3RGLA

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc in complex with atp and glycine
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP and glycine.
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
molecule keywords Glycyl-tRNA synthetase alpha subunit
total genus 101
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3rglA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rglA01
4YP0A 4YCUA 3P8VA 3LSQA 3NENA 3V7CA 4RQFA 1WU7A 3MF1A 2ZNJA 3NELA 3NETA 5K1XA 4YDQA 3M4PA 3QO5A 1E1OA 4YRQA 1NJ6A 4P3NA 1HXDA 5HGQA 1Z7MA 4YRNA 2ZIMA 2J3MA 5ELNA 5K1PA 4TTVA 1HC7A 1GGMA 1EIYA 3HXWA 4CS2A 1VQZA 1E1TA 1X2HA 4EX5A 2ZT6A 4HWTA 3EFSA 4P75C 4TVAB 3QTCA 1X56A 1USYA 1EQRA 1H4TA 2QHUA 4H2WA 2PMEA 2XTIA 3G1ZA 4J15A 4XTZA 3TEHB 2DZ9A 2ZT8A 3ICAA 1B8AA 2XGTA 4P75A 2DVEA 3IG2A 1BIAA 3HRKA 4OP0A 1ASZA 3EFRA 4NCXA 4AH6A 1EOVA 4TVWA 1BBUA 1KMMA 4YRPA 3HXVA 4DPGA 4XU2A 3IALA 3A32A 1QE0A 1WLEA 1WPYA 2I4OA 2FYKA 2G4CA 4P72A 2EAYA 2E3CA 3HTZA 3VQWA 4YRLA 4E51A 1QF6A 2I4LA 4WJ4A 1X2GA 2E65A 3LSSA 1WQ7A 4RQEA 2Q5HA 4KQEA 3IKMB 2C7IA 2CJBA 1JJCB 3PZCA 3MEYA 3RIRA 2ALYA 4WJ3M 2ZNIA 3L4GB 4XEMA 4EO4A 2ODRD 2RHSB 2ZGWA 3A7UA 4DQ2A 3HFVA 2EJ9A 4HWSA 2DDZA 12ASA 1SETA 4OLFA 4YRJA 1NJ8A 3UFGA 1ATIA 1G5IA 1BBWA 3RKYA 3RGLA 2Q7GA 4YRGA 4XEOA 1WNLA 3KFUA 2DU7A 2EL9A 4LNSA 1LYLA 2ARUA 1PYSA 4HA8A 4WI1A 3VBBA 4YRRA 2DQ0A 4YRFA 4P73C 2ZCEA 2QHTA 2ARTA 3IKLA 4XTYA 3A7RA 3RKWA 3OD1A 4K87A 4TQDA 1C0AA 3UGTA 1NJ2A 1ADYA 4P71A 1Z7NA 4YRSA 3W3SA 1BIBA 4TVYA 3M4QA 2Q7HA 3V8KA 2C8MA 2EWNA 3HRIA 2ALYB 2DJZA 3L2ZA 3NEMA 4UPAA 1NJ1A 4CH6A 5KNNA 2ODRC 4L87A 3RF1A 4P3OA 1WYDA 5C53B 3A5ZA 3L4GA 3VQVA 1HTTA 2ZXFA 4XU3A 4YRMA 4ZTZB 4H2UA 4H2VA 3L1AA 2IY5B 3WQZA 1KOGA 2CGHA 1RIQA 3ERRA 2I4MA 3HXZA 1YGBA 4P74C 4P74A 3V8LA 1NYRA 3HXUA 4XTUA 2E10A 4H2YA 3RKXA 1B7YA 2ZR3A 3TEHA 4CS4A 1EFWA 4H2SA 4YRCA 2RHSA 2P0LA 2CJAA 2RHQB 2DTHA 2DEQA 3REXA 1SRYA 3A5YA 2DTIA 4YYEA 11ASA 4RMFA 1JJCA 4UP8A 2DU5A 4UP9A 1H4QA 2AKWB 2ZZEA 4HWOA 2ZZGA 1NJ5A 3VQXA 4ZTUB 4YCWA 4YREA 1IL2A 1ADJA 4P71C 3LC0A 4XTWA 4RDXA 4UP7A 2E41A 3E9IA 4TQFA 4YPFA 3VQYA 1W66A 2ZZFA 4YRKA 2EJFA 2J3LA 4HVCA 4K88A 3A74A 4PHCA 4XTVA 1X54A 3FJPA 3P8TA 2CJ9A 3UH0A 2P5IA 1SESA 1B70B 1KMNA 3HFZB 2EJGA 4P72C 4BWAA 2HNIA 2ZT7A 4XU0A 4WF2A 3PCOB 3HY1A 1YB3A 5C51B 2E64A 4ZIBA 4P3PA 3V8JA 3R07A 4YRIA 4K86A 3HXXA 1EIYB 1EVLA 1G5HA 3REUA 1B7YB 2DZCA 2AKWA 3HXYA 1H4SA 1YFSA 3DSQA 1L0WA 2DTOA 2PMFA 4G84A 3A7AA 2QHVA 4Q6GA 4XTXA 2Q5IA 2DKGA 2QHSA 4YROA 5C52B 2RHQA 4Q15A 1G51A 4KR3A 4PG3A 4CS3A 3QO8A 4CH3A 2ZIOA 3RACA 1USYC 1YFTA 1WQWA 4YCVA 3HY0A 3I7FA 1H4VB 2I4NA 1SERA 3RUXA 3RL6A 3E9HA 2ZR2A 4TVAA 3MF2A 2ARSA 1PYSB 4X5OA 1E22A 2IY5A 3PCOA 3P8YA 2DXTA 3BJUA 4HWRA 1J5WA 4P73A 1ASYA 2CIMA 1B70A 3TUPA 1NYQA 4O2DA 4HWPA 2E5AA 4YRTA 1X55A 4CH4A 4BW9A 3TEGA 2DXUA 3CMQA 2ZINA 2AMCA 4CH5A 1X01A 3V7SA 2ZT5A 5E3IA 2Q7EA 2E1HA 4XU1A 4KR2A 1E24A 4H2XB 1EVKA 3V7RA 1FYFA 3A31A 3BFMA 4H02A 3QNEA 4G85A 1N9WA 3QO7A 5ELOA 4H2TA 1YFRA 1B76A 4H2XA 3UGQA 2ZTGA 2DQ3A 3HFZA 2AMCB 5F5WA 4TWAA 1NNHA
chains in the Genus database with same CATH superfamily
4YCUA 3UQ7A 3NZPA 4HFEA 4IL4A 3JCFA 5AQKB 2BVLA 3AE6A 5FXWA 5LP6E 1HTJF 2A9UA 1KF6A 2M6BA 4I43B 3I9YA 3TLSA 4KUMB 2ZNJA 1UGOA 4YDQA 1HNXT 3QO5A 4YRQA 4X1IE 2BKOA 2W61A 2J3MA 3M65A 5F8PA 4QHOA 2BG9B 2NR4A 5C8YE 5J2TE 4U2ZA 3AXJA 4EGWA 4PK6A 4I55E 2I0MA 4IDZA 4QH5A 4MALA 3VU7H 3ZT5A 4U33A 2WU2A 4JI5T 3RPUA 2BG9C 3CQCB 3AAAB 3AB3B 3QTCA 3O4XE 5FXZA 2X9XA 1X56A 5LHHB 1USYA 4IDQA 5FMNA 4H2WA 2CHNA 4JI4T 3G1ZA 4JEHB 3GA8A 3UFEA 4XTZA 4YSYA 3ICAA 4LMKA 1B8AA 2LSGA 2LSYA 4U7YA 1S94A 3KDSE 2LM2A 4LF5T 1ASZA 1XMOT 3IA3A 5L2LA 3PE0A 3RYIE 5AQMB 3V5SA 3I1AA 1BBUA 1KMMA 4YRPA 2H7OA 3O1JA 3BQLA 4TUYE 4ZI7E 2JPFA 4UR9A 5AQSB 3A32A 2AXDS 4B6XA 1IBKT 2NP9A 3IBPA 2EAYA 2E9XA 2E3CA 3ZPOA 1J1JA 1E7PA 2K24A 4YRLA 4WJ4A 3FZKB 5JR9C 3ZT7A 4KQEA 2WS3A 3AAEB 2CJBA 5KX5E 4B3MT 5HEHA 4H9PC 5JTGA 4A98A 4TX5A 4OX9T 2UXCT 2FJEA 3FBZA 2OA5A 1UCUA 2RHSB 4O2AE 2KSRA 1KEYA 2QGSA 3A7UA 4YJ2E 2H88A 3C64A 3ZC0A 3HFVA 4HWSA 2DDZA 2EHOA 3HI2A 5L47A 2XPKA 1X79A 1U5PA 1ATIA 3N9NA 3F2EA 2PG8A 2BS4A 4YRGA 3L09A 2XQ4A 3ZYLA 5FXXA 2EL9A 1LYLA 4LVJA 3K3NA 2ARUA 1PYSA 2W62A 4HA8A 4H9SE 4DO0A 1HFAA 2X67A 4JI1T 4ILCA 3E22E 4NUUA 4P73C 4AKLA 2ARTA 3IKLA 3RQUA 3OD1A 1C0AA 1NJ2A 4XAXB 1ADYA 3A7MA 4P71A 4ADZA 4YRSA 4GOUA 4M1PA 4CZZB 2NW9A 2V7KA 3W3SA 4ZHQE 4OHFA 4TVYA 1O3XA 2XQ6A 3HRIA 1OXZA 4ZS2A 4N78D 3L2ZA 5FKYA 4AQFA 4UPAA 4DV1T 5JH7E 1NJ1A 3LBXB 3LFMA 5H6RB 4JUYA 4TNWA 4GK0E 4CN6A 5LGTB 2N1GA 2YINA 3A5ZA 3QOFA 4YJ3E 3CX8B 3PURA 4XU3A 4YRMA 3FXDB 3L1AA 3WI3A 2I59A 2LEHA 3NBXX 3PUVF 1KOGA 3OJAA 2MBGA 1NEKA 4MHCA 4L9IA 2ZM6T 5HCMA 1YGBA 2L3LA 2CRBA 2IHR1 2E9XD 4YTNA 3V8LA 2J1DG 3HXUA 2XZEA 2FUPA 3R6NA 5TAOA 5JDFA 4PFPA 2IMLA 2Y8DA 3RKXA 1B7YA 1LVFA 4CS4A 5ABEA 1EFWA 4H2SA 5AQOB 2WAUA 2RHSA 3OKQA 2X66A 2RHQB 3PV0F 2CHOA 1BR0A 3A5YA 3P4SA 2DTIA 11ASA 4LVLA 1QLBA 5HXEA 1D1CA 4UP9A 2JQQA 4O4IE 5JRCA 3ZMUB 4KI0F 4UF0A 2V5CA 4HWOA 2CBIA 2QA7A 4CXYA 3PUZF 1NJ5A 1VCSA 4YREA 1IL2A 4OYKA 2VVSA 2XQYA 1CUNA 4RDXA 1CHUA 5FP3A 1NWMX 3RH3A 4YPFA 3VQYA 1MIYA 2X51A 2EJFA 2WDRA 2YDRA 4HEAA 3SS1A 4HVCA 3A74A 5HXCA 2DI4A 1N36T 4JLEA 4OYJA 2XSBA 1EZ3A 4IE5A 1BR4A 2NS6A 3HKBE 2CLYC 4AKIA 3QB5A 4ISTA 3OTOT 5LB7B 2EJGA 2IC9A 1M62A 2FJAA 3HKEE 3X1DA 4H9RC 2Y6XA 4IL9A 5LG3A 5JVDE 2LHNA 4HFVA 4EXTA 2LM9A 2YDQA 4TV9E 1DU2A 1XNQT 3REUA 2DZCA 3QB5K 1H4SA 1YFSA 3ZJ1A 2DTOA 5AQJB 2PMFA 5FY1A 4MBQA 4G84A 2Q5IA 2ES0A 2WZIA 2UUCT 5C52B 4Q15A 3QO8A 4CH3A 1US7B 1S35A 1N34T 1USYC 3I7FA 1H4VB 2I4NA 1SERA 2ZR2A 2XM2A 3AEBA 3U3IA 2IC6A 1D0XA 2CE7A 3MK7C 1PYSB 1E22A 3ONLC 4P1NA 2DXTA 3KVAA 4AI6A 3AVRA 2QRXA 1SUMB 2ODVA 2D0TA 2Y48B 4AISA 2XQ8A 4CH4A 3QK6A 4JYAT 2Q9QB 5FXVA 5CA0E 1KNZA 2DXUA 2ZM0A 4CH5A 1X01A 4IE6A 3RYFE 3AA1B 4EIWA 2Q7EA 4XU1A 4CXWA 4LVIA 3LBXA 2YEVC 1ZV4X 1FJGT 3RC3A 2JMKA 4F6RC 3PUYF 3ZMTB 4DR1T 3RYCE 3P4QA 3OVUA 1IZNB 3NWIA 2CWOA 1B76A 4H2XA 3UGQA 2K9AA 4UIGA 3WAJA 3AEDA 4QH4A 4WW0A 3TLTA 1MNEA 1NNHA 2YU1A 3P8VA 1IAPA 3V7CA 4RQFA 3AE7A 5ETWA 3MF1A 4DBQA 3NETA 5DABA 2VKJA 3B57A 4YTPA 1NJ6A 4P3NA 1HXDA 2VWAA 4YRNA 2KMFA 2P9BA 5ELNA 4YHJA 1WCRA 2X0LB 3QNUA 3J7Yq 2WB5A 1GGMA 1EIYA 3IHRA 3VR8A 3HXWA 4CS2A 1E1TA 3OYXA 2CWYA 2ZT6A 4HWTA 1GQEA 4KHPT 4BAYB 5IWAT 3K3OA 4DR5T 2EHOD 1EQRA 2MOZA 4FI5A 2IW5B 4J15A 3AECA 2ZT8A 3AVSA 2XAFB 3FB2A 3P50A 2DVEA 3IG2A 1HG2A 1BIAA 4LFAT 1UUSA 3ETUA 2XSAA 4CQIA 3ETVA 2C5KT 4AH6A 4DV6T 3FBLA 4X66T 5KMGP 4H9QC 1WLEA 4ANJA 1WPYA 2CXLA 4DMVA 3HTZA 4QXHB 4E51A 5ABHA 2PTFA 3Q9DA 5JDNA 2WZHA 2Q5HA 1KNRA 2J47A 5CJ5A 5AQFB 2XQ5A 5ABGA 5AQUB 3RIRA 2ALYA 4WJ3M 4QXBB 3L4GB 4XEMA 1UX5A 2A3DA 4TN7B 4U72A 2XAJB 4DQ2A 3N9QA 1HG5A 2LE8A 3MXZA 3EAMA 1SETA 2JMHA 2LKHA 3HR0A 4EZHA 3K8PC 3QC9A 1ZKEA 2XUEA 3RKYA 5J0ZA 3NRYA 4YFSA 2FJDA 4H9OC 4A56A 1MMDA 4XEOA 4CXXA 4EOZB 3ANWB 1H7CA 4HFHA 1OEDE 2UXBT 4WI1A 3N9OA 5LBQB 3VBBA 2DQ0A 4DMWA 1NENA 2ZCEA 2QHTA 3UUMA 4ERRA 1Z0PA 4YT0A 5CFBA 2F4VT 3DTOA 3N5LA 3ZSSA 5BR8T 5HYAA 4U74A 5JREA 4ASKA 2CM0A 2WM9A 4QH1A 1D1AA 4HWIB 2N2NA 3IF8B 2LOSA 4Z90A 4HWDA 3PJAA 3NZQA 4C90A 1ZOYA 2C8MA 2RPAA 3SOLA 3NEMA 2FBWA 1MNDA 4DUYT 3JAEA 4YSZA 3RKOA 3RF1A 5AQLB 5L4EA 4LFCT 3L4GA 4LF7T 1XDOA 1IBLT 3BK9A 4H2UA 4HWCA 1WYBA 3AE9A 3NRXA 2Z6EA 2W63A 5EZYE 3AEFA 2CLYB 3O1HA 4P74C 3JAFA 3KBTA 5HCJA 2CBJA 2D0UA 3SFEA 5HXHA 2H7VC 4DV3T 3A5XA 2N9DA 3JADA 2D2SA 3KBUA 3TEHA 4YRCA 3PTRB 2P0LA 2CJAA 1SHZC 2J62A 2YOEA 3AE5A 2DTHA 4AIUA 3REXA 1SRYA 3F57A 4RMFA 4UP8A 2DU5A 2KLQA 1H4QA 4WBNE 3CKDA 4HT4A 2AE9A 2YN6A 5IUXA 5JDQA 5HEJA 3VQXA 4ZI2D 2ACXA 1D0YA 4ZTUB 1ADJA 3AA6B 2LOPA 4IE7A 4UP7A 2DWGA 3ZN1B 3ZLIA 4TQFA 2ACZA 3ZJ2A 3UUBA 3EDVA 4JI6T 4ZI3D 3GMIA 4JBWF 3U78A 2XTLA 2J3LA 4QKNA 1MMAA 3N9PA 3OBVE 2IAKA 4XTVA 5ABFA 3FJPA 4U3CA 3MACA 4Z91A 5EK2A 2CJ9A 3JC6C 2BS2A 2VVNA 2VURA 1KNPA 1SESA 2BG9E 2WQYA 4KP3C 4ZS3A 4NPPA 4F8HA 4BWAA 2KINB 1YQ4A 5LBMA 2ZT7A 5FL1A 4WF2A 2LRKA 3HL6A 3HY1A 2Q9QD 1YB3A 1D0ZA 2FJBA 5LJNA 3AAIA 2XM1A 2H89A 4ZIBA 4COFA 3V8JA 5FVKA 3F31A 4A5XA 3R07A 3RX6A 3VHLA 1YW0A 4KMCA 3HXXA 3LK3B 3GN5A 1G5HA 1B7YB 4OFZA 2ZM2A 3E08A 4JI0T 2JRKA 2QHVA 3EDUA 4XTXA 2NTXA 3VR9A 2DKGA 4YROA 2SPCA 4DR2T 2RHQA 3UUNA 3PUWF 3CIRA 1UK5A 3C4XA 4YTMA 4LF9T 3FZFB 1YXRA 2BVMA 3E0ZA 5FL0A 4DNDA 2XQ9A 5H6QB 2ARSA 4X5OA 2KWIB 3PCOA 3L8RA 3ABVA 2UXXB 3BJUA 5JQGE 2YU2A 3QUJA 1ASYA 3TKLB 2E8IA 2E5VA 3TUPA 4O2DA 4HWPA 2CCQA 4WNKA 4YRTA 4WYVA 3UU4A 5LXTE 3TEGA 1KFYA 5AQIB 2V6XA 2IDOB 4ILUA 3CMQA 3PUXF 2LHRA 2BZBA 4DV0T 3AA0B 2ODUA 2E1HA 2WP9A 5L3CB 4QXCB 3ONXA 2MPKA 3BFMA 3PUQA 3AE3A 4H2TA 1YFRA 2VL8A 2ZTGA 3PU3A 4HE8A 3S4UA 4YP0A 3A8YC 4P0AA 3ZSTA 3NENA 1JNZA 1L0VA 4CI1B 3G06A 1HNWT 3H3AA 2E5LT 3NELA 4PJMA 1Y01A 4UXNB 2LKGA 3UU5A 2DNXA 4ZOLE 2NWBA 5JDLA 5HGQA 2ZIMA 4CI2B 2IUBA 2WMNA 5LYJE 4HFBA 4TTVA 4GK5E 4IREA 4JI3T 4NXMT 4DR4T 3LK42 3TLUA 1VOMA 1IJ5A 2MAWA 4P75C 2NW8A 1N32T 2XAGB 1H4TA 2QHUA 4BJNA 4LFBT 2K48A 2WMOA 3VRBA 4UF0B 2KWHA 2H3RA 3BQIA 3TEHB 3I0OA 2VQET 4P75A 1FIOA 2WY2A 4UELA 1SA0E 4OP0A 4O2BE 3KV6A 1EOVA 4TVWA 2JJ9A 4DPGA 4XU2A 3IALA 5AQNB 4IDNA 1MMGA 2C5JA 1E2AA 3ZYMA 2UU9T 2E9XB 2I4OA 3AE2A 2DHRA 2G4CA 4U2YA 5JDMA 4UVAB 4IE4A 5ABFB 2I4LA 1X2GA 2E65A 2CA5A 3CWZB 3LSSA 5JDGA 1WQ7A 1LKXA 2CXDA 3AEGA 3KV5A 4TZ4C 1KK7A 1JJCB 3PZCA 3D0TA 1BR1A 1MIVA 1LVKA 4B3RT 4XZCA 5JRCB 3PUGA 3AXJB 2X0HA 3H37A 2EJ9A 4ZXLA 4LF8T 12ASA 4OLFA 4HGAA 5HWYA 3KINB 3UFGA 1G5IA 1BBWA 4PK4A 4V1Av 1HX1B 3RGLA 4B3TT 3RLFF 4IDOA 5FY7A 5M4YA 3KFUA 2DU7A 4LNSA 4G63A 4DUZT 5AQGB 2BKNA 4X65T 2BBHA 2IIUA 2XAQB 3I9WA 2LSIA 4DBRA 5LNKA 2ZM8A 2I6HA 4BJMA 3FZHB 5JR9B 3A7RA 4XTYA 5EK3A 3UU6A 1J5ET 2VKDA 3MZKB 5LHIB 2E2AA 4K87A 3UGTA 5FY0A 4E7SA 1Z7NA 3OYZA 2KZ7B 2VQFT 4IGUA 5L3EB 3Q5WA 1HX8A 3M4QA 3FHNA 2Q7HA 3RIUA 2WSSV 3ZKRA 4P09A 5DQWA 2ALYB 2DJZA 3LJCA 2LLYA 5F3JA 4LVMA 1YKHB 2W2UA 2EHOB 4O8SA 2ODRC 4TNVA 4PAGA 3J9X1 2HPJA 3LDQB 4P3OA 1FEWA 3HKCE 1WYDA 5C53B 3ZCIA 1LRZA 3VQVA 5L3FB 2ZXFA 2VK9A 4DR7T 3C51A 4H2VA 1W0BA 2IY5B 2K3WA 3WQZA 4L0RA 2NOXA 1RIQA 4KBMB 2XQ3A 3M3ZB 3P4PA 3HXZA 4I50E 4PW8A 1XMQT 2X68A 2W0GA 2UUBT 2HN2A 1ZP0A 4G2AA 5LOVE 4K0KT 3Q2MA 4DR3T 4QX7B 4IDPA 3T1YT 3ONJA 2PFVA 1YQ3A 2E10A 4LMLA 2DL1A 5HEOA 2V6YB 4H2YA 2NW7A 1I6ZA 2E9XC 2LJLA 1WR0A 4O4HE 2UXDT 4CI3B 3N9LA 4HFDA 3PDYA 1D1BA 1OWAA 4UV9B 2HPLA 1JJCA 4AQFC 2X9HA 3CVRA 2A8EA 3CX7B 4EV6A 2AKWB 1Z8UA 2V5DA 4ZEYA 4YHHT 4MLKA 3AE4A 3P4RA 4P71C 4XTWA 3SWHA 2E41A 2ZZFA 4HFCA 3EUHA 2VKHA 4AKRB 3VRAA 4LF4T 4K88A 2V6YA 1XDPA 3EVYA 3H3MA 1X54A 4X1KE 1OEDA 5CA1E 5LCYA 3P8TA 4ZZCA 2X9WA 4NUVA 3TLWA 1XZYA 4TV8E 2WU5A 2P5IA 2JQ9A 2XY8B 1B70B 4HTEA 2J4GA 1KMNA 2WDVA 4P72C 5HWXA 2HNIA 4EEBA 4L5GA 4AXPA 4XU0A 5LGNB 4TWHA 5AQPB 2V7JA 4TWFA 1X9BA 5C51B 3RRCA 1MIWA 3LSVA 2V7LA 2JIWA 3MKDA 4P3PA 4YRIA 3SFDA 4CN1A 1WLXA 4K86A 3CQGB 1HNZT 3CPZA 5AQRB 2M6IA 3LK2B 3HXYA 5DJQC 3RHWA 3RRWA 2KNDA 2VB6A 4X5TA 5BMVE 3DSQA 3KV9A 4BA9A 4HN9A 2RA1A 2WDQA 3A7AA 4Q6GA 4PK5A 3LG7A 2QHSA 4ILAA 4KR3A 4CS3A 1NAFA 4DV2T 5JR9A 4YCVA 1R8IA 4H9NC 3RUXA 1W09A 3E9HA 2UXNB 3RKGA 2BG9A 2WCAA 5DQVA 3MF2A 5LMUT 3RYHE 5AQHB 2LSKA 2KT9A 3P8YA 2CMRA 1WRDA 4HWRA 4ISSA 2YKSA 2XQAA 2CIMA 1B70A 4I0UA 5J2UE 3ZMSB 4KHZF 1X55A 3PUAA 2DWKA 1XWMA 2K5BB 1JNRA 1WR6A 3ZN0B 4YSXA 3KV4A 4EAHA 2ZINA 2ZT5A 3CQXC 4IT4A 4OK0A 2BKPA 4H2XB 3RIUC 3K3QC 1EVKA 3V7RA 3SRZA 4LF6T 3DJBA 3QO7A 3AE1A 3N9MA 2DQ3A 2WWUA 4QX8B 2AMCB 4AKGA 5F5WA 5IHYA 3AE8A 3NVOA 2XHEB 1WFDA 3W15B 3LSQA 3WAKA 3RI5A 5KDMC 3KVBA 1T72A 4PJJA 1WU7A 5AQVB 5K1XA 3M4PA 2LSJA 1E1OA 4X64T 1AJ3A 1MMNA 2ZLYA 4YY3T 3CK6A 4O4LE 2LT3A 4JI2T 1Z7MA 5ADXL 5K1PA 3L3PA 2MYSA 2L9QA 4JI7T 3PU8A 1HC7A 2EHOC 1VCTA 3DP7A 3GN5B 3PUSA 1WYCA 1VQZA 1X2HA 4EX5A 3EFSA 3T8OA 2WBLA 5AQTB 2B76A 1N33T 4TVAB 1UURA 2VKOA 3Q5DA 5JDHA 4EEDA 5FVLA 2PMEA 2XTIA 2BS3A 2W4XA 5LJMA 2DZ9A 3ZMZB 2XGTA 3UU8A 3HRKA 2GK9A 3KFWX 2Q9QA 2L8KA 3ESLA 3EFRA 2X9YA 4GIWA 4NCXA 2XQ7A 5CGMA 5J1GA 3HXVA 3EHZA 3AEEA 1B7TA 3UT5E 1QE0A 3PJAJ 2FYKA 4P72A 3VQWA 3GWHA 3ZCJA 4ZZBA 1QF6A 4EYUA 4JI8T 5KXJA 2V1DB 4HWFA 3MJXA 4RQEA 2MTQA 4GYSA 1FMWA 2UUAT 4JEUB 3IKMB 3P7IA 2C7IA 2JQKA 2XJ7A 2QYWA 2W66A 3MEYA 3UUXB 1XNRT 3B5MA 4EZ4A 2WWVA 2ZNIA 4EO4A 1T7SA 2ODRD 4KX6A 2VL0A 3FZMB 2ZGWA 2OLTA 1QSDA 3K1SA 3N2OA 4ILBA 4YRJA 1NJ8A 1YD8G 5L3BB 1SE7A 1OEDC 1HCIA 2Q7GA 4EB6E 4AKHA 2D9DA 4IIJE 2W00A 2YDSA 1WNLA 2CPTA 3UU3A 3I0QA 4JV5T 2KXPB 3MA9A 4GYRA 2V8SV 3FZLB 5GONE 2V7MA 3CMLA 4YRRA 4YRFA 3CX6B 5AFUL 4DR6T 4Q25A 3NKZA 3RKWA 1U4QA 3VKGA 1YKEB 4TQDA 2NTYA 4AQGA 4DV4T 4PJNA 3P8CD 3Q5XA 5HXRA 3BQKA 4H63V 3C98B 4P0BA 1BIBA 5FYMA 3V8KA 2EWNA 4EYYR 2BDEA 3EABA 3TLVA 4DV5T 1UX4A 4CH6A 5KNNA 2B1EA 2XAHB 4C91A 1VRBA 4E7ZA 4LMJA 4L87A 2DLRA 5HXSA 5HAXA 3RIAA 4B3ST 5HEUA 1HTTA 4ZTZB 3V5UA 4U31A 1T8BA 1W9RA 3ANWA 2CGHA 3ERRA 5L4HA 2ZMAA 1HF8A 3OPCA 4IHJE 4J2CA 2I4MA 4UV8B 2LRLA 3UQ4A 4I4TE 2A2FX 1QUUA 5C2TA 1FMVA 3IEEA 5EK4A 4P74A 4PFOA 3N2KE 5LA6E 2HH7A 2DCFA 2BBJA 1NYRA 3VKHA 4XTUA 2G0UA 2VASA 1G73A 2YK0A 4A97A 1M7KA 4GKJT 2ZR3A 4X1YE 3RC8A 3HA4A 4O4JE 3UTKA 3UULA 2OV9A 1E1HB 4HKAA 2DEQA 1ZHCA 4PNIA 4XBFB 4YYEA 3P4WA 4UEMA 2V7IA 3AA7B 1IJ6A 2QVAA 3ZEFB 3RIFA 4H63H 4PJLA 2ZZEA 4HFIA 2ZZGA 5A1LA 4ZI3C 4YCWA 4YXDA 2R6GF 2HHHT 5E0OA 3LC0A 3E9IA 2JQHA 4WZXA 1W66A 1Y64B 3ZMVB 4YRKA 1OEDB 4ZI2C 4NXNT 3ZC1A 2CXFA 4PHCA 3ZT6A 5LGUB 2A72A 4UVCB 4MFRA 5LHGB 2D5UA 3T1HT 4IE0A 3UH0A 4DIDB 3O1IA 3HFZB 4WBOA 3RQWA 3PCOB 3JC6D 5C3JA 2E64A 2V26A 4Z8XA 3R84B 2CEAA 1EIYB 1BR2A 1G8XA 1EVLA 4YLHA 3HKDE 2Q9QC 2PBIA 2AKWA 1T98A 1L0WA 1V9DA 1G51A 4PG3A 2ZIOA 2X0YA 3N2GE 1YFTA 3RACA 1WQWA 3HY0A 3MQZA 2C5IT 3RL6A 3C50A 4TVAA 1ZEEA 2C0SA 3C4WA 2IY5A 3C4ZA 4FJOA 5CB4E 1J5WA 4P73A 4GKKT 1NYQA 2XASB 2E5AA 5HEGA 4X20E 3ZYKA 1W0AA 4CN4A 5AQQB 3FXEB 2HN1A 4BW9A 4K0UA 5LMNT 5L3DB 2AMCA 3V7SA 2W67A 5E3IA 1HR0T 2RP4A 4AQYT 4KR2A 1I94T 1E24A 2M67A 5LG4A 4LVKA 4U7IA 4QWNB 1HS7A 1FYFA 4UVBB 5L3GB 3B13A 3A31A 4H02A 3L39A 3QNEA 4G85A 1N9WA 5ELOA 5FNVE 4HWHA 4DV7T 3Q5EA 3AEAA 3EI0A 1IBMT 3HFZA 2PJQA 5IYZE 4TWDA 4NIQA 4DVDA 4TWAA 3O9XA 4X62T
chains in the Genus database with same CATH topology
4YP0A 4YCUA 3P8VA 3LSQA 3NENA 3V7CA 4RQFA 1WU7A 3MF1A 2ZNJA 3NELA 3NETA 5K1XA 4YDQA 3M4PA 3QO5A 1E1OA 4YRQA 1NJ6A 4P3NA 1HXDA 5HGQA 1Z7MA 4YRNA 2ZIMA 2J3MA 5ELNA 5K1PA 4TTVA 1HC7A 1GGMA 1EIYA 3HXWA 4CS2A 1VQZA 1E1TA 1X2HA 4EX5A 2ZT6A 4HWTA 3EFSA 4P75C 4TVAB 3QTCA 1X56A 1USYA 1EQRA 1H4TA 2QHUA 4H2WA 2PMEA 2XTIA 3G1ZA 4J15A 4XTZA 3TEHB 2DZ9A 2ZT8A 3ICAA 1B8AA 2XGTA 4P75A 2DVEA 3IG2A 1BIAA 3HRKA 4OP0A 1ASZA 3EFRA 4NCXA 4AH6A 1EOVA 4TVWA 1BBUA 1KMMA 4YRPA 3HXVA 4DPGA 4XU2A 3IALA 3A32A 1QE0A 1WLEA 1WPYA 2I4OA 2FYKA 2G4CA 4P72A 2EAYA 2E3CA 3HTZA 3VQWA 4YRLA 4E51A 1QF6A 2I4LA 4WJ4A 1X2GA 2E65A 3LSSA 1WQ7A 4RQEA 2Q5HA 4KQEA 3IKMB 2C7IA 2CJBA 1JJCB 3PZCA 3MEYA 3RIRA 2ALYA 4WJ3M 2ZNIA 3L4GB 4XEMA 4EO4A 2ODRD 2RHSB 2ZGWA 3A7UA 4DQ2A 3HFVA 2EJ9A 4HWSA 2DDZA 12ASA 1SETA 4OLFA 4YRJA 1NJ8A 3UFGA 1ATIA 1G5IA 1BBWA 3RKYA 3RGLA 2Q7GA 4YRGA 4XEOA 1WNLA 3KFUA 2DU7A 2EL9A 4LNSA 1LYLA 4LVJA 2ARUA 1PYSA 4HA8A 4WI1A 3VBBA 4YRRA 2DQ0A 4YRFA 4P73C 2ZCEA 2QHTA 2ARTA 3IKLA 4XTYA 3A7RA 3RKWA 3OD1A 4K87A 4TQDA 1C0AA 3UGTA 1NJ2A 1ADYA 4P71A 1Z7NA 4YRSA 3W3SA 1BIBA 4TVYA 3M4QA 2Q7HA 3V8KA 2C8MA 2EWNA 3HRIA 2ALYB 2DJZA 3L2ZA 4LVMA 3NEMA 4UPAA 1NJ1A 4CH6A 5KNNA 2ODRC 4L87A 3RF1A 4P3OA 1WYDA 5C53B 3A5ZA 3L4GA 3VQVA 1HTTA 2ZXFA 4XU3A 4YRMA 4ZTZB 4H2UA 4H2VA 3L1AA 2IY5B 3WQZA 1KOGA 2CGHA 1RIQA 3ERRA 2I4MA 3HXZA 1YGBA 4P74C 4P74A 3V8LA 1NYRA 3HXUA 4XTUA 2E10A 4H2YA 3RKXA 1B7YA 2ZR3A 3TEHA 4CS4A 1EFWA 4H2SA 4YRCA 2RHSA 2P0LA 2CJAA 2RHQB 2DTHA 2DEQA 3REXA 1SRYA 3A5YA 2DTIA 4YYEA 11ASA 4LVLA 4RMFA 1JJCA 4UP8A 2DU5A 2A8EA 4UP9A 1H4QA 2AKWB 2ZZEA 4HWOA 4HT4A 2ZZGA 1NJ5A 3VQXA 4ZTUB 4YCWA 4YREA 1IL2A 1ADJA 4P71C 3LC0A 4XTWA 4RDXA 4UP7A 2E41A 3E9IA 4TQFA 4YPFA 3VQYA 1W66A 2ZZFA 4YRKA 2EJFA 2J3LA 4HVCA 4K88A 3A74A 4PHCA 4XTVA 1X54A 3FJPA 3P8TA 2CJ9A 2NS6A 3UH0A 2P5IA 1SESA 1B70B 1KMNA 3HFZB 2EJGA 4P72C 4BWAA 2HNIA 2ZT7A 4XU0A 4WF2A 3PCOB 3HY1A 1YB3A 5C51B 2E64A 4ZIBA 4P3PA 3V8JA 3R07A 4YRIA 4K86A 3HXXA 1EIYB 1EVLA 1G5HA 3REUA 1B7YB 2DZCA 2AKWA 3HXYA 1H4SA 1YFSA 3DSQA 1L0WA 2DTOA 2PMFA 4G84A 3A7AA 2QHVA 4Q6GA 4XTXA 2Q5IA 2DKGA 2QHSA 4YROA 5C52B 2RHQA 4Q15A 1G51A 4KR3A 4PG3A 4CS3A 3QO8A 4CH3A 2ZIOA 3RACA 1USYC 1YFTA 1WQWA 4YCVA 3HY0A 3MQZA 3I7FA 1H4VB 2I4NA 1SERA 3RUXA 3RL6A 3E9HA 2ZR2A 4TVAA 3MF2A 2ARSA 1PYSB 4X5OA 1E22A 2IY5A 3PCOA 3P8YA 2DXTA 3BJUA 4HWRA 1J5WA 4P73A 1ASYA 2CIMA 1B70A 3TUPA 1NYQA 4O2DA 4HWPA 2E5AA 4YRTA 1X55A 4CH4A 4BW9A 3TEGA 2DXUA 3CMQA 2ZINA 2AMCA 4CH5A 1X01A 3V7SA 2ZT5A 5E3IA 2Q7EA 2E1HA 4XU1A 4LVIA 4KR2A 1E24A 4H2XB 4LVKA 1EVKA 3V7RA 1FYFA 3A31A 3BFMA 4H02A 3QNEA 4G85A 1N9WA 3QO7A 5ELOA 4H2TA 1YFRA 1B76A 4H2XA 3UGQA 2ZTGA 2DQ3A 3HFZA 2AMCB 5F5WA 4TWAA 1NNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YP0 A;  4YCU A;  3P8V A;  3LSQ A;  3NEN A;  3V7C A;  4RQF A;  1WU7 A;  3MF1 A;  2ZNJ A;  3NEL A;  3NET A;  5K1X A;  4YDQ A;  3M4P A;  3QO5 A;  1E1O A;  4YRQ A;  1NJ6 A;  4P3N A;  1HXD A;  5HGQ A;  1Z7M A;  4YRN A;  2ZIM A;  2J3M A;  5ELN A;  5K1P A;  4TTV A;  1HC7 A;  1GGM A;  1EIY A;  3HXW A;  4CS2 A;  1VQZ A;  1E1T A;  1X2H A;  4EX5 A;  2ZT6 A;  4HWT A;  3EFS A;  4P75 C;  4TVA B;  3QTC A;  1X56 A;  1USY A;  1EQR A;  1H4T A;  2QHU A;  4H2W A;  2PME A;  2XTI A;  3G1Z A;  4J15 A;  4XTZ A;  3TEH B;  2DZ9 A;  2ZT8 A;  3ICA A;  1B8A A;  2XGT A;  4P75 A;  2DVE A;  3IG2 A;  1BIA A;  3HRK A;  4OP0 A;  1ASZ A;  3EFR A;  4NCX A;  4AH6 A;  1EOV A;  4TVW A;  1BBU A;  1KMM A;  4YRP A;  3HXV A;  4DPG A;  4XU2 A;  3IAL A;  3A32 A;  1QE0 A;  1WLE A;  1WPY A;  2I4O A;  2FYK A;  2G4C A;  4P72 A;  2EAY A;  2E3C A;  3HTZ A;  3VQW A;  4YRL A;  4E51 A;  1QF6 A;  2I4L A;  4WJ4 A;  1X2G A;  2E65 A;  3LSS A;  1WQ7 A;  4RQE A;  2Q5H A;  4KQE A;  3IKM B;  2C7I A;  2CJB A;  1JJC B;  3PZC A;  3MEY A;  3RIR A;  2ALY A;  4WJ3 M;  2ZNI A;  3L4G B;  4XEM A;  4EO4 A;  2ODR D;  2RHS B;  2ZGW A;  3A7U A;  4DQ2 A;  3HFV A;  2EJ9 A;  4HWS A;  2DDZ A;  12AS A;  1SET A;  4OLF A;  4YRJ A;  1NJ8 A;  3UFG A;  1ATI A;  1G5I A;  1BBW A;  3RKY A;  3RGL A;  2Q7G A;  4YRG A;  4XEO A;  1WNL A;  3KFU A;  2DU7 A;  2EL9 A;  4LNS A;  1LYL A;  2ARU A;  1PYS A;  4HA8 A;  4WI1 A;  3VBB A;  4YRR A;  2DQ0 A;  4YRF A;  4P73 C;  2ZCE A;  2QHT A;  2ART A;  3IKL A;  4XTY A;  3A7R A;  3RKW A;  3OD1 A;  4K87 A;  4TQD A;  1C0A A;  3UGT A;  1NJ2 A;  1ADY A;  4P71 A;  1Z7N A;  4YRS A;  3W3S A;  1BIB A;  4TVY A;  3M4Q A;  2Q7H A;  3V8K A;  2C8M A;  2EWN A;  3HRI A;  2ALY B;  2DJZ A;  3L2Z A;  3NEM A;  4UPA A;  1NJ1 A;  4CH6 A;  5KNN A;  2ODR C;  4L87 A;  3RF1 A;  4P3O A;  1WYD A;  5C53 B;  3A5Z A;  3L4G A;  3VQV A;  1HTT A;  2ZXF A;  4XU3 A;  4YRM A;  4ZTZ B;  4H2U A;  4H2V A;  3L1A A;  2IY5 B;  3WQZ A;  1KOG A;  2CGH A;  1RIQ A;  3ERR A;  2I4M A;  3HXZ A;  1YGB A;  4P74 C;  4P74 A;  3V8L A;  1NYR A;  3HXU A;  4XTU A;  2E10 A;  4H2Y A;  3RKX A;  1B7Y A;  2ZR3 A;  3TEH A;  4CS4 A;  1EFW A;  4H2S A;  4YRC A;  2RHS A;  2P0L A;  2CJA A;  2RHQ B;  2DTH A;  2DEQ A;  3REX A;  1SRY A;  3A5Y A;  2DTI A;  4YYE A;  11AS A;  4RMF A;  1JJC A;  4UP8 A;  2DU5 A;  4UP9 A;  1H4Q A;  2AKW B;  2ZZE A;  4HWO A;  2ZZG A;  1NJ5 A;  3VQX A;  4ZTU B;  4YCW A;  4YRE A;  1IL2 A;  1ADJ A;  4P71 C;  3LC0 A;  4XTW A;  4RDX A;  4UP7 A;  2E41 A;  3E9I A;  4TQF A;  4YPF A;  3VQY A;  1W66 A;  2ZZF A;  4YRK A;  2EJF A;  2J3L A;  4HVC A;  4K88 A;  3A74 A;  4PHC A;  4XTV A;  1X54 A;  3FJP A;  3P8T A;  2CJ9 A;  3UH0 A;  2P5I A;  1SES A;  1B70 B;  1KMN A;  3HFZ B;  2EJG A;  4P72 C;  4BWA A;  2HNI A;  2ZT7 A;  4XU0 A;  4WF2 A;  3PCO B;  3HY1 A;  1YB3 A;  5C51 B;  2E64 A;  4ZIB A;  4P3P A;  3V8J A;  3R07 A;  4YRI A;  4K86 A;  3HXX A;  1EIY B;  1EVL A;  1G5H A;  3REU A;  1B7Y B;  2DZC A;  2AKW A;  3HXY A;  1H4S A;  1YFS A;  3DSQ A;  1L0W A;  2DTO A;  2PMF A;  4G84 A;  3A7A A;  2QHV A;  4Q6G A;  4XTX A;  2Q5I A;  2DKG A;  2QHS A;  4YRO A;  5C52 B;  2RHQ A;  4Q15 A;  1G51 A;  4KR3 A;  4PG3 A;  4CS3 A;  3QO8 A;  4CH3 A;  2ZIO A;  3RAC A;  1USY C;  1YFT A;  1WQW A;  4YCV A;  3HY0 A;  3I7F A;  1H4V B;  2I4N A;  1SER A;  3RUX A;  3RL6 A;  3E9H A;  2ZR2 A;  4TVA A;  3MF2 A;  2ARS A;  1PYS B;  4X5O A;  1E22 A;  2IY5 A;  3PCO A;  3P8Y A;  2DXT A;  3BJU A;  4HWR A;  1J5W A;  4P73 A;  1ASY A;  2CIM A;  1B70 A;  3TUP A;  1NYQ A;  4O2D A;  4HWP A;  2E5A A;  4YRT A;  1X55 A;  4CH4 A;  4BW9 A;  3TEG A;  2DXU A;  3CMQ A;  2ZIN A;  2AMC A;  4CH5 A;  1X01 A;  3V7S A;  2ZT5 A;  5E3I A;  2Q7E A;  2E1H A;  4XU1 A;  4KR2 A;  1E24 A;  4H2X B;  1EVK A;  3V7R A;  1FYF A;  3A31 A;  3BFM A;  4H02 A;  3QNE A;  4G85 A;  1N9W A;  3QO7 A;  5ELO A;  4H2T A;  1YFR A;  1B76 A;  4H2X A;  3UGQ A;  2ZTG A;  2DQ3 A;  3HFZ A;  2AMC B;  5F5W A;  4TWA A;  1NNH A; 
#chains in the Genus database with same CATH topology
 4YCU A;  3UQ7 A;  3NZP A;  4HFE A;  4IL4 A;  3JCF A;  5AQK B;  2BVL A;  3AE6 A;  5FXW A;  5LP6 E;  1HTJ F;  2A9U A;  1KF6 A;  2M6B A;  4I43 B;  3I9Y A;  3TLS A;  4KUM B;  2ZNJ A;  1UGO A;  4YDQ A;  1HNX T;  3QO5 A;  4YRQ A;  4X1I E;  2BKO A;  2W61 A;  2J3M A;  3M65 A;  5F8P A;  4QHO A;  2BG9 B;  2NR4 A;  5C8Y E;  5J2T E;  4U2Z A;  3AXJ A;  4EGW A;  4PK6 A;  4I55 E;  2I0M A;  4IDZ A;  4QH5 A;  4MAL A;  3VU7 H;  3ZT5 A;  4U33 A;  2WU2 A;  4JI5 T;  3RPU A;  2BG9 C;  3CQC B;  3AAA B;  3AB3 B;  3QTC A;  3O4X E;  5FXZ A;  2X9X A;  1X56 A;  5LHH B;  1USY A;  4IDQ A;  5FMN A;  4H2W A;  2CHN A;  4JI4 T;  3G1Z A;  4JEH B;  3GA8 A;  3UFE A;  4XTZ A;  4YSY A;  3ICA A;  4LMK A;  1B8A A;  2LSG A;  2LSY A;  4U7Y A;  1S94 A;  3KDS E;  2LM2 A;  4LF5 T;  1ASZ A;  1XMO T;  3IA3 A;  5L2L A;  3PE0 A;  3RYI E;  5AQM B;  3V5S A;  3I1A A;  1BBU A;  1KMM A;  4YRP A;  2H7O A;  3O1J A;  3BQL A;  4TUY E;  4ZI7 E;  2JPF A;  4UR9 A;  5AQS B;  3A32 A;  2AXD S;  4B6X A;  1IBK T;  2NP9 A;  3IBP A;  2EAY A;  2E9X A;  2E3C A;  3ZPO A;  1J1J A;  1E7P A;  2K24 A;  4YRL A;  4WJ4 A;  3FZK B;  5JR9 C;  3ZT7 A;  4KQE A;  2WS3 A;  3AAE B;  2CJB A;  5KX5 E;  4B3M T;  5HEH A;  4H9P C;  5JTG A;  4A98 A;  4TX5 A;  4OX9 T;  2UXC T;  2FJE A;  3FBZ A;  2OA5 A;  1UCU A;  2RHS B;  4O2A E;  2KSR A;  1KEY A;  2QGS A;  3A7U A;  4YJ2 E;  2H88 A;  3C64 A;  3ZC0 A;  3HFV A;  4HWS A;  2DDZ A;  2EHO A;  3HI2 A;  5L47 A;  2XPK A;  1X79 A;  1U5P A;  1ATI A;  3N9N A;  3F2E A;  2PG8 A;  2BS4 A;  4YRG A;  3L09 A;  2XQ4 A;  3ZYL A;  5FXX A;  2EL9 A;  1LYL A;  4LVJ A;  3K3N A;  2ARU A;  1PYS A;  2W62 A;  4HA8 A;  4H9S E;  4DO0 A;  1HFA A;  2X67 A;  4JI1 T;  4ILC A;  3E22 E;  4NUU A;  4P73 C;  4AKL A;  2ART A;  3IKL A;  3RQU A;  3OD1 A;  1C0A A;  1NJ2 A;  4XAX B;  1ADY A;  3A7M A;  4P71 A;  4ADZ A;  4YRS A;  4GOU A;  4M1P A;  4CZZ B;  2NW9 A;  2V7K A;  3W3S A;  4ZHQ E;  4OHF A;  4TVY A;  1O3X A;  2XQ6 A;  3HRI A;  1OXZ A;  4ZS2 A;  4N78 D;  3L2Z A;  5FKY A;  4AQF A;  4UPA A;  4DV1 T;  5JH7 E;  1NJ1 A;  3LBX B;  3LFM A;  5H6R B;  4JUY A;  4TNW A;  4GK0 E;  4CN6 A;  5LGT B;  2N1G A;  2YIN A;  3A5Z A;  3QOF A;  4YJ3 E;  3CX8 B;  3PUR A;  4XU3 A;  4YRM A;  3FXD B;  3L1A A;  3WI3 A;  2I59 A;  2LEH A;  3NBX X;  3PUV F;  1KOG A;  3OJA A;  2MBG A;  1NEK A;  4MHC A;  4L9I A;  2ZM6 T;  5HCM A;  1YGB A;  2L3L A;  2CRB A;  2IHR 1;  2E9X D;  4YTN A;  3V8L A;  2J1D G;  3HXU A;  2XZE A;  2FUP A;  3R6N A;  5TAO A;  5JDF A;  4PFP A;  2IML A;  2Y8D A;  3RKX A;  1B7Y A;  1LVF A;  4CS4 A;  5ABE A;  1EFW A;  4H2S A;  5AQO B;  2WAU A;  2RHS A;  3OKQ A;  2X66 A;  2RHQ B;  3PV0 F;  2CHO A;  1BR0 A;  3A5Y A;  3P4S A;  2DTI A;  11AS A;  4LVL A;  1QLB A;  5HXE A;  1D1C A;  4UP9 A;  2JQQ A;  4O4I E;  5JRC A;  3ZMU B;  4KI0 F;  4UF0 A;  2V5C A;  4HWO A;  2CBI A;  2QA7 A;  4CXY A;  3PUZ F;  1NJ5 A;  1VCS A;  4YRE A;  1IL2 A;  4OYK A;  2VVS A;  2XQY A;  1CUN A;  4RDX A;  1CHU A;  5FP3 A;  1NWM X;  3RH3 A;  4YPF A;  3VQY A;  1MIY A;  2X51 A;  2EJF A;  2WDR A;  2YDR A;  4HEA A;  3SS1 A;  4HVC A;  3A74 A;  5HXC A;  2DI4 A;  1N36 T;  4JLE A;  4OYJ A;  2XSB A;  1EZ3 A;  4IE5 A;  1BR4 A;  2NS6 A;  3HKB E;  2CLY C;  4AKI A;  3QB5 A;  4IST A;  3OTO T;  5LB7 B;  2EJG A;  2IC9 A;  1M62 A;  2FJA A;  3HKE E;  3X1D A;  4H9R C;  2Y6X A;  4IL9 A;  5LG3 A;  5JVD E;  2LHN A;  4HFV A;  4EXT A;  2LM9 A;  2YDQ A;  4TV9 E;  1DU2 A;  1XNQ T;  3REU A;  2DZC A;  3QB5 K;  1H4S A;  1YFS A;  3ZJ1 A;  2DTO A;  5AQJ B;  2PMF A;  5FY1 A;  4MBQ A;  4G84 A;  2Q5I A;  2ES0 A;  2WZI A;  2UUC T;  5C52 B;  4Q15 A;  3QO8 A;  4CH3 A;  1US7 B;  1S35 A;  1N34 T;  1USY C;  3I7F A;  1H4V B;  2I4N A;  1SER A;  2ZR2 A;  2XM2 A;  3AEB A;  3U3I A;  2IC6 A;  1D0X A;  2CE7 A;  3MK7 C;  1PYS B;  1E22 A;  3ONL C;  4P1N A;  2DXT A;  3KVA A;  4AI6 A;  3AVR A;  2QRX A;  1SUM B;  2ODV A;  2D0T A;  2Y48 B;  4AIS A;  2XQ8 A;  4CH4 A;  3QK6 A;  4JYA T;  2Q9Q B;  5FXV A;  5CA0 E;  1KNZ A;  2DXU A;  2ZM0 A;  4CH5 A;  1X01 A;  4IE6 A;  3RYF E;  3AA1 B;  4EIW A;  2Q7E A;  4XU1 A;  4CXW A;  4LVI A;  3LBX A;  2YEV C;  1ZV4 X;  1FJG T;  3RC3 A;  2JMK A;  4F6R C;  3PUY F;  3ZMT B;  4DR1 T;  3RYC E;  3P4Q A;  3OVU A;  1IZN B;  3NWI A;  2CWO A;  1B76 A;  4H2X A;  3UGQ A;  2K9A A;  4UIG A;  3WAJ A;  3AED A;  4QH4 A;  4WW0 A;  3TLT A;  1MNE A;  1NNH A;  2YU1 A;  3P8V A;  1IAP A;  3V7C A;  4RQF A;  3AE7 A;  5ETW A;  3MF1 A;  4DBQ A;  3NET A;  5DAB A;  2VKJ A;  3B57 A;  4YTP A;  1NJ6 A;  4P3N A;  1HXD A;  2VWA A;  4YRN A;  2KMF A;  2P9B A;  5ELN A;  4YHJ A;  1WCR A;  2X0L B;  3QNU A;  3J7Y q;  2WB5 A;  1GGM A;  1EIY A;  3IHR A;  3VR8 A;  3HXW A;  4CS2 A;  1E1T A;  3OYX A;  2CWY A;  2ZT6 A;  4HWT A;  1GQE A;  4KHP T;  4BAY B;  5IWA T;  3K3O A;  4DR5 T;  2EHO D;  1EQR A;  2MOZ A;  4FI5 A;  2IW5 B;  4J15 A;  3AEC A;  2ZT8 A;  3AVS A;  2XAF B;  3FB2 A;  3P50 A;  2DVE A;  3IG2 A;  1HG2 A;  1BIA A;  4LFA T;  1UUS A;  3ETU A;  2XSA A;  4CQI A;  3ETV A;  2C5K T;  4AH6 A;  4DV6 T;  3FBL A;  4X66 T;  5KMG P;  4H9Q C;  1WLE A;  4ANJ A;  1WPY A;  2CXL A;  4DMV A;  3HTZ A;  4QXH B;  4E51 A;  5ABH A;  2PTF A;  3Q9D A;  5JDN A;  2WZH A;  2Q5H A;  1KNR A;  2J47 A;  5CJ5 A;  5AQF B;  2XQ5 A;  5ABG A;  5AQU B;  3RIR A;  2ALY A;  4WJ3 M;  4QXB B;  3L4G B;  4XEM A;  1UX5 A;  2A3D A;  4TN7 B;  4U72 A;  2XAJ B;  4DQ2 A;  3N9Q A;  1HG5 A;  2LE8 A;  3MXZ A;  3EAM A;  1SET A;  2JMH A;  2LKH A;  3HR0 A;  4EZH A;  3K8P C;  3QC9 A;  1ZKE A;  2XUE A;  3RKY A;  5J0Z A;  3NRY A;  4YFS A;  2FJD A;  4H9O C;  4A56 A;  1MMD A;  4XEO A;  4CXX A;  4EOZ B;  3ANW B;  1H7C A;  4HFH A;  1OED E;  2UXB T;  4WI1 A;  3N9O A;  5LBQ B;  3VBB A;  2DQ0 A;  4DMW A;  1NEN A;  2ZCE A;  2QHT A;  3UUM A;  4ERR A;  1Z0P A;  4YT0 A;  5CFB A;  2F4V T;  3DTO A;  3N5L A;  3ZSS A;  5BR8 T;  5HYA A;  4U74 A;  5JRE A;  4ASK A;  2CM0 A;  2WM9 A;  4QH1 A;  1D1A A;  4HWI B;  2N2N A;  3IF8 B;  2LOS A;  4Z90 A;  4HWD A;  3PJA A;  3NZQ A;  4C90 A;  1ZOY A;  2C8M A;  2RPA A;  3SOL A;  3NEM A;  2FBW A;  1MND A;  4DUY T;  3JAE A;  4YSZ A;  3RKO A;  3RF1 A;  5AQL B;  5L4E A;  4LFC T;  3L4G A;  4LF7 T;  1XDO A;  1IBL T;  3BK9 A;  4H2U A;  4HWC A;  1WYB A;  3AE9 A;  3NRX A;  2Z6E A;  2W63 A;  5EZY E;  3AEF A;  2CLY B;  3O1H A;  4P74 C;  3JAF A;  3KBT A;  5HCJ A;  2CBJ A;  2D0U A;  3SFE A;  5HXH A;  2H7V C;  4DV3 T;  3A5X A;  2N9D A;  3JAD A;  2D2S A;  3KBU A;  3TEH A;  4YRC A;  3PTR B;  2P0L A;  2CJA A;  1SHZ C;  2J62 A;  2YOE A;  3AE5 A;  2DTH A;  4AIU A;  3REX A;  1SRY A;  3F57 A;  4RMF A;  4UP8 A;  2DU5 A;  2KLQ A;  1H4Q A;  4WBN E;  3CKD A;  4HT4 A;  2AE9 A;  2YN6 A;  5IUX A;  5JDQ A;  5HEJ A;  3VQX A;  4ZI2 D;  2ACX A;  1D0Y A;  4ZTU B;  1ADJ A;  3AA6 B;  2LOP A;  4IE7 A;  4UP7 A;  2DWG A;  3ZN1 B;  3ZLI A;  4TQF A;  2ACZ A;  3ZJ2 A;  3UUB A;  3EDV A;  4JI6 T;  4ZI3 D;  3GMI A;  4JBW F;  3U78 A;  2XTL A;  2J3L A;  4QKN A;  1MMA A;  3N9P A;  3OBV E;  2IAK A;  4XTV A;  5ABF A;  3FJP A;  4U3C A;  3MAC A;  4Z91 A;  5EK2 A;  2CJ9 A;  3JC6 C;  2BS2 A;  2VVN A;  2VUR A;  1KNP A;  1SES A;  2BG9 E;  2WQY A;  4KP3 C;  4ZS3 A;  4NPP A;  4F8H A;  4BWA A;  2KIN B;  1YQ4 A;  5LBM A;  2ZT7 A;  5FL1 A;  4WF2 A;  2LRK A;  3HL6 A;  3HY1 A;  2Q9Q D;  1YB3 A;  1D0Z A;  2FJB A;  5LJN A;  3AAI A;  2XM1 A;  2H89 A;  4ZIB A;  4COF A;  3V8J A;  5FVK A;  3F31 A;  4A5X A;  3R07 A;  3RX6 A;  3VHL A;  1YW0 A;  4KMC A;  3HXX A;  3LK3 B;  3GN5 A;  1G5H A;  1B7Y B;  4OFZ A;  2ZM2 A;  3E08 A;  4JI0 T;  2JRK A;  2QHV A;  3EDU A;  4XTX A;  2NTX A;  3VR9 A;  2DKG A;  4YRO A;  2SPC A;  4DR2 T;  2RHQ A;  3UUN A;  3PUW F;  3CIR A;  1UK5 A;  3C4X A;  4YTM A;  4LF9 T;  3FZF B;  1YXR A;  2BVM A;  3E0Z A;  5FL0 A;  4DND A;  2XQ9 A;  5H6Q B;  2ARS A;  4X5O A;  2KWI B;  3PCO A;  3L8R A;  3ABV A;  2UXX B;  3BJU A;  5JQG E;  2YU2 A;  3QUJ A;  1ASY A;  3TKL B;  2E8I A;  2E5V A;  3TUP A;  4O2D A;  4HWP A;  2CCQ A;  4WNK A;  4YRT A;  4WYV A;  3UU4 A;  5LXT E;  3TEG A;  1KFY A;  5AQI B;  2V6X A;  2IDO B;  4ILU A;  3CMQ A;  3PUX F;  2LHR A;  2BZB A;  4DV0 T;  3AA0 B;  2ODU A;  2E1H A;  2WP9 A;  5L3C B;  4QXC B;  3ONX A;  2MPK A;  3BFM A;  3PUQ A;  3AE3 A;  4H2T A;  1YFR A;  2VL8 A;  2ZTG A;  3PU3 A;  4HE8 A;  3S4U A;  4YP0 A;  3A8Y C;  4P0A A;  3ZST A;  3NEN A;  1JNZ A;  1L0V A;  4CI1 B;  3G06 A;  1HNW T;  3H3A A;  2E5L T;  3NEL A;  4PJM A;  1Y01 A;  4UXN B;  2LKG A;  3UU5 A;  2DNX A;  4ZOL E;  2NWB A;  5JDL A;  5HGQ A;  2ZIM A;  4CI2 B;  2IUB A;  2WMN A;  5LYJ E;  4HFB A;  4TTV A;  4GK5 E;  4IRE A;  4JI3 T;  4NXM T;  4DR4 T;  3LK4 2;  3TLU A;  1VOM A;  1IJ5 A;  2MAW A;  4P75 C;  2NW8 A;  1N32 T;  2XAG B;  1H4T A;  2QHU A;  4BJN A;  4LFB T;  2K48 A;  2WMO A;  3VRB A;  4UF0 B;  2KWH A;  2H3R A;  3BQI A;  3TEH B;  3I0O A;  2VQE T;  4P75 A;  1FIO A;  2WY2 A;  4UEL A;  1SA0 E;  4OP0 A;  4O2B E;  3KV6 A;  1EOV A;  4TVW A;  2JJ9 A;  4DPG A;  4XU2 A;  3IAL A;  5AQN B;  4IDN A;  1MMG A;  2C5J A;  1E2A A;  3ZYM A;  2UU9 T;  2E9X B;  2I4O A;  3AE2 A;  2DHR A;  2G4C A;  4U2Y A;  5JDM A;  4UVA B;  4IE4 A;  5ABF B;  2I4L A;  1X2G A;  2E65 A;  2CA5 A;  3CWZ B;  3LSS A;  5JDG A;  1WQ7 A;  1LKX A;  2CXD A;  3AEG A;  3KV5 A;  4TZ4 C;  1KK7 A;  1JJC B;  3PZC A;  3D0T A;  1BR1 A;  1MIV A;  1LVK A;  4B3R T;  4XZC A;  5JRC B;  3PUG A;  3AXJ B;  2X0H A;  3H37 A;  2EJ9 A;  4ZXL A;  4LF8 T;  12AS A;  4OLF A;  4HGA A;  5HWY A;  3KIN B;  3UFG A;  1G5I A;  1BBW A;  4PK4 A;  4V1A v;  1HX1 B;  3RGL A;  4B3T T;  3RLF F;  4IDO A;  5FY7 A;  5M4Y A;  3KFU A;  2DU7 A;  4LNS A;  4G63 A;  4DUZ T;  5AQG B;  2BKN A;  4X65 T;  2BBH A;  2IIU A;  2XAQ B;  3I9W A;  2LSI A;  4DBR A;  5LNK A;  2ZM8 A;  2I6H A;  4BJM A;  3FZH B;  5JR9 B;  3A7R A;  4XTY A;  5EK3 A;  3UU6 A;  1J5E T;  2VKD A;  3MZK B;  5LHI B;  2E2A A;  4K87 A;  3UGT A;  5FY0 A;  4E7S A;  1Z7N A;  3OYZ A;  2KZ7 B;  2VQF T;  4IGU A;  5L3E B;  3Q5W A;  1HX8 A;  3M4Q A;  3FHN A;  2Q7H A;  3RIU A;  2WSS V;  3ZKR A;  4P09 A;  5DQW A;  2ALY B;  2DJZ A;  3LJC A;  2LLY A;  5F3J A;  4LVM A;  1YKH B;  2W2U A;  2EHO B;  4O8S A;  2ODR C;  4TNV A;  4PAG A;  3J9X 1;  2HPJ A;  3LDQ B;  4P3O A;  1FEW A;  3HKC E;  1WYD A;  5C53 B;  3ZCI A;  1LRZ A;  3VQV A;  5L3F B;  2ZXF A;  2VK9 A;  4DR7 T;  3C51 A;  4H2V A;  1W0B A;  2IY5 B;  2K3W A;  3WQZ A;  4L0R A;  2NOX A;  1RIQ A;  4KBM B;  2XQ3 A;  3M3Z B;  3P4P A;  3HXZ A;  4I50 E;  4PW8 A;  1XMQ T;  2X68 A;  2W0G A;  2UUB T;  2HN2 A;  1ZP0 A;  4G2A A;  5LOV E;  4K0K T;  3Q2M A;  4DR3 T;  4QX7 B;  4IDP A;  3T1Y T;  3ONJ A;  2PFV A;  1YQ3 A;  2E10 A;  4LML A;  2DL1 A;  5HEO A;  2V6Y B;  4H2Y A;  2NW7 A;  1I6Z A;  2E9X C;  2LJL A;  1WR0 A;  4O4H E;  2UXD T;  4CI3 B;  3N9L A;  4HFD A;  3PDY A;  1D1B A;  1OWA A;  4UV9 B;  2HPL A;  1JJC A;  4AQF C;  2X9H A;  3CVR A;  2A8E A;  3CX7 B;  4EV6 A;  2AKW B;  1Z8U A;  2V5D A;  4ZEY A;  4YHH T;  4MLK A;  3AE4 A;  3P4R A;  4P71 C;  4XTW A;  3SWH A;  2E41 A;  2ZZF A;  4HFC A;  3EUH A;  2VKH A;  4AKR B;  3VRA A;  4LF4 T;  4K88 A;  2V6Y A;  1XDP A;  3EVY A;  3H3M A;  1X54 A;  4X1K E;  1OED A;  5CA1 E;  5LCY A;  3P8T A;  4ZZC A;  2X9W A;  4NUV A;  3TLW A;  1XZY A;  4TV8 E;  2WU5 A;  2P5I A;  2JQ9 A;  2XY8 B;  1B70 B;  4HTE A;  2J4G A;  1KMN A;  2WDV A;  4P72 C;  5HWX A;  2HNI A;  4EEB A;  4L5G A;  4AXP A;  4XU0 A;  5LGN B;  4TWH A;  5AQP B;  2V7J A;  4TWF A;  1X9B A;  5C51 B;  3RRC A;  1MIW A;  3LSV A;  2V7L A;  2JIW A;  3MKD A;  4P3P A;  4YRI A;  3SFD A;  4CN1 A;  1WLX A;  4K86 A;  3CQG B;  1HNZ T;  3CPZ A;  5AQR B;  2M6I A;  3LK2 B;  3HXY A;  5DJQ C;  3RHW A;  3RRW A;  2KND A;  2VB6 A;  4X5T A;  5BMV E;  3DSQ A;  3KV9 A;  4BA9 A;  4HN9 A;  2RA1 A;  2WDQ A;  3A7A A;  4Q6G A;  4PK5 A;  3LG7 A;  2QHS A;  4ILA A;  4KR3 A;  4CS3 A;  1NAF A;  4DV2 T;  5JR9 A;  4YCV A;  1R8I A;  4H9N C;  3RUX A;  1W09 A;  3E9H A;  2UXN B;  3RKG A;  2BG9 A;  2WCA A;  5DQV A;  3MF2 A;  5LMU T;  3RYH E;  5AQH B;  2LSK A;  2KT9 A;  3P8Y A;  2CMR A;  1WRD A;  4HWR A;  4ISS A;  2YKS A;  2XQA A;  2CIM A;  1B70 A;  4I0U A;  5J2U E;  3ZMS B;  4KHZ F;  1X55 A;  3PUA A;  2DWK A;  1XWM A;  2K5B B;  1JNR A;  1WR6 A;  3ZN0 B;  4YSX A;  3KV4 A;  4EAH A;  2ZIN A;  2ZT5 A;  3CQX C;  4IT4 A;  4OK0 A;  2BKP A;  4H2X B;  3RIU C;  3K3Q C;  1EVK A;  3V7R A;  3SRZ A;  4LF6 T;  3DJB A;  3QO7 A;  3AE1 A;  3N9M A;  2DQ3 A;  2WWU A;  4QX8 B;  2AMC B;  4AKG A;  5F5W A;  5IHY A;  3AE8 A;  3NVO A;  2XHE B;  1WFD A;  3W15 B;  3LSQ A;  3WAK A;  3RI5 A;  5KDM C;  3KVB A;  1T72 A;  4PJJ A;  1WU7 A;  5AQV B;  5K1X A;  3M4P A;  2LSJ A;  1E1O A;  4X64 T;  1AJ3 A;  1MMN A;  2ZLY A;  4YY3 T;  3CK6 A;  4O4L E;  2LT3 A;  4JI2 T;  1Z7M A;  5ADX L;  5K1P A;  3L3P A;  2MYS A;  2L9Q A;  4JI7 T;  3PU8 A;  1HC7 A;  2EHO C;  1VCT A;  3DP7 A;  3GN5 B;  3PUS A;  1WYC A;  1VQZ A;  1X2H A;  4EX5 A;  3EFS A;  3T8O A;  2WBL A;  5AQT B;  2B76 A;  1N33 T;  4TVA B;  1UUR A;  2VKO A;  3Q5D A;  5JDH A;  4EED A;  5FVL A;  2PME A;  2XTI A;  2BS3 A;  2W4X A;  5LJM A;  2DZ9 A;  3ZMZ B;  2XGT A;  3UU8 A;  3HRK A;  2GK9 A;  3KFW X;  2Q9Q A;  2L8K A;  3ESL A;  3EFR A;  2X9Y A;  4GIW A;  4NCX A;  2XQ7 A;  5CGM A;  5J1G A;  3HXV A;  3EHZ A;  3AEE A;  1B7T A;  3UT5 E;  1QE0 A;  3PJA J;  2FYK A;  4P72 A;  3VQW A;  3GWH A;  3ZCJ A;  4ZZB A;  1QF6 A;  4EYU A;  4JI8 T;  5KXJ A;  2V1D B;  4HWF A;  3MJX A;  4RQE A;  2MTQ A;  4GYS A;  1FMW A;  2UUA T;  4JEU B;  3IKM B;  3P7I A;  2C7I A;  2JQK A;  2XJ7 A;  2QYW A;  2W66 A;  3MEY A;  3UUX B;  1XNR T;  3B5M A;  4EZ4 A;  2WWV A;  2ZNI A;  4EO4 A;  1T7S A;  2ODR D;  4KX6 A;  2VL0 A;  3FZM B;  2ZGW A;  2OLT A;  1QSD A;  3K1S A;  3N2O A;  4ILB A;  4YRJ A;  1NJ8 A;  1YD8 G;  5L3B B;  1SE7 A;  1OED C;  1HCI A;  2Q7G A;  4EB6 E;  4AKH A;  2D9D A;  4IIJ E;  2W00 A;  2YDS A;  1WNL A;  2CPT A;  3UU3 A;  3I0Q A;  4JV5 T;  2KXP B;  3MA9 A;  4GYR A;  2V8S V;  3FZL B;  5GON E;  2V7M A;  3CML A;  4YRR A;  4YRF A;  3CX6 B;  5AFU L;  4DR6 T;  4Q25 A;  3NKZ A;  3RKW A;  1U4Q A;  3VKG A;  1YKE B;  4TQD A;  2NTY A;  4AQG A;  4DV4 T;  4PJN A;  3P8C D;  3Q5X A;  5HXR A;  3BQK A;  4H63 V;  3C98 B;  4P0B A;  1BIB A;  5FYM A;  3V8K A;  2EWN A;  4EYY R;  2BDE A;  3EAB A;  3TLV A;  4DV5 T;  1UX4 A;  4CH6 A;  5KNN A;  2B1E A;  2XAH B;  4C91 A;  1VRB A;  4E7Z A;  4LMJ A;  4L87 A;  2DLR A;  5HXS A;  5HAX A;  3RIA A;  4B3S T;  5HEU A;  1HTT A;  4ZTZ B;  3V5U A;  4U31 A;  1T8B A;  1W9R A;  3ANW A;  2CGH A;  3ERR A;  5L4H A;  2ZMA A;  1HF8 A;  3OPC A;  4IHJ E;  4J2C A;  2I4M A;  4UV8 B;  2LRL A;  3UQ4 A;  4I4T E;  2A2F X;  1QUU A;  5C2T A;  1FMV A;  3IEE A;  5EK4 A;  4P74 A;  4PFO A;  3N2K E;  5LA6 E;  2HH7 A;  2DCF A;  2BBJ A;  1NYR A;  3VKH A;  4XTU A;  2G0U A;  2VAS A;  1G73 A;  2YK0 A;  4A97 A;  1M7K A;  4GKJ T;  2ZR3 A;  4X1Y E;  3RC8 A;  3HA4 A;  4O4J E;  3UTK A;  3UUL A;  2OV9 A;  1E1H B;  4HKA A;  2DEQ A;  1ZHC A;  4PNI A;  4XBF B;  4YYE A;  3P4W A;  4UEM A;  2V7I A;  3AA7 B;  1IJ6 A;  2QVA A;  3ZEF B;  3RIF A;  4H63 H;  4PJL A;  2ZZE A;  4HFI A;  2ZZG A;  5A1L A;  4ZI3 C;  4YCW A;  4YXD A;  2R6G F;  2HHH T;  5E0O A;  3LC0 A;  3E9I A;  2JQH A;  4WZX A;  1W66 A;  1Y64 B;  3ZMV B;  4YRK A;  1OED B;  4ZI2 C;  4NXN T;  3ZC1 A;  2CXF A;  4PHC A;  3ZT6 A;  5LGU B;  2A72 A;  4UVC B;  4MFR A;  5LHG B;  2D5U A;  3T1H T;  4IE0 A;  3UH0 A;  4DID B;  3O1I A;  3HFZ B;  4WBO A;  3RQW A;  3PCO B;  3JC6 D;  5C3J A;  2E64 A;  2V26 A;  4Z8X A;  3R84 B;  2CEA A;  1EIY B;  1BR2 A;  1G8X A;  1EVL A;  4YLH A;  3HKD E;  2Q9Q C;  2PBI A;  2AKW A;  1T98 A;  1L0W A;  1V9D A;  1G51 A;  4PG3 A;  2ZIO A;  2X0Y A;  3N2G E;  1YFT A;  3RAC A;  1WQW A;  3HY0 A;  3MQZ A;  2C5I T;  3RL6 A;  3C50 A;  4TVA A;  1ZEE A;  2C0S A;  3C4W A;  2IY5 A;  3C4Z A;  4FJO A;  5CB4 E;  1J5W A;  4P73 A;  4GKK T;  1NYQ A;  2XAS B;  2E5A A;  5HEG A;  4X20 E;  3ZYK A;  1W0A A;  4CN4 A;  5AQQ B;  3FXE B;  2HN1 A;  4BW9 A;  4K0U A;  5LMN T;  5L3D B;  2AMC A;  3V7S A;  2W67 A;  5E3I A;  1HR0 T;  2RP4 A;  4AQY T;  4KR2 A;  1I94 T;  1E24 A;  2M67 A;  5LG4 A;  4LVK A;  4U7I A;  4QWN B;  1HS7 A;  1FYF A;  4UVB B;  5L3G B;  3B13 A;  3A31 A;  4H02 A;  3L39 A;  3QNE A;  4G85 A;  1N9W A;  5ELO A;  5FNV E;  4HWH A;  4DV7 T;  3Q5E A;  3AEA A;  3EI0 A;  1IBM T;  3HFZ A;  2PJQ A;  5IYZ E;  4TWD A;  4NIQ A;  4DVD A;  4TWA A;  3O9X A;  4X62 T; 
#chains in the Genus database with same CATH homology
 4YP0 A;  4YCU A;  3P8V A;  3LSQ A;  3NEN A;  3V7C A;  4RQF A;  1WU7 A;  3MF1 A;  2ZNJ A;  3NEL A;  3NET A;  5K1X A;  4YDQ A;  3M4P A;  3QO5 A;  1E1O A;  4YRQ A;  1NJ6 A;  4P3N A;  1HXD A;  5HGQ A;  1Z7M A;  4YRN A;  2ZIM A;  2J3M A;  5ELN A;  5K1P A;  4TTV A;  1HC7 A;  1GGM A;  1EIY A;  3HXW A;  4CS2 A;  1VQZ A;  1E1T A;  1X2H A;  4EX5 A;  2ZT6 A;  4HWT A;  3EFS A;  4P75 C;  4TVA B;  3QTC A;  1X56 A;  1USY A;  1EQR A;  1H4T A;  2QHU A;  4H2W A;  2PME A;  2XTI A;  3G1Z A;  4J15 A;  4XTZ A;  3TEH B;  2DZ9 A;  2ZT8 A;  3ICA A;  1B8A A;  2XGT A;  4P75 A;  2DVE A;  3IG2 A;  1BIA A;  3HRK A;  4OP0 A;  1ASZ A;  3EFR A;  4NCX A;  4AH6 A;  1EOV A;  4TVW A;  1BBU A;  1KMM A;  4YRP A;  3HXV A;  4DPG A;  4XU2 A;  3IAL A;  3A32 A;  1QE0 A;  1WLE A;  1WPY A;  2I4O A;  2FYK A;  2G4C A;  4P72 A;  2EAY A;  2E3C A;  3HTZ A;  3VQW A;  4YRL A;  4E51 A;  1QF6 A;  2I4L A;  4WJ4 A;  1X2G A;  2E65 A;  3LSS A;  1WQ7 A;  4RQE A;  2Q5H A;  4KQE A;  3IKM B;  2C7I A;  2CJB A;  1JJC B;  3PZC A;  3MEY A;  3RIR A;  2ALY A;  4WJ3 M;  2ZNI A;  3L4G B;  4XEM A;  4EO4 A;  2ODR D;  2RHS B;  2ZGW A;  3A7U A;  4DQ2 A;  3HFV A;  2EJ9 A;  4HWS A;  2DDZ A;  12AS A;  1SET A;  4OLF A;  4YRJ A;  1NJ8 A;  3UFG A;  1ATI A;  1G5I A;  1BBW A;  3RKY A;  3RGL A;  2Q7G A;  4YRG A;  4XEO A;  1WNL A;  3KFU A;  2DU7 A;  2EL9 A;  4LNS A;  1LYL A;  4LVJ A;  2ARU A;  1PYS A;  4HA8 A;  4WI1 A;  3VBB A;  4YRR A;  2DQ0 A;  4YRF A;  4P73 C;  2ZCE A;  2QHT A;  2ART A;  3IKL A;  4XTY A;  3A7R A;  3RKW A;  3OD1 A;  4K87 A;  4TQD A;  1C0A A;  3UGT A;  1NJ2 A;  1ADY A;  4P71 A;  1Z7N A;  4YRS A;  3W3S A;  1BIB A;  4TVY A;  3M4Q A;  2Q7H A;  3V8K A;  2C8M A;  2EWN A;  3HRI A;  2ALY B;  2DJZ A;  3L2Z A;  4LVM A;  3NEM A;  4UPA A;  1NJ1 A;  4CH6 A;  5KNN A;  2ODR C;  4L87 A;  3RF1 A;  4P3O A;  1WYD A;  5C53 B;  3A5Z A;  3L4G A;  3VQV A;  1HTT A;  2ZXF A;  4XU3 A;  4YRM A;  4ZTZ B;  4H2U A;  4H2V A;  3L1A A;  2IY5 B;  3WQZ A;  1KOG A;  2CGH A;  1RIQ A;  3ERR A;  2I4M A;  3HXZ A;  1YGB A;  4P74 C;  4P74 A;  3V8L A;  1NYR A;  3HXU A;  4XTU A;  2E10 A;  4H2Y A;  3RKX A;  1B7Y A;  2ZR3 A;  3TEH A;  4CS4 A;  1EFW A;  4H2S A;  4YRC A;  2RHS A;  2P0L A;  2CJA A;  2RHQ B;  2DTH A;  2DEQ A;  3REX A;  1SRY A;  3A5Y A;  2DTI A;  4YYE A;  11AS A;  4LVL A;  4RMF A;  1JJC A;  4UP8 A;  2DU5 A;  2A8E A;  4UP9 A;  1H4Q A;  2AKW B;  2ZZE A;  4HWO A;  4HT4 A;  2ZZG A;  1NJ5 A;  3VQX A;  4ZTU B;  4YCW A;  4YRE A;  1IL2 A;  1ADJ A;  4P71 C;  3LC0 A;  4XTW A;  4RDX A;  4UP7 A;  2E41 A;  3E9I A;  4TQF A;  4YPF A;  3VQY A;  1W66 A;  2ZZF A;  4YRK A;  2EJF A;  2J3L A;  4HVC A;  4K88 A;  3A74 A;  4PHC A;  4XTV A;  1X54 A;  3FJP A;  3P8T A;  2CJ9 A;  2NS6 A;  3UH0 A;  2P5I A;  1SES A;  1B70 B;  1KMN A;  3HFZ B;  2EJG A;  4P72 C;  4BWA A;  2HNI A;  2ZT7 A;  4XU0 A;  4WF2 A;  3PCO B;  3HY1 A;  1YB3 A;  5C51 B;  2E64 A;  4ZIB A;  4P3P A;  3V8J A;  3R07 A;  4YRI A;  4K86 A;  3HXX A;  1EIY B;  1EVL A;  1G5H A;  3REU A;  1B7Y B;  2DZC A;  2AKW A;  3HXY A;  1H4S A;  1YFS A;  3DSQ A;  1L0W A;  2DTO A;  2PMF A;  4G84 A;  3A7A A;  2QHV A;  4Q6G A;  4XTX A;  2Q5I A;  2DKG A;  2QHS A;  4YRO A;  5C52 B;  2RHQ A;  4Q15 A;  1G51 A;  4KR3 A;  4PG3 A;  4CS3 A;  3QO8 A;  4CH3 A;  2ZIO A;  3RAC A;  1USY C;  1YFT A;  1WQW A;  4YCV A;  3HY0 A;  3MQZ A;  3I7F A;  1H4V B;  2I4N A;  1SER A;  3RUX A;  3RL6 A;  3E9H A;  2ZR2 A;  4TVA A;  3MF2 A;  2ARS A;  1PYS B;  4X5O A;  1E22 A;  2IY5 A;  3PCO A;  3P8Y A;  2DXT A;  3BJU A;  4HWR A;  1J5W A;  4P73 A;  1ASY A;  2CIM A;  1B70 A;  3TUP A;  1NYQ A;  4O2D A;  4HWP A;  2E5A A;  4YRT A;  1X55 A;  4CH4 A;  4BW9 A;  3TEG A;  2DXU A;  3CMQ A;  2ZIN A;  2AMC A;  4CH5 A;  1X01 A;  3V7S A;  2ZT5 A;  5E3I A;  2Q7E A;  2E1H A;  4XU1 A;  4LVI A;  4KR2 A;  1E24 A;  4H2X B;  4LVK A;  1EVK A;  3V7R A;  1FYF A;  3A31 A;  3BFM A;  4H02 A;  3QNE A;  4G85 A;  1N9W A;  3QO7 A;  5ELO A;  4H2T A;  1YFR A;  1B76 A;  4H2X A;  3UGQ A;  2ZTG A;  2DQ3 A;  3HFZ A;  2AMC B;  5F5W A;  4TWA A;  1NNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...