3RGLA

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc in complex with atp and glycine
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
292
structure length
292
Chain Sequence
b'NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycyl-tRNA synthetase alpha subunit
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP and glycine.
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
total genus 101
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3rglA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rglA01
2ZXFA 1WQ7A 2PMEA 2I4LA 4YPFA 3NELA 2ZZFA 3L4GB 4CH4A 3P8YA 4Q15A 2E3CA 1YB3A 3A7AA 2DEQA 4P3OA 4WJ4A 3NEMA 5C53B 1NNHA 5K1PA 3KFUA 2I4OA 2ALYB 3HXXA 2AKWB 2ODRC 4YYEA 4YRCA 4YRSA 1N9WA 1E1TA 1PYSA 1C0AA 2E65A 1SESA 3HXZA 3RUXA 4P73C 1ATIA 2J3MA 3LSQA 3P8VA 1E1OA 4LNSA 2ZR3A 4YRIA 1H4SA 2AMCB 4UP7A 4NCXA 1E24A 2ZTGA 2FYKA 4RMFA 3G1ZA 1IL2A 1BBWA 4P74C 3FJPA 4XEOA 3MF2A 3LC0A 1EOVA 1X01A 2DQ0A 3E9HA 4XTYA 2RHSA 4YRMA 1BIAA 4J15A 4RDXA 2ARSA 5F5WA 4E51A 4YRPA 4WJ3M 3PCOB 4OP0A 4XTWA 4CS3A 2ZNIA 4YRNA 4H2WA 4TTVA 2IY5A 1EQRA 5HGQA 4RQEA 4BWAA 2C8MA 2Q5HA 3V8LA 4H2UA 4L87A 2P0LA 4XTZA 1LYLA 4K87A 5C51B 5KNNA 1X55A 3V7CA 4HVCA 4YRKA 2DQ3A 3UH0A 4P3NA 3W3SA 4H2SA 2QHSA 4P75A 4K88A 4XEMA 4H2XB 2J3LA 3IKMB 2Q7HA 3A32A 4UP9A 2DTIA 4YRQA 1B7YA 2Q7GA 1NJ6A 4YP0A 2EJGA 2XGTA 1JJCA 4P71A 2E64A 4HWPA 2ZT6A 3LSSA 1EFWA 3MEYA 5K1XA 3E9IA 1WLEA 2QHVA 1HTTA 3L4GA 4CH3A 4P72A 2DZCA 3HTZA 4HA8A 3V8JA 2ZIOA 3ICAA 2C7IA 3UFGA 1BBUA 2ZCEA 2ALYA 3QO7A 2AKWA 3TEGA 1USYC 2ZZGA 4HWSA 4XTVA 2XTIA 2DJZA 3VQVA 1KMNA 4RQFA 1X2HA 2RHQB 11ASA 3VQYA 4ZTZB 4XTUA 2QHTA 4EX5A 3P8TA 4YCVA 4CS4A 1NYQA 3A74A 2AMCA 1X54A 3QTCA 2ZT5A 3RIRA 4H2VA 1H4TA 4YCWA 4ZIBA 3TEHB 2DKGA 3CMQA 3WQZA 1W66A 3IALA 4UPAA 1H4QA 2ZIMA 2DXUA 1B8AA 1EVKA 4TQFA 2PMFA 3EFSA 1WYDA 2DTHA 1ASZA 4H02A 3PCOA 3TUPA 1Z7NA 2ARTA 2E1HA 2EJFA 4CS2A 3NETA 2ODRD 4TVYA 4G85A 3MF1A 5ELOA 1G5HA 3A7RA 3A7UA 3I7FA 4H2YA 4G84A 3BJUA 1HC7A 1G5IA 4X5OA 4KR3A 3RF1A 1VQZA 1YGBA 1X56A 4XTXA 3A5ZA 3QO8A 1NJ1A 3HXYA 3HFZB 4YROA 2ZINA 2DVEA 4H2XA 1Z7MA 4YCUA 5ELNA 1EIYB 4XU1A 1J5WA 3RGLA 4CH5A 2CJ9A 3M4QA 1ASYA 1L0WA 4TWAA 1BIBA 4O2DA 3QNEA 4P73A 3IG2A 4XU3A 4AH6A 2CJAA 1WQWA 3REUA 1SETA 2DTOA 3HY0A 3HY1A 2ZT7A 4UP8A 2EWNA 3L1AA 2DU7A 4PHCA 4P74A 3VQWA 4EO4A 4YRLA 1ADJA 1QF6A 3OD1A 1FYFA 1YFRA 2DXTA 2DU5A 1RIQA 2P5IA 3UGTA 1NJ2A 2DDZA 1NJ5A 12ASA 3VBBA 4YDQA 4YRFA 2RHQA 4BW9A 3VQXA 4XU2A 4P75C 3RKWA 4KR2A 3EFRA 3UGQA 2CJBA 4YRJA 1H4VB 2EAYA 4XU0A 4TQDA 1PYSB 3A5YA 3RKYA 1GGMA 4PG3A 2EL9A 3REXA 4TVAB 4TVAA 2G4CA 1YFSA 3TEHA 3L2ZA 1B76A 4CH6A 4P71C 2CGHA 2EJ9A 4WI1A 3BFMA 2ARUA 2QHUA 3HRKA 3HFVA 1EVLA 4HWOA 1WU7A 1KMMA 3A31A 2ZT8A 4YREA 2DZ9A 3HXVA 3DSQA 1G51A 2ZZEA 1KOGA 3R07A 2Q5IA 4P72C 4H2TA 4P3PA 2ZGWA 4K86A 4TVWA 4DQ2A 4HWRA 3V8KA 3M4PA 3PZCA 1NJ8A 2RHSB 2CIMA 3RL6A 3RKXA 4YRGA 3HRIA 4YRRA 4HWTA 3NENA 2HNIA 5E3IA 2IY5B 4WF2A 2Q7EA 1SERA 4ZTUB 3HFZA 1EIYA 1X2GA 3RACA 3HXWA 1USYA 1SRYA 4YRTA 1NYRA 3V7SA 4KQEA 1WNLA 3IKLA 1YFTA 4Q6GA 1E22A 1B70B 1B70A 5C52B 2ZR2A 3QO5A 1HXDA 1WPYA 1B7YB 3HXUA 2ZNJA 3ERRA 1ADYA 2E41A 4DPGA 4OLFA 2E10A 1QE0A 1JJCB 2I4NA 3V7RA 2I4MA 2E5AA
chains in the Genus database with same CATH superfamily
2BBHA 3AEGA 2ZXFA 4DBRA 4CXYA 4EAHA 3KV9A 5FYMA 3NELA 2ZZFA 4EXTA 2BS4A 3GN5B 2WU5A 3P8YA 2L3LA 5HEGA 4DNDA 3RIUA 3A7AA 4X66T 2DEQA 4ILBA 3AAEB 3CQXC 2I4OA 3AA1B 3C50A 3CQGB 5LMNT 2MBGA 4H9OC 4IT4A 4YRSA 4AIUA 1C0AA 3NRXA 4L5GA 3IBPA 3PUYF 3SFEA 4YHHT 4P73C 2J3MA 3LSQA 2ZR3A 3RPUA 3P4WA 2DNXA 2ZM0A 2AMCB 1D1CA 3DP7A 4UP7A 1FIOA 4HWIB 2UUBT 2FYKA 3G1ZA 3L3PA 2WDRA 4PK4A 2HN1A 2E9XD 2V26A 4YTPA 3FJPA 3MF2A 4HFEA 4ZZCA 1X01A 1KK7A 4B3ST 2RHSA 1UURA 5AQPB 3VRAA 4M1PA 4A56A 4CXWA 5BMVE 4U2YA 2C5KT 5HGQA 2CEAA 3I9WA 5JQGE 3NZQA 4L87A 4ZI3C 5C51B 2KNDA 2IAKA 2WDVA 3TKLB 3CX6B 5JDGA 5LHIB 5F3JA 3RQWA 1KNZA 4YRKA 2DQ3A 3CPZA 4P3NA 1W0BA 2WZHA 4WBNE 2DLRA 3M3ZB 5LGUB 3ZMTB 2X68A 2J3LA 1XDOA 3QK6A 3IKMB 2PTFA 2Q7HA 4UP9A 3P4QA 5L3FB 2DTIA 4DR5T 3UQ7A 4YP0A 2EJGA 5FVLA 1KNPA 2XGTA 4IL4A 4HWPA 3S4UA 4DV0T 2SPCA 1EFWA 5KXJA 5K1XA 2ACZA 4ADZA 3E9IA 2I0MA 3FBZA 5L47A 2RA1A 5HEOA 3AA7B 3L4GA 2LM9A 2BKOA 3PU8A 4CH3A 4X64T 4HA8A 3WAJA 1XNRT 5AQOB 2X51A 2YDSA 1BBUA 2ALYA 2H7OA 3IA3A 2HPLA 4YXDA 3PV0F 4U31A 2M6IA 2H88A 2L9QA 3KFWX 3AE3A 4ILUA 5CA0E 4PJMA 4I0UA 4XTUA 2H3RA 4UF0A 4AKHA 2QHTA 3X1DA 2E5VA 5LOVE 4QXBB 1X54A 1MMAA 3QTCA 4LF4T 5LB7B 2K48A 4HWCA 3RIAA 4YTMA 1E2AA 3TLWA 2FBWA 2XSAA 4UPAA 1H4QA 5FMNA 5FL0A 2DXUA 3CQCB 4GKJT 2XQYA 4C91A 1B8AA 2L8KA 2VL0A 4TQFA 4HWDA 5FXVA 4PJJA 2XQ9A 4TWDA 1IBLT 2XM1A 1WYDA 3PCOA 2XHEB 3U3IA 1Z7NA 4UVBB 5LJNA 2ARTA 3NETA 4UEMA 4XAXB 4O4IE 3ZYMA 1G5HA 1QSDA 3A7RA 3A7UA 1Z8UA 3BQLA 1X9BA 3RF1A 4DV2T 4JI4T 3P4RA 3WI3A 3A5ZA 4QH4A 4YHJA 3HR0A 1XWMA 3K1SA 4YCUA 4YT0A 2CBIA 4BJMA 2CWOA 2LRLA 3PUSA 5EK4A 2W61A 1ASYA 5L3DB 4G63A 1OWAA 5AQHB 5JRCB 4FJOA 5ETWA 3AEAA 4KX6A 4DV1T 4P73A 4TN7B 4QXCB 1YXRA 4AH6A 2CJAA 4TWHA 4LFAT 3KINB 2A72A 3AE8A 2DTOA 4TWFA 1MMDA 3LJCA 5AFUL 2VB6A 2RPAA 2Q9QD 3OVUA 2Y48B 3ETVA 1AJ3A 5LGTB 2YDRA 4H9RC 5HYAA 2E9XC 2LSGA 4YY3T 2LRKA 1IZNB 2WB5A 4QHOA 2KT9A 3N2OA 3UU5A 2HN2A 1LRZA 2W66A 2UUCT 3VQXA 5IHYA 4HGAA 2B76A 3Q2MA 3UGQA 2Q9QB 3OJAA 5LBMA 4YRJA 4FI5A 2Z6EA 4DR4T 2V6YB 3N9OA 1PYSB 3ZN0B 3QB5A 3LBXB 4TVAA 4AXPA 4ZI2D 2NOXA 3L2ZA 2I59A 4CH6A 2EJ9A 4TNVA 5FXZA 2ARUA 4X20E 4EYYR 2KWHA 1MMGA 1ZKEA 1EVLA 4UR9A 2YK0A 3R07A 2Q5IA 4P72C 4P0AA 5LG4A 4TNWA 4DQ2A 3FZKB 4X65T 2G0UA 5CB4E 3KVBA 1NJ8A 2CRBA 4YFSA 3IEEA 1N32T 2CIMA 2D5UA 1UGOA 3O1JA 4YRGA 2UXXB 4EEDA 4YLHA 4LF5T 1YQ4A 5E3IA 2IY5B 1VOMA 2W0GA 4WF2A 3MK7C 2NWBA 5HXRA 2VVSA 4AQFC 4CI3B 2BVLA 3HKCE 3MQZA 4YRTA 4K0KT 3V7SA 4DVDA 4KQEA 3IKLA 3AA0B 1LVKA 4X1YE 1B70B 1OEDB 5FY0A 3A5XA 3NVOA 5AQMB 4HFIA 3HA4A 4I55E 1B7YB 3HXUA 3AXJA 4PJNA 3UU3A 5FNVE 5J2UE 2V7LA 3ERRA 2CHOA 2CBJA 3GWHA 5HEJA 3AE7A 3ANWA 2HHHT 3DJBA 5CGMA 4ASKA 2X9YA 5TAOA 3A7MA 2NP9A 2FUPA 5JR9C 3PU3A 2PMEA 3LK3B 4B6XA 5L3BB 2I4LA 4YPFA 4TUYE 4U7YA 2LT3A 5LYJE 3C98B 4UIGA 3FBLA 1Y01A 3RLFF 3FZLB 4P3OA 1JNRA 5C53B 3KFUA 2C5IT 3T8OA 2AKWB 2V7MA 3LK2B 5LP6E 2PG8A 4YRCA 1T8BA 1E1TA 4CN1A 2XQ3A 2W00A 1T72A 1H7CA 4LF7T 1FJGT 2AXDS 1ATIA 5HXCA 3RQUA 3TLUA 4OFZA 1BR4A 4LNSA 1MNDA 2IW5B 4GIWA 1H4SA 1KFYA 4LMLA 4NCXA 1E24A 3F57A 1ZOYA 4WBOA 1XMQT 2AE9A 4LFCT 3P7IA 2WWVA 4Q25A 4P74C 4JLEA 1EOVA 4DUZT 3MJXA 2A3DA 2D0UA 4LVIA 3E9HA 4XTYA 3KV5A 1I94T 2X0LB 5ABFB 4RDXA 2FJEA 1ZP0A 4XTWA 2ZNIA 2XAHB 3AE1A 1EQRA 2Q9QC 2E9XA 4Z90A 2ZMAA 2Y6XA 1HX8A 3PJAJ 4V1Av 3HKDE 1OXZA 4XTZA 5AQRB 4K87A 4U2ZA 4YSZA 1BR1A 2M6BA 5KNNA 3N2GE 3CIRA 4TV8E 4HVCA 2CXFA 3O1HA 5LHHB 3UH0A 3KBTA 4EYUA 4H2SA 2H7VC 2YU2A 4K0UA 4K88A 4LF8T 3MACA 3L8RA 4H9SE 2NTXA 2XZEA 4XEMA 2C5JA 4IIJE 3EABA 4YRQA 5IUXA 4HWHA 3ZCJA 2ZM2A 5IWAT 1WR6A 3ABVA 4ZI7E 2LKGA 5FKYA 3LG7A 3R6NA 2E64A 2CCQA 5AQVB 4ZI2C 2ZT6A 4N78D 5FP3A 1D1BA 4LVLA 2R6GF 3C4ZA 4KHZF 2VKOA 4P72A 3VKHA 2ZIOA 2C7IA 1HX1B 4QKNA 3G06A 2VVNA 3QO7A 3E0ZA 2CMRA 2ZZGA 4JI6T 1HG5A 2XTIA 2DJZA 2ZLYA 2K24A 1KMNA 5L2LA 2RHQB 5DABA 2WS3A 2EHOB 3B57A 3RKOA 4EX5A 1FMVA 2D9DA 1ZEEA 3PUZF 2B1EA 2W4XA 3MKDA 3GMIA 4AQFA 3TLTA 1US7B 3UFEA 2LKHA 3ESLA 3KVAA 1W9RA 4LMJA 4DR7T 4AISA 3K3OA 4HFVA 5HXHA 1HNZT 3TEHB 5LJMA 3WQZA 4JEUB 3SFDA 4LFBT 2CWYA 1J1JA 4DMVA 5DJQC 5FXXA 4HN9A 5LXTE 2DTHA 1WCRA 2V5CA 2CPTA 2ZM6T 2LOSA 3PDYA 2LLYA 3ZMSB 3AEFA 4CI1B 4CS2A 2ODRD 5FY1A 4HFHA 3J7Yq 3MF1A 5ELOA 5L4HA 5JR9A 4JI5T 4WYVA 4AKIA 3FZHB 4HFCA 2XQ6A 4H2YA 1HC7A 3EHZA 3SRZA 2BS2A 4DV4T 4MBQA 4JV5T 4PFOA 4CZZB 3CVRA 3HXYA 2NR4A 2BBJA 4H2XA 5ELNA 1EIYB 4DO0A 3JC6D 4XU1A 1J5WA 2A2FX 3RGLA 4LVJA 2CJ9A 3M4QA 2UXNB 4CN6A 5HCJA 3R84B 3AE4A 3IF8B 2CM0A 4TWAA 1GQEA 2NTYA 1BR0A 5JVDE 4HEAA 3IG2A 5C2TA 4H63V 3C51A 4PK5A 4X1KE 1IBKT 2BG9C 2FJBA 3B5MA 1SETA 3OTOT 2KWIB 3HY0A 4NUVA 3B13A 4GYRA 4DMWA 5J2TE 1VCTA 4P74A 4U72A 5LHGB 2J47A 4YRLA 4EO4A 3L09A 5JDLA 4A5XA 2P5IA 3UGTA 2DDZA 2LOPA 1HG2A 5CFBA 1NJ5A 5H6QB 1YQ3A 12ASA 5L3GB 3VBBA 4YDQA 1M7KA 4P75C 3RKWA 4QX7B 2WQYA 3EFRA 2Q9QA 2X67A 3P4SA 4JEHB 2VURA 1NEKA 1N34T 2MAWA 4TQDA 5JTGA 1D0ZA 4J2CA 2I6HA 5AQIB 3REXA 4Z8XA 2BZBA 4YJ3E 2CXLA 3VKGA 5FVKA 3EAMA 2DWKA 2X0HA 2CGHA 2CLYC 1IJ6A 2QHUA 4QX8B 2FJDA 4HWOA 1WU7A 1NWMX 1KMMA 3PE0A 3KV4A 3N9NA 2NW7A 3DSQA 2LJLA 4XZCA 3VRBA 5F8PA 2ZZEA 1KOGA 4K86A 4HWRA 4A97A 3V8KA 3ZT6A 2UU9T 3EI0A 2RHSB 2WAUA 3EDVA 3I0OA 3HRIA 4OHFA 3ZJ2A 4GK0E 4YJ2E 4ZZBA 4HWFA 4NUUA 4JI7T 4TZ4C 3AVRA 3N9QA 2Q7EA 4ZTUB 1KNRA 3HFZA 1WLXA 1X2GA 1JNZA 4KMCA 4I50E 2K3WA 4BA9A 4EB6E 3H3MA 5J1GA 2ZM8A 3NWIA 4LVKA 2XAGB 3RIFA 2V7IA 4IREA 1B70A 4XBFB 4UELA 3LSVA 2ZR2A 2W62A 5GONE 2OA5A 1IBMT 1WPYA 2V7JA 1U5PA 3U78A 2IC6A 2XAJB 1ADYA 2E41A 1BR2A 2E10A 2I4NA 3V7RA 2A9UA 3JCFA 2I4MA 2VWAA 2HPJA 1N33T 2E5AA 4AQGA 5LA6E 4IGUA 3L4GB 4CH4A 4GYSA 2OLTA 2E3CA 5E0OA 3MA9A 4BAYB 1YB3A 1ZV4X 1HNWT 4P1NA 3NEMA 3EVYA 2ALYB 3BQIA 3HXXA 1QUUA 2ODRC 3QC9A 3N5LA 1N9WA 2H89A 1M62A 1UCUA 1SESA 4HTEA 4KUMB 5HWYA 3RUXA 2WZIA 4HFDA 4QH1A 4UF0B 3RYCE 1E1OA 1LKXA 3NRYA 3FB2A 2XQ7A 1MNEA 2W67A 4YSYA 3JC6C 1BBWA 2ODUA 1HF8A 5FXWA 3LC0A 4JI1T 2UUAT 4L9IA 4O2BE 3ZSTA 2DQ0A 4X1IE 3AVSA 2XQ8A 2BG9A 2KSRA 4EZHA 2N2NA 2ARSA 5F5WA 5JREA 2BDEA 1SA0E 5AQTB 3PCOB 4OP0A 3QNUA 2VQET 4YRNA 2IMLA 2BG9E 1ZHCA 4H2WA 4RQEA 2XAFB 2IDOB 3AAIA 4BWAA 4O4LE 3OYZA 3V8LA 1E1HB 2YINA 1LYLA 2YOEA 2JQ9A 3AE9A 4ZHQE 3RC8A 2N1GA 2VK9A 1QLBA 3RX6A 4AKGA 3UUBA 2YKSA 4P75A 1VCSA 2XJ7A 4TX5A 1DU2A 3NKZA 2JPFA 3I1AA 3A32A 4PJLA 2QGSA 3I0QA 4U3CA 1YW0A 2CHNA 4KP3C 3E22E 2XASB 3QOFA 1FEWA 3PUWF 5EK2A 2D2SA 1JJCA 5LBQB 4IDZA 1EZ3A 3LSSA 1CUNA 3MEYA 3LFMA 2XPKA 5JDMA 2WM9A 2C0SA 1WLEA 3RRWA 3GN5A 2V8SV 4IHJE 3O1IA 2J1DG 5DQVA 2VL8A 3ZMUB 2DZCA 2WDQA 2XSBA 3V8JA 2WCAA 4G2AA 3ICAA 3EUHA 3K3QC 2IC9A 2HH7A 1USYC 4NXMT 4AQYT 3ZKRA 4DUYT 4HWSA 3VQVA 3PUGA 3VU7H 4RQFA 2X9WA 5LGNB 3CX7B 4QWNB 2D0TA 3VQYA 1D0YA 4ZTZB 4B3MT 3UT5E 3P8TA 4YCVA 4UVCB 4EEBA 4OK0A 4CS4A 3A74A 2AMCA 5L3CB 4H9NC 3RKGA 4YTNA 5C8YE 4PFPA 4DR3T 3RIRA 4AKLA 1WR0A 5HEUA 5L4EA 4I4TE 3UQ4A 1MIWA 4NIQA 3JAFA 2YDQA 4EV6A 1IAPA 3AAAB 4ZIBA 2DKGA 2RP4A 2JQQA 4DV7T 3CMQA 2YEVC 3A8YC 4HKAA 4U74A 4KHPT 3LK42 4NXNT 3Q5EA 3EFSA 5JDNA 1YKEB 2E8IA 3KBUA 1ASZA 1V9DA 3F2EA 3UUXB 2E1HA 2EJFA 3FXEB 3ZMVB 2XAQB 2P9BA 1MIVA 4G85A 2BVMA 2N9DA 3V5UA 3ZPOA 3PJAA 3RRCA 4IDQA 3QB5K 1D1AA 3I7FA 1XZYA 4WZXA 3BJUA 2DI4A 4KR3A 1G5IA 1YGBA 3L39A 3PURA 1X56A 5J0ZA 5HCMA 1Y64B 2QVAA 4YROA 2DVEA 4QXHB 1Z7MA 2QYWA 4JI3T 3CX8B 2UXCT 4CH5A 3RYHE 3Q5DA 2VQFT 3PUQA 2JMKA 2JQHA 5CA1E 2LSIA 3PUAA 3WAKA 4IE6A 4O2DA 3QNEA 4XU3A 1WQWA 2KINB 3REUA 4Z91A 2VASA 2XTLA 3FHNA 4CI2B 3TLSA 3AECA 2EHOD 3AXJB 2EWNA 5EK3A 5JDHA 2DU7A 4PK6A 2CXDA 3OKQA 3VQWA 3PUVF 3ANWB 3ONJA 4ZS2A 1G73A 1ADJA 1QF6A 3OD1A 2LSJA 1YFRA 2XQ5A 1WFDA 5AQJB 3H3AA 2WWUA 3ZJ1A 3RH3A 4COFA 2Y8DA 4DR6T 3RC3A 4YRFA 5AQGB 1I6ZA 4BW9A 4PW8A 3ZT7A 1OEDC 4AKRB 2X0YA 3CKDA 1H4VB 2MPKA 2IUBA 4XU0A 1SHZC 4U33A 3A5YA 1GGMA 4PG3A 4DR1T 2EL9A 3TLVA 4ISSA 3AEBA 4P71C 4WI1A 1O3XA 3PTRB 1MMNA 2VKJA 1E7PA 5FY7A 3A31A 2ZT8A 3AEEA 1UX5A 2IIUA 3ZC1A 5C3JA 1W0AA 3CMLA 5HXSA 2WY2A 2ZGWA 1XMOT 1W09A 3M4PA 3ZYLA 5ABGA 2UXDT 4DR2T 3UUNA 3Q5XA 3RKXA 3FXDB 3UU4A 3PUXF 4YRRA 3ZC0A 4HWTA 3JADA 3UU8A 3NENA 3K8PC 1WRDA 2W2UA 2E9XB 2WSSV 3KDSE 3D0TA 4ILAA 4GKKT 3HXWA 4JI8T 1USYA 4MLKA 1SRYA 4JI0T 2QA7A 4JI2T 1NENA 5LMUT 5JRCA 5AQNB 1WNLA 1Z0PA 4MHCA 1YFTA 1E22A 3JAEA 1HCIA 4PAGA 3N9LA 3QO5A 4CQIA 4HT4A 1XNQT 3OBVE 4IDOA 5ADXL 3RYIE 3HL6A 4CXXA 3CWZB 2ZNJA 3NZPA 4DPGA 4OLFA 1SUMB 4DV3T 4CN4A 1N36T 1WQ7A 2LSKA 3MXZA 4F6RC 4X62T 1VRBA 4Q15A 2E2AA 3UU6A 4DBQA 2K9AA 3C4WA 1SE7A 4IE0A 1B7TA 4WJ4A 5LG3A 1NNHA 5K1PA 5AQUB 2KZ7B 3EDUA 4YYEA 2F4VT 2V6YA 3CK6A 4GOUA 2ACXA 3ZSSA 1PYSA 2E65A 3LBXA 3UTKA 2V1DB 4TV9E 3HKEE 2KXPB 3HXZA 3P8VA 4YRIA 3ETUA 4KI0F 4O2AE 3ZEFB 4H9QC 3DTOA 2ZTGA 3OYXA 2WU2A 4RMFA 2LM2A 1IL2A 1YD8G 4ISTA 2JRKA 2V7KA 4XEOA 5BR8T 4LF6T 1FMWA 5EZYE 4OX9T 1WYBA 3FZFB 3IHRA 3O9XA 4YRMA 4E7ZA 2VKHA 2J62A 1BIAA 4J15A 2JQKA 1HTJF 4E51A 4YRPA 4WJ3M 2QRXA 3NBXX 5FL1A 4CS3A 4B3TT 2EHOC 4TTVA 2IY5A 3ZMZB 2C8MA 2Q5HA 4H2UA 4IDPA 2P0LA 2DWGA 1U4QA 5JR9B 5JDQA 1UK5A 5JDFA 4EOZB 4JYAT 1X55A 5AQLB 3V7CA 4ZXLA 2J4GA 2XQAA 4MFRA 3OPCA 3W3SA 2QHSA 2BS3A 1KEYA 4JUYA 1OEDA 4H2XB 4HFBA 3SOLA 5JH7E 4X5TA 2MOZA 3SS1A 1B7YA 1OEDE 2Q7GA 3AE5A 1NJ6A 3P4PA 3ZLIA 2ES0A 2OV9A 4P71A 4ERRA 2YU1A 4WNKA 2X9HA 3T1HT 2UXBT 2MTQA 2QHVA 1HTTA 3VR8A 3Q9DA 5AQSB 3HTZA 3I9YA 3VR9A 4HE8A 2LE8A 4ZEYA 3UFGA 3ZT5A 1J5ET 2ZCEA 5HAXA 2AKWA 3TEGA 4WW0A 4IL9A 2MYSA 4XTVA 5AQFB 2LSYA 1X2HA 11ASA 2BKPA 4ZS3A 2BKNA 5ABEA 4UV9B 1NYQA 2IHR1 3H37A 5KX5E 1HNXT 2ZT5A 3ONLC 4O4JE 4H2VA 5HEHA 3FZMB 1H4TA 5LCYA 3AEDA 1YKHB 2NW9A 4YCWA 3V5SA 2WP9A 4KBMB 4PNIA 1W66A 5HWXA 3IALA 3RYFE 3ONXA 2ZIMA 2XQ4A 1R8IA 5ABFA 1EVKA 5KMGP 2PMFA 2JJ9A 4H02A 2XM2A 3E08A 3N2KE 4LMKA 3RIUC 2PJQA 2JIWA 5M4YA 1HS7A 3TUPA 4UXNB 4B3RT 4I43B 4C90A 4TVYA 2PBIA 1UUSA 4ANJA 3VHLA 4U7IA 2JMHA 2X66A 3LDQB 3MZKB 4BJNA 2CA5A 3RHWA 1NAFA 1MIYA 4G84A 5AQKB 4X5OA 4MALA 1VQZA 5HXEA 3ZN1B 4XTXA 3UUMA 3QO8A 3Q5WA 1NJ1A 3HFZB 1UX4A 2ZINA 2FJAA 3GA8A 3BK9A 3T1YT 4E7SA 1L0WA 3AA6B 1BIBA 2YN6A 1WYCA 2WMOA 2V5DA 4YSXA 3HY1A 2ZT7A 4UP8A 3C4XA 3L1AA 4IE7A 2LHRA 4L0RA 2E5LT 4PHCA 2DHRA 2GK9A 4OYJA 4DV6T 4DV5T 2X9XA 4AI6A 1FYFA 4ZI3D 4GK5E 4F8HA 2DXTA 2DU5A 1RIQA 2M67A 1NJ2A 3C64A 2ODVA 4LF9T 3F31A 3AE2A 2RHQA 4EGWA 3ZCIA 4XU2A 2EHOA 4UVAB 4KR2A 3ZYKA 2WBLA 2CJBA 3M65A 5IYZE 2EAYA 5LNKA 2DL1A 2KLQA 3RKYA 4H9PC 5DQWA 4IE4A 1D0XA 4QH5A 5AQQB 2WMNA 3UULA 1G8XA 4O8SA 4TVAB 2XY8B 3AE6A 2G4CA 1S35A 1YFSA 1T7SA 1B76A 3TEHA 3QUJA 1LVFA 2NW8A 3BFMA 4ILCA 3O4XE 4DIDB 3W15B 3HRKA 3HFVA 4IDNA 3N9MA 4EIWA 4YREA 2DZ9A 1XDPA 3HXVA 5CJ5A 1G51A 2KMFA 2K5BB 2W63A 5L3EB 3SWHA 1HR0T 2LHNA 3BQKA 4H2TA 3K3NA 4H63H 3AB3B 2DCFA 4P3PA 4TVWA 1HFAA 2PFVA 3PZCA 3HKBE 2A8EA 2BG9B 3RL6A 2XUEA 3P8CD 5ABHA 4P0BA 4ZOLE 4EZ4A 2HNIA 1IJ5A 2VKDA 1SERA 3RI5A 5KDMC 1EIYA 4NPPA 3RACA 5H6RB 4O4HE 1L0VA 4OYKA 1NYRA 2CE7A 4P09A 3KV6A 4Q6GA 2LEHA 2V6XA 4IE5A 5A1LA 5C52B 1T98A 1HXDA 1KF6A 3J9X1 4UV8B 1S94A 4JBWF 1CHUA 3HI2A 2NS6A 1X79A 4A98A 4LVMA 1QE0A 3N9PA 3P50A 1JJCB 2CLYB
chains in the Genus database with same CATH topology
2ZXFA 1WQ7A 2PMEA 2I4LA 4YPFA 3NELA 2ZZFA 3L4GB 4CH4A 3P8YA 4Q15A 2E3CA 1YB3A 3A7AA 2DEQA 4P3OA 4WJ4A 3NEMA 5C53B 1NNHA 5K1PA 3KFUA 2I4OA 2ALYB 3HXXA 2AKWB 2ODRC 4YYEA 4YRCA 4YRSA 1N9WA 1E1TA 1PYSA 1C0AA 2E65A 1SESA 3HXZA 3RUXA 4P73C 1ATIA 2J3MA 3LSQA 3P8VA 1E1OA 4LNSA 2ZR3A 4YRIA 1H4SA 2AMCB 4UP7A 4NCXA 1E24A 2ZTGA 2FYKA 4RMFA 3G1ZA 1IL2A 1BBWA 4P74C 3FJPA 4XEOA 3MF2A 3LC0A 1EOVA 1X01A 2DQ0A 4LVIA 3E9HA 4XTYA 2RHSA 4YRMA 1BIAA 4J15A 4RDXA 2ARSA 5F5WA 4E51A 4YRPA 4WJ3M 3PCOB 4OP0A 4XTWA 4CS3A 2ZNIA 4YRNA 4H2WA 4TTVA 2IY5A 1EQRA 5HGQA 4RQEA 4BWAA 2C8MA 2Q5HA 3V8LA 4H2UA 4L87A 2P0LA 4XTZA 1LYLA 4K87A 5C51B 5KNNA 1X55A 3V7CA 4HVCA 4YRKA 2DQ3A 3UH0A 4P3NA 3W3SA 4H2SA 2QHSA 4P75A 4K88A 4XEMA 4H2XB 2J3LA 3IKMB 2Q7HA 3A32A 4UP9A 2DTIA 4YRQA 1B7YA 2Q7GA 1NJ6A 4YP0A 2EJGA 2XGTA 1JJCA 4P71A 2E64A 4HWPA 2ZT6A 3LSSA 1EFWA 3MEYA 5K1XA 4LVLA 3E9IA 1WLEA 2QHVA 1HTTA 3L4GA 4CH3A 4P72A 2DZCA 3HTZA 4HA8A 3V8JA 2ZIOA 3ICAA 2C7IA 3UFGA 1BBUA 2ZCEA 2ALYA 3QO7A 2AKWA 3TEGA 1USYC 2ZZGA 4HWSA 4XTVA 2XTIA 2DJZA 3VQVA 1KMNA 4RQFA 1X2HA 2RHQB 11ASA 3VQYA 4ZTZB 4XTUA 2QHTA 4EX5A 3P8TA 4YCVA 4CS4A 1NYQA 3A74A 2AMCA 1X54A 3QTCA 2ZT5A 3RIRA 4H2VA 1H4TA 4YCWA 4ZIBA 3TEHB 2DKGA 3CMQA 3WQZA 1W66A 3IALA 4UPAA 1H4QA 2ZIMA 2DXUA 1B8AA 1EVKA 4TQFA 2PMFA 3EFSA 1WYDA 2DTHA 1ASZA 4H02A 3PCOA 3TUPA 1Z7NA 2ARTA 2E1HA 2EJFA 4CS2A 3NETA 2ODRD 4TVYA 4G85A 3MF1A 5ELOA 1G5HA 3A7RA 3A7UA 3I7FA 4H2YA 4G84A 3BJUA 1HC7A 1G5IA 4X5OA 4KR3A 3RF1A 1VQZA 1YGBA 1X56A 4XTXA 3A5ZA 3QO8A 1NJ1A 3HXYA 3HFZB 4YROA 2ZINA 2DVEA 4H2XA 1Z7MA 4YCUA 5ELNA 1EIYB 4XU1A 1J5WA 3RGLA 4CH5A 4LVJA 2CJ9A 3M4QA 1ASYA 1L0WA 4TWAA 1BIBA 4O2DA 3QNEA 4P73A 3IG2A 4XU3A 4AH6A 2CJAA 1WQWA 3REUA 1SETA 2DTOA 3HY0A 3HY1A 2ZT7A 4UP8A 2EWNA 3L1AA 2DU7A 4PHCA 4P74A 3VQWA 4EO4A 4YRLA 1ADJA 1QF6A 3OD1A 1FYFA 1YFRA 2DXTA 2DU5A 1RIQA 2P5IA 3UGTA 1NJ2A 2DDZA 1NJ5A 12ASA 3VBBA 4YDQA 4YRFA 2RHQA 4BW9A 3VQXA 4XU2A 4P75C 3RKWA 4KR2A 3EFRA 3UGQA 2CJBA 4YRJA 1H4VB 2EAYA 4XU0A 4TQDA 1PYSB 3A5YA 3RKYA 1GGMA 4PG3A 2EL9A 3REXA 4TVAB 4TVAA 2G4CA 1YFSA 3TEHA 3L2ZA 1B76A 4CH6A 4P71C 2CGHA 2EJ9A 4WI1A 3BFMA 2ARUA 2QHUA 3HRKA 3HFVA 1EVLA 4HWOA 1WU7A 1KMMA 3A31A 2ZT8A 4YREA 2DZ9A 3HXVA 3DSQA 1G51A 2ZZEA 1KOGA 3R07A 2Q5IA 4P72C 4H2TA 4P3PA 2ZGWA 4K86A 4TVWA 4DQ2A 4HWRA 3V8KA 3M4PA 3PZCA 1NJ8A 2RHSB 2CIMA 2A8EA 3RL6A 3RKXA 4YRGA 3HRIA 4YRRA 4HWTA 3NENA 2HNIA 5E3IA 2IY5B 4WF2A 2Q7EA 1SERA 4ZTUB 3HFZA 1EIYA 1X2GA 3RACA 3HXWA 1USYA 1SRYA 4YRTA 3MQZA 1NYRA 3V7SA 4LVKA 4KQEA 1WNLA 3IKLA 1YFTA 4Q6GA 1E22A 1B70B 1B70A 5C52B 2ZR2A 3QO5A 4HT4A 1HXDA 1WPYA 1B7YB 3HXUA 2NS6A 2ZNJA 3ERRA 1ADYA 2E41A 4DPGA 4OLFA 2E10A 4LVMA 1QE0A 1JJCB 2I4NA 3V7RA 2I4MA 2E5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXF A;  1WQ7 A;  2PME A;  2I4L A;  4YPF A;  3NEL A;  2ZZF A;  3L4G B;  4CH4 A;  3P8Y A;  4Q15 A;  2E3C A;  1YB3 A;  3A7A A;  2DEQ A;  4P3O A;  4WJ4 A;  3NEM A;  5C53 B;  1NNH A;  5K1P A;  3KFU A;  2I4O A;  2ALY B;  3HXX A;  2AKW B;  2ODR C;  4YYE A;  4YRC A;  4YRS A;  1N9W A;  1E1T A;  1PYS A;  1C0A A;  2E65 A;  1SES A;  3HXZ A;  3RUX A;  4P73 C;  1ATI A;  2J3M A;  3LSQ A;  3P8V A;  1E1O A;  4LNS A;  2ZR3 A;  4YRI A;  1H4S A;  2AMC B;  4UP7 A;  4NCX A;  1E24 A;  2ZTG A;  2FYK A;  4RMF A;  3G1Z A;  1IL2 A;  1BBW A;  4P74 C;  3FJP A;  4XEO A;  3MF2 A;  3LC0 A;  1EOV A;  1X01 A;  2DQ0 A;  3E9H A;  4XTY A;  2RHS A;  4YRM A;  1BIA A;  4J15 A;  4RDX A;  2ARS A;  5F5W A;  4E51 A;  4YRP A;  4WJ3 M;  3PCO B;  4OP0 A;  4XTW A;  4CS3 A;  2ZNI A;  4YRN A;  4H2W A;  4TTV A;  2IY5 A;  1EQR A;  5HGQ A;  4RQE A;  4BWA A;  2C8M A;  2Q5H A;  3V8L A;  4H2U A;  4L87 A;  2P0L A;  4XTZ A;  1LYL A;  4K87 A;  5C51 B;  5KNN A;  1X55 A;  3V7C A;  4HVC A;  4YRK A;  2DQ3 A;  3UH0 A;  4P3N A;  3W3S A;  4H2S A;  2QHS A;  4P75 A;  4K88 A;  4XEM A;  4H2X B;  2J3L A;  3IKM B;  2Q7H A;  3A32 A;  4UP9 A;  2DTI A;  4YRQ A;  1B7Y A;  2Q7G A;  1NJ6 A;  4YP0 A;  2EJG A;  2XGT A;  1JJC A;  4P71 A;  2E64 A;  4HWP A;  2ZT6 A;  3LSS A;  1EFW A;  3MEY A;  5K1X A;  3E9I A;  1WLE A;  2QHV A;  1HTT A;  3L4G A;  4CH3 A;  4P72 A;  2DZC A;  3HTZ A;  4HA8 A;  3V8J A;  2ZIO A;  3ICA A;  2C7I A;  3UFG A;  1BBU A;  2ZCE A;  2ALY A;  3QO7 A;  2AKW A;  3TEG A;  1USY C;  2ZZG A;  4HWS A;  4XTV A;  2XTI A;  2DJZ A;  3VQV A;  1KMN A;  4RQF A;  1X2H A;  2RHQ B;  11AS A;  3VQY A;  4ZTZ B;  4XTU A;  2QHT A;  4EX5 A;  3P8T A;  4YCV A;  4CS4 A;  1NYQ A;  3A74 A;  2AMC A;  1X54 A;  3QTC A;  2ZT5 A;  3RIR A;  4H2V A;  1H4T A;  4YCW A;  4ZIB A;  3TEH B;  2DKG A;  3CMQ A;  3WQZ A;  1W66 A;  3IAL A;  4UPA A;  1H4Q A;  2ZIM A;  2DXU A;  1B8A A;  1EVK A;  4TQF A;  2PMF A;  3EFS A;  1WYD A;  2DTH A;  1ASZ A;  4H02 A;  3PCO A;  3TUP A;  1Z7N A;  2ART A;  2E1H A;  2EJF A;  4CS2 A;  3NET A;  2ODR D;  4TVY A;  4G85 A;  3MF1 A;  5ELO A;  1G5H A;  3A7R A;  3A7U A;  3I7F A;  4H2Y A;  4G84 A;  3BJU A;  1HC7 A;  1G5I A;  4X5O A;  4KR3 A;  3RF1 A;  1VQZ A;  1YGB A;  1X56 A;  4XTX A;  3A5Z A;  3QO8 A;  1NJ1 A;  3HXY A;  3HFZ B;  4YRO A;  2ZIN A;  2DVE A;  4H2X A;  1Z7M A;  4YCU A;  5ELN A;  1EIY B;  4XU1 A;  1J5W A;  3RGL A;  4CH5 A;  2CJ9 A;  3M4Q A;  1ASY A;  1L0W A;  4TWA A;  1BIB A;  4O2D A;  3QNE A;  4P73 A;  3IG2 A;  4XU3 A;  4AH6 A;  2CJA A;  1WQW A;  3REU A;  1SET A;  2DTO A;  3HY0 A;  3HY1 A;  2ZT7 A;  4UP8 A;  2EWN A;  3L1A A;  2DU7 A;  4PHC A;  4P74 A;  3VQW A;  4EO4 A;  4YRL A;  1ADJ A;  1QF6 A;  3OD1 A;  1FYF A;  1YFR A;  2DXT A;  2DU5 A;  1RIQ A;  2P5I A;  3UGT A;  1NJ2 A;  2DDZ A;  1NJ5 A;  12AS A;  3VBB A;  4YDQ A;  4YRF A;  2RHQ A;  4BW9 A;  3VQX A;  4XU2 A;  4P75 C;  3RKW A;  4KR2 A;  3EFR A;  3UGQ A;  2CJB A;  4YRJ A;  1H4V B;  2EAY A;  4XU0 A;  4TQD A;  1PYS B;  3A5Y A;  3RKY A;  1GGM A;  4PG3 A;  2EL9 A;  3REX A;  4TVA B;  4TVA A;  2G4C A;  1YFS A;  3TEH A;  3L2Z A;  1B76 A;  4CH6 A;  4P71 C;  2CGH A;  2EJ9 A;  4WI1 A;  3BFM A;  2ARU A;  2QHU A;  3HRK A;  3HFV A;  1EVL A;  4HWO A;  1WU7 A;  1KMM A;  3A31 A;  2ZT8 A;  4YRE A;  2DZ9 A;  3HXV A;  3DSQ A;  1G51 A;  2ZZE A;  1KOG A;  3R07 A;  2Q5I A;  4P72 C;  4H2T A;  4P3P A;  2ZGW A;  4K86 A;  4TVW A;  4DQ2 A;  4HWR A;  3V8K A;  3M4P A;  3PZC A;  1NJ8 A;  2RHS B;  2CIM A;  3RL6 A;  3RKX A;  4YRG A;  3HRI A;  4YRR A;  4HWT A;  3NEN A;  2HNI A;  5E3I A;  2IY5 B;  4WF2 A;  2Q7E A;  1SER A;  4ZTU B;  3HFZ A;  1EIY A;  1X2G A;  3RAC A;  3HXW A;  1USY A;  1SRY A;  4YRT A;  1NYR A;  3V7S A;  4KQE A;  1WNL A;  3IKL A;  1YFT A;  4Q6G A;  1E22 A;  1B70 B;  1B70 A;  5C52 B;  2ZR2 A;  3QO5 A;  1HXD A;  1WPY A;  1B7Y B;  3HXU A;  2ZNJ A;  3ERR A;  1ADY A;  2E41 A;  4DPG A;  4OLF A;  2E10 A;  1QE0 A;  1JJC B;  2I4N A;  3V7R A;  2I4M A;  2E5A A; 
#chains in the Genus database with same CATH topology
 2BBH A;  3AEG A;  2ZXF A;  4DBR A;  4CXY A;  4EAH A;  3KV9 A;  5FYM A;  3NEL A;  2ZZF A;  4EXT A;  2BS4 A;  3GN5 B;  2WU5 A;  3P8Y A;  2L3L A;  5HEG A;  4DND A;  3RIU A;  3A7A A;  4X66 T;  2DEQ A;  4ILB A;  3AAE B;  3CQX C;  2I4O A;  3AA1 B;  3C50 A;  3CQG B;  5LMN T;  2MBG A;  4H9O C;  4IT4 A;  4YRS A;  4AIU A;  1C0A A;  3NRX A;  4L5G A;  3IBP A;  3PUY F;  3SFE A;  4YHH T;  4P73 C;  2J3M A;  3LSQ A;  2ZR3 A;  3RPU A;  3P4W A;  2DNX A;  2ZM0 A;  2AMC B;  1D1C A;  3DP7 A;  4UP7 A;  1FIO A;  4HWI B;  2UUB T;  2FYK A;  3G1Z A;  3L3P A;  2WDR A;  4PK4 A;  2HN1 A;  2E9X D;  2V26 A;  4YTP A;  3FJP A;  3MF2 A;  4HFE A;  4ZZC A;  1X01 A;  1KK7 A;  4B3S T;  2RHS A;  1UUR A;  5AQP B;  3VRA A;  4M1P A;  4A56 A;  4CXW A;  5BMV E;  4U2Y A;  2C5K T;  5HGQ A;  2CEA A;  3I9W A;  5JQG E;  3NZQ A;  4L87 A;  4ZI3 C;  5C51 B;  2KND A;  2IAK A;  2WDV A;  3TKL B;  3CX6 B;  5JDG A;  5LHI B;  5F3J A;  3RQW A;  1KNZ A;  4YRK A;  2DQ3 A;  3CPZ A;  4P3N A;  1W0B A;  2WZH A;  4WBN E;  2DLR A;  3M3Z B;  5LGU B;  3ZMT B;  2X68 A;  2J3L A;  1XDO A;  3QK6 A;  3IKM B;  2PTF A;  2Q7H A;  4UP9 A;  3P4Q A;  5L3F B;  2DTI A;  4DR5 T;  3UQ7 A;  4YP0 A;  2EJG A;  5FVL A;  1KNP A;  2XGT A;  4IL4 A;  4HWP A;  3S4U A;  4DV0 T;  2SPC A;  1EFW A;  5KXJ A;  5K1X A;  2ACZ A;  4ADZ A;  3E9I A;  2I0M A;  3FBZ A;  5L47 A;  2RA1 A;  5HEO A;  3AA7 B;  3L4G A;  2LM9 A;  2BKO A;  3PU8 A;  4CH3 A;  4X64 T;  4HA8 A;  3WAJ A;  1XNR T;  5AQO B;  2X51 A;  2YDS A;  1BBU A;  2ALY A;  2H7O A;  3IA3 A;  2HPL A;  4YXD A;  3PV0 F;  4U31 A;  2M6I A;  2H88 A;  2L9Q A;  3KFW X;  3AE3 A;  4ILU A;  5CA0 E;  4PJM A;  4I0U A;  4XTU A;  2H3R A;  4UF0 A;  4AKH A;  2QHT A;  3X1D A;  2E5V A;  5LOV E;  4QXB B;  1X54 A;  1MMA A;  3QTC A;  4LF4 T;  5LB7 B;  2K48 A;  4HWC A;  3RIA A;  4YTM A;  1E2A A;  3TLW A;  2FBW A;  2XSA A;  4UPA A;  1H4Q A;  5FMN A;  5FL0 A;  2DXU A;  3CQC B;  4GKJ T;  2XQY A;  4C91 A;  1B8A A;  2L8K A;  2VL0 A;  4TQF A;  4HWD A;  5FXV A;  4PJJ A;  2XQ9 A;  4TWD A;  1IBL T;  2XM1 A;  1WYD A;  3PCO A;  2XHE B;  3U3I A;  1Z7N A;  4UVB B;  5LJN A;  2ART A;  3NET A;  4UEM A;  4XAX B;  4O4I E;  3ZYM A;  1G5H A;  1QSD A;  3A7R A;  3A7U A;  1Z8U A;  3BQL A;  1X9B A;  3RF1 A;  4DV2 T;  4JI4 T;  3P4R A;  3WI3 A;  3A5Z A;  4QH4 A;  4YHJ A;  3HR0 A;  1XWM A;  3K1S A;  4YCU A;  4YT0 A;  2CBI A;  4BJM A;  2CWO A;  2LRL A;  3PUS A;  5EK4 A;  2W61 A;  1ASY A;  5L3D B;  4G63 A;  1OWA A;  5AQH B;  5JRC B;  4FJO A;  5ETW A;  3AEA A;  4KX6 A;  4DV1 T;  4P73 A;  4TN7 B;  4QXC B;  1YXR A;  4AH6 A;  2CJA A;  4TWH A;  4LFA T;  3KIN B;  2A72 A;  3AE8 A;  2DTO A;  4TWF A;  1MMD A;  3LJC A;  5AFU L;  2VB6 A;  2RPA A;  2Q9Q D;  3OVU A;  2Y48 B;  3ETV A;  1AJ3 A;  5LGT B;  2YDR A;  4H9R C;  5HYA A;  2E9X C;  2LSG A;  4YY3 T;  2LRK A;  1IZN B;  2WB5 A;  4QHO A;  2KT9 A;  3N2O A;  3UU5 A;  2HN2 A;  1LRZ A;  2W66 A;  2UUC T;  3VQX A;  5IHY A;  4HGA A;  2B76 A;  3Q2M A;  3UGQ A;  2Q9Q B;  3OJA A;  5LBM A;  4YRJ A;  4FI5 A;  2Z6E A;  4DR4 T;  2V6Y B;  3N9O A;  1PYS B;  3ZN0 B;  3QB5 A;  3LBX B;  4TVA A;  4AXP A;  4ZI2 D;  2NOX A;  3L2Z A;  2I59 A;  4CH6 A;  2EJ9 A;  4TNV A;  5FXZ A;  2ARU A;  4X20 E;  4EYY R;  2KWH A;  1MMG A;  1ZKE A;  1EVL A;  4UR9 A;  2YK0 A;  3R07 A;  2Q5I A;  4P72 C;  4P0A A;  5LG4 A;  4TNW A;  4DQ2 A;  3FZK B;  4X65 T;  2G0U A;  5CB4 E;  3KVB A;  1NJ8 A;  2CRB A;  4YFS A;  3IEE A;  1N32 T;  2CIM A;  2D5U A;  1UGO A;  3O1J A;  4YRG A;  2UXX B;  4EED A;  4YLH A;  4LF5 T;  1YQ4 A;  5E3I A;  2IY5 B;  1VOM A;  2W0G A;  4WF2 A;  3MK7 C;  2NWB A;  5HXR A;  2VVS A;  4AQF C;  4CI3 B;  2BVL A;  3HKC E;  3MQZ A;  4YRT A;  4K0K T;  3V7S A;  4DVD A;  4KQE A;  3IKL A;  3AA0 B;  1LVK A;  4X1Y E;  1B70 B;  1OED B;  5FY0 A;  3A5X A;  3NVO A;  5AQM B;  4HFI A;  3HA4 A;  4I55 E;  1B7Y B;  3HXU A;  3AXJ A;  4PJN A;  3UU3 A;  5FNV E;  5J2U E;  2V7L A;  3ERR A;  2CHO A;  2CBJ A;  3GWH A;  5HEJ A;  3AE7 A;  3ANW A;  2HHH T;  3DJB A;  5CGM A;  4ASK A;  2X9Y A;  5TAO A;  3A7M A;  2NP9 A;  2FUP A;  5JR9 C;  3PU3 A;  2PME A;  3LK3 B;  4B6X A;  5L3B B;  2I4L A;  4YPF A;  4TUY E;  4U7Y A;  2LT3 A;  5LYJ E;  3C98 B;  4UIG A;  3FBL A;  1Y01 A;  3RLF F;  3FZL B;  4P3O A;  1JNR A;  5C53 B;  3KFU A;  2C5I T;  3T8O A;  2AKW B;  2V7M A;  3LK2 B;  5LP6 E;  2PG8 A;  4YRC A;  1T8B A;  1E1T A;  4CN1 A;  2XQ3 A;  2W00 A;  1T72 A;  1H7C A;  4LF7 T;  1FJG T;  2AXD S;  1ATI A;  5HXC A;  3RQU A;  3TLU A;  4OFZ A;  1BR4 A;  4LNS A;  1MND A;  2IW5 B;  4GIW A;  1H4S A;  1KFY A;  4LML A;  4NCX A;  1E24 A;  3F57 A;  1ZOY A;  4WBO A;  1XMQ T;  2AE9 A;  4LFC T;  3P7I A;  2WWV A;  4Q25 A;  4P74 C;  4JLE A;  1EOV A;  4DUZ T;  3MJX A;  2A3D A;  2D0U A;  4LVI A;  3E9H A;  4XTY A;  3KV5 A;  1I94 T;  2X0L B;  5ABF B;  4RDX A;  2FJE A;  1ZP0 A;  4XTW A;  2ZNI A;  2XAH B;  3AE1 A;  1EQR A;  2Q9Q C;  2E9X A;  4Z90 A;  2ZMA A;  2Y6X A;  1HX8 A;  3PJA J;  4V1A v;  3HKD E;  1OXZ A;  4XTZ A;  5AQR B;  4K87 A;  4U2Z A;  4YSZ A;  1BR1 A;  2M6B A;  5KNN A;  3N2G E;  3CIR A;  4TV8 E;  4HVC A;  2CXF A;  3O1H A;  5LHH B;  3UH0 A;  3KBT A;  4EYU A;  4H2S A;  2H7V C;  2YU2 A;  4K0U A;  4K88 A;  4LF8 T;  3MAC A;  3L8R A;  4H9S E;  2NTX A;  2XZE A;  4XEM A;  2C5J A;  4IIJ E;  3EAB A;  4YRQ A;  5IUX A;  4HWH A;  3ZCJ A;  2ZM2 A;  5IWA T;  1WR6 A;  3ABV A;  4ZI7 E;  2LKG A;  5FKY A;  3LG7 A;  3R6N A;  2E64 A;  2CCQ A;  5AQV B;  4ZI2 C;  2ZT6 A;  4N78 D;  5FP3 A;  1D1B A;  4LVL A;  2R6G F;  3C4Z A;  4KHZ F;  2VKO A;  4P72 A;  3VKH A;  2ZIO A;  2C7I A;  1HX1 B;  4QKN A;  3G06 A;  2VVN A;  3QO7 A;  3E0Z A;  2CMR A;  2ZZG A;  4JI6 T;  1HG5 A;  2XTI A;  2DJZ A;  2ZLY A;  2K24 A;  1KMN A;  5L2L A;  2RHQ B;  5DAB A;  2WS3 A;  2EHO B;  3B57 A;  3RKO A;  4EX5 A;  1FMV A;  2D9D A;  1ZEE A;  3PUZ F;  2B1E A;  2W4X A;  3MKD A;  3GMI A;  4AQF A;  3TLT A;  1US7 B;  3UFE A;  2LKH A;  3ESL A;  3KVA A;  1W9R A;  4LMJ A;  4DR7 T;  4AIS A;  3K3O A;  4HFV A;  5HXH A;  1HNZ T;  3TEH B;  5LJM A;  3WQZ A;  4JEU B;  3SFD A;  4LFB T;  2CWY A;  1J1J A;  4DMV A;  5DJQ C;  5FXX A;  4HN9 A;  5LXT E;  2DTH A;  1WCR A;  2V5C A;  2CPT A;  2ZM6 T;  2LOS A;  3PDY A;  2LLY A;  3ZMS B;  3AEF A;  4CI1 B;  4CS2 A;  2ODR D;  5FY1 A;  4HFH A;  3J7Y q;  3MF1 A;  5ELO A;  5L4H A;  5JR9 A;  4JI5 T;  4WYV A;  4AKI A;  3FZH B;  4HFC A;  2XQ6 A;  4H2Y A;  1HC7 A;  3EHZ A;  3SRZ A;  2BS2 A;  4DV4 T;  4MBQ A;  4JV5 T;  4PFO A;  4CZZ B;  3CVR A;  3HXY A;  2NR4 A;  2BBJ A;  4H2X A;  5ELN A;  1EIY B;  4DO0 A;  3JC6 D;  4XU1 A;  1J5W A;  2A2F X;  3RGL A;  4LVJ A;  2CJ9 A;  3M4Q A;  2UXN B;  4CN6 A;  5HCJ A;  3R84 B;  3AE4 A;  3IF8 B;  2CM0 A;  4TWA A;  1GQE A;  2NTY A;  1BR0 A;  5JVD E;  4HEA A;  3IG2 A;  5C2T A;  4H63 V;  3C51 A;  4PK5 A;  4X1K E;  1IBK T;  2BG9 C;  2FJB A;  3B5M A;  1SET A;  3OTO T;  2KWI B;  3HY0 A;  4NUV A;  3B13 A;  4GYR A;  4DMW A;  5J2T E;  1VCT A;  4P74 A;  4U72 A;  5LHG B;  2J47 A;  4YRL A;  4EO4 A;  3L09 A;  5JDL A;  4A5X A;  2P5I A;  3UGT A;  2DDZ A;  2LOP A;  1HG2 A;  5CFB A;  1NJ5 A;  5H6Q B;  1YQ3 A;  12AS A;  5L3G B;  3VBB A;  4YDQ A;  1M7K A;  4P75 C;  3RKW A;  4QX7 B;  2WQY A;  3EFR A;  2Q9Q A;  2X67 A;  3P4S A;  4JEH B;  2VUR A;  1NEK A;  1N34 T;  2MAW A;  4TQD A;  5JTG A;  1D0Z A;  4J2C A;  2I6H A;  5AQI B;  3REX A;  4Z8X A;  2BZB A;  4YJ3 E;  2CXL A;  3VKG A;  5FVK A;  3EAM A;  2DWK A;  2X0H A;  2CGH A;  2CLY C;  1IJ6 A;  2QHU A;  4QX8 B;  2FJD A;  4HWO A;  1WU7 A;  1NWM X;  1KMM A;  3PE0 A;  3KV4 A;  3N9N A;  2NW7 A;  3DSQ A;  2LJL A;  4XZC A;  3VRB A;  5F8P A;  2ZZE A;  1KOG A;  4K86 A;  4HWR A;  4A97 A;  3V8K A;  3ZT6 A;  2UU9 T;  3EI0 A;  2RHS B;  2WAU A;  3EDV A;  3I0O A;  3HRI A;  4OHF A;  3ZJ2 A;  4GK0 E;  4YJ2 E;  4ZZB A;  4HWF A;  4NUU A;  4JI7 T;  4TZ4 C;  3AVR A;  3N9Q A;  2Q7E A;  4ZTU B;  1KNR A;  3HFZ A;  1WLX A;  1X2G A;  1JNZ A;  4KMC A;  4I50 E;  2K3W A;  4BA9 A;  4EB6 E;  3H3M A;  5J1G A;  2ZM8 A;  3NWI A;  4LVK A;  2XAG B;  3RIF A;  2V7I A;  4IRE A;  1B70 A;  4XBF B;  4UEL A;  3LSV A;  2ZR2 A;  2W62 A;  5GON E;  2OA5 A;  1IBM T;  1WPY A;  2V7J A;  1U5P A;  3U78 A;  2IC6 A;  2XAJ B;  1ADY A;  2E41 A;  1BR2 A;  2E10 A;  2I4N A;  3V7R A;  2A9U A;  3JCF A;  2I4M A;  2VWA A;  2HPJ A;  1N33 T;  2E5A A;  4AQG A;  5LA6 E;  4IGU A;  3L4G B;  4CH4 A;  4GYS A;  2OLT A;  2E3C A;  5E0O A;  3MA9 A;  4BAY B;  1YB3 A;  1ZV4 X;  1HNW T;  4P1N A;  3NEM A;  3EVY A;  2ALY B;  3BQI A;  3HXX A;  1QUU A;  2ODR C;  3QC9 A;  3N5L A;  1N9W A;  2H89 A;  1M62 A;  1UCU A;  1SES A;  4HTE A;  4KUM B;  5HWY A;  3RUX A;  2WZI A;  4HFD A;  4QH1 A;  4UF0 B;  3RYC E;  1E1O A;  1LKX A;  3NRY A;  3FB2 A;  2XQ7 A;  1MNE A;  2W67 A;  4YSY A;  3JC6 C;  1BBW A;  2ODU A;  1HF8 A;  5FXW A;  3LC0 A;  4JI1 T;  2UUA T;  4L9I A;  4O2B E;  3ZST A;  2DQ0 A;  4X1I E;  3AVS A;  2XQ8 A;  2BG9 A;  2KSR A;  4EZH A;  2N2N A;  2ARS A;  5F5W A;  5JRE A;  2BDE A;  1SA0 E;  5AQT B;  3PCO B;  4OP0 A;  3QNU A;  2VQE T;  4YRN A;  2IML A;  2BG9 E;  1ZHC A;  4H2W A;  4RQE A;  2XAF B;  2IDO B;  3AAI A;  4BWA A;  4O4L E;  3OYZ A;  3V8L A;  1E1H B;  2YIN A;  1LYL A;  2YOE A;  2JQ9 A;  3AE9 A;  4ZHQ E;  3RC8 A;  2N1G A;  2VK9 A;  1QLB A;  3RX6 A;  4AKG A;  3UUB A;  2YKS A;  4P75 A;  1VCS A;  2XJ7 A;  4TX5 A;  1DU2 A;  3NKZ A;  2JPF A;  3I1A A;  3A32 A;  4PJL A;  2QGS A;  3I0Q A;  4U3C A;  1YW0 A;  2CHN A;  4KP3 C;  3E22 E;  2XAS B;  3QOF A;  1FEW A;  3PUW F;  5EK2 A;  2D2S A;  1JJC A;  5LBQ B;  4IDZ A;  1EZ3 A;  3LSS A;  1CUN A;  3MEY A;  3LFM A;  2XPK A;  5JDM A;  2WM9 A;  2C0S A;  1WLE A;  3RRW A;  3GN5 A;  2V8S V;  4IHJ E;  3O1I A;  2J1D G;  5DQV A;  2VL8 A;  3ZMU B;  2DZC A;  2WDQ A;  2XSB A;  3V8J A;  2WCA A;  4G2A A;  3ICA A;  3EUH A;  3K3Q C;  2IC9 A;  2HH7 A;  1USY C;  4NXM T;  4AQY T;  3ZKR A;  4DUY T;  4HWS A;  3VQV A;  3PUG A;  3VU7 H;  4RQF A;  2X9W A;  5LGN B;  3CX7 B;  4QWN B;  2D0T A;  3VQY A;  1D0Y A;  4ZTZ B;  4B3M T;  3UT5 E;  3P8T A;  4YCV A;  4UVC B;  4EEB A;  4OK0 A;  4CS4 A;  3A74 A;  2AMC A;  5L3C B;  4H9N C;  3RKG A;  4YTN A;  5C8Y E;  4PFP A;  4DR3 T;  3RIR A;  4AKL A;  1WR0 A;  5HEU A;  5L4E A;  4I4T E;  3UQ4 A;  1MIW A;  4NIQ A;  3JAF A;  2YDQ A;  4EV6 A;  1IAP A;  3AAA B;  4ZIB A;  2DKG A;  2RP4 A;  2JQQ A;  4DV7 T;  3CMQ A;  2YEV C;  3A8Y C;  4HKA A;  4U74 A;  4KHP T;  3LK4 2;  4NXN T;  3Q5E A;  3EFS A;  5JDN A;  1YKE B;  2E8I A;  3KBU A;  1ASZ A;  1V9D A;  3F2E A;  3UUX B;  2E1H A;  2EJF A;  3FXE B;  3ZMV B;  2XAQ B;  2P9B A;  1MIV A;  4G85 A;  2BVM A;  2N9D A;  3V5U A;  3ZPO A;  3PJA A;  3RRC A;  4IDQ A;  3QB5 K;  1D1A A;  3I7F A;  1XZY A;  4WZX A;  3BJU A;  2DI4 A;  4KR3 A;  1G5I A;  1YGB A;  3L39 A;  3PUR A;  1X56 A;  5J0Z A;  5HCM A;  1Y64 B;  2QVA A;  4YRO A;  2DVE A;  4QXH B;  1Z7M A;  2QYW A;  4JI3 T;  3CX8 B;  2UXC T;  4CH5 A;  3RYH E;  3Q5D A;  2VQF T;  3PUQ A;  2JMK A;  2JQH A;  5CA1 E;  2LSI A;  3PUA A;  3WAK A;  4IE6 A;  4O2D A;  3QNE A;  4XU3 A;  1WQW A;  2KIN B;  3REU A;  4Z91 A;  2VAS A;  2XTL A;  3FHN A;  4CI2 B;  3TLS A;  3AEC A;  2EHO D;  3AXJ B;  2EWN A;  5EK3 A;  5JDH A;  2DU7 A;  4PK6 A;  2CXD A;  3OKQ A;  3VQW A;  3PUV F;  3ANW B;  3ONJ A;  4ZS2 A;  1G73 A;  1ADJ A;  1QF6 A;  3OD1 A;  2LSJ A;  1YFR A;  2XQ5 A;  1WFD A;  5AQJ B;  3H3A A;  2WWU A;  3ZJ1 A;  3RH3 A;  4COF A;  2Y8D A;  4DR6 T;  3RC3 A;  4YRF A;  5AQG B;  1I6Z A;  4BW9 A;  4PW8 A;  3ZT7 A;  1OED C;  4AKR B;  2X0Y A;  3CKD A;  1H4V B;  2MPK A;  2IUB A;  4XU0 A;  1SHZ C;  4U33 A;  3A5Y A;  1GGM A;  4PG3 A;  4DR1 T;  2EL9 A;  3TLV A;  4ISS A;  3AEB A;  4P71 C;  4WI1 A;  1O3X A;  3PTR B;  1MMN A;  2VKJ A;  1E7P A;  5FY7 A;  3A31 A;  2ZT8 A;  3AEE A;  1UX5 A;  2IIU A;  3ZC1 A;  5C3J A;  1W0A A;  3CML A;  5HXS A;  2WY2 A;  2ZGW A;  1XMO T;  1W09 A;  3M4P A;  3ZYL A;  5ABG A;  2UXD T;  4DR2 T;  3UUN A;  3Q5X A;  3RKX A;  3FXD B;  3UU4 A;  3PUX F;  4YRR A;  3ZC0 A;  4HWT A;  3JAD A;  3UU8 A;  3NEN A;  3K8P C;  1WRD A;  2W2U A;  2E9X B;  2WSS V;  3KDS E;  3D0T A;  4ILA A;  4GKK T;  3HXW A;  4JI8 T;  1USY A;  4MLK A;  1SRY A;  4JI0 T;  2QA7 A;  4JI2 T;  1NEN A;  5LMU T;  5JRC A;  5AQN B;  1WNL A;  1Z0P A;  4MHC A;  1YFT A;  1E22 A;  3JAE A;  1HCI A;  4PAG A;  3N9L A;  3QO5 A;  4CQI A;  4HT4 A;  1XNQ T;  3OBV E;  4IDO A;  5ADX L;  3RYI E;  3HL6 A;  4CXX A;  3CWZ B;  2ZNJ A;  3NZP A;  4DPG A;  4OLF A;  1SUM B;  4DV3 T;  4CN4 A;  1N36 T;  1WQ7 A;  2LSK A;  3MXZ A;  4F6R C;  4X62 T;  1VRB A;  4Q15 A;  2E2A A;  3UU6 A;  4DBQ A;  2K9A A;  3C4W A;  1SE7 A;  4IE0 A;  1B7T A;  4WJ4 A;  5LG3 A;  1NNH A;  5K1P A;  5AQU B;  2KZ7 B;  3EDU A;  4YYE A;  2F4V T;  2V6Y A;  3CK6 A;  4GOU A;  2ACX A;  3ZSS A;  1PYS A;  2E65 A;  3LBX A;  3UTK A;  2V1D B;  4TV9 E;  3HKE E;  2KXP B;  3HXZ A;  3P8V A;  4YRI A;  3ETU A;  4KI0 F;  4O2A E;  3ZEF B;  4H9Q C;  3DTO A;  2ZTG A;  3OYX A;  2WU2 A;  4RMF A;  2LM2 A;  1IL2 A;  1YD8 G;  4IST A;  2JRK A;  2V7K A;  4XEO A;  5BR8 T;  4LF6 T;  1FMW A;  5EZY E;  4OX9 T;  1WYB A;  3FZF B;  3IHR A;  3O9X A;  4YRM A;  4E7Z A;  2VKH A;  2J62 A;  1BIA A;  4J15 A;  2JQK A;  1HTJ F;  4E51 A;  4YRP A;  4WJ3 M;  2QRX A;  3NBX X;  5FL1 A;  4CS3 A;  4B3T T;  2EHO C;  4TTV A;  2IY5 A;  3ZMZ B;  2C8M A;  2Q5H A;  4H2U A;  4IDP A;  2P0L A;  2DWG A;  1U4Q A;  5JR9 B;  5JDQ A;  1UK5 A;  5JDF A;  4EOZ B;  4JYA T;  1X55 A;  5AQL B;  3V7C A;  4ZXL A;  2J4G A;  2XQA A;  4MFR A;  3OPC A;  3W3S A;  2QHS A;  2BS3 A;  1KEY A;  4JUY A;  1OED A;  4H2X B;  4HFB A;  3SOL A;  5JH7 E;  4X5T A;  2MOZ A;  3SS1 A;  1B7Y A;  1OED E;  2Q7G A;  3AE5 A;  1NJ6 A;  3P4P A;  3ZLI A;  2ES0 A;  2OV9 A;  4P71 A;  4ERR A;  2YU1 A;  4WNK A;  2X9H A;  3T1H T;  2UXB T;  2MTQ A;  2QHV A;  1HTT A;  3VR8 A;  3Q9D A;  5AQS B;  3HTZ A;  3I9Y A;  3VR9 A;  4HE8 A;  2LE8 A;  4ZEY A;  3UFG A;  3ZT5 A;  1J5E T;  2ZCE A;  5HAX A;  2AKW A;  3TEG A;  4WW0 A;  4IL9 A;  2MYS A;  4XTV A;  5AQF B;  2LSY A;  1X2H A;  11AS A;  2BKP A;  4ZS3 A;  2BKN A;  5ABE A;  4UV9 B;  1NYQ A;  2IHR 1;  3H37 A;  5KX5 E;  1HNX T;  2ZT5 A;  3ONL C;  4O4J E;  4H2V A;  5HEH A;  3FZM B;  1H4T A;  5LCY A;  3AED A;  1YKH B;  2NW9 A;  4YCW A;  3V5S A;  2WP9 A;  4KBM B;  4PNI A;  1W66 A;  5HWX A;  3IAL A;  3RYF E;  3ONX A;  2ZIM A;  2XQ4 A;  1R8I A;  5ABF A;  1EVK A;  5KMG P;  2PMF A;  2JJ9 A;  4H02 A;  2XM2 A;  3E08 A;  3N2K E;  4LMK A;  3RIU C;  2PJQ A;  2JIW A;  5M4Y A;  1HS7 A;  3TUP A;  4UXN B;  4B3R T;  4I43 B;  4C90 A;  4TVY A;  2PBI A;  1UUS A;  4ANJ A;  3VHL A;  4U7I A;  2JMH A;  2X66 A;  3LDQ B;  3MZK B;  4BJN A;  2CA5 A;  3RHW A;  1NAF A;  1MIY A;  4G84 A;  5AQK B;  4X5O A;  4MAL A;  1VQZ A;  5HXE A;  3ZN1 B;  4XTX A;  3UUM A;  3QO8 A;  3Q5W A;  1NJ1 A;  3HFZ B;  1UX4 A;  2ZIN A;  2FJA A;  3GA8 A;  3BK9 A;  3T1Y T;  4E7S A;  1L0W A;  3AA6 B;  1BIB A;  2YN6 A;  1WYC A;  2WMO A;  2V5D A;  4YSX A;  3HY1 A;  2ZT7 A;  4UP8 A;  3C4X A;  3L1A A;  4IE7 A;  2LHR A;  4L0R A;  2E5L T;  4PHC A;  2DHR A;  2GK9 A;  4OYJ A;  4DV6 T;  4DV5 T;  2X9X A;  4AI6 A;  1FYF A;  4ZI3 D;  4GK5 E;  4F8H A;  2DXT A;  2DU5 A;  1RIQ A;  2M67 A;  1NJ2 A;  3C64 A;  2ODV A;  4LF9 T;  3F31 A;  3AE2 A;  2RHQ A;  4EGW A;  3ZCI A;  4XU2 A;  2EHO A;  4UVA B;  4KR2 A;  3ZYK A;  2WBL A;  2CJB A;  3M65 A;  5IYZ E;  2EAY A;  5LNK A;  2DL1 A;  2KLQ A;  3RKY A;  4H9P C;  5DQW A;  4IE4 A;  1D0X A;  4QH5 A;  5AQQ B;  2WMN A;  3UUL A;  1G8X A;  4O8S A;  4TVA B;  2XY8 B;  3AE6 A;  2G4C A;  1S35 A;  1YFS A;  1T7S A;  1B76 A;  3TEH A;  3QUJ A;  1LVF A;  2NW8 A;  3BFM A;  4ILC A;  3O4X E;  4DID B;  3W15 B;  3HRK A;  3HFV A;  4IDN A;  3N9M A;  4EIW A;  4YRE A;  2DZ9 A;  1XDP A;  3HXV A;  5CJ5 A;  1G51 A;  2KMF A;  2K5B B;  2W63 A;  5L3E B;  3SWH A;  1HR0 T;  2LHN A;  3BQK A;  4H2T A;  3K3N A;  4H63 H;  3AB3 B;  2DCF A;  4P3P A;  4TVW A;  1HFA A;  2PFV A;  3PZC A;  3HKB E;  2A8E A;  2BG9 B;  3RL6 A;  2XUE A;  3P8C D;  5ABH A;  4P0B A;  4ZOL E;  4EZ4 A;  2HNI A;  1IJ5 A;  2VKD A;  1SER A;  3RI5 A;  5KDM C;  1EIY A;  4NPP A;  3RAC A;  5H6R B;  4O4H E;  1L0V A;  4OYK A;  1NYR A;  2CE7 A;  4P09 A;  3KV6 A;  4Q6G A;  2LEH A;  2V6X A;  4IE5 A;  5A1L A;  5C52 B;  1T98 A;  1HXD A;  1KF6 A;  3J9X 1;  4UV8 B;  1S94 A;  4JBW F;  1CHU A;  3HI2 A;  2NS6 A;  1X79 A;  4A98 A;  4LVM A;  1QE0 A;  3N9P A;  3P50 A;  1JJC B;  2CLY B; 
#chains in the Genus database with same CATH homology
 2ZXF A;  1WQ7 A;  2PME A;  2I4L A;  4YPF A;  3NEL A;  2ZZF A;  3L4G B;  4CH4 A;  3P8Y A;  4Q15 A;  2E3C A;  1YB3 A;  3A7A A;  2DEQ A;  4P3O A;  4WJ4 A;  3NEM A;  5C53 B;  1NNH A;  5K1P A;  3KFU A;  2I4O A;  2ALY B;  3HXX A;  2AKW B;  2ODR C;  4YYE A;  4YRC A;  4YRS A;  1N9W A;  1E1T A;  1PYS A;  1C0A A;  2E65 A;  1SES A;  3HXZ A;  3RUX A;  4P73 C;  1ATI A;  2J3M A;  3LSQ A;  3P8V A;  1E1O A;  4LNS A;  2ZR3 A;  4YRI A;  1H4S A;  2AMC B;  4UP7 A;  4NCX A;  1E24 A;  2ZTG A;  2FYK A;  4RMF A;  3G1Z A;  1IL2 A;  1BBW A;  4P74 C;  3FJP A;  4XEO A;  3MF2 A;  3LC0 A;  1EOV A;  1X01 A;  2DQ0 A;  4LVI A;  3E9H A;  4XTY A;  2RHS A;  4YRM A;  1BIA A;  4J15 A;  4RDX A;  2ARS A;  5F5W A;  4E51 A;  4YRP A;  4WJ3 M;  3PCO B;  4OP0 A;  4XTW A;  4CS3 A;  2ZNI A;  4YRN A;  4H2W A;  4TTV A;  2IY5 A;  1EQR A;  5HGQ A;  4RQE A;  4BWA A;  2C8M A;  2Q5H A;  3V8L A;  4H2U A;  4L87 A;  2P0L A;  4XTZ A;  1LYL A;  4K87 A;  5C51 B;  5KNN A;  1X55 A;  3V7C A;  4HVC A;  4YRK A;  2DQ3 A;  3UH0 A;  4P3N A;  3W3S A;  4H2S A;  2QHS A;  4P75 A;  4K88 A;  4XEM A;  4H2X B;  2J3L A;  3IKM B;  2Q7H A;  3A32 A;  4UP9 A;  2DTI A;  4YRQ A;  1B7Y A;  2Q7G A;  1NJ6 A;  4YP0 A;  2EJG A;  2XGT A;  1JJC A;  4P71 A;  2E64 A;  4HWP A;  2ZT6 A;  3LSS A;  1EFW A;  3MEY A;  5K1X A;  4LVL A;  3E9I A;  1WLE A;  2QHV A;  1HTT A;  3L4G A;  4CH3 A;  4P72 A;  2DZC A;  3HTZ A;  4HA8 A;  3V8J A;  2ZIO A;  3ICA A;  2C7I A;  3UFG A;  1BBU A;  2ZCE A;  2ALY A;  3QO7 A;  2AKW A;  3TEG A;  1USY C;  2ZZG A;  4HWS A;  4XTV A;  2XTI A;  2DJZ A;  3VQV A;  1KMN A;  4RQF A;  1X2H A;  2RHQ B;  11AS A;  3VQY A;  4ZTZ B;  4XTU A;  2QHT A;  4EX5 A;  3P8T A;  4YCV A;  4CS4 A;  1NYQ A;  3A74 A;  2AMC A;  1X54 A;  3QTC A;  2ZT5 A;  3RIR A;  4H2V A;  1H4T A;  4YCW A;  4ZIB A;  3TEH B;  2DKG A;  3CMQ A;  3WQZ A;  1W66 A;  3IAL A;  4UPA A;  1H4Q A;  2ZIM A;  2DXU A;  1B8A A;  1EVK A;  4TQF A;  2PMF A;  3EFS A;  1WYD A;  2DTH A;  1ASZ A;  4H02 A;  3PCO A;  3TUP A;  1Z7N A;  2ART A;  2E1H A;  2EJF A;  4CS2 A;  3NET A;  2ODR D;  4TVY A;  4G85 A;  3MF1 A;  5ELO A;  1G5H A;  3A7R A;  3A7U A;  3I7F A;  4H2Y A;  4G84 A;  3BJU A;  1HC7 A;  1G5I A;  4X5O A;  4KR3 A;  3RF1 A;  1VQZ A;  1YGB A;  1X56 A;  4XTX A;  3A5Z A;  3QO8 A;  1NJ1 A;  3HXY A;  3HFZ B;  4YRO A;  2ZIN A;  2DVE A;  4H2X A;  1Z7M A;  4YCU A;  5ELN A;  1EIY B;  4XU1 A;  1J5W A;  3RGL A;  4CH5 A;  4LVJ A;  2CJ9 A;  3M4Q A;  1ASY A;  1L0W A;  4TWA A;  1BIB A;  4O2D A;  3QNE A;  4P73 A;  3IG2 A;  4XU3 A;  4AH6 A;  2CJA A;  1WQW A;  3REU A;  1SET A;  2DTO A;  3HY0 A;  3HY1 A;  2ZT7 A;  4UP8 A;  2EWN A;  3L1A A;  2DU7 A;  4PHC A;  4P74 A;  3VQW A;  4EO4 A;  4YRL A;  1ADJ A;  1QF6 A;  3OD1 A;  1FYF A;  1YFR A;  2DXT A;  2DU5 A;  1RIQ A;  2P5I A;  3UGT A;  1NJ2 A;  2DDZ A;  1NJ5 A;  12AS A;  3VBB A;  4YDQ A;  4YRF A;  2RHQ A;  4BW9 A;  3VQX A;  4XU2 A;  4P75 C;  3RKW A;  4KR2 A;  3EFR A;  3UGQ A;  2CJB A;  4YRJ A;  1H4V B;  2EAY A;  4XU0 A;  4TQD A;  1PYS B;  3A5Y A;  3RKY A;  1GGM A;  4PG3 A;  2EL9 A;  3REX A;  4TVA B;  4TVA A;  2G4C A;  1YFS A;  3TEH A;  3L2Z A;  1B76 A;  4CH6 A;  4P71 C;  2CGH A;  2EJ9 A;  4WI1 A;  3BFM A;  2ARU A;  2QHU A;  3HRK A;  3HFV A;  1EVL A;  4HWO A;  1WU7 A;  1KMM A;  3A31 A;  2ZT8 A;  4YRE A;  2DZ9 A;  3HXV A;  3DSQ A;  1G51 A;  2ZZE A;  1KOG A;  3R07 A;  2Q5I A;  4P72 C;  4H2T A;  4P3P A;  2ZGW A;  4K86 A;  4TVW A;  4DQ2 A;  4HWR A;  3V8K A;  3M4P A;  3PZC A;  1NJ8 A;  2RHS B;  2CIM A;  2A8E A;  3RL6 A;  3RKX A;  4YRG A;  3HRI A;  4YRR A;  4HWT A;  3NEN A;  2HNI A;  5E3I A;  2IY5 B;  4WF2 A;  2Q7E A;  1SER A;  4ZTU B;  3HFZ A;  1EIY A;  1X2G A;  3RAC A;  3HXW A;  1USY A;  1SRY A;  4YRT A;  3MQZ A;  1NYR A;  3V7S A;  4LVK A;  4KQE A;  1WNL A;  3IKL A;  1YFT A;  4Q6G A;  1E22 A;  1B70 B;  1B70 A;  5C52 B;  2ZR2 A;  3QO5 A;  4HT4 A;  1HXD A;  1WPY A;  1B7Y B;  3HXU A;  2NS6 A;  2ZNJ A;  3ERR A;  1ADY A;  2E41 A;  4DPG A;  4OLF A;  2E10 A;  4LVM A;  1QE0 A;  1JJC B;  2I4N A;  3V7R A;  2I4M A;  2E5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...