3RGLA

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc in complex with atp and glycine
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
292
structure length
292
Chain Sequence
b'NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycyl-tRNA synthetase alpha subunit
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP and glycine.
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
total genus 101
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3rglA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rglA01
2Q7GA 4YRNA 1EIYA 3IKLA 5KNNA 2ZNJA 4KR2A 4H2XB 4YRJA 2XTIA 3CMQA 1E1OA 1KMMA 3BFMA 4XEMA 3NELA 2G4CA 3RUXA 3V7RA 2ZZGA 2AKWB 1WPYA 3VQWA 1EOVA 2DEQA 4TTVA 1EVLA 4TVAB 5K1XA 4H2YA 1GGMA 4P72A 1NYRA 4K88A 4XEOA 1H4SA 3M4QA 4H2TA 4P3PA 2E1HA 2E41A 3A31A 3A7AA 1BBWA 3REUA 1B76A 1B70A 2I4LA 1NJ5A 1ATIA 1W66A 4RQEA 1WYDA 3BJUA 2ODRC 3REXA 2RHQA 1ASZA 2DZ9A 4P71A 3MF2A 4H2SA 3HY1A 3UGQA 4RDXA 3LSQA 3V8KA 4XTZA 2ALYA 2DKGA 1JJCB 1PYSA 3MEYA 2Q5HA 4Q15A 4J15A 4HVCA 2I4MA 3HY0A 3NEMA 4P71C 1G5IA 1NJ8A 4YCWA 2EWNA 4AH6A 3E9HA 1EIYB 2ARTA 1YFRA 2ZXFA 4XTVA 1B8AA 2QHVA 4ZTZB 4YRQA 3IKMB 3QNEA 2C7IA 1L0WA 3TEGA 2XGTA 3RL6A 2P0LA 2ZR3A 1YFSA 2DJZA 11ASA 3QO7A 2EL9A 3QTCA 4G85A 1YB3A 2J3MA 2EJFA 3W3SA 2CGHA 3UFGA 5F5WA 2QHUA 1H4VB 1SERA 1RIQA 3NENA 3P8VA 2ZZFA 5C53B 4YRGA 2DDZA 3HXZA 4K87A 1YFTA 3EFRA 1C0AA 4LNSA 3V8LA 2FYKA 4HWPA 1KOGA 4XU2A 3VQVA 3ICAA 4H2UA 2CJBA 2PMFA 1B70B 2ZIMA 2Q7EA 4XU0A 2E65A 1WNLA 1EQRA 1HXDA 4YPFA 2IY5A 2RHQB 4UP7A 2Q7HA 5C52B 1E22A 3ERRA 4P73C 3UGTA 2DQ3A 2ALYB 1ADJA 4UP9A 4HWRA 3L4GA 3HFZA 1PYSB 3HRIA 4DQ2A 4EO4A 4YRCA 2DU5A 1N9WA 3EFSA 1BIAA 4PG3A 3LSSA 4P3NA 4CS3A 4YYEA 3A7RA 2ARSA 3L1AA 2DVEA 2DQ0A 2I4NA 1EFWA 3G1ZA 1WQ7A 4K86A 1SESA 4L87A 4UPAA 3OD1A 4ZIBA 2AMCA 2HNIA 4DPGA 5ELNA 5E3IA 3L2ZA 3I7FA 4YRIA 1G51A 4OLFA 2ZIOA 3TEHA 2DZCA 3TUPA 4UP8A 2AKWA 3PCOA 3WQZA 1BBUA 1E24A 4TQDA 3V8JA 4KQEA 3IG2A 4RQFA 1FYFA 5ELOA 2ZT5A 3DSQA 3VQXA 1X56A 3A32A 4CH6A 1X2GA 4YRLA 3FJPA 3HXUA 2ODRD 4HA8A 4TVYA 4CS4A 3NETA 3RKXA 3QO8A 3HXVA 3E9IA 2CJAA 4RMFA 2DTHA 1VQZA 5K1PA 1B7YA 4H02A 1X2HA 2E3CA 4YRPA 1Z7MA 3MF1A 4XTXA 3HXYA 4YP0A 1WLEA 2ZCEA 3A5YA 4XU3A 3UH0A 3HFZB 3HRKA 4XU1A 2CIMA 2DTIA 1X54A 1X55A 4HWSA 2QHSA 4CH3A 1BIBA 3V7SA 4P75C 3RKYA 2EJGA 2ZT6A 4TQFA 2DTOA 2RHSA 2ZZEA 4P73A 4WJ3M 4KR3A 4YRKA 1JJCA 3RKWA 1NJ1A 4OP0A 2ZT7A 2ZT8A 2PMEA 2CJ9A 3HXWA 2ZR2A 2I4OA 1LYLA 3KFUA 4YCVA 1SETA 1HTTA 2AMCB 4TVWA 2E64A 1E1TA 3RIRA 3M4PA 3TEHB 4X5OA 4YRTA 3RF1A 1WU7A 4CH4A 4YRSA 1USYA 4WI1A 2E5AA 3V7CA 1WQWA 3PCOB 4YRFA 5HGQA 2ZGWA 4YDQA 4P74A 1NYQA 4HWOA 1ADYA 1IL2A 1Z7NA 2EJ9A 12ASA 4CS2A 2ZTGA 1ASYA 4H2VA 4YREA 3VQYA 4XTWA 4XTUA 5C51B 1NJ2A 4YCUA 4E51A 1H4QA 2J3LA 1USYC 2QHTA 4NCXA 1QF6A 1H4TA 4P74C 4H2XA 4P3OA 1B7YB 1YGBA 1G5HA 3HXXA 2ZNIA 3R07A 2EAYA 4P72C 3HTZA 3QO5A 4O2DA 3A5ZA 3PZCA 4YRMA 1KMNA 4BW9A 1X01A 2P5IA 1NJ6A 4WJ4A 1QE0A 4CH5A 2RHSB 3A74A 4TVAA 1SRYA 3RACA 4WF2A 2DU7A 4YROA 1EVKA 1HC7A 2IY5B 3VBBA 4P75A 2DXTA 4BWAA 4ZTUB 3A7UA 4TWAA 1NNHA 4PHCA 4EX5A 4H2WA 3P8YA 3P8TA 2ARUA 1J5WA 3L4GB 4XTYA 2ZINA 4G84A 4YRRA 3HFVA 4Q6GA 3RGLA 2C8MA 2Q5IA 2DXUA 3IALA 4HWTA 3LC0A 2E10A
chains in the Genus database with same CATH superfamily
2Q7GA 4LFBT 2XAHB 3I0QA 4PNIA 4KR2A 3MA9A 1KMMA 4ILUA 4IDNA 3SOLA 3RUXA 5L4HA 3ZEFB 2FJAA 5HEOA 3MKDA 3O4XE 2JQQA 1EOVA 3OPCA 1DU2A 5JDHA 4UV8B 4TTVA 2BDEA 1GGMA 3CQCB 4PK6A 3F57A 3AEAA 1VCTA 4K88A 5L3DB 3M4QA 2I0MA 5AQSB 1T72A 3ZSSA 3VKHA 4AQFA 4X65T 3I9WA 1WYDA 4EB6E 1YQ4A 4HFBA 4LF5T 1ASZA 4MFRA 2CM0A 4ASKA 3LK3B 2HN1A 2D0TA 3JC6D 2A3DA 1N32T 3NWIA 3WI3A 1WYBA 2DKGA 2VVNA 3MEYA 3LJCA 4YT0A 2IAKA 4HVCA 1XNRT 4C90A 2K48A 3NEMA 4TUYE 2SPCA 2OV9A 5AQLB 3AAEB 5LG3A 4HFEA 2ARTA 2ES0A 4N78D 2IMLA 3FXDB 3IKMB 4G2AA 2XGTA 2WDRA 3ONJA 3VRAA 2EL9A 2XAQB 4LVKA 4EIWA 4G85A 4UVCB 5F5WA 1WFDA 4IE0A 1SERA 1H7CA 3TLSA 5CA0E 4YRGA 3AA6B 3HXZA 4K87A 1YFTA 4UEMA 3EFRA 2XM2A 4BA9A 3V8LA 2XQAA 2N2NA 3VRBA 3A5XA 2PTFA 2CBJA 3CKDA 3JAFA 1HF8A 3KVBA 4U3CA 5FL0A 4TNVA 2VL8A 1W0BA 4X1KE 2UUCT 2V5CA 1WNLA 3K3QC 2M6IA 4B3TT 2OLTA 4IDQA 3P4PA 2BVLA 4XBFB 2YK0A 2IUBA 5FXZA 5FY1A 4E7ZA 5LNKA 3HFZA 3LK2B 4AKHA 2CWOA 4EO4A 5KXJA 4CXXA 3EFSA 2YDQA 3FHNA 5LCYA 4PG3A 5ABEA 3R6NA 4NXNT 2XAGB 5LYJE 1IJ6A 1X79A 4YYEA 3L1AA 3HKCE 2DVEA 2NOXA 2DQ0A 2H7OA 2YU1A 1T8BA 2K9AA 1M62A 2AMCA 4DPGA 2A2FX 3I7FA 3I0OA 2ZM6T 4PFOA 2ZIOA 2KMFA 4IL4A 3P50A 5FVKA 4KP3C 4YHHT 4H9RC 4U31A 3VKGA 3AE3A 4NPPA 3L09A 2ZT5A 3VQXA 1ZV4X 3VR8A 5ABFA 4XAXB 1MNEA 1UX5A 4HA8A 1V9DA 4KX6A 3ZT5A 4B3MT 4KUMB 5L3CB 3RYCE 1VOMA 1VQZA 2GK9A 2CHOA 3CX6B 2E3CA 2N1GA 3MF1A 3HXYA 4YP0A 2E9XB 2ZCEA 5HXHA 2FBWA 3HFZB 5AQGB 2WDVA 3UULA 2BG9E 2L3LA 3V7SA 3EDUA 4ZS2A 2RHSA 2H89A 4IE6A 3BQKA 4P1NA 3LSVA 4YRKA 1JJCA 2XSAA 3RKWA 1UX4A 4GKKT 4QX7B 4OP0A 4PJNA 3FZHB 2ZT7A 2V7KA 2P9BA 2ZR2A 4HFCA 2LOSA 3H3MA 4U74A 4YCVA 2W2UA 1HTTA 2AMCB 4AISA 4ANJA 3N2GE 4YRTA 2OA5A 5LB7B 2QRXA 4OX9T 5FXWA 4O2AE 3V7CA 1X9BA 3FZKB 3ESLA 4Z91A 3Q9DA 1NYQA 1D0YA 1LVKA 3OBVE 1UGOA 2J4GA 2WAUA 4A97A 4LVJA 1KNZA 4CS2A 3B13A 5ABFB 4H2VA 2WMOA 2CHNA 1D1AA 3PDYA 3WAJA 4H2XA 4P3OA 1YGBA 1QSDA 4COFA 2JIWA 2YOEA 3HL6A 2BVMA 3M3ZB 5JDQA 2PBIA 2LJLA 3ZPOA 2M67A 1KFYA 4QH5A 4DV6T 3HTZA 3A5ZA 2KLQA 3UFEA 2YDSA 1S94A 3CMLA 5LHIB 1NJ6A 5JQGE 2XHEB 4CH5A 2XAJB 1KF6A 1NAFA 2RHSB 1SRYA 3AXJA 2W67A 3AE8A 3RRWA 1EVKA 1HC7A 2WU5A 2CE7A 2IY5B 4BWAA 3GWHA 1BR4A 4YLHA 4TWAA 3T1YT 4AQYT 4NIQA 3C98B 1D0XA 2LHRA 3L4GB 4H9SE 1G73A 2JMKA 3CK6A 2AXDS 3DJBA 3CQXC 3AEGA 3AVRA 2C8MA 5HYAA 4LMKA 2K5BB 2D5UA 3BQIA 3RH3A 2E10A 5FYMA 3P4RA 3AEEA 5AQKB 3N9QA 1ZP0A 2F4VT 3NRXA 2LHNA 4OFZA 4H2XB 4YRJA 4P09A 3JADA 4EXTA 3NVOA 4ZZBA 3U78A 4LF6T 3NELA 3NZQA 4H9OC 4HE8A 2B76A 5BR8T 4UELA 4XZCA 2I6HA 4HWFA 5L3GB 4IL9A 3KV9A 2VQET 2X0HA 3GA8A 3OYZA 2WZHA 1EVLA 5K1XA 2CXFA 4AI6A 3DTOA 2RA1A 1ZKEA 1NYRA 3CWZB 5HCJA 5FP3A 4ZI3C 4XEOA 3ANWA 3FXEB 4H2TA 2E1HA 4O4IE 3C50A 3A7AA 3REUA 3ABVA 1B76A 3TKLB 2UU9T 2RPAA 2XQ5A 4CI1B 3TLTA 4FI5A 5FKYA 1N36T 2J62A 2DZ9A 4P71A 3N9NA 2MYSA 5DJQC 5KMGP 3U3IA 1D0ZA 4H2SA 3Q5DA 1FJGT 1Y01A 4HWCA 2DCFA 3LSQA 2I59A 4XTZA 2NS6A 3HI2A 4JYAT 4Q15A 2Q5HA 2I4MA 2YU2A 2E5LT 4P71C 1G5IA 4YCWA 3E9HA 2RP4A 5HXRA 4TX5A 1B8AA 2QHVA 4H9PC 4ZTZB 4CXWA 2HHHT 1IBLT 3QNEA 1L0WA 4B6XA 2P0LA 1YFSA 3IHRA 3QO7A 3QTCA 1YB3A 3AEDA 2NTYA 2EJFA 3Q5XA 2VKHA 2B1EA 2KT9A 2V1DB 4DV1T 2PFVA 4P0BA 3P8VA 2ZZFA 4JBWF 2D9DA 4PJJA 3PU3A 1M7KA 4H63H 4O4LE 4ZI7E 3IA3A 2BS2A 4DNDA 1AJ3A 3TLVA 2CEAA 3VU7H 2LEHA 1EZ3A 2FYKA 3ANWB 5JRCA 2X68A 4XU2A 2ZM0A 3ICAA 3HA4A 4H2UA 5HXCA 2W66A 2ZIMA 2WWVA 5F8PA 2VKDA 4QHOA 4PK5A 2E65A 3LBXA 4DV2T 4UP7A 1HNWT 1D1CA 2Q7HA 5C52B 5EK2A 3WAKA 1E22A 3ERRA 2DQ3A 4YTMA 4UP9A 4AIUA 2XQ6A 4HWRA 2H7VC 2W61A 2X9WA 2UXNB 1T7SA 5HEJA 2IC6A 1YKEB 3KVAA 2ODUA 3E08A 4KMCA 3A7RA 4PFPA 2HH7A 2ARSA 5FNVE 4ZI2C 5JR9A 2LKHA 5LMNT 4K86A 3N2KE 3ONXA 4L87A 2BS4A 4QWNB 3K3NA 4UPAA 3OD1A 3C51A 4ZIBA 4QXHB 3L2ZA 4YRIA 4OLFA 4LVIA 4YJ3E 3AB3B 2D0UA 5J0ZA 5IYZE 2Z6EA 1QLBA 3TUPA 5JR9C 4UP8A 3EHZA 2AKWA 4ZI3D 2XTLA 5JTGA 4TQDA 5EZYE 5TAOA 4EGWA 5JRCB 5ELOA 3RQUA 4QX8B 5LHHB 4TZ4C 3A32A 3BK9A 4IDOA 4YRLA 3FJPA 3HXUA 4C91A 1BR1A 2LSGA 4EAHA 2Y8DA 3LBXB 4DR6T 2BS3A 3NETA 3RKXA 2C5JA 2CJAA 3CVRA 2LOPA 3Q5EA 1XNQT 4H02A 4O4JE 3AVSA 3MACA 4AKLA 4OYJA 4ILBA 1Z0PA 2KZ7B 3A5YA 1IZNB 3X1DA 1NEKA 2DLRA 2DL1A 3KBTA 4BJMA 5JDFA 1X54A 3MJXA 4HWSA 3UU4A 4CH3A 1BIBA 2XJ7A 3AE9A 4TQFA 2XUEA 1HX1B 4EZ4A 3MK7C 2UUAT 1NJ1A 2CA5A 3ETUA 2CJ9A 4GYRA 5JR9B 2W63A 3CQGB 5IWAT 4O8SA 4Q25A 3FZMB 4DV0T 5HEUA 4TVWA 2WQYA 3QUJA 4ZS3A 1IAPA 2KWHA 2E64A 5JH7E 3OKQA 3ZJ1A 3EAMA 2XZEA 4YRSA 1USYA 4GK0E 1GQEA 3IBPA 3M65A 4YRFA 5HGQA 2N9DA 4YDQA 4HTEA 3P4WA 4DBRA 1IL2A 2NW9A 4IE4A 2V6XA 2EJ9A 5JDGA 4A98A 1ASYA 1HR0T 3VQYA 2CPTA 4XTWA 4XTUA 5C51B 1NJ2A 2XSBA 3PUYF 5EK4A 5LBMA 4E51A 4X1IE 1USYC 3EUHA 4ZZCA 4JI5T 1XDOA 2D2SA 4IE7A 2Q9QA 1ZHCA 2V7JA 3UU5A 3UUNA 3UUMA 5BMVE 4P72C 2NR4A 4O2DA 3PZCA 3AAIA 1U4QA 3HR0A 4ZEYA 2L9QA 1US7B 3AE7A 4M1PA 2FJEA 1QE0A 2X0LB 3O1JA 3NRYA 4YFSA 2HPJA 3RACA 2Q9QC 2J47A 2BKOA 4ZI2D 2ZM2A 1Z8UA 3KV4A 1E7PA 4LF8T 4ISTA 5HXSA 5AQHB 5GONE 4LFCT 4ZTUB 2UXCT 3A7UA 4QXCB 5LG4A 5LXTE 1KK7A 4V1Av 2V5DA 4EV6A 2XQ8A 2MBGA 5LJMA 4EX5A 5L3BB 3P8YA 2EHOA 3CPZA 4XTYA 3QC9A 3HKEE 2ZINA 4YRRA 1SE7A 2V8SV 2L8KA 3E0ZA 2QA7A 4I50E 2FJDA 5LMUT 1B7TA 2NW8A 3SFEA 2DXUA 4J2CA 3C4XA 3CX8B 4PJLA 3A7MA 1YXRA 2EHOC 4WNKA 4AXPA 2ZNJA 1LKXA 2K3WA 2WP9A 3K1SA 3CMQA 5L47A 2QGSA 1LVFA 3PJAA 2Q9QB 2G4CA 4JI8T 2CLYC 4TN7B 4NXMT 3TLWA 2ZZGA 2KXPB 1WPYA 3RYHE 3IF8B 5LGNB 4HFVA 4GOUA 4DR5T 3VQWA 5M4YA 3O9XA 4IHJE 3T1HT 1HS7A 3O1IA 5LJNA 3KINB 1WRDA 4HWDA 4CI3B 2UXXB 4DMVA 2WY2A 1KEYA 1H4SA 3NKZA 3UQ4A 3PTRB 1HNXT 2E41A 4P3PA 2DI4A 3QNUA 3A31A 4HFHA 3PV0F 2CRBA 1BBWA 1B70A 2I4LA 3NZPA 2X67A 3AEBA 1W66A 4RQEA 3B57A 2A9UA 3BJUA 3Q5WA 5DQVA 3REXA 2EHOB 4JI4T 2YEVC 2VVSA 4Z8XA 1R8IA 3MF2A 2DNXA 3HY1A 4UIGA 3ZN1B 3L3PA 5JREA 3MXZA 3K3OA 5HXEA 4RDXA 1NWMX 3V8KA 4ZOLE 2X9HA 1JJCB 4JI2T 4K0KT 3CX7B 3N9LA 1XDPA 2ZLYA 3RPUA 5CB4E 5C2TA 3D0TA 3LFMA 1NJ8A 2EWNA 1IBKT 4YJ2E 2LKGA 1UURA 1YFRA 4XTVA 5HEGA 1UCUA 4JEUB 1YKHB 4UVAB 3RL6A 5IHYA 4O2BE 2DJZA 3RYFE 2VURA 11ASA 5LGTB 2CBIA 2V7MA 3W3SA 3PUAA 4AKRB 1JNZA 3UFGA 2XQ4A 4X5TA 3RC8A 2QHUA 2K24A 4CN4A 2NW7A 1RIQA 3NENA 3ZLIA 4I0UA 2PG8A 2Q9QD 3VHLA 3MQZA 5C53B 3I9YA 2DDZA 2AE9A 3QB5A 1C0AA 4LNSA 4GK5E 4BJNA 1KOGA 2WU2A 3O1HA 3VQVA 2PMFA 3PJAJ 1B70B 2Q7EA 4XU0A 5AQQB 3NBXX 2YKSA 4YSZA 1EQRA 1HXDA 4YPFA 2KNDA 2XQYA 2JQHA 4TNWA 4AQGA 4KHZF 3ZMVB 4DV7T 1W0AA 4P73C 3UGTA 3RIFA 4U2ZA 3OVUA 3N9MA 4LF4T 1ADJA 5AQTB 1HCIA 4G63A 3AXJB 2EHOD 2H88A 3AAAB 4HFIA 4JI6T 4DQ2A 3JCFA 2DU5A 4YTPA 3AE6A 2JQ9A 4EZHA 2VK9A 1BIAA 5FMNA 5E0OA 3S4UA 2CXLA 4P3NA 2CCQA 2X9YA 4ERRA 3UU8A 4JI7T 2I4NA 3RIAA 1EFWA 2JQKA 2UXBT 2UXDT 5L2LA 2V7IA 1WYCA 1FMWA 2X66A 4CQIA 2IC9A 3PU8A 5HCMA 3PUZF 2HNIA 1S35A 4DR7T 3TEHA 1WR6A 3CIRA 4JV5T 4WW0A 3GN5A 2KSRA 3PCOA 4I4TE 4QXBB 3WQZA 3UT5E 4DR2T 1BBUA 3V8JA 4KQEA 1KNRA 4RQFA 5JDMA 1FYFA 1X56A 4JI3T 3HKBE 2G0UA 1NENA 4ZXLA 2VQFT 4TWHA 4K0UA 4TVYA 4CS4A 5AFUL 5ADXL 1WR0A 3QO8A 3E9IA 2DTHA 4L9IA 1B7YA 1X2HA 3JAEA 1MMDA 3RX6A 3ZYLA 2NP9A 2VB6A 4TWDA 1OEDA 3UQ7A 1WLEA 2WBLA 5C8YE 5AQMB 1XMQT 4DR4T 3ZCIA 1FIOA 4X1YE 4LMJA 3F31A 4FJOA 4DMWA 2DTIA 4HGAA 2IIUA 4ISSA 1BR0A 4P75C 2KINB 3RKYA 2EJGA 2ZT6A 3H37A 3ZC1A 2ZZEA 2XASB 4UV9B 1OEDC 2YN6A 4WBNE 4DR1T 2ODVA 2IHR1 3G06A 3HXWA 2A8EA 3ONLC 3T8OA 5H6RB 1IBMT 3KFUA 1LRZA 1SETA 1E1TA 2ACXA 1N34T 1I6ZA 2WWUA 2H3RA 3TEHB 1T98A 3RF1A 3AEFA 4LVLA 4CH4A 2X51A 2E5AA 5AQUB 3GN5B 1WQWA 3PCOB 1L0VA 2IDOB 4P74A 4AKIA 4HWOA 1ADYA 5FY7A 4U33A 4U72A 2NWBA 4HN9A 12ASA 4UXNB 4EYYR 3AA1B 4UF0A 4YREA 3P7IA 3OJAA 4YSYA 3OYXA 4YCUA 2J3LA 2C5KT 3RYIE 1JNRA 3K8PC 4QH1A 3I1AA 1QF6A 4KI0F 1H4TA 4P74C 1B7YB 4DUZT 3C64A 3HXXA 5AQPB 2ZNIA 1OEDB 1O3XA 4DO0A 4KHPT 5JVDE 2ZMAA 2EAYA 1J1JA 1OXZA 3DP7A 4PK4A 4MLKA 4BW9A 3ZMUB 2WZIA 1MMGA 2P5IA 4DR3T 4AQFC 3PUWF 4LF9T 4TVAA 1YQ3A 5AQOB 2DU7A 2BKNA 4WF2A 1MIVA 4I55E 3LK42 3FZFB 4X62T 4HEAA 2W00A 5CA1E 4I43B 4B3RT 5C3JA 4OYKA 2XM1A 4L5GA 3EVYA 2JMHA 1HFAA 2VKJA 1NNHA 5LHGB 3N9OA 1YW0A 4LF7T 3P8TA 2ARUA 3QOFA 1KNPA 4A56A 4G84A 4TV9E 4QH4A 3RHWA 4Q6GA 5EK3A 3ZJ2A 4JLEA 1I94T 5CJ5A 4YY3T 5IUXA 4GKJT 4JI1T 2Q5IA 5LP6E 2Y6XA 2XQ9A 2BKPA 3KFWX 4DV3T 3IALA 3SWHA 4UF0B 3ZMSB 3ZSTA 3LC0A 3SRZA 4JEHB 2JPFA 1D1BA 4YRNA 4WYVA 4EYUA 1EIYA 2M6BA 3L8RA 3IKLA 5KNNA 4PAGA 1W9RA 2ACZA 2XTIA 1E1OA 1SA0E 1MNDA 3VR9A 4X64T 2CXDA 3BFMA 3L39A 4XEMA 2WS3A 1FMVA 2BBJA 5LBQB 2W62A 2DHRA 2YDRA 5CGMA 3V7RA 2X9XA 4ADZA 5FY0A 2LE8A 2AKWB 3RRCA 4BAYB 2X0YA 5J2UE 2XQ7A 3FBLA 2E9XA 2DEQA 4UVBB 2LM9A 2VKOA 3KDSE 4IT4A 4NUUA 4TVAB 3PUVF 4H2YA 4P72A 5L3FB 2MTQA 1MIYA 2XAFB 2XQ3A 5HWYA 5FXXA 2LLYA 3ZMTB 2E9XC 1NJ5A 1HTJF 1ATIA 2E2AA 4DVDA 4AKGA 1UK5A 4B3ST 2ODRC 1Y64B 3V5UA 3OTOT 2RHQA 4HWIB 4PW8A 1WLXA 2LRLA 3ZN0B 5JDLA 5HEHA 1WCRA 4P0AA 3UGQA 3P4SA 4MALA 3PUXF 2R6GF 4IGUA 2ALYA 1PYSA 2VASA 4J15A 2IW5B 4U7IA 3H3AA 3HY0A 3KV5A 3ZYMA 4AH6A 2MAWA 3AE5A 2JRKA 4LMLA 1EIYB 2ZXFA 4U7YA 3KV6A 4CI2B 3W15B 4YRQA 4NUVA 5AQNB 2C7IA 3TEGA 4DV4T 3GMIA 5ABGA 3ZC0A 2ZR3A 4CN1A 1E1HB 3RQWA 1XZYA 3PURA 4CN6A 2J3MA 5AQRB 2NTXA 2CGHA 1MIWA 1J5ET 3AE4A 4YHJA 1H4VB 2LRKA 3UUBA 5DABA 2BBHA 4LFAT 5ABHA 1UUSA 4HWPA 2CJBA 3RC3A 4WBOA 5HWXA 1N33T 4MHCA 4OHFA 1OWAA 5FL1A 1VRBA 2IY5A 2RHQB 4HT4A 2QYWA 1HNZT 4IDZA 3ZCJA 2BG9A 3RKGA 3E22E 2HPLA 5J2TE 4YSXA 4DIDB 1ZEEA 4ZHQE 2KWIB 2ALYB 3LDQB 3L4GA 1PYSB 3HRIA 3EABA 3B5MA 3N9PA 2FUPA 4PJMA 5KDMC 4YRCA 1N9WA 1E2AA 2MPKA 4KBMB 3AE1A 5DQWA 2BG9C 3LSSA 4CS3A 2JJ9A 3G1ZA 1WQ7A 1SESA 4A5XA 1HG5A 4DBQA 5ELNA 3KBUA 5E3IA 1G51A 2XY8B 5ETWA 2DZCA 2CLYB 1XMOT 5FXVA 3SFDA 1E24A 3IG2A 3C4ZA 3DSQA 3EDVA 2E9XD 2ZM8A 4X66T 2V6YA 4CH6A 1X2GA 3LG7A 5L3EB 3P8CD 3PUQA 3ZT7A 2WMNA 3UTKA 1QUUA 2ODRD 1IJ5A 1XWMA 2YINA 3HXVA 2VWAA 5KX5E 4RMFA 4EEDA 4IIJE 5LA6E 4HFDA 5K1PA 1CUNA 5LGUB 4LVMA 3FB2A 2BG9B 4TWFA 4YRPA 4EEBA 1Z7MA 1HX8A 4XTXA 4Z90A 4IE5A 3AA0B 4HKAA 4DUYT 2W4XA 2WB5A 3V5SA 4XU3A 3UH0A 2E8IA 1G8XA 5H6QB 3HRKA 4XU1A 2CIMA 4EOZB 2WCAA 5CFBA 4TV8E 2DWKA 3F2EA 1X55A 2QHSA 2C0SA 4WZXA 4ILAA 3RKOA 3QK6A 2J1DG 3ZKRA 2DTOA 4YXDA 4QKNA 4P73A 4WJ3M 3FZLB 4KR3A 4GYSA 2WM9A 2QVAA 3J7Yq 5AQVB 2ZT8A 2PMEA 3PE0A 2WSSV 2LT3A 3J9X1 2A72A 1HG2A 2DWGA 3TLUA 2HN2A 2I4OA 4F6RC 3MZKB 1LYLA 3Q2MA 3EI0A 3AE2A 2C5IT 3PUSA 3RIRA 2Y48B 3M4PA 4X5OA 1WU7A 4DV5T 1U5PA 4WI1A 5A1LA 4OK0A 2ZGWA 2LM2A 2FJBA 1MMNA 4O4HE 3UU6A 2E5VA 4F8HA 3JC6C 3FBZA 4L0RA 3R84B 1Z7NA 5L4EA 5JDNA 4H9NC 5FVLA 2ZTGA 2V6YB 4ILCA 2V7LA 1H4QA 4H63V 2QHTA 2W0GA 4NCXA 4CXYA 3ZT6A 2XPKA 3HKDE 3AA7B 3C4WA 2LSJA 1G5HA 4UR9A 5F3JA 3R07A 3RI5A 3ETVA 2WDQA 5AQJB 4E7SA 5HAXA 3QO5A 4YRMA 4IREA 1ZOYA 1KMNA 2PJQA 1X01A 1SUMB 1VCSA 2V26A 1OEDE 4WJ4A 2VL0A 4GIWA 3N2OA 3A74A 1CHUA 3QB5K 3RLFF 4H9QC 1YD8G 4YROA 4MBQA 2MOZA 3P4QA 3UU3A 4IDPA 4JI0T 3PUGA 4CZZB 4P75A 3VBBA 2DXTA 3SS1A 3AECA 4HWHA 1FEWA 3A8YC 3IEEA 3RIUA 3N5LA 5LOVE 2LSKA 4PHCA 2CWYA 2UUBT 4H2WA 1J5WA 2BZBA 3BQLA 4YTNA 1BR2A 3HFVA 2LSYA 4X20E 5AQIB 4U2YA 1MMAA 2LSIA 5AQFB 3RGLA 5J1GA 1W09A 4JUYA 3ZMZB 3RIUC 3ZYKA 2CMRA 1SHZC 4HWTA 3UUXB
chains in the Genus database with same CATH topology
2Q7GA 4YRNA 1EIYA 3IKLA 5KNNA 2ZNJA 4KR2A 4H2XB 4YRJA 2XTIA 3CMQA 1E1OA 1KMMA 3BFMA 4XEMA 3NELA 2G4CA 3RUXA 3V7RA 2ZZGA 2AKWB 1WPYA 3VQWA 1EOVA 2DEQA 4TTVA 1EVLA 4TVAB 5K1XA 4H2YA 1GGMA 4P72A 1NYRA 4K88A 4XEOA 1H4SA 3M4QA 4H2TA 4P3PA 2E1HA 2E41A 3A31A 3A7AA 1BBWA 3REUA 1B76A 1B70A 2I4LA 1NJ5A 1ATIA 1W66A 4RQEA 1WYDA 3BJUA 2ODRC 3REXA 2RHQA 1ASZA 2DZ9A 4P71A 3MF2A 4H2SA 3HY1A 3UGQA 4RDXA 3LSQA 3V8KA 4XTZA 2NS6A 2ALYA 2DKGA 1JJCB 1PYSA 3MEYA 2Q5HA 4Q15A 4J15A 4HVCA 2I4MA 3HY0A 3NEMA 4P71C 1G5IA 1NJ8A 4YCWA 2EWNA 4AH6A 3E9HA 1EIYB 2ARTA 1YFRA 2ZXFA 4XTVA 1B8AA 2QHVA 4ZTZB 4YRQA 3IKMB 3QNEA 2C7IA 1L0WA 3TEGA 2XGTA 3RL6A 2P0LA 2ZR3A 1YFSA 2DJZA 11ASA 3QO7A 2EL9A 4LVKA 3QTCA 4G85A 1YB3A 2J3MA 2EJFA 3W3SA 2CGHA 3UFGA 5F5WA 2QHUA 1H4VB 1SERA 1RIQA 3NENA 3P8VA 2ZZFA 3MQZA 5C53B 4YRGA 2DDZA 3HXZA 4K87A 1YFTA 3EFRA 1C0AA 4LNSA 3V8LA 2FYKA 4HWPA 1KOGA 4XU2A 3VQVA 3ICAA 4H2UA 2CJBA 2PMFA 1B70B 2ZIMA 2Q7EA 4XU0A 2E65A 1WNLA 1EQRA 1HXDA 4YPFA 2IY5A 2RHQB 4HT4A 4UP7A 2Q7HA 5C52B 1E22A 3ERRA 4P73C 3UGTA 2DQ3A 2ALYB 1ADJA 4UP9A 4HWRA 3L4GA 3HFZA 1PYSB 3HRIA 4DQ2A 4EO4A 4YRCA 2DU5A 1N9WA 3EFSA 1BIAA 4PG3A 3LSSA 4P3NA 4CS3A 4YYEA 3A7RA 2ARSA 3L1AA 2DVEA 2DQ0A 2I4NA 1EFWA 3G1ZA 1WQ7A 4K86A 1SESA 4L87A 4UPAA 3OD1A 4ZIBA 2AMCA 2HNIA 4DPGA 5ELNA 5E3IA 3L2ZA 3I7FA 4YRIA 1G51A 4OLFA 4LVIA 2ZIOA 3TEHA 2DZCA 3TUPA 4UP8A 2AKWA 3PCOA 3WQZA 1BBUA 1E24A 4TQDA 3V8JA 4KQEA 3IG2A 4RQFA 1FYFA 5ELOA 2ZT5A 3DSQA 3VQXA 1X56A 3A32A 4CH6A 1X2GA 4YRLA 3FJPA 3HXUA 2ODRD 4HA8A 4TVYA 4CS4A 3NETA 3RKXA 3QO8A 3HXVA 3E9IA 2CJAA 4RMFA 2DTHA 1VQZA 5K1PA 1B7YA 4LVMA 4H02A 1X2HA 2E3CA 4YRPA 1Z7MA 3MF1A 4XTXA 3HXYA 4YP0A 1WLEA 2ZCEA 3A5YA 4XU3A 3UH0A 3HFZB 3HRKA 4XU1A 2CIMA 2DTIA 1X54A 1X55A 4HWSA 2QHSA 4CH3A 1BIBA 3V7SA 4P75C 3RKYA 2EJGA 2ZT6A 4TQFA 2DTOA 2RHSA 2ZZEA 4P73A 4WJ3M 4KR3A 4YRKA 1JJCA 3RKWA 1NJ1A 4OP0A 2ZT7A 2ZT8A 2PMEA 2CJ9A 3HXWA 2ZR2A 2I4OA 2A8EA 1LYLA 3KFUA 4YCVA 1SETA 1HTTA 2AMCB 4TVWA 2E64A 1E1TA 3RIRA 3M4PA 3TEHB 4X5OA 4YRTA 3RF1A 4LVLA 1WU7A 4CH4A 4YRSA 1USYA 4WI1A 2E5AA 3V7CA 1WQWA 3PCOB 4YRFA 5HGQA 2ZGWA 4YDQA 4P74A 1NYQA 4HWOA 1ADYA 1IL2A 1Z7NA 2EJ9A 4LVJA 12ASA 4CS2A 2ZTGA 1ASYA 4H2VA 4YREA 3VQYA 4XTWA 4XTUA 5C51B 1NJ2A 4YCUA 4E51A 1H4QA 2J3LA 1USYC 2QHTA 4NCXA 1QF6A 1H4TA 4P74C 4H2XA 4P3OA 1B7YB 1YGBA 1G5HA 3HXXA 2ZNIA 3R07A 2EAYA 4P72C 3HTZA 3QO5A 4O2DA 3A5ZA 3PZCA 4YRMA 1KMNA 4BW9A 1X01A 2P5IA 1NJ6A 4WJ4A 1QE0A 4CH5A 2RHSB 3A74A 4TVAA 1SRYA 3RACA 4WF2A 2DU7A 4YROA 1EVKA 1HC7A 2IY5B 3VBBA 4P75A 2DXTA 4BWAA 4ZTUB 3A7UA 4TWAA 1NNHA 4PHCA 4EX5A 4H2WA 3P8YA 3P8TA 2ARUA 1J5WA 3L4GB 4XTYA 2ZINA 4G84A 4YRRA 3HFVA 4Q6GA 3RGLA 2C8MA 2Q5IA 2DXUA 3IALA 4HWTA 3LC0A 2E10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7G A;  4YRN A;  1EIY A;  3IKL A;  5KNN A;  2ZNJ A;  4KR2 A;  4H2X B;  4YRJ A;  2XTI A;  3CMQ A;  1E1O A;  1KMM A;  3BFM A;  4XEM A;  3NEL A;  2G4C A;  3RUX A;  3V7R A;  2ZZG A;  2AKW B;  1WPY A;  3VQW A;  1EOV A;  2DEQ A;  4TTV A;  1EVL A;  4TVA B;  5K1X A;  4H2Y A;  1GGM A;  4P72 A;  1NYR A;  4K88 A;  4XEO A;  1H4S A;  3M4Q A;  4H2T A;  4P3P A;  2E1H A;  2E41 A;  3A31 A;  3A7A A;  1BBW A;  3REU A;  1B76 A;  1B70 A;  2I4L A;  1NJ5 A;  1ATI A;  1W66 A;  4RQE A;  1WYD A;  3BJU A;  2ODR C;  3REX A;  2RHQ A;  1ASZ A;  2DZ9 A;  4P71 A;  3MF2 A;  4H2S A;  3HY1 A;  3UGQ A;  4RDX A;  3LSQ A;  3V8K A;  4XTZ A;  2ALY A;  2DKG A;  1JJC B;  1PYS A;  3MEY A;  2Q5H A;  4Q15 A;  4J15 A;  4HVC A;  2I4M A;  3HY0 A;  3NEM A;  4P71 C;  1G5I A;  1NJ8 A;  4YCW A;  2EWN A;  4AH6 A;  3E9H A;  1EIY B;  2ART A;  1YFR A;  2ZXF A;  4XTV A;  1B8A A;  2QHV A;  4ZTZ B;  4YRQ A;  3IKM B;  3QNE A;  2C7I A;  1L0W A;  3TEG A;  2XGT A;  3RL6 A;  2P0L A;  2ZR3 A;  1YFS A;  2DJZ A;  11AS A;  3QO7 A;  2EL9 A;  3QTC A;  4G85 A;  1YB3 A;  2J3M A;  2EJF A;  3W3S A;  2CGH A;  3UFG A;  5F5W A;  2QHU A;  1H4V B;  1SER A;  1RIQ A;  3NEN A;  3P8V A;  2ZZF A;  5C53 B;  4YRG A;  2DDZ A;  3HXZ A;  4K87 A;  1YFT A;  3EFR A;  1C0A A;  4LNS A;  3V8L A;  2FYK A;  4HWP A;  1KOG A;  4XU2 A;  3VQV A;  3ICA A;  4H2U A;  2CJB A;  2PMF A;  1B70 B;  2ZIM A;  2Q7E A;  4XU0 A;  2E65 A;  1WNL A;  1EQR A;  1HXD A;  4YPF A;  2IY5 A;  2RHQ B;  4UP7 A;  2Q7H A;  5C52 B;  1E22 A;  3ERR A;  4P73 C;  3UGT A;  2DQ3 A;  2ALY B;  1ADJ A;  4UP9 A;  4HWR A;  3L4G A;  3HFZ A;  1PYS B;  3HRI A;  4DQ2 A;  4EO4 A;  4YRC A;  2DU5 A;  1N9W A;  3EFS A;  1BIA A;  4PG3 A;  3LSS A;  4P3N A;  4CS3 A;  4YYE A;  3A7R A;  2ARS A;  3L1A A;  2DVE A;  2DQ0 A;  2I4N A;  1EFW A;  3G1Z A;  1WQ7 A;  4K86 A;  1SES A;  4L87 A;  4UPA A;  3OD1 A;  4ZIB A;  2AMC A;  2HNI A;  4DPG A;  5ELN A;  5E3I A;  3L2Z A;  3I7F A;  4YRI A;  1G51 A;  4OLF A;  2ZIO A;  3TEH A;  2DZC A;  3TUP A;  4UP8 A;  2AKW A;  3PCO A;  3WQZ A;  1BBU A;  1E24 A;  4TQD A;  3V8J A;  4KQE A;  3IG2 A;  4RQF A;  1FYF A;  5ELO A;  2ZT5 A;  3DSQ A;  3VQX A;  1X56 A;  3A32 A;  4CH6 A;  1X2G A;  4YRL A;  3FJP A;  3HXU A;  2ODR D;  4HA8 A;  4TVY A;  4CS4 A;  3NET A;  3RKX A;  3QO8 A;  3HXV A;  3E9I A;  2CJA A;  4RMF A;  2DTH A;  1VQZ A;  5K1P A;  1B7Y A;  4H02 A;  1X2H A;  2E3C A;  4YRP A;  1Z7M A;  3MF1 A;  4XTX A;  3HXY A;  4YP0 A;  1WLE A;  2ZCE A;  3A5Y A;  4XU3 A;  3UH0 A;  3HFZ B;  3HRK A;  4XU1 A;  2CIM A;  2DTI A;  1X54 A;  1X55 A;  4HWS A;  2QHS A;  4CH3 A;  1BIB A;  3V7S A;  4P75 C;  3RKY A;  2EJG A;  2ZT6 A;  4TQF A;  2DTO A;  2RHS A;  2ZZE A;  4P73 A;  4WJ3 M;  4KR3 A;  4YRK A;  1JJC A;  3RKW A;  1NJ1 A;  4OP0 A;  2ZT7 A;  2ZT8 A;  2PME A;  2CJ9 A;  3HXW A;  2ZR2 A;  2I4O A;  1LYL A;  3KFU A;  4YCV A;  1SET A;  1HTT A;  2AMC B;  4TVW A;  2E64 A;  1E1T A;  3RIR A;  3M4P A;  3TEH B;  4X5O A;  4YRT A;  3RF1 A;  1WU7 A;  4CH4 A;  4YRS A;  1USY A;  4WI1 A;  2E5A A;  3V7C A;  1WQW A;  3PCO B;  4YRF A;  5HGQ A;  2ZGW A;  4YDQ A;  4P74 A;  1NYQ A;  4HWO A;  1ADY A;  1IL2 A;  1Z7N A;  2EJ9 A;  12AS A;  4CS2 A;  2ZTG A;  1ASY A;  4H2V A;  4YRE A;  3VQY A;  4XTW A;  4XTU A;  5C51 B;  1NJ2 A;  4YCU A;  4E51 A;  1H4Q A;  2J3L A;  1USY C;  2QHT A;  4NCX A;  1QF6 A;  1H4T A;  4P74 C;  4H2X A;  4P3O A;  1B7Y B;  1YGB A;  1G5H A;  3HXX A;  2ZNI A;  3R07 A;  2EAY A;  4P72 C;  3HTZ A;  3QO5 A;  4O2D A;  3A5Z A;  3PZC A;  4YRM A;  1KMN A;  4BW9 A;  1X01 A;  2P5I A;  1NJ6 A;  4WJ4 A;  1QE0 A;  4CH5 A;  2RHS B;  3A74 A;  4TVA A;  1SRY A;  3RAC A;  4WF2 A;  2DU7 A;  4YRO A;  1EVK A;  1HC7 A;  2IY5 B;  3VBB A;  4P75 A;  2DXT A;  4BWA A;  4ZTU B;  3A7U A;  4TWA A;  1NNH A;  4PHC A;  4EX5 A;  4H2W A;  3P8Y A;  3P8T A;  2ARU A;  1J5W A;  3L4G B;  4XTY A;  2ZIN A;  4G84 A;  4YRR A;  3HFV A;  4Q6G A;  3RGL A;  2C8M A;  2Q5I A;  2DXU A;  3IAL A;  4HWT A;  3LC0 A;  2E10 A; 
#chains in the Genus database with same CATH topology
 2Q7G A;  4LFB T;  2XAH B;  3I0Q A;  4PNI A;  4KR2 A;  3MA9 A;  1KMM A;  4ILU A;  4IDN A;  3SOL A;  3RUX A;  5L4H A;  3ZEF B;  2FJA A;  5HEO A;  3MKD A;  3O4X E;  2JQQ A;  1EOV A;  3OPC A;  1DU2 A;  5JDH A;  4UV8 B;  4TTV A;  2BDE A;  1GGM A;  3CQC B;  4PK6 A;  3F57 A;  3AEA A;  1VCT A;  4K88 A;  5L3D B;  3M4Q A;  2I0M A;  5AQS B;  1T72 A;  3ZSS A;  3VKH A;  4AQF A;  4X65 T;  3I9W A;  1WYD A;  4EB6 E;  1YQ4 A;  4HFB A;  4LF5 T;  1ASZ A;  4MFR A;  2CM0 A;  4ASK A;  3LK3 B;  2HN1 A;  2D0T A;  3JC6 D;  2A3D A;  1N32 T;  3NWI A;  3WI3 A;  1WYB A;  2DKG A;  2VVN A;  3MEY A;  3LJC A;  4YT0 A;  2IAK A;  4HVC A;  1XNR T;  4C90 A;  2K48 A;  3NEM A;  4TUY E;  2SPC A;  2OV9 A;  5AQL B;  3AAE B;  5LG3 A;  4HFE A;  2ART A;  2ES0 A;  4N78 D;  2IML A;  3FXD B;  3IKM B;  4G2A A;  2XGT A;  2WDR A;  3ONJ A;  3VRA A;  2EL9 A;  2XAQ B;  4LVK A;  4EIW A;  4G85 A;  4UVC B;  5F5W A;  1WFD A;  4IE0 A;  1SER A;  1H7C A;  3TLS A;  5CA0 E;  4YRG A;  3AA6 B;  3HXZ A;  4K87 A;  1YFT A;  4UEM A;  3EFR A;  2XM2 A;  4BA9 A;  3V8L A;  2XQA A;  2N2N A;  3VRB A;  3A5X A;  2PTF A;  2CBJ A;  3CKD A;  3JAF A;  1HF8 A;  3KVB A;  4U3C A;  5FL0 A;  4TNV A;  2VL8 A;  1W0B A;  4X1K E;  2UUC T;  2V5C A;  1WNL A;  3K3Q C;  2M6I A;  4B3T T;  2OLT A;  4IDQ A;  3P4P A;  2BVL A;  4XBF B;  2YK0 A;  2IUB A;  5FXZ A;  5FY1 A;  4E7Z A;  5LNK A;  3HFZ A;  3LK2 B;  4AKH A;  2CWO A;  4EO4 A;  5KXJ A;  4CXX A;  3EFS A;  2YDQ A;  3FHN A;  5LCY A;  4PG3 A;  5ABE A;  3R6N A;  4NXN T;  2XAG B;  5LYJ E;  1IJ6 A;  1X79 A;  4YYE A;  3L1A A;  3HKC E;  2DVE A;  2NOX A;  2DQ0 A;  2H7O A;  2YU1 A;  1T8B A;  2K9A A;  1M62 A;  2AMC A;  4DPG A;  2A2F X;  3I7F A;  3I0O A;  2ZM6 T;  4PFO A;  2ZIO A;  2KMF A;  4IL4 A;  3P50 A;  5FVK A;  4KP3 C;  4YHH T;  4H9R C;  4U31 A;  3VKG A;  3AE3 A;  4NPP A;  3L09 A;  2ZT5 A;  3VQX A;  1ZV4 X;  3VR8 A;  5ABF A;  4XAX B;  1MNE A;  1UX5 A;  4HA8 A;  1V9D A;  4KX6 A;  3ZT5 A;  4B3M T;  4KUM B;  5L3C B;  3RYC E;  1VOM A;  1VQZ A;  2GK9 A;  2CHO A;  3CX6 B;  2E3C A;  2N1G A;  3MF1 A;  3HXY A;  4YP0 A;  2E9X B;  2ZCE A;  5HXH A;  2FBW A;  3HFZ B;  5AQG B;  2WDV A;  3UUL A;  2BG9 E;  2L3L A;  3V7S A;  3EDU A;  4ZS2 A;  2RHS A;  2H89 A;  4IE6 A;  3BQK A;  4P1N A;  3LSV A;  4YRK A;  1JJC A;  2XSA A;  3RKW A;  1UX4 A;  4GKK T;  4QX7 B;  4OP0 A;  4PJN A;  3FZH B;  2ZT7 A;  2V7K A;  2P9B A;  2ZR2 A;  4HFC A;  2LOS A;  3H3M A;  4U74 A;  4YCV A;  2W2U A;  1HTT A;  2AMC B;  4AIS A;  4ANJ A;  3N2G E;  4YRT A;  2OA5 A;  5LB7 B;  2QRX A;  4OX9 T;  5FXW A;  4O2A E;  3V7C A;  1X9B A;  3FZK B;  3ESL A;  4Z91 A;  3Q9D A;  1NYQ A;  1D0Y A;  1LVK A;  3OBV E;  1UGO A;  2J4G A;  2WAU A;  4A97 A;  4LVJ A;  1KNZ A;  4CS2 A;  3B13 A;  5ABF B;  4H2V A;  2WMO A;  2CHN A;  1D1A A;  3PDY A;  3WAJ A;  4H2X A;  4P3O A;  1YGB A;  1QSD A;  4COF A;  2JIW A;  2YOE A;  3HL6 A;  2BVM A;  3M3Z B;  5JDQ A;  2PBI A;  2LJL A;  3ZPO A;  2M67 A;  1KFY A;  4QH5 A;  4DV6 T;  3HTZ A;  3A5Z A;  2KLQ A;  3UFE A;  2YDS A;  1S94 A;  3CML A;  5LHI B;  1NJ6 A;  5JQG E;  2XHE B;  4CH5 A;  2XAJ B;  1KF6 A;  1NAF A;  2RHS B;  1SRY A;  3AXJ A;  2W67 A;  3AE8 A;  3RRW A;  1EVK A;  1HC7 A;  2WU5 A;  2CE7 A;  2IY5 B;  4BWA A;  3GWH A;  1BR4 A;  4YLH A;  4TWA A;  3T1Y T;  4AQY T;  4NIQ A;  3C98 B;  1D0X A;  2LHR A;  3L4G B;  4H9S E;  1G73 A;  2JMK A;  3CK6 A;  2AXD S;  3DJB A;  3CQX C;  3AEG A;  3AVR A;  2C8M A;  5HYA A;  4LMK A;  2K5B B;  2D5U A;  3BQI A;  3RH3 A;  2E10 A;  5FYM A;  3P4R A;  3AEE A;  5AQK B;  3N9Q A;  1ZP0 A;  2F4V T;  3NRX A;  2LHN A;  4OFZ A;  4H2X B;  4YRJ A;  4P09 A;  3JAD A;  4EXT A;  3NVO A;  4ZZB A;  3U78 A;  4LF6 T;  3NEL A;  3NZQ A;  4H9O C;  4HE8 A;  2B76 A;  5BR8 T;  4UEL A;  4XZC A;  2I6H A;  4HWF A;  5L3G B;  4IL9 A;  3KV9 A;  2VQE T;  2X0H A;  3GA8 A;  3OYZ A;  2WZH A;  1EVL A;  5K1X A;  2CXF A;  4AI6 A;  3DTO A;  2RA1 A;  1ZKE A;  1NYR A;  3CWZ B;  5HCJ A;  5FP3 A;  4ZI3 C;  4XEO A;  3ANW A;  3FXE B;  4H2T A;  2E1H A;  4O4I E;  3C50 A;  3A7A A;  3REU A;  3ABV A;  1B76 A;  3TKL B;  2UU9 T;  2RPA A;  2XQ5 A;  4CI1 B;  3TLT A;  4FI5 A;  5FKY A;  1N36 T;  2J62 A;  2DZ9 A;  4P71 A;  3N9N A;  2MYS A;  5DJQ C;  5KMG P;  3U3I A;  1D0Z A;  4H2S A;  3Q5D A;  1FJG T;  1Y01 A;  4HWC A;  2DCF A;  3LSQ A;  2I59 A;  4XTZ A;  2NS6 A;  3HI2 A;  4JYA T;  4Q15 A;  2Q5H A;  2I4M A;  2YU2 A;  2E5L T;  4P71 C;  1G5I A;  4YCW A;  3E9H A;  2RP4 A;  5HXR A;  4TX5 A;  1B8A A;  2QHV A;  4H9P C;  4ZTZ B;  4CXW A;  2HHH T;  1IBL T;  3QNE A;  1L0W A;  4B6X A;  2P0L A;  1YFS A;  3IHR A;  3QO7 A;  3QTC A;  1YB3 A;  3AED A;  2NTY A;  2EJF A;  3Q5X A;  2VKH A;  2B1E A;  2KT9 A;  2V1D B;  4DV1 T;  2PFV A;  4P0B A;  3P8V A;  2ZZF A;  4JBW F;  2D9D A;  4PJJ A;  3PU3 A;  1M7K A;  4H63 H;  4O4L E;  4ZI7 E;  3IA3 A;  2BS2 A;  4DND A;  1AJ3 A;  3TLV A;  2CEA A;  3VU7 H;  2LEH A;  1EZ3 A;  2FYK A;  3ANW B;  5JRC A;  2X68 A;  4XU2 A;  2ZM0 A;  3ICA A;  3HA4 A;  4H2U A;  5HXC A;  2W66 A;  2ZIM A;  2WWV A;  5F8P A;  2VKD A;  4QHO A;  4PK5 A;  2E65 A;  3LBX A;  4DV2 T;  4UP7 A;  1HNW T;  1D1C A;  2Q7H A;  5C52 B;  5EK2 A;  3WAK A;  1E22 A;  3ERR A;  2DQ3 A;  4YTM A;  4UP9 A;  4AIU A;  2XQ6 A;  4HWR A;  2H7V C;  2W61 A;  2X9W A;  2UXN B;  1T7S A;  5HEJ A;  2IC6 A;  1YKE B;  3KVA A;  2ODU A;  3E08 A;  4KMC A;  3A7R A;  4PFP A;  2HH7 A;  2ARS A;  5FNV E;  4ZI2 C;  5JR9 A;  2LKH A;  5LMN T;  4K86 A;  3N2K E;  3ONX A;  4L87 A;  2BS4 A;  4QWN B;  3K3N A;  4UPA A;  3OD1 A;  3C51 A;  4ZIB A;  4QXH B;  3L2Z A;  4YRI A;  4OLF A;  4LVI A;  4YJ3 E;  3AB3 B;  2D0U A;  5J0Z A;  5IYZ E;  2Z6E A;  1QLB A;  3TUP A;  5JR9 C;  4UP8 A;  3EHZ A;  2AKW A;  4ZI3 D;  2XTL A;  5JTG A;  4TQD A;  5EZY E;  5TAO A;  4EGW A;  5JRC B;  5ELO A;  3RQU A;  4QX8 B;  5LHH B;  4TZ4 C;  3A32 A;  3BK9 A;  4IDO A;  4YRL A;  3FJP A;  3HXU A;  4C91 A;  1BR1 A;  2LSG A;  4EAH A;  2Y8D A;  3LBX B;  4DR6 T;  2BS3 A;  3NET A;  3RKX A;  2C5J A;  2CJA A;  3CVR A;  2LOP A;  3Q5E A;  1XNQ T;  4H02 A;  4O4J E;  3AVS A;  3MAC A;  4AKL A;  4OYJ A;  4ILB A;  1Z0P A;  2KZ7 B;  3A5Y A;  1IZN B;  3X1D A;  1NEK A;  2DLR A;  2DL1 A;  3KBT A;  4BJM A;  5JDF A;  1X54 A;  3MJX A;  4HWS A;  3UU4 A;  4CH3 A;  1BIB A;  2XJ7 A;  3AE9 A;  4TQF A;  2XUE A;  1HX1 B;  4EZ4 A;  3MK7 C;  2UUA T;  1NJ1 A;  2CA5 A;  3ETU A;  2CJ9 A;  4GYR A;  5JR9 B;  2W63 A;  3CQG B;  5IWA T;  4O8S A;  4Q25 A;  3FZM B;  4DV0 T;  5HEU A;  4TVW A;  2WQY A;  3QUJ A;  4ZS3 A;  1IAP A;  2KWH A;  2E64 A;  5JH7 E;  3OKQ A;  3ZJ1 A;  3EAM A;  2XZE A;  4YRS A;  1USY A;  4GK0 E;  1GQE A;  3IBP A;  3M65 A;  4YRF A;  5HGQ A;  2N9D A;  4YDQ A;  4HTE A;  3P4W A;  4DBR A;  1IL2 A;  2NW9 A;  4IE4 A;  2V6X A;  2EJ9 A;  5JDG A;  4A98 A;  1ASY A;  1HR0 T;  3VQY A;  2CPT A;  4XTW A;  4XTU A;  5C51 B;  1NJ2 A;  2XSB A;  3PUY F;  5EK4 A;  5LBM A;  4E51 A;  4X1I E;  1USY C;  3EUH A;  4ZZC A;  4JI5 T;  1XDO A;  2D2S A;  4IE7 A;  2Q9Q A;  1ZHC A;  2V7J A;  3UU5 A;  3UUN A;  3UUM A;  5BMV E;  4P72 C;  2NR4 A;  4O2D A;  3PZC A;  3AAI A;  1U4Q A;  3HR0 A;  4ZEY A;  2L9Q A;  1US7 B;  3AE7 A;  4M1P A;  2FJE A;  1QE0 A;  2X0L B;  3O1J A;  3NRY A;  4YFS A;  2HPJ A;  3RAC A;  2Q9Q C;  2J47 A;  2BKO A;  4ZI2 D;  2ZM2 A;  1Z8U A;  3KV4 A;  1E7P A;  4LF8 T;  4IST A;  5HXS A;  5AQH B;  5GON E;  4LFC T;  4ZTU B;  2UXC T;  3A7U A;  4QXC B;  5LG4 A;  5LXT E;  1KK7 A;  4V1A v;  2V5D A;  4EV6 A;  2XQ8 A;  2MBG A;  5LJM A;  4EX5 A;  5L3B B;  3P8Y A;  2EHO A;  3CPZ A;  4XTY A;  3QC9 A;  3HKE E;  2ZIN A;  4YRR A;  1SE7 A;  2V8S V;  2L8K A;  3E0Z A;  2QA7 A;  4I50 E;  2FJD A;  5LMU T;  1B7T A;  2NW8 A;  3SFE A;  2DXU A;  4J2C A;  3C4X A;  3CX8 B;  4PJL A;  3A7M A;  1YXR A;  2EHO C;  4WNK A;  4AXP A;  2ZNJ A;  1LKX A;  2K3W A;  2WP9 A;  3K1S A;  3CMQ A;  5L47 A;  2QGS A;  1LVF A;  3PJA A;  2Q9Q B;  2G4C A;  4JI8 T;  2CLY C;  4TN7 B;  4NXM T;  3TLW A;  2ZZG A;  2KXP B;  1WPY A;  3RYH E;  3IF8 B;  5LGN B;  4HFV A;  4GOU A;  4DR5 T;  3VQW A;  5M4Y A;  3O9X A;  4IHJ E;  3T1H T;  1HS7 A;  3O1I A;  5LJN A;  3KIN B;  1WRD A;  4HWD A;  4CI3 B;  2UXX B;  4DMV A;  2WY2 A;  1KEY A;  1H4S A;  3NKZ A;  3UQ4 A;  3PTR B;  1HNX T;  2E41 A;  4P3P A;  2DI4 A;  3QNU A;  3A31 A;  4HFH A;  3PV0 F;  2CRB A;  1BBW A;  1B70 A;  2I4L A;  3NZP A;  2X67 A;  3AEB A;  1W66 A;  4RQE A;  3B57 A;  2A9U A;  3BJU A;  3Q5W A;  5DQV A;  3REX A;  2EHO B;  4JI4 T;  2YEV C;  2VVS A;  4Z8X A;  1R8I A;  3MF2 A;  2DNX A;  3HY1 A;  4UIG A;  3ZN1 B;  3L3P A;  5JRE A;  3MXZ A;  3K3O A;  5HXE A;  4RDX A;  1NWM X;  3V8K A;  4ZOL E;  2X9H A;  1JJC B;  4JI2 T;  4K0K T;  3CX7 B;  3N9L A;  1XDP A;  2ZLY A;  3RPU A;  5CB4 E;  5C2T A;  3D0T A;  3LFM A;  1NJ8 A;  2EWN A;  1IBK T;  4YJ2 E;  2LKG A;  1UUR A;  1YFR A;  4XTV A;  5HEG A;  1UCU A;  4JEU B;  1YKH B;  4UVA B;  3RL6 A;  5IHY A;  4O2B E;  2DJZ A;  3RYF E;  2VUR A;  11AS A;  5LGT B;  2CBI A;  2V7M A;  3W3S A;  3PUA A;  4AKR B;  1JNZ A;  3UFG A;  2XQ4 A;  4X5T A;  3RC8 A;  2QHU A;  2K24 A;  4CN4 A;  2NW7 A;  1RIQ A;  3NEN A;  3ZLI A;  4I0U A;  2PG8 A;  2Q9Q D;  3VHL A;  3MQZ A;  5C53 B;  3I9Y A;  2DDZ A;  2AE9 A;  3QB5 A;  1C0A A;  4LNS A;  4GK5 E;  4BJN A;  1KOG A;  2WU2 A;  3O1H A;  3VQV A;  2PMF A;  3PJA J;  1B70 B;  2Q7E A;  4XU0 A;  5AQQ B;  3NBX X;  2YKS A;  4YSZ A;  1EQR A;  1HXD A;  4YPF A;  2KND A;  2XQY A;  2JQH A;  4TNW A;  4AQG A;  4KHZ F;  3ZMV B;  4DV7 T;  1W0A A;  4P73 C;  3UGT A;  3RIF A;  4U2Z A;  3OVU A;  3N9M A;  4LF4 T;  1ADJ A;  5AQT B;  1HCI A;  4G63 A;  3AXJ B;  2EHO D;  2H88 A;  3AAA B;  4HFI A;  4JI6 T;  4DQ2 A;  3JCF A;  2DU5 A;  4YTP A;  3AE6 A;  2JQ9 A;  4EZH A;  2VK9 A;  1BIA A;  5FMN A;  5E0O A;  3S4U A;  2CXL A;  4P3N A;  2CCQ A;  2X9Y A;  4ERR A;  3UU8 A;  4JI7 T;  2I4N A;  3RIA A;  1EFW A;  2JQK A;  2UXB T;  2UXD T;  5L2L A;  2V7I A;  1WYC A;  1FMW A;  2X66 A;  4CQI A;  2IC9 A;  3PU8 A;  5HCM A;  3PUZ F;  2HNI A;  1S35 A;  4DR7 T;  3TEH A;  1WR6 A;  3CIR A;  4JV5 T;  4WW0 A;  3GN5 A;  2KSR A;  3PCO A;  4I4T E;  4QXB B;  3WQZ A;  3UT5 E;  4DR2 T;  1BBU A;  3V8J A;  4KQE A;  1KNR A;  4RQF A;  5JDM A;  1FYF A;  1X56 A;  4JI3 T;  3HKB E;  2G0U A;  1NEN A;  4ZXL A;  2VQF T;  4TWH A;  4K0U A;  4TVY A;  4CS4 A;  5AFU L;  5ADX L;  1WR0 A;  3QO8 A;  3E9I A;  2DTH A;  4L9I A;  1B7Y A;  1X2H A;  3JAE A;  1MMD A;  3RX6 A;  3ZYL A;  2NP9 A;  2VB6 A;  4TWD A;  1OED A;  3UQ7 A;  1WLE A;  2WBL A;  5C8Y E;  5AQM B;  1XMQ T;  4DR4 T;  3ZCI A;  1FIO A;  4X1Y E;  4LMJ A;  3F31 A;  4FJO A;  4DMW A;  2DTI A;  4HGA A;  2IIU A;  4ISS A;  1BR0 A;  4P75 C;  2KIN B;  3RKY A;  2EJG A;  2ZT6 A;  3H37 A;  3ZC1 A;  2ZZE A;  2XAS B;  4UV9 B;  1OED C;  2YN6 A;  4WBN E;  4DR1 T;  2ODV A;  2IHR 1;  3G06 A;  3HXW A;  2A8E A;  3ONL C;  3T8O A;  5H6R B;  1IBM T;  3KFU A;  1LRZ A;  1SET A;  1E1T A;  2ACX A;  1N34 T;  1I6Z A;  2WWU A;  2H3R A;  3TEH B;  1T98 A;  3RF1 A;  3AEF A;  4LVL A;  4CH4 A;  2X51 A;  2E5A A;  5AQU B;  3GN5 B;  1WQW A;  3PCO B;  1L0V A;  2IDO B;  4P74 A;  4AKI A;  4HWO A;  1ADY A;  5FY7 A;  4U33 A;  4U72 A;  2NWB A;  4HN9 A;  12AS A;  4UXN B;  4EYY R;  3AA1 B;  4UF0 A;  4YRE A;  3P7I A;  3OJA A;  4YSY A;  3OYX A;  4YCU A;  2J3L A;  2C5K T;  3RYI E;  1JNR A;  3K8P C;  4QH1 A;  3I1A A;  1QF6 A;  4KI0 F;  1H4T A;  4P74 C;  1B7Y B;  4DUZ T;  3C64 A;  3HXX A;  5AQP B;  2ZNI A;  1OED B;  1O3X A;  4DO0 A;  4KHP T;  5JVD E;  2ZMA A;  2EAY A;  1J1J A;  1OXZ A;  3DP7 A;  4PK4 A;  4MLK A;  4BW9 A;  3ZMU B;  2WZI A;  1MMG A;  2P5I A;  4DR3 T;  4AQF C;  3PUW F;  4LF9 T;  4TVA A;  1YQ3 A;  5AQO B;  2DU7 A;  2BKN A;  4WF2 A;  1MIV A;  4I55 E;  3LK4 2;  3FZF B;  4X62 T;  4HEA A;  2W00 A;  5CA1 E;  4I43 B;  4B3R T;  5C3J A;  4OYK A;  2XM1 A;  4L5G A;  3EVY A;  2JMH A;  1HFA A;  2VKJ A;  1NNH A;  5LHG B;  3N9O A;  1YW0 A;  4LF7 T;  3P8T A;  2ARU A;  3QOF A;  1KNP A;  4A56 A;  4G84 A;  4TV9 E;  4QH4 A;  3RHW A;  4Q6G A;  5EK3 A;  3ZJ2 A;  4JLE A;  1I94 T;  5CJ5 A;  4YY3 T;  5IUX A;  4GKJ T;  4JI1 T;  2Q5I A;  5LP6 E;  2Y6X A;  2XQ9 A;  2BKP A;  3KFW X;  4DV3 T;  3IAL A;  3SWH A;  4UF0 B;  3ZMS B;  3ZST A;  3LC0 A;  3SRZ A;  4JEH B;  2JPF A;  1D1B A;  4YRN A;  4WYV A;  4EYU A;  1EIY A;  2M6B A;  3L8R A;  3IKL A;  5KNN A;  4PAG A;  1W9R A;  2ACZ A;  2XTI A;  1E1O A;  1SA0 E;  1MND A;  3VR9 A;  4X64 T;  2CXD A;  3BFM A;  3L39 A;  4XEM A;  2WS3 A;  1FMV A;  2BBJ A;  5LBQ B;  2W62 A;  2DHR A;  2YDR A;  5CGM A;  3V7R A;  2X9X A;  4ADZ A;  5FY0 A;  2LE8 A;  2AKW B;  3RRC A;  4BAY B;  2X0Y A;  5J2U E;  2XQ7 A;  3FBL A;  2E9X A;  2DEQ A;  4UVB B;  2LM9 A;  2VKO A;  3KDS E;  4IT4 A;  4NUU A;  4TVA B;  3PUV F;  4H2Y A;  4P72 A;  5L3F B;  2MTQ A;  1MIY A;  2XAF B;  2XQ3 A;  5HWY A;  5FXX A;  2LLY A;  3ZMT B;  2E9X C;  1NJ5 A;  1HTJ F;  1ATI A;  2E2A A;  4DVD A;  4AKG A;  1UK5 A;  4B3S T;  2ODR C;  1Y64 B;  3V5U A;  3OTO T;  2RHQ A;  4HWI B;  4PW8 A;  1WLX A;  2LRL A;  3ZN0 B;  5JDL A;  5HEH A;  1WCR A;  4P0A A;  3UGQ A;  3P4S A;  4MAL A;  3PUX F;  2R6G F;  4IGU A;  2ALY A;  1PYS A;  2VAS A;  4J15 A;  2IW5 B;  4U7I A;  3H3A A;  3HY0 A;  3KV5 A;  3ZYM A;  4AH6 A;  2MAW A;  3AE5 A;  2JRK A;  4LML A;  1EIY B;  2ZXF A;  4U7Y A;  3KV6 A;  4CI2 B;  3W15 B;  4YRQ A;  4NUV A;  5AQN B;  2C7I A;  3TEG A;  4DV4 T;  3GMI A;  5ABG A;  3ZC0 A;  2ZR3 A;  4CN1 A;  1E1H B;  3RQW A;  1XZY A;  3PUR A;  4CN6 A;  2J3M A;  5AQR B;  2NTX A;  2CGH A;  1MIW A;  1J5E T;  3AE4 A;  4YHJ A;  1H4V B;  2LRK A;  3UUB A;  5DAB A;  2BBH A;  4LFA T;  5ABH A;  1UUS A;  4HWP A;  2CJB A;  3RC3 A;  4WBO A;  5HWX A;  1N33 T;  4MHC A;  4OHF A;  1OWA A;  5FL1 A;  1VRB A;  2IY5 A;  2RHQ B;  4HT4 A;  2QYW A;  1HNZ T;  4IDZ A;  3ZCJ A;  2BG9 A;  3RKG A;  3E22 E;  2HPL A;  5J2T E;  4YSX A;  4DID B;  1ZEE A;  4ZHQ E;  2KWI B;  2ALY B;  3LDQ B;  3L4G A;  1PYS B;  3HRI A;  3EAB A;  3B5M A;  3N9P A;  2FUP A;  4PJM A;  5KDM C;  4YRC A;  1N9W A;  1E2A A;  2MPK A;  4KBM B;  3AE1 A;  5DQW A;  2BG9 C;  3LSS A;  4CS3 A;  2JJ9 A;  3G1Z A;  1WQ7 A;  1SES A;  4A5X A;  1HG5 A;  4DBQ A;  5ELN A;  3KBU A;  5E3I A;  1G51 A;  2XY8 B;  5ETW A;  2DZC A;  2CLY B;  1XMO T;  5FXV A;  3SFD A;  1E24 A;  3IG2 A;  3C4Z A;  3DSQ A;  3EDV A;  2E9X D;  2ZM8 A;  4X66 T;  2V6Y A;  4CH6 A;  1X2G A;  3LG7 A;  5L3E B;  3P8C D;  3PUQ A;  3ZT7 A;  2WMN A;  3UTK A;  1QUU A;  2ODR D;  1IJ5 A;  1XWM A;  2YIN A;  3HXV A;  2VWA A;  5KX5 E;  4RMF A;  4EED A;  4IIJ E;  5LA6 E;  4HFD A;  5K1P A;  1CUN A;  5LGU B;  4LVM A;  3FB2 A;  2BG9 B;  4TWF A;  4YRP A;  4EEB A;  1Z7M A;  1HX8 A;  4XTX A;  4Z90 A;  4IE5 A;  3AA0 B;  4HKA A;  4DUY T;  2W4X A;  2WB5 A;  3V5S A;  4XU3 A;  3UH0 A;  2E8I A;  1G8X A;  5H6Q B;  3HRK A;  4XU1 A;  2CIM A;  4EOZ B;  2WCA A;  5CFB A;  4TV8 E;  2DWK A;  3F2E A;  1X55 A;  2QHS A;  2C0S A;  4WZX A;  4ILA A;  3RKO A;  3QK6 A;  2J1D G;  3ZKR A;  2DTO A;  4YXD A;  4QKN A;  4P73 A;  4WJ3 M;  3FZL B;  4KR3 A;  4GYS A;  2WM9 A;  2QVA A;  3J7Y q;  5AQV B;  2ZT8 A;  2PME A;  3PE0 A;  2WSS V;  2LT3 A;  3J9X 1;  2A72 A;  1HG2 A;  2DWG A;  3TLU A;  2HN2 A;  2I4O A;  4F6R C;  3MZK B;  1LYL A;  3Q2M A;  3EI0 A;  3AE2 A;  2C5I T;  3PUS A;  3RIR A;  2Y48 B;  3M4P A;  4X5O A;  1WU7 A;  4DV5 T;  1U5P A;  4WI1 A;  5A1L A;  4OK0 A;  2ZGW A;  2LM2 A;  2FJB A;  1MMN A;  4O4H E;  3UU6 A;  2E5V A;  4F8H A;  3JC6 C;  3FBZ A;  4L0R A;  3R84 B;  1Z7N A;  5L4E A;  5JDN A;  4H9N C;  5FVL A;  2ZTG A;  2V6Y B;  4ILC A;  2V7L A;  1H4Q A;  4H63 V;  2QHT A;  2W0G A;  4NCX A;  4CXY A;  3ZT6 A;  2XPK A;  3HKD E;  3AA7 B;  3C4W A;  2LSJ A;  1G5H A;  4UR9 A;  5F3J A;  3R07 A;  3RI5 A;  3ETV A;  2WDQ A;  5AQJ B;  4E7S A;  5HAX A;  3QO5 A;  4YRM A;  4IRE A;  1ZOY A;  1KMN A;  2PJQ A;  1X01 A;  1SUM B;  1VCS A;  2V26 A;  1OED E;  4WJ4 A;  2VL0 A;  4GIW A;  3N2O A;  3A74 A;  1CHU A;  3QB5 K;  3RLF F;  4H9Q C;  1YD8 G;  4YRO A;  4MBQ A;  2MOZ A;  3P4Q A;  3UU3 A;  4IDP A;  4JI0 T;  3PUG A;  4CZZ B;  4P75 A;  3VBB A;  2DXT A;  3SS1 A;  3AEC A;  4HWH A;  1FEW A;  3A8Y C;  3IEE A;  3RIU A;  3N5L A;  5LOV E;  2LSK A;  4PHC A;  2CWY A;  2UUB T;  4H2W A;  1J5W A;  2BZB A;  3BQL A;  4YTN A;  1BR2 A;  3HFV A;  2LSY A;  4X20 E;  5AQI B;  4U2Y A;  1MMA A;  2LSI A;  5AQF B;  3RGL A;  5J1G A;  1W09 A;  4JUY A;  3ZMZ B;  3RIU C;  3ZYK A;  2CMR A;  1SHZ C;  4HWT A;  3UUX B; 
#chains in the Genus database with same CATH homology
 2Q7G A;  4YRN A;  1EIY A;  3IKL A;  5KNN A;  2ZNJ A;  4KR2 A;  4H2X B;  4YRJ A;  2XTI A;  3CMQ A;  1E1O A;  1KMM A;  3BFM A;  4XEM A;  3NEL A;  2G4C A;  3RUX A;  3V7R A;  2ZZG A;  2AKW B;  1WPY A;  3VQW A;  1EOV A;  2DEQ A;  4TTV A;  1EVL A;  4TVA B;  5K1X A;  4H2Y A;  1GGM A;  4P72 A;  1NYR A;  4K88 A;  4XEO A;  1H4S A;  3M4Q A;  4H2T A;  4P3P A;  2E1H A;  2E41 A;  3A31 A;  3A7A A;  1BBW A;  3REU A;  1B76 A;  1B70 A;  2I4L A;  1NJ5 A;  1ATI A;  1W66 A;  4RQE A;  1WYD A;  3BJU A;  2ODR C;  3REX A;  2RHQ A;  1ASZ A;  2DZ9 A;  4P71 A;  3MF2 A;  4H2S A;  3HY1 A;  3UGQ A;  4RDX A;  3LSQ A;  3V8K A;  4XTZ A;  2NS6 A;  2ALY A;  2DKG A;  1JJC B;  1PYS A;  3MEY A;  2Q5H A;  4Q15 A;  4J15 A;  4HVC A;  2I4M A;  3HY0 A;  3NEM A;  4P71 C;  1G5I A;  1NJ8 A;  4YCW A;  2EWN A;  4AH6 A;  3E9H A;  1EIY B;  2ART A;  1YFR A;  2ZXF A;  4XTV A;  1B8A A;  2QHV A;  4ZTZ B;  4YRQ A;  3IKM B;  3QNE A;  2C7I A;  1L0W A;  3TEG A;  2XGT A;  3RL6 A;  2P0L A;  2ZR3 A;  1YFS A;  2DJZ A;  11AS A;  3QO7 A;  2EL9 A;  4LVK A;  3QTC A;  4G85 A;  1YB3 A;  2J3M A;  2EJF A;  3W3S A;  2CGH A;  3UFG A;  5F5W A;  2QHU A;  1H4V B;  1SER A;  1RIQ A;  3NEN A;  3P8V A;  2ZZF A;  3MQZ A;  5C53 B;  4YRG A;  2DDZ A;  3HXZ A;  4K87 A;  1YFT A;  3EFR A;  1C0A A;  4LNS A;  3V8L A;  2FYK A;  4HWP A;  1KOG A;  4XU2 A;  3VQV A;  3ICA A;  4H2U A;  2CJB A;  2PMF A;  1B70 B;  2ZIM A;  2Q7E A;  4XU0 A;  2E65 A;  1WNL A;  1EQR A;  1HXD A;  4YPF A;  2IY5 A;  2RHQ B;  4HT4 A;  4UP7 A;  2Q7H A;  5C52 B;  1E22 A;  3ERR A;  4P73 C;  3UGT A;  2DQ3 A;  2ALY B;  1ADJ A;  4UP9 A;  4HWR A;  3L4G A;  3HFZ A;  1PYS B;  3HRI A;  4DQ2 A;  4EO4 A;  4YRC A;  2DU5 A;  1N9W A;  3EFS A;  1BIA A;  4PG3 A;  3LSS A;  4P3N A;  4CS3 A;  4YYE A;  3A7R A;  2ARS A;  3L1A A;  2DVE A;  2DQ0 A;  2I4N A;  1EFW A;  3G1Z A;  1WQ7 A;  4K86 A;  1SES A;  4L87 A;  4UPA A;  3OD1 A;  4ZIB A;  2AMC A;  2HNI A;  4DPG A;  5ELN A;  5E3I A;  3L2Z A;  3I7F A;  4YRI A;  1G51 A;  4OLF A;  4LVI A;  2ZIO A;  3TEH A;  2DZC A;  3TUP A;  4UP8 A;  2AKW A;  3PCO A;  3WQZ A;  1BBU A;  1E24 A;  4TQD A;  3V8J A;  4KQE A;  3IG2 A;  4RQF A;  1FYF A;  5ELO A;  2ZT5 A;  3DSQ A;  3VQX A;  1X56 A;  3A32 A;  4CH6 A;  1X2G A;  4YRL A;  3FJP A;  3HXU A;  2ODR D;  4HA8 A;  4TVY A;  4CS4 A;  3NET A;  3RKX A;  3QO8 A;  3HXV A;  3E9I A;  2CJA A;  4RMF A;  2DTH A;  1VQZ A;  5K1P A;  1B7Y A;  4LVM A;  4H02 A;  1X2H A;  2E3C A;  4YRP A;  1Z7M A;  3MF1 A;  4XTX A;  3HXY A;  4YP0 A;  1WLE A;  2ZCE A;  3A5Y A;  4XU3 A;  3UH0 A;  3HFZ B;  3HRK A;  4XU1 A;  2CIM A;  2DTI A;  1X54 A;  1X55 A;  4HWS A;  2QHS A;  4CH3 A;  1BIB A;  3V7S A;  4P75 C;  3RKY A;  2EJG A;  2ZT6 A;  4TQF A;  2DTO A;  2RHS A;  2ZZE A;  4P73 A;  4WJ3 M;  4KR3 A;  4YRK A;  1JJC A;  3RKW A;  1NJ1 A;  4OP0 A;  2ZT7 A;  2ZT8 A;  2PME A;  2CJ9 A;  3HXW A;  2ZR2 A;  2I4O A;  2A8E A;  1LYL A;  3KFU A;  4YCV A;  1SET A;  1HTT A;  2AMC B;  4TVW A;  2E64 A;  1E1T A;  3RIR A;  3M4P A;  3TEH B;  4X5O A;  4YRT A;  3RF1 A;  4LVL A;  1WU7 A;  4CH4 A;  4YRS A;  1USY A;  4WI1 A;  2E5A A;  3V7C A;  1WQW A;  3PCO B;  4YRF A;  5HGQ A;  2ZGW A;  4YDQ A;  4P74 A;  1NYQ A;  4HWO A;  1ADY A;  1IL2 A;  1Z7N A;  2EJ9 A;  4LVJ A;  12AS A;  4CS2 A;  2ZTG A;  1ASY A;  4H2V A;  4YRE A;  3VQY A;  4XTW A;  4XTU A;  5C51 B;  1NJ2 A;  4YCU A;  4E51 A;  1H4Q A;  2J3L A;  1USY C;  2QHT A;  4NCX A;  1QF6 A;  1H4T A;  4P74 C;  4H2X A;  4P3O A;  1B7Y B;  1YGB A;  1G5H A;  3HXX A;  2ZNI A;  3R07 A;  2EAY A;  4P72 C;  3HTZ A;  3QO5 A;  4O2D A;  3A5Z A;  3PZC A;  4YRM A;  1KMN A;  4BW9 A;  1X01 A;  2P5I A;  1NJ6 A;  4WJ4 A;  1QE0 A;  4CH5 A;  2RHS B;  3A74 A;  4TVA A;  1SRY A;  3RAC A;  4WF2 A;  2DU7 A;  4YRO A;  1EVK A;  1HC7 A;  2IY5 B;  3VBB A;  4P75 A;  2DXT A;  4BWA A;  4ZTU B;  3A7U A;  4TWA A;  1NNH A;  4PHC A;  4EX5 A;  4H2W A;  3P8Y A;  3P8T A;  2ARU A;  1J5W A;  3L4G B;  4XTY A;  2ZIN A;  4G84 A;  4YRR A;  3HFV A;  4Q6G A;  3RGL A;  2C8M A;  2Q5I A;  2DXU A;  3IAL A;  4HWT A;  3LC0 A;  2E10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...