3RGLA

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc in complex with atp and glycine
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP and glycine.
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
molecule keywords Glycyl-tRNA synthetase alpha subunit
total genus 101
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3rglA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rglA01
2AMCB 2E5AA 2ZGWA 4UPAA 3IKLA 3L4GA 4YYEA 3RL6A 3NETA 3HXWA 1QE0A 4RQFA 4P3PA 2DU5A 3G1ZA 3IKMB 1PYSB 3RKXA 2AKWA 2ZZFA 4KR3A 12ASA 2G4CA 2DZCA 3V8KA 1YGBA 3I7FA 4TQDA 2Q7EA 3A5ZA 3PCOB 3FJPA 1G5HA 4P3OA 3UGQA 4H2XA 1NJ1A 3A31A 4TWAA 3V7SA 2ZNJA 3NENA 1Z7NA 3HXZA 3HFZB 3VQWA 4H2XB 4P74A 4YRMA 2ZZEA 4G85A 2C7IA 1X55A 3HXUA 4YRCA 3RKWA 4CH5A 2DZ9A 3MF2A 1JJCB 2CJ9A 2ZTGA 3LSSA 4P3NA 2DTOA 2QHSA 4YRRA 5F5WA 3M4QA 4H02A 4K87A 3TEGA 3M4PA 1B76A 4YRFA 4K88A 2EJ9A 1G5IA 3V8LA 1ASZA 3L4GB 4ZTUB 4J15A 1E1OA 4E51A 2E41A 3LSQA 1X54A 3RF1A 1KMMA 1YFSA 3E9HA 4WI1A 2AKWB 4P73A 4CH3A 3HXXA 5KNNA 2RHQB 1C0AA 4H2YA 4K86A 3DSQA 4OP0A 4WJ3M 4OLFA 1BIBA 4UP7A 4H2SA 3A7RA 1ADYA 4PHCA 1RIQA 2XTIA 4RQEA 4HWOA 2ZZGA 3VQYA 1GGMA 2ZXFA 3BJUA 4XEOA 4YCUA 3REUA 2DKGA 2CJBA 4X5OA 4YRJA 3REXA 2IY5B 4CS4A 4L87A 2ZR3A 1N9WA 1QF6A 2ARTA 2ALYB 1H4VB 2DU7A 2ZT5A 3LC0A 3MEYA 3EFSA 3E9IA 1WNLA 2DQ0A 4XU0A 3UFGA 3HRIA 1USYA 3BFMA 2ZT6A 4YP0A 1NJ6A 1SERA 4TVAA 2I4NA 2ZIMA 3CMQA 3UGTA 2EWNA 1IL2A 3A7AA 3A32A 2EL9A 1KOGA 1SETA 3ICAA 1X56A 3QO8A 3IALA 2CJAA 3L2ZA 4H2TA 4YRIA 1PYSA 5E3IA 1FYFA 2ODRD 2DXTA 4HWSA 1WQ7A 4YRKA 2PMEA 2Q5HA 1X01A 3P8TA 3QNEA 3TEHA 2J3LA 3L1AA 4UP8A 4HVCA 2EAYA 1WQWA 1NJ8A 4BWAA 4WF2A 4BW9A 1USYC 4XU3A 2CGHA 4NCXA 1NJ5A 4YRNA 4RMFA 2ODRC 4YRPA 4CS2A 5C53B 1HTTA 4HWRA 1VQZA 1ATIA 4HA8A 1Z7MA 2E65A 2Q7GA 2ZR2A 1YFTA 3V7CA 4YRGA 3UH0A 2I4LA 4TVAB 2ALYA 1WPYA 3HY0A 3QTCA 4XTWA 4P72A 5C51B 3VQVA 4HWPA 2ZNIA 4XU1A 1ADJA 2DTHA 1EFWA 1WU7A 2Q7HA 1E22A 1SESA 2ARUA 3RACA 1EQRA 4LNSA 5K1XA 2EJGA 4P71C 3QO5A 2E64A 1B7YB 3IG2A 3NELA 3PCOA 1NYQA 4P75A 4YREA 4WJ4A 3HXVA 4KQEA 3V8JA 1W66A 2IY5A 3WQZA 3VBBA 2ZCEA 1EVLA 3OD1A 1NNHA 1HXDA 1H4TA 4AH6A 4YPFA 3RIRA 1EIYA 1G51A 3W3SA 3P8VA 4YRTA 4XTUA 4CH6A 4RDXA 2AMCA 1J5WA 4XTYA 2RHSA 3P8YA 4P72C 4YCVA 1L0WA 2RHQA 5C52B 2DDZA 1WYDA 3HY1A 2P0LA 1B8AA 3RKYA 4Q6GA 4XU2A 2ZT7A 2C8MA 2DTIA 4P71A 3TUPA 3VQXA 3ERRA 3HRKA 4PG3A 3HFZA 4XEMA 1YB3A 3PZCA 11ASA 4EO4A 4TVYA 1SRYA 4UP9A 4YROA 2CIMA 1X2GA 1NJ2A 2E3CA 4TQFA 3TEHB 4ZIBA 2E10A 1EOVA 4XTZA 2J3MA 4XTXA 1BIAA 1WLEA 1JJCA 1NYRA 1E24A 2P5IA 2FYKA 2I4MA 3MF1A 4TVWA 4G84A 3A74A 4H2WA 4P74C 1H4QA 1BBUA 2HNIA 2PMFA 4H2VA 1H4SA 2DXUA 1B70B 2DEQA 3KFUA 1KMNA 4ZTZB 4YDQA 4DPGA 4XTVA 2DJZA 4YCWA 1HC7A 4YRSA 2ARSA 2XGTA 3HFVA 2RHSB 1X2HA 3A7UA 4HWTA 2DQ3A 5ELOA 1EIYB 2ZIOA 2QHTA 2DVEA 1BBWA 4CS3A 3R07A 3A5YA 4CH4A 4O2DA 4EX5A 4YRQA 2Q5IA 1B7YA 5ELNA 3QO7A 4P73C 3NEMA 3EFRA 1EVKA 3HXYA 2ZINA 4Q15A 5HGQA 3RGLA 4KR2A 3RUXA 5K1PA 2ZT8A 1E1TA 4DQ2A 2I4OA 2E1HA 1ASYA 2QHUA 4P75C 4TTVA 2QHVA 1YFRA 4H2UA 1LYLA 2EJFA 3V7RA 3HTZA 4YRLA 1B70A
chains in the Genus database with same CATH superfamily
5HCMA 3C4WA 3PURA 3NRYA 3IKLA 4BJMA 5AFUL 3H3MA 4ZOLE 3HXWA 2LM9A 4RQFA 3LBXB 2N1GA 3O1HA 2DU5A 2E9XD 4LVKA 1WYCA 3N2OA 5FY0A 4NIQA 4DUYT 2AKWA 2UUAT 4DV2T 3RIAA 1VRBA 3PUYF 4P0BA 3BK9A 4JI1T 5CFBA 4CXYA 4LVJA 3GN5B 2BS3A 5EZYE 1D0XA 5IWAT 1DU2A 5LMUT 3FJPA 3MXZA 5JR9A 5F3JA 1CHUA 2QGSA 2LSKA 4ZI3C 5AQLB 4TV8E 2ZNJA 1D1BA 2XSBA 3VQWA 2E2AA 3ZKRA 3TKLB 4YRMA 5KXJA 2ZZEA 4G85A 2E5VA 1X55A 3RKWA 4CH5A 2N9DA 4DR4T 2DZ9A 4CI2B 1JJCB 2ZTGA 4P3NA 3C64A 4Z90A 3QK6A 2JMKA 2IIUA 5FKYA 3FBZA 4QWNB 3CPZA 2WY2A 4H9OC 2NR4A 1ZHCA 4LF7T 3L4GB 5FNVE 3RC8A 4B3ST 3H3AA 4WZXA 4LMJA 4WI1A 4XBFB 1C0AA 3A5XA 3CVRA 3I9WA 4NXNT 1E2AA 2DLRA 1YQ3A 4YSZA 5JDMA 5E0OA 4H2SA 4YJ3E 5H6RB 1D1AA 2OV9A 3AXJB 2LSYA 4O8SA 3PUGA 1GGMA 4YCUA 4LFCT 3REUA 3FZMB 2DKGA 5J0ZA 2CJBA 2XAHB 4X5OA 4YRJA 2IY5B 2XJ7A 4LMKA 3AXJA 2ZM2A 2ALYB 4JEHB 1H4VB 3I9YA 2ZT5A 3OKQA 3EFSA 3PUAA 3E9IA 1WNLA 3ZMUB 2MYSA 4LFBT 4TNVA 3HRIA 1OEDC 3X1DA 1USYA 1R8IA 3HKCE 2V6YA 4PK4A 3EDVA 5JH7E 4LFAT 5LOVE 3CMQA 2LT3A 3CX6B 2RPAA 3A32A 2EL9A 5BR8T 1KOGA 3UUBA 2LRKA 1FEWA 2CEAA 3IALA 3Q2MA 3L2ZA 3ZN0B 1PYSA 4UVBB 3KV4A 5JREA 4LF4T 1IJ6A 4YRKA 4HFCA 5AQSB 2XQ3A 4ZEYA 1X01A 5ABHA 3NVOA 2EAYA 4BWAA 3ANWB 1XZYA 4QXCB 3B57A 4NUUA 3AE6A 2CGHA 4NCXA 1NAFA 1NJ5A 5HWYA 1IAPA 5JVDE 1OEDE 2XTLA 2BS4A 3LBXA 2BBHA 5EK3A 3PU8A 2MOZA 2Q7GA 2H89A 4DO0A 3V7CA 4ILAA 3VKGA 3LK3B 3OBVE 3LG7A 2ALYA 1UX5A 4YTNA 4O2BE 4UEMA 3R6NA 3QNUA 2ES0A 2VWAA 1UK5A 2W61A 3N9QA 2CLYC 2R6GF 4H9RC 2MTQA 1H7CA 3RYIE 4U72A 2I59A 4GOUA 2LSJA 5DQVA 1SESA 2WZHA 3FZHB 4DR3T 2FUPA 2EJGA 4P71C 2CBIA 4IE4A 2ODVA 3QO5A 1UX4A 3PCOA 1NYQA 4P75A 5JR9C 2WP9A 2HPJA 2KT9A 3WQZA 1W66A 2NW8A 2XAFB 3CMLA 2XASB 4H9SE 2ZCEA 1EVLA 3GN5A 3OD1A 2X66A 3ABVA 2BKPA 2WU2A 4HFVA 1Z8UA 3RIRA 1EIYA 2J1DG 2A3DA 4IHJE 2IC9A 2WQYA 3V5UA 5LHGB 3P8VA 4CH6A 1T7SA 5FXXA 3ZMTB 2AMCA 3C4ZA 1N34T 1B8AA 2H88A 2Y8DA 2JPFA 3W15B 3RKYA 3AE7A 3RIUA 2QRXA 5ADXL 4ZZCA 2ZT7A 2ACXA 1FMVA 4ZS2A 2VVSA 3MK7C 3Q5DA 3ZT7A 2J4GA 3ERRA 3HRKA 4MALA 5HXHA 5LGNB 2V8SV 1XDPA 1WCRA 3B5MA 3ZMVB 1YB3A 4LVLA 4WBNE 3JC6C 5HCJA 4UP9A 2W66A 3ZMSB 3GMIA 4I4TE 2X9YA 3TEHB 4XTZA 1EOVA 3OYXA 5LP6E 1E24A 2PFVA 2FYKA 2UU9T 1SA0E 4ZI2D 3O1IA 3VRBA 3MF1A 4IDZA 3LDQB 1H4QA 2C5JA 1BBUA 3AECA 4YTPA 3I0OA 2LM2A 4DV5T 5L4EA 3KFUA 3WI3A 3KVBA 4ZTZB 2LHRA 3I1AA 4O4IE 4YCWA 3M65A 2J47A 3AE4A 4YRSA 2XGTA 3OJAA 1XWMA 4O4LE 5LG3A 2FJEA 2XZEA 1M62A 4HWTA 1IZNB 5BMVE 5F8PA 3RPUA 1EIYB 2MAWA 2ZIOA 2BVMA 5HEHA 4GYRA 1YKEB 2WWUA 3E08A 4IT4A 1BBWA 2W62A 2XQ4A 1MNDA 2QYWA 4CS3A 2W00A 4YSYA 3KVAA 5AQMB 4TX5A 4YRQA 1D0ZA 3RI5A 4HGAA 1W0AA 5AQNB 3EDUA 3N9OA 3SWHA 4Z91A 3ZT6A 4TN7B 2L9QA 2VQFT 1EVKA 3HXYA 2V26A 1HTJF 3TLSA 4QH1A 4QX7B 4I0UA 1X79A 2WDQA 5JDNA 1MMAA 2ACZA 4ZHQE 1O3XA 4DQ2A 4X1KE 3CQXC 2JQKA 2V5DA 2XQYA 4GKJT 2CCQA 4L5GA 2IHR1 3AVRA 3KBTA 3PDYA 3HTZA 5EK2A 2AMCB 1WYBA 2ZGWA 3ZCJA 4HTEA 3RKOA 3N9PA 3L4GA 3RH3A 3RL6A 3NETA 4QXBB 4EEDA 1YQ4A 3KV5A 1FIOA 4DIDB 3IKMB 3IF8B 2DL1A 3UUNA 3L09A 4HKAA 5ABGA 4KR3A 12ASA 4ILCA 1YGBA 4E7ZA 2UXBT 1W9RA 3ONLC 4QH5A 3Q9DA 1G5HA 2CMRA 4H2XA 2UXXB 3QB5K 4HE8A 4LF9T 3A31A 2EHOC 3D0TA 1Z7NA 3HFZB 5C8YE 3FXDB 1N33T 4H2XB 4P74A 3P7IA 4DV4T 2C7IA 2K9AA 3OYZA 5LHIB 4ADZA 3JADA 1JNZA 4NPPA 1E7PA 3LSSA 3AA6B 4UVAB 1YW0A 3DP7A 2WB5A 5F5WA 3NZPA 4YXDA 2XQ5A 4GYSA 4K88A 3AE1A 2EJ9A 2L8KA 3CKDA 3ZPOA 1HX8A 2X0HA 4U74A 2DCFA 1G5IA 1J1JA 3EI0A 2D0UA 4L0RA 4U7IA 4ASKA 2W0GA 5LJMA 1E1OA 4E51A 3HKDE 2W4XA 2NS6A 2XQ7A 3FZKB 4QXHB 2BG9C 4WYVA 5FXVA 3RKGA 2E5LT 5KNNA 4BAYB 2V6YB 4UVCB 4CXWA 3SFEA 5AQGB 2YK0A 5FL0A 4F6RC 2K24A 4WJ3M 4OLFA 1LKXA 2KLQA 3C4XA 5HXRA 4JI7T 4JI2T 2LKGA 3A7RA 1EZ3A 1ADYA 4DR2T 3HR0A 1RIQA 4IIJE 5L47A 4HWOA 2CXLA 1KF6A 3F57A 5CA0E 1QF6A 2ARTA 3SS1A 2CWOA 4J2CA 3ZCIA 4KP3C 2WWVA 2P9BA 2DQ0A 3K1SA 1W0BA 2DWKA 3CK6A 4ZI3D 3H37A 3BFMA 4YP0A 1FMWA 1NJ6A 3ETVA 1KNRA 4TVAA 2WDVA 2E8IA 3AAAB 3L8RA 4EZ4A 4OX9T 2PG8A 2EWNA 3MQZA 5ABFA 2YU1A 1ZEEA 1BR2A 1UGOA 2K48A 3ZMZB 1KNZA 2ODRD 2E9XC 4HEAA 3ONXA 1LVKA 5AQHB 4X64T 2PMEA 3PJAA 1YXRA 3P8TA 3IEEA 3TEHA 1M7KA 4HVCA 4QKNA 2IW5B 4WF2A 3RRWA 2WBLA 3P50A 4BW9A 3LSVA 1USYC 3AA0B 4E7SA 1L0VA 1VCTA 1U4QA 2WCAA 1HTTA 2D0TA 1XNQT 4H9QC 1YD8G 2LOSA 2E65A 2KINB 4EV6A 1YFTA 3AA7B 2I0MA 4GIWA 4JI5T 2V7KA 4U33A 4LF6T 2I4LA 1WPYA 3AE3A 3QTCA 2XAGB 5LGTB 1ZP0A 4XTWA 3GA8A 4P72A 5C51B 2B76A 3PUZF 4U7YA 4ZS3A 1EFWA 1WU7A 3TLTA 1E22A 3RACA 4LNSA 3ANWA 4ZXLA 5K1XA 4A5XA 2Q9QC 1FJGT 1V9DA 2E64A 1UCUA 5LXTE 3AEFA 3NRXA 2BG9E 2LSGA 4YREA 2V7MA 3GWHA 4WJ4A 3FBLA 4KQEA 2CE7A 3KFWX 3UU6A 4ISTA 3VBBA 4P09A 1D0YA 1SE7A 1NNHA 5FVLA 2DHRA 3C50A 4AH6A 5LHHB 1N32T 4YRTA 4RDXA 3HL6A 2FJBA 5C52B 2P0LA 2WZIA 4HWHA 3CQCB 3BQLA 4HN9A 2JQ9A 1HFAA 1US7B 5FL1A 4HWIB 4A98A 4P71A 5JDHA 3VQXA 4H63H 4HFDA 5FYMA 4XEMA 3PZCA 4EO4A 4NUVA 4UV8B 2CIMA 2X0YA 4ANJA 2E3CA 4DBRA 3U3IA 2VK9A 3RIUC 1BIAA 1WLEA 1NYRA 3K3NA 4ILUA 4CN4A 5ABEA 4A97A 4G84A 3AA1B 1AJ3A 1XDOA 2W67A 2HNIA 2SPCA 1H4SA 5FY7A 2XAQB 4JLEA 4EEBA 1HNXT 1MIVA 4BA9A 2X0LB 4F8HA 2DJZA 2D9DA 1HC7A 5LG4A 2VKJA 3HFVA 4ERRA 1HG5A 3G06A 3P4QA 3EVYA 5AQIB 4C90A 2DQ3A 3N2GE 3PUSA 4TWFA 3ETUA 2QHTA 4JBWF 1MIWA 3WAJA 1T98A 3R07A 3A5YA 5FP3A 4IE6A 5CB4E 4EX5A 5DJQC 3AEGA 4PFPA 4TUYE 5KMGP 3QO7A 2WSSV 4P73C 4LF5T 2JIWA 1XNRT 4AKGA 3HKBE 2A9UA 2QVAA 2ZINA 3ZYMA 3FB2A 4GK5E 2HH7A 3AAIA 4UXNB 2UUCT 2FJDA 1W09A 1WFDA 3JAFA 2VQET 3WAKA 5HEJA 4DMWA 1YFRA 5C3JA 5L3CB 1B7TA 3TLWA 4H2UA 2LKHA 1SUMB 3P4SA 3LFMA 4UPAA 2KMFA 4YYEA 4P3PA 2DNXA 4EIWA 2FBWA 2XQAA 3RKXA 4YTMA 1IJ5A 2NWBA 2ZZFA 4FJOA 3EUHA 4YLHA 2G4CA 2DZCA 3V8KA 4XZCA 2Q7EA 2JQHA 3M3ZB 5A1LA 3PCOB 2WS3A 4QHOA 4AKHA 2UXDT 3UGQA 3DTOA 2VKDA 3V7SA 3RYHE 3NENA 3HXZA 4COFA 3V5SA 2XAJB 3CQGB 4P0AA 2YU2A 2VKHA 3ZJ1A 3HXUA 4YRCA 5M4YA 3EHZA 3RQUA 1ZV4X 1Y64B 5AQTB 1HCIA 1MMNA 1G8XA 4DR5T 2CJ9A 3VU7H 5AQKB 2V6XA 4N78D 3N9MA 2QHSA 4LF8T 3FHNA 1G73A 3M4PA 2B1EA 4EXTA 1WLXA 3AE9A 3V8LA 2IMLA 4CQIA 2VURA 5L4HA 3LSQA 2CHOA 3AEDA 1KMMA 2LOPA 2NTXA 2KWHA 4CH3A 2CM0A 2OLTA 4KBMB 4H2YA 3AVSA 1WR0A 3DJBA 4OP0A 2AXDS 5IHYA 1BIBA 4MHCA 2LLYA 4HWCA 4UP7A 3J7Yq 1UURA 4IDPA 4HFHA 5HXSA 2NOXA 2UUBT 2XTIA 1LRZA 4RQEA 3UFEA 3C51A 5J2UE 4IDOA 4KI0F 4M1PA 2ZZGA 3BJUA 3VQYA 3NKZA 5FXWA 1VOMA 3REXA 3OTOT 4L87A 3PTRB 2ZR3A 1N9WA 3RRCA 3UUXB 1HNWT 2XSAA 4DV0T 2DU7A 3LC0A 1OEDA 4YFSA 3P4WA 4JI0T 5CGMA 4CN1A 2QA7A 4MFRA 3UFGA 1OEDB 4IGUA 2H3RA 2ZT6A 2YKSA 2I4NA 4AIUA 1BR1A 2IDOB 2ZIMA 5H6QB 2WU5A 3A7AA 3ZC0A 4GKKT 1SETA 1X56A 5AQFB 4AQYT 2CJAA 4X66T 3A7MA 1FYFA 4QH4A 4AI6A 4HWSA 1WQ7A 2HN2A 3E0ZA 5AQQB 4ZZBA 2J3LA 3L1AA 4UP8A 1WQWA 3QOFA 3AE8A 3R84B 2A8EA 3B13A 4XU3A 4U3CA 1HF8A 4RMFA 2ODRC 2RP4A 4CS2A 4DV1T 4HWRA 1VQZA 4B3TT 1Z7MA 3P4PA 1E1HB 2ZR2A 5HYAA 2C5IT 2L3LA 4HFEA 3OPCA 5AQPB 2C0SA 4EB6E 4U2ZA 3HY0A 3CX7B 2XHEB 2BKOA 2CXDA 5L3BB 2H7OA 3HA4A 3LK2B 3VQVA 5TAOA 4XU1A 4HFIA 1ADJA 3CWZB 5L3FB 3KINB 2CLYB 4PK6A 4WBOA 2DTHA 4BJNA 4H63V 5HEGA 2XQ6A 2ARUA 5KX5E 2KZ7B 2BZBA 4PJLA 3RIFA 5LB7B 4XAXB 4YHJA 2HN1A 3O1JA 3NELA 4AXPA 2XPKA 2KXPB 5JR9B 2X68A 2PBIA 3J9X1 5JRCA 4EYYR 1IBKT 2IUBA 1H4TA 4HFBA 4OK0A 5C2TA 1MNEA 3RLFF 1JNRA 3W3SA 4XTUA 4YJ2E 4P72C 2VL8A 1L0WA 2RHQA 2GK9A 2YOEA 1WYDA 4C91A 2WMNA 2NP9A 4Q6GA 1IBLT 5HWXA 4XU2A 2KWIB 3Q5XA 3ZC1A 2DTIA 2Q9QA 4TWDA 4PG3A 4YT0A 3HFZA 1ZOYA 2VASA 2CXFA 2WM9A 5EK4A 4TVYA 4DV7T 3VR8A 1SRYA 4JI8T 1HNZT 3ZSSA 4I50E 4U31A 3T8OA 1X2GA 1NJ2A 5LCYA 3ZN1B 1KNPA 5JDGA 4ZIBA 5ABFB 2E10A 4TV9E 2J3MA 4AKIA 3PU3A 3UQ4A 2YDQA 4EOZB 3T1YT 4XTXA 2RA1A 3C98B 3P8CD 4X65T 1JJCA 2MPKA 2P5IA 3PUXF 3FZFB 4PFOA 1WRDA 1IBMT 2HPLA 2H7VC 2I4MA 2BBJA 4H2WA 2EHOD 1ZKEA 4CZZB 5L3EB 2BDEA 2PMFA 4H2VA 2CBJA 2DEQA 2CWYA 3ESLA 1XMQT 2WAUA 4DPGA 5LBMA 4XTVA 4UIGA 4HT4A 3SRZA 1J5ET 4KHPT 4H9PC 2NW7A 2RHSB 4PJJA 2LHNA 3A7UA 2HHHT 2W2UA 4HWFA 5L3GB 3P4RA 5J2TE 1S35A 3O4XE 4IE5A 4EZHA 3E22E 4JI6T 4CH4A 3N2KE 2Q5IA 1B7YA 5ELNA 5AQRB 1T8BA 4GK0E 4H9NC 4I55E 4ZI7E 3EFRA 4YSXA 1NEKA 3RGLA 3OVUA 4X62T 2IAKA 4FI5A 2JRKA 3UU8A 2X9XA 2ZT8A 1E1TA 4JYAT 4PJNA 4O2AE 3AEEA 2I4OA 5LGUB 4UV9B 2XM1A 4X20E 4JI4T 3UUMA 3N5LA 2CRBA 1SHZC 4X1YE 4KHZF 1LYLA 4KMCA 4UELA 4AQFA 3IBPA 4YRLA 1B70A 2E5AA 1LVFA 3UT5E 3L39A 2C5KT 4CN6A 1QE0A 4DNDA 3ZLIA 3AEAA 3G1ZA 1PYSB 2UXCT 2A2FX 5JDQA 4UF0A 2XY8B 3LJCA 3ONJA 4JEUB 4JUYA 4WW0A 3I7FA 4TQDA 3A5ZA 4DR7T 4DBQA 3CX8B 1XMOT 4P3OA 1NJ1A 1N36T 4TWAA 2EHOB 3ZJ2A 4Z8XA 4DR1T 4ZI2C 4K0UA 5L2LA 1I94T 1WR6A 3ZYKA 4B6XA 1QUUA 5HXEA 3PUVF 3BQIA 3MF2A 1QLBA 2DI4A 2DTOA 3LK42 2BKNA 3PUQA 4YRRA 3M4QA 4O4HE 3S4UA 4H02A 3JC6D 4K87A 3TEGA 1B76A 5HAXA 1KK7A 4IREA 4YRFA 1QSDA 2X51A 5JQGE 1ASZA 2K5BB 2X9WA 4ZTUB 4J15A 3IHRA 2E41A 4V1Av 3RF1A 1X54A 2Z6EA 1OWAA 1UUSA 1MMGA 1YFSA 2BG9B 4AQGA 3N9NA 3E9HA 3KBUA 5HXCA 2AKWB 4P73A 3HXXA 4B3RT 2RHQB 1Y01A 4X5TA 4K86A 5FVKA 3DSQA 2YN6A 2JJ9A 3BQKA 3EAMA 3ZSTA 2F4VT 5AQUB 1HS7A 2VB6A 3KDSE 5JDLA 4PHCA 3TLVA 5IUXA 4CI1B 1MMDA 2LJLA 2ZXFA 4XEOA 2LSIA 3MKDA 3PE0A 1NWMX 4CI3B 5DQWA 4CS4A 4MBQA 4B3MT 3RYCE 1GQEA 2AE9A 3MJXA 3MEYA 4JV5T 3RHWA 2KNDA 3UULA 5CA1E 3ZEFB 2XQ8A 4XU0A 5LJNA 3UU5A 5IYZE 3Q5WA 2JMHA 2LE8A 4IE0A 3SFDA 1SERA 3NZQA 5LMNT 3AAEB 3NBXX 3UGTA 2A72A 1IL2A 3VRAA 5HEOA 3ICAA 1YKHB 3QO8A 3MACA 4H2TA 4YRIA 5E3IA 2X67A 2E9XB 2ZM6T 2DXTA 3F31A 4A56A 3VR9A 5JRCB 2Q5HA 5AQOB 2BG9A 3QNEA 5L3DB 2BVLA 4U2YA 1HR0T 2PTFA 1NJ8A 2XM2A 3AE2A 4PAGA 1NENA 3PV0F 4DMVA 4EAHA 5ETWA 5FMNA 2UXNB 1U5PA 5JTGA 4MLKA 4YRNA 4P1NA 3U78A 4PW8A 4IDNA 4YRPA 2ZLYA 2I6HA 5C53B 3PJAJ 1ATIA 4HA8A 3JAEA 4IL9A 4WNKA 2K3WA 1MIYA 4YRGA 3FZLB 3UH0A 2YEVC 4AQFC 4TVAB 3ZYLA 4DVDA 4K0KT 1BR0A 2YDRA 4IE7A 3ZT5A 3VKHA 4HWPA 2ZNIA 3CIRA 4UR9A 4LVIA 1HG2A 4X1IE 2Q7HA 5LBQB 1OXZA 5FY1A 2G0UA 2M6IA 1I6ZA 3AE5A 5AQJB 1EQRA 2VL0A 4ISSA 2Q9QB 4AKLA 3UU4A 1B7YB 3IG2A 2JQQA 4PJMA 4QX8B 4DUZT 1X9BA 2M6BA 4O4JE 5CJ5A 5J1GA 2YINA 3HXVA 3V8JA 2IY5A 4YY3T 3I0QA 2V7JA 4OYKA 1HXDA 5FXZA 2E9XA 2KSRA 4YPFA 3F2EA 1G51A 1S94A 1J5WA 4IL4A 1D1CA 2RHSA 3FXEB 3P8YA 4XTYA 4YCVA 5LYJE 3RQWA 4AISA 3TLUA 2DDZA 3HY1A 2LRLA 5DABA 3UQ7A 3UU3A 4L9IA 4EYUA 2LEHA 5LNKA 3AB3B 4G63A 2BS2A 4G2AA 2WDRA 2C8MA 3KV6A 3A8YC 3TUPA 3NWIA 2IC6A 1Z0PA 2J62A 2OA5A 3AEBA 5LA6E 4DV6T 3QC9A 2CPTA 11ASA 4TWHA 2M67A 3UTKA 1T72A 4YHHT 4YROA 2ODUA 4HWDA 1CUNA 2V1DB 4TQFA 3K3OA 3EABA 2NTYA 3MZKB 3QUJA 5KDMC 2ZM0A 2D5UA 4OFZA 2EHOA 4OYJA 4TVWA 4LMLA 4DV3T 3A74A 4P74C 2CHNA 1KFYA 4NXMT 2Y48B 3Q5EA 3O9XA 2DXUA 1B70B 1KEYA 4IDQA 3T1HT 1KMNA 2YDSA 4TZ4C 4YDQA 4KUMB 2D2SA 4TNWA 2ARSA 5HEUA 1BR4A 2W63A 2ZM8A 4LVMA 2Q9QD 1X2HA 3RC3A 4PK5A 2ZMAA 4OHFA 5GONE 3IA3A 4UF0B 5ELOA 2V7LA 4CXXA 3KV9A 2DVEA 5JDFA 3RX6A 4JI3T 4KX6A 2XUEA 2N2NA 4O2DA 2PJQA 2X9HA 3SOLA 2V5CA 2FJAA 4DR6T 3K8PC 3NEMA 3RYFE 1VCSA 4Q15A 5HGQA 4KR2A 4Q25A 3JCFA 2MBGA 2VKOA 1HX1B 3MA9A 4AKRB 3RUXA 3QB5A 4PNIA 5K1PA 3PUWF 2DWGA 2V7IA 3N9LA 2NW9A 4EGWA 3HI2A 3VHLA 2VVNA 2Y6XA 2XQ9A 2E1HA 1ASYA 3K3QC 2QHUA 4P75C 4TTVA 3L3PA 2QHVA 3HKEE 5AQVB 4ILBA 2WMOA 2EJFA 3V7RA 4I43B 2CA5A
chains in the Genus database with same CATH topology
2AMCB 2E5AA 2ZGWA 4UPAA 3IKLA 3L4GA 4YYEA 3RL6A 3NETA 3HXWA 1QE0A 4RQFA 4P3PA 2DU5A 3G1ZA 3IKMB 1PYSB 4LVKA 3RKXA 2AKWA 2ZZFA 4KR3A 12ASA 2G4CA 2DZCA 4LVJA 3V8KA 1YGBA 3I7FA 4TQDA 2Q7EA 3A5ZA 3PCOB 3FJPA 1G5HA 4P3OA 3UGQA 4H2XA 1NJ1A 3A31A 4TWAA 3V7SA 2ZNJA 3NENA 1Z7NA 3HXZA 3HFZB 3VQWA 4H2XB 4P74A 4YRMA 2ZZEA 4G85A 2C7IA 1X55A 3HXUA 4YRCA 3RKWA 4CH5A 2DZ9A 3MF2A 1JJCB 2CJ9A 2ZTGA 3LSSA 4P3NA 2DTOA 2QHSA 4YRRA 5F5WA 3M4QA 4H02A 4K87A 3TEGA 3M4PA 1B76A 4YRFA 4K88A 2EJ9A 1G5IA 3V8LA 1ASZA 3L4GB 4ZTUB 4J15A 1E1OA 4E51A 2E41A 3LSQA 1X54A 3RF1A 2NS6A 1KMMA 1YFSA 3E9HA 4WI1A 2AKWB 4P73A 4CH3A 3HXXA 5KNNA 2RHQB 1C0AA 4H2YA 4K86A 3DSQA 4OP0A 4WJ3M 4OLFA 1BIBA 4UP7A 4H2SA 3A7RA 1ADYA 4PHCA 1RIQA 2XTIA 4RQEA 4HWOA 2ZZGA 3VQYA 1GGMA 2ZXFA 3BJUA 4XEOA 4YCUA 3REUA 2DKGA 2CJBA 4X5OA 4YRJA 3REXA 2IY5B 4CS4A 4L87A 2ZR3A 1N9WA 1QF6A 2ARTA 2ALYB 1H4VB 2DU7A 2ZT5A 3LC0A 3MEYA 3EFSA 3E9IA 1WNLA 2DQ0A 4XU0A 3UFGA 3HRIA 1USYA 3BFMA 2ZT6A 4YP0A 1NJ6A 1SERA 4TVAA 2I4NA 2ZIMA 3CMQA 3UGTA 2EWNA 1IL2A 3MQZA 3A7AA 3A32A 2EL9A 1KOGA 1SETA 3ICAA 1X56A 3QO8A 3IALA 2CJAA 3L2ZA 4H2TA 4YRIA 1PYSA 5E3IA 1FYFA 2ODRD 2DXTA 4HWSA 1WQ7A 4YRKA 2PMEA 2Q5HA 1X01A 3P8TA 3QNEA 3TEHA 2J3LA 3L1AA 4UP8A 4HVCA 2EAYA 1WQWA 1NJ8A 4BWAA 4WF2A 4BW9A 2A8EA 1USYC 4XU3A 2CGHA 4NCXA 1NJ5A 4YRNA 4RMFA 2ODRC 4YRPA 4CS2A 5C53B 1HTTA 4HWRA 1VQZA 1ATIA 4HA8A 1Z7MA 2E65A 2Q7GA 2ZR2A 1YFTA 3V7CA 4YRGA 3UH0A 2I4LA 4TVAB 2ALYA 1WPYA 3HY0A 3QTCA 4XTWA 4P72A 5C51B 3VQVA 4HWPA 2ZNIA 4XU1A 1ADJA 4LVIA 2DTHA 1EFWA 1WU7A 2Q7HA 1E22A 1SESA 2ARUA 3RACA 1EQRA 4LNSA 5K1XA 2EJGA 4P71C 3QO5A 2E64A 1B7YB 3IG2A 3NELA 3PCOA 1NYQA 4P75A 4YREA 4WJ4A 3HXVA 4KQEA 3V8JA 1W66A 2IY5A 3WQZA 3VBBA 2ZCEA 1EVLA 3OD1A 1NNHA 1HXDA 1H4TA 4AH6A 4YPFA 3RIRA 1EIYA 1G51A 3W3SA 3P8VA 4YRTA 4XTUA 4CH6A 4RDXA 2AMCA 1J5WA 4XTYA 2RHSA 3P8YA 4P72C 4YCVA 1L0WA 2RHQA 5C52B 2DDZA 1WYDA 3HY1A 2P0LA 1B8AA 3RKYA 4Q6GA 4XU2A 2ZT7A 2C8MA 2DTIA 4P71A 3TUPA 3VQXA 3ERRA 3HRKA 4PG3A 3HFZA 4XEMA 1YB3A 3PZCA 11ASA 4EO4A 4LVLA 4TVYA 1SRYA 4UP9A 4YROA 2CIMA 1X2GA 1NJ2A 2E3CA 4TQFA 3TEHB 4ZIBA 2E10A 1EOVA 4XTZA 2J3MA 4XTXA 1BIAA 1WLEA 1JJCA 1NYRA 1E24A 2P5IA 2FYKA 2I4MA 3MF1A 4TVWA 4G84A 3A74A 4H2WA 4P74C 1H4QA 1BBUA 2HNIA 2PMFA 4H2VA 1H4SA 2DXUA 1B70B 2DEQA 3KFUA 1KMNA 4ZTZB 4YDQA 4DPGA 4XTVA 2DJZA 4YCWA 4HT4A 1HC7A 4YRSA 2ARSA 2XGTA 3HFVA 2RHSB 4LVMA 1X2HA 3A7UA 4HWTA 2DQ3A 5ELOA 1EIYB 2ZIOA 2QHTA 2DVEA 1BBWA 4CS3A 3R07A 3A5YA 4CH4A 4O2DA 4EX5A 4YRQA 2Q5IA 1B7YA 5ELNA 3QO7A 4P73C 3NEMA 3EFRA 1EVKA 3HXYA 2ZINA 4Q15A 5HGQA 3RGLA 4KR2A 3RUXA 5K1PA 2ZT8A 1E1TA 4DQ2A 2I4OA 2E1HA 1ASYA 2QHUA 4P75C 4TTVA 2QHVA 1YFRA 4H2UA 1LYLA 2EJFA 3V7RA 3HTZA 4YRLA 1B70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AMC B;  2E5A A;  2ZGW A;  4UPA A;  3IKL A;  3L4G A;  4YYE A;  3RL6 A;  3NET A;  3HXW A;  1QE0 A;  4RQF A;  4P3P A;  2DU5 A;  3G1Z A;  3IKM B;  1PYS B;  3RKX A;  2AKW A;  2ZZF A;  4KR3 A;  12AS A;  2G4C A;  2DZC A;  3V8K A;  1YGB A;  3I7F A;  4TQD A;  2Q7E A;  3A5Z A;  3PCO B;  3FJP A;  1G5H A;  4P3O A;  3UGQ A;  4H2X A;  1NJ1 A;  3A31 A;  4TWA A;  3V7S A;  2ZNJ A;  3NEN A;  1Z7N A;  3HXZ A;  3HFZ B;  3VQW A;  4H2X B;  4P74 A;  4YRM A;  2ZZE A;  4G85 A;  2C7I A;  1X55 A;  3HXU A;  4YRC A;  3RKW A;  4CH5 A;  2DZ9 A;  3MF2 A;  1JJC B;  2CJ9 A;  2ZTG A;  3LSS A;  4P3N A;  2DTO A;  2QHS A;  4YRR A;  5F5W A;  3M4Q A;  4H02 A;  4K87 A;  3TEG A;  3M4P A;  1B76 A;  4YRF A;  4K88 A;  2EJ9 A;  1G5I A;  3V8L A;  1ASZ A;  3L4G B;  4ZTU B;  4J15 A;  1E1O A;  4E51 A;  2E41 A;  3LSQ A;  1X54 A;  3RF1 A;  1KMM A;  1YFS A;  3E9H A;  4WI1 A;  2AKW B;  4P73 A;  4CH3 A;  3HXX A;  5KNN A;  2RHQ B;  1C0A A;  4H2Y A;  4K86 A;  3DSQ A;  4OP0 A;  4WJ3 M;  4OLF A;  1BIB A;  4UP7 A;  4H2S A;  3A7R A;  1ADY A;  4PHC A;  1RIQ A;  2XTI A;  4RQE A;  4HWO A;  2ZZG A;  3VQY A;  1GGM A;  2ZXF A;  3BJU A;  4XEO A;  4YCU A;  3REU A;  2DKG A;  2CJB A;  4X5O A;  4YRJ A;  3REX A;  2IY5 B;  4CS4 A;  4L87 A;  2ZR3 A;  1N9W A;  1QF6 A;  2ART A;  2ALY B;  1H4V B;  2DU7 A;  2ZT5 A;  3LC0 A;  3MEY A;  3EFS A;  3E9I A;  1WNL A;  2DQ0 A;  4XU0 A;  3UFG A;  3HRI A;  1USY A;  3BFM A;  2ZT6 A;  4YP0 A;  1NJ6 A;  1SER A;  4TVA A;  2I4N A;  2ZIM A;  3CMQ A;  3UGT A;  2EWN A;  1IL2 A;  3A7A A;  3A32 A;  2EL9 A;  1KOG A;  1SET A;  3ICA A;  1X56 A;  3QO8 A;  3IAL A;  2CJA A;  3L2Z A;  4H2T A;  4YRI A;  1PYS A;  5E3I A;  1FYF A;  2ODR D;  2DXT A;  4HWS A;  1WQ7 A;  4YRK A;  2PME A;  2Q5H A;  1X01 A;  3P8T A;  3QNE A;  3TEH A;  2J3L A;  3L1A A;  4UP8 A;  4HVC A;  2EAY A;  1WQW A;  1NJ8 A;  4BWA A;  4WF2 A;  4BW9 A;  1USY C;  4XU3 A;  2CGH A;  4NCX A;  1NJ5 A;  4YRN A;  4RMF A;  2ODR C;  4YRP A;  4CS2 A;  5C53 B;  1HTT A;  4HWR A;  1VQZ A;  1ATI A;  4HA8 A;  1Z7M A;  2E65 A;  2Q7G A;  2ZR2 A;  1YFT A;  3V7C A;  4YRG A;  3UH0 A;  2I4L A;  4TVA B;  2ALY A;  1WPY A;  3HY0 A;  3QTC A;  4XTW A;  4P72 A;  5C51 B;  3VQV A;  4HWP A;  2ZNI A;  4XU1 A;  1ADJ A;  2DTH A;  1EFW A;  1WU7 A;  2Q7H A;  1E22 A;  1SES A;  2ARU A;  3RAC A;  1EQR A;  4LNS A;  5K1X A;  2EJG A;  4P71 C;  3QO5 A;  2E64 A;  1B7Y B;  3IG2 A;  3NEL A;  3PCO A;  1NYQ A;  4P75 A;  4YRE A;  4WJ4 A;  3HXV A;  4KQE A;  3V8J A;  1W66 A;  2IY5 A;  3WQZ A;  3VBB A;  2ZCE A;  1EVL A;  3OD1 A;  1NNH A;  1HXD A;  1H4T A;  4AH6 A;  4YPF A;  3RIR A;  1EIY A;  1G51 A;  3W3S A;  3P8V A;  4YRT A;  4XTU A;  4CH6 A;  4RDX A;  2AMC A;  1J5W A;  4XTY A;  2RHS A;  3P8Y A;  4P72 C;  4YCV A;  1L0W A;  2RHQ A;  5C52 B;  2DDZ A;  1WYD A;  3HY1 A;  2P0L A;  1B8A A;  3RKY A;  4Q6G A;  4XU2 A;  2ZT7 A;  2C8M A;  2DTI A;  4P71 A;  3TUP A;  3VQX A;  3ERR A;  3HRK A;  4PG3 A;  3HFZ A;  4XEM A;  1YB3 A;  3PZC A;  11AS A;  4EO4 A;  4TVY A;  1SRY A;  4UP9 A;  4YRO A;  2CIM A;  1X2G A;  1NJ2 A;  2E3C A;  4TQF A;  3TEH B;  4ZIB A;  2E10 A;  1EOV A;  4XTZ A;  2J3M A;  4XTX A;  1BIA A;  1WLE A;  1JJC A;  1NYR A;  1E24 A;  2P5I A;  2FYK A;  2I4M A;  3MF1 A;  4TVW A;  4G84 A;  3A74 A;  4H2W A;  4P74 C;  1H4Q A;  1BBU A;  2HNI A;  2PMF A;  4H2V A;  1H4S A;  2DXU A;  1B70 B;  2DEQ A;  3KFU A;  1KMN A;  4ZTZ B;  4YDQ A;  4DPG A;  4XTV A;  2DJZ A;  4YCW A;  1HC7 A;  4YRS A;  2ARS A;  2XGT A;  3HFV A;  2RHS B;  1X2H A;  3A7U A;  4HWT A;  2DQ3 A;  5ELO A;  1EIY B;  2ZIO A;  2QHT A;  2DVE A;  1BBW A;  4CS3 A;  3R07 A;  3A5Y A;  4CH4 A;  4O2D A;  4EX5 A;  4YRQ A;  2Q5I A;  1B7Y A;  5ELN A;  3QO7 A;  4P73 C;  3NEM A;  3EFR A;  1EVK A;  3HXY A;  2ZIN A;  4Q15 A;  5HGQ A;  3RGL A;  4KR2 A;  3RUX A;  5K1P A;  2ZT8 A;  1E1T A;  4DQ2 A;  2I4O A;  2E1H A;  1ASY A;  2QHU A;  4P75 C;  4TTV A;  2QHV A;  1YFR A;  4H2U A;  1LYL A;  2EJF A;  3V7R A;  3HTZ A;  4YRL A;  1B70 A; 
#chains in the Genus database with same CATH topology
 5HCM A;  3C4W A;  3PUR A;  3NRY A;  3IKL A;  4BJM A;  5AFU L;  3H3M A;  4ZOL E;  3HXW A;  2LM9 A;  4RQF A;  3LBX B;  2N1G A;  3O1H A;  2DU5 A;  2E9X D;  4LVK A;  1WYC A;  3N2O A;  5FY0 A;  4NIQ A;  4DUY T;  2AKW A;  2UUA T;  4DV2 T;  3RIA A;  1VRB A;  3PUY F;  4P0B A;  3BK9 A;  4JI1 T;  5CFB A;  4CXY A;  4LVJ A;  3GN5 B;  2BS3 A;  5EZY E;  1D0X A;  5IWA T;  1DU2 A;  5LMU T;  3FJP A;  3MXZ A;  5JR9 A;  5F3J A;  1CHU A;  2QGS A;  2LSK A;  4ZI3 C;  5AQL B;  4TV8 E;  2ZNJ A;  1D1B A;  2XSB A;  3VQW A;  2E2A A;  3ZKR A;  3TKL B;  4YRM A;  5KXJ A;  2ZZE A;  4G85 A;  2E5V A;  1X55 A;  3RKW A;  4CH5 A;  2N9D A;  4DR4 T;  2DZ9 A;  4CI2 B;  1JJC B;  2ZTG A;  4P3N A;  3C64 A;  4Z90 A;  3QK6 A;  2JMK A;  2IIU A;  5FKY A;  3FBZ A;  4QWN B;  3CPZ A;  2WY2 A;  4H9O C;  2NR4 A;  1ZHC A;  4LF7 T;  3L4G B;  5FNV E;  3RC8 A;  4B3S T;  3H3A A;  4WZX A;  4LMJ A;  4WI1 A;  4XBF B;  1C0A A;  3A5X A;  3CVR A;  3I9W A;  4NXN T;  1E2A A;  2DLR A;  1YQ3 A;  4YSZ A;  5JDM A;  5E0O A;  4H2S A;  4YJ3 E;  5H6R B;  1D1A A;  2OV9 A;  3AXJ B;  2LSY A;  4O8S A;  3PUG A;  1GGM A;  4YCU A;  4LFC T;  3REU A;  3FZM B;  2DKG A;  5J0Z A;  2CJB A;  2XAH B;  4X5O A;  4YRJ A;  2IY5 B;  2XJ7 A;  4LMK A;  3AXJ A;  2ZM2 A;  2ALY B;  4JEH B;  1H4V B;  3I9Y A;  2ZT5 A;  3OKQ A;  3EFS A;  3PUA A;  3E9I A;  1WNL A;  3ZMU B;  2MYS A;  4LFB T;  4TNV A;  3HRI A;  1OED C;  3X1D A;  1USY A;  1R8I A;  3HKC E;  2V6Y A;  4PK4 A;  3EDV A;  5JH7 E;  4LFA T;  5LOV E;  3CMQ A;  2LT3 A;  3CX6 B;  2RPA A;  3A32 A;  2EL9 A;  5BR8 T;  1KOG A;  3UUB A;  2LRK A;  1FEW A;  2CEA A;  3IAL A;  3Q2M A;  3L2Z A;  3ZN0 B;  1PYS A;  4UVB B;  3KV4 A;  5JRE A;  4LF4 T;  1IJ6 A;  4YRK A;  4HFC A;  5AQS B;  2XQ3 A;  4ZEY A;  1X01 A;  5ABH A;  3NVO A;  2EAY A;  4BWA A;  3ANW B;  1XZY A;  4QXC B;  3B57 A;  4NUU A;  3AE6 A;  2CGH A;  4NCX A;  1NAF A;  1NJ5 A;  5HWY A;  1IAP A;  5JVD E;  1OED E;  2XTL A;  2BS4 A;  3LBX A;  2BBH A;  5EK3 A;  3PU8 A;  2MOZ A;  2Q7G A;  2H89 A;  4DO0 A;  3V7C A;  4ILA A;  3VKG A;  3LK3 B;  3OBV E;  3LG7 A;  2ALY A;  1UX5 A;  4YTN A;  4O2B E;  4UEM A;  3R6N A;  3QNU A;  2ES0 A;  2VWA A;  1UK5 A;  2W61 A;  3N9Q A;  2CLY C;  2R6G F;  4H9R C;  2MTQ A;  1H7C A;  3RYI E;  4U72 A;  2I59 A;  4GOU A;  2LSJ A;  5DQV A;  1SES A;  2WZH A;  3FZH B;  4DR3 T;  2FUP A;  2EJG A;  4P71 C;  2CBI A;  4IE4 A;  2ODV A;  3QO5 A;  1UX4 A;  3PCO A;  1NYQ A;  4P75 A;  5JR9 C;  2WP9 A;  2HPJ A;  2KT9 A;  3WQZ A;  1W66 A;  2NW8 A;  2XAF B;  3CML A;  2XAS B;  4H9S E;  2ZCE A;  1EVL A;  3GN5 A;  3OD1 A;  2X66 A;  3ABV A;  2BKP A;  2WU2 A;  4HFV A;  1Z8U A;  3RIR A;  1EIY A;  2J1D G;  2A3D A;  4IHJ E;  2IC9 A;  2WQY A;  3V5U A;  5LHG B;  3P8V A;  4CH6 A;  1T7S A;  5FXX A;  3ZMT B;  2AMC A;  3C4Z A;  1N34 T;  1B8A A;  2H88 A;  2Y8D A;  2JPF A;  3W15 B;  3RKY A;  3AE7 A;  3RIU A;  2QRX A;  5ADX L;  4ZZC A;  2ZT7 A;  2ACX A;  1FMV A;  4ZS2 A;  2VVS A;  3MK7 C;  3Q5D A;  3ZT7 A;  2J4G A;  3ERR A;  3HRK A;  4MAL A;  5HXH A;  5LGN B;  2V8S V;  1XDP A;  1WCR A;  3B5M A;  3ZMV B;  1YB3 A;  4LVL A;  4WBN E;  3JC6 C;  5HCJ A;  4UP9 A;  2W66 A;  3ZMS B;  3GMI A;  4I4T E;  2X9Y A;  3TEH B;  4XTZ A;  1EOV A;  3OYX A;  5LP6 E;  1E24 A;  2PFV A;  2FYK A;  2UU9 T;  1SA0 E;  4ZI2 D;  3O1I A;  3VRB A;  3MF1 A;  4IDZ A;  3LDQ B;  1H4Q A;  2C5J A;  1BBU A;  3AEC A;  4YTP A;  3I0O A;  2LM2 A;  4DV5 T;  5L4E A;  3KFU A;  3WI3 A;  3KVB A;  4ZTZ B;  2LHR A;  3I1A A;  4O4I E;  4YCW A;  3M65 A;  2J47 A;  3AE4 A;  4YRS A;  2XGT A;  3OJA A;  1XWM A;  4O4L E;  5LG3 A;  2FJE A;  2XZE A;  1M62 A;  4HWT A;  1IZN B;  5BMV E;  5F8P A;  3RPU A;  1EIY B;  2MAW A;  2ZIO A;  2BVM A;  5HEH A;  4GYR A;  1YKE B;  2WWU A;  3E08 A;  4IT4 A;  1BBW A;  2W62 A;  2XQ4 A;  1MND A;  2QYW A;  4CS3 A;  2W00 A;  4YSY A;  3KVA A;  5AQM B;  4TX5 A;  4YRQ A;  1D0Z A;  3RI5 A;  4HGA A;  1W0A A;  5AQN B;  3EDU A;  3N9O A;  3SWH A;  4Z91 A;  3ZT6 A;  4TN7 B;  2L9Q A;  2VQF T;  1EVK A;  3HXY A;  2V26 A;  1HTJ F;  3TLS A;  4QH1 A;  4QX7 B;  4I0U A;  1X79 A;  2WDQ A;  5JDN A;  1MMA A;  2ACZ A;  4ZHQ E;  1O3X A;  4DQ2 A;  4X1K E;  3CQX C;  2JQK A;  2V5D A;  2XQY A;  4GKJ T;  2CCQ A;  4L5G A;  2IHR 1;  3AVR A;  3KBT A;  3PDY A;  3HTZ A;  5EK2 A;  2AMC B;  1WYB A;  2ZGW A;  3ZCJ A;  4HTE A;  3RKO A;  3N9P A;  3L4G A;  3RH3 A;  3RL6 A;  3NET A;  4QXB B;  4EED A;  1YQ4 A;  3KV5 A;  1FIO A;  4DID B;  3IKM B;  3IF8 B;  2DL1 A;  3UUN A;  3L09 A;  4HKA A;  5ABG A;  4KR3 A;  12AS A;  4ILC A;  1YGB A;  4E7Z A;  2UXB T;  1W9R A;  3ONL C;  4QH5 A;  3Q9D A;  1G5H A;  2CMR A;  4H2X A;  2UXX B;  3QB5 K;  4HE8 A;  4LF9 T;  3A31 A;  2EHO C;  3D0T A;  1Z7N A;  3HFZ B;  5C8Y E;  3FXD B;  1N33 T;  4H2X B;  4P74 A;  3P7I A;  4DV4 T;  2C7I A;  2K9A A;  3OYZ A;  5LHI B;  4ADZ A;  3JAD A;  1JNZ A;  4NPP A;  1E7P A;  3LSS A;  3AA6 B;  4UVA B;  1YW0 A;  3DP7 A;  2WB5 A;  5F5W A;  3NZP A;  4YXD A;  2XQ5 A;  4GYS A;  4K88 A;  3AE1 A;  2EJ9 A;  2L8K A;  3CKD A;  3ZPO A;  1HX8 A;  2X0H A;  4U74 A;  2DCF A;  1G5I A;  1J1J A;  3EI0 A;  2D0U A;  4L0R A;  4U7I A;  4ASK A;  2W0G A;  5LJM A;  1E1O A;  4E51 A;  3HKD E;  2W4X A;  2NS6 A;  2XQ7 A;  3FZK B;  4QXH B;  2BG9 C;  4WYV A;  5FXV A;  3RKG A;  2E5L T;  5KNN A;  4BAY B;  2V6Y B;  4UVC B;  4CXW A;  3SFE A;  5AQG B;  2YK0 A;  5FL0 A;  4F6R C;  2K24 A;  4WJ3 M;  4OLF A;  1LKX A;  2KLQ A;  3C4X A;  5HXR A;  4JI7 T;  4JI2 T;  2LKG A;  3A7R A;  1EZ3 A;  1ADY A;  4DR2 T;  3HR0 A;  1RIQ A;  4IIJ E;  5L47 A;  4HWO A;  2CXL A;  1KF6 A;  3F57 A;  5CA0 E;  1QF6 A;  2ART A;  3SS1 A;  2CWO A;  4J2C A;  3ZCI A;  4KP3 C;  2WWV A;  2P9B A;  2DQ0 A;  3K1S A;  1W0B A;  2DWK A;  3CK6 A;  4ZI3 D;  3H37 A;  3BFM A;  4YP0 A;  1FMW A;  1NJ6 A;  3ETV A;  1KNR A;  4TVA A;  2WDV A;  2E8I A;  3AAA B;  3L8R A;  4EZ4 A;  4OX9 T;  2PG8 A;  2EWN A;  3MQZ A;  5ABF A;  2YU1 A;  1ZEE A;  1BR2 A;  1UGO A;  2K48 A;  3ZMZ B;  1KNZ A;  2ODR D;  2E9X C;  4HEA A;  3ONX A;  1LVK A;  5AQH B;  4X64 T;  2PME A;  3PJA A;  1YXR A;  3P8T A;  3IEE A;  3TEH A;  1M7K A;  4HVC A;  4QKN A;  2IW5 B;  4WF2 A;  3RRW A;  2WBL A;  3P50 A;  4BW9 A;  3LSV A;  1USY C;  3AA0 B;  4E7S A;  1L0V A;  1VCT A;  1U4Q A;  2WCA A;  1HTT A;  2D0T A;  1XNQ T;  4H9Q C;  1YD8 G;  2LOS A;  2E65 A;  2KIN B;  4EV6 A;  1YFT A;  3AA7 B;  2I0M A;  4GIW A;  4JI5 T;  2V7K A;  4U33 A;  4LF6 T;  2I4L A;  1WPY A;  3AE3 A;  3QTC A;  2XAG B;  5LGT B;  1ZP0 A;  4XTW A;  3GA8 A;  4P72 A;  5C51 B;  2B76 A;  3PUZ F;  4U7Y A;  4ZS3 A;  1EFW A;  1WU7 A;  3TLT A;  1E22 A;  3RAC A;  4LNS A;  3ANW A;  4ZXL A;  5K1X A;  4A5X A;  2Q9Q C;  1FJG T;  1V9D A;  2E64 A;  1UCU A;  5LXT E;  3AEF A;  3NRX A;  2BG9 E;  2LSG A;  4YRE A;  2V7M A;  3GWH A;  4WJ4 A;  3FBL A;  4KQE A;  2CE7 A;  3KFW X;  3UU6 A;  4IST A;  3VBB A;  4P09 A;  1D0Y A;  1SE7 A;  1NNH A;  5FVL A;  2DHR A;  3C50 A;  4AH6 A;  5LHH B;  1N32 T;  4YRT A;  4RDX A;  3HL6 A;  2FJB A;  5C52 B;  2P0L A;  2WZI A;  4HWH A;  3CQC B;  3BQL A;  4HN9 A;  2JQ9 A;  1HFA A;  1US7 B;  5FL1 A;  4HWI B;  4A98 A;  4P71 A;  5JDH A;  3VQX A;  4H63 H;  4HFD A;  5FYM A;  4XEM A;  3PZC A;  4EO4 A;  4NUV A;  4UV8 B;  2CIM A;  2X0Y A;  4ANJ A;  2E3C A;  4DBR A;  3U3I A;  2VK9 A;  3RIU C;  1BIA A;  1WLE A;  1NYR A;  3K3N A;  4ILU A;  4CN4 A;  5ABE A;  4A97 A;  4G84 A;  3AA1 B;  1AJ3 A;  1XDO A;  2W67 A;  2HNI A;  2SPC A;  1H4S A;  5FY7 A;  2XAQ B;  4JLE A;  4EEB A;  1HNX T;  1MIV A;  4BA9 A;  2X0L B;  4F8H A;  2DJZ A;  2D9D A;  1HC7 A;  5LG4 A;  2VKJ A;  3HFV A;  4ERR A;  1HG5 A;  3G06 A;  3P4Q A;  3EVY A;  5AQI B;  4C90 A;  2DQ3 A;  3N2G E;  3PUS A;  4TWF A;  3ETU A;  2QHT A;  4JBW F;  1MIW A;  3WAJ A;  1T98 A;  3R07 A;  3A5Y A;  5FP3 A;  4IE6 A;  5CB4 E;  4EX5 A;  5DJQ C;  3AEG A;  4PFP A;  4TUY E;  5KMG P;  3QO7 A;  2WSS V;  4P73 C;  4LF5 T;  2JIW A;  1XNR T;  4AKG A;  3HKB E;  2A9U A;  2QVA A;  2ZIN A;  3ZYM A;  3FB2 A;  4GK5 E;  2HH7 A;  3AAI A;  4UXN B;  2UUC T;  2FJD A;  1W09 A;  1WFD A;  3JAF A;  2VQE T;  3WAK A;  5HEJ A;  4DMW A;  1YFR A;  5C3J A;  5L3C B;  1B7T A;  3TLW A;  4H2U A;  2LKH A;  1SUM B;  3P4S A;  3LFM A;  4UPA A;  2KMF A;  4YYE A;  4P3P A;  2DNX A;  4EIW A;  2FBW A;  2XQA A;  3RKX A;  4YTM A;  1IJ5 A;  2NWB A;  2ZZF A;  4FJO A;  3EUH A;  4YLH A;  2G4C A;  2DZC A;  3V8K A;  4XZC A;  2Q7E A;  2JQH A;  3M3Z B;  5A1L A;  3PCO B;  2WS3 A;  4QHO A;  4AKH A;  2UXD T;  3UGQ A;  3DTO A;  2VKD A;  3V7S A;  3RYH E;  3NEN A;  3HXZ A;  4COF A;  3V5S A;  2XAJ B;  3CQG B;  4P0A A;  2YU2 A;  2VKH A;  3ZJ1 A;  3HXU A;  4YRC A;  5M4Y A;  3EHZ A;  3RQU A;  1ZV4 X;  1Y64 B;  5AQT B;  1HCI A;  1MMN A;  1G8X A;  4DR5 T;  2CJ9 A;  3VU7 H;  5AQK B;  2V6X A;  4N78 D;  3N9M A;  2QHS A;  4LF8 T;  3FHN A;  1G73 A;  3M4P A;  2B1E A;  4EXT A;  1WLX A;  3AE9 A;  3V8L A;  2IML A;  4CQI A;  2VUR A;  5L4H A;  3LSQ A;  2CHO A;  3AED A;  1KMM A;  2LOP A;  2NTX A;  2KWH A;  4CH3 A;  2CM0 A;  2OLT A;  4KBM B;  4H2Y A;  3AVS A;  1WR0 A;  3DJB A;  4OP0 A;  2AXD S;  5IHY A;  1BIB A;  4MHC A;  2LLY A;  4HWC A;  4UP7 A;  3J7Y q;  1UUR A;  4IDP A;  4HFH A;  5HXS A;  2NOX A;  2UUB T;  2XTI A;  1LRZ A;  4RQE A;  3UFE A;  3C51 A;  5J2U E;  4IDO A;  4KI0 F;  4M1P A;  2ZZG A;  3BJU A;  3VQY A;  3NKZ A;  5FXW A;  1VOM A;  3REX A;  3OTO T;  4L87 A;  3PTR B;  2ZR3 A;  1N9W A;  3RRC A;  3UUX B;  1HNW T;  2XSA A;  4DV0 T;  2DU7 A;  3LC0 A;  1OED A;  4YFS A;  3P4W A;  4JI0 T;  5CGM A;  4CN1 A;  2QA7 A;  4MFR A;  3UFG A;  1OED B;  4IGU A;  2H3R A;  2ZT6 A;  2YKS A;  2I4N A;  4AIU A;  1BR1 A;  2IDO B;  2ZIM A;  5H6Q B;  2WU5 A;  3A7A A;  3ZC0 A;  4GKK T;  1SET A;  1X56 A;  5AQF B;  4AQY T;  2CJA A;  4X66 T;  3A7M A;  1FYF A;  4QH4 A;  4AI6 A;  4HWS A;  1WQ7 A;  2HN2 A;  3E0Z A;  5AQQ B;  4ZZB A;  2J3L A;  3L1A A;  4UP8 A;  1WQW A;  3QOF A;  3AE8 A;  3R84 B;  2A8E A;  3B13 A;  4XU3 A;  4U3C A;  1HF8 A;  4RMF A;  2ODR C;  2RP4 A;  4CS2 A;  4DV1 T;  4HWR A;  1VQZ A;  4B3T T;  1Z7M A;  3P4P A;  1E1H B;  2ZR2 A;  5HYA A;  2C5I T;  2L3L A;  4HFE A;  3OPC A;  5AQP B;  2C0S A;  4EB6 E;  4U2Z A;  3HY0 A;  3CX7 B;  2XHE B;  2BKO A;  2CXD A;  5L3B B;  2H7O A;  3HA4 A;  3LK2 B;  3VQV A;  5TAO A;  4XU1 A;  4HFI A;  1ADJ A;  3CWZ B;  5L3F B;  3KIN B;  2CLY B;  4PK6 A;  4WBO A;  2DTH A;  4BJN A;  4H63 V;  5HEG A;  2XQ6 A;  2ARU A;  5KX5 E;  2KZ7 B;  2BZB A;  4PJL A;  3RIF A;  5LB7 B;  4XAX B;  4YHJ A;  2HN1 A;  3O1J A;  3NEL A;  4AXP A;  2XPK A;  2KXP B;  5JR9 B;  2X68 A;  2PBI A;  3J9X 1;  5JRC A;  4EYY R;  1IBK T;  2IUB A;  1H4T A;  4HFB A;  4OK0 A;  5C2T A;  1MNE A;  3RLF F;  1JNR A;  3W3S A;  4XTU A;  4YJ2 E;  4P72 C;  2VL8 A;  1L0W A;  2RHQ A;  2GK9 A;  2YOE A;  1WYD A;  4C91 A;  2WMN A;  2NP9 A;  4Q6G A;  1IBL T;  5HWX A;  4XU2 A;  2KWI B;  3Q5X A;  3ZC1 A;  2DTI A;  2Q9Q A;  4TWD A;  4PG3 A;  4YT0 A;  3HFZ A;  1ZOY A;  2VAS A;  2CXF A;  2WM9 A;  5EK4 A;  4TVY A;  4DV7 T;  3VR8 A;  1SRY A;  4JI8 T;  1HNZ T;  3ZSS A;  4I50 E;  4U31 A;  3T8O A;  1X2G A;  1NJ2 A;  5LCY A;  3ZN1 B;  1KNP A;  5JDG A;  4ZIB A;  5ABF B;  2E10 A;  4TV9 E;  2J3M A;  4AKI A;  3PU3 A;  3UQ4 A;  2YDQ A;  4EOZ B;  3T1Y T;  4XTX A;  2RA1 A;  3C98 B;  3P8C D;  4X65 T;  1JJC A;  2MPK A;  2P5I A;  3PUX F;  3FZF B;  4PFO A;  1WRD A;  1IBM T;  2HPL A;  2H7V C;  2I4M A;  2BBJ A;  4H2W A;  2EHO D;  1ZKE A;  4CZZ B;  5L3E B;  2BDE A;  2PMF A;  4H2V A;  2CBJ A;  2DEQ A;  2CWY A;  3ESL A;  1XMQ T;  2WAU A;  4DPG A;  5LBM A;  4XTV A;  4UIG A;  4HT4 A;  3SRZ A;  1J5E T;  4KHP T;  4H9P C;  2NW7 A;  2RHS B;  4PJJ A;  2LHN A;  3A7U A;  2HHH T;  2W2U A;  4HWF A;  5L3G B;  3P4R A;  5J2T E;  1S35 A;  3O4X E;  4IE5 A;  4EZH A;  3E22 E;  4JI6 T;  4CH4 A;  3N2K E;  2Q5I A;  1B7Y A;  5ELN A;  5AQR B;  1T8B A;  4GK0 E;  4H9N C;  4I55 E;  4ZI7 E;  3EFR A;  4YSX A;  1NEK A;  3RGL A;  3OVU A;  4X62 T;  2IAK A;  4FI5 A;  2JRK A;  3UU8 A;  2X9X A;  2ZT8 A;  1E1T A;  4JYA T;  4PJN A;  4O2A E;  3AEE A;  2I4O A;  5LGU B;  4UV9 B;  2XM1 A;  4X20 E;  4JI4 T;  3UUM A;  3N5L A;  2CRB A;  1SHZ C;  4X1Y E;  4KHZ F;  1LYL A;  4KMC A;  4UEL A;  4AQF A;  3IBP A;  4YRL A;  1B70 A;  2E5A A;  1LVF A;  3UT5 E;  3L39 A;  2C5K T;  4CN6 A;  1QE0 A;  4DND A;  3ZLI A;  3AEA A;  3G1Z A;  1PYS B;  2UXC T;  2A2F X;  5JDQ A;  4UF0 A;  2XY8 B;  3LJC A;  3ONJ A;  4JEU B;  4JUY A;  4WW0 A;  3I7F A;  4TQD A;  3A5Z A;  4DR7 T;  4DBQ A;  3CX8 B;  1XMO T;  4P3O A;  1NJ1 A;  1N36 T;  4TWA A;  2EHO B;  3ZJ2 A;  4Z8X A;  4DR1 T;  4ZI2 C;  4K0U A;  5L2L A;  1I94 T;  1WR6 A;  3ZYK A;  4B6X A;  1QUU A;  5HXE A;  3PUV F;  3BQI A;  3MF2 A;  1QLB A;  2DI4 A;  2DTO A;  3LK4 2;  2BKN A;  3PUQ A;  4YRR A;  3M4Q A;  4O4H E;  3S4U A;  4H02 A;  3JC6 D;  4K87 A;  3TEG A;  1B76 A;  5HAX A;  1KK7 A;  4IRE A;  4YRF A;  1QSD A;  2X51 A;  5JQG E;  1ASZ A;  2K5B B;  2X9W A;  4ZTU B;  4J15 A;  3IHR A;  2E41 A;  4V1A v;  3RF1 A;  1X54 A;  2Z6E A;  1OWA A;  1UUS A;  1MMG A;  1YFS A;  2BG9 B;  4AQG A;  3N9N A;  3E9H A;  3KBU A;  5HXC A;  2AKW B;  4P73 A;  3HXX A;  4B3R T;  2RHQ B;  1Y01 A;  4X5T A;  4K86 A;  5FVK A;  3DSQ A;  2YN6 A;  2JJ9 A;  3BQK A;  3EAM A;  3ZST A;  2F4V T;  5AQU B;  1HS7 A;  2VB6 A;  3KDS E;  5JDL A;  4PHC A;  3TLV A;  5IUX A;  4CI1 B;  1MMD A;  2LJL A;  2ZXF A;  4XEO A;  2LSI A;  3MKD A;  3PE0 A;  1NWM X;  4CI3 B;  5DQW A;  4CS4 A;  4MBQ A;  4B3M T;  3RYC E;  1GQE A;  2AE9 A;  3MJX A;  3MEY A;  4JV5 T;  3RHW A;  2KND A;  3UUL A;  5CA1 E;  3ZEF B;  2XQ8 A;  4XU0 A;  5LJN A;  3UU5 A;  5IYZ E;  3Q5W A;  2JMH A;  2LE8 A;  4IE0 A;  3SFD A;  1SER A;  3NZQ A;  5LMN T;  3AAE B;  3NBX X;  3UGT A;  2A72 A;  1IL2 A;  3VRA A;  5HEO A;  3ICA A;  1YKH B;  3QO8 A;  3MAC A;  4H2T A;  4YRI A;  5E3I A;  2X67 A;  2E9X B;  2ZM6 T;  2DXT A;  3F31 A;  4A56 A;  3VR9 A;  5JRC B;  2Q5H A;  5AQO B;  2BG9 A;  3QNE A;  5L3D B;  2BVL A;  4U2Y A;  1HR0 T;  2PTF A;  1NJ8 A;  2XM2 A;  3AE2 A;  4PAG A;  1NEN A;  3PV0 F;  4DMV A;  4EAH A;  5ETW A;  5FMN A;  2UXN B;  1U5P A;  5JTG A;  4MLK A;  4YRN A;  4P1N A;  3U78 A;  4PW8 A;  4IDN A;  4YRP A;  2ZLY A;  2I6H A;  5C53 B;  3PJA J;  1ATI A;  4HA8 A;  3JAE A;  4IL9 A;  4WNK A;  2K3W A;  1MIY A;  4YRG A;  3FZL B;  3UH0 A;  2YEV C;  4AQF C;  4TVA B;  3ZYL A;  4DVD A;  4K0K T;  1BR0 A;  2YDR A;  4IE7 A;  3ZT5 A;  3VKH A;  4HWP A;  2ZNI A;  3CIR A;  4UR9 A;  4LVI A;  1HG2 A;  4X1I E;  2Q7H A;  5LBQ B;  1OXZ A;  5FY1 A;  2G0U A;  2M6I A;  1I6Z A;  3AE5 A;  5AQJ B;  1EQR A;  2VL0 A;  4ISS A;  2Q9Q B;  4AKL A;  3UU4 A;  1B7Y B;  3IG2 A;  2JQQ A;  4PJM A;  4QX8 B;  4DUZ T;  1X9B A;  2M6B A;  4O4J E;  5CJ5 A;  5J1G A;  2YIN A;  3HXV A;  3V8J A;  2IY5 A;  4YY3 T;  3I0Q A;  2V7J A;  4OYK A;  1HXD A;  5FXZ A;  2E9X A;  2KSR A;  4YPF A;  3F2E A;  1G51 A;  1S94 A;  1J5W A;  4IL4 A;  1D1C A;  2RHS A;  3FXE B;  3P8Y A;  4XTY A;  4YCV A;  5LYJ E;  3RQW A;  4AIS A;  3TLU A;  2DDZ A;  3HY1 A;  2LRL A;  5DAB A;  3UQ7 A;  3UU3 A;  4L9I A;  4EYU A;  2LEH A;  5LNK A;  3AB3 B;  4G63 A;  2BS2 A;  4G2A A;  2WDR A;  2C8M A;  3KV6 A;  3A8Y C;  3TUP A;  3NWI A;  2IC6 A;  1Z0P A;  2J62 A;  2OA5 A;  3AEB A;  5LA6 E;  4DV6 T;  3QC9 A;  2CPT A;  11AS A;  4TWH A;  2M67 A;  3UTK A;  1T72 A;  4YHH T;  4YRO A;  2ODU A;  4HWD A;  1CUN A;  2V1D B;  4TQF A;  3K3O A;  3EAB A;  2NTY A;  3MZK B;  3QUJ A;  5KDM C;  2ZM0 A;  2D5U A;  4OFZ A;  2EHO A;  4OYJ A;  4TVW A;  4LML A;  4DV3 T;  3A74 A;  4P74 C;  2CHN A;  1KFY A;  4NXM T;  2Y48 B;  3Q5E A;  3O9X A;  2DXU A;  1B70 B;  1KEY A;  4IDQ A;  3T1H T;  1KMN A;  2YDS A;  4TZ4 C;  4YDQ A;  4KUM B;  2D2S A;  4TNW A;  2ARS A;  5HEU A;  1BR4 A;  2W63 A;  2ZM8 A;  4LVM A;  2Q9Q D;  1X2H A;  3RC3 A;  4PK5 A;  2ZMA A;  4OHF A;  5GON E;  3IA3 A;  4UF0 B;  5ELO A;  2V7L A;  4CXX A;  3KV9 A;  2DVE A;  5JDF A;  3RX6 A;  4JI3 T;  4KX6 A;  2XUE A;  2N2N A;  4O2D A;  2PJQ A;  2X9H A;  3SOL A;  2V5C A;  2FJA A;  4DR6 T;  3K8P C;  3NEM A;  3RYF E;  1VCS A;  4Q15 A;  5HGQ A;  4KR2 A;  4Q25 A;  3JCF A;  2MBG A;  2VKO A;  1HX1 B;  3MA9 A;  4AKR B;  3RUX A;  3QB5 A;  4PNI A;  5K1P A;  3PUW F;  2DWG A;  2V7I A;  3N9L A;  2NW9 A;  4EGW A;  3HI2 A;  3VHL A;  2VVN A;  2Y6X A;  2XQ9 A;  2E1H A;  1ASY A;  3K3Q C;  2QHU A;  4P75 C;  4TTV A;  3L3P A;  2QHV A;  3HKE E;  5AQV B;  4ILB A;  2WMO A;  2EJF A;  3V7R A;  4I43 B;  2CA5 A; 
#chains in the Genus database with same CATH homology
 2AMC B;  2E5A A;  2ZGW A;  4UPA A;  3IKL A;  3L4G A;  4YYE A;  3RL6 A;  3NET A;  3HXW A;  1QE0 A;  4RQF A;  4P3P A;  2DU5 A;  3G1Z A;  3IKM B;  1PYS B;  4LVK A;  3RKX A;  2AKW A;  2ZZF A;  4KR3 A;  12AS A;  2G4C A;  2DZC A;  4LVJ A;  3V8K A;  1YGB A;  3I7F A;  4TQD A;  2Q7E A;  3A5Z A;  3PCO B;  3FJP A;  1G5H A;  4P3O A;  3UGQ A;  4H2X A;  1NJ1 A;  3A31 A;  4TWA A;  3V7S A;  2ZNJ A;  3NEN A;  1Z7N A;  3HXZ A;  3HFZ B;  3VQW A;  4H2X B;  4P74 A;  4YRM A;  2ZZE A;  4G85 A;  2C7I A;  1X55 A;  3HXU A;  4YRC A;  3RKW A;  4CH5 A;  2DZ9 A;  3MF2 A;  1JJC B;  2CJ9 A;  2ZTG A;  3LSS A;  4P3N A;  2DTO A;  2QHS A;  4YRR A;  5F5W A;  3M4Q A;  4H02 A;  4K87 A;  3TEG A;  3M4P A;  1B76 A;  4YRF A;  4K88 A;  2EJ9 A;  1G5I A;  3V8L A;  1ASZ A;  3L4G B;  4ZTU B;  4J15 A;  1E1O A;  4E51 A;  2E41 A;  3LSQ A;  1X54 A;  3RF1 A;  2NS6 A;  1KMM A;  1YFS A;  3E9H A;  4WI1 A;  2AKW B;  4P73 A;  4CH3 A;  3HXX A;  5KNN A;  2RHQ B;  1C0A A;  4H2Y A;  4K86 A;  3DSQ A;  4OP0 A;  4WJ3 M;  4OLF A;  1BIB A;  4UP7 A;  4H2S A;  3A7R A;  1ADY A;  4PHC A;  1RIQ A;  2XTI A;  4RQE A;  4HWO A;  2ZZG A;  3VQY A;  1GGM A;  2ZXF A;  3BJU A;  4XEO A;  4YCU A;  3REU A;  2DKG A;  2CJB A;  4X5O A;  4YRJ A;  3REX A;  2IY5 B;  4CS4 A;  4L87 A;  2ZR3 A;  1N9W A;  1QF6 A;  2ART A;  2ALY B;  1H4V B;  2DU7 A;  2ZT5 A;  3LC0 A;  3MEY A;  3EFS A;  3E9I A;  1WNL A;  2DQ0 A;  4XU0 A;  3UFG A;  3HRI A;  1USY A;  3BFM A;  2ZT6 A;  4YP0 A;  1NJ6 A;  1SER A;  4TVA A;  2I4N A;  2ZIM A;  3CMQ A;  3UGT A;  2EWN A;  1IL2 A;  3MQZ A;  3A7A A;  3A32 A;  2EL9 A;  1KOG A;  1SET A;  3ICA A;  1X56 A;  3QO8 A;  3IAL A;  2CJA A;  3L2Z A;  4H2T A;  4YRI A;  1PYS A;  5E3I A;  1FYF A;  2ODR D;  2DXT A;  4HWS A;  1WQ7 A;  4YRK A;  2PME A;  2Q5H A;  1X01 A;  3P8T A;  3QNE A;  3TEH A;  2J3L A;  3L1A A;  4UP8 A;  4HVC A;  2EAY A;  1WQW A;  1NJ8 A;  4BWA A;  4WF2 A;  4BW9 A;  2A8E A;  1USY C;  4XU3 A;  2CGH A;  4NCX A;  1NJ5 A;  4YRN A;  4RMF A;  2ODR C;  4YRP A;  4CS2 A;  5C53 B;  1HTT A;  4HWR A;  1VQZ A;  1ATI A;  4HA8 A;  1Z7M A;  2E65 A;  2Q7G A;  2ZR2 A;  1YFT A;  3V7C A;  4YRG A;  3UH0 A;  2I4L A;  4TVA B;  2ALY A;  1WPY A;  3HY0 A;  3QTC A;  4XTW A;  4P72 A;  5C51 B;  3VQV A;  4HWP A;  2ZNI A;  4XU1 A;  1ADJ A;  4LVI A;  2DTH A;  1EFW A;  1WU7 A;  2Q7H A;  1E22 A;  1SES A;  2ARU A;  3RAC A;  1EQR A;  4LNS A;  5K1X A;  2EJG A;  4P71 C;  3QO5 A;  2E64 A;  1B7Y B;  3IG2 A;  3NEL A;  3PCO A;  1NYQ A;  4P75 A;  4YRE A;  4WJ4 A;  3HXV A;  4KQE A;  3V8J A;  1W66 A;  2IY5 A;  3WQZ A;  3VBB A;  2ZCE A;  1EVL A;  3OD1 A;  1NNH A;  1HXD A;  1H4T A;  4AH6 A;  4YPF A;  3RIR A;  1EIY A;  1G51 A;  3W3S A;  3P8V A;  4YRT A;  4XTU A;  4CH6 A;  4RDX A;  2AMC A;  1J5W A;  4XTY A;  2RHS A;  3P8Y A;  4P72 C;  4YCV A;  1L0W A;  2RHQ A;  5C52 B;  2DDZ A;  1WYD A;  3HY1 A;  2P0L A;  1B8A A;  3RKY A;  4Q6G A;  4XU2 A;  2ZT7 A;  2C8M A;  2DTI A;  4P71 A;  3TUP A;  3VQX A;  3ERR A;  3HRK A;  4PG3 A;  3HFZ A;  4XEM A;  1YB3 A;  3PZC A;  11AS A;  4EO4 A;  4LVL A;  4TVY A;  1SRY A;  4UP9 A;  4YRO A;  2CIM A;  1X2G A;  1NJ2 A;  2E3C A;  4TQF A;  3TEH B;  4ZIB A;  2E10 A;  1EOV A;  4XTZ A;  2J3M A;  4XTX A;  1BIA A;  1WLE A;  1JJC A;  1NYR A;  1E24 A;  2P5I A;  2FYK A;  2I4M A;  3MF1 A;  4TVW A;  4G84 A;  3A74 A;  4H2W A;  4P74 C;  1H4Q A;  1BBU A;  2HNI A;  2PMF A;  4H2V A;  1H4S A;  2DXU A;  1B70 B;  2DEQ A;  3KFU A;  1KMN A;  4ZTZ B;  4YDQ A;  4DPG A;  4XTV A;  2DJZ A;  4YCW A;  4HT4 A;  1HC7 A;  4YRS A;  2ARS A;  2XGT A;  3HFV A;  2RHS B;  4LVM A;  1X2H A;  3A7U A;  4HWT A;  2DQ3 A;  5ELO A;  1EIY B;  2ZIO A;  2QHT A;  2DVE A;  1BBW A;  4CS3 A;  3R07 A;  3A5Y A;  4CH4 A;  4O2D A;  4EX5 A;  4YRQ A;  2Q5I A;  1B7Y A;  5ELN A;  3QO7 A;  4P73 C;  3NEM A;  3EFR A;  1EVK A;  3HXY A;  2ZIN A;  4Q15 A;  5HGQ A;  3RGL A;  4KR2 A;  3RUX A;  5K1P A;  2ZT8 A;  1E1T A;  4DQ2 A;  2I4O A;  2E1H A;  1ASY A;  2QHU A;  4P75 C;  4TTV A;  2QHV A;  1YFR A;  4H2U A;  1LYL A;  2EJF A;  3V7R A;  3HTZ A;  4YRL A;  1B70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...