3RGLA

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc in complex with atp and glycine
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glycyl-tRNA synthetase alpha subunit
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP and glycine.
rcsb
source organism Campylobacter jejuni
total genus 101
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3rglA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rglA01
5C52B 2DTHA 1ASYA 3LSQA 2DU7A 5K1XA 2AKWB 2ZIOA 4XTWA 4UP8A 4PHCA 1EVLA 2I4NA 3A5YA 1X54A 2DZCA 2DU5A 4YRIA 3LC0A 3OD1A 4YRTA 3IKLA 2J3MA 3L1AA 2DDZA 3RKWA 1WPYA 3V8JA 5F5WA 4H2SA 4YRJA 11ASA 2I4MA 2DXTA 3RL6A 3QTCA 4HVCA 4YDQA 1H4VB 4HWPA 3BJUA 4P74A 2ALYA 3QO8A 2ZT8A 2PMEA 2Q7GA 1WU7A 2QHUA 2Q7EA 3EFRA 2ZR3A 1J5WA 3CMQA 1KMNA 3HXUA 2AMCA 3HFZA 1NJ5A 2E10A 3MEYA 4HWTA 2Q7HA 1BIBA 1B7YB 1ASZA 1H4TA 4WI1A 1JJCB 5C51B 1EIYB 4BWAA 5E3IA 3V8LA 3NELA 2Q5HA 3TUPA 1HC7A 4CH5A 1VQZA 12ASA 1B70A 1G5IA 3E9IA 1BIAA 3VBBA 4ZTZB 1YB3A 2ARUA 2C7IA 2XGTA 3RF1A 5ELNA 1HTTA 4P75A 4XU2A 3TEGA 4P73A 1NJ2A 4TQDA 3REXA 1N9WA 4YCVA 4CS4A 1SERA 4KR3A 4YCUA 1LYLA 2PMFA 4K86A 3RGLA 1PYSA 4EO4A 4XU3A 1NJ6A 2J3LA 4XTXA 1KMMA 4YRQA 5K1PA 4CS3A 4YP0A 4P71C 3LSSA 2FYKA 2ZT6A 4H2XB 2RHQB 3REUA 1EVKA 3L2ZA 3RKXA 2EL9A 4XTYA 4YROA 4YRLA 3ERRA 1G5HA 3VQYA 4TVWA 1E1TA 4OLFA 2DXUA 1HXDA 1H4QA 3FJPA 2ARTA 2DVEA 3L4GB 4H2YA 1FYFA 4RQEA 2IY5B 2EJFA 3VQWA 1ADJA 4G85A 2DQ3A 3RUXA 2E5AA 3VQXA 4P72C 2EJGA 2ZT7A 4K88A 4CS2A 3TEHB 1X55A 1X56A 2I4OA 4KR2A 4L87A 1USYA 4WF2A 4P3PA 4X5OA 1E1OA 4ZIBA 1YFTA 1W66A 4Q15A 4TQFA 4CH3A 2RHSA 2E41A 4H2TA 3ICAA 4UP9A 1YFSA 3MF2A 1B70B 4LNSA 1NJ8A 4XU0A 1WLEA 4UP7A 3HRIA 4PG3A 1Z7NA 4YRFA 4KQEA 2ZIMA 3G1ZA 4P3NA 2E64A 4XTUA 3V7CA 3DSQA 3M4QA 1EOVA 4G84A 4O2DA 4YPFA 4P74C 1WQWA 1H4SA 3P8TA 4H02A 2I4LA 2DQ0A 1PYSB 2ODRC 1L0WA 3PZCA 4H2VA 2ZT5A 4TVAB 3E9HA 1B7YA 2HNIA 3I7FA 3NETA 1B8AA 1KOGA 1ATIA 3A74A 1SESA 4NCXA 1ADYA 5KNNA 2ZINA 2ZGWA 3HXWA 4CH4A 3NENA 3PCOA 2ZCEA 3BFMA 4HWOA 2C8MA 2CJAA 1RIQA 4P75C 2CJBA 3WQZA 3HXYA 4YRNA 1GGMA 2DTIA 1E22A 2DJZA 1X01A 4YYEA 4P73C 4HWRA 3A32A 3P8VA 2ZXFA 3HY1A 3IG2A 2ZZGA 2E65A 4ZTUB 4UPAA 3V8KA 2ALYB 1YGBA 4E51A 3HY0A 3RIRA 4YRGA 4XTZA 3UFGA 1SETA 2RHSB 4HWSA 3V7SA 3UGTA 4EX5A 3HXZA 2AMCB 4YCWA 3HFZB 3RACA 4AH6A 4H2XA 2RHQA 3HFVA 1BBUA 4YRSA 4YREA 4BW9A 3A5ZA 3W3SA 1X2HA 3HTZA 1EFWA 4Q6GA 1SRYA 1E24A 2AKWA 2CGHA 2ZZFA 2ZZEA 4RQFA 4TVYA 4K87A 2QHVA 3L4GA 2IY5A 1IL2A 2P5IA 4OP0A 4XTVA 1BBWA 2DKGA 5C53B 3QO7A 3IKMB 4WJ3M 1WQ7A 3IALA 4YRMA 4RMFA 4H2UA 3TEHA 1YFRA 4DQ2A 4RDXA 2Q5IA 4YRRA 2E3CA 1X2GA 3A7RA 2ZNJA 1QF6A 4H2WA 3HRKA 1USYC 4CH6A 2DEQA 1NYRA 3UGQA 2EJ9A 2ODRD 4WJ4A 3M4PA 4P3OA 2EAYA 5ELOA 4YRKA 3PCOB 4J15A 3A7UA 1Z7MA 2DZ9A 1EQRA 4DPGA 4P71A 1JJCA 3R07A 1QE0A 1EIYA 4HA8A 3RKYA 3HXXA 3V7RA 2ARSA 2P0LA 2CJ9A 2XTIA 3A7AA 2QHTA 3NEMA 1WYDA 3HXVA 2QHSA 4TWAA 3QNEA 4YRCA 1B76A 1NNHA 2ZNIA 2E1HA 2G4CA 5HGQA 2ZR2A 4XEOA 3P8YA 4XEMA 3VQVA 3KFUA 4XU1A 2ZTGA 4TTVA 4P72A 2EWNA 4TVAA 4YRPA 3MF1A 1G51A 3A31A 3QO5A 1NJ1A 2CIMA 3UH0A 2DTOA 1WNLA 1NYQA 1C0AA 3EFSA
chains in the Genus database with same CATH superfamily
3AEFA 4PK5A 4LVLA 4NUUA 2BKNA 2W66A 2VWAA 3PUAA 4EV6A 2ZIOA 2J62A 2CHNA 5IYZE 4GOUA 3H3MA 4UP8A 2D2SA 4PW8A 1UUSA 2I4NA 4YXDA 3Q2MA 3PUZF 4IDPA 3LC0A 4LMLA 5L4HA 3IKLA 4UVCB 3MZKB 3V8JA 2VKJA 4YRJA 4H9PC 4JI8T 2I4MA 5FXXA 5LJNA 3LFMA 3P50A 2DCFA 5JRCA 3ZT5A 4TUYE 2WQYA 3QO8A 2Q7GA 5KX5E 4U7IA 1KF6A 2QHUA 2Q7EA 4WYVA 3RYIE 5BMVE 4H9NC 2AMCA 2LE8A 3IA3A 1BR1A 1B7YB 1U5PA 2Z6EA 3M65A 3AEDA 3LK3B 1EIYB 1VCTA 2V26A 4HWFA 3H3AA 2YINA 4H63V 5LOVE 3WI3A 4L0RA 4CH5A 1JNZA 5L47A 2CEAA 12ASA 2ZM2A 2NW8A 1BIAA 4YSYA 4ZTZB 5LG3A 1YB3A 2ARUA 2C7IA 2LKHA 2QRXA 5HXHA 4X62T 3RF1A 5ELNA 3PUXF 2E9XD 4XU2A 3CIRA 2ES0A 1MIYA 2CLYB 5H6RB 3N2OA 4AQFA 4EYYR 5LGTB 1T98A 2JRKA 2RP4A 3GN5B 4AI6A 1KNZA 4YCUA 1H7CA 3G06A 5FL0A 2YDQA 4TV9E 5CGMA 2V1DB 2UXNB 1D0XA 4U31A 4I0UA 3V5SA 1PYSA 3N9NA 5LBQB 5LGNB 1XZYA 2CM0A 1NJ6A 5CA0E 1KMMA 2LOPA 4CS3A 3FHNA 3GA8A 3AXJB 3LSSA 2FYKA 4H2XB 4U7YA 5LMUT 3RKXA 2V5CA 5JDQA 3IEEA 5DABA 2C5IT 2KMFA 1E7PA 4O4IE 4H2YA 5LMNT 2EJFA 2WWVA 3VQWA 3EAMA 3C4XA 2CRBA 5JDHA 3EVYA 1D0ZA 3KVBA 5AQPB 4WBNE 3UU3A 4NIQA 4K88A 3HKBE 3AA0B 1WYBA 1X56A 3ZC1A 1USYA 1UCUA 4WF2A 4MBQA 3F2EA 4ZIBA 3FZFB 2L9QA 4FI5A 4Q15A 2NOXA 5FNVE 3VHLA 3J9X1 5FXZA 4ZXLA 4H2TA 3RKOA 4AKLA 3CMLA 3IHRA 4LNSA 3CQXC 3BQKA 3RH3A 3LG7A 2X9XA 1JNRA 5HEOA 1WLEA 5FYMA 2OA5A 3HRIA 2VL0A 4PG3A 4ZEYA 2BVLA 4KQEA 4JYAT 3KBTA 2DI4A 1N36T 2BS4A 2MAWA 2EHOB 3M4QA 4QXHB 4O2DA 4U2YA 4P74C 2LRKA 1WQWA 2L8KA 2BS3A 2DQ0A 5A1LA 3N5LA 1L0WA 5JDGA 5LHGB 4I50E 2B1EA 4QHOA 3I7FA 4O2BE 4JI0T 3T1YT 1T8BA 2RA1A 4DR2T 3A5XA 1ATIA 2KWHA 1SESA 1ADYA 5KNNA 4EZ4A 5L3EB 2ZINA 3ZJ2A 2E9XC 3BK9A 4E7SA 2QA7A 3EDVA 2K9AA 5AQLB 2M67A 2QGSA 3I0OA 1I6ZA 4JI1T 2IMLA 4HWOA 4G2AA 2DNXA 2E5LT 2YU1A 2YN6A 2LOSA 5AQSB 4DV4T 2JQ9A 1SHZC 2CJAA 4P75C 4DV5T 1QLBA 3WQZA 2ODVA 4KI0F 3HXYA 2HPLA 3ONLC 4UIGA 4YRNA 2DTIA 1E22A 2DJZA 4X64T 1MNDA 2N2NA 3KV6A 5AQMB 2IAKA 1D1BA 2ZXFA 3D0TA 2UXCT 2EHOC 3IG2A 2H7VC 1LVFA 4H9OC 5JDFA 5JRCB 4ZS2A 2CA5A 2YDRA 5DQVA 5HCJA 5C8YE 3T1HT 3HY0A 3RIRA 4NPPA 4XTZA 3AEBA 2RHSB 3EI0A 2X0YA 2AMCB 4YCWA 3RACA 1BBUA 3KINB 2X0LB 5EK2A 2BG9B 1FEWA 3A5ZA 4QX7B 1HX8A 4Q6GA 2WWUA 3O9XA 2ZZFA 2ZZEA 4K87A 4IIJE 2QHVA 4E7ZA 4EXTA 3AA1B 3Q5XA 2NW9A 2DKGA 1DU2A 4IGUA 3IKMB 5ABEA 4RMFA 1YFRA 1HG2A 4OFZA 1SA0E 4DQ2A 3PV0F 3UU8A 4EZHA 4YTNA 4RDXA 2Q5IA 4YRRA 2E3CA 2ZNJA 2YOEA 3UUMA 1IBKT 2LM9A 2DEQA 3UGQA 2ODRD 3M4PA 4P3OA 3KBUA 2I6HA 5ELOA 3PCOB 3PJAA 3A7UA 4AKGA 2DZ9A 2YEVC 2CE7A 1EIYA 3U3IA 2BG9C 3HXXA 3RKYA 3V7RA 4KHPT 3ZPOA 2PBIA 3HXVA 5FVKA 1ZEEA 4HFDA 3SOLA 2QHSA 2XQ9A 3I9YA 3QNEA 3SRZA 1D1CA 1ZHCA 2E1HA 4QXCB 4QXBB 4XEOA 3VQVA 3TLSA 2XY8B 4YSXA 3KV5A 2KZ7B 2UXBT 2HN1A 2BZBA 5ADXL 5JDNA 3A31A 3GN5A 2W62A 3QO5A 2V7KA 5LB7B 3EDUA 3UH0A 4TN7B 5FXWA 1C0AA 3UU4A 1WNLA 3EFSA 2XSBA 5C2TA 2W2UA 2F4VT 1ASYA 3Q5DA 4ISSA 3CWZB 2DU7A 1MMNA 4XTWA 5LA6E 5LP6E 2AE9A 4PHCA 3LSVA 3CPZA 1EVLA 3KV9A 4H9SE 4CXYA 2DU5A 4C91A 4HN9A 4YRIA 4ZS3A 4YRTA 2J3MA 5AQQB 4X65T 3RKWA 3RLFF 1XDPA 4DR1T 5FP3A 3F57A 3B5MA 4H2SA 3LDQB 2CWOA 3AVSA 1AJ3A 2XQ8A 4YDQA 4EEDA 4P74A 4UF0A 2ALYA 1YQ3A 1V9DA 2ZT8A 4HFBA 1M7KA 5FL1A 3WAKA 3CMQA 3H37A 1NJ5A 4X1KE 3SWHA 5JDLA 2E10A 1J1JA 4U33A 1BIBA 4WI1A 1JJCB 4JUYA 5C51B 4HWIB 2K3WA 3AB3B 4Z8XA 5IHYA 4BWAA 4GKJT 3Q5WA 3NELA 2QYWA 2BBHA 3TUPA 1KNRA 2XAGB 5FY7A 2MTQA 2X67A 2XQ4A 3VBBA 3MXZA 2CCQA 1YQ4A 3E22E 4P75A 4ISTA 4EB6E 4O4HE 1J5ET 3E08A 1NJ2A 5GONE 3REXA 1N9WA 1WR0A 2EHOA 4CS4A 1YKHB 3QB5K 1SERA 4KR3A 4KBMB 4EYUA 4V1Av 3UU5A 4OK0A 4EO4A 3VU7H 4ZHQE 4XU3A 4P1NA 2J3LA 3AAIA 5KDMC 4EOZB 2JIWA 2JMKA 3AEEA 4F6RC 2V7LA 1EVKA 1VOMA 4AQYT 3SFDA 4AKIA 2PFVA 2C0SA 1OXZA 5LHIB 4HFHA 1YD8G 3CQGB 3SS1A 1Y01A 2WZHA 4EEBA 1E1TA 2LJLA 4DV6T 4OLFA 3HA4A 4C90A 3P4WA 1HXDA 3FJPA 3P4PA 1FYFA 2FJBA 3AE6A 2A3DA 1ADJA 2DQ3A 4LVJA 2SPCA 2E5AA 1N33T 5L3GB 2ZT7A 3UFEA 4N78D 3ZYMA 3K8PC 1B7TA 1NENA 4KR2A 2Y8DA 1BR4A 2LSYA 2X68A 3TKLB 4UEMA 3UUBA 2RHSA 1XNRT 2CBIA 3MF2A 1M62A 3AE3A 1B70B 5AQIB 2BG9A 4XBFB 3HKDE 4TWDA 5IWAT 2XQ6A 1IJ6A 4QKNA 2ZIMA 4LF4T 4YFSA 4PK4A 3B57A 5ETWA 2LSGA 3LBXA 3UUNA 2H7OA 3DSQA 2ACZA 2W4XA 4ZI2C 1EOVA 4YHHT 4YPFA 3A8YC 3O1IA 1WRDA 4COFA 5HYAA 3P8TA 4YHJA 1BR0A 2BVMA 1CHUA 3BQIA 4YY3T 5H6QB 2ZT5A 5LCYA 2VVNA 2A2FX 5HCMA 3RIUC 2YKSA 1KOGA 4TZ4C 3EUHA 3RYFE 2HN2A 1HS7A 1X79A 3PUVF 2LRLA 3PU3A 2LM2A 1LRZA 5AQHB 2LEHA 3NENA 3PCOA 4JEHB 3UQ4A 2X0HA 3RQUA 5HEGA 3Q9DA 2XTLA 4CXWA 1W9RA 2V6XA 1W0AA 5HXSA 1RIQA 3CKDA 4DVDA 1MIWA 3O4XE 2XHEB 2CJBA 3PE0A 1GGMA 1X01A 4P73C 3ZMSB 3JAEA 3OTOT 2ZMAA 4TNVA 3P8VA 3JC6D 5FVLA 2ACXA 4YT0A 2VASA 3X1DA 4ZTUB 5J2TE 4PNIA 3V8KA 3AECA 3VRBA 2J47A 4JBWF 4UF0B 2ALYB 4E51A 4YRGA 4KHZF 2Q9QD 2FJDA 4JI5T 4LF8T 4EX5A 3PURA 3UGTA 4IE6A 2DL1A 3M3ZB 2RHQA 1S35A 1NEKA 2X9YA 2ZM8A 4B6XA 4U2ZA 4YREA 1YKEB 2CXFA 5JR9C 3L39A 4WNKA 4X1YE 3W3SA 1SRYA 3RC8A 3P4RA 4QH1A 2E9XB 3CQCB 4ILCA 4H9RC 1T7SA 4TWHA 4I55E 2CGHA 4HFEA 1N32T 1VCSA 3UULA 3L4GA 3L8RA 2I0MA 5AQGB 4P0BA 2X9WA 4IL9A 2NR4A 5CA1E 5LYJE 3AE7A 4JI2T 4DUYT 4UV8B 5LNKA 3QO7A 2VQET 3RQWA 4OYKA 4H2UA 3C98B 3TEHA 5EZYE 5JVDE 3I0QA 2VKOA 2XM2A 5AQOB 4DR6T 4H2WA 2WB5A 3OVUA 3N9QA 3HRKA 4CH6A 3FZHB 2EJ9A 4WJ4A 5JH7E 2EAYA 2WMNA 2XM1A 3ZLIA 5L3DB 3UT5E 1Z7MA 3MQZA 3S4UA 1EQRA 1JJCA 3R07A 3E0ZA 4ZI3D 1QE0A 4HA8A 3N9MA 4MALA 5AFUL 2KINB 3DTOA 1QSDA 1W09A 2KT9A 2NP9A 4CN4A 3RRWA 4HGAA 4P09A 3PUSA 1O3XA 4LF6T 2WZIA 3CK6A 3RKGA 5L3FB 4PJNA 4YRCA 1B76A 3CVRA 5IUXA 2ZNIA 3ABVA 4MHCA 2WP9A 2UXDT 3L3PA 1E2AA 5HGQA 4YTMA 4H9QC 4UR9A 2UXXB 4KMCA 2H88A 2EWNA 1G8XA 4TVAA 3ZC0A 3FZKB 1HTJF 4B3MT 2K24A 3TLTA 1NJ1A 3RIFA 5ABGA 3JAFA 3AE8A 1NYQA 2WY2A 5C52B 5FMNA 2DTHA 3T8OA 3LSQA 2AKWB 1FJGT 4ANJA 4TX5A 1OWAA 4IE7A 4BA9A 4UVBB 3A5YA 2WM9A 2H3RA 4PFPA 1X54A 2DZCA 2C5JA 3R84B 4A97A 2LLYA 1I94T 5JREA 3C64A 2K48A 2DDZA 2YDSA 4AIUA 4ILUA 3RYHE 2Q9QC 4U74A 3GWHA 5AQJB 5F5WA 3C51A 4QH5A 3F31A 4B3TT 4GYSA 3LBXB 3QTCA 2JPFA 3O1JA 3BJUA 1VRBA 2IDOB 3TLUA 2PMEA 3OYZA 3KVAA 1WU7A 3LK2B 3ZT7A 3QUJA 5CB4E 4IDZA 2ZR3A 1J5WA 1KMNA 3HFZA 2D0TA 3MEYA 4UVAB 3RIUA 1ASZA 1H4TA 4MFRA 2WU2A 5E3IA 3P4QA 3MJXA 4K0UA 4TWFA 1HC7A 4P0AA 2CXDA 5AQNB 1B70A 2DWGA 5FY1A 3E9IA 2XZEA 3TLVA 3ZMVB 4ILBA 5LXTE 2LHNA 5AQFB 1HTTA 3AAAB 2N1GA 4P73A 2IUBA 2V7MA 2J1DG 3PTRB 3NZPA 3ZJ1A 2JJ9A 2V5DA 1LYLA 4IL4A 4CQIA 2HHHT 2PMFA 5HXEA 2AXDS 1KNPA 3ZT6A 2JQHA 3PUQA 4DV0T 3AEGA 4X1IE 5K1PA 1LVKA 5LGUB 4P71C 2ZT6A 2RHQB 3REUA 5JR9A 3L2ZA 4IE0A 4U72A 4BJMA 2EL9A 4WBOA 5E0OA 4X20E 4YROA 2HH7A 3UTKA 2FJEA 1G5HA 4NXMT 3VQYA 2KLQA 4DR7T 3IBPA 3N9OA 2D5UA 4IT4A 2DXUA 2NTXA 1LKXA 4BJNA 1H4QA 5L4EA 2BS2A 2CHOA 2ARTA 2DVEA 4IE4A 2YU2A 3L4GB 4PK6A 3AAEB 3ZMZB 2XAHB 2MPKA 4F8HA 1OEDE 5AQVB 3C4WA 3MKDA 3PUWF 4P72C 2EJGA 3VQXA 3OBVE 3UU6A 5LHHB 3TEHB 4LVMA 1N34T 4YTPA 2VQFT 2UUAT 2XQ3A 2I4OA 4L87A 4P3PA 5M4YA 2IC9A 3ZN0B 4UV9B 4KP3C 4HTEA 1CUNA 2BKOA 5KXJA 3K3QC 3ICAA 2XAQB 4UP9A 5FKYA 3ZN1B 4IDOA 5AQRB 1NJ8A 4G63A 3RIAA 4CN1A 2H89A 3ZSSA 2E9XA 4XU0A 5CJ5A 1IBMT 4UP7A 4HWHA 2MOZA 1FMVA 1Z7NA 4DR3T 1MIVA 3MA9A 4HFIA 2E64A 4HWDA 4XTUA 3V7CA 3ZMUB 1R8IA 4G84A 1UURA 4IE5A 1H4SA 5JDMA 3I9WA 4DR4T 2YK0A 3C4ZA 1UGOA 2ODRC 4EAHA 3PZCA 3OKQA 2DWKA 4H2VA 3N2KE 4AKHA 3HKEE 4TVAB 4WW0A 2JQQA 1NWMX 5LBMA 2LSJA 3ZCJA 4JEUB 2ZGWA 3PUYF 4KX6A 4CH4A 2ZCEA 4DV1T 3AE4A 2XPKA 2JQKA 4O4JE 1SUMB 4IHJE 1U4QA 4KUMB 4JI3T 2KWIB 1MMGA 3AVRA 4ASKA 3AE1A 4GKKT 4LVIA 3FBZA 3DP7A 4ERRA 3WAJA 1OEDC 4YYEA 4DR5T 4HWRA 2NW7A 3HY1A 2DLRA 2IC6A 3L09A 4UPAA 4LFAT 5DJQC 5L3CB 1HFAA 5AQUB 1HR0T 4LFBT 3UFGA 1SETA 3V7SA 3HXZA 1KFYA 3HFZB 4AH6A 3ETVA 2XQ7A 2W61A 1G73A 2UUCT 4BW9A 2BBJA 3HTZA 1EFWA 3ZEFB 4ZZCA 2Y6XA 3R6NA 2MBGA 5HAXA 3QB5A 2IIUA 2AKWA 3AE2A 1XMOT 2XAFB 2M6IA 2WAUA 2X51A 5DQWA 2IY5A 3AE5A 2P5IA 5ABHA 1IBLT 4DMVA 4ZI7E 2V6YA 4WJ3M 1WQ7A 4I43B 3IALA 5L3BB 1D1AA 2E2AA 4A5XA 1BR2A 4PJMA 5C3JA 5TAOA 3P7IA 1QF6A 4JI6T 4LVKA 4B3RT 4UXNB 3VKGA 1NYRA 2B76A 3OJAA 4YRKA 2LHRA 4J15A 4LMJA 4DPGA 4P71A 4M1PA 4GIWA 4O8SA 4PJLA 2P0LA 2CJ9A 2VK9A 5JR9B 2XTIA 3VR9A 2QHTA 3A7AA 1WYDA 2VURA 2HPJA 4CN6A 5LJMA 3JADA 5FXVA 3NBXX 2M6BA 5JTGA 3ANWB 3FXEB 3RX6A 2X66A 1NNHA 3CX8B 4QWNB 2G4CA 5HWXA 3VRAA 3EABA 2FBWA 4XEMA 1HG5A 3ZYLA 3KFUA 2ZTGA 4TTVA 4H63H 5BR8T 3ZYKA 4P72A 1T72A 2A72A 3V5UA 2ZM0A 3O1HA 4A56A 4YRPA 3MF1A 1G51A 5HEUA 2EHOD 4CXXA 4PAGA 4IDQA 4EIWA 1GQEA 2CIMA 4DBQA 3A7MA 2DTOA 4DV2T 3RHWA 4K0KT 3TLWA 5K1XA 2J4GA 2CXLA 4A98A 3KFWX 1ZOYA 2W63A 1ZKEA 3CX7B 4HFCA 3J7Yq 3OD1A 2VB6A 3L1AA 1QUUA 2XQYA 3NVOA 3ZKRA 2CLYC 1WPYA 3HI2A 4XAXB 5AQKB 5F8PA 11ASA 2PG8A 4GYRA 2DXTA 3RL6A 4HVCA 5HXCA 5JQGE 1H4VB 2WU5A 3EHZA 4HWPA 2XJ7A 4OHFA 5ABFA 4CI3B 3EFRA 3HXUA 4MLKA 5CFBA 4HWTA 2E8IA 3PUGA 2Q7HA 5AQTB 2QVAA 3V8LA 1HNXT 1IJ5A 2ODUA 3JCFA 2Q5HA 3C50A 4TV8E 3ETUA 1VQZA 1FIOA 1G5IA 3B13A 2XGTA 4IREA 3ZSTA 4BAYB 4L9IA 2WMOA 2LT3A 3AE9A 4JI4T 3TEGA 1WCRA 1OEDA 2PJQA 2Q9QB 2OV9A 1XWMA 4TQDA 3PDYA 4YCVA 4ILAA 3P4SA 2VKDA 4Z90A 5FY0A 2BDEA 2XASB 2L3LA 2LSKA 2UU9T 4XZCA 4NXNT 5HXRA 2CBJA 4K86A 4JV5T 3RGLA 1UX4A 3W15B 2C5KT 4XTXA 2XAJB 4YRQA 2W67A 2CWYA 3NWIA 1IZNB 4JI7T 4YP0A 2IHR1 3P8CD 2BG9E 2V7IA 3LJCA 1SE7A 2XSAA 4DBRA 4HKAA 3HKCE 4XTYA 4DO0A 4IDNA 3N9PA 4YRLA 3ERRA 3PU8A 3ESLA 4TVWA 2IW5B 2MYSA 3RI5A 4LF9T 3FBLA 3JC6C 1Z0PA 3QK6A 4RQEA 2IY5B 4G85A 3RUXA 2N9DA 3ONJA 2KXPB 2P9BA 3OYXA 2V6YB 1HX1B 4CS2A 1Z8UA 3K1SA 4HE8A 3KDSE 1X55A 4QH4A 4X5OA 1E1OA 1YFTA 1W66A 2OLTA 1NAFA 4TQFA 4YJ3E 4CH3A 3GMIA 3Q5EA 2E41A 4AQGA 2V7JA 1HF8A 4X5TA 1YFSA 1IAPA 1FMWA 3PJAJ 4I4TE 5J1GA 1YW0A 3RYCE 2W0GA 5F3JA 5J2UE 1WFDA 4OYJA 4LFCT 3QOFA 4O2AE 2X9HA 4YRFA 2BKPA 2V8SV 3MACA 3G1ZA 2GK9A 4P3NA 2XUEA 2A8EA 5HEJA 4DIDB 2G0UA 3UUXB 1MMDA 3NRYA 1Y64B 2UUBT 2NS6A 4H02A 2K5BB 3AA6B 4TNWA 2I4LA 1KEYA 1PYSB 4LMKA 1MNEA 3SFEA 3E9HA 1B7YA 2HNIA 2E5VA 2WS3A 1ZV4X 3HL6A 4ADZA 2XQ5A 4ZI3C 3NETA 1B8AA 4LF5T 4L5GA 1XNQT 3A74A 5L2LA 4NCXA 2ZM6T 4HWCA 2VVSA 1WR6A 3ZMTB 3BQLA 1WYCA 3HXWA 3UQ7A 3RC3A 3ONXA 1XDOA 2WDQA 3BFMA 2CPTA 4NUVA 5EK4A 2C8MA 4Q25A 2WSSV 1L0VA 1X9BA 1D0YA 1XMQT 4YLHA 5LG4A 4DV3T 4O4LE 4AQFC 3A32A 3ANWA 3N9LA 2ZZGA 2E65A 2VL8A 3MK7C 3DJBA 4CI2B 5HWYA 2NWBA 4WZXA 4X66T 4YSZA 1YGBA 1UX5A 1HNWT 4GK5E 3RRCA 5ABFB 4HWSA 3KV4A 1MMAA 3ZCIA 3AXJA 4UELA 3NRXA 2W00A 4FJOA 4H2XA 4B3ST 3HFVA 5J0ZA 2XQAA 4YRSA 4DV7T 1X2HA 1ZP0A 2WDVA 1E24A 4EGWA 4PFOA 2PTFA 2FJAA 2JMHA 1E1HB 4DUZT 2D9DA 2FUPA 2A9UA 3CX6B 4RQFA 4J2CA 4TVYA 2VKHA 2DHRA 3NKZA 3RPUA 1IL2A 4GK0E 4OP0A 4XTVA 1BBWA 1HCIA 3FZMB 4QX8B 2LSIA 4LF7T 5C53B 4AISA 1OEDB 5KMGP 4YRMA 4PJJA 1YXRA 5EK3A 3QC9A 1US7B 4U3CA 4CZZB 1X2GA 3A7RA 4ZI2D 4YJ2E 1USYC 4ZOLE 2WBLA 3QNUA 4DNDA 3IF8B 2R6GF 4OX9T 2LKGA 4HFVA 3I1AA 3AA7B 4AKRB 2WDRA 3AEAA 1UK5A 3FB2A 4JLEA 4AXPA 3HR0A 2ARSA 1S94A 1EZ3A 3NEMA 1W0BA 4DMWA 1WLXA 3U78A 3VKHA 2RPAA 2D0UA 2ZLYA 2CMRA 2I59A 4TWAA 2KSRA 3FZLB 4HT4A 2WCAA 2ZR2A 3P8YA 3FXDB 3K3OA 3LK42 4XU1A 2KNDA 5HEHA 3K3NA 4ZZBA 1HNZT 2Q9QA 3OPCA 2Y48B 2NTYA 1KK7A 3VR8A 4Z91A 4CI1B 3N2GE 3NZQA 4HEAA
chains in the Genus database with same CATH topology
5C52B 4LVLA 2DTHA 1ASYA 3LSQA 2DU7A 5K1XA 2AKWB 2ZIOA 4XTWA 4UP8A 4PHCA 1EVLA 2I4NA 3A5YA 1X54A 2DZCA 2DU5A 4YRIA 3LC0A 3OD1A 4YRTA 3IKLA 2J3MA 3L1AA 2DDZA 3RKWA 1WPYA 3V8JA 5F5WA 4H2SA 4YRJA 11ASA 2I4MA 2DXTA 3RL6A 3QTCA 4HVCA 4YDQA 1H4VB 4HWPA 3BJUA 4P74A 2ALYA 3QO8A 2ZT8A 2PMEA 2Q7GA 1WU7A 2QHUA 2Q7EA 3EFRA 2ZR3A 1J5WA 3CMQA 1KMNA 3HXUA 2AMCA 3HFZA 1NJ5A 2E10A 3MEYA 4HWTA 2Q7HA 1BIBA 1B7YB 1ASZA 1H4TA 4WI1A 1JJCB 5C51B 1EIYB 4BWAA 5E3IA 3V8LA 3NELA 2Q5HA 3TUPA 1HC7A 4CH5A 1VQZA 12ASA 1B70A 1G5IA 3E9IA 1BIAA 3VBBA 4ZTZB 1YB3A 2ARUA 2C7IA 2XGTA 3RF1A 5ELNA 1HTTA 4P75A 4XU2A 3TEGA 4P73A 1NJ2A 4TQDA 3REXA 1N9WA 4YCVA 4CS4A 1SERA 4KR3A 4YCUA 1LYLA 2PMFA 4K86A 3RGLA 1PYSA 4EO4A 4XU3A 1NJ6A 2J3LA 4XTXA 1KMMA 4YRQA 5K1PA 4CS3A 4YP0A 4P71C 3LSSA 2FYKA 2ZT6A 4H2XB 2RHQB 3REUA 1EVKA 3L2ZA 3RKXA 2EL9A 4XTYA 4YROA 4YRLA 3ERRA 1G5HA 3VQYA 4TVWA 1E1TA 4OLFA 2DXUA 1HXDA 1H4QA 3FJPA 2ARTA 2DVEA 3L4GB 4H2YA 1FYFA 4RQEA 2IY5B 2EJFA 3VQWA 1ADJA 4G85A 2DQ3A 3RUXA 4LVJA 2E5AA 3VQXA 4P72C 2EJGA 2ZT7A 4K88A 4CS2A 3TEHB 4LVMA 1X55A 1X56A 2I4OA 4KR2A 4L87A 1USYA 4WF2A 4P3PA 4X5OA 1E1OA 4ZIBA 1YFTA 1W66A 4Q15A 4TQFA 4CH3A 2RHSA 2E41A 4H2TA 3ICAA 4UP9A 1YFSA 3MF2A 1B70B 4LNSA 1NJ8A 4XU0A 1WLEA 4UP7A 3HRIA 4PG3A 1Z7NA 4YRFA 4KQEA 2ZIMA 3G1ZA 4P3NA 2E64A 4XTUA 3V7CA 3DSQA 2A8EA 3M4QA 1EOVA 4G84A 4O2DA 4YPFA 4P74C 1WQWA 1H4SA 3P8TA 2NS6A 4H02A 2I4LA 2DQ0A 1PYSB 2ODRC 1L0WA 3PZCA 4H2VA 2ZT5A 4TVAB 3E9HA 1B7YA 2HNIA 3I7FA 3NETA 1B8AA 1KOGA 1ATIA 3A74A 1SESA 4NCXA 1ADYA 5KNNA 2ZINA 2ZGWA 3HXWA 4CH4A 3NENA 3PCOA 2ZCEA 3BFMA 4HWOA 2C8MA 2CJAA 1RIQA 4LVIA 4P75C 2CJBA 3WQZA 3HXYA 4YRNA 1GGMA 2DTIA 1E22A 2DJZA 1X01A 4YYEA 4P73C 4HWRA 3A32A 3P8VA 2ZXFA 3HY1A 3IG2A 2ZZGA 2E65A 4ZTUB 4UPAA 3V8KA 2ALYB 1YGBA 4E51A 3HY0A 3RIRA 4YRGA 4XTZA 3UFGA 1SETA 2RHSB 4HWSA 3V7SA 3UGTA 4EX5A 3HXZA 2AMCB 4YCWA 3HFZB 3RACA 4AH6A 4H2XA 2RHQA 3HFVA 1BBUA 4YRSA 4YREA 4BW9A 3A5ZA 3W3SA 1X2HA 3HTZA 1EFWA 4Q6GA 1SRYA 1E24A 2AKWA 2CGHA 2ZZFA 2ZZEA 4RQFA 4TVYA 4K87A 2QHVA 3L4GA 2IY5A 1IL2A 2P5IA 4OP0A 4XTVA 1BBWA 2DKGA 5C53B 3QO7A 3IKMB 4WJ3M 1WQ7A 3IALA 4YRMA 4RMFA 4H2UA 3TEHA 1YFRA 4DQ2A 4RDXA 2Q5IA 4YRRA 2E3CA 1X2GA 3A7RA 2ZNJA 1QF6A 4H2WA 3HRKA 1USYC 4LVKA 4CH6A 2DEQA 1NYRA 3UGQA 2EJ9A 2ODRD 4WJ4A 3M4PA 4P3OA 2EAYA 5ELOA 4YRKA 3PCOB 4J15A 3A7UA 1Z7MA 3MQZA 2DZ9A 1EQRA 4DPGA 4P71A 1JJCA 3R07A 1QE0A 1EIYA 4HA8A 3RKYA 3HXXA 3V7RA 2ARSA 2P0LA 2CJ9A 2XTIA 3A7AA 2QHTA 3NEMA 1WYDA 3HXVA 2QHSA 4TWAA 3QNEA 4YRCA 1B76A 1NNHA 2ZNIA 2E1HA 2G4CA 4HT4A 5HGQA 2ZR2A 4XEOA 3P8YA 4XEMA 3VQVA 3KFUA 4XU1A 2ZTGA 4TTVA 4P72A 2EWNA 4TVAA 4YRPA 3MF1A 1G51A 3A31A 3QO5A 1NJ1A 2CIMA 3UH0A 2DTOA 1WNLA 1NYQA 1C0AA 3EFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C52 B;  2DTH A;  1ASY A;  3LSQ A;  2DU7 A;  5K1X A;  2AKW B;  2ZIO A;  4XTW A;  4UP8 A;  4PHC A;  1EVL A;  2I4N A;  3A5Y A;  1X54 A;  2DZC A;  2DU5 A;  4YRI A;  3LC0 A;  3OD1 A;  4YRT A;  3IKL A;  2J3M A;  3L1A A;  2DDZ A;  3RKW A;  1WPY A;  3V8J A;  5F5W A;  4H2S A;  4YRJ A;  11AS A;  2I4M A;  2DXT A;  3RL6 A;  3QTC A;  4HVC A;  4YDQ A;  1H4V B;  4HWP A;  3BJU A;  4P74 A;  2ALY A;  3QO8 A;  2ZT8 A;  2PME A;  2Q7G A;  1WU7 A;  2QHU A;  2Q7E A;  3EFR A;  2ZR3 A;  1J5W A;  3CMQ A;  1KMN A;  3HXU A;  2AMC A;  3HFZ A;  1NJ5 A;  2E10 A;  3MEY A;  4HWT A;  2Q7H A;  1BIB A;  1B7Y B;  1ASZ A;  1H4T A;  4WI1 A;  1JJC B;  5C51 B;  1EIY B;  4BWA A;  5E3I A;  3V8L A;  3NEL A;  2Q5H A;  3TUP A;  1HC7 A;  4CH5 A;  1VQZ A;  12AS A;  1B70 A;  1G5I A;  3E9I A;  1BIA A;  3VBB A;  4ZTZ B;  1YB3 A;  2ARU A;  2C7I A;  2XGT A;  3RF1 A;  5ELN A;  1HTT A;  4P75 A;  4XU2 A;  3TEG A;  4P73 A;  1NJ2 A;  4TQD A;  3REX A;  1N9W A;  4YCV A;  4CS4 A;  1SER A;  4KR3 A;  4YCU A;  1LYL A;  2PMF A;  4K86 A;  3RGL A;  1PYS A;  4EO4 A;  4XU3 A;  1NJ6 A;  2J3L A;  4XTX A;  1KMM A;  4YRQ A;  5K1P A;  4CS3 A;  4YP0 A;  4P71 C;  3LSS A;  2FYK A;  2ZT6 A;  4H2X B;  2RHQ B;  3REU A;  1EVK A;  3L2Z A;  3RKX A;  2EL9 A;  4XTY A;  4YRO A;  4YRL A;  3ERR A;  1G5H A;  3VQY A;  4TVW A;  1E1T A;  4OLF A;  2DXU A;  1HXD A;  1H4Q A;  3FJP A;  2ART A;  2DVE A;  3L4G B;  4H2Y A;  1FYF A;  4RQE A;  2IY5 B;  2EJF A;  3VQW A;  1ADJ A;  4G85 A;  2DQ3 A;  3RUX A;  2E5A A;  3VQX A;  4P72 C;  2EJG A;  2ZT7 A;  4K88 A;  4CS2 A;  3TEH B;  1X55 A;  1X56 A;  2I4O A;  4KR2 A;  4L87 A;  1USY A;  4WF2 A;  4P3P A;  4X5O A;  1E1O A;  4ZIB A;  1YFT A;  1W66 A;  4Q15 A;  4TQF A;  4CH3 A;  2RHS A;  2E41 A;  4H2T A;  3ICA A;  4UP9 A;  1YFS A;  3MF2 A;  1B70 B;  4LNS A;  1NJ8 A;  4XU0 A;  1WLE A;  4UP7 A;  3HRI A;  4PG3 A;  1Z7N A;  4YRF A;  4KQE A;  2ZIM A;  3G1Z A;  4P3N A;  2E64 A;  4XTU A;  3V7C A;  3DSQ A;  3M4Q A;  1EOV A;  4G84 A;  4O2D A;  4YPF A;  4P74 C;  1WQW A;  1H4S A;  3P8T A;  4H02 A;  2I4L A;  2DQ0 A;  1PYS B;  2ODR C;  1L0W A;  3PZC A;  4H2V A;  2ZT5 A;  4TVA B;  3E9H A;  1B7Y A;  2HNI A;  3I7F A;  3NET A;  1B8A A;  1KOG A;  1ATI A;  3A74 A;  1SES A;  4NCX A;  1ADY A;  5KNN A;  2ZIN A;  2ZGW A;  3HXW A;  4CH4 A;  3NEN A;  3PCO A;  2ZCE A;  3BFM A;  4HWO A;  2C8M A;  2CJA A;  1RIQ A;  4P75 C;  2CJB A;  3WQZ A;  3HXY A;  4YRN A;  1GGM A;  2DTI A;  1E22 A;  2DJZ A;  1X01 A;  4YYE A;  4P73 C;  4HWR A;  3A32 A;  3P8V A;  2ZXF A;  3HY1 A;  3IG2 A;  2ZZG A;  2E65 A;  4ZTU B;  4UPA A;  3V8K A;  2ALY B;  1YGB A;  4E51 A;  3HY0 A;  3RIR A;  4YRG A;  4XTZ A;  3UFG A;  1SET A;  2RHS B;  4HWS A;  3V7S A;  3UGT A;  4EX5 A;  3HXZ A;  2AMC B;  4YCW A;  3HFZ B;  3RAC A;  4AH6 A;  4H2X A;  2RHQ A;  3HFV A;  1BBU A;  4YRS A;  4YRE A;  4BW9 A;  3A5Z A;  3W3S A;  1X2H A;  3HTZ A;  1EFW A;  4Q6G A;  1SRY A;  1E24 A;  2AKW A;  2CGH A;  2ZZF A;  2ZZE A;  4RQF A;  4TVY A;  4K87 A;  2QHV A;  3L4G A;  2IY5 A;  1IL2 A;  2P5I A;  4OP0 A;  4XTV A;  1BBW A;  2DKG A;  5C53 B;  3QO7 A;  3IKM B;  4WJ3 M;  1WQ7 A;  3IAL A;  4YRM A;  4RMF A;  4H2U A;  3TEH A;  1YFR A;  4DQ2 A;  4RDX A;  2Q5I A;  4YRR A;  2E3C A;  1X2G A;  3A7R A;  2ZNJ A;  1QF6 A;  4H2W A;  3HRK A;  1USY C;  4CH6 A;  2DEQ A;  1NYR A;  3UGQ A;  2EJ9 A;  2ODR D;  4WJ4 A;  3M4P A;  4P3O A;  2EAY A;  5ELO A;  4YRK A;  3PCO B;  4J15 A;  3A7U A;  1Z7M A;  2DZ9 A;  1EQR A;  4DPG A;  4P71 A;  1JJC A;  3R07 A;  1QE0 A;  1EIY A;  4HA8 A;  3RKY A;  3HXX A;  3V7R A;  2ARS A;  2P0L A;  2CJ9 A;  2XTI A;  3A7A A;  2QHT A;  3NEM A;  1WYD A;  3HXV A;  2QHS A;  4TWA A;  3QNE A;  4YRC A;  1B76 A;  1NNH A;  2ZNI A;  2E1H A;  2G4C A;  5HGQ A;  2ZR2 A;  4XEO A;  3P8Y A;  4XEM A;  3VQV A;  3KFU A;  4XU1 A;  2ZTG A;  4TTV A;  4P72 A;  2EWN A;  4TVA A;  4YRP A;  3MF1 A;  1G51 A;  3A31 A;  3QO5 A;  1NJ1 A;  2CIM A;  3UH0 A;  2DTO A;  1WNL A;  1NYQ A;  1C0A A;  3EFS A; 
#chains in the Genus database with same CATH topology
 3AEF A;  4PK5 A;  4LVL A;  4NUU A;  2BKN A;  2W66 A;  2VWA A;  3PUA A;  4EV6 A;  2ZIO A;  2J62 A;  2CHN A;  5IYZ E;  4GOU A;  3H3M A;  4UP8 A;  2D2S A;  4PW8 A;  1UUS A;  2I4N A;  4YXD A;  3Q2M A;  3PUZ F;  4IDP A;  3LC0 A;  4LML A;  5L4H A;  3IKL A;  4UVC B;  3MZK B;  3V8J A;  2VKJ A;  4YRJ A;  4H9P C;  4JI8 T;  2I4M A;  5FXX A;  5LJN A;  3LFM A;  3P50 A;  2DCF A;  5JRC A;  3ZT5 A;  4TUY E;  2WQY A;  3QO8 A;  2Q7G A;  5KX5 E;  4U7I A;  1KF6 A;  2QHU A;  2Q7E A;  4WYV A;  3RYI E;  5BMV E;  4H9N C;  2AMC A;  2LE8 A;  3IA3 A;  1BR1 A;  1B7Y B;  1U5P A;  2Z6E A;  3M65 A;  3AED A;  3LK3 B;  1EIY B;  1VCT A;  2V26 A;  4HWF A;  3H3A A;  2YIN A;  4H63 V;  5LOV E;  3WI3 A;  4L0R A;  4CH5 A;  1JNZ A;  5L47 A;  2CEA A;  12AS A;  2ZM2 A;  2NW8 A;  1BIA A;  4YSY A;  4ZTZ B;  5LG3 A;  1YB3 A;  2ARU A;  2C7I A;  2LKH A;  2QRX A;  5HXH A;  4X62 T;  3RF1 A;  5ELN A;  3PUX F;  2E9X D;  4XU2 A;  3CIR A;  2ES0 A;  1MIY A;  2CLY B;  5H6R B;  3N2O A;  4AQF A;  4EYY R;  5LGT B;  1T98 A;  2JRK A;  2RP4 A;  3GN5 B;  4AI6 A;  1KNZ A;  4YCU A;  1H7C A;  3G06 A;  5FL0 A;  2YDQ A;  4TV9 E;  5CGM A;  2V1D B;  2UXN B;  1D0X A;  4U31 A;  4I0U A;  3V5S A;  1PYS A;  3N9N A;  5LBQ B;  5LGN B;  1XZY A;  2CM0 A;  1NJ6 A;  5CA0 E;  1KMM A;  2LOP A;  4CS3 A;  3FHN A;  3GA8 A;  3AXJ B;  3LSS A;  2FYK A;  4H2X B;  4U7Y A;  5LMU T;  3RKX A;  2V5C A;  5JDQ A;  3IEE A;  5DAB A;  2C5I T;  2KMF A;  1E7P A;  4O4I E;  4H2Y A;  5LMN T;  2EJF A;  2WWV A;  3VQW A;  3EAM A;  3C4X A;  2CRB A;  5JDH A;  3EVY A;  1D0Z A;  3KVB A;  5AQP B;  4WBN E;  3UU3 A;  4NIQ A;  4K88 A;  3HKB E;  3AA0 B;  1WYB A;  1X56 A;  3ZC1 A;  1USY A;  1UCU A;  4WF2 A;  4MBQ A;  3F2E A;  4ZIB A;  3FZF B;  2L9Q A;  4FI5 A;  4Q15 A;  2NOX A;  5FNV E;  3VHL A;  3J9X 1;  5FXZ A;  4ZXL A;  4H2T A;  3RKO A;  4AKL A;  3CML A;  3IHR A;  4LNS A;  3CQX C;  3BQK A;  3RH3 A;  3LG7 A;  2X9X A;  1JNR A;  5HEO A;  1WLE A;  5FYM A;  2OA5 A;  3HRI A;  2VL0 A;  4PG3 A;  4ZEY A;  2BVL A;  4KQE A;  4JYA T;  3KBT A;  2DI4 A;  1N36 T;  2BS4 A;  2MAW A;  2EHO B;  3M4Q A;  4QXH B;  4O2D A;  4U2Y A;  4P74 C;  2LRK A;  1WQW A;  2L8K A;  2BS3 A;  2DQ0 A;  5A1L A;  3N5L A;  1L0W A;  5JDG A;  5LHG B;  4I50 E;  2B1E A;  4QHO A;  3I7F A;  4O2B E;  4JI0 T;  3T1Y T;  1T8B A;  2RA1 A;  4DR2 T;  3A5X A;  1ATI A;  2KWH A;  1SES A;  1ADY A;  5KNN A;  4EZ4 A;  5L3E B;  2ZIN A;  3ZJ2 A;  2E9X C;  3BK9 A;  4E7S A;  2QA7 A;  3EDV A;  2K9A A;  5AQL B;  2M67 A;  2QGS A;  3I0O A;  1I6Z A;  4JI1 T;  2IML A;  4HWO A;  4G2A A;  2DNX A;  2E5L T;  2YU1 A;  2YN6 A;  2LOS A;  5AQS B;  4DV4 T;  2JQ9 A;  1SHZ C;  2CJA A;  4P75 C;  4DV5 T;  1QLB A;  3WQZ A;  2ODV A;  4KI0 F;  3HXY A;  2HPL A;  3ONL C;  4UIG A;  4YRN A;  2DTI A;  1E22 A;  2DJZ A;  4X64 T;  1MND A;  2N2N A;  3KV6 A;  5AQM B;  2IAK A;  1D1B A;  2ZXF A;  3D0T A;  2UXC T;  2EHO C;  3IG2 A;  2H7V C;  1LVF A;  4H9O C;  5JDF A;  5JRC B;  4ZS2 A;  2CA5 A;  2YDR A;  5DQV A;  5HCJ A;  5C8Y E;  3T1H T;  3HY0 A;  3RIR A;  4NPP A;  4XTZ A;  3AEB A;  2RHS B;  3EI0 A;  2X0Y A;  2AMC B;  4YCW A;  3RAC A;  1BBU A;  3KIN B;  2X0L B;  5EK2 A;  2BG9 B;  1FEW A;  3A5Z A;  4QX7 B;  1HX8 A;  4Q6G A;  2WWU A;  3O9X A;  2ZZF A;  2ZZE A;  4K87 A;  4IIJ E;  2QHV A;  4E7Z A;  4EXT A;  3AA1 B;  3Q5X A;  2NW9 A;  2DKG A;  1DU2 A;  4IGU A;  3IKM B;  5ABE A;  4RMF A;  1YFR A;  1HG2 A;  4OFZ A;  1SA0 E;  4DQ2 A;  3PV0 F;  3UU8 A;  4EZH A;  4YTN A;  4RDX A;  2Q5I A;  4YRR A;  2E3C A;  2ZNJ A;  2YOE A;  3UUM A;  1IBK T;  2LM9 A;  2DEQ A;  3UGQ A;  2ODR D;  3M4P A;  4P3O A;  3KBU A;  2I6H A;  5ELO A;  3PCO B;  3PJA A;  3A7U A;  4AKG A;  2DZ9 A;  2YEV C;  2CE7 A;  1EIY A;  3U3I A;  2BG9 C;  3HXX A;  3RKY A;  3V7R A;  4KHP T;  3ZPO A;  2PBI A;  3HXV A;  5FVK A;  1ZEE A;  4HFD A;  3SOL A;  2QHS A;  2XQ9 A;  3I9Y A;  3QNE A;  3SRZ A;  1D1C A;  1ZHC A;  2E1H A;  4QXC B;  4QXB B;  4XEO A;  3VQV A;  3TLS A;  2XY8 B;  4YSX A;  3KV5 A;  2KZ7 B;  2UXB T;  2HN1 A;  2BZB A;  5ADX L;  5JDN A;  3A31 A;  3GN5 A;  2W62 A;  3QO5 A;  2V7K A;  5LB7 B;  3EDU A;  3UH0 A;  4TN7 B;  5FXW A;  1C0A A;  3UU4 A;  1WNL A;  3EFS A;  2XSB A;  5C2T A;  2W2U A;  2F4V T;  1ASY A;  3Q5D A;  4ISS A;  3CWZ B;  2DU7 A;  1MMN A;  4XTW A;  5LA6 E;  5LP6 E;  2AE9 A;  4PHC A;  3LSV A;  3CPZ A;  1EVL A;  3KV9 A;  4H9S E;  4CXY A;  2DU5 A;  4C91 A;  4HN9 A;  4YRI A;  4ZS3 A;  4YRT A;  2J3M A;  5AQQ B;  4X65 T;  3RKW A;  3RLF F;  1XDP A;  4DR1 T;  5FP3 A;  3F57 A;  3B5M A;  4H2S A;  3LDQ B;  2CWO A;  3AVS A;  1AJ3 A;  2XQ8 A;  4YDQ A;  4EED A;  4P74 A;  4UF0 A;  2ALY A;  1YQ3 A;  1V9D A;  2ZT8 A;  4HFB A;  1M7K A;  5FL1 A;  3WAK A;  3CMQ A;  3H37 A;  1NJ5 A;  4X1K E;  3SWH A;  5JDL A;  2E10 A;  1J1J A;  4U33 A;  1BIB A;  4WI1 A;  1JJC B;  4JUY A;  5C51 B;  4HWI B;  2K3W A;  3AB3 B;  4Z8X A;  5IHY A;  4BWA A;  4GKJ T;  3Q5W A;  3NEL A;  2QYW A;  2BBH A;  3TUP A;  1KNR A;  2XAG B;  5FY7 A;  2MTQ A;  2X67 A;  2XQ4 A;  3VBB A;  3MXZ A;  2CCQ A;  1YQ4 A;  3E22 E;  4P75 A;  4IST A;  4EB6 E;  4O4H E;  1J5E T;  3E08 A;  1NJ2 A;  5GON E;  3REX A;  1N9W A;  1WR0 A;  2EHO A;  4CS4 A;  1YKH B;  3QB5 K;  1SER A;  4KR3 A;  4KBM B;  4EYU A;  4V1A v;  3UU5 A;  4OK0 A;  4EO4 A;  3VU7 H;  4ZHQ E;  4XU3 A;  4P1N A;  2J3L A;  3AAI A;  5KDM C;  4EOZ B;  2JIW A;  2JMK A;  3AEE A;  4F6R C;  2V7L A;  1EVK A;  1VOM A;  4AQY T;  3SFD A;  4AKI A;  2PFV A;  2C0S A;  1OXZ A;  5LHI B;  4HFH A;  1YD8 G;  3CQG B;  3SS1 A;  1Y01 A;  2WZH A;  4EEB A;  1E1T A;  2LJL A;  4DV6 T;  4OLF A;  3HA4 A;  4C90 A;  3P4W A;  1HXD A;  3FJP A;  3P4P A;  1FYF A;  2FJB A;  3AE6 A;  2A3D A;  1ADJ A;  2DQ3 A;  4LVJ A;  2SPC A;  2E5A A;  1N33 T;  5L3G B;  2ZT7 A;  3UFE A;  4N78 D;  3ZYM A;  3K8P C;  1B7T A;  1NEN A;  4KR2 A;  2Y8D A;  1BR4 A;  2LSY A;  2X68 A;  3TKL B;  4UEM A;  3UUB A;  2RHS A;  1XNR T;  2CBI A;  3MF2 A;  1M62 A;  3AE3 A;  1B70 B;  5AQI B;  2BG9 A;  4XBF B;  3HKD E;  4TWD A;  5IWA T;  2XQ6 A;  1IJ6 A;  4QKN A;  2ZIM A;  4LF4 T;  4YFS A;  4PK4 A;  3B57 A;  5ETW A;  2LSG A;  3LBX A;  3UUN A;  2H7O A;  3DSQ A;  2ACZ A;  2W4X A;  4ZI2 C;  1EOV A;  4YHH T;  4YPF A;  3A8Y C;  3O1I A;  1WRD A;  4COF A;  5HYA A;  3P8T A;  4YHJ A;  1BR0 A;  2BVM A;  1CHU A;  3BQI A;  4YY3 T;  5H6Q B;  2ZT5 A;  5LCY A;  2VVN A;  2A2F X;  5HCM A;  3RIU C;  2YKS A;  1KOG A;  4TZ4 C;  3EUH A;  3RYF E;  2HN2 A;  1HS7 A;  1X79 A;  3PUV F;  2LRL A;  3PU3 A;  2LM2 A;  1LRZ A;  5AQH B;  2LEH A;  3NEN A;  3PCO A;  4JEH B;  3UQ4 A;  2X0H A;  3RQU A;  5HEG A;  3Q9D A;  2XTL A;  4CXW A;  1W9R A;  2V6X A;  1W0A A;  5HXS A;  1RIQ A;  3CKD A;  4DVD A;  1MIW A;  3O4X E;  2XHE B;  2CJB A;  3PE0 A;  1GGM A;  1X01 A;  4P73 C;  3ZMS B;  3JAE A;  3OTO T;  2ZMA A;  4TNV A;  3P8V A;  3JC6 D;  5FVL A;  2ACX A;  4YT0 A;  2VAS A;  3X1D A;  4ZTU B;  5J2T E;  4PNI A;  3V8K A;  3AEC A;  3VRB A;  2J47 A;  4JBW F;  4UF0 B;  2ALY B;  4E51 A;  4YRG A;  4KHZ F;  2Q9Q D;  2FJD A;  4JI5 T;  4LF8 T;  4EX5 A;  3PUR A;  3UGT A;  4IE6 A;  2DL1 A;  3M3Z B;  2RHQ A;  1S35 A;  1NEK A;  2X9Y A;  2ZM8 A;  4B6X A;  4U2Z A;  4YRE A;  1YKE B;  2CXF A;  5JR9 C;  3L39 A;  4WNK A;  4X1Y E;  3W3S A;  1SRY A;  3RC8 A;  3P4R A;  4QH1 A;  2E9X B;  3CQC B;  4ILC A;  4H9R C;  1T7S A;  4TWH A;  4I55 E;  2CGH A;  4HFE A;  1N32 T;  1VCS A;  3UUL A;  3L4G A;  3L8R A;  2I0M A;  5AQG B;  4P0B A;  2X9W A;  4IL9 A;  2NR4 A;  5CA1 E;  5LYJ E;  3AE7 A;  4JI2 T;  4DUY T;  4UV8 B;  5LNK A;  3QO7 A;  2VQE T;  3RQW A;  4OYK A;  4H2U A;  3C98 B;  3TEH A;  5EZY E;  5JVD E;  3I0Q A;  2VKO A;  2XM2 A;  5AQO B;  4DR6 T;  4H2W A;  2WB5 A;  3OVU A;  3N9Q A;  3HRK A;  4CH6 A;  3FZH B;  2EJ9 A;  4WJ4 A;  5JH7 E;  2EAY A;  2WMN A;  2XM1 A;  3ZLI A;  5L3D B;  3UT5 E;  1Z7M A;  3MQZ A;  3S4U A;  1EQR A;  1JJC A;  3R07 A;  3E0Z A;  4ZI3 D;  1QE0 A;  4HA8 A;  3N9M A;  4MAL A;  5AFU L;  2KIN B;  3DTO A;  1QSD A;  1W09 A;  2KT9 A;  2NP9 A;  4CN4 A;  3RRW A;  4HGA A;  4P09 A;  3PUS A;  1O3X A;  4LF6 T;  2WZI A;  3CK6 A;  3RKG A;  5L3F B;  4PJN A;  4YRC A;  1B76 A;  3CVR A;  5IUX A;  2ZNI A;  3ABV A;  4MHC A;  2WP9 A;  2UXD T;  3L3P A;  1E2A A;  5HGQ A;  4YTM A;  4H9Q C;  4UR9 A;  2UXX B;  4KMC A;  2H88 A;  2EWN A;  1G8X A;  4TVA A;  3ZC0 A;  3FZK B;  1HTJ F;  4B3M T;  2K24 A;  3TLT A;  1NJ1 A;  3RIF A;  5ABG A;  3JAF A;  3AE8 A;  1NYQ A;  2WY2 A;  5C52 B;  5FMN A;  2DTH A;  3T8O A;  3LSQ A;  2AKW B;  1FJG T;  4ANJ A;  4TX5 A;  1OWA A;  4IE7 A;  4BA9 A;  4UVB B;  3A5Y A;  2WM9 A;  2H3R A;  4PFP A;  1X54 A;  2DZC A;  2C5J A;  3R84 B;  4A97 A;  2LLY A;  1I94 T;  5JRE A;  3C64 A;  2K48 A;  2DDZ A;  2YDS A;  4AIU A;  4ILU A;  3RYH E;  2Q9Q C;  4U74 A;  3GWH A;  5AQJ B;  5F5W A;  3C51 A;  4QH5 A;  3F31 A;  4B3T T;  4GYS A;  3LBX B;  3QTC A;  2JPF A;  3O1J A;  3BJU A;  1VRB A;  2IDO B;  3TLU A;  2PME A;  3OYZ A;  3KVA A;  1WU7 A;  3LK2 B;  3ZT7 A;  3QUJ A;  5CB4 E;  4IDZ A;  2ZR3 A;  1J5W A;  1KMN A;  3HFZ A;  2D0T A;  3MEY A;  4UVA B;  3RIU A;  1ASZ A;  1H4T A;  4MFR A;  2WU2 A;  5E3I A;  3P4Q A;  3MJX A;  4K0U A;  4TWF A;  1HC7 A;  4P0A A;  2CXD A;  5AQN B;  1B70 A;  2DWG A;  5FY1 A;  3E9I A;  2XZE A;  3TLV A;  3ZMV B;  4ILB A;  5LXT E;  2LHN A;  5AQF B;  1HTT A;  3AAA B;  2N1G A;  4P73 A;  2IUB A;  2V7M A;  2J1D G;  3PTR B;  3NZP A;  3ZJ1 A;  2JJ9 A;  2V5D A;  1LYL A;  4IL4 A;  4CQI A;  2HHH T;  2PMF A;  5HXE A;  2AXD S;  1KNP A;  3ZT6 A;  2JQH A;  3PUQ A;  4DV0 T;  3AEG A;  4X1I E;  5K1P A;  1LVK A;  5LGU B;  4P71 C;  2ZT6 A;  2RHQ B;  3REU A;  5JR9 A;  3L2Z A;  4IE0 A;  4U72 A;  4BJM A;  2EL9 A;  4WBO A;  5E0O A;  4X20 E;  4YRO A;  2HH7 A;  3UTK A;  2FJE A;  1G5H A;  4NXM T;  3VQY A;  2KLQ A;  4DR7 T;  3IBP A;  3N9O A;  2D5U A;  4IT4 A;  2DXU A;  2NTX A;  1LKX A;  4BJN A;  1H4Q A;  5L4E A;  2BS2 A;  2CHO A;  2ART A;  2DVE A;  4IE4 A;  2YU2 A;  3L4G B;  4PK6 A;  3AAE B;  3ZMZ B;  2XAH B;  2MPK A;  4F8H A;  1OED E;  5AQV B;  3C4W A;  3MKD A;  3PUW F;  4P72 C;  2EJG A;  3VQX A;  3OBV E;  3UU6 A;  5LHH B;  3TEH B;  4LVM A;  1N34 T;  4YTP A;  2VQF T;  2UUA T;  2XQ3 A;  2I4O A;  4L87 A;  4P3P A;  5M4Y A;  2IC9 A;  3ZN0 B;  4UV9 B;  4KP3 C;  4HTE A;  1CUN A;  2BKO A;  5KXJ A;  3K3Q C;  3ICA A;  2XAQ B;  4UP9 A;  5FKY A;  3ZN1 B;  4IDO A;  5AQR B;  1NJ8 A;  4G63 A;  3RIA A;  4CN1 A;  2H89 A;  3ZSS A;  2E9X A;  4XU0 A;  5CJ5 A;  1IBM T;  4UP7 A;  4HWH A;  2MOZ A;  1FMV A;  1Z7N A;  4DR3 T;  1MIV A;  3MA9 A;  4HFI A;  2E64 A;  4HWD A;  4XTU A;  3V7C A;  3ZMU B;  1R8I A;  4G84 A;  1UUR A;  4IE5 A;  1H4S A;  5JDM A;  3I9W A;  4DR4 T;  2YK0 A;  3C4Z A;  1UGO A;  2ODR C;  4EAH A;  3PZC A;  3OKQ A;  2DWK A;  4H2V A;  3N2K E;  4AKH A;  3HKE E;  4TVA B;  4WW0 A;  2JQQ A;  1NWM X;  5LBM A;  2LSJ A;  3ZCJ A;  4JEU B;  2ZGW A;  3PUY F;  4KX6 A;  4CH4 A;  2ZCE A;  4DV1 T;  3AE4 A;  2XPK A;  2JQK A;  4O4J E;  1SUM B;  4IHJ E;  1U4Q A;  4KUM B;  4JI3 T;  2KWI B;  1MMG A;  3AVR A;  4ASK A;  3AE1 A;  4GKK T;  4LVI A;  3FBZ A;  3DP7 A;  4ERR A;  3WAJ A;  1OED C;  4YYE A;  4DR5 T;  4HWR A;  2NW7 A;  3HY1 A;  2DLR A;  2IC6 A;  3L09 A;  4UPA A;  4LFA T;  5DJQ C;  5L3C B;  1HFA A;  5AQU B;  1HR0 T;  4LFB T;  3UFG A;  1SET A;  3V7S A;  3HXZ A;  1KFY A;  3HFZ B;  4AH6 A;  3ETV A;  2XQ7 A;  2W61 A;  1G73 A;  2UUC T;  4BW9 A;  2BBJ A;  3HTZ A;  1EFW A;  3ZEF B;  4ZZC A;  2Y6X A;  3R6N A;  2MBG A;  5HAX A;  3QB5 A;  2IIU A;  2AKW A;  3AE2 A;  1XMO T;  2XAF B;  2M6I A;  2WAU A;  2X51 A;  5DQW A;  2IY5 A;  3AE5 A;  2P5I A;  5ABH A;  1IBL T;  4DMV A;  4ZI7 E;  2V6Y A;  4WJ3 M;  1WQ7 A;  4I43 B;  3IAL A;  5L3B B;  1D1A A;  2E2A A;  4A5X A;  1BR2 A;  4PJM A;  5C3J A;  5TAO A;  3P7I A;  1QF6 A;  4JI6 T;  4LVK A;  4B3R T;  4UXN B;  3VKG A;  1NYR A;  2B76 A;  3OJA A;  4YRK A;  2LHR A;  4J15 A;  4LMJ A;  4DPG A;  4P71 A;  4M1P A;  4GIW A;  4O8S A;  4PJL A;  2P0L A;  2CJ9 A;  2VK9 A;  5JR9 B;  2XTI A;  3VR9 A;  2QHT A;  3A7A A;  1WYD A;  2VUR A;  2HPJ A;  4CN6 A;  5LJM A;  3JAD A;  5FXV A;  3NBX X;  2M6B A;  5JTG A;  3ANW B;  3FXE B;  3RX6 A;  2X66 A;  1NNH A;  3CX8 B;  4QWN B;  2G4C A;  5HWX A;  3VRA A;  3EAB A;  2FBW A;  4XEM A;  1HG5 A;  3ZYL A;  3KFU A;  2ZTG A;  4TTV A;  4H63 H;  5BR8 T;  3ZYK A;  4P72 A;  1T72 A;  2A72 A;  3V5U A;  2ZM0 A;  3O1H A;  4A56 A;  4YRP A;  3MF1 A;  1G51 A;  5HEU A;  2EHO D;  4CXX A;  4PAG A;  4IDQ A;  4EIW A;  1GQE A;  2CIM A;  4DBQ A;  3A7M A;  2DTO A;  4DV2 T;  3RHW A;  4K0K T;  3TLW A;  5K1X A;  2J4G A;  2CXL A;  4A98 A;  3KFW X;  1ZOY A;  2W63 A;  1ZKE A;  3CX7 B;  4HFC A;  3J7Y q;  3OD1 A;  2VB6 A;  3L1A A;  1QUU A;  2XQY A;  3NVO A;  3ZKR A;  2CLY C;  1WPY A;  3HI2 A;  4XAX B;  5AQK B;  5F8P A;  11AS A;  2PG8 A;  4GYR A;  2DXT A;  3RL6 A;  4HVC A;  5HXC A;  5JQG E;  1H4V B;  2WU5 A;  3EHZ A;  4HWP A;  2XJ7 A;  4OHF A;  5ABF A;  4CI3 B;  3EFR A;  3HXU A;  4MLK A;  5CFB A;  4HWT A;  2E8I A;  3PUG A;  2Q7H A;  5AQT B;  2QVA A;  3V8L A;  1HNX T;  1IJ5 A;  2ODU A;  3JCF A;  2Q5H A;  3C50 A;  4TV8 E;  3ETU A;  1VQZ A;  1FIO A;  1G5I A;  3B13 A;  2XGT A;  4IRE A;  3ZST A;  4BAY B;  4L9I A;  2WMO A;  2LT3 A;  3AE9 A;  4JI4 T;  3TEG A;  1WCR A;  1OED A;  2PJQ A;  2Q9Q B;  2OV9 A;  1XWM A;  4TQD A;  3PDY A;  4YCV A;  4ILA A;  3P4S A;  2VKD A;  4Z90 A;  5FY0 A;  2BDE A;  2XAS B;  2L3L A;  2LSK A;  2UU9 T;  4XZC A;  4NXN T;  5HXR A;  2CBJ A;  4K86 A;  4JV5 T;  3RGL A;  1UX4 A;  3W15 B;  2C5K T;  4XTX A;  2XAJ B;  4YRQ A;  2W67 A;  2CWY A;  3NWI A;  1IZN B;  4JI7 T;  4YP0 A;  2IHR 1;  3P8C D;  2BG9 E;  2V7I A;  3LJC A;  1SE7 A;  2XSA A;  4DBR A;  4HKA A;  3HKC E;  4XTY A;  4DO0 A;  4IDN A;  3N9P A;  4YRL A;  3ERR A;  3PU8 A;  3ESL A;  4TVW A;  2IW5 B;  2MYS A;  3RI5 A;  4LF9 T;  3FBL A;  3JC6 C;  1Z0P A;  3QK6 A;  4RQE A;  2IY5 B;  4G85 A;  3RUX A;  2N9D A;  3ONJ A;  2KXP B;  2P9B A;  3OYX A;  2V6Y B;  1HX1 B;  4CS2 A;  1Z8U A;  3K1S A;  4HE8 A;  3KDS E;  1X55 A;  4QH4 A;  4X5O A;  1E1O A;  1YFT A;  1W66 A;  2OLT A;  1NAF A;  4TQF A;  4YJ3 E;  4CH3 A;  3GMI A;  3Q5E A;  2E41 A;  4AQG A;  2V7J A;  1HF8 A;  4X5T A;  1YFS A;  1IAP A;  1FMW A;  3PJA J;  4I4T E;  5J1G A;  1YW0 A;  3RYC E;  2W0G A;  5F3J A;  5J2U E;  1WFD A;  4OYJ A;  4LFC T;  3QOF A;  4O2A E;  2X9H A;  4YRF A;  2BKP A;  2V8S V;  3MAC A;  3G1Z A;  2GK9 A;  4P3N A;  2XUE A;  2A8E A;  5HEJ A;  4DID B;  2G0U A;  3UUX B;  1MMD A;  3NRY A;  1Y64 B;  2UUB T;  2NS6 A;  4H02 A;  2K5B B;  3AA6 B;  4TNW A;  2I4L A;  1KEY A;  1PYS B;  4LMK A;  1MNE A;  3SFE A;  3E9H A;  1B7Y A;  2HNI A;  2E5V A;  2WS3 A;  1ZV4 X;  3HL6 A;  4ADZ A;  2XQ5 A;  4ZI3 C;  3NET A;  1B8A A;  4LF5 T;  4L5G A;  1XNQ T;  3A74 A;  5L2L A;  4NCX A;  2ZM6 T;  4HWC A;  2VVS A;  1WR6 A;  3ZMT B;  3BQL A;  1WYC A;  3HXW A;  3UQ7 A;  3RC3 A;  3ONX A;  1XDO A;  2WDQ A;  3BFM A;  2CPT A;  4NUV A;  5EK4 A;  2C8M A;  4Q25 A;  2WSS V;  1L0V A;  1X9B A;  1D0Y A;  1XMQ T;  4YLH A;  5LG4 A;  4DV3 T;  4O4L E;  4AQF C;  3A32 A;  3ANW A;  3N9L A;  2ZZG A;  2E65 A;  2VL8 A;  3MK7 C;  3DJB A;  4CI2 B;  5HWY A;  2NWB A;  4WZX A;  4X66 T;  4YSZ A;  1YGB A;  1UX5 A;  1HNW T;  4GK5 E;  3RRC A;  5ABF B;  4HWS A;  3KV4 A;  1MMA A;  3ZCI A;  3AXJ A;  4UEL A;  3NRX A;  2W00 A;  4FJO A;  4H2X A;  4B3S T;  3HFV A;  5J0Z A;  2XQA A;  4YRS A;  4DV7 T;  1X2H A;  1ZP0 A;  2WDV A;  1E24 A;  4EGW A;  4PFO A;  2PTF A;  2FJA A;  2JMH A;  1E1H B;  4DUZ T;  2D9D A;  2FUP A;  2A9U A;  3CX6 B;  4RQF A;  4J2C A;  4TVY A;  2VKH A;  2DHR A;  3NKZ A;  3RPU A;  1IL2 A;  4GK0 E;  4OP0 A;  4XTV A;  1BBW A;  1HCI A;  3FZM B;  4QX8 B;  2LSI A;  4LF7 T;  5C53 B;  4AIS A;  1OED B;  5KMG P;  4YRM A;  4PJJ A;  1YXR A;  5EK3 A;  3QC9 A;  1US7 B;  4U3C A;  4CZZ B;  1X2G A;  3A7R A;  4ZI2 D;  4YJ2 E;  1USY C;  4ZOL E;  2WBL A;  3QNU A;  4DND A;  3IF8 B;  2R6G F;  4OX9 T;  2LKG A;  4HFV A;  3I1A A;  3AA7 B;  4AKR B;  2WDR A;  3AEA A;  1UK5 A;  3FB2 A;  4JLE A;  4AXP A;  3HR0 A;  2ARS A;  1S94 A;  1EZ3 A;  3NEM A;  1W0B A;  4DMW A;  1WLX A;  3U78 A;  3VKH A;  2RPA A;  2D0U A;  2ZLY A;  2CMR A;  2I59 A;  4TWA A;  2KSR A;  3FZL B;  4HT4 A;  2WCA A;  2ZR2 A;  3P8Y A;  3FXD B;  3K3O A;  3LK4 2;  4XU1 A;  2KND A;  5HEH A;  3K3N A;  4ZZB A;  1HNZ T;  2Q9Q A;  3OPC A;  2Y48 B;  2NTY A;  1KK7 A;  3VR8 A;  4Z91 A;  4CI1 B;  3N2G E;  3NZQ A;  4HEA A; 
#chains in the Genus database with same CATH homology
 5C52 B;  4LVL A;  2DTH A;  1ASY A;  3LSQ A;  2DU7 A;  5K1X A;  2AKW B;  2ZIO A;  4XTW A;  4UP8 A;  4PHC A;  1EVL A;  2I4N A;  3A5Y A;  1X54 A;  2DZC A;  2DU5 A;  4YRI A;  3LC0 A;  3OD1 A;  4YRT A;  3IKL A;  2J3M A;  3L1A A;  2DDZ A;  3RKW A;  1WPY A;  3V8J A;  5F5W A;  4H2S A;  4YRJ A;  11AS A;  2I4M A;  2DXT A;  3RL6 A;  3QTC A;  4HVC A;  4YDQ A;  1H4V B;  4HWP A;  3BJU A;  4P74 A;  2ALY A;  3QO8 A;  2ZT8 A;  2PME A;  2Q7G A;  1WU7 A;  2QHU A;  2Q7E A;  3EFR A;  2ZR3 A;  1J5W A;  3CMQ A;  1KMN A;  3HXU A;  2AMC A;  3HFZ A;  1NJ5 A;  2E10 A;  3MEY A;  4HWT A;  2Q7H A;  1BIB A;  1B7Y B;  1ASZ A;  1H4T A;  4WI1 A;  1JJC B;  5C51 B;  1EIY B;  4BWA A;  5E3I A;  3V8L A;  3NEL A;  2Q5H A;  3TUP A;  1HC7 A;  4CH5 A;  1VQZ A;  12AS A;  1B70 A;  1G5I A;  3E9I A;  1BIA A;  3VBB A;  4ZTZ B;  1YB3 A;  2ARU A;  2C7I A;  2XGT A;  3RF1 A;  5ELN A;  1HTT A;  4P75 A;  4XU2 A;  3TEG A;  4P73 A;  1NJ2 A;  4TQD A;  3REX A;  1N9W A;  4YCV A;  4CS4 A;  1SER A;  4KR3 A;  4YCU A;  1LYL A;  2PMF A;  4K86 A;  3RGL A;  1PYS A;  4EO4 A;  4XU3 A;  1NJ6 A;  2J3L A;  4XTX A;  1KMM A;  4YRQ A;  5K1P A;  4CS3 A;  4YP0 A;  4P71 C;  3LSS A;  2FYK A;  2ZT6 A;  4H2X B;  2RHQ B;  3REU A;  1EVK A;  3L2Z A;  3RKX A;  2EL9 A;  4XTY A;  4YRO A;  4YRL A;  3ERR A;  1G5H A;  3VQY A;  4TVW A;  1E1T A;  4OLF A;  2DXU A;  1HXD A;  1H4Q A;  3FJP A;  2ART A;  2DVE A;  3L4G B;  4H2Y A;  1FYF A;  4RQE A;  2IY5 B;  2EJF A;  3VQW A;  1ADJ A;  4G85 A;  2DQ3 A;  3RUX A;  4LVJ A;  2E5A A;  3VQX A;  4P72 C;  2EJG A;  2ZT7 A;  4K88 A;  4CS2 A;  3TEH B;  4LVM A;  1X55 A;  1X56 A;  2I4O A;  4KR2 A;  4L87 A;  1USY A;  4WF2 A;  4P3P A;  4X5O A;  1E1O A;  4ZIB A;  1YFT A;  1W66 A;  4Q15 A;  4TQF A;  4CH3 A;  2RHS A;  2E41 A;  4H2T A;  3ICA A;  4UP9 A;  1YFS A;  3MF2 A;  1B70 B;  4LNS A;  1NJ8 A;  4XU0 A;  1WLE A;  4UP7 A;  3HRI A;  4PG3 A;  1Z7N A;  4YRF A;  4KQE A;  2ZIM A;  3G1Z A;  4P3N A;  2E64 A;  4XTU A;  3V7C A;  3DSQ A;  2A8E A;  3M4Q A;  1EOV A;  4G84 A;  4O2D A;  4YPF A;  4P74 C;  1WQW A;  1H4S A;  3P8T A;  2NS6 A;  4H02 A;  2I4L A;  2DQ0 A;  1PYS B;  2ODR C;  1L0W A;  3PZC A;  4H2V A;  2ZT5 A;  4TVA B;  3E9H A;  1B7Y A;  2HNI A;  3I7F A;  3NET A;  1B8A A;  1KOG A;  1ATI A;  3A74 A;  1SES A;  4NCX A;  1ADY A;  5KNN A;  2ZIN A;  2ZGW A;  3HXW A;  4CH4 A;  3NEN A;  3PCO A;  2ZCE A;  3BFM A;  4HWO A;  2C8M A;  2CJA A;  1RIQ A;  4LVI A;  4P75 C;  2CJB A;  3WQZ A;  3HXY A;  4YRN A;  1GGM A;  2DTI A;  1E22 A;  2DJZ A;  1X01 A;  4YYE A;  4P73 C;  4HWR A;  3A32 A;  3P8V A;  2ZXF A;  3HY1 A;  3IG2 A;  2ZZG A;  2E65 A;  4ZTU B;  4UPA A;  3V8K A;  2ALY B;  1YGB A;  4E51 A;  3HY0 A;  3RIR A;  4YRG A;  4XTZ A;  3UFG A;  1SET A;  2RHS B;  4HWS A;  3V7S A;  3UGT A;  4EX5 A;  3HXZ A;  2AMC B;  4YCW A;  3HFZ B;  3RAC A;  4AH6 A;  4H2X A;  2RHQ A;  3HFV A;  1BBU A;  4YRS A;  4YRE A;  4BW9 A;  3A5Z A;  3W3S A;  1X2H A;  3HTZ A;  1EFW A;  4Q6G A;  1SRY A;  1E24 A;  2AKW A;  2CGH A;  2ZZF A;  2ZZE A;  4RQF A;  4TVY A;  4K87 A;  2QHV A;  3L4G A;  2IY5 A;  1IL2 A;  2P5I A;  4OP0 A;  4XTV A;  1BBW A;  2DKG A;  5C53 B;  3QO7 A;  3IKM B;  4WJ3 M;  1WQ7 A;  3IAL A;  4YRM A;  4RMF A;  4H2U A;  3TEH A;  1YFR A;  4DQ2 A;  4RDX A;  2Q5I A;  4YRR A;  2E3C A;  1X2G A;  3A7R A;  2ZNJ A;  1QF6 A;  4H2W A;  3HRK A;  1USY C;  4LVK A;  4CH6 A;  2DEQ A;  1NYR A;  3UGQ A;  2EJ9 A;  2ODR D;  4WJ4 A;  3M4P A;  4P3O A;  2EAY A;  5ELO A;  4YRK A;  3PCO B;  4J15 A;  3A7U A;  1Z7M A;  3MQZ A;  2DZ9 A;  1EQR A;  4DPG A;  4P71 A;  1JJC A;  3R07 A;  1QE0 A;  1EIY A;  4HA8 A;  3RKY A;  3HXX A;  3V7R A;  2ARS A;  2P0L A;  2CJ9 A;  2XTI A;  3A7A A;  2QHT A;  3NEM A;  1WYD A;  3HXV A;  2QHS A;  4TWA A;  3QNE A;  4YRC A;  1B76 A;  1NNH A;  2ZNI A;  2E1H A;  2G4C A;  4HT4 A;  5HGQ A;  2ZR2 A;  4XEO A;  3P8Y A;  4XEM A;  3VQV A;  3KFU A;  4XU1 A;  2ZTG A;  4TTV A;  4P72 A;  2EWN A;  4TVA A;  4YRP A;  3MF1 A;  1G51 A;  3A31 A;  3QO5 A;  1NJ1 A;  2CIM A;  3UH0 A;  2DTO A;  1WNL A;  1NYQ A;  1C0A A;  3EFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...