3RGLA

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc in complex with atp and glycine
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycyl-tRNA synthetase alpha subunit
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP and glycine.
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
total genus 101
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3rglA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rglA01
4K87A 4YRCA 1H4QA 1WNLA 3P8VA 1X54A 3RUXA 1ADJA 4ZIBA 1BBUA 4PG3A 3A74A 3VBBA 3RIRA 3QO8A 3L1AA 1SESA 3EFSA 1H4SA 2ALYA 2RHSB 4HWRA 4XU2A 3BJUA 3RL6A 1PYSB 3HTZA 4PHCA 2EWNA 3MEYA 3V7CA 2ZTGA 4CS3A 4ZTZB 4WJ3M 2J3MA 3TEHB 1GGMA 1HXDA 4UP8A 2G4CA 1NJ5A 1X56A 3HXUA 5C53B 2E1HA 4H2YA 2EJGA 4ZTUB 4CH4A 2EL9A 4AH6A 3HXZA 1B76A 2QHTA 4TWAA 3TEHA 1EVKA 2DXUA 1USYC 4LNSA 4CH6A 1VQZA 4XEMA 2ODRC 1E22A 2IY5A 3A5YA 5C52B 2EJFA 2ZCEA 4YRLA 2DEQA 4YRJA 2C8MA 4KQEA 3HFVA 4XTZA 4K86A 3WQZA 3QTCA 4YRQA 4H2TA 1QF6A 5F5WA 4TVWA 4EX5A 3NELA 2DTIA 4WI1A 5ELOA 2DDZA 3V8LA 3M4PA 3P8TA 2ZT5A 2DU5A 2ZR3A 2PMEA 3IG2A 1KMMA 4DQ2A 1WPYA 2QHVA 4YP0A 2AKWA 2C7IA 1J5WA 1KMNA 2ZNJA 4WJ4A 4EO4A 3A32A 4P73A 3HXXA 2ZT6A 2RHQB 2ZT8A 1IL2A 2E3CA 3IKMB 3BFMA 1JJCA 4RMFA 3V8JA 1RIQA 4OP0A 4P71A 2ALYB 4P74A 5C51B 2CJBA 1SRYA 4XTUA 3CMQA 2Q7HA 1X2HA 3EFRA 2ARUA 1YB3A 2ZXFA 3HFZA 4CS4A 1ADYA 3UGTA 2RHQA 4XTXA 3UFGA 4O2DA 1H4TA 2Q7GA 1SETA 4YRTA 4YPFA 3A31A 2QHSA 3E9IA 1HC7A 1N9WA 3HXYA 2CGHA 4X5OA 2DTOA 3ERRA 3RGLA 3NETA 3IKLA 3LSSA 4UPAA 4J15A 2E64A 4HWPA 3VQWA 1X55A 2E65A 3TUPA 1BBWA 4TQDA 2ZZGA 2DU7A 3A7RA 4CS2A 2DKGA 4H2SA 1YGBA 2ZZEA 2DQ0A 5KNNA 4XEOA 2I4OA 4YDQA 2IY5B 3QO7A 4YCWA 3A7AA 4HWTA 2I4MA 4WF2A 1WLEA 3M4QA 4H2XB 2CIMA 3A7UA 2ZZFA 2HNIA 1W66A 3P8YA 4P73C 4P72A 4XTYA 1NJ8A 1WYDA 4P71C 2E10A 4P74C 1B7YA 4H2XA 4HWSA 3PCOA 4H2UA 1EFWA 3UH0A 4Q6GA 2AKWB 1NJ2A 2Q5HA 2ZIOA 2DZ9A 2EAYA 4H2VA 4YRMA 2P5IA 2P0LA 4RDXA 5HGQA 1JJCB 3V7SA 1E1OA 1FYFA 2J3LA 2XGTA 3FJPA 4YRIA 1X01A 4P3PA 4H2WA 3HFZB 3RF1A 2E41A 3I7FA 4TVYA 2QHUA 4YRNA 3TEGA 2ZT7A 1B70B 2I4NA 3V7RA 1X2GA 3RKYA 4OLFA 2PMFA 3QO5A 1NJ1A 3MF1A 2ODRD 2ZINA 2EJ9A 4TVAA 3VQYA 1WU7A 4P75A 3L2ZA 1NYQA 2AMCA 1YFTA 3LSQA 3L4GA 1B70A 3HRIA 1BIAA 3NENA 3G1ZA 5E3IA 4XTVA 3DSQA 4XU3A 3RKXA 4BW9A 4XU1A 3PZCA 1G5IA 4YROA 4E51A 4YCVA 2ARSA 2I4LA 4CH3A 1G51A 4P72C 3A5ZA 1E24A 4XU0A 5K1PA 4UP7A 4TTVA 2ZIMA 3UGQA 1NNHA 4KR2A 3REUA 1H4VB 1E1TA 3VQVA 4H02A 4YYEA 1ASYA 1ATIA 1EVLA 5ELNA 4YRPA 2RHSA 4HA8A 4L87A 1G5HA 1EQRA 3RKWA 1B7YB 1Z7NA 3PCOB 1KOGA 3HY1A 4YRGA 4YRRA 4HWOA 1NYRA 3IALA 1L0WA 1BIBA 1PYSA 2DJZA 3ICAA 4HVCA 3LC0A 1B8AA 1WQWA 4RQEA 4KR3A 2ZGWA 4DPGA 4TQFA 3HXWA 1SERA 2XTIA 3V8KA 1ASZA 4RQFA 4YRFA 4P75C 2CJ9A 4UP9A 11ASA 2FYKA 4YREA 3VQXA 4NCXA 2DZCA 3W3SA 2DXTA 1YFSA 1Z7MA 4YRSA 1WQ7A 2Q5IA 1C0AA 2E5AA 3KFUA 3HXVA 1NJ6A 1QE0A 3HRKA 3OD1A 3MF2A 1EIYB 4P3NA 3E9HA 2DQ3A 3R07A 4K88A 4P3OA 4TVAB 3HY0A 3RACA 4YCUA 12ASA 2DVEA 2CJAA 5K1XA 2AMCB 2ARTA 4XTWA 4CH5A 1YFRA 4YRKA 3L4GB 2Q7EA 1EIYA 1USYA 2DTHA 4G85A 3QNEA 4Q15A 3REXA 1EOVA 1HTTA 2ZR2A 3NEMA 2ZNIA 4G84A 1LYLA 4BWAA
chains in the Genus database with same CATH superfamily
1KNZA 1SA0E 1ZP0A 2BVMA 4AQFC 3P8VA 1X54A 3EABA 3RUXA 3CQGB 3PU3A 4PG3A 3I9YA 4U74A 4AI6A 2XY8B 2BZBA 3QNUA 4ADZA 3QO8A 3L1AA 2CLYC 3EFSA 3IEEA 5M4YA 3EUHA 3RYIE 2ALYA 2NP9A 4EZHA 4TX5A 1D1BA 5L3BB 3JAEA 3BJUA 2V6XA 2CXDA 2CXFA 4UVCB 2XAHB 3RL6A 1PYSB 3RQWA 3OKQA 5A1LA 2CLYB 4HWHA 4TNWA 3HKBE 5JDMA 2Y48B 4MBQA 3Q5XA 3V7CA 5FMNA 2IC9A 2J3MA 5CJ5A 2G4CA 1NJ5A 3O1IA 1LKXA 5KX5E 4DR4T 5C53B 4H2YA 4PJMA 4ZTUB 1MNEA 2CMRA 3HXZA 3FHNA 1N33T 2QHTA 4TWAA 5LOVE 1USYC 4LNSA 3MQZA 1VQZA 4LVLA 2P9BA 2UU9T 4KHPT 3A5YA 2ZCEA 3JC6C 4YRLA 2C8MA 4JBWF 4LVJA 3FZKB 4KQEA 2IC6A 3WQZA 3QTCA 4IGUA 3OPCA 4FJOA 1YW0A 3V8LA 2Q9QC 3M4PA 3N9PA 4YY3T 4CI1B 2SPCA 3AEGA 4HFBA 4TWHA 4O2BE 2D2SA 4QWNB 3UUNA 2LM2A 3UQ7A 2WMOA 4YLHA 3BK9A 2RHQB 2ODVA 3IKMB 3BFMA 4RMFA 4H9OC 1RIQA 2C0SA 2WU5A 4P71A 3LBXB 4P74A 4MALA 5C51B 1CHUA 5AQIB 2LHNA 4PJLA 1YB3A 1D0YA 3N9MA 3UTKA 5AQJB 3PV0F 3FXDB 4HFHA 1NWMX 4P0BA 3LG7A 3J7Yq 1H4TA 1X79A 3QB5A 4HWCA 3UFEA 2J1DG 2NOXA 4G2AA 3R84B 4CI2B 1BR2A 3ANWA 5BR8T 3ZMUB 2MYSA 3CPZA 2DTOA 4HN9A 3ERRA 3RGLA 2H7OA 3L3PA 4L9IA 4UPAA 2CE7A 4X64T 3ZEFB 4EGWA 3A5XA 5FL0A 3ZCIA 2NW9A 3VKGA 4LF6T 2MBGA 1BR0A 3A7RA 5C8YE 3ONXA 5L2LA 3HI2A 5KNNA 3K1SA 4XEOA 1D0XA 1HNWT 2IY5B 4L5GA 4HFVA 4YCWA 1KNPA 2I4MA 4G63A 2DI4A 1S94A 4QXBB 3LDQB 2BG9E 3MA9A 2C5IT 5CB4E 4P73C 4ZI3D 4LMKA 5L4EA 5AQFB 3AEBA 2V5CA 4AQGA 5JR9C 2PJQA 4H2UA 4IDZA 2YU1A 3RKGA 2LOSA 2LSJA 1T72A 5FY1A 3A7MA 4TNVA 4YSYA 2DZ9A 2EAYA 4YRMA 4OHFA 2P5IA 3EVYA 3AEFA 1UX5A 3N9QA 4JYAT 1OEDE 5LNKA 1FYFA 5JR9B 4B3RT 2BKPA 3AE4A 3Q9DA 4P3PA 3AVSA 3PUVF 2JMHA 1G8XA 5JDQA 4TVYA 2QHUA 2IAKA 5HCJA 3JAFA 1B70B 4UIGA 3NVOA 5FXVA 4H9NC 2VVNA 2BKOA 2PMFA 4A56A 2W00A 3QO5A 3VQYA 1WU7A 3DP7A 2UUAT 2BS3A 4JEUB 2H89A 4JUYA 1XNQT 1YD8G 3NBXX 4JI8T 5HEGA 4PJJA 3N9NA 3OBVE 4NUVA 1BIAA 2W2UA 3HA4A 3NENA 2LM9A 5HCMA 4BW9A 1DU2A 1G5IA 4YROA 4E51A 2I4LA 1YKHB 5J2TE 4CH3A 3C64A 2F4VT 3A5ZA 2FJEA 2WZIA 2X0HA 2X9XA 4GK5E 1ASYA 4V1Av 4YRPA 4HA8A 4IL4A 3MK7C 2H88A 4IDOA 1SUMB 2NW8A 4ZS2A 2R6GF 4WBNE 5LHGB 2E9XC 5AQNB 4YRGA 1YQ4A 1L0WA 3T1HT 2HH7A 4H9QC 2XSBA 5AQKB 3FB2A 3VRAA 5AQUB 4COFA 3E08A 4OX9T 5IYZE 1WQWA 4DPGA 3HXWA 5L3DB 4HT4A 5IWAT 3EDVA 4DV5T 4RQFA 4I50E 3UU8A 3AE2A 3NRYA 2CHOA 2MOZA 4ASKA 4N78D 4UF0B 4NCXA 1Y64B 3N2OA 2XZEA 2DXTA 5AQVB 4IE0A 3N9LA 2YK0A 4DR1T 1NJ6A 3OD1A 1EIYB 2WZHA 5KMGP 4CN1A 5DQWA 1OEDA 5AFUL 5LHHB 3AE3A 3K3OA 4TVAB 3SWHA 2WY2A 1UCUA 4IE5A 4EV6A 2CJAA 2ARTA 4U2YA 4YRKA 3RIUC 3RX6A 2V6YB 5CFBA 4TV9E 4DNDA 4P09A 4F8HA 3P4QA 3AA7B 2JMKA 5L3GB 3EHZA 2K48A 2ZNIA 3HXYA 4G84A 4K87A 4A5XA 4AISA 1MNDA 5EK4A 3ZCJA 1ADJA 2K9AA 4EYUA 1BBUA 3RKOA 5C3JA 4KP3C 4JI3T 2Z6EA 2DL1A 4PFOA 5FY7A 4ZI3C 3F31A 2ACZA 1MIWA 4ERRA 2RHSB 3AE8A 1D1CA 4DV1T 2WDVA 2V7MA 3ZKRA 1I94T 4JI7T 4LVKA 4XU2A 3AE9A 1MMNA 3ZYLA 1W09A 1UK5A 2X0LB 3UUBA 5HXRA 3HTZA 2YN6A 4PHCA 3MEYA 2VKOA 2ZTGA 4CS3A 4WJ3M 1J1JA 4HWIB 1D1AA 5JRCA 2WQYA 4UP8A 2BVLA 5JDNA 3SS1A 1E2AA 2E1HA 4UV8B 4ILUA 5AQMB 1LVKA 2HPJA 2EJGA 3CQCB 1T7SA 4CH4A 1KF6A 2JQQA 4IHJE 4MFRA 3VR8A 3TEHA 4HFCA 2DXUA 2BS2A 1XDOA 2X68A 4U3CA 4CH6A 1W0BA 3ZSSA 2PBIA 1L0VA 3UU4A 4YRJA 5IHYA 4X66T 2D5UA 3AXJA 4K86A 5HYAA 3PJAJ 5LCYA 3S4UA 4QH5A 5ADXL 2J4GA 1VCTA 4YRQA 2E5VA 1QF6A 3N5LA 5F5WA 3ZMVB 2DTIA 2XM1A 3AE6A 2YDRA 1HNXT 5L47A 3Q5DA 3I1AA 4IT4A 3IG2A 4PNIA 1WPYA 2UXXB 2QHVA 3KV5A 4YP0A 2M67A 3PUYF 4YXDA 2ZNJA 2QYWA 4EO4A 1T98A 3A32A 2ZT6A 2E3CA 2IDOB 4EAHA 2XQ3A 3GMIA 5JDGA 2A9UA 1SRYA 4XTUA 5HWXA 3BQIA 4DBQA 3EFRA 3F2EA 3ZLIA 2FJDA 2ZXFA 3HFZA 5EK2A 4CS4A 1ADYA 4DMVA 3SOLA 3ZT5A 3Q5EA 1Y01A 2JIWA 3UFGA 3ONJA 4O2DA 2Q7GA 1VRBA 5HAXA 1IBLT 2QRXA 2YDQA 1M7KA 3A31A 2WBLA 5LB7B 2QHSA 2NW7A 5LBMA 5LYJE 3JCFA 4DR7T 3A8YC 2BKNA 4ILAA 4CXYA 3VQWA 1X55A 2HHHT 3WI3A 3TUPA 2CBIA 2ZZGA 2G0UA 4CS2A 4H2SA 1YGBA 2ZZEA 4EYYR 2CM0A 2I4OA 3EI0A 4TN7B 4DVDA 1N36T 2CWOA 2L8KA 1U5PA 5JDLA 3LK42 2HNIA 2J47A 1YKEB 4DV6T 3HKCE 5LG3A 3P8YA 4X62T 3IA3A 3GN5B 1W0AA 4LMJA 4JI4T 1NJ8A 3N2KE 4U33A 5KXJA 4C91A 1B7YA 4H2XA 2V7JA 3CX6B 2VQFT 2EHOA 4KHZF 2AKWB 2Q5HA 3CKDA 1B7TA 4H2VA 4ZS3A 1IAPA 2KNDA 3KBTA 3OYZA 4RDXA 5HGQA 1JJCB 1IJ6A 3P7IA 3KINB 2J3LA 3FJPA 4YRIA 4L0RA 3SFDA 4AKGA 3AE5A 4H2WA 3FZMB 3OYXA 2UXBT 5L4HA 4CN4A 4UVAB 1OWAA 2YEVC 2WDRA 3I7FA 2D0UA 2LSIA 3Q2MA 3C4WA 2WDQA 4HGAA 4PFPA 2WM9A 1IBMT 4GKJT 1X2GA 3RKYA 4IE4A 3TLTA 3MF1A 4K0UA 2XTLA 3AB3B 1FEWA 2EJ9A 3FXEB 1XZYA 2YINA 4LF5T 3L09A 1NYQA 2CA5A 3RPUA 3LSQA 3ZMZB 3AEDA 2NWBA 4BA9A 1KNRA 5E3IA 1XNRT 2LEHA 4NIQA 4XU3A 3P50A 3RKXA 3C4ZA 3CWZB 1WFDA 2ARSA 4CZZB 1G51A 3AAIA 4P72C 3UULA 4DV7T 1E24A 2UUBT 2BG9C 4H9PC 4UP7A 3UGQA 3PDYA 3K8PC 1NEKA 4H63H 5JTGA 2CPTA 3UU5A 1E1TA 5FP3A 3VQVA 3PJAA 1AJ3A 5ELNA 2XQ4A 4TWFA 1CUNA 1QUUA 5LXTE 4QXHB 4AQFA 1WYBA 3RKWA 2CXLA 2XQ6A 4IE7A 2BG9B 5H6RB 3RC8A 3PCOB 5JREA 2RA1A 3TLWA 3IALA 4O4IE 1PYSA 2NS6A 2DJZA 4UXNB 5FXXA 5ABFA 5LBQB 4ISTA 2IIUA 4TV8E 3JADA 4TQFA 1SERA 4QX7B 2OV9A 5LP6E 4LVIA 1XDPA 4YRFA 5FVKA 3AAAB 3V5UA 4U2ZA 2LSKA 4HFEA 4P75C 2K24A 1OEDB 1EZ3A 3N9OA 11ASA 4YREA 4CXWA 5JVDE 2LKGA 4XBFB 2EHOD 3W3SA 4IL9A 3CX7B 1Z7MA 4QH1A 4YRSA 4ANJA 5FNVE 1C0AA 3KFUA 5HEUA 1QE0A 3HRKA 4HEAA 1NAFA 5DJQC 3KV9A 4CQIA 1OXZA 3KV6A 2CBJA 3U3IA 3MJXA 2V26A 3B57A 4YCUA 4B3MT 4LF9T 2AMCB 5C2TA 2QVAA 3L4GB 2Q7EA 2XQ5A 3MXZA 4Q25A 2JQ9A 1USYA 3REXA 3MZKB 2HN2A 3FBLA 2DWKA 2FBWA 5FXZA 4WNKA 3ZJ2A 3FZLB 4DV2T 2V7KA 1IL2A 4YRCA 1WNLA 2IMLA 3J9X1 2ZLYA 3H3MA 2CCQA 3GA8A 2HN1A 3VR9A 4LF7T 3A74A 3NZPA 1QSDA 4YTMA 3L39A 3RIRA 3VBBA 4YSXA 2WSSV 5LHIB 4HFDA 1ZKEA 4EEDA 3KDSE 2Q9QA 2XQYA 4LMLA 1H4SA 3LBXA 5JQGE 2IHR1 1G73A 4IE6A 4X5TA 3X1DA 4P0AA 4E7SA 4KI0F 2CRBA 4TUYE 4AIUA 5ABEA 5JRCB 3AE7A 1Z0PA 3ABVA 4HWDA 2WAUA 2EWNA 2MAWA 2QA7A 5AQLB 3TEHB 4DR2T 1HXDA 3AEAA 3OJAA 1JNZA 4EEBA 1IZNB 3KVAA 4NXNT 1X56A 2I0MA 3HXUA 4UELA 5IUXA 3VHLA 3ESLA 2ODUA 2EL9A 4AH6A 5DQVA 4X1KE 1B76A 4QHOA 1Z8UA 4AQYT 2D0TA 2KWIB 2JQHA 5J0ZA 1NENA 2ZMAA 1MMAA 3QC9A 4A97A 4IDQA 4ZZCA 2VURA 4DUZT 4XEMA 1E22A 2IY5A 1X9BA 2EJFA 3E22E 4KBMB 2DEQA 2XAFB 4WW0A 1W9RA 3P8CD 2MTQA 5EZYE 4DV4T 3HFVA 5LJNA 3PURA 3DJBA 4ZXLA 1HTJF 1XMQT 4JI5T 4H2TA 4GOUA 5KDMC 4TVWA 2LOPA 3NELA 1M62A 5ELOA 2KMFA 4I43B 3P8TA 2ZT5A 2A2FX 1FJGT 2DU5A 2ZR3A 4JI2T 1KMMA 4DQ2A 3L8RA 2QGSA 2C7IA 3MKDA 1KMNA 2VKJA 1N32T 4PAGA 4DMWA 1XMOT 4I55E 4LFCT 3HXXA 2V7IA 4P73A 4WZXA 3CQXC 3V8JA 4H9RC 4MLKA 2ALYB 5JR9A 2CJBA 3TLUA 3AECA 1US7B 3CMQA 1N34T 2Q7HA 1KEYA 2ARUA 2RP4A 2V7LA 4ZI2D 4YJ2E 5LGTB 5FL1A 4XTXA 3RH3A 1HG5A 2ZM8A 5FKYA 3CVRA 1E1HB 3ZMTB 4ILBA 3KFWX 3ZN1B 1HS7A 3C98B 1N9WA 4PJNA 2Q9QD 3NETA 3IKLA 3LSSA 4EB6E 3CIRA 2WU2A 3KBUA 5LMUT 4HWPA 2ACXA 2E65A 3MACA 1D0ZA 3PUQA 1WRDA 2DKGA 2W66A 2JPFA 1VCSA 2VASA 5FVLA 5J1GA 3QO7A 2LKHA 2X9YA 2HPLA 4U7YA 4WYVA 4C90A 5AQSB 4BJMA 1E7PA 4H9SE 4HWTA 4WF2A 1WLEA 4HWFA 4Z91A 3M4QA 1LVFA 4O8SA 3CMLA 3ETUA 1V9DA 1FMWA 3LK2B 4X1YE 4H2XB 2EHOB 1WR6A 2V1DB 1W66A 2FJBA 3P4PA 3FZHB 3TLSA 3PUZF 2PTFA 4GYRA 4P71C 2WWVA 2E10A 4P74C 3K3QC 4ILCA 5E0OA 4HWSA 2DWGA 2LHRA 2WP9A 4JI1T 1EFWA 2W4XA 4M1PA 5HXEA 1NJ2A 3AEEA 2KINB 3M65A 2ZIOA 4IDPA 4HKAA 2W63A 3IHRA 3WAKA 4GK0E 4EXTA 3WAJA 3D0TA 3Q5WA 3PUGA 2P0LA 4AKRB 3V7SA 1E1OA 2XGTA 4KUMB 2BBHA 3R6NA 1X01A 1IBKT 2E9XA 1SHZC 3RF1A 3RI5A 4E7ZA 3AA0B 2E41A 3UQ4A 4UF0A 5AQOB 5LGUB 3M3ZB 4Z90A 4YRNA 5LA6E 1UGOA 2ZT7A 4UEMA 4ZHQE 4U72A 4X65T 2I4NA 4ZZBA 1QLBA 2M6IA 4EZ4A 3ANWB 2WWUA 1NJ1A 2ODRD 4TVAA 3VKHA 4DV0T 3L2ZA 3ZN0B 4LVMA 2WMNA 1T8BA 5HXCA 2LRLA 5L3FB 1ZV4X 3AE1A 3RHWA 5AQPB 2V6YA 2JJ9A 2D9DA 3I0OA 3UUXB 3C4XA 2LLYA 1R8IA 3RRCA 4YCVA 1MMGA 2XSAA 2JRKA 1BR1A 4UR9A 5CA0E 3VRBA 2XPKA 2WB5A 4XU0A 5TAOA 5K1PA 3ZYMA 4U7IA 2ZIMA 4TTVA 3RIUA 5HXSA 1NNHA 3REUA 1YQ3A 3LK3B 4JI6T 4B6XA 2MPKA 4LFAT 5LGNB 3ETVA 2UXDT 2YKSA 4NXMT 4Z8XA 2RHSA 4L87A 2AE9A 1EQRA 5ABFB 4GKKT 1Z7NA 2OA5A 3HY1A 4YRRA 4HWOA 2IUBA 1BIBA 4YTNA 3ICAA 4HVCA 2BS4A 3AAEB 3LC0A 2ZGWA 3QOFA 3AA6B 2XTIA 3C50A 2XQ9A 1GQEA 5FY0A 2CWYA 4CN6A 4LF4T 4UP9A 2PFVA 2AXDS 4ZI2C 4ISSA 1WCRA 5LMNT 5L3EB 2J62A 1YFSA 2YOEA 2Q5IA 2CEAA 2JQKA 3CX8B 5JH7E 2KSRA 4P3NA 2XHEB 2XAGB 2B76A 3QK6A 2DQ3A 3E9HA 2KZ7B 4J2CA 1YXRA 4P3OA 3RACA 3O4XE 12ASA 2BBJA 1HCIA 5K1XA 3NZQA 2XASB 4CH5A 4MHCA 3AA1B 4DBRA 1YFRA 4HFIA 2E9XD 2C5KT 3UU3A 2XUEA 2VKDA 2DTHA 1MMDA 3ZC1A 4YJ3E 4G85A 4B3ST 3PTRB 2UXCT 4P1NA 2LT3A 3NEMA 1LYLA 2N9DA 2Q9QB 1H4QA 3FBZA 3HL6A 3EAMA 4AXPA 2BDEA 4ZIBA 3U78A 3O9XA 4B3TT 4NUUA 1SESA 4WBOA 3G06A 2V8SV 2LE8A 4PK4A 3GWHA 3K3NA 3E0ZA 1HG2A 2GK9A 1S35A 3H37A 4HWRA 3KV4A 4ZEYA 2B1EA 2VK9A 3DTOA 3UU6A 1KFYA 3ZC0A 4O4JE 1ZHCA 2W67A 3UT5E 4ZTZB 3ZPOA 3VU7H 3RQUA 3F57A 1GGMA 4EOZB 4I0UA 3SRZA 4ZI7E 2LSGA 2DNXA 1OEDC 3CK6A 2H3RA 2XAQB 1FMVA 2VKHA 2DLRA 4JLEA 1HR0T 2L9QA 4CI3B 5HEJA 1EVKA 4QKNA 5HEHA 5FXWA 4CXXA 1FIOA 5FYMA 3ZJ1A 2ODRC 2XQ7A 3RRWA 2WS3A 5C52B 4PW8A 3IBPA 2UUCT 4AKLA 4YHJA 1HX8A 4XTZA 3O1JA 4XZCA 3EDUA 2VL0A 2LRKA 4TWDA 3GN5A 4EX5A 3B5MA 1MIYA 4WI1A 3BQKA 4IDNA 4DUYT 2DDZA 2XQAA 4QX8B 2PMEA 5JDHA 2KXPB 2AKWA 1J5WA 2E2AA 2XQ8A 2ZM2A 4F6RC 4WJ4A 4O2AE 2YDSA 3UUMA 2VWAA 3RC3A 3ZYKA 2XAJB 2ZT8A 2PG8A 3O1HA 4A98A 5HWYA 1JJCA 4OP0A 4YFSA 1ZOYA 3RLFF 4UVBB 2X66A 1X2HA 3SFEA 2KWHA 2FJAA 2XM2A 2E8IA 5AQRB 3LSVA 4U31A 3UGTA 2RHQA 2VQET 2L3LA 3BQLA 2X0YA 5EK3A 2UXNB 5ETWA 4AKHA 1SETA 4YRTA 4YPFA 4LF8T 3ZSTA 3E9IA 1HC7A 2CGHA 4X5OA 5DABA 4J15A 2E64A 2VB6A 1BR4A 5F3JA 4OFZA 1MIVA 1HNZT 2W62A 1BBWA 4TQDA 3H3AA 2DU7A 4QH4A 4X20E 2DQ0A 5ABHA 4YDQA 1WYCA 2NR4A 4TZ4C 4DR5T 3A7AA 1HFAA 2NTXA 2I59A 3PU8A 2CHNA 1KK7A 3AXJB 5LG4A 2CIMA 4PK5A 3A7UA 2ZZFA 2YU2A 4DIDB 1UURA 4DR6T 2N2NA 4KX6A 3T8OA 2H7VC 2RPAA 4P72A 4XTYA 3I9WA 3C51A 2BG9A 1WYDA 3ZT7A 3TKLB 3PCOA 2OLTA 3PUSA 3UH0A 4Q6GA 5H6QB 2DHRA 2X67A 1WLXA 2E9XB 3TLVA 4JEHB 3W15B 4X1IE 3NWIA 4DR3T 4UV9B 1WR0A 3PUXF 4DO0A 2FUPA 4HTEA 1UX4A 2A72A 2VVSA 4QXCB 4AKIA 4IREA 4O4LE 2LSYA 5J2UE 3FZFB 4IIJE 3IF8B 3HFZB 1H7CA 2ES0A 5LJMA 4JI0T 4LFBT 3HKEE 3B13A 5AQTB 3TEGA 2Y8DA 3V7RA 2N1GA 2I6HA 2C5JA 3I0QA 2DCFA 3RYFE 4OLFA 1O3XA 4NPPA 2K3WA 2ZINA 2X9WA 5JDFA 4P75A 3JC6D 1SE7A 3ONLC 4YT0A 2AMCA 1YFTA 4OK0A 3AVRA 3L4GA 1B70A 3HRIA 5AQQB 3G1ZA 1U4QA 3PE0A 4XTVA 3DSQA 4FI5A 2Y6XA 4XU1A 3PZCA 4JV5T 3ZMSB 1JNRA 4GYSA 3P4SA 2W0GA 5AQGB 3ZT6A 2ZM6T 3NKZA 4EIWA 2E5LT 3HKDE 3P4RA 2M6BA 2W61A 1VOMA 2EHOC 4KR2A 4OYKA 3QUJA 1H4VB 1LRZA 3QB5K 3T1YT 4H63V 4H02A 4YYEA 1ZEEA 2V5DA 2IW5B 1ATIA 1EVLA 1XWMA 1HF8A 1I6ZA 1HX1B 4GIWA 1G5HA 2K5BB 2XJ7A 3KVBA 2X51A 1B7YB 2WCAA 1KOGA 4ZOLE 2NTYA 4XAXB 1NYRA 5BMVE 2LJLA 3RIFA 3OVUA 5HXHA 2A8EA 3RIAA 1B8AA 2VL8A 2ZM0A 4RQEA 4KR3A 2KT9A 2KLQA 3V8KA 1ASZA 5CA1E 3N2GE 4I4TE 4BAYB 4DV3T 2CJ9A 4PK6A 2FYKA 4HE8A 3VQXA 3HR0A 5HEOA 1UUSA 2DZCA 3LFMA 5F8PA 1WQ7A 3OTOT 3P4WA 3PUAA 3NRXA 2E5AA 5GONE 3HXVA 5ABGA 4YTPA 3PUWF 3MF2A 1J5ET 3R07A 4K88A 5CGMA 4YSZA 3HY0A 4K0KT 5L3CB 2DVEA 2X9HA 2A3DA 4XTWA 4OYJA 5AQHB 1EIYA 3RYCE 3QNEA 4Q15A 3RYHE 1EOVA 1IJ5A 4O4HE 4BJNA 1HTTA 3V5SA 4KMCA 2ZR2A 4YHHT 3LJCA 4BWAA
chains in the Genus database with same CATH topology
4K87A 4YRCA 1H4QA 1WNLA 3P8VA 1X54A 3RUXA 1ADJA 4ZIBA 1BBUA 4PG3A 3A74A 3VBBA 3RIRA 3QO8A 3L1AA 1SESA 3EFSA 1H4SA 2ALYA 2RHSB 4HWRA 4LVKA 4XU2A 3BJUA 3RL6A 1PYSB 3HTZA 4PHCA 2EWNA 3MEYA 3V7CA 2ZTGA 4CS3A 4ZTZB 4WJ3M 2J3MA 3TEHB 1GGMA 1HXDA 4UP8A 2G4CA 1NJ5A 1X56A 3HXUA 5C53B 2E1HA 4H2YA 2EJGA 4ZTUB 4CH4A 2EL9A 4AH6A 3HXZA 1B76A 2QHTA 4TWAA 3TEHA 1EVKA 2DXUA 1USYC 4LNSA 4CH6A 3MQZA 1VQZA 4LVLA 4XEMA 2ODRC 1E22A 2IY5A 3A5YA 5C52B 2EJFA 2ZCEA 4YRLA 2DEQA 4YRJA 2C8MA 4LVJA 4KQEA 3HFVA 4XTZA 4K86A 3WQZA 3QTCA 4YRQA 4H2TA 1QF6A 5F5WA 4TVWA 4EX5A 3NELA 2DTIA 4WI1A 5ELOA 2DDZA 3V8LA 3M4PA 3P8TA 2ZT5A 2DU5A 2ZR3A 2PMEA 3IG2A 1KMMA 4DQ2A 1WPYA 2QHVA 4YP0A 2AKWA 2C7IA 1J5WA 1KMNA 2ZNJA 4WJ4A 4EO4A 3A32A 4P73A 3HXXA 2ZT6A 2RHQB 2ZT8A 1IL2A 2E3CA 3IKMB 3BFMA 1JJCA 4RMFA 3V8JA 1RIQA 4OP0A 4P71A 2ALYB 4P74A 5C51B 2CJBA 1SRYA 4XTUA 3CMQA 2Q7HA 1X2HA 3EFRA 2ARUA 1YB3A 2ZXFA 3HFZA 4CS4A 1ADYA 3UGTA 2RHQA 4XTXA 3UFGA 4O2DA 1H4TA 2Q7GA 1SETA 4YRTA 4YPFA 3A31A 2QHSA 3E9IA 1HC7A 1N9WA 3HXYA 2CGHA 4X5OA 2DTOA 3ERRA 3RGLA 3NETA 3IKLA 3LSSA 4UPAA 4J15A 2E64A 4HWPA 3VQWA 1X55A 2E65A 3TUPA 1BBWA 4TQDA 2ZZGA 2DU7A 3A7RA 4CS2A 2DKGA 4H2SA 1YGBA 2ZZEA 2DQ0A 5KNNA 4XEOA 2I4OA 4YDQA 2IY5B 3QO7A 4YCWA 3A7AA 4HWTA 2I4MA 4WF2A 1WLEA 3M4QA 4H2XB 2CIMA 3A7UA 2ZZFA 2HNIA 1W66A 3P8YA 4P73C 4P72A 4XTYA 1NJ8A 1WYDA 4P71C 2E10A 4P74C 1B7YA 4H2XA 4HWSA 3PCOA 4H2UA 1EFWA 3UH0A 4Q6GA 2AKWB 1NJ2A 2Q5HA 2ZIOA 2DZ9A 2EAYA 4H2VA 4YRMA 2P5IA 2P0LA 4RDXA 5HGQA 1JJCB 3V7SA 1E1OA 1FYFA 2J3LA 2XGTA 3FJPA 4YRIA 1X01A 4P3PA 4H2WA 3HFZB 3RF1A 2E41A 3I7FA 4TVYA 2QHUA 4YRNA 3TEGA 2ZT7A 1B70B 2I4NA 3V7RA 1X2GA 3RKYA 4OLFA 2PMFA 3QO5A 1NJ1A 3MF1A 2ODRD 2ZINA 2EJ9A 4TVAA 3VQYA 1WU7A 4P75A 3L2ZA 1NYQA 4LVMA 2AMCA 1YFTA 3LSQA 3L4GA 1B70A 3HRIA 1BIAA 3NENA 3G1ZA 5E3IA 4XTVA 3DSQA 4XU3A 3RKXA 4BW9A 4XU1A 3PZCA 1G5IA 4YROA 4E51A 4YCVA 2ARSA 2I4LA 4CH3A 1G51A 4P72C 3A5ZA 1E24A 4XU0A 5K1PA 4UP7A 4TTVA 2ZIMA 3UGQA 1NNHA 4KR2A 3REUA 1H4VB 1E1TA 3VQVA 4H02A 4YYEA 1ASYA 1ATIA 1EVLA 5ELNA 4YRPA 2RHSA 4HA8A 4L87A 1G5HA 1EQRA 3RKWA 1B7YB 1Z7NA 3PCOB 1KOGA 3HY1A 4YRGA 4YRRA 4HWOA 1NYRA 3IALA 1L0WA 1BIBA 1PYSA 2NS6A 2DJZA 3ICAA 4HVCA 2A8EA 3LC0A 1B8AA 1WQWA 4RQEA 4KR3A 2ZGWA 4DPGA 4TQFA 3HXWA 1SERA 2XTIA 4HT4A 3V8KA 1ASZA 4LVIA 4RQFA 4YRFA 4P75C 2CJ9A 4UP9A 11ASA 2FYKA 4YREA 3VQXA 4NCXA 2DZCA 3W3SA 2DXTA 1YFSA 1Z7MA 4YRSA 1WQ7A 2Q5IA 1C0AA 2E5AA 3KFUA 3HXVA 1NJ6A 1QE0A 3HRKA 3OD1A 3MF2A 1EIYB 4P3NA 3E9HA 2DQ3A 3R07A 4K88A 4P3OA 4TVAB 3HY0A 3RACA 4YCUA 12ASA 2DVEA 2CJAA 5K1XA 2AMCB 2ARTA 4XTWA 4CH5A 1YFRA 4YRKA 3L4GB 2Q7EA 1EIYA 1USYA 2DTHA 4G85A 3QNEA 4Q15A 3REXA 1EOVA 1HTTA 2ZR2A 3NEMA 2ZNIA 4G84A 1LYLA 4BWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K87 A;  4YRC A;  1H4Q A;  1WNL A;  3P8V A;  1X54 A;  3RUX A;  1ADJ A;  4ZIB A;  1BBU A;  4PG3 A;  3A74 A;  3VBB A;  3RIR A;  3QO8 A;  3L1A A;  1SES A;  3EFS A;  1H4S A;  2ALY A;  2RHS B;  4HWR A;  4XU2 A;  3BJU A;  3RL6 A;  1PYS B;  3HTZ A;  4PHC A;  2EWN A;  3MEY A;  3V7C A;  2ZTG A;  4CS3 A;  4ZTZ B;  4WJ3 M;  2J3M A;  3TEH B;  1GGM A;  1HXD A;  4UP8 A;  2G4C A;  1NJ5 A;  1X56 A;  3HXU A;  5C53 B;  2E1H A;  4H2Y A;  2EJG A;  4ZTU B;  4CH4 A;  2EL9 A;  4AH6 A;  3HXZ A;  1B76 A;  2QHT A;  4TWA A;  3TEH A;  1EVK A;  2DXU A;  1USY C;  4LNS A;  4CH6 A;  1VQZ A;  4XEM A;  2ODR C;  1E22 A;  2IY5 A;  3A5Y A;  5C52 B;  2EJF A;  2ZCE A;  4YRL A;  2DEQ A;  4YRJ A;  2C8M A;  4KQE A;  3HFV A;  4XTZ A;  4K86 A;  3WQZ A;  3QTC A;  4YRQ A;  4H2T A;  1QF6 A;  5F5W A;  4TVW A;  4EX5 A;  3NEL A;  2DTI A;  4WI1 A;  5ELO A;  2DDZ A;  3V8L A;  3M4P A;  3P8T A;  2ZT5 A;  2DU5 A;  2ZR3 A;  2PME A;  3IG2 A;  1KMM A;  4DQ2 A;  1WPY A;  2QHV A;  4YP0 A;  2AKW A;  2C7I A;  1J5W A;  1KMN A;  2ZNJ A;  4WJ4 A;  4EO4 A;  3A32 A;  4P73 A;  3HXX A;  2ZT6 A;  2RHQ B;  2ZT8 A;  1IL2 A;  2E3C A;  3IKM B;  3BFM A;  1JJC A;  4RMF A;  3V8J A;  1RIQ A;  4OP0 A;  4P71 A;  2ALY B;  4P74 A;  5C51 B;  2CJB A;  1SRY A;  4XTU A;  3CMQ A;  2Q7H A;  1X2H A;  3EFR A;  2ARU A;  1YB3 A;  2ZXF A;  3HFZ A;  4CS4 A;  1ADY A;  3UGT A;  2RHQ A;  4XTX A;  3UFG A;  4O2D A;  1H4T A;  2Q7G A;  1SET A;  4YRT A;  4YPF A;  3A31 A;  2QHS A;  3E9I A;  1HC7 A;  1N9W A;  3HXY A;  2CGH A;  4X5O A;  2DTO A;  3ERR A;  3RGL A;  3NET A;  3IKL A;  3LSS A;  4UPA A;  4J15 A;  2E64 A;  4HWP A;  3VQW A;  1X55 A;  2E65 A;  3TUP A;  1BBW A;  4TQD A;  2ZZG A;  2DU7 A;  3A7R A;  4CS2 A;  2DKG A;  4H2S A;  1YGB A;  2ZZE A;  2DQ0 A;  5KNN A;  4XEO A;  2I4O A;  4YDQ A;  2IY5 B;  3QO7 A;  4YCW A;  3A7A A;  4HWT A;  2I4M A;  4WF2 A;  1WLE A;  3M4Q A;  4H2X B;  2CIM A;  3A7U A;  2ZZF A;  2HNI A;  1W66 A;  3P8Y A;  4P73 C;  4P72 A;  4XTY A;  1NJ8 A;  1WYD A;  4P71 C;  2E10 A;  4P74 C;  1B7Y A;  4H2X A;  4HWS A;  3PCO A;  4H2U A;  1EFW A;  3UH0 A;  4Q6G A;  2AKW B;  1NJ2 A;  2Q5H A;  2ZIO A;  2DZ9 A;  2EAY A;  4H2V A;  4YRM A;  2P5I A;  2P0L A;  4RDX A;  5HGQ A;  1JJC B;  3V7S A;  1E1O A;  1FYF A;  2J3L A;  2XGT A;  3FJP A;  4YRI A;  1X01 A;  4P3P A;  4H2W A;  3HFZ B;  3RF1 A;  2E41 A;  3I7F A;  4TVY A;  2QHU A;  4YRN A;  3TEG A;  2ZT7 A;  1B70 B;  2I4N A;  3V7R A;  1X2G A;  3RKY A;  4OLF A;  2PMF A;  3QO5 A;  1NJ1 A;  3MF1 A;  2ODR D;  2ZIN A;  2EJ9 A;  4TVA A;  3VQY A;  1WU7 A;  4P75 A;  3L2Z A;  1NYQ A;  2AMC A;  1YFT A;  3LSQ A;  3L4G A;  1B70 A;  3HRI A;  1BIA A;  3NEN A;  3G1Z A;  5E3I A;  4XTV A;  3DSQ A;  4XU3 A;  3RKX A;  4BW9 A;  4XU1 A;  3PZC A;  1G5I A;  4YRO A;  4E51 A;  4YCV A;  2ARS A;  2I4L A;  4CH3 A;  1G51 A;  4P72 C;  3A5Z A;  1E24 A;  4XU0 A;  5K1P A;  4UP7 A;  4TTV A;  2ZIM A;  3UGQ A;  1NNH A;  4KR2 A;  3REU A;  1H4V B;  1E1T A;  3VQV A;  4H02 A;  4YYE A;  1ASY A;  1ATI A;  1EVL A;  5ELN A;  4YRP A;  2RHS A;  4HA8 A;  4L87 A;  1G5H A;  1EQR A;  3RKW A;  1B7Y B;  1Z7N A;  3PCO B;  1KOG A;  3HY1 A;  4YRG A;  4YRR A;  4HWO A;  1NYR A;  3IAL A;  1L0W A;  1BIB A;  1PYS A;  2DJZ A;  3ICA A;  4HVC A;  3LC0 A;  1B8A A;  1WQW A;  4RQE A;  4KR3 A;  2ZGW A;  4DPG A;  4TQF A;  3HXW A;  1SER A;  2XTI A;  3V8K A;  1ASZ A;  4RQF A;  4YRF A;  4P75 C;  2CJ9 A;  4UP9 A;  11AS A;  2FYK A;  4YRE A;  3VQX A;  4NCX A;  2DZC A;  3W3S A;  2DXT A;  1YFS A;  1Z7M A;  4YRS A;  1WQ7 A;  2Q5I A;  1C0A A;  2E5A A;  3KFU A;  3HXV A;  1NJ6 A;  1QE0 A;  3HRK A;  3OD1 A;  3MF2 A;  1EIY B;  4P3N A;  3E9H A;  2DQ3 A;  3R07 A;  4K88 A;  4P3O A;  4TVA B;  3HY0 A;  3RAC A;  4YCU A;  12AS A;  2DVE A;  2CJA A;  5K1X A;  2AMC B;  2ART A;  4XTW A;  4CH5 A;  1YFR A;  4YRK A;  3L4G B;  2Q7E A;  1EIY A;  1USY A;  2DTH A;  4G85 A;  3QNE A;  4Q15 A;  3REX A;  1EOV A;  1HTT A;  2ZR2 A;  3NEM A;  2ZNI A;  4G84 A;  1LYL A;  4BWA A; 
#chains in the Genus database with same CATH topology
 1KNZ A;  1SA0 E;  1ZP0 A;  2BVM A;  4AQF C;  3P8V A;  1X54 A;  3EAB A;  3RUX A;  3CQG B;  3PU3 A;  4PG3 A;  3I9Y A;  4U74 A;  4AI6 A;  2XY8 B;  2BZB A;  3QNU A;  4ADZ A;  3QO8 A;  3L1A A;  2CLY C;  3EFS A;  3IEE A;  5M4Y A;  3EUH A;  3RYI E;  2ALY A;  2NP9 A;  4EZH A;  4TX5 A;  1D1B A;  5L3B B;  3JAE A;  3BJU A;  2V6X A;  2CXD A;  2CXF A;  4UVC B;  2XAH B;  3RL6 A;  1PYS B;  3RQW A;  3OKQ A;  5A1L A;  2CLY B;  4HWH A;  4TNW A;  3HKB E;  5JDM A;  2Y48 B;  4MBQ A;  3Q5X A;  3V7C A;  5FMN A;  2IC9 A;  2J3M A;  5CJ5 A;  2G4C A;  1NJ5 A;  3O1I A;  1LKX A;  5KX5 E;  4DR4 T;  5C53 B;  4H2Y A;  4PJM A;  4ZTU B;  1MNE A;  2CMR A;  3HXZ A;  3FHN A;  1N33 T;  2QHT A;  4TWA A;  5LOV E;  1USY C;  4LNS A;  3MQZ A;  1VQZ A;  4LVL A;  2P9B A;  2UU9 T;  4KHP T;  3A5Y A;  2ZCE A;  3JC6 C;  4YRL A;  2C8M A;  4JBW F;  4LVJ A;  3FZK B;  4KQE A;  2IC6 A;  3WQZ A;  3QTC A;  4IGU A;  3OPC A;  4FJO A;  1YW0 A;  3V8L A;  2Q9Q C;  3M4P A;  3N9P A;  4YY3 T;  4CI1 B;  2SPC A;  3AEG A;  4HFB A;  4TWH A;  4O2B E;  2D2S A;  4QWN B;  3UUN A;  2LM2 A;  3UQ7 A;  2WMO A;  4YLH A;  3BK9 A;  2RHQ B;  2ODV A;  3IKM B;  3BFM A;  4RMF A;  4H9O C;  1RIQ A;  2C0S A;  2WU5 A;  4P71 A;  3LBX B;  4P74 A;  4MAL A;  5C51 B;  1CHU A;  5AQI B;  2LHN A;  4PJL A;  1YB3 A;  1D0Y A;  3N9M A;  3UTK A;  5AQJ B;  3PV0 F;  3FXD B;  4HFH A;  1NWM X;  4P0B A;  3LG7 A;  3J7Y q;  1H4T A;  1X79 A;  3QB5 A;  4HWC A;  3UFE A;  2J1D G;  2NOX A;  4G2A A;  3R84 B;  4CI2 B;  1BR2 A;  3ANW A;  5BR8 T;  3ZMU B;  2MYS A;  3CPZ A;  2DTO A;  4HN9 A;  3ERR A;  3RGL A;  2H7O A;  3L3P A;  4L9I A;  4UPA A;  2CE7 A;  4X64 T;  3ZEF B;  4EGW A;  3A5X A;  5FL0 A;  3ZCI A;  2NW9 A;  3VKG A;  4LF6 T;  2MBG A;  1BR0 A;  3A7R A;  5C8Y E;  3ONX A;  5L2L A;  3HI2 A;  5KNN A;  3K1S A;  4XEO A;  1D0X A;  1HNW T;  2IY5 B;  4L5G A;  4HFV A;  4YCW A;  1KNP A;  2I4M A;  4G63 A;  2DI4 A;  1S94 A;  4QXB B;  3LDQ B;  2BG9 E;  3MA9 A;  2C5I T;  5CB4 E;  4P73 C;  4ZI3 D;  4LMK A;  5L4E A;  5AQF B;  3AEB A;  2V5C A;  4AQG A;  5JR9 C;  2PJQ A;  4H2U A;  4IDZ A;  2YU1 A;  3RKG A;  2LOS A;  2LSJ A;  1T72 A;  5FY1 A;  3A7M A;  4TNV A;  4YSY A;  2DZ9 A;  2EAY A;  4YRM A;  4OHF A;  2P5I A;  3EVY A;  3AEF A;  1UX5 A;  3N9Q A;  4JYA T;  1OED E;  5LNK A;  1FYF A;  5JR9 B;  4B3R T;  2BKP A;  3AE4 A;  3Q9D A;  4P3P A;  3AVS A;  3PUV F;  2JMH A;  1G8X A;  5JDQ A;  4TVY A;  2QHU A;  2IAK A;  5HCJ A;  3JAF A;  1B70 B;  4UIG A;  3NVO A;  5FXV A;  4H9N C;  2VVN A;  2BKO A;  2PMF A;  4A56 A;  2W00 A;  3QO5 A;  3VQY A;  1WU7 A;  3DP7 A;  2UUA T;  2BS3 A;  4JEU B;  2H89 A;  4JUY A;  1XNQ T;  1YD8 G;  3NBX X;  4JI8 T;  5HEG A;  4PJJ A;  3N9N A;  3OBV E;  4NUV A;  1BIA A;  2W2U A;  3HA4 A;  3NEN A;  2LM9 A;  5HCM A;  4BW9 A;  1DU2 A;  1G5I A;  4YRO A;  4E51 A;  2I4L A;  1YKH B;  5J2T E;  4CH3 A;  3C64 A;  2F4V T;  3A5Z A;  2FJE A;  2WZI A;  2X0H A;  2X9X A;  4GK5 E;  1ASY A;  4V1A v;  4YRP A;  4HA8 A;  4IL4 A;  3MK7 C;  2H88 A;  4IDO A;  1SUM B;  2NW8 A;  4ZS2 A;  2R6G F;  4WBN E;  5LHG B;  2E9X C;  5AQN B;  4YRG A;  1YQ4 A;  1L0W A;  3T1H T;  2HH7 A;  4H9Q C;  2XSB A;  5AQK B;  3FB2 A;  3VRA A;  5AQU B;  4COF A;  3E08 A;  4OX9 T;  5IYZ E;  1WQW A;  4DPG A;  3HXW A;  5L3D B;  4HT4 A;  5IWA T;  3EDV A;  4DV5 T;  4RQF A;  4I50 E;  3UU8 A;  3AE2 A;  3NRY A;  2CHO A;  2MOZ A;  4ASK A;  4N78 D;  4UF0 B;  4NCX A;  1Y64 B;  3N2O A;  2XZE A;  2DXT A;  5AQV B;  4IE0 A;  3N9L A;  2YK0 A;  4DR1 T;  1NJ6 A;  3OD1 A;  1EIY B;  2WZH A;  5KMG P;  4CN1 A;  5DQW A;  1OED A;  5AFU L;  5LHH B;  3AE3 A;  3K3O A;  4TVA B;  3SWH A;  2WY2 A;  1UCU A;  4IE5 A;  4EV6 A;  2CJA A;  2ART A;  4U2Y A;  4YRK A;  3RIU C;  3RX6 A;  2V6Y B;  5CFB A;  4TV9 E;  4DND A;  4P09 A;  4F8H A;  3P4Q A;  3AA7 B;  2JMK A;  5L3G B;  3EHZ A;  2K48 A;  2ZNI A;  3HXY A;  4G84 A;  4K87 A;  4A5X A;  4AIS A;  1MND A;  5EK4 A;  3ZCJ A;  1ADJ A;  2K9A A;  4EYU A;  1BBU A;  3RKO A;  5C3J A;  4KP3 C;  4JI3 T;  2Z6E A;  2DL1 A;  4PFO A;  5FY7 A;  4ZI3 C;  3F31 A;  2ACZ A;  1MIW A;  4ERR A;  2RHS B;  3AE8 A;  1D1C A;  4DV1 T;  2WDV A;  2V7M A;  3ZKR A;  1I94 T;  4JI7 T;  4LVK A;  4XU2 A;  3AE9 A;  1MMN A;  3ZYL A;  1W09 A;  1UK5 A;  2X0L B;  3UUB A;  5HXR A;  3HTZ A;  2YN6 A;  4PHC A;  3MEY A;  2VKO A;  2ZTG A;  4CS3 A;  4WJ3 M;  1J1J A;  4HWI B;  1D1A A;  5JRC A;  2WQY A;  4UP8 A;  2BVL A;  5JDN A;  3SS1 A;  1E2A A;  2E1H A;  4UV8 B;  4ILU A;  5AQM B;  1LVK A;  2HPJ A;  2EJG A;  3CQC B;  1T7S A;  4CH4 A;  1KF6 A;  2JQQ A;  4IHJ E;  4MFR A;  3VR8 A;  3TEH A;  4HFC A;  2DXU A;  2BS2 A;  1XDO A;  2X68 A;  4U3C A;  4CH6 A;  1W0B A;  3ZSS A;  2PBI A;  1L0V A;  3UU4 A;  4YRJ A;  5IHY A;  4X66 T;  2D5U A;  3AXJ A;  4K86 A;  5HYA A;  3PJA J;  5LCY A;  3S4U A;  4QH5 A;  5ADX L;  2J4G A;  1VCT A;  4YRQ A;  2E5V A;  1QF6 A;  3N5L A;  5F5W A;  3ZMV B;  2DTI A;  2XM1 A;  3AE6 A;  2YDR A;  1HNX T;  5L47 A;  3Q5D A;  3I1A A;  4IT4 A;  3IG2 A;  4PNI A;  1WPY A;  2UXX B;  2QHV A;  3KV5 A;  4YP0 A;  2M67 A;  3PUY F;  4YXD A;  2ZNJ A;  2QYW A;  4EO4 A;  1T98 A;  3A32 A;  2ZT6 A;  2E3C A;  2IDO B;  4EAH A;  2XQ3 A;  3GMI A;  5JDG A;  2A9U A;  1SRY A;  4XTU A;  5HWX A;  3BQI A;  4DBQ A;  3EFR A;  3F2E A;  3ZLI A;  2FJD A;  2ZXF A;  3HFZ A;  5EK2 A;  4CS4 A;  1ADY A;  4DMV A;  3SOL A;  3ZT5 A;  3Q5E A;  1Y01 A;  2JIW A;  3UFG A;  3ONJ A;  4O2D A;  2Q7G A;  1VRB A;  5HAX A;  1IBL T;  2QRX A;  2YDQ A;  1M7K A;  3A31 A;  2WBL A;  5LB7 B;  2QHS A;  2NW7 A;  5LBM A;  5LYJ E;  3JCF A;  4DR7 T;  3A8Y C;  2BKN A;  4ILA A;  4CXY A;  3VQW A;  1X55 A;  2HHH T;  3WI3 A;  3TUP A;  2CBI A;  2ZZG A;  2G0U A;  4CS2 A;  4H2S A;  1YGB A;  2ZZE A;  4EYY R;  2CM0 A;  2I4O A;  3EI0 A;  4TN7 B;  4DVD A;  1N36 T;  2CWO A;  2L8K A;  1U5P A;  5JDL A;  3LK4 2;  2HNI A;  2J47 A;  1YKE B;  4DV6 T;  3HKC E;  5LG3 A;  3P8Y A;  4X62 T;  3IA3 A;  3GN5 B;  1W0A A;  4LMJ A;  4JI4 T;  1NJ8 A;  3N2K E;  4U33 A;  5KXJ A;  4C91 A;  1B7Y A;  4H2X A;  2V7J A;  3CX6 B;  2VQF T;  2EHO A;  4KHZ F;  2AKW B;  2Q5H A;  3CKD A;  1B7T A;  4H2V A;  4ZS3 A;  1IAP A;  2KND A;  3KBT A;  3OYZ A;  4RDX A;  5HGQ A;  1JJC B;  1IJ6 A;  3P7I A;  3KIN B;  2J3L A;  3FJP A;  4YRI A;  4L0R A;  3SFD A;  4AKG A;  3AE5 A;  4H2W A;  3FZM B;  3OYX A;  2UXB T;  5L4H A;  4CN4 A;  4UVA B;  1OWA A;  2YEV C;  2WDR A;  3I7F A;  2D0U A;  2LSI A;  3Q2M A;  3C4W A;  2WDQ A;  4HGA A;  4PFP A;  2WM9 A;  1IBM T;  4GKJ T;  1X2G A;  3RKY A;  4IE4 A;  3TLT A;  3MF1 A;  4K0U A;  2XTL A;  3AB3 B;  1FEW A;  2EJ9 A;  3FXE B;  1XZY A;  2YIN A;  4LF5 T;  3L09 A;  1NYQ A;  2CA5 A;  3RPU A;  3LSQ A;  3ZMZ B;  3AED A;  2NWB A;  4BA9 A;  1KNR A;  5E3I A;  1XNR T;  2LEH A;  4NIQ A;  4XU3 A;  3P50 A;  3RKX A;  3C4Z A;  3CWZ B;  1WFD A;  2ARS A;  4CZZ B;  1G51 A;  3AAI A;  4P72 C;  3UUL A;  4DV7 T;  1E24 A;  2UUB T;  2BG9 C;  4H9P C;  4UP7 A;  3UGQ A;  3PDY A;  3K8P C;  1NEK A;  4H63 H;  5JTG A;  2CPT A;  3UU5 A;  1E1T A;  5FP3 A;  3VQV A;  3PJA A;  1AJ3 A;  5ELN A;  2XQ4 A;  4TWF A;  1CUN A;  1QUU A;  5LXT E;  4QXH B;  4AQF A;  1WYB A;  3RKW A;  2CXL A;  2XQ6 A;  4IE7 A;  2BG9 B;  5H6R B;  3RC8 A;  3PCO B;  5JRE A;  2RA1 A;  3TLW A;  3IAL A;  4O4I E;  1PYS A;  2NS6 A;  2DJZ A;  4UXN B;  5FXX A;  5ABF A;  5LBQ B;  4IST A;  2IIU A;  4TV8 E;  3JAD A;  4TQF A;  1SER A;  4QX7 B;  2OV9 A;  5LP6 E;  4LVI A;  1XDP A;  4YRF A;  5FVK A;  3AAA B;  3V5U A;  4U2Z A;  2LSK A;  4HFE A;  4P75 C;  2K24 A;  1OED B;  1EZ3 A;  3N9O A;  11AS A;  4YRE A;  4CXW A;  5JVD E;  2LKG A;  4XBF B;  2EHO D;  3W3S A;  4IL9 A;  3CX7 B;  1Z7M A;  4QH1 A;  4YRS A;  4ANJ A;  5FNV E;  1C0A A;  3KFU A;  5HEU A;  1QE0 A;  3HRK A;  4HEA A;  1NAF A;  5DJQ C;  3KV9 A;  4CQI A;  1OXZ A;  3KV6 A;  2CBJ A;  3U3I A;  3MJX A;  2V26 A;  3B57 A;  4YCU A;  4B3M T;  4LF9 T;  2AMC B;  5C2T A;  2QVA A;  3L4G B;  2Q7E A;  2XQ5 A;  3MXZ A;  4Q25 A;  2JQ9 A;  1USY A;  3REX A;  3MZK B;  2HN2 A;  3FBL A;  2DWK A;  2FBW A;  5FXZ A;  4WNK A;  3ZJ2 A;  3FZL B;  4DV2 T;  2V7K A;  1IL2 A;  4YRC A;  1WNL A;  2IML A;  3J9X 1;  2ZLY A;  3H3M A;  2CCQ A;  3GA8 A;  2HN1 A;  3VR9 A;  4LF7 T;  3A74 A;  3NZP A;  1QSD A;  4YTM A;  3L39 A;  3RIR A;  3VBB A;  4YSX A;  2WSS V;  5LHI B;  4HFD A;  1ZKE A;  4EED A;  3KDS E;  2Q9Q A;  2XQY A;  4LML A;  1H4S A;  3LBX A;  5JQG E;  2IHR 1;  1G73 A;  4IE6 A;  4X5T A;  3X1D A;  4P0A A;  4E7S A;  4KI0 F;  2CRB A;  4TUY E;  4AIU A;  5ABE A;  5JRC B;  3AE7 A;  1Z0P A;  3ABV A;  4HWD A;  2WAU A;  2EWN A;  2MAW A;  2QA7 A;  5AQL B;  3TEH B;  4DR2 T;  1HXD A;  3AEA A;  3OJA A;  1JNZ A;  4EEB A;  1IZN B;  3KVA A;  4NXN T;  1X56 A;  2I0M A;  3HXU A;  4UEL A;  5IUX A;  3VHL A;  3ESL A;  2ODU A;  2EL9 A;  4AH6 A;  5DQV A;  4X1K E;  1B76 A;  4QHO A;  1Z8U A;  4AQY T;  2D0T A;  2KWI B;  2JQH A;  5J0Z A;  1NEN A;  2ZMA A;  1MMA A;  3QC9 A;  4A97 A;  4IDQ A;  4ZZC A;  2VUR A;  4DUZ T;  4XEM A;  1E22 A;  2IY5 A;  1X9B A;  2EJF A;  3E22 E;  4KBM B;  2DEQ A;  2XAF B;  4WW0 A;  1W9R A;  3P8C D;  2MTQ A;  5EZY E;  4DV4 T;  3HFV A;  5LJN A;  3PUR A;  3DJB A;  4ZXL A;  1HTJ F;  1XMQ T;  4JI5 T;  4H2T A;  4GOU A;  5KDM C;  4TVW A;  2LOP A;  3NEL A;  1M62 A;  5ELO A;  2KMF A;  4I43 B;  3P8T A;  2ZT5 A;  2A2F X;  1FJG T;  2DU5 A;  2ZR3 A;  4JI2 T;  1KMM A;  4DQ2 A;  3L8R A;  2QGS A;  2C7I A;  3MKD A;  1KMN A;  2VKJ A;  1N32 T;  4PAG A;  4DMW A;  1XMO T;  4I55 E;  4LFC T;  3HXX A;  2V7I A;  4P73 A;  4WZX A;  3CQX C;  3V8J A;  4H9R C;  4MLK A;  2ALY B;  5JR9 A;  2CJB A;  3TLU A;  3AEC A;  1US7 B;  3CMQ A;  1N34 T;  2Q7H A;  1KEY A;  2ARU A;  2RP4 A;  2V7L A;  4ZI2 D;  4YJ2 E;  5LGT B;  5FL1 A;  4XTX A;  3RH3 A;  1HG5 A;  2ZM8 A;  5FKY A;  3CVR A;  1E1H B;  3ZMT B;  4ILB A;  3KFW X;  3ZN1 B;  1HS7 A;  3C98 B;  1N9W A;  4PJN A;  2Q9Q D;  3NET A;  3IKL A;  3LSS A;  4EB6 E;  3CIR A;  2WU2 A;  3KBU A;  5LMU T;  4HWP A;  2ACX A;  2E65 A;  3MAC A;  1D0Z A;  3PUQ A;  1WRD A;  2DKG A;  2W66 A;  2JPF A;  1VCS A;  2VAS A;  5FVL A;  5J1G A;  3QO7 A;  2LKH A;  2X9Y A;  2HPL A;  4U7Y A;  4WYV A;  4C90 A;  5AQS B;  4BJM A;  1E7P A;  4H9S E;  4HWT A;  4WF2 A;  1WLE A;  4HWF A;  4Z91 A;  3M4Q A;  1LVF A;  4O8S A;  3CML A;  3ETU A;  1V9D A;  1FMW A;  3LK2 B;  4X1Y E;  4H2X B;  2EHO B;  1WR6 A;  2V1D B;  1W66 A;  2FJB A;  3P4P A;  3FZH B;  3TLS A;  3PUZ F;  2PTF A;  4GYR A;  4P71 C;  2WWV A;  2E10 A;  4P74 C;  3K3Q C;  4ILC A;  5E0O A;  4HWS A;  2DWG A;  2LHR A;  2WP9 A;  4JI1 T;  1EFW A;  2W4X A;  4M1P A;  5HXE A;  1NJ2 A;  3AEE A;  2KIN B;  3M65 A;  2ZIO A;  4IDP A;  4HKA A;  2W63 A;  3IHR A;  3WAK A;  4GK0 E;  4EXT A;  3WAJ A;  3D0T A;  3Q5W A;  3PUG A;  2P0L A;  4AKR B;  3V7S A;  1E1O A;  2XGT A;  4KUM B;  2BBH A;  3R6N A;  1X01 A;  1IBK T;  2E9X A;  1SHZ C;  3RF1 A;  3RI5 A;  4E7Z A;  3AA0 B;  2E41 A;  3UQ4 A;  4UF0 A;  5AQO B;  5LGU B;  3M3Z B;  4Z90 A;  4YRN A;  5LA6 E;  1UGO A;  2ZT7 A;  4UEM A;  4ZHQ E;  4U72 A;  4X65 T;  2I4N A;  4ZZB A;  1QLB A;  2M6I A;  4EZ4 A;  3ANW B;  2WWU A;  1NJ1 A;  2ODR D;  4TVA A;  3VKH A;  4DV0 T;  3L2Z A;  3ZN0 B;  4LVM A;  2WMN A;  1T8B A;  5HXC A;  2LRL A;  5L3F B;  1ZV4 X;  3AE1 A;  3RHW A;  5AQP B;  2V6Y A;  2JJ9 A;  2D9D A;  3I0O A;  3UUX B;  3C4X A;  2LLY A;  1R8I A;  3RRC A;  4YCV A;  1MMG A;  2XSA A;  2JRK A;  1BR1 A;  4UR9 A;  5CA0 E;  3VRB A;  2XPK A;  2WB5 A;  4XU0 A;  5TAO A;  5K1P A;  3ZYM A;  4U7I A;  2ZIM A;  4TTV A;  3RIU A;  5HXS A;  1NNH A;  3REU A;  1YQ3 A;  3LK3 B;  4JI6 T;  4B6X A;  2MPK A;  4LFA T;  5LGN B;  3ETV A;  2UXD T;  2YKS A;  4NXM T;  4Z8X A;  2RHS A;  4L87 A;  2AE9 A;  1EQR A;  5ABF B;  4GKK T;  1Z7N A;  2OA5 A;  3HY1 A;  4YRR A;  4HWO A;  2IUB A;  1BIB A;  4YTN A;  3ICA A;  4HVC A;  2BS4 A;  3AAE B;  3LC0 A;  2ZGW A;  3QOF A;  3AA6 B;  2XTI A;  3C50 A;  2XQ9 A;  1GQE A;  5FY0 A;  2CWY A;  4CN6 A;  4LF4 T;  4UP9 A;  2PFV A;  2AXD S;  4ZI2 C;  4ISS A;  1WCR A;  5LMN T;  5L3E B;  2J62 A;  1YFS A;  2YOE A;  2Q5I A;  2CEA A;  2JQK A;  3CX8 B;  5JH7 E;  2KSR A;  4P3N A;  2XHE B;  2XAG B;  2B76 A;  3QK6 A;  2DQ3 A;  3E9H A;  2KZ7 B;  4J2C A;  1YXR A;  4P3O A;  3RAC A;  3O4X E;  12AS A;  2BBJ A;  1HCI A;  5K1X A;  3NZQ A;  2XAS B;  4CH5 A;  4MHC A;  3AA1 B;  4DBR A;  1YFR A;  4HFI A;  2E9X D;  2C5K T;  3UU3 A;  2XUE A;  2VKD A;  2DTH A;  1MMD A;  3ZC1 A;  4YJ3 E;  4G85 A;  4B3S T;  3PTR B;  2UXC T;  4P1N A;  2LT3 A;  3NEM A;  1LYL A;  2N9D A;  2Q9Q B;  1H4Q A;  3FBZ A;  3HL6 A;  3EAM A;  4AXP A;  2BDE A;  4ZIB A;  3U78 A;  3O9X A;  4B3T T;  4NUU A;  1SES A;  4WBO A;  3G06 A;  2V8S V;  2LE8 A;  4PK4 A;  3GWH A;  3K3N A;  3E0Z A;  1HG2 A;  2GK9 A;  1S35 A;  3H37 A;  4HWR A;  3KV4 A;  4ZEY A;  2B1E A;  2VK9 A;  3DTO A;  3UU6 A;  1KFY A;  3ZC0 A;  4O4J E;  1ZHC A;  2W67 A;  3UT5 E;  4ZTZ B;  3ZPO A;  3VU7 H;  3RQU A;  3F57 A;  1GGM A;  4EOZ B;  4I0U A;  3SRZ A;  4ZI7 E;  2LSG A;  2DNX A;  1OED C;  3CK6 A;  2H3R A;  2XAQ B;  1FMV A;  2VKH A;  2DLR A;  4JLE A;  1HR0 T;  2L9Q A;  4CI3 B;  5HEJ A;  1EVK A;  4QKN A;  5HEH A;  5FXW A;  4CXX A;  1FIO A;  5FYM A;  3ZJ1 A;  2ODR C;  2XQ7 A;  3RRW A;  2WS3 A;  5C52 B;  4PW8 A;  3IBP A;  2UUC T;  4AKL A;  4YHJ A;  1HX8 A;  4XTZ A;  3O1J A;  4XZC A;  3EDU A;  2VL0 A;  2LRK A;  4TWD A;  3GN5 A;  4EX5 A;  3B5M A;  1MIY A;  4WI1 A;  3BQK A;  4IDN A;  4DUY T;  2DDZ A;  2XQA A;  4QX8 B;  2PME A;  5JDH A;  2KXP B;  2AKW A;  1J5W A;  2E2A A;  2XQ8 A;  2ZM2 A;  4F6R C;  4WJ4 A;  4O2A E;  2YDS A;  3UUM A;  2VWA A;  3RC3 A;  3ZYK A;  2XAJ B;  2ZT8 A;  2PG8 A;  3O1H A;  4A98 A;  5HWY A;  1JJC A;  4OP0 A;  4YFS A;  1ZOY A;  3RLF F;  4UVB B;  2X66 A;  1X2H A;  3SFE A;  2KWH A;  2FJA A;  2XM2 A;  2E8I A;  5AQR B;  3LSV A;  4U31 A;  3UGT A;  2RHQ A;  2VQE T;  2L3L A;  3BQL A;  2X0Y A;  5EK3 A;  2UXN B;  5ETW A;  4AKH A;  1SET A;  4YRT A;  4YPF A;  4LF8 T;  3ZST A;  3E9I A;  1HC7 A;  2CGH A;  4X5O A;  5DAB A;  4J15 A;  2E64 A;  2VB6 A;  1BR4 A;  5F3J A;  4OFZ A;  1MIV A;  1HNZ T;  2W62 A;  1BBW A;  4TQD A;  3H3A A;  2DU7 A;  4QH4 A;  4X20 E;  2DQ0 A;  5ABH A;  4YDQ A;  1WYC A;  2NR4 A;  4TZ4 C;  4DR5 T;  3A7A A;  1HFA A;  2NTX A;  2I59 A;  3PU8 A;  2CHN A;  1KK7 A;  3AXJ B;  5LG4 A;  2CIM A;  4PK5 A;  3A7U A;  2ZZF A;  2YU2 A;  4DID B;  1UUR A;  4DR6 T;  2N2N A;  4KX6 A;  3T8O A;  2H7V C;  2RPA A;  4P72 A;  4XTY A;  3I9W A;  3C51 A;  2BG9 A;  1WYD A;  3ZT7 A;  3TKL B;  3PCO A;  2OLT A;  3PUS A;  3UH0 A;  4Q6G A;  5H6Q B;  2DHR A;  2X67 A;  1WLX A;  2E9X B;  3TLV A;  4JEH B;  3W15 B;  4X1I E;  3NWI A;  4DR3 T;  4UV9 B;  1WR0 A;  3PUX F;  4DO0 A;  2FUP A;  4HTE A;  1UX4 A;  2A72 A;  2VVS A;  4QXC B;  4AKI A;  4IRE A;  4O4L E;  2LSY A;  5J2U E;  3FZF B;  4IIJ E;  3IF8 B;  3HFZ B;  1H7C A;  2ES0 A;  5LJM A;  4JI0 T;  4LFB T;  3HKE E;  3B13 A;  5AQT B;  3TEG A;  2Y8D A;  3V7R A;  2N1G A;  2I6H A;  2C5J A;  3I0Q A;  2DCF A;  3RYF E;  4OLF A;  1O3X A;  4NPP A;  2K3W A;  2ZIN A;  2X9W A;  5JDF A;  4P75 A;  3JC6 D;  1SE7 A;  3ONL C;  4YT0 A;  2AMC A;  1YFT A;  4OK0 A;  3AVR A;  3L4G A;  1B70 A;  3HRI A;  5AQQ B;  3G1Z A;  1U4Q A;  3PE0 A;  4XTV A;  3DSQ A;  4FI5 A;  2Y6X A;  4XU1 A;  3PZC A;  4JV5 T;  3ZMS B;  1JNR A;  4GYS A;  3P4S A;  2W0G A;  5AQG B;  3ZT6 A;  2ZM6 T;  3NKZ A;  4EIW A;  2E5L T;  3HKD E;  3P4R A;  2M6B A;  2W61 A;  1VOM A;  2EHO C;  4KR2 A;  4OYK A;  3QUJ A;  1H4V B;  1LRZ A;  3QB5 K;  3T1Y T;  4H63 V;  4H02 A;  4YYE A;  1ZEE A;  2V5D A;  2IW5 B;  1ATI A;  1EVL A;  1XWM A;  1HF8 A;  1I6Z A;  1HX1 B;  4GIW A;  1G5H A;  2K5B B;  2XJ7 A;  3KVB A;  2X51 A;  1B7Y B;  2WCA A;  1KOG A;  4ZOL E;  2NTY A;  4XAX B;  1NYR A;  5BMV E;  2LJL A;  3RIF A;  3OVU A;  5HXH A;  2A8E A;  3RIA A;  1B8A A;  2VL8 A;  2ZM0 A;  4RQE A;  4KR3 A;  2KT9 A;  2KLQ A;  3V8K A;  1ASZ A;  5CA1 E;  3N2G E;  4I4T E;  4BAY B;  4DV3 T;  2CJ9 A;  4PK6 A;  2FYK A;  4HE8 A;  3VQX A;  3HR0 A;  5HEO A;  1UUS A;  2DZC A;  3LFM A;  5F8P A;  1WQ7 A;  3OTO T;  3P4W A;  3PUA A;  3NRX A;  2E5A A;  5GON E;  3HXV A;  5ABG A;  4YTP A;  3PUW F;  3MF2 A;  1J5E T;  3R07 A;  4K88 A;  5CGM A;  4YSZ A;  3HY0 A;  4K0K T;  5L3C B;  2DVE A;  2X9H A;  2A3D A;  4XTW A;  4OYJ A;  5AQH B;  1EIY A;  3RYC E;  3QNE A;  4Q15 A;  3RYH E;  1EOV A;  1IJ5 A;  4O4H E;  4BJN A;  1HTT A;  3V5S A;  4KMC A;  2ZR2 A;  4YHH T;  3LJC A;  4BWA A; 
#chains in the Genus database with same CATH homology
 4K87 A;  4YRC A;  1H4Q A;  1WNL A;  3P8V A;  1X54 A;  3RUX A;  1ADJ A;  4ZIB A;  1BBU A;  4PG3 A;  3A74 A;  3VBB A;  3RIR A;  3QO8 A;  3L1A A;  1SES A;  3EFS A;  1H4S A;  2ALY A;  2RHS B;  4HWR A;  4LVK A;  4XU2 A;  3BJU A;  3RL6 A;  1PYS B;  3HTZ A;  4PHC A;  2EWN A;  3MEY A;  3V7C A;  2ZTG A;  4CS3 A;  4ZTZ B;  4WJ3 M;  2J3M A;  3TEH B;  1GGM A;  1HXD A;  4UP8 A;  2G4C A;  1NJ5 A;  1X56 A;  3HXU A;  5C53 B;  2E1H A;  4H2Y A;  2EJG A;  4ZTU B;  4CH4 A;  2EL9 A;  4AH6 A;  3HXZ A;  1B76 A;  2QHT A;  4TWA A;  3TEH A;  1EVK A;  2DXU A;  1USY C;  4LNS A;  4CH6 A;  3MQZ A;  1VQZ A;  4LVL A;  4XEM A;  2ODR C;  1E22 A;  2IY5 A;  3A5Y A;  5C52 B;  2EJF A;  2ZCE A;  4YRL A;  2DEQ A;  4YRJ A;  2C8M A;  4LVJ A;  4KQE A;  3HFV A;  4XTZ A;  4K86 A;  3WQZ A;  3QTC A;  4YRQ A;  4H2T A;  1QF6 A;  5F5W A;  4TVW A;  4EX5 A;  3NEL A;  2DTI A;  4WI1 A;  5ELO A;  2DDZ A;  3V8L A;  3M4P A;  3P8T A;  2ZT5 A;  2DU5 A;  2ZR3 A;  2PME A;  3IG2 A;  1KMM A;  4DQ2 A;  1WPY A;  2QHV A;  4YP0 A;  2AKW A;  2C7I A;  1J5W A;  1KMN A;  2ZNJ A;  4WJ4 A;  4EO4 A;  3A32 A;  4P73 A;  3HXX A;  2ZT6 A;  2RHQ B;  2ZT8 A;  1IL2 A;  2E3C A;  3IKM B;  3BFM A;  1JJC A;  4RMF A;  3V8J A;  1RIQ A;  4OP0 A;  4P71 A;  2ALY B;  4P74 A;  5C51 B;  2CJB A;  1SRY A;  4XTU A;  3CMQ A;  2Q7H A;  1X2H A;  3EFR A;  2ARU A;  1YB3 A;  2ZXF A;  3HFZ A;  4CS4 A;  1ADY A;  3UGT A;  2RHQ A;  4XTX A;  3UFG A;  4O2D A;  1H4T A;  2Q7G A;  1SET A;  4YRT A;  4YPF A;  3A31 A;  2QHS A;  3E9I A;  1HC7 A;  1N9W A;  3HXY A;  2CGH A;  4X5O A;  2DTO A;  3ERR A;  3RGL A;  3NET A;  3IKL A;  3LSS A;  4UPA A;  4J15 A;  2E64 A;  4HWP A;  3VQW A;  1X55 A;  2E65 A;  3TUP A;  1BBW A;  4TQD A;  2ZZG A;  2DU7 A;  3A7R A;  4CS2 A;  2DKG A;  4H2S A;  1YGB A;  2ZZE A;  2DQ0 A;  5KNN A;  4XEO A;  2I4O A;  4YDQ A;  2IY5 B;  3QO7 A;  4YCW A;  3A7A A;  4HWT A;  2I4M A;  4WF2 A;  1WLE A;  3M4Q A;  4H2X B;  2CIM A;  3A7U A;  2ZZF A;  2HNI A;  1W66 A;  3P8Y A;  4P73 C;  4P72 A;  4XTY A;  1NJ8 A;  1WYD A;  4P71 C;  2E10 A;  4P74 C;  1B7Y A;  4H2X A;  4HWS A;  3PCO A;  4H2U A;  1EFW A;  3UH0 A;  4Q6G A;  2AKW B;  1NJ2 A;  2Q5H A;  2ZIO A;  2DZ9 A;  2EAY A;  4H2V A;  4YRM A;  2P5I A;  2P0L A;  4RDX A;  5HGQ A;  1JJC B;  3V7S A;  1E1O A;  1FYF A;  2J3L A;  2XGT A;  3FJP A;  4YRI A;  1X01 A;  4P3P A;  4H2W A;  3HFZ B;  3RF1 A;  2E41 A;  3I7F A;  4TVY A;  2QHU A;  4YRN A;  3TEG A;  2ZT7 A;  1B70 B;  2I4N A;  3V7R A;  1X2G A;  3RKY A;  4OLF A;  2PMF A;  3QO5 A;  1NJ1 A;  3MF1 A;  2ODR D;  2ZIN A;  2EJ9 A;  4TVA A;  3VQY A;  1WU7 A;  4P75 A;  3L2Z A;  1NYQ A;  4LVM A;  2AMC A;  1YFT A;  3LSQ A;  3L4G A;  1B70 A;  3HRI A;  1BIA A;  3NEN A;  3G1Z A;  5E3I A;  4XTV A;  3DSQ A;  4XU3 A;  3RKX A;  4BW9 A;  4XU1 A;  3PZC A;  1G5I A;  4YRO A;  4E51 A;  4YCV A;  2ARS A;  2I4L A;  4CH3 A;  1G51 A;  4P72 C;  3A5Z A;  1E24 A;  4XU0 A;  5K1P A;  4UP7 A;  4TTV A;  2ZIM A;  3UGQ A;  1NNH A;  4KR2 A;  3REU A;  1H4V B;  1E1T A;  3VQV A;  4H02 A;  4YYE A;  1ASY A;  1ATI A;  1EVL A;  5ELN A;  4YRP A;  2RHS A;  4HA8 A;  4L87 A;  1G5H A;  1EQR A;  3RKW A;  1B7Y B;  1Z7N A;  3PCO B;  1KOG A;  3HY1 A;  4YRG A;  4YRR A;  4HWO A;  1NYR A;  3IAL A;  1L0W A;  1BIB A;  1PYS A;  2NS6 A;  2DJZ A;  3ICA A;  4HVC A;  2A8E A;  3LC0 A;  1B8A A;  1WQW A;  4RQE A;  4KR3 A;  2ZGW A;  4DPG A;  4TQF A;  3HXW A;  1SER A;  2XTI A;  4HT4 A;  3V8K A;  1ASZ A;  4LVI A;  4RQF A;  4YRF A;  4P75 C;  2CJ9 A;  4UP9 A;  11AS A;  2FYK A;  4YRE A;  3VQX A;  4NCX A;  2DZC A;  3W3S A;  2DXT A;  1YFS A;  1Z7M A;  4YRS A;  1WQ7 A;  2Q5I A;  1C0A A;  2E5A A;  3KFU A;  3HXV A;  1NJ6 A;  1QE0 A;  3HRK A;  3OD1 A;  3MF2 A;  1EIY B;  4P3N A;  3E9H A;  2DQ3 A;  3R07 A;  4K88 A;  4P3O A;  4TVA B;  3HY0 A;  3RAC A;  4YCU A;  12AS A;  2DVE A;  2CJA A;  5K1X A;  2AMC B;  2ART A;  4XTW A;  4CH5 A;  1YFR A;  4YRK A;  3L4G B;  2Q7E A;  1EIY A;  1USY A;  2DTH A;  4G85 A;  3QNE A;  4Q15 A;  3REX A;  1EOV A;  1HTT A;  2ZR2 A;  3NEM A;  2ZNI A;  4G84 A;  1LYL A;  4BWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...