4P73C

Phers in complex with compound 1a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
251
structure length
239
Chain Sequence
AAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 64
structure length 239
sequence length 251
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p73C01
4ZTZB 1WLEA 3RIRA 4LNSA 2ZTGA 2QHTA 2RHSA 3V8JA 4RMFA 4YDQA 1YFSA 4XU1A 3V8LA 4YP0A 2RHQB 3UFGA 4XTWA 4YCUA 2RHQA 4UP7A 2DU5A 3QO5A 3HXVA 4P73A 4E51A 1BBWA 4HA8A 2XTIA 3L4GB 2ALYB 1NJ8A 4H2UA 4P3NA 1X2GA 1B70A 2EWNA 3RF1A 3PCOB 3VQXA 3PCOA 4H2WA 4CS3A 4P75C 4P74A 3A7RA 4XTYA 3REXA 3A74A 3WQZA 1WYDA 1ASZA 1EFWA 3IKMB 4YRCA 2J3MA 4YREA 5K1PA 4H2VA 3RKXA 3MEYA 4EX5A 1IL2A 4X5OA 4XTZA 1EVLA 3TEHB 5KNNA 2E10A 1QE0A 3R07A 3HRKA 1E22A 12ASA 1NYQA 4WJ4A 4K87A 3MF2A 4XTVA 1NJ6A 2DTOA 2E64A 4YRPA 3QO8A 4HVCA 2ZCEA 4TVAB 4KR3A 3M4QA 1GGMA 1YFRA 4TVAA 4BWAA 4CH6A 4YRQA 2DXTA 3RKWA 2I4LA 3V7SA 2ZT7A 1ADJA 4RQEA 2ZR3A 3L2ZA 4YRFA 1FYFA 1ASYA 3FJPA 4OLFA 2DTHA 4YRJA 2ZT6A 2EL9A 3HXUA 1NJ2A 1PYSB 4HWSA 3NETA 3HXYA 1USYA 1X2HA 1N9WA 3V7RA 3P8VA 3QO7A 4P73C 2ZXFA 3A5YA 4Q15A 4WF2A 1G5HA 2CJAA 3A7UA 4OP0A 1HC7A 3HY0A 1HXDA 1G5IA 3E9IA 3HY1A 1E1OA 4YRSA 3TUPA 3IKLA 4ZIBA 2QHVA 2RHSB 1H4SA 4XTUA 4CS4A 4DQ2A 1EQRA 1Z7MA 4UP9A 4BW9A 3VQWA 2Q5IA 2ODRC 3LSSA 4P3PA 5E3IA 4YPFA 11ASA 2DKGA 4YRNA 1B70B 3HXZA 3A5ZA 2I4NA 3G1ZA 4TQFA 1SESA 1EVKA 5C51B 4G85A 2ZZFA 1NJ5A 2C7IA 1LYLA 2QHUA 3M4PA 2ARUA 2E5AA 3IALA 1C0AA 4TQDA 4YRGA 1BBUA 2DQ0A 4H02A 3REUA 4CH3A 2AMCA 3UGTA 4TVWA 1X54A 1W66A 3BJUA 4CS2A 2IY5A 4XTXA 3MF1A 1JJCA 2ZNJA 4H2XA 3NEMA 3HFZB 1EIYB 1ATIA 2PMFA 2EJGA 1WQ7A 3HFZA 1EIYA 1ADYA 4P72A 2FYKA 4K86A 4CH4A 1B76A 5F5WA 4YRLA 1X55A 4TVYA 4G84A 5K1XA 2Q7EA 5ELOA 2J3LA 4Q6GA 4P71A 3A32A 1SRYA 4L87A 2C8MA 2CIMA 4HWRA 1BIAA 2I4MA 4EO4A 2ZIOA 4K88A 3LC0A 1KOGA 4YRIA 2QHSA 2ZGWA 3RKYA 2E1HA 1WNLA 2DVEA 2ZT8A 4H2YA 3W3SA 3E9HA 4YCVA 1KMNA 5ELNA 4J15A 1WQWA 4YROA 3VQVA 2ARTA 2HNIA 2DJZA 5C52B 2ZINA 1H4QA 2CJ9A 4P74C 4H2SA 2P0LA 2AKWA 2DQ3A 2E3CA 3A7AA 1J5WA 1X56A 4YRTA 1VQZA 2EJFA 2DEQA 1SERA 4O2DA 3BFMA 3NELA 4XEOA 1KMMA 4XU3A 4WJ3M 4YRKA 3RACA 4XU0A 3P8YA 1NYRA 2ARSA 2E65A 3RUXA 4RDXA 3OD1A 4HWTA 2EAYA 1EOVA 4KQEA 3L4GA 3ICAA 4XEMA 2ALYA 2Q5HA 2ZNIA 4PG3A 3RGLA 3HXWA 2P5IA 3PZCA 3QTCA 1HTTA 4P72C 2AMCB 2EJ9A 1BIBA 2DXUA 1WU7A 2ODRD 4XU2A 1G51A 2CJBA 3NENA 3CMQA 4HWPA 4AH6A 2IY5B 2DDZA 1JJCB 4H2TA 4H2XB 4YCWA 1B8AA 3EFSA 1NJ1A 4P71C 3KFUA 1QF6A 3A31A 3ERRA 1YB3A 2DTIA 1B7YB 2Q7HA 2ZZEA 3HTZA 1B7YA 2XGTA 2DZCA 3L1AA 4P75A 2ZIMA 1H4TA 3TEHA 3I7FA 4NCXA 2DU7A 1USYC 3VBBA 3QNEA 1YGBA 3V8KA 1L0WA 3V7CA 4CH5A 2E41A 3TEGA 1H4VB 1WPYA 4YRMA 3VQYA 3HRIA 3EFRA 2ZR2A 1Z7NA 2CGHA 2G4CA 2Q7GA 1X01A 4DPGA 2ZZGA 4P3OA 2I4OA 3HFVA 1E1TA 3P8TA 2DZ9A 3HXXA 1SETA 3LSQA 1NNHA 4UPAA 4HWOA 5HGQA 5C53B 3UGQA 2PMEA 3DSQA 4TTVA 1YFTA 3IG2A 3UH0A 3RL6A 1E24A 1RIQA 4RQFA 4YRRA 1PYSA 4WI1A 4ZTUB 4KR2A 2AKWB 4TWAA 2ZT5A 4UP8A 4YYEA 4PHCA
chains in the Genus database with same CATH superfamily
4ZTZB 1WLEA 3RIRA 4LNSA 2ZTGA 2QHTA 2RHSA 3V8JA 4RMFA 4YDQA 1YFSA 4XU1A 3V8LA 4LVMA 4YP0A 2RHQB 3UFGA 4XTWA 4YCUA 2RHQA 4UP7A 2DU5A 3QO5A 3HXVA 4P73A 2A8EA 4E51A 1BBWA 4HA8A 2XTIA 3L4GB 2ALYB 1NJ8A 4H2UA 4P3NA 1X2GA 1B70A 2EWNA 3RF1A 3PCOB 3VQXA 3PCOA 4H2WA 4CS3A 4P75C 4P74A 3A7RA 4XTYA 3REXA 3A74A 3WQZA 1WYDA 1ASZA 1EFWA 3IKMB 4YRCA 2J3MA 4YREA 5K1PA 4H2VA 3RKXA 3MEYA 4EX5A 3MQZA 1IL2A 4X5OA 4XTZA 1EVLA 3TEHB 5KNNA 2E10A 1QE0A 3R07A 3HRKA 1E22A 12ASA 1NYQA 4WJ4A 4K87A 3MF2A 4XTVA 1NJ6A 2DTOA 2E64A 4YRPA 3QO8A 4HVCA 2ZCEA 4TVAB 4KR3A 3M4QA 1GGMA 4LVLA 1YFRA 4TVAA 4BWAA 4CH6A 4YRQA 2DXTA 3RKWA 2I4LA 3V7SA 2ZT7A 1ADJA 4RQEA 2ZR3A 3L2ZA 4YRFA 1FYFA 1ASYA 3FJPA 4OLFA 2DTHA 4YRJA 2ZT6A 2EL9A 3HXUA 1NJ2A 1PYSB 4HWSA 3NETA 3HXYA 1USYA 1X2HA 1N9WA 3V7RA 3P8VA 3QO7A 4P73C 2ZXFA 3A5YA 4Q15A 4WF2A 1G5HA 2CJAA 3A7UA 4OP0A 1HC7A 3HY0A 1HXDA 1G5IA 3E9IA 3HY1A 1E1OA 4YRSA 3TUPA 3IKLA 4ZIBA 2QHVA 2RHSB 1H4SA 4XTUA 4CS4A 4DQ2A 1EQRA 1Z7MA 4UP9A 4BW9A 3VQWA 2Q5IA 2ODRC 3LSSA 4P3PA 5E3IA 4YPFA 11ASA 2DKGA 4YRNA 2NS6A 1B70B 3HXZA 3A5ZA 2I4NA 3G1ZA 4TQFA 1SESA 1EVKA 5C51B 4G85A 2ZZFA 1NJ5A 2C7IA 1LYLA 2QHUA 3M4PA 2ARUA 2E5AA 3IALA 4LVKA 1C0AA 4TQDA 4YRGA 1BBUA 2DQ0A 4H02A 3REUA 4CH3A 2AMCA 3UGTA 4TVWA 1X54A 4LVIA 1W66A 3BJUA 4CS2A 2IY5A 4XTXA 3MF1A 1JJCA 2ZNJA 4H2XA 3NEMA 3HFZB 1EIYB 1ATIA 4HT4A 2PMFA 2EJGA 1WQ7A 3HFZA 1EIYA 1ADYA 4P72A 2FYKA 4K86A 4CH4A 1B76A 5F5WA 4YRLA 1X55A 4TVYA 4G84A 5K1XA 2Q7EA 5ELOA 2J3LA 4Q6GA 4P71A 3A32A 1SRYA 4L87A 2C8MA 2CIMA 4HWRA 1BIAA 2I4MA 4EO4A 2ZIOA 4K88A 3LC0A 1KOGA 4YRIA 2QHSA 2ZGWA 3RKYA 2E1HA 1WNLA 2DVEA 2ZT8A 4H2YA 3W3SA 3E9HA 4YCVA 1KMNA 5ELNA 4J15A 1WQWA 4YROA 3VQVA 2ARTA 2HNIA 2DJZA 5C52B 2ZINA 1H4QA 2CJ9A 4P74C 4H2SA 2P0LA 2AKWA 2DQ3A 2E3CA 3A7AA 1J5WA 1X56A 4YRTA 1VQZA 2EJFA 2DEQA 1SERA 4O2DA 3BFMA 3NELA 4XEOA 1KMMA 4XU3A 4WJ3M 4YRKA 3RACA 4XU0A 3P8YA 1NYRA 2ARSA 2E65A 3RUXA 4RDXA 3OD1A 4HWTA 2EAYA 1EOVA 4KQEA 3L4GA 3ICAA 4XEMA 2ALYA 2Q5HA 2ZNIA 4PG3A 3RGLA 3HXWA 2P5IA 3PZCA 3QTCA 1HTTA 4P72C 2AMCB 2EJ9A 1BIBA 2DXUA 1WU7A 2ODRD 4XU2A 1G51A 2CJBA 3NENA 3CMQA 4HWPA 4AH6A 2IY5B 2DDZA 1JJCB 4H2TA 4H2XB 4YCWA 1B8AA 3EFSA 1NJ1A 4P71C 3KFUA 1QF6A 3A31A 3ERRA 1YB3A 2DTIA 1B7YB 2Q7HA 2ZZEA 3HTZA 1B7YA 2XGTA 2DZCA 3L1AA 4P75A 2ZIMA 1H4TA 3TEHA 3I7FA 4NCXA 2DU7A 1USYC 3VBBA 3QNEA 1YGBA 3V8KA 1L0WA 3V7CA 4CH5A 2E41A 3TEGA 1H4VB 1WPYA 4YRMA 3VQYA 3HRIA 3EFRA 2ZR2A 1Z7NA 2CGHA 2G4CA 2Q7GA 1X01A 4DPGA 2ZZGA 4P3OA 2I4OA 3HFVA 1E1TA 3P8TA 2DZ9A 3HXXA 1SETA 3LSQA 1NNHA 4UPAA 4HWOA 5HGQA 5C53B 3UGQA 2PMEA 3DSQA 4TTVA 1YFTA 3IG2A 3UH0A 3RL6A 1E24A 1RIQA 4RQFA 4YRRA 1PYSA 4LVJA 4WI1A 4ZTUB 4KR2A 2AKWB 4TWAA 2ZT5A 4UP8A 4YYEA 4PHCA
chains in the Genus database with same CATH topology
4ZTZB 1WLEA 3RIRA 4LNSA 2ZTGA 2QHTA 2RHSA 3V8JA 4RMFA 4YDQA 1YFSA 4XU1A 3V8LA 4LVMA 4YP0A 2RHQB 3UFGA 4XTWA 4YCUA 2RHQA 4UP7A 2DU5A 3QO5A 3HXVA 4P73A 2A8EA 4E51A 1BBWA 4HA8A 2XTIA 3L4GB 2ALYB 1NJ8A 4H2UA 4P3NA 1X2GA 1B70A 2EWNA 3RF1A 3PCOB 3VQXA 3PCOA 4H2WA 4CS3A 4P75C 4P74A 3A7RA 4XTYA 3REXA 3A74A 3WQZA 1WYDA 1ASZA 1EFWA 3IKMB 4YRCA 2J3MA 4YREA 5K1PA 4H2VA 3RKXA 3MEYA 4EX5A 3MQZA 1IL2A 4X5OA 4XTZA 1EVLA 3TEHB 5KNNA 2E10A 1QE0A 3R07A 3HRKA 1E22A 12ASA 1NYQA 4WJ4A 4K87A 3MF2A 4XTVA 1NJ6A 2DTOA 2E64A 4YRPA 3QO8A 4HVCA 2ZCEA 4TVAB 4KR3A 3M4QA 1GGMA 4LVLA 1YFRA 4TVAA 4BWAA 4CH6A 4YRQA 2DXTA 3RKWA 2I4LA 3V7SA 2ZT7A 1ADJA 4RQEA 2ZR3A 3L2ZA 4YRFA 1FYFA 1ASYA 3FJPA 4OLFA 2DTHA 4YRJA 2ZT6A 2EL9A 3HXUA 1NJ2A 1PYSB 4HWSA 3NETA 3HXYA 1USYA 1X2HA 1N9WA 3V7RA 3P8VA 3QO7A 4P73C 2ZXFA 3A5YA 4Q15A 4WF2A 1G5HA 2CJAA 3A7UA 4OP0A 1HC7A 3HY0A 1HXDA 1G5IA 3E9IA 3HY1A 1E1OA 4YRSA 3TUPA 3IKLA 4ZIBA 2QHVA 2RHSB 1H4SA 4XTUA 4CS4A 4DQ2A 1EQRA 1Z7MA 4UP9A 4BW9A 3VQWA 2Q5IA 2ODRC 3LSSA 4P3PA 5E3IA 4YPFA 11ASA 2DKGA 4YRNA 2NS6A 1B70B 3HXZA 3A5ZA 2I4NA 3G1ZA 4TQFA 1SESA 1EVKA 5C51B 4G85A 2ZZFA 1NJ5A 2C7IA 1LYLA 2QHUA 3M4PA 2ARUA 2E5AA 3IALA 4LVKA 1C0AA 4TQDA 4YRGA 1BBUA 2DQ0A 4H02A 3REUA 4CH3A 2AMCA 3UGTA 4TVWA 1X54A 4LVIA 1W66A 3BJUA 4CS2A 2IY5A 4XTXA 3MF1A 1JJCA 2ZNJA 4H2XA 3NEMA 3HFZB 1EIYB 1ATIA 4HT4A 2PMFA 2EJGA 1WQ7A 3HFZA 1EIYA 1ADYA 4P72A 2FYKA 4K86A 4CH4A 1B76A 5F5WA 4YRLA 1X55A 4TVYA 4G84A 5K1XA 2Q7EA 5ELOA 2J3LA 4Q6GA 4P71A 3A32A 1SRYA 4L87A 2C8MA 2CIMA 4HWRA 1BIAA 2I4MA 4EO4A 2ZIOA 4K88A 3LC0A 1KOGA 4YRIA 2QHSA 2ZGWA 3RKYA 2E1HA 1WNLA 2DVEA 2ZT8A 4H2YA 3W3SA 3E9HA 4YCVA 1KMNA 5ELNA 4J15A 1WQWA 4YROA 3VQVA 2ARTA 2HNIA 2DJZA 5C52B 2ZINA 1H4QA 2CJ9A 4P74C 4H2SA 2P0LA 2AKWA 2DQ3A 2E3CA 3A7AA 1J5WA 1X56A 4YRTA 1VQZA 2EJFA 2DEQA 1SERA 4O2DA 3BFMA 3NELA 4XEOA 1KMMA 4XU3A 4WJ3M 4YRKA 3RACA 4XU0A 3P8YA 1NYRA 2ARSA 2E65A 3RUXA 4RDXA 3OD1A 4HWTA 2EAYA 1EOVA 4KQEA 3L4GA 3ICAA 4XEMA 2ALYA 2Q5HA 2ZNIA 4PG3A 3RGLA 3HXWA 2P5IA 3PZCA 3QTCA 1HTTA 4P72C 2AMCB 2EJ9A 1BIBA 2DXUA 1WU7A 2ODRD 4XU2A 1G51A 2CJBA 3NENA 3CMQA 4HWPA 4AH6A 2IY5B 2DDZA 1JJCB 4H2TA 4H2XB 4YCWA 1B8AA 3EFSA 1NJ1A 4P71C 3KFUA 1QF6A 3A31A 3ERRA 1YB3A 2DTIA 1B7YB 2Q7HA 2ZZEA 3HTZA 1B7YA 2XGTA 2DZCA 3L1AA 4P75A 2ZIMA 1H4TA 3TEHA 3I7FA 4NCXA 2DU7A 1USYC 3VBBA 3QNEA 1YGBA 3V8KA 1L0WA 3V7CA 4CH5A 2E41A 3TEGA 1H4VB 1WPYA 4YRMA 3VQYA 3HRIA 3EFRA 2ZR2A 1Z7NA 2CGHA 2G4CA 2Q7GA 1X01A 4DPGA 2ZZGA 4P3OA 2I4OA 3HFVA 1E1TA 3P8TA 2DZ9A 3HXXA 1SETA 3LSQA 1NNHA 4UPAA 4HWOA 5HGQA 5C53B 3UGQA 2PMEA 3DSQA 4TTVA 1YFTA 3IG2A 3UH0A 3RL6A 1E24A 1RIQA 4RQFA 4YRRA 1PYSA 4LVJA 4WI1A 4ZTUB 4KR2A 2AKWB 4TWAA 2ZT5A 4UP8A 4YYEA 4PHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZTZ B;  1WLE A;  3RIR A;  4LNS A;  2ZTG A;  2QHT A;  2RHS A;  3V8J A;  4RMF A;  4YDQ A;  1YFS A;  4XU1 A;  3V8L A;  4YP0 A;  2RHQ B;  3UFG A;  4XTW A;  4YCU A;  2RHQ A;  4UP7 A;  2DU5 A;  3QO5 A;  3HXV A;  4P73 A;  4E51 A;  1BBW A;  4HA8 A;  2XTI A;  3L4G B;  2ALY B;  1NJ8 A;  4H2U A;  4P3N A;  1X2G A;  1B70 A;  2EWN A;  3RF1 A;  3PCO B;  3VQX A;  3PCO A;  4H2W A;  4CS3 A;  4P75 C;  4P74 A;  3A7R A;  4XTY A;  3REX A;  3A74 A;  3WQZ A;  1WYD A;  1ASZ A;  1EFW A;  3IKM B;  4YRC A;  2J3M A;  4YRE A;  5K1P A;  4H2V A;  3RKX A;  3MEY A;  4EX5 A;  1IL2 A;  4X5O A;  4XTZ A;  1EVL A;  3TEH B;  5KNN A;  2E10 A;  1QE0 A;  3R07 A;  3HRK A;  1E22 A;  12AS A;  1NYQ A;  4WJ4 A;  4K87 A;  3MF2 A;  4XTV A;  1NJ6 A;  2DTO A;  2E64 A;  4YRP A;  3QO8 A;  4HVC A;  2ZCE A;  4TVA B;  4KR3 A;  3M4Q A;  1GGM A;  1YFR A;  4TVA A;  4BWA A;  4CH6 A;  4YRQ A;  2DXT A;  3RKW A;  2I4L A;  3V7S A;  2ZT7 A;  1ADJ A;  4RQE A;  2ZR3 A;  3L2Z A;  4YRF A;  1FYF A;  1ASY A;  3FJP A;  4OLF A;  2DTH A;  4YRJ A;  2ZT6 A;  2EL9 A;  3HXU A;  1NJ2 A;  1PYS B;  4HWS A;  3NET A;  3HXY A;  1USY A;  1X2H A;  1N9W A;  3V7R A;  3P8V A;  3QO7 A;  4P73 C;  2ZXF A;  3A5Y A;  4Q15 A;  4WF2 A;  1G5H A;  2CJA A;  3A7U A;  4OP0 A;  1HC7 A;  3HY0 A;  1HXD A;  1G5I A;  3E9I A;  3HY1 A;  1E1O A;  4YRS A;  3TUP A;  3IKL A;  4ZIB A;  2QHV A;  2RHS B;  1H4S A;  4XTU A;  4CS4 A;  4DQ2 A;  1EQR A;  1Z7M A;  4UP9 A;  4BW9 A;  3VQW A;  2Q5I A;  2ODR C;  3LSS A;  4P3P A;  5E3I A;  4YPF A;  11AS A;  2DKG A;  4YRN A;  1B70 B;  3HXZ A;  3A5Z A;  2I4N A;  3G1Z A;  4TQF A;  1SES A;  1EVK A;  5C51 B;  4G85 A;  2ZZF A;  1NJ5 A;  2C7I A;  1LYL A;  2QHU A;  3M4P A;  2ARU A;  2E5A A;  3IAL A;  1C0A A;  4TQD A;  4YRG A;  1BBU A;  2DQ0 A;  4H02 A;  3REU A;  4CH3 A;  2AMC A;  3UGT A;  4TVW A;  1X54 A;  1W66 A;  3BJU A;  4CS2 A;  2IY5 A;  4XTX A;  3MF1 A;  1JJC A;  2ZNJ A;  4H2X A;  3NEM A;  3HFZ B;  1EIY B;  1ATI A;  2PMF A;  2EJG A;  1WQ7 A;  3HFZ A;  1EIY A;  1ADY A;  4P72 A;  2FYK A;  4K86 A;  4CH4 A;  1B76 A;  5F5W A;  4YRL A;  1X55 A;  4TVY A;  4G84 A;  5K1X A;  2Q7E A;  5ELO A;  2J3L A;  4Q6G A;  4P71 A;  3A32 A;  1SRY A;  4L87 A;  2C8M A;  2CIM A;  4HWR A;  1BIA A;  2I4M A;  4EO4 A;  2ZIO A;  4K88 A;  3LC0 A;  1KOG A;  4YRI A;  2QHS A;  2ZGW A;  3RKY A;  2E1H A;  1WNL A;  2DVE A;  2ZT8 A;  4H2Y A;  3W3S A;  3E9H A;  4YCV A;  1KMN A;  5ELN A;  4J15 A;  1WQW A;  4YRO A;  3VQV A;  2ART A;  2HNI A;  2DJZ A;  5C52 B;  2ZIN A;  1H4Q A;  2CJ9 A;  4P74 C;  4H2S A;  2P0L A;  2AKW A;  2DQ3 A;  2E3C A;  3A7A A;  1J5W A;  1X56 A;  4YRT A;  1VQZ A;  2EJF A;  2DEQ A;  1SER A;  4O2D A;  3BFM A;  3NEL A;  4XEO A;  1KMM A;  4XU3 A;  4WJ3 M;  4YRK A;  3RAC A;  4XU0 A;  3P8Y A;  1NYR A;  2ARS A;  2E65 A;  3RUX A;  4RDX A;  3OD1 A;  4HWT A;  2EAY A;  1EOV A;  4KQE A;  3L4G A;  3ICA A;  4XEM A;  2ALY A;  2Q5H A;  2ZNI A;  4PG3 A;  3RGL A;  3HXW A;  2P5I A;  3PZC A;  3QTC A;  1HTT A;  4P72 C;  2AMC B;  2EJ9 A;  1BIB A;  2DXU A;  1WU7 A;  2ODR D;  4XU2 A;  1G51 A;  2CJB A;  3NEN A;  3CMQ A;  4HWP A;  4AH6 A;  2IY5 B;  2DDZ A;  1JJC B;  4H2T A;  4H2X B;  4YCW A;  1B8A A;  3EFS A;  1NJ1 A;  4P71 C;  3KFU A;  1QF6 A;  3A31 A;  3ERR A;  1YB3 A;  2DTI A;  1B7Y B;  2Q7H A;  2ZZE A;  3HTZ A;  1B7Y A;  2XGT A;  2DZC A;  3L1A A;  4P75 A;  2ZIM A;  1H4T A;  3TEH A;  3I7F A;  4NCX A;  2DU7 A;  1USY C;  3VBB A;  3QNE A;  1YGB A;  3V8K A;  1L0W A;  3V7C A;  4CH5 A;  2E41 A;  3TEG A;  1H4V B;  1WPY A;  4YRM A;  3VQY A;  3HRI A;  3EFR A;  2ZR2 A;  1Z7N A;  2CGH A;  2G4C A;  2Q7G A;  1X01 A;  4DPG A;  2ZZG A;  4P3O A;  2I4O A;  3HFV A;  1E1T A;  3P8T A;  2DZ9 A;  3HXX A;  1SET A;  3LSQ A;  1NNH A;  4UPA A;  4HWO A;  5HGQ A;  5C53 B;  3UGQ A;  2PME A;  3DSQ A;  4TTV A;  1YFT A;  3IG2 A;  3UH0 A;  3RL6 A;  1E24 A;  1RIQ A;  4RQF A;  4YRR A;  1PYS A;  4WI1 A;  4ZTU B;  4KR2 A;  2AKW B;  4TWA A;  2ZT5 A;  4UP8 A;  4YYE A;  4PHC A; 
#chains in the Genus database with same CATH topology
 4ZTZ B;  1WLE A;  3RIR A;  4LNS A;  2ZTG A;  2QHT A;  2RHS A;  3V8J A;  4RMF A;  4YDQ A;  1YFS A;  4XU1 A;  3V8L A;  4LVM A;  4YP0 A;  2RHQ B;  3UFG A;  4XTW A;  4YCU A;  2RHQ A;  4UP7 A;  2DU5 A;  3QO5 A;  3HXV A;  4P73 A;  2A8E A;  4E51 A;  1BBW A;  4HA8 A;  2XTI A;  3L4G B;  2ALY B;  1NJ8 A;  4H2U A;  4P3N A;  1X2G A;  1B70 A;  2EWN A;  3RF1 A;  3PCO B;  3VQX A;  3PCO A;  4H2W A;  4CS3 A;  4P75 C;  4P74 A;  3A7R A;  4XTY A;  3REX A;  3A74 A;  3WQZ A;  1WYD A;  1ASZ A;  1EFW A;  3IKM B;  4YRC A;  2J3M A;  4YRE A;  5K1P A;  4H2V A;  3RKX A;  3MEY A;  4EX5 A;  3MQZ A;  1IL2 A;  4X5O A;  4XTZ A;  1EVL A;  3TEH B;  5KNN A;  2E10 A;  1QE0 A;  3R07 A;  3HRK A;  1E22 A;  12AS A;  1NYQ A;  4WJ4 A;  4K87 A;  3MF2 A;  4XTV A;  1NJ6 A;  2DTO A;  2E64 A;  4YRP A;  3QO8 A;  4HVC A;  2ZCE A;  4TVA B;  4KR3 A;  3M4Q A;  1GGM A;  4LVL A;  1YFR A;  4TVA A;  4BWA A;  4CH6 A;  4YRQ A;  2DXT A;  3RKW A;  2I4L A;  3V7S A;  2ZT7 A;  1ADJ A;  4RQE A;  2ZR3 A;  3L2Z A;  4YRF A;  1FYF A;  1ASY A;  3FJP A;  4OLF A;  2DTH A;  4YRJ A;  2ZT6 A;  2EL9 A;  3HXU A;  1NJ2 A;  1PYS B;  4HWS A;  3NET A;  3HXY A;  1USY A;  1X2H A;  1N9W A;  3V7R A;  3P8V A;  3QO7 A;  4P73 C;  2ZXF A;  3A5Y A;  4Q15 A;  4WF2 A;  1G5H A;  2CJA A;  3A7U A;  4OP0 A;  1HC7 A;  3HY0 A;  1HXD A;  1G5I A;  3E9I A;  3HY1 A;  1E1O A;  4YRS A;  3TUP A;  3IKL A;  4ZIB A;  2QHV A;  2RHS B;  1H4S A;  4XTU A;  4CS4 A;  4DQ2 A;  1EQR A;  1Z7M A;  4UP9 A;  4BW9 A;  3VQW A;  2Q5I A;  2ODR C;  3LSS A;  4P3P A;  5E3I A;  4YPF A;  11AS A;  2DKG A;  4YRN A;  2NS6 A;  1B70 B;  3HXZ A;  3A5Z A;  2I4N A;  3G1Z A;  4TQF A;  1SES A;  1EVK A;  5C51 B;  4G85 A;  2ZZF A;  1NJ5 A;  2C7I A;  1LYL A;  2QHU A;  3M4P A;  2ARU A;  2E5A A;  3IAL A;  4LVK A;  1C0A A;  4TQD A;  4YRG A;  1BBU A;  2DQ0 A;  4H02 A;  3REU A;  4CH3 A;  2AMC A;  3UGT A;  4TVW A;  1X54 A;  4LVI A;  1W66 A;  3BJU A;  4CS2 A;  2IY5 A;  4XTX A;  3MF1 A;  1JJC A;  2ZNJ A;  4H2X A;  3NEM A;  3HFZ B;  1EIY B;  1ATI A;  4HT4 A;  2PMF A;  2EJG A;  1WQ7 A;  3HFZ A;  1EIY A;  1ADY A;  4P72 A;  2FYK A;  4K86 A;  4CH4 A;  1B76 A;  5F5W A;  4YRL A;  1X55 A;  4TVY A;  4G84 A;  5K1X A;  2Q7E A;  5ELO A;  2J3L A;  4Q6G A;  4P71 A;  3A32 A;  1SRY A;  4L87 A;  2C8M A;  2CIM A;  4HWR A;  1BIA A;  2I4M A;  4EO4 A;  2ZIO A;  4K88 A;  3LC0 A;  1KOG A;  4YRI A;  2QHS A;  2ZGW A;  3RKY A;  2E1H A;  1WNL A;  2DVE A;  2ZT8 A;  4H2Y A;  3W3S A;  3E9H A;  4YCV A;  1KMN A;  5ELN A;  4J15 A;  1WQW A;  4YRO A;  3VQV A;  2ART A;  2HNI A;  2DJZ A;  5C52 B;  2ZIN A;  1H4Q A;  2CJ9 A;  4P74 C;  4H2S A;  2P0L A;  2AKW A;  2DQ3 A;  2E3C A;  3A7A A;  1J5W A;  1X56 A;  4YRT A;  1VQZ A;  2EJF A;  2DEQ A;  1SER A;  4O2D A;  3BFM A;  3NEL A;  4XEO A;  1KMM A;  4XU3 A;  4WJ3 M;  4YRK A;  3RAC A;  4XU0 A;  3P8Y A;  1NYR A;  2ARS A;  2E65 A;  3RUX A;  4RDX A;  3OD1 A;  4HWT A;  2EAY A;  1EOV A;  4KQE A;  3L4G A;  3ICA A;  4XEM A;  2ALY A;  2Q5H A;  2ZNI A;  4PG3 A;  3RGL A;  3HXW A;  2P5I A;  3PZC A;  3QTC A;  1HTT A;  4P72 C;  2AMC B;  2EJ9 A;  1BIB A;  2DXU A;  1WU7 A;  2ODR D;  4XU2 A;  1G51 A;  2CJB A;  3NEN A;  3CMQ A;  4HWP A;  4AH6 A;  2IY5 B;  2DDZ A;  1JJC B;  4H2T A;  4H2X B;  4YCW A;  1B8A A;  3EFS A;  1NJ1 A;  4P71 C;  3KFU A;  1QF6 A;  3A31 A;  3ERR A;  1YB3 A;  2DTI A;  1B7Y B;  2Q7H A;  2ZZE A;  3HTZ A;  1B7Y A;  2XGT A;  2DZC A;  3L1A A;  4P75 A;  2ZIM A;  1H4T A;  3TEH A;  3I7F A;  4NCX A;  2DU7 A;  1USY C;  3VBB A;  3QNE A;  1YGB A;  3V8K A;  1L0W A;  3V7C A;  4CH5 A;  2E41 A;  3TEG A;  1H4V B;  1WPY A;  4YRM A;  3VQY A;  3HRI A;  3EFR A;  2ZR2 A;  1Z7N A;  2CGH A;  2G4C A;  2Q7G A;  1X01 A;  4DPG A;  2ZZG A;  4P3O A;  2I4O A;  3HFV A;  1E1T A;  3P8T A;  2DZ9 A;  3HXX A;  1SET A;  3LSQ A;  1NNH A;  4UPA A;  4HWO A;  5HGQ A;  5C53 B;  3UGQ A;  2PME A;  3DSQ A;  4TTV A;  1YFT A;  3IG2 A;  3UH0 A;  3RL6 A;  1E24 A;  1RIQ A;  4RQF A;  4YRR A;  1PYS A;  4LVJ A;  4WI1 A;  4ZTU B;  4KR2 A;  2AKW B;  4TWA A;  2ZT5 A;  4UP8 A;  4YYE A;  4PHC A; 
#chains in the Genus database with same CATH homology
 4ZTZ B;  1WLE A;  3RIR A;  4LNS A;  2ZTG A;  2QHT A;  2RHS A;  3V8J A;  4RMF A;  4YDQ A;  1YFS A;  4XU1 A;  3V8L A;  4LVM A;  4YP0 A;  2RHQ B;  3UFG A;  4XTW A;  4YCU A;  2RHQ A;  4UP7 A;  2DU5 A;  3QO5 A;  3HXV A;  4P73 A;  2A8E A;  4E51 A;  1BBW A;  4HA8 A;  2XTI A;  3L4G B;  2ALY B;  1NJ8 A;  4H2U A;  4P3N A;  1X2G A;  1B70 A;  2EWN A;  3RF1 A;  3PCO B;  3VQX A;  3PCO A;  4H2W A;  4CS3 A;  4P75 C;  4P74 A;  3A7R A;  4XTY A;  3REX A;  3A74 A;  3WQZ A;  1WYD A;  1ASZ A;  1EFW A;  3IKM B;  4YRC A;  2J3M A;  4YRE A;  5K1P A;  4H2V A;  3RKX A;  3MEY A;  4EX5 A;  3MQZ A;  1IL2 A;  4X5O A;  4XTZ A;  1EVL A;  3TEH B;  5KNN A;  2E10 A;  1QE0 A;  3R07 A;  3HRK A;  1E22 A;  12AS A;  1NYQ A;  4WJ4 A;  4K87 A;  3MF2 A;  4XTV A;  1NJ6 A;  2DTO A;  2E64 A;  4YRP A;  3QO8 A;  4HVC A;  2ZCE A;  4TVA B;  4KR3 A;  3M4Q A;  1GGM A;  4LVL A;  1YFR A;  4TVA A;  4BWA A;  4CH6 A;  4YRQ A;  2DXT A;  3RKW A;  2I4L A;  3V7S A;  2ZT7 A;  1ADJ A;  4RQE A;  2ZR3 A;  3L2Z A;  4YRF A;  1FYF A;  1ASY A;  3FJP A;  4OLF A;  2DTH A;  4YRJ A;  2ZT6 A;  2EL9 A;  3HXU A;  1NJ2 A;  1PYS B;  4HWS A;  3NET A;  3HXY A;  1USY A;  1X2H A;  1N9W A;  3V7R A;  3P8V A;  3QO7 A;  4P73 C;  2ZXF A;  3A5Y A;  4Q15 A;  4WF2 A;  1G5H A;  2CJA A;  3A7U A;  4OP0 A;  1HC7 A;  3HY0 A;  1HXD A;  1G5I A;  3E9I A;  3HY1 A;  1E1O A;  4YRS A;  3TUP A;  3IKL A;  4ZIB A;  2QHV A;  2RHS B;  1H4S A;  4XTU A;  4CS4 A;  4DQ2 A;  1EQR A;  1Z7M A;  4UP9 A;  4BW9 A;  3VQW A;  2Q5I A;  2ODR C;  3LSS A;  4P3P A;  5E3I A;  4YPF A;  11AS A;  2DKG A;  4YRN A;  2NS6 A;  1B70 B;  3HXZ A;  3A5Z A;  2I4N A;  3G1Z A;  4TQF A;  1SES A;  1EVK A;  5C51 B;  4G85 A;  2ZZF A;  1NJ5 A;  2C7I A;  1LYL A;  2QHU A;  3M4P A;  2ARU A;  2E5A A;  3IAL A;  4LVK A;  1C0A A;  4TQD A;  4YRG A;  1BBU A;  2DQ0 A;  4H02 A;  3REU A;  4CH3 A;  2AMC A;  3UGT A;  4TVW A;  1X54 A;  4LVI A;  1W66 A;  3BJU A;  4CS2 A;  2IY5 A;  4XTX A;  3MF1 A;  1JJC A;  2ZNJ A;  4H2X A;  3NEM A;  3HFZ B;  1EIY B;  1ATI A;  4HT4 A;  2PMF A;  2EJG A;  1WQ7 A;  3HFZ A;  1EIY A;  1ADY A;  4P72 A;  2FYK A;  4K86 A;  4CH4 A;  1B76 A;  5F5W A;  4YRL A;  1X55 A;  4TVY A;  4G84 A;  5K1X A;  2Q7E A;  5ELO A;  2J3L A;  4Q6G A;  4P71 A;  3A32 A;  1SRY A;  4L87 A;  2C8M A;  2CIM A;  4HWR A;  1BIA A;  2I4M A;  4EO4 A;  2ZIO A;  4K88 A;  3LC0 A;  1KOG A;  4YRI A;  2QHS A;  2ZGW A;  3RKY A;  2E1H A;  1WNL A;  2DVE A;  2ZT8 A;  4H2Y A;  3W3S A;  3E9H A;  4YCV A;  1KMN A;  5ELN A;  4J15 A;  1WQW A;  4YRO A;  3VQV A;  2ART A;  2HNI A;  2DJZ A;  5C52 B;  2ZIN A;  1H4Q A;  2CJ9 A;  4P74 C;  4H2S A;  2P0L A;  2AKW A;  2DQ3 A;  2E3C A;  3A7A A;  1J5W A;  1X56 A;  4YRT A;  1VQZ A;  2EJF A;  2DEQ A;  1SER A;  4O2D A;  3BFM A;  3NEL A;  4XEO A;  1KMM A;  4XU3 A;  4WJ3 M;  4YRK A;  3RAC A;  4XU0 A;  3P8Y A;  1NYR A;  2ARS A;  2E65 A;  3RUX A;  4RDX A;  3OD1 A;  4HWT A;  2EAY A;  1EOV A;  4KQE A;  3L4G A;  3ICA A;  4XEM A;  2ALY A;  2Q5H A;  2ZNI A;  4PG3 A;  3RGL A;  3HXW A;  2P5I A;  3PZC A;  3QTC A;  1HTT A;  4P72 C;  2AMC B;  2EJ9 A;  1BIB A;  2DXU A;  1WU7 A;  2ODR D;  4XU2 A;  1G51 A;  2CJB A;  3NEN A;  3CMQ A;  4HWP A;  4AH6 A;  2IY5 B;  2DDZ A;  1JJC B;  4H2T A;  4H2X B;  4YCW A;  1B8A A;  3EFS A;  1NJ1 A;  4P71 C;  3KFU A;  1QF6 A;  3A31 A;  3ERR A;  1YB3 A;  2DTI A;  1B7Y B;  2Q7H A;  2ZZE A;  3HTZ A;  1B7Y A;  2XGT A;  2DZC A;  3L1A A;  4P75 A;  2ZIM A;  1H4T A;  3TEH A;  3I7F A;  4NCX A;  2DU7 A;  1USY C;  3VBB A;  3QNE A;  1YGB A;  3V8K A;  1L0W A;  3V7C A;  4CH5 A;  2E41 A;  3TEG A;  1H4V B;  1WPY A;  4YRM A;  3VQY A;  3HRI A;  3EFR A;  2ZR2 A;  1Z7N A;  2CGH A;  2G4C A;  2Q7G A;  1X01 A;  4DPG A;  2ZZG A;  4P3O A;  2I4O A;  3HFV A;  1E1T A;  3P8T A;  2DZ9 A;  3HXX A;  1SET A;  3LSQ A;  1NNH A;  4UPA A;  4HWO A;  5HGQ A;  5C53 B;  3UGQ A;  2PME A;  3DSQ A;  4TTV A;  1YFT A;  3IG2 A;  3UH0 A;  3RL6 A;  1E24 A;  1RIQ A;  4RQF A;  4YRR A;  1PYS A;  4LVJ A;  4WI1 A;  4ZTU B;  4KR2 A;  2AKW B;  4TWA A;  2ZT5 A;  4UP8 A;  4YYE A;  4PHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...