4P73C

Phers in complex with compound 1a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
251
structure length
239
Chain Sequence
b'AAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanine--tRNA ligase beta subunit
molecule tags Ligase/ligase inhibitor
source organism Pseudomonas aeruginosa
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
total genus 64
structure length 239
sequence length 251
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p73C01
4H2WA 1BBUA 3IKLA 3EFRA 2DXTA 4WI1A 4K87A 4PHCA 4J15A 5K1XA 3QNEA 2IY5B 11ASA 2CJAA 1LYLA 3CMQA 4P75C 4E51A 3HFZB 1X54A 2DTOA 5ELOA 2XTIA 2EJFA 1NJ2A 4UPAA 3R07A 2J3LA 1RIQA 3V7RA 1SERA 2DU5A 2DDZA 2Q7EA 4TVAA 4XTYA 4TVYA 4YROA 4P74C 1Z7MA 4Q6GA 3V7SA 2DZCA 4H2TA 1YB3A 3HXVA 1WYDA 4H2VA 1HXDA 1EIYA 3PCOB 2AKWA 4XTVA 1B70B 4TQFA 5KNNA 3P8TA 5C52B 1WU7A 4YRLA 1PYSA 2P0LA 5K1PA 2ZGWA 1H4VB 1USYC 4TVWA 4L87A 3TUPA 3LC0A 4HWRA 4HWPA 1NNHA 1ATIA 1L0WA 4XU2A 1SESA 4EX5A 3RACA 4G85A 3LSSA 3TEHB 1G51A 3QTCA 4WJ3M 1NYRA 4UP9A 1SETA 1H4QA 2EJ9A 2RHSA 3V8JA 2ZZEA 2ZT5A 3V8LA 4YPFA 3DSQA 1H4SA 2ZT8A 3QO7A 4WF2A 2QHVA 5HGQA 3RKYA 1YFTA 1GGMA 4RDXA 2CIMA 2DKGA 3NEMA 4YRJA 4WJ4A 3VBBA 3HXYA 1J5WA 3A5ZA 3P8VA 4NCXA 1B7YB 3L4GB 3V7CA 1X2GA 1ADYA 3BFMA 4BW9A 3PZCA 2IY5A 3M4PA 2AMCA 2ZIOA 4KQEA 2ZR2A 4YCVA 3RGLA 4P73A 3TEHA 4P71A 4ZIBA 3A31A 4XU1A 2DVEA 2ODRC 2XGTA 3HRIA 4YRTA 4RMFA 1WQWA 2RHSB 3E9HA 1E24A 4H2YA 2E41A 1KMMA 3M4QA 3NENA 1PYSB 4G84A 3RL6A 2E64A 3HXXA 4XU0A 4P72A 1EIYB 1EVLA 2ZNIA 1H4TA 1G5IA 2EAYA 4TQDA 1X55A 3RKWA 2I4LA 2ZINA 3UH0A 1E22A 3A74A 1NJ6A 1ASYA 3HY0A 3VQWA 2Q5IA 1YGBA 3VQXA 3RUXA 4CS2A 2ALYB 2ZZFA 3VQVA 3A7AA 1IL2A 3I7FA 4DQ2A 4ZTUB 4PG3A 3HFZA 1X56A 2ODRD 2AKWB 4Q15A 2CGHA 2PMFA 2DQ3A 2EL9A 3KFUA 1BIBA 4YRQA 3LSQA 2RHQB 3WQZA 3A7UA 4CH3A 4DPGA 1B8AA 4YP0A 4XTXA 4YRNA 3A5YA 3UGTA 5E3IA 1QE0A 4HWSA 1G5HA 2ZT7A 2AMCB 4YRRA 2QHUA 3MF1A 4K88A 3BJUA 4RQEA 4YRFA 1B7YA 3V8KA 1JJCA 4YRMA 2ZNJA 3NETA 1ASZA 2ALYA 4KR2A 3IALA 1JJCB 2G4CA 2ZR3A 2PMEA 4BWAA 2E3CA 4YRCA 4YCUA 4YRPA 2DEQA 2FYKA 3RF1A 4YREA 1W66A 4UP8A 5F5WA 4AH6A 1KMNA 4H2XA 4XTUA 4H2UA 3L2ZA 2DJZA 3REXA 4OP0A 2ZCEA 1N9WA 2C7IA 3ICAA 1NYQA 4CS3A 2ZTGA 1HTTA 3VQYA 2P5IA 4P74A 2ARSA 4XEMA 1FYFA 2J3MA 2EJGA 4HVCA 4EO4A 1C0AA 2ZXFA 3NELA 1WQ7A 3L4GA 3HTZA 4UP7A 4CH4A 3L1AA 3RIRA 4CS4A 3EFSA 3TEGA 3FJPA 4YRIA 1VQZA 1NJ5A 4H2XB 2E5AA 2QHTA 1ADJA 1X2HA 1BIAA 1B70A 4CH6A 3HRKA 2E65A 2DQ0A 1EQRA 1WPYA 1EFWA 4O2DA 2C8MA 3OD1A 4P72C 2DTIA 3A7RA 5C51B 3MEYA 1WLEA 1WNLA 2DTHA 4YRGA 4HA8A 4RQFA 2ARUA 3G1ZA 4TWAA 1Z7NA 4P71C 1KOGA 2ZZGA 4TTVA 3MF2A 1X01A 4XU3A 4KR3A 3HXWA 3HY1A 4YCWA 4P73C 4YRKA 2DU7A 3A32A 3HXZA 2Q7GA 3P8YA 4CH5A 4H2SA 5ELNA 3ERRA 4YRSA 1NJ1A 2I4OA 1QF6A 4OLFA 1EVKA 2I4NA 4XTWA 4HWTA 2ARTA 2DXUA 3IKMB 1B76A 3PCOA 1BBWA 1E1OA 3QO5A 4LNSA 4XTZA 1YFRA 5C53B 2DZ9A 3REUA 4ZTZB 3HXUA 2ZIMA 4X5OA 1E1TA 2I4MA 1SRYA 12ASA 3UFGA 1USYA 2CJ9A 1HC7A 2Q7HA 3HFVA 4YDQA 2E1HA 3IG2A 3E9IA 1NJ8A 2ZT6A 1YFSA 4K86A 4XEOA 4H02A 4YYEA 2Q5HA 3UGQA 4TVAB 2EWNA 4P3PA 2HNIA 3RKXA 2QHSA 3W3SA 4HWOA 2RHQA 2E10A 4P3OA 4P75A 3QO8A 4P3NA 2CJBA 1EOVA
chains in the Genus database with same CATH superfamily
4H2WA 1BBUA 3IKLA 3EFRA 2DXTA 4WI1A 4K87A 4PHCA 4J15A 5K1XA 3QNEA 2IY5B 11ASA 2CJAA 1LYLA 3CMQA 4P75C 4E51A 3HFZB 1X54A 2DTOA 5ELOA 2XTIA 2EJFA 1NJ2A 4UPAA 3R07A 2J3LA 1RIQA 4LVIA 3V7RA 1SERA 2DU5A 2DDZA 2Q7EA 4TVAA 4XTYA 4TVYA 4YROA 4P74C 1Z7MA 4Q6GA 3V7SA 2DZCA 4H2TA 1YB3A 3HXVA 1WYDA 4H2VA 1HXDA 1EIYA 3PCOB 2AKWA 4XTVA 1B70B 4TQFA 5KNNA 3P8TA 5C52B 1WU7A 4YRLA 3MQZA 1PYSA 2P0LA 5K1PA 2ZGWA 1H4VB 1USYC 4TVWA 4L87A 3TUPA 3LC0A 4HWRA 4HWPA 1NNHA 1ATIA 1L0WA 4XU2A 1SESA 4EX5A 3RACA 4G85A 3LSSA 3TEHB 1G51A 3QTCA 4WJ3M 1NYRA 4UP9A 1SETA 1H4QA 2EJ9A 2RHSA 3V8JA 2ZZEA 2ZT5A 3V8LA 4YPFA 3DSQA 1H4SA 2ZT8A 3QO7A 4WF2A 2QHVA 5HGQA 3RKYA 1YFTA 1GGMA 4RDXA 2CIMA 2DKGA 3NEMA 4YRJA 4WJ4A 3VBBA 3HXYA 1J5WA 3A5ZA 3P8VA 4NCXA 1B7YB 3L4GB 3V7CA 1X2GA 1ADYA 3BFMA 4BW9A 3PZCA 2IY5A 3M4PA 2AMCA 2ZIOA 4KQEA 2ZR2A 4YCVA 3RGLA 4P73A 3TEHA 4P71A 4ZIBA 3A31A 4XU1A 2DVEA 2ODRC 2XGTA 3HRIA 4YRTA 4RMFA 1WQWA 2RHSB 3E9HA 1E24A 4H2YA 2E41A 1KMMA 3M4QA 3NENA 1PYSB 4G84A 3RL6A 2E64A 3HXXA 4XU0A 4P72A 1EIYB 1EVLA 2ZNIA 1H4TA 1G5IA 2EAYA 4TQDA 1X55A 3RKWA 2I4LA 2ZINA 3UH0A 1E22A 3A74A 1NJ6A 1ASYA 3HY0A 4LVLA 3VQWA 2Q5IA 1YGBA 3VQXA 3RUXA 4CS2A 2ALYB 2ZZFA 3VQVA 3A7AA 1IL2A 3I7FA 4DQ2A 4ZTUB 4PG3A 3HFZA 1X56A 2ODRD 2AKWB 4Q15A 2CGHA 2PMFA 2DQ3A 2EL9A 3KFUA 1BIBA 4YRQA 3LSQA 2RHQB 3WQZA 3A7UA 4CH3A 4DPGA 1B8AA 4LVJA 4YP0A 4XTXA 4YRNA 3A5YA 3UGTA 5E3IA 1QE0A 4HWSA 1G5HA 2ZT7A 2AMCB 4YRRA 2QHUA 3MF1A 4K88A 3BJUA 4RQEA 4YRFA 1B7YA 3V8KA 1JJCA 4YRMA 2ZNJA 3NETA 1ASZA 2ALYA 4KR2A 3IALA 1JJCB 2G4CA 2ZR3A 2PMEA 4BWAA 2E3CA 4HT4A 4YRCA 4YCUA 4YRPA 2DEQA 2FYKA 3RF1A 4YREA 1W66A 4UP8A 5F5WA 4AH6A 1KMNA 4H2XA 4XTUA 4H2UA 3L2ZA 2DJZA 2A8EA 3REXA 4OP0A 2ZCEA 1N9WA 2C7IA 3ICAA 1NYQA 4CS3A 2ZTGA 1HTTA 3VQYA 2P5IA 4P74A 2ARSA 4XEMA 1FYFA 2J3MA 2EJGA 2NS6A 4HVCA 4EO4A 1C0AA 2ZXFA 3NELA 1WQ7A 3L4GA 3HTZA 4UP7A 4CH4A 3L1AA 3RIRA 4CS4A 3EFSA 3TEGA 3FJPA 4YRIA 1VQZA 1NJ5A 4H2XB 2E5AA 2QHTA 1ADJA 1X2HA 1BIAA 1B70A 4CH6A 3HRKA 2E65A 2DQ0A 1EQRA 1WPYA 1EFWA 4O2DA 2C8MA 3OD1A 4P72C 2DTIA 3A7RA 5C51B 3MEYA 1WLEA 1WNLA 2DTHA 4YRGA 4HA8A 4RQFA 2ARUA 3G1ZA 4TWAA 1Z7NA 4P71C 1KOGA 2ZZGA 4TTVA 3MF2A 1X01A 4XU3A 4KR3A 3HXWA 3HY1A 4YCWA 4P73C 4YRKA 2DU7A 3A32A 3HXZA 2Q7GA 3P8YA 4CH5A 4H2SA 5ELNA 3ERRA 4YRSA 1NJ1A 2I4OA 1QF6A 4OLFA 1EVKA 2I4NA 4XTWA 4HWTA 2ARTA 2DXUA 3IKMB 1B76A 3PCOA 1BBWA 1E1OA 3QO5A 4LNSA 4XTZA 4LVMA 1YFRA 5C53B 2DZ9A 3REUA 4ZTZB 3HXUA 2ZIMA 4X5OA 1E1TA 2I4MA 1SRYA 12ASA 3UFGA 1USYA 2CJ9A 1HC7A 2Q7HA 3HFVA 4YDQA 2E1HA 3IG2A 3E9IA 1NJ8A 2ZT6A 1YFSA 4K86A 4XEOA 4H02A 4YYEA 2Q5HA 3UGQA 4TVAB 2EWNA 4P3PA 4LVKA 2HNIA 3RKXA 2QHSA 3W3SA 4HWOA 2RHQA 2E10A 4P3OA 4P75A 3QO8A 4P3NA 2CJBA 1EOVA
chains in the Genus database with same CATH topology
4H2WA 1BBUA 3IKLA 3EFRA 2DXTA 4WI1A 4K87A 4PHCA 4J15A 5K1XA 3QNEA 2IY5B 11ASA 2CJAA 1LYLA 3CMQA 4P75C 4E51A 3HFZB 1X54A 2DTOA 5ELOA 2XTIA 2EJFA 1NJ2A 4UPAA 3R07A 2J3LA 1RIQA 4LVIA 3V7RA 1SERA 2DU5A 2DDZA 2Q7EA 4TVAA 4XTYA 4TVYA 4YROA 4P74C 1Z7MA 4Q6GA 3V7SA 2DZCA 4H2TA 1YB3A 3HXVA 1WYDA 4H2VA 1HXDA 1EIYA 3PCOB 2AKWA 4XTVA 1B70B 4TQFA 5KNNA 3P8TA 5C52B 1WU7A 4YRLA 3MQZA 1PYSA 2P0LA 5K1PA 2ZGWA 1H4VB 1USYC 4TVWA 4L87A 3TUPA 3LC0A 4HWRA 4HWPA 1NNHA 1ATIA 1L0WA 4XU2A 1SESA 4EX5A 3RACA 4G85A 3LSSA 3TEHB 1G51A 3QTCA 4WJ3M 1NYRA 4UP9A 1SETA 1H4QA 2EJ9A 2RHSA 3V8JA 2ZZEA 2ZT5A 3V8LA 4YPFA 3DSQA 1H4SA 2ZT8A 3QO7A 4WF2A 2QHVA 5HGQA 3RKYA 1YFTA 1GGMA 4RDXA 2CIMA 2DKGA 3NEMA 4YRJA 4WJ4A 3VBBA 3HXYA 1J5WA 3A5ZA 3P8VA 4NCXA 1B7YB 3L4GB 3V7CA 1X2GA 1ADYA 3BFMA 4BW9A 3PZCA 2IY5A 3M4PA 2AMCA 2ZIOA 4KQEA 2ZR2A 4YCVA 3RGLA 4P73A 3TEHA 4P71A 4ZIBA 3A31A 4XU1A 2DVEA 2ODRC 2XGTA 3HRIA 4YRTA 4RMFA 1WQWA 2RHSB 3E9HA 1E24A 4H2YA 2E41A 1KMMA 3M4QA 3NENA 1PYSB 4G84A 3RL6A 2E64A 3HXXA 4XU0A 4P72A 1EIYB 1EVLA 2ZNIA 1H4TA 1G5IA 2EAYA 4TQDA 1X55A 3RKWA 2I4LA 2ZINA 3UH0A 1E22A 3A74A 1NJ6A 1ASYA 3HY0A 4LVLA 3VQWA 2Q5IA 1YGBA 3VQXA 3RUXA 4CS2A 2ALYB 2ZZFA 3VQVA 3A7AA 1IL2A 3I7FA 4DQ2A 4ZTUB 4PG3A 3HFZA 1X56A 2ODRD 2AKWB 4Q15A 2CGHA 2PMFA 2DQ3A 2EL9A 3KFUA 1BIBA 4YRQA 3LSQA 2RHQB 3WQZA 3A7UA 4CH3A 4DPGA 1B8AA 4LVJA 4YP0A 4XTXA 4YRNA 3A5YA 3UGTA 5E3IA 1QE0A 4HWSA 1G5HA 2ZT7A 2AMCB 4YRRA 2QHUA 3MF1A 4K88A 3BJUA 4RQEA 4YRFA 1B7YA 3V8KA 1JJCA 4YRMA 2ZNJA 3NETA 1ASZA 2ALYA 4KR2A 3IALA 1JJCB 2G4CA 2ZR3A 2PMEA 4BWAA 2E3CA 4HT4A 4YRCA 4YCUA 4YRPA 2DEQA 2FYKA 3RF1A 4YREA 1W66A 4UP8A 5F5WA 4AH6A 1KMNA 4H2XA 4XTUA 4H2UA 3L2ZA 2DJZA 2A8EA 3REXA 4OP0A 2ZCEA 1N9WA 2C7IA 3ICAA 1NYQA 4CS3A 2ZTGA 1HTTA 3VQYA 2P5IA 4P74A 2ARSA 4XEMA 1FYFA 2J3MA 2EJGA 2NS6A 4HVCA 4EO4A 1C0AA 2ZXFA 3NELA 1WQ7A 3L4GA 3HTZA 4UP7A 4CH4A 3L1AA 3RIRA 4CS4A 3EFSA 3TEGA 3FJPA 4YRIA 1VQZA 1NJ5A 4H2XB 2E5AA 2QHTA 1ADJA 1X2HA 1BIAA 1B70A 4CH6A 3HRKA 2E65A 2DQ0A 1EQRA 1WPYA 1EFWA 4O2DA 2C8MA 3OD1A 4P72C 2DTIA 3A7RA 5C51B 3MEYA 1WLEA 1WNLA 2DTHA 4YRGA 4HA8A 4RQFA 2ARUA 3G1ZA 4TWAA 1Z7NA 4P71C 1KOGA 2ZZGA 4TTVA 3MF2A 1X01A 4XU3A 4KR3A 3HXWA 3HY1A 4YCWA 4P73C 4YRKA 2DU7A 3A32A 3HXZA 2Q7GA 3P8YA 4CH5A 4H2SA 5ELNA 3ERRA 4YRSA 1NJ1A 2I4OA 1QF6A 4OLFA 1EVKA 2I4NA 4XTWA 4HWTA 2ARTA 2DXUA 3IKMB 1B76A 3PCOA 1BBWA 1E1OA 3QO5A 4LNSA 4XTZA 4LVMA 1YFRA 5C53B 2DZ9A 3REUA 4ZTZB 3HXUA 2ZIMA 4X5OA 1E1TA 2I4MA 1SRYA 12ASA 3UFGA 1USYA 2CJ9A 1HC7A 2Q7HA 3HFVA 4YDQA 2E1HA 3IG2A 3E9IA 1NJ8A 2ZT6A 1YFSA 4K86A 4XEOA 4H02A 4YYEA 2Q5HA 3UGQA 4TVAB 2EWNA 4P3PA 4LVKA 2HNIA 3RKXA 2QHSA 3W3SA 4HWOA 2RHQA 2E10A 4P3OA 4P75A 3QO8A 4P3NA 2CJBA 1EOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2W A;  1BBU A;  3IKL A;  3EFR A;  2DXT A;  4WI1 A;  4K87 A;  4PHC A;  4J15 A;  5K1X A;  3QNE A;  2IY5 B;  11AS A;  2CJA A;  1LYL A;  3CMQ A;  4P75 C;  4E51 A;  3HFZ B;  1X54 A;  2DTO A;  5ELO A;  2XTI A;  2EJF A;  1NJ2 A;  4UPA A;  3R07 A;  2J3L A;  1RIQ A;  3V7R A;  1SER A;  2DU5 A;  2DDZ A;  2Q7E A;  4TVA A;  4XTY A;  4TVY A;  4YRO A;  4P74 C;  1Z7M A;  4Q6G A;  3V7S A;  2DZC A;  4H2T A;  1YB3 A;  3HXV A;  1WYD A;  4H2V A;  1HXD A;  1EIY A;  3PCO B;  2AKW A;  4XTV A;  1B70 B;  4TQF A;  5KNN A;  3P8T A;  5C52 B;  1WU7 A;  4YRL A;  1PYS A;  2P0L A;  5K1P A;  2ZGW A;  1H4V B;  1USY C;  4TVW A;  4L87 A;  3TUP A;  3LC0 A;  4HWR A;  4HWP A;  1NNH A;  1ATI A;  1L0W A;  4XU2 A;  1SES A;  4EX5 A;  3RAC A;  4G85 A;  3LSS A;  3TEH B;  1G51 A;  3QTC A;  4WJ3 M;  1NYR A;  4UP9 A;  1SET A;  1H4Q A;  2EJ9 A;  2RHS A;  3V8J A;  2ZZE A;  2ZT5 A;  3V8L A;  4YPF A;  3DSQ A;  1H4S A;  2ZT8 A;  3QO7 A;  4WF2 A;  2QHV A;  5HGQ A;  3RKY A;  1YFT A;  1GGM A;  4RDX A;  2CIM A;  2DKG A;  3NEM A;  4YRJ A;  4WJ4 A;  3VBB A;  3HXY A;  1J5W A;  3A5Z A;  3P8V A;  4NCX A;  1B7Y B;  3L4G B;  3V7C A;  1X2G A;  1ADY A;  3BFM A;  4BW9 A;  3PZC A;  2IY5 A;  3M4P A;  2AMC A;  2ZIO A;  4KQE A;  2ZR2 A;  4YCV A;  3RGL A;  4P73 A;  3TEH A;  4P71 A;  4ZIB A;  3A31 A;  4XU1 A;  2DVE A;  2ODR C;  2XGT A;  3HRI A;  4YRT A;  4RMF A;  1WQW A;  2RHS B;  3E9H A;  1E24 A;  4H2Y A;  2E41 A;  1KMM A;  3M4Q A;  3NEN A;  1PYS B;  4G84 A;  3RL6 A;  2E64 A;  3HXX A;  4XU0 A;  4P72 A;  1EIY B;  1EVL A;  2ZNI A;  1H4T A;  1G5I A;  2EAY A;  4TQD A;  1X55 A;  3RKW A;  2I4L A;  2ZIN A;  3UH0 A;  1E22 A;  3A74 A;  1NJ6 A;  1ASY A;  3HY0 A;  3VQW A;  2Q5I A;  1YGB A;  3VQX A;  3RUX A;  4CS2 A;  2ALY B;  2ZZF A;  3VQV A;  3A7A A;  1IL2 A;  3I7F A;  4DQ2 A;  4ZTU B;  4PG3 A;  3HFZ A;  1X56 A;  2ODR D;  2AKW B;  4Q15 A;  2CGH A;  2PMF A;  2DQ3 A;  2EL9 A;  3KFU A;  1BIB A;  4YRQ A;  3LSQ A;  2RHQ B;  3WQZ A;  3A7U A;  4CH3 A;  4DPG A;  1B8A A;  4YP0 A;  4XTX A;  4YRN A;  3A5Y A;  3UGT A;  5E3I A;  1QE0 A;  4HWS A;  1G5H A;  2ZT7 A;  2AMC B;  4YRR A;  2QHU A;  3MF1 A;  4K88 A;  3BJU A;  4RQE A;  4YRF A;  1B7Y A;  3V8K A;  1JJC A;  4YRM A;  2ZNJ A;  3NET A;  1ASZ A;  2ALY A;  4KR2 A;  3IAL A;  1JJC B;  2G4C A;  2ZR3 A;  2PME A;  4BWA A;  2E3C A;  4YRC A;  4YCU A;  4YRP A;  2DEQ A;  2FYK A;  3RF1 A;  4YRE A;  1W66 A;  4UP8 A;  5F5W A;  4AH6 A;  1KMN A;  4H2X A;  4XTU A;  4H2U A;  3L2Z A;  2DJZ A;  3REX A;  4OP0 A;  2ZCE A;  1N9W A;  2C7I A;  3ICA A;  1NYQ A;  4CS3 A;  2ZTG A;  1HTT A;  3VQY A;  2P5I A;  4P74 A;  2ARS A;  4XEM A;  1FYF A;  2J3M A;  2EJG A;  4HVC A;  4EO4 A;  1C0A A;  2ZXF A;  3NEL A;  1WQ7 A;  3L4G A;  3HTZ A;  4UP7 A;  4CH4 A;  3L1A A;  3RIR A;  4CS4 A;  3EFS A;  3TEG A;  3FJP A;  4YRI A;  1VQZ A;  1NJ5 A;  4H2X B;  2E5A A;  2QHT A;  1ADJ A;  1X2H A;  1BIA A;  1B70 A;  4CH6 A;  3HRK A;  2E65 A;  2DQ0 A;  1EQR A;  1WPY A;  1EFW A;  4O2D A;  2C8M A;  3OD1 A;  4P72 C;  2DTI A;  3A7R A;  5C51 B;  3MEY A;  1WLE A;  1WNL A;  2DTH A;  4YRG A;  4HA8 A;  4RQF A;  2ARU A;  3G1Z A;  4TWA A;  1Z7N A;  4P71 C;  1KOG A;  2ZZG A;  4TTV A;  3MF2 A;  1X01 A;  4XU3 A;  4KR3 A;  3HXW A;  3HY1 A;  4YCW A;  4P73 C;  4YRK A;  2DU7 A;  3A32 A;  3HXZ A;  2Q7G A;  3P8Y A;  4CH5 A;  4H2S A;  5ELN A;  3ERR A;  4YRS A;  1NJ1 A;  2I4O A;  1QF6 A;  4OLF A;  1EVK A;  2I4N A;  4XTW A;  4HWT A;  2ART A;  2DXU A;  3IKM B;  1B76 A;  3PCO A;  1BBW A;  1E1O A;  3QO5 A;  4LNS A;  4XTZ A;  1YFR A;  5C53 B;  2DZ9 A;  3REU A;  4ZTZ B;  3HXU A;  2ZIM A;  4X5O A;  1E1T A;  2I4M A;  1SRY A;  12AS A;  3UFG A;  1USY A;  2CJ9 A;  1HC7 A;  2Q7H A;  3HFV A;  4YDQ A;  2E1H A;  3IG2 A;  3E9I A;  1NJ8 A;  2ZT6 A;  1YFS A;  4K86 A;  4XEO A;  4H02 A;  4YYE A;  2Q5H A;  3UGQ A;  4TVA B;  2EWN A;  4P3P A;  2HNI A;  3RKX A;  2QHS A;  3W3S A;  4HWO A;  2RHQ A;  2E10 A;  4P3O A;  4P75 A;  3QO8 A;  4P3N A;  2CJB A;  1EOV A; 
#chains in the Genus database with same CATH topology
 4H2W A;  1BBU A;  3IKL A;  3EFR A;  2DXT A;  4WI1 A;  4K87 A;  4PHC A;  4J15 A;  5K1X A;  3QNE A;  2IY5 B;  11AS A;  2CJA A;  1LYL A;  3CMQ A;  4P75 C;  4E51 A;  3HFZ B;  1X54 A;  2DTO A;  5ELO A;  2XTI A;  2EJF A;  1NJ2 A;  4UPA A;  3R07 A;  2J3L A;  1RIQ A;  4LVI A;  3V7R A;  1SER A;  2DU5 A;  2DDZ A;  2Q7E A;  4TVA A;  4XTY A;  4TVY A;  4YRO A;  4P74 C;  1Z7M A;  4Q6G A;  3V7S A;  2DZC A;  4H2T A;  1YB3 A;  3HXV A;  1WYD A;  4H2V A;  1HXD A;  1EIY A;  3PCO B;  2AKW A;  4XTV A;  1B70 B;  4TQF A;  5KNN A;  3P8T A;  5C52 B;  1WU7 A;  4YRL A;  3MQZ A;  1PYS A;  2P0L A;  5K1P A;  2ZGW A;  1H4V B;  1USY C;  4TVW A;  4L87 A;  3TUP A;  3LC0 A;  4HWR A;  4HWP A;  1NNH A;  1ATI A;  1L0W A;  4XU2 A;  1SES A;  4EX5 A;  3RAC A;  4G85 A;  3LSS A;  3TEH B;  1G51 A;  3QTC A;  4WJ3 M;  1NYR A;  4UP9 A;  1SET A;  1H4Q A;  2EJ9 A;  2RHS A;  3V8J A;  2ZZE A;  2ZT5 A;  3V8L A;  4YPF A;  3DSQ A;  1H4S A;  2ZT8 A;  3QO7 A;  4WF2 A;  2QHV A;  5HGQ A;  3RKY A;  1YFT A;  1GGM A;  4RDX A;  2CIM A;  2DKG A;  3NEM A;  4YRJ A;  4WJ4 A;  3VBB A;  3HXY A;  1J5W A;  3A5Z A;  3P8V A;  4NCX A;  1B7Y B;  3L4G B;  3V7C A;  1X2G A;  1ADY A;  3BFM A;  4BW9 A;  3PZC A;  2IY5 A;  3M4P A;  2AMC A;  2ZIO A;  4KQE A;  2ZR2 A;  4YCV A;  3RGL A;  4P73 A;  3TEH A;  4P71 A;  4ZIB A;  3A31 A;  4XU1 A;  2DVE A;  2ODR C;  2XGT A;  3HRI A;  4YRT A;  4RMF A;  1WQW A;  2RHS B;  3E9H A;  1E24 A;  4H2Y A;  2E41 A;  1KMM A;  3M4Q A;  3NEN A;  1PYS B;  4G84 A;  3RL6 A;  2E64 A;  3HXX A;  4XU0 A;  4P72 A;  1EIY B;  1EVL A;  2ZNI A;  1H4T A;  1G5I A;  2EAY A;  4TQD A;  1X55 A;  3RKW A;  2I4L A;  2ZIN A;  3UH0 A;  1E22 A;  3A74 A;  1NJ6 A;  1ASY A;  3HY0 A;  4LVL A;  3VQW A;  2Q5I A;  1YGB A;  3VQX A;  3RUX A;  4CS2 A;  2ALY B;  2ZZF A;  3VQV A;  3A7A A;  1IL2 A;  3I7F A;  4DQ2 A;  4ZTU B;  4PG3 A;  3HFZ A;  1X56 A;  2ODR D;  2AKW B;  4Q15 A;  2CGH A;  2PMF A;  2DQ3 A;  2EL9 A;  3KFU A;  1BIB A;  4YRQ A;  3LSQ A;  2RHQ B;  3WQZ A;  3A7U A;  4CH3 A;  4DPG A;  1B8A A;  4LVJ A;  4YP0 A;  4XTX A;  4YRN A;  3A5Y A;  3UGT A;  5E3I A;  1QE0 A;  4HWS A;  1G5H A;  2ZT7 A;  2AMC B;  4YRR A;  2QHU A;  3MF1 A;  4K88 A;  3BJU A;  4RQE A;  4YRF A;  1B7Y A;  3V8K A;  1JJC A;  4YRM A;  2ZNJ A;  3NET A;  1ASZ A;  2ALY A;  4KR2 A;  3IAL A;  1JJC B;  2G4C A;  2ZR3 A;  2PME A;  4BWA A;  2E3C A;  4HT4 A;  4YRC A;  4YCU A;  4YRP A;  2DEQ A;  2FYK A;  3RF1 A;  4YRE A;  1W66 A;  4UP8 A;  5F5W A;  4AH6 A;  1KMN A;  4H2X A;  4XTU A;  4H2U A;  3L2Z A;  2DJZ A;  2A8E A;  3REX A;  4OP0 A;  2ZCE A;  1N9W A;  2C7I A;  3ICA A;  1NYQ A;  4CS3 A;  2ZTG A;  1HTT A;  3VQY A;  2P5I A;  4P74 A;  2ARS A;  4XEM A;  1FYF A;  2J3M A;  2EJG A;  2NS6 A;  4HVC A;  4EO4 A;  1C0A A;  2ZXF A;  3NEL A;  1WQ7 A;  3L4G A;  3HTZ A;  4UP7 A;  4CH4 A;  3L1A A;  3RIR A;  4CS4 A;  3EFS A;  3TEG A;  3FJP A;  4YRI A;  1VQZ A;  1NJ5 A;  4H2X B;  2E5A A;  2QHT A;  1ADJ A;  1X2H A;  1BIA A;  1B70 A;  4CH6 A;  3HRK A;  2E65 A;  2DQ0 A;  1EQR A;  1WPY A;  1EFW A;  4O2D A;  2C8M A;  3OD1 A;  4P72 C;  2DTI A;  3A7R A;  5C51 B;  3MEY A;  1WLE A;  1WNL A;  2DTH A;  4YRG A;  4HA8 A;  4RQF A;  2ARU A;  3G1Z A;  4TWA A;  1Z7N A;  4P71 C;  1KOG A;  2ZZG A;  4TTV A;  3MF2 A;  1X01 A;  4XU3 A;  4KR3 A;  3HXW A;  3HY1 A;  4YCW A;  4P73 C;  4YRK A;  2DU7 A;  3A32 A;  3HXZ A;  2Q7G A;  3P8Y A;  4CH5 A;  4H2S A;  5ELN A;  3ERR A;  4YRS A;  1NJ1 A;  2I4O A;  1QF6 A;  4OLF A;  1EVK A;  2I4N A;  4XTW A;  4HWT A;  2ART A;  2DXU A;  3IKM B;  1B76 A;  3PCO A;  1BBW A;  1E1O A;  3QO5 A;  4LNS A;  4XTZ A;  4LVM A;  1YFR A;  5C53 B;  2DZ9 A;  3REU A;  4ZTZ B;  3HXU A;  2ZIM A;  4X5O A;  1E1T A;  2I4M A;  1SRY A;  12AS A;  3UFG A;  1USY A;  2CJ9 A;  1HC7 A;  2Q7H A;  3HFV A;  4YDQ A;  2E1H A;  3IG2 A;  3E9I A;  1NJ8 A;  2ZT6 A;  1YFS A;  4K86 A;  4XEO A;  4H02 A;  4YYE A;  2Q5H A;  3UGQ A;  4TVA B;  2EWN A;  4P3P A;  4LVK A;  2HNI A;  3RKX A;  2QHS A;  3W3S A;  4HWO A;  2RHQ A;  2E10 A;  4P3O A;  4P75 A;  3QO8 A;  4P3N A;  2CJB A;  1EOV A; 
#chains in the Genus database with same CATH homology
 4H2W A;  1BBU A;  3IKL A;  3EFR A;  2DXT A;  4WI1 A;  4K87 A;  4PHC A;  4J15 A;  5K1X A;  3QNE A;  2IY5 B;  11AS A;  2CJA A;  1LYL A;  3CMQ A;  4P75 C;  4E51 A;  3HFZ B;  1X54 A;  2DTO A;  5ELO A;  2XTI A;  2EJF A;  1NJ2 A;  4UPA A;  3R07 A;  2J3L A;  1RIQ A;  4LVI A;  3V7R A;  1SER A;  2DU5 A;  2DDZ A;  2Q7E A;  4TVA A;  4XTY A;  4TVY A;  4YRO A;  4P74 C;  1Z7M A;  4Q6G A;  3V7S A;  2DZC A;  4H2T A;  1YB3 A;  3HXV A;  1WYD A;  4H2V A;  1HXD A;  1EIY A;  3PCO B;  2AKW A;  4XTV A;  1B70 B;  4TQF A;  5KNN A;  3P8T A;  5C52 B;  1WU7 A;  4YRL A;  3MQZ A;  1PYS A;  2P0L A;  5K1P A;  2ZGW A;  1H4V B;  1USY C;  4TVW A;  4L87 A;  3TUP A;  3LC0 A;  4HWR A;  4HWP A;  1NNH A;  1ATI A;  1L0W A;  4XU2 A;  1SES A;  4EX5 A;  3RAC A;  4G85 A;  3LSS A;  3TEH B;  1G51 A;  3QTC A;  4WJ3 M;  1NYR A;  4UP9 A;  1SET A;  1H4Q A;  2EJ9 A;  2RHS A;  3V8J A;  2ZZE A;  2ZT5 A;  3V8L A;  4YPF A;  3DSQ A;  1H4S A;  2ZT8 A;  3QO7 A;  4WF2 A;  2QHV A;  5HGQ A;  3RKY A;  1YFT A;  1GGM A;  4RDX A;  2CIM A;  2DKG A;  3NEM A;  4YRJ A;  4WJ4 A;  3VBB A;  3HXY A;  1J5W A;  3A5Z A;  3P8V A;  4NCX A;  1B7Y B;  3L4G B;  3V7C A;  1X2G A;  1ADY A;  3BFM A;  4BW9 A;  3PZC A;  2IY5 A;  3M4P A;  2AMC A;  2ZIO A;  4KQE A;  2ZR2 A;  4YCV A;  3RGL A;  4P73 A;  3TEH A;  4P71 A;  4ZIB A;  3A31 A;  4XU1 A;  2DVE A;  2ODR C;  2XGT A;  3HRI A;  4YRT A;  4RMF A;  1WQW A;  2RHS B;  3E9H A;  1E24 A;  4H2Y A;  2E41 A;  1KMM A;  3M4Q A;  3NEN A;  1PYS B;  4G84 A;  3RL6 A;  2E64 A;  3HXX A;  4XU0 A;  4P72 A;  1EIY B;  1EVL A;  2ZNI A;  1H4T A;  1G5I A;  2EAY A;  4TQD A;  1X55 A;  3RKW A;  2I4L A;  2ZIN A;  3UH0 A;  1E22 A;  3A74 A;  1NJ6 A;  1ASY A;  3HY0 A;  4LVL A;  3VQW A;  2Q5I A;  1YGB A;  3VQX A;  3RUX A;  4CS2 A;  2ALY B;  2ZZF A;  3VQV A;  3A7A A;  1IL2 A;  3I7F A;  4DQ2 A;  4ZTU B;  4PG3 A;  3HFZ A;  1X56 A;  2ODR D;  2AKW B;  4Q15 A;  2CGH A;  2PMF A;  2DQ3 A;  2EL9 A;  3KFU A;  1BIB A;  4YRQ A;  3LSQ A;  2RHQ B;  3WQZ A;  3A7U A;  4CH3 A;  4DPG A;  1B8A A;  4LVJ A;  4YP0 A;  4XTX A;  4YRN A;  3A5Y A;  3UGT A;  5E3I A;  1QE0 A;  4HWS A;  1G5H A;  2ZT7 A;  2AMC B;  4YRR A;  2QHU A;  3MF1 A;  4K88 A;  3BJU A;  4RQE A;  4YRF A;  1B7Y A;  3V8K A;  1JJC A;  4YRM A;  2ZNJ A;  3NET A;  1ASZ A;  2ALY A;  4KR2 A;  3IAL A;  1JJC B;  2G4C A;  2ZR3 A;  2PME A;  4BWA A;  2E3C A;  4HT4 A;  4YRC A;  4YCU A;  4YRP A;  2DEQ A;  2FYK A;  3RF1 A;  4YRE A;  1W66 A;  4UP8 A;  5F5W A;  4AH6 A;  1KMN A;  4H2X A;  4XTU A;  4H2U A;  3L2Z A;  2DJZ A;  2A8E A;  3REX A;  4OP0 A;  2ZCE A;  1N9W A;  2C7I A;  3ICA A;  1NYQ A;  4CS3 A;  2ZTG A;  1HTT A;  3VQY A;  2P5I A;  4P74 A;  2ARS A;  4XEM A;  1FYF A;  2J3M A;  2EJG A;  2NS6 A;  4HVC A;  4EO4 A;  1C0A A;  2ZXF A;  3NEL A;  1WQ7 A;  3L4G A;  3HTZ A;  4UP7 A;  4CH4 A;  3L1A A;  3RIR A;  4CS4 A;  3EFS A;  3TEG A;  3FJP A;  4YRI A;  1VQZ A;  1NJ5 A;  4H2X B;  2E5A A;  2QHT A;  1ADJ A;  1X2H A;  1BIA A;  1B70 A;  4CH6 A;  3HRK A;  2E65 A;  2DQ0 A;  1EQR A;  1WPY A;  1EFW A;  4O2D A;  2C8M A;  3OD1 A;  4P72 C;  2DTI A;  3A7R A;  5C51 B;  3MEY A;  1WLE A;  1WNL A;  2DTH A;  4YRG A;  4HA8 A;  4RQF A;  2ARU A;  3G1Z A;  4TWA A;  1Z7N A;  4P71 C;  1KOG A;  2ZZG A;  4TTV A;  3MF2 A;  1X01 A;  4XU3 A;  4KR3 A;  3HXW A;  3HY1 A;  4YCW A;  4P73 C;  4YRK A;  2DU7 A;  3A32 A;  3HXZ A;  2Q7G A;  3P8Y A;  4CH5 A;  4H2S A;  5ELN A;  3ERR A;  4YRS A;  1NJ1 A;  2I4O A;  1QF6 A;  4OLF A;  1EVK A;  2I4N A;  4XTW A;  4HWT A;  2ART A;  2DXU A;  3IKM B;  1B76 A;  3PCO A;  1BBW A;  1E1O A;  3QO5 A;  4LNS A;  4XTZ A;  4LVM A;  1YFR A;  5C53 B;  2DZ9 A;  3REU A;  4ZTZ B;  3HXU A;  2ZIM A;  4X5O A;  1E1T A;  2I4M A;  1SRY A;  12AS A;  3UFG A;  1USY A;  2CJ9 A;  1HC7 A;  2Q7H A;  3HFV A;  4YDQ A;  2E1H A;  3IG2 A;  3E9I A;  1NJ8 A;  2ZT6 A;  1YFS A;  4K86 A;  4XEO A;  4H02 A;  4YYE A;  2Q5H A;  3UGQ A;  4TVA B;  2EWN A;  4P3P A;  4LVK A;  2HNI A;  3RKX A;  2QHS A;  3W3S A;  4HWO A;  2RHQ A;  2E10 A;  4P3O A;  4P75 A;  3QO8 A;  4P3N A;  2CJB A;  1EOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...