4P73C

Phers in complex with compound 1a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
251
structure length
239
Chain Sequence
AAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
molecule keywords Phenylalanine--tRNA ligase beta subunit
total genus 64
structure length 239
sequence length 251
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p73C01
4P3NA 3REXA 4XU0A 2C8MA 2P0LA 4XTVA 2DU5A 1X2HA 1X01A 4ZTZB 2RHQB 4LNSA 3V7RA 1YFTA 2ODRD 4XU3A 2DXUA 1SERA 4YDQA 4DQ2A 1BBUA 1BIBA 4G84A 3TUPA 4YYEA 4WJ3M 3E9HA 1WPYA 3P8TA 4P73C 4H2YA 1N9WA 2DU7A 1G5HA 4P74A 3RL6A 3HXUA 5C52B 4CS3A 1EFWA 2ZZGA 1NJ1A 3IALA 5HGQA 3VQWA 3A5YA 2QHSA 3L1AA 3RGLA 2ALYA 1ADYA 5C51B 3VBBA 4H2WA 4H2TA 4TQDA 4L87A 2IY5B 1EVKA 2HNIA 2DTOA 2Q7EA 2E3CA 3TEHB 4OP0A 4P72C 3A7RA 5C53B 3V7CA 2ZT6A 2RHSB 1X54A 4EO4A 1IL2A 2Q5HA 3P8YA 1KOGA 4RQFA 3UGTA 2EL9A 4E51A 2ARSA 3V8KA 4CH6A 4HWRA 3HXXA 4XTXA 2I4LA 2DZ9A 2ZTGA 4H2VA 4XTYA 1WLEA 1C0AA 1J5WA 1WU7A 3IG2A 4YRKA 1ADJA 3ERRA 2QHUA 1PYSB 2ALYB 1SRYA 4AH6A 2ZNIA 2E1HA 4BWAA 4ZIBA 2J3LA 2E65A 4YCWA 4YRQA 2ZXFA 1B70B 1H4SA 2ZZEA 3A32A 2ZR3A 1L0WA 3RKXA 3TEHA 4K86A 4P71A 1SESA 4OLFA 4H2UA 1BBWA 3HXYA 4WJ4A 3HRKA 3QO8A 3A5ZA 5F5WA 2EWNA 4YROA 1NYRA 2FYKA 3VQVA 5ELOA 5E3IA 4P72A 3W3SA 2ZT5A 4P3PA 3UGQA 3I7FA 3HFVA 4UP8A 2E10A 3RF1A 1B7YA 3HTZA 4YP0A 2DDZA 1HXDA 2P5IA 1NJ6A 4KR3A 1WQWA 3M4PA 4XTUA 2DQ0A 2ZINA 3BJUA 4CS4A 2I4OA 1E1OA 2RHSA 4HWPA 3HXZA 2I4NA 1HC7A 4EX5A 4P75C 1H4TA 3E9IA 1X55A 4YRMA 1G5IA 3HY1A 2ZGWA 1LYLA 4YRCA 3UH0A 3QTCA 3RACA 4K87A 3EFSA 4P3OA 4XEMA 4YRTA 3TEGA 4H2XA 4TQFA 1E22A 1YB3A 1YGBA 2E5AA 1Z7NA 4XU1A 1JJCA 3DSQA 3VQXA 2AKWA 4YRJA 4YCVA 1KMNA 3MEYA 2DEQA 4YRNA 4H02A 2PMEA 1QF6A 1EIYA 2AMCA 11ASA 3IKMB 4K88A 2Q7GA 4YRIA 1NNHA 4YRLA 1WNLA 3PZCA 4O2DA 2ZZFA 4HWTA 2DKGA 3LC0A 2C7IA 4X5OA 2QHTA 3QNEA 1WYDA 1X2GA 4ZTUB 1NJ8A 4HWSA 4CH3A 3IKLA 4YRGA 1RIQA 1W66A 3G1ZA 4UPAA 4KQEA 4YPFA 1YFRA 4TVAB 2EJGA 2XTIA 3V8JA 1NJ2A 3V8LA 3REUA 2Q7HA 4RQEA 2G4CA 5KNNA 4TVAA 4YRPA 3PCOB 4PHCA 3HFZA 1EVLA 1HTTA 3CMQA 3PCOA 3A74A 4HWOA 5K1XA 1Z7MA 3P8VA 3WQZA 1EQRA 1KMMA 1ASYA 2ZIOA 3FJPA 4YREA 2E41A 5K1PA 3MF1A 2EJ9A 1ASZA 2DJZA 3V7SA 2DTIA 1JJCB 3M4QA 3HXVA 4XU2A 3LSQA 3BFMA 2AKWB 1H4VB 4P71C 1WQ7A 1USYA 4CH4A 2ZT7A 1ATIA 12ASA 4TVYA 1EIYB 1VQZA 3RIRA 4YRFA 1FYFA 4H2SA 2ZR2A 3L4GB 1SETA 4HA8A 3A7AA 2QHVA 2AMCB 2CGHA 1USYC 2ODRC 4TTVA 2ARTA 3R07A 3EFRA 4UP7A 2RHQA 4WF2A 2PMFA 3ICAA 1E1TA 3OD1A 2ZNJA 2ARUA 2XGTA 1PYSA 3L2ZA 3HXWA 4TWAA 1QE0A 4Q15A 3NEMA 1GGMA 2ZCEA 3UFGA 1NYQA 3NETA 4YRSA 3HY0A 4WI1A 1E24A 5ELNA 2ZIMA 4UP9A 4YRRA 3NELA 4PG3A 4KR2A 1YFSA 2E64A 4BW9A 2CJAA 4J15A 1G51A 3RKWA 2DQ3A 1NJ5A 4XTWA 4NCXA 2DVEA 4Q6GA 1BIAA 4G85A 1H4QA 1B70A 1EOVA 2CJ9A 3HFZB 4RDXA 3VQYA 3L4GA 4TVWA 1B7YB 1B76A 4CH5A 2IY5A 2I4MA 3QO7A 3RKYA 2J3MA 4CS2A 4XEOA 1X56A 3A31A 2EJFA 4H2XB 2DXTA 2ZT8A 3HRIA 3MF2A 3NENA 3QO5A 2EAYA 4YCUA 4HVCA 3A7UA 1B8AA 2DZCA 2DTHA 2CJBA 2Q5IA 3KFUA 4P73A 4P75A 3LSSA 4DPGA 4RMFA 4XTZA 3RUXA 2CIMA 4P74C
chains in the Genus database with same CATH superfamily
4P3NA 3REXA 4XU0A 2C8MA 2P0LA 4XTVA 2DU5A 1X2HA 1X01A 4ZTZB 2RHQB 4LNSA 3V7RA 1YFTA 2ODRD 4XU3A 2DXUA 1SERA 4YDQA 4DQ2A 1BBUA 1BIBA 4G84A 3TUPA 4LVJA 4YYEA 4WJ3M 3E9HA 1WPYA 3P8TA 4P73C 4H2YA 1N9WA 2DU7A 1G5HA 4LVKA 4P74A 3RL6A 3HXUA 5C52B 4CS3A 1EFWA 2ZZGA 1NJ1A 3IALA 5HGQA 3VQWA 3A5YA 2QHSA 3L1AA 3RGLA 2ALYA 1ADYA 5C51B 3VBBA 4H2WA 4H2TA 4TQDA 4L87A 2IY5B 1EVKA 2HNIA 2DTOA 2Q7EA 2E3CA 4LVLA 3TEHB 4OP0A 4P72C 3A7RA 5C53B 3V7CA 2ZT6A 2RHSB 1X54A 4EO4A 1IL2A 2Q5HA 3P8YA 1KOGA 4RQFA 3UGTA 2EL9A 4E51A 2ARSA 3V8KA 4CH6A 4HWRA 3HXXA 4XTXA 2I4LA 2DZ9A 2ZTGA 4H2VA 4XTYA 1WLEA 1C0AA 1J5WA 1WU7A 3IG2A 4YRKA 1ADJA 3ERRA 2QHUA 1PYSB 2ALYB 1SRYA 4AH6A 2ZNIA 2E1HA 4BWAA 4ZIBA 2J3LA 2E65A 4YCWA 4YRQA 2ZXFA 1B70B 1H4SA 4LVIA 2ZZEA 3A32A 2ZR3A 1L0WA 3RKXA 3TEHA 4K86A 4P71A 1SESA 4OLFA 4H2UA 1BBWA 3HXYA 4WJ4A 3HRKA 3QO8A 3A5ZA 5F5WA 2EWNA 4YROA 1NYRA 4LVMA 2FYKA 3VQVA 5ELOA 5E3IA 4P72A 3W3SA 2ZT5A 4P3PA 3UGQA 3I7FA 3HFVA 4UP8A 2E10A 3RF1A 1B7YA 3HTZA 4YP0A 2DDZA 1HXDA 2P5IA 1NJ6A 4KR3A 1WQWA 3M4PA 4XTUA 2DQ0A 2ZINA 3BJUA 4CS4A 2I4OA 1E1OA 2RHSA 4HWPA 3HXZA 2I4NA 1HC7A 4EX5A 4P75C 4HT4A 1H4TA 3E9IA 1X55A 4YRMA 1G5IA 3HY1A 2ZGWA 1LYLA 4YRCA 3UH0A 3QTCA 3RACA 4K87A 3EFSA 4P3OA 4XEMA 4YRTA 3TEGA 4H2XA 4TQFA 1E22A 1YB3A 1YGBA 2E5AA 1Z7NA 4XU1A 1JJCA 3DSQA 3VQXA 2AKWA 4YRJA 4YCVA 1KMNA 3MEYA 2DEQA 4YRNA 4H02A 2PMEA 1QF6A 1EIYA 2AMCA 11ASA 3IKMB 4K88A 2Q7GA 4YRIA 1NNHA 4YRLA 1WNLA 3PZCA 4O2DA 2ZZFA 4HWTA 2DKGA 3LC0A 2C7IA 4X5OA 2QHTA 3QNEA 1WYDA 1X2GA 4ZTUB 1NJ8A 4HWSA 4CH3A 2NS6A 3IKLA 4YRGA 1RIQA 1W66A 3G1ZA 4UPAA 4KQEA 4YPFA 1YFRA 4TVAB 2EJGA 2XTIA 3V8JA 1NJ2A 3V8LA 3REUA 2Q7HA 4RQEA 2G4CA 5KNNA 4TVAA 4YRPA 3PCOB 4PHCA 3HFZA 1EVLA 1HTTA 3CMQA 3PCOA 3A74A 4HWOA 5K1XA 1Z7MA 3P8VA 3WQZA 1EQRA 1KMMA 1ASYA 3MQZA 2ZIOA 3FJPA 4YREA 2E41A 5K1PA 3MF1A 2EJ9A 1ASZA 2DJZA 3V7SA 2DTIA 1JJCB 3M4QA 3HXVA 4XU2A 3LSQA 3BFMA 2AKWB 1H4VB 4P71C 1WQ7A 1USYA 4CH4A 2ZT7A 1ATIA 12ASA 4TVYA 1EIYB 1VQZA 3RIRA 4YRFA 1FYFA 4H2SA 2ZR2A 3L4GB 1SETA 4HA8A 3A7AA 2QHVA 2AMCB 2CGHA 1USYC 2ODRC 4TTVA 2ARTA 3R07A 3EFRA 4UP7A 2RHQA 4WF2A 2PMFA 3ICAA 1E1TA 3OD1A 2ZNJA 2ARUA 2XGTA 1PYSA 3L2ZA 3HXWA 2A8EA 4TWAA 1QE0A 4Q15A 3NEMA 1GGMA 2ZCEA 3UFGA 1NYQA 3NETA 4YRSA 3HY0A 4WI1A 1E24A 5ELNA 2ZIMA 4UP9A 4YRRA 3NELA 4PG3A 4KR2A 1YFSA 2E64A 4BW9A 2CJAA 4J15A 1G51A 3RKWA 2DQ3A 1NJ5A 4XTWA 4NCXA 2DVEA 4Q6GA 1BIAA 4G85A 1H4QA 1B70A 1EOVA 2CJ9A 3HFZB 4RDXA 3VQYA 3L4GA 4TVWA 1B7YB 1B76A 4CH5A 2IY5A 2I4MA 3QO7A 3RKYA 2J3MA 4CS2A 4XEOA 1X56A 3A31A 2EJFA 4H2XB 2DXTA 2ZT8A 3HRIA 3MF2A 3NENA 3QO5A 2EAYA 4YCUA 4HVCA 3A7UA 1B8AA 2DZCA 2DTHA 2CJBA 2Q5IA 3KFUA 4P73A 4P75A 3LSSA 4DPGA 4RMFA 4XTZA 3RUXA 2CIMA 4P74C
chains in the Genus database with same CATH topology
4P3NA 3REXA 4XU0A 2C8MA 2P0LA 4XTVA 2DU5A 1X2HA 1X01A 4ZTZB 2RHQB 4LNSA 3V7RA 1YFTA 2ODRD 4XU3A 2DXUA 1SERA 4YDQA 4DQ2A 1BBUA 1BIBA 4G84A 3TUPA 4LVJA 4YYEA 4WJ3M 3E9HA 1WPYA 3P8TA 4P73C 4H2YA 1N9WA 2DU7A 1G5HA 4LVKA 4P74A 3RL6A 3HXUA 5C52B 4CS3A 1EFWA 2ZZGA 1NJ1A 3IALA 5HGQA 3VQWA 3A5YA 2QHSA 3L1AA 3RGLA 2ALYA 1ADYA 5C51B 3VBBA 4H2WA 4H2TA 4TQDA 4L87A 2IY5B 1EVKA 2HNIA 2DTOA 2Q7EA 2E3CA 4LVLA 3TEHB 4OP0A 4P72C 3A7RA 5C53B 3V7CA 2ZT6A 2RHSB 1X54A 4EO4A 1IL2A 2Q5HA 3P8YA 1KOGA 4RQFA 3UGTA 2EL9A 4E51A 2ARSA 3V8KA 4CH6A 4HWRA 3HXXA 4XTXA 2I4LA 2DZ9A 2ZTGA 4H2VA 4XTYA 1WLEA 1C0AA 1J5WA 1WU7A 3IG2A 4YRKA 1ADJA 3ERRA 2QHUA 1PYSB 2ALYB 1SRYA 4AH6A 2ZNIA 2E1HA 4BWAA 4ZIBA 2J3LA 2E65A 4YCWA 4YRQA 2ZXFA 1B70B 1H4SA 4LVIA 2ZZEA 3A32A 2ZR3A 1L0WA 3RKXA 3TEHA 4K86A 4P71A 1SESA 4OLFA 4H2UA 1BBWA 3HXYA 4WJ4A 3HRKA 3QO8A 3A5ZA 5F5WA 2EWNA 4YROA 1NYRA 4LVMA 2FYKA 3VQVA 5ELOA 5E3IA 4P72A 3W3SA 2ZT5A 4P3PA 3UGQA 3I7FA 3HFVA 4UP8A 2E10A 3RF1A 1B7YA 3HTZA 4YP0A 2DDZA 1HXDA 2P5IA 1NJ6A 4KR3A 1WQWA 3M4PA 4XTUA 2DQ0A 2ZINA 3BJUA 4CS4A 2I4OA 1E1OA 2RHSA 4HWPA 3HXZA 2I4NA 1HC7A 4EX5A 4P75C 4HT4A 1H4TA 3E9IA 1X55A 4YRMA 1G5IA 3HY1A 2ZGWA 1LYLA 4YRCA 3UH0A 3QTCA 3RACA 4K87A 3EFSA 4P3OA 4XEMA 4YRTA 3TEGA 4H2XA 4TQFA 1E22A 1YB3A 1YGBA 2E5AA 1Z7NA 4XU1A 1JJCA 3DSQA 3VQXA 2AKWA 4YRJA 4YCVA 1KMNA 3MEYA 2DEQA 4YRNA 4H02A 2PMEA 1QF6A 1EIYA 2AMCA 11ASA 3IKMB 4K88A 2Q7GA 4YRIA 1NNHA 4YRLA 1WNLA 3PZCA 4O2DA 2ZZFA 4HWTA 2DKGA 3LC0A 2C7IA 4X5OA 2QHTA 3QNEA 1WYDA 1X2GA 4ZTUB 1NJ8A 4HWSA 4CH3A 2NS6A 3IKLA 4YRGA 1RIQA 1W66A 3G1ZA 4UPAA 4KQEA 4YPFA 1YFRA 4TVAB 2EJGA 2XTIA 3V8JA 1NJ2A 3V8LA 3REUA 2Q7HA 4RQEA 2G4CA 5KNNA 4TVAA 4YRPA 3PCOB 4PHCA 3HFZA 1EVLA 1HTTA 3CMQA 3PCOA 3A74A 4HWOA 5K1XA 1Z7MA 3P8VA 3WQZA 1EQRA 1KMMA 1ASYA 3MQZA 2ZIOA 3FJPA 4YREA 2E41A 5K1PA 3MF1A 2EJ9A 1ASZA 2DJZA 3V7SA 2DTIA 1JJCB 3M4QA 3HXVA 4XU2A 3LSQA 3BFMA 2AKWB 1H4VB 4P71C 1WQ7A 1USYA 4CH4A 2ZT7A 1ATIA 12ASA 4TVYA 1EIYB 1VQZA 3RIRA 4YRFA 1FYFA 4H2SA 2ZR2A 3L4GB 1SETA 4HA8A 3A7AA 2QHVA 2AMCB 2CGHA 1USYC 2ODRC 4TTVA 2ARTA 3R07A 3EFRA 4UP7A 2RHQA 4WF2A 2PMFA 3ICAA 1E1TA 3OD1A 2ZNJA 2ARUA 2XGTA 1PYSA 3L2ZA 3HXWA 2A8EA 4TWAA 1QE0A 4Q15A 3NEMA 1GGMA 2ZCEA 3UFGA 1NYQA 3NETA 4YRSA 3HY0A 4WI1A 1E24A 5ELNA 2ZIMA 4UP9A 4YRRA 3NELA 4PG3A 4KR2A 1YFSA 2E64A 4BW9A 2CJAA 4J15A 1G51A 3RKWA 2DQ3A 1NJ5A 4XTWA 4NCXA 2DVEA 4Q6GA 1BIAA 4G85A 1H4QA 1B70A 1EOVA 2CJ9A 3HFZB 4RDXA 3VQYA 3L4GA 4TVWA 1B7YB 1B76A 4CH5A 2IY5A 2I4MA 3QO7A 3RKYA 2J3MA 4CS2A 4XEOA 1X56A 3A31A 2EJFA 4H2XB 2DXTA 2ZT8A 3HRIA 3MF2A 3NENA 3QO5A 2EAYA 4YCUA 4HVCA 3A7UA 1B8AA 2DZCA 2DTHA 2CJBA 2Q5IA 3KFUA 4P73A 4P75A 3LSSA 4DPGA 4RMFA 4XTZA 3RUXA 2CIMA 4P74C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P3N A;  3REX A;  4XU0 A;  2C8M A;  2P0L A;  4XTV A;  2DU5 A;  1X2H A;  1X01 A;  4ZTZ B;  2RHQ B;  4LNS A;  3V7R A;  1YFT A;  2ODR D;  4XU3 A;  2DXU A;  1SER A;  4YDQ A;  4DQ2 A;  1BBU A;  1BIB A;  4G84 A;  3TUP A;  4YYE A;  4WJ3 M;  3E9H A;  1WPY A;  3P8T A;  4P73 C;  4H2Y A;  1N9W A;  2DU7 A;  1G5H A;  4P74 A;  3RL6 A;  3HXU A;  5C52 B;  4CS3 A;  1EFW A;  2ZZG A;  1NJ1 A;  3IAL A;  5HGQ A;  3VQW A;  3A5Y A;  2QHS A;  3L1A A;  3RGL A;  2ALY A;  1ADY A;  5C51 B;  3VBB A;  4H2W A;  4H2T A;  4TQD A;  4L87 A;  2IY5 B;  1EVK A;  2HNI A;  2DTO A;  2Q7E A;  2E3C A;  3TEH B;  4OP0 A;  4P72 C;  3A7R A;  5C53 B;  3V7C A;  2ZT6 A;  2RHS B;  1X54 A;  4EO4 A;  1IL2 A;  2Q5H A;  3P8Y A;  1KOG A;  4RQF A;  3UGT A;  2EL9 A;  4E51 A;  2ARS A;  3V8K A;  4CH6 A;  4HWR A;  3HXX A;  4XTX A;  2I4L A;  2DZ9 A;  2ZTG A;  4H2V A;  4XTY A;  1WLE A;  1C0A A;  1J5W A;  1WU7 A;  3IG2 A;  4YRK A;  1ADJ A;  3ERR A;  2QHU A;  1PYS B;  2ALY B;  1SRY A;  4AH6 A;  2ZNI A;  2E1H A;  4BWA A;  4ZIB A;  2J3L A;  2E65 A;  4YCW A;  4YRQ A;  2ZXF A;  1B70 B;  1H4S A;  2ZZE A;  3A32 A;  2ZR3 A;  1L0W A;  3RKX A;  3TEH A;  4K86 A;  4P71 A;  1SES A;  4OLF A;  4H2U A;  1BBW A;  3HXY A;  4WJ4 A;  3HRK A;  3QO8 A;  3A5Z A;  5F5W A;  2EWN A;  4YRO A;  1NYR A;  2FYK A;  3VQV A;  5ELO A;  5E3I A;  4P72 A;  3W3S A;  2ZT5 A;  4P3P A;  3UGQ A;  3I7F A;  3HFV A;  4UP8 A;  2E10 A;  3RF1 A;  1B7Y A;  3HTZ A;  4YP0 A;  2DDZ A;  1HXD A;  2P5I A;  1NJ6 A;  4KR3 A;  1WQW A;  3M4P A;  4XTU A;  2DQ0 A;  2ZIN A;  3BJU A;  4CS4 A;  2I4O A;  1E1O A;  2RHS A;  4HWP A;  3HXZ A;  2I4N A;  1HC7 A;  4EX5 A;  4P75 C;  1H4T A;  3E9I A;  1X55 A;  4YRM A;  1G5I A;  3HY1 A;  2ZGW A;  1LYL A;  4YRC A;  3UH0 A;  3QTC A;  3RAC A;  4K87 A;  3EFS A;  4P3O A;  4XEM A;  4YRT A;  3TEG A;  4H2X A;  4TQF A;  1E22 A;  1YB3 A;  1YGB A;  2E5A A;  1Z7N A;  4XU1 A;  1JJC A;  3DSQ A;  3VQX A;  2AKW A;  4YRJ A;  4YCV A;  1KMN A;  3MEY A;  2DEQ A;  4YRN A;  4H02 A;  2PME A;  1QF6 A;  1EIY A;  2AMC A;  11AS A;  3IKM B;  4K88 A;  2Q7G A;  4YRI A;  1NNH A;  4YRL A;  1WNL A;  3PZC A;  4O2D A;  2ZZF A;  4HWT A;  2DKG A;  3LC0 A;  2C7I A;  4X5O A;  2QHT A;  3QNE A;  1WYD A;  1X2G A;  4ZTU B;  1NJ8 A;  4HWS A;  4CH3 A;  3IKL A;  4YRG A;  1RIQ A;  1W66 A;  3G1Z A;  4UPA A;  4KQE A;  4YPF A;  1YFR A;  4TVA B;  2EJG A;  2XTI A;  3V8J A;  1NJ2 A;  3V8L A;  3REU A;  2Q7H A;  4RQE A;  2G4C A;  5KNN A;  4TVA A;  4YRP A;  3PCO B;  4PHC A;  3HFZ A;  1EVL A;  1HTT A;  3CMQ A;  3PCO A;  3A74 A;  4HWO A;  5K1X A;  1Z7M A;  3P8V A;  3WQZ A;  1EQR A;  1KMM A;  1ASY A;  2ZIO A;  3FJP A;  4YRE A;  2E41 A;  5K1P A;  3MF1 A;  2EJ9 A;  1ASZ A;  2DJZ A;  3V7S A;  2DTI A;  1JJC B;  3M4Q A;  3HXV A;  4XU2 A;  3LSQ A;  3BFM A;  2AKW B;  1H4V B;  4P71 C;  1WQ7 A;  1USY A;  4CH4 A;  2ZT7 A;  1ATI A;  12AS A;  4TVY A;  1EIY B;  1VQZ A;  3RIR A;  4YRF A;  1FYF A;  4H2S A;  2ZR2 A;  3L4G B;  1SET A;  4HA8 A;  3A7A A;  2QHV A;  2AMC B;  2CGH A;  1USY C;  2ODR C;  4TTV A;  2ART A;  3R07 A;  3EFR A;  4UP7 A;  2RHQ A;  4WF2 A;  2PMF A;  3ICA A;  1E1T A;  3OD1 A;  2ZNJ A;  2ARU A;  2XGT A;  1PYS A;  3L2Z A;  3HXW A;  4TWA A;  1QE0 A;  4Q15 A;  3NEM A;  1GGM A;  2ZCE A;  3UFG A;  1NYQ A;  3NET A;  4YRS A;  3HY0 A;  4WI1 A;  1E24 A;  5ELN A;  2ZIM A;  4UP9 A;  4YRR A;  3NEL A;  4PG3 A;  4KR2 A;  1YFS A;  2E64 A;  4BW9 A;  2CJA A;  4J15 A;  1G51 A;  3RKW A;  2DQ3 A;  1NJ5 A;  4XTW A;  4NCX A;  2DVE A;  4Q6G A;  1BIA A;  4G85 A;  1H4Q A;  1B70 A;  1EOV A;  2CJ9 A;  3HFZ B;  4RDX A;  3VQY A;  3L4G A;  4TVW A;  1B7Y B;  1B76 A;  4CH5 A;  2IY5 A;  2I4M A;  3QO7 A;  3RKY A;  2J3M A;  4CS2 A;  4XEO A;  1X56 A;  3A31 A;  2EJF A;  4H2X B;  2DXT A;  2ZT8 A;  3HRI A;  3MF2 A;  3NEN A;  3QO5 A;  2EAY A;  4YCU A;  4HVC A;  3A7U A;  1B8A A;  2DZC A;  2DTH A;  2CJB A;  2Q5I A;  3KFU A;  4P73 A;  4P75 A;  3LSS A;  4DPG A;  4RMF A;  4XTZ A;  3RUX A;  2CIM A;  4P74 C; 
#chains in the Genus database with same CATH topology
 4P3N A;  3REX A;  4XU0 A;  2C8M A;  2P0L A;  4XTV A;  2DU5 A;  1X2H A;  1X01 A;  4ZTZ B;  2RHQ B;  4LNS A;  3V7R A;  1YFT A;  2ODR D;  4XU3 A;  2DXU A;  1SER A;  4YDQ A;  4DQ2 A;  1BBU A;  1BIB A;  4G84 A;  3TUP A;  4LVJ A;  4YYE A;  4WJ3 M;  3E9H A;  1WPY A;  3P8T A;  4P73 C;  4H2Y A;  1N9W A;  2DU7 A;  1G5H A;  4LVK A;  4P74 A;  3RL6 A;  3HXU A;  5C52 B;  4CS3 A;  1EFW A;  2ZZG A;  1NJ1 A;  3IAL A;  5HGQ A;  3VQW A;  3A5Y A;  2QHS A;  3L1A A;  3RGL A;  2ALY A;  1ADY A;  5C51 B;  3VBB A;  4H2W A;  4H2T A;  4TQD A;  4L87 A;  2IY5 B;  1EVK A;  2HNI A;  2DTO A;  2Q7E A;  2E3C A;  4LVL A;  3TEH B;  4OP0 A;  4P72 C;  3A7R A;  5C53 B;  3V7C A;  2ZT6 A;  2RHS B;  1X54 A;  4EO4 A;  1IL2 A;  2Q5H A;  3P8Y A;  1KOG A;  4RQF A;  3UGT A;  2EL9 A;  4E51 A;  2ARS A;  3V8K A;  4CH6 A;  4HWR A;  3HXX A;  4XTX A;  2I4L A;  2DZ9 A;  2ZTG A;  4H2V A;  4XTY A;  1WLE A;  1C0A A;  1J5W A;  1WU7 A;  3IG2 A;  4YRK A;  1ADJ A;  3ERR A;  2QHU A;  1PYS B;  2ALY B;  1SRY A;  4AH6 A;  2ZNI A;  2E1H A;  4BWA A;  4ZIB A;  2J3L A;  2E65 A;  4YCW A;  4YRQ A;  2ZXF A;  1B70 B;  1H4S A;  4LVI A;  2ZZE A;  3A32 A;  2ZR3 A;  1L0W A;  3RKX A;  3TEH A;  4K86 A;  4P71 A;  1SES A;  4OLF A;  4H2U A;  1BBW A;  3HXY A;  4WJ4 A;  3HRK A;  3QO8 A;  3A5Z A;  5F5W A;  2EWN A;  4YRO A;  1NYR A;  4LVM A;  2FYK A;  3VQV A;  5ELO A;  5E3I A;  4P72 A;  3W3S A;  2ZT5 A;  4P3P A;  3UGQ A;  3I7F A;  3HFV A;  4UP8 A;  2E10 A;  3RF1 A;  1B7Y A;  3HTZ A;  4YP0 A;  2DDZ A;  1HXD A;  2P5I A;  1NJ6 A;  4KR3 A;  1WQW A;  3M4P A;  4XTU A;  2DQ0 A;  2ZIN A;  3BJU A;  4CS4 A;  2I4O A;  1E1O A;  2RHS A;  4HWP A;  3HXZ A;  2I4N A;  1HC7 A;  4EX5 A;  4P75 C;  4HT4 A;  1H4T A;  3E9I A;  1X55 A;  4YRM A;  1G5I A;  3HY1 A;  2ZGW A;  1LYL A;  4YRC A;  3UH0 A;  3QTC A;  3RAC A;  4K87 A;  3EFS A;  4P3O A;  4XEM A;  4YRT A;  3TEG A;  4H2X A;  4TQF A;  1E22 A;  1YB3 A;  1YGB A;  2E5A A;  1Z7N A;  4XU1 A;  1JJC A;  3DSQ A;  3VQX A;  2AKW A;  4YRJ A;  4YCV A;  1KMN A;  3MEY A;  2DEQ A;  4YRN A;  4H02 A;  2PME A;  1QF6 A;  1EIY A;  2AMC A;  11AS A;  3IKM B;  4K88 A;  2Q7G A;  4YRI A;  1NNH A;  4YRL A;  1WNL A;  3PZC A;  4O2D A;  2ZZF A;  4HWT A;  2DKG A;  3LC0 A;  2C7I A;  4X5O A;  2QHT A;  3QNE A;  1WYD A;  1X2G A;  4ZTU B;  1NJ8 A;  4HWS A;  4CH3 A;  2NS6 A;  3IKL A;  4YRG A;  1RIQ A;  1W66 A;  3G1Z A;  4UPA A;  4KQE A;  4YPF A;  1YFR A;  4TVA B;  2EJG A;  2XTI A;  3V8J A;  1NJ2 A;  3V8L A;  3REU A;  2Q7H A;  4RQE A;  2G4C A;  5KNN A;  4TVA A;  4YRP A;  3PCO B;  4PHC A;  3HFZ A;  1EVL A;  1HTT A;  3CMQ A;  3PCO A;  3A74 A;  4HWO A;  5K1X A;  1Z7M A;  3P8V A;  3WQZ A;  1EQR A;  1KMM A;  1ASY A;  3MQZ A;  2ZIO A;  3FJP A;  4YRE A;  2E41 A;  5K1P A;  3MF1 A;  2EJ9 A;  1ASZ A;  2DJZ A;  3V7S A;  2DTI A;  1JJC B;  3M4Q A;  3HXV A;  4XU2 A;  3LSQ A;  3BFM A;  2AKW B;  1H4V B;  4P71 C;  1WQ7 A;  1USY A;  4CH4 A;  2ZT7 A;  1ATI A;  12AS A;  4TVY A;  1EIY B;  1VQZ A;  3RIR A;  4YRF A;  1FYF A;  4H2S A;  2ZR2 A;  3L4G B;  1SET A;  4HA8 A;  3A7A A;  2QHV A;  2AMC B;  2CGH A;  1USY C;  2ODR C;  4TTV A;  2ART A;  3R07 A;  3EFR A;  4UP7 A;  2RHQ A;  4WF2 A;  2PMF A;  3ICA A;  1E1T A;  3OD1 A;  2ZNJ A;  2ARU A;  2XGT A;  1PYS A;  3L2Z A;  3HXW A;  2A8E A;  4TWA A;  1QE0 A;  4Q15 A;  3NEM A;  1GGM A;  2ZCE A;  3UFG A;  1NYQ A;  3NET A;  4YRS A;  3HY0 A;  4WI1 A;  1E24 A;  5ELN A;  2ZIM A;  4UP9 A;  4YRR A;  3NEL A;  4PG3 A;  4KR2 A;  1YFS A;  2E64 A;  4BW9 A;  2CJA A;  4J15 A;  1G51 A;  3RKW A;  2DQ3 A;  1NJ5 A;  4XTW A;  4NCX A;  2DVE A;  4Q6G A;  1BIA A;  4G85 A;  1H4Q A;  1B70 A;  1EOV A;  2CJ9 A;  3HFZ B;  4RDX A;  3VQY A;  3L4G A;  4TVW A;  1B7Y B;  1B76 A;  4CH5 A;  2IY5 A;  2I4M A;  3QO7 A;  3RKY A;  2J3M A;  4CS2 A;  4XEO A;  1X56 A;  3A31 A;  2EJF A;  4H2X B;  2DXT A;  2ZT8 A;  3HRI A;  3MF2 A;  3NEN A;  3QO5 A;  2EAY A;  4YCU A;  4HVC A;  3A7U A;  1B8A A;  2DZC A;  2DTH A;  2CJB A;  2Q5I A;  3KFU A;  4P73 A;  4P75 A;  3LSS A;  4DPG A;  4RMF A;  4XTZ A;  3RUX A;  2CIM A;  4P74 C; 
#chains in the Genus database with same CATH homology
 4P3N A;  3REX A;  4XU0 A;  2C8M A;  2P0L A;  4XTV A;  2DU5 A;  1X2H A;  1X01 A;  4ZTZ B;  2RHQ B;  4LNS A;  3V7R A;  1YFT A;  2ODR D;  4XU3 A;  2DXU A;  1SER A;  4YDQ A;  4DQ2 A;  1BBU A;  1BIB A;  4G84 A;  3TUP A;  4LVJ A;  4YYE A;  4WJ3 M;  3E9H A;  1WPY A;  3P8T A;  4P73 C;  4H2Y A;  1N9W A;  2DU7 A;  1G5H A;  4LVK A;  4P74 A;  3RL6 A;  3HXU A;  5C52 B;  4CS3 A;  1EFW A;  2ZZG A;  1NJ1 A;  3IAL A;  5HGQ A;  3VQW A;  3A5Y A;  2QHS A;  3L1A A;  3RGL A;  2ALY A;  1ADY A;  5C51 B;  3VBB A;  4H2W A;  4H2T A;  4TQD A;  4L87 A;  2IY5 B;  1EVK A;  2HNI A;  2DTO A;  2Q7E A;  2E3C A;  4LVL A;  3TEH B;  4OP0 A;  4P72 C;  3A7R A;  5C53 B;  3V7C A;  2ZT6 A;  2RHS B;  1X54 A;  4EO4 A;  1IL2 A;  2Q5H A;  3P8Y A;  1KOG A;  4RQF A;  3UGT A;  2EL9 A;  4E51 A;  2ARS A;  3V8K A;  4CH6 A;  4HWR A;  3HXX A;  4XTX A;  2I4L A;  2DZ9 A;  2ZTG A;  4H2V A;  4XTY A;  1WLE A;  1C0A A;  1J5W A;  1WU7 A;  3IG2 A;  4YRK A;  1ADJ A;  3ERR A;  2QHU A;  1PYS B;  2ALY B;  1SRY A;  4AH6 A;  2ZNI A;  2E1H A;  4BWA A;  4ZIB A;  2J3L A;  2E65 A;  4YCW A;  4YRQ A;  2ZXF A;  1B70 B;  1H4S A;  4LVI A;  2ZZE A;  3A32 A;  2ZR3 A;  1L0W A;  3RKX A;  3TEH A;  4K86 A;  4P71 A;  1SES A;  4OLF A;  4H2U A;  1BBW A;  3HXY A;  4WJ4 A;  3HRK A;  3QO8 A;  3A5Z A;  5F5W A;  2EWN A;  4YRO A;  1NYR A;  4LVM A;  2FYK A;  3VQV A;  5ELO A;  5E3I A;  4P72 A;  3W3S A;  2ZT5 A;  4P3P A;  3UGQ A;  3I7F A;  3HFV A;  4UP8 A;  2E10 A;  3RF1 A;  1B7Y A;  3HTZ A;  4YP0 A;  2DDZ A;  1HXD A;  2P5I A;  1NJ6 A;  4KR3 A;  1WQW A;  3M4P A;  4XTU A;  2DQ0 A;  2ZIN A;  3BJU A;  4CS4 A;  2I4O A;  1E1O A;  2RHS A;  4HWP A;  3HXZ A;  2I4N A;  1HC7 A;  4EX5 A;  4P75 C;  4HT4 A;  1H4T A;  3E9I A;  1X55 A;  4YRM A;  1G5I A;  3HY1 A;  2ZGW A;  1LYL A;  4YRC A;  3UH0 A;  3QTC A;  3RAC A;  4K87 A;  3EFS A;  4P3O A;  4XEM A;  4YRT A;  3TEG A;  4H2X A;  4TQF A;  1E22 A;  1YB3 A;  1YGB A;  2E5A A;  1Z7N A;  4XU1 A;  1JJC A;  3DSQ A;  3VQX A;  2AKW A;  4YRJ A;  4YCV A;  1KMN A;  3MEY A;  2DEQ A;  4YRN A;  4H02 A;  2PME A;  1QF6 A;  1EIY A;  2AMC A;  11AS A;  3IKM B;  4K88 A;  2Q7G A;  4YRI A;  1NNH A;  4YRL A;  1WNL A;  3PZC A;  4O2D A;  2ZZF A;  4HWT A;  2DKG A;  3LC0 A;  2C7I A;  4X5O A;  2QHT A;  3QNE A;  1WYD A;  1X2G A;  4ZTU B;  1NJ8 A;  4HWS A;  4CH3 A;  2NS6 A;  3IKL A;  4YRG A;  1RIQ A;  1W66 A;  3G1Z A;  4UPA A;  4KQE A;  4YPF A;  1YFR A;  4TVA B;  2EJG A;  2XTI A;  3V8J A;  1NJ2 A;  3V8L A;  3REU A;  2Q7H A;  4RQE A;  2G4C A;  5KNN A;  4TVA A;  4YRP A;  3PCO B;  4PHC A;  3HFZ A;  1EVL A;  1HTT A;  3CMQ A;  3PCO A;  3A74 A;  4HWO A;  5K1X A;  1Z7M A;  3P8V A;  3WQZ A;  1EQR A;  1KMM A;  1ASY A;  3MQZ A;  2ZIO A;  3FJP A;  4YRE A;  2E41 A;  5K1P A;  3MF1 A;  2EJ9 A;  1ASZ A;  2DJZ A;  3V7S A;  2DTI A;  1JJC B;  3M4Q A;  3HXV A;  4XU2 A;  3LSQ A;  3BFM A;  2AKW B;  1H4V B;  4P71 C;  1WQ7 A;  1USY A;  4CH4 A;  2ZT7 A;  1ATI A;  12AS A;  4TVY A;  1EIY B;  1VQZ A;  3RIR A;  4YRF A;  1FYF A;  4H2S A;  2ZR2 A;  3L4G B;  1SET A;  4HA8 A;  3A7A A;  2QHV A;  2AMC B;  2CGH A;  1USY C;  2ODR C;  4TTV A;  2ART A;  3R07 A;  3EFR A;  4UP7 A;  2RHQ A;  4WF2 A;  2PMF A;  3ICA A;  1E1T A;  3OD1 A;  2ZNJ A;  2ARU A;  2XGT A;  1PYS A;  3L2Z A;  3HXW A;  2A8E A;  4TWA A;  1QE0 A;  4Q15 A;  3NEM A;  1GGM A;  2ZCE A;  3UFG A;  1NYQ A;  3NET A;  4YRS A;  3HY0 A;  4WI1 A;  1E24 A;  5ELN A;  2ZIM A;  4UP9 A;  4YRR A;  3NEL A;  4PG3 A;  4KR2 A;  1YFS A;  2E64 A;  4BW9 A;  2CJA A;  4J15 A;  1G51 A;  3RKW A;  2DQ3 A;  1NJ5 A;  4XTW A;  4NCX A;  2DVE A;  4Q6G A;  1BIA A;  4G85 A;  1H4Q A;  1B70 A;  1EOV A;  2CJ9 A;  3HFZ B;  4RDX A;  3VQY A;  3L4G A;  4TVW A;  1B7Y B;  1B76 A;  4CH5 A;  2IY5 A;  2I4M A;  3QO7 A;  3RKY A;  2J3M A;  4CS2 A;  4XEO A;  1X56 A;  3A31 A;  2EJF A;  4H2X B;  2DXT A;  2ZT8 A;  3HRI A;  3MF2 A;  3NEN A;  3QO5 A;  2EAY A;  4YCU A;  4HVC A;  3A7U A;  1B8A A;  2DZC A;  2DTH A;  2CJB A;  2Q5I A;  3KFU A;  4P73 A;  4P75 A;  3LSS A;  4DPG A;  4RMF A;  4XTZ A;  3RUX A;  2CIM A;  4P74 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...