4P73C

Phers in complex with compound 1a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
251
structure length
239
Chain Sequence
AAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
molecule keywords Phenylalanine--tRNA ligase beta subunit
total genus 64
structure length 239
sequence length 251
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p73C01
5ELNA 4H2VA 2EL9A 4KR3A 1E1OA 2ODRD 4HVCA 3CMQA 4P74A 2I4LA 3IKLA 4YRPA 2ZIMA 2DTIA 2DTOA 2CIMA 4YDQA 2ZNIA 2XTIA 4XTUA 1NJ5A 3VBBA 1USYA 1NJ2A 3IG2A 4L87A 3M4QA 3FJPA 1WLEA 4G85A 4UP7A 4CS3A 1HXDA 4YRSA 1IL2A 2CJAA 1SRYA 1E24A 2ZT6A 4OLFA 3EFRA 4Q15A 4UPAA 3L4GB 1WU7A 2ZIOA 1X2HA 3QO8A 2CJBA 4YP0A 1EIYA 1N9WA 4YRTA 2J3MA 1VQZA 1NJ1A 1PYSB 4J15A 3E9HA 4PG3A 3RGLA 4DPGA 1YFTA 1H4VB 4E51A 2DZ9A 4EO4A 4K88A 4P73A 5C52B 3MF2A 3ICAA 3WQZA 2EJGA 4TWAA 3NEMA 2P0LA 3KFUA 3G1ZA 4CS4A 1W66A 2ARTA 4RDXA 2RHQB 4P71A 4HWSA 3BFMA 1ADJA 3A5ZA 3HRIA 1E1TA 4X5OA 2DZCA 3A7AA 1NJ8A 2DU7A 3P8TA 1NJ6A 2Q5HA 3P8YA 1NYQA 4K86A 4H2YA 4CH5A 4XEMA 2DXTA 4RMFA 2ZNJA 2E3CA 2ZZEA 3QO5A 4LNSA 4TQFA 1NNHA 2DDZA 1B76A 4EX5A 2ZGWA 2E10A 3W3SA 2ALYA 3TUPA 2E5AA 2P5IA 3RIRA 3PCOA 4AH6A 1B70A 12ASA 1BIAA 3RKYA 3L4GA 3TEHB 2EJFA 3L1AA 2I4OA 3A5YA 1EIYB 1USYC 1GGMA 1YB3A 4YCVA 4XU0A 4XTVA 1X56A 4H2UA 1EVKA 4P71C 11ASA 5E3IA 4UP8A 3V7RA 4TQDA 1H4SA 2ARUA 3A31A 1ADYA 1BIBA 1J5WA 3HFZB 2CGHA 4KQEA 4WJ4A 4HWRA 2G4CA 3NETA 2ZINA 3A32A 4K87A 4TVWA 3OD1A 2E41A 1X55A 2ZZGA 1YFSA 1ASZA 2ZR2A 2RHQA 2DJZA 2Q7EA 4YCWA 2Q7GA 3HXXA 3I7FA 4H2TA 2DEQA 3PZCA 3BJUA 4YYEA 4Q6GA 1EVLA 4H02A 5HGQA 4NCXA 4ZTUB 3NENA 4XU2A 2ZR3A 4RQEA 2PMFA 4ZTZB 4YRIA 1X2GA 4CH3A 2AKWB 1L0WA 1YGBA 2Q5IA 1WYDA 2RHSA 2EAYA 2DKGA 2ZCEA 1G5IA 4BWAA 1WPYA 3HY0A 2IY5A 3QNEA 3VQXA 1G51A 1X01A 2FYKA 2ZZFA 1ATIA 4H2XA 4TVAA 2E1HA 4RQFA 4P75C 2E65A 2DVEA 3HXUA 4O2DA 4XU1A 1ASYA 3QTCA 4HA8A 3HTZA 4CH4A 4HWPA 3A7RA 3LSQA 4TVAB 3HXYA 1EQRA 1SESA 2ZTGA 1H4TA 2E64A 2QHUA 1KMNA 3E9IA 1H4QA 4P74C 2DTHA 3HXVA 2AKWA 2QHVA 2EJ9A 3HRKA 1QF6A 3DSQA 3V7CA 1B70B 4YCUA 1BBWA 5F5WA 4YROA 2ARSA 4UP9A 3V7SA 4XTYA 4YREA 3MEYA 4YRKA 3UH0A 5C51B 1HC7A 2QHSA 4WJ3M 3QO7A 1Z7MA 2I4NA 4YRMA 4XEOA 1WQ7A 3IALA 3RKXA 3VQVA 4YRNA 2I4MA 3HY1A 4YRGA 3EFSA 1PYSA 1HTTA 2PMEA 1B8AA 4YRLA 4YRCA 4YRJA 1EOVA 5C53B 1X54A 1E22A 3IKMB 3RL6A 3MF1A 4P72A 3VQYA 2C8MA 1BBUA 1SETA 3RACA 4TVYA 4G84A 2HNIA 3RUXA 4XTXA 3NELA 1WQWA 4P75A 2J3LA 1KMMA 1Z7NA 1C0AA 4H2SA 4P3NA 3VQWA 2Q7HA 3LC0A 2EWNA 3HFVA 4P3PA 1NYRA 3M4PA 3REUA 1G5HA 2IY5B 5ELOA 1FYFA 4P3OA 5K1PA 2ZXFA 3V8LA 3UGQA 2XGTA 3TEGA 4XU3A 4DQ2A 3HXWA 1B7YA 1LYLA 1JJCB 1WNLA 2AMCB 2QHTA 3A74A 3UFGA 3HXZA 3A7UA 4PHCA 4YRFA 3RKWA 3R07A 3V8KA 3L2ZA 3PCOB 2RHSB 2DQ0A 1JJCA 4H2WA 4HWTA 2C7IA 4HWOA 1B7YB 3P8VA 1RIQA 4ZIBA 2CJ9A 2ODRC 4TTVA 3V8JA 4YRRA 4P73C 1YFRA 1QE0A 4WI1A 4CH6A 4CS2A 4XTWA 4H2XB 5K1XA 1KOGA 2DQ3A 2DXUA 3RF1A 2ZT7A 5KNNA 4WF2A 4P72C 2DU5A 2ZT8A 2AMCA 1SERA 3TEHA 4BW9A 4YRQA 3HFZA 4KR2A 2ALYB 3LSSA 3UGTA 4OP0A 1EFWA 2ZT5A 4XTZA 3ERRA 4YPFA 3REXA
chains in the Genus database with same CATH superfamily
5ELNA 4H2VA 2EL9A 4KR3A 1E1OA 2ODRD 4HVCA 3CMQA 4P74A 2I4LA 3IKLA 4YRPA 2ZIMA 2DTIA 2DTOA 2CIMA 4LVIA 4YDQA 2ZNIA 2XTIA 4XTUA 1NJ5A 3VBBA 1USYA 1NJ2A 3IG2A 4L87A 3M4QA 3FJPA 1WLEA 4G85A 4UP7A 4CS3A 1HXDA 4YRSA 1IL2A 2CJAA 1SRYA 1E24A 2ZT6A 4OLFA 3EFRA 4Q15A 2A8EA 4UPAA 3L4GB 1WU7A 2ZIOA 1X2HA 3QO8A 2CJBA 4YP0A 1EIYA 1N9WA 4YRTA 2J3MA 1VQZA 1NJ1A 1PYSB 4J15A 3E9HA 4PG3A 3RGLA 4DPGA 1YFTA 1H4VB 4E51A 2DZ9A 4EO4A 4K88A 4P73A 5C52B 3MF2A 3ICAA 3WQZA 2EJGA 4TWAA 3NEMA 2P0LA 3KFUA 3G1ZA 4CS4A 1W66A 2ARTA 4RDXA 2RHQB 4P71A 4HWSA 3BFMA 1ADJA 3A5ZA 3HRIA 1E1TA 3MQZA 4X5OA 2DZCA 3A7AA 1NJ8A 2DU7A 3P8TA 1NJ6A 2Q5HA 3P8YA 1NYQA 4K86A 4H2YA 4CH5A 4XEMA 2DXTA 4RMFA 2ZNJA 2E3CA 2ZZEA 3QO5A 4LNSA 4TQFA 1NNHA 2DDZA 1B76A 4EX5A 4LVJA 2ZGWA 2E10A 3W3SA 2ALYA 3TUPA 2E5AA 2P5IA 3RIRA 3PCOA 4AH6A 1B70A 12ASA 1BIAA 3RKYA 3L4GA 3TEHB 2EJFA 3L1AA 2I4OA 3A5YA 2NS6A 1EIYB 1USYC 1GGMA 1YB3A 4YCVA 4XU0A 4HT4A 4XTVA 1X56A 4H2UA 1EVKA 4P71C 11ASA 5E3IA 4UP8A 3V7RA 4TQDA 1H4SA 2ARUA 3A31A 1ADYA 1BIBA 1J5WA 3HFZB 2CGHA 4KQEA 4WJ4A 4HWRA 2G4CA 3NETA 2ZINA 3A32A 4K87A 4TVWA 3OD1A 2E41A 1X55A 2ZZGA 1YFSA 1ASZA 2ZR2A 2RHQA 2DJZA 2Q7EA 4YCWA 2Q7GA 4LVLA 3HXXA 3I7FA 4H2TA 2DEQA 3PZCA 3BJUA 4YYEA 4Q6GA 1EVLA 4H02A 5HGQA 4NCXA 4ZTUB 3NENA 4XU2A 2ZR3A 4RQEA 2PMFA 4ZTZB 4YRIA 1X2GA 4CH3A 2AKWB 1L0WA 1YGBA 2Q5IA 1WYDA 2RHSA 2EAYA 2DKGA 2ZCEA 1G5IA 4BWAA 1WPYA 3HY0A 2IY5A 3QNEA 3VQXA 1G51A 1X01A 2FYKA 2ZZFA 1ATIA 4H2XA 4TVAA 2E1HA 4RQFA 4P75C 2E65A 2DVEA 3HXUA 4O2DA 4XU1A 1ASYA 3QTCA 4HA8A 3HTZA 4CH4A 4HWPA 3A7RA 3LSQA 4TVAB 3HXYA 1EQRA 1SESA 2ZTGA 1H4TA 2E64A 2QHUA 1KMNA 3E9IA 1H4QA 4P74C 2DTHA 3HXVA 2AKWA 2QHVA 2EJ9A 3HRKA 1QF6A 3DSQA 3V7CA 1B70B 4YCUA 1BBWA 5F5WA 4YROA 2ARSA 4UP9A 3V7SA 4XTYA 4YREA 3MEYA 4YRKA 3UH0A 5C51B 1HC7A 2QHSA 4WJ3M 3QO7A 1Z7MA 2I4NA 4YRMA 4XEOA 1WQ7A 3IALA 3RKXA 3VQVA 4YRNA 2I4MA 3HY1A 4YRGA 3EFSA 1PYSA 1HTTA 2PMEA 1B8AA 4YRLA 4YRCA 4YRJA 1EOVA 5C53B 1X54A 1E22A 3IKMB 3RL6A 3MF1A 4P72A 3VQYA 2C8MA 1BBUA 1SETA 3RACA 4TVYA 4G84A 2HNIA 3RUXA 4XTXA 3NELA 1WQWA 4P75A 2J3LA 1KMMA 1Z7NA 1C0AA 4H2SA 4P3NA 3VQWA 2Q7HA 3LC0A 2EWNA 3HFVA 4P3PA 1NYRA 3M4PA 3REUA 1G5HA 2IY5B 5ELOA 1FYFA 4P3OA 5K1PA 2ZXFA 3V8LA 4LVMA 3UGQA 2XGTA 3TEGA 4XU3A 4DQ2A 3HXWA 1B7YA 1LYLA 1JJCB 1WNLA 2AMCB 2QHTA 3A74A 3UFGA 3HXZA 3A7UA 4PHCA 4YRFA 3RKWA 3R07A 3V8KA 3L2ZA 3PCOB 2RHSB 2DQ0A 1JJCA 4H2WA 4HWTA 2C7IA 4HWOA 1B7YB 3P8VA 1RIQA 4ZIBA 2CJ9A 2ODRC 4TTVA 3V8JA 4YRRA 4P73C 1YFRA 1QE0A 4WI1A 4CH6A 4CS2A 4XTWA 4H2XB 5K1XA 1KOGA 2DQ3A 2DXUA 3RF1A 2ZT7A 5KNNA 4WF2A 4P72C 2DU5A 2ZT8A 2AMCA 1SERA 3TEHA 4BW9A 4YRQA 3HFZA 4KR2A 2ALYB 3LSSA 3UGTA 4OP0A 4LVKA 2ZT5A 4XTZA 1EFWA 3ERRA 4YPFA 3REXA
chains in the Genus database with same CATH topology
5ELNA 4H2VA 2EL9A 4KR3A 1E1OA 2ODRD 4HVCA 3CMQA 4P74A 2I4LA 3IKLA 4YRPA 2ZIMA 2DTIA 2DTOA 2CIMA 4LVIA 4YDQA 2ZNIA 2XTIA 4XTUA 1NJ5A 3VBBA 1USYA 1NJ2A 3IG2A 4L87A 3M4QA 3FJPA 1WLEA 4G85A 4UP7A 4CS3A 1HXDA 4YRSA 1IL2A 2CJAA 1SRYA 1E24A 2ZT6A 4OLFA 3EFRA 4Q15A 2A8EA 4UPAA 3L4GB 1WU7A 2ZIOA 1X2HA 3QO8A 2CJBA 4YP0A 1EIYA 1N9WA 4YRTA 2J3MA 1VQZA 1NJ1A 1PYSB 4J15A 3E9HA 4PG3A 3RGLA 4DPGA 1YFTA 1H4VB 4E51A 2DZ9A 4EO4A 4K88A 4P73A 5C52B 3MF2A 3ICAA 3WQZA 2EJGA 4TWAA 3NEMA 2P0LA 3KFUA 3G1ZA 4CS4A 1W66A 2ARTA 4RDXA 2RHQB 4P71A 4HWSA 3BFMA 1ADJA 3A5ZA 3HRIA 1E1TA 3MQZA 4X5OA 2DZCA 3A7AA 1NJ8A 2DU7A 3P8TA 1NJ6A 2Q5HA 3P8YA 1NYQA 4K86A 4H2YA 4CH5A 4XEMA 2DXTA 4RMFA 2ZNJA 2E3CA 2ZZEA 3QO5A 4LNSA 4TQFA 1NNHA 2DDZA 1B76A 4EX5A 4LVJA 2ZGWA 2E10A 3W3SA 2ALYA 3TUPA 2E5AA 2P5IA 3RIRA 3PCOA 4AH6A 1B70A 12ASA 1BIAA 3RKYA 3L4GA 3TEHB 2EJFA 3L1AA 2I4OA 3A5YA 2NS6A 1EIYB 1USYC 1GGMA 1YB3A 4YCVA 4XU0A 4HT4A 4XTVA 1X56A 4H2UA 1EVKA 4P71C 11ASA 5E3IA 4UP8A 3V7RA 4TQDA 1H4SA 2ARUA 3A31A 1ADYA 1BIBA 1J5WA 3HFZB 2CGHA 4KQEA 4WJ4A 4HWRA 2G4CA 3NETA 2ZINA 3A32A 4K87A 4TVWA 3OD1A 2E41A 1X55A 2ZZGA 1YFSA 1ASZA 2ZR2A 2RHQA 2DJZA 2Q7EA 4YCWA 2Q7GA 4LVLA 3HXXA 3I7FA 4H2TA 2DEQA 3PZCA 3BJUA 4YYEA 4Q6GA 1EVLA 4H02A 5HGQA 4NCXA 4ZTUB 3NENA 4XU2A 2ZR3A 4RQEA 2PMFA 4ZTZB 4YRIA 1X2GA 4CH3A 2AKWB 1L0WA 1YGBA 2Q5IA 1WYDA 2RHSA 2EAYA 2DKGA 2ZCEA 1G5IA 4BWAA 1WPYA 3HY0A 2IY5A 3QNEA 3VQXA 1G51A 1X01A 2FYKA 2ZZFA 1ATIA 4H2XA 4TVAA 2E1HA 4RQFA 4P75C 2E65A 2DVEA 3HXUA 4O2DA 4XU1A 1ASYA 3QTCA 4HA8A 3HTZA 4CH4A 4HWPA 3A7RA 3LSQA 4TVAB 3HXYA 1EQRA 1SESA 2ZTGA 1H4TA 2E64A 2QHUA 1KMNA 3E9IA 1H4QA 4P74C 2DTHA 3HXVA 2AKWA 2QHVA 2EJ9A 3HRKA 1QF6A 3DSQA 3V7CA 1B70B 4YCUA 1BBWA 5F5WA 4YROA 2ARSA 4UP9A 3V7SA 4XTYA 4YREA 3MEYA 4YRKA 3UH0A 5C51B 1HC7A 2QHSA 4WJ3M 3QO7A 1Z7MA 2I4NA 4YRMA 4XEOA 1WQ7A 3IALA 3RKXA 3VQVA 4YRNA 2I4MA 3HY1A 4YRGA 3EFSA 1PYSA 1HTTA 2PMEA 1B8AA 4YRLA 4YRCA 4YRJA 1EOVA 5C53B 1X54A 1E22A 3IKMB 3RL6A 3MF1A 4P72A 3VQYA 2C8MA 1BBUA 1SETA 3RACA 4TVYA 4G84A 2HNIA 3RUXA 4XTXA 3NELA 1WQWA 4P75A 2J3LA 1KMMA 1Z7NA 1C0AA 4H2SA 4P3NA 3VQWA 2Q7HA 3LC0A 2EWNA 3HFVA 4P3PA 1NYRA 3M4PA 3REUA 1G5HA 2IY5B 5ELOA 1FYFA 4P3OA 5K1PA 2ZXFA 3V8LA 4LVMA 3UGQA 2XGTA 3TEGA 4XU3A 4DQ2A 3HXWA 1B7YA 1LYLA 1JJCB 1WNLA 2AMCB 2QHTA 3A74A 3UFGA 3HXZA 3A7UA 4PHCA 4YRFA 3RKWA 3R07A 3V8KA 3L2ZA 3PCOB 2RHSB 2DQ0A 1JJCA 4H2WA 4HWTA 2C7IA 4HWOA 1B7YB 3P8VA 1RIQA 4ZIBA 2CJ9A 2ODRC 4TTVA 3V8JA 4YRRA 4P73C 1YFRA 1QE0A 4WI1A 4CH6A 4CS2A 4XTWA 4H2XB 5K1XA 1KOGA 2DQ3A 2DXUA 3RF1A 2ZT7A 5KNNA 4WF2A 4P72C 2DU5A 2ZT8A 2AMCA 1SERA 3TEHA 4BW9A 4YRQA 3HFZA 4KR2A 2ALYB 3LSSA 3UGTA 4OP0A 4LVKA 2ZT5A 4XTZA 1EFWA 3ERRA 4YPFA 3REXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELN A;  4H2V A;  2EL9 A;  4KR3 A;  1E1O A;  2ODR D;  4HVC A;  3CMQ A;  4P74 A;  2I4L A;  3IKL A;  4YRP A;  2ZIM A;  2DTI A;  2DTO A;  2CIM A;  4YDQ A;  2ZNI A;  2XTI A;  4XTU A;  1NJ5 A;  3VBB A;  1USY A;  1NJ2 A;  3IG2 A;  4L87 A;  3M4Q A;  3FJP A;  1WLE A;  4G85 A;  4UP7 A;  4CS3 A;  1HXD A;  4YRS A;  1IL2 A;  2CJA A;  1SRY A;  1E24 A;  2ZT6 A;  4OLF A;  3EFR A;  4Q15 A;  4UPA A;  3L4G B;  1WU7 A;  2ZIO A;  1X2H A;  3QO8 A;  2CJB A;  4YP0 A;  1EIY A;  1N9W A;  4YRT A;  2J3M A;  1VQZ A;  1NJ1 A;  1PYS B;  4J15 A;  3E9H A;  4PG3 A;  3RGL A;  4DPG A;  1YFT A;  1H4V B;  4E51 A;  2DZ9 A;  4EO4 A;  4K88 A;  4P73 A;  5C52 B;  3MF2 A;  3ICA A;  3WQZ A;  2EJG A;  4TWA A;  3NEM A;  2P0L A;  3KFU A;  3G1Z A;  4CS4 A;  1W66 A;  2ART A;  4RDX A;  2RHQ B;  4P71 A;  4HWS A;  3BFM A;  1ADJ A;  3A5Z A;  3HRI A;  1E1T A;  4X5O A;  2DZC A;  3A7A A;  1NJ8 A;  2DU7 A;  3P8T A;  1NJ6 A;  2Q5H A;  3P8Y A;  1NYQ A;  4K86 A;  4H2Y A;  4CH5 A;  4XEM A;  2DXT A;  4RMF A;  2ZNJ A;  2E3C A;  2ZZE A;  3QO5 A;  4LNS A;  4TQF A;  1NNH A;  2DDZ A;  1B76 A;  4EX5 A;  2ZGW A;  2E10 A;  3W3S A;  2ALY A;  3TUP A;  2E5A A;  2P5I A;  3RIR A;  3PCO A;  4AH6 A;  1B70 A;  12AS A;  1BIA A;  3RKY A;  3L4G A;  3TEH B;  2EJF A;  3L1A A;  2I4O A;  3A5Y A;  1EIY B;  1USY C;  1GGM A;  1YB3 A;  4YCV A;  4XU0 A;  4XTV A;  1X56 A;  4H2U A;  1EVK A;  4P71 C;  11AS A;  5E3I A;  4UP8 A;  3V7R A;  4TQD A;  1H4S A;  2ARU A;  3A31 A;  1ADY A;  1BIB A;  1J5W A;  3HFZ B;  2CGH A;  4KQE A;  4WJ4 A;  4HWR A;  2G4C A;  3NET A;  2ZIN A;  3A32 A;  4K87 A;  4TVW A;  3OD1 A;  2E41 A;  1X55 A;  2ZZG A;  1YFS A;  1ASZ A;  2ZR2 A;  2RHQ A;  2DJZ A;  2Q7E A;  4YCW A;  2Q7G A;  3HXX A;  3I7F A;  4H2T A;  2DEQ A;  3PZC A;  3BJU A;  4YYE A;  4Q6G A;  1EVL A;  4H02 A;  5HGQ A;  4NCX A;  4ZTU B;  3NEN A;  4XU2 A;  2ZR3 A;  4RQE A;  2PMF A;  4ZTZ B;  4YRI A;  1X2G A;  4CH3 A;  2AKW B;  1L0W A;  1YGB A;  2Q5I A;  1WYD A;  2RHS A;  2EAY A;  2DKG A;  2ZCE A;  1G5I A;  4BWA A;  1WPY A;  3HY0 A;  2IY5 A;  3QNE A;  3VQX A;  1G51 A;  1X01 A;  2FYK A;  2ZZF A;  1ATI A;  4H2X A;  4TVA A;  2E1H A;  4RQF A;  4P75 C;  2E65 A;  2DVE A;  3HXU A;  4O2D A;  4XU1 A;  1ASY A;  3QTC A;  4HA8 A;  3HTZ A;  4CH4 A;  4HWP A;  3A7R A;  3LSQ A;  4TVA B;  3HXY A;  1EQR A;  1SES A;  2ZTG A;  1H4T A;  2E64 A;  2QHU A;  1KMN A;  3E9I A;  1H4Q A;  4P74 C;  2DTH A;  3HXV A;  2AKW A;  2QHV A;  2EJ9 A;  3HRK A;  1QF6 A;  3DSQ A;  3V7C A;  1B70 B;  4YCU A;  1BBW A;  5F5W A;  4YRO A;  2ARS A;  4UP9 A;  3V7S A;  4XTY A;  4YRE A;  3MEY A;  4YRK A;  3UH0 A;  5C51 B;  1HC7 A;  2QHS A;  4WJ3 M;  3QO7 A;  1Z7M A;  2I4N A;  4YRM A;  4XEO A;  1WQ7 A;  3IAL A;  3RKX A;  3VQV A;  4YRN A;  2I4M A;  3HY1 A;  4YRG A;  3EFS A;  1PYS A;  1HTT A;  2PME A;  1B8A A;  4YRL A;  4YRC A;  4YRJ A;  1EOV A;  5C53 B;  1X54 A;  1E22 A;  3IKM B;  3RL6 A;  3MF1 A;  4P72 A;  3VQY A;  2C8M A;  1BBU A;  1SET A;  3RAC A;  4TVY A;  4G84 A;  2HNI A;  3RUX A;  4XTX A;  3NEL A;  1WQW A;  4P75 A;  2J3L A;  1KMM A;  1Z7N A;  1C0A A;  4H2S A;  4P3N A;  3VQW A;  2Q7H A;  3LC0 A;  2EWN A;  3HFV A;  4P3P A;  1NYR A;  3M4P A;  3REU A;  1G5H A;  2IY5 B;  5ELO A;  1FYF A;  4P3O A;  5K1P A;  2ZXF A;  3V8L A;  3UGQ A;  2XGT A;  3TEG A;  4XU3 A;  4DQ2 A;  3HXW A;  1B7Y A;  1LYL A;  1JJC B;  1WNL A;  2AMC B;  2QHT A;  3A74 A;  3UFG A;  3HXZ A;  3A7U A;  4PHC A;  4YRF A;  3RKW A;  3R07 A;  3V8K A;  3L2Z A;  3PCO B;  2RHS B;  2DQ0 A;  1JJC A;  4H2W A;  4HWT A;  2C7I A;  4HWO A;  1B7Y B;  3P8V A;  1RIQ A;  4ZIB A;  2CJ9 A;  2ODR C;  4TTV A;  3V8J A;  4YRR A;  4P73 C;  1YFR A;  1QE0 A;  4WI1 A;  4CH6 A;  4CS2 A;  4XTW A;  4H2X B;  5K1X A;  1KOG A;  2DQ3 A;  2DXU A;  3RF1 A;  2ZT7 A;  5KNN A;  4WF2 A;  4P72 C;  2DU5 A;  2ZT8 A;  2AMC A;  1SER A;  3TEH A;  4BW9 A;  4YRQ A;  3HFZ A;  4KR2 A;  2ALY B;  3LSS A;  3UGT A;  4OP0 A;  1EFW A;  2ZT5 A;  4XTZ A;  3ERR A;  4YPF A;  3REX A; 
#chains in the Genus database with same CATH topology
 5ELN A;  4H2V A;  2EL9 A;  4KR3 A;  1E1O A;  2ODR D;  4HVC A;  3CMQ A;  4P74 A;  2I4L A;  3IKL A;  4YRP A;  2ZIM A;  2DTI A;  2DTO A;  2CIM A;  4LVI A;  4YDQ A;  2ZNI A;  2XTI A;  4XTU A;  1NJ5 A;  3VBB A;  1USY A;  1NJ2 A;  3IG2 A;  4L87 A;  3M4Q A;  3FJP A;  1WLE A;  4G85 A;  4UP7 A;  4CS3 A;  1HXD A;  4YRS A;  1IL2 A;  2CJA A;  1SRY A;  1E24 A;  2ZT6 A;  4OLF A;  3EFR A;  4Q15 A;  2A8E A;  4UPA A;  3L4G B;  1WU7 A;  2ZIO A;  1X2H A;  3QO8 A;  2CJB A;  4YP0 A;  1EIY A;  1N9W A;  4YRT A;  2J3M A;  1VQZ A;  1NJ1 A;  1PYS B;  4J15 A;  3E9H A;  4PG3 A;  3RGL A;  4DPG A;  1YFT A;  1H4V B;  4E51 A;  2DZ9 A;  4EO4 A;  4K88 A;  4P73 A;  5C52 B;  3MF2 A;  3ICA A;  3WQZ A;  2EJG A;  4TWA A;  3NEM A;  2P0L A;  3KFU A;  3G1Z A;  4CS4 A;  1W66 A;  2ART A;  4RDX A;  2RHQ B;  4P71 A;  4HWS A;  3BFM A;  1ADJ A;  3A5Z A;  3HRI A;  1E1T A;  3MQZ A;  4X5O A;  2DZC A;  3A7A A;  1NJ8 A;  2DU7 A;  3P8T A;  1NJ6 A;  2Q5H A;  3P8Y A;  1NYQ A;  4K86 A;  4H2Y A;  4CH5 A;  4XEM A;  2DXT A;  4RMF A;  2ZNJ A;  2E3C A;  2ZZE A;  3QO5 A;  4LNS A;  4TQF A;  1NNH A;  2DDZ A;  1B76 A;  4EX5 A;  4LVJ A;  2ZGW A;  2E10 A;  3W3S A;  2ALY A;  3TUP A;  2E5A A;  2P5I A;  3RIR A;  3PCO A;  4AH6 A;  1B70 A;  12AS A;  1BIA A;  3RKY A;  3L4G A;  3TEH B;  2EJF A;  3L1A A;  2I4O A;  3A5Y A;  2NS6 A;  1EIY B;  1USY C;  1GGM A;  1YB3 A;  4YCV A;  4XU0 A;  4HT4 A;  4XTV A;  1X56 A;  4H2U A;  1EVK A;  4P71 C;  11AS A;  5E3I A;  4UP8 A;  3V7R A;  4TQD A;  1H4S A;  2ARU A;  3A31 A;  1ADY A;  1BIB A;  1J5W A;  3HFZ B;  2CGH A;  4KQE A;  4WJ4 A;  4HWR A;  2G4C A;  3NET A;  2ZIN A;  3A32 A;  4K87 A;  4TVW A;  3OD1 A;  2E41 A;  1X55 A;  2ZZG A;  1YFS A;  1ASZ A;  2ZR2 A;  2RHQ A;  2DJZ A;  2Q7E A;  4YCW A;  2Q7G A;  4LVL A;  3HXX A;  3I7F A;  4H2T A;  2DEQ A;  3PZC A;  3BJU A;  4YYE A;  4Q6G A;  1EVL A;  4H02 A;  5HGQ A;  4NCX A;  4ZTU B;  3NEN A;  4XU2 A;  2ZR3 A;  4RQE A;  2PMF A;  4ZTZ B;  4YRI A;  1X2G A;  4CH3 A;  2AKW B;  1L0W A;  1YGB A;  2Q5I A;  1WYD A;  2RHS A;  2EAY A;  2DKG A;  2ZCE A;  1G5I A;  4BWA A;  1WPY A;  3HY0 A;  2IY5 A;  3QNE A;  3VQX A;  1G51 A;  1X01 A;  2FYK A;  2ZZF A;  1ATI A;  4H2X A;  4TVA A;  2E1H A;  4RQF A;  4P75 C;  2E65 A;  2DVE A;  3HXU A;  4O2D A;  4XU1 A;  1ASY A;  3QTC A;  4HA8 A;  3HTZ A;  4CH4 A;  4HWP A;  3A7R A;  3LSQ A;  4TVA B;  3HXY A;  1EQR A;  1SES A;  2ZTG A;  1H4T A;  2E64 A;  2QHU A;  1KMN A;  3E9I A;  1H4Q A;  4P74 C;  2DTH A;  3HXV A;  2AKW A;  2QHV A;  2EJ9 A;  3HRK A;  1QF6 A;  3DSQ A;  3V7C A;  1B70 B;  4YCU A;  1BBW A;  5F5W A;  4YRO A;  2ARS A;  4UP9 A;  3V7S A;  4XTY A;  4YRE A;  3MEY A;  4YRK A;  3UH0 A;  5C51 B;  1HC7 A;  2QHS A;  4WJ3 M;  3QO7 A;  1Z7M A;  2I4N A;  4YRM A;  4XEO A;  1WQ7 A;  3IAL A;  3RKX A;  3VQV A;  4YRN A;  2I4M A;  3HY1 A;  4YRG A;  3EFS A;  1PYS A;  1HTT A;  2PME A;  1B8A A;  4YRL A;  4YRC A;  4YRJ A;  1EOV A;  5C53 B;  1X54 A;  1E22 A;  3IKM B;  3RL6 A;  3MF1 A;  4P72 A;  3VQY A;  2C8M A;  1BBU A;  1SET A;  3RAC A;  4TVY A;  4G84 A;  2HNI A;  3RUX A;  4XTX A;  3NEL A;  1WQW A;  4P75 A;  2J3L A;  1KMM A;  1Z7N A;  1C0A A;  4H2S A;  4P3N A;  3VQW A;  2Q7H A;  3LC0 A;  2EWN A;  3HFV A;  4P3P A;  1NYR A;  3M4P A;  3REU A;  1G5H A;  2IY5 B;  5ELO A;  1FYF A;  4P3O A;  5K1P A;  2ZXF A;  3V8L A;  4LVM A;  3UGQ A;  2XGT A;  3TEG A;  4XU3 A;  4DQ2 A;  3HXW A;  1B7Y A;  1LYL A;  1JJC B;  1WNL A;  2AMC B;  2QHT A;  3A74 A;  3UFG A;  3HXZ A;  3A7U A;  4PHC A;  4YRF A;  3RKW A;  3R07 A;  3V8K A;  3L2Z A;  3PCO B;  2RHS B;  2DQ0 A;  1JJC A;  4H2W A;  4HWT A;  2C7I A;  4HWO A;  1B7Y B;  3P8V A;  1RIQ A;  4ZIB A;  2CJ9 A;  2ODR C;  4TTV A;  3V8J A;  4YRR A;  4P73 C;  1YFR A;  1QE0 A;  4WI1 A;  4CH6 A;  4CS2 A;  4XTW A;  4H2X B;  5K1X A;  1KOG A;  2DQ3 A;  2DXU A;  3RF1 A;  2ZT7 A;  5KNN A;  4WF2 A;  4P72 C;  2DU5 A;  2ZT8 A;  2AMC A;  1SER A;  3TEH A;  4BW9 A;  4YRQ A;  3HFZ A;  4KR2 A;  2ALY B;  3LSS A;  3UGT A;  4OP0 A;  4LVK A;  2ZT5 A;  4XTZ A;  1EFW A;  3ERR A;  4YPF A;  3REX A; 
#chains in the Genus database with same CATH homology
 5ELN A;  4H2V A;  2EL9 A;  4KR3 A;  1E1O A;  2ODR D;  4HVC A;  3CMQ A;  4P74 A;  2I4L A;  3IKL A;  4YRP A;  2ZIM A;  2DTI A;  2DTO A;  2CIM A;  4LVI A;  4YDQ A;  2ZNI A;  2XTI A;  4XTU A;  1NJ5 A;  3VBB A;  1USY A;  1NJ2 A;  3IG2 A;  4L87 A;  3M4Q A;  3FJP A;  1WLE A;  4G85 A;  4UP7 A;  4CS3 A;  1HXD A;  4YRS A;  1IL2 A;  2CJA A;  1SRY A;  1E24 A;  2ZT6 A;  4OLF A;  3EFR A;  4Q15 A;  2A8E A;  4UPA A;  3L4G B;  1WU7 A;  2ZIO A;  1X2H A;  3QO8 A;  2CJB A;  4YP0 A;  1EIY A;  1N9W A;  4YRT A;  2J3M A;  1VQZ A;  1NJ1 A;  1PYS B;  4J15 A;  3E9H A;  4PG3 A;  3RGL A;  4DPG A;  1YFT A;  1H4V B;  4E51 A;  2DZ9 A;  4EO4 A;  4K88 A;  4P73 A;  5C52 B;  3MF2 A;  3ICA A;  3WQZ A;  2EJG A;  4TWA A;  3NEM A;  2P0L A;  3KFU A;  3G1Z A;  4CS4 A;  1W66 A;  2ART A;  4RDX A;  2RHQ B;  4P71 A;  4HWS A;  3BFM A;  1ADJ A;  3A5Z A;  3HRI A;  1E1T A;  3MQZ A;  4X5O A;  2DZC A;  3A7A A;  1NJ8 A;  2DU7 A;  3P8T A;  1NJ6 A;  2Q5H A;  3P8Y A;  1NYQ A;  4K86 A;  4H2Y A;  4CH5 A;  4XEM A;  2DXT A;  4RMF A;  2ZNJ A;  2E3C A;  2ZZE A;  3QO5 A;  4LNS A;  4TQF A;  1NNH A;  2DDZ A;  1B76 A;  4EX5 A;  4LVJ A;  2ZGW A;  2E10 A;  3W3S A;  2ALY A;  3TUP A;  2E5A A;  2P5I A;  3RIR A;  3PCO A;  4AH6 A;  1B70 A;  12AS A;  1BIA A;  3RKY A;  3L4G A;  3TEH B;  2EJF A;  3L1A A;  2I4O A;  3A5Y A;  2NS6 A;  1EIY B;  1USY C;  1GGM A;  1YB3 A;  4YCV A;  4XU0 A;  4HT4 A;  4XTV A;  1X56 A;  4H2U A;  1EVK A;  4P71 C;  11AS A;  5E3I A;  4UP8 A;  3V7R A;  4TQD A;  1H4S A;  2ARU A;  3A31 A;  1ADY A;  1BIB A;  1J5W A;  3HFZ B;  2CGH A;  4KQE A;  4WJ4 A;  4HWR A;  2G4C A;  3NET A;  2ZIN A;  3A32 A;  4K87 A;  4TVW A;  3OD1 A;  2E41 A;  1X55 A;  2ZZG A;  1YFS A;  1ASZ A;  2ZR2 A;  2RHQ A;  2DJZ A;  2Q7E A;  4YCW A;  2Q7G A;  4LVL A;  3HXX A;  3I7F A;  4H2T A;  2DEQ A;  3PZC A;  3BJU A;  4YYE A;  4Q6G A;  1EVL A;  4H02 A;  5HGQ A;  4NCX A;  4ZTU B;  3NEN A;  4XU2 A;  2ZR3 A;  4RQE A;  2PMF A;  4ZTZ B;  4YRI A;  1X2G A;  4CH3 A;  2AKW B;  1L0W A;  1YGB A;  2Q5I A;  1WYD A;  2RHS A;  2EAY A;  2DKG A;  2ZCE A;  1G5I A;  4BWA A;  1WPY A;  3HY0 A;  2IY5 A;  3QNE A;  3VQX A;  1G51 A;  1X01 A;  2FYK A;  2ZZF A;  1ATI A;  4H2X A;  4TVA A;  2E1H A;  4RQF A;  4P75 C;  2E65 A;  2DVE A;  3HXU A;  4O2D A;  4XU1 A;  1ASY A;  3QTC A;  4HA8 A;  3HTZ A;  4CH4 A;  4HWP A;  3A7R A;  3LSQ A;  4TVA B;  3HXY A;  1EQR A;  1SES A;  2ZTG A;  1H4T A;  2E64 A;  2QHU A;  1KMN A;  3E9I A;  1H4Q A;  4P74 C;  2DTH A;  3HXV A;  2AKW A;  2QHV A;  2EJ9 A;  3HRK A;  1QF6 A;  3DSQ A;  3V7C A;  1B70 B;  4YCU A;  1BBW A;  5F5W A;  4YRO A;  2ARS A;  4UP9 A;  3V7S A;  4XTY A;  4YRE A;  3MEY A;  4YRK A;  3UH0 A;  5C51 B;  1HC7 A;  2QHS A;  4WJ3 M;  3QO7 A;  1Z7M A;  2I4N A;  4YRM A;  4XEO A;  1WQ7 A;  3IAL A;  3RKX A;  3VQV A;  4YRN A;  2I4M A;  3HY1 A;  4YRG A;  3EFS A;  1PYS A;  1HTT A;  2PME A;  1B8A A;  4YRL A;  4YRC A;  4YRJ A;  1EOV A;  5C53 B;  1X54 A;  1E22 A;  3IKM B;  3RL6 A;  3MF1 A;  4P72 A;  3VQY A;  2C8M A;  1BBU A;  1SET A;  3RAC A;  4TVY A;  4G84 A;  2HNI A;  3RUX A;  4XTX A;  3NEL A;  1WQW A;  4P75 A;  2J3L A;  1KMM A;  1Z7N A;  1C0A A;  4H2S A;  4P3N A;  3VQW A;  2Q7H A;  3LC0 A;  2EWN A;  3HFV A;  4P3P A;  1NYR A;  3M4P A;  3REU A;  1G5H A;  2IY5 B;  5ELO A;  1FYF A;  4P3O A;  5K1P A;  2ZXF A;  3V8L A;  4LVM A;  3UGQ A;  2XGT A;  3TEG A;  4XU3 A;  4DQ2 A;  3HXW A;  1B7Y A;  1LYL A;  1JJC B;  1WNL A;  2AMC B;  2QHT A;  3A74 A;  3UFG A;  3HXZ A;  3A7U A;  4PHC A;  4YRF A;  3RKW A;  3R07 A;  3V8K A;  3L2Z A;  3PCO B;  2RHS B;  2DQ0 A;  1JJC A;  4H2W A;  4HWT A;  2C7I A;  4HWO A;  1B7Y B;  3P8V A;  1RIQ A;  4ZIB A;  2CJ9 A;  2ODR C;  4TTV A;  3V8J A;  4YRR A;  4P73 C;  1YFR A;  1QE0 A;  4WI1 A;  4CH6 A;  4CS2 A;  4XTW A;  4H2X B;  5K1X A;  1KOG A;  2DQ3 A;  2DXU A;  3RF1 A;  2ZT7 A;  5KNN A;  4WF2 A;  4P72 C;  2DU5 A;  2ZT8 A;  2AMC A;  1SER A;  3TEH A;  4BW9 A;  4YRQ A;  3HFZ A;  4KR2 A;  2ALY B;  3LSS A;  3UGT A;  4OP0 A;  4LVK A;  2ZT5 A;  4XTZ A;  1EFW A;  3ERR A;  4YPF A;  3REX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...