4P73C

Phers in complex with compound 1a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
251
structure length
239
Chain Sequence
AAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
total genus 64
structure length 239
sequence length 251
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p73C01
1USYA 4P75C 4UP8A 3P8YA 4YCUA 1ATIA 2AKWA 1WYDA 1B70A 3HXZA 4P73A 2EJFA 3V8KA 2ARSA 2RHSA 2DQ0A 3IG2A 11ASA 4O2DA 4P72A 2ZCEA 3HXYA 1QF6A 1G5IA 4UP7A 5ELOA 4AH6A 4K86A 3RL6A 1B7YA 4YCVA 3P8VA 3A5YA 4G85A 2DTIA 2P5IA 3A32A 2QHTA 4TQDA 4YRGA 2DTHA 3ERRA 2RHQA 1X56A 3HFZA 2ZGWA 3V7SA 3RACA 3V7CA 1BBUA 1WQWA 4K87A 4YDQA 1ASYA 2AMCA 1YFTA 3UGTA 4P3NA 3RGLA 3HY0A 2J3MA 4H2XA 1BIAA 4P74A 1EIYA 1ADJA 4KR3A 2CJBA 4HA8A 2ODRD 4YCWA 4TVYA 4TVAB 4XTWA 3TUPA 1WU7A 4H2UA 2DXUA 4P75A 4OP0A 2I4OA 1C0AA 3NENA 1BBWA 3PZCA 3RF1A 3UH0A 4RQFA 3NELA 1FYFA 2ZINA 3IALA 2QHSA 1L0WA 4KR2A 2C8MA 2E5AA 3E9IA 3A31A 2QHVA 3QNEA 3LC0A 3HRKA 2IY5A 1HTTA 4CS3A 2E65A 2Q5HA 3M4QA 2I4MA 3L4GA 2DDZA 4EO4A 2C7IA 3NETA 4HWOA 5KNNA 4YRRA 1E22A 4YRIA 2CGHA 1H4VB 4XEMA 4YRMA 2ALYA 2ZT7A 3REXA 3VQVA 1E1OA 4G84A 3VQYA 4ZTUB 1WPYA 4HWRA 1E1TA 5K1XA 3A7AA 1PYSA 4E51A 2ZT8A 3VBBA 4BWAA 4HWTA 3TEGA 1BIBA 1EVLA 3V8LA 3I7FA 4YRKA 2ZIMA 4LNSA 4PHCA 3HFZB 3MF2A 3EFRA 5C52B 3A74A 1LYLA 4YP0A 4BW9A 3A7UA 2DZ9A 3PCOA 1X54A 4XTZA 2AMCB 2PMFA 3V8JA 1H4QA 2DVEA 5ELNA 4YRCA 5F5WA 2ZR3A 3V7RA 4H2XB 1NJ8A 5C51B 1EIYB 4YREA 1YB3A 1H4SA 1NJ6A 4HWPA 4YPFA 4DPGA 4CH4A 2DKGA 4CS4A 1X01A 4WJ3M 1WNLA 3REUA 4YRJA 4CH5A 2DU5A 1SERA 4XTYA 3MF1A 2ZIOA 3VQWA 3HXXA 4Q6GA 4YRPA 4XU2A 4YRNA 3CMQA 1SETA 1ADYA 2ZXFA 1SRYA 2ZT6A 1JJCB 2EWNA 1WQ7A 3IKMB 4L87A 4XTVA 1X55A 1W66A 2Q5IA 3HXWA 2G4CA 2DU7A 3QO7A 4RDXA 3QTCA 5HGQA 3WQZA 4XTUA 3QO5A 4TTVA 4YYEA 2ZZEA 1GGMA 1VQZA 4CH3A 3DSQA 2E10A 3HXVA 4WF2A 2FYKA 4YRSA 3RKXA 4YRFA 3HY1A 1KOGA 3L2ZA 2XTIA 4H2TA 3TEHA 2AKWB 3L1AA 4CS2A 1EOVA 1B70B 4TVAA 3MEYA 3RKWA 2RHSB 4XU0A 1NNHA 1B8AA 2EL9A 4XTXA 4XU3A 1E24A 3BFMA 1ASZA 2HNIA 1B7YB 4DQ2A 5C53B 4H2WA 4YRTA 1EVKA 4RQEA 1NYRA 1Z7MA 3RUXA 3OD1A 2RHQB 4H2VA 1B76A 1X2GA 2EJ9A 1NJ1A 1SESA 4ZTZB 3W3SA 4KQEA 2E64A 2ZZFA 4YRLA 1EQRA 4CH6A 5K1PA 1YFRA 4X5OA 1HC7A 2XGTA 1G51A 4J15A 2ODRC 2E41A 1YGBA 2PMEA 2ZTGA 1QE0A 2ZR2A 2CJAA 2EAYA 1J5WA 3KFUA 3VQXA 3EFSA 2E3CA 2DQ3A 4H02A 3P8TA 3E9HA 2QHUA 3LSQA 1IL2A 4P71C 4YROA 1Z7NA 2DXTA 4RMFA 4NCXA 2P0LA 2ARUA 2J3LA 2IY5B 2Q7EA 2E1HA 4WI1A 4XEOA 3UFGA 4HWSA 1USYC 2CIMA 4UP9A 2I4LA 4ZIBA 4OLFA 3L4GB 3IKLA 3BJUA 3FJPA 1RIQA 4EX5A 3TEHB 4P73C 3R07A 3NEMA 2EJGA 1HXDA 4P72C 2ALYB 1N9WA 2ZT5A 1G5HA 4P3OA 2DZCA 4P3PA 3HTZA 4TWAA 1NJ2A 1PYSB 4XU1A 12ASA 3QO8A 5E3IA 3RIRA 4TVWA 1NYQA 1YFSA 4UPAA 1EFWA 3RKYA 2ZNIA 3HXUA 1JJCA 1KMMA 3HRIA 4YRQA 2CJ9A 4WJ4A 1X2HA 2ZNJA 1KMNA 3A5ZA 3PCOB 2DJZA 3UGQA 4P71A 4H2YA 4HVCA 4TQFA 3M4PA 1NJ5A 2ARTA 2I4NA 3A7RA 1H4TA 3HFVA 4P74C 2Q7HA 4H2SA 3G1ZA 2DEQA 2ZZGA 1WLEA 3LSSA 4K88A 4PG3A 4Q15A 2Q7GA 2DTOA 3ICAA
chains in the Genus database with same CATH superfamily
1USYA 4P75C 4UP8A 3P8YA 4YCUA 1ATIA 2AKWA 1WYDA 1B70A 3HXZA 4P73A 2EJFA 3V8KA 2ARSA 2RHSA 2DQ0A 3IG2A 11ASA 4O2DA 4P72A 2ZCEA 3HXYA 1QF6A 1G5IA 4UP7A 5ELOA 4AH6A 4K86A 3RL6A 4LVKA 1B7YA 4YCVA 3P8VA 3A5YA 4G85A 2DTIA 2P5IA 3A32A 2QHTA 4TQDA 4YRGA 2DTHA 3ERRA 2RHQA 1X56A 3HFZA 2ZGWA 3V7SA 3RACA 3V7CA 1BBUA 1WQWA 4K87A 4YDQA 1ASYA 2AMCA 1YFTA 3UGTA 4P3NA 3RGLA 3HY0A 2J3MA 4H2XA 1BIAA 4P74A 1EIYA 1ADJA 4KR3A 2CJBA 4HA8A 2ODRD 4YCWA 4TVYA 4TVAB 4XTWA 3TUPA 1WU7A 4H2UA 2DXUA 4P75A 4OP0A 2I4OA 1C0AA 3NENA 1BBWA 3PZCA 3RF1A 3UH0A 4RQFA 3NELA 1FYFA 2ZINA 3IALA 2QHSA 1L0WA 4KR2A 2C8MA 2E5AA 3E9IA 3A31A 2QHVA 3QNEA 3LC0A 3HRKA 2IY5A 1HTTA 4CS3A 2E65A 2Q5HA 3M4QA 2I4MA 3L4GA 2DDZA 4EO4A 2C7IA 3NETA 4HWOA 5KNNA 4YRRA 1E22A 4YRIA 2CGHA 1H4VB 4XEMA 4YRMA 2ALYA 2ZT7A 3REXA 3VQVA 1E1OA 4G84A 3VQYA 4ZTUB 1WPYA 4HWRA 1E1TA 5K1XA 2NS6A 3A7AA 1PYSA 4E51A 2ZT8A 3VBBA 4BWAA 4HWTA 3TEGA 1BIBA 1EVLA 3V8LA 3I7FA 4YRKA 2ZIMA 4LNSA 4PHCA 3HFZB 3MF2A 3EFRA 5C52B 3A74A 1LYLA 4YP0A 4BW9A 3A7UA 2DZ9A 3PCOA 1X54A 4XTZA 2AMCB 2PMFA 3V8JA 1H4QA 2DVEA 5ELNA 4YRCA 5F5WA 2ZR3A 3V7RA 4H2XB 1NJ8A 5C51B 1EIYB 4YREA 4HT4A 1YB3A 1H4SA 1NJ6A 4HWPA 4YPFA 4DPGA 4CH4A 2DKGA 4CS4A 1X01A 4WJ3M 4LVJA 1WNLA 3REUA 4YRJA 4CH5A 2DU5A 1SERA 4XTYA 3MF1A 2ZIOA 3VQWA 3HXXA 4Q6GA 3MQZA 4YRPA 4XU2A 4YRNA 3CMQA 1SETA 1ADYA 2ZXFA 1SRYA 2ZT6A 1JJCB 2EWNA 1WQ7A 3IKMB 4L87A 4XTVA 1X55A 1W66A 2Q5IA 3HXWA 2G4CA 2DU7A 3QO7A 4RDXA 3QTCA 5HGQA 3WQZA 4XTUA 3QO5A 4TTVA 4YYEA 2ZZEA 1GGMA 1VQZA 4CH3A 3DSQA 2E10A 3HXVA 4WF2A 2FYKA 4YRSA 3RKXA 4YRFA 3HY1A 1KOGA 3L2ZA 2XTIA 4H2TA 3TEHA 2AKWB 3L1AA 4CS2A 1EOVA 1B70B 4TVAA 3MEYA 3RKWA 2RHSB 4XU0A 1NNHA 1B8AA 2EL9A 4XTXA 4XU3A 1E24A 4LVLA 3BFMA 1ASZA 2HNIA 1B7YB 4DQ2A 5C53B 4H2WA 4YRTA 1EVKA 4RQEA 1NYRA 1Z7MA 2A8EA 3RUXA 3OD1A 2RHQB 4H2VA 1B76A 1X2GA 2EJ9A 1NJ1A 1SESA 4ZTZB 3W3SA 4KQEA 2E64A 2ZZFA 4YRLA 1EQRA 4CH6A 5K1PA 1YFRA 4X5OA 1HC7A 2XGTA 1G51A 4J15A 2ODRC 2E41A 1YGBA 2PMEA 2ZTGA 1QE0A 2ZR2A 2CJAA 2EAYA 1J5WA 3KFUA 3VQXA 3EFSA 2E3CA 2DQ3A 4H02A 3P8TA 3E9HA 2QHUA 3LSQA 1IL2A 4P71C 4YROA 1Z7NA 2DXTA 4RMFA 4NCXA 2P0LA 2ARUA 2J3LA 2IY5B 2Q7EA 2E1HA 4WI1A 4XEOA 3UFGA 4HWSA 1USYC 2CIMA 4UP9A 2I4LA 4ZIBA 4OLFA 3L4GB 3IKLA 3BJUA 3FJPA 1RIQA 4EX5A 3TEHB 4P73C 3R07A 3NEMA 2EJGA 1HXDA 4P72C 2ALYB 1N9WA 2ZT5A 1G5HA 4P3OA 2DZCA 4P3PA 3HTZA 4TWAA 1NJ2A 1PYSB 4XU1A 12ASA 3QO8A 5E3IA 3RIRA 4TVWA 1NYQA 1YFSA 4UPAA 1EFWA 3RKYA 2ZNIA 4LVMA 3HXUA 1JJCA 1KMMA 3HRIA 4YRQA 2CJ9A 4WJ4A 1X2HA 2ZNJA 1KMNA 3A5ZA 3PCOB 2DJZA 3UGQA 4P71A 4H2YA 4HVCA 4TQFA 3M4PA 1NJ5A 2ARTA 2I4NA 3A7RA 1H4TA 3HFVA 4P74C 2Q7HA 4LVIA 4H2SA 3G1ZA 2DEQA 2ZZGA 1WLEA 3LSSA 4K88A 4PG3A 4Q15A 2Q7GA 2DTOA 3ICAA
chains in the Genus database with same CATH topology
1USYA 4P75C 4UP8A 3P8YA 4YCUA 1ATIA 2AKWA 1WYDA 1B70A 3HXZA 4P73A 2EJFA 3V8KA 2ARSA 2RHSA 2DQ0A 3IG2A 11ASA 4O2DA 4P72A 2ZCEA 3HXYA 1QF6A 1G5IA 4UP7A 5ELOA 4AH6A 4K86A 3RL6A 4LVKA 1B7YA 4YCVA 3P8VA 3A5YA 4G85A 2DTIA 2P5IA 3A32A 2QHTA 4TQDA 4YRGA 2DTHA 3ERRA 2RHQA 1X56A 3HFZA 2ZGWA 3V7SA 3RACA 3V7CA 1BBUA 1WQWA 4K87A 4YDQA 1ASYA 2AMCA 1YFTA 3UGTA 4P3NA 3RGLA 3HY0A 2J3MA 4H2XA 1BIAA 4P74A 1EIYA 1ADJA 4KR3A 2CJBA 4HA8A 2ODRD 4YCWA 4TVYA 4TVAB 4XTWA 3TUPA 1WU7A 4H2UA 2DXUA 4P75A 4OP0A 2I4OA 1C0AA 3NENA 1BBWA 3PZCA 3RF1A 3UH0A 4RQFA 3NELA 1FYFA 2ZINA 3IALA 2QHSA 1L0WA 4KR2A 2C8MA 2E5AA 3E9IA 3A31A 2QHVA 3QNEA 3LC0A 3HRKA 2IY5A 1HTTA 4CS3A 2E65A 2Q5HA 3M4QA 2I4MA 3L4GA 2DDZA 4EO4A 2C7IA 3NETA 4HWOA 5KNNA 4YRRA 1E22A 4YRIA 2CGHA 1H4VB 4XEMA 4YRMA 2ALYA 2ZT7A 3REXA 3VQVA 1E1OA 4G84A 3VQYA 4ZTUB 1WPYA 4HWRA 1E1TA 5K1XA 2NS6A 3A7AA 1PYSA 4E51A 2ZT8A 3VBBA 4BWAA 4HWTA 3TEGA 1BIBA 1EVLA 3V8LA 3I7FA 4YRKA 2ZIMA 4LNSA 4PHCA 3HFZB 3MF2A 3EFRA 5C52B 3A74A 1LYLA 4YP0A 4BW9A 3A7UA 2DZ9A 3PCOA 1X54A 4XTZA 2AMCB 2PMFA 3V8JA 1H4QA 2DVEA 5ELNA 4YRCA 5F5WA 2ZR3A 3V7RA 4H2XB 1NJ8A 5C51B 1EIYB 4YREA 4HT4A 1YB3A 1H4SA 1NJ6A 4HWPA 4YPFA 4DPGA 4CH4A 2DKGA 4CS4A 1X01A 4WJ3M 4LVJA 1WNLA 3REUA 4YRJA 4CH5A 2DU5A 1SERA 4XTYA 3MF1A 2ZIOA 3VQWA 3HXXA 4Q6GA 3MQZA 4YRPA 4XU2A 4YRNA 3CMQA 1SETA 1ADYA 2ZXFA 1SRYA 2ZT6A 1JJCB 2EWNA 1WQ7A 3IKMB 4L87A 4XTVA 1X55A 1W66A 2Q5IA 3HXWA 2G4CA 2DU7A 3QO7A 4RDXA 3QTCA 5HGQA 3WQZA 4XTUA 3QO5A 4TTVA 4YYEA 2ZZEA 1GGMA 1VQZA 4CH3A 3DSQA 2E10A 3HXVA 4WF2A 2FYKA 4YRSA 3RKXA 4YRFA 3HY1A 1KOGA 3L2ZA 2XTIA 4H2TA 3TEHA 2AKWB 3L1AA 4CS2A 1EOVA 1B70B 4TVAA 3MEYA 3RKWA 2RHSB 4XU0A 1NNHA 1B8AA 2EL9A 4XTXA 4XU3A 1E24A 4LVLA 3BFMA 1ASZA 2HNIA 1B7YB 4DQ2A 5C53B 4H2WA 4YRTA 1EVKA 4RQEA 1NYRA 1Z7MA 2A8EA 3RUXA 3OD1A 2RHQB 4H2VA 1B76A 1X2GA 2EJ9A 1NJ1A 1SESA 4ZTZB 3W3SA 4KQEA 2E64A 2ZZFA 4YRLA 1EQRA 4CH6A 5K1PA 1YFRA 4X5OA 1HC7A 2XGTA 1G51A 4J15A 2ODRC 2E41A 1YGBA 2PMEA 2ZTGA 1QE0A 2ZR2A 2CJAA 2EAYA 1J5WA 3KFUA 3VQXA 3EFSA 2E3CA 2DQ3A 4H02A 3P8TA 3E9HA 2QHUA 3LSQA 1IL2A 4P71C 4YROA 1Z7NA 2DXTA 4RMFA 4NCXA 2P0LA 2ARUA 2J3LA 2IY5B 2Q7EA 2E1HA 4WI1A 4XEOA 3UFGA 4HWSA 1USYC 2CIMA 4UP9A 2I4LA 4ZIBA 4OLFA 3L4GB 3IKLA 3BJUA 3FJPA 1RIQA 4EX5A 3TEHB 4P73C 3R07A 3NEMA 2EJGA 1HXDA 4P72C 2ALYB 1N9WA 2ZT5A 1G5HA 4P3OA 2DZCA 4P3PA 3HTZA 4TWAA 1NJ2A 1PYSB 4XU1A 12ASA 3QO8A 5E3IA 3RIRA 4TVWA 1NYQA 1YFSA 4UPAA 1EFWA 3RKYA 2ZNIA 4LVMA 3HXUA 1JJCA 1KMMA 3HRIA 4YRQA 2CJ9A 4WJ4A 1X2HA 2ZNJA 1KMNA 3A5ZA 3PCOB 2DJZA 3UGQA 4P71A 4H2YA 4HVCA 4TQFA 3M4PA 1NJ5A 2ARTA 2I4NA 3A7RA 1H4TA 3HFVA 4P74C 2Q7HA 4LVIA 4H2SA 3G1ZA 2DEQA 2ZZGA 1WLEA 3LSSA 4K88A 4PG3A 4Q15A 2Q7GA 2DTOA 3ICAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USY A;  4P75 C;  4UP8 A;  3P8Y A;  4YCU A;  1ATI A;  2AKW A;  1WYD A;  1B70 A;  3HXZ A;  4P73 A;  2EJF A;  3V8K A;  2ARS A;  2RHS A;  2DQ0 A;  3IG2 A;  11AS A;  4O2D A;  4P72 A;  2ZCE A;  3HXY A;  1QF6 A;  1G5I A;  4UP7 A;  5ELO A;  4AH6 A;  4K86 A;  3RL6 A;  1B7Y A;  4YCV A;  3P8V A;  3A5Y A;  4G85 A;  2DTI A;  2P5I A;  3A32 A;  2QHT A;  4TQD A;  4YRG A;  2DTH A;  3ERR A;  2RHQ A;  1X56 A;  3HFZ A;  2ZGW A;  3V7S A;  3RAC A;  3V7C A;  1BBU A;  1WQW A;  4K87 A;  4YDQ A;  1ASY A;  2AMC A;  1YFT A;  3UGT A;  4P3N A;  3RGL A;  3HY0 A;  2J3M A;  4H2X A;  1BIA A;  4P74 A;  1EIY A;  1ADJ A;  4KR3 A;  2CJB A;  4HA8 A;  2ODR D;  4YCW A;  4TVY A;  4TVA B;  4XTW A;  3TUP A;  1WU7 A;  4H2U A;  2DXU A;  4P75 A;  4OP0 A;  2I4O A;  1C0A A;  3NEN A;  1BBW A;  3PZC A;  3RF1 A;  3UH0 A;  4RQF A;  3NEL A;  1FYF A;  2ZIN A;  3IAL A;  2QHS A;  1L0W A;  4KR2 A;  2C8M A;  2E5A A;  3E9I A;  3A31 A;  2QHV A;  3QNE A;  3LC0 A;  3HRK A;  2IY5 A;  1HTT A;  4CS3 A;  2E65 A;  2Q5H A;  3M4Q A;  2I4M A;  3L4G A;  2DDZ A;  4EO4 A;  2C7I A;  3NET A;  4HWO A;  5KNN A;  4YRR A;  1E22 A;  4YRI A;  2CGH A;  1H4V B;  4XEM A;  4YRM A;  2ALY A;  2ZT7 A;  3REX A;  3VQV A;  1E1O A;  4G84 A;  3VQY A;  4ZTU B;  1WPY A;  4HWR A;  1E1T A;  5K1X A;  3A7A A;  1PYS A;  4E51 A;  2ZT8 A;  3VBB A;  4BWA A;  4HWT A;  3TEG A;  1BIB A;  1EVL A;  3V8L A;  3I7F A;  4YRK A;  2ZIM A;  4LNS A;  4PHC A;  3HFZ B;  3MF2 A;  3EFR A;  5C52 B;  3A74 A;  1LYL A;  4YP0 A;  4BW9 A;  3A7U A;  2DZ9 A;  3PCO A;  1X54 A;  4XTZ A;  2AMC B;  2PMF A;  3V8J A;  1H4Q A;  2DVE A;  5ELN A;  4YRC A;  5F5W A;  2ZR3 A;  3V7R A;  4H2X B;  1NJ8 A;  5C51 B;  1EIY B;  4YRE A;  1YB3 A;  1H4S A;  1NJ6 A;  4HWP A;  4YPF A;  4DPG A;  4CH4 A;  2DKG A;  4CS4 A;  1X01 A;  4WJ3 M;  1WNL A;  3REU A;  4YRJ A;  4CH5 A;  2DU5 A;  1SER A;  4XTY A;  3MF1 A;  2ZIO A;  3VQW A;  3HXX A;  4Q6G A;  4YRP A;  4XU2 A;  4YRN A;  3CMQ A;  1SET A;  1ADY A;  2ZXF A;  1SRY A;  2ZT6 A;  1JJC B;  2EWN A;  1WQ7 A;  3IKM B;  4L87 A;  4XTV A;  1X55 A;  1W66 A;  2Q5I A;  3HXW A;  2G4C A;  2DU7 A;  3QO7 A;  4RDX A;  3QTC A;  5HGQ A;  3WQZ A;  4XTU A;  3QO5 A;  4TTV A;  4YYE A;  2ZZE A;  1GGM A;  1VQZ A;  4CH3 A;  3DSQ A;  2E10 A;  3HXV A;  4WF2 A;  2FYK A;  4YRS A;  3RKX A;  4YRF A;  3HY1 A;  1KOG A;  3L2Z A;  2XTI A;  4H2T A;  3TEH A;  2AKW B;  3L1A A;  4CS2 A;  1EOV A;  1B70 B;  4TVA A;  3MEY A;  3RKW A;  2RHS B;  4XU0 A;  1NNH A;  1B8A A;  2EL9 A;  4XTX A;  4XU3 A;  1E24 A;  3BFM A;  1ASZ A;  2HNI A;  1B7Y B;  4DQ2 A;  5C53 B;  4H2W A;  4YRT A;  1EVK A;  4RQE A;  1NYR A;  1Z7M A;  3RUX A;  3OD1 A;  2RHQ B;  4H2V A;  1B76 A;  1X2G A;  2EJ9 A;  1NJ1 A;  1SES A;  4ZTZ B;  3W3S A;  4KQE A;  2E64 A;  2ZZF A;  4YRL A;  1EQR A;  4CH6 A;  5K1P A;  1YFR A;  4X5O A;  1HC7 A;  2XGT A;  1G51 A;  4J15 A;  2ODR C;  2E41 A;  1YGB A;  2PME A;  2ZTG A;  1QE0 A;  2ZR2 A;  2CJA A;  2EAY A;  1J5W A;  3KFU A;  3VQX A;  3EFS A;  2E3C A;  2DQ3 A;  4H02 A;  3P8T A;  3E9H A;  2QHU A;  3LSQ A;  1IL2 A;  4P71 C;  4YRO A;  1Z7N A;  2DXT A;  4RMF A;  4NCX A;  2P0L A;  2ARU A;  2J3L A;  2IY5 B;  2Q7E A;  2E1H A;  4WI1 A;  4XEO A;  3UFG A;  4HWS A;  1USY C;  2CIM A;  4UP9 A;  2I4L A;  4ZIB A;  4OLF A;  3L4G B;  3IKL A;  3BJU A;  3FJP A;  1RIQ A;  4EX5 A;  3TEH B;  4P73 C;  3R07 A;  3NEM A;  2EJG A;  1HXD A;  4P72 C;  2ALY B;  1N9W A;  2ZT5 A;  1G5H A;  4P3O A;  2DZC A;  4P3P A;  3HTZ A;  4TWA A;  1NJ2 A;  1PYS B;  4XU1 A;  12AS A;  3QO8 A;  5E3I A;  3RIR A;  4TVW A;  1NYQ A;  1YFS A;  4UPA A;  1EFW A;  3RKY A;  2ZNI A;  3HXU A;  1JJC A;  1KMM A;  3HRI A;  4YRQ A;  2CJ9 A;  4WJ4 A;  1X2H A;  2ZNJ A;  1KMN A;  3A5Z A;  3PCO B;  2DJZ A;  3UGQ A;  4P71 A;  4H2Y A;  4HVC A;  4TQF A;  3M4P A;  1NJ5 A;  2ART A;  2I4N A;  3A7R A;  1H4T A;  3HFV A;  4P74 C;  2Q7H A;  4H2S A;  3G1Z A;  2DEQ A;  2ZZG A;  1WLE A;  3LSS A;  4K88 A;  4PG3 A;  4Q15 A;  2Q7G A;  2DTO A;  3ICA A; 
#chains in the Genus database with same CATH topology
 1USY A;  4P75 C;  4UP8 A;  3P8Y A;  4YCU A;  1ATI A;  2AKW A;  1WYD A;  1B70 A;  3HXZ A;  4P73 A;  2EJF A;  3V8K A;  2ARS A;  2RHS A;  2DQ0 A;  3IG2 A;  11AS A;  4O2D A;  4P72 A;  2ZCE A;  3HXY A;  1QF6 A;  1G5I A;  4UP7 A;  5ELO A;  4AH6 A;  4K86 A;  3RL6 A;  4LVK A;  1B7Y A;  4YCV A;  3P8V A;  3A5Y A;  4G85 A;  2DTI A;  2P5I A;  3A32 A;  2QHT A;  4TQD A;  4YRG A;  2DTH A;  3ERR A;  2RHQ A;  1X56 A;  3HFZ A;  2ZGW A;  3V7S A;  3RAC A;  3V7C A;  1BBU A;  1WQW A;  4K87 A;  4YDQ A;  1ASY A;  2AMC A;  1YFT A;  3UGT A;  4P3N A;  3RGL A;  3HY0 A;  2J3M A;  4H2X A;  1BIA A;  4P74 A;  1EIY A;  1ADJ A;  4KR3 A;  2CJB A;  4HA8 A;  2ODR D;  4YCW A;  4TVY A;  4TVA B;  4XTW A;  3TUP A;  1WU7 A;  4H2U A;  2DXU A;  4P75 A;  4OP0 A;  2I4O A;  1C0A A;  3NEN A;  1BBW A;  3PZC A;  3RF1 A;  3UH0 A;  4RQF A;  3NEL A;  1FYF A;  2ZIN A;  3IAL A;  2QHS A;  1L0W A;  4KR2 A;  2C8M A;  2E5A A;  3E9I A;  3A31 A;  2QHV A;  3QNE A;  3LC0 A;  3HRK A;  2IY5 A;  1HTT A;  4CS3 A;  2E65 A;  2Q5H A;  3M4Q A;  2I4M A;  3L4G A;  2DDZ A;  4EO4 A;  2C7I A;  3NET A;  4HWO A;  5KNN A;  4YRR A;  1E22 A;  4YRI A;  2CGH A;  1H4V B;  4XEM A;  4YRM A;  2ALY A;  2ZT7 A;  3REX A;  3VQV A;  1E1O A;  4G84 A;  3VQY A;  4ZTU B;  1WPY A;  4HWR A;  1E1T A;  5K1X A;  2NS6 A;  3A7A A;  1PYS A;  4E51 A;  2ZT8 A;  3VBB A;  4BWA A;  4HWT A;  3TEG A;  1BIB A;  1EVL A;  3V8L A;  3I7F A;  4YRK A;  2ZIM A;  4LNS A;  4PHC A;  3HFZ B;  3MF2 A;  3EFR A;  5C52 B;  3A74 A;  1LYL A;  4YP0 A;  4BW9 A;  3A7U A;  2DZ9 A;  3PCO A;  1X54 A;  4XTZ A;  2AMC B;  2PMF A;  3V8J A;  1H4Q A;  2DVE A;  5ELN A;  4YRC A;  5F5W A;  2ZR3 A;  3V7R A;  4H2X B;  1NJ8 A;  5C51 B;  1EIY B;  4YRE A;  4HT4 A;  1YB3 A;  1H4S A;  1NJ6 A;  4HWP A;  4YPF A;  4DPG A;  4CH4 A;  2DKG A;  4CS4 A;  1X01 A;  4WJ3 M;  4LVJ A;  1WNL A;  3REU A;  4YRJ A;  4CH5 A;  2DU5 A;  1SER A;  4XTY A;  3MF1 A;  2ZIO A;  3VQW A;  3HXX A;  4Q6G A;  3MQZ A;  4YRP A;  4XU2 A;  4YRN A;  3CMQ A;  1SET A;  1ADY A;  2ZXF A;  1SRY A;  2ZT6 A;  1JJC B;  2EWN A;  1WQ7 A;  3IKM B;  4L87 A;  4XTV A;  1X55 A;  1W66 A;  2Q5I A;  3HXW A;  2G4C A;  2DU7 A;  3QO7 A;  4RDX A;  3QTC A;  5HGQ A;  3WQZ A;  4XTU A;  3QO5 A;  4TTV A;  4YYE A;  2ZZE A;  1GGM A;  1VQZ A;  4CH3 A;  3DSQ A;  2E10 A;  3HXV A;  4WF2 A;  2FYK A;  4YRS A;  3RKX A;  4YRF A;  3HY1 A;  1KOG A;  3L2Z A;  2XTI A;  4H2T A;  3TEH A;  2AKW B;  3L1A A;  4CS2 A;  1EOV A;  1B70 B;  4TVA A;  3MEY A;  3RKW A;  2RHS B;  4XU0 A;  1NNH A;  1B8A A;  2EL9 A;  4XTX A;  4XU3 A;  1E24 A;  4LVL A;  3BFM A;  1ASZ A;  2HNI A;  1B7Y B;  4DQ2 A;  5C53 B;  4H2W A;  4YRT A;  1EVK A;  4RQE A;  1NYR A;  1Z7M A;  2A8E A;  3RUX A;  3OD1 A;  2RHQ B;  4H2V A;  1B76 A;  1X2G A;  2EJ9 A;  1NJ1 A;  1SES A;  4ZTZ B;  3W3S A;  4KQE A;  2E64 A;  2ZZF A;  4YRL A;  1EQR A;  4CH6 A;  5K1P A;  1YFR A;  4X5O A;  1HC7 A;  2XGT A;  1G51 A;  4J15 A;  2ODR C;  2E41 A;  1YGB A;  2PME A;  2ZTG A;  1QE0 A;  2ZR2 A;  2CJA A;  2EAY A;  1J5W A;  3KFU A;  3VQX A;  3EFS A;  2E3C A;  2DQ3 A;  4H02 A;  3P8T A;  3E9H A;  2QHU A;  3LSQ A;  1IL2 A;  4P71 C;  4YRO A;  1Z7N A;  2DXT A;  4RMF A;  4NCX A;  2P0L A;  2ARU A;  2J3L A;  2IY5 B;  2Q7E A;  2E1H A;  4WI1 A;  4XEO A;  3UFG A;  4HWS A;  1USY C;  2CIM A;  4UP9 A;  2I4L A;  4ZIB A;  4OLF A;  3L4G B;  3IKL A;  3BJU A;  3FJP A;  1RIQ A;  4EX5 A;  3TEH B;  4P73 C;  3R07 A;  3NEM A;  2EJG A;  1HXD A;  4P72 C;  2ALY B;  1N9W A;  2ZT5 A;  1G5H A;  4P3O A;  2DZC A;  4P3P A;  3HTZ A;  4TWA A;  1NJ2 A;  1PYS B;  4XU1 A;  12AS A;  3QO8 A;  5E3I A;  3RIR A;  4TVW A;  1NYQ A;  1YFS A;  4UPA A;  1EFW A;  3RKY A;  2ZNI A;  4LVM A;  3HXU A;  1JJC A;  1KMM A;  3HRI A;  4YRQ A;  2CJ9 A;  4WJ4 A;  1X2H A;  2ZNJ A;  1KMN A;  3A5Z A;  3PCO B;  2DJZ A;  3UGQ A;  4P71 A;  4H2Y A;  4HVC A;  4TQF A;  3M4P A;  1NJ5 A;  2ART A;  2I4N A;  3A7R A;  1H4T A;  3HFV A;  4P74 C;  2Q7H A;  4LVI A;  4H2S A;  3G1Z A;  2DEQ A;  2ZZG A;  1WLE A;  3LSS A;  4K88 A;  4PG3 A;  4Q15 A;  2Q7G A;  2DTO A;  3ICA A; 
#chains in the Genus database with same CATH homology
 1USY A;  4P75 C;  4UP8 A;  3P8Y A;  4YCU A;  1ATI A;  2AKW A;  1WYD A;  1B70 A;  3HXZ A;  4P73 A;  2EJF A;  3V8K A;  2ARS A;  2RHS A;  2DQ0 A;  3IG2 A;  11AS A;  4O2D A;  4P72 A;  2ZCE A;  3HXY A;  1QF6 A;  1G5I A;  4UP7 A;  5ELO A;  4AH6 A;  4K86 A;  3RL6 A;  4LVK A;  1B7Y A;  4YCV A;  3P8V A;  3A5Y A;  4G85 A;  2DTI A;  2P5I A;  3A32 A;  2QHT A;  4TQD A;  4YRG A;  2DTH A;  3ERR A;  2RHQ A;  1X56 A;  3HFZ A;  2ZGW A;  3V7S A;  3RAC A;  3V7C A;  1BBU A;  1WQW A;  4K87 A;  4YDQ A;  1ASY A;  2AMC A;  1YFT A;  3UGT A;  4P3N A;  3RGL A;  3HY0 A;  2J3M A;  4H2X A;  1BIA A;  4P74 A;  1EIY A;  1ADJ A;  4KR3 A;  2CJB A;  4HA8 A;  2ODR D;  4YCW A;  4TVY A;  4TVA B;  4XTW A;  3TUP A;  1WU7 A;  4H2U A;  2DXU A;  4P75 A;  4OP0 A;  2I4O A;  1C0A A;  3NEN A;  1BBW A;  3PZC A;  3RF1 A;  3UH0 A;  4RQF A;  3NEL A;  1FYF A;  2ZIN A;  3IAL A;  2QHS A;  1L0W A;  4KR2 A;  2C8M A;  2E5A A;  3E9I A;  3A31 A;  2QHV A;  3QNE A;  3LC0 A;  3HRK A;  2IY5 A;  1HTT A;  4CS3 A;  2E65 A;  2Q5H A;  3M4Q A;  2I4M A;  3L4G A;  2DDZ A;  4EO4 A;  2C7I A;  3NET A;  4HWO A;  5KNN A;  4YRR A;  1E22 A;  4YRI A;  2CGH A;  1H4V B;  4XEM A;  4YRM A;  2ALY A;  2ZT7 A;  3REX A;  3VQV A;  1E1O A;  4G84 A;  3VQY A;  4ZTU B;  1WPY A;  4HWR A;  1E1T A;  5K1X A;  2NS6 A;  3A7A A;  1PYS A;  4E51 A;  2ZT8 A;  3VBB A;  4BWA A;  4HWT A;  3TEG A;  1BIB A;  1EVL A;  3V8L A;  3I7F A;  4YRK A;  2ZIM A;  4LNS A;  4PHC A;  3HFZ B;  3MF2 A;  3EFR A;  5C52 B;  3A74 A;  1LYL A;  4YP0 A;  4BW9 A;  3A7U A;  2DZ9 A;  3PCO A;  1X54 A;  4XTZ A;  2AMC B;  2PMF A;  3V8J A;  1H4Q A;  2DVE A;  5ELN A;  4YRC A;  5F5W A;  2ZR3 A;  3V7R A;  4H2X B;  1NJ8 A;  5C51 B;  1EIY B;  4YRE A;  4HT4 A;  1YB3 A;  1H4S A;  1NJ6 A;  4HWP A;  4YPF A;  4DPG A;  4CH4 A;  2DKG A;  4CS4 A;  1X01 A;  4WJ3 M;  4LVJ A;  1WNL A;  3REU A;  4YRJ A;  4CH5 A;  2DU5 A;  1SER A;  4XTY A;  3MF1 A;  2ZIO A;  3VQW A;  3HXX A;  4Q6G A;  3MQZ A;  4YRP A;  4XU2 A;  4YRN A;  3CMQ A;  1SET A;  1ADY A;  2ZXF A;  1SRY A;  2ZT6 A;  1JJC B;  2EWN A;  1WQ7 A;  3IKM B;  4L87 A;  4XTV A;  1X55 A;  1W66 A;  2Q5I A;  3HXW A;  2G4C A;  2DU7 A;  3QO7 A;  4RDX A;  3QTC A;  5HGQ A;  3WQZ A;  4XTU A;  3QO5 A;  4TTV A;  4YYE A;  2ZZE A;  1GGM A;  1VQZ A;  4CH3 A;  3DSQ A;  2E10 A;  3HXV A;  4WF2 A;  2FYK A;  4YRS A;  3RKX A;  4YRF A;  3HY1 A;  1KOG A;  3L2Z A;  2XTI A;  4H2T A;  3TEH A;  2AKW B;  3L1A A;  4CS2 A;  1EOV A;  1B70 B;  4TVA A;  3MEY A;  3RKW A;  2RHS B;  4XU0 A;  1NNH A;  1B8A A;  2EL9 A;  4XTX A;  4XU3 A;  1E24 A;  4LVL A;  3BFM A;  1ASZ A;  2HNI A;  1B7Y B;  4DQ2 A;  5C53 B;  4H2W A;  4YRT A;  1EVK A;  4RQE A;  1NYR A;  1Z7M A;  2A8E A;  3RUX A;  3OD1 A;  2RHQ B;  4H2V A;  1B76 A;  1X2G A;  2EJ9 A;  1NJ1 A;  1SES A;  4ZTZ B;  3W3S A;  4KQE A;  2E64 A;  2ZZF A;  4YRL A;  1EQR A;  4CH6 A;  5K1P A;  1YFR A;  4X5O A;  1HC7 A;  2XGT A;  1G51 A;  4J15 A;  2ODR C;  2E41 A;  1YGB A;  2PME A;  2ZTG A;  1QE0 A;  2ZR2 A;  2CJA A;  2EAY A;  1J5W A;  3KFU A;  3VQX A;  3EFS A;  2E3C A;  2DQ3 A;  4H02 A;  3P8T A;  3E9H A;  2QHU A;  3LSQ A;  1IL2 A;  4P71 C;  4YRO A;  1Z7N A;  2DXT A;  4RMF A;  4NCX A;  2P0L A;  2ARU A;  2J3L A;  2IY5 B;  2Q7E A;  2E1H A;  4WI1 A;  4XEO A;  3UFG A;  4HWS A;  1USY C;  2CIM A;  4UP9 A;  2I4L A;  4ZIB A;  4OLF A;  3L4G B;  3IKL A;  3BJU A;  3FJP A;  1RIQ A;  4EX5 A;  3TEH B;  4P73 C;  3R07 A;  3NEM A;  2EJG A;  1HXD A;  4P72 C;  2ALY B;  1N9W A;  2ZT5 A;  1G5H A;  4P3O A;  2DZC A;  4P3P A;  3HTZ A;  4TWA A;  1NJ2 A;  1PYS B;  4XU1 A;  12AS A;  3QO8 A;  5E3I A;  3RIR A;  4TVW A;  1NYQ A;  1YFS A;  4UPA A;  1EFW A;  3RKY A;  2ZNI A;  4LVM A;  3HXU A;  1JJC A;  1KMM A;  3HRI A;  4YRQ A;  2CJ9 A;  4WJ4 A;  1X2H A;  2ZNJ A;  1KMN A;  3A5Z A;  3PCO B;  2DJZ A;  3UGQ A;  4P71 A;  4H2Y A;  4HVC A;  4TQF A;  3M4P A;  1NJ5 A;  2ART A;  2I4N A;  3A7R A;  1H4T A;  3HFV A;  4P74 C;  2Q7H A;  4LVI A;  4H2S A;  3G1Z A;  2DEQ A;  2ZZG A;  1WLE A;  3LSS A;  4K88 A;  4PG3 A;  4Q15 A;  2Q7G A;  2DTO A;  3ICA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...