4OP0A

Crystal structure of biotin protein ligase (rv3279c) of mycobacterium tuberculosis, complexed with biotinyl-5'-amp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
265
structure length
259
Chain Sequence
MADRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLITGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site conformational changes upon reaction intermediate biotinyl-5'-AMP binding in biotin protein ligase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords BirA bifunctional protein
total genus 89
structure length 259
sequence length 265
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4op0A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4op0A01
1HK9A 4M75E 4X9CA 4DPGA 2FB7A 4PJOF 2ZINA 4M7AA 2G4CA 3IKLA 1WYDA 3TUPA 1D3BB 4OP0A 4DQ2A 5GAOp 2ODRD 1NNHA 1ASYA 2IY5A 3A74A 1Y96B 4CS3A 3JCMV 11ASA 2ZT8A 4J5YA 2RD1A 1YFTA 2RB6A 3HXVA 2EWNA 4P3OA 4NL2A 4M75C 4YRSA 1LYLA 1H4TA 5GAN7 4C8QD 2ALYB 4F7UG 1NJ8A 4YCWA 2IY5B 1KMMA 1U1SA 4TVYA 4HT8A 4M78F 4H02A 4YRKA 1X2GA 1RIQA 3RKWA 4XEMA 4BW9A 1USYA 2ZZGA 4PJOA 1NJ1A 2ZNJA 5LJ5g 4UP8A 1YFRA 1B34B 4H2WA 3V7CA 5KNNA 3WQZA 3M4GA 2YLCA 5DY9A 3JCMW 5GANj 4Y91A 2EJFA 1Z7MA 2I4OA 2K57A 4C8QA 3HFNA 5LJ5h 2ZT7A 1B8AA 2QTXA 4M78G 2HNIA 1E1TA 4M78D 4P75A 3E9HA 4HWTA 4YRFA 4HWRA 1EQRA 4WJ3M 3LSSA 4HA8A 4J6XA 1HXDA 3JCMb 2RM4A 4P75C 3TEHA 4EMHA 4ZTUB 5GAOl 5GAMg 4RMFA 5GAMe 2E65A 3PCOB 2CIMA 2I2LA 2ZGWA 1X2HA 12ASA 4M7DC 3LC0A 1LNXA 1BIAA 4M78A 3NETA 4J6WA 4C92D 1USYC 1KQ2A 2EJ9A 2VXEA 2CJ9A 4YRIA 4E51A 4XTYA 4H2YA 4CH3A 3A5ZA 3JB9D 3E9IA 3NEMA 1EIYA 4PJOE 3HTZA 5E3IA 3RGLA 4CS2A 2RA2A 5ELNA 5GAN3 2EL9A 4P72C 4P3PA 4YRNA 4M7AC 1X56A 4XU1A 2E3CA 3M4PA 4TVAA 2RHSB 4NL3A 3RUXA 3INZA 3CMQA 4O2DA 4YRJA 4H2TA 4MMKA 2Q7GA 4TTVA 1B70B 1IL2A 5CAIA 3JCMh 2I4LA 4UPAA 3BFMA 4H2XB 1Y96A 3A7UA 1SETA 3PCOA 4P3NA 5LJ3f 4TQFA 5ELOA 4J6YA 2ARUA 4M75A 3W3SA 4P74A 1WQWA 5GAMh 3PZCA 4M7DA 4M77C 4ZIBA 3SB2A 3BDUA 4EMKB 1H4SA 5GAN8 4M77B 5GAOq 2RHQB 4PHCA 1I4K1 1GGMA 3KFUA 3HRIA 4H2UA 4CH4A 1HTTA 5GANe 3RIRA 4KQEA 4M75G 2AKWB 2DTOA 5GAMd 1J5WA 3QO8A 1HC7A 3HXXA 4P73A 3JCMQ 4JRKA 4M78E 2DJZA 1LJOA 3A31A 2ARSA 3A7AA 3HXWA 3EFRA 4C8QC 3QUIA 3P8VA 4C92G 2DKGA 4C8QB 2DZCA 3G1ZA 4LNSA 2I4NA 1PYSA 4RQEA 1WQ7A 4F7UB 4YRRA 3VQWA 4QVCA 4YRQA 3L4GB 4YRPA 4YCVA 3BJUA 2YLBA 2P5IA 3HY0A 1B70A 2QHTA 1I5LA 4YRGA 3RF1A 4M7DB 3JB9I 5GAOn 4CH5A 4C92B 4K88A 4PJOB 4XTUA 4YRLA 1H4VB 4Q6GA 1N9SA 4C92C 4PJOG 1JJCB 1M8VA 2ZCEA 1SERA 5GAOr 3GIBA 4EO4A 5LJ5f 4TVWA 1G51A 4Q15A 2QHVA 5C53B 4P73C 4M78C 2J3MA 4YROA 4PJOC 4C92A 5GANd 2E41A 5GMKh 3QTCA 1B7YA 2ARTA 3TEGA 5LJ3g 3HSBA 4M7AF 3MEYA 5GAN6 1W66A 4H2SA 2PMEA 3IALA 3IKMB 2ZT5A 4HT9A 4YREA 2E64A 3HXYA 5HGQA 1QE0A 4JRIA 2ZXFA 2YHTA 1LOJA 1L0WA 2DQ3A 4M7AB 2Q7EA 1B34A 4HWOA 2QHUA 4EX5A 4WJ4A 1FYFA 2C7IA 2ZR2A 1ASZA 1JRIA 4M7DG 2CGHA 1EVKA 4HWSA 4RDXA 1KOGA 4XTZA 5LJ3d 2ALYA 2RHSA 5LJ5e 1YCYA 4YRCA 2C8MA 1G5IA 1NYRA 1U1TA 1N9WA 4XEOA 3PGGA 4HVCA 2DVEA 4P71A 4V2SA 1KQ1A 3FJPA 1JJCA 1EIYB 5K1XA 1M5Q1 1YFSA 2DEQA 4HWPA 4M77F 2RHQA 3MF1A 4F7UE 4M75F 1YGBA 1EFWA 4JUVA 3DSQA 4F7UF 3LSQA 5GAMf 5GANh 3JCMJ 1JBMA 3QHSA 3JCMf 4EMKA 4TWAA 4C8QF 4YYEA 4M7DE 1WPYA 4C92E 1SRYA 5LJ3h 3AHUA 3RERA 5GAOm 2Q5IA 3M4QA 4G85A 4AH6A 5GMKl 5K1PA 2I4MA 1H641 1KMNA 1WU7A 3OD1A 2ZR3A 3VBBA 5LJ3j 2FYKA 2ZTGA 2DZ9A 4P72A 3VQXA 1E24A 1YB3A 1ATIA 3TEHB 1E1OA 4X5OA 1X01A 3V7SA 3NENA 4C8QG 5GANf 1NJ6A 4XU2A 4WI1A 5GAN2 3QNEA 2DDZA 2DU7A 4UP7A 4XU3A 4MMLA 4RQFA 1WLEA 1WNLA 2DU5A 4QVDA 4XTXA 4M7AE 5C51B 3JB9J 1EVLA 4G84A 4J15A 3JCMe 4TQDA 4N0AA 4NOYA 4PNOA 3HFZA 5GMKm 3JCMc 3VQYA 3SWNC 1BIBA 4ZTZB 3UFGA 3HRKA 1X54A 1PYSB 4F7UA 4N0AC 2CJAA 1VQZA 5LJ5d 2DXUA 4H2VA 3RL6A 1B76A 3ICAA 3HXUA 3JCMX 2AKWA 4XTWA 4M77E 3RACA 3UGQA 1X55A 2J3LA 3QSUA 4YRMA 1H4QA 1SESA 4YRTA 3REXA 5GAN5 3HFVA 4TVAB 5GMKe 3HFOA 4YCUA 1N9RA 2Y90A 5GAMj 4YP0A 2E1HA 2E10A 4JLIA 4M7AG 3ERRA 4RCBA 4XQ3A 5GMKj 2XGTA 3P8TA 3A5YA 2ZIOA 1ADYA 2ODRC 4H2XA 1NJ2A 3QO5A 4OLFA 3MF2A 4M75B 2E5AA 4UP9A 2QHSA 3JB9G 3R07A 3JCMP 2ZT6A 4M75D 4C8QE 3HFZB 4YDQA 4KR3A 4K86A 4M7DD 3VU3C 2EAYA 4CH6A 1EOVA 4PJOD 1ADJA 2Q5HA 4CS4A 5LJ5j 1I81A 2ZZFA 3P8YA 3SWNA 3BW1A 3IG2A 2DXTA 3NELA 4EMKC 2P0LA 1NJ5A 3RKXA 2VC8A 2DTIA 2JN0A 3A32A 3EFSA 3RKYA 4XTVA 1I8FA 4A53A 5GANg 4XU0A 3JB9F 2PMFA 2XTIA 5F5WA 3V8LA 4EMGA 4RCCA 2Q7HA 1C0AA 4M77G 3L2ZA 3I7FA 3JCMd 1QF6A 1TH7A 3HXZA 3L4GA 3JB9H 1Z7NA 3A7RA 1D3BA 4P74C 4M77A 5I21A 2CJBA 3BY7A 2EJGA 3REUA 3L1AA 3UGTA 5GAN4 4WF2A 4YPFA 4A54A 4NCXA 5GMKi 4BWAA 2ZZEA 4M78B 5LJ3e 4M77D 2AMCB 2ZIMA 4M7AD 4P71C 2ZNIA 3JCMg 3V8JA 4L87A 1BBWA 3FIFA 3QO3A 3V8KA 2DTHA 3VQVA 4K87A 2VXFA 3FB9A 2AMCA 3UH0A 3HY1A 1B7YB 1G5HA 4C92F 4X9DA 1E22A 4PG3A 3QO7A 4M7DF 3SWNB 4KR2A 2DQ0A 1BBUA 3RESA 1MGQA 1NYQA 5C52B 3V7RA
chains in the Genus database with same CATH superfamily
4X9CA 1X2QA 1U8RA 3REAB 2QQRA 1M30A 1QVGP 1KJWA 1EIFA 3TUPA 1GCQC 1FMKA 3E1SA 1NNHA 3LH0A 2IY5A 1AWOA 5C6SA 4MDWA 1GXIE 1R0BG 2VB6A 4J5YA 1RAAB 2RB6A 1WYXA 4LDUA 3EG9B 4BI4A 2Z0WA 1PRMC 5GAN7 5CQYA 4C8QD 4F7UG 1X2GA 4CI0C 2HDAA 4BW9A 2L89A 1VQ9A 1LCKA 2FZKB 4PJOA 1CKAA 2AIRB 1NJ1A 1AHJB 5LJ5g 3M55A 1QVPA 5FWBA 3EGUA 3V7CA 5KNNA 2KRSA 2VKNA 4HCBA 5GJWB 2DL4A 2CS7A 4J9IA 2BIVA 4C8QA 1B8AA 2D0QB 4M78D 1YHQT 1T3LA 1PM3A 2LQWA 2KDSA 3VRZA 3TQ7P 4HWRA 1W2BS 2OTJQ 2K6DA 1YIJT 4WJ3M 1Q7YC 4MZTA 3HPWA 4QQGA 4FYVB 4JJBA 2RM4A 4P75C 2RNAA 4ZTUB 3VUZA 3QG1A 1Q86U 5D7UA 5GAMe 2M16A 3I55Q 1N8RR 1BBZA 1OV3A 1PSFA 1PSEA 4Z88A 1X2HA 2VUBA 2J6FA 12ASA 2D9TA 2A08A 3LC0A 4JRPA 4M78A 2RO0A 4FM4B 4C92D 3NTIA 3QJ6A 1N5ZA 1PNJA 3H0IA 3E9GA 1NZ9A 5ECAA 4H2YA 4CH3A 2L2PA 4KULA 2HSPA 4PFPA 3JB9D 4WTOB 4J9CA 4J7IA 2RA2A 1PD0A 2NLUA 3I55A 2KQWA 2EYWA 4P72C 3M0QA 4M7AC 3M57A 4Z02A 3M4PA 2NWMA 4ELYC 4TVAA 4YRJA 4J8OA 1QQJA 4H2TA 3M54A 1IL2A 1B70B 4QQ6A 5CAIA 1Y7XA 5LL6S 2DPPB 1Q81U 2L5QA 2XHCA 4IIOA 4C5GA 2DD4A 4A4EA 4BB7A 4M75A 1SF9A 3L2WA 4RMOA 3OYBA 4ESRA 1W2BA 4FIBA 4BY6C 4EMKB 1H4SA 1M3CA 3QBYA 1VUBA 1I4K1 4RTYA 1GGMA 2QTVA 3C12A 1K73C 1HTTA 4OVAA 5GANe 3CC4Q 4KQEA 2X4YA 2AKWB 2DTOA 5CKBA 2D1XA 2AKKA 3QO8A 2EW3A 1HC7A 5CQXA 3VS7A 4PJNA 3JCMQ 1RAEB 1RI0A 2RJEA 1VQNQ 2Y4XA 1OZ3A 2DMOA 3VUBA 5A0LA 1X6BA 3QUIA 1M90U 2DKGA 1HYOA 2DZCA 1UJYA 3G1ZA 3META 4LNSA 4RQEA 4F16A 1JU5C 2YRCA 4LVKA 4YRPA 3BJUA 3HY0A 1KK7A 1Y0MA 1B70A 1YIJA 4CH5A 4PL6A 3M5AA 4YRLA 1FX7A 1H4VB 1Q86R 4Q6GA 1V29B 1M2VA 1NE8A 4KGZB 3DLMA 2YUNA 4E7JA 1IGUA 2QA4A 2ZCEA 5LJ5f 4C0GA 2IIMA 1R0CB 3M53A 1KD1U 4M78C 2J3MA 1PKSA 4PJOC 4YROA 1NYFA 5GANd 1B7YA 3CPWP 4RKUE 2ARTA 2LRQA 2ATCB 2K2VA 3HSBA 1PRLC 4IUQA 4E7HA 4JS4A 2CH4A 3PIPA 2EQIA 3HXYA 1UGVA 2EQKA 4JRIA 2YHTA 1YJWT 4M7AB 4AG2C 2COWA 5IHKA 2QHUA 1FYFA 3C94A 3CCUQ 1M9SA 1VQ7Q 3GNFB 1JRIA 1VQ6T 4HWSA 1ZSGA 3D7SB 3G7ZA 5LJ5e 1A0NB 1YCYA 2DXCA 1TU0B 1RAIB 3CCJA 1VQPT 3M59A 4HVCA 2DVEA 5CVIA 4P71A 1OZ2A 2QYZA 2HEQA 3PTAA 1YJ9A 3VJPA 3PNWC 2F5TX 3MF1A 1OU9A 3NPFA 1YGBA 1W1FA 4JUVA 1P92A 5A2QE 2FRYA 1YITQ 2K5IA 2X3WD 5GANh 1JBMA 4EMKA 1D0ZA 4C92E 2P0PA 4ZGDB 1SRYA 4XAXB 3RERA 2JMAA 1SHFA 2W10A 4G85A 5GMKl 5K1PA 3HHTB 1WU7A 3G6EQ 3VBBA 4C0DB 2FYKA 5LJ3j 2DZ9A 1VQ6A 1E24A 2ABLA 1YB3A 4N4IA 1PG5B 1B7TA 1NYGA 2F2XA 2KEAA 1ATIA 1W2BP 2O31A 4GLKA 2VASA 3OYHA 2KRNA 1SPKA 3QKJA 3OYDA 2NUPA 2JTEA 3SDZA 2VVKA 2DU7A 4MMLA 3MEVA 4JRQA 2A28A 4XTXA 1D1AA 2G6FX 3NFCA 2FRWA 5HCKA 4N0AA 4C0ZA 4PNOA 2K3YA 2WSFE 2X3XD 1VYTA 3SWNC 1K73R 3CCJQ 4DOWA 4J9FA 4RTUA 4ZTZB 2PTKA 1QWEA 3NTKA 2QQ9A 4N0AC 2CJAA 1TG0A 4OB0B 2DXUA 2RHUA 3KBGA 2QEXQ 3RACA 2LNHB 3FLGA 2J3LA 3QSUA 4LUDA 4PLIA 5FU7C 1AWWA 4TVAB 4IUTA 5DLQE 4YCUA 2RN8A 2EYXA 1YHQA 2QQAA 3WVDB 4KRTA 2E10A 4TVRA 4EDUA 4XQ3A 2XGTA 5IHIA 2ZIOA 1ADYA 3VV0A 4X1VA 3HL8A 4CRIA 3MF2A 1KD1R 2E70A 3TCJA 4OB2B 3CCST 1RLQC 2BZ8A 4EPCA 2ZT6A 4RUGA 2JMCA 4KR3A 1M1GA 1PKTA 2FPDA 1FXXA 1EOVA 1QP3A 1SRLA 3SWNA 2HKNA 1BCMA 2DXTA 3H8ZA 3SEMA 3IG2A 4BY6B 4EMKC 9ATCB 3RKXA 4PJMA 4KH0B 2JN0A 1K8AC 2FZGB 1RAGB 1M3BA 3RKYA 3OYCA 1I8FA 1SRMA 1OI1A 2XTIA 1JJ2S 5F5WA 1QVGA 2LNVA 1G5VA 3EG3A 4LDWA 4B6MA 1K4US 1EZZB 3L2ZA 2KSSA 3QYGB 1TH7A 3HXZA 3L4GA 3JB9H 1KC8R 1Z7NA 4VUBA 3A8LB 2EBPA 1BYMA 2YRDA 2OJ2A 4OF1A 3REUA 1AD5A 5GAN4 4A54A 1VQNA 4AG1C 5CO7A 3MEUA 2KR3A 2V1RA 3EG2A 4RTZA 4E47A 1BU1A 3OS1A 3RNJA 4C0FA 1ZA1B 4HVWA 5CKEA 3NGPA 3OMGA 5A0GA 3FC3A 2F69A 1UGQB 2HKQB 4A4FA 2FHDA 1VYVA 4X9DA 1KHIA 4M7DF 3SWNB 3MEWA 1MGQA 2RF0A 3CCRQ 2LCLA 3GOXA 2CUBA 3V7RA 1HK9A 4M75E 3I56Q 2FB7A 4PJOF 1VQOT 1BK2A 2DM1A 1WYDA 2LCCA 3EG0A 2EVRA 4LDVA 4OP0A 2NUPB 4DQ2A 2LVMA 3AT1B 3A74A 1Y96B 2LQ8A 3M9QA 2K9GA 11ASA 3RBBB 4JPBW 2ZPGB 3HXVA 3H0FA 4P3OA 4NL2A 4ZN3A 1ZLMA 4YRSA 1TUDA 1Z9QA 3CMET 2HBPA 4JZ4A 4BE1A 3MP1A 2RQTA 2IY5B 1WHHA 1YJNT 4M78F 1UEBA 2R5AA 3TREA 2CP5A 3OBYA 3QWYA 3RKWA 1Y57A 2ZNJA 4LD9K 2CZ7B 3A1PA 2RJDA 4MDXA 4UP8A 1AVZC 1YFRA 3MJXA 3PVQA 2BZYA 4L5GA 4ZGJB 2GGRA 3A5ZB 4KBMB 3PFSA 2QG9B 3JCMW 2WSEE 5GANj 4Y91A 2EJFA 1Q81C 1OX9A 2I4OA 2K57A 2ZT7A 1AZEA 3QXEB 2ECZA 4LVMA 2HNIA 5CR2A 4HCCA 4P75A 3DKMA 3GNGA 2LQKA 3E9HA 1AEYA 3CMAT 1QVFA 4AFUC 1EQRA 3QZ5B 4PK4A 4J6XA 2CP7A 3CCQQ 2P0QA 1HXDA 2KK4A 2M0YA 3T9NA 4LVLA 5GAMg 4RMFA 1QVFP 2FG0A 3PCOB 2DNUA 2DETA 2KT8A 3FEOA 2ZGWA 2DF6A 3MP8A 1VQ4T 1PC0A 2O9SA 1LNXA 4J6WA 1QCNA 1YCSB 1YJ9T 1KQ2A 1W70A 2VXEA 4LN2A 3CC7Q 4XTYA 4R0KA 2CZ0B 1BI1A 3E9IA 3NEMA 3SFMA 3CCLT 1K9MU 1EIYA 3CCUT 1KFZA 4A4HA 3CBPA 1VQ6Q 1D0YA 2LDMA 5IAYA 4P3PA 1MV0B 4PFZA 1X56A 4PJLA 4DBRA 1VQOA 3INZA 3CMQA 1VQKT 1WJQA 3O5ZA 5D6XA 4O5VA 2GTOA 1MHNA 2K3XA 4GLMA 3S3MA 2GCXA 4RTVA 1V76A 2I4LA 3EGXA 2QDYB 1M1KR 4OMPA 4H2XB 2GTJA 1VQ9T 2OAUA 5ELOA 4WCIA 1YNZA 4J6YA 3IQLA 2ARUA 3S6WA 1WQWA 5GAMh 3CCSA 4B9WA 2AZVA 3OYMA 2K2MA 4DEXA 1ZBXA 3BDUA 3N5BB 4J9EA 3JRZA 5GAOq 1YJ9Q 4D8KA 1GBRA 1MUZA 1IGQA 3EGXB 2PUKB 1ZBJA 2RK2A 3KFUA 2QQSA 1RI9A 3QWXX 1ZUUA 2DL5A 2J05A 4CH4A 3UT1A 5IH2A 2LJ1A 5KYWB 2COZA 1ABQA 2BE9B 2L3PA 1QW1A 1S72T 3HXXA 5D6YA 1VQPQ 3LWIA 4KGVB 2K3BA 3A31A 1RAFB 5C0MA 1WXUA 3ZL7C 3EFRA 1MMAA 1WX6A 4A4GA 3UDCA 1NBEB 1NLPC 4M4ZA 3M0TA 3I56T 4FW1A 2X35A 1FYNA 1WQ7A 5KCHA 3VQWA 4QVCA 2RQUA 4LXCA 4YCVA 1UDLA 1Q95G 1I5LA 4YRGA 5CCAA 4C92B 4PJOB 4XTUA 4MZMA 3EFOB 4C5EA 4ZTFA 4DBHA 2BTTA 2RPNA 2P4TA 5M9OA 1G83A 1JJCB 2AZSA 2CSIA 1Q82U 3GIBA 3PVLA 5IHNA 4AFQC 3OB9A 2KYMA 1TSFA 4C92A 2E41A 3OYFA 4LE9A 2MF2A 5DM7R 2RJFA 2DIGA 4M7AF 3G6EA 1W66A 4H2SA 2KNBB 2LT1A 1OOTA 3EH2A 3GF5A 2ZT5A 4HT9A 2FZCB 3KXTA 3G71T 1QE0A 2ZXFA 1LOJA 1YI2A 2DQ3A 1B34A 3OYKA 1HSQA 1U06A 4HWOA 3CCEQ 2ZR2A 2RMOA 5AT1B 3GLXA 4J9HA 1F1BB 4YTLA 1EVKA 1FWZA 3MQZA 4RDXA 2FO0A 5LJ3d 2RHSA 2L3RA 2C8MA 1NYRA 1U1TA 1TWBA 2E4HA 4XEOA 2ZPIB 3ULRB 3FJPA 1OYXA 5I2SA 1M5Q1 3OS0A 1YFSA 2B8AA 4XK8E 1EFWA 3WXMB 1E6GA 2E6ZA 3CCVA 1WGSA 1IZ6A 4F7UF 3QHSA 2QQBA 1VQLT 3VS2A 1WPYA 2R57A 3VKIA 4C0DC 2JZ2A 4OMOA 4M7DE 6AT1B 1WDXA 5LJ3h 2Q5IA 3M4QA 1CKBA 4NS5A 4AH6A 1N8RC 2V26A 5J26A 2ZR3A 1JB0E 2E3HA 2ZTGA 2DD5A 4ANJA 2CZ6B 4DA4A 2KXDA 2LP5A 1TTHB 1E1OA 1X01A 2NUTB 3HP9A 4RTXA 4X34A 3NENA 4C8QG 5GANf 4PLLA 1NJ6A 1RABB 2YDLA 3QNEA 3FRNA 4LDXA 4UP7A 4XU3A 3CC2Q 2DU5A 1LVKA 1JXMA 2KMTA 3JSCA 5C51B 3JB9J 2ED1A 4G84A 4J15A 3MP6A 4IIMA 1JQQA 2EQJA 3HRUA 3P8BB 3X28B 2A8EA 3I5RA 1NPPA 2J06A 2RI5A 2A0FB 1X54A 4F7UA 3U23A 2ESWA 3RL6A 1B76A 1Q7YU 3JAME 2RHXA 5FWCA 2AKWA 4M77E 3L2QA 5FU6C 4IURA 1JJ2P 4DBFA 5GAN5 1K0XA 1QCOA 2M0OA 1GL5A 1R77A 2VV5A 3HFOA 2CT3A 5CKHA 3TEEA 4L59A 3GPLA 3ZBDA 2QAZA 5AYFA 2DYIA 4YP0A 1N27A 4BI3A 3WVEB 1TUGB 1UECA 3DB3A 3OYEA 4LUEA 3ERRA 1AT1B 3VS6A 2PU9B 5KYYA 3QO5A 3PMTA 2DRKA 2F2VA 4UP9A 1XQHA 3JB9G 4M75D 4K86A 4CS4A 2Q5HA 3CCRA 5LJ5j 2GFUA 3P8YA 2AT1B 4IUVA 1PWTA 4OMFB 3ER0A 2D0NA 4FYYB 4R56A 2P0LA 2DTIA 1E7OA 2CP6A 3EFSA 3P8DA 2E5KA 5GANg 1D1CA 3V8LA 4RCCA 2Q7HA 4M77G 3CEYA 1QF6A 2XICA 4J9GA 3CCSQ 1IRXA 2NUZA 3M0RA 5I21A 1BCOA 3BY7A 2XG8D 2D8JA 4R55A 3CC4T 3OS2A 1AZGB 1WLPB 2CP2A 5GMKi 1AWXA 3OW2P 2DAQA 2MIOA 2D6FA 2W0ZA 4OGCA 2C0IA 1NPRA 1ZA2B 3CBMA 5D6WA 2SRCA 3JCMg 5HK3A 4L87A 1I07A 1UE9A 3V8KA 1WJRA 2DTHA 4ZTJA 3VQVA 5KYXA 3I35A 2FPFA 2OTJA 2VXFA 3FB9A 3H41A 3LGFA 3CCEA 2AMCA 2M9UA 2ZAEA 1PD1A 5FU6B 1B7YB 4E7KA 1B3QA 4HVUA 4KR2A 3L2UA 1M1KC 3VYHB 1UG1A 5C52B 5CKDA 2ZINA 5DLOA 2HBWA 2HQEA 1I0CA 3OYJA 1SG5A 4OMMA 4RG2A 1D3BB 5GAOp 3C95A 2LJ3A 2ODRD 4JS5A 3QDFA 1YHQQ 2KAFA 4KUDK 4BDYA 2E12A 1GCQA 4M75C 1ZQ1A 1B07A 1XJWB 2XDPA 3RMSA 4E7IA 1H4TA 4BACA 1YBYA 1NJ8A 2WACA 4YCWA 1IHVA 1U1SA 4HT8A 2PUOB 1RAHB 4F17A 1G8XA 1K73U 3HRTA 4A4KA 4YRKA 1RIQA 2EQMA 2RHYA 1WHKA 2XI9A 4AFZC 4UC4A 4XEMA 1USYA 2ZZGA 1RLPC 2OAWA 1Y71A 2VGNA 2BKDN 3DB4A 3KFVA 1B34B 4MZPA 1JJ2A 2YLCA 5DY9A 1Z7MA 1Y07A 2KXCA 3CCLA 3MKDA 2QK0A 1JEGA 1SKUB 4AMCA 1U3OA 3HFNA 1S1NA 5LJ5h 2ZZDA 1GRIA 2EKOA 1VQ8A 1VQ8Q 4HWTA 1VYUA 2X4JA 1UB4A 4HA8A 4OMNA 3TEHA 1D1BA 1ARKA 4FCYA 2PVGB 2CH4W 4GBQA 2E65A 2HQHA 1VQ9Q 1K0SA 5EC7A 2QGGA 4HXJA 2ZCFB 3I55T 1KQSP 4BD3A 4LVJA 2X9HA 4M7DC 3NETA 2ZPBB 2A36A 2DVJA 2EJ9A 2EFIA 2CJ9A 2VWFA 4YRIA 4E51A 2LC4A 2PZ1A 3CCMQ 3A5ZA 1Q86C 1N8RU 4PJOE 5E3IA 3RGLA 3CCQT 1Q81R 5ELNA 2ROLA 5FRMA 2EL9A 4YRNA 3HKSA 2EYYA 4XU1A 1BI0A 3BDLA 3MPUB 2RHSB 1RADB 3H6ZA 3RUXA 3TU4K 4O2DA 1VQ4Q 4MMKA 3CCUA 2Q7GA 4E7SA 3JCMh 2R5MA 1NEGA 1YITA 2GNCA 2AK5A 1Y96A 2O01E 3A7UA 5I2MA 2KT1A 2XK0A 4Y92A 1SETA 4P3NA 4TQFA 4P74A 3PZCA 4M7DA 4M77C 4RG8A 1HD3A 2MI6A 4KT0E 2PQWA 3EGDB 4PHCA 4ATOA 4H2UA 2JUFA 2M1HA 3DLLA 1WA7A 3QJYA 4OGEA 1D09B 3H0HA 2L0AA 3CBOA 1J5WA 3CC2A 2P0KA 1SEMA 2JT4A 4P73A 4JRKA 2F2WA 4M78E 1VOMA 1G2BA 1UGPB 4JLGA 4E6RA 3E9FA 2CKKA 1TS9A 4PFOA 4RTWA 2EQUA 4OB3B 3A7AA 4C8QC 3P8VA 4FT4A 2QA4Q 2KVQG 2I4NA 1PYSA 2K7AA 4F7UB 4YRQA 2EGCA 3G4SA 1UGSB 3H9NA 3G1JA 3RF1A 4M7DB 2JW4A 1YFNA 2ZPFB 1J3TA 1M90R 1N9SA 2E3IA 4C92C 2O4XB 4BI8B 1M8VA 3LH5A 3OYIA 1SERA 2E6NA 4IUPA 1UJ0A 4PKCC 1G51A 4HT4A 2OTJT 4P73C 4QKUA 5IXBA 2DERA 7AT1B 3QTCA 2HAXA 1KIKA 3CPFA 1AOJA 3TEGA 2LJ0A 4Z89A 5LJ3g 2V8JA 2O4XA 3MEYA 1TUCA 2PMEA 2HL5C 2E64A 2LQNA 4JJNK 1NM7A 3OQ5A 3UATA 3CCQA 2CREA 4QW2A 2X4WA 2Q7EA 2DL3A 3S3OA 3G71Q 1WHGA 3L2VA 3EH1A 2MWPA 4HCKA 4WJ4A 3X25B 4HCZA 1T3SA 1AWJA 2QGFB 1ASZA 1OU8A 4M7DG 1KG1A 2CGHA 3OMCA 1X6OA 2CP3A 2KRMA 1KOGA 1KQSA 4XTZA 2E5QA 1TXQA 3EG1A 1VQMA 1PHTA 1ACMB 1S72A 1QCFA 3MCAB 3EHRA 2C0TA 3TVTA 1KQ1A 1JJCA 1EIYB 4HWPA 2DEQA 2VGMA 3NTHA 2C06A 1H92A 2LMJA 4M75F 2BUDA 3DSQA 1IXDA 2MK5A 3LYIA 3JCMJ 3UPUA 3JCMf 3EGDA 4TWAA 1I5OB 4LNPA 2DXBA 2ZPHB 1Q82R 1X27A 4Y28E 1DJ7B 5GAOm 1R8OB 1VQ8T 1EFNA 2I4MA 1H641 3Q1JA 8AT1B 3CCET 3OD1A 1SSHA 4DEYA 1ABOA 3MHXA 2KY9A 2IPOB 4X5OA 3V7SA 5GJVB 1G3SA 1WXBA 1FMVA 3CQTA 3LWHA 1QVFS 4XU2A 5GAN2 1X75C 2DDZA 1YP5A 4FYXB 1WLEA 1WNLA 1NG2A 1EVLA 3CXCA 3JCMe 3HFZA 5GMKm 3A8OB 3JCMc 3VQYA 1BIBA 1Z9ZA 2A7YA 1ZUKA 4RTTA 2Y4YA 2DL7A 1RACB 3HRKA 2YUPA 3LLRA 4H2VA 3LW5E 5IXFA 3O8VA 3JCMX 4XTWA 3UGQA 2L8DA 1X55A 1SESA 1C6VX 3G71A 2HZYA 1KC8C 4EIKA 2EIFA 1M3AA 1XNIA 2I0NA 3J81E 3EAEA 5GMKe 1N9RA 2Y90A 2E1HA 2KYBA 1K8AR 4JLIA 4M7AG 4RCBA 3UF4A 5GMKj 3P8TA 2RI2A 1W6XA 4F04B 1KHCA 4OLFA 3CD6A 4GY5A 3X20B 2E5AA 3OYNA 2YSQA 2YT6A 2MYSA 1G3WA 2QHSA 3JCMP 1UFFA 2L3QA 1VQMT 3OSSC 4E2FB 2X4XA 2JNGA 3VU3C 2EAYA 2NYSA 3A8GB 2O9VA 1I81A 1X6GA 1T0HA 3CXCS 2KI7A 3UA7A 1G3YA 1VA7A 5HK0A 2QEXT 2DK3A 1MMGA 1VQLA 1OPKA 4A53A 1CSKA 3CCRT 3RMQA 2PMFA 2EGEA 3QPHA 1ZHIA 4EMGA 1QVGS 1C0AA 2HMAA 5KYUA 3G4ST 3I7FA 2KROA 2DRMA 2V1QA 5CKFA 4ELZC 1D3BA 1K9AA 2OTLA 2CJBA 2EJGA 3L1AA 1YWOA 1EX4A 2IVWA 2RJCA 5LJ3e 3CC7T 5J3BA 4M77D 5KYUB 3CCMT 2AMCB 2XDDA 2ZIMA 4AT1B 4M7AD 3V8JA 3OYGA 2FVUA 1U5SA 1BBWA 3FIFA 2R58A 3M4YA 2RHIA 3URGA 4C92F 4PG3A 3QO7A 1JXOA 1BBUA 8ATCB 4O6JA 3R6OA 4ME7A 2NS6A 3C0CA 1NYQA 4BUGA 4M75G 4DPGA 1QP2A 1UHFA 4M7AA 3VYGA 2CSQA 4HKEA 2G4CA 2DO3A 3IKLA 2COYA 2KGTA 4BE0A 2OTLT 2JOYA 1VQOQ 2DA9A 2K5FA 2M02A 4Z8AA 3ZEHA 1VQLQ 1ASYA 5CIUA 4IUUA 4CS3A 3JCMV 2K5LA 1WIEA 2ZT8A 2RD1A 1YFTA 2DILA 2EWNA 4QVZA 4IKFA 2LX7A 1H3ZA 2L3SA 3A8HB 1ZSZA 4B9XA 1MNEA 3I56A 1LYLA 4KH1B 2ALYB 2DL8A 1KMMA 4TVYA 1M90C 1WFWA 4PJJA 1GFDA 4H02A 2ED0A 1UGRB 2HQXA 2B86A 5KYWA 2XIDA 1IO6A 4E7LA 3G4SQ 1MMDA 3JV3A 2H3EB 2VYTA 4H2WA 2F5KA 4ZGEB 3WQZA 2GQIA 3M4GA 2YWWA 1IHWA 3LGLA 3M58A 1VQ7A 4J9BA 2QTXA 1K76A 4M78G 1C0MA 1E1TA 1KC8U 4J9DA 4YRFA 4Q5WA 1SHGA 3SD4A 1N6AA 4FW2A 1VQ5A 3LSSA 2MCNA 3J7AF 1XOVA 1OPLA 4CC4B 3JCMb 4JJCA 3S3NA 4EMHA 2CUDA 5GAOl 4JJDA 2DBKA 2JJ9A 2OX7A 4FSSA 2JTFA 3CCVT 3OW2A 3OW2S 2QA4T 2MOXA 1V1CA 2ZPEB 1PCXA 4QT7A 1FMWA 2CIMA 2HSEB 2I2LA 2RH2A 5EG2A 1QKWA 2LZ6B 1TOVA 4N4HA 3VS0A 1BIAA 1USYC 1D0XA 3PIOA 1NJIR 5KE2A 3I9QA 1H8KA 3OSVA 1WI7A 1UHCA 3C4SA 3HTZA 4CS2A 2AHJB 5GAN3 3OYYA 1HJDA 1M27C 2XKOC 1QLYA 3UWNA 2E3CA 3CMAQ 2RHZA 3FJ5A 3ZFJA 4NL3A 1VQ5T 5KE3A 2MWOA 4TTVA 2A37A 1E6HA 2WSCE 2FPEA 2YRVA 3BFMA 3X26B 4UPAA 3CD6T 3CCJT 1VQPA 5LJ3f 1ZSZC 3PCOA 3W3SA 5I22A 4FL6A 1T0JA 1QMCA 1UUEA 5IN1A 4J83A 1VIEA 2D8HA 2OI3A 3CD6Q 4ZIBA 2O88A 2HCKA 3SB2A 1VQKA 4DBQA 5GAN8 4M77B 2QDLA 2RHQB 1ZUYA 1LPLA 2JVVA 5J39A 3CC4A 3HRIA 1I1JA 3RIRA 4KUIA 3HRSA 2H3JA 1W4SA 5GAMd 2CZ1B 2DIQA 3NHNA 3CMEQ 1BB9A 2DJZA 4E7ZA 1LJOA 3M0UA 2CT4A 3HXWA 3TSZA 2KE9A 4C92G 2DBMA 2RI3A 3VRYA 4C8QB 1WHJA 1YN8A 3OY9A 2EKHA 4FU6A 2JM9A 3MEAA 4YRRA 3L4GB 2YLBA 2P5IA 3E2UA 2QHTA 3JB9I 3VS4A 1UTIA 5GAOn 1SSFA 5KCOA 4K88A 3F70A 1M1KU 1YJWQ 3QZ9B 2MMPA 4PJOG 4CC3A 3QYHB 5GAOr 4EO4A 4TVWA 2QXFA 4Q15A 2QHVA 5C53B 1X69A 1KQSS 5GMKh 1VIFA 4FYWB 1IREB 3BE3A 5HY6A 3L2RA 2DE0X 3PE0A 1H3HA 3GP8A 2F1LA 5FU7B 5GAN6 2ROTA 2RQWA 2CP0A 3IALA 2XD0A 3IKMB 4YREA 4D6WA 2MAMA 1RL2A 2GFAA 5HGQA 4JZ3A 2H8HA 4L6V5 4LDYA 3X24B 5KYYB 1L0WA 1ZX6A 2RK1A 5FRNA 4AFSC 3RR6A 2HD0A 3G6ET 4EX5A 2DFUA 2NUTA 3CCLQ 2C7IA 3P8HA 2LCSA 2K4YA 4D8DA 2EPDA 5FW9A 1NEBA 2DJQA 2GQVA 5KYXB 1WHMA 1YJNQ 2ALYA 1M2OA 4F14A 4YRCA 1S72Q 4J7FA 1G5IA 1ZSZB 1N9WA 3PGGA 3A8MB 3I5SA 3CMAA 1VQKQ 1OEBA 1QKXA 4V2SA 5K1XA 3M0SA 1KSWA 4M77F 2RHQA 1OQKA 4JDSA 4F7UE 4LVIA 3CXCP 3CPWA 3RDVA 3J80E 1M1FA 2FL7A 2OTLQ 3LSQA 5GAMf 1X2KA 2DLPA 4OB1B 2PVDB 4C8QF 4YYEA 3HTRA 3VS3A 3CC2T 3LX7A 1VQ7T 3AHUA 3M56A 1YJWA 1XTDA 2EGAA 1X43A 1KMNA 3ASKA 3ME9A 2GBQA 2J7IA 2XMFA 3EG9A 5KYNA 2K79A 2V8IA 4P72A 1YJNA 2EYZA 3VQXA 1VQNT 3TEHB 1VQ5Q 3PMIA 4BE2A 1Q82C 4II1A 4QQDA 3GBQA 4CC7A 2PVOB 2YUOA 1WXTA 3A98A 4WI1A 2JXBA 3CCVQ 1WJSA 4RQFA 3VS1A 1M2VB 2MPXC 4QVDA 2BZXA 4M7AE 1YITT 1MV3A 4TQDA 4NOYA 4FT2A 2ENMA 4ORZA 1VQMQ 4CC2A 2P84A 5I11A 3CPWS 3OYLA 4ZNXA 3UFGA 5CK9A 1WHLA 2AKLA 1PYSB 3QDRB 1M8MA 2JTMA 1MMNA 5KH6A 1VQZA 1K8AU 2HL3A 5LJ5d 1JO8A 3ICAA 2LX9A 3HXUA 2CYZB 3SHWA 3QIIA 3NMZC 1KD1C 4N4GA 4YRMA 1H4QA 3EFOA 3OS5A 4YRTA 3FDRA 3REXA 1YI2Q 3HFVA 2JM8A 2C0OA 2YUQA 1NJIU 5GAMj 4FSXA 1GBQA 5A0DA 2IG0A 2QASA 3A5YA 3THKA 2ODRC 3VS5A 4H2XA 1NJ2A 4M75B 4C5IA 2SEMA 3R07A 3CC7A 2FEIA 2RQRA 3REBB 4YDQA 4P5NA 4C8QE 3HFZB 4M7DD 4CH6A 4LD6A 5IT9E 4PJOD 1ADJA 2ZZFA 2P4RA 1BI2A 1YI2T 1K1ZA 3BW1A 3NELA 3CMEA 3R6NA 4ZN1A 3OYAA 1NJ5A 2VC8A 2XU8A 2DEUA 1YIJQ 3EHQA 1NLOC 2O2OA 3A32A 5HKCA 1BKBA 2YXYA 1OX8A 2EYQA 5L23A 2DYBA 1K9MC 2JS2A 2M51A 2DX1A 4XTVA 1G3TA 1K9MR 4XU0A 3JB9F 4KGXB 3PT9A 4HVVA 1O75A 2X51A 4DOVA 2XDBA 1Q7YR 3JCMd 1O9SA 2J6OA 3A7RA 4P74C 2A3LA 1GCPA 2QEXA 2QI2A 4M77A 3OA6A 1WZOA 3UGTA 2RQVA 2PNIA 4WF2A 2KBTA 2G3RA 4C5HA 4NCXA 4YPFA 4BWAA 1M4ZA 2ZZEA 4OMQA 4M78B 1C1AA 3KUFA 3MO8A 3E19A 5FLXE 4P71C 2ZNIA 2LTOA 1YWPA 2JS0A 3M0PA 4K11A 3QO3A 4A63B 3OBWA 3L42A 4K87A 3TSWA 1OULA 2GF7A 3UH0A 4BDZA 1BI3A 3HY1A 3CCMA 1G5HA 1E22A 1IB8A 5L8RE 2BE7D 1QWFA 2DQ0A 2J6KA 2CDTA 2LT4A 2V8KA 3RESA 1NJIC 1MNDA 5FROA 3UA6A 1RUWA 1VQ4A 4OMLA 1GFCA 2ARSA
chains in the Genus database with same CATH topology
4X9CA 1U8RA 2QQRA 1EIFA 3TUPA 3E1SA 1NNHA 3LH0A 2IY5A 5C6SA 4MDWA 1GXIE 4J5YA 2RB6A 4LDUA 4BI4A 5GAN7 5CQYA 4C8QD 4F7UG 1X2GA 4CI0C 4BW9A 2L89A 1VQ9A 4PJOA 1NJ1A 1AHJB 5LJ5g 3M55A 1QVPA 3V7CA 5KNNA 4HCBA 2CS7A 2BIVA 4C8QA 1B8AA 2D0QB 4M78D 1YHQT 2KDSA 4HWRA 1W2BS 4WJ3M 1YIJT 1Q7YC 4MZTA 3HPWA 4QQGA 4P75C 2RM4A 4ZTUB 3VUZA 3QG1A 1Q86U 5GAMe 2M16A 1PSFA 1PSEA 1X2HA 2VUBA 12ASA 2D9TA 3LC0A 4JRPA 4M78A 2RO0A 4FM4B 4C92D 3NTIA 3QJ6A 3E9GA 1NZ9A 4H2YA 4CH3A 4KULA 3JB9D 4J7IA 2RA2A 2NLUA 3I55A 2KQWA 4P72C 4M7AC 3M57A 4Z02A 3M4PA 4ELYC 4TVAA 4YRJA 4J8OA 4H2TA 3M54A 1IL2A 1B70B 4QQ6A 5CAIA 1Y7XA 5LL6S 2DPPB 1Q81U 2L5QA 2XHCA 4C5GA 2DD4A 4A4EA 4BB7A 4M75A 3L2WA 4RMOA 3OYBA 1W2BA 4FIBA 4BY6C 4EMKB 1H4SA 3QBYA 1VUBA 1I4K1 1GGMA 3C12A 1K73C 1HTTA 4OVAA 5GANe 4KQEA 2X4YA 2AKWB 2DTOA 5CKBA 3QO8A 1HC7A 5CQXA 3JCMQ 2RJEA 1RI0A 2Y4XA 1OZ3A 3VUBA 5A0LA 3QUIA 1M90U 2DKGA 2DZCA 3G1ZA 3META 4LNSA 4RQEA 4LVKA 4YRPA 3BJUA 3HY0A 1B70A 1YIJA 4CH5A 4PL6A 3M5AA 4YRLA 1FX7A 1H4VB 4Q6GA 1V29B 1NE8A 3DLMA 4E7JA 2QA4A 2ZCEA 5LJ5f 4C0GA 3M53A 1KD1U 4M78C 2J3MA 4YROA 4PJOC 5GANd 1B7YA 4RKUE 2ARTA 2LRQA 2K2VA 3HSBA 4IUQA 4E7HA 4JS4A 3PIPA 3HXYA 2EQKA 4JRIA 2YHTA 1YJWT 4M7AB 2QHUA 1FYFA 3C94A 1M9SA 3GNFB 1JRIA 1VQ6T 4HWSA 3G7ZA 5LJ5e 1YCYA 2DXCA 3CCJA 1VQPT 3M59A 4HVCA 2DVEA 5CVIA 4P71A 1OZ2A 3PTAA 1YJ9A 3VJPA 3PNWC 2F5TX 3MF1A 1YGBA 4JUVA 1P92A 5A2QE 2K5IA 5GANh 1JBMA 4EMKA 4C92E 2P0PA 4ZGDB 1SRYA 4XAXB 3RERA 4G85A 5GMKl 5K1PA 3HHTB 1WU7A 3VBBA 4C0DB 2FYKA 5LJ3j 2DZ9A 1VQ6A 1E24A 1YB3A 4N4IA 1ATIA 4GLKA 3OYHA 3QKJA 3OYDA 3SDZA 2DU7A 4MMLA 3MEVA 4JRQA 4XTXA 3NFCA 4C0ZA 4N0AA 4PNOA 2K3YA 2WSFE 3SWNC 4DOWA 4ZTZB 3NTKA 2QQ9A 4N0AC 2CJAA 4OB0B 2DXUA 2RHUA 3KBGA 3RACA 3FLGA 2J3LA 3QSUA 4PLIA 5FU7C 4TVAB 4IUTA 5DLQE 4YCUA 1YHQA 2QQAA 3WVDB 4TVRA 2E10A 4EDUA 4XQ3A 2XGTA 2ZIOA 1ADYA 3VV0A 3HL8A 4CRIA 3MF2A 2E70A 3TCJA 4OB2B 3CCST 4EPCA 2ZT6A 4KR3A 1M1GA 1FXXA 1EOVA 1QP3A 3SWNA 3IG2A 2DXTA 3H8ZA 4BY6B 4EMKC 3RKXA 2JN0A 1K8AC 3RKYA 3OYCA 1I8FA 1OI1A 2XTIA 1JJ2S 5F5WA 1QVGA 2LNVA 1G5VA 4LDWA 3L2ZA 2KSSA 3QYGB 1TH7A 3HXZA 3L4GA 3JB9H 1Z7NA 4VUBA 3A8LB 1BYMA 4OF1A 3REUA 5GAN4 4A54A 1VQNA 5CO7A 3MEUA 4E47A 3OS1A 4C0FA 5CKEA 3OMGA 5A0GA 3FC3A 2F69A 1UGQB 4A4FA 2FHDA 4X9DA 1KHIA 4M7DF 3SWNB 3MEWA 1MGQA 2LCLA 3GOXA 3V7RA 1HK9A 4M75E 2FB7A 4PJOF 1VQOT 1WYDA 2LCCA 4LDVA 4OP0A 4DQ2A 2LVMA 3A74A 1Y96B 2LQ8A 3M9QA 11ASA 2ZPGB 3HXVA 4P3OA 4NL2A 4ZN3A 4YRSA 3CMET 2HBPA 4BE1A 3MP1A 2IY5B 1YJNT 4M78F 1UEBA 2R5AA 3TREA 3OBYA 3RKWA 2ZNJA 4LD9K 2CZ7B 2RJDA 4MDXA 4UP8A 1YFRA 4L5GA 4ZGJB 3A5ZB 4KBMB 3PFSA 3JCMW 2WSEE 5GANj 4Y91A 2EJFA 1Q81C 2I4OA 2K57A 2ZT7A 3QXEB 4LVMA 2HNIA 5CR2A 4HCCA 4P75A 3DKMA 3GNGA 2LQKA 3E9HA 3CMAT 1QVFA 1EQRA 3QZ5B 4J6XA 2P0QA 1HXDA 2KK4A 3T9NA 4LVLA 5GAMg 4RMFA 3PCOB 3FEOA 2ZGWA 3MP8A 1VQ4T 1LNXA 4J6WA 1YJ9T 1KQ2A 2VXEA 4XTYA 2CZ0B 1BI1A 3E9IA 3NEMA 3SFMA 3CCLT 1K9MU 1EIYA 3CCUT 4A4HA 3CBPA 2LDMA 5IAYA 4P3PA 1X56A 1VQOA 3INZA 3CMQA 1VQKT 1WJQA 5D6XA 4O5VA 1MHNA 2K3XA 3S3MA 2GCXA 2I4LA 2QDYB 4H2XB 1VQ9T 2OAUA 5ELOA 4J6YA 2ARUA 3S6WA 1WQWA 5GAMh 3CCSA 4B9WA 3OYMA 1ZBXA 3BDUA 3N5BB 3JRZA 5GAOq 2PUKB 2RK2A 3KFUA 2QQSA 4CH4A 3UT1A 1QW1A 1S72T 3HXXA 5D6YA 3LWIA 3A31A 5C0MA 3EFRA 4A4GA 3UDCA 3I56T 2X35A 1WQ7A 5KCHA 3VQWA 4QVCA 4YCVA 1I5LA 4YRGA 5CCAA 4C92B 4PJOB 4XTUA 4MZMA 4C5EA 4ZTFA 2P4TA 5M9OA 1JJCB 1Q82U 3GIBA 3OB9A 4C92A 2E41A 3OYFA 2MF2A 5DM7R 2RJFA 2DIGA 4M7AF 3G6EA 1W66A 4H2SA 2LT1A 3GF5A 2ZT5A 4HT9A 3KXTA 3G71T 1QE0A 2ZXFA 1LOJA 1YI2A 2DQ3A 1B34A 3OYKA 4HWOA 2ZR2A 3GLXA 4YTLA 1EVKA 1FWZA 3MQZA 4RDXA 5LJ3d 2RHSA 2L3RA 2C8MA 1NYRA 1U1TA 4XEOA 2ZPIB 3FJPA 1OYXA 5I2SA 1M5Q1 3OS0A 1YFSA 2B8AA 4XK8E 1EFWA 3WXMB 3CCVA 2E6ZA 1WGSA 1IZ6A 4F7UF 3QHSA 2QQBA 1VQLT 4C0DC 1WPYA 2R57A 3VKIA 4M7DE 2JZ2A 5LJ3h 2Q5IA 3M4QA 4NS5A 4AH6A 1N8RC 5J26A 2ZR3A 1JB0E 2ZTGA 2DD5A 2CZ6B 4DA4A 1E1OA 1X01A 3HP9A 4X34A 3NENA 4C8QG 5GANf 4PLLA 1NJ6A 3QNEA 3FRNA 4LDXA 4UP7A 4XU3A 2DU5A 2KMTA 3JSCA 5C51B 3JB9J 4G84A 4J15A 3MP6A 2EQJA 3HRUA 3P8BB 3X28B 2A8EA 1NPPA 2RI5A 1X54A 4F7UA 3RL6A 1B76A 1Q7YU 3JAME 2RHXA 2AKWA 4M77E 3L2QA 5FU6C 4IURA 5GAN5 2M0OA 2VV5A 3HFOA 5CKHA 3TEEA 4L59A 3GPLA 3ZBDA 5AYFA 4YP0A 1N27A 4BI3A 3WVEB 3DB3A 3OYEA 3ERRA 2PU9B 3QO5A 3PMTA 4UP9A 1XQHA 3JB9G 4M75D 4K86A 4CS4A 2Q5HA 3CCRA 5LJ5j 2GFUA 3P8YA 4IUVA 4OMFB 3ER0A 4R56A 2P0LA 2DTIA 3EFSA 3P8DA 5GANg 3V8LA 4RCCA 2Q7HA 4M77G 3CEYA 1QF6A 2XICA 5I21A 3BY7A 2XG8D 4R55A 3CC4T 3OS2A 5GMKi 2DAQA 2D6FA 4OGCA 1NPRA 3CBMA 5D6WA 3JCMg 5HK3A 4L87A 3V8KA 1WJRA 2DTHA 4ZTJA 3VQVA 2OTJA 2VXFA 3FB9A 3LGFA 3CCEA 2AMCA 2M9UA 5FU6B 1B7YB 4E7KA 4KR2A 3L2UA 1M1KC 3VYHB 5C52B 5CKDA 2ZINA 5DLOA 2HQEA 3OYJA 4RG2A 1D3BB 5GAOp 3C95A 2ODRD 4JS5A 2KAFA 4KUDK 4BDYA 2E12A 4M75C 1ZQ1A 2XDPA 3RMSA 4E7IA 1H4TA 4BACA 1YBYA 1NJ8A 2WACA 4YCWA 1U1SA 4HT8A 2PUOB 1K73U 3HRTA 4A4KA 4YRKA 1RIQA 2EQMA 2RHYA 2XI9A 4UC4A 4XEMA 1USYA 2ZZGA 3DB4A 1Y71A 2VGNA 2BKDN 1B34B 4MZPA 1JJ2A 2YLCA 5DY9A 1Z7MA 1Y07A 3CCLA 3HFNA 5LJ5h 2ZZDA 2EKOA 1VQ8A 4HWTA 2X4JA 1UB4A 4HA8A 3TEHA 2PVGB 2E65A 2ZCFB 3I55T 4BD3A 4LVJA 4M7DC 3NETA 2ZPBB 2EJ9A 2EFIA 2CJ9A 4YRIA 4E51A 2LC4A 3A5ZA 1Q86C 1N8RU 4PJOE 5E3IA 3RGLA 3CCQT 5ELNA 5FRMA 2EL9A 4YRNA 3HKSA 4XU1A 1BI0A 3BDLA 2RHSB 3H6ZA 3RUXA 3TU4K 4O2DA 4MMKA 3CCUA 2Q7GA 3JCMh 2R5MA 1YITA 1Y96A 2O01E 3A7UA 5I2MA 2XK0A 1SETA 4P3NA 4TQFA 4P74A 3PZCA 4M7DA 4M77C 4RG8A 2MI6A 4KT0E 2PQWA 4PHCA 4ATOA 4H2UA 2JUFA 2M1HA 3DLLA 3QJYA 4OGEA 3CBOA 1J5WA 3CC2A 2P0KA 4P73A 4JRKA 4M78E 4JLGA 1UGPB 3E9FA 2CKKA 2EQUA 4OB3B 3A7AA 4C8QC 3P8VA 4FT4A 2KVQG 2I4NA 1PYSA 4F7UB 4YRQA 3G4SA 1UGSB 3RF1A 4M7DB 2ZPFB 1N9SA 4C92C 2O4XB 4BI8B 1M8VA 3OYIA 1SERA 2E6NA 4IUPA 4PKCC 1G51A 4HT4A 2OTJT 4P73C 3QTCA 2HAXA 3CPFA 3TEGA 5LJ3g 2V8JA 2O4XA 3MEYA 2PMEA 2E64A 4JJNK 3CCQA 3OQ5A 4QW2A 2X4WA 2Q7EA 3S3OA 3L2VA 2MWPA 4WJ4A 3X25B 4HCZA 1ASZA 4M7DG 1KG1A 2CGHA 3OMCA 1X6OA 1KOGA 1KQSA 4XTZA 2E5QA 1VQMA 1S72A 3MCAB 1KQ1A 1JJCA 1EIYB 4HWPA 2DEQA 2VGMA 3NTHA 2C06A 4M75F 2BUDA 3DSQA 3LYIA 3JCMJ 3UPUA 3JCMf 4TWAA 2DXBA 2ZPHB 4Y28E 1DJ7B 5GAOm 1R8OB 1VQ8T 2I4MA 1H641 3Q1JA 3CCET 3OD1A 3MHXA 2KY9A 4X5OA 3V7SA 1G3SA 1QVFS 3LWHA 4XU2A 5GAN2 1X75C 2DDZA 1WLEA 1WNLA 1EVLA 3CXCA 3JCMe 3HFZA 5GMKm 3A8OB 3JCMc 3VQYA 1BIBA 2A7YA 2Y4YA 3HRKA 3LLRA 4H2VA 3LW5E 3O8VA 3JCMX 4XTWA 3UGQA 2L8DA 1X55A 1SESA 3G71A 1KC8C 2EIFA 1XNIA 3J81E 3EAEA 5GMKe 1N9RA 2Y90A 2E1HA 4JLIA 4M7AG 4RCBA 3P8TA 5GMKj 2RI2A 1KHCA 4OLFA 3CD6A 4GY5A 3X20B 2E5AA 3OYNA 1G3WA 2QHSA 3JCMP 1VQMT 3OSSC 2X4XA 2JNGA 3VU3C 2EAYA 3A8GB 1I81A 3CXCS 1G3YA 5HK0A 2QEXT 2DK3A 1VQLA 4A53A 3CCRT 3RMQA 2PMFA 3QPHA 1ZHIA 4EMGA 1QVGS 1C0AA 3I7FA 3G4ST 5CKFA 4ELZC 1D3BA 2OTLA 2CJBA 2EJGA 3L1AA 2IVWA 2RJCA 5LJ3e 3CC7T 5J3BA 4M77D 2AMCB 3CCMT 2ZIMA 2XDDA 4M7AD 3V8JA 3OYGA 2FVUA 1BBWA 3FIFA 2R58A 3M4YA 2RHIA 3URGA 4C92F 4PG3A 3QO7A 1BBUA 4O6JA 3R6OA 4ME7A 2NS6A 1NYQA 4BUGA 4M75G 4DPGA 1QP2A 4M7AA 3VYGA 4HKEA 2G4CA 2DO3A 3IKLA 4BE0A 2OTLT 2JOYA 2K5FA 1ASYA 3ZEHA 5CIUA 4IUUA 4CS3A 3JCMV 2K5LA 2ZT8A 2RD1A 1YFTA 2EWNA 4QVZA 4IKFA 1H3ZA 3A8HB 4B9XA 3I56A 1LYLA 2ALYB 1KMMA 4TVYA 1M90C 4H02A 1UGRB 2HQXA 2XIDA 4E7LA 4H2WA 2VYTA 2F5KA 4ZGEB 3WQZA 3M4GA 3LGLA 3M58A 1VQ7A 2QTXA 4M78G 1E1TA 1KC8U 4YRFA 4Q5WA 3SD4A 1N6AA 1VQ5A 3LSSA 3J7AF 1XOVA 3JCMb 3S3NA 4EMHA 5GAOl 3CCVT 2JTFA 3OW2A 3OW2S 2QA4T 2ZPEB 2CIMA 2I2LA 2RH2A 5EG2A 4N4HA 1BIAA 1USYC 3PIOA 5KE2A 3OSVA 3C4SA 3HTZA 4CS2A 2AHJB 5GAN3 3OYYA 2XKOC 3UWNA 2E3CA 2RHZA 3ZFJA 4NL3A 1VQ5T 5KE3A 2MWOA 4TTVA 2WSCE 2YRVA 4UPAA 3BFMA 3X26B 3CD6T 3CCJT 1VQPA 5LJ3f 3PCOA 3W3SA 4FL6A 5IN1A 4J83A 1VIEA 4ZIBA 3SB2A 1VQKA 5GAN8 4M77B 2RHQB 2JVVA 5J39A 3CC4A 3HRIA 3RIRA 4KUIA 3HRSA 2H3JA 1W4SA 5GAMd 2CZ1B 2DIQA 2DJZA 1LJOA 3HXWA 4C92G 2RI3A 4C8QB 3OY9A 4FU6A 3MEAA 4YRRA 3L4GB 2YLBA 2P5IA 2QHTA 3JB9I 5GAOn 1SSFA 5KCOA 4K88A 3F70A 1M1KU 3QZ9B 2MMPA 4PJOG 3QYHB 5GAOr 4EO4A 4TVWA 2QXFA 4Q15A 2QHVA 5C53B 1KQSS 5GMKh 1VIFA 1IREB 5HY6A 3L2RA 3GP8A 5FU7B 5GAN6 3IALA 2XD0A 3IKMB 4YREA 4D6WA 2MAMA 1RL2A 2GFAA 5HGQA 4LDYA 4L6V5 3X24B 1L0WA 2RK1A 5FRNA 2HD0A 3G6ET 4EX5A 2C7IA 3P8HA 2K4YA 2GQVA 2ALYA 4YRCA 4J7FA 1G5IA 1N9WA 3PGGA 3A8MB 3CMAA 4V2SA 5K1XA 4M77F 2RHQA 4JDSA 4F7UE 4LVIA 3CPWA 3J80E 1M1FA 2FL7A 3LSQA 5GAMf 4OB1B 2PVDB 4C8QF 4YYEA 3CC2T 3LX7A 1VQ7T 3AHUA 3M56A 1YJWA 1XTDA 1KMNA 3ASKA 3ME9A 2V8IA 4P72A 1YJNA 3VQXA 1VQNT 3TEHB 3PMIA 4BE2A 1Q82C 4II1A 4QQDA 2PVOB 4WI1A 1WJSA 4RQFA 4QVDA 4M7AE 1YITT 4TQDA 4NOYA 4FT2A 3CPWS 3OYLA 3UFGA 5CK9A 1PYSB 3QDRB 2JTMA 1VQZA 5KH6A 1K8AU 5LJ5d 3ICAA 2LX9A 3HXUA 2CYZB 3QIIA 1KD1C 4N4GA 4YRMA 1H4QA 3OS5A 4YRTA 3FDRA 3REXA 3HFVA 1NJIU 5GAMj 4FSXA 5A0DA 2IG0A 3A5YA 2ODRC 4H2XA 1NJ2A 4M75B 4C5IA 3R07A 3CC7A 4YDQA 4P5NA 4C8QE 3HFZB 4M7DD 4CH6A 4LD6A 5IT9E 4PJOD 1ADJA 2ZZFA 1BI2A 1YI2T 3BW1A 3NELA 3CMEA 4ZN1A 3OYAA 1NJ5A 2VC8A 2XU8A 3A32A 5HKCA 1BKBA 1K9MC 2EYQA 4XTVA 1G3TA 4XU0A 3JB9F 3PT9A 1O75A 4DOVA 2XDBA 3JCMd 1O9SA 3A7RA 4P74C 2A3LA 2QEXA 2QI2A 4M77A 3OA6A 3UGTA 4WF2A 4C5HA 2G3RA 4NCXA 4YPFA 4BWAA 1M4ZA 2ZZEA 4M78B 3KUFA 3MO8A 3E19A 5FLXE 4P71C 2ZNIA 2LTOA 3QO3A 3OBWA 3L42A 4K87A 2GF7A 3UH0A 4BDZA 3HY1A 1BI3A 1G5HA 3CCMA 1E22A 5L8RE 2DQ0A 2LT4A 2V8KA 1NJIC 3RESA 5FROA 1VQ4A 2ARSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HK9 A;  4M75 E;  4X9C A;  4DPG A;  2FB7 A;  4PJO F;  2ZIN A;  4M7A A;  2G4C A;  3IKL A;  1WYD A;  3TUP A;  1D3B B;  4OP0 A;  4DQ2 A;  5GAO p;  2ODR D;  1NNH A;  1ASY A;  2IY5 A;  3A74 A;  1Y96 B;  4CS3 A;  3JCM V;  11AS A;  2ZT8 A;  4J5Y A;  2RD1 A;  1YFT A;  2RB6 A;  3HXV A;  2EWN A;  4P3O A;  4NL2 A;  4M75 C;  4YRS A;  1LYL A;  1H4T A;  5GAN 7;  4C8Q D;  2ALY B;  4F7U G;  1NJ8 A;  4YCW A;  2IY5 B;  1KMM A;  1U1S A;  4TVY A;  4HT8 A;  4M78 F;  4H02 A;  4YRK A;  1X2G A;  1RIQ A;  3RKW A;  4XEM A;  4BW9 A;  1USY A;  2ZZG A;  4PJO A;  1NJ1 A;  2ZNJ A;  5LJ5 g;  4UP8 A;  1YFR A;  1B34 B;  4H2W A;  3V7C A;  5KNN A;  3WQZ A;  3M4G A;  2YLC A;  5DY9 A;  3JCM W;  5GAN j;  4Y91 A;  2EJF A;  1Z7M A;  2I4O A;  2K57 A;  4C8Q A;  3HFN A;  5LJ5 h;  2ZT7 A;  1B8A A;  2QTX A;  4M78 G;  2HNI A;  1E1T A;  4M78 D;  4P75 A;  3E9H A;  4HWT A;  4YRF A;  4HWR A;  1EQR A;  4WJ3 M;  3LSS A;  4HA8 A;  4J6X A;  1HXD A;  3JCM b;  2RM4 A;  4P75 C;  3TEH A;  4EMH A;  4ZTU B;  5GAO l;  5GAM g;  4RMF A;  5GAM e;  2E65 A;  3PCO B;  2CIM A;  2I2L A;  2ZGW A;  1X2H A;  12AS A;  4M7D C;  3LC0 A;  1LNX A;  1BIA A;  4M78 A;  3NET A;  4J6W A;  4C92 D;  1USY C;  1KQ2 A;  2EJ9 A;  2VXE A;  2CJ9 A;  4YRI A;  4E51 A;  4XTY A;  4H2Y A;  4CH3 A;  3A5Z A;  3JB9 D;  3E9I A;  3NEM A;  1EIY A;  4PJO E;  3HTZ A;  5E3I A;  3RGL A;  4CS2 A;  2RA2 A;  5ELN A;  5GAN 3;  2EL9 A;  4P72 C;  4P3P A;  4YRN A;  4M7A C;  1X56 A;  4XU1 A;  2E3C A;  3M4P A;  4TVA A;  2RHS B;  4NL3 A;  3RUX A;  3INZ A;  3CMQ A;  4O2D A;  4YRJ A;  4H2T A;  4MMK A;  2Q7G A;  4TTV A;  1B70 B;  1IL2 A;  5CAI A;  3JCM h;  2I4L A;  4UPA A;  3BFM A;  4H2X B;  1Y96 A;  3A7U A;  1SET A;  3PCO A;  4P3N A;  5LJ3 f;  4TQF A;  5ELO A;  4J6Y A;  2ARU A;  4M75 A;  3W3S A;  4P74 A;  1WQW A;  5GAM h;  3PZC A;  4M7D A;  4M77 C;  4ZIB A;  3SB2 A;  3BDU A;  4EMK B;  1H4S A;  5GAN 8;  4M77 B;  5GAO q;  2RHQ B;  4PHC A;  1I4K 1;  1GGM A;  3KFU A;  3HRI A;  4H2U A;  4CH4 A;  1HTT A;  5GAN e;  3RIR A;  4KQE A;  4M75 G;  2AKW B;  2DTO A;  5GAM d;  1J5W A;  3QO8 A;  1HC7 A;  3HXX A;  4P73 A;  3JCM Q;  4JRK A;  4M78 E;  2DJZ A;  1LJO A;  3A31 A;  2ARS A;  3A7A A;  3HXW A;  3EFR A;  4C8Q C;  3QUI A;  3P8V A;  4C92 G;  2DKG A;  4C8Q B;  2DZC A;  3G1Z A;  4LNS A;  2I4N A;  1PYS A;  4RQE A;  1WQ7 A;  4F7U B;  4YRR A;  3VQW A;  4QVC A;  4YRQ A;  3L4G B;  4YRP A;  4YCV A;  3BJU A;  2YLB A;  2P5I A;  3HY0 A;  1B70 A;  2QHT A;  1I5L A;  4YRG A;  3RF1 A;  4M7D B;  3JB9 I;  5GAO n;  4CH5 A;  4C92 B;  4K88 A;  4PJO B;  4XTU A;  4YRL A;  1H4V B;  4Q6G A;  1N9S A;  4C92 C;  4PJO G;  1JJC B;  1M8V A;  2ZCE A;  1SER A;  5GAO r;  3GIB A;  4EO4 A;  5LJ5 f;  4TVW A;  1G51 A;  4Q15 A;  2QHV A;  5C53 B;  4P73 C;  4M78 C;  2J3M A;  4YRO A;  4PJO C;  4C92 A;  5GAN d;  2E41 A;  5GMK h;  3QTC A;  1B7Y A;  2ART A;  3TEG A;  5LJ3 g;  3HSB A;  4M7A F;  3MEY A;  5GAN 6;  1W66 A;  4H2S A;  2PME A;  3IAL A;  3IKM B;  2ZT5 A;  4HT9 A;  4YRE A;  2E64 A;  3HXY A;  5HGQ A;  1QE0 A;  4JRI A;  2ZXF A;  2YHT A;  1LOJ A;  1L0W A;  2DQ3 A;  4M7A B;  2Q7E A;  1B34 A;  4HWO A;  2QHU A;  4EX5 A;  4WJ4 A;  1FYF A;  2C7I A;  2ZR2 A;  1ASZ A;  1JRI A;  4M7D G;  2CGH A;  1EVK A;  4HWS A;  4RDX A;  1KOG A;  4XTZ A;  5LJ3 d;  2ALY A;  2RHS A;  5LJ5 e;  1YCY A;  4YRC A;  2C8M A;  1G5I A;  1NYR A;  1U1T A;  1N9W A;  4XEO A;  3PGG A;  4HVC A;  2DVE A;  4P71 A;  4V2S A;  1KQ1 A;  3FJP A;  1JJC A;  1EIY B;  5K1X A;  1M5Q 1;  1YFS A;  2DEQ A;  4HWP A;  4M77 F;  2RHQ A;  3MF1 A;  4F7U E;  4M75 F;  1YGB A;  1EFW A;  4JUV A;  3DSQ A;  4F7U F;  3LSQ A;  5GAM f;  5GAN h;  3JCM J;  1JBM A;  3QHS A;  3JCM f;  4EMK A;  4TWA A;  4C8Q F;  4YYE A;  4M7D E;  1WPY A;  4C92 E;  1SRY A;  5LJ3 h;  3AHU A;  3RER A;  5GAO m;  2Q5I A;  3M4Q A;  4G85 A;  4AH6 A;  5GMK l;  5K1P A;  2I4M A;  1H64 1;  1KMN A;  1WU7 A;  3OD1 A;  2ZR3 A;  3VBB A;  5LJ3 j;  2FYK A;  2ZTG A;  2DZ9 A;  4P72 A;  3VQX A;  1E24 A;  1YB3 A;  1ATI A;  3TEH B;  1E1O A;  4X5O A;  1X01 A;  3V7S A;  3NEN A;  4C8Q G;  5GAN f;  1NJ6 A;  4XU2 A;  4WI1 A;  5GAN 2;  3QNE A;  2DDZ A;  2DU7 A;  4UP7 A;  4XU3 A;  4MML A;  4RQF A;  1WLE A;  1WNL A;  2DU5 A;  4QVD A;  4XTX A;  4M7A E;  5C51 B;  3JB9 J;  1EVL A;  4G84 A;  4J15 A;  3JCM e;  4TQD A;  4N0A A;  4NOY A;  4PNO A;  3HFZ A;  5GMK m;  3JCM c;  3VQY A;  3SWN C;  1BIB A;  4ZTZ B;  3UFG A;  3HRK A;  1X54 A;  1PYS B;  4F7U A;  4N0A C;  2CJA A;  1VQZ A;  5LJ5 d;  2DXU A;  4H2V A;  3RL6 A;  1B76 A;  3ICA A;  3HXU A;  3JCM X;  2AKW A;  4XTW A;  4M77 E;  3RAC A;  3UGQ A;  1X55 A;  2J3L A;  3QSU A;  4YRM A;  1H4Q A;  1SES A;  4YRT A;  3REX A;  5GAN 5;  3HFV A;  4TVA B;  5GMK e;  3HFO A;  4YCU A;  1N9R A;  2Y90 A;  5GAM j;  4YP0 A;  2E1H A;  2E10 A;  4JLI A;  4M7A G;  3ERR A;  4RCB A;  4XQ3 A;  5GMK j;  2XGT A;  3P8T A;  3A5Y A;  2ZIO A;  1ADY A;  2ODR C;  4H2X A;  1NJ2 A;  3QO5 A;  4OLF A;  3MF2 A;  4M75 B;  2E5A A;  4UP9 A;  2QHS A;  3JB9 G;  3R07 A;  3JCM P;  2ZT6 A;  4M75 D;  4C8Q E;  3HFZ B;  4YDQ A;  4KR3 A;  4K86 A;  4M7D D;  3VU3 C;  2EAY A;  4CH6 A;  1EOV A;  4PJO D;  1ADJ A;  2Q5H A;  4CS4 A;  5LJ5 j;  1I81 A;  2ZZF A;  3P8Y A;  3SWN A;  3BW1 A;  3IG2 A;  2DXT A;  3NEL A;  4EMK C;  2P0L A;  1NJ5 A;  3RKX A;  2VC8 A;  2DTI A;  2JN0 A;  3A32 A;  3EFS A;  3RKY A;  4XTV A;  1I8F A;  4A53 A;  5GAN g;  4XU0 A;  3JB9 F;  2PMF A;  2XTI A;  5F5W A;  3V8L A;  4EMG A;  4RCC A;  2Q7H A;  1C0A A;  4M77 G;  3L2Z A;  3I7F A;  3JCM d;  1QF6 A;  1TH7 A;  3HXZ A;  3L4G A;  3JB9 H;  1Z7N A;  3A7R A;  1D3B A;  4P74 C;  4M77 A;  5I21 A;  2CJB A;  3BY7 A;  2EJG A;  3REU A;  3L1A A;  3UGT A;  5GAN 4;  4WF2 A;  4YPF A;  4A54 A;  4NCX A;  5GMK i;  4BWA A;  2ZZE A;  4M78 B;  5LJ3 e;  4M77 D;  2AMC B;  2ZIM A;  4M7A D;  4P71 C;  2ZNI A;  3JCM g;  3V8J A;  4L87 A;  1BBW A;  3FIF A;  3QO3 A;  3V8K A;  2DTH A;  3VQV A;  4K87 A;  2VXF A;  3FB9 A;  2AMC A;  3UH0 A;  3HY1 A;  1B7Y B;  1G5H A;  4C92 F;  4X9D A;  1E22 A;  4PG3 A;  3QO7 A;  4M7D F;  3SWN B;  4KR2 A;  2DQ0 A;  1BBU A;  3RES A;  1MGQ A;  1NYQ A;  5C52 B;  3V7R A; 
#chains in the Genus database with same CATH topology
 4X9C A;  1X2Q A;  1U8R A;  3REA B;  2QQR A;  1M30 A;  1QVG P;  1KJW A;  1EIF A;  3TUP A;  1GCQ C;  1FMK A;  3E1S A;  1NNH A;  3LH0 A;  2IY5 A;  1AWO A;  5C6S A;  4MDW A;  1GXI E;  1R0B G;  2VB6 A;  4J5Y A;  1RAA B;  2RB6 A;  1WYX A;  4LDU A;  3EG9 B;  4BI4 A;  2Z0W A;  1PRM C;  5GAN 7;  5CQY A;  4C8Q D;  4F7U G;  1X2G A;  4CI0 C;  2HDA A;  4BW9 A;  2L89 A;  1VQ9 A;  1LCK A;  2FZK B;  4PJO A;  1CKA A;  2AIR B;  1NJ1 A;  1AHJ B;  5LJ5 g;  3M55 A;  1QVP A;  5FWB A;  3EGU A;  3V7C A;  5KNN A;  2KRS A;  2VKN A;  4HCB A;  5GJW B;  2DL4 A;  2CS7 A;  4J9I A;  2BIV A;  4C8Q A;  1B8A A;  2D0Q B;  4M78 D;  1YHQ T;  1T3L A;  1PM3 A;  2LQW A;  2KDS A;  3VRZ A;  3TQ7 P;  4HWR A;  1W2B S;  2OTJ Q;  2K6D A;  1YIJ T;  4WJ3 M;  1Q7Y C;  4MZT A;  3HPW A;  4QQG A;  4FYV B;  4JJB A;  2RM4 A;  4P75 C;  2RNA A;  4ZTU B;  3VUZ A;  3QG1 A;  1Q86 U;  5D7U A;  5GAM e;  2M16 A;  3I55 Q;  1N8R R;  1BBZ A;  1OV3 A;  1PSF A;  1PSE A;  4Z88 A;  1X2H A;  2VUB A;  2J6F A;  12AS A;  2D9T A;  2A08 A;  3LC0 A;  4JRP A;  4M78 A;  2RO0 A;  4FM4 B;  4C92 D;  3NTI A;  3QJ6 A;  1N5Z A;  1PNJ A;  3H0I A;  3E9G A;  1NZ9 A;  5ECA A;  4H2Y A;  4CH3 A;  2L2P A;  4KUL A;  2HSP A;  4PFP A;  3JB9 D;  4WTO B;  4J9C A;  4J7I A;  2RA2 A;  1PD0 A;  2NLU A;  3I55 A;  2KQW A;  2EYW A;  4P72 C;  3M0Q A;  4M7A C;  3M57 A;  4Z02 A;  3M4P A;  2NWM A;  4ELY C;  4TVA A;  4YRJ A;  4J8O A;  1QQJ A;  4H2T A;  3M54 A;  1IL2 A;  1B70 B;  4QQ6 A;  5CAI A;  1Y7X A;  5LL6 S;  2DPP B;  1Q81 U;  2L5Q A;  2XHC A;  4IIO A;  4C5G A;  2DD4 A;  4A4E A;  4BB7 A;  4M75 A;  1SF9 A;  3L2W A;  4RMO A;  3OYB A;  4ESR A;  1W2B A;  4FIB A;  4BY6 C;  4EMK B;  1H4S A;  1M3C A;  3QBY A;  1VUB A;  1I4K 1;  4RTY A;  1GGM A;  2QTV A;  3C12 A;  1K73 C;  1HTT A;  4OVA A;  5GAN e;  3CC4 Q;  4KQE A;  2X4Y A;  2AKW B;  2DTO A;  5CKB A;  2D1X A;  2AKK A;  3QO8 A;  2EW3 A;  1HC7 A;  5CQX A;  3VS7 A;  4PJN A;  3JCM Q;  1RAE B;  1RI0 A;  2RJE A;  1VQN Q;  2Y4X A;  1OZ3 A;  2DMO A;  3VUB A;  5A0L A;  1X6B A;  3QUI A;  1M90 U;  2DKG A;  1HYO A;  2DZC A;  1UJY A;  3G1Z A;  3MET A;  4LNS A;  4RQE A;  4F16 A;  1JU5 C;  2YRC A;  4LVK A;  4YRP A;  3BJU A;  3HY0 A;  1KK7 A;  1Y0M A;  1B70 A;  1YIJ A;  4CH5 A;  4PL6 A;  3M5A A;  4YRL A;  1FX7 A;  1H4V B;  1Q86 R;  4Q6G A;  1V29 B;  1M2V A;  1NE8 A;  4KGZ B;  3DLM A;  2YUN A;  4E7J A;  1IGU A;  2QA4 A;  2ZCE A;  5LJ5 f;  4C0G A;  2IIM A;  1R0C B;  3M53 A;  1KD1 U;  4M78 C;  2J3M A;  1PKS A;  4PJO C;  4YRO A;  1NYF A;  5GAN d;  1B7Y A;  3CPW P;  4RKU E;  2ART A;  2LRQ A;  2ATC B;  2K2V A;  3HSB A;  1PRL C;  4IUQ A;  4E7H A;  4JS4 A;  2CH4 A;  3PIP A;  2EQI A;  3HXY A;  1UGV A;  2EQK A;  4JRI A;  2YHT A;  1YJW T;  4M7A B;  4AG2 C;  2COW A;  5IHK A;  2QHU A;  1FYF A;  3C94 A;  3CCU Q;  1M9S A;  1VQ7 Q;  3GNF B;  1JRI A;  1VQ6 T;  4HWS A;  1ZSG A;  3D7S B;  3G7Z A;  5LJ5 e;  1A0N B;  1YCY A;  2DXC A;  1TU0 B;  1RAI B;  3CCJ A;  1VQP T;  3M59 A;  4HVC A;  2DVE A;  5CVI A;  4P71 A;  1OZ2 A;  2QYZ A;  2HEQ A;  3PTA A;  1YJ9 A;  3VJP A;  3PNW C;  2F5T X;  3MF1 A;  1OU9 A;  3NPF A;  1YGB A;  1W1F A;  4JUV A;  1P92 A;  5A2Q E;  2FRY A;  1YIT Q;  2K5I A;  2X3W D;  5GAN h;  1JBM A;  4EMK A;  1D0Z A;  4C92 E;  2P0P A;  4ZGD B;  1SRY A;  4XAX B;  3RER A;  2JMA A;  1SHF A;  2W10 A;  4G85 A;  5GMK l;  5K1P A;  3HHT B;  1WU7 A;  3G6E Q;  3VBB A;  4C0D B;  2FYK A;  5LJ3 j;  2DZ9 A;  1VQ6 A;  1E24 A;  2ABL A;  1YB3 A;  4N4I A;  1PG5 B;  1B7T A;  1NYG A;  2F2X A;  2KEA A;  1ATI A;  1W2B P;  2O31 A;  4GLK A;  2VAS A;  3OYH A;  2KRN A;  1SPK A;  3QKJ A;  3OYD A;  2NUP A;  2JTE A;  3SDZ A;  2VVK A;  2DU7 A;  4MML A;  3MEV A;  4JRQ A;  2A28 A;  4XTX A;  1D1A A;  2G6F X;  3NFC A;  2FRW A;  5HCK A;  4N0A A;  4C0Z A;  4PNO A;  2K3Y A;  2WSF E;  2X3X D;  1VYT A;  3SWN C;  1K73 R;  3CCJ Q;  4DOW A;  4J9F A;  4RTU A;  4ZTZ B;  2PTK A;  1QWE A;  3NTK A;  2QQ9 A;  4N0A C;  2CJA A;  1TG0 A;  4OB0 B;  2DXU A;  2RHU A;  3KBG A;  2QEX Q;  3RAC A;  2LNH B;  3FLG A;  2J3L A;  3QSU A;  4LUD A;  4PLI A;  5FU7 C;  1AWW A;  4TVA B;  4IUT A;  5DLQ E;  4YCU A;  2RN8 A;  2EYX A;  1YHQ A;  2QQA A;  3WVD B;  4KRT A;  2E10 A;  4TVR A;  4EDU A;  4XQ3 A;  2XGT A;  5IHI A;  2ZIO A;  1ADY A;  3VV0 A;  4X1V A;  3HL8 A;  4CRI A;  3MF2 A;  1KD1 R;  2E70 A;  3TCJ A;  4OB2 B;  3CCS T;  1RLQ C;  2BZ8 A;  4EPC A;  2ZT6 A;  4RUG A;  2JMC A;  4KR3 A;  1M1G A;  1PKT A;  2FPD A;  1FXX A;  1EOV A;  1QP3 A;  1SRL A;  3SWN A;  2HKN A;  1BCM A;  2DXT A;  3H8Z A;  3SEM A;  3IG2 A;  4BY6 B;  4EMK C;  9ATC B;  3RKX A;  4PJM A;  4KH0 B;  2JN0 A;  1K8A C;  2FZG B;  1RAG B;  1M3B A;  3RKY A;  3OYC A;  1I8F A;  1SRM A;  1OI1 A;  2XTI A;  1JJ2 S;  5F5W A;  1QVG A;  2LNV A;  1G5V A;  3EG3 A;  4LDW A;  4B6M A;  1K4U S;  1EZZ B;  3L2Z A;  2KSS A;  3QYG B;  1TH7 A;  3HXZ A;  3L4G A;  3JB9 H;  1KC8 R;  1Z7N A;  4VUB A;  3A8L B;  2EBP A;  1BYM A;  2YRD A;  2OJ2 A;  4OF1 A;  3REU A;  1AD5 A;  5GAN 4;  4A54 A;  1VQN A;  4AG1 C;  5CO7 A;  3MEU A;  2KR3 A;  2V1R A;  3EG2 A;  4RTZ A;  4E47 A;  1BU1 A;  3OS1 A;  3RNJ A;  4C0F A;  1ZA1 B;  4HVW A;  5CKE A;  3NGP A;  3OMG A;  5A0G A;  3FC3 A;  2F69 A;  1UGQ B;  2HKQ B;  4A4F A;  2FHD A;  1VYV A;  4X9D A;  1KHI A;  4M7D F;  3SWN B;  3MEW A;  1MGQ A;  2RF0 A;  3CCR Q;  2LCL A;  3GOX A;  2CUB A;  3V7R A;  1HK9 A;  4M75 E;  3I56 Q;  2FB7 A;  4PJO F;  1VQO T;  1BK2 A;  2DM1 A;  1WYD A;  2LCC A;  3EG0 A;  2EVR A;  4LDV A;  4OP0 A;  2NUP B;  4DQ2 A;  2LVM A;  3AT1 B;  3A74 A;  1Y96 B;  2LQ8 A;  3M9Q A;  2K9G A;  11AS A;  3RBB B;  4JPB W;  2ZPG B;  3HXV A;  3H0F A;  4P3O A;  4NL2 A;  4ZN3 A;  1ZLM A;  4YRS A;  1TUD A;  1Z9Q A;  3CME T;  2HBP A;  4JZ4 A;  4BE1 A;  3MP1 A;  2RQT A;  2IY5 B;  1WHH A;  1YJN T;  4M78 F;  1UEB A;  2R5A A;  3TRE A;  2CP5 A;  3OBY A;  3QWY A;  3RKW A;  1Y57 A;  2ZNJ A;  4LD9 K;  2CZ7 B;  3A1P A;  2RJD A;  4MDX A;  4UP8 A;  1AVZ C;  1YFR A;  3MJX A;  3PVQ A;  2BZY A;  4L5G A;  4ZGJ B;  2GGR A;  3A5Z B;  4KBM B;  3PFS A;  2QG9 B;  3JCM W;  2WSE E;  5GAN j;  4Y91 A;  2EJF A;  1Q81 C;  1OX9 A;  2I4O A;  2K57 A;  2ZT7 A;  1AZE A;  3QXE B;  2ECZ A;  4LVM A;  2HNI A;  5CR2 A;  4HCC A;  4P75 A;  3DKM A;  3GNG A;  2LQK A;  3E9H A;  1AEY A;  3CMA T;  1QVF A;  4AFU C;  1EQR A;  3QZ5 B;  4PK4 A;  4J6X A;  2CP7 A;  3CCQ Q;  2P0Q A;  1HXD A;  2KK4 A;  2M0Y A;  3T9N A;  4LVL A;  5GAM g;  4RMF A;  1QVF P;  2FG0 A;  3PCO B;  2DNU A;  2DET A;  2KT8 A;  3FEO A;  2ZGW A;  2DF6 A;  3MP8 A;  1VQ4 T;  1PC0 A;  2O9S A;  1LNX A;  4J6W A;  1QCN A;  1YCS B;  1YJ9 T;  1KQ2 A;  1W70 A;  2VXE A;  4LN2 A;  3CC7 Q;  4XTY A;  4R0K A;  2CZ0 B;  1BI1 A;  3E9I A;  3NEM A;  3SFM A;  3CCL T;  1K9M U;  1EIY A;  3CCU T;  1KFZ A;  4A4H A;  3CBP A;  1VQ6 Q;  1D0Y A;  2LDM A;  5IAY A;  4P3P A;  1MV0 B;  4PFZ A;  1X56 A;  4PJL A;  4DBR A;  1VQO A;  3INZ A;  3CMQ A;  1VQK T;  1WJQ A;  3O5Z A;  5D6X A;  4O5V A;  2GTO A;  1MHN A;  2K3X A;  4GLM A;  3S3M A;  2GCX A;  4RTV A;  1V76 A;  2I4L A;  3EGX A;  2QDY B;  1M1K R;  4OMP A;  4H2X B;  2GTJ A;  1VQ9 T;  2OAU A;  5ELO A;  4WCI A;  1YNZ A;  4J6Y A;  3IQL A;  2ARU A;  3S6W A;  1WQW A;  5GAM h;  3CCS A;  4B9W A;  2AZV A;  3OYM A;  2K2M A;  4DEX A;  1ZBX A;  3BDU A;  3N5B B;  4J9E A;  3JRZ A;  5GAO q;  1YJ9 Q;  4D8K A;  1GBR A;  1MUZ A;  1IGQ A;  3EGX B;  2PUK B;  1ZBJ A;  2RK2 A;  3KFU A;  2QQS A;  1RI9 A;  3QWX X;  1ZUU A;  2DL5 A;  2J05 A;  4CH4 A;  3UT1 A;  5IH2 A;  2LJ1 A;  5KYW B;  2COZ A;  1ABQ A;  2BE9 B;  2L3P A;  1QW1 A;  1S72 T;  3HXX A;  5D6Y A;  1VQP Q;  3LWI A;  4KGV B;  2K3B A;  3A31 A;  1RAF B;  5C0M A;  1WXU A;  3ZL7 C;  3EFR A;  1MMA A;  1WX6 A;  4A4G A;  3UDC A;  1NBE B;  1NLP C;  4M4Z A;  3M0T A;  3I56 T;  4FW1 A;  2X35 A;  1FYN A;  1WQ7 A;  5KCH A;  3VQW A;  4QVC A;  2RQU A;  4LXC A;  4YCV A;  1UDL A;  1Q95 G;  1I5L A;  4YRG A;  5CCA A;  4C92 B;  4PJO B;  4XTU A;  4MZM A;  3EFO B;  4C5E A;  4ZTF A;  4DBH A;  2BTT A;  2RPN A;  2P4T A;  5M9O A;  1G83 A;  1JJC B;  2AZS A;  2CSI A;  1Q82 U;  3GIB A;  3PVL A;  5IHN A;  4AFQ C;  3OB9 A;  2KYM A;  1TSF A;  4C92 A;  2E41 A;  3OYF A;  4LE9 A;  2MF2 A;  5DM7 R;  2RJF A;  2DIG A;  4M7A F;  3G6E A;  1W66 A;  4H2S A;  2KNB B;  2LT1 A;  1OOT A;  3EH2 A;  3GF5 A;  2ZT5 A;  4HT9 A;  2FZC B;  3KXT A;  3G71 T;  1QE0 A;  2ZXF A;  1LOJ A;  1YI2 A;  2DQ3 A;  1B34 A;  3OYK A;  1HSQ A;  1U06 A;  4HWO A;  3CCE Q;  2ZR2 A;  2RMO A;  5AT1 B;  3GLX A;  4J9H A;  1F1B B;  4YTL A;  1EVK A;  1FWZ A;  3MQZ A;  4RDX A;  2FO0 A;  5LJ3 d;  2RHS A;  2L3R A;  2C8M A;  1NYR A;  1U1T A;  1TWB A;  2E4H A;  4XEO A;  2ZPI B;  3ULR B;  3FJP A;  1OYX A;  5I2S A;  1M5Q 1;  3OS0 A;  1YFS A;  2B8A A;  4XK8 E;  1EFW A;  3WXM B;  1E6G A;  2E6Z A;  3CCV A;  1WGS A;  1IZ6 A;  4F7U F;  3QHS A;  2QQB A;  1VQL T;  3VS2 A;  1WPY A;  2R57 A;  3VKI A;  4C0D C;  2JZ2 A;  4OMO A;  4M7D E;  6AT1 B;  1WDX A;  5LJ3 h;  2Q5I A;  3M4Q A;  1CKB A;  4NS5 A;  4AH6 A;  1N8R C;  2V26 A;  5J26 A;  2ZR3 A;  1JB0 E;  2E3H A;  2ZTG A;  2DD5 A;  4ANJ A;  2CZ6 B;  4DA4 A;  2KXD A;  2LP5 A;  1TTH B;  1E1O A;  1X01 A;  2NUT B;  3HP9 A;  4RTX A;  4X34 A;  3NEN A;  4C8Q G;  5GAN f;  4PLL A;  1NJ6 A;  1RAB B;  2YDL A;  3QNE A;  3FRN A;  4LDX A;  4UP7 A;  4XU3 A;  3CC2 Q;  2DU5 A;  1LVK A;  1JXM A;  2KMT A;  3JSC A;  5C51 B;  3JB9 J;  2ED1 A;  4G84 A;  4J15 A;  3MP6 A;  4IIM A;  1JQQ A;  2EQJ A;  3HRU A;  3P8B B;  3X28 B;  2A8E A;  3I5R A;  1NPP A;  2J06 A;  2RI5 A;  2A0F B;  1X54 A;  4F7U A;  3U23 A;  2ESW A;  3RL6 A;  1B76 A;  1Q7Y U;  3JAM E;  2RHX A;  5FWC A;  2AKW A;  4M77 E;  3L2Q A;  5FU6 C;  4IUR A;  1JJ2 P;  4DBF A;  5GAN 5;  1K0X A;  1QCO A;  2M0O A;  1GL5 A;  1R77 A;  2VV5 A;  3HFO A;  2CT3 A;  5CKH A;  3TEE A;  4L59 A;  3GPL A;  3ZBD A;  2QAZ A;  5AYF A;  2DYI A;  4YP0 A;  1N27 A;  4BI3 A;  3WVE B;  1TUG B;  1UEC A;  3DB3 A;  3OYE A;  4LUE A;  3ERR A;  1AT1 B;  3VS6 A;  2PU9 B;  5KYY A;  3QO5 A;  3PMT A;  2DRK A;  2F2V A;  4UP9 A;  1XQH A;  3JB9 G;  4M75 D;  4K86 A;  4CS4 A;  2Q5H A;  3CCR A;  5LJ5 j;  2GFU A;  3P8Y A;  2AT1 B;  4IUV A;  1PWT A;  4OMF B;  3ER0 A;  2D0N A;  4FYY B;  4R56 A;  2P0L A;  2DTI A;  1E7O A;  2CP6 A;  3EFS A;  3P8D A;  2E5K A;  5GAN g;  1D1C A;  3V8L A;  4RCC A;  2Q7H A;  4M77 G;  3CEY A;  1QF6 A;  2XIC A;  4J9G A;  3CCS Q;  1IRX A;  2NUZ A;  3M0R A;  5I21 A;  1BCO A;  3BY7 A;  2XG8 D;  2D8J A;  4R55 A;  3CC4 T;  3OS2 A;  1AZG B;  1WLP B;  2CP2 A;  5GMK i;  1AWX A;  3OW2 P;  2DAQ A;  2MIO A;  2D6F A;  2W0Z A;  4OGC A;  2C0I A;  1NPR A;  1ZA2 B;  3CBM A;  5D6W A;  2SRC A;  3JCM g;  5HK3 A;  4L87 A;  1I07 A;  1UE9 A;  3V8K A;  1WJR A;  2DTH A;  4ZTJ A;  3VQV A;  5KYX A;  3I35 A;  2FPF A;  2OTJ A;  2VXF A;  3FB9 A;  3H41 A;  3LGF A;  3CCE A;  2AMC A;  2M9U A;  2ZAE A;  1PD1 A;  5FU6 B;  1B7Y B;  4E7K A;  1B3Q A;  4HVU A;  4KR2 A;  3L2U A;  1M1K C;  3VYH B;  1UG1 A;  5C52 B;  5CKD A;  2ZIN A;  5DLO A;  2HBW A;  2HQE A;  1I0C A;  3OYJ A;  1SG5 A;  4OMM A;  4RG2 A;  1D3B B;  5GAO p;  3C95 A;  2LJ3 A;  2ODR D;  4JS5 A;  3QDF A;  1YHQ Q;  2KAF A;  4KUD K;  4BDY A;  2E12 A;  1GCQ A;  4M75 C;  1ZQ1 A;  1B07 A;  1XJW B;  2XDP A;  3RMS A;  4E7I A;  1H4T A;  4BAC A;  1YBY A;  1NJ8 A;  2WAC A;  4YCW A;  1IHV A;  1U1S A;  4HT8 A;  2PUO B;  1RAH B;  4F17 A;  1G8X A;  1K73 U;  3HRT A;  4A4K A;  4YRK A;  1RIQ A;  2EQM A;  2RHY A;  1WHK A;  2XI9 A;  4AFZ C;  4UC4 A;  4XEM A;  1USY A;  2ZZG A;  1RLP C;  2OAW A;  1Y71 A;  2VGN A;  2BKD N;  3DB4 A;  3KFV A;  1B34 B;  4MZP A;  1JJ2 A;  2YLC A;  5DY9 A;  1Z7M A;  1Y07 A;  2KXC A;  3CCL A;  3MKD A;  2QK0 A;  1JEG A;  1SKU B;  4AMC A;  1U3O A;  3HFN A;  1S1N A;  5LJ5 h;  2ZZD A;  1GRI A;  2EKO A;  1VQ8 A;  1VQ8 Q;  4HWT A;  1VYU A;  2X4J A;  1UB4 A;  4HA8 A;  4OMN A;  3TEH A;  1D1B A;  1ARK A;  4FCY A;  2PVG B;  2CH4 W;  4GBQ A;  2E65 A;  2HQH A;  1VQ9 Q;  1K0S A;  5EC7 A;  2QGG A;  4HXJ A;  2ZCF B;  3I55 T;  1KQS P;  4BD3 A;  4LVJ A;  2X9H A;  4M7D C;  3NET A;  2ZPB B;  2A36 A;  2DVJ A;  2EJ9 A;  2EFI A;  2CJ9 A;  2VWF A;  4YRI A;  4E51 A;  2LC4 A;  2PZ1 A;  3CCM Q;  3A5Z A;  1Q86 C;  1N8R U;  4PJO E;  5E3I A;  3RGL A;  3CCQ T;  1Q81 R;  5ELN A;  2ROL A;  5FRM A;  2EL9 A;  4YRN A;  3HKS A;  2EYY A;  4XU1 A;  1BI0 A;  3BDL A;  3MPU B;  2RHS B;  1RAD B;  3H6Z A;  3RUX A;  3TU4 K;  4O2D A;  1VQ4 Q;  4MMK A;  3CCU A;  2Q7G A;  4E7S A;  3JCM h;  2R5M A;  1NEG A;  1YIT A;  2GNC A;  2AK5 A;  1Y96 A;  2O01 E;  3A7U A;  5I2M A;  2KT1 A;  2XK0 A;  4Y92 A;  1SET A;  4P3N A;  4TQF A;  4P74 A;  3PZC A;  4M7D A;  4M77 C;  4RG8 A;  1HD3 A;  2MI6 A;  4KT0 E;  2PQW A;  3EGD B;  4PHC A;  4ATO A;  4H2U A;  2JUF A;  2M1H A;  3DLL A;  1WA7 A;  3QJY A;  4OGE A;  1D09 B;  3H0H A;  2L0A A;  3CBO A;  1J5W A;  3CC2 A;  2P0K A;  1SEM A;  2JT4 A;  4P73 A;  4JRK A;  2F2W A;  4M78 E;  1VOM A;  1G2B A;  1UGP B;  4JLG A;  4E6R A;  3E9F A;  2CKK A;  1TS9 A;  4PFO A;  4RTW A;  2EQU A;  4OB3 B;  3A7A A;  4C8Q C;  3P8V A;  4FT4 A;  2QA4 Q;  2KVQ G;  2I4N A;  1PYS A;  2K7A A;  4F7U B;  4YRQ A;  2EGC A;  3G4S A;  1UGS B;  3H9N A;  3G1J A;  3RF1 A;  4M7D B;  2JW4 A;  1YFN A;  2ZPF B;  1J3T A;  1M90 R;  1N9S A;  2E3I A;  4C92 C;  2O4X B;  4BI8 B;  1M8V A;  3LH5 A;  3OYI A;  1SER A;  2E6N A;  4IUP A;  1UJ0 A;  4PKC C;  1G51 A;  4HT4 A;  2OTJ T;  4P73 C;  4QKU A;  5IXB A;  2DER A;  7AT1 B;  3QTC A;  2HAX A;  1KIK A;  3CPF A;  1AOJ A;  3TEG A;  2LJ0 A;  4Z89 A;  5LJ3 g;  2V8J A;  2O4X A;  3MEY A;  1TUC A;  2PME A;  2HL5 C;  2E64 A;  2LQN A;  4JJN K;  1NM7 A;  3OQ5 A;  3UAT A;  3CCQ A;  2CRE A;  4QW2 A;  2X4W A;  2Q7E A;  2DL3 A;  3S3O A;  3G71 Q;  1WHG A;  3L2V A;  3EH1 A;  2MWP A;  4HCK A;  4WJ4 A;  3X25 B;  4HCZ A;  1T3S A;  1AWJ A;  2QGF B;  1ASZ A;  1OU8 A;  4M7D G;  1KG1 A;  2CGH A;  3OMC A;  1X6O A;  2CP3 A;  2KRM A;  1KOG A;  1KQS A;  4XTZ A;  2E5Q A;  1TXQ A;  3EG1 A;  1VQM A;  1PHT A;  1ACM B;  1S72 A;  1QCF A;  3MCA B;  3EHR A;  2C0T A;  3TVT A;  1KQ1 A;  1JJC A;  1EIY B;  4HWP A;  2DEQ A;  2VGM A;  3NTH A;  2C06 A;  1H92 A;  2LMJ A;  4M75 F;  2BUD A;  3DSQ A;  1IXD A;  2MK5 A;  3LYI A;  3JCM J;  3UPU A;  3JCM f;  3EGD A;  4TWA A;  1I5O B;  4LNP A;  2DXB A;  2ZPH B;  1Q82 R;  1X27 A;  4Y28 E;  1DJ7 B;  5GAO m;  1R8O B;  1VQ8 T;  1EFN A;  2I4M A;  1H64 1;  3Q1J A;  8AT1 B;  3CCE T;  3OD1 A;  1SSH A;  4DEY A;  1ABO A;  3MHX A;  2KY9 A;  2IPO B;  4X5O A;  3V7S A;  5GJV B;  1G3S A;  1WXB A;  1FMV A;  3CQT A;  3LWH A;  1QVF S;  4XU2 A;  5GAN 2;  1X75 C;  2DDZ A;  1YP5 A;  4FYX B;  1WLE A;  1WNL A;  1NG2 A;  1EVL A;  3CXC A;  3JCM e;  3HFZ A;  5GMK m;  3A8O B;  3JCM c;  3VQY A;  1BIB A;  1Z9Z A;  2A7Y A;  1ZUK A;  4RTT A;  2Y4Y A;  2DL7 A;  1RAC B;  3HRK A;  2YUP A;  3LLR A;  4H2V A;  3LW5 E;  5IXF A;  3O8V A;  3JCM X;  4XTW A;  3UGQ A;  2L8D A;  1X55 A;  1SES A;  1C6V X;  3G71 A;  2HZY A;  1KC8 C;  4EIK A;  2EIF A;  1M3A A;  1XNI A;  2I0N A;  3J81 E;  3EAE A;  5GMK e;  1N9R A;  2Y90 A;  2E1H A;  2KYB A;  1K8A R;  4JLI A;  4M7A G;  4RCB A;  3UF4 A;  5GMK j;  3P8T A;  2RI2 A;  1W6X A;  4F04 B;  1KHC A;  4OLF A;  3CD6 A;  4GY5 A;  3X20 B;  2E5A A;  3OYN A;  2YSQ A;  2YT6 A;  2MYS A;  1G3W A;  2QHS A;  3JCM P;  1UFF A;  2L3Q A;  1VQM T;  3OSS C;  4E2F B;  2X4X A;  2JNG A;  3VU3 C;  2EAY A;  2NYS A;  3A8G B;  2O9V A;  1I81 A;  1X6G A;  1T0H A;  3CXC S;  2KI7 A;  3UA7 A;  1G3Y A;  1VA7 A;  5HK0 A;  2QEX T;  2DK3 A;  1MMG A;  1VQL A;  1OPK A;  4A53 A;  1CSK A;  3CCR T;  3RMQ A;  2PMF A;  2EGE A;  3QPH A;  1ZHI A;  4EMG A;  1QVG S;  1C0A A;  2HMA A;  5KYU A;  3G4S T;  3I7F A;  2KRO A;  2DRM A;  2V1Q A;  5CKF A;  4ELZ C;  1D3B A;  1K9A A;  2OTL A;  2CJB A;  2EJG A;  3L1A A;  1YWO A;  1EX4 A;  2IVW A;  2RJC A;  5LJ3 e;  3CC7 T;  5J3B A;  4M77 D;  5KYU B;  3CCM T;  2AMC B;  2XDD A;  2ZIM A;  4AT1 B;  4M7A D;  3V8J A;  3OYG A;  2FVU A;  1U5S A;  1BBW A;  3FIF A;  2R58 A;  3M4Y A;  2RHI A;  3URG A;  4C92 F;  4PG3 A;  3QO7 A;  1JXO A;  1BBU A;  8ATC B;  4O6J A;  3R6O A;  4ME7 A;  2NS6 A;  3C0C A;  1NYQ A;  4BUG A;  4M75 G;  4DPG A;  1QP2 A;  1UHF A;  4M7A A;  3VYG A;  2CSQ A;  4HKE A;  2G4C A;  2DO3 A;  3IKL A;  2COY A;  2KGT A;  4BE0 A;  2OTL T;  2JOY A;  1VQO Q;  2DA9 A;  2K5F A;  2M02 A;  4Z8A A;  3ZEH A;  1VQL Q;  1ASY A;  5CIU A;  4IUU A;  4CS3 A;  3JCM V;  2K5L A;  1WIE A;  2ZT8 A;  2RD1 A;  1YFT A;  2DIL A;  2EWN A;  4QVZ A;  4IKF A;  2LX7 A;  1H3Z A;  2L3S A;  3A8H B;  1ZSZ A;  4B9X A;  1MNE A;  3I56 A;  1LYL A;  4KH1 B;  2ALY B;  2DL8 A;  1KMM A;  4TVY A;  1M90 C;  1WFW A;  4PJJ A;  1GFD A;  4H02 A;  2ED0 A;  1UGR B;  2HQX A;  2B86 A;  5KYW A;  2XID A;  1IO6 A;  4E7L A;  3G4S Q;  1MMD A;  3JV3 A;  2H3E B;  2VYT A;  4H2W A;  2F5K A;  4ZGE B;  3WQZ A;  2GQI A;  3M4G A;  2YWW A;  1IHW A;  3LGL A;  3M58 A;  1VQ7 A;  4J9B A;  2QTX A;  1K76 A;  4M78 G;  1C0M A;  1E1T A;  1KC8 U;  4J9D A;  4YRF A;  4Q5W A;  1SHG A;  3SD4 A;  1N6A A;  4FW2 A;  1VQ5 A;  3LSS A;  2MCN A;  3J7A F;  1XOV A;  1OPL A;  4CC4 B;  3JCM b;  4JJC A;  3S3N A;  4EMH A;  2CUD A;  5GAO l;  4JJD A;  2DBK A;  2JJ9 A;  2OX7 A;  4FSS A;  2JTF A;  3CCV T;  3OW2 A;  3OW2 S;  2QA4 T;  2MOX A;  1V1C A;  2ZPE B;  1PCX A;  4QT7 A;  1FMW A;  2CIM A;  2HSE B;  2I2L A;  2RH2 A;  5EG2 A;  1QKW A;  2LZ6 B;  1TOV A;  4N4H A;  3VS0 A;  1BIA A;  1USY C;  1D0X A;  3PIO A;  1NJI R;  5KE2 A;  3I9Q A;  1H8K A;  3OSV A;  1WI7 A;  1UHC A;  3C4S A;  3HTZ A;  4CS2 A;  2AHJ B;  5GAN 3;  3OYY A;  1HJD A;  1M27 C;  2XKO C;  1QLY A;  3UWN A;  2E3C A;  3CMA Q;  2RHZ A;  3FJ5 A;  3ZFJ A;  4NL3 A;  1VQ5 T;  5KE3 A;  2MWO A;  4TTV A;  2A37 A;  1E6H A;  2WSC E;  2FPE A;  2YRV A;  3BFM A;  3X26 B;  4UPA A;  3CD6 T;  3CCJ T;  1VQP A;  5LJ3 f;  1ZSZ C;  3PCO A;  3W3S A;  5I22 A;  4FL6 A;  1T0J A;  1QMC A;  1UUE A;  5IN1 A;  4J83 A;  1VIE A;  2D8H A;  2OI3 A;  3CD6 Q;  4ZIB A;  2O88 A;  2HCK A;  3SB2 A;  1VQK A;  4DBQ A;  5GAN 8;  4M77 B;  2QDL A;  2RHQ B;  1ZUY A;  1LPL A;  2JVV A;  5J39 A;  3CC4 A;  3HRI A;  1I1J A;  3RIR A;  4KUI A;  3HRS A;  2H3J A;  1W4S A;  5GAM d;  2CZ1 B;  2DIQ A;  3NHN A;  3CME Q;  1BB9 A;  2DJZ A;  4E7Z A;  1LJO A;  3M0U A;  2CT4 A;  3HXW A;  3TSZ A;  2KE9 A;  4C92 G;  2DBM A;  2RI3 A;  3VRY A;  4C8Q B;  1WHJ A;  1YN8 A;  3OY9 A;  2EKH A;  4FU6 A;  2JM9 A;  3MEA A;  4YRR A;  3L4G B;  2YLB A;  2P5I A;  3E2U A;  2QHT A;  3JB9 I;  3VS4 A;  1UTI A;  5GAO n;  1SSF A;  5KCO A;  4K88 A;  3F70 A;  1M1K U;  1YJW Q;  3QZ9 B;  2MMP A;  4PJO G;  4CC3 A;  3QYH B;  5GAO r;  4EO4 A;  4TVW A;  2QXF A;  4Q15 A;  2QHV A;  5C53 B;  1X69 A;  1KQS S;  5GMK h;  1VIF A;  4FYW B;  1IRE B;  3BE3 A;  5HY6 A;  3L2R A;  2DE0 X;  3PE0 A;  1H3H A;  3GP8 A;  2F1L A;  5FU7 B;  5GAN 6;  2ROT A;  2RQW A;  2CP0 A;  3IAL A;  2XD0 A;  3IKM B;  4YRE A;  4D6W A;  2MAM A;  1RL2 A;  2GFA A;  5HGQ A;  4JZ3 A;  2H8H A;  4L6V 5;  4LDY A;  3X24 B;  5KYY B;  1L0W A;  1ZX6 A;  2RK1 A;  5FRN A;  4AFS C;  3RR6 A;  2HD0 A;  3G6E T;  4EX5 A;  2DFU A;  2NUT A;  3CCL Q;  2C7I A;  3P8H A;  2LCS A;  2K4Y A;  4D8D A;  2EPD A;  5FW9 A;  1NEB A;  2DJQ A;  2GQV A;  5KYX B;  1WHM A;  1YJN Q;  2ALY A;  1M2O A;  4F14 A;  4YRC A;  1S72 Q;  4J7F A;  1G5I A;  1ZSZ B;  1N9W A;  3PGG A;  3A8M B;  3I5S A;  3CMA A;  1VQK Q;  1OEB A;  1QKX A;  4V2S A;  5K1X A;  3M0S A;  1KSW A;  4M77 F;  2RHQ A;  1OQK A;  4JDS A;  4F7U E;  4LVI A;  3CXC P;  3CPW A;  3RDV A;  3J80 E;  1M1F A;  2FL7 A;  2OTL Q;  3LSQ A;  5GAM f;  1X2K A;  2DLP A;  4OB1 B;  2PVD B;  4C8Q F;  4YYE A;  3HTR A;  3VS3 A;  3CC2 T;  3LX7 A;  1VQ7 T;  3AHU A;  3M56 A;  1YJW A;  1XTD A;  2EGA A;  1X43 A;  1KMN A;  3ASK A;  3ME9 A;  2GBQ A;  2J7I A;  2XMF A;  3EG9 A;  5KYN A;  2K79 A;  2V8I A;  4P72 A;  1YJN A;  2EYZ A;  3VQX A;  1VQN T;  3TEH B;  1VQ5 Q;  3PMI A;  4BE2 A;  1Q82 C;  4II1 A;  4QQD A;  3GBQ A;  4CC7 A;  2PVO B;  2YUO A;  1WXT A;  3A98 A;  4WI1 A;  2JXB A;  3CCV Q;  1WJS A;  4RQF A;  3VS1 A;  1M2V B;  2MPX C;  4QVD A;  2BZX A;  4M7A E;  1YIT T;  1MV3 A;  4TQD A;  4NOY A;  4FT2 A;  2ENM A;  4ORZ A;  1VQM Q;  4CC2 A;  2P84 A;  5I11 A;  3CPW S;  3OYL A;  4ZNX A;  3UFG A;  5CK9 A;  1WHL A;  2AKL A;  1PYS B;  3QDR B;  1M8M A;  2JTM A;  1MMN A;  5KH6 A;  1VQZ A;  1K8A U;  2HL3 A;  5LJ5 d;  1JO8 A;  3ICA A;  2LX9 A;  3HXU A;  2CYZ B;  3SHW A;  3QII A;  3NMZ C;  1KD1 C;  4N4G A;  4YRM A;  1H4Q A;  3EFO A;  3OS5 A;  4YRT A;  3FDR A;  3REX A;  1YI2 Q;  3HFV A;  2JM8 A;  2C0O A;  2YUQ A;  1NJI U;  5GAM j;  4FSX A;  1GBQ A;  5A0D A;  2IG0 A;  2QAS A;  3A5Y A;  3THK A;  2ODR C;  3VS5 A;  4H2X A;  1NJ2 A;  4M75 B;  4C5I A;  2SEM A;  3R07 A;  3CC7 A;  2FEI A;  2RQR A;  3REB B;  4YDQ A;  4P5N A;  4C8Q E;  3HFZ B;  4M7D D;  4CH6 A;  4LD6 A;  5IT9 E;  4PJO D;  1ADJ A;  2ZZF A;  2P4R A;  1BI2 A;  1YI2 T;  1K1Z A;  3BW1 A;  3NEL A;  3CME A;  3R6N A;  4ZN1 A;  3OYA A;  1NJ5 A;  2VC8 A;  2XU8 A;  2DEU A;  1YIJ Q;  3EHQ A;  1NLO C;  2O2O A;  3A32 A;  5HKC A;  1BKB A;  2YXY A;  1OX8 A;  2EYQ A;  5L23 A;  2DYB A;  1K9M C;  2JS2 A;  2M51 A;  2DX1 A;  4XTV A;  1G3T A;  1K9M R;  4XU0 A;  3JB9 F;  4KGX B;  3PT9 A;  4HVV A;  1O75 A;  2X51 A;  4DOV A;  2XDB A;  1Q7Y R;  3JCM d;  1O9S A;  2J6O A;  3A7R A;  4P74 C;  2A3L A;  1GCP A;  2QEX A;  2QI2 A;  4M77 A;  3OA6 A;  1WZO A;  3UGT A;  2RQV A;  2PNI A;  4WF2 A;  2KBT A;  2G3R A;  4C5H A;  4NCX A;  4YPF A;  4BWA A;  1M4Z A;  2ZZE A;  4OMQ A;  4M78 B;  1C1A A;  3KUF A;  3MO8 A;  3E19 A;  5FLX E;  4P71 C;  2ZNI A;  2LTO A;  1YWP A;  2JS0 A;  3M0P A;  4K11 A;  3QO3 A;  4A63 B;  3OBW A;  3L42 A;  4K87 A;  3TSW A;  1OUL A;  2GF7 A;  3UH0 A;  4BDZ A;  1BI3 A;  3HY1 A;  3CCM A;  1G5H A;  1E22 A;  1IB8 A;  5L8R E;  2BE7 D;  1QWF A;  2DQ0 A;  2J6K A;  2CDT A;  2LT4 A;  2V8K A;  3RES A;  1NJI C;  1MND A;  5FRO A;  3UA6 A;  1RUW A;  1VQ4 A;  4OML A;  1GFC A;  2ARS A; 
#chains in the Genus database with same CATH homology
 4X9C A;  1U8R A;  2QQR A;  1EIF A;  3TUP A;  3E1S A;  1NNH A;  3LH0 A;  2IY5 A;  5C6S A;  4MDW A;  1GXI E;  4J5Y A;  2RB6 A;  4LDU A;  4BI4 A;  5GAN 7;  5CQY A;  4C8Q D;  4F7U G;  1X2G A;  4CI0 C;  4BW9 A;  2L89 A;  1VQ9 A;  4PJO A;  1NJ1 A;  1AHJ B;  5LJ5 g;  3M55 A;  1QVP A;  3V7C A;  5KNN A;  4HCB A;  2CS7 A;  2BIV A;  4C8Q A;  1B8A A;  2D0Q B;  4M78 D;  1YHQ T;  2KDS A;  4HWR A;  1W2B S;  4WJ3 M;  1YIJ T;  1Q7Y C;  4MZT A;  3HPW A;  4QQG A;  4P75 C;  2RM4 A;  4ZTU B;  3VUZ A;  3QG1 A;  1Q86 U;  5GAM e;  2M16 A;  1PSF A;  1PSE A;  1X2H A;  2VUB A;  12AS A;  2D9T A;  3LC0 A;  4JRP A;  4M78 A;  2RO0 A;  4FM4 B;  4C92 D;  3NTI A;  3QJ6 A;  3E9G A;  1NZ9 A;  4H2Y A;  4CH3 A;  4KUL A;  3JB9 D;  4J7I A;  2RA2 A;  2NLU A;  3I55 A;  2KQW A;  4P72 C;  4M7A C;  3M57 A;  4Z02 A;  3M4P A;  4ELY C;  4TVA A;  4YRJ A;  4J8O A;  4H2T A;  3M54 A;  1IL2 A;  1B70 B;  4QQ6 A;  5CAI A;  1Y7X A;  5LL6 S;  2DPP B;  1Q81 U;  2L5Q A;  2XHC A;  4C5G A;  2DD4 A;  4A4E A;  4BB7 A;  4M75 A;  3L2W A;  4RMO A;  3OYB A;  1W2B A;  4FIB A;  4BY6 C;  4EMK B;  1H4S A;  3QBY A;  1VUB A;  1I4K 1;  1GGM A;  3C12 A;  1K73 C;  1HTT A;  4OVA A;  5GAN e;  4KQE A;  2X4Y A;  2AKW B;  2DTO A;  5CKB A;  3QO8 A;  1HC7 A;  5CQX A;  3JCM Q;  2RJE A;  1RI0 A;  2Y4X A;  1OZ3 A;  3VUB A;  5A0L A;  3QUI A;  1M90 U;  2DKG A;  2DZC A;  3G1Z A;  3MET A;  4LNS A;  4RQE A;  4LVK A;  4YRP A;  3BJU A;  3HY0 A;  1B70 A;  1YIJ A;  4CH5 A;  4PL6 A;  3M5A A;  4YRL A;  1FX7 A;  1H4V B;  4Q6G A;  1V29 B;  1NE8 A;  3DLM A;  4E7J A;  2QA4 A;  2ZCE A;  5LJ5 f;  4C0G A;  3M53 A;  1KD1 U;  4M78 C;  2J3M A;  4YRO A;  4PJO C;  5GAN d;  1B7Y A;  4RKU E;  2ART A;  2LRQ A;  2K2V A;  3HSB A;  4IUQ A;  4E7H A;  4JS4 A;  3PIP A;  3HXY A;  2EQK A;  4JRI A;  2YHT A;  1YJW T;  4M7A B;  2QHU A;  1FYF A;  3C94 A;  1M9S A;  3GNF B;  1JRI A;  1VQ6 T;  4HWS A;  3G7Z A;  5LJ5 e;  1YCY A;  2DXC A;  3CCJ A;  1VQP T;  3M59 A;  4HVC A;  2DVE A;  5CVI A;  4P71 A;  1OZ2 A;  3PTA A;  1YJ9 A;  3VJP A;  3PNW C;  2F5T X;  3MF1 A;  1YGB A;  4JUV A;  1P92 A;  5A2Q E;  2K5I A;  5GAN h;  1JBM A;  4EMK A;  4C92 E;  2P0P A;  4ZGD B;  1SRY A;  4XAX B;  3RER A;  4G85 A;  5GMK l;  5K1P A;  3HHT B;  1WU7 A;  3VBB A;  4C0D B;  2FYK A;  5LJ3 j;  2DZ9 A;  1VQ6 A;  1E24 A;  1YB3 A;  4N4I A;  1ATI A;  4GLK A;  3OYH A;  3QKJ A;  3OYD A;  3SDZ A;  2DU7 A;  4MML A;  3MEV A;  4JRQ A;  4XTX A;  3NFC A;  4C0Z A;  4N0A A;  4PNO A;  2K3Y A;  2WSF E;  3SWN C;  4DOW A;  4ZTZ B;  3NTK A;  2QQ9 A;  4N0A C;  2CJA A;  4OB0 B;  2DXU A;  2RHU A;  3KBG A;  3RAC A;  3FLG A;  2J3L A;  3QSU A;  4PLI A;  5FU7 C;  4TVA B;  4IUT A;  5DLQ E;  4YCU A;  1YHQ A;  2QQA A;  3WVD B;  4TVR A;  2E10 A;  4EDU A;  4XQ3 A;  2XGT A;  2ZIO A;  1ADY A;  3VV0 A;  3HL8 A;  4CRI A;  3MF2 A;  2E70 A;  3TCJ A;  4OB2 B;  3CCS T;  4EPC A;  2ZT6 A;  4KR3 A;  1M1G A;  1FXX A;  1EOV A;  1QP3 A;  3SWN A;  3IG2 A;  2DXT A;  3H8Z A;  4BY6 B;  4EMK C;  3RKX A;  2JN0 A;  1K8A C;  3RKY A;  3OYC A;  1I8F A;  1OI1 A;  2XTI A;  1JJ2 S;  5F5W A;  1QVG A;  2LNV A;  1G5V A;  4LDW A;  3L2Z A;  2KSS A;  3QYG B;  1TH7 A;  3HXZ A;  3L4G A;  3JB9 H;  1Z7N A;  4VUB A;  3A8L B;  1BYM A;  4OF1 A;  3REU A;  5GAN 4;  4A54 A;  1VQN A;  5CO7 A;  3MEU A;  4E47 A;  3OS1 A;  4C0F A;  5CKE A;  3OMG A;  5A0G A;  3FC3 A;  2F69 A;  1UGQ B;  4A4F A;  2FHD A;  4X9D A;  1KHI A;  4M7D F;  3SWN B;  3MEW A;  1MGQ A;  2LCL A;  3GOX A;  3V7R A;  1HK9 A;  4M75 E;  2FB7 A;  4PJO F;  1VQO T;  1WYD A;  2LCC A;  4LDV A;  4OP0 A;  4DQ2 A;  2LVM A;  3A74 A;  1Y96 B;  2LQ8 A;  3M9Q A;  11AS A;  2ZPG B;  3HXV A;  4P3O A;  4NL2 A;  4ZN3 A;  4YRS A;  3CME T;  2HBP A;  4BE1 A;  3MP1 A;  2IY5 B;  1YJN T;  4M78 F;  1UEB A;  2R5A A;  3TRE A;  3OBY A;  3RKW A;  2ZNJ A;  4LD9 K;  2CZ7 B;  2RJD A;  4MDX A;  4UP8 A;  1YFR A;  4L5G A;  4ZGJ B;  3A5Z B;  4KBM B;  3PFS A;  3JCM W;  2WSE E;  5GAN j;  4Y91 A;  2EJF A;  1Q81 C;  2I4O A;  2K57 A;  2ZT7 A;  3QXE B;  4LVM A;  2HNI A;  5CR2 A;  4HCC A;  4P75 A;  3DKM A;  3GNG A;  2LQK A;  3E9H A;  3CMA T;  1QVF A;  1EQR A;  3QZ5 B;  4J6X A;  2P0Q A;  1HXD A;  2KK4 A;  3T9N A;  4LVL A;  5GAM g;  4RMF A;  3PCO B;  3FEO A;  2ZGW A;  3MP8 A;  1VQ4 T;  1LNX A;  4J6W A;  1YJ9 T;  1KQ2 A;  2VXE A;  4XTY A;  2CZ0 B;  1BI1 A;  3E9I A;  3NEM A;  3SFM A;  3CCL T;  1K9M U;  1EIY A;  3CCU T;  4A4H A;  3CBP A;  2LDM A;  5IAY A;  4P3P A;  1X56 A;  1VQO A;  3INZ A;  3CMQ A;  1VQK T;  1WJQ A;  5D6X A;  4O5V A;  1MHN A;  2K3X A;  3S3M A;  2GCX A;  2I4L A;  2QDY B;  4H2X B;  1VQ9 T;  2OAU A;  5ELO A;  4J6Y A;  2ARU A;  3S6W A;  1WQW A;  5GAM h;  3CCS A;  4B9W A;  3OYM A;  1ZBX A;  3BDU A;  3N5B B;  3JRZ A;  5GAO q;  2PUK B;  2RK2 A;  3KFU A;  2QQS A;  4CH4 A;  3UT1 A;  1QW1 A;  1S72 T;  3HXX A;  5D6Y A;  3LWI A;  3A31 A;  5C0M A;  3EFR A;  4A4G A;  3UDC A;  3I56 T;  2X35 A;  1WQ7 A;  5KCH A;  3VQW A;  4QVC A;  4YCV A;  1I5L A;  4YRG A;  5CCA A;  4C92 B;  4PJO B;  4XTU A;  4MZM A;  4C5E A;  4ZTF A;  2P4T A;  5M9O A;  1JJC B;  1Q82 U;  3GIB A;  3OB9 A;  4C92 A;  2E41 A;  3OYF A;  2MF2 A;  5DM7 R;  2RJF A;  2DIG A;  4M7A F;  3G6E A;  1W66 A;  4H2S A;  2LT1 A;  3GF5 A;  2ZT5 A;  4HT9 A;  3KXT A;  3G71 T;  1QE0 A;  2ZXF A;  1LOJ A;  1YI2 A;  2DQ3 A;  1B34 A;  3OYK A;  4HWO A;  2ZR2 A;  3GLX A;  4YTL A;  1EVK A;  1FWZ A;  3MQZ A;  4RDX A;  5LJ3 d;  2RHS A;  2L3R A;  2C8M A;  1NYR A;  1U1T A;  4XEO A;  2ZPI B;  3FJP A;  1OYX A;  5I2S A;  1M5Q 1;  3OS0 A;  1YFS A;  2B8A A;  4XK8 E;  1EFW A;  3WXM B;  3CCV A;  2E6Z A;  1WGS A;  1IZ6 A;  4F7U F;  3QHS A;  2QQB A;  1VQL T;  4C0D C;  1WPY A;  2R57 A;  3VKI A;  4M7D E;  2JZ2 A;  5LJ3 h;  2Q5I A;  3M4Q A;  4NS5 A;  4AH6 A;  1N8R C;  5J26 A;  2ZR3 A;  1JB0 E;  2ZTG A;  2DD5 A;  2CZ6 B;  4DA4 A;  1E1O A;  1X01 A;  3HP9 A;  4X34 A;  3NEN A;  4C8Q G;  5GAN f;  4PLL A;  1NJ6 A;  3QNE A;  3FRN A;  4LDX A;  4UP7 A;  4XU3 A;  2DU5 A;  2KMT A;  3JSC A;  5C51 B;  3JB9 J;  4G84 A;  4J15 A;  3MP6 A;  2EQJ A;  3HRU A;  3P8B B;  3X28 B;  2A8E A;  1NPP A;  2RI5 A;  1X54 A;  4F7U A;  3RL6 A;  1B76 A;  1Q7Y U;  3JAM E;  2RHX A;  2AKW A;  4M77 E;  3L2Q A;  5FU6 C;  4IUR A;  5GAN 5;  2M0O A;  2VV5 A;  3HFO A;  5CKH A;  3TEE A;  4L59 A;  3GPL A;  3ZBD A;  5AYF A;  4YP0 A;  1N27 A;  4BI3 A;  3WVE B;  3DB3 A;  3OYE A;  3ERR A;  2PU9 B;  3QO5 A;  3PMT A;  4UP9 A;  1XQH A;  3JB9 G;  4M75 D;  4K86 A;  4CS4 A;  2Q5H A;  3CCR A;  5LJ5 j;  2GFU A;  3P8Y A;  4IUV A;  4OMF B;  3ER0 A;  4R56 A;  2P0L A;  2DTI A;  3EFS A;  3P8D A;  5GAN g;  3V8L A;  4RCC A;  2Q7H A;  4M77 G;  3CEY A;  1QF6 A;  2XIC A;  5I21 A;  3BY7 A;  2XG8 D;  4R55 A;  3CC4 T;  3OS2 A;  5GMK i;  2DAQ A;  2D6F A;  4OGC A;  1NPR A;  3CBM A;  5D6W A;  3JCM g;  5HK3 A;  4L87 A;  3V8K A;  1WJR A;  2DTH A;  4ZTJ A;  3VQV A;  2OTJ A;  2VXF A;  3FB9 A;  3LGF A;  3CCE A;  2AMC A;  2M9U A;  5FU6 B;  1B7Y B;  4E7K A;  4KR2 A;  3L2U A;  1M1K C;  3VYH B;  5C52 B;  5CKD A;  2ZIN A;  5DLO A;  2HQE A;  3OYJ A;  4RG2 A;  1D3B B;  5GAO p;  3C95 A;  2ODR D;  4JS5 A;  2KAF A;  4KUD K;  4BDY A;  2E12 A;  4M75 C;  1ZQ1 A;  2XDP A;  3RMS A;  4E7I A;  1H4T A;  4BAC A;  1YBY A;  1NJ8 A;  2WAC A;  4YCW A;  1U1S A;  4HT8 A;  2PUO B;  1K73 U;  3HRT A;  4A4K A;  4YRK A;  1RIQ A;  2EQM A;  2RHY A;  2XI9 A;  4UC4 A;  4XEM A;  1USY A;  2ZZG A;  3DB4 A;  1Y71 A;  2VGN A;  2BKD N;  1B34 B;  4MZP A;  1JJ2 A;  2YLC A;  5DY9 A;  1Z7M A;  1Y07 A;  3CCL A;  3HFN A;  5LJ5 h;  2ZZD A;  2EKO A;  1VQ8 A;  4HWT A;  2X4J A;  1UB4 A;  4HA8 A;  3TEH A;  2PVG B;  2E65 A;  2ZCF B;  3I55 T;  4BD3 A;  4LVJ A;  4M7D C;  3NET A;  2ZPB B;  2EJ9 A;  2EFI A;  2CJ9 A;  4YRI A;  4E51 A;  2LC4 A;  3A5Z A;  1Q86 C;  1N8R U;  4PJO E;  5E3I A;  3RGL A;  3CCQ T;  5ELN A;  5FRM A;  2EL9 A;  4YRN A;  3HKS A;  4XU1 A;  1BI0 A;  3BDL A;  2RHS B;  3H6Z A;  3RUX A;  3TU4 K;  4O2D A;  4MMK A;  3CCU A;  2Q7G A;  3JCM h;  2R5M A;  1YIT A;  1Y96 A;  2O01 E;  3A7U A;  5I2M A;  2XK0 A;  1SET A;  4P3N A;  4TQF A;  4P74 A;  3PZC A;  4M7D A;  4M77 C;  4RG8 A;  2MI6 A;  4KT0 E;  2PQW A;  4PHC A;  4ATO A;  4H2U A;  2JUF A;  2M1H A;  3DLL A;  3QJY A;  4OGE A;  3CBO A;  1J5W A;  3CC2 A;  2P0K A;  4P73 A;  4JRK A;  4M78 E;  4JLG A;  1UGP B;  3E9F A;  2CKK A;  2EQU A;  4OB3 B;  3A7A A;  4C8Q C;  3P8V A;  4FT4 A;  2KVQ G;  2I4N A;  1PYS A;  4F7U B;  4YRQ A;  3G4S A;  1UGS B;  3RF1 A;  4M7D B;  2ZPF B;  1N9S A;  4C92 C;  2O4X B;  4BI8 B;  1M8V A;  3OYI A;  1SER A;  2E6N A;  4IUP A;  4PKC C;  1G51 A;  4HT4 A;  2OTJ T;  4P73 C;  3QTC A;  2HAX A;  3CPF A;  3TEG A;  5LJ3 g;  2V8J A;  2O4X A;  3MEY A;  2PME A;  2E64 A;  4JJN K;  3CCQ A;  3OQ5 A;  4QW2 A;  2X4W A;  2Q7E A;  3S3O A;  3L2V A;  2MWP A;  4WJ4 A;  3X25 B;  4HCZ A;  1ASZ A;  4M7D G;  1KG1 A;  2CGH A;  3OMC A;  1X6O A;  1KOG A;  1KQS A;  4XTZ A;  2E5Q A;  1VQM A;  1S72 A;  3MCA B;  1KQ1 A;  1JJC A;  1EIY B;  4HWP A;  2DEQ A;  2VGM A;  3NTH A;  2C06 A;  4M75 F;  2BUD A;  3DSQ A;  3LYI A;  3JCM J;  3UPU A;  3JCM f;  4TWA A;  2DXB A;  2ZPH B;  4Y28 E;  1DJ7 B;  5GAO m;  1R8O B;  1VQ8 T;  2I4M A;  1H64 1;  3Q1J A;  3CCE T;  3OD1 A;  3MHX A;  2KY9 A;  4X5O A;  3V7S A;  1G3S A;  1QVF S;  3LWH A;  4XU2 A;  5GAN 2;  1X75 C;  2DDZ A;  1WLE A;  1WNL A;  1EVL A;  3CXC A;  3JCM e;  3HFZ A;  5GMK m;  3A8O B;  3JCM c;  3VQY A;  1BIB A;  2A7Y A;  2Y4Y A;  3HRK A;  3LLR A;  4H2V A;  3LW5 E;  3O8V A;  3JCM X;  4XTW A;  3UGQ A;  2L8D A;  1X55 A;  1SES A;  3G71 A;  1KC8 C;  2EIF A;  1XNI A;  3J81 E;  3EAE A;  5GMK e;  1N9R A;  2Y90 A;  2E1H A;  4JLI A;  4M7A G;  4RCB A;  3P8T A;  5GMK j;  2RI2 A;  1KHC A;  4OLF A;  3CD6 A;  4GY5 A;  3X20 B;  2E5A A;  3OYN A;  1G3W A;  2QHS A;  3JCM P;  1VQM T;  3OSS C;  2X4X A;  2JNG A;  3VU3 C;  2EAY A;  3A8G B;  1I81 A;  3CXC S;  1G3Y A;  5HK0 A;  2QEX T;  2DK3 A;  1VQL A;  4A53 A;  3CCR T;  3RMQ A;  2PMF A;  3QPH A;  1ZHI A;  4EMG A;  1QVG S;  1C0A A;  3I7F A;  3G4S T;  5CKF A;  4ELZ C;  1D3B A;  2OTL A;  2CJB A;  2EJG A;  3L1A A;  2IVW A;  2RJC A;  5LJ3 e;  3CC7 T;  5J3B A;  4M77 D;  2AMC B;  3CCM T;  2ZIM A;  2XDD A;  4M7A D;  3V8J A;  3OYG A;  2FVU A;  1BBW A;  3FIF A;  2R58 A;  3M4Y A;  2RHI A;  3URG A;  4C92 F;  4PG3 A;  3QO7 A;  1BBU A;  4O6J A;  3R6O A;  4ME7 A;  2NS6 A;  1NYQ A;  4BUG A;  4M75 G;  4DPG A;  1QP2 A;  4M7A A;  3VYG A;  4HKE A;  2G4C A;  2DO3 A;  3IKL A;  4BE0 A;  2OTL T;  2JOY A;  2K5F A;  1ASY A;  3ZEH A;  5CIU A;  4IUU A;  4CS3 A;  3JCM V;  2K5L A;  2ZT8 A;  2RD1 A;  1YFT A;  2EWN A;  4QVZ A;  4IKF A;  1H3Z A;  3A8H B;  4B9X A;  3I56 A;  1LYL A;  2ALY B;  1KMM A;  4TVY A;  1M90 C;  4H02 A;  1UGR B;  2HQX A;  2XID A;  4E7L A;  4H2W A;  2VYT A;  2F5K A;  4ZGE B;  3WQZ A;  3M4G A;  3LGL A;  3M58 A;  1VQ7 A;  2QTX A;  4M78 G;  1E1T A;  1KC8 U;  4YRF A;  4Q5W A;  3SD4 A;  1N6A A;  1VQ5 A;  3LSS A;  3J7A F;  1XOV A;  3JCM b;  3S3N A;  4EMH A;  5GAO l;  3CCV T;  2JTF A;  3OW2 A;  3OW2 S;  2QA4 T;  2ZPE B;  2CIM A;  2I2L A;  2RH2 A;  5EG2 A;  4N4H A;  1BIA A;  1USY C;  3PIO A;  5KE2 A;  3OSV A;  3C4S A;  3HTZ A;  4CS2 A;  2AHJ B;  5GAN 3;  3OYY A;  2XKO C;  3UWN A;  2E3C A;  2RHZ A;  3ZFJ A;  4NL3 A;  1VQ5 T;  5KE3 A;  2MWO A;  4TTV A;  2WSC E;  2YRV A;  4UPA A;  3BFM A;  3X26 B;  3CD6 T;  3CCJ T;  1VQP A;  5LJ3 f;  3PCO A;  3W3S A;  4FL6 A;  5IN1 A;  4J83 A;  1VIE A;  4ZIB A;  3SB2 A;  1VQK A;  5GAN 8;  4M77 B;  2RHQ B;  2JVV A;  5J39 A;  3CC4 A;  3HRI A;  3RIR A;  4KUI A;  3HRS A;  2H3J A;  1W4S A;  5GAM d;  2CZ1 B;  2DIQ A;  2DJZ A;  1LJO A;  3HXW A;  4C92 G;  2RI3 A;  4C8Q B;  3OY9 A;  4FU6 A;  3MEA A;  4YRR A;  3L4G B;  2YLB A;  2P5I A;  2QHT A;  3JB9 I;  5GAO n;  1SSF A;  5KCO A;  4K88 A;  3F70 A;  1M1K U;  3QZ9 B;  2MMP A;  4PJO G;  3QYH B;  5GAO r;  4EO4 A;  4TVW A;  2QXF A;  4Q15 A;  2QHV A;  5C53 B;  1KQS S;  5GMK h;  1VIF A;  1IRE B;  5HY6 A;  3L2R A;  3GP8 A;  5FU7 B;  5GAN 6;  3IAL A;  2XD0 A;  3IKM B;  4YRE A;  4D6W A;  2MAM A;  1RL2 A;  2GFA A;  5HGQ A;  4LDY A;  4L6V 5;  3X24 B;  1L0W A;  2RK1 A;  5FRN A;  2HD0 A;  3G6E T;  4EX5 A;  2C7I A;  3P8H A;  2K4Y A;  2GQV A;  2ALY A;  4YRC A;  4J7F A;  1G5I A;  1N9W A;  3PGG A;  3A8M B;  3CMA A;  4V2S A;  5K1X A;  4M77 F;  2RHQ A;  4JDS A;  4F7U E;  4LVI A;  3CPW A;  3J80 E;  1M1F A;  2FL7 A;  3LSQ A;  5GAM f;  4OB1 B;  2PVD B;  4C8Q F;  4YYE A;  3CC2 T;  3LX7 A;  1VQ7 T;  3AHU A;  3M56 A;  1YJW A;  1XTD A;  1KMN A;  3ASK A;  3ME9 A;  2V8I A;  4P72 A;  1YJN A;  3VQX A;  1VQN T;  3TEH B;  3PMI A;  4BE2 A;  1Q82 C;  4II1 A;  4QQD A;  2PVO B;  4WI1 A;  1WJS A;  4RQF A;  4QVD A;  4M7A E;  1YIT T;  4TQD A;  4NOY A;  4FT2 A;  3CPW S;  3OYL A;  3UFG A;  5CK9 A;  1PYS B;  3QDR B;  2JTM A;  1VQZ A;  5KH6 A;  1K8A U;  5LJ5 d;  3ICA A;  2LX9 A;  3HXU A;  2CYZ B;  3QII A;  1KD1 C;  4N4G A;  4YRM A;  1H4Q A;  3OS5 A;  4YRT A;  3FDR A;  3REX A;  3HFV A;  1NJI U;  5GAM j;  4FSX A;  5A0D A;  2IG0 A;  3A5Y A;  2ODR C;  4H2X A;  1NJ2 A;  4M75 B;  4C5I A;  3R07 A;  3CC7 A;  4YDQ A;  4P5N A;  4C8Q E;  3HFZ B;  4M7D D;  4CH6 A;  4LD6 A;  5IT9 E;  4PJO D;  1ADJ A;  2ZZF A;  1BI2 A;  1YI2 T;  3BW1 A;  3NEL A;  3CME A;  4ZN1 A;  3OYA A;  1NJ5 A;  2VC8 A;  2XU8 A;  3A32 A;  5HKC A;  1BKB A;  1K9M C;  2EYQ A;  4XTV A;  1G3T A;  4XU0 A;  3JB9 F;  3PT9 A;  1O75 A;  4DOV A;  2XDB A;  3JCM d;  1O9S A;  3A7R A;  4P74 C;  2A3L A;  2QEX A;  2QI2 A;  4M77 A;  3OA6 A;  3UGT A;  4WF2 A;  4C5H A;  2G3R A;  4NCX A;  4YPF A;  4BWA A;  1M4Z A;  2ZZE A;  4M78 B;  3KUF A;  3MO8 A;  3E19 A;  5FLX E;  4P71 C;  2ZNI A;  2LTO A;  3QO3 A;  3OBW A;  3L42 A;  4K87 A;  2GF7 A;  3UH0 A;  4BDZ A;  3HY1 A;  1BI3 A;  1G5H A;  3CCM A;  1E22 A;  5L8R E;  2DQ0 A;  2LT4 A;  2V8K A;  1NJI C;  3RES A;  5FRO A;  1VQ4 A;  2ARS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...