4OP0A

Crystal structure of biotin protein ligase (rv3279c) of mycobacterium tuberculosis, complexed with biotinyl-5'-amp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
265
structure length
259
Chain Sequence
MADRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLITGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords BirA bifunctional protein
publication title Active site conformational changes upon reaction intermediate biotinyl-5'-AMP binding in biotin protein ligase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 89
structure length 259
sequence length 265
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4op0A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4op0A01
2EAYA 1YGBA 3RKXA 5GAOl 3IKMB 5LJ3h 5LJ5h 1Y96B 3A7UA 4XU3A 2DXTA 4X9CA 4Y91A 2CGHA 3R07A 3G1ZA 4F7UE 5C52B 2PMFA 3JCMb 5GAMh 1JJCA 1NYRA 4MMLA 1YB3A 4M7DA 4YRKA 3HXXA 4M7DC 1WPYA 2RB6A 2EL9A 2DDZA 4WJ4A 2C7IA 3QO5A 2DZ9A 4TVWA 4YRSA 4M75G 1N9RA 1GGMA 3CMQA 4YCVA 1ATIA 1JJCB 3VQXA 5GANf 4M7DB 1B8AA 2DU5A 4P3OA 1E22A 2ALYA 4RDXA 5GAN5 1E1TA 4BWAA 3BDUA 4LNSA 2EJFA 5F5WA 4H2XA 5GANj 2ZT7A 1B7YA 3JCMf 4HT9A 1BBUA 4PJOE 2DZCA 4YROA 4M78E 2ALYB 3VU3C 1QF6A 5GAN8 4F7UF 1N9SA 4HWOA 4DQ2A 4H2XB 4WI1A 1B7YB 2ZT6A 4YRFA 4L87A 4YPFA 2I4NA 4KQEA 3RL6A 2AKWA 2EJ9A 4TTVA 2E65A 2ZIMA 1C0AA 5GAOr 3PGGA 2E3CA 2ZZGA 4JLIA 4YCUA 1ADYA 4H2VA 2IY5A 4P3PA 2ZTGA 2AKWB 4EX5A 4K88A 4CS2A 3JB9H 1EVKA 5LJ3d 5LJ5d 1B70A 4CH6A 3V8JA 1KQ1A 4EMKA 2Q7HA 1KOGA 1YFRA 4RQFA 4EMKC 2QHUA 3RIRA 3JCMX 2IY5B 3HFZA 5GAMd 3JCMe 2P5IA 4C8QA 4G84A 2QHVA 4XTUA 4M78F 4M7DG 3RESA 4C8QC 4ZIBA 3JCMV 1B70B 2DTOA 4EMKB 3UH0A 3V7CA 3A5YA 4J15A 1D3BA 4Q6GA 5I21A 3HFZB 5GMKe 4C8QB 2ZCEA 4ZTUB 5LJ3e 5LJ5e 4NL2A 3P8VA 4YRRA 4UP8A 5GAOp 4HA8A 5GAN7 4P71A 4XTZA 3JCMQ 3QO8A 1D3BB 1NYQA 1B34A 2EJGA 4P71C 4PG3A 2RD1A 4PNOA 2DQ0A 2ZGWA 1SRYA 1KMMA 3MF1A 1X2HA 4M7AA 3JCMh 3JB9F 3JB9I 3VQWA 3M4GA 4M7AC 3JB9D 3NEMA 1G51A 3VBBA 4WF2A 1B34B 1FYFA 1WYDA 1NJ8A 1X55A 4ZTZB 4M7AB 5GMKh 4Q15A 3A31A 3A7AA 2PMEA 3JCMJ 4M77E 3HXUA 1LNXA 2YHTA 5GAOq 1NJ1A 1G5IA 4F7UA 2JN0A 2FB7A 5LJ5g 1BIAA 4JUVA 4HT8A 2I4LA 2J3LA 4TVYA 4OP0A 3HXWA 1EQRA 5GAMg 4YRPA 1BIBA 4M7AF 1H4VB 3TEHA 2ZZFA 3DSQA 1E24A 4NL3A 1EFWA 4F7UB 3REUA 3RF1A 4XEOA 4M7AD 2E1HA 5GMKl 2DTIA 2Q5IA 4XU0A 4C8QG 4X9DA 4TVAA 5C53B 4YREA 2QHSA 2RM4A 3OD1A 3TEHB 3QO3A 3VQYA 4C92E 4YCWA 4J6WA 1ADJA 2ZT8A 3HRKA 1WU7A 4TVAB 1WNLA 4N0AA 4PJOA 2RHSA 4AH6A 3HY0A 4XU2A 1HC7A 4N0AC 4PJOC 3GIBA 4M78A 3IALA 4H2WA 3P8TA 4M78C 5GMKi 3RACA 3BFMA 4TQDA 1SESA 3EFRA 1LJOA 1QE0A 5K1XA 4RQEA 4JRKA 3HY1A 3JCMd 1EIYA 4PJOB 1WQWA 4M7AG 2RHSB 5GAN6 2DU7A 1EVLA 4M78B 2DQ3A 3A74A 2AMCA 3MEYA 2I4OA 3SB2A 3RKYA 3W3SA 4P73A 3UGTA 4RCCA 2E10A 3SWNA 5GANe 2ZT5A 1J5WA 2E41A 4P73C 1EIYB 3SWNC 4XU1A 4EMHA 1H641 4JRIA 2CIMA 2AMCB 1IL2A 1U1SA 2ODRC 2C8MA 1H4QA 4PJOF 3LC0A 3SWNB 4YRJA 4K86A 4F7UG 2Q7GA 4PJOD 3HRIA 5GMKj 1HK9A 5GAMf 3ICAA 4M78D 5LJ3j 5LJ5j 1WQ7A 1NJ2A 2Q5HA 3VQVA 1JRIA 2DTHA 4M75E 1LYLA 5GAMj 3BW1A 2ZNIA 4A53A 5GANh 4CS4A 4H2SA 4C8QE 2VXEA 4UPAA 3V7SA 2XTIA 4YDQA 1PYSA 4UP9A 3RERA 5DY9A 3REXA 3RUXA 4XTWA 4MMKA 2ZIOA 3LSSA 4UP7A 3JCMP 4RMFA 4PJOG 2ZR3A 2ODRD 2E5AA 1M8VA 4M78G 4YYEA 1PYSB 3JCMg 1HXDA 4NCXA 4YRNA 3PZCA 2FYKA 4J6XA 3JCMW 2I4MA 3HXVA 1I4K1 2VXFA 2XGTA 4YRLA 4M77A 1W66A 3EFSA 4M75F 4M77C 5LJ3g 2QHTA 3HXYA 2I2LA 1EOVA 4H2TA 1SETA 3BJUA 2DJZA 4QVDA 2CJAA 4HVCA 4KR3A 3KFUA 1YCYA 4M77B 4V2SA 4XTVA 3QNEA 3JB9G 1VQZA 4P74A 1JBMA 4E51A 4EO4A 4P74C 2ZNJA 1BBWA 1ASZA 3M4QA 3P8YA 4CH3A 2ARSA 4M7DE 1X54A 3INZA 4TWAA 4YRMA 3E9HA 3BY7A 3L4GA 2E64A 3HTZA 4H2UA 5GAN4 3HFNA 4C92A 2RA2A 3MF2A 1RIQA 4XEMA 4C92C 12ASA 5GANd 4M77F 5ELOA 3A5ZA 2EWNA 3HFOA 1Z7MA 2J3MA 4NOYA 5CAIA 2VC8A 4M77D 1E1OA 4CH5A 3L4GB 3E9IA 4EMGA 4XTXA 1I8FA 4J5YA 3WQZA 3RGLA 4C92B 1WLEA 4CS3A 4DPGA 1I5LA 3V8KA 1YFTA 1SERA 2DEQA 3HFVA 4P72A 4YRGA 1MGQA 1NNHA 4P72C 4O2DA 4OLFA 3QSUA 3JCMc 2P0LA 2ARTA 2K57A 1KQ2A 4M7DF 1Z7NA 4X5OA 1H4TA 4J6YA 1USYA 3QUIA 4M7DD 3I7FA 3V8LA 1USYC 1G5HA 1X2GA 3IG2A 5LJ3f 4C92F 5LJ5f 2ZR2A 4M77G 3RKWA 1L0WA 4C92D 1NJ6A 5HGQA 3TEGA 4HWPA 2Y90A 3UFGA 2QTXA 1M5Q1 1ASYA 4CH4A 1NJ5A 4HWTA 2YLBA 4KR2A 3HXZA 4TQFA 5GAOn 2G4CA 5KNNA 3JB9J 4M75A 2RHQA 4A54A 1LOJA 1N9WA 4M75C 5GAOm 5GAN2 3QO7A 5GAN3 4PHCA 4K87A 3TUPA 2DKGA 4YRCA 4HWRA 4HWSA 3IKLA 4XQ3A 5GANg 3AHUA 4YRIA 4RCBA 4M75B 3L1AA 2RHQB 4P3NA 2ZZEA 4P75A 3FIFA 4C92G 4WJ3M 3A7RA 3L2ZA 3NELA 3NETA 4P75C 3PCOA 1YFSA 2ZXFA 4YP0A 4G85A 3FJPA 5K1PA 2YLCA 3NENA 3QHSA 2CJ9A 2ZINA 5E3IA 4XTYA 11ASA 4H02A 2ARUA 1TH7A 4H2YA 3HSBA 5GMKm 1HTTA 2HNIA 5GAMe 3ERRA 3LSQA 5ELNA 1H4SA 3PCOB 4M7AE 4BW9A 2DXUA 2DVEA 3A32A 4QVCA 5C51B 3QTCA 1Y96A 1KMNA 4M75D 3M4PA 2Q7EA 1X56A 4YRQA 4C8QF 3FB9A 1U1TA 2CJBA 3UGQA 3V7RA 1I81A 1B76A 4YRTA 4C8QD 1X01A
chains in the Genus database with same CATH superfamily
5GJWB 3TREA 2NUPA 3RKXA 5GAOl 2EQUA 3IKMB 3C0CA 4DOWA 4LNPA 2IG0A 3EG1A 3EG3A 1RAFB 2CGHA 2KK4A 1OX8A 4MMLA 2OTLA 1JJCA 3VS0A 2EGEA 4E7IA 3HXXA 2O4XA 4MDWA 5C6SA 2CP6A 4IUPA 4M7DC 2RB6A 2EL9A 5FU7C 1NE8A 1N8RU 4RUGA 4TVWA 2DETA 4DA4A 1N9RA 1M1GA 3EAEA 4YCVA 3VQXA 1X2KA 2IVWA 2CP0A 2QQAA 1MUZA 3MO8A 1UUEA 2DU5A 3QJYA 1NPRA 3NPFA 2L3PA 3M5AA 2ALYA 3OYBA 1YJ9Q 3M0QA 3CCSA 4RDXA 5GAN5 1E1TA 3MP1A 4LNSA 2EJFA 1KQSS 1QCOA 3EFOB 3S6WA 1TTHB 3L2QA 1VQ5T 2LCSA 4HT9A 1B7YA 4PJOE 1Q82R 2DJQA 4A4HA 2M0OA 2A3LA 1YJWT 2QA4T 4BDZA 2FG0A 4HWOA 1RAEB 4OMOA 1M2OA 4IIOA 2QG9B 2MPXC 1VQ4A 1VQ7Q 2E65A 4IUVA 1C0AA 1WHJA 2VASA 1MNDA 4FT4A 3PGGA 1KD1C 1N6AA 2KR3A 1VQ8T 2XG8D 2IY5A 2ZTGA 2P0KA 2RHUA 3JB9H 1EVKA 1N8RR 5LJ5d 4CH6A 1N27A 5CQXA 4EMKC 4D6WA 3RIRA 2Y4XA 4DEYA 5GAMd 1AZGB 1VQ5Q 1NM7A 4PJLA 5J3BA 2DYIA 2QHVA 2K2VA 1QVPA 4OMNA 3RESA 4C8QC 4ZIBA 1NYFA 2DXCA 3JCMV 1OOTA 4PJMA 1KG1A 4LXCA 2DBMA 2CP7A 4ZNXA 1JO8A 3CCRQ 1OZ2A 2V26A 5GMKe 3JSCA 3OYAA 2ZCEA 1WJQA 5LJ5e 1Y71A 2ED0A 2F1LA 4B9XA 4XTZA 3QO8A 1UHFA 3CCVQ 1K4US 4PG3A 2GCXA 3MF1A 4M7AA 1YN8A 1ZSZA 3JB9F 3VQWA 3M4GA 5DLQE 3REBB 1WA7A 2QEXT 3NEMA 4JLGA 3OS1A 4KH0B 1HSQA 1WYDA 1NJ8A 2D8JA 2EGCA 4KGZB 4ZTZB 2FPDA 2ZCFB 5HCKA 2HCKA 4C0DC 2XU8A 4K11A 4C5HA 2KAFA 3JCMJ 3G4SA 2RH2A 1PCXA 2AKKA 1NEBA 2YHTA 5GAOq 1BK2A 2CS7A 4D8DA 2HQEA 3MJXA 5LJ5g 2NYSA 4HT8A 4AFSC 4RKUE 3P8DA 3HXWA 1EQRA 1E6HA 5GAMg 3M53A 3ZFJA 1BCOA 2O9VA 4M7AF 1H4VB 1VQLT 2ZZFA 4NL3A 1IXDA 1GCQA 2E1HA 3CBMA 4XU0A 2CP2A 2LNVA 4TVAA 1Y07A 2FPFA 4DEXA 2VYTA 1K9MC 4RTXA 3WVDB 1M27C 3QO3A 4C92E 4YCWA 2ZT8A 1PKTA 4L5GA 1WHGA 4FW2A 3HY0A 1HC7A 2KROA 4N0AC 3GIBA 4HKEA 1YBYA 2K7AA 2NUZA 3IALA 4JJBA 1EIFA 3VV0A 2CZ1B 2R58A 4M78C 3EGXB 4TQDA 2RJFA 2OJ2A 1LVKA 3EHQA 5CKBA 1RAIB 4LDYA 1EVLA 4N4IA 1K0XA 4QQ6A 2DILA 2K79A 2MAMA 3A74A 1JQQA 4EPCA 3MEYA 1MV0B 3RKYA 1Q7YR 3UGTA 1PKSA 2ZT5A 2J6FA 4P73C 2QDYB 1QWFA 2VGMA 2I0NA 1QW1A 1H641 4WTOB 3IQLA 2ZPEB 1SSFA 2ODRC 3GOXA 1GCPA 2VV5A 2PUOB 3SWNB 2DO3A 1LCKA 2CKKA 2XK0A 4M78D 5LJ3j 4JS4A 1C6VX 4EIKA 5CO7A 2OTLT 2Q5HA 3VQVA 3EGUA 2RHXA 1JRIA 2D0QB 1WDXA 1X2QA 2ZNIA 2E12A 3EGDB 2LMJA 4CS4A 4H2SA 4AMCA 2XTIA 1VOMA 4YDQA 2LTOA 4UP9A 4VUBA 1TS9A 4O5VA 2X4YA 1KHIA 4F14A 3LSSA 4RTWA 3CCST 4FL6A 3GNFB 2KXCA 2CUDA 4PJOG 3R6NA 2ZR3A 2ODRD 1Q86U 1K73C 1X43A 3HL8A 4UC4A 1GBRA 1HXDA 3VS6A 4KGXB 2I4MA 1I4K1 3CC7Q 1IGUA 1WJSA 3MEWA 3X25B 1RABB 1M30A 2YRVA 3MQZA 1OI1A 4Y92A 1IHWA 1VQ4T 1UGVA 2X4JA 2M1HA 5LJ3g 2EVRA 4Q5WA 2CT4A 3HXYA 4H2TA 3BJUA 2DJZA 4HVCA 6AT1B 5CQYA 2KEAA 2KQWA 2KVQG 4M77B 4BD3A 1KC8C 4XTVA 2CYZB 1VQZA 4RTYA 2PQWA 4P74C 2WSFE 3PFSA 1QVFP 4LVMA 2FL7A 1BBWA 3M4QA 3P8YA 4CH3A 3CCSQ 1Q95G 4CC3A 4M7DE 2C0OA 3L4GA 3BY7A 1SKUB 2LVMA 3UA7A 3META 4LN2A 3GLXA 4ANJA 4OB2B 4J9DA 5ELOA 3AT1B 1Z7MA 4ZTJA 1BI1A 1TU0B 3CD6A 2RI3A 1OQKA 1SHGA 3O5ZA 3VS1A 3E9IA 3M4YA 3QIIA 5KYWA 1YJ9A 2X3WD 3KXTA 2WACA 4YRGA 1B3QA 1NNHA 1R8OB 1XOVA 2DIQA 1OZ3A 5FLXE 5HKCA 4GY5A 4FSXA 2ARTA 2K57A 1HD3A 2BZXA 2LP5A 3OYDA 2K5LA 1USYA 1PD0A 3OYCA 2COZA 4QQGA 1X2GA 2CREA 3FEOA 3DKMA 1AT1B 3RKWA 2QQBA 1NJ6A 1VQ7A 2K9GA 2CUBA 2GNCA 2SRCA 3G4ST 5J26A 4CH4A 2PZ1A 4LD6A 3CMEQ 5CVIA 3MP8A 3I5RA 2RHQA 4LVKA 4M75C 4BACA 1G3YA 3TUPA 4PFZA 2O9SA 2PUKB 1NJIR 4HWSA 4AT1B 3IKLA 1W2BP 2QQRA 1YP5A 3OYMA 3BDLA 1BKBA 3L1AA 4P75A 4C92G 3NELA 3PCOA 2ZPHB 3LH0A 3CCRA 5K1PA 4BE1A 3NENA 2ZINA 1VQPQ 3VUBA 2MCNA 3URGA 3UT1A 2ARUA 4CI0C 3QZ9B 4J7IA 1HTTA 2HNIA 3LSQA 1H4SA 5IN1A 1KIKA 4BW9A 3CCVA 4X1VA 5CCAA 4Z89A 1R77A 4F16A 5I22A 1QP2A 2A08A 1BU1A 4M75D 4IURA 3M59A 3CPWP 1X56A 4OMLA 4JJCA 1QKWA 3UGQA 1B7TA 3V7RA 2FO0A 1FYNA 4PFPA 5LJ3h 1Y96B 4X34A 3GBQA 3A7UA 2ED1A 4XU3A 2MMPA 1W70A 2YXYA 4Y91A 3M55A 4F7UE 2MK5A 3X26B 1YB3A 1BI3A 2FZCB 3I55A 2VUBA 3QO5A 3JV3A 1ZUUA 2C06A 1X75C 3CEYA 3EFOA 3SDZA 5GANf 1B8AA 4PLIA 2FZKB 1A0NB 2JTEA 3CCJA 2KI7A 4FIBA 2FRWA 1Q82C 1YIJQ 2EQIA 3GP8A 4B9WA 5GANj 5KYYB 3GPLA 4BDYA 1BBUA 2LJ3A 2DD4A 3HPWA 4YROA 4M78E 4LUDA 2JOYA 2JZ2A 4J9IA 4AFQC 1NG2A 5A0GA 4JZ4A 4WI1A 4L87A 3VYGA 2GGRA 5HK3A 1QLYA 4JRQA 1YJNT 1M1KR 1K0SA 2RI2A 1OPKA 4BY6C 2H3EB 3EH2A 4YCUA 1ADYA 4KUDK 1R0BG 1OU8A 3ER0A 3SHWA 4H2VA 1N8RC 2EYWA 2AKWB 1OX9A 4FW1A 4BI8B 4QQDA 2HSPA 4EX5A 5AYFA 2R57A 2Q7HA 2XKOC 1YFRA 1YI2Q 4MDXA 4ZGJB 1UECA 1TUGB 1G83A 2OI3A 3JCMX 1ZX6A 3QYGB 4ZGEB 3A8GB 4PFOA 2EKHA 4G84A 2J06A 4M7DG 2K3YA 1B70B 2M0YA 2DTOA 3UH0A 4J15A 5IXFA 2KDSA 1Q81U 4BE2A 1NPPA 3P8VA 2BE9B 4KUIA 3KUFA 4GLKA 5GAOp 1W2BA 2RN8A 1QCFA 4IUQA 1KK7A 1F1BB 1D3BB 1NYQA 2RD1A 1BI2A 2KT8A 3CD6T 2DYBA 3NMZC 2DQ0A 1KMMA 1N5ZA 3JCMh 3OYLA 1IB8A 4M7AC 1ZSZC 3MCAB 4LDUA 3JB9D 1YJ9T 2EW3A 1VQKQ 1Y57A 3M0RA 2DK3A 5IHIA 1G51A 3VBBA 4N4GA 1AWXA 3OYYA 4J9CA 1B34B 3A8HB 2PNIA 4J9BA 4KRTA 1FYFA 2RI5A 1X55A 4Q15A 2V1RA 3A31A 3CC7A 3HRTA 2PMEA 1WHHA 2KYMA 1KHCA 2HKQB 4J9EA 3CPWA 3LX7A 1FWZA 2JTMA 2DL7A 1G5IA 2DLPA 2RF0A 2GQVA 3LW5E 1VQ7T 4JUVA 5FU6C 2I4LA 3QKJA 3S3NA 2J3LA 4OP0A 1V76A 1KSWA 1Q81R 2R5MA 3LYIA 1EFWA 3CD6Q 3MKDA 3REUA 2O2OA 4E2FB 4M7AD 4C8QG 4X9DA 1GCQC 1ZSGA 3HKSA 1G5VA 1O9SA 1PC0A 2RMOA 4R55A 3OD1A 1BI0A 3VS3A 2F69A 3EGXA 1WXBA 1AWOA 1K76A 1WU7A 3A1PA 3E9GA 4LVLA 3NFCA 3KBGA 4LVIA 4H2WA 4JRPA 3CCRT 4Z8AA 3EG0A 3EFRA 2KNBB 1V1CA 1LJOA 1W2BS 1H92A 3HY1A 3VS2A 4J9GA 3HTRA 2X4WA 4YTLA 1WQWA 4PJOB 2RHSB 2XDDA 3QJ6A 1VIFA 2DL5A 2QYZA 2RQWA 3CCVT 1YCSB 1JU5C 5L8RE 5A0LA 4OVAA 3G6EQ 1RUWA 3FLGA 2G6FX 4RCCA 3SWNA 1UTIA 4MZMA 1EIYB 2E41A 3UDCA 3OBWA 3CCUQ 2F5KA 4EMHA 2BZYA 4LDXA 2CIMA 3M0SA 2SEMA 1TWBA 2P84A 3I9QA 4J83A 1KJWA 3C95A 2AMCB 1IL2A 3F70A 4FCYA 1D1BA 1H4QA 1NEGA 4AFZC 4YRJA 2GFAA 2X9HA 4F7UG 3HRIA 4K86A 1T0HA 2JUFA 3EGDA 5GMKj 1HK9A 3CPFA 5GAMf 3OS0A 3CPWS 3ICAA 1FMVA 1UHCA 5LJ5j 4FT2A 3RMQA 4ELZC 2HEQA 3RDVA 4M75E 3CMEA 2LQWA 5GAMj 3BW1A 3PNWC 4A53A 2JS0A 2D9TA 2DL4A 3HHTB 1XQHA 5M9OA 2COWA 2M9UA 5GANh 2P0QA 2BZ8A 5KYNA 1OV3A 2MOXA 2LRQA 1X6OA 4PJNA 1WGSA 3REXA 3ULRB 3CCJT 1EFNA 5IHKA 2EPDA 4OMFB 2COYA 4M78G 4YYEA 1PYSB 4NCXA 4YRNA 1CSKA 2B8AA 1TUDA 2FYKA 3JCMW 1VQPA 3L2RA 3M0TA 4HCBA 2VXFA 1OEBA 5KCOA 2HZYA 2R5AA 2XGTA 1NLPC 4M77A 4FU6A 3EFSA 2CZ0B 4FYWB 4JZ3A 4DBRA 2PTKA 2QHTA 1JB0E 1Q7YU 2I2LA 3I55Q 1EOVA 4KR3A 1PG5B 1YCYA 3GF5A 3J81E 1U06A 1JBMA 3RNJA 1G3TA 2D0NA 2KYBA 2MI6A 3OQ5A 3I56Q 2LT1A 2ZNJA 3CCJQ 1M9SA 4Z88A 3OYJA 2DRKA 1I07A 2ARSA 1S72A 1X54A 4IUTA 4HVWA 3INZA 3OS5A 3QWXX 3CXCA 1KD1U 1VQ9Q 3E9HA 4YRMA 2HL3A 2JM9A 4JDSA 1Q86C 5GAN4 3EH1A 2ENMA 2LCCA 4M77F 3P8HA 5CAIA 1MMAA 3QWYA 4EMGA 2AKLA 1AWJA 3WQZA 1U8RA 4C92B 2LT4A 5CK9A 1WLEA 4CS3A 2HSEB 1SERA 2DEQA 1YIJA 4P72A 1CKAA 2RJCA 3WXMB 1MGQA 1OYXA 2A0FB 4IKFA 3M9QA 3JCMc 3LWIA 2P0LA 1KQ2A 3FRNA 4M7DF 5EG2A 3ME9A 2CZ6B 2IPOB 3V8LA 1USYC 1G5HA 5LJ3f 2BTTA 3A8MB 1D09B 2RHZA 5HGQA 1RI0A 1X27A 1UE9A 3CC7T 1JXOA 4XK8E 1UGSB 2Y90A 2LQNA 4HCZA 2ABLA 2QTXA 2L3SA 2HD0A 2ZPFB 1ASYA 3LLRA 4J9HA 3CC4Q 1KD1R 2AZSA 3MEAA 3HXZA 5KNNA 3TVTA 3JB9J 2WSCE 3G1JA 4BB7A 2KT1A 1N9WA 3QPHA 1Z9QA 1YI2A 3O8VA 3HRUA 1RI9A 5GAN2 5GAN3 3DB3A 1PNJA 4HWRA 4YRCA 2K5FA 4QVZA 1FMKA 3OB9A 3H8ZA 4RCBA 4WJ3M 2ZZEA 3FIFA 5CKEA 4ESRA 1H3HA 2NS6A 3A7RA 4P75C 2MWPA 2KRNA 3CXCS 1YFSA 4OMMA 2YLCA 2CJ9A 5E3IA 2RNAA 4XTYA 3EG9B 1NLOC 4H2YA 3HSBA 5GMKm 4FM4B 5ELNA 4KULA 4R56A 1PD1A 4M7AE 4J7FA 4RMOA 2DXUA 1VQ6A 2FZGB 3PVQA 4QVCA 5C51B 1O75A 3C94A 1K1ZA 1WLPB 1Y96A 2L3RA 1QWEA 3M4PA 2Q7EA 2D6FA 4C8QF 3FB9A 1U1TA 1X6GA 1VQKA 2CJBA 3THKA 2K2MA 4YRTA 2KSSA 4OGCA 1PWTA 2EAYA 2WSEE 2GQIA 2ROLA 3MP6A 5KYXB 5LJ5h 3A98A 3TQ7P 2DXTA 2O31A 4X9CA 1PM3A 2FEIA 2QTVA 3G1ZA 3R07A 1VQOA 5C52B 3E1SA 3H0FA 5GAMh 2J05A 4KH1B 1LPLA 4YRKA 1SRMA 1WPYA 2BE7D 2DDZA 2RHIA 4WJ4A 2C7IA 2DZ9A 2DBKA 4YRSA 1K9AA 1RLPC 2XMFA 4M75G 1E6GA 1GGMA 2B86A 3CMQA 5KYYA 1OU9A 4M7DB 4ORZA 4OMQA 1TSFA 3CMET 1SHFA 4P3OA 5D6WA 3OYEA 1JJ2A 5FU7B 1NJIU 1M90C 5DLOA 3BDUA 2GFUA 5F5WA 4MZPA 3JCMf 4ZGDB 3CMAQ 3PIOA 2E70A 3SEMA 5FROA 2DM1A 5GAN8 1TXQA 4F7UF 3OA6A 3E9FA 1IREB 2JMAA 4H2XB 2ZT6A 2FRYA 2CSQA 2I4NA 4KQEA 3RL6A 2AKWA 2C0TA 2EJ9A 1VQPT 1WYXA 3CCQA 2CH4W 3HRSA 2RQUA 2QDLA 3A8LB 4L59A 2E3CA 4JLIA 3UA6A 3SFMA 4P3PA 2DX1A 3C12A 4Y28E 3G6EA 2LX9A 4CS2A 1B70A 3CCUA 1KOGA 2QI2A 4RQFA 2DIGA 2QHUA 2EKOA 4XAXB 5A2QE 1NYGA 3JCMe 4J8OA 5CKFA 1M2VB 2H8HA 3P8BB 4RTVA 4M78F 4XTUA 1MMNA 4EDUA 1AEYA 4EMKB 1RL2A 4RG8A 1UEBA 2L5QA 3V7CA 3A5YA 1D3BA 5KYUB 5I21A 4Q6GA 4GLMA 5HY6A 3HFZB 2NWMA 2E3IA 4C8QB 2YUPA 3MEVA 4ZTUB 4NL2A 1AZEA 3G71A 1GBQA 1UJYA 2K5IA 4P71A 2V8JA 1B34A 1G3WA 4FYXB 5DM7R 4CC4B 1JJ2S 2ZGWA 1SRYA 3E2UA 2P0PA 3H41A 3OYHA 1YIJT 4WF2A 3U23A 4P5NA 4CC7A 2D1XA 2YSQA 3EG2A 1WXTA 3A7AA 4PJJA 1S72Q 2DXBA 1M1KU 2CT3A 3I5SA 2K4YA 4OGEA 4C5EA 2JN0A 4C0DB 1BIAA 2JMCA 4IUUA 1ACMB 2JVVA 4DOVA 1MMDA 1Q81C 2DRMA 3QG1A 3M54A 1B07A 1BIBA 3ZEHA 3DSQA 1E24A 2K6DA 4F7UB 3OW2A 2Q5IA 1KC8R 1S1NA 3I56A 1UJ0A 5C53B 5CIUA 4YREA 2RM4A 3CCMA 3FJ5A 1YI2T 1MMGA 1X6BA 3TEHB 5KE3A 1VQ9A 1ADJA 3OS2A 3HRKA 1SG5A 4PJOA 2RHSA 4AH6A 5CR2A 2AHJB 3QXEB 3BE3A 2A7YA 3P8TA 2YWWA 3LGLA 3RACA 2GF7A 1SESA 1QE0A 5K1XA 4JRKA 3VUZA 1EIYA 1MV3A 2VWFA 4M7AG 3CC2A 3OMCA 2DU7A 1R0CB 4M78B 3CBOA 2OTJQ 1WHLA 2AMCA 2HL5C 2I4OA 3TU4K 2HMAA 2KGTA 3W3SA 3DLLA 5GANe 1WJRA 1J5WA 3SWNC 1VQKT 4CC2A 2NUTB 3RR6A 2L3QA 5L23A 1U1SA 2RQRA 2LX7A 3L2WA 2L89A 4PJOF 1AOJA 4BI3A 3WVEB 2JT4A 2H3JA 1YWOA 2X51A 1VQOT 1WQ7A 4N4HA 5GJVB 3ASKA 3CC4A 5AT1B 2DPPB 1BB9A 3M56A 3KFVA 2XICA 1LYLA 3TEEA 3X24B 2E5QA 2YRCA 3VS5A 2ZZDA 2VXEA 1YITQ 2HBPA 3V7SA 3OW2S 1PYSA 2ESWA 5DY9A 1VQ6Q 3RERA 2XIDA 2QGFB 4XTWA 4LDWA 2QQSA 4MMKA 1C1AA 2XDPA 4E7SA 2E3HA 1I1JA 2QAZA 2IIMA 2MWOA 1UDLA 5FRMA 4GBQA 3PZCA 4FYYB 3D7SB 8ATCB 4JJNK 2BUDA 4LDVA 1IZ6A 3X20B 2CP5A 4OF1A 1ABOA 4E7HA 1VQOQ 1W66A 2KBTA 4M75F 3PMIA 4M77C 2J6KA 4MZTA 2EYXA 4JJDA 4HVUA 4QVDA 3OMGA 3R6OA 1QVGA 3VS7A 2ECZA 5CKDA 3CXCP 2HDAA 4E51A 3G6ET 3C4SA 1M3CA 5C0MA 2MYSA 3CCUT 2CDTA 3EHRA 2DA9A 3ZBDA 4TWAA 1T3SA 1YHQQ 2E64A 3VKIA 4FYVB 3TSZA 2DEUA 3HTZA 4D8KA 4H2UA 4C92A 3MEUA 1W6XA 2RA2A 1ZA2B 2L0AA 4XEMA 1VUBA 2EWNA 3HFOA 1VQMQ 4NOYA 4OB3B 2VC8A 4M77D 1XTDA 2A36A 2DL3A 1OPLA 2K3XA 1I8FA 2PVOB 5IXBA 3CCQQ 1AWWA 2X4XA 3H6ZA 3G71T 1H3ZA 1I5LA 3A5ZB 3V8KA 1Q7YC 3HFVA 5I2SA 1BYMA 4P72C 3CMAA 4OLFA 2VVKA 2YT6A 1BBZA 4OMPA 5IHNA 2LCLA 4L6V5 2HQXA 1K8AU 2YDLA 1Z7NA 4X5OA 4J6YA 1IO6A 4M7DD 3I7FA 2AK5A 2ROTA 5LL6S 5D6XA 3IG2A 4C92F 5LJ5f 3GNGA 2F2WA 1UGRB 3TEGA 3PVLA 4C5GA 4HWPA 2V8KA 2GTJA 1YWPA 3NHNA 3UFGA 2DD5A 4KBMB 2JXBA 2OX7A 1GL5A 1MHNA 1ABQA 4PLLA 1NJ5A 2E6ZA 4HWTA 4KR2A 4DBQA 2G4CA 2RK1A 3I55T 2HKNA 1QVGS 2M51A 3G71Q 1VYTA 2O01E 2JM8A 4A4GA 4M4ZA 1EX4A 2QQ9A 4PHCA 2DKGA 3H0IA 3L2VA 1ARKA 3PIPA 2Z0WA 1WIEA 3I56T 2RJEA 3EG9A 2LJ0A 4YRIA 3CCMT 4M75B 1YJWQ 4P3NA 2QA4Q 7AT1B 3L2ZA 3T9NA 5IAYA 1IRXA 4E7LA 2CSIA 2ZXFA 4YP0A 2ZPIB 3QHSA 1VQ9T 1PSEA 4BUGA 2EQJA 5ECAA 11ASA 1TH7A 1K8AR 3CCLA 4RTUA 5GAMe 3ERRA 1VQ8Q 2E4HA 1WFWA 2DVEA 2QGGA 1AD5A 3A32A 2AT1B 2HBWA 5I11A 5KYXA 2DFUA 1WXUA 2ZPGB 3CC2T 1KMNA 3H9NA 1BCMA 3E19A 1M1FA 2OAWA 4C8QD 1X01A 2EBPA 1GXIE 4RTTA 2KXDA 2LDMA 1YGBA 3QZ5B 2RQVA 4II1A 1Y7XA 3CCMQ 1TUCA 4C0ZA 2PMFA 2KY9A 3JCMb 5FRNA 1NYRA 1D0ZA 4M7DA 1WHMA 1JJ2P 3VRZA 1ZBXA 2NUPB 3LH5A 4LE9A 2KRMA 1M8MA 2FPEA 2P4TA 4F17A 4LVJA 3CC4T 4A4FA 1ATIA 4E7KA 1JJCB 3CBPA 3VJPA 2O4XB 3UF4A 2C0IA 1E22A 3RMSA 1QCNA 3CC2Q 5J39A 4BWAA 2QEXQ 1I0CA 4JPBW 3FDRA 1D0YA 4H2XA 2CZ7B 4B6MA 1KFZA 2ZT7A 1G3SA 1ZQ1A 9ATCB 2F2VA 2V8IA 2DZCA 2P4RA 3Q1JA 2ALYB 3VU3C 2LQKA 3A8OB 2VKNA 2GTOA 1QF6A 2DF6A 1RACB 1N9SA 3NTIA 4DQ2A 4JS5A 4QT7A 1SEMA 1B7YB 4YRFA 4YPFA 4ELYC 4A4EA 3M58A 4TTVA 3MHXA 2A8EA 2ZIMA 4ME7A 5A0DA 5GAOr 1VYVA 1ZBJA 5CKHA 3TCJA 2CH4A 1U3OA 2ZZGA 4ATOA 3N5BB 3QDRB 1VQLQ 2OTJA 4C5IA 4O6JA 1VQNA 1M2VA 4RTZA 3OYGA 5IT9E 1CKBA 4K88A 1FX7A 4BY6B 5LJ3d 3V8JA 1KQ1A 4EMKA 2LNHB 1NJIC 5KYUA 2DMOA 3JAME 1JEGA 3HFZA 2IY5B 2P5IA 4C8QA 1YFNA 3UATA 4BI4A 1G8XA 1WZOA 1E7OA 3CCEA 3OYNA 1VA7A 3UPUA 1MNEA 5LJ3e 2YUNA 4YRRA 4UP8A 3TSWA 4LUEA 1PSFA 2KE9A 3M0PA 4HA8A 5GAN7 3JCMQ 1YITA 2VGNA 2EJGA 4P71C 3OYFA 1XJWB 4PNOA 1ZHIA 1X2HA 3JB9I 1K9MU 2DL8A 1ZLMA 4HCCA 1EZZB 1J3TA 5D7UA 3HP9A 1NZ9A 5KE2A 3CMAT 2XDBA 4M7AB 3OBYA 5GMKh 1ZSZB 2LZ6B 1YJNA 4LD9K 1D1AA 1D0XA 1PHTA 4M77E 2FVUA 2A37A 3HXUA 1LNXA 2OTLQ 1JXMA 3OW2P 1NJ1A 4F7UA 2FB7A 1UGQB 2QK0A 3VYHB 4TVYA 4J9FA 1UFFA 2AIRB 4YRPA 4HT4A 1W4SA 2FHDA 4PL6A 3FC3A 3TEHA 5FU6B 3RF1A 4XEOA 2RHYA 2LQ8A 5GMKl 2DTIA 3PE0A 4AG1C 3G7ZA 1QKXA 2QHSA 3UWNA 5HK0A 3VQYA 3H0HA 1G2BA 2YRDA 3CQTA 4J6WA 1YHQA 1K9MR 1WI7A 1OULA 4C0GA 1WNLA 4TVAB 4N0AA 1RAGB 1Q86R 4XU2A 3JRZA 4PJOC 2RO0A 4M78A 1VQMA 4OB0B 5GMKi 1VQ4Q 3BFMA 4KGVB 3S3MA 1M1KC 4E47A 4RQEA 4R0KA 3JCMd 5GAN6 1M3BA 1M4ZA 3CCLT 4AG2C 1WX6A 2NUTA 2E5KA 2DQ3A 2D8HA 2BIVA 3SB2A 3OY9A 4P73A 2E10A 1SRLA 1K73U 2BKDN 1SSHA 1Y0MA 4XU1A 4KT0E 4JRIA 3VRYA 3NTKA 2C8MA 3OSVA 4QKUA 3LC0A 4PK4A 2Q7GA 4PJOD 1YNZA 3J80E 2J7IA 3L2UA 2RK2A 4PKCC 1S72T 1KQSP 1NJ2A 1PRLC 4ZN3A 2DVJA 2ATCB 2VB6A 2DTHA 2QASA 3LWHA 2JJ9A 2QXFA 4E6RA 1KC8U 1Z9ZA 4C8QE 3CCLQ 2EIFA 4IIMA 3M57A 4UPAA 5I2MA 2HQHA 2A28A 4Z02A 3RUXA 1VQ5A 2F5TX 1WHKA 1W1FA 3I35A 3VS4A 2ZIOA 1RLQC 4BE0A 2JTFA 4UP7A 2MF2A 2DE0X 3JCMP 5IH2A 2GBQA 1YJWA 4RMFA 2QA4A 2E5AA 1M8VA 3JCMg 2JS2A 3QYHB 4J6XA 3ZL7C 1HYOA 2G3RA 1K73R 3HXVA 4TVRA 2PU9B 5KCHA 4ZTFA 3G4SQ 2DNUA 4RG2A 1QVGP 3LGFA 1M90U 4YRLA 1VQ8A 2RPNA 2MIOA 1QP3A 2EYZA 1U5SA 3MPUB 3OYIA 1NBEB 8AT1B 3QDFA 1SETA 3OYKA 1X69A 2CJAA 4DBFA 1RAHB 3KFUA 1IGQA 3NGPA 4A63B 2OTJT 1HJDA 4V2SA 3S3OA 3QNEA 3JB9G 1VQNT 4P74A 4EO4A 2CP3A 2DAQA 3DLMA 4C0FA 2O88A 1ASZA 1VYUA 1UB4A 2XHCA 1ZUKA 3X28B 1TOVA 2M16A 2PVGB 1GFDA 3RBBB 1GRIA 2EYYA 2HAXA 4QW2A 2JW4A 3HFNA 4E7JA 1QVFA 3MF2A 1RIQA 4C92C 1AHJB 1UGPB 5GANd 12ASA 2E6NA 3CCET 3A5ZA 1RAAB 2J3MA 1E1OA 4WCIA 2KMTA 1DJ7B 1ZUYA 4CH5A 3L4GB 3L42A 4XTXA 1XNIA 2KRSA 4J5YA 3RGLA 2J6OA 4ZN1A 2X3XD 4A4KA 4DPGA 3SD4A 1M90R 3M0UA 1P92A 2QEXA 1YITT 1ZA1B 1YFTA 1FXXA 1IHVA 1H8KA 2EQKA 1VQ6T 2NLUA 5D6YA 1VQNQ 2K3BA 2W0ZA 4O2DA 1GFCA 2RQTA 3J7AF 3QSUA 3PMTA 4CRIA 5KYWB 2XD0A 1H4TA 2L8DA 4DBHA 1T3LA 3QUIA 2ZR2A 2M02A 4M77G 2EFIA 1PRMC 1L0WA 1M3AA 4C92D 3NTHA 2RJDA 3REAB 2AZVA 4AFUC 1M5Q1 3CCEQ 3QBYA 3PT9A 1VQLA 2YLBA 2LC4A 4TQFA 5GAOn 4M75A 2YUOA 1T0JA 1LOJA 4A54A 2LJ1A 5GAOm 3QO7A 2YUQA 1D1CA 5EC7A 1C0MA 2F2XA 4K87A 2EQMA 1I5OB 2EYQA 2PVDB 1KQSA 5FWCA 1QQJA 4XQ3A 5GANg 5FW9A 2X35A 3AHUA 1V29B 3DB4A 2RHQB 3NETA 3OSSC 4HCKA 2EGAA 2JNGA 4FSSA 4OB1B 4G85A 3FJPA 4HXJA 1AVZC 1K8AC 1YHQT 2DERA 1SF9A 4F04B 1QVFS 2OAUA 4H02A 1YJNQ 2V1QA 4HVVA 1VIEA 2L2PA 1VQMT 3PCOB 1RADB 5KH6A 1SPKA 1UG1A 2ZPBB 4NS5A 2ZAEA 5FWBA 3PTAA 3CCQT 1Q82U 2Y4YA 1FMWA 3QTCA 1QMCA 4YRQA 2XI9A 1TG0A 1I81A 4E7ZA 1B76A 2W10A
chains in the Genus database with same CATH topology
3TREA 3RKXA 5GAOl 2EQUA 3IKMB 4DOWA 2IG0A 2CGHA 2KK4A 2OTLA 4MMLA 1JJCA 4E7IA 3HXXA 2O4XA 4MDWA 5C6SA 4IUPA 4M7DC 2RB6A 2EL9A 5FU7C 1NE8A 1N8RU 4TVWA 4DA4A 1N9RA 1M1GA 3EAEA 4YCVA 3VQXA 2IVWA 3MO8A 2QQAA 2DU5A 3QJYA 1NPRA 3M5AA 2ALYA 3OYBA 4RDXA 3CCSA 5GAN5 1E1TA 3MP1A 4LNSA 2EJFA 1KQSS 1B7YA 3S6WA 3L2QA 4HT9A 1VQ5T 4PJOE 4A4HA 2M0OA 2A3LA 1YJWT 2QA4T 4BDZA 4HWOA 1VQ4A 2E65A 4IUVA 1C0AA 4FT4A 3PGGA 1KD1C 1N6AA 1VQ8T 2XG8D 2IY5A 2ZTGA 2P0KA 2RHUA 3JB9H 1EVKA 5LJ5d 4CH6A 1N27A 5CQXA 4EMKC 4D6WA 3RIRA 2Y4XA 5GAMd 2QHVA 5J3BA 2K2VA 1QVPA 3RESA 4C8QC 4ZIBA 2DXCA 3JCMV 1KG1A 1OZ2A 5GMKe 3JSCA 3OYAA 2ZCEA 1WJQA 5LJ5e 1Y71A 4B9XA 4XTZA 3QO8A 4PG3A 2GCXA 3MF1A 4M7AA 3JB9F 3VQWA 3M4GA 5DLQE 2QEXT 3NEMA 4JLGA 3OS1A 1WYDA 1NJ8A 4ZTZB 2ZCFB 4C0DC 2XU8A 4C5HA 2KAFA 3JCMJ 3G4SA 2RH2A 2YHTA 5GAOq 2CS7A 2HQEA 5LJ5g 4HT8A 4RKUE 3P8DA 3HXWA 1EQRA 5GAMg 3M53A 3ZFJA 4M7AF 1H4VB 1VQLT 2ZZFA 4NL3A 2E1HA 3CBMA 4XU0A 2LNVA 4TVAA 1Y07A 2VYTA 1K9MC 3WVDB 3QO3A 4C92E 4YCWA 2ZT8A 4L5GA 3HY0A 1HC7A 4N0AC 3GIBA 4HKEA 1YBYA 3IALA 1EIFA 3VV0A 2CZ1B 2R58A 4M78C 4TQDA 2RJFA 5CKBA 4LDYA 1EVLA 4N4IA 4QQ6A 2MAMA 3A74A 4EPCA 3MEYA 3RKYA 3UGTA 2ZT5A 4P73C 2QDYB 2VGMA 1QW1A 1H641 2ZPEB 1SSFA 2ODRC 3GOXA 2VV5A 3SWNB 2PUOB 2DO3A 2CKKA 2XK0A 4M78D 5LJ3j 4JS4A 5CO7A 2OTLT 2Q5HA 3VQVA 2RHXA 1JRIA 2D0QB 2ZNIA 2E12A 4CS4A 4H2SA 2XTIA 4YDQA 2LTOA 4UP9A 4VUBA 4O5VA 2X4YA 1KHIA 3LSSA 3CCST 4FL6A 3GNFB 4PJOG 2ZR3A 2ODRD 1Q86U 1K73C 3HL8A 4UC4A 1HXDA 2I4MA 1I4K1 1WJSA 3MEWA 3X25B 2YRVA 3MQZA 1OI1A 1VQ4T 2X4JA 2M1HA 5LJ3g 4Q5WA 3HXYA 4H2TA 3BJUA 2DJZA 4HVCA 5CQYA 2KQWA 2KVQG 4M77B 4BD3A 1KC8C 4XTVA 2CYZB 1VQZA 2PQWA 4P74C 2WSFE 3PFSA 4LVMA 2FL7A 1BBWA 3M4QA 3P8YA 4CH3A 4M7DE 3L4GA 3BY7A 2LVMA 3META 3GLXA 4OB2B 5ELOA 1Z7MA 4ZTJA 1BI1A 3CD6A 2RI3A 3E9IA 3M4YA 3QIIA 1YJ9A 3KXTA 2WACA 4YRGA 1NNHA 1R8OB 1XOVA 2DIQA 1OZ3A 5FLXE 5HKCA 4GY5A 4FSXA 2ARTA 2K57A 3OYDA 2K5LA 1USYA 3OYCA 4QQGA 1X2GA 3FEOA 3DKMA 3RKWA 2QQBA 1NJ6A 1VQ7A 3G4ST 5J26A 4CH4A 4LD6A 5CVIA 3MP8A 2RHQA 4LVKA 4M75C 4BACA 1G3YA 3TUPA 2PUKB 4HWSA 3IKLA 2QQRA 3OYMA 3BDLA 1BKBA 3L1AA 4P75A 4C92G 3NELA 3PCOA 2ZPHB 3LH0A 3CCRA 5K1PA 4BE1A 3NENA 2ZINA 3VUBA 3URGA 3UT1A 2ARUA 4CI0C 3QZ9B 4J7IA 1HTTA 2HNIA 3LSQA 1H4SA 5IN1A 4BW9A 3CCVA 5CCAA 1QP2A 4M75D 4IURA 3M59A 1X56A 3UGQA 3V7RA 5LJ3h 1Y96B 4X34A 3A7UA 4XU3A 2MMPA 4Y91A 3M55A 4F7UE 3X26B 1YB3A 1BI3A 3I55A 2VUBA 3QO5A 2C06A 1X75C 3CEYA 3SDZA 5GANf 1B8AA 4PLIA 3CCJA 4FIBA 1Q82C 3GP8A 4B9WA 5GANj 3GPLA 4BDYA 1BBUA 2DD4A 3HPWA 4YROA 4M78E 2JOYA 2JZ2A 5A0GA 4WI1A 4L87A 3VYGA 5HK3A 4JRQA 1YJNT 2RI2A 4BY6C 4YCUA 1ADYA 4KUDK 3ER0A 4H2VA 1N8RC 2AKWB 4BI8B 4QQDA 4EX5A 5AYFA 2R57A 2Q7HA 2XKOC 1YFRA 4MDXA 4ZGJB 3JCMX 3QYGB 4ZGEB 3A8GB 4G84A 4M7DG 2K3YA 1B70B 2DTOA 3UH0A 4J15A 2KDSA 1Q81U 4BE2A 1NPPA 3P8VA 4KUIA 3KUFA 4GLKA 5GAOp 1W2BA 4IUQA 1D3BB 1NYQA 2RD1A 1BI2A 3CD6T 2DQ0A 1KMMA 3JCMh 3OYLA 4M7AC 3MCAB 4LDUA 3JB9D 1YJ9T 2DK3A 1G51A 3VBBA 4N4GA 3OYYA 1B34B 3A8HB 1FYFA 2RI5A 1X55A 4Q15A 3A31A 3CC7A 3HRTA 2PMEA 1KHCA 3CPWA 3LX7A 1FWZA 2JTMA 1G5IA 2GQVA 3LW5E 1VQ7T 4JUVA 5FU6C 2I4LA 3QKJA 3S3NA 2J3LA 4OP0A 2R5MA 3LYIA 1EFWA 3REUA 4M7AD 4C8QG 4X9DA 3HKSA 1G5VA 1O9SA 4R55A 3OD1A 1BI0A 2F69A 1WU7A 3E9GA 4LVLA 3NFCA 3KBGA 4LVIA 4H2WA 4JRPA 3CCRT 3EFRA 1LJOA 1W2BS 3HY1A 2X4WA 4YTLA 1WQWA 4PJOB 2RHSB 2XDDA 3QJ6A 1VIFA 3CCVT 5L8RE 5A0LA 4OVAA 3FLGA 4RCCA 3SWNA 4MZMA 1EIYB 2E41A 3UDCA 3OBWA 2F5KA 4EMHA 4LDXA 2CIMA 4J83A 2AMCB 3C95A 1IL2A 3F70A 1H4QA 4YRJA 2GFAA 4K86A 4F7UG 3HRIA 2JUFA 5GMKj 1HK9A 3CPFA 5GAMf 3OS0A 3CPWS 3ICAA 5LJ5j 4FT2A 3RMQA 4ELZC 4M75E 3CMEA 5GAMj 3BW1A 3PNWC 4A53A 2D9TA 3HHTB 1XQHA 5M9OA 5GANh 2M9UA 2P0QA 2LRQA 1X6OA 1WGSA 3REXA 3CCJT 4OMFB 4M78G 4YYEA 1PYSB 4NCXA 4YRNA 2B8AA 2FYKA 3JCMW 1VQPA 3L2RA 4HCBA 2VXFA 5KCOA 2R5AA 2XGTA 4M77A 4FU6A 3EFSA 2CZ0B 2QHTA 1JB0E 1Q7YU 2I2LA 1EOVA 4KR3A 1YCYA 3GF5A 3J81E 1JBMA 1G3TA 3OQ5A 2MI6A 2LT1A 2ZNJA 1M9SA 3OYJA 2ARSA 1S72A 1X54A 4IUTA 3INZA 3OS5A 3CXCA 3E9HA 1KD1U 4YRMA 1Q86C 4JDSA 5GAN4 2LCCA 4M77F 3P8HA 5CAIA 4EMGA 3WQZA 1U8RA 4C92B 2LT4A 5CK9A 1WLEA 4CS3A 1SERA 2DEQA 1YIJA 4P72A 2RJCA 3WXMB 1MGQA 1OYXA 4IKFA 3M9QA 3JCMc 3LWIA 2P0LA 1KQ2A 3FRNA 4M7DF 5EG2A 3ME9A 2CZ6B 3V8LA 1USYC 1G5HA 5LJ3f 3A8MB 2RHZA 5HGQA 1RI0A 3CC7T 4XK8E 1UGSB 2Y90A 4HCZA 2QTXA 2HD0A 2ZPFB 1ASYA 3LLRA 3MEAA 3HXZA 5KNNA 3JB9J 2WSCE 4BB7A 1N9WA 3QPHA 1YI2A 3O8VA 3HRUA 5GAN2 5GAN3 3DB3A 4YRCA 4HWRA 2K5FA 4QVZA 3OB9A 3H8ZA 4RCBA 4WJ3M 2ZZEA 3FIFA 5CKEA 2NS6A 3A7RA 4P75C 2MWPA 3CXCS 1YFSA 2YLCA 2CJ9A 5E3IA 4XTYA 4H2YA 3HSBA 5GMKm 4FM4B 5ELNA 4KULA 4R56A 4M7AE 4J7FA 4RMOA 2DXUA 1VQ6A 4QVCA 5C51B 1O75A 3C94A 1Y96A 2L3RA 3M4PA 2Q7EA 2D6FA 4C8QF 3FB9A 1U1TA 1VQKA 2CJBA 4YRTA 2KSSA 4OGCA 2EAYA 2WSEE 3MP6A 5LJ5h 2DXTA 4X9CA 3R07A 3G1ZA 1VQOA 5C52B 3E1SA 5GAMh 4YRKA 1WPYA 2DDZA 2RHIA 4WJ4A 2C7IA 2DZ9A 4YRSA 4M75G 1GGMA 3CMQA 4M7DB 3CMET 4P3OA 5D6WA 3OYEA 1JJ2A 5FU7B 1NJIU 1M90C 5DLOA 3BDUA 2GFUA 5F5WA 4MZPA 3JCMf 4ZGDB 3PIOA 2E70A 5FROA 5GAN8 4F7UF 3OA6A 3E9FA 1IREB 4H2XB 2ZT6A 2I4NA 4KQEA 3RL6A 2AKWA 2EJ9A 1VQPT 3CCQA 3HRSA 3A8LB 4L59A 2E3CA 4JLIA 3SFMA 4P3PA 3C12A 4Y28E 3G6EA 2LX9A 4CS2A 1B70A 3CCUA 1KOGA 2QI2A 4RQFA 2DIGA 2QHUA 2EKOA 4XAXB 5A2QE 3JCMe 4J8OA 5CKFA 3P8BB 4XTUA 4M78F 4EDUA 4EMKB 1RL2A 4RG8A 1UEBA 2L5QA 3V7CA 3A5YA 1D3BA 4Q6GA 5I21A 5HY6A 3HFZB 4C8QB 3MEVA 4ZTUB 4NL2A 3G71A 2K5IA 4P71A 2V8JA 1B34A 1G3WA 5DM7R 1JJ2S 2ZGWA 1SRYA 2P0PA 3OYHA 1YIJT 4WF2A 4P5NA 3A7AA 2DXBA 1M1KU 2K4YA 4OGEA 4C5EA 2JN0A 4C0DB 1BIAA 4IUUA 2JVVA 4DOVA 1Q81C 3QG1A 3M54A 1BIBA 3ZEHA 3DSQA 1E24A 4F7UB 3OW2A 2Q5IA 3I56A 5C53B 5CIUA 4YREA 2RM4A 3CCMA 1YI2T 3TEHB 5KE3A 1VQ9A 1ADJA 3OS2A 3HRKA 4PJOA 2RHSA 4AH6A 5CR2A 2AHJB 3QXEB 2A7YA 3P8TA 3LGLA 3RACA 2GF7A 1SESA 1QE0A 5K1XA 4JRKA 3VUZA 1EIYA 4M7AG 3CC2A 3OMCA 2DU7A 4M78B 3CBOA 2AMCA 2I4OA 3TU4K 3W3SA 3DLLA 5GANe 1WJRA 1J5WA 3SWNC 1VQKT 1U1SA 3L2WA 2L89A 4PJOF 4BI3A 3WVEB 2H3JA 1VQOT 1WQ7A 4N4HA 3ASKA 3CC4A 2DPPB 3M56A 2XICA 1LYLA 3TEEA 3X24B 2E5QA 2ZZDA 2VXEA 2HBPA 3V7SA 3OW2S 1PYSA 3RERA 5DY9A 2XIDA 4XTWA 4LDWA 2QQSA 4MMKA 2XDPA 2MWOA 5FRMA 3PZCA 4JJNK 2BUDA 4LDVA 1IZ6A 3X20B 4OF1A 4E7HA 1W66A 4M75F 3PMIA 4M77C 4MZTA 4QVDA 3OMGA 3R6OA 1QVGA 5CKDA 4E51A 3G6ET 3C4SA 5C0MA 3CCUT 3ZBDA 4TWAA 2E64A 3VKIA 3HTZA 4H2UA 4C92A 3MEUA 2RA2A 4XEMA 1VUBA 2EWNA 3HFOA 4NOYA 4OB3B 2VC8A 4M77D 1XTDA 2K3XA 1I8FA 2PVOB 2X4XA 3H6ZA 3G71T 1H3ZA 1I5LA 3A5ZB 3V8KA 1Q7YC 3HFVA 5I2SA 1BYMA 4P72C 3CMAA 4OLFA 2LCLA 4L6V5 2HQXA 1Z7NA 1K8AU 4X5OA 4J6YA 4M7DD 3I7FA 5LL6S 5D6XA 3IG2A 4C92F 5LJ5f 3GNGA 1UGRB 3TEGA 4C5GA 4HWPA 2V8KA 3UFGA 2DD5A 4KBMB 1MHNA 4PLLA 1NJ5A 2E6ZA 4HWTA 4KR2A 2G4CA 2RK1A 3I55T 1QVGS 2O01E 4A4GA 2QQ9A 4PHCA 2DKGA 3L2VA 3PIPA 3I56T 2RJEA 4YRIA 3CCMT 4M75B 4P3NA 3L2ZA 3T9NA 5IAYA 4E7LA 2ZXFA 4YP0A 2ZPIB 3QHSA 1VQ9T 1PSEA 4BUGA 2EQJA 11ASA 1TH7A 3CCLA 5GAMe 3ERRA 2DVEA 3A32A 2ZPGB 3CC2T 1KMNA 3E19A 1M1FA 4C8QD 1X01A 1GXIE 2LDMA 1YGBA 3QZ5B 4II1A 1Y7XA 4C0ZA 2PMFA 2KY9A 3JCMb 5FRNA 1NYRA 4M7DA 1ZBXA 2P4TA 4LVJA 3CC4T 4A4FA 1ATIA 4E7KA 1JJCB 3CBPA 3VJPA 2O4XB 1E22A 3RMSA 5J39A 4BWAA 3FDRA 4H2XA 2CZ7B 2ZT7A 1G3SA 1ZQ1A 2V8IA 2DZCA 3Q1JA 2ALYB 3VU3C 2LQKA 3A8OB 1QF6A 1N9SA 3NTIA 4DQ2A 4JS5A 1B7YB 4YRFA 4YPFA 4ELYC 4A4EA 3M58A 4TTVA 3MHXA 2A8EA 2ZIMA 4ME7A 5A0DA 5GAOr 5CKHA 3TCJA 2ZZGA 4ATOA 3N5BB 3QDRB 2OTJA 4C5IA 4O6JA 1VQNA 3OYGA 5IT9E 4K88A 1FX7A 4BY6B 5LJ3d 3V8JA 1KQ1A 4EMKA 1NJIC 3JAME 2IY5B 3HFZA 2P5IA 4C8QA 4BI4A 3CCEA 3OYNA 3UPUA 5LJ3e 4YRRA 4UP8A 1PSFA 4HA8A 5GAN7 3JCMQ 1YITA 2VGNA 2EJGA 4P71C 3OYFA 4PNOA 1ZHIA 1X2HA 3JB9I 1K9MU 4HCCA 3HP9A 1NZ9A 5KE2A 3CMAT 2XDBA 4M7AB 3OBYA 5GMKh 1YJNA 4LD9K 4M77E 2FVUA 3HXUA 1LNXA 1NJ1A 4F7UA 2FB7A 1UGQB 3VYHB 4TVYA 4YRPA 4HT4A 1W4SA 2FHDA 4PL6A 3FC3A 3TEHA 5FU6B 3RF1A 4XEOA 2RHYA 2LQ8A 5GMKl 2DTIA 3G7ZA 2QHSA 3UWNA 5HK0A 3VQYA 4J6WA 1YHQA 4C0GA 1WNLA 4TVAB 4N0AA 4XU2A 3JRZA 4PJOC 2RO0A 4M78A 1VQMA 4OB0B 5GMKi 3BFMA 3S3MA 1M1KC 4E47A 4RQEA 3JCMd 5GAN6 1M4ZA 3CCLT 2DQ3A 2BIVA 3SB2A 3OY9A 4P73A 2E10A 1K73U 2BKDN 4XU1A 4KT0E 4JRIA 3NTKA 2C8MA 3OSVA 3LC0A 2Q7GA 4PJOD 3J80E 3L2UA 2RK2A 4PKCC 1S72T 1NJ2A 4ZN3A 2DTHA 3LWHA 2QXFA 1KC8U 4C8QE 2EIFA 3M57A 4UPAA 5I2MA 4Z02A 3RUXA 1VQ5A 2F5TX 2ZIOA 4BE0A 2JTFA 4UP7A 2MF2A 3JCMP 1YJWA 4RMFA 2QA4A 2E5AA 1M8VA 3JCMg 4J6XA 3QYHB 2G3RA 3HXVA 4TVRA 2PU9B 5KCHA 4ZTFA 4RG2A 3LGFA 1M90U 4YRLA 1VQ8A 1QP3A 3OYIA 1SETA 3OYKA 2CJAA 3KFUA 2OTJT 4V2SA 3S3OA 3QNEA 3JB9G 1VQNT 4P74A 4EO4A 2DAQA 3DLMA 4C0FA 1ASZA 1UB4A 2XHCA 3X28B 2M16A 2PVGB 2HAXA 4QW2A 3HFNA 4E7JA 1QVFA 3MF2A 1RIQA 4C92C 1AHJB 1UGPB 5GANd 12ASA 2E6NA 3CCET 3A5ZA 2J3MA 1E1OA 2KMTA 1DJ7B 4CH5A 3L4GB 3L42A 4XTXA 1XNIA 4J5YA 3RGLA 4ZN1A 4A4KA 4DPGA 3SD4A 1P92A 2QEXA 1YITT 1YFTA 1FXXA 2EQKA 1VQ6T 2NLUA 5D6YA 4O2DA 3J7AF 3QSUA 3PMTA 4CRIA 2XD0A 1H4TA 2L8DA 3QUIA 2ZR2A 4M77G 2EFIA 1L0WA 4C92D 3NTHA 2RJDA 1M5Q1 3QBYA 3PT9A 1VQLA 2YLBA 2LC4A 4TQFA 5GAOn 4M75A 4A54A 1LOJA 5GAOm 3QO7A 4K87A 2EQMA 2EYQA 2PVDB 1KQSA 4XQ3A 5GANg 2X35A 3AHUA 1V29B 3DB4A 2RHQB 3NETA 3OSSC 2JNGA 4OB1B 4G85A 3FJPA 1K8AC 1YHQT 1QVFS 2OAUA 4H02A 1VIEA 1VQMT 3PCOB 5KH6A 2ZPBB 4NS5A 3PTAA 3CCQT 1Q82U 2Y4YA 3QTCA 4YRQA 2XI9A 1I81A 1B76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAY A;  1YGB A;  3RKX A;  5GAO l;  3IKM B;  5LJ3 h;  5LJ5 h;  1Y96 B;  3A7U A;  4XU3 A;  2DXT A;  4X9C A;  4Y91 A;  2CGH A;  3R07 A;  3G1Z A;  4F7U E;  5C52 B;  2PMF A;  3JCM b;  5GAM h;  1JJC A;  1NYR A;  4MML A;  1YB3 A;  4M7D A;  4YRK A;  3HXX A;  4M7D C;  1WPY A;  2RB6 A;  2EL9 A;  2DDZ A;  4WJ4 A;  2C7I A;  3QO5 A;  2DZ9 A;  4TVW A;  4YRS A;  4M75 G;  1N9R A;  1GGM A;  3CMQ A;  4YCV A;  1ATI A;  1JJC B;  3VQX A;  5GAN f;  4M7D B;  1B8A A;  2DU5 A;  4P3O A;  1E22 A;  2ALY A;  4RDX A;  5GAN 5;  1E1T A;  4BWA A;  3BDU A;  4LNS A;  2EJF A;  5F5W A;  4H2X A;  5GAN j;  2ZT7 A;  1B7Y A;  3JCM f;  4HT9 A;  1BBU A;  4PJO E;  2DZC A;  4YRO A;  4M78 E;  2ALY B;  3VU3 C;  1QF6 A;  5GAN 8;  4F7U F;  1N9S A;  4HWO A;  4DQ2 A;  4H2X B;  4WI1 A;  1B7Y B;  2ZT6 A;  4YRF A;  4L87 A;  4YPF A;  2I4N A;  4KQE A;  3RL6 A;  2AKW A;  2EJ9 A;  4TTV A;  2E65 A;  2ZIM A;  1C0A A;  5GAO r;  3PGG A;  2E3C A;  2ZZG A;  4JLI A;  4YCU A;  1ADY A;  4H2V A;  2IY5 A;  4P3P A;  2ZTG A;  2AKW B;  4EX5 A;  4K88 A;  4CS2 A;  3JB9 H;  1EVK A;  5LJ3 d;  5LJ5 d;  1B70 A;  4CH6 A;  3V8J A;  1KQ1 A;  4EMK A;  2Q7H A;  1KOG A;  1YFR A;  4RQF A;  4EMK C;  2QHU A;  3RIR A;  3JCM X;  2IY5 B;  3HFZ A;  5GAM d;  3JCM e;  2P5I A;  4C8Q A;  4G84 A;  2QHV A;  4XTU A;  4M78 F;  4M7D G;  3RES A;  4C8Q C;  4ZIB A;  3JCM V;  1B70 B;  2DTO A;  4EMK B;  3UH0 A;  3V7C A;  3A5Y A;  4J15 A;  1D3B A;  4Q6G A;  5I21 A;  3HFZ B;  5GMK e;  4C8Q B;  2ZCE A;  4ZTU B;  5LJ3 e;  5LJ5 e;  4NL2 A;  3P8V A;  4YRR A;  4UP8 A;  5GAO p;  4HA8 A;  5GAN 7;  4P71 A;  4XTZ A;  3JCM Q;  3QO8 A;  1D3B B;  1NYQ A;  1B34 A;  2EJG A;  4P71 C;  4PG3 A;  2RD1 A;  4PNO A;  2DQ0 A;  2ZGW A;  1SRY A;  1KMM A;  3MF1 A;  1X2H A;  4M7A A;  3JCM h;  3JB9 F;  3JB9 I;  3VQW A;  3M4G A;  4M7A C;  3JB9 D;  3NEM A;  1G51 A;  3VBB A;  4WF2 A;  1B34 B;  1FYF A;  1WYD A;  1NJ8 A;  1X55 A;  4ZTZ B;  4M7A B;  5GMK h;  4Q15 A;  3A31 A;  3A7A A;  2PME A;  3JCM J;  4M77 E;  3HXU A;  1LNX A;  2YHT A;  5GAO q;  1NJ1 A;  1G5I A;  4F7U A;  2JN0 A;  2FB7 A;  5LJ5 g;  1BIA A;  4JUV A;  4HT8 A;  2I4L A;  2J3L A;  4TVY A;  4OP0 A;  3HXW A;  1EQR A;  5GAM g;  4YRP A;  1BIB A;  4M7A F;  1H4V B;  3TEH A;  2ZZF A;  3DSQ A;  1E24 A;  4NL3 A;  1EFW A;  4F7U B;  3REU A;  3RF1 A;  4XEO A;  4M7A D;  2E1H A;  5GMK l;  2DTI A;  2Q5I A;  4XU0 A;  4C8Q G;  4X9D A;  4TVA A;  5C53 B;  4YRE A;  2QHS A;  2RM4 A;  3OD1 A;  3TEH B;  3QO3 A;  3VQY A;  4C92 E;  4YCW A;  4J6W A;  1ADJ A;  2ZT8 A;  3HRK A;  1WU7 A;  4TVA B;  1WNL A;  4N0A A;  4PJO A;  2RHS A;  4AH6 A;  3HY0 A;  4XU2 A;  1HC7 A;  4N0A C;  4PJO C;  3GIB A;  4M78 A;  3IAL A;  4H2W A;  3P8T A;  4M78 C;  5GMK i;  3RAC A;  3BFM A;  4TQD A;  1SES A;  3EFR A;  1LJO A;  1QE0 A;  5K1X A;  4RQE A;  4JRK A;  3HY1 A;  3JCM d;  1EIY A;  4PJO B;  1WQW A;  4M7A G;  2RHS B;  5GAN 6;  2DU7 A;  1EVL A;  4M78 B;  2DQ3 A;  3A74 A;  2AMC A;  3MEY A;  2I4O A;  3SB2 A;  3RKY A;  3W3S A;  4P73 A;  3UGT A;  4RCC A;  2E10 A;  3SWN A;  5GAN e;  2ZT5 A;  1J5W A;  2E41 A;  4P73 C;  1EIY B;  3SWN C;  4XU1 A;  4EMH A;  1H64 1;  4JRI A;  2CIM A;  2AMC B;  1IL2 A;  1U1S A;  2ODR C;  2C8M A;  1H4Q A;  4PJO F;  3LC0 A;  3SWN B;  4YRJ A;  4K86 A;  4F7U G;  2Q7G A;  4PJO D;  3HRI A;  5GMK j;  1HK9 A;  5GAM f;  3ICA A;  4M78 D;  5LJ3 j;  5LJ5 j;  1WQ7 A;  1NJ2 A;  2Q5H A;  3VQV A;  1JRI A;  2DTH A;  4M75 E;  1LYL A;  5GAM j;  3BW1 A;  2ZNI A;  4A53 A;  5GAN h;  4CS4 A;  4H2S A;  4C8Q E;  2VXE A;  4UPA A;  3V7S A;  2XTI A;  4YDQ A;  1PYS A;  4UP9 A;  3RER A;  5DY9 A;  3REX A;  3RUX A;  4XTW A;  4MMK A;  2ZIO A;  3LSS A;  4UP7 A;  3JCM P;  4RMF A;  4PJO G;  2ZR3 A;  2ODR D;  2E5A A;  1M8V A;  4M78 G;  4YYE A;  1PYS B;  3JCM g;  1HXD A;  4NCX A;  4YRN A;  3PZC A;  2FYK A;  4J6X A;  3JCM W;  2I4M A;  3HXV A;  1I4K 1;  2VXF A;  2XGT A;  4YRL A;  4M77 A;  1W66 A;  3EFS A;  4M75 F;  4M77 C;  5LJ3 g;  2QHT A;  3HXY A;  2I2L A;  1EOV A;  4H2T A;  1SET A;  3BJU A;  2DJZ A;  4QVD A;  2CJA A;  4HVC A;  4KR3 A;  3KFU A;  1YCY A;  4M77 B;  4V2S A;  4XTV A;  3QNE A;  3JB9 G;  1VQZ A;  4P74 A;  1JBM A;  4E51 A;  4EO4 A;  4P74 C;  2ZNJ A;  1BBW A;  1ASZ A;  3M4Q A;  3P8Y A;  4CH3 A;  2ARS A;  4M7D E;  1X54 A;  3INZ A;  4TWA A;  4YRM A;  3E9H A;  3BY7 A;  3L4G A;  2E64 A;  3HTZ A;  4H2U A;  5GAN 4;  3HFN A;  4C92 A;  2RA2 A;  3MF2 A;  1RIQ A;  4XEM A;  4C92 C;  12AS A;  5GAN d;  4M77 F;  5ELO A;  3A5Z A;  2EWN A;  3HFO A;  1Z7M A;  2J3M A;  4NOY A;  5CAI A;  2VC8 A;  4M77 D;  1E1O A;  4CH5 A;  3L4G B;  3E9I A;  4EMG A;  4XTX A;  1I8F A;  4J5Y A;  3WQZ A;  3RGL A;  4C92 B;  1WLE A;  4CS3 A;  4DPG A;  1I5L A;  3V8K A;  1YFT A;  1SER A;  2DEQ A;  3HFV A;  4P72 A;  4YRG A;  1MGQ A;  1NNH A;  4P72 C;  4O2D A;  4OLF A;  3QSU A;  3JCM c;  2P0L A;  2ART A;  2K57 A;  1KQ2 A;  4M7D F;  1Z7N A;  4X5O A;  1H4T A;  4J6Y A;  1USY A;  3QUI A;  4M7D D;  3I7F A;  3V8L A;  1USY C;  1G5H A;  1X2G A;  3IG2 A;  5LJ3 f;  4C92 F;  5LJ5 f;  2ZR2 A;  4M77 G;  3RKW A;  1L0W A;  4C92 D;  1NJ6 A;  5HGQ A;  3TEG A;  4HWP A;  2Y90 A;  3UFG A;  2QTX A;  1M5Q 1;  1ASY A;  4CH4 A;  1NJ5 A;  4HWT A;  2YLB A;  4KR2 A;  3HXZ A;  4TQF A;  5GAO n;  2G4C A;  5KNN A;  3JB9 J;  4M75 A;  2RHQ A;  4A54 A;  1LOJ A;  1N9W A;  4M75 C;  5GAO m;  5GAN 2;  3QO7 A;  5GAN 3;  4PHC A;  4K87 A;  3TUP A;  2DKG A;  4YRC A;  4HWR A;  4HWS A;  3IKL A;  4XQ3 A;  5GAN g;  3AHU A;  4YRI A;  4RCB A;  4M75 B;  3L1A A;  2RHQ B;  4P3N A;  2ZZE A;  4P75 A;  3FIF A;  4C92 G;  4WJ3 M;  3A7R A;  3L2Z A;  3NEL A;  3NET A;  4P75 C;  3PCO A;  1YFS A;  2ZXF A;  4YP0 A;  4G85 A;  3FJP A;  5K1P A;  2YLC A;  3NEN A;  3QHS A;  2CJ9 A;  2ZIN A;  5E3I A;  4XTY A;  11AS A;  4H02 A;  2ARU A;  1TH7 A;  4H2Y A;  3HSB A;  5GMK m;  1HTT A;  2HNI A;  5GAM e;  3ERR A;  3LSQ A;  5ELN A;  1H4S A;  3PCO B;  4M7A E;  4BW9 A;  2DXU A;  2DVE A;  3A32 A;  4QVC A;  5C51 B;  3QTC A;  1Y96 A;  1KMN A;  4M75 D;  3M4P A;  2Q7E A;  1X56 A;  4YRQ A;  4C8Q F;  3FB9 A;  1U1T A;  2CJB A;  3UGQ A;  3V7R A;  1I81 A;  1B76 A;  4YRT A;  4C8Q D;  1X01 A; 
#chains in the Genus database with same CATH topology
 5GJW B;  3TRE A;  2NUP A;  3RKX A;  5GAO l;  2EQU A;  3IKM B;  3C0C A;  4DOW A;  4LNP A;  2IG0 A;  3EG1 A;  3EG3 A;  1RAF B;  2CGH A;  2KK4 A;  1OX8 A;  4MML A;  2OTL A;  1JJC A;  3VS0 A;  2EGE A;  4E7I A;  3HXX A;  2O4X A;  4MDW A;  5C6S A;  2CP6 A;  4IUP A;  4M7D C;  2RB6 A;  2EL9 A;  5FU7 C;  1NE8 A;  1N8R U;  4RUG A;  4TVW A;  2DET A;  4DA4 A;  1N9R A;  1M1G A;  3EAE A;  4YCV A;  3VQX A;  1X2K A;  2IVW A;  2CP0 A;  2QQA A;  1MUZ A;  3MO8 A;  1UUE A;  2DU5 A;  3QJY A;  1NPR A;  3NPF A;  2L3P A;  3M5A A;  2ALY A;  3OYB A;  1YJ9 Q;  3M0Q A;  3CCS A;  4RDX A;  5GAN 5;  1E1T A;  3MP1 A;  4LNS A;  2EJF A;  1KQS S;  1QCO A;  3EFO B;  3S6W A;  1TTH B;  3L2Q A;  1VQ5 T;  2LCS A;  4HT9 A;  1B7Y A;  4PJO E;  1Q82 R;  2DJQ A;  4A4H A;  2M0O A;  2A3L A;  1YJW T;  2QA4 T;  4BDZ A;  2FG0 A;  4HWO A;  1RAE B;  4OMO A;  1M2O A;  4IIO A;  2QG9 B;  2MPX C;  1VQ4 A;  1VQ7 Q;  2E65 A;  4IUV A;  1C0A A;  1WHJ A;  2VAS A;  1MND A;  4FT4 A;  3PGG A;  1KD1 C;  1N6A A;  2KR3 A;  1VQ8 T;  2XG8 D;  2IY5 A;  2ZTG A;  2P0K A;  2RHU A;  3JB9 H;  1EVK A;  1N8R R;  5LJ5 d;  4CH6 A;  1N27 A;  5CQX A;  4EMK C;  4D6W A;  3RIR A;  2Y4X A;  4DEY A;  5GAM d;  1AZG B;  1VQ5 Q;  1NM7 A;  4PJL A;  5J3B A;  2DYI A;  2QHV A;  2K2V A;  1QVP A;  4OMN A;  3RES A;  4C8Q C;  4ZIB A;  1NYF A;  2DXC A;  3JCM V;  1OOT A;  4PJM A;  1KG1 A;  4LXC A;  2DBM A;  2CP7 A;  4ZNX A;  1JO8 A;  3CCR Q;  1OZ2 A;  2V26 A;  5GMK e;  3JSC A;  3OYA A;  2ZCE A;  1WJQ A;  5LJ5 e;  1Y71 A;  2ED0 A;  2F1L A;  4B9X A;  4XTZ A;  3QO8 A;  1UHF A;  3CCV Q;  1K4U S;  4PG3 A;  2GCX A;  3MF1 A;  4M7A A;  1YN8 A;  1ZSZ A;  3JB9 F;  3VQW A;  3M4G A;  5DLQ E;  3REB B;  1WA7 A;  2QEX T;  3NEM A;  4JLG A;  3OS1 A;  4KH0 B;  1HSQ A;  1WYD A;  1NJ8 A;  2D8J A;  2EGC A;  4KGZ B;  4ZTZ B;  2FPD A;  2ZCF B;  5HCK A;  2HCK A;  4C0D C;  2XU8 A;  4K11 A;  4C5H A;  2KAF A;  3JCM J;  3G4S A;  2RH2 A;  1PCX A;  2AKK A;  1NEB A;  2YHT A;  5GAO q;  1BK2 A;  2CS7 A;  4D8D A;  2HQE A;  3MJX A;  5LJ5 g;  2NYS A;  4HT8 A;  4AFS C;  4RKU E;  3P8D A;  3HXW A;  1EQR A;  1E6H A;  5GAM g;  3M53 A;  3ZFJ A;  1BCO A;  2O9V A;  4M7A F;  1H4V B;  1VQL T;  2ZZF A;  4NL3 A;  1IXD A;  1GCQ A;  2E1H A;  3CBM A;  4XU0 A;  2CP2 A;  2LNV A;  4TVA A;  1Y07 A;  2FPF A;  4DEX A;  2VYT A;  1K9M C;  4RTX A;  3WVD B;  1M27 C;  3QO3 A;  4C92 E;  4YCW A;  2ZT8 A;  1PKT A;  4L5G A;  1WHG A;  4FW2 A;  3HY0 A;  1HC7 A;  2KRO A;  4N0A C;  3GIB A;  4HKE A;  1YBY A;  2K7A A;  2NUZ A;  3IAL A;  4JJB A;  1EIF A;  3VV0 A;  2CZ1 B;  2R58 A;  4M78 C;  3EGX B;  4TQD A;  2RJF A;  2OJ2 A;  1LVK A;  3EHQ A;  5CKB A;  1RAI B;  4LDY A;  1EVL A;  4N4I A;  1K0X A;  4QQ6 A;  2DIL A;  2K79 A;  2MAM A;  3A74 A;  1JQQ A;  4EPC A;  3MEY A;  1MV0 B;  3RKY A;  1Q7Y R;  3UGT A;  1PKS A;  2ZT5 A;  2J6F A;  4P73 C;  2QDY B;  1QWF A;  2VGM A;  2I0N A;  1QW1 A;  1H64 1;  4WTO B;  3IQL A;  2ZPE B;  1SSF A;  2ODR C;  3GOX A;  1GCP A;  2VV5 A;  2PUO B;  3SWN B;  2DO3 A;  1LCK A;  2CKK A;  2XK0 A;  4M78 D;  5LJ3 j;  4JS4 A;  1C6V X;  4EIK A;  5CO7 A;  2OTL T;  2Q5H A;  3VQV A;  3EGU A;  2RHX A;  1JRI A;  2D0Q B;  1WDX A;  1X2Q A;  2ZNI A;  2E12 A;  3EGD B;  2LMJ A;  4CS4 A;  4H2S A;  4AMC A;  2XTI A;  1VOM A;  4YDQ A;  2LTO A;  4UP9 A;  4VUB A;  1TS9 A;  4O5V A;  2X4Y A;  1KHI A;  4F14 A;  3LSS A;  4RTW A;  3CCS T;  4FL6 A;  3GNF B;  2KXC A;  2CUD A;  4PJO G;  3R6N A;  2ZR3 A;  2ODR D;  1Q86 U;  1K73 C;  1X43 A;  3HL8 A;  4UC4 A;  1GBR A;  1HXD A;  3VS6 A;  4KGX B;  2I4M A;  1I4K 1;  3CC7 Q;  1IGU A;  1WJS A;  3MEW A;  3X25 B;  1RAB B;  1M30 A;  2YRV A;  3MQZ A;  1OI1 A;  4Y92 A;  1IHW A;  1VQ4 T;  1UGV A;  2X4J A;  2M1H A;  5LJ3 g;  2EVR A;  4Q5W A;  2CT4 A;  3HXY A;  4H2T A;  3BJU A;  2DJZ A;  4HVC A;  6AT1 B;  5CQY A;  2KEA A;  2KQW A;  2KVQ G;  4M77 B;  4BD3 A;  1KC8 C;  4XTV A;  2CYZ B;  1VQZ A;  4RTY A;  2PQW A;  4P74 C;  2WSF E;  3PFS A;  1QVF P;  4LVM A;  2FL7 A;  1BBW A;  3M4Q A;  3P8Y A;  4CH3 A;  3CCS Q;  1Q95 G;  4CC3 A;  4M7D E;  2C0O A;  3L4G A;  3BY7 A;  1SKU B;  2LVM A;  3UA7 A;  3MET A;  4LN2 A;  3GLX A;  4ANJ A;  4OB2 B;  4J9D A;  5ELO A;  3AT1 B;  1Z7M A;  4ZTJ A;  1BI1 A;  1TU0 B;  3CD6 A;  2RI3 A;  1OQK A;  1SHG A;  3O5Z A;  3VS1 A;  3E9I A;  3M4Y A;  3QII A;  5KYW A;  1YJ9 A;  2X3W D;  3KXT A;  2WAC A;  4YRG A;  1B3Q A;  1NNH A;  1R8O B;  1XOV A;  2DIQ A;  1OZ3 A;  5FLX E;  5HKC A;  4GY5 A;  4FSX A;  2ART A;  2K57 A;  1HD3 A;  2BZX A;  2LP5 A;  3OYD A;  2K5L A;  1USY A;  1PD0 A;  3OYC A;  2COZ A;  4QQG A;  1X2G A;  2CRE A;  3FEO A;  3DKM A;  1AT1 B;  3RKW A;  2QQB A;  1NJ6 A;  1VQ7 A;  2K9G A;  2CUB A;  2GNC A;  2SRC A;  3G4S T;  5J26 A;  4CH4 A;  2PZ1 A;  4LD6 A;  3CME Q;  5CVI A;  3MP8 A;  3I5R A;  2RHQ A;  4LVK A;  4M75 C;  4BAC A;  1G3Y A;  3TUP A;  4PFZ A;  2O9S A;  2PUK B;  1NJI R;  4HWS A;  4AT1 B;  3IKL A;  1W2B P;  2QQR A;  1YP5 A;  3OYM A;  3BDL A;  1BKB A;  3L1A A;  4P75 A;  4C92 G;  3NEL A;  3PCO A;  2ZPH B;  3LH0 A;  3CCR A;  5K1P A;  4BE1 A;  3NEN A;  2ZIN A;  1VQP Q;  3VUB A;  2MCN A;  3URG A;  3UT1 A;  2ARU A;  4CI0 C;  3QZ9 B;  4J7I A;  1HTT A;  2HNI A;  3LSQ A;  1H4S A;  5IN1 A;  1KIK A;  4BW9 A;  3CCV A;  4X1V A;  5CCA A;  4Z89 A;  1R77 A;  4F16 A;  5I22 A;  1QP2 A;  2A08 A;  1BU1 A;  4M75 D;  4IUR A;  3M59 A;  3CPW P;  1X56 A;  4OML A;  4JJC A;  1QKW A;  3UGQ A;  1B7T A;  3V7R A;  2FO0 A;  1FYN A;  4PFP A;  5LJ3 h;  1Y96 B;  4X34 A;  3GBQ A;  3A7U A;  2ED1 A;  4XU3 A;  2MMP A;  1W70 A;  2YXY A;  4Y91 A;  3M55 A;  4F7U E;  2MK5 A;  3X26 B;  1YB3 A;  1BI3 A;  2FZC B;  3I55 A;  2VUB A;  3QO5 A;  3JV3 A;  1ZUU A;  2C06 A;  1X75 C;  3CEY A;  3EFO A;  3SDZ A;  5GAN f;  1B8A A;  4PLI A;  2FZK B;  1A0N B;  2JTE A;  3CCJ A;  2KI7 A;  4FIB A;  2FRW A;  1Q82 C;  1YIJ Q;  2EQI A;  3GP8 A;  4B9W A;  5GAN j;  5KYY B;  3GPL A;  4BDY A;  1BBU A;  2LJ3 A;  2DD4 A;  3HPW A;  4YRO A;  4M78 E;  4LUD A;  2JOY A;  2JZ2 A;  4J9I A;  4AFQ C;  1NG2 A;  5A0G A;  4JZ4 A;  4WI1 A;  4L87 A;  3VYG A;  2GGR A;  5HK3 A;  1QLY A;  4JRQ A;  1YJN T;  1M1K R;  1K0S A;  2RI2 A;  1OPK A;  4BY6 C;  2H3E B;  3EH2 A;  4YCU A;  1ADY A;  4KUD K;  1R0B G;  1OU8 A;  3ER0 A;  3SHW A;  4H2V A;  1N8R C;  2EYW A;  2AKW B;  1OX9 A;  4FW1 A;  4BI8 B;  4QQD A;  2HSP A;  4EX5 A;  5AYF A;  2R57 A;  2Q7H A;  2XKO C;  1YFR A;  1YI2 Q;  4MDX A;  4ZGJ B;  1UEC A;  1TUG B;  1G83 A;  2OI3 A;  3JCM X;  1ZX6 A;  3QYG B;  4ZGE B;  3A8G B;  4PFO A;  2EKH A;  4G84 A;  2J06 A;  4M7D G;  2K3Y A;  1B70 B;  2M0Y A;  2DTO A;  3UH0 A;  4J15 A;  5IXF A;  2KDS A;  1Q81 U;  4BE2 A;  1NPP A;  3P8V A;  2BE9 B;  4KUI A;  3KUF A;  4GLK A;  5GAO p;  1W2B A;  2RN8 A;  1QCF A;  4IUQ A;  1KK7 A;  1F1B B;  1D3B B;  1NYQ A;  2RD1 A;  1BI2 A;  2KT8 A;  3CD6 T;  2DYB A;  3NMZ C;  2DQ0 A;  1KMM A;  1N5Z A;  3JCM h;  3OYL A;  1IB8 A;  4M7A C;  1ZSZ C;  3MCA B;  4LDU A;  3JB9 D;  1YJ9 T;  2EW3 A;  1VQK Q;  1Y57 A;  3M0R A;  2DK3 A;  5IHI A;  1G51 A;  3VBB A;  4N4G A;  1AWX A;  3OYY A;  4J9C A;  1B34 B;  3A8H B;  2PNI A;  4J9B A;  4KRT A;  1FYF A;  2RI5 A;  1X55 A;  4Q15 A;  2V1R A;  3A31 A;  3CC7 A;  3HRT A;  2PME A;  1WHH A;  2KYM A;  1KHC A;  2HKQ B;  4J9E A;  3CPW A;  3LX7 A;  1FWZ A;  2JTM A;  2DL7 A;  1G5I A;  2DLP A;  2RF0 A;  2GQV A;  3LW5 E;  1VQ7 T;  4JUV A;  5FU6 C;  2I4L A;  3QKJ A;  3S3N A;  2J3L A;  4OP0 A;  1V76 A;  1KSW A;  1Q81 R;  2R5M A;  3LYI A;  1EFW A;  3CD6 Q;  3MKD A;  3REU A;  2O2O A;  4E2F B;  4M7A D;  4C8Q G;  4X9D A;  1GCQ C;  1ZSG A;  3HKS A;  1G5V A;  1O9S A;  1PC0 A;  2RMO A;  4R55 A;  3OD1 A;  1BI0 A;  3VS3 A;  2F69 A;  3EGX A;  1WXB A;  1AWO A;  1K76 A;  1WU7 A;  3A1P A;  3E9G A;  4LVL A;  3NFC A;  3KBG A;  4LVI A;  4H2W A;  4JRP A;  3CCR T;  4Z8A A;  3EG0 A;  3EFR A;  2KNB B;  1V1C A;  1LJO A;  1W2B S;  1H92 A;  3HY1 A;  3VS2 A;  4J9G A;  3HTR A;  2X4W A;  4YTL A;  1WQW A;  4PJO B;  2RHS B;  2XDD A;  3QJ6 A;  1VIF A;  2DL5 A;  2QYZ A;  2RQW A;  3CCV T;  1YCS B;  1JU5 C;  5L8R E;  5A0L A;  4OVA A;  3G6E Q;  1RUW A;  3FLG A;  2G6F X;  4RCC A;  3SWN A;  1UTI A;  4MZM A;  1EIY B;  2E41 A;  3UDC A;  3OBW A;  3CCU Q;  2F5K A;  4EMH A;  2BZY A;  4LDX A;  2CIM A;  3M0S A;  2SEM A;  1TWB A;  2P84 A;  3I9Q A;  4J83 A;  1KJW A;  3C95 A;  2AMC B;  1IL2 A;  3F70 A;  4FCY A;  1D1B A;  1H4Q A;  1NEG A;  4AFZ C;  4YRJ A;  2GFA A;  2X9H A;  4F7U G;  3HRI A;  4K86 A;  1T0H A;  2JUF A;  3EGD A;  5GMK j;  1HK9 A;  3CPF A;  5GAM f;  3OS0 A;  3CPW S;  3ICA A;  1FMV A;  1UHC A;  5LJ5 j;  4FT2 A;  3RMQ A;  4ELZ C;  2HEQ A;  3RDV A;  4M75 E;  3CME A;  2LQW A;  5GAM j;  3BW1 A;  3PNW C;  4A53 A;  2JS0 A;  2D9T A;  2DL4 A;  3HHT B;  1XQH A;  5M9O A;  2COW A;  2M9U A;  5GAN h;  2P0Q A;  2BZ8 A;  5KYN A;  1OV3 A;  2MOX A;  2LRQ A;  1X6O A;  4PJN A;  1WGS A;  3REX A;  3ULR B;  3CCJ T;  1EFN A;  5IHK A;  2EPD A;  4OMF B;  2COY A;  4M78 G;  4YYE A;  1PYS B;  4NCX A;  4YRN A;  1CSK A;  2B8A A;  1TUD A;  2FYK A;  3JCM W;  1VQP A;  3L2R A;  3M0T A;  4HCB A;  2VXF A;  1OEB A;  5KCO A;  2HZY A;  2R5A A;  2XGT A;  1NLP C;  4M77 A;  4FU6 A;  3EFS A;  2CZ0 B;  4FYW B;  4JZ3 A;  4DBR A;  2PTK A;  2QHT A;  1JB0 E;  1Q7Y U;  2I2L A;  3I55 Q;  1EOV A;  4KR3 A;  1PG5 B;  1YCY A;  3GF5 A;  3J81 E;  1U06 A;  1JBM A;  3RNJ A;  1G3T A;  2D0N A;  2KYB A;  2MI6 A;  3OQ5 A;  3I56 Q;  2LT1 A;  2ZNJ A;  3CCJ Q;  1M9S A;  4Z88 A;  3OYJ A;  2DRK A;  1I07 A;  2ARS A;  1S72 A;  1X54 A;  4IUT A;  4HVW A;  3INZ A;  3OS5 A;  3QWX X;  3CXC A;  1KD1 U;  1VQ9 Q;  3E9H A;  4YRM A;  2HL3 A;  2JM9 A;  4JDS A;  1Q86 C;  5GAN 4;  3EH1 A;  2ENM A;  2LCC A;  4M77 F;  3P8H A;  5CAI A;  1MMA A;  3QWY A;  4EMG A;  2AKL A;  1AWJ A;  3WQZ A;  1U8R A;  4C92 B;  2LT4 A;  5CK9 A;  1WLE A;  4CS3 A;  2HSE B;  1SER A;  2DEQ A;  1YIJ A;  4P72 A;  1CKA A;  2RJC A;  3WXM B;  1MGQ A;  1OYX A;  2A0F B;  4IKF A;  3M9Q A;  3JCM c;  3LWI A;  2P0L A;  1KQ2 A;  3FRN A;  4M7D F;  5EG2 A;  3ME9 A;  2CZ6 B;  2IPO B;  3V8L A;  1USY C;  1G5H A;  5LJ3 f;  2BTT A;  3A8M B;  1D09 B;  2RHZ A;  5HGQ A;  1RI0 A;  1X27 A;  1UE9 A;  3CC7 T;  1JXO A;  4XK8 E;  1UGS B;  2Y90 A;  2LQN A;  4HCZ A;  2ABL A;  2QTX A;  2L3S A;  2HD0 A;  2ZPF B;  1ASY A;  3LLR A;  4J9H A;  3CC4 Q;  1KD1 R;  2AZS A;  3MEA A;  3HXZ A;  5KNN A;  3TVT A;  3JB9 J;  2WSC E;  3G1J A;  4BB7 A;  2KT1 A;  1N9W A;  3QPH A;  1Z9Q A;  1YI2 A;  3O8V A;  3HRU A;  1RI9 A;  5GAN 2;  5GAN 3;  3DB3 A;  1PNJ A;  4HWR A;  4YRC A;  2K5F A;  4QVZ A;  1FMK A;  3OB9 A;  3H8Z A;  4RCB A;  4WJ3 M;  2ZZE A;  3FIF A;  5CKE A;  4ESR A;  1H3H A;  2NS6 A;  3A7R A;  4P75 C;  2MWP A;  2KRN A;  3CXC S;  1YFS A;  4OMM A;  2YLC A;  2CJ9 A;  5E3I A;  2RNA A;  4XTY A;  3EG9 B;  1NLO C;  4H2Y A;  3HSB A;  5GMK m;  4FM4 B;  5ELN A;  4KUL A;  4R56 A;  1PD1 A;  4M7A E;  4J7F A;  4RMO A;  2DXU A;  1VQ6 A;  2FZG B;  3PVQ A;  4QVC A;  5C51 B;  1O75 A;  3C94 A;  1K1Z A;  1WLP B;  1Y96 A;  2L3R A;  1QWE A;  3M4P A;  2Q7E A;  2D6F A;  4C8Q F;  3FB9 A;  1U1T A;  1X6G A;  1VQK A;  2CJB A;  3THK A;  2K2M A;  4YRT A;  2KSS A;  4OGC A;  1PWT A;  2EAY A;  2WSE E;  2GQI A;  2ROL A;  3MP6 A;  5KYX B;  5LJ5 h;  3A98 A;  3TQ7 P;  2DXT A;  2O31 A;  4X9C A;  1PM3 A;  2FEI A;  2QTV A;  3G1Z A;  3R07 A;  1VQO A;  5C52 B;  3E1S A;  3H0F A;  5GAM h;  2J05 A;  4KH1 B;  1LPL A;  4YRK A;  1SRM A;  1WPY A;  2BE7 D;  2DDZ A;  2RHI A;  4WJ4 A;  2C7I A;  2DZ9 A;  2DBK A;  4YRS A;  1K9A A;  1RLP C;  2XMF A;  4M75 G;  1E6G A;  1GGM A;  2B86 A;  3CMQ A;  5KYY A;  1OU9 A;  4M7D B;  4ORZ A;  4OMQ A;  1TSF A;  3CME T;  1SHF A;  4P3O A;  5D6W A;  3OYE A;  1JJ2 A;  5FU7 B;  1NJI U;  1M90 C;  5DLO A;  3BDU A;  2GFU A;  5F5W A;  4MZP A;  3JCM f;  4ZGD B;  3CMA Q;  3PIO A;  2E70 A;  3SEM A;  5FRO A;  2DM1 A;  5GAN 8;  1TXQ A;  4F7U F;  3OA6 A;  3E9F A;  1IRE B;  2JMA A;  4H2X B;  2ZT6 A;  2FRY A;  2CSQ A;  2I4N A;  4KQE A;  3RL6 A;  2AKW A;  2C0T A;  2EJ9 A;  1VQP T;  1WYX A;  3CCQ A;  2CH4 W;  3HRS A;  2RQU A;  2QDL A;  3A8L B;  4L59 A;  2E3C A;  4JLI A;  3UA6 A;  3SFM A;  4P3P A;  2DX1 A;  3C12 A;  4Y28 E;  3G6E A;  2LX9 A;  4CS2 A;  1B70 A;  3CCU A;  1KOG A;  2QI2 A;  4RQF A;  2DIG A;  2QHU A;  2EKO A;  4XAX B;  5A2Q E;  1NYG A;  3JCM e;  4J8O A;  5CKF A;  1M2V B;  2H8H A;  3P8B B;  4RTV A;  4M78 F;  4XTU A;  1MMN A;  4EDU A;  1AEY A;  4EMK B;  1RL2 A;  4RG8 A;  1UEB A;  2L5Q A;  3V7C A;  3A5Y A;  1D3B A;  5KYU B;  5I21 A;  4Q6G A;  4GLM A;  5HY6 A;  3HFZ B;  2NWM A;  2E3I A;  4C8Q B;  2YUP A;  3MEV A;  4ZTU B;  4NL2 A;  1AZE A;  3G71 A;  1GBQ A;  1UJY A;  2K5I A;  4P71 A;  2V8J A;  1B34 A;  1G3W A;  4FYX B;  5DM7 R;  4CC4 B;  1JJ2 S;  2ZGW A;  1SRY A;  3E2U A;  2P0P A;  3H41 A;  3OYH A;  1YIJ T;  4WF2 A;  3U23 A;  4P5N A;  4CC7 A;  2D1X A;  2YSQ A;  3EG2 A;  1WXT A;  3A7A A;  4PJJ A;  1S72 Q;  2DXB A;  1M1K U;  2CT3 A;  3I5S A;  2K4Y A;  4OGE A;  4C5E A;  2JN0 A;  4C0D B;  1BIA A;  2JMC A;  4IUU A;  1ACM B;  2JVV A;  4DOV A;  1MMD A;  1Q81 C;  2DRM A;  3QG1 A;  3M54 A;  1B07 A;  1BIB A;  3ZEH A;  3DSQ A;  1E24 A;  2K6D A;  4F7U B;  3OW2 A;  2Q5I A;  1KC8 R;  1S1N A;  3I56 A;  1UJ0 A;  5C53 B;  5CIU A;  4YRE A;  2RM4 A;  3CCM A;  3FJ5 A;  1YI2 T;  1MMG A;  1X6B A;  3TEH B;  5KE3 A;  1VQ9 A;  1ADJ A;  3OS2 A;  3HRK A;  1SG5 A;  4PJO A;  2RHS A;  4AH6 A;  5CR2 A;  2AHJ B;  3QXE B;  3BE3 A;  2A7Y A;  3P8T A;  2YWW A;  3LGL A;  3RAC A;  2GF7 A;  1SES A;  1QE0 A;  5K1X A;  4JRK A;  3VUZ A;  1EIY A;  1MV3 A;  2VWF A;  4M7A G;  3CC2 A;  3OMC A;  2DU7 A;  1R0C B;  4M78 B;  3CBO A;  2OTJ Q;  1WHL A;  2AMC A;  2HL5 C;  2I4O A;  3TU4 K;  2HMA A;  2KGT A;  3W3S A;  3DLL A;  5GAN e;  1WJR A;  1J5W A;  3SWN C;  1VQK T;  4CC2 A;  2NUT B;  3RR6 A;  2L3Q A;  5L23 A;  1U1S A;  2RQR A;  2LX7 A;  3L2W A;  2L89 A;  4PJO F;  1AOJ A;  4BI3 A;  3WVE B;  2JT4 A;  2H3J A;  1YWO A;  2X51 A;  1VQO T;  1WQ7 A;  4N4H A;  5GJV B;  3ASK A;  3CC4 A;  5AT1 B;  2DPP B;  1BB9 A;  3M56 A;  3KFV A;  2XIC A;  1LYL A;  3TEE A;  3X24 B;  2E5Q A;  2YRC A;  3VS5 A;  2ZZD A;  2VXE A;  1YIT Q;  2HBP A;  3V7S A;  3OW2 S;  1PYS A;  2ESW A;  5DY9 A;  1VQ6 Q;  3RER A;  2XID A;  2QGF B;  4XTW A;  4LDW A;  2QQS A;  4MMK A;  1C1A A;  2XDP A;  4E7S A;  2E3H A;  1I1J A;  2QAZ A;  2IIM A;  2MWO A;  1UDL A;  5FRM A;  4GBQ A;  3PZC A;  4FYY B;  3D7S B;  8ATC B;  4JJN K;  2BUD A;  4LDV A;  1IZ6 A;  3X20 B;  2CP5 A;  4OF1 A;  1ABO A;  4E7H A;  1VQO Q;  1W66 A;  2KBT A;  4M75 F;  3PMI A;  4M77 C;  2J6K A;  4MZT A;  2EYX A;  4JJD A;  4HVU A;  4QVD A;  3OMG A;  3R6O A;  1QVG A;  3VS7 A;  2ECZ A;  5CKD A;  3CXC P;  2HDA A;  4E51 A;  3G6E T;  3C4S A;  1M3C A;  5C0M A;  2MYS A;  3CCU T;  2CDT A;  3EHR A;  2DA9 A;  3ZBD A;  4TWA A;  1T3S A;  1YHQ Q;  2E64 A;  3VKI A;  4FYV B;  3TSZ A;  2DEU A;  3HTZ A;  4D8K A;  4H2U A;  4C92 A;  3MEU A;  1W6X A;  2RA2 A;  1ZA2 B;  2L0A A;  4XEM A;  1VUB A;  2EWN A;  3HFO A;  1VQM Q;  4NOY A;  4OB3 B;  2VC8 A;  4M77 D;  1XTD A;  2A36 A;  2DL3 A;  1OPL A;  2K3X A;  1I8F A;  2PVO B;  5IXB A;  3CCQ Q;  1AWW A;  2X4X A;  3H6Z A;  3G71 T;  1H3Z A;  1I5L A;  3A5Z B;  3V8K A;  1Q7Y C;  3HFV A;  5I2S A;  1BYM A;  4P72 C;  3CMA A;  4OLF A;  2VVK A;  2YT6 A;  1BBZ A;  4OMP A;  5IHN A;  2LCL A;  4L6V 5;  2HQX A;  1K8A U;  2YDL A;  1Z7N A;  4X5O A;  4J6Y A;  1IO6 A;  4M7D D;  3I7F A;  2AK5 A;  2ROT A;  5LL6 S;  5D6X A;  3IG2 A;  4C92 F;  5LJ5 f;  3GNG A;  2F2W A;  1UGR B;  3TEG A;  3PVL A;  4C5G A;  4HWP A;  2V8K A;  2GTJ A;  1YWP A;  3NHN A;  3UFG A;  2DD5 A;  4KBM B;  2JXB A;  2OX7 A;  1GL5 A;  1MHN A;  1ABQ A;  4PLL A;  1NJ5 A;  2E6Z A;  4HWT A;  4KR2 A;  4DBQ A;  2G4C A;  2RK1 A;  3I55 T;  2HKN A;  1QVG S;  2M51 A;  3G71 Q;  1VYT A;  2O01 E;  2JM8 A;  4A4G A;  4M4Z A;  1EX4 A;  2QQ9 A;  4PHC A;  2DKG A;  3H0I A;  3L2V A;  1ARK A;  3PIP A;  2Z0W A;  1WIE A;  3I56 T;  2RJE A;  3EG9 A;  2LJ0 A;  4YRI A;  3CCM T;  4M75 B;  1YJW Q;  4P3N A;  2QA4 Q;  7AT1 B;  3L2Z A;  3T9N A;  5IAY A;  1IRX A;  4E7L A;  2CSI A;  2ZXF A;  4YP0 A;  2ZPI B;  3QHS A;  1VQ9 T;  1PSE A;  4BUG A;  2EQJ A;  5ECA A;  11AS A;  1TH7 A;  1K8A R;  3CCL A;  4RTU A;  5GAM e;  3ERR A;  1VQ8 Q;  2E4H A;  1WFW A;  2DVE A;  2QGG A;  1AD5 A;  3A32 A;  2AT1 B;  2HBW A;  5I11 A;  5KYX A;  2DFU A;  1WXU A;  2ZPG B;  3CC2 T;  1KMN A;  3H9N A;  1BCM A;  3E19 A;  1M1F A;  2OAW A;  4C8Q D;  1X01 A;  2EBP A;  1GXI E;  4RTT A;  2KXD A;  2LDM A;  1YGB A;  3QZ5 B;  2RQV A;  4II1 A;  1Y7X A;  3CCM Q;  1TUC A;  4C0Z A;  2PMF A;  2KY9 A;  3JCM b;  5FRN A;  1NYR A;  1D0Z A;  4M7D A;  1WHM A;  1JJ2 P;  3VRZ A;  1ZBX A;  2NUP B;  3LH5 A;  4LE9 A;  2KRM A;  1M8M A;  2FPE A;  2P4T A;  4F17 A;  4LVJ A;  3CC4 T;  4A4F A;  1ATI A;  4E7K A;  1JJC B;  3CBP A;  3VJP A;  2O4X B;  3UF4 A;  2C0I A;  1E22 A;  3RMS A;  1QCN A;  3CC2 Q;  5J39 A;  4BWA A;  2QEX Q;  1I0C A;  4JPB W;  3FDR A;  1D0Y A;  4H2X A;  2CZ7 B;  4B6M A;  1KFZ A;  2ZT7 A;  1G3S A;  1ZQ1 A;  9ATC B;  2F2V A;  2V8I A;  2DZC A;  2P4R A;  3Q1J A;  2ALY B;  3VU3 C;  2LQK A;  3A8O B;  2VKN A;  2GTO A;  1QF6 A;  2DF6 A;  1RAC B;  1N9S A;  3NTI A;  4DQ2 A;  4JS5 A;  4QT7 A;  1SEM A;  1B7Y B;  4YRF A;  4YPF A;  4ELY C;  4A4E A;  3M58 A;  4TTV A;  3MHX A;  2A8E A;  2ZIM A;  4ME7 A;  5A0D A;  5GAO r;  1VYV A;  1ZBJ A;  5CKH A;  3TCJ A;  2CH4 A;  1U3O A;  2ZZG A;  4ATO A;  3N5B B;  3QDR B;  1VQL Q;  2OTJ A;  4C5I A;  4O6J A;  1VQN A;  1M2V A;  4RTZ A;  3OYG A;  5IT9 E;  1CKB A;  4K88 A;  1FX7 A;  4BY6 B;  5LJ3 d;  3V8J A;  1KQ1 A;  4EMK A;  2LNH B;  1NJI C;  5KYU A;  2DMO A;  3JAM E;  1JEG A;  3HFZ A;  2IY5 B;  2P5I A;  4C8Q A;  1YFN A;  3UAT A;  4BI4 A;  1G8X A;  1WZO A;  1E7O A;  3CCE A;  3OYN A;  1VA7 A;  3UPU A;  1MNE A;  5LJ3 e;  2YUN A;  4YRR A;  4UP8 A;  3TSW A;  4LUE A;  1PSF A;  2KE9 A;  3M0P A;  4HA8 A;  5GAN 7;  3JCM Q;  1YIT A;  2VGN A;  2EJG A;  4P71 C;  3OYF A;  1XJW B;  4PNO A;  1ZHI A;  1X2H A;  3JB9 I;  1K9M U;  2DL8 A;  1ZLM A;  4HCC A;  1EZZ B;  1J3T A;  5D7U A;  3HP9 A;  1NZ9 A;  5KE2 A;  3CMA T;  2XDB A;  4M7A B;  3OBY A;  5GMK h;  1ZSZ B;  2LZ6 B;  1YJN A;  4LD9 K;  1D1A A;  1D0X A;  1PHT A;  4M77 E;  2FVU A;  2A37 A;  3HXU A;  1LNX A;  2OTL Q;  1JXM A;  3OW2 P;  1NJ1 A;  4F7U A;  2FB7 A;  1UGQ B;  2QK0 A;  3VYH B;  4TVY A;  4J9F A;  1UFF A;  2AIR B;  4YRP A;  4HT4 A;  1W4S A;  2FHD A;  4PL6 A;  3FC3 A;  3TEH A;  5FU6 B;  3RF1 A;  4XEO A;  2RHY A;  2LQ8 A;  5GMK l;  2DTI A;  3PE0 A;  4AG1 C;  3G7Z A;  1QKX A;  2QHS A;  3UWN A;  5HK0 A;  3VQY A;  3H0H A;  1G2B A;  2YRD A;  3CQT A;  4J6W A;  1YHQ A;  1K9M R;  1WI7 A;  1OUL A;  4C0G A;  1WNL A;  4TVA B;  4N0A A;  1RAG B;  1Q86 R;  4XU2 A;  3JRZ A;  4PJO C;  2RO0 A;  4M78 A;  1VQM A;  4OB0 B;  5GMK i;  1VQ4 Q;  3BFM A;  4KGV B;  3S3M A;  1M1K C;  4E47 A;  4RQE A;  4R0K A;  3JCM d;  5GAN 6;  1M3B A;  1M4Z A;  3CCL T;  4AG2 C;  1WX6 A;  2NUT A;  2E5K A;  2DQ3 A;  2D8H A;  2BIV A;  3SB2 A;  3OY9 A;  4P73 A;  2E10 A;  1SRL A;  1K73 U;  2BKD N;  1SSH A;  1Y0M A;  4XU1 A;  4KT0 E;  4JRI A;  3VRY A;  3NTK A;  2C8M A;  3OSV A;  4QKU A;  3LC0 A;  4PK4 A;  2Q7G A;  4PJO D;  1YNZ A;  3J80 E;  2J7I A;  3L2U A;  2RK2 A;  4PKC C;  1S72 T;  1KQS P;  1NJ2 A;  1PRL C;  4ZN3 A;  2DVJ A;  2ATC B;  2VB6 A;  2DTH A;  2QAS A;  3LWH A;  2JJ9 A;  2QXF A;  4E6R A;  1KC8 U;  1Z9Z A;  4C8Q E;  3CCL Q;  2EIF A;  4IIM A;  3M57 A;  4UPA A;  5I2M A;  2HQH A;  2A28 A;  4Z02 A;  3RUX A;  1VQ5 A;  2F5T X;  1WHK A;  1W1F A;  3I35 A;  3VS4 A;  2ZIO A;  1RLQ C;  4BE0 A;  2JTF A;  4UP7 A;  2MF2 A;  2DE0 X;  3JCM P;  5IH2 A;  2GBQ A;  1YJW A;  4RMF A;  2QA4 A;  2E5A A;  1M8V A;  3JCM g;  2JS2 A;  3QYH B;  4J6X A;  3ZL7 C;  1HYO A;  2G3R A;  1K73 R;  3HXV A;  4TVR A;  2PU9 B;  5KCH A;  4ZTF A;  3G4S Q;  2DNU A;  4RG2 A;  1QVG P;  3LGF A;  1M90 U;  4YRL A;  1VQ8 A;  2RPN A;  2MIO A;  1QP3 A;  2EYZ A;  1U5S A;  3MPU B;  3OYI A;  1NBE B;  8AT1 B;  3QDF A;  1SET A;  3OYK A;  1X69 A;  2CJA A;  4DBF A;  1RAH B;  3KFU A;  1IGQ A;  3NGP A;  4A63 B;  2OTJ T;  1HJD A;  4V2S A;  3S3O A;  3QNE A;  3JB9 G;  1VQN T;  4P74 A;  4EO4 A;  2CP3 A;  2DAQ A;  3DLM A;  4C0F A;  2O88 A;  1ASZ A;  1VYU A;  1UB4 A;  2XHC A;  1ZUK A;  3X28 B;  1TOV A;  2M16 A;  2PVG B;  1GFD A;  3RBB B;  1GRI A;  2EYY A;  2HAX A;  4QW2 A;  2JW4 A;  3HFN A;  4E7J A;  1QVF A;  3MF2 A;  1RIQ A;  4C92 C;  1AHJ B;  1UGP B;  5GAN d;  12AS A;  2E6N A;  3CCE T;  3A5Z A;  1RAA B;  2J3M A;  1E1O A;  4WCI A;  2KMT A;  1DJ7 B;  1ZUY A;  4CH5 A;  3L4G B;  3L42 A;  4XTX A;  1XNI A;  2KRS A;  4J5Y A;  3RGL A;  2J6O A;  4ZN1 A;  2X3X D;  4A4K A;  4DPG A;  3SD4 A;  1M90 R;  3M0U A;  1P92 A;  2QEX A;  1YIT T;  1ZA1 B;  1YFT A;  1FXX A;  1IHV A;  1H8K A;  2EQK A;  1VQ6 T;  2NLU A;  5D6Y A;  1VQN Q;  2K3B A;  2W0Z A;  4O2D A;  1GFC A;  2RQT A;  3J7A F;  3QSU A;  3PMT A;  4CRI A;  5KYW B;  2XD0 A;  1H4T A;  2L8D A;  4DBH A;  1T3L A;  3QUI A;  2ZR2 A;  2M02 A;  4M77 G;  2EFI A;  1PRM C;  1L0W A;  1M3A A;  4C92 D;  3NTH A;  2RJD A;  3REA B;  2AZV A;  4AFU C;  1M5Q 1;  3CCE Q;  3QBY A;  3PT9 A;  1VQL A;  2YLB A;  2LC4 A;  4TQF A;  5GAO n;  4M75 A;  2YUO A;  1T0J A;  1LOJ A;  4A54 A;  2LJ1 A;  5GAO m;  3QO7 A;  2YUQ A;  1D1C A;  5EC7 A;  1C0M A;  2F2X A;  4K87 A;  2EQM A;  1I5O B;  2EYQ A;  2PVD B;  1KQS A;  5FWC A;  1QQJ A;  4XQ3 A;  5GAN g;  5FW9 A;  2X35 A;  3AHU A;  1V29 B;  3DB4 A;  2RHQ B;  3NET A;  3OSS C;  4HCK A;  2EGA A;  2JNG A;  4FSS A;  4OB1 B;  4G85 A;  3FJP A;  4HXJ A;  1AVZ C;  1K8A C;  1YHQ T;  2DER A;  1SF9 A;  4F04 B;  1QVF S;  2OAU A;  4H02 A;  1YJN Q;  2V1Q A;  4HVV A;  1VIE A;  2L2P A;  1VQM T;  3PCO B;  1RAD B;  5KH6 A;  1SPK A;  1UG1 A;  2ZPB B;  4NS5 A;  2ZAE A;  5FWB A;  3PTA A;  3CCQ T;  1Q82 U;  2Y4Y A;  1FMW A;  3QTC A;  1QMC A;  4YRQ A;  2XI9 A;  1TG0 A;  1I81 A;  4E7Z A;  1B76 A;  2W10 A; 
#chains in the Genus database with same CATH homology
 3TRE A;  3RKX A;  5GAO l;  2EQU A;  3IKM B;  4DOW A;  2IG0 A;  2CGH A;  2KK4 A;  2OTL A;  4MML A;  1JJC A;  4E7I A;  3HXX A;  2O4X A;  4MDW A;  5C6S A;  4IUP A;  4M7D C;  2RB6 A;  2EL9 A;  5FU7 C;  1NE8 A;  1N8R U;  4TVW A;  4DA4 A;  1N9R A;  1M1G A;  3EAE A;  4YCV A;  3VQX A;  2IVW A;  3MO8 A;  2QQA A;  2DU5 A;  3QJY A;  1NPR A;  3M5A A;  2ALY A;  3OYB A;  4RDX A;  3CCS A;  5GAN 5;  1E1T A;  3MP1 A;  4LNS A;  2EJF A;  1KQS S;  1B7Y A;  3S6W A;  3L2Q A;  4HT9 A;  1VQ5 T;  4PJO E;  4A4H A;  2M0O A;  2A3L A;  1YJW T;  2QA4 T;  4BDZ A;  4HWO A;  1VQ4 A;  2E65 A;  4IUV A;  1C0A A;  4FT4 A;  3PGG A;  1KD1 C;  1N6A A;  1VQ8 T;  2XG8 D;  2IY5 A;  2ZTG A;  2P0K A;  2RHU A;  3JB9 H;  1EVK A;  5LJ5 d;  4CH6 A;  1N27 A;  5CQX A;  4EMK C;  4D6W A;  3RIR A;  2Y4X A;  5GAM d;  2QHV A;  5J3B A;  2K2V A;  1QVP A;  3RES A;  4C8Q C;  4ZIB A;  2DXC A;  3JCM V;  1KG1 A;  1OZ2 A;  5GMK e;  3JSC A;  3OYA A;  2ZCE A;  1WJQ A;  5LJ5 e;  1Y71 A;  4B9X A;  4XTZ A;  3QO8 A;  4PG3 A;  2GCX A;  3MF1 A;  4M7A A;  3JB9 F;  3VQW A;  3M4G A;  5DLQ E;  2QEX T;  3NEM A;  4JLG A;  3OS1 A;  1WYD A;  1NJ8 A;  4ZTZ B;  2ZCF B;  4C0D C;  2XU8 A;  4C5H A;  2KAF A;  3JCM J;  3G4S A;  2RH2 A;  2YHT A;  5GAO q;  2CS7 A;  2HQE A;  5LJ5 g;  4HT8 A;  4RKU E;  3P8D A;  3HXW A;  1EQR A;  5GAM g;  3M53 A;  3ZFJ A;  4M7A F;  1H4V B;  1VQL T;  2ZZF A;  4NL3 A;  2E1H A;  3CBM A;  4XU0 A;  2LNV A;  4TVA A;  1Y07 A;  2VYT A;  1K9M C;  3WVD B;  3QO3 A;  4C92 E;  4YCW A;  2ZT8 A;  4L5G A;  3HY0 A;  1HC7 A;  4N0A C;  3GIB A;  4HKE A;  1YBY A;  3IAL A;  1EIF A;  3VV0 A;  2CZ1 B;  2R58 A;  4M78 C;  4TQD A;  2RJF A;  5CKB A;  4LDY A;  1EVL A;  4N4I A;  4QQ6 A;  2MAM A;  3A74 A;  4EPC A;  3MEY A;  3RKY A;  3UGT A;  2ZT5 A;  4P73 C;  2QDY B;  2VGM A;  1QW1 A;  1H64 1;  2ZPE B;  1SSF A;  2ODR C;  3GOX A;  2VV5 A;  3SWN B;  2PUO B;  2DO3 A;  2CKK A;  2XK0 A;  4M78 D;  5LJ3 j;  4JS4 A;  5CO7 A;  2OTL T;  2Q5H A;  3VQV A;  2RHX A;  1JRI A;  2D0Q B;  2ZNI A;  2E12 A;  4CS4 A;  4H2S A;  2XTI A;  4YDQ A;  2LTO A;  4UP9 A;  4VUB A;  4O5V A;  2X4Y A;  1KHI A;  3LSS A;  3CCS T;  4FL6 A;  3GNF B;  4PJO G;  2ZR3 A;  2ODR D;  1Q86 U;  1K73 C;  3HL8 A;  4UC4 A;  1HXD A;  2I4M A;  1I4K 1;  1WJS A;  3MEW A;  3X25 B;  2YRV A;  3MQZ A;  1OI1 A;  1VQ4 T;  2X4J A;  2M1H A;  5LJ3 g;  4Q5W A;  3HXY A;  4H2T A;  3BJU A;  2DJZ A;  4HVC A;  5CQY A;  2KQW A;  2KVQ G;  4M77 B;  4BD3 A;  1KC8 C;  4XTV A;  2CYZ B;  1VQZ A;  2PQW A;  4P74 C;  2WSF E;  3PFS A;  4LVM A;  2FL7 A;  1BBW A;  3M4Q A;  3P8Y A;  4CH3 A;  4M7D E;  3L4G A;  3BY7 A;  2LVM A;  3MET A;  3GLX A;  4OB2 B;  5ELO A;  1Z7M A;  4ZTJ A;  1BI1 A;  3CD6 A;  2RI3 A;  3E9I A;  3M4Y A;  3QII A;  1YJ9 A;  3KXT A;  2WAC A;  4YRG A;  1NNH A;  1R8O B;  1XOV A;  2DIQ A;  1OZ3 A;  5FLX E;  5HKC A;  4GY5 A;  4FSX A;  2ART A;  2K57 A;  3OYD A;  2K5L A;  1USY A;  3OYC A;  4QQG A;  1X2G A;  3FEO A;  3DKM A;  3RKW A;  2QQB A;  1NJ6 A;  1VQ7 A;  3G4S T;  5J26 A;  4CH4 A;  4LD6 A;  5CVI A;  3MP8 A;  2RHQ A;  4LVK A;  4M75 C;  4BAC A;  1G3Y A;  3TUP A;  2PUK B;  4HWS A;  3IKL A;  2QQR A;  3OYM A;  3BDL A;  1BKB A;  3L1A A;  4P75 A;  4C92 G;  3NEL A;  3PCO A;  2ZPH B;  3LH0 A;  3CCR A;  5K1P A;  4BE1 A;  3NEN A;  2ZIN A;  3VUB A;  3URG A;  3UT1 A;  2ARU A;  4CI0 C;  3QZ9 B;  4J7I A;  1HTT A;  2HNI A;  3LSQ A;  1H4S A;  5IN1 A;  4BW9 A;  3CCV A;  5CCA A;  1QP2 A;  4M75 D;  4IUR A;  3M59 A;  1X56 A;  3UGQ A;  3V7R A;  5LJ3 h;  1Y96 B;  4X34 A;  3A7U A;  4XU3 A;  2MMP A;  4Y91 A;  3M55 A;  4F7U E;  3X26 B;  1YB3 A;  1BI3 A;  3I55 A;  2VUB A;  3QO5 A;  2C06 A;  1X75 C;  3CEY A;  3SDZ A;  5GAN f;  1B8A A;  4PLI A;  3CCJ A;  4FIB A;  1Q82 C;  3GP8 A;  4B9W A;  5GAN j;  3GPL A;  4BDY A;  1BBU A;  2DD4 A;  3HPW A;  4YRO A;  4M78 E;  2JOY A;  2JZ2 A;  5A0G A;  4WI1 A;  4L87 A;  3VYG A;  5HK3 A;  4JRQ A;  1YJN T;  2RI2 A;  4BY6 C;  4YCU A;  1ADY A;  4KUD K;  3ER0 A;  4H2V A;  1N8R C;  2AKW B;  4BI8 B;  4QQD A;  4EX5 A;  5AYF A;  2R57 A;  2Q7H A;  2XKO C;  1YFR A;  4MDX A;  4ZGJ B;  3JCM X;  3QYG B;  4ZGE B;  3A8G B;  4G84 A;  4M7D G;  2K3Y A;  1B70 B;  2DTO A;  3UH0 A;  4J15 A;  2KDS A;  1Q81 U;  4BE2 A;  1NPP A;  3P8V A;  4KUI A;  3KUF A;  4GLK A;  5GAO p;  1W2B A;  4IUQ A;  1D3B B;  1NYQ A;  2RD1 A;  1BI2 A;  3CD6 T;  2DQ0 A;  1KMM A;  3JCM h;  3OYL A;  4M7A C;  3MCA B;  4LDU A;  3JB9 D;  1YJ9 T;  2DK3 A;  1G51 A;  3VBB A;  4N4G A;  3OYY A;  1B34 B;  3A8H B;  1FYF A;  2RI5 A;  1X55 A;  4Q15 A;  3A31 A;  3CC7 A;  3HRT A;  2PME A;  1KHC A;  3CPW A;  3LX7 A;  1FWZ A;  2JTM A;  1G5I A;  2GQV A;  3LW5 E;  1VQ7 T;  4JUV A;  5FU6 C;  2I4L A;  3QKJ A;  3S3N A;  2J3L A;  4OP0 A;  2R5M A;  3LYI A;  1EFW A;  3REU A;  4M7A D;  4C8Q G;  4X9D A;  3HKS A;  1G5V A;  1O9S A;  4R55 A;  3OD1 A;  1BI0 A;  2F69 A;  1WU7 A;  3E9G A;  4LVL A;  3NFC A;  3KBG A;  4LVI A;  4H2W A;  4JRP A;  3CCR T;  3EFR A;  1LJO A;  1W2B S;  3HY1 A;  2X4W A;  4YTL A;  1WQW A;  4PJO B;  2RHS B;  2XDD A;  3QJ6 A;  1VIF A;  3CCV T;  5L8R E;  5A0L A;  4OVA A;  3FLG A;  4RCC A;  3SWN A;  4MZM A;  1EIY B;  2E41 A;  3UDC A;  3OBW A;  2F5K A;  4EMH A;  4LDX A;  2CIM A;  4J83 A;  2AMC B;  3C95 A;  1IL2 A;  3F70 A;  1H4Q A;  4YRJ A;  2GFA A;  4K86 A;  4F7U G;  3HRI A;  2JUF A;  5GMK j;  1HK9 A;  3CPF A;  5GAM f;  3OS0 A;  3CPW S;  3ICA A;  5LJ5 j;  4FT2 A;  3RMQ A;  4ELZ C;  4M75 E;  3CME A;  5GAM j;  3BW1 A;  3PNW C;  4A53 A;  2D9T A;  3HHT B;  1XQH A;  5M9O A;  5GAN h;  2M9U A;  2P0Q A;  2LRQ A;  1X6O A;  1WGS A;  3REX A;  3CCJ T;  4OMF B;  4M78 G;  4YYE A;  1PYS B;  4NCX A;  4YRN A;  2B8A A;  2FYK A;  3JCM W;  1VQP A;  3L2R A;  4HCB A;  2VXF A;  5KCO A;  2R5A A;  2XGT A;  4M77 A;  4FU6 A;  3EFS A;  2CZ0 B;  2QHT A;  1JB0 E;  1Q7Y U;  2I2L A;  1EOV A;  4KR3 A;  1YCY A;  3GF5 A;  3J81 E;  1JBM A;  1G3T A;  3OQ5 A;  2MI6 A;  2LT1 A;  2ZNJ A;  1M9S A;  3OYJ A;  2ARS A;  1S72 A;  1X54 A;  4IUT A;  3INZ A;  3OS5 A;  3CXC A;  3E9H A;  1KD1 U;  4YRM A;  1Q86 C;  4JDS A;  5GAN 4;  2LCC A;  4M77 F;  3P8H A;  5CAI A;  4EMG A;  3WQZ A;  1U8R A;  4C92 B;  2LT4 A;  5CK9 A;  1WLE A;  4CS3 A;  1SER A;  2DEQ A;  1YIJ A;  4P72 A;  2RJC A;  3WXM B;  1MGQ A;  1OYX A;  4IKF A;  3M9Q A;  3JCM c;  3LWI A;  2P0L A;  1KQ2 A;  3FRN A;  4M7D F;  5EG2 A;  3ME9 A;  2CZ6 B;  3V8L A;  1USY C;  1G5H A;  5LJ3 f;  3A8M B;  2RHZ A;  5HGQ A;  1RI0 A;  3CC7 T;  4XK8 E;  1UGS B;  2Y90 A;  4HCZ A;  2QTX A;  2HD0 A;  2ZPF B;  1ASY A;  3LLR A;  3MEA A;  3HXZ A;  5KNN A;  3JB9 J;  2WSC E;  4BB7 A;  1N9W A;  3QPH A;  1YI2 A;  3O8V A;  3HRU A;  5GAN 2;  5GAN 3;  3DB3 A;  4YRC A;  4HWR A;  2K5F A;  4QVZ A;  3OB9 A;  3H8Z A;  4RCB A;  4WJ3 M;  2ZZE A;  3FIF A;  5CKE A;  2NS6 A;  3A7R A;  4P75 C;  2MWP A;  3CXC S;  1YFS A;  2YLC A;  2CJ9 A;  5E3I A;  4XTY A;  4H2Y A;  3HSB A;  5GMK m;  4FM4 B;  5ELN A;  4KUL A;  4R56 A;  4M7A E;  4J7F A;  4RMO A;  2DXU A;  1VQ6 A;  4QVC A;  5C51 B;  1O75 A;  3C94 A;  1Y96 A;  2L3R A;  3M4P A;  2Q7E A;  2D6F A;  4C8Q F;  3FB9 A;  1U1T A;  1VQK A;  2CJB A;  4YRT A;  2KSS A;  4OGC A;  2EAY A;  2WSE E;  3MP6 A;  5LJ5 h;  2DXT A;  4X9C A;  3R07 A;  3G1Z A;  1VQO A;  5C52 B;  3E1S A;  5GAM h;  4YRK A;  1WPY A;  2DDZ A;  2RHI A;  4WJ4 A;  2C7I A;  2DZ9 A;  4YRS A;  4M75 G;  1GGM A;  3CMQ A;  4M7D B;  3CME T;  4P3O A;  5D6W A;  3OYE A;  1JJ2 A;  5FU7 B;  1NJI U;  1M90 C;  5DLO A;  3BDU A;  2GFU A;  5F5W A;  4MZP A;  3JCM f;  4ZGD B;  3PIO A;  2E70 A;  5FRO A;  5GAN 8;  4F7U F;  3OA6 A;  3E9F A;  1IRE B;  4H2X B;  2ZT6 A;  2I4N A;  4KQE A;  3RL6 A;  2AKW A;  2EJ9 A;  1VQP T;  3CCQ A;  3HRS A;  3A8L B;  4L59 A;  2E3C A;  4JLI A;  3SFM A;  4P3P A;  3C12 A;  4Y28 E;  3G6E A;  2LX9 A;  4CS2 A;  1B70 A;  3CCU A;  1KOG A;  2QI2 A;  4RQF A;  2DIG A;  2QHU A;  2EKO A;  4XAX B;  5A2Q E;  3JCM e;  4J8O A;  5CKF A;  3P8B B;  4XTU A;  4M78 F;  4EDU A;  4EMK B;  1RL2 A;  4RG8 A;  1UEB A;  2L5Q A;  3V7C A;  3A5Y A;  1D3B A;  4Q6G A;  5I21 A;  5HY6 A;  3HFZ B;  4C8Q B;  3MEV A;  4ZTU B;  4NL2 A;  3G71 A;  2K5I A;  4P71 A;  2V8J A;  1B34 A;  1G3W A;  5DM7 R;  1JJ2 S;  2ZGW A;  1SRY A;  2P0P A;  3OYH A;  1YIJ T;  4WF2 A;  4P5N A;  3A7A A;  2DXB A;  1M1K U;  2K4Y A;  4OGE A;  4C5E A;  2JN0 A;  4C0D B;  1BIA A;  4IUU A;  2JVV A;  4DOV A;  1Q81 C;  3QG1 A;  3M54 A;  1BIB A;  3ZEH A;  3DSQ A;  1E24 A;  4F7U B;  3OW2 A;  2Q5I A;  3I56 A;  5C53 B;  5CIU A;  4YRE A;  2RM4 A;  3CCM A;  1YI2 T;  3TEH B;  5KE3 A;  1VQ9 A;  1ADJ A;  3OS2 A;  3HRK A;  4PJO A;  2RHS A;  4AH6 A;  5CR2 A;  2AHJ B;  3QXE B;  2A7Y A;  3P8T A;  3LGL A;  3RAC A;  2GF7 A;  1SES A;  1QE0 A;  5K1X A;  4JRK A;  3VUZ A;  1EIY A;  4M7A G;  3CC2 A;  3OMC A;  2DU7 A;  4M78 B;  3CBO A;  2AMC A;  2I4O A;  3TU4 K;  3W3S A;  3DLL A;  5GAN e;  1WJR A;  1J5W A;  3SWN C;  1VQK T;  1U1S A;  3L2W A;  2L89 A;  4PJO F;  4BI3 A;  3WVE B;  2H3J A;  1VQO T;  1WQ7 A;  4N4H A;  3ASK A;  3CC4 A;  2DPP B;  3M56 A;  2XIC A;  1LYL A;  3TEE A;  3X24 B;  2E5Q A;  2ZZD A;  2VXE A;  2HBP A;  3V7S A;  3OW2 S;  1PYS A;  3RER A;  5DY9 A;  2XID A;  4XTW A;  4LDW A;  2QQS A;  4MMK A;  2XDP A;  2MWO A;  5FRM A;  3PZC A;  4JJN K;  2BUD A;  4LDV A;  1IZ6 A;  3X20 B;  4OF1 A;  4E7H A;  1W66 A;  4M75 F;  3PMI A;  4M77 C;  4MZT A;  4QVD A;  3OMG A;  3R6O A;  1QVG A;  5CKD A;  4E51 A;  3G6E T;  3C4S A;  5C0M A;  3CCU T;  3ZBD A;  4TWA A;  2E64 A;  3VKI A;  3HTZ A;  4H2U A;  4C92 A;  3MEU A;  2RA2 A;  4XEM A;  1VUB A;  2EWN A;  3HFO A;  4NOY A;  4OB3 B;  2VC8 A;  4M77 D;  1XTD A;  2K3X A;  1I8F A;  2PVO B;  2X4X A;  3H6Z A;  3G71 T;  1H3Z A;  1I5L A;  3A5Z B;  3V8K A;  1Q7Y C;  3HFV A;  5I2S A;  1BYM A;  4P72 C;  3CMA A;  4OLF A;  2LCL A;  4L6V 5;  2HQX A;  1Z7N A;  1K8A U;  4X5O A;  4J6Y A;  4M7D D;  3I7F A;  5LL6 S;  5D6X A;  3IG2 A;  4C92 F;  5LJ5 f;  3GNG A;  1UGR B;  3TEG A;  4C5G A;  4HWP A;  2V8K A;  3UFG A;  2DD5 A;  4KBM B;  1MHN A;  4PLL A;  1NJ5 A;  2E6Z A;  4HWT A;  4KR2 A;  2G4C A;  2RK1 A;  3I55 T;  1QVG S;  2O01 E;  4A4G A;  2QQ9 A;  4PHC A;  2DKG A;  3L2V A;  3PIP A;  3I56 T;  2RJE A;  4YRI A;  3CCM T;  4M75 B;  4P3N A;  3L2Z A;  3T9N A;  5IAY A;  4E7L A;  2ZXF A;  4YP0 A;  2ZPI B;  3QHS A;  1VQ9 T;  1PSE A;  4BUG A;  2EQJ A;  11AS A;  1TH7 A;  3CCL A;  5GAM e;  3ERR A;  2DVE A;  3A32 A;  2ZPG B;  3CC2 T;  1KMN A;  3E19 A;  1M1F A;  4C8Q D;  1X01 A;  1GXI E;  2LDM A;  1YGB A;  3QZ5 B;  4II1 A;  1Y7X A;  4C0Z A;  2PMF A;  2KY9 A;  3JCM b;  5FRN A;  1NYR A;  4M7D A;  1ZBX A;  2P4T A;  4LVJ A;  3CC4 T;  4A4F A;  1ATI A;  4E7K A;  1JJC B;  3CBP A;  3VJP A;  2O4X B;  1E22 A;  3RMS A;  5J39 A;  4BWA A;  3FDR A;  4H2X A;  2CZ7 B;  2ZT7 A;  1G3S A;  1ZQ1 A;  2V8I A;  2DZC A;  3Q1J A;  2ALY B;  3VU3 C;  2LQK A;  3A8O B;  1QF6 A;  1N9S A;  3NTI A;  4DQ2 A;  4JS5 A;  1B7Y B;  4YRF A;  4YPF A;  4ELY C;  4A4E A;  3M58 A;  4TTV A;  3MHX A;  2A8E A;  2ZIM A;  4ME7 A;  5A0D A;  5GAO r;  5CKH A;  3TCJ A;  2ZZG A;  4ATO A;  3N5B B;  3QDR B;  2OTJ A;  4C5I A;  4O6J A;  1VQN A;  3OYG A;  5IT9 E;  4K88 A;  1FX7 A;  4BY6 B;  5LJ3 d;  3V8J A;  1KQ1 A;  4EMK A;  1NJI C;  3JAM E;  2IY5 B;  3HFZ A;  2P5I A;  4C8Q A;  4BI4 A;  3CCE A;  3OYN A;  3UPU A;  5LJ3 e;  4YRR A;  4UP8 A;  1PSF A;  4HA8 A;  5GAN 7;  3JCM Q;  1YIT A;  2VGN A;  2EJG A;  4P71 C;  3OYF A;  4PNO A;  1ZHI A;  1X2H A;  3JB9 I;  1K9M U;  4HCC A;  3HP9 A;  1NZ9 A;  5KE2 A;  3CMA T;  2XDB A;  4M7A B;  3OBY A;  5GMK h;  1YJN A;  4LD9 K;  4M77 E;  2FVU A;  3HXU A;  1LNX A;  1NJ1 A;  4F7U A;  2FB7 A;  1UGQ B;  3VYH B;  4TVY A;  4YRP A;  4HT4 A;  1W4S A;  2FHD A;  4PL6 A;  3FC3 A;  3TEH A;  5FU6 B;  3RF1 A;  4XEO A;  2RHY A;  2LQ8 A;  5GMK l;  2DTI A;  3G7Z A;  2QHS A;  3UWN A;  5HK0 A;  3VQY A;  4J6W A;  1YHQ A;  4C0G A;  1WNL A;  4TVA B;  4N0A A;  4XU2 A;  3JRZ A;  4PJO C;  2RO0 A;  4M78 A;  1VQM A;  4OB0 B;  5GMK i;  3BFM A;  3S3M A;  1M1K C;  4E47 A;  4RQE A;  3JCM d;  5GAN 6;  1M4Z A;  3CCL T;  2DQ3 A;  2BIV A;  3SB2 A;  3OY9 A;  4P73 A;  2E10 A;  1K73 U;  2BKD N;  4XU1 A;  4KT0 E;  4JRI A;  3NTK A;  2C8M A;  3OSV A;  3LC0 A;  2Q7G A;  4PJO D;  3J80 E;  3L2U A;  2RK2 A;  4PKC C;  1S72 T;  1NJ2 A;  4ZN3 A;  2DTH A;  3LWH A;  2QXF A;  1KC8 U;  4C8Q E;  2EIF A;  3M57 A;  4UPA A;  5I2M A;  4Z02 A;  3RUX A;  1VQ5 A;  2F5T X;  2ZIO A;  4BE0 A;  2JTF A;  4UP7 A;  2MF2 A;  3JCM P;  1YJW A;  4RMF A;  2QA4 A;  2E5A A;  1M8V A;  3JCM g;  4J6X A;  3QYH B;  2G3R A;  3HXV A;  4TVR A;  2PU9 B;  5KCH A;  4ZTF A;  4RG2 A;  3LGF A;  1M90 U;  4YRL A;  1VQ8 A;  1QP3 A;  3OYI A;  1SET A;  3OYK A;  2CJA A;  3KFU A;  2OTJ T;  4V2S A;  3S3O A;  3QNE A;  3JB9 G;  1VQN T;  4P74 A;  4EO4 A;  2DAQ A;  3DLM A;  4C0F A;  1ASZ A;  1UB4 A;  2XHC A;  3X28 B;  2M16 A;  2PVG B;  2HAX A;  4QW2 A;  3HFN A;  4E7J A;  1QVF A;  3MF2 A;  1RIQ A;  4C92 C;  1AHJ B;  1UGP B;  5GAN d;  12AS A;  2E6N A;  3CCE T;  3A5Z A;  2J3M A;  1E1O A;  2KMT A;  1DJ7 B;  4CH5 A;  3L4G B;  3L42 A;  4XTX A;  1XNI A;  4J5Y A;  3RGL A;  4ZN1 A;  4A4K A;  4DPG A;  3SD4 A;  1P92 A;  2QEX A;  1YIT T;  1YFT A;  1FXX A;  2EQK A;  1VQ6 T;  2NLU A;  5D6Y A;  4O2D A;  3J7A F;  3QSU A;  3PMT A;  4CRI A;  2XD0 A;  1H4T A;  2L8D A;  3QUI A;  2ZR2 A;  4M77 G;  2EFI A;  1L0W A;  4C92 D;  3NTH A;  2RJD A;  1M5Q 1;  3QBY A;  3PT9 A;  1VQL A;  2YLB A;  2LC4 A;  4TQF A;  5GAO n;  4M75 A;  4A54 A;  1LOJ A;  5GAO m;  3QO7 A;  4K87 A;  2EQM A;  2EYQ A;  2PVD B;  1KQS A;  4XQ3 A;  5GAN g;  2X35 A;  3AHU A;  1V29 B;  3DB4 A;  2RHQ B;  3NET A;  3OSS C;  2JNG A;  4OB1 B;  4G85 A;  3FJP A;  1K8A C;  1YHQ T;  1QVF S;  2OAU A;  4H02 A;  1VIE A;  1VQM T;  3PCO B;  5KH6 A;  2ZPB B;  4NS5 A;  3PTA A;  3CCQ T;  1Q82 U;  2Y4Y A;  3QTC A;  4YRQ A;  2XI9 A;  1I81 A;  1B76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...