4OP0A

Crystal structure of biotin protein ligase (rv3279c) of mycobacterium tuberculosis, complexed with biotinyl-5'-amp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
265
structure length
259
Chain Sequence
b'MADRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLITGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BirA bifunctional protein
publication title Active site conformational changes upon reaction intermediate biotinyl-5'-AMP binding in biotin protein ligase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 89
structure length 259
sequence length 265
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4op0A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4op0A01
5GANe 4M78B 3JCMe 5GAMg 3A7AA 3JB9J 2Q7GA 3FJPA 3JCMg 5GANg 5GMKm 3BFMA 4WJ4A 1ADYA 2EWNA 1PYSA 1EVLA 2VXEA 5GAOm 4M77B 1TH7A 2I4LA 2Y90A 1B76A 4C92B 4HT9A 3HXZA 5LJ5d 1YFRA 1ADJA 4UPAA 3VQXA 2RHQB 1NJ6A 3A32A 1E22A 4M7AA 2DXUA 3P8VA 3QO3A 5GAN7 4TVAA 3RGLA 2PMEA 5GAOq 4EO4A 2E10A 2EAYA 2CJAA 3RKXA 2E5AA 4X5OA 5C52B 2DTHA 4EMKA 1NJ2A 4XEOA 3HRKA 3UGQA 3A31A 4MMLA 4XU3A 2Q5HA 5GAN8 4NL3A 2ZT5A 3BW1A 5LJ3f 2I4OA 3HFZB 1X55A 3HSBA 3JCMh 5E3IA 3RACA 3IALA 4HWPA 5GAN3 4F7UA 4F7UF 4M7DG 12ASA 4XTUA 2ZT7A 1EIYB 4P73C 2YHTA 1B7YA 4YCWA 3JCMX 2ARUA 3LSSA 2I4MA 1H4QA 2DQ0A 4PHCA 4C8QG 3QO5A 3VBBA 4ZTUB 3HXXA 4WJ3M 4ZIBA 1ASYA 1NJ1A 4CS4A 4DQ2A 1N9WA 3RERA 2JN0A 1LJOA 4M75E 1X01A 4NOYA 2E41A 3JCMP 2G4CA 4M77E 1WQ7A 1Z7MA 3L2ZA 4C92E 2J3MA 4PJOG 1Y96B 1X56A 4YCUA 5GAMd 1X54A 3M4PA 4P73A 5C53B 1WNLA 4M78G 1B8AA 1JJCA 3TUPA 1BIBA 1B34B 5GMKh 3JCMd 5GANd 3TEHA 4H2XA 1E24A 11ASA 4H2TA 4P75C 3QTCA 3SB2A 2ALYB 4P3PA 3P8TA 4M77G 4M7AE 5HGQA 4YDQA 4C92G 4QVDA 3PCOB 4KR3A 3PZCA 4X9DA 4JRKA 2DJZA 2AKWB 3HXVA 1I4K1 1USYC 4XU0A 3HFOA 1QF6A 4XU1A 4YP0A 2AMCA 3DSQA 2RHSB 5LJ5f 4WI1A 5K1XA 4M7AG 4YROA 4YRTA 1LOJA 4TWAA 4J5YA 3A5ZA 4P75A 4RQEA 5GMKj 1WQWA 3EFSA 1SERA 5LJ3e 1E1TA 2ZR2A 3HXUA 3UGTA 4NL2A 3BJUA 2I2LA 4H2YA 4XTVA 2DVEA 4J6YA 1D3BA 3TEGA 5LJ3g 2CJBA 1U1TA 2J3LA 3UH0A 4OP0A 4M75B 3VQVA 4H2WA 4HT8A 4XQ3A 1YB3A 4JUVA 4A54A 3JB9G 3QUIA 3JCMc 1QE0A 3JCMJ 1USYA 5GMKl 2DXTA 1YGBA 3HY0A 4YRGA 1NJ5A 5GAOl 4HWRA 1PYSB 2ARSA 2ZGWA 3MF1A 1KQ2A 1ASZA 5GAOp 1SETA 5KNNA 4O2DA 3RKYA 3HFNA 3NENA 3VU3C 4M7DD 3OD1A 2ZR3A 4M7AB 3L1AA 4TVAB 4RCBA 2P5IA 2ARTA 4OLFA 4YRJA 2Q5IA 4H02A 2QHUA 3QO7A 2RM4A 3FB9A 2QTXA 1H4TA 4LNSA 5LJ3h 3JCMQ 4E51A 4YRKA 2DQ3A 2YLCA 4Y91A 3V7RA 1YCYA 5GMKe 4EMKB 3A7RA 4C8QD 3L4GA 3QNEA 3E9HA 1IL2A 4YREA 1EOVA 5GAOn 4P3NA 3HTZA 3R07A 2ZZEA 4YRLA 5GAMf 1H641 3RF1A 1NJ8A 3NEMA 5GANf 4F7UB 1L0WA 1HXDA 4K86A 2K57A 1B70A 4M7DC 4PJOD 3KFUA 1B7YB 5I21A 2DEQA 1BBWA 4EMGA 2DU7A 4P74C 1SRYA 4CH4A 4M78D 4MMKA 3HRIA 4ZTZB 3INZA 1GGMA 3AHUA 1E1OA 3UFGA 4HVCA 1U1SA 4C8QC 3BDUA 3EFRA 1SESA 5LJ3j 1I81A 4K87A 2DTOA 1G5IA 3M4QA 1WYDA 3RKWA 5LJ3d 4G84A 3GIBA 4YRSA 2CGHA 1EVKA 4M75G 2XGTA 3VQYA 4PJOC 1JBMA 2E65A 4H2VA 1FYFA 4M7DA 4M7DF 1JJCB 3ICAA 2ZIMA 4M78C 2ODRD 3IKLA 3TEHB 3FIFA 4J15A 3V7CA 4CH6A 2IY5A 4L87A 3W3SA 4P74A 2Q7HA 2VC8A 2QHSA 3JB9I 2EJFA 2RD1A 1X2GA 5DY9A 3NETA 4UP8A 4HA8A 2ZT6A 5GAN5 2E1HA 4M77C 4C8QA 1JRIA 4C8QF 4H2SA 4TQFA 4PG3A 4C92C 4YRQA 4XEMA 3RL6A 2XTIA 3V8LA 1WU7A 4P72C 5LJ5h 1KMNA 1BBUA 3RIRA 4F7UE 4QVCA 1N9SA 1HTTA 4YRIA 3JB9H 3SWNB 4P3OA 2ZIOA 2DZCA 2AMCB 2I4NA 2ZNIA 1MGQA 3JB9D 4PJOA 4PJOF 3M4GA 4HWOA 4K88A 1I5LA 2ODRC 4YRRA 1YFSA 3JCMW 3JCMV 4M7AC 4M78A 4M78F 2PMFA 1ATIA 3NELA 2FB7A 2QHTA 4F7UG 3MF2A 2E64A 4N0AC 5CAIA 1LYLA 4KQEA 4EMKC 3RUXA 1D3BB 4M77A 4M77F 1H4SA 4C92A 4C92F 4KR2A 3IG2A 4P72A 5GAN2 2RHQA 1NYQA 4Q6GA 4AH6A 4UP7A 3E9IA 5GMKi 2C8MA 4XTWA 5LJ5j 1RIQA 4DPGA 4YCVA 1BIAA 3G1ZA 4RMFA 2ZXFA 3RESA 4M7AF 1X2HA 4YPFA 2QHVA 4M7DE 4H2UA 3HFZA 4TTVA 4TVWA 5GAN6 1W66A 4N0AA 2DU5A 4J6XA 1H4VB 2EJ9A 1I8FA 1EIYA 4TVYA 2RB6A 5GAMh 2ZNJA 2DZ9A 3JCMf 3IKMB 3L4GB 4C8QE 3QHSA 4UP9A 5GANh 4G85A 2DTIA 3JB9F 4XTYA 1NNHA 4YRMA 4XTXA 4BWAA 4TQDA 3REUA 4CS3A 3QO8A 3ERRA 2CIMA 3A5YA 5ELOA 1B70B 4YRNA 3A74A 3LSQA 1Z7NA 1HK9A 5LJ5e 2ZINA 4PJOE 4YRFA 4EX5A 5K1PA 3LC0A 4M75D 4YRCA 3HFVA 2ZT8A 3WQZA 4M77D 5LJ5g 4M78E 2RA2A 4C92D 1G51A 3HXWA 1Y96A 4PNOA 3V8JA 2DKGA 1EQRA 4V2SA 1KQ1A 3V8KA 1B34A 4EMHA 4HWSA 3VQWA 4X9CA 4A53A 2Q7EA 4J6WA 4JRIA 4XTZA 3SWNC 5GAMj 2ZTGA 3HY1A 2VXFA 1HC7A 2CJ9A 2ALYA 3A7UA 3MEYA 4H2XB 4P71C 5GANj 4M7AD 5F5WA 4YYEA 3V7SA 4YRPA 2E3CA 1YFTA 3CMQA 3PCOA 5GAOr 1KOGA 4BW9A 2ZCEA 4M75C 1NYRA 1VQZA 2ZZGA 3JCMb 4M7DB 4CH5A 2DDZA 4HWTA 1J5WA 5ELNA 2AKWA 2P0LA 4CH3A 3PGGA 5GAN4 2IY5B 1LNXA 4Q15A 3BY7A 4WF2A 3QSUA 1WPYA 3I7FA 2EJGA 4CS2A 1C0AA 2RHSA 5C51B 2C7IA 1KMMA 4RQFA 3P8YA 4C8QB 4XU2A 4NCXA 1M8VA 3SWNA 4RDXA 2HNIA 2ZZFA 4RCCA 4P71A 4JLIA 2EL9A 2FYKA 2YLBA 1G5HA 1M5Q1 4PJOB 3REXA 1N9RA 5GAMe 3HXYA 4M75A 1EFWA 4M75F 1WLEA
chains in the Genus database with same CATH superfamily
5GANe 4M78B 3JCMe 1AWJA 4J7FA 2Q7GA 1CKBA 3H6ZA 1YJWT 2CDTA 1MNEA 3OYJA 2D8HA 1TG0A 4LVIA 4LUDA 2DIGA 2Y90A 2DE0X 2H8HA 1QCOA 2DF6A 4R0KA 2VV5A 3H0IA 2RHQB 3A32A 2HDAA 3VQXA 1V1CA 5GAN7 1VQLA 1NG2A 3RGLA 2PMEA 3R6OA 3OBYA 1C6VX 2OAWA 2BKDN 4BY6B 2KROA 2J05A 2RI3A 8AT1B 1K73U 1NJ2A 3H8ZA 4A4GA 2KK4A 3UGQA 5GJVB 4OGCA 1M4ZA 3OYBA 1X6GA 1RACB 1K73C 2ZT5A 3BW1A 5I22A 2A08A 1RLPC 3WVEB 4Z8AA 2L8DA 2CZ7B 2FPEA 4KBMB 2EQJA 3FLGA 3RACA 2K5FA 3A98A 2BUDA 2JNGA 4M7DG 1EIYB 5IXFA 4P73C 5FLXE 2FEIA 2C06A 4YCWA 2ARUA 2GTOA 3M9QA 3O8VA 1KD1R 1YITQ 2XDBA 1H4QA 1R0CB 3R6NA 3DLMA 3CC2A 1JJ2S 3CC4A 4C8QG 5FWCA 1VQPT 4VUBA 1XJWB 2F1LA 4ZTUB 3HXXA 1KD1U 2ZPFB 4ZIBA 3G6EA 1PC0A 2IIMA 1KD1C 1BBZA 4L59A 2RHUA 3UATA 2G4CA 1QMCA 2KEAA 4OMMA 1M2VB 3U23A 1Z7MA 3L2ZA 3I5SA 1Y96B 2HBWA 1WJQA 2RHYA 2ZPBB 1X56A 4J9FA 3M4PA 5C53B 1JJCA 3TUPA 2CUBA 3M0QA 1Z9ZA 2EIFA 1N8RU 4H2TA 3QTCA 1KJWA 2DYBA 2JUFA 2SEMA 1N8RC 3X20B 2OI3A 4M7AE 2K5IA 4YDQA 2DD4A 2P0QA 2XHCA 3PVQA 3CMEA 3CCJT 4OF1A 2DJZA 1VQ5A 2KRNA 1BB9A 2EKHA 2EYXA 4E7KA 2OTJQ 2RQTA 2ENMA 1QF6A 3PNWC 1W70A 4YP0A 2AMCA 4RMOA 1UGQB 1X6BA 1IGQA 1OZ3A 2RJCA 4XK8E 2K9GA 5KCHA 3OYFA 4YRTA 3ZBDA 4TWAA 1H8KA 2X3XD 2AIRB 2P4RA 4P75A 3SHWA 1WQWA 2C0IA 2VGNA 1GBRA 2ZR2A 5J39A 2W0ZA 3LX7A 4HCCA 2DVEA 4J6YA 2H3JA 3RMSA 1VQLQ 1IHVA 4FCYA 1BI0A 4OP0A 3M58A 1FWZA 1USYA 3QUIA 1RI0A 3EFOB 1YGBA 4PFZA 1JO8A 3M59A 4YRGA 2GF7A 2V26A 2ZPIB 1ASZA 1SETA 4CI0C 4O2DA 3VV0A 2GFUA 3RKYA 2DA9A 3HFNA 1VYTA 2RQVA 3NENA 2RHZA 3OD1A 2FPDA 4TVAB 2LC4A 3CD6A 1YP5A 2ARTA 4CC2A 1M9SA 2RM4A 2QTXA 1H4TA 1FX7A 3JCMQ 2DQ3A 1N6AA 3CC2Q 3CC4Q 2GBQA 3L4GA 1W2BP 4C5EA 2O2OA 4P3NA 3HTZA 3A8GB 3QBYA 3G6EQ 1OEBA 1KHCA 5GAMf 1UE9A 2KDSA 2MWOA 3C4SA 3LW5E 4A4FA 2D8JA 4QVZA 2E6ZA 4F7UB 1KG1A 1UFFA 4PJOD 1B7YB 5I21A 3CXCA 3CMAA 1MV0B 4CH4A 1PM3A 1BK2A 3NTKA 1DJ7B 2QQ9A 2L3RA 2EYQA 2E5QA 5M9OA 3MEAA 4MDWA 2CYZB 1IO6A 1WFWA 8ATCB 3A8OB 3M4QA 4G84A 2LRQA 3CMEQ 1VQ5Q 1QVPA 4AFZC 3F70A 2XGTA 3OMGA 4L5GA 4F04B 1EFNA 4PJOC 2M9UA 2E65A 4H2VA 1VQ6T 2ROLA 3ICAA 1I07A 2L89A 2ZIMA 4QT7A 3IKLA 3TEHB 3FIFA 2IY5A 3P8DA 3HL8A 2AKKA 2SRCA 3JB9I 2EJFA 1X2GA 4N4HA 3M53A 1OZ2A 1OPLA 2MIOA 4OGEA 3EAEA 2E1HA 2VYTA 4H2SA 4BE0A 2KAFA 1YWOA 4C92C 4PG3A 2BIVA 3M55A 1K8AR 2RK1A 4FM4B 1QVGS 1WU7A 1ZA1B 1KMNA 1C1AA 1TTHB 4E7LA 4C5GA 1U8RA 2ED0A 4F7UE 3OS2A 4PFPA 5IHKA 4QVCA 4KUIA 5LL6S 4YRIA 2L0AA 4P3OA 2DZCA 1K8AU 2I4NA 5KE2A 1V29B 1M90R 3CPWA 4PJOF 4YRRA 1G3YA 1K8AC 1QVGA 1RI9A 2NYSA 4M78A 2A3LA 2CREA 1PSEA 1AT1B 1NPPA 2KNBB 1M90U 2JMAA 1AWXA 3M56A 1HSQA 2P4TA 2QQBA 2QASA 4KULA 2E64A 1M90C 3EHQA 1D3BB 4KT0E 2RO0A 1H4SA 2J06A 4C92F 3I56A 2QI2A 1LCKA 1ZSZB 3CCJA 2DXBA 2QYZA 3IG2A 2RHQA 4AH6A 3GBQA 3VRZA 2C8MA 1JU5C 1RIQA 2FVUA 2KR3A 2E70A 1WHGA 2LJ0A 1YJWQ 1X2HA 4JLGA 1ZA2B 1YITT 3E9GA 2QHVA 1TSFA 1SHFA 5IHNA 3PMTA 5GAN6 3QXEB 1WHJA 5CVIA 3CMAQ 1P92A 1H4VB 2B8AA 2EJ9A 1I8FA 1EIYA 1MHNA 3IQLA 1MNDA 2ZNJA 1D09B 4FT2A 7AT1B 4RG2A 2F5TX 4XTYA 4YRMA 4XTXA 4BWAA 1WGSA 4GLKA 1R8OB 5HK3A 2O31A 3G4ST 1OU9A 4GLMA 4LVJA 2CIMA 4J9GA 1B70B 2QAZA 3A74A 3LSQA 1B7TA 1HK9A 2ZINA 2RI5A 4PJOE 5FU6B 4J9DA 4M75D 1VQ8A 2ZT8A 1IGUA 2J6FA 3CXCP 5LJ5g 1M2VA 1PD0A 1BCOA 1G51A 2A8EA 1W4SA 1Y96A 3V8JA 3JSCA 3REAB 2DL8A 5AT1B 4RTUA 4HCZA 3ULRB 3SWNC 2VXFA 1ZBJA 4AFQC 1QP3A 3A7UA 1ACMB 4LDYA 4YRPA 5D6YA 1IRXA 1ZUUA 3CCLA 1BI1A 1VIEA 2MCNA 4M75C 2HSEB 1VQZA 4M7DB 4RTVA 1WJSA 3PFSA 3J80E 4HWTA 5ELNA 4CH3A 3UA6A 3QSUA 2EJGA 1VQLT 4B9WA 3NGPA 5C51B 2C7IA 3I55A 3P8YA 2QDYB 2RF0A 4C8QB 4XU2A 2K4YA 1UUEA 2L3SA 3NTIA 3CCQA 2ZZFA 3DKMA 3MP1A 4RCCA 4JS5A 1VYUA 3I56Q 4JLIA 2EL9A 3CCJQ 1Z9QA 3EG0A 2HQEA 2COYA 2KRMA 3CPWP 4M75F 1VQ6A 1M3AA 2K3XA 2XDPA 2DO3A 3JCMg 4N4IA 5GANg 5GMKm 3BFMA 2EWNA 2HEQA 2QDLA 1UJ0A 3CC2T 3CCET 1FMKA 3CBMA 3OYEA 2LNVA 1B76A 4HT9A 3HXZA 5LJ5d 3H0FA 2J6KA 4A4HA 3RDVA 1YFRA 3G6ET 1YJNA 1NJ6A 1E22A 5AYFA 2D1XA 2DXUA 4TVAA 2QA4T 3OYLA 3NMZC 3MPUB 2GQVA 3PTAA 2JW4A 4EO4A 2KYBA 2RQWA 2E10A 4HVVA 1BCMA 2EAYA 1K0XA 2D0NA 4Z89A 1GCQA 4X5OA 1M1GA 3META 2DTHA 5HY6A 2CP2A 4XEOA 3HRKA 3P8HA 2HKNA 2RN8A 4MMLA 3A31A 3OYIA 5IH2A 5GAN8 4JRPA 1KFZA 4E6RA 3HFZB 1X55A 3HSBA 3JCMh 5E3IA 1VQ8Q 4HWPA 1D1AA 3MP8A 4F7UA 3AT1B 12ASA 2L2PA 1B07A 1BI3A 4FYXB 3OYMA 1NYFA 1AHJB 1B7YA 2KRSA 2YUPA 3I35A 3OYYA 3CMET 2K6DA 2MYSA 1VQ5T 1LPLA 3H9NA 3VUBA 3VRYA 3QO5A 5C6SA 2JJ9A 2PNIA 1AEYA 2VKNA 1ASYA 1NJ1A 4CS4A 4DQ2A 1N9WA 2F2WA 3BE3A 2QEXT 3G71T 2EQIA 1RAAB 1X01A 4M75E 2HL5C 2LZ6B 5CQYA 2KYMA 2J3MA 4PJOG 3FRNA 3LWHA 1YI2A 4C0DB 2J6OA 4JRQA 1X54A 4KGXB 1PD1A 4QQDA 1BU1A 5GMKh 3JCMd 1TUCA 2OJ2A 5GANd 3TEHA 3E1SA 2ATCB 1MMNA 4P3PA 3NTHA 4EDUA 3P8TA 3C95A 4RTYA 1TWBA 4C92G 3PCOB 2O9VA 2V8KA 1TUGB 2V8JA 1XNIA 4X9DA 4IUQA 2BTTA 2RQUA 1JXMA 4E2FB 1N27A 3TREA 2DD5A 3OY9A 1VQ6Q 1RUWA 1JEGA 4XU0A 1XTDA 3CD6T 3DSQA 2RJDA 3M57A 4WI1A 1XQHA 2CT4A 2KBTA 2QG9B 2QGGA 5CK9A 1QVFA 4RQEA 2V1QA 5HK0A 4FT4A 3HXUA 1ZHIA 3UGTA 4XTVA 4BDZA 1YJNQ 1G3WA 4JJBA 1D3BA 2XICA 1KHIA 4NS5A 2XMFA 1ZSZA 1D1BA 4H2WA 4HT8A 2YRVA 4XQ3A 4JUVA 2NUPB 2X4XA 5CKFA 3GP8A 3G1JA 3JCMJ 1W2BS 2LQWA 4KGZB 2DXTA 3CMAT 3HHTB 4XAXB 2LP5A 2PTKA 1K9AA 4O6JA 3VU3C 1I0CA 1X27A 1YCSB 1W2BA 4M7AB 3L1AA 2EQMA 5ECAA 2GCXA 1X6OA 1Y57A 2HKQB 4H02A 3M5AA 2QHUA 4JDSA 3CPFA 4LNSA 4YRKA 1ZUKA 3V7RA 5GMKe 1YCYA 4EMKB 4ZGJB 4BUGA 3EG2A 4D8KA 3E9HA 2ZPGB 1IB8A 5GAOn 3R07A 1IHWA 2ZZEA 4E7HA 1YWPA 3RF1A 2RPNA 2DK3A 4TVRA 3QYHB 3CCEA 4J9IA 1B70A 3RR6A 5A2QE 1YJ9A 2DU7A 4P74C 2GNCA 4M4ZA 3SEMA 2QA4A 5C0MA 4LN2A 3FJ5A 4GBQA 4ZTZB 3INZA 1U3OA 3H41A 2EQKA 1U1SA 4AT1B 2YUQA 1FXXA 1UG1A 3CBPA 5LJ3j 1I81A 3G4SQ 3LH0A 4MZTA 2LCSA 2HQXA 4JS4A 1VIFA 4FW2A 1QKXA 1D1CA 2IVWA 4M75G 2QGFB 1D0YA 4M7DA 1N5ZA 4J15A 3I56T 3W3SA 2A0FB 2YSQA 2ECZA 1RABB 1KQSA 4UP8A 4OMOA 3QG1A 4M77C 4C8QA 5FW9A 1UHCA 3L2UA 4II1A 3RL6A 2OX7A 1UB4A 2MOXA 5EC7A 2HQHA 3V8LA 1E6HA 4P72C 3CQTA 2QEXA 3G71A 1BBUA 3MEUA 1Q95G 2FZGB 5IN1A 5CKDA 1N9SA 2CSQA 1SG5A 3QKJA 1VQKA 4PLLA 2KVQG 2ZNIA 1ABQA 1M27C 4HWOA 3ZEHA 1RAGB 2R58A 1K76A 2LQNA 3X26B 1I5LA 4LVLA 4OMFB 2HCKA 3JCMW 1QVFP 1G8XA 3A5ZB 5FROA 1ATIA 4FYWB 1WJRA 4ELYC 4IUTA 2FB7A 6AT1B 2QHTA 1I5OB 1T3SA 3MQZA 2KI7A 1VQOT 4M77F 1TUDA 1M8MA 1PKSA 1UGRB 4KR2A 1NYQA 2X4JA 3LH5A 1MMAA 3E9IA 4XTWA 3PE0A 4O5VA 1VQ8T 5LJ5j 3ASKA 2EYYA 4DPGA 4YCVA 1W1FA 2DJQA 1BIAA 3WVDB 2RJEA 2KSSA 4A63B 1WZOA 3T9NA 4QKUA 3M54A 3JRZA 4ANJA 4YPFA 2XIDA 3CCEQ 3HFZA 4BE2A 3ER0A 2D9TA 3QWYA 4TVWA 2LJ3A 1YJ9Q 3CXCS 4N0AA 3THKA 2K7AA 1KK7A 2YUNA 3GF5A 4J6XA 3PIPA 2QA4Q 2X4WA 3OA6A 3CCMA 1GL5A 3VS2A 2QK0A 3CCLT 2E12A 5GAMh 3GLXA 3IKMB 1YIJT 4IURA 2ZAEA 3A1PA 4G85A 1QWFA 1WHKA 1O75A 1NNHA 2O9SA 2COZA 2NUTB 1GBQA 4OMPA 1Q82R 3EG9A 2A36A 3ERRA 4FSXA 3I55T 4C5HA 4F17A 4YRFA 1G5VA 2E6NA 1GFDA 3LC0A 3VS7A 3HFVA 2E4HA 2FRYA 3CCQT 2BZ8A 4C92D 2XU8A 2BE7D 3HXWA 4DEXA 3HPWA 4PNOA 2AZVA 2DKGA 4E7IA 4OB0B 2MAMA 1KQ1A 2JM9A 1WA7A 4EMHA 1OOTA 4A4KA 2LDMA 2O01E 4JRIA 3JAME 4R56A 2Q7EA 3P8BB 3C94A 1UECA 4EPCA 2CJ9A 1Q7YR 3OMCA 4RTTA 4ORZA 5GANj 1IXDA 1ZLMA 2QEXQ 3G71Q 3PCOA 2ROTA 2L3QA 2A37A 2ZCEA 1G3TA 1NYRA 2ZZGA 1Q7YU 1J5WA 3CPWS 5GAN4 2KMTA 1NEBA 1Q7YC 3HTRA 1YJNT 2O4XB 2PVGB 1GRIA 3I7FA 1C0AA 2I0NA 1KQSP 2DFUA 4RQFA 2JMCA 2LQ8A 4RTXA 2BZYA 4ME7A 2DBMA 2HNIA 4P71A 1FYNA 2W10A 2LVMA 2RK2A 5CQXA 2DL3A 2NLUA 4BD3A 3Q1JA 4PJOB 5GAMe 3J7AF 1WLEA 3CD6Q 1YNZA 2NUPA 4E47A 4Y92A 1QKWA 3JB9J 2LJ1A 1ADYA 4FYYB 2CZ0B 2VXEA 2WSFE 3TVTA 5GAOm 2HAXA 1J3TA 2XG8D 2I4LA 2AT1B 5DLQE 2AHJB 2VGMA 2GQIA 4C92B 1NZ9A 3LGFA 1ADJA 3CCMQ 4M7AA 3DB3A 1UJYA 1VQ4T 3OYHA 2XI9A 5FU7C 2RJFA 2DILA 3ME9A 2CJAA 3RKXA 5C52B 1YI2T 4ZNXA 4EMKA 2LX9A 3UWNA 5KH6A 4FU6A 2Q5HA 1S1NA 1YHQT 4PKCC 4NL3A 5LJ3f 2I4OA 1MUZA 2DERA 2DEUA 1R0BG 3IALA 5GAN3 1EX4A 1VQOA 4JZ4A 2EBPA 5FWBA 4XTUA 3CCRA 2ZT7A 3A8MB 3MJXA 4LDVA 2HZYA 1K9MR 5DM7R 3LSSA 2I4MA 5CKHA 1QLYA 2CT3A 4FSSA 2DQ0A 2DL5A 4CRIA 5CR2A 2IG0A 1IZ6A 3HRSA 4X34A 1EZZB 3TSWA 1ZQ1A 2JN0A 3CEYA 4BDYA 1LJOA 2E41A 2HL3A 2BE9B 2CP0A 2RMOA 2ZZDA 4C92E 1WIEA 4UC4A 2A7YA 3S3OA 2XD0A 3VS5A 4P73A 3D7SB 2WSCE 2NWMA 1BIBA 1B34B 1OI1A 2RHXA 3GOXA 3OQ5A 4H2XA 1YIJA 3UT1A 4J9BA 4P75C 11ASA 2RHIA 5KYYB 2QQSA 1AVZC 2CH4A 2PUOB 1JXOA 4CC7A 2CZ6B 4M77G 3EGUA 1E6GA 1ZBXA 4OMQA 4DBRA 5HGQA 1M1KR 4QVDA 1OV3A 2O88A 3MO8A 3PZCA 4JRKA 2AKWB 4C0GA 1USYC 3VS3A 1X2QA 2AZSA 2QQAA 2VASA 3M0PA 3FEOA 4ATOA 2EGCA 3HFOA 2FO0A 2K3BA 5LJ5f 3H0HA 3OW2P 5K1XA 1ZX6A 1D0XA 3CCSA 4YROA 4BB7A 1Y07A 1LOJA 1T0HA 4ZGDB 4ZN3A 3OS0A 3A5ZA 2E3HA 3EFSA 1SERA 5LJ3e 3BJUA 4H2YA 4J9EA 2CP6A 1Q81R 3TEGA 2CJBA 2HMAA 2J3LA 4N4GA 3UH0A 1OYXA 4M75B 2XDDA 2YUOA 1F1BB 1YB3A 2HD0A 4A54A 1AWWA 1QE0A 1M1FA 4KUDK 5GMKl 1YJ9T 1YBYA 4HWRA 2JXBA 3VYGA 1PYSB 2YRCA 1KQ2A 5D6WA 4EIKA 2FG0A 3HP9A 4LDXA 9ATCB 1SSFA 2YRDA 4PL6A 1VQOQ 3CCRQ 4HKEA 4RCBA 1YFNA 5IAYA 1RAHB 4YRJA 1UEBA 3HKSA 3QO7A 5DLOA 4E51A 2YT6A 3A7RA 2LMJA 2K2MA 3QNEA 4YREA 2R57A 1EOVA 2AKLA 1QW1A 4C0DC 1H641 2EQUA 2NUTA 1BYMA 1NM7A 3E19A 2DIQA 1NJ8A 3L2WA 5GANf 1L0WA 2CUDA 1HXDA 5D7UA 2K57A 3VUZA 2DAQA 3EG9B 2DEQA 4CC3A 4M78D 4MMKA 1VQ9T 3CCLQ 1VQ4A 1D0ZA 1OX9A 1YIJQ 1GGMA 3PIOA 3UFGA 4RTWA 2FZCB 4HVCA 1VQKT 2M02A 2ZCFB 5KCOA 3BDUA 3EFRA 1SESA 4MZPA 3TEEA 2ZPEB 1YHQA 5L8RE 2MPXC 1WYDA 3RKWA 1UDLA 3OB9A 4PJNA 3I55Q 4R55A 4DOVA 3N5BB 1EVKA 4E7SA 3VQYA 1JBMA 3CCQQ 1HYOA 1FYFA 4M78C 2ODRD 3CBOA 3GNFB 4CH6A 3EH2A 3V7CA 1ARKA 1KSWA 3CCSQ 4L87A 1QVFS 2QHSA 2O4XA 5KYWB 2RD1A 5DY9A 2PVOB 3NETA 4AMCA 2P0KA 4PJJA 2ZT6A 1G83A 1JRIA 4TQFA 3DLLA 1PCXA 4HCKA 4C5IA 1WLPB 3MP6A 3FDRA 2XK0A 3RIRA 4OVAA 5CKBA 1NLPC 1HTTA 3NFCA 2JT4A 3JB9H 2FHDA 4K11A 5I2SA 2H3EB 4JPBW 2DL4A 4BY6C 2ZIOA 1MGQA 3JB9D 4PJOA 2F2VA 3VJPA 2ODRC 5L23A 2F5KA 3OBWA 3JCMV 4M7AC 3OSSC 3CCMT 4M78F 2K3YA 2NUZA 3NELA 2E5KA 3OS1A 3MF2A 3S3NA 1FMWA 5CKEA 4EMKC 1OPKA 2VWFA 2L3PA 2PQWA 4CC4B 1NEGA 4C92A 2X3WD 1CKAA 2QTVA 3CCVA 4UP7A 2XKOC 2X4YA 1QQJA 1SKUB 4JZ3A 1PSFA 1ZUYA 2C0TA 1RAEB 1WXBA 4RMFA 2KE9A 4M7AF 2FRWA 2ED1A 2V1RA 1K73R 5A0LA 1VOMA 4H2UA 3TQ7P 1VQNT 4P5NA 2E3IA 1TS9A 4QQ6A 2CSIA 2KQWA 2FL7A 2DXCA 1X2KA 2DU5A 4LNPA 5CCAA 1VQ4Q 4LD6A 5FRNA 1WHHA 1AWOA 2RB6A 1EIFA 5KE3A 4PJLA 1MV3A 5I2MA 1SHGA 1SF9A 2GTJA 4MZMA 3QHSA 1SEMA 2JOYA 1M3BA 2D6FA 1PHTA 2P0PA 1YI2Q 1Y71A 3JB9F 2EW3A 1YHQQ 1X43A 2GGRA 3REUA 3BDLA 3QO8A 3A5YA 5ELOA 3QJ6A 1UHFA 4YRNA 2HSPA 5K1PA 3CC7A 3EG3A 4EX5A 4YRCA 3WQZA 4M77D 4AFSC 4M78E 2RA2A 3KFVA 4B9XA 5IHIA 1MMDA 2X35A 1I1JA 5IXBA 3QZ9B 1EQRA 4V2SA 1KQSS 3V8KA 4IKFA 1B34A 1Q86R 2ZPHB 2EGAA 1SPKA 4J6WA 4XTZA 2DL7A 2EKOA 1JJ2A 5KYYA 2ZTGA 4RG8A 3M0UA 1H3HA 1N8RR 3MEYA 4H2XB 2YXYA 5F5WA 2M51A 2M0OA 3V7SA 2LQKA 1Q86U 3A8HB 1RLQC 3CMQA 3O5ZA 2CKKA 1V76A 1Q86C 1X75C 5KYXA 1SSHA 1O9SA 4CH5A 3L2VA 2DDZA 2AKWA 4LVMA 3PGGA 3OSVA 3MCAB 3LYIA 4Q15A 4WF2A 1WHMA 2M1HA 1VQ9A 1R77A 1K0SA 1PG5B 2OTLA 1GFCA 3EGXB 2C0OA 4NCXA 1VQMT 2JTFA 1M8VA 1AZGB 3I5RA 3UF4A 1S72A 3CCUT 3SWNA 4RDXA 3VS6A 1WDXA 3RNJA 4ZTFA 1T0JA 1GCPA 1UGSB 3CCVQ 3G7ZA 2YLBA 3WXMB 3VYHB 1M5Q1 1GCQC 3REXA 2Y4XA 2JTMA 3KUFA 4BACA 3HXYA 4M75A 1HJDA 3CCRT 5GAMg 3OYKA 3A7AA 2IPOB 2CP3A 3FC3A 2DM1A 3FJPA 2RNAA 4WJ4A 3C12A 4X1VA 1PYSA 1PRMC 1EVLA 5J3BA 4DBHA 2MF2A 4M77B 2V8IA 1TH7A 2D0QB 4LUEA 1SRMA 2KY9A 4C0FA 4YTLA 4UPAA 3P8VA 3QO3A 5KYNA 2YWWA 3EG1A 5GAOq 2JTEA 2VUBA 1ABOA 1RAIB 4WTOB 2E5AA 1JQQA 4JJDA 5KYUB 4HCBA 4D8DA 4XU3A 3C0CA 4IUPA 1NJIR 1G2BA 3SD4A 3CC7Q 5A0DA 1QCNA 4AFUC 3QJYA 4GY5A 4F7UF 1NJIU 2YHTA 3JCMX 4FL6A 2DX1A 2EYZA 1NJIC 1YJWA 2LT4A 3QZ5B 2ESWA 1Y0MA 1A0NB 2FZKB 4BI4A 4PHCA 3EGDB 4IUVA 1Q82U 3VBBA 1VYVA 2CS7A 2G6FX 2Z0WA 2L5QA 1VQ7T 4WJ3M 1Q82C 4DBFA 3CCST 3OYCA 3RERA 1QCFA 4NOYA 3JCMP 1M2OA 1CSKA 4M77E 1WQ7A 1VQNA 4OB2B 4E7JA 2G3RA 3DB4A 4ZGEB 2MK5A 5GAMd 4YCUA 1VQ9Q 1WNLA 4M78G 1B8AA 4A4EA 3OW2S 3A8LB 1PNJA 2EPDA 2GFAA 2MMPA 1RL2A 1VQKQ 2OTLQ 1E24A 1RADB 1JJ2P 3SB2A 2F69A 2ALYB 5KYWA 1S72Q 3QPHA 4KR3A 3OW2A 4PJMA 2MWPA 1ZSZC 2QXFA 3OS5A 3HXVA 1I4K1 3RMQA 1WYXA 4LE9A 1M30A 3M0SA 1TOVA 4J83A 4ZTJA 3SDZA 1VQPA 2RH2A 4XU1A 1KIKA 1UGVA 2RHSB 4M7AG 3RBBB 4QW2A 2LX7A 2CZ1B 4LVKA 4J5YA 2KT1A 1TXQA 2WSEE 2JS2A 2LNHB 1AZEA 5GMKj 1OQKA 1E1TA 4OB1B 4NL2A 2I2LA 4J7IA 3ZFJA 2RQRA 3QDFA 1PKTA 1AD5A 3GPLA 3LWIA 1ZSGA 5LJ3g 1U1TA 1NBEB 3VQVA 2M16A 3I9QA 1MMGA 3LLRA 1UGPB 1AOJA 3JB9G 3JCMc 4J9HA 5J26A 2X51A 3HY0A 4LDWA 3VKIA 1NJ5A 5GAOl 2ARSA 2ZGWA 5FRMA 3MF1A 5GAOp 5KNNA 4RUGA 1BKBA 1WI7A 1JB0E 1VQMA 3X28B 5FU6C 3SFMA 5IT9E 4M7DD 3CCUA 2ZR3A 4OB3B 2KXDA 4RTZA 2P5IA 4OLFA 1OX8A 2R5AA 2KT8A 3M0TA 2Q5IA 4IIOA 3FB9A 1QP2A 1GXIE 5LJ3h 2EVRA 3UPUA 2K79A 2YLCA 5EG2A 4AG1C 4Y91A 2A28A 4L6V5 4C8QD 1WXTA 1X69A 1IL2A 2K2VA 1VA7A 3PVLA 4YRLA 2LCCA 2DLPA 1C0MA 3NEMA 3URGA 3QYGB 1VQNQ 4K86A 4DOWA 1K9MU 1U06A 4M7DC 4PK4A 3KFUA 4FIBA 3E9FA 1YN8A 1K9MC 1BBWA 4EMGA 1SRYA 4F16A 3VS1A 3HRIA 4IUUA 1SRLA 3MKDA 3AHUA 5GJWB 1E1OA 5FU7B 4ZN1A 2X9HA 4C8QC 5I11A 3GNGA 4BE1A 2KXCA 4J8OA 4K87A 2DTOA 1G5IA 4YRSA 1E7OA 5LJ3d 3GIBA 2DRMA 3VS0A 2CGHA 4E7ZA 2PUKB 1PWTA 2MI6A 3EHRA 3VS4A 2OTJT 1VQPQ 1M3CA 4M7DF 2EFIA 1JJCB 4HVWA 4KH0B 5KYXB 4P74A 2Q7HA 5HCKA 2VC8A 3CCVT 2JVVA 4KH1B 1M1KU 4HA8A 1HD3A 4DEYA 3L42A 1WX6A 5GAN5 3EGXA 4C8QF 3REBB 1M1KC 1VQ7A 4YRQA 4XEMA 2XTIA 2CP7A 2B86A 5LJ5h 4DA4A 3LGLA 1U5SA 2PVDB 3X24B 3SWNB 2HBPA 2JZ2A 1NYGA 2F2XA 2AMCB 3OYGA 3HRUA 3M4GA 5A0GA 4K88A 2FPFA 1WXUA 1YFSA 2COWA 2PMFA 1KC8R 2JS0A 1W6XA 3ZL7C 4D6WA 1K1ZA 4KRTA 1VQMQ 2DMOA 2RI2A 1Q81U 4F7UG 4N0AC 3OYAA 5CAIA 3CCUQ 1LYLA 1NLOC 4KQEA 3RUXA 4M77A 3OYNA 1KC8U 2PU9B 1Q81C 4PLIA 1QVGP 4JJNK 4QQGA 4KGVB 3S6WA 3EFOA 1KC8C 4P72A 5GAN2 4Q6GA 2LCLA 5GMKi 1TU0B 3CC7T 3QDRB 3NPFA 4DBQA 4HT4A 3CC4T 1RAFB 2QQRA 2LT1A 3G1ZA 3E2UA 2ZXFA 4PFOA 5HKCA 2CH4W 5KYUA 3RESA 4F14A 2R5MA 4J9CA 1UTIA 4Z02A 4M7DE 2DPPB 3M4YA 2JM8A 1NE8A 4TTVA 2KGTA 2P84A 1OU8A 2M0YA 3S3MA 1W66A 3QIIA 3PMIA 3L2QA 4TVYA 2DZ9A 3JCMf 4B6MA 1XOVA 2J7IA 3X25B 3L4GB 4C8QE 3MEWA 4UP9A 5GANh 2DTIA 4AG2C 2VB6A 4FW1A 3EGDA 4LD9K 4MDXA 4TQDA 4CS3A 4IIMA 3JV3A 4OMLA 3MHXA 2OTLT 1Z7NA 5LJ5e 2Y4YA 5CIUA 3TU4K 1H92A 1K4US 2EYWA 1VUBA 3L2RA 1S72T 1Y7XA 1QWEA 2DRKA 2NS6A 2DNUA 1YITA 1H3ZA 4Q5WA 4ELZC 4HWSA 3VQWA 5CO7A 4ESRA 4X9CA 4A53A 4Z88A 5GAMj 4LDUA 3HY1A 1HC7A 4JJCA 1VQ7Q 2ALYA 1FMVA 3EH1A 2OAUA 4LXCA 4P71C 1BI2A 4M7AD 4YYEA 1LVKA 1WHLA 2EGEA 2E3CA 1YFTA 1KOGA 5GAOr 2BZXA 4BW9A 4BI3A 2AK5A 2DYIA 1IREB 4WCIA 3JCMb 2P0LA 2IY5B 1LNXA 3NHNA 3BY7A 4RKUE 5D6XA 1WPYA 2DETA 1G3SA 4HXJA 3G4SA 1T3LA 4CS2A 3HRTA 2RHSA 3KXTA 1PRLC 1OULA 1KMMA 4HVUA 3M0RA 1B3QA 2K5LA 2PZ1A 2CP5A 4Y28E 2LTOA 3J81E 4BI8B 3UA7A 3OYDA 2ABLA 3KBGA 3MEVA 2FYKA 2YDLA 3TCJA 1G5HA 3QWXX 2DVJA 1NPRA 2DBKA 2VVKA 2WACA 3PT9A 4FYVB 4C0ZA 1N9RA 4OMNA 2OTJA 1EFWA 3UDCA 3TSZA
chains in the Genus database with same CATH topology
5GANe 4M78B 3JCMe 4J7FA 2Q7GA 1YJWT 3H6ZA 3OYJA 4LVIA 2DIGA 2Y90A 2VV5A 3VQXA 2RHQB 3A32A 5GAN7 1VQLA 3RGLA 2PMEA 3R6OA 3OBYA 2BKDN 4BY6B 2RI3A 1K73U 1NJ2A 3H8ZA 4A4GA 2KK4A 3UGQA 4OGCA 1M4ZA 3OYBA 1K73C 2ZT5A 3BW1A 3WVEB 2L8DA 2CZ7B 4KBMB 2EQJA 3FLGA 3RACA 2K5FA 2BUDA 2JNGA 4M7DG 1EIYB 4P73C 5FLXE 4YCWA 2C06A 2ARUA 3O8VA 3M9QA 2XDBA 1H4QA 3DLMA 3CC2A 1JJ2S 3CC4A 4C8QG 1VQPT 4VUBA 4ZTUB 3HXXA 1KD1U 2ZPFB 4ZIBA 3G6EA 1KD1C 4L59A 2RHUA 2G4CA 1Z7MA 3L2ZA 1Y96B 1WJQA 2RHYA 2ZPBB 1X56A 3M4PA 5C53B 1JJCA 3TUPA 2EIFA 1N8RU 4H2TA 3QTCA 2JUFA 1N8RC 3X20B 4M7AE 2K5IA 4YDQA 2DD4A 2P0QA 2XHCA 3CMEA 3CCJT 4OF1A 2DJZA 1VQ5A 4E7KA 1QF6A 3PNWC 4YP0A 2AMCA 4RMOA 1UGQB 1OZ3A 2RJCA 4XK8E 5KCHA 3OYFA 4YRTA 3ZBDA 4TWAA 4P75A 1WQWA 2VGNA 2ZR2A 5J39A 4HCCA 3LX7A 2DVEA 4J6YA 2H3JA 3RMSA 1BI0A 4OP0A 3M58A 1FWZA 1USYA 3QUIA 1RI0A 1YGBA 3M59A 4YRGA 2GF7A 2ZPIB 1ASZA 1SETA 4CI0C 4O2DA 3VV0A 2GFUA 3RKYA 3HFNA 3NENA 2RHZA 3OD1A 4TVAB 2LC4A 3CD6A 2ARTA 1M9SA 2RM4A 2QTXA 1H4TA 1FX7A 3JCMQ 2DQ3A 1N6AA 3L4GA 4C5EA 4P3NA 3HTZA 3A8GB 3QBYA 1KHCA 5GAMf 2KDSA 2MWOA 3C4SA 3LW5E 4A4FA 4QVZA 2E6ZA 4F7UB 1KG1A 4PJOD 1B7YB 5I21A 3CXCA 3CMAA 4CH4A 3NTKA 1DJ7B 2QQ9A 2L3RA 2EYQA 2E5QA 5M9OA 3MEAA 4MDWA 2CYZB 3A8OB 3M4QA 4G84A 2LRQA 1QVPA 3F70A 2XGTA 3OMGA 4L5GA 4PJOC 2M9UA 2E65A 4H2VA 1VQ6T 3ICAA 2L89A 2ZIMA 3IKLA 3TEHB 3FIFA 2IY5A 3P8DA 3HL8A 3JB9I 2EJFA 1X2GA 4N4HA 3M53A 1OZ2A 4OGEA 3EAEA 2E1HA 2VYTA 4H2SA 4BE0A 2KAFA 4PG3A 4C92C 2BIVA 3M55A 2RK1A 4FM4B 1QVGS 1WU7A 1KMNA 4E7LA 4C5GA 1U8RA 4F7UE 3OS2A 4QVCA 4KUIA 5LL6S 4YRIA 4P3OA 2DZCA 1K8AU 2I4NA 5KE2A 1V29B 3CPWA 4PJOF 4YRRA 1G3YA 1K8AC 1QVGA 4M78A 2A3LA 1PSEA 1NPPA 1M90U 3M56A 2P4TA 2QQBA 4KULA 2E64A 1M90C 1D3BB 4KT0E 2RO0A 1H4SA 4C92F 3I56A 2QI2A 3CCJA 2DXBA 3IG2A 2RHQA 4AH6A 2C8MA 1RIQA 2FVUA 2E70A 1X2HA 4JLGA 1YITT 3E9GA 2QHVA 3PMTA 5GAN6 3QXEB 5CVIA 1P92A 1H4VB 2B8AA 2EJ9A 1I8FA 1EIYA 1MHNA 2ZNJA 4FT2A 4RG2A 2F5TX 4XTYA 4YRMA 4XTXA 4BWAA 1WGSA 4GLKA 1R8OB 5HK3A 3G4ST 4LVJA 2CIMA 1B70B 3A74A 3LSQA 2ZINA 1HK9A 2RI5A 4PJOE 5FU6B 4M75D 1VQ8A 2ZT8A 5LJ5g 1G51A 2A8EA 1W4SA 1Y96A 3V8JA 3JSCA 4HCZA 3SWNC 2VXFA 1QP3A 3A7UA 4LDYA 4YRPA 5D6YA 3CCLA 1BI1A 1VIEA 4M75C 1VQZA 4M7DB 1WJSA 3PFSA 3J80E 4HWTA 5ELNA 4CH3A 3QSUA 2EJGA 1VQLT 4B9WA 5C51B 2C7IA 3I55A 3P8YA 2QDYB 4C8QB 4XU2A 2K4YA 3NTIA 3CCQA 2ZZFA 3DKMA 3MP1A 4RCCA 4JS5A 4JLIA 2EL9A 2HQEA 4M75F 1VQ6A 2K3XA 2XDPA 2DO3A 3JCMg 4N4IA 5GANg 5GMKm 3BFMA 2EWNA 3CC2T 3CCET 3CBMA 3OYEA 2LNVA 1B76A 4HT9A 3HXZA 5LJ5d 4A4HA 1YFRA 3G6ET 1YJNA 1NJ6A 1E22A 5AYFA 2DXUA 4TVAA 2QA4T 3OYLA 2GQVA 3PTAA 4EO4A 2E10A 2EAYA 4X5OA 1M1GA 3META 2DTHA 5HY6A 4XEOA 3HRKA 3P8HA 3A31A 4MMLA 3OYIA 5GAN8 4JRPA 3HFZB 1X55A 3HSBA 3JCMh 5E3IA 4HWPA 3MP8A 4F7UA 12ASA 1BI3A 3OYMA 1AHJB 1B7YA 3CMET 3OYYA 1VQ5T 3VUBA 3QO5A 5C6SA 1ASYA 1NJ1A 4CS4A 4DQ2A 1N9WA 2QEXT 3G71T 4M75E 1X01A 5CQYA 2J3MA 4PJOG 3FRNA 3LWHA 1YI2A 4C0DB 4JRQA 1X54A 4QQDA 5GMKh 3JCMd 5GANd 3TEHA 3E1SA 4P3PA 3NTHA 4EDUA 3P8TA 3C95A 4C92G 3PCOB 2V8KA 2V8JA 1XNIA 4X9DA 4IUQA 1N27A 3TREA 2DD5A 3OY9A 4XU0A 1XTDA 3CD6T 3DSQA 2RJDA 3M57A 4WI1A 1XQHA 5CK9A 1QVFA 4RQEA 5HK0A 4FT4A 3HXUA 1ZHIA 3UGTA 4XTVA 4BDZA 1G3WA 1D3BA 2XICA 1KHIA 4NS5A 4H2WA 4HT8A 2YRVA 4XQ3A 4JUVA 2X4XA 5CKFA 3GP8A 3JCMJ 1W2BS 2DXTA 3CMAT 3HHTB 4XAXB 4O6JA 3VU3C 1W2BA 4M7AB 3L1AA 2EQMA 2GCXA 1X6OA 4H02A 3M5AA 2QHUA 4JDSA 3CPFA 4LNSA 4YRKA 3V7RA 5GMKe 1YCYA 4EMKB 4ZGJB 4BUGA 3E9HA 2ZPGB 5GAOn 3R07A 2ZZEA 4E7HA 3RF1A 2DK3A 4TVRA 3QYHB 3CCEA 1B70A 5A2QE 1YJ9A 2DU7A 4P74C 2QA4A 5C0MA 4ZTZB 3INZA 2EQKA 1U1SA 1FXXA 3CBPA 5LJ3j 1I81A 3LH0A 4MZTA 2HQXA 4JS4A 1VIFA 2IVWA 4M75G 4M7DA 4J15A 3I56T 3W3SA 1KQSA 4UP8A 3QG1A 4M77C 4C8QA 3L2UA 4II1A 3RL6A 1UB4A 3V8LA 4P72C 2QEXA 3G71A 1BBUA 3MEUA 5IN1A 5CKDA 1N9SA 3QKJA 1VQKA 4PLLA 2KVQG 2ZNIA 4HWOA 3ZEHA 2R58A 3X26B 1I5LA 4LVLA 4OMFB 3JCMW 3A5ZB 5FROA 1ATIA 1WJRA 4ELYC 4IUTA 2FB7A 2QHTA 3MQZA 1VQOT 4M77F 1UGRB 4KR2A 1NYQA 2X4JA 3E9IA 4XTWA 4O5VA 1VQ8T 5LJ5j 3ASKA 4DPGA 4YCVA 1BIAA 3WVDB 2RJEA 2KSSA 3T9NA 3M54A 3JRZA 4YPFA 2XIDA 3HFZA 4BE2A 3ER0A 2D9TA 4TVWA 3CXCS 4N0AA 3GF5A 4J6XA 3PIPA 2X4WA 3OA6A 3CCMA 3CCLT 2E12A 5GAMh 3GLXA 3IKMB 1YIJT 4IURA 4G85A 1O75A 1NNHA 3ERRA 4FSXA 3I55T 4C5HA 4YRFA 1G5VA 2E6NA 3LC0A 3HFVA 3CCQT 4C92D 2XU8A 3HXWA 3HPWA 4PNOA 2DKGA 4E7IA 4OB0B 2MAMA 1KQ1A 4EMHA 4A4KA 2LDMA 3JAME 4R56A 2O01E 4JRIA 2Q7EA 3P8BB 3C94A 4EPCA 2CJ9A 3OMCA 5GANj 3PCOA 2ZCEA 1G3TA 1NYRA 2ZZGA 1Q7YU 1J5WA 3CPWS 5GAN4 2KMTA 1Q7YC 1YJNT 2O4XB 2PVGB 3I7FA 1C0AA 4RQFA 2LQ8A 4ME7A 2HNIA 4P71A 2LVMA 2RK2A 5CQXA 2NLUA 4BD3A 3Q1JA 4PJOB 5GAMe 3J7AF 1WLEA 4E47A 3JB9J 1ADYA 2CZ0B 2VXEA 2WSFE 5GAOm 2HAXA 2XG8D 2I4LA 5DLQE 2AHJB 2VGMA 4C92B 1NZ9A 3LGFA 1ADJA 4M7AA 3DB3A 1VQ4T 3OYHA 2XI9A 5FU7C 2RJFA 3ME9A 2CJAA 3RKXA 5C52B 1YI2T 4EMKA 2LX9A 3UWNA 5KH6A 4FU6A 2Q5HA 1YHQT 4PKCC 4NL3A 5LJ3f 2I4OA 3IALA 5GAN3 1VQOA 4XTUA 3CCRA 2ZT7A 3A8MB 4LDVA 5DM7R 3LSSA 2I4MA 5CKHA 2DQ0A 4CRIA 5CR2A 2IG0A 1IZ6A 3HRSA 4X34A 4BDYA 1ZQ1A 2JN0A 3CEYA 1LJOA 2E41A 2ZZDA 4C92E 4UC4A 2A7YA 3S3OA 2XD0A 4P73A 2WSCE 1BIBA 1B34B 2RHXA 1OI1A 3GOXA 3OQ5A 4H2XA 1YIJA 3UT1A 11ASA 4P75C 2RHIA 2QQSA 2PUOB 2CZ6B 4M77G 5HGQA 1ZBXA 4QVDA 3MO8A 3PZCA 4JRKA 2AKWB 4C0GA 1USYC 2QQAA 3FEOA 4ATOA 3HFOA 5LJ5f 5K1XA 3CCSA 4YROA 4BB7A 1Y07A 1LOJA 4ZGDB 4ZN3A 3OS0A 3A5ZA 3EFSA 1SERA 5LJ3e 3BJUA 4H2YA 3TEGA 2CJBA 2J3LA 4N4GA 3UH0A 1OYXA 4M75B 2XDDA 1YB3A 2HD0A 4A54A 1QE0A 1M1FA 4KUDK 5GMKl 1YJ9T 1YBYA 4HWRA 3VYGA 1PYSB 1KQ2A 5D6WA 4LDXA 3HP9A 1SSFA 4PL6A 4HKEA 4RCBA 5IAYA 4YRJA 1UEBA 3HKSA 3QO7A 5DLOA 4E51A 3A7RA 3QNEA 4YREA 2R57A 1EOVA 1QW1A 4C0DC 1H641 2EQUA 1BYMA 3E19A 2DIQA 1NJ8A 3L2WA 5GANf 1L0WA 1HXDA 2K57A 3VUZA 2DAQA 2DEQA 4M78D 4MMKA 1VQ9T 1VQ4A 1GGMA 3PIOA 3UFGA 4HVCA 1VQKT 2ZCFB 5KCOA 3BDUA 3EFRA 1SESA 4MZPA 3TEEA 2ZPEB 1YHQA 5L8RE 1WYDA 3RKWA 3OB9A 4R55A 4DOVA 3N5BB 1EVKA 3VQYA 1JBMA 1FYFA 4M78C 2ODRD 3CBOA 3GNFB 4CH6A 3V7CA 4L87A 1QVFS 2QHSA 2O4XA 2RD1A 5DY9A 2PVOB 3NETA 2P0KA 2ZT6A 1JRIA 4TQFA 3DLLA 4C5IA 3MP6A 3FDRA 2XK0A 3RIRA 4OVAA 5CKBA 1HTTA 3NFCA 3JB9H 2FHDA 2ZIOA 5I2SA 4BY6C 1MGQA 3JB9D 4PJOA 3VJPA 2ODRC 2F5KA 3OBWA 3JCMV 4M7AC 3OSSC 3CCMT 4M78F 2K3YA 3NELA 3OS1A 3MF2A 3S3NA 5CKEA 4EMKC 2PQWA 4C92A 3CCVA 4UP7A 2XKOC 2X4YA 1PSFA 4RMFA 4M7AF 5A0LA 4H2UA 1VQNT 4P5NA 4QQ6A 2KQWA 2FL7A 2DXCA 2DU5A 5CCAA 4LD6A 5FRNA 2RB6A 1EIFA 5KE3A 5I2MA 4MZMA 3QHSA 2JOYA 2D6FA 2P0PA 1Y71A 3JB9F 3REUA 3BDLA 3QO8A 3A5YA 5ELOA 3QJ6A 4YRNA 5K1PA 3CC7A 4EX5A 4YRCA 3WQZA 4M77D 4M78E 2RA2A 4B9XA 2X35A 3QZ9B 1EQRA 4V2SA 1KQSS 3V8KA 4IKFA 1B34A 2ZPHB 4J6WA 4XTZA 2EKOA 1JJ2A 2ZTGA 4RG8A 3MEYA 4H2XB 5F5WA 2M0OA 3V7SA 2LQKA 1Q86U 3A8HB 3CMQA 2CKKA 1Q86C 1X75C 1O9SA 4CH5A 3L2VA 2DDZA 2AKWA 4LVMA 3PGGA 3OSVA 3MCAB 3LYIA 4Q15A 4WF2A 2M1HA 1VQ9A 2OTLA 4NCXA 1VQMT 2JTFA 1M8VA 1S72A 3CCUT 3SWNA 4RDXA 4ZTFA 1UGSB 3G7ZA 2YLBA 3WXMB 3VYHB 1M5Q1 3REXA 2Y4XA 2JTMA 3KUFA 4BACA 3HXYA 4M75A 3CCRT 5GAMg 3OYKA 3A7AA 3FC3A 3FJPA 4WJ4A 3C12A 1PYSA 1EVLA 5J3BA 2MF2A 4M77B 2V8IA 1TH7A 2D0QB 2KY9A 4C0FA 4YTLA 4UPAA 3P8VA 3QO3A 5GAOq 2VUBA 2E5AA 4HCBA 4XU3A 4IUPA 3SD4A 5A0DA 3QJYA 4GY5A 4F7UF 1NJIU 2YHTA 3JCMX 4FL6A 1NJIC 1YJWA 2LT4A 3QZ5B 4BI4A 4PHCA 4IUVA 1Q82U 3VBBA 2CS7A 2L5QA 1VQ7T 4WJ3M 1Q82C 3CCST 3OYCA 3RERA 4NOYA 3JCMP 4M77E 1WQ7A 1VQNA 4OB2B 4E7JA 2G3RA 3DB4A 4ZGEB 4YCUA 5GAMd 1WNLA 4M78G 1B8AA 4A4EA 3OW2S 3A8LB 2GFAA 2MMPA 1RL2A 1E24A 3SB2A 2F69A 2ALYB 3QPHA 4KR3A 3OW2A 2MWPA 2QXFA 3OS5A 3HXVA 1I4K1 3RMQA 4J83A 4ZTJA 3SDZA 1VQPA 2RH2A 4XU1A 2RHSB 4M7AG 4QW2A 2CZ1B 4LVKA 4J5YA 2WSEE 5GMKj 1E1TA 4OB1B 4NL2A 2I2LA 4J7IA 3ZFJA 3GPLA 3LWIA 5LJ3g 1U1TA 3VQVA 2M16A 3LLRA 1UGPB 3JB9G 3JCMc 5J26A 3HY0A 4LDWA 3VKIA 1NJ5A 5GAOl 2ARSA 2ZGWA 5FRMA 3MF1A 5GAOp 5KNNA 1BKBA 1JB0E 1VQMA 3X28B 5FU6C 3SFMA 5IT9E 4M7DD 3CCUA 2ZR3A 4OB3B 2P5IA 4OLFA 2R5AA 2Q5IA 3FB9A 1QP2A 1GXIE 5LJ3h 3UPUA 2YLCA 5EG2A 4Y91A 4L6V5 4C8QD 1IL2A 2K2VA 4YRLA 2LCCA 3NEMA 3URGA 3QYGB 4K86A 4DOWA 1K9MU 4M7DC 3KFUA 4FIBA 3E9FA 1K9MC 1BBWA 4EMGA 1SRYA 3HRIA 4IUUA 3AHUA 1E1OA 5FU7B 4ZN1A 4C8QC 3GNGA 4BE1A 4J8OA 4K87A 2DTOA 1G5IA 4YRSA 5LJ3d 3GIBA 2CGHA 2PUKB 2MI6A 2OTJT 4M7DF 2EFIA 1JJCB 4P74A 2Q7HA 3CCVT 2VC8A 2JVVA 1M1KU 4HA8A 3L42A 5GAN5 4C8QF 1M1KC 1VQ7A 4YRQA 4XEMA 2XTIA 5LJ5h 4DA4A 3LGLA 2PVDB 3X24B 3SWNB 2HBPA 2JZ2A 2AMCB 3OYGA 3HRUA 3M4GA 5A0GA 4K88A 1YFSA 2PMFA 4D6WA 2RI2A 1Q81U 4F7UG 4N0AC 3OYAA 5CAIA 1LYLA 4KQEA 3RUXA 4M77A 3OYNA 1KC8U 2PU9B 1Q81C 4PLIA 4JJNK 4QQGA 3S6WA 1KC8C 4P72A 5GAN2 4Q6GA 2LCLA 5GMKi 3CC7T 3QDRB 4HT4A 3CC4T 2QQRA 2LT1A 3G1ZA 2ZXFA 5HKCA 3RESA 2R5MA 4Z02A 4M7DE 2DPPB 3M4YA 1NE8A 4TTVA 3S3MA 1W66A 3QIIA 3PMIA 3L2QA 4TVYA 2DZ9A 3JCMf 1XOVA 3X25B 3L4GB 4C8QE 3MEWA 4UP9A 5GANh 2DTIA 4LD9K 4MDXA 4TQDA 4CS3A 3MHXA 2OTLT 1Z7NA 5LJ5e 2Y4YA 5CIUA 3TU4K 1VUBA 3L2RA 1S72T 1Y7XA 2NS6A 1YITA 1H3ZA 4Q5WA 4ELZC 4HWSA 3VQWA 5CO7A 4X9CA 4A53A 5GAMj 4LDUA 3HY1A 1HC7A 2ALYA 2OAUA 4P71C 1BI2A 4M7AD 4YYEA 2E3CA 1YFTA 1KOGA 5GAOr 4BW9A 4BI3A 1IREB 3JCMb 2P0LA 2IY5B 1LNXA 3BY7A 4RKUE 5D6XA 1WPYA 1G3SA 3G4SA 4CS2A 3HRTA 2RHSA 3KXTA 1KMMA 2K5LA 4Y28E 2LTOA 3J81E 4BI8B 3OYDA 3KBGA 3MEVA 2FYKA 3TCJA 1G5HA 1NPRA 2WACA 3PT9A 4C0ZA 1N9RA 2OTJA 1EFWA 3UDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN e;  4M78 B;  3JCM e;  5GAM g;  3A7A A;  3JB9 J;  2Q7G A;  3FJP A;  3JCM g;  5GAN g;  5GMK m;  3BFM A;  4WJ4 A;  1ADY A;  2EWN A;  1PYS A;  1EVL A;  2VXE A;  5GAO m;  4M77 B;  1TH7 A;  2I4L A;  2Y90 A;  1B76 A;  4C92 B;  4HT9 A;  3HXZ A;  5LJ5 d;  1YFR A;  1ADJ A;  4UPA A;  3VQX A;  2RHQ B;  1NJ6 A;  3A32 A;  1E22 A;  4M7A A;  2DXU A;  3P8V A;  3QO3 A;  5GAN 7;  4TVA A;  3RGL A;  2PME A;  5GAO q;  4EO4 A;  2E10 A;  2EAY A;  2CJA A;  3RKX A;  2E5A A;  4X5O A;  5C52 B;  2DTH A;  4EMK A;  1NJ2 A;  4XEO A;  3HRK A;  3UGQ A;  3A31 A;  4MML A;  4XU3 A;  2Q5H A;  5GAN 8;  4NL3 A;  2ZT5 A;  3BW1 A;  5LJ3 f;  2I4O A;  3HFZ B;  1X55 A;  3HSB A;  3JCM h;  5E3I A;  3RAC A;  3IAL A;  4HWP A;  5GAN 3;  4F7U A;  4F7U F;  4M7D G;  12AS A;  4XTU A;  2ZT7 A;  1EIY B;  4P73 C;  2YHT A;  1B7Y A;  4YCW A;  3JCM X;  2ARU A;  3LSS A;  2I4M A;  1H4Q A;  2DQ0 A;  4PHC A;  4C8Q G;  3QO5 A;  3VBB A;  4ZTU B;  3HXX A;  4WJ3 M;  4ZIB A;  1ASY A;  1NJ1 A;  4CS4 A;  4DQ2 A;  1N9W A;  3RER A;  2JN0 A;  1LJO A;  4M75 E;  1X01 A;  4NOY A;  2E41 A;  3JCM P;  2G4C A;  4M77 E;  1WQ7 A;  1Z7M A;  3L2Z A;  4C92 E;  2J3M A;  4PJO G;  1Y96 B;  1X56 A;  4YCU A;  5GAM d;  1X54 A;  3M4P A;  4P73 A;  5C53 B;  1WNL A;  4M78 G;  1B8A A;  1JJC A;  3TUP A;  1BIB A;  1B34 B;  5GMK h;  3JCM d;  5GAN d;  3TEH A;  4H2X A;  1E24 A;  11AS A;  4H2T A;  4P75 C;  3QTC A;  3SB2 A;  2ALY B;  4P3P A;  3P8T A;  4M77 G;  4M7A E;  5HGQ A;  4YDQ A;  4C92 G;  4QVD A;  3PCO B;  4KR3 A;  3PZC A;  4X9D A;  4JRK A;  2DJZ A;  2AKW B;  3HXV A;  1I4K 1;  1USY C;  4XU0 A;  3HFO A;  1QF6 A;  4XU1 A;  4YP0 A;  2AMC A;  3DSQ A;  2RHS B;  5LJ5 f;  4WI1 A;  5K1X A;  4M7A G;  4YRO A;  4YRT A;  1LOJ A;  4TWA A;  4J5Y A;  3A5Z A;  4P75 A;  4RQE A;  5GMK j;  1WQW A;  3EFS A;  1SER A;  5LJ3 e;  1E1T A;  2ZR2 A;  3HXU A;  3UGT A;  4NL2 A;  3BJU A;  2I2L A;  4H2Y A;  4XTV A;  2DVE A;  4J6Y A;  1D3B A;  3TEG A;  5LJ3 g;  2CJB A;  1U1T A;  2J3L A;  3UH0 A;  4OP0 A;  4M75 B;  3VQV A;  4H2W A;  4HT8 A;  4XQ3 A;  1YB3 A;  4JUV A;  4A54 A;  3JB9 G;  3QUI A;  3JCM c;  1QE0 A;  3JCM J;  1USY A;  5GMK l;  2DXT A;  1YGB A;  3HY0 A;  4YRG A;  1NJ5 A;  5GAO l;  4HWR A;  1PYS B;  2ARS A;  2ZGW A;  3MF1 A;  1KQ2 A;  1ASZ A;  5GAO p;  1SET A;  5KNN A;  4O2D A;  3RKY A;  3HFN A;  3NEN A;  3VU3 C;  4M7D D;  3OD1 A;  2ZR3 A;  4M7A B;  3L1A A;  4TVA B;  4RCB A;  2P5I A;  2ART A;  4OLF A;  4YRJ A;  2Q5I A;  4H02 A;  2QHU A;  3QO7 A;  2RM4 A;  3FB9 A;  2QTX A;  1H4T A;  4LNS A;  5LJ3 h;  3JCM Q;  4E51 A;  4YRK A;  2DQ3 A;  2YLC A;  4Y91 A;  3V7R A;  1YCY A;  5GMK e;  4EMK B;  3A7R A;  4C8Q D;  3L4G A;  3QNE A;  3E9H A;  1IL2 A;  4YRE A;  1EOV A;  5GAO n;  4P3N A;  3HTZ A;  3R07 A;  2ZZE A;  4YRL A;  5GAM f;  1H64 1;  3RF1 A;  1NJ8 A;  3NEM A;  5GAN f;  4F7U B;  1L0W A;  1HXD A;  4K86 A;  2K57 A;  1B70 A;  4M7D C;  4PJO D;  3KFU A;  1B7Y B;  5I21 A;  2DEQ A;  1BBW A;  4EMG A;  2DU7 A;  4P74 C;  1SRY A;  4CH4 A;  4M78 D;  4MMK A;  3HRI A;  4ZTZ B;  3INZ A;  1GGM A;  3AHU A;  1E1O A;  3UFG A;  4HVC A;  1U1S A;  4C8Q C;  3BDU A;  3EFR A;  1SES A;  5LJ3 j;  1I81 A;  4K87 A;  2DTO A;  1G5I A;  3M4Q A;  1WYD A;  3RKW A;  5LJ3 d;  4G84 A;  3GIB A;  4YRS A;  2CGH A;  1EVK A;  4M75 G;  2XGT A;  3VQY A;  4PJO C;  1JBM A;  2E65 A;  4H2V A;  1FYF A;  4M7D A;  4M7D F;  1JJC B;  3ICA A;  2ZIM A;  4M78 C;  2ODR D;  3IKL A;  3TEH B;  3FIF A;  4J15 A;  3V7C A;  4CH6 A;  2IY5 A;  4L87 A;  3W3S A;  4P74 A;  2Q7H A;  2VC8 A;  2QHS A;  3JB9 I;  2EJF A;  2RD1 A;  1X2G A;  5DY9 A;  3NET A;  4UP8 A;  4HA8 A;  2ZT6 A;  5GAN 5;  2E1H A;  4M77 C;  4C8Q A;  1JRI A;  4C8Q F;  4H2S A;  4TQF A;  4PG3 A;  4C92 C;  4YRQ A;  4XEM A;  3RL6 A;  2XTI A;  3V8L A;  1WU7 A;  4P72 C;  5LJ5 h;  1KMN A;  1BBU A;  3RIR A;  4F7U E;  4QVC A;  1N9S A;  1HTT A;  4YRI A;  3JB9 H;  3SWN B;  4P3O A;  2ZIO A;  2DZC A;  2AMC B;  2I4N A;  2ZNI A;  1MGQ A;  3JB9 D;  4PJO A;  4PJO F;  3M4G A;  4HWO A;  4K88 A;  1I5L A;  2ODR C;  4YRR A;  1YFS A;  3JCM W;  3JCM V;  4M7A C;  4M78 A;  4M78 F;  2PMF A;  1ATI A;  3NEL A;  2FB7 A;  2QHT A;  4F7U G;  3MF2 A;  2E64 A;  4N0A C;  5CAI A;  1LYL A;  4KQE A;  4EMK C;  3RUX A;  1D3B B;  4M77 A;  4M77 F;  1H4S A;  4C92 A;  4C92 F;  4KR2 A;  3IG2 A;  4P72 A;  5GAN 2;  2RHQ A;  1NYQ A;  4Q6G A;  4AH6 A;  4UP7 A;  3E9I A;  5GMK i;  2C8M A;  4XTW A;  5LJ5 j;  1RIQ A;  4DPG A;  4YCV A;  1BIA A;  3G1Z A;  4RMF A;  2ZXF A;  3RES A;  4M7A F;  1X2H A;  4YPF A;  2QHV A;  4M7D E;  4H2U A;  3HFZ A;  4TTV A;  4TVW A;  5GAN 6;  1W66 A;  4N0A A;  2DU5 A;  4J6X A;  1H4V B;  2EJ9 A;  1I8F A;  1EIY A;  4TVY A;  2RB6 A;  5GAM h;  2ZNJ A;  2DZ9 A;  3JCM f;  3IKM B;  3L4G B;  4C8Q E;  3QHS A;  4UP9 A;  5GAN h;  4G85 A;  2DTI A;  3JB9 F;  4XTY A;  1NNH A;  4YRM A;  4XTX A;  4BWA A;  4TQD A;  3REU A;  4CS3 A;  3QO8 A;  3ERR A;  2CIM A;  3A5Y A;  5ELO A;  1B70 B;  4YRN A;  3A74 A;  3LSQ A;  1Z7N A;  1HK9 A;  5LJ5 e;  2ZIN A;  4PJO E;  4YRF A;  4EX5 A;  5K1P A;  3LC0 A;  4M75 D;  4YRC A;  3HFV A;  2ZT8 A;  3WQZ A;  4M77 D;  5LJ5 g;  4M78 E;  2RA2 A;  4C92 D;  1G51 A;  3HXW A;  1Y96 A;  4PNO A;  3V8J A;  2DKG A;  1EQR A;  4V2S A;  1KQ1 A;  3V8K A;  1B34 A;  4EMH A;  4HWS A;  3VQW A;  4X9C A;  4A53 A;  2Q7E A;  4J6W A;  4JRI A;  4XTZ A;  3SWN C;  5GAM j;  2ZTG A;  3HY1 A;  2VXF A;  1HC7 A;  2CJ9 A;  2ALY A;  3A7U A;  3MEY A;  4H2X B;  4P71 C;  5GAN j;  4M7A D;  5F5W A;  4YYE A;  3V7S A;  4YRP A;  2E3C A;  1YFT A;  3CMQ A;  3PCO A;  5GAO r;  1KOG A;  4BW9 A;  2ZCE A;  4M75 C;  1NYR A;  1VQZ A;  2ZZG A;  3JCM b;  4M7D B;  4CH5 A;  2DDZ A;  4HWT A;  1J5W A;  5ELN A;  2AKW A;  2P0L A;  4CH3 A;  3PGG A;  5GAN 4;  2IY5 B;  1LNX A;  4Q15 A;  3BY7 A;  4WF2 A;  3QSU A;  1WPY A;  3I7F A;  2EJG A;  4CS2 A;  1C0A A;  2RHS A;  5C51 B;  2C7I A;  1KMM A;  4RQF A;  3P8Y A;  4C8Q B;  4XU2 A;  4NCX A;  1M8V A;  3SWN A;  4RDX A;  2HNI A;  2ZZF A;  4RCC A;  4P71 A;  4JLI A;  2EL9 A;  2FYK A;  2YLB A;  1G5H A;  1M5Q 1;  4PJO B;  3REX A;  1N9R A;  5GAM e;  3HXY A;  4M75 A;  1EFW A;  4M75 F;  1WLE A; 
#chains in the Genus database with same CATH topology
 5GAN e;  4M78 B;  3JCM e;  1AWJ A;  4J7F A;  2Q7G A;  1CKB A;  3H6Z A;  1YJW T;  2CDT A;  1MNE A;  3OYJ A;  2D8H A;  1TG0 A;  4LVI A;  4LUD A;  2DIG A;  2Y90 A;  2DE0 X;  2H8H A;  1QCO A;  2DF6 A;  4R0K A;  2VV5 A;  3H0I A;  2RHQ B;  3A32 A;  2HDA A;  3VQX A;  1V1C A;  5GAN 7;  1VQL A;  1NG2 A;  3RGL A;  2PME A;  3R6O A;  3OBY A;  1C6V X;  2OAW A;  2BKD N;  4BY6 B;  2KRO A;  2J05 A;  2RI3 A;  8AT1 B;  1K73 U;  1NJ2 A;  3H8Z A;  4A4G A;  2KK4 A;  3UGQ A;  5GJV B;  4OGC A;  1M4Z A;  3OYB A;  1X6G A;  1RAC B;  1K73 C;  2ZT5 A;  3BW1 A;  5I22 A;  2A08 A;  1RLP C;  3WVE B;  4Z8A A;  2L8D A;  2CZ7 B;  2FPE A;  4KBM B;  2EQJ A;  3FLG A;  3RAC A;  2K5F A;  3A98 A;  2BUD A;  2JNG A;  4M7D G;  1EIY B;  5IXF A;  4P73 C;  5FLX E;  2FEI A;  2C06 A;  4YCW A;  2ARU A;  2GTO A;  3M9Q A;  3O8V A;  1KD1 R;  1YIT Q;  2XDB A;  1H4Q A;  1R0C B;  3R6N A;  3DLM A;  3CC2 A;  1JJ2 S;  3CC4 A;  4C8Q G;  5FWC A;  1VQP T;  4VUB A;  1XJW B;  2F1L A;  4ZTU B;  3HXX A;  1KD1 U;  2ZPF B;  4ZIB A;  3G6E A;  1PC0 A;  2IIM A;  1KD1 C;  1BBZ A;  4L59 A;  2RHU A;  3UAT A;  2G4C A;  1QMC A;  2KEA A;  4OMM A;  1M2V B;  3U23 A;  1Z7M A;  3L2Z A;  3I5S A;  1Y96 B;  2HBW A;  1WJQ A;  2RHY A;  2ZPB B;  1X56 A;  4J9F A;  3M4P A;  5C53 B;  1JJC A;  3TUP A;  2CUB A;  3M0Q A;  1Z9Z A;  2EIF A;  1N8R U;  4H2T A;  3QTC A;  1KJW A;  2DYB A;  2JUF A;  2SEM A;  1N8R C;  3X20 B;  2OI3 A;  4M7A E;  2K5I A;  4YDQ A;  2DD4 A;  2P0Q A;  2XHC A;  3PVQ A;  3CME A;  3CCJ T;  4OF1 A;  2DJZ A;  1VQ5 A;  2KRN A;  1BB9 A;  2EKH A;  2EYX A;  4E7K A;  2OTJ Q;  2RQT A;  2ENM A;  1QF6 A;  3PNW C;  1W70 A;  4YP0 A;  2AMC A;  4RMO A;  1UGQ B;  1X6B A;  1IGQ A;  1OZ3 A;  2RJC A;  4XK8 E;  2K9G A;  5KCH A;  3OYF A;  4YRT A;  3ZBD A;  4TWA A;  1H8K A;  2X3X D;  2AIR B;  2P4R A;  4P75 A;  3SHW A;  1WQW A;  2C0I A;  2VGN A;  1GBR A;  2ZR2 A;  5J39 A;  2W0Z A;  3LX7 A;  4HCC A;  2DVE A;  4J6Y A;  2H3J A;  3RMS A;  1VQL Q;  1IHV A;  4FCY A;  1BI0 A;  4OP0 A;  3M58 A;  1FWZ A;  1USY A;  3QUI A;  1RI0 A;  3EFO B;  1YGB A;  4PFZ A;  1JO8 A;  3M59 A;  4YRG A;  2GF7 A;  2V26 A;  2ZPI B;  1ASZ A;  1SET A;  4CI0 C;  4O2D A;  3VV0 A;  2GFU A;  3RKY A;  2DA9 A;  3HFN A;  1VYT A;  2RQV A;  3NEN A;  2RHZ A;  3OD1 A;  2FPD A;  4TVA B;  2LC4 A;  3CD6 A;  1YP5 A;  2ART A;  4CC2 A;  1M9S A;  2RM4 A;  2QTX A;  1H4T A;  1FX7 A;  3JCM Q;  2DQ3 A;  1N6A A;  3CC2 Q;  3CC4 Q;  2GBQ A;  3L4G A;  1W2B P;  4C5E A;  2O2O A;  4P3N A;  3HTZ A;  3A8G B;  3QBY A;  3G6E Q;  1OEB A;  1KHC A;  5GAM f;  1UE9 A;  2KDS A;  2MWO A;  3C4S A;  3LW5 E;  4A4F A;  2D8J A;  4QVZ A;  2E6Z A;  4F7U B;  1KG1 A;  1UFF A;  4PJO D;  1B7Y B;  5I21 A;  3CXC A;  3CMA A;  1MV0 B;  4CH4 A;  1PM3 A;  1BK2 A;  3NTK A;  1DJ7 B;  2QQ9 A;  2L3R A;  2EYQ A;  2E5Q A;  5M9O A;  3MEA A;  4MDW A;  2CYZ B;  1IO6 A;  1WFW A;  8ATC B;  3A8O B;  3M4Q A;  4G84 A;  2LRQ A;  3CME Q;  1VQ5 Q;  1QVP A;  4AFZ C;  3F70 A;  2XGT A;  3OMG A;  4L5G A;  4F04 B;  1EFN A;  4PJO C;  2M9U A;  2E65 A;  4H2V A;  1VQ6 T;  2ROL A;  3ICA A;  1I07 A;  2L89 A;  2ZIM A;  4QT7 A;  3IKL A;  3TEH B;  3FIF A;  2IY5 A;  3P8D A;  3HL8 A;  2AKK A;  2SRC A;  3JB9 I;  2EJF A;  1X2G A;  4N4H A;  3M53 A;  1OZ2 A;  1OPL A;  2MIO A;  4OGE A;  3EAE A;  2E1H A;  2VYT A;  4H2S A;  4BE0 A;  2KAF A;  1YWO A;  4C92 C;  4PG3 A;  2BIV A;  3M55 A;  1K8A R;  2RK1 A;  4FM4 B;  1QVG S;  1WU7 A;  1ZA1 B;  1KMN A;  1C1A A;  1TTH B;  4E7L A;  4C5G A;  1U8R A;  2ED0 A;  4F7U E;  3OS2 A;  4PFP A;  5IHK A;  4QVC A;  4KUI A;  5LL6 S;  4YRI A;  2L0A A;  4P3O A;  2DZC A;  1K8A U;  2I4N A;  5KE2 A;  1V29 B;  1M90 R;  3CPW A;  4PJO F;  4YRR A;  1G3Y A;  1K8A C;  1QVG A;  1RI9 A;  2NYS A;  4M78 A;  2A3L A;  2CRE A;  1PSE A;  1AT1 B;  1NPP A;  2KNB B;  1M90 U;  2JMA A;  1AWX A;  3M56 A;  1HSQ A;  2P4T A;  2QQB A;  2QAS A;  4KUL A;  2E64 A;  1M90 C;  3EHQ A;  1D3B B;  4KT0 E;  2RO0 A;  1H4S A;  2J06 A;  4C92 F;  3I56 A;  2QI2 A;  1LCK A;  1ZSZ B;  3CCJ A;  2DXB A;  2QYZ A;  3IG2 A;  2RHQ A;  4AH6 A;  3GBQ A;  3VRZ A;  2C8M A;  1JU5 C;  1RIQ A;  2FVU A;  2KR3 A;  2E70 A;  1WHG A;  2LJ0 A;  1YJW Q;  1X2H A;  4JLG A;  1ZA2 B;  1YIT T;  3E9G A;  2QHV A;  1TSF A;  1SHF A;  5IHN A;  3PMT A;  5GAN 6;  3QXE B;  1WHJ A;  5CVI A;  3CMA Q;  1P92 A;  1H4V B;  2B8A A;  2EJ9 A;  1I8F A;  1EIY A;  1MHN A;  3IQL A;  1MND A;  2ZNJ A;  1D09 B;  4FT2 A;  7AT1 B;  4RG2 A;  2F5T X;  4XTY A;  4YRM A;  4XTX A;  4BWA A;  1WGS A;  4GLK A;  1R8O B;  5HK3 A;  2O31 A;  3G4S T;  1OU9 A;  4GLM A;  4LVJ A;  2CIM A;  4J9G A;  1B70 B;  2QAZ A;  3A74 A;  3LSQ A;  1B7T A;  1HK9 A;  2ZIN A;  2RI5 A;  4PJO E;  5FU6 B;  4J9D A;  4M75 D;  1VQ8 A;  2ZT8 A;  1IGU A;  2J6F A;  3CXC P;  5LJ5 g;  1M2V A;  1PD0 A;  1BCO A;  1G51 A;  2A8E A;  1W4S A;  1Y96 A;  3V8J A;  3JSC A;  3REA B;  2DL8 A;  5AT1 B;  4RTU A;  4HCZ A;  3ULR B;  3SWN C;  2VXF A;  1ZBJ A;  4AFQ C;  1QP3 A;  3A7U A;  1ACM B;  4LDY A;  4YRP A;  5D6Y A;  1IRX A;  1ZUU A;  3CCL A;  1BI1 A;  1VIE A;  2MCN A;  4M75 C;  2HSE B;  1VQZ A;  4M7D B;  4RTV A;  1WJS A;  3PFS A;  3J80 E;  4HWT A;  5ELN A;  4CH3 A;  3UA6 A;  3QSU A;  2EJG A;  1VQL T;  4B9W A;  3NGP A;  5C51 B;  2C7I A;  3I55 A;  3P8Y A;  2QDY B;  2RF0 A;  4C8Q B;  4XU2 A;  2K4Y A;  1UUE A;  2L3S A;  3NTI A;  3CCQ A;  2ZZF A;  3DKM A;  3MP1 A;  4RCC A;  4JS5 A;  1VYU A;  3I56 Q;  4JLI A;  2EL9 A;  3CCJ Q;  1Z9Q A;  3EG0 A;  2HQE A;  2COY A;  2KRM A;  3CPW P;  4M75 F;  1VQ6 A;  1M3A A;  2K3X A;  2XDP A;  2DO3 A;  3JCM g;  4N4I A;  5GAN g;  5GMK m;  3BFM A;  2EWN A;  2HEQ A;  2QDL A;  1UJ0 A;  3CC2 T;  3CCE T;  1FMK A;  3CBM A;  3OYE A;  2LNV A;  1B76 A;  4HT9 A;  3HXZ A;  5LJ5 d;  3H0F A;  2J6K A;  4A4H A;  3RDV A;  1YFR A;  3G6E T;  1YJN A;  1NJ6 A;  1E22 A;  5AYF A;  2D1X A;  2DXU A;  4TVA A;  2QA4 T;  3OYL A;  3NMZ C;  3MPU B;  2GQV A;  3PTA A;  2JW4 A;  4EO4 A;  2KYB A;  2RQW A;  2E10 A;  4HVV A;  1BCM A;  2EAY A;  1K0X A;  2D0N A;  4Z89 A;  1GCQ A;  4X5O A;  1M1G A;  3MET A;  2DTH A;  5HY6 A;  2CP2 A;  4XEO A;  3HRK A;  3P8H A;  2HKN A;  2RN8 A;  4MML A;  3A31 A;  3OYI A;  5IH2 A;  5GAN 8;  4JRP A;  1KFZ A;  4E6R A;  3HFZ B;  1X55 A;  3HSB A;  3JCM h;  5E3I A;  1VQ8 Q;  4HWP A;  1D1A A;  3MP8 A;  4F7U A;  3AT1 B;  12AS A;  2L2P A;  1B07 A;  1BI3 A;  4FYX B;  3OYM A;  1NYF A;  1AHJ B;  1B7Y A;  2KRS A;  2YUP A;  3I35 A;  3OYY A;  3CME T;  2K6D A;  2MYS A;  1VQ5 T;  1LPL A;  3H9N A;  3VUB A;  3VRY A;  3QO5 A;  5C6S A;  2JJ9 A;  2PNI A;  1AEY A;  2VKN A;  1ASY A;  1NJ1 A;  4CS4 A;  4DQ2 A;  1N9W A;  2F2W A;  3BE3 A;  2QEX T;  3G71 T;  2EQI A;  1RAA B;  1X01 A;  4M75 E;  2HL5 C;  2LZ6 B;  5CQY A;  2KYM A;  2J3M A;  4PJO G;  3FRN A;  3LWH A;  1YI2 A;  4C0D B;  2J6O A;  4JRQ A;  1X54 A;  4KGX B;  1PD1 A;  4QQD A;  1BU1 A;  5GMK h;  3JCM d;  1TUC A;  2OJ2 A;  5GAN d;  3TEH A;  3E1S A;  2ATC B;  1MMN A;  4P3P A;  3NTH A;  4EDU A;  3P8T A;  3C95 A;  4RTY A;  1TWB A;  4C92 G;  3PCO B;  2O9V A;  2V8K A;  1TUG B;  2V8J A;  1XNI A;  4X9D A;  4IUQ A;  2BTT A;  2RQU A;  1JXM A;  4E2F B;  1N27 A;  3TRE A;  2DD5 A;  3OY9 A;  1VQ6 Q;  1RUW A;  1JEG A;  4XU0 A;  1XTD A;  3CD6 T;  3DSQ A;  2RJD A;  3M57 A;  4WI1 A;  1XQH A;  2CT4 A;  2KBT A;  2QG9 B;  2QGG A;  5CK9 A;  1QVF A;  4RQE A;  2V1Q A;  5HK0 A;  4FT4 A;  3HXU A;  1ZHI A;  3UGT A;  4XTV A;  4BDZ A;  1YJN Q;  1G3W A;  4JJB A;  1D3B A;  2XIC A;  1KHI A;  4NS5 A;  2XMF A;  1ZSZ A;  1D1B A;  4H2W A;  4HT8 A;  2YRV A;  4XQ3 A;  4JUV A;  2NUP B;  2X4X A;  5CKF A;  3GP8 A;  3G1J A;  3JCM J;  1W2B S;  2LQW A;  4KGZ B;  2DXT A;  3CMA T;  3HHT B;  4XAX B;  2LP5 A;  2PTK A;  1K9A A;  4O6J A;  3VU3 C;  1I0C A;  1X27 A;  1YCS B;  1W2B A;  4M7A B;  3L1A A;  2EQM A;  5ECA A;  2GCX A;  1X6O A;  1Y57 A;  2HKQ B;  4H02 A;  3M5A A;  2QHU A;  4JDS A;  3CPF A;  4LNS A;  4YRK A;  1ZUK A;  3V7R A;  5GMK e;  1YCY A;  4EMK B;  4ZGJ B;  4BUG A;  3EG2 A;  4D8K A;  3E9H A;  2ZPG B;  1IB8 A;  5GAO n;  3R07 A;  1IHW A;  2ZZE A;  4E7H A;  1YWP A;  3RF1 A;  2RPN A;  2DK3 A;  4TVR A;  3QYH B;  3CCE A;  4J9I A;  1B70 A;  3RR6 A;  5A2Q E;  1YJ9 A;  2DU7 A;  4P74 C;  2GNC A;  4M4Z A;  3SEM A;  2QA4 A;  5C0M A;  4LN2 A;  3FJ5 A;  4GBQ A;  4ZTZ B;  3INZ A;  1U3O A;  3H41 A;  2EQK A;  1U1S A;  4AT1 B;  2YUQ A;  1FXX A;  1UG1 A;  3CBP A;  5LJ3 j;  1I81 A;  3G4S Q;  3LH0 A;  4MZT A;  2LCS A;  2HQX A;  4JS4 A;  1VIF A;  4FW2 A;  1QKX A;  1D1C A;  2IVW A;  4M75 G;  2QGF B;  1D0Y A;  4M7D A;  1N5Z A;  4J15 A;  3I56 T;  3W3S A;  2A0F B;  2YSQ A;  2ECZ A;  1RAB B;  1KQS A;  4UP8 A;  4OMO A;  3QG1 A;  4M77 C;  4C8Q A;  5FW9 A;  1UHC A;  3L2U A;  4II1 A;  3RL6 A;  2OX7 A;  1UB4 A;  2MOX A;  5EC7 A;  2HQH A;  3V8L A;  1E6H A;  4P72 C;  3CQT A;  2QEX A;  3G71 A;  1BBU A;  3MEU A;  1Q95 G;  2FZG B;  5IN1 A;  5CKD A;  1N9S A;  2CSQ A;  1SG5 A;  3QKJ A;  1VQK A;  4PLL A;  2KVQ G;  2ZNI A;  1ABQ A;  1M27 C;  4HWO A;  3ZEH A;  1RAG B;  2R58 A;  1K76 A;  2LQN A;  3X26 B;  1I5L A;  4LVL A;  4OMF B;  2HCK A;  3JCM W;  1QVF P;  1G8X A;  3A5Z B;  5FRO A;  1ATI A;  4FYW B;  1WJR A;  4ELY C;  4IUT A;  2FB7 A;  6AT1 B;  2QHT A;  1I5O B;  1T3S A;  3MQZ A;  2KI7 A;  1VQO T;  4M77 F;  1TUD A;  1M8M A;  1PKS A;  1UGR B;  4KR2 A;  1NYQ A;  2X4J A;  3LH5 A;  1MMA A;  3E9I A;  4XTW A;  3PE0 A;  4O5V A;  1VQ8 T;  5LJ5 j;  3ASK A;  2EYY A;  4DPG A;  4YCV A;  1W1F A;  2DJQ A;  1BIA A;  3WVD B;  2RJE A;  2KSS A;  4A63 B;  1WZO A;  3T9N A;  4QKU A;  3M54 A;  3JRZ A;  4ANJ A;  4YPF A;  2XID A;  3CCE Q;  3HFZ A;  4BE2 A;  3ER0 A;  2D9T A;  3QWY A;  4TVW A;  2LJ3 A;  1YJ9 Q;  3CXC S;  4N0A A;  3THK A;  2K7A A;  1KK7 A;  2YUN A;  3GF5 A;  4J6X A;  3PIP A;  2QA4 Q;  2X4W A;  3OA6 A;  3CCM A;  1GL5 A;  3VS2 A;  2QK0 A;  3CCL T;  2E12 A;  5GAM h;  3GLX A;  3IKM B;  1YIJ T;  4IUR A;  2ZAE A;  3A1P A;  4G85 A;  1QWF A;  1WHK A;  1O75 A;  1NNH A;  2O9S A;  2COZ A;  2NUT B;  1GBQ A;  4OMP A;  1Q82 R;  3EG9 A;  2A36 A;  3ERR A;  4FSX A;  3I55 T;  4C5H A;  4F17 A;  4YRF A;  1G5V A;  2E6N A;  1GFD A;  3LC0 A;  3VS7 A;  3HFV A;  2E4H A;  2FRY A;  3CCQ T;  2BZ8 A;  4C92 D;  2XU8 A;  2BE7 D;  3HXW A;  4DEX A;  3HPW A;  4PNO A;  2AZV A;  2DKG A;  4E7I A;  4OB0 B;  2MAM A;  1KQ1 A;  2JM9 A;  1WA7 A;  4EMH A;  1OOT A;  4A4K A;  2LDM A;  2O01 E;  4JRI A;  3JAM E;  4R56 A;  2Q7E A;  3P8B B;  3C94 A;  1UEC A;  4EPC A;  2CJ9 A;  1Q7Y R;  3OMC A;  4RTT A;  4ORZ A;  5GAN j;  1IXD A;  1ZLM A;  2QEX Q;  3G71 Q;  3PCO A;  2ROT A;  2L3Q A;  2A37 A;  2ZCE A;  1G3T A;  1NYR A;  2ZZG A;  1Q7Y U;  1J5W A;  3CPW S;  5GAN 4;  2KMT A;  1NEB A;  1Q7Y C;  3HTR A;  1YJN T;  2O4X B;  2PVG B;  1GRI A;  3I7F A;  1C0A A;  2I0N A;  1KQS P;  2DFU A;  4RQF A;  2JMC A;  2LQ8 A;  4RTX A;  2BZY A;  4ME7 A;  2DBM A;  2HNI A;  4P71 A;  1FYN A;  2W10 A;  2LVM A;  2RK2 A;  5CQX A;  2DL3 A;  2NLU A;  4BD3 A;  3Q1J A;  4PJO B;  5GAM e;  3J7A F;  1WLE A;  3CD6 Q;  1YNZ A;  2NUP A;  4E47 A;  4Y92 A;  1QKW A;  3JB9 J;  2LJ1 A;  1ADY A;  4FYY B;  2CZ0 B;  2VXE A;  2WSF E;  3TVT A;  5GAO m;  2HAX A;  1J3T A;  2XG8 D;  2I4L A;  2AT1 B;  5DLQ E;  2AHJ B;  2VGM A;  2GQI A;  4C92 B;  1NZ9 A;  3LGF A;  1ADJ A;  3CCM Q;  4M7A A;  3DB3 A;  1UJY A;  1VQ4 T;  3OYH A;  2XI9 A;  5FU7 C;  2RJF A;  2DIL A;  3ME9 A;  2CJA A;  3RKX A;  5C52 B;  1YI2 T;  4ZNX A;  4EMK A;  2LX9 A;  3UWN A;  5KH6 A;  4FU6 A;  2Q5H A;  1S1N A;  1YHQ T;  4PKC C;  4NL3 A;  5LJ3 f;  2I4O A;  1MUZ A;  2DER A;  2DEU A;  1R0B G;  3IAL A;  5GAN 3;  1EX4 A;  1VQO A;  4JZ4 A;  2EBP A;  5FWB A;  4XTU A;  3CCR A;  2ZT7 A;  3A8M B;  3MJX A;  4LDV A;  2HZY A;  1K9M R;  5DM7 R;  3LSS A;  2I4M A;  5CKH A;  1QLY A;  2CT3 A;  4FSS A;  2DQ0 A;  2DL5 A;  4CRI A;  5CR2 A;  2IG0 A;  1IZ6 A;  3HRS A;  4X34 A;  1EZZ B;  3TSW A;  1ZQ1 A;  2JN0 A;  3CEY A;  4BDY A;  1LJO A;  2E41 A;  2HL3 A;  2BE9 B;  2CP0 A;  2RMO A;  2ZZD A;  4C92 E;  1WIE A;  4UC4 A;  2A7Y A;  3S3O A;  2XD0 A;  3VS5 A;  4P73 A;  3D7S B;  2WSC E;  2NWM A;  1BIB A;  1B34 B;  1OI1 A;  2RHX A;  3GOX A;  3OQ5 A;  4H2X A;  1YIJ A;  3UT1 A;  4J9B A;  4P75 C;  11AS A;  2RHI A;  5KYY B;  2QQS A;  1AVZ C;  2CH4 A;  2PUO B;  1JXO A;  4CC7 A;  2CZ6 B;  4M77 G;  3EGU A;  1E6G A;  1ZBX A;  4OMQ A;  4DBR A;  5HGQ A;  1M1K R;  4QVD A;  1OV3 A;  2O88 A;  3MO8 A;  3PZC A;  4JRK A;  2AKW B;  4C0G A;  1USY C;  3VS3 A;  1X2Q A;  2AZS A;  2QQA A;  2VAS A;  3M0P A;  3FEO A;  4ATO A;  2EGC A;  3HFO A;  2FO0 A;  2K3B A;  5LJ5 f;  3H0H A;  3OW2 P;  5K1X A;  1ZX6 A;  1D0X A;  3CCS A;  4YRO A;  4BB7 A;  1Y07 A;  1LOJ A;  1T0H A;  4ZGD B;  4ZN3 A;  3OS0 A;  3A5Z A;  2E3H A;  3EFS A;  1SER A;  5LJ3 e;  3BJU A;  4H2Y A;  4J9E A;  2CP6 A;  1Q81 R;  3TEG A;  2CJB A;  2HMA A;  2J3L A;  4N4G A;  3UH0 A;  1OYX A;  4M75 B;  2XDD A;  2YUO A;  1F1B B;  1YB3 A;  2HD0 A;  4A54 A;  1AWW A;  1QE0 A;  1M1F A;  4KUD K;  5GMK l;  1YJ9 T;  1YBY A;  4HWR A;  2JXB A;  3VYG A;  1PYS B;  2YRC A;  1KQ2 A;  5D6W A;  4EIK A;  2FG0 A;  3HP9 A;  4LDX A;  9ATC B;  1SSF A;  2YRD A;  4PL6 A;  1VQO Q;  3CCR Q;  4HKE A;  4RCB A;  1YFN A;  5IAY A;  1RAH B;  4YRJ A;  1UEB A;  3HKS A;  3QO7 A;  5DLO A;  4E51 A;  2YT6 A;  3A7R A;  2LMJ A;  2K2M A;  3QNE A;  4YRE A;  2R57 A;  1EOV A;  2AKL A;  1QW1 A;  4C0D C;  1H64 1;  2EQU A;  2NUT A;  1BYM A;  1NM7 A;  3E19 A;  2DIQ A;  1NJ8 A;  3L2W A;  5GAN f;  1L0W A;  2CUD A;  1HXD A;  5D7U A;  2K57 A;  3VUZ A;  2DAQ A;  3EG9 B;  2DEQ A;  4CC3 A;  4M78 D;  4MMK A;  1VQ9 T;  3CCL Q;  1VQ4 A;  1D0Z A;  1OX9 A;  1YIJ Q;  1GGM A;  3PIO A;  3UFG A;  4RTW A;  2FZC B;  4HVC A;  1VQK T;  2M02 A;  2ZCF B;  5KCO A;  3BDU A;  3EFR A;  1SES A;  4MZP A;  3TEE A;  2ZPE B;  1YHQ A;  5L8R E;  2MPX C;  1WYD A;  3RKW A;  1UDL A;  3OB9 A;  4PJN A;  3I55 Q;  4R55 A;  4DOV A;  3N5B B;  1EVK A;  4E7S A;  3VQY A;  1JBM A;  3CCQ Q;  1HYO A;  1FYF A;  4M78 C;  2ODR D;  3CBO A;  3GNF B;  4CH6 A;  3EH2 A;  3V7C A;  1ARK A;  1KSW A;  3CCS Q;  4L87 A;  1QVF S;  2QHS A;  2O4X A;  5KYW B;  2RD1 A;  5DY9 A;  2PVO B;  3NET A;  4AMC A;  2P0K A;  4PJJ A;  2ZT6 A;  1G83 A;  1JRI A;  4TQF A;  3DLL A;  1PCX A;  4HCK A;  4C5I A;  1WLP B;  3MP6 A;  3FDR A;  2XK0 A;  3RIR A;  4OVA A;  5CKB A;  1NLP C;  1HTT A;  3NFC A;  2JT4 A;  3JB9 H;  2FHD A;  4K11 A;  5I2S A;  2H3E B;  4JPB W;  2DL4 A;  4BY6 C;  2ZIO A;  1MGQ A;  3JB9 D;  4PJO A;  2F2V A;  3VJP A;  2ODR C;  5L23 A;  2F5K A;  3OBW A;  3JCM V;  4M7A C;  3OSS C;  3CCM T;  4M78 F;  2K3Y A;  2NUZ A;  3NEL A;  2E5K A;  3OS1 A;  3MF2 A;  3S3N A;  1FMW A;  5CKE A;  4EMK C;  1OPK A;  2VWF A;  2L3P A;  2PQW A;  4CC4 B;  1NEG A;  4C92 A;  2X3W D;  1CKA A;  2QTV A;  3CCV A;  4UP7 A;  2XKO C;  2X4Y A;  1QQJ A;  1SKU B;  4JZ3 A;  1PSF A;  1ZUY A;  2C0T A;  1RAE B;  1WXB A;  4RMF A;  2KE9 A;  4M7A F;  2FRW A;  2ED1 A;  2V1R A;  1K73 R;  5A0L A;  1VOM A;  4H2U A;  3TQ7 P;  1VQN T;  4P5N A;  2E3I A;  1TS9 A;  4QQ6 A;  2CSI A;  2KQW A;  2FL7 A;  2DXC A;  1X2K A;  2DU5 A;  4LNP A;  5CCA A;  1VQ4 Q;  4LD6 A;  5FRN A;  1WHH A;  1AWO A;  2RB6 A;  1EIF A;  5KE3 A;  4PJL A;  1MV3 A;  5I2M A;  1SHG A;  1SF9 A;  2GTJ A;  4MZM A;  3QHS A;  1SEM A;  2JOY A;  1M3B A;  2D6F A;  1PHT A;  2P0P A;  1YI2 Q;  1Y71 A;  3JB9 F;  2EW3 A;  1YHQ Q;  1X43 A;  2GGR A;  3REU A;  3BDL A;  3QO8 A;  3A5Y A;  5ELO A;  3QJ6 A;  1UHF A;  4YRN A;  2HSP A;  5K1P A;  3CC7 A;  3EG3 A;  4EX5 A;  4YRC A;  3WQZ A;  4M77 D;  4AFS C;  4M78 E;  2RA2 A;  3KFV A;  4B9X A;  5IHI A;  1MMD A;  2X35 A;  1I1J A;  5IXB A;  3QZ9 B;  1EQR A;  4V2S A;  1KQS S;  3V8K A;  4IKF A;  1B34 A;  1Q86 R;  2ZPH B;  2EGA A;  1SPK A;  4J6W A;  4XTZ A;  2DL7 A;  2EKO A;  1JJ2 A;  5KYY A;  2ZTG A;  4RG8 A;  3M0U A;  1H3H A;  1N8R R;  3MEY A;  4H2X B;  2YXY A;  5F5W A;  2M51 A;  2M0O A;  3V7S A;  2LQK A;  1Q86 U;  3A8H B;  1RLQ C;  3CMQ A;  3O5Z A;  2CKK A;  1V76 A;  1Q86 C;  1X75 C;  5KYX A;  1SSH A;  1O9S A;  4CH5 A;  3L2V A;  2DDZ A;  2AKW A;  4LVM A;  3PGG A;  3OSV A;  3MCA B;  3LYI A;  4Q15 A;  4WF2 A;  1WHM A;  2M1H A;  1VQ9 A;  1R77 A;  1K0S A;  1PG5 B;  2OTL A;  1GFC A;  3EGX B;  2C0O A;  4NCX A;  1VQM T;  2JTF A;  1M8V A;  1AZG B;  3I5R A;  3UF4 A;  1S72 A;  3CCU T;  3SWN A;  4RDX A;  3VS6 A;  1WDX A;  3RNJ A;  4ZTF A;  1T0J A;  1GCP A;  1UGS B;  3CCV Q;  3G7Z A;  2YLB A;  3WXM B;  3VYH B;  1M5Q 1;  1GCQ C;  3REX A;  2Y4X A;  2JTM A;  3KUF A;  4BAC A;  3HXY A;  4M75 A;  1HJD A;  3CCR T;  5GAM g;  3OYK A;  3A7A A;  2IPO B;  2CP3 A;  3FC3 A;  2DM1 A;  3FJP A;  2RNA A;  4WJ4 A;  3C12 A;  4X1V A;  1PYS A;  1PRM C;  1EVL A;  5J3B A;  4DBH A;  2MF2 A;  4M77 B;  2V8I A;  1TH7 A;  2D0Q B;  4LUE A;  1SRM A;  2KY9 A;  4C0F A;  4YTL A;  4UPA A;  3P8V A;  3QO3 A;  5KYN A;  2YWW A;  3EG1 A;  5GAO q;  2JTE A;  2VUB A;  1ABO A;  1RAI B;  4WTO B;  2E5A A;  1JQQ A;  4JJD A;  5KYU B;  4HCB A;  4D8D A;  4XU3 A;  3C0C A;  4IUP A;  1NJI R;  1G2B A;  3SD4 A;  3CC7 Q;  5A0D A;  1QCN A;  4AFU C;  3QJY A;  4GY5 A;  4F7U F;  1NJI U;  2YHT A;  3JCM X;  4FL6 A;  2DX1 A;  2EYZ A;  1NJI C;  1YJW A;  2LT4 A;  3QZ5 B;  2ESW A;  1Y0M A;  1A0N B;  2FZK B;  4BI4 A;  4PHC A;  3EGD B;  4IUV A;  1Q82 U;  3VBB A;  1VYV A;  2CS7 A;  2G6F X;  2Z0W A;  2L5Q A;  1VQ7 T;  4WJ3 M;  1Q82 C;  4DBF A;  3CCS T;  3OYC A;  3RER A;  1QCF A;  4NOY A;  3JCM P;  1M2O A;  1CSK A;  4M77 E;  1WQ7 A;  1VQN A;  4OB2 B;  4E7J A;  2G3R A;  3DB4 A;  4ZGE B;  2MK5 A;  5GAM d;  4YCU A;  1VQ9 Q;  1WNL A;  4M78 G;  1B8A A;  4A4E A;  3OW2 S;  3A8L B;  1PNJ A;  2EPD A;  2GFA A;  2MMP A;  1RL2 A;  1VQK Q;  2OTL Q;  1E24 A;  1RAD B;  1JJ2 P;  3SB2 A;  2F69 A;  2ALY B;  5KYW A;  1S72 Q;  3QPH A;  4KR3 A;  3OW2 A;  4PJM A;  2MWP A;  1ZSZ C;  2QXF A;  3OS5 A;  3HXV A;  1I4K 1;  3RMQ A;  1WYX A;  4LE9 A;  1M30 A;  3M0S A;  1TOV A;  4J83 A;  4ZTJ A;  3SDZ A;  1VQP A;  2RH2 A;  4XU1 A;  1KIK A;  1UGV A;  2RHS B;  4M7A G;  3RBB B;  4QW2 A;  2LX7 A;  2CZ1 B;  4LVK A;  4J5Y A;  2KT1 A;  1TXQ A;  2WSE E;  2JS2 A;  2LNH B;  1AZE A;  5GMK j;  1OQK A;  1E1T A;  4OB1 B;  4NL2 A;  2I2L A;  4J7I A;  3ZFJ A;  2RQR A;  3QDF A;  1PKT A;  1AD5 A;  3GPL A;  3LWI A;  1ZSG A;  5LJ3 g;  1U1T A;  1NBE B;  3VQV A;  2M16 A;  3I9Q A;  1MMG A;  3LLR A;  1UGP B;  1AOJ A;  3JB9 G;  3JCM c;  4J9H A;  5J26 A;  2X51 A;  3HY0 A;  4LDW A;  3VKI A;  1NJ5 A;  5GAO l;  2ARS A;  2ZGW A;  5FRM A;  3MF1 A;  5GAO p;  5KNN A;  4RUG A;  1BKB A;  1WI7 A;  1JB0 E;  1VQM A;  3X28 B;  5FU6 C;  3SFM A;  5IT9 E;  4M7D D;  3CCU A;  2ZR3 A;  4OB3 B;  2KXD A;  4RTZ A;  2P5I A;  4OLF A;  1OX8 A;  2R5A A;  2KT8 A;  3M0T A;  2Q5I A;  4IIO A;  3FB9 A;  1QP2 A;  1GXI E;  5LJ3 h;  2EVR A;  3UPU A;  2K79 A;  2YLC A;  5EG2 A;  4AG1 C;  4Y91 A;  2A28 A;  4L6V 5;  4C8Q D;  1WXT A;  1X69 A;  1IL2 A;  2K2V A;  1VA7 A;  3PVL A;  4YRL A;  2LCC A;  2DLP A;  1C0M A;  3NEM A;  3URG A;  3QYG B;  1VQN Q;  4K86 A;  4DOW A;  1K9M U;  1U06 A;  4M7D C;  4PK4 A;  3KFU A;  4FIB A;  3E9F A;  1YN8 A;  1K9M C;  1BBW A;  4EMG A;  1SRY A;  4F16 A;  3VS1 A;  3HRI A;  4IUU A;  1SRL A;  3MKD A;  3AHU A;  5GJW B;  1E1O A;  5FU7 B;  4ZN1 A;  2X9H A;  4C8Q C;  5I11 A;  3GNG A;  4BE1 A;  2KXC A;  4J8O A;  4K87 A;  2DTO A;  1G5I A;  4YRS A;  1E7O A;  5LJ3 d;  3GIB A;  2DRM A;  3VS0 A;  2CGH A;  4E7Z A;  2PUK B;  1PWT A;  2MI6 A;  3EHR A;  3VS4 A;  2OTJ T;  1VQP Q;  1M3C A;  4M7D F;  2EFI A;  1JJC B;  4HVW A;  4KH0 B;  5KYX B;  4P74 A;  2Q7H A;  5HCK A;  2VC8 A;  3CCV T;  2JVV A;  4KH1 B;  1M1K U;  4HA8 A;  1HD3 A;  4DEY A;  3L42 A;  1WX6 A;  5GAN 5;  3EGX A;  4C8Q F;  3REB B;  1M1K C;  1VQ7 A;  4YRQ A;  4XEM A;  2XTI A;  2CP7 A;  2B86 A;  5LJ5 h;  4DA4 A;  3LGL A;  1U5S A;  2PVD B;  3X24 B;  3SWN B;  2HBP A;  2JZ2 A;  1NYG A;  2F2X A;  2AMC B;  3OYG A;  3HRU A;  3M4G A;  5A0G A;  4K88 A;  2FPF A;  1WXU A;  1YFS A;  2COW A;  2PMF A;  1KC8 R;  2JS0 A;  1W6X A;  3ZL7 C;  4D6W A;  1K1Z A;  4KRT A;  1VQM Q;  2DMO A;  2RI2 A;  1Q81 U;  4F7U G;  4N0A C;  3OYA A;  5CAI A;  3CCU Q;  1LYL A;  1NLO C;  4KQE A;  3RUX A;  4M77 A;  3OYN A;  1KC8 U;  2PU9 B;  1Q81 C;  4PLI A;  1QVG P;  4JJN K;  4QQG A;  4KGV B;  3S6W A;  3EFO A;  1KC8 C;  4P72 A;  5GAN 2;  4Q6G A;  2LCL A;  5GMK i;  1TU0 B;  3CC7 T;  3QDR B;  3NPF A;  4DBQ A;  4HT4 A;  3CC4 T;  1RAF B;  2QQR A;  2LT1 A;  3G1Z A;  3E2U A;  2ZXF A;  4PFO A;  5HKC A;  2CH4 W;  5KYU A;  3RES A;  4F14 A;  2R5M A;  4J9C A;  1UTI A;  4Z02 A;  4M7D E;  2DPP B;  3M4Y A;  2JM8 A;  1NE8 A;  4TTV A;  2KGT A;  2P84 A;  1OU8 A;  2M0Y A;  3S3M A;  1W66 A;  3QII A;  3PMI A;  3L2Q A;  4TVY A;  2DZ9 A;  3JCM f;  4B6M A;  1XOV A;  2J7I A;  3X25 B;  3L4G B;  4C8Q E;  3MEW A;  4UP9 A;  5GAN h;  2DTI A;  4AG2 C;  2VB6 A;  4FW1 A;  3EGD A;  4LD9 K;  4MDX A;  4TQD A;  4CS3 A;  4IIM A;  3JV3 A;  4OML A;  3MHX A;  2OTL T;  1Z7N A;  5LJ5 e;  2Y4Y A;  5CIU A;  3TU4 K;  1H92 A;  1K4U S;  2EYW A;  1VUB A;  3L2R A;  1S72 T;  1Y7X A;  1QWE A;  2DRK A;  2NS6 A;  2DNU A;  1YIT A;  1H3Z A;  4Q5W A;  4ELZ C;  4HWS A;  3VQW A;  5CO7 A;  4ESR A;  4X9C A;  4A53 A;  4Z88 A;  5GAM j;  4LDU A;  3HY1 A;  1HC7 A;  4JJC A;  1VQ7 Q;  2ALY A;  1FMV A;  3EH1 A;  2OAU A;  4LXC A;  4P71 C;  1BI2 A;  4M7A D;  4YYE A;  1LVK A;  1WHL A;  2EGE A;  2E3C A;  1YFT A;  1KOG A;  5GAO r;  2BZX A;  4BW9 A;  4BI3 A;  2AK5 A;  2DYI A;  1IRE B;  4WCI A;  3JCM b;  2P0L A;  2IY5 B;  1LNX A;  3NHN A;  3BY7 A;  4RKU E;  5D6X A;  1WPY A;  2DET A;  1G3S A;  4HXJ A;  3G4S A;  1T3L A;  4CS2 A;  3HRT A;  2RHS A;  3KXT A;  1PRL C;  1OUL A;  1KMM A;  4HVU A;  3M0R A;  1B3Q A;  2K5L A;  2PZ1 A;  2CP5 A;  4Y28 E;  2LTO A;  3J81 E;  4BI8 B;  3UA7 A;  3OYD A;  2ABL A;  3KBG A;  3MEV A;  2FYK A;  2YDL A;  3TCJ A;  1G5H A;  3QWX X;  2DVJ A;  1NPR A;  2DBK A;  2VVK A;  2WAC A;  3PT9 A;  4FYV B;  4C0Z A;  1N9R A;  4OMN A;  2OTJ A;  1EFW A;  3UDC A;  3TSZ A; 
#chains in the Genus database with same CATH homology
 5GAN e;  4M78 B;  3JCM e;  4J7F A;  2Q7G A;  1YJW T;  3H6Z A;  3OYJ A;  4LVI A;  2DIG A;  2Y90 A;  2VV5 A;  3VQX A;  2RHQ B;  3A32 A;  5GAN 7;  1VQL A;  3RGL A;  2PME A;  3R6O A;  3OBY A;  2BKD N;  4BY6 B;  2RI3 A;  1K73 U;  1NJ2 A;  3H8Z A;  4A4G A;  2KK4 A;  3UGQ A;  4OGC A;  1M4Z A;  3OYB A;  1K73 C;  2ZT5 A;  3BW1 A;  3WVE B;  2L8D A;  2CZ7 B;  4KBM B;  2EQJ A;  3FLG A;  3RAC A;  2K5F A;  2BUD A;  2JNG A;  4M7D G;  1EIY B;  4P73 C;  5FLX E;  4YCW A;  2C06 A;  2ARU A;  3O8V A;  3M9Q A;  2XDB A;  1H4Q A;  3DLM A;  3CC2 A;  1JJ2 S;  3CC4 A;  4C8Q G;  1VQP T;  4VUB A;  4ZTU B;  3HXX A;  1KD1 U;  2ZPF B;  4ZIB A;  3G6E A;  1KD1 C;  4L59 A;  2RHU A;  2G4C A;  1Z7M A;  3L2Z A;  1Y96 B;  1WJQ A;  2RHY A;  2ZPB B;  1X56 A;  3M4P A;  5C53 B;  1JJC A;  3TUP A;  2EIF A;  1N8R U;  4H2T A;  3QTC A;  2JUF A;  1N8R C;  3X20 B;  4M7A E;  2K5I A;  4YDQ A;  2DD4 A;  2P0Q A;  2XHC A;  3CME A;  3CCJ T;  4OF1 A;  2DJZ A;  1VQ5 A;  4E7K A;  1QF6 A;  3PNW C;  4YP0 A;  2AMC A;  4RMO A;  1UGQ B;  1OZ3 A;  2RJC A;  4XK8 E;  5KCH A;  3OYF A;  4YRT A;  3ZBD A;  4TWA A;  4P75 A;  1WQW A;  2VGN A;  2ZR2 A;  5J39 A;  4HCC A;  3LX7 A;  2DVE A;  4J6Y A;  2H3J A;  3RMS A;  1BI0 A;  4OP0 A;  3M58 A;  1FWZ A;  1USY A;  3QUI A;  1RI0 A;  1YGB A;  3M59 A;  4YRG A;  2GF7 A;  2ZPI B;  1ASZ A;  1SET A;  4CI0 C;  4O2D A;  3VV0 A;  2GFU A;  3RKY A;  3HFN A;  3NEN A;  2RHZ A;  3OD1 A;  4TVA B;  2LC4 A;  3CD6 A;  2ART A;  1M9S A;  2RM4 A;  2QTX A;  1H4T A;  1FX7 A;  3JCM Q;  2DQ3 A;  1N6A A;  3L4G A;  4C5E A;  4P3N A;  3HTZ A;  3A8G B;  3QBY A;  1KHC A;  5GAM f;  2KDS A;  2MWO A;  3C4S A;  3LW5 E;  4A4F A;  4QVZ A;  2E6Z A;  4F7U B;  1KG1 A;  4PJO D;  1B7Y B;  5I21 A;  3CXC A;  3CMA A;  4CH4 A;  3NTK A;  1DJ7 B;  2QQ9 A;  2L3R A;  2EYQ A;  2E5Q A;  5M9O A;  3MEA A;  4MDW A;  2CYZ B;  3A8O B;  3M4Q A;  4G84 A;  2LRQ A;  1QVP A;  3F70 A;  2XGT A;  3OMG A;  4L5G A;  4PJO C;  2M9U A;  2E65 A;  4H2V A;  1VQ6 T;  3ICA A;  2L89 A;  2ZIM A;  3IKL A;  3TEH B;  3FIF A;  2IY5 A;  3P8D A;  3HL8 A;  3JB9 I;  2EJF A;  1X2G A;  4N4H A;  3M53 A;  1OZ2 A;  4OGE A;  3EAE A;  2E1H A;  2VYT A;  4H2S A;  4BE0 A;  2KAF A;  4PG3 A;  4C92 C;  2BIV A;  3M55 A;  2RK1 A;  4FM4 B;  1QVG S;  1WU7 A;  1KMN A;  4E7L A;  4C5G A;  1U8R A;  4F7U E;  3OS2 A;  4QVC A;  4KUI A;  5LL6 S;  4YRI A;  4P3O A;  2DZC A;  1K8A U;  2I4N A;  5KE2 A;  1V29 B;  3CPW A;  4PJO F;  4YRR A;  1G3Y A;  1K8A C;  1QVG A;  4M78 A;  2A3L A;  1PSE A;  1NPP A;  1M90 U;  3M56 A;  2P4T A;  2QQB A;  4KUL A;  2E64 A;  1M90 C;  1D3B B;  4KT0 E;  2RO0 A;  1H4S A;  4C92 F;  3I56 A;  2QI2 A;  3CCJ A;  2DXB A;  3IG2 A;  2RHQ A;  4AH6 A;  2C8M A;  1RIQ A;  2FVU A;  2E70 A;  1X2H A;  4JLG A;  1YIT T;  3E9G A;  2QHV A;  3PMT A;  5GAN 6;  3QXE B;  5CVI A;  1P92 A;  1H4V B;  2B8A A;  2EJ9 A;  1I8F A;  1EIY A;  1MHN A;  2ZNJ A;  4FT2 A;  4RG2 A;  2F5T X;  4XTY A;  4YRM A;  4XTX A;  4BWA A;  1WGS A;  4GLK A;  1R8O B;  5HK3 A;  3G4S T;  4LVJ A;  2CIM A;  1B70 B;  3A74 A;  3LSQ A;  2ZIN A;  1HK9 A;  2RI5 A;  4PJO E;  5FU6 B;  4M75 D;  1VQ8 A;  2ZT8 A;  5LJ5 g;  1G51 A;  2A8E A;  1W4S A;  1Y96 A;  3V8J A;  3JSC A;  4HCZ A;  3SWN C;  2VXF A;  1QP3 A;  3A7U A;  4LDY A;  4YRP A;  5D6Y A;  3CCL A;  1BI1 A;  1VIE A;  4M75 C;  1VQZ A;  4M7D B;  1WJS A;  3PFS A;  3J80 E;  4HWT A;  5ELN A;  4CH3 A;  3QSU A;  2EJG A;  1VQL T;  4B9W A;  5C51 B;  2C7I A;  3I55 A;  3P8Y A;  2QDY B;  4C8Q B;  4XU2 A;  2K4Y A;  3NTI A;  3CCQ A;  2ZZF A;  3DKM A;  3MP1 A;  4RCC A;  4JS5 A;  4JLI A;  2EL9 A;  2HQE A;  4M75 F;  1VQ6 A;  2K3X A;  2XDP A;  2DO3 A;  3JCM g;  4N4I A;  5GAN g;  5GMK m;  3BFM A;  2EWN A;  3CC2 T;  3CCE T;  3CBM A;  3OYE A;  2LNV A;  1B76 A;  4HT9 A;  3HXZ A;  5LJ5 d;  4A4H A;  1YFR A;  3G6E T;  1YJN A;  1NJ6 A;  1E22 A;  5AYF A;  2DXU A;  4TVA A;  2QA4 T;  3OYL A;  2GQV A;  3PTA A;  4EO4 A;  2E10 A;  2EAY A;  4X5O A;  1M1G A;  3MET A;  2DTH A;  5HY6 A;  4XEO A;  3HRK A;  3P8H A;  3A31 A;  4MML A;  3OYI A;  5GAN 8;  4JRP A;  3HFZ B;  1X55 A;  3HSB A;  3JCM h;  5E3I A;  4HWP A;  3MP8 A;  4F7U A;  12AS A;  1BI3 A;  3OYM A;  1AHJ B;  1B7Y A;  3CME T;  3OYY A;  1VQ5 T;  3VUB A;  3QO5 A;  5C6S A;  1ASY A;  1NJ1 A;  4CS4 A;  4DQ2 A;  1N9W A;  2QEX T;  3G71 T;  4M75 E;  1X01 A;  5CQY A;  2J3M A;  4PJO G;  3FRN A;  3LWH A;  1YI2 A;  4C0D B;  4JRQ A;  1X54 A;  4QQD A;  5GMK h;  3JCM d;  5GAN d;  3TEH A;  3E1S A;  4P3P A;  3NTH A;  4EDU A;  3P8T A;  3C95 A;  4C92 G;  3PCO B;  2V8K A;  2V8J A;  1XNI A;  4X9D A;  4IUQ A;  1N27 A;  3TRE A;  2DD5 A;  3OY9 A;  4XU0 A;  1XTD A;  3CD6 T;  3DSQ A;  2RJD A;  3M57 A;  4WI1 A;  1XQH A;  5CK9 A;  1QVF A;  4RQE A;  5HK0 A;  4FT4 A;  3HXU A;  1ZHI A;  3UGT A;  4XTV A;  4BDZ A;  1G3W A;  1D3B A;  2XIC A;  1KHI A;  4NS5 A;  4H2W A;  4HT8 A;  2YRV A;  4XQ3 A;  4JUV A;  2X4X A;  5CKF A;  3GP8 A;  3JCM J;  1W2B S;  2DXT A;  3CMA T;  3HHT B;  4XAX B;  4O6J A;  3VU3 C;  1W2B A;  4M7A B;  3L1A A;  2EQM A;  2GCX A;  1X6O A;  4H02 A;  3M5A A;  2QHU A;  4JDS A;  3CPF A;  4LNS A;  4YRK A;  3V7R A;  5GMK e;  1YCY A;  4EMK B;  4ZGJ B;  4BUG A;  3E9H A;  2ZPG B;  5GAO n;  3R07 A;  2ZZE A;  4E7H A;  3RF1 A;  2DK3 A;  4TVR A;  3QYH B;  3CCE A;  1B70 A;  5A2Q E;  1YJ9 A;  2DU7 A;  4P74 C;  2QA4 A;  5C0M A;  4ZTZ B;  3INZ A;  2EQK A;  1U1S A;  1FXX A;  3CBP A;  5LJ3 j;  1I81 A;  3LH0 A;  4MZT A;  2HQX A;  4JS4 A;  1VIF A;  2IVW A;  4M75 G;  4M7D A;  4J15 A;  3I56 T;  3W3S A;  1KQS A;  4UP8 A;  3QG1 A;  4M77 C;  4C8Q A;  3L2U A;  4II1 A;  3RL6 A;  1UB4 A;  3V8L A;  4P72 C;  2QEX A;  3G71 A;  1BBU A;  3MEU A;  5IN1 A;  5CKD A;  1N9S A;  3QKJ A;  1VQK A;  4PLL A;  2KVQ G;  2ZNI A;  4HWO A;  3ZEH A;  2R58 A;  3X26 B;  1I5L A;  4LVL A;  4OMF B;  3JCM W;  3A5Z B;  5FRO A;  1ATI A;  1WJR A;  4ELY C;  4IUT A;  2FB7 A;  2QHT A;  3MQZ A;  1VQO T;  4M77 F;  1UGR B;  4KR2 A;  1NYQ A;  2X4J A;  3E9I A;  4XTW A;  4O5V A;  1VQ8 T;  5LJ5 j;  3ASK A;  4DPG A;  4YCV A;  1BIA A;  3WVD B;  2RJE A;  2KSS A;  3T9N A;  3M54 A;  3JRZ A;  4YPF A;  2XID A;  3HFZ A;  4BE2 A;  3ER0 A;  2D9T A;  4TVW A;  3CXC S;  4N0A A;  3GF5 A;  4J6X A;  3PIP A;  2X4W A;  3OA6 A;  3CCM A;  3CCL T;  2E12 A;  5GAM h;  3GLX A;  3IKM B;  1YIJ T;  4IUR A;  4G85 A;  1O75 A;  1NNH A;  3ERR A;  4FSX A;  3I55 T;  4C5H A;  4YRF A;  1G5V A;  2E6N A;  3LC0 A;  3HFV A;  3CCQ T;  4C92 D;  2XU8 A;  3HXW A;  3HPW A;  4PNO A;  2DKG A;  4E7I A;  4OB0 B;  2MAM A;  1KQ1 A;  4EMH A;  4A4K A;  2LDM A;  3JAM E;  4R56 A;  2O01 E;  4JRI A;  2Q7E A;  3P8B B;  3C94 A;  4EPC A;  2CJ9 A;  3OMC A;  5GAN j;  3PCO A;  2ZCE A;  1G3T A;  1NYR A;  2ZZG A;  1Q7Y U;  1J5W A;  3CPW S;  5GAN 4;  2KMT A;  1Q7Y C;  1YJN T;  2O4X B;  2PVG B;  3I7F A;  1C0A A;  4RQF A;  2LQ8 A;  4ME7 A;  2HNI A;  4P71 A;  2LVM A;  2RK2 A;  5CQX A;  2NLU A;  4BD3 A;  3Q1J A;  4PJO B;  5GAM e;  3J7A F;  1WLE A;  4E47 A;  3JB9 J;  1ADY A;  2CZ0 B;  2VXE A;  2WSF E;  5GAO m;  2HAX A;  2XG8 D;  2I4L A;  5DLQ E;  2AHJ B;  2VGM A;  4C92 B;  1NZ9 A;  3LGF A;  1ADJ A;  4M7A A;  3DB3 A;  1VQ4 T;  3OYH A;  2XI9 A;  5FU7 C;  2RJF A;  3ME9 A;  2CJA A;  3RKX A;  5C52 B;  1YI2 T;  4EMK A;  2LX9 A;  3UWN A;  5KH6 A;  4FU6 A;  2Q5H A;  1YHQ T;  4PKC C;  4NL3 A;  5LJ3 f;  2I4O A;  3IAL A;  5GAN 3;  1VQO A;  4XTU A;  3CCR A;  2ZT7 A;  3A8M B;  4LDV A;  5DM7 R;  3LSS A;  2I4M A;  5CKH A;  2DQ0 A;  4CRI A;  5CR2 A;  2IG0 A;  1IZ6 A;  3HRS A;  4X34 A;  4BDY A;  1ZQ1 A;  2JN0 A;  3CEY A;  1LJO A;  2E41 A;  2ZZD A;  4C92 E;  4UC4 A;  2A7Y A;  3S3O A;  2XD0 A;  4P73 A;  2WSC E;  1BIB A;  1B34 B;  2RHX A;  1OI1 A;  3GOX A;  3OQ5 A;  4H2X A;  1YIJ A;  3UT1 A;  11AS A;  4P75 C;  2RHI A;  2QQS A;  2PUO B;  2CZ6 B;  4M77 G;  5HGQ A;  1ZBX A;  4QVD A;  3MO8 A;  3PZC A;  4JRK A;  2AKW B;  4C0G A;  1USY C;  2QQA A;  3FEO A;  4ATO A;  3HFO A;  5LJ5 f;  5K1X A;  3CCS A;  4YRO A;  4BB7 A;  1Y07 A;  1LOJ A;  4ZGD B;  4ZN3 A;  3OS0 A;  3A5Z A;  3EFS A;  1SER A;  5LJ3 e;  3BJU A;  4H2Y A;  3TEG A;  2CJB A;  2J3L A;  4N4G A;  3UH0 A;  1OYX A;  4M75 B;  2XDD A;  1YB3 A;  2HD0 A;  4A54 A;  1QE0 A;  1M1F A;  4KUD K;  5GMK l;  1YJ9 T;  1YBY A;  4HWR A;  3VYG A;  1PYS B;  1KQ2 A;  5D6W A;  4LDX A;  3HP9 A;  1SSF A;  4PL6 A;  4HKE A;  4RCB A;  5IAY A;  4YRJ A;  1UEB A;  3HKS A;  3QO7 A;  5DLO A;  4E51 A;  3A7R A;  3QNE A;  4YRE A;  2R57 A;  1EOV A;  1QW1 A;  4C0D C;  1H64 1;  2EQU A;  1BYM A;  3E19 A;  2DIQ A;  1NJ8 A;  3L2W A;  5GAN f;  1L0W A;  1HXD A;  2K57 A;  3VUZ A;  2DAQ A;  2DEQ A;  4M78 D;  4MMK A;  1VQ9 T;  1VQ4 A;  1GGM A;  3PIO A;  3UFG A;  4HVC A;  1VQK T;  2ZCF B;  5KCO A;  3BDU A;  3EFR A;  1SES A;  4MZP A;  3TEE A;  2ZPE B;  1YHQ A;  5L8R E;  1WYD A;  3RKW A;  3OB9 A;  4R55 A;  4DOV A;  3N5B B;  1EVK A;  3VQY A;  1JBM A;  1FYF A;  4M78 C;  2ODR D;  3CBO A;  3GNF B;  4CH6 A;  3V7C A;  4L87 A;  1QVF S;  2QHS A;  2O4X A;  2RD1 A;  5DY9 A;  2PVO B;  3NET A;  2P0K A;  2ZT6 A;  1JRI A;  4TQF A;  3DLL A;  4C5I A;  3MP6 A;  3FDR A;  2XK0 A;  3RIR A;  4OVA A;  5CKB A;  1HTT A;  3NFC A;  3JB9 H;  2FHD A;  2ZIO A;  5I2S A;  4BY6 C;  1MGQ A;  3JB9 D;  4PJO A;  3VJP A;  2ODR C;  2F5K A;  3OBW A;  3JCM V;  4M7A C;  3OSS C;  3CCM T;  4M78 F;  2K3Y A;  3NEL A;  3OS1 A;  3MF2 A;  3S3N A;  5CKE A;  4EMK C;  2PQW A;  4C92 A;  3CCV A;  4UP7 A;  2XKO C;  2X4Y A;  1PSF A;  4RMF A;  4M7A F;  5A0L A;  4H2U A;  1VQN T;  4P5N A;  4QQ6 A;  2KQW A;  2FL7 A;  2DXC A;  2DU5 A;  5CCA A;  4LD6 A;  5FRN A;  2RB6 A;  1EIF A;  5KE3 A;  5I2M A;  4MZM A;  3QHS A;  2JOY A;  2D6F A;  2P0P A;  1Y71 A;  3JB9 F;  3REU A;  3BDL A;  3QO8 A;  3A5Y A;  5ELO A;  3QJ6 A;  4YRN A;  5K1P A;  3CC7 A;  4EX5 A;  4YRC A;  3WQZ A;  4M77 D;  4M78 E;  2RA2 A;  4B9X A;  2X35 A;  3QZ9 B;  1EQR A;  4V2S A;  1KQS S;  3V8K A;  4IKF A;  1B34 A;  2ZPH B;  4J6W A;  4XTZ A;  2EKO A;  1JJ2 A;  2ZTG A;  4RG8 A;  3MEY A;  4H2X B;  5F5W A;  2M0O A;  3V7S A;  2LQK A;  1Q86 U;  3A8H B;  3CMQ A;  2CKK A;  1Q86 C;  1X75 C;  1O9S A;  4CH5 A;  3L2V A;  2DDZ A;  2AKW A;  4LVM A;  3PGG A;  3OSV A;  3MCA B;  3LYI A;  4Q15 A;  4WF2 A;  2M1H A;  1VQ9 A;  2OTL A;  4NCX A;  1VQM T;  2JTF A;  1M8V A;  1S72 A;  3CCU T;  3SWN A;  4RDX A;  4ZTF A;  1UGS B;  3G7Z A;  2YLB A;  3WXM B;  3VYH B;  1M5Q 1;  3REX A;  2Y4X A;  2JTM A;  3KUF A;  4BAC A;  3HXY A;  4M75 A;  3CCR T;  5GAM g;  3OYK A;  3A7A A;  3FC3 A;  3FJP A;  4WJ4 A;  3C12 A;  1PYS A;  1EVL A;  5J3B A;  2MF2 A;  4M77 B;  2V8I A;  1TH7 A;  2D0Q B;  2KY9 A;  4C0F A;  4YTL A;  4UPA A;  3P8V A;  3QO3 A;  5GAO q;  2VUB A;  2E5A A;  4HCB A;  4XU3 A;  4IUP A;  3SD4 A;  5A0D A;  3QJY A;  4GY5 A;  4F7U F;  1NJI U;  2YHT A;  3JCM X;  4FL6 A;  1NJI C;  1YJW A;  2LT4 A;  3QZ5 B;  4BI4 A;  4PHC A;  4IUV A;  1Q82 U;  3VBB A;  2CS7 A;  2L5Q A;  1VQ7 T;  4WJ3 M;  1Q82 C;  3CCS T;  3OYC A;  3RER A;  4NOY A;  3JCM P;  4M77 E;  1WQ7 A;  1VQN A;  4OB2 B;  4E7J A;  2G3R A;  3DB4 A;  4ZGE B;  4YCU A;  5GAM d;  1WNL A;  4M78 G;  1B8A A;  4A4E A;  3OW2 S;  3A8L B;  2GFA A;  2MMP A;  1RL2 A;  1E24 A;  3SB2 A;  2F69 A;  2ALY B;  3QPH A;  4KR3 A;  3OW2 A;  2MWP A;  2QXF A;  3OS5 A;  3HXV A;  1I4K 1;  3RMQ A;  4J83 A;  4ZTJ A;  3SDZ A;  1VQP A;  2RH2 A;  4XU1 A;  2RHS B;  4M7A G;  4QW2 A;  2CZ1 B;  4LVK A;  4J5Y A;  2WSE E;  5GMK j;  1E1T A;  4OB1 B;  4NL2 A;  2I2L A;  4J7I A;  3ZFJ A;  3GPL A;  3LWI A;  5LJ3 g;  1U1T A;  3VQV A;  2M16 A;  3LLR A;  1UGP B;  3JB9 G;  3JCM c;  5J26 A;  3HY0 A;  4LDW A;  3VKI A;  1NJ5 A;  5GAO l;  2ARS A;  2ZGW A;  5FRM A;  3MF1 A;  5GAO p;  5KNN A;  1BKB A;  1JB0 E;  1VQM A;  3X28 B;  5FU6 C;  3SFM A;  5IT9 E;  4M7D D;  3CCU A;  2ZR3 A;  4OB3 B;  2P5I A;  4OLF A;  2R5A A;  2Q5I A;  3FB9 A;  1QP2 A;  1GXI E;  5LJ3 h;  3UPU A;  2YLC A;  5EG2 A;  4Y91 A;  4L6V 5;  4C8Q D;  1IL2 A;  2K2V A;  4YRL A;  2LCC A;  3NEM A;  3URG A;  3QYG B;  4K86 A;  4DOW A;  1K9M U;  4M7D C;  3KFU A;  4FIB A;  3E9F A;  1K9M C;  1BBW A;  4EMG A;  1SRY A;  3HRI A;  4IUU A;  3AHU A;  1E1O A;  5FU7 B;  4ZN1 A;  4C8Q C;  3GNG A;  4BE1 A;  4J8O A;  4K87 A;  2DTO A;  1G5I A;  4YRS A;  5LJ3 d;  3GIB A;  2CGH A;  2PUK B;  2MI6 A;  2OTJ T;  4M7D F;  2EFI A;  1JJC B;  4P74 A;  2Q7H A;  3CCV T;  2VC8 A;  2JVV A;  1M1K U;  4HA8 A;  3L42 A;  5GAN 5;  4C8Q F;  1M1K C;  1VQ7 A;  4YRQ A;  4XEM A;  2XTI A;  5LJ5 h;  4DA4 A;  3LGL A;  2PVD B;  3X24 B;  3SWN B;  2HBP A;  2JZ2 A;  2AMC B;  3OYG A;  3HRU A;  3M4G A;  5A0G A;  4K88 A;  1YFS A;  2PMF A;  4D6W A;  2RI2 A;  1Q81 U;  4F7U G;  4N0A C;  3OYA A;  5CAI A;  1LYL A;  4KQE A;  3RUX A;  4M77 A;  3OYN A;  1KC8 U;  2PU9 B;  1Q81 C;  4PLI A;  4JJN K;  4QQG A;  3S6W A;  1KC8 C;  4P72 A;  5GAN 2;  4Q6G A;  2LCL A;  5GMK i;  3CC7 T;  3QDR B;  4HT4 A;  3CC4 T;  2QQR A;  2LT1 A;  3G1Z A;  2ZXF A;  5HKC A;  3RES A;  2R5M A;  4Z02 A;  4M7D E;  2DPP B;  3M4Y A;  1NE8 A;  4TTV A;  3S3M A;  1W66 A;  3QII A;  3PMI A;  3L2Q A;  4TVY A;  2DZ9 A;  3JCM f;  1XOV A;  3X25 B;  3L4G B;  4C8Q E;  3MEW A;  4UP9 A;  5GAN h;  2DTI A;  4LD9 K;  4MDX A;  4TQD A;  4CS3 A;  3MHX A;  2OTL T;  1Z7N A;  5LJ5 e;  2Y4Y A;  5CIU A;  3TU4 K;  1VUB A;  3L2R A;  1S72 T;  1Y7X A;  2NS6 A;  1YIT A;  1H3Z A;  4Q5W A;  4ELZ C;  4HWS A;  3VQW A;  5CO7 A;  4X9C A;  4A53 A;  5GAM j;  4LDU A;  3HY1 A;  1HC7 A;  2ALY A;  2OAU A;  4P71 C;  1BI2 A;  4M7A D;  4YYE A;  2E3C A;  1YFT A;  1KOG A;  5GAO r;  4BW9 A;  4BI3 A;  1IRE B;  3JCM b;  2P0L A;  2IY5 B;  1LNX A;  3BY7 A;  4RKU E;  5D6X A;  1WPY A;  1G3S A;  3G4S A;  4CS2 A;  3HRT A;  2RHS A;  3KXT A;  1KMM A;  2K5L A;  4Y28 E;  2LTO A;  3J81 E;  4BI8 B;  3OYD A;  3KBG A;  3MEV A;  2FYK A;  3TCJ A;  1G5H A;  1NPR A;  2WAC A;  3PT9 A;  4C0Z A;  1N9R A;  2OTJ A;  1EFW A;  3UDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...