4OP0A

Crystal structure of biotin protein ligase (rv3279c) of mycobacterium tuberculosis, complexed with biotinyl-5'-amp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
265
structure length
259
Chain Sequence
MADRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLITGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BirA bifunctional protein
publication title Active site conformational changes upon reaction intermediate biotinyl-5'-AMP binding in biotin protein ligase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 89
structure length 259
sequence length 265
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4op0A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4op0A01
1PYSA 1YB3A 4YROA 1YFSA 4CH5A 2I4OA 4EX5A 1NJ1A 1USYC 3QNEA 4MMKA 3JB9I 4RCCA 4H2VA 3VBBA 4YRLA 5HGQA 2E1HA 1BBUA 1HC7A 3NELA 4J6XA 2CJAA 3MEYA 4BW9A 4M78B 5F5WA 4M7AB 5ELOA 4C92G 3JCMP 1NYRA 4M75G 1YFTA 2E10A 4HT9A 4F7UB 2RHQA 2E64A 5LJ5g 3REUA 4C8QG 2ZZFA 1N9SA 2DTIA 5GAOq 1ASZA 4TTVA 4C8QD 5GAN4 3HXZA 2FYKA 1B70A 4YRTA 5LJ5h 2RHSA 3JB9F 2Q5IA 4M78E 4M7AE 4YYEA 4X9DA 4YRPA 1SRYA 4HWSA 2EAYA 3RUXA 4F7UE 1BIAA 4TVYA 4EO4A 1EVKA 4G85A 2ARSA 5GAOm 1WYDA 4M78F 1FYFA 1E24A 4DPGA 2DKGA 2VXEA 3M4QA 3A7RA 4XTWA 3FB9A 1I81A 4YRNA 4H2UA 3V7SA 4YCUA 4H2YA 2Q7EA 4MMLA 4K86A 2DXUA 1L0WA 3VQYA 4ZTUB 1ADJA 3TEGA 5GAOp 4TWAA 3A5YA 3P8YA 3RKWA 1BBWA 2E3CA 5LJ3g 2RA2A 1IL2A 4CH3A 2ZIMA 2DJZA 1H4QA 4AH6A 3HXUA 2XTIA 3OD1A 1M8VA 4P72A 4CS3A 4M77B 1B7YA 4M77D 4YRJA 1RIQA 3LSQA 5GAMg 2CIMA 3JCMd 1X2HA 3EFRA 5GAN5 4H2XA 4M75A 3VU3C 2ALYA 4P3OA 2AMCA 1EIYA 3HXWA 3QO7A 2ZNJA 2E41A 3A32A 4P72C 4ZIBA 5GAMh 3HFZA 2RD1A 4UP7A 2ZNIA 3V8LA 4C92C 1HXDA 4M75C 5GMKm 5LJ5e 3NETA 4M77E 3BW1A 2HNIA 3UFGA 5LJ5f 3E9IA 5GAN3 1SETA 3QO8A 3NEMA 2DQ0A 2IY5B 1I8FA 5C53B 2ZZEA 2E5AA 2FB7A 1D3BB 1YCYA 4NL3A 3JCMJ 1GGMA 1WU7A 2XGTA 3ERRA 1LNXA 3PCOB 1U1TA 4RQEA 2DQ3A 4HWRA 5GANd 5CAIA 3L4GA 4H2TA 4Q6GA 4RQFA 4EMHA 1SERA 4P75A 3RIRA 3GIBA 4J6WA 4QVDA 1KMNA 4JUVA 2DU5A 1H4VB 1EFWA 3QSUA 4HT8A 4PHCA 1JJCB 3KFUA 3VQVA 2K57A 11ASA 4M7DE 2Y90A 5LJ5j 4P75C 1WLEA 5K1PA 4XTZA 1B34A 4PJOE 4CS4A 3QHSA 5ELNA 2ZIOA 3E9HA 1H641 4M7DF 4Q15A 4H02A 5GAN8 1Y96A 2I2LA 3UGQA 4C92B 4PJOF 5C51B 4M75B 3SWNB 2C8MA 3JB9J 4C92D 4G84A 3INZA 4M75D 2ZZGA 2DTHA 3JB9G 3P8VA 3IKLA 5GAMe 4C8QB 3TEHB 4JLIA 2QTXA 3QO5A 5GAMf 2QHSA 1X54A 3A5ZA 4HWPA 2DTOA 4P3NA 4KQEA 3HFOA 3RERA 3JCMV 3M4GA 3HRKA 1VQZA 1KQ2A 3QTCA 1I4K1 2YLCA 4RDXA 3RL6A 3CMQA 4TVAB 2G4CA 5GMKj 1G5IA 3RGLA 3V8JA 3PZCA 4HVCA 3RACA 4M7AF 3JCMg 2C7IA 3A74A 3ICAA 2J3LA 4C8QE 4HWTA 5GAN6 4F7UF 3BDUA 5LJ3j 1U1SA 3L1AA 2AKWB 4JRKA 4C8QF 3FIFA 3JCMh 1I5LA 2ZINA 5E3IA 3HY1A 2EJFA 4J15A 1PYSB 12ASA 2ZT7A 3HSBA 5GAMj 2ARUA 4BWAA 5GMKh 4YRSA 5GANj 4M7DA 1KQ1A 3HFNA 4X9CA 4LNSA 4PJOA 4L87A 2ZTGA 3DSQA 2EWNA 2CJ9A 4WJ3M 5LJ3h 3BY7A 4DQ2A 3JCMQ 3JB9H 4UPAA 1E22A 5GANg 2ZCEA 4XTVA 1X01A 3HY0A 4K88A 2RHQB 4YCWA 2ZT5A 4YRRA 2DEQA 4N0AA 3QUIA 4XTUA 4UP8A 5GANh 1EVLA 4YPFA 4YRCA 2Q5HA 4HWOA 1B70B 4M78A 4M7AA 4YRGA 4XU1A 4OP0A 1NYQA 3UGTA 2RHSB 4F7UA 4TQDA 1BIBA 4CS2A 2EJGA 4PG3A 1WQ7A 4M77F 4J5YA 4YRMA 3HTZA 2QHVA 2ZT8A 5GAOr 4WF2A 4M78C 4M7AC 2VXFA 2DU7A 2P0LA 4J6YA 4K87A 3G1ZA 3LC0A 4OLFA 1YGBA 1B8AA 5GAN7 1QF6A 5KNNA 4Y91A 5GAN2 3JCMe 1MGQA 4P71A 3I7FA 3JCMf 3HXXA 5GMKe 2ZXFA 4M7DG 3VQWA 3A7AA 1Z7MA 2RB6A 2YHTA 3JCMc 4ZTZB 2J3MA 4PJOG 3MF1A 4P71C 2EL9A 4YRIA 1KOGA 2DZ9A 2JN0A 4RCBA 3REXA 5LJ3e 2ODRC 3V7RA 3L2ZA 1B7YB 4XU0A 4NOYA 5LJ3f 5GAOn 4H2XB 2ALYB 2AMCB 1NJ8A 1EIYB 1M5Q1 1EQRA 4KR2A 1E1OA 3JB9D 4YRKA 5GANe 3WQZA 2QHUA 3HFZB 4M77A 1G5HA 5GAOl 4YREA 4M78G 3JCMX 5GANf 4M7AG 2ZR2A 2QHTA 4F7UG 4M78D 1LOJA 4M7AD 1G51A 3TUPA 4V2SA 1NJ2A 3IG2A 4C92E 1N9RA 4M75E 4NCXA 4WI1A 4NL2A 4M77C 4WJ4A 3RF1A 3SB2A 4TQFA 4A54A 2ZR3A 4C92F 4M75F 1X55A 2PMEA 1WNLA 4UP9A 4E51A 1EOVA 4EMKA 4KR3A 3RKXA 3L4GB 2P5IA 2VC8A 3IALA 1C0AA 3JCMW 2IY5A 1Z7NA 3HRIA 3UH0A 2DDZA 2E65A 4CH6A 4XTXA 1WQWA 3NENA 1X2GA 4P73A 1NNHA 2ODRD 1HTTA 3W3SA 1D3BA 1WPYA 3PCOA 4TVWA 4EMKC 1E1TA 4H2WA 2YLBA 5GMKi 4XU3A 4YCVA 3R07A 3FJPA 3P8TA 1B34B 1W66A 5DY9A 5LJ5d 1N9WA 4P73C 1J5WA 1LYLA 2DVEA 4M7DC 3A31A 1H4SA 1Y96B 4JRIA 5GMKl 4PJOC 3BFMA 1NJ5A 3HXVA 1JJCA 2PMFA 2ZT6A 4XU2A 4XTYA 2EJ9A 3LSSA 4M77G 4XQ3A 1JBMA 4XEMA 1SESA 2I4LA 4HA8A 3V7CA 1YFRA 2RM4A 2CJBA 1LJOA 3M4PA 4C92A 3SWNA 4N0AC 1B76A 1X56A 3QO3A 2ZGWA 2CGHA 1NJ6A 2I4MA 3RKYA 1KMMA 4CH4A 4C8QA 3JCMb 3TEHA 3AHUA 1JRIA 3MF2A 4YRFA 2DXTA 3SWNC 3BJUA 4P74A 4XEOA 3V8KA 4YP0A 4PNOA 4H2SA 2Q7HA 4RMFA 4YRQA 4QVCA 2I4NA 4EMKB 1QE0A 5LJ3d 3RESA 4C8QC 4EMGA 4TVAA 5C52B 1ADYA 3PGGA 4X5OA 3VQXA 3A7UA 3IKMB 1HK9A 4P74C 1TH7A 5I21A 1ATIA 4YDQA 4M7DB 2DZCA 2ARTA 3HFVA 4M7DD 3EFSA 5GAMd 1USYA 2Q7GA 4P3PA 5K1XA 1H4TA 2AKWA 4PJOB 3HXYA 4A53A 4PJOD 4O2DA 1ASYA
chains in the Genus database with same CATH superfamily
2XKOC 2J05A 2MAMA 1PYSA 3H0HA 4KULA 4CRIA 1Q82C 2I4OA 4EX5A 1ZX6A 4MMKA 1PSEA 2KYMA 3VBBA 1RAEB 4CC4B 4EDUA 1AVZC 4BE1A 3NELA 4J6XA 4C0FA 1VQLT 5I11A 2NYSA 3UT1A 5F5WA 5ELOA 4QQDA 5DLOA 1NYGA 4RTTA 3JCMP 1K9MU 1YFTA 1D1AA 2E10A 4F7UB 1KHIA 3IQLA 4AT1B 1M1KC 4Z02A 1N9SA 2DTIA 3CCEA 3QDRB 2ENMA 4C8QD 4CC7A 5GAN4 2OTLT 2KE9A 4B9WA 4PJLA 1PHTA 4DOWA 3OYGA 2FYKA 1PNJA 2CZ6B 1AT1B 2CP3A 3HKSA 3X24B 2DIGA 3JB9F 1QCNA 8AT1B 2Q5IA 3CD6A 2PVOB 2KEAA 1SRYA 1MV3A 2H3EB 4F7UE 4FYWB 2LCCA 4EO4A 2D8HA 2FO0A 4G85A 1ZLMA 4DPGA 2DKGA 1VQ7Q 2GGRA 3EFOB 1VQOA 2RI3A 1NG2A 3PVLA 3CCJT 1MNDA 2AZVA 2K6DA 2EIFA 1YI2A 2GFUA 1K9MR 2R5AA 4YCUA 2BZXA 1W4SA 3HTRA 3VQYA 4ZTUB 1QP2A 2EQIA 1KD1R 1WGSA 3QYGB 2CP0A 1QVFP 2RA2A 1BBZA 4CH3A 2ZIMA 4IUVA 1QVPA 1RAFB 2DD4A 2A36A 3HRSA 3HXUA 1JXOA 2DAQA 1UGVA 1VQPQ 4P72A 1B7YA 4YRJA 6AT1B 3LSQA 2CIMA 3JCMd 1X2HA 5GAN5 1X6OA 4C5GA 1PC0A 2ALYA 5L23A 1EIYA 2J6KA 2ZNJA 2E41A 4ATOA 3CCRQ 1OEBA 1X43A 4MZTA 5GAMh 2RD1A 4UP7A 2M0OA 4C92C 1U06A 4M75C 4RTZA 5GMKm 2DILA 2CH4W 1B07A 1E6HA 1I5OB 1HD3A 5GAN3 2DXBA 1EIFA 1O9SA 1PKSA 2IY5B 3X28B 2CH4A 2ZPEB 1UEBA 1YCYA 2FRWA 3CPWS 3E2UA 1TUDA 2RQVA 4LD9K 5GANd 3T9NA 2L3SA 3QIIA 4EMHA 3I56T 1M3CA 3RIRA 1IGQA 2KMTA 1OYXA 3O5ZA 1ACMB 4J6WA 4ZGDB 1KMNA 2LJ1A 2HSPA 2DU5A 5FROA 2BE7D 1H92A 2VWFA 3G6EQ 2Y90A 5LJ5j 1WLEA 2KR3A 1B34A 2ED1A 3L2UA 1OI1A 5ELNA 2QDLA 1BKBA 3E9HA 4CC2A 3M0QA 1PG5B 4J9BA 3SWNB 4DBQA 3JB9J 3JB9G 1KHCA 4C8QB 1W2BP 3LH0A 3MO8A 3OW2S 3TEHB 1PD1A 2QTXA 4FT2A 3QO5A 5GAMf 1WHLA 1X54A 2QHSA 4JZ3A 2D9TA 3A98A 3DLLA 4KQEA 1SHGA 1YIJA 2X4YA 2M51A 3HP9A 5LL6S 5IT9E 1D09B 2AIRB 3CMQA 5GMKj 1Q82U 3RACA 5CO7A 2E6NA 2EKOA 3ICAA 4C8QE 4CC3A 2LVMA 4RUGA 4F7UF 5GAN6 1Q95G 1ZSZA 2DL8A 1VQ9Q 1Q81R 5LJ3j 4OGCA 4C5IA 2C0OA 2RHZA 3L1AA 4FW1A 2VKNA 1EFNA 5E3IA 1VQ6Q 2K5FA 2WSCE 2EJFA 5IXFA 2X3XD 1ASYA 2Z0WA 2W10A 1KC8C 4KH1B 3L2WA 5GMKh 3A8OB 2JNGA 4LVKA 2JJ9A 2K5IA 3L42A 5D7UA 5CK9A 3LLRA 5LJ3h 5CKHA 1UJYA 4LN2A 3H0IA 2RHQB 5FWBA 5C0MA 2RNAA 3ZL7C 3EGXA 3EG9B 1K73C 2HSEB 2O4XA 4YPFA 4AFZC 4HWOA 1F1BB 4OP0A 3I5SA 3QXEB 1BIBA 2EJGA 3REBB 3LGLA 4YRMA 2KXCA 1G3WA 1LVKA 2HD0A 2V26A 2VXFA 1ZUKA 2K4YA 4OLFA 2QAZA 1YGBA 5IN1A 5GAN7 1QF6A 4HCZA 1VQ4A 2GBQA 2M16A 5GAN2 2JVVA 1AD5A 2ECZA 5ECAA 1MGQA 3CXCP 4HVWA 1FMWA 4P71A 2M0YA 1XTDA 1XNIA 2RH2A 3SEMA 3A8GB 2XIDA 4WCIA 1HSQA 1JJ2S 3A7AA 1JB0E 2RB6A 2YHTA 2VGNA 3JCMc 1OPKA 3OYBA 4BUGA 1SG5A 3UATA 2V1RA 2BTTA 3QYHB 4HCKA 1X2QA 4LUEA 3V7RA 1QP3A 5CKEA 4L6V5 5LJ3f 1KK7A 2RMOA 1G3TA 2KGTA 1QVGP 4H2XB 3VUBA 1M1GA 2NWMA 3QKJA 2LNHB 3QJYA 1VQKQ 2XU8A 1G5VA 2AMCB 2YUOA 1M5Q1 3JB9D 3KUFA 2M02A 4IKFA 3MHXA 2DEUA 1NEGA 3HFZB 1G5HA 5CKFA 3JCMX 2KT1A 1WJSA 4J9DA 1NYFA 2P0QA 3OBYA 4F7UG 3CCLA 1WJRA 4EIKA 3CC4Q 2HMAA 1VIEA 1KFZA 1VUBA 4F04B 4WTOB 4JS5A 2PVDB 1WXBA 1X2KA 1VQ7T 1M3BA 3SB2A 4IIOA 2HDAA 1X55A 3ULRB 2RF0A 3N5BB 2MMPA 1K9AA 4ZN3A 3JAME 1JQQA 3IALA 1LCKA 4PJNA 1CKAA 4XTXA 3NENA 2J6FA 2X4XA 4P73A 2KNBB 2DNUA 2ODRD 1D3BA 3PCOA 4RG8A 5GMKi 1YHQA 1Q7YC 2LMJA 1VQPT 4YCVA 3P8TA 5A0GA 2JZ2A 4RMOA 1N9WA 1LPLA 1UTIA 1VIFA 2CZ0B 2EQKA 4JRIA 2HQEA 1W6XA 3VS7A 1AOJA 2ZT6A 2L8DA 3CCRT 4J7IA 4XU2A 1JO8A 3MEAA 2EJ9A 4XQ3A 2CP5A 2FPEA 1AWOA 3MKDA 1GL5A 4OMPA 2EYZA 4FT4A 3V7CA 1YFRA 2RM4A 3NMZC 3RDVA 1RL2A 3CBOA 2DJQA 2LP5A 2PUOB 4OVAA 1B76A 1X56A 2ZGWA 2CGHA 3OYMA 5FU6B 1QW1A 4HVVA 4AG2C 1XJWB 2RJDA 1BI3A 1WHHA 4PLLA 3SWNC 3NGPA 1C6VX 2GCXA 4YP0A 1YFNA 4QVCA 1NM7A 2HEQA 2JXBA 4A4KA 4C8QC 1ADYA 3PGGA 1ABQA 3EG3A 3CCMQ 4P5NA 2E12A 2EQUA 2VV5A 2WACA 2IVWA 5FLXE 3G6ET 3CCQA 1ATIA 4M7DB 2DZCA 4C0DB 3HFVA 3H6ZA 5GAMd 3NFCA 4P3PA 5K1XA 2AKWA 1KSWA 3RMQA 2O31A 4LVMA 2PVGB 1YB3A 2ROTA 5CQYA 1OU8A 3HHTB 1NJ1A 1USYC 3QNEA 3G1JA 3J7AF 4AMCA 1YBYA 3OS0A 1VQLA 1QVFS 3A1PA 2CT4A 1OULA 4BI3A 2F69A 2LC4A 3H0FA 2CJAA 4BW9A 3HRUA 1YWOA 3GOXA 2RK1A 2SEMA 1NEBA 4BY6B 4HT9A 2NS6A 5KYUB 3TCJA 1CSKA 1YN8A 2DPPB 1X69A 5LJ5g 3CCVQ 4C8QG 2OTLA 1PCXA 2EKHA 3CCUQ 1ASZA 4KBMB 1VQ9T 4HCBA 3HXZA 2C0TA 3JRZA 1B70A 4YRTA 2RHSA 1VQ6T 1SPKA 4YYEA 1D0XA 4YRPA 4HWSA 3UF4A 4RTWA 4E7LA 1WYDA 4M78F 2P4RA 1E24A 4LVLA 2RJFA 3CCJA 1B3QA 3EHQA 1I81A 3TSZA 3S3NA 2JTEA 4E7HA 2DXUA 4IIMA 4AFQC 3E9FA 1PRLC 5GAOp 2GQVA 3A5YA 3P8YA 4TWAA 4OB1B 5LJ3g 1VQNQ 2V8KA 1M27C 2MPXC 1J3TA 2XTIA 4M77B 3MQZA 1RIQA 3CMEQ 2K5LA 4DEYA 3O8VA 1RAGB 1R8OB 4M75A 4ZTFA 1YWPA 3DB4A 1OU9A 1CKBA 3VS1A 2EYQA 3HXWA 1JXMA 1N6AA 4PL6A 3VUZA 4ZIBA 2EGEA 1W2BS 1EX4A 3CBMA 1HXDA 2JTFA 3FEOA 5LJ5e 2HBWA 3UWNA 4M77E 1PKTA 4PKCC 3BW1A 2HNIA 1TUCA 3EGDA 3E9IA 1G83A 1SETA 2HL5C 1SHFA 3OMGA 1I8FA 2EYXA 2BKDN 2FB7A 1FMVA 2XGTA 1GGMA 2K3YA 3ERRA 1RUWA 3CCQT 3C0CA 3I56A 4JRPA 5IHKA 3G71Q 3L4GA 4Q6GA 2KRNA 4RQFA 1SERA 1WA7A 3OQ5A 3OW2A 4QVDA 1N5ZA 1QMCA 1VQKT 2XMFA 1D0YA 4PHCA 2K57A 5L8RE 3M0RA 4CS4A 3CCSQ 1H641 1RI0A 3PIPA 3PMTA 3KBGA 3RNJA 4M7DF 4ZGEB 3CC4T 4Z89A 1Y96A 1S72Q 5C51B 2QK0A 2ZZGA 4OMMA 1EZZB 2DTHA 2L3PA 2EGCA 1SSHA 2XD0A 2CUBA 1X75C 3EGUA 4JLIA 3NTHA 1AWJA 1PRMC 4HVUA 5CCAA 1G3SA 3RERA 2JS2A 1WHMA 1X6GA 4A4FA 1YJ9Q 1YJNQ 3QTCA 1I4K1 1QCFA 2YLCA 4FSSA 1T0HA 4TVAB 4DEXA 2QQBA 4HVCA 1UGQB 3JCMg 1QCOA 1W1FA 5KYXA 2EQJA 1K8AU 1WJQA 3BDUA 2ATCB 3OS1A 2DO3A 3CC2Q 1SRLA 4E7KA 2F2XA 5FU6C 2ZINA 3OY9A 3VYGA 3CXCS 4J9HA 8ATCB 1TU0B 1ARKA 12ASA 2ZT7A 5GAMj 1KQ1A 4X9CA 1T3SA 2NUTA 1UG1A 4GLKA 2K3BA 1Y57A 2DRKA 2PQWA 5KYYB 2QYZA 2QQAA 3BY7A 3JCMQ 1N8RC 3M57A 4UPAA 1E22A 4E47A 2LNVA 5GANg 3H9NA 5HK3A 4C0DC 2ZCEA 4K88A 4B6MA 1QVGS 4GBQA 3OS2A 2OTJQ 2D6FA 3JSCA 1NE8A 5I2MA 1K8AR 4N0AA 4IUPA 1M90C 1IXDA 2DYBA 1OZ2A 4YRCA 5CKDA 3OS5A 4FW2A 1NYQA 2KROA 1JJ2A 4F7UA 1OPLA 4CS2A 1UGRB 3P8DA 3PTAA 1U8RA 4PG3A 1WQ7A 2D1XA 3CCMT 4M77F 2ZZDA 1WYXA 3HTZA 2J6OA 2DETA 3E1SA 1AZEA 2ZT8A 1VOMA 2WSFE 1PD0A 4BDYA 2DU7A 3BDLA 1YP5A 2P0LA 1MMGA 4BY6C 1B8AA 5IHNA 1KQSA 5KNNA 4Y91A 4K11A 3JCMe 3OYLA 2XDPA 2RQUA 4DOVA 1MUZA 2E3IA 5KYWB 1QLYA 4M7DG 3VQWA 3EFOA 2KSSA 4BI8B 4ZTZB 2J3MA 3CCSA 3I55Q 5A0LA 4YRIA 2DZ9A 2JN0A 3REXA 2O9SA 1M1FA 2ODRC 2IPOB 4XU0A 1TTHB 1TOVA 1IGUA 3CCVT 4FYXB 2R5MA 3CMAQ 3CCUT 2EVRA 3CBPA 1NBEB 4YRKA 2CYZB 5GANe 2F2VA 5EC7A 2ZCFB 3OBWA 5J39A 2L0AA 5HY6A 1R0CB 1MMAA 1IRXA 3CC7Q 5GJVB 4M78D 3QDFA 4M7AD 4V2SA 1NJ2A 3IG2A 5J3BA 1QWEA 4NCXA 4C5HA 1VQ7A 4NL2A 4M77C 2A37A 1GCQA 1Y07A 4FSXA 4ZNXA 3CC2A 2LCSA 2CSQA 4UP9A 3TU4K 1EOVA 1DJ7B 1RLQC 3LW5E 3RKXA 2VC8A 3CQTA 4X34A 2FZCB 3P8BB 3JCMW 2IY5A 2E65A 3HRTA 4CH6A 2QDYB 2O9VA 1X2GA 1BU1A 4KRTA 1VQNT 1WPYA 1M1KU 1MMDA 2XK0A 4F16A 4TVWA 4EMKC 1YITQ 1VQPA 1TWBA 2YLBA 4XU3A 1BCOA 2EPDA 1GBQA 2XHCA 2DMOA 3R07A 1TXQA 5DY9A 3CMET 1O75A 5D6WA 3WVEB 4ZN1A 3G4SQ 2FL7A 4C0ZA 2DVEA 4FYYB 1H4SA 2CDTA 3CCRA 5GMKl 1YJWQ 1Q82R 3BFMA 3HXVA 1K76A 2G6FX 2DVJA 5I2SA 3I5RA 2HQXA 4XTYA 4E7ZA 4N4IA 4LNPA 5FWCA 4M77G 3REAB 2VGMA 3GF5A 1WHJA 3A5ZB 1JBMA 3L2QA 1NJIC 1LJOA 1UHFA 3M4PA 3SWNA 4N0AC 2O2OA 3OYIA 2VASA 1PSFA 2I4MA 4CH4A 1KMMA 4C8QA 1M1KR 3NTIA 3JCMb 4ELZC 3TEHA 1VYVA 2KAFA 3OYCA 1G3YA 2DXTA 2F5KA 1WLPB 3G71T 3V8KA 4AG1C 4RMFA 5AYFA 3UA7A 3RESA 4EMGA 4A4GA 1N8RU 2HCKA 4LDXA 3FLGA 4N4HA 3VQXA 2RJEA 4IUTA 3G6EA 7AT1B 4OB0B 1HK9A 4P74C 2ZPGB 2CS7A 4D8DA 3A8MB 4L5GA 4M7DD 4FCYA 2X4WA 1USYA 3CPFA 1WZOA 3HXYA 4PJOB 2QQ9A 2VVKA 3CCST 1M90U 4O2DA 3M4YA 2CSIA 2QEXQ 4HCCA 1S72T 1H3HA 1IB8A 3TVTA 3UDCA 3FC3A 3JB9I 4RTUA 2NUPB 4GY5A 1IHWA 3ER0A 3NHNA 2E1HA 3ZFJA 4BD3A 2MF2A 1SF9A 1AWWA 4OMNA 2DERA 1P92A 2CP7A 4HKEA 2JUFA 4M78B 3GNGA 4M7AB 1YJ9T 1YJNT 2RHQA 2E64A 3J80E 4RTYA 4QT7A 3MEUA 4ME7A 3KFVA 4PJJA 4II1A 2ZZFA 1VQ9A 3UA6A 2D0QB 2JMAA 2L5QA 2QGFB 5GAOq 2HQHA 1QQJA 2YXYA 4FYVB 1VQ6A 3CC2T 2XG8D 4M78E 4M7AE 4LXCA 1D1CA 1GCQC 4A4EA 4QKUA 5D6YA 1GRIA 2EAYA 3RUXA 1BIAA 3LX7A 3I9QA 4TVYA 4JJDA 3SFMA 5GAOm 4OMLA 1YITA 1C1AA 4PJMA 4IUUA 1UGSB 1XQHA 3M4QA 2ED0A 3A7RA 1MNEA 5KE3A 5M9OA 4XTWA 3FB9A 2FEIA 3P8HA 4H2UA 4YRNA 5IXBA 4L59A 4H2YA 4VUBA 2Q7EA 4MMLA 4K86A 1L0WA 1ADJA 1H8KA 3TEGA 1I0CA 4J83A 2X4JA 3RKWA 2OTJT 2RK2A 2E3CA 2PTKA 1VQ8Q 2DJZA 4PFZA 1H4QA 4AH6A 4RTXA 2P4TA 4HXJA 3OD1A 3X20B 1M2VB 2KDSA 2RHUA 4LDVA 4M77D 1OV3A 2J06A 2QQRA 4Z8AA 5GAMg 2DRMA 4H2XA 1UDLA 3VU3C 2RQTA 3EG2A 2AMCA 2AKLA 3QBYA 3QO7A 1UB4A 1KC8U 3OW2P 4R56A 2CP2A 1G2BA 2OAWA 4F14A 3HFZA 2ZNIA 3V8LA 1OOTA 4JJBA 3M56A 1VQ5Q 1NLOC 3MJXA 1RADB 3UFGA 4R0KA 1RAHB 2KT8A 1Q86C 3NEMA 2A8EA 1IHVA 4JJNK 3LWIA 1ZA1B 5C53B 2F5TX 2BE9B 2RHIA 2E5AA 2QXFA 4E6RA 2F2WA 4NL3A 3JCMJ 1WU7A 2DF6A 4FU6A 2LQKA 1U1TA 4RQEA 1TUGB 2DQ3A 3VRZA 1K73U 4HWRA 4RTVA 3M53A 1NPPA 1K9MC 4H2TA 5A2QE 1VQKA 3GIBA 3A8HB 3G7ZA 1KD1C 2W0ZA 1H3ZA 3CMAT 4XAXB 2KRSA 4JUVA 3PE0A 2A08A 1EFWA 1GXIE 1KC8R 4HT8A 5FU7B 3QSUA 1JJCB 3KFUA 11ASA 2MIOA 4M7DE 4P75C 1VQMQ 5K1PA 4XTZA 3QHSA 1GCPA 2ZIOA 3CC4A 3CC7T 2NUZA 4H02A 1MMNA 1PWTA 4C92B 4PJOF 4M75B 2C8MA 1I07A 2QG9B 2NLUA 3IKLA 2RQRA 2J7IA 4BI4A 2P84A 5GAMe 2KRMA 3OSSC 2EQMA 1K73R 4HWPA 4P3NA 2DTOA 3JCMV 1YCSB 1KQ2A 4OB2B 1UJ0A 2MOXA 1FWZA 4RDXA 4PK4A 2DIQA 2G4CA 4FM4B 3M5AA 3V8JA 3R6OA 2OX7A 4M7AF 4BE0A 2RQWA 3A74A 1M2OA 2DL4A 2K3XA 1X6BA 1YITT 2J3LA 4HWTA 2KXDA 3CCEQ 2L3RA 1U1SA 4J9GA 2EYYA 2CREA 4JRKA 4X1VA 4Z88A 4MZPA 4OB3B 3G4ST 1I5LA 4J15A 5C6SA 2L2PA 1PYSB 5CVIA 3J81E 1YJWT 3CD6Q 4C5EA 3HSBA 3U23A 1JJ2P 4M7DA 3HFNA 4LNSA 3SD4A 2ZTGA 2JS0A 2EWNA 1VQOQ 5J26A 4WJ3M 2JW4A 2K9GA 2YSQA 1KQSP 4BDZA 2BIVA 4XTVA 1YI2Q 3CPWA 3VS3A 1X01A 1K4US 2DE0X 1UE9A 3M54A 1VQ5A 3QUIA 2MYSA 2DBKA 4TVRA 2Q5HA 2CT3A 3RMSA 2X9HA 2FRYA 1BI0A 3FRNA 4OGEA 1Q7YU 1R0BG 1BB9A 2YUPA 1IO6A 2EGAA 3CCMA 5KYUA 2CZ7B 2OJ2A 3DLMA 1ZSGA 1BK2A 2KY9A 2QHVA 2ZPBB 4M78C 4M7AC 4KGVB 1Q81C 1AWXA 4E7JA 4J6YA 3G1ZA 3LC0A 3OB9A 1RACB 5CR2A 1V76A 1VYUA 2QEXT 2A28A 3Q1JA 1M3AA 1UECA 3SDZA 3OYFA 2HAXA 2SRCA 4QW2A 3CEYA 4PFOA 2OI3A 5GMKe 2RPNA 2GFAA 1VQMA 4DA4A 1D1BA 4PJOG 3MF1A 3S3OA 2EL9A 3H41A 2VYTA 1KOGA 1Q7YR 2DLPA 4RCBA 5LJ3e 1E7OA 2YRCA 1B7YB 4NOYA 4KGZB 3CCVA 3QG1A 1FMKA 3CCUA 2ALYB 2K2MA 3E19A 1V1CA 1Q86U 3VS4A 2YUNA 1EIYB 1EQRA 4KR2A 1E1OA 4J7FA 4O5VA 9ATCB 3MEVA 2QHUA 2QQSA 4M77A 4YREA 4M78G 4M7AG 2RN8A 4JDSA 2ZR2A 3X25B 4D6WA 4WI1A 4R55A 1KD1U 3GPLA 3RR6A 3RF1A 1FYNA 4TQFA 3HL8A 4RG2A 4A54A 1K0SA 1BCMA 2DL7A 4C92F 2ZR3A 4M75F 2FG0A 4J8OA 2PMEA 1WNLA 1BYMA 2BZYA 2LJ3A 3M0UA 4MDXA 4J9IA 4E51A 4EMKA 4KR3A 1TG0A 1YIJQ 1C0AA 1Z7NA 3HRIA 3UH0A 2DDZA 1Q86R 2EBPA 1WQWA 1VQNA 1VQ8T 2AK5A 5EG2A 2KI7A 2HZYA 1E1TA 4JJCA 4H2WA 3MP8A 3CMEA 3FJPA 1B34B 2KK4A 3ME9A 1G8XA 1GBRA 1MV0B 3MP6A 4KH0B 4M7DC 3A31A 1WI7A 1NJ5A 2WSEE 1GFDA 2F1LA 2E70A 2DA9A 4QQ6A 3LSSA 2DD5A 1PM3A 4J9EA 1VQ5T 2JM9A 5IH2A 4XEMA 4LUDA 1SESA 1IREB 5FU7C 3M9QA 2DL5A 2GQIA 2R57A 3OYEA 2V1QA 2PZ1A 1V29B 4CI0C 1NJ6A 2LCLA 2E6ZA 3BE3A 1TS9A 2JOYA 2LRQA 1Y7XA 2K7AA 2ZPFB 3VYHB 3OYKA 3G71A 1ZSZB 2VUBA 2RJCA 3DB3A 4P74A 4XEOA 4H2SA 3NPFA 4YRQA 2I4NA 3M0TA 1QE0A 2RI5A 4TVAA 1GFCA 2JT4A 5D6XA 5C52B 1WXTA 2LQWA 4X5OA 2PNIA 1NZ9A 2A3LA 3A7UA 5HKCA 4EPCA 2ARTA 3EFSA 1M8MA 1VQMT 2Q7GA 4LVIA 1QWFA 3EH1A 4PJOD 3VRYA 2CUDA 2MI6A 4ESRA 3OYAA 1S72A 1OX9A 3JV3A 1VQ4Q 3TEEA 4LDYA 1UFFA 4YROA 1YFSA 4CH5A 4RCCA 4H2VA 2MWOA 3META 4YRLA 5HGQA 1BBUA 1HC7A 3EGXB 1KJWA 2XICA 4Y28E 2O4XB 1Q81U 4D8KA 1YJ9A 3MEYA 1YJNA 5KYYA 4F17A 2X3WD 4C92G 1NYRA 4M75G 5I22A 1FXXA 2B8AA 2B86A 4KT0E 2M1HA 5FW9A 4BACA 3C95A 4ZTJA 1D0ZA 3MEWA 3VS0A 4ZGJB 3REUA 3VS2A 4AFSC 2IG0A 2H8HA 3UPUA 2DX1A 4TTVA 2D0NA 3URGA 3CCET 2AKKA 3EH2A 2VB6A 5LJ5h 3GNFB 2AHJB 2LX9A 4X9DA 3CD6T 3OMCA 3QJ6A 3CCLQ 1EVKA 3RBBB 2ARSA 3C94A 4KGXB 3TQ7P 2Y4YA 2MCNA 1FYFA 2QA4Q 3AT1B 2VXEA 3EG0A 1WX6A 2MWPA 2RHXA 3M58A 4OF1A 2R58A 1VQOT 1ZQ1A 3V7SA 2YRVA 1YI2T 5KYWA 2OTJA 2FHDA 2G3RA 4BB7A 4JPBW 2JM8A 2OAUA 4KUDK 1BBWA 2IIMA 3EHRA 3QZ9B 2K2VA 1IL2A 2DBMA 4N4GA 2LZ6B 4KUIA 4E2FB 2QTVA 3GBQA 1U3OA 1M8VA 4HT4A 4CS3A 2FZGB 2DM1A 1YHQQ 2GNCA 2AZSA 3EFRA 4MDWA 4P3OA 4DBRA 1M30A 3A32A 4P72C 1MHNA 4B9XA 4MZMA 4NS5A 3NETA 4Q5WA 2QASA 3A8LB 5LJ5f 1B7TA 3OA6A 1QVFA 3QO8A 1SSFA 4J9CA 2DQ0A 3C12A 5FRNA 3OSVA 1X27A 1JEGA 2ZZEA 3I55A 2E4HA 2DXCA 2FPFA 3LGFA 1D3BB 3VKIA 3PCOB 2PUKB 1LNXA 2A7YA 2LQNA 1RI9A 2LJ0A 5CAIA 2P0KA 1IZ6A 4P75A 3CMAA 3M59A 2KYBA 2GTOA 4OMQA 2EYWA 2DK3A 1WIEA 1HJDA 1H4VB 5DLQE 1AZGB 1E6GA 2LT1A 3MCAB 3VQVA 1ABOA 2LTOA 1S1NA 3L2RA 2YDLA 3PT9A 1RABB 3PVQA 3CC7A 3CCQQ 4PJOE 5DM7R 5KE2A 3E9GA 3QWYA 2COWA 4Q15A 5GAN8 1N8RR 2AT1B 3PNWC 2I2LA 3UGQA 1QKWA 4G84A 2LX7A 1KQSS 4C92D 2HBPA 3INZA 4M75D 1SKUB 1T0JA 2P0PA 4ELYC 3P8VA 4QQGA 4IURA 4DBHA 3FJ5A 3EG9A 1YNZA 2KVQG 4IUQA 2JTMA 1VQLQ 2ESWA 5KH6A 3A5ZA 2ABLA 3M55A 1M90R 3TREA 2GF7A 3HFOA 3TSWA 4JRQA 3M4GA 3HRKA 4QVZA 1VQZA 2LT4A 3PFSA 5HCKA 1YIJT 1JU5C 3QZ5B 3ZBDA 3X26B 3RL6A 1WDXA 4DBFA 2QA4A 1G5IA 2QI2A 3RGLA 3PZCA 2C7IA 2LDMA 3CPWP 3SHWA 2OTLQ 5IAYA 3G4SA 2AKWB 3ZEHA 2BUDA 4Y92A 4OMFB 4C8QF 3KXTA 3FIFA 3JCMh 4A63B 1YJWA 3NTKA 5CKBA 4BE2A 3HY1A 2D8JA 2QGGA 5KCOA 1ZHIA 1W2BA 2E3HA 1ZSZC 1Z9ZA 4BWAA 2ARUA 4J9FA 4M4ZA 1Y71A 2C0IA 1ZBJA 2M9UA 3M0PA 5GANj 4FIBA 4YRSA 1HYOA 2O01E 3OYDA 4PJOA 4L87A 3L2VA 4JZ4A 3DSQA 2KBTA 3MPUB 2EW3A 3CCJQ 2C06A 2XDDA 2CJ9A 2E5QA 1K0XA 4DQ2A 3JB9H 4JLGA 2ZPIB 4LVJA 2V8IA 3HY0A 4YCWA 3M0SA 2ZT5A 4YRRA 2NUPA 2FPDA 1WHKA 2HKNA 2DEQA 4GLMA 4XTUA 4UP8A 3D7SB 5GANh 1EVLA 4ANJA 1B70B 4M78A 4M7AA 2V8JA 4YRGA 4XU1A 3UGTA 2RHSB 5GJWB 4TQDA 1OZ3A 4LDWA 3VV0A 4OMOA 5IHIA 3FDRA 3MP1A 4J5YA 1N27A 1M4ZA 2RHYA 2RI2A 5GAOr 4WF2A 4K87A 3I55T 1BI1A 2CKKA 2RO0A 1ZUYA 4E7SA 2QEXA 3S6WA 3QWXX 5AT1B 1VQ4T 3I7FA 1NJIU 2K79A 3JCMf 3S3MA 1M9SA 4RKUE 5CIUA 3HXXA 2ZXFA 1Z7MA 2CZ1B 1RAIB 1SRMA 1ZBXA 4P71C 2COZA 3I35A 2GTJA 2KQWA 3L2ZA 3I56Q 1T3LA 1FX7A 1KIKA 5GAOn 3H8ZA 2XI9A 1NJ8A 2COYA 1K8AC 3WQZA 3CXCA 3HPWA 2E5KA 2H3JA 1M2VA 1I1JA 5GAOl 1UHCA 5GANf 5KYNA 4E7IA 3R6NA 2QHTA 1LOJA 1NJIR 1G51A 3TUPA 3EGDB 1NPRA 2DFUA 3OYNA 3GP8A 1RAAB 1N9RA 4C92E 1TSFA 2X51A 4M75E 3CCLT 2YWWA 2YT6A 4WJ4A 1KG1A 2QA4T 2Y4XA 4LD6A 2FVUA 2A0FB 2MK5A 1U5SA 3C4SA 4AFUC 1QVGA 3OYYA 1QKXA 1A0NB 4O6JA 3L4GB 4LDUA 3OYHA 2P5IA 2L89A 4UC4A 1VQ8A 3THKA 2DL3A 1K1ZA 1OQKA 1VYTA 2XDBA 1NNHA 1HTTA 3W3SA 4FL6A 2DYIA 2FZKB 1W70A 1WFWA 3EAEA 1WHGA 3EG1A 1ZUUA 3WXMB 1AEYA 5HK0A 4ORZA 2HKQB 1W66A 5CQXA 1BI2A 2L3QA 1YHQT 5FRMA 5LJ5d 4P73C 1J5WA 1LYLA 1Y0MA 2HL3A 1Y96B 3ASKA 4PJOC 4JS4A 1JJCA 2CP6A 2YRDA 2ZPHB 2PMFA 3VJPA 2I0NA 2LQ8A 3VS5A 1RLPC 1NLPC 2I4LA 1WXUA 2PU9B 3GLXA 4HA8A 2CJBA 4C92A 1UUEA 3PMIA 1OX8A 1SEMA 5A0DA 3LWHA 3QO3A 4LE9A 3RKYA 2ROLA 4A4HA 2BZ8A 1XOVA 1ZA2B 1JRIA 3AHUA 3MF2A 5KYXB 3QPHA 2JMCA 3DKMA 4PFPA 2EFIA 1Z9QA 4YRFA 3F70A 2O88A 3BJUA 3WVDB 4C0GA 3VS6A 4PNOA 2Q7HA 4PLIA 4EMKB 5LJ3d 2ZAEA 3OYJA 1UGPB 1AHJB 2YUQA 5KCHA 3IKMB 4XK8E 2X35A 1TH7A 3LYIA 5I21A 4YDQA 2NUTB 1C0MA 4YTLA 1H4TA 1VA7A 1R77A 3LH5A 4A53A 3PIOA
chains in the Genus database with same CATH topology
2XKOC 2MAMA 1PYSA 1Q82C 4KULA 4CRIA 2I4OA 4EX5A 4MMKA 1PSEA 3VBBA 4EDUA 4BE1A 3NELA 4J6XA 4C0FA 1VQLT 3UT1A 5F5WA 5ELOA 4QQDA 5DLOA 3JCMP 1K9MU 1YFTA 2E10A 4F7UB 1KHIA 1M1KC 4Z02A 1N9SA 2DTIA 3CCEA 3QDRB 4C8QD 5GAN4 2OTLT 4B9WA 3OYGA 4DOWA 2FYKA 2CZ6B 3HKSA 3X24B 2DIGA 3JB9F 2Q5IA 3CD6A 2PVOB 1SRYA 4F7UE 2LCCA 4EO4A 4G85A 4DPGA 2DKGA 1VQOA 2RI3A 3CCJT 2EIFA 1YI2A 2GFUA 4YCUA 2R5AA 1W4SA 3VQYA 4ZTUB 1QP2A 1WGSA 3QYGB 2RA2A 4CH3A 2ZIMA 4IUVA 1QVPA 2DD4A 3HRSA 3HXUA 2DAQA 4P72A 1B7YA 4YRJA 3LSQA 2CIMA 3JCMd 1X2HA 5GAN5 1X6OA 4C5GA 2ALYA 1EIYA 2ZNJA 2E41A 4ATOA 4MZTA 5GAMh 2RD1A 4UP7A 2M0OA 4C92C 4M75C 5GMKm 5GAN3 2DXBA 1EIFA 1O9SA 2IY5B 3X28B 2ZPEB 1UEBA 1YCYA 3CPWS 4LD9K 5GANd 3T9NA 3QIIA 4EMHA 3I56T 3RIRA 2KMTA 1OYXA 4J6WA 4ZGDB 1KMNA 2DU5A 5FROA 2Y90A 5LJ5j 1WLEA 1B34A 3L2UA 1OI1A 5ELNA 3E9HA 1BKBA 3SWNB 3JB9J 3JB9G 1KHCA 4C8QB 3LH0A 3MO8A 3OW2S 3TEHB 2QTXA 4FT2A 3QO5A 5GAMf 2QHSA 1X54A 2D9TA 4KQEA 3DLLA 1YIJA 2X4YA 3HP9A 5LL6S 5IT9E 3CMQA 5GMKj 1Q82U 3RACA 5CO7A 2E6NA 2EKOA 3ICAA 4C8QE 2LVMA 5GAN6 4F7UF 5LJ3j 4OGCA 4C5IA 2RHZA 3L1AA 5E3IA 2K5FA 2WSCE 2EJFA 1ASYA 1KC8C 3L2WA 5GMKh 3A8OB 2JNGA 4LVKA 2K5IA 3L42A 5CK9A 3LLRA 5LJ3h 5CKHA 2RHQB 5C0MA 1K73C 2O4XA 4YPFA 4HWOA 4OP0A 3QXEB 1BIBA 2EJGA 3LGLA 4YRMA 1G3WA 2HD0A 2VXFA 2K4YA 4OLFA 1YGBA 5IN1A 5GAN7 1QF6A 4HCZA 1VQ4A 2M16A 5GAN2 2JVVA 1MGQA 4P71A 1XTDA 1XNIA 2RH2A 3A8GB 2XIDA 1JJ2S 3A7AA 1JB0E 2RB6A 2YHTA 2VGNA 3JCMc 3OYBA 4BUGA 3QYHB 3V7RA 1QP3A 5CKEA 4L6V5 5LJ3f 1G3TA 4H2XB 3VUBA 1M1GA 3QKJA 3QJYA 2AMCB 2XU8A 1G5VA 1M5Q1 3JB9D 3KUFA 4IKFA 3MHXA 3HFZB 1G5HA 5CKFA 3JCMX 1WJSA 2P0QA 3OBYA 4F7UG 3CCLA 1WJRA 1VIEA 1VUBA 4JS5A 2PVDB 1VQ7T 3SB2A 1X55A 3N5BB 2MMPA 4ZN3A 3JAME 3IALA 4XTXA 3NENA 2X4XA 4P73A 2ODRD 1D3BA 3PCOA 4RG8A 5GMKi 1YHQA 1Q7YC 1VQPT 4YCVA 3P8TA 5A0GA 2JZ2A 4RMOA 1N9WA 1VIFA 2CZ0B 2EQKA 4JRIA 2HQEA 2ZT6A 2L8DA 3CCRT 4J7IA 4XU2A 3MEAA 2EJ9A 4XQ3A 4FT4A 3V7CA 1YFRA 2RM4A 1RL2A 3CBOA 2PUOB 1B76A 4OVAA 1X56A 2ZGWA 2CGHA 3OYMA 5FU6B 1QW1A 2RJDA 1BI3A 4PLLA 3SWNC 2GCXA 4YP0A 4QVCA 4A4KA 4C8QC 1ADYA 3PGGA 4P5NA 2E12A 2EQUA 2VV5A 2WACA 2IVWA 5FLXE 3G6ET 1ATIA 3CCQA 4M7DB 2DZCA 4C0DB 3HFVA 3H6ZA 5GAMd 3NFCA 4P3PA 5K1XA 2AKWA 3RMQA 4LVMA 2PVGB 1YB3A 5CQYA 3HHTB 1NJ1A 1USYC 3QNEA 3J7AF 1YBYA 3OS0A 1VQLA 1QVFS 4BI3A 2F69A 2LC4A 2CJAA 4BW9A 3HRUA 3GOXA 2RK1A 4BY6B 4HT9A 2NS6A 3TCJA 2DPPB 5LJ5g 4C8QG 2OTLA 1ASZA 4KBMB 1VQ9T 4HCBA 3HXZA 3JRZA 1B70A 4YRTA 2RHSA 1VQ6T 4YYEA 4YRPA 4HWSA 4E7LA 1WYDA 4M78F 1E24A 4LVLA 2RJFA 3CCJA 1I81A 3S3NA 4E7HA 2DXUA 3E9FA 5GAOp 2GQVA 3A5YA 3P8YA 4TWAA 4OB1B 5LJ3g 2V8KA 2XTIA 4M77B 3MQZA 1RIQA 2K5LA 3O8VA 1R8OB 4M75A 4ZTFA 3DB4A 2EYQA 3HXWA 1N6AA 4PL6A 3VUZA 4ZIBA 1W2BS 3CBMA 1HXDA 2JTFA 3FEOA 5LJ5e 3UWNA 4M77E 4PKCC 3BW1A 2HNIA 3E9IA 1SETA 3OMGA 1I8FA 2BKDN 2FB7A 2XGTA 1GGMA 2K3YA 3ERRA 3CCQT 3I56A 4JRPA 3L4GA 4Q6GA 4RQFA 1SERA 3OQ5A 3OW2A 4QVDA 1VQKT 4PHCA 2K57A 5L8RE 4CS4A 1H641 1RI0A 3PIPA 3PMTA 3KBGA 4M7DF 4ZGEB 3CC4T 1Y96A 5C51B 2ZZGA 2DTHA 2XD0A 1X75C 4JLIA 3NTHA 5CCAA 1G3SA 3RERA 4A4FA 3QTCA 1I4K1 2YLCA 4TVAB 2QQBA 4HVCA 1UGQB 3JCMg 2EQJA 1K8AU 1WJQA 3BDUA 3OS1A 2DO3A 4E7KA 5FU6C 2ZINA 3OY9A 3VYGA 3CXCS 12ASA 2ZT7A 5GAMj 1KQ1A 4X9CA 4GLKA 2PQWA 2QQAA 3BY7A 3JCMQ 1N8RC 3M57A 4UPAA 1E22A 4E47A 2LNVA 5GANg 2ZCEA 5HK3A 4C0DC 4K88A 1QVGS 3OS2A 2D6FA 3JSCA 1NE8A 5I2MA 4N0AA 4IUPA 1M90C 1OZ2A 4YRCA 5CKDA 3OS5A 1NYQA 1JJ2A 4F7UA 4CS2A 1UGRB 3P8DA 3PTAA 1U8RA 4PG3A 1WQ7A 3CCMT 4M77F 2ZZDA 3HTZA 3E1SA 2ZT8A 2WSFE 4BDYA 2DU7A 3BDLA 2P0LA 4BY6C 1B8AA 1KQSA 5KNNA 4Y91A 3JCMe 3OYLA 2XDPA 4DOVA 4M7DG 3VQWA 2KSSA 4BI8B 4ZTZB 2J3MA 3CCSA 5A0LA 4YRIA 2DZ9A 2JN0A 3REXA 1M1FA 2ODRC 4XU0A 3CCVT 2R5MA 3CCUT 3CBPA 4YRKA 2CYZB 5GANe 2ZCFB 3OBWA 5J39A 5HY6A 4M78D 4M7AD 4V2SA 1NJ2A 3IG2A 5J3BA 4NCXA 4C5HA 1VQ7A 4NL2A 4M77C 1Y07A 4FSXA 3CC2A 4UP9A 3TU4K 1EOVA 1DJ7B 3LW5E 3RKXA 2VC8A 4X34A 3P8BB 3JCMW 2IY5A 2E65A 3HRTA 4CH6A 2QDYB 1X2GA 1VQNT 1WPYA 1M1KU 2XK0A 4TVWA 4EMKC 1VQPA 2YLBA 4XU3A 2XHCA 3R07A 5DY9A 3CMET 1O75A 5D6WA 3WVEB 4ZN1A 2FL7A 4C0ZA 2DVEA 1H4SA 3CCRA 5GMKl 3BFMA 3HXVA 5I2SA 2HQXA 4XTYA 4N4IA 4M77G 2VGMA 3GF5A 3A5ZB 1JBMA 3L2QA 1NJIC 1LJOA 3M4PA 3SWNA 4N0AC 3OYIA 1PSFA 2I4MA 4CH4A 1KMMA 4C8QA 3NTIA 3JCMb 4ELZC 3TEHA 2KAFA 3OYCA 1G3YA 2DXTA 2F5KA 3G71T 3V8KA 4RMFA 5AYFA 3RESA 4EMGA 4A4GA 1N8RU 4LDXA 3FLGA 4N4HA 3VQXA 2RJEA 4IUTA 3G6EA 4OB0B 1HK9A 4P74C 2ZPGB 2CS7A 3A8MB 4L5GA 4M7DD 2X4WA 1USYA 3CPFA 3HXYA 4PJOB 2QQ9A 3CCST 1M90U 4O2DA 3M4YA 4HCCA 1S72T 3UDCA 3FC3A 3JB9I 4GY5A 3ER0A 2E1HA 3ZFJA 4BD3A 2MF2A 1P92A 4HKEA 2JUFA 4M78B 3GNGA 4M7AB 1YJ9T 1YJNT 2RHQA 2E64A 3J80E 3MEUA 4ME7A 4II1A 2ZZFA 1VQ9A 2D0QB 2L5QA 5GAOq 1VQ6A 3CC2T 2XG8D 4M78E 4M7AE 4A4EA 5D6YA 2EAYA 3RUXA 1BIAA 3LX7A 4TVYA 3SFMA 5GAOm 1YITA 4IUUA 1UGSB 1XQHA 3M4QA 3A7RA 5KE3A 5M9OA 4XTWA 3FB9A 3P8HA 4H2UA 4YRNA 4L59A 4H2YA 4VUBA 2Q7EA 4MMLA 4K86A 1L0WA 1ADJA 3TEGA 4J83A 2X4JA 3RKWA 2OTJT 2RK2A 2E3CA 2DJZA 1H4QA 4AH6A 2P4TA 3OD1A 3X20B 2KDSA 2RHUA 4LDVA 4M77D 2QQRA 5GAMg 4H2XA 3VU3C 2AMCA 3QBYA 3QO7A 1UB4A 1KC8U 4R56A 3HFZA 2ZNIA 3V8LA 3M56A 3UFGA 1Q86C 3NEMA 2A8EA 4JJNK 3LWIA 5C53B 2F5TX 2RHIA 2E5AA 2QXFA 4NL3A 3JCMJ 1WU7A 4FU6A 2LQKA 1U1TA 4RQEA 2DQ3A 4HWRA 1K73U 3M53A 1NPPA 1K9MC 4H2TA 5A2QE 1VQKA 3GIBA 3A8HB 3G7ZA 1KD1C 1H3ZA 3CMAT 4XAXB 4JUVA 1EFWA 1GXIE 3QSUA 4HT8A 5FU7B 1JJCB 3KFUA 11ASA 4M7DE 4P75C 5K1PA 4XTZA 3QHSA 2ZIOA 3CC4A 3CC7T 4H02A 4C92B 4PJOF 4M75B 2C8MA 2NLUA 3IKLA 4BI4A 5GAMe 3OSSC 2EQMA 4HWPA 4P3NA 2DTOA 3JCMV 1KQ2A 4OB2B 1FWZA 4RDXA 2DIQA 2G4CA 4FM4B 3M5AA 3V8JA 3R6OA 4M7AF 4BE0A 3A74A 2J3LA 2K3XA 1YITT 4HWTA 2L3RA 1U1SA 4JRKA 4MZPA 4OB3B 3G4ST 1I5LA 4J15A 5C6SA 1PYSB 5CVIA 3J81E 1YJWT 4C5EA 3HSBA 4M7DA 3HFNA 4LNSA 3SD4A 2ZTGA 2EWNA 5J26A 4WJ3M 4BDZA 2BIVA 4XTVA 3CPWA 1X01A 3M54A 1VQ5A 3QUIA 4TVRA 2Q5HA 3RMSA 3FRNA 1BI0A 4OGEA 1Q7YU 3CCMA 2CZ7B 3DLMA 2KY9A 2QHVA 2ZPBB 4M78C 4M7AC 1Q81C 4E7JA 4J6YA 3G1ZA 3LC0A 3OB9A 5CR2A 2QEXT 3Q1JA 3SDZA 3OYFA 2HAXA 4QW2A 3CEYA 5GMKe 2GFAA 1VQMA 4DA4A 4PJOG 3MF1A 3S3OA 2EL9A 2VYTA 1KOGA 4RCBA 5LJ3e 1B7YB 4NOYA 3CCVA 3QG1A 3CCUA 2ALYB 3E19A 1Q86U 1EIYB 1EQRA 4KR2A 1E1OA 4J7FA 4O5VA 3MEVA 2QHUA 2QQSA 4M77A 4YREA 4M78G 4M7AG 4JDSA 2ZR2A 3X25B 4D6WA 4WI1A 4R55A 1KD1U 3GPLA 3RF1A 4TQFA 3HL8A 4RG2A 4A54A 2ZR3A 4C92F 4M75F 4J8OA 2PMEA 1WNLA 1BYMA 4MDXA 4E51A 4EMKA 4KR3A 1C0AA 1Z7NA 3HRIA 3UH0A 2DDZA 1WQWA 1VQNA 1VQ8T 5EG2A 1E1TA 4H2WA 3MP8A 3CMEA 3FJPA 1B34B 2KK4A 3ME9A 3MP6A 4M7DC 3A31A 1NJ5A 2WSEE 2E70A 4QQ6A 3LSSA 2DD5A 1VQ5T 4XEMA 1SESA 1IREB 5FU7C 3M9QA 2R57A 3OYEA 1V29B 4CI0C 1NJ6A 2LCLA 2E6ZA 2JOYA 2LRQA 3OYKA 1Y7XA 2ZPFB 3VYHB 3G71A 2VUBA 2RJCA 3DB3A 4P74A 4XEOA 4H2SA 4YRQA 2I4NA 1QE0A 2RI5A 4TVAA 5D6XA 5C52B 4X5OA 1NZ9A 2A3LA 3A7UA 5HKCA 4EPCA 2ARTA 3EFSA 2Q7GA 1VQMT 4LVIA 4PJOD 2MI6A 1S72A 3OYAA 3TEEA 4LDYA 4YROA 1YFSA 4CH5A 4RCCA 4H2VA 2MWOA 3META 4YRLA 5HGQA 1BBUA 1HC7A 2XICA 4Y28E 2O4XB 1Q81U 1YJ9A 3MEYA 1YJNA 4C92G 1NYRA 4M75G 1FXXA 2B8AA 4BACA 4KT0E 2M1HA 3C95A 4ZTJA 3MEWA 4ZGJB 3REUA 2IG0A 3UPUA 4TTVA 3URGA 3CCET 5LJ5h 3GNFB 2AHJB 2LX9A 4X9DA 3CD6T 3OMCA 3QJ6A 1EVKA 2ARSA 3C94A 2Y4YA 1FYFA 2VXEA 2MWPA 2RHXA 3M58A 4OF1A 2R58A 1VQOT 1ZQ1A 3V7SA 2YRVA 1YI2T 2OTJA 2FHDA 2G3RA 4BB7A 2OAUA 4KUDK 1BBWA 3QZ9B 2K2VA 1IL2A 4N4GA 4KUIA 1M8VA 4HT4A 4CS3A 3EFRA 4MDWA 4P3OA 3A32A 4P72C 1MHNA 4B9XA 4MZMA 4NS5A 3NETA 4Q5WA 3A8LB 5LJ5f 3OA6A 1QVFA 3QO8A 1SSFA 2DQ0A 3C12A 5FRNA 3OSVA 2ZZEA 3I55A 2DXCA 3LGFA 1D3BB 3VKIA 3PCOB 2PUKB 1LNXA 2A7YA 5CAIA 2P0KA 1IZ6A 4P75A 3CMAA 3M59A 2DK3A 1H4VB 5DLQE 3VQVA 3MCAB 2LT1A 2LTOA 3L2RA 3PT9A 3CC7A 4PJOE 5DM7R 5KE2A 3E9GA 4Q15A 5GAN8 3PNWC 2I2LA 3UGQA 4G84A 1KQSS 4C92D 2HBPA 3INZA 4M75D 2P0PA 4ELYC 3P8VA 4QQGA 4IURA 2KVQG 4IUQA 2JTMA 5KH6A 3A5ZA 3M55A 3TREA 2GF7A 3HFOA 4JRQA 3M4GA 3HRKA 4QVZA 1VQZA 2LT4A 3PFSA 1YIJT 3QZ5B 3ZBDA 3X26B 3RL6A 2QA4A 1G5IA 2QI2A 3RGLA 3PZCA 2C7IA 2LDMA 5IAYA 3G4SA 2AKWB 3ZEHA 2BUDA 4OMFB 4C8QF 3KXTA 3FIFA 3JCMh 1YJWA 3NTKA 5CKBA 4BE2A 3HY1A 5KCOA 1ZHIA 1W2BA 4BWAA 2ARUA 1Y71A 4YRSA 2M9UA 5GANj 4FIBA 2O01E 3OYDA 4PJOA 4L87A 3L2VA 3DSQA 2C06A 2XDDA 2CJ9A 2E5QA 4DQ2A 3JB9H 4JLGA 2ZPIB 4LVJA 2V8IA 3HY0A 4YCWA 2ZT5A 4YRRA 2DEQA 4XTUA 4UP8A 5GANh 1EVLA 1B70B 4M78A 4M7AA 2V8JA 4YRGA 4XU1A 3UGTA 2RHSB 4TQDA 1OZ3A 4LDWA 3VV0A 3FDRA 3MP1A 4J5YA 1N27A 1M4ZA 2RHYA 2RI2A 5GAOr 4WF2A 4K87A 3I55T 1BI1A 2CKKA 2RO0A 2QEXA 3S6WA 1VQ4T 3I7FA 1NJIU 3JCMf 3S3MA 1M9SA 4RKUE 5CIUA 3HXXA 2ZXFA 1Z7MA 2CZ1B 1ZBXA 4P71C 2KQWA 3L2ZA 1FX7A 5GAOn 3H8ZA 2XI9A 1NJ8A 1K8AC 3WQZA 3CXCA 3HPWA 2H3JA 5GAOl 5GANf 4E7IA 2QHTA 1LOJA 1G51A 3TUPA 1NPRA 3OYNA 3GP8A 4C92E 1N9RA 3CCLT 4M75E 4WJ4A 1KG1A 2QA4T 2Y4XA 4LD6A 2FVUA 3C4SA 1QVGA 3OYYA 4O6JA 3L4GB 4LDUA 3OYHA 2P5IA 2L89A 4UC4A 1VQ8A 2XDBA 1NNHA 1HTTA 3W3SA 4FL6A 3EAEA 3WXMB 5HK0A 1W66A 5CQXA 1BI2A 1YHQT 5FRMA 5LJ5d 4P73C 1J5WA 1LYLA 1Y96B 3ASKA 4PJOC 4JS4A 1JJCA 2ZPHB 2PMFA 3VJPA 2LQ8A 2I4LA 2PU9B 3GLXA 4HA8A 2CJBA 4C92A 3PMIA 5A0DA 3LWHA 3QO3A 3RKYA 4A4HA 1XOVA 3AHUA 1JRIA 3MF2A 3QPHA 3DKMA 2EFIA 4YRFA 3F70A 3BJUA 3WVDB 4C0GA 4PNOA 2Q7HA 4PLIA 4EMKB 5LJ3d 3OYJA 1UGPB 1AHJB 5KCHA 3IKMB 4XK8E 2X35A 1TH7A 3LYIA 5I21A 4YDQA 4YTLA 1H4TA 4A53A 3PIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYS A;  1YB3 A;  4YRO A;  1YFS A;  4CH5 A;  2I4O A;  4EX5 A;  1NJ1 A;  1USY C;  3QNE A;  4MMK A;  3JB9 I;  4RCC A;  4H2V A;  3VBB A;  4YRL A;  5HGQ A;  2E1H A;  1BBU A;  1HC7 A;  3NEL A;  4J6X A;  2CJA A;  3MEY A;  4BW9 A;  4M78 B;  5F5W A;  4M7A B;  5ELO A;  4C92 G;  3JCM P;  1NYR A;  4M75 G;  1YFT A;  2E10 A;  4HT9 A;  4F7U B;  2RHQ A;  2E64 A;  5LJ5 g;  3REU A;  4C8Q G;  2ZZF A;  1N9S A;  2DTI A;  5GAO q;  1ASZ A;  4TTV A;  4C8Q D;  5GAN 4;  3HXZ A;  2FYK A;  1B70 A;  4YRT A;  5LJ5 h;  2RHS A;  3JB9 F;  2Q5I A;  4M78 E;  4M7A E;  4YYE A;  4X9D A;  4YRP A;  1SRY A;  4HWS A;  2EAY A;  3RUX A;  4F7U E;  1BIA A;  4TVY A;  4EO4 A;  1EVK A;  4G85 A;  2ARS A;  5GAO m;  1WYD A;  4M78 F;  1FYF A;  1E24 A;  4DPG A;  2DKG A;  2VXE A;  3M4Q A;  3A7R A;  4XTW A;  3FB9 A;  1I81 A;  4YRN A;  4H2U A;  3V7S A;  4YCU A;  4H2Y A;  2Q7E A;  4MML A;  4K86 A;  2DXU A;  1L0W A;  3VQY A;  4ZTU B;  1ADJ A;  3TEG A;  5GAO p;  4TWA A;  3A5Y A;  3P8Y A;  3RKW A;  1BBW A;  2E3C A;  5LJ3 g;  2RA2 A;  1IL2 A;  4CH3 A;  2ZIM A;  2DJZ A;  1H4Q A;  4AH6 A;  3HXU A;  2XTI A;  3OD1 A;  1M8V A;  4P72 A;  4CS3 A;  4M77 B;  1B7Y A;  4M77 D;  4YRJ A;  1RIQ A;  3LSQ A;  5GAM g;  2CIM A;  3JCM d;  1X2H A;  3EFR A;  5GAN 5;  4H2X A;  4M75 A;  3VU3 C;  2ALY A;  4P3O A;  2AMC A;  1EIY A;  3HXW A;  3QO7 A;  2ZNJ A;  2E41 A;  3A32 A;  4P72 C;  4ZIB A;  5GAM h;  3HFZ A;  2RD1 A;  4UP7 A;  2ZNI A;  3V8L A;  4C92 C;  1HXD A;  4M75 C;  5GMK m;  5LJ5 e;  3NET A;  4M77 E;  3BW1 A;  2HNI A;  3UFG A;  5LJ5 f;  3E9I A;  5GAN 3;  1SET A;  3QO8 A;  3NEM A;  2DQ0 A;  2IY5 B;  1I8F A;  5C53 B;  2ZZE A;  2E5A A;  2FB7 A;  1D3B B;  1YCY A;  4NL3 A;  3JCM J;  1GGM A;  1WU7 A;  2XGT A;  3ERR A;  1LNX A;  3PCO B;  1U1T A;  4RQE A;  2DQ3 A;  4HWR A;  5GAN d;  5CAI A;  3L4G A;  4H2T A;  4Q6G A;  4RQF A;  4EMH A;  1SER A;  4P75 A;  3RIR A;  3GIB A;  4J6W A;  4QVD A;  1KMN A;  4JUV A;  2DU5 A;  1H4V B;  1EFW A;  3QSU A;  4HT8 A;  4PHC A;  1JJC B;  3KFU A;  3VQV A;  2K57 A;  11AS A;  4M7D E;  2Y90 A;  5LJ5 j;  4P75 C;  1WLE A;  5K1P A;  4XTZ A;  1B34 A;  4PJO E;  4CS4 A;  3QHS A;  5ELN A;  2ZIO A;  3E9H A;  1H64 1;  4M7D F;  4Q15 A;  4H02 A;  5GAN 8;  1Y96 A;  2I2L A;  3UGQ A;  4C92 B;  4PJO F;  5C51 B;  4M75 B;  3SWN B;  2C8M A;  3JB9 J;  4C92 D;  4G84 A;  3INZ A;  4M75 D;  2ZZG A;  2DTH A;  3JB9 G;  3P8V A;  3IKL A;  5GAM e;  4C8Q B;  3TEH B;  4JLI A;  2QTX A;  3QO5 A;  5GAM f;  2QHS A;  1X54 A;  3A5Z A;  4HWP A;  2DTO A;  4P3N A;  4KQE A;  3HFO A;  3RER A;  3JCM V;  3M4G A;  3HRK A;  1VQZ A;  1KQ2 A;  3QTC A;  1I4K 1;  2YLC A;  4RDX A;  3RL6 A;  3CMQ A;  4TVA B;  2G4C A;  5GMK j;  1G5I A;  3RGL A;  3V8J A;  3PZC A;  4HVC A;  3RAC A;  4M7A F;  3JCM g;  2C7I A;  3A74 A;  3ICA A;  2J3L A;  4C8Q E;  4HWT A;  5GAN 6;  4F7U F;  3BDU A;  5LJ3 j;  1U1S A;  3L1A A;  2AKW B;  4JRK A;  4C8Q F;  3FIF A;  3JCM h;  1I5L A;  2ZIN A;  5E3I A;  3HY1 A;  2EJF A;  4J15 A;  1PYS B;  12AS A;  2ZT7 A;  3HSB A;  5GAM j;  2ARU A;  4BWA A;  5GMK h;  4YRS A;  5GAN j;  4M7D A;  1KQ1 A;  3HFN A;  4X9C A;  4LNS A;  4PJO A;  4L87 A;  2ZTG A;  3DSQ A;  2EWN A;  2CJ9 A;  4WJ3 M;  5LJ3 h;  3BY7 A;  4DQ2 A;  3JCM Q;  3JB9 H;  4UPA A;  1E22 A;  5GAN g;  2ZCE A;  4XTV A;  1X01 A;  3HY0 A;  4K88 A;  2RHQ B;  4YCW A;  2ZT5 A;  4YRR A;  2DEQ A;  4N0A A;  3QUI A;  4XTU A;  4UP8 A;  5GAN h;  1EVL A;  4YPF A;  4YRC A;  2Q5H A;  4HWO A;  1B70 B;  4M78 A;  4M7A A;  4YRG A;  4XU1 A;  4OP0 A;  1NYQ A;  3UGT A;  2RHS B;  4F7U A;  4TQD A;  1BIB A;  4CS2 A;  2EJG A;  4PG3 A;  1WQ7 A;  4M77 F;  4J5Y A;  4YRM A;  3HTZ A;  2QHV A;  2ZT8 A;  5GAO r;  4WF2 A;  4M78 C;  4M7A C;  2VXF A;  2DU7 A;  2P0L A;  4J6Y A;  4K87 A;  3G1Z A;  3LC0 A;  4OLF A;  1YGB A;  1B8A A;  5GAN 7;  1QF6 A;  5KNN A;  4Y91 A;  5GAN 2;  3JCM e;  1MGQ A;  4P71 A;  3I7F A;  3JCM f;  3HXX A;  5GMK e;  2ZXF A;  4M7D G;  3VQW A;  3A7A A;  1Z7M A;  2RB6 A;  2YHT A;  3JCM c;  4ZTZ B;  2J3M A;  4PJO G;  3MF1 A;  4P71 C;  2EL9 A;  4YRI A;  1KOG A;  2DZ9 A;  2JN0 A;  4RCB A;  3REX A;  5LJ3 e;  2ODR C;  3V7R A;  3L2Z A;  1B7Y B;  4XU0 A;  4NOY A;  5LJ3 f;  5GAO n;  4H2X B;  2ALY B;  2AMC B;  1NJ8 A;  1EIY B;  1M5Q 1;  1EQR A;  4KR2 A;  1E1O A;  3JB9 D;  4YRK A;  5GAN e;  3WQZ A;  2QHU A;  3HFZ B;  4M77 A;  1G5H A;  5GAO l;  4YRE A;  4M78 G;  3JCM X;  5GAN f;  4M7A G;  2ZR2 A;  2QHT A;  4F7U G;  4M78 D;  1LOJ A;  4M7A D;  1G51 A;  3TUP A;  4V2S A;  1NJ2 A;  3IG2 A;  4C92 E;  1N9R A;  4M75 E;  4NCX A;  4WI1 A;  4NL2 A;  4M77 C;  4WJ4 A;  3RF1 A;  3SB2 A;  4TQF A;  4A54 A;  2ZR3 A;  4C92 F;  4M75 F;  1X55 A;  2PME A;  1WNL A;  4UP9 A;  4E51 A;  1EOV A;  4EMK A;  4KR3 A;  3RKX A;  3L4G B;  2P5I A;  2VC8 A;  3IAL A;  1C0A A;  3JCM W;  2IY5 A;  1Z7N A;  3HRI A;  3UH0 A;  2DDZ A;  2E65 A;  4CH6 A;  4XTX A;  1WQW A;  3NEN A;  1X2G A;  4P73 A;  1NNH A;  2ODR D;  1HTT A;  3W3S A;  1D3B A;  1WPY A;  3PCO A;  4TVW A;  4EMK C;  1E1T A;  4H2W A;  2YLB A;  5GMK i;  4XU3 A;  4YCV A;  3R07 A;  3FJP A;  3P8T A;  1B34 B;  1W66 A;  5DY9 A;  5LJ5 d;  1N9W A;  4P73 C;  1J5W A;  1LYL A;  2DVE A;  4M7D C;  3A31 A;  1H4S A;  1Y96 B;  4JRI A;  5GMK l;  4PJO C;  3BFM A;  1NJ5 A;  3HXV A;  1JJC A;  2PMF A;  2ZT6 A;  4XU2 A;  4XTY A;  2EJ9 A;  3LSS A;  4M77 G;  4XQ3 A;  1JBM A;  4XEM A;  1SES A;  2I4L A;  4HA8 A;  3V7C A;  1YFR A;  2RM4 A;  2CJB A;  1LJO A;  3M4P A;  4C92 A;  3SWN A;  4N0A C;  1B76 A;  1X56 A;  3QO3 A;  2ZGW A;  2CGH A;  1NJ6 A;  2I4M A;  3RKY A;  1KMM A;  4CH4 A;  4C8Q A;  3JCM b;  3TEH A;  3AHU A;  1JRI A;  3MF2 A;  4YRF A;  2DXT A;  3SWN C;  3BJU A;  4P74 A;  4XEO A;  3V8K A;  4YP0 A;  4PNO A;  4H2S A;  2Q7H A;  4RMF A;  4YRQ A;  4QVC A;  2I4N A;  4EMK B;  1QE0 A;  5LJ3 d;  3RES A;  4C8Q C;  4EMG A;  4TVA A;  5C52 B;  1ADY A;  3PGG A;  4X5O A;  3VQX A;  3A7U A;  3IKM B;  1HK9 A;  4P74 C;  1TH7 A;  5I21 A;  1ATI A;  4YDQ A;  4M7D B;  2DZC A;  2ART A;  3HFV A;  4M7D D;  3EFS A;  5GAM d;  1USY A;  2Q7G A;  4P3P A;  5K1X A;  1H4T A;  2AKW A;  4PJO B;  3HXY A;  4A53 A;  4PJO D;  4O2D A;  1ASY A; 
#chains in the Genus database with same CATH topology
 2XKO C;  2J05 A;  2MAM A;  1PYS A;  3H0H A;  4KUL A;  4CRI A;  1Q82 C;  2I4O A;  4EX5 A;  1ZX6 A;  4MMK A;  1PSE A;  2KYM A;  3VBB A;  1RAE B;  4CC4 B;  4EDU A;  1AVZ C;  4BE1 A;  3NEL A;  4J6X A;  4C0F A;  1VQL T;  5I11 A;  2NYS A;  3UT1 A;  5F5W A;  5ELO A;  4QQD A;  5DLO A;  1NYG A;  4RTT A;  3JCM P;  1K9M U;  1YFT A;  1D1A A;  2E10 A;  4F7U B;  1KHI A;  3IQL A;  4AT1 B;  1M1K C;  4Z02 A;  1N9S A;  2DTI A;  3CCE A;  3QDR B;  2ENM A;  4C8Q D;  4CC7 A;  5GAN 4;  2OTL T;  2KE9 A;  4B9W A;  4PJL A;  1PHT A;  4DOW A;  3OYG A;  2FYK A;  1PNJ A;  2CZ6 B;  1AT1 B;  2CP3 A;  3HKS A;  3X24 B;  2DIG A;  3JB9 F;  1QCN A;  8AT1 B;  2Q5I A;  3CD6 A;  2PVO B;  2KEA A;  1SRY A;  1MV3 A;  2H3E B;  4F7U E;  4FYW B;  2LCC A;  4EO4 A;  2D8H A;  2FO0 A;  4G85 A;  1ZLM A;  4DPG A;  2DKG A;  1VQ7 Q;  2GGR A;  3EFO B;  1VQO A;  2RI3 A;  1NG2 A;  3PVL A;  3CCJ T;  1MND A;  2AZV A;  2K6D A;  2EIF A;  1YI2 A;  2GFU A;  1K9M R;  2R5A A;  4YCU A;  2BZX A;  1W4S A;  3HTR A;  3VQY A;  4ZTU B;  1QP2 A;  2EQI A;  1KD1 R;  1WGS A;  3QYG B;  2CP0 A;  1QVF P;  2RA2 A;  1BBZ A;  4CH3 A;  2ZIM A;  4IUV A;  1QVP A;  1RAF B;  2DD4 A;  2A36 A;  3HRS A;  3HXU A;  1JXO A;  2DAQ A;  1UGV A;  1VQP Q;  4P72 A;  1B7Y A;  4YRJ A;  6AT1 B;  3LSQ A;  2CIM A;  3JCM d;  1X2H A;  5GAN 5;  1X6O A;  4C5G A;  1PC0 A;  2ALY A;  5L23 A;  1EIY A;  2J6K A;  2ZNJ A;  2E41 A;  4ATO A;  3CCR Q;  1OEB A;  1X43 A;  4MZT A;  5GAM h;  2RD1 A;  4UP7 A;  2M0O A;  4C92 C;  1U06 A;  4M75 C;  4RTZ A;  5GMK m;  2DIL A;  2CH4 W;  1B07 A;  1E6H A;  1I5O B;  1HD3 A;  5GAN 3;  2DXB A;  1EIF A;  1O9S A;  1PKS A;  2IY5 B;  3X28 B;  2CH4 A;  2ZPE B;  1UEB A;  1YCY A;  2FRW A;  3CPW S;  3E2U A;  1TUD A;  2RQV A;  4LD9 K;  5GAN d;  3T9N A;  2L3S A;  3QII A;  4EMH A;  3I56 T;  1M3C A;  3RIR A;  1IGQ A;  2KMT A;  1OYX A;  3O5Z A;  1ACM B;  4J6W A;  4ZGD B;  1KMN A;  2LJ1 A;  2HSP A;  2DU5 A;  5FRO A;  2BE7 D;  1H92 A;  2VWF A;  3G6E Q;  2Y90 A;  5LJ5 j;  1WLE A;  2KR3 A;  1B34 A;  2ED1 A;  3L2U A;  1OI1 A;  5ELN A;  2QDL A;  1BKB A;  3E9H A;  4CC2 A;  3M0Q A;  1PG5 B;  4J9B A;  3SWN B;  4DBQ A;  3JB9 J;  3JB9 G;  1KHC A;  4C8Q B;  1W2B P;  3LH0 A;  3MO8 A;  3OW2 S;  3TEH B;  1PD1 A;  2QTX A;  4FT2 A;  3QO5 A;  5GAM f;  1WHL A;  1X54 A;  2QHS A;  4JZ3 A;  2D9T A;  3A98 A;  3DLL A;  4KQE A;  1SHG A;  1YIJ A;  2X4Y A;  2M51 A;  3HP9 A;  5LL6 S;  5IT9 E;  1D09 B;  2AIR B;  3CMQ A;  5GMK j;  1Q82 U;  3RAC A;  5CO7 A;  2E6N A;  2EKO A;  3ICA A;  4C8Q E;  4CC3 A;  2LVM A;  4RUG A;  4F7U F;  5GAN 6;  1Q95 G;  1ZSZ A;  2DL8 A;  1VQ9 Q;  1Q81 R;  5LJ3 j;  4OGC A;  4C5I A;  2C0O A;  2RHZ A;  3L1A A;  4FW1 A;  2VKN A;  1EFN A;  5E3I A;  1VQ6 Q;  2K5F A;  2WSC E;  2EJF A;  5IXF A;  2X3X D;  1ASY A;  2Z0W A;  2W10 A;  1KC8 C;  4KH1 B;  3L2W A;  5GMK h;  3A8O B;  2JNG A;  4LVK A;  2JJ9 A;  2K5I A;  3L42 A;  5D7U A;  5CK9 A;  3LLR A;  5LJ3 h;  5CKH A;  1UJY A;  4LN2 A;  3H0I A;  2RHQ B;  5FWB A;  5C0M A;  2RNA A;  3ZL7 C;  3EGX A;  3EG9 B;  1K73 C;  2HSE B;  2O4X A;  4YPF A;  4AFZ C;  4HWO A;  1F1B B;  4OP0 A;  3I5S A;  3QXE B;  1BIB A;  2EJG A;  3REB B;  3LGL A;  4YRM A;  2KXC A;  1G3W A;  1LVK A;  2HD0 A;  2V26 A;  2VXF A;  1ZUK A;  2K4Y A;  4OLF A;  2QAZ A;  1YGB A;  5IN1 A;  5GAN 7;  1QF6 A;  4HCZ A;  1VQ4 A;  2GBQ A;  2M16 A;  5GAN 2;  2JVV A;  1AD5 A;  2ECZ A;  5ECA A;  1MGQ A;  3CXC P;  4HVW A;  1FMW A;  4P71 A;  2M0Y A;  1XTD A;  1XNI A;  2RH2 A;  3SEM A;  3A8G B;  2XID A;  4WCI A;  1HSQ A;  1JJ2 S;  3A7A A;  1JB0 E;  2RB6 A;  2YHT A;  2VGN A;  3JCM c;  1OPK A;  3OYB A;  4BUG A;  1SG5 A;  3UAT A;  2V1R A;  2BTT A;  3QYH B;  4HCK A;  1X2Q A;  4LUE A;  3V7R A;  1QP3 A;  5CKE A;  4L6V 5;  5LJ3 f;  1KK7 A;  2RMO A;  1G3T A;  2KGT A;  1QVG P;  4H2X B;  3VUB A;  1M1G A;  2NWM A;  3QKJ A;  2LNH B;  3QJY A;  1VQK Q;  2XU8 A;  1G5V A;  2AMC B;  2YUO A;  1M5Q 1;  3JB9 D;  3KUF A;  2M02 A;  4IKF A;  3MHX A;  2DEU A;  1NEG A;  3HFZ B;  1G5H A;  5CKF A;  3JCM X;  2KT1 A;  1WJS A;  4J9D A;  1NYF A;  2P0Q A;  3OBY A;  4F7U G;  3CCL A;  1WJR A;  4EIK A;  3CC4 Q;  2HMA A;  1VIE A;  1KFZ A;  1VUB A;  4F04 B;  4WTO B;  4JS5 A;  2PVD B;  1WXB A;  1X2K A;  1VQ7 T;  1M3B A;  3SB2 A;  4IIO A;  2HDA A;  1X55 A;  3ULR B;  2RF0 A;  3N5B B;  2MMP A;  1K9A A;  4ZN3 A;  3JAM E;  1JQQ A;  3IAL A;  1LCK A;  4PJN A;  1CKA A;  4XTX A;  3NEN A;  2J6F A;  2X4X A;  4P73 A;  2KNB B;  2DNU A;  2ODR D;  1D3B A;  3PCO A;  4RG8 A;  5GMK i;  1YHQ A;  1Q7Y C;  2LMJ A;  1VQP T;  4YCV A;  3P8T A;  5A0G A;  2JZ2 A;  4RMO A;  1N9W A;  1LPL A;  1UTI A;  1VIF A;  2CZ0 B;  2EQK A;  4JRI A;  2HQE A;  1W6X A;  3VS7 A;  1AOJ A;  2ZT6 A;  2L8D A;  3CCR T;  4J7I A;  4XU2 A;  1JO8 A;  3MEA A;  2EJ9 A;  4XQ3 A;  2CP5 A;  2FPE A;  1AWO A;  3MKD A;  1GL5 A;  4OMP A;  2EYZ A;  4FT4 A;  3V7C A;  1YFR A;  2RM4 A;  3NMZ C;  3RDV A;  1RL2 A;  3CBO A;  2DJQ A;  2LP5 A;  2PUO B;  4OVA A;  1B76 A;  1X56 A;  2ZGW A;  2CGH A;  3OYM A;  5FU6 B;  1QW1 A;  4HVV A;  4AG2 C;  1XJW B;  2RJD A;  1BI3 A;  1WHH A;  4PLL A;  3SWN C;  3NGP A;  1C6V X;  2GCX A;  4YP0 A;  1YFN A;  4QVC A;  1NM7 A;  2HEQ A;  2JXB A;  4A4K A;  4C8Q C;  1ADY A;  3PGG A;  1ABQ A;  3EG3 A;  3CCM Q;  4P5N A;  2E12 A;  2EQU A;  2VV5 A;  2WAC A;  2IVW A;  5FLX E;  3G6E T;  3CCQ A;  1ATI A;  4M7D B;  2DZC A;  4C0D B;  3HFV A;  3H6Z A;  5GAM d;  3NFC A;  4P3P A;  5K1X A;  2AKW A;  1KSW A;  3RMQ A;  2O31 A;  4LVM A;  2PVG B;  1YB3 A;  2ROT A;  5CQY A;  1OU8 A;  3HHT B;  1NJ1 A;  1USY C;  3QNE A;  3G1J A;  3J7A F;  4AMC A;  1YBY A;  3OS0 A;  1VQL A;  1QVF S;  3A1P A;  2CT4 A;  1OUL A;  4BI3 A;  2F69 A;  2LC4 A;  3H0F A;  2CJA A;  4BW9 A;  3HRU A;  1YWO A;  3GOX A;  2RK1 A;  2SEM A;  1NEB A;  4BY6 B;  4HT9 A;  2NS6 A;  5KYU B;  3TCJ A;  1CSK A;  1YN8 A;  2DPP B;  1X69 A;  5LJ5 g;  3CCV Q;  4C8Q G;  2OTL A;  1PCX A;  2EKH A;  3CCU Q;  1ASZ A;  4KBM B;  1VQ9 T;  4HCB A;  3HXZ A;  2C0T A;  3JRZ A;  1B70 A;  4YRT A;  2RHS A;  1VQ6 T;  1SPK A;  4YYE A;  1D0X A;  4YRP A;  4HWS A;  3UF4 A;  4RTW A;  4E7L A;  1WYD A;  4M78 F;  2P4R A;  1E24 A;  4LVL A;  2RJF A;  3CCJ A;  1B3Q A;  3EHQ A;  1I81 A;  3TSZ A;  3S3N A;  2JTE A;  4E7H A;  2DXU A;  4IIM A;  4AFQ C;  3E9F A;  1PRL C;  5GAO p;  2GQV A;  3A5Y A;  3P8Y A;  4TWA A;  4OB1 B;  5LJ3 g;  1VQN Q;  2V8K A;  1M27 C;  2MPX C;  1J3T A;  2XTI A;  4M77 B;  3MQZ A;  1RIQ A;  3CME Q;  2K5L A;  4DEY A;  3O8V A;  1RAG B;  1R8O B;  4M75 A;  4ZTF A;  1YWP A;  3DB4 A;  1OU9 A;  1CKB A;  3VS1 A;  2EYQ A;  3HXW A;  1JXM A;  1N6A A;  4PL6 A;  3VUZ A;  4ZIB A;  2EGE A;  1W2B S;  1EX4 A;  3CBM A;  1HXD A;  2JTF A;  3FEO A;  5LJ5 e;  2HBW A;  3UWN A;  4M77 E;  1PKT A;  4PKC C;  3BW1 A;  2HNI A;  1TUC A;  3EGD A;  3E9I A;  1G83 A;  1SET A;  2HL5 C;  1SHF A;  3OMG A;  1I8F A;  2EYX A;  2BKD N;  2FB7 A;  1FMV A;  2XGT A;  1GGM A;  2K3Y A;  3ERR A;  1RUW A;  3CCQ T;  3C0C A;  3I56 A;  4JRP A;  5IHK A;  3G71 Q;  3L4G A;  4Q6G A;  2KRN A;  4RQF A;  1SER A;  1WA7 A;  3OQ5 A;  3OW2 A;  4QVD A;  1N5Z A;  1QMC A;  1VQK T;  2XMF A;  1D0Y A;  4PHC A;  2K57 A;  5L8R E;  3M0R A;  4CS4 A;  3CCS Q;  1H64 1;  1RI0 A;  3PIP A;  3PMT A;  3KBG A;  3RNJ A;  4M7D F;  4ZGE B;  3CC4 T;  4Z89 A;  1Y96 A;  1S72 Q;  5C51 B;  2QK0 A;  2ZZG A;  4OMM A;  1EZZ B;  2DTH A;  2L3P A;  2EGC A;  1SSH A;  2XD0 A;  2CUB A;  1X75 C;  3EGU A;  4JLI A;  3NTH A;  1AWJ A;  1PRM C;  4HVU A;  5CCA A;  1G3S A;  3RER A;  2JS2 A;  1WHM A;  1X6G A;  4A4F A;  1YJ9 Q;  1YJN Q;  3QTC A;  1I4K 1;  1QCF A;  2YLC A;  4FSS A;  1T0H A;  4TVA B;  4DEX A;  2QQB A;  4HVC A;  1UGQ B;  3JCM g;  1QCO A;  1W1F A;  5KYX A;  2EQJ A;  1K8A U;  1WJQ A;  3BDU A;  2ATC B;  3OS1 A;  2DO3 A;  3CC2 Q;  1SRL A;  4E7K A;  2F2X A;  5FU6 C;  2ZIN A;  3OY9 A;  3VYG A;  3CXC S;  4J9H A;  8ATC B;  1TU0 B;  1ARK A;  12AS A;  2ZT7 A;  5GAM j;  1KQ1 A;  4X9C A;  1T3S A;  2NUT A;  1UG1 A;  4GLK A;  2K3B A;  1Y57 A;  2DRK A;  2PQW A;  5KYY B;  2QYZ A;  2QQA A;  3BY7 A;  3JCM Q;  1N8R C;  3M57 A;  4UPA A;  1E22 A;  4E47 A;  2LNV A;  5GAN g;  3H9N A;  5HK3 A;  4C0D C;  2ZCE A;  4K88 A;  4B6M A;  1QVG S;  4GBQ A;  3OS2 A;  2OTJ Q;  2D6F A;  3JSC A;  1NE8 A;  5I2M A;  1K8A R;  4N0A A;  4IUP A;  1M90 C;  1IXD A;  2DYB A;  1OZ2 A;  4YRC A;  5CKD A;  3OS5 A;  4FW2 A;  1NYQ A;  2KRO A;  1JJ2 A;  4F7U A;  1OPL A;  4CS2 A;  1UGR B;  3P8D A;  3PTA A;  1U8R A;  4PG3 A;  1WQ7 A;  2D1X A;  3CCM T;  4M77 F;  2ZZD A;  1WYX A;  3HTZ A;  2J6O A;  2DET A;  3E1S A;  1AZE A;  2ZT8 A;  1VOM A;  2WSF E;  1PD0 A;  4BDY A;  2DU7 A;  3BDL A;  1YP5 A;  2P0L A;  1MMG A;  4BY6 C;  1B8A A;  5IHN A;  1KQS A;  5KNN A;  4Y91 A;  4K11 A;  3JCM e;  3OYL A;  2XDP A;  2RQU A;  4DOV A;  1MUZ A;  2E3I A;  5KYW B;  1QLY A;  4M7D G;  3VQW A;  3EFO A;  2KSS A;  4BI8 B;  4ZTZ B;  2J3M A;  3CCS A;  3I55 Q;  5A0L A;  4YRI A;  2DZ9 A;  2JN0 A;  3REX A;  2O9S A;  1M1F A;  2ODR C;  2IPO B;  4XU0 A;  1TTH B;  1TOV A;  1IGU A;  3CCV T;  4FYX B;  2R5M A;  3CMA Q;  3CCU T;  2EVR A;  3CBP A;  1NBE B;  4YRK A;  2CYZ B;  5GAN e;  2F2V A;  5EC7 A;  2ZCF B;  3OBW A;  5J39 A;  2L0A A;  5HY6 A;  1R0C B;  1MMA A;  1IRX A;  3CC7 Q;  5GJV B;  4M78 D;  3QDF A;  4M7A D;  4V2S A;  1NJ2 A;  3IG2 A;  5J3B A;  1QWE A;  4NCX A;  4C5H A;  1VQ7 A;  4NL2 A;  4M77 C;  2A37 A;  1GCQ A;  1Y07 A;  4FSX A;  4ZNX A;  3CC2 A;  2LCS A;  2CSQ A;  4UP9 A;  3TU4 K;  1EOV A;  1DJ7 B;  1RLQ C;  3LW5 E;  3RKX A;  2VC8 A;  3CQT A;  4X34 A;  2FZC B;  3P8B B;  3JCM W;  2IY5 A;  2E65 A;  3HRT A;  4CH6 A;  2QDY B;  2O9V A;  1X2G A;  1BU1 A;  4KRT A;  1VQN T;  1WPY A;  1M1K U;  1MMD A;  2XK0 A;  4F16 A;  4TVW A;  4EMK C;  1YIT Q;  1VQP A;  1TWB A;  2YLB A;  4XU3 A;  1BCO A;  2EPD A;  1GBQ A;  2XHC A;  2DMO A;  3R07 A;  1TXQ A;  5DY9 A;  3CME T;  1O75 A;  5D6W A;  3WVE B;  4ZN1 A;  3G4S Q;  2FL7 A;  4C0Z A;  2DVE A;  4FYY B;  1H4S A;  2CDT A;  3CCR A;  5GMK l;  1YJW Q;  1Q82 R;  3BFM A;  3HXV A;  1K76 A;  2G6F X;  2DVJ A;  5I2S A;  3I5R A;  2HQX A;  4XTY A;  4E7Z A;  4N4I A;  4LNP A;  5FWC A;  4M77 G;  3REA B;  2VGM A;  3GF5 A;  1WHJ A;  3A5Z B;  1JBM A;  3L2Q A;  1NJI C;  1LJO A;  1UHF A;  3M4P A;  3SWN A;  4N0A C;  2O2O A;  3OYI A;  2VAS A;  1PSF A;  2I4M A;  4CH4 A;  1KMM A;  4C8Q A;  1M1K R;  3NTI A;  3JCM b;  4ELZ C;  3TEH A;  1VYV A;  2KAF A;  3OYC A;  1G3Y A;  2DXT A;  2F5K A;  1WLP B;  3G71 T;  3V8K A;  4AG1 C;  4RMF A;  5AYF A;  3UA7 A;  3RES A;  4EMG A;  4A4G A;  1N8R U;  2HCK A;  4LDX A;  3FLG A;  4N4H A;  3VQX A;  2RJE A;  4IUT A;  3G6E A;  7AT1 B;  4OB0 B;  1HK9 A;  4P74 C;  2ZPG B;  2CS7 A;  4D8D A;  3A8M B;  4L5G A;  4M7D D;  4FCY A;  2X4W A;  1USY A;  3CPF A;  1WZO A;  3HXY A;  4PJO B;  2QQ9 A;  2VVK A;  3CCS T;  1M90 U;  4O2D A;  3M4Y A;  2CSI A;  2QEX Q;  4HCC A;  1S72 T;  1H3H A;  1IB8 A;  3TVT A;  3UDC A;  3FC3 A;  3JB9 I;  4RTU A;  2NUP B;  4GY5 A;  1IHW A;  3ER0 A;  3NHN A;  2E1H A;  3ZFJ A;  4BD3 A;  2MF2 A;  1SF9 A;  1AWW A;  4OMN A;  2DER A;  1P92 A;  2CP7 A;  4HKE A;  2JUF A;  4M78 B;  3GNG A;  4M7A B;  1YJ9 T;  1YJN T;  2RHQ A;  2E64 A;  3J80 E;  4RTY A;  4QT7 A;  3MEU A;  4ME7 A;  3KFV A;  4PJJ A;  4II1 A;  2ZZF A;  1VQ9 A;  3UA6 A;  2D0Q B;  2JMA A;  2L5Q A;  2QGF B;  5GAO q;  2HQH A;  1QQJ A;  2YXY A;  4FYV B;  1VQ6 A;  3CC2 T;  2XG8 D;  4M78 E;  4M7A E;  4LXC A;  1D1C A;  1GCQ C;  4A4E A;  4QKU A;  5D6Y A;  1GRI A;  2EAY A;  3RUX A;  1BIA A;  3LX7 A;  3I9Q A;  4TVY A;  4JJD A;  3SFM A;  5GAO m;  4OML A;  1YIT A;  1C1A A;  4PJM A;  4IUU A;  1UGS B;  1XQH A;  3M4Q A;  2ED0 A;  3A7R A;  1MNE A;  5KE3 A;  5M9O A;  4XTW A;  3FB9 A;  2FEI A;  3P8H A;  4H2U A;  4YRN A;  5IXB A;  4L59 A;  4H2Y A;  4VUB A;  2Q7E A;  4MML A;  4K86 A;  1L0W A;  1ADJ A;  1H8K A;  3TEG A;  1I0C A;  4J83 A;  2X4J A;  3RKW A;  2OTJ T;  2RK2 A;  2E3C A;  2PTK A;  1VQ8 Q;  2DJZ A;  4PFZ A;  1H4Q A;  4AH6 A;  4RTX A;  2P4T A;  4HXJ A;  3OD1 A;  3X20 B;  1M2V B;  2KDS A;  2RHU A;  4LDV A;  4M77 D;  1OV3 A;  2J06 A;  2QQR A;  4Z8A A;  5GAM g;  2DRM A;  4H2X A;  1UDL A;  3VU3 C;  2RQT A;  3EG2 A;  2AMC A;  2AKL A;  3QBY A;  3QO7 A;  1UB4 A;  1KC8 U;  3OW2 P;  4R56 A;  2CP2 A;  1G2B A;  2OAW A;  4F14 A;  3HFZ A;  2ZNI A;  3V8L A;  1OOT A;  4JJB A;  3M56 A;  1VQ5 Q;  1NLO C;  3MJX A;  1RAD B;  3UFG A;  4R0K A;  1RAH B;  2KT8 A;  1Q86 C;  3NEM A;  2A8E A;  1IHV A;  4JJN K;  3LWI A;  1ZA1 B;  5C53 B;  2F5T X;  2BE9 B;  2RHI A;  2E5A A;  2QXF A;  4E6R A;  2F2W A;  4NL3 A;  3JCM J;  1WU7 A;  2DF6 A;  4FU6 A;  2LQK A;  1U1T A;  4RQE A;  1TUG B;  2DQ3 A;  3VRZ A;  1K73 U;  4HWR A;  4RTV A;  3M53 A;  1NPP A;  1K9M C;  4H2T A;  5A2Q E;  1VQK A;  3GIB A;  3A8H B;  3G7Z A;  1KD1 C;  2W0Z A;  1H3Z A;  3CMA T;  4XAX B;  2KRS A;  4JUV A;  3PE0 A;  2A08 A;  1EFW A;  1GXI E;  1KC8 R;  4HT8 A;  5FU7 B;  3QSU A;  1JJC B;  3KFU A;  11AS A;  2MIO A;  4M7D E;  4P75 C;  1VQM Q;  5K1P A;  4XTZ A;  3QHS A;  1GCP A;  2ZIO A;  3CC4 A;  3CC7 T;  2NUZ A;  4H02 A;  1MMN A;  1PWT A;  4C92 B;  4PJO F;  4M75 B;  2C8M A;  1I07 A;  2QG9 B;  2NLU A;  3IKL A;  2RQR A;  2J7I A;  4BI4 A;  2P84 A;  5GAM e;  2KRM A;  3OSS C;  2EQM A;  1K73 R;  4HWP A;  4P3N A;  2DTO A;  3JCM V;  1YCS B;  1KQ2 A;  4OB2 B;  1UJ0 A;  2MOX A;  1FWZ A;  4RDX A;  4PK4 A;  2DIQ A;  2G4C A;  4FM4 B;  3M5A A;  3V8J A;  3R6O A;  2OX7 A;  4M7A F;  4BE0 A;  2RQW A;  3A74 A;  1M2O A;  2DL4 A;  2K3X A;  1X6B A;  1YIT T;  2J3L A;  4HWT A;  2KXD A;  3CCE Q;  2L3R A;  1U1S A;  4J9G A;  2EYY A;  2CRE A;  4JRK A;  4X1V A;  4Z88 A;  4MZP A;  4OB3 B;  3G4S T;  1I5L A;  4J15 A;  5C6S A;  2L2P A;  1PYS B;  5CVI A;  3J81 E;  1YJW T;  3CD6 Q;  4C5E A;  3HSB A;  3U23 A;  1JJ2 P;  4M7D A;  3HFN A;  4LNS A;  3SD4 A;  2ZTG A;  2JS0 A;  2EWN A;  1VQO Q;  5J26 A;  4WJ3 M;  2JW4 A;  2K9G A;  2YSQ A;  1KQS P;  4BDZ A;  2BIV A;  4XTV A;  1YI2 Q;  3CPW A;  3VS3 A;  1X01 A;  1K4U S;  2DE0 X;  1UE9 A;  3M54 A;  1VQ5 A;  3QUI A;  2MYS A;  2DBK A;  4TVR A;  2Q5H A;  2CT3 A;  3RMS A;  2X9H A;  2FRY A;  1BI0 A;  3FRN A;  4OGE A;  1Q7Y U;  1R0B G;  1BB9 A;  2YUP A;  1IO6 A;  2EGA A;  3CCM A;  5KYU A;  2CZ7 B;  2OJ2 A;  3DLM A;  1ZSG A;  1BK2 A;  2KY9 A;  2QHV A;  2ZPB B;  4M78 C;  4M7A C;  4KGV B;  1Q81 C;  1AWX A;  4E7J A;  4J6Y A;  3G1Z A;  3LC0 A;  3OB9 A;  1RAC B;  5CR2 A;  1V76 A;  1VYU A;  2QEX T;  2A28 A;  3Q1J A;  1M3A A;  1UEC A;  3SDZ A;  3OYF A;  2HAX A;  2SRC A;  4QW2 A;  3CEY A;  4PFO A;  2OI3 A;  5GMK e;  2RPN A;  2GFA A;  1VQM A;  4DA4 A;  1D1B A;  4PJO G;  3MF1 A;  3S3O A;  2EL9 A;  3H41 A;  2VYT A;  1KOG A;  1Q7Y R;  2DLP A;  4RCB A;  5LJ3 e;  1E7O A;  2YRC A;  1B7Y B;  4NOY A;  4KGZ B;  3CCV A;  3QG1 A;  1FMK A;  3CCU A;  2ALY B;  2K2M A;  3E19 A;  1V1C A;  1Q86 U;  3VS4 A;  2YUN A;  1EIY B;  1EQR A;  4KR2 A;  1E1O A;  4J7F A;  4O5V A;  9ATC B;  3MEV A;  2QHU A;  2QQS A;  4M77 A;  4YRE A;  4M78 G;  4M7A G;  2RN8 A;  4JDS A;  2ZR2 A;  3X25 B;  4D6W A;  4WI1 A;  4R55 A;  1KD1 U;  3GPL A;  3RR6 A;  3RF1 A;  1FYN A;  4TQF A;  3HL8 A;  4RG2 A;  4A54 A;  1K0S A;  1BCM A;  2DL7 A;  4C92 F;  2ZR3 A;  4M75 F;  2FG0 A;  4J8O A;  2PME A;  1WNL A;  1BYM A;  2BZY A;  2LJ3 A;  3M0U A;  4MDX A;  4J9I A;  4E51 A;  4EMK A;  4KR3 A;  1TG0 A;  1YIJ Q;  1C0A A;  1Z7N A;  3HRI A;  3UH0 A;  2DDZ A;  1Q86 R;  2EBP A;  1WQW A;  1VQN A;  1VQ8 T;  2AK5 A;  5EG2 A;  2KI7 A;  2HZY A;  1E1T A;  4JJC A;  4H2W A;  3MP8 A;  3CME A;  3FJP A;  1B34 B;  2KK4 A;  3ME9 A;  1G8X A;  1GBR A;  1MV0 B;  3MP6 A;  4KH0 B;  4M7D C;  3A31 A;  1WI7 A;  1NJ5 A;  2WSE E;  1GFD A;  2F1L A;  2E70 A;  2DA9 A;  4QQ6 A;  3LSS A;  2DD5 A;  1PM3 A;  4J9E A;  1VQ5 T;  2JM9 A;  5IH2 A;  4XEM A;  4LUD A;  1SES A;  1IRE B;  5FU7 C;  3M9Q A;  2DL5 A;  2GQI A;  2R57 A;  3OYE A;  2V1Q A;  2PZ1 A;  1V29 B;  4CI0 C;  1NJ6 A;  2LCL A;  2E6Z A;  3BE3 A;  1TS9 A;  2JOY A;  2LRQ A;  1Y7X A;  2K7A A;  2ZPF B;  3VYH B;  3OYK A;  3G71 A;  1ZSZ B;  2VUB A;  2RJC A;  3DB3 A;  4P74 A;  4XEO A;  4H2S A;  3NPF A;  4YRQ A;  2I4N A;  3M0T A;  1QE0 A;  2RI5 A;  4TVA A;  1GFC A;  2JT4 A;  5D6X A;  5C52 B;  1WXT A;  2LQW A;  4X5O A;  2PNI A;  1NZ9 A;  2A3L A;  3A7U A;  5HKC A;  4EPC A;  2ART A;  3EFS A;  1M8M A;  1VQM T;  2Q7G A;  4LVI A;  1QWF A;  3EH1 A;  4PJO D;  3VRY A;  2CUD A;  2MI6 A;  4ESR A;  3OYA A;  1S72 A;  1OX9 A;  3JV3 A;  1VQ4 Q;  3TEE A;  4LDY A;  1UFF A;  4YRO A;  1YFS A;  4CH5 A;  4RCC A;  4H2V A;  2MWO A;  3MET A;  4YRL A;  5HGQ A;  1BBU A;  1HC7 A;  3EGX B;  1KJW A;  2XIC A;  4Y28 E;  2O4X B;  1Q81 U;  4D8K A;  1YJ9 A;  3MEY A;  1YJN A;  5KYY A;  4F17 A;  2X3W D;  4C92 G;  1NYR A;  4M75 G;  5I22 A;  1FXX A;  2B8A A;  2B86 A;  4KT0 E;  2M1H A;  5FW9 A;  4BAC A;  3C95 A;  4ZTJ A;  1D0Z A;  3MEW A;  3VS0 A;  4ZGJ B;  3REU A;  3VS2 A;  4AFS C;  2IG0 A;  2H8H A;  3UPU A;  2DX1 A;  4TTV A;  2D0N A;  3URG A;  3CCE T;  2AKK A;  3EH2 A;  2VB6 A;  5LJ5 h;  3GNF B;  2AHJ B;  2LX9 A;  4X9D A;  3CD6 T;  3OMC A;  3QJ6 A;  3CCL Q;  1EVK A;  3RBB B;  2ARS A;  3C94 A;  4KGX B;  3TQ7 P;  2Y4Y A;  2MCN A;  1FYF A;  2QA4 Q;  3AT1 B;  2VXE A;  3EG0 A;  1WX6 A;  2MWP A;  2RHX A;  3M58 A;  4OF1 A;  2R58 A;  1VQO T;  1ZQ1 A;  3V7S A;  2YRV A;  1YI2 T;  5KYW A;  2OTJ A;  2FHD A;  2G3R A;  4BB7 A;  4JPB W;  2JM8 A;  2OAU A;  4KUD K;  1BBW A;  2IIM A;  3EHR A;  3QZ9 B;  2K2V A;  1IL2 A;  2DBM A;  4N4G A;  2LZ6 B;  4KUI A;  4E2F B;  2QTV A;  3GBQ A;  1U3O A;  1M8V A;  4HT4 A;  4CS3 A;  2FZG B;  2DM1 A;  1YHQ Q;  2GNC A;  2AZS A;  3EFR A;  4MDW A;  4P3O A;  4DBR A;  1M30 A;  3A32 A;  4P72 C;  1MHN A;  4B9X A;  4MZM A;  4NS5 A;  3NET A;  4Q5W A;  2QAS A;  3A8L B;  5LJ5 f;  1B7T A;  3OA6 A;  1QVF A;  3QO8 A;  1SSF A;  4J9C A;  2DQ0 A;  3C12 A;  5FRN A;  3OSV A;  1X27 A;  1JEG A;  2ZZE A;  3I55 A;  2E4H A;  2DXC A;  2FPF A;  3LGF A;  1D3B B;  3VKI A;  3PCO B;  2PUK B;  1LNX A;  2A7Y A;  2LQN A;  1RI9 A;  2LJ0 A;  5CAI A;  2P0K A;  1IZ6 A;  4P75 A;  3CMA A;  3M59 A;  2KYB A;  2GTO A;  4OMQ A;  2EYW A;  2DK3 A;  1WIE A;  1HJD A;  1H4V B;  5DLQ E;  1AZG B;  1E6G A;  2LT1 A;  3MCA B;  3VQV A;  1ABO A;  2LTO A;  1S1N A;  3L2R A;  2YDL A;  3PT9 A;  1RAB B;  3PVQ A;  3CC7 A;  3CCQ Q;  4PJO E;  5DM7 R;  5KE2 A;  3E9G A;  3QWY A;  2COW A;  4Q15 A;  5GAN 8;  1N8R R;  2AT1 B;  3PNW C;  2I2L A;  3UGQ A;  1QKW A;  4G84 A;  2LX7 A;  1KQS S;  4C92 D;  2HBP A;  3INZ A;  4M75 D;  1SKU B;  1T0J A;  2P0P A;  4ELY C;  3P8V A;  4QQG A;  4IUR A;  4DBH A;  3FJ5 A;  3EG9 A;  1YNZ A;  2KVQ G;  4IUQ A;  2JTM A;  1VQL Q;  2ESW A;  5KH6 A;  3A5Z A;  2ABL A;  3M55 A;  1M90 R;  3TRE A;  2GF7 A;  3HFO A;  3TSW A;  4JRQ A;  3M4G A;  3HRK A;  4QVZ A;  1VQZ A;  2LT4 A;  3PFS A;  5HCK A;  1YIJ T;  1JU5 C;  3QZ5 B;  3ZBD A;  3X26 B;  3RL6 A;  1WDX A;  4DBF A;  2QA4 A;  1G5I A;  2QI2 A;  3RGL A;  3PZC A;  2C7I A;  2LDM A;  3CPW P;  3SHW A;  2OTL Q;  5IAY A;  3G4S A;  2AKW B;  3ZEH A;  2BUD A;  4Y92 A;  4OMF B;  4C8Q F;  3KXT A;  3FIF A;  3JCM h;  4A63 B;  1YJW A;  3NTK A;  5CKB A;  4BE2 A;  3HY1 A;  2D8J A;  2QGG A;  5KCO A;  1ZHI A;  1W2B A;  2E3H A;  1ZSZ C;  1Z9Z A;  4BWA A;  2ARU A;  4J9F A;  4M4Z A;  1Y71 A;  2C0I A;  1ZBJ A;  2M9U A;  3M0P A;  5GAN j;  4FIB A;  4YRS A;  1HYO A;  2O01 E;  3OYD A;  4PJO A;  4L87 A;  3L2V A;  4JZ4 A;  3DSQ A;  2KBT A;  3MPU B;  2EW3 A;  3CCJ Q;  2C06 A;  2XDD A;  2CJ9 A;  2E5Q A;  1K0X A;  4DQ2 A;  3JB9 H;  4JLG A;  2ZPI B;  4LVJ A;  2V8I A;  3HY0 A;  4YCW A;  3M0S A;  2ZT5 A;  4YRR A;  2NUP A;  2FPD A;  1WHK A;  2HKN A;  2DEQ A;  4GLM A;  4XTU A;  4UP8 A;  3D7S B;  5GAN h;  1EVL A;  4ANJ A;  1B70 B;  4M78 A;  4M7A A;  2V8J A;  4YRG A;  4XU1 A;  3UGT A;  2RHS B;  5GJW B;  4TQD A;  1OZ3 A;  4LDW A;  3VV0 A;  4OMO A;  5IHI A;  3FDR A;  3MP1 A;  4J5Y A;  1N27 A;  1M4Z A;  2RHY A;  2RI2 A;  5GAO r;  4WF2 A;  4K87 A;  3I55 T;  1BI1 A;  2CKK A;  2RO0 A;  1ZUY A;  4E7S A;  2QEX A;  3S6W A;  3QWX X;  5AT1 B;  1VQ4 T;  3I7F A;  1NJI U;  2K79 A;  3JCM f;  3S3M A;  1M9S A;  4RKU E;  5CIU A;  3HXX A;  2ZXF A;  1Z7M A;  2CZ1 B;  1RAI B;  1SRM A;  1ZBX A;  4P71 C;  2COZ A;  3I35 A;  2GTJ A;  2KQW A;  3L2Z A;  3I56 Q;  1T3L A;  1FX7 A;  1KIK A;  5GAO n;  3H8Z A;  2XI9 A;  1NJ8 A;  2COY A;  1K8A C;  3WQZ A;  3CXC A;  3HPW A;  2E5K A;  2H3J A;  1M2V A;  1I1J A;  5GAO l;  1UHC A;  5GAN f;  5KYN A;  4E7I A;  3R6N A;  2QHT A;  1LOJ A;  1NJI R;  1G51 A;  3TUP A;  3EGD B;  1NPR A;  2DFU A;  3OYN A;  3GP8 A;  1RAA B;  1N9R A;  4C92 E;  1TSF A;  2X51 A;  4M75 E;  3CCL T;  2YWW A;  2YT6 A;  4WJ4 A;  1KG1 A;  2QA4 T;  2Y4X A;  4LD6 A;  2FVU A;  2A0F B;  2MK5 A;  1U5S A;  3C4S A;  4AFU C;  1QVG A;  3OYY A;  1QKX A;  1A0N B;  4O6J A;  3L4G B;  4LDU A;  3OYH A;  2P5I A;  2L89 A;  4UC4 A;  1VQ8 A;  3THK A;  2DL3 A;  1K1Z A;  1OQK A;  1VYT A;  2XDB A;  1NNH A;  1HTT A;  3W3S A;  4FL6 A;  2DYI A;  2FZK B;  1W70 A;  1WFW A;  3EAE A;  1WHG A;  3EG1 A;  1ZUU A;  3WXM B;  1AEY A;  5HK0 A;  4ORZ A;  2HKQ B;  1W66 A;  5CQX A;  1BI2 A;  2L3Q A;  1YHQ T;  5FRM A;  5LJ5 d;  4P73 C;  1J5W A;  1LYL A;  1Y0M A;  2HL3 A;  1Y96 B;  3ASK A;  4PJO C;  4JS4 A;  1JJC A;  2CP6 A;  2YRD A;  2ZPH B;  2PMF A;  3VJP A;  2I0N A;  2LQ8 A;  3VS5 A;  1RLP C;  1NLP C;  2I4L A;  1WXU A;  2PU9 B;  3GLX A;  4HA8 A;  2CJB A;  4C92 A;  1UUE A;  3PMI A;  1OX8 A;  1SEM A;  5A0D A;  3LWH A;  3QO3 A;  4LE9 A;  3RKY A;  2ROL A;  4A4H A;  2BZ8 A;  1XOV A;  1ZA2 B;  1JRI A;  3AHU A;  3MF2 A;  5KYX B;  3QPH A;  2JMC A;  3DKM A;  4PFP A;  2EFI A;  1Z9Q A;  4YRF A;  3F70 A;  2O88 A;  3BJU A;  3WVD B;  4C0G A;  3VS6 A;  4PNO A;  2Q7H A;  4PLI A;  4EMK B;  5LJ3 d;  2ZAE A;  3OYJ A;  1UGP B;  1AHJ B;  2YUQ A;  5KCH A;  3IKM B;  4XK8 E;  2X35 A;  1TH7 A;  3LYI A;  5I21 A;  4YDQ A;  2NUT B;  1C0M A;  4YTL A;  1H4T A;  1VA7 A;  1R77 A;  3LH5 A;  4A53 A;  3PIO A; 
#chains in the Genus database with same CATH homology
 2XKO C;  2MAM A;  1PYS A;  1Q82 C;  4KUL A;  4CRI A;  2I4O A;  4EX5 A;  4MMK A;  1PSE A;  3VBB A;  4EDU A;  4BE1 A;  3NEL A;  4J6X A;  4C0F A;  1VQL T;  3UT1 A;  5F5W A;  5ELO A;  4QQD A;  5DLO A;  3JCM P;  1K9M U;  1YFT A;  2E10 A;  4F7U B;  1KHI A;  1M1K C;  4Z02 A;  1N9S A;  2DTI A;  3CCE A;  3QDR B;  4C8Q D;  5GAN 4;  2OTL T;  4B9W A;  3OYG A;  4DOW A;  2FYK A;  2CZ6 B;  3HKS A;  3X24 B;  2DIG A;  3JB9 F;  2Q5I A;  3CD6 A;  2PVO B;  1SRY A;  4F7U E;  2LCC A;  4EO4 A;  4G85 A;  4DPG A;  2DKG A;  1VQO A;  2RI3 A;  3CCJ T;  2EIF A;  1YI2 A;  2GFU A;  4YCU A;  2R5A A;  1W4S A;  3VQY A;  4ZTU B;  1QP2 A;  1WGS A;  3QYG B;  2RA2 A;  4CH3 A;  2ZIM A;  4IUV A;  1QVP A;  2DD4 A;  3HRS A;  3HXU A;  2DAQ A;  4P72 A;  1B7Y A;  4YRJ A;  3LSQ A;  2CIM A;  3JCM d;  1X2H A;  5GAN 5;  1X6O A;  4C5G A;  2ALY A;  1EIY A;  2ZNJ A;  2E41 A;  4ATO A;  4MZT A;  5GAM h;  2RD1 A;  4UP7 A;  2M0O A;  4C92 C;  4M75 C;  5GMK m;  5GAN 3;  2DXB A;  1EIF A;  1O9S A;  2IY5 B;  3X28 B;  2ZPE B;  1UEB A;  1YCY A;  3CPW S;  4LD9 K;  5GAN d;  3T9N A;  3QII A;  4EMH A;  3I56 T;  3RIR A;  2KMT A;  1OYX A;  4J6W A;  4ZGD B;  1KMN A;  2DU5 A;  5FRO A;  2Y90 A;  5LJ5 j;  1WLE A;  1B34 A;  3L2U A;  1OI1 A;  5ELN A;  3E9H A;  1BKB A;  3SWN B;  3JB9 J;  3JB9 G;  1KHC A;  4C8Q B;  3LH0 A;  3MO8 A;  3OW2 S;  3TEH B;  2QTX A;  4FT2 A;  3QO5 A;  5GAM f;  2QHS A;  1X54 A;  2D9T A;  4KQE A;  3DLL A;  1YIJ A;  2X4Y A;  3HP9 A;  5LL6 S;  5IT9 E;  3CMQ A;  5GMK j;  1Q82 U;  3RAC A;  5CO7 A;  2E6N A;  2EKO A;  3ICA A;  4C8Q E;  2LVM A;  5GAN 6;  4F7U F;  5LJ3 j;  4OGC A;  4C5I A;  2RHZ A;  3L1A A;  5E3I A;  2K5F A;  2WSC E;  2EJF A;  1ASY A;  1KC8 C;  3L2W A;  5GMK h;  3A8O B;  2JNG A;  4LVK A;  2K5I A;  3L42 A;  5CK9 A;  3LLR A;  5LJ3 h;  5CKH A;  2RHQ B;  5C0M A;  1K73 C;  2O4X A;  4YPF A;  4HWO A;  4OP0 A;  3QXE B;  1BIB A;  2EJG A;  3LGL A;  4YRM A;  1G3W A;  2HD0 A;  2VXF A;  2K4Y A;  4OLF A;  1YGB A;  5IN1 A;  5GAN 7;  1QF6 A;  4HCZ A;  1VQ4 A;  2M16 A;  5GAN 2;  2JVV A;  1MGQ A;  4P71 A;  1XTD A;  1XNI A;  2RH2 A;  3A8G B;  2XID A;  1JJ2 S;  3A7A A;  1JB0 E;  2RB6 A;  2YHT A;  2VGN A;  3JCM c;  3OYB A;  4BUG A;  3QYH B;  3V7R A;  1QP3 A;  5CKE A;  4L6V 5;  5LJ3 f;  1G3T A;  4H2X B;  3VUB A;  1M1G A;  3QKJ A;  3QJY A;  2AMC B;  2XU8 A;  1G5V A;  1M5Q 1;  3JB9 D;  3KUF A;  4IKF A;  3MHX A;  3HFZ B;  1G5H A;  5CKF A;  3JCM X;  1WJS A;  2P0Q A;  3OBY A;  4F7U G;  3CCL A;  1WJR A;  1VIE A;  1VUB A;  4JS5 A;  2PVD B;  1VQ7 T;  3SB2 A;  1X55 A;  3N5B B;  2MMP A;  4ZN3 A;  3JAM E;  3IAL A;  4XTX A;  3NEN A;  2X4X A;  4P73 A;  2ODR D;  1D3B A;  3PCO A;  4RG8 A;  5GMK i;  1YHQ A;  1Q7Y C;  1VQP T;  4YCV A;  3P8T A;  5A0G A;  2JZ2 A;  4RMO A;  1N9W A;  1VIF A;  2CZ0 B;  2EQK A;  4JRI A;  2HQE A;  2ZT6 A;  2L8D A;  3CCR T;  4J7I A;  4XU2 A;  3MEA A;  2EJ9 A;  4XQ3 A;  4FT4 A;  3V7C A;  1YFR A;  2RM4 A;  1RL2 A;  3CBO A;  2PUO B;  1B76 A;  4OVA A;  1X56 A;  2ZGW A;  2CGH A;  3OYM A;  5FU6 B;  1QW1 A;  2RJD A;  1BI3 A;  4PLL A;  3SWN C;  2GCX A;  4YP0 A;  4QVC A;  4A4K A;  4C8Q C;  1ADY A;  3PGG A;  4P5N A;  2E12 A;  2EQU A;  2VV5 A;  2WAC A;  2IVW A;  5FLX E;  3G6E T;  1ATI A;  3CCQ A;  4M7D B;  2DZC A;  4C0D B;  3HFV A;  3H6Z A;  5GAM d;  3NFC A;  4P3P A;  5K1X A;  2AKW A;  3RMQ A;  4LVM A;  2PVG B;  1YB3 A;  5CQY A;  3HHT B;  1NJ1 A;  1USY C;  3QNE A;  3J7A F;  1YBY A;  3OS0 A;  1VQL A;  1QVF S;  4BI3 A;  2F69 A;  2LC4 A;  2CJA A;  4BW9 A;  3HRU A;  3GOX A;  2RK1 A;  4BY6 B;  4HT9 A;  2NS6 A;  3TCJ A;  2DPP B;  5LJ5 g;  4C8Q G;  2OTL A;  1ASZ A;  4KBM B;  1VQ9 T;  4HCB A;  3HXZ A;  3JRZ A;  1B70 A;  4YRT A;  2RHS A;  1VQ6 T;  4YYE A;  4YRP A;  4HWS A;  4E7L A;  1WYD A;  4M78 F;  1E24 A;  4LVL A;  2RJF A;  3CCJ A;  1I81 A;  3S3N A;  4E7H A;  2DXU A;  3E9F A;  5GAO p;  2GQV A;  3A5Y A;  3P8Y A;  4TWA A;  4OB1 B;  5LJ3 g;  2V8K A;  2XTI A;  4M77 B;  3MQZ A;  1RIQ A;  2K5L A;  3O8V A;  1R8O B;  4M75 A;  4ZTF A;  3DB4 A;  2EYQ A;  3HXW A;  1N6A A;  4PL6 A;  3VUZ A;  4ZIB A;  1W2B S;  3CBM A;  1HXD A;  2JTF A;  3FEO A;  5LJ5 e;  3UWN A;  4M77 E;  4PKC C;  3BW1 A;  2HNI A;  3E9I A;  1SET A;  3OMG A;  1I8F A;  2BKD N;  2FB7 A;  2XGT A;  1GGM A;  2K3Y A;  3ERR A;  3CCQ T;  3I56 A;  4JRP A;  3L4G A;  4Q6G A;  4RQF A;  1SER A;  3OQ5 A;  3OW2 A;  4QVD A;  1VQK T;  4PHC A;  2K57 A;  5L8R E;  4CS4 A;  1H64 1;  1RI0 A;  3PIP A;  3PMT A;  3KBG A;  4M7D F;  4ZGE B;  3CC4 T;  1Y96 A;  5C51 B;  2ZZG A;  2DTH A;  2XD0 A;  1X75 C;  4JLI A;  3NTH A;  5CCA A;  1G3S A;  3RER A;  4A4F A;  3QTC A;  1I4K 1;  2YLC A;  4TVA B;  2QQB A;  4HVC A;  1UGQ B;  3JCM g;  2EQJ A;  1K8A U;  1WJQ A;  3BDU A;  3OS1 A;  2DO3 A;  4E7K A;  5FU6 C;  2ZIN A;  3OY9 A;  3VYG A;  3CXC S;  12AS A;  2ZT7 A;  5GAM j;  1KQ1 A;  4X9C A;  4GLK A;  2PQW A;  2QQA A;  3BY7 A;  3JCM Q;  1N8R C;  3M57 A;  4UPA A;  1E22 A;  4E47 A;  2LNV A;  5GAN g;  2ZCE A;  5HK3 A;  4C0D C;  4K88 A;  1QVG S;  3OS2 A;  2D6F A;  3JSC A;  1NE8 A;  5I2M A;  4N0A A;  4IUP A;  1M90 C;  1OZ2 A;  4YRC A;  5CKD A;  3OS5 A;  1NYQ A;  1JJ2 A;  4F7U A;  4CS2 A;  1UGR B;  3P8D A;  3PTA A;  1U8R A;  4PG3 A;  1WQ7 A;  3CCM T;  4M77 F;  2ZZD A;  3HTZ A;  3E1S A;  2ZT8 A;  2WSF E;  4BDY A;  2DU7 A;  3BDL A;  2P0L A;  4BY6 C;  1B8A A;  1KQS A;  5KNN A;  4Y91 A;  3JCM e;  3OYL A;  2XDP A;  4DOV A;  4M7D G;  3VQW A;  2KSS A;  4BI8 B;  4ZTZ B;  2J3M A;  3CCS A;  5A0L A;  4YRI A;  2DZ9 A;  2JN0 A;  3REX A;  1M1F A;  2ODR C;  4XU0 A;  3CCV T;  2R5M A;  3CCU T;  3CBP A;  4YRK A;  2CYZ B;  5GAN e;  2ZCF B;  3OBW A;  5J39 A;  5HY6 A;  4M78 D;  4M7A D;  4V2S A;  1NJ2 A;  3IG2 A;  5J3B A;  4NCX A;  4C5H A;  1VQ7 A;  4NL2 A;  4M77 C;  1Y07 A;  4FSX A;  3CC2 A;  4UP9 A;  3TU4 K;  1EOV A;  1DJ7 B;  3LW5 E;  3RKX A;  2VC8 A;  4X34 A;  3P8B B;  3JCM W;  2IY5 A;  2E65 A;  3HRT A;  4CH6 A;  2QDY B;  1X2G A;  1VQN T;  1WPY A;  1M1K U;  2XK0 A;  4TVW A;  4EMK C;  1VQP A;  2YLB A;  4XU3 A;  2XHC A;  3R07 A;  5DY9 A;  3CME T;  1O75 A;  5D6W A;  3WVE B;  4ZN1 A;  2FL7 A;  4C0Z A;  2DVE A;  1H4S A;  3CCR A;  5GMK l;  3BFM A;  3HXV A;  5I2S A;  2HQX A;  4XTY A;  4N4I A;  4M77 G;  2VGM A;  3GF5 A;  3A5Z B;  1JBM A;  3L2Q A;  1NJI C;  1LJO A;  3M4P A;  3SWN A;  4N0A C;  3OYI A;  1PSF A;  2I4M A;  4CH4 A;  1KMM A;  4C8Q A;  3NTI A;  3JCM b;  4ELZ C;  3TEH A;  2KAF A;  3OYC A;  1G3Y A;  2DXT A;  2F5K A;  3G71 T;  3V8K A;  4RMF A;  5AYF A;  3RES A;  4EMG A;  4A4G A;  1N8R U;  4LDX A;  3FLG A;  4N4H A;  3VQX A;  2RJE A;  4IUT A;  3G6E A;  4OB0 B;  1HK9 A;  4P74 C;  2ZPG B;  2CS7 A;  3A8M B;  4L5G A;  4M7D D;  2X4W A;  1USY A;  3CPF A;  3HXY A;  4PJO B;  2QQ9 A;  3CCS T;  1M90 U;  4O2D A;  3M4Y A;  4HCC A;  1S72 T;  3UDC A;  3FC3 A;  3JB9 I;  4GY5 A;  3ER0 A;  2E1H A;  3ZFJ A;  4BD3 A;  2MF2 A;  1P92 A;  4HKE A;  2JUF A;  4M78 B;  3GNG A;  4M7A B;  1YJ9 T;  1YJN T;  2RHQ A;  2E64 A;  3J80 E;  3MEU A;  4ME7 A;  4II1 A;  2ZZF A;  1VQ9 A;  2D0Q B;  2L5Q A;  5GAO q;  1VQ6 A;  3CC2 T;  2XG8 D;  4M78 E;  4M7A E;  4A4E A;  5D6Y A;  2EAY A;  3RUX A;  1BIA A;  3LX7 A;  4TVY A;  3SFM A;  5GAO m;  1YIT A;  4IUU A;  1UGS B;  1XQH A;  3M4Q A;  3A7R A;  5KE3 A;  5M9O A;  4XTW A;  3FB9 A;  3P8H A;  4H2U A;  4YRN A;  4L59 A;  4H2Y A;  4VUB A;  2Q7E A;  4MML A;  4K86 A;  1L0W A;  1ADJ A;  3TEG A;  4J83 A;  2X4J A;  3RKW A;  2OTJ T;  2RK2 A;  2E3C A;  2DJZ A;  1H4Q A;  4AH6 A;  2P4T A;  3OD1 A;  3X20 B;  2KDS A;  2RHU A;  4LDV A;  4M77 D;  2QQR A;  5GAM g;  4H2X A;  3VU3 C;  2AMC A;  3QBY A;  3QO7 A;  1UB4 A;  1KC8 U;  4R56 A;  3HFZ A;  2ZNI A;  3V8L A;  3M56 A;  3UFG A;  1Q86 C;  3NEM A;  2A8E A;  4JJN K;  3LWI A;  5C53 B;  2F5T X;  2RHI A;  2E5A A;  2QXF A;  4NL3 A;  3JCM J;  1WU7 A;  4FU6 A;  2LQK A;  1U1T A;  4RQE A;  2DQ3 A;  4HWR A;  1K73 U;  3M53 A;  1NPP A;  1K9M C;  4H2T A;  5A2Q E;  1VQK A;  3GIB A;  3A8H B;  3G7Z A;  1KD1 C;  1H3Z A;  3CMA T;  4XAX B;  4JUV A;  1EFW A;  1GXI E;  3QSU A;  4HT8 A;  5FU7 B;  1JJC B;  3KFU A;  11AS A;  4M7D E;  4P75 C;  5K1P A;  4XTZ A;  3QHS A;  2ZIO A;  3CC4 A;  3CC7 T;  4H02 A;  4C92 B;  4PJO F;  4M75 B;  2C8M A;  2NLU A;  3IKL A;  4BI4 A;  5GAM e;  3OSS C;  2EQM A;  4HWP A;  4P3N A;  2DTO A;  3JCM V;  1KQ2 A;  4OB2 B;  1FWZ A;  4RDX A;  2DIQ A;  2G4C A;  4FM4 B;  3M5A A;  3V8J A;  3R6O A;  4M7A F;  4BE0 A;  3A74 A;  2J3L A;  2K3X A;  1YIT T;  4HWT A;  2L3R A;  1U1S A;  4JRK A;  4MZP A;  4OB3 B;  3G4S T;  1I5L A;  4J15 A;  5C6S A;  1PYS B;  5CVI A;  3J81 E;  1YJW T;  4C5E A;  3HSB A;  4M7D A;  3HFN A;  4LNS A;  3SD4 A;  2ZTG A;  2EWN A;  5J26 A;  4WJ3 M;  4BDZ A;  2BIV A;  4XTV A;  3CPW A;  1X01 A;  3M54 A;  1VQ5 A;  3QUI A;  4TVR A;  2Q5H A;  3RMS A;  3FRN A;  1BI0 A;  4OGE A;  1Q7Y U;  3CCM A;  2CZ7 B;  3DLM A;  2KY9 A;  2QHV A;  2ZPB B;  4M78 C;  4M7A C;  1Q81 C;  4E7J A;  4J6Y A;  3G1Z A;  3LC0 A;  3OB9 A;  5CR2 A;  2QEX T;  3Q1J A;  3SDZ A;  3OYF A;  2HAX A;  4QW2 A;  3CEY A;  5GMK e;  2GFA A;  1VQM A;  4DA4 A;  4PJO G;  3MF1 A;  3S3O A;  2EL9 A;  2VYT A;  1KOG A;  4RCB A;  5LJ3 e;  1B7Y B;  4NOY A;  3CCV A;  3QG1 A;  3CCU A;  2ALY B;  3E19 A;  1Q86 U;  1EIY B;  1EQR A;  4KR2 A;  1E1O A;  4J7F A;  4O5V A;  3MEV A;  2QHU A;  2QQS A;  4M77 A;  4YRE A;  4M78 G;  4M7A G;  4JDS A;  2ZR2 A;  3X25 B;  4D6W A;  4WI1 A;  4R55 A;  1KD1 U;  3GPL A;  3RF1 A;  4TQF A;  3HL8 A;  4RG2 A;  4A54 A;  2ZR3 A;  4C92 F;  4M75 F;  4J8O A;  2PME A;  1WNL A;  1BYM A;  4MDX A;  4E51 A;  4EMK A;  4KR3 A;  1C0A A;  1Z7N A;  3HRI A;  3UH0 A;  2DDZ A;  1WQW A;  1VQN A;  1VQ8 T;  5EG2 A;  1E1T A;  4H2W A;  3MP8 A;  3CME A;  3FJP A;  1B34 B;  2KK4 A;  3ME9 A;  3MP6 A;  4M7D C;  3A31 A;  1NJ5 A;  2WSE E;  2E70 A;  4QQ6 A;  3LSS A;  2DD5 A;  1VQ5 T;  4XEM A;  1SES A;  1IRE B;  5FU7 C;  3M9Q A;  2R57 A;  3OYE A;  1V29 B;  4CI0 C;  1NJ6 A;  2LCL A;  2E6Z A;  2JOY A;  2LRQ A;  3OYK A;  1Y7X A;  2ZPF B;  3VYH B;  3G71 A;  2VUB A;  2RJC A;  3DB3 A;  4P74 A;  4XEO A;  4H2S A;  4YRQ A;  2I4N A;  1QE0 A;  2RI5 A;  4TVA A;  5D6X A;  5C52 B;  4X5O A;  1NZ9 A;  2A3L A;  3A7U A;  5HKC A;  4EPC A;  2ART A;  3EFS A;  2Q7G A;  1VQM T;  4LVI A;  4PJO D;  2MI6 A;  1S72 A;  3OYA A;  3TEE A;  4LDY A;  4YRO A;  1YFS A;  4CH5 A;  4RCC A;  4H2V A;  2MWO A;  3MET A;  4YRL A;  5HGQ A;  1BBU A;  1HC7 A;  2XIC A;  4Y28 E;  2O4X B;  1Q81 U;  1YJ9 A;  3MEY A;  1YJN A;  4C92 G;  1NYR A;  4M75 G;  1FXX A;  2B8A A;  4BAC A;  4KT0 E;  2M1H A;  3C95 A;  4ZTJ A;  3MEW A;  4ZGJ B;  3REU A;  2IG0 A;  3UPU A;  4TTV A;  3URG A;  3CCE T;  5LJ5 h;  3GNF B;  2AHJ B;  2LX9 A;  4X9D A;  3CD6 T;  3OMC A;  3QJ6 A;  1EVK A;  2ARS A;  3C94 A;  2Y4Y A;  1FYF A;  2VXE A;  2MWP A;  2RHX A;  3M58 A;  4OF1 A;  2R58 A;  1VQO T;  1ZQ1 A;  3V7S A;  2YRV A;  1YI2 T;  2OTJ A;  2FHD A;  2G3R A;  4BB7 A;  2OAU A;  4KUD K;  1BBW A;  3QZ9 B;  2K2V A;  1IL2 A;  4N4G A;  4KUI A;  1M8V A;  4HT4 A;  4CS3 A;  3EFR A;  4MDW A;  4P3O A;  3A32 A;  4P72 C;  1MHN A;  4B9X A;  4MZM A;  4NS5 A;  3NET A;  4Q5W A;  3A8L B;  5LJ5 f;  3OA6 A;  1QVF A;  3QO8 A;  1SSF A;  2DQ0 A;  3C12 A;  5FRN A;  3OSV A;  2ZZE A;  3I55 A;  2DXC A;  3LGF A;  1D3B B;  3VKI A;  3PCO B;  2PUK B;  1LNX A;  2A7Y A;  5CAI A;  2P0K A;  1IZ6 A;  4P75 A;  3CMA A;  3M59 A;  2DK3 A;  1H4V B;  5DLQ E;  3VQV A;  3MCA B;  2LT1 A;  2LTO A;  3L2R A;  3PT9 A;  3CC7 A;  4PJO E;  5DM7 R;  5KE2 A;  3E9G A;  4Q15 A;  5GAN 8;  3PNW C;  2I2L A;  3UGQ A;  4G84 A;  1KQS S;  4C92 D;  2HBP A;  3INZ A;  4M75 D;  2P0P A;  4ELY C;  3P8V A;  4QQG A;  4IUR A;  2KVQ G;  4IUQ A;  2JTM A;  5KH6 A;  3A5Z A;  3M55 A;  3TRE A;  2GF7 A;  3HFO A;  4JRQ A;  3M4G A;  3HRK A;  4QVZ A;  1VQZ A;  2LT4 A;  3PFS A;  1YIJ T;  3QZ5 B;  3ZBD A;  3X26 B;  3RL6 A;  2QA4 A;  1G5I A;  2QI2 A;  3RGL A;  3PZC A;  2C7I A;  2LDM A;  5IAY A;  3G4S A;  2AKW B;  3ZEH A;  2BUD A;  4OMF B;  4C8Q F;  3KXT A;  3FIF A;  3JCM h;  1YJW A;  3NTK A;  5CKB A;  4BE2 A;  3HY1 A;  5KCO A;  1ZHI A;  1W2B A;  4BWA A;  2ARU A;  1Y71 A;  4YRS A;  2M9U A;  5GAN j;  4FIB A;  2O01 E;  3OYD A;  4PJO A;  4L87 A;  3L2V A;  3DSQ A;  2C06 A;  2XDD A;  2CJ9 A;  2E5Q A;  4DQ2 A;  3JB9 H;  4JLG A;  2ZPI B;  4LVJ A;  2V8I A;  3HY0 A;  4YCW A;  2ZT5 A;  4YRR A;  2DEQ A;  4XTU A;  4UP8 A;  5GAN h;  1EVL A;  1B70 B;  4M78 A;  4M7A A;  2V8J A;  4YRG A;  4XU1 A;  3UGT A;  2RHS B;  4TQD A;  1OZ3 A;  4LDW A;  3VV0 A;  3FDR A;  3MP1 A;  4J5Y A;  1N27 A;  1M4Z A;  2RHY A;  2RI2 A;  5GAO r;  4WF2 A;  4K87 A;  3I55 T;  1BI1 A;  2CKK A;  2RO0 A;  2QEX A;  3S6W A;  1VQ4 T;  3I7F A;  1NJI U;  3JCM f;  3S3M A;  1M9S A;  4RKU E;  5CIU A;  3HXX A;  2ZXF A;  1Z7M A;  2CZ1 B;  1ZBX A;  4P71 C;  2KQW A;  3L2Z A;  1FX7 A;  5GAO n;  3H8Z A;  2XI9 A;  1NJ8 A;  1K8A C;  3WQZ A;  3CXC A;  3HPW A;  2H3J A;  5GAO l;  5GAN f;  4E7I A;  2QHT A;  1LOJ A;  1G51 A;  3TUP A;  1NPR A;  3OYN A;  3GP8 A;  4C92 E;  1N9R A;  3CCL T;  4M75 E;  4WJ4 A;  1KG1 A;  2QA4 T;  2Y4X A;  4LD6 A;  2FVU A;  3C4S A;  1QVG A;  3OYY A;  4O6J A;  3L4G B;  4LDU A;  3OYH A;  2P5I A;  2L89 A;  4UC4 A;  1VQ8 A;  2XDB A;  1NNH A;  1HTT A;  3W3S A;  4FL6 A;  3EAE A;  3WXM B;  5HK0 A;  1W66 A;  5CQX A;  1BI2 A;  1YHQ T;  5FRM A;  5LJ5 d;  4P73 C;  1J5W A;  1LYL A;  1Y96 B;  3ASK A;  4PJO C;  4JS4 A;  1JJC A;  2ZPH B;  2PMF A;  3VJP A;  2LQ8 A;  2I4L A;  2PU9 B;  3GLX A;  4HA8 A;  2CJB A;  4C92 A;  3PMI A;  5A0D A;  3LWH A;  3QO3 A;  3RKY A;  4A4H A;  1XOV A;  3AHU A;  1JRI A;  3MF2 A;  3QPH A;  3DKM A;  2EFI A;  4YRF A;  3F70 A;  3BJU A;  3WVD B;  4C0G A;  4PNO A;  2Q7H A;  4PLI A;  4EMK B;  5LJ3 d;  3OYJ A;  1UGP B;  1AHJ B;  5KCH A;  3IKM B;  4XK8 E;  2X35 A;  1TH7 A;  3LYI A;  5I21 A;  4YDQ A;  4YTL A;  1H4T A;  4A53 A;  3PIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...