2DXTA

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with atp and biotin, mutation d104a
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNAVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 70
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxtA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dxtA01
3V7CA 4C8QE 3QO8A 4P3OA 4ZIBA 3HFVA 4E51A 3M4PA 2DU5A 2XTIA 3IALA 3WQZA 4TQFA 4H2TA 4G84A 4M75G 4F7UF 4RDXA 2AMCB 4HWSA 2ZNIA 2EJ9A 2DTOA 3V8JA 1NJ2A 4P74C 3V8LA 1H4TA 4AH6A 4XTYA 1EIYA 5GAN5 3PZCA 4EMKA 4L87A 1WQWA 3HFZB 4CH3A 1RIQA 1NYRA 4RCCA 3HXZA 3MF1A 1LOJA 4TWAA 3V8KA 2DJZA 3REXA 4P71C 1WPYA 3QO5A 4YRNA 3JCMV 5DY9A 5LJ5g 5GAMd 2HNIA 3VU3C 4OLFA 2YLCA 1B34A 1N9SA 4RQFA 1GGMA 3RKXA 3JCMd 2CIMA 4YRCA 2ZIOA 3NELA 4PJOG 4J6WA 2QHVA 2XGTA 2DTHA 2I2LA 5GAN7 4UP7A 4YPFA 5GANg 4BW9A 2ALYA 3HXVA 4M7AB 1USYC 2DU7A 3E9IA 1H4SA 12ASA 2ZTGA 4XU1A 4J15A 4M77B 4TVAB 1ADJA 3L1AA 2QHTA 4WF2A 2J3LA 4K86A 3VQYA 4A54A 4P73C 4XU2A 3ERRA 1H4VB 1YCYA 1ASYA 3SWNA 3ICAA 1EFWA 4M7AD 3JB9J 1EQRA 1M5Q1 5C53B 1N9RA 1B7YB 3BDUA 1G51A 3BJUA 4EMKB 4H2SA 3REUA 4M77F 3R07A 4WI1A 4Y91A 4YRLA 4CS4A 3OD1A 3RF1A 4M78A 2K57A 2Y90A 3BFMA 2C8MA 3HSBA 3JB9I 1E22A 4TVWA 4WJ4A 1TH7A 1VQZA 3A7AA 4C92C 3RERA 1YB3A 2ARUA 2FYKA 1HTTA 4PJOD 1SERA 4F7UB 3JCMg 2DDZA 5GAMf 4YRPA 4XU3A 4P75A 1WQ7A 4M77E 4PG3A 3UFGA 1QF6A 2P0LA 3QNEA 2DXUA 1X2GA 4M77D 5GAOr 3INZA 3RACA 1U1SA 2ZZFA 1G5IA 4H2XB 2RHSB 4EX5A 4ZTZB 4LNSA 3QUIA 4F7UG 4QVCA 5E3IA 3L4GB 3HRIA 4M7DC 3IKMB 4TVAA 4HT9A 2DTIA 2AKWA 4XU0A 5GAOn 2E41A 4M75A 1E24A 4XTZA 3JB9H 4P72A 4Q15A 3VQXA 1YFRA 4J5YA 3JB9D 4PJOB 3RGLA 1LNXA 1B7YA 2ZNJA 3HXYA 3VQWA 5KNNA 4H2XA 3MF2A 1J5WA 3I7FA 1X54A 1QE0A 3RESA 3HFNA 1NJ6A 4H02A 4CH4A 1Y96A 2DZCA 3HXWA 3RKYA 5LJ3h 4QVDA 11ASA 4HWPA 4BWAA 2EJFA 4XTWA 1C0AA 1EOVA 3SWNC 1NJ8A 3A31A 2ODRC 5GMKh 1YFSA 3JCMP 4M78C 2ARTA 2G4CA 3RL6A 2E10A 2ZZEA 3A7UA 1NJ1A 3HY0A 5GAN6 1BIAA 1PYSB 2I4MA 2ZT7A 3JCMQ 3LSQA 4PJOA 1Z7NA 2EAYA 2Q5IA 4X9DA 5LJ3g 1B70B 4RMFA 4DQ2A 4M77A 5CAIA 1SETA 4YCVA 1KQ1A 1WNLA 3HFZA 5GANd 1BBWA 4M7AA 4RQEA 4KR2A 3DSQA 3AHUA 5GANe 5GAOq 3A5ZA 4YREA 3UH0A 4M75C 4P72C 4PHCA 4M7DG 4C8QF 5GAOl 4K88A 2RHSA 4YYEA 4CS2A 4XTXA 4X9CA 5LJ5d 1JRIA 5GAMg 4N0AC 4TQDA 2E64A 5LJ5j 4YRKA 3P8YA 2IY5A 2CGHA 4M78B 1D3BA 2Q7EA 5LJ5e 2VXFA 3M4GA 3P8VA 4UP8A 2YHTA 3TEHB 2CJBA 1X55A 3HRKA 2E65A 2DXTA 4CH5A 1KMNA 5GANj 1I8FA 4JRIA 4YRTA 5K1XA 3A74A 3IKLA 1U1TA 1JBMA 3TUPA 2ZT5A 1FYFA 4PJOC 2DKGA 1B8AA 4C92E 4V2SA 1JJCB 1KQ2A 2ZGWA 3UGTA 2E1HA 5GANf 4C92D 1EVLA 5K1PA 4XTVA 4C8QA 3UGQA 4JLIA 2ODRD 1IL2A 1M8VA 4OP0A 4M78D 3JCMh 3FJPA 3HY1A 2ZR3A 2DEQA 5GAMe 5GAOp 4HWOA 2C7IA 4P74A 1JJCA 4K87A 1NNHA 3L2ZA 4M7AF 3PCOA 2AKWB 5ELNA 2JN0A 4RCBA 2PMEA 3L4GA 4YRJA 4M75B 4KQEA 4C92B 1KMMA 4PJOF 3JCMX 1KOGA 3VQVA 3JCMe 3CMQA 1I5LA 4YCUA 4NL3A 3QHSA 2AMCA 3NENA 4F7UA 5GMKi 1EVKA 3RKWA 3NETA 1L0WA 4M7AC 5GMKm 2VC8A 3E9HA 1I4K1 4YRRA 1E1TA 3RIRA 3LSSA 1B70A 2RB6A 5GAMj 2QHUA 4M7AG 4NL2A 4PNOA 2I4OA 3A5YA 4Q6GA 3SB2A 4YROA 4DPGA 5C52B 4A53A 1YFTA 2Q7HA 4YRQA 5LJ3d 4M78E 5GAMh 4YCWA 2RHQA 4YRFA 3JCMW 2E3CA 4XTUA 1USYA 4N0AA 1H4QA 4CS3A 3JCMf 4C92A 4C8QB 1LJOA 4EMHA 5GAN8 5LJ5h 1PYSA 4YRMA 4C8QC 4NOYA 3PCOB 5GAOm 5C51B 4P73A 4P75C 1WLEA 1H641 2RM4A 2YLBA 2Q5HA 4TTVA 2DQ0A 4YRSA 5GMKl 4C8QG 3EFSA 3PGGA 4X5OA 4M7DD 1ATIA 4M77G 3QSUA 4XEMA 1W66A 3JCMb 4HT8A 3HFOA 2ZXFA 4M75E 1HK9A 2DQ3A 2QTXA 3BW1A 4HA8A 4H2VA 1YGBA 4HVCA 3JB9G 2ZR2A 4P3NA 3GIBA 1G5HA 4G85A 5LJ3e 3G1ZA 3V7SA 3JB9F 2ZINA 1X56A 4M78F 3HXXA 4UPAA 4F7UE 1Z7MA 2PMFA 2ZCEA 4YRIA 2Q7GA 2IY5B 3HXUA 3FB9A 4EMGA 4M75F 4M7DA 3A32A 3TEGA 2EJGA 2ZT6A 4M7DB 1EIYB 4KR3A 3P8TA 2DVEA 1HC7A 1LYLA 5LJ5f 4H2WA 3JCMc 3TEHA 4HWRA 4UP9A 4C92G 4EMKC 3V7RA 2I4NA 1D3BB 3BY7A 5GAN3 3QTCA 4TVYA 1ADYA 4PJOE 4YP0A 4YDQA 4YRGA 4JRKA 4H2UA 1WU7A 4HWTA 1B76A 2ZIMA 2CJAA 2ZZGA 4EO4A 1X2HA 1ASZA 4J6XA 4J6YA 4C8QD 5GMKj 3A7RA 5HGQA 5ELOA 4M75D 4JUVA 2FB7A 5I21A 5GMKe 2DZ9A 3LC0A 2RD1A 1N9WA 3QO7A 4CH6A 4ZTUB 3KFUA 1BIBA 2ALYB 3QO3A 1Y96B 4XQ3A 2J3MA 4C92F 1SRYA 4P3PA 2CJ9A 5LJ3f 3MEYA 2ZT8A 4MMLA 4NCXA 2QHSA 3HTZA 4XEOA 2EL9A 3IG2A 4M77C 2I4LA 3NEMA 3VBBA 5LJ3j 1B34B 2VXEA 4MMKA 3SWNB 1BBUA 1E1OA 2ARSA 2E5AA 4P71A 3M4QA 4M7AE 3EFRA 4O2DA 4M7DE 4WJ3M 4M7DF 1NJ5A 1HXDA 4M78G 3FIFA 5GAN4 2RA2A 5F5WA 1I81A 2EWNA 4H2YA 5GANh 1NYQA 1SESA 1MGQA 3JCMJ 3W3SA 1X01A 5GAN2 2RHQB 3RUXA 1WYDA 2P5IA
chains in the Genus database with same CATH superfamily
2KAFA 2CP7A 2E5QA 4LD9K 4P3OA 4MZMA 1SKUB 2LT1A 3I55A 4C5GA 2ZPBB 4RTYA 4M75G 4F7UF 2CSQA 2ZZDA 4HWSA 2DNUA 2AZSA 2GCXA 3H6ZA 4FCYA 1VQ9Q 1NJ2A 1H4TA 4AH6A 5GAN5 3X26B 4EMKA 1M1FA 2NUZA 3A5ZB 1D0YA 1K73R 2K5IA 4A4KA 1QCNA 2DRMA 2DJQA 4C0ZA 3HXZA 1YWOA 1OZ3A 1S72A 4P71C 2F5TX 2XKOC 4LVLA 1UECA 1S72Q 3MHXA 5LJ5g 2KQWA 5GAMd 4B9XA 2FHDA 3UWNA 5CKBA 1B34A 4QW2A 1X43A 3UA6A 5C0MA 1TS9A 2CIMA 4YRCA 1X75C 2YXYA 2V8IA 3NELA 1GCQA 4PJOG 2E6NA 3MP6A 3OYFA 1HSQA 2XGTA 5GAN7 2KY9A 4UP7A 3HXVA 1USYC 1H4SA 12ASA 1RACB 4J15A 2HEQA 1QKWA 3VQYA 4A54A 2EQIA 4P73C 2HDAA 2LQNA 1H4VB 2CZ6B 2VASA 1NBEB 3VYGA 1EQRA 3OYBA 1N9RA 1B7YB 4C5EA 4PJLA 3RMSA 2QTVA 4WI1A 4Y91A 2IVWA 2CT4A 4Q5WA 3RF1A 3X20B 3OYIA 2Y90A 2W0ZA 2L8DA 1TH7A 4ZN3A 1BK2A 4PJOD 3JCMg 4YRPA 5GAMf 1W2BS 3CCLA 2KI7A 4M77E 4FT4A 3QNEA 2X9HA 1X2GA 2D1XA 5I11A 2OI3A 4H2XB 1UDLA 4LNSA 1S1NA 3QUIA 3ZEHA 4F7UG 1T3LA 2ZPEB 2M0YA 4XU0A 1D1CA 2FRWA 2K3YA 4UC4A 5GAOn 1VQ8A 4OMMA 3JB9H 5FWCA 1M1KR 3CPWA 1M8MA 3LGLA 1GCQC 3CCUT 4PJOB 4JJNK 3M54A 3E9GA 4BB7A 2ZNJA 3HXYA 1NJIU 1KQSA 4H2XA 3VQWA 2R58A 1Q82R 2RK2A 1MMGA 1VQLT 1AZGB 1QE0A 3RESA 3HFNA 1NJ6A 1ZA1B 3OSVA 1Y96A 2YUOA 3HXWA 2PTKA 4E47A 1X69A 2P0KA 2OAWA 2GGRA 3UF4A 3FC3A 2QDYB 1NJ8A 2KDSA 3A31A 2X35A 3JCMP 1Y0MA 2EPDA 2ED1A 3MJXA 2ZZEA 3A7UA 1NJ1A 4E7JA 4PLIA 4KUDK 1PYSB 3EH1A 3PIOA 1Z7NA 2EAYA 5KYUA 1GBRA 4RMFA 3S3NA 3CMAQ 1TOVA 2DD5A 3CPWS 1KQ1A 1WNLA 5CQXA 1XOVA 3TU4K 5HCKA 1VQ9A 1WHGA 3CCQA 2E3IA 3QJ6A 5KYXA 5GAOq 2LJ3A 2J7IA 4P72C 1QVGP 3EGXA 4J83A 4PFPA 4K88A 3G6ET 2DE0X 2F2WA 3CBOA 4XTXA 1YIJQ 5LJ5d 5GAMg 3MEWA 2LQ8A 4A4GA 5I22A 2ZPGB 2YUPA 2CGHA 4M78B 3VS5A 5LJ5e 3M4GA 4UP8A 3OB9A 2RPNA 1VQKQ 4PFZA 1X55A 1K8AC 5FU6B 1I8FA 4PFOA 2JW4A 3GLXA 4D6WA 4KULA 5KYXB 2C06A 3A74A 4ESRA 1SSFA 1JBMA 5HK3A 3M5AA 2VKNA 3MP8A 2A08A 2E1HA 1OX8A 3CCRA 1ABQA 2DIQA 5CIUA 2DBMA 1TWBA 1K9MU 4ME7A 4ZTJA 3X25B 3OS1A 1KD1R 4OP0A 3JCMh 1NM7A 3CC7T 2ZR3A 2KYBA 2DEQA 3TSWA 1Q7YR 3G4SA 2XD0A 2XDPA 5GAOp 4IUUA 4RUGA 2E5KA 5KE2A 1IHWA 2AKWB 2RN8A 3CC2A 2MYSA 2NLUA 4RCBA 1WA7A 3CCQQ 2PMEA 3L4GA 1SHFA 3EH2A 4IUVA 1M30A 2H3EB 3C94A 3JCMe 3KXTA 4CC7A 2RI5A 1SF9A 2HQXA 4YCUA 1VOMA 4J9GA 2EYXA 2RHYA 1WFWA 9ATCB 1NG2A 4BDZA 2Y4XA 4M4ZA 1TUDA 1O75A 1R0BG 4XK8E 3PMIA 3EG3A 1PNJA 2VC8A 1EX4A 1VQPQ 4M7AG 3OYEA 4PNOA 2I4OA 4DA4A 4YROA 2JTEA 4D8KA 4YRQA 4AG2C 1NLPC 4M78E 1M90R 4A4FA 1K73U 2RHQA 2RMOA 1GFDA 4XTUA 1USYA 1H4QA 2LQWA 1NEGA 4C92A 1NJIC 4EMHA 2L0AA 5GAN8 5LJ5h 3QG1A 1H92A 1PYSA 3CC4Q 2DETA 4C5IA 3WXMB 4P73A 2CP6A 2RM4A 4YRSA 1QVGS 4R55A 3PGGA 4X5OA 2Z0WA 3PTAA 3L2QA 3MCAB 1YJNQ 2ECZA 1W66A 3M56A 1NPPA 2XMFA 4M75E 5A0LA 5I2MA 4HA8A 1RI9A 3CC7A 3JB9G 4HCCA 2LCCA 1K4US 3G1ZA 5J26A 4VUBA 4BACA 1IGQA 2EVRA 4OMNA 1X56A 2LNVA 2BE7D 4UPAA 3QYGB 3UA7A 1VQ7T 1Z7MA 2EYQA 2Q7GA 2IY5B 2LJ0A 5A0DA 2P84A 4M75F 4ZNXA 3VS3A 4E7KA 4L59A 2DL4A 2EJGA 1EIYB 2DVEA 1WJQA 3MKDA 2PU9B 3TEHA 1D0ZA 3DLMA 1B07A 3QDFA 3VS7A 3WVEB 4PJOE 3A8OB 3SHWA 3WVDB 2DM1A 2JMAA 2JVVA 3OYNA 1ZUKA 4JJCA 7AT1B 3CXCP 2ZIMA 3HPWA 5EG2A 4WTOB 2ZZGA 5GMKj 3A7RA 1W2BP 2JTMA 4JUVA 5I21A 3DB3A 2EYWA 2DAQA 3ZFJA 2X3WD 2DZ9A 4E6RA 3QO7A 4CH6A 2EBPA 5I2SA 2D0QB 3META 4XQ3A 1FXXA 4C92F 4P3PA 2RK1A 4D8DA 3CQTA 1N8RU 2O9SA 1AEYA 1GRIA 3MEYA 1AOJA 2GFAA 1MMDA 2P0PA 2QHSA 4NCXA 5KYWA 1Q81U 2I4LA 5LJ3j 2A37A 2COYA 2QYZA 4GLKA 4P71A 2K3XA 2YRVA 4GLMA 3PNWC 3FIFA 5GAN4 1FMVA 8ATCB 1SESA 4C0GA 4DOWA 2XIDA 3UT1A 2E4HA 3QJYA 4IUPA 1X01A 3QZ9B 1VQNQ 2RQTA 3RUXA 2P5IA 1RABB 1QKXA 2VB6A 1NLOC 3V7CA 4C8QE 3CCJT 2O01E 1ZUYA 4OF1A 2DPPB 3M4PA 3CD6T 2LP5A 2JXBA 2XTIA 3WQZA 4TQFA 1G3YA 3VRYA 2RI3A 1VA7A 1H3HA 3OSSC 3VS2A 4II1A 3QDRB 3CPWP 3A1PA 1ZSZB 4FW2A 2DL5A 3V8LA 2JOYA 4LVKA 2XDDA 3J7AF 4Z88A 3PZCA 4L87A 1WQWA 1UGVA 1Y71A 4FYVB 4AFUC 4DEXA 3HFZB 3RDVA 3FJ5A 1RIQA 3MF1A 1LOJA 1ZSZA 2DO3A 1PWTA 1VQ4T 1WPYA 3QO5A 2A0FB 2RQRA 2AHJB 3VUBA 4OLFA 2MI6A 4F14A 1LCKA 4RQFA 2QGGA 2V26A 1GGMA 2FPFA 4L5GA 2Y4YA 1Z9QA 4PJMA 1KSWA 2DTHA 2I2LA 1K9MC 2PVOB 1QLYA 1X2KA 1VQ6A 2ALYA 1N8RC 1MMAA 3E9IA 1X6GA 2WSCE 1RAGB 4JDSA 5KYNA 4XU1A 1BYMA 4M77B 2H3JA 4TVAB 2EQMA 1BI2A 3NGPA 2DMOA 4WF2A 4K86A 2L3QA 2K7AA 4HVVA 3CMAT 3HRUA 4RTXA 3HL8A 3SDZA 3QXEB 2R5AA 2PNIA 2SEMA 2RH2A 3BDUA 3NFCA 3BJUA 1UHFA 1YITT 4HVWA 1BB9A 3OD1A 1OPKA 1FYNA 4J9IA 2KRMA 2FO0A 2C8MA 3JB9I 1E22A 1VQZA 3A7AA 2GNCA 1QWFA 4C92C 3RERA 2ARUA 1O9SA 4JJDA 1QF6A 2F5KA 3HHTB 3INZA 2EGAA 3RACA 4LDUA 1XNIA 1G5IA 4EX5A 4O5VA 3CPFA 3QKJA 3L4GB 1PKSA 4M7DC 2DXBA 2LZ6B 1KJWA 2AKWA 3PIPA 3M59A 4EPCA 2YRCA 1VQ9T 4P72A 2O31A 4E2FB 1X6OA 1KHCA 1JXOA 2D0NA 5L8RE 1PSFA 3RGLA 1W1FA 1B7YA 3H8ZA 4IIOA 3CC2Q 1J5WA 2HKQB 4BE2A 1UJYA 5IXBA 1KFZA 5CCAA 2A3LA 4CH4A 3E9FA 3HRTA 2P4RA 3M55A 4KGZB 2DZCA 5IXFA 3RKYA 11ASA 4HWPA 4BWAA 1YNZA 1EIFA 3FLGA 1JJ2S 2GF7A 3VS6A 1OZ2A 2X4YA 4E7LA 1YFSA 4M78C 3JAME 2V1RA 3URGA 3CMAA 3RL6A 4BY6B 5GAN6 4QT7A 4CI0C 1C6VX 3M4YA 4DBQA 5LJ3g 3UATA 1V29B 1VQ6T 1WJSA 5AT1B 3CCUA 1PC0A 1SETA 3EAEA 2O9VA 3I5SA 3HFZA 1BBWA 1VQOA 4JZ3A 4M7AA 2KE9A 3TVTA 1KD1C 3M0UA 4FYWB 3DSQA 3AHUA 2LRQA 1VUBA 3A5ZA 3UH0A 3OYDA 3UPUA 4PHCA 4E7ZA 4RTWA 2CS7A 2RHSA 2CYZB 4CS2A 3CC2T 1XTDA 3EGUA 5FU7C 2KT1A 1U06A 1VIEA 3H41A 4TQDA 2HAXA 3CCLQ 4BI3A 5LJ5j 2J6OA 1YCSB 3CCVA 2LVMA 1LPLA 1AZEA 2V8JA 2Q7EA 2DX1A 2PZ1A 1UE9A 1M3CA 3FRNA 3P8VA 1G83A 2E65A 2DXTA 2F2XA 1UJ0A 2EYZA 3CCRT 1T0HA 1TU0B 4KT0E 5K1XA 1RAAB 1GL5A 1PM3A 1U1TA 3TUPA 4B6MA 1QP2A 4GY5A 2F69A 2KNBB 4C92E 3CBMA 3JV3A 2ZGWA 5CKFA 1KQ2A 5GANf 1EVLA 3CBPA 1PHTA 2JM8A 2DL7A 1M4ZA 1YHQT 1VQ6Q 2RNAA 4KH1B 1KG1A 1IL2A 1M8VA 3HTRA 2HL5C 4P5NA 1RAHB 1MUZA 3PFSA 1UGSB 2PQWA 1S72T 1XQHA 5GAMe 3LGFA 3M53A 5L23A 3L2ZA 1TUGB 2VVKA 1AWOA 2JN0A 4R0KA 4YRJA 4KQEA 2HQEA 4PJOF 3JCMX 3OYKA 3OS5A 3CMQA 1I5LA 2QQRA 3I55Q 2KXDA 3QHSA 3NENA 2DL8A 1OPLA 1EVKA 1L0WA 3OYAA 4PJNA 1M2VB 2EIFA 5GMKm 2QXFA 1OYXA 2EFIA 3L2VA 2FG0A 3RIRA 3LSSA 2RB6A 2ZPFB 5GAMj 1VIFA 2K2VA 2QHUA 3A5YA 2LCSA 5IN1A 5C52B 3SB2A 2J05A 2ED0A 1IXDA 2DLPA 3GNFB 5GAMh 1Q81C 1WHMA 2HMAA 2RI2A 4CS3A 4J9EA 2CZ7B 1W6XA 3PCOB 4E7IA 1AHJB 1Q86U 5KCHA 1PRMC 4P75C 1N8RR 1H641 4DBHA 1NE8A 2Q5HA 4C5HA 1PSEA 4TTVA 3CC4T 1AD5A 4C8QG 3CMEQ 1WXBA 2C0TA 3EFSA 5AYFA 4M7DD 1T0JA 1VQ4A 1ATIA 1EZZB 3QSUA 1JU5C 1UHCA 3MP1A 5CK9A 4XEMA 3M0PA 4LVIA 3PVLA 4J9CA 3JCMb 4HT8A 1K0XA 4F16A 2ZPHB 4CC2A 2HBPA 2HD0A 2DQ3A 4H2VA 4AG1C 1YGBA 4HVCA 5IAYA 1VQ7A 4N4GA 3GIBA 1YJWT 3I35A 3OMGA 1G5HA 1BI1A 5DLQE 5LJ3e 2HBWA 3V7SA 2HQHA 1YHQA 1G3TA 2KBTA 3HXXA 4L6V5 1YJWQ 4N4HA 2I0NA 1UEBA 1M9SA 2ZCEA 2CP3A 2QEXT 2HZYA 2J06A 1UGQB 3A32A 4AT1B 1NJIR 2ZT6A 2E12A 2K3BA 1HC7A 2DFUA 1VYUA 3J81E 2J6FA 4HWRA 4BDYA 4BI4A 3V7RA 1D3BB 1QWEA 2NUTB 1VQNT 2RQVA 1ADYA 4YDQA 3R6OA 4YRGA 1MHNA 3LH5A 4KUIA 2JJ9A 2QAZA 1ZBJA 2VV5A 4HWTA 2HL3A 1ZUUA 1B76A 1M27C 1MV3A 4EO4A 1X2HA 3RMQA 4M75D 2DF6A 1R0CB 1ZSGA 5LL6S 1PG5B 2ROLA 1JO8A 2L3RA 4HVUA 4F04B 3ULRB 1SRYA 4BI8B 2FVUA 2CJ9A 5LJ3f 5KE3A 2AKLA 1YJ9Q 4FM4B 1YI2T 4XEOA 1ZSZC 1PRLC 2LMJA 1G3WA 2VXEA 3VV0A 1FX7A 4MMKA 1KC8R 1WJRA 4Z02A 2CP2A 4JLGA 2FEIA 4WJ3M 3MEVA 1Q82C 4ORZA 2EQJA 1OOTA 1I81A 3TCJA 1WLPB 4Z89A 2CZ1B 5CVIA 3VKIA 1KQSP 3G4SQ 2DILA 5GAN2 5D6WA 1WYDA 4YREA 4DEYA 2EGEA 3G1JA 1KHIA 3QO8A 1A0NB 4ZIBA 3OYHA 2MOXA 1QVFS 2QDLA 2EKOA 3IALA 4LDYA 4H2TA 3OMCA 4G84A 1K9AA 2AMCB 4LVMA 2EJ9A 2HCKA 1AWXA 4KGVB 5D6YA 2AK5A 2NUPA 1M3BA 3EG2A 4HXJA 2CREA 4AFZC 4ZGEB 3EGXB 3OS2A 4CH3A 2DD4A 1NYRA 1T3SA 4ZGDB 5GJVB 4RCCA 2YUQA 4TWAA 1AT1B 4JPBW 1HJDA 4QKUA 2CZ0B 2DJZA 3TSZA 3REXA 3JCMV 2NS6A 5DY9A 3L2UA 1PKTA 3VU3C 3S3OA 2D8JA 2YLCA 3ASKA 1N9SA 2SRCA 1YITA 2EW3A 3JCMd 2PUKB 2DK3A 1LVKA 4J6WA 3GBQA 5IHNA 3LWIA 1QCOA 4BE0A 3OQ5A 5GANg 2ZTGA 2O88A 1MNDA 3CCEA 3HP9A 2M1HA 3CC7Q 1ADJA 2QHTA 1CKBA 2GQIA 5HK0A 2D6FA 1ZLMA 4XU2A 3ERRA 2IPOB 5FLXE 1ASYA 4FL6A 3ICAA 1EFWA 3EFOB 1M90U 3CCJA 2ESWA 1M5Q1 3CMET 1M90C 5C53B 2HSPA 1RLQC 3EG9A 1YWPA 2RF0A 4RTVA 4H2SA 4M77F 2MCNA 3P8DA 4CS4A 2KVQG 1RADB 2K57A 3BFMA 3REBB 6AT1B 4TVWA 4WJ4A 5J39A 1YB3A 4FYYB 4F7UB 3EG9B 4XU3A 3JSCA 2FPDA 1WQ7A 3UFGA 4PG3A 3E2UA 2DYIA 1K9MR 4M77D 5GAOr 1QVGA 2X3XD 5E3IA 4OMOA 3HRIA 5A0GA 2OTLT 3PT9A 3LH0A 1E7OA 2QA4A 1VQMT 2M51A 2BZXA 4JJBA 2OJ2A 1YN8A 2QA4Q 1YJWA 3RBBB 4EDUA 3FDRA 3QPHA 3E1SA 5FU6C 3VQXA 1NZ9A 3ZL7C 4J5YA 3JB9D 2E3HA 1N6AA 2D9TA 4GBQA 5KNNA 3CCLT 1WXTA 5HY6A 1VQKA 3CCUQ 4FIBA 3VS4A 4LDXA 2X4XA 1BU1A 2IIMA 1Q81R 5LJ3h 4QVDA 4FSXA 5FU7B 1ZHIA 1GFCA 1EOVA 1G8XA 3SWNC 4QQGA 1FMKA 1V1CA 5J3BA 4JS4A 2B86A 2ARTA 2G4CA 2E10A 1OU9A 1BIAA 2I4MA 2ZT7A 3G6EA 2Q5IA 4X9DA 1VQ5Q 1B70B 3NTKA 2LCLA 5CAIA 2O4XA 5GANd 3OW2A 4RTTA 2BIVA 3H0HA 5FROA 1YP5A 4ELZC 1YJ9A 4M75C 3JRZA 2OTJT 3A8MB 1QW1A 1YITQ 2COWA 4M7DG 4C8QF 5GAOl 4YYEA 1JQQA 2WSEE 3X24B 4JRPA 2KROA 4X9CA 5CO7A 2E64A 2JUFA 1MV0B 3MO8A 3P8YA 2IY5A 4ANJA 2FZCB 2KRSA 1ARKA 1WHKA 3EGDB 2VXFA 1WHJA 3DKMA 2RJFA 3CD6Q 2CJBA 1VQMQ 2W10A 3HRKA 4ATOA 4OB2B 4CH5A 1KMNA 1VQKT 4OMPA 2GBQA 2AZVA 2QASA 2YDLA 2L2PA 2K6DA 4JS5A 3GP8A 1OV3A 2ZT5A 1FYFA 4PJOC 2DKGA 1B8AA 1ACMB 1UUEA 1ZQ1A 4XTVA 3UGQA 4JLIA 1R77A 1I0CA 4M78D 3H9NA 3EGDA 3FJPA 1DJ7B 2KT8A 3L2WA 1E6GA 2JMCA 1VQ5A 2MWPA 1Y57A 1JJ2P 4HWOA 4P74A 1SSHA 2OTJQ 1NNHA 2G3RA 4M7AF 3PCOA 5DM7R 5ELNA 2PVDB 2KK4A 3RR6A 1KMMA 1KOGA 3VQVA 4E7SA 1H3ZA 2K2MA 2J6KA 2V1QA 3CEYA 1D1BA 1YI2A 1RLPC 4NL3A 1VQ5T 2AMCA 2GFUA 1Q95G 2BTTA 3CMEA 5GMKi 3RKWA 4M7AC 2VGNA 3Q1JA 3OYMA 1AWWA 2JS2A 4YRRA 3A8GB 2A28A 1B70A 2JTFA 1M2VA 1RUWA 2FZGB 4NL2A 3RNJA 3VS0A 4Q6GA 2CP0A 1QP3A 3OBWA 3REAB 4A53A 1YFTA 3EG0A 2HKNA 2HSEB 5LJ3d 1FWZA 4YCWA 3CD6A 4YRFA 3C0CA 2E3CA 1U5SA 1I07A 4ELYC 2MAMA 4OVAA 4C8QB 1VQ4Q 2IG0A 4YRMA 2H8HA 3VUZA 2BZYA 4NOYA 5C51B 1SHGA 1C1AA 4A4HA 2MF2A 3NHNA 3QBYA 2RJDA 1WLEA 2YLBA 2RHIA 5CR2A 2GTJA 4OMLA 4OGCA 3AT1B 2RQWA 3E19A 4ZGJB 1W70A 4AFSC 2ATCB 3M57A 4K11A 3EG1A 4HKEA 2ZXFA 2ENMA 2V8KA 2DERA 3CCVQ 1TG0A 1HK9A 3C95A 3BW1A 5KYWB 5IHKA 4R56A 3CCST 3PE0A 2JT4A 1VQOT 2ZR2A 2QQ9A 4P3NA 4F17A 4G85A 2OTJA 1YJ9T 1CSKA 1TUCA 1PD1A 3ER0A 2A8EA 4J8OA 2X4WA 2ZINA 4M78F 2YT6A 3CCJQ 2RJEA 4O6JA 4F7UE 2X4JA 2PMFA 4YRIA 4IIMA 3I56A 3DLLA 4BE1A 1UB4A 5M9OA 4EMGA 1Q82U 3BE3A 3M58A 1VQPT 2DRKA 3N5BB 2LDMA 4J9BA 4KRTA 3GPLA 1K73C 3P8HA 3TEGA 3SEMA 4M7DB 4KR3A 3P8TA 1MMNA 2FRYA 1LYLA 4H2WA 2ZCFB 2B8AA 2ZAEA 4C92G 1IRXA 4IURA 2I4NA 2YRDA 2M16A 3QTCA 4YP0A 2X51A 3HKSA 2L89A 4C0DB 4ZN1A 2LX9A 4LD6A 1ZBXA 3NTIA 1R8OB 1G3SA 5KYUB 3VYHB 1Q7YU 2CJAA 2VGMA 3S6WA 4J6XA 8AT1B 4C8QD 5HGQA 3CCMT 1IZ6A 3I5RA 1QQJA 1VQLA 2FB7A 3KBGA 2XK0A 4RMOA 2K79A 1M1KU 3DB4A 3C12A 1RAEB 2RD1A 4YTLA 2M9UA 2YUNA 4EIKA 1BIBA 2CP5A 2ALYB 1Y96B 2J3MA 2AIRB 1UG1A 3NMZC 4J7IA 1BKBA 4MMLA 5IHIA 3HTZA 4PL6A 5CKEA 3EHQA 3VBBA 5KCOA 4MZTA 3CCSA 3LX7A 1E1OA 2ARSA 1RI0A 3M4QA 1JJ2A 2CKKA 4M7DE 4FW1A 1HD3A 1IB8A 1HXDA 2BUDA 5IH2A 1U8RA 2RA2A 4HCKA 4BD3A 3SFMA 2LTOA 2RO0A 4H2YA 5GANh 1NYQA 1VYVA 1MGQA 1UTIA 4E7HA 2RHUA 3ME9A 4JRQA 1VQ8Q 3JCMJ 3UDCA 3W3SA 2LC4A 4CC3A 2WSFE 3D7SB 4RKUE 3OBYA 2K9GA 2GQVA 2MWOA 2RQUA 2NUPB 3LLRA 2COZA 3HFVA 4E51A 2DU5A 5CQYA 1WIEA 2XHCA 3VS1A 3CCET 4RDXA 2ZNIA 1UFFA 2DTOA 3V8JA 2QA4T 4P74C 1YFNA 2OTLA 5HKCA 4XTYA 3OA6A 1EIYA 3CCEQ 4LUEA 3FEOA 4PLLA 2F2VA 2CH4W 1GBQA 3T9NA 2RJCA 4LDVA 2EYYA 1Q86C 2EGCA 2JS0A 3V8KA 4MDXA 4X1VA 4YRNA 4OMFB 1OULA 2QQAA 3SD4A 2M02A 3CC4A 1WI7A 2HNIA 4ZTFA 4IKFA 2OTLQ 1HYOA 2K5LA 1QVPA 3RKXA 1QVFP 3OY9A 1WYXA 3M9QA 2ZIOA 2QHVA 1BCMA 4AMCA 5FW9A 3G7ZA 4YPFA 4BW9A 4M7AB 2DU7A 4BY6C 3KUFA 3TQ7P 3CCMA 3L1AA 1G5VA 4PJJA 1E6HA 5FRNA 2J3LA 2BZ8A 1D09B 1V76A 4Y92A 1YCYA 4HT4A 3SWNA 1D1AA 4M7AD 2CT3A 2L3PA 3U23A 3JB9J 1RL2A 5DLOA 1Q7YC 1G51A 1OI1A 5CKHA 4EMKB 3REUA 3R07A 4YRLA 4M78A 3J80E 4FU6A 3HSBA 1X27A 4FSSA 2FL7A 4J9HA 2G6FX 1M3AA 2FYKA 1HTTA 1SERA 3LW5E 2DDZA 4C0DC 4P75A 1I5OB 2P0LA 2DXUA 1G2BA 2CDTA 1U1SA 2LJ1A 1K0SA 2ZZFA 2RHSB 4QQ6A 4ZTZB 2MPXC 1GCPA 4QVCA 2VUBA 3VRZA 1K8AR 3CCRQ 3IKMB 4TVAA 4HT9A 2DTIA 4WCIA 2OX7A 2E6ZA 2RHXA 2E41A 4M75A 2M0OA 4XTZA 1WHHA 2QI2A 2VYTA 2L3SA 1E24A 4Q15A 4KH0B 3CCMQ 1RAIB 1YFRA 1SRMA 4DBRA 5ECAA 1LNXA 2NYSA 1WDXA 3MF2A 2F1LA 3I7FA 3F70A 1NYGA 1X54A 4RTUA 4B9WA 4H02A 1PD0A 3OYGA 1W4SA 1YI2Q 1KC8U 2EJFA 4XTWA 1C0AA 3QZ5B 3OYJA 1OEBA 3OYLA 2ODRC 1AVZC 1NPRA 2E70A 4J9FA 5GMKh 3CCVT 5C6SA 1IHVA 3ZBDA 4J7FA 1YIJA 1VQNA 4MDWA 2XI9A 1YBYA 1VQPA 2LQKA 1WGSA 4NS5A 3HY0A 1I1JA 1TSFA 3LYIA 3JCMQ 2R57A 3LSQA 1C0MA 4PJOA 3P8BB 2FZKB 1VQ7Q 4Z8AA 4DQ2A 4IUQA 3PMTA 4RTZA 4M77A 5GJWB 4YCVA 4MZPA 3M0SA 3THKA 4DOVA 1UGRB 3R6NA 3OW2P 4RQEA 4KR2A 3CXCA 1KC8C 1SRLA 5GANe 3A8LB 3O5ZA 2A36A 2CUDA 4RG2A 4LXCA 1FMWA 1MNEA 2MK5A 2LX7A 1JRIA 3MEAA 4N0AC 2YWWA 1IREB 3G71T 2EQKA 1KQSS 1YIJT 4FYXB 4YRKA 2QGFB 1M2OA 2ROTA 1OU8A 3M0QA 1D3BA 3LWHA 1UGPB 4C0FA 1M1KC 2YHTA 5KYYB 2DA9A 3TEHB 4QVZA 4X34A 3EFOA 2FPEA 5GANj 4JRIA 4YRTA 4PK4A 2MIOA 3IKLA 4OB3B 1BCOA 3I56Q 1K76A 4OMQA 5KH6A 4FT2A 3HRSA 4V2SA 1JJCB 1EFNA 2BKDN 2EQUA 3UGTA 3OYYA 4C92D 4LUDA 5K1PA 2KMTA 2DXCA 4C8QA 1GXIE 2ODRD 5CKDA 3HY1A 2RHZA 4BUGA 1K1ZA 3C4SA 4KGXB 3BDLA 1JXMA 2P0QA 3S3MA 3MEUA 2C7IA 1JJCA 2NWMA 4HCZA 3OYCA 4K87A 5FWBA 3G4ST 3GF5A 4PKCC 2YSQA 3OW2S 4M75B 3NTHA 3A98A 4C92B 1VQOQ 3OS0A 1KK7A 1JEGA 1P92A 4HCBA 3H0IA 1WX6A 3KFVA 2O2OA 5EC7A 2XG8D 4J9DA 2VWFA 4F7UA 2R5MA 3NETA 1SPKA 1BBZA 2L5QA 2LT4A 3I55T 3E9HA 1I4K1 1E1TA 2XU8A 1KIKA 2ABLA 1IO6A 4DPGA 3IQLA 2KEAA 1N27A 2Q7HA 2DYBA 2AT1B 5IT9E 2KYMA 3G6EQ 3JCMW 1M1GA 1H8KA 3NPFA 1SEMA 4N0AA 3JCMf 3MPUB 1NEBA 1LJOA 1Y07A 4C8QC 1WZOA 5A2QE 3X28B 1AWJA 1ZA2B 2OAUA 5GAOm 2LNHB 2JZ2A 3H0FA 3EHRA 2QQSA 4OGEA 2EKHA 5D7UA 2DQ0A 1Z9ZA 4A4EA 5GMKl 5FRMA 4M77G 1B7TA 2C0IA 2O4XB 3HFOA 3G71A 2DEUA 1B3QA 1X6BA 3QWYA 1U3OA 1OX9A 2A7YA 2QTXA 3I56T 3CCQT 1K8AU 2D8HA 1N5ZA 3TREA 1QMCA 2QQBA 4XAXB 1VQ8T 1VQMA 4IUTA 4JZ4A 3JB9F 2GTOA 1YHQQ 1J3TA 2DIGA 4OB1B 3TEEA 3HXUA 3FB9A 3GOXA 2CUBA 4KBMB 4M7DA 2P4TA 4AFQC 1W2BA 5D6XA 1Y7XA 2K4YA 5LJ5f 2K5FA 3JCMc 3L2RA 1YJNA 4UP9A 4EMKC 2DL3A 3QIIA 3BY7A 5GAN3 4TVYA 2KR3A 1TTHB 1IGUA 4LN2A 2NUTA 1QCFA 4JRKA 2C0OA 3QYHB 1CKAA 4H2UA 3A8HB 3G71Q 1WU7A 1ZX6A 4CC4B 1YJNT 3M0TA 4LE9A 2QEXA 1ASZA 1D0XA 4J6YA 5ELOA 2XDBA 4LNPA 2AKKA 1X2QA 1XJWB 2PVGB 2CH4A 1OQKA 5GMKe 4CRIA 3LC0A 2XICA 1WHLA 1N9WA 2PUOB 3KFUA 4ZTUB 3M0RA 2KXCA 1F1BB 3QO3A 2JM9A 4OB0B 4Y28E 2DBKA 4TVRA 1VQLQ 2QG9B 3MQZA 2ZT8A 4LVJA 1PCXA 3GNGA 1RAFB 2EL9A 2KSSA 3IG2A 4M77C 3NEMA 2QEXQ 3PVQA 3O8VA 1B34B 3I9QA 3SWNB 1BBUA 2BE9B 3L42A 3QWXX 3VJPA 2WACA 4A63B 2E5AA 2JNGA 4M7AE 3EFRA 1WXUA 4O2DA 1TXQA 1KD1U 1QVFA 2MMPA 2CSIA 4M7DF 1NYFA 4M78G 1NJ5A 2ZPIB 3CXCS 5F5WA 4QQDA 2EWNA 1SG5A 3CCSQ 1VYTA 1JB0E 2QK0A 4RG8A 1ABOA 1BI3A 2KGTA 4DBFA 2RHQB 1BI0A 4N4IA 2KRNA 2DVJA 4LDWA 5KYYA 1Q86R
chains in the Genus database with same CATH topology
2KAFA 2E5QA 4LD9K 4P3OA 4MZMA 2LT1A 3I55A 4C5GA 2ZPBB 4M75G 4F7UF 2ZZDA 4HWSA 2GCXA 3H6ZA 1NJ2A 1H4TA 4AH6A 5GAN5 3X26B 4EMKA 1M1FA 3A5ZB 2K5IA 4A4KA 4C0ZA 3HXZA 1OZ3A 1S72A 4P71C 2F5TX 2XKOC 4LVLA 3MHXA 5LJ5g 2KQWA 5GAMd 4B9XA 2FHDA 3UWNA 5CKBA 1B34A 4QW2A 5C0MA 2CIMA 4YRCA 1X75C 2V8IA 3NELA 4PJOG 2E6NA 3MP6A 3OYFA 2XGTA 5GAN7 2KY9A 4UP7A 3HXVA 1USYC 1H4SA 12ASA 4J15A 3VQYA 4A54A 4P73C 1H4VB 2CZ6B 3VYGA 1EQRA 3OYBA 1N9RA 1B7YB 4C5EA 3RMSA 4WI1A 4Y91A 2IVWA 4Q5WA 3RF1A 3X20B 3OYIA 2Y90A 2L8DA 1TH7A 4ZN3A 4PJOD 3JCMg 4YRPA 5GAMf 1W2BS 3CCLA 4M77E 4FT4A 3QNEA 1X2GA 4H2XB 4LNSA 3QUIA 3ZEHA 4F7UG 2ZPEB 4XU0A 1VQ8A 2K3YA 4UC4A 5GAOn 3JB9H 3CPWA 3LGLA 3CCUT 4PJOB 4JJNK 3M54A 3E9GA 4BB7A 2ZNJA 3HXYA 1NJIU 1KQSA 4H2XA 3VQWA 2R58A 2RK2A 1VQLT 1QE0A 3RESA 3HFNA 1NJ6A 3OSVA 1Y96A 3HXWA 4E47A 2P0KA 3FC3A 2QDYB 1NJ8A 2KDSA 3A31A 2X35A 3JCMP 2ZZEA 3A7UA 1NJ1A 4E7JA 4PLIA 4KUDK 1PYSB 3PIOA 1Z7NA 2EAYA 4RMFA 3S3NA 2DD5A 3CPWS 1KQ1A 1WNLA 5CQXA 1XOVA 3TU4K 1VQ9A 3CCQA 3QJ6A 5GAOq 4P72C 4J83A 4K88A 3G6ET 3CBOA 4XTXA 5LJ5d 5GAMg 3MEWA 2LQ8A 4A4GA 2ZPGB 2CGHA 4M78B 5LJ5e 3M4GA 4UP8A 3OB9A 1X55A 1K8AC 5FU6B 1I8FA 3GLXA 4D6WA 4KULA 2C06A 3A74A 1SSFA 1JBMA 5HK3A 3M5AA 3MP8A 2E1HA 3CCRA 2DIQA 5CIUA 1K9MU 4ME7A 4ZTJA 3X25B 3OS1A 4OP0A 3JCMh 3CC7T 2ZR3A 2DEQA 3G4SA 2XD0A 2XDPA 5GAOp 4IUUA 5KE2A 2AKWB 3CC2A 2NLUA 4RCBA 2PMEA 3L4GA 4IUVA 3C94A 3JCMe 3KXTA 2RI5A 2HQXA 4YCUA 2RHYA 4BDZA 2Y4XA 1O75A 4XK8E 3PMIA 2VC8A 4M7AG 3OYEA 4PNOA 2I4OA 4DA4A 4YROA 4YRQA 4M78E 4A4FA 1K73U 2RHQA 4XTUA 1USYA 1H4QA 4C92A 1NJIC 4EMHA 5GAN8 5LJ5h 3QG1A 1PYSA 4C5IA 3WXMB 4P73A 2RM4A 4YRSA 1QVGS 4R55A 3PGGA 4X5OA 3PTAA 3L2QA 3MCAB 1W66A 3M56A 1NPPA 4M75E 5A0LA 5I2MA 4HA8A 3CC7A 3JB9G 4HCCA 2LCCA 3G1ZA 5J26A 4VUBA 4BACA 1X56A 2LNVA 4UPAA 3QYGB 1VQ7T 1Z7MA 2EYQA 2Q7GA 2IY5B 5A0DA 4M75F 4E7KA 4L59A 2EJGA 1EIYB 2DVEA 1WJQA 2PU9B 3TEHA 3DLMA 3WVEB 4PJOE 3A8OB 3WVDB 2JVVA 3OYNA 2ZIMA 3HPWA 5EG2A 2ZZGA 5GMKj 3A7RA 2JTMA 4JUVA 5I21A 3DB3A 2DAQA 3ZFJA 2DZ9A 3QO7A 4CH6A 5I2SA 2D0QB 3META 4XQ3A 1FXXA 4C92F 4P3PA 2RK1A 1N8RU 3MEYA 2GFAA 4NCXA 2QHSA 2P0PA 1Q81U 2I4LA 5LJ3j 4GLKA 4P71A 2K3XA 2YRVA 3PNWC 3FIFA 5GAN4 1SESA 4C0GA 4DOWA 2XIDA 3UT1A 3QJYA 4IUPA 1X01A 3QZ9B 3RUXA 2P5IA 3V7CA 4C8QE 3CCJT 2O01E 4OF1A 2DPPB 3M4PA 3CD6T 2XTIA 3WQZA 4TQFA 1G3YA 2RI3A 3OSSC 4II1A 3QDRB 3V8LA 2JOYA 4LVKA 2XDDA 3J7AF 3PZCA 4L87A 1WQWA 1Y71A 3HFZB 1RIQA 3MF1A 1LOJA 2DO3A 1VQ4T 1WPYA 3QO5A 2AHJB 3VUBA 4OLFA 2MI6A 4RQFA 1GGMA 4L5GA 2Y4YA 2DTHA 2I2LA 1K9MC 2PVOB 1VQ6A 2ALYA 1N8RC 3E9IA 2WSCE 4JDSA 4XU1A 1BYMA 4M77B 2H3JA 4TVAB 2EQMA 1BI2A 4WF2A 4K86A 3CMAT 3HRUA 3HL8A 3SDZA 3QXEB 2R5AA 2RH2A 3BDUA 3NFCA 3BJUA 1YITT 3OD1A 2C8MA 3JB9I 1E22A 1VQZA 3A7AA 4C92C 3RERA 2ARUA 1O9SA 1QF6A 2F5KA 3HHTB 3INZA 3RACA 4LDUA 1XNIA 1G5IA 4EX5A 4O5VA 3CPFA 3QKJA 3L4GB 4M7DC 2DXBA 2AKWA 3PIPA 3M59A 4EPCA 1VQ9T 4P72A 1X6OA 1KHCA 5L8RE 1PSFA 3RGLA 1B7YA 3H8ZA 1J5WA 4BE2A 5CCAA 2A3LA 4CH4A 3E9FA 3HRTA 3M55A 2DZCA 3RKYA 11ASA 4HWPA 4BWAA 1EIFA 3FLGA 1JJ2S 2GF7A 1OZ2A 2X4YA 4E7LA 1YFSA 4M78C 3JAME 3URGA 3CMAA 3RL6A 4BY6B 5GAN6 4CI0C 3M4YA 5LJ3g 1V29B 1VQ6T 1WJSA 3CCUA 1SETA 3EAEA 3HFZA 1BBWA 1VQOA 4M7AA 1KD1C 3DSQA 3AHUA 2LRQA 1VUBA 3A5ZA 3UH0A 3OYDA 3UPUA 4PHCA 2CS7A 2RHSA 2CYZB 4CS2A 3CC2T 1XTDA 5FU7C 1VIEA 4TQDA 2HAXA 4BI3A 5LJ5j 3CCVA 2LVMA 2V8JA 2Q7EA 3FRNA 3P8VA 2E65A 2DXTA 3CCRT 4KT0E 5K1XA 1U1TA 3TUPA 1QP2A 4GY5A 2F69A 4C92E 3CBMA 5CKFA 2ZGWA 1KQ2A 5GANf 1EVLA 3CBPA 1M4ZA 1YHQT 1KG1A 1IL2A 1M8VA 4P5NA 3PFSA 1UGSB 2PQWA 1S72T 1XQHA 5GAMe 3LGFA 3M53A 3L2ZA 2JN0A 4YRJA 4KQEA 2HQEA 4PJOF 3JCMX 3OYKA 3OS5A 3CMQA 1I5LA 2QQRA 3QHSA 3NENA 1EVKA 1L0WA 3OYAA 2EIFA 5GMKm 2QXFA 1OYXA 2EFIA 3L2VA 3RIRA 3LSSA 2RB6A 2ZPFB 5GAMj 1VIFA 2K2VA 2QHUA 3A5YA 5C52B 5IN1A 3SB2A 3GNFB 5GAMh 1Q81C 2RI2A 4CS3A 2CZ7B 3PCOB 4E7IA 1AHJB 1Q86U 5KCHA 4P75C 1H641 1NE8A 2Q5HA 4TTVA 1PSEA 4C5HA 3CC4T 4C8QG 3EFSA 5AYFA 4M7DD 1VQ4A 1ATIA 3QSUA 4XEMA 3MP1A 5CK9A 4LVIA 3JCMb 4HT8A 2ZPHB 2HBPA 2HD0A 2DQ3A 4H2VA 1YGBA 4HVCA 5IAYA 1VQ7A 4N4GA 3GIBA 1YJWT 1G5HA 3OMGA 1BI1A 5DLQE 5LJ3e 3V7SA 1YHQA 1G3TA 3HXXA 4L6V5 4N4HA 1UEBA 1M9SA 2ZCEA 2QEXT 1UGQB 3A32A 2ZT6A 2E12A 1HC7A 3J81E 4HWRA 4BDYA 4BI4A 3V7RA 1D3BB 1VQNT 1ADYA 4YDQA 3R6OA 4YRGA 1MHNA 4KUIA 2VV5A 4HWTA 1B76A 4EO4A 1X2HA 3RMQA 4M75D 5LL6S 2L3RA 1SRYA 4BI8B 2FVUA 2CJ9A 5LJ3f 5KE3A 4FM4B 1YI2T 4XEOA 3VV0A 1G3WA 2VXEA 1FX7A 4MMKA 1WJRA 4Z02A 4JLGA 4WJ3M 3MEVA 1Q82C 2EQJA 1I81A 3TCJA 2CZ1B 5CVIA 3VKIA 5GAN2 5D6WA 1WYDA 4YREA 1KHIA 3QO8A 4ZIBA 3OYHA 1QVFS 2EKOA 3IALA 4LDYA 4H2TA 3OMCA 4G84A 2AMCB 4LVMA 2EJ9A 5D6YA 4ZGEB 3OS2A 4CH3A 2DD4A 1NYRA 4ZGDB 4RCCA 4TWAA 2CZ0B 2DJZA 3REXA 3JCMV 2NS6A 5DY9A 3L2UA 3S3OA 3VU3C 2YLCA 3ASKA 1N9SA 1YITA 3JCMd 2PUKB 2DK3A 4J6WA 3LWIA 4BE0A 3OQ5A 5GANg 2ZTGA 3CCEA 3HP9A 2M1HA 1ADJA 2QHTA 5HK0A 2D6FA 4XU2A 3ERRA 5FLXE 1ASYA 4FL6A 3ICAA 1EFWA 1M90U 3CCJA 1M5Q1 3CMET 1M90C 5C53B 4H2SA 4M77F 3P8DA 4CS4A 2KVQG 2K57A 3BFMA 4TVWA 4WJ4A 5J39A 1YB3A 4F7UB 4XU3A 3JSCA 1WQ7A 3UFGA 4PG3A 4M77D 5GAOr 1QVGA 5E3IA 3HRIA 5A0GA 2OTLT 3PT9A 3LH0A 2QA4A 1VQMT 1YJWA 4EDUA 3FDRA 3QPHA 3E1SA 5FU6C 3VQXA 1NZ9A 4J5YA 3JB9D 1N6AA 2D9TA 5KNNA 3CCLT 5HY6A 1VQKA 4FIBA 4LDXA 2X4XA 5LJ3h 4QVDA 4FSXA 5FU7B 1ZHIA 1EOVA 3SWNC 4QQGA 5J3BA 4JS4A 2ARTA 2G4CA 2E10A 1BIAA 2I4MA 2ZT7A 3G6EA 2Q5IA 4X9DA 1B70B 3NTKA 2LCLA 5CAIA 2O4XA 5GANd 3OW2A 2BIVA 5FROA 4ELZC 1YJ9A 4M75C 3JRZA 2OTJT 3A8MB 1QW1A 4M7DG 4C8QF 5GAOl 4YYEA 3X24B 2WSEE 4JRPA 4X9CA 5CO7A 2E64A 2JUFA 3MO8A 3P8YA 2IY5A 2VXFA 3DKMA 2RJFA 2CJBA 3HRKA 4ATOA 4OB2B 4CH5A 1KMNA 1VQKT 4JS5A 3GP8A 2ZT5A 1FYFA 4PJOC 2DKGA 1B8AA 1ZQ1A 4XTVA 3UGQA 4JLIA 4M78D 3FJPA 1DJ7B 3L2WA 1VQ5A 2MWPA 4HWOA 4P74A 1NNHA 2G3RA 4M7AF 3PCOA 5DM7R 5ELNA 2PVDB 2KK4A 1KMMA 1KOGA 3VQVA 1H3ZA 3CEYA 1YI2A 4NL3A 1VQ5T 2AMCA 2GFUA 3CMEA 5GMKi 3RKWA 4M7AC 2VGNA 3Q1JA 3OYMA 4YRRA 3A8GB 1B70A 2JTFA 4NL2A 4Q6GA 1QP3A 3OBWA 4A53A 1YFTA 5LJ3d 1FWZA 4YCWA 3CD6A 4YRFA 2E3CA 4ELYC 2MAMA 4OVAA 4C8QB 2IG0A 4YRMA 3VUZA 4NOYA 5C51B 4A4HA 2MF2A 3QBYA 2RJDA 1WLEA 2YLBA 2RHIA 5CR2A 4OGCA 3E19A 4ZGJB 3M57A 4HKEA 2ZXFA 2V8KA 1HK9A 3C95A 3BW1A 4R56A 3CCST 1VQOT 2ZR2A 4P3NA 2QQ9A 4G85A 2OTJA 1YJ9T 3ER0A 2A8EA 2ZINA 4J8OA 2X4WA 4M78F 2RJEA 4O6JA 4F7UE 2X4JA 2PMFA 4YRIA 3I56A 3DLLA 4BE1A 1UB4A 5M9OA 4EMGA 1Q82U 3M58A 1VQPT 3N5BB 2LDMA 3GPLA 1K73C 3P8HA 3TEGA 4M7DB 4KR3A 3P8TA 1LYLA 4H2WA 2ZCFB 2B8AA 4C92G 4IURA 2I4NA 2M16A 3QTCA 4YP0A 3HKSA 2L89A 4C0DB 4ZN1A 2LX9A 4LD6A 1ZBXA 3NTIA 1R8OB 1G3SA 3VYHB 1Q7YU 2CJAA 2VGMA 3S6WA 4J6XA 4C8QD 5HGQA 3CCMT 1IZ6A 1VQLA 2FB7A 3KBGA 2XK0A 4RMOA 1M1KU 3DB4A 3C12A 2RD1A 4YTLA 2M9UA 1BIBA 2ALYB 1Y96B 2J3MA 4J7IA 1BKBA 4MMLA 3HTZA 4PL6A 5CKEA 3VBBA 5KCOA 4MZTA 3CCSA 3LX7A 1E1OA 2ARSA 1RI0A 3M4QA 1JJ2A 2CKKA 4M7DE 1HXDA 2BUDA 1U8RA 2RA2A 4BD3A 3SFMA 2LTOA 2RO0A 4H2YA 5GANh 1NYQA 1MGQA 4E7HA 2RHUA 3ME9A 4JRQA 3JCMJ 3UDCA 3W3SA 2LC4A 2WSFE 4RKUE 3OBYA 2GQVA 2MWOA 3LLRA 3HFVA 4E51A 2DU5A 5CQYA 2XHCA 3CCET 4RDXA 2ZNIA 2DTOA 3V8JA 2QA4T 4P74C 2OTLA 5HKCA 4XTYA 3OA6A 1EIYA 3FEOA 4PLLA 3T9NA 2RJCA 4LDVA 1Q86C 3V8KA 4MDXA 4YRNA 4OMFB 2QQAA 3SD4A 3CC4A 2HNIA 4ZTFA 4IKFA 2K5LA 1QVPA 3RKXA 3OY9A 3M9QA 2ZIOA 2QHVA 3G7ZA 4YPFA 4BW9A 4M7AB 2DU7A 4BY6C 3KUFA 3CCMA 3L1AA 1G5VA 5FRNA 2J3LA 1YCYA 4HT4A 3SWNA 4M7AD 3JB9J 1RL2A 5DLOA 1Q7YC 1G51A 1OI1A 5CKHA 4EMKB 3REUA 3R07A 4YRLA 4M78A 3J80E 4FU6A 3HSBA 2FL7A 2FYKA 1HTTA 1SERA 3LW5E 2DDZA 4C0DC 4P75A 2P0LA 2DXUA 1U1SA 2ZZFA 2RHSB 4QQ6A 4ZTZB 4QVCA 2VUBA 3IKMB 4TVAA 4HT9A 2DTIA 2E6ZA 2RHXA 2E41A 4M75A 2M0OA 4XTZA 2QI2A 2VYTA 1E24A 4Q15A 1YFRA 1LNXA 3MF2A 3I7FA 3F70A 1X54A 4B9WA 4H02A 3OYGA 1W4SA 1KC8U 2EJFA 4XTWA 1C0AA 3QZ5B 3OYJA 3OYLA 2ODRC 1NPRA 2E70A 5GMKh 3CCVT 5C6SA 3ZBDA 4J7FA 1YIJA 1VQNA 4MDWA 2XI9A 1YBYA 1VQPA 2LQKA 1WGSA 4NS5A 3HY0A 3LYIA 3JCMQ 2R57A 3LSQA 4PJOA 3P8BB 4DQ2A 4IUQA 3PMTA 4M77A 4YCVA 4MZPA 4DOVA 1UGRB 4RQEA 4KR2A 3CXCA 1KC8C 5GANe 3A8LB 4RG2A 1JRIA 3MEAA 4N0AC 1IREB 3G71T 2EQKA 1KQSS 1YIJT 4YRKA 1D3BA 3LWHA 1UGPB 4C0FA 1M1KC 2YHTA 3TEHB 4QVZA 4X34A 5GANj 4JRIA 4YRTA 3IKLA 4OB3B 5KH6A 4FT2A 3HRSA 4V2SA 1JJCB 2BKDN 3UGTA 2EQUA 3OYYA 4C92D 5K1PA 2KMTA 2DXCA 4C8QA 1GXIE 2ODRD 5CKDA 3HY1A 2RHZA 4BUGA 3C4SA 3BDLA 2P0QA 3S3MA 3MEUA 2C7IA 1JJCA 4HCZA 3OYCA 4K87A 3G4ST 3GF5A 4PKCC 3OW2S 4M75B 3NTHA 4C92B 3OS0A 1P92A 4HCBA 2XG8D 4F7UA 2R5MA 3NETA 2L5QA 2LT4A 3I55T 3E9HA 1I4K1 1E1TA 2XU8A 4DPGA 1N27A 2Q7HA 5IT9E 3JCMW 1M1GA 4N0AA 3JCMf 1LJOA 1Y07A 4C8QC 5A2QE 3X28B 2OAUA 5GAOm 2JZ2A 2QQSA 4OGEA 2DQ0A 4A4EA 5GMKl 5FRMA 4M77G 2O4XB 3HFOA 3G71A 2A7YA 2QTXA 3I56T 3CCQT 1K8AU 3TREA 2QQBA 4XAXB 1VQ8T 1VQMA 4IUTA 3JB9F 2DIGA 4OB1B 3TEEA 3HXUA 3FB9A 3GOXA 4KBMB 4M7DA 2P4TA 1W2BA 5D6XA 1Y7XA 2K4YA 5LJ5f 2K5FA 3JCMc 3L2RA 1YJNA 4UP9A 4EMKC 3QIIA 3BY7A 5GAN3 4TVYA 4JRKA 3QYHB 4H2UA 3A8HB 1WU7A 1YJNT 2QEXA 1ASZA 4J6YA 5ELOA 2XDBA 2PVGB 5GMKe 4CRIA 3LC0A 2XICA 1N9WA 2PUOB 3KFUA 4ZTUB 3QO3A 4OB0B 4Y28E 4TVRA 3MQZA 2ZT8A 4LVJA 3GNGA 2EL9A 2KSSA 3IG2A 4M77C 3NEMA 3O8VA 1B34B 3SWNB 1BBUA 3L42A 3VJPA 2WACA 2E5AA 2JNGA 4M7AE 3EFRA 4O2DA 1KD1U 1QVFA 2MMPA 4M7DF 1NJ5A 4M78G 2ZPIB 3CXCS 5F5WA 4QQDA 2EWNA 1JB0E 4RG8A 1BI3A 2RHQB 1BI0A 4N4IA 4LDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7C A;  4C8Q E;  3QO8 A;  4P3O A;  4ZIB A;  3HFV A;  4E51 A;  3M4P A;  2DU5 A;  2XTI A;  3IAL A;  3WQZ A;  4TQF A;  4H2T A;  4G84 A;  4M75 G;  4F7U F;  4RDX A;  2AMC B;  4HWS A;  2ZNI A;  2EJ9 A;  2DTO A;  3V8J A;  1NJ2 A;  4P74 C;  3V8L A;  1H4T A;  4AH6 A;  4XTY A;  1EIY A;  5GAN 5;  3PZC A;  4EMK A;  4L87 A;  1WQW A;  3HFZ B;  4CH3 A;  1RIQ A;  1NYR A;  4RCC A;  3HXZ A;  3MF1 A;  1LOJ A;  4TWA A;  3V8K A;  2DJZ A;  3REX A;  4P71 C;  1WPY A;  3QO5 A;  4YRN A;  3JCM V;  5DY9 A;  5LJ5 g;  5GAM d;  2HNI A;  3VU3 C;  4OLF A;  2YLC A;  1B34 A;  1N9S A;  4RQF A;  1GGM A;  3RKX A;  3JCM d;  2CIM A;  4YRC A;  2ZIO A;  3NEL A;  4PJO G;  4J6W A;  2QHV A;  2XGT A;  2DTH A;  2I2L A;  5GAN 7;  4UP7 A;  4YPF A;  5GAN g;  4BW9 A;  2ALY A;  3HXV A;  4M7A B;  1USY C;  2DU7 A;  3E9I A;  1H4S A;  12AS A;  2ZTG A;  4XU1 A;  4J15 A;  4M77 B;  4TVA B;  1ADJ A;  3L1A A;  2QHT A;  4WF2 A;  2J3L A;  4K86 A;  3VQY A;  4A54 A;  4P73 C;  4XU2 A;  3ERR A;  1H4V B;  1YCY A;  1ASY A;  3SWN A;  3ICA A;  1EFW A;  4M7A D;  3JB9 J;  1EQR A;  1M5Q 1;  5C53 B;  1N9R A;  1B7Y B;  3BDU A;  1G51 A;  3BJU A;  4EMK B;  4H2S A;  3REU A;  4M77 F;  3R07 A;  4WI1 A;  4Y91 A;  4YRL A;  4CS4 A;  3OD1 A;  3RF1 A;  4M78 A;  2K57 A;  2Y90 A;  3BFM A;  2C8M A;  3HSB A;  3JB9 I;  1E22 A;  4TVW A;  4WJ4 A;  1TH7 A;  1VQZ A;  3A7A A;  4C92 C;  3RER A;  1YB3 A;  2ARU A;  2FYK A;  1HTT A;  4PJO D;  1SER A;  4F7U B;  3JCM g;  2DDZ A;  5GAM f;  4YRP A;  4XU3 A;  4P75 A;  1WQ7 A;  4M77 E;  4PG3 A;  3UFG A;  1QF6 A;  2P0L A;  3QNE A;  2DXU A;  1X2G A;  4M77 D;  5GAO r;  3INZ A;  3RAC A;  1U1S A;  2ZZF A;  1G5I A;  4H2X B;  2RHS B;  4EX5 A;  4ZTZ B;  4LNS A;  3QUI A;  4F7U G;  4QVC A;  5E3I A;  3L4G B;  3HRI A;  4M7D C;  3IKM B;  4TVA A;  4HT9 A;  2DTI A;  2AKW A;  4XU0 A;  5GAO n;  2E41 A;  4M75 A;  1E24 A;  4XTZ A;  3JB9 H;  4P72 A;  4Q15 A;  3VQX A;  1YFR A;  4J5Y A;  3JB9 D;  4PJO B;  3RGL A;  1LNX A;  1B7Y A;  2ZNJ A;  3HXY A;  3VQW A;  5KNN A;  4H2X A;  3MF2 A;  1J5W A;  3I7F A;  1X54 A;  1QE0 A;  3RES A;  3HFN A;  1NJ6 A;  4H02 A;  4CH4 A;  1Y96 A;  2DZC A;  3HXW A;  3RKY A;  5LJ3 h;  4QVD A;  11AS A;  4HWP A;  4BWA A;  2EJF A;  4XTW A;  1C0A A;  1EOV A;  3SWN C;  1NJ8 A;  3A31 A;  2ODR C;  5GMK h;  1YFS A;  3JCM P;  4M78 C;  2ART A;  2G4C A;  3RL6 A;  2E10 A;  2ZZE A;  3A7U A;  1NJ1 A;  3HY0 A;  5GAN 6;  1BIA A;  1PYS B;  2I4M A;  2ZT7 A;  3JCM Q;  3LSQ A;  4PJO A;  1Z7N A;  2EAY A;  2Q5I A;  4X9D A;  5LJ3 g;  1B70 B;  4RMF A;  4DQ2 A;  4M77 A;  5CAI A;  1SET A;  4YCV A;  1KQ1 A;  1WNL A;  3HFZ A;  5GAN d;  1BBW A;  4M7A A;  4RQE A;  4KR2 A;  3DSQ A;  3AHU A;  5GAN e;  5GAO q;  3A5Z A;  4YRE A;  3UH0 A;  4M75 C;  4P72 C;  4PHC A;  4M7D G;  4C8Q F;  5GAO l;  4K88 A;  2RHS A;  4YYE A;  4CS2 A;  4XTX A;  4X9C A;  5LJ5 d;  1JRI A;  5GAM g;  4N0A C;  4TQD A;  2E64 A;  5LJ5 j;  4YRK A;  3P8Y A;  2IY5 A;  2CGH A;  4M78 B;  1D3B A;  2Q7E A;  5LJ5 e;  2VXF A;  3M4G A;  3P8V A;  4UP8 A;  2YHT A;  3TEH B;  2CJB A;  1X55 A;  3HRK A;  2E65 A;  2DXT A;  4CH5 A;  1KMN A;  5GAN j;  1I8F A;  4JRI A;  4YRT A;  5K1X A;  3A74 A;  3IKL A;  1U1T A;  1JBM A;  3TUP A;  2ZT5 A;  1FYF A;  4PJO C;  2DKG A;  1B8A A;  4C92 E;  4V2S A;  1JJC B;  1KQ2 A;  2ZGW A;  3UGT A;  2E1H A;  5GAN f;  4C92 D;  1EVL A;  5K1P A;  4XTV A;  4C8Q A;  3UGQ A;  4JLI A;  2ODR D;  1IL2 A;  1M8V A;  4OP0 A;  4M78 D;  3JCM h;  3FJP A;  3HY1 A;  2ZR3 A;  2DEQ A;  5GAM e;  5GAO p;  4HWO A;  2C7I A;  4P74 A;  1JJC A;  4K87 A;  1NNH A;  3L2Z A;  4M7A F;  3PCO A;  2AKW B;  5ELN A;  2JN0 A;  4RCB A;  2PME A;  3L4G A;  4YRJ A;  4M75 B;  4KQE A;  4C92 B;  1KMM A;  4PJO F;  3JCM X;  1KOG A;  3VQV A;  3JCM e;  3CMQ A;  1I5L A;  4YCU A;  4NL3 A;  3QHS A;  2AMC A;  3NEN A;  4F7U A;  5GMK i;  1EVK A;  3RKW A;  3NET A;  1L0W A;  4M7A C;  5GMK m;  2VC8 A;  3E9H A;  1I4K 1;  4YRR A;  1E1T A;  3RIR A;  3LSS A;  1B70 A;  2RB6 A;  5GAM j;  2QHU A;  4M7A G;  4NL2 A;  4PNO A;  2I4O A;  3A5Y A;  4Q6G A;  3SB2 A;  4YRO A;  4DPG A;  5C52 B;  4A53 A;  1YFT A;  2Q7H A;  4YRQ A;  5LJ3 d;  4M78 E;  5GAM h;  4YCW A;  2RHQ A;  4YRF A;  3JCM W;  2E3C A;  4XTU A;  1USY A;  4N0A A;  1H4Q A;  4CS3 A;  3JCM f;  4C92 A;  4C8Q B;  1LJO A;  4EMH A;  5GAN 8;  5LJ5 h;  1PYS A;  4YRM A;  4C8Q C;  4NOY A;  3PCO B;  5GAO m;  5C51 B;  4P73 A;  4P75 C;  1WLE A;  1H64 1;  2RM4 A;  2YLB A;  2Q5H A;  4TTV A;  2DQ0 A;  4YRS A;  5GMK l;  4C8Q G;  3EFS A;  3PGG A;  4X5O A;  4M7D D;  1ATI A;  4M77 G;  3QSU A;  4XEM A;  1W66 A;  3JCM b;  4HT8 A;  3HFO A;  2ZXF A;  4M75 E;  1HK9 A;  2DQ3 A;  2QTX A;  3BW1 A;  4HA8 A;  4H2V A;  1YGB A;  4HVC A;  3JB9 G;  2ZR2 A;  4P3N A;  3GIB A;  1G5H A;  4G85 A;  5LJ3 e;  3G1Z A;  3V7S A;  3JB9 F;  2ZIN A;  1X56 A;  4M78 F;  3HXX A;  4UPA A;  4F7U E;  1Z7M A;  2PMF A;  2ZCE A;  4YRI A;  2Q7G A;  2IY5 B;  3HXU A;  3FB9 A;  4EMG A;  4M75 F;  4M7D A;  3A32 A;  3TEG A;  2EJG A;  2ZT6 A;  4M7D B;  1EIY B;  4KR3 A;  3P8T A;  2DVE A;  1HC7 A;  1LYL A;  5LJ5 f;  4H2W A;  3JCM c;  3TEH A;  4HWR A;  4UP9 A;  4C92 G;  4EMK C;  3V7R A;  2I4N A;  1D3B B;  3BY7 A;  5GAN 3;  3QTC A;  4TVY A;  1ADY A;  4PJO E;  4YP0 A;  4YDQ A;  4YRG A;  4JRK A;  4H2U A;  1WU7 A;  4HWT A;  1B76 A;  2ZIM A;  2CJA A;  2ZZG A;  4EO4 A;  1X2H A;  1ASZ A;  4J6X A;  4J6Y A;  4C8Q D;  5GMK j;  3A7R A;  5HGQ A;  5ELO A;  4M75 D;  4JUV A;  2FB7 A;  5I21 A;  5GMK e;  2DZ9 A;  3LC0 A;  2RD1 A;  1N9W A;  3QO7 A;  4CH6 A;  4ZTU B;  3KFU A;  1BIB A;  2ALY B;  3QO3 A;  1Y96 B;  4XQ3 A;  2J3M A;  4C92 F;  1SRY A;  4P3P A;  2CJ9 A;  5LJ3 f;  3MEY A;  2ZT8 A;  4MML A;  4NCX A;  2QHS A;  3HTZ A;  4XEO A;  2EL9 A;  3IG2 A;  4M77 C;  2I4L A;  3NEM A;  3VBB A;  5LJ3 j;  1B34 B;  2VXE A;  4MMK A;  3SWN B;  1BBU A;  1E1O A;  2ARS A;  2E5A A;  4P71 A;  3M4Q A;  4M7A E;  3EFR A;  4O2D A;  4M7D E;  4WJ3 M;  4M7D F;  1NJ5 A;  1HXD A;  4M78 G;  3FIF A;  5GAN 4;  2RA2 A;  5F5W A;  1I81 A;  2EWN A;  4H2Y A;  5GAN h;  1NYQ A;  1SES A;  1MGQ A;  3JCM J;  3W3S A;  1X01 A;  5GAN 2;  2RHQ B;  3RUX A;  1WYD A;  2P5I A; 
#chains in the Genus database with same CATH topology
 2KAF A;  2CP7 A;  2E5Q A;  4LD9 K;  4P3O A;  4MZM A;  1SKU B;  2LT1 A;  3I55 A;  4C5G A;  2ZPB B;  4RTY A;  4M75 G;  4F7U F;  2CSQ A;  2ZZD A;  4HWS A;  2DNU A;  2AZS A;  2GCX A;  3H6Z A;  4FCY A;  1VQ9 Q;  1NJ2 A;  1H4T A;  4AH6 A;  5GAN 5;  3X26 B;  4EMK A;  1M1F A;  2NUZ A;  3A5Z B;  1D0Y A;  1K73 R;  2K5I A;  4A4K A;  1QCN A;  2DRM A;  2DJQ A;  4C0Z A;  3HXZ A;  1YWO A;  1OZ3 A;  1S72 A;  4P71 C;  2F5T X;  2XKO C;  4LVL A;  1UEC A;  1S72 Q;  3MHX A;  5LJ5 g;  2KQW A;  5GAM d;  4B9X A;  2FHD A;  3UWN A;  5CKB A;  1B34 A;  4QW2 A;  1X43 A;  3UA6 A;  5C0M A;  1TS9 A;  2CIM A;  4YRC A;  1X75 C;  2YXY A;  2V8I A;  3NEL A;  1GCQ A;  4PJO G;  2E6N A;  3MP6 A;  3OYF A;  1HSQ A;  2XGT A;  5GAN 7;  2KY9 A;  4UP7 A;  3HXV A;  1USY C;  1H4S A;  12AS A;  1RAC B;  4J15 A;  2HEQ A;  1QKW A;  3VQY A;  4A54 A;  2EQI A;  4P73 C;  2HDA A;  2LQN A;  1H4V B;  2CZ6 B;  2VAS A;  1NBE B;  3VYG A;  1EQR A;  3OYB A;  1N9R A;  1B7Y B;  4C5E A;  4PJL A;  3RMS A;  2QTV A;  4WI1 A;  4Y91 A;  2IVW A;  2CT4 A;  4Q5W A;  3RF1 A;  3X20 B;  3OYI A;  2Y90 A;  2W0Z A;  2L8D A;  1TH7 A;  4ZN3 A;  1BK2 A;  4PJO D;  3JCM g;  4YRP A;  5GAM f;  1W2B S;  3CCL A;  2KI7 A;  4M77 E;  4FT4 A;  3QNE A;  2X9H A;  1X2G A;  2D1X A;  5I11 A;  2OI3 A;  4H2X B;  1UDL A;  4LNS A;  1S1N A;  3QUI A;  3ZEH A;  4F7U G;  1T3L A;  2ZPE B;  2M0Y A;  4XU0 A;  1D1C A;  2FRW A;  2K3Y A;  4UC4 A;  5GAO n;  1VQ8 A;  4OMM A;  3JB9 H;  5FWC A;  1M1K R;  3CPW A;  1M8M A;  3LGL A;  1GCQ C;  3CCU T;  4PJO B;  4JJN K;  3M54 A;  3E9G A;  4BB7 A;  2ZNJ A;  3HXY A;  1NJI U;  1KQS A;  4H2X A;  3VQW A;  2R58 A;  1Q82 R;  2RK2 A;  1MMG A;  1VQL T;  1AZG B;  1QE0 A;  3RES A;  3HFN A;  1NJ6 A;  1ZA1 B;  3OSV A;  1Y96 A;  2YUO A;  3HXW A;  2PTK A;  4E47 A;  1X69 A;  2P0K A;  2OAW A;  2GGR A;  3UF4 A;  3FC3 A;  2QDY B;  1NJ8 A;  2KDS A;  3A31 A;  2X35 A;  3JCM P;  1Y0M A;  2EPD A;  2ED1 A;  3MJX A;  2ZZE A;  3A7U A;  1NJ1 A;  4E7J A;  4PLI A;  4KUD K;  1PYS B;  3EH1 A;  3PIO A;  1Z7N A;  2EAY A;  5KYU A;  1GBR A;  4RMF A;  3S3N A;  3CMA Q;  1TOV A;  2DD5 A;  3CPW S;  1KQ1 A;  1WNL A;  5CQX A;  1XOV A;  3TU4 K;  5HCK A;  1VQ9 A;  1WHG A;  3CCQ A;  2E3I A;  3QJ6 A;  5KYX A;  5GAO q;  2LJ3 A;  2J7I A;  4P72 C;  1QVG P;  3EGX A;  4J83 A;  4PFP A;  4K88 A;  3G6E T;  2DE0 X;  2F2W A;  3CBO A;  4XTX A;  1YIJ Q;  5LJ5 d;  5GAM g;  3MEW A;  2LQ8 A;  4A4G A;  5I22 A;  2ZPG B;  2YUP A;  2CGH A;  4M78 B;  3VS5 A;  5LJ5 e;  3M4G A;  4UP8 A;  3OB9 A;  2RPN A;  1VQK Q;  4PFZ A;  1X55 A;  1K8A C;  5FU6 B;  1I8F A;  4PFO A;  2JW4 A;  3GLX A;  4D6W A;  4KUL A;  5KYX B;  2C06 A;  3A74 A;  4ESR A;  1SSF A;  1JBM A;  5HK3 A;  3M5A A;  2VKN A;  3MP8 A;  2A08 A;  2E1H A;  1OX8 A;  3CCR A;  1ABQ A;  2DIQ A;  5CIU A;  2DBM A;  1TWB A;  1K9M U;  4ME7 A;  4ZTJ A;  3X25 B;  3OS1 A;  1KD1 R;  4OP0 A;  3JCM h;  1NM7 A;  3CC7 T;  2ZR3 A;  2KYB A;  2DEQ A;  3TSW A;  1Q7Y R;  3G4S A;  2XD0 A;  2XDP A;  5GAO p;  4IUU A;  4RUG A;  2E5K A;  5KE2 A;  1IHW A;  2AKW B;  2RN8 A;  3CC2 A;  2MYS A;  2NLU A;  4RCB A;  1WA7 A;  3CCQ Q;  2PME A;  3L4G A;  1SHF A;  3EH2 A;  4IUV A;  1M30 A;  2H3E B;  3C94 A;  3JCM e;  3KXT A;  4CC7 A;  2RI5 A;  1SF9 A;  2HQX A;  4YCU A;  1VOM A;  4J9G A;  2EYX A;  2RHY A;  1WFW A;  9ATC B;  1NG2 A;  4BDZ A;  2Y4X A;  4M4Z A;  1TUD A;  1O75 A;  1R0B G;  4XK8 E;  3PMI A;  3EG3 A;  1PNJ A;  2VC8 A;  1EX4 A;  1VQP Q;  4M7A G;  3OYE A;  4PNO A;  2I4O A;  4DA4 A;  4YRO A;  2JTE A;  4D8K A;  4YRQ A;  4AG2 C;  1NLP C;  4M78 E;  1M90 R;  4A4F A;  1K73 U;  2RHQ A;  2RMO A;  1GFD A;  4XTU A;  1USY A;  1H4Q A;  2LQW A;  1NEG A;  4C92 A;  1NJI C;  4EMH A;  2L0A A;  5GAN 8;  5LJ5 h;  3QG1 A;  1H92 A;  1PYS A;  3CC4 Q;  2DET A;  4C5I A;  3WXM B;  4P73 A;  2CP6 A;  2RM4 A;  4YRS A;  1QVG S;  4R55 A;  3PGG A;  4X5O A;  2Z0W A;  3PTA A;  3L2Q A;  3MCA B;  1YJN Q;  2ECZ A;  1W66 A;  3M56 A;  1NPP A;  2XMF A;  4M75 E;  5A0L A;  5I2M A;  4HA8 A;  1RI9 A;  3CC7 A;  3JB9 G;  4HCC A;  2LCC A;  1K4U S;  3G1Z A;  5J26 A;  4VUB A;  4BAC A;  1IGQ A;  2EVR A;  4OMN A;  1X56 A;  2LNV A;  2BE7 D;  4UPA A;  3QYG B;  3UA7 A;  1VQ7 T;  1Z7M A;  2EYQ A;  2Q7G A;  2IY5 B;  2LJ0 A;  5A0D A;  2P84 A;  4M75 F;  4ZNX A;  3VS3 A;  4E7K A;  4L59 A;  2DL4 A;  2EJG A;  1EIY B;  2DVE A;  1WJQ A;  3MKD A;  2PU9 B;  3TEH A;  1D0Z A;  3DLM A;  1B07 A;  3QDF A;  3VS7 A;  3WVE B;  4PJO E;  3A8O B;  3SHW A;  3WVD B;  2DM1 A;  2JMA A;  2JVV A;  3OYN A;  1ZUK A;  4JJC A;  7AT1 B;  3CXC P;  2ZIM A;  3HPW A;  5EG2 A;  4WTO B;  2ZZG A;  5GMK j;  3A7R A;  1W2B P;  2JTM A;  4JUV A;  5I21 A;  3DB3 A;  2EYW A;  2DAQ A;  3ZFJ A;  2X3W D;  2DZ9 A;  4E6R A;  3QO7 A;  4CH6 A;  2EBP A;  5I2S A;  2D0Q B;  3MET A;  4XQ3 A;  1FXX A;  4C92 F;  4P3P A;  2RK1 A;  4D8D A;  3CQT A;  1N8R U;  2O9S A;  1AEY A;  1GRI A;  3MEY A;  1AOJ A;  2GFA A;  1MMD A;  2P0P A;  2QHS A;  4NCX A;  5KYW A;  1Q81 U;  2I4L A;  5LJ3 j;  2A37 A;  2COY A;  2QYZ A;  4GLK A;  4P71 A;  2K3X A;  2YRV A;  4GLM A;  3PNW C;  3FIF A;  5GAN 4;  1FMV A;  8ATC B;  1SES A;  4C0G A;  4DOW A;  2XID A;  3UT1 A;  2E4H A;  3QJY A;  4IUP A;  1X01 A;  3QZ9 B;  1VQN Q;  2RQT A;  3RUX A;  2P5I A;  1RAB B;  1QKX A;  2VB6 A;  1NLO C;  3V7C A;  4C8Q E;  3CCJ T;  2O01 E;  1ZUY A;  4OF1 A;  2DPP B;  3M4P A;  3CD6 T;  2LP5 A;  2JXB A;  2XTI A;  3WQZ A;  4TQF A;  1G3Y A;  3VRY A;  2RI3 A;  1VA7 A;  1H3H A;  3OSS C;  3VS2 A;  4II1 A;  3QDR B;  3CPW P;  3A1P A;  1ZSZ B;  4FW2 A;  2DL5 A;  3V8L A;  2JOY A;  4LVK A;  2XDD A;  3J7A F;  4Z88 A;  3PZC A;  4L87 A;  1WQW A;  1UGV A;  1Y71 A;  4FYV B;  4AFU C;  4DEX A;  3HFZ B;  3RDV A;  3FJ5 A;  1RIQ A;  3MF1 A;  1LOJ A;  1ZSZ A;  2DO3 A;  1PWT A;  1VQ4 T;  1WPY A;  3QO5 A;  2A0F B;  2RQR A;  2AHJ B;  3VUB A;  4OLF A;  2MI6 A;  4F14 A;  1LCK A;  4RQF A;  2QGG A;  2V26 A;  1GGM A;  2FPF A;  4L5G A;  2Y4Y A;  1Z9Q A;  4PJM A;  1KSW A;  2DTH A;  2I2L A;  1K9M C;  2PVO B;  1QLY A;  1X2K A;  1VQ6 A;  2ALY A;  1N8R C;  1MMA A;  3E9I A;  1X6G A;  2WSC E;  1RAG B;  4JDS A;  5KYN A;  4XU1 A;  1BYM A;  4M77 B;  2H3J A;  4TVA B;  2EQM A;  1BI2 A;  3NGP A;  2DMO A;  4WF2 A;  4K86 A;  2L3Q A;  2K7A A;  4HVV A;  3CMA T;  3HRU A;  4RTX A;  3HL8 A;  3SDZ A;  3QXE B;  2R5A A;  2PNI A;  2SEM A;  2RH2 A;  3BDU A;  3NFC A;  3BJU A;  1UHF A;  1YIT T;  4HVW A;  1BB9 A;  3OD1 A;  1OPK A;  1FYN A;  4J9I A;  2KRM A;  2FO0 A;  2C8M A;  3JB9 I;  1E22 A;  1VQZ A;  3A7A A;  2GNC A;  1QWF A;  4C92 C;  3RER A;  2ARU A;  1O9S A;  4JJD A;  1QF6 A;  2F5K A;  3HHT B;  3INZ A;  2EGA A;  3RAC A;  4LDU A;  1XNI A;  1G5I A;  4EX5 A;  4O5V A;  3CPF A;  3QKJ A;  3L4G B;  1PKS A;  4M7D C;  2DXB A;  2LZ6 B;  1KJW A;  2AKW A;  3PIP A;  3M59 A;  4EPC A;  2YRC A;  1VQ9 T;  4P72 A;  2O31 A;  4E2F B;  1X6O A;  1KHC A;  1JXO A;  2D0N A;  5L8R E;  1PSF A;  3RGL A;  1W1F A;  1B7Y A;  3H8Z A;  4IIO A;  3CC2 Q;  1J5W A;  2HKQ B;  4BE2 A;  1UJY A;  5IXB A;  1KFZ A;  5CCA A;  2A3L A;  4CH4 A;  3E9F A;  3HRT A;  2P4R A;  3M55 A;  4KGZ B;  2DZC A;  5IXF A;  3RKY A;  11AS A;  4HWP A;  4BWA A;  1YNZ A;  1EIF A;  3FLG A;  1JJ2 S;  2GF7 A;  3VS6 A;  1OZ2 A;  2X4Y A;  4E7L A;  1YFS A;  4M78 C;  3JAM E;  2V1R A;  3URG A;  3CMA A;  3RL6 A;  4BY6 B;  5GAN 6;  4QT7 A;  4CI0 C;  1C6V X;  3M4Y A;  4DBQ A;  5LJ3 g;  3UAT A;  1V29 B;  1VQ6 T;  1WJS A;  5AT1 B;  3CCU A;  1PC0 A;  1SET A;  3EAE A;  2O9V A;  3I5S A;  3HFZ A;  1BBW A;  1VQO A;  4JZ3 A;  4M7A A;  2KE9 A;  3TVT A;  1KD1 C;  3M0U A;  4FYW B;  3DSQ A;  3AHU A;  2LRQ A;  1VUB A;  3A5Z A;  3UH0 A;  3OYD A;  3UPU A;  4PHC A;  4E7Z A;  4RTW A;  2CS7 A;  2RHS A;  2CYZ B;  4CS2 A;  3CC2 T;  1XTD A;  3EGU A;  5FU7 C;  2KT1 A;  1U06 A;  1VIE A;  3H41 A;  4TQD A;  2HAX A;  3CCL Q;  4BI3 A;  5LJ5 j;  2J6O A;  1YCS B;  3CCV A;  2LVM A;  1LPL A;  1AZE A;  2V8J A;  2Q7E A;  2DX1 A;  2PZ1 A;  1UE9 A;  1M3C A;  3FRN A;  3P8V A;  1G83 A;  2E65 A;  2DXT A;  2F2X A;  1UJ0 A;  2EYZ A;  3CCR T;  1T0H A;  1TU0 B;  4KT0 E;  5K1X A;  1RAA B;  1GL5 A;  1PM3 A;  1U1T A;  3TUP A;  4B6M A;  1QP2 A;  4GY5 A;  2F69 A;  2KNB B;  4C92 E;  3CBM A;  3JV3 A;  2ZGW A;  5CKF A;  1KQ2 A;  5GAN f;  1EVL A;  3CBP A;  1PHT A;  2JM8 A;  2DL7 A;  1M4Z A;  1YHQ T;  1VQ6 Q;  2RNA A;  4KH1 B;  1KG1 A;  1IL2 A;  1M8V A;  3HTR A;  2HL5 C;  4P5N A;  1RAH B;  1MUZ A;  3PFS A;  1UGS B;  2PQW A;  1S72 T;  1XQH A;  5GAM e;  3LGF A;  3M53 A;  5L23 A;  3L2Z A;  1TUG B;  2VVK A;  1AWO A;  2JN0 A;  4R0K A;  4YRJ A;  4KQE A;  2HQE A;  4PJO F;  3JCM X;  3OYK A;  3OS5 A;  3CMQ A;  1I5L A;  2QQR A;  3I55 Q;  2KXD A;  3QHS A;  3NEN A;  2DL8 A;  1OPL A;  1EVK A;  1L0W A;  3OYA A;  4PJN A;  1M2V B;  2EIF A;  5GMK m;  2QXF A;  1OYX A;  2EFI A;  3L2V A;  2FG0 A;  3RIR A;  3LSS A;  2RB6 A;  2ZPF B;  5GAM j;  1VIF A;  2K2V A;  2QHU A;  3A5Y A;  2LCS A;  5IN1 A;  5C52 B;  3SB2 A;  2J05 A;  2ED0 A;  1IXD A;  2DLP A;  3GNF B;  5GAM h;  1Q81 C;  1WHM A;  2HMA A;  2RI2 A;  4CS3 A;  4J9E A;  2CZ7 B;  1W6X A;  3PCO B;  4E7I A;  1AHJ B;  1Q86 U;  5KCH A;  1PRM C;  4P75 C;  1N8R R;  1H64 1;  4DBH A;  1NE8 A;  2Q5H A;  4C5H A;  1PSE A;  4TTV A;  3CC4 T;  1AD5 A;  4C8Q G;  3CME Q;  1WXB A;  2C0T A;  3EFS A;  5AYF A;  4M7D D;  1T0J A;  1VQ4 A;  1ATI A;  1EZZ B;  3QSU A;  1JU5 C;  1UHC A;  3MP1 A;  5CK9 A;  4XEM A;  3M0P A;  4LVI A;  3PVL A;  4J9C A;  3JCM b;  4HT8 A;  1K0X A;  4F16 A;  2ZPH B;  4CC2 A;  2HBP A;  2HD0 A;  2DQ3 A;  4H2V A;  4AG1 C;  1YGB A;  4HVC A;  5IAY A;  1VQ7 A;  4N4G A;  3GIB A;  1YJW T;  3I35 A;  3OMG A;  1G5H A;  1BI1 A;  5DLQ E;  5LJ3 e;  2HBW A;  3V7S A;  2HQH A;  1YHQ A;  1G3T A;  2KBT A;  3HXX A;  4L6V 5;  1YJW Q;  4N4H A;  2I0N A;  1UEB A;  1M9S A;  2ZCE A;  2CP3 A;  2QEX T;  2HZY A;  2J06 A;  1UGQ B;  3A32 A;  4AT1 B;  1NJI R;  2ZT6 A;  2E12 A;  2K3B A;  1HC7 A;  2DFU A;  1VYU A;  3J81 E;  2J6F A;  4HWR A;  4BDY A;  4BI4 A;  3V7R A;  1D3B B;  1QWE A;  2NUT B;  1VQN T;  2RQV A;  1ADY A;  4YDQ A;  3R6O A;  4YRG A;  1MHN A;  3LH5 A;  4KUI A;  2JJ9 A;  2QAZ A;  1ZBJ A;  2VV5 A;  4HWT A;  2HL3 A;  1ZUU A;  1B76 A;  1M27 C;  1MV3 A;  4EO4 A;  1X2H A;  3RMQ A;  4M75 D;  2DF6 A;  1R0C B;  1ZSG A;  5LL6 S;  1PG5 B;  2ROL A;  1JO8 A;  2L3R A;  4HVU A;  4F04 B;  3ULR B;  1SRY A;  4BI8 B;  2FVU A;  2CJ9 A;  5LJ3 f;  5KE3 A;  2AKL A;  1YJ9 Q;  4FM4 B;  1YI2 T;  4XEO A;  1ZSZ C;  1PRL C;  2LMJ A;  1G3W A;  2VXE A;  3VV0 A;  1FX7 A;  4MMK A;  1KC8 R;  1WJR A;  4Z02 A;  2CP2 A;  4JLG A;  2FEI A;  4WJ3 M;  3MEV A;  1Q82 C;  4ORZ A;  2EQJ A;  1OOT A;  1I81 A;  3TCJ A;  1WLP B;  4Z89 A;  2CZ1 B;  5CVI A;  3VKI A;  1KQS P;  3G4S Q;  2DIL A;  5GAN 2;  5D6W A;  1WYD A;  4YRE A;  4DEY A;  2EGE A;  3G1J A;  1KHI A;  3QO8 A;  1A0N B;  4ZIB A;  3OYH A;  2MOX A;  1QVF S;  2QDL A;  2EKO A;  3IAL A;  4LDY A;  4H2T A;  3OMC A;  4G84 A;  1K9A A;  2AMC B;  4LVM A;  2EJ9 A;  2HCK A;  1AWX A;  4KGV B;  5D6Y A;  2AK5 A;  2NUP A;  1M3B A;  3EG2 A;  4HXJ A;  2CRE A;  4AFZ C;  4ZGE B;  3EGX B;  3OS2 A;  4CH3 A;  2DD4 A;  1NYR A;  1T3S A;  4ZGD B;  5GJV B;  4RCC A;  2YUQ A;  4TWA A;  1AT1 B;  4JPB W;  1HJD A;  4QKU A;  2CZ0 B;  2DJZ A;  3TSZ A;  3REX A;  3JCM V;  2NS6 A;  5DY9 A;  3L2U A;  1PKT A;  3VU3 C;  3S3O A;  2D8J A;  2YLC A;  3ASK A;  1N9S A;  2SRC A;  1YIT A;  2EW3 A;  3JCM d;  2PUK B;  2DK3 A;  1LVK A;  4J6W A;  3GBQ A;  5IHN A;  3LWI A;  1QCO A;  4BE0 A;  3OQ5 A;  5GAN g;  2ZTG A;  2O88 A;  1MND A;  3CCE A;  3HP9 A;  2M1H A;  3CC7 Q;  1ADJ A;  2QHT A;  1CKB A;  2GQI A;  5HK0 A;  2D6F A;  1ZLM A;  4XU2 A;  3ERR A;  2IPO B;  5FLX E;  1ASY A;  4FL6 A;  3ICA A;  1EFW A;  3EFO B;  1M90 U;  3CCJ A;  2ESW A;  1M5Q 1;  3CME T;  1M90 C;  5C53 B;  2HSP A;  1RLQ C;  3EG9 A;  1YWP A;  2RF0 A;  4RTV A;  4H2S A;  4M77 F;  2MCN A;  3P8D A;  4CS4 A;  2KVQ G;  1RAD B;  2K57 A;  3BFM A;  3REB B;  6AT1 B;  4TVW A;  4WJ4 A;  5J39 A;  1YB3 A;  4FYY B;  4F7U B;  3EG9 B;  4XU3 A;  3JSC A;  2FPD A;  1WQ7 A;  3UFG A;  4PG3 A;  3E2U A;  2DYI A;  1K9M R;  4M77 D;  5GAO r;  1QVG A;  2X3X D;  5E3I A;  4OMO A;  3HRI A;  5A0G A;  2OTL T;  3PT9 A;  3LH0 A;  1E7O A;  2QA4 A;  1VQM T;  2M51 A;  2BZX A;  4JJB A;  2OJ2 A;  1YN8 A;  2QA4 Q;  1YJW A;  3RBB B;  4EDU A;  3FDR A;  3QPH A;  3E1S A;  5FU6 C;  3VQX A;  1NZ9 A;  3ZL7 C;  4J5Y A;  3JB9 D;  2E3H A;  1N6A A;  2D9T A;  4GBQ A;  5KNN A;  3CCL T;  1WXT A;  5HY6 A;  1VQK A;  3CCU Q;  4FIB A;  3VS4 A;  4LDX A;  2X4X A;  1BU1 A;  2IIM A;  1Q81 R;  5LJ3 h;  4QVD A;  4FSX A;  5FU7 B;  1ZHI A;  1GFC A;  1EOV A;  1G8X A;  3SWN C;  4QQG A;  1FMK A;  1V1C A;  5J3B A;  4JS4 A;  2B86 A;  2ART A;  2G4C A;  2E10 A;  1OU9 A;  1BIA A;  2I4M A;  2ZT7 A;  3G6E A;  2Q5I A;  4X9D A;  1VQ5 Q;  1B70 B;  3NTK A;  2LCL A;  5CAI A;  2O4X A;  5GAN d;  3OW2 A;  4RTT A;  2BIV A;  3H0H A;  5FRO A;  1YP5 A;  4ELZ C;  1YJ9 A;  4M75 C;  3JRZ A;  2OTJ T;  3A8M B;  1QW1 A;  1YIT Q;  2COW A;  4M7D G;  4C8Q F;  5GAO l;  4YYE A;  1JQQ A;  2WSE E;  3X24 B;  4JRP A;  2KRO A;  4X9C A;  5CO7 A;  2E64 A;  2JUF A;  1MV0 B;  3MO8 A;  3P8Y A;  2IY5 A;  4ANJ A;  2FZC B;  2KRS A;  1ARK A;  1WHK A;  3EGD B;  2VXF A;  1WHJ A;  3DKM A;  2RJF A;  3CD6 Q;  2CJB A;  1VQM Q;  2W10 A;  3HRK A;  4ATO A;  4OB2 B;  4CH5 A;  1KMN A;  1VQK T;  4OMP A;  2GBQ A;  2AZV A;  2QAS A;  2YDL A;  2L2P A;  2K6D A;  4JS5 A;  3GP8 A;  1OV3 A;  2ZT5 A;  1FYF A;  4PJO C;  2DKG A;  1B8A A;  1ACM B;  1UUE A;  1ZQ1 A;  4XTV A;  3UGQ A;  4JLI A;  1R77 A;  1I0C A;  4M78 D;  3H9N A;  3EGD A;  3FJP A;  1DJ7 B;  2KT8 A;  3L2W A;  1E6G A;  2JMC A;  1VQ5 A;  2MWP A;  1Y57 A;  1JJ2 P;  4HWO A;  4P74 A;  1SSH A;  2OTJ Q;  1NNH A;  2G3R A;  4M7A F;  3PCO A;  5DM7 R;  5ELN A;  2PVD B;  2KK4 A;  3RR6 A;  1KMM A;  1KOG A;  3VQV A;  4E7S A;  1H3Z A;  2K2M A;  2J6K A;  2V1Q A;  3CEY A;  1D1B A;  1YI2 A;  1RLP C;  4NL3 A;  1VQ5 T;  2AMC A;  2GFU A;  1Q95 G;  2BTT A;  3CME A;  5GMK i;  3RKW A;  4M7A C;  2VGN A;  3Q1J A;  3OYM A;  1AWW A;  2JS2 A;  4YRR A;  3A8G B;  2A28 A;  1B70 A;  2JTF A;  1M2V A;  1RUW A;  2FZG B;  4NL2 A;  3RNJ A;  3VS0 A;  4Q6G A;  2CP0 A;  1QP3 A;  3OBW A;  3REA B;  4A53 A;  1YFT A;  3EG0 A;  2HKN A;  2HSE B;  5LJ3 d;  1FWZ A;  4YCW A;  3CD6 A;  4YRF A;  3C0C A;  2E3C A;  1U5S A;  1I07 A;  4ELY C;  2MAM A;  4OVA A;  4C8Q B;  1VQ4 Q;  2IG0 A;  4YRM A;  2H8H A;  3VUZ A;  2BZY A;  4NOY A;  5C51 B;  1SHG A;  1C1A A;  4A4H A;  2MF2 A;  3NHN A;  3QBY A;  2RJD A;  1WLE A;  2YLB A;  2RHI A;  5CR2 A;  2GTJ A;  4OML A;  4OGC A;  3AT1 B;  2RQW A;  3E19 A;  4ZGJ B;  1W70 A;  4AFS C;  2ATC B;  3M57 A;  4K11 A;  3EG1 A;  4HKE A;  2ZXF A;  2ENM A;  2V8K A;  2DER A;  3CCV Q;  1TG0 A;  1HK9 A;  3C95 A;  3BW1 A;  5KYW B;  5IHK A;  4R56 A;  3CCS T;  3PE0 A;  2JT4 A;  1VQO T;  2ZR2 A;  2QQ9 A;  4P3N A;  4F17 A;  4G85 A;  2OTJ A;  1YJ9 T;  1CSK A;  1TUC A;  1PD1 A;  3ER0 A;  2A8E A;  4J8O A;  2X4W A;  2ZIN A;  4M78 F;  2YT6 A;  3CCJ Q;  2RJE A;  4O6J A;  4F7U E;  2X4J A;  2PMF A;  4YRI A;  4IIM A;  3I56 A;  3DLL A;  4BE1 A;  1UB4 A;  5M9O A;  4EMG A;  1Q82 U;  3BE3 A;  3M58 A;  1VQP T;  2DRK A;  3N5B B;  2LDM A;  4J9B A;  4KRT A;  3GPL A;  1K73 C;  3P8H A;  3TEG A;  3SEM A;  4M7D B;  4KR3 A;  3P8T A;  1MMN A;  2FRY A;  1LYL A;  4H2W A;  2ZCF B;  2B8A A;  2ZAE A;  4C92 G;  1IRX A;  4IUR A;  2I4N A;  2YRD A;  2M16 A;  3QTC A;  4YP0 A;  2X51 A;  3HKS A;  2L89 A;  4C0D B;  4ZN1 A;  2LX9 A;  4LD6 A;  1ZBX A;  3NTI A;  1R8O B;  1G3S A;  5KYU B;  3VYH B;  1Q7Y U;  2CJA A;  2VGM A;  3S6W A;  4J6X A;  8AT1 B;  4C8Q D;  5HGQ A;  3CCM T;  1IZ6 A;  3I5R A;  1QQJ A;  1VQL A;  2FB7 A;  3KBG A;  2XK0 A;  4RMO A;  2K79 A;  1M1K U;  3DB4 A;  3C12 A;  1RAE B;  2RD1 A;  4YTL A;  2M9U A;  2YUN A;  4EIK A;  1BIB A;  2CP5 A;  2ALY B;  1Y96 B;  2J3M A;  2AIR B;  1UG1 A;  3NMZ C;  4J7I A;  1BKB A;  4MML A;  5IHI A;  3HTZ A;  4PL6 A;  5CKE A;  3EHQ A;  3VBB A;  5KCO A;  4MZT A;  3CCS A;  3LX7 A;  1E1O A;  2ARS A;  1RI0 A;  3M4Q A;  1JJ2 A;  2CKK A;  4M7D E;  4FW1 A;  1HD3 A;  1IB8 A;  1HXD A;  2BUD A;  5IH2 A;  1U8R A;  2RA2 A;  4HCK A;  4BD3 A;  3SFM A;  2LTO A;  2RO0 A;  4H2Y A;  5GAN h;  1NYQ A;  1VYV A;  1MGQ A;  1UTI A;  4E7H A;  2RHU A;  3ME9 A;  4JRQ A;  1VQ8 Q;  3JCM J;  3UDC A;  3W3S A;  2LC4 A;  4CC3 A;  2WSF E;  3D7S B;  4RKU E;  3OBY A;  2K9G A;  2GQV A;  2MWO A;  2RQU A;  2NUP B;  3LLR A;  2COZ A;  3HFV A;  4E51 A;  2DU5 A;  5CQY A;  1WIE A;  2XHC A;  3VS1 A;  3CCE T;  4RDX A;  2ZNI A;  1UFF A;  2DTO A;  3V8J A;  2QA4 T;  4P74 C;  1YFN A;  2OTL A;  5HKC A;  4XTY A;  3OA6 A;  1EIY A;  3CCE Q;  4LUE A;  3FEO A;  4PLL A;  2F2V A;  2CH4 W;  1GBQ A;  3T9N A;  2RJC A;  4LDV A;  2EYY A;  1Q86 C;  2EGC A;  2JS0 A;  3V8K A;  4MDX A;  4X1V A;  4YRN A;  4OMF B;  1OUL A;  2QQA A;  3SD4 A;  2M02 A;  3CC4 A;  1WI7 A;  2HNI A;  4ZTF A;  4IKF A;  2OTL Q;  1HYO A;  2K5L A;  1QVP A;  3RKX A;  1QVF P;  3OY9 A;  1WYX A;  3M9Q A;  2ZIO A;  2QHV A;  1BCM A;  4AMC A;  5FW9 A;  3G7Z A;  4YPF A;  4BW9 A;  4M7A B;  2DU7 A;  4BY6 C;  3KUF A;  3TQ7 P;  3CCM A;  3L1A A;  1G5V A;  4PJJ A;  1E6H A;  5FRN A;  2J3L A;  2BZ8 A;  1D09 B;  1V76 A;  4Y92 A;  1YCY A;  4HT4 A;  3SWN A;  1D1A A;  4M7A D;  2CT3 A;  2L3P A;  3U23 A;  3JB9 J;  1RL2 A;  5DLO A;  1Q7Y C;  1G51 A;  1OI1 A;  5CKH A;  4EMK B;  3REU A;  3R07 A;  4YRL A;  4M78 A;  3J80 E;  4FU6 A;  3HSB A;  1X27 A;  4FSS A;  2FL7 A;  4J9H A;  2G6F X;  1M3A A;  2FYK A;  1HTT A;  1SER A;  3LW5 E;  2DDZ A;  4C0D C;  4P75 A;  1I5O B;  2P0L A;  2DXU A;  1G2B A;  2CDT A;  1U1S A;  2LJ1 A;  1K0S A;  2ZZF A;  2RHS B;  4QQ6 A;  4ZTZ B;  2MPX C;  1GCP A;  4QVC A;  2VUB A;  3VRZ A;  1K8A R;  3CCR Q;  3IKM B;  4TVA A;  4HT9 A;  2DTI A;  4WCI A;  2OX7 A;  2E6Z A;  2RHX A;  2E41 A;  4M75 A;  2M0O A;  4XTZ A;  1WHH A;  2QI2 A;  2VYT A;  2L3S A;  1E24 A;  4Q15 A;  4KH0 B;  3CCM Q;  1RAI B;  1YFR A;  1SRM A;  4DBR A;  5ECA A;  1LNX A;  2NYS A;  1WDX A;  3MF2 A;  2F1L A;  3I7F A;  3F70 A;  1NYG A;  1X54 A;  4RTU A;  4B9W A;  4H02 A;  1PD0 A;  3OYG A;  1W4S A;  1YI2 Q;  1KC8 U;  2EJF A;  4XTW A;  1C0A A;  3QZ5 B;  3OYJ A;  1OEB A;  3OYL A;  2ODR C;  1AVZ C;  1NPR A;  2E70 A;  4J9F A;  5GMK h;  3CCV T;  5C6S A;  1IHV A;  3ZBD A;  4J7F A;  1YIJ A;  1VQN A;  4MDW A;  2XI9 A;  1YBY A;  1VQP A;  2LQK A;  1WGS A;  4NS5 A;  3HY0 A;  1I1J A;  1TSF A;  3LYI A;  3JCM Q;  2R57 A;  3LSQ A;  1C0M A;  4PJO A;  3P8B B;  2FZK B;  1VQ7 Q;  4Z8A A;  4DQ2 A;  4IUQ A;  3PMT A;  4RTZ A;  4M77 A;  5GJW B;  4YCV A;  4MZP A;  3M0S A;  3THK A;  4DOV A;  1UGR B;  3R6N A;  3OW2 P;  4RQE A;  4KR2 A;  3CXC A;  1KC8 C;  1SRL A;  5GAN e;  3A8L B;  3O5Z A;  2A36 A;  2CUD A;  4RG2 A;  4LXC A;  1FMW A;  1MNE A;  2MK5 A;  2LX7 A;  1JRI A;  3MEA A;  4N0A C;  2YWW A;  1IRE B;  3G71 T;  2EQK A;  1KQS S;  1YIJ T;  4FYX B;  4YRK A;  2QGF B;  1M2O A;  2ROT A;  1OU8 A;  3M0Q A;  1D3B A;  3LWH A;  1UGP B;  4C0F A;  1M1K C;  2YHT A;  5KYY B;  2DA9 A;  3TEH B;  4QVZ A;  4X34 A;  3EFO A;  2FPE A;  5GAN j;  4JRI A;  4YRT A;  4PK4 A;  2MIO A;  3IKL A;  4OB3 B;  1BCO A;  3I56 Q;  1K76 A;  4OMQ A;  5KH6 A;  4FT2 A;  3HRS A;  4V2S A;  1JJC B;  1EFN A;  2BKD N;  2EQU A;  3UGT A;  3OYY A;  4C92 D;  4LUD A;  5K1P A;  2KMT A;  2DXC A;  4C8Q A;  1GXI E;  2ODR D;  5CKD A;  3HY1 A;  2RHZ A;  4BUG A;  1K1Z A;  3C4S A;  4KGX B;  3BDL A;  1JXM A;  2P0Q A;  3S3M A;  3MEU A;  2C7I A;  1JJC A;  2NWM A;  4HCZ A;  3OYC A;  4K87 A;  5FWB A;  3G4S T;  3GF5 A;  4PKC C;  2YSQ A;  3OW2 S;  4M75 B;  3NTH A;  3A98 A;  4C92 B;  1VQO Q;  3OS0 A;  1KK7 A;  1JEG A;  1P92 A;  4HCB A;  3H0I A;  1WX6 A;  3KFV A;  2O2O A;  5EC7 A;  2XG8 D;  4J9D A;  2VWF A;  4F7U A;  2R5M A;  3NET A;  1SPK A;  1BBZ A;  2L5Q A;  2LT4 A;  3I55 T;  3E9H A;  1I4K 1;  1E1T A;  2XU8 A;  1KIK A;  2ABL A;  1IO6 A;  4DPG A;  3IQL A;  2KEA A;  1N27 A;  2Q7H A;  2DYB A;  2AT1 B;  5IT9 E;  2KYM A;  3G6E Q;  3JCM W;  1M1G A;  1H8K A;  3NPF A;  1SEM A;  4N0A A;  3JCM f;  3MPU B;  1NEB A;  1LJO A;  1Y07 A;  4C8Q C;  1WZO A;  5A2Q E;  3X28 B;  1AWJ A;  1ZA2 B;  2OAU A;  5GAO m;  2LNH B;  2JZ2 A;  3H0F A;  3EHR A;  2QQS A;  4OGE A;  2EKH A;  5D7U A;  2DQ0 A;  1Z9Z A;  4A4E A;  5GMK l;  5FRM A;  4M77 G;  1B7T A;  2C0I A;  2O4X B;  3HFO A;  3G71 A;  2DEU A;  1B3Q A;  1X6B A;  3QWY A;  1U3O A;  1OX9 A;  2A7Y A;  2QTX A;  3I56 T;  3CCQ T;  1K8A U;  2D8H A;  1N5Z A;  3TRE A;  1QMC A;  2QQB A;  4XAX B;  1VQ8 T;  1VQM A;  4IUT A;  4JZ4 A;  3JB9 F;  2GTO A;  1YHQ Q;  1J3T A;  2DIG A;  4OB1 B;  3TEE A;  3HXU A;  3FB9 A;  3GOX A;  2CUB A;  4KBM B;  4M7D A;  2P4T A;  4AFQ C;  1W2B A;  5D6X A;  1Y7X A;  2K4Y A;  5LJ5 f;  2K5F A;  3JCM c;  3L2R A;  1YJN A;  4UP9 A;  4EMK C;  2DL3 A;  3QII A;  3BY7 A;  5GAN 3;  4TVY A;  2KR3 A;  1TTH B;  1IGU A;  4LN2 A;  2NUT A;  1QCF A;  4JRK A;  2C0O A;  3QYH B;  1CKA A;  4H2U A;  3A8H B;  3G71 Q;  1WU7 A;  1ZX6 A;  4CC4 B;  1YJN T;  3M0T A;  4LE9 A;  2QEX A;  1ASZ A;  1D0X A;  4J6Y A;  5ELO A;  2XDB A;  4LNP A;  2AKK A;  1X2Q A;  1XJW B;  2PVG B;  2CH4 A;  1OQK A;  5GMK e;  4CRI A;  3LC0 A;  2XIC A;  1WHL A;  1N9W A;  2PUO B;  3KFU A;  4ZTU B;  3M0R A;  2KXC A;  1F1B B;  3QO3 A;  2JM9 A;  4OB0 B;  4Y28 E;  2DBK A;  4TVR A;  1VQL Q;  2QG9 B;  3MQZ A;  2ZT8 A;  4LVJ A;  1PCX A;  3GNG A;  1RAF B;  2EL9 A;  2KSS A;  3IG2 A;  4M77 C;  3NEM A;  2QEX Q;  3PVQ A;  3O8V A;  1B34 B;  3I9Q A;  3SWN B;  1BBU A;  2BE9 B;  3L42 A;  3QWX X;  3VJP A;  2WAC A;  4A63 B;  2E5A A;  2JNG A;  4M7A E;  3EFR A;  1WXU A;  4O2D A;  1TXQ A;  1KD1 U;  1QVF A;  2MMP A;  2CSI A;  4M7D F;  1NYF A;  4M78 G;  1NJ5 A;  2ZPI B;  3CXC S;  5F5W A;  4QQD A;  2EWN A;  1SG5 A;  3CCS Q;  1VYT A;  1JB0 E;  2QK0 A;  4RG8 A;  1ABO A;  1BI3 A;  2KGT A;  4DBF A;  2RHQ B;  1BI0 A;  4N4I A;  2KRN A;  2DVJ A;  4LDW A;  5KYY A;  1Q86 R; 
#chains in the Genus database with same CATH homology
 2KAF A;  2E5Q A;  4LD9 K;  4P3O A;  4MZM A;  2LT1 A;  3I55 A;  4C5G A;  2ZPB B;  4M75 G;  4F7U F;  2ZZD A;  4HWS A;  2GCX A;  3H6Z A;  1NJ2 A;  1H4T A;  4AH6 A;  5GAN 5;  3X26 B;  4EMK A;  1M1F A;  3A5Z B;  2K5I A;  4A4K A;  4C0Z A;  3HXZ A;  1OZ3 A;  1S72 A;  4P71 C;  2F5T X;  2XKO C;  4LVL A;  3MHX A;  5LJ5 g;  2KQW A;  5GAM d;  4B9X A;  2FHD A;  3UWN A;  5CKB A;  1B34 A;  4QW2 A;  5C0M A;  2CIM A;  4YRC A;  1X75 C;  2V8I A;  3NEL A;  4PJO G;  2E6N A;  3MP6 A;  3OYF A;  2XGT A;  5GAN 7;  2KY9 A;  4UP7 A;  3HXV A;  1USY C;  1H4S A;  12AS A;  4J15 A;  3VQY A;  4A54 A;  4P73 C;  1H4V B;  2CZ6 B;  3VYG A;  1EQR A;  3OYB A;  1N9R A;  1B7Y B;  4C5E A;  3RMS A;  4WI1 A;  4Y91 A;  2IVW A;  4Q5W A;  3RF1 A;  3X20 B;  3OYI A;  2Y90 A;  2L8D A;  1TH7 A;  4ZN3 A;  4PJO D;  3JCM g;  4YRP A;  5GAM f;  1W2B S;  3CCL A;  4M77 E;  4FT4 A;  3QNE A;  1X2G A;  4H2X B;  4LNS A;  3QUI A;  3ZEH A;  4F7U G;  2ZPE B;  4XU0 A;  1VQ8 A;  2K3Y A;  4UC4 A;  5GAO n;  3JB9 H;  3CPW A;  3LGL A;  3CCU T;  4PJO B;  4JJN K;  3M54 A;  3E9G A;  4BB7 A;  2ZNJ A;  3HXY A;  1NJI U;  1KQS A;  4H2X A;  3VQW A;  2R58 A;  2RK2 A;  1VQL T;  1QE0 A;  3RES A;  3HFN A;  1NJ6 A;  3OSV A;  1Y96 A;  3HXW A;  4E47 A;  2P0K A;  3FC3 A;  2QDY B;  1NJ8 A;  2KDS A;  3A31 A;  2X35 A;  3JCM P;  2ZZE A;  3A7U A;  1NJ1 A;  4E7J A;  4PLI A;  4KUD K;  1PYS B;  3PIO A;  1Z7N A;  2EAY A;  4RMF A;  3S3N A;  2DD5 A;  3CPW S;  1KQ1 A;  1WNL A;  5CQX A;  1XOV A;  3TU4 K;  1VQ9 A;  3CCQ A;  3QJ6 A;  5GAO q;  4P72 C;  4J83 A;  4K88 A;  3G6E T;  3CBO A;  4XTX A;  5LJ5 d;  5GAM g;  3MEW A;  2LQ8 A;  4A4G A;  2ZPG B;  2CGH A;  4M78 B;  5LJ5 e;  3M4G A;  4UP8 A;  3OB9 A;  1X55 A;  1K8A C;  5FU6 B;  1I8F A;  3GLX A;  4D6W A;  4KUL A;  2C06 A;  3A74 A;  1SSF A;  1JBM A;  5HK3 A;  3M5A A;  3MP8 A;  2E1H A;  3CCR A;  2DIQ A;  5CIU A;  1K9M U;  4ME7 A;  4ZTJ A;  3X25 B;  3OS1 A;  4OP0 A;  3JCM h;  3CC7 T;  2ZR3 A;  2DEQ A;  3G4S A;  2XD0 A;  2XDP A;  5GAO p;  4IUU A;  5KE2 A;  2AKW B;  3CC2 A;  2NLU A;  4RCB A;  2PME A;  3L4G A;  4IUV A;  3C94 A;  3JCM e;  3KXT A;  2RI5 A;  2HQX A;  4YCU A;  2RHY A;  4BDZ A;  2Y4X A;  1O75 A;  4XK8 E;  3PMI A;  2VC8 A;  4M7A G;  3OYE A;  4PNO A;  2I4O A;  4DA4 A;  4YRO A;  4YRQ A;  4M78 E;  4A4F A;  1K73 U;  2RHQ A;  4XTU A;  1USY A;  1H4Q A;  4C92 A;  1NJI C;  4EMH A;  5GAN 8;  5LJ5 h;  3QG1 A;  1PYS A;  4C5I A;  3WXM B;  4P73 A;  2RM4 A;  4YRS A;  1QVG S;  4R55 A;  3PGG A;  4X5O A;  3PTA A;  3L2Q A;  3MCA B;  1W66 A;  3M56 A;  1NPP A;  4M75 E;  5A0L A;  5I2M A;  4HA8 A;  3CC7 A;  3JB9 G;  4HCC A;  2LCC A;  3G1Z A;  5J26 A;  4VUB A;  4BAC A;  1X56 A;  2LNV A;  4UPA A;  3QYG B;  1VQ7 T;  1Z7M A;  2EYQ A;  2Q7G A;  2IY5 B;  5A0D A;  4M75 F;  4E7K A;  4L59 A;  2EJG A;  1EIY B;  2DVE A;  1WJQ A;  2PU9 B;  3TEH A;  3DLM A;  3WVE B;  4PJO E;  3A8O B;  3WVD B;  2JVV A;  3OYN A;  2ZIM A;  3HPW A;  5EG2 A;  2ZZG A;  5GMK j;  3A7R A;  2JTM A;  4JUV A;  5I21 A;  3DB3 A;  2DAQ A;  3ZFJ A;  2DZ9 A;  3QO7 A;  4CH6 A;  5I2S A;  2D0Q B;  3MET A;  4XQ3 A;  1FXX A;  4C92 F;  4P3P A;  2RK1 A;  1N8R U;  3MEY A;  2GFA A;  4NCX A;  2QHS A;  2P0P A;  1Q81 U;  2I4L A;  5LJ3 j;  4GLK A;  4P71 A;  2K3X A;  2YRV A;  3PNW C;  3FIF A;  5GAN 4;  1SES A;  4C0G A;  4DOW A;  2XID A;  3UT1 A;  3QJY A;  4IUP A;  1X01 A;  3QZ9 B;  3RUX A;  2P5I A;  3V7C A;  4C8Q E;  3CCJ T;  2O01 E;  4OF1 A;  2DPP B;  3M4P A;  3CD6 T;  2XTI A;  3WQZ A;  4TQF A;  1G3Y A;  2RI3 A;  3OSS C;  4II1 A;  3QDR B;  3V8L A;  2JOY A;  4LVK A;  2XDD A;  3J7A F;  3PZC A;  4L87 A;  1WQW A;  1Y71 A;  3HFZ B;  1RIQ A;  3MF1 A;  1LOJ A;  2DO3 A;  1VQ4 T;  1WPY A;  3QO5 A;  2AHJ B;  3VUB A;  4OLF A;  2MI6 A;  4RQF A;  1GGM A;  4L5G A;  2Y4Y A;  2DTH A;  2I2L A;  1K9M C;  2PVO B;  1VQ6 A;  2ALY A;  1N8R C;  3E9I A;  2WSC E;  4JDS A;  4XU1 A;  1BYM A;  4M77 B;  2H3J A;  4TVA B;  2EQM A;  1BI2 A;  4WF2 A;  4K86 A;  3CMA T;  3HRU A;  3HL8 A;  3SDZ A;  3QXE B;  2R5A A;  2RH2 A;  3BDU A;  3NFC A;  3BJU A;  1YIT T;  3OD1 A;  2C8M A;  3JB9 I;  1E22 A;  1VQZ A;  3A7A A;  4C92 C;  3RER A;  2ARU A;  1O9S A;  1QF6 A;  2F5K A;  3HHT B;  3INZ A;  3RAC A;  4LDU A;  1XNI A;  1G5I A;  4EX5 A;  4O5V A;  3CPF A;  3QKJ A;  3L4G B;  4M7D C;  2DXB A;  2AKW A;  3PIP A;  3M59 A;  4EPC A;  1VQ9 T;  4P72 A;  1X6O A;  1KHC A;  5L8R E;  1PSF A;  3RGL A;  1B7Y A;  3H8Z A;  1J5W A;  4BE2 A;  5CCA A;  2A3L A;  4CH4 A;  3E9F A;  3HRT A;  3M55 A;  2DZC A;  3RKY A;  11AS A;  4HWP A;  4BWA A;  1EIF A;  3FLG A;  1JJ2 S;  2GF7 A;  1OZ2 A;  2X4Y A;  4E7L A;  1YFS A;  4M78 C;  3JAM E;  3URG A;  3CMA A;  3RL6 A;  4BY6 B;  5GAN 6;  4CI0 C;  3M4Y A;  5LJ3 g;  1V29 B;  1VQ6 T;  1WJS A;  3CCU A;  1SET A;  3EAE A;  3HFZ A;  1BBW A;  1VQO A;  4M7A A;  1KD1 C;  3DSQ A;  3AHU A;  2LRQ A;  1VUB A;  3A5Z A;  3UH0 A;  3OYD A;  3UPU A;  4PHC A;  2CS7 A;  2RHS A;  2CYZ B;  4CS2 A;  3CC2 T;  1XTD A;  5FU7 C;  1VIE A;  4TQD A;  2HAX A;  4BI3 A;  5LJ5 j;  3CCV A;  2LVM A;  2V8J A;  2Q7E A;  3FRN A;  3P8V A;  2E65 A;  2DXT A;  3CCR T;  4KT0 E;  5K1X A;  1U1T A;  3TUP A;  1QP2 A;  4GY5 A;  2F69 A;  4C92 E;  3CBM A;  5CKF A;  2ZGW A;  1KQ2 A;  5GAN f;  1EVL A;  3CBP A;  1M4Z A;  1YHQ T;  1KG1 A;  1IL2 A;  1M8V A;  4P5N A;  3PFS A;  1UGS B;  2PQW A;  1S72 T;  1XQH A;  5GAM e;  3LGF A;  3M53 A;  3L2Z A;  2JN0 A;  4YRJ A;  4KQE A;  2HQE A;  4PJO F;  3JCM X;  3OYK A;  3OS5 A;  3CMQ A;  1I5L A;  2QQR A;  3QHS A;  3NEN A;  1EVK A;  1L0W A;  3OYA A;  2EIF A;  5GMK m;  2QXF A;  1OYX A;  2EFI A;  3L2V A;  3RIR A;  3LSS A;  2RB6 A;  2ZPF B;  5GAM j;  1VIF A;  2K2V A;  2QHU A;  3A5Y A;  5C52 B;  5IN1 A;  3SB2 A;  3GNF B;  5GAM h;  1Q81 C;  2RI2 A;  4CS3 A;  2CZ7 B;  3PCO B;  4E7I A;  1AHJ B;  1Q86 U;  5KCH A;  4P75 C;  1H64 1;  1NE8 A;  2Q5H A;  4TTV A;  1PSE A;  4C5H A;  3CC4 T;  4C8Q G;  3EFS A;  5AYF A;  4M7D D;  1VQ4 A;  1ATI A;  3QSU A;  4XEM A;  3MP1 A;  5CK9 A;  4LVI A;  3JCM b;  4HT8 A;  2ZPH B;  2HBP A;  2HD0 A;  2DQ3 A;  4H2V A;  1YGB A;  4HVC A;  5IAY A;  1VQ7 A;  4N4G A;  3GIB A;  1YJW T;  1G5H A;  3OMG A;  1BI1 A;  5DLQ E;  5LJ3 e;  3V7S A;  1YHQ A;  1G3T A;  3HXX A;  4L6V 5;  4N4H A;  1UEB A;  1M9S A;  2ZCE A;  2QEX T;  1UGQ B;  3A32 A;  2ZT6 A;  2E12 A;  1HC7 A;  3J81 E;  4HWR A;  4BDY A;  4BI4 A;  3V7R A;  1D3B B;  1VQN T;  1ADY A;  4YDQ A;  3R6O A;  4YRG A;  1MHN A;  4KUI A;  2VV5 A;  4HWT A;  1B76 A;  4EO4 A;  1X2H A;  3RMQ A;  4M75 D;  5LL6 S;  2L3R A;  1SRY A;  4BI8 B;  2FVU A;  2CJ9 A;  5LJ3 f;  5KE3 A;  4FM4 B;  1YI2 T;  4XEO A;  3VV0 A;  1G3W A;  2VXE A;  1FX7 A;  4MMK A;  1WJR A;  4Z02 A;  4JLG A;  4WJ3 M;  3MEV A;  1Q82 C;  2EQJ A;  1I81 A;  3TCJ A;  2CZ1 B;  5CVI A;  3VKI A;  5GAN 2;  5D6W A;  1WYD A;  4YRE A;  1KHI A;  3QO8 A;  4ZIB A;  3OYH A;  1QVF S;  2EKO A;  3IAL A;  4LDY A;  4H2T A;  3OMC A;  4G84 A;  2AMC B;  4LVM A;  2EJ9 A;  5D6Y A;  4ZGE B;  3OS2 A;  4CH3 A;  2DD4 A;  1NYR A;  4ZGD B;  4RCC A;  4TWA A;  2CZ0 B;  2DJZ A;  3REX A;  3JCM V;  2NS6 A;  5DY9 A;  3L2U A;  3S3O A;  3VU3 C;  2YLC A;  3ASK A;  1N9S A;  1YIT A;  3JCM d;  2PUK B;  2DK3 A;  4J6W A;  3LWI A;  4BE0 A;  3OQ5 A;  5GAN g;  2ZTG A;  3CCE A;  3HP9 A;  2M1H A;  1ADJ A;  2QHT A;  5HK0 A;  2D6F A;  4XU2 A;  3ERR A;  5FLX E;  1ASY A;  4FL6 A;  3ICA A;  1EFW A;  1M90 U;  3CCJ A;  1M5Q 1;  3CME T;  1M90 C;  5C53 B;  4H2S A;  4M77 F;  3P8D A;  4CS4 A;  2KVQ G;  2K57 A;  3BFM A;  4TVW A;  4WJ4 A;  5J39 A;  1YB3 A;  4F7U B;  4XU3 A;  3JSC A;  1WQ7 A;  3UFG A;  4PG3 A;  4M77 D;  5GAO r;  1QVG A;  5E3I A;  3HRI A;  5A0G A;  2OTL T;  3PT9 A;  3LH0 A;  2QA4 A;  1VQM T;  1YJW A;  4EDU A;  3FDR A;  3QPH A;  3E1S A;  5FU6 C;  3VQX A;  1NZ9 A;  4J5Y A;  3JB9 D;  1N6A A;  2D9T A;  5KNN A;  3CCL T;  5HY6 A;  1VQK A;  4FIB A;  4LDX A;  2X4X A;  5LJ3 h;  4QVD A;  4FSX A;  5FU7 B;  1ZHI A;  1EOV A;  3SWN C;  4QQG A;  5J3B A;  4JS4 A;  2ART A;  2G4C A;  2E10 A;  1BIA A;  2I4M A;  2ZT7 A;  3G6E A;  2Q5I A;  4X9D A;  1B70 B;  3NTK A;  2LCL A;  5CAI A;  2O4X A;  5GAN d;  3OW2 A;  2BIV A;  5FRO A;  4ELZ C;  1YJ9 A;  4M75 C;  3JRZ A;  2OTJ T;  3A8M B;  1QW1 A;  4M7D G;  4C8Q F;  5GAO l;  4YYE A;  3X24 B;  2WSE E;  4JRP A;  4X9C A;  5CO7 A;  2E64 A;  2JUF A;  3MO8 A;  3P8Y A;  2IY5 A;  2VXF A;  3DKM A;  2RJF A;  2CJB A;  3HRK A;  4ATO A;  4OB2 B;  4CH5 A;  1KMN A;  1VQK T;  4JS5 A;  3GP8 A;  2ZT5 A;  1FYF A;  4PJO C;  2DKG A;  1B8A A;  1ZQ1 A;  4XTV A;  3UGQ A;  4JLI A;  4M78 D;  3FJP A;  1DJ7 B;  3L2W A;  1VQ5 A;  2MWP A;  4HWO A;  4P74 A;  1NNH A;  2G3R A;  4M7A F;  3PCO A;  5DM7 R;  5ELN A;  2PVD B;  2KK4 A;  1KMM A;  1KOG A;  3VQV A;  1H3Z A;  3CEY A;  1YI2 A;  4NL3 A;  1VQ5 T;  2AMC A;  2GFU A;  3CME A;  5GMK i;  3RKW A;  4M7A C;  2VGN A;  3Q1J A;  3OYM A;  4YRR A;  3A8G B;  1B70 A;  2JTF A;  4NL2 A;  4Q6G A;  1QP3 A;  3OBW A;  4A53 A;  1YFT A;  5LJ3 d;  1FWZ A;  4YCW A;  3CD6 A;  4YRF A;  2E3C A;  4ELY C;  2MAM A;  4OVA A;  4C8Q B;  2IG0 A;  4YRM A;  3VUZ A;  4NOY A;  5C51 B;  4A4H A;  2MF2 A;  3QBY A;  2RJD A;  1WLE A;  2YLB A;  2RHI A;  5CR2 A;  4OGC A;  3E19 A;  4ZGJ B;  3M57 A;  4HKE A;  2ZXF A;  2V8K A;  1HK9 A;  3C95 A;  3BW1 A;  4R56 A;  3CCS T;  1VQO T;  2ZR2 A;  4P3N A;  2QQ9 A;  4G85 A;  2OTJ A;  1YJ9 T;  3ER0 A;  2A8E A;  2ZIN A;  4J8O A;  2X4W A;  4M78 F;  2RJE A;  4O6J A;  4F7U E;  2X4J A;  2PMF A;  4YRI A;  3I56 A;  3DLL A;  4BE1 A;  1UB4 A;  5M9O A;  4EMG A;  1Q82 U;  3M58 A;  1VQP T;  3N5B B;  2LDM A;  3GPL A;  1K73 C;  3P8H A;  3TEG A;  4M7D B;  4KR3 A;  3P8T A;  1LYL A;  4H2W A;  2ZCF B;  2B8A A;  4C92 G;  4IUR A;  2I4N A;  2M16 A;  3QTC A;  4YP0 A;  3HKS A;  2L89 A;  4C0D B;  4ZN1 A;  2LX9 A;  4LD6 A;  1ZBX A;  3NTI A;  1R8O B;  1G3S A;  3VYH B;  1Q7Y U;  2CJA A;  2VGM A;  3S6W A;  4J6X A;  4C8Q D;  5HGQ A;  3CCM T;  1IZ6 A;  1VQL A;  2FB7 A;  3KBG A;  2XK0 A;  4RMO A;  1M1K U;  3DB4 A;  3C12 A;  2RD1 A;  4YTL A;  2M9U A;  1BIB A;  2ALY B;  1Y96 B;  2J3M A;  4J7I A;  1BKB A;  4MML A;  3HTZ A;  4PL6 A;  5CKE A;  3VBB A;  5KCO A;  4MZT A;  3CCS A;  3LX7 A;  1E1O A;  2ARS A;  1RI0 A;  3M4Q A;  1JJ2 A;  2CKK A;  4M7D E;  1HXD A;  2BUD A;  1U8R A;  2RA2 A;  4BD3 A;  3SFM A;  2LTO A;  2RO0 A;  4H2Y A;  5GAN h;  1NYQ A;  1MGQ A;  4E7H A;  2RHU A;  3ME9 A;  4JRQ A;  3JCM J;  3UDC A;  3W3S A;  2LC4 A;  2WSF E;  4RKU E;  3OBY A;  2GQV A;  2MWO A;  3LLR A;  3HFV A;  4E51 A;  2DU5 A;  5CQY A;  2XHC A;  3CCE T;  4RDX A;  2ZNI A;  2DTO A;  3V8J A;  2QA4 T;  4P74 C;  2OTL A;  5HKC A;  4XTY A;  3OA6 A;  1EIY A;  3FEO A;  4PLL A;  3T9N A;  2RJC A;  4LDV A;  1Q86 C;  3V8K A;  4MDX A;  4YRN A;  4OMF B;  2QQA A;  3SD4 A;  3CC4 A;  2HNI A;  4ZTF A;  4IKF A;  2K5L A;  1QVP A;  3RKX A;  3OY9 A;  3M9Q A;  2ZIO A;  2QHV A;  3G7Z A;  4YPF A;  4BW9 A;  4M7A B;  2DU7 A;  4BY6 C;  3KUF A;  3CCM A;  3L1A A;  1G5V A;  5FRN A;  2J3L A;  1YCY A;  4HT4 A;  3SWN A;  4M7A D;  3JB9 J;  1RL2 A;  5DLO A;  1Q7Y C;  1G51 A;  1OI1 A;  5CKH A;  4EMK B;  3REU A;  3R07 A;  4YRL A;  4M78 A;  3J80 E;  4FU6 A;  3HSB A;  2FL7 A;  2FYK A;  1HTT A;  1SER A;  3LW5 E;  2DDZ A;  4C0D C;  4P75 A;  2P0L A;  2DXU A;  1U1S A;  2ZZF A;  2RHS B;  4QQ6 A;  4ZTZ B;  4QVC A;  2VUB A;  3IKM B;  4TVA A;  4HT9 A;  2DTI A;  2E6Z A;  2RHX A;  2E41 A;  4M75 A;  2M0O A;  4XTZ A;  2QI2 A;  2VYT A;  1E24 A;  4Q15 A;  1YFR A;  1LNX A;  3MF2 A;  3I7F A;  3F70 A;  1X54 A;  4B9W A;  4H02 A;  3OYG A;  1W4S A;  1KC8 U;  2EJF A;  4XTW A;  1C0A A;  3QZ5 B;  3OYJ A;  3OYL A;  2ODR C;  1NPR A;  2E70 A;  5GMK h;  3CCV T;  5C6S A;  3ZBD A;  4J7F A;  1YIJ A;  1VQN A;  4MDW A;  2XI9 A;  1YBY A;  1VQP A;  2LQK A;  1WGS A;  4NS5 A;  3HY0 A;  3LYI A;  3JCM Q;  2R57 A;  3LSQ A;  4PJO A;  3P8B B;  4DQ2 A;  4IUQ A;  3PMT A;  4M77 A;  4YCV A;  4MZP A;  4DOV A;  1UGR B;  4RQE A;  4KR2 A;  3CXC A;  1KC8 C;  5GAN e;  3A8L B;  4RG2 A;  1JRI A;  3MEA A;  4N0A C;  1IRE B;  3G71 T;  2EQK A;  1KQS S;  1YIJ T;  4YRK A;  1D3B A;  3LWH A;  1UGP B;  4C0F A;  1M1K C;  2YHT A;  3TEH B;  4QVZ A;  4X34 A;  5GAN j;  4JRI A;  4YRT A;  3IKL A;  4OB3 B;  5KH6 A;  4FT2 A;  3HRS A;  4V2S A;  1JJC B;  2BKD N;  3UGT A;  2EQU A;  3OYY A;  4C92 D;  5K1P A;  2KMT A;  2DXC A;  4C8Q A;  1GXI E;  2ODR D;  5CKD A;  3HY1 A;  2RHZ A;  4BUG A;  3C4S A;  3BDL A;  2P0Q A;  3S3M A;  3MEU A;  2C7I A;  1JJC A;  4HCZ A;  3OYC A;  4K87 A;  3G4S T;  3GF5 A;  4PKC C;  3OW2 S;  4M75 B;  3NTH A;  4C92 B;  3OS0 A;  1P92 A;  4HCB A;  2XG8 D;  4F7U A;  2R5M A;  3NET A;  2L5Q A;  2LT4 A;  3I55 T;  3E9H A;  1I4K 1;  1E1T A;  2XU8 A;  4DPG A;  1N27 A;  2Q7H A;  5IT9 E;  3JCM W;  1M1G A;  4N0A A;  3JCM f;  1LJO A;  1Y07 A;  4C8Q C;  5A2Q E;  3X28 B;  2OAU A;  5GAO m;  2JZ2 A;  2QQS A;  4OGE A;  2DQ0 A;  4A4E A;  5GMK l;  5FRM A;  4M77 G;  2O4X B;  3HFO A;  3G71 A;  2A7Y A;  2QTX A;  3I56 T;  3CCQ T;  1K8A U;  3TRE A;  2QQB A;  4XAX B;  1VQ8 T;  1VQM A;  4IUT A;  3JB9 F;  2DIG A;  4OB1 B;  3TEE A;  3HXU A;  3FB9 A;  3GOX A;  4KBM B;  4M7D A;  2P4T A;  1W2B A;  5D6X A;  1Y7X A;  2K4Y A;  5LJ5 f;  2K5F A;  3JCM c;  3L2R A;  1YJN A;  4UP9 A;  4EMK C;  3QII A;  3BY7 A;  5GAN 3;  4TVY A;  4JRK A;  3QYH B;  4H2U A;  3A8H B;  1WU7 A;  1YJN T;  2QEX A;  1ASZ A;  4J6Y A;  5ELO A;  2XDB A;  2PVG B;  5GMK e;  4CRI A;  3LC0 A;  2XIC A;  1N9W A;  2PUO B;  3KFU A;  4ZTU B;  3QO3 A;  4OB0 B;  4Y28 E;  4TVR A;  3MQZ A;  2ZT8 A;  4LVJ A;  3GNG A;  2EL9 A;  2KSS A;  3IG2 A;  4M77 C;  3NEM A;  3O8V A;  1B34 B;  3SWN B;  1BBU A;  3L42 A;  3VJP A;  2WAC A;  2E5A A;  2JNG A;  4M7A E;  3EFR A;  4O2D A;  1KD1 U;  1QVF A;  2MMP A;  4M7D F;  1NJ5 A;  4M78 G;  2ZPI B;  3CXC S;  5F5W A;  4QQD A;  2EWN A;  1JB0 E;  4RG8 A;  1BI3 A;  2RHQ B;  1BI0 A;  4N4I A;  4LDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...