2DXTA

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with atp and biotin, mutation d104a
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
235
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNAVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 70
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxtA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dxtA01
4OP0A 3RGLA 1N9WA 1B34A 2ARUA 2I4NA 1RIQA 2Q5IA 3NETA 1YB3A 3JCMd 1FYFA 4AH6A 4P74A 3JB9D 2ARTA 2DEQA 1H4QA 4H2WA 4YRGA 3QTCA 3JB9I 4G84A 2DZ9A 3JB9J 3V8LA 4M7DA 4F7UG 1NJ2A 1WU7A 2QHUA 3PCOB 3V8JA 3HXZA 1Y96A 4M75G 5LJ3j 1L0WA 3A5YA 1B7YA 4M7DF 5LJ3f 2EL9A 4P71A 5GANe 4C8QA 4K86A 4EMKB 2P5IA 4ZIBA 4YRPA 3LSQA 1KMNA 4YRCA 4YRSA 1X54A 4UP7A 3KFUA 5HGQA 4CH4A 2CJBA 1ATIA 4C8QF 1KOGA 2CJAA 3HFNA 3JCMW 2EAYA 2G4CA 5GANj 3SWNB 4M78C 1PYSA 3QNEA 2ZNIA 4M77C 4LNSA 4HT9A 1Z7MA 3NEMA 4X5OA 4BW9A 11ASA 3UFGA 4C92C 4K87A 4PJOG 4P3PA 2ODRD 3RERA 3BJUA 3HRIA 4HWTA 2RHQB 5GAMd 3OD1A 1N9SA 2ZCEA 4F7UE 4P73C 2Y90A 3RL6A 2FB7A 3VBBA 3HXVA 4M77B 4CS3A 3A7AA 3MEYA 4NL2A 2AMCB 1G5IA 4C92B 2E64A 1B8AA 5GMKi 1SESA 4H2YA 4YRIA 1HK9A 5F5WA 4OLFA 3CMQA 1ADYA 4RCCA 5LJ5f 4P72A 1I4K1 5GMKe 3EFSA 4NL3A 2E65A 5GANd 4M7AA 5C53B 2DZCA 3HXYA 4CH6A 4TQDA 2XGTA 4JLIA 4M78G 4TTVA 1D3BB 3L1AA 3JB9H 3V7CA 3JB9F 3LSSA 1JJCB 4M77G 3A5ZA 5GMKj 4H2VA 4CH5A 3HFZA 2CGHA 5GAN5 3AHUA 1B70A 3JCMX 2ZZFA 3TEHA 1EVLA 1BBWA 4XTWA 2DTOA 4RQFA 5CAIA 2Q5HA 4L87A 5LJ3g 3IKMB 4H02A 1ADJA 3V7RA 3UGQA 4YRMA 1EQRA 3RF1A 1YFSA 4CS2A 4HWSA 4M7AE 2QHTA 5GMKl 4TQFA 3TUPA 4P74C 1NYQA 4A53A 3REXA 1E24A 4TVAB 3UH0A 4M7DC 4HT8A 2Q7EA 4V2SA 4XU1A 3VQWA 1B34B 4YRTA 4X9CA 3JCMc 1NNHA 3A32A 4P75C 2ZZGA 2ZR2A 3HXUA 4P71C 3DSQA 4C8QC 4KR3A 4M7DB 1WNLA 3VU3C 1E22A 4RMFA 1M5Q1 2DTHA 4N0AA 1Y96B 4H2XA 5LJ3e 4XU3A 1B7YB 2VXFA 2E5AA 4M7AD 5C51B 3WQZA 3JCMh 1N9RA 2DVEA 4C8QB 3QSUA 3HRKA 2E10A 4EMKC 5C52B 1C0AA 3E9HA 3FB9A 1SETA 3QHSA 5LJ5g 4WJ3M 2ARSA 4Q15A 2DQ3A 1ASZA 4F7UA 2YHTA 4J6WA 5I21A 1KMMA 1PYSB 1EIYA 3SWNC 3P8YA 1M8VA 4F7UF 1NJ1A 2I4MA 4XTUA 2E41A 2RB6A 4M7DG 2AKWA 3IG2A 1HXDA 3NENA 3BFMA 4HWOA 3HFVA 4XTYA 2ZT5A 3LC0A 2HNIA 4XQ3A 2EJFA 4C8QG 4HA8A 3G1ZA 1MGQA 2QHVA 1LYLA 4YRQA 4YREA 3P8TA 4RQEA 5LJ5e 5GAMh 3GIBA 4PJOA 4H2SA 2XTIA 3RUXA 3W3SA 5LJ3d 4JUVA 2YLBA 4M75E 1GGMA 3M4QA 3NELA 4YP0A 2DXTA 4JRIA 4XU0A 3VQVA 1JBMA 2P0LA 3R07A 1EVKA 4CS4A 5GAOn 4E51A 4UP8A 3HY0A 2DU7A 5LJ5j 2ZR3A 3L4GA 4YRLA 1EFWA 5GAN2 1W66A 4YRRA 2IY5A 1LOJA 4EO4A 3HFZB 5GANh 3JCMV 12ASA 2DKGA 1B70B 4XEOA 2ZT6A 2PMFA 3TEHB 1G5HA 2DJZA 4M7AF 2I2LA 4PJOE 1NYRA 2PMEA 3QO8A 3RACA 4M75D 2CJ9A 4TWAA 2ODRC 4M78A 3L2ZA 2J3MA 4MMKA 4C92G 2ALYA 3TEGA 4ZTUB 4G85A 2ZIMA 1E1OA 5GAOl 1WQWA 2ZXFA 4HWRA 2ZNJA 5K1XA 3EFRA 3JB9G 4WF2A 4J5YA 3PZCA 2QTXA 2E1HA 5LJ5d 4YPFA 4ZTZB 2DXUA 3SB2A 4DPGA 2EWNA 4QVDA 2I4OA 4J6XA 4RDXA 2CIMA 1SERA 4PJOD 2I4LA 1NJ5A 3VQYA 5GAOr 1E1TA 4H2XB 1WPYA 4M78E 4J6YA 3IALA 4TVWA 3A74A 1BBUA 1X55A 4MMLA 4QVCA 2EJ9A 4M77E 2QHSA 3JCMf 4O2DA 4C92E 3ERRA 3JCMP 5GAN7 1YFTA 1X2GA 4KQEA 2RHSA 3JCMJ 3BY7A 4F7UB 2J3LA 3INZA 4NOYA 1EIYB 5GAOm 1NJ6A 1QE0A 1X01A 1U1SA 1HC7A 2AKWB 3UGTA 5GAOp 4M78D 4WJ4A 1USYA 2K57A 4M75A 4M77D 3RKWA 2RM4A 3HXWA 1YFRA 4C92D 5GMKm 4J15A 2ZTGA 4M75F 4K88A 3REUA 5GAMj 1JRIA 3A7RA 4EMHA 4PJOB 4XTXA 4UPAA 5GAMf 2C7IA 3ICAA 3MF2A 4P72C 4P3NA 2DU5A 1WQ7A 5GAN6 4P75A 1H641 3A31A 4YCWA 4M7AC 4YRJA 4PNOA 3QO7A 3L4GB 4XEMA 3PCOA 1Z7NA 1WLEA 3MF1A 4YYEA 4JRKA 5LJ3h 2DQ0A 1BIAA 3A7UA 3HSBA 3I7FA 4YDQA 4PJOF 2IY5B 4M7AB 4PHCA 3HY1A 4EMKA 4WI1A 5GANf 5GAN8 1TH7A 5GAN3 4M7DE 3QUIA 5DY9A 2ZT7A 3FIFA 5E3IA 1B76A 1LJOA 4M78B 5GAOq 2ZZEA 3SWNA 1KQ2A 2E3CA 2ALYB 4P3OA 4YRFA 3BW1A 4PG3A 3JCMg 3HFOA 4Y91A 3IKLA 1ASYA 5ELNA 4KR2A 4C8QE 1LNXA 4EX5A 1KQ1A 2DDZA 2ZT8A 4YROA 3FJPA 4A54A 3V7SA 2RHQA 1I8FA 1H4VB 2VC8A 4M77A 4M7AG 4YRNA 3QO3A 2AMCA 3HXXA 5ELOA 2FYKA 4M78F 4C92A 1X56A 4M77F 4M7DD 3M4PA 4UP9A 4CH3A 3JCMQ 1HTTA 1H4SA 4TVYA 2Q7HA 1NJ8A 4C92F 4X9DA 5LJ5h 4P73A 1QF6A 4YRKA 4YCVA 3BDUA 3RKXA 4N0AC 2ZIOA 1J5WA 3P8VA 3E9IA 4H2UA 2DTIA 5K1PA 3JCMe 4HVCA 4C8QD 1YGBA 4EMGA 5KNNA 2JN0A 1YCYA 1H4TA 3M4GA 4NCXA 5GAMg 1D3BA 3QO5A 1X2HA 2RHSB 3RKYA 1JJCA 2EJGA 1SRYA 1EOVA 1USYC 2ZGWA 4XU2A 5GMKh 4DQ2A 4M75C 1IL2A 2RD1A 3RESA 1I81A 4RCBA 4XTVA 3V8KA 3RIRA 1G51A 3VQXA 4HWPA 2YLCA 4Q6GA 4H2TA 2Q7GA 2VXEA 4YCUA 1WYDA 4M75B 4XTZA 1BIBA 1U1TA 2ZINA 3PGGA 2C8MA 5GANg 1I5LA 4BWAA 3JCMb 1VQZA 4TVAA 5GAMe 5GAN4 2RA2A 3HTZA 4PJOC
chains in the Genus database with same CATH superfamily
3CPWP 1N9WA 4BE0A 1M1FA 1B34A 1G3SA 2VVKA 1UJ0A 1Q7YR 1RIQA 4KH0B 2D8HA 3JB9I 2DZ9A 2EYQA 1VQ7A 2NLUA 3OYCA 4QQDA 1NJ2A 3HXZA 2KGTA 2XMFA 2C06A 2BE9B 4JRPA 4LDVA 1B7YA 2ROLA 2DFUA 4BI3A 1VQOT 2DF6A 3OQ5A 1ZHIA 1OQKA 1FYNA 4EMKB 1KMNA 4YRCA 1X54A 1YHQT 1K4US 1QQJA 2K2VA 3HFNA 2KYMA 2LQ8A 3JCMW 5IN1A 5C6SA 4IIOA 5GANj 2ZNIA 2MAMA 2Z0WA 4M77C 1Z7MA 1X6OA 2RI3A 5DLQE 3UFGA 1TSFA 3MKDA 4K87A 3PVLA 4P3PA 1GBRA 2FRWA 3NPFA 4F14A 3HRIA 2EIFA 2DE0X 1N9SA 4QW2A 4F7UE 2FB7A 3MEYA 4Y92A 3CMAA 2AMCB 1B8AA 1W1FA 3OYJA 4MZPA 2ZZDA 4C5EA 3LWIA 1M90R 1X6GA 4LE9A 4YRIA 1GCQC 1K8AR 3E2UA 1W4SA 1I07A 4OLFA 1NJIR 2QEXA 1ADYA 4KGVB 2DNUA 4P72A 1OZ2A 2K79A 2HQXA 2PVGB 2FZCB 2YRVA 5GMKe 4E7LA 3EFSA 5GANd 1UGVA 3X24B 4UC4A 2OTJT 1K9MU 4LUEA 2KMTA 2ED0A 2KEAA 2F2XA 2CDTA 4PFOA 5IXBA 2CP3A 3HFZA 2CGHA 1PRMC 5GAN5 3OS5A 3AHUA 3ULRB 3JCMX 1PRLC 4JLGA 1EVLA 4ME7A 1Q95G 1M1KU 4A4FA 4Z8AA 3LGLA 2KNBB 1B3QA 4RUGA 2Q5HA 1QVGS 5KYUB 4L87A 3VS7A 3VS0A 2DM1A 3G6EQ 1W2BA 1EQRA 2QHTA 4TQFA 3MJXA 2KDSA 2KR3A 2YT6A 4A53A 1E6HA 3FC3A 4HT8A 3HKSA 2ROTA 4V2SA 1PSFA 2VGNA 2MK5A 4X9CA 4P75C 1VOMA 3CC7Q 1QVGP 2A28A 2KAFA 1WNLA 1J3TA 1M5Q1 2RK2A 2DTHA 2YWWA 3M0PA 2E6ZA 2LC4A 3Q1JA 4C0GA 3TSWA 3OYIA 1VQPT 1G5VA 4OGCA 1N9RA 2DVEA 1PWTA 4C8QB 4EMKC 5C52B 4C5GA 3H41A 1K73C 4AFZC 1RAGB 4Q15A 1ASZA 3CCVQ 1GBQA 2AKLA 2YHTA 1BK2A 3MHXA 3LH5A 1PYSB 1EIFA 1EIYA 5KYWA 4PK4A 3OYLA 2K9GA 3P8YA 2PUKB 1NJ1A 4EDUA 3CCEQ 2I4MA 5GJWB 2E41A 4FSSA 1XOVA 2GFUA 2CSIA 3IG2A 5KYXA 1QCOA 1CSKA 1Z9QA 3E9GA 4RTTA 4FM4B 3CMAT 2ZT5A 2FHDA 3SD4A 3X20B 1WFWA 2WACA 1N27A 3CXCA 3PVQA 5CK9A 1R0CB 1VQ9Q 1LYLA 2QEXT 3CMEQ 3OW2S 4RQEA 1VA7A 3GIBA 1H92A 2F1LA 4OMNA 3OYFA 5LJ3d 4J9EA 4XU0A 5FU7B 4AMCA 1EVKA 5GAOn 3M59A 1H3HA 1FX7A 3NTKA 5LJ5j 1M8MA 3L4GA 3L42A 1EFWA 1ZLMA 4CC2A 2GBQA 4II1A 4AFUC 3X28B 4YRRA 1LOJA 2RHXA 3OW2P 5GANh 3JCMV 2LT1A 3JAME 2PTKA 1JB0E 2DKGA 1B70B 4XEOA 1SF9A 2RQUA 4DOWA 2KBTA 2QXFA 4M7AF 1N8RR 1GCPA 3HRUA 2CJ9A 3BE3A 2GNCA 2A37A 2COWA 4HVUA 1PNJA 1WQWA 5GAOl 1S72A 1OI1A 1JJ2A 3PZCA 1BI3A 5LJ5d 1OPLA 4YPFA 3L2VA 3OYNA 1KHIA 2DD5A 2LJ0A 2C0TA 4J83A 1RAHB 3CCQT 1ARKA 4QVDA 1VQ4Q 4J6XA 4ZN1A 3CC2A 4BE2A 2QK0A 4OMMA 1N5ZA 2NUPA 1UJYA 1RI9A 1NJ5A 4CC4B 2CZ6B 1T3SA 2GTJA 1WX6A 3EG1A 2E70A 4XAXB 1G2BA 1WPYA 4M78E 2RN8A 4TVWA 4MMLA 4QVCA 2EJ9A 1C6VX 1QWEA 5D6YA 2JOYA 1VQMQ 4IUTA 4JZ3A 2RPNA 2KXDA 1YFTA 3EH2A 1FXXA 2X51A 1Q81R 3NGPA 1RABB 1WHMA 1NJ6A 1HJDA 1M1GA 1NEGA 1YFNA 1IHVA 5CO7A 2AKWB 2X3WD 2HKQB 1WJQA 1D0YA 5KE2A 5KCOA 2K57A 4M75A 2J6KA 3A8LB 3QYGB 3M9QA 3CCSQ 2DYBA 4C92D 2L3SA 1SRMA 4J15A 4M75F 3OSSC 2VUBA 4XTXA 1NZ9A 3REBB 2HQHA 3MF2A 4DBHA 3EGXB 2PNIA 4P3NA 4D6WA 1H641 4M7AC 3MEUA 4PNOA 2RI5A 4PJNA 2LZ6B 4E7KA 4XEMA 2L3QA 3PCOA 4OMLA 2LMJA 3MF1A 4JRKA 5LJ3h 1SPKA 1M27C 1ZUUA 2LX7A 2IY5B 1KD1C 3HY1A 1HD3A 2L2PA 1GL5A 5GANf 3M0RA 1UE9A 1KC8U 2WSCE 3CC4T 1BYMA 5DY9A 4FW1A 4IIMA 5E3IA 1IGQA 3WVEB 2V1QA 1KQ2A 4KULA 2E3CA 4P3OA 3OA6A 2RQRA 2W0ZA 3HFOA 3QWYA 2R57A 1ASYA 4C8QE 4EX5A 1SEMA 3CCUA 4J7FA 2DDZA 1IZ6A 4BACA 2RHQA 3TCJA 1MMNA 1I8FA 2FVUA 1GFCA 2QQBA 4FL6A 3CC2T 4YRNA 2ZPBB 1TXQA 3HXXA 1VQOQ 2FZKB 2QQRA 5A0DA 4CH3A 3I55A 3H0FA 1VQKA 4X9DA 5LJ5h 3THKA 5EC7A 3E9IA 2BZXA 2E5QA 1KFZA 2M16A 5K1PA 3QBYA 1Y71A 2O9SA 1YGBA 2KRSA 3UF4A 2RJFA 4LD6A 4LD9K 3M4GA 4NCXA 1TG0A 1ZA2B 4RTZA 3QO5A 2RHSB 3QZ9B 1JQQA 3RKYA 3MP1A 1G83A 5C0MA 4M75C 2X35A 2RD1A 1I81A 5KYYA 2AZVA 2OTLA 2YLCA 3UDCA 2Q7GA 2VXEA 1WYDA 4JPBW 4A4EA 4OMFB 1M3AA 2J05A 2C8MA 5GANg 4KRTA 2L89A 1I5LA 2BZYA 1N8RC 1X69A 2OTJQ 1AWOA 1QKWA 1KSWA 3OBYA 3VS2A 1R0BG 1YWOA 2CREA 4E2FB 2ARUA 3DB3A 2LCCA 3NETA 1VQNA 3JCMd 1W2BS 4AH6A 3L2RA 2DEQA 1RL2A 5CIUA 3CCMT 1H4QA 4R55A 3QTCA 2BE7D 2JTFA 4PJMA 2LNHB 4M7DA 1M30A 2M51A 4FT4A 2QHUA 1Y7XA 4RTXA 2DX1A 1Y96A 3OS2A 2W10A 1WI7A 3LWHA 2X4WA 3A5YA 3TQ7P 2D1XA 4M7DF 2NUTA 5AT1B 5IXFA 5LJ3f 1VUBA 4P71A 4K86A 2P5IA 2LCLA 4YRPA 3CCJA 4YRSA 5HGQA 2LP5A 2MF2A 8ATCB 1ATIA 1WGSA 4ORZA 1UB4A 1KOGA 4AG2C 2G4CA 5J26A 3SWNB 4HVWA 1I5OB 2PZ1A 4DEYA 4LNSA 3CCUT 4Z88A 1VQ7Q 2DYIA 1IGUA 3QKJA 2K3BA 3GF5A 1YHQA 2ODRD 5J39A 3BJUA 1OU9A 2CH4A 4C0ZA 2L3RA 1H8KA 2RK1A 4M77B 3EH1A 2M0OA 4CS3A 2E64A 3I55T 1SESA 4H2YA 1VQKT 3HPWA 5F5WA 2IVWA 3CMQA 1ZSZA 4E7ZA 5LJ5f 2DVJA 5FROA 4O6JA 2V8JA 3EAEA 4E7SA 8AT1B 2HBPA 3CXCS 2MMPA 2XGTA 4JLIA 4M78G 1D3BB 3EGDB 5KCHA 3JB9H 3LSSA 1NLOC 2EQIA 5GMKj 3CMAQ 3R6OA 1TTHB 1T0JA 4IURA 1Q82U 3TEHA 2ESWA 3P8HA 2QEXQ 1BBWA 1X27A 3KUFA 2GQVA 2A36A 4FW2A 1XNIA 1XQHA 2MYSA 5LJ3g 3CXCP 2QDYB 4BE1A 4PLIA 4DOVA 4F04B 1NYQA 3REXA 1E24A 4TVAB 2QGGA 1K73U 2F69A 4M7DC 3ME9A 4J9FA 1MMDA 2K6DA 2A8EA 3PMIA 2CP5A 3I56T 1VQNT 3SEMA 3VQWA 1B34B 2XU8A 1SRLA 2D0NA 4YRTA 3I5SA 1NNHA 2ZR2A 4P71C 1KHCA 4KR3A 1JJ2S 1JO8A 4RMFA 4N0AA 3CD6T 2KI7A 1B7YB 5C51B 2QDLA 4FT2A 3JCMh 3M55A 3CCJT 1M2VA 3QSUA 2RH2A 2E10A 1LCKA 3E9HA 3OS0A 2RHYA 3FB9A 4FSXA 3QHSA 5LJ5g 2JTEA 2ARSA 4WJ3M 2YRDA 1WLPB 2ZPEB 3S3OA 1PHTA 3SWNC 4QQ6A 1BBZA 1JJ2P 1VQPA 1WHHA 2ZPHB 3KFVA 2E3HA 4XTUA 1WDXA 1OU8A 4MZMA 5FU6C 1P92A 2DK3A 4RTWA 2J7IA 3BFMA 3MP6A 4HWOA 1ZSZC 1Q7YU 2LX9A 4XTYA 5FW9A 5IT9E 2XIDA 2PVDB 3GNGA 4C8QG 5CVIA 3G1ZA 5J3BA 2QHVA 1V76A 2EKOA 4ZNXA 4YREA 2H3EB 1CKBA 5HY6A 2VB6A 3RUXA 3LW5E 2LNVA 2XDPA 2HMAA 3VQVA 4YP0A 2AT1B 1JBMA 3R07A 5CR2A 4E51A 2F2VA 4BI8B 2DL5A 2DU7A 1UGSB 1M9SA 4AFQC 1BKBA 4YRLA 1BI2A 4LN2A 3UWNA 2DAQA 2GGRA 2LTOA 4E6RA 4OMOA 3HFZB 4ZTJA 3I5RA 1EX4A 2ZT6A 1Q86R 2V26A 2PMFA 1WYXA 3MO8A 4J9HA 2CUDA 2M1HA 1RLPC 1T3LA 4B6MA 4PJOE 3QO8A 3H9NA 3PFSA 4M78A 4BUGA 2J3MA 4MMKA 4C92G 2JM9A 3TEGA 2DRKA 4DBRA 4PJJA 2L3PA 1NBEB 4OVAA 1M90U 5K1XA 2ZNJA 3EFRA 3JB9G 1K8AU 3M4YA 2QTXA 1NJIU 1B7TA 1IRXA 4OF1A 2E1HA 2OAWA 1AT1B 1AZEA 3HRTA 1FMKA 3O5ZA 2DO3A 1BB9A 2I4LA 4Y28E 2ZPIB 3CC4Q 2GFAA 2JT4A 2PQWA 1WXTA 1E1TA 1NM7A 4J6YA 5FWCA 3A74A 1BBUA 3CCQA 1X55A 1S72Q 4M77E 3JCMf 3C4SA 1KD1R 4O2DA 1KIKA 1HSQA 3UT1A 2L5QA 4QQGA 5GAN7 3FJ5A 3VRZA 1LPLA 1X2GA 4KQEA 1HYOA 3BY7A 1GXIE 3T9NA 1EIYB 3CC2Q 1OZ3A 5KYWB 1F1BB 1U1SA 2H3JA 4GY5A 1HC7A 5KYXB 3JSCA 3TREA 4ZGEB 5GAOp 2QA4T 4M78D 1X43A 1ZA1B 4D8KA 1AEYA 1USYA 4KT0E 3ZFJA 1ZBXA 2KE9A 2RM4A 3M57A 5GMKm 2K5IA 1VQ6A 1EFNA 5D6WA 4RMOA 1SHGA 3REUA 1UFFA 3NTIA 5GAMj 2X4YA 1JRIA 3OB9A 3A7RA 4EMHA 2QASA 3G4SA 4UPAA 4R0KA 2ZCFB 2C7IA 3L2UA 4P72C 1WQ7A 2MWPA 2CSQA 1K0XA 5FRNA 2DL4A 4YRJA 3QO7A 1PC0A 3L4GB 1SKUB 3DLLA 3HP9A 5A0LA 1JXMA 1VQ8A 3C94A 2DQ0A 3I7FA 2K3XA 4YDQA 3M53A 1NYFA 3A8HB 4M7AB 3MPUB 5L8RE 3GBQA 4JJBA 4C5IA 5HCKA 4WI1A 1MNDA 1QVFA 1YJWT 5CQXA 3FLGA 2DL7A 1G8XA 4RTVA 1WXBA 5GAOq 3M0UA 2AZSA 3JCMg 2EGCA 4Y91A 1SSFA 1D0XA 4KR2A 4FCYA 3CCMQ 4BB7A 2ZT8A 4YROA 3CC4A 1X6BA 3V7SA 2RO0A 2EKHA 3P8DA 2RQTA 3QO3A 2P0KA 4C92A 2NUPB 2L0AA 3M58A 4PJOC 5GJVB 1K9AA 1H4SA 2Q7HA 4C92F 4P73A 5I22A 4KUDK 3BDUA 3GPLA 3H6ZA 4H2UA 3FRNA 2DTIA 3EHRA 1TU0B 4C8QD 4EMGA 3CCUQ 5I2MA 2JN0A 2HSPA 1H4TA 1N8RU 5CKDA 2R5MA 4KGXB 1JJCA 1SRYA 1EOVA 1USYC 4XU2A 2YUNA 2XK0A 3C12A 4Z02A 1SSHA 2QI2A 2QGFB 1WHLA 1W6XA 3I55Q 2E12A 3V8KA 1RAFB 3RIRA 1VQKQ 1YBYA 3G7ZA 2JMAA 5M9OA 3WVDB 3QWXX 1PCXA 2O4XA 5A2QE 4M75B 4XTZA 1VQ6T 4A4KA 1YN8A 4JS5A 3OYDA 1T0HA 1Q86C 2DA9A 4XK8E 4E7HA 3JCMb 1VQZA 4AFSC 1QCNA 3PT9A 4A4HA 1RAIB 3G4ST 2O01E 2QG9B 5GAMe 5GAN4 2RA2A 5DLOA 2RQVA 1XJWB 1QKXA 4OP0A 3RNJA 1X2QA 1YB3A 3EG0A 1UGPB 2DIQA 1FYFA 3JB9D 2ARTA 5KE3A 2KRNA 1OOTA 4HXJA 2OTLQ 1B07A 1VQ8T 4F7UG 3S3MA 1Q81U 3PCOB 3GP8A 2A0FB 1Y07A 1L0WA 3EFOA 2IIMA 2I0NA 2QAZA 2EL9A 3X26B 2JTMA 1VYUA 4N4GA 3CCMA 1UGRB 4CH4A 2CJBA 3QDFA 2CJAA 2EAYA 3REAB 3M5AA 3I56Q 3QNEA 1MV0B 2XICA 2DBMA 1VQNQ 3MEVA 4X5OA 1K1ZA 5I11A 1FMWA 3ZL7C 1KQSA 2NS6A 4C92C 1MV3A 4PJOG 3RERA 1UUEA 1AD5A 2RHQB 3VS4A 4HWTA 4ZGJB 3OD1A 1ZBJA 2ZCEA 4P73C 2HAXA 3RL6A 2LJ3A 3VBBA 3HXVA 2JVVA 3RDVA 3D7SB 1G5IA 4PKCC 3CCJQ 4OB2B 3UA7A 1HK9A 4OMPA 3GLXA 3EG3A 2O31A 3CCLA 4YTLA 1NYGA 2YUPA 2X9HA 3LH0A 3HRSA 4GLMA 3A8OB 1WZOA 5IH2A 2IG0A 2E65A 5C53B 1C0MA 4CC3A 4F17A 2JM8A 1YHQQ 4P5NA 4TTVA 2O88A 3V7CA 3M54A 2F2WA 4M77G 3A5ZA 1WXUA 2FO0A 4K11A 1CKAA 1E7OA 5KYYB 4F16A 4OGEA 1PD0A 4BY6B 1D1AA 4XTWA 3G71T 4RQFA 2RMOA 1M3BA 3LGFA 4HKEA 1WJRA 2HZYA 2NYSA 3UGQA 4RG2A 1PM3A 3BDLA 3RF1A 1YFSA 4CS2A 2KT8A 4HWSA 4M7AE 2JXBA 2RNAA 5GMKl 4L6V5 3CCRT 4EIKA 3UH0A 2KQWA 2M02A 4X34A 4KUIA 1AWJA 2XHCA 2Q7EA 1K76A 1IREB 2R58A 2YUQA 2YDLA 5IHKA 2M0YA 2ZZGA 2PUOB 1MUZA 3DSQA 4ZTFA 1VQ9T 3VYGA 3EG2A 3PE0A 4M7DB 3VU3C 2XG8D 2K2MA 2WSEE 1E22A 1Y96B 4H2XA 4CRIA 1VQLA 1NLPC 5CQYA 3I56A 2E5AA 2NUTB 1AOJA 2HL3A 2F5KA 2J06A 1YJ9A 4HCBA 3HRKA 1AWXA 3MP8A 5CKFA 1SETA 2QTVA 4LVMA 1H3ZA 2DQ3A 2FG0A 4F7UA 1BI0A 3CD6A 2DEUA 1KMMA 1RUWA 5HK3A 2D6FA 3TU4K 3SHWA 2KK4A 1M8VA 4F7UF 4C0DC 1RLQC 3A8MB 3U23A 4J9BA 3OMGA 1EZZB 3P8BB 3NENA 3CBPA 2AKKA 2B8AA 2CH4W 3M56A 2K5FA 4ANJA 4PL6A 4O5VA 2D9TA 4HCKA 2EJFA 2QQSA 1IB8A 4HA8A 2VKNA 5FU6B 2VYTA 3P8TA 3CCLT 1BCMA 1ZSZB 4B9WA 4PJOA 4FU6A 1YIJA 2FEIA 3VYHB 1QW1A 3CBMA 1VQPQ 3W3SA 4M75E 2YLBA 3NELA 4JRIA 3OYMA 4CS4A 2P0LA 1VQ4T 3CEYA 2MOXA 1AHJB 4UP8A 4B9XA 3HY0A 4IUUA 2ZR3A 3ZEHA 1YP5A 1I1JA 2QA4Q 3J7AF 3S6WA 5GAN2 1IO6A 1K0SA 1TS9A 2P0PA 3VV0A 2HQEA 12ASA 2EQKA 2ED1A 3TEHB 4ELYC 1G5HA 2DJZA 3OYEA 4BY6C 4GBQA 2FPEA 4IKFA 1NYRA 2PMEA 4TWAA 2ODRC 2GCXA 3L2ZA 4ZTUB 2ALYA 4FYVB 2VWFA 4G85A 2JJ9A 1WIEA 5CKHA 3SFMA 1SG5A 4WF2A 2LVMA 1QP2A 4J9IA 2A7YA 2CYZB 3VRYA 1UHCA 2NWMA 3KXTA 1C1AA 1QVFS 1AZGB 2V8IA 2XI9A 3SB2A 4DPGA 4RDXA 5HKCA 2E3IA 2CIMA 4OB1B 1G3TA 1GCQA 3H0HA 1PKSA 2COZA 2JS0A 1SERA 4PJOD 4CC7A 5IHIA 3JV3A 1VQLT 3VQYA 2YSQA 2RI2A 3MEAA 3IALA 2OX7A 1YJ9T 2C0OA 5IAYA 1VQ5A 1QVFP 1M2VB 1UTIA 2DMOA 5ECAA 1W70A 2DJQA 3SDZA 1O9SA 3ERRA 5FRMA 5D6XA 1D1BA 3JCMJ 2LCSA 1YI2A 2J3LA 3TSZA 4BDYA 5GAOm 1QE0A 4R56A 2CP7A 1YNZA 3RBBB 3UGTA 4J9DA 2AK5A 3J81E 4WJ4A 1VYTA 4LVIA 2CUBA 3CCQQ 2ZPGB 2QQ9A 4M77D 2MI6A 3RKWA 2BKDN 3LYIA 4FYYB 3RMSA 4LDXA 3HXWA 1MMAA 4MDXA 1TWBA 3A1PA 3CPFA 2ZTGA 4K88A 3EG9A 3QDRB 1YIJT 1WJSA 2DPPB 2QA4A 2RHIA 3H8ZA 2OI3A 3GOXA 1BU1A 2DU5A 5GAN6 4P75A 2DETA 3A31A 4YCWA 3A98A 1BCOA 1S1NA 1TUDA 1ZX6A 3M0TA 4IUQA 2RF0A 3O8VA 1Z7NA 1WLEA 4YYEA 3MQZA 3UATA 1VQ6Q 3HSBA 2CP6A 3E1SA 5CKEA 1YITA 3L2WA 1PG5B 1ABOA 4EMKA 3H0IA 5GAN3 3HHTB 3OS1A 3G4SQ 4BD3A 4M7DE 2EYZA 1YJNA 4J9CA 1K9MR 3PMTA 1X2KA 3FIFA 2SEMA 4WTOB 1LJOA 4M78B 1B76A 2ZZEA 5FWBA 1D09B 2E4HA 3IKLA 2KYBA 2LDMA 1JU5C 5ELNA 1AWWA 1LNXA 1UG1A 3QPHA 1KQ1A 1YJWA 1VQ8Q 4VUBA 1IXDA 1QMCA 1M1KR 3QYHB 1H4VB 2CZ0B 4HVVA 4M7AG 2AMCA 5ELOA 4FYXB 4HT4A 4M78F 3TEEA 4N4IA 4LNPA 1X56A 1RADB 1WHJA 2LRQA 3PIPA 1KQSS 1UECA 1HTTA 1NJ8A 1QF6A 4YRKA 4YCVA 3RKXA 4N0AC 2ZIOA 1Y0MA 4D8DA 1VQ5T 1DJ7B 5AYFA 4DEXA 1X75C 1Q86U 2HEQA 1Y57A 4RKUE 1YCYA 4JDSA 3OY9A 4E47A 4DBFA 1QWFA 1LVKA 2D8JA 2RJCA 1PD1A 4LUDA 2RHUA 6AT1B 1YI2T 3LLRA 2X4XA 2EJGA 4RTYA 4TVRA 5GMKh 1KQSP 2P84A 3S3NA 4RCBA 4XTVA 3AT1B 2CP0A 1G51A 4FIBA 4HWPA 1RACB 4H2TA 3LX7A 2ZAEA 5KYUA 2JW4A 4OB3B 1U1TA 2ZINA 4LVJA 4GLKA 4LDYA 3FEOA 1U06A 4BWAA 1VQ7T 1BI1A 1Q82C 4X1VA 1U3OA 1O75A 4RTUA 1KG1A 2HL5C 2DD4A 2KSSA 3RGLA 5KH6A 5CCAA 2I4NA 1VYVA 1UEBA 2Q5IA 1KD1U 2FPDA 4ZGDB 4P74A 2JUFA 4H2WA 4YRGA 4G84A 4ESRA 3R6NA 3VS1A 3V8LA 3JB9J 2BUDA 4LDUA 1WU7A 3G71Q 3V8JA 4M75G 5LJ3j 5FLXE 1OYXA 3OYYA 2K7AA 1YITT 4PLLA 4ATOA 5GANe 2XDDA 1G3WA 4C8QA 1ACMB 2X3XD 4ZIBA 3LSQA 4JS4A 4UP7A 4MDWA 3KFUA 1YJNT 3CCRQ 1KK7A 4C8QF 2XD0A 4E7IA 4CI0C 4M4ZA 4M78C 1PYSA 3QJYA 2EGEA 4HT9A 2R5AA 3NEMA 1Z9ZA 4BW9A 11ASA 3OYBA 2JNGA 1FMVA 5GAMd 2HBWA 2Y90A 1SHFA 1PKTA 2KT1A 2O2OA 3A7AA 4NL2A 4L59A 4C92B 2KVQG 5GMKi 1TOVA 1KJWA 1XTDA 4OMQA 3QJ6A 2GF7A 4RCCA 4PJLA 4J9GA 3DLMA 1Q7YC 1I4K1 3A8GB 5IHNA 5EG2A 3OYAA 4NL3A 3CPWA 4N4HA 2FZGB 3G6EA 2DZCA 4M7AA 1YWPA 3C95A 1ZUKA 3HXYA 4CH6A 4TQDA 2J6FA 3L1AA 3JB9F 1JJCB 3EHQA 3QG1A 2EFIA 4H2VA 4CH5A 1QCFA 2EQUA 2EPDA 1B70A 3CC7A 2ZZFA 5LL6S 3CCLQ 3VKIA 2DTOA 5CAIA 2O4XB 5KYNA 1MHNA 3IKMB 4H02A 5I2SA 1U5SA 1ADJA 3V7RA 4YRMA 7AT1B 2LQNA 5HK0A 3TUPA 1K9MC 4P74C 3VS5A 1RAAB 4QKUA 3G71A 2CZ1B 1TUGB 4XU1A 3CCVA 4PFPA 2ATCB 3JCMc 3A32A 1M90C 2G3RA 2OAUA 3NMZC 2IPOB 1K8AC 3HXUA 3CCEA 4C8QC 3C0CA 1NJIC 2GTOA 1M1KC 1M3CA 3CCRA 1NPPA 2LQKA 9ATCB 3EFOB 4OB0B 2OJ2A 5LJ3e 4XU3A 4HCZA 2VXFA 4LVLA 3WXMB 4M7AD 3WQZA 2C0IA 1OULA 4IUPA 4KGZB 1IHWA 1I0CA 3I35A 1C0AA 2MCNA 2V1RA 1VQ9A 2X4JA 2YRCA 2EW3A 5L23A 3CMEA 2JS2A 1OV3A 2NUZA 4J6WA 5I21A 2AHJB 2DXBA 3OBWA 1D1CA 3DKMA 4JJNK 2BZ8A 1AVZC 2RB6A 4M7DG 2AKWA 1RAEB 1HXDA 2DRMA 1KC8R 3KBGA 1VQLQ 3ZBDA 2Y4YA 1NEBA 3HFVA 3PNWC 2Y4XA 3LC0A 2HKNA 4JRQA 2HNIA 4XQ3A 1YJ9Q 4C0DB 1VIEA 1E6GA 1MGQA 5FU7C 1OEBA 2J6OA 4YRQA 1JXOA 5LJ5e 2D0QB 5GAMh 4H2SA 3CD6Q 2XTIA 2MPXC 1GRIA 3NTHA 1QP3A 1RI0A 3EGXA 2VASA 4JUVA 1GGMA 3M4QA 1UHFA 3G6ET 2DXTA 1WHKA 3OSVA 2CS7A 2P4RA 2DILA 2QYZA 1QVGA 1A0NB 3CBOA 1WA7A 3L2QA 3JRZA 2E6NA 3A5ZB 4PFZA 3VJPA 1W66A 2IY5A 4EO4A 1S72T 3NFCA 4A4GA 1VQ4A 3CC7T 2EGAA 2ENMA 2K3YA 2RHZA 2RQWA 2I2LA 1YIJQ 3META 4LXCA 2BTTA 3RACA 3UPUA 4M75D 2K5LA 3EGUA 3E9FA 3I9QA 4BI4A 1E1OA 2ZIMA 4RG8A 3OYKA 3VUBA 2ZXFA 4HWRA 2HD0A 2F5TX 2A08A 4J5YA 3M0QA 1QVPA 2JZ2A 1VQMA 2A3LA 2ABLA 4Z89A 3CCVT 4ZTZB 2DXUA 1OPKA 2CKKA 2P0QA 2EWNA 2FRYA 2I4OA 4AG1C 4JZ4A 3CCET 2M9UA 2FPFA 2DL8A 3M0SA 4LDWA 2XKOC 2BIVA 2ZPFB 3OYHA 1ABQA 2H8HA 5GAOr 3VUZA 4FYWB 4H2XB 3TVTA 1MNEA 4C5HA 1V1CA 4KH1B 5D7UA 4BDZA 3CCSA 2DERA 2QHSA 1ZSGA 4C92E 3JCMP 3OYGA 3F70A 3CMET 1QLYA 2CZ7B 3X25B 2CT4A 4JJCA 1TUCA 2RHSA 2P4TA 2EQJA 4F7UB 2VGMA 3INZA 1OX9A 2CT3A 4NOYA 3RMQA 4IUVA 2VV5A 1X01A 1NPRA 4WCIA 2HSEB 3OW2A 2O9VA 1U8RA 3HTRA 3OMCA 4KBMB 4DBQA 2HDAA 1VQ5Q 2L8DA 1YFRA 2KRMA 2RJEA 3NHNA 2EYXA 3FDRA 4ZN3A 2KXCA 3RR6A 1FWZA 2KROA 4MZTA 2EVRA 5A0GA 1YI2Q 4PJOB 2AIRB 3VS3A 3URGA 5GAMf 3ICAA 2PVOB 1WHGA 4E7JA 3ASKA 3J80E 2B86A 1NG2A 1ZQ1A 3PIOA 4HCCA 2DBKA 2YXYA 3IQLA 2WSFE 1W2BP 2LQWA 1BIAA 3A7UA 1ZUYA 4PJOF 2EQMA 2LT4A 3E19A 4PHCA 2LJ1A 2GQIA 1VQOA 5GAN8 1TH7A 3MEWA 2KY9A 4EPCA 1Q81C 3QUIA 2ZT7A 3PTAA 2K4YA 3QXEB 2ECZA 4A63B 1R8OB 3SWNA 1JEGA 2ALYB 4YRFA 1D0ZA 3BW1A 2COYA 4PG3A 3VS6A 4ELZC 1PSEA 1VQMT 2EYYA 4JJDA 4L5GA 1Q82R 3UA6A 3QIIA 3FJPA 4A54A 3N5BB 3G1JA 1GFDA 1G3YA 1R77A 2EYWA 2DXCA 2VC8A 1YITQ 4M77A 2YUOA 1NE8A 2EBPA 2V8KA 2FYKA 4NS5A 2FL7A 1OX8A 2E5KA 1KC8C 4M77F 4DA4A 4M7DD 3M4PA 4UP9A 4J8OA 3JCMQ 1YJNQ 2QQAA 4TVYA 2HCKA 3DB4A 1UDLA 1MMGA 3QZ5B 1K73R 2PU9B 1J5WA 3P8VA 1M4ZA 3CCST 2JMCA 3JCMe 2DLPA 4HVCA 5DM7R 4QT7A 5KNNA 2SRCA 1YJWQ 2OTLT 2OTJA 4J7IA 1D3BA 3EGDA 5GAMg 1X2HA 1N6AA 4QVZA 3MCAB 2ZGWA 1YCSB 4DQ2A 1IL2A 3RESA 2MIOA 4Q5WA 3CPWS 4AT1B 4LVKA 3VQXA 2CP2A 1M2OA 3CQTA 4Q6GA 2G6FX 3HL8A 4YCUA 2XDBA 2DIGA 1BIBA 4C0FA 1V29B 3PGGA 5CKBA 2RJDA 2MWOA 3GNFB 3EG9B 1UGQB 1VIFA 4TVAA 2DL3A 3HTZA 3ER0A
chains in the Genus database with same CATH topology
1N9WA 4BE0A 1M1FA 1B34A 1G3SA 1RIQA 3JB9I 2DZ9A 2EYQA 1VQ7A 2NLUA 3OYCA 4QQDA 1NJ2A 3HXZA 2C06A 4JRPA 4LDVA 1B7YA 4BI3A 1VQOT 3OQ5A 1ZHIA 4EMKB 1KMNA 4YRCA 1X54A 1YHQT 2K2VA 3HFNA 2LQ8A 3JCMW 5IN1A 5C6SA 5GANj 2ZNIA 2MAMA 4M77C 1Z7MA 1X6OA 2RI3A 5DLQE 3UFGA 4K87A 4P3PA 3HRIA 3ER0A 2EIFA 1N9SA 4QW2A 4F7UE 2FB7A 3MEYA 2AMCB 3CMAA 1B8AA 3OYJA 4MZPA 2ZZDA 4C5EA 3LWIA 4YRIA 1W4SA 4OLFA 2QEXA 1ADYA 4P72A 1OZ2A 2HQXA 2PVGB 2YRVA 5GMKe 4E7LA 3EFSA 5GANd 3X24B 4UC4A 2OTJT 1K9MU 2KMTA 3HFZA 2CGHA 5GAN5 3OS5A 3AHUA 3JCMX 4JLGA 1EVLA 4ME7A 1M1KU 4A4FA 3LGLA 2Q5HA 1QVGS 4L87A 1W2BA 1EQRA 2QHTA 4TQFA 2KDSA 4A53A 3FC3A 4HT8A 3HKSA 4V2SA 1PSFA 2VGNA 4X9CA 4P75C 2KAFA 1WNLA 1M5Q1 2RK2A 2DTHA 3Q1JA 2E6ZA 2LC4A 4C0GA 3OYIA 1VQPT 1G5VA 4OGCA 1N9RA 2DVEA 4C8QB 4EMKC 5C52B 4C5GA 1K73C 4Q15A 1ASZA 2YHTA 3MHXA 1PYSB 1EIFA 1EIYA 3OYLA 3P8YA 2PUKB 1NJ1A 4EDUA 2I4MA 2E41A 1XOVA 2GFUA 3IG2A 3E9GA 4FM4B 3CMAT 2ZT5A 2FHDA 3SD4A 3X20B 2WACA 1N27A 3CXCA 5CK9A 1LYLA 2QEXT 3OW2S 4RQEA 3GIBA 3OYFA 5LJ3d 4XU0A 5FU7B 1EVKA 5GAOn 3M59A 1FX7A 3NTKA 5LJ5j 3L4GA 3L42A 1EFWA 4II1A 3X28B 4YRRA 1LOJA 2RHXA 5GANh 3JCMV 2LT1A 3JAME 1JB0E 2DKGA 1B70B 4XEOA 4DOWA 2QXFA 4M7AF 3HRUA 2CJ9A 5GAOl 1WQWA 1S72A 1OI1A 1JJ2A 3PZCA 1BI3A 5LJ5d 4YPFA 3L2VA 3OYNA 1KHIA 2DD5A 4J83A 3CCQT 4QVDA 4J6XA 4ZN1A 3CC2A 4BE2A 1NJ5A 2CZ6B 4XAXB 2E70A 1WPYA 4M78E 4TVWA 4MMLA 4QVCA 2EJ9A 5D6YA 2JOYA 4IUTA 1YFTA 1FXXA 1NJ6A 1M1GA 5CO7A 2AKWB 1WJQA 5KCOA 5KE2A 2K57A 4M75A 3A8LB 3QYGB 3M9QA 4C92D 4J15A 4M75F 3OSSC 2VUBA 4XTXA 1NZ9A 3MF2A 4P3NA 4D6WA 1H641 4M7AC 3MEUA 4PNOA 2RI5A 4E7KA 4XEMA 3PCOA 3MF1A 4JRKA 5LJ3h 2IY5B 1KD1C 3HY1A 5GANf 1KC8U 2WSCE 3CC4T 1BYMA 5DY9A 5E3IA 3WVEB 1KQ2A 4KULA 2E3CA 4P3OA 3OA6A 3HFOA 2R57A 1ASYA 4C8QE 4EX5A 3CCUA 4J7FA 2DDZA 1IZ6A 4BACA 2RHQA 3TCJA 1I8FA 2FVUA 2QQBA 4FL6A 3CC2T 4YRNA 2ZPBB 3HXXA 2QQRA 5A0DA 4CH3A 3I55A 1VQKA 4X9DA 5LJ5h 3E9IA 2E5QA 2M16A 5K1PA 3QBYA 1Y71A 1YGBA 2RJFA 4LD9K 4LD6A 3M4GA 4NCXA 3QO5A 2RHSB 3QZ9B 3RKYA 3MP1A 5C0MA 4M75C 2X35A 2RD1A 1I81A 2OTLA 2YLCA 3UDCA 2Q7GA 2VXEA 1WYDA 4A4EA 4OMFB 2C8MA 5GANg 2L89A 1I5LA 1N8RC 3OBYA 2ARUA 3DB3A 2LCCA 3NETA 1VQNA 3JCMd 1W2BS 4AH6A 3L2RA 2DEQA 1RL2A 5CIUA 3CCMT 1H4QA 4R55A 3QTCA 2JTFA 4M7DA 4FT4A 2QHUA 1Y7XA 3OS2A 1Y96A 3LWHA 2X4WA 3A5YA 4M7DF 5LJ3f 1VUBA 4P71A 4K86A 2P5IA 2LCLA 4YRPA 3CCJA 4YRSA 5HGQA 2MF2A 1ATIA 1WGSA 1KOGA 1UB4A 2G4CA 5J26A 3SWNB 4LNSA 3CCUT 3QKJA 3GF5A 1YHQA 2ODRD 5J39A 3BJUA 4C0ZA 2L3RA 2RK1A 4M77B 2M0OA 4CS3A 2E64A 3I55T 1SESA 4H2YA 1VQKT 3HPWA 5F5WA 2IVWA 3CMQA 5LJ5f 5FROA 4O6JA 2V8JA 3EAEA 2HBPA 3CXCS 2MMPA 2XGTA 4JLIA 4M78G 1D3BB 5KCHA 3JB9H 3LSSA 5GMKj 3R6OA 4IURA 1Q82U 3TEHA 3P8HA 1BBWA 3KUFA 2GQVA 1XNIA 1XQHA 5LJ3g 2QDYB 4BE1A 4PLIA 4DOVA 1NYQA 3REXA 1E24A 4TVAB 1K73U 2F69A 4M7DC 3ME9A 2A8EA 3PMIA 3I56T 1VQNT 3VQWA 1B34B 2XU8A 4YRTA 1NNHA 2ZR2A 4P71C 1KHCA 4KR3A 1JJ2S 4RMFA 4N0AA 3CD6T 1B7YB 5C51B 4FT2A 3JCMh 3M55A 3CCJT 3QSUA 2RH2A 2E10A 3E9HA 3OS0A 2RHYA 3FB9A 4FSXA 3QHSA 5LJ5g 4WJ3M 2ARSA 2ZPEB 3S3OA 3SWNC 4QQ6A 1VQPA 2ZPHB 4XTUA 4MZMA 5FU6C 1P92A 2DK3A 3BFMA 3MP6A 4HWOA 1Q7YU 2LX9A 4XTYA 5IT9E 2XIDA 2PVDB 3GNGA 4C8QG 5CVIA 3G1ZA 5J3BA 2QHVA 2EKOA 4YREA 5HY6A 3RUXA 3LW5E 2LNVA 2XDPA 3VQVA 4YP0A 1JBMA 3R07A 5CR2A 4E51A 4BI8B 2DU7A 1UGSB 1M9SA 1BKBA 4YRLA 1BI2A 3UWNA 2DAQA 2LTOA 3HFZB 4ZTJA 2ZT6A 2PMFA 3MO8A 2M1HA 4PJOE 3QO8A 4M78A 3PFSA 4BUGA 2J3MA 4MMKA 4C92G 3TEGA 4OVAA 5K1XA 1M90U 2ZNJA 3EFRA 3JB9G 1K8AU 3M4YA 2QTXA 1NJIU 4OF1A 2E1HA 3HRTA 2DO3A 2I4LA 4Y28E 2ZPIB 2GFAA 2PQWA 1E1TA 4J6YA 3A74A 1BBUA 3CCQA 1X55A 4M77E 3JCMf 3C4SA 4O2DA 3UT1A 2L5QA 4QQGA 5GAN7 1X2GA 4KQEA 3BY7A 1GXIE 3T9NA 1EIYB 1OZ3A 1U1SA 2H3JA 4GY5A 1HC7A 3JSCA 3TREA 4ZGEB 5GAOp 2QA4T 4M78D 1USYA 4KT0E 3ZFJA 1ZBXA 2RM4A 3M57A 5GMKm 2K5IA 1VQ6A 5D6WA 4RMOA 3REUA 3NTIA 5GAMj 2X4YA 1JRIA 3OB9A 3A7RA 4EMHA 3G4SA 4UPAA 2ZCFB 2C7IA 3L2UA 4P72C 1WQ7A 2MWPA 5FRNA 4YRJA 3QO7A 3L4GB 3DLLA 3HP9A 5A0LA 1VQ8A 3C94A 2DQ0A 3I7FA 2K3XA 4YDQA 3M53A 3A8HB 4M7AB 5L8RE 4C5IA 4WI1A 1QVFA 1YJWT 5CQXA 3FLGA 5GAOq 3JCMg 4Y91A 1SSFA 4KR2A 4BB7A 2ZT8A 4YROA 3CC4A 3V7SA 2RO0A 3P8DA 3QO3A 2P0KA 4C92A 3M58A 1H4SA 2Q7HA 4C92F 4P73A 4KUDK 3BDUA 3GPLA 3H6ZA 4H2UA 3FRNA 2DTIA 4C8QD 4EMGA 5I2MA 2JN0A 1H4TA 1N8RU 5CKDA 2R5MA 1JJCA 1SRYA 1EOVA 1USYC 4XU2A 2XK0A 3C12A 4Z02A 2QI2A 2E12A 3V8KA 3RIRA 1YBYA 3G7ZA 5M9OA 3WVDB 2O4XA 5A2QE 4M75B 4XTZA 1VQ6T 4A4KA 4JS5A 3OYDA 1Q86C 4XK8E 4E7HA 3JCMb 1VQZA 4A4HA 3PT9A 3G4ST 2O01E 5GAMe 5GAN4 2RA2A 5DLOA 4OP0A 1YB3A 1UGPB 2DIQA 1FYFA 3JB9D 2ARTA 5KE3A 1VQ8T 4F7UG 3S3MA 1Q81U 3PCOB 3GP8A 1Y07A 1L0WA 2EL9A 3X26B 2JTMA 4N4GA 3CCMA 1UGRB 4CH4A 2CJBA 2CJAA 2EAYA 3M5AA 3QNEA 2XICA 3MEVA 4X5OA 1KQSA 2NS6A 4C92C 4PJOG 3RERA 4HWTA 2RHQB 4ZGJB 3OD1A 2ZCEA 4P73C 2HAXA 3RL6A 3VBBA 3HXVA 2JVVA 1G5IA 4PKCC 4OB2B 1HK9A 3GLXA 3CCLA 4YTLA 3LH0A 3HRSA 3A8OB 2IG0A 2E65A 5C53B 4P5NA 4TTVA 3V7CA 3M54A 4M77G 3A5ZA 4OGEA 4BY6B 4XTWA 3G71T 4RQFA 3LGFA 4HKEA 1WJRA 3UGQA 4RG2A 3BDLA 3RF1A 1YFSA 4CS2A 4HWSA 4M7AE 5GMKl 4L6V5 3CCRT 3UH0A 2KQWA 4X34A 4KUIA 2XHCA 2Q7EA 1IREB 2R58A 2ZZGA 2PUOB 3DSQA 4ZTFA 1VQ9T 3VYGA 4M7DB 3VU3C 2XG8D 1E22A 2WSEE 1Y96B 4H2XA 4CRIA 1VQLA 5CQYA 3I56A 2E5AA 2F5KA 1YJ9A 4HCBA 3HRKA 3MP8A 5CKFA 1SETA 4LVMA 1H3ZA 2DQ3A 4F7UA 1BI0A 3CD6A 1KMMA 5HK3A 2D6FA 3TU4K 1M8VA 2KK4A 4F7UF 4C0DC 3A8MB 3OMGA 3P8BB 3NENA 3CBPA 3M56A 2B8AA 2K5FA 4PL6A 4O5VA 2D9TA 2EJFA 2QQSA 4HA8A 5FU6B 2VYTA 3P8TA 3CCLT 4B9WA 4PJOA 4FU6A 1YIJA 3VYHB 1QW1A 3CBMA 3W3SA 4M75E 2YLBA 3NELA 4JRIA 3OYMA 4CS4A 2P0LA 1VQ4T 3CEYA 1AHJB 4UP8A 4B9XA 3HY0A 4IUUA 2ZR3A 3ZEHA 3J7AF 3S6WA 5GAN2 2P0PA 3VV0A 2HQEA 12ASA 2EQKA 3TEHB 4ELYC 1G5HA 2DJZA 3OYEA 4BY6C 4IKFA 1NYRA 2PMEA 4TWAA 2ODRC 2GCXA 3L2ZA 4ZTUB 2ALYA 4G85A 5CKHA 3SFMA 4WF2A 2LVMA 1QP2A 2A7YA 2CYZB 3KXTA 1QVFS 2V8IA 2XI9A 3SB2A 4DPGA 4RDXA 5HKCA 2CIMA 4OB1B 1G3TA 1SERA 4PJOD 1VQLT 3VQYA 2RI2A 3MEAA 3IALA 1YJ9T 5IAYA 1VQ5A 3SDZA 3ERRA 1O9SA 5FRMA 5D6XA 3JCMJ 1YI2A 2J3LA 4BDYA 5GAOm 1QE0A 4R56A 3UGTA 3J81E 4WJ4A 4LVIA 2ZPGB 2QQ9A 4M77D 2MI6A 3RKWA 2BKDN 3LYIA 3RMSA 4LDXA 3HXWA 4MDXA 3CPFA 2ZTGA 4K88A 3QDRB 1YIJT 1WJSA 2DPPB 2QA4A 2RHIA 3H8ZA 3GOXA 2DU5A 5GAN6 4P75A 3A31A 4YCWA 4IUQA 3O8VA 1Z7NA 1WLEA 4YYEA 3MQZA 3HSBA 5CKEA 3E1SA 1YITA 3L2WA 4EMKA 5GAN3 3HHTB 3OS1A 4BD3A 4M7DE 1YJNA 3PMTA 3FIFA 1B76A 1LJOA 4M78B 2ZZEA 3IKLA 2LDMA 5ELNA 1LNXA 3QPHA 1KQ1A 1YJWA 4VUBA 3QYHB 1H4VB 2CZ0B 4M7AG 2AMCA 5ELOA 4HT4A 4M78F 3TEEA 4N4IA 1X56A 2LRQA 3PIPA 1KQSS 1HTTA 1NJ8A 1QF6A 4YRKA 4YCVA 3RKXA 4N0AC 2ZIOA 1VQ5T 1DJ7B 5AYFA 1X75C 1Q86U 4RKUE 1YCYA 4JDSA 3OY9A 4E47A 2RJCA 2RHUA 1YI2T 3LLRA 2X4XA 2EJGA 4TVRA 5GMKh 3S3NA 4RCBA 4XTVA 1G51A 4FIBA 4HWPA 4H2TA 3LX7A 4OB3B 1U1TA 2ZINA 4LVJA 4GLKA 4LDYA 3FEOA 4BWAA 1VQ7T 1BI1A 1Q82C 1O75A 1KG1A 2DD4A 2KSSA 3RGLA 5KH6A 5CCAA 2I4NA 1UEBA 2Q5IA 1KD1U 4ZGDB 4P74A 2JUFA 4H2WA 4YRGA 4G84A 3JB9J 3V8LA 2BUDA 4LDUA 1WU7A 3V8JA 4M75G 5LJ3j 5FLXE 1OYXA 3OYYA 1YITT 4PLLA 4ATOA 5GANe 2XDDA 1G3WA 4C8QA 4ZIBA 3LSQA 4JS4A 4UP7A 4MDWA 3KFUA 1YJNT 4C8QF 2XD0A 4E7IA 4CI0C 4M78C 1PYSA 3QJYA 4HT9A 2R5AA 3NEMA 4BW9A 11ASA 3OYBA 2JNGA 5GAMd 2Y90A 3A7AA 4NL2A 4L59A 4C92B 2KVQG 5GMKi 1XTDA 3QJ6A 2GF7A 4RCCA 3DLMA 1Q7YC 1I4K1 3A8GB 5EG2A 3OYAA 4M7AA 4NL3A 4N4HA 3G6EA 3CPWA 2DZCA 3C95A 3HXYA 4CH6A 4TQDA 3L1AA 3JB9F 1JJCB 3QG1A 2EFIA 4H2VA 4CH5A 2EQUA 1B70A 3CC7A 2ZZFA 5LL6S 3VKIA 2DTOA 5CAIA 2O4XB 1MHNA 3IKMB 4H02A 5I2SA 1ADJA 3V7RA 4YRMA 5HK0A 3TUPA 1K9MC 4P74C 3G71A 2CZ1B 4XU1A 3CCVA 3JCMc 3A32A 1M90C 2G3RA 2OAUA 1K8AC 3HXUA 3CCEA 4C8QC 1NJIC 1M1KC 3CCRA 1NPPA 2LQKA 4OB0B 5LJ3e 4XU3A 4HCZA 2VXFA 4LVLA 3WXMB 4M7AD 3WQZA 4IUPA 1C0AA 1VQ9A 2X4JA 3CMEA 4J6WA 5I21A 2AHJB 2DXBA 3OBWA 4JJNK 3DKMA 2RB6A 4M7DG 2AKWA 1HXDA 3KBGA 3ZBDA 2Y4YA 3HFVA 3PNWC 2Y4XA 3LC0A 4JRQA 2HNIA 4XQ3A 4C0DB 1VIEA 1MGQA 5FU7C 4YRQA 5LJ5e 2D0QB 5GAMh 4H2SA 2XTIA 3NTHA 1QP3A 1RI0A 3M4QA 4JUVA 1GGMA 3G6ET 2DXTA 3OSVA 2CS7A 1QVGA 3CBOA 3L2QA 3JRZA 2E6NA 3A5ZB 3VJPA 1W66A 2IY5A 4EO4A 1S72T 3NFCA 4A4GA 1VQ4A 3CC7T 2K3YA 2RHZA 2I2LA 3META 3RACA 3UPUA 4M75D 2K5LA 3E9FA 4BI4A 1E1OA 2ZIMA 4RG8A 3OYKA 3VUBA 2ZXFA 4HWRA 2HD0A 2F5TX 4J5YA 1QVPA 2JZ2A 1VQMA 2A3LA 3CCVT 4ZTZB 2DXUA 2CKKA 2P0QA 2EWNA 2I4OA 3CCET 2M9UA 4LDWA 2XKOC 2BIVA 2ZPFB 3OYHA 5GAOr 3VUZA 4H2XB 4C5HA 2QHSA 4BDZA 3CCSA 4C92E 3JCMP 3OYGA 3F70A 3CMET 2CZ7B 3X25B 2RHSA 2P4TA 2EQJA 4F7UB 2VGMA 3INZA 4NOYA 3RMQA 4IUVA 2VV5A 1X01A 1NPRA 3OW2A 1U8RA 3OMCA 4KBMB 2L8DA 1YFRA 2RJEA 3FDRA 4ZN3A 1FWZA 4MZTA 5A0GA 4PJOB 3URGA 5GAMf 3ICAA 2PVOB 4E7JA 3ASKA 3J80E 1ZQ1A 3PIOA 4HCCA 2WSFE 1BIAA 3A7UA 4PJOF 2EQMA 2LT4A 3E19A 4PHCA 1VQOA 5GAN8 1TH7A 3MEWA 2KY9A 4EPCA 1Q81C 3QUIA 2ZT7A 3PTAA 2K4YA 3QXEB 1R8OB 3SWNA 2ALYB 4YRFA 3BW1A 4PG3A 4ELZC 1PSEA 1VQMT 4L5GA 3QIIA 3FJPA 4A54A 3N5BB 1G3YA 2DXCA 2VC8A 4M77A 1NE8A 2V8KA 2FYKA 4NS5A 2FL7A 1KC8C 4M77F 4DA4A 4M7DD 3M4PA 4UP9A 4J8OA 3JCMQ 2QQAA 4TVYA 3DB4A 3QZ5B 2PU9B 1J5WA 3P8VA 1M4ZA 3CCST 3JCMe 4HVCA 5DM7R 5KNNA 2OTLT 2OTJA 4J7IA 1D3BA 5GAMg 1X2HA 1N6AA 4QVZA 3MCAB 2ZGWA 4DQ2A 1IL2A 3RESA 4Q5WA 3CPWS 4LVKA 3VQXA 4Q6GA 3HL8A 4YCUA 2XDBA 2DIGA 1BIBA 4C0FA 1V29B 3PGGA 5CKBA 2RJDA 2MWOA 3GNFB 1UGQB 1VIFA 4TVAA 3HTZA 4PJOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OP0 A;  3RGL A;  1N9W A;  1B34 A;  2ARU A;  2I4N A;  1RIQ A;  2Q5I A;  3NET A;  1YB3 A;  3JCM d;  1FYF A;  4AH6 A;  4P74 A;  3JB9 D;  2ART A;  2DEQ A;  1H4Q A;  4H2W A;  4YRG A;  3QTC A;  3JB9 I;  4G84 A;  2DZ9 A;  3JB9 J;  3V8L A;  4M7D A;  4F7U G;  1NJ2 A;  1WU7 A;  2QHU A;  3PCO B;  3V8J A;  3HXZ A;  1Y96 A;  4M75 G;  5LJ3 j;  1L0W A;  3A5Y A;  1B7Y A;  4M7D F;  5LJ3 f;  2EL9 A;  4P71 A;  5GAN e;  4C8Q A;  4K86 A;  4EMK B;  2P5I A;  4ZIB A;  4YRP A;  3LSQ A;  1KMN A;  4YRC A;  4YRS A;  1X54 A;  4UP7 A;  3KFU A;  5HGQ A;  4CH4 A;  2CJB A;  1ATI A;  4C8Q F;  1KOG A;  2CJA A;  3HFN A;  3JCM W;  2EAY A;  2G4C A;  5GAN j;  3SWN B;  4M78 C;  1PYS A;  3QNE A;  2ZNI A;  4M77 C;  4LNS A;  4HT9 A;  1Z7M A;  3NEM A;  4X5O A;  4BW9 A;  11AS A;  3UFG A;  4C92 C;  4K87 A;  4PJO G;  4P3P A;  2ODR D;  3RER A;  3BJU A;  3HRI A;  4HWT A;  2RHQ B;  5GAM d;  3OD1 A;  1N9S A;  2ZCE A;  4F7U E;  4P73 C;  2Y90 A;  3RL6 A;  2FB7 A;  3VBB A;  3HXV A;  4M77 B;  4CS3 A;  3A7A A;  3MEY A;  4NL2 A;  2AMC B;  1G5I A;  4C92 B;  2E64 A;  1B8A A;  5GMK i;  1SES A;  4H2Y A;  4YRI A;  1HK9 A;  5F5W A;  4OLF A;  3CMQ A;  1ADY A;  4RCC A;  5LJ5 f;  4P72 A;  1I4K 1;  5GMK e;  3EFS A;  4NL3 A;  2E65 A;  5GAN d;  4M7A A;  5C53 B;  2DZC A;  3HXY A;  4CH6 A;  4TQD A;  2XGT A;  4JLI A;  4M78 G;  4TTV A;  1D3B B;  3L1A A;  3JB9 H;  3V7C A;  3JB9 F;  3LSS A;  1JJC B;  4M77 G;  3A5Z A;  5GMK j;  4H2V A;  4CH5 A;  3HFZ A;  2CGH A;  5GAN 5;  3AHU A;  1B70 A;  3JCM X;  2ZZF A;  3TEH A;  1EVL A;  1BBW A;  4XTW A;  2DTO A;  4RQF A;  5CAI A;  2Q5H A;  4L87 A;  5LJ3 g;  3IKM B;  4H02 A;  1ADJ A;  3V7R A;  3UGQ A;  4YRM A;  1EQR A;  3RF1 A;  1YFS A;  4CS2 A;  4HWS A;  4M7A E;  2QHT A;  5GMK l;  4TQF A;  3TUP A;  4P74 C;  1NYQ A;  4A53 A;  3REX A;  1E24 A;  4TVA B;  3UH0 A;  4M7D C;  4HT8 A;  2Q7E A;  4V2S A;  4XU1 A;  3VQW A;  1B34 B;  4YRT A;  4X9C A;  3JCM c;  1NNH A;  3A32 A;  4P75 C;  2ZZG A;  2ZR2 A;  3HXU A;  4P71 C;  3DSQ A;  4C8Q C;  4KR3 A;  4M7D B;  1WNL A;  3VU3 C;  1E22 A;  4RMF A;  1M5Q 1;  2DTH A;  4N0A A;  1Y96 B;  4H2X A;  5LJ3 e;  4XU3 A;  1B7Y B;  2VXF A;  2E5A A;  4M7A D;  5C51 B;  3WQZ A;  3JCM h;  1N9R A;  2DVE A;  4C8Q B;  3QSU A;  3HRK A;  2E10 A;  4EMK C;  5C52 B;  1C0A A;  3E9H A;  3FB9 A;  1SET A;  3QHS A;  5LJ5 g;  4WJ3 M;  2ARS A;  4Q15 A;  2DQ3 A;  1ASZ A;  4F7U A;  2YHT A;  4J6W A;  5I21 A;  1KMM A;  1PYS B;  1EIY A;  3SWN C;  3P8Y A;  1M8V A;  4F7U F;  1NJ1 A;  2I4M A;  4XTU A;  2E41 A;  2RB6 A;  4M7D G;  2AKW A;  3IG2 A;  1HXD A;  3NEN A;  3BFM A;  4HWO A;  3HFV A;  4XTY A;  2ZT5 A;  3LC0 A;  2HNI A;  4XQ3 A;  2EJF A;  4C8Q G;  4HA8 A;  3G1Z A;  1MGQ A;  2QHV A;  1LYL A;  4YRQ A;  4YRE A;  3P8T A;  4RQE A;  5LJ5 e;  5GAM h;  3GIB A;  4PJO A;  4H2S A;  2XTI A;  3RUX A;  3W3S A;  5LJ3 d;  4JUV A;  2YLB A;  4M75 E;  1GGM A;  3M4Q A;  3NEL A;  4YP0 A;  2DXT A;  4JRI A;  4XU0 A;  3VQV A;  1JBM A;  2P0L A;  3R07 A;  1EVK A;  4CS4 A;  5GAO n;  4E51 A;  4UP8 A;  3HY0 A;  2DU7 A;  5LJ5 j;  2ZR3 A;  3L4G A;  4YRL A;  1EFW A;  5GAN 2;  1W66 A;  4YRR A;  2IY5 A;  1LOJ A;  4EO4 A;  3HFZ B;  5GAN h;  3JCM V;  12AS A;  2DKG A;  1B70 B;  4XEO A;  2ZT6 A;  2PMF A;  3TEH B;  1G5H A;  2DJZ A;  4M7A F;  2I2L A;  4PJO E;  1NYR A;  2PME A;  3QO8 A;  3RAC A;  4M75 D;  2CJ9 A;  4TWA A;  2ODR C;  4M78 A;  3L2Z A;  2J3M A;  4MMK A;  4C92 G;  2ALY A;  3TEG A;  4ZTU B;  4G85 A;  2ZIM A;  1E1O A;  5GAO l;  1WQW A;  2ZXF A;  4HWR A;  2ZNJ A;  5K1X A;  3EFR A;  3JB9 G;  4WF2 A;  4J5Y A;  3PZC A;  2QTX A;  2E1H A;  5LJ5 d;  4YPF A;  4ZTZ B;  2DXU A;  3SB2 A;  4DPG A;  2EWN A;  4QVD A;  2I4O A;  4J6X A;  4RDX A;  2CIM A;  1SER A;  4PJO D;  2I4L A;  1NJ5 A;  3VQY A;  5GAO r;  1E1T A;  4H2X B;  1WPY A;  4M78 E;  4J6Y A;  3IAL A;  4TVW A;  3A74 A;  1BBU A;  1X55 A;  4MML A;  4QVC A;  2EJ9 A;  4M77 E;  2QHS A;  3JCM f;  4O2D A;  4C92 E;  3ERR A;  3JCM P;  5GAN 7;  1YFT A;  1X2G A;  4KQE A;  2RHS A;  3JCM J;  3BY7 A;  4F7U B;  2J3L A;  3INZ A;  4NOY A;  1EIY B;  5GAO m;  1NJ6 A;  1QE0 A;  1X01 A;  1U1S A;  1HC7 A;  2AKW B;  3UGT A;  5GAO p;  4M78 D;  4WJ4 A;  1USY A;  2K57 A;  4M75 A;  4M77 D;  3RKW A;  2RM4 A;  3HXW A;  1YFR A;  4C92 D;  5GMK m;  4J15 A;  2ZTG A;  4M75 F;  4K88 A;  3REU A;  5GAM j;  1JRI A;  3A7R A;  4EMH A;  4PJO B;  4XTX A;  4UPA A;  5GAM f;  2C7I A;  3ICA A;  3MF2 A;  4P72 C;  4P3N A;  2DU5 A;  1WQ7 A;  5GAN 6;  4P75 A;  1H64 1;  3A31 A;  4YCW A;  4M7A C;  4YRJ A;  4PNO A;  3QO7 A;  3L4G B;  4XEM A;  3PCO A;  1Z7N A;  1WLE A;  3MF1 A;  4YYE A;  4JRK A;  5LJ3 h;  2DQ0 A;  1BIA A;  3A7U A;  3HSB A;  3I7F A;  4YDQ A;  4PJO F;  2IY5 B;  4M7A B;  4PHC A;  3HY1 A;  4EMK A;  4WI1 A;  5GAN f;  5GAN 8;  1TH7 A;  5GAN 3;  4M7D E;  3QUI A;  5DY9 A;  2ZT7 A;  3FIF A;  5E3I A;  1B76 A;  1LJO A;  4M78 B;  5GAO q;  2ZZE A;  3SWN A;  1KQ2 A;  2E3C A;  2ALY B;  4P3O A;  4YRF A;  3BW1 A;  4PG3 A;  3JCM g;  3HFO A;  4Y91 A;  3IKL A;  1ASY A;  5ELN A;  4KR2 A;  4C8Q E;  1LNX A;  4EX5 A;  1KQ1 A;  2DDZ A;  2ZT8 A;  4YRO A;  3FJP A;  4A54 A;  3V7S A;  2RHQ A;  1I8F A;  1H4V B;  2VC8 A;  4M77 A;  4M7A G;  4YRN A;  3QO3 A;  2AMC A;  3HXX A;  5ELO A;  2FYK A;  4M78 F;  4C92 A;  1X56 A;  4M77 F;  4M7D D;  3M4P A;  4UP9 A;  4CH3 A;  3JCM Q;  1HTT A;  1H4S A;  4TVY A;  2Q7H A;  1NJ8 A;  4C92 F;  4X9D A;  5LJ5 h;  4P73 A;  1QF6 A;  4YRK A;  4YCV A;  3BDU A;  3RKX A;  4N0A C;  2ZIO A;  1J5W A;  3P8V A;  3E9I A;  4H2U A;  2DTI A;  5K1P A;  3JCM e;  4HVC A;  4C8Q D;  1YGB A;  4EMG A;  5KNN A;  2JN0 A;  1YCY A;  1H4T A;  3M4G A;  4NCX A;  5GAM g;  1D3B A;  3QO5 A;  1X2H A;  2RHS B;  3RKY A;  1JJC A;  2EJG A;  1SRY A;  1EOV A;  1USY C;  2ZGW A;  4XU2 A;  5GMK h;  4DQ2 A;  4M75 C;  1IL2 A;  2RD1 A;  3RES A;  1I81 A;  4RCB A;  4XTV A;  3V8K A;  3RIR A;  1G51 A;  3VQX A;  4HWP A;  2YLC A;  4Q6G A;  4H2T A;  2Q7G A;  2VXE A;  4YCU A;  1WYD A;  4M75 B;  4XTZ A;  1BIB A;  1U1T A;  2ZIN A;  3PGG A;  2C8M A;  5GAN g;  1I5L A;  4BWA A;  3JCM b;  1VQZ A;  4TVA A;  5GAM e;  5GAN 4;  2RA2 A;  3HTZ A;  4PJO C; 
#chains in the Genus database with same CATH topology
 3CPW P;  1N9W A;  4BE0 A;  1M1F A;  1B34 A;  1G3S A;  2VVK A;  1UJ0 A;  1Q7Y R;  1RIQ A;  4KH0 B;  2D8H A;  3JB9 I;  2DZ9 A;  2EYQ A;  1VQ7 A;  2NLU A;  3OYC A;  4QQD A;  1NJ2 A;  3HXZ A;  2KGT A;  2XMF A;  2C06 A;  2BE9 B;  4JRP A;  4LDV A;  1B7Y A;  2ROL A;  2DFU A;  4BI3 A;  1VQO T;  2DF6 A;  3OQ5 A;  1ZHI A;  1OQK A;  1FYN A;  4EMK B;  1KMN A;  4YRC A;  1X54 A;  1YHQ T;  1K4U S;  1QQJ A;  2K2V A;  3HFN A;  2KYM A;  2LQ8 A;  3JCM W;  5IN1 A;  5C6S A;  4IIO A;  5GAN j;  2ZNI A;  2MAM A;  2Z0W A;  4M77 C;  1Z7M A;  1X6O A;  2RI3 A;  5DLQ E;  3UFG A;  1TSF A;  3MKD A;  4K87 A;  3PVL A;  4P3P A;  1GBR A;  2FRW A;  3NPF A;  4F14 A;  3HRI A;  2EIF A;  2DE0 X;  1N9S A;  4QW2 A;  4F7U E;  2FB7 A;  3MEY A;  4Y92 A;  3CMA A;  2AMC B;  1B8A A;  1W1F A;  3OYJ A;  4MZP A;  2ZZD A;  4C5E A;  3LWI A;  1M90 R;  1X6G A;  4LE9 A;  4YRI A;  1GCQ C;  1K8A R;  3E2U A;  1W4S A;  1I07 A;  4OLF A;  1NJI R;  2QEX A;  1ADY A;  4KGV B;  2DNU A;  4P72 A;  1OZ2 A;  2K79 A;  2HQX A;  2PVG B;  2FZC B;  2YRV A;  5GMK e;  4E7L A;  3EFS A;  5GAN d;  1UGV A;  3X24 B;  4UC4 A;  2OTJ T;  1K9M U;  4LUE A;  2KMT A;  2ED0 A;  2KEA A;  2F2X A;  2CDT A;  4PFO A;  5IXB A;  2CP3 A;  3HFZ A;  2CGH A;  1PRM C;  5GAN 5;  3OS5 A;  3AHU A;  3ULR B;  3JCM X;  1PRL C;  4JLG A;  1EVL A;  4ME7 A;  1Q95 G;  1M1K U;  4A4F A;  4Z8A A;  3LGL A;  2KNB B;  1B3Q A;  4RUG A;  2Q5H A;  1QVG S;  5KYU B;  4L87 A;  3VS7 A;  3VS0 A;  2DM1 A;  3G6E Q;  1W2B A;  1EQR A;  2QHT A;  4TQF A;  3MJX A;  2KDS A;  2KR3 A;  2YT6 A;  4A53 A;  1E6H A;  3FC3 A;  4HT8 A;  3HKS A;  2ROT A;  4V2S A;  1PSF A;  2VGN A;  2MK5 A;  4X9C A;  4P75 C;  1VOM A;  3CC7 Q;  1QVG P;  2A28 A;  2KAF A;  1WNL A;  1J3T A;  1M5Q 1;  2RK2 A;  2DTH A;  2YWW A;  3M0P A;  2E6Z A;  2LC4 A;  3Q1J A;  4C0G A;  3TSW A;  3OYI A;  1VQP T;  1G5V A;  4OGC A;  1N9R A;  2DVE A;  1PWT A;  4C8Q B;  4EMK C;  5C52 B;  4C5G A;  3H41 A;  1K73 C;  4AFZ C;  1RAG B;  4Q15 A;  1ASZ A;  3CCV Q;  1GBQ A;  2AKL A;  2YHT A;  1BK2 A;  3MHX A;  3LH5 A;  1PYS B;  1EIF A;  1EIY A;  5KYW A;  4PK4 A;  3OYL A;  2K9G A;  3P8Y A;  2PUK B;  1NJ1 A;  4EDU A;  3CCE Q;  2I4M A;  5GJW B;  2E41 A;  4FSS A;  1XOV A;  2GFU A;  2CSI A;  3IG2 A;  5KYX A;  1QCO A;  1CSK A;  1Z9Q A;  3E9G A;  4RTT A;  4FM4 B;  3CMA T;  2ZT5 A;  2FHD A;  3SD4 A;  3X20 B;  1WFW A;  2WAC A;  1N27 A;  3CXC A;  3PVQ A;  5CK9 A;  1R0C B;  1VQ9 Q;  1LYL A;  2QEX T;  3CME Q;  3OW2 S;  4RQE A;  1VA7 A;  3GIB A;  1H92 A;  2F1L A;  4OMN A;  3OYF A;  5LJ3 d;  4J9E A;  4XU0 A;  5FU7 B;  4AMC A;  1EVK A;  5GAO n;  3M59 A;  1H3H A;  1FX7 A;  3NTK A;  5LJ5 j;  1M8M A;  3L4G A;  3L42 A;  1EFW A;  1ZLM A;  4CC2 A;  2GBQ A;  4II1 A;  4AFU C;  3X28 B;  4YRR A;  1LOJ A;  2RHX A;  3OW2 P;  5GAN h;  3JCM V;  2LT1 A;  3JAM E;  2PTK A;  1JB0 E;  2DKG A;  1B70 B;  4XEO A;  1SF9 A;  2RQU A;  4DOW A;  2KBT A;  2QXF A;  4M7A F;  1N8R R;  1GCP A;  3HRU A;  2CJ9 A;  3BE3 A;  2GNC A;  2A37 A;  2COW A;  4HVU A;  1PNJ A;  1WQW A;  5GAO l;  1S72 A;  1OI1 A;  1JJ2 A;  3PZC A;  1BI3 A;  5LJ5 d;  1OPL A;  4YPF A;  3L2V A;  3OYN A;  1KHI A;  2DD5 A;  2LJ0 A;  2C0T A;  4J83 A;  1RAH B;  3CCQ T;  1ARK A;  4QVD A;  1VQ4 Q;  4J6X A;  4ZN1 A;  3CC2 A;  4BE2 A;  2QK0 A;  4OMM A;  1N5Z A;  2NUP A;  1UJY A;  1RI9 A;  1NJ5 A;  4CC4 B;  2CZ6 B;  1T3S A;  2GTJ A;  1WX6 A;  3EG1 A;  2E70 A;  4XAX B;  1G2B A;  1WPY A;  4M78 E;  2RN8 A;  4TVW A;  4MML A;  4QVC A;  2EJ9 A;  1C6V X;  1QWE A;  5D6Y A;  2JOY A;  1VQM Q;  4IUT A;  4JZ3 A;  2RPN A;  2KXD A;  1YFT A;  3EH2 A;  1FXX A;  2X51 A;  1Q81 R;  3NGP A;  1RAB B;  1WHM A;  1NJ6 A;  1HJD A;  1M1G A;  1NEG A;  1YFN A;  1IHV A;  5CO7 A;  2AKW B;  2X3W D;  2HKQ B;  1WJQ A;  1D0Y A;  5KE2 A;  5KCO A;  2K57 A;  4M75 A;  2J6K A;  3A8L B;  3QYG B;  3M9Q A;  3CCS Q;  2DYB A;  4C92 D;  2L3S A;  1SRM A;  4J15 A;  4M75 F;  3OSS C;  2VUB A;  4XTX A;  1NZ9 A;  3REB B;  2HQH A;  3MF2 A;  4DBH A;  3EGX B;  2PNI A;  4P3N A;  4D6W A;  1H64 1;  4M7A C;  3MEU A;  4PNO A;  2RI5 A;  4PJN A;  2LZ6 B;  4E7K A;  4XEM A;  2L3Q A;  3PCO A;  4OML A;  2LMJ A;  3MF1 A;  4JRK A;  5LJ3 h;  1SPK A;  1M27 C;  1ZUU A;  2LX7 A;  2IY5 B;  1KD1 C;  3HY1 A;  1HD3 A;  2L2P A;  1GL5 A;  5GAN f;  3M0R A;  1UE9 A;  1KC8 U;  2WSC E;  3CC4 T;  1BYM A;  5DY9 A;  4FW1 A;  4IIM A;  5E3I A;  1IGQ A;  3WVE B;  2V1Q A;  1KQ2 A;  4KUL A;  2E3C A;  4P3O A;  3OA6 A;  2RQR A;  2W0Z A;  3HFO A;  3QWY A;  2R57 A;  1ASY A;  4C8Q E;  4EX5 A;  1SEM A;  3CCU A;  4J7F A;  2DDZ A;  1IZ6 A;  4BAC A;  2RHQ A;  3TCJ A;  1MMN A;  1I8F A;  2FVU A;  1GFC A;  2QQB A;  4FL6 A;  3CC2 T;  4YRN A;  2ZPB B;  1TXQ A;  3HXX A;  1VQO Q;  2FZK B;  2QQR A;  5A0D A;  4CH3 A;  3I55 A;  3H0F A;  1VQK A;  4X9D A;  5LJ5 h;  3THK A;  5EC7 A;  3E9I A;  2BZX A;  2E5Q A;  1KFZ A;  2M16 A;  5K1P A;  3QBY A;  1Y71 A;  2O9S A;  1YGB A;  2KRS A;  3UF4 A;  2RJF A;  4LD6 A;  4LD9 K;  3M4G A;  4NCX A;  1TG0 A;  1ZA2 B;  4RTZ A;  3QO5 A;  2RHS B;  3QZ9 B;  1JQQ A;  3RKY A;  3MP1 A;  1G83 A;  5C0M A;  4M75 C;  2X35 A;  2RD1 A;  1I81 A;  5KYY A;  2AZV A;  2OTL A;  2YLC A;  3UDC A;  2Q7G A;  2VXE A;  1WYD A;  4JPB W;  4A4E A;  4OMF B;  1M3A A;  2J05 A;  2C8M A;  5GAN g;  4KRT A;  2L89 A;  1I5L A;  2BZY A;  1N8R C;  1X69 A;  2OTJ Q;  1AWO A;  1QKW A;  1KSW A;  3OBY A;  3VS2 A;  1R0B G;  1YWO A;  2CRE A;  4E2F B;  2ARU A;  3DB3 A;  2LCC A;  3NET A;  1VQN A;  3JCM d;  1W2B S;  4AH6 A;  3L2R A;  2DEQ A;  1RL2 A;  5CIU A;  3CCM T;  1H4Q A;  4R55 A;  3QTC A;  2BE7 D;  2JTF A;  4PJM A;  2LNH B;  4M7D A;  1M30 A;  2M51 A;  4FT4 A;  2QHU A;  1Y7X A;  4RTX A;  2DX1 A;  1Y96 A;  3OS2 A;  2W10 A;  1WI7 A;  3LWH A;  2X4W A;  3A5Y A;  3TQ7 P;  2D1X A;  4M7D F;  2NUT A;  5AT1 B;  5IXF A;  5LJ3 f;  1VUB A;  4P71 A;  4K86 A;  2P5I A;  2LCL A;  4YRP A;  3CCJ A;  4YRS A;  5HGQ A;  2LP5 A;  2MF2 A;  8ATC B;  1ATI A;  1WGS A;  4ORZ A;  1UB4 A;  1KOG A;  4AG2 C;  2G4C A;  5J26 A;  3SWN B;  4HVW A;  1I5O B;  2PZ1 A;  4DEY A;  4LNS A;  3CCU T;  4Z88 A;  1VQ7 Q;  2DYI A;  1IGU A;  3QKJ A;  2K3B A;  3GF5 A;  1YHQ A;  2ODR D;  5J39 A;  3BJU A;  1OU9 A;  2CH4 A;  4C0Z A;  2L3R A;  1H8K A;  2RK1 A;  4M77 B;  3EH1 A;  2M0O A;  4CS3 A;  2E64 A;  3I55 T;  1SES A;  4H2Y A;  1VQK T;  3HPW A;  5F5W A;  2IVW A;  3CMQ A;  1ZSZ A;  4E7Z A;  5LJ5 f;  2DVJ A;  5FRO A;  4O6J A;  2V8J A;  3EAE A;  4E7S A;  8AT1 B;  2HBP A;  3CXC S;  2MMP A;  2XGT A;  4JLI A;  4M78 G;  1D3B B;  3EGD B;  5KCH A;  3JB9 H;  3LSS A;  1NLO C;  2EQI A;  5GMK j;  3CMA Q;  3R6O A;  1TTH B;  1T0J A;  4IUR A;  1Q82 U;  3TEH A;  2ESW A;  3P8H A;  2QEX Q;  1BBW A;  1X27 A;  3KUF A;  2GQV A;  2A36 A;  4FW2 A;  1XNI A;  1XQH A;  2MYS A;  5LJ3 g;  3CXC P;  2QDY B;  4BE1 A;  4PLI A;  4DOV A;  4F04 B;  1NYQ A;  3REX A;  1E24 A;  4TVA B;  2QGG A;  1K73 U;  2F69 A;  4M7D C;  3ME9 A;  4J9F A;  1MMD A;  2K6D A;  2A8E A;  3PMI A;  2CP5 A;  3I56 T;  1VQN T;  3SEM A;  3VQW A;  1B34 B;  2XU8 A;  1SRL A;  2D0N A;  4YRT A;  3I5S A;  1NNH A;  2ZR2 A;  4P71 C;  1KHC A;  4KR3 A;  1JJ2 S;  1JO8 A;  4RMF A;  4N0A A;  3CD6 T;  2KI7 A;  1B7Y B;  5C51 B;  2QDL A;  4FT2 A;  3JCM h;  3M55 A;  3CCJ T;  1M2V A;  3QSU A;  2RH2 A;  2E10 A;  1LCK A;  3E9H A;  3OS0 A;  2RHY A;  3FB9 A;  4FSX A;  3QHS A;  5LJ5 g;  2JTE A;  2ARS A;  4WJ3 M;  2YRD A;  1WLP B;  2ZPE B;  3S3O A;  1PHT A;  3SWN C;  4QQ6 A;  1BBZ A;  1JJ2 P;  1VQP A;  1WHH A;  2ZPH B;  3KFV A;  2E3H A;  4XTU A;  1WDX A;  1OU8 A;  4MZM A;  5FU6 C;  1P92 A;  2DK3 A;  4RTW A;  2J7I A;  3BFM A;  3MP6 A;  4HWO A;  1ZSZ C;  1Q7Y U;  2LX9 A;  4XTY A;  5FW9 A;  5IT9 E;  2XID A;  2PVD B;  3GNG A;  4C8Q G;  5CVI A;  3G1Z A;  5J3B A;  2QHV A;  1V76 A;  2EKO A;  4ZNX A;  4YRE A;  2H3E B;  1CKB A;  5HY6 A;  2VB6 A;  3RUX A;  3LW5 E;  2LNV A;  2XDP A;  2HMA A;  3VQV A;  4YP0 A;  2AT1 B;  1JBM A;  3R07 A;  5CR2 A;  4E51 A;  2F2V A;  4BI8 B;  2DL5 A;  2DU7 A;  1UGS B;  1M9S A;  4AFQ C;  1BKB A;  4YRL A;  1BI2 A;  4LN2 A;  3UWN A;  2DAQ A;  2GGR A;  2LTO A;  4E6R A;  4OMO A;  3HFZ B;  4ZTJ A;  3I5R A;  1EX4 A;  2ZT6 A;  1Q86 R;  2V26 A;  2PMF A;  1WYX A;  3MO8 A;  4J9H A;  2CUD A;  2M1H A;  1RLP C;  1T3L A;  4B6M A;  4PJO E;  3QO8 A;  3H9N A;  3PFS A;  4M78 A;  4BUG A;  2J3M A;  4MMK A;  4C92 G;  2JM9 A;  3TEG A;  2DRK A;  4DBR A;  4PJJ A;  2L3P A;  1NBE B;  4OVA A;  1M90 U;  5K1X A;  2ZNJ A;  3EFR A;  3JB9 G;  1K8A U;  3M4Y A;  2QTX A;  1NJI U;  1B7T A;  1IRX A;  4OF1 A;  2E1H A;  2OAW A;  1AT1 B;  1AZE A;  3HRT A;  1FMK A;  3O5Z A;  2DO3 A;  1BB9 A;  2I4L A;  4Y28 E;  2ZPI B;  3CC4 Q;  2GFA A;  2JT4 A;  2PQW A;  1WXT A;  1E1T A;  1NM7 A;  4J6Y A;  5FWC A;  3A74 A;  1BBU A;  3CCQ A;  1X55 A;  1S72 Q;  4M77 E;  3JCM f;  3C4S A;  1KD1 R;  4O2D A;  1KIK A;  1HSQ A;  3UT1 A;  2L5Q A;  4QQG A;  5GAN 7;  3FJ5 A;  3VRZ A;  1LPL A;  1X2G A;  4KQE A;  1HYO A;  3BY7 A;  1GXI E;  3T9N A;  1EIY B;  3CC2 Q;  1OZ3 A;  5KYW B;  1F1B B;  1U1S A;  2H3J A;  4GY5 A;  1HC7 A;  5KYX B;  3JSC A;  3TRE A;  4ZGE B;  5GAO p;  2QA4 T;  4M78 D;  1X43 A;  1ZA1 B;  4D8K A;  1AEY A;  1USY A;  4KT0 E;  3ZFJ A;  1ZBX A;  2KE9 A;  2RM4 A;  3M57 A;  5GMK m;  2K5I A;  1VQ6 A;  1EFN A;  5D6W A;  4RMO A;  1SHG A;  3REU A;  1UFF A;  3NTI A;  5GAM j;  2X4Y A;  1JRI A;  3OB9 A;  3A7R A;  4EMH A;  2QAS A;  3G4S A;  4UPA A;  4R0K A;  2ZCF B;  2C7I A;  3L2U A;  4P72 C;  1WQ7 A;  2MWP A;  2CSQ A;  1K0X A;  5FRN A;  2DL4 A;  4YRJ A;  3QO7 A;  1PC0 A;  3L4G B;  1SKU B;  3DLL A;  3HP9 A;  5A0L A;  1JXM A;  1VQ8 A;  3C94 A;  2DQ0 A;  3I7F A;  2K3X A;  4YDQ A;  3M53 A;  1NYF A;  3A8H B;  4M7A B;  3MPU B;  5L8R E;  3GBQ A;  4JJB A;  4C5I A;  5HCK A;  4WI1 A;  1MND A;  1QVF A;  1YJW T;  5CQX A;  3FLG A;  2DL7 A;  1G8X A;  4RTV A;  1WXB A;  5GAO q;  3M0U A;  2AZS A;  3JCM g;  2EGC A;  4Y91 A;  1SSF A;  1D0X A;  4KR2 A;  4FCY A;  3CCM Q;  4BB7 A;  2ZT8 A;  4YRO A;  3CC4 A;  1X6B A;  3V7S A;  2RO0 A;  2EKH A;  3P8D A;  2RQT A;  3QO3 A;  2P0K A;  4C92 A;  2NUP B;  2L0A A;  3M58 A;  4PJO C;  5GJV B;  1K9A A;  1H4S A;  2Q7H A;  4C92 F;  4P73 A;  5I22 A;  4KUD K;  3BDU A;  3GPL A;  3H6Z A;  4H2U A;  3FRN A;  2DTI A;  3EHR A;  1TU0 B;  4C8Q D;  4EMG A;  3CCU Q;  5I2M A;  2JN0 A;  2HSP A;  1H4T A;  1N8R U;  5CKD A;  2R5M A;  4KGX B;  1JJC A;  1SRY A;  1EOV A;  1USY C;  4XU2 A;  2YUN A;  2XK0 A;  3C12 A;  4Z02 A;  1SSH A;  2QI2 A;  2QGF B;  1WHL A;  1W6X A;  3I55 Q;  2E12 A;  3V8K A;  1RAF B;  3RIR A;  1VQK Q;  1YBY A;  3G7Z A;  2JMA A;  5M9O A;  3WVD B;  3QWX X;  1PCX A;  2O4X A;  5A2Q E;  4M75 B;  4XTZ A;  1VQ6 T;  4A4K A;  1YN8 A;  4JS5 A;  3OYD A;  1T0H A;  1Q86 C;  2DA9 A;  4XK8 E;  4E7H A;  3JCM b;  1VQZ A;  4AFS C;  1QCN A;  3PT9 A;  4A4H A;  1RAI B;  3G4S T;  2O01 E;  2QG9 B;  5GAM e;  5GAN 4;  2RA2 A;  5DLO A;  2RQV A;  1XJW B;  1QKX A;  4OP0 A;  3RNJ A;  1X2Q A;  1YB3 A;  3EG0 A;  1UGP B;  2DIQ A;  1FYF A;  3JB9 D;  2ART A;  5KE3 A;  2KRN A;  1OOT A;  4HXJ A;  2OTL Q;  1B07 A;  1VQ8 T;  4F7U G;  3S3M A;  1Q81 U;  3PCO B;  3GP8 A;  2A0F B;  1Y07 A;  1L0W A;  3EFO A;  2IIM A;  2I0N A;  2QAZ A;  2EL9 A;  3X26 B;  2JTM A;  1VYU A;  4N4G A;  3CCM A;  1UGR B;  4CH4 A;  2CJB A;  3QDF A;  2CJA A;  2EAY A;  3REA B;  3M5A A;  3I56 Q;  3QNE A;  1MV0 B;  2XIC A;  2DBM A;  1VQN Q;  3MEV A;  4X5O A;  1K1Z A;  5I11 A;  1FMW A;  3ZL7 C;  1KQS A;  2NS6 A;  4C92 C;  1MV3 A;  4PJO G;  3RER A;  1UUE A;  1AD5 A;  2RHQ B;  3VS4 A;  4HWT A;  4ZGJ B;  3OD1 A;  1ZBJ A;  2ZCE A;  4P73 C;  2HAX A;  3RL6 A;  2LJ3 A;  3VBB A;  3HXV A;  2JVV A;  3RDV A;  3D7S B;  1G5I A;  4PKC C;  3CCJ Q;  4OB2 B;  3UA7 A;  1HK9 A;  4OMP A;  3GLX A;  3EG3 A;  2O31 A;  3CCL A;  4YTL A;  1NYG A;  2YUP A;  2X9H A;  3LH0 A;  3HRS A;  4GLM A;  3A8O B;  1WZO A;  5IH2 A;  2IG0 A;  2E65 A;  5C53 B;  1C0M A;  4CC3 A;  4F17 A;  2JM8 A;  1YHQ Q;  4P5N A;  4TTV A;  2O88 A;  3V7C A;  3M54 A;  2F2W A;  4M77 G;  3A5Z A;  1WXU A;  2FO0 A;  4K11 A;  1CKA A;  1E7O A;  5KYY B;  4F16 A;  4OGE A;  1PD0 A;  4BY6 B;  1D1A A;  4XTW A;  3G71 T;  4RQF A;  2RMO A;  1M3B A;  3LGF A;  4HKE A;  1WJR A;  2HZY A;  2NYS A;  3UGQ A;  4RG2 A;  1PM3 A;  3BDL A;  3RF1 A;  1YFS A;  4CS2 A;  2KT8 A;  4HWS A;  4M7A E;  2JXB A;  2RNA A;  5GMK l;  4L6V 5;  3CCR T;  4EIK A;  3UH0 A;  2KQW A;  2M02 A;  4X34 A;  4KUI A;  1AWJ A;  2XHC A;  2Q7E A;  1K76 A;  1IRE B;  2R58 A;  2YUQ A;  2YDL A;  5IHK A;  2M0Y A;  2ZZG A;  2PUO B;  1MUZ A;  3DSQ A;  4ZTF A;  1VQ9 T;  3VYG A;  3EG2 A;  3PE0 A;  4M7D B;  3VU3 C;  2XG8 D;  2K2M A;  2WSE E;  1E22 A;  1Y96 B;  4H2X A;  4CRI A;  1VQL A;  1NLP C;  5CQY A;  3I56 A;  2E5A A;  2NUT B;  1AOJ A;  2HL3 A;  2F5K A;  2J06 A;  1YJ9 A;  4HCB A;  3HRK A;  1AWX A;  3MP8 A;  5CKF A;  1SET A;  2QTV A;  4LVM A;  1H3Z A;  2DQ3 A;  2FG0 A;  4F7U A;  1BI0 A;  3CD6 A;  2DEU A;  1KMM A;  1RUW A;  5HK3 A;  2D6F A;  3TU4 K;  3SHW A;  2KK4 A;  1M8V A;  4F7U F;  4C0D C;  1RLQ C;  3A8M B;  3U23 A;  4J9B A;  3OMG A;  1EZZ B;  3P8B B;  3NEN A;  3CBP A;  2AKK A;  2B8A A;  2CH4 W;  3M56 A;  2K5F A;  4ANJ A;  4PL6 A;  4O5V A;  2D9T A;  4HCK A;  2EJF A;  2QQS A;  1IB8 A;  4HA8 A;  2VKN A;  5FU6 B;  2VYT A;  3P8T A;  3CCL T;  1BCM A;  1ZSZ B;  4B9W A;  4PJO A;  4FU6 A;  1YIJ A;  2FEI A;  3VYH B;  1QW1 A;  3CBM A;  1VQP Q;  3W3S A;  4M75 E;  2YLB A;  3NEL A;  4JRI A;  3OYM A;  4CS4 A;  2P0L A;  1VQ4 T;  3CEY A;  2MOX A;  1AHJ B;  4UP8 A;  4B9X A;  3HY0 A;  4IUU A;  2ZR3 A;  3ZEH A;  1YP5 A;  1I1J A;  2QA4 Q;  3J7A F;  3S6W A;  5GAN 2;  1IO6 A;  1K0S A;  1TS9 A;  2P0P A;  3VV0 A;  2HQE A;  12AS A;  2EQK A;  2ED1 A;  3TEH B;  4ELY C;  1G5H A;  2DJZ A;  3OYE A;  4BY6 C;  4GBQ A;  2FPE A;  4IKF A;  1NYR A;  2PME A;  4TWA A;  2ODR C;  2GCX A;  3L2Z A;  4ZTU B;  2ALY A;  4FYV B;  2VWF A;  4G85 A;  2JJ9 A;  1WIE A;  5CKH A;  3SFM A;  1SG5 A;  4WF2 A;  2LVM A;  1QP2 A;  4J9I A;  2A7Y A;  2CYZ B;  3VRY A;  1UHC A;  2NWM A;  3KXT A;  1C1A A;  1QVF S;  1AZG B;  2V8I A;  2XI9 A;  3SB2 A;  4DPG A;  4RDX A;  5HKC A;  2E3I A;  2CIM A;  4OB1 B;  1G3T A;  1GCQ A;  3H0H A;  1PKS A;  2COZ A;  2JS0 A;  1SER A;  4PJO D;  4CC7 A;  5IHI A;  3JV3 A;  1VQL T;  3VQY A;  2YSQ A;  2RI2 A;  3MEA A;  3IAL A;  2OX7 A;  1YJ9 T;  2C0O A;  5IAY A;  1VQ5 A;  1QVF P;  1M2V B;  1UTI A;  2DMO A;  5ECA A;  1W70 A;  2DJQ A;  3SDZ A;  1O9S A;  3ERR A;  5FRM A;  5D6X A;  1D1B A;  3JCM J;  2LCS A;  1YI2 A;  2J3L A;  3TSZ A;  4BDY A;  5GAO m;  1QE0 A;  4R56 A;  2CP7 A;  1YNZ A;  3RBB B;  3UGT A;  4J9D A;  2AK5 A;  3J81 E;  4WJ4 A;  1VYT A;  4LVI A;  2CUB A;  3CCQ Q;  2ZPG B;  2QQ9 A;  4M77 D;  2MI6 A;  3RKW A;  2BKD N;  3LYI A;  4FYY B;  3RMS A;  4LDX A;  3HXW A;  1MMA A;  4MDX A;  1TWB A;  3A1P A;  3CPF A;  2ZTG A;  4K88 A;  3EG9 A;  3QDR B;  1YIJ T;  1WJS A;  2DPP B;  2QA4 A;  2RHI A;  3H8Z A;  2OI3 A;  3GOX A;  1BU1 A;  2DU5 A;  5GAN 6;  4P75 A;  2DET A;  3A31 A;  4YCW A;  3A98 A;  1BCO A;  1S1N A;  1TUD A;  1ZX6 A;  3M0T A;  4IUQ A;  2RF0 A;  3O8V A;  1Z7N A;  1WLE A;  4YYE A;  3MQZ A;  3UAT A;  1VQ6 Q;  3HSB A;  2CP6 A;  3E1S A;  5CKE A;  1YIT A;  3L2W A;  1PG5 B;  1ABO A;  4EMK A;  3H0I A;  5GAN 3;  3HHT B;  3OS1 A;  3G4S Q;  4BD3 A;  4M7D E;  2EYZ A;  1YJN A;  4J9C A;  1K9M R;  3PMT A;  1X2K A;  3FIF A;  2SEM A;  4WTO B;  1LJO A;  4M78 B;  1B76 A;  2ZZE A;  5FWB A;  1D09 B;  2E4H A;  3IKL A;  2KYB A;  2LDM A;  1JU5 C;  5ELN A;  1AWW A;  1LNX A;  1UG1 A;  3QPH A;  1KQ1 A;  1YJW A;  1VQ8 Q;  4VUB A;  1IXD A;  1QMC A;  1M1K R;  3QYH B;  1H4V B;  2CZ0 B;  4HVV A;  4M7A G;  2AMC A;  5ELO A;  4FYX B;  4HT4 A;  4M78 F;  3TEE A;  4N4I A;  4LNP A;  1X56 A;  1RAD B;  1WHJ A;  2LRQ A;  3PIP A;  1KQS S;  1UEC A;  1HTT A;  1NJ8 A;  1QF6 A;  4YRK A;  4YCV A;  3RKX A;  4N0A C;  2ZIO A;  1Y0M A;  4D8D A;  1VQ5 T;  1DJ7 B;  5AYF A;  4DEX A;  1X75 C;  1Q86 U;  2HEQ A;  1Y57 A;  4RKU E;  1YCY A;  4JDS A;  3OY9 A;  4E47 A;  4DBF A;  1QWF A;  1LVK A;  2D8J A;  2RJC A;  1PD1 A;  4LUD A;  2RHU A;  6AT1 B;  1YI2 T;  3LLR A;  2X4X A;  2EJG A;  4RTY A;  4TVR A;  5GMK h;  1KQS P;  2P84 A;  3S3N A;  4RCB A;  4XTV A;  3AT1 B;  2CP0 A;  1G51 A;  4FIB A;  4HWP A;  1RAC B;  4H2T A;  3LX7 A;  2ZAE A;  5KYU A;  2JW4 A;  4OB3 B;  1U1T A;  2ZIN A;  4LVJ A;  4GLK A;  4LDY A;  3FEO A;  1U06 A;  4BWA A;  1VQ7 T;  1BI1 A;  1Q82 C;  4X1V A;  1U3O A;  1O75 A;  4RTU A;  1KG1 A;  2HL5 C;  2DD4 A;  2KSS A;  3RGL A;  5KH6 A;  5CCA A;  2I4N A;  1VYV A;  1UEB A;  2Q5I A;  1KD1 U;  2FPD A;  4ZGD B;  4P74 A;  2JUF A;  4H2W A;  4YRG A;  4G84 A;  4ESR A;  3R6N A;  3VS1 A;  3V8L A;  3JB9 J;  2BUD A;  4LDU A;  1WU7 A;  3G71 Q;  3V8J A;  4M75 G;  5LJ3 j;  5FLX E;  1OYX A;  3OYY A;  2K7A A;  1YIT T;  4PLL A;  4ATO A;  5GAN e;  2XDD A;  1G3W A;  4C8Q A;  1ACM B;  2X3X D;  4ZIB A;  3LSQ A;  4JS4 A;  4UP7 A;  4MDW A;  3KFU A;  1YJN T;  3CCR Q;  1KK7 A;  4C8Q F;  2XD0 A;  4E7I A;  4CI0 C;  4M4Z A;  4M78 C;  1PYS A;  3QJY A;  2EGE A;  4HT9 A;  2R5A A;  3NEM A;  1Z9Z A;  4BW9 A;  11AS A;  3OYB A;  2JNG A;  1FMV A;  5GAM d;  2HBW A;  2Y90 A;  1SHF A;  1PKT A;  2KT1 A;  2O2O A;  3A7A A;  4NL2 A;  4L59 A;  4C92 B;  2KVQ G;  5GMK i;  1TOV A;  1KJW A;  1XTD A;  4OMQ A;  3QJ6 A;  2GF7 A;  4RCC A;  4PJL A;  4J9G A;  3DLM A;  1Q7Y C;  1I4K 1;  3A8G B;  5IHN A;  5EG2 A;  3OYA A;  4NL3 A;  3CPW A;  4N4H A;  2FZG B;  3G6E A;  2DZC A;  4M7A A;  1YWP A;  3C95 A;  1ZUK A;  3HXY A;  4CH6 A;  4TQD A;  2J6F A;  3L1A A;  3JB9 F;  1JJC B;  3EHQ A;  3QG1 A;  2EFI A;  4H2V A;  4CH5 A;  1QCF A;  2EQU A;  2EPD A;  1B70 A;  3CC7 A;  2ZZF A;  5LL6 S;  3CCL Q;  3VKI A;  2DTO A;  5CAI A;  2O4X B;  5KYN A;  1MHN A;  3IKM B;  4H02 A;  5I2S A;  1U5S A;  1ADJ A;  3V7R A;  4YRM A;  7AT1 B;  2LQN A;  5HK0 A;  3TUP A;  1K9M C;  4P74 C;  3VS5 A;  1RAA B;  4QKU A;  3G71 A;  2CZ1 B;  1TUG B;  4XU1 A;  3CCV A;  4PFP A;  2ATC B;  3JCM c;  3A32 A;  1M90 C;  2G3R A;  2OAU A;  3NMZ C;  2IPO B;  1K8A C;  3HXU A;  3CCE A;  4C8Q C;  3C0C A;  1NJI C;  2GTO A;  1M1K C;  1M3C A;  3CCR A;  1NPP A;  2LQK A;  9ATC B;  3EFO B;  4OB0 B;  2OJ2 A;  5LJ3 e;  4XU3 A;  4HCZ A;  2VXF A;  4LVL A;  3WXM B;  4M7A D;  3WQZ A;  2C0I A;  1OUL A;  4IUP A;  4KGZ B;  1IHW A;  1I0C A;  3I35 A;  1C0A A;  2MCN A;  2V1R A;  1VQ9 A;  2X4J A;  2YRC A;  2EW3 A;  5L23 A;  3CME A;  2JS2 A;  1OV3 A;  2NUZ A;  4J6W A;  5I21 A;  2AHJ B;  2DXB A;  3OBW A;  1D1C A;  3DKM A;  4JJN K;  2BZ8 A;  1AVZ C;  2RB6 A;  4M7D G;  2AKW A;  1RAE B;  1HXD A;  2DRM A;  1KC8 R;  3KBG A;  1VQL Q;  3ZBD A;  2Y4Y A;  1NEB A;  3HFV A;  3PNW C;  2Y4X A;  3LC0 A;  2HKN A;  4JRQ A;  2HNI A;  4XQ3 A;  1YJ9 Q;  4C0D B;  1VIE A;  1E6G A;  1MGQ A;  5FU7 C;  1OEB A;  2J6O A;  4YRQ A;  1JXO A;  5LJ5 e;  2D0Q B;  5GAM h;  4H2S A;  3CD6 Q;  2XTI A;  2MPX C;  1GRI A;  3NTH A;  1QP3 A;  1RI0 A;  3EGX A;  2VAS A;  4JUV A;  1GGM A;  3M4Q A;  1UHF A;  3G6E T;  2DXT A;  1WHK A;  3OSV A;  2CS7 A;  2P4R A;  2DIL A;  2QYZ A;  1QVG A;  1A0N B;  3CBO A;  1WA7 A;  3L2Q A;  3JRZ A;  2E6N A;  3A5Z B;  4PFZ A;  3VJP A;  1W66 A;  2IY5 A;  4EO4 A;  1S72 T;  3NFC A;  4A4G A;  1VQ4 A;  3CC7 T;  2EGA A;  2ENM A;  2K3Y A;  2RHZ A;  2RQW A;  2I2L A;  1YIJ Q;  3MET A;  4LXC A;  2BTT A;  3RAC A;  3UPU A;  4M75 D;  2K5L A;  3EGU A;  3E9F A;  3I9Q A;  4BI4 A;  1E1O A;  2ZIM A;  4RG8 A;  3OYK A;  3VUB A;  2ZXF A;  4HWR A;  2HD0 A;  2F5T X;  2A08 A;  4J5Y A;  3M0Q A;  1QVP A;  2JZ2 A;  1VQM A;  2A3L A;  2ABL A;  4Z89 A;  3CCV T;  4ZTZ B;  2DXU A;  1OPK A;  2CKK A;  2P0Q A;  2EWN A;  2FRY A;  2I4O A;  4AG1 C;  4JZ4 A;  3CCE T;  2M9U A;  2FPF A;  2DL8 A;  3M0S A;  4LDW A;  2XKO C;  2BIV A;  2ZPF B;  3OYH A;  1ABQ A;  2H8H A;  5GAO r;  3VUZ A;  4FYW B;  4H2X B;  3TVT A;  1MNE A;  4C5H A;  1V1C A;  4KH1 B;  5D7U A;  4BDZ A;  3CCS A;  2DER A;  2QHS A;  1ZSG A;  4C92 E;  3JCM P;  3OYG A;  3F70 A;  3CME T;  1QLY A;  2CZ7 B;  3X25 B;  2CT4 A;  4JJC A;  1TUC A;  2RHS A;  2P4T A;  2EQJ A;  4F7U B;  2VGM A;  3INZ A;  1OX9 A;  2CT3 A;  4NOY A;  3RMQ A;  4IUV A;  2VV5 A;  1X01 A;  1NPR A;  4WCI A;  2HSE B;  3OW2 A;  2O9V A;  1U8R A;  3HTR A;  3OMC A;  4KBM B;  4DBQ A;  2HDA A;  1VQ5 Q;  2L8D A;  1YFR A;  2KRM A;  2RJE A;  3NHN A;  2EYX A;  3FDR A;  4ZN3 A;  2KXC A;  3RR6 A;  1FWZ A;  2KRO A;  4MZT A;  2EVR A;  5A0G A;  1YI2 Q;  4PJO B;  2AIR B;  3VS3 A;  3URG A;  5GAM f;  3ICA A;  2PVO B;  1WHG A;  4E7J A;  3ASK A;  3J80 E;  2B86 A;  1NG2 A;  1ZQ1 A;  3PIO A;  4HCC A;  2DBK A;  2YXY A;  3IQL A;  2WSF E;  1W2B P;  2LQW A;  1BIA A;  3A7U A;  1ZUY A;  4PJO F;  2EQM A;  2LT4 A;  3E19 A;  4PHC A;  2LJ1 A;  2GQI A;  1VQO A;  5GAN 8;  1TH7 A;  3MEW A;  2KY9 A;  4EPC A;  1Q81 C;  3QUI A;  2ZT7 A;  3PTA A;  2K4Y A;  3QXE B;  2ECZ A;  4A63 B;  1R8O B;  3SWN A;  1JEG A;  2ALY B;  4YRF A;  1D0Z A;  3BW1 A;  2COY A;  4PG3 A;  3VS6 A;  4ELZ C;  1PSE A;  1VQM T;  2EYY A;  4JJD A;  4L5G A;  1Q82 R;  3UA6 A;  3QII A;  3FJP A;  4A54 A;  3N5B B;  3G1J A;  1GFD A;  1G3Y A;  1R77 A;  2EYW A;  2DXC A;  2VC8 A;  1YIT Q;  4M77 A;  2YUO A;  1NE8 A;  2EBP A;  2V8K A;  2FYK A;  4NS5 A;  2FL7 A;  1OX8 A;  2E5K A;  1KC8 C;  4M77 F;  4DA4 A;  4M7D D;  3M4P A;  4UP9 A;  4J8O A;  3JCM Q;  1YJN Q;  2QQA A;  4TVY A;  2HCK A;  3DB4 A;  1UDL A;  1MMG A;  3QZ5 B;  1K73 R;  2PU9 B;  1J5W A;  3P8V A;  1M4Z A;  3CCS T;  2JMC A;  3JCM e;  2DLP A;  4HVC A;  5DM7 R;  4QT7 A;  5KNN A;  2SRC A;  1YJW Q;  2OTL T;  2OTJ A;  4J7I A;  1D3B A;  3EGD A;  5GAM g;  1X2H A;  1N6A A;  4QVZ A;  3MCA B;  2ZGW A;  1YCS B;  4DQ2 A;  1IL2 A;  3RES A;  2MIO A;  4Q5W A;  3CPW S;  4AT1 B;  4LVK A;  3VQX A;  2CP2 A;  1M2O A;  3CQT A;  4Q6G A;  2G6F X;  3HL8 A;  4YCU A;  2XDB A;  2DIG A;  1BIB A;  4C0F A;  1V29 B;  3PGG A;  5CKB A;  2RJD A;  2MWO A;  3GNF B;  3EG9 B;  1UGQ B;  1VIF A;  4TVA A;  2DL3 A;  3HTZ A;  3ER0 A; 
#chains in the Genus database with same CATH homology
 1N9W A;  4BE0 A;  1M1F A;  1B34 A;  1G3S A;  1RIQ A;  3JB9 I;  2DZ9 A;  2EYQ A;  1VQ7 A;  2NLU A;  3OYC A;  4QQD A;  1NJ2 A;  3HXZ A;  2C06 A;  4JRP A;  4LDV A;  1B7Y A;  4BI3 A;  1VQO T;  3OQ5 A;  1ZHI A;  4EMK B;  1KMN A;  4YRC A;  1X54 A;  1YHQ T;  2K2V A;  3HFN A;  2LQ8 A;  3JCM W;  5IN1 A;  5C6S A;  5GAN j;  2ZNI A;  2MAM A;  4M77 C;  1Z7M A;  1X6O A;  2RI3 A;  5DLQ E;  3UFG A;  4K87 A;  4P3P A;  3HRI A;  3ER0 A;  2EIF A;  1N9S A;  4QW2 A;  4F7U E;  2FB7 A;  3MEY A;  2AMC B;  3CMA A;  1B8A A;  3OYJ A;  4MZP A;  2ZZD A;  4C5E A;  3LWI A;  4YRI A;  1W4S A;  4OLF A;  2QEX A;  1ADY A;  4P72 A;  1OZ2 A;  2HQX A;  2PVG B;  2YRV A;  5GMK e;  4E7L A;  3EFS A;  5GAN d;  3X24 B;  4UC4 A;  2OTJ T;  1K9M U;  2KMT A;  3HFZ A;  2CGH A;  5GAN 5;  3OS5 A;  3AHU A;  3JCM X;  4JLG A;  1EVL A;  4ME7 A;  1M1K U;  4A4F A;  3LGL A;  2Q5H A;  1QVG S;  4L87 A;  1W2B A;  1EQR A;  2QHT A;  4TQF A;  2KDS A;  4A53 A;  3FC3 A;  4HT8 A;  3HKS A;  4V2S A;  1PSF A;  2VGN A;  4X9C A;  4P75 C;  2KAF A;  1WNL A;  1M5Q 1;  2RK2 A;  2DTH A;  3Q1J A;  2E6Z A;  2LC4 A;  4C0G A;  3OYI A;  1VQP T;  1G5V A;  4OGC A;  1N9R A;  2DVE A;  4C8Q B;  4EMK C;  5C52 B;  4C5G A;  1K73 C;  4Q15 A;  1ASZ A;  2YHT A;  3MHX A;  1PYS B;  1EIF A;  1EIY A;  3OYL A;  3P8Y A;  2PUK B;  1NJ1 A;  4EDU A;  2I4M A;  2E41 A;  1XOV A;  2GFU A;  3IG2 A;  3E9G A;  4FM4 B;  3CMA T;  2ZT5 A;  2FHD A;  3SD4 A;  3X20 B;  2WAC A;  1N27 A;  3CXC A;  5CK9 A;  1LYL A;  2QEX T;  3OW2 S;  4RQE A;  3GIB A;  3OYF A;  5LJ3 d;  4XU0 A;  5FU7 B;  1EVK A;  5GAO n;  3M59 A;  1FX7 A;  3NTK A;  5LJ5 j;  3L4G A;  3L42 A;  1EFW A;  4II1 A;  3X28 B;  4YRR A;  1LOJ A;  2RHX A;  5GAN h;  3JCM V;  2LT1 A;  3JAM E;  1JB0 E;  2DKG A;  1B70 B;  4XEO A;  4DOW A;  2QXF A;  4M7A F;  3HRU A;  2CJ9 A;  5GAO l;  1WQW A;  1S72 A;  1OI1 A;  1JJ2 A;  3PZC A;  1BI3 A;  5LJ5 d;  4YPF A;  3L2V A;  3OYN A;  1KHI A;  2DD5 A;  4J83 A;  3CCQ T;  4QVD A;  4J6X A;  4ZN1 A;  3CC2 A;  4BE2 A;  1NJ5 A;  2CZ6 B;  4XAX B;  2E70 A;  1WPY A;  4M78 E;  4TVW A;  4MML A;  4QVC A;  2EJ9 A;  5D6Y A;  2JOY A;  4IUT A;  1YFT A;  1FXX A;  1NJ6 A;  1M1G A;  5CO7 A;  2AKW B;  1WJQ A;  5KCO A;  5KE2 A;  2K57 A;  4M75 A;  3A8L B;  3QYG B;  3M9Q A;  4C92 D;  4J15 A;  4M75 F;  3OSS C;  2VUB A;  4XTX A;  1NZ9 A;  3MF2 A;  4P3N A;  4D6W A;  1H64 1;  4M7A C;  3MEU A;  4PNO A;  2RI5 A;  4E7K A;  4XEM A;  3PCO A;  3MF1 A;  4JRK A;  5LJ3 h;  2IY5 B;  1KD1 C;  3HY1 A;  5GAN f;  1KC8 U;  2WSC E;  3CC4 T;  1BYM A;  5DY9 A;  5E3I A;  3WVE B;  1KQ2 A;  4KUL A;  2E3C A;  4P3O A;  3OA6 A;  3HFO A;  2R57 A;  1ASY A;  4C8Q E;  4EX5 A;  3CCU A;  4J7F A;  2DDZ A;  1IZ6 A;  4BAC A;  2RHQ A;  3TCJ A;  1I8F A;  2FVU A;  2QQB A;  4FL6 A;  3CC2 T;  4YRN A;  2ZPB B;  3HXX A;  2QQR A;  5A0D A;  4CH3 A;  3I55 A;  1VQK A;  4X9D A;  5LJ5 h;  3E9I A;  2E5Q A;  2M16 A;  5K1P A;  3QBY A;  1Y71 A;  1YGB A;  2RJF A;  4LD9 K;  4LD6 A;  3M4G A;  4NCX A;  3QO5 A;  2RHS B;  3QZ9 B;  3RKY A;  3MP1 A;  5C0M A;  4M75 C;  2X35 A;  2RD1 A;  1I81 A;  2OTL A;  2YLC A;  3UDC A;  2Q7G A;  2VXE A;  1WYD A;  4A4E A;  4OMF B;  2C8M A;  5GAN g;  2L89 A;  1I5L A;  1N8R C;  3OBY A;  2ARU A;  3DB3 A;  2LCC A;  3NET A;  1VQN A;  3JCM d;  1W2B S;  4AH6 A;  3L2R A;  2DEQ A;  1RL2 A;  5CIU A;  3CCM T;  1H4Q A;  4R55 A;  3QTC A;  2JTF A;  4M7D A;  4FT4 A;  2QHU A;  1Y7X A;  3OS2 A;  1Y96 A;  3LWH A;  2X4W A;  3A5Y A;  4M7D F;  5LJ3 f;  1VUB A;  4P71 A;  4K86 A;  2P5I A;  2LCL A;  4YRP A;  3CCJ A;  4YRS A;  5HGQ A;  2MF2 A;  1ATI A;  1WGS A;  1KOG A;  1UB4 A;  2G4C A;  5J26 A;  3SWN B;  4LNS A;  3CCU T;  3QKJ A;  3GF5 A;  1YHQ A;  2ODR D;  5J39 A;  3BJU A;  4C0Z A;  2L3R A;  2RK1 A;  4M77 B;  2M0O A;  4CS3 A;  2E64 A;  3I55 T;  1SES A;  4H2Y A;  1VQK T;  3HPW A;  5F5W A;  2IVW A;  3CMQ A;  5LJ5 f;  5FRO A;  4O6J A;  2V8J A;  3EAE A;  2HBP A;  3CXC S;  2MMP A;  2XGT A;  4JLI A;  4M78 G;  1D3B B;  5KCH A;  3JB9 H;  3LSS A;  5GMK j;  3R6O A;  4IUR A;  1Q82 U;  3TEH A;  3P8H A;  1BBW A;  3KUF A;  2GQV A;  1XNI A;  1XQH A;  5LJ3 g;  2QDY B;  4BE1 A;  4PLI A;  4DOV A;  1NYQ A;  3REX A;  1E24 A;  4TVA B;  1K73 U;  2F69 A;  4M7D C;  3ME9 A;  2A8E A;  3PMI A;  3I56 T;  1VQN T;  3VQW A;  1B34 B;  2XU8 A;  4YRT A;  1NNH A;  2ZR2 A;  4P71 C;  1KHC A;  4KR3 A;  1JJ2 S;  4RMF A;  4N0A A;  3CD6 T;  1B7Y B;  5C51 B;  4FT2 A;  3JCM h;  3M55 A;  3CCJ T;  3QSU A;  2RH2 A;  2E10 A;  3E9H A;  3OS0 A;  2RHY A;  3FB9 A;  4FSX A;  3QHS A;  5LJ5 g;  4WJ3 M;  2ARS A;  2ZPE B;  3S3O A;  3SWN C;  4QQ6 A;  1VQP A;  2ZPH B;  4XTU A;  4MZM A;  5FU6 C;  1P92 A;  2DK3 A;  3BFM A;  3MP6 A;  4HWO A;  1Q7Y U;  2LX9 A;  4XTY A;  5IT9 E;  2XID A;  2PVD B;  3GNG A;  4C8Q G;  5CVI A;  3G1Z A;  5J3B A;  2QHV A;  2EKO A;  4YRE A;  5HY6 A;  3RUX A;  3LW5 E;  2LNV A;  2XDP A;  3VQV A;  4YP0 A;  1JBM A;  3R07 A;  5CR2 A;  4E51 A;  4BI8 B;  2DU7 A;  1UGS B;  1M9S A;  1BKB A;  4YRL A;  1BI2 A;  3UWN A;  2DAQ A;  2LTO A;  3HFZ B;  4ZTJ A;  2ZT6 A;  2PMF A;  3MO8 A;  2M1H A;  4PJO E;  3QO8 A;  4M78 A;  3PFS A;  4BUG A;  2J3M A;  4MMK A;  4C92 G;  3TEG A;  4OVA A;  5K1X A;  1M90 U;  2ZNJ A;  3EFR A;  3JB9 G;  1K8A U;  3M4Y A;  2QTX A;  1NJI U;  4OF1 A;  2E1H A;  3HRT A;  2DO3 A;  2I4L A;  4Y28 E;  2ZPI B;  2GFA A;  2PQW A;  1E1T A;  4J6Y A;  3A74 A;  1BBU A;  3CCQ A;  1X55 A;  4M77 E;  3JCM f;  3C4S A;  4O2D A;  3UT1 A;  2L5Q A;  4QQG A;  5GAN 7;  1X2G A;  4KQE A;  3BY7 A;  1GXI E;  3T9N A;  1EIY B;  1OZ3 A;  1U1S A;  2H3J A;  4GY5 A;  1HC7 A;  3JSC A;  3TRE A;  4ZGE B;  5GAO p;  2QA4 T;  4M78 D;  1USY A;  4KT0 E;  3ZFJ A;  1ZBX A;  2RM4 A;  3M57 A;  5GMK m;  2K5I A;  1VQ6 A;  5D6W A;  4RMO A;  3REU A;  3NTI A;  5GAM j;  2X4Y A;  1JRI A;  3OB9 A;  3A7R A;  4EMH A;  3G4S A;  4UPA A;  2ZCF B;  2C7I A;  3L2U A;  4P72 C;  1WQ7 A;  2MWP A;  5FRN A;  4YRJ A;  3QO7 A;  3L4G B;  3DLL A;  3HP9 A;  5A0L A;  1VQ8 A;  3C94 A;  2DQ0 A;  3I7F A;  2K3X A;  4YDQ A;  3M53 A;  3A8H B;  4M7A B;  5L8R E;  4C5I A;  4WI1 A;  1QVF A;  1YJW T;  5CQX A;  3FLG A;  5GAO q;  3JCM g;  4Y91 A;  1SSF A;  4KR2 A;  4BB7 A;  2ZT8 A;  4YRO A;  3CC4 A;  3V7S A;  2RO0 A;  3P8D A;  3QO3 A;  2P0K A;  4C92 A;  3M58 A;  1H4S A;  2Q7H A;  4C92 F;  4P73 A;  4KUD K;  3BDU A;  3GPL A;  3H6Z A;  4H2U A;  3FRN A;  2DTI A;  4C8Q D;  4EMG A;  5I2M A;  2JN0 A;  1H4T A;  1N8R U;  5CKD A;  2R5M A;  1JJC A;  1SRY A;  1EOV A;  1USY C;  4XU2 A;  2XK0 A;  3C12 A;  4Z02 A;  2QI2 A;  2E12 A;  3V8K A;  3RIR A;  1YBY A;  3G7Z A;  5M9O A;  3WVD B;  2O4X A;  5A2Q E;  4M75 B;  4XTZ A;  1VQ6 T;  4A4K A;  4JS5 A;  3OYD A;  1Q86 C;  4XK8 E;  4E7H A;  3JCM b;  1VQZ A;  4A4H A;  3PT9 A;  3G4S T;  2O01 E;  5GAM e;  5GAN 4;  2RA2 A;  5DLO A;  4OP0 A;  1YB3 A;  1UGP B;  2DIQ A;  1FYF A;  3JB9 D;  2ART A;  5KE3 A;  1VQ8 T;  4F7U G;  3S3M A;  1Q81 U;  3PCO B;  3GP8 A;  1Y07 A;  1L0W A;  2EL9 A;  3X26 B;  2JTM A;  4N4G A;  3CCM A;  1UGR B;  4CH4 A;  2CJB A;  2CJA A;  2EAY A;  3M5A A;  3QNE A;  2XIC A;  3MEV A;  4X5O A;  1KQS A;  2NS6 A;  4C92 C;  4PJO G;  3RER A;  4HWT A;  2RHQ B;  4ZGJ B;  3OD1 A;  2ZCE A;  4P73 C;  2HAX A;  3RL6 A;  3VBB A;  3HXV A;  2JVV A;  1G5I A;  4PKC C;  4OB2 B;  1HK9 A;  3GLX A;  3CCL A;  4YTL A;  3LH0 A;  3HRS A;  3A8O B;  2IG0 A;  2E65 A;  5C53 B;  4P5N A;  4TTV A;  3V7C A;  3M54 A;  4M77 G;  3A5Z A;  4OGE A;  4BY6 B;  4XTW A;  3G71 T;  4RQF A;  3LGF A;  4HKE A;  1WJR A;  3UGQ A;  4RG2 A;  3BDL A;  3RF1 A;  1YFS A;  4CS2 A;  4HWS A;  4M7A E;  5GMK l;  4L6V 5;  3CCR T;  3UH0 A;  2KQW A;  4X34 A;  4KUI A;  2XHC A;  2Q7E A;  1IRE B;  2R58 A;  2ZZG A;  2PUO B;  3DSQ A;  4ZTF A;  1VQ9 T;  3VYG A;  4M7D B;  3VU3 C;  2XG8 D;  1E22 A;  2WSE E;  1Y96 B;  4H2X A;  4CRI A;  1VQL A;  5CQY A;  3I56 A;  2E5A A;  2F5K A;  1YJ9 A;  4HCB A;  3HRK A;  3MP8 A;  5CKF A;  1SET A;  4LVM A;  1H3Z A;  2DQ3 A;  4F7U A;  1BI0 A;  3CD6 A;  1KMM A;  5HK3 A;  2D6F A;  3TU4 K;  1M8V A;  2KK4 A;  4F7U F;  4C0D C;  3A8M B;  3OMG A;  3P8B B;  3NEN A;  3CBP A;  3M56 A;  2B8A A;  2K5F A;  4PL6 A;  4O5V A;  2D9T A;  2EJF A;  2QQS A;  4HA8 A;  5FU6 B;  2VYT A;  3P8T A;  3CCL T;  4B9W A;  4PJO A;  4FU6 A;  1YIJ A;  3VYH B;  1QW1 A;  3CBM A;  3W3S A;  4M75 E;  2YLB A;  3NEL A;  4JRI A;  3OYM A;  4CS4 A;  2P0L A;  1VQ4 T;  3CEY A;  1AHJ B;  4UP8 A;  4B9X A;  3HY0 A;  4IUU A;  2ZR3 A;  3ZEH A;  3J7A F;  3S6W A;  5GAN 2;  2P0P A;  3VV0 A;  2HQE A;  12AS A;  2EQK A;  3TEH B;  4ELY C;  1G5H A;  2DJZ A;  3OYE A;  4BY6 C;  4IKF A;  1NYR A;  2PME A;  4TWA A;  2ODR C;  2GCX A;  3L2Z A;  4ZTU B;  2ALY A;  4G85 A;  5CKH A;  3SFM A;  4WF2 A;  2LVM A;  1QP2 A;  2A7Y A;  2CYZ B;  3KXT A;  1QVF S;  2V8I A;  2XI9 A;  3SB2 A;  4DPG A;  4RDX A;  5HKC A;  2CIM A;  4OB1 B;  1G3T A;  1SER A;  4PJO D;  1VQL T;  3VQY A;  2RI2 A;  3MEA A;  3IAL A;  1YJ9 T;  5IAY A;  1VQ5 A;  3SDZ A;  3ERR A;  1O9S A;  5FRM A;  5D6X A;  3JCM J;  1YI2 A;  2J3L A;  4BDY A;  5GAO m;  1QE0 A;  4R56 A;  3UGT A;  3J81 E;  4WJ4 A;  4LVI A;  2ZPG B;  2QQ9 A;  4M77 D;  2MI6 A;  3RKW A;  2BKD N;  3LYI A;  3RMS A;  4LDX A;  3HXW A;  4MDX A;  3CPF A;  2ZTG A;  4K88 A;  3QDR B;  1YIJ T;  1WJS A;  2DPP B;  2QA4 A;  2RHI A;  3H8Z A;  3GOX A;  2DU5 A;  5GAN 6;  4P75 A;  3A31 A;  4YCW A;  4IUQ A;  3O8V A;  1Z7N A;  1WLE A;  4YYE A;  3MQZ A;  3HSB A;  5CKE A;  3E1S A;  1YIT A;  3L2W A;  4EMK A;  5GAN 3;  3HHT B;  3OS1 A;  4BD3 A;  4M7D E;  1YJN A;  3PMT A;  3FIF A;  1B76 A;  1LJO A;  4M78 B;  2ZZE A;  3IKL A;  2LDM A;  5ELN A;  1LNX A;  3QPH A;  1KQ1 A;  1YJW A;  4VUB A;  3QYH B;  1H4V B;  2CZ0 B;  4M7A G;  2AMC A;  5ELO A;  4HT4 A;  4M78 F;  3TEE A;  4N4I A;  1X56 A;  2LRQ A;  3PIP A;  1KQS S;  1HTT A;  1NJ8 A;  1QF6 A;  4YRK A;  4YCV A;  3RKX A;  4N0A C;  2ZIO A;  1VQ5 T;  1DJ7 B;  5AYF A;  1X75 C;  1Q86 U;  4RKU E;  1YCY A;  4JDS A;  3OY9 A;  4E47 A;  2RJC A;  2RHU A;  1YI2 T;  3LLR A;  2X4X A;  2EJG A;  4TVR A;  5GMK h;  3S3N A;  4RCB A;  4XTV A;  1G51 A;  4FIB A;  4HWP A;  4H2T A;  3LX7 A;  4OB3 B;  1U1T A;  2ZIN A;  4LVJ A;  4GLK A;  4LDY A;  3FEO A;  4BWA A;  1VQ7 T;  1BI1 A;  1Q82 C;  1O75 A;  1KG1 A;  2DD4 A;  2KSS A;  3RGL A;  5KH6 A;  5CCA A;  2I4N A;  1UEB A;  2Q5I A;  1KD1 U;  4ZGD B;  4P74 A;  2JUF A;  4H2W A;  4YRG A;  4G84 A;  3JB9 J;  3V8L A;  2BUD A;  4LDU A;  1WU7 A;  3V8J A;  4M75 G;  5LJ3 j;  5FLX E;  1OYX A;  3OYY A;  1YIT T;  4PLL A;  4ATO A;  5GAN e;  2XDD A;  1G3W A;  4C8Q A;  4ZIB A;  3LSQ A;  4JS4 A;  4UP7 A;  4MDW A;  3KFU A;  1YJN T;  4C8Q F;  2XD0 A;  4E7I A;  4CI0 C;  4M78 C;  1PYS A;  3QJY A;  4HT9 A;  2R5A A;  3NEM A;  4BW9 A;  11AS A;  3OYB A;  2JNG A;  5GAM d;  2Y90 A;  3A7A A;  4NL2 A;  4L59 A;  4C92 B;  2KVQ G;  5GMK i;  1XTD A;  3QJ6 A;  2GF7 A;  4RCC A;  3DLM A;  1Q7Y C;  1I4K 1;  3A8G B;  5EG2 A;  3OYA A;  4M7A A;  4NL3 A;  4N4H A;  3G6E A;  3CPW A;  2DZC A;  3C95 A;  3HXY A;  4CH6 A;  4TQD A;  3L1A A;  3JB9 F;  1JJC B;  3QG1 A;  2EFI A;  4H2V A;  4CH5 A;  2EQU A;  1B70 A;  3CC7 A;  2ZZF A;  5LL6 S;  3VKI A;  2DTO A;  5CAI A;  2O4X B;  1MHN A;  3IKM B;  4H02 A;  5I2S A;  1ADJ A;  3V7R A;  4YRM A;  5HK0 A;  3TUP A;  1K9M C;  4P74 C;  3G71 A;  2CZ1 B;  4XU1 A;  3CCV A;  3JCM c;  3A32 A;  1M90 C;  2G3R A;  2OAU A;  1K8A C;  3HXU A;  3CCE A;  4C8Q C;  1NJI C;  1M1K C;  3CCR A;  1NPP A;  2LQK A;  4OB0 B;  5LJ3 e;  4XU3 A;  4HCZ A;  2VXF A;  4LVL A;  3WXM B;  4M7A D;  3WQZ A;  4IUP A;  1C0A A;  1VQ9 A;  2X4J A;  3CME A;  4J6W A;  5I21 A;  2AHJ B;  2DXB A;  3OBW A;  4JJN K;  3DKM A;  2RB6 A;  4M7D G;  2AKW A;  1HXD A;  3KBG A;  3ZBD A;  2Y4Y A;  3HFV A;  3PNW C;  2Y4X A;  3LC0 A;  4JRQ A;  2HNI A;  4XQ3 A;  4C0D B;  1VIE A;  1MGQ A;  5FU7 C;  4YRQ A;  5LJ5 e;  2D0Q B;  5GAM h;  4H2S A;  2XTI A;  3NTH A;  1QP3 A;  1RI0 A;  3M4Q A;  4JUV A;  1GGM A;  3G6E T;  2DXT A;  3OSV A;  2CS7 A;  1QVG A;  3CBO A;  3L2Q A;  3JRZ A;  2E6N A;  3A5Z B;  3VJP A;  1W66 A;  2IY5 A;  4EO4 A;  1S72 T;  3NFC A;  4A4G A;  1VQ4 A;  3CC7 T;  2K3Y A;  2RHZ A;  2I2L A;  3MET A;  3RAC A;  3UPU A;  4M75 D;  2K5L A;  3E9F A;  4BI4 A;  1E1O A;  2ZIM A;  4RG8 A;  3OYK A;  3VUB A;  2ZXF A;  4HWR A;  2HD0 A;  2F5T X;  4J5Y A;  1QVP A;  2JZ2 A;  1VQM A;  2A3L A;  3CCV T;  4ZTZ B;  2DXU A;  2CKK A;  2P0Q A;  2EWN A;  2I4O A;  3CCE T;  2M9U A;  4LDW A;  2XKO C;  2BIV A;  2ZPF B;  3OYH A;  5GAO r;  3VUZ A;  4H2X B;  4C5H A;  2QHS A;  4BDZ A;  3CCS A;  4C92 E;  3JCM P;  3OYG A;  3F70 A;  3CME T;  2CZ7 B;  3X25 B;  2RHS A;  2P4T A;  2EQJ A;  4F7U B;  2VGM A;  3INZ A;  4NOY A;  3RMQ A;  4IUV A;  2VV5 A;  1X01 A;  1NPR A;  3OW2 A;  1U8R A;  3OMC A;  4KBM B;  2L8D A;  1YFR A;  2RJE A;  3FDR A;  4ZN3 A;  1FWZ A;  4MZT A;  5A0G A;  4PJO B;  3URG A;  5GAM f;  3ICA A;  2PVO B;  4E7J A;  3ASK A;  3J80 E;  1ZQ1 A;  3PIO A;  4HCC A;  2WSF E;  1BIA A;  3A7U A;  4PJO F;  2EQM A;  2LT4 A;  3E19 A;  4PHC A;  1VQO A;  5GAN 8;  1TH7 A;  3MEW A;  2KY9 A;  4EPC A;  1Q81 C;  3QUI A;  2ZT7 A;  3PTA A;  2K4Y A;  3QXE B;  1R8O B;  3SWN A;  2ALY B;  4YRF A;  3BW1 A;  4PG3 A;  4ELZ C;  1PSE A;  1VQM T;  4L5G A;  3QII A;  3FJP A;  4A54 A;  3N5B B;  1G3Y A;  2DXC A;  2VC8 A;  4M77 A;  1NE8 A;  2V8K A;  2FYK A;  4NS5 A;  2FL7 A;  1KC8 C;  4M77 F;  4DA4 A;  4M7D D;  3M4P A;  4UP9 A;  4J8O A;  3JCM Q;  2QQA A;  4TVY A;  3DB4 A;  3QZ5 B;  2PU9 B;  1J5W A;  3P8V A;  1M4Z A;  3CCS T;  3JCM e;  4HVC A;  5DM7 R;  5KNN A;  2OTL T;  2OTJ A;  4J7I A;  1D3B A;  5GAM g;  1X2H A;  1N6A A;  4QVZ A;  3MCA B;  2ZGW A;  4DQ2 A;  1IL2 A;  3RES A;  4Q5W A;  3CPW S;  4LVK A;  3VQX A;  4Q6G A;  3HL8 A;  4YCU A;  2XDB A;  2DIG A;  1BIB A;  4C0F A;  1V29 B;  3PGG A;  5CKB A;  2RJD A;  2MWO A;  3GNF B;  1UGQ B;  1VIF A;  4TVA A;  3HTZ A;  4PJO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...