2DXTA

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with atp and biotin, mutation d104a
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNAVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 70
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxtA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dxtA01
2K57A 2C7IA 1ASYA 4C92B 4M77A 3EFRA 5LJ5e 2I2LA 1D3BB 2EJ9A 4C92D 5LJ5f 5DY9A 3TEHA 4RQFA 2DVEA 4K88A 1QF6A 4YRSA 2RM4A 4TVYA 2DTOA 4X5OA 4M75A 1SETA 3A74A 1JJCA 1LYLA 4P72A 3V8KA 3HTZA 3AHUA 4XEOA 3INZA 4TWAA 3REXA 5LJ5j 5E3IA 1U1TA 3ERRA 5GAOl 4F7UE 4YRJA 5GMKl 1G5HA 4XU2A 4DPGA 3JCMX 2I4NA 5GAN3 4H2XA 4KQEA 4YRTA 3JB9G 5LJ3j 2E3CA 2DEQA 4H02A 1N9SA 4JUVA 4H2WA 3LSSA 3REUA 2ALYB 3JCMQ 4F7UB 1SRYA 1X01A 3M4QA 3BJUA 3RACA 5KNNA 1HK9A 5GANh 1IL2A 4J6YA 1NJ5A 2VXFA 4YRCA 4PJOG 3M4PA 3VQWA 4WJ3M 2J3MA 4M7DG 5LJ5g 3VU3C 2XGTA 4KR2A 3KFUA 2DQ3A 1U1SA 1WPYA 3E9IA 3RL6A 4EMGA 4HT8A 2ZIMA 4YRKA 1TH7A 4E51A 4HWRA 1BBUA 1BIBA 2DKGA 3PGGA 3JCMd 4M7AG 4M75G 5GAMd 4UP9A 3RERA 4TQFA 4XU0A 1YFRA 2DXUA 1BBWA 1E22A 2ZINA 4YP0A 2QHSA 4X9DA 1EOVA 2EJGA 3A7UA 1KMNA 2DXTA 1N9WA 5C52B 4YRRA 3HXYA 1EVKA 3RKYA 5GMKe 5LJ3d 4M77E 2RHSA 1M5Q1 1MGQA 5GAOm 1NYRA 4H2UA 3UGTA 3P8TA 1B34A 2I4LA 2Q7EA 1EIYA 2Q5IA 3JB9F 2ARSA 1W66A 1B7YB 2DQ0A 4M77B 3DSQA 2DU7A 4UP8A 4L87A 4M77D 4XQ3A 3VQYA 3I7FA 3RUXA 1FYFA 4UP7A 3QUIA 1X2HA 4H2TA 4M78A 4PJOF 3JB9J 3E9HA 1LJOA 3HFNA 5GAOr 4HWOA 4M77F 1KMMA 1X56A 3G1ZA 3JCMe 3QO5A 3A7AA 5GAMe 4P74A 3JCMf 1WU7A 5GAMf 3HY0A 1E1TA 4YCWA 2VXEA 1RIQA 1HXDA 1WLEA 4M7DA 4CS2A 1PYSA 4M75F 2AKWB 2HNIA 1X2GA 4P71A 4XEMA 1BIAA 1E24A 4TVAB 1SESA 4YRMA 2ZR2A 4J5YA 4Y91A 4AH6A 3MF2A 1I5LA 3JCMV 4F7UG 5GAMj 3FB9A 4M7AA 5LJ3e 5C51B 3L4GB 5GANj 2IY5A 4J6XA 5LJ3f 3HXXA 3M4GA 4J6WA 2VC8A 4YRQA 4OP0A 1NJ2A 3HXUA 3HXVA 2EL9A 3JCMc 4HWPA 4TVWA 4YYEA 1YGBA 4C8QA 1I8FA 4P3OA 2ARTA 5I21A 5GMKh 2RHQA 5GAOq 1H4VB 4XU3A 4EMKC 4XTUA 5GAOp 2Q5HA 4P75A 4N0AC 4M78G 3SWNC 1JBMA 3JCMJ 4EMKB 1ADJA 3JCMg 5GAMg 1M8VA 4P73A 3QTCA 4WI1A 1NJ1A 4V2SA 3PCOA 3RKXA 3SWNB 1ATIA 4YDQA 1Z7MA 3QHSA 1EVLA 2QTXA 2CIMA 1YB3A 3JCMW 2ZXFA 2E10A 4C92A 3HFZB 2EWNA 4HWSA 1D3BA 4HWTA 1N9RA 3A31A 2ZT6A 4JLIA 1YFTA 2E1HA 3P8VA 3V7RA 3RKWA 3QO7A 4PHCA 4UPAA 1Y96B 3JB9H 5LJ3g 1KOGA 1NJ8A 4YCUA 2QHTA 1H641 5GANd 2CGHA 4YRNA 4WF2A 4WJ4A 1USYC 1I4K1 5LJ5h 3HXWA 1GGMA 1B70B 2DTIA 2ZNJA 1EQRA 1H4SA 4C8QG 2YLBA 4PJOE 4JRIA 1EFWA 3HSBA 4M7DE 3EFSA 2DZ9A 3JB9D 1B76A 4PJOC 2FB7A 2AMCB 2ZIOA 4DQ2A 4P3NA 3RESA 2ALYA 4Q15A 3CMQA 2YLCA 4F7UA 5GMKm 4YRGA 4M77C 3QNEA 2P5IA 1NYQA 4PJOB 4XTXA 4CH5A 2PMFA 4YREA 3FIFA 4M78F 4M7AE 4M75E 4PJOD 2ZZGA 2PMEA 4CH6A 3FJPA 3WQZA 1KQ1A 4C92G 4M7DD 1E1OA 1YFSA 4M75C 3TEHB 3UGQA 3RGLA 4G85A 4PG3A 4P72C 3BY7A 5GMKi 2DTHA 4M7AB 4M75B 4CS4A 1JJCB 3UH0A 4M7DF 4M7AD 4M75D 4XTZA 3QO8A 3W3SA 3PZCA 1WQWA 5GANe 5GANf 3JB9I 4NCXA 4CH3A 1H4TA 2ODRC 3A7RA 4M7AF 3HRIA 5GAN8 2ZZEA 2ZR3A 5CAIA 4H2XB 3P8YA 4ZTUB 2Y90A 1SERA 2QHVA 2EAYA 2ODRD 3NETA 2P0LA 1YCYA 4C8QF 4X9CA 2RB6A 4MMLA 5GAN7 2ZGWA 4MMKA 3HFOA 5GAN6 4TTVA 1VQZA 3QO3A 2QHUA 1B7YA 4G84A 3HFVA 3MEYA 2ZCEA 4K86A 4NOYA 4A53A 5HGQA 3OD1A 4J15A 4XU1A 2CJBA 3JCMP 3V7SA 2J3LA 4C92F 4A54A 1NJ6A 4YRPA 2RA2A 4YROA 4YPFA 4RQEA 3IKMB 3VQXA 5GANg 4HVCA 2E64A 4PNOA 1QE0A 4HT9A 2I4MA 3LSQA 1J5WA 3A32A 4RCCA 2AKWA 5K1PA 2JN0A 2E5AA 5F5WA 2DZCA 2DDZA 3ICAA 3UFGA 4BW9A 4TQDA 2I4OA 3R07A 4TVAA 1H4QA 4EO4A 2RHSB 3V7CA 3BFMA 3V8LA 3BW1A 1ADYA 3GIBA 3A5YA 4EMHA 4YRIA 1ASZA 2ZT8A 5ELNA 3RIRA 3JCMh 4QVDA 4H2SA 5GAMh 1B34B 3L4GA 1G5IA 1X54A 2XTIA 4M78E 3V8JA 1EIYB 1NNHA 4P3PA 3TUPA 3HRKA 1G51A 3TEGA 4CH4A 3IG2A 4BWAA 4M77G 4M78C 1WNLA 3VQVA 1HTTA 1HC7A 3IALA 2DU5A 1WQ7A 2YHTA 4H2VA 3NELA 4F7UF 1KQ2A 2ZT5A 1JRIA 5C53B 3SB2A 4H2YA 4M78B 3MF1A 3L2ZA 2ZTGA 4EX5A 2ZNIA 4P74C 4M78D 5LJ3h 4NL2A 1L0WA 2FYKA 2RD1A 4RCBA 3JCMb 2ZZFA 4EMKA 1X55A 4M7DC 1LOJA 4N0AA 4RMFA 3NEMA 3A5ZA 3SWNA 4JRKA 5LJ5d 4P71C 2E41A 3NENA 4YRFA 4XTYA 4M7DB 1PYSB 3HFZA 3VBBA 4HA8A 4LNSA 5GAN2 4XTWA 3BDUA 5GAOn 4M7AC 2C8MA 4YRLA 1WYDA 4CS3A 4O2DA 2ZT7A 1Y96A 4C8QE 3QSUA 2EJFA 1I81A 4YCVA 2IY5B 2ARUA 5K1XA 4ZTZB 2Q7HA 4C8QC 2CJ9A 4ZIBA 1B70A 4Q6GA 4K87A 4P75C 3IKLA 4RDXA 4C8QB 1USYA 3HXZA 2DJZA 5GMKj 12ASA 2RHQB 4C8QD 2CJAA 4NL3A 3HY1A 3L1AA 3LC0A 4OLFA 4P73C 4KR3A 5GAN4 3RF1A 11ASA 2G4CA 4C92E 4QVCA 2AMCA 5GAN5 1C0AA 5ELOA 1LNXA 4XTVA 4C92C 1B8AA 2E65A 2Q7GA 3PCOB 1Z7NA 4PJOA
chains in the Genus database with same CATH superfamily
1ASYA 4KUDK 1OPKA 3CXCS 2I2LA 2EJ9A 5DY9A 2HD0A 2DX1A 3JAME 1G3WA 4Z89A 2JOYA 4AMCA 2DYIA 1WXBA 1ZSZC 3SDZA 2A8EA 4M75A 1TU0B 4BB7A 1SETA 4DEYA 2BKDN 3FRNA 1MNEA 2QYZA 5A0GA 3INZA 1RADB 1RLPC 2GTJA 3A98A 5E3IA 1U1TA 2BZ8A 4RTVA 3ERRA 1QVFA 3UT1A 4F7UE 2CP3A 3RMQA 3JCMX 2F69A 3A1PA 4HVWA 4KQEA 2PZ1A 2F2VA 3CCST 4JUVA 1M3BA 4BD3A 4H2WA 3REUA 4BE1A 3JCMQ 1SRYA 1UTIA 4ZTFA 4J9FA 3BJUA 5KNNA 4HVVA 2K3XA 4YRCA 2YT6A 1PWTA 4ZGEB 3UPUA 4X34A 2DQ3A 3E9IA 4Z8AA 2YDLA 3LH0A 4A63B 2ZIMA 3HRUA 3TVTA 1TH7A 3VS0A 1IHVA 4HWRA 1BIBA 2DAQA 3TCJA 1QCNA 3PGGA 4M7AG 5GAMd 3CCVT 1JJ2P 4XU0A 1YFRA 2OTLA 1GL5A 2DL7A 2DXUA 2OTLQ 1YITA 3E9FA 2QHSA 1ZLMA 1YITQ 2HBWA 2M9UA 3CMAT 1UGVA 1ZUUA 3RDVA 1YWPA 3OYCA 3HXYA 1VQ8A 2KGTA 5GMKe 1YWOA 1Q86U 1AOJA 1MGQA 1VQ8Q 1SHFA 1GCQA 1R0CB 3P8TA 1WIEA 3CCQA 2A28A 1KG1A 3CCQQ 1PNJA 1E6HA 4B9WA 1AHJB 2Q5IA 2ARSA 3VUBA 4JRQA 1W66A 1B7YB 2DQ0A 4M77B 4M77D 1ZUYA 4J9EA 1PRLC 1NPPA 1H92A 4OB1B 4F16A 2D0QB 5CO7A 2KRNA 2BIVA 1TOVA 4KGZB 1VQNT 4IUVA 4M77F 3X26B 4IUPA 2NUTA 3JCMe 3QO5A 3O5ZA 1ZHIA 4E7HA 5KE3A 1W4SA 1E1TA 1NJIU 1NEBA 2C0IA 3M5AA 4EPCA 5AT1B 3CXCA 1WLEA 1W2BP 3U23A 2HNIA 2SRCA 1FXXA 5FU6B 2DMOA 1E24A 2DLPA 1X6BA 1M2VB 2LTOA 3G1JA 4FU6A 2KRMA 4J5YA 3VUZA 4Y91A 4LUDA 1VQKA 4AH6A 2D1XA 2MMPA 3JCMV 5GAMj 3C0CA 3FB9A 1VQKQ 4M7AA 1QCOA 5GANj 3L4GB 4MZTA 5LJ3f 2M0YA 2VC8A 1R8OB 4YRQA 1QKXA 2KE9A 4BDYA 1VQPT 3FJ5A 1R0BG 1KD1C 1SRMA 3MJXA 5HK3A 4XU3A 2RHXA 1VQ4A 3CD6T 4XTUA 1VQ4Q 2KSSA 2RHZA 3T9NA 3SWNC 1HYOA 1BK2A 2WSEE 5CKDA 5GAMg 2HBPA 5IN1A 3P8HA 2Y4YA 1NLOC 2CP7A 4ZN1A 1K1ZA 2QTXA 2I0NA 1YB3A 1K8AR 1UECA 3EG0A 2XD0A 3REAB 3MEVA 3FEOA 3RKWA 1KC8U 2BZXA 2CP5A 4IUUA 4LD6A 2K5IA 4WJ4A 4CC3A 2DL4A 3GF5A 1N8RR 3I56T 1PHTA 4RMOA 3DB4A 4L6V5 2M16A 2MWOA 2DTIA 1KIKA 2K3BA 2RQUA 1NPRA 1H4SA 4II1A 4LDUA 2HL3A 3HSBA 4M7DE 2NWMA 1QW1A 2RK1A 4PJOC 2LP5A 2AMCB 4DQ2A 4JRPA 5FW9A 3CMQA 3CPFA 5GMKm 2SEMA 1VA7A 3LGLA 1TUCA 2P5IA 1MV0B 1F1BB 3CCET 4JJDA 1KFZA 4YREA 2CH4W 4CI0C 2PMEA 4CH6A 2LJ1A 1MUZA 4OMLA 4M75C 3TEHB 2LC4A 4F04B 4J83A 4KH1B 4FT2A 1AEYA 1BYMA 1C6VX 3EG1A 3L2VA 3OMGA 1JJCB 2LNHB 3MQZA 1RI0A 4PJNA 1SKUB 2LCCA 2QGGA 3MEUA 3M54A 3PZCA 2DE0X 1ZX6A 2WACA 2GFUA 5CKBA 1VQOA 2EKHA 3JB9I 1VQOQ 1K73U 2CZ0B 3CC2A 4HCCA 4C5EA 3CCLT 3CC2Q 1G5VA 2F5KA 2LQKA 4JS4A 3QBYA 1X27A 1PM3A 4RKUE 2R5AA 3UDCA 4AFZC 2P0LA 2AT1B 3MO8A 4C8QF 4X9CA 2RB6A 2RI2A 1UUEA 4E7ZA 5GAN6 2NS6A 2X4YA 5CKHA 3LX7A 1QLYA 5IXBA 1I0CA 1B7YA 3M0UA 3HL8A 1X6GA 1PKSA 4K86A 3NTKA 4NOYA 2HKQB 4AFQC 2QQ9A 2ENMA 5I2SA 1LVKA 2ABLA 5A0LA 4N4GA 4C92F 2XIDA 4A54A 3UATA 3C95A 3CCJA 4RQEA 1N6AA 8ATCB 3CCJQ 2QEXT 1JXOA 1UJ0A 4RCCA 4PLLA 3RR6A 1GCQC 2X4XA 2E5AA 2P4TA 2HMAA 1C1AA 5EC7A 2EYZA 1M2VA 2X4WA 4EO4A 5KYXB 3V7CA 3BFMA 3A5YA 1ASZA 2R58A 2ZT8A 1YNZA 5GAMh 1B34B 3L4GA 2KK4A 4GBQA 2RJEA 2JTEA 1SF9A 4C5HA 3OSSC 2XTIA 5CVIA 3M0QA 2HQXA 4IURA 2A08A 1G51A 4HXJA 1HC7A 3IALA 2YHTA 1ZBXA 2DNUA 4M78B 4OMMA 2P0KA 4FM4B 2ZNIA 4ANJA 4M78D 4OMPA 2VGMA 1I1JA 2L0AA 4LUEA 1X55A 1LOJA 1WFWA 1KJWA 2P0PA 1K9AA 5LJ5d 1IGUA 3CBMA 3CCRA 2RHIA 1YJ9A 3CCRQ 1YJ9Q 2RF0A 2OTLT 3BDUA 2XMFA 5GAOn 1YITT 1YBYA 4M7AC 1WYDA 1HD3A 4CS3A 1QWFA 2COZA 3CC4Q 4O2DA 3MP6A 1XNIA 4CC2A 1MV3A 2D0NA 4C8QE 3GOXA 3QSUA 2MPXC 3ULRB 3R6NA 2A3LA 2ARUA 5DLOA 2RJDA 5DLQE 1VQ8T 1M90C 3EGDA 2F5TX 1NZ9A 1QP2A 4MDXA 1G83A 4JJCA 4O6JA 3WVDB 2KY9A 4BY6C 3CCQT 4RDXA 1C0MA 5GMKj 2RHQB 2PU9B 2CJAA 2FZCB 2IG0A 3I35A 3OSVA 3A8GB 2J7IA 5CIUA 5GAN4 4C92E 2L8DA 2QASA 2JS2A 4QVCA 1NYGA 5D6XA 2AMCA 5GAN5 1Q86R 2DBKA 2VV5A 1Q82U 4FW2A 5FRNA 5ELOA 4ATOA 1RAFB 2LRQA 3PCOB 1B7TA 4J9HA 2GFAA 1K8AU 2K57A 3M0TA 5IT9E 1GBQA 3EHQA 4MZPA 2DXBA 4HCKA 1K4US 2LZ6B 4J9BA 1W6XA 3TEHA 3X25B 2O9SA 2DRMA 3NMZC 1D0YA 2X35A 4K88A 2MWPA 4YRSA 4X5OA 1YFNA 3A74A 1JJCA 4LE9A 4P72A 1OZ2A 5J39A 1K9MR 1VYUA 1BCMA 1VQKT 5FU7B 5LJ5j 2ESWA 3UA6A 2V26A 1W70A 2XICA 5GJVB 5GAOl 3PFSA 1QVFS 3QJYA 5DM7R 5GMKl 1KQSP 3LH5A 2VVKA 1T3LA 4LVKA 2I4NA 4YRTA 2E3HA 3JB9G 1NJIC 2E3CA 2DEQA 2EQUA 2FRYA 1N9SA 2DF6A 2RQTA 4ZNXA 2HCKA 4F7UB 2X4JA 2M02A 2OI3A 4J6YA 3QXEB 2DPPB 3ZBDA 4PJOG 2J3MA 3I55A 5LJ5g 2XDPA 4KR2A 1U1SA 2AZVA 2BZYA 4YRKA 5L8RE 2EQMA 2ED1A 1IHWA 2ZPGB 2IIMA 4RTYA 1BBUA 2DKGA 3EGUA 4M75G 4F17A 1IO6A 3EH1A 3ME9A 3CBPA 4K11A 1BBWA 1V76A 1BBZA 1YJWA 4YP0A 3OMCA 4X9DA 1YJWQ 2M51A 2JUFA 3A7UA 2CZ1B 1E6GA 3URGA 4HT4A 2DXTA 1N9WA 5C52B 1MHNA 2K3YA 1WA7A 3RKYA 4DBRA 5KYXA 1NYRA 4H2UA 2P84A 1KC8R 2LT4A 1B34A 3PMIA 4PJJA 3CQTA 3OW2P 4M4ZA 3GP8A 3DSQA 2L3RA 3VS3A 2ED0A 2EYXA 4XK8E 3M56A 2V1RA 3I7FA 2HSEB 5IH2A 4KULA 4UP7A 3THKA 4LVJA 1X2HA 2RJCA 4M78A 2X3XD 2CS7A 5GAOr 1WJRA 2VKNA 4RTXA 1N27A 1DJ7B 2DVJA 2DIQA 3NTIA 3M53A 4P74A 3C94A 1WU7A 5FU6C 5GAMf 2EYYA 5EG2A 1D1BA 5CKEA 2RPNA 3FDRA 4CS2A 2LJ0A 2D8HA 3OS5A 4XEMA 4E7JA 2XHCA 4OF1A 2DETA 4TVAB 3CC2T 1SESA 4HCZA 2RNAA 4F7UG 5C51B 5LJ3e 2LJ3A 4PFZA 2HQEA 5GJWB 1YCSB 2FEIA 3LWIA 3HXVA 4RG2A 2D8JA 2EL9A 1UHCA 4HWPA 2AIRB 4TVWA 4P3OA 1K73R 2ARTA 1HJDA 5GMKh 2RHQA 1LCKA 4CRIA 1RAGB 1AWJA 4PJMA 3JRZA 2Q5HA 4P75A 4FL6A 2B86A 2K5FA 8AT1B 1OU8A 2JMAA 3QG1A 4QQDA 3ZL7C 3OYEA 1M8VA 1FX7A 3QTCA 4WI1A 2J6OA 3PCOA 5HK0A 1IZ6A 4YDQA 3QHSA 3CPWP 1EVLA 2H3EB 3HTRA 2ZXFA 2E10A 3CCJT 2ZT6A 4ME7A 3M59A 2OTJA 1AZGB 1WGSA 2OTJQ 3OB9A 4OB0B 4UPAA 3JB9H 1TSFA 2PUOB 5FROA 1KOGA 5GANd 2CGHA 4WF2A 2DXCA 3LLRA 5FRMA 4J9CA 2PVOB 5LJ5h 2OJ2A 2LQ8A 3HXWA 1GGMA 3H0IA 4OMQA 1B70B 3NPFA 4VUBA 3LGFA 3EGXB 3G4SA 1ZUKA 2OAUA 3PT9A 3MHXA 1IB8A 4LXCA 3G4SQ 2KXDA 1UJYA 5CQXA 3EFSA 2RI3A 2QG9B 2FB7A 2L89A 2ZIOA 3X28B 3KXTA 2HKNA 4F7UA 2L5QA 3ASKA 1JJ2S 1NYQA 1R77A 3WVEB 4CH5A 4RTZA 4M7AE 2GCXA 3FJPA 1JU5C 2OX7A 4M7DD 1YFSA 2LQNA 4D8KA 2DA9A 4P72C 3CCRT 2FG0A 1YJ9T 2E5QA 2DEUA 2BE7D 5GMKi 6AT1B 1VQMA 3UH0A 4M7DF 2DILA 4XTZA 3CC4T 1VQMQ 2G6FX 1K9MU 3M4YA 2YSQA 2GNCA 3TQ7P 2HQHA 1H4TA 1UGPB 2E6NA 5GAN8 2ZZEA 1T0JA 4AT1B 2Y90A 3S3NA 5M9OA 2R5MA 4Z02A 3QYHB 2EAYA 2ODRD 2X3WD 2HZYA 1FYNA 2DIGA 3Q1JA 3EG3A 1WLPB 4LDWA 3LYIA 3SFMA 4TTVA 4JZ3A 1X2QA 1XJWB 4BUGA 3MEYA 2ZCEA 4QVZA 1W2BS 5HGQA 2KBTA 3M0PA 4JJBA 3A8LB 3OA6A 4WCIA 2CJBA 2CREA 3P8BB 1BI0A 3NHNA 1FMVA 1D0ZA 2RA2A 2FL7A 3IKMB 2XKOC 1Q7YU 2QA4A 1Q82R 5GANg 1VQLA 3VQXA 4HVCA 1VQLQ 2QA4Q 2COYA 1V1CA 1QE0A 3LSQA 2I4MA 3E19A 3A32A 5K1PA 5KYWB 2JN0A 2A37A 4B6MA 5F5WA 3A8MB 1U8RA 4TQDA 4TVRA 2ZPFB 1K8AC 1M1KR 4TVAA 3V8LA 1EFNA 1ADYA 1M4ZA 4YRIA 3M0SA 2PNIA 4EMHA 3MCAB 1Z9ZA 1XQHA 2QQSA 4FYWB 1UHFA 1X54A 1SRLA 2CSIA 3BE3A 1RL2A 1T0HA 1NNHA 4P3PA 3REBB 1WHLA 4CH4A 1BI3A 4M77G 2IVWA 1WNLA 1KSWA 4M78C 1AWOA 1PKTA 3VJPA 3G71A 4H2VA 1N8RC 2F2WA 1E7OA 3G71Q 5L23A 1JXMA 4P74C 4NL2A 3LWHA 1L0WA 4L5GA 2FYKA 3JCMb 4IKFA 3META 1SSHA 1IRXA 4BE2A 3M55A 1JJ2A 4RMFA 1OOTA 3AT1B 1OU9A 2BTTA 1QVGP 3L2WA 4YRFA 2VGNA 3HPWA 2V8KA 3MEWA 4HKEA 1PYSB 2K9GA 1M3CA 4DA4A 5ECAA 1Q81U 4HA8A 2F2XA 4XAXB 5FWCA 3QWXX 1YJWT 2VYTA 4YRLA 1SSFA 2KYMA 4PKCC 1MNDA 5KCHA 4J8OA 1NG2A 4OMOA 4YCVA 5K1XA 2QDLA 2Q7HA 1PCXA 1RACB 3CCMA 3CCMQ 3J81E 2RO0A 2KVQG 1B70A 4Q6GA 4P75C 2KNBB 2P0QA 4C8QB 1USYA 2YRDA 3HXZA 3SEMA 4RG8A 4C8QD 3EGXA 3HY1A 4CC4B 3E9GA 4KGVB 4E47A 2CUBA 2DO3A 2J6KA 1YI2A 1AWXA 2J06A 2VWFA 1YI2Q 1LNXA 1B8AA 1KHCA 1Z7NA 2CZ7B 3G7ZA 4DOVA 1WHMA 2RH2A 2PVDB 2GF7A 2C7IA 4C92B 1H3ZA 4M77A 3EFRA 1D3BB 4C92D 5LJ5f 1A0NB 3QZ5B 1W2BA 1U5SA 2XI9A 2K2VA 3TSWA 1B3QA 2DVEA 2RHUA 2O9VA 5I2MA 4JS5A 1QF6A 1GRIA 2CP0A 2RM4A 3NFCA 3VS2A 2DFUA 4TVYA 2H8HA 5CCAA 5FU7C 3V8KA 1NM7A 1X69A 2C0TA 2NYSA 3CBOA 4TWAA 4PFOA 3REXA 4LVMA 2JTMA 4J9DA 2Y4XA 2PVGB 1SG5A 3CC7A 1G5HA 3CC7Q 5FWBA 1MMDA 4BACA 4DPGA 1X2KA 4A4KA 2RMOA 1QVPA 5LJ3j 2O31A 3X24B 4LNPA 3LSSA 3QDFA 3S3MA 2ALYB 4LDYA 2RK2A 2CUDA 2MIOA 5GANh 2VXFA 2KR3A 2MK5A 3VQWA 4AFUC 3S6WA 2WSCE 3VU3C 3QKJA 2XGTA 2ZPIB 1WPYA 3RL6A 1AD5A 4E51A 4L59A 4OMNA 3G6EA 1X75C 2EQJA 3JCMd 3G6EQ 2CZ6B 5IHKA 3RERA 2OTJT 1ZQ1A 4TQFA 2RN8A 1AT1B 3QWYA 1MMAA 2H3JA 4Y28E 2ZINA 2E6ZA 1RAAB 1EOVA 2KDSA 2M1HA 4EDUA 1OEBA 5KYWA 1MMNA 1KMNA 2RQRA 3R6OA 2BUDA 3CCUA 1VYTA 3CEYA 4YRRA 1QKWA 2GTOA 3CCUQ 2QXFA 1ABOA 3I5RA 3J80E 1M5Q1 1O9SA 1W1FA 3M0RA 3G4ST 1BB9A 4PLIA 4LD9K 4B9XA 4C0DB 2I4LA 3JB9F 4RUGA 7AT1B 2DU7A 4UP8A 4L87A 1K0SA 2CT3A 3VQYA 4E7KA 3F70A 4IUQA 1RABB 1Y71A 4PJOF 3JB9J 2YUPA 5KE2A 4PL6A 3E9HA 4DBHA 4HWOA 3GNGA 1WYXA 4J7IA 1KD1U 3D7SB 3G1ZA 1XTDA 1UB4A 3TREA 5GAMe 2JNGA 3HY0A 1VQMT 1Q86C 2AKLA 2VXEA 1RIQA 2KMTA 3CMEA 1MMGA 1PYSA 4M75F 2AKWB 1X2GA 5KYUB 3CMEQ 4HVUA 4KH0B 4E6RA 2HSPA 1M1KU 1Z9QA 2JS0A 2W0ZA 4Y92A 2ZR2A 4A4HA 2DL8A 3MF2A 2V8IA 1M8MA 4O5VA 3I5SA 4J6XA 4Z88A 1WX6A 3M4GA 1D1CA 4J6WA 4GLMA 4RTTA 1GFDA 4FSXA 4FW1A 4DOWA 1YGBA 2ROLA 3EG9B 2O4XB 3M58A 1Y0MA 4C8QA 1I8FA 4R56A 1K9MC 2RQVA 5I21A 1OV3A 1VQ7A 5GAOq 1H4VB 1VQ7Q 1M2OA 5GAOp 4FT4A 3GBQA 4M78G 2NUPB 2DRKA 3C4SA 2DL5A 2EGAA 4KRTA 3JCMJ 1OX8A 4EMKB 1ADJA 3JCMg 1VQ4T 2JJ9A 3MEAA 1IREB 5KH6A 4P73A 2DM1A 2JM8A 4KT0E 2E12A 1EIFA 1YHQA 2AKKA 4V2SA 1ATIA 3VYGA 1YHQQ 2CIMA 3JCMW 2CP2A 4C92A 2KQWA 2LX9A 2EWNA 2ZPBB 2O88A 3HFZB 4HWSA 1D3BA 3I55Q 4HWTA 1RAIB 1VQLT 1M1FA 1N9RA 2O01E 1KQSS 3A31A 4JLIA 3L42A 1YFTA 1VQ5A 3TU4K 1U3OA 3I56A 1VQ5Q 3QO7A 2FZKB 1G3TA 4PHCA 1QQJA 1VYVA 1ZSGA 1NJ8A 3ZFJA 4YCUA 2QHTA 4R0KA 5KYNA 1USYC 2K7AA 2EGCA 2IPOB 2L3QA 1Q7YR 4FYXB 2ZNJA 3OYHA 3M57A 4JLGA 1GFCA 2YLBA 4PJOE 4JRIA 1WZOA 1QCFA 4F14A 1B76A 3UA7A 1B07A 4QT7A 5CQYA 4P3NA 5AYFA 3RESA 3HKSA 4UC4A 3VKIA 2ALYA 4Q15A 4YRGA 3OQ5A 4D8DA 2LCLA 4M77C 1VQ6A 3QNEA 3L2RA 3OBWA 1VQ6Q 3FIFA 1KC8C 3M9QA 4M75E 2ZZGA 3WQZA 1KQ1A 4N4IA 2XK0A 5D6WA 1E1OA 3NGPA 4FSSA 1YJNA 3RGLA 2FPDA 4PG3A 2KYBA 1YJNQ 4GLKA 2DTHA 4M7AB 4CS4A 1GBRA 1G2BA 4M7AD 1M9SA 1SPKA 2A36A 4FIBA 2L2PA 3OYNA 3C12A 3OW2S 3CXCP 2KT8A 5GANf 3GLXA 1RI9A 2J6FA 4NCXA 4CH3A 9ATCB 2ODRC 3A7RA 4M7AF 1FWZA 3CCMT 1VUBA 1TTHB 4DEXA 4OGEA 1VQOT 2ZR3A 1Q81R 1OX9A 4H2XB 3P8YA 1S72A 4ZTUB 1JQQA 1S72Q 2QHVA 2MF2A 1K76A 2GQVA 3NETA 1UDLA 3P8DA 4MMLA 1FMKA 3JV3A 3ER0A 2L3SA 1VQZA 1D1AA 1YI2T 4FCYA 4E7LA 4N4HA 4A53A 1ZA2B 2EKOA 1SEMA 2DERA 3PIOA 3OYAA 3VS4A 4J15A 4XU1A 1K73C 2QEXA 2QEXQ 1NJ6A 3H41A 4J9IA 4YROA 2RJFA 3DB3A 3PE0A 3HP9A 2E64A 4PNOA 2BE9B 1VIFA 3OYIA 3PMTA 2AKWA 3X20B 5KYUA 2K6DA 1KQSA 2DZCA 1M1GA 3UFGA 1BI2A 1QMCA 4A4GA 3CC7T 3R07A 2KROA 1H4QA 2RHSB 3GIBA 4JDSA 2EW3A 3JCMh 4H2SA 2HL5C 5KYYB 1BCOA 3V8JA 1EIYB 1M3AA 2KEAA 3CPWS 3IG2A 4BWAA 1Y07A 4YTLA 3EG9A 2O4XA 2A7YA 2ZT5A 4FYYB 5C53B 1M90U 2E3IA 3SB2A 4H2YA 3MF1A 1CSKA 2NLUA 3L2ZA 2ZTGA 5KCOA 1HSQA 2LDMA 1TS9A 2NUPA 5IAYA 1EZZB 4Q5WA 4RCBA 2VASA 2ZZFA 1CKAA 4EMKA 1G3SA 1V29B 2KI7A 4N0AA 3VV0A 2JVVA 3NEMA 3G6ET 2B8AA 4JRKA 3HHTB 2ZCFB 2A0FB 4XTYA 2YUQA 4M7DB 3HFZA 2EQIA 2QAZA 4LNSA 5GAN2 4XTWA 2CP6A 5HY6A 2DD5A 3E2UA 2ZT7A 3QZ9B 3RBBB 2EJFA 5C6SA 2IY5B 1UGSB 3CCUT 1BKBA 2QQAA 4C8QC 2AK5A 2CJ9A 3OW2A 2QQBA 3KFVA 1TXQA 2EIFA 1TUDA 4CC7A 3FC3A 4KGXB 3BDLA 1GCPA 1VQ9A 1UEBA 3IKLA 2DJZA 3L2UA 1VQ9Q 1XOVA 4JPBW 4NL3A 3L1AA 1G8XA 2MCNA 2EGEA 4OLFA 4P73C 2MI6A 2XDDA 3RF1A 11ASA 1VOMA 3EH2A 3OYKA 1GXIE 3EHRA 1C0AA 4XTVA 2EFIA 4C92C 2D6FA 2E65A 1RLQC 1TUGB 2EVRA 4J9GA 1H8KA 3DLMA 4QQGA 3TEEA 1J3TA 2ZPEB 5LJ5e 1AVZC 3PVQA 4RQFA 4OMFB 3RNJA 1KK7A 4AFSC 3DKMA 3CMET 2K2MA 2YXYA 2DTOA 3VRYA 2ROTA 1LYLA 1ABQA 3HTZA 3H8ZA 3AHUA 4R55A 4XEOA 1OZ3A 1ZSZB 1KD1R 3OS2A 1YP5A 1X6OA 2M0OA 2YWWA 2FZGB 4YRJA 1Q82C 4XU2A 1CKBA 2YUNA 1WDXA 2PQWA 2ZPHB 5GAN3 4H2XA 4AG1C 4H02A 2ZZDA 1VQ7T 2MOXA 3PNWC 5I11A 1X01A 3M4QA 1M1KC 3RACA 1HK9A 4BI4A 2DBMA 1IL2A 1NJ5A 2NUZA 3M4PA 1SHGA 4WJ3M 2VB6A 3CPWA 4M7DG 3KFUA 5CK9A 3SD4A 5FLXE 2DJQA 1YHQT 3TSZA 4EMGA 3PTAA 2EYWA 4HT8A 5D7UA 4OB3B 3L2QA 2K79A 1QWEA 3I55T 2P4RA 1NEGA 2QTVA 4GY5A 4LVIA 1PSFA 4UP9A 3O8VA 3H6ZA 3EGDB 1VQ5T 1ACMB 4ZN3A 1E22A 2FO0A 3OS0A 1JO8A 1P92A 1YIJA 2EJGA 1U06A 1YIJQ 4ESRA 3N5BB 1EVKA 5IHIA 5LJ3d 2RI5A 4M77E 3MP8A 2RHSA 4HCBA 4C0DC 5GAOm 3UGTA 1RAEB 1JB0E 5KYYA 3HRSA 2KXCA 4QQ6A 2Q7EA 1M27C 5J3BA 1EIYA 2R57A 2CYZB 2HEQA 1QVGS 2X51A 1VQ6T 4XQ3A 2QQRA 2ZAEA 4ORZA 3RUXA 1I07A 4OB2B 1FYFA 3QUIA 4H2TA 2W10A 4WTOB 4BDZA 2YRCA 1NBEB 1LJOA 1OPLA 3HFNA 1YJNT 1KMMA 1JEGA 1X56A 2C06A 3A7AA 2YRVA 3JCMf 2Z0WA 4YCWA 1HXDA 4LDVA 4M7DA 3MKDA 1S1NA 4LVLA 2FPEA 3UF4A 4P71A 2ATCB 1BIAA 1K0XA 1X43A 4LDXA 4YRMA 3OYGA 2RQWA 2EBPA 1I5LA 3W3SA 4BE0A 2IY5A 3EFOB 2K5LA 1S72T 2HAXA 3HXXA 5A2QE 1QP3A 4OP0A 1NJ2A 3HXUA 4RTWA 4C5GA 4YYEA 3JCMc 5C0MA 3CCSA 4IUTA 1FMWA 3CCSQ 4EMKC 1AZEA 4N0AC 4PJLA 3SHWA 1JBMA 2KAFA 1WHKA 2JZ2A 1AWWA 1NJ1A 2J05A 3A5ZB 2G3RA 2WSFE 3RKXA 3SWNB 1Z7MA 3PIPA 4J7FA 5IHNA 4EIKA 3OS1A 4FYVB 3CCVA 3RMSA 2KT1A 3CCVQ 2E1HA 3P8VA 3V7RA 2ECZA 2JMCA 1OI1A 5HKCA 3QDRB 1Y96B 3A8OB 3MP1A 5LJ3g 2LVMA 3VYHB 4ELYC 1H641 1UGQB 5HCKA 4YRNA 3VS7A 3CMAA 2YUOA 1ZSZA 1I4K1 2L3PA 3EAEA 3OYFA 3CMAQ 3JSCA 1O75A 1NE8A 1WHJA 2JW4A 1EQRA 4C8QG 3OYJA 3GNFB 2K4YA 1EFWA 1UFFA 1PD1A 1Q95G 1PC0A 2DZ9A 2CDTA 2CH4A 2GGRA 3JB9D 2EQKA 4D6WA 3E1SA 1VIEA 2YLCA 1PG5B 4KUIA 1TWBA 1BI1A 2GQIA 2LCSA 2XU8A 2RHYA 4XTXA 4PJOB 2PMFA 1BU1A 2LNVA 4M78F 4PJOD 2F1LA 2QI2A 4E7IA 2JTFA 1QVGA 4C92G 1M30A 1IGQA 4E2FB 1VQNA 3CC4A 3UGQA 4G85A 1VQNQ 1NYFA 3BY7A 1M90R 3KUFA 1WJSA 3VS6A 2FVUA 2HDAA 4M75B 4OVAA 5I22A 1YN8A 4M75D 3S3OA 3QO8A 2COWA 4MDWA 1WQWA 2VUBA 3DLLA 4AG2C 5GANe 3OYYA 3QJ6A 2QK0A 1N5ZA 1UG1A 4RTUA 4DBQA 4C0ZA 3HRIA 5J26A 5CAIA 4JZ4A 1VQ9T 1SERA 5CKFA 1UE9A 2DL3A 1VQPA 3VS1A 1Y57A 1YCYA 2EPDA 2X9HA 1VQPQ 3OBYA 2E4HA 1D09B 5GAN7 2ZGWA 1WHGA 4MMKA 3HFOA 3WXMB 3ZEHA 4ZTJA 4P5NA 3QO3A 3CD6A 2QHUA 2DD4A 1QVFP 2LT1A 3VS5A 4G84A 3HFVA 3CD6Q 1T3SA 3UWNA 2E5KA 2PTKA 3A8HB 3J7AF 3OYLA 1WJQA 1IXDA 3MPUB 4ZGDB 3OD1A 2LMJA 3JCMP 3V7SA 2J3LA 1OQKA 1Y7XA 1WXUA 3OYBA 4YRPA 1N8RU 4JJNK 2V8JA 4PK4A 4YPFA 3HRTA 3OY9A 5IXFA 4HT9A 1NJIR 1OULA 1J5WA 2C0OA 2DK3A 3KBGA 4E7SA 2FRWA 2QA4T 3VRZA 2DDZA 3ICAA 4BW9A 2I4OA 1PD0A 4OGCA 3BW1A 1I5OB 5ELNA 2O2OA 2XG8D 3RIRA 4ZGJB 4QVDA 3I56Q 3IQLA 3EFOA 1G5IA 3QYGB 2CT4A 4M78E 2CSQA 5LL6S 3TUPA 3HRKA 2D9TA 2FHDA 3TEGA 1WI7A 1HTTA 3VQVA 2DU5A 1WQ7A 2PUKB 3NELA 4F7UF 1KQ2A 4PFPA 1JRIA 1RAHB 1WHHA 2AZSA 1Q7YC 3NTHA 1PRMC 5A0DA 4EX5A 1RUWA 1TG0A 4NS5A 5LJ3h 3CCEA 4IIOA 3G71T 3OYMA 3H9NA 2MYSA 3CCEQ 2RD1A 1PSEA 4BI8B 1KHIA 2V1QA 4QKUA 1LPLA 2NUTB 4M7DC 1ZBJA 1UGRB 2JXBA 3A5ZA 3H0HA 2OAWA 3SWNA 3EG2A 4P71C 4BI3A 2E41A 3NENA 1NLPC 5D6YA 2DYBA 3VBBA 2AHJB 2C8MA 2FPFA 1OYXA 1ZA1B 1D0XA 1YIJT 3FLGA 4IIMA 1Y96A 3H0FA 1I81A 2LQWA 2EYQA 2QGFB 3GPLA 4ZTZB 4C5IA 1H3HA 3CCLA 2JM9A 2GBQA 2KRSA 4LN2A 3CCLQ 3PVLA 1WXTA 4KBMB 1G3YA 4ZIBA 4DBFA 4K87A 5CR2A 1ARKA 2QDYB 4ELZC 2XDBA 12ASA 4C0GA 2LX7A 2MAMA 4A4EA 4A4FA 2E70A 3LC0A 4BY6B 4KR3A 4MZMA 2G4CA 2CKKA 3QPHA 2JT4A 3OYDA 1Q81C 3I9QA 2Q7GA 4PJOA 4C0FA 4QW2A 3LW5E 3QIIA 4X1VA 1EX4A
chains in the Genus database with same CATH topology
1ASYA 4KUDK 3CXCS 2I2LA 2EJ9A 5DY9A 2HD0A 3JAME 1G3WA 2JOYA 3SDZA 2A8EA 4M75A 1SETA 4BB7A 2BKDN 3FRNA 5A0GA 3INZA 5E3IA 1U1TA 3ERRA 1QVFA 3UT1A 4F7UE 3RMQA 3JCMX 2F69A 4KQEA 3CCST 4JUVA 4BD3A 4H2WA 3REUA 4BE1A 3JCMQ 1SRYA 4ZTFA 3BJUA 5KNNA 2K3XA 4YRCA 4ZGEB 3UPUA 4X34A 2DQ3A 3E9IA 3LH0A 2ZIMA 3HRUA 1TH7A 4HWRA 1BIBA 2DAQA 3TCJA 3PGGA 4M7AG 5GAMd 3CCVT 4XU0A 1YFRA 2OTLA 2DXUA 1YITA 3E9FA 2QHSA 2M9UA 3CMAT 3OYCA 3HXYA 1VQ8A 5GMKe 1Q86U 1MGQA 3P8TA 3CCQA 1KG1A 4B9WA 1AHJB 2Q5IA 2ARSA 3VUBA 4JRQA 1W66A 1B7YB 2DQ0A 4M77B 4M77D 1NPPA 4OB1B 2D0QB 5CO7A 2BIVA 1VQNT 4IUVA 4M77F 3X26B 4IUPA 3JCMe 3QO5A 1ZHIA 4E7HA 5KE3A 1W4SA 1E1TA 1NJIU 3M5AA 4EPCA 3CXCA 1WLEA 2HNIA 1FXXA 5FU6B 1E24A 2LTOA 4FU6A 4J5YA 3VUZA 4Y91A 1VQKA 4AH6A 2MMPA 3JCMV 5GAMj 3FB9A 4M7AA 3L4GB 5GANj 4MZTA 5LJ3f 2VC8A 1R8OB 4YRQA 4BDYA 1VQPT 1KD1C 5HK3A 4XU3A 2RHXA 1VQ4A 3CD6T 4XTUA 2KSSA 2RHZA 3T9NA 3SWNC 2WSEE 5CKDA 5GAMg 2HBPA 5IN1A 2Y4YA 3P8HA 4ZN1A 2QTXA 1YB3A 2XD0A 3MEVA 3FEOA 3RKWA 1KC8U 4IUUA 4LD6A 2K5IA 4WJ4A 3GF5A 3I56T 4RMOA 3DB4A 4L6V5 2M16A 2MWOA 2DTIA 1NPRA 1H4SA 4II1A 4LDUA 3HSBA 4M7DE 1QW1A 2RK1A 4PJOC 2AMCB 4DQ2A 4JRPA 3CMQA 3CPFA 5GMKm 3LGLA 2P5IA 3CCET 4YREA 4CI0C 2PMEA 4CH6A 4M75C 3TEHB 2LC4A 4J83A 4FT2A 1BYMA 3L2VA 3OMGA 1JJCB 3MQZA 1RI0A 2LCCA 3MEUA 3M54A 3PZCA 5CKBA 2WACA 2GFUA 1VQOA 3JB9I 1K73U 2CZ0B 3CC2A 4HCCA 4C5EA 3CCLT 1G5VA 2F5KA 2LQKA 4JS4A 3QBYA 4RKUE 2R5AA 3UDCA 2P0LA 4C8QF 3MO8A 4X9CA 2RB6A 2RI2A 5GAN6 2NS6A 2X4YA 5CKHA 3LX7A 1B7YA 3HL8A 4K86A 3NTKA 4NOYA 2QQ9A 5I2SA 5A0LA 4N4GA 4C92F 2XIDA 4A54A 3C95A 3CCJA 4RQEA 1N6AA 2QEXT 4RCCA 4PLLA 2X4XA 2E5AA 2P4TA 2X4WA 4EO4A 3V7CA 3BFMA 3A5YA 1ASZA 2R58A 2ZT8A 5GAMh 1B34B 3L4GA 2KK4A 4C5HA 2RJEA 3OSSC 2XTIA 5CVIA 2HQXA 4IURA 1G51A 1HC7A 3IALA 2YHTA 1ZBXA 4M78B 2P0KA 4FM4B 2ZNIA 4M78D 2VGMA 1X55A 1LOJA 2P0PA 5LJ5d 3CBMA 3CCRA 2RHIA 1YJ9A 2OTLT 3BDUA 5GAOn 1YITT 4M7AC 1YBYA 1WYDA 4CS3A 4O2DA 3MP6A 1XNIA 4C8QE 3GOXA 3QSUA 2A3LA 2ARUA 5DLOA 2RJDA 5DLQE 1VQ8T 1M90C 2F5TX 1NZ9A 1QP2A 4MDXA 4O6JA 3WVDB 2KY9A 4BY6C 3CCQT 4RDXA 5GMKj 2RHQB 2PU9B 2CJAA 2IG0A 3OSVA 3A8GB 5CIUA 5GAN4 4C92E 2L8DA 4QVCA 5D6XA 2AMCA 5GAN5 2VV5A 1Q82U 5FRNA 5ELOA 4ATOA 2LRQA 3PCOB 2GFAA 1K8AU 2K57A 5IT9E 4MZPA 2DXBA 3TEHA 3X25B 2X35A 4K88A 2MWPA 4YRSA 4X5OA 3A74A 1JJCA 4P72A 1OZ2A 5J39A 1VQKT 5FU7B 5LJ5j 2XICA 5GAOl 3PFSA 1QVFS 3QJYA 5DM7R 5GMKl 4LVKA 2I4NA 4YRTA 3JB9G 1NJIC 2E3CA 2DEQA 2EQUA 1N9SA 4F7UB 2X4JA 4J6YA 3QXEB 2DPPB 3ZBDA 4PJOG 2J3MA 3I55A 5LJ5g 2XDPA 4KR2A 1U1SA 4YRKA 5L8RE 2EQMA 2ZPGB 1BBUA 2DKGA 4M75G 3ME9A 3CBPA 1BBWA 1YJWA 4YP0A 3OMCA 4X9DA 2JUFA 3A7UA 2CZ1B 3URGA 4HT4A 2DXTA 1N9WA 5C52B 1MHNA 2K3YA 3RKYA 1NYRA 4H2UA 2LT4A 1B34A 3PMIA 3GP8A 3DSQA 2L3RA 4XK8E 3M56A 3I7FA 4UP7A 4KULA 4LVJA 1X2HA 2RJCA 4M78A 2CS7A 5GAOr 1WJRA 1N27A 1DJ7B 2DIQA 3NTIA 3M53A 4P74A 3C94A 1WU7A 5FU6C 5GAMf 5EG2A 5CKEA 3FDRA 4CS2A 3OS5A 4XEMA 4E7JA 2XHCA 4OF1A 4TVAB 3CC2T 1SESA 4HCZA 4F7UG 5C51B 5LJ3e 2HQEA 3LWIA 3HXVA 4RG2A 2EL9A 4HWPA 4TVWA 4P3OA 2ARTA 5GMKh 2RHQA 4CRIA 3JRZA 2Q5HA 4P75A 4FL6A 2K5FA 3QG1A 4QQDA 3OYEA 1M8VA 1FX7A 3QTCA 4WI1A 3PCOA 5HK0A 1IZ6A 4YDQA 3QHSA 1EVLA 2ZXFA 2E10A 3CCJT 2ZT6A 4ME7A 3M59A 2OTJA 1WGSA 3OB9A 4OB0B 4UPAA 3JB9H 2PUOB 5FROA 1KOGA 5GANd 2CGHA 4WF2A 2DXCA 3LLRA 5FRMA 2PVOB 5LJ5h 2LQ8A 3HXWA 1GGMA 1B70B 4VUBA 3LGFA 3G4SA 2OAUA 3PT9A 3MHXA 5CQXA 3EFSA 2RI3A 2FB7A 2L89A 2ZIOA 3X28B 3KXTA 4F7UA 2L5QA 3ASKA 1JJ2S 1NYQA 3WVEB 4CH5A 4M7AE 2GCXA 3FJPA 4M7DD 1YFSA 4P72C 3CCRT 1YJ9T 2E5QA 5GMKi 1VQMA 3UH0A 4M7DF 4XTZA 3CC4T 1K9MU 3M4YA 1H4TA 1UGPB 2E6NA 5GAN8 2ZZEA 2Y90A 3S3NA 5M9OA 2R5MA 4Z02A 3QYHB 2EAYA 2ODRD 2DIGA 3Q1JA 4LDWA 3LYIA 3SFMA 4TTVA 4BUGA 3MEYA 2ZCEA 4QVZA 1W2BS 5HGQA 3A8LB 3OA6A 2CJBA 3P8BB 1BI0A 2RA2A 2FL7A 3IKMB 2XKOC 1Q7YU 2QA4A 1VQLA 5GANg 3VQXA 4HVCA 1QE0A 3LSQA 2I4MA 3E19A 3A32A 5K1PA 2JN0A 5F5WA 3A8MB 1U8RA 4TQDA 4TVRA 2ZPFB 1K8AC 4TVAA 3V8LA 1ADYA 1M4ZA 4YRIA 4EMHA 3MCAB 1XQHA 2QQSA 1X54A 1RL2A 1NNHA 4P3PA 4CH4A 1BI3A 4M77G 2IVWA 1WNLA 4M78C 3VJPA 3G71A 4H2VA 1N8RC 4P74C 4NL2A 3LWHA 1L0WA 3JCMb 4IKFA 2FYKA 4L5GA 3META 4BE2A 3M55A 1JJ2A 4RMFA 3L2WA 4YRFA 2VGNA 3HPWA 2V8KA 3MEWA 4HKEA 1PYSB 4DA4A 1Q81U 4HA8A 4XAXB 1YJWT 2VYTA 4YRLA 1SSFA 4PKCC 5KCHA 4J8OA 4YCVA 5K1XA 2Q7HA 3CCMA 3J81E 2RO0A 2KVQG 1B70A 4Q6GA 4P75C 2P0QA 4C8QB 1USYA 3HXZA 4RG8A 4C8QD 3HY1A 4E47A 3E9GA 2DO3A 1YI2A 1LNXA 1B8AA 1KHCA 1Z7NA 2CZ7B 3G7ZA 4DOVA 2RH2A 2PVDB 2GF7A 2C7IA 4C92B 1H3ZA 4M77A 3EFRA 1D3BB 4C92D 5LJ5f 3QZ5B 1W2BA 2XI9A 2K2VA 2DVEA 2RHUA 5I2MA 4JS5A 1QF6A 2RM4A 3NFCA 4TVYA 5CCAA 5FU7C 3V8KA 3CBOA 4TWAA 3REXA 4LVMA 2JTMA 2Y4XA 2PVGB 3CC7A 1G5HA 4BACA 4DPGA 4A4KA 5LJ3j 1QVPA 3X24B 3LSSA 3S3MA 2ALYB 4LDYA 2RK2A 5GANh 2VXFA 3VQWA 3S6WA 2WSCE 3VU3C 3QKJA 2XGTA 2ZPIB 1WPYA 3RL6A 4E51A 4L59A 3G6EA 1X75C 2EQJA 3JCMd 2CZ6B 3RERA 2OTJT 1ZQ1A 4TQFA 2H3JA 4Y28E 2ZINA 2E6ZA 1EOVA 2KDSA 2M1HA 4EDUA 1KMNA 3R6OA 2BUDA 3CCUA 3CEYA 4YRRA 2QXFA 3J80E 1M5Q1 1O9SA 3G4ST 4PLIA 4LD9K 4B9XA 4C0DB 2I4LA 3JB9F 2DU7A 4UP8A 4L87A 3VQYA 4E7KA 3F70A 4IUQA 1Y71A 4PJOF 3JB9J 5KE2A 3E9HA 4PL6A 4HWOA 3GNGA 4J7IA 1KD1U 3G1ZA 1XTDA 1UB4A 3TREA 5GAMe 2JNGA 3HY0A 1VQMT 1Q86C 2VXEA 1RIQA 2KMTA 3CMEA 1PYSA 4M75F 2AKWB 1X2GA 1M1KU 2ZR2A 4A4HA 3MF2A 2V8IA 4O5VA 4J6XA 3M4GA 4J6WA 4FSXA 4DOWA 1YGBA 2O4XB 3M58A 4C8QA 1I8FA 4R56A 1K9MC 5I21A 1VQ7A 5GAOq 1H4VB 5GAOp 4FT4A 4M78G 3C4SA 3JCMJ 4EMKB 1ADJA 3JCMg 1VQ4T 3MEAA 1IREB 5KH6A 4P73A 4KT0E 2E12A 1YHQA 1EIFA 1ATIA 4V2SA 3VYGA 2CIMA 3JCMW 4C92A 2KQWA 2LX9A 2EWNA 2ZPBB 3HFZB 4HWSA 1D3BA 4HWTA 1VQLT 1M1FA 1N9RA 2O01E 1KQSS 3A31A 4JLIA 3L42A 1YFTA 1VQ5A 3TU4K 3I56A 3QO7A 4PHCA 1G3TA 1NJ8A 3ZFJA 4YCUA 2QHTA 1USYC 2ZNJA 3OYHA 3M57A 4JLGA 2YLBA 4PJOE 4JRIA 1B76A 5CQYA 4P3NA 5AYFA 3RESA 3HKSA 4UC4A 3VKIA 2ALYA 4Q15A 4YRGA 3OQ5A 2LCLA 4M77C 1VQ6A 3QNEA 3L2RA 3OBWA 3FIFA 1KC8C 3M9QA 4M75E 2ZZGA 3WQZA 1KQ1A 4N4IA 2XK0A 5D6WA 1E1OA 1YJNA 3RGLA 4PG3A 4GLKA 2DTHA 4M7AB 4CS4A 4M7AD 1M9SA 4FIBA 3OYNA 3C12A 3OW2S 5GANf 3GLXA 4NCXA 4CH3A 2ODRC 3A7RA 4M7AF 1FWZA 3CCMT 1VUBA 4OGEA 1VQOT 2ZR3A 4H2XB 3P8YA 1S72A 4ZTUB 2QHVA 2MF2A 2GQVA 3NETA 3P8DA 4MMLA 3ER0A 1VQZA 1YI2T 4E7LA 4N4HA 4A53A 2EKOA 3PIOA 3OYAA 4J15A 4XU1A 1K73C 2QEXA 1NJ6A 4YROA 2RJFA 3DB3A 3HP9A 2E64A 4PNOA 1VIFA 3OYIA 3PMTA 2AKWA 3X20B 1KQSA 2DZCA 1M1GA 3UFGA 1BI2A 4A4GA 3CC7T 3R07A 1H4QA 2RHSB 3GIBA 4JDSA 3JCMh 4H2SA 3V8JA 1EIYB 3IG2A 3CPWS 4BWAA 1Y07A 4YTLA 2O4XA 2A7YA 2ZT5A 5C53B 1M90U 3SB2A 4H2YA 3MF1A 2NLUA 3L2ZA 2ZTGA 5KCOA 5IAYA 2LDMA 4Q5WA 4RCBA 2ZZFA 4EMKA 1G3SA 1V29B 4N0AA 3VV0A 2JVVA 3NEMA 3G6ET 2B8AA 4JRKA 3HHTB 2ZCFB 4XTYA 4M7DB 3HFZA 4LNSA 5GAN2 4XTWA 5HY6A 2DD5A 2ZT7A 3QZ9B 2EJFA 5C6SA 2IY5B 1UGSB 3CCUT 1BKBA 2QQAA 4C8QC 2CJ9A 3OW2A 2QQBA 2EIFA 3FC3A 3IKLA 3BDLA 1VQ9A 1UEBA 2DJZA 3L2UA 1XOVA 4NL3A 3L1AA 4OLFA 4P73C 2MI6A 2XDDA 3RF1A 11ASA 3OYKA 1GXIE 1C0AA 4XTVA 2EFIA 4C92C 2D6FA 2E65A 3DLMA 4QQGA 3TEEA 2ZPEB 5LJ5e 4RQFA 4OMFB 3DKMA 3CMET 2DTOA 1LYLA 3HTZA 3H8ZA 3AHUA 4R55A 4XEOA 1OZ3A 3OS2A 1X6OA 2M0OA 4YRJA 1Q82C 4XU2A 2PQWA 2ZPHB 5GAN3 4H2XA 4H02A 2ZZDA 1VQ7T 3PNWC 1X01A 3M4QA 1M1KC 3RACA 1HK9A 4BI4A 1IL2A 1NJ5A 3M4PA 4WJ3M 3CPWA 4M7DG 3KFUA 5CK9A 3SD4A 5FLXE 1YHQT 4EMGA 3PTAA 4HT8A 4OB3B 3L2QA 3I55T 4GY5A 4LVIA 1PSFA 4UP9A 3O8VA 3H6ZA 1VQ5T 4ZN3A 1E22A 3OS0A 1P92A 1YIJA 2EJGA 3N5BB 1EVKA 5LJ3d 2RI5A 2RHSA 4M77E 3MP8A 4HCBA 4C0DC 5GAOm 3UGTA 1JB0E 3HRSA 4QQ6A 2Q7EA 5J3BA 1EIYA 2R57A 2CYZB 1QVGS 1VQ6T 4XQ3A 2QQRA 3RUXA 1FYFA 4OB2B 3QUIA 4H2TA 4BDZA 1LJOA 3HFNA 1YJNT 1KMMA 1X56A 2C06A 3A7AA 2YRVA 3JCMf 4YCWA 1HXDA 4LDVA 4M7DA 4LVLA 4P71A 1BIAA 4LDXA 4YRMA 3OYGA 1I5LA 3W3SA 4BE0A 2IY5A 2K5LA 1S72T 2HAXA 3HXXA 5A2QE 1QP3A 4OP0A 1NJ2A 3HXUA 4C5GA 4YYEA 3JCMc 5C0MA 3CCSA 4IUTA 4EMKC 4N0AC 1JBMA 2KAFA 2JZ2A 1NJ1A 3A5ZB 2G3RA 2WSFE 3RKXA 3SWNB 1Z7MA 3PIPA 4J7FA 3OS1A 3CCVA 3RMSA 2E1HA 3P8VA 3V7RA 1OI1A 5HKCA 3QDRB 1Y96B 3A8OB 3MP1A 5LJ3g 2LVMA 3VYHB 4ELYC 1H641 1UGQB 4YRNA 3CMAA 1I4K1 3EAEA 3OYFA 3JSCA 1O75A 1NE8A 1EQRA 4C8QG 3OYJA 3GNFB 2K4YA 1EFWA 2DZ9A 3JB9D 2EQKA 4D6WA 3E1SA 1VIEA 2YLCA 4KUIA 1BI1A 2XU8A 2RHYA 4XTXA 4PJOB 2PMFA 2LNVA 4PJOD 4M78F 2QI2A 4E7IA 2JTFA 1QVGA 4C92G 1VQNA 3CC4A 3UGQA 4G85A 3BY7A 3KUFA 1WJSA 2FVUA 4M75B 4OVAA 4M75D 3S3OA 3QO8A 4MDWA 2VUBA 1WQWA 3DLLA 5GANe 3OYYA 3QJ6A 3HRIA 4C0ZA 5J26A 5CAIA 1VQ9T 1SERA 5CKFA 1VQPA 1YCYA 3OBYA 5GAN7 2ZGWA 4MMKA 3HFOA 3WXMB 3ZEHA 4ZTJA 4P5NA 3QO3A 3CD6A 2QHUA 2DD4A 2LT1A 4G84A 3HFVA 3UWNA 3A8HB 3J7AF 3OYLA 1WJQA 4ZGDB 3OD1A 3JCMP 3V7SA 2J3LA 1Y7XA 3OYBA 4YRPA 1N8RU 4JJNK 2V8JA 4YPFA 3HRTA 3OY9A 4HT9A 1J5WA 2DK3A 3KBGA 2QA4T 2DDZA 3ICAA 4BW9A 2I4OA 4OGCA 3BW1A 5ELNA 2XG8D 3RIRA 4ZGJB 4QVDA 1G5IA 3QYGB 4M78E 5LL6S 3TUPA 3HRKA 2D9TA 2FHDA 3TEGA 3VQVA 1HTTA 2DU5A 1WQ7A 2PUKB 3NELA 4F7UF 1KQ2A 1JRIA 1Q7YC 3NTHA 5A0DA 4EX5A 4NS5A 5LJ3h 3CCEA 3G71T 3OYMA 2RD1A 1PSEA 4BI8B 1KHIA 4M7DC 1UGRB 3A5ZA 3SWNA 4P71C 4BI3A 2E41A 3NENA 5D6YA 3VBBA 2AHJB 2C8MA 1OYXA 1YIJT 3FLGA 1Y96A 1I81A 2EYQA 3GPLA 4ZTZB 4C5IA 3CCLA 4KBMB 1G3YA 4ZIBA 4K87A 5CR2A 2QDYB 4ELZC 2XDBA 12ASA 4C0GA 2MAMA 4A4EA 4A4FA 2E70A 3LC0A 4BY6B 4KR3A 4MZMA 2G4CA 2CKKA 3QPHA 3OYDA 1Q81C 2Q7GA 4PJOA 4C0FA 4QW2A 3LW5E 3QIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K57 A;  2C7I A;  1ASY A;  4C92 B;  4M77 A;  3EFR A;  5LJ5 e;  2I2L A;  1D3B B;  2EJ9 A;  4C92 D;  5LJ5 f;  5DY9 A;  3TEH A;  4RQF A;  2DVE A;  4K88 A;  1QF6 A;  4YRS A;  2RM4 A;  4TVY A;  2DTO A;  4X5O A;  4M75 A;  1SET A;  3A74 A;  1JJC A;  1LYL A;  4P72 A;  3V8K A;  3HTZ A;  3AHU A;  4XEO A;  3INZ A;  4TWA A;  3REX A;  5LJ5 j;  5E3I A;  1U1T A;  3ERR A;  5GAO l;  4F7U E;  4YRJ A;  5GMK l;  1G5H A;  4XU2 A;  4DPG A;  3JCM X;  2I4N A;  5GAN 3;  4H2X A;  4KQE A;  4YRT A;  3JB9 G;  5LJ3 j;  2E3C A;  2DEQ A;  4H02 A;  1N9S A;  4JUV A;  4H2W A;  3LSS A;  3REU A;  2ALY B;  3JCM Q;  4F7U B;  1SRY A;  1X01 A;  3M4Q A;  3BJU A;  3RAC A;  5KNN A;  1HK9 A;  5GAN h;  1IL2 A;  4J6Y A;  1NJ5 A;  2VXF A;  4YRC A;  4PJO G;  3M4P A;  3VQW A;  4WJ3 M;  2J3M A;  4M7D G;  5LJ5 g;  3VU3 C;  2XGT A;  4KR2 A;  3KFU A;  2DQ3 A;  1U1S A;  1WPY A;  3E9I A;  3RL6 A;  4EMG A;  4HT8 A;  2ZIM A;  4YRK A;  1TH7 A;  4E51 A;  4HWR A;  1BBU A;  1BIB A;  2DKG A;  3PGG A;  3JCM d;  4M7A G;  4M75 G;  5GAM d;  4UP9 A;  3RER A;  4TQF A;  4XU0 A;  1YFR A;  2DXU A;  1BBW A;  1E22 A;  2ZIN A;  4YP0 A;  2QHS A;  4X9D A;  1EOV A;  2EJG A;  3A7U A;  1KMN A;  2DXT A;  1N9W A;  5C52 B;  4YRR A;  3HXY A;  1EVK A;  3RKY A;  5GMK e;  5LJ3 d;  4M77 E;  2RHS A;  1M5Q 1;  1MGQ A;  5GAO m;  1NYR A;  4H2U A;  3UGT A;  3P8T A;  1B34 A;  2I4L A;  2Q7E A;  1EIY A;  2Q5I A;  3JB9 F;  2ARS A;  1W66 A;  1B7Y B;  2DQ0 A;  4M77 B;  3DSQ A;  2DU7 A;  4UP8 A;  4L87 A;  4M77 D;  4XQ3 A;  3VQY A;  3I7F A;  3RUX A;  1FYF A;  4UP7 A;  3QUI A;  1X2H A;  4H2T A;  4M78 A;  4PJO F;  3JB9 J;  3E9H A;  1LJO A;  3HFN A;  5GAO r;  4HWO A;  4M77 F;  1KMM A;  1X56 A;  3G1Z A;  3JCM e;  3QO5 A;  3A7A A;  5GAM e;  4P74 A;  3JCM f;  1WU7 A;  5GAM f;  3HY0 A;  1E1T A;  4YCW A;  2VXE A;  1RIQ A;  1HXD A;  1WLE A;  4M7D A;  4CS2 A;  1PYS A;  4M75 F;  2AKW B;  2HNI A;  1X2G A;  4P71 A;  4XEM A;  1BIA A;  1E24 A;  4TVA B;  1SES A;  4YRM A;  2ZR2 A;  4J5Y A;  4Y91 A;  4AH6 A;  3MF2 A;  1I5L A;  3JCM V;  4F7U G;  5GAM j;  3FB9 A;  4M7A A;  5LJ3 e;  5C51 B;  3L4G B;  5GAN j;  2IY5 A;  4J6X A;  5LJ3 f;  3HXX A;  3M4G A;  4J6W A;  2VC8 A;  4YRQ A;  4OP0 A;  1NJ2 A;  3HXU A;  3HXV A;  2EL9 A;  3JCM c;  4HWP A;  4TVW A;  4YYE A;  1YGB A;  4C8Q A;  1I8F A;  4P3O A;  2ART A;  5I21 A;  5GMK h;  2RHQ A;  5GAO q;  1H4V B;  4XU3 A;  4EMK C;  4XTU A;  5GAO p;  2Q5H A;  4P75 A;  4N0A C;  4M78 G;  3SWN C;  1JBM A;  3JCM J;  4EMK B;  1ADJ A;  3JCM g;  5GAM g;  1M8V A;  4P73 A;  3QTC A;  4WI1 A;  1NJ1 A;  4V2S A;  3PCO A;  3RKX A;  3SWN B;  1ATI A;  4YDQ A;  1Z7M A;  3QHS A;  1EVL A;  2QTX A;  2CIM A;  1YB3 A;  3JCM W;  2ZXF A;  2E10 A;  4C92 A;  3HFZ B;  2EWN A;  4HWS A;  1D3B A;  4HWT A;  1N9R A;  3A31 A;  2ZT6 A;  4JLI A;  1YFT A;  2E1H A;  3P8V A;  3V7R A;  3RKW A;  3QO7 A;  4PHC A;  4UPA A;  1Y96 B;  3JB9 H;  5LJ3 g;  1KOG A;  1NJ8 A;  4YCU A;  2QHT A;  1H64 1;  5GAN d;  2CGH A;  4YRN A;  4WF2 A;  4WJ4 A;  1USY C;  1I4K 1;  5LJ5 h;  3HXW A;  1GGM A;  1B70 B;  2DTI A;  2ZNJ A;  1EQR A;  1H4S A;  4C8Q G;  2YLB A;  4PJO E;  4JRI A;  1EFW A;  3HSB A;  4M7D E;  3EFS A;  2DZ9 A;  3JB9 D;  1B76 A;  4PJO C;  2FB7 A;  2AMC B;  2ZIO A;  4DQ2 A;  4P3N A;  3RES A;  2ALY A;  4Q15 A;  3CMQ A;  2YLC A;  4F7U A;  5GMK m;  4YRG A;  4M77 C;  3QNE A;  2P5I A;  1NYQ A;  4PJO B;  4XTX A;  4CH5 A;  2PMF A;  4YRE A;  3FIF A;  4M78 F;  4M7A E;  4M75 E;  4PJO D;  2ZZG A;  2PME A;  4CH6 A;  3FJP A;  3WQZ A;  1KQ1 A;  4C92 G;  4M7D D;  1E1O A;  1YFS A;  4M75 C;  3TEH B;  3UGQ A;  3RGL A;  4G85 A;  4PG3 A;  4P72 C;  3BY7 A;  5GMK i;  2DTH A;  4M7A B;  4M75 B;  4CS4 A;  1JJC B;  3UH0 A;  4M7D F;  4M7A D;  4M75 D;  4XTZ A;  3QO8 A;  3W3S A;  3PZC A;  1WQW A;  5GAN e;  5GAN f;  3JB9 I;  4NCX A;  4CH3 A;  1H4T A;  2ODR C;  3A7R A;  4M7A F;  3HRI A;  5GAN 8;  2ZZE A;  2ZR3 A;  5CAI A;  4H2X B;  3P8Y A;  4ZTU B;  2Y90 A;  1SER A;  2QHV A;  2EAY A;  2ODR D;  3NET A;  2P0L A;  1YCY A;  4C8Q F;  4X9C A;  2RB6 A;  4MML A;  5GAN 7;  2ZGW A;  4MMK A;  3HFO A;  5GAN 6;  4TTV A;  1VQZ A;  3QO3 A;  2QHU A;  1B7Y A;  4G84 A;  3HFV A;  3MEY A;  2ZCE A;  4K86 A;  4NOY A;  4A53 A;  5HGQ A;  3OD1 A;  4J15 A;  4XU1 A;  2CJB A;  3JCM P;  3V7S A;  2J3L A;  4C92 F;  4A54 A;  1NJ6 A;  4YRP A;  2RA2 A;  4YRO A;  4YPF A;  4RQE A;  3IKM B;  3VQX A;  5GAN g;  4HVC A;  2E64 A;  4PNO A;  1QE0 A;  4HT9 A;  2I4M A;  3LSQ A;  1J5W A;  3A32 A;  4RCC A;  2AKW A;  5K1P A;  2JN0 A;  2E5A A;  5F5W A;  2DZC A;  2DDZ A;  3ICA A;  3UFG A;  4BW9 A;  4TQD A;  2I4O A;  3R07 A;  4TVA A;  1H4Q A;  4EO4 A;  2RHS B;  3V7C A;  3BFM A;  3V8L A;  3BW1 A;  1ADY A;  3GIB A;  3A5Y A;  4EMH A;  4YRI A;  1ASZ A;  2ZT8 A;  5ELN A;  3RIR A;  3JCM h;  4QVD A;  4H2S A;  5GAM h;  1B34 B;  3L4G A;  1G5I A;  1X54 A;  2XTI A;  4M78 E;  3V8J A;  1EIY B;  1NNH A;  4P3P A;  3TUP A;  3HRK A;  1G51 A;  3TEG A;  4CH4 A;  3IG2 A;  4BWA A;  4M77 G;  4M78 C;  1WNL A;  3VQV A;  1HTT A;  1HC7 A;  3IAL A;  2DU5 A;  1WQ7 A;  2YHT A;  4H2V A;  3NEL A;  4F7U F;  1KQ2 A;  2ZT5 A;  1JRI A;  5C53 B;  3SB2 A;  4H2Y A;  4M78 B;  3MF1 A;  3L2Z A;  2ZTG A;  4EX5 A;  2ZNI A;  4P74 C;  4M78 D;  5LJ3 h;  4NL2 A;  1L0W A;  2FYK A;  2RD1 A;  4RCB A;  3JCM b;  2ZZF A;  4EMK A;  1X55 A;  4M7D C;  1LOJ A;  4N0A A;  4RMF A;  3NEM A;  3A5Z A;  3SWN A;  4JRK A;  5LJ5 d;  4P71 C;  2E41 A;  3NEN A;  4YRF A;  4XTY A;  4M7D B;  1PYS B;  3HFZ A;  3VBB A;  4HA8 A;  4LNS A;  5GAN 2;  4XTW A;  3BDU A;  5GAO n;  4M7A C;  2C8M A;  4YRL A;  1WYD A;  4CS3 A;  4O2D A;  2ZT7 A;  1Y96 A;  4C8Q E;  3QSU A;  2EJF A;  1I81 A;  4YCV A;  2IY5 B;  2ARU A;  5K1X A;  4ZTZ B;  2Q7H A;  4C8Q C;  2CJ9 A;  4ZIB A;  1B70 A;  4Q6G A;  4K87 A;  4P75 C;  3IKL A;  4RDX A;  4C8Q B;  1USY A;  3HXZ A;  2DJZ A;  5GMK j;  12AS A;  2RHQ B;  4C8Q D;  2CJA A;  4NL3 A;  3HY1 A;  3L1A A;  3LC0 A;  4OLF A;  4P73 C;  4KR3 A;  5GAN 4;  3RF1 A;  11AS A;  2G4C A;  4C92 E;  4QVC A;  2AMC A;  5GAN 5;  1C0A A;  5ELO A;  1LNX A;  4XTV A;  4C92 C;  1B8A A;  2E65 A;  2Q7G A;  3PCO B;  1Z7N A;  4PJO A; 
#chains in the Genus database with same CATH topology
 1ASY A;  4KUD K;  1OPK A;  3CXC S;  2I2L A;  2EJ9 A;  5DY9 A;  2HD0 A;  2DX1 A;  3JAM E;  1G3W A;  4Z89 A;  2JOY A;  4AMC A;  2DYI A;  1WXB A;  1ZSZ C;  3SDZ A;  2A8E A;  4M75 A;  1TU0 B;  4BB7 A;  1SET A;  4DEY A;  2BKD N;  3FRN A;  1MNE A;  2QYZ A;  5A0G A;  3INZ A;  1RAD B;  1RLP C;  2GTJ A;  3A98 A;  5E3I A;  1U1T A;  2BZ8 A;  4RTV A;  3ERR A;  1QVF A;  3UT1 A;  4F7U E;  2CP3 A;  3RMQ A;  3JCM X;  2F69 A;  3A1P A;  4HVW A;  4KQE A;  2PZ1 A;  2F2V A;  3CCS T;  4JUV A;  1M3B A;  4BD3 A;  4H2W A;  3REU A;  4BE1 A;  3JCM Q;  1SRY A;  1UTI A;  4ZTF A;  4J9F A;  3BJU A;  5KNN A;  4HVV A;  2K3X A;  4YRC A;  2YT6 A;  1PWT A;  4ZGE B;  3UPU A;  4X34 A;  2DQ3 A;  3E9I A;  4Z8A A;  2YDL A;  3LH0 A;  4A63 B;  2ZIM A;  3HRU A;  3TVT A;  1TH7 A;  3VS0 A;  1IHV A;  4HWR A;  1BIB A;  2DAQ A;  3TCJ A;  1QCN A;  3PGG A;  4M7A G;  5GAM d;  3CCV T;  1JJ2 P;  4XU0 A;  1YFR A;  2OTL A;  1GL5 A;  2DL7 A;  2DXU A;  2OTL Q;  1YIT A;  3E9F A;  2QHS A;  1ZLM A;  1YIT Q;  2HBW A;  2M9U A;  3CMA T;  1UGV A;  1ZUU A;  3RDV A;  1YWP A;  3OYC A;  3HXY A;  1VQ8 A;  2KGT A;  5GMK e;  1YWO A;  1Q86 U;  1AOJ A;  1MGQ A;  1VQ8 Q;  1SHF A;  1GCQ A;  1R0C B;  3P8T A;  1WIE A;  3CCQ A;  2A28 A;  1KG1 A;  3CCQ Q;  1PNJ A;  1E6H A;  4B9W A;  1AHJ B;  2Q5I A;  2ARS A;  3VUB A;  4JRQ A;  1W66 A;  1B7Y B;  2DQ0 A;  4M77 B;  4M77 D;  1ZUY A;  4J9E A;  1PRL C;  1NPP A;  1H92 A;  4OB1 B;  4F16 A;  2D0Q B;  5CO7 A;  2KRN A;  2BIV A;  1TOV A;  4KGZ B;  1VQN T;  4IUV A;  4M77 F;  3X26 B;  4IUP A;  2NUT A;  3JCM e;  3QO5 A;  3O5Z A;  1ZHI A;  4E7H A;  5KE3 A;  1W4S A;  1E1T A;  1NJI U;  1NEB A;  2C0I A;  3M5A A;  4EPC A;  5AT1 B;  3CXC A;  1WLE A;  1W2B P;  3U23 A;  2HNI A;  2SRC A;  1FXX A;  5FU6 B;  2DMO A;  1E24 A;  2DLP A;  1X6B A;  1M2V B;  2LTO A;  3G1J A;  4FU6 A;  2KRM A;  4J5Y A;  3VUZ A;  4Y91 A;  4LUD A;  1VQK A;  4AH6 A;  2D1X A;  2MMP A;  3JCM V;  5GAM j;  3C0C A;  3FB9 A;  1VQK Q;  4M7A A;  1QCO A;  5GAN j;  3L4G B;  4MZT A;  5LJ3 f;  2M0Y A;  2VC8 A;  1R8O B;  4YRQ A;  1QKX A;  2KE9 A;  4BDY A;  1VQP T;  3FJ5 A;  1R0B G;  1KD1 C;  1SRM A;  3MJX A;  5HK3 A;  4XU3 A;  2RHX A;  1VQ4 A;  3CD6 T;  4XTU A;  1VQ4 Q;  2KSS A;  2RHZ A;  3T9N A;  3SWN C;  1HYO A;  1BK2 A;  2WSE E;  5CKD A;  5GAM g;  2HBP A;  5IN1 A;  3P8H A;  2Y4Y A;  1NLO C;  2CP7 A;  4ZN1 A;  1K1Z A;  2QTX A;  2I0N A;  1YB3 A;  1K8A R;  1UEC A;  3EG0 A;  2XD0 A;  3REA B;  3MEV A;  3FEO A;  3RKW A;  1KC8 U;  2BZX A;  2CP5 A;  4IUU A;  4LD6 A;  2K5I A;  4WJ4 A;  4CC3 A;  2DL4 A;  3GF5 A;  1N8R R;  3I56 T;  1PHT A;  4RMO A;  3DB4 A;  4L6V 5;  2M16 A;  2MWO A;  2DTI A;  1KIK A;  2K3B A;  2RQU A;  1NPR A;  1H4S A;  4II1 A;  4LDU A;  2HL3 A;  3HSB A;  4M7D E;  2NWM A;  1QW1 A;  2RK1 A;  4PJO C;  2LP5 A;  2AMC B;  4DQ2 A;  4JRP A;  5FW9 A;  3CMQ A;  3CPF A;  5GMK m;  2SEM A;  1VA7 A;  3LGL A;  1TUC A;  2P5I A;  1MV0 B;  1F1B B;  3CCE T;  4JJD A;  1KFZ A;  4YRE A;  2CH4 W;  4CI0 C;  2PME A;  4CH6 A;  2LJ1 A;  1MUZ A;  4OML A;  4M75 C;  3TEH B;  2LC4 A;  4F04 B;  4J83 A;  4KH1 B;  4FT2 A;  1AEY A;  1BYM A;  1C6V X;  3EG1 A;  3L2V A;  3OMG A;  1JJC B;  2LNH B;  3MQZ A;  1RI0 A;  4PJN A;  1SKU B;  2LCC A;  2QGG A;  3MEU A;  3M54 A;  3PZC A;  2DE0 X;  1ZX6 A;  2WAC A;  2GFU A;  5CKB A;  1VQO A;  2EKH A;  3JB9 I;  1VQO Q;  1K73 U;  2CZ0 B;  3CC2 A;  4HCC A;  4C5E A;  3CCL T;  3CC2 Q;  1G5V A;  2F5K A;  2LQK A;  4JS4 A;  3QBY A;  1X27 A;  1PM3 A;  4RKU E;  2R5A A;  3UDC A;  4AFZ C;  2P0L A;  2AT1 B;  3MO8 A;  4C8Q F;  4X9C A;  2RB6 A;  2RI2 A;  1UUE A;  4E7Z A;  5GAN 6;  2NS6 A;  2X4Y A;  5CKH A;  3LX7 A;  1QLY A;  5IXB A;  1I0C A;  1B7Y A;  3M0U A;  3HL8 A;  1X6G A;  1PKS A;  4K86 A;  3NTK A;  4NOY A;  2HKQ B;  4AFQ C;  2QQ9 A;  2ENM A;  5I2S A;  1LVK A;  2ABL A;  5A0L A;  4N4G A;  4C92 F;  2XID A;  4A54 A;  3UAT A;  3C95 A;  3CCJ A;  4RQE A;  1N6A A;  8ATC B;  3CCJ Q;  2QEX T;  1JXO A;  1UJ0 A;  4RCC A;  4PLL A;  3RR6 A;  1GCQ C;  2X4X A;  2E5A A;  2P4T A;  2HMA A;  1C1A A;  5EC7 A;  2EYZ A;  1M2V A;  2X4W A;  4EO4 A;  5KYX B;  3V7C A;  3BFM A;  3A5Y A;  1ASZ A;  2R58 A;  2ZT8 A;  1YNZ A;  5GAM h;  1B34 B;  3L4G A;  2KK4 A;  4GBQ A;  2RJE A;  2JTE A;  1SF9 A;  4C5H A;  3OSS C;  2XTI A;  5CVI A;  3M0Q A;  2HQX A;  4IUR A;  2A08 A;  1G51 A;  4HXJ A;  1HC7 A;  3IAL A;  2YHT A;  1ZBX A;  2DNU A;  4M78 B;  4OMM A;  2P0K A;  4FM4 B;  2ZNI A;  4ANJ A;  4M78 D;  4OMP A;  2VGM A;  1I1J A;  2L0A A;  4LUE A;  1X55 A;  1LOJ A;  1WFW A;  1KJW A;  2P0P A;  1K9A A;  5LJ5 d;  1IGU A;  3CBM A;  3CCR A;  2RHI A;  1YJ9 A;  3CCR Q;  1YJ9 Q;  2RF0 A;  2OTL T;  3BDU A;  2XMF A;  5GAO n;  1YIT T;  1YBY A;  4M7A C;  1WYD A;  1HD3 A;  4CS3 A;  1QWF A;  2COZ A;  3CC4 Q;  4O2D A;  3MP6 A;  1XNI A;  4CC2 A;  1MV3 A;  2D0N A;  4C8Q E;  3GOX A;  3QSU A;  2MPX C;  3ULR B;  3R6N A;  2A3L A;  2ARU A;  5DLO A;  2RJD A;  5DLQ E;  1VQ8 T;  1M90 C;  3EGD A;  2F5T X;  1NZ9 A;  1QP2 A;  4MDX A;  1G83 A;  4JJC A;  4O6J A;  3WVD B;  2KY9 A;  4BY6 C;  3CCQ T;  4RDX A;  1C0M A;  5GMK j;  2RHQ B;  2PU9 B;  2CJA A;  2FZC B;  2IG0 A;  3I35 A;  3OSV A;  3A8G B;  2J7I A;  5CIU A;  5GAN 4;  4C92 E;  2L8D A;  2QAS A;  2JS2 A;  4QVC A;  1NYG A;  5D6X A;  2AMC A;  5GAN 5;  1Q86 R;  2DBK A;  2VV5 A;  1Q82 U;  4FW2 A;  5FRN A;  5ELO A;  4ATO A;  1RAF B;  2LRQ A;  3PCO B;  1B7T A;  4J9H A;  2GFA A;  1K8A U;  2K57 A;  3M0T A;  5IT9 E;  1GBQ A;  3EHQ A;  4MZP A;  2DXB A;  4HCK A;  1K4U S;  2LZ6 B;  4J9B A;  1W6X A;  3TEH A;  3X25 B;  2O9S A;  2DRM A;  3NMZ C;  1D0Y A;  2X35 A;  4K88 A;  2MWP A;  4YRS A;  4X5O A;  1YFN A;  3A74 A;  1JJC A;  4LE9 A;  4P72 A;  1OZ2 A;  5J39 A;  1K9M R;  1VYU A;  1BCM A;  1VQK T;  5FU7 B;  5LJ5 j;  2ESW A;  3UA6 A;  2V26 A;  1W70 A;  2XIC A;  5GJV B;  5GAO l;  3PFS A;  1QVF S;  3QJY A;  5DM7 R;  5GMK l;  1KQS P;  3LH5 A;  2VVK A;  1T3L A;  4LVK A;  2I4N A;  4YRT A;  2E3H A;  3JB9 G;  1NJI C;  2E3C A;  2DEQ A;  2EQU A;  2FRY A;  1N9S A;  2DF6 A;  2RQT A;  4ZNX A;  2HCK A;  4F7U B;  2X4J A;  2M02 A;  2OI3 A;  4J6Y A;  3QXE B;  2DPP B;  3ZBD A;  4PJO G;  2J3M A;  3I55 A;  5LJ5 g;  2XDP A;  4KR2 A;  1U1S A;  2AZV A;  2BZY A;  4YRK A;  5L8R E;  2EQM A;  2ED1 A;  1IHW A;  2ZPG B;  2IIM A;  4RTY A;  1BBU A;  2DKG A;  3EGU A;  4M75 G;  4F17 A;  1IO6 A;  3EH1 A;  3ME9 A;  3CBP A;  4K11 A;  1BBW A;  1V76 A;  1BBZ A;  1YJW A;  4YP0 A;  3OMC A;  4X9D A;  1YJW Q;  2M51 A;  2JUF A;  3A7U A;  2CZ1 B;  1E6G A;  3URG A;  4HT4 A;  2DXT A;  1N9W A;  5C52 B;  1MHN A;  2K3Y A;  1WA7 A;  3RKY A;  4DBR A;  5KYX A;  1NYR A;  4H2U A;  2P84 A;  1KC8 R;  2LT4 A;  1B34 A;  3PMI A;  4PJJ A;  3CQT A;  3OW2 P;  4M4Z A;  3GP8 A;  3DSQ A;  2L3R A;  3VS3 A;  2ED0 A;  2EYX A;  4XK8 E;  3M56 A;  2V1R A;  3I7F A;  2HSE B;  5IH2 A;  4KUL A;  4UP7 A;  3THK A;  4LVJ A;  1X2H A;  2RJC A;  4M78 A;  2X3X D;  2CS7 A;  5GAO r;  1WJR A;  2VKN A;  4RTX A;  1N27 A;  1DJ7 B;  2DVJ A;  2DIQ A;  3NTI A;  3M53 A;  4P74 A;  3C94 A;  1WU7 A;  5FU6 C;  5GAM f;  2EYY A;  5EG2 A;  1D1B A;  5CKE A;  2RPN A;  3FDR A;  4CS2 A;  2LJ0 A;  2D8H A;  3OS5 A;  4XEM A;  4E7J A;  2XHC A;  4OF1 A;  2DET A;  4TVA B;  3CC2 T;  1SES A;  4HCZ A;  2RNA A;  4F7U G;  5C51 B;  5LJ3 e;  2LJ3 A;  4PFZ A;  2HQE A;  5GJW B;  1YCS B;  2FEI A;  3LWI A;  3HXV A;  4RG2 A;  2D8J A;  2EL9 A;  1UHC A;  4HWP A;  2AIR B;  4TVW A;  4P3O A;  1K73 R;  2ART A;  1HJD A;  5GMK h;  2RHQ A;  1LCK A;  4CRI A;  1RAG B;  1AWJ A;  4PJM A;  3JRZ A;  2Q5H A;  4P75 A;  4FL6 A;  2B86 A;  2K5F A;  8AT1 B;  1OU8 A;  2JMA A;  3QG1 A;  4QQD A;  3ZL7 C;  3OYE A;  1M8V A;  1FX7 A;  3QTC A;  4WI1 A;  2J6O A;  3PCO A;  5HK0 A;  1IZ6 A;  4YDQ A;  3QHS A;  3CPW P;  1EVL A;  2H3E B;  3HTR A;  2ZXF A;  2E10 A;  3CCJ T;  2ZT6 A;  4ME7 A;  3M59 A;  2OTJ A;  1AZG B;  1WGS A;  2OTJ Q;  3OB9 A;  4OB0 B;  4UPA A;  3JB9 H;  1TSF A;  2PUO B;  5FRO A;  1KOG A;  5GAN d;  2CGH A;  4WF2 A;  2DXC A;  3LLR A;  5FRM A;  4J9C A;  2PVO B;  5LJ5 h;  2OJ2 A;  2LQ8 A;  3HXW A;  1GGM A;  3H0I A;  4OMQ A;  1B70 B;  3NPF A;  4VUB A;  3LGF A;  3EGX B;  3G4S A;  1ZUK A;  2OAU A;  3PT9 A;  3MHX A;  1IB8 A;  4LXC A;  3G4S Q;  2KXD A;  1UJY A;  5CQX A;  3EFS A;  2RI3 A;  2QG9 B;  2FB7 A;  2L89 A;  2ZIO A;  3X28 B;  3KXT A;  2HKN A;  4F7U A;  2L5Q A;  3ASK A;  1JJ2 S;  1NYQ A;  1R77 A;  3WVE B;  4CH5 A;  4RTZ A;  4M7A E;  2GCX A;  3FJP A;  1JU5 C;  2OX7 A;  4M7D D;  1YFS A;  2LQN A;  4D8K A;  2DA9 A;  4P72 C;  3CCR T;  2FG0 A;  1YJ9 T;  2E5Q A;  2DEU A;  2BE7 D;  5GMK i;  6AT1 B;  1VQM A;  3UH0 A;  4M7D F;  2DIL A;  4XTZ A;  3CC4 T;  1VQM Q;  2G6F X;  1K9M U;  3M4Y A;  2YSQ A;  2GNC A;  3TQ7 P;  2HQH A;  1H4T A;  1UGP B;  2E6N A;  5GAN 8;  2ZZE A;  1T0J A;  4AT1 B;  2Y90 A;  3S3N A;  5M9O A;  2R5M A;  4Z02 A;  3QYH B;  2EAY A;  2ODR D;  2X3W D;  2HZY A;  1FYN A;  2DIG A;  3Q1J A;  3EG3 A;  1WLP B;  4LDW A;  3LYI A;  3SFM A;  4TTV A;  4JZ3 A;  1X2Q A;  1XJW B;  4BUG A;  3MEY A;  2ZCE A;  4QVZ A;  1W2B S;  5HGQ A;  2KBT A;  3M0P A;  4JJB A;  3A8L B;  3OA6 A;  4WCI A;  2CJB A;  2CRE A;  3P8B B;  1BI0 A;  3NHN A;  1FMV A;  1D0Z A;  2RA2 A;  2FL7 A;  3IKM B;  2XKO C;  1Q7Y U;  2QA4 A;  1Q82 R;  5GAN g;  1VQL A;  3VQX A;  4HVC A;  1VQL Q;  2QA4 Q;  2COY A;  1V1C A;  1QE0 A;  3LSQ A;  2I4M A;  3E19 A;  3A32 A;  5K1P A;  5KYW B;  2JN0 A;  2A37 A;  4B6M A;  5F5W A;  3A8M B;  1U8R A;  4TQD A;  4TVR A;  2ZPF B;  1K8A C;  1M1K R;  4TVA A;  3V8L A;  1EFN A;  1ADY A;  1M4Z A;  4YRI A;  3M0S A;  2PNI A;  4EMH A;  3MCA B;  1Z9Z A;  1XQH A;  2QQS A;  4FYW B;  1UHF A;  1X54 A;  1SRL A;  2CSI A;  3BE3 A;  1RL2 A;  1T0H A;  1NNH A;  4P3P A;  3REB B;  1WHL A;  4CH4 A;  1BI3 A;  4M77 G;  2IVW A;  1WNL A;  1KSW A;  4M78 C;  1AWO A;  1PKT A;  3VJP A;  3G71 A;  4H2V A;  1N8R C;  2F2W A;  1E7O A;  3G71 Q;  5L23 A;  1JXM A;  4P74 C;  4NL2 A;  3LWH A;  1L0W A;  4L5G A;  2FYK A;  3JCM b;  4IKF A;  3MET A;  1SSH A;  1IRX A;  4BE2 A;  3M55 A;  1JJ2 A;  4RMF A;  1OOT A;  3AT1 B;  1OU9 A;  2BTT A;  1QVG P;  3L2W A;  4YRF A;  2VGN A;  3HPW A;  2V8K A;  3MEW A;  4HKE A;  1PYS B;  2K9G A;  1M3C A;  4DA4 A;  5ECA A;  1Q81 U;  4HA8 A;  2F2X A;  4XAX B;  5FWC A;  3QWX X;  1YJW T;  2VYT A;  4YRL A;  1SSF A;  2KYM A;  4PKC C;  1MND A;  5KCH A;  4J8O A;  1NG2 A;  4OMO A;  4YCV A;  5K1X A;  2QDL A;  2Q7H A;  1PCX A;  1RAC B;  3CCM A;  3CCM Q;  3J81 E;  2RO0 A;  2KVQ G;  1B70 A;  4Q6G A;  4P75 C;  2KNB B;  2P0Q A;  4C8Q B;  1USY A;  2YRD A;  3HXZ A;  3SEM A;  4RG8 A;  4C8Q D;  3EGX A;  3HY1 A;  4CC4 B;  3E9G A;  4KGV B;  4E47 A;  2CUB A;  2DO3 A;  2J6K A;  1YI2 A;  1AWX A;  2J06 A;  2VWF A;  1YI2 Q;  1LNX A;  1B8A A;  1KHC A;  1Z7N A;  2CZ7 B;  3G7Z A;  4DOV A;  1WHM A;  2RH2 A;  2PVD B;  2GF7 A;  2C7I A;  4C92 B;  1H3Z A;  4M77 A;  3EFR A;  1D3B B;  4C92 D;  5LJ5 f;  1A0N B;  3QZ5 B;  1W2B A;  1U5S A;  2XI9 A;  2K2V A;  3TSW A;  1B3Q A;  2DVE A;  2RHU A;  2O9V A;  5I2M A;  4JS5 A;  1QF6 A;  1GRI A;  2CP0 A;  2RM4 A;  3NFC A;  3VS2 A;  2DFU A;  4TVY A;  2H8H A;  5CCA A;  5FU7 C;  3V8K A;  1NM7 A;  1X69 A;  2C0T A;  2NYS A;  3CBO A;  4TWA A;  4PFO A;  3REX A;  4LVM A;  2JTM A;  4J9D A;  2Y4X A;  2PVG B;  1SG5 A;  3CC7 A;  1G5H A;  3CC7 Q;  5FWB A;  1MMD A;  4BAC A;  4DPG A;  1X2K A;  4A4K A;  2RMO A;  1QVP A;  5LJ3 j;  2O31 A;  3X24 B;  4LNP A;  3LSS A;  3QDF A;  3S3M A;  2ALY B;  4LDY A;  2RK2 A;  2CUD A;  2MIO A;  5GAN h;  2VXF A;  2KR3 A;  2MK5 A;  3VQW A;  4AFU C;  3S6W A;  2WSC E;  3VU3 C;  3QKJ A;  2XGT A;  2ZPI B;  1WPY A;  3RL6 A;  1AD5 A;  4E51 A;  4L59 A;  4OMN A;  3G6E A;  1X75 C;  2EQJ A;  3JCM d;  3G6E Q;  2CZ6 B;  5IHK A;  3RER A;  2OTJ T;  1ZQ1 A;  4TQF A;  2RN8 A;  1AT1 B;  3QWY A;  1MMA A;  2H3J A;  4Y28 E;  2ZIN A;  2E6Z A;  1RAA B;  1EOV A;  2KDS A;  2M1H A;  4EDU A;  1OEB A;  5KYW A;  1MMN A;  1KMN A;  2RQR A;  3R6O A;  2BUD A;  3CCU A;  1VYT A;  3CEY A;  4YRR A;  1QKW A;  2GTO A;  3CCU Q;  2QXF A;  1ABO A;  3I5R A;  3J80 E;  1M5Q 1;  1O9S A;  1W1F A;  3M0R A;  3G4S T;  1BB9 A;  4PLI A;  4LD9 K;  4B9X A;  4C0D B;  2I4L A;  3JB9 F;  4RUG A;  7AT1 B;  2DU7 A;  4UP8 A;  4L87 A;  1K0S A;  2CT3 A;  3VQY A;  4E7K A;  3F70 A;  4IUQ A;  1RAB B;  1Y71 A;  4PJO F;  3JB9 J;  2YUP A;  5KE2 A;  4PL6 A;  3E9H A;  4DBH A;  4HWO A;  3GNG A;  1WYX A;  4J7I A;  1KD1 U;  3D7S B;  3G1Z A;  1XTD A;  1UB4 A;  3TRE A;  5GAM e;  2JNG A;  3HY0 A;  1VQM T;  1Q86 C;  2AKL A;  2VXE A;  1RIQ A;  2KMT A;  3CME A;  1MMG A;  1PYS A;  4M75 F;  2AKW B;  1X2G A;  5KYU B;  3CME Q;  4HVU A;  4KH0 B;  4E6R A;  2HSP A;  1M1K U;  1Z9Q A;  2JS0 A;  2W0Z A;  4Y92 A;  2ZR2 A;  4A4H A;  2DL8 A;  3MF2 A;  2V8I A;  1M8M A;  4O5V A;  3I5S A;  4J6X A;  4Z88 A;  1WX6 A;  3M4G A;  1D1C A;  4J6W A;  4GLM A;  4RTT A;  1GFD A;  4FSX A;  4FW1 A;  4DOW A;  1YGB A;  2ROL A;  3EG9 B;  2O4X B;  3M58 A;  1Y0M A;  4C8Q A;  1I8F A;  4R56 A;  1K9M C;  2RQV A;  5I21 A;  1OV3 A;  1VQ7 A;  5GAO q;  1H4V B;  1VQ7 Q;  1M2O A;  5GAO p;  4FT4 A;  3GBQ A;  4M78 G;  2NUP B;  2DRK A;  3C4S A;  2DL5 A;  2EGA A;  4KRT A;  3JCM J;  1OX8 A;  4EMK B;  1ADJ A;  3JCM g;  1VQ4 T;  2JJ9 A;  3MEA A;  1IRE B;  5KH6 A;  4P73 A;  2DM1 A;  2JM8 A;  4KT0 E;  2E12 A;  1EIF A;  1YHQ A;  2AKK A;  4V2S A;  1ATI A;  3VYG A;  1YHQ Q;  2CIM A;  3JCM W;  2CP2 A;  4C92 A;  2KQW A;  2LX9 A;  2EWN A;  2ZPB B;  2O88 A;  3HFZ B;  4HWS A;  1D3B A;  3I55 Q;  4HWT A;  1RAI B;  1VQL T;  1M1F A;  1N9R A;  2O01 E;  1KQS S;  3A31 A;  4JLI A;  3L42 A;  1YFT A;  1VQ5 A;  3TU4 K;  1U3O A;  3I56 A;  1VQ5 Q;  3QO7 A;  2FZK B;  1G3T A;  4PHC A;  1QQJ A;  1VYV A;  1ZSG A;  1NJ8 A;  3ZFJ A;  4YCU A;  2QHT A;  4R0K A;  5KYN A;  1USY C;  2K7A A;  2EGC A;  2IPO B;  2L3Q A;  1Q7Y R;  4FYX B;  2ZNJ A;  3OYH A;  3M57 A;  4JLG A;  1GFC A;  2YLB A;  4PJO E;  4JRI A;  1WZO A;  1QCF A;  4F14 A;  1B76 A;  3UA7 A;  1B07 A;  4QT7 A;  5CQY A;  4P3N A;  5AYF A;  3RES A;  3HKS A;  4UC4 A;  3VKI A;  2ALY A;  4Q15 A;  4YRG A;  3OQ5 A;  4D8D A;  2LCL A;  4M77 C;  1VQ6 A;  3QNE A;  3L2R A;  3OBW A;  1VQ6 Q;  3FIF A;  1KC8 C;  3M9Q A;  4M75 E;  2ZZG A;  3WQZ A;  1KQ1 A;  4N4I A;  2XK0 A;  5D6W A;  1E1O A;  3NGP A;  4FSS A;  1YJN A;  3RGL A;  2FPD A;  4PG3 A;  2KYB A;  1YJN Q;  4GLK A;  2DTH A;  4M7A B;  4CS4 A;  1GBR A;  1G2B A;  4M7A D;  1M9S A;  1SPK A;  2A36 A;  4FIB A;  2L2P A;  3OYN A;  3C12 A;  3OW2 S;  3CXC P;  2KT8 A;  5GAN f;  3GLX A;  1RI9 A;  2J6F A;  4NCX A;  4CH3 A;  9ATC B;  2ODR C;  3A7R A;  4M7A F;  1FWZ A;  3CCM T;  1VUB A;  1TTH B;  4DEX A;  4OGE A;  1VQO T;  2ZR3 A;  1Q81 R;  1OX9 A;  4H2X B;  3P8Y A;  1S72 A;  4ZTU B;  1JQQ A;  1S72 Q;  2QHV A;  2MF2 A;  1K76 A;  2GQV A;  3NET A;  1UDL A;  3P8D A;  4MML A;  1FMK A;  3JV3 A;  3ER0 A;  2L3S A;  1VQZ A;  1D1A A;  1YI2 T;  4FCY A;  4E7L A;  4N4H A;  4A53 A;  1ZA2 B;  2EKO A;  1SEM A;  2DER A;  3PIO A;  3OYA A;  3VS4 A;  4J15 A;  4XU1 A;  1K73 C;  2QEX A;  2QEX Q;  1NJ6 A;  3H41 A;  4J9I A;  4YRO A;  2RJF A;  3DB3 A;  3PE0 A;  3HP9 A;  2E64 A;  4PNO A;  2BE9 B;  1VIF A;  3OYI A;  3PMT A;  2AKW A;  3X20 B;  5KYU A;  2K6D A;  1KQS A;  2DZC A;  1M1G A;  3UFG A;  1BI2 A;  1QMC A;  4A4G A;  3CC7 T;  3R07 A;  2KRO A;  1H4Q A;  2RHS B;  3GIB A;  4JDS A;  2EW3 A;  3JCM h;  4H2S A;  2HL5 C;  5KYY B;  1BCO A;  3V8J A;  1EIY B;  1M3A A;  2KEA A;  3CPW S;  3IG2 A;  4BWA A;  1Y07 A;  4YTL A;  3EG9 A;  2O4X A;  2A7Y A;  2ZT5 A;  4FYY B;  5C53 B;  1M90 U;  2E3I A;  3SB2 A;  4H2Y A;  3MF1 A;  1CSK A;  2NLU A;  3L2Z A;  2ZTG A;  5KCO A;  1HSQ A;  2LDM A;  1TS9 A;  2NUP A;  5IAY A;  1EZZ B;  4Q5W A;  4RCB A;  2VAS A;  2ZZF A;  1CKA A;  4EMK A;  1G3S A;  1V29 B;  2KI7 A;  4N0A A;  3VV0 A;  2JVV A;  3NEM A;  3G6E T;  2B8A A;  4JRK A;  3HHT B;  2ZCF B;  2A0F B;  4XTY A;  2YUQ A;  4M7D B;  3HFZ A;  2EQI A;  2QAZ A;  4LNS A;  5GAN 2;  4XTW A;  2CP6 A;  5HY6 A;  2DD5 A;  3E2U A;  2ZT7 A;  3QZ9 B;  3RBB B;  2EJF A;  5C6S A;  2IY5 B;  1UGS B;  3CCU T;  1BKB A;  2QQA A;  4C8Q C;  2AK5 A;  2CJ9 A;  3OW2 A;  2QQB A;  3KFV A;  1TXQ A;  2EIF A;  1TUD A;  4CC7 A;  3FC3 A;  4KGX B;  3BDL A;  1GCP A;  1VQ9 A;  1UEB A;  3IKL A;  2DJZ A;  3L2U A;  1VQ9 Q;  1XOV A;  4JPB W;  4NL3 A;  3L1A A;  1G8X A;  2MCN A;  2EGE A;  4OLF A;  4P73 C;  2MI6 A;  2XDD A;  3RF1 A;  11AS A;  1VOM A;  3EH2 A;  3OYK A;  1GXI E;  3EHR A;  1C0A A;  4XTV A;  2EFI A;  4C92 C;  2D6F A;  2E65 A;  1RLQ C;  1TUG B;  2EVR A;  4J9G A;  1H8K A;  3DLM A;  4QQG A;  3TEE A;  1J3T A;  2ZPE B;  5LJ5 e;  1AVZ C;  3PVQ A;  4RQF A;  4OMF B;  3RNJ A;  1KK7 A;  4AFS C;  3DKM A;  3CME T;  2K2M A;  2YXY A;  2DTO A;  3VRY A;  2ROT A;  1LYL A;  1ABQ A;  3HTZ A;  3H8Z A;  3AHU A;  4R55 A;  4XEO A;  1OZ3 A;  1ZSZ B;  1KD1 R;  3OS2 A;  1YP5 A;  1X6O A;  2M0O A;  2YWW A;  2FZG B;  4YRJ A;  1Q82 C;  4XU2 A;  1CKB A;  2YUN A;  1WDX A;  2PQW A;  2ZPH B;  5GAN 3;  4H2X A;  4AG1 C;  4H02 A;  2ZZD A;  1VQ7 T;  2MOX A;  3PNW C;  5I11 A;  1X01 A;  3M4Q A;  1M1K C;  3RAC A;  1HK9 A;  4BI4 A;  2DBM A;  1IL2 A;  1NJ5 A;  2NUZ A;  3M4P A;  1SHG A;  4WJ3 M;  2VB6 A;  3CPW A;  4M7D G;  3KFU A;  5CK9 A;  3SD4 A;  5FLX E;  2DJQ A;  1YHQ T;  3TSZ A;  4EMG A;  3PTA A;  2EYW A;  4HT8 A;  5D7U A;  4OB3 B;  3L2Q A;  2K79 A;  1QWE A;  3I55 T;  2P4R A;  1NEG A;  2QTV A;  4GY5 A;  4LVI A;  1PSF A;  4UP9 A;  3O8V A;  3H6Z A;  3EGD B;  1VQ5 T;  1ACM B;  4ZN3 A;  1E22 A;  2FO0 A;  3OS0 A;  1JO8 A;  1P92 A;  1YIJ A;  2EJG A;  1U06 A;  1YIJ Q;  4ESR A;  3N5B B;  1EVK A;  5IHI A;  5LJ3 d;  2RI5 A;  4M77 E;  3MP8 A;  2RHS A;  4HCB A;  4C0D C;  5GAO m;  3UGT A;  1RAE B;  1JB0 E;  5KYY A;  3HRS A;  2KXC A;  4QQ6 A;  2Q7E A;  1M27 C;  5J3B A;  1EIY A;  2R57 A;  2CYZ B;  2HEQ A;  1QVG S;  2X51 A;  1VQ6 T;  4XQ3 A;  2QQR A;  2ZAE A;  4ORZ A;  3RUX A;  1I07 A;  4OB2 B;  1FYF A;  3QUI A;  4H2T A;  2W10 A;  4WTO B;  4BDZ A;  2YRC A;  1NBE B;  1LJO A;  1OPL A;  3HFN A;  1YJN T;  1KMM A;  1JEG A;  1X56 A;  2C06 A;  3A7A A;  2YRV A;  3JCM f;  2Z0W A;  4YCW A;  1HXD A;  4LDV A;  4M7D A;  3MKD A;  1S1N A;  4LVL A;  2FPE A;  3UF4 A;  4P71 A;  2ATC B;  1BIA A;  1K0X A;  1X43 A;  4LDX A;  4YRM A;  3OYG A;  2RQW A;  2EBP A;  1I5L A;  3W3S A;  4BE0 A;  2IY5 A;  3EFO B;  2K5L A;  1S72 T;  2HAX A;  3HXX A;  5A2Q E;  1QP3 A;  4OP0 A;  1NJ2 A;  3HXU A;  4RTW A;  4C5G A;  4YYE A;  3JCM c;  5C0M A;  3CCS A;  4IUT A;  1FMW A;  3CCS Q;  4EMK C;  1AZE A;  4N0A C;  4PJL A;  3SHW A;  1JBM A;  2KAF A;  1WHK A;  2JZ2 A;  1AWW A;  1NJ1 A;  2J05 A;  3A5Z B;  2G3R A;  2WSF E;  3RKX A;  3SWN B;  1Z7M A;  3PIP A;  4J7F A;  5IHN A;  4EIK A;  3OS1 A;  4FYV B;  3CCV A;  3RMS A;  2KT1 A;  3CCV Q;  2E1H A;  3P8V A;  3V7R A;  2ECZ A;  2JMC A;  1OI1 A;  5HKC A;  3QDR B;  1Y96 B;  3A8O B;  3MP1 A;  5LJ3 g;  2LVM A;  3VYH B;  4ELY C;  1H64 1;  1UGQ B;  5HCK A;  4YRN A;  3VS7 A;  3CMA A;  2YUO A;  1ZSZ A;  1I4K 1;  2L3P A;  3EAE A;  3OYF A;  3CMA Q;  3JSC A;  1O75 A;  1NE8 A;  1WHJ A;  2JW4 A;  1EQR A;  4C8Q G;  3OYJ A;  3GNF B;  2K4Y A;  1EFW A;  1UFF A;  1PD1 A;  1Q95 G;  1PC0 A;  2DZ9 A;  2CDT A;  2CH4 A;  2GGR A;  3JB9 D;  2EQK A;  4D6W A;  3E1S A;  1VIE A;  2YLC A;  1PG5 B;  4KUI A;  1TWB A;  1BI1 A;  2GQI A;  2LCS A;  2XU8 A;  2RHY A;  4XTX A;  4PJO B;  2PMF A;  1BU1 A;  2LNV A;  4M78 F;  4PJO D;  2F1L A;  2QI2 A;  4E7I A;  2JTF A;  1QVG A;  4C92 G;  1M30 A;  1IGQ A;  4E2F B;  1VQN A;  3CC4 A;  3UGQ A;  4G85 A;  1VQN Q;  1NYF A;  3BY7 A;  1M90 R;  3KUF A;  1WJS A;  3VS6 A;  2FVU A;  2HDA A;  4M75 B;  4OVA A;  5I22 A;  1YN8 A;  4M75 D;  3S3O A;  3QO8 A;  2COW A;  4MDW A;  1WQW A;  2VUB A;  3DLL A;  4AG2 C;  5GAN e;  3OYY A;  3QJ6 A;  2QK0 A;  1N5Z A;  1UG1 A;  4RTU A;  4DBQ A;  4C0Z A;  3HRI A;  5J26 A;  5CAI A;  4JZ4 A;  1VQ9 T;  1SER A;  5CKF A;  1UE9 A;  2DL3 A;  1VQP A;  3VS1 A;  1Y57 A;  1YCY A;  2EPD A;  2X9H A;  1VQP Q;  3OBY A;  2E4H A;  1D09 B;  5GAN 7;  2ZGW A;  1WHG A;  4MMK A;  3HFO A;  3WXM B;  3ZEH A;  4ZTJ A;  4P5N A;  3QO3 A;  3CD6 A;  2QHU A;  2DD4 A;  1QVF P;  2LT1 A;  3VS5 A;  4G84 A;  3HFV A;  3CD6 Q;  1T3S A;  3UWN A;  2E5K A;  2PTK A;  3A8H B;  3J7A F;  3OYL A;  1WJQ A;  1IXD A;  3MPU B;  4ZGD B;  3OD1 A;  2LMJ A;  3JCM P;  3V7S A;  2J3L A;  1OQK A;  1Y7X A;  1WXU A;  3OYB A;  4YRP A;  1N8R U;  4JJN K;  2V8J A;  4PK4 A;  4YPF A;  3HRT A;  3OY9 A;  5IXF A;  4HT9 A;  1NJI R;  1OUL A;  1J5W A;  2C0O A;  2DK3 A;  3KBG A;  4E7S A;  2FRW A;  2QA4 T;  3VRZ A;  2DDZ A;  3ICA A;  4BW9 A;  2I4O A;  1PD0 A;  4OGC A;  3BW1 A;  1I5O B;  5ELN A;  2O2O A;  2XG8 D;  3RIR A;  4ZGJ B;  4QVD A;  3I56 Q;  3IQL A;  3EFO A;  1G5I A;  3QYG B;  2CT4 A;  4M78 E;  2CSQ A;  5LL6 S;  3TUP A;  3HRK A;  2D9T A;  2FHD A;  3TEG A;  1WI7 A;  1HTT A;  3VQV A;  2DU5 A;  1WQ7 A;  2PUK B;  3NEL A;  4F7U F;  1KQ2 A;  4PFP A;  1JRI A;  1RAH B;  1WHH A;  2AZS A;  1Q7Y C;  3NTH A;  1PRM C;  5A0D A;  4EX5 A;  1RUW A;  1TG0 A;  4NS5 A;  5LJ3 h;  3CCE A;  4IIO A;  3G71 T;  3OYM A;  3H9N A;  2MYS A;  3CCE Q;  2RD1 A;  1PSE A;  4BI8 B;  1KHI A;  2V1Q A;  4QKU A;  1LPL A;  2NUT B;  4M7D C;  1ZBJ A;  1UGR B;  2JXB A;  3A5Z A;  3H0H A;  2OAW A;  3SWN A;  3EG2 A;  4P71 C;  4BI3 A;  2E41 A;  3NEN A;  1NLP C;  5D6Y A;  2DYB A;  3VBB A;  2AHJ B;  2C8M A;  2FPF A;  1OYX A;  1ZA1 B;  1D0X A;  1YIJ T;  3FLG A;  4IIM A;  1Y96 A;  3H0F A;  1I81 A;  2LQW A;  2EYQ A;  2QGF B;  3GPL A;  4ZTZ B;  4C5I A;  1H3H A;  3CCL A;  2JM9 A;  2GBQ A;  2KRS A;  4LN2 A;  3CCL Q;  3PVL A;  1WXT A;  4KBM B;  1G3Y A;  4ZIB A;  4DBF A;  4K87 A;  5CR2 A;  1ARK A;  2QDY B;  4ELZ C;  2XDB A;  12AS A;  4C0G A;  2LX7 A;  2MAM A;  4A4E A;  4A4F A;  2E70 A;  3LC0 A;  4BY6 B;  4KR3 A;  4MZM A;  2G4C A;  2CKK A;  3QPH A;  2JT4 A;  3OYD A;  1Q81 C;  3I9Q A;  2Q7G A;  4PJO A;  4C0F A;  4QW2 A;  3LW5 E;  3QII A;  4X1V A;  1EX4 A; 
#chains in the Genus database with same CATH homology
 1ASY A;  4KUD K;  3CXC S;  2I2L A;  2EJ9 A;  5DY9 A;  2HD0 A;  3JAM E;  1G3W A;  2JOY A;  3SDZ A;  2A8E A;  4M75 A;  1SET A;  4BB7 A;  2BKD N;  3FRN A;  5A0G A;  3INZ A;  5E3I A;  1U1T A;  3ERR A;  1QVF A;  3UT1 A;  4F7U E;  3RMQ A;  3JCM X;  2F69 A;  4KQE A;  3CCS T;  4JUV A;  4BD3 A;  4H2W A;  3REU A;  4BE1 A;  3JCM Q;  1SRY A;  4ZTF A;  3BJU A;  5KNN A;  2K3X A;  4YRC A;  4ZGE B;  3UPU A;  4X34 A;  2DQ3 A;  3E9I A;  3LH0 A;  2ZIM A;  3HRU A;  1TH7 A;  4HWR A;  1BIB A;  2DAQ A;  3TCJ A;  3PGG A;  4M7A G;  5GAM d;  3CCV T;  4XU0 A;  1YFR A;  2OTL A;  2DXU A;  1YIT A;  3E9F A;  2QHS A;  2M9U A;  3CMA T;  3OYC A;  3HXY A;  1VQ8 A;  5GMK e;  1Q86 U;  1MGQ A;  3P8T A;  3CCQ A;  1KG1 A;  4B9W A;  1AHJ B;  2Q5I A;  2ARS A;  3VUB A;  4JRQ A;  1W66 A;  1B7Y B;  2DQ0 A;  4M77 B;  4M77 D;  1NPP A;  4OB1 B;  2D0Q B;  5CO7 A;  2BIV A;  1VQN T;  4IUV A;  4M77 F;  3X26 B;  4IUP A;  3JCM e;  3QO5 A;  1ZHI A;  4E7H A;  5KE3 A;  1W4S A;  1E1T A;  1NJI U;  3M5A A;  4EPC A;  3CXC A;  1WLE A;  2HNI A;  1FXX A;  5FU6 B;  1E24 A;  2LTO A;  4FU6 A;  4J5Y A;  3VUZ A;  4Y91 A;  1VQK A;  4AH6 A;  2MMP A;  3JCM V;  5GAM j;  3FB9 A;  4M7A A;  3L4G B;  5GAN j;  4MZT A;  5LJ3 f;  2VC8 A;  1R8O B;  4YRQ A;  4BDY A;  1VQP T;  1KD1 C;  5HK3 A;  4XU3 A;  2RHX A;  1VQ4 A;  3CD6 T;  4XTU A;  2KSS A;  2RHZ A;  3T9N A;  3SWN C;  2WSE E;  5CKD A;  5GAM g;  2HBP A;  5IN1 A;  2Y4Y A;  3P8H A;  4ZN1 A;  2QTX A;  1YB3 A;  2XD0 A;  3MEV A;  3FEO A;  3RKW A;  1KC8 U;  4IUU A;  4LD6 A;  2K5I A;  4WJ4 A;  3GF5 A;  3I56 T;  4RMO A;  3DB4 A;  4L6V 5;  2M16 A;  2MWO A;  2DTI A;  1NPR A;  1H4S A;  4II1 A;  4LDU A;  3HSB A;  4M7D E;  1QW1 A;  2RK1 A;  4PJO C;  2AMC B;  4DQ2 A;  4JRP A;  3CMQ A;  3CPF A;  5GMK m;  3LGL A;  2P5I A;  3CCE T;  4YRE A;  4CI0 C;  2PME A;  4CH6 A;  4M75 C;  3TEH B;  2LC4 A;  4J83 A;  4FT2 A;  1BYM A;  3L2V A;  3OMG A;  1JJC B;  3MQZ A;  1RI0 A;  2LCC A;  3MEU A;  3M54 A;  3PZC A;  5CKB A;  2WAC A;  2GFU A;  1VQO A;  3JB9 I;  1K73 U;  2CZ0 B;  3CC2 A;  4HCC A;  4C5E A;  3CCL T;  1G5V A;  2F5K A;  2LQK A;  4JS4 A;  3QBY A;  4RKU E;  2R5A A;  3UDC A;  2P0L A;  4C8Q F;  3MO8 A;  4X9C A;  2RB6 A;  2RI2 A;  5GAN 6;  2NS6 A;  2X4Y A;  5CKH A;  3LX7 A;  1B7Y A;  3HL8 A;  4K86 A;  3NTK A;  4NOY A;  2QQ9 A;  5I2S A;  5A0L A;  4N4G A;  4C92 F;  2XID A;  4A54 A;  3C95 A;  3CCJ A;  4RQE A;  1N6A A;  2QEX T;  4RCC A;  4PLL A;  2X4X A;  2E5A A;  2P4T A;  2X4W A;  4EO4 A;  3V7C A;  3BFM A;  3A5Y A;  1ASZ A;  2R58 A;  2ZT8 A;  5GAM h;  1B34 B;  3L4G A;  2KK4 A;  4C5H A;  2RJE A;  3OSS C;  2XTI A;  5CVI A;  2HQX A;  4IUR A;  1G51 A;  1HC7 A;  3IAL A;  2YHT A;  1ZBX A;  4M78 B;  2P0K A;  4FM4 B;  2ZNI A;  4M78 D;  2VGM A;  1X55 A;  1LOJ A;  2P0P A;  5LJ5 d;  3CBM A;  3CCR A;  2RHI A;  1YJ9 A;  2OTL T;  3BDU A;  5GAO n;  1YIT T;  4M7A C;  1YBY A;  1WYD A;  4CS3 A;  4O2D A;  3MP6 A;  1XNI A;  4C8Q E;  3GOX A;  3QSU A;  2A3L A;  2ARU A;  5DLO A;  2RJD A;  5DLQ E;  1VQ8 T;  1M90 C;  2F5T X;  1NZ9 A;  1QP2 A;  4MDX A;  4O6J A;  3WVD B;  2KY9 A;  4BY6 C;  3CCQ T;  4RDX A;  5GMK j;  2RHQ B;  2PU9 B;  2CJA A;  2IG0 A;  3OSV A;  3A8G B;  5CIU A;  5GAN 4;  4C92 E;  2L8D A;  4QVC A;  5D6X A;  2AMC A;  5GAN 5;  2VV5 A;  1Q82 U;  5FRN A;  5ELO A;  4ATO A;  2LRQ A;  3PCO B;  2GFA A;  1K8A U;  2K57 A;  5IT9 E;  4MZP A;  2DXB A;  3TEH A;  3X25 B;  2X35 A;  4K88 A;  2MWP A;  4YRS A;  4X5O A;  3A74 A;  1JJC A;  4P72 A;  1OZ2 A;  5J39 A;  1VQK T;  5FU7 B;  5LJ5 j;  2XIC A;  5GAO l;  3PFS A;  1QVF S;  3QJY A;  5DM7 R;  5GMK l;  4LVK A;  2I4N A;  4YRT A;  3JB9 G;  1NJI C;  2E3C A;  2DEQ A;  2EQU A;  1N9S A;  4F7U B;  2X4J A;  4J6Y A;  3QXE B;  2DPP B;  3ZBD A;  4PJO G;  2J3M A;  3I55 A;  5LJ5 g;  2XDP A;  4KR2 A;  1U1S A;  4YRK A;  5L8R E;  2EQM A;  2ZPG B;  1BBU A;  2DKG A;  4M75 G;  3ME9 A;  3CBP A;  1BBW A;  1YJW A;  4YP0 A;  3OMC A;  4X9D A;  2JUF A;  3A7U A;  2CZ1 B;  3URG A;  4HT4 A;  2DXT A;  1N9W A;  5C52 B;  1MHN A;  2K3Y A;  3RKY A;  1NYR A;  4H2U A;  2LT4 A;  1B34 A;  3PMI A;  3GP8 A;  3DSQ A;  2L3R A;  4XK8 E;  3M56 A;  3I7F A;  4UP7 A;  4KUL A;  4LVJ A;  1X2H A;  2RJC A;  4M78 A;  2CS7 A;  5GAO r;  1WJR A;  1N27 A;  1DJ7 B;  2DIQ A;  3NTI A;  3M53 A;  4P74 A;  3C94 A;  1WU7 A;  5FU6 C;  5GAM f;  5EG2 A;  5CKE A;  3FDR A;  4CS2 A;  3OS5 A;  4XEM A;  4E7J A;  2XHC A;  4OF1 A;  4TVA B;  3CC2 T;  1SES A;  4HCZ A;  4F7U G;  5C51 B;  5LJ3 e;  2HQE A;  3LWI A;  3HXV A;  4RG2 A;  2EL9 A;  4HWP A;  4TVW A;  4P3O A;  2ART A;  5GMK h;  2RHQ A;  4CRI A;  3JRZ A;  2Q5H A;  4P75 A;  4FL6 A;  2K5F A;  3QG1 A;  4QQD A;  3OYE A;  1M8V A;  1FX7 A;  3QTC A;  4WI1 A;  3PCO A;  5HK0 A;  1IZ6 A;  4YDQ A;  3QHS A;  1EVL A;  2ZXF A;  2E10 A;  3CCJ T;  2ZT6 A;  4ME7 A;  3M59 A;  2OTJ A;  1WGS A;  3OB9 A;  4OB0 B;  4UPA A;  3JB9 H;  2PUO B;  5FRO A;  1KOG A;  5GAN d;  2CGH A;  4WF2 A;  2DXC A;  3LLR A;  5FRM A;  2PVO B;  5LJ5 h;  2LQ8 A;  3HXW A;  1GGM A;  1B70 B;  4VUB A;  3LGF A;  3G4S A;  2OAU A;  3PT9 A;  3MHX A;  5CQX A;  3EFS A;  2RI3 A;  2FB7 A;  2L89 A;  2ZIO A;  3X28 B;  3KXT A;  4F7U A;  2L5Q A;  3ASK A;  1JJ2 S;  1NYQ A;  3WVE B;  4CH5 A;  4M7A E;  2GCX A;  3FJP A;  4M7D D;  1YFS A;  4P72 C;  3CCR T;  1YJ9 T;  2E5Q A;  5GMK i;  1VQM A;  3UH0 A;  4M7D F;  4XTZ A;  3CC4 T;  1K9M U;  3M4Y A;  1H4T A;  1UGP B;  2E6N A;  5GAN 8;  2ZZE A;  2Y90 A;  3S3N A;  5M9O A;  2R5M A;  4Z02 A;  3QYH B;  2EAY A;  2ODR D;  2DIG A;  3Q1J A;  4LDW A;  3LYI A;  3SFM A;  4TTV A;  4BUG A;  3MEY A;  2ZCE A;  4QVZ A;  1W2B S;  5HGQ A;  3A8L B;  3OA6 A;  2CJB A;  3P8B B;  1BI0 A;  2RA2 A;  2FL7 A;  3IKM B;  2XKO C;  1Q7Y U;  2QA4 A;  1VQL A;  5GAN g;  3VQX A;  4HVC A;  1QE0 A;  3LSQ A;  2I4M A;  3E19 A;  3A32 A;  5K1P A;  2JN0 A;  5F5W A;  3A8M B;  1U8R A;  4TQD A;  4TVR A;  2ZPF B;  1K8A C;  4TVA A;  3V8L A;  1ADY A;  1M4Z A;  4YRI A;  4EMH A;  3MCA B;  1XQH A;  2QQS A;  1X54 A;  1RL2 A;  1NNH A;  4P3P A;  4CH4 A;  1BI3 A;  4M77 G;  2IVW A;  1WNL A;  4M78 C;  3VJP A;  3G71 A;  4H2V A;  1N8R C;  4P74 C;  4NL2 A;  3LWH A;  1L0W A;  3JCM b;  4IKF A;  2FYK A;  4L5G A;  3MET A;  4BE2 A;  3M55 A;  1JJ2 A;  4RMF A;  3L2W A;  4YRF A;  2VGN A;  3HPW A;  2V8K A;  3MEW A;  4HKE A;  1PYS B;  4DA4 A;  1Q81 U;  4HA8 A;  4XAX B;  1YJW T;  2VYT A;  4YRL A;  1SSF A;  4PKC C;  5KCH A;  4J8O A;  4YCV A;  5K1X A;  2Q7H A;  3CCM A;  3J81 E;  2RO0 A;  2KVQ G;  1B70 A;  4Q6G A;  4P75 C;  2P0Q A;  4C8Q B;  1USY A;  3HXZ A;  4RG8 A;  4C8Q D;  3HY1 A;  4E47 A;  3E9G A;  2DO3 A;  1YI2 A;  1LNX A;  1B8A A;  1KHC A;  1Z7N A;  2CZ7 B;  3G7Z A;  4DOV A;  2RH2 A;  2PVD B;  2GF7 A;  2C7I A;  4C92 B;  1H3Z A;  4M77 A;  3EFR A;  1D3B B;  4C92 D;  5LJ5 f;  3QZ5 B;  1W2B A;  2XI9 A;  2K2V A;  2DVE A;  2RHU A;  5I2M A;  4JS5 A;  1QF6 A;  2RM4 A;  3NFC A;  4TVY A;  5CCA A;  5FU7 C;  3V8K A;  3CBO A;  4TWA A;  3REX A;  4LVM A;  2JTM A;  2Y4X A;  2PVG B;  3CC7 A;  1G5H A;  4BAC A;  4DPG A;  4A4K A;  5LJ3 j;  1QVP A;  3X24 B;  3LSS A;  3S3M A;  2ALY B;  4LDY A;  2RK2 A;  5GAN h;  2VXF A;  3VQW A;  3S6W A;  2WSC E;  3VU3 C;  3QKJ A;  2XGT A;  2ZPI B;  1WPY A;  3RL6 A;  4E51 A;  4L59 A;  3G6E A;  1X75 C;  2EQJ A;  3JCM d;  2CZ6 B;  3RER A;  2OTJ T;  1ZQ1 A;  4TQF A;  2H3J A;  4Y28 E;  2ZIN A;  2E6Z A;  1EOV A;  2KDS A;  2M1H A;  4EDU A;  1KMN A;  3R6O A;  2BUD A;  3CCU A;  3CEY A;  4YRR A;  2QXF A;  3J80 E;  1M5Q 1;  1O9S A;  3G4S T;  4PLI A;  4LD9 K;  4B9X A;  4C0D B;  2I4L A;  3JB9 F;  2DU7 A;  4UP8 A;  4L87 A;  3VQY A;  4E7K A;  3F70 A;  4IUQ A;  1Y71 A;  4PJO F;  3JB9 J;  5KE2 A;  3E9H A;  4PL6 A;  4HWO A;  3GNG A;  4J7I A;  1KD1 U;  3G1Z A;  1XTD A;  1UB4 A;  3TRE A;  5GAM e;  2JNG A;  3HY0 A;  1VQM T;  1Q86 C;  2VXE A;  1RIQ A;  2KMT A;  3CME A;  1PYS A;  4M75 F;  2AKW B;  1X2G A;  1M1K U;  2ZR2 A;  4A4H A;  3MF2 A;  2V8I A;  4O5V A;  4J6X A;  3M4G A;  4J6W A;  4FSX A;  4DOW A;  1YGB A;  2O4X B;  3M58 A;  4C8Q A;  1I8F A;  4R56 A;  1K9M C;  5I21 A;  1VQ7 A;  5GAO q;  1H4V B;  5GAO p;  4FT4 A;  4M78 G;  3C4S A;  3JCM J;  4EMK B;  1ADJ A;  3JCM g;  1VQ4 T;  3MEA A;  1IRE B;  5KH6 A;  4P73 A;  4KT0 E;  2E12 A;  1YHQ A;  1EIF A;  1ATI A;  4V2S A;  3VYG A;  2CIM A;  3JCM W;  4C92 A;  2KQW A;  2LX9 A;  2EWN A;  2ZPB B;  3HFZ B;  4HWS A;  1D3B A;  4HWT A;  1VQL T;  1M1F A;  1N9R A;  2O01 E;  1KQS S;  3A31 A;  4JLI A;  3L42 A;  1YFT A;  1VQ5 A;  3TU4 K;  3I56 A;  3QO7 A;  4PHC A;  1G3T A;  1NJ8 A;  3ZFJ A;  4YCU A;  2QHT A;  1USY C;  2ZNJ A;  3OYH A;  3M57 A;  4JLG A;  2YLB A;  4PJO E;  4JRI A;  1B76 A;  5CQY A;  4P3N A;  5AYF A;  3RES A;  3HKS A;  4UC4 A;  3VKI A;  2ALY A;  4Q15 A;  4YRG A;  3OQ5 A;  2LCL A;  4M77 C;  1VQ6 A;  3QNE A;  3L2R A;  3OBW A;  3FIF A;  1KC8 C;  3M9Q A;  4M75 E;  2ZZG A;  3WQZ A;  1KQ1 A;  4N4I A;  2XK0 A;  5D6W A;  1E1O A;  1YJN A;  3RGL A;  4PG3 A;  4GLK A;  2DTH A;  4M7A B;  4CS4 A;  4M7A D;  1M9S A;  4FIB A;  3OYN A;  3C12 A;  3OW2 S;  5GAN f;  3GLX A;  4NCX A;  4CH3 A;  2ODR C;  3A7R A;  4M7A F;  1FWZ A;  3CCM T;  1VUB A;  4OGE A;  1VQO T;  2ZR3 A;  4H2X B;  3P8Y A;  1S72 A;  4ZTU B;  2QHV A;  2MF2 A;  2GQV A;  3NET A;  3P8D A;  4MML A;  3ER0 A;  1VQZ A;  1YI2 T;  4E7L A;  4N4H A;  4A53 A;  2EKO A;  3PIO A;  3OYA A;  4J15 A;  4XU1 A;  1K73 C;  2QEX A;  1NJ6 A;  4YRO A;  2RJF A;  3DB3 A;  3HP9 A;  2E64 A;  4PNO A;  1VIF A;  3OYI A;  3PMT A;  2AKW A;  3X20 B;  1KQS A;  2DZC A;  1M1G A;  3UFG A;  1BI2 A;  4A4G A;  3CC7 T;  3R07 A;  1H4Q A;  2RHS B;  3GIB A;  4JDS A;  3JCM h;  4H2S A;  3V8J A;  1EIY B;  3IG2 A;  3CPW S;  4BWA A;  1Y07 A;  4YTL A;  2O4X A;  2A7Y A;  2ZT5 A;  5C53 B;  1M90 U;  3SB2 A;  4H2Y A;  3MF1 A;  2NLU A;  3L2Z A;  2ZTG A;  5KCO A;  5IAY A;  2LDM A;  4Q5W A;  4RCB A;  2ZZF A;  4EMK A;  1G3S A;  1V29 B;  4N0A A;  3VV0 A;  2JVV A;  3NEM A;  3G6E T;  2B8A A;  4JRK A;  3HHT B;  2ZCF B;  4XTY A;  4M7D B;  3HFZ A;  4LNS A;  5GAN 2;  4XTW A;  5HY6 A;  2DD5 A;  2ZT7 A;  3QZ9 B;  2EJF A;  5C6S A;  2IY5 B;  1UGS B;  3CCU T;  1BKB A;  2QQA A;  4C8Q C;  2CJ9 A;  3OW2 A;  2QQB A;  2EIF A;  3FC3 A;  3IKL A;  3BDL A;  1VQ9 A;  1UEB A;  2DJZ A;  3L2U A;  1XOV A;  4NL3 A;  3L1A A;  4OLF A;  4P73 C;  2MI6 A;  2XDD A;  3RF1 A;  11AS A;  3OYK A;  1GXI E;  1C0A A;  4XTV A;  2EFI A;  4C92 C;  2D6F A;  2E65 A;  3DLM A;  4QQG A;  3TEE A;  2ZPE B;  5LJ5 e;  4RQF A;  4OMF B;  3DKM A;  3CME T;  2DTO A;  1LYL A;  3HTZ A;  3H8Z A;  3AHU A;  4R55 A;  4XEO A;  1OZ3 A;  3OS2 A;  1X6O A;  2M0O A;  4YRJ A;  1Q82 C;  4XU2 A;  2PQW A;  2ZPH B;  5GAN 3;  4H2X A;  4H02 A;  2ZZD A;  1VQ7 T;  3PNW C;  1X01 A;  3M4Q A;  1M1K C;  3RAC A;  1HK9 A;  4BI4 A;  1IL2 A;  1NJ5 A;  3M4P A;  4WJ3 M;  3CPW A;  4M7D G;  3KFU A;  5CK9 A;  3SD4 A;  5FLX E;  1YHQ T;  4EMG A;  3PTA A;  4HT8 A;  4OB3 B;  3L2Q A;  3I55 T;  4GY5 A;  4LVI A;  1PSF A;  4UP9 A;  3O8V A;  3H6Z A;  1VQ5 T;  4ZN3 A;  1E22 A;  3OS0 A;  1P92 A;  1YIJ A;  2EJG A;  3N5B B;  1EVK A;  5LJ3 d;  2RI5 A;  2RHS A;  4M77 E;  3MP8 A;  4HCB A;  4C0D C;  5GAO m;  3UGT A;  1JB0 E;  3HRS A;  4QQ6 A;  2Q7E A;  5J3B A;  1EIY A;  2R57 A;  2CYZ B;  1QVG S;  1VQ6 T;  4XQ3 A;  2QQR A;  3RUX A;  1FYF A;  4OB2 B;  3QUI A;  4H2T A;  4BDZ A;  1LJO A;  3HFN A;  1YJN T;  1KMM A;  1X56 A;  2C06 A;  3A7A A;  2YRV A;  3JCM f;  4YCW A;  1HXD A;  4LDV A;  4M7D A;  4LVL A;  4P71 A;  1BIA A;  4LDX A;  4YRM A;  3OYG A;  1I5L A;  3W3S A;  4BE0 A;  2IY5 A;  2K5L A;  1S72 T;  2HAX A;  3HXX A;  5A2Q E;  1QP3 A;  4OP0 A;  1NJ2 A;  3HXU A;  4C5G A;  4YYE A;  3JCM c;  5C0M A;  3CCS A;  4IUT A;  4EMK C;  4N0A C;  1JBM A;  2KAF A;  2JZ2 A;  1NJ1 A;  3A5Z B;  2G3R A;  2WSF E;  3RKX A;  3SWN B;  1Z7M A;  3PIP A;  4J7F A;  3OS1 A;  3CCV A;  3RMS A;  2E1H A;  3P8V A;  3V7R A;  1OI1 A;  5HKC A;  3QDR B;  1Y96 B;  3A8O B;  3MP1 A;  5LJ3 g;  2LVM A;  3VYH B;  4ELY C;  1H64 1;  1UGQ B;  4YRN A;  3CMA A;  1I4K 1;  3EAE A;  3OYF A;  3JSC A;  1O75 A;  1NE8 A;  1EQR A;  4C8Q G;  3OYJ A;  3GNF B;  2K4Y A;  1EFW A;  2DZ9 A;  3JB9 D;  2EQK A;  4D6W A;  3E1S A;  1VIE A;  2YLC A;  4KUI A;  1BI1 A;  2XU8 A;  2RHY A;  4XTX A;  4PJO B;  2PMF A;  2LNV A;  4PJO D;  4M78 F;  2QI2 A;  4E7I A;  2JTF A;  1QVG A;  4C92 G;  1VQN A;  3CC4 A;  3UGQ A;  4G85 A;  3BY7 A;  3KUF A;  1WJS A;  2FVU A;  4M75 B;  4OVA A;  4M75 D;  3S3O A;  3QO8 A;  4MDW A;  2VUB A;  1WQW A;  3DLL A;  5GAN e;  3OYY A;  3QJ6 A;  3HRI A;  4C0Z A;  5J26 A;  5CAI A;  1VQ9 T;  1SER A;  5CKF A;  1VQP A;  1YCY A;  3OBY A;  5GAN 7;  2ZGW A;  4MMK A;  3HFO A;  3WXM B;  3ZEH A;  4ZTJ A;  4P5N A;  3QO3 A;  3CD6 A;  2QHU A;  2DD4 A;  2LT1 A;  4G84 A;  3HFV A;  3UWN A;  3A8H B;  3J7A F;  3OYL A;  1WJQ A;  4ZGD B;  3OD1 A;  3JCM P;  3V7S A;  2J3L A;  1Y7X A;  3OYB A;  4YRP A;  1N8R U;  4JJN K;  2V8J A;  4YPF A;  3HRT A;  3OY9 A;  4HT9 A;  1J5W A;  2DK3 A;  3KBG A;  2QA4 T;  2DDZ A;  3ICA A;  4BW9 A;  2I4O A;  4OGC A;  3BW1 A;  5ELN A;  2XG8 D;  3RIR A;  4ZGJ B;  4QVD A;  1G5I A;  3QYG B;  4M78 E;  5LL6 S;  3TUP A;  3HRK A;  2D9T A;  2FHD A;  3TEG A;  3VQV A;  1HTT A;  2DU5 A;  1WQ7 A;  2PUK B;  3NEL A;  4F7U F;  1KQ2 A;  1JRI A;  1Q7Y C;  3NTH A;  5A0D A;  4EX5 A;  4NS5 A;  5LJ3 h;  3CCE A;  3G71 T;  3OYM A;  2RD1 A;  1PSE A;  4BI8 B;  1KHI A;  4M7D C;  1UGR B;  3A5Z A;  3SWN A;  4P71 C;  4BI3 A;  2E41 A;  3NEN A;  5D6Y A;  3VBB A;  2AHJ B;  2C8M A;  1OYX A;  1YIJ T;  3FLG A;  1Y96 A;  1I81 A;  2EYQ A;  3GPL A;  4ZTZ B;  4C5I A;  3CCL A;  4KBM B;  1G3Y A;  4ZIB A;  4K87 A;  5CR2 A;  2QDY B;  4ELZ C;  2XDB A;  12AS A;  4C0G A;  2MAM A;  4A4E A;  4A4F A;  2E70 A;  3LC0 A;  4BY6 B;  4KR3 A;  4MZM A;  2G4C A;  2CKK A;  3QPH A;  3OYD A;  1Q81 C;  2Q7G A;  4PJO A;  4C0F A;  4QW2 A;  3LW5 E;  3QII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...