2DXTA

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with atp and biotin, mutation d104a
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNAVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 70
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxtA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dxtA01
2CJBA 3A7UA 5GMKe 1N9SA 2QHUA 3RERA 1SESA 5LJ3g 4CS2A 1HC7A 4TWAA 4P72C 4M7DG 3HRIA 4YRCA 4M7AG 5GMKm 4XU2A 4X9DA 4CH6A 2DEQA 4TVAB 5C52B 4K88A 1Y96B 3MF2A 2CGHA 2EWNA 3UGTA 4YRGA 5GMKj 4M75G 4CH3A 1H641 3M4GA 5KNNA 1X01A 4CH4A 1WYDA 3PCOA 5LJ5d 1D3BB 4H2XA 2Q7HA 4M75B 4Q6GA 3UH0A 1BIAA 3HFZB 1KQ1A 4YRIA 1EQRA 1ATIA 4H2UA 2YHTA 3BJUA 1WQWA 4YRJA 4HWSA 3RKWA 3HXXA 3TEHB 2RHSB 3TEGA 2ZCEA 5DY9A 5E3IA 3FIFA 3JCMd 4TQDA 1EVKA 3P8VA 2DQ0A 4PJOG 3VU3C 5GAN6 1NYQA 4YRQA 3E9HA 1WPYA 4M78A 4J5YA 1X55A 2Y90A 4YRMA 3V8LA 2ZZEA 1NJ6A 5GANe 3IKLA 4XTYA 1G5HA 3HY0A 4YRLA 4F7UE 5GMKh 4HT8A 4HWPA 2QTXA 3HXUA 4RMFA 2E65A 3JB9I 1B34B 5LJ3e 3JCMV 4RDXA 1W66A 3IG2A 4C8QA 3V8KA 4YRTA 3MF1A 4EX5A 1QE0A 4C8QD 3V7CA 3JB9F 2ALYA 3HXVA 4YCUA 1B70B 4C92B 2JN0A 2AKWB 3BW1A 3VBBA 1U1SA 5GANj 3RL6A 12ASA 2P0LA 3UFGA 1C0AA 4J6XA 1E1TA 3HXZA 4BWAA 4M77D 1ASZA 2QHSA 1JBMA 4C92G 2AMCA 4UPAA 3A31A 4XTUA 3P8YA 4CS4A 4X5OA 4M78B 4J15A 4YYEA 3JB9D 4JLIA 3LSSA 4RCCA 3PZCA 2EL9A 4M78G 4P72A 1QF6A 4YCWA 4WJ3M 1ASYA 1LJOA 3IKMB 1JJCB 3HRKA 4M77E 4JUVA 4M7AC 3A7AA 1I4K1 4M77F 1NJ1A 3CMQA 3HY1A 5K1XA 3BFMA 2DU7A 2J3LA 2ZT8A 4M78C 4XTZA 4EMKB 4K86A 1USYA 3NENA 3JB9H 2FB7A 1X54A 5CAIA 4E51A 1E24A 1YFRA 3IALA 1NYRA 2YLCA 4N0AA 4C92F 2I4NA 3NETA 3RKYA 4Y91A 4BW9A 1ADYA 2ZT5A 4F7UG 2DTOA 1I8FA 4QVCA 5I21A 5GAMg 4X9CA 1USYC 1E22A 4PJOB 2DQ3A 4YCVA 2HNIA 4RCBA 4XTVA 1X56A 3VQXA 5LJ5e 1I5LA 1I81A 4P73A 3FB9A 3REXA 1IL2A 1GGMA 1HK9A 2DVEA 3EFRA 2RB6A 1N9WA 3JCMc 1Z7NA 4C92C 11ASA 4YP0A 5GAMe 3R07A 4XEOA 1H4QA 1MGQA 3V7RA 4MMLA 5GAMj 3DSQA 4P75C 3RESA 2RA2A 2P5IA 2DZ9A 3JB9J 2I2LA 4A54A 1SRYA 3REUA 2ZNJA 2AMCB 5LJ5j 4LNSA 4MMKA 4H2VA 4HWOA 4M7AB 2DTIA 3QO8A 2DZCA 5LJ3j 2ZR2A 4PJOF 2AKWA 3VQYA 4EMHA 1JJCA 3JCMh 4DQ2A 1WLEA 1B70A 2Q7GA 3A74A 4N0AC 4H2WA 1PYSB 3JCMe 1NNHA 3RF1A 4NL3A 4ZTUB 1M8VA 2EJGA 5GANf 4NL2A 3ERRA 2DJZA 3TUPA 1H4SA 5GMKi 2VC8A 3FJPA 2ZT7A 3A5YA 3V8JA 3AHUA 1ADJA 4XU0A 1H4TA 1N9RA 2VXFA 4XU1A 3UGQA 2E41A 2EJ9A 4UP8A 4PJOC 3SWNB 4HT9A 2ZTGA 4M7AF 1J5WA 5GAOl 4OLFA 4M7DB 4NOYA 2ALYB 4YROA 2PMEA 1LYLA 4RQFA 3HTZA 2RHQA 3WQZA 2RM4A 2ZIMA 4PNOA 2ZINA 3A7RA 1LNXA 3L1AA 3LC0A 2Q5HA 5HGQA 4EMGA 1WQ7A 1PYSA 3JCMf 2DXUA 3SWNC 4M7DD 2E10A 3QHSA 4YREA 2RHSA 1BBUA 4M7AD 4JRKA 2DU5A 1SETA 4M7AA 2I4LA 4H2YA 3NELA 3HFVA 4C8QC 1EFWA 1YCYA 2DDZA 4P74A 4C92E 1KMMA 4M75D 3JCMX 1BBWA 4M75A 1NJ8A 4YRNA 2IY5B 1M5Q1 5C53B 5GAN5 3VQVA 4F7UB 5LJ3f 2EAYA 3QTCA 1YGBA 3TEHA 4HA8A 2XTIA 1Y96A 4H2TA 5F5WA 1B76A 3A5ZA 3VQWA 1G5IA 4XTXA 2CIMA 4ZIBA 3HFZA 3QUIA 5ELOA 1LOJA 4PJOA 4M7DC 4XEMA 1D3BA 4PG3A 2YLBA 4EMKC 4PJOD 5GAN4 4EO4A 2Q7EA 1U1TA 2ARTA 4A53A 4TQFA 2ZT6A 1NJ5A 4H2SA 4TVAA 1KMNA 4EMKA 4O2DA 1WNLA 5GAOq 4PJOE 4QVDA 2ZIOA 1BIBA 3RKXA 3RIRA 3RACA 4WJ4A 4TVWA 4M75C 1H4VB 4P3OA 4C8QE 5LJ5g 3SB2A 1HTTA 4YRRA 4DPGA 4KR3A 4Q15A 4C8QG 4OP0A 3INZA 3M4PA 5C51B 5GAN3 2ZXFA 4M7DE 3JCMQ 5GAMd 3RUXA 3HXYA 3I7FA 4PHCA 5LJ5h 4M78E 2Q5IA 3W3SA 1L0WA 5K1PA 4M7AE 1EOVA 4C92A 3L4GB 4M77G 4M75F 1VQZA 4C92D 1EIYB 1B7YA 4M75E 3RGLA 4H02A 5LJ3d 4HWRA 4P71C 4WI1A 3JB9G 4AH6A 3PGGA 1HXDA 4C8QB 1Z7MA 2C8MA 3JCMg 4M78D 4P75A 1KOGA 3KFUA 1B34A 4V2SA 3E9IA 2DXTA 4TVYA 4G84A 4NCXA 3OD1A 4J6YA 3QO7A 2CJAA 1WU7A 2ZNIA 2ZGWA 5GAN2 5GMKl 2ZZGA 5LJ3h 4YRKA 2VXEA 3L2ZA 5GANd 4YDQA 1RIQA 1TH7A 4P73C 4P74C 4F7UA 4RQEA 4K87A 4WF2A 3BY7A 4CS3A 1E1OA 3LSQA 4JRIA 5GAN8 2IY5A 3G1ZA 5GAMh 3BDUA 1B8AA 4P3NA 3HXWA 4M77B 1YFTA 5GAMf 1FYFA 4XQ3A 3HFOA 4P71A 3JCMP 3QSUA 4M77A 2C7IA 1JRIA 2E5AA 2PMFA 4F7UF 3NEMA 2G4CA 5GAOr 4H2XB 1G51A 3PCOB 3EFSA 4L87A 3JCMJ 1YB3A 4XU3A 2I4OA 1X2GA 2ARUA 3P8TA 4YRSA 2FYKA 2ZR3A 3JCMW 2RHQB 3A32A 4YRPA 1B7YB 1EIYA 4M7DA 4P3PA 3L4GA 2E1HA 3GIBA 1YFSA 3SWNA 2XGTA 4HWTA 1NJ2A 2DTHA 4KR2A 4KQEA 5GANg 3JCMb 2QHVA 5ELNA 2RD1A 3QO5A 4XTWA 2CJ9A 2I4MA 5GAOn 1EVLA 2DKGA 5LJ5f 3V7SA 4ZTZB 3QO3A 4UP9A 3HSBA 1X2HA 3MEYA 4J6WA 4YRFA 4M7DF 4G85A 4M77C 5GAN7 3M4QA 4UP7A 4HVCA 2EJFA 3ICAA 4M78F 5GAOm 4TTVA 1SERA 2K57A 3QNEA 2ARSA 2J3MA 1KQ2A 5GANh 4C8QF 2QHTA 2ZZFA 4YPFA 4CH5A 5GAOp 3HFNA 2ODRD 2E3CA 2ODRC 2E64A
chains in the Genus database with same CATH superfamily
3A7UA 5GMKe 1N9SA 2CT3A 2PUOB 2L8DA 2XIDA 1SESA 4AT1B 3PIOA 2K3YA 3VS1A 2G3RA 3CC4Q 1VQ7Q 2AKKA 1K4US 5GMKm 3SFMA 1QKXA 2CT4A 3MP1A 4CH6A 2DEQA 4TVAB 3HRSA 4M4ZA 4K88A 2MPXC 1W2BS 1H92A 3MF2A 3CPWP 5GMKj 1VQKA 3I9QA 4MDXA 5CIUA 1R77A 4ATOA 2RHYA 3MO8A 1KC8U 2XMFA 3PCOA 4H2XA 3G4ST 2Q7HA 4ZN1A 4Q6GA 3M59A 4C5HA 4YRIA 2V26A 3QZ5B 2QQBA 4FSXA 1ATIA 2YHTA 4BE1A 1WQWA 1ZBJA 3C12A 3DLLA 2CP7A 3QJYA 1S72Q 1TOVA 2CP0A 2HZYA 5CVIA 4RTTA 3J80E 2D8HA 5E3IA 4KRTA 3JCMd 2OTLT 2NLUA 1VQ9T 4AG2C 2R57A 2X35A 2L3PA 5HCKA 5GAN6 3RR6A 1R0CB 1WJSA 4M78A 1Y07A 3EGUA 2X51A 3MPUB 1K9MC 5GANe 3JRZA 3FDRA 4O6JA 4J9GA 5HKCA 1G5HA 4YRLA 4F7UE 2DPPB 3I55A 4HT8A 4HWPA 2K6DA 2L3SA 3JB9I 3H0FA 1B34B 3GLXA 5KYXA 2DBKA 5LJ3e 3HTRA 2LQWA 4RDXA 2DILA 1VQMA 1QE0A 3V7CA 1HYOA 4D8DA 1HSQA 2E6ZA 2HEQA 2AKWB 2DL4A 3OYJA 3VBBA 3UATA 5GANj 3RL6A 1WHHA 3UFGA 5CR2A 1FMKA 1VQNQ 3UT1A 3JSCA 1E1TA 1SRMA 4E7LA 4L5GA 4M77D 1JBMA 3P8YA 3LSSA 4FW2A 1NJIU 2EL9A 3FLGA 4P72A 3M56A 2SEMA 5IN1A 4YCWA 4LE9A 1LJOA 1Q95G 3IKMB 4JUVA 2LCSA 3UF4A 1I4K1 1YJ9A 3CMQA 5CKDA 3VS6A 2M16A 3BFMA 2J3LA 4M78C 3CCET 4EMKB 1Q86U 4K86A 2PVOB 1VYUA 2KXCA 2FB7A 4LN2A 2LJ0A 5CAIA 4E51A 2YLCA 4N0AA 4C92F 2I4NA 3NETA 3CXCA 3RKYA 1WDXA 4Y91A 1V76A 4BW9A 2ROLA 1I8FA 5GAMg 1X27A 3S3OA 4X9CA 2CZ6B 2KBTA 4C0FA 1RL2A 2QI2A 5IT9E 2EBPA 2EYWA 1KK7A 4YCVA 3OBYA 5LJ5e 1V29B 5KYUB 1GGMA 1HK9A 1AHJB 3L2RA 2GGRA 3DB3A 2D8JA 1NG2A 4RTWA 1U06A 5KCOA 4YP0A 4PKCC 3CC2Q 1H4QA 3MEVA 5M9OA 3OYBA 4MMLA 5GAMj 3QYGB 3RESA 4P75C 1GFDA 2HL5C 3JB9J 2O4XA 3CD6Q 4LVMA 3OMCA 2JXBA 2AMCB 3CCVQ 4HWOA 2LCLA 2DTIA 1KC8R 4JS4A 1O9SA 2ZR2A 2VGMA 1NLPC 4OGEA 3JCMh 3VS4A 4OMMA 5IH2A 1M8MA 1NNHA 3VUBA 4ZTUB 1IHWA 5GANf 3ERRA 1AWXA 3TUPA 1H4SA 5GMKi 1NBEB 3CCRA 1TSFA 2MOXA 4C5EA 2Y4YA 1VQ6Q 3C0CA 4XU1A 3I5SA 1AOJA 3VUZA 4M7AF 1J5WA 4YROA 4RQFA 2L2PA 3OSSC 4PNOA 4XK8E 3A7RA 1LNXA 1JB0E 3LC0A 1VQMT 2D0NA 3WVDB 1G2BA 1WHLA 1WQ7A 3EG9A 1KD1U 2YWWA 5C0MA 2DXUA 3SWNC 1UHFA 3CBPA 4ZGEB 3QWXX 2RHSA 4JRKA 1SETA 1W6XA 1NE8A 3LYIA 4H2YA 5KYNA 3CMEQ 4F16A 2C0IA 4OMQA 1UGQB 3CD6T 3G6EQ 2ED0A 1BKBA 1R8OB 4N4IA 3EFOB 4M75A 2IY5B 2JS0A 4J9CA 3TVTA 1KD1C 2HD0A 2P4RA 3P8BB 5D6YA 3VQVA 1VYTA 5LJ3f 2PUKB 1YGBA 3TEHA 3S3MA 1Y96A 5FWBA 5FU6C 2XKOC 3I5RA 1YJ9T 4C0DB 3A5ZA 4ZIBA 4QT7A 1LOJA 1PG5B 2W0ZA 2EYZA 4EMKC 4EO4A 1NLOC 2F2WA 2NUZA 4JS5A 2R58A 1JXOA 2VV5A 1VYVA 5IXBA 2ARTA 1NEGA 2E5QA 2RNAA 3G71A 1IRXA 1ABQA 4TVAA 1KMNA 1K73U 4O2DA 1WJRA 4HCCA 3MEUA 3NPFA 1GXIE 2L3RA 2ZIOA 2NUTA 3RACA 2DLPA 1VQLT 4P3OA 1TS9A 5LJ5g 3SB2A 2DK3A 1VQOA 4DPGA 4KR3A 4OP0A 3QDRB 2MK5A 3OBWA 2A28A 2P84A 3CCUT 5C51B 4QKUA 1H3ZA 1Q82C 3RUXA 3OYLA 1FX7A 4Z88A 2JM9A 2K5IA 3L2VA 1EOVA 1UGRB 4M75F 4MDWA 2P0PA 1G8XA 3RGLA 2CP5A 4B9XA 2DVJA 2FRYA 1A0NB 1OZ2A 2J06A 4WI1A 3X20B 2O9SA 2PVGB 3JCMg 3EGDB 1KOGA 3E9GA 3CCLT 1B34A 5KYXB 4V2SA 4G84A 4J9HA 2DD4A 4NCXA 2CP2A 1UJ0A 1EZZB 4J6YA 2CJAA 2LZ6B 5FRNA 1WU7A 1AT1B 1X75C 3VS5A 4J9EA 1LCKA 4QQDA 5GMKl 4BD3A 2ZZGA 2CP6A 4YRKA 2VXEA 2K79A 3CXCS 2LC4A 4P74C 1VQ6T 5FROA 4RQEA 3OYAA 3UPUA 2NWMA 2DO3A 3MEAA 2ABLA 5GAN8 1NJIC 2IY5A 1PM3A 2XDDA 3G1ZA 4ZGJB 5FU7C 1XNIA 2VUBA 4RG8A 5GAMf 1G83A 4XQ3A 1YI2T 2QA4Q 4M77A 2X3WD 1QCOA 3H6ZA 4DBHA 2G4CA 2RH2A 1C0MA 2YSQA 2NYSA 5IHNA 3QPHA 1KJWA 4BACA 1RAHB 1RACB 1YB3A 2MMPA 1W70A 1ZBXA 1PKSA 3P8TA 2ZR3A 5I11A 4IUQA 2RQWA 2GCXA 3HP9A 1B7YB 1M90U 1EIYA 2A37A 2XK0A 4M7DA 3VS3A 4FYYB 2ZPEB 3L4GA 1SSHA 1FXXA 1QVFA 1D0ZA 3SWNA 5KH6A 4KQEA 1YNZA 1VUBA 5GANg 1ZLMA 1RI0A 2RD1A 4PLIA 4XTWA 2I4MA 1VQ7A 2MIOA 2DKGA 2H8HA 2I0NA 2EGEA 3V7SA 4ZTZB 2IIMA 3QO3A 2CDTA 2A8EA 3G6EA 4G85A 3G71T 2A7YA 4UP7A 1AD5A 4HVCA 2EJFA 3CC2T 5GAOm 1YJWQ 2K57A 2CS7A 3QNEA 1RABB 2ARSA 3NTHA 4C8QF 5GANh 2QHTA 4CH5A 3TU4K 1VQLA 2ODRD 3MP6A 3PTAA 4Y28E 2CJBA 2WSFE 2J05A 2X9HA 5C6SA 4EIKA 4TWAA 1K9MR 4P72C 2NUTB 4X1VA 3HRIA 2E70A 3C95A 5CQYA 1M9SA 1VIEA 2JT4A 3G4SQ 3VS2A 2FZCB 4F04B 1UGVA 1M4ZA 3OYYA 2EWNA 3UWNA 1H641 2LRQA 1X01A 1OU9A 4OMFB 2GTOA 4LNPA 3G4SA 4JRPA 3HFZB 3EG2A 1KQ1A 1SEMA 1UJYA 4ZGDB 2F69A 4H2UA 5HK3A 1W1FA 8AT1B 4HWSA 3PMIA 2DNUA 2MYSA 3TEGA 1NYGA 4AFUC 1MMNA 1KQSS 3CCJT 2K3BA 3EFOA 1X55A 1FWZA 3V8LA 1NJ6A 2QQAA 1WLPB 4C0GA 4HVUA 3EAEA 2YRVA 2HBPA 2LQ8A 4PL6A 2FVUA 1QVPA 2QTXA 2OTLA 2E65A 3OYNA 3OW2S 4JZ4A 3JCMV 3T9NA 1M90C 3EGDA 2CUBA 4ZTJA 3OYKA 4C8QA 2BTTA 2KRMA 4J8OA 1YHQQ 2WACA 4E2FB 4FCYA 3JB9F 2ALYA 2RQRA 4YCUA 3MKDA 3CQTA 1X2QA 1B70B 1WA7A 2LQKA 3CCRT 2L5QA 2P0LA 2CP3A 3VRZA 4BWAA 1SF9A 2KSSA 4IIMA 1ASZA 1VQ6A 4C92G 4UPAA 1TTHB 2BE9B 5IXFA 4PJMA 4X5OA 4HXJA 1SHFA 3L2WA 4ORZA 9ATCB 4RCCA 3LH0A 4WJ3M 1VQNA 3X28B 1JJCB 4A4HA 4M77E 4M7AC 3A7AA 2KK4A 2LP5A 4IUTA 2QQRA 2ZT8A 2CSIA 1UHCA 1USYA 3NENA 3CCJQ 1ZA1B 2V8JA 5KYUA 4E7JA 1VQMQ 3IALA 1NYRA 2O4XB 1EIFA 2V8IA 1IGUA 1BI0A 2FZKB 4Z8AA 2EW3A 4RTZA 2ZCFB 1ZUYA 4JPBW 2OAUA 2DX1A 2DTOA 5I21A 4HT4A 2QK0A 3C4SA 1EFNA 1JJ2P 3MJXA 4PJOB 2DQ3A 2FZGB 5J3BA 3CMET 4P73A 3FB9A 3REXA 1IL2A 1UDLA 1WXTA 2AT1B 3OYDA 3QJ6A 4IKFA 2KAFA 1N9WA 1RLQC 1Z7NA 2LTOA 11ASA 1VOMA 4OB1B 4KH0B 2CH4W 3R07A 2DMOA 2PU9B 2KE9A 3V7RA 1NZ9A 4ZTFA 3DSQA 2KRSA 4E7SA 2P5IA 4FT4A 2DZ9A 2EYXA 3P8DA 2QEXT 2I2LA 4QQGA 4C0DC 1Y7XA 2X4WA 3UDCA 3J7AF 1SRYA 4LNSA 2EQMA 4L59A 4H2VA 1AZEA 2MI6A 1CKBA 2DZCA 5FU7B 3CCMA 5LJ3j 1JXMA 2ZPHB 1B7TA 2PZ1A 2DXCA 4DQ2A 1X6OA 4LD9K 2FO0A 4IUPA 3QBYA 1IHVA 3OY9A 2DJZA 4BY6C 5A0LA 1SHGA 1JO8A 2EGAA 4J9IA 2DL8A 1U8RA 1N9RA 4UP8A 4PJNA 4PJOC 1G3WA 1MUZA 3TQ7P 2GQIA 3L42A 4HT9A 3DLMA 4LDWA 4NOYA 4M7DB 2PMEA 2RJCA 4D8KA 2RHQA 3WQZA 2RM4A 2ZINA 3BDLA 3ZEHA 3I56T 1PYSA 4IUVA 2O01E 3X25B 4F17A 3S3NA 1YI2A 3OS0A 1BBZA 1OEBA 4GLKA 3NELA 5KYWB 1PKTA 1X6BA 4C8QC 3HFVA 4IIOA 4AMCA 3TSWA 2DAQA 4AFQC 4M75D 3JCMX 4A4GA 5AYFA 1GL5A 3CCJA 2D1XA 3ZL7C 5CCAA 5GAN5 4OB3B 3UA6A 2DFUA 1T0HA 4N4HA 2EAYA 1FYNA 2LX9A 2SRCA 2XTIA 3R6OA 4B9WA 3BE3A 2GFAA 3N5BB 1G5IA 4XTXA 2KQWA 2LCCA 4LVKA 3E9FA 3GNGA 1UTIA 3X24B 2HMAA 4PJOA 3OYIA 1ZX6A 5L8RE 5KE2A 1U1TA 2BUDA 1Q7YR 3HRUA 1CSKA 4A53A 2GQVA 3LWIA 3E2UA 1NJ5A 2IVWA 2OI3A 2KYMA 1YHQA 1YN8A 3PFSA 4PJOE 2Y4XA 4QVDA 1BB9A 1BIBA 2OJ2A 3OW2P 1VQ8T 2W10A 3LGFA 4LXCA 3M9QA 3KFVA 1VQ4T 4TVWA 1UFFA 1MMAA 1VQOT 1D0XA 1N5ZA 5CK9A 3INZA 4M7DE 3M0UA 5GAMd 2B8AA 3LH5A 1NYFA 4PHCA 1D09B 1M1GA 5K1PA 3CC4T 3PMTA 2ENMA 3TCJA 2M1HA 1ZA2B 2X4YA 4M75E 2O2OA 1Q7YU 3UA7A 4AH6A 4BDZA 4E7KA 1Z7MA 1VQPT 4M78D 1R0BG 1I0CA 4TVYA 1YWOA 5FWCA 4CI0C 4A63B 1RUWA 4PFZA 2EPDA 1K0XA 1Q86R 3HL8A 1OU8A 2QGFB 6AT1B 3EH2A 5LJ3h 2MCNA 1QVGA 1B07A 2BE7D 1RIQA 3I56Q 1RLPC 1YI2Q 4P73C 4F7UA 1IB8A 2LJ3A 4WF2A 3BY7A 4CS3A 5IAYA 2GNCA 3M0QA 3LSQA 1M3AA 3G7ZA 2M0YA 4P3NA 4GY5A 3HXWA 5I22A 4M77B 2CSQA 2HCKA 1OZ3A 2GBQA 1K8AC 1M90R 2PMFA 2BIVA 5J39A 5GAOr 2XHCA 3VJPA 3CPWA 1IGQA 4H2XB 2XDPA 2KEAA 3C94A 4JJCA 1YFNA 1G5VA 2VB6A 1VQ9A 1Y57A 1NEBA 2I4OA 1X2GA 2ARUA 2FYKA 4P5NA 1ABOA 1M2VA 2QA4T 1X43A 4AFZC 2J7IA 3M0PA 4HCBA 4P3PA 1G3YA 3GIBA 1KQSA 4HWTA 1PSFA 2DTHA 1M27C 3J81E 1QLYA 2Z0WA 5CKEA 4DBQA 2ZPGB 4IURA 2QHVA 5ELNA 2JOYA 4ZN3A 1U3OA 2CZ7B 2GTJA 4OGCA 2KVQG 3GNFB 1VQKQ 3HSBA 3MEYA 3M0TA 4J6WA 1FMVA 3HPWA 2LQNA 2COZA 4M78F 4KUDK 1ZHIA 4TTVA 1SERA 2B86A 2YUQA 4PFOA 1OPKA 2EVRA 3META 1OV3A 2M02A 3OYHA 2F2XA 1TUGB 1KQ2A 4E47A 5GAOp 3NFCA 2E3CA 2RI5A 1G3TA 1ZSZA 2CKKA 1ARKA 1NPRA 3P8HA 2M9UA 4RTVA 5LJ3g 4FU6A 1HC7A 1PRMC 2K7AA 1WHJA 2EQKA 2F1LA 4YRCA 3OYFA 4M7AG 4J9FA 4XU2A 2H3EB 2DE0X 4X9DA 5DLOA 4DBFA 3UGTA 2CGHA 1BYMA 3M4GA 1YJWT 5KNNA 3GP8A 2EKHA 5CKBA 5LJ5d 1QKWA 1D3BB 2FL7A 4BE2A 1IXDA 4M75B 1QQJA 3UH0A 1BIAA 2FPEA 1EQRA 4KGZB 1X69A 1SSFA 4KBMB 3BJUA 3PE0A 4YRJA 1KHIA 2FPDA 3JV3A 3TEHB 2ZCEA 1PD1A 1WXUA 1VQ8A 1RADB 4E7ZA 4ME7A 4TQDA 1Q82U 2DQ0A 2COYA 1NYQA 1U5SA 2EQIA 2HQXA 4HVVA 2MAMA 4CRIA 4YRQA 3H41A 1WPYA 4J5YA 2JMCA 2O31A 2DRKA 2A3LA 3EGXA 5DLQE 5KYWA 3IKLA 2J6FA 1MV0B 3HY0A 1NM7A 3DKMA 4ESRA 4BB7A 1BI2A 2NUPB 2O9VA 3HXUA 4RMFA 3ULRB 3NMZC 3REBB 1D1BA 1YP5A 1TXQA 3CPFA 3IG2A 2RK1A 2ESWA 3V8KA 1K8AU 4YRTA 4LVJA 4EX5A 4C8QD 2DYBA 4J83A 4C92B 3ME9A 2LT4A 1GBRA 12ASA 1C0AA 1VQ5Q 4J6XA 3HXZA 3IQLA 2AMCA 4FL6A 4M78B 4JLIA 2K5FA 2YUNA 4NS5A 3G6ET 2DL5A 4JZ3A 4LD6A 4M78G 1QP3A 1QF6A 1M3BA 1VQ8Q 2QEXA 1ASYA 4HCKA 1YCSB 3VKIA 1KHCA 1Q81U 4M77F 1NJ1A 1M1KC 4KH1B 3HY1A 4XTZA 2ZPFB 2E12A 4LVIA 1NPPA 4JJNK 2WSEE 1PHTA 1E24A 1YFRA 1HJDA 3OA6A 1Y0MA 3M53A 2QYZA 1H3HA 2D0QB 1QWFA 4FYWB 2E3HA 4QVCA 4ELYC 3MHXA 5D6WA 1W2BA 1USYC 1E22A 2KYBA 1YITA 2FEIA 3VQXA 2HNIA 4RCBA 1X56A 2VYTA 1I81A 4A4EA 4FW1A 2HKNA 3EFRA 4WCIA 1VQPQ 1D1CA 3LX7A 3CCSQ 2ECZA 3U23A 4ANJA 2BZXA 4C92C 1QW1A 1YJWA 1Q81C 5GAMe 3G1JA 5KCHA 4XEOA 1WGSA 1BCMA 4FM4B 2JTEA 2RA2A 3M0RA 1VQ5T 3CMEA 1KSWA 5A0GA 3PNWC 2A36A 3CC7T 1E6HA 3REUA 2ZNJA 1KQSP 4M7AB 3QO8A 2IG0A 2LX7A 2F5TX 2O88A 4EPCA 2X4JA 4OMLA 4EDUA 1TU0B 2AKWA 3VQYA 1JJCA 4X34A 2AHJB 3A74A 2Q7GA 4N0AC 1D1AA 2BKDN 3ASKA 3JCMe 2QQSA 1K73C 3RF1A 1MV3A 4NL3A 2RJFA 1UB4A 3QWYA 4NL2A 3CCQA 1S72T 4N4GA 2OAWA 3GBQA 3QZ9B 3FJPA 4OF1A 2ZT7A 3A5YA 1VQ9Q 3CMAT 1LVKA 1ADJA 4XU0A 4D6WA 1H4TA 4RKUE 2NUPA 4B6MA 3EH1A 2E41A 3UGQA 4PFPA 2E3IA 4C5GA 3SWNB 2DRMA 1K0SA 2ZTGA 1SPKA 2XI9A 4OLFA 2CH4A 2ALYB 3HTZA 1GBQA 1K76A 2EQUA 3SEMA 2ZIMA 1RAGB 2JMAA 3VS7A 3G71Q 3L1AA 3CCQT 4PK4A 1S72A 4MZPA 2XDBA 4C5IA 1Q7YC 4EMGA 1WIEA 3CCST 3JCMf 2LJ1A 1RAAB 2EYYA 4M7DD 1ZUUA 3H8ZA 3QHSA 4YREA 2OX7A 1N6AA 3A1PA 1K8AR 4LDYA 2I4LA 1I1JA 5EG2A 2LT1A 2F2VA 3NHNA 3EGXB 2DBMA 1EFWA 2PNIA 3E19A 1YCYA 3H0HA 1ZQ1A 2RHXA 4BI3A 4C92E 4P74A 1KMMA 5FU6B 2C0OA 2VVKA 2ED1A 3CCVT 1YIJT 4QW2A 3S6WA 4YRNA 1K1ZA 1M5Q1 3CCUA 4J9BA 3OYEA 2QGGA 5I2SA 3VYHB 3QTCA 4OMPA 1OQKA 1PNJA 3OQ5A 1JJ2S 4MZTA 1B76A 1NJIR 3VQWA 3CCLQ 1Q86C 2JW4A 3WXMB 3O8VA 3QUIA 1UE9A 3HFZA 4DOWA 1OI1A 4CC4B 1UGSB 2ZZDA 3FJ5A 2YRDA 4F14A 2RQVA 4M7DC 4PG3A 2Q7EA 2RI3A 3AT1B 1VQ4Q 1JQQA 3CCLA 4TQFA 1N8RC 1GRIA 1YJNA 4H2SA 4RTXA 2RI2A 1WNLA 3NGPA 3RKXA 1XQHA 1DJ7B 3RIRA 3SHWA 2EQJA 1C1AA 1Y71A 4M75C 1H4VB 2DIQA 1AZGB 2H3JA 4Q15A 4JJBA 4C8QG 4AFSC 3M4PA 3KXTA 2LDMA 5GAN3 2GFUA 3LW5E 3JCMQ 2CZ1B 4R55A 4R56A 2PTKA 1YIJQ 5LJ5h 4BUGA 1F1BB 3VV0A 1L0WA 5FLXE 3A8OB 2L89A 4M7AE 4M77G 2ZPBB 2K9GA 4C92D 2X4XA 1B7YA 1EIYB 2P0QA 4HWRA 1PCXA 3THKA 2IPOB 4AG1C 3JB9G 4LUEA 2HAXA 3PGGA 1HXDA 4C8QB 2X3XD 2C8MA 2XD0A 3H9NA 3LLRA 4P75A 3E9IA 3I55Q 2KR3A 1XTDA 4BY6B 2ZAEA 1VQOQ 3QO7A 1FMWA 2OTJT 2ZNIA 2KXDA 5GAN2 1GCQC 3CCQQ 2BZYA 4YDQA 3VS0A 1S1NA 1TH7A 3E1SA 2JZ2A 3MQZA 1W4SA 3D7SB 2HKQB 2R5MA 4K87A 2DIGA 4KUIA 3OYGA 1E1OA 1MNDA 3OS1A 4Y92A 1KC8C 2RPNA 5GAMh 3BDUA 1B8AA 4DOVA 1VQLQ 1YFTA 1ZSGA 2YUOA 1I5OB 3HFOA 2E5KA 4P71A 1RAEB 1P92A 2M51A 1OX9A 2C7IA 1JRIA 3M0SA 2E5AA 3TSZA 3KUFA 4F7UF 5ECAA 1M1FA 1N27A 3PCOB 2QAZA 2HBWA 3EFSA 3OS2A 3L2QA 4BDYA 1GCPA 2CYZB 4HKEA 3CCSA 3JCMW 2KMTA 3A32A 1ZSZC 4GLMA 1MMDA 1UGPB 2XGTA 1ACMB 1NJ2A 2RN8A 3RBBB 4KR2A 1YJNQ 4KULA 3JCMb 5CQXA 4OB0B 5I2MA 2CJ9A 1BCOA 1SKUB 1RAFB 1QVFP 5LJ5f 1ZSZB 2VKNA 2EIFA 4UP9A 3EHRA 4O5VA 4YRFA 5GAN7 2A08A 3CC2A 3ICAA 2VASA 1QMCA 2DL3A 5HY6A 5AT1B 2RK2A 3RMQA 2K2VA 1CKAA 3GF5A 4FYXB 4MZMA 2ATCB 1YIJA 2J3MA 4K11A 1ZUKA 2HSPA 3HFNA 3QDFA 1M8VA 1TG0A 2E64A 1AVZC 2QHUA 1T3LA 3HRTA 3RERA 1XJWB 4CS2A 1GCQA 2XG8D 4M7DG 3A8HB 2LVMA 2R5AA 3A5ZB 2XU8A 5C52B 2YDLA 1Y96B 4YRGA 4LUDA 5HK0A 4M75G 4CH3A 2D9TA 1YJ9Q 1XOVA 4Z89A 5LL6S 1QCNA 1VQ7T 4CH4A 2HDAA 1WYDA 2P4TA 1YJNT 1Q82R 1OX8A 2AK5A 1C6VX 2K5LA 4KGVB 4PLLA 1YWPA 1AWWA 4E7IA 3M5AA 2P0KA 2LNHB 2FHDA 1PC0A 1TUDA 4PJJA 3RKWA 2DA9A 3Q1JA 3HXXA 3I55T 2RHSB 5DY9A 2RQTA 3FIFA 3RMSA 2QDYB 1EVKA 3P8VA 1T0JA 2KT8A 4PJOG 3VU3C 1UEBA 2RO0A 4A4KA 3E9HA 2DYIA 2Y90A 3TEEA 4YRMA 2ZZEA 2DF6A 2COWA 2AIRB 4FT2A 2L3QA 2V1QA 3ZBDA 3SDZA 4XTYA 4BI8B 1K73R 5GMKh 4E6RA 5A2QE 2EKOA 4CC7A 3MP8A 4VUBA 3CBMA 3EG9B 4DEXA 5D7UA 2RJEA 1W66A 4TVRA 1WX6A 1PSEA 3MF1A 2E4HA 2MWPA 1HD3A 3HXVA 2JN0A 3BW1A 2HQEA 3EG0A 1U1SA 2KGTA 2QEXQ 1OYXA 2RHUA 2JVVA 2V8KA 1K9AA 4R0KA 1Q81R 2QHSA 3VRYA 3CD6A 3CCEQ 3SD4A 4LDVA 3A31A 4XTUA 1YBYA 4JDSA 4CS4A 2HQHA 4J15A 7AT1B 3JB9D 2CZ0B 2L0AA 3HHTB 5L23A 4YYEA 4ELZC 3PZCA 3QKJA 2C0TA 2V1RA 1QWEA 1VQ5A 2MWOA 2PQWA 5A0DA 2A0FB 4QQ6A 3HRKA 1T3SA 4RG2A 1BI1A 2KY9A 1BK2A 4CC2A 5K1XA 2AZVA 2DU7A 1PD0A 4J7FA 2QASA 4OB2B 4OMOA 3PVLA 3H0IA 3JB9H 4E7HA 1X54A 5GJVB 2DM1A 3GPLA 2GF7A 1QVGP 1RI9A 4KT0E 1ADYA 2ZT5A 3O5ZA 4F7UG 1JJ2A 4QVZA 1IREB 1N8RR 1YITT 1WJQA 3CEYA 3CC7A 4XTVA 2J6KA 1I5LA 3PVQA 1SG5A 3A8MB 2DVEA 3FRNA 4FIBA 3OYCA 3GOXA 2RB6A 1M30A 1VQKT 2RMOA 3JCMc 4BE0A 2QXFA 3A8LB 2JTMA 5GJWB 1PRLC 5IHKA 1MGQA 3CCRQ 3EG3A 1OOTA 2QA4A 1KFZA 4A54A 3A98A 2JTFA 4JLGA 2NS6A 4RTUA 4YTLA 5LJ5j 4MMKA 1WZOA 4PJLA 4DA4A 2DJQA 2YT6A 2M0OA 2RQUA 3WVEB 3NTIA 1IZ6A 4KGXB 4PJOF 4EMHA 1WLEA 1WFWA 1B70A 3PT9A 4H2WA 1PYSB 1M2OA 3FC3A 3QYHB 3R6NA 2QQ9A 1LPLA 1QCFA 2KROA 2EJGA 1X6GA 1H8KA 3M55A 2YRCA 1RAIB 2VC8A 4DBRA 1AWJA 3V8JA 3MCAB 3AHUA 4BI4A 2VXFA 3KBGA 2EJ9A 2QDLA 2ZPIB 4LDUA 2KT1A 4RMOA 5GAOl 3FEOA 2K2MA 5D6XA 1LYLA 1M2VB 3OW2A 3M57A 2HL3A 2DD5A 2Q5HA 5HGQA 2J6OA 1OPLA 3LWHA 2JM8A 1I07A 1M1KU 3REAB 1WHMA 2AKLA 2E10A 1BBUA 4HVWA 4M7AD 1KG1A 5FRMA 2CUDA 3OB9A 2DU5A 4M7AA 3CXCP 2C06A 3CCMT 1YHQT 2F5KA 1VQ4A 1W2BP 4LVLA 5KE3A 2DDZA 1X2KA 3CPWS 3CMAQ 1E7OA 2EFIA 4C0ZA 1BBWA 1NJ8A 5C53B 2RHZA 2XICA 3OSVA 4F7UB 4HA8A 3TREA 1N8RU 3PIPA 2JJ9A 3F70A 1WHKA 1QVFS 2FRWA 4H2TA 3CMAA 5F5WA 3CC7Q 2LMJA 3RDVA 1WI7A 3OYMA 1TUCA 3CC4A 2CIMA 5CO7A 3X26B 3CCUQ 1WHGA 2ROTA 5ELOA 4XEMA 1VA7A 1D3BA 5EC7A 2YLBA 3M58A 4PJOD 5GAN4 3NTKA 1O75A 4RUGA 3ZFJA 2KRNA 2ZT6A 2JNGA 3QIIA 4RTYA 4EMKA 1EX4A 3A8GB 5GAOq 4J7IA 4JRQA 4OMNA 4II1A 4WJ4A 1MNEA 4C8QE 1HTTA 4YRRA 2QG9B 2ZXFA 2RJDA 3HXYA 3I7FA 2DERA 1BU1A 4M78E 1UUEA 4XAXB 4CC3A 2Q5IA 2YXYA 3W3SA 5CKFA 2MF2A 4C92A 3L4GB 5CKHA 1VQZA 4H02A 1MHNA 5LJ3d 1V1CA 1M3CA 4P71C 2VWFA 3EHQA 2BZ8A 2E6NA 2EGCA 1D0YA 3VYGA 5DM7R 3I56A 1WXBA 3KFUA 2DXTA 1BI3A 3M4YA 1TWBA 2YUPA 3OD1A 2DL7A 2K3XA 1UG1A 2VGNA 2ZGWA 3OS5A 4UC4A 2AZSA 3L2ZA 5GANd 1SRLA 3JAME 1QVGS 2RF0A 4HCZA 2FG0A 2OTLQ 2KNBB 4JRIA 3RNJA 1AWOA 3CCMQ 4DEYA 2FPFA 1OULA 5KYYA 1JU5C 1UECA 2OTJA 2DEUA 3CCEA 1KD1R 1WYXA 1FYFA 3JCMP 3QSUA 1J3TA 3LGLA 5KYYB 3NEMA 1M1KR 1AEYA 1VIFA 2D6FA 1G3SA 5J26A 4J9DA 2JS2A 1G51A 4OVAA 2HSEB 2LNVA 1Z9QA 4L87A 3JCMJ 4XU3A 1B3QA 1VQNT 2KI7A 5IHIA 4YRSA 3ER0A 3OMGA 4Z02A 1VQPA 2JUFA 2RHQB 4YRPA 1K9MU 3URGA 4ZNXA 4LDXA 2E1HA 3QXEB 4Q5WA 1YFSA 4JJDA 1Z9ZA 3MEWA 2KDSA 1YITQ 3QG1A 2QTVA 1PWTA 3QO5A 3I35A 2EYQA 8ATCB 3L2UA 5GAOn 1EVLA 3M54A 1GFCA 1KIKA 4WTOB 3CCVA 2PVDB 3EG1A 2DETA 1X2HA 4GBQA 4M7DF 1JEGA 4IUUA 2WSCE 2G6FX 4M77C 4A4FA 3M4QA 1QP2A 4L6V5 4FYVB 1E6GA 4FSSA 3CBOA 2K4YA 5FW9A 1IO6A 1MMGA 4YPFA 2ZZFA 2CREA 3HKSA 2OTJQ 3DB4A 2RHIA 2DXBA 2ODRC
chains in the Genus database with same CATH topology
3A7UA 5GMKe 1N9SA 2PUOB 2L8DA 2XIDA 1SESA 3PIOA 2K3YA 2G3RA 5GMKm 3SFMA 3MP1A 4CH6A 2DEQA 4TVAB 3HRSA 4K88A 1W2BS 3MF2A 5GMKj 1VQKA 4MDXA 5CIUA 4ATOA 2RHYA 3MO8A 1KC8U 3PCOA 4H2XA 3G4ST 2Q7HA 4ZN1A 4Q6GA 3M59A 4C5HA 4YRIA 3QZ5B 2QQBA 4FSXA 1ATIA 2YHTA 4BE1A 1WQWA 3C12A 3DLLA 3QJYA 5CVIA 3J80E 5E3IA 2OTLT 3JCMd 2NLUA 1VQ9T 2R57A 2X35A 5GAN6 1WJSA 4M78A 1Y07A 1K9MC 5GANe 3JRZA 3FDRA 4O6JA 5HKCA 1G5HA 4YRLA 4F7UE 2DPPB 4HWPA 3I55A 4HT8A 3JB9I 1B34B 3GLXA 5LJ3e 4RDXA 1VQMA 1QE0A 3V7CA 2E6ZA 2AKWB 3OYJA 3VBBA 3UFGA 5GANj 3RL6A 5CR2A 3UT1A 3JSCA 1E1TA 4E7LA 4L5GA 4M77D 1JBMA 3P8YA 3LSSA 1NJIU 2EL9A 3FLGA 4P72A 3M56A 5IN1A 4YCWA 1LJOA 3IKMB 4JUVA 1I4K1 1YJ9A 3CMQA 5CKDA 2M16A 3BFMA 2J3LA 4M78C 3CCET 4EMKB 1Q86U 4K86A 2PVOB 2FB7A 5CAIA 4E51A 2YLCA 4N0AA 4C92F 2I4NA 3NETA 3CXCA 3RKYA 4Y91A 4BW9A 1I8FA 5GAMg 3S3OA 4X9CA 2CZ6B 4C0FA 1RL2A 2QI2A 5IT9E 4YCVA 3OBYA 5LJ5e 1V29B 1GGMA 1HK9A 1AHJB 3L2RA 3DB3A 5KCOA 4YP0A 4PKCC 1H4QA 3MEVA 5M9OA 3OYBA 4MMLA 5GAMj 3QYGB 3RESA 4P75C 4LVMA 3JB9J 2O4XA 3OMCA 2AMCB 4HWOA 2LCLA 2DTIA 4JS4A 1O9SA 2ZR2A 2VGMA 4OGEA 3JCMh 1NNHA 3VUBA 4ZTUB 5GANf 3ERRA 3TUPA 1H4SA 5GMKi 3CCRA 4C5EA 2Y4YA 4XU1A 3VUZA 4M7AF 1J5WA 4YROA 4RQFA 3OSSC 4PNOA 4XK8E 3A7RA 1LNXA 1JB0E 3LC0A 1VQMT 3WVDB 1WQ7A 1KD1U 5C0MA 2DXUA 3SWNC 3CBPA 4ZGEB 2RHSA 4JRKA 1SETA 1NE8A 3LYIA 4H2YA 3CD6T 1UGQB 1BKBA 1R8OB 4N4IA 4M75A 2IY5B 1KD1C 2HD0A 3P8BB 5D6YA 3VQVA 5LJ3f 2PUKB 1YGBA 3TEHA 3S3MA 1Y96A 5FU6C 2XKOC 1YJ9T 4C0DB 3A5ZA 4ZIBA 1LOJA 4EMKC 4EO4A 4JS5A 2R58A 2VV5A 2ARTA 2E5QA 3G71A 4TVAA 1KMNA 1K73U 4O2DA 1WJRA 4HCCA 3MEUA 1GXIE 2L3RA 2ZIOA 3RACA 1VQLT 4P3OA 5LJ5g 3SB2A 2DK3A 1VQOA 4DPGA 4KR3A 4OP0A 3QDRB 3OBWA 5C51B 3CCUT 1H3ZA 1Q82C 3RUXA 3OYLA 1FX7A 2K5IA 3L2VA 1EOVA 1UGRB 4M75F 4MDWA 2P0PA 3RGLA 4B9XA 1OZ2A 4WI1A 3X20B 2PVGB 3JCMg 1KOGA 3E9GA 3CCLT 1B34A 4V2SA 4G84A 2DD4A 4NCXA 4J6YA 2CJAA 5FRNA 1WU7A 1X75C 4QQDA 5GMKl 4BD3A 2ZZGA 4YRKA 2VXEA 3CXCS 2LC4A 4P74C 1VQ6T 5FROA 4RQEA 3OYAA 3UPUA 2DO3A 3MEAA 5GAN8 1NJIC 2IY5A 2XDDA 3G1ZA 4ZGJB 5FU7C 1XNIA 2VUBA 4RG8A 5GAMf 4XQ3A 1YI2T 4M77A 3H6ZA 2G4CA 2RH2A 3QPHA 4BACA 1YB3A 2MMPA 1ZBXA 3P8TA 2ZR3A 4IUQA 2GCXA 3HP9A 1B7YB 1M90U 1EIYA 2XK0A 4M7DA 2ZPEB 3L4GA 1FXXA 1QVFA 3SWNA 5KH6A 4KQEA 1VUBA 5GANg 1RI0A 2RD1A 4PLIA 4XTWA 2I4MA 1VQ7A 2DKGA 3V7SA 4ZTZB 3QO3A 2A8EA 3G6EA 4G85A 3G71T 2A7YA 4UP7A 4HVCA 2EJFA 3CC2T 5GAOm 2K57A 2CS7A 3QNEA 2ARSA 3NTHA 4C8QF 5GANh 2QHTA 4CH5A 3TU4K 1VQLA 2ODRD 3MP6A 3PTAA 4Y28E 2CJBA 2WSFE 5C6SA 4TWAA 4P72C 3HRIA 2E70A 3C95A 5CQYA 1M9SA 1VIEA 1M4ZA 3OYYA 2EWNA 3UWNA 1H641 2LRQA 1X01A 4OMFB 3G4SA 4JRPA 3HFZB 1KQ1A 4ZGDB 2F69A 4H2UA 5HK3A 4HWSA 3PMIA 3TEGA 1KQSS 3CCJT 1X55A 1FWZA 3V8LA 1NJ6A 2QQAA 4C0GA 3EAEA 2YRVA 2HBPA 2LQ8A 4PL6A 2FVUA 1QVPA 2QTXA 2OTLA 2E65A 3OYNA 3OW2S 3JCMV 3T9NA 1M90C 4ZTJA 3OYKA 4C8QA 4J8OA 2WACA 3JB9F 2ALYA 4YCUA 1B70B 2LQKA 3CCRT 2L5QA 2P0LA 4BWAA 2KSSA 1ASZA 1VQ6A 4C92G 4UPAA 4X5OA 3L2WA 4RCCA 3LH0A 4WJ3M 1VQNA 3X28B 1JJCB 4A4HA 4M77E 4M7AC 3A7AA 2KK4A 4IUTA 2QQRA 2ZT8A 1USYA 3NENA 2V8JA 4E7JA 3IALA 1NYRA 2O4XB 1EIFA 2V8IA 1BI0A 2ZCFB 2OAUA 2DTOA 5I21A 4HT4A 3C4SA 4PJOB 2DQ3A 5J3BA 3CMET 4P73A 3FB9A 3REXA 1IL2A 3OYDA 3QJ6A 4IKFA 2KAFA 1N9WA 1Z7NA 2LTOA 11ASA 4OB1B 3R07A 2PU9B 3V7RA 1NZ9A 4ZTFA 3DSQA 2P5IA 4FT4A 2DZ9A 3P8DA 2QEXT 2I2LA 4QQGA 4C0DC 1Y7XA 2X4WA 3UDCA 3J7AF 1SRYA 4LNSA 2EQMA 4L59A 4H2VA 2MI6A 2DZCA 5FU7B 3CCMA 5LJ3j 2ZPHB 2DXCA 4DQ2A 1X6OA 4LD9K 4IUPA 3QBYA 3OY9A 2DJZA 4BY6C 5A0LA 1U8RA 1N9RA 4UP8A 4PJOC 1G3WA 3L42A 4HT9A 3DLMA 4LDWA 4NOYA 4M7DB 2PMEA 2RJCA 2RHQA 3WQZA 2RM4A 2ZINA 3BDLA 3ZEHA 3I56T 1PYSA 4IUVA 2O01E 3X25B 3S3NA 1YI2A 3OS0A 4GLKA 3NELA 3HFVA 4C8QC 2DAQA 4M75D 3JCMX 4A4GA 5AYFA 3CCJA 5CCAA 5GAN5 4OB3B 4N4HA 2EAYA 2LX9A 2XTIA 3R6OA 4B9WA 2GFAA 3N5BB 1G5IA 4XTXA 2KQWA 2LCCA 4LVKA 3E9FA 3GNGA 3X24B 4PJOA 3OYIA 5L8RE 5KE2A 1U1TA 2BUDA 3HRUA 4A53A 2GQVA 3LWIA 1NJ5A 2IVWA 1YHQA 3PFSA 4PJOE 2Y4XA 4QVDA 1BIBA 1VQ8T 3LGFA 3M9QA 1VQ4T 4TVWA 1VQOT 5CK9A 3INZA 4M7DE 5GAMd 2B8AA 4PHCA 1M1GA 5K1PA 3CC4T 3PMTA 3TCJA 2M1HA 2X4YA 4M75E 1Q7YU 4AH6A 4BDZA 4E7KA 1Z7MA 1VQPT 4M78D 4TVYA 4CI0C 3HL8A 5LJ3h 1QVGA 1RIQA 4P73C 4F7UA 4WF2A 3BY7A 4CS3A 5IAYA 3LSQA 3G7ZA 4P3NA 4GY5A 3HXWA 4M77B 1OZ3A 1K8AC 2PMFA 2BIVA 5J39A 5GAOr 2XHCA 3VJPA 3CPWA 4H2XB 2XDPA 3C94A 1G5VA 1VQ9A 2I4OA 1X2GA 2ARUA 2FYKA 4P5NA 2QA4T 4P3PA 4HCBA 1G3YA 3GIBA 4HWTA 1KQSA 1PSFA 2DTHA 3J81E 5CKEA 2ZPGB 4IURA 2QHVA 5ELNA 2JOYA 4ZN3A 2CZ7B 4OGCA 2KVQG 3GNFB 3HSBA 3MEYA 4J6WA 3HPWA 4M78F 4KUDK 1ZHIA 4TTVA 1SERA 3META 3OYHA 1KQ2A 4E47A 5GAOp 3NFCA 2E3CA 2RI5A 1G3TA 2CKKA 1NPRA 3P8HA 2M9UA 5LJ3g 4FU6A 1HC7A 2EQKA 4YRCA 3OYFA 4M7AG 4XU2A 4X9DA 5DLOA 3UGTA 2CGHA 1BYMA 3M4GA 1YJWT 5KNNA 3GP8A 5CKBA 5LJ5d 1D3BB 2FL7A 4BE2A 4M75B 3UH0A 1BIAA 1EQRA 1SSFA 4KBMB 3BJUA 4YRJA 1KHIA 3TEHB 2ZCEA 1VQ8A 4ME7A 4TQDA 2ODRC 1Q82U 2DQ0A 1NYQA 2HQXA 2MAMA 4CRIA 4YRQA 1WPYA 4J5YA 2A3LA 5DLQE 3IKLA 3HY0A 3DKMA 4BB7A 1BI2A 3HXUA 4RMFA 3CPFA 3IG2A 2RK1A 3V8KA 1K8AU 4YRTA 4LVJA 4EX5A 4C8QD 4J83A 4C92B 3ME9A 2LT4A 12ASA 1C0AA 3HXZA 4J6XA 2AMCA 4FL6A 4M78B 4JLIA 2K5FA 4NS5A 3G6ET 4LD6A 4M78G 1QP3A 1QF6A 2QEXA 1ASYA 3VKIA 1KHCA 1Q81U 1NJ1A 4M77F 1M1KC 3HY1A 4XTZA 2ZPFB 2E12A 4LVIA 1NPPA 4JJNK 2WSEE 1E24A 1YFRA 3OA6A 3M53A 2D0QB 4QVCA 4ELYC 3MHXA 5D6WA 1W2BA 1USYC 1E22A 1YITA 3VQXA 2HNIA 4RCBA 1X56A 2VYTA 1I81A 4A4EA 3EFRA 3LX7A 4C92C 1QW1A 1YJWA 1Q81C 5GAMe 5KCHA 4XEOA 1WGSA 4FM4B 2RA2A 1VQ5T 3CMEA 5A0GA 3PNWC 3CC7T 3REUA 2ZNJA 4M7AB 3QO8A 2IG0A 2F5TX 4EPCA 2X4JA 4EDUA 2AKWA 3VQYA 1JJCA 4X34A 2AHJB 3A74A 2Q7GA 4N0AC 2BKDN 3ASKA 3JCMe 2QQSA 1K73C 3RF1A 4NL3A 2RJFA 1UB4A 4NL2A 3CCQA 1S72T 4N4GA 3QZ9B 3FJPA 4OF1A 2ZT7A 3A5YA 3CMAT 1ADJA 4XU0A 4D6WA 1H4TA 4RKUE 3UGQA 2E41A 4C5GA 3SWNB 2ZTGA 2XI9A 4OLFA 2ALYB 3HTZA 2EQUA 2ZIMA 3L1AA 3CCQT 1S72A 4MZPA 2XDBA 4C5IA 1Q7YC 4EMGA 3CCST 3JCMf 4M7DD 3H8ZA 3QHSA 4YREA 1N6AA 4LDYA 2I4LA 5EG2A 2LT1A 1EFWA 3E19A 1YCYA 4P74A 1ZQ1A 2RHXA 4BI3A 4C92E 1KMMA 5FU6B 3CCVT 1YIJT 4QW2A 3S6WA 4YRNA 1M5Q1 3CCUA 3OYEA 5I2SA 3VYHB 3QTCA 3OQ5A 1JJ2S 4MZTA 1B76A 3VQWA 1Q86C 3WXMB 3O8VA 3QUIA 3HFZA 4DOWA 1OI1A 4M7DC 1UGSB 2ZZDA 4PG3A 2Q7EA 2RI3A 3CCLA 4TQFA 1N8RC 1YJNA 4H2SA 2RI2A 1WNLA 3RKXA 1XQHA 1DJ7B 3RIRA 2EQJA 1Y71A 4M75C 1H4VB 2DIQA 2H3JA 4Q15A 4C8QG 3M4PA 3KXTA 2LDMA 5GAN3 2GFUA 3LW5E 3JCMQ 2CZ1B 4R55A 4R56A 5LJ5h 4BUGA 3VV0A 1L0WA 5FLXE 3A8OB 2L89A 4M7AE 4M77G 2ZPBB 4C92D 1EIYB 2X4XA 1B7YA 2P0QA 4HWRA 3JB9G 2HAXA 3PGGA 1HXDA 4C8QB 2C8MA 2XD0A 3LLRA 4P75A 3E9IA 1XTDA 4BY6B 3QO7A 2OTJT 2ZNIA 5GAN2 4YDQA 1TH7A 3E1SA 2JZ2A 3MQZA 1W4SA 2R5MA 4K87A 2DIGA 4KUIA 3OYGA 1E1OA 3OS1A 1KC8C 5GAMh 3BDUA 1B8AA 4DOVA 1YFTA 3HFOA 4P71A 1P92A 2C7IA 1JRIA 2E5AA 3KUFA 4F7UF 1M1FA 1N27A 3PCOB 3EFSA 3OS2A 3L2QA 4BDYA 2CYZB 4HKEA 3CCSA 3JCMW 2KMTA 3A32A 1UGPB 2XGTA 1NJ2A 4KR2A 4KULA 3JCMb 5CQXA 4OB0B 5I2MA 2CJ9A 5LJ5f 2EIFA 4UP9A 4O5VA 4YRFA 5GAN7 3CC2A 3ICAA 5HY6A 2RK2A 3RMQA 2K2VA 3GF5A 4MZMA 1YIJA 2J3MA 1M8VA 3HFNA 2E64A 2QHUA 3HRTA 3RERA 4CS2A 2XG8D 4M7DG 3A8HB 2LVMA 2R5AA 3A5ZB 2XU8A 5C52B 1Y96B 4YRGA 5HK0A 4M75G 4CH3A 2D9TA 1XOVA 5LL6S 1VQ7T 4CH4A 1WYDA 2P4TA 1YJNT 2K5LA 4PLLA 4E7IA 3M5AA 2P0KA 2FHDA 3RKWA 3Q1JA 3HXXA 3I55T 2RHSB 5DY9A 3FIFA 3RMSA 2QDYB 1EVKA 3P8VA 4PJOG 3VU3C 1UEBA 2RO0A 4A4KA 3E9HA 2Y90A 3TEEA 4YRMA 2ZZEA 4FT2A 3ZBDA 3SDZA 4XTYA 4BI8B 5GMKh 5A2QE 2EKOA 3MP8A 4VUBA 3CBMA 2RJEA 1W66A 4TVRA 1PSEA 3MF1A 2MWPA 3HXVA 2JN0A 3BW1A 2HQEA 1U1SA 1OYXA 2RHUA 2JVVA 2V8KA 2QHSA 3CD6A 3SD4A 4LDVA 3A31A 4XTUA 1YBYA 4JDSA 4CS4A 4J15A 4YYEA 3JB9D 2CZ0B 3HHTB 4ELZC 3PZCA 3QKJA 1VQ5A 2MWOA 2PQWA 5A0DA 4QQ6A 3HRKA 4RG2A 1BI1A 2KY9A 5K1XA 2DU7A 4J7FA 4OB2B 3JB9H 4E7HA 1X54A 3GPLA 2GF7A 4KT0E 1ADYA 2ZT5A 4F7UG 1JJ2A 4QVZA 1IREB 1YITT 1WJQA 3CEYA 3CC7A 4XTVA 1I5LA 3A8MB 2DVEA 3FRNA 4FIBA 3OYCA 3GOXA 2RB6A 1VQKT 3JCMc 4BE0A 2QXFA 3A8LB 2JTMA 1MGQA 2QA4A 4A54A 2JTFA 4JLGA 2NS6A 4YTLA 5LJ5j 4MMKA 4DA4A 2M0OA 3WVEB 3NTIA 1IZ6A 4PJOF 4EMHA 1WLEA 1B70A 3PT9A 4H2WA 1PYSB 3FC3A 3QYHB 2QQ9A 2EJGA 3M55A 2VC8A 3V8JA 3MCAB 3AHUA 4BI4A 2VXFA 3KBGA 2EJ9A 2ZPIB 4LDUA 4RMOA 5GAOl 3FEOA 5D6XA 1LYLA 3OW2A 3M57A 2DD5A 2Q5HA 5HGQA 3LWHA 1M1KU 2E10A 1BBUA 4M7AD 1KG1A 5FRMA 2DU5A 3OB9A 4M7AA 2C06A 3CCMT 1YHQT 2F5KA 1VQ4A 4LVLA 5KE3A 2DDZA 3CPWS 2EFIA 4C0ZA 1BBWA 1NJ8A 5C53B 2RHZA 2XICA 3OSVA 4F7UB 4HA8A 3TREA 1N8RU 3PIPA 3F70A 1QVFS 4H2TA 3CMAA 5F5WA 3OYMA 3CC4A 2CIMA 5CO7A 3X26B 5ELOA 1D3BA 2YLBA 3M58A 4PJOD 5GAN4 3NTKA 1O75A 3ZFJA 2ZT6A 2JNGA 3QIIA 4EMKA 3A8GB 5GAOq 4J7IA 4JRQA 4II1A 4WJ4A 4C8QE 1HTTA 4YRRA 2ZXFA 2RJDA 3HXYA 3I7FA 4M78E 4XAXB 2Q5IA 3W3SA 5CKFA 2MF2A 4C92A 3L4GB 5CKHA 1VQZA 4H02A 1MHNA 5LJ3d 4P71C 2E6NA 3VYGA 5DM7R 3I56A 3KFUA 2DXTA 1BI3A 3M4YA 3OD1A 2K3XA 2VGNA 2ZGWA 3OS5A 4UC4A 3L2ZA 5GANd 3JAME 1QVGS 4HCZA 4JRIA 2OTJA 3CCEA 1FYFA 3JCMP 3QSUA 3LGLA 3NEMA 1VIFA 2D6FA 1G3SA 5J26A 1G51A 4OVAA 2LNVA 4L87A 3JCMJ 4XU3A 1VQNT 4YRSA 3ER0A 3OMGA 4Z02A 1VQPA 2JUFA 2RHQB 4YRPA 1K9MU 3URGA 4LDXA 2E1HA 3QXEB 4Q5WA 1YFSA 3MEWA 2KDSA 3QG1A 3QO5A 2EYQA 3L2UA 5GAOn 1EVLA 3M54A 3CCVA 2PVDB 1X2HA 4M7DF 4IUUA 2WSCE 4M77C 4A4FA 3M4QA 1QP2A 4L6V5 3CBOA 2K4YA 4YPFA 2ZZFA 3HKSA 3DB4A 2RHIA 2DXBA 4XEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJB A;  3A7U A;  5GMK e;  1N9S A;  2QHU A;  3RER A;  1SES A;  5LJ3 g;  4CS2 A;  1HC7 A;  4TWA A;  4P72 C;  4M7D G;  3HRI A;  4YRC A;  4M7A G;  5GMK m;  4XU2 A;  4X9D A;  4CH6 A;  2DEQ A;  4TVA B;  5C52 B;  4K88 A;  1Y96 B;  3MF2 A;  2CGH A;  2EWN A;  3UGT A;  4YRG A;  5GMK j;  4M75 G;  4CH3 A;  1H64 1;  3M4G A;  5KNN A;  1X01 A;  4CH4 A;  1WYD A;  3PCO A;  5LJ5 d;  1D3B B;  4H2X A;  2Q7H A;  4M75 B;  4Q6G A;  3UH0 A;  1BIA A;  3HFZ B;  1KQ1 A;  4YRI A;  1EQR A;  1ATI A;  4H2U A;  2YHT A;  3BJU A;  1WQW A;  4YRJ A;  4HWS A;  3RKW A;  3HXX A;  3TEH B;  2RHS B;  3TEG A;  2ZCE A;  5DY9 A;  5E3I A;  3FIF A;  3JCM d;  4TQD A;  1EVK A;  3P8V A;  2DQ0 A;  4PJO G;  3VU3 C;  5GAN 6;  1NYQ A;  4YRQ A;  3E9H A;  1WPY A;  4M78 A;  4J5Y A;  1X55 A;  2Y90 A;  4YRM A;  3V8L A;  2ZZE A;  1NJ6 A;  5GAN e;  3IKL A;  4XTY A;  1G5H A;  3HY0 A;  4YRL A;  4F7U E;  5GMK h;  4HT8 A;  4HWP A;  2QTX A;  3HXU A;  4RMF A;  2E65 A;  3JB9 I;  1B34 B;  5LJ3 e;  3JCM V;  4RDX A;  1W66 A;  3IG2 A;  4C8Q A;  3V8K A;  4YRT A;  3MF1 A;  4EX5 A;  1QE0 A;  4C8Q D;  3V7C A;  3JB9 F;  2ALY A;  3HXV A;  4YCU A;  1B70 B;  4C92 B;  2JN0 A;  2AKW B;  3BW1 A;  3VBB A;  1U1S A;  5GAN j;  3RL6 A;  12AS A;  2P0L A;  3UFG A;  1C0A A;  4J6X A;  1E1T A;  3HXZ A;  4BWA A;  4M77 D;  1ASZ A;  2QHS A;  1JBM A;  4C92 G;  2AMC A;  4UPA A;  3A31 A;  4XTU A;  3P8Y A;  4CS4 A;  4X5O A;  4M78 B;  4J15 A;  4YYE A;  3JB9 D;  4JLI A;  3LSS A;  4RCC A;  3PZC A;  2EL9 A;  4M78 G;  4P72 A;  1QF6 A;  4YCW A;  4WJ3 M;  1ASY A;  1LJO A;  3IKM B;  1JJC B;  3HRK A;  4M77 E;  4JUV A;  4M7A C;  3A7A A;  1I4K 1;  4M77 F;  1NJ1 A;  3CMQ A;  3HY1 A;  5K1X A;  3BFM A;  2DU7 A;  2J3L A;  2ZT8 A;  4M78 C;  4XTZ A;  4EMK B;  4K86 A;  1USY A;  3NEN A;  3JB9 H;  2FB7 A;  1X54 A;  5CAI A;  4E51 A;  1E24 A;  1YFR A;  3IAL A;  1NYR A;  2YLC A;  4N0A A;  4C92 F;  2I4N A;  3NET A;  3RKY A;  4Y91 A;  4BW9 A;  1ADY A;  2ZT5 A;  4F7U G;  2DTO A;  1I8F A;  4QVC A;  5I21 A;  5GAM g;  4X9C A;  1USY C;  1E22 A;  4PJO B;  2DQ3 A;  4YCV A;  2HNI A;  4RCB A;  4XTV A;  1X56 A;  3VQX A;  5LJ5 e;  1I5L A;  1I81 A;  4P73 A;  3FB9 A;  3REX A;  1IL2 A;  1GGM A;  1HK9 A;  2DVE A;  3EFR A;  2RB6 A;  1N9W A;  3JCM c;  1Z7N A;  4C92 C;  11AS A;  4YP0 A;  5GAM e;  3R07 A;  4XEO A;  1H4Q A;  1MGQ A;  3V7R A;  4MML A;  5GAM j;  3DSQ A;  4P75 C;  3RES A;  2RA2 A;  2P5I A;  2DZ9 A;  3JB9 J;  2I2L A;  4A54 A;  1SRY A;  3REU A;  2ZNJ A;  2AMC B;  5LJ5 j;  4LNS A;  4MMK A;  4H2V A;  4HWO A;  4M7A B;  2DTI A;  3QO8 A;  2DZC A;  5LJ3 j;  2ZR2 A;  4PJO F;  2AKW A;  3VQY A;  4EMH A;  1JJC A;  3JCM h;  4DQ2 A;  1WLE A;  1B70 A;  2Q7G A;  3A74 A;  4N0A C;  4H2W A;  1PYS B;  3JCM e;  1NNH A;  3RF1 A;  4NL3 A;  4ZTU B;  1M8V A;  2EJG A;  5GAN f;  4NL2 A;  3ERR A;  2DJZ A;  3TUP A;  1H4S A;  5GMK i;  2VC8 A;  3FJP A;  2ZT7 A;  3A5Y A;  3V8J A;  3AHU A;  1ADJ A;  4XU0 A;  1H4T A;  1N9R A;  2VXF A;  4XU1 A;  3UGQ A;  2E41 A;  2EJ9 A;  4UP8 A;  4PJO C;  3SWN B;  4HT9 A;  2ZTG A;  4M7A F;  1J5W A;  5GAO l;  4OLF A;  4M7D B;  4NOY A;  2ALY B;  4YRO A;  2PME A;  1LYL A;  4RQF A;  3HTZ A;  2RHQ A;  3WQZ A;  2RM4 A;  2ZIM A;  4PNO A;  2ZIN A;  3A7R A;  1LNX A;  3L1A A;  3LC0 A;  2Q5H A;  5HGQ A;  4EMG A;  1WQ7 A;  1PYS A;  3JCM f;  2DXU A;  3SWN C;  4M7D D;  2E10 A;  3QHS A;  4YRE A;  2RHS A;  1BBU A;  4M7A D;  4JRK A;  2DU5 A;  1SET A;  4M7A A;  2I4L A;  4H2Y A;  3NEL A;  3HFV A;  4C8Q C;  1EFW A;  1YCY A;  2DDZ A;  4P74 A;  4C92 E;  1KMM A;  4M75 D;  3JCM X;  1BBW A;  4M75 A;  1NJ8 A;  4YRN A;  2IY5 B;  1M5Q 1;  5C53 B;  5GAN 5;  3VQV A;  4F7U B;  5LJ3 f;  2EAY A;  3QTC A;  1YGB A;  3TEH A;  4HA8 A;  2XTI A;  1Y96 A;  4H2T A;  5F5W A;  1B76 A;  3A5Z A;  3VQW A;  1G5I A;  4XTX A;  2CIM A;  4ZIB A;  3HFZ A;  3QUI A;  5ELO A;  1LOJ A;  4PJO A;  4M7D C;  4XEM A;  1D3B A;  4PG3 A;  2YLB A;  4EMK C;  4PJO D;  5GAN 4;  4EO4 A;  2Q7E A;  1U1T A;  2ART A;  4A53 A;  4TQF A;  2ZT6 A;  1NJ5 A;  4H2S A;  4TVA A;  1KMN A;  4EMK A;  4O2D A;  1WNL A;  5GAO q;  4PJO E;  4QVD A;  2ZIO A;  1BIB A;  3RKX A;  3RIR A;  3RAC A;  4WJ4 A;  4TVW A;  4M75 C;  1H4V B;  4P3O A;  4C8Q E;  5LJ5 g;  3SB2 A;  1HTT A;  4YRR A;  4DPG A;  4KR3 A;  4Q15 A;  4C8Q G;  4OP0 A;  3INZ A;  3M4P A;  5C51 B;  5GAN 3;  2ZXF A;  4M7D E;  3JCM Q;  5GAM d;  3RUX A;  3HXY A;  3I7F A;  4PHC A;  5LJ5 h;  4M78 E;  2Q5I A;  3W3S A;  1L0W A;  5K1P A;  4M7A E;  1EOV A;  4C92 A;  3L4G B;  4M77 G;  4M75 F;  1VQZ A;  4C92 D;  1EIY B;  1B7Y A;  4M75 E;  3RGL A;  4H02 A;  5LJ3 d;  4HWR A;  4P71 C;  4WI1 A;  3JB9 G;  4AH6 A;  3PGG A;  1HXD A;  4C8Q B;  1Z7M A;  2C8M A;  3JCM g;  4M78 D;  4P75 A;  1KOG A;  3KFU A;  1B34 A;  4V2S A;  3E9I A;  2DXT A;  4TVY A;  4G84 A;  4NCX A;  3OD1 A;  4J6Y A;  3QO7 A;  2CJA A;  1WU7 A;  2ZNI A;  2ZGW A;  5GAN 2;  5GMK l;  2ZZG A;  5LJ3 h;  4YRK A;  2VXE A;  3L2Z A;  5GAN d;  4YDQ A;  1RIQ A;  1TH7 A;  4P73 C;  4P74 C;  4F7U A;  4RQE A;  4K87 A;  4WF2 A;  3BY7 A;  4CS3 A;  1E1O A;  3LSQ A;  4JRI A;  5GAN 8;  2IY5 A;  3G1Z A;  5GAM h;  3BDU A;  1B8A A;  4P3N A;  3HXW A;  4M77 B;  1YFT A;  5GAM f;  1FYF A;  4XQ3 A;  3HFO A;  4P71 A;  3JCM P;  3QSU A;  4M77 A;  2C7I A;  1JRI A;  2E5A A;  2PMF A;  4F7U F;  3NEM A;  2G4C A;  5GAO r;  4H2X B;  1G51 A;  3PCO B;  3EFS A;  4L87 A;  3JCM J;  1YB3 A;  4XU3 A;  2I4O A;  1X2G A;  2ARU A;  3P8T A;  4YRS A;  2FYK A;  2ZR3 A;  3JCM W;  2RHQ B;  3A32 A;  4YRP A;  1B7Y B;  1EIY A;  4M7D A;  4P3P A;  3L4G A;  2E1H A;  3GIB A;  1YFS A;  3SWN A;  2XGT A;  4HWT A;  1NJ2 A;  2DTH A;  4KR2 A;  4KQE A;  5GAN g;  3JCM b;  2QHV A;  5ELN A;  2RD1 A;  3QO5 A;  4XTW A;  2CJ9 A;  2I4M A;  5GAO n;  1EVL A;  2DKG A;  5LJ5 f;  3V7S A;  4ZTZ B;  3QO3 A;  4UP9 A;  3HSB A;  1X2H A;  3MEY A;  4J6W A;  4YRF A;  4M7D F;  4G85 A;  4M77 C;  5GAN 7;  3M4Q A;  4UP7 A;  4HVC A;  2EJF A;  3ICA A;  4M78 F;  5GAO m;  4TTV A;  1SER A;  2K57 A;  3QNE A;  2ARS A;  2J3M A;  1KQ2 A;  5GAN h;  4C8Q F;  2QHT A;  2ZZF A;  4YPF A;  4CH5 A;  5GAO p;  3HFN A;  2ODR D;  2E3C A;  2ODR C;  2E64 A; 
#chains in the Genus database with same CATH topology
 3A7U A;  5GMK e;  1N9S A;  2CT3 A;  2PUO B;  2L8D A;  2XID A;  1SES A;  4AT1 B;  3PIO A;  2K3Y A;  3VS1 A;  2G3R A;  3CC4 Q;  1VQ7 Q;  2AKK A;  1K4U S;  5GMK m;  3SFM A;  1QKX A;  2CT4 A;  3MP1 A;  4CH6 A;  2DEQ A;  4TVA B;  3HRS A;  4M4Z A;  4K88 A;  2MPX C;  1W2B S;  1H92 A;  3MF2 A;  3CPW P;  5GMK j;  1VQK A;  3I9Q A;  4MDX A;  5CIU A;  1R77 A;  4ATO A;  2RHY A;  3MO8 A;  1KC8 U;  2XMF A;  3PCO A;  4H2X A;  3G4S T;  2Q7H A;  4ZN1 A;  4Q6G A;  3M59 A;  4C5H A;  4YRI A;  2V26 A;  3QZ5 B;  2QQB A;  4FSX A;  1ATI A;  2YHT A;  4BE1 A;  1WQW A;  1ZBJ A;  3C12 A;  3DLL A;  2CP7 A;  3QJY A;  1S72 Q;  1TOV A;  2CP0 A;  2HZY A;  5CVI A;  4RTT A;  3J80 E;  2D8H A;  5E3I A;  4KRT A;  3JCM d;  2OTL T;  2NLU A;  1VQ9 T;  4AG2 C;  2R57 A;  2X35 A;  2L3P A;  5HCK A;  5GAN 6;  3RR6 A;  1R0C B;  1WJS A;  4M78 A;  1Y07 A;  3EGU A;  2X51 A;  3MPU B;  1K9M C;  5GAN e;  3JRZ A;  3FDR A;  4O6J A;  4J9G A;  5HKC A;  1G5H A;  4YRL A;  4F7U E;  2DPP B;  3I55 A;  4HT8 A;  4HWP A;  2K6D A;  2L3S A;  3JB9 I;  3H0F A;  1B34 B;  3GLX A;  5KYX A;  2DBK A;  5LJ3 e;  3HTR A;  2LQW A;  4RDX A;  2DIL A;  1VQM A;  1QE0 A;  3V7C A;  1HYO A;  4D8D A;  1HSQ A;  2E6Z A;  2HEQ A;  2AKW B;  2DL4 A;  3OYJ A;  3VBB A;  3UAT A;  5GAN j;  3RL6 A;  1WHH A;  3UFG A;  5CR2 A;  1FMK A;  1VQN Q;  3UT1 A;  3JSC A;  1E1T A;  1SRM A;  4E7L A;  4L5G A;  4M77 D;  1JBM A;  3P8Y A;  3LSS A;  4FW2 A;  1NJI U;  2EL9 A;  3FLG A;  4P72 A;  3M56 A;  2SEM A;  5IN1 A;  4YCW A;  4LE9 A;  1LJO A;  1Q95 G;  3IKM B;  4JUV A;  2LCS A;  3UF4 A;  1I4K 1;  1YJ9 A;  3CMQ A;  5CKD A;  3VS6 A;  2M16 A;  3BFM A;  2J3L A;  4M78 C;  3CCE T;  4EMK B;  1Q86 U;  4K86 A;  2PVO B;  1VYU A;  2KXC A;  2FB7 A;  4LN2 A;  2LJ0 A;  5CAI A;  4E51 A;  2YLC A;  4N0A A;  4C92 F;  2I4N A;  3NET A;  3CXC A;  3RKY A;  1WDX A;  4Y91 A;  1V76 A;  4BW9 A;  2ROL A;  1I8F A;  5GAM g;  1X27 A;  3S3O A;  4X9C A;  2CZ6 B;  2KBT A;  4C0F A;  1RL2 A;  2QI2 A;  5IT9 E;  2EBP A;  2EYW A;  1KK7 A;  4YCV A;  3OBY A;  5LJ5 e;  1V29 B;  5KYU B;  1GGM A;  1HK9 A;  1AHJ B;  3L2R A;  2GGR A;  3DB3 A;  2D8J A;  1NG2 A;  4RTW A;  1U06 A;  5KCO A;  4YP0 A;  4PKC C;  3CC2 Q;  1H4Q A;  3MEV A;  5M9O A;  3OYB A;  4MML A;  5GAM j;  3QYG B;  3RES A;  4P75 C;  1GFD A;  2HL5 C;  3JB9 J;  2O4X A;  3CD6 Q;  4LVM A;  3OMC A;  2JXB A;  2AMC B;  3CCV Q;  4HWO A;  2LCL A;  2DTI A;  1KC8 R;  4JS4 A;  1O9S A;  2ZR2 A;  2VGM A;  1NLP C;  4OGE A;  3JCM h;  3VS4 A;  4OMM A;  5IH2 A;  1M8M A;  1NNH A;  3VUB A;  4ZTU B;  1IHW A;  5GAN f;  3ERR A;  1AWX A;  3TUP A;  1H4S A;  5GMK i;  1NBE B;  3CCR A;  1TSF A;  2MOX A;  4C5E A;  2Y4Y A;  1VQ6 Q;  3C0C A;  4XU1 A;  3I5S A;  1AOJ A;  3VUZ A;  4M7A F;  1J5W A;  4YRO A;  4RQF A;  2L2P A;  3OSS C;  4PNO A;  4XK8 E;  3A7R A;  1LNX A;  1JB0 E;  3LC0 A;  1VQM T;  2D0N A;  3WVD B;  1G2B A;  1WHL A;  1WQ7 A;  3EG9 A;  1KD1 U;  2YWW A;  5C0M A;  2DXU A;  3SWN C;  1UHF A;  3CBP A;  4ZGE B;  3QWX X;  2RHS A;  4JRK A;  1SET A;  1W6X A;  1NE8 A;  3LYI A;  4H2Y A;  5KYN A;  3CME Q;  4F16 A;  2C0I A;  4OMQ A;  1UGQ B;  3CD6 T;  3G6E Q;  2ED0 A;  1BKB A;  1R8O B;  4N4I A;  3EFO B;  4M75 A;  2IY5 B;  2JS0 A;  4J9C A;  3TVT A;  1KD1 C;  2HD0 A;  2P4R A;  3P8B B;  5D6Y A;  3VQV A;  1VYT A;  5LJ3 f;  2PUK B;  1YGB A;  3TEH A;  3S3M A;  1Y96 A;  5FWB A;  5FU6 C;  2XKO C;  3I5R A;  1YJ9 T;  4C0D B;  3A5Z A;  4ZIB A;  4QT7 A;  1LOJ A;  1PG5 B;  2W0Z A;  2EYZ A;  4EMK C;  4EO4 A;  1NLO C;  2F2W A;  2NUZ A;  4JS5 A;  2R58 A;  1JXO A;  2VV5 A;  1VYV A;  5IXB A;  2ART A;  1NEG A;  2E5Q A;  2RNA A;  3G71 A;  1IRX A;  1ABQ A;  4TVA A;  1KMN A;  1K73 U;  4O2D A;  1WJR A;  4HCC A;  3MEU A;  3NPF A;  1GXI E;  2L3R A;  2ZIO A;  2NUT A;  3RAC A;  2DLP A;  1VQL T;  4P3O A;  1TS9 A;  5LJ5 g;  3SB2 A;  2DK3 A;  1VQO A;  4DPG A;  4KR3 A;  4OP0 A;  3QDR B;  2MK5 A;  3OBW A;  2A28 A;  2P84 A;  3CCU T;  5C51 B;  4QKU A;  1H3Z A;  1Q82 C;  3RUX A;  3OYL A;  1FX7 A;  4Z88 A;  2JM9 A;  2K5I A;  3L2V A;  1EOV A;  1UGR B;  4M75 F;  4MDW A;  2P0P A;  1G8X A;  3RGL A;  2CP5 A;  4B9X A;  2DVJ A;  2FRY A;  1A0N B;  1OZ2 A;  2J06 A;  4WI1 A;  3X20 B;  2O9S A;  2PVG B;  3JCM g;  3EGD B;  1KOG A;  3E9G A;  3CCL T;  1B34 A;  5KYX B;  4V2S A;  4G84 A;  4J9H A;  2DD4 A;  4NCX A;  2CP2 A;  1UJ0 A;  1EZZ B;  4J6Y A;  2CJA A;  2LZ6 B;  5FRN A;  1WU7 A;  1AT1 B;  1X75 C;  3VS5 A;  4J9E A;  1LCK A;  4QQD A;  5GMK l;  4BD3 A;  2ZZG A;  2CP6 A;  4YRK A;  2VXE A;  2K79 A;  3CXC S;  2LC4 A;  4P74 C;  1VQ6 T;  5FRO A;  4RQE A;  3OYA A;  3UPU A;  2NWM A;  2DO3 A;  3MEA A;  2ABL A;  5GAN 8;  1NJI C;  2IY5 A;  1PM3 A;  2XDD A;  3G1Z A;  4ZGJ B;  5FU7 C;  1XNI A;  2VUB A;  4RG8 A;  5GAM f;  1G83 A;  4XQ3 A;  1YI2 T;  2QA4 Q;  4M77 A;  2X3W D;  1QCO A;  3H6Z A;  4DBH A;  2G4C A;  2RH2 A;  1C0M A;  2YSQ A;  2NYS A;  5IHN A;  3QPH A;  1KJW A;  4BAC A;  1RAH B;  1RAC B;  1YB3 A;  2MMP A;  1W70 A;  1ZBX A;  1PKS A;  3P8T A;  2ZR3 A;  5I11 A;  4IUQ A;  2RQW A;  2GCX A;  3HP9 A;  1B7Y B;  1M90 U;  1EIY A;  2A37 A;  2XK0 A;  4M7D A;  3VS3 A;  4FYY B;  2ZPE B;  3L4G A;  1SSH A;  1FXX A;  1QVF A;  1D0Z A;  3SWN A;  5KH6 A;  4KQE A;  1YNZ A;  1VUB A;  5GAN g;  1ZLM A;  1RI0 A;  2RD1 A;  4PLI A;  4XTW A;  2I4M A;  1VQ7 A;  2MIO A;  2DKG A;  2H8H A;  2I0N A;  2EGE A;  3V7S A;  4ZTZ B;  2IIM A;  3QO3 A;  2CDT A;  2A8E A;  3G6E A;  4G85 A;  3G71 T;  2A7Y A;  4UP7 A;  1AD5 A;  4HVC A;  2EJF A;  3CC2 T;  5GAO m;  1YJW Q;  2K57 A;  2CS7 A;  3QNE A;  1RAB B;  2ARS A;  3NTH A;  4C8Q F;  5GAN h;  2QHT A;  4CH5 A;  3TU4 K;  1VQL A;  2ODR D;  3MP6 A;  3PTA A;  4Y28 E;  2CJB A;  2WSF E;  2J05 A;  2X9H A;  5C6S A;  4EIK A;  4TWA A;  1K9M R;  4P72 C;  2NUT B;  4X1V A;  3HRI A;  2E70 A;  3C95 A;  5CQY A;  1M9S A;  1VIE A;  2JT4 A;  3G4S Q;  3VS2 A;  2FZC B;  4F04 B;  1UGV A;  1M4Z A;  3OYY A;  2EWN A;  3UWN A;  1H64 1;  2LRQ A;  1X01 A;  1OU9 A;  4OMF B;  2GTO A;  4LNP A;  3G4S A;  4JRP A;  3HFZ B;  3EG2 A;  1KQ1 A;  1SEM A;  1UJY A;  4ZGD B;  2F69 A;  4H2U A;  5HK3 A;  1W1F A;  8AT1 B;  4HWS A;  3PMI A;  2DNU A;  2MYS A;  3TEG A;  1NYG A;  4AFU C;  1MMN A;  1KQS S;  3CCJ T;  2K3B A;  3EFO A;  1X55 A;  1FWZ A;  3V8L A;  1NJ6 A;  2QQA A;  1WLP B;  4C0G A;  4HVU A;  3EAE A;  2YRV A;  2HBP A;  2LQ8 A;  4PL6 A;  2FVU A;  1QVP A;  2QTX A;  2OTL A;  2E65 A;  3OYN A;  3OW2 S;  4JZ4 A;  3JCM V;  3T9N A;  1M90 C;  3EGD A;  2CUB A;  4ZTJ A;  3OYK A;  4C8Q A;  2BTT A;  2KRM A;  4J8O A;  1YHQ Q;  2WAC A;  4E2F B;  4FCY A;  3JB9 F;  2ALY A;  2RQR A;  4YCU A;  3MKD A;  3CQT A;  1X2Q A;  1B70 B;  1WA7 A;  2LQK A;  3CCR T;  2L5Q A;  2P0L A;  2CP3 A;  3VRZ A;  4BWA A;  1SF9 A;  2KSS A;  4IIM A;  1ASZ A;  1VQ6 A;  4C92 G;  4UPA A;  1TTH B;  2BE9 B;  5IXF A;  4PJM A;  4X5O A;  4HXJ A;  1SHF A;  3L2W A;  4ORZ A;  9ATC B;  4RCC A;  3LH0 A;  4WJ3 M;  1VQN A;  3X28 B;  1JJC B;  4A4H A;  4M77 E;  4M7A C;  3A7A A;  2KK4 A;  2LP5 A;  4IUT A;  2QQR A;  2ZT8 A;  2CSI A;  1UHC A;  1USY A;  3NEN A;  3CCJ Q;  1ZA1 B;  2V8J A;  5KYU A;  4E7J A;  1VQM Q;  3IAL A;  1NYR A;  2O4X B;  1EIF A;  2V8I A;  1IGU A;  1BI0 A;  2FZK B;  4Z8A A;  2EW3 A;  4RTZ A;  2ZCF B;  1ZUY A;  4JPB W;  2OAU A;  2DX1 A;  2DTO A;  5I21 A;  4HT4 A;  2QK0 A;  3C4S A;  1EFN A;  1JJ2 P;  3MJX A;  4PJO B;  2DQ3 A;  2FZG B;  5J3B A;  3CME T;  4P73 A;  3FB9 A;  3REX A;  1IL2 A;  1UDL A;  1WXT A;  2AT1 B;  3OYD A;  3QJ6 A;  4IKF A;  2KAF A;  1N9W A;  1RLQ C;  1Z7N A;  2LTO A;  11AS A;  1VOM A;  4OB1 B;  4KH0 B;  2CH4 W;  3R07 A;  2DMO A;  2PU9 B;  2KE9 A;  3V7R A;  1NZ9 A;  4ZTF A;  3DSQ A;  2KRS A;  4E7S A;  2P5I A;  4FT4 A;  2DZ9 A;  2EYX A;  3P8D A;  2QEX T;  2I2L A;  4QQG A;  4C0D C;  1Y7X A;  2X4W A;  3UDC A;  3J7A F;  1SRY A;  4LNS A;  2EQM A;  4L59 A;  4H2V A;  1AZE A;  2MI6 A;  1CKB A;  2DZC A;  5FU7 B;  3CCM A;  5LJ3 j;  1JXM A;  2ZPH B;  1B7T A;  2PZ1 A;  2DXC A;  4DQ2 A;  1X6O A;  4LD9 K;  2FO0 A;  4IUP A;  3QBY A;  1IHV A;  3OY9 A;  2DJZ A;  4BY6 C;  5A0L A;  1SHG A;  1JO8 A;  2EGA A;  4J9I A;  2DL8 A;  1U8R A;  1N9R A;  4UP8 A;  4PJN A;  4PJO C;  1G3W A;  1MUZ A;  3TQ7 P;  2GQI A;  3L42 A;  4HT9 A;  3DLM A;  4LDW A;  4NOY A;  4M7D B;  2PME A;  2RJC A;  4D8K A;  2RHQ A;  3WQZ A;  2RM4 A;  2ZIN A;  3BDL A;  3ZEH A;  3I56 T;  1PYS A;  4IUV A;  2O01 E;  3X25 B;  4F17 A;  3S3N A;  1YI2 A;  3OS0 A;  1BBZ A;  1OEB A;  4GLK A;  3NEL A;  5KYW B;  1PKT A;  1X6B A;  4C8Q C;  3HFV A;  4IIO A;  4AMC A;  3TSW A;  2DAQ A;  4AFQ C;  4M75 D;  3JCM X;  4A4G A;  5AYF A;  1GL5 A;  3CCJ A;  2D1X A;  3ZL7 C;  5CCA A;  5GAN 5;  4OB3 B;  3UA6 A;  2DFU A;  1T0H A;  4N4H A;  2EAY A;  1FYN A;  2LX9 A;  2SRC A;  2XTI A;  3R6O A;  4B9W A;  3BE3 A;  2GFA A;  3N5B B;  1G5I A;  4XTX A;  2KQW A;  2LCC A;  4LVK A;  3E9F A;  3GNG A;  1UTI A;  3X24 B;  2HMA A;  4PJO A;  3OYI A;  1ZX6 A;  5L8R E;  5KE2 A;  1U1T A;  2BUD A;  1Q7Y R;  3HRU A;  1CSK A;  4A53 A;  2GQV A;  3LWI A;  3E2U A;  1NJ5 A;  2IVW A;  2OI3 A;  2KYM A;  1YHQ A;  1YN8 A;  3PFS A;  4PJO E;  2Y4X A;  4QVD A;  1BB9 A;  1BIB A;  2OJ2 A;  3OW2 P;  1VQ8 T;  2W10 A;  3LGF A;  4LXC A;  3M9Q A;  3KFV A;  1VQ4 T;  4TVW A;  1UFF A;  1MMA A;  1VQO T;  1D0X A;  1N5Z A;  5CK9 A;  3INZ A;  4M7D E;  3M0U A;  5GAM d;  2B8A A;  3LH5 A;  1NYF A;  4PHC A;  1D09 B;  1M1G A;  5K1P A;  3CC4 T;  3PMT A;  2ENM A;  3TCJ A;  2M1H A;  1ZA2 B;  2X4Y A;  4M75 E;  2O2O A;  1Q7Y U;  3UA7 A;  4AH6 A;  4BDZ A;  4E7K A;  1Z7M A;  1VQP T;  4M78 D;  1R0B G;  1I0C A;  4TVY A;  1YWO A;  5FWC A;  4CI0 C;  4A63 B;  1RUW A;  4PFZ A;  2EPD A;  1K0X A;  1Q86 R;  3HL8 A;  1OU8 A;  2QGF B;  6AT1 B;  3EH2 A;  5LJ3 h;  2MCN A;  1QVG A;  1B07 A;  2BE7 D;  1RIQ A;  3I56 Q;  1RLP C;  1YI2 Q;  4P73 C;  4F7U A;  1IB8 A;  2LJ3 A;  4WF2 A;  3BY7 A;  4CS3 A;  5IAY A;  2GNC A;  3M0Q A;  3LSQ A;  1M3A A;  3G7Z A;  2M0Y A;  4P3N A;  4GY5 A;  3HXW A;  5I22 A;  4M77 B;  2CSQ A;  2HCK A;  1OZ3 A;  2GBQ A;  1K8A C;  1M90 R;  2PMF A;  2BIV A;  5J39 A;  5GAO r;  2XHC A;  3VJP A;  3CPW A;  1IGQ A;  4H2X B;  2XDP A;  2KEA A;  3C94 A;  4JJC A;  1YFN A;  1G5V A;  2VB6 A;  1VQ9 A;  1Y57 A;  1NEB A;  2I4O A;  1X2G A;  2ARU A;  2FYK A;  4P5N A;  1ABO A;  1M2V A;  2QA4 T;  1X43 A;  4AFZ C;  2J7I A;  3M0P A;  4HCB A;  4P3P A;  1G3Y A;  3GIB A;  1KQS A;  4HWT A;  1PSF A;  2DTH A;  1M27 C;  3J81 E;  1QLY A;  2Z0W A;  5CKE A;  4DBQ A;  2ZPG B;  4IUR A;  2QHV A;  5ELN A;  2JOY A;  4ZN3 A;  1U3O A;  2CZ7 B;  2GTJ A;  4OGC A;  2KVQ G;  3GNF B;  1VQK Q;  3HSB A;  3MEY A;  3M0T A;  4J6W A;  1FMV A;  3HPW A;  2LQN A;  2COZ A;  4M78 F;  4KUD K;  1ZHI A;  4TTV A;  1SER A;  2B86 A;  2YUQ A;  4PFO A;  1OPK A;  2EVR A;  3MET A;  1OV3 A;  2M02 A;  3OYH A;  2F2X A;  1TUG B;  1KQ2 A;  4E47 A;  5GAO p;  3NFC A;  2E3C A;  2RI5 A;  1G3T A;  1ZSZ A;  2CKK A;  1ARK A;  1NPR A;  3P8H A;  2M9U A;  4RTV A;  5LJ3 g;  4FU6 A;  1HC7 A;  1PRM C;  2K7A A;  1WHJ A;  2EQK A;  2F1L A;  4YRC A;  3OYF A;  4M7A G;  4J9F A;  4XU2 A;  2H3E B;  2DE0 X;  4X9D A;  5DLO A;  4DBF A;  3UGT A;  2CGH A;  1BYM A;  3M4G A;  1YJW T;  5KNN A;  3GP8 A;  2EKH A;  5CKB A;  5LJ5 d;  1QKW A;  1D3B B;  2FL7 A;  4BE2 A;  1IXD A;  4M75 B;  1QQJ A;  3UH0 A;  1BIA A;  2FPE A;  1EQR A;  4KGZ B;  1X69 A;  1SSF A;  4KBM B;  3BJU A;  3PE0 A;  4YRJ A;  1KHI A;  2FPD A;  3JV3 A;  3TEH B;  2ZCE A;  1PD1 A;  1WXU A;  1VQ8 A;  1RAD B;  4E7Z A;  4ME7 A;  4TQD A;  1Q82 U;  2DQ0 A;  2COY A;  1NYQ A;  1U5S A;  2EQI A;  2HQX A;  4HVV A;  2MAM A;  4CRI A;  4YRQ A;  3H41 A;  1WPY A;  4J5Y A;  2JMC A;  2O31 A;  2DRK A;  2A3L A;  3EGX A;  5DLQ E;  5KYW A;  3IKL A;  2J6F A;  1MV0 B;  3HY0 A;  1NM7 A;  3DKM A;  4ESR A;  4BB7 A;  1BI2 A;  2NUP B;  2O9V A;  3HXU A;  4RMF A;  3ULR B;  3NMZ C;  3REB B;  1D1B A;  1YP5 A;  1TXQ A;  3CPF A;  3IG2 A;  2RK1 A;  2ESW A;  3V8K A;  1K8A U;  4YRT A;  4LVJ A;  4EX5 A;  4C8Q D;  2DYB A;  4J83 A;  4C92 B;  3ME9 A;  2LT4 A;  1GBR A;  12AS A;  1C0A A;  1VQ5 Q;  4J6X A;  3HXZ A;  3IQL A;  2AMC A;  4FL6 A;  4M78 B;  4JLI A;  2K5F A;  2YUN A;  4NS5 A;  3G6E T;  2DL5 A;  4JZ3 A;  4LD6 A;  4M78 G;  1QP3 A;  1QF6 A;  1M3B A;  1VQ8 Q;  2QEX A;  1ASY A;  4HCK A;  1YCS B;  3VKI A;  1KHC A;  1Q81 U;  4M77 F;  1NJ1 A;  1M1K C;  4KH1 B;  3HY1 A;  4XTZ A;  2ZPF B;  2E12 A;  4LVI A;  1NPP A;  4JJN K;  2WSE E;  1PHT A;  1E24 A;  1YFR A;  1HJD A;  3OA6 A;  1Y0M A;  3M53 A;  2QYZ A;  1H3H A;  2D0Q B;  1QWF A;  4FYW B;  2E3H A;  4QVC A;  4ELY C;  3MHX A;  5D6W A;  1W2B A;  1USY C;  1E22 A;  2KYB A;  1YIT A;  2FEI A;  3VQX A;  2HNI A;  4RCB A;  1X56 A;  2VYT A;  1I81 A;  4A4E A;  4FW1 A;  2HKN A;  3EFR A;  4WCI A;  1VQP Q;  1D1C A;  3LX7 A;  3CCS Q;  2ECZ A;  3U23 A;  4ANJ A;  2BZX A;  4C92 C;  1QW1 A;  1YJW A;  1Q81 C;  5GAM e;  3G1J A;  5KCH A;  4XEO A;  1WGS A;  1BCM A;  4FM4 B;  2JTE A;  2RA2 A;  3M0R A;  1VQ5 T;  3CME A;  1KSW A;  5A0G A;  3PNW C;  2A36 A;  3CC7 T;  1E6H A;  3REU A;  2ZNJ A;  1KQS P;  4M7A B;  3QO8 A;  2IG0 A;  2LX7 A;  2F5T X;  2O88 A;  4EPC A;  2X4J A;  4OML A;  4EDU A;  1TU0 B;  2AKW A;  3VQY A;  1JJC A;  4X34 A;  2AHJ B;  3A74 A;  2Q7G A;  4N0A C;  1D1A A;  2BKD N;  3ASK A;  3JCM e;  2QQS A;  1K73 C;  3RF1 A;  1MV3 A;  4NL3 A;  2RJF A;  1UB4 A;  3QWY A;  4NL2 A;  3CCQ A;  1S72 T;  4N4G A;  2OAW A;  3GBQ A;  3QZ9 B;  3FJP A;  4OF1 A;  2ZT7 A;  3A5Y A;  1VQ9 Q;  3CMA T;  1LVK A;  1ADJ A;  4XU0 A;  4D6W A;  1H4T A;  4RKU E;  2NUP A;  4B6M A;  3EH1 A;  2E41 A;  3UGQ A;  4PFP A;  2E3I A;  4C5G A;  3SWN B;  2DRM A;  1K0S A;  2ZTG A;  1SPK A;  2XI9 A;  4OLF A;  2CH4 A;  2ALY B;  3HTZ A;  1GBQ A;  1K76 A;  2EQU A;  3SEM A;  2ZIM A;  1RAG B;  2JMA A;  3VS7 A;  3G71 Q;  3L1A A;  3CCQ T;  4PK4 A;  1S72 A;  4MZP A;  2XDB A;  4C5I A;  1Q7Y C;  4EMG A;  1WIE A;  3CCS T;  3JCM f;  2LJ1 A;  1RAA B;  2EYY A;  4M7D D;  1ZUU A;  3H8Z A;  3QHS A;  4YRE A;  2OX7 A;  1N6A A;  3A1P A;  1K8A R;  4LDY A;  2I4L A;  1I1J A;  5EG2 A;  2LT1 A;  2F2V A;  3NHN A;  3EGX B;  2DBM A;  1EFW A;  2PNI A;  3E19 A;  1YCY A;  3H0H A;  1ZQ1 A;  2RHX A;  4BI3 A;  4C92 E;  4P74 A;  1KMM A;  5FU6 B;  2C0O A;  2VVK A;  2ED1 A;  3CCV T;  1YIJ T;  4QW2 A;  3S6W A;  4YRN A;  1K1Z A;  1M5Q 1;  3CCU A;  4J9B A;  3OYE A;  2QGG A;  5I2S A;  3VYH B;  3QTC A;  4OMP A;  1OQK A;  1PNJ A;  3OQ5 A;  1JJ2 S;  4MZT A;  1B76 A;  1NJI R;  3VQW A;  3CCL Q;  1Q86 C;  2JW4 A;  3WXM B;  3O8V A;  3QUI A;  1UE9 A;  3HFZ A;  4DOW A;  1OI1 A;  4CC4 B;  1UGS B;  2ZZD A;  3FJ5 A;  2YRD A;  4F14 A;  2RQV A;  4M7D C;  4PG3 A;  2Q7E A;  2RI3 A;  3AT1 B;  1VQ4 Q;  1JQQ A;  3CCL A;  4TQF A;  1N8R C;  1GRI A;  1YJN A;  4H2S A;  4RTX A;  2RI2 A;  1WNL A;  3NGP A;  3RKX A;  1XQH A;  1DJ7 B;  3RIR A;  3SHW A;  2EQJ A;  1C1A A;  1Y71 A;  4M75 C;  1H4V B;  2DIQ A;  1AZG B;  2H3J A;  4Q15 A;  4JJB A;  4C8Q G;  4AFS C;  3M4P A;  3KXT A;  2LDM A;  5GAN 3;  2GFU A;  3LW5 E;  3JCM Q;  2CZ1 B;  4R55 A;  4R56 A;  2PTK A;  1YIJ Q;  5LJ5 h;  4BUG A;  1F1B B;  3VV0 A;  1L0W A;  5FLX E;  3A8O B;  2L89 A;  4M7A E;  4M77 G;  2ZPB B;  2K9G A;  4C92 D;  2X4X A;  1B7Y A;  1EIY B;  2P0Q A;  4HWR A;  1PCX A;  3THK A;  2IPO B;  4AG1 C;  3JB9 G;  4LUE A;  2HAX A;  3PGG A;  1HXD A;  4C8Q B;  2X3X D;  2C8M A;  2XD0 A;  3H9N A;  3LLR A;  4P75 A;  3E9I A;  3I55 Q;  2KR3 A;  1XTD A;  4BY6 B;  2ZAE A;  1VQO Q;  3QO7 A;  1FMW A;  2OTJ T;  2ZNI A;  2KXD A;  5GAN 2;  1GCQ C;  3CCQ Q;  2BZY A;  4YDQ A;  3VS0 A;  1S1N A;  1TH7 A;  3E1S A;  2JZ2 A;  3MQZ A;  1W4S A;  3D7S B;  2HKQ B;  2R5M A;  4K87 A;  2DIG A;  4KUI A;  3OYG A;  1E1O A;  1MND A;  3OS1 A;  4Y92 A;  1KC8 C;  2RPN A;  5GAM h;  3BDU A;  1B8A A;  4DOV A;  1VQL Q;  1YFT A;  1ZSG A;  2YUO A;  1I5O B;  3HFO A;  2E5K A;  4P71 A;  1RAE B;  1P92 A;  2M51 A;  1OX9 A;  2C7I A;  1JRI A;  3M0S A;  2E5A A;  3TSZ A;  3KUF A;  4F7U F;  5ECA A;  1M1F A;  1N27 A;  3PCO B;  2QAZ A;  2HBW A;  3EFS A;  3OS2 A;  3L2Q A;  4BDY A;  1GCP A;  2CYZ B;  4HKE A;  3CCS A;  3JCM W;  2KMT A;  3A32 A;  1ZSZ C;  4GLM A;  1MMD A;  1UGP B;  2XGT A;  1ACM B;  1NJ2 A;  2RN8 A;  3RBB B;  4KR2 A;  1YJN Q;  4KUL A;  3JCM b;  5CQX A;  4OB0 B;  5I2M A;  2CJ9 A;  1BCO A;  1SKU B;  1RAF B;  1QVF P;  5LJ5 f;  1ZSZ B;  2VKN A;  2EIF A;  4UP9 A;  3EHR A;  4O5V A;  4YRF A;  5GAN 7;  2A08 A;  3CC2 A;  3ICA A;  2VAS A;  1QMC A;  2DL3 A;  5HY6 A;  5AT1 B;  2RK2 A;  3RMQ A;  2K2V A;  1CKA A;  3GF5 A;  4FYX B;  4MZM A;  2ATC B;  1YIJ A;  2J3M A;  4K11 A;  1ZUK A;  2HSP A;  3HFN A;  3QDF A;  1M8V A;  1TG0 A;  2E64 A;  1AVZ C;  2QHU A;  1T3L A;  3HRT A;  3RER A;  1XJW B;  4CS2 A;  1GCQ A;  2XG8 D;  4M7D G;  3A8H B;  2LVM A;  2R5A A;  3A5Z B;  2XU8 A;  5C52 B;  2YDL A;  1Y96 B;  4YRG A;  4LUD A;  5HK0 A;  4M75 G;  4CH3 A;  2D9T A;  1YJ9 Q;  1XOV A;  4Z89 A;  5LL6 S;  1QCN A;  1VQ7 T;  4CH4 A;  2HDA A;  1WYD A;  2P4T A;  1YJN T;  1Q82 R;  1OX8 A;  2AK5 A;  1C6V X;  2K5L A;  4KGV B;  4PLL A;  1YWP A;  1AWW A;  4E7I A;  3M5A A;  2P0K A;  2LNH B;  2FHD A;  1PC0 A;  1TUD A;  4PJJ A;  3RKW A;  2DA9 A;  3Q1J A;  3HXX A;  3I55 T;  2RHS B;  5DY9 A;  2RQT A;  3FIF A;  3RMS A;  2QDY B;  1EVK A;  3P8V A;  1T0J A;  2KT8 A;  4PJO G;  3VU3 C;  1UEB A;  2RO0 A;  4A4K A;  3E9H A;  2DYI A;  2Y90 A;  3TEE A;  4YRM A;  2ZZE A;  2DF6 A;  2COW A;  2AIR B;  4FT2 A;  2L3Q A;  2V1Q A;  3ZBD A;  3SDZ A;  4XTY A;  4BI8 B;  1K73 R;  5GMK h;  4E6R A;  5A2Q E;  2EKO A;  4CC7 A;  3MP8 A;  4VUB A;  3CBM A;  3EG9 B;  4DEX A;  5D7U A;  2RJE A;  1W66 A;  4TVR A;  1WX6 A;  1PSE A;  3MF1 A;  2E4H A;  2MWP A;  1HD3 A;  3HXV A;  2JN0 A;  3BW1 A;  2HQE A;  3EG0 A;  1U1S A;  2KGT A;  2QEX Q;  1OYX A;  2RHU A;  2JVV A;  2V8K A;  1K9A A;  4R0K A;  1Q81 R;  2QHS A;  3VRY A;  3CD6 A;  3CCE Q;  3SD4 A;  4LDV A;  3A31 A;  4XTU A;  1YBY A;  4JDS A;  4CS4 A;  2HQH A;  4J15 A;  7AT1 B;  3JB9 D;  2CZ0 B;  2L0A A;  3HHT B;  5L23 A;  4YYE A;  4ELZ C;  3PZC A;  3QKJ A;  2C0T A;  2V1R A;  1QWE A;  1VQ5 A;  2MWO A;  2PQW A;  5A0D A;  2A0F B;  4QQ6 A;  3HRK A;  1T3S A;  4RG2 A;  1BI1 A;  2KY9 A;  1BK2 A;  4CC2 A;  5K1X A;  2AZV A;  2DU7 A;  1PD0 A;  4J7F A;  2QAS A;  4OB2 B;  4OMO A;  3PVL A;  3H0I A;  3JB9 H;  4E7H A;  1X54 A;  5GJV B;  2DM1 A;  3GPL A;  2GF7 A;  1QVG P;  1RI9 A;  4KT0 E;  1ADY A;  2ZT5 A;  3O5Z A;  4F7U G;  1JJ2 A;  4QVZ A;  1IRE B;  1N8R R;  1YIT T;  1WJQ A;  3CEY A;  3CC7 A;  4XTV A;  2J6K A;  1I5L A;  3PVQ A;  1SG5 A;  3A8M B;  2DVE A;  3FRN A;  4FIB A;  3OYC A;  3GOX A;  2RB6 A;  1M30 A;  1VQK T;  2RMO A;  3JCM c;  4BE0 A;  2QXF A;  3A8L B;  2JTM A;  5GJW B;  1PRL C;  5IHK A;  1MGQ A;  3CCR Q;  3EG3 A;  1OOT A;  2QA4 A;  1KFZ A;  4A54 A;  3A98 A;  2JTF A;  4JLG A;  2NS6 A;  4RTU A;  4YTL A;  5LJ5 j;  4MMK A;  1WZO A;  4PJL A;  4DA4 A;  2DJQ A;  2YT6 A;  2M0O A;  2RQU A;  3WVE B;  3NTI A;  1IZ6 A;  4KGX B;  4PJO F;  4EMH A;  1WLE A;  1WFW A;  1B70 A;  3PT9 A;  4H2W A;  1PYS B;  1M2O A;  3FC3 A;  3QYH B;  3R6N A;  2QQ9 A;  1LPL A;  1QCF A;  2KRO A;  2EJG A;  1X6G A;  1H8K A;  3M55 A;  2YRC A;  1RAI B;  2VC8 A;  4DBR A;  1AWJ A;  3V8J A;  3MCA B;  3AHU A;  4BI4 A;  2VXF A;  3KBG A;  2EJ9 A;  2QDL A;  2ZPI B;  4LDU A;  2KT1 A;  4RMO A;  5GAO l;  3FEO A;  2K2M A;  5D6X A;  1LYL A;  1M2V B;  3OW2 A;  3M57 A;  2HL3 A;  2DD5 A;  2Q5H A;  5HGQ A;  2J6O A;  1OPL A;  3LWH A;  2JM8 A;  1I07 A;  1M1K U;  3REA B;  1WHM A;  2AKL A;  2E10 A;  1BBU A;  4HVW A;  4M7A D;  1KG1 A;  5FRM A;  2CUD A;  3OB9 A;  2DU5 A;  4M7A A;  3CXC P;  2C06 A;  3CCM T;  1YHQ T;  2F5K A;  1VQ4 A;  1W2B P;  4LVL A;  5KE3 A;  2DDZ A;  1X2K A;  3CPW S;  3CMA Q;  1E7O A;  2EFI A;  4C0Z A;  1BBW A;  1NJ8 A;  5C53 B;  2RHZ A;  2XIC A;  3OSV A;  4F7U B;  4HA8 A;  3TRE A;  1N8R U;  3PIP A;  2JJ9 A;  3F70 A;  1WHK A;  1QVF S;  2FRW A;  4H2T A;  3CMA A;  5F5W A;  3CC7 Q;  2LMJ A;  3RDV A;  1WI7 A;  3OYM A;  1TUC A;  3CC4 A;  2CIM A;  5CO7 A;  3X26 B;  3CCU Q;  1WHG A;  2ROT A;  5ELO A;  4XEM A;  1VA7 A;  1D3B A;  5EC7 A;  2YLB A;  3M58 A;  4PJO D;  5GAN 4;  3NTK A;  1O75 A;  4RUG A;  3ZFJ A;  2KRN A;  2ZT6 A;  2JNG A;  3QII A;  4RTY A;  4EMK A;  1EX4 A;  3A8G B;  5GAO q;  4J7I A;  4JRQ A;  4OMN A;  4II1 A;  4WJ4 A;  1MNE A;  4C8Q E;  1HTT A;  4YRR A;  2QG9 B;  2ZXF A;  2RJD A;  3HXY A;  3I7F A;  2DER A;  1BU1 A;  4M78 E;  1UUE A;  4XAX B;  4CC3 A;  2Q5I A;  2YXY A;  3W3S A;  5CKF A;  2MF2 A;  4C92 A;  3L4G B;  5CKH A;  1VQZ A;  4H02 A;  1MHN A;  5LJ3 d;  1V1C A;  1M3C A;  4P71 C;  2VWF A;  3EHQ A;  2BZ8 A;  2E6N A;  2EGC A;  1D0Y A;  3VYG A;  5DM7 R;  3I56 A;  1WXB A;  3KFU A;  2DXT A;  1BI3 A;  3M4Y A;  1TWB A;  2YUP A;  3OD1 A;  2DL7 A;  2K3X A;  1UG1 A;  2VGN A;  2ZGW A;  3OS5 A;  4UC4 A;  2AZS A;  3L2Z A;  5GAN d;  1SRL A;  3JAM E;  1QVG S;  2RF0 A;  4HCZ A;  2FG0 A;  2OTL Q;  2KNB B;  4JRI A;  3RNJ A;  1AWO A;  3CCM Q;  4DEY A;  2FPF A;  1OUL A;  5KYY A;  1JU5 C;  1UEC A;  2OTJ A;  2DEU A;  3CCE A;  1KD1 R;  1WYX A;  1FYF A;  3JCM P;  3QSU A;  1J3T A;  3LGL A;  5KYY B;  3NEM A;  1M1K R;  1AEY A;  1VIF A;  2D6F A;  1G3S A;  5J26 A;  4J9D A;  2JS2 A;  1G51 A;  4OVA A;  2HSE B;  2LNV A;  1Z9Q A;  4L87 A;  3JCM J;  4XU3 A;  1B3Q A;  1VQN T;  2KI7 A;  5IHI A;  4YRS A;  3ER0 A;  3OMG A;  4Z02 A;  1VQP A;  2JUF A;  2RHQ B;  4YRP A;  1K9M U;  3URG A;  4ZNX A;  4LDX A;  2E1H A;  3QXE B;  4Q5W A;  1YFS A;  4JJD A;  1Z9Z A;  3MEW A;  2KDS A;  1YIT Q;  3QG1 A;  2QTV A;  1PWT A;  3QO5 A;  3I35 A;  2EYQ A;  8ATC B;  3L2U A;  5GAO n;  1EVL A;  3M54 A;  1GFC A;  1KIK A;  4WTO B;  3CCV A;  2PVD B;  3EG1 A;  2DET A;  1X2H A;  4GBQ A;  4M7D F;  1JEG A;  4IUU A;  2WSC E;  2G6F X;  4M77 C;  4A4F A;  3M4Q A;  1QP2 A;  4L6V 5;  4FYV B;  1E6G A;  4FSS A;  3CBO A;  2K4Y A;  5FW9 A;  1IO6 A;  1MMG A;  4YPF A;  2ZZF A;  2CRE A;  3HKS A;  2OTJ Q;  3DB4 A;  2RHI A;  2DXB A;  2ODR C; 
#chains in the Genus database with same CATH homology
 3A7U A;  5GMK e;  1N9S A;  2PUO B;  2L8D A;  2XID A;  1SES A;  3PIO A;  2K3Y A;  2G3R A;  5GMK m;  3SFM A;  3MP1 A;  4CH6 A;  2DEQ A;  4TVA B;  3HRS A;  4K88 A;  1W2B S;  3MF2 A;  5GMK j;  1VQK A;  4MDX A;  5CIU A;  4ATO A;  2RHY A;  3MO8 A;  1KC8 U;  3PCO A;  4H2X A;  3G4S T;  2Q7H A;  4ZN1 A;  4Q6G A;  3M59 A;  4C5H A;  4YRI A;  3QZ5 B;  2QQB A;  4FSX A;  1ATI A;  2YHT A;  4BE1 A;  1WQW A;  3C12 A;  3DLL A;  3QJY A;  5CVI A;  3J80 E;  5E3I A;  2OTL T;  3JCM d;  2NLU A;  1VQ9 T;  2R57 A;  2X35 A;  5GAN 6;  1WJS A;  4M78 A;  1Y07 A;  1K9M C;  5GAN e;  3JRZ A;  3FDR A;  4O6J A;  5HKC A;  1G5H A;  4YRL A;  4F7U E;  2DPP B;  4HWP A;  3I55 A;  4HT8 A;  3JB9 I;  1B34 B;  3GLX A;  5LJ3 e;  4RDX A;  1VQM A;  1QE0 A;  3V7C A;  2E6Z A;  2AKW B;  3OYJ A;  3VBB A;  3UFG A;  5GAN j;  3RL6 A;  5CR2 A;  3UT1 A;  3JSC A;  1E1T A;  4E7L A;  4L5G A;  4M77 D;  1JBM A;  3P8Y A;  3LSS A;  1NJI U;  2EL9 A;  3FLG A;  4P72 A;  3M56 A;  5IN1 A;  4YCW A;  1LJO A;  3IKM B;  4JUV A;  1I4K 1;  1YJ9 A;  3CMQ A;  5CKD A;  2M16 A;  3BFM A;  2J3L A;  4M78 C;  3CCE T;  4EMK B;  1Q86 U;  4K86 A;  2PVO B;  2FB7 A;  5CAI A;  4E51 A;  2YLC A;  4N0A A;  4C92 F;  2I4N A;  3NET A;  3CXC A;  3RKY A;  4Y91 A;  4BW9 A;  1I8F A;  5GAM g;  3S3O A;  4X9C A;  2CZ6 B;  4C0F A;  1RL2 A;  2QI2 A;  5IT9 E;  4YCV A;  3OBY A;  5LJ5 e;  1V29 B;  1GGM A;  1HK9 A;  1AHJ B;  3L2R A;  3DB3 A;  5KCO A;  4YP0 A;  4PKC C;  1H4Q A;  3MEV A;  5M9O A;  3OYB A;  4MML A;  5GAM j;  3QYG B;  3RES A;  4P75 C;  4LVM A;  3JB9 J;  2O4X A;  3OMC A;  2AMC B;  4HWO A;  2LCL A;  2DTI A;  4JS4 A;  1O9S A;  2ZR2 A;  2VGM A;  4OGE A;  3JCM h;  1NNH A;  3VUB A;  4ZTU B;  5GAN f;  3ERR A;  3TUP A;  1H4S A;  5GMK i;  3CCR A;  4C5E A;  2Y4Y A;  4XU1 A;  3VUZ A;  4M7A F;  1J5W A;  4YRO A;  4RQF A;  3OSS C;  4PNO A;  4XK8 E;  3A7R A;  1LNX A;  1JB0 E;  3LC0 A;  1VQM T;  3WVD B;  1WQ7 A;  1KD1 U;  5C0M A;  2DXU A;  3SWN C;  3CBP A;  4ZGE B;  2RHS A;  4JRK A;  1SET A;  1NE8 A;  3LYI A;  4H2Y A;  3CD6 T;  1UGQ B;  1BKB A;  1R8O B;  4N4I A;  4M75 A;  2IY5 B;  1KD1 C;  2HD0 A;  3P8B B;  5D6Y A;  3VQV A;  5LJ3 f;  2PUK B;  1YGB A;  3TEH A;  3S3M A;  1Y96 A;  5FU6 C;  2XKO C;  1YJ9 T;  4C0D B;  3A5Z A;  4ZIB A;  1LOJ A;  4EMK C;  4EO4 A;  4JS5 A;  2R58 A;  2VV5 A;  2ART A;  2E5Q A;  3G71 A;  4TVA A;  1KMN A;  1K73 U;  4O2D A;  1WJR A;  4HCC A;  3MEU A;  1GXI E;  2L3R A;  2ZIO A;  3RAC A;  1VQL T;  4P3O A;  5LJ5 g;  3SB2 A;  2DK3 A;  1VQO A;  4DPG A;  4KR3 A;  4OP0 A;  3QDR B;  3OBW A;  5C51 B;  3CCU T;  1H3Z A;  1Q82 C;  3RUX A;  3OYL A;  1FX7 A;  2K5I A;  3L2V A;  1EOV A;  1UGR B;  4M75 F;  4MDW A;  2P0P A;  3RGL A;  4B9X A;  1OZ2 A;  4WI1 A;  3X20 B;  2PVG B;  3JCM g;  1KOG A;  3E9G A;  3CCL T;  1B34 A;  4V2S A;  4G84 A;  2DD4 A;  4NCX A;  4J6Y A;  2CJA A;  5FRN A;  1WU7 A;  1X75 C;  4QQD A;  5GMK l;  4BD3 A;  2ZZG A;  4YRK A;  2VXE A;  3CXC S;  2LC4 A;  4P74 C;  1VQ6 T;  5FRO A;  4RQE A;  3OYA A;  3UPU A;  2DO3 A;  3MEA A;  5GAN 8;  1NJI C;  2IY5 A;  2XDD A;  3G1Z A;  4ZGJ B;  5FU7 C;  1XNI A;  2VUB A;  4RG8 A;  5GAM f;  4XQ3 A;  1YI2 T;  4M77 A;  3H6Z A;  2G4C A;  2RH2 A;  3QPH A;  4BAC A;  1YB3 A;  2MMP A;  1ZBX A;  3P8T A;  2ZR3 A;  4IUQ A;  2GCX A;  3HP9 A;  1B7Y B;  1M90 U;  1EIY A;  2XK0 A;  4M7D A;  2ZPE B;  3L4G A;  1FXX A;  1QVF A;  3SWN A;  5KH6 A;  4KQE A;  1VUB A;  5GAN g;  1RI0 A;  2RD1 A;  4PLI A;  4XTW A;  2I4M A;  1VQ7 A;  2DKG A;  3V7S A;  4ZTZ B;  3QO3 A;  2A8E A;  3G6E A;  4G85 A;  3G71 T;  2A7Y A;  4UP7 A;  4HVC A;  2EJF A;  3CC2 T;  5GAO m;  2K57 A;  2CS7 A;  3QNE A;  2ARS A;  3NTH A;  4C8Q F;  5GAN h;  2QHT A;  4CH5 A;  3TU4 K;  1VQL A;  2ODR D;  3MP6 A;  3PTA A;  4Y28 E;  2CJB A;  2WSF E;  5C6S A;  4TWA A;  4P72 C;  3HRI A;  2E70 A;  3C95 A;  5CQY A;  1M9S A;  1VIE A;  1M4Z A;  3OYY A;  2EWN A;  3UWN A;  1H64 1;  2LRQ A;  1X01 A;  4OMF B;  3G4S A;  4JRP A;  3HFZ B;  1KQ1 A;  4ZGD B;  2F69 A;  4H2U A;  5HK3 A;  4HWS A;  3PMI A;  3TEG A;  1KQS S;  3CCJ T;  1X55 A;  1FWZ A;  3V8L A;  1NJ6 A;  2QQA A;  4C0G A;  3EAE A;  2YRV A;  2HBP A;  2LQ8 A;  4PL6 A;  2FVU A;  1QVP A;  2QTX A;  2OTL A;  2E65 A;  3OYN A;  3OW2 S;  3JCM V;  3T9N A;  1M90 C;  4ZTJ A;  3OYK A;  4C8Q A;  4J8O A;  2WAC A;  3JB9 F;  2ALY A;  4YCU A;  1B70 B;  2LQK A;  3CCR T;  2L5Q A;  2P0L A;  4BWA A;  2KSS A;  1ASZ A;  1VQ6 A;  4C92 G;  4UPA A;  4X5O A;  3L2W A;  4RCC A;  3LH0 A;  4WJ3 M;  1VQN A;  3X28 B;  1JJC B;  4A4H A;  4M77 E;  4M7A C;  3A7A A;  2KK4 A;  4IUT A;  2QQR A;  2ZT8 A;  1USY A;  3NEN A;  2V8J A;  4E7J A;  3IAL A;  1NYR A;  2O4X B;  1EIF A;  2V8I A;  1BI0 A;  2ZCF B;  2OAU A;  2DTO A;  5I21 A;  4HT4 A;  3C4S A;  4PJO B;  2DQ3 A;  5J3B A;  3CME T;  4P73 A;  3FB9 A;  3REX A;  1IL2 A;  3OYD A;  3QJ6 A;  4IKF A;  2KAF A;  1N9W A;  1Z7N A;  2LTO A;  11AS A;  4OB1 B;  3R07 A;  2PU9 B;  3V7R A;  1NZ9 A;  4ZTF A;  3DSQ A;  2P5I A;  4FT4 A;  2DZ9 A;  3P8D A;  2QEX T;  2I2L A;  4QQG A;  4C0D C;  1Y7X A;  2X4W A;  3UDC A;  3J7A F;  1SRY A;  4LNS A;  2EQM A;  4L59 A;  4H2V A;  2MI6 A;  2DZC A;  5FU7 B;  3CCM A;  5LJ3 j;  2ZPH B;  2DXC A;  4DQ2 A;  1X6O A;  4LD9 K;  4IUP A;  3QBY A;  3OY9 A;  2DJZ A;  4BY6 C;  5A0L A;  1U8R A;  1N9R A;  4UP8 A;  4PJO C;  1G3W A;  3L42 A;  4HT9 A;  3DLM A;  4LDW A;  4NOY A;  4M7D B;  2PME A;  2RJC A;  2RHQ A;  3WQZ A;  2RM4 A;  2ZIN A;  3BDL A;  3ZEH A;  3I56 T;  1PYS A;  4IUV A;  2O01 E;  3X25 B;  3S3N A;  1YI2 A;  3OS0 A;  4GLK A;  3NEL A;  3HFV A;  4C8Q C;  2DAQ A;  4M75 D;  3JCM X;  4A4G A;  5AYF A;  3CCJ A;  5CCA A;  5GAN 5;  4OB3 B;  4N4H A;  2EAY A;  2LX9 A;  2XTI A;  3R6O A;  4B9W A;  2GFA A;  3N5B B;  1G5I A;  4XTX A;  2KQW A;  2LCC A;  4LVK A;  3E9F A;  3GNG A;  3X24 B;  4PJO A;  3OYI A;  5L8R E;  5KE2 A;  1U1T A;  2BUD A;  3HRU A;  4A53 A;  2GQV A;  3LWI A;  1NJ5 A;  2IVW A;  1YHQ A;  3PFS A;  4PJO E;  2Y4X A;  4QVD A;  1BIB A;  1VQ8 T;  3LGF A;  3M9Q A;  1VQ4 T;  4TVW A;  1VQO T;  5CK9 A;  3INZ A;  4M7D E;  5GAM d;  2B8A A;  4PHC A;  1M1G A;  5K1P A;  3CC4 T;  3PMT A;  3TCJ A;  2M1H A;  2X4Y A;  4M75 E;  1Q7Y U;  4AH6 A;  4BDZ A;  4E7K A;  1Z7M A;  1VQP T;  4M78 D;  4TVY A;  4CI0 C;  3HL8 A;  5LJ3 h;  1QVG A;  1RIQ A;  4P73 C;  4F7U A;  4WF2 A;  3BY7 A;  4CS3 A;  5IAY A;  3LSQ A;  3G7Z A;  4P3N A;  4GY5 A;  3HXW A;  4M77 B;  1OZ3 A;  1K8A C;  2PMF A;  2BIV A;  5J39 A;  5GAO r;  2XHC A;  3VJP A;  3CPW A;  4H2X B;  2XDP A;  3C94 A;  1G5V A;  1VQ9 A;  2I4O A;  1X2G A;  2ARU A;  2FYK A;  4P5N A;  2QA4 T;  4P3P A;  4HCB A;  1G3Y A;  3GIB A;  4HWT A;  1KQS A;  1PSF A;  2DTH A;  3J81 E;  5CKE A;  2ZPG B;  4IUR A;  2QHV A;  5ELN A;  2JOY A;  4ZN3 A;  2CZ7 B;  4OGC A;  2KVQ G;  3GNF B;  3HSB A;  3MEY A;  4J6W A;  3HPW A;  4M78 F;  4KUD K;  1ZHI A;  4TTV A;  1SER A;  3MET A;  3OYH A;  1KQ2 A;  4E47 A;  5GAO p;  3NFC A;  2E3C A;  2RI5 A;  1G3T A;  2CKK A;  1NPR A;  3P8H A;  2M9U A;  5LJ3 g;  4FU6 A;  1HC7 A;  2EQK A;  4YRC A;  3OYF A;  4M7A G;  4XU2 A;  4X9D A;  5DLO A;  3UGT A;  2CGH A;  1BYM A;  3M4G A;  1YJW T;  5KNN A;  3GP8 A;  5CKB A;  5LJ5 d;  1D3B B;  2FL7 A;  4BE2 A;  4M75 B;  3UH0 A;  1BIA A;  1EQR A;  1SSF A;  4KBM B;  3BJU A;  4YRJ A;  1KHI A;  3TEH B;  2ZCE A;  1VQ8 A;  4ME7 A;  4TQD A;  2ODR C;  1Q82 U;  2DQ0 A;  1NYQ A;  2HQX A;  2MAM A;  4CRI A;  4YRQ A;  1WPY A;  4J5Y A;  2A3L A;  5DLQ E;  3IKL A;  3HY0 A;  3DKM A;  4BB7 A;  1BI2 A;  3HXU A;  4RMF A;  3CPF A;  3IG2 A;  2RK1 A;  3V8K A;  1K8A U;  4YRT A;  4LVJ A;  4EX5 A;  4C8Q D;  4J83 A;  4C92 B;  3ME9 A;  2LT4 A;  12AS A;  1C0A A;  3HXZ A;  4J6X A;  2AMC A;  4FL6 A;  4M78 B;  4JLI A;  2K5F A;  4NS5 A;  3G6E T;  4LD6 A;  4M78 G;  1QP3 A;  1QF6 A;  2QEX A;  1ASY A;  3VKI A;  1KHC A;  1Q81 U;  1NJ1 A;  4M77 F;  1M1K C;  3HY1 A;  4XTZ A;  2ZPF B;  2E12 A;  4LVI A;  1NPP A;  4JJN K;  2WSE E;  1E24 A;  1YFR A;  3OA6 A;  3M53 A;  2D0Q B;  4QVC A;  4ELY C;  3MHX A;  5D6W A;  1W2B A;  1USY C;  1E22 A;  1YIT A;  3VQX A;  2HNI A;  4RCB A;  1X56 A;  2VYT A;  1I81 A;  4A4E A;  3EFR A;  3LX7 A;  4C92 C;  1QW1 A;  1YJW A;  1Q81 C;  5GAM e;  5KCH A;  4XEO A;  1WGS A;  4FM4 B;  2RA2 A;  1VQ5 T;  3CME A;  5A0G A;  3PNW C;  3CC7 T;  3REU A;  2ZNJ A;  4M7A B;  3QO8 A;  2IG0 A;  2F5T X;  4EPC A;  2X4J A;  4EDU A;  2AKW A;  3VQY A;  1JJC A;  4X34 A;  2AHJ B;  3A74 A;  2Q7G A;  4N0A C;  2BKD N;  3ASK A;  3JCM e;  2QQS A;  1K73 C;  3RF1 A;  4NL3 A;  2RJF A;  1UB4 A;  4NL2 A;  3CCQ A;  1S72 T;  4N4G A;  3QZ9 B;  3FJP A;  4OF1 A;  2ZT7 A;  3A5Y A;  3CMA T;  1ADJ A;  4XU0 A;  4D6W A;  1H4T A;  4RKU E;  3UGQ A;  2E41 A;  4C5G A;  3SWN B;  2ZTG A;  2XI9 A;  4OLF A;  2ALY B;  3HTZ A;  2EQU A;  2ZIM A;  3L1A A;  3CCQ T;  1S72 A;  4MZP A;  2XDB A;  4C5I A;  1Q7Y C;  4EMG A;  3CCS T;  3JCM f;  4M7D D;  3H8Z A;  3QHS A;  4YRE A;  1N6A A;  4LDY A;  2I4L A;  5EG2 A;  2LT1 A;  1EFW A;  3E19 A;  1YCY A;  4P74 A;  1ZQ1 A;  2RHX A;  4BI3 A;  4C92 E;  1KMM A;  5FU6 B;  3CCV T;  1YIJ T;  4QW2 A;  3S6W A;  4YRN A;  1M5Q 1;  3CCU A;  3OYE A;  5I2S A;  3VYH B;  3QTC A;  3OQ5 A;  1JJ2 S;  4MZT A;  1B76 A;  3VQW A;  1Q86 C;  3WXM B;  3O8V A;  3QUI A;  3HFZ A;  4DOW A;  1OI1 A;  4M7D C;  1UGS B;  2ZZD A;  4PG3 A;  2Q7E A;  2RI3 A;  3CCL A;  4TQF A;  1N8R C;  1YJN A;  4H2S A;  2RI2 A;  1WNL A;  3RKX A;  1XQH A;  1DJ7 B;  3RIR A;  2EQJ A;  1Y71 A;  4M75 C;  1H4V B;  2DIQ A;  2H3J A;  4Q15 A;  4C8Q G;  3M4P A;  3KXT A;  2LDM A;  5GAN 3;  2GFU A;  3LW5 E;  3JCM Q;  2CZ1 B;  4R55 A;  4R56 A;  5LJ5 h;  4BUG A;  3VV0 A;  1L0W A;  5FLX E;  3A8O B;  2L89 A;  4M7A E;  4M77 G;  2ZPB B;  4C92 D;  1EIY B;  2X4X A;  1B7Y A;  2P0Q A;  4HWR A;  3JB9 G;  2HAX A;  3PGG A;  1HXD A;  4C8Q B;  2C8M A;  2XD0 A;  3LLR A;  4P75 A;  3E9I A;  1XTD A;  4BY6 B;  3QO7 A;  2OTJ T;  2ZNI A;  5GAN 2;  4YDQ A;  1TH7 A;  3E1S A;  2JZ2 A;  3MQZ A;  1W4S A;  2R5M A;  4K87 A;  2DIG A;  4KUI A;  3OYG A;  1E1O A;  3OS1 A;  1KC8 C;  5GAM h;  3BDU A;  1B8A A;  4DOV A;  1YFT A;  3HFO A;  4P71 A;  1P92 A;  2C7I A;  1JRI A;  2E5A A;  3KUF A;  4F7U F;  1M1F A;  1N27 A;  3PCO B;  3EFS A;  3OS2 A;  3L2Q A;  4BDY A;  2CYZ B;  4HKE A;  3CCS A;  3JCM W;  2KMT A;  3A32 A;  1UGP B;  2XGT A;  1NJ2 A;  4KR2 A;  4KUL A;  3JCM b;  5CQX A;  4OB0 B;  5I2M A;  2CJ9 A;  5LJ5 f;  2EIF A;  4UP9 A;  4O5V A;  4YRF A;  5GAN 7;  3CC2 A;  3ICA A;  5HY6 A;  2RK2 A;  3RMQ A;  2K2V A;  3GF5 A;  4MZM A;  1YIJ A;  2J3M A;  1M8V A;  3HFN A;  2E64 A;  2QHU A;  3HRT A;  3RER A;  4CS2 A;  2XG8 D;  4M7D G;  3A8H B;  2LVM A;  2R5A A;  3A5Z B;  2XU8 A;  5C52 B;  1Y96 B;  4YRG A;  5HK0 A;  4M75 G;  4CH3 A;  2D9T A;  1XOV A;  5LL6 S;  1VQ7 T;  4CH4 A;  1WYD A;  2P4T A;  1YJN T;  2K5L A;  4PLL A;  4E7I A;  3M5A A;  2P0K A;  2FHD A;  3RKW A;  3Q1J A;  3HXX A;  3I55 T;  2RHS B;  5DY9 A;  3FIF A;  3RMS A;  2QDY B;  1EVK A;  3P8V A;  4PJO G;  3VU3 C;  1UEB A;  2RO0 A;  4A4K A;  3E9H A;  2Y90 A;  3TEE A;  4YRM A;  2ZZE A;  4FT2 A;  3ZBD A;  3SDZ A;  4XTY A;  4BI8 B;  5GMK h;  5A2Q E;  2EKO A;  3MP8 A;  4VUB A;  3CBM A;  2RJE A;  1W66 A;  4TVR A;  1PSE A;  3MF1 A;  2MWP A;  3HXV A;  2JN0 A;  3BW1 A;  2HQE A;  1U1S A;  1OYX A;  2RHU A;  2JVV A;  2V8K A;  2QHS A;  3CD6 A;  3SD4 A;  4LDV A;  3A31 A;  4XTU A;  1YBY A;  4JDS A;  4CS4 A;  4J15 A;  4YYE A;  3JB9 D;  2CZ0 B;  3HHT B;  4ELZ C;  3PZC A;  3QKJ A;  1VQ5 A;  2MWO A;  2PQW A;  5A0D A;  4QQ6 A;  3HRK A;  4RG2 A;  1BI1 A;  2KY9 A;  5K1X A;  2DU7 A;  4J7F A;  4OB2 B;  3JB9 H;  4E7H A;  1X54 A;  3GPL A;  2GF7 A;  4KT0 E;  1ADY A;  2ZT5 A;  4F7U G;  1JJ2 A;  4QVZ A;  1IRE B;  1YIT T;  1WJQ A;  3CEY A;  3CC7 A;  4XTV A;  1I5L A;  3A8M B;  2DVE A;  3FRN A;  4FIB A;  3OYC A;  3GOX A;  2RB6 A;  1VQK T;  3JCM c;  4BE0 A;  2QXF A;  3A8L B;  2JTM A;  1MGQ A;  2QA4 A;  4A54 A;  2JTF A;  4JLG A;  2NS6 A;  4YTL A;  5LJ5 j;  4MMK A;  4DA4 A;  2M0O A;  3WVE B;  3NTI A;  1IZ6 A;  4PJO F;  4EMH A;  1WLE A;  1B70 A;  3PT9 A;  4H2W A;  1PYS B;  3FC3 A;  3QYH B;  2QQ9 A;  2EJG A;  3M55 A;  2VC8 A;  3V8J A;  3MCA B;  3AHU A;  4BI4 A;  2VXF A;  3KBG A;  2EJ9 A;  2ZPI B;  4LDU A;  4RMO A;  5GAO l;  3FEO A;  5D6X A;  1LYL A;  3OW2 A;  3M57 A;  2DD5 A;  2Q5H A;  5HGQ A;  3LWH A;  1M1K U;  2E10 A;  1BBU A;  4M7A D;  1KG1 A;  5FRM A;  2DU5 A;  3OB9 A;  4M7A A;  2C06 A;  3CCM T;  1YHQ T;  2F5K A;  1VQ4 A;  4LVL A;  5KE3 A;  2DDZ A;  3CPW S;  2EFI A;  4C0Z A;  1BBW A;  1NJ8 A;  5C53 B;  2RHZ A;  2XIC A;  3OSV A;  4F7U B;  4HA8 A;  3TRE A;  1N8R U;  3PIP A;  3F70 A;  1QVF S;  4H2T A;  3CMA A;  5F5W A;  3OYM A;  3CC4 A;  2CIM A;  5CO7 A;  3X26 B;  5ELO A;  1D3B A;  2YLB A;  3M58 A;  4PJO D;  5GAN 4;  3NTK A;  1O75 A;  3ZFJ A;  2ZT6 A;  2JNG A;  3QII A;  4EMK A;  3A8G B;  5GAO q;  4J7I A;  4JRQ A;  4II1 A;  4WJ4 A;  4C8Q E;  1HTT A;  4YRR A;  2ZXF A;  2RJD A;  3HXY A;  3I7F A;  4M78 E;  4XAX B;  2Q5I A;  3W3S A;  5CKF A;  2MF2 A;  4C92 A;  3L4G B;  5CKH A;  1VQZ A;  4H02 A;  1MHN A;  5LJ3 d;  4P71 C;  2E6N A;  3VYG A;  5DM7 R;  3I56 A;  3KFU A;  2DXT A;  1BI3 A;  3M4Y A;  3OD1 A;  2K3X A;  2VGN A;  2ZGW A;  3OS5 A;  4UC4 A;  3L2Z A;  5GAN d;  3JAM E;  1QVG S;  4HCZ A;  4JRI A;  2OTJ A;  3CCE A;  1FYF A;  3JCM P;  3QSU A;  3LGL A;  3NEM A;  1VIF A;  2D6F A;  1G3S A;  5J26 A;  1G51 A;  4OVA A;  2LNV A;  4L87 A;  3JCM J;  4XU3 A;  1VQN T;  4YRS A;  3ER0 A;  3OMG A;  4Z02 A;  1VQP A;  2JUF A;  2RHQ B;  4YRP A;  1K9M U;  3URG A;  4LDX A;  2E1H A;  3QXE B;  4Q5W A;  1YFS A;  3MEW A;  2KDS A;  3QG1 A;  3QO5 A;  2EYQ A;  3L2U A;  5GAO n;  1EVL A;  3M54 A;  3CCV A;  2PVD B;  1X2H A;  4M7D F;  4IUU A;  2WSC E;  4M77 C;  4A4F A;  3M4Q A;  1QP2 A;  4L6V 5;  3CBO A;  2K4Y A;  4YPF A;  2ZZF A;  3HKS A;  3DB4 A;  2RHI A;  2DXB A;  4XEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...