2DXTA

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with atp and biotin, mutation d104a
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNAVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
total genus 70
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxtA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dxtA01
2I4MA 4KR2A 4P71A 1NYRA 1ATIA 4M77A 4JRKA 4H2VA 3A7RA 3RIRA 1C0AA 5C53B 1LNXA 2RM4A 4YPFA 1QF6A 1W66A 3W3SA 5GANj 3INZA 1X01A 3FIFA 1X54A 3L4GA 4RDXA 4OP0A 4CH6A 2E65A 4MMKA 3RERA 2E41A 3EFRA 3M4QA 5GAN2 3R07A 4XU0A 4TTVA 3QTCA 3HFZA 5GMKl 5KNNA 2EJFA 1N9WA 2ARSA 3V7SA 4L87A 1WPYA 4C92B 1YCYA 4XTUA 5HGQA 11ASA 1WNLA 5LJ3e 2ALYA 4YRRA 4CS2A 3A5YA 3QHSA 3KFUA 4HWTA 4YRLA 5LJ3d 4P3NA 4JLIA 4H2WA 4XTZA 3JB9D 2DTOA 1B70B 3FJPA 4DPGA 4M75C 3RKYA 4PJOG 3IG2A 5C52B 2E64A 4J6WA 2Q7GA 1B8AA 2ZCEA 1J5WA 3PGGA 4P74A 4F7UE 1Z7NA 5ELOA 3FB9A 1HTTA 3BFMA 3JCMX 1N9RA 4M75E 2IY5A 3TUPA 2AMCB 3BJUA 1ADJA 3IKLA 5GMKi 2AKWB 4C8QD 2C8MA 3TEHA 1SESA 2ZT6A 5GAOr 5LJ5e 4EMGA 4XTXA 3P8TA 3HFVA 3SWNC 5LJ5d 2J3MA 1EVKA 2DDZA 3CMQA 1D3BA 4C8QC 3JCMb 3REXA 3UGTA 2DEQA 3QO8A 3VBBA 4G85A 1KQ2A 1LJOA 1M8VA 2RD1A 5GAN8 3IKMB 3UH0A 4YRCA 1WYDA 4PJOA 4H2UA 5GMKm 4YCVA 1U1TA 4C8QE 5GANg 4M7AD 3WQZA 4KR3A 2ZXFA 4CH3A 4P3PA 1EQRA 2ZT7A 2E10A 3HRIA 4J6XA 1YFRA 3RACA 1WQWA 3RKWA 2DQ3A 1TH7A 4P72C 3JB9J 1KMMA 4F7UB 3SWNA 2PMFA 4C92G 3REUA 1Z7MA 3EFSA 4N0AA 4XTVA 4CS3A 3A74A 4M75B 4RMFA 3V8JA 4M7AE 1I4K1 4M78D 3RL6A 1PYSB 3GIBA 5LJ5f 2DVEA 1E1OA 2P0LA 1NJ6A 4YREA 4M77D 3HXXA 1Y96B 3JB9H 3A5ZA 4X9CA 4J6YA 1B7YB 1QE0A 3PCOB 3HRKA 4H2YA 3V8KA 2ARTA 3NENA 4Q6GA 2E3CA 2CJ9A 5CAIA 4Q15A 5LJ3h 4NL2A 5GAOp 2QHUA 2VC8A 4C92F 2Q5IA 3MEYA 1H4QA 4KQEA 2ZNIA 2RHQB 3E9HA 3I7FA 4C8QB 3HXYA 2ZZFA 4TVAA 1HC7A 4C92A 2ODRC 3G1ZA 2DJZA 1H4SA 4XU2A 4M77E 5GAN3 3V8LA 4K86A 4PHCA 3VU3C 4M7DD 2DU7A 4H2XA 1B70A 3VQWA 1LYLA 1GGMA 2E5AA 3QO5A 4P75A 3UGQA 1USYA 4YRPA 5LJ5h 1RIQA 4M7AB 5K1PA 1H4VB 4M7DC 1MGQA 2DXUA 2AKWA 4YRKA 2DKGA 1YFTA 2FB7A 3LC0A 2CJAA 1JJCB 4E51A 4M7DE 5DY9A 4BWAA 3HY0A 2RB6A 1X2HA 3A31A 4M75G 3L2ZA 4XEOA 1EVLA 5GAOl 3IALA 3JCMV 2ZZEA 4YP0A 3P8VA 1NJ1A 1NJ2A 4YCUA 1NJ8A 5LJ3j 3JCMc 5I21A 2Q7HA 5GMKe 1I81A 1I5LA 4PJOD 4M77B 4YCWA 5GAMe 4OLFA 1E1TA 3JCMe 1EIYA 1G51A 2E1HA 5GAMd 3JCMJ 4H2SA 1X55A 3JCMd 4P3OA 4F7UF 1ADYA 4C8QG 2ARUA 4F7UA 2RHSB 4TVYA 4M75F 2QHSA 2JN0A 4H02A 4M75A 2C7IA 5LJ3f 2Q5HA 5LJ5j 4K88A 4WF2A 4TVWA 2ALYB 1YB3A 3JB9F 1ASYA 4M7DB 3V7RA 1B34A 1BBWA 3AHUA 1Y96A 1B7YA 4Y91A 2ZT8A 12ASA 3RUXA 3BW1A 2I4OA 4M7AG 3L1AA 1WU7A 3SB2A 1L0WA 2G4CA 4M7AC 1NNHA 4QVCA 2ZTGA 3HSBA 3RKXA 5GAOm 1ASZA 4XTYA 1BBUA 4DQ2A 1M5Q1 4C8QF 1YFSA 4TWAA 2CGHA 2RHQA 4C8QA 1E22A 1KMNA 5F5WA 4A54A 3NETA 4YRFA 4HWOA 3QO7A 4QVDA 3HXWA 2EJ9A 2FYKA 4HA8A 2RA2A 3QO3A 4HT8A 1YGBA 2Q7EA 5LJ3g 4HT9A 5C51B 5GAN4 2P5IA 4YROA 3M4GA 4PG3A 4M78C 4H2TA 1JRIA 4XQ3A 4M7AF 2XGTA 5GAN5 2YLBA 2DTHA 4P71C 1SETA 4M77C 3QNEA 4M7AA 4P72A 4M78E 1JBMA 4P73C 2K57A 3A7UA 4EO4A 4J5YA 2DQ0A 2I2LA 4UPAA 1JJCA 3PZCA 2XTIA 2EL9A 3LSSA 1EOVA 2CJBA 1EFWA 5LJ5g 4CS4A 3QUIA 5GMKh 2ZR3A 3A7AA 4M78F 1FYFA 2DXTA 5GAMh 1BIBA 5GANe 3JCMh 2QHVA 4LNSA 2YHTA 1HXDA 3HFNA 5GAOn 4M77F 4M7DG 4ZIBA 1HK9A 1KQ1A 5GANd 4O2DA 2AMCA 3A32A 3JCMQ 1X2GA 4HWRA 4P73A 1NYQA 4J15A 4F7UG 1SERA 4P74C 3TEGA 3JCMW 4ZTZB 2HNIA 4MMLA 3V7CA 3RF1A 2RHSA 4JRIA 1H4TA 2I4NA 4EMKB 4YDQA 4M78B 3ICAA 3OD1A 4TVAB 4M75D 2ZNJA 3JB9G 4M7DF 2ZT5A 3BY7A 3UFGA 4M7DA 3MF2A 4TQFA 1B76A 3MF1A 4YRIA 2EJGA 4XTWA 5K1XA 1I8FA 2VXEA 3VQVA 4H2XB 2DTIA 4WJ4A 3LSQA 4CH4A 2CIMA 1G5IA 4PJOC 3L4GB 5GANf 4K87A 5GMKj 4XEMA 2ZR2A 4EX5A 2ZIOA 4X5OA 4YRMA 4YRQA 3HFZB 5GAMj 4PJOE 1PYSA 3HFOA 1VQZA 3NELA 4RQEA 4JUVA 4NCXA 2ZZGA 5GAN7 3E9IA 3RESA 3DSQA 1BIAA 4A53A 3PCOA 4N0AC 3HXUA 4UP9A 3HXVA 1NJ5A 3M4PA 4PJOF 2EWNA 4HVCA 2YLCA 1X56A 2QTXA 4X9DA 4RCBA 2IY5B 4TQDA 4PNOA 5GAMf 4YRJA 3VQXA 3QSUA 3ERRA 4AH6A 1KOGA 3JCMf 3TEHB 4C92D 1EIYB 4BW9A 5GAN6 5ELNA 1E24A 5GANh 4WI1A 2ZGWA 1WQ7A 3BDUA 4M78G 4EMKC 2I4LA 2ZINA 3NEMA 4YYEA 4YRTA 1D3BB 2PMEA 4WJ3M 4V2SA 4C92C 4M77G 3VQYA 5GAOq 4RCCA 1N9SA 4G84A 2DU5A 3HTZA 2Y90A 4PJOB 1G5HA 4UP8A 4ZTUB 3JB9I 2VXFA 4C92E 4XU3A 1B34B 4UP7A 3P8YA 1LOJA 4XU1A 4YRNA 1U1SA 2DZCA 2DZ9A 5GAMg 2J3LA 2QHTA 4HWPA 4P75C 2EAYA 2ODRD 3JCMg 4YRGA 4EMHA 1USYC 1SRYA 4YRSA 3RGLA 4CH5A 4RQFA 3SWNB 1H641 4HWSA 2ZIMA 4EMKA 4NL3A 1IL2A 3HY1A 3JCMP 4M78A 4NOYA 5E3IA 1WLEA 3HXZA
chains in the Genus database with same CATH superfamily
1QVGS 1YNZA 2RJDA 2EKHA 1X6OA 4X34A 3CC7T 3A5ZB 3CCRQ 2A0FB 2HQHA 3M4YA 4HCCA 2JT4A 5C53B 1KD1C 1QF6A 1QVFA 5GANj 1X01A 1QMCA 2OAUA 1X54A 1BYMA 4CH6A 4JJBA 2A08A 4E7ZA 1UGPB 2K5IA 3RR6A 5GMKl 5KNNA 1N9WA 1WPYA 4C92B 2CP6A 4PFOA 3QBYA 2JM8A 5J26A 4HWTA 2QA4Q 1W2BS 2FRYA 1OULA 4MDWA 1UJYA 2KT1A 4JLIA 4H2WA 1QCFA 3FJPA 4CC7A 3RKYA 1M9SA 1PCXA 5C52B 3C0CA 2D0QB 2E64A 1M90C 1B8AA 1UGSB 3BE3A 4F7UE 2OTJA 3EGXB 1D1BA 4HVVA 1RAIB 1NE8A 4AT1B 1KG1A 4ZTFA 1YJ9T 2AMCB 4DBFA 5DLQE 3TEHA 1BBZA 2ZT6A 1NBEB 5GAOr 5LJ5e 3L2UA 1N8RR 4EMGA 2LQNA 4XTXA 1A0NB 5HY6A 3HFVA 1T0HA 2J3MA 2DL8A 1PWTA 4LN2A 2CP0A 2K2MA 2HL5C 2CP3A 1VIEA 5IHKA 3OSSC 1RAHB 2CSIA 2NUPB 5CCAA 3OW2S 4G85A 1KQ2A 4FM4B 1LJOA 2DX1A 2D1XA 3QIIA 3IKMB 1V76A 5CIUA 1K8AU 1VQKA 1U1TA 3WXMB 1QQJA 4L6V5 4M7AD 4KR3A 2LZ6B 5FWBA 2DBKA 3D7SB 4JZ4A 3E9FA 2RQWA 1VIFA 2E10A 3HRIA 4RTUA 1VQPT 1IB8A 4OB3B 1YFRA 3G71T 1UB4A 3WVDB 3ASKA 2EYYA 3EFSA 4N0AA 4CS3A 4LE9A 2RJCA 2CUBA 3V8JA 4M7AE 1I4K1 1NYFA 3LX7A 1AWOA 1ZX6A 3GIBA 3OS1A 1E1OA 1TUGB 1X6BA 3UA6A 1ZSZC 3QDRB 1JXOA 1Y96B 4B9XA 1B7YB 2PVGB 4J6YA 3NENA 2FPFA 3L2RA 5LJ3h 3EG9B 1M3CA 1VQLT 4HCKA 2LCCA 2DERA 2QG9B 2BE7D 2COZA 4C92F 3I7FA 3HXYA 1YITT 5DLOA 4JRQA 3SHWA 3PFSA 1H4SA 2GFAA 3NFCA 3HRSA 4K86A 4QW2A 4M7DD 2X4WA 5LL6S 3H0IA 3X25B 1VYUA 3EGUA 3S6WA 2KBTA 3EAEA 4J9DA 3NMZC 2RHZA 1FYNA 4FL6A 5FROA 2E5AA 2YT6A 3VS2A 3N5BB 1RIQA 3H0FA 1ACMB 4BB7A 4M7DC 1VUBA 2BIVA 2C0IA 2H3JA 2F5TX 2DXUA 3CCJT 2AKWA 4YRKA 1YFTA 2FB7A 4F16A 2KXDA 1WXTA 4E51A 1NYGA 4M7DE 4BWAA 1BI1A 3A31A 4Z89A 2IIMA 2GTJA 3M0PA 1M3AA 1PD1A 4XEOA 2OTLT 3IALA 1I07A 4HKEA 3P8VA 1NJ2A 4YCUA 3JCMc 1EX4A 1H92A 1I5LA 4M77B 2F69A 1RAEB 1RL2A 1NEBA 4OLFA 2XDPA 1Q82U 4X1VA 2AKLA 3I55Q 1G51A 3CBPA 3NTKA 5GAMd 1CSKA 8ATCB 2XD0A 4H2SA 1VQ9Q 3TU4K 4E6RA 4C8QG 3I9QA 1UGRB 1ZUYA 1BKBA 4TVYA 3VYGA 4O5VA 1VQ6T 4LDVA 2QQSA 3QG1A 4ELYC 2ALYB 1YB3A 5HKCA 4TVRA 2VVKA 4GLKA 3A8GB 3RBBB 2J6KA 3OBWA 2V8IA 2DM1A 3VYHB 2G4CA 2J6FA 3VS0A 4DBQA 3EFOA 1SG5A 4FYYB 3GBQA 4C8QA 1KMNA 2RF0A 3NETA 1WJRA 2ATCB 4HA8A 4ZN1A 2LJ1A 1OEBA 2ZCFB 2JVVA 3EGDA 1T3LA 2KYBA 2JOYA 2DRKA 5GAN4 3J7AF 4YROA 1M1KU 3MP6A 3CCQA 2CP5A 1Q81U 1LCKA 4AFQC 2DTHA 4P71C 1SETA 4JDSA 4IUPA 2D8HA 1PKSA 3THKA 4P72A 4C5IA 2EYXA 5CKEA 1TWBA 1JBMA 1TSFA 3A7UA 4EO4A 4J5YA 1VQOQ 1JJCA 2EW3A 1ARKA 3G4SQ 1K8AR 2GNCA 3OMCA 3CEYA 4BE0A 5GMKh 2ZR3A 5FRMA 3DLMA 1BIBA 2CT4A 4R56A 3EGXA 2YHTA 1HXDA 5GAOn 4M77F 2L3RA 1K0XA 5FRNA 2J6OA 2EQIA 2KT8A 2LT4A 4Q5WA 2MCNA 2OTJT 2AMCA 3O5ZA 4BI8B 1NYQA 3QJ6A 1YIJA 1SERA 1U3OA 1MMNA 4M4ZA 3G6EQ 2DILA 2RHSA 3QXEB 4JRIA 4FYWB 3M58A 4LVKA 4M78B 3ICAA 1HSQA 3OD1A 4TVAB 1KD1U 5KCOA 2FHDA 4GY5A 1BU1A 3CC7A 2ZT5A 2LRQA 3HRUA 3UDCA 4IUVA 3MF1A 2AT1B 2EJGA 4XTWA 2LX7A 1I8FA 1TG0A 4J83A 1VQKT 2VXEA 1JJ2P 4WJ4A 2FL7A 5IN1A 3LSQA 1IGUA 5IH2A 4K87A 2YUQA 2LCLA 1ZSGA 3QWYA 4EX5A 2WSFE 3QWXX 2V1RA 4IUUA 3I56Q 1JEGA 3PE0A 1GBQA 5GAMj 3JV3A 4DOVA 1H3ZA 2KYMA 2RK2A 1UDLA 1VQ4A 5KCHA 1GCQA 1VQZA 3OY9A 1M90U 3S3MA 4JUVA 3EG2A 2P4TA 2X51A 2ZZGA 5FU6C 3RESA 4A53A 3HXUA 5A0LA 4RG2A 2LDMA 3M4PA 1W4SA 3EG9A 4PJOF 5FU7C 1X56A 4X9DA 4RCBA 2QDYB 4C0GA 1JQQA 2MWOA 2DO3A 2RQVA 4A63B 5GAMf 2IG0A 2E6NA 4AH6A 4HCZA 5C0MA 3TEHB 2QK0A 3VS1A 1YHQA 5ELNA 4J7IA 5GANh 1BK2A 4JS4A 3BDUA 2ZINA 1Q82R 4DOWA 4YYEA 1C1AA 2P0KA 2RHXA 4V2SA 4M77G 4WTOB 3CPWA 3GOXA 4G84A 2QQAA 2RHUA 4ESRA 2K5FA 2CZ0B 1IXDA 3J80E 2O31A 4LVMA 4EPCA 1X43A 4UP7A 2CKKA 3EG3A 2DZCA 2DZ9A 2QHTA 3F70A 1PG5B 4FT4A 3JCMg 3VS7A 4FSSA 3CMEA 4C5HA 2FVUA 2MWPA 4HWSA 2F2XA 2L3QA 1G8XA 4OB0B 1RLQC 3HY1A 4NOYA 1FMKA 1KC8C 4M77A 1VQ5Q 2R5AA 1K9AA 3T9NA 1J3TA 1VQMQ 2KNBB 1C0AA 2EVRA 2BKDN 4OGEA 1LNXA 4YPFA 3CCVQ 3W3SA 3FIFA 1VQNA 2QAZA 2JW4A 2E65A 2CDTA 4MMKA 3RERA 3EFRA 1M1KR 1X6GA 3NGPA 4IURA 4XU0A 4E7JA 3HFZA 4L87A 1YCYA 5HGQA 1WNLA 5LJ3e 1SSHA 3UA7A 2ALYA 4YRRA 2VWFA 3KFUA 3OYGA 1YCSB 1B07A 4XTZA 2L2PA 3JB9D 3SFMA 4PJJA 3FLGA 1EFNA 1ZSZB 1Q7YR 4M75C 2KVQG 4PJOG 4FT2A 2Q7GA 1TU0B 1J5WA 3PGGA 4P74A 4FW2A 1BI3A 3FB9A 2DEUA 3BFMA 1OPLA 3M0SA 4J9GA 1QWEA 1N9RA 4M75E 3CC4A 4WCIA 2DXBA 4UC4A 1O9SA 3GF5A 1ADJA 1SSFA 3MCAB 2DD4A 4LDUA 5I22A 2AKWB 4KH0B 2V26A 2LJ0A 2MI6A 4F14A 2O88A 2EBPA 4BY6C 2L5QA 4E7IA 2ROTA 2M51A 1VQ7A 3PMIA 2KRMA 2Z0WA 2NUTB 2RNAA 2DF6A 3CCMQ 2PQWA 3UGTA 1RAAB 3QO8A 1SRMA 1W70A 2AZSA 4PJOA 4H2UA 4Z8AA 4ATOA 4CH3A 1EQRA 2O01E 2ZT7A 1M2OA 1KD1R 2DMOA 3VS5A 1Y07A 1ZLMA 2LVMA 5EG2A 4FW1A 1XNIA 4J6XA 1Q86C 1CKAA 2RJFA 1WQWA 2PVOB 3CMAA 2DQ3A 2GCXA 1WHHA 2M0OA 1KMMA 3FC3A 2PMFA 4D8KA 1WLPB 3CCQQ 1WXUA 2YSQA 3META 4M78D 2F1LA 1PYSB 2F2VA 2ZPEB 4ZGEB 1MUZA 5LJ5f 4BD3A 4YREA 2K9GA 5D6WA 4C0DC 1QVFP 4C5GA 4X9CA 3PCOB 1M90R 4Q6GA 1WHJA 2E3CA 1UE9A 2CJ9A 2XMFA 3ME9A 5CAIA 4Q15A 5GJVB 4MZPA 1YIJT 3OYMA 5GAOp 2VC8A 2Q5IA 2ZNIA 4C8QB 2QASA 8AT1B 1HC7A 4TVAA 5GAN3 2HKNA 3EGDB 4PHCA 2M02A 2GF7A 3M55A 4RUGA 2DU7A 3VQWA 2YRCA 4KGXB 2K6DA 1N27A 4P5NA 1GGMA 1FXXA 3QO5A 4P75A 1USYA 2YRVA 1NPRA 1MGQA 1YWOA 1Y0MA 2WSCE 2DKGA 2CJAA 3C12A 1JJCB 4JJNK 3CC7Q 2GFUA 5DY9A 3LLRA 1VQ4T 2RB6A 3R6NA 1UECA 2D6FA 1YJWA 2WSEE 2CZ6B 5GAOl 1HD3A 2ZZEA 3OYNA 3PT9A 1UHCA 5DM7R 2XI9A 2K4YA 1NJ8A 3CC2A 5GMKe 2VASA 1YI2A 1H3HA 2LQWA 1PNJA 4YTLA 1PHTA 4A4HA 3H0HA 1BCOA 2EKOA 2KE9A 3C4SA 3JCMJ 9ATCB 2A8EA 2A37A 3JCMd 4P3OA 3HHTB 2EIFA 2ARUA 1YHQT 4F7UA 2RHSB 3EHRA 1M4ZA 2DVJA 4H02A 2ROLA 4PLIA 2HZYA 1YJ9Q 3RNJA 4WF2A 2FZGB 1ASYA 2O4XB 5AT1B 2J05A 1AEYA 3VV0A 5CR2A 4QQGA 2ZT8A 12ASA 3URGA 3BW1A 1G2BA 4M7AG 2I4OA 4N4IA 1PSFA 1WU7A 1L0WA 1W1FA 4M7AC 2ZTGA 3MPUB 3HSBA 2OAWA 1G3TA 2RHIA 1M5Q1 2RHYA 1VYTA 4PKCC 4C8QF 4TWAA 1D1CA 3ZEHA 1D1AA 3CMET 1E22A 7AT1B 4HXJA 4HWOA 3EG1A 1XTDA 2YDLA 3HXWA 5CQYA 2FYKA 3QO3A 2OJ2A 1QVFS 2E12A 3TSWA 5FWCA 5C51B 1VQPQ 2V1QA 3G71Q 4J9EA 4PG3A 4LVJA 4XQ3A 2YUNA 2G3RA 3M9QA 4M7AA 1VQNT 2LP5A 2X4YA 3M59A 3NTIA 4P73C 2K57A 3J81E 1QP2A 3PZCA 2PTKA 3E1SA 2PU9B 1YJNA 1AZEA 1N8RC 2MOXA 1EFWA 5LJ5g 1ZSZA 3CBMA 5FU6B 2YWWA 1VQLQ 3A7AA 2VYTA 5HK3A 2DXTA 2EGEA 5GAMh 5KYYB 1S1NA 1WHLA 3OS5A 5GANe 2QHVA 3HFNA 2VKNA 4M7DG 1AOJA 4ZIBA 1YITQ 1KQ1A 2KEAA 3M53A 1OZ3A 4KGZB 3A32A 2C06A 3CD6A 1PC0A 2HD0A 3CC4T 2DETA 3EHQA 2E3HA 4LDXA 3HP9A 1X2GA 3Q1JA 4P73A 3OMGA 1UEBA 3PIPA 3TEGA 1KC8U 1OQKA 2NUTA 4MMLA 3RF1A 3EG0A 2KK4A 1X75C 3PNWC 4CRIA 2VGMA 4DBRA 5CKDA 1VQ7T 4YDQA 2BZYA 1MV0B 2KROA 4BE2A 3TCJA 1UGVA 4RTWA 2ZNJA 1UHFA 3CCJQ 2ENMA 1MNEA 2JTEA 3UFGA 1GCPA 4O6JA 3L2WA 4M7DA 2ZPGB 2P4RA 5K1XA 4KULA 2LX9A 4LNPA 4CC2A 2QEXA 2OTLQ 1OX8A 1G5IA 3MP1A 3CXCA 1NJIU 2XDDA 4Z88A 2ZR2A 3A8LB 4QQ6A 3GLXA 4OF1A 3CMAT 4X5OA 3HFZB 3DLLA 1QLYA 1AWJA 1UGQB 3CCSA 1U8RA 1PYSA 1FMWA 3HFOA 1MHNA 2PUOB 3CCLT 1ZBXA 3E9IA 2CP2A 3DSQA 3PCOA 2EGAA 2HQXA 1H8KA 3MHXA 4Y92A 1RAFB 4UP9A 4HVWA 3OYIA 2IVWA 4BI3A 1VQ6Q 1NJ5A 3HKSA 2EWNA 3QJYA 2D0NA 1HJDA 4TQDA 4PNOA 3FRNA 2KXCA 3QSUA 1SRLA 1KOGA 3JCMf 4C92D 1MMAA 2LQKA 4BW9A 3KUFA 2NUZA 3CCUA 1KHCA 3X28B 2HQEA 2LCSA 4KUDK 1JXMA 4OMOA 1RAGB 2LMJA 4LDWA 2DA9A 3NEMA 3QZ9B 4XAXB 2I4LA 4IUTA 1ZHIA 2XHCA 3M0RA 1R77A 1D09B 4C92C 1M30A 2M9UA 2JNGA 2RI3A 1NPPA 4CI0C 2XU8A 2Y90A 1S72A 4PJOB 1G5HA 1VQ8T 3VKIA 3JB9I 1PRLC 2DYIA 2KI7A 3ULRB 4C92E 4E2FB 2KRNA 3HPWA 2RH2A 1LOJA 4XU1A 5L23A 3H9NA 3LGLA 2F5KA 2O2OA 2J3LA 2EAYA 2ODRD 2KY9A 4YRGA 4EMHA 2DLPA 4BY6B 1WYXA 4CH5A 4RQFA 2ZIMA 1YJWT 4AFZC 4RMOA 2M16A 4ME7A 5E3IA 4FU6A 2QQRA 4KR2A 4FIBA 2FO0A 4P71A 1Y7XA 1ATIA 4PLLA 1M8MA 3CC2T 1VYVA 4LUEA 3A7RA 4H2VA 3RIRA 1YI2T 1NLOC 1AVZC 5IXBA 1ZBJA 1W66A 3JAME 2AKKA 3RMSA 4D8DA 4RDXA 2QQBA 2EYQA 3CBOA 3M0TA 3S3OA 2D8JA 2L8DA 2E41A 1GXIE 3M4QA 1EZZB 3OB9A 1KHIA 2EJFA 2OTJQ 2FG0A 4XTUA 3CCRA 11ASA 2HDAA 4YRLA 1KQSA 2O4XA 2ESWA 4P3NA 3L2VA 5HK0A 2E5KA 3KFVA 3E2UA 2DTOA 4DPGA 5I2MA 3IG2A 4JLGA 4J6WA 1KSWA 2ZCEA 2JS0A 3BDLA 3UT1A 1Z7NA 5ELOA 2JMAA 3VRYA 3JCMX 1NG2A 3REAB 2IY5A 3RDVA 1NEGA 2AHJB 2QA4A 1KJWA 3BJUA 3IKLA 2B86A 3HL8A 5GMKi 2XG8D 1VQKQ 3P8TA 2HKQB 5LJ5d 3LWIA 4QT7A 3MP8A 2CH4A 4XK8E 1EVKA 4AMCA 2DDZA 3H8ZA 3VS3A 2KQWA 3CPWP 2EQKA 4FYVB 1D3BA 1M2VA 2DYBA 1NLPC 2DEQA 4E7KA 1T3SA 1KC8R 1M8VA 3CQTA 2RD1A 2BZ8A 5GAN8 4YRCA 5GMKm 2CP7A 4JJCA 2AK5A 1FWZA 1ABQA 4R0KA 1OOTA 2DFUA 1AHJB 2M0YA 2XKOC 2CYZB 5A0GA 3QYHB 2HL3A 2PVDB 1HYOA 3RACA 3I35A 3RKWA 2AZVA 4PFZA 1TH7A 4OB1B 3JB9J 4F7UB 1K1ZA 3REUA 1YJNT 3MEWA 4XTVA 5KYYA 2XDBA 2HCKA 4RMFA 2QGFB 1NJIR 4PFPA 4OGCA 4BI4A 2DVEA 1YBYA 1NJ6A 4M77D 3LGFA 4H2YA 1IZ6A 3TVTA 3HRKA 2ARTA 2K3XA 3OS2A 3CD6T 3MEAA 2W0ZA 3TQ7P 4RTYA 3LW5E 3MEVA 4LDYA 1RADB 3MEYA 1H4QA 4E7SA 3E9HA 3HTRA 1X2KA 4DBHA 2DJQA 3ZBDA 3G1ZA 2DJZA 2XIDA 4XU2A 1Z9ZA 2KAFA 4M77E 1TTHB 3OYLA 1MMDA 1D0YA 2FZCB 2PZ1A 4CC4B 5KE3A 1E7OA 1P92A 4MDXA 5AYFA 1B70A 2M1HA 2JMCA 1MMGA 2QYZA 2Y4XA 2JUFA 5C6SA 3E19A 1TOVA 2X35A 3UGQA 3H6ZA 1ZQ1A 3KXTA 1KK7A 3OYAA 4PK4A 4M7AB 2QEXT 2LJ3A 2CZ7B 1N8RU 3PVLA 2LNHB 1Q81R 4BDYA 1G83A 4E47A 3CCST 5CVIA 4M75G 3L2ZA 1K4US 4MZTA 2DIQA 1LPLA 3JCMV 1R0CB 4YP0A 2RJEA 4QVZA 2DL3A 2OX7A 2FRWA 1I81A 2EGCA 4PJOD 3QDFA 3VS4A 2ZZDA 3LWHA 5GAMe 1Y57A 1E1TA 1I0CA 1QVGA 3NHNA 2MMPA 4OMLA 1QCOA 2FPEA 1MV3A 1X55A 4F7UF 3CCET 3CPWS 3TEEA 1ADYA 2RPNA 3X26B 3CCUT 2LT1A 3OBYA 3OYKA 2JN0A 2GTOA 4M75A 1JU5C 1G5VA 2C7IA 2Y4YA 2IPOB 5GJWB 1K0SA 2K2VA 5LJ5j 1ZUUA 3I55A 4K88A 4RKUE 5KYUB 2EFIA 1VQ9A 4M7DB 3EH2A 3V7RA 1S72T 5IXFA 2P0PA 1BBWA 3AHUA 2YUPA 4GBQA 3I5RA 2OI3A 2K7AA 1W2BA 5KYXA 3CCUQ 4C0ZA 2C0OA 3SB2A 1SKUB 1OV3A 3RKXA 1BBUA 1NM7A 2E3IA 2ED1A 1YFSA 2CGHA 4JZ3A 2K79A 2DXCA 2RHQA 3A8OB 1GBRA 2MPXC 3CCLA 4A54A 3QO7A 4QVDA 1PKTA 2EJ9A 2RA2A 4HT8A 2RI2A 5LJ3g 4HT9A 2ZPFB 1YP5A 4LVLA 2QGGA 4M78C 4K11A 1UJ0A 2L3SA 4M7AF 1Q7YC 1WFWA 2QDLA 2YLBA 4ELZC 2HSEB 2V8JA 5GAN5 2RMOA 1WIEA 2VV5A 4M78E 5FW9A 2ZPHB 4A4KA 1U06A 3OW2A 5D6YA 2BTTA 2CS7A 4LD9K 4QKUA 2RO0A 2I2LA 2DQ0A 3VUBA 5KE2A 1EOVA 3CCRT 1YWPA 3P8HA 2AIRB 1G3WA 3QUIA 2J7IA 1YIJQ 5KH6A 3OYCA 1RUWA 1WDXA 1VQ8A 2VGNA 1CKBA 1IRXA 4Y28E 3JCMh 4HCBA 2MYSA 2CT3A 2P84A 1VQOA 4OVAA 4C5EA 2CZ1B 3G4SA 1OI1A 2SEMA 1GL5A 1TXQA 1XJWB 1YFNA 2ECZA 4PJLA 2FEIA 2C0TA 2RQRA 1YN8A 2QA4T 1Q95G 1QKWA 4F7UG 1WHGA 2HEQA 2DRMA 3JCMW 2HNIA 4N4GA 4EDUA 1VOMA 2YRDA 3FEOA 2I4NA 1WX6A 4AFUC 2ZPIB 1I5OB 1I1JA 1IGQA 4M7DF 4DEXA 3BY7A 2PNIA 1E6HA 4TQFA 2KDSA 1K73C 1B76A 1VQ4Q 1X27A 1BCMA 3G6EA 2B8AA 3NTHA 3SD4A 1WHKA 4ZGDB 4H2XB 1B7TA 1AZGB 4CH4A 2CIMA 4IUQA 5GANf 2YXYA 1OU9A 4XEMA 2GQVA 1K9MC 2HMAA 1G3YA 3LYIA 2YUOA 4EIKA 2LQ8A 3M0UA 1B3QA 6AT1B 2X3WD 2QQ9A 1K76A 1V29B 4NCXA 1X2QA 3TREA 1WHMA 1RACB 1BIAA 4N0AC 1UTIA 2VUBA 4DEYA 1YHQQ 3I56A 3HXVA 4RTZA 2SRCA 4HVCA 1SHFA 2QTXA 3R6OA 4A4FA 2COWA 1GFCA 2DD5A 2IY5B 1DJ7B 1UUEA 4YRJA 2MAMA 3ERRA 1EIYB 2RQUA 5GAN6 2ED0A 3MEUA 1E24A 1SPKA 2GQIA 2ZGWA 1ZA1B 1WQ7A 4EMKC 2CREA 4AG2C 4JS5A 4L5GA 1D3BB 1M2VB 4FSXA 1BI0A 3PIOA 4WJ3M 3VQYA 5GAOq 4RCCA 2K3YA 3CMEQ 1IO6A 2X9HA 3VS6A 3P8BB 2ZAEA 4ZTUB 2BZXA 2BE9B 1BB9A 2VXFA 3AT1B 4XU3A 1B34B 3C95A 4A4GA 4YRNA 1GFDA 1U1SA 3L2QA 5CO7A 4KGVB 1OZ2A 3MO8A 1QWFA 1SRYA 4YRSA 4B9WA 2DL5A 1H641 2FPDA 2DAQA 2HBPA 4OMPA 4EMKA 2A28A 3S3NA 4ZTJA 1IL2A 3JCMP 1VQNQ 2R58A 4JRPA 4MZMA 4LXCA 2I4MA 5FU7B 1NYRA 3A1PA 4LUDA 4JRKA 2XK0A 1TUCA 2A7YA 3VUZA 3JRZA 4J9BA 1WA7A 1KIKA 5CQXA 3CXCP 2CUDA 4IIMA 2NYSA 2RM4A 3HRTA 3OYEA 4J9FA 3INZA 3KBGA 3L4GA 4RTXA 4OP0A 2X4XA 1IHVA 5GAN2 2R57A 3R07A 2EQJA 4TTVA 3QTCA 2CSQA 3SDZA 2ARSA 1TUDA 1VQ5A 3V7SA 2E5QA 5CKBA 4PJMA 5M9OA 1PRMC 1VQMA 5KYUA 4CS2A 4RTVA 1SF9A 3A5YA 3CC4Q 3QHSA 3X24B 5LJ3d 3CCVA 1V1CA 3REBB 3I55T 1G3SA 3DB4A 2DPPB 2LTOA 4FYXB 4OMFB 1VQ9T 1B70B 5ECAA 4IKFA 1JB0E 1UFFA 1VQ7Q 2V8KA 2RQTA 3IQLA 1HTTA 5KYWA 3O8VA 2CH4W 3TUPA 1OX9A 4OB2B 4OMQA 4C8QD 2C8MA 1SESA 5J3BA 2JM9A 2O9VA 3CPFA 4N4HA 1Y71A 1C6VX 3WVEB 3SWNC 4RTTA 2HBWA 4RG8A 3TSZA 1VA7A 3CMQA 2EQMA 4C8QC 3JCMb 3REXA 3VBBA 3OSVA 4QQDA 3CMAQ 5CK9A 1KFZA 4KBMB 2MK5A 3UH0A 1WYDA 3X20B 4YCVA 4AG1C 4C8QE 2DL4A 5GANg 3WQZA 2ZXFA 5IHIA 4OMNA 2A3LA 4KUIA 3PTAA 1IHWA 4P3PA 3CCLQ 4GLMA 3MKDA 3CCEA 2FZKB 4LD6A 3GP8A 3CCMA 3P8DA 1PM3A 1O75A 2VB6A 4IIOA 4P72C 1WJQA 3SWNA 4C92G 5D7UA 1Z7MA 1OYXA 4JPBW 3A74A 3G1JA 1JO8A 4M75B 4OMMA 2D9TA 2JS2A 1Q86U 3RL6A 1ZA2B 2K3BA 2P0LA 1U5SA 4DA4A 3HXXA 1VQOT 3G4ST 3JB9H 1EIFA 3A5ZA 3G7ZA 1Z9QA 3M57A 4D6WA 5A0DA 1QE0A 3V8KA 5KYXB 3M0QA 2H3EB 4R55A 3OYJA 3H41A 2JZ2A 2BUDA 4NL2A 2QHUA 1QCNA 1SHGA 2COYA 5EC7A 1M1GA 2MIOA 4KQEA 1VQ8Q 2RHQB 3PVQA 2ZZFA 5CKFA 3GNFB 2NWMA 4C92A 2ODRC 1KQSP 2E6ZA 3V8LA 3M56A 3LH0A 1Q7YU 3JSCA 1MNDA 2KR3A 3QKJA 2RK1A 3VU3C 2MF2A 3CXCS 2KSSA 4H2XA 2ZPBB 2DK3A 1D0XA 1LYLA 4FCYA 4KT0E 4VUBA 3G6ET 1ZUKA 1YJWQ 3C94A 4B6MA 4YRPA 5LJ5h 5K1PA 3UWNA 1H4VB 4KRTA 5CKHA 3CC2Q 3LC0A 1LVKA 1RLPC 1SEMA 2X4JA 1T0JA 4ZN3A 5HCKA 1YI2Q 5A2QE 3HY0A 2NLUA 1X2HA 1M27C 4A4EA 1FX7A 2E70A 4ORZA 1EVLA 1NZ9A 1IREB 2JJ9A 4C0DB 1AWWA 1OPKA 4F17A 4AFSC 2NUPA 1NJ1A 1GCQC 1XQHA 5LJ3j 4LVIA 5I21A 1R8OB 1N5ZA 3I56T 5KYNA 2Q7HA 4KH1B 4YCWA 3I5SA 2KGTA 1TS9A 2JTMA 3JCMe 1EIYA 2E1HA 2H8HA 2ABLA 1QP3A 4BDZA 1W6XA 1K8AC 2EYZA 2RN8A 2WACA 4M75F 1K73U 2QHSA 3SEMA 2LC4A 1R0BG 2W10A 3ZFJA 2DL7A 4J9IA 5LJ3f 3OS0A 2Q5HA 3OYFA 3LH5A 4TVWA 3JB9F 1K9MU 1B34A 1Y96A 3OYBA 4E7LA 1B7YA 4Y91A 3RUXA 4HT4A 1ABOA 2KMTA 3L1AA 1JJ2A 2HAXA 1NNHA 4QVCA 3UATA 5GAOm 1ASZA 4XTYA 1RI0A 2F2WA 5I11A 4DQ2A 1YJ9A 1AT1B 4ZNXA 1OU8A 2O9SA 5F5WA 3QPHA 3NPFA 4YRFA 2QTVA 1YGBA 2Q7EA 1M1FA 2P5IA 1XOVA 2XICA 3QYGB 3M4GA 3DB3A 4H2TA 1JRIA 2QI2A 3ZL7C 1YJNQ 4HVUA 2XGTA 3ER0A 4M77C 3QNEA 2NS6A 2L0AA 2LNVA 3FDRA 2EPDA 1KQSS 4NS5A 4PJNA 2DE0X 1VQPA 1WGSA 3G71A 4UPAA 2XTIA 1VQ5T 2EL9A 4JJDA 3LSSA 1WXBA 2CJBA 3CD6Q 1VQMT 3GNGA 4CS4A 3CCVT 4M78F 1QVPA 1FYFA 3A98A 4LNSA 3OYHA 1HK9A 5IHNA 5GANd 4O2DA 1QVGP 3M54A 2P0QA 1X69A 1Q86R 3JCMQ 4HWRA 1WZOA 1VQLA 4J15A 4P74C 1C0MA 2DIGA 4ZTZB 3L42A 3V7CA 1YITA 3OQ5A 4EMKB 2HSPA 1Q82C 2J06A 2QEXQ 4C0FA 2E4HA 4M75D 3JB9G 2I0NA 1N6AA 1NJIC 1WI7A 5D6XA 4F04B 3MQZA 3UF4A 3MF2A 3CCSQ 1JJ2S 1W2BP 4YRIA 4BUGA 1WJSA 3VQVA 1AWXA 5L8RE 2DBMA 2DTIA 4PJOC 2QXFA 3L4GB 3CCMT 4ANJA 5GMKj 3CCJA 2EYWA 4BE1A 2EQUA 2ZIOA 3FJ5A 3OYYA 4YRMA 5FLXE 4YRQA 2DNUA 3GPLA 4PJOE 4Z02A 3NELA 4RQEA 2JXBA 4II1A 1GRIA 5GAN7 1RI9A 2OTLA 3QZ5B 5IT9E 3U23A 3CCEQ 2L89A 4PL6A 1PSEA 3A8HB 3DKMA 1QKXA 1D0ZA 3UPUA 1FMVA 2PUKB 4L59A 2YLCA 5KYWB 3CCQT 4BACA 3OW2P 3A8MB 3VRZA 1M1KC 1AD5A 2G6FX 3VQXA 4E7HA 1Q81C 1S72Q 1UG1A 3VJPA 4ZGJB 2X3XD 1RABB 4WI1A 1BI2A 1VQ6A 2KRSA 3M5AA 2GGRA 2K5LA 4M78G 1QW1A 3E9GA 4YRTA 2PMEA 4J9HA 2JTFA 4J9CA 1N9SA 2DU5A 3HTZA 4UP8A 2A36A 3MJXA 1K73R 2RI5A 4CC3A 4J8OA 5J39A 2GBQA 3OYDA 3P8YA 4J7FA 3OA6A 5GAMg 4HWPA 2R5MA 4P75C 1USYC 1PD0A 1K9MR 3RGLA 5I2SA 3SWNB 3EH1A 5IAYA 2L3PA 3PMTA 4NL3A 1E6GA 3EFOB 4M78A 3RMQA 1H4TA 1F1BB 1WLEA 3HXZA 1M3BA
chains in the Genus database with same CATH topology
1QVGS 2RJDA 1X6OA 4X34A 3CC7T 3A5ZB 3M4YA 4HCCA 5C53B 1KD1C 1QF6A 1QVFA 5GANj 1X01A 2OAUA 1X54A 1BYMA 4CH6A 1UGPB 2K5IA 5GMKl 5KNNA 1N9WA 1WPYA 4C92B 3QBYA 5J26A 4HWTA 1W2BS 4MDWA 4JLIA 4H2WA 3FJPA 3RKYA 1M9SA 5C52B 2D0QB 2E64A 1M90C 1B8AA 1UGSB 4F7UE 2OTJA 1NE8A 1KG1A 4ZTFA 1YJ9T 2AMCB 5DLQE 3TEHA 2ZT6A 5GAOr 5LJ5e 3L2UA 4EMGA 4XTXA 5HY6A 3HFVA 2J3MA 1VIEA 3OSSC 5CCAA 4G85A 3OW2S 1KQ2A 4FM4B 1LJOA 3QIIA 3IKMB 5CIUA 1K8AU 1VQKA 1U1TA 3WXMB 4L6V5 4M7AD 4KR3A 3E9FA 1VIFA 2E10A 3HRIA 1VQPT 1YFRA 4OB3B 3G71T 1UB4A 3WVDB 3ASKA 3EFSA 4N0AA 4CS3A 2RJCA 3V8JA 4M7AE 1I4K1 3LX7A 3GIBA 3OS1A 1E1OA 3QDRB 1Y96B 4B9XA 1B7YB 2PVGB 4J6YA 3NENA 3L2RA 5LJ3h 1VQLT 2LCCA 4C92F 3I7FA 3HXYA 1YITT 5DLOA 4JRQA 3PFSA 1H4SA 2GFAA 3NFCA 3HRSA 4K86A 4QW2A 4M7DD 2X4WA 5LL6S 3X25B 3S6WA 3EAEA 2RHZA 4FL6A 5FROA 2E5AA 3N5BB 1RIQA 4BB7A 4M7DC 1VUBA 2BIVA 2H3JA 2F5TX 2DXUA 3CCJT 2AKWA 4YRKA 1YFTA 2FB7A 4E51A 4M7DE 4BWAA 1BI1A 3A31A 4XEOA 2OTLT 3IALA 4HKEA 3P8VA 1NJ2A 4YCUA 3JCMc 1I5LA 4M77B 2F69A 1RL2A 4OLFA 2XDPA 1Q82U 1G51A 3CBPA 3NTKA 5GAMd 2XD0A 4H2SA 3TU4K 4C8QG 1UGRB 1BKBA 4TVYA 3VYGA 4O5VA 1VQ6T 4LDVA 2QQSA 3QG1A 4ELYC 2ALYB 1YB3A 5HKCA 4TVRA 4GLKA 3A8GB 3OBWA 2V8IA 3VYHB 2G4CA 4C8QA 1KMNA 3NETA 1WJRA 4HA8A 4ZN1A 2ZCFB 2JVVA 5GAN4 2JOYA 3J7AF 4YROA 1M1KU 3MP6A 3CCQA 1Q81U 2DTHA 4P71C 1SETA 4JDSA 4IUPA 4P72A 4C5IA 5CKEA 1JBMA 3A7UA 4EO4A 4J5YA 1JJCA 3OMCA 3CEYA 4BE0A 5GMKh 2ZR3A 5FRMA 3DLMA 1BIBA 4R56A 2YHTA 1HXDA 5GAOn 4M77F 2L3RA 5FRNA 2LT4A 4Q5WA 2OTJT 2AMCA 4BI8B 1NYQA 3QJ6A 1YIJA 1SERA 2RHSA 3QXEB 4JRIA 3M58A 4LVKA 4M78B 3ICAA 3OD1A 4TVAB 1KD1U 5KCOA 2FHDA 4GY5A 3CC7A 2ZT5A 2LRQA 3HRUA 3UDCA 4IUVA 3MF1A 1VQKT 2EJGA 4XTWA 1I8FA 4J83A 2VXEA 4WJ4A 2FL7A 5IN1A 3LSQA 4K87A 2LCLA 4EX5A 2WSFE 4IUUA 5GAMj 4DOVA 1H3ZA 2RK2A 1VQ4A 5KCHA 1VQZA 3OY9A 1M90U 3S3MA 4JUVA 2P4TA 2ZZGA 5FU6C 3RESA 4A53A 3HXUA 5A0LA 4RG2A 2LDMA 3M4PA 1W4SA 4PJOF 5FU7C 1X56A 4X9DA 4RCBA 2QDYB 4C0GA 2MWOA 2DO3A 5GAMf 2IG0A 2E6NA 4AH6A 4HCZA 5C0MA 3TEHB 1YHQA 5ELNA 4J7IA 5GANh 4JS4A 3BDUA 2ZINA 4DOWA 4YYEA 2P0KA 2RHXA 4V2SA 4M77G 3CPWA 3GOXA 4G84A 2QQAA 2RHUA 2K5FA 2CZ0B 3J80E 4LVMA 4EPCA 4UP7A 2CKKA 2DZCA 2DZ9A 2QHTA 3F70A 4FT4A 3JCMg 3CMEA 4C5HA 2FVUA 2MWPA 4HWSA 4OB0B 3HY1A 4NOYA 1KC8C 4M77A 2R5AA 3T9NA 1C0AA 2BKDN 4OGEA 1LNXA 4YPFA 3W3SA 3FIFA 1VQNA 2E65A 4MMKA 3RERA 3EFRA 4IURA 4XU0A 4E7JA 3HFZA 4L87A 1YCYA 5HGQA 1WNLA 5LJ3e 2ALYA 4YRRA 3KFUA 3OYGA 4XTZA 3JB9D 3SFMA 3FLGA 4M75C 2KVQG 4PJOG 4FT2A 2Q7GA 1J5WA 3PGGA 4P74A 1BI3A 3FB9A 3BFMA 1N9RA 4M75E 3CC4A 2DXBA 4UC4A 1O9SA 3GF5A 1ADJA 1SSFA 3MCAB 2DD4A 4LDUA 2AKWB 2MI6A 4BY6C 2L5QA 4E7IA 1VQ7A 3PMIA 2PQWA 3UGTA 3QO8A 4PJOA 4H2UA 4ATOA 4CH3A 1EQRA 2O01E 2ZT7A 1Y07A 2LVMA 5EG2A 1XNIA 4J6XA 1Q86C 2RJFA 1WQWA 2PVOB 3CMAA 2DQ3A 2GCXA 2M0OA 1KMMA 3FC3A 2PMFA 3META 4M78D 1PYSB 2ZPEB 4ZGEB 5LJ5f 4BD3A 4YREA 5D6WA 4C0DC 4C5GA 4X9CA 3PCOB 4Q6GA 2E3CA 2CJ9A 3ME9A 5CAIA 4Q15A 4MZPA 1YIJT 3OYMA 5GAOp 2VC8A 2Q5IA 2ZNIA 4C8QB 4TVAA 1HC7A 5GAN3 4PHCA 2GF7A 3M55A 2DU7A 3VQWA 1N27A 4P5NA 1GGMA 1FXXA 3QO5A 4P75A 1USYA 2YRVA 1NPRA 1MGQA 2WSCE 2DKGA 2CJAA 3C12A 1JJCB 4JJNK 2GFUA 5DY9A 3LLRA 1VQ4T 2RB6A 2D6FA 1YJWA 2WSEE 2CZ6B 5GAOl 2ZZEA 3OYNA 3PT9A 5DM7R 2XI9A 2K4YA 1NJ8A 3CC2A 5GMKe 1YI2A 4YTLA 4A4HA 2EKOA 3C4SA 3JCMJ 2A8EA 3JCMd 4P3OA 3HHTB 2EIFA 2ARUA 1YHQT 4F7UA 2RHSB 1M4ZA 4H02A 4PLIA 4WF2A 1ASYA 2O4XB 3VV0A 5CR2A 4QQGA 2ZT8A 12ASA 3URGA 3BW1A 2I4OA 4M7AG 4N4IA 1PSFA 1WU7A 1L0WA 4M7AC 2ZTGA 3HSBA 1G3TA 2RHIA 1M5Q1 2RHYA 4PKCC 4C8QF 4TWAA 3ZEHA 3CMET 1E22A 4HWOA 1XTDA 3HXWA 5CQYA 2FYKA 3QO3A 1QVFS 2E12A 5C51B 4PG3A 4LVJA 4XQ3A 2G3RA 3M9QA 4M7AA 1VQNT 2X4YA 3M59A 3NTIA 4P73C 2K57A 3J81E 1QP2A 3PZCA 3E1SA 2PU9B 1YJNA 1N8RC 1EFWA 5LJ5g 3CBMA 5FU6B 3A7AA 2VYTA 5HK3A 2DXTA 5GAMh 5GANe 3OS5A 2QHVA 4ZIBA 3HFNA 4M7DG 1KQ1A 3M53A 1OZ3A 3A32A 2C06A 3CD6A 2HD0A 3CC4T 4LDXA 1X2GA 3HP9A 3Q1JA 4P73A 3OMGA 1UEBA 3PIPA 3TEGA 1KC8U 4MMLA 3RF1A 2KK4A 1X75C 3PNWC 4CRIA 2VGMA 5CKDA 1VQ7T 4YDQA 4BE2A 3TCJA 2ZNJA 3UFGA 4O6JA 3L2WA 4M7DA 2ZPGB 5K1XA 4KULA 2LX9A 2QEXA 1G5IA 3MP1A 3CXCA 1NJIU 2XDDA 2ZR2A 3A8LB 3GLXA 4QQ6A 4OF1A 3CMAT 4X5OA 3HFZB 3DLLA 1UGQB 3CCSA 1U8RA 1PYSA 3HFOA 1MHNA 2PUOB 3CCLT 1ZBXA 3E9IA 3DSQA 3PCOA 2HQXA 3MHXA 4UP9A 3OYIA 2IVWA 4BI3A 1NJ5A 3HKSA 2EWNA 3QJYA 4TQDA 4PNOA 3FRNA 3QSUA 1KOGA 3JCMf 4C92D 4BW9A 2LQKA 3KUFA 3CCUA 1KHCA 3X28B 2HQEA 4KUDK 4LDWA 3NEMA 3QZ9B 4XAXB 2I4LA 4IUTA 1ZHIA 2XHCA 4C92C 2M9UA 2JNGA 2RI3A 1NPPA 4CI0C 2XU8A 2Y90A 1S72A 4PJOB 1G5HA 1VQ8T 3VKIA 3JB9I 4C92E 3HPWA 2RH2A 1LOJA 4XU1A 3LGLA 2F5KA 2J3LA 2EAYA 2ODRD 2KY9A 4YRGA 4EMHA 4BY6B 4CH5A 4RQFA 2ZIMA 1YJWT 4RMOA 2M16A 4ME7A 5E3IA 4FU6A 2QQRA 4KR2A 4FIBA 4P71A 1Y7XA 1ATIA 4PLLA 3CC2T 4H2VA 3A7RA 3RIRA 1YI2T 1W66A 3JAME 3RMSA 4RDXA 2QQBA 2EYQA 3CBOA 3S3OA 2L8DA 2E41A 1GXIE 3M4QA 3OB9A 1KHIA 2EJFA 4XTUA 3CCRA 11ASA 4YRLA 1KQSA 2O4XA 4P3NA 3L2VA 5HK0A 2DTOA 4DPGA 5I2MA 3IG2A 4JLGA 4J6WA 2ZCEA 3BDLA 3UT1A 1Z7NA 5ELOA 3JCMX 2IY5A 2AHJB 2QA4A 3BJUA 3IKLA 3HL8A 5GMKi 2XG8D 3P8TA 5LJ5d 3LWIA 3MP8A 1EVKA 4XK8E 2DDZA 3H8ZA 2KQWA 2EQKA 1D3BA 2DEQA 4E7KA 1M8VA 2RD1A 5GAN8 4YRCA 5GMKm 1FWZA 1AHJB 2XKOC 2CYZB 5A0GA 3QYHB 2PVDB 3RACA 3RKWA 1TH7A 4OB1B 3JB9J 4F7UB 3REUA 1YJNT 3MEWA 4XTVA 2XDBA 4RMFA 4OGCA 4BI4A 2DVEA 1YBYA 1NJ6A 4M77D 3LGFA 4H2YA 1IZ6A 3HRKA 2ARTA 2K3XA 3OS2A 3CD6T 3MEAA 3LW5E 3MEVA 4LDYA 3MEYA 1H4QA 3E9HA 3ZBDA 3G1ZA 2DJZA 2XIDA 4XU2A 4M77E 2KAFA 3OYLA 5KE3A 1P92A 4MDXA 5AYFA 1B70A 2M1HA 2Y4XA 2JUFA 5C6SA 3E19A 3UGQA 2X35A 3H6ZA 1ZQ1A 3KXTA 3OYAA 4M7AB 2QEXT 2CZ7B 1N8RU 4BDYA 4E47A 3CCST 5CVIA 4M75G 3L2ZA 4MZTA 2DIQA 3JCMV 4YP0A 2RJEA 4QVZA 1I81A 4PJOD 2ZZDA 3LWHA 5GAMe 1E1TA 1QVGA 2MMPA 1X55A 4F7UF 3CCET 3CPWS 3TEEA 1ADYA 3X26B 3CCUT 2LT1A 3OBYA 3OYKA 2JN0A 4M75A 1G5VA 2C7IA 2Y4YA 2K2VA 5LJ5j 4K88A 3I55A 4RKUE 2EFIA 1VQ9A 4M7DB 3V7RA 1S72T 2P0PA 1BBWA 3AHUA 1W2BA 4C0ZA 3SB2A 3RKXA 1BBUA 1YFSA 2CGHA 2DXCA 2RHQA 3A8OB 3CCLA 4A54A 3QO7A 4QVDA 2EJ9A 2RA2A 4HT8A 2RI2A 5LJ3g 4HT9A 2ZPFB 4LVLA 4M78C 4M7AF 1Q7YC 5GAN5 2YLBA 4ELZC 2V8JA 2VV5A 4M78E 2ZPHB 4A4KA 3OW2A 5D6YA 2CS7A 4LD9K 2DQ0A 2RO0A 2I2LA 3VUBA 5KE2A 1EOVA 3CCRT 3P8HA 3QUIA 1G3WA 5KH6A 3OYCA 1VQ8A 2VGNA 4Y28E 3JCMh 4HCBA 1VQOA 4OVAA 4C5EA 2CZ1B 3G4SA 1OI1A 2QA4T 4F7UG 3JCMW 2HNIA 4N4GA 4EDUA 3FEOA 2I4NA 2ZPIB 4M7DF 3BY7A 4TQFA 2KDSA 1K73C 1B76A 3G6EA 2B8AA 3NTHA 3SD4A 4ZGDB 4H2XB 4CH4A 2CIMA 4IUQA 5GANf 4XEMA 2GQVA 1K9MC 1G3YA 3LYIA 2LQ8A 2QQ9A 1V29B 4NCXA 3TREA 1BIAA 4N0AC 2VUBA 3I56A 3HXVA 4HVCA 3R6OA 2QTXA 4A4FA 2DD5A 2IY5B 1DJ7B 4YRJA 2MAMA 3ERRA 1EIYB 5GAN6 3MEUA 1E24A 2ZGWA 1WQ7A 4EMKC 4JS5A 4L5GA 1D3BB 4FSXA 1BI0A 3PIOA 4WJ3M 3VQYA 5GAOq 4RCCA 2K3YA 3P8BB 4ZTUB 2VXFA 4XU3A 1B34B 3C95A 4A4GA 4YRNA 1U1SA 3L2QA 5CO7A 1OZ2A 3MO8A 1SRYA 4YRSA 4B9WA 1H641 4EMKA 2DAQA 2HBPA 4ZTJA 3S3NA 1IL2A 3JCMP 4JRPA 2R58A 4MZMA 2I4MA 5FU7B 1NYRA 4JRKA 2XK0A 2A7YA 3VUZA 3JRZA 5CQXA 2RM4A 3HRTA 3OYEA 3INZA 3KBGA 3L4GA 4OP0A 2X4XA 5GAN2 3R07A 2R57A 2EQJA 4TTVA 3QTCA 3SDZA 2ARSA 1VQ5A 3V7SA 2E5QA 5CKBA 5M9OA 1VQMA 4CS2A 3A5YA 3QHSA 3X24B 5LJ3d 3CCVA 3I55T 1G3SA 3DB4A 2DPPB 2LTOA 4OMFB 1VQ9T 1B70B 4IKFA 1JB0E 2V8KA 1HTTA 3O8VA 3TUPA 4OB2B 4C8QD 2C8MA 1SESA 5J3BA 3CPFA 4N4HA 1Y71A 3WVEB 3SWNC 4RG8A 3CMQA 2EQMA 4C8QC 3JCMb 3REXA 3VBBA 3OSVA 4QQDA 5CK9A 4KBMB 3UH0A 1WYDA 3X20B 4YCVA 4C8QE 5GANg 3WQZA 2ZXFA 2A3LA 4KUIA 3PTAA 4P3PA 3CCEA 4LD6A 3GP8A 3CCMA 3P8DA 1O75A 4P72C 1WJQA 3SWNA 4C92G 1Z7MA 1OYXA 3A74A 4M75B 2D9TA 1Q86U 3RL6A 2P0LA 4DA4A 3HXXA 1VQOT 3G4ST 3JB9H 1EIFA 3A5ZA 3G7ZA 4D6WA 3M57A 5A0DA 1QE0A 3V8KA 4R55A 3OYJA 2JZ2A 2BUDA 4NL2A 2QHUA 1M1GA 4KQEA 2RHQB 2ZZFA 5CKFA 3GNFB 4C92A 2ODRC 2E6ZA 3V8LA 3M56A 3LH0A 1Q7YU 3JSCA 3QKJA 2RK1A 3VU3C 2MF2A 3CXCS 2KSSA 4H2XA 2ZPBB 1LYLA 2DK3A 4KT0E 4VUBA 3G6ET 3C94A 4YRPA 5LJ5h 5K1PA 3UWNA 1H4VB 5CKHA 3LC0A 2X4JA 4ZN3A 5A2QE 3HY0A 2NLUA 1X2HA 4A4EA 1FX7A 2E70A 1EVLA 1IREB 1NZ9A 4C0DB 1NJ1A 1XQHA 5LJ3j 4LVIA 5I21A 1R8OB 3I56T 2Q7HA 4YCWA 2JTMA 3JCMe 1EIYA 2E1HA 1QP3A 4BDZA 1K8AC 2WACA 4M75F 1K73U 2QHSA 2LC4A 3ZFJA 5LJ3f 3OS0A 2Q5HA 3OYFA 4TVWA 3JB9F 1K9MU 1B34A 1Y96A 3OYBA 4E7LA 1B7YA 4Y91A 3RUXA 4HT4A 2KMTA 3L1AA 1JJ2A 2HAXA 1NNHA 4QVCA 5GAOm 1ASZA 4XTYA 1RI0A 1YJ9A 4DQ2A 5F5WA 3QPHA 4YRFA 1YGBA 2Q7EA 1M1FA 2P5IA 1XOVA 2XICA 3QYGB 3M4GA 3DB3A 4H2TA 1JRIA 2QI2A 2XGTA 3ER0A 4M77C 3QNEA 2NS6A 2LNVA 3FDRA 1KQSS 4NS5A 1VQPA 1WGSA 3G71A 4UPAA 2XTIA 1VQ5T 2EL9A 3LSSA 2CJBA 1VQMT 3GNGA 4CS4A 3CCVT 4M78F 1QVPA 1FYFA 4LNSA 3OYHA 1HK9A 5GANd 4O2DA 3M54A 2P0QA 3JCMQ 4HWRA 1VQLA 4J15A 4P74C 2DIGA 4ZTZB 3L42A 3V7CA 1YITA 3OQ5A 4EMKB 1Q82C 4C0FA 4M75D 3JB9G 1N6AA 1NJIC 5D6XA 3MQZA 3MF2A 1JJ2S 4YRIA 4BUGA 1WJSA 3VQVA 5L8RE 2DTIA 4PJOC 2QXFA 3L4GB 3CCMT 5GMKj 3CCJA 4BE1A 2EQUA 2ZIOA 3OYYA 4YRMA 5FLXE 4YRQA 3GPLA 4PJOE 4Z02A 3NELA 4RQEA 4II1A 5GAN7 2OTLA 3QZ5B 5IT9E 2L89A 4PL6A 1PSEA 3A8HB 3DKMA 3UPUA 2PUKB 4L59A 2YLCA 3CCQT 4BACA 3A8MB 1M1KC 3VQXA 4E7HA 1Q81C 4ZGJB 3VJPA 4WI1A 1BI2A 1VQ6A 3M5AA 2K5LA 4M78G 1QW1A 3E9GA 4YRTA 2PMEA 2JTFA 1N9SA 2DU5A 3HTZA 4UP8A 2RI5A 4J8OA 5J39A 3OYDA 3P8YA 4J7FA 3OA6A 5GAMg 4HWPA 2R5MA 4P75C 1USYC 3RGLA 5I2SA 3SWNB 5IAYA 3PMTA 4NL3A 4M78A 3RMQA 1H4TA 1WLEA 3HXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I4M A;  4KR2 A;  4P71 A;  1NYR A;  1ATI A;  4M77 A;  4JRK A;  4H2V A;  3A7R A;  3RIR A;  1C0A A;  5C53 B;  1LNX A;  2RM4 A;  4YPF A;  1QF6 A;  1W66 A;  3W3S A;  5GAN j;  3INZ A;  1X01 A;  3FIF A;  1X54 A;  3L4G A;  4RDX A;  4OP0 A;  4CH6 A;  2E65 A;  4MMK A;  3RER A;  2E41 A;  3EFR A;  3M4Q A;  5GAN 2;  3R07 A;  4XU0 A;  4TTV A;  3QTC A;  3HFZ A;  5GMK l;  5KNN A;  2EJF A;  1N9W A;  2ARS A;  3V7S A;  4L87 A;  1WPY A;  4C92 B;  1YCY A;  4XTU A;  5HGQ A;  11AS A;  1WNL A;  5LJ3 e;  2ALY A;  4YRR A;  4CS2 A;  3A5Y A;  3QHS A;  3KFU A;  4HWT A;  4YRL A;  5LJ3 d;  4P3N A;  4JLI A;  4H2W A;  4XTZ A;  3JB9 D;  2DTO A;  1B70 B;  3FJP A;  4DPG A;  4M75 C;  3RKY A;  4PJO G;  3IG2 A;  5C52 B;  2E64 A;  4J6W A;  2Q7G A;  1B8A A;  2ZCE A;  1J5W A;  3PGG A;  4P74 A;  4F7U E;  1Z7N A;  5ELO A;  3FB9 A;  1HTT A;  3BFM A;  3JCM X;  1N9R A;  4M75 E;  2IY5 A;  3TUP A;  2AMC B;  3BJU A;  1ADJ A;  3IKL A;  5GMK i;  2AKW B;  4C8Q D;  2C8M A;  3TEH A;  1SES A;  2ZT6 A;  5GAO r;  5LJ5 e;  4EMG A;  4XTX A;  3P8T A;  3HFV A;  3SWN C;  5LJ5 d;  2J3M A;  1EVK A;  2DDZ A;  3CMQ A;  1D3B A;  4C8Q C;  3JCM b;  3REX A;  3UGT A;  2DEQ A;  3QO8 A;  3VBB A;  4G85 A;  1KQ2 A;  1LJO A;  1M8V A;  2RD1 A;  5GAN 8;  3IKM B;  3UH0 A;  4YRC A;  1WYD A;  4PJO A;  4H2U A;  5GMK m;  4YCV A;  1U1T A;  4C8Q E;  5GAN g;  4M7A D;  3WQZ A;  4KR3 A;  2ZXF A;  4CH3 A;  4P3P A;  1EQR A;  2ZT7 A;  2E10 A;  3HRI A;  4J6X A;  1YFR A;  3RAC A;  1WQW A;  3RKW A;  2DQ3 A;  1TH7 A;  4P72 C;  3JB9 J;  1KMM A;  4F7U B;  3SWN A;  2PMF A;  4C92 G;  3REU A;  1Z7M A;  3EFS A;  4N0A A;  4XTV A;  4CS3 A;  3A74 A;  4M75 B;  4RMF A;  3V8J A;  4M7A E;  1I4K 1;  4M78 D;  3RL6 A;  1PYS B;  3GIB A;  5LJ5 f;  2DVE A;  1E1O A;  2P0L A;  1NJ6 A;  4YRE A;  4M77 D;  3HXX A;  1Y96 B;  3JB9 H;  3A5Z A;  4X9C A;  4J6Y A;  1B7Y B;  1QE0 A;  3PCO B;  3HRK A;  4H2Y A;  3V8K A;  2ART A;  3NEN A;  4Q6G A;  2E3C A;  2CJ9 A;  5CAI A;  4Q15 A;  5LJ3 h;  4NL2 A;  5GAO p;  2QHU A;  2VC8 A;  4C92 F;  2Q5I A;  3MEY A;  1H4Q A;  4KQE A;  2ZNI A;  2RHQ B;  3E9H A;  3I7F A;  4C8Q B;  3HXY A;  2ZZF A;  4TVA A;  1HC7 A;  4C92 A;  2ODR C;  3G1Z A;  2DJZ A;  1H4S A;  4XU2 A;  4M77 E;  5GAN 3;  3V8L A;  4K86 A;  4PHC A;  3VU3 C;  4M7D D;  2DU7 A;  4H2X A;  1B70 A;  3VQW A;  1LYL A;  1GGM A;  2E5A A;  3QO5 A;  4P75 A;  3UGQ A;  1USY A;  4YRP A;  5LJ5 h;  1RIQ A;  4M7A B;  5K1P A;  1H4V B;  4M7D C;  1MGQ A;  2DXU A;  2AKW A;  4YRK A;  2DKG A;  1YFT A;  2FB7 A;  3LC0 A;  2CJA A;  1JJC B;  4E51 A;  4M7D E;  5DY9 A;  4BWA A;  3HY0 A;  2RB6 A;  1X2H A;  3A31 A;  4M75 G;  3L2Z A;  4XEO A;  1EVL A;  5GAO l;  3IAL A;  3JCM V;  2ZZE A;  4YP0 A;  3P8V A;  1NJ1 A;  1NJ2 A;  4YCU A;  1NJ8 A;  5LJ3 j;  3JCM c;  5I21 A;  2Q7H A;  5GMK e;  1I81 A;  1I5L A;  4PJO D;  4M77 B;  4YCW A;  5GAM e;  4OLF A;  1E1T A;  3JCM e;  1EIY A;  1G51 A;  2E1H A;  5GAM d;  3JCM J;  4H2S A;  1X55 A;  3JCM d;  4P3O A;  4F7U F;  1ADY A;  4C8Q G;  2ARU A;  4F7U A;  2RHS B;  4TVY A;  4M75 F;  2QHS A;  2JN0 A;  4H02 A;  4M75 A;  2C7I A;  5LJ3 f;  2Q5H A;  5LJ5 j;  4K88 A;  4WF2 A;  4TVW A;  2ALY B;  1YB3 A;  3JB9 F;  1ASY A;  4M7D B;  3V7R A;  1B34 A;  1BBW A;  3AHU A;  1Y96 A;  1B7Y A;  4Y91 A;  2ZT8 A;  12AS A;  3RUX A;  3BW1 A;  2I4O A;  4M7A G;  3L1A A;  1WU7 A;  3SB2 A;  1L0W A;  2G4C A;  4M7A C;  1NNH A;  4QVC A;  2ZTG A;  3HSB A;  3RKX A;  5GAO m;  1ASZ A;  4XTY A;  1BBU A;  4DQ2 A;  1M5Q 1;  4C8Q F;  1YFS A;  4TWA A;  2CGH A;  2RHQ A;  4C8Q A;  1E22 A;  1KMN A;  5F5W A;  4A54 A;  3NET A;  4YRF A;  4HWO A;  3QO7 A;  4QVD A;  3HXW A;  2EJ9 A;  2FYK A;  4HA8 A;  2RA2 A;  3QO3 A;  4HT8 A;  1YGB A;  2Q7E A;  5LJ3 g;  4HT9 A;  5C51 B;  5GAN 4;  2P5I A;  4YRO A;  3M4G A;  4PG3 A;  4M78 C;  4H2T A;  1JRI A;  4XQ3 A;  4M7A F;  2XGT A;  5GAN 5;  2YLB A;  2DTH A;  4P71 C;  1SET A;  4M77 C;  3QNE A;  4M7A A;  4P72 A;  4M78 E;  1JBM A;  4P73 C;  2K57 A;  3A7U A;  4EO4 A;  4J5Y A;  2DQ0 A;  2I2L A;  4UPA A;  1JJC A;  3PZC A;  2XTI A;  2EL9 A;  3LSS A;  1EOV A;  2CJB A;  1EFW A;  5LJ5 g;  4CS4 A;  3QUI A;  5GMK h;  2ZR3 A;  3A7A A;  4M78 F;  1FYF A;  2DXT A;  5GAM h;  1BIB A;  5GAN e;  3JCM h;  2QHV A;  4LNS A;  2YHT A;  1HXD A;  3HFN A;  5GAO n;  4M77 F;  4M7D G;  4ZIB A;  1HK9 A;  1KQ1 A;  5GAN d;  4O2D A;  2AMC A;  3A32 A;  3JCM Q;  1X2G A;  4HWR A;  4P73 A;  1NYQ A;  4J15 A;  4F7U G;  1SER A;  4P74 C;  3TEG A;  3JCM W;  4ZTZ B;  2HNI A;  4MML A;  3V7C A;  3RF1 A;  2RHS A;  4JRI A;  1H4T A;  2I4N A;  4EMK B;  4YDQ A;  4M78 B;  3ICA A;  3OD1 A;  4TVA B;  4M75 D;  2ZNJ A;  3JB9 G;  4M7D F;  2ZT5 A;  3BY7 A;  3UFG A;  4M7D A;  3MF2 A;  4TQF A;  1B76 A;  3MF1 A;  4YRI A;  2EJG A;  4XTW A;  5K1X A;  1I8F A;  2VXE A;  3VQV A;  4H2X B;  2DTI A;  4WJ4 A;  3LSQ A;  4CH4 A;  2CIM A;  1G5I A;  4PJO C;  3L4G B;  5GAN f;  4K87 A;  5GMK j;  4XEM A;  2ZR2 A;  4EX5 A;  2ZIO A;  4X5O A;  4YRM A;  4YRQ A;  3HFZ B;  5GAM j;  4PJO E;  1PYS A;  3HFO A;  1VQZ A;  3NEL A;  4RQE A;  4JUV A;  4NCX A;  2ZZG A;  5GAN 7;  3E9I A;  3RES A;  3DSQ A;  1BIA A;  4A53 A;  3PCO A;  4N0A C;  3HXU A;  4UP9 A;  3HXV A;  1NJ5 A;  3M4P A;  4PJO F;  2EWN A;  4HVC A;  2YLC A;  1X56 A;  2QTX A;  4X9D A;  4RCB A;  2IY5 B;  4TQD A;  4PNO A;  5GAM f;  4YRJ A;  3VQX A;  3QSU A;  3ERR A;  4AH6 A;  1KOG A;  3JCM f;  3TEH B;  4C92 D;  1EIY B;  4BW9 A;  5GAN 6;  5ELN A;  1E24 A;  5GAN h;  4WI1 A;  2ZGW A;  1WQ7 A;  3BDU A;  4M78 G;  4EMK C;  2I4L A;  2ZIN A;  3NEM A;  4YYE A;  4YRT A;  1D3B B;  2PME A;  4WJ3 M;  4V2S A;  4C92 C;  4M77 G;  3VQY A;  5GAO q;  4RCC A;  1N9S A;  4G84 A;  2DU5 A;  3HTZ A;  2Y90 A;  4PJO B;  1G5H A;  4UP8 A;  4ZTU B;  3JB9 I;  2VXF A;  4C92 E;  4XU3 A;  1B34 B;  4UP7 A;  3P8Y A;  1LOJ A;  4XU1 A;  4YRN A;  1U1S A;  2DZC A;  2DZ9 A;  5GAM g;  2J3L A;  2QHT A;  4HWP A;  4P75 C;  2EAY A;  2ODR D;  3JCM g;  4YRG A;  4EMH A;  1USY C;  1SRY A;  4YRS A;  3RGL A;  4CH5 A;  4RQF A;  3SWN B;  1H64 1;  4HWS A;  2ZIM A;  4EMK A;  4NL3 A;  1IL2 A;  3HY1 A;  3JCM P;  4M78 A;  4NOY A;  5E3I A;  1WLE A;  3HXZ A; 
#chains in the Genus database with same CATH topology
 1QVG S;  1YNZ A;  2RJD A;  2EKH A;  1X6O A;  4X34 A;  3CC7 T;  3A5Z B;  3CCR Q;  2A0F B;  2HQH A;  3M4Y A;  4HCC A;  2JT4 A;  5C53 B;  1KD1 C;  1QF6 A;  1QVF A;  5GAN j;  1X01 A;  1QMC A;  2OAU A;  1X54 A;  1BYM A;  4CH6 A;  4JJB A;  2A08 A;  4E7Z A;  1UGP B;  2K5I A;  3RR6 A;  5GMK l;  5KNN A;  1N9W A;  1WPY A;  4C92 B;  2CP6 A;  4PFO A;  3QBY A;  2JM8 A;  5J26 A;  4HWT A;  2QA4 Q;  1W2B S;  2FRY A;  1OUL A;  4MDW A;  1UJY A;  2KT1 A;  4JLI A;  4H2W A;  1QCF A;  3FJP A;  4CC7 A;  3RKY A;  1M9S A;  1PCX A;  5C52 B;  3C0C A;  2D0Q B;  2E64 A;  1M90 C;  1B8A A;  1UGS B;  3BE3 A;  4F7U E;  2OTJ A;  3EGX B;  1D1B A;  4HVV A;  1RAI B;  1NE8 A;  4AT1 B;  1KG1 A;  4ZTF A;  1YJ9 T;  2AMC B;  4DBF A;  5DLQ E;  3TEH A;  1BBZ A;  2ZT6 A;  1NBE B;  5GAO r;  5LJ5 e;  3L2U A;  1N8R R;  4EMG A;  2LQN A;  4XTX A;  1A0N B;  5HY6 A;  3HFV A;  1T0H A;  2J3M A;  2DL8 A;  1PWT A;  4LN2 A;  2CP0 A;  2K2M A;  2HL5 C;  2CP3 A;  1VIE A;  5IHK A;  3OSS C;  1RAH B;  2CSI A;  2NUP B;  5CCA A;  3OW2 S;  4G85 A;  1KQ2 A;  4FM4 B;  1LJO A;  2DX1 A;  2D1X A;  3QII A;  3IKM B;  1V76 A;  5CIU A;  1K8A U;  1VQK A;  1U1T A;  3WXM B;  1QQJ A;  4L6V 5;  4M7A D;  4KR3 A;  2LZ6 B;  5FWB A;  2DBK A;  3D7S B;  4JZ4 A;  3E9F A;  2RQW A;  1VIF A;  2E10 A;  3HRI A;  4RTU A;  1VQP T;  1IB8 A;  4OB3 B;  1YFR A;  3G71 T;  1UB4 A;  3WVD B;  3ASK A;  2EYY A;  3EFS A;  4N0A A;  4CS3 A;  4LE9 A;  2RJC A;  2CUB A;  3V8J A;  4M7A E;  1I4K 1;  1NYF A;  3LX7 A;  1AWO A;  1ZX6 A;  3GIB A;  3OS1 A;  1E1O A;  1TUG B;  1X6B A;  3UA6 A;  1ZSZ C;  3QDR B;  1JXO A;  1Y96 B;  4B9X A;  1B7Y B;  2PVG B;  4J6Y A;  3NEN A;  2FPF A;  3L2R A;  5LJ3 h;  3EG9 B;  1M3C A;  1VQL T;  4HCK A;  2LCC A;  2DER A;  2QG9 B;  2BE7 D;  2COZ A;  4C92 F;  3I7F A;  3HXY A;  1YIT T;  5DLO A;  4JRQ A;  3SHW A;  3PFS A;  1H4S A;  2GFA A;  3NFC A;  3HRS A;  4K86 A;  4QW2 A;  4M7D D;  2X4W A;  5LL6 S;  3H0I A;  3X25 B;  1VYU A;  3EGU A;  3S6W A;  2KBT A;  3EAE A;  4J9D A;  3NMZ C;  2RHZ A;  1FYN A;  4FL6 A;  5FRO A;  2E5A A;  2YT6 A;  3VS2 A;  3N5B B;  1RIQ A;  3H0F A;  1ACM B;  4BB7 A;  4M7D C;  1VUB A;  2BIV A;  2C0I A;  2H3J A;  2F5T X;  2DXU A;  3CCJ T;  2AKW A;  4YRK A;  1YFT A;  2FB7 A;  4F16 A;  2KXD A;  1WXT A;  4E51 A;  1NYG A;  4M7D E;  4BWA A;  1BI1 A;  3A31 A;  4Z89 A;  2IIM A;  2GTJ A;  3M0P A;  1M3A A;  1PD1 A;  4XEO A;  2OTL T;  3IAL A;  1I07 A;  4HKE A;  3P8V A;  1NJ2 A;  4YCU A;  3JCM c;  1EX4 A;  1H92 A;  1I5L A;  4M77 B;  2F69 A;  1RAE B;  1RL2 A;  1NEB A;  4OLF A;  2XDP A;  1Q82 U;  4X1V A;  2AKL A;  3I55 Q;  1G51 A;  3CBP A;  3NTK A;  5GAM d;  1CSK A;  8ATC B;  2XD0 A;  4H2S A;  1VQ9 Q;  3TU4 K;  4E6R A;  4C8Q G;  3I9Q A;  1UGR B;  1ZUY A;  1BKB A;  4TVY A;  3VYG A;  4O5V A;  1VQ6 T;  4LDV A;  2QQS A;  3QG1 A;  4ELY C;  2ALY B;  1YB3 A;  5HKC A;  4TVR A;  2VVK A;  4GLK A;  3A8G B;  3RBB B;  2J6K A;  3OBW A;  2V8I A;  2DM1 A;  3VYH B;  2G4C A;  2J6F A;  3VS0 A;  4DBQ A;  3EFO A;  1SG5 A;  4FYY B;  3GBQ A;  4C8Q A;  1KMN A;  2RF0 A;  3NET A;  1WJR A;  2ATC B;  4HA8 A;  4ZN1 A;  2LJ1 A;  1OEB A;  2ZCF B;  2JVV A;  3EGD A;  1T3L A;  2KYB A;  2JOY A;  2DRK A;  5GAN 4;  3J7A F;  4YRO A;  1M1K U;  3MP6 A;  3CCQ A;  2CP5 A;  1Q81 U;  1LCK A;  4AFQ C;  2DTH A;  4P71 C;  1SET A;  4JDS A;  4IUP A;  2D8H A;  1PKS A;  3THK A;  4P72 A;  4C5I A;  2EYX A;  5CKE A;  1TWB A;  1JBM A;  1TSF A;  3A7U A;  4EO4 A;  4J5Y A;  1VQO Q;  1JJC A;  2EW3 A;  1ARK A;  3G4S Q;  1K8A R;  2GNC A;  3OMC A;  3CEY A;  4BE0 A;  5GMK h;  2ZR3 A;  5FRM A;  3DLM A;  1BIB A;  2CT4 A;  4R56 A;  3EGX A;  2YHT A;  1HXD A;  5GAO n;  4M77 F;  2L3R A;  1K0X A;  5FRN A;  2J6O A;  2EQI A;  2KT8 A;  2LT4 A;  4Q5W A;  2MCN A;  2OTJ T;  2AMC A;  3O5Z A;  4BI8 B;  1NYQ A;  3QJ6 A;  1YIJ A;  1SER A;  1U3O A;  1MMN A;  4M4Z A;  3G6E Q;  2DIL A;  2RHS A;  3QXE B;  4JRI A;  4FYW B;  3M58 A;  4LVK A;  4M78 B;  3ICA A;  1HSQ A;  3OD1 A;  4TVA B;  1KD1 U;  5KCO A;  2FHD A;  4GY5 A;  1BU1 A;  3CC7 A;  2ZT5 A;  2LRQ A;  3HRU A;  3UDC A;  4IUV A;  3MF1 A;  2AT1 B;  2EJG A;  4XTW A;  2LX7 A;  1I8F A;  1TG0 A;  4J83 A;  1VQK T;  2VXE A;  1JJ2 P;  4WJ4 A;  2FL7 A;  5IN1 A;  3LSQ A;  1IGU A;  5IH2 A;  4K87 A;  2YUQ A;  2LCL A;  1ZSG A;  3QWY A;  4EX5 A;  2WSF E;  3QWX X;  2V1R A;  4IUU A;  3I56 Q;  1JEG A;  3PE0 A;  1GBQ A;  5GAM j;  3JV3 A;  4DOV A;  1H3Z A;  2KYM A;  2RK2 A;  1UDL A;  1VQ4 A;  5KCH A;  1GCQ A;  1VQZ A;  3OY9 A;  1M90 U;  3S3M A;  4JUV A;  3EG2 A;  2P4T A;  2X51 A;  2ZZG A;  5FU6 C;  3RES A;  4A53 A;  3HXU A;  5A0L A;  4RG2 A;  2LDM A;  3M4P A;  1W4S A;  3EG9 A;  4PJO F;  5FU7 C;  1X56 A;  4X9D A;  4RCB A;  2QDY B;  4C0G A;  1JQQ A;  2MWO A;  2DO3 A;  2RQV A;  4A63 B;  5GAM f;  2IG0 A;  2E6N A;  4AH6 A;  4HCZ A;  5C0M A;  3TEH B;  2QK0 A;  3VS1 A;  1YHQ A;  5ELN A;  4J7I A;  5GAN h;  1BK2 A;  4JS4 A;  3BDU A;  2ZIN A;  1Q82 R;  4DOW A;  4YYE A;  1C1A A;  2P0K A;  2RHX A;  4V2S A;  4M77 G;  4WTO B;  3CPW A;  3GOX A;  4G84 A;  2QQA A;  2RHU A;  4ESR A;  2K5F A;  2CZ0 B;  1IXD A;  3J80 E;  2O31 A;  4LVM A;  4EPC A;  1X43 A;  4UP7 A;  2CKK A;  3EG3 A;  2DZC A;  2DZ9 A;  2QHT A;  3F70 A;  1PG5 B;  4FT4 A;  3JCM g;  3VS7 A;  4FSS A;  3CME A;  4C5H A;  2FVU A;  2MWP A;  4HWS A;  2F2X A;  2L3Q A;  1G8X A;  4OB0 B;  1RLQ C;  3HY1 A;  4NOY A;  1FMK A;  1KC8 C;  4M77 A;  1VQ5 Q;  2R5A A;  1K9A A;  3T9N A;  1J3T A;  1VQM Q;  2KNB B;  1C0A A;  2EVR A;  2BKD N;  4OGE A;  1LNX A;  4YPF A;  3CCV Q;  3W3S A;  3FIF A;  1VQN A;  2QAZ A;  2JW4 A;  2E65 A;  2CDT A;  4MMK A;  3RER A;  3EFR A;  1M1K R;  1X6G A;  3NGP A;  4IUR A;  4XU0 A;  4E7J A;  3HFZ A;  4L87 A;  1YCY A;  5HGQ A;  1WNL A;  5LJ3 e;  1SSH A;  3UA7 A;  2ALY A;  4YRR A;  2VWF A;  3KFU A;  3OYG A;  1YCS B;  1B07 A;  4XTZ A;  2L2P A;  3JB9 D;  3SFM A;  4PJJ A;  3FLG A;  1EFN A;  1ZSZ B;  1Q7Y R;  4M75 C;  2KVQ G;  4PJO G;  4FT2 A;  2Q7G A;  1TU0 B;  1J5W A;  3PGG A;  4P74 A;  4FW2 A;  1BI3 A;  3FB9 A;  2DEU A;  3BFM A;  1OPL A;  3M0S A;  4J9G A;  1QWE A;  1N9R A;  4M75 E;  3CC4 A;  4WCI A;  2DXB A;  4UC4 A;  1O9S A;  3GF5 A;  1ADJ A;  1SSF A;  3MCA B;  2DD4 A;  4LDU A;  5I22 A;  2AKW B;  4KH0 B;  2V26 A;  2LJ0 A;  2MI6 A;  4F14 A;  2O88 A;  2EBP A;  4BY6 C;  2L5Q A;  4E7I A;  2ROT A;  2M51 A;  1VQ7 A;  3PMI A;  2KRM A;  2Z0W A;  2NUT B;  2RNA A;  2DF6 A;  3CCM Q;  2PQW A;  3UGT A;  1RAA B;  3QO8 A;  1SRM A;  1W70 A;  2AZS A;  4PJO A;  4H2U A;  4Z8A A;  4ATO A;  4CH3 A;  1EQR A;  2O01 E;  2ZT7 A;  1M2O A;  1KD1 R;  2DMO A;  3VS5 A;  1Y07 A;  1ZLM A;  2LVM A;  5EG2 A;  4FW1 A;  1XNI A;  4J6X A;  1Q86 C;  1CKA A;  2RJF A;  1WQW A;  2PVO B;  3CMA A;  2DQ3 A;  2GCX A;  1WHH A;  2M0O A;  1KMM A;  3FC3 A;  2PMF A;  4D8K A;  1WLP B;  3CCQ Q;  1WXU A;  2YSQ A;  3MET A;  4M78 D;  2F1L A;  1PYS B;  2F2V A;  2ZPE B;  4ZGE B;  1MUZ A;  5LJ5 f;  4BD3 A;  4YRE A;  2K9G A;  5D6W A;  4C0D C;  1QVF P;  4C5G A;  4X9C A;  3PCO B;  1M90 R;  4Q6G A;  1WHJ A;  2E3C A;  1UE9 A;  2CJ9 A;  2XMF A;  3ME9 A;  5CAI A;  4Q15 A;  5GJV B;  4MZP A;  1YIJ T;  3OYM A;  5GAO p;  2VC8 A;  2Q5I A;  2ZNI A;  4C8Q B;  2QAS A;  8AT1 B;  1HC7 A;  4TVA A;  5GAN 3;  2HKN A;  3EGD B;  4PHC A;  2M02 A;  2GF7 A;  3M55 A;  4RUG A;  2DU7 A;  3VQW A;  2YRC A;  4KGX B;  2K6D A;  1N27 A;  4P5N A;  1GGM A;  1FXX A;  3QO5 A;  4P75 A;  1USY A;  2YRV A;  1NPR A;  1MGQ A;  1YWO A;  1Y0M A;  2WSC E;  2DKG A;  2CJA A;  3C12 A;  1JJC B;  4JJN K;  3CC7 Q;  2GFU A;  5DY9 A;  3LLR A;  1VQ4 T;  2RB6 A;  3R6N A;  1UEC A;  2D6F A;  1YJW A;  2WSE E;  2CZ6 B;  5GAO l;  1HD3 A;  2ZZE A;  3OYN A;  3PT9 A;  1UHC A;  5DM7 R;  2XI9 A;  2K4Y A;  1NJ8 A;  3CC2 A;  5GMK e;  2VAS A;  1YI2 A;  1H3H A;  2LQW A;  1PNJ A;  4YTL A;  1PHT A;  4A4H A;  3H0H A;  1BCO A;  2EKO A;  2KE9 A;  3C4S A;  3JCM J;  9ATC B;  2A8E A;  2A37 A;  3JCM d;  4P3O A;  3HHT B;  2EIF A;  2ARU A;  1YHQ T;  4F7U A;  2RHS B;  3EHR A;  1M4Z A;  2DVJ A;  4H02 A;  2ROL A;  4PLI A;  2HZY A;  1YJ9 Q;  3RNJ A;  4WF2 A;  2FZG B;  1ASY A;  2O4X B;  5AT1 B;  2J05 A;  1AEY A;  3VV0 A;  5CR2 A;  4QQG A;  2ZT8 A;  12AS A;  3URG A;  3BW1 A;  1G2B A;  4M7A G;  2I4O A;  4N4I A;  1PSF A;  1WU7 A;  1L0W A;  1W1F A;  4M7A C;  2ZTG A;  3MPU B;  3HSB A;  2OAW A;  1G3T A;  2RHI A;  1M5Q 1;  2RHY A;  1VYT A;  4PKC C;  4C8Q F;  4TWA A;  1D1C A;  3ZEH A;  1D1A A;  3CME T;  1E22 A;  7AT1 B;  4HXJ A;  4HWO A;  3EG1 A;  1XTD A;  2YDL A;  3HXW A;  5CQY A;  2FYK A;  3QO3 A;  2OJ2 A;  1QVF S;  2E12 A;  3TSW A;  5FWC A;  5C51 B;  1VQP Q;  2V1Q A;  3G71 Q;  4J9E A;  4PG3 A;  4LVJ A;  4XQ3 A;  2YUN A;  2G3R A;  3M9Q A;  4M7A A;  1VQN T;  2LP5 A;  2X4Y A;  3M59 A;  3NTI A;  4P73 C;  2K57 A;  3J81 E;  1QP2 A;  3PZC A;  2PTK A;  3E1S A;  2PU9 B;  1YJN A;  1AZE A;  1N8R C;  2MOX A;  1EFW A;  5LJ5 g;  1ZSZ A;  3CBM A;  5FU6 B;  2YWW A;  1VQL Q;  3A7A A;  2VYT A;  5HK3 A;  2DXT A;  2EGE A;  5GAM h;  5KYY B;  1S1N A;  1WHL A;  3OS5 A;  5GAN e;  2QHV A;  3HFN A;  2VKN A;  4M7D G;  1AOJ A;  4ZIB A;  1YIT Q;  1KQ1 A;  2KEA A;  3M53 A;  1OZ3 A;  4KGZ B;  3A32 A;  2C06 A;  3CD6 A;  1PC0 A;  2HD0 A;  3CC4 T;  2DET A;  3EHQ A;  2E3H A;  4LDX A;  3HP9 A;  1X2G A;  3Q1J A;  4P73 A;  3OMG A;  1UEB A;  3PIP A;  3TEG A;  1KC8 U;  1OQK A;  2NUT A;  4MML A;  3RF1 A;  3EG0 A;  2KK4 A;  1X75 C;  3PNW C;  4CRI A;  2VGM A;  4DBR A;  5CKD A;  1VQ7 T;  4YDQ A;  2BZY A;  1MV0 B;  2KRO A;  4BE2 A;  3TCJ A;  1UGV A;  4RTW A;  2ZNJ A;  1UHF A;  3CCJ Q;  2ENM A;  1MNE A;  2JTE A;  3UFG A;  1GCP A;  4O6J A;  3L2W A;  4M7D A;  2ZPG B;  2P4R A;  5K1X A;  4KUL A;  2LX9 A;  4LNP A;  4CC2 A;  2QEX A;  2OTL Q;  1OX8 A;  1G5I A;  3MP1 A;  3CXC A;  1NJI U;  2XDD A;  4Z88 A;  2ZR2 A;  3A8L B;  4QQ6 A;  3GLX A;  4OF1 A;  3CMA T;  4X5O A;  3HFZ B;  3DLL A;  1QLY A;  1AWJ A;  1UGQ B;  3CCS A;  1U8R A;  1PYS A;  1FMW A;  3HFO A;  1MHN A;  2PUO B;  3CCL T;  1ZBX A;  3E9I A;  2CP2 A;  3DSQ A;  3PCO A;  2EGA A;  2HQX A;  1H8K A;  3MHX A;  4Y92 A;  1RAF B;  4UP9 A;  4HVW A;  3OYI A;  2IVW A;  4BI3 A;  1VQ6 Q;  1NJ5 A;  3HKS A;  2EWN A;  3QJY A;  2D0N A;  1HJD A;  4TQD A;  4PNO A;  3FRN A;  2KXC A;  3QSU A;  1SRL A;  1KOG A;  3JCM f;  4C92 D;  1MMA A;  2LQK A;  4BW9 A;  3KUF A;  2NUZ A;  3CCU A;  1KHC A;  3X28 B;  2HQE A;  2LCS A;  4KUD K;  1JXM A;  4OMO A;  1RAG B;  2LMJ A;  4LDW A;  2DA9 A;  3NEM A;  3QZ9 B;  4XAX B;  2I4L A;  4IUT A;  1ZHI A;  2XHC A;  3M0R A;  1R77 A;  1D09 B;  4C92 C;  1M30 A;  2M9U A;  2JNG A;  2RI3 A;  1NPP A;  4CI0 C;  2XU8 A;  2Y90 A;  1S72 A;  4PJO B;  1G5H A;  1VQ8 T;  3VKI A;  3JB9 I;  1PRL C;  2DYI A;  2KI7 A;  3ULR B;  4C92 E;  4E2F B;  2KRN A;  3HPW A;  2RH2 A;  1LOJ A;  4XU1 A;  5L23 A;  3H9N A;  3LGL A;  2F5K A;  2O2O A;  2J3L A;  2EAY A;  2ODR D;  2KY9 A;  4YRG A;  4EMH A;  2DLP A;  4BY6 B;  1WYX A;  4CH5 A;  4RQF A;  2ZIM A;  1YJW T;  4AFZ C;  4RMO A;  2M16 A;  4ME7 A;  5E3I A;  4FU6 A;  2QQR A;  4KR2 A;  4FIB A;  2FO0 A;  4P71 A;  1Y7X A;  1ATI A;  4PLL A;  1M8M A;  3CC2 T;  1VYV A;  4LUE A;  3A7R A;  4H2V A;  3RIR A;  1YI2 T;  1NLO C;  1AVZ C;  5IXB A;  1ZBJ A;  1W66 A;  3JAM E;  2AKK A;  3RMS A;  4D8D A;  4RDX A;  2QQB A;  2EYQ A;  3CBO A;  3M0T A;  3S3O A;  2D8J A;  2L8D A;  2E41 A;  1GXI E;  3M4Q A;  1EZZ B;  3OB9 A;  1KHI A;  2EJF A;  2OTJ Q;  2FG0 A;  4XTU A;  3CCR A;  11AS A;  2HDA A;  4YRL A;  1KQS A;  2O4X A;  2ESW A;  4P3N A;  3L2V A;  5HK0 A;  2E5K A;  3KFV A;  3E2U A;  2DTO A;  4DPG A;  5I2M A;  3IG2 A;  4JLG A;  4J6W A;  1KSW A;  2ZCE A;  2JS0 A;  3BDL A;  3UT1 A;  1Z7N A;  5ELO A;  2JMA A;  3VRY A;  3JCM X;  1NG2 A;  3REA B;  2IY5 A;  3RDV A;  1NEG A;  2AHJ B;  2QA4 A;  1KJW A;  3BJU A;  3IKL A;  2B86 A;  3HL8 A;  5GMK i;  2XG8 D;  1VQK Q;  3P8T A;  2HKQ B;  5LJ5 d;  3LWI A;  4QT7 A;  3MP8 A;  2CH4 A;  4XK8 E;  1EVK A;  4AMC A;  2DDZ A;  3H8Z A;  3VS3 A;  2KQW A;  3CPW P;  2EQK A;  4FYV B;  1D3B A;  1M2V A;  2DYB A;  1NLP C;  2DEQ A;  4E7K A;  1T3S A;  1KC8 R;  1M8V A;  3CQT A;  2RD1 A;  2BZ8 A;  5GAN 8;  4YRC A;  5GMK m;  2CP7 A;  4JJC A;  2AK5 A;  1FWZ A;  1ABQ A;  4R0K A;  1OOT A;  2DFU A;  1AHJ B;  2M0Y A;  2XKO C;  2CYZ B;  5A0G A;  3QYH B;  2HL3 A;  2PVD B;  1HYO A;  3RAC A;  3I35 A;  3RKW A;  2AZV A;  4PFZ A;  1TH7 A;  4OB1 B;  3JB9 J;  4F7U B;  1K1Z A;  3REU A;  1YJN T;  3MEW A;  4XTV A;  5KYY A;  2XDB A;  2HCK A;  4RMF A;  2QGF B;  1NJI R;  4PFP A;  4OGC A;  4BI4 A;  2DVE A;  1YBY A;  1NJ6 A;  4M77 D;  3LGF A;  4H2Y A;  1IZ6 A;  3TVT A;  3HRK A;  2ART A;  2K3X A;  3OS2 A;  3CD6 T;  3MEA A;  2W0Z A;  3TQ7 P;  4RTY A;  3LW5 E;  3MEV A;  4LDY A;  1RAD B;  3MEY A;  1H4Q A;  4E7S A;  3E9H A;  3HTR A;  1X2K A;  4DBH A;  2DJQ A;  3ZBD A;  3G1Z A;  2DJZ A;  2XID A;  4XU2 A;  1Z9Z A;  2KAF A;  4M77 E;  1TTH B;  3OYL A;  1MMD A;  1D0Y A;  2FZC B;  2PZ1 A;  4CC4 B;  5KE3 A;  1E7O A;  1P92 A;  4MDX A;  5AYF A;  1B70 A;  2M1H A;  2JMC A;  1MMG A;  2QYZ A;  2Y4X A;  2JUF A;  5C6S A;  3E19 A;  1TOV A;  2X35 A;  3UGQ A;  3H6Z A;  1ZQ1 A;  3KXT A;  1KK7 A;  3OYA A;  4PK4 A;  4M7A B;  2QEX T;  2LJ3 A;  2CZ7 B;  1N8R U;  3PVL A;  2LNH B;  1Q81 R;  4BDY A;  1G83 A;  4E47 A;  3CCS T;  5CVI A;  4M75 G;  3L2Z A;  1K4U S;  4MZT A;  2DIQ A;  1LPL A;  3JCM V;  1R0C B;  4YP0 A;  2RJE A;  4QVZ A;  2DL3 A;  2OX7 A;  2FRW A;  1I81 A;  2EGC A;  4PJO D;  3QDF A;  3VS4 A;  2ZZD A;  3LWH A;  5GAM e;  1Y57 A;  1E1T A;  1I0C A;  1QVG A;  3NHN A;  2MMP A;  4OML A;  1QCO A;  2FPE A;  1MV3 A;  1X55 A;  4F7U F;  3CCE T;  3CPW S;  3TEE A;  1ADY A;  2RPN A;  3X26 B;  3CCU T;  2LT1 A;  3OBY A;  3OYK A;  2JN0 A;  2GTO A;  4M75 A;  1JU5 C;  1G5V A;  2C7I A;  2Y4Y A;  2IPO B;  5GJW B;  1K0S A;  2K2V A;  5LJ5 j;  1ZUU A;  3I55 A;  4K88 A;  4RKU E;  5KYU B;  2EFI A;  1VQ9 A;  4M7D B;  3EH2 A;  3V7R A;  1S72 T;  5IXF A;  2P0P A;  1BBW A;  3AHU A;  2YUP A;  4GBQ A;  3I5R A;  2OI3 A;  2K7A A;  1W2B A;  5KYX A;  3CCU Q;  4C0Z A;  2C0O A;  3SB2 A;  1SKU B;  1OV3 A;  3RKX A;  1BBU A;  1NM7 A;  2E3I A;  2ED1 A;  1YFS A;  2CGH A;  4JZ3 A;  2K79 A;  2DXC A;  2RHQ A;  3A8O B;  1GBR A;  2MPX C;  3CCL A;  4A54 A;  3QO7 A;  4QVD A;  1PKT A;  2EJ9 A;  2RA2 A;  4HT8 A;  2RI2 A;  5LJ3 g;  4HT9 A;  2ZPF B;  1YP5 A;  4LVL A;  2QGG A;  4M78 C;  4K11 A;  1UJ0 A;  2L3S A;  4M7A F;  1Q7Y C;  1WFW A;  2QDL A;  2YLB A;  4ELZ C;  2HSE B;  2V8J A;  5GAN 5;  2RMO A;  1WIE A;  2VV5 A;  4M78 E;  5FW9 A;  2ZPH B;  4A4K A;  1U06 A;  3OW2 A;  5D6Y A;  2BTT A;  2CS7 A;  4LD9 K;  4QKU A;  2RO0 A;  2I2L A;  2DQ0 A;  3VUB A;  5KE2 A;  1EOV A;  3CCR T;  1YWP A;  3P8H A;  2AIR B;  1G3W A;  3QUI A;  2J7I A;  1YIJ Q;  5KH6 A;  3OYC A;  1RUW A;  1WDX A;  1VQ8 A;  2VGN A;  1CKB A;  1IRX A;  4Y28 E;  3JCM h;  4HCB A;  2MYS A;  2CT3 A;  2P84 A;  1VQO A;  4OVA A;  4C5E A;  2CZ1 B;  3G4S A;  1OI1 A;  2SEM A;  1GL5 A;  1TXQ A;  1XJW B;  1YFN A;  2ECZ A;  4PJL A;  2FEI A;  2C0T A;  2RQR A;  1YN8 A;  2QA4 T;  1Q95 G;  1QKW A;  4F7U G;  1WHG A;  2HEQ A;  2DRM A;  3JCM W;  2HNI A;  4N4G A;  4EDU A;  1VOM A;  2YRD A;  3FEO A;  2I4N A;  1WX6 A;  4AFU C;  2ZPI B;  1I5O B;  1I1J A;  1IGQ A;  4M7D F;  4DEX A;  3BY7 A;  2PNI A;  1E6H A;  4TQF A;  2KDS A;  1K73 C;  1B76 A;  1VQ4 Q;  1X27 A;  1BCM A;  3G6E A;  2B8A A;  3NTH A;  3SD4 A;  1WHK A;  4ZGD B;  4H2X B;  1B7T A;  1AZG B;  4CH4 A;  2CIM A;  4IUQ A;  5GAN f;  2YXY A;  1OU9 A;  4XEM A;  2GQV A;  1K9M C;  2HMA A;  1G3Y A;  3LYI A;  2YUO A;  4EIK A;  2LQ8 A;  3M0U A;  1B3Q A;  6AT1 B;  2X3W D;  2QQ9 A;  1K76 A;  1V29 B;  4NCX A;  1X2Q A;  3TRE A;  1WHM A;  1RAC B;  1BIA A;  4N0A C;  1UTI A;  2VUB A;  4DEY A;  1YHQ Q;  3I56 A;  3HXV A;  4RTZ A;  2SRC A;  4HVC A;  1SHF A;  2QTX A;  3R6O A;  4A4F A;  2COW A;  1GFC A;  2DD5 A;  2IY5 B;  1DJ7 B;  1UUE A;  4YRJ A;  2MAM A;  3ERR A;  1EIY B;  2RQU A;  5GAN 6;  2ED0 A;  3MEU A;  1E24 A;  1SPK A;  2GQI A;  2ZGW A;  1ZA1 B;  1WQ7 A;  4EMK C;  2CRE A;  4AG2 C;  4JS5 A;  4L5G A;  1D3B B;  1M2V B;  4FSX A;  1BI0 A;  3PIO A;  4WJ3 M;  3VQY A;  5GAO q;  4RCC A;  2K3Y A;  3CME Q;  1IO6 A;  2X9H A;  3VS6 A;  3P8B B;  2ZAE A;  4ZTU B;  2BZX A;  2BE9 B;  1BB9 A;  2VXF A;  3AT1 B;  4XU3 A;  1B34 B;  3C95 A;  4A4G A;  4YRN A;  1GFD A;  1U1S A;  3L2Q A;  5CO7 A;  4KGV B;  1OZ2 A;  3MO8 A;  1QWF A;  1SRY A;  4YRS A;  4B9W A;  2DL5 A;  1H64 1;  2FPD A;  2DAQ A;  2HBP A;  4OMP A;  4EMK A;  2A28 A;  3S3N A;  4ZTJ A;  1IL2 A;  3JCM P;  1VQN Q;  2R58 A;  4JRP A;  4MZM A;  4LXC A;  2I4M A;  5FU7 B;  1NYR A;  3A1P A;  4LUD A;  4JRK A;  2XK0 A;  1TUC A;  2A7Y A;  3VUZ A;  3JRZ A;  4J9B A;  1WA7 A;  1KIK A;  5CQX A;  3CXC P;  2CUD A;  4IIM A;  2NYS A;  2RM4 A;  3HRT A;  3OYE A;  4J9F A;  3INZ A;  3KBG A;  3L4G A;  4RTX A;  4OP0 A;  2X4X A;  1IHV A;  5GAN 2;  2R57 A;  3R07 A;  2EQJ A;  4TTV A;  3QTC A;  2CSQ A;  3SDZ A;  2ARS A;  1TUD A;  1VQ5 A;  3V7S A;  2E5Q A;  5CKB A;  4PJM A;  5M9O A;  1PRM C;  1VQM A;  5KYU A;  4CS2 A;  4RTV A;  1SF9 A;  3A5Y A;  3CC4 Q;  3QHS A;  3X24 B;  5LJ3 d;  3CCV A;  1V1C A;  3REB B;  3I55 T;  1G3S A;  3DB4 A;  2DPP B;  2LTO A;  4FYX B;  4OMF B;  1VQ9 T;  1B70 B;  5ECA A;  4IKF A;  1JB0 E;  1UFF A;  1VQ7 Q;  2V8K A;  2RQT A;  3IQL A;  1HTT A;  5KYW A;  3O8V A;  2CH4 W;  3TUP A;  1OX9 A;  4OB2 B;  4OMQ A;  4C8Q D;  2C8M A;  1SES A;  5J3B A;  2JM9 A;  2O9V A;  3CPF A;  4N4H A;  1Y71 A;  1C6V X;  3WVE B;  3SWN C;  4RTT A;  2HBW A;  4RG8 A;  3TSZ A;  1VA7 A;  3CMQ A;  2EQM A;  4C8Q C;  3JCM b;  3REX A;  3VBB A;  3OSV A;  4QQD A;  3CMA Q;  5CK9 A;  1KFZ A;  4KBM B;  2MK5 A;  3UH0 A;  1WYD A;  3X20 B;  4YCV A;  4AG1 C;  4C8Q E;  2DL4 A;  5GAN g;  3WQZ A;  2ZXF A;  5IHI A;  4OMN A;  2A3L A;  4KUI A;  3PTA A;  1IHW A;  4P3P A;  3CCL Q;  4GLM A;  3MKD A;  3CCE A;  2FZK B;  4LD6 A;  3GP8 A;  3CCM A;  3P8D A;  1PM3 A;  1O75 A;  2VB6 A;  4IIO A;  4P72 C;  1WJQ A;  3SWN A;  4C92 G;  5D7U A;  1Z7M A;  1OYX A;  4JPB W;  3A74 A;  3G1J A;  1JO8 A;  4M75 B;  4OMM A;  2D9T A;  2JS2 A;  1Q86 U;  3RL6 A;  1ZA2 B;  2K3B A;  2P0L A;  1U5S A;  4DA4 A;  3HXX A;  1VQO T;  3G4S T;  3JB9 H;  1EIF A;  3A5Z A;  3G7Z A;  1Z9Q A;  3M57 A;  4D6W A;  5A0D A;  1QE0 A;  3V8K A;  5KYX B;  3M0Q A;  2H3E B;  4R55 A;  3OYJ A;  3H41 A;  2JZ2 A;  2BUD A;  4NL2 A;  2QHU A;  1QCN A;  1SHG A;  2COY A;  5EC7 A;  1M1G A;  2MIO A;  4KQE A;  1VQ8 Q;  2RHQ B;  3PVQ A;  2ZZF A;  5CKF A;  3GNF B;  2NWM A;  4C92 A;  2ODR C;  1KQS P;  2E6Z A;  3V8L A;  3M56 A;  3LH0 A;  1Q7Y U;  3JSC A;  1MND A;  2KR3 A;  3QKJ A;  2RK1 A;  3VU3 C;  2MF2 A;  3CXC S;  2KSS A;  4H2X A;  2ZPB B;  2DK3 A;  1D0X A;  1LYL A;  4FCY A;  4KT0 E;  4VUB A;  3G6E T;  1ZUK A;  1YJW Q;  3C94 A;  4B6M A;  4YRP A;  5LJ5 h;  5K1P A;  3UWN A;  1H4V B;  4KRT A;  5CKH A;  3CC2 Q;  3LC0 A;  1LVK A;  1RLP C;  1SEM A;  2X4J A;  1T0J A;  4ZN3 A;  5HCK A;  1YI2 Q;  5A2Q E;  3HY0 A;  2NLU A;  1X2H A;  1M27 C;  4A4E A;  1FX7 A;  2E70 A;  4ORZ A;  1EVL A;  1NZ9 A;  1IRE B;  2JJ9 A;  4C0D B;  1AWW A;  1OPK A;  4F17 A;  4AFS C;  2NUP A;  1NJ1 A;  1GCQ C;  1XQH A;  5LJ3 j;  4LVI A;  5I21 A;  1R8O B;  1N5Z A;  3I56 T;  5KYN A;  2Q7H A;  4KH1 B;  4YCW A;  3I5S A;  2KGT A;  1TS9 A;  2JTM A;  3JCM e;  1EIY A;  2E1H A;  2H8H A;  2ABL A;  1QP3 A;  4BDZ A;  1W6X A;  1K8A C;  2EYZ A;  2RN8 A;  2WAC A;  4M75 F;  1K73 U;  2QHS A;  3SEM A;  2LC4 A;  1R0B G;  2W10 A;  3ZFJ A;  2DL7 A;  4J9I A;  5LJ3 f;  3OS0 A;  2Q5H A;  3OYF A;  3LH5 A;  4TVW A;  3JB9 F;  1K9M U;  1B34 A;  1Y96 A;  3OYB A;  4E7L A;  1B7Y A;  4Y91 A;  3RUX A;  4HT4 A;  1ABO A;  2KMT A;  3L1A A;  1JJ2 A;  2HAX A;  1NNH A;  4QVC A;  3UAT A;  5GAO m;  1ASZ A;  4XTY A;  1RI0 A;  2F2W A;  5I11 A;  4DQ2 A;  1YJ9 A;  1AT1 B;  4ZNX A;  1OU8 A;  2O9S A;  5F5W A;  3QPH A;  3NPF A;  4YRF A;  2QTV A;  1YGB A;  2Q7E A;  1M1F A;  2P5I A;  1XOV A;  2XIC A;  3QYG B;  3M4G A;  3DB3 A;  4H2T A;  1JRI A;  2QI2 A;  3ZL7 C;  1YJN Q;  4HVU A;  2XGT A;  3ER0 A;  4M77 C;  3QNE A;  2NS6 A;  2L0A A;  2LNV A;  3FDR A;  2EPD A;  1KQS S;  4NS5 A;  4PJN A;  2DE0 X;  1VQP A;  1WGS A;  3G71 A;  4UPA A;  2XTI A;  1VQ5 T;  2EL9 A;  4JJD A;  3LSS A;  1WXB A;  2CJB A;  3CD6 Q;  1VQM T;  3GNG A;  4CS4 A;  3CCV T;  4M78 F;  1QVP A;  1FYF A;  3A98 A;  4LNS A;  3OYH A;  1HK9 A;  5IHN A;  5GAN d;  4O2D A;  1QVG P;  3M54 A;  2P0Q A;  1X69 A;  1Q86 R;  3JCM Q;  4HWR A;  1WZO A;  1VQL A;  4J15 A;  4P74 C;  1C0M A;  2DIG A;  4ZTZ B;  3L42 A;  3V7C A;  1YIT A;  3OQ5 A;  4EMK B;  2HSP A;  1Q82 C;  2J06 A;  2QEX Q;  4C0F A;  2E4H A;  4M75 D;  3JB9 G;  2I0N A;  1N6A A;  1NJI C;  1WI7 A;  5D6X A;  4F04 B;  3MQZ A;  3UF4 A;  3MF2 A;  3CCS Q;  1JJ2 S;  1W2B P;  4YRI A;  4BUG A;  1WJS A;  3VQV A;  1AWX A;  5L8R E;  2DBM A;  2DTI A;  4PJO C;  2QXF A;  3L4G B;  3CCM T;  4ANJ A;  5GMK j;  3CCJ A;  2EYW A;  4BE1 A;  2EQU A;  2ZIO A;  3FJ5 A;  3OYY A;  4YRM A;  5FLX E;  4YRQ A;  2DNU A;  3GPL A;  4PJO E;  4Z02 A;  3NEL A;  4RQE A;  2JXB A;  4II1 A;  1GRI A;  5GAN 7;  1RI9 A;  2OTL A;  3QZ5 B;  5IT9 E;  3U23 A;  3CCE Q;  2L89 A;  4PL6 A;  1PSE A;  3A8H B;  3DKM A;  1QKX A;  1D0Z A;  3UPU A;  1FMV A;  2PUK B;  4L59 A;  2YLC A;  5KYW B;  3CCQ T;  4BAC A;  3OW2 P;  3A8M B;  3VRZ A;  1M1K C;  1AD5 A;  2G6F X;  3VQX A;  4E7H A;  1Q81 C;  1S72 Q;  1UG1 A;  3VJP A;  4ZGJ B;  2X3X D;  1RAB B;  4WI1 A;  1BI2 A;  1VQ6 A;  2KRS A;  3M5A A;  2GGR A;  2K5L A;  4M78 G;  1QW1 A;  3E9G A;  4YRT A;  2PME A;  4J9H A;  2JTF A;  4J9C A;  1N9S A;  2DU5 A;  3HTZ A;  4UP8 A;  2A36 A;  3MJX A;  1K73 R;  2RI5 A;  4CC3 A;  4J8O A;  5J39 A;  2GBQ A;  3OYD A;  3P8Y A;  4J7F A;  3OA6 A;  5GAM g;  4HWP A;  2R5M A;  4P75 C;  1USY C;  1PD0 A;  1K9M R;  3RGL A;  5I2S A;  3SWN B;  3EH1 A;  5IAY A;  2L3P A;  3PMT A;  4NL3 A;  1E6G A;  3EFO B;  4M78 A;  3RMQ A;  1H4T A;  1F1B B;  1WLE A;  3HXZ A;  1M3B A; 
#chains in the Genus database with same CATH homology
 1QVG S;  2RJD A;  1X6O A;  4X34 A;  3CC7 T;  3A5Z B;  3M4Y A;  4HCC A;  5C53 B;  1KD1 C;  1QF6 A;  1QVF A;  5GAN j;  1X01 A;  2OAU A;  1X54 A;  1BYM A;  4CH6 A;  1UGP B;  2K5I A;  5GMK l;  5KNN A;  1N9W A;  1WPY A;  4C92 B;  3QBY A;  5J26 A;  4HWT A;  1W2B S;  4MDW A;  4JLI A;  4H2W A;  3FJP A;  3RKY A;  1M9S A;  5C52 B;  2D0Q B;  2E64 A;  1M90 C;  1B8A A;  1UGS B;  4F7U E;  2OTJ A;  1NE8 A;  1KG1 A;  4ZTF A;  1YJ9 T;  2AMC B;  5DLQ E;  3TEH A;  2ZT6 A;  5GAO r;  5LJ5 e;  3L2U A;  4EMG A;  4XTX A;  5HY6 A;  3HFV A;  2J3M A;  1VIE A;  3OSS C;  5CCA A;  4G85 A;  3OW2 S;  1KQ2 A;  4FM4 B;  1LJO A;  3QII A;  3IKM B;  5CIU A;  1K8A U;  1VQK A;  1U1T A;  3WXM B;  4L6V 5;  4M7A D;  4KR3 A;  3E9F A;  1VIF A;  2E10 A;  3HRI A;  1VQP T;  1YFR A;  4OB3 B;  3G71 T;  1UB4 A;  3WVD B;  3ASK A;  3EFS A;  4N0A A;  4CS3 A;  2RJC A;  3V8J A;  4M7A E;  1I4K 1;  3LX7 A;  3GIB A;  3OS1 A;  1E1O A;  3QDR B;  1Y96 B;  4B9X A;  1B7Y B;  2PVG B;  4J6Y A;  3NEN A;  3L2R A;  5LJ3 h;  1VQL T;  2LCC A;  4C92 F;  3I7F A;  3HXY A;  1YIT T;  5DLO A;  4JRQ A;  3PFS A;  1H4S A;  2GFA A;  3NFC A;  3HRS A;  4K86 A;  4QW2 A;  4M7D D;  2X4W A;  5LL6 S;  3X25 B;  3S6W A;  3EAE A;  2RHZ A;  4FL6 A;  5FRO A;  2E5A A;  3N5B B;  1RIQ A;  4BB7 A;  4M7D C;  1VUB A;  2BIV A;  2H3J A;  2F5T X;  2DXU A;  3CCJ T;  2AKW A;  4YRK A;  1YFT A;  2FB7 A;  4E51 A;  4M7D E;  4BWA A;  1BI1 A;  3A31 A;  4XEO A;  2OTL T;  3IAL A;  4HKE A;  3P8V A;  1NJ2 A;  4YCU A;  3JCM c;  1I5L A;  4M77 B;  2F69 A;  1RL2 A;  4OLF A;  2XDP A;  1Q82 U;  1G51 A;  3CBP A;  3NTK A;  5GAM d;  2XD0 A;  4H2S A;  3TU4 K;  4C8Q G;  1UGR B;  1BKB A;  4TVY A;  3VYG A;  4O5V A;  1VQ6 T;  4LDV A;  2QQS A;  3QG1 A;  4ELY C;  2ALY B;  1YB3 A;  5HKC A;  4TVR A;  4GLK A;  3A8G B;  3OBW A;  2V8I A;  3VYH B;  2G4C A;  4C8Q A;  1KMN A;  3NET A;  1WJR A;  4HA8 A;  4ZN1 A;  2ZCF B;  2JVV A;  5GAN 4;  2JOY A;  3J7A F;  4YRO A;  1M1K U;  3MP6 A;  3CCQ A;  1Q81 U;  2DTH A;  4P71 C;  1SET A;  4JDS A;  4IUP A;  4P72 A;  4C5I A;  5CKE A;  1JBM A;  3A7U A;  4EO4 A;  4J5Y A;  1JJC A;  3OMC A;  3CEY A;  4BE0 A;  5GMK h;  2ZR3 A;  5FRM A;  3DLM A;  1BIB A;  4R56 A;  2YHT A;  1HXD A;  5GAO n;  4M77 F;  2L3R A;  5FRN A;  2LT4 A;  4Q5W A;  2OTJ T;  2AMC A;  4BI8 B;  1NYQ A;  3QJ6 A;  1YIJ A;  1SER A;  2RHS A;  3QXE B;  4JRI A;  3M58 A;  4LVK A;  4M78 B;  3ICA A;  3OD1 A;  4TVA B;  1KD1 U;  5KCO A;  2FHD A;  4GY5 A;  3CC7 A;  2ZT5 A;  2LRQ A;  3HRU A;  3UDC A;  4IUV A;  3MF1 A;  1VQK T;  2EJG A;  4XTW A;  1I8F A;  4J83 A;  2VXE A;  4WJ4 A;  2FL7 A;  5IN1 A;  3LSQ A;  4K87 A;  2LCL A;  4EX5 A;  2WSF E;  4IUU A;  5GAM j;  4DOV A;  1H3Z A;  2RK2 A;  1VQ4 A;  5KCH A;  1VQZ A;  3OY9 A;  1M90 U;  3S3M A;  4JUV A;  2P4T A;  2ZZG A;  5FU6 C;  3RES A;  4A53 A;  3HXU A;  5A0L A;  4RG2 A;  2LDM A;  3M4P A;  1W4S A;  4PJO F;  5FU7 C;  1X56 A;  4X9D A;  4RCB A;  2QDY B;  4C0G A;  2MWO A;  2DO3 A;  5GAM f;  2IG0 A;  2E6N A;  4AH6 A;  4HCZ A;  5C0M A;  3TEH B;  1YHQ A;  5ELN A;  4J7I A;  5GAN h;  4JS4 A;  3BDU A;  2ZIN A;  4DOW A;  4YYE A;  2P0K A;  2RHX A;  4V2S A;  4M77 G;  3CPW A;  3GOX A;  4G84 A;  2QQA A;  2RHU A;  2K5F A;  2CZ0 B;  3J80 E;  4LVM A;  4EPC A;  4UP7 A;  2CKK A;  2DZC A;  2DZ9 A;  2QHT A;  3F70 A;  4FT4 A;  3JCM g;  3CME A;  4C5H A;  2FVU A;  2MWP A;  4HWS A;  4OB0 B;  3HY1 A;  4NOY A;  1KC8 C;  4M77 A;  2R5A A;  3T9N A;  1C0A A;  2BKD N;  4OGE A;  1LNX A;  4YPF A;  3W3S A;  3FIF A;  1VQN A;  2E65 A;  4MMK A;  3RER A;  3EFR A;  4IUR A;  4XU0 A;  4E7J A;  3HFZ A;  4L87 A;  1YCY A;  5HGQ A;  1WNL A;  5LJ3 e;  2ALY A;  4YRR A;  3KFU A;  3OYG A;  4XTZ A;  3JB9 D;  3SFM A;  3FLG A;  4M75 C;  2KVQ G;  4PJO G;  4FT2 A;  2Q7G A;  1J5W A;  3PGG A;  4P74 A;  1BI3 A;  3FB9 A;  3BFM A;  1N9R A;  4M75 E;  3CC4 A;  2DXB A;  4UC4 A;  1O9S A;  3GF5 A;  1ADJ A;  1SSF A;  3MCA B;  2DD4 A;  4LDU A;  2AKW B;  2MI6 A;  4BY6 C;  2L5Q A;  4E7I A;  1VQ7 A;  3PMI A;  2PQW A;  3UGT A;  3QO8 A;  4PJO A;  4H2U A;  4ATO A;  4CH3 A;  1EQR A;  2O01 E;  2ZT7 A;  1Y07 A;  2LVM A;  5EG2 A;  1XNI A;  4J6X A;  1Q86 C;  2RJF A;  1WQW A;  2PVO B;  3CMA A;  2DQ3 A;  2GCX A;  2M0O A;  1KMM A;  3FC3 A;  2PMF A;  3MET A;  4M78 D;  1PYS B;  2ZPE B;  4ZGE B;  5LJ5 f;  4BD3 A;  4YRE A;  5D6W A;  4C0D C;  4C5G A;  4X9C A;  3PCO B;  4Q6G A;  2E3C A;  2CJ9 A;  3ME9 A;  5CAI A;  4Q15 A;  4MZP A;  1YIJ T;  3OYM A;  5GAO p;  2VC8 A;  2Q5I A;  2ZNI A;  4C8Q B;  4TVA A;  1HC7 A;  5GAN 3;  4PHC A;  2GF7 A;  3M55 A;  2DU7 A;  3VQW A;  1N27 A;  4P5N A;  1GGM A;  1FXX A;  3QO5 A;  4P75 A;  1USY A;  2YRV A;  1NPR A;  1MGQ A;  2WSC E;  2DKG A;  2CJA A;  3C12 A;  1JJC B;  4JJN K;  2GFU A;  5DY9 A;  3LLR A;  1VQ4 T;  2RB6 A;  2D6F A;  1YJW A;  2WSE E;  2CZ6 B;  5GAO l;  2ZZE A;  3OYN A;  3PT9 A;  5DM7 R;  2XI9 A;  2K4Y A;  1NJ8 A;  3CC2 A;  5GMK e;  1YI2 A;  4YTL A;  4A4H A;  2EKO A;  3C4S A;  3JCM J;  2A8E A;  3JCM d;  4P3O A;  3HHT B;  2EIF A;  2ARU A;  1YHQ T;  4F7U A;  2RHS B;  1M4Z A;  4H02 A;  4PLI A;  4WF2 A;  1ASY A;  2O4X B;  3VV0 A;  5CR2 A;  4QQG A;  2ZT8 A;  12AS A;  3URG A;  3BW1 A;  2I4O A;  4M7A G;  4N4I A;  1PSF A;  1WU7 A;  1L0W A;  4M7A C;  2ZTG A;  3HSB A;  1G3T A;  2RHI A;  1M5Q 1;  2RHY A;  4PKC C;  4C8Q F;  4TWA A;  3ZEH A;  3CME T;  1E22 A;  4HWO A;  1XTD A;  3HXW A;  5CQY A;  2FYK A;  3QO3 A;  1QVF S;  2E12 A;  5C51 B;  4PG3 A;  4LVJ A;  4XQ3 A;  2G3R A;  3M9Q A;  4M7A A;  1VQN T;  2X4Y A;  3M59 A;  3NTI A;  4P73 C;  2K57 A;  3J81 E;  1QP2 A;  3PZC A;  3E1S A;  2PU9 B;  1YJN A;  1N8R C;  1EFW A;  5LJ5 g;  3CBM A;  5FU6 B;  3A7A A;  2VYT A;  5HK3 A;  2DXT A;  5GAM h;  5GAN e;  3OS5 A;  2QHV A;  4ZIB A;  3HFN A;  4M7D G;  1KQ1 A;  3M53 A;  1OZ3 A;  3A32 A;  2C06 A;  3CD6 A;  2HD0 A;  3CC4 T;  4LDX A;  1X2G A;  3HP9 A;  3Q1J A;  4P73 A;  3OMG A;  1UEB A;  3PIP A;  3TEG A;  1KC8 U;  4MML A;  3RF1 A;  2KK4 A;  1X75 C;  3PNW C;  4CRI A;  2VGM A;  5CKD A;  1VQ7 T;  4YDQ A;  4BE2 A;  3TCJ A;  2ZNJ A;  3UFG A;  4O6J A;  3L2W A;  4M7D A;  2ZPG B;  5K1X A;  4KUL A;  2LX9 A;  2QEX A;  1G5I A;  3MP1 A;  3CXC A;  1NJI U;  2XDD A;  2ZR2 A;  3A8L B;  3GLX A;  4QQ6 A;  4OF1 A;  3CMA T;  4X5O A;  3HFZ B;  3DLL A;  1UGQ B;  3CCS A;  1U8R A;  1PYS A;  3HFO A;  1MHN A;  2PUO B;  3CCL T;  1ZBX A;  3E9I A;  3DSQ A;  3PCO A;  2HQX A;  3MHX A;  4UP9 A;  3OYI A;  2IVW A;  4BI3 A;  1NJ5 A;  3HKS A;  2EWN A;  3QJY A;  4TQD A;  4PNO A;  3FRN A;  3QSU A;  1KOG A;  3JCM f;  4C92 D;  4BW9 A;  2LQK A;  3KUF A;  3CCU A;  1KHC A;  3X28 B;  2HQE A;  4KUD K;  4LDW A;  3NEM A;  3QZ9 B;  4XAX B;  2I4L A;  4IUT A;  1ZHI A;  2XHC A;  4C92 C;  2M9U A;  2JNG A;  2RI3 A;  1NPP A;  4CI0 C;  2XU8 A;  2Y90 A;  1S72 A;  4PJO B;  1G5H A;  1VQ8 T;  3VKI A;  3JB9 I;  4C92 E;  3HPW A;  2RH2 A;  1LOJ A;  4XU1 A;  3LGL A;  2F5K A;  2J3L A;  2EAY A;  2ODR D;  2KY9 A;  4YRG A;  4EMH A;  4BY6 B;  4CH5 A;  4RQF A;  2ZIM A;  1YJW T;  4RMO A;  2M16 A;  4ME7 A;  5E3I A;  4FU6 A;  2QQR A;  4KR2 A;  4FIB A;  4P71 A;  1Y7X A;  1ATI A;  4PLL A;  3CC2 T;  4H2V A;  3A7R A;  3RIR A;  1YI2 T;  1W66 A;  3JAM E;  3RMS A;  4RDX A;  2QQB A;  2EYQ A;  3CBO A;  3S3O A;  2L8D A;  2E41 A;  1GXI E;  3M4Q A;  3OB9 A;  1KHI A;  2EJF A;  4XTU A;  3CCR A;  11AS A;  4YRL A;  1KQS A;  2O4X A;  4P3N A;  3L2V A;  5HK0 A;  2DTO A;  4DPG A;  5I2M A;  3IG2 A;  4JLG A;  4J6W A;  2ZCE A;  3BDL A;  3UT1 A;  1Z7N A;  5ELO A;  3JCM X;  2IY5 A;  2AHJ B;  2QA4 A;  3BJU A;  3IKL A;  3HL8 A;  5GMK i;  2XG8 D;  3P8T A;  5LJ5 d;  3LWI A;  3MP8 A;  1EVK A;  4XK8 E;  2DDZ A;  3H8Z A;  2KQW A;  2EQK A;  1D3B A;  2DEQ A;  4E7K A;  1M8V A;  2RD1 A;  5GAN 8;  4YRC A;  5GMK m;  1FWZ A;  1AHJ B;  2XKO C;  2CYZ B;  5A0G A;  3QYH B;  2PVD B;  3RAC A;  3RKW A;  1TH7 A;  4OB1 B;  3JB9 J;  4F7U B;  3REU A;  1YJN T;  3MEW A;  4XTV A;  2XDB A;  4RMF A;  4OGC A;  4BI4 A;  2DVE A;  1YBY A;  1NJ6 A;  4M77 D;  3LGF A;  4H2Y A;  1IZ6 A;  3HRK A;  2ART A;  2K3X A;  3OS2 A;  3CD6 T;  3MEA A;  3LW5 E;  3MEV A;  4LDY A;  3MEY A;  1H4Q A;  3E9H A;  3ZBD A;  3G1Z A;  2DJZ A;  2XID A;  4XU2 A;  4M77 E;  2KAF A;  3OYL A;  5KE3 A;  1P92 A;  4MDX A;  5AYF A;  1B70 A;  2M1H A;  2Y4X A;  2JUF A;  5C6S A;  3E19 A;  3UGQ A;  2X35 A;  3H6Z A;  1ZQ1 A;  3KXT A;  3OYA A;  4M7A B;  2QEX T;  2CZ7 B;  1N8R U;  4BDY A;  4E47 A;  3CCS T;  5CVI A;  4M75 G;  3L2Z A;  4MZT A;  2DIQ A;  3JCM V;  4YP0 A;  2RJE A;  4QVZ A;  1I81 A;  4PJO D;  2ZZD A;  3LWH A;  5GAM e;  1E1T A;  1QVG A;  2MMP A;  1X55 A;  4F7U F;  3CCE T;  3CPW S;  3TEE A;  1ADY A;  3X26 B;  3CCU T;  2LT1 A;  3OBY A;  3OYK A;  2JN0 A;  4M75 A;  1G5V A;  2C7I A;  2Y4Y A;  2K2V A;  5LJ5 j;  4K88 A;  3I55 A;  4RKU E;  2EFI A;  1VQ9 A;  4M7D B;  3V7R A;  1S72 T;  2P0P A;  1BBW A;  3AHU A;  1W2B A;  4C0Z A;  3SB2 A;  3RKX A;  1BBU A;  1YFS A;  2CGH A;  2DXC A;  2RHQ A;  3A8O B;  3CCL A;  4A54 A;  3QO7 A;  4QVD A;  2EJ9 A;  2RA2 A;  4HT8 A;  2RI2 A;  5LJ3 g;  4HT9 A;  2ZPF B;  4LVL A;  4M78 C;  4M7A F;  1Q7Y C;  5GAN 5;  2YLB A;  4ELZ C;  2V8J A;  2VV5 A;  4M78 E;  2ZPH B;  4A4K A;  3OW2 A;  5D6Y A;  2CS7 A;  4LD9 K;  2DQ0 A;  2RO0 A;  2I2L A;  3VUB A;  5KE2 A;  1EOV A;  3CCR T;  3P8H A;  3QUI A;  1G3W A;  5KH6 A;  3OYC A;  1VQ8 A;  2VGN A;  4Y28 E;  3JCM h;  4HCB A;  1VQO A;  4OVA A;  4C5E A;  2CZ1 B;  3G4S A;  1OI1 A;  2QA4 T;  4F7U G;  3JCM W;  2HNI A;  4N4G A;  4EDU A;  3FEO A;  2I4N A;  2ZPI B;  4M7D F;  3BY7 A;  4TQF A;  2KDS A;  1K73 C;  1B76 A;  3G6E A;  2B8A A;  3NTH A;  3SD4 A;  4ZGD B;  4H2X B;  4CH4 A;  2CIM A;  4IUQ A;  5GAN f;  4XEM A;  2GQV A;  1K9M C;  1G3Y A;  3LYI A;  2LQ8 A;  2QQ9 A;  1V29 B;  4NCX A;  3TRE A;  1BIA A;  4N0A C;  2VUB A;  3I56 A;  3HXV A;  4HVC A;  3R6O A;  2QTX A;  4A4F A;  2DD5 A;  2IY5 B;  1DJ7 B;  4YRJ A;  2MAM A;  3ERR A;  1EIY B;  5GAN 6;  3MEU A;  1E24 A;  2ZGW A;  1WQ7 A;  4EMK C;  4JS5 A;  4L5G A;  1D3B B;  4FSX A;  1BI0 A;  3PIO A;  4WJ3 M;  3VQY A;  5GAO q;  4RCC A;  2K3Y A;  3P8B B;  4ZTU B;  2VXF A;  4XU3 A;  1B34 B;  3C95 A;  4A4G A;  4YRN A;  1U1S A;  3L2Q A;  5CO7 A;  1OZ2 A;  3MO8 A;  1SRY A;  4YRS A;  4B9W A;  1H64 1;  4EMK A;  2DAQ A;  2HBP A;  4ZTJ A;  3S3N A;  1IL2 A;  3JCM P;  4JRP A;  2R58 A;  4MZM A;  2I4M A;  5FU7 B;  1NYR A;  4JRK A;  2XK0 A;  2A7Y A;  3VUZ A;  3JRZ A;  5CQX A;  2RM4 A;  3HRT A;  3OYE A;  3INZ A;  3KBG A;  3L4G A;  4OP0 A;  2X4X A;  5GAN 2;  3R07 A;  2R57 A;  2EQJ A;  4TTV A;  3QTC A;  3SDZ A;  2ARS A;  1VQ5 A;  3V7S A;  2E5Q A;  5CKB A;  5M9O A;  1VQM A;  4CS2 A;  3A5Y A;  3QHS A;  3X24 B;  5LJ3 d;  3CCV A;  3I55 T;  1G3S A;  3DB4 A;  2DPP B;  2LTO A;  4OMF B;  1VQ9 T;  1B70 B;  4IKF A;  1JB0 E;  2V8K A;  1HTT A;  3O8V A;  3TUP A;  4OB2 B;  4C8Q D;  2C8M A;  1SES A;  5J3B A;  3CPF A;  4N4H A;  1Y71 A;  3WVE B;  3SWN C;  4RG8 A;  3CMQ A;  2EQM A;  4C8Q C;  3JCM b;  3REX A;  3VBB A;  3OSV A;  4QQD A;  5CK9 A;  4KBM B;  3UH0 A;  1WYD A;  3X20 B;  4YCV A;  4C8Q E;  5GAN g;  3WQZ A;  2ZXF A;  2A3L A;  4KUI A;  3PTA A;  4P3P A;  3CCE A;  4LD6 A;  3GP8 A;  3CCM A;  3P8D A;  1O75 A;  4P72 C;  1WJQ A;  3SWN A;  4C92 G;  1Z7M A;  1OYX A;  3A74 A;  4M75 B;  2D9T A;  1Q86 U;  3RL6 A;  2P0L A;  4DA4 A;  3HXX A;  1VQO T;  3G4S T;  3JB9 H;  1EIF A;  3A5Z A;  3G7Z A;  4D6W A;  3M57 A;  5A0D A;  1QE0 A;  3V8K A;  4R55 A;  3OYJ A;  2JZ2 A;  2BUD A;  4NL2 A;  2QHU A;  1M1G A;  4KQE A;  2RHQ B;  2ZZF A;  5CKF A;  3GNF B;  4C92 A;  2ODR C;  2E6Z A;  3V8L A;  3M56 A;  3LH0 A;  1Q7Y U;  3JSC A;  3QKJ A;  2RK1 A;  3VU3 C;  2MF2 A;  3CXC S;  2KSS A;  4H2X A;  2ZPB B;  1LYL A;  2DK3 A;  4KT0 E;  4VUB A;  3G6E T;  3C94 A;  4YRP A;  5LJ5 h;  5K1P A;  3UWN A;  1H4V B;  5CKH A;  3LC0 A;  2X4J A;  4ZN3 A;  5A2Q E;  3HY0 A;  2NLU A;  1X2H A;  4A4E A;  1FX7 A;  2E70 A;  1EVL A;  1IRE B;  1NZ9 A;  4C0D B;  1NJ1 A;  1XQH A;  5LJ3 j;  4LVI A;  5I21 A;  1R8O B;  3I56 T;  2Q7H A;  4YCW A;  2JTM A;  3JCM e;  1EIY A;  2E1H A;  1QP3 A;  4BDZ A;  1K8A C;  2WAC A;  4M75 F;  1K73 U;  2QHS A;  2LC4 A;  3ZFJ A;  5LJ3 f;  3OS0 A;  2Q5H A;  3OYF A;  4TVW A;  3JB9 F;  1K9M U;  1B34 A;  1Y96 A;  3OYB A;  4E7L A;  1B7Y A;  4Y91 A;  3RUX A;  4HT4 A;  2KMT A;  3L1A A;  1JJ2 A;  2HAX A;  1NNH A;  4QVC A;  5GAO m;  1ASZ A;  4XTY A;  1RI0 A;  1YJ9 A;  4DQ2 A;  5F5W A;  3QPH A;  4YRF A;  1YGB A;  2Q7E A;  1M1F A;  2P5I A;  1XOV A;  2XIC A;  3QYG B;  3M4G A;  3DB3 A;  4H2T A;  1JRI A;  2QI2 A;  2XGT A;  3ER0 A;  4M77 C;  3QNE A;  2NS6 A;  2LNV A;  3FDR A;  1KQS S;  4NS5 A;  1VQP A;  1WGS A;  3G71 A;  4UPA A;  2XTI A;  1VQ5 T;  2EL9 A;  3LSS A;  2CJB A;  1VQM T;  3GNG A;  4CS4 A;  3CCV T;  4M78 F;  1QVP A;  1FYF A;  4LNS A;  3OYH A;  1HK9 A;  5GAN d;  4O2D A;  3M54 A;  2P0Q A;  3JCM Q;  4HWR A;  1VQL A;  4J15 A;  4P74 C;  2DIG A;  4ZTZ B;  3L42 A;  3V7C A;  1YIT A;  3OQ5 A;  4EMK B;  1Q82 C;  4C0F A;  4M75 D;  3JB9 G;  1N6A A;  1NJI C;  5D6X A;  3MQZ A;  3MF2 A;  1JJ2 S;  4YRI A;  4BUG A;  1WJS A;  3VQV A;  5L8R E;  2DTI A;  4PJO C;  2QXF A;  3L4G B;  3CCM T;  5GMK j;  3CCJ A;  4BE1 A;  2EQU A;  2ZIO A;  3OYY A;  4YRM A;  5FLX E;  4YRQ A;  3GPL A;  4PJO E;  4Z02 A;  3NEL A;  4RQE A;  4II1 A;  5GAN 7;  2OTL A;  3QZ5 B;  5IT9 E;  2L89 A;  4PL6 A;  1PSE A;  3A8H B;  3DKM A;  3UPU A;  2PUK B;  4L59 A;  2YLC A;  3CCQ T;  4BAC A;  3A8M B;  1M1K C;  3VQX A;  4E7H A;  1Q81 C;  4ZGJ B;  3VJP A;  4WI1 A;  1BI2 A;  1VQ6 A;  3M5A A;  2K5L A;  4M78 G;  1QW1 A;  3E9G A;  4YRT A;  2PME A;  2JTF A;  1N9S A;  2DU5 A;  3HTZ A;  4UP8 A;  2RI5 A;  4J8O A;  5J39 A;  3OYD A;  3P8Y A;  4J7F A;  3OA6 A;  5GAM g;  4HWP A;  2R5M A;  4P75 C;  1USY C;  3RGL A;  5I2S A;  3SWN B;  5IAY A;  3PMT A;  4NL3 A;  4M78 A;  3RMQ A;  1H4T A;  1WLE A;  3HXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...