4L87A

Crystal structure of the human seryl-trna synthetase in complex with ser-sa at 2.9 angstrom resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
476
structure length
476
Chain Sequence
b'VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine--tRNA ligase, cytoplasmic
publication title Crystal Structure of Human Seryl-tRNA Synthetase and Ser-SA Complex Reveals a Molecular Lever Specific to Higher Eukaryotes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 132
structure length 476
sequence length 476
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4l87A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4l87A02
3LC0A 1PYSB 4H2SA 3TUPA 1QF6A 3V7CA 3NELA 2P0LA 4P74A 3G1ZA 1H4VB 3RUXA 3CMQA 2J3LA 2RHSA 3L2ZA 1SETA 1KOGA 4BW9A 3IKMB 4K86A 3P8TA 4P3OA 3RGLA 2EL9A 4YRGA 2HNIA 3MEYA 2C7IA 4YRPA 3HTZA 2Q7HA 2DZ9A 3HXVA 2ZR2A 4Q15A 3A7AA 4X5OA 2DEQA 3NETA 1NJ2A 1EQRA 1ATIA 3TEGA 1BBWA 1NJ1A 3A31A 4P74C 3HXWA 2QHTA 3HFVA 3W3SA 2EWNA 1J5WA 1N9WA 4XTUA 3TEHB 1B8AA 1QE0A 3UGTA 4YRIA 1WLEA 3HY0A 1ASYA 2E5AA 3V8KA 2EJ9A 4RMFA 4CH3A 2DXUA 2ODRC 4DPGA 3VQYA 4CH4A 2XTIA 3QO5A 2Q5IA 2CJAA 3I7FA 3VQWA 5C51B 4UP9A 1B70A 1JJCA 4YRKA 3BJUA 4YCWA 2CJBA 1ADJA 2Q5HA 4XEOA 1SRYA 2ZT7A 2DTOA 4XEMA 3L1AA 12ASA 4P71A 3UGQA 1W66A 3A7UA 3VBBA 3V8JA 2ZGWA 4UP7A 4YRCA 1WPYA 4CH5A 3MF2A 1FYFA 4H2XB 3QNEA 5K1PA 3E9HA 4WI1A 4YRTA 4YRNA 4TQFA 1WU7A 3RKYA 3EFSA 3EFRA 2I4LA 1IL2A 4P73C 3HXZA 4ZTUB 1WQ7A 1ASZA 4CS3A 1BIAA 4HWSA 3REUA 3PCOA 1G5IA 3E9IA 1G5HA 4DQ2A 4LNSA 1EIYB 4HWOA 3RIRA 1HXDA 3P8YA 2DKGA 4P71C 4K87A 4H2YA 3IG2A 2QHUA 4BWAA 1X54A 1HTTA 4XTYA 1H4QA 2DQ0A 3A5ZA 1H4SA 2ZT8A 3RL6A 2DU7A 5C52B 1VQZA 4PG3A 1Z7NA 2ZIMA 3OD1A 4H2VA 3A5YA 4OP0A 3DSQA 5ELNA 4KR3A 2ODRD 4YRFA 1B76A 5KNNA 3QTCA 1X55A 2EAYA 2DJZA 3IALA 4YPFA 2ZNIA 5E3IA 2CGHA 3HRIA 3IKLA 1EFWA 4H2WA 2FYKA 2J3MA 4TVAB 4WF2A 4XTWA 4P3PA 1YGBA 4AH6A 1L0WA 1GGMA 3TEHA 1X01A 2DZCA 1SESA 3REXA 4XTVA 4CH6A 3RKWA 2ZZEA 3V8LA 2ARTA 2ZXFA 4L87A 4HWRA 5HGQA 4YYEA 4P73A 4H2UA 4XU1A 3V7SA 2QHVA 3WQZA 4WJ3M 1NJ5A 4XTXA 4YRMA 2RHQA 2QHSA 2RHQB 4XTZA 1YB3A 3A32A 1YFSA 1NYQA 1WNLA 4YRLA 2I4OA 4TVWA 4OLFA 2E64A 4H2XA 3LSSA 2ARSA 1G51A 1E1TA 3HY1A 4HWTA 3ICAA 4HA8A 2C8MA 4P72A 5K1XA 2Q7EA 3M4QA 3KFUA 2DDZA 3RF1A 4XU2A 3V7RA 4ZIBA 1USYC 4WJ4A 2DVEA 4RQEA 2ZINA 2DXTA 1EIYA 4XU3A 2PMFA 3HFZB 1BBUA 3UFGA 1EOVA 1KMMA 1H4TA 2AMCA 1SERA 1E24A 2AMCB 2ZZFA 2AKWA 4P72C 2ZT6A 4RQFA 1YFRA 2AKWB 1WQWA 4P75C 4HVCA 3LSQA 3P8VA 1X2HA 4TQDA 4YROA 1NJ6A 4H02A 1BIBA 1NNHA 2RHSB 2ZT5A 2ZZGA 2CIMA 3NEMA 4RDXA 2G4CA 2ZTGA 2ZNJA 2DU5A 4TVAA 3UH0A 3RACA 4YRRA 3RKXA 11ASA 3QO7A 1E1OA 4E51A 2ZIOA 4YRQA 2I4NA 3M4PA 4TTVA 4G85A 4HWPA 4O2DA 1YFTA 3HXXA 5ELOA 2E10A 1C0AA 2DTIA 4UP8A 4YP0A 1WYDA 1USYA 2P5IA 5C53B 1B7YA 2E41A 2PMEA 3VQVA 1B7YB 3HXUA 4YCVA 4J15A 5F5WA 2E3CA 4H2TA 2ZR3A 4YDQA 2E1HA 4TVYA 3QO8A 4ZTZB 2IY5A 1RIQA 1B70B 2ALYA 1JJCB 2IY5B 2ALYB 4PHCA 4YREA 1LYLA 4YCUA 3A7RA 2CJ9A 3BFMA 3R07A 4XU0A 4P75A 3VQXA 2EJFA 4P3NA 2E65A 4YRSA 3PZCA 3HRKA 4NCXA 1NYRA 3HFZA 1NJ8A 1X2GA 2Q7GA 4KR2A 4K88A 2EJGA 2DQ3A 1KMNA 4KQEA 2ARUA 3FJPA 4CS4A 3MF1A 4UPAA 3NENA 1HC7A 4EO4A 1X56A 3L4GA 1ADYA 4CS2A 4Q6GA 3HXYA 3L4GB 1E22A 3PCOB 4YRJA 2XGTA 1Z7MA 3ERRA 2ZCEA 4G84A 2DTHA 1EVKA 1EVLA 4TWAA 3A74A 1PYSA 4EX5A 2I4MA
chains in the Genus database with same CATH superfamily
1CEZA 3TUPA 5E1AC 3TGUH 1QF6A 3NELA 2HJDA 4LH7A 4P74A 4OXSA 1H4VB 4PI0A 2J3LA 2RHSA 2YXYA 1KOGA 4BW9A 2QSAA 1TVKB 3RGLA 4UV9A 2VWJA 4X66B 1Y4MA 3K9SA 3JAKA 1N36B 4Q15A 1DLBA 4W4KA 1KP3A 3KG2A 3C90A 4I5SA 1LUVA 1ATIA 1SQFA 4PDVA 3K5NA 3BA9A 1NJ1A 3PJSK 4CBCA 4FPPA 3J81N 1KBHA 1NTZH 3RVZA 4ZHQB 5LP6C 4LF7B 5EBLC 3HFVA 4TV9B 3JALA 1ORQC 1HNZB 4CC5A 1OZ0A 1WNSA 1GH6A 1YJWV 2W0XA 4FLTA 1ZLZA 1XBLA 1R6TA 1B8AA 1Q6IA 1WP7A 4UCRA 1VF6A 4RMFA 2HFEC 4DV7B 4JI8O 4JGSA 1SF9A 1D5AA 1V54C 2ZKOA 3AK1A 3JATA 1Q81W 1FXKC 3BJUA 1OHHG 4LF6O 5LOVA 2HVKC 2CH7B 1M9NA 1AI4A 4I0XB 1SRYA 5FPOA 4I4TA 2QWRB 4GT1A 3L1AA 3E8BA 3RBZA 12ASA 3RT3C 4J9YB 2A0LA 3K5LA 2UU9O 1JMKC 5JVDB 2N74A 2QWPB 3OW2U 1I0HA 2UXCO 5K1PA 2F66C 1VQ4V 3RWRD 5EC1C 1JOYA 3P3PA 5JCOA 1OCZB 4LFCO 1IL2A 1YTFB 5B5EZ 1DF4A 3ABMC 2HJFC 3ETGA 3REUA 1LNQA 1I5YA 2IBZH 2UXXA 1I94O 3ETQA 4LNSA 1TUBA 3RIRA 1HXDA 5KUMA 4FLXA 4P71C 2KG7A 1BSMA 3HKCB 4LF4O 2QHUA 4F4LA 4MW8A 1VQPV 2EIJC 2EIKB 2Y0IA 1H4SA 3E8FA 2MW2B 1TVKA 2DE0X 3RL6A 1UPGA 3K57A 3DC6A 1VQZA 3ZRSA 1Z7NA 3AG4B 3G80A 3H9VA 4KL1A 3CS5A 3OD1A 2ZT9B 1JA8A 2ZXWC 1E1QG 4R6ZA 2EZPA 1QVGU 4XBFA 2WLJA 2DYRC 3E22B 1N32B 3JSLA 5KHGA 3IGAC 1JJOA 3CJHB 3QVNA 3QTCA 2UUBO 1GTOA 5FL7G 4J7KA 4GX5A 4IGGA 1X55A 4E2LA 2DJZA 1NI8A 3ASOC 3OM3B 4FM0A 4BIOA 1NU1H 4DV5O 2Q67A 2NS6A 3ABLB 4X1KB 4I55A 4TV9A 1WA8B 4GX2A 1IURA 1YGBA 4OPHA 2JK5C 5H2FZ 1PNKA 3HKEB 3BY6A 3CX5F 5AG2A 4PA9A 4FLYA 1EZVH 2LFRA 5L3GA 4YY3O 4HBNA 2UUCB 4CH6A 3GWOA 3V8LA 1XMOO 3DC5A 2ARTA 4O4IA 3U0ZA 4QE9A 3ZX6A 1RPOA 1FPOA 4MS2A 5HGQA 1M1KW 2ZM6O 4XDKA 2A06H 4P73A 4N23A 3WQZA 4TUYB 4XTXA 5J2TB 2FKXA 2CH7A 2JEXA 2A8EA 3JARB 1J5EO 1W59A 1VIBA 4LFBO 2JGDB 4GKJO 3ZHSA 3RYFA 2A9HA 3SJBC 4K8XA 4E4EA 3HB3B 2XASA 1MMMA 5JVDA 4DR5B 2I4OA 3A8TA 2E64A 2V1DA 4KHPO 3HY1A 4NTXA 4HWTA 2M7WA 4PHZA 2HHHO 3ICAA 2C8MA 4RUFA 2Q7EA 1K4CC 1R3IC 4PV1B 3TXSA 4PA4A 4X9QA 3KFUA 4JTAB 3W7TA 1N8RW 2F4VB 3GWKC 4DR3B 3I5DA 2F23A 1YZBA 5LL6Y 3MHSC 4WJ4A 1IBKB 2YICA 4OGQB 2DWEC 4HT4A 3UFGA 3OE7G 1OCOB 1K5SA 2YI8A 2GBOA 3B09A 4KUMA 3HKCA 4U3FH 1KMMA 1JFFB 2P5OA 2AMCA 3P32A 4QE7A 1ZL8B 3E89A 1K3EA 4P72C 2AKWB 1WQWA 3B77A 5B1NA 4HVCA 2CAZC 5EIBC 4HNAB 4MTFA 1BGYH 3MDSA 2AGAA 3F7YC 5F2VO 3P8VA 4TQDA 4YROA 4JI7B 1L0LH 2ADPA 5LP6B 1BIBA 4FMTA 3CMAV 3NEMA 3JD0A 4UUJC 2CE4A 2G4CA 2DU5A 2P67A 3RACA 4P9OA 4X1KA 3RKXA 1WA8A 2F93B 3FYIB 3QO7A 2OCCC 4YRQA 4KFMA 4X1IB 5ITZB 3HKEA 1QR8A 2BSKB 2O57A 5D5QA 4G85A 1V54B 4JV5O 3ZRWB 4JYYA 4WFAV 1SZTA 3OUSA 4MTOA 1BMFG 3T1YO 1AI7A 4WFFA 2QM7A 1WJZA 3H1LH 4K8ZA 1IBMO 1DTOA 4B7KA 2Z3YA 1M90W 1RPRA 1QVFU 4TUYA 1GM9A 2XNDG 2P06A 5J2TA 2P5IA 3BEHA 3OTOO 5LYJB 2BCCH 3LDCA 2Q0AA 2W6JG 3JARA 4LF9B 1H2LA 1B7YA 3BFRA 3VQVA 3HXUA 4QNHB 2Z5UA 4LFCB 1VQ6V 4JF3A 4YCVA 4DR1O 3SJQC 1FKAO 1KD1W 4TVYA 3QO8A 2UXDO 3FB6C 1GAXA 2ZDIC 2B5UA 1GN3A 4DV1O 4X64O 4LP8A 1XNRB 4WBNB 1XHXA 1ZX3A 3CCUV 2BOCC 5JQGB 5IY5C 1YI2V 2HP8A 1EBOA 4O2AB 4LF4B 4P75A 2EULA 4G28B 2ITDC 4K3AA 4O4JA 1QU7A 3K08A 4R7CA 3RN4A 4P3NA 5KLVH 3STZC 4QIWF 5C93A 4JASA 2ZE5A 4NYKA 2EIJB 4LC1A 4MVRA 4DUZB 4GKKO 4J10A 3THOA 2DQ3A 2ARUA 4DRXA 3UM7A 1TAEA 1E1RG 1KQSU 1JFFA 3J80N 4YXWG 4O2BB 4UFZA 2QM4A 5FLXN 1YEWA 4CS2A 3CCEV 5LGNA 4K0KB 1XEQA 4W4LA 4RWUA 2FL4A 2QTSA 4JI4B 3PCOB 2XGTA 2R9RB 3BCCH 4G84A 3Q4HB 1JPXA 5KMGB 1BQZA 3MHHC 4HNAA 4IYIA 2HR3A 1OCCB 2AHZA 2X0LA 4YIPA 2I4MA 1PYSB 2B9ZA 3L71H 4R8CA 4H2SA 1N4CA 3OT7A 3B8MA 3RW0A 3CCVV 5LP6A 4LH6A 3CMQA 3IFXA 3ASNC 1SETA 4O4LA 3IKMB 3CPWU 2GTAA 4K86A 4P3OA 2YDEA 2WWWA 3L70H 3HTZA 2Q7HA 3OGIB 4KXRA 3JAKB 2DZ9A 2ZR2A 4WF9V 4FLWA 5C8YA 1MOFA 4X5OA 2DYSC 2BSKA 1K9MW 1RM1B 4JI3O 2Q68A 5LMUB 4B3RB 1NJ2A 4DR6B 1NH2D 3WB2A 3ZRWA 4DW1A 3CC2V 1FXKA 1ENVA 4DUYO 3TJTA 1XUQA 5BXZA 1ZTEA 4LNUB 2PZSA 2IU0A 4FM1A 3FAVA 3ZN1A 3JALB 4FLZA 2IH3C 2EWNA 1YITV 4K35A 1N9WA 4FVMA 1AROP 2HHHB 3HKDB 2VQFB 2ZQMA 1QE0A 3MQZA 5D5PA 1MZEA 1G8MA 2E5AA 3J7AU 2JDIG 2PF4E 2ODRC 4X89A 2VQEO 2RQ6A 3K58A 4DPGA 3OMIB 4DK1A 2CTQA 2Q5IA 4DW0A 5C51B 5IWAO 4UP9A 2CK3G 4WBNA 5LA6B 5EZYA 5CB4B 4X65O 4YRKA 4UCUA 1ADJA 2KSDA 1PPJH 1SQQH 5BMVB 4XEOA 2ZT7A 4O2AA 3FB7C 4I4TB 1VP7A 1HNXO 4XEMA 4P71A 3UGQA 1SQPH 1BQ0A 1YF2A 2WAMA 3AG2B 4UP7A 5IDJA 5B1AB 3A0RA 3K79A 4LVKA 1XNQB 4JI2O 3BA8A 3O65A 2YXLA 1EN5A 4YRTA 4YRNA 4KP4A 2RJZA 3JCUZ 3RKYA 1HP8A 3EFSA 4B3MO 4DXWA 4MW3A 1KUQA 2MK3A 1R6NA 3WB1A 3HPLC 2EIMC 3HXZA 1ASZA 2RNBA 1YJNV 3IC9A 4CS3A 4U7NA 5JJEB 3PCOA 2LO1A 1AVMA 2ILMA 3E9IA 4DQ2A 1EIYB 4HWOA 3Q4HA 2FMLA 1I7FA 3OAAG 3K3WA 1H2GA 4UVAA 2DKGA 5GTIZ 1K7DA 5BR8O 4K87A 3ZHTA 5LMNO 3IG2A 1CXZB 2KG7B 2G38A 2Q9LA 2X6BA 1NQTA 1H4QA 1B6QA 2ZT8A 3SPHA 1KB9F 2OCCB 2E75B 4G2KA 5C52B 1SC5B 2ZIMA 2Q4PA 1R3KC 3CSXA 4MTXA 2D2CB 1N33O 4JTCB 4DV4B 4X1YA 2ODRD 1N0JA 3OEHG 3RYCB 1AR5A 2JS3A 4JI5O 2EAYA 3OTOB 3BAAA 4DR7B 3RGBA 3CCJV 5GW7A 2ZNIA 2CGHA 3AG1C 4H2WA 5IYCO 2J3MA 5TISZ 4TVAB 1IZ3A 2W6IG 4LNUA 2X6AA 2YIAA 4X88A 2K9PA 4XDLA 4I55B 1VQKV 4J42A 1GGMA 3L9DA 1X01A 4Z2WA 1SESA 3HKDA 3CXCU 3REXA 1DGSA 1S3JA 1ZUQA 4GCZA 4H44B 3OUFA 3RKWA 1WPBA 1MG1A 1NH2B 1MSDA 2ZXFA 1P49A 1EN6A 3K9AA 4O4IB 1PNMA 2EJ7A 1AR1B 4JYAB 4IIJA 4YYEA 4XU1A 2QHVA 1WP8A 5LA6A 5CB4A 4WJ3M 1GMGA 5KHIA 2RHQA 5BMVA 4F6EA 2E5LB 4NXMO 3A32A 4JI6B 1SQVH 4JI0O 5HFMA 4H0LB 3KZIZ 2CDYA 1HNWB 3WG7C 2H94A 5DM6V 1P7BA 4JAAA 3RYFB 3JAMN 2WA3A 2ZE7A 1WNLA 4TVWA 4OLFA 2ARSA 3AEIA 1GN6A 3ZN0A 2RMKB 4P72A 5K1XA 2GUZB 3T2MA 2LGQA 3H1KH 4NXNB 5JJNB 4JI1O 1I5XA 3RF1A 3LDDA 5EC2C 3V7RA 1V55C 2BTOA 4RQEA 4J41A 1H8EG 1QCEA 3ZMUA 1EIYA 2PMFA 2OT5A 3OR7C 2YUAA 1LR1A 4AQYO 1EOVA 2QR4A 4YJ2B 2JRIA 1AI5A 5KUKA 5FNVB 3SDLA 1E79G 1UJWB 3ZCCA 4LF8O 2H8PC 3E35A 4DV0B 1SERA 2AMCB 1YJ9V 1NS1A 2ZZFA 2ZT6A 1YFRA 4DO2A 1YHQV 2RDCA 2UUAB 4HZ3A 3L75H 5CA0A 1NBMG 4X62B 1R6KA 4MVQA 1SKVA 2XHBA 3T1CA 2B1IA 2EBOA 3RYCA 2CTRA 5CBHA 1N34O 1EZJA 3T1HO 3TXQA 2ZZGA 4B3TB 3E2EA 1FYJA 3AG7A 3ZBHA 4H13B 2UXNA 4AI8A 2CGOA 5B1BB 1F7YA 1QLEC 3CRAA 2ZTGA 1Q6HA 1SQXH 2ZNJA 4TVAA 2WLLA 2VQEB 4DV6B 4YHHB 2I4NA 1PL0A 2JJ1G 5IWAB 1MA1A 3ML0A 2QM8A 2ZDIA 1AP6A 3FB5C 2Y48A 3SYQA 3SYOA 4GUNA 3HXXA 3AG3C 2EINB 3HKBB 2A3QA 3B40A 3CB2A 4YP0A 1BHBA 1WYDA 2PTMA 4PJ0Z 1USYA 2ZD9A 5C53B 5EK0A 4P30A 2GV9A 3ZMSA 4BR6A 1PV0A 4L8JA 3T4ZA 3RFRA 1P4RA 2PMEA 1B7YB 4I50B 3ZHQA 2ODMA 5BZBA 3X2QC 4LFAO 3ABKB 1I08A 2ZR3A 1EFRG 1RSOB 1VQMV 4DR2B 1ZAUA 4OX9B 1WPXA 2IY5A 2ALYA 4NKGB 1KECA 1F4NA 1WB8A 4LF5O 3APOA 2GUZA 3A7RA 4LCUC 3R07A 4XU0A 3VQXA 1Q3EA 3S3XA 4O4HB 2EJFA 4O4JB 4XDJA 4WFGA 4NVPA 4FFKA 1OCRC 2EX3A 4NCXA 4LR3A 1NYRA 1M57C 3G67A 2Q7GA 3G6BA 2IJHA 1DK1A 4F6RB 1SQBH 4YJ2A 4UPAA 4DRXB 1FFTB 2LP7A 1W0KG 5FNVA 1R3JC 1UFIA 3CC4V 4PDRA 5KHJA 1ADYA 3VOUA 4Q6GA 3STLC 1Y66A 2UXBO 2Y69C 2XAQA 2WSSG 4I9QA 1F51A 2N04A 3ETDA 3BHPA 2DTHA 4BW5A 1G6UA 2P4VA 3D8CA 5H6RA 1GM7A 4TWAA 3M8AA 4EX5A 5L3CA 4EFBA 4J80A 3F5TA 1Q86W 2P0LA 3G1ZA 2H3OA 5EBMC 3W7UA 4MT8A 3MD0A 3R66A 4MVZA 1S76D 2R70A 1IBLO 4O4LB 1VEWA 3P8TA 2EL9A 4YRGA 2HNIA 1Q8IA 4DV3O 2C7IA 4YRPA 4ZBMA 1FJGO 3H1HH 3ZMVA 5LHGA 4B7EA 4P9PA 4FJCC 3HXVA 1NKDA 4JI8B 3CCSV 3A7AA 2EILC 5C8YB 5KX5B 2LFSA 3K0GA 4DV2O 4B3SO 3NETA 1OJHA 2PUSA 1GKFA 4LF6B 2NNUA 1EQRA 3TEGA 5DECA 1Y74B 5A9GA 1FXKB 2BTQB 2ARHA 1B04A 3LSUA 3HXWA 3OFNG 3K03A 1NTKH 2QHTA 2N05A 4UB8Z 3HKBA 4TWKA 3FAVB 2UU9B 3T4DA 2XAFA 4X8AA 1Q5OA 4PI2A 4XTUA 1QBZA 4ZKIA 3TEHB 2UXCB 4NB5A 4FK5C 3SJCC 3UGTA 2WLMA 1ASYA 1JX9A 4I50A 3UT5A 3BABA 3UO2A 4X66O 3SJAC 2DXUA 3VQYA 1RSOA 1N36O 1CPYA 1Y76B 4CH4A 2VWKA 2XTIA 3QO5A 1EN4A 1VQOV 3RYIB 3I7FA 1I94B 3K59A 1K34A 3ABMB 4IYHA 3K5OA 3P3NA 1YCIA 2FYUH 2XAGA 5EZYB 3D3IA 1GN4A 2Q8VA 2Q5HA 1BZKA 2OYQA 3FX7A 2DTOA 5EIBD 3APQA 2P90A 4O4HA 1J95A 4TT3G 4LF7O 5EBWC 5IJ0B 1W66A 3A7UA 3VBBA 3V8JA 4FLVA 1HNZO 3L73H 4UXNA 2Y4UA 4YRCA 4CH5A 1JR9A 4F6RA 4DYLA 2FTKA 4WI1A 4H37A 3EVKA 1WU7A 3IJ4A 4I7ZB 4HAMA 2I4LA 2XTAA 1H2NA 4P73C 1XI1A 4DV7O 4J7ZA 2ZXWB 1BIAA 2UUBB 4RAIA 2L35A 2DYRB 4PELA 1G5IA 5LXTB 4U3JB 1RFYA 5KAFZ 3P8YA 4DV5B 3JASA 2HG5C 4FM2A 3ASOB 3SPJA 1QLEB 1X54A 1VARA 3U11A 1HTTA 5KHHA 4XTYA 4ICGA 2DQ0A 3A5ZA 1JVMA 1K8AW 1XDCA 1S72V 4MSWC 2DU7A 3FB8C 2W0FC 1OCZC 4WCEV 4YY3B 4PG3A 5KA5A 4IL6Z 1K92A 1XMOB 3A5YA 4H2VA 1Z5VA 2A79B 4OP0A 3DSQA 3SPCA 5ELNA 4KR3A 4X1YB 4IHJB 4YRFA 2ZM6B 4PA7A 5KX5A 1B76A 5KNNA 1VQ7V 3AG3B 4YIOA 2QE7G 1L0NH 3OTFA 2YEVB 3ZMTA 1Y74A 1J5EB 5JWPA 3HRIA 1EFWA 2BTQA 4LFBB 4PDLA 1IXBA 2EIKC 5IYZA 4GKJB 4XTWA 2V7QG 5HFLA 2CUGA 4UCOA 4AH6A 4HYOA 3JAWB 1D2DA 3CXHF 2DW4A 3UO3A 4NTWA 3AG4C 3CWBH 3TEHA 4KHPB 4LVMA 3A2FA 1P84F 4JZ2A 1VQ5V 3SYAA 4UCSA 3CE2A 3FD9A 2ZZEA 1AILA 2R72A 3CRRA 5KA6A 2OTLV 3LDEA 3CHXA 3PN1A 3O9OA 5B3SC 3N2KA 5CBFA 1VQNV 1Y76A 5DN6G 3RYIA 1N32O 4IIJB 4H2UA 3ZEDA 2AW9A 2L6LA 1NJ5A 4YRMA 4RO2A 5IT9N 2RHQB 2PYLA 1YB3A 4UB6Z 1BS3A 2JIZG 1YFSA 2EJRA 1NYQA 5IJ0A 1H2KA 5J9PC 1NVPD 5CA1A 2V4DA 2YXHA 3B8NA 3SYPA 5BY1A 1G51A 2YSUB 1OV9A 1AB3A 3CYOA 4CZZA 3FKSG 4PA3A 2UUCO 4JPRA 2DWDC 2P6JA 3M4QA 3UCSC 1AR4A 1R1BA 2IJJA 1S77D 4LVJA 2DDZA 3OGCC 3KCYA 4GX0A 1X4TA 1KU9A 3I56V 1T5EA 2PGGA 3CCMV 1AJNA 3WU2Z 3AK2A 5LXTA 1IBLB 2ZINA 3K04A 2DVEA 4U3JA 1AP5A 2HEPA 4P2ZA 1R3LC 3JD2A 3HFZB 1BBUA 4CC6A 5DEDA 1X59A 1Y6XA 4DV3B 1CP9A 2X7RB 2Q5ZA 3L74H 3CC7V 1FJGB 3WFVA 4R50A 2QKCA 3EHBB 3W7SA 1ZWIC 2ITCC 2M6YA 4Z1VA 4FFBB 3D36C 4EEQA 5JH7A 1VQ9V 1H4TA 4UVBA 1FD9A 5IJ9B 4DR5O 1M93A 1BE3H 4JV5B 4WFHA 1NJIW 3E8GA 4P75C 3LSQA 1NZ6A 1US6A 5L3DA 3T1YB 5CA0B 2F4VO 1Z5WA 4IHJA 3OD4A 4DR3O 4MVUA 1QLNA 1NJ6A 3CRMA 3M7MX 1IBMB 2F1MA 1NNHA 3MAQA 1OCOC 2ZT5A 1IBKO 2LW1A 2KB1A 4RDXA 1M4UA 2YEVA 4TV8B 1Y67A 1XOUA 2KQXA 1B3QA 2XT9A 4DR1B 1KKCA 2WLLB 1HR0O 3CP1A 3N2GB 11ASA 1E1OA 3DTUB 4E51A 3JAWA 2UXDB 4DV1B 4X64B 3G71V 4TTVA 1M5IA 2YIBA 2A7WA 3E86A 5JJJB 2KKWA 4HWPA 2PI5A 2QTOA 4O2DA 5IYBO 5ELOA 5IY5B 5H5NA 1C0AA 4JI7O 3K5MA 2LJ2A 2QKAA 2DTIA 4UP8A 2E74B 3ZHRA 1NTMH 2D3OW 4GKKB 4A5UB 2Z0AA 2QA4V 2E41A 4YJ3B 2IJIA 1FXVA 2E3CA 1IDSA 4H2TA 4YDQA 3A0BZ 3DXRA 1G4YB 2E1HA 3ZJZA 2LGWA 1XQ8A 2OCHA 1B70B 3SYCA 4ASUG 3UQ8A 1JJCB 2ALYB 4PHCA 2IY5B 5EYPA 4YREA 2B1GA 2WLIA 1EM1A 5LHIA 4YCUA 2CJ9A 3BFMA 1VQLV 4D7SA 3JSNA 2E65A 4IT5A 5H6QA 3FFQA 4PDMA 3HRKA 4FZ1A 1NVPB 4QGPA 1K97A 3HFZA 2WPDG 3EFFK 4K88A 5L3FA 2EJGA 3ASNB 1B06A 4JAVA 1KMNA 4LF9O 4KQEA 1PL4A 1HC7A 1S0VA 2P7TC 1FFXB 4Z1MG 3CCRV 2Y4TA 2JEUA 2CTPA 4FFBA 1AJPA 1BHAA 3L4GA 5E79Z 1S5HC 5IJ9A 1MABG 1O9GA 1HW7A 3CMEV 4JI3B 3L72H 2ZCEA 4QPKA 1XNRO 2DYSB 2PY5A 4UV8A 1EVKA 3ZIAG 2P4KA 4EKWA 3CRCA 4DR4O 1KKDA 1XREA 3UKMA 4DUYB 3LC0A 4EB6B 4GZRB 1KC8W 3V7CA 4EFEA 1WN7A 4FLUA 4NR1A 3CCQV 1W2BU 3RUXA 4BIZA 3L2ZA 2YI9A 2IH1C 1U96A 2XAJA 2FB5A 1L1FA 5CBGA 2CGNA 4TV8A 4DUZO 3MEYA 5CMUA 4TSFG 2DMXA 5LBQA 1XILA 3N2GA 5KAIZ 4BIUA 2Q0OC 4JYCA 3OMAB 1R73A 3C3SA 4RUEA 3RVYA 3OEEG 1IX9A 2DEQA 4U7OA 1GK9A 5B3SB 4K0KO 2PI4A 5H9CA 1AI6A 4X65B 1OCCC 4JI4O 4FIPC 2OIEA 3GB7C 1GO3F 1MSWD 1BBWA 5L3BA 3A31A 4P74C 5B1OA 4ZHQA 3CCLV 1HNXB 4JYBA 3ETEA 3W3SA 1FAFA 3B4SA 1J5WA 1JCHA 4JI2B 4ZI7B 1PD3A 1YXBA 2P22C 3ZHUA 1FS0G 2LW7A 4YRIA 3BVOA 1WLEA 3HY0A 4YJ3A 3V8KA 2EJ9A 1NR1A 3UT5B 4B3MB 2DJVA 4J9ZB 4CH3A 1TGOA 1K5QA 1SZXA 1QR9A 1RM1C 2QJ1A 3P30A 3VQWA 4B08A 2CJAA 4GLXA 2EIMB 1B70A 1VF7A 1JJCA 4D6TH 4GYCB 1K4DC 3ABUA 4YCWA 5LMUO 2CJBA 4B3RO 1VF5B 4DR6O 4I0XA 3H01A 2OIGA 5BR8B 2OTJV 5LMNB 4QJFB 3F5WC 3TCUA 3SGIA 2QWOB 1Q7YW 1YSCA 1G1XB 1F23A 1XMQO 3OR6C 2ZE6A 4AILC 2ZGWA 1WPYA 3C3TA 3MF2A 1FYFA 4H2XB 1VF6C 3QNEA 4XU3A 1VMGA 3BRCA 3ICXA 2VQFO 3E9HA 4TQFA 1N33B 1FFXA 2VRZA 3N27A 3EFRA 3SR2C 4J11A 5IE9A 4ZTUB 1WQ7A 1A32A 3H1JH 5GONB 4HWSA 1H2SB 3TETA 1YIJV 4JI5B 1K73W 1G5HA 3M99B 2IU3A 3BPZA 3ZS8C 3CRQA 4X20B 1NR7A 1GRJA 3S3WA 2XAHA 1PKXA 1M56C 1GM8A 3JASB 4EB6A 4UCVA 4H2YA 1HR0B 3AG2C 1MZFA 5B1AC 4BWAA 2QGNA 1QQCA 3AG1B 5J2UB 1BCCH 5GTHZ 4QPJA 2RCVA 1HWYA 1XNQO 2GHYA 4BAYA 5JCOC 3JYCA 1W0JG 3KKYA 2WLKA 4NTYA 2NN4A 3E22A 3ZHVA 5IYDO 4ZOLB 5A2QN 1N0NA 3CJHA 4LVLA 2YIBD 1QHTA 2AZ0A 1THZA 3W7XA 2RN9A 3IALA 3AK3A 4UVCA 4YPFA 5E3IA 4NXMB 3IKLA 2FYKA 4JI0B 2EZOA 5IYZB 4WF2A 4JTDB 4P3PA 3LNNA 4FZ0A 2ETNA 3EXAA 2VS0A 1L0WA 3WG7B 4ZI7A 1SS3A 2DZCA 1F4MA 2Q6AA 2XUMA 3LNMB 4XTVA 2OWOA 2WA4A 4JI1B 3NXSA 5CA3A 4DV4O 3CEIA 4L87A 3OMNB 2QWQB 4MVOA 4HWRA 3N2KB 1XHZA 2WLNA 3B2EE 3V7SA 1V55B 4PD4F 4DR7O 2QEXV 3I55V 1XL4A 2HVJC 2YC0A 2QHSA 4AQYB 2C2AA 3IC7A 3QG5A 4XTZA 3IAYA 2IJKA 2JGDA 2PYJA 2ADQB 5L3EA 1URFA 4MVSA 2BE3A 4LF8B 5B66Z 4I9WA 2R9AA 5CA1B 3D36A 4YRLA 4H2XA 3LSSA 1YDXA 3D3QA 1E1TA 2GTSA 2ATKC 1KMIZ 4DR4B 4HA8A 3GVMA 1O9HA 5LHHA 2QKSA 4C7UA 4DK0A 4OPAA 5GONA 4XU2A 4JYAO 4ZIBA 1USYC 3JD3A 4D7TA 1N34B 1WB7A 3T1HB 2QWNB 4PA6A 1PM9A 2F95B 3F7VC 3NR7A 2DXTA 1SA0B 5KHKA 2Q69A 4G27B 1ZSPA 4AHCA 4X20A 1H2MA 2BOBC 3W7WA 4LWSB 2JS5A 1TA8A 2AHYA 2IM9A 2E5LO 1BT8A 3QF7A 4JI6O 1IXMA 4Q20A 1TUEB 5J2UA 3RYHB 2JVDA 1HNWO 1AJQA 1ZL8A 5CN0A 5JH7B 2NR5A 1E24A 2JJ2G 2AKWA 3HR0A 1LUWA 2Y0PA 4RQFA 2F43G 3WB0A 3E83A 2XOKG 1D5NA 2NLJC 3KCXA 4NXNO 1X2HA 2DN9A 1MNGA 2R9IA 1ROPA 2GDSA 4ZOLA 3ZRXA 5LGUA 4H02A 2RHSB 2X6CA 2CIMA 5LGTA 4GX1A 4ABMA 4UCTA 1S5JA 3UH0A 4LFAB 4YRRA 2Q73A 1Z2GA 2ZIOA 1U97A 4X1IA 3ZMZA 5ITZA 3X2QB 2YIDA 3R65A 4DV0O 3M4PA 1V9PA 3K0DA 4LF5B 1L8DA 1DF5A 3ABTA 1PP9H 2YS8A 2UUAO 1YFTA 3JCZA 2E10A 3ZRVA 3TK1A 1COWG 4X62O 1XMQB 3SPGA 2HLDG 5B1BC 3DGEA 5LYJA 4B3TO 1OCRB 4WFEA 2WLHA 3ABLC 4WFBV 2LQTA 1M57B 2E76B 2IW5A 4JAUA 4J15A 5F5WA 1VQ8V 4DV6O 1H8HG 4N21A 3DXRB 4ZTZB 2UXBB 4J7JA 1Q43A 4YHHO 1JJ2U 2AZ2A 1RIQA 4TOIA 2HKOA 2Y69B 3JATB 1HDJA 1IVSA 2CTWA 5EYPB 5JQGA 1Q6UA 3H1IH 4MTGA 5LOVB 3JD4A 1P7GA 1S5LZ 1LYLA 2WLIB 1YTFD 2EINC 3U10A 3G6EV 1RP3B 2K1EA 1M56B 4LVIA 1GN2A 2DOSA 1KP2A 1FXHA 4YRSA 3PZCA 5FPRA 1SA0A 1NJ8A 3E8HA 1H38A 2GSMB 3SPIA 1X2GA 4KR2A 1K33A 3CD6V 4LWSA 1YVWA 4JZGA 3FJPA 3ABKC 4CS4A 3MF1A 2ZE8A 3NENA 1WAZA 1XL6A 1SQGA 4O2BA 3RYHA 2QDOA 1Q90D 3K06A 1JQ0A 4EO4A 1X56A 3FYEB 4LBEC 1QNMA 4DR2O 3HXYA 3L4GB 3A0HZ 4OX9O 4DV2B 4B3SB 2AXTZ 1BL8A 3G4SV 1E22A 4YRJA 3LUTB 1Z7MA 3ERRA 2JGUA 2EILB 5KMGA 1TUBB 1KYOF 4MVMA 1NT2B 1PNLA 1EVLA 3JD1A 3A74A 4H33A 1PYSA 1Q82W
chains in the Genus database with same CATH topology
3LC0A 1PYSB 1CEZA 4R8CA 5E1AC 1KC8W 4H2SA 3V7CA 3NELA 3TUPA 1QF6A 3B8MA 1Q86W 2P0LA 4P74A 3G1ZA 4OXSA 5EBMC 3RW0A 3CCQV 1W2BU 1H4VB 3CCVV 4X5OA 3CMQA 4BIZA 4MT8A 3W7UA 2J3LA 2RHSA 3MD0A 4MVZA 3IFXA 3ASNC 1S76D 3L2ZA 1SETA 2IH1C 1KOGA 4BW9A 3IKMB 3CPWU 2XAJA 4K86A 1L1FA 3P8TA 4P3OA 2EL9A 5CBGA 2WWWA 2HNIA 3RGLA 4YRGA 3MEYA 5CMUA 2C7IA 4YRPA 4TSFG 4ZBMA 4UV9A 3ZMVA 5LBQA 5LHGA 3HTZA 2Q7HA 1Y4MA 4EX5A 4BIUA 4JYCA 4P9PA 3OMAB 4FJCC 2DZ9A 3HXVA 1NKDA 1R73A 2ZR2A 1DLBA 4RUEA 1KP3A 4WF9V 2Q7GA 3RVYA 3CCSV 3A7AA 4Q15A 2EILC 1MOFA 3KG2A 2DYSC 3OEEG 1GK9A 4U7OA 1K9MW 1RM1B 5B3SB 2DEQA 2LFSA 3K0GA 2PI4A 3NETA 5H9CA 1AI6A 1OCCC 4I5SA 2Q68A 4FIPC 1GKFA 1NJ2A 2NNUA 1EQRA 1NH2D 3GB7C 3ZRWA 1ATIA 1GO3F 3TEGA 3CC2V 1FXKA 4PDVA 1MSWD 1BBWA 1FXKB 1ENVA 5L3BA 3PJSK 4CBCA 1NJ1A 3A31A 4FPPA 5B1OA 4P74C 3CCLV 3RVZA 3HXWA 3OFNG 3K03A 4JYBA 2IU0A 3ETEA 5EBLC 2QHTA 3HFVA 1ORQC 3W3SA 3ZN1A 4TWKA 2IH3C 1OZ0A 2EWNA 1J5WA 1YITV 3T4DA 1YJWV 2XAFA 4X8AA 1N9WA 4XTUA 1JCHA 1QBZA 4ZKIA 3TEHB 1PD3A 1B8AA 1AROP 1FS0G 1QE0A 2ZQMA 4FK5C 3UGTA 4YRIA 1WLEA 2WLMA 3HY0A 3MQZA 1JX9A 1ASYA 1G8MA 2E5AA 3V8KA 2EJ9A 4RMFA 1NR1A 2JDIG 2HFEC 4J9ZB 4CH3A 2DXUA 4X89A 2ODRC 1K5QA 4DPGA 1QR9A 1RM1C 3VQYA 3OMIB 1CPYA 4CH4A 2XTIA 3QO5A 4JGSA 1VQOV 2Q5IA 1V54C 3P30A 2CJAA 3I7FA 3VQWA 5C51B 4UP9A 2EIMB 1B70A 2CK3G 1JJCA 1K34A 3ABMB 4YRKA 1Q81W 1FXKC 1K4DC 2XAGA 3ABUA 3D3IA 3BJUA 4YCWA 2CJBA 1OHHG 1ADJA 2Q5HA 2HVKC 4XEOA 1M9NA 3H01A 1AI4A 1SRYA 2OTJV 2DTOA 2ZT7A 4QJFB 3F5WC 3FB7C 2P90A 4GT1A 3TCUA 4XEMA 1Q7YW 3L1AA 1YSCA 3E8BA 3RBZA 12ASA 4P71A 1J95A 1F23A 4TT3G 4J9YB 3UGQA 5EBWC 3OR6C 1W66A 3A7UA 3VBBA 2WAMA 2A0LA 3V8JA 2ZGWA 3AG2B 4UP7A 5IDJA 5B1AB 4UXNA 4YRCA 1WPYA 3A0RA 3K79A 4LVKA 3OW2U 4CH5A 3MF2A 1FYFA 4H2XB 3QNEA 5K1PA 1VQ4V 2FTKA 3E9HA 4WI1A 4H37A 5EC1C 4YRTA 4YRNA 4KP4A 1JOYA 4TQFA 1WU7A 3RKYA 4HAMA 3EFSA 1OCZB 2I4LA 3EFRA 4DXWA 4MW3A 2MK3A 1IL2A 1R6NA 1YTFB 4P73C 3HPLC 2EIMC 3HXZA 4ZTUB 2ZXWB 1WQ7A 1YJNV 1ASZA 1DF4A 3ABMC 4CS3A 1BIAA 4U7NA 2HJFC 4HWSA 3ETGA 3REUA 1LNQA 1I5YA 4RAIA 3TETA 1YIJV 3PCOA 2DYRB 2UXXA 4PELA 1K73W 1G5HA 1G5IA 3E9IA 4LNSA 4DQ2A 3M99B 1EIYB 4HWOA 2IU3A 3RIRA 3OAAG 1NR7A 1H2GA 3K3WA 4UVAA 5KUMA 1HXDA 2XAHA 1PKXA 2DKGA 1M56C 1K7DA 1GM8A 4K87A 4P71C 2HG5C 3IG2A 4H2YA 3ASOB 3SPJA 3AG2C 2QHUA 1QLEB 5B1AC 4F4LA 4BWAA 3AG1B 4MW8A 1X54A 2X6BA 1VQPV 2EIJC 1HTTA 2EIKB 1NQTA 4XTYA 1H4QA 4QPJA 2DQ0A 3A5ZA 1B6QA 1H4SA 1JVMA 1K8AW 3E8FA 2ZT8A 1S72V 3SPHA 3RL6A 1HWYA 2OCCB 4MSWC 2GHYA 4G2KA 2DU7A 3FB8C 5C52B 2W0FC 4BAYA 1VQZA 1OCZC 3JYCA 3ZRSA 4WCEV 4PG3A 1W0JG 3AG4B 5KA5A 1Z7NA 2ZIMA 3OD1A 1R3KC 4MTXA 1K92A 4H2VA 3A5YA 2WLKA 2A79B 2ZXWC 4JTCB 4OP0A 1E1QG 4R6ZA 3DSQA 2EZPA 3SPCA 1QVGU 5ELNA 4KR3A 2ODRD 4XBFA 2WLJA 2DYRC 5IYDO 4YRFA 3OEHG 4PA7A 1B76A 4LVLA 3IGAC 5KNNA 1VQ7V 3QTCA 1GTOA 3AG3B 5FL7G 4GX5A 1X55A 2EAYA 2QE7G 1THZA 4E2LA 3W7XA 2DJZA 3IALA 3CCJV 2YEVB 4UVCA 3ASOC 3OM3B 5GW7A 3ZMTA 4YPFA 5E3IA 2ZNIA 2CGHA 3HRIA 3IKLA 1EFWA 3AG1C 4H2WA 2FYKA 2Q67A 5IYCO 2J3MA 2NS6A 4PDLA 3ABLB 2EIKC 4TVAB 2W6IG 2X6AA 2EZOA 4X88A 4WF2A 4JTDB 4XTWA 4XDLA 4P3PA 2V7QG 4GX2A 5HFLA 1VQKV 1YGBA 4AH6A 4HYOA 1L0WA 2DW4A 2JK5C 3WG7B 3AG4C 1PNKA 1GGMA 3BY6A 3TEHA 1X01A 2DZCA 4PA9A 1F4MA 1SESA 4LVMA 2Q6AA 3CXCU 2LFRA 3REXA 2IY5B 1S3JA 1VQ5V 3LNMB 5L3GA 3SYAA 4XTVA 4GCZA 4CH6A 3GWOA 3OUFA 2ZZEA 3RKWA 5KA6A 2ARTA 3V8LA 1MG1A 1NH2B 3NXSA 2OTLV 2ZXFA 3LDEA 3K9AA 5CA3A 4QE9A 1RPOA 1PNMA 4L87A 5B3SC 1VQNV 3OMNB 5CBFA 1AR1B 5DN6G 4MVOA 4HWRA 4MS2A 2WLNA 5HGQA 1M1KW 4XDKA 4YYEA 4P73A 4H2UA 4XU1A 3V7SA 2QHVA 4N23A 3WQZA 4WJ3M 1NJ5A 1GMGA 1V55B 4XTXA 4YRMA 2QEXV 3I55V 4RO2A 1XL4A 2HVJC 2RHQA 2QHSA 2JEXA 2C2AA 2A8EA 2RHQB 3IC7A 4XTZA 1YB3A 2IJKA 3A32A 5L3EA 2JIZG 1YFSA 2EJRA 5HFMA 1NYQA 5J9PC 4MVSA 3WG7C 2H94A 5DM6V 1P7BA 1NVPD 2A9HA 3HB3B 4I9WA 2XASA 1WNLA 3B8NA 3D36A 3SYPA 4YRLA 2I4OA 4TVWA 4OLFA 2E64A 4H2XA 3LSSA 2V1DA 2ARSA 3AEIA 3ZN0A 1G51A 1E1TA 3HY1A 2YSUB 4HWTA 2M7WA 2ATKC 3ICAA 4HA8A 3CYOA 4RUFA 3FKSG 4CZZA 4PA3A 2C8MA 4P72A 4JPRA 2Q7EA 5K1XA 1K4CC 2DWDC 2P6JA 1R3IC 3T2MA 2IJJA 1S77D 3M4QA 4PA4A 5LHHA 3KFUA 2QKSA 4JTAB 3W7TA 1N8RW 4LVJA 2DDZA 1I5XA 3OGCC 3RF1A 3LDDA 4GX0A 4XU2A 5EC2C 3V7RA 1V55C 3I56V 3JD3A 1USYC 4ZIBA 3MHSC 4WJ4A 3CCMV 1AJNA 4PA6A 2DVEA 4RQEA 2ZINA 3F7VC 3K04A 2DXTA 1H8EG 1QCEA 3ZMUA 1EIYA 3JD2A 4XU3A 1R3LC 4P2ZA 2OT5A 2Q69A 4G27B 1BBUA 3OR7C 2PMFA 2DWEC 3HFZB 1CP9A 2X7RB 3UFGA 4HT4A 3OE7G 1OCOB 2BOBC 1K5SA 3CC7V 3W7WA 1EOVA 3WFVA 2AHYA 4R50A 4KUMA 1KMMA 3EHBB 3W7SA 1AI5A 1IXMA 1ZWIC 2ITCC 4Q20A 5KUKA 1TUEB 1E79G 1UJWB 3ZCCA 1AJQA 2H8PC 3E35A 1H4TA 1VQ9V 4UVBA 2AMCA 3P32A 5CN0A 4QE7A 1SERA 1E24A 2AMCB 1YJ9V 3E89A 1K3EA 2JJ2G 2ZZFA 2AKWA 4P72C 2ZT6A 4RQFA 1YFRA 2F43G 2AKWB 4WFHA 1WQWA 4DO2A 3B77A 5B1NA 1YHQV 1NJIW 3E8GA 3E83A 4P75C 4HVCA 3LSQA 2XOKG 4MTFA 4HZ3A 5L3DA 2NLJC 3F7YC 3P8VA 1NBMG 1X2HA 1R6KA 4TQDA 4MVQA 4YROA 2R9IA 4MVUA 1ROPA 3T1CA 1QLNA 1NJ6A 2B1IA 2EBOA 3ZRXA 5LGUA 4H02A 5CBHA 1BIBA 1NNHA 1OCOC 1EZJA 4FMTA 2RHSB 2ZT5A 2X6CA 3CMAV 2CIMA 2ZZGA 2KB1A 3E2EA 3NEMA 4RDXA 2YEVA 3JD0A 4UUJC 2UXNA 5LGTA 4GX1A 2G4CA 5B1BB 1QLEC 2ZTGA 2ZNJA 2DU5A 4TVAA 2P67A 2WLLA 3UH0A 3RACA 4P9OA 2WLLB 3CP1A 1Q82W 4YRRA 3RKXA 11ASA 3FYIB 3QO7A 1E1OA 3DTUB 1X2GA 4E51A 2ZIOA 2OCCC 4YRQA 3ZMZA 4KFMA 3X2QB 2I4NA 1PL0A 3R65A 2JJ1G 3ML0A 1QR8A 3G71V 2QM8A 3M4PA 4TTVA 2ZDIA 3K0DA 3E86A 4G85A 1V54B 1DF5A 4HWPA 2PI5A 3FB5C 2QTOA 2Y48A 3ABTA 3ZRWB 4O2DA 3SYQA 3SYOA 4WFAV 1SZTA 1YFTA 3OUSA 3JCZA 4MTOA 5IYBO 3HXXA 2E10A 5ELOA 3ZRVA 1BMFG 3TK1A 1AI7A 4WFFA 1COWG 5IY5B 2QM7A 3RUXA 1C0AA 3AG3C 3SPGA 2EINB 2DTIA 2HLDG 4UP8A 1DTOA 4YP0A 2Z3YA 1M90W 1RPRA 1QVFU 1BHBA 1WYDA 5B1BC 1GM9A 2XNDG 3DGEA 1USYA 2D3OW 2P5IA 1OCRB 3BEHA 2ZD9A 4WFEA 5C53B 2WLHA 3ABLC 2QA4V 3LDCA 4P30A 5EK0A 3ZMSA 2W6JG 4WFBV 1M57B 3T4ZA 1B7YA 2E41A 1P4RA 2IW5A 1B7YB 2PMEA 3HXUA 3VQVA 4JAUA 4QNHB 2Z5UA 1VQ6V 5BZBA 2IJIA 4JF3A 3X2QC 1FXVA 4J15A 1VQ8V 4YCVA 5F5WA 3SJQC 1H8HG 3ABKB 2E3CA 4H2TA 2ZR3A 4YDQA 4N21A 1G4YB 1KD1W 3QO8A 3ZJZA 1EFRG 1VQMV 2E1HA 4TVYA 4ZTZB 3FB6C 1JJ2U 2ZDIC 1WPXA 2B5UA 4LP8A 2IY5A 1RIQA 1B70B 2ALYA 3SYCA 1KECA 4ASUG 1JJCB 2ALYB 4PHCA 1F4NA 2HKOA 2Y69B 3CCUV 4YRJA 4YREA 2B1GA 2BOCC 2WLIA 3JD4A 4MTGA 5IY5C 1YI2V 1LYLA 2WLIB 5LHIA 4YCUA 1YTFD 3A7RA 2EINC 1EBOA 4LCUC 2CJ9A 3BFMA 3R07A 4P75A 4XU0A 4G28B 1VQLV 3VQXA 2ITDC 3G6EV 4LVIA 2K1EA 3K08A 1M56B 4R7CA 2EJFA 4P3NA 4XDJA 1KP2A 4WFGA 1FXHA 2E65A 5H6QA 3STZC 4YRSA 4QIWF 3PZCA 1OCRC 4PDMA 5C93A 3HRKA 1NVPB 4JASA 4NCXA 1K97A 1NYRA 3HFZA 1M57C 2EIJB 1NJ8A 2WPDG 3E8HA 2GSMB 3EFFK 4LC1A 2IJHA 4MVRA 3SPIA 5L3FA 1K33A 1H38A 3ASNB 2EJGA 4K88A 4KR2A 2DQ3A 3CD6V 4JAVA 1KMNA 4KQEA 2ARUA 3FJPA 3ABKC 4CS4A 3MF1A 4UPAA 3UM7A 3NENA 1HC7A 1S0VA 2P7TC 1E1RG 1FFTB 1W0KG 1XL6A 2LP7A 4Z1MG 1R3JC 3CCRV 1KQSU 4YXWG 2JEUA 3CC4V 3K06A 4PDRA 1JQ0A 4EO4A 1AJPA 1X56A 1BHAA 1ADYA 3L4GA 4CS2A 3FYEB 4LBEC 3VOUA 3CCEV 5LGNA 3STLC 3HXYA 1Y66A 3L4GB 2Y69C 4Q6GA 1S5HC 2WSSG 2XAQA 1MABG 1F51A 1E22A 1BL8A 3G4SV 3CMEV 3PCOB 3ETDA 3LUTB 1Z7MA 2XGTA 3ERRA 2R9RB 3P8YA 4QPKA 2ZCEA 2EILB 4G84A 2DYSB 2DTHA 4UV8A 4BW5A 1JPXA 3MHHC 3ZIAG 1EVKA 4MVMA 5H6RA 4EKWA 1PNLA 2HR3A 1EVLA 1OCCB 1GM7A 3JD1A 1KKDA 3A74A 3UKMA 2AHZA 4H33A 2X0LA 1PYSA 4TWAA 5L3CA 2I4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LC0 A;  1PYS B;  4H2S A;  3TUP A;  1QF6 A;  3V7C A;  3NEL A;  2P0L A;  4P74 A;  3G1Z A;  1H4V B;  3RUX A;  3CMQ A;  2J3L A;  2RHS A;  3L2Z A;  1SET A;  1KOG A;  4BW9 A;  3IKM B;  4K86 A;  3P8T A;  4P3O A;  3RGL A;  2EL9 A;  4YRG A;  2HNI A;  3MEY A;  2C7I A;  4YRP A;  3HTZ A;  2Q7H A;  2DZ9 A;  3HXV A;  2ZR2 A;  4Q15 A;  3A7A A;  4X5O A;  2DEQ A;  3NET A;  1NJ2 A;  1EQR A;  1ATI A;  3TEG A;  1BBW A;  1NJ1 A;  3A31 A;  4P74 C;  3HXW A;  2QHT A;  3HFV A;  3W3S A;  2EWN A;  1J5W A;  1N9W A;  4XTU A;  3TEH B;  1B8A A;  1QE0 A;  3UGT A;  4YRI A;  1WLE A;  3HY0 A;  1ASY A;  2E5A A;  3V8K A;  2EJ9 A;  4RMF A;  4CH3 A;  2DXU A;  2ODR C;  4DPG A;  3VQY A;  4CH4 A;  2XTI A;  3QO5 A;  2Q5I A;  2CJA A;  3I7F A;  3VQW A;  5C51 B;  4UP9 A;  1B70 A;  1JJC A;  4YRK A;  3BJU A;  4YCW A;  2CJB A;  1ADJ A;  2Q5H A;  4XEO A;  1SRY A;  2ZT7 A;  2DTO A;  4XEM A;  3L1A A;  12AS A;  4P71 A;  3UGQ A;  1W66 A;  3A7U A;  3VBB A;  3V8J A;  2ZGW A;  4UP7 A;  4YRC A;  1WPY A;  4CH5 A;  3MF2 A;  1FYF A;  4H2X B;  3QNE A;  5K1P A;  3E9H A;  4WI1 A;  4YRT A;  4YRN A;  4TQF A;  1WU7 A;  3RKY A;  3EFS A;  3EFR A;  2I4L A;  1IL2 A;  4P73 C;  3HXZ A;  4ZTU B;  1WQ7 A;  1ASZ A;  4CS3 A;  1BIA A;  4HWS A;  3REU A;  3PCO A;  1G5I A;  3E9I A;  1G5H A;  4DQ2 A;  4LNS A;  1EIY B;  4HWO A;  3RIR A;  1HXD A;  3P8Y A;  2DKG A;  4P71 C;  4K87 A;  4H2Y A;  3IG2 A;  2QHU A;  4BWA A;  1X54 A;  1HTT A;  4XTY A;  1H4Q A;  2DQ0 A;  3A5Z A;  1H4S A;  2ZT8 A;  3RL6 A;  2DU7 A;  5C52 B;  1VQZ A;  4PG3 A;  1Z7N A;  2ZIM A;  3OD1 A;  4H2V A;  3A5Y A;  4OP0 A;  3DSQ A;  5ELN A;  4KR3 A;  2ODR D;  4YRF A;  1B76 A;  5KNN A;  3QTC A;  1X55 A;  2EAY A;  2DJZ A;  3IAL A;  4YPF A;  2ZNI A;  5E3I A;  2CGH A;  3HRI A;  3IKL A;  1EFW A;  4H2W A;  2FYK A;  2J3M A;  4TVA B;  4WF2 A;  4XTW A;  4P3P A;  1YGB A;  4AH6 A;  1L0W A;  1GGM A;  3TEH A;  1X01 A;  2DZC A;  1SES A;  3REX A;  4XTV A;  4CH6 A;  3RKW A;  2ZZE A;  3V8L A;  2ART A;  2ZXF A;  4L87 A;  4HWR A;  5HGQ A;  4YYE A;  4P73 A;  4H2U A;  4XU1 A;  3V7S A;  2QHV A;  3WQZ A;  4WJ3 M;  1NJ5 A;  4XTX A;  4YRM A;  2RHQ A;  2QHS A;  2RHQ B;  4XTZ A;  1YB3 A;  3A32 A;  1YFS A;  1NYQ A;  1WNL A;  4YRL A;  2I4O A;  4TVW A;  4OLF A;  2E64 A;  4H2X A;  3LSS A;  2ARS A;  1G51 A;  1E1T A;  3HY1 A;  4HWT A;  3ICA A;  4HA8 A;  2C8M A;  4P72 A;  5K1X A;  2Q7E A;  3M4Q A;  3KFU A;  2DDZ A;  3RF1 A;  4XU2 A;  3V7R A;  4ZIB A;  1USY C;  4WJ4 A;  2DVE A;  4RQE A;  2ZIN A;  2DXT A;  1EIY A;  4XU3 A;  2PMF A;  3HFZ B;  1BBU A;  3UFG A;  1EOV A;  1KMM A;  1H4T A;  2AMC A;  1SER A;  1E24 A;  2AMC B;  2ZZF A;  2AKW A;  4P72 C;  2ZT6 A;  4RQF A;  1YFR A;  2AKW B;  1WQW A;  4P75 C;  4HVC A;  3LSQ A;  3P8V A;  1X2H A;  4TQD A;  4YRO A;  1NJ6 A;  4H02 A;  1BIB A;  1NNH A;  2RHS B;  2ZT5 A;  2ZZG A;  2CIM A;  3NEM A;  4RDX A;  2G4C A;  2ZTG A;  2ZNJ A;  2DU5 A;  4TVA A;  3UH0 A;  3RAC A;  4YRR A;  3RKX A;  11AS A;  3QO7 A;  1E1O A;  4E51 A;  2ZIO A;  4YRQ A;  2I4N A;  3M4P A;  4TTV A;  4G85 A;  4HWP A;  4O2D A;  1YFT A;  3HXX A;  5ELO A;  2E10 A;  1C0A A;  2DTI A;  4UP8 A;  4YP0 A;  1WYD A;  1USY A;  2P5I A;  5C53 B;  1B7Y A;  2E41 A;  2PME A;  3VQV A;  1B7Y B;  3HXU A;  4YCV A;  4J15 A;  5F5W A;  2E3C A;  4H2T A;  2ZR3 A;  4YDQ A;  2E1H A;  4TVY A;  3QO8 A;  4ZTZ B;  2IY5 A;  1RIQ A;  1B70 B;  2ALY A;  1JJC B;  2IY5 B;  2ALY B;  4PHC A;  4YRE A;  1LYL A;  4YCU A;  3A7R A;  2CJ9 A;  3BFM A;  3R07 A;  4XU0 A;  4P75 A;  3VQX A;  2EJF A;  4P3N A;  2E65 A;  4YRS A;  3PZC A;  3HRK A;  4NCX A;  1NYR A;  3HFZ A;  1NJ8 A;  1X2G A;  2Q7G A;  4KR2 A;  4K88 A;  2EJG A;  2DQ3 A;  1KMN A;  4KQE A;  2ARU A;  3FJP A;  4CS4 A;  3MF1 A;  4UPA A;  3NEN A;  1HC7 A;  4EO4 A;  1X56 A;  3L4G A;  1ADY A;  4CS2 A;  4Q6G A;  3HXY A;  3L4G B;  1E22 A;  3PCO B;  4YRJ A;  2XGT A;  1Z7M A;  3ERR A;  2ZCE A;  4G84 A;  2DTH A;  1EVK A;  1EVL A;  4TWA A;  3A74 A;  1PYS A;  4EX5 A;  2I4M A; 
#chains in the Genus database with same CATH topology
 1CEZ A;  3TUP A;  5E1A C;  3TGU H;  1QF6 A;  3NEL A;  2HJD A;  4LH7 A;  4P74 A;  4OXS A;  1H4V B;  4PI0 A;  2J3L A;  2RHS A;  2YXY A;  1KOG A;  4BW9 A;  2QSA A;  1TVK B;  3RGL A;  4UV9 A;  2VWJ A;  4X66 B;  1Y4M A;  3K9S A;  3JAK A;  1N36 B;  4Q15 A;  1DLB A;  4W4K A;  1KP3 A;  3KG2 A;  3C90 A;  4I5S A;  1LUV A;  1ATI A;  1SQF A;  4PDV A;  3K5N A;  3BA9 A;  1NJ1 A;  3PJS K;  4CBC A;  4FPP A;  3J81 N;  1KBH A;  1NTZ H;  3RVZ A;  4ZHQ B;  5LP6 C;  4LF7 B;  5EBL C;  3HFV A;  4TV9 B;  3JAL A;  1ORQ C;  1HNZ B;  4CC5 A;  1OZ0 A;  1WNS A;  1GH6 A;  1YJW V;  2W0X A;  4FLT A;  1ZLZ A;  1XBL A;  1R6T A;  1B8A A;  1Q6I A;  1WP7 A;  4UCR A;  1VF6 A;  4RMF A;  2HFE C;  4DV7 B;  4JI8 O;  4JGS A;  1SF9 A;  1D5A A;  1V54 C;  2ZKO A;  3AK1 A;  3JAT A;  1Q81 W;  1FXK C;  3BJU A;  1OHH G;  4LF6 O;  5LOV A;  2HVK C;  2CH7 B;  1M9N A;  1AI4 A;  4I0X B;  1SRY A;  5FPO A;  4I4T A;  2QWR B;  4GT1 A;  3L1A A;  3E8B A;  3RBZ A;  12AS A;  3RT3 C;  4J9Y B;  2A0L A;  3K5L A;  2UU9 O;  1JMK C;  5JVD B;  2N74 A;  2QWP B;  3OW2 U;  1I0H A;  2UXC O;  5K1P A;  2F66 C;  1VQ4 V;  3RWR D;  5EC1 C;  1JOY A;  3P3P A;  5JCO A;  1OCZ B;  4LFC O;  1IL2 A;  1YTF B;  5B5E Z;  1DF4 A;  3ABM C;  2HJF C;  3ETG A;  3REU A;  1LNQ A;  1I5Y A;  2IBZ H;  2UXX A;  1I94 O;  3ETQ A;  4LNS A;  1TUB A;  3RIR A;  1HXD A;  5KUM A;  4FLX A;  4P71 C;  2KG7 A;  1BSM A;  3HKC B;  4LF4 O;  2QHU A;  4F4L A;  4MW8 A;  1VQP V;  2EIJ C;  2EIK B;  2Y0I A;  1H4S A;  3E8F A;  2MW2 B;  1TVK A;  2DE0 X;  3RL6 A;  1UPG A;  3K57 A;  3DC6 A;  1VQZ A;  3ZRS A;  1Z7N A;  3AG4 B;  3G80 A;  3H9V A;  4KL1 A;  3CS5 A;  3OD1 A;  2ZT9 B;  1JA8 A;  2ZXW C;  1E1Q G;  4R6Z A;  2EZP A;  1QVG U;  4XBF A;  2WLJ A;  2DYR C;  3E22 B;  1N32 B;  3JSL A;  5KHG A;  3IGA C;  1JJO A;  3CJH B;  3QVN A;  3QTC A;  2UUB O;  1GTO A;  5FL7 G;  4J7K A;  4GX5 A;  4IGG A;  1X55 A;  4E2L A;  2DJZ A;  1NI8 A;  3ASO C;  3OM3 B;  4FM0 A;  4BIO A;  1NU1 H;  4DV5 O;  2Q67 A;  2NS6 A;  3ABL B;  4X1K B;  4I55 A;  4TV9 A;  1WA8 B;  4GX2 A;  1IUR A;  1YGB A;  4OPH A;  2JK5 C;  5H2F Z;  1PNK A;  3HKE B;  3BY6 A;  3CX5 F;  5AG2 A;  4PA9 A;  4FLY A;  1EZV H;  2LFR A;  5L3G A;  4YY3 O;  4HBN A;  2UUC B;  4CH6 A;  3GWO A;  3V8L A;  1XMO O;  3DC5 A;  2ART A;  4O4I A;  3U0Z A;  4QE9 A;  3ZX6 A;  1RPO A;  1FPO A;  4MS2 A;  5HGQ A;  1M1K W;  2ZM6 O;  4XDK A;  2A06 H;  4P73 A;  4N23 A;  3WQZ A;  4TUY B;  4XTX A;  5J2T B;  2FKX A;  2CH7 A;  2JEX A;  2A8E A;  3JAR B;  1J5E O;  1W59 A;  1VIB A;  4LFB O;  2JGD B;  4GKJ O;  3ZHS A;  3RYF A;  2A9H A;  3SJB C;  4K8X A;  4E4E A;  3HB3 B;  2XAS A;  1MMM A;  5JVD A;  4DR5 B;  2I4O A;  3A8T A;  2E64 A;  2V1D A;  4KHP O;  3HY1 A;  4NTX A;  4HWT A;  2M7W A;  4PHZ A;  2HHH O;  3ICA A;  2C8M A;  4RUF A;  2Q7E A;  1K4C C;  1R3I C;  4PV1 B;  3TXS A;  4PA4 A;  4X9Q A;  3KFU A;  4JTA B;  3W7T A;  1N8R W;  2F4V B;  3GWK C;  4DR3 B;  3I5D A;  2F23 A;  1YZB A;  5LL6 Y;  3MHS C;  4WJ4 A;  1IBK B;  2YIC A;  4OGQ B;  2DWE C;  4HT4 A;  3UFG A;  3OE7 G;  1OCO B;  1K5S A;  2YI8 A;  2GBO A;  3B09 A;  4KUM A;  3HKC A;  4U3F H;  1KMM A;  1JFF B;  2P5O A;  2AMC A;  3P32 A;  4QE7 A;  1ZL8 B;  3E89 A;  1K3E A;  4P72 C;  2AKW B;  1WQW A;  3B77 A;  5B1N A;  4HVC A;  2CAZ C;  5EIB C;  4HNA B;  4MTF A;  1BGY H;  3MDS A;  2AGA A;  3F7Y C;  5F2V O;  3P8V A;  4TQD A;  4YRO A;  4JI7 B;  1L0L H;  2ADP A;  5LP6 B;  1BIB A;  4FMT A;  3CMA V;  3NEM A;  3JD0 A;  4UUJ C;  2CE4 A;  2G4C A;  2DU5 A;  2P67 A;  3RAC A;  4P9O A;  4X1K A;  3RKX A;  1WA8 A;  2F93 B;  3FYI B;  3QO7 A;  2OCC C;  4YRQ A;  4KFM A;  4X1I B;  5ITZ B;  3HKE A;  1QR8 A;  2BSK B;  2O57 A;  5D5Q A;  4G85 A;  1V54 B;  4JV5 O;  3ZRW B;  4JYY A;  4WFA V;  1SZT A;  3OUS A;  4MTO A;  1BMF G;  3T1Y O;  1AI7 A;  4WFF A;  2QM7 A;  1WJZ A;  3H1L H;  4K8Z A;  1IBM O;  1DTO A;  4B7K A;  2Z3Y A;  1M90 W;  1RPR A;  1QVF U;  4TUY A;  1GM9 A;  2XND G;  2P06 A;  5J2T A;  2P5I A;  3BEH A;  3OTO O;  5LYJ B;  2BCC H;  3LDC A;  2Q0A A;  2W6J G;  3JAR A;  4LF9 B;  1H2L A;  1B7Y A;  3BFR A;  3VQV A;  3HXU A;  4QNH B;  2Z5U A;  4LFC B;  1VQ6 V;  4JF3 A;  4YCV A;  4DR1 O;  3SJQ C;  1FKA O;  1KD1 W;  4TVY A;  3QO8 A;  2UXD O;  3FB6 C;  1GAX A;  2ZDI C;  2B5U A;  1GN3 A;  4DV1 O;  4X64 O;  4LP8 A;  1XNR B;  4WBN B;  1XHX A;  1ZX3 A;  3CCU V;  2BOC C;  5JQG B;  5IY5 C;  1YI2 V;  2HP8 A;  1EBO A;  4O2A B;  4LF4 B;  4P75 A;  2EUL A;  4G28 B;  2ITD C;  4K3A A;  4O4J A;  1QU7 A;  3K08 A;  4R7C A;  3RN4 A;  4P3N A;  5KLV H;  3STZ C;  4QIW F;  5C93 A;  4JAS A;  2ZE5 A;  4NYK A;  2EIJ B;  4LC1 A;  4MVR A;  4DUZ B;  4GKK O;  4J10 A;  3THO A;  2DQ3 A;  2ARU A;  4DRX A;  3UM7 A;  1TAE A;  1E1R G;  1KQS U;  1JFF A;  3J80 N;  4YXW G;  4O2B B;  4UFZ A;  2QM4 A;  5FLX N;  1YEW A;  4CS2 A;  3CCE V;  5LGN A;  4K0K B;  1XEQ A;  4W4L A;  4RWU A;  2FL4 A;  2QTS A;  4JI4 B;  3PCO B;  2XGT A;  2R9R B;  3BCC H;  4G84 A;  3Q4H B;  1JPX A;  5KMG B;  1BQZ A;  3MHH C;  4HNA A;  4IYI A;  2HR3 A;  1OCC B;  2AHZ A;  2X0L A;  4YIP A;  2I4M A;  1PYS B;  2B9Z A;  3L71 H;  4R8C A;  4H2S A;  1N4C A;  3OT7 A;  3B8M A;  3RW0 A;  3CCV V;  5LP6 A;  4LH6 A;  3CMQ A;  3IFX A;  3ASN C;  1SET A;  4O4L A;  3IKM B;  3CPW U;  2GTA A;  4K86 A;  4P3O A;  2YDE A;  2WWW A;  3L70 H;  3HTZ A;  2Q7H A;  3OGI B;  4KXR A;  3JAK B;  2DZ9 A;  2ZR2 A;  4WF9 V;  4FLW A;  5C8Y A;  1MOF A;  4X5O A;  2DYS C;  2BSK A;  1K9M W;  1RM1 B;  4JI3 O;  2Q68 A;  5LMU B;  4B3R B;  1NJ2 A;  4DR6 B;  1NH2 D;  3WB2 A;  3ZRW A;  4DW1 A;  3CC2 V;  1FXK A;  1ENV A;  4DUY O;  3TJT A;  1XUQ A;  5BXZ A;  1ZTE A;  4LNU B;  2PZS A;  2IU0 A;  4FM1 A;  3FAV A;  3ZN1 A;  3JAL B;  4FLZ A;  2IH3 C;  2EWN A;  1YIT V;  4K35 A;  1N9W A;  4FVM A;  1ARO P;  2HHH B;  3HKD B;  2VQF B;  2ZQM A;  1QE0 A;  3MQZ A;  5D5P A;  1MZE A;  1G8M A;  2E5A A;  3J7A U;  2JDI G;  2PF4 E;  2ODR C;  4X89 A;  2VQE O;  2RQ6 A;  3K58 A;  4DPG A;  3OMI B;  4DK1 A;  2CTQ A;  2Q5I A;  4DW0 A;  5C51 B;  5IWA O;  4UP9 A;  2CK3 G;  4WBN A;  5LA6 B;  5EZY A;  5CB4 B;  4X65 O;  4YRK A;  4UCU A;  1ADJ A;  2KSD A;  1PPJ H;  1SQQ H;  5BMV B;  4XEO A;  2ZT7 A;  4O2A A;  3FB7 C;  4I4T B;  1VP7 A;  1HNX O;  4XEM A;  4P71 A;  3UGQ A;  1SQP H;  1BQ0 A;  1YF2 A;  2WAM A;  3AG2 B;  4UP7 A;  5IDJ A;  5B1A B;  3A0R A;  3K79 A;  4LVK A;  1XNQ B;  4JI2 O;  3BA8 A;  3O65 A;  2YXL A;  1EN5 A;  4YRT A;  4YRN A;  4KP4 A;  2RJZ A;  3JCU Z;  3RKY A;  1HP8 A;  3EFS A;  4B3M O;  4DXW A;  4MW3 A;  1KUQ A;  2MK3 A;  1R6N A;  3WB1 A;  3HPL C;  2EIM C;  3HXZ A;  1ASZ A;  2RNB A;  1YJN V;  3IC9 A;  4CS3 A;  4U7N A;  5JJE B;  3PCO A;  2LO1 A;  1AVM A;  2ILM A;  3E9I A;  4DQ2 A;  1EIY B;  4HWO A;  3Q4H A;  2FML A;  1I7F A;  3OAA G;  3K3W A;  1H2G A;  4UVA A;  2DKG A;  5GTI Z;  1K7D A;  5BR8 O;  4K87 A;  3ZHT A;  5LMN O;  3IG2 A;  1CXZ B;  2KG7 B;  2G38 A;  2Q9L A;  2X6B A;  1NQT A;  1H4Q A;  1B6Q A;  2ZT8 A;  3SPH A;  1KB9 F;  2OCC B;  2E75 B;  4G2K A;  5C52 B;  1SC5 B;  2ZIM A;  2Q4P A;  1R3K C;  3CSX A;  4MTX A;  2D2C B;  1N33 O;  4JTC B;  4DV4 B;  4X1Y A;  2ODR D;  1N0J A;  3OEH G;  3RYC B;  1AR5 A;  2JS3 A;  4JI5 O;  2EAY A;  3OTO B;  3BAA A;  4DR7 B;  3RGB A;  3CCJ V;  5GW7 A;  2ZNI A;  2CGH A;  3AG1 C;  4H2W A;  5IYC O;  2J3M A;  5TIS Z;  4TVA B;  1IZ3 A;  2W6I G;  4LNU A;  2X6A A;  2YIA A;  4X88 A;  2K9P A;  4XDL A;  4I55 B;  1VQK V;  4J42 A;  1GGM A;  3L9D A;  1X01 A;  4Z2W A;  1SES A;  3HKD A;  3CXC U;  3REX A;  1DGS A;  1S3J A;  1ZUQ A;  4GCZ A;  4H44 B;  3OUF A;  3RKW A;  1WPB A;  1MG1 A;  1NH2 B;  1MSD A;  2ZXF A;  1P49 A;  1EN6 A;  3K9A A;  4O4I B;  1PNM A;  2EJ7 A;  1AR1 B;  4JYA B;  4IIJ A;  4YYE A;  4XU1 A;  2QHV A;  1WP8 A;  5LA6 A;  5CB4 A;  4WJ3 M;  1GMG A;  5KHI A;  2RHQ A;  5BMV A;  4F6E A;  2E5L B;  4NXM O;  3A32 A;  4JI6 B;  1SQV H;  4JI0 O;  5HFM A;  4H0L B;  3KZI Z;  2CDY A;  1HNW B;  3WG7 C;  2H94 A;  5DM6 V;  1P7B A;  4JAA A;  3RYF B;  3JAM N;  2WA3 A;  2ZE7 A;  1WNL A;  4TVW A;  4OLF A;  2ARS A;  3AEI A;  1GN6 A;  3ZN0 A;  2RMK B;  4P72 A;  5K1X A;  2GUZ B;  3T2M A;  2LGQ A;  3H1K H;  4NXN B;  5JJN B;  4JI1 O;  1I5X A;  3RF1 A;  3LDD A;  5EC2 C;  3V7R A;  1V55 C;  2BTO A;  4RQE A;  4J41 A;  1H8E G;  1QCE A;  3ZMU A;  1EIY A;  2PMF A;  2OT5 A;  3OR7 C;  2YUA A;  1LR1 A;  4AQY O;  1EOV A;  2QR4 A;  4YJ2 B;  2JRI A;  1AI5 A;  5KUK A;  5FNV B;  3SDL A;  1E79 G;  1UJW B;  3ZCC A;  4LF8 O;  2H8P C;  3E35 A;  4DV0 B;  1SER A;  2AMC B;  1YJ9 V;  1NS1 A;  2ZZF A;  2ZT6 A;  1YFR A;  4DO2 A;  1YHQ V;  2RDC A;  2UUA B;  4HZ3 A;  3L75 H;  5CA0 A;  1NBM G;  4X62 B;  1R6K A;  4MVQ A;  1SKV A;  2XHB A;  3T1C A;  2B1I A;  2EBO A;  3RYC A;  2CTR A;  5CBH A;  1N34 O;  1EZJ A;  3T1H O;  3TXQ A;  2ZZG A;  4B3T B;  3E2E A;  1FYJ A;  3AG7 A;  3ZBH A;  4H13 B;  2UXN A;  4AI8 A;  2CGO A;  5B1B B;  1F7Y A;  1QLE C;  3CRA A;  2ZTG A;  1Q6H A;  1SQX H;  2ZNJ A;  4TVA A;  2WLL A;  2VQE B;  4DV6 B;  4YHH B;  2I4N A;  1PL0 A;  2JJ1 G;  5IWA B;  1MA1 A;  3ML0 A;  2QM8 A;  2ZDI A;  1AP6 A;  3FB5 C;  2Y48 A;  3SYQ A;  3SYO A;  4GUN A;  3HXX A;  3AG3 C;  2EIN B;  3HKB B;  2A3Q A;  3B40 A;  3CB2 A;  4YP0 A;  1BHB A;  1WYD A;  2PTM A;  4PJ0 Z;  1USY A;  2ZD9 A;  5C53 B;  5EK0 A;  4P30 A;  2GV9 A;  3ZMS A;  4BR6 A;  1PV0 A;  4L8J A;  3T4Z A;  3RFR A;  1P4R A;  2PME A;  1B7Y B;  4I50 B;  3ZHQ A;  2ODM A;  5BZB A;  3X2Q C;  4LFA O;  3ABK B;  1I08 A;  2ZR3 A;  1EFR G;  1RSO B;  1VQM V;  4DR2 B;  1ZAU A;  4OX9 B;  1WPX A;  2IY5 A;  2ALY A;  4NKG B;  1KEC A;  1F4N A;  1WB8 A;  4LF5 O;  3APO A;  2GUZ A;  3A7R A;  4LCU C;  3R07 A;  4XU0 A;  3VQX A;  1Q3E A;  3S3X A;  4O4H B;  2EJF A;  4O4J B;  4XDJ A;  4WFG A;  4NVP A;  4FFK A;  1OCR C;  2EX3 A;  4NCX A;  4LR3 A;  1NYR A;  1M57 C;  3G67 A;  2Q7G A;  3G6B A;  2IJH A;  1DK1 A;  4F6R B;  1SQB H;  4YJ2 A;  4UPA A;  4DRX B;  1FFT B;  2LP7 A;  1W0K G;  5FNV A;  1R3J C;  1UFI A;  3CC4 V;  4PDR A;  5KHJ A;  1ADY A;  3VOU A;  4Q6G A;  3STL C;  1Y66 A;  2UXB O;  2Y69 C;  2XAQ A;  2WSS G;  4I9Q A;  1F51 A;  2N04 A;  3ETD A;  3BHP A;  2DTH A;  4BW5 A;  1G6U A;  2P4V A;  3D8C A;  5H6R A;  1GM7 A;  4TWA A;  3M8A A;  4EX5 A;  5L3C A;  4EFB A;  4J80 A;  3F5T A;  1Q86 W;  2P0L A;  3G1Z A;  2H3O A;  5EBM C;  3W7U A;  4MT8 A;  3MD0 A;  3R66 A;  4MVZ A;  1S76 D;  2R70 A;  1IBL O;  4O4L B;  1VEW A;  3P8T A;  2EL9 A;  4YRG A;  2HNI A;  1Q8I A;  4DV3 O;  2C7I A;  4YRP A;  4ZBM A;  1FJG O;  3H1H H;  3ZMV A;  5LHG A;  4B7E A;  4P9P A;  4FJC C;  3HXV A;  1NKD A;  4JI8 B;  3CCS V;  3A7A A;  2EIL C;  5C8Y B;  5KX5 B;  2LFS A;  3K0G A;  4DV2 O;  4B3S O;  3NET A;  1OJH A;  2PUS A;  1GKF A;  4LF6 B;  2NNU A;  1EQR A;  3TEG A;  5DEC A;  1Y74 B;  5A9G A;  1FXK B;  2BTQ B;  2ARH A;  1B04 A;  3LSU A;  3HXW A;  3OFN G;  3K03 A;  1NTK H;  2QHT A;  2N05 A;  4UB8 Z;  3HKB A;  4TWK A;  3FAV B;  2UU9 B;  3T4D A;  2XAF A;  4X8A A;  1Q5O A;  4PI2 A;  4XTU A;  1QBZ A;  4ZKI A;  3TEH B;  2UXC B;  4NB5 A;  4FK5 C;  3SJC C;  3UGT A;  2WLM A;  1ASY A;  1JX9 A;  4I50 A;  3UT5 A;  3BAB A;  3UO2 A;  4X66 O;  3SJA C;  2DXU A;  3VQY A;  1RSO A;  1N36 O;  1CPY A;  1Y76 B;  4CH4 A;  2VWK A;  2XTI A;  3QO5 A;  1EN4 A;  1VQO V;  3RYI B;  3I7F A;  1I94 B;  3K59 A;  1K34 A;  3ABM B;  4IYH A;  3K5O A;  3P3N A;  1YCI A;  2FYU H;  2XAG A;  5EZY B;  3D3I A;  1GN4 A;  2Q8V A;  2Q5H A;  1BZK A;  2OYQ A;  3FX7 A;  2DTO A;  5EIB D;  3APQ A;  2P90 A;  4O4H A;  1J95 A;  4TT3 G;  4LF7 O;  5EBW C;  5IJ0 B;  1W66 A;  3A7U A;  3VBB A;  3V8J A;  4FLV A;  1HNZ O;  3L73 H;  4UXN A;  2Y4U A;  4YRC A;  4CH5 A;  1JR9 A;  4F6R A;  4DYL A;  2FTK A;  4WI1 A;  4H37 A;  3EVK A;  1WU7 A;  3IJ4 A;  4I7Z B;  4HAM A;  2I4L A;  2XTA A;  1H2N A;  4P73 C;  1XI1 A;  4DV7 O;  4J7Z A;  2ZXW B;  1BIA A;  2UUB B;  4RAI A;  2L35 A;  2DYR B;  4PEL A;  1G5I A;  5LXT B;  4U3J B;  1RFY A;  5KAF Z;  3P8Y A;  4DV5 B;  3JAS A;  2HG5 C;  4FM2 A;  3ASO B;  3SPJ A;  1QLE B;  1X54 A;  1VAR A;  3U11 A;  1HTT A;  5KHH A;  4XTY A;  4ICG A;  2DQ0 A;  3A5Z A;  1JVM A;  1K8A W;  1XDC A;  1S72 V;  4MSW C;  2DU7 A;  3FB8 C;  2W0F C;  1OCZ C;  4WCE V;  4YY3 B;  4PG3 A;  5KA5 A;  4IL6 Z;  1K92 A;  1XMO B;  3A5Y A;  4H2V A;  1Z5V A;  2A79 B;  4OP0 A;  3DSQ A;  3SPC A;  5ELN A;  4KR3 A;  4X1Y B;  4IHJ B;  4YRF A;  2ZM6 B;  4PA7 A;  5KX5 A;  1B76 A;  5KNN A;  1VQ7 V;  3AG3 B;  4YIO A;  2QE7 G;  1L0N H;  3OTF A;  2YEV B;  3ZMT A;  1Y74 A;  1J5E B;  5JWP A;  3HRI A;  1EFW A;  2BTQ A;  4LFB B;  4PDL A;  1IXB A;  2EIK C;  5IYZ A;  4GKJ B;  4XTW A;  2V7Q G;  5HFL A;  2CUG A;  4UCO A;  4AH6 A;  4HYO A;  3JAW B;  1D2D A;  3CXH F;  2DW4 A;  3UO3 A;  4NTW A;  3AG4 C;  3CWB H;  3TEH A;  4KHP B;  4LVM A;  3A2F A;  1P84 F;  4JZ2 A;  1VQ5 V;  3SYA A;  4UCS A;  3CE2 A;  3FD9 A;  2ZZE A;  1AIL A;  2R72 A;  3CRR A;  5KA6 A;  2OTL V;  3LDE A;  3CHX A;  3PN1 A;  3O9O A;  5B3S C;  3N2K A;  5CBF A;  1VQN V;  1Y76 A;  5DN6 G;  3RYI A;  1N32 O;  4IIJ B;  4H2U A;  3ZED A;  2AW9 A;  2L6L A;  1NJ5 A;  4YRM A;  4RO2 A;  5IT9 N;  2RHQ B;  2PYL A;  1YB3 A;  4UB6 Z;  1BS3 A;  2JIZ G;  1YFS A;  2EJR A;  1NYQ A;  5IJ0 A;  1H2K A;  5J9P C;  1NVP D;  5CA1 A;  2V4D A;  2YXH A;  3B8N A;  3SYP A;  5BY1 A;  1G51 A;  2YSU B;  1OV9 A;  1AB3 A;  3CYO A;  4CZZ A;  3FKS G;  4PA3 A;  2UUC O;  4JPR A;  2DWD C;  2P6J A;  3M4Q A;  3UCS C;  1AR4 A;  1R1B A;  2IJJ A;  1S77 D;  4LVJ A;  2DDZ A;  3OGC C;  3KCY A;  4GX0 A;  1X4T A;  1KU9 A;  3I56 V;  1T5E A;  2PGG A;  3CCM V;  1AJN A;  3WU2 Z;  3AK2 A;  5LXT A;  1IBL B;  2ZIN A;  3K04 A;  2DVE A;  4U3J A;  1AP5 A;  2HEP A;  4P2Z A;  1R3L C;  3JD2 A;  3HFZ B;  1BBU A;  4CC6 A;  5DED A;  1X59 A;  1Y6X A;  4DV3 B;  1CP9 A;  2X7R B;  2Q5Z A;  3L74 H;  3CC7 V;  1FJG B;  3WFV A;  4R50 A;  2QKC A;  3EHB B;  3W7S A;  1ZWI C;  2ITC C;  2M6Y A;  4Z1V A;  4FFB B;  3D36 C;  4EEQ A;  5JH7 A;  1VQ9 V;  1H4T A;  4UVB A;  1FD9 A;  5IJ9 B;  4DR5 O;  1M93 A;  1BE3 H;  4JV5 B;  4WFH A;  1NJI W;  3E8G A;  4P75 C;  3LSQ A;  1NZ6 A;  1US6 A;  5L3D A;  3T1Y B;  5CA0 B;  2F4V O;  1Z5W A;  4IHJ A;  3OD4 A;  4DR3 O;  4MVU A;  1QLN A;  1NJ6 A;  3CRM A;  3M7M X;  1IBM B;  2F1M A;  1NNH A;  3MAQ A;  1OCO C;  2ZT5 A;  1IBK O;  2LW1 A;  2KB1 A;  4RDX A;  1M4U A;  2YEV A;  4TV8 B;  1Y67 A;  1XOU A;  2KQX A;  1B3Q A;  2XT9 A;  4DR1 B;  1KKC A;  2WLL B;  1HR0 O;  3CP1 A;  3N2G B;  11AS A;  1E1O A;  3DTU B;  4E51 A;  3JAW A;  2UXD B;  4DV1 B;  4X64 B;  3G71 V;  4TTV A;  1M5I A;  2YIB A;  2A7W A;  3E86 A;  5JJJ B;  2KKW A;  4HWP A;  2PI5 A;  2QTO A;  4O2D A;  5IYB O;  5ELO A;  5IY5 B;  5H5N A;  1C0A A;  4JI7 O;  3K5M A;  2LJ2 A;  2QKA A;  2DTI A;  4UP8 A;  2E74 B;  3ZHR A;  1NTM H;  2D3O W;  4GKK B;  4A5U B;  2Z0A A;  2QA4 V;  2E41 A;  4YJ3 B;  2IJI A;  1FXV A;  2E3C A;  1IDS A;  4H2T A;  4YDQ A;  3A0B Z;  3DXR A;  1G4Y B;  2E1H A;  3ZJZ A;  2LGW A;  1XQ8 A;  2OCH A;  1B70 B;  3SYC A;  4ASU G;  3UQ8 A;  1JJC B;  2ALY B;  4PHC A;  2IY5 B;  5EYP A;  4YRE A;  2B1G A;  2WLI A;  1EM1 A;  5LHI A;  4YCU A;  2CJ9 A;  3BFM A;  1VQL V;  4D7S A;  3JSN A;  2E65 A;  4IT5 A;  5H6Q A;  3FFQ A;  4PDM A;  3HRK A;  4FZ1 A;  1NVP B;  4QGP A;  1K97 A;  3HFZ A;  2WPD G;  3EFF K;  4K88 A;  5L3F A;  2EJG A;  3ASN B;  1B06 A;  4JAV A;  1KMN A;  4LF9 O;  4KQE A;  1PL4 A;  1HC7 A;  1S0V A;  2P7T C;  1FFX B;  4Z1M G;  3CCR V;  2Y4T A;  2JEU A;  2CTP A;  4FFB A;  1AJP A;  1BHA A;  3L4G A;  5E79 Z;  1S5H C;  5IJ9 A;  1MAB G;  1O9G A;  1HW7 A;  3CME V;  4JI3 B;  3L72 H;  2ZCE A;  4QPK A;  1XNR O;  2DYS B;  2PY5 A;  4UV8 A;  1EVK A;  3ZIA G;  2P4K A;  4EKW A;  3CRC A;  4DR4 O;  1KKD A;  1XRE A;  3UKM A;  4DUY B;  3LC0 A;  4EB6 B;  4GZR B;  1KC8 W;  3V7C A;  4EFE A;  1WN7 A;  4FLU A;  4NR1 A;  3CCQ V;  1W2B U;  3RUX A;  4BIZ A;  3L2Z A;  2YI9 A;  2IH1 C;  1U96 A;  2XAJ A;  2FB5 A;  1L1F A;  5CBG A;  2CGN A;  4TV8 A;  4DUZ O;  3MEY A;  5CMU A;  4TSF G;  2DMX A;  5LBQ A;  1XIL A;  3N2G A;  5KAI Z;  4BIU A;  2Q0O C;  4JYC A;  3OMA B;  1R73 A;  3C3S A;  4RUE A;  3RVY A;  3OEE G;  1IX9 A;  2DEQ A;  4U7O A;  1GK9 A;  5B3S B;  4K0K O;  2PI4 A;  5H9C A;  1AI6 A;  4X65 B;  1OCC C;  4JI4 O;  4FIP C;  2OIE A;  3GB7 C;  1GO3 F;  1MSW D;  1BBW A;  5L3B A;  3A31 A;  4P74 C;  5B1O A;  4ZHQ A;  3CCL V;  1HNX B;  4JYB A;  3ETE A;  3W3S A;  1FAF A;  3B4S A;  1J5W A;  1JCH A;  4JI2 B;  4ZI7 B;  1PD3 A;  1YXB A;  2P22 C;  3ZHU A;  1FS0 G;  2LW7 A;  4YRI A;  3BVO A;  1WLE A;  3HY0 A;  4YJ3 A;  3V8K A;  2EJ9 A;  1NR1 A;  3UT5 B;  4B3M B;  2DJV A;  4J9Z B;  4CH3 A;  1TGO A;  1K5Q A;  1SZX A;  1QR9 A;  1RM1 C;  2QJ1 A;  3P30 A;  3VQW A;  4B08 A;  2CJA A;  4GLX A;  2EIM B;  1B70 A;  1VF7 A;  1JJC A;  4D6T H;  4GYC B;  1K4D C;  3ABU A;  4YCW A;  5LMU O;  2CJB A;  4B3R O;  1VF5 B;  4DR6 O;  4I0X A;  3H01 A;  2OIG A;  5BR8 B;  2OTJ V;  5LMN B;  4QJF B;  3F5W C;  3TCU A;  3SGI A;  2QWO B;  1Q7Y W;  1YSC A;  1G1X B;  1F23 A;  1XMQ O;  3OR6 C;  2ZE6 A;  4AIL C;  2ZGW A;  1WPY A;  3C3T A;  3MF2 A;  1FYF A;  4H2X B;  1VF6 C;  3QNE A;  4XU3 A;  1VMG A;  3BRC A;  3ICX A;  2VQF O;  3E9H A;  4TQF A;  1N33 B;  1FFX A;  2VRZ A;  3N27 A;  3EFR A;  3SR2 C;  4J11 A;  5IE9 A;  4ZTU B;  1WQ7 A;  1A32 A;  3H1J H;  5GON B;  4HWS A;  1H2S B;  3TET A;  1YIJ V;  4JI5 B;  1K73 W;  1G5H A;  3M99 B;  2IU3 A;  3BPZ A;  3ZS8 C;  3CRQ A;  4X20 B;  1NR7 A;  1GRJ A;  3S3W A;  2XAH A;  1PKX A;  1M56 C;  1GM8 A;  3JAS B;  4EB6 A;  4UCV A;  4H2Y A;  1HR0 B;  3AG2 C;  1MZF A;  5B1A C;  4BWA A;  2QGN A;  1QQC A;  3AG1 B;  5J2U B;  1BCC H;  5GTH Z;  4QPJ A;  2RCV A;  1HWY A;  1XNQ O;  2GHY A;  4BAY A;  5JCO C;  3JYC A;  1W0J G;  3KKY A;  2WLK A;  4NTY A;  2NN4 A;  3E22 A;  3ZHV A;  5IYD O;  4ZOL B;  5A2Q N;  1N0N A;  3CJH A;  4LVL A;  2YIB D;  1QHT A;  2AZ0 A;  1THZ A;  3W7X A;  2RN9 A;  3IAL A;  3AK3 A;  4UVC A;  4YPF A;  5E3I A;  4NXM B;  3IKL A;  2FYK A;  4JI0 B;  2EZO A;  5IYZ B;  4WF2 A;  4JTD B;  4P3P A;  3LNN A;  4FZ0 A;  2ETN A;  3EXA A;  2VS0 A;  1L0W A;  3WG7 B;  4ZI7 A;  1SS3 A;  2DZC A;  1F4M A;  2Q6A A;  2XUM A;  3LNM B;  4XTV A;  2OWO A;  2WA4 A;  4JI1 B;  3NXS A;  5CA3 A;  4DV4 O;  3CEI A;  4L87 A;  3OMN B;  2QWQ B;  4MVO A;  4HWR A;  3N2K B;  1XHZ A;  2WLN A;  3B2E E;  3V7S A;  1V55 B;  4PD4 F;  4DR7 O;  2QEX V;  3I55 V;  1XL4 A;  2HVJ C;  2YC0 A;  2QHS A;  4AQY B;  2C2A A;  3IC7 A;  3QG5 A;  4XTZ A;  3IAY A;  2IJK A;  2JGD A;  2PYJ A;  2ADQ B;  5L3E A;  1URF A;  4MVS A;  2BE3 A;  4LF8 B;  5B66 Z;  4I9W A;  2R9A A;  5CA1 B;  3D36 A;  4YRL A;  4H2X A;  3LSS A;  1YDX A;  3D3Q A;  1E1T A;  2GTS A;  2ATK C;  1KMI Z;  4DR4 B;  4HA8 A;  3GVM A;  1O9H A;  5LHH A;  2QKS A;  4C7U A;  4DK0 A;  4OPA A;  5GON A;  4XU2 A;  4JYA O;  4ZIB A;  1USY C;  3JD3 A;  4D7T A;  1N34 B;  1WB7 A;  3T1H B;  2QWN B;  4PA6 A;  1PM9 A;  2F95 B;  3F7V C;  3NR7 A;  2DXT A;  1SA0 B;  5KHK A;  2Q69 A;  4G27 B;  1ZSP A;  4AHC A;  4X20 A;  1H2M A;  2BOB C;  3W7W A;  4LWS B;  2JS5 A;  1TA8 A;  2AHY A;  2IM9 A;  2E5L O;  1BT8 A;  3QF7 A;  4JI6 O;  1IXM A;  4Q20 A;  1TUE B;  5J2U A;  3RYH B;  2JVD A;  1HNW O;  1AJQ A;  1ZL8 A;  5CN0 A;  5JH7 B;  2NR5 A;  1E24 A;  2JJ2 G;  2AKW A;  3HR0 A;  1LUW A;  2Y0P A;  4RQF A;  2F43 G;  3WB0 A;  3E83 A;  2XOK G;  1D5N A;  2NLJ C;  3KCX A;  4NXN O;  1X2H A;  2DN9 A;  1MNG A;  2R9I A;  1ROP A;  2GDS A;  4ZOL A;  3ZRX A;  5LGU A;  4H02 A;  2RHS B;  2X6C A;  2CIM A;  5LGT A;  4GX1 A;  4ABM A;  4UCT A;  1S5J A;  3UH0 A;  4LFA B;  4YRR A;  2Q73 A;  1Z2G A;  2ZIO A;  1U97 A;  4X1I A;  3ZMZ A;  5ITZ A;  3X2Q B;  2YID A;  3R65 A;  4DV0 O;  3M4P A;  1V9P A;  3K0D A;  4LF5 B;  1L8D A;  1DF5 A;  3ABT A;  1PP9 H;  2YS8 A;  2UUA O;  1YFT A;  3JCZ A;  2E10 A;  3ZRV A;  3TK1 A;  1COW G;  4X62 O;  1XMQ B;  3SPG A;  2HLD G;  5B1B C;  3DGE A;  5LYJ A;  4B3T O;  1OCR B;  4WFE A;  2WLH A;  3ABL C;  4WFB V;  2LQT A;  1M57 B;  2E76 B;  2IW5 A;  4JAU A;  4J15 A;  5F5W A;  1VQ8 V;  4DV6 O;  1H8H G;  4N21 A;  3DXR B;  4ZTZ B;  2UXB B;  4J7J A;  1Q43 A;  4YHH O;  1JJ2 U;  2AZ2 A;  1RIQ A;  4TOI A;  2HKO A;  2Y69 B;  3JAT B;  1HDJ A;  1IVS A;  2CTW A;  5EYP B;  5JQG A;  1Q6U A;  3H1I H;  4MTG A;  5LOV B;  3JD4 A;  1P7G A;  1S5L Z;  1LYL A;  2WLI B;  1YTF D;  2EIN C;  3U10 A;  3G6E V;  1RP3 B;  2K1E A;  1M56 B;  4LVI A;  1GN2 A;  2DOS A;  1KP2 A;  1FXH A;  4YRS A;  3PZC A;  5FPR A;  1SA0 A;  1NJ8 A;  3E8H A;  1H38 A;  2GSM B;  3SPI A;  1X2G A;  4KR2 A;  1K33 A;  3CD6 V;  4LWS A;  1YVW A;  4JZG A;  3FJP A;  3ABK C;  4CS4 A;  3MF1 A;  2ZE8 A;  3NEN A;  1WAZ A;  1XL6 A;  1SQG A;  4O2B A;  3RYH A;  2QDO A;  1Q90 D;  3K06 A;  1JQ0 A;  4EO4 A;  1X56 A;  3FYE B;  4LBE C;  1QNM A;  4DR2 O;  3HXY A;  3L4G B;  3A0H Z;  4OX9 O;  4DV2 B;  4B3S B;  2AXT Z;  1BL8 A;  3G4S V;  1E22 A;  4YRJ A;  3LUT B;  1Z7M A;  3ERR A;  2JGU A;  2EIL B;  5KMG A;  1TUB B;  1KYO F;  4MVM A;  1NT2 B;  1PNL A;  1EVL A;  3JD1 A;  3A74 A;  4H33 A;  1PYS A;  1Q82 W; 
#chains in the Genus database with same CATH homology
 3LC0 A;  1PYS B;  1CEZ A;  4R8C A;  5E1A C;  1KC8 W;  4H2S A;  3V7C A;  3NEL A;  3TUP A;  1QF6 A;  3B8M A;  1Q86 W;  2P0L A;  4P74 A;  3G1Z A;  4OXS A;  5EBM C;  3RW0 A;  3CCQ V;  1W2B U;  1H4V B;  3CCV V;  4X5O A;  3CMQ A;  4BIZ A;  4MT8 A;  3W7U A;  2J3L A;  2RHS A;  3MD0 A;  4MVZ A;  3IFX A;  3ASN C;  1S76 D;  3L2Z A;  1SET A;  2IH1 C;  1KOG A;  4BW9 A;  3IKM B;  3CPW U;  2XAJ A;  4K86 A;  1L1F A;  3P8T A;  4P3O A;  2EL9 A;  5CBG A;  2WWW A;  2HNI A;  3RGL A;  4YRG A;  3MEY A;  5CMU A;  2C7I A;  4YRP A;  4TSF G;  4ZBM A;  4UV9 A;  3ZMV A;  5LBQ A;  5LHG A;  3HTZ A;  2Q7H A;  1Y4M A;  4EX5 A;  4BIU A;  4JYC A;  4P9P A;  3OMA B;  4FJC C;  2DZ9 A;  3HXV A;  1NKD A;  1R73 A;  2ZR2 A;  1DLB A;  4RUE A;  1KP3 A;  4WF9 V;  2Q7G A;  3RVY A;  3CCS V;  3A7A A;  4Q15 A;  2EIL C;  1MOF A;  3KG2 A;  2DYS C;  3OEE G;  1GK9 A;  4U7O A;  1K9M W;  1RM1 B;  5B3S B;  2DEQ A;  2LFS A;  3K0G A;  2PI4 A;  3NET A;  5H9C A;  1AI6 A;  1OCC C;  4I5S A;  2Q68 A;  4FIP C;  1GKF A;  1NJ2 A;  2NNU A;  1EQR A;  1NH2 D;  3GB7 C;  3ZRW A;  1ATI A;  1GO3 F;  3TEG A;  3CC2 V;  1FXK A;  4PDV A;  1MSW D;  1BBW A;  1FXK B;  1ENV A;  5L3B A;  3PJS K;  4CBC A;  1NJ1 A;  3A31 A;  4FPP A;  5B1O A;  4P74 C;  3CCL V;  3RVZ A;  3HXW A;  3OFN G;  3K03 A;  4JYB A;  2IU0 A;  3ETE A;  5EBL C;  2QHT A;  3HFV A;  1ORQ C;  3W3S A;  3ZN1 A;  4TWK A;  2IH3 C;  1OZ0 A;  2EWN A;  1J5W A;  1YIT V;  3T4D A;  1YJW V;  2XAF A;  4X8A A;  1N9W A;  4XTU A;  1JCH A;  1QBZ A;  4ZKI A;  3TEH B;  1PD3 A;  1B8A A;  1ARO P;  1FS0 G;  1QE0 A;  2ZQM A;  4FK5 C;  3UGT A;  4YRI A;  1WLE A;  2WLM A;  3HY0 A;  3MQZ A;  1JX9 A;  1ASY A;  1G8M A;  2E5A A;  3V8K A;  2EJ9 A;  4RMF A;  1NR1 A;  2JDI G;  2HFE C;  4J9Z B;  4CH3 A;  2DXU A;  4X89 A;  2ODR C;  1K5Q A;  4DPG A;  1QR9 A;  1RM1 C;  3VQY A;  3OMI B;  1CPY A;  4CH4 A;  2XTI A;  3QO5 A;  4JGS A;  1VQO V;  2Q5I A;  1V54 C;  3P30 A;  2CJA A;  3I7F A;  3VQW A;  5C51 B;  4UP9 A;  2EIM B;  1B70 A;  2CK3 G;  1JJC A;  1K34 A;  3ABM B;  4YRK A;  1Q81 W;  1FXK C;  1K4D C;  2XAG A;  3ABU A;  3D3I A;  3BJU A;  4YCW A;  2CJB A;  1OHH G;  1ADJ A;  2Q5H A;  2HVK C;  4XEO A;  1M9N A;  3H01 A;  1AI4 A;  1SRY A;  2OTJ V;  2DTO A;  2ZT7 A;  4QJF B;  3F5W C;  3FB7 C;  2P90 A;  4GT1 A;  3TCU A;  4XEM A;  1Q7Y W;  3L1A A;  1YSC A;  3E8B A;  3RBZ A;  12AS A;  4P71 A;  1J95 A;  1F23 A;  4TT3 G;  4J9Y B;  3UGQ A;  5EBW C;  3OR6 C;  1W66 A;  3A7U A;  3VBB A;  2WAM A;  2A0L A;  3V8J A;  2ZGW A;  3AG2 B;  4UP7 A;  5IDJ A;  5B1A B;  4UXN A;  4YRC A;  1WPY A;  3A0R A;  3K79 A;  4LVK A;  3OW2 U;  4CH5 A;  3MF2 A;  1FYF A;  4H2X B;  3QNE A;  5K1P A;  1VQ4 V;  2FTK A;  3E9H A;  4WI1 A;  4H37 A;  5EC1 C;  4YRT A;  4YRN A;  4KP4 A;  1JOY A;  4TQF A;  1WU7 A;  3RKY A;  4HAM A;  3EFS A;  1OCZ B;  2I4L A;  3EFR A;  4DXW A;  4MW3 A;  2MK3 A;  1IL2 A;  1R6N A;  1YTF B;  4P73 C;  3HPL C;  2EIM C;  3HXZ A;  4ZTU B;  2ZXW B;  1WQ7 A;  1YJN V;  1ASZ A;  1DF4 A;  3ABM C;  4CS3 A;  1BIA A;  4U7N A;  2HJF C;  4HWS A;  3ETG A;  3REU A;  1LNQ A;  1I5Y A;  4RAI A;  3TET A;  1YIJ V;  3PCO A;  2DYR B;  2UXX A;  4PEL A;  1K73 W;  1G5H A;  1G5I A;  3E9I A;  4LNS A;  4DQ2 A;  3M99 B;  1EIY B;  4HWO A;  2IU3 A;  3RIR A;  3OAA G;  1NR7 A;  1H2G A;  3K3W A;  4UVA A;  5KUM A;  1HXD A;  2XAH A;  1PKX A;  2DKG A;  1M56 C;  1K7D A;  1GM8 A;  4K87 A;  4P71 C;  2HG5 C;  3IG2 A;  4H2Y A;  3ASO B;  3SPJ A;  3AG2 C;  2QHU A;  1QLE B;  5B1A C;  4F4L A;  4BWA A;  3AG1 B;  4MW8 A;  1X54 A;  2X6B A;  1VQP V;  2EIJ C;  1HTT A;  2EIK B;  1NQT A;  4XTY A;  1H4Q A;  4QPJ A;  2DQ0 A;  3A5Z A;  1B6Q A;  1H4S A;  1JVM A;  1K8A W;  3E8F A;  2ZT8 A;  1S72 V;  3SPH A;  3RL6 A;  1HWY A;  2OCC B;  4MSW C;  2GHY A;  4G2K A;  2DU7 A;  3FB8 C;  5C52 B;  2W0F C;  4BAY A;  1VQZ A;  1OCZ C;  3JYC A;  3ZRS A;  4WCE V;  4PG3 A;  1W0J G;  3AG4 B;  5KA5 A;  1Z7N A;  2ZIM A;  3OD1 A;  1R3K C;  4MTX A;  1K92 A;  4H2V A;  3A5Y A;  2WLK A;  2A79 B;  2ZXW C;  4JTC B;  4OP0 A;  1E1Q G;  4R6Z A;  3DSQ A;  2EZP A;  3SPC A;  1QVG U;  5ELN A;  4KR3 A;  2ODR D;  4XBF A;  2WLJ A;  2DYR C;  5IYD O;  4YRF A;  3OEH G;  4PA7 A;  1B76 A;  4LVL A;  3IGA C;  5KNN A;  1VQ7 V;  3QTC A;  1GTO A;  3AG3 B;  5FL7 G;  4GX5 A;  1X55 A;  2EAY A;  2QE7 G;  1THZ A;  4E2L A;  3W7X A;  2DJZ A;  3IAL A;  3CCJ V;  2YEV B;  4UVC A;  3ASO C;  3OM3 B;  5GW7 A;  3ZMT A;  4YPF A;  5E3I A;  2ZNI A;  2CGH A;  3HRI A;  3IKL A;  1EFW A;  3AG1 C;  4H2W A;  2FYK A;  2Q67 A;  5IYC O;  2J3M A;  2NS6 A;  4PDL A;  3ABL B;  2EIK C;  4TVA B;  2W6I G;  2X6A A;  2EZO A;  4X88 A;  4WF2 A;  4JTD B;  4XTW A;  4XDL A;  4P3P A;  2V7Q G;  4GX2 A;  5HFL A;  1VQK V;  1YGB A;  4AH6 A;  4HYO A;  1L0W A;  2DW4 A;  2JK5 C;  3WG7 B;  3AG4 C;  1PNK A;  1GGM A;  3BY6 A;  3TEH A;  1X01 A;  2DZC A;  4PA9 A;  1F4M A;  1SES A;  4LVM A;  2Q6A A;  3CXC U;  2LFR A;  3REX A;  2IY5 B;  1S3J A;  1VQ5 V;  3LNM B;  5L3G A;  3SYA A;  4XTV A;  4GCZ A;  4CH6 A;  3GWO A;  3OUF A;  2ZZE A;  3RKW A;  5KA6 A;  2ART A;  3V8L A;  1MG1 A;  1NH2 B;  3NXS A;  2OTL V;  2ZXF A;  3LDE A;  3K9A A;  5CA3 A;  4QE9 A;  1RPO A;  1PNM A;  4L87 A;  5B3S C;  1VQN V;  3OMN B;  5CBF A;  1AR1 B;  5DN6 G;  4MVO A;  4HWR A;  4MS2 A;  2WLN A;  5HGQ A;  1M1K W;  4XDK A;  4YYE A;  4P73 A;  4H2U A;  4XU1 A;  3V7S A;  2QHV A;  4N23 A;  3WQZ A;  4WJ3 M;  1NJ5 A;  1GMG A;  1V55 B;  4XTX A;  4YRM A;  2QEX V;  3I55 V;  4RO2 A;  1XL4 A;  2HVJ C;  2RHQ A;  2QHS A;  2JEX A;  2C2A A;  2A8E A;  2RHQ B;  3IC7 A;  4XTZ A;  1YB3 A;  2IJK A;  3A32 A;  5L3E A;  2JIZ G;  1YFS A;  2EJR A;  5HFM A;  1NYQ A;  5J9P C;  4MVS A;  3WG7 C;  2H94 A;  5DM6 V;  1P7B A;  1NVP D;  2A9H A;  3HB3 B;  4I9W A;  2XAS A;  1WNL A;  3B8N A;  3D36 A;  3SYP A;  4YRL A;  2I4O A;  4TVW A;  4OLF A;  2E64 A;  4H2X A;  3LSS A;  2V1D A;  2ARS A;  3AEI A;  3ZN0 A;  1G51 A;  1E1T A;  3HY1 A;  2YSU B;  4HWT A;  2M7W A;  2ATK C;  3ICA A;  4HA8 A;  3CYO A;  4RUF A;  3FKS G;  4CZZ A;  4PA3 A;  2C8M A;  4P72 A;  4JPR A;  2Q7E A;  5K1X A;  1K4C C;  2DWD C;  2P6J A;  1R3I C;  3T2M A;  2IJJ A;  1S77 D;  3M4Q A;  4PA4 A;  5LHH A;  3KFU A;  2QKS A;  4JTA B;  3W7T A;  1N8R W;  4LVJ A;  2DDZ A;  1I5X A;  3OGC C;  3RF1 A;  3LDD A;  4GX0 A;  4XU2 A;  5EC2 C;  3V7R A;  1V55 C;  3I56 V;  3JD3 A;  1USY C;  4ZIB A;  3MHS C;  4WJ4 A;  3CCM V;  1AJN A;  4PA6 A;  2DVE A;  4RQE A;  2ZIN A;  3F7V C;  3K04 A;  2DXT A;  1H8E G;  1QCE A;  3ZMU A;  1EIY A;  3JD2 A;  4XU3 A;  1R3L C;  4P2Z A;  2OT5 A;  2Q69 A;  4G27 B;  1BBU A;  3OR7 C;  2PMF A;  2DWE C;  3HFZ B;  1CP9 A;  2X7R B;  3UFG A;  4HT4 A;  3OE7 G;  1OCO B;  2BOB C;  1K5S A;  3CC7 V;  3W7W A;  1EOV A;  3WFV A;  2AHY A;  4R50 A;  4KUM A;  1KMM A;  3EHB B;  3W7S A;  1AI5 A;  1IXM A;  1ZWI C;  2ITC C;  4Q20 A;  5KUK A;  1TUE B;  1E79 G;  1UJW B;  3ZCC A;  1AJQ A;  2H8P C;  3E35 A;  1H4T A;  1VQ9 V;  4UVB A;  2AMC A;  3P32 A;  5CN0 A;  4QE7 A;  1SER A;  1E24 A;  2AMC B;  1YJ9 V;  3E89 A;  1K3E A;  2JJ2 G;  2ZZF A;  2AKW A;  4P72 C;  2ZT6 A;  4RQF A;  1YFR A;  2F43 G;  2AKW B;  4WFH A;  1WQW A;  4DO2 A;  3B77 A;  5B1N A;  1YHQ V;  1NJI W;  3E8G A;  3E83 A;  4P75 C;  4HVC A;  3LSQ A;  2XOK G;  4MTF A;  4HZ3 A;  5L3D A;  2NLJ C;  3F7Y C;  3P8V A;  1NBM G;  1X2H A;  1R6K A;  4TQD A;  4MVQ A;  4YRO A;  2R9I A;  4MVU A;  1ROP A;  3T1C A;  1QLN A;  1NJ6 A;  2B1I A;  2EBO A;  3ZRX A;  5LGU A;  4H02 A;  5CBH A;  1BIB A;  1NNH A;  1OCO C;  1EZJ A;  4FMT A;  2RHS B;  2ZT5 A;  2X6C A;  3CMA V;  2CIM A;  2ZZG A;  2KB1 A;  3E2E A;  3NEM A;  4RDX A;  2YEV A;  3JD0 A;  4UUJ C;  2UXN A;  5LGT A;  4GX1 A;  2G4C A;  5B1B B;  1QLE C;  2ZTG A;  2ZNJ A;  2DU5 A;  4TVA A;  2P67 A;  2WLL A;  3UH0 A;  3RAC A;  4P9O A;  2WLL B;  3CP1 A;  1Q82 W;  4YRR A;  3RKX A;  11AS A;  3FYI B;  3QO7 A;  1E1O A;  3DTU B;  1X2G A;  4E51 A;  2ZIO A;  2OCC C;  4YRQ A;  3ZMZ A;  4KFM A;  3X2Q B;  2I4N A;  1PL0 A;  3R65 A;  2JJ1 G;  3ML0 A;  1QR8 A;  3G71 V;  2QM8 A;  3M4P A;  4TTV A;  2ZDI A;  3K0D A;  3E86 A;  4G85 A;  1V54 B;  1DF5 A;  4HWP A;  2PI5 A;  3FB5 C;  2QTO A;  2Y48 A;  3ABT A;  3ZRW B;  4O2D A;  3SYQ A;  3SYO A;  4WFA V;  1SZT A;  1YFT A;  3OUS A;  3JCZ A;  4MTO A;  5IYB O;  3HXX A;  2E10 A;  5ELO A;  3ZRV A;  1BMF G;  3TK1 A;  1AI7 A;  4WFF A;  1COW G;  5IY5 B;  2QM7 A;  3RUX A;  1C0A A;  3AG3 C;  3SPG A;  2EIN B;  2DTI A;  2HLD G;  4UP8 A;  1DTO A;  4YP0 A;  2Z3Y A;  1M90 W;  1RPR A;  1QVF U;  1BHB A;  1WYD A;  5B1B C;  1GM9 A;  2XND G;  3DGE A;  1USY A;  2D3O W;  2P5I A;  1OCR B;  3BEH A;  2ZD9 A;  4WFE A;  5C53 B;  2WLH A;  3ABL C;  2QA4 V;  3LDC A;  4P30 A;  5EK0 A;  3ZMS A;  2W6J G;  4WFB V;  1M57 B;  3T4Z A;  1B7Y A;  2E41 A;  1P4R A;  2IW5 A;  1B7Y B;  2PME A;  3HXU A;  3VQV A;  4JAU A;  4QNH B;  2Z5U A;  1VQ6 V;  5BZB A;  2IJI A;  4JF3 A;  3X2Q C;  1FXV A;  4J15 A;  1VQ8 V;  4YCV A;  5F5W A;  3SJQ C;  1H8H G;  3ABK B;  2E3C A;  4H2T A;  2ZR3 A;  4YDQ A;  4N21 A;  1G4Y B;  1KD1 W;  3QO8 A;  3ZJZ A;  1EFR G;  1VQM V;  2E1H A;  4TVY A;  4ZTZ B;  3FB6 C;  1JJ2 U;  2ZDI C;  1WPX A;  2B5U A;  4LP8 A;  2IY5 A;  1RIQ A;  1B70 B;  2ALY A;  3SYC A;  1KEC A;  4ASU G;  1JJC B;  2ALY B;  4PHC A;  1F4N A;  2HKO A;  2Y69 B;  3CCU V;  4YRJ A;  4YRE A;  2B1G A;  2BOC C;  2WLI A;  3JD4 A;  4MTG A;  5IY5 C;  1YI2 V;  1LYL A;  2WLI B;  5LHI A;  4YCU A;  1YTF D;  3A7R A;  2EIN C;  1EBO A;  4LCU C;  2CJ9 A;  3BFM A;  3R07 A;  4P75 A;  4XU0 A;  4G28 B;  1VQL V;  3VQX A;  2ITD C;  3G6E V;  4LVI A;  2K1E A;  3K08 A;  1M56 B;  4R7C A;  2EJF A;  4P3N A;  4XDJ A;  1KP2 A;  4WFG A;  1FXH A;  2E65 A;  5H6Q A;  3STZ C;  4YRS A;  4QIW F;  3PZC A;  1OCR C;  4PDM A;  5C93 A;  3HRK A;  1NVP B;  4JAS A;  4NCX A;  1K97 A;  1NYR A;  3HFZ A;  1M57 C;  2EIJ B;  1NJ8 A;  2WPD G;  3E8H A;  2GSM B;  3EFF K;  4LC1 A;  2IJH A;  4MVR A;  3SPI A;  5L3F A;  1K33 A;  1H38 A;  3ASN B;  2EJG A;  4K88 A;  4KR2 A;  2DQ3 A;  3CD6 V;  4JAV A;  1KMN A;  4KQE A;  2ARU A;  3FJP A;  3ABK C;  4CS4 A;  3MF1 A;  4UPA A;  3UM7 A;  3NEN A;  1HC7 A;  1S0V A;  2P7T C;  1E1R G;  1FFT B;  1W0K G;  1XL6 A;  2LP7 A;  4Z1M G;  1R3J C;  3CCR V;  1KQS U;  4YXW G;  2JEU A;  3CC4 V;  3K06 A;  4PDR A;  1JQ0 A;  4EO4 A;  1AJP A;  1X56 A;  1BHA A;  1ADY A;  3L4G A;  4CS2 A;  3FYE B;  4LBE C;  3VOU A;  3CCE V;  5LGN A;  3STL C;  3HXY A;  1Y66 A;  3L4G B;  2Y69 C;  4Q6G A;  1S5H C;  2WSS G;  2XAQ A;  1MAB G;  1F51 A;  1E22 A;  1BL8 A;  3G4S V;  3CME V;  3PCO B;  3ETD A;  3LUT B;  1Z7M A;  2XGT A;  3ERR A;  2R9R B;  3P8Y A;  4QPK A;  2ZCE A;  2EIL B;  4G84 A;  2DYS B;  2DTH A;  4UV8 A;  4BW5 A;  1JPX A;  3MHH C;  3ZIA G;  1EVK A;  4MVM A;  5H6R A;  4EKW A;  1PNL A;  2HR3 A;  1EVL A;  1OCC B;  1GM7 A;  3JD1 A;  1KKD A;  3A74 A;  3UKM A;  2AHZ A;  4H33 A;  2X0L A;  1PYS A;  4TWA A;  5L3C A;  2I4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...