4L87A

Crystal structure of the human seryl-trna synthetase in complex with ser-sa at 2.9 angstrom resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
476
structure length
476
Chain Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine--tRNA ligase, cytoplasmic
publication title Crystal Structure of Human Seryl-tRNA Synthetase and Ser-SA Complex Reveals a Molecular Lever Specific to Higher Eukaryotes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 132
structure length 476
sequence length 476
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4l87A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4l87A02
4K87A 3L2ZA 3L4GB 3QTCA 2IY5B 1SETA 1SERA 4DQ2A 4WI1A 4O2DA 3BJUA 2ARUA 3E9IA 4X5OA 5ELNA 4YYEA 4XTWA 4XU0A 3M4QA 4H2XB 2RHSB 3HFZB 4K86A 3LSSA 4XEMA 4HWRA 1RIQA 1Z7MA 4Q6GA 1E1TA 3A7RA 1BBWA 3RKWA 2ZR2A 1ASYA 1X56A 3TUPA 2J3MA 3EFSA 3HTZA 4YREA 1EFWA 2E41A 4YCUA 3UFGA 4YRIA 2DTIA 1NJ6A 1KOGA 1SRYA 2I4MA 3A7AA 1WYDA 1L0WA 3DSQA 1G51A 2EJGA 2PMEA 4KR3A 1HTTA 3QO8A 2ARSA 1ADYA 3A5ZA 4XEOA 2CGHA 4P3PA 1QE0A 4YRPA 3NELA 4HWPA 1B70A 2ZNIA 2E5AA 3V7RA 2G4CA 2RHQB 4P72A 2Q7GA 3TEHA 4DPGA 5E3IA 3V8LA 3G1ZA 4XU2A 3HY1A 4P72C 3LSQA 3A74A 2QHVA 1EVKA 4KQEA 1H4TA 3NEMA 2C8MA 2E64A 2ZT6A 2CJAA 4WJ3M 4H2VA 2EJFA 2ZT5A 2ARTA 5C52B 1B70B 2Q5HA 1E1OA 1H4SA 3MF1A 3REXA 3HXUA 4TVAA 4TVWA 4YRTA 2E3CA 3REUA 2DVEA 4EX5A 3RL6A 1G5IA 4BW9A 3HFZA 1W66A 2EAYA 5ELOA 4HWSA 1ASZA 1B8AA 4YRKA 3MEYA 4H2WA 4YRCA 4H2UA 3RACA 4YRJA 4AH6A 2CJ9A 3PZCA 4YP0A 1QF6A 3RUXA 2DKGA 4E51A 3HXXA 2PMFA 2ZZGA 2HNIA 2I4NA 2E65A 4HWTA 1B7YA 4G85A 3LC0A 2ODRD 4YRLA 2DTOA 1JJCA 4TVAB 4YDQA 1J5WA 2ALYB 4YRNA 2FYKA 1C0AA 4J15A 1BIAA 3I7FA 2EWNA 2ZZEA 4ZIBA 4YPFA 3NETA 4PG3A 4TTVA 3IKMB 5C53B 4UP9A 3V8KA 3QNEA 2C7IA 4YRRA 1NNHA 3NENA 3BFMA 2DXTA 4G84A 3KFUA 2XTIA 1B7YB 4YCVA 2DU5A 1HXDA 1JJCB 2RHQA 1LYLA 2AMCA 2ZNJA 2ZCEA 4TQDA 3HXZA 3RKXA 4KR2A 2Q5IA 3V7SA 1YFTA 1H4VB 2EJ9A 2QHTA 3HXWA 2ZT8A 3IG2A 4P71A 2ZT7A 2DZCA 1IL2A 1PYSA 3UH0A 1NJ1A 4CH4A 4XTUA 3WQZA 3W3SA 1NYRA 2AMCB 2ZZFA 3VQYA 1G5HA 1N9WA 4YRGA 2AKWB 3VQXA 5K1PA 2ZIOA 3L1AA 3PCOA 3E9HA 1BIBA 1PYSB 2ZTGA 3RF1A 1E24A 3A31A 3TEGA 3OD1A 3V7CA 1USYA 1WU7A 3P8YA 4K88A 4CH3A 2ALYA 1EIYB 4CS4A 3HRKA 1USYC 2DXUA 4H02A 4L87A 4CS2A 4YRFA 1B76A 4P3NA 1BBUA 1KMNA 3IALA 4WJ4A 3QO7A 4YROA 2EL9A 2DEQA 5K1XA 2E10A 3PCOB 3R07A 2QHUA 3HXVA 3M4PA 2Q7EA 3ICAA 1X2GA 4P73A 4ZTZB 1KMMA 2CIMA 4P75A 4OLFA 4H2SA 5HGQA 4HA8A 4PHCA 3IKLA 4P75C 4RQFA 2P5IA 1X54A 2ZR3A 1WNLA 1E22A 3A32A 1HC7A 4YCWA 2DQ0A 3MF2A 3VBBA 3RKYA 2ZIMA 2ZINA 4UP7A 2J3LA 12ASA 1H4QA 1WQWA 3FJPA 5C51B 4YRMA 2DQ3A 4TWAA 3QO5A 1YB3A 1X55A 3HY0A 4XTXA 2DJZA 2AKWA 2XGTA 4CH5A 1WQ7A 2ODRC 3EFRA 4XU1A 1WLEA 4H2YA 3HXYA 4UP8A 2DZ9A 4UPAA 1ATIA 3V8JA 3VQVA 2I4OA 4OP0A 4P71C 4EO4A 1ADJA 4H2TA 1EIYA 2ZGWA 2ZXFA 2DDZA 4P3OA 3A5YA 4YRSA 1EVLA 4HVCA 1Z7NA 11ASA 4P74A 4WF2A 3VQWA 4HWOA 1YFSA 1NYQA 2E1HA 4RQEA 1NJ2A 1GGMA 4P74C 3HFVA 4ZTUB 2Q7HA 4TQFA 4XU3A 3UGQA 3RIRA 2CJBA 4LNSA 2DTHA 1SESA 4TVYA 3P8TA 1YGBA 1YFRA 3CMQA 2QHSA 4Q15A 5KNNA 3A7UA 3UGTA 3RGLA 3L4GA 2IY5A 2I4LA 1FYFA 1NJ8A 4CS3A 3HRIA 2DU7A 4NCXA 4BWAA 1EOVA 4H2XA 4YRQA 2RHSA 3TEHB 1VQZA 4XTVA 5F5WA 4RDXA 2P0LA 4XTYA 4CH6A 4XTZA 3ERRA 1NJ5A 4RMFA 4P73C 1WPYA 1X01A 3P8VA 1X2HA 1EQRA
chains in the Genus database with same CATH superfamily
3JAWA 5H6QA 2NN4A 4JI6B 1SERA 5DECA 4DQ2A 3AG1B 3P30A 3RVZA 3BJUA 4ZHQA 2ARUA 4P2ZA 3E9IA 4XTWA 1VQ8V 2YEVA 4XU0A 4DK0A 5GONB 4JYBA 4B3TB 4MVMA 4LWSA 1XI1A 3OUSA 4EB6B 4GKJO 3AK1A 2WLJA 1E1TA 3A7RA 1BBWA 3RKWA 2R70A 4YIPA 3ZHSA 3TUPA 3B09A 1HNXO 2AZ2A 3L9DA 2J3MA 3EFSA 2P90A 4L8JA 1MOFA 1SC5B 3ZBHA 2OWOA 1S0VA 3L75H 3JD4A 2VQEB 2LQTA 2CTWA 4NXMB 2Q69A 4YCUA 3UFGA 4JV5B 2DTIA 3CHXA 1PL0A 1TAEA 3ASOB 1NJ6A 1KOGA 4WFFA 4WFHA 4JTAB 1E1RG 1URFA 3DSQA 5J2TA 1G51A 2EJGA 2BTQB 3QO8A 1KU9A 4JYAB 4XEOA 4LNUA 1QE0A 4YRPA 1KYOF 1ZTEA 3OR7C 3K3WA 1NR7A 1RSOB 4LBEC 4O2AB 4TWKA 1QLEB 3OUFA 5B1OA 3V7RA 1IX9A 2ZM6O 2G4CA 1CPYA 4J80A 2RHQB 4P72A 3W7WA 4LH7A 3TEHA 2OCCB 4JYCA 2ZE7A 3G1ZA 1B06A 1FJGB 1H2NA 3HY1A 4J41A 5EC2C 3A74A 2QHVA 3N2KB 4X20B 1TGOA 2G38A 3OTOO 2E64A 2CJAA 1Q86W 3CXCU 1AVMA 4WJ3M 4H2VA 4WBNA 2ZT5A 2ZQMA 3T2MA 1O9HA 4F6EA 3OE7G 2YDEA 4H13B 3JD1A 1Y6XA 3ZMSA 2Q5HA 3CMEV 3REUA 4EX5A 4ABMA 3U0ZA 4NXNB 2GBOA 3RGBA 5ELOA 5LL6Y 2UXDO 1K4DC 1ASZA 2Y4UA 4O4LB 4YJ2B 5JJNB 2YI9A 1Q6IA 4H2WA 4OGQB 4B3SB 3RACA 1W2BU 4YRJA 5CB4A 4LF9B 4YP0A 3RUXA 2PMFA 1GH6A 4MW8A 3GVMA 3D8CA 2R9RB 1B7YA 5IT9N 4TV8B 2OT5A 3UKMA 4DR2B 2DTOA 4YDQA 2A8EA 1R3IC 3G4SV 1R1BA 4YRNA 2FYKA 1C0AA 4J15A 1AI6A 4KHPO 4ZIBA 3SDLA 2JGDB 3ASOC 3HB3B 1US6A 3FD9A 4Q20A 4D7TA 4YJ3A 4PG3A 5EBMC 4MTXA 1QR9A 1U97A 1HDJA 2EINB 1J5EO 4YRRA 3NENA 3BFMA 2DXTA 4G84A 4LP8A 4QGPA 1W0KG 4LFBO 4OX9O 4HNAB 3K0GA 4X64O 2UXBB 2ZNJA 4XBFA 1QLEC 5FLXN 3APQA 3HXZA 1OHHG 1X4TA 2BTOA 5IYCO 2UUBB 1KKCA 4J10A 4QIWF 5KHJA 3RKXA 2OCCC 3THOA 3ABUA 2ZE8A 4ZI7B 2VS0A 1H4VB 3HXWA 1NH2D 3APOA 1M4UA 2Q4PA 5TISZ 2ZT8A 4P71A 2AXTZ 4IYHA 2QJ1A 1PYSA 4D6TH 3RYCA 1S5JA 5IE9A 1GRJA 3B4SA 5EIBD 4CC5A 4LF7O 3K57A 1R3LC 4FLYA 1PV0A 1KECA 2L6LA 4PHZA 4E2LA 3VQYA 1YCIA 1RFYA 4OPHA 5B1BB 1HNWO 4P9PA 1JFFB 1N9WA 4JI2O 4YRGA 3JARB 2AKWB 3PN1A 3L1AA 2DYSC 1MSDA 2H3OA 2PF4E 2ZXWC 1Q90D 3RN4A 2XUMA 5B1AB 4HAMA 3ETGA 2DW4A 2LFSA 4JI5B 1VF5B 3OD1A 1USYA 3HPLC 1B3QA 1QNMA 2YXLA 5KHHA 2WLLA 5IWAO 2GSMB 3OT7A 3ML0A 3C90A 4P30A 4FFKA 2N74A 1XMOO 4H02A 4L87A 1IVSA 1B76A 3CMAV 4JI0O 1PD3A 1BBUA 1NBMG 1NI8A 1G1XB 3CB2A 4JYYA 3RFRA 3N2GA 3L73H 3MAQA 5C8YA 2H8PC 1WB8A 1CXZB 1PKXA 3HXVA 3ICAA 3CCLV 4P73A 4K3AA 1WB7A 2LP7A 5L3GA 4UXNA 2EINC 3L71H 4OLFA 4H2SA 1XQ8A 3O65A 4QPKA 4PHCA 1DTOA 3FAVB 5JQGB 3IKLA 3RW0A 2P5IA 1ROPA 5LP6B 2ZR3A 1X54A 5ITZB 1W0JG 2DQ0A 4UV8A 1B04A 2QKSA 1P7GA 5BMVA 1SF9A 4X1KB 1DLBA 1Y76B 2EX3A 4JAVA 3RKYA 4JF3A 1NJIW 1S77D 2ZIMA 5B3SC 1SZXA 3ZS8C 3CCEV 2WPDG 4AQYO 3PJSK 1B6QA 4X62O 3FJPA 1QVFU 5C51B 4TWAA 1X55A 4DXWA 3HY0A 2RNBA 3TJTA 1QCEA 2QM8A 1VQ9V 1K7DA 5FNVA 2CTQA 3EFRA 1M56B 1NU1H 4PA4A 3P3NA 2M7WA 4IIJB 2A3QA 1WN7A 3HXYA 2DZ9A 1ATIA 3V8JA 4DV4O 1ADJA 5B1AC 3JAMN 4H2TA 2JRIA 2R9AA 5J2UA 1EIYA 2QA4V 4BR6A 2VQFO 4X65B 1EVLA 4HVCA 1HR0B 1Z7NA 4UVBA 4O4IA 3IFXA 2QKCA 1BQZA 1YFSA 3R66A 3LDEA 1NTMH 2E1HA 1MMMA 1PP9H 2Y69C 5IJ9A 1XUQA 3HKBA 3B8MA 3OR6C 4U7OA 4P74C 2ADPA 4A5UB 2Q7HA 4B3MB 5LMNO 3CC2V 4X1IB 3CCMV 4TQFA 1R6NA 3JASB 2F66C 4LR3A 1OV9A 2BSKB 2Q6AA 4OXSA 3D3IA 3CCSV 2DTHA 4NYKA 3ZMZA 5KMGB 5JJJB 1AI7A 2QEXV 3A7UA 3RGLA 1R3JC 2X6BA 5H9CA 3ABLB 3RWRD 1KMIZ 3OFNG 5E79Z 2YIDA 1FYFA 4J9YB 1NJ8A 4CS3A 5LP6C 4BWAA 5CMUA 5H5NA 3H1LH 4DRXB 3D36A 4YRQA 1FXHA 4JI4B 2CDYA 4J11A 3K59A 3DXRB 4DR4B 4EB6A 4DV2O 2E75B 4FFBA 1R6KA 4CZZA 5HFMA 3ERRA 4RMFA 2X7RB 2P6JA 2ZE6A 1Y74B 5IYZA 1WPYA 2A7WA 3CD6V 3RYHA 1QQCA 4Z1MG 3T1YO 1GN3A 3L2ZA 1AP5A 1EN4A 3QTCA 2IY5B 4EKWA 3K06A 1SETA 4HBNA 2KQXA 1GKFA 3G6EV 4O2DA 2WA4A 5LXTB 2YUAA 2PYLA 5ELNA 1Q5OA 4LF5O 4YYEA 4LF8O 1SQXH 4U3FH 4DV0O 1FD9A 1VQPV 2Q67A 1M56C 3HFZB 4K86A 2YICA 4XEMA 3WB2A 5KAIZ 4HWRA 1RIQA 4Q6GA 3B8NA 4J42A 1JJOA 1TUEB 2BTQA 3ZEDA 1W59A 1ASYA 2O57A 1X56A 1GM8A 4XDKA 2RDCA 2WLIB 1WPXA 3H1KH 1Q8IA 2NNUA 1FFTB 3BFRA 4YREA 2Y4TA 1PNKA 1YIJV 1IDSA 1KUQA 1MSWD 3IC9A 1K97A 1P84F 2K1EA 3ZMUA 2FL4A 5FPOA 5KA5A 1P49A 3A7AA 4PI0A 4LVMA 4UCTA 4QE9A 4JAUA 5CBGA 1AB3A 3N2KA 4X20A 1HTTA 4JZ2A 3A5ZA 4H33A 1X59A 1F51A 2PTMA 2CGHA 3CRMA 3UO2A 3NELA 3IAYA 3VOUA 1AJPA 2YIBA 2ZNIA 5JH7A 2XTAA 1HNXB 2CK3G 2V7QG 5LOVB 3ABLC 1XHZA 1OCZC 1VMGA 4DR3O 4XDLA 4JASA 5KHGA 4J7JA 1ORQC 2LFRA 4GX1A 3TXSA 3SPHA 1EZVH 2DE0X 3Q4HA 4O4LA 4YJ2A 3K5NA 1EVKA 3X2QB 2P7TC 1XNRB 1H4TA 3ICXA 2KG7B 1IXMA 3WB1A 1NKDA 4JI3B 2E5LO 3ZRSA 4PDLA 4F4LA 2E74B 2PZSA 2WAMA 2IJJA 4K0KB 3ETQA 3WFVA 2F4VB 1V55B 2XNDG 3MF1A 3REXA 1N36O 2Q0OC 1Q43A 1RPOA 2EJRA 1SA0A 2E3CA 3HKCB 4TVWA 2DVEA 1JOYA 4MVRA 2Y0IA 1PNLA 5EZYA 3W7XA 2YI8A 4UVCA 3H1JH 4U7NA 4BW9A 2Y0PA 1JJ2U 2HEPA 3TCUA 1I5YA 2XHBA 1K9MW 4YXWG 3GB7C 1RPRA 1XMQO 3MEYA 3FB8C 5L3CA 1E1QG 4H2UA 1KBHA 3CCVV 4E51A 5LGTA 3HXXA 4XDJA 5H6RA 2KKWA 5CA3A 2HNIA 3BPZA 1PPJH 5H2FZ 2HLDG 1FXKA 1Y66A 2YXHA 3OMAB 3ASNB 3OTOB 4I50B 4YRLA 3JCUZ 1BHAA 1ENVA 4ZOLA 4TVAB 4K35A 1J5WA 2ALYB 1YSCA 4JGSA 1KB9F 4J7ZA 4PD4F 4MVUA 3WU2Z 5BR8O 1BIAA 2EWNA 3U11A 4F6RB 4DUYO 3FB7C 4ZI7A 4UCUA 5GTHZ 3NETA 4TTVA 5C53B 3U10A 4UP9A 3QNEA 5LHGA 2BOBC 4PI2A 2HJDA 1I7FA 4AHCA 3ETEA 5EBWC 2MK3A 4DV7O 3P3PA 2UU9O 1LYLA 3T4DA 3CS5A 2FTKA 3AG2B 1GN4A 3EXAA 1LUVA 1JFFA 4JI1O 2IBZH 3JARA 2DWEC 1OCCB 4MT8A 3V7SA 2EJ9A 4P9OA 4KHPB 1K92A 2WLKA 1XNQO 4GKKO 3SJCC 4ICGA 3X2QC 5JCOA 1IL2A 4B7KA 2CTPA 1GN2A 3UH0A 1MZFA 3CJHA 1IURA 4PDVA 3A0HZ 5IJ0B 3CC7V 1JPXA 1S5HC 1NYRA 2PI4A 5KX5B 2ZZFA 1V55C 3G80A 4LFBB 5A9GA 4X64B 1VARA 1G5HA 3JAKB 4O2BB 3BHPA 4G2KA 3T1CA 2JS5A 1SQPH 3QF7A 2GTSA 3ZRXA 1VEWA 2D2CB 1JQ0A 1IBLB 4FMTA 2CGNA 3UM7A 3E9HA 1BIBA 1Q6HA 3F7YC 2ZTGA 3RF1A 4HT4A 2JJ1G 3K03A 1WA8B 1ZL8B 1FAFA 3TEGA 1IBKO 1S72V 4CH3A 2W6JG 5LA6B 4WFAV 1GK9A 1SQQH 3ASNC 4DR1B 4UVAA 4R6ZA 1COWG 3SYQA 3N27A 4UUJC 3FAVA 1H2MA 2DXUA 2DYSB 1YI2V 2VWKA 5FL7G 1AR1B 4JTDB 4LF7B 2ZXWB 4LFAB 3HKDB 3IALA 4WJ4A 1HNWB 4FLUA 2EL9A 4X66O 4JI2B 1VF7A 1SQBH 1QU7A 3G71V 3PCOB 3R07A 2IJHA 3K04A 4X88A 2QHUA 1L0LH 2NR5A 3SYPA 2Q7EA 1X2GA 4DV3O 1NH2B 1N4CA 4P75A 2EULA 2IJIA 4IL6Z 4MS2A 2ARHA 3ZIAG 2VQEO 4TV9A 4J7KA 2EIJB 3CRRA 4N23A 3EFFK 3IC7A 5KUKA 4I4TA 3A32A 5IWAB 3AG2C 3ZCCA 1NVPB 1YITV 1NT2B 3MF2A 1XMOB 1OCCC 4FLTA 2HHHO 1BCCH 2QTOA 5J9PC 4DO2A 2ZINA 1UJWB 4TT3G 12ASA 2BE3A 3AEIA 2QTSA 3OEHG 1VF6A 3LNNA 2WSSG 1EN5A 2DQ3A 1N0JA 1TUBB 1YB3A 2QR4A 4DV1B 5JVDB 3JAWB 2XGTA 3E8FA 3STZC 1FYJA 4XU1A 4NTWA 5B3SB 1MA1A 4H2YA 2F23A 4X1IA 4JI8B 2LO1A 1HP8A 4NKGB 3E8BA 1YF2A 2BSKA 1WPBA 2W6IG 2XAQA 4LWSB 2I4OA 2L35A 2ZXFA 1Y4MA 2DDZA 4X89A 3E8HA 1DK1A 4DR7B 5LMUB 2DN9A 2X6AA 5KMGA 3CSXA 2UUCB 4BW5A 4O4JA 1FS0G 2GV9A 3FX7A 4AQYB 2ZDIA 2Q9LA 3SJAC 4X62B 5KHKA 2RN9A 1NYQA 3A8TA 1NJ2A 1L1FA 3ZRWB 2QGNA 3M8AA 4DRXA 1HNZO 4I0XA 3FKSG 5GW7A 1TVKB 1I94O 3DXRA 2DWDC 1M93A 4FZ0A 2CJBA 1JX9A 5J2TB 1IBMB 4MVZA 4LNSA 1Y74A 2ETNA 1SQVH 5B5EZ 1JVMA 3HKEA 4Q15A 3BABA 4B3RO 2Y69B 3FYIB 3SJQC 3A0BZ 2IY5A 4U3JB 2VQFB 2EIJC 3OMNB 3E35A 1GO3F 3S3XA 5LXTA 1Y67A 4R8CA 1XL6A 3WB0A 3G67A 3E8GA 2H94A 4DYLA 5EIBC 1EOVA 3W7SA 2FMLA 3TEHB 4LC1A 1VQZA 4UCSA 5F5WA 1NZ6A 4RDXA 2P0LA 4GT1A 1R3KC 4TUYB 4WF9V 1GMGA 1LR1A 3ZN0A 1K5QA 2HKOA 4YY3O 3CP1A 4JZGA 1NJ5A 2D3OW 2A06H 4N21A 4DW0A 2LGWA 3HR0A 1Z5VA 2V4DA 3P8VA 4UB6Z 4DR5O 2QWPB 1EQRA 4WBNB 3BEHA 3L4GB 3IJ4A 1H8HG 4Z2WA 1AI4A 3LNMB 4WI1A 4AI8A 4YHHO 3RYIA 1I08A 5CA0B 3OMIB 2ADQB 2AGAA 3LSSA 4DR6O 3NR7A 2E76B 3CCJV 3MHSC 4IHJA 4O4HB 1K34A 2JGUA 1VQ7V 4FPPA 4B08A 5CB4B 2EIMB 2NS6A 4DV2B 3HTZA 5GTIZ 2HVJC 1Q3EA 1Q6UA 2Y48A 3AG7A 2E41A 1YHQV 1EFWA 4LF4O 5LOVA 1FKAO 2ZKOA 3JATA 3RYFA 5CA1A 2B9ZA 1R73A 3ZHRA 1AP6A 2QWQB 4UB8Z 5LYJA 3WG7C 2P4KA 1L8DA 5FPRA 3TETA 1WYDA 1L0WA 2IJKA 2PMEA 4LF5B 1AR4A 4KR3A 2KB1A 2ARSA 1N33O 4YJ3B 1ADYA 4K8ZA 1AJQA 4P3PA 1PNMA 3JYCA 2VWJA 5D5QA 1CP9A 2JS3A 2GDSA 3SPJA 3BA8A 4QJFB 1JMKC 4E4EA 3HKCA 2LJ2A 5IYDO 2QE7G 2Z0AA 4LF6O 2HR3A 2Q7GA 3B77A 3J81N 3SYAA 3ZN1A 2ITCC 5L3BA 3CXHF 1YTFB 5E3IA 1GM9A 4IYIA 3T1HO 2BOCC 1YJ9V 5LGUA 4P72C 5B1NA 2CH7A 4I9QA 4KQEA 2QM4A 3E86A 4RUEA 2C8MA 4RAIA 1K5SA 1BSMA 2ZT6A 3AG3B 1YXBA 2XOKG 3E2EA 2ARTA 4LFCO 1OCZB 4I55B 4FLXA 2QWOB 1NR1A 1YZBA 3GWKC 1B70B 4I50A 1H4SA 4EFBA 3HXUA 4TVAA 4KUMA 2GUZB 1VQ4V 5DM6V 1G5IA 5GONA 1XILA 4KFMA 3AG4B 1W66A 2XAGA 2YIAA 2EAYA 1XDCA 4G28B 4F6RA 1BS3A 1AJNA 4LVLA 1B8AA 4DR3B 4YRKA 1BL8A 2AHZA 4QE7A 2EIKB 4AH6A 3PZCA 1QF6A 3CRQA 3FFQA 2DKGA 2QWRB 2ZZGA 5LHIA 2EIMC 5CBHA 1HW7A 2ODRD 2OYQA 2WLHA 1THZA 4JI7O 3LDDA 1F7YA 2E5LB 2X0LA 2XAHA 4UCRA 2NLJC 2XAJA 1N36B 3I7FA 2ZZEA 5L3DA 3EVKA 4YPFA 1N32O 4RO2A 1M1KW 1SQFA 3V8KA 2PGGA 4WFEA 1XMQB 2Z5UA 1ZLZA 1PL4A 4JTCB 1RSOA 4PV1B 5CBFA 4O2AA 3KFUA 2AZ0A 3SGIA 3M99B 1FFXB 1HXDA 5IJ0A 1HR0O 1JJCB 2RHQA 4GCZA 2HP8A 5KX5A 1S3JA 2ZCEA 4YIOA 2XT9A 1QHTA 4TQDA 3J80N 3JAKA 4O2BA 5IY5B 3NXSA 2ZE5A 1PM9A 2JIZG 3DC6A 3OEEG 1QBZA 3OGIB 2Q5IA 1YFTA 2JJ2G 5BR8B 5LHHA 5BMVB 4GKJB 1N34O 4DUYB 2DZCA 1I0HA 1BQ0A 3T4ZA 2PYJA 4K8XA 1E79G 4NTXA 1ZL8A 3AG3C 3B40A 4C7UA 4GLXA 2OTJV 4XTUA 3WQZA 1MZEA 5LA6A 3LUTB 5EBLC 3W7TA 3W3SA 4HZ3A 1AR5A 2AMCB 2EZOA 2N04A 4DUZO 4NTYA 5F2VO 4DV7B 3MD0A 2R72A 2P22C 2UU9B 1OCOC 1XOUA 3MQZA 3AG4C 3HKDA 4JI4O 1K4CC 2IW5A 1JR9A 5EC1C 4X1YB 4JI1B 3S3WA 3PCOA 4H37A 2EIKC 4ZKIA 2CTRA 1ZX3A 4TV8A 1Q82W 3V7CA 1XNQB 1WU7A 4GKKB 4UV9A 4GX0A 3ZHVA 2B1GA 1AI5A 1GM7A 1EIYB 1M57B 4I9WA 4CS4A 1CEZA 4H44B 3ZMTA 4I5SA 1USYC 3FYEB 2XAFA 2ZM6B 4YRFA 1IXBA 2JGDA 1KP3A 3K9SA 2IH1C 3UT5B 4FLZA 4P3NA 3G6BA 4PA9A 4W4KA 4FLVA 3QO7A 2FKXA 4FK5C 3ZX6A 2QM7A 4WCEV 5K1XA 2DEQA 2E10A 1EN6A 4DW1A 5LGNA 1H2GA 1Q81W 3M4PA 4HNAA 4UCVA 3K58A 4BAYA 5BY1A 3QG5A 1P7BA 4HA8A 2C2AA 5D5PA 1TUBA 1IBKB 1SQGA 1KQSU 5JVDA 3SPIA 1WNLA 1E22A 1SS3A 3E89A 1HC7A 2UXCO 5KLVH 3BRCA 3UCSC 2B5UA 5IY5C 2UXDB 4R7CA 2P67A 1K8AW 1HWYA 3UO3A 5L3FA 4IGGA 4UP7A 2J3LA 4DV5O 2P06A 4PA6A 1H4QA 4X66B 1WQWA 2IU3A 4FFBB 1NQTA 3ABMB 2YSUB 2ZD9A 2BCCH 2UUAO 5IYZB 4DV3B 2OTLV 3RYHB 1BGYH 4XTXA 2DJZA 2AKWA 3CCRV 1DF5A 2EILB 3CCUV 3DC5A 1WQ7A 4LVIA 3A2FA 3IGAC 2DOSA 3ZRWA 4DV6O 3I5DA 5KA6A 1L0NH 1XNRO 1TVKA 2RCVA 3CRCA 4UP8A 4NB5A 4WFGA 4QNHB 3VQVA 2QKAA 4OP0A 4EO4A 2JK5C 2K9PA 4JI3O 1J5EB 1UFIA 3ZHUA 2HHHB 4J9ZB 3H1HH 5IYBO 4GX2A 4P3OA 4GX5A 2R9IA 4K0KO 4OX9B 5EYPB 2F4VO 1VQLV 3K5MA 1M57C 11ASA 4JAAA 1XEQA 4P74A 4U3JA 1Z5WA 3J7AU 2N05A 4RQEA 1G8MA 2F93B 3BVOA 2AHYA 2LGQA 3HFVA 4ZTUB 2JEUA 3E22B 5JWPA 4MVQA 4G27B 1YJNV 3KCYA 3SJBC 4TUYA 4B7EA 1G4YB 3RIRA 1M9NA 3ETDA 1KD1W 2GHYA 2P4VA 4FM0A 4JI6O 5DEDA 1YGBA 1YFRA 5JQGA 2IU0A 5LP6A 2W0XA 3L4GA 4X9QA 5ITZA 2WLNA 3K79A 4PA3A 1WAZA 1D2DA 5JH7B 4X1KA 4B3TO 2EJ7A 3LDCA 1AILA 1Y76A 5CA0A 3UQ8A 4EEQA 3AG1C 4W4LA 3Q4HB 4XTYA 3D36C 4XTZA 1HNZB 2EZPA 4O4HA 3TGUH 3CCQV 1LUWA 1X01A 1I94B 4NXMO 4PDMA 4JV5O 3ABMC 2ITDC 4RUFA 1K3EA 4K87A 5L3EA 2B1IA 3MDSA 4MTGA 2ILMA 5C93A 4B3RB 1SA0B 4JI0B 2EILC 4X5OA 2HJFC 2OIGA 4IIJA 5EZYB 3M4QA 4H2XB 2RHSB 4JYAO 3CYOA 1WJZA 1Z7MA 3D3QA 2YIBD 3C3SA 2YS8A 2ZR2A 1NTKH 3KKYA 4PA7A 1OCRB 3JALB 4FZ1A 1UPGA 2F43G 4YY3B 2HVKC 1FXKB 2XASA 3TXQA 1R6TA 1VQ5V 1FJGO 1RM1B 3F5WC 4ZOLB 1EZJA 4DR5B 4YRIA 4ZHQB 4KXRA 3OTFA 1IZ3A 3CEIA 2FB5A 2GTAA 3OW2U 1SRYA 2YEVB 3K9AA 3OGCC 2I4MA 4IT5A 1VQ6V 1WP8A 2CGOA 3CWBH 4MVOA 2CAZC 1XHXA 3AK3A 3JASA 4YHHB 1IBLO 4NVPA 4LVKA 4LCUC 4DR6B 1SZTA 3JD3A 5E1AC 4TSFG 4OPAA 1SKVA 1TA8A 4I55A 4HWPA 4DR1O 1B70A 1VQMV 3FB6C 4NXNO 2E5AA 3JCZA 3WG7B 2GUZA 2LW1A 1NVPD 3SYOA 4B3SO 4LFAO 4DPGA 4LF9O 3V8LA 3I55V 4LF4B 4XU2A 5CN0A 1N8RW 1D5NA 3LSQA 3B2EE 3C3TA 2F1MA 3NEMA 4BIZA 4DR2O 4LNUB 2CE4A 2Q8VA 4DV4B 2EJFA 3AK2A 3BAAA 5C52B 2JEXA 1N33B 1O9GA 4H0LB 3CJHB 1E1OA 1EM1A 2PUSA 3RT3C 4YRTA 2ODMA 1VQNV 3H01A 3RL6A 1D5AA 1S76D 3HFZA 1A32A 4HYOA 3ABTA 4HWSA 4LF6B 4YRCA 1YDXA 5LMNB 2UXXA 2CJ9A 3SPGA 1YJWV 1BZKA 1F4NA 5AG2A 3ZJZA 3T1HB 2WLIA 2UXBO 2I4NA 2E65A 4HWTA 1WNSA 2W0FC 4G85A 3CE2A 1GTOA 1FFXA 3LC0A 1OCRC 1VQKV 1RP3B 2QWNB 1JJCA 2UUBO 3JD0A 4DV1O 4LFCB 1FXKC 2QSAA 2AW9A 2RQ6A 1RM1C 2X6CA 4BIOA 2P5OA 1V54B 5B66Z 5BZBA 1FXVA 4JI8O 1H8EG 3ZHTA 4DK1A 3IKMB 4MTFA 2CUGA 2JDIG 1BMFG 2C7IA 3ZRVA 1AROP 1NNHA 4MTOA 1M5IA 1BHBA 3OD4A 3RBZA 5LMUO 4DR7O 4CC6A 2XTIA 1B7YB 4YCVA 3JD2A 2DU5A 1H2KA 2EBOA 2UUCO 1OJHA 2RJZA 3T1YB 2A79B 4LVJA 2AMCA 4MVSA 1KC8W 4TV9B 4AILC 3STLC 3OAAG 1MABG 2DYRB 4JI7B 4FVMA 3SR2C 4I4TB 4KR2A 4LF8B 4DV0B 1JCHA 5B1BC 4JI5O 2QHTA 2KG7A 1Z2GA 2MW2B 3K5OA 3H9VA 4X1YA 3IG2A 4KL1A 3P32A 4RWUA 2ZT7A 5EK0A 1IBMO 2JVDA 3JSNA 1N32B 1NJ1A 1FPOA 4CH4A 4QPJA 1ZUQA 3OM3B 1K33A 1DF4A 5JCOC 2ATKC 1NS1A 1MNGA 3FB5C 4FM2A 3SYCA 2PY5A 1ZSPA 1K73W 3UT5A 2IM9A 2YC0A 3VQXA 5K1PA 3K5LA 2Q68A 2ZIOA 1KKDA 4GZRB 1PYSB 2OCHA 1E24A 3A31A 3RYCB 3KG2A 4FLWA 2IH3C 3P8YA 4K88A 2ALYA 1N34B 4ASUG 5A2QN 3RVYA 1OCOB 2PI5A 1ZWIC 3HRKA 1MG1A 5KAFZ 4CS2A 4O4JB 4TOIA 1GAXA 3L70H 4NR1A 4DUZB 1KMNA 3E83A 5KHIA 3KCXA 1JA8A 4YROA 1ZAUA 1V9PA 1V54C 1XL4A 3K08A 4I0XB 3CPWU 2A9HA 3L72H 4ZTZB 1KMMA 2CIMA 3ABKB 1G6UA 1P4RA 2UXNA 2DJVA 3CRAA 1DGSA 5HGQA 1EFRG 2WLLB 2FYUH 3LSUA 3HKEB 4Z1VA 4P75C 4RQFA 1YTFD 4YCWA 4LH6A 2YXYA 2DYRC 3N2GB 3I56V 5C8YB 3VBBA 3GWOA 5HFLA 4CBCA 1I5XA 1NTZH 1QVGU 1F4MA 4X65O 3ZHQA 3F5TA 1GN6A 4ZBMA 2QDOA 5LBQA 2Q0AA 1U96A 1VQOV 1H2SB 3CC4V 5EYPA 3DGEA 4YRMA 2VRZA 3QO5A 2WWWA 4EFEA 3M7MX 1VIBA 5DN6G 4UFZA 1VF6C 4B3MO 2Q5ZA 4CH5A 2ODRC 5BXZA 3RYIB 4PELA 5IDJA 1WLEA 3E22A 2UXCB 2DMXA 4PDRA 1WA8A 2HFEC 1Q7YW 3A0RA 4KP4A 4X8AA 4UPAA 4P71C 2ZGWA 3TK1A 4MW3A 4IHJB 3A5YA 1YEWA 1BE3H 1F23A 4DV5B 3L74H 4YRSA 1N0NA 4WFBV 2WA3A 2KSDA 2A0LA 4MSWC 2RMKB 3VQWA 4WF2A 4HWOA 2WLMA 2UUAB 2Q73A 3BY6A 3MHHC 3CX5F 5FNVB 1QR8A 4FJCC 2ZT9B 1LNQA 4I7ZB 1BT8A 5JJEB 4FM1A 4DR4O 1GGMA 3QVNA 3KZIZ 3JATB 3W7UA 2HG5C 2ZDIC 2LW7A 3F7VC 4GYCB 3RYFB 5CA1B 4JPRA 3R65A 4XU3A 1VP7A 5LYJB 3UGQA 3DTUB 4DV6B 5J2UB 1SESA 4TVYA 1WP7A 3P8TA 1OZ0A 1EBOA 3ABKC 3CMQA 2QHSA 5KNNA 3UGTA 4R50A 4O4IB 4PJ0Z 4GUNA 2I4LA 3EHBB 1XREA 1YVWA 4BIUA 4UCOA 2OIEA 3JSLA 1XBLA 3HRIA 4D7SA 2DU7A 4NCXA 5IJ9B 1H2LA 1T5EA 1M90W 5KUMA 3HKBB 2Z3YA 1QLNA 4H2XA 3O9OA 2V1DA 2RHSA 3H1IH 4XTVA 1H38A 3BCCH 4CH6A 3SPCA 1J95A 2CH7B 3BA9A 3ZMVA 2M6YA 1KP2A 4P73C 2F95B 3K0DA 4FIPC 1X2HA 1S5LZ 3JALA
chains in the Genus database with same CATH topology
4RUFA 1K3EA 5H6QA 3L2ZA 5L3EA 3L4GB 3QTCA 4K87A 3VQVA 2IY5B 2B1IA 4EKWA 3K06A 1H8HG 1SETA 1SERA 1GKFA 1AI4A 4DQ2A 3LNMB 3AG1B 3G6EV 4WI1A 3P30A 3RVZA 4O2DA 4MTGA 5C93A 3BJUA 2ARUA 4Z1MG 3OMIB 2EILC 4P2ZA 3E9IA 2HJFC 4X5OA 4XTWA 1VQ8V 5ELNA 2YEVA 3M4QA 4XU0A 4YYEA 4H2XB 1VQPV 2RHSB 2Q67A 1M56C 3HFZB 3CYOA 4K86A 4JYBA 3LSSA 4XEMA 4HWRA 4MVMA 3CCJV 1RIQA 1Z7MA 3B8NA 3OUSA 4Q6GA 2WLJA 1TUEB 3MHSC 1E1TA 3A7RA 1K34A 1BBWA 1VQ7V 4FPPA 3RKWA 2ZR2A 1ASYA 1X56A 2EIMB 1GM8A 3TUPA 4PA7A 4XDKA 2NS6A 1OCRB 2WLIB 2J3MA 1WPXA 3EFSA 2P90A 3HTZA 2NNUA 2F43G 1FFTB 1MOFA 4YREA 2HVJC 1EFWA 1PNKA 2Y48A 2HVKC 1YHQV 1YIJV 2E41A 1S0VA 1FXKB 2XASA 3JD4A 1VQ5V 2Q69A 1RM1B 1MSWD 3F5WC 4YCUA 1EZJA 3UFGA 4YRIA 1K97A 2DTIA 3OW2U 2K1EA 1PL0A 3ASOB 3ZMUA 1NJ6A 1KOGA 1SRYA 4WFFA 1R73A 2YEVB 3K9AA 3OGCC 4WFHA 5KA5A 4JTAB 1VQ6V 2I4MA 3A7AA 4LVMA 1E1RG 4MVOA 3WG7C 4QE9A 4JAUA 1WYDA 5CBGA 3TETA 1L0WA 2IJKA 3DSQA 1G51A 2EJGA 2PMEA 4KR3A 1HTTA 3QO8A 4LVKA 2KB1A 4LCUC 2ARSA 1ADYA 3A5ZA 4H33A 4XEOA 1AJQA 1F51A 1SZTA 3JD3A 2CGHA 4P3PA 1PNMA 5E1AC 3JYCA 3OR7C 4TSFG 1QE0A 4YRPA 3NELA 3VOUA 4HWPA 3K3WA 1NR7A 1AJPA 1CP9A 1B70A 2ZNIA 4LBEC 3FB6C 1VQMV 4TWKA 2E5AA 1QLEB 3OUFA 3SPJA 5B1OA 3V7RA 4QJFB 3JCZA 2CK3G 5IYDO 2V7QG 2QE7G 3WG7B 1CPYA 2G4CA 2RHQB 3ABLC 1NVPD 4P72A 1OCZC 2HR3A 3B77A 3SYOA 3W7WA 2Q7GA 3TEHA 4DPGA 3SYAA 4XDLA 2OCCB 4JASA 3ZN1A 4JYCA 1ORQC 2ITCC 2LFRA 4GX1A 5L3BA 5E3IA 3SPHA 1YTFB 3I55V 3G1ZA 3V8LA 1GM9A 4XU2A 5CN0A 2BOCC 1YJ9V 1N8RW 3HY1A 5LGUA 4P72C 3LSQA 5EC2C 3A74A 5B1NA 2QHVA 1EVKA 3X2QB 4KQEA 3E86A 2P7TC 1H4TA 4RUEA 2C8MA 3NEMA 4RAIA 2E64A 4BIZA 1K5SA 1IXMA 2CJAA 3AG3B 1Q86W 2XOKG 2ZT6A 1NKDA 3CXCU 3E2EA 4WJ3M 4H2VA 2EJFA 2ZT5A 2ZQMA 3T2MA 2ARTA 3ZRSA 3OE7G 5C52B 2JEXA 4PDLA 3JD1A 1OCZB 4F4LA 3ZMSA 2WAMA 2IJJA 1NR1A 1B70B 2Q5HA 1E1OA 3WFVA 3MF1A 1V55B 2XNDG 1H4SA 3REXA 3HXUA 4TVAA 4TVWA 2EJRA 1RPOA 4YRTA 2E3CA 4KUMA 3CMEV 3REUA 2DVEA 1VQNV 4MVRA 3H01A 1JOYA 4EX5A 3RL6A 1PNLA 3W7XA 1VQ4V 4UVCA 5DM6V 1S76D 1G5IA 4U7NA 3HFZA 4BW9A 4KFMA 1JJ2U 3AG4B 1W66A 2XAGA 2EAYA 5ELOA 3TCUA 1I5YA 4G28B 4HYOA 3ABTA 1K9MW 1K4DC 4YXWG 4HWSA 3GB7C 1AJNA 4LVLA 1ASZA 1B8AA 1RPRA 4YRKA 1BL8A 3MEYA 4H2WA 4YRCA 3FB8C 5L3CA 1E1QG 2AHZA 4QE7A 1W2BU 2EIKB 4H2UA 4YRJA 3RACA 4AH6A 2UXXA 2CJ9A 3SPGA 1YJWV 3PZCA 3CCVV 1F4NA 4YP0A 1QF6A 3BEHA 2DKGA 3RUXA 5LGTA 3ZJZA 2PMFA 3HXXA 2WLIA 4XDJA 2ZZGA 5H6RA 5LHIA 4MW8A 5CA3A 2HNIA 2I4NA 2E65A 2R9RB 4HWTA 2W0FC 2HLDG 1FXKA 1Y66A 2EIMC 3OMAB 3ASNB 1B7YA 4G85A 1GTOA 5CBHA 3LC0A 2ODRD 4YRLA 1OCRC 2OT5A 2WLHA 1ENVA 3UKMA 1VQKV 1BHAA 1JJCA 2A8EA 2DTOA 4TVAB 4YDQA 1R3IC 1THZA 3G4SV 3LDDA 1J5WA 3JD0A 2ALYB 4YRNA 1YSCA 2FYKA 1C0AA 4JGSA 1FXKC 2X0LA 4MVUA 1RM1C 4J15A 2XAHA 2NLJC 1AI6A 2XAJA 1BIAA 2EWNA 2ZZEA 3I7FA 2X6CA 4ZIBA 5L3DA 3ASOC 3HB3B 3FB7C 4YPFA 1V54B 5BZBA 4Q20A 1FXVA 4RO2A 3NETA 4PG3A 4TTVA 1H8EG 1M1KW 3IKMB 5C53B 4MTFA 5EBMC 4MTXA 1QR9A 2JDIG 4UP9A 3V8KA 1BMFG 3QNEA 5LHGA 2C7IA 3ZRVA 4WFEA 1AROP 2EINB 2Z5UA 4YRRA 1NNHA 4MTOA 2BOBC 4JTCB 3NENA 5CBFA 1BHBA 3BFMA 3RBZA 2DXTA 4G84A 3KFUA 4LP8A 2XTIA 1B7YB 4YCVA 1W0KG 3JD2A 2DU5A 3M99B 1HXDA 3ETEA 2EBOA 5EBWC 2MK3A 3K0GA 1JJCB 2RHQA 4GCZA 1LYLA 2A79B 4LVJA 2AMCA 3T4DA 2ZNJA 1S3JA 2ZCEA 4MVSA 1QLEC 4XBFA 4TQDA 2FTKA 3HXZA 3AG2B 1OHHG 1KC8W 5IYCO 3STLC 3OAAG 1MABG 2DYRB 4QIWF 3NXSA 5IY5B 4E51A 3RKXA 4KR2A 2OCCC 2DWEC 3ABUA 2JIZG 3OEEG 1QBZA 1OCCB 4MT8A 2Q5IA 1JCHA 3V7SA 1YFTA 2JJ2G 5B1BC 4P9OA 1H4VB 2EJ9A 2QHTA 5LHHA 1NH2D 3HXWA 2ITDC 1K92A 2WLKA 2ZT8A 3IG2A 4P71A 3X2QC 3P32A 2DZCA 2ZT7A 1PYSA 5EK0A 1IL2A 3UH0A 1NJ1A 3T4ZA 1E79G 4CH4A 3AG3C 4PDVA 2OTJV 4XTUA 4QPJA 3OM3B 3CC7V 1DF4A 1K33A 1JPXA 3WQZA 3W3SA 2ATKC 1S5HC 3LUTB 5EBLC 4HZ3A 3W7TA 2PI4A 1NYRA 2AMCB 1R3LC 2EZOA 2ZZFA 3FB5C 1KECA 1V55C 4E2LA 3VQYA 3SYCA 5B1BB 3MD0A 4CS4A 4P9PA 1G5HA 1K73W 1OCOC 1N9WA 4G2KA 4YRGA 2AKWB 3VQXA 3T1CA 3MQZA 3AG4C 5K1PA 2Q68A 2ZIOA 3L1AA 1KKDA 2DYSC 1K4CC 2IW5A 5EC1C 3ZRXA 2ZXWC 3PCOA 1JQ0A 4H37A 4FMTA 2EIKC 3UM7A 5B1AB 3E9HA 1BIBA 4HAMA 3ETGA 1PYSB 3F7YC 4ZKIA 2DW4A 1E24A 2ZTGA 2LFSA 3RF1A 4HT4A 2JJ1G 3K03A 1Q82W 3A31A 3OD1A 3TEGA 1S72V 3KG2A 3V7CA 1USYA 2IH3C 3HPLC 1WU7A 3P8YA 4K88A 4CH3A 4UV9A 2ALYA 4GX0A 4ASUG 2W6JG 2B1GA 2WLLA 1AI5A 1GK9A 1GM7A 3ASNC 1OCOB 3RVYA 2GSMB 1M57B 3ML0A 4I9WA 4UVAA 2PI5A 1CEZA 1ZWIC 4R6ZA 1COWG 4P30A 3SYQA 3ZMTA 4UUJC 3HRKA 1MG1A 4I5SA 1USYC 3FYEB 2DXUA 2DYSB 2XAFA 4L87A 1YI2V 4H02A 5FL7G 1AR1B 4YRFA 4CS2A 1KP3A 1B76A 2IH1C 4JTDB 1PD3A 3CMAV 4P3NA 2ZXWB 1BBUA 1NBMG 1EIYB 1KMNA 4PA9A 3IALA 3E83A 4WJ4A 3QO7A 4FK5C 2QM7A 2H8PC 4WCEV 4YROA 2EL9A 2DEQA 5K1XA 2E10A 1V54C 1PKXA 3G71V 3PCOB 1XL4A 3R07A 2IJHA 3K08A 3K04A 4X88A 5LGNA 2QHUA 3HXVA 1H2GA 3SYPA 1Q81W 3M4PA 3CPWU 3ICAA 1X2GA 2A9HA 3CCLV 4P73A 2Q7EA 4ZTZB 5L3GA 2LP7A 1KMMA 2CIMA 3ABKB 4UXNA 2EINC 1NH2B 1P4RA 4P75A 2UXNA 4BAYA 4OLFA 4H2SA 5HGQA 1EFRG 1P7BA 2C2AA 2IJIA 2WLLB 4MS2A 3ERRA 4HA8A 3ZIAG 4QPKA 4PHCA 1DTOA 2EIJB 4N23A 3IKLA 3EFFK 3IC7A 3RW0A 5KUKA 4P75C 4RQFA 1KQSU 1ROPA 2P5IA 1X54A 2ZR3A 3SPIA 1WNLA 1E22A 3A32A 3E89A 1HC7A 1YTFD 3AG2C 3ZCCA 4YCWA 1NVPB 3V8JA 1W0JG 2DQ0A 4UV8A 2QKSA 1YITV 3MF2A 2B5UA 2DYRC 5IY5C 3I56V 4R7CA 3VBBA 2P67A 3GWOA 5HFLA 4CBCA 1DLBA 1K8AW 1OCCC 1HWYA 2QTOA 1I5XA 4JAVA 5J9PC 5L3FA 3RKYA 4JF3A 4DO2A 1NJIW 1S77D 1QVGU 1F4MA 1UJWB 2ZIMA 5B3SC 2J3LA 2ZINA 4UP7A 4TT3G 12ASA 4PA6A 1H4QA 3CCEV 1WQWA 2WPDG 3AEIA 3PJSK 4ZBMA 2IU3A 3OEHG 5LBQA 1NQTA 3ABMB 1B6QA 2YSUB 2ZD9A 2WSSG 1VQOV 3FJPA 3CC4V 1QVFU 4YRMA 3DGEA 5C51B 2DQ3A 4TWAA 3QO5A 2WWWA 1YB3A 2OTLV 1X55A 4DXWA 5DN6G 3HY0A 4XTXA 2DJZA 2AKWA 3CCRV 1DF5A 1QCEA 2XGTA 2QM8A 2EILB 1VQ9V 3CCUV 1K7DA 4CH5A 3E8FA 3STZC 1WQ7A 2ODRC 3EFRA 4XU1A 4LVIA 1M56B 5B3SB 3IGAC 4PA4A 3ZRWA 5IDJA 4PELA 1WLEA 4H2YA 2M7WA 5KA6A 4PDRA 3HXYA 4UP8A 3E8BA 4WFGA 2DZ9A 2HFEC 1Q7YW 3A0RA 4KP4A 4X8AA 4QNHB 1ATIA 4UPAA 2W6IG 2I4OA 2JK5C 2XAQA 4OP0A 4P71C 1ADJA 5B1AC 4H2TA 4EO4A 1EIYA 2ZGWA 2ZXFA 2QA4V 1Y4MA 2DDZA 4X89A 3TK1A 3E8HA 4MW3A 4J9ZB 5IYBO 4GX2A 4P3OA 4GX5A 3A5YA 2R9IA 1F23A 2X6AA 4YRSA 1EVLA 4BW5A 4WFBV 4HVCA 1FS0G 1VQLV 1Z7NA 4UVBA 2A0LA 1M57C 2ZDIA 3IFXA 4MSWC 4P74A 11ASA 4WF2A 3VQWA 4HWOA 2WLMA 1YFSA 3BY6A 3MHHC 3LDEA 1NYQA 2E1HA 1QR8A 4RQEA 4FJCC 1LNQA 2Y69C 1L1FA 1NJ2A 1G8MA 1GGMA 3B8MA 3ZRWB 3W7UA 3OR6C 2HG5C 2AHYA 2ZDIC 4U7OA 3F7VC 3HFVA 4P74C 4ZTUB 2JEUA 2Q7HA 3FKSG 4JPRA 4MVQA 3CCMV 3R65A 5GW7A 3CC2V 4TQFA 4XU3A 1R6NA 4G27B 1YJNV 2DWDC 3UGQA 3DTUB 1G4YB 3RIRA 2Q6AA 2CJBA 1M9NA 1JX9A 3ETDA 4OXSA 2GHYA 1KD1W 3D3IA 4MVZA 3CCSV 4LNSA 2DTHA 1SESA 4TVYA 3P8TA 1OZ0A 1JVMA 1EBOA 3ABKC 3ZMZA 1YGBA 1YFRA 2QHSA 3CMQA 1AI7A 4Q15A 2QEXV 3A7UA 3UGTA 5KNNA 4R50A 2IU0A 3RGLA 2Y69B 3FYIB 3SJQC 3L4GA 1R3JC 2X6BA 2IY5A 5H9CA 3ABLB 2I4LA 3EHBB 2WLNA 3OFNG 3K79A 2EIJC 3OMNB 3E35A 4PA3A 4J9YB 1GO3F 4BIUA 1FYFA 1NJ8A 4CS3A 3LDCA 3HRIA 2DU7A 4NCXA 4BWAA 4R8CA 1XL6A 5KUMA 5CMUA 3E8GA 2H94A 1M90W 1EOVA 3W7SA 2Z3YA 3D36A 1QLNA 4H2XA 4YRQA 2V1DA 2RHSA 3TEHB 4WFAV 3AG1C 1FXHA 4LC1A 1VQZA 4XTVA 5F5WA 4RDXA 1H38A 4GT1A 2P0LA 1R3KC 4WF9V 4XTYA 1GMGA 3ZN0A 1K5QA 2HKOA 4CH6A 3SPCA 4XTZA 1J95A 1R6KA 2EZPA 3CP1A 4CZZA 5HFMA 3CCQV 2D3OW 2X7RB 2P6JA 4N21A 3ZMVA 1NJ5A 4RMFA 1KP2A 4P73C 1WPYA 1X01A 3CD6V 3P8VA 3K0DA 4FIPC 1X2HA 4PDMA 1EQRA 3ABMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K87 A;  3L2Z A;  3L4G B;  3QTC A;  2IY5 B;  1SET A;  1SER A;  4DQ2 A;  4WI1 A;  4O2D A;  3BJU A;  2ARU A;  3E9I A;  4X5O A;  5ELN A;  4YYE A;  4XTW A;  4XU0 A;  3M4Q A;  4H2X B;  2RHS B;  3HFZ B;  4K86 A;  3LSS A;  4XEM A;  4HWR A;  1RIQ A;  1Z7M A;  4Q6G A;  1E1T A;  3A7R A;  1BBW A;  3RKW A;  2ZR2 A;  1ASY A;  1X56 A;  3TUP A;  2J3M A;  3EFS A;  3HTZ A;  4YRE A;  1EFW A;  2E41 A;  4YCU A;  3UFG A;  4YRI A;  2DTI A;  1NJ6 A;  1KOG A;  1SRY A;  2I4M A;  3A7A A;  1WYD A;  1L0W A;  3DSQ A;  1G51 A;  2EJG A;  2PME A;  4KR3 A;  1HTT A;  3QO8 A;  2ARS A;  1ADY A;  3A5Z A;  4XEO A;  2CGH A;  4P3P A;  1QE0 A;  4YRP A;  3NEL A;  4HWP A;  1B70 A;  2ZNI A;  2E5A A;  3V7R A;  2G4C A;  2RHQ B;  4P72 A;  2Q7G A;  3TEH A;  4DPG A;  5E3I A;  3V8L A;  3G1Z A;  4XU2 A;  3HY1 A;  4P72 C;  3LSQ A;  3A74 A;  2QHV A;  1EVK A;  4KQE A;  1H4T A;  3NEM A;  2C8M A;  2E64 A;  2ZT6 A;  2CJA A;  4WJ3 M;  4H2V A;  2EJF A;  2ZT5 A;  2ART A;  5C52 B;  1B70 B;  2Q5H A;  1E1O A;  1H4S A;  3MF1 A;  3REX A;  3HXU A;  4TVA A;  4TVW A;  4YRT A;  2E3C A;  3REU A;  2DVE A;  4EX5 A;  3RL6 A;  1G5I A;  4BW9 A;  3HFZ A;  1W66 A;  2EAY A;  5ELO A;  4HWS A;  1ASZ A;  1B8A A;  4YRK A;  3MEY A;  4H2W A;  4YRC A;  4H2U A;  3RAC A;  4YRJ A;  4AH6 A;  2CJ9 A;  3PZC A;  4YP0 A;  1QF6 A;  3RUX A;  2DKG A;  4E51 A;  3HXX A;  2PMF A;  2ZZG A;  2HNI A;  2I4N A;  2E65 A;  4HWT A;  1B7Y A;  4G85 A;  3LC0 A;  2ODR D;  4YRL A;  2DTO A;  1JJC A;  4TVA B;  4YDQ A;  1J5W A;  2ALY B;  4YRN A;  2FYK A;  1C0A A;  4J15 A;  1BIA A;  3I7F A;  2EWN A;  2ZZE A;  4ZIB A;  4YPF A;  3NET A;  4PG3 A;  4TTV A;  3IKM B;  5C53 B;  4UP9 A;  3V8K A;  3QNE A;  2C7I A;  4YRR A;  1NNH A;  3NEN A;  3BFM A;  2DXT A;  4G84 A;  3KFU A;  2XTI A;  1B7Y B;  4YCV A;  2DU5 A;  1HXD A;  1JJC B;  2RHQ A;  1LYL A;  2AMC A;  2ZNJ A;  2ZCE A;  4TQD A;  3HXZ A;  3RKX A;  4KR2 A;  2Q5I A;  3V7S A;  1YFT A;  1H4V B;  2EJ9 A;  2QHT A;  3HXW A;  2ZT8 A;  3IG2 A;  4P71 A;  2ZT7 A;  2DZC A;  1IL2 A;  1PYS A;  3UH0 A;  1NJ1 A;  4CH4 A;  4XTU A;  3WQZ A;  3W3S A;  1NYR A;  2AMC B;  2ZZF A;  3VQY A;  1G5H A;  1N9W A;  4YRG A;  2AKW B;  3VQX A;  5K1P A;  2ZIO A;  3L1A A;  3PCO A;  3E9H A;  1BIB A;  1PYS B;  2ZTG A;  3RF1 A;  1E24 A;  3A31 A;  3TEG A;  3OD1 A;  3V7C A;  1USY A;  1WU7 A;  3P8Y A;  4K88 A;  4CH3 A;  2ALY A;  1EIY B;  4CS4 A;  3HRK A;  1USY C;  2DXU A;  4H02 A;  4L87 A;  4CS2 A;  4YRF A;  1B76 A;  4P3N A;  1BBU A;  1KMN A;  3IAL A;  4WJ4 A;  3QO7 A;  4YRO A;  2EL9 A;  2DEQ A;  5K1X A;  2E10 A;  3PCO B;  3R07 A;  2QHU A;  3HXV A;  3M4P A;  2Q7E A;  3ICA A;  1X2G A;  4P73 A;  4ZTZ B;  1KMM A;  2CIM A;  4P75 A;  4OLF A;  4H2S A;  5HGQ A;  4HA8 A;  4PHC A;  3IKL A;  4P75 C;  4RQF A;  2P5I A;  1X54 A;  2ZR3 A;  1WNL A;  1E22 A;  3A32 A;  1HC7 A;  4YCW A;  2DQ0 A;  3MF2 A;  3VBB A;  3RKY A;  2ZIM A;  2ZIN A;  4UP7 A;  2J3L A;  12AS A;  1H4Q A;  1WQW A;  3FJP A;  5C51 B;  4YRM A;  2DQ3 A;  4TWA A;  3QO5 A;  1YB3 A;  1X55 A;  3HY0 A;  4XTX A;  2DJZ A;  2AKW A;  2XGT A;  4CH5 A;  1WQ7 A;  2ODR C;  3EFR A;  4XU1 A;  1WLE A;  4H2Y A;  3HXY A;  4UP8 A;  2DZ9 A;  4UPA A;  1ATI A;  3V8J A;  3VQV A;  2I4O A;  4OP0 A;  4P71 C;  4EO4 A;  1ADJ A;  4H2T A;  1EIY A;  2ZGW A;  2ZXF A;  2DDZ A;  4P3O A;  3A5Y A;  4YRS A;  1EVL A;  4HVC A;  1Z7N A;  11AS A;  4P74 A;  4WF2 A;  3VQW A;  4HWO A;  1YFS A;  1NYQ A;  2E1H A;  4RQE A;  1NJ2 A;  1GGM A;  4P74 C;  3HFV A;  4ZTU B;  2Q7H A;  4TQF A;  4XU3 A;  3UGQ A;  3RIR A;  2CJB A;  4LNS A;  2DTH A;  1SES A;  4TVY A;  3P8T A;  1YGB A;  1YFR A;  3CMQ A;  2QHS A;  4Q15 A;  5KNN A;  3A7U A;  3UGT A;  3RGL A;  3L4G A;  2IY5 A;  2I4L A;  1FYF A;  1NJ8 A;  4CS3 A;  3HRI A;  2DU7 A;  4NCX A;  4BWA A;  1EOV A;  4H2X A;  4YRQ A;  2RHS A;  3TEH B;  1VQZ A;  4XTV A;  5F5W A;  4RDX A;  2P0L A;  4XTY A;  4CH6 A;  4XTZ A;  3ERR A;  1NJ5 A;  4RMF A;  4P73 C;  1WPY A;  1X01 A;  3P8V A;  1X2H A;  1EQR A; 
#chains in the Genus database with same CATH topology
 3JAW A;  5H6Q A;  2NN4 A;  4JI6 B;  1SER A;  5DEC A;  4DQ2 A;  3AG1 B;  3P30 A;  3RVZ A;  3BJU A;  4ZHQ A;  2ARU A;  4P2Z A;  3E9I A;  4XTW A;  1VQ8 V;  2YEV A;  4XU0 A;  4DK0 A;  5GON B;  4JYB A;  4B3T B;  4MVM A;  4LWS A;  1XI1 A;  3OUS A;  4EB6 B;  4GKJ O;  3AK1 A;  2WLJ A;  1E1T A;  3A7R A;  1BBW A;  3RKW A;  2R70 A;  4YIP A;  3ZHS A;  3TUP A;  3B09 A;  1HNX O;  2AZ2 A;  3L9D A;  2J3M A;  3EFS A;  2P90 A;  4L8J A;  1MOF A;  1SC5 B;  3ZBH A;  2OWO A;  1S0V A;  3L75 H;  3JD4 A;  2VQE B;  2LQT A;  2CTW A;  4NXM B;  2Q69 A;  4YCU A;  3UFG A;  4JV5 B;  2DTI A;  3CHX A;  1PL0 A;  1TAE A;  3ASO B;  1NJ6 A;  1KOG A;  4WFF A;  4WFH A;  4JTA B;  1E1R G;  1URF A;  3DSQ A;  5J2T A;  1G51 A;  2EJG A;  2BTQ B;  3QO8 A;  1KU9 A;  4JYA B;  4XEO A;  4LNU A;  1QE0 A;  4YRP A;  1KYO F;  1ZTE A;  3OR7 C;  3K3W A;  1NR7 A;  1RSO B;  4LBE C;  4O2A B;  4TWK A;  1QLE B;  3OUF A;  5B1O A;  3V7R A;  1IX9 A;  2ZM6 O;  2G4C A;  1CPY A;  4J80 A;  2RHQ B;  4P72 A;  3W7W A;  4LH7 A;  3TEH A;  2OCC B;  4JYC A;  2ZE7 A;  3G1Z A;  1B06 A;  1FJG B;  1H2N A;  3HY1 A;  4J41 A;  5EC2 C;  3A74 A;  2QHV A;  3N2K B;  4X20 B;  1TGO A;  2G38 A;  3OTO O;  2E64 A;  2CJA A;  1Q86 W;  3CXC U;  1AVM A;  4WJ3 M;  4H2V A;  4WBN A;  2ZT5 A;  2ZQM A;  3T2M A;  1O9H A;  4F6E A;  3OE7 G;  2YDE A;  4H13 B;  3JD1 A;  1Y6X A;  3ZMS A;  2Q5H A;  3CME V;  3REU A;  4EX5 A;  4ABM A;  3U0Z A;  4NXN B;  2GBO A;  3RGB A;  5ELO A;  5LL6 Y;  2UXD O;  1K4D C;  1ASZ A;  2Y4U A;  4O4L B;  4YJ2 B;  5JJN B;  2YI9 A;  1Q6I A;  4H2W A;  4OGQ B;  4B3S B;  3RAC A;  1W2B U;  4YRJ A;  5CB4 A;  4LF9 B;  4YP0 A;  3RUX A;  2PMF A;  1GH6 A;  4MW8 A;  3GVM A;  3D8C A;  2R9R B;  1B7Y A;  5IT9 N;  4TV8 B;  2OT5 A;  3UKM A;  4DR2 B;  2DTO A;  4YDQ A;  2A8E A;  1R3I C;  3G4S V;  1R1B A;  4YRN A;  2FYK A;  1C0A A;  4J15 A;  1AI6 A;  4KHP O;  4ZIB A;  3SDL A;  2JGD B;  3ASO C;  3HB3 B;  1US6 A;  3FD9 A;  4Q20 A;  4D7T A;  4YJ3 A;  4PG3 A;  5EBM C;  4MTX A;  1QR9 A;  1U97 A;  1HDJ A;  2EIN B;  1J5E O;  4YRR A;  3NEN A;  3BFM A;  2DXT A;  4G84 A;  4LP8 A;  4QGP A;  1W0K G;  4LFB O;  4OX9 O;  4HNA B;  3K0G A;  4X64 O;  2UXB B;  2ZNJ A;  4XBF A;  1QLE C;  5FLX N;  3APQ A;  3HXZ A;  1OHH G;  1X4T A;  2BTO A;  5IYC O;  2UUB B;  1KKC A;  4J10 A;  4QIW F;  5KHJ A;  3RKX A;  2OCC C;  3THO A;  3ABU A;  2ZE8 A;  4ZI7 B;  2VS0 A;  1H4V B;  3HXW A;  1NH2 D;  3APO A;  1M4U A;  2Q4P A;  5TIS Z;  2ZT8 A;  4P71 A;  2AXT Z;  4IYH A;  2QJ1 A;  1PYS A;  4D6T H;  3RYC A;  1S5J A;  5IE9 A;  1GRJ A;  3B4S A;  5EIB D;  4CC5 A;  4LF7 O;  3K57 A;  1R3L C;  4FLY A;  1PV0 A;  1KEC A;  2L6L A;  4PHZ A;  4E2L A;  3VQY A;  1YCI A;  1RFY A;  4OPH A;  5B1B B;  1HNW O;  4P9P A;  1JFF B;  1N9W A;  4JI2 O;  4YRG A;  3JAR B;  2AKW B;  3PN1 A;  3L1A A;  2DYS C;  1MSD A;  2H3O A;  2PF4 E;  2ZXW C;  1Q90 D;  3RN4 A;  2XUM A;  5B1A B;  4HAM A;  3ETG A;  2DW4 A;  2LFS A;  4JI5 B;  1VF5 B;  3OD1 A;  1USY A;  3HPL C;  1B3Q A;  1QNM A;  2YXL A;  5KHH A;  2WLL A;  5IWA O;  2GSM B;  3OT7 A;  3ML0 A;  3C90 A;  4P30 A;  4FFK A;  2N74 A;  1XMO O;  4H02 A;  4L87 A;  1IVS A;  1B76 A;  3CMA V;  4JI0 O;  1PD3 A;  1BBU A;  1NBM G;  1NI8 A;  1G1X B;  3CB2 A;  4JYY A;  3RFR A;  3N2G A;  3L73 H;  3MAQ A;  5C8Y A;  2H8P C;  1WB8 A;  1CXZ B;  1PKX A;  3HXV A;  3ICA A;  3CCL V;  4P73 A;  4K3A A;  1WB7 A;  2LP7 A;  5L3G A;  4UXN A;  2EIN C;  3L71 H;  4OLF A;  4H2S A;  1XQ8 A;  3O65 A;  4QPK A;  4PHC A;  1DTO A;  3FAV B;  5JQG B;  3IKL A;  3RW0 A;  2P5I A;  1ROP A;  5LP6 B;  2ZR3 A;  1X54 A;  5ITZ B;  1W0J G;  2DQ0 A;  4UV8 A;  1B04 A;  2QKS A;  1P7G A;  5BMV A;  1SF9 A;  4X1K B;  1DLB A;  1Y76 B;  2EX3 A;  4JAV A;  3RKY A;  4JF3 A;  1NJI W;  1S77 D;  2ZIM A;  5B3S C;  1SZX A;  3ZS8 C;  3CCE V;  2WPD G;  4AQY O;  3PJS K;  1B6Q A;  4X62 O;  3FJP A;  1QVF U;  5C51 B;  4TWA A;  1X55 A;  4DXW A;  3HY0 A;  2RNB A;  3TJT A;  1QCE A;  2QM8 A;  1VQ9 V;  1K7D A;  5FNV A;  2CTQ A;  3EFR A;  1M56 B;  1NU1 H;  4PA4 A;  3P3N A;  2M7W A;  4IIJ B;  2A3Q A;  1WN7 A;  3HXY A;  2DZ9 A;  1ATI A;  3V8J A;  4DV4 O;  1ADJ A;  5B1A C;  3JAM N;  4H2T A;  2JRI A;  2R9A A;  5J2U A;  1EIY A;  2QA4 V;  4BR6 A;  2VQF O;  4X65 B;  1EVL A;  4HVC A;  1HR0 B;  1Z7N A;  4UVB A;  4O4I A;  3IFX A;  2QKC A;  1BQZ A;  1YFS A;  3R66 A;  3LDE A;  1NTM H;  2E1H A;  1MMM A;  1PP9 H;  2Y69 C;  5IJ9 A;  1XUQ A;  3HKB A;  3B8M A;  3OR6 C;  4U7O A;  4P74 C;  2ADP A;  4A5U B;  2Q7H A;  4B3M B;  5LMN O;  3CC2 V;  4X1I B;  3CCM V;  4TQF A;  1R6N A;  3JAS B;  2F66 C;  4LR3 A;  1OV9 A;  2BSK B;  2Q6A A;  4OXS A;  3D3I A;  3CCS V;  2DTH A;  4NYK A;  3ZMZ A;  5KMG B;  5JJJ B;  1AI7 A;  2QEX V;  3A7U A;  3RGL A;  1R3J C;  2X6B A;  5H9C A;  3ABL B;  3RWR D;  1KMI Z;  3OFN G;  5E79 Z;  2YID A;  1FYF A;  4J9Y B;  1NJ8 A;  4CS3 A;  5LP6 C;  4BWA A;  5CMU A;  5H5N A;  3H1L H;  4DRX B;  3D36 A;  4YRQ A;  1FXH A;  4JI4 B;  2CDY A;  4J11 A;  3K59 A;  3DXR B;  4DR4 B;  4EB6 A;  4DV2 O;  2E75 B;  4FFB A;  1R6K A;  4CZZ A;  5HFM A;  3ERR A;  4RMF A;  2X7R B;  2P6J A;  2ZE6 A;  1Y74 B;  5IYZ A;  1WPY A;  2A7W A;  3CD6 V;  3RYH A;  1QQC A;  4Z1M G;  3T1Y O;  1GN3 A;  3L2Z A;  1AP5 A;  1EN4 A;  3QTC A;  2IY5 B;  4EKW A;  3K06 A;  1SET A;  4HBN A;  2KQX A;  1GKF A;  3G6E V;  4O2D A;  2WA4 A;  5LXT B;  2YUA A;  2PYL A;  5ELN A;  1Q5O A;  4LF5 O;  4YYE A;  4LF8 O;  1SQX H;  4U3F H;  4DV0 O;  1FD9 A;  1VQP V;  2Q67 A;  1M56 C;  3HFZ B;  4K86 A;  2YIC A;  4XEM A;  3WB2 A;  5KAI Z;  4HWR A;  1RIQ A;  4Q6G A;  3B8N A;  4J42 A;  1JJO A;  1TUE B;  2BTQ A;  3ZED A;  1W59 A;  1ASY A;  2O57 A;  1X56 A;  1GM8 A;  4XDK A;  2RDC A;  2WLI B;  1WPX A;  3H1K H;  1Q8I A;  2NNU A;  1FFT B;  3BFR A;  4YRE A;  2Y4T A;  1PNK A;  1YIJ V;  1IDS A;  1KUQ A;  1MSW D;  3IC9 A;  1K97 A;  1P84 F;  2K1E A;  3ZMU A;  2FL4 A;  5FPO A;  5KA5 A;  1P49 A;  3A7A A;  4PI0 A;  4LVM A;  4UCT A;  4QE9 A;  4JAU A;  5CBG A;  1AB3 A;  3N2K A;  4X20 A;  1HTT A;  4JZ2 A;  3A5Z A;  4H33 A;  1X59 A;  1F51 A;  2PTM A;  2CGH A;  3CRM A;  3UO2 A;  3NEL A;  3IAY A;  3VOU A;  1AJP A;  2YIB A;  2ZNI A;  5JH7 A;  2XTA A;  1HNX B;  2CK3 G;  2V7Q G;  5LOV B;  3ABL C;  1XHZ A;  1OCZ C;  1VMG A;  4DR3 O;  4XDL A;  4JAS A;  5KHG A;  4J7J A;  1ORQ C;  2LFR A;  4GX1 A;  3TXS A;  3SPH A;  1EZV H;  2DE0 X;  3Q4H A;  4O4L A;  4YJ2 A;  3K5N A;  1EVK A;  3X2Q B;  2P7T C;  1XNR B;  1H4T A;  3ICX A;  2KG7 B;  1IXM A;  3WB1 A;  1NKD A;  4JI3 B;  2E5L O;  3ZRS A;  4PDL A;  4F4L A;  2E74 B;  2PZS A;  2WAM A;  2IJJ A;  4K0K B;  3ETQ A;  3WFV A;  2F4V B;  1V55 B;  2XND G;  3MF1 A;  3REX A;  1N36 O;  2Q0O C;  1Q43 A;  1RPO A;  2EJR A;  1SA0 A;  2E3C A;  3HKC B;  4TVW A;  2DVE A;  1JOY A;  4MVR A;  2Y0I A;  1PNL A;  5EZY A;  3W7X A;  2YI8 A;  4UVC A;  3H1J H;  4U7N A;  4BW9 A;  2Y0P A;  1JJ2 U;  2HEP A;  3TCU A;  1I5Y A;  2XHB A;  1K9M W;  4YXW G;  3GB7 C;  1RPR A;  1XMQ O;  3MEY A;  3FB8 C;  5L3C A;  1E1Q G;  4H2U A;  1KBH A;  3CCV V;  4E51 A;  5LGT A;  3HXX A;  4XDJ A;  5H6R A;  2KKW A;  5CA3 A;  2HNI A;  3BPZ A;  1PPJ H;  5H2F Z;  2HLD G;  1FXK A;  1Y66 A;  2YXH A;  3OMA B;  3ASN B;  3OTO B;  4I50 B;  4YRL A;  3JCU Z;  1BHA A;  1ENV A;  4ZOL A;  4TVA B;  4K35 A;  1J5W A;  2ALY B;  1YSC A;  4JGS A;  1KB9 F;  4J7Z A;  4PD4 F;  4MVU A;  3WU2 Z;  5BR8 O;  1BIA A;  2EWN A;  3U11 A;  4F6R B;  4DUY O;  3FB7 C;  4ZI7 A;  4UCU A;  5GTH Z;  3NET A;  4TTV A;  5C53 B;  3U10 A;  4UP9 A;  3QNE A;  5LHG A;  2BOB C;  4PI2 A;  2HJD A;  1I7F A;  4AHC A;  3ETE A;  5EBW C;  2MK3 A;  4DV7 O;  3P3P A;  2UU9 O;  1LYL A;  3T4D A;  3CS5 A;  2FTK A;  3AG2 B;  1GN4 A;  3EXA A;  1LUV A;  1JFF A;  4JI1 O;  2IBZ H;  3JAR A;  2DWE C;  1OCC B;  4MT8 A;  3V7S A;  2EJ9 A;  4P9O A;  4KHP B;  1K92 A;  2WLK A;  1XNQ O;  4GKK O;  3SJC C;  4ICG A;  3X2Q C;  5JCO A;  1IL2 A;  4B7K A;  2CTP A;  1GN2 A;  3UH0 A;  1MZF A;  3CJH A;  1IUR A;  4PDV A;  3A0H Z;  5IJ0 B;  3CC7 V;  1JPX A;  1S5H C;  1NYR A;  2PI4 A;  5KX5 B;  2ZZF A;  1V55 C;  3G80 A;  4LFB B;  5A9G A;  4X64 B;  1VAR A;  1G5H A;  3JAK B;  4O2B B;  3BHP A;  4G2K A;  3T1C A;  2JS5 A;  1SQP H;  3QF7 A;  2GTS A;  3ZRX A;  1VEW A;  2D2C B;  1JQ0 A;  1IBL B;  4FMT A;  2CGN A;  3UM7 A;  3E9H A;  1BIB A;  1Q6H A;  3F7Y C;  2ZTG A;  3RF1 A;  4HT4 A;  2JJ1 G;  3K03 A;  1WA8 B;  1ZL8 B;  1FAF A;  3TEG A;  1IBK O;  1S72 V;  4CH3 A;  2W6J G;  5LA6 B;  4WFA V;  1GK9 A;  1SQQ H;  3ASN C;  4DR1 B;  4UVA A;  4R6Z A;  1COW G;  3SYQ A;  3N27 A;  4UUJ C;  3FAV A;  1H2M A;  2DXU A;  2DYS B;  1YI2 V;  2VWK A;  5FL7 G;  1AR1 B;  4JTD B;  4LF7 B;  2ZXW B;  4LFA B;  3HKD B;  3IAL A;  4WJ4 A;  1HNW B;  4FLU A;  2EL9 A;  4X66 O;  4JI2 B;  1VF7 A;  1SQB H;  1QU7 A;  3G71 V;  3PCO B;  3R07 A;  2IJH A;  3K04 A;  4X88 A;  2QHU A;  1L0L H;  2NR5 A;  3SYP A;  2Q7E A;  1X2G A;  4DV3 O;  1NH2 B;  1N4C A;  4P75 A;  2EUL A;  2IJI A;  4IL6 Z;  4MS2 A;  2ARH A;  3ZIA G;  2VQE O;  4TV9 A;  4J7K A;  2EIJ B;  3CRR A;  4N23 A;  3EFF K;  3IC7 A;  5KUK A;  4I4T A;  3A32 A;  5IWA B;  3AG2 C;  3ZCC A;  1NVP B;  1YIT V;  1NT2 B;  3MF2 A;  1XMO B;  1OCC C;  4FLT A;  2HHH O;  1BCC H;  2QTO A;  5J9P C;  4DO2 A;  2ZIN A;  1UJW B;  4TT3 G;  12AS A;  2BE3 A;  3AEI A;  2QTS A;  3OEH G;  1VF6 A;  3LNN A;  2WSS G;  1EN5 A;  2DQ3 A;  1N0J A;  1TUB B;  1YB3 A;  2QR4 A;  4DV1 B;  5JVD B;  3JAW B;  2XGT A;  3E8F A;  3STZ C;  1FYJ A;  4XU1 A;  4NTW A;  5B3S B;  1MA1 A;  4H2Y A;  2F23 A;  4X1I A;  4JI8 B;  2LO1 A;  1HP8 A;  4NKG B;  3E8B A;  1YF2 A;  2BSK A;  1WPB A;  2W6I G;  2XAQ A;  4LWS B;  2I4O A;  2L35 A;  2ZXF A;  1Y4M A;  2DDZ A;  4X89 A;  3E8H A;  1DK1 A;  4DR7 B;  5LMU B;  2DN9 A;  2X6A A;  5KMG A;  3CSX A;  2UUC B;  4BW5 A;  4O4J A;  1FS0 G;  2GV9 A;  3FX7 A;  4AQY B;  2ZDI A;  2Q9L A;  3SJA C;  4X62 B;  5KHK A;  2RN9 A;  1NYQ A;  3A8T A;  1NJ2 A;  1L1F A;  3ZRW B;  2QGN A;  3M8A A;  4DRX A;  1HNZ O;  4I0X A;  3FKS G;  5GW7 A;  1TVK B;  1I94 O;  3DXR A;  2DWD C;  1M93 A;  4FZ0 A;  2CJB A;  1JX9 A;  5J2T B;  1IBM B;  4MVZ A;  4LNS A;  1Y74 A;  2ETN A;  1SQV H;  5B5E Z;  1JVM A;  3HKE A;  4Q15 A;  3BAB A;  4B3R O;  2Y69 B;  3FYI B;  3SJQ C;  3A0B Z;  2IY5 A;  4U3J B;  2VQF B;  2EIJ C;  3OMN B;  3E35 A;  1GO3 F;  3S3X A;  5LXT A;  1Y67 A;  4R8C A;  1XL6 A;  3WB0 A;  3G67 A;  3E8G A;  2H94 A;  4DYL A;  5EIB C;  1EOV A;  3W7S A;  2FML A;  3TEH B;  4LC1 A;  1VQZ A;  4UCS A;  5F5W A;  1NZ6 A;  4RDX A;  2P0L A;  4GT1 A;  1R3K C;  4TUY B;  4WF9 V;  1GMG A;  1LR1 A;  3ZN0 A;  1K5Q A;  2HKO A;  4YY3 O;  3CP1 A;  4JZG A;  1NJ5 A;  2D3O W;  2A06 H;  4N21 A;  4DW0 A;  2LGW A;  3HR0 A;  1Z5V A;  2V4D A;  3P8V A;  4UB6 Z;  4DR5 O;  2QWP B;  1EQR A;  4WBN B;  3BEH A;  3L4G B;  3IJ4 A;  1H8H G;  4Z2W A;  1AI4 A;  3LNM B;  4WI1 A;  4AI8 A;  4YHH O;  3RYI A;  1I08 A;  5CA0 B;  3OMI B;  2ADQ B;  2AGA A;  3LSS A;  4DR6 O;  3NR7 A;  2E76 B;  3CCJ V;  3MHS C;  4IHJ A;  4O4H B;  1K34 A;  2JGU A;  1VQ7 V;  4FPP A;  4B08 A;  5CB4 B;  2EIM B;  2NS6 A;  4DV2 B;  3HTZ A;  5GTI Z;  2HVJ C;  1Q3E A;  1Q6U A;  2Y48 A;  3AG7 A;  2E41 A;  1YHQ V;  1EFW A;  4LF4 O;  5LOV A;  1FKA O;  2ZKO A;  3JAT A;  3RYF A;  5CA1 A;  2B9Z A;  1R73 A;  3ZHR A;  1AP6 A;  2QWQ B;  4UB8 Z;  5LYJ A;  3WG7 C;  2P4K A;  1L8D A;  5FPR A;  3TET A;  1WYD A;  1L0W A;  2IJK A;  2PME A;  4LF5 B;  1AR4 A;  4KR3 A;  2KB1 A;  2ARS A;  1N33 O;  4YJ3 B;  1ADY A;  4K8Z A;  1AJQ A;  4P3P A;  1PNM A;  3JYC A;  2VWJ A;  5D5Q A;  1CP9 A;  2JS3 A;  2GDS A;  3SPJ A;  3BA8 A;  4QJF B;  1JMK C;  4E4E A;  3HKC A;  2LJ2 A;  5IYD O;  2QE7 G;  2Z0A A;  4LF6 O;  2HR3 A;  2Q7G A;  3B77 A;  3J81 N;  3SYA A;  3ZN1 A;  2ITC C;  5L3B A;  3CXH F;  1YTF B;  5E3I A;  1GM9 A;  4IYI A;  3T1H O;  2BOC C;  1YJ9 V;  5LGU A;  4P72 C;  5B1N A;  2CH7 A;  4I9Q A;  4KQE A;  2QM4 A;  3E86 A;  4RUE A;  2C8M A;  4RAI A;  1K5S A;  1BSM A;  2ZT6 A;  3AG3 B;  1YXB A;  2XOK G;  3E2E A;  2ART A;  4LFC O;  1OCZ B;  4I55 B;  4FLX A;  2QWO B;  1NR1 A;  1YZB A;  3GWK C;  1B70 B;  4I50 A;  1H4S A;  4EFB A;  3HXU A;  4TVA A;  4KUM A;  2GUZ B;  1VQ4 V;  5DM6 V;  1G5I A;  5GON A;  1XIL A;  4KFM A;  3AG4 B;  1W66 A;  2XAG A;  2YIA A;  2EAY A;  1XDC A;  4G28 B;  4F6R A;  1BS3 A;  1AJN A;  4LVL A;  1B8A A;  4DR3 B;  4YRK A;  1BL8 A;  2AHZ A;  4QE7 A;  2EIK B;  4AH6 A;  3PZC A;  1QF6 A;  3CRQ A;  3FFQ A;  2DKG A;  2QWR B;  2ZZG A;  5LHI A;  2EIM C;  5CBH A;  1HW7 A;  2ODR D;  2OYQ A;  2WLH A;  1THZ A;  4JI7 O;  3LDD A;  1F7Y A;  2E5L B;  2X0L A;  2XAH A;  4UCR A;  2NLJ C;  2XAJ A;  1N36 B;  3I7F A;  2ZZE A;  5L3D A;  3EVK A;  4YPF A;  1N32 O;  4RO2 A;  1M1K W;  1SQF A;  3V8K A;  2PGG A;  4WFE A;  1XMQ B;  2Z5U A;  1ZLZ A;  1PL4 A;  4JTC B;  1RSO A;  4PV1 B;  5CBF A;  4O2A A;  3KFU A;  2AZ0 A;  3SGI A;  3M99 B;  1FFX B;  1HXD A;  5IJ0 A;  1HR0 O;  1JJC B;  2RHQ A;  4GCZ A;  2HP8 A;  5KX5 A;  1S3J A;  2ZCE A;  4YIO A;  2XT9 A;  1QHT A;  4TQD A;  3J80 N;  3JAK A;  4O2B A;  5IY5 B;  3NXS A;  2ZE5 A;  1PM9 A;  2JIZ G;  3DC6 A;  3OEE G;  1QBZ A;  3OGI B;  2Q5I A;  1YFT A;  2JJ2 G;  5BR8 B;  5LHH A;  5BMV B;  4GKJ B;  1N34 O;  4DUY B;  2DZC A;  1I0H A;  1BQ0 A;  3T4Z A;  2PYJ A;  4K8X A;  1E79 G;  4NTX A;  1ZL8 A;  3AG3 C;  3B40 A;  4C7U A;  4GLX A;  2OTJ V;  4XTU A;  3WQZ A;  1MZE A;  5LA6 A;  3LUT B;  5EBL C;  3W7T A;  3W3S A;  4HZ3 A;  1AR5 A;  2AMC B;  2EZO A;  2N04 A;  4DUZ O;  4NTY A;  5F2V O;  4DV7 B;  3MD0 A;  2R72 A;  2P22 C;  2UU9 B;  1OCO C;  1XOU A;  3MQZ A;  3AG4 C;  3HKD A;  4JI4 O;  1K4C C;  2IW5 A;  1JR9 A;  5EC1 C;  4X1Y B;  4JI1 B;  3S3W A;  3PCO A;  4H37 A;  2EIK C;  4ZKI A;  2CTR A;  1ZX3 A;  4TV8 A;  1Q82 W;  3V7C A;  1XNQ B;  1WU7 A;  4GKK B;  4UV9 A;  4GX0 A;  3ZHV A;  2B1G A;  1AI5 A;  1GM7 A;  1EIY B;  1M57 B;  4I9W A;  4CS4 A;  1CEZ A;  4H44 B;  3ZMT A;  4I5S A;  1USY C;  3FYE B;  2XAF A;  2ZM6 B;  4YRF A;  1IXB A;  2JGD A;  1KP3 A;  3K9S A;  2IH1 C;  3UT5 B;  4FLZ A;  4P3N A;  3G6B A;  4PA9 A;  4W4K A;  4FLV A;  3QO7 A;  2FKX A;  4FK5 C;  3ZX6 A;  2QM7 A;  4WCE V;  5K1X A;  2DEQ A;  2E10 A;  1EN6 A;  4DW1 A;  5LGN A;  1H2G A;  1Q81 W;  3M4P A;  4HNA A;  4UCV A;  3K58 A;  4BAY A;  5BY1 A;  3QG5 A;  1P7B A;  4HA8 A;  2C2A A;  5D5P A;  1TUB A;  1IBK B;  1SQG A;  1KQS U;  5JVD A;  3SPI A;  1WNL A;  1E22 A;  1SS3 A;  3E89 A;  1HC7 A;  2UXC O;  5KLV H;  3BRC A;  3UCS C;  2B5U A;  5IY5 C;  2UXD B;  4R7C A;  2P67 A;  1K8A W;  1HWY A;  3UO3 A;  5L3F A;  4IGG A;  4UP7 A;  2J3L A;  4DV5 O;  2P06 A;  4PA6 A;  1H4Q A;  4X66 B;  1WQW A;  2IU3 A;  4FFB B;  1NQT A;  3ABM B;  2YSU B;  2ZD9 A;  2BCC H;  2UUA O;  5IYZ B;  4DV3 B;  2OTL V;  3RYH B;  1BGY H;  4XTX A;  2DJZ A;  2AKW A;  3CCR V;  1DF5 A;  2EIL B;  3CCU V;  3DC5 A;  1WQ7 A;  4LVI A;  3A2F A;  3IGA C;  2DOS A;  3ZRW A;  4DV6 O;  3I5D A;  5KA6 A;  1L0N H;  1XNR O;  1TVK A;  2RCV A;  3CRC A;  4UP8 A;  4NB5 A;  4WFG A;  4QNH B;  3VQV A;  2QKA A;  4OP0 A;  4EO4 A;  2JK5 C;  2K9P A;  4JI3 O;  1J5E B;  1UFI A;  3ZHU A;  2HHH B;  4J9Z B;  3H1H H;  5IYB O;  4GX2 A;  4P3O A;  4GX5 A;  2R9I A;  4K0K O;  4OX9 B;  5EYP B;  2F4V O;  1VQL V;  3K5M A;  1M57 C;  11AS A;  4JAA A;  1XEQ A;  4P74 A;  4U3J A;  1Z5W A;  3J7A U;  2N05 A;  4RQE A;  1G8M A;  2F93 B;  3BVO A;  2AHY A;  2LGQ A;  3HFV A;  4ZTU B;  2JEU A;  3E22 B;  5JWP A;  4MVQ A;  4G27 B;  1YJN V;  3KCY A;  3SJB C;  4TUY A;  4B7E A;  1G4Y B;  3RIR A;  1M9N A;  3ETD A;  1KD1 W;  2GHY A;  2P4V A;  4FM0 A;  4JI6 O;  5DED A;  1YGB A;  1YFR A;  5JQG A;  2IU0 A;  5LP6 A;  2W0X A;  3L4G A;  4X9Q A;  5ITZ A;  2WLN A;  3K79 A;  4PA3 A;  1WAZ A;  1D2D A;  5JH7 B;  4X1K A;  4B3T O;  2EJ7 A;  3LDC A;  1AIL A;  1Y76 A;  5CA0 A;  3UQ8 A;  4EEQ A;  3AG1 C;  4W4L A;  3Q4H B;  4XTY A;  3D36 C;  4XTZ A;  1HNZ B;  2EZP A;  4O4H A;  3TGU H;  3CCQ V;  1LUW A;  1X01 A;  1I94 B;  4NXM O;  4PDM A;  4JV5 O;  3ABM C;  2ITD C;  4RUF A;  1K3E A;  4K87 A;  5L3E A;  2B1I A;  3MDS A;  4MTG A;  2ILM A;  5C93 A;  4B3R B;  1SA0 B;  4JI0 B;  2EIL C;  4X5O A;  2HJF C;  2OIG A;  4IIJ A;  5EZY B;  3M4Q A;  4H2X B;  2RHS B;  4JYA O;  3CYO A;  1WJZ A;  1Z7M A;  3D3Q A;  2YIB D;  3C3S A;  2YS8 A;  2ZR2 A;  1NTK H;  3KKY A;  4PA7 A;  1OCR B;  3JAL B;  4FZ1 A;  1UPG A;  2F43 G;  4YY3 B;  2HVK C;  1FXK B;  2XAS A;  3TXQ A;  1R6T A;  1VQ5 V;  1FJG O;  1RM1 B;  3F5W C;  4ZOL B;  1EZJ A;  4DR5 B;  4YRI A;  4ZHQ B;  4KXR A;  3OTF A;  1IZ3 A;  3CEI A;  2FB5 A;  2GTA A;  3OW2 U;  1SRY A;  2YEV B;  3K9A A;  3OGC C;  2I4M A;  4IT5 A;  1VQ6 V;  1WP8 A;  2CGO A;  3CWB H;  4MVO A;  2CAZ C;  1XHX A;  3AK3 A;  3JAS A;  4YHH B;  1IBL O;  4NVP A;  4LVK A;  4LCU C;  4DR6 B;  1SZT A;  3JD3 A;  5E1A C;  4TSF G;  4OPA A;  1SKV A;  1TA8 A;  4I55 A;  4HWP A;  4DR1 O;  1B70 A;  1VQM V;  3FB6 C;  4NXN O;  2E5A A;  3JCZ A;  3WG7 B;  2GUZ A;  2LW1 A;  1NVP D;  3SYO A;  4B3S O;  4LFA O;  4DPG A;  4LF9 O;  3V8L A;  3I55 V;  4LF4 B;  4XU2 A;  5CN0 A;  1N8R W;  1D5N A;  3LSQ A;  3B2E E;  3C3T A;  2F1M A;  3NEM A;  4BIZ A;  4DR2 O;  4LNU B;  2CE4 A;  2Q8V A;  4DV4 B;  2EJF A;  3AK2 A;  3BAA A;  5C52 B;  2JEX A;  1N33 B;  1O9G A;  4H0L B;  3CJH B;  1E1O A;  1EM1 A;  2PUS A;  3RT3 C;  4YRT A;  2ODM A;  1VQN V;  3H01 A;  3RL6 A;  1D5A A;  1S76 D;  3HFZ A;  1A32 A;  4HYO A;  3ABT A;  4HWS A;  4LF6 B;  4YRC A;  1YDX A;  5LMN B;  2UXX A;  2CJ9 A;  3SPG A;  1YJW V;  1BZK A;  1F4N A;  5AG2 A;  3ZJZ A;  3T1H B;  2WLI A;  2UXB O;  2I4N A;  2E65 A;  4HWT A;  1WNS A;  2W0F C;  4G85 A;  3CE2 A;  1GTO A;  1FFX A;  3LC0 A;  1OCR C;  1VQK V;  1RP3 B;  2QWN B;  1JJC A;  2UUB O;  3JD0 A;  4DV1 O;  4LFC B;  1FXK C;  2QSA A;  2AW9 A;  2RQ6 A;  1RM1 C;  2X6C A;  4BIO A;  2P5O A;  1V54 B;  5B66 Z;  5BZB A;  1FXV A;  4JI8 O;  1H8E G;  3ZHT A;  4DK1 A;  3IKM B;  4MTF A;  2CUG A;  2JDI G;  1BMF G;  2C7I A;  3ZRV A;  1ARO P;  1NNH A;  4MTO A;  1M5I A;  1BHB A;  3OD4 A;  3RBZ A;  5LMU O;  4DR7 O;  4CC6 A;  2XTI A;  1B7Y B;  4YCV A;  3JD2 A;  2DU5 A;  1H2K A;  2EBO A;  2UUC O;  1OJH A;  2RJZ A;  3T1Y B;  2A79 B;  4LVJ A;  2AMC A;  4MVS A;  1KC8 W;  4TV9 B;  4AIL C;  3STL C;  3OAA G;  1MAB G;  2DYR B;  4JI7 B;  4FVM A;  3SR2 C;  4I4T B;  4KR2 A;  4LF8 B;  4DV0 B;  1JCH A;  5B1B C;  4JI5 O;  2QHT A;  2KG7 A;  1Z2G A;  2MW2 B;  3K5O A;  3H9V A;  4X1Y A;  3IG2 A;  4KL1 A;  3P32 A;  4RWU A;  2ZT7 A;  5EK0 A;  1IBM O;  2JVD A;  3JSN A;  1N32 B;  1NJ1 A;  1FPO A;  4CH4 A;  4QPJ A;  1ZUQ A;  3OM3 B;  1K33 A;  1DF4 A;  5JCO C;  2ATK C;  1NS1 A;  1MNG A;  3FB5 C;  4FM2 A;  3SYC A;  2PY5 A;  1ZSP A;  1K73 W;  3UT5 A;  2IM9 A;  2YC0 A;  3VQX A;  5K1P A;  3K5L A;  2Q68 A;  2ZIO A;  1KKD A;  4GZR B;  1PYS B;  2OCH A;  1E24 A;  3A31 A;  3RYC B;  3KG2 A;  4FLW A;  2IH3 C;  3P8Y A;  4K88 A;  2ALY A;  1N34 B;  4ASU G;  5A2Q N;  3RVY A;  1OCO B;  2PI5 A;  1ZWI C;  3HRK A;  1MG1 A;  5KAF Z;  4CS2 A;  4O4J B;  4TOI A;  1GAX A;  3L70 H;  4NR1 A;  4DUZ B;  1KMN A;  3E83 A;  5KHI A;  3KCX A;  1JA8 A;  4YRO A;  1ZAU A;  1V9P A;  1V54 C;  1XL4 A;  3K08 A;  4I0X B;  3CPW U;  2A9H A;  3L72 H;  4ZTZ B;  1KMM A;  2CIM A;  3ABK B;  1G6U A;  1P4R A;  2UXN A;  2DJV A;  3CRA A;  1DGS A;  5HGQ A;  1EFR G;  2WLL B;  2FYU H;  3LSU A;  3HKE B;  4Z1V A;  4P75 C;  4RQF A;  1YTF D;  4YCW A;  4LH6 A;  2YXY A;  2DYR C;  3N2G B;  3I56 V;  5C8Y B;  3VBB A;  3GWO A;  5HFL A;  4CBC A;  1I5X A;  1NTZ H;  1QVG U;  1F4M A;  4X65 O;  3ZHQ A;  3F5T A;  1GN6 A;  4ZBM A;  2QDO A;  5LBQ A;  2Q0A A;  1U96 A;  1VQO V;  1H2S B;  3CC4 V;  5EYP A;  3DGE A;  4YRM A;  2VRZ A;  3QO5 A;  2WWW A;  4EFE A;  3M7M X;  1VIB A;  5DN6 G;  4UFZ A;  1VF6 C;  4B3M O;  2Q5Z A;  4CH5 A;  2ODR C;  5BXZ A;  3RYI B;  4PEL A;  5IDJ A;  1WLE A;  3E22 A;  2UXC B;  2DMX A;  4PDR A;  1WA8 A;  2HFE C;  1Q7Y W;  3A0R A;  4KP4 A;  4X8A A;  4UPA A;  4P71 C;  2ZGW A;  3TK1 A;  4MW3 A;  4IHJ B;  3A5Y A;  1YEW A;  1BE3 H;  1F23 A;  4DV5 B;  3L74 H;  4YRS A;  1N0N A;  4WFB V;  2WA3 A;  2KSD A;  2A0L A;  4MSW C;  2RMK B;  3VQW A;  4WF2 A;  4HWO A;  2WLM A;  2UUA B;  2Q73 A;  3BY6 A;  3MHH C;  3CX5 F;  5FNV B;  1QR8 A;  4FJC C;  2ZT9 B;  1LNQ A;  4I7Z B;  1BT8 A;  5JJE B;  4FM1 A;  4DR4 O;  1GGM A;  3QVN A;  3KZI Z;  3JAT B;  3W7U A;  2HG5 C;  2ZDI C;  2LW7 A;  3F7V C;  4GYC B;  3RYF B;  5CA1 B;  4JPR A;  3R65 A;  4XU3 A;  1VP7 A;  5LYJ B;  3UGQ A;  3DTU B;  4DV6 B;  5J2U B;  1SES A;  4TVY A;  1WP7 A;  3P8T A;  1OZ0 A;  1EBO A;  3ABK C;  3CMQ A;  2QHS A;  5KNN A;  3UGT A;  4R50 A;  4O4I B;  4PJ0 Z;  4GUN A;  2I4L A;  3EHB B;  1XRE A;  1YVW A;  4BIU A;  4UCO A;  2OIE A;  3JSL A;  1XBL A;  3HRI A;  4D7S A;  2DU7 A;  4NCX A;  5IJ9 B;  1H2L A;  1T5E A;  1M90 W;  5KUM A;  3HKB B;  2Z3Y A;  1QLN A;  4H2X A;  3O9O A;  2V1D A;  2RHS A;  3H1I H;  4XTV A;  1H38 A;  3BCC H;  4CH6 A;  3SPC A;  1J95 A;  2CH7 B;  3BA9 A;  3ZMV A;  2M6Y A;  1KP2 A;  4P73 C;  2F95 B;  3K0D A;  4FIP C;  1X2H A;  1S5L Z;  3JAL A; 
#chains in the Genus database with same CATH homology
 4RUF A;  1K3E A;  5H6Q A;  3L2Z A;  5L3E A;  3L4G B;  3QTC A;  4K87 A;  3VQV A;  2IY5 B;  2B1I A;  4EKW A;  3K06 A;  1H8H G;  1SET A;  1SER A;  1GKF A;  1AI4 A;  4DQ2 A;  3LNM B;  3AG1 B;  3G6E V;  4WI1 A;  3P30 A;  3RVZ A;  4O2D A;  4MTG A;  5C93 A;  3BJU A;  2ARU A;  4Z1M G;  3OMI B;  2EIL C;  4P2Z A;  3E9I A;  2HJF C;  4X5O A;  4XTW A;  1VQ8 V;  5ELN A;  2YEV A;  3M4Q A;  4XU0 A;  4YYE A;  4H2X B;  1VQP V;  2RHS B;  2Q67 A;  1M56 C;  3HFZ B;  3CYO A;  4K86 A;  4JYB A;  3LSS A;  4XEM A;  4HWR A;  4MVM A;  3CCJ V;  1RIQ A;  1Z7M A;  3B8N A;  3OUS A;  4Q6G A;  2WLJ A;  1TUE B;  3MHS C;  1E1T A;  3A7R A;  1K34 A;  1BBW A;  1VQ7 V;  4FPP A;  3RKW A;  2ZR2 A;  1ASY A;  1X56 A;  2EIM B;  1GM8 A;  3TUP A;  4PA7 A;  4XDK A;  2NS6 A;  1OCR B;  2WLI B;  2J3M A;  1WPX A;  3EFS A;  2P90 A;  3HTZ A;  2NNU A;  2F43 G;  1FFT B;  1MOF A;  4YRE A;  2HVJ C;  1EFW A;  1PNK A;  2Y48 A;  2HVK C;  1YHQ V;  1YIJ V;  2E41 A;  1S0V A;  1FXK B;  2XAS A;  3JD4 A;  1VQ5 V;  2Q69 A;  1RM1 B;  1MSW D;  3F5W C;  4YCU A;  1EZJ A;  3UFG A;  4YRI A;  1K97 A;  2DTI A;  3OW2 U;  2K1E A;  1PL0 A;  3ASO B;  3ZMU A;  1NJ6 A;  1KOG A;  1SRY A;  4WFF A;  1R73 A;  2YEV B;  3K9A A;  3OGC C;  4WFH A;  5KA5 A;  4JTA B;  1VQ6 V;  2I4M A;  3A7A A;  4LVM A;  1E1R G;  4MVO A;  3WG7 C;  4QE9 A;  4JAU A;  1WYD A;  5CBG A;  3TET A;  1L0W A;  2IJK A;  3DSQ A;  1G51 A;  2EJG A;  2PME A;  4KR3 A;  1HTT A;  3QO8 A;  4LVK A;  2KB1 A;  4LCU C;  2ARS A;  1ADY A;  3A5Z A;  4H33 A;  4XEO A;  1AJQ A;  1F51 A;  1SZT A;  3JD3 A;  2CGH A;  4P3P A;  1PNM A;  5E1A C;  3JYC A;  3OR7 C;  4TSF G;  1QE0 A;  4YRP A;  3NEL A;  3VOU A;  4HWP A;  3K3W A;  1NR7 A;  1AJP A;  1CP9 A;  1B70 A;  2ZNI A;  4LBE C;  3FB6 C;  1VQM V;  4TWK A;  2E5A A;  1QLE B;  3OUF A;  3SPJ A;  5B1O A;  3V7R A;  4QJF B;  3JCZ A;  2CK3 G;  5IYD O;  2V7Q G;  2QE7 G;  3WG7 B;  1CPY A;  2G4C A;  2RHQ B;  3ABL C;  1NVP D;  4P72 A;  1OCZ C;  2HR3 A;  3B77 A;  3SYO A;  3W7W A;  2Q7G A;  3TEH A;  4DPG A;  3SYA A;  4XDL A;  2OCC B;  4JAS A;  3ZN1 A;  4JYC A;  1ORQ C;  2ITC C;  2LFR A;  4GX1 A;  5L3B A;  5E3I A;  3SPH A;  1YTF B;  3I55 V;  3G1Z A;  3V8L A;  1GM9 A;  4XU2 A;  5CN0 A;  2BOC C;  1YJ9 V;  1N8R W;  3HY1 A;  5LGU A;  4P72 C;  3LSQ A;  5EC2 C;  3A74 A;  5B1N A;  2QHV A;  1EVK A;  3X2Q B;  4KQE A;  3E86 A;  2P7T C;  1H4T A;  4RUE A;  2C8M A;  3NEM A;  4RAI A;  2E64 A;  4BIZ A;  1K5S A;  1IXM A;  2CJA A;  3AG3 B;  1Q86 W;  2XOK G;  2ZT6 A;  1NKD A;  3CXC U;  3E2E A;  4WJ3 M;  4H2V A;  2EJF A;  2ZT5 A;  2ZQM A;  3T2M A;  2ART A;  3ZRS A;  3OE7 G;  5C52 B;  2JEX A;  4PDL A;  3JD1 A;  1OCZ B;  4F4L A;  3ZMS A;  2WAM A;  2IJJ A;  1NR1 A;  1B70 B;  2Q5H A;  1E1O A;  3WFV A;  3MF1 A;  1V55 B;  2XND G;  1H4S A;  3REX A;  3HXU A;  4TVA A;  4TVW A;  2EJR A;  1RPO A;  4YRT A;  2E3C A;  4KUM A;  3CME V;  3REU A;  2DVE A;  1VQN V;  4MVR A;  3H01 A;  1JOY A;  4EX5 A;  3RL6 A;  1PNL A;  3W7X A;  1VQ4 V;  4UVC A;  5DM6 V;  1S76 D;  1G5I A;  4U7N A;  3HFZ A;  4BW9 A;  4KFM A;  1JJ2 U;  3AG4 B;  1W66 A;  2XAG A;  2EAY A;  5ELO A;  3TCU A;  1I5Y A;  4G28 B;  4HYO A;  3ABT A;  1K9M W;  1K4D C;  4YXW G;  4HWS A;  3GB7 C;  1AJN A;  4LVL A;  1ASZ A;  1B8A A;  1RPR A;  4YRK A;  1BL8 A;  3MEY A;  4H2W A;  4YRC A;  3FB8 C;  5L3C A;  1E1Q G;  2AHZ A;  4QE7 A;  1W2B U;  2EIK B;  4H2U A;  4YRJ A;  3RAC A;  4AH6 A;  2UXX A;  2CJ9 A;  3SPG A;  1YJW V;  3PZC A;  3CCV V;  1F4N A;  4YP0 A;  1QF6 A;  3BEH A;  2DKG A;  3RUX A;  5LGT A;  3ZJZ A;  2PMF A;  3HXX A;  2WLI A;  4XDJ A;  2ZZG A;  5H6R A;  5LHI A;  4MW8 A;  5CA3 A;  2HNI A;  2I4N A;  2E65 A;  2R9R B;  4HWT A;  2W0F C;  2HLD G;  1FXK A;  1Y66 A;  2EIM C;  3OMA B;  3ASN B;  1B7Y A;  4G85 A;  1GTO A;  5CBH A;  3LC0 A;  2ODR D;  4YRL A;  1OCR C;  2OT5 A;  2WLH A;  1ENV A;  3UKM A;  1VQK V;  1BHA A;  1JJC A;  2A8E A;  2DTO A;  4TVA B;  4YDQ A;  1R3I C;  1THZ A;  3G4S V;  3LDD A;  1J5W A;  3JD0 A;  2ALY B;  4YRN A;  1YSC A;  2FYK A;  1C0A A;  4JGS A;  1FXK C;  2X0L A;  4MVU A;  1RM1 C;  4J15 A;  2XAH A;  2NLJ C;  1AI6 A;  2XAJ A;  1BIA A;  2EWN A;  2ZZE A;  3I7F A;  2X6C A;  4ZIB A;  5L3D A;  3ASO C;  3HB3 B;  3FB7 C;  4YPF A;  1V54 B;  5BZB A;  4Q20 A;  1FXV A;  4RO2 A;  3NET A;  4PG3 A;  4TTV A;  1H8E G;  1M1K W;  3IKM B;  5C53 B;  4MTF A;  5EBM C;  4MTX A;  1QR9 A;  2JDI G;  4UP9 A;  3V8K A;  1BMF G;  3QNE A;  5LHG A;  2C7I A;  3ZRV A;  4WFE A;  1ARO P;  2EIN B;  2Z5U A;  4YRR A;  1NNH A;  4MTO A;  2BOB C;  4JTC B;  3NEN A;  5CBF A;  1BHB A;  3BFM A;  3RBZ A;  2DXT A;  4G84 A;  3KFU A;  4LP8 A;  2XTI A;  1B7Y B;  4YCV A;  1W0K G;  3JD2 A;  2DU5 A;  3M99 B;  1HXD A;  3ETE A;  2EBO A;  5EBW C;  2MK3 A;  3K0G A;  1JJC B;  2RHQ A;  4GCZ A;  1LYL A;  2A79 B;  4LVJ A;  2AMC A;  3T4D A;  2ZNJ A;  1S3J A;  2ZCE A;  4MVS A;  1QLE C;  4XBF A;  4TQD A;  2FTK A;  3HXZ A;  3AG2 B;  1OHH G;  1KC8 W;  5IYC O;  3STL C;  3OAA G;  1MAB G;  2DYR B;  4QIW F;  3NXS A;  5IY5 B;  4E51 A;  3RKX A;  4KR2 A;  2OCC C;  2DWE C;  3ABU A;  2JIZ G;  3OEE G;  1QBZ A;  1OCC B;  4MT8 A;  2Q5I A;  1JCH A;  3V7S A;  1YFT A;  2JJ2 G;  5B1B C;  4P9O A;  1H4V B;  2EJ9 A;  2QHT A;  5LHH A;  1NH2 D;  3HXW A;  2ITD C;  1K92 A;  2WLK A;  2ZT8 A;  3IG2 A;  4P71 A;  3X2Q C;  3P32 A;  2DZC A;  2ZT7 A;  1PYS A;  5EK0 A;  1IL2 A;  3UH0 A;  1NJ1 A;  3T4Z A;  1E79 G;  4CH4 A;  3AG3 C;  4PDV A;  2OTJ V;  4XTU A;  4QPJ A;  3OM3 B;  3CC7 V;  1DF4 A;  1K33 A;  1JPX A;  3WQZ A;  3W3S A;  2ATK C;  1S5H C;  3LUT B;  5EBL C;  4HZ3 A;  3W7T A;  2PI4 A;  1NYR A;  2AMC B;  1R3L C;  2EZO A;  2ZZF A;  3FB5 C;  1KEC A;  1V55 C;  4E2L A;  3VQY A;  3SYC A;  5B1B B;  3MD0 A;  4CS4 A;  4P9P A;  1G5H A;  1K73 W;  1OCO C;  1N9W A;  4G2K A;  4YRG A;  2AKW B;  3VQX A;  3T1C A;  3MQZ A;  3AG4 C;  5K1P A;  2Q68 A;  2ZIO A;  3L1A A;  1KKD A;  2DYS C;  1K4C C;  2IW5 A;  5EC1 C;  3ZRX A;  2ZXW C;  3PCO A;  1JQ0 A;  4H37 A;  4FMT A;  2EIK C;  3UM7 A;  5B1A B;  3E9H A;  1BIB A;  4HAM A;  3ETG A;  1PYS B;  3F7Y C;  4ZKI A;  2DW4 A;  1E24 A;  2ZTG A;  2LFS A;  3RF1 A;  4HT4 A;  2JJ1 G;  3K03 A;  1Q82 W;  3A31 A;  3OD1 A;  3TEG A;  1S72 V;  3KG2 A;  3V7C A;  1USY A;  2IH3 C;  3HPL C;  1WU7 A;  3P8Y A;  4K88 A;  4CH3 A;  4UV9 A;  2ALY A;  4GX0 A;  4ASU G;  2W6J G;  2B1G A;  2WLL A;  1AI5 A;  1GK9 A;  1GM7 A;  3ASN C;  1OCO B;  3RVY A;  2GSM B;  1M57 B;  3ML0 A;  4I9W A;  4UVA A;  2PI5 A;  1CEZ A;  1ZWI C;  4R6Z A;  1COW G;  4P30 A;  3SYQ A;  3ZMT A;  4UUJ C;  3HRK A;  1MG1 A;  4I5S A;  1USY C;  3FYE B;  2DXU A;  2DYS B;  2XAF A;  4L87 A;  1YI2 V;  4H02 A;  5FL7 G;  1AR1 B;  4YRF A;  4CS2 A;  1KP3 A;  1B76 A;  2IH1 C;  4JTD B;  1PD3 A;  3CMA V;  4P3N A;  2ZXW B;  1BBU A;  1NBM G;  1EIY B;  1KMN A;  4PA9 A;  3IAL A;  3E83 A;  4WJ4 A;  3QO7 A;  4FK5 C;  2QM7 A;  2H8P C;  4WCE V;  4YRO A;  2EL9 A;  2DEQ A;  5K1X A;  2E10 A;  1V54 C;  1PKX A;  3G71 V;  3PCO B;  1XL4 A;  3R07 A;  2IJH A;  3K08 A;  3K04 A;  4X88 A;  5LGN A;  2QHU A;  3HXV A;  1H2G A;  3SYP A;  1Q81 W;  3M4P A;  3CPW U;  3ICA A;  1X2G A;  2A9H A;  3CCL V;  4P73 A;  2Q7E A;  4ZTZ B;  5L3G A;  2LP7 A;  1KMM A;  2CIM A;  3ABK B;  4UXN A;  2EIN C;  1NH2 B;  1P4R A;  4P75 A;  2UXN A;  4BAY A;  4OLF A;  4H2S A;  5HGQ A;  1EFR G;  1P7B A;  2C2A A;  2IJI A;  2WLL B;  4MS2 A;  3ERR A;  4HA8 A;  3ZIA G;  4QPK A;  4PHC A;  1DTO A;  2EIJ B;  4N23 A;  3IKL A;  3EFF K;  3IC7 A;  3RW0 A;  5KUK A;  4P75 C;  4RQF A;  1KQS U;  1ROP A;  2P5I A;  1X54 A;  2ZR3 A;  3SPI A;  1WNL A;  1E22 A;  3A32 A;  3E89 A;  1HC7 A;  1YTF D;  3AG2 C;  3ZCC A;  4YCW A;  1NVP B;  3V8J A;  1W0J G;  2DQ0 A;  4UV8 A;  2QKS A;  1YIT V;  3MF2 A;  2B5U A;  2DYR C;  5IY5 C;  3I56 V;  4R7C A;  3VBB A;  2P67 A;  3GWO A;  5HFL A;  4CBC A;  1DLB A;  1K8A W;  1OCC C;  1HWY A;  2QTO A;  1I5X A;  4JAV A;  5J9P C;  5L3F A;  3RKY A;  4JF3 A;  4DO2 A;  1NJI W;  1S77 D;  1QVG U;  1F4M A;  1UJW B;  2ZIM A;  5B3S C;  2J3L A;  2ZIN A;  4UP7 A;  4TT3 G;  12AS A;  4PA6 A;  1H4Q A;  3CCE V;  1WQW A;  2WPD G;  3AEI A;  3PJS K;  4ZBM A;  2IU3 A;  3OEH G;  5LBQ A;  1NQT A;  3ABM B;  1B6Q A;  2YSU B;  2ZD9 A;  2WSS G;  1VQO V;  3FJP A;  3CC4 V;  1QVF U;  4YRM A;  3DGE A;  5C51 B;  2DQ3 A;  4TWA A;  3QO5 A;  2WWW A;  1YB3 A;  2OTL V;  1X55 A;  4DXW A;  5DN6 G;  3HY0 A;  4XTX A;  2DJZ A;  2AKW A;  3CCR V;  1DF5 A;  1QCE A;  2XGT A;  2QM8 A;  2EIL B;  1VQ9 V;  3CCU V;  1K7D A;  4CH5 A;  3E8F A;  3STZ C;  1WQ7 A;  2ODR C;  3EFR A;  4XU1 A;  4LVI A;  1M56 B;  5B3S B;  3IGA C;  4PA4 A;  3ZRW A;  5IDJ A;  4PEL A;  1WLE A;  4H2Y A;  2M7W A;  5KA6 A;  4PDR A;  3HXY A;  4UP8 A;  3E8B A;  4WFG A;  2DZ9 A;  2HFE C;  1Q7Y W;  3A0R A;  4KP4 A;  4X8A A;  4QNH B;  1ATI A;  4UPA A;  2W6I G;  2I4O A;  2JK5 C;  2XAQ A;  4OP0 A;  4P71 C;  1ADJ A;  5B1A C;  4H2T A;  4EO4 A;  1EIY A;  2ZGW A;  2ZXF A;  2QA4 V;  1Y4M A;  2DDZ A;  4X89 A;  3TK1 A;  3E8H A;  4MW3 A;  4J9Z B;  5IYB O;  4GX2 A;  4P3O A;  4GX5 A;  3A5Y A;  2R9I A;  1F23 A;  2X6A A;  4YRS A;  1EVL A;  4BW5 A;  4WFB V;  4HVC A;  1FS0 G;  1VQL V;  1Z7N A;  4UVB A;  2A0L A;  1M57 C;  2ZDI A;  3IFX A;  4MSW C;  4P74 A;  11AS A;  4WF2 A;  3VQW A;  4HWO A;  2WLM A;  1YFS A;  3BY6 A;  3MHH C;  3LDE A;  1NYQ A;  2E1H A;  1QR8 A;  4RQE A;  4FJC C;  1LNQ A;  2Y69 C;  1L1F A;  1NJ2 A;  1G8M A;  1GGM A;  3B8M A;  3ZRW B;  3W7U A;  3OR6 C;  2HG5 C;  2AHY A;  2ZDI C;  4U7O A;  3F7V C;  3HFV A;  4P74 C;  4ZTU B;  2JEU A;  2Q7H A;  3FKS G;  4JPR A;  4MVQ A;  3CCM V;  3R65 A;  5GW7 A;  3CC2 V;  4TQF A;  4XU3 A;  1R6N A;  4G27 B;  1YJN V;  2DWD C;  3UGQ A;  3DTU B;  1G4Y B;  3RIR A;  2Q6A A;  2CJB A;  1M9N A;  1JX9 A;  3ETD A;  4OXS A;  2GHY A;  1KD1 W;  3D3I A;  4MVZ A;  3CCS V;  4LNS A;  2DTH A;  1SES A;  4TVY A;  3P8T A;  1OZ0 A;  1JVM A;  1EBO A;  3ABK C;  3ZMZ A;  1YGB A;  1YFR A;  2QHS A;  3CMQ A;  1AI7 A;  4Q15 A;  2QEX V;  3A7U A;  3UGT A;  5KNN A;  4R50 A;  2IU0 A;  3RGL A;  2Y69 B;  3FYI B;  3SJQ C;  3L4G A;  1R3J C;  2X6B A;  2IY5 A;  5H9C A;  3ABL B;  2I4L A;  3EHB B;  2WLN A;  3OFN G;  3K79 A;  2EIJ C;  3OMN B;  3E35 A;  4PA3 A;  4J9Y B;  1GO3 F;  4BIU A;  1FYF A;  1NJ8 A;  4CS3 A;  3LDC A;  3HRI A;  2DU7 A;  4NCX A;  4BWA A;  4R8C A;  1XL6 A;  5KUM A;  5CMU A;  3E8G A;  2H94 A;  1M90 W;  1EOV A;  3W7S A;  2Z3Y A;  3D36 A;  1QLN A;  4H2X A;  4YRQ A;  2V1D A;  2RHS A;  3TEH B;  4WFA V;  3AG1 C;  1FXH A;  4LC1 A;  1VQZ A;  4XTV A;  5F5W A;  4RDX A;  1H38 A;  4GT1 A;  2P0L A;  1R3K C;  4WF9 V;  4XTY A;  1GMG A;  3ZN0 A;  1K5Q A;  2HKO A;  4CH6 A;  3SPC A;  4XTZ A;  1J95 A;  1R6K A;  2EZP A;  3CP1 A;  4CZZ A;  5HFM A;  3CCQ V;  2D3O W;  2X7R B;  2P6J A;  4N21 A;  3ZMV A;  1NJ5 A;  4RMF A;  1KP2 A;  4P73 C;  1WPY A;  1X01 A;  3CD6 V;  3P8V A;  3K0D A;  4FIP C;  1X2H A;  4PDM A;  1EQR A;  3ABM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...