4L87A

Crystal structure of the human seryl-trna synthetase in complex with ser-sa at 2.9 angstrom resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
476
structure length
476
Chain Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Serine--tRNA ligase, cytoplasmic
publication title Crystal Structure of Human Seryl-tRNA Synthetase and Ser-SA Complex Reveals a Molecular Lever Specific to Higher Eukaryotes.
pubmed doi rcsb
source organism Homo sapiens
total genus 132
structure length 476
sequence length 476
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4l87A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4l87A02
3E9IA 2EJ9A 4YCVA 1USYC 3RKXA 1QE0A 1BIAA 1IL2A 1RIQA 1B7YA 4Q6GA 3PCOA 2Q7EA 1USYA 4K88A 1ADJA 2DKGA 2CJAA 2AKWB 2P5IA 4G85A 3EFRA 2DTOA 3A7UA 4YPFA 4PHCA 5C53B 2FYKA 2DEQA 3NEMA 4TQDA 5HGQA 3W3SA 1WYDA 3L4GA 2I4OA 3HXWA 1E22A 3M4QA 1WU7A 3LSSA 2DQ0A 1KMMA 2ZT6A 4YROA 2DQ3A 3A5ZA 1SESA 1WQWA 1ATIA 4HVCA 1ASYA 1EFWA 1HXDA 2DU5A 1H4TA 1ADYA 1B8AA 4OLFA 3UGTA 3UGQA 3NELA 3HY0A 4TVAB 2DTHA 2E1HA 4CS4A 3QO5A 2RHSA 3V8LA 4K87A 3NETA 1J5WA 4HWTA 1NJ6A 4HWOA 3ERRA 3A31A 4X5OA 4P74C 3HFVA 3VBBA 2I4NA 1HTTA 1PYSB 4XTXA 4P74A 4WF2A 4CH6A 1C0AA 2I4LA 4ZTUB 3HFZA 4XTZA 1E1TA 2ZXFA 2E3CA 1H4QA 3A7AA 1SETA 1EIYB 2EJFA 3NENA 4WJ4A 4XEOA 2CJ9A 3MEYA 3L1AA 4L87A 4EO4A 4K86A 3OD1A 4P73A 2P0LA 3ICAA 4KR3A 2PMFA 4WJ3M 3UH0A 1B70B 2E10A 2RHQB 1QF6A 3V7RA 4H2WA 4DQ2A 1G51A 4RDXA 5C51B 3A7RA 4P3OA 1SERA 1L0WA 4YCUA 2EWNA 2AMCA 1E24A 3L2ZA 4YYEA 3QO8A 4H2SA 2ARTA 1YB3A 1EQRA 1N9WA 4H2XB 1Z7NA 4WI1A 2ZINA 5KNNA 3RGLA 12ASA 4TWAA 4XEMA 1EOVA 1X01A 4YRTA 3KFUA 4XTYA 3HRKA 5ELOA 3HFZB 3HXZA 2ZIMA 3A74A 2ZGWA 1FYFA 1NYQA 4P3PA 3QNEA 1GGMA 2EL9A 1EVKA 4KQEA 1Z7MA 3HXYA 2ARUA 1JJCB 5ELNA 1NJ5A 1LYLA 1SRYA 4YRFA 2E65A 3P8TA 11ASA 3HY1A 1WNLA 2E64A 4TVWA 2Q5HA 3VQYA 4H2TA 4XU2A 4YRRA 1NJ2A 4HWRA 4EX5A 4RMFA 4CH3A 1WLEA 4H02A 1YGBA 1B7YB 3HTZA 4YP0A 3PCOB 4AH6A 1YFSA 2C7IA 1B76A 4XU1A 3V7SA 2ZT8A 3REXA 1NJ8A 4OP0A 4RQFA 1NYRA 4P3NA 4UP8A 2J3LA 4H2YA 4YRLA 3L4GB 1X55A 1WPYA 2C8MA 4E51A 2ZR3A 4YRPA 4CH4A 4YREA 4YRNA 2DZCA 4YRJA 3BJUA 3QTCA 2ZIOA 3IALA 4HWSA 4YDQA 2DU7A 4P73C 3DSQA 2ZCEA 2DXUA 4CS3A 2ODRC 1KMNA 2E41A 2XGTA 3HRIA 3M4PA 4YRQA 3HXVA 3V8KA 2AKWA 1HC7A 3RF1A 2QHTA 2RHSB 3RKYA 3P8YA 4TVYA 1WQ7A 4LNSA 3LC0A 2CJBA 4YRSA 2ZZFA 3P8VA 3HXXA 1X2GA 4ZTZB 4DPGA 3MF2A 3RUXA 2EAYA 4H2UA 3VQXA 5F5WA 3I7FA 5C52B 2DXTA 2ZZEA 1X2HA 4XTWA 2EJGA 1EVLA 4TTVA 1G5HA 4CH5A 4YRGA 4BW9A 4ZIBA 3RKWA 2ZZGA 2DDZA 3A32A 3A5YA 4TQFA 4TVAA 4UPAA 5K1PA 4Q15A 2QHSA 3RL6A 2DZ9A 2CGHA 5E3IA 2DJZA 2G4CA 3MF1A 4YCWA 5K1XA 3TUPA 2E5AA 1PYSA 1VQZA 1W66A 3CMQA 2ZTGA 2AMCB 2HNIA 4XTUA 2QHUA 3TEHA 4XU0A 2Q7HA 3V8JA 3QO7A 2J3MA 1EIYA 1YFTA 2XTIA 1E1OA 2IY5A 2I4MA 1B70A 3IKLA 4P72C 3V7CA 2RHQA 4YRIA 4PG3A 4XTVA 4HA8A 3RIRA 4P72A 2ZT7A 3G1ZA 2ODRD 2ALYA 3WQZA 4CS2A 3RACA 3R07A 3E9HA 2DVEA 4O2DA 4G84A 1H4SA 2ZNIA 3IKMB 4H2XA 2DTIA 2ZT5A 3BFMA 4NCXA 1KOGA 2ARSA 4KR2A 3EFSA 2CIMA 1NNHA 1ASZA 2PMEA 4P71C 4P75C 3TEHB 4UP7A 1BBUA 3TEGA 4J15A 4YRCA 3UFGA 4P71A 4P75A 1BBWA 4XU3A 4RQEA 3PZCA 4YRMA 4YRKA 4HWPA 1X54A 1NJ1A 2IY5B 1X56A 1JJCA 3REUA 2Q7GA 3HXUA 2QHVA 2ZNJA 3VQWA 1H4VB 4H2VA 3VQVA 1YFRA 1BIBA 3FJPA 2ALYB 3LSQA 1G5IA 4BWAA 4UP9A 3IG2A 2ZR2A 2Q5IA
chains in the Genus database with same CATH superfamily
4D7SA 3E9IA 2EJ9A 1AI4A 1I94B 4YHHB 2R72A 2WLLB 4H13B 3U11A 2OIEA 3CJHA 4Q6GA 3PCOA 2XASA 2Q67A 3A2FA 3SPGA 4DR2O 2YIDA 1VQ9V 2JIZG 3K79A 5LOVA 1ADJA 2OCCC 2WLKA 2UUBB 4IYHA 2CJAA 1MMMA 4G85A 3A0HZ 2UXCB 2O57A 2QTSA 4PHCA 5LP6B 2DEQA 4K3AA 4QE7A 2I4OA 5L3DA 1H8EG 1P49A 1PL0A 3IGAC 1IBMB 1E22A 1KYOF 1QNMA 3SDLA 4WFAV 2JJ2G 1XDCA 4YROA 2DQ3A 3A0BZ 3F5TA 4YJ2A 1NI8A 1MOFA 1BSMA 2OWOA 1ATIA 3BAAA 3RYFA 4EFBA 1ASYA 1O9HA 1SA0A 1AJNA 3SYCA 4G28B 2A3QA 4GKKB 5KA5A 4JYBA 3ZMVA 4AILC 2DJVA 4FZ1A 1RM1B 4O2BB 4Z2WA 1V54C 1QLNA 3IJ4A 4X64B 2PF4E 2ZQMA 4KXRA 5CB4A 1NBMG 1NH2D 3D3QA 4KHPB 1WP7A 4GYCB 1TUBA 2E1HA 4FLUA 3K04A 2RHSA 3V8LA 5JH7B 3NETA 4JAVA 3ABLC 2H8PC 2Q8VA 1PV0A 2JGDB 1NJ6A 3SPIA 3RW0A 3ABKC 2QSAA 4P74C 4H44B 2F93B 3FKSG 1ROPA 2PUSA 1HTTA 4L8JA 1PYSB 1KP2A 4X66O 3HKEA 2B5UA 3OR7C 2EIKC 1OV9A 3DXRB 4H0LB 1WNSA 2IJIA 4IHJB 1M57B 5JVDB 3RT3C 4QNHB 4TOIA 4XTZA 2E3CA 4PA4A 1H4QA 3A7AA 1VF7A 4DV5B 4WJ4A 3OEHG 1Y66A 2M6YA 2CJ9A 3CWBH 3ML0A 4L87A 4EO4A 1JCHA 2DMXA 4K86A 2P0LA 4KR3A 4WJ3M 2FL4A 3TJTA 4JI4O 1CXZB 1YJNV 1HW7A 4TWKA 1OJHA 1XL6A 4FM0A 1B70B 1P7BA 5KHHA 2UU9O 4LF6O 3GWOA 1XNRO 2FTKA 4RDXA 2UUAB 3BFRA 2WA3A 3G6BA 4PA9A 4P3OA 2F1MA 2JS5A 3K9SA 1TUEB 5KA6A 1E24A 4BIZA 2MW2B 1YB3A 1F23A 1YSCA 1N9WA 1D2DA 4WI1A 1SQBH 2XAHA 4DR7O 12ASA 4YJ3B 4UB8Z 3VOUA 1NTKH 4OPHA 4EKWA 2WAMA 5GTIZ 4B3TO 3CHXA 2K1EA 4B3MO 3HXZA 1HNXO 2EILC 3MD0A 5JCOC 2ZGWA 3H1IH 2UXNA 1FYFA 4O2AA 1MG1A 1N4CA 1PM9A 1IBKB 3ZMZA 3FB5C 4KQEA 4ZOLB 4LF8B 1EBOA 3AG1B 5IWAO 4X20A 2ARHA 4K35A 1FXKC 1JJCB 5EIBC 1JJ2U 1SRYA 4K8XA 4NVPA 4ZHQA 1AP6A 1GM8A 2XHBA 4JI8B 4HBNA 4TVWA 3ABUA 4FLYA 1H2MA 4PA6A 1KECA 5HFMA 1FS0G 4IL6Z 4YRRA 3BPZA 4HWRA 2LQTA 4RMFA 4CH3A 3OMAB 1W0KG 4CBCA 1W0JG 2P67A 3HTZA 4X65O 1Y67A 4DR3B 1XNQB 5EZYA 4E4EA 5J2UA 3D36A 4HAMA 1Q6HA 4XU1A 1THZA 3JALB 4I55A 3OT7A 4P3NA 4UP8A 2J3LA 5IJ9A 1SQPH 2QTOA 4DV7B 4JPRA 3L4GB 1W59A 5KUKA 1GN3A 4X1YA 3X2QC 3AG4C 1WPYA 3JD4A 4E51A 3K08A 3T1HO 1GO3F 1XOUA 2ZXWC 1EZJA 3TCUA 4ASUG 1NVPD 4YRNA 2JGUA 1AP5A 3QTCA 2ZIOA 1QLEC 4X88A 2DU7A 3L70H 2WLLA 5HFLA 1VARA 2ZCEA 1HNWB 2C2AA 1X59A 3HRIA 1R73A 3M4PA 1H2GA 2JRIA 5FNVB 5A9GA 3K5NA 4JYAB 4TV8B 5B66Z 1F7YA 2QHTA 5LP6A 3RKYA 1J95A 3LC0A 2XAFA 2ZZFA 5KAIZ 3RVYA 3CCVV 3QVNA 2AXTZ 3RUXA 1BCCH 2JJ1G 3FD9A 3VQXA 5CA3A 2IH3C 1D5NA 2DXTA 2ITCC 4IIJA 2RN9A 1OCRC 1T5EA 1GN4A 2AW9A 5FL7G 1G5HA 4TTVA 3K0GA 4CH5A 3CCUV 3E8FA 4ZIBA 4EEQA 3TXSA 4O2BA 1N33B 1S5HC 5IJ0B 5JQGB 5ITZA 1QBZA 2LGWA 3A32A 3CXCU 1WJZA 3DTUB 2Q73A 4UPAA 4MVMA 2EX3A 2QHSA 3AG3C 4QE9A 4O4LB 3SGIA 5JH7A 5EK0A 4FK5C 3AG2B 1JMKC 2NN4A 1GAXA 3RL6A 3TXQA 3J7AU 4PV1B 1BMFG 4PD4F 2DW4A 3MF1A 2JEUA 3L75H 2OT5A 2IJKA 4FLXA 3ZHQA 1MSWD 3TUPA 1PYSA 3RYIB 1VQZA 2ETNA 1BT8A 3DXRA 2AMCB 1ZX3A 3L72H 4IHJA 2X6BA 4LR3A 4O4HB 3JAKA 3F7YC 5JVDA 1IBLO 4XU0A 2YIBA 3OEEG 2J3MA 4IT5A 1GH6A 4J42A 4B3SO 1YFTA 2ZKOA 4GKJO 2XTIA 3MHHC 1L0NH 4DRXB 3CCJV 3R66A 1MABG 1E79G 1B70A 2VQEB 1AR4A 3C3SA 1K7DA 3EFFK 2VRZA 4AQYO 2Y4UA 2P90A 1BGYH 4XTVA 1I5XA 3ETQA 4Z1MG 1VP7A 3E86A 4DV0O 1OHHG 2ODRD 2ALYA 5JJJB 3OTOB 1S0VA 3R65A 3RACA 3R07A 4JI6B 3E9HA 1US6A 4X1KB 4G84A 1MSDA 1QU7A 4UFZA 2KG7B 4QIWF 2DTIA 2UXDO 4GCZA 1S3JA 2A0LA 1M90W 2ARSA 2HJFC 4YJ3A 3APOA 1NNHA 1R6NA 1VQPV 4P71C 4NTXA 1R3LC 3TEHB 1N32O 3OGCC 4W4LA 2F43G 3CPWU 3GB7C 1SS3A 1FD9A 5JJNB 4PELA 4RUEA 4NXNB 4LVKA 4P75A 2Y69C 2YC0A 1VQMV 4XDKA 5LYJB 3B2EE 4LBEC 5D5QA 1N8RW 1IDSA 3J81N 3PZCA 4UCSA 3N27A 2OTLV 4ZOLA 1OCZB 1AI5A 2Q6AA 2IY5B 5LHHA 1FFXB 4PDRA 3UQ8A 1AR1B 1JJCA 3DGEA 2VQFO 3SYQA 1IXBA 1SKVA 4JI7O 3K9AA 1K5SA 4H2VA 1AI6A 1RFYA 3BA8A 1YFRA 5LL6Y 5EBWC 3FJPA 5TISZ 3AK3A 4F6RB 1FYJA 2K9PA 3E35A 1QE0A 2F4VO 4GLXA 2UUCO 1IURA 4UCRA 3EXAA 4OX9B 4DK1A 2N74A 1USYA 3SPJA 1Q6IA 1K92A 4K88A 1YCIA 2RCVA 4GT1A 3K58A 2P5IA 1R3IC 1R3JC 4DV6O 4YPFA 5CBGA 3D3IA 4LFBB 4LF5O 3RYCB 3I55V 2XOKG 2W6IG 2CTRA 3L4GA 1OCOC 2EIMB 1XMOO 1IX9A 3BHPA 3JASB 1U97A 3OM3B 1S5LZ 1SESA 1YEWA 2E5LB 1QVFU 4HVCA 4DR5O 4ZBMA 3ASOC 2IU3A 4X62O 5LMNO 2F95B 3FYIB 3JAMN 2FMLA 2R9RB 1B8AA 3UO3A 2D2CB 3ZHUA 1WN7A 5FNVA 2IJHA 4TV8A 3G4SV 4TVAB 2P6JA 1K97A 5D5PA 3QO5A 1P84F 4UCOA 5IY5C 1F4NA 2ADQB 4HWTA 4H33A 2H3OA 4BAYA 3L71H 2EULA 2HJDA 3S3WA 3B8MA 3RGBA 2CTQA 1J5EB 3KG2A 4XTXA 1ZSPA 2CTWA 4WF2A 4UV9A 1C0AA 3UCSC 2I4LA 4MTXA 1VQ7V 2YI8A 5JQGA 4LF7O 5GONB 4QGPA 5E1AC 1Q81W 1Z2GA 4XEOA 5IYBO 4YY3O 3OFNG 3HKBB 2PI4A 1ZTEA 3OD1A 4P73A 1JQ0A 4O4LA 1L0LH 1NKDA 2E76B 3K3WA 5LMUO 4J80A 3CCSV 2E10A 3JAWA 3CCRV 2BCCH 2RHQB 1QF6A 4DR2B 3JCZA 3Q4HB 4H2WA 1SQXH 3RYIA 3A7RA 2AHYA 4LCUC 2QE7G 1SERA 1NZ6A 2EWNA 2AMCA 1NH2B 4H2SA 1BS3A 2ARTA 1WPBA 1WB8A 5DECA 1DLBA 1EQRA 1Z7NA 1S77D 3ABKB 3LSUA 1RPRA 3ETEA 1EOVA 3CE2A 1JFFB 3WFVA 1X01A 1VIBA 4XTYA 2DYSB 3E2EA 2EIKB 1YHQV 3HFZB 2ZIMA 2WA4A 3A74A 2JK5C 4P3PA 3K5LA 2FKXA 3CC2V 4MVQA 2DYRC 3E83A 2ZDIA 1GGMA 2OYQA 2EIJC 1B3QA 1Z7MA 3HXYA 2EJRA 1V55C 2ODMA 1YF2A 5H2FZ 1XI1A 3WU2Z 4XBFA 2E75B 1XHZA 4X1KA 5J9PC 2ZM6O 3P8TA 4MVSA 1VQ4V 2Z3YA 2KG7A 1RSOB 2GDSA 1WNLA 2E64A 1FJGO 3FB8C 3VQYA 4JI0O 5BXZA 3U10A 4LF4O 1VQNV 2GTAA 5C8YA 4LWSB 1QVGU 1JA8A 4DUZO 2ILMA 3CX5F 5KX5A 1YGBA 1B7YB 2HKOA 1Q86W 4AH6A 4X66B 4KFMA 1Q5OA 3D36C 1P4RA 1AJQA 5LYJA 4I50B 1FPOA 3V7SA 1B76A 2VWJA 4O4IB 2ZT8A 1COWG 4QPJA 4RQFA 3AK2A 1AJPA 2RMKB 4H2YA 2WLJA 3B77A 4TV9B 2EILB 1XEQA 2ZE6A 3ZN1A 4JI4B 4DUYO 1PNLA 2E74B 1MZEA 3KCYA 3T1YO 5CBHA 2UU9B 3CMAV 3HR0A 1XHXA 4F6RA 2JEXA 4YDQA 3ASNC 1TA8A 1XNRB 3DSQA 3M99B 5L3EA 3G67A 5LP6C 2GHYA 3HXVA 1HDJA 3B8NA 1HC7A 3P32A 1K3EA 3RF1A 4DR7B 3RYHB 4TVYA 1WQ7A 4DR6O 2CJBA 4YRSA 3P8VA 2DOSA 2IJJA 3SPHA 1ZWIC 4B3TB 3ZX6A 2ITDC 3ZMTA 4F6EA 3ZBHA 4B3MB 1X2GA 4DV4O 1HNXB 4DPGA 5BMVB 3MF2A 3DC6A 2XUMA 1JR9A 2GV9A 2VWKA 4GX2A 3CD6V 1U96A 1RM1C 2EJGA 3K5MA 3CCMV 4RAIA 5IWAB 4J9ZB 4MW3A 4ZI7A 4NXMO 4LVMA 3X2QB 1SZTA 4MTGA 5CA0A 1XMQO 1HR0O 2PGGA 4JF3A 1YXBA 4NB5A 1Q82W 4DV3O 5EIBD 4TVAA 4BR6A 1M56B 1Y6XA 4I0XA 1QR8A 2CGNA 5K1PA 2YEVB 3K03A 2HVJC 4Q15A 1H2KA 3M7MX 3IAYA 4UVAA 4RO2A 4WBNB 2UXBO 1NVPB 3ABMB 4G2KA 3A0RA 4X65B 5BR8O 2Q0AA 2DZ9A 2CGHA 4WFGA 3IFXA 3STZC 5E3IA 3CRCA 2G4CA 1PP9H 3OUFA 4GZRB 1WA8A 2GTSA 4JI5O 1M57C 1W66A 5IYZA 4I4TB 4NR1A 1NTZH 3ZIAG 3SYPA 1HWYA 3SR2C 4PI0A 3BABA 5CMUA 1K33A 4XDLA 2V7QG 2QWQB 3V8JA 3QO7A 1UPGA 2EJ7A 5GONA 5KHJA 4YIOA 3T1HB 1HNZO 4DV1O 4FFBB 2IH1C 2WLIB 3K06A 3N2KB 1OCRB 2QKSA 2XAGA 4UVBA 2Q9LA 5EBMC 2ZE5A 4B08A 2XAJA 4JAUA 1GMGA 3EHBB 3KCXA 2QA4V 2HG5C 5E79Z 2Y0IA 4JTDB 1PKXA 3STLC 2RHQA 4HA8A 5KUMA 3RIRA 1Q43A 1EFRG 3Q4HA 2PI5A 1S76D 3G1ZA 4DK0A 4CS2A 3S3XA 4MW8A 1M4UA 4DR1O 3JYCA 4HT4A 4NKGB 2ZT5A 3BFMA 5J2TB 1KB9F 3CMEV 1KOGA 4MSWC 2CIMA 1JFFA 2P22C 4P75C 4OXSA 1N0NA 1VEWA 3TEGA 4J15A 1K8AW 4YRCA 1LUVA 5B3SB 5EC2C 5FPOA 3G80A 3LDDA 4YRMA 5B1BB 4NTWA 2KQXA 4LH6A 4JTAB 4HWPA 4UCTA 1X54A 1GKFA 4G27B 3ETDA 1BHBA 2IBZH 3REUA 2Q7GA 3HXUA 3UM7A 2QHVA 1N36O 2L35A 4JI1O 2B1GA 3VQVA 3ZHSA 1RSOA 4WFEA 1V9PA 3JSLA 4PDMA 1I7FA 3LSQA 1XUQA 4BWAA 1YI2V 3M8AA 2Y48A 1OZ0A 3CRQA 4LF9O 5B5EZ 2Q5IA 1QHTA 4HNAB 1USYC 3RKXA 1IL2A 2D3OW 1KD1W 1B7YA 3T2MA 4D7TA 5IDJA 4CC6A 3H1JH 1VQLV 4O4JB 2WLHA 2EINC 4I50A 4Q20A 1IBLB 3H9VA 2DKGA 2JVDA 2JGDA 4KUMA 2HLDG 3A7UA 5C53B 1YIJV 2FYKA 1KUQA 3RVZA 4PJ0Z 4TQDA 5CN0A 4B3SB 4GKJB 3M4QA 3E8HA 3ZRWB 4Z1VA 5LHIA 3LSSA 4JI3O 2V1DA 2DQ0A 2FB5A 2ZT6A 3A5ZA 1Z5WA 1EZVH 3ZRVA 1S72V 1R1BA 5IE9A 3ZMSA 2Z0AA 4AQYB 1EFWA 1H38A 1HXDA 2DU5A 1ZAUA 1G8MA 2Q0OC 3E89A 2IU0A 4DV0B 1VQKV 2PTMA 2UXXA 3CRMA 1ORQC 3UGTA 1B04A 2X0LA 3UGQA 1ZLZA 3HY0A 3CJHB 2KB1A 4LFCO 2UXDB 4CS4A 1GN2A 3RFRA 4K87A 1NT2B 3CEIA 5C93A 1VF5B 1N32B 5LOVB 1KQSU 4LH7A 4PA3A 5EBLC 4HWOA 5IT9N 3ERRA 3A31A 3TGUH 4X5OA 1OCCB 5KHKA 1VF6A 4W4KA 4K8ZA 1AI7A 2P7TC 4I9WA 5KLVH 4CC5A 2QDOA 4QPKA 2X7RB 1OCOB 1ZUQA 4ZTUB 1FXHA 3BVOA 2VQFB 4U7OA 1BZKA 4JI7B 1E1TA 1EIYB 3H1KH 4R6ZA 5JWPA 1TGOA 3GVMA 3MEYA 3OAAG 3AG2C 1XQ8A 5EC1C 1G1XB 2YEVA 3OMIB 2CDYA 1YJ9V 3CC4V 2PMFA 1DF5A 4N21A 4JGSA 1TAEA 3PN1A 4WBNA 2F4VB 3CB2A 2UUCB 4DV2O 4JASA 2R9AA 2DE0X 4DQ2A 1NJIW 5LGNA 4DR4B 2WLMA 3ZHVA 5C51B 1KKDA 4DV6B 4I4TA 3BA9A 4X8AA 4LF5B 2LGQA 4B3RO 3L2ZA 4YYEA 1GTOA 4WFBV 2R70A 2ZINA 1XMOB 5KNNA 4K0KO 3RGLA 2Q4PA 4TWAA 2GSMB 4P30A 4FFBA 2WLIA 3KFUA 3HRKA 5ELOA 3JALA 2W0XA 4HYOA 4DR5B 1BE3H 2ZE8A 2WWWA 2ZDIC 4X62B 1MZFA 2RJZA 5LMNB 3T4ZA 2GBOA 3OUSA 1EVKA 1GK9A 1LNQA 4UVCA 2ARUA 3WG7B 4DW1A 2QR4A 1LYLA 2Y4TA 2E65A 4LFAO 3HY1A 4P9PA 4UV8A 1CEZA 4YIPA 5J2TA 2WPDG 2QWOB 1NJ2A 3CCLV 4EX5A 4GX0A 1WLEA 1N34O 4TSFG 5GW7A 3UKMA 3L73H 2YXLA 4AHCA 1OCZC 4OPAA 3CYOA 4LF7B 1JVMA 3BEHA 5BY1A 2OCCB 4GX1A 2HHHO 2NNUA 4H37A 4BW5A 4YY3B 2AZ0A 2CTPA 3OMNB 4LVIA 4WF9V 3C3TA 5LMUB 1LR1A 1B6QA 1I08A 4MTFA 4YRJA 3BJUA 4HZ3A 5IJ0A 1VQ6V 4HNAA 1SZXA 5B1AC 1SQQH 2ZE7A 1Z5VA 4O4JA 1K34A 4J9YB 4YRQA 3L74H 2QWRB 2AHZA 3OD4A 3P3NA 4LVJA 1V54B 2A9HA 1Y76B 3P8YA 2LW7A 4LNSA 5J2UB 4J41A 5CBFA 4JTCB 1DK1A 1I5YA 2G38A 1WP8A 3ZRWA 3SJCC 3ABLB 3CC7V 4U3JB 4I55B 4TT3G 4O4HA 4FLWA 4EB6B 4JI2O 5C52B 3FB7C 2W0FC 2XTAA 3EVKA 1VQ5V 3ZRSA 1EVLA 2M7WA 3W7UA 1YTFD 4DW0A 4JV5O 2BTOA 3RKWA 2HFEC 2ZZGA 4DRXA 2ZM6B 3JD1A 2DDZA 3O9OA 4B7KA 3A5YA 1FJGB 3ASNB 4JI0B 3CP1A 5DEDA 2ADPA 1FKAO 4LF4B 1KU9A 4ABMA 4DUZB 2X6CA 4WFHA 1KKCA 4LNUB 4N23A 4B7EA 3PJSK 2DJZA 2OTJV 1H2SB 3E8GA 1LUWA 1I94O 2YI9A 5KMGB 5EYPB 4YHHO 1W2BU 3BRCA 1PL4A 3OE7G 4KP4A 4R7CA 2PYLA 2ZTGA 1DGSA 4I5SA 2P06A 3HKCB 3TEHA 3B40A 2CUGA 2UUBO 4FLTA 3P3PA 2A8EA 1X4TA 1SF9A 3AK1A 1MNGA 2BTQB 2UXCO 4IIJB 3JSNA 1EIYA 3A8TA 1AROP 4GUNA 4DUYB 1PNMA 3ZMUA 4J10A 3T1YB 1IBMO 4MVZA 1WPXA 1E1OA 2XT9A 3OGIB 4DYLA 3MAQA 1G6UA 3LNNA 2IY5A 1FFXA 1SQGA 5ITZB 4FFKA 3ZHRA 4F4LA 2HVKC 3V7CA 1ENVA 1VMGA 2CH7B 2LJ2A 4PG3A 3W7XA 1GM7A 3RBZA 4P72A 2ZT7A 4GKKO 1TVKB 2KSDA 3WQZA 4OGQB 4LF6B 4PDLA 4O2DA 4X64O 2NR5A 3H01A 2CE4A 1IXMA 1H4SA 1FXKB 4KL1A 4DR6B 2QKAA 3ZN0A 4YXWG 4KHPO 3IKMB 3W7TA 3HKDB 1UJWB 2B9ZA 3ABTA 4J7JA 2DYSC 4KR2A 1E1RG 2DWEC 4DV4B 3EFSA 1R6KA 4P2ZA 1ASZA 1M93A 1FXVA 4MVUA 4WFFA 3JAKB 2XAQA 4WCEV 2W6JG 4MT8A 3SPCA 2NS6A 3RYCA 3SJAC 2PZSA 1BBWA 1PD3A 2ATKC 2P4VA 1SQVH 4RQEA 4NXMB 3LDCA 1HR0B 1XMQB 3CXHF 4X1IB 4YRKA 1GN6A 2BSKB 1JX9A 1JOYA 2LW1A 1NTMH 3JASA 1NJ1A 1H8HG 1R3KC 4DV3B 2GUZB 5CA1B 1K5QA 3MQZA 3VQWA 4C7UA 4DV5O 3UT5B 1R6TA 3THOA 1NS1A 1BIBA 2UXBB 3AG4B 2ALYB 1G5IA 5BR8B 3IG2A 2ZR2A 2ZXWB 1RPOA 1K9MW 3RWRD 3I56V 4YCVA 3K57A 4DO2A 3OR6C 1BIAA 1RIQA 1QLEB 3P30A 4FIPC 2Q7EA 4JI5B 1E1QG 1Q6UA 3G71V 3ZRXA 3CRAA 2QEXV 2VS0A 2UUAO 1P7GA 2AKWB 3EFRA 2YIBD 2DTOA 1NR7A 4U3FH 2JDIG 3NEMA 1B06A 5HGQA 1HNZB 4DV1B 3W3SA 2A79B 1FFTB 1WYDA 1PPJH 5L3FA 3HXWA 1NU1H 4RUFA 3K59A 1XILA 1WU7A 5L3CA 3N2GB 1KMMA 1RP3B 3F7VC 1WQWA 2X6AA 2BOBC 3WB0A 4U7NA 1H4TA 5LXTB 3SJBC 2FYUH 3JARB 1K4CC 3HKBA 1IBKO 2IW5A 5L3BA 3IC7A 1ADYA 4LF8O 4OLFA 5AG2A 4XDJA 4DR1B 3NELA 1FAFA 1Y76A 2DWDC 2DTHA 2CAZC 3ETGA 5DM6V 4JYCA 1J5WA 4JI8O 2EZPA 1H2NA 2HP8A 2N05A 3AG3B 1ZL8B 1VF6C 3JCUZ 2EINB 4U3JA 3HB3B 3U0ZA 3HFVA 2P4KA 2CGOA 1Y74B 2DN9A 2QWNB 3AG7A 3VBBA 4EB6A 1Q8IA 2I4NA 2LP7A 2YIAA 1N0JA 3NXSA 4P74A 4DR3O 3IC9A 1DTOA 4CH6A 1XNQO 1QCEA 3FB6C 2YDEA 2PYJA 2N04A 4TUYB 1Y4MA 3ICXA 3HFZA 1M56C 4MVOA 1N36B 2ZXFA 2WLNA 1SETA 5H5NA 4JI1B 2EJFA 3NENA 3C90A 1L8DA 5KHGA 5H6QA 3AG1C 3FX7A 4DV7O 3L1AA 5LA6B 3DC5A 3JATB 3ICAA 3ABMC 3ZHTA 2F23A 3UH0A 4LF9B 2PY5A 5IYDO 4MS2A 4I9QA 1URFA 4LNUA 1L1FA 4FMTA 3V7RA 1AB3A 4X89A 5KMGA 5EYPA 1G51A 1F51A 3SYAA 1HNWO 3F5WC 2A06H 1EM1A 1L0WA 4YCUA 1NQTA 4LWSA 2Q5ZA 2QWPB 1M1KW 3HKCA 3QO8A 4JYAO 4H2XB 2P5OA 2BTQA 3SYOA 4UB6Z 3RN4A 2MK3A 3FAVB 4JI3B 4XEMA 3ZS8C 3WB1A 4YRTA 4P9OA 3MHSC 4ZKIA 4O4IA 4E2LA 5GTHZ 4PDVA 5F2VO 1NYQA 3OTFA 5A2QN 3QNEA 2F66C 4TV9A 4FM2A 2CH7A 5JCOA 2Y69B 1M9NA 5DN6G 2EL9A 4IYIA 3SJQC 2YXYA 2LO1A 5KHIA 1TVKA 2HEPA 5ELNA 4LFCB 4AI8A 3JAWB 5JJEB 1NJ5A 1N33O 4YRFA 5IYCO 4I7ZB 11ASA 1FXKA 5LBQA 1NR1A 1XREA 3HKDA 2Q5HA 3E22B 4FM1A 2BOCC 4H2TA 1QR9A 4JZGA 3LUTB 4LC1A 4XU2A 3J80N 1WAZA 2OCHA 3ZJZA 5B3SC 2CK3G 3APQA 4H02A 1F4MA 2EBOA 5L3GA 1Q7YW 4YP0A 3PCOB 1YFSA 5B1BC 3RYHA 1YZBA 3K0DA 4BIOA 1XL4A 3W7SA 2C7IA 4X1IA 1BQ0A 1QQCA 2BSKA 1KMIZ 1YDXA 4FJCC 3REXA 2LFRA 1NJ8A 4OP0A 5BMVA 1NYRA 3GWKC 1D5AA 3B09A 4YRLA 2GUZA 1X55A 1VQ8V 1MA1A 2ZT9B 1Q90D 5CA1A 2C8MA 1H2LA 2ZR3A 4YRPA 3UT5A 4CH4A 3H1HH 2WSSG 3K5OA 2B1IA 4QJFB 4YREA 4YJ2B 2DZCA 4NYKA 2QM4A 2QGNA 4EFEA 3RYFB 3IALA 4DV2B 4HWSA 1SA0B 4P73C 4J11A 4JZ2A 1JPXA 4FZ0A 3ZCCA 3ZEDA 2VQEO 2DXUA 4CS3A 2ODRC 3ASOB 4FLZA 3QF7A 1KMNA 1EN4A 2E41A 2XGTA 1XBLA 5BZBA 5C8YB 5CB4B 4B3RB 1KP3A 3I5DA 3NR7A 5KX5B 3D8CA 3OTOO 2AKWA 3V8KA 3O65A 1TUBB 4JI6O 4R8CA 2RHSB 4K0KB 1EN5A 3T4DA 2QM7A 4FVMA 1IVSA 3JD3A 2V4DA 2EZOA 3KKYA 1YVWA 2IM9A 2RNBA 4DXWA 3HXXA 5IY5B 1HP8A 1SQFA 3CRRA 1K4DC 2Z5UA 3N2GA 4ZTZB 2Q69A 2BE3A 2RQ6A 3TETA 5KAFZ 2EAYA 1A32A 4H2UA 3E8BA 5F5WA 2YXHA 3I7FA 1S5JA 2ZZEA 1X2HA 3HKEB 4PA7A 3B4SA 5B1OA 4NXNO 4XTWA 1BHAA 3BY6A 1CPYA 2LFSA 5LXTA 3JARA 4YRGA 4BW9A 3N2KA 4ICGA 4J7ZA 3G6EV 1YJWV 5FPRA 4LFAB 4TQFA 3OW2U 1EN6A 1I0HA 5LHGA 5B1AB 2R9IA 1SC5B 1N34B 4DR4O 1OCCC 2H94A 4FLVA 2L6LA 3W7WA 1ZL8A 3JD2A 2KKWA 1BL8A 4FPPA 4PHZA 4YCWA 1Y74A 4UUJC 5K1XA 5FLXN 3AEIA 2NLJC 4GX5A 2YSUB 2E5AA 4OX9O 2RDCA 3CMQA 4IGGA 2HNIA 4XTUA 4UCUA 2QHUA 3WB2A 4TUYA 2HHHB 2Q7HA 2JS3A 4LP8A 4LFBO 4CZZA 1BQZA 3CCQV 2AGAA 1KC8W 3LNMB 4RWUA 1G4YB 4LVLA 4NTYA 4ZI7B 5LA6A 3JATA 5CA0B 3MDSA 3H1LH 3T1CA 2I4MA 1WB7A 1CP9A 1PNKA 4O2AB 5LGTA 3IKLA 2E5LO 2AZ2A 4P72C 4I0XB 5B1NA 3FYEB 4YRIA 3L9DA 1IZ3A 4JAAA 4J7KA 3KZIZ 4A5UB 3QG5A 3BCCH 3LDEA 2DYRB 3CSXA 4X20B 1YTFB 3JD0A 2EIJB 4PI2A 2DVEA 2YUAA 3HPLC 1AVMA 3CCEV 1V55B 4ZHQB 2ZNIA 4H2XA 1WA8B 2ZD9A 5LGUA 4R50A 4JYYA 3FAVA 4NCXA 2Q68A 1UFIA 4D6TH 1DF4A 5IYZB 1K73W 2A7WA 4UXNA 4BIUA 2PMEA 2YICA 4UP7A 1BBUA 4JI2B 5H9CA 3UFGA 2YS8A 4P71A 1GM9A 1O9GA 1AILA 2EIMC 4X9QA 3UO2A 4XU3A 5EZYB 1KBHA 4JV5B 1J5EO 3WG7C 2Y0PA 1YITV 2XNDG 2QM8A 3FFQA 1Q3EA 5H6RA 1X56A 3TK1A 1GRJA 5IJ9B 1AR5A 1VQOV 2QJ1A 2OIGA 4X1YB 2ZNJA 4MVRA 2QKCA 1H4VB 2HR3A 4MTOA 4UCVA 1M5IA 3E22A 1JJOA 4UP9A 3CS5A
chains in the Genus database with same CATH topology
3E9IA 3I56V 2EJ9A 4YCVA 1AI4A 1USYC 3RKXA 2WLLB 1QE0A 4DO2A 3OR6C 1BIAA 1IL2A 1RIQA 2D3OW 1KD1W 1B7YA 4Q6GA 3PCOA 1QLEB 2XASA 3P30A 3T2MA 4FIPC 5IDJA 2Q67A 2Q7EA 1E1QG 3G71V 3SPGA 3ZRXA 3SPJA 1VQLV 1USYA 1K92A 2QEXV 4K88A 4KR2A 2WLHA 1VQ9V 2JIZG 2EINC 3K79A 1ADJA 2OCCC 4GT1A 2WLKA 4Q20A 2DKGA 2CJAA 2AKWB 4KUMA 2HLDG 2P5IA 3EFRA 1R3IC 4G85A 1R3JC 2DTOA 3A7UA 4YPFA 4PHCA 1NR7A 5CBGA 3D3IA 1YIJV 2FYKA 3I55V 2DEQA 5C53B 2JDIG 3NEMA 2XOKG 3RVZA 5CN0A 2W6IG 4TQDA 5HGQA 4QE7A 3W3SA 2A79B 1FFTB 1WYDA 3L4GA 5L3FA 2I4OA 3HXWA 1OCOC 1H8EG 1PL0A 3IGAC 4RUFA 5L3DA 1E22A 2EIMB 3M4QA 3E8HA 3ZRWB 5LHIA 3LSSA 2JJ2G 2V1DA 4WFAV 5L3CA 2DQ0A 1WU7A 3OM3B 1KMMA 2ZT6A 4YROA 2DQ3A 3A5ZA 3ZRVA 1S72V 1SESA 3F7VC 1MOFA 1WQWA 1ATIA 3ZMSA 2X6AA 1QVFU 4HVCA 4ZBMA 2BOBC 1ASYA 1EFWA 1H38A 1HXDA 2DU5A 1AJNA 3ASOC 2IU3A 4U7NA 3SYCA 1G8MA 1H4TA 3E89A 4G28B 2IU0A 3FYIB 4JYBA 5KA5A 3ZMVA 1K4CC 1VQKV 2IW5A 2R9RB 5L3BA 3IC7A 1ADYA 1B8AA 1RM1B 2UXXA 1QLNA 1V54C 2ZQMA 1ORQC 4OLFA 3UGTA 4H02A 1NBMG 2X0LA 1NH2D 4XDJA 3UGQA 2IJHA 3NELA 3G4SV 3HY0A 4TVAB 2KB1A 2DWDC 2P6JA 1K97A 2DTHA 2E1HA 4CS4A 3QO5A 3K04A 2RHSA 3V8LA 3ETGA 4K87A 5IY5C 5DM6V 5C93A 3NETA 4JAVA 3ABLC 1F4NA 4JYCA 1J5WA 4HWTA 2H8PC 2EZPA 4H33A 1KQSU 4PA3A 5EBLC 4BAYA 3AG3B 1NJ6A 3SPIA 4HWOA 3ERRA 3A31A 2EINB 3RW0A 3ABKC 4X5OA 3HB3B 3B8MA 4P74C 1ASZA 3HFVA 1OCCB 3FKSG 3VBBA 2I4NA 1ROPA 1HTTA 2LP7A 1PYSB 3KG2A 1KP2A 4XTXA 1AI7A 3NXSA 4P74A 2P7TC 4WF2A 1DTOA 4CH6A 2B5UA 3OR7C 1QCEA 2EIKC 4I9WA 3FB6C 4UV9A 1C0AA 4QPKA 1K9MW 2X7RB 5C51B 1OCOB 2I4LA 2IJIA 4MTXA 1M57B 4ZTUB 1Y4MA 4QNHB 1VQ7V 3HFZA 1FXHA 1M56C 4XTZA 4MVOA 4U7OA 1E1TA 2ZXFA 2WLNA 4PA4A 2E3CA 1H4QA 3A7AA 1SETA 1EIYB 5E1AC 2EJFA 1Q81W 3NENA 4WJ4A 5H6QA 3OEHG 4R6ZA 5IYBO 1Y66A 2CJ9A 4XEOA 3AG1C 3ML0A 3OAAG 3MEYA 3AG2C 3OFNG 5EC1C 3L1AA 4L87A 2PI4A 4EO4A 2YEVA 1JCHA 4K86A 3OD1A 4P73A 3OMIB 2P0LA 3ICAA 1YJ9V 3ABMC 3CC4V 1JQ0A 2PMFA 4KR3A 4WJ3M 3UH0A 1DF5A 1NKDA 4N21A 1YJNV 4JGSA 4TWKA 3K3WA 5IYDO 1XL6A 1B70B 3CCSV 2E10A 4MS2A 1P7BA 3CCRV 4JASA 2RHQB 3GWOA 1QF6A 1L1FA 4FMTA 3V7RA 3JCZA 2FTKA 4X89A 4H2WA 4DQ2A 1G51A 4RDXA 1NJIW 1F51A 3SYAA 5LGNA 2WLMA 3F5WC 4PA9A 1KKDA 2AHYA 3A7RA 4LCUC 4P3OA 2QE7G 1SERA 4P72A 1L0WA 4YCUA 1NQTA 4X8AA 1TUEB 2AMCA 2EWNA 1M1KW 5KA6A 1E24A 3L2ZA 4BIZA 4YYEA 1GTOA 1NH2B 3QO8A 4H2SA 2ARTA 1YB3A 1EQRA 1F23A 1YSCA 1DLBA 1N9WA 4H2XB 1Z7NA 4WFBV 4WI1A 3SYOA 1S77D 2XAHA 2ZINA 5KNNA 2MK3A 3ABKB 3RGLA 12ASA 1RPRA 4TWAA 3VOUA 4XEMA 2GSMB 3ETEA 1EOVA 3WFVA 1X01A 5E3IA 4P30A 4P9OA 4YRTA 4EKWA 2WLIA 3KFUA 2WAMA 4XTYA 3HRKA 3MHSC 2DYSB 3E2EA 4ZKIA 5ELOA 2EIKB 1YHQV 4HYOA 3HFZB 2K1EA 3HXZA 2ZIMA 2EILC 3MD0A 3A74A 4E2LA 2WWWA 2UXNA 2ZDIC 2ZGWA 1FYFA 2JK5C 4PDVA 3T4ZA 1NYQA 1MG1A 4P3PA 3CC2V 3QNEA 4MVQA 2DYRC 3E83A 3OUSA 3ZMZA 2Y69B 1M9NA 5DN6G 2ZDIA 1GGMA 3FB5C 2EL9A 1EVKA 1GK9A 2EIJC 4KQEA 1Z7MA 3HXYA 2EJRA 3E35A 1EBOA 3SJQC 3AG1B 1LNQA 4UVCA 1V55C 2ARUA 3WG7B 1FXKC 1JJCB 5ELNA 1JJ2U 1NJ5A 1LYLA 1SRYA 4XBFA 4YRFA 5IYCO 2E65A 5J9PC 3P8TA 4MVSA 11ASA 1VQ4V 2Z3YA 1FXKA 3HY1A 4P9PA 4UV8A 1GM8A 5LBQA 1CEZA 1WNLA 1NR1A 2E64A 4TVWA 2Q5HA 3ABUA 3FB8C 2BOCC 3VQYA 2WPDG 1QR9A 4LC1A 3LUTB 4H2TA 4PA6A 1KECA 5HFMA 1FS0G 4XU2A 4YRRA 1NJ2A 3CCLV 4HWRA 1VQNV 4EX5A 1QVGU 4RMFA 3ZJZA 5B3SC 4CH3A 3OMAB 4GX0A 1WLEA 1W0KG 2CK3G 4CBCA 1F4MA 4TSFG 1YGBA 2EBOA 1W0JG 2P67A 5L3GA 2HKOA 5GW7A 1Q7YW 3UKMA 1Q86W 1B7YB 3HTZA 3PCOB 4YP0A 4AH6A 1YFSA 4KFMA 5B1BC 1P4RA 1AJQA 3K0DA 1OCZC 1XL4A 3W7SA 3D36A 4HAMA 2C7IA 1B76A 4XU1A 3V7SA 1THZA 2ZT8A 1COWG 3CYOA 4FJCC 4QPJA 2LFRA 1NJ8A 4OP0A 4RQFA 3REXA 1NYRA 1JVMA 3BEHA 2OCCB 4GX1A 4P3NA 1AJPA 2J3LA 2NNUA 4H37A 4BW5A 4H2YA 4UP8A 4YRLA 2QTOA 3L4GB 2WLJA 4JPRA 1X55A 1VQ8V 3B77A 5KUKA 2EILB 3X2QC 3ZN1A 3AG4C 1WPYA 2C8MA 3JD4A 3OMNB 4E51A 3K08A 2ZR3A 4YRPA 4CH4A 1GO3F 4LVIA 2WSSG 2B1IA 4WF9V 1PNLA 4QJFB 2ZXWC 1EZJA 3TCUA 1B6QA 4MTFA 4ASUG 1NVPD 2DZCA 4YRJA 4YREA 4YRNA 3BJUA 4HZ3A 5CBHA 3QTCA 1OZ0A 3CMAV 2ZIOA 3IALA 1QLEC 1VQ6V 4HWSA 2JEXA 4YDQA 3ASNC 4X88A 2DU7A 4P73C 2WLLA 3DSQA 5HFLA 1JPXA 5B1AC 3ZCCA 2ZCEA 3M99B 2DXUA 2C2AA 4CS3A 2ODRC 3ASOB 1KMNA 5L3EA 2E41A 2XGTA 3HRIA 1R73A 5BZBA 1K34A 4J9YB 3M4PA 4YRQA 1H2GA 1KP3A 2GHYA 2AHZA 3HXVA 3B8NA 2AKWA 3V8KA 4LVJA 1HC7A 1V54B 2A9HA 3P32A 1K3EA 3RF1A 2QHTA 4R8CA 2RHSB 3RKYA 3P8YA 1J95A 4TVYA 3T4DA 2QM7A 1WQ7A 4LNSA 3LC0A 2XAFA 3JD3A 2CJBA 5CBFA 2EZOA 2ZZFA 3P8VA 4YRSA 2IJJA 3SPHA 4JTCB 1I5YA 1ZWIC 4DXWA 3ZRWA 3HXXA 2ITDC 5IY5B 3RVYA 3ZMTA 3ABLB 3CCVV 1X2GA 1K4DC 2Z5UA 4ZTZB 4DPGA 3CC7V 3MF2A 3RUXA 2Q69A 4TT3G 3TETA 2EAYA 2JJ1G 4H2UA 3E8BA 5CA3A 5F5WA 3TEHB 3VQXA 2IH3C 3I7FA 5C52B 3FB7C 2DXTA 2ITCC 2W0FC 4GX2A 4PA7A 1X2HA 5B1OA 2ZZEA 1OCRC 1VQ5V 3CD6V 4XTWA 1RM1C 2EJGA 3ZRSA 3BY6A 1CPYA 2LFSA 2M7WA 5FL7G 3CCMV 1BHAA 4RAIA 1EVLA 3K0GA 1G5HA 4TTVA 3CCUV 3E8FA 4J9ZB 3W7UA 4MW3A 4CH5A 1YTFD 4YRGA 3X2QB 4LVMA 1SZTA 4MTGA 3RKWA 4BW9A 2HFEC 3G6EV 4ZIBA 1YJWV 2ZZGA 1S5HC 4JF3A 3JD1A 1Q82W 2DDZA 1QBZA 3A32A 3CXCU 3A5YA 3DTUB 3OW2U 4TQFA 4TVAA 1M56B 4UPAA 1QR8A 5K1PA 2YEVB 3ASNB 3K03A 4MVMA 2HVJC 4Q15A 2QHSA 3AG3C 3CP1A 5LHGA 4QE9A 5B1AB 5EK0A 4FK5C 2R9IA 3AG2B 2X6CA 4UVAA 4WFHA 4RO2A 1NVPB 1OCCC 2H94A 3ABMB 3RL6A 3W7WA 3JD2A 4G2KA 3A0RA 1BMFG 4N23A 2DW4A 2DZ9A 2CGHA 1BL8A 4WFGA 3IFXA 3PJSK 3STZC 2OTJV 2DJZA 3E8GA 2JEUA 4FPPA 2G4CA 3MF1A 4YCWA 3OUFA 2OT5A 2IJKA 4UUJC 1W2BU 5K1XA 3AEIA 1MSWD 2NLJC 4GX5A 3TUPA 2YSUB 2E5AA 1PYSA 1VQZA 3OE7G 1M57C 4KP4A 4R7CA 1W66A 3CMQA 2ZTGA 4I5SA 3ZIAG 2AMCB 3SYPA 1HWYA 2HNIA 2QHUA 4XTUA 3TEHA 2X6BA 5CMUA 1K33A 3F7YC 4XU0A 4XDLA 2A8EA 2V7QG 2Q7HA 3V8JA 3QO7A 4LP8A 3OEEG 4CZZA 2J3MA 1EIYA 3CCQV 1KC8W 1AROP 3LNMB 1G4YB 1PNMA 4LVLA 2IH1C 1YFTA 2WLIB 3K06A 3ZMUA 1OCRB 2QKSA 2XTIA 4MVZA 1WPXA 1E1OA 3MHHC 2XAGA 4UVBA 5EBMC 3T1CA 2IY5A 2I4MA 3CCJV 2XAJA 1MABG 1CP9A 1E79G 1PNKA 4JAUA 5LGTA 1GMGA 3EHBB 1B70A 3IKLA 2QA4V 2HG5C 4P72C 4F4LA 2HVKC 1K7DA 3V7CA 1ENVA 5B1NA 1PKXA 3EFFK 3FYEB 4JTDB 2P90A 3STLC 2RHQA 4YRIA 4PG3A 4XTVA 3W7XA 5KUMA 4HA8A 3RIRA 1EFRG 1I5XA 1GM7A 3RBZA 4Z1MG 2PI5A 1S76D 3E86A 2ZT7A 3G1ZA 3LDEA 2DYRB 1OHHG 2ODRD 1YTFB 2ALYA 3WQZA 1S0VA 4CS2A 3JD0A 3R65A 2EIJB 3RACA 3R07A 3E9HA 2DVEA 4PDLA 3HPLC 4O2DA 3CCEV 4G84A 3H01A 1V55B 1IXMA 1H4SA 4MW8A 1FXKB 3ZN0A 2ZNIA 3JYCA 4YXWG 3IKMB 3W7TA 4QIWF 4H2XA 1UJWB 2ZD9A 2DTIA 4HT4A 2ZT5A 3BFMA 4GCZA 5LGUA 3ABTA 4R50A 3CMEV 1S3JA 4NCXA 2A0LA 1M90W 2Q68A 2DYSC 2ARSA 4MSWC 1DF4A 1K73W 1E1RG 2DWEC 2HJFC 3EFSA 1R6KA 4P2ZA 4UXNA 2CIMA 1NNHA 4BIUA 1R6NA 1VQPV 4P71C 2PMEA 1R3LC 1FXVA 4MVUA 4P75C 3OGCC 1BBUA 2F43G 3CPWU 4WFFA 3GB7C 4OXSA 4UP7A 3TEGA 2XAQA 4WCEV 4PELA 5H9CA 4J15A 2W6JG 4MT8A 3SPCA 1K8AW 4YRCA 4RUEA 2NS6A 3UFGA 5B3SB 4P71A 1GM9A 5EC2C 4P75A 2Y69C 4LVKA 2EIMC 1BBWA 4XU3A 1PD3A 2ATKC 1VQMV 4XDKA 4RQEA 4LBEC 1N8RW 3LDDA 3PZCA 4YRMA 3LDCA 5B1BB 3WG7C 1KOGA 2OTLV 4YRKA 1JOYA 1JX9A 4HWPA 4JTAB 1YITV 1X54A 1NJ1A 2XNDG 1H8HG 2QM8A 1GKFA 1OCZB 1AI5A 1R3KC 2Q6AA 4G27B 5LHHA 5H6RA 2IY5B 4PDRA 1AR1B 3ETDA 1X56A 3TK1A 1BHBA 1JJCA 3REUA 2Q7GA 1VQOV 3HXUA 3DGEA 3SYQA 3UM7A 1K5QA 2QHVA 2ZNJA 3MQZA 3VQWA 3K9AA 4MVRA 2B1GA 1K5SA 1H4VB 4H2VA 2HR3A 1AI6A 3VQVA 4MTOA 1YFRA 1BIBA 5EBWC 4WFEA 3FJPA 3AG4B 4PDMA 2ALYB 3LSQA 1YI2V 1G5IA 4BWAA 4UP9A 3IG2A 2Y48A 2ZR2A 2ZXWB 2Q5IA 1RPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9I A;  2EJ9 A;  4YCV A;  1USY C;  3RKX A;  1QE0 A;  1BIA A;  1IL2 A;  1RIQ A;  1B7Y A;  4Q6G A;  3PCO A;  2Q7E A;  1USY A;  4K88 A;  1ADJ A;  2DKG A;  2CJA A;  2AKW B;  2P5I A;  4G85 A;  3EFR A;  2DTO A;  3A7U A;  4YPF A;  4PHC A;  5C53 B;  2FYK A;  2DEQ A;  3NEM A;  4TQD A;  5HGQ A;  3W3S A;  1WYD A;  3L4G A;  2I4O A;  3HXW A;  1E22 A;  3M4Q A;  1WU7 A;  3LSS A;  2DQ0 A;  1KMM A;  2ZT6 A;  4YRO A;  2DQ3 A;  3A5Z A;  1SES A;  1WQW A;  1ATI A;  4HVC A;  1ASY A;  1EFW A;  1HXD A;  2DU5 A;  1H4T A;  1ADY A;  1B8A A;  4OLF A;  3UGT A;  3UGQ A;  3NEL A;  3HY0 A;  4TVA B;  2DTH A;  2E1H A;  4CS4 A;  3QO5 A;  2RHS A;  3V8L A;  4K87 A;  3NET A;  1J5W A;  4HWT A;  1NJ6 A;  4HWO A;  3ERR A;  3A31 A;  4X5O A;  4P74 C;  3HFV A;  3VBB A;  2I4N A;  1HTT A;  1PYS B;  4XTX A;  4P74 A;  4WF2 A;  4CH6 A;  1C0A A;  2I4L A;  4ZTU B;  3HFZ A;  4XTZ A;  1E1T A;  2ZXF A;  2E3C A;  1H4Q A;  3A7A A;  1SET A;  1EIY B;  2EJF A;  3NEN A;  4WJ4 A;  4XEO A;  2CJ9 A;  3MEY A;  3L1A A;  4L87 A;  4EO4 A;  4K86 A;  3OD1 A;  4P73 A;  2P0L A;  3ICA A;  4KR3 A;  2PMF A;  4WJ3 M;  3UH0 A;  1B70 B;  2E10 A;  2RHQ B;  1QF6 A;  3V7R A;  4H2W A;  4DQ2 A;  1G51 A;  4RDX A;  5C51 B;  3A7R A;  4P3O A;  1SER A;  1L0W A;  4YCU A;  2EWN A;  2AMC A;  1E24 A;  3L2Z A;  4YYE A;  3QO8 A;  4H2S A;  2ART A;  1YB3 A;  1EQR A;  1N9W A;  4H2X B;  1Z7N A;  4WI1 A;  2ZIN A;  5KNN A;  3RGL A;  12AS A;  4TWA A;  4XEM A;  1EOV A;  1X01 A;  4YRT A;  3KFU A;  4XTY A;  3HRK A;  5ELO A;  3HFZ B;  3HXZ A;  2ZIM A;  3A74 A;  2ZGW A;  1FYF A;  1NYQ A;  4P3P A;  3QNE A;  1GGM A;  2EL9 A;  1EVK A;  4KQE A;  1Z7M A;  3HXY A;  2ARU A;  1JJC B;  5ELN A;  1NJ5 A;  1LYL A;  1SRY A;  4YRF A;  2E65 A;  3P8T A;  11AS A;  3HY1 A;  1WNL A;  2E64 A;  4TVW A;  2Q5H A;  3VQY A;  4H2T A;  4XU2 A;  4YRR A;  1NJ2 A;  4HWR A;  4EX5 A;  4RMF A;  4CH3 A;  1WLE A;  4H02 A;  1YGB A;  1B7Y B;  3HTZ A;  4YP0 A;  3PCO B;  4AH6 A;  1YFS A;  2C7I A;  1B76 A;  4XU1 A;  3V7S A;  2ZT8 A;  3REX A;  1NJ8 A;  4OP0 A;  4RQF A;  1NYR A;  4P3N A;  4UP8 A;  2J3L A;  4H2Y A;  4YRL A;  3L4G B;  1X55 A;  1WPY A;  2C8M A;  4E51 A;  2ZR3 A;  4YRP A;  4CH4 A;  4YRE A;  4YRN A;  2DZC A;  4YRJ A;  3BJU A;  3QTC A;  2ZIO A;  3IAL A;  4HWS A;  4YDQ A;  2DU7 A;  4P73 C;  3DSQ A;  2ZCE A;  2DXU A;  4CS3 A;  2ODR C;  1KMN A;  2E41 A;  2XGT A;  3HRI A;  3M4P A;  4YRQ A;  3HXV A;  3V8K A;  2AKW A;  1HC7 A;  3RF1 A;  2QHT A;  2RHS B;  3RKY A;  3P8Y A;  4TVY A;  1WQ7 A;  4LNS A;  3LC0 A;  2CJB A;  4YRS A;  2ZZF A;  3P8V A;  3HXX A;  1X2G A;  4ZTZ B;  4DPG A;  3MF2 A;  3RUX A;  2EAY A;  4H2U A;  3VQX A;  5F5W A;  3I7F A;  5C52 B;  2DXT A;  2ZZE A;  1X2H A;  4XTW A;  2EJG A;  1EVL A;  4TTV A;  1G5H A;  4CH5 A;  4YRG A;  4BW9 A;  4ZIB A;  3RKW A;  2ZZG A;  2DDZ A;  3A32 A;  3A5Y A;  4TQF A;  4TVA A;  4UPA A;  5K1P A;  4Q15 A;  2QHS A;  3RL6 A;  2DZ9 A;  2CGH A;  5E3I A;  2DJZ A;  2G4C A;  3MF1 A;  4YCW A;  5K1X A;  3TUP A;  2E5A A;  1PYS A;  1VQZ A;  1W66 A;  3CMQ A;  2ZTG A;  2AMC B;  2HNI A;  4XTU A;  2QHU A;  3TEH A;  4XU0 A;  2Q7H A;  3V8J A;  3QO7 A;  2J3M A;  1EIY A;  1YFT A;  2XTI A;  1E1O A;  2IY5 A;  2I4M A;  1B70 A;  3IKL A;  4P72 C;  3V7C A;  2RHQ A;  4YRI A;  4PG3 A;  4XTV A;  4HA8 A;  3RIR A;  4P72 A;  2ZT7 A;  3G1Z A;  2ODR D;  2ALY A;  3WQZ A;  4CS2 A;  3RAC A;  3R07 A;  3E9H A;  2DVE A;  4O2D A;  4G84 A;  1H4S A;  2ZNI A;  3IKM B;  4H2X A;  2DTI A;  2ZT5 A;  3BFM A;  4NCX A;  1KOG A;  2ARS A;  4KR2 A;  3EFS A;  2CIM A;  1NNH A;  1ASZ A;  2PME A;  4P71 C;  4P75 C;  3TEH B;  4UP7 A;  1BBU A;  3TEG A;  4J15 A;  4YRC A;  3UFG A;  4P71 A;  4P75 A;  1BBW A;  4XU3 A;  4RQE A;  3PZC A;  4YRM A;  4YRK A;  4HWP A;  1X54 A;  1NJ1 A;  2IY5 B;  1X56 A;  1JJC A;  3REU A;  2Q7G A;  3HXU A;  2QHV A;  2ZNJ A;  3VQW A;  1H4V B;  4H2V A;  3VQV A;  1YFR A;  1BIB A;  3FJP A;  2ALY B;  3LSQ A;  1G5I A;  4BWA A;  4UP9 A;  3IG2 A;  2ZR2 A;  2Q5I A; 
#chains in the Genus database with same CATH topology
 4D7S A;  3E9I A;  2EJ9 A;  1AI4 A;  1I94 B;  4YHH B;  2R72 A;  2WLL B;  4H13 B;  3U11 A;  2OIE A;  3CJH A;  4Q6G A;  3PCO A;  2XAS A;  2Q67 A;  3A2F A;  3SPG A;  4DR2 O;  2YID A;  1VQ9 V;  2JIZ G;  3K79 A;  5LOV A;  1ADJ A;  2OCC C;  2WLK A;  2UUB B;  4IYH A;  2CJA A;  1MMM A;  4G85 A;  3A0H Z;  2UXC B;  2O57 A;  2QTS A;  4PHC A;  5LP6 B;  2DEQ A;  4K3A A;  4QE7 A;  2I4O A;  5L3D A;  1H8E G;  1P49 A;  1PL0 A;  3IGA C;  1IBM B;  1E22 A;  1KYO F;  1QNM A;  3SDL A;  4WFA V;  2JJ2 G;  1XDC A;  4YRO A;  2DQ3 A;  3A0B Z;  3F5T A;  4YJ2 A;  1NI8 A;  1MOF A;  1BSM A;  2OWO A;  1ATI A;  3BAA A;  3RYF A;  4EFB A;  1ASY A;  1O9H A;  1SA0 A;  1AJN A;  3SYC A;  4G28 B;  2A3Q A;  4GKK B;  5KA5 A;  4JYB A;  3ZMV A;  4AIL C;  2DJV A;  4FZ1 A;  1RM1 B;  4O2B B;  4Z2W A;  1V54 C;  1QLN A;  3IJ4 A;  4X64 B;  2PF4 E;  2ZQM A;  4KXR A;  5CB4 A;  1NBM G;  1NH2 D;  3D3Q A;  4KHP B;  1WP7 A;  4GYC B;  1TUB A;  2E1H A;  4FLU A;  3K04 A;  2RHS A;  3V8L A;  5JH7 B;  3NET A;  4JAV A;  3ABL C;  2H8P C;  2Q8V A;  1PV0 A;  2JGD B;  1NJ6 A;  3SPI A;  3RW0 A;  3ABK C;  2QSA A;  4P74 C;  4H44 B;  2F93 B;  3FKS G;  1ROP A;  2PUS A;  1HTT A;  4L8J A;  1PYS B;  1KP2 A;  4X66 O;  3HKE A;  2B5U A;  3OR7 C;  2EIK C;  1OV9 A;  3DXR B;  4H0L B;  1WNS A;  2IJI A;  4IHJ B;  1M57 B;  5JVD B;  3RT3 C;  4QNH B;  4TOI A;  4XTZ A;  2E3C A;  4PA4 A;  1H4Q A;  3A7A A;  1VF7 A;  4DV5 B;  4WJ4 A;  3OEH G;  1Y66 A;  2M6Y A;  2CJ9 A;  3CWB H;  3ML0 A;  4L87 A;  4EO4 A;  1JCH A;  2DMX A;  4K86 A;  2P0L A;  4KR3 A;  4WJ3 M;  2FL4 A;  3TJT A;  4JI4 O;  1CXZ B;  1YJN V;  1HW7 A;  4TWK A;  1OJH A;  1XL6 A;  4FM0 A;  1B70 B;  1P7B A;  5KHH A;  2UU9 O;  4LF6 O;  3GWO A;  1XNR O;  2FTK A;  4RDX A;  2UUA B;  3BFR A;  2WA3 A;  3G6B A;  4PA9 A;  4P3O A;  2F1M A;  2JS5 A;  3K9S A;  1TUE B;  5KA6 A;  1E24 A;  4BIZ A;  2MW2 B;  1YB3 A;  1F23 A;  1YSC A;  1N9W A;  1D2D A;  4WI1 A;  1SQB H;  2XAH A;  4DR7 O;  12AS A;  4YJ3 B;  4UB8 Z;  3VOU A;  1NTK H;  4OPH A;  4EKW A;  2WAM A;  5GTI Z;  4B3T O;  3CHX A;  2K1E A;  4B3M O;  3HXZ A;  1HNX O;  2EIL C;  3MD0 A;  5JCO C;  2ZGW A;  3H1I H;  2UXN A;  1FYF A;  4O2A A;  1MG1 A;  1N4C A;  1PM9 A;  1IBK B;  3ZMZ A;  3FB5 C;  4KQE A;  4ZOL B;  4LF8 B;  1EBO A;  3AG1 B;  5IWA O;  4X20 A;  2ARH A;  4K35 A;  1FXK C;  1JJC B;  5EIB C;  1JJ2 U;  1SRY A;  4K8X A;  4NVP A;  4ZHQ A;  1AP6 A;  1GM8 A;  2XHB A;  4JI8 B;  4HBN A;  4TVW A;  3ABU A;  4FLY A;  1H2M A;  4PA6 A;  1KEC A;  5HFM A;  1FS0 G;  4IL6 Z;  4YRR A;  3BPZ A;  4HWR A;  2LQT A;  4RMF A;  4CH3 A;  3OMA B;  1W0K G;  4CBC A;  1W0J G;  2P67 A;  3HTZ A;  4X65 O;  1Y67 A;  4DR3 B;  1XNQ B;  5EZY A;  4E4E A;  5J2U A;  3D36 A;  4HAM A;  1Q6H A;  4XU1 A;  1THZ A;  3JAL B;  4I55 A;  3OT7 A;  4P3N A;  4UP8 A;  2J3L A;  5IJ9 A;  1SQP H;  2QTO A;  4DV7 B;  4JPR A;  3L4G B;  1W59 A;  5KUK A;  1GN3 A;  4X1Y A;  3X2Q C;  3AG4 C;  1WPY A;  3JD4 A;  4E51 A;  3K08 A;  3T1H O;  1GO3 F;  1XOU A;  2ZXW C;  1EZJ A;  3TCU A;  4ASU G;  1NVP D;  4YRN A;  2JGU A;  1AP5 A;  3QTC A;  2ZIO A;  1QLE C;  4X88 A;  2DU7 A;  3L70 H;  2WLL A;  5HFL A;  1VAR A;  2ZCE A;  1HNW B;  2C2A A;  1X59 A;  3HRI A;  1R73 A;  3M4P A;  1H2G A;  2JRI A;  5FNV B;  5A9G A;  3K5N A;  4JYA B;  4TV8 B;  5B66 Z;  1F7Y A;  2QHT A;  5LP6 A;  3RKY A;  1J95 A;  3LC0 A;  2XAF A;  2ZZF A;  5KAI Z;  3RVY A;  3CCV V;  3QVN A;  2AXT Z;  3RUX A;  1BCC H;  2JJ1 G;  3FD9 A;  3VQX A;  5CA3 A;  2IH3 C;  1D5N A;  2DXT A;  2ITC C;  4IIJ A;  2RN9 A;  1OCR C;  1T5E A;  1GN4 A;  2AW9 A;  5FL7 G;  1G5H A;  4TTV A;  3K0G A;  4CH5 A;  3CCU V;  3E8F A;  4ZIB A;  4EEQ A;  3TXS A;  4O2B A;  1N33 B;  1S5H C;  5IJ0 B;  5JQG B;  5ITZ A;  1QBZ A;  2LGW A;  3A32 A;  3CXC U;  1WJZ A;  3DTU B;  2Q73 A;  4UPA A;  4MVM A;  2EX3 A;  2QHS A;  3AG3 C;  4QE9 A;  4O4L B;  3SGI A;  5JH7 A;  5EK0 A;  4FK5 C;  3AG2 B;  1JMK C;  2NN4 A;  1GAX A;  3RL6 A;  3TXQ A;  3J7A U;  4PV1 B;  1BMF G;  4PD4 F;  2DW4 A;  3MF1 A;  2JEU A;  3L75 H;  2OT5 A;  2IJK A;  4FLX A;  3ZHQ A;  1MSW D;  3TUP A;  1PYS A;  3RYI B;  1VQZ A;  2ETN A;  1BT8 A;  3DXR A;  2AMC B;  1ZX3 A;  3L72 H;  4IHJ A;  2X6B A;  4LR3 A;  4O4H B;  3JAK A;  3F7Y C;  5JVD A;  1IBL O;  4XU0 A;  2YIB A;  3OEE G;  2J3M A;  4IT5 A;  1GH6 A;  4J42 A;  4B3S O;  1YFT A;  2ZKO A;  4GKJ O;  2XTI A;  3MHH C;  1L0N H;  4DRX B;  3CCJ V;  3R66 A;  1MAB G;  1E79 G;  1B70 A;  2VQE B;  1AR4 A;  3C3S A;  1K7D A;  3EFF K;  2VRZ A;  4AQY O;  2Y4U A;  2P90 A;  1BGY H;  4XTV A;  1I5X A;  3ETQ A;  4Z1M G;  1VP7 A;  3E86 A;  4DV0 O;  1OHH G;  2ODR D;  2ALY A;  5JJJ B;  3OTO B;  1S0V A;  3R65 A;  3RAC A;  3R07 A;  4JI6 B;  3E9H A;  1US6 A;  4X1K B;  4G84 A;  1MSD A;  1QU7 A;  4UFZ A;  2KG7 B;  4QIW F;  2DTI A;  2UXD O;  4GCZ A;  1S3J A;  2A0L A;  1M90 W;  2ARS A;  2HJF C;  4YJ3 A;  3APO A;  1NNH A;  1R6N A;  1VQP V;  4P71 C;  4NTX A;  1R3L C;  3TEH B;  1N32 O;  3OGC C;  4W4L A;  2F43 G;  3CPW U;  3GB7 C;  1SS3 A;  1FD9 A;  5JJN B;  4PEL A;  4RUE A;  4NXN B;  4LVK A;  4P75 A;  2Y69 C;  2YC0 A;  1VQM V;  4XDK A;  5LYJ B;  3B2E E;  4LBE C;  5D5Q A;  1N8R W;  1IDS A;  3J81 N;  3PZC A;  4UCS A;  3N27 A;  2OTL V;  4ZOL A;  1OCZ B;  1AI5 A;  2Q6A A;  2IY5 B;  5LHH A;  1FFX B;  4PDR A;  3UQ8 A;  1AR1 B;  1JJC A;  3DGE A;  2VQF O;  3SYQ A;  1IXB A;  1SKV A;  4JI7 O;  3K9A A;  1K5S A;  4H2V A;  1AI6 A;  1RFY A;  3BA8 A;  1YFR A;  5LL6 Y;  5EBW C;  3FJP A;  5TIS Z;  3AK3 A;  4F6R B;  1FYJ A;  2K9P A;  3E35 A;  1QE0 A;  2F4V O;  4GLX A;  2UUC O;  1IUR A;  4UCR A;  3EXA A;  4OX9 B;  4DK1 A;  2N74 A;  1USY A;  3SPJ A;  1Q6I A;  1K92 A;  4K88 A;  1YCI A;  2RCV A;  4GT1 A;  3K58 A;  2P5I A;  1R3I C;  1R3J C;  4DV6 O;  4YPF A;  5CBG A;  3D3I A;  4LFB B;  4LF5 O;  3RYC B;  3I55 V;  2XOK G;  2W6I G;  2CTR A;  3L4G A;  1OCO C;  2EIM B;  1XMO O;  1IX9 A;  3BHP A;  3JAS B;  1U97 A;  3OM3 B;  1S5L Z;  1SES A;  1YEW A;  2E5L B;  1QVF U;  4HVC A;  4DR5 O;  4ZBM A;  3ASO C;  2IU3 A;  4X62 O;  5LMN O;  2F95 B;  3FYI B;  3JAM N;  2FML A;  2R9R B;  1B8A A;  3UO3 A;  2D2C B;  3ZHU A;  1WN7 A;  5FNV A;  2IJH A;  4TV8 A;  3G4S V;  4TVA B;  2P6J A;  1K97 A;  5D5P A;  3QO5 A;  1P84 F;  4UCO A;  5IY5 C;  1F4N A;  2ADQ B;  4HWT A;  4H33 A;  2H3O A;  4BAY A;  3L71 H;  2EUL A;  2HJD A;  3S3W A;  3B8M A;  3RGB A;  2CTQ A;  1J5E B;  3KG2 A;  4XTX A;  1ZSP A;  2CTW A;  4WF2 A;  4UV9 A;  1C0A A;  3UCS C;  2I4L A;  4MTX A;  1VQ7 V;  2YI8 A;  5JQG A;  4LF7 O;  5GON B;  4QGP A;  5E1A C;  1Q81 W;  1Z2G A;  4XEO A;  5IYB O;  4YY3 O;  3OFN G;  3HKB B;  2PI4 A;  1ZTE A;  3OD1 A;  4P73 A;  1JQ0 A;  4O4L A;  1L0L H;  1NKD A;  2E76 B;  3K3W A;  5LMU O;  4J80 A;  3CCS V;  2E10 A;  3JAW A;  3CCR V;  2BCC H;  2RHQ B;  1QF6 A;  4DR2 B;  3JCZ A;  3Q4H B;  4H2W A;  1SQX H;  3RYI A;  3A7R A;  2AHY A;  4LCU C;  2QE7 G;  1SER A;  1NZ6 A;  2EWN A;  2AMC A;  1NH2 B;  4H2S A;  1BS3 A;  2ART A;  1WPB A;  1WB8 A;  5DEC A;  1DLB A;  1EQR A;  1Z7N A;  1S77 D;  3ABK B;  3LSU A;  1RPR A;  3ETE A;  1EOV A;  3CE2 A;  1JFF B;  3WFV A;  1X01 A;  1VIB A;  4XTY A;  2DYS B;  3E2E A;  2EIK B;  1YHQ V;  3HFZ B;  2ZIM A;  2WA4 A;  3A74 A;  2JK5 C;  4P3P A;  3K5L A;  2FKX A;  3CC2 V;  4MVQ A;  2DYR C;  3E83 A;  2ZDI A;  1GGM A;  2OYQ A;  2EIJ C;  1B3Q A;  1Z7M A;  3HXY A;  2EJR A;  1V55 C;  2ODM A;  1YF2 A;  5H2F Z;  1XI1 A;  3WU2 Z;  4XBF A;  2E75 B;  1XHZ A;  4X1K A;  5J9P C;  2ZM6 O;  3P8T A;  4MVS A;  1VQ4 V;  2Z3Y A;  2KG7 A;  1RSO B;  2GDS A;  1WNL A;  2E64 A;  1FJG O;  3FB8 C;  3VQY A;  4JI0 O;  5BXZ A;  3U10 A;  4LF4 O;  1VQN V;  2GTA A;  5C8Y A;  4LWS B;  1QVG U;  1JA8 A;  4DUZ O;  2ILM A;  3CX5 F;  5KX5 A;  1YGB A;  1B7Y B;  2HKO A;  1Q86 W;  4AH6 A;  4X66 B;  4KFM A;  1Q5O A;  3D36 C;  1P4R A;  1AJQ A;  5LYJ A;  4I50 B;  1FPO A;  3V7S A;  1B76 A;  2VWJ A;  4O4I B;  2ZT8 A;  1COW G;  4QPJ A;  4RQF A;  3AK2 A;  1AJP A;  2RMK B;  4H2Y A;  2WLJ A;  3B77 A;  4TV9 B;  2EIL B;  1XEQ A;  2ZE6 A;  3ZN1 A;  4JI4 B;  4DUY O;  1PNL A;  2E74 B;  1MZE A;  3KCY A;  3T1Y O;  5CBH A;  2UU9 B;  3CMA V;  3HR0 A;  1XHX A;  4F6R A;  2JEX A;  4YDQ A;  3ASN C;  1TA8 A;  1XNR B;  3DSQ A;  3M99 B;  5L3E A;  3G67 A;  5LP6 C;  2GHY A;  3HXV A;  1HDJ A;  3B8N A;  1HC7 A;  3P32 A;  1K3E A;  3RF1 A;  4DR7 B;  3RYH B;  4TVY A;  1WQ7 A;  4DR6 O;  2CJB A;  4YRS A;  3P8V A;  2DOS A;  2IJJ A;  3SPH A;  1ZWI C;  4B3T B;  3ZX6 A;  2ITD C;  3ZMT A;  4F6E A;  3ZBH A;  4B3M B;  1X2G A;  4DV4 O;  1HNX B;  4DPG A;  5BMV B;  3MF2 A;  3DC6 A;  2XUM A;  1JR9 A;  2GV9 A;  2VWK A;  4GX2 A;  3CD6 V;  1U96 A;  1RM1 C;  2EJG A;  3K5M A;  3CCM V;  4RAI A;  5IWA B;  4J9Z B;  4MW3 A;  4ZI7 A;  4NXM O;  4LVM A;  3X2Q B;  1SZT A;  4MTG A;  5CA0 A;  1XMQ O;  1HR0 O;  2PGG A;  4JF3 A;  1YXB A;  4NB5 A;  1Q82 W;  4DV3 O;  5EIB D;  4TVA A;  4BR6 A;  1M56 B;  1Y6X A;  4I0X A;  1QR8 A;  2CGN A;  5K1P A;  2YEV B;  3K03 A;  2HVJ C;  4Q15 A;  1H2K A;  3M7M X;  3IAY A;  4UVA A;  4RO2 A;  4WBN B;  2UXB O;  1NVP B;  3ABM B;  4G2K A;  3A0R A;  4X65 B;  5BR8 O;  2Q0A A;  2DZ9 A;  2CGH A;  4WFG A;  3IFX A;  3STZ C;  5E3I A;  3CRC A;  2G4C A;  1PP9 H;  3OUF A;  4GZR B;  1WA8 A;  2GTS A;  4JI5 O;  1M57 C;  1W66 A;  5IYZ A;  4I4T B;  4NR1 A;  1NTZ H;  3ZIA G;  3SYP A;  1HWY A;  3SR2 C;  4PI0 A;  3BAB A;  5CMU A;  1K33 A;  4XDL A;  2V7Q G;  2QWQ B;  3V8J A;  3QO7 A;  1UPG A;  2EJ7 A;  5GON A;  5KHJ A;  4YIO A;  3T1H B;  1HNZ O;  4DV1 O;  4FFB B;  2IH1 C;  2WLI B;  3K06 A;  3N2K B;  1OCR B;  2QKS A;  2XAG A;  4UVB A;  2Q9L A;  5EBM C;  2ZE5 A;  4B08 A;  2XAJ A;  4JAU A;  1GMG A;  3EHB B;  3KCX A;  2QA4 V;  2HG5 C;  5E79 Z;  2Y0I A;  4JTD B;  1PKX A;  3STL C;  2RHQ A;  4HA8 A;  5KUM A;  3RIR A;  1Q43 A;  1EFR G;  3Q4H A;  2PI5 A;  1S76 D;  3G1Z A;  4DK0 A;  4CS2 A;  3S3X A;  4MW8 A;  1M4U A;  4DR1 O;  3JYC A;  4HT4 A;  4NKG B;  2ZT5 A;  3BFM A;  5J2T B;  1KB9 F;  3CME V;  1KOG A;  4MSW C;  2CIM A;  1JFF A;  2P22 C;  4P75 C;  4OXS A;  1N0N A;  1VEW A;  3TEG A;  4J15 A;  1K8A W;  4YRC A;  1LUV A;  5B3S B;  5EC2 C;  5FPO A;  3G80 A;  3LDD A;  4YRM A;  5B1B B;  4NTW A;  2KQX A;  4LH6 A;  4JTA B;  4HWP A;  4UCT A;  1X54 A;  1GKF A;  4G27 B;  3ETD A;  1BHB A;  2IBZ H;  3REU A;  2Q7G A;  3HXU A;  3UM7 A;  2QHV A;  1N36 O;  2L35 A;  4JI1 O;  2B1G A;  3VQV A;  3ZHS A;  1RSO A;  4WFE A;  1V9P A;  3JSL A;  4PDM A;  1I7F A;  3LSQ A;  1XUQ A;  4BWA A;  1YI2 V;  3M8A A;  2Y48 A;  1OZ0 A;  3CRQ A;  4LF9 O;  5B5E Z;  2Q5I A;  1QHT A;  4HNA B;  1USY C;  3RKX A;  1IL2 A;  2D3O W;  1KD1 W;  1B7Y A;  3T2M A;  4D7T A;  5IDJ A;  4CC6 A;  3H1J H;  1VQL V;  4O4J B;  2WLH A;  2EIN C;  4I50 A;  4Q20 A;  1IBL B;  3H9V A;  2DKG A;  2JVD A;  2JGD A;  4KUM A;  2HLD G;  3A7U A;  5C53 B;  1YIJ V;  2FYK A;  1KUQ A;  3RVZ A;  4PJ0 Z;  4TQD A;  5CN0 A;  4B3S B;  4GKJ B;  3M4Q A;  3E8H A;  3ZRW B;  4Z1V A;  5LHI A;  3LSS A;  4JI3 O;  2V1D A;  2DQ0 A;  2FB5 A;  2ZT6 A;  3A5Z A;  1Z5W A;  1EZV H;  3ZRV A;  1S72 V;  1R1B A;  5IE9 A;  3ZMS A;  2Z0A A;  4AQY B;  1EFW A;  1H38 A;  1HXD A;  2DU5 A;  1ZAU A;  1G8M A;  2Q0O C;  3E89 A;  2IU0 A;  4DV0 B;  1VQK V;  2PTM A;  2UXX A;  3CRM A;  1ORQ C;  3UGT A;  1B04 A;  2X0L A;  3UGQ A;  1ZLZ A;  3HY0 A;  3CJH B;  2KB1 A;  4LFC O;  2UXD B;  4CS4 A;  1GN2 A;  3RFR A;  4K87 A;  1NT2 B;  3CEI A;  5C93 A;  1VF5 B;  1N32 B;  5LOV B;  1KQS U;  4LH7 A;  4PA3 A;  5EBL C;  4HWO A;  5IT9 N;  3ERR A;  3A31 A;  3TGU H;  4X5O A;  1OCC B;  5KHK A;  1VF6 A;  4W4K A;  4K8Z A;  1AI7 A;  2P7T C;  4I9W A;  5KLV H;  4CC5 A;  2QDO A;  4QPK A;  2X7R B;  1OCO B;  1ZUQ A;  4ZTU B;  1FXH A;  3BVO A;  2VQF B;  4U7O A;  1BZK A;  4JI7 B;  1E1T A;  1EIY B;  3H1K H;  4R6Z A;  5JWP A;  1TGO A;  3GVM A;  3MEY A;  3OAA G;  3AG2 C;  1XQ8 A;  5EC1 C;  1G1X B;  2YEV A;  3OMI B;  2CDY A;  1YJ9 V;  3CC4 V;  2PMF A;  1DF5 A;  4N21 A;  4JGS A;  1TAE A;  3PN1 A;  4WBN A;  2F4V B;  3CB2 A;  2UUC B;  4DV2 O;  4JAS A;  2R9A A;  2DE0 X;  4DQ2 A;  1NJI W;  5LGN A;  4DR4 B;  2WLM A;  3ZHV A;  5C51 B;  1KKD A;  4DV6 B;  4I4T A;  3BA9 A;  4X8A A;  4LF5 B;  2LGQ A;  4B3R O;  3L2Z A;  4YYE A;  1GTO A;  4WFB V;  2R70 A;  2ZIN A;  1XMO B;  5KNN A;  4K0K O;  3RGL A;  2Q4P A;  4TWA A;  2GSM B;  4P30 A;  4FFB A;  2WLI A;  3KFU A;  3HRK A;  5ELO A;  3JAL A;  2W0X A;  4HYO A;  4DR5 B;  1BE3 H;  2ZE8 A;  2WWW A;  2ZDI C;  4X62 B;  1MZF A;  2RJZ A;  5LMN B;  3T4Z A;  2GBO A;  3OUS A;  1EVK A;  1GK9 A;  1LNQ A;  4UVC A;  2ARU A;  3WG7 B;  4DW1 A;  2QR4 A;  1LYL A;  2Y4T A;  2E65 A;  4LFA O;  3HY1 A;  4P9P A;  4UV8 A;  1CEZ A;  4YIP A;  5J2T A;  2WPD G;  2QWO B;  1NJ2 A;  3CCL V;  4EX5 A;  4GX0 A;  1WLE A;  1N34 O;  4TSF G;  5GW7 A;  3UKM A;  3L73 H;  2YXL A;  4AHC A;  1OCZ C;  4OPA A;  3CYO A;  4LF7 B;  1JVM A;  3BEH A;  5BY1 A;  2OCC B;  4GX1 A;  2HHH O;  2NNU A;  4H37 A;  4BW5 A;  4YY3 B;  2AZ0 A;  2CTP A;  3OMN B;  4LVI A;  4WF9 V;  3C3T A;  5LMU B;  1LR1 A;  1B6Q A;  1I08 A;  4MTF A;  4YRJ A;  3BJU A;  4HZ3 A;  5IJ0 A;  1VQ6 V;  4HNA A;  1SZX A;  5B1A C;  1SQQ H;  2ZE7 A;  1Z5V A;  4O4J A;  1K34 A;  4J9Y B;  4YRQ A;  3L74 H;  2QWR B;  2AHZ A;  3OD4 A;  3P3N A;  4LVJ A;  1V54 B;  2A9H A;  1Y76 B;  3P8Y A;  2LW7 A;  4LNS A;  5J2U B;  4J41 A;  5CBF A;  4JTC B;  1DK1 A;  1I5Y A;  2G38 A;  1WP8 A;  3ZRW A;  3SJC C;  3ABL B;  3CC7 V;  4U3J B;  4I55 B;  4TT3 G;  4O4H A;  4FLW A;  4EB6 B;  4JI2 O;  5C52 B;  3FB7 C;  2W0F C;  2XTA A;  3EVK A;  1VQ5 V;  3ZRS A;  1EVL A;  2M7W A;  3W7U A;  1YTF D;  4DW0 A;  4JV5 O;  2BTO A;  3RKW A;  2HFE C;  2ZZG A;  4DRX A;  2ZM6 B;  3JD1 A;  2DDZ A;  3O9O A;  4B7K A;  3A5Y A;  1FJG B;  3ASN B;  4JI0 B;  3CP1 A;  5DED A;  2ADP A;  1FKA O;  4LF4 B;  1KU9 A;  4ABM A;  4DUZ B;  2X6C A;  4WFH A;  1KKC A;  4LNU B;  4N23 A;  4B7E A;  3PJS K;  2DJZ A;  2OTJ V;  1H2S B;  3E8G A;  1LUW A;  1I94 O;  2YI9 A;  5KMG B;  5EYP B;  4YHH O;  1W2B U;  3BRC A;  1PL4 A;  3OE7 G;  4KP4 A;  4R7C A;  2PYL A;  2ZTG A;  1DGS A;  4I5S A;  2P06 A;  3HKC B;  3TEH A;  3B40 A;  2CUG A;  2UUB O;  4FLT A;  3P3P A;  2A8E A;  1X4T A;  1SF9 A;  3AK1 A;  1MNG A;  2BTQ B;  2UXC O;  4IIJ B;  3JSN A;  1EIY A;  3A8T A;  1ARO P;  4GUN A;  4DUY B;  1PNM A;  3ZMU A;  4J10 A;  3T1Y B;  1IBM O;  4MVZ A;  1WPX A;  1E1O A;  2XT9 A;  3OGI B;  4DYL A;  3MAQ A;  1G6U A;  3LNN A;  2IY5 A;  1FFX A;  1SQG A;  5ITZ B;  4FFK A;  3ZHR A;  4F4L A;  2HVK C;  3V7C A;  1ENV A;  1VMG A;  2CH7 B;  2LJ2 A;  4PG3 A;  3W7X A;  1GM7 A;  3RBZ A;  4P72 A;  2ZT7 A;  4GKK O;  1TVK B;  2KSD A;  3WQZ A;  4OGQ B;  4LF6 B;  4PDL A;  4O2D A;  4X64 O;  2NR5 A;  3H01 A;  2CE4 A;  1IXM A;  1H4S A;  1FXK B;  4KL1 A;  4DR6 B;  2QKA A;  3ZN0 A;  4YXW G;  4KHP O;  3IKM B;  3W7T A;  3HKD B;  1UJW B;  2B9Z A;  3ABT A;  4J7J A;  2DYS C;  4KR2 A;  1E1R G;  2DWE C;  4DV4 B;  3EFS A;  1R6K A;  4P2Z A;  1ASZ A;  1M93 A;  1FXV A;  4MVU A;  4WFF A;  3JAK B;  2XAQ A;  4WCE V;  2W6J G;  4MT8 A;  3SPC A;  2NS6 A;  3RYC A;  3SJA C;  2PZS A;  1BBW A;  1PD3 A;  2ATK C;  2P4V A;  1SQV H;  4RQE A;  4NXM B;  3LDC A;  1HR0 B;  1XMQ B;  3CXH F;  4X1I B;  4YRK A;  1GN6 A;  2BSK B;  1JX9 A;  1JOY A;  2LW1 A;  1NTM H;  3JAS A;  1NJ1 A;  1H8H G;  1R3K C;  4DV3 B;  2GUZ B;  5CA1 B;  1K5Q A;  3MQZ A;  3VQW A;  4C7U A;  4DV5 O;  3UT5 B;  1R6T A;  3THO A;  1NS1 A;  1BIB A;  2UXB B;  3AG4 B;  2ALY B;  1G5I A;  5BR8 B;  3IG2 A;  2ZR2 A;  2ZXW B;  1RPO A;  1K9M W;  3RWR D;  3I56 V;  4YCV A;  3K57 A;  4DO2 A;  3OR6 C;  1BIA A;  1RIQ A;  1QLE B;  3P30 A;  4FIP C;  2Q7E A;  4JI5 B;  1E1Q G;  1Q6U A;  3G71 V;  3ZRX A;  3CRA A;  2QEX V;  2VS0 A;  2UUA O;  1P7G A;  2AKW B;  3EFR A;  2YIB D;  2DTO A;  1NR7 A;  4U3F H;  2JDI G;  3NEM A;  1B06 A;  5HGQ A;  1HNZ B;  4DV1 B;  3W3S A;  2A79 B;  1FFT B;  1WYD A;  1PPJ H;  5L3F A;  3HXW A;  1NU1 H;  4RUF A;  3K59 A;  1XIL A;  1WU7 A;  5L3C A;  3N2G B;  1KMM A;  1RP3 B;  3F7V C;  1WQW A;  2X6A A;  2BOB C;  3WB0 A;  4U7N A;  1H4T A;  5LXT B;  3SJB C;  2FYU H;  3JAR B;  1K4C C;  3HKB A;  1IBK O;  2IW5 A;  5L3B A;  3IC7 A;  1ADY A;  4LF8 O;  4OLF A;  5AG2 A;  4XDJ A;  4DR1 B;  3NEL A;  1FAF A;  1Y76 A;  2DWD C;  2DTH A;  2CAZ C;  3ETG A;  5DM6 V;  4JYC A;  1J5W A;  4JI8 O;  2EZP A;  1H2N A;  2HP8 A;  2N05 A;  3AG3 B;  1ZL8 B;  1VF6 C;  3JCU Z;  2EIN B;  4U3J A;  3HB3 B;  3U0Z A;  3HFV A;  2P4K A;  2CGO A;  1Y74 B;  2DN9 A;  2QWN B;  3AG7 A;  3VBB A;  4EB6 A;  1Q8I A;  2I4N A;  2LP7 A;  2YIA A;  1N0J A;  3NXS A;  4P74 A;  4DR3 O;  3IC9 A;  1DTO A;  4CH6 A;  1XNQ O;  1QCE A;  3FB6 C;  2YDE A;  2PYJ A;  2N04 A;  4TUY B;  1Y4M A;  3ICX A;  3HFZ A;  1M56 C;  4MVO A;  1N36 B;  2ZXF A;  2WLN A;  1SET A;  5H5N A;  4JI1 B;  2EJF A;  3NEN A;  3C90 A;  1L8D A;  5KHG A;  5H6Q A;  3AG1 C;  3FX7 A;  4DV7 O;  3L1A A;  5LA6 B;  3DC5 A;  3JAT B;  3ICA A;  3ABM C;  3ZHT A;  2F23 A;  3UH0 A;  4LF9 B;  2PY5 A;  5IYD O;  4MS2 A;  4I9Q A;  1URF A;  4LNU A;  1L1F A;  4FMT A;  3V7R A;  1AB3 A;  4X89 A;  5KMG A;  5EYP A;  1G51 A;  1F51 A;  3SYA A;  1HNW O;  3F5W C;  2A06 H;  1EM1 A;  1L0W A;  4YCU A;  1NQT A;  4LWS A;  2Q5Z A;  2QWP B;  1M1K W;  3HKC A;  3QO8 A;  4JYA O;  4H2X B;  2P5O A;  2BTQ A;  3SYO A;  4UB6 Z;  3RN4 A;  2MK3 A;  3FAV B;  4JI3 B;  4XEM A;  3ZS8 C;  3WB1 A;  4YRT A;  4P9O A;  3MHS C;  4ZKI A;  4O4I A;  4E2L A;  5GTH Z;  4PDV A;  5F2V O;  1NYQ A;  3OTF A;  5A2Q N;  3QNE A;  2F66 C;  4TV9 A;  4FM2 A;  2CH7 A;  5JCO A;  2Y69 B;  1M9N A;  5DN6 G;  2EL9 A;  4IYI A;  3SJQ C;  2YXY A;  2LO1 A;  5KHI A;  1TVK A;  2HEP A;  5ELN A;  4LFC B;  4AI8 A;  3JAW B;  5JJE B;  1NJ5 A;  1N33 O;  4YRF A;  5IYC O;  4I7Z B;  11AS A;  1FXK A;  5LBQ A;  1NR1 A;  1XRE A;  3HKD A;  2Q5H A;  3E22 B;  4FM1 A;  2BOC C;  4H2T A;  1QR9 A;  4JZG A;  3LUT B;  4LC1 A;  4XU2 A;  3J80 N;  1WAZ A;  2OCH A;  3ZJZ A;  5B3S C;  2CK3 G;  3APQ A;  4H02 A;  1F4M A;  2EBO A;  5L3G A;  1Q7Y W;  4YP0 A;  3PCO B;  1YFS A;  5B1B C;  3RYH A;  1YZB A;  3K0D A;  4BIO A;  1XL4 A;  3W7S A;  2C7I A;  4X1I A;  1BQ0 A;  1QQC A;  2BSK A;  1KMI Z;  1YDX A;  4FJC C;  3REX A;  2LFR A;  1NJ8 A;  4OP0 A;  5BMV A;  1NYR A;  3GWK C;  1D5A A;  3B09 A;  4YRL A;  2GUZ A;  1X55 A;  1VQ8 V;  1MA1 A;  2ZT9 B;  1Q90 D;  5CA1 A;  2C8M A;  1H2L A;  2ZR3 A;  4YRP A;  3UT5 A;  4CH4 A;  3H1H H;  2WSS G;  3K5O A;  2B1I A;  4QJF B;  4YRE A;  4YJ2 B;  2DZC A;  4NYK A;  2QM4 A;  2QGN A;  4EFE A;  3RYF B;  3IAL A;  4DV2 B;  4HWS A;  1SA0 B;  4P73 C;  4J11 A;  4JZ2 A;  1JPX A;  4FZ0 A;  3ZCC A;  3ZED A;  2VQE O;  2DXU A;  4CS3 A;  2ODR C;  3ASO B;  4FLZ A;  3QF7 A;  1KMN A;  1EN4 A;  2E41 A;  2XGT A;  1XBL A;  5BZB A;  5C8Y B;  5CB4 B;  4B3R B;  1KP3 A;  3I5D A;  3NR7 A;  5KX5 B;  3D8C A;  3OTO O;  2AKW A;  3V8K A;  3O65 A;  1TUB B;  4JI6 O;  4R8C A;  2RHS B;  4K0K B;  1EN5 A;  3T4D A;  2QM7 A;  4FVM A;  1IVS A;  3JD3 A;  2V4D A;  2EZO A;  3KKY A;  1YVW A;  2IM9 A;  2RNB A;  4DXW A;  3HXX A;  5IY5 B;  1HP8 A;  1SQF A;  3CRR A;  1K4D C;  2Z5U A;  3N2G A;  4ZTZ B;  2Q69 A;  2BE3 A;  2RQ6 A;  3TET A;  5KAF Z;  2EAY A;  1A32 A;  4H2U A;  3E8B A;  5F5W A;  2YXH A;  3I7F A;  1S5J A;  2ZZE A;  1X2H A;  3HKE B;  4PA7 A;  3B4S A;  5B1O A;  4NXN O;  4XTW A;  1BHA A;  3BY6 A;  1CPY A;  2LFS A;  5LXT A;  3JAR A;  4YRG A;  4BW9 A;  3N2K A;  4ICG A;  4J7Z A;  3G6E V;  1YJW V;  5FPR A;  4LFA B;  4TQF A;  3OW2 U;  1EN6 A;  1I0H A;  5LHG A;  5B1A B;  2R9I A;  1SC5 B;  1N34 B;  4DR4 O;  1OCC C;  2H94 A;  4FLV A;  2L6L A;  3W7W A;  1ZL8 A;  3JD2 A;  2KKW A;  1BL8 A;  4FPP A;  4PHZ A;  4YCW A;  1Y74 A;  4UUJ C;  5K1X A;  5FLX N;  3AEI A;  2NLJ C;  4GX5 A;  2YSU B;  2E5A A;  4OX9 O;  2RDC A;  3CMQ A;  4IGG A;  2HNI A;  4XTU A;  4UCU A;  2QHU A;  3WB2 A;  4TUY A;  2HHH B;  2Q7H A;  2JS3 A;  4LP8 A;  4LFB O;  4CZZ A;  1BQZ A;  3CCQ V;  2AGA A;  1KC8 W;  3LNM B;  4RWU A;  1G4Y B;  4LVL A;  4NTY A;  4ZI7 B;  5LA6 A;  3JAT A;  5CA0 B;  3MDS A;  3H1L H;  3T1C A;  2I4M A;  1WB7 A;  1CP9 A;  1PNK A;  4O2A B;  5LGT A;  3IKL A;  2E5L O;  2AZ2 A;  4P72 C;  4I0X B;  5B1N A;  3FYE B;  4YRI A;  3L9D A;  1IZ3 A;  4JAA A;  4J7K A;  3KZI Z;  4A5U B;  3QG5 A;  3BCC H;  3LDE A;  2DYR B;  3CSX A;  4X20 B;  1YTF B;  3JD0 A;  2EIJ B;  4PI2 A;  2DVE A;  2YUA A;  3HPL C;  1AVM A;  3CCE V;  1V55 B;  4ZHQ B;  2ZNI A;  4H2X A;  1WA8 B;  2ZD9 A;  5LGU A;  4R50 A;  4JYY A;  3FAV A;  4NCX A;  2Q68 A;  1UFI A;  4D6T H;  1DF4 A;  5IYZ B;  1K73 W;  2A7W A;  4UXN A;  4BIU A;  2PME A;  2YIC A;  4UP7 A;  1BBU A;  4JI2 B;  5H9C A;  3UFG A;  2YS8 A;  4P71 A;  1GM9 A;  1O9G A;  1AIL A;  2EIM C;  4X9Q A;  3UO2 A;  4XU3 A;  5EZY B;  1KBH A;  4JV5 B;  1J5E O;  3WG7 C;  2Y0P A;  1YIT V;  2XND G;  2QM8 A;  3FFQ A;  1Q3E A;  5H6R A;  1X56 A;  3TK1 A;  1GRJ A;  5IJ9 B;  1AR5 A;  1VQO V;  2QJ1 A;  2OIG A;  4X1Y B;  2ZNJ A;  4MVR A;  2QKC A;  1H4V B;  2HR3 A;  4MTO A;  4UCV A;  1M5I A;  3E22 A;  1JJO A;  4UP9 A;  3CS5 A; 
#chains in the Genus database with same CATH homology
 3E9I A;  3I56 V;  2EJ9 A;  4YCV A;  1AI4 A;  1USY C;  3RKX A;  2WLL B;  1QE0 A;  4DO2 A;  3OR6 C;  1BIA A;  1IL2 A;  1RIQ A;  2D3O W;  1KD1 W;  1B7Y A;  4Q6G A;  3PCO A;  1QLE B;  2XAS A;  3P30 A;  3T2M A;  4FIP C;  5IDJ A;  2Q67 A;  2Q7E A;  1E1Q G;  3G71 V;  3SPG A;  3ZRX A;  3SPJ A;  1VQL V;  1USY A;  1K92 A;  2QEX V;  4K88 A;  4KR2 A;  2WLH A;  1VQ9 V;  2JIZ G;  2EIN C;  3K79 A;  1ADJ A;  2OCC C;  4GT1 A;  2WLK A;  4Q20 A;  2DKG A;  2CJA A;  2AKW B;  4KUM A;  2HLD G;  2P5I A;  3EFR A;  1R3I C;  4G85 A;  1R3J C;  2DTO A;  3A7U A;  4YPF A;  4PHC A;  1NR7 A;  5CBG A;  3D3I A;  1YIJ V;  2FYK A;  3I55 V;  2DEQ A;  5C53 B;  2JDI G;  3NEM A;  2XOK G;  3RVZ A;  5CN0 A;  2W6I G;  4TQD A;  5HGQ A;  4QE7 A;  3W3S A;  2A79 B;  1FFT B;  1WYD A;  3L4G A;  5L3F A;  2I4O A;  3HXW A;  1OCO C;  1H8E G;  1PL0 A;  3IGA C;  4RUF A;  5L3D A;  1E22 A;  2EIM B;  3M4Q A;  3E8H A;  3ZRW B;  5LHI A;  3LSS A;  2JJ2 G;  2V1D A;  4WFA V;  5L3C A;  2DQ0 A;  1WU7 A;  3OM3 B;  1KMM A;  2ZT6 A;  4YRO A;  2DQ3 A;  3A5Z A;  3ZRV A;  1S72 V;  1SES A;  3F7V C;  1MOF A;  1WQW A;  1ATI A;  3ZMS A;  2X6A A;  1QVF U;  4HVC A;  4ZBM A;  2BOB C;  1ASY A;  1EFW A;  1H38 A;  1HXD A;  2DU5 A;  1AJN A;  3ASO C;  2IU3 A;  4U7N A;  3SYC A;  1G8M A;  1H4T A;  3E89 A;  4G28 B;  2IU0 A;  3FYI B;  4JYB A;  5KA5 A;  3ZMV A;  1K4C C;  1VQK V;  2IW5 A;  2R9R B;  5L3B A;  3IC7 A;  1ADY A;  1B8A A;  1RM1 B;  2UXX A;  1QLN A;  1V54 C;  2ZQM A;  1ORQ C;  4OLF A;  3UGT A;  4H02 A;  1NBM G;  2X0L A;  1NH2 D;  4XDJ A;  3UGQ A;  2IJH A;  3NEL A;  3G4S V;  3HY0 A;  4TVA B;  2KB1 A;  2DWD C;  2P6J A;  1K97 A;  2DTH A;  2E1H A;  4CS4 A;  3QO5 A;  3K04 A;  2RHS A;  3V8L A;  3ETG A;  4K87 A;  5IY5 C;  5DM6 V;  5C93 A;  3NET A;  4JAV A;  3ABL C;  1F4N A;  4JYC A;  1J5W A;  4HWT A;  2H8P C;  2EZP A;  4H33 A;  1KQS U;  4PA3 A;  5EBL C;  4BAY A;  3AG3 B;  1NJ6 A;  3SPI A;  4HWO A;  3ERR A;  3A31 A;  2EIN B;  3RW0 A;  3ABK C;  4X5O A;  3HB3 B;  3B8M A;  4P74 C;  1ASZ A;  3HFV A;  1OCC B;  3FKS G;  3VBB A;  2I4N A;  1ROP A;  1HTT A;  2LP7 A;  1PYS B;  3KG2 A;  1KP2 A;  4XTX A;  1AI7 A;  3NXS A;  4P74 A;  2P7T C;  4WF2 A;  1DTO A;  4CH6 A;  2B5U A;  3OR7 C;  1QCE A;  2EIK C;  4I9W A;  3FB6 C;  4UV9 A;  1C0A A;  4QPK A;  1K9M W;  2X7R B;  5C51 B;  1OCO B;  2I4L A;  2IJI A;  4MTX A;  1M57 B;  4ZTU B;  1Y4M A;  4QNH B;  1VQ7 V;  3HFZ A;  1FXH A;  1M56 C;  4XTZ A;  4MVO A;  4U7O A;  1E1T A;  2ZXF A;  2WLN A;  4PA4 A;  2E3C A;  1H4Q A;  3A7A A;  1SET A;  1EIY B;  5E1A C;  2EJF A;  1Q81 W;  3NEN A;  4WJ4 A;  5H6Q A;  3OEH G;  4R6Z A;  5IYB O;  1Y66 A;  2CJ9 A;  4XEO A;  3AG1 C;  3ML0 A;  3OAA G;  3MEY A;  3AG2 C;  3OFN G;  5EC1 C;  3L1A A;  4L87 A;  2PI4 A;  4EO4 A;  2YEV A;  1JCH A;  4K86 A;  3OD1 A;  4P73 A;  3OMI B;  2P0L A;  3ICA A;  1YJ9 V;  3ABM C;  3CC4 V;  1JQ0 A;  2PMF A;  4KR3 A;  4WJ3 M;  3UH0 A;  1DF5 A;  1NKD A;  4N21 A;  1YJN V;  4JGS A;  4TWK A;  3K3W A;  5IYD O;  1XL6 A;  1B70 B;  3CCS V;  2E10 A;  4MS2 A;  1P7B A;  3CCR V;  4JAS A;  2RHQ B;  3GWO A;  1QF6 A;  1L1F A;  4FMT A;  3V7R A;  3JCZ A;  2FTK A;  4X89 A;  4H2W A;  4DQ2 A;  1G51 A;  4RDX A;  1NJI W;  1F51 A;  3SYA A;  5LGN A;  2WLM A;  3F5W C;  4PA9 A;  1KKD A;  2AHY A;  3A7R A;  4LCU C;  4P3O A;  2QE7 G;  1SER A;  4P72 A;  1L0W A;  4YCU A;  1NQT A;  4X8A A;  1TUE B;  2AMC A;  2EWN A;  1M1K W;  5KA6 A;  1E24 A;  3L2Z A;  4BIZ A;  4YYE A;  1GTO A;  1NH2 B;  3QO8 A;  4H2S A;  2ART A;  1YB3 A;  1EQR A;  1F23 A;  1YSC A;  1DLB A;  1N9W A;  4H2X B;  1Z7N A;  4WFB V;  4WI1 A;  3SYO A;  1S77 D;  2XAH A;  2ZIN A;  5KNN A;  2MK3 A;  3ABK B;  3RGL A;  12AS A;  1RPR A;  4TWA A;  3VOU A;  4XEM A;  2GSM B;  3ETE A;  1EOV A;  3WFV A;  1X01 A;  5E3I A;  4P30 A;  4P9O A;  4YRT A;  4EKW A;  2WLI A;  3KFU A;  2WAM A;  4XTY A;  3HRK A;  3MHS C;  2DYS B;  3E2E A;  4ZKI A;  5ELO A;  2EIK B;  1YHQ V;  4HYO A;  3HFZ B;  2K1E A;  3HXZ A;  2ZIM A;  2EIL C;  3MD0 A;  3A74 A;  4E2L A;  2WWW A;  2UXN A;  2ZDI C;  2ZGW A;  1FYF A;  2JK5 C;  4PDV A;  3T4Z A;  1NYQ A;  1MG1 A;  4P3P A;  3CC2 V;  3QNE A;  4MVQ A;  2DYR C;  3E83 A;  3OUS A;  3ZMZ A;  2Y69 B;  1M9N A;  5DN6 G;  2ZDI A;  1GGM A;  3FB5 C;  2EL9 A;  1EVK A;  1GK9 A;  2EIJ C;  4KQE A;  1Z7M A;  3HXY A;  2EJR A;  3E35 A;  1EBO A;  3SJQ C;  3AG1 B;  1LNQ A;  4UVC A;  1V55 C;  2ARU A;  3WG7 B;  1FXK C;  1JJC B;  5ELN A;  1JJ2 U;  1NJ5 A;  1LYL A;  1SRY A;  4XBF A;  4YRF A;  5IYC O;  2E65 A;  5J9P C;  3P8T A;  4MVS A;  11AS A;  1VQ4 V;  2Z3Y A;  1FXK A;  3HY1 A;  4P9P A;  4UV8 A;  1GM8 A;  5LBQ A;  1CEZ A;  1WNL A;  1NR1 A;  2E64 A;  4TVW A;  2Q5H A;  3ABU A;  3FB8 C;  2BOC C;  3VQY A;  2WPD G;  1QR9 A;  4LC1 A;  3LUT B;  4H2T A;  4PA6 A;  1KEC A;  5HFM A;  1FS0 G;  4XU2 A;  4YRR A;  1NJ2 A;  3CCL V;  4HWR A;  1VQN V;  4EX5 A;  1QVG U;  4RMF A;  3ZJZ A;  5B3S C;  4CH3 A;  3OMA B;  4GX0 A;  1WLE A;  1W0K G;  2CK3 G;  4CBC A;  1F4M A;  4TSF G;  1YGB A;  2EBO A;  1W0J G;  2P67 A;  5L3G A;  2HKO A;  5GW7 A;  1Q7Y W;  3UKM A;  1Q86 W;  1B7Y B;  3HTZ A;  3PCO B;  4YP0 A;  4AH6 A;  1YFS A;  4KFM A;  5B1B C;  1P4R A;  1AJQ A;  3K0D A;  1OCZ C;  1XL4 A;  3W7S A;  3D36 A;  4HAM A;  2C7I A;  1B76 A;  4XU1 A;  3V7S A;  1THZ A;  2ZT8 A;  1COW G;  3CYO A;  4FJC C;  4QPJ A;  2LFR A;  1NJ8 A;  4OP0 A;  4RQF A;  3REX A;  1NYR A;  1JVM A;  3BEH A;  2OCC B;  4GX1 A;  4P3N A;  1AJP A;  2J3L A;  2NNU A;  4H37 A;  4BW5 A;  4H2Y A;  4UP8 A;  4YRL A;  2QTO A;  3L4G B;  2WLJ A;  4JPR A;  1X55 A;  1VQ8 V;  3B77 A;  5KUK A;  2EIL B;  3X2Q C;  3ZN1 A;  3AG4 C;  1WPY A;  2C8M A;  3JD4 A;  3OMN B;  4E51 A;  3K08 A;  2ZR3 A;  4YRP A;  4CH4 A;  1GO3 F;  4LVI A;  2WSS G;  2B1I A;  4WF9 V;  1PNL A;  4QJF B;  2ZXW C;  1EZJ A;  3TCU A;  1B6Q A;  4MTF A;  4ASU G;  1NVP D;  2DZC A;  4YRJ A;  4YRE A;  4YRN A;  3BJU A;  4HZ3 A;  5CBH A;  3QTC A;  1OZ0 A;  3CMA V;  2ZIO A;  3IAL A;  1QLE C;  1VQ6 V;  4HWS A;  2JEX A;  4YDQ A;  3ASN C;  4X88 A;  2DU7 A;  4P73 C;  2WLL A;  3DSQ A;  5HFL A;  1JPX A;  5B1A C;  3ZCC A;  2ZCE A;  3M99 B;  2DXU A;  2C2A A;  4CS3 A;  2ODR C;  3ASO B;  1KMN A;  5L3E A;  2E41 A;  2XGT A;  3HRI A;  1R73 A;  5BZB A;  1K34 A;  4J9Y B;  3M4P A;  4YRQ A;  1H2G A;  1KP3 A;  2GHY A;  2AHZ A;  3HXV A;  3B8N A;  2AKW A;  3V8K A;  4LVJ A;  1HC7 A;  1V54 B;  2A9H A;  3P32 A;  1K3E A;  3RF1 A;  2QHT A;  4R8C A;  2RHS B;  3RKY A;  3P8Y A;  1J95 A;  4TVY A;  3T4D A;  2QM7 A;  1WQ7 A;  4LNS A;  3LC0 A;  2XAF A;  3JD3 A;  2CJB A;  5CBF A;  2EZO A;  2ZZF A;  3P8V A;  4YRS A;  2IJJ A;  3SPH A;  4JTC B;  1I5Y A;  1ZWI C;  4DXW A;  3ZRW A;  3HXX A;  2ITD C;  5IY5 B;  3RVY A;  3ZMT A;  3ABL B;  3CCV V;  1X2G A;  1K4D C;  2Z5U A;  4ZTZ B;  4DPG A;  3CC7 V;  3MF2 A;  3RUX A;  2Q69 A;  4TT3 G;  3TET A;  2EAY A;  2JJ1 G;  4H2U A;  3E8B A;  5CA3 A;  5F5W A;  3TEH B;  3VQX A;  2IH3 C;  3I7F A;  5C52 B;  3FB7 C;  2DXT A;  2ITC C;  2W0F C;  4GX2 A;  4PA7 A;  1X2H A;  5B1O A;  2ZZE A;  1OCR C;  1VQ5 V;  3CD6 V;  4XTW A;  1RM1 C;  2EJG A;  3ZRS A;  3BY6 A;  1CPY A;  2LFS A;  2M7W A;  5FL7 G;  3CCM V;  1BHA A;  4RAI A;  1EVL A;  3K0G A;  1G5H A;  4TTV A;  3CCU V;  3E8F A;  4J9Z B;  3W7U A;  4MW3 A;  4CH5 A;  1YTF D;  4YRG A;  3X2Q B;  4LVM A;  1SZT A;  4MTG A;  3RKW A;  4BW9 A;  2HFE C;  3G6E V;  4ZIB A;  1YJW V;  2ZZG A;  1S5H C;  4JF3 A;  3JD1 A;  1Q82 W;  2DDZ A;  1QBZ A;  3A32 A;  3CXC U;  3A5Y A;  3DTU B;  3OW2 U;  4TQF A;  4TVA A;  1M56 B;  4UPA A;  1QR8 A;  5K1P A;  2YEV B;  3ASN B;  3K03 A;  4MVM A;  2HVJ C;  4Q15 A;  2QHS A;  3AG3 C;  3CP1 A;  5LHG A;  4QE9 A;  5B1A B;  5EK0 A;  4FK5 C;  2R9I A;  3AG2 B;  2X6C A;  4UVA A;  4WFH A;  4RO2 A;  1NVP B;  1OCC C;  2H94 A;  3ABM B;  3RL6 A;  3W7W A;  3JD2 A;  4G2K A;  3A0R A;  1BMF G;  4N23 A;  2DW4 A;  2DZ9 A;  2CGH A;  1BL8 A;  4WFG A;  3IFX A;  3PJS K;  3STZ C;  2OTJ V;  2DJZ A;  3E8G A;  2JEU A;  4FPP A;  2G4C A;  3MF1 A;  4YCW A;  3OUF A;  2OT5 A;  2IJK A;  4UUJ C;  1W2B U;  5K1X A;  3AEI A;  1MSW D;  2NLJ C;  4GX5 A;  3TUP A;  2YSU B;  2E5A A;  1PYS A;  1VQZ A;  3OE7 G;  1M57 C;  4KP4 A;  4R7C A;  1W66 A;  3CMQ A;  2ZTG A;  4I5S A;  3ZIA G;  2AMC B;  3SYP A;  1HWY A;  2HNI A;  2QHU A;  4XTU A;  3TEH A;  2X6B A;  5CMU A;  1K33 A;  3F7Y C;  4XU0 A;  4XDL A;  2A8E A;  2V7Q G;  2Q7H A;  3V8J A;  3QO7 A;  4LP8 A;  3OEE G;  4CZZ A;  2J3M A;  1EIY A;  3CCQ V;  1KC8 W;  1ARO P;  3LNM B;  1G4Y B;  1PNM A;  4LVL A;  2IH1 C;  1YFT A;  2WLI B;  3K06 A;  3ZMU A;  1OCR B;  2QKS A;  2XTI A;  4MVZ A;  1WPX A;  1E1O A;  3MHH C;  2XAG A;  4UVB A;  5EBM C;  3T1C A;  2IY5 A;  2I4M A;  3CCJ V;  2XAJ A;  1MAB G;  1CP9 A;  1E79 G;  1PNK A;  4JAU A;  5LGT A;  1GMG A;  3EHB B;  1B70 A;  3IKL A;  2QA4 V;  2HG5 C;  4P72 C;  4F4L A;  2HVK C;  1K7D A;  3V7C A;  1ENV A;  5B1N A;  1PKX A;  3EFF K;  3FYE B;  4JTD B;  2P90 A;  3STL C;  2RHQ A;  4YRI A;  4PG3 A;  4XTV A;  3W7X A;  5KUM A;  4HA8 A;  3RIR A;  1EFR G;  1I5X A;  1GM7 A;  3RBZ A;  4Z1M G;  2PI5 A;  1S76 D;  3E86 A;  2ZT7 A;  3G1Z A;  3LDE A;  2DYR B;  1OHH G;  2ODR D;  1YTF B;  2ALY A;  3WQZ A;  1S0V A;  4CS2 A;  3JD0 A;  3R65 A;  2EIJ B;  3RAC A;  3R07 A;  3E9H A;  2DVE A;  4PDL A;  3HPL C;  4O2D A;  3CCE V;  4G84 A;  3H01 A;  1V55 B;  1IXM A;  1H4S A;  4MW8 A;  1FXK B;  3ZN0 A;  2ZNI A;  3JYC A;  4YXW G;  3IKM B;  3W7T A;  4QIW F;  4H2X A;  1UJW B;  2ZD9 A;  2DTI A;  4HT4 A;  2ZT5 A;  3BFM A;  4GCZ A;  5LGU A;  3ABT A;  4R50 A;  3CME V;  1S3J A;  4NCX A;  2A0L A;  1M90 W;  2Q68 A;  2DYS C;  2ARS A;  4MSW C;  1DF4 A;  1K73 W;  1E1R G;  2DWE C;  2HJF C;  3EFS A;  1R6K A;  4P2Z A;  4UXN A;  2CIM A;  1NNH A;  4BIU A;  1R6N A;  1VQP V;  4P71 C;  2PME A;  1R3L C;  1FXV A;  4MVU A;  4P75 C;  3OGC C;  1BBU A;  2F43 G;  3CPW U;  4WFF A;  3GB7 C;  4OXS A;  4UP7 A;  3TEG A;  2XAQ A;  4WCE V;  4PEL A;  5H9C A;  4J15 A;  2W6J G;  4MT8 A;  3SPC A;  1K8A W;  4YRC A;  4RUE A;  2NS6 A;  3UFG A;  5B3S B;  4P71 A;  1GM9 A;  5EC2 C;  4P75 A;  2Y69 C;  4LVK A;  2EIM C;  1BBW A;  4XU3 A;  1PD3 A;  2ATK C;  1VQM V;  4XDK A;  4RQE A;  4LBE C;  1N8R W;  3LDD A;  3PZC A;  4YRM A;  3LDC A;  5B1B B;  3WG7 C;  1KOG A;  2OTL V;  4YRK A;  1JOY A;  1JX9 A;  4HWP A;  4JTA B;  1YIT V;  1X54 A;  1NJ1 A;  2XND G;  1H8H G;  2QM8 A;  1GKF A;  1OCZ B;  1AI5 A;  1R3K C;  2Q6A A;  4G27 B;  5LHH A;  5H6R A;  2IY5 B;  4PDR A;  1AR1 B;  3ETD A;  1X56 A;  3TK1 A;  1BHB A;  1JJC A;  3REU A;  2Q7G A;  1VQO V;  3HXU A;  3DGE A;  3SYQ A;  3UM7 A;  1K5Q A;  2QHV A;  2ZNJ A;  3MQZ A;  3VQW A;  3K9A A;  4MVR A;  2B1G A;  1K5S A;  1H4V B;  4H2V A;  2HR3 A;  1AI6 A;  3VQV A;  4MTO A;  1YFR A;  1BIB A;  5EBW C;  4WFE A;  3FJP A;  3AG4 B;  4PDM A;  2ALY B;  3LSQ A;  1YI2 V;  1G5I A;  4BWA A;  4UP9 A;  3IG2 A;  2Y48 A;  2ZR2 A;  2ZXW B;  2Q5I A;  1RPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...