3PCOA

Crystal structure of e. coli phenylalanine-trna synthetase complexed with phenylalanine and amp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
242
structure length
242
Chain Sequence
RLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNVLRNVGIDPEVYSGFAFGMGMERLTMLRYGVTDLRSFFENDLRFLKQFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phenylalanyl-tRNA synthetase, alpha subunit
publication title Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 242
sequence length 242
chains with identical sequence C
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
A PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3pcoA01
4CH4A 1WU7A 1PYSB 2I4NA 3EFRA 1USYA 2RHQB 3L1AA 4YRMA 3A7RA 5K1PA 2ODRC 2EAYA 2EJ9A 3V8KA 3KFUA 4YRFA 4H2XA 4K86A 2DEQA 1SESA 1BIAA 5E3IA 4YRLA 4YRJA 2CJAA 4CS4A 1KOGA 1NNHA 2DTOA 5HGQA 3L2ZA 4YRKA 1X01A 1Z7NA 3V7RA 4P75A 3RGLA 1H4VB 4Q15A 3HY0A 2DVEA 2QHUA 3QTCA 1YFTA 3QO5A 4XTVA 3OD1A 2AMCA 1WQWA 3V8LA 1WYDA 4TQDA 1H4SA 2G4CA 3BFMA 1HC7A 3PZCA 1SRYA 1GGMA 4G84A 4YRSA 1NJ5A 1B7YB 2DTHA 2QHVA 3P8YA 5C51B 4XU0A 3HXYA 4DPGA 4XEMA 2ZZGA 4P3NA 2ZTGA 1E1TA 1KMNA 3HFVA 2E3CA 2AMCB 4XU2A 4H2TA 1N9WA 3I7FA 1X2HA 4XEOA 1C0AA 2EWNA 4WI1A 4UP7A 2ZT8A 4KR3A 4TTVA 3HXWA 4P73C 2ZNJA 4XU1A 1SERA 1E1OA 2PMFA 2AKWB 1Z7MA 2C8MA 1X54A 2Q5HA 4YRQA 3HY1A 4OLFA 3NELA 1YGBA 1USYC 2RHQA 4ZTUB 2CJBA 4TVYA 2ZR3A 1ATIA 1G5HA 2I4LA 4WJ3M 4PG3A 3R07A 1QE0A 4YRTA 3NEMA 2FYKA 4H2WA 4UPAA 4P73A 3A7AA 1WLEA 5C52B 3TEHA 2EJFA 2J3LA 4Q6GA 3M4PA 3REXA 4P75C 3DSQA 4KR2A 3MEYA 3P8TA 1ADYA 3E9HA 2ZINA 1YFRA 1NJ2A 2EL9A 3A74A 1NYQA 4H02A 2ZGWA 4P72A 4H2UA 3REUA 2DDZA 3RL6A 3A32A 3QO8A 2ZZFA 2Q7HA 4ZIBA 1B7YA 1RIQA 3TEHB 3EFSA 4HWRA 4YREA 4XU3A 3P8VA 4TWAA 2C7IA 4P74A 4XTUA 2P5IA 3HXXA 2PMEA 1NJ6A 3HRIA 5ELOA 4WF2A 2E65A 5KNNA 1FYFA 3V7SA 1ASYA 3L4GA 2ZIOA 3G1ZA 3VBBA 4RQFA 1L0WA 4XTWA 4EO4A 5C53B 3TEGA 3UH0A 1EOVA 4BWAA 2RHSA 4NCXA 3RKXA 1YB3A 3IKMB 4YDQA 1E22A 1SETA 4YP0A 3A5ZA 1BBUA 2ZR2A 4YRCA 3TUPA 2ZXFA 4H2VA 4K88A 3LSQA 3UGQA 2AKWA 2DZCA 2ALYA 2ZIMA 4TQFA 1E24A 3CMQA 4UP8A 3L4GB 3IG2A 1H4QA 2QHSA 1NYRA 2EJGA 2J3MA 3VQVA 2RHSB 1EQRA 4K87A 2I4OA 1HTTA 4P3PA 4OP0A 4BW9A 3RKYA 3NENA 3E9IA 4G85A 3RUXA 2Q7GA 3HXVA 3HXUA 2ALYB 4XTZA 4CH6A 4YRIA 4YRPA 2DXUA 2DTIA 1ADJA 1JJCA 1G5IA 3VQXA 4HWOA 2ZT6A 3V7CA 4YCUA 3IKLA 4HA8A 2DQ0A 2DJZA 3RACA 4P72C 3V8JA 2IY5A 2DXTA 1WPYA 3ERRA 4TVWA 4DQ2A 4CS2A 3A7UA 3QO7A 4P74C 4P3OA 1JJCB 1QF6A 2QHTA 3HTZA 3RF1A 2P0LA 3RIRA 4RMFA 4TVAA 3A5YA 2I4MA 2XGTA 2IY5B 4L87A 4J15A 1LYLA 1G51A 2ZT5A 4P71C 4YRNA 12ASA 4RDXA 4CH5A 3LSSA 4E51A 2ODRD 5F5WA 1NJ1A 4HWPA 4XTYA 3MF1A 4YCWA 3VQYA 2HNIA 3PCOA 3VQWA 4H2SA 4TVAB 1BIBA 4AH6A 2CGHA 1VQZA 4X5OA 3HRKA 3HFZA 2ZNIA 11ASA 3NETA 4P71A 3UFGA 1B70A 1WNLA 1ASZA 4UP9A 4HWTA 2ZZEA 1EFWA 1HXDA 2Q7EA 2E10A 3PCOB 4H2XB 5K1XA 1W66A 2ZT7A 4KQEA 2DU5A 2E41A 4EX5A 3QNEA 4ZTZB 1YFSA 4XTXA 1X55A 3HFZB 2ARTA 2XTIA 4O2DA 1B70B 4YRRA 2E5AA 3BJUA 4RQEA 3ICAA 2DQ3A 4CS3A 4YPFA 1IL2A 1EIYA 2ZCEA 2ARUA 3FJPA 3WQZA 1NJ8A 4PHCA 3RKWA 3IALA 5ELNA 3M4QA 4HVCA 4HWSA 3UGTA 1EVKA 1KMMA 2DKGA 4LNSA 1X56A 2CJ9A 3A31A 2CIMA 1PYSA 4WJ4A 2ARSA 4YCVA 3W3SA 1EIYB 3LC0A 2E1HA 2Q5IA 3MF2A 1EVLA 4CH3A 2E64A 1B8AA 4YYEA 1J5WA 1WQ7A 1H4TA 1X2GA 2DU7A 3HXZA 1B76A 1BBWA 4YRGA 2DZ9A 4YROA 4H2YA
chains in the Genus database with same CATH superfamily
4CH4A 1WU7A 1PYSB 2I4NA 3EFRA 1USYA 2RHQB 3L1AA 4YRMA 3A7RA 5K1PA 2ODRC 2EAYA 2EJ9A 3V8KA 3KFUA 4YRFA 4H2XA 4K86A 2DEQA 1SESA 1BIAA 5E3IA 4YRLA 4YRJA 2CJAA 4CS4A 1KOGA 1NNHA 2DTOA 5HGQA 3L2ZA 4YRKA 1X01A 1Z7NA 3V7RA 4P75A 3RGLA 1H4VB 4Q15A 3HY0A 2DVEA 2QHUA 3QTCA 1YFTA 3QO5A 4XTVA 3OD1A 2AMCA 1WQWA 3V8LA 1WYDA 4TQDA 1H4SA 2G4CA 3BFMA 1HC7A 3PZCA 1SRYA 1GGMA 4G84A 4YRSA 1NJ5A 1B7YB 2DTHA 2QHVA 3P8YA 5C51B 4XU0A 3HXYA 4DPGA 4XEMA 2ZZGA 4P3NA 2ZTGA 1E1TA 1KMNA 3HFVA 2E3CA 2AMCB 4XU2A 4H2TA 1N9WA 3I7FA 1X2HA 4XEOA 1C0AA 2EWNA 4WI1A 4UP7A 2ZT8A 4KR3A 4TTVA 3HXWA 4HT4A 4P73C 2ZNJA 4XU1A 1SERA 2NS6A 1E1OA 2PMFA 2AKWB 1Z7MA 2C8MA 1X54A 2Q5HA 4YRQA 3HY1A 4OLFA 3NELA 1YGBA 1USYC 2RHQA 4ZTUB 2CJBA 4TVYA 2ZR3A 1ATIA 1G5HA 2I4LA 4WJ3M 4PG3A 3R07A 1QE0A 4YRTA 3NEMA 2FYKA 4H2WA 4UPAA 4P73A 3A7AA 1WLEA 5C52B 3TEHA 2EJFA 2J3LA 4Q6GA 3M4PA 3REXA 4P75C 3DSQA 4KR2A 3MEYA 3P8TA 1ADYA 3E9HA 2ZINA 1YFRA 1NJ2A 2EL9A 3A74A 1NYQA 4H02A 2ZGWA 4P72A 4H2UA 3REUA 2DDZA 3RL6A 3A32A 3QO8A 2ZZFA 2Q7HA 4ZIBA 1B7YA 1RIQA 3TEHB 3EFSA 4HWRA 4YREA 4XU3A 3P8VA 4TWAA 2C7IA 4P74A 4XTUA 2P5IA 3HXXA 2PMEA 1NJ6A 3HRIA 5ELOA 4WF2A 2E65A 5KNNA 1FYFA 3V7SA 1ASYA 3L4GA 2ZIOA 3G1ZA 3VBBA 4RQFA 1L0WA 4XTWA 4EO4A 5C53B 3TEGA 3UH0A 1EOVA 4BWAA 2RHSA 4NCXA 3RKXA 1YB3A 3IKMB 4YDQA 1E22A 1SETA 4YP0A 3A5ZA 1BBUA 2ZR2A 4YRCA 3TUPA 2ZXFA 4H2VA 4K88A 3LSQA 3UGQA 2AKWA 2DZCA 2ALYA 2ZIMA 4UP8A 1E24A 3CMQA 4TQFA 3L4GB 3IG2A 1H4QA 2QHSA 1NYRA 2EJGA 2A8EA 2J3MA 3VQVA 2RHSB 1EQRA 4K87A 2I4OA 1HTTA 4P3PA 4OP0A 4BW9A 3RKYA 3NENA 3E9IA 4G85A 3RUXA 2Q7GA 3HXVA 3HXUA 2ALYB 4XTZA 4CH6A 4YRIA 4YRPA 2DXUA 2DTIA 1ADJA 1JJCA 1G5IA 3VQXA 4HWOA 2ZT6A 3V7CA 4YCUA 3IKLA 4HA8A 2DQ0A 2DJZA 3RACA 4P72C 3V8JA 2IY5A 2DXTA 1WPYA 3ERRA 4TVWA 4DQ2A 4CS2A 3A7UA 3QO7A 4P74C 4P3OA 1JJCB 1QF6A 2QHTA 3HTZA 3RF1A 2P0LA 3RIRA 4RMFA 4TVAA 3A5YA 2I4MA 2XGTA 2IY5B 4L87A 4J15A 1LYLA 1G51A 2ZT5A 4P71C 4YRNA 12ASA 4RDXA 4CH5A 3LSSA 4E51A 2ODRD 5F5WA 1NJ1A 4HWPA 4XTYA 3MF1A 4YCWA 3VQYA 2HNIA 3PCOA 3VQWA 4H2SA 4TVAB 1BIBA 4LVJA 4AH6A 2CGHA 1VQZA 4X5OA 3HRKA 3HFZA 2ZNIA 11ASA 3NETA 4P71A 3UFGA 1B70A 1WNLA 1ASZA 4UP9A 4HWTA 2ZZEA 1EFWA 1HXDA 2Q7EA 2E10A 3PCOB 4H2XB 5K1XA 1W66A 2ZT7A 4KQEA 2DU5A 2E41A 4EX5A 3QNEA 4ZTZB 1YFSA 4XTXA 1X55A 3HFZB 2ARTA 2XTIA 4O2DA 1B70B 4YRRA 4LVMA 2E5AA 3BJUA 4RQEA 3ICAA 2DQ3A 4CS3A 4YPFA 1IL2A 1EIYA 2ZCEA 2ARUA 3FJPA 3WQZA 1NJ8A 4PHCA 3RKWA 3IALA 5ELNA 3M4QA 4HVCA 4HWSA 3UGTA 1EVKA 1KMMA 2DKGA 4LNSA 1X56A 2CJ9A 3A31A 2CIMA 4LVLA 1PYSA 4WJ4A 2ARSA 4YCVA 3W3SA 1EIYB 3LC0A 4LVIA 2E1HA 2Q5IA 3MF2A 1EVLA 4CH3A 2E64A 1B8AA 4LVKA 4YYEA 1J5WA 1WQ7A 1H4TA 1X2GA 3MQZA 2DU7A 3HXZA 1B76A 1BBWA 4YRGA 2DZ9A 4YROA 4H2YA
chains in the Genus database with same CATH topology
4CH4A 1WU7A 1PYSB 2I4NA 3EFRA 1USYA 2RHQB 3L1AA 4YRMA 3A7RA 5K1PA 2ODRC 2EAYA 2EJ9A 3V8KA 3KFUA 4YRFA 4H2XA 4K86A 2DEQA 1SESA 1BIAA 5E3IA 4YRLA 4YRJA 2CJAA 4CS4A 1KOGA 1NNHA 2DTOA 5HGQA 3L2ZA 4YRKA 1X01A 1Z7NA 3V7RA 4P75A 3RGLA 1H4VB 4Q15A 3HY0A 2DVEA 2QHUA 3QTCA 1YFTA 3QO5A 4XTVA 3OD1A 2AMCA 1WQWA 3V8LA 1WYDA 4TQDA 1H4SA 2G4CA 3BFMA 1HC7A 3PZCA 1SRYA 1GGMA 4G84A 4YRSA 1NJ5A 1B7YB 2DTHA 2QHVA 3P8YA 5C51B 4XU0A 3HXYA 4DPGA 4XEMA 2ZZGA 4P3NA 2ZTGA 1E1TA 1KMNA 3HFVA 2E3CA 2AMCB 4XU2A 4H2TA 1N9WA 3I7FA 1X2HA 4XEOA 1C0AA 2EWNA 4WI1A 4UP7A 2ZT8A 4KR3A 4TTVA 3HXWA 4HT4A 4P73C 2ZNJA 4XU1A 1SERA 2NS6A 1E1OA 2PMFA 2AKWB 1Z7MA 2C8MA 1X54A 2Q5HA 4YRQA 3HY1A 4OLFA 3NELA 1YGBA 1USYC 2RHQA 4ZTUB 2CJBA 4TVYA 2ZR3A 1ATIA 1G5HA 2I4LA 4WJ3M 4PG3A 3R07A 1QE0A 4YRTA 3NEMA 2FYKA 4H2WA 4UPAA 4P73A 3A7AA 1WLEA 5C52B 3TEHA 2EJFA 2J3LA 4Q6GA 3M4PA 3REXA 4P75C 3DSQA 4KR2A 3MEYA 3P8TA 1ADYA 3E9HA 2ZINA 1YFRA 1NJ2A 2EL9A 3A74A 1NYQA 4H02A 2ZGWA 4P72A 4H2UA 3REUA 2DDZA 3RL6A 3A32A 3QO8A 2ZZFA 2Q7HA 4ZIBA 1B7YA 1RIQA 3TEHB 3EFSA 4HWRA 4YREA 4XU3A 3P8VA 4TWAA 2C7IA 4P74A 4XTUA 2P5IA 3HXXA 2PMEA 1NJ6A 3HRIA 5ELOA 4WF2A 2E65A 5KNNA 1FYFA 3V7SA 1ASYA 3L4GA 2ZIOA 3G1ZA 3VBBA 4RQFA 1L0WA 4XTWA 4EO4A 5C53B 3TEGA 3UH0A 1EOVA 4BWAA 2RHSA 4NCXA 3RKXA 1YB3A 3IKMB 4YDQA 1E22A 1SETA 4YP0A 3A5ZA 1BBUA 2ZR2A 4YRCA 3TUPA 2ZXFA 4H2VA 4K88A 3LSQA 3UGQA 2AKWA 2DZCA 2ALYA 2ZIMA 4UP8A 1E24A 3CMQA 4TQFA 3L4GB 3IG2A 1H4QA 2QHSA 1NYRA 2EJGA 2A8EA 2J3MA 3VQVA 2RHSB 1EQRA 4K87A 2I4OA 1HTTA 4P3PA 4OP0A 4BW9A 3RKYA 3NENA 3E9IA 4G85A 3RUXA 2Q7GA 3HXVA 3HXUA 2ALYB 4XTZA 4CH6A 4YRIA 4YRPA 2DXUA 2DTIA 1ADJA 1JJCA 1G5IA 3VQXA 4HWOA 2ZT6A 3V7CA 4YCUA 3IKLA 4HA8A 2DQ0A 2DJZA 3RACA 4P72C 3V8JA 2IY5A 2DXTA 1WPYA 3ERRA 4TVWA 4DQ2A 4CS2A 3A7UA 3QO7A 4P74C 4P3OA 1JJCB 1QF6A 2QHTA 3HTZA 3RF1A 2P0LA 3RIRA 4RMFA 4TVAA 3A5YA 2I4MA 2XGTA 2IY5B 4L87A 4J15A 1LYLA 1G51A 2ZT5A 4P71C 4YRNA 12ASA 4RDXA 4CH5A 3LSSA 4E51A 2ODRD 5F5WA 1NJ1A 4HWPA 4XTYA 3MF1A 4YCWA 3VQYA 2HNIA 3PCOA 3VQWA 4H2SA 4TVAB 1BIBA 4LVJA 4AH6A 2CGHA 1VQZA 4X5OA 3HRKA 3HFZA 2ZNIA 11ASA 3NETA 4P71A 3UFGA 1B70A 1WNLA 1ASZA 4UP9A 4HWTA 2ZZEA 1EFWA 1HXDA 2Q7EA 2E10A 3PCOB 4H2XB 5K1XA 1W66A 2ZT7A 4KQEA 2DU5A 2E41A 4EX5A 3QNEA 4ZTZB 1YFSA 4XTXA 1X55A 3HFZB 2ARTA 2XTIA 4O2DA 1B70B 4YRRA 4LVMA 2E5AA 3BJUA 4RQEA 3ICAA 2DQ3A 4CS3A 4YPFA 1IL2A 1EIYA 2ZCEA 2ARUA 3FJPA 3WQZA 1NJ8A 4PHCA 3RKWA 3IALA 5ELNA 3M4QA 4HVCA 4HWSA 3UGTA 1EVKA 1KMMA 2DKGA 4LNSA 1X56A 2CJ9A 3A31A 2CIMA 4LVLA 1PYSA 4WJ4A 2ARSA 4YCVA 3W3SA 1EIYB 3LC0A 4LVIA 2E1HA 2Q5IA 3MF2A 1EVLA 4CH3A 2E64A 1B8AA 4LVKA 4YYEA 1J5WA 1WQ7A 1H4TA 1X2GA 3MQZA 2DU7A 3HXZA 1B76A 1BBWA 4YRGA 2DZ9A 4YROA 4H2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CH4 A;  1WU7 A;  1PYS B;  2I4N A;  3EFR A;  1USY A;  2RHQ B;  3L1A A;  4YRM A;  3A7R A;  5K1P A;  2ODR C;  2EAY A;  2EJ9 A;  3V8K A;  3KFU A;  4YRF A;  4H2X A;  4K86 A;  2DEQ A;  1SES A;  1BIA A;  5E3I A;  4YRL A;  4YRJ A;  2CJA A;  4CS4 A;  1KOG A;  1NNH A;  2DTO A;  5HGQ A;  3L2Z A;  4YRK A;  1X01 A;  1Z7N A;  3V7R A;  4P75 A;  3RGL A;  1H4V B;  4Q15 A;  3HY0 A;  2DVE A;  2QHU A;  3QTC A;  1YFT A;  3QO5 A;  4XTV A;  3OD1 A;  2AMC A;  1WQW A;  3V8L A;  1WYD A;  4TQD A;  1H4S A;  2G4C A;  3BFM A;  1HC7 A;  3PZC A;  1SRY A;  1GGM A;  4G84 A;  4YRS A;  1NJ5 A;  1B7Y B;  2DTH A;  2QHV A;  3P8Y A;  5C51 B;  4XU0 A;  3HXY A;  4DPG A;  4XEM A;  2ZZG A;  4P3N A;  2ZTG A;  1E1T A;  1KMN A;  3HFV A;  2E3C A;  2AMC B;  4XU2 A;  4H2T A;  1N9W A;  3I7F A;  1X2H A;  4XEO A;  1C0A A;  2EWN A;  4WI1 A;  4UP7 A;  2ZT8 A;  4KR3 A;  4TTV A;  3HXW A;  4P73 C;  2ZNJ A;  4XU1 A;  1SER A;  1E1O A;  2PMF A;  2AKW B;  1Z7M A;  2C8M A;  1X54 A;  2Q5H A;  4YRQ A;  3HY1 A;  4OLF A;  3NEL A;  1YGB A;  1USY C;  2RHQ A;  4ZTU B;  2CJB A;  4TVY A;  2ZR3 A;  1ATI A;  1G5H A;  2I4L A;  4WJ3 M;  4PG3 A;  3R07 A;  1QE0 A;  4YRT A;  3NEM A;  2FYK A;  4H2W A;  4UPA A;  4P73 A;  3A7A A;  1WLE A;  5C52 B;  3TEH A;  2EJF A;  2J3L A;  4Q6G A;  3M4P A;  3REX A;  4P75 C;  3DSQ A;  4KR2 A;  3MEY A;  3P8T A;  1ADY A;  3E9H A;  2ZIN A;  1YFR A;  1NJ2 A;  2EL9 A;  3A74 A;  1NYQ A;  4H02 A;  2ZGW A;  4P72 A;  4H2U A;  3REU A;  2DDZ A;  3RL6 A;  3A32 A;  3QO8 A;  2ZZF A;  2Q7H A;  4ZIB A;  1B7Y A;  1RIQ A;  3TEH B;  3EFS A;  4HWR A;  4YRE A;  4XU3 A;  3P8V A;  4TWA A;  2C7I A;  4P74 A;  4XTU A;  2P5I A;  3HXX A;  2PME A;  1NJ6 A;  3HRI A;  5ELO A;  4WF2 A;  2E65 A;  5KNN A;  1FYF A;  3V7S A;  1ASY A;  3L4G A;  2ZIO A;  3G1Z A;  3VBB A;  4RQF A;  1L0W A;  4XTW A;  4EO4 A;  5C53 B;  3TEG A;  3UH0 A;  1EOV A;  4BWA A;  2RHS A;  4NCX A;  3RKX A;  1YB3 A;  3IKM B;  4YDQ A;  1E22 A;  1SET A;  4YP0 A;  3A5Z A;  1BBU A;  2ZR2 A;  4YRC A;  3TUP A;  2ZXF A;  4H2V A;  4K88 A;  3LSQ A;  3UGQ A;  2AKW A;  2DZC A;  2ALY A;  2ZIM A;  4TQF A;  1E24 A;  3CMQ A;  4UP8 A;  3L4G B;  3IG2 A;  1H4Q A;  2QHS A;  1NYR A;  2EJG A;  2J3M A;  3VQV A;  2RHS B;  1EQR A;  4K87 A;  2I4O A;  1HTT A;  4P3P A;  4OP0 A;  4BW9 A;  3RKY A;  3NEN A;  3E9I A;  4G85 A;  3RUX A;  2Q7G A;  3HXV A;  3HXU A;  2ALY B;  4XTZ A;  4CH6 A;  4YRI A;  4YRP A;  2DXU A;  2DTI A;  1ADJ A;  1JJC A;  1G5I A;  3VQX A;  4HWO A;  2ZT6 A;  3V7C A;  4YCU A;  3IKL A;  4HA8 A;  2DQ0 A;  2DJZ A;  3RAC A;  4P72 C;  3V8J A;  2IY5 A;  2DXT A;  1WPY A;  3ERR A;  4TVW A;  4DQ2 A;  4CS2 A;  3A7U A;  3QO7 A;  4P74 C;  4P3O A;  1JJC B;  1QF6 A;  2QHT A;  3HTZ A;  3RF1 A;  2P0L A;  3RIR A;  4RMF A;  4TVA A;  3A5Y A;  2I4M A;  2XGT A;  2IY5 B;  4L87 A;  4J15 A;  1LYL A;  1G51 A;  2ZT5 A;  4P71 C;  4YRN A;  12AS A;  4RDX A;  4CH5 A;  3LSS A;  4E51 A;  2ODR D;  5F5W A;  1NJ1 A;  4HWP A;  4XTY A;  3MF1 A;  4YCW A;  3VQY A;  2HNI A;  3PCO A;  3VQW A;  4H2S A;  4TVA B;  1BIB A;  4AH6 A;  2CGH A;  1VQZ A;  4X5O A;  3HRK A;  3HFZ A;  2ZNI A;  11AS A;  3NET A;  4P71 A;  3UFG A;  1B70 A;  1WNL A;  1ASZ A;  4UP9 A;  4HWT A;  2ZZE A;  1EFW A;  1HXD A;  2Q7E A;  2E10 A;  3PCO B;  4H2X B;  5K1X A;  1W66 A;  2ZT7 A;  4KQE A;  2DU5 A;  2E41 A;  4EX5 A;  3QNE A;  4ZTZ B;  1YFS A;  4XTX A;  1X55 A;  3HFZ B;  2ART A;  2XTI A;  4O2D A;  1B70 B;  4YRR A;  2E5A A;  3BJU A;  4RQE A;  3ICA A;  2DQ3 A;  4CS3 A;  4YPF A;  1IL2 A;  1EIY A;  2ZCE A;  2ARU A;  3FJP A;  3WQZ A;  1NJ8 A;  4PHC A;  3RKW A;  3IAL A;  5ELN A;  3M4Q A;  4HVC A;  4HWS A;  3UGT A;  1EVK A;  1KMM A;  2DKG A;  4LNS A;  1X56 A;  2CJ9 A;  3A31 A;  2CIM A;  1PYS A;  4WJ4 A;  2ARS A;  4YCV A;  3W3S A;  1EIY B;  3LC0 A;  2E1H A;  2Q5I A;  3MF2 A;  1EVL A;  4CH3 A;  2E64 A;  1B8A A;  4YYE A;  1J5W A;  1WQ7 A;  1H4T A;  1X2G A;  2DU7 A;  3HXZ A;  1B76 A;  1BBW A;  4YRG A;  2DZ9 A;  4YRO A;  4H2Y A; 
#chains in the Genus database with same CATH topology
 4CH4 A;  1WU7 A;  1PYS B;  2I4N A;  3EFR A;  1USY A;  2RHQ B;  3L1A A;  4YRM A;  3A7R A;  5K1P A;  2ODR C;  2EAY A;  2EJ9 A;  3V8K A;  3KFU A;  4YRF A;  4H2X A;  4K86 A;  2DEQ A;  1SES A;  1BIA A;  5E3I A;  4YRL A;  4YRJ A;  2CJA A;  4CS4 A;  1KOG A;  1NNH A;  2DTO A;  5HGQ A;  3L2Z A;  4YRK A;  1X01 A;  1Z7N A;  3V7R A;  4P75 A;  3RGL A;  1H4V B;  4Q15 A;  3HY0 A;  2DVE A;  2QHU A;  3QTC A;  1YFT A;  3QO5 A;  4XTV A;  3OD1 A;  2AMC A;  1WQW A;  3V8L A;  1WYD A;  4TQD A;  1H4S A;  2G4C A;  3BFM A;  1HC7 A;  3PZC A;  1SRY A;  1GGM A;  4G84 A;  4YRS A;  1NJ5 A;  1B7Y B;  2DTH A;  2QHV A;  3P8Y A;  5C51 B;  4XU0 A;  3HXY A;  4DPG A;  4XEM A;  2ZZG A;  4P3N A;  2ZTG A;  1E1T A;  1KMN A;  3HFV A;  2E3C A;  2AMC B;  4XU2 A;  4H2T A;  1N9W A;  3I7F A;  1X2H A;  4XEO A;  1C0A A;  2EWN A;  4WI1 A;  4UP7 A;  2ZT8 A;  4KR3 A;  4TTV A;  3HXW A;  4HT4 A;  4P73 C;  2ZNJ A;  4XU1 A;  1SER A;  2NS6 A;  1E1O A;  2PMF A;  2AKW B;  1Z7M A;  2C8M A;  1X54 A;  2Q5H A;  4YRQ A;  3HY1 A;  4OLF A;  3NEL A;  1YGB A;  1USY C;  2RHQ A;  4ZTU B;  2CJB A;  4TVY A;  2ZR3 A;  1ATI A;  1G5H A;  2I4L A;  4WJ3 M;  4PG3 A;  3R07 A;  1QE0 A;  4YRT A;  3NEM A;  2FYK A;  4H2W A;  4UPA A;  4P73 A;  3A7A A;  1WLE A;  5C52 B;  3TEH A;  2EJF A;  2J3L A;  4Q6G A;  3M4P A;  3REX A;  4P75 C;  3DSQ A;  4KR2 A;  3MEY A;  3P8T A;  1ADY A;  3E9H A;  2ZIN A;  1YFR A;  1NJ2 A;  2EL9 A;  3A74 A;  1NYQ A;  4H02 A;  2ZGW A;  4P72 A;  4H2U A;  3REU A;  2DDZ A;  3RL6 A;  3A32 A;  3QO8 A;  2ZZF A;  2Q7H A;  4ZIB A;  1B7Y A;  1RIQ A;  3TEH B;  3EFS A;  4HWR A;  4YRE A;  4XU3 A;  3P8V A;  4TWA A;  2C7I A;  4P74 A;  4XTU A;  2P5I A;  3HXX A;  2PME A;  1NJ6 A;  3HRI A;  5ELO A;  4WF2 A;  2E65 A;  5KNN A;  1FYF A;  3V7S A;  1ASY A;  3L4G A;  2ZIO A;  3G1Z A;  3VBB A;  4RQF A;  1L0W A;  4XTW A;  4EO4 A;  5C53 B;  3TEG A;  3UH0 A;  1EOV A;  4BWA A;  2RHS A;  4NCX A;  3RKX A;  1YB3 A;  3IKM B;  4YDQ A;  1E22 A;  1SET A;  4YP0 A;  3A5Z A;  1BBU A;  2ZR2 A;  4YRC A;  3TUP A;  2ZXF A;  4H2V A;  4K88 A;  3LSQ A;  3UGQ A;  2AKW A;  2DZC A;  2ALY A;  2ZIM A;  4UP8 A;  1E24 A;  3CMQ A;  4TQF A;  3L4G B;  3IG2 A;  1H4Q A;  2QHS A;  1NYR A;  2EJG A;  2A8E A;  2J3M A;  3VQV A;  2RHS B;  1EQR A;  4K87 A;  2I4O A;  1HTT A;  4P3P A;  4OP0 A;  4BW9 A;  3RKY A;  3NEN A;  3E9I A;  4G85 A;  3RUX A;  2Q7G A;  3HXV A;  3HXU A;  2ALY B;  4XTZ A;  4CH6 A;  4YRI A;  4YRP A;  2DXU A;  2DTI A;  1ADJ A;  1JJC A;  1G5I A;  3VQX A;  4HWO A;  2ZT6 A;  3V7C A;  4YCU A;  3IKL A;  4HA8 A;  2DQ0 A;  2DJZ A;  3RAC A;  4P72 C;  3V8J A;  2IY5 A;  2DXT A;  1WPY A;  3ERR A;  4TVW A;  4DQ2 A;  4CS2 A;  3A7U A;  3QO7 A;  4P74 C;  4P3O A;  1JJC B;  1QF6 A;  2QHT A;  3HTZ A;  3RF1 A;  2P0L A;  3RIR A;  4RMF A;  4TVA A;  3A5Y A;  2I4M A;  2XGT A;  2IY5 B;  4L87 A;  4J15 A;  1LYL A;  1G51 A;  2ZT5 A;  4P71 C;  4YRN A;  12AS A;  4RDX A;  4CH5 A;  3LSS A;  4E51 A;  2ODR D;  5F5W A;  1NJ1 A;  4HWP A;  4XTY A;  3MF1 A;  4YCW A;  3VQY A;  2HNI A;  3PCO A;  3VQW A;  4H2S A;  4TVA B;  1BIB A;  4LVJ A;  4AH6 A;  2CGH A;  1VQZ A;  4X5O A;  3HRK A;  3HFZ A;  2ZNI A;  11AS A;  3NET A;  4P71 A;  3UFG A;  1B70 A;  1WNL A;  1ASZ A;  4UP9 A;  4HWT A;  2ZZE A;  1EFW A;  1HXD A;  2Q7E A;  2E10 A;  3PCO B;  4H2X B;  5K1X A;  1W66 A;  2ZT7 A;  4KQE A;  2DU5 A;  2E41 A;  4EX5 A;  3QNE A;  4ZTZ B;  1YFS A;  4XTX A;  1X55 A;  3HFZ B;  2ART A;  2XTI A;  4O2D A;  1B70 B;  4YRR A;  4LVM A;  2E5A A;  3BJU A;  4RQE A;  3ICA A;  2DQ3 A;  4CS3 A;  4YPF A;  1IL2 A;  1EIY A;  2ZCE A;  2ARU A;  3FJP A;  3WQZ A;  1NJ8 A;  4PHC A;  3RKW A;  3IAL A;  5ELN A;  3M4Q A;  4HVC A;  4HWS A;  3UGT A;  1EVK A;  1KMM A;  2DKG A;  4LNS A;  1X56 A;  2CJ9 A;  3A31 A;  2CIM A;  4LVL A;  1PYS A;  4WJ4 A;  2ARS A;  4YCV A;  3W3S A;  1EIY B;  3LC0 A;  4LVI A;  2E1H A;  2Q5I A;  3MF2 A;  1EVL A;  4CH3 A;  2E64 A;  1B8A A;  4LVK A;  4YYE A;  1J5W A;  1WQ7 A;  1H4T A;  1X2G A;  3MQZ A;  2DU7 A;  3HXZ A;  1B76 A;  1BBW A;  4YRG A;  2DZ9 A;  4YRO A;  4H2Y A; 
#chains in the Genus database with same CATH homology
 4CH4 A;  1WU7 A;  1PYS B;  2I4N A;  3EFR A;  1USY A;  2RHQ B;  3L1A A;  4YRM A;  3A7R A;  5K1P A;  2ODR C;  2EAY A;  2EJ9 A;  3V8K A;  3KFU A;  4YRF A;  4H2X A;  4K86 A;  2DEQ A;  1SES A;  1BIA A;  5E3I A;  4YRL A;  4YRJ A;  2CJA A;  4CS4 A;  1KOG A;  1NNH A;  2DTO A;  5HGQ A;  3L2Z A;  4YRK A;  1X01 A;  1Z7N A;  3V7R A;  4P75 A;  3RGL A;  1H4V B;  4Q15 A;  3HY0 A;  2DVE A;  2QHU A;  3QTC A;  1YFT A;  3QO5 A;  4XTV A;  3OD1 A;  2AMC A;  1WQW A;  3V8L A;  1WYD A;  4TQD A;  1H4S A;  2G4C A;  3BFM A;  1HC7 A;  3PZC A;  1SRY A;  1GGM A;  4G84 A;  4YRS A;  1NJ5 A;  1B7Y B;  2DTH A;  2QHV A;  3P8Y A;  5C51 B;  4XU0 A;  3HXY A;  4DPG A;  4XEM A;  2ZZG A;  4P3N A;  2ZTG A;  1E1T A;  1KMN A;  3HFV A;  2E3C A;  2AMC B;  4XU2 A;  4H2T A;  1N9W A;  3I7F A;  1X2H A;  4XEO A;  1C0A A;  2EWN A;  4WI1 A;  4UP7 A;  2ZT8 A;  4KR3 A;  4TTV A;  3HXW A;  4HT4 A;  4P73 C;  2ZNJ A;  4XU1 A;  1SER A;  2NS6 A;  1E1O A;  2PMF A;  2AKW B;  1Z7M A;  2C8M A;  1X54 A;  2Q5H A;  4YRQ A;  3HY1 A;  4OLF A;  3NEL A;  1YGB A;  1USY C;  2RHQ A;  4ZTU B;  2CJB A;  4TVY A;  2ZR3 A;  1ATI A;  1G5H A;  2I4L A;  4WJ3 M;  4PG3 A;  3R07 A;  1QE0 A;  4YRT A;  3NEM A;  2FYK A;  4H2W A;  4UPA A;  4P73 A;  3A7A A;  1WLE A;  5C52 B;  3TEH A;  2EJF A;  2J3L A;  4Q6G A;  3M4P A;  3REX A;  4P75 C;  3DSQ A;  4KR2 A;  3MEY A;  3P8T A;  1ADY A;  3E9H A;  2ZIN A;  1YFR A;  1NJ2 A;  2EL9 A;  3A74 A;  1NYQ A;  4H02 A;  2ZGW A;  4P72 A;  4H2U A;  3REU A;  2DDZ A;  3RL6 A;  3A32 A;  3QO8 A;  2ZZF A;  2Q7H A;  4ZIB A;  1B7Y A;  1RIQ A;  3TEH B;  3EFS A;  4HWR A;  4YRE A;  4XU3 A;  3P8V A;  4TWA A;  2C7I A;  4P74 A;  4XTU A;  2P5I A;  3HXX A;  2PME A;  1NJ6 A;  3HRI A;  5ELO A;  4WF2 A;  2E65 A;  5KNN A;  1FYF A;  3V7S A;  1ASY A;  3L4G A;  2ZIO A;  3G1Z A;  3VBB A;  4RQF A;  1L0W A;  4XTW A;  4EO4 A;  5C53 B;  3TEG A;  3UH0 A;  1EOV A;  4BWA A;  2RHS A;  4NCX A;  3RKX A;  1YB3 A;  3IKM B;  4YDQ A;  1E22 A;  1SET A;  4YP0 A;  3A5Z A;  1BBU A;  2ZR2 A;  4YRC A;  3TUP A;  2ZXF A;  4H2V A;  4K88 A;  3LSQ A;  3UGQ A;  2AKW A;  2DZC A;  2ALY A;  2ZIM A;  4UP8 A;  1E24 A;  3CMQ A;  4TQF A;  3L4G B;  3IG2 A;  1H4Q A;  2QHS A;  1NYR A;  2EJG A;  2A8E A;  2J3M A;  3VQV A;  2RHS B;  1EQR A;  4K87 A;  2I4O A;  1HTT A;  4P3P A;  4OP0 A;  4BW9 A;  3RKY A;  3NEN A;  3E9I A;  4G85 A;  3RUX A;  2Q7G A;  3HXV A;  3HXU A;  2ALY B;  4XTZ A;  4CH6 A;  4YRI A;  4YRP A;  2DXU A;  2DTI A;  1ADJ A;  1JJC A;  1G5I A;  3VQX A;  4HWO A;  2ZT6 A;  3V7C A;  4YCU A;  3IKL A;  4HA8 A;  2DQ0 A;  2DJZ A;  3RAC A;  4P72 C;  3V8J A;  2IY5 A;  2DXT A;  1WPY A;  3ERR A;  4TVW A;  4DQ2 A;  4CS2 A;  3A7U A;  3QO7 A;  4P74 C;  4P3O A;  1JJC B;  1QF6 A;  2QHT A;  3HTZ A;  3RF1 A;  2P0L A;  3RIR A;  4RMF A;  4TVA A;  3A5Y A;  2I4M A;  2XGT A;  2IY5 B;  4L87 A;  4J15 A;  1LYL A;  1G51 A;  2ZT5 A;  4P71 C;  4YRN A;  12AS A;  4RDX A;  4CH5 A;  3LSS A;  4E51 A;  2ODR D;  5F5W A;  1NJ1 A;  4HWP A;  4XTY A;  3MF1 A;  4YCW A;  3VQY A;  2HNI A;  3PCO A;  3VQW A;  4H2S A;  4TVA B;  1BIB A;  4LVJ A;  4AH6 A;  2CGH A;  1VQZ A;  4X5O A;  3HRK A;  3HFZ A;  2ZNI A;  11AS A;  3NET A;  4P71 A;  3UFG A;  1B70 A;  1WNL A;  1ASZ A;  4UP9 A;  4HWT A;  2ZZE A;  1EFW A;  1HXD A;  2Q7E A;  2E10 A;  3PCO B;  4H2X B;  5K1X A;  1W66 A;  2ZT7 A;  4KQE A;  2DU5 A;  2E41 A;  4EX5 A;  3QNE A;  4ZTZ B;  1YFS A;  4XTX A;  1X55 A;  3HFZ B;  2ART A;  2XTI A;  4O2D A;  1B70 B;  4YRR A;  4LVM A;  2E5A A;  3BJU A;  4RQE A;  3ICA A;  2DQ3 A;  4CS3 A;  4YPF A;  1IL2 A;  1EIY A;  2ZCE A;  2ARU A;  3FJP A;  3WQZ A;  1NJ8 A;  4PHC A;  3RKW A;  3IAL A;  5ELN A;  3M4Q A;  4HVC A;  4HWS A;  3UGT A;  1EVK A;  1KMM A;  2DKG A;  4LNS A;  1X56 A;  2CJ9 A;  3A31 A;  2CIM A;  4LVL A;  1PYS A;  4WJ4 A;  2ARS A;  4YCV A;  3W3S A;  1EIY B;  3LC0 A;  4LVI A;  2E1H A;  2Q5I A;  3MF2 A;  1EVL A;  4CH3 A;  2E64 A;  1B8A A;  4LVK A;  4YYE A;  1J5W A;  1WQ7 A;  1H4T A;  1X2G A;  3MQZ A;  2DU7 A;  3HXZ A;  1B76 A;  1BBW A;  4YRG A;  2DZ9 A;  4YRO A;  4H2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...