3PCOA

Crystal structure of e. coli phenylalanine-trna synthetase complexed with phenylalanine and amp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
242
structure length
242
Chain Sequence
RLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNVLRNVGIDPEVYSGFAFGMGMERLTMLRYGVTDLRSFFENDLRFLKQFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanyl-tRNA synthetase, alpha subunit
publication title Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 62
structure length 242
sequence length 242
chains with identical sequence C
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
A PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3pcoA01
3UH0A 3QNEA 11ASA 4H2WA 1WLEA 3HY0A 3RIRA 4UP7A 1W66A 4HWPA 1USYA 3LSQA 1ADYA 1NJ2A 3RKYA 3MF2A 4KR3A 2ZGWA 3QO5A 4YRMA 1H4VB 1PYSB 1E22A 5K1XA 1SRYA 4P3PA 2Q7EA 2RHQB 2PMEA 3QO8A 4K87A 1B70A 4CH5A 4J15A 1WNLA 3A32A 1FYFA 5C53B 4K88A 3FJPA 4WJ4A 3VQVA 1NYRA 3HRIA 1KMMA 2ARTA 4Q6GA 4RMFA 4G84A 2E1HA 4ZTZB 4YDQA 2ZZFA 2J3MA 3QTCA 3HRKA 4CS2A 1ADJA 1GGMA 3RF1A 4DQ2A 4YCWA 1E1OA 2ZIOA 1X2GA 3ERRA 1HXDA 4P72C 4O2DA 4XEMA 1LYLA 2DQ0A 1E1TA 4EX5A 1WYDA 3A7AA 2AKWA 4YRKA 4HA8A 2Q7HA 4YREA 4H2TA 4UP9A 1J5WA 3PZCA 1H4QA 1B76A 1G51A 1Z7NA 5ELNA 4XTVA 1BIAA 3DSQA 1EIYB 4YRLA 2J3LA 3LC0A 3TUPA 2DEQA 2ZR3A 1HC7A 4BW9A 2E41A 3A74A 4H02A 5C51B 3HXYA 1WU7A 3UFGA 1EOVA 4YRJA 4YPFA 4L87A 3VQYA 4YCVA 1Z7MA 2E64A 1C0AA 3HTZA 2DXTA 3IG2A 3L4GA 3W3SA 3M4QA 3V8KA 4RQFA 1E24A 4YRCA 1KOGA 1N9WA 2DTHA 3BFMA 4P71C 1NNHA 2FYKA 4KQEA 3VBBA 1G5HA 3NETA 2CJBA 1HTTA 2CJ9A 4YRRA 1B8AA 4H2XA 2ZT7A 4P3OA 2I4NA 1BBUA 4H2YA 2XGTA 3V8JA 4XTZA 1YGBA 4H2VA 2E10A 5ELOA 4YRSA 2IY5B 4UP8A 4P72A 3E9HA 2G4CA 4YRQA 1KMNA 3P8TA 4K86A 3IKMB 4KR2A 1EVKA 1PYSA 4P73C 4YRGA 2ZNJA 4XU2A 2RHQA 3A7RA 3HY1A 2DQ3A 4NCXA 1ASZA 3L1AA 4XU3A 4YRFA 2AMCB 1ATIA 1WQ7A 1VQZA 1BBWA 1BIBA 2QHUA 2ARSA 5E3IA 3WQZA 3BJUA 1B7YB 2E65A 1EVLA 4Q15A 3L2ZA 3HXVA 1JJCB 3REXA 4BWAA 4WJ3M 2CGHA 4YYEA 4YRPA 4HVCA 4ZIBA 1USYC 4TVYA 3HFZB 4G85A 1JJCA 4YRTA 2DJZA 1L0WA 3LSSA 4HWTA 4OP0A 2EJ9A 4H2UA 5K1PA 4XU1A 3RL6A 2DXUA 2DZ9A 12ASA 2E3CA 2I4MA 4P71A 1ASYA 3V8LA 2ZIMA 4X5OA 2ODRD 2ZT5A 4TVAB 2HNIA 4HWOA 1EIYA 2DTOA 1WPYA 3UGQA 3HXWA 5KNNA 2ALYB 2ZCEA 2QHTA 4WI1A 3HXXA 3R07A 3PCOB 2ARUA 4TQFA 3REUA 1EFWA 4CS4A 1G5IA 2I4OA 4LNSA 4P3NA 2ODRC 4CH6A 3HXUA 2ZZGA 4P73A 4YROA 3A7UA 3PCOA 3VQXA 1X55A 2ZINA 3RKWA 2ZXFA 1EQRA 4YCUA 4YRNA 1H4TA 4PHCA 1YFRA 4XU0A 4P75C 3HFVA 4HWSA 3CMQA 2XTIA 4H2SA 1WQWA 2DVEA 4CS3A 3NELA 4XTXA 3IKLA 2EL9A 2ZR2A 3NENA 2IY5A 2ZTGA 4HWRA 4XTUA 2Q5HA 3P8YA 4P74C 2EJFA 1B70B 1SERA 1RIQA 3KFUA 4XEOA 4XTYA 1H4SA 3RUXA 2EJGA 3UGTA 4E51A 2DKGA 1X56A 3VQWA 4CH3A 3EFRA 4TTVA 2QHVA 3QO7A 2EAYA 2C8MA 4PG3A 2PMFA 4YP0A 1YFTA 2AMCA 3OD1A 4TWAA 2P5IA 1QE0A 4RQEA 1X01A 2I4LA 3A5YA 3MEYA 4EO4A 2ZNIA 1B7YA 1IL2A 3V7RA 2CJAA 3TEHB 4WF2A 2AKWB 3I7FA 2QHSA 1X2HA 1QF6A 2Q5IA 1SESA 4UPAA 3TEHA 3HFZA 3IALA 3RACA 1NJ1A 1SETA 3V7CA 4YRIA 3EFSA 3G1ZA 1X54A 2P0LA 2RHSB 2C7IA 3ICAA 4TQDA 4OLFA 1YB3A 1NJ5A 3TEGA 4P75A 3RKXA 3A5ZA 2RHSA 4TVAA 5HGQA 1NJ8A 2DZCA 1NJ6A 2Q7GA 2ALYA 3A31A 3P8VA 4RDXA 2CIMA 2DDZA 3HXZA 2EWNA 4CH4A 3E9IA 3V7SA 4P74A 3NEMA 3L4GB 1NYQA 4ZTUB 4XTWA 2DU5A 3MF1A 2ZT6A 4TVWA 2DTIA 3M4PA 4AH6A 5C52B 1YFSA 3RGLA 4H2XB 2ZT8A 2DU7A 4DPGA 2ZZEA 5F5WA 2E5AA
chains in the Genus database with same CATH superfamily
3UH0A 3QNEA 11ASA 4H2WA 1WLEA 3HY0A 3RIRA 4UP7A 1W66A 4HWPA 1USYA 3LSQA 1ADYA 1NJ2A 3RKYA 3MF2A 4KR3A 2ZGWA 3QO5A 4YRMA 1H4VB 1PYSB 1E22A 5K1XA 1SRYA 4P3PA 4LVMA 2Q7EA 2RHQB 2PMEA 3QO8A 4K87A 1B70A 4CH5A 4J15A 1WNLA 3A32A 1FYFA 5C53B 4K88A 3FJPA 4WJ4A 3MQZA 3VQVA 1NYRA 3HRIA 1KMMA 2ARTA 4Q6GA 4RMFA 4G84A 2E1HA 4ZTZB 4YDQA 2ZZFA 2J3MA 3QTCA 3HRKA 4CS2A 1ADJA 1GGMA 3RF1A 4DQ2A 4YCWA 1E1OA 4LVJA 2ZIOA 1X2GA 3ERRA 1HXDA 4P72C 4O2DA 2NS6A 4XEMA 1LYLA 2DQ0A 1E1TA 4EX5A 1WYDA 3A7AA 2AKWA 4YRKA 4HA8A 2Q7HA 4YREA 4H2TA 4UP9A 1J5WA 3PZCA 1H4QA 1B76A 1G51A 1Z7NA 5ELNA 4XTVA 1BIAA 3DSQA 1EIYB 4YRLA 2J3LA 3LC0A 3TUPA 2DEQA 2ZR3A 1HC7A 4BW9A 2E41A 3A74A 4H02A 5C51B 3HXYA 1WU7A 3UFGA 1EOVA 4YRJA 4YPFA 4L87A 3VQYA 4YCVA 1Z7MA 2E64A 1C0AA 3HTZA 2DXTA 3IG2A 3L4GA 3W3SA 3M4QA 3V8KA 4RQFA 1E24A 4YRCA 1KOGA 1N9WA 2DTHA 3BFMA 4P71C 1NNHA 2A8EA 2FYKA 4KQEA 3VBBA 1G5HA 3NETA 2CJBA 1HTTA 2CJ9A 4YRRA 1B8AA 4H2XA 2ZT7A 4P3OA 2I4NA 1BBUA 4H2YA 2XGTA 3V8JA 4XTZA 1YGBA 4H2VA 2E10A 5ELOA 4YRSA 2IY5B 4UP8A 4P72A 3E9HA 2G4CA 4YRQA 1KMNA 3P8TA 4K86A 3IKMB 4KR2A 1EVKA 1PYSA 4P73C 4YRGA 2ZNJA 4XU2A 2RHQA 3A7RA 3HY1A 2DQ3A 4NCXA 1ASZA 3L1AA 4XU3A 4YRFA 2AMCB 1ATIA 1WQ7A 1VQZA 1BBWA 1BIBA 2QHUA 2ARSA 5E3IA 3WQZA 3BJUA 1B7YB 2E65A 1EVLA 4Q15A 3L2ZA 3HXVA 1JJCB 3REXA 4BWAA 4WJ3M 2CGHA 4YYEA 4YRPA 4HVCA 4ZIBA 1USYC 4TVYA 3HFZB 4G85A 1JJCA 4YRTA 2DJZA 1L0WA 3LSSA 4HWTA 4OP0A 2EJ9A 4H2UA 5K1PA 4XU1A 3RL6A 2DXUA 2DZ9A 12ASA 2E3CA 2I4MA 4P71A 1ASYA 3V8LA 2ZIMA 4X5OA 2ODRD 2ZT5A 4TVAB 4LVIA 2HNIA 4HWOA 1EIYA 2DTOA 1WPYA 3UGQA 3HXWA 5KNNA 2ALYB 2ZCEA 2QHTA 4WI1A 3HXXA 3R07A 3PCOB 2ARUA 4TQFA 3REUA 1EFWA 4CS4A 1G5IA 2I4OA 4LNSA 4P3NA 2ODRC 4CH6A 3HXUA 2ZZGA 4P73A 4YROA 3A7UA 3PCOA 3VQXA 1X55A 2ZINA 3RKWA 2ZXFA 1EQRA 4YCUA 4YRNA 1H4TA 4PHCA 1YFRA 4XU0A 4P75C 3HFVA 4HWSA 3CMQA 2XTIA 4H2SA 1WQWA 2DVEA 4CS3A 3NELA 4XTXA 3IKLA 2EL9A 2ZR2A 3NENA 2IY5A 2ZTGA 4HWRA 4XTUA 2Q5HA 3P8YA 4P74C 4LVLA 2EJFA 1B70B 1SERA 1RIQA 3KFUA 4XEOA 4XTYA 1H4SA 3RUXA 2EJGA 3UGTA 4E51A 2DKGA 1X56A 3VQWA 4CH3A 3EFRA 4TTVA 2QHVA 3QO7A 2EAYA 2C8MA 4PG3A 2PMFA 4YP0A 1YFTA 2AMCA 3OD1A 4TWAA 2P5IA 1QE0A 4RQEA 1X01A 2I4LA 3A5YA 3MEYA 4EO4A 2ZNIA 1B7YA 1IL2A 3V7RA 2CJAA 3TEHB 4WF2A 2AKWB 3I7FA 2QHSA 1X2HA 1QF6A 2Q5IA 1SESA 4UPAA 3TEHA 3HFZA 3IALA 3RACA 1NJ1A 1SETA 3V7CA 4YRIA 3EFSA 3G1ZA 1X54A 2P0LA 2RHSB 2C7IA 3ICAA 4TQDA 4OLFA 1YB3A 1NJ5A 3TEGA 4P75A 3RKXA 3A5ZA 2RHSA 4TVAA 5HGQA 1NJ8A 2DZCA 1NJ6A 2Q7GA 2ALYA 3A31A 3P8VA 4RDXA 2CIMA 2DDZA 3HXZA 2EWNA 4CH4A 4LVKA 3E9IA 3V7SA 4HT4A 4P74A 3NEMA 3L4GB 1NYQA 4ZTUB 4XTWA 2DU5A 3MF1A 2ZT6A 4TVWA 2DTIA 3M4PA 4AH6A 5C52B 1YFSA 3RGLA 4H2XB 2ZT8A 2DU7A 4DPGA 2ZZEA 5F5WA 2E5AA
chains in the Genus database with same CATH topology
3UH0A 3QNEA 11ASA 4H2WA 1WLEA 3HY0A 3RIRA 4UP7A 1W66A 4HWPA 1USYA 3LSQA 1ADYA 1NJ2A 3RKYA 3MF2A 4KR3A 2ZGWA 3QO5A 4YRMA 1H4VB 1PYSB 1E22A 5K1XA 1SRYA 4P3PA 4LVMA 2Q7EA 2RHQB 2PMEA 3QO8A 4K87A 1B70A 4CH5A 4J15A 1WNLA 3A32A 1FYFA 5C53B 4K88A 3FJPA 4WJ4A 3MQZA 3VQVA 1NYRA 3HRIA 1KMMA 2ARTA 4Q6GA 4RMFA 4G84A 2E1HA 4ZTZB 4YDQA 2ZZFA 2J3MA 3QTCA 3HRKA 4CS2A 1ADJA 1GGMA 3RF1A 4DQ2A 4YCWA 1E1OA 4LVJA 2ZIOA 1X2GA 3ERRA 1HXDA 4P72C 4O2DA 2NS6A 4XEMA 1LYLA 2DQ0A 1E1TA 4EX5A 1WYDA 3A7AA 2AKWA 4YRKA 4HA8A 2Q7HA 4YREA 4H2TA 4UP9A 1J5WA 3PZCA 1H4QA 1B76A 1G51A 1Z7NA 5ELNA 4XTVA 1BIAA 3DSQA 1EIYB 4YRLA 2J3LA 3LC0A 3TUPA 2DEQA 2ZR3A 1HC7A 4BW9A 2E41A 3A74A 4H02A 5C51B 3HXYA 1WU7A 3UFGA 1EOVA 4YRJA 4YPFA 4L87A 3VQYA 4YCVA 1Z7MA 2E64A 1C0AA 3HTZA 2DXTA 3IG2A 3L4GA 3W3SA 3M4QA 3V8KA 4RQFA 1E24A 4YRCA 1KOGA 1N9WA 2DTHA 3BFMA 4P71C 1NNHA 2A8EA 2FYKA 4KQEA 3VBBA 1G5HA 3NETA 2CJBA 1HTTA 2CJ9A 4YRRA 1B8AA 4H2XA 2ZT7A 4P3OA 2I4NA 1BBUA 4H2YA 2XGTA 3V8JA 4XTZA 1YGBA 4H2VA 2E10A 5ELOA 4YRSA 2IY5B 4UP8A 4P72A 3E9HA 2G4CA 4YRQA 1KMNA 3P8TA 4K86A 3IKMB 4KR2A 1EVKA 1PYSA 4P73C 4YRGA 2ZNJA 4XU2A 2RHQA 3A7RA 3HY1A 2DQ3A 4NCXA 1ASZA 3L1AA 4XU3A 4YRFA 2AMCB 1ATIA 1WQ7A 1VQZA 1BBWA 1BIBA 2QHUA 2ARSA 5E3IA 3WQZA 3BJUA 1B7YB 2E65A 1EVLA 4Q15A 3L2ZA 3HXVA 1JJCB 3REXA 4BWAA 4WJ3M 2CGHA 4YYEA 4YRPA 4HVCA 4ZIBA 1USYC 4TVYA 3HFZB 4G85A 1JJCA 4YRTA 2DJZA 1L0WA 3LSSA 4HWTA 4OP0A 2EJ9A 4H2UA 5K1PA 4XU1A 3RL6A 2DXUA 2DZ9A 12ASA 2E3CA 2I4MA 4P71A 1ASYA 3V8LA 2ZIMA 4X5OA 2ODRD 2ZT5A 4TVAB 4LVIA 2HNIA 4HWOA 1EIYA 2DTOA 1WPYA 3UGQA 3HXWA 5KNNA 2ALYB 2ZCEA 2QHTA 4WI1A 3HXXA 3R07A 3PCOB 2ARUA 4TQFA 3REUA 1EFWA 4CS4A 1G5IA 2I4OA 4LNSA 4P3NA 2ODRC 4CH6A 3HXUA 2ZZGA 4P73A 4YROA 3A7UA 3PCOA 3VQXA 1X55A 2ZINA 3RKWA 2ZXFA 1EQRA 4YCUA 4YRNA 1H4TA 4PHCA 1YFRA 4XU0A 4P75C 3HFVA 4HWSA 3CMQA 2XTIA 4H2SA 1WQWA 2DVEA 4CS3A 3NELA 4XTXA 3IKLA 2EL9A 2ZR2A 3NENA 2IY5A 2ZTGA 4HWRA 4XTUA 2Q5HA 3P8YA 4P74C 4LVLA 2EJFA 1B70B 1SERA 1RIQA 3KFUA 4XEOA 4XTYA 1H4SA 3RUXA 2EJGA 3UGTA 4E51A 2DKGA 1X56A 3VQWA 4CH3A 3EFRA 4TTVA 2QHVA 3QO7A 2EAYA 2C8MA 4PG3A 2PMFA 4YP0A 1YFTA 2AMCA 3OD1A 4TWAA 2P5IA 1QE0A 4RQEA 1X01A 2I4LA 3A5YA 3MEYA 4EO4A 2ZNIA 1B7YA 1IL2A 3V7RA 2CJAA 3TEHB 4WF2A 2AKWB 3I7FA 2QHSA 1X2HA 1QF6A 2Q5IA 1SESA 4UPAA 3TEHA 3HFZA 3IALA 3RACA 1NJ1A 1SETA 3V7CA 4YRIA 3EFSA 3G1ZA 1X54A 2P0LA 2RHSB 2C7IA 3ICAA 4TQDA 4OLFA 1YB3A 1NJ5A 3TEGA 4P75A 3RKXA 3A5ZA 2RHSA 4TVAA 5HGQA 1NJ8A 2DZCA 1NJ6A 2Q7GA 2ALYA 3A31A 3P8VA 4RDXA 2CIMA 2DDZA 3HXZA 2EWNA 4CH4A 4LVKA 3E9IA 3V7SA 4HT4A 4P74A 3NEMA 3L4GB 1NYQA 4ZTUB 4XTWA 2DU5A 3MF1A 2ZT6A 4TVWA 2DTIA 3M4PA 4AH6A 5C52B 1YFSA 3RGLA 4H2XB 2ZT8A 2DU7A 4DPGA 2ZZEA 5F5WA 2E5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UH0 A;  3QNE A;  11AS A;  4H2W A;  1WLE A;  3HY0 A;  3RIR A;  4UP7 A;  1W66 A;  4HWP A;  1USY A;  3LSQ A;  1ADY A;  1NJ2 A;  3RKY A;  3MF2 A;  4KR3 A;  2ZGW A;  3QO5 A;  4YRM A;  1H4V B;  1PYS B;  1E22 A;  5K1X A;  1SRY A;  4P3P A;  2Q7E A;  2RHQ B;  2PME A;  3QO8 A;  4K87 A;  1B70 A;  4CH5 A;  4J15 A;  1WNL A;  3A32 A;  1FYF A;  5C53 B;  4K88 A;  3FJP A;  4WJ4 A;  3VQV A;  1NYR A;  3HRI A;  1KMM A;  2ART A;  4Q6G A;  4RMF A;  4G84 A;  2E1H A;  4ZTZ B;  4YDQ A;  2ZZF A;  2J3M A;  3QTC A;  3HRK A;  4CS2 A;  1ADJ A;  1GGM A;  3RF1 A;  4DQ2 A;  4YCW A;  1E1O A;  2ZIO A;  1X2G A;  3ERR A;  1HXD A;  4P72 C;  4O2D A;  4XEM A;  1LYL A;  2DQ0 A;  1E1T A;  4EX5 A;  1WYD A;  3A7A A;  2AKW A;  4YRK A;  4HA8 A;  2Q7H A;  4YRE A;  4H2T A;  4UP9 A;  1J5W A;  3PZC A;  1H4Q A;  1B76 A;  1G51 A;  1Z7N A;  5ELN A;  4XTV A;  1BIA A;  3DSQ A;  1EIY B;  4YRL A;  2J3L A;  3LC0 A;  3TUP A;  2DEQ A;  2ZR3 A;  1HC7 A;  4BW9 A;  2E41 A;  3A74 A;  4H02 A;  5C51 B;  3HXY A;  1WU7 A;  3UFG A;  1EOV A;  4YRJ A;  4YPF A;  4L87 A;  3VQY A;  4YCV A;  1Z7M A;  2E64 A;  1C0A A;  3HTZ A;  2DXT A;  3IG2 A;  3L4G A;  3W3S A;  3M4Q A;  3V8K A;  4RQF A;  1E24 A;  4YRC A;  1KOG A;  1N9W A;  2DTH A;  3BFM A;  4P71 C;  1NNH A;  2FYK A;  4KQE A;  3VBB A;  1G5H A;  3NET A;  2CJB A;  1HTT A;  2CJ9 A;  4YRR A;  1B8A A;  4H2X A;  2ZT7 A;  4P3O A;  2I4N A;  1BBU A;  4H2Y A;  2XGT A;  3V8J A;  4XTZ A;  1YGB A;  4H2V A;  2E10 A;  5ELO A;  4YRS A;  2IY5 B;  4UP8 A;  4P72 A;  3E9H A;  2G4C A;  4YRQ A;  1KMN A;  3P8T A;  4K86 A;  3IKM B;  4KR2 A;  1EVK A;  1PYS A;  4P73 C;  4YRG A;  2ZNJ A;  4XU2 A;  2RHQ A;  3A7R A;  3HY1 A;  2DQ3 A;  4NCX A;  1ASZ A;  3L1A A;  4XU3 A;  4YRF A;  2AMC B;  1ATI A;  1WQ7 A;  1VQZ A;  1BBW A;  1BIB A;  2QHU A;  2ARS A;  5E3I A;  3WQZ A;  3BJU A;  1B7Y B;  2E65 A;  1EVL A;  4Q15 A;  3L2Z A;  3HXV A;  1JJC B;  3REX A;  4BWA A;  4WJ3 M;  2CGH A;  4YYE A;  4YRP A;  4HVC A;  4ZIB A;  1USY C;  4TVY A;  3HFZ B;  4G85 A;  1JJC A;  4YRT A;  2DJZ A;  1L0W A;  3LSS A;  4HWT A;  4OP0 A;  2EJ9 A;  4H2U A;  5K1P A;  4XU1 A;  3RL6 A;  2DXU A;  2DZ9 A;  12AS A;  2E3C A;  2I4M A;  4P71 A;  1ASY A;  3V8L A;  2ZIM A;  4X5O A;  2ODR D;  2ZT5 A;  4TVA B;  2HNI A;  4HWO A;  1EIY A;  2DTO A;  1WPY A;  3UGQ A;  3HXW A;  5KNN A;  2ALY B;  2ZCE A;  2QHT A;  4WI1 A;  3HXX A;  3R07 A;  3PCO B;  2ARU A;  4TQF A;  3REU A;  1EFW A;  4CS4 A;  1G5I A;  2I4O A;  4LNS A;  4P3N A;  2ODR C;  4CH6 A;  3HXU A;  2ZZG A;  4P73 A;  4YRO A;  3A7U A;  3PCO A;  3VQX A;  1X55 A;  2ZIN A;  3RKW A;  2ZXF A;  1EQR A;  4YCU A;  4YRN A;  1H4T A;  4PHC A;  1YFR A;  4XU0 A;  4P75 C;  3HFV A;  4HWS A;  3CMQ A;  2XTI A;  4H2S A;  1WQW A;  2DVE A;  4CS3 A;  3NEL A;  4XTX A;  3IKL A;  2EL9 A;  2ZR2 A;  3NEN A;  2IY5 A;  2ZTG A;  4HWR A;  4XTU A;  2Q5H A;  3P8Y A;  4P74 C;  2EJF A;  1B70 B;  1SER A;  1RIQ A;  3KFU A;  4XEO A;  4XTY A;  1H4S A;  3RUX A;  2EJG A;  3UGT A;  4E51 A;  2DKG A;  1X56 A;  3VQW A;  4CH3 A;  3EFR A;  4TTV A;  2QHV A;  3QO7 A;  2EAY A;  2C8M A;  4PG3 A;  2PMF A;  4YP0 A;  1YFT A;  2AMC A;  3OD1 A;  4TWA A;  2P5I A;  1QE0 A;  4RQE A;  1X01 A;  2I4L A;  3A5Y A;  3MEY A;  4EO4 A;  2ZNI A;  1B7Y A;  1IL2 A;  3V7R A;  2CJA A;  3TEH B;  4WF2 A;  2AKW B;  3I7F A;  2QHS A;  1X2H A;  1QF6 A;  2Q5I A;  1SES A;  4UPA A;  3TEH A;  3HFZ A;  3IAL A;  3RAC A;  1NJ1 A;  1SET A;  3V7C A;  4YRI A;  3EFS A;  3G1Z A;  1X54 A;  2P0L A;  2RHS B;  2C7I A;  3ICA A;  4TQD A;  4OLF A;  1YB3 A;  1NJ5 A;  3TEG A;  4P75 A;  3RKX A;  3A5Z A;  2RHS A;  4TVA A;  5HGQ A;  1NJ8 A;  2DZC A;  1NJ6 A;  2Q7G A;  2ALY A;  3A31 A;  3P8V A;  4RDX A;  2CIM A;  2DDZ A;  3HXZ A;  2EWN A;  4CH4 A;  3E9I A;  3V7S A;  4P74 A;  3NEM A;  3L4G B;  1NYQ A;  4ZTU B;  4XTW A;  2DU5 A;  3MF1 A;  2ZT6 A;  4TVW A;  2DTI A;  3M4P A;  4AH6 A;  5C52 B;  1YFS A;  3RGL A;  4H2X B;  2ZT8 A;  2DU7 A;  4DPG A;  2ZZE A;  5F5W A;  2E5A A; 
#chains in the Genus database with same CATH topology
 3UH0 A;  3QNE A;  11AS A;  4H2W A;  1WLE A;  3HY0 A;  3RIR A;  4UP7 A;  1W66 A;  4HWP A;  1USY A;  3LSQ A;  1ADY A;  1NJ2 A;  3RKY A;  3MF2 A;  4KR3 A;  2ZGW A;  3QO5 A;  4YRM A;  1H4V B;  1PYS B;  1E22 A;  5K1X A;  1SRY A;  4P3P A;  4LVM A;  2Q7E A;  2RHQ B;  2PME A;  3QO8 A;  4K87 A;  1B70 A;  4CH5 A;  4J15 A;  1WNL A;  3A32 A;  1FYF A;  5C53 B;  4K88 A;  3FJP A;  4WJ4 A;  3MQZ A;  3VQV A;  1NYR A;  3HRI A;  1KMM A;  2ART A;  4Q6G A;  4RMF A;  4G84 A;  2E1H A;  4ZTZ B;  4YDQ A;  2ZZF A;  2J3M A;  3QTC A;  3HRK A;  4CS2 A;  1ADJ A;  1GGM A;  3RF1 A;  4DQ2 A;  4YCW A;  1E1O A;  4LVJ A;  2ZIO A;  1X2G A;  3ERR A;  1HXD A;  4P72 C;  4O2D A;  2NS6 A;  4XEM A;  1LYL A;  2DQ0 A;  1E1T A;  4EX5 A;  1WYD A;  3A7A A;  2AKW A;  4YRK A;  4HA8 A;  2Q7H A;  4YRE A;  4H2T A;  4UP9 A;  1J5W A;  3PZC A;  1H4Q A;  1B76 A;  1G51 A;  1Z7N A;  5ELN A;  4XTV A;  1BIA A;  3DSQ A;  1EIY B;  4YRL A;  2J3L A;  3LC0 A;  3TUP A;  2DEQ A;  2ZR3 A;  1HC7 A;  4BW9 A;  2E41 A;  3A74 A;  4H02 A;  5C51 B;  3HXY A;  1WU7 A;  3UFG A;  1EOV A;  4YRJ A;  4YPF A;  4L87 A;  3VQY A;  4YCV A;  1Z7M A;  2E64 A;  1C0A A;  3HTZ A;  2DXT A;  3IG2 A;  3L4G A;  3W3S A;  3M4Q A;  3V8K A;  4RQF A;  1E24 A;  4YRC A;  1KOG A;  1N9W A;  2DTH A;  3BFM A;  4P71 C;  1NNH A;  2A8E A;  2FYK A;  4KQE A;  3VBB A;  1G5H A;  3NET A;  2CJB A;  1HTT A;  2CJ9 A;  4YRR A;  1B8A A;  4H2X A;  2ZT7 A;  4P3O A;  2I4N A;  1BBU A;  4H2Y A;  2XGT A;  3V8J A;  4XTZ A;  1YGB A;  4H2V A;  2E10 A;  5ELO A;  4YRS A;  2IY5 B;  4UP8 A;  4P72 A;  3E9H A;  2G4C A;  4YRQ A;  1KMN A;  3P8T A;  4K86 A;  3IKM B;  4KR2 A;  1EVK A;  1PYS A;  4P73 C;  4YRG A;  2ZNJ A;  4XU2 A;  2RHQ A;  3A7R A;  3HY1 A;  2DQ3 A;  4NCX A;  1ASZ A;  3L1A A;  4XU3 A;  4YRF A;  2AMC B;  1ATI A;  1WQ7 A;  1VQZ A;  1BBW A;  1BIB A;  2QHU A;  2ARS A;  5E3I A;  3WQZ A;  3BJU A;  1B7Y B;  2E65 A;  1EVL A;  4Q15 A;  3L2Z A;  3HXV A;  1JJC B;  3REX A;  4BWA A;  4WJ3 M;  2CGH A;  4YYE A;  4YRP A;  4HVC A;  4ZIB A;  1USY C;  4TVY A;  3HFZ B;  4G85 A;  1JJC A;  4YRT A;  2DJZ A;  1L0W A;  3LSS A;  4HWT A;  4OP0 A;  2EJ9 A;  4H2U A;  5K1P A;  4XU1 A;  3RL6 A;  2DXU A;  2DZ9 A;  12AS A;  2E3C A;  2I4M A;  4P71 A;  1ASY A;  3V8L A;  2ZIM A;  4X5O A;  2ODR D;  2ZT5 A;  4TVA B;  4LVI A;  2HNI A;  4HWO A;  1EIY A;  2DTO A;  1WPY A;  3UGQ A;  3HXW A;  5KNN A;  2ALY B;  2ZCE A;  2QHT A;  4WI1 A;  3HXX A;  3R07 A;  3PCO B;  2ARU A;  4TQF A;  3REU A;  1EFW A;  4CS4 A;  1G5I A;  2I4O A;  4LNS A;  4P3N A;  2ODR C;  4CH6 A;  3HXU A;  2ZZG A;  4P73 A;  4YRO A;  3A7U A;  3PCO A;  3VQX A;  1X55 A;  2ZIN A;  3RKW A;  2ZXF A;  1EQR A;  4YCU A;  4YRN A;  1H4T A;  4PHC A;  1YFR A;  4XU0 A;  4P75 C;  3HFV A;  4HWS A;  3CMQ A;  2XTI A;  4H2S A;  1WQW A;  2DVE A;  4CS3 A;  3NEL A;  4XTX A;  3IKL A;  2EL9 A;  2ZR2 A;  3NEN A;  2IY5 A;  2ZTG A;  4HWR A;  4XTU A;  2Q5H A;  3P8Y A;  4P74 C;  4LVL A;  2EJF A;  1B70 B;  1SER A;  1RIQ A;  3KFU A;  4XEO A;  4XTY A;  1H4S A;  3RUX A;  2EJG A;  3UGT A;  4E51 A;  2DKG A;  1X56 A;  3VQW A;  4CH3 A;  3EFR A;  4TTV A;  2QHV A;  3QO7 A;  2EAY A;  2C8M A;  4PG3 A;  2PMF A;  4YP0 A;  1YFT A;  2AMC A;  3OD1 A;  4TWA A;  2P5I A;  1QE0 A;  4RQE A;  1X01 A;  2I4L A;  3A5Y A;  3MEY A;  4EO4 A;  2ZNI A;  1B7Y A;  1IL2 A;  3V7R A;  2CJA A;  3TEH B;  4WF2 A;  2AKW B;  3I7F A;  2QHS A;  1X2H A;  1QF6 A;  2Q5I A;  1SES A;  4UPA A;  3TEH A;  3HFZ A;  3IAL A;  3RAC A;  1NJ1 A;  1SET A;  3V7C A;  4YRI A;  3EFS A;  3G1Z A;  1X54 A;  2P0L A;  2RHS B;  2C7I A;  3ICA A;  4TQD A;  4OLF A;  1YB3 A;  1NJ5 A;  3TEG A;  4P75 A;  3RKX A;  3A5Z A;  2RHS A;  4TVA A;  5HGQ A;  1NJ8 A;  2DZC A;  1NJ6 A;  2Q7G A;  2ALY A;  3A31 A;  3P8V A;  4RDX A;  2CIM A;  2DDZ A;  3HXZ A;  2EWN A;  4CH4 A;  4LVK A;  3E9I A;  3V7S A;  4HT4 A;  4P74 A;  3NEM A;  3L4G B;  1NYQ A;  4ZTU B;  4XTW A;  2DU5 A;  3MF1 A;  2ZT6 A;  4TVW A;  2DTI A;  3M4P A;  4AH6 A;  5C52 B;  1YFS A;  3RGL A;  4H2X B;  2ZT8 A;  2DU7 A;  4DPG A;  2ZZE A;  5F5W A;  2E5A A; 
#chains in the Genus database with same CATH homology
 3UH0 A;  3QNE A;  11AS A;  4H2W A;  1WLE A;  3HY0 A;  3RIR A;  4UP7 A;  1W66 A;  4HWP A;  1USY A;  3LSQ A;  1ADY A;  1NJ2 A;  3RKY A;  3MF2 A;  4KR3 A;  2ZGW A;  3QO5 A;  4YRM A;  1H4V B;  1PYS B;  1E22 A;  5K1X A;  1SRY A;  4P3P A;  4LVM A;  2Q7E A;  2RHQ B;  2PME A;  3QO8 A;  4K87 A;  1B70 A;  4CH5 A;  4J15 A;  1WNL A;  3A32 A;  1FYF A;  5C53 B;  4K88 A;  3FJP A;  4WJ4 A;  3MQZ A;  3VQV A;  1NYR A;  3HRI A;  1KMM A;  2ART A;  4Q6G A;  4RMF A;  4G84 A;  2E1H A;  4ZTZ B;  4YDQ A;  2ZZF A;  2J3M A;  3QTC A;  3HRK A;  4CS2 A;  1ADJ A;  1GGM A;  3RF1 A;  4DQ2 A;  4YCW A;  1E1O A;  4LVJ A;  2ZIO A;  1X2G A;  3ERR A;  1HXD A;  4P72 C;  4O2D A;  2NS6 A;  4XEM A;  1LYL A;  2DQ0 A;  1E1T A;  4EX5 A;  1WYD A;  3A7A A;  2AKW A;  4YRK A;  4HA8 A;  2Q7H A;  4YRE A;  4H2T A;  4UP9 A;  1J5W A;  3PZC A;  1H4Q A;  1B76 A;  1G51 A;  1Z7N A;  5ELN A;  4XTV A;  1BIA A;  3DSQ A;  1EIY B;  4YRL A;  2J3L A;  3LC0 A;  3TUP A;  2DEQ A;  2ZR3 A;  1HC7 A;  4BW9 A;  2E41 A;  3A74 A;  4H02 A;  5C51 B;  3HXY A;  1WU7 A;  3UFG A;  1EOV A;  4YRJ A;  4YPF A;  4L87 A;  3VQY A;  4YCV A;  1Z7M A;  2E64 A;  1C0A A;  3HTZ A;  2DXT A;  3IG2 A;  3L4G A;  3W3S A;  3M4Q A;  3V8K A;  4RQF A;  1E24 A;  4YRC A;  1KOG A;  1N9W A;  2DTH A;  3BFM A;  4P71 C;  1NNH A;  2A8E A;  2FYK A;  4KQE A;  3VBB A;  1G5H A;  3NET A;  2CJB A;  1HTT A;  2CJ9 A;  4YRR A;  1B8A A;  4H2X A;  2ZT7 A;  4P3O A;  2I4N A;  1BBU A;  4H2Y A;  2XGT A;  3V8J A;  4XTZ A;  1YGB A;  4H2V A;  2E10 A;  5ELO A;  4YRS A;  2IY5 B;  4UP8 A;  4P72 A;  3E9H A;  2G4C A;  4YRQ A;  1KMN A;  3P8T A;  4K86 A;  3IKM B;  4KR2 A;  1EVK A;  1PYS A;  4P73 C;  4YRG A;  2ZNJ A;  4XU2 A;  2RHQ A;  3A7R A;  3HY1 A;  2DQ3 A;  4NCX A;  1ASZ A;  3L1A A;  4XU3 A;  4YRF A;  2AMC B;  1ATI A;  1WQ7 A;  1VQZ A;  1BBW A;  1BIB A;  2QHU A;  2ARS A;  5E3I A;  3WQZ A;  3BJU A;  1B7Y B;  2E65 A;  1EVL A;  4Q15 A;  3L2Z A;  3HXV A;  1JJC B;  3REX A;  4BWA A;  4WJ3 M;  2CGH A;  4YYE A;  4YRP A;  4HVC A;  4ZIB A;  1USY C;  4TVY A;  3HFZ B;  4G85 A;  1JJC A;  4YRT A;  2DJZ A;  1L0W A;  3LSS A;  4HWT A;  4OP0 A;  2EJ9 A;  4H2U A;  5K1P A;  4XU1 A;  3RL6 A;  2DXU A;  2DZ9 A;  12AS A;  2E3C A;  2I4M A;  4P71 A;  1ASY A;  3V8L A;  2ZIM A;  4X5O A;  2ODR D;  2ZT5 A;  4TVA B;  4LVI A;  2HNI A;  4HWO A;  1EIY A;  2DTO A;  1WPY A;  3UGQ A;  3HXW A;  5KNN A;  2ALY B;  2ZCE A;  2QHT A;  4WI1 A;  3HXX A;  3R07 A;  3PCO B;  2ARU A;  4TQF A;  3REU A;  1EFW A;  4CS4 A;  1G5I A;  2I4O A;  4LNS A;  4P3N A;  2ODR C;  4CH6 A;  3HXU A;  2ZZG A;  4P73 A;  4YRO A;  3A7U A;  3PCO A;  3VQX A;  1X55 A;  2ZIN A;  3RKW A;  2ZXF A;  1EQR A;  4YCU A;  4YRN A;  1H4T A;  4PHC A;  1YFR A;  4XU0 A;  4P75 C;  3HFV A;  4HWS A;  3CMQ A;  2XTI A;  4H2S A;  1WQW A;  2DVE A;  4CS3 A;  3NEL A;  4XTX A;  3IKL A;  2EL9 A;  2ZR2 A;  3NEN A;  2IY5 A;  2ZTG A;  4HWR A;  4XTU A;  2Q5H A;  3P8Y A;  4P74 C;  4LVL A;  2EJF A;  1B70 B;  1SER A;  1RIQ A;  3KFU A;  4XEO A;  4XTY A;  1H4S A;  3RUX A;  2EJG A;  3UGT A;  4E51 A;  2DKG A;  1X56 A;  3VQW A;  4CH3 A;  3EFR A;  4TTV A;  2QHV A;  3QO7 A;  2EAY A;  2C8M A;  4PG3 A;  2PMF A;  4YP0 A;  1YFT A;  2AMC A;  3OD1 A;  4TWA A;  2P5I A;  1QE0 A;  4RQE A;  1X01 A;  2I4L A;  3A5Y A;  3MEY A;  4EO4 A;  2ZNI A;  1B7Y A;  1IL2 A;  3V7R A;  2CJA A;  3TEH B;  4WF2 A;  2AKW B;  3I7F A;  2QHS A;  1X2H A;  1QF6 A;  2Q5I A;  1SES A;  4UPA A;  3TEH A;  3HFZ A;  3IAL A;  3RAC A;  1NJ1 A;  1SET A;  3V7C A;  4YRI A;  3EFS A;  3G1Z A;  1X54 A;  2P0L A;  2RHS B;  2C7I A;  3ICA A;  4TQD A;  4OLF A;  1YB3 A;  1NJ5 A;  3TEG A;  4P75 A;  3RKX A;  3A5Z A;  2RHS A;  4TVA A;  5HGQ A;  1NJ8 A;  2DZC A;  1NJ6 A;  2Q7G A;  2ALY A;  3A31 A;  3P8V A;  4RDX A;  2CIM A;  2DDZ A;  3HXZ A;  2EWN A;  4CH4 A;  4LVK A;  3E9I A;  3V7S A;  4HT4 A;  4P74 A;  3NEM A;  3L4G B;  1NYQ A;  4ZTU B;  4XTW A;  2DU5 A;  3MF1 A;  2ZT6 A;  4TVW A;  2DTI A;  3M4P A;  4AH6 A;  5C52 B;  1YFS A;  3RGL A;  4H2X B;  2ZT8 A;  2DU7 A;  4DPG A;  2ZZE A;  5F5W A;  2E5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...