3PCOA

Crystal structure of e. coli phenylalanine-trna synthetase complexed with phenylalanine and amp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
242
structure length
242
Chain Sequence
RLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNVLRNVGIDPEVYSGFAFGMGMERLTMLRYGVTDLRSFFENDLRFLKQFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Phenylalanyl-tRNA synthetase, alpha subunit
total genus 62
structure length 242
sequence length 242
chains with identical sequence C
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
A PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3pcoA01
4RQEA 4BWAA 4XU3A 1EIYA 2C8MA 3UGQA 3RKWA 3TEHB 1NYQA 4HWOA 3NENA 5E3IA 3REUA 3QTCA 5ELOA 4P73C 2EAYA 2QHVA 4OP0A 3L4GA 1ASZA 4CS2A 4X5OA 4YRRA 3V7RA 1LYLA 4K87A 1SETA 2ARUA 4CH3A 3W3SA 2ZGWA 1HTTA 3V7SA 1KMNA 3UGTA 2PMEA 3HXYA 4YRKA 1L0WA 1USYA 2ZT7A 1BBWA 4YDQA 3PCOA 3VQWA 2DTOA 1B8AA 3IALA 2J3MA 4HWTA 3RL6A 3BJUA 3RUXA 1C0AA 1RIQA 1EOVA 2ZR3A 4TWAA 2ZR2A 4P75A 2E41A 3HRIA 1FYFA 4AH6A 5ELNA 4CH5A 1H4TA 2DXUA 3QO7A 4UPAA 4H2UA 3VBBA 1GGMA 4XU2A 4EX5A 4H2SA 1NJ1A 4LNSA 2ARTA 3RACA 5C51B 4XTUA 2QHSA 2E10A 4TVAB 3V8JA 3RKXA 4CS3A 4UP9A 2AKWB 3FJPA 4YRLA 3HRKA 1QF6A 2C7IA 3P8TA 3PCOB 1NYRA 2RHSA 4PG3A 3E9IA 2ZNIA 4DQ2A 3L1AA 4OLFA 2RHSB 2E65A 4NCXA 1B70A 1E22A 4YROA 3L4GB 4P72C 2CGHA 2DKGA 4BW9A 4O2DA 2E3CA 4YRGA 2RHQA 3HXXA 2FYKA 2I4LA 2AKWA 1EIYB 4P74A 1QE0A 4Q6GA 4CS4A 3QO5A 1NJ2A 3LSQA 1X56A 2DTHA 2EJGA 2ZT5A 2EJ9A 2DQ0A 2PMFA 1YFTA 4HWPA 4YRQA 1EVKA 4P3PA 1BIBA 2IY5A 4YREA 1PYSA 4TTVA 4XTVA 2CJAA 3P8VA 1NNHA 2DTIA 3HFVA 3NETA 1E24A 4ZIBA 1X55A 2Q5HA 3V8LA 3RGLA 4HVCA 2QHUA 4P73A 1Z7MA 2ZZFA 2ARSA 2QHTA 3UH0A 4XTZA 3REXA 4YPFA 3M4QA 2DVEA 3A7UA 1G51A 4H2TA 1WNLA 4TVWA 3QO8A 4YRMA 1ADJA 2EWNA 2ODRC 4TQDA 4YCVA 2ZZEA 3A32A 3HXZA 1WLEA 2DJZA 3QNEA 1EQRA 5K1XA 1W66A 3VQXA 2EJFA 1H4SA 3R07A 4XTWA 1B76A 3HXWA 4J15A 1H4QA 1SESA 1WQ7A 4H2XA 3M4PA 2CJBA 3TEGA 2DEQA 4RMFA 2DZ9A 1BBUA 4TVYA 1X2GA 2J3LA 4P3OA 2ZTGA 3G1ZA 2I4OA 2DZCA 3P8YA 3TEHA 4H2XB 4TQFA 3VQVA 3MF1A 4H2YA 4ZTUB 3HXUA 1B7YA 2Q7EA 3RIRA 2ZIMA 1SRYA 4WJ4A 2DXTA 2ZXFA 1WYDA 4P71A 3HTZA 3HXVA 3WQZA 4HA8A 2Q5IA 3OD1A 4WJ3M 1NJ5A 12ASA 2CJ9A 3LSSA 4KQEA 1WU7A 4YRJA 4K88A 1X2HA 3IG2A 4L87A 4G84A 3HY0A 3A7AA 4XU0A 3A74A 1B7YB 3TUPA 1NJ8A 2CIMA 1KMMA 4P74C 4P3NA 2DU5A 2AMCA 4WF2A 3L2ZA 5HGQA 2ZIOA 4H02A 2ZT8A 1EVLA 2IY5B 4RQFA 2AMCB 4H2WA 4HWSA 4KR2A 4XEOA 1PYSB 5C52B 3UFGA 3IKMB 1KOGA 2EL9A 2XTIA 1G5IA 1WQWA 4CH4A 1J5WA 3IKLA 1N9WA 4HWRA 2ODRD 4YRPA 1HXDA 3E9HA 3EFSA 3NELA 1YFSA 3A5YA 1YB3A 4XTXA 4YRCA 3V7CA 1USYC 1JJCB 4RDXA 4XEMA 4H2VA 4YCWA 1BIAA 2ZCEA 1ADYA 3EFRA 3LC0A 1VQZA 3NEMA 11ASA 2ZZGA 2ALYA 4P75C 3A7RA 4YRNA 3KFUA 3I7FA 3HY1A 4DPGA 1Z7NA 4YRTA 2I4MA 2DDZA 2XGTA 4TVAA 3BFMA 2E1HA 4YRSA 5K1PA 2I4NA 5KNNA 4CH6A 1IL2A 1YFRA 4YP0A 1E1OA 2P0LA 1ASYA 2HNIA 4PHCA 3DSQA 1YGBA 1X01A 4UP7A 3ERRA 3MF2A 3MEYA 5F5WA 3RF1A 4EO4A 2G4CA 2ZNJA 4WI1A 1E1TA 2E5AA 3RKYA 2RHQB 2DQ3A 1NJ6A 1B70B 3ICAA 1EFWA 1G5HA 3V8KA 2ZINA 4P72A 3A31A 4YRIA 4KR3A 4P71C 3A5ZA 4G85A 2DU7A 5C53B 4UP8A 4XU1A 4ZTZB 4YCUA 2ZT6A 1ATIA 2P5IA 1X54A 2Q7HA 1JJCA 3HFZA 1WPYA 4XTYA 1HC7A 3PZCA 4YYEA 4Q15A 3HFZB 2E64A 4K86A 4YRFA 4E51A 2Q7GA 1H4VB 1SERA 3VQYA 2ALYB 3CMQA
chains in the Genus database with same CATH superfamily
4RQEA 4BWAA 4XU3A 1EIYA 2C8MA 3UGQA 3RKWA 3TEHB 1NYQA 4HWOA 3NENA 5E3IA 3REUA 3QTCA 5ELOA 4P73C 2EAYA 2QHVA 4OP0A 3L4GA 1ASZA 4CS2A 4X5OA 4YRRA 3V7RA 1LYLA 4K87A 1SETA 2ARUA 4CH3A 3W3SA 2ZGWA 1HTTA 3V7SA 1KMNA 3UGTA 2PMEA 3HXYA 4YRKA 1L0WA 1USYA 2ZT7A 1BBWA 4YDQA 3PCOA 3VQWA 2DTOA 1B8AA 3IALA 2J3MA 4HWTA 3RL6A 3BJUA 3RUXA 1C0AA 1RIQA 1EOVA 2ZR3A 4TWAA 2ZR2A 4P75A 2E41A 3HRIA 1FYFA 4AH6A 5ELNA 4CH5A 1H4TA 2DXUA 3QO7A 4UPAA 4H2UA 3VBBA 1GGMA 4XU2A 4EX5A 4H2SA 1NJ1A 4LNSA 2ARTA 3RACA 5C51B 4XTUA 4HT4A 2QHSA 2E10A 4TVAB 3V8JA 3RKXA 4CS3A 4UP9A 2AKWB 3FJPA 4YRLA 3HRKA 1QF6A 3MQZA 2C7IA 3P8TA 3PCOB 1NYRA 2RHSA 4PG3A 3E9IA 2ZNIA 4DQ2A 3L1AA 4OLFA 2RHSB 2E65A 4NCXA 1B70A 1E22A 4YROA 3L4GB 4P72C 2CGHA 2DKGA 4BW9A 4O2DA 2E3CA 4YRGA 2RHQA 3HXXA 2FYKA 2I4LA 2AKWA 1EIYB 4P74A 1QE0A 4Q6GA 4CS4A 3QO5A 1NJ2A 3LSQA 1X56A 2DTHA 2EJGA 2ZT5A 2EJ9A 2DQ0A 2PMFA 1YFTA 4HWPA 4YRQA 1EVKA 4P3PA 1BIBA 2IY5A 4YREA 1PYSA 4TTVA 4XTVA 2CJAA 3P8VA 1NNHA 4LVJA 2DTIA 3HFVA 3NETA 1E24A 4ZIBA 1X55A 4LVIA 2Q5HA 3V8LA 3RGLA 4HVCA 2QHUA 4P73A 1Z7MA 2ZZFA 2ARSA 2QHTA 3UH0A 4XTZA 3REXA 4LVMA 4YPFA 3M4QA 2DVEA 3A7UA 1G51A 4H2TA 1WNLA 4TVWA 3QO8A 4YRMA 1ADJA 2EWNA 2ODRC 4TQDA 4YCVA 2ZZEA 3A32A 3HXZA 1WLEA 2DJZA 3QNEA 1EQRA 5K1XA 1W66A 3VQXA 2EJFA 1H4SA 3R07A 4XTWA 1B76A 3HXWA 4J15A 1H4QA 1SESA 1WQ7A 4H2XA 3M4PA 2CJBA 3TEGA 2DEQA 4RMFA 2DZ9A 1BBUA 4TVYA 4LVLA 1X2GA 2J3LA 4P3OA 2ZTGA 3G1ZA 2I4OA 2DZCA 3P8YA 3TEHA 2NS6A 4H2XB 4TQFA 3VQVA 3MF1A 4H2YA 4LVKA 4ZTUB 3HXUA 1B7YA 2Q7EA 3RIRA 2ZIMA 1SRYA 4WJ4A 2DXTA 2ZXFA 1WYDA 4P71A 3HTZA 3HXVA 3WQZA 4HA8A 2Q5IA 3OD1A 4WJ3M 1NJ5A 12ASA 2CJ9A 3LSSA 4KQEA 1WU7A 4YRJA 4K88A 1X2HA 3IG2A 4L87A 4G84A 3HY0A 3A7AA 4XU0A 3A74A 1B7YB 3TUPA 1NJ8A 2CIMA 1KMMA 4P74C 4P3NA 2DU5A 2AMCA 4WF2A 3L2ZA 5HGQA 2ZIOA 4H02A 2ZT8A 1EVLA 2IY5B 4RQFA 2AMCB 4H2WA 4HWSA 4KR2A 4XEOA 1PYSB 5C52B 3UFGA 3IKMB 1KOGA 2EL9A 2XTIA 1G5IA 1WQWA 4CH4A 1J5WA 3IKLA 1N9WA 4HWRA 2ODRD 4YRPA 1HXDA 3E9HA 3EFSA 3NELA 1YFSA 3A5YA 1YB3A 4XTXA 4YRCA 3V7CA 1USYC 1JJCB 4RDXA 4XEMA 4H2VA 4YCWA 1BIAA 2ZCEA 1ADYA 3EFRA 3LC0A 1VQZA 3NEMA 11ASA 2ZZGA 2ALYA 4P75C 3A7RA 4YRNA 3KFUA 3I7FA 3HY1A 4DPGA 1Z7NA 4YRTA 2I4MA 2DDZA 2XGTA 4TVAA 3BFMA 2E1HA 4YRSA 5K1PA 2I4NA 5KNNA 4CH6A 1IL2A 1YFRA 4YP0A 1E1OA 2P0LA 1ASYA 2HNIA 4PHCA 3DSQA 1YGBA 1X01A 4UP7A 3ERRA 3MF2A 3MEYA 5F5WA 3RF1A 4EO4A 2G4CA 2ZNJA 4WI1A 1E1TA 2E5AA 3RKYA 2RHQB 2DQ3A 1NJ6A 1B70B 3ICAA 1EFWA 1G5HA 3V8KA 2ZINA 4P72A 3A31A 4YRIA 4KR3A 4P71C 3A5ZA 4G85A 2DU7A 5C53B 4UP8A 4XU1A 4ZTZB 4YCUA 2ZT6A 1ATIA 2P5IA 1X54A 2Q7HA 1JJCA 3HFZA 1WPYA 4XTYA 1HC7A 3PZCA 4YYEA 4Q15A 2A8EA 3HFZB 2E64A 4K86A 4YRFA 4E51A 2Q7GA 1H4VB 1SERA 3VQYA 2ALYB 3CMQA
chains in the Genus database with same CATH topology
4RQEA 4BWAA 4XU3A 1EIYA 2C8MA 3UGQA 3RKWA 3TEHB 1NYQA 4HWOA 3NENA 5E3IA 3REUA 3QTCA 5ELOA 4P73C 2EAYA 2QHVA 4OP0A 3L4GA 1ASZA 4CS2A 4X5OA 4YRRA 3V7RA 1LYLA 4K87A 1SETA 2ARUA 4CH3A 3W3SA 2ZGWA 1HTTA 3V7SA 1KMNA 3UGTA 2PMEA 3HXYA 4YRKA 1L0WA 1USYA 2ZT7A 1BBWA 4YDQA 3PCOA 3VQWA 2DTOA 1B8AA 3IALA 2J3MA 4HWTA 3RL6A 3BJUA 3RUXA 1C0AA 1RIQA 1EOVA 2ZR3A 4TWAA 2ZR2A 4P75A 2E41A 3HRIA 1FYFA 4AH6A 5ELNA 4CH5A 1H4TA 2DXUA 3QO7A 4UPAA 4H2UA 3VBBA 1GGMA 4XU2A 4EX5A 4H2SA 1NJ1A 4LNSA 2ARTA 3RACA 5C51B 4XTUA 4HT4A 2QHSA 2E10A 4TVAB 3V8JA 3RKXA 4CS3A 4UP9A 2AKWB 3FJPA 4YRLA 3HRKA 1QF6A 3MQZA 2C7IA 3P8TA 3PCOB 1NYRA 2RHSA 4PG3A 3E9IA 2ZNIA 4DQ2A 3L1AA 4OLFA 2RHSB 2E65A 4NCXA 1B70A 1E22A 4YROA 3L4GB 4P72C 2CGHA 2DKGA 4BW9A 4O2DA 2E3CA 4YRGA 2RHQA 3HXXA 2FYKA 2I4LA 2AKWA 1EIYB 4P74A 1QE0A 4Q6GA 4CS4A 3QO5A 1NJ2A 3LSQA 1X56A 2DTHA 2EJGA 2ZT5A 2EJ9A 2DQ0A 2PMFA 1YFTA 4HWPA 4YRQA 1EVKA 4P3PA 1BIBA 2IY5A 4YREA 1PYSA 4TTVA 4XTVA 2CJAA 3P8VA 1NNHA 4LVJA 2DTIA 3HFVA 3NETA 1E24A 4ZIBA 1X55A 4LVIA 2Q5HA 3V8LA 3RGLA 4HVCA 2QHUA 4P73A 1Z7MA 2ZZFA 2ARSA 2QHTA 3UH0A 4XTZA 3REXA 4LVMA 4YPFA 3M4QA 2DVEA 3A7UA 1G51A 4H2TA 1WNLA 4TVWA 3QO8A 4YRMA 1ADJA 2EWNA 2ODRC 4TQDA 4YCVA 2ZZEA 3A32A 3HXZA 1WLEA 2DJZA 3QNEA 1EQRA 5K1XA 1W66A 3VQXA 2EJFA 1H4SA 3R07A 4XTWA 1B76A 3HXWA 4J15A 1H4QA 1SESA 1WQ7A 4H2XA 3M4PA 2CJBA 3TEGA 2DEQA 4RMFA 2DZ9A 1BBUA 4TVYA 4LVLA 1X2GA 2J3LA 4P3OA 2ZTGA 3G1ZA 2I4OA 2DZCA 3P8YA 3TEHA 2NS6A 4H2XB 4TQFA 3VQVA 3MF1A 4H2YA 4LVKA 4ZTUB 3HXUA 1B7YA 2Q7EA 3RIRA 2ZIMA 1SRYA 4WJ4A 2DXTA 2ZXFA 1WYDA 4P71A 3HTZA 3HXVA 3WQZA 4HA8A 2Q5IA 3OD1A 4WJ3M 1NJ5A 12ASA 2CJ9A 3LSSA 4KQEA 1WU7A 4YRJA 4K88A 1X2HA 3IG2A 4L87A 4G84A 3HY0A 3A7AA 4XU0A 3A74A 1B7YB 3TUPA 1NJ8A 2CIMA 1KMMA 4P74C 4P3NA 2DU5A 2AMCA 4WF2A 3L2ZA 5HGQA 2ZIOA 4H02A 2ZT8A 1EVLA 2IY5B 4RQFA 2AMCB 4H2WA 4HWSA 4KR2A 4XEOA 1PYSB 5C52B 3UFGA 3IKMB 1KOGA 2EL9A 2XTIA 1G5IA 1WQWA 4CH4A 1J5WA 3IKLA 1N9WA 4HWRA 2ODRD 4YRPA 1HXDA 3E9HA 3EFSA 3NELA 1YFSA 3A5YA 1YB3A 4XTXA 4YRCA 3V7CA 1USYC 1JJCB 4RDXA 4XEMA 4H2VA 4YCWA 1BIAA 2ZCEA 1ADYA 3EFRA 3LC0A 1VQZA 3NEMA 11ASA 2ZZGA 2ALYA 4P75C 3A7RA 4YRNA 3KFUA 3I7FA 3HY1A 4DPGA 1Z7NA 4YRTA 2I4MA 2DDZA 2XGTA 4TVAA 3BFMA 2E1HA 4YRSA 5K1PA 2I4NA 5KNNA 4CH6A 1IL2A 1YFRA 4YP0A 1E1OA 2P0LA 1ASYA 2HNIA 4PHCA 3DSQA 1YGBA 1X01A 4UP7A 3ERRA 3MF2A 3MEYA 5F5WA 3RF1A 4EO4A 2G4CA 2ZNJA 4WI1A 1E1TA 2E5AA 3RKYA 2RHQB 2DQ3A 1NJ6A 1B70B 3ICAA 1EFWA 1G5HA 3V8KA 2ZINA 4P72A 3A31A 4YRIA 4KR3A 4P71C 3A5ZA 4G85A 2DU7A 5C53B 4UP8A 4XU1A 4ZTZB 4YCUA 2ZT6A 1ATIA 2P5IA 1X54A 2Q7HA 1JJCA 3HFZA 1WPYA 4XTYA 1HC7A 3PZCA 4YYEA 4Q15A 2A8EA 3HFZB 2E64A 4K86A 4YRFA 4E51A 2Q7GA 1H4VB 1SERA 3VQYA 2ALYB 3CMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQE A;  4BWA A;  4XU3 A;  1EIY A;  2C8M A;  3UGQ A;  3RKW A;  3TEH B;  1NYQ A;  4HWO A;  3NEN A;  5E3I A;  3REU A;  3QTC A;  5ELO A;  4P73 C;  2EAY A;  2QHV A;  4OP0 A;  3L4G A;  1ASZ A;  4CS2 A;  4X5O A;  4YRR A;  3V7R A;  1LYL A;  4K87 A;  1SET A;  2ARU A;  4CH3 A;  3W3S A;  2ZGW A;  1HTT A;  3V7S A;  1KMN A;  3UGT A;  2PME A;  3HXY A;  4YRK A;  1L0W A;  1USY A;  2ZT7 A;  1BBW A;  4YDQ A;  3PCO A;  3VQW A;  2DTO A;  1B8A A;  3IAL A;  2J3M A;  4HWT A;  3RL6 A;  3BJU A;  3RUX A;  1C0A A;  1RIQ A;  1EOV A;  2ZR3 A;  4TWA A;  2ZR2 A;  4P75 A;  2E41 A;  3HRI A;  1FYF A;  4AH6 A;  5ELN A;  4CH5 A;  1H4T A;  2DXU A;  3QO7 A;  4UPA A;  4H2U A;  3VBB A;  1GGM A;  4XU2 A;  4EX5 A;  4H2S A;  1NJ1 A;  4LNS A;  2ART A;  3RAC A;  5C51 B;  4XTU A;  2QHS A;  2E10 A;  4TVA B;  3V8J A;  3RKX A;  4CS3 A;  4UP9 A;  2AKW B;  3FJP A;  4YRL A;  3HRK A;  1QF6 A;  2C7I A;  3P8T A;  3PCO B;  1NYR A;  2RHS A;  4PG3 A;  3E9I A;  2ZNI A;  4DQ2 A;  3L1A A;  4OLF A;  2RHS B;  2E65 A;  4NCX A;  1B70 A;  1E22 A;  4YRO A;  3L4G B;  4P72 C;  2CGH A;  2DKG A;  4BW9 A;  4O2D A;  2E3C A;  4YRG A;  2RHQ A;  3HXX A;  2FYK A;  2I4L A;  2AKW A;  1EIY B;  4P74 A;  1QE0 A;  4Q6G A;  4CS4 A;  3QO5 A;  1NJ2 A;  3LSQ A;  1X56 A;  2DTH A;  2EJG A;  2ZT5 A;  2EJ9 A;  2DQ0 A;  2PMF A;  1YFT A;  4HWP A;  4YRQ A;  1EVK A;  4P3P A;  1BIB A;  2IY5 A;  4YRE A;  1PYS A;  4TTV A;  4XTV A;  2CJA A;  3P8V A;  1NNH A;  2DTI A;  3HFV A;  3NET A;  1E24 A;  4ZIB A;  1X55 A;  2Q5H A;  3V8L A;  3RGL A;  4HVC A;  2QHU A;  4P73 A;  1Z7M A;  2ZZF A;  2ARS A;  2QHT A;  3UH0 A;  4XTZ A;  3REX A;  4YPF A;  3M4Q A;  2DVE A;  3A7U A;  1G51 A;  4H2T A;  1WNL A;  4TVW A;  3QO8 A;  4YRM A;  1ADJ A;  2EWN A;  2ODR C;  4TQD A;  4YCV A;  2ZZE A;  3A32 A;  3HXZ A;  1WLE A;  2DJZ A;  3QNE A;  1EQR A;  5K1X A;  1W66 A;  3VQX A;  2EJF A;  1H4S A;  3R07 A;  4XTW A;  1B76 A;  3HXW A;  4J15 A;  1H4Q A;  1SES A;  1WQ7 A;  4H2X A;  3M4P A;  2CJB A;  3TEG A;  2DEQ A;  4RMF A;  2DZ9 A;  1BBU A;  4TVY A;  1X2G A;  2J3L A;  4P3O A;  2ZTG A;  3G1Z A;  2I4O A;  2DZC A;  3P8Y A;  3TEH A;  4H2X B;  4TQF A;  3VQV A;  3MF1 A;  4H2Y A;  4ZTU B;  3HXU A;  1B7Y A;  2Q7E A;  3RIR A;  2ZIM A;  1SRY A;  4WJ4 A;  2DXT A;  2ZXF A;  1WYD A;  4P71 A;  3HTZ A;  3HXV A;  3WQZ A;  4HA8 A;  2Q5I A;  3OD1 A;  4WJ3 M;  1NJ5 A;  12AS A;  2CJ9 A;  3LSS A;  4KQE A;  1WU7 A;  4YRJ A;  4K88 A;  1X2H A;  3IG2 A;  4L87 A;  4G84 A;  3HY0 A;  3A7A A;  4XU0 A;  3A74 A;  1B7Y B;  3TUP A;  1NJ8 A;  2CIM A;  1KMM A;  4P74 C;  4P3N A;  2DU5 A;  2AMC A;  4WF2 A;  3L2Z A;  5HGQ A;  2ZIO A;  4H02 A;  2ZT8 A;  1EVL A;  2IY5 B;  4RQF A;  2AMC B;  4H2W A;  4HWS A;  4KR2 A;  4XEO A;  1PYS B;  5C52 B;  3UFG A;  3IKM B;  1KOG A;  2EL9 A;  2XTI A;  1G5I A;  1WQW A;  4CH4 A;  1J5W A;  3IKL A;  1N9W A;  4HWR A;  2ODR D;  4YRP A;  1HXD A;  3E9H A;  3EFS A;  3NEL A;  1YFS A;  3A5Y A;  1YB3 A;  4XTX A;  4YRC A;  3V7C A;  1USY C;  1JJC B;  4RDX A;  4XEM A;  4H2V A;  4YCW A;  1BIA A;  2ZCE A;  1ADY A;  3EFR A;  3LC0 A;  1VQZ A;  3NEM A;  11AS A;  2ZZG A;  2ALY A;  4P75 C;  3A7R A;  4YRN A;  3KFU A;  3I7F A;  3HY1 A;  4DPG A;  1Z7N A;  4YRT A;  2I4M A;  2DDZ A;  2XGT A;  4TVA A;  3BFM A;  2E1H A;  4YRS A;  5K1P A;  2I4N A;  5KNN A;  4CH6 A;  1IL2 A;  1YFR A;  4YP0 A;  1E1O A;  2P0L A;  1ASY A;  2HNI A;  4PHC A;  3DSQ A;  1YGB A;  1X01 A;  4UP7 A;  3ERR A;  3MF2 A;  3MEY A;  5F5W A;  3RF1 A;  4EO4 A;  2G4C A;  2ZNJ A;  4WI1 A;  1E1T A;  2E5A A;  3RKY A;  2RHQ B;  2DQ3 A;  1NJ6 A;  1B70 B;  3ICA A;  1EFW A;  1G5H A;  3V8K A;  2ZIN A;  4P72 A;  3A31 A;  4YRI A;  4KR3 A;  4P71 C;  3A5Z A;  4G85 A;  2DU7 A;  5C53 B;  4UP8 A;  4XU1 A;  4ZTZ B;  4YCU A;  2ZT6 A;  1ATI A;  2P5I A;  1X54 A;  2Q7H A;  1JJC A;  3HFZ A;  1WPY A;  4XTY A;  1HC7 A;  3PZC A;  4YYE A;  4Q15 A;  3HFZ B;  2E64 A;  4K86 A;  4YRF A;  4E51 A;  2Q7G A;  1H4V B;  1SER A;  3VQY A;  2ALY B;  3CMQ A; 
#chains in the Genus database with same CATH topology
 4RQE A;  4BWA A;  4XU3 A;  1EIY A;  2C8M A;  3UGQ A;  3RKW A;  3TEH B;  1NYQ A;  4HWO A;  3NEN A;  5E3I A;  3REU A;  3QTC A;  5ELO A;  4P73 C;  2EAY A;  2QHV A;  4OP0 A;  3L4G A;  1ASZ A;  4CS2 A;  4X5O A;  4YRR A;  3V7R A;  1LYL A;  4K87 A;  1SET A;  2ARU A;  4CH3 A;  3W3S A;  2ZGW A;  1HTT A;  3V7S A;  1KMN A;  3UGT A;  2PME A;  3HXY A;  4YRK A;  1L0W A;  1USY A;  2ZT7 A;  1BBW A;  4YDQ A;  3PCO A;  3VQW A;  2DTO A;  1B8A A;  3IAL A;  2J3M A;  4HWT A;  3RL6 A;  3BJU A;  3RUX A;  1C0A A;  1RIQ A;  1EOV A;  2ZR3 A;  4TWA A;  2ZR2 A;  4P75 A;  2E41 A;  3HRI A;  1FYF A;  4AH6 A;  5ELN A;  4CH5 A;  1H4T A;  2DXU A;  3QO7 A;  4UPA A;  4H2U A;  3VBB A;  1GGM A;  4XU2 A;  4EX5 A;  4H2S A;  1NJ1 A;  4LNS A;  2ART A;  3RAC A;  5C51 B;  4XTU A;  4HT4 A;  2QHS A;  2E10 A;  4TVA B;  3V8J A;  3RKX A;  4CS3 A;  4UP9 A;  2AKW B;  3FJP A;  4YRL A;  3HRK A;  1QF6 A;  3MQZ A;  2C7I A;  3P8T A;  3PCO B;  1NYR A;  2RHS A;  4PG3 A;  3E9I A;  2ZNI A;  4DQ2 A;  3L1A A;  4OLF A;  2RHS B;  2E65 A;  4NCX A;  1B70 A;  1E22 A;  4YRO A;  3L4G B;  4P72 C;  2CGH A;  2DKG A;  4BW9 A;  4O2D A;  2E3C A;  4YRG A;  2RHQ A;  3HXX A;  2FYK A;  2I4L A;  2AKW A;  1EIY B;  4P74 A;  1QE0 A;  4Q6G A;  4CS4 A;  3QO5 A;  1NJ2 A;  3LSQ A;  1X56 A;  2DTH A;  2EJG A;  2ZT5 A;  2EJ9 A;  2DQ0 A;  2PMF A;  1YFT A;  4HWP A;  4YRQ A;  1EVK A;  4P3P A;  1BIB A;  2IY5 A;  4YRE A;  1PYS A;  4TTV A;  4XTV A;  2CJA A;  3P8V A;  1NNH A;  4LVJ A;  2DTI A;  3HFV A;  3NET A;  1E24 A;  4ZIB A;  1X55 A;  4LVI A;  2Q5H A;  3V8L A;  3RGL A;  4HVC A;  2QHU A;  4P73 A;  1Z7M A;  2ZZF A;  2ARS A;  2QHT A;  3UH0 A;  4XTZ A;  3REX A;  4LVM A;  4YPF A;  3M4Q A;  2DVE A;  3A7U A;  1G51 A;  4H2T A;  1WNL A;  4TVW A;  3QO8 A;  4YRM A;  1ADJ A;  2EWN A;  2ODR C;  4TQD A;  4YCV A;  2ZZE A;  3A32 A;  3HXZ A;  1WLE A;  2DJZ A;  3QNE A;  1EQR A;  5K1X A;  1W66 A;  3VQX A;  2EJF A;  1H4S A;  3R07 A;  4XTW A;  1B76 A;  3HXW A;  4J15 A;  1H4Q A;  1SES A;  1WQ7 A;  4H2X A;  3M4P A;  2CJB A;  3TEG A;  2DEQ A;  4RMF A;  2DZ9 A;  1BBU A;  4TVY A;  4LVL A;  1X2G A;  2J3L A;  4P3O A;  2ZTG A;  3G1Z A;  2I4O A;  2DZC A;  3P8Y A;  3TEH A;  2NS6 A;  4H2X B;  4TQF A;  3VQV A;  3MF1 A;  4H2Y A;  4LVK A;  4ZTU B;  3HXU A;  1B7Y A;  2Q7E A;  3RIR A;  2ZIM A;  1SRY A;  4WJ4 A;  2DXT A;  2ZXF A;  1WYD A;  4P71 A;  3HTZ A;  3HXV A;  3WQZ A;  4HA8 A;  2Q5I A;  3OD1 A;  4WJ3 M;  1NJ5 A;  12AS A;  2CJ9 A;  3LSS A;  4KQE A;  1WU7 A;  4YRJ A;  4K88 A;  1X2H A;  3IG2 A;  4L87 A;  4G84 A;  3HY0 A;  3A7A A;  4XU0 A;  3A74 A;  1B7Y B;  3TUP A;  1NJ8 A;  2CIM A;  1KMM A;  4P74 C;  4P3N A;  2DU5 A;  2AMC A;  4WF2 A;  3L2Z A;  5HGQ A;  2ZIO A;  4H02 A;  2ZT8 A;  1EVL A;  2IY5 B;  4RQF A;  2AMC B;  4H2W A;  4HWS A;  4KR2 A;  4XEO A;  1PYS B;  5C52 B;  3UFG A;  3IKM B;  1KOG A;  2EL9 A;  2XTI A;  1G5I A;  1WQW A;  4CH4 A;  1J5W A;  3IKL A;  1N9W A;  4HWR A;  2ODR D;  4YRP A;  1HXD A;  3E9H A;  3EFS A;  3NEL A;  1YFS A;  3A5Y A;  1YB3 A;  4XTX A;  4YRC A;  3V7C A;  1USY C;  1JJC B;  4RDX A;  4XEM A;  4H2V A;  4YCW A;  1BIA A;  2ZCE A;  1ADY A;  3EFR A;  3LC0 A;  1VQZ A;  3NEM A;  11AS A;  2ZZG A;  2ALY A;  4P75 C;  3A7R A;  4YRN A;  3KFU A;  3I7F A;  3HY1 A;  4DPG A;  1Z7N A;  4YRT A;  2I4M A;  2DDZ A;  2XGT A;  4TVA A;  3BFM A;  2E1H A;  4YRS A;  5K1P A;  2I4N A;  5KNN A;  4CH6 A;  1IL2 A;  1YFR A;  4YP0 A;  1E1O A;  2P0L A;  1ASY A;  2HNI A;  4PHC A;  3DSQ A;  1YGB A;  1X01 A;  4UP7 A;  3ERR A;  3MF2 A;  3MEY A;  5F5W A;  3RF1 A;  4EO4 A;  2G4C A;  2ZNJ A;  4WI1 A;  1E1T A;  2E5A A;  3RKY A;  2RHQ B;  2DQ3 A;  1NJ6 A;  1B70 B;  3ICA A;  1EFW A;  1G5H A;  3V8K A;  2ZIN A;  4P72 A;  3A31 A;  4YRI A;  4KR3 A;  4P71 C;  3A5Z A;  4G85 A;  2DU7 A;  5C53 B;  4UP8 A;  4XU1 A;  4ZTZ B;  4YCU A;  2ZT6 A;  1ATI A;  2P5I A;  1X54 A;  2Q7H A;  1JJC A;  3HFZ A;  1WPY A;  4XTY A;  1HC7 A;  3PZC A;  4YYE A;  4Q15 A;  2A8E A;  3HFZ B;  2E64 A;  4K86 A;  4YRF A;  4E51 A;  2Q7G A;  1H4V B;  1SER A;  3VQY A;  2ALY B;  3CMQ A; 
#chains in the Genus database with same CATH homology
 4RQE A;  4BWA A;  4XU3 A;  1EIY A;  2C8M A;  3UGQ A;  3RKW A;  3TEH B;  1NYQ A;  4HWO A;  3NEN A;  5E3I A;  3REU A;  3QTC A;  5ELO A;  4P73 C;  2EAY A;  2QHV A;  4OP0 A;  3L4G A;  1ASZ A;  4CS2 A;  4X5O A;  4YRR A;  3V7R A;  1LYL A;  4K87 A;  1SET A;  2ARU A;  4CH3 A;  3W3S A;  2ZGW A;  1HTT A;  3V7S A;  1KMN A;  3UGT A;  2PME A;  3HXY A;  4YRK A;  1L0W A;  1USY A;  2ZT7 A;  1BBW A;  4YDQ A;  3PCO A;  3VQW A;  2DTO A;  1B8A A;  3IAL A;  2J3M A;  4HWT A;  3RL6 A;  3BJU A;  3RUX A;  1C0A A;  1RIQ A;  1EOV A;  2ZR3 A;  4TWA A;  2ZR2 A;  4P75 A;  2E41 A;  3HRI A;  1FYF A;  4AH6 A;  5ELN A;  4CH5 A;  1H4T A;  2DXU A;  3QO7 A;  4UPA A;  4H2U A;  3VBB A;  1GGM A;  4XU2 A;  4EX5 A;  4H2S A;  1NJ1 A;  4LNS A;  2ART A;  3RAC A;  5C51 B;  4XTU A;  4HT4 A;  2QHS A;  2E10 A;  4TVA B;  3V8J A;  3RKX A;  4CS3 A;  4UP9 A;  2AKW B;  3FJP A;  4YRL A;  3HRK A;  1QF6 A;  3MQZ A;  2C7I A;  3P8T A;  3PCO B;  1NYR A;  2RHS A;  4PG3 A;  3E9I A;  2ZNI A;  4DQ2 A;  3L1A A;  4OLF A;  2RHS B;  2E65 A;  4NCX A;  1B70 A;  1E22 A;  4YRO A;  3L4G B;  4P72 C;  2CGH A;  2DKG A;  4BW9 A;  4O2D A;  2E3C A;  4YRG A;  2RHQ A;  3HXX A;  2FYK A;  2I4L A;  2AKW A;  1EIY B;  4P74 A;  1QE0 A;  4Q6G A;  4CS4 A;  3QO5 A;  1NJ2 A;  3LSQ A;  1X56 A;  2DTH A;  2EJG A;  2ZT5 A;  2EJ9 A;  2DQ0 A;  2PMF A;  1YFT A;  4HWP A;  4YRQ A;  1EVK A;  4P3P A;  1BIB A;  2IY5 A;  4YRE A;  1PYS A;  4TTV A;  4XTV A;  2CJA A;  3P8V A;  1NNH A;  4LVJ A;  2DTI A;  3HFV A;  3NET A;  1E24 A;  4ZIB A;  1X55 A;  4LVI A;  2Q5H A;  3V8L A;  3RGL A;  4HVC A;  2QHU A;  4P73 A;  1Z7M A;  2ZZF A;  2ARS A;  2QHT A;  3UH0 A;  4XTZ A;  3REX A;  4LVM A;  4YPF A;  3M4Q A;  2DVE A;  3A7U A;  1G51 A;  4H2T A;  1WNL A;  4TVW A;  3QO8 A;  4YRM A;  1ADJ A;  2EWN A;  2ODR C;  4TQD A;  4YCV A;  2ZZE A;  3A32 A;  3HXZ A;  1WLE A;  2DJZ A;  3QNE A;  1EQR A;  5K1X A;  1W66 A;  3VQX A;  2EJF A;  1H4S A;  3R07 A;  4XTW A;  1B76 A;  3HXW A;  4J15 A;  1H4Q A;  1SES A;  1WQ7 A;  4H2X A;  3M4P A;  2CJB A;  3TEG A;  2DEQ A;  4RMF A;  2DZ9 A;  1BBU A;  4TVY A;  4LVL A;  1X2G A;  2J3L A;  4P3O A;  2ZTG A;  3G1Z A;  2I4O A;  2DZC A;  3P8Y A;  3TEH A;  2NS6 A;  4H2X B;  4TQF A;  3VQV A;  3MF1 A;  4H2Y A;  4LVK A;  4ZTU B;  3HXU A;  1B7Y A;  2Q7E A;  3RIR A;  2ZIM A;  1SRY A;  4WJ4 A;  2DXT A;  2ZXF A;  1WYD A;  4P71 A;  3HTZ A;  3HXV A;  3WQZ A;  4HA8 A;  2Q5I A;  3OD1 A;  4WJ3 M;  1NJ5 A;  12AS A;  2CJ9 A;  3LSS A;  4KQE A;  1WU7 A;  4YRJ A;  4K88 A;  1X2H A;  3IG2 A;  4L87 A;  4G84 A;  3HY0 A;  3A7A A;  4XU0 A;  3A74 A;  1B7Y B;  3TUP A;  1NJ8 A;  2CIM A;  1KMM A;  4P74 C;  4P3N A;  2DU5 A;  2AMC A;  4WF2 A;  3L2Z A;  5HGQ A;  2ZIO A;  4H02 A;  2ZT8 A;  1EVL A;  2IY5 B;  4RQF A;  2AMC B;  4H2W A;  4HWS A;  4KR2 A;  4XEO A;  1PYS B;  5C52 B;  3UFG A;  3IKM B;  1KOG A;  2EL9 A;  2XTI A;  1G5I A;  1WQW A;  4CH4 A;  1J5W A;  3IKL A;  1N9W A;  4HWR A;  2ODR D;  4YRP A;  1HXD A;  3E9H A;  3EFS A;  3NEL A;  1YFS A;  3A5Y A;  1YB3 A;  4XTX A;  4YRC A;  3V7C A;  1USY C;  1JJC B;  4RDX A;  4XEM A;  4H2V A;  4YCW A;  1BIA A;  2ZCE A;  1ADY A;  3EFR A;  3LC0 A;  1VQZ A;  3NEM A;  11AS A;  2ZZG A;  2ALY A;  4P75 C;  3A7R A;  4YRN A;  3KFU A;  3I7F A;  3HY1 A;  4DPG A;  1Z7N A;  4YRT A;  2I4M A;  2DDZ A;  2XGT A;  4TVA A;  3BFM A;  2E1H A;  4YRS A;  5K1P A;  2I4N A;  5KNN A;  4CH6 A;  1IL2 A;  1YFR A;  4YP0 A;  1E1O A;  2P0L A;  1ASY A;  2HNI A;  4PHC A;  3DSQ A;  1YGB A;  1X01 A;  4UP7 A;  3ERR A;  3MF2 A;  3MEY A;  5F5W A;  3RF1 A;  4EO4 A;  2G4C A;  2ZNJ A;  4WI1 A;  1E1T A;  2E5A A;  3RKY A;  2RHQ B;  2DQ3 A;  1NJ6 A;  1B70 B;  3ICA A;  1EFW A;  1G5H A;  3V8K A;  2ZIN A;  4P72 A;  3A31 A;  4YRI A;  4KR3 A;  4P71 C;  3A5Z A;  4G85 A;  2DU7 A;  5C53 B;  4UP8 A;  4XU1 A;  4ZTZ B;  4YCU A;  2ZT6 A;  1ATI A;  2P5I A;  1X54 A;  2Q7H A;  1JJC A;  3HFZ A;  1WPY A;  4XTY A;  1HC7 A;  3PZC A;  4YYE A;  4Q15 A;  2A8E A;  3HFZ B;  2E64 A;  4K86 A;  4YRF A;  4E51 A;  2Q7G A;  1H4V B;  1SER A;  3VQY A;  2ALY B;  3CMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...