3PCOA

Crystal structure of e. coli phenylalanine-trna synthetase complexed with phenylalanine and amp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
242
structure length
242
Chain Sequence
RLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNVLRNVGIDPEVYSGFAFGMGMERLTMLRYGVTDLRSFFENDLRFLKQFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanyl-tRNA synthetase, alpha subunit
publication title Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 62
structure length 242
sequence length 242
chains with identical sequence C
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2010-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
A PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3pcoA01
4XTZA 5C53B 2ARTA 3NEMA 2DTIA 4UP9A 2XGTA 2P5IA 1WNLA 4PG3A 3RIRA 4XTUA 4YYEA 1LYLA 4CH4A 3VQXA 4CH6A 3L2ZA 1YB3A 4P73A 4OP0A 3V8LA 2IY5B 2HNIA 1NYRA 1YGBA 2DXTA 1G51A 2DDZA 3HXVA 1ASZA 4YP0A 4H2WA 3OD1A 3NETA 2AMCB 3G1ZA 1X01A 2E65A 2E3CA 4KQEA 2ZZFA 4XTXA 1NYQA 2ZGWA 4EO4A 3IALA 2QHVA 2CGHA 1B8AA 2DVEA 2G4CA 3RF1A 1KMMA 2ZT8A 3RL6A 1B76A 3HXWA 3EFRA 3KFUA 3A31A 1H4QA 2DQ0A 4P73C 4RDXA 4BW9A 4K88A 4H2TA 1X54A 4YRNA 3CMQA 1HC7A 3HXYA 2ZINA 3BFMA 4XTVA 3QNEA 3BJUA 3TUPA 2C8MA 2DQ3A 1QF6A 1WU7A 1EVLA 1BIBA 4P3PA 2I4MA 4TVWA 2ODRC 2RHQA 2QHTA 2ALYA 2EJFA 4P3NA 3P8YA 1IL2A 4XU1A 4Q15A 4J15A 3E9HA 4P75A 4TTVA 1EOVA 1BIAA 4P74A 4YRCA 4RQEA 4YRJA 4X5OA 3HTZA 3IG2A 5ELNA 1PYSA 1USYA 4YCWA 4UP7A 11ASA 3A5YA 3E9IA 3UFGA 4H02A 3TEHA 5K1XA 3HRKA 3QO7A 3REXA 2C7IA 3HY0A 1WQ7A 1SERA 1HXDA 1L0WA 3L4GB 4KR2A 1NJ6A 2CJ9A 2ZIMA 2PMFA 4YRTA 3VBBA 4YCVA 3PCOB 4HVCA 2DZ9A 4L87A 4DPGA 3A7UA 3HFZB 3MF2A 1SRYA 4H2YA 2DTHA 3DSQA 2RHSB 4P75C 1E22A 4XTWA 1NJ5A 4P74C 5F5WA 2DJZA 3RKYA 1JJCA 3V7CA 1NNHA 2E41A 4ZTUB 2ZR3A 3RUXA 2ZT7A 3HXUA 4YDQA 1EIYB 1USYC 3W3SA 4RQFA 2ZNJA 1NJ8A 1X2GA 1B7YA 1ATIA 3RACA 5C51B 3UH0A 4YRIA 1W66A 4RMFA 5E3IA 4K87A 2ODRD 4K86A 2EAYA 4P72C 1KMNA 3NENA 2EL9A 2EJ9A 4TQDA 2J3LA 2DTOA 2ZNIA 1B70A 3HRIA 1EFWA 1EQRA 4YRPA 1H4TA 3A32A 1FYFA 3VQYA 2Q5HA 3QO8A 1RIQA 4ZIBA 1JJCB 2ZXFA 2ARSA 2I4OA 2I4NA 1GGMA 3M4QA 1B7YB 3M4PA 4YRGA 3A7AA 3TEGA 1ADJA 4CS4A 2CIMA 2DU7A 4TVAA 2ZR2A 4ZTZB 1Z7MA 12ASA 2E5AA 3IKLA 4XU0A 3PZCA 2I4LA 4KR3A 1N9WA 3REUA 3P8TA 1X56A 2PMEA 1G5HA 3LC0A 2P0LA 4CH5A 2E1HA 1E1TA 4YRSA 2IY5A 1H4VB 2ZCEA 4YRMA 5ELOA 1ADYA 4TWAA 3ERRA 2E64A 1EVKA 1NJ2A 2ZZGA 4XU2A 3A7RA 1BBWA 4UPAA 2AMCA 4PHCA 3UGTA 2AKWA 4P72A 5KNNA 4WJ3M 1SESA 4H2XA 1J5WA 1WQWA 2ZIOA 4XTYA 2QHUA 4TVYA 2DEQA 3P8VA 3IKMB 2RHQB 4H2UA 1NJ1A 4P3OA 4DQ2A 2ALYB 4WF2A 1BBUA 2CJAA 4YRLA 2EJGA 3A5ZA 4WJ4A 3UGQA 4H2SA 4CS2A 2ZZEA 3I7FA 3A74A 2QHSA 4HA8A 3HY1A 2DU5A 1PYSB 4WI1A 3HFVA 1KOGA 3VQVA 4HWOA 2FYKA 4HWRA 1SETA 4G84A 3EFSA 4HWSA 2ZT6A 4P71C 3TEHB 4CH3A 1YFRA 1HTTA 3RGLA 3RKXA 2AKWB 4TQFA 1G5IA 2Q7EA 3V8JA 4YRKA 2EWNA 2DXUA 2DKGA 3V7SA 3HXXA 4XEMA 4AH6A 4H2XB 2XTIA 1X2HA 3ICAA 4Q6GA 3QO5A 4E51A 4YRRA 2Q7GA 2ARUA 5K1PA 3VQWA 3HXZA 3R07A 2Q5IA 3FJPA 1WYDA 4YRFA 4YRQA 1E24A 3MF1A 4OLFA 1WLEA 4NCXA 3RKWA 4O2DA 3LSSA 1E1OA 4EX5A 3MEYA 3WQZA 2ZT5A 4G85A 2DZCA 4YROA 3V7RA 3L1AA 4XEOA 1X55A 2J3MA 3NELA 3L4GA 2E10A 3LSQA 1YFSA 3V8KA 3PCOA 1B70B 1ASYA 2ZTGA 3QTCA 4UP8A 3HFZA 1YFTA 2RHSA 2CJBA 4BWAA 4YPFA 1WPYA 4YCUA 1Z7NA 4LNSA 4P71A 1EIYA 4HWPA 4XU3A 4HWTA 1H4SA 4YREA 1QE0A 4H2VA 1VQZA 4CS3A 1C0AA 4TVAB 2Q7HA 5HGQA 5C52B
chains in the Genus database with same CATH superfamily
4XTZA 5C53B 2ARTA 3NEMA 2DTIA 4UP9A 2XGTA 2P5IA 1WNLA 4PG3A 3RIRA 4XTUA 4YYEA 1LYLA 4CH4A 3VQXA 4CH6A 3L2ZA 1YB3A 4P73A 4OP0A 3V8LA 2IY5B 2HNIA 1NYRA 1YGBA 2DXTA 1G51A 2DDZA 3HXVA 1ASZA 4YP0A 4H2WA 3OD1A 3NETA 2AMCB 3G1ZA 1X01A 2E65A 2E3CA 4KQEA 2ZZFA 4XTXA 1NYQA 2ZGWA 4EO4A 3IALA 2QHVA 2CGHA 1B8AA 2DVEA 2G4CA 2NS6A 3RF1A 1KMMA 2ZT8A 3RL6A 1B76A 3HXWA 3EFRA 3KFUA 3A31A 1H4QA 2DQ0A 4P73C 4RDXA 4BW9A 4K88A 4H2TA 1X54A 4YRNA 3CMQA 1HC7A 3HXYA 2ZINA 3BFMA 4XTVA 4HT4A 3QNEA 3BJUA 2A8EA 3TUPA 2C8MA 2DQ3A 1QF6A 1WU7A 1EVLA 1BIBA 4P3PA 2I4MA 4TVWA 2ODRC 2RHQA 2QHTA 2ALYA 2EJFA 4P3NA 3P8YA 1IL2A 4XU1A 4Q15A 4J15A 3E9HA 4P75A 4TTVA 1EOVA 1BIAA 4P74A 4YRCA 4RQEA 4YRJA 4X5OA 3HTZA 3IG2A 5ELNA 1PYSA 1USYA 4YCWA 4UP7A 11ASA 3A5YA 3E9IA 3UFGA 4H02A 3TEHA 5K1XA 3HRKA 3QO7A 3REXA 2C7IA 3HY0A 1WQ7A 1SERA 1HXDA 1L0WA 3L4GB 4KR2A 1NJ6A 2CJ9A 2ZIMA 2PMFA 4YRTA 3VBBA 4YCVA 3PCOB 4HVCA 2DZ9A 4L87A 4DPGA 3A7UA 3HFZB 3MF2A 1SRYA 4H2YA 2DTHA 3DSQA 2RHSB 4P75C 1E22A 4XTWA 1NJ5A 4P74C 5F5WA 2DJZA 3RKYA 1JJCA 3V7CA 1NNHA 2E41A 4ZTUB 2ZR3A 3RUXA 2ZT7A 3HXUA 4YDQA 1EIYB 1USYC 3W3SA 4RQFA 2ZNJA 1NJ8A 1X2GA 1B7YA 1ATIA 3RACA 5C51B 3UH0A 4YRIA 1W66A 4RMFA 5E3IA 4K87A 2ODRD 4K86A 2EAYA 4P72C 1KMNA 3NENA 2EL9A 2EJ9A 4TQDA 2J3LA 2DTOA 2ZNIA 1B70A 3HRIA 1EFWA 1EQRA 4YRPA 1H4TA 3A32A 1FYFA 3VQYA 2Q5HA 3QO8A 1RIQA 4ZIBA 1JJCB 2ZXFA 2ARSA 2I4OA 2I4NA 1GGMA 3M4QA 1B7YB 3M4PA 4YRGA 3A7AA 3TEGA 1ADJA 4CS4A 2CIMA 2DU7A 4TVAA 2ZR2A 4ZTZB 1Z7MA 4LVJA 12ASA 2E5AA 3IKLA 4XU0A 3PZCA 2I4LA 4KR3A 1N9WA 3REUA 3P8TA 1X56A 2PMEA 1G5HA 3LC0A 4LVMA 2P0LA 4CH5A 4LVIA 4LVKA 2E1HA 1E1TA 4YRSA 2IY5A 1H4VB 2ZCEA 4YRMA 5ELOA 1ADYA 4TWAA 3ERRA 2E64A 1EVKA 1NJ2A 2ZZGA 4XU2A 3A7RA 1BBWA 4UPAA 2AMCA 4PHCA 3UGTA 2AKWA 4P72A 5KNNA 4WJ3M 1SESA 4H2XA 1J5WA 1WQWA 2ZIOA 4XTYA 2QHUA 4TVYA 2DEQA 3P8VA 3IKMB 2RHQB 4H2UA 1NJ1A 4P3OA 4DQ2A 2ALYB 4WF2A 1BBUA 2CJAA 4YRLA 2EJGA 3A5ZA 4WJ4A 3UGQA 4H2SA 4CS2A 2ZZEA 3I7FA 3A74A 2QHSA 4HA8A 3HY1A 4LVLA 2DU5A 1PYSB 4WI1A 3HFVA 1KOGA 3VQVA 4HWOA 2FYKA 4HWRA 1SETA 4G84A 3EFSA 4HWSA 2ZT6A 4P71C 3TEHB 4CH3A 1YFRA 1HTTA 3RGLA 3RKXA 2AKWB 4TQFA 1G5IA 2Q7EA 3V8JA 4YRKA 2EWNA 2DXUA 2DKGA 3V7SA 3HXXA 4XEMA 4AH6A 4H2XB 2XTIA 1X2HA 3ICAA 4Q6GA 3QO5A 4E51A 4YRRA 2Q7GA 2ARUA 5K1PA 3VQWA 3HXZA 3MQZA 3R07A 2Q5IA 3FJPA 1WYDA 4YRFA 4YRQA 1E24A 3MF1A 4OLFA 1WLEA 4NCXA 3RKWA 4O2DA 3LSSA 1E1OA 4EX5A 3MEYA 3WQZA 2ZT5A 4G85A 2DZCA 4YROA 3V7RA 3L1AA 4XEOA 1X55A 2J3MA 3NELA 3L4GA 2E10A 3LSQA 1YFSA 3V8KA 3PCOA 1B70B 1ASYA 2ZTGA 3QTCA 4UP8A 3HFZA 1YFTA 2RHSA 2CJBA 4BWAA 4YPFA 1WPYA 4YCUA 1Z7NA 4LNSA 4P71A 1EIYA 4HWPA 4XU3A 4HWTA 1H4SA 4YREA 1QE0A 4H2VA 1VQZA 4CS3A 1C0AA 4TVAB 2Q7HA 5HGQA 5C52B
chains in the Genus database with same CATH topology
4XTZA 5C53B 2ARTA 3NEMA 2DTIA 4UP9A 2XGTA 2P5IA 1WNLA 4PG3A 3RIRA 4XTUA 4YYEA 1LYLA 4CH4A 3VQXA 4CH6A 3L2ZA 1YB3A 4P73A 4OP0A 3V8LA 2IY5B 2HNIA 1NYRA 1YGBA 2DXTA 1G51A 2DDZA 3HXVA 1ASZA 4YP0A 4H2WA 3OD1A 3NETA 2AMCB 3G1ZA 1X01A 2E65A 2E3CA 4KQEA 2ZZFA 4XTXA 1NYQA 2ZGWA 4EO4A 3IALA 2QHVA 2CGHA 1B8AA 2DVEA 2G4CA 2NS6A 3RF1A 1KMMA 2ZT8A 3RL6A 1B76A 3HXWA 3EFRA 3KFUA 3A31A 1H4QA 2DQ0A 4P73C 4RDXA 4BW9A 4K88A 4H2TA 1X54A 4YRNA 3CMQA 1HC7A 3HXYA 2ZINA 3BFMA 4XTVA 4HT4A 3QNEA 3BJUA 2A8EA 3TUPA 2C8MA 2DQ3A 1QF6A 1WU7A 1EVLA 1BIBA 4P3PA 2I4MA 4TVWA 2ODRC 2RHQA 2QHTA 2ALYA 2EJFA 4P3NA 3P8YA 1IL2A 4XU1A 4Q15A 4J15A 3E9HA 4P75A 4TTVA 1EOVA 1BIAA 4P74A 4YRCA 4RQEA 4YRJA 4X5OA 3HTZA 3IG2A 5ELNA 1PYSA 1USYA 4YCWA 4UP7A 11ASA 3A5YA 3E9IA 3UFGA 4H02A 3TEHA 5K1XA 3HRKA 3QO7A 3REXA 2C7IA 3HY0A 1WQ7A 1SERA 1HXDA 1L0WA 3L4GB 4KR2A 1NJ6A 2CJ9A 2ZIMA 2PMFA 4YRTA 3VBBA 4YCVA 3PCOB 4HVCA 2DZ9A 4L87A 4DPGA 3A7UA 3HFZB 3MF2A 1SRYA 4H2YA 2DTHA 3DSQA 2RHSB 4P75C 1E22A 4XTWA 1NJ5A 4P74C 5F5WA 2DJZA 3RKYA 1JJCA 3V7CA 1NNHA 2E41A 4ZTUB 2ZR3A 3RUXA 2ZT7A 3HXUA 4YDQA 1EIYB 1USYC 3W3SA 4RQFA 2ZNJA 1NJ8A 1X2GA 1B7YA 1ATIA 3RACA 5C51B 3UH0A 4YRIA 1W66A 4RMFA 5E3IA 4K87A 2ODRD 4K86A 2EAYA 4P72C 1KMNA 3NENA 2EL9A 2EJ9A 4TQDA 2J3LA 2DTOA 2ZNIA 1B70A 3HRIA 1EFWA 1EQRA 4YRPA 1H4TA 3A32A 1FYFA 3VQYA 2Q5HA 3QO8A 1RIQA 4ZIBA 1JJCB 2ZXFA 2ARSA 2I4OA 2I4NA 1GGMA 3M4QA 1B7YB 3M4PA 4YRGA 3A7AA 3TEGA 1ADJA 4CS4A 2CIMA 2DU7A 4TVAA 2ZR2A 4ZTZB 1Z7MA 4LVJA 12ASA 2E5AA 3IKLA 4XU0A 3PZCA 2I4LA 4KR3A 1N9WA 3REUA 3P8TA 1X56A 2PMEA 1G5HA 3LC0A 4LVMA 2P0LA 4CH5A 4LVIA 4LVKA 2E1HA 1E1TA 4YRSA 2IY5A 1H4VB 2ZCEA 4YRMA 5ELOA 1ADYA 4TWAA 3ERRA 2E64A 1EVKA 1NJ2A 2ZZGA 4XU2A 3A7RA 1BBWA 4UPAA 2AMCA 4PHCA 3UGTA 2AKWA 4P72A 5KNNA 4WJ3M 1SESA 4H2XA 1J5WA 1WQWA 2ZIOA 4XTYA 2QHUA 4TVYA 2DEQA 3P8VA 3IKMB 2RHQB 4H2UA 1NJ1A 4P3OA 4DQ2A 2ALYB 4WF2A 1BBUA 2CJAA 4YRLA 2EJGA 3A5ZA 4WJ4A 3UGQA 4H2SA 4CS2A 2ZZEA 3I7FA 3A74A 2QHSA 4HA8A 3HY1A 4LVLA 2DU5A 1PYSB 4WI1A 3HFVA 1KOGA 3VQVA 4HWOA 2FYKA 4HWRA 1SETA 4G84A 3EFSA 4HWSA 2ZT6A 4P71C 3TEHB 4CH3A 1YFRA 1HTTA 3RGLA 3RKXA 2AKWB 4TQFA 1G5IA 2Q7EA 3V8JA 4YRKA 2EWNA 2DXUA 2DKGA 3V7SA 3HXXA 4XEMA 4AH6A 4H2XB 2XTIA 1X2HA 3ICAA 4Q6GA 3QO5A 4E51A 4YRRA 2Q7GA 2ARUA 5K1PA 3VQWA 3HXZA 3MQZA 3R07A 2Q5IA 3FJPA 1WYDA 4YRFA 4YRQA 1E24A 3MF1A 4OLFA 1WLEA 4NCXA 3RKWA 4O2DA 3LSSA 1E1OA 4EX5A 3MEYA 3WQZA 2ZT5A 4G85A 2DZCA 4YROA 3V7RA 3L1AA 4XEOA 1X55A 2J3MA 3NELA 3L4GA 2E10A 3LSQA 1YFSA 3V8KA 3PCOA 1B70B 1ASYA 2ZTGA 3QTCA 4UP8A 3HFZA 1YFTA 2RHSA 2CJBA 4BWAA 4YPFA 1WPYA 4YCUA 1Z7NA 4LNSA 4P71A 1EIYA 4HWPA 4XU3A 4HWTA 1H4SA 4YREA 1QE0A 4H2VA 1VQZA 4CS3A 1C0AA 4TVAB 2Q7HA 5HGQA 5C52B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTZ A;  5C53 B;  2ART A;  3NEM A;  2DTI A;  4UP9 A;  2XGT A;  2P5I A;  1WNL A;  4PG3 A;  3RIR A;  4XTU A;  4YYE A;  1LYL A;  4CH4 A;  3VQX A;  4CH6 A;  3L2Z A;  1YB3 A;  4P73 A;  4OP0 A;  3V8L A;  2IY5 B;  2HNI A;  1NYR A;  1YGB A;  2DXT A;  1G51 A;  2DDZ A;  3HXV A;  1ASZ A;  4YP0 A;  4H2W A;  3OD1 A;  3NET A;  2AMC B;  3G1Z A;  1X01 A;  2E65 A;  2E3C A;  4KQE A;  2ZZF A;  4XTX A;  1NYQ A;  2ZGW A;  4EO4 A;  3IAL A;  2QHV A;  2CGH A;  1B8A A;  2DVE A;  2G4C A;  3RF1 A;  1KMM A;  2ZT8 A;  3RL6 A;  1B76 A;  3HXW A;  3EFR A;  3KFU A;  3A31 A;  1H4Q A;  2DQ0 A;  4P73 C;  4RDX A;  4BW9 A;  4K88 A;  4H2T A;  1X54 A;  4YRN A;  3CMQ A;  1HC7 A;  3HXY A;  2ZIN A;  3BFM A;  4XTV A;  3QNE A;  3BJU A;  3TUP A;  2C8M A;  2DQ3 A;  1QF6 A;  1WU7 A;  1EVL A;  1BIB A;  4P3P A;  2I4M A;  4TVW A;  2ODR C;  2RHQ A;  2QHT A;  2ALY A;  2EJF A;  4P3N A;  3P8Y A;  1IL2 A;  4XU1 A;  4Q15 A;  4J15 A;  3E9H A;  4P75 A;  4TTV A;  1EOV A;  1BIA A;  4P74 A;  4YRC A;  4RQE A;  4YRJ A;  4X5O A;  3HTZ A;  3IG2 A;  5ELN A;  1PYS A;  1USY A;  4YCW A;  4UP7 A;  11AS A;  3A5Y A;  3E9I A;  3UFG A;  4H02 A;  3TEH A;  5K1X A;  3HRK A;  3QO7 A;  3REX A;  2C7I A;  3HY0 A;  1WQ7 A;  1SER A;  1HXD A;  1L0W A;  3L4G B;  4KR2 A;  1NJ6 A;  2CJ9 A;  2ZIM A;  2PMF A;  4YRT A;  3VBB A;  4YCV A;  3PCO B;  4HVC A;  2DZ9 A;  4L87 A;  4DPG A;  3A7U A;  3HFZ B;  3MF2 A;  1SRY A;  4H2Y A;  2DTH A;  3DSQ A;  2RHS B;  4P75 C;  1E22 A;  4XTW A;  1NJ5 A;  4P74 C;  5F5W A;  2DJZ A;  3RKY A;  1JJC A;  3V7C A;  1NNH A;  2E41 A;  4ZTU B;  2ZR3 A;  3RUX A;  2ZT7 A;  3HXU A;  4YDQ A;  1EIY B;  1USY C;  3W3S A;  4RQF A;  2ZNJ A;  1NJ8 A;  1X2G A;  1B7Y A;  1ATI A;  3RAC A;  5C51 B;  3UH0 A;  4YRI A;  1W66 A;  4RMF A;  5E3I A;  4K87 A;  2ODR D;  4K86 A;  2EAY A;  4P72 C;  1KMN A;  3NEN A;  2EL9 A;  2EJ9 A;  4TQD A;  2J3L A;  2DTO A;  2ZNI A;  1B70 A;  3HRI A;  1EFW A;  1EQR A;  4YRP A;  1H4T A;  3A32 A;  1FYF A;  3VQY A;  2Q5H A;  3QO8 A;  1RIQ A;  4ZIB A;  1JJC B;  2ZXF A;  2ARS A;  2I4O A;  2I4N A;  1GGM A;  3M4Q A;  1B7Y B;  3M4P A;  4YRG A;  3A7A A;  3TEG A;  1ADJ A;  4CS4 A;  2CIM A;  2DU7 A;  4TVA A;  2ZR2 A;  4ZTZ B;  1Z7M A;  12AS A;  2E5A A;  3IKL A;  4XU0 A;  3PZC A;  2I4L A;  4KR3 A;  1N9W A;  3REU A;  3P8T A;  1X56 A;  2PME A;  1G5H A;  3LC0 A;  2P0L A;  4CH5 A;  2E1H A;  1E1T A;  4YRS A;  2IY5 A;  1H4V B;  2ZCE A;  4YRM A;  5ELO A;  1ADY A;  4TWA A;  3ERR A;  2E64 A;  1EVK A;  1NJ2 A;  2ZZG A;  4XU2 A;  3A7R A;  1BBW A;  4UPA A;  2AMC A;  4PHC A;  3UGT A;  2AKW A;  4P72 A;  5KNN A;  4WJ3 M;  1SES A;  4H2X A;  1J5W A;  1WQW A;  2ZIO A;  4XTY A;  2QHU A;  4TVY A;  2DEQ A;  3P8V A;  3IKM B;  2RHQ B;  4H2U A;  1NJ1 A;  4P3O A;  4DQ2 A;  2ALY B;  4WF2 A;  1BBU A;  2CJA A;  4YRL A;  2EJG A;  3A5Z A;  4WJ4 A;  3UGQ A;  4H2S A;  4CS2 A;  2ZZE A;  3I7F A;  3A74 A;  2QHS A;  4HA8 A;  3HY1 A;  2DU5 A;  1PYS B;  4WI1 A;  3HFV A;  1KOG A;  3VQV A;  4HWO A;  2FYK A;  4HWR A;  1SET A;  4G84 A;  3EFS A;  4HWS A;  2ZT6 A;  4P71 C;  3TEH B;  4CH3 A;  1YFR A;  1HTT A;  3RGL A;  3RKX A;  2AKW B;  4TQF A;  1G5I A;  2Q7E A;  3V8J A;  4YRK A;  2EWN A;  2DXU A;  2DKG A;  3V7S A;  3HXX A;  4XEM A;  4AH6 A;  4H2X B;  2XTI A;  1X2H A;  3ICA A;  4Q6G A;  3QO5 A;  4E51 A;  4YRR A;  2Q7G A;  2ARU A;  5K1P A;  3VQW A;  3HXZ A;  3R07 A;  2Q5I A;  3FJP A;  1WYD A;  4YRF A;  4YRQ A;  1E24 A;  3MF1 A;  4OLF A;  1WLE A;  4NCX A;  3RKW A;  4O2D A;  3LSS A;  1E1O A;  4EX5 A;  3MEY A;  3WQZ A;  2ZT5 A;  4G85 A;  2DZC A;  4YRO A;  3V7R A;  3L1A A;  4XEO A;  1X55 A;  2J3M A;  3NEL A;  3L4G A;  2E10 A;  3LSQ A;  1YFS A;  3V8K A;  3PCO A;  1B70 B;  1ASY A;  2ZTG A;  3QTC A;  4UP8 A;  3HFZ A;  1YFT A;  2RHS A;  2CJB A;  4BWA A;  4YPF A;  1WPY A;  4YCU A;  1Z7N A;  4LNS A;  4P71 A;  1EIY A;  4HWP A;  4XU3 A;  4HWT A;  1H4S A;  4YRE A;  1QE0 A;  4H2V A;  1VQZ A;  4CS3 A;  1C0A A;  4TVA B;  2Q7H A;  5HGQ A;  5C52 B; 
#chains in the Genus database with same CATH topology
 4XTZ A;  5C53 B;  2ART A;  3NEM A;  2DTI A;  4UP9 A;  2XGT A;  2P5I A;  1WNL A;  4PG3 A;  3RIR A;  4XTU A;  4YYE A;  1LYL A;  4CH4 A;  3VQX A;  4CH6 A;  3L2Z A;  1YB3 A;  4P73 A;  4OP0 A;  3V8L A;  2IY5 B;  2HNI A;  1NYR A;  1YGB A;  2DXT A;  1G51 A;  2DDZ A;  3HXV A;  1ASZ A;  4YP0 A;  4H2W A;  3OD1 A;  3NET A;  2AMC B;  3G1Z A;  1X01 A;  2E65 A;  2E3C A;  4KQE A;  2ZZF A;  4XTX A;  1NYQ A;  2ZGW A;  4EO4 A;  3IAL A;  2QHV A;  2CGH A;  1B8A A;  2DVE A;  2G4C A;  2NS6 A;  3RF1 A;  1KMM A;  2ZT8 A;  3RL6 A;  1B76 A;  3HXW A;  3EFR A;  3KFU A;  3A31 A;  1H4Q A;  2DQ0 A;  4P73 C;  4RDX A;  4BW9 A;  4K88 A;  4H2T A;  1X54 A;  4YRN A;  3CMQ A;  1HC7 A;  3HXY A;  2ZIN A;  3BFM A;  4XTV A;  4HT4 A;  3QNE A;  3BJU A;  2A8E A;  3TUP A;  2C8M A;  2DQ3 A;  1QF6 A;  1WU7 A;  1EVL A;  1BIB A;  4P3P A;  2I4M A;  4TVW A;  2ODR C;  2RHQ A;  2QHT A;  2ALY A;  2EJF A;  4P3N A;  3P8Y A;  1IL2 A;  4XU1 A;  4Q15 A;  4J15 A;  3E9H A;  4P75 A;  4TTV A;  1EOV A;  1BIA A;  4P74 A;  4YRC A;  4RQE A;  4YRJ A;  4X5O A;  3HTZ A;  3IG2 A;  5ELN A;  1PYS A;  1USY A;  4YCW A;  4UP7 A;  11AS A;  3A5Y A;  3E9I A;  3UFG A;  4H02 A;  3TEH A;  5K1X A;  3HRK A;  3QO7 A;  3REX A;  2C7I A;  3HY0 A;  1WQ7 A;  1SER A;  1HXD A;  1L0W A;  3L4G B;  4KR2 A;  1NJ6 A;  2CJ9 A;  2ZIM A;  2PMF A;  4YRT A;  3VBB A;  4YCV A;  3PCO B;  4HVC A;  2DZ9 A;  4L87 A;  4DPG A;  3A7U A;  3HFZ B;  3MF2 A;  1SRY A;  4H2Y A;  2DTH A;  3DSQ A;  2RHS B;  4P75 C;  1E22 A;  4XTW A;  1NJ5 A;  4P74 C;  5F5W A;  2DJZ A;  3RKY A;  1JJC A;  3V7C A;  1NNH A;  2E41 A;  4ZTU B;  2ZR3 A;  3RUX A;  2ZT7 A;  3HXU A;  4YDQ A;  1EIY B;  1USY C;  3W3S A;  4RQF A;  2ZNJ A;  1NJ8 A;  1X2G A;  1B7Y A;  1ATI A;  3RAC A;  5C51 B;  3UH0 A;  4YRI A;  1W66 A;  4RMF A;  5E3I A;  4K87 A;  2ODR D;  4K86 A;  2EAY A;  4P72 C;  1KMN A;  3NEN A;  2EL9 A;  2EJ9 A;  4TQD A;  2J3L A;  2DTO A;  2ZNI A;  1B70 A;  3HRI A;  1EFW A;  1EQR A;  4YRP A;  1H4T A;  3A32 A;  1FYF A;  3VQY A;  2Q5H A;  3QO8 A;  1RIQ A;  4ZIB A;  1JJC B;  2ZXF A;  2ARS A;  2I4O A;  2I4N A;  1GGM A;  3M4Q A;  1B7Y B;  3M4P A;  4YRG A;  3A7A A;  3TEG A;  1ADJ A;  4CS4 A;  2CIM A;  2DU7 A;  4TVA A;  2ZR2 A;  4ZTZ B;  1Z7M A;  4LVJ A;  12AS A;  2E5A A;  3IKL A;  4XU0 A;  3PZC A;  2I4L A;  4KR3 A;  1N9W A;  3REU A;  3P8T A;  1X56 A;  2PME A;  1G5H A;  3LC0 A;  4LVM A;  2P0L A;  4CH5 A;  4LVI A;  4LVK A;  2E1H A;  1E1T A;  4YRS A;  2IY5 A;  1H4V B;  2ZCE A;  4YRM A;  5ELO A;  1ADY A;  4TWA A;  3ERR A;  2E64 A;  1EVK A;  1NJ2 A;  2ZZG A;  4XU2 A;  3A7R A;  1BBW A;  4UPA A;  2AMC A;  4PHC A;  3UGT A;  2AKW A;  4P72 A;  5KNN A;  4WJ3 M;  1SES A;  4H2X A;  1J5W A;  1WQW A;  2ZIO A;  4XTY A;  2QHU A;  4TVY A;  2DEQ A;  3P8V A;  3IKM B;  2RHQ B;  4H2U A;  1NJ1 A;  4P3O A;  4DQ2 A;  2ALY B;  4WF2 A;  1BBU A;  2CJA A;  4YRL A;  2EJG A;  3A5Z A;  4WJ4 A;  3UGQ A;  4H2S A;  4CS2 A;  2ZZE A;  3I7F A;  3A74 A;  2QHS A;  4HA8 A;  3HY1 A;  4LVL A;  2DU5 A;  1PYS B;  4WI1 A;  3HFV A;  1KOG A;  3VQV A;  4HWO A;  2FYK A;  4HWR A;  1SET A;  4G84 A;  3EFS A;  4HWS A;  2ZT6 A;  4P71 C;  3TEH B;  4CH3 A;  1YFR A;  1HTT A;  3RGL A;  3RKX A;  2AKW B;  4TQF A;  1G5I A;  2Q7E A;  3V8J A;  4YRK A;  2EWN A;  2DXU A;  2DKG A;  3V7S A;  3HXX A;  4XEM A;  4AH6 A;  4H2X B;  2XTI A;  1X2H A;  3ICA A;  4Q6G A;  3QO5 A;  4E51 A;  4YRR A;  2Q7G A;  2ARU A;  5K1P A;  3VQW A;  3HXZ A;  3MQZ A;  3R07 A;  2Q5I A;  3FJP A;  1WYD A;  4YRF A;  4YRQ A;  1E24 A;  3MF1 A;  4OLF A;  1WLE A;  4NCX A;  3RKW A;  4O2D A;  3LSS A;  1E1O A;  4EX5 A;  3MEY A;  3WQZ A;  2ZT5 A;  4G85 A;  2DZC A;  4YRO A;  3V7R A;  3L1A A;  4XEO A;  1X55 A;  2J3M A;  3NEL A;  3L4G A;  2E10 A;  3LSQ A;  1YFS A;  3V8K A;  3PCO A;  1B70 B;  1ASY A;  2ZTG A;  3QTC A;  4UP8 A;  3HFZ A;  1YFT A;  2RHS A;  2CJB A;  4BWA A;  4YPF A;  1WPY A;  4YCU A;  1Z7N A;  4LNS A;  4P71 A;  1EIY A;  4HWP A;  4XU3 A;  4HWT A;  1H4S A;  4YRE A;  1QE0 A;  4H2V A;  1VQZ A;  4CS3 A;  1C0A A;  4TVA B;  2Q7H A;  5HGQ A;  5C52 B; 
#chains in the Genus database with same CATH homology
 4XTZ A;  5C53 B;  2ART A;  3NEM A;  2DTI A;  4UP9 A;  2XGT A;  2P5I A;  1WNL A;  4PG3 A;  3RIR A;  4XTU A;  4YYE A;  1LYL A;  4CH4 A;  3VQX A;  4CH6 A;  3L2Z A;  1YB3 A;  4P73 A;  4OP0 A;  3V8L A;  2IY5 B;  2HNI A;  1NYR A;  1YGB A;  2DXT A;  1G51 A;  2DDZ A;  3HXV A;  1ASZ A;  4YP0 A;  4H2W A;  3OD1 A;  3NET A;  2AMC B;  3G1Z A;  1X01 A;  2E65 A;  2E3C A;  4KQE A;  2ZZF A;  4XTX A;  1NYQ A;  2ZGW A;  4EO4 A;  3IAL A;  2QHV A;  2CGH A;  1B8A A;  2DVE A;  2G4C A;  2NS6 A;  3RF1 A;  1KMM A;  2ZT8 A;  3RL6 A;  1B76 A;  3HXW A;  3EFR A;  3KFU A;  3A31 A;  1H4Q A;  2DQ0 A;  4P73 C;  4RDX A;  4BW9 A;  4K88 A;  4H2T A;  1X54 A;  4YRN A;  3CMQ A;  1HC7 A;  3HXY A;  2ZIN A;  3BFM A;  4XTV A;  4HT4 A;  3QNE A;  3BJU A;  2A8E A;  3TUP A;  2C8M A;  2DQ3 A;  1QF6 A;  1WU7 A;  1EVL A;  1BIB A;  4P3P A;  2I4M A;  4TVW A;  2ODR C;  2RHQ A;  2QHT A;  2ALY A;  2EJF A;  4P3N A;  3P8Y A;  1IL2 A;  4XU1 A;  4Q15 A;  4J15 A;  3E9H A;  4P75 A;  4TTV A;  1EOV A;  1BIA A;  4P74 A;  4YRC A;  4RQE A;  4YRJ A;  4X5O A;  3HTZ A;  3IG2 A;  5ELN A;  1PYS A;  1USY A;  4YCW A;  4UP7 A;  11AS A;  3A5Y A;  3E9I A;  3UFG A;  4H02 A;  3TEH A;  5K1X A;  3HRK A;  3QO7 A;  3REX A;  2C7I A;  3HY0 A;  1WQ7 A;  1SER A;  1HXD A;  1L0W A;  3L4G B;  4KR2 A;  1NJ6 A;  2CJ9 A;  2ZIM A;  2PMF A;  4YRT A;  3VBB A;  4YCV A;  3PCO B;  4HVC A;  2DZ9 A;  4L87 A;  4DPG A;  3A7U A;  3HFZ B;  3MF2 A;  1SRY A;  4H2Y A;  2DTH A;  3DSQ A;  2RHS B;  4P75 C;  1E22 A;  4XTW A;  1NJ5 A;  4P74 C;  5F5W A;  2DJZ A;  3RKY A;  1JJC A;  3V7C A;  1NNH A;  2E41 A;  4ZTU B;  2ZR3 A;  3RUX A;  2ZT7 A;  3HXU A;  4YDQ A;  1EIY B;  1USY C;  3W3S A;  4RQF A;  2ZNJ A;  1NJ8 A;  1X2G A;  1B7Y A;  1ATI A;  3RAC A;  5C51 B;  3UH0 A;  4YRI A;  1W66 A;  4RMF A;  5E3I A;  4K87 A;  2ODR D;  4K86 A;  2EAY A;  4P72 C;  1KMN A;  3NEN A;  2EL9 A;  2EJ9 A;  4TQD A;  2J3L A;  2DTO A;  2ZNI A;  1B70 A;  3HRI A;  1EFW A;  1EQR A;  4YRP A;  1H4T A;  3A32 A;  1FYF A;  3VQY A;  2Q5H A;  3QO8 A;  1RIQ A;  4ZIB A;  1JJC B;  2ZXF A;  2ARS A;  2I4O A;  2I4N A;  1GGM A;  3M4Q A;  1B7Y B;  3M4P A;  4YRG A;  3A7A A;  3TEG A;  1ADJ A;  4CS4 A;  2CIM A;  2DU7 A;  4TVA A;  2ZR2 A;  4ZTZ B;  1Z7M A;  4LVJ A;  12AS A;  2E5A A;  3IKL A;  4XU0 A;  3PZC A;  2I4L A;  4KR3 A;  1N9W A;  3REU A;  3P8T A;  1X56 A;  2PME A;  1G5H A;  3LC0 A;  4LVM A;  2P0L A;  4CH5 A;  4LVI A;  4LVK A;  2E1H A;  1E1T A;  4YRS A;  2IY5 A;  1H4V B;  2ZCE A;  4YRM A;  5ELO A;  1ADY A;  4TWA A;  3ERR A;  2E64 A;  1EVK A;  1NJ2 A;  2ZZG A;  4XU2 A;  3A7R A;  1BBW A;  4UPA A;  2AMC A;  4PHC A;  3UGT A;  2AKW A;  4P72 A;  5KNN A;  4WJ3 M;  1SES A;  4H2X A;  1J5W A;  1WQW A;  2ZIO A;  4XTY A;  2QHU A;  4TVY A;  2DEQ A;  3P8V A;  3IKM B;  2RHQ B;  4H2U A;  1NJ1 A;  4P3O A;  4DQ2 A;  2ALY B;  4WF2 A;  1BBU A;  2CJA A;  4YRL A;  2EJG A;  3A5Z A;  4WJ4 A;  3UGQ A;  4H2S A;  4CS2 A;  2ZZE A;  3I7F A;  3A74 A;  2QHS A;  4HA8 A;  3HY1 A;  4LVL A;  2DU5 A;  1PYS B;  4WI1 A;  3HFV A;  1KOG A;  3VQV A;  4HWO A;  2FYK A;  4HWR A;  1SET A;  4G84 A;  3EFS A;  4HWS A;  2ZT6 A;  4P71 C;  3TEH B;  4CH3 A;  1YFR A;  1HTT A;  3RGL A;  3RKX A;  2AKW B;  4TQF A;  1G5I A;  2Q7E A;  3V8J A;  4YRK A;  2EWN A;  2DXU A;  2DKG A;  3V7S A;  3HXX A;  4XEM A;  4AH6 A;  4H2X B;  2XTI A;  1X2H A;  3ICA A;  4Q6G A;  3QO5 A;  4E51 A;  4YRR A;  2Q7G A;  2ARU A;  5K1P A;  3VQW A;  3HXZ A;  3MQZ A;  3R07 A;  2Q5I A;  3FJP A;  1WYD A;  4YRF A;  4YRQ A;  1E24 A;  3MF1 A;  4OLF A;  1WLE A;  4NCX A;  3RKW A;  4O2D A;  3LSS A;  1E1O A;  4EX5 A;  3MEY A;  3WQZ A;  2ZT5 A;  4G85 A;  2DZC A;  4YRO A;  3V7R A;  3L1A A;  4XEO A;  1X55 A;  2J3M A;  3NEL A;  3L4G A;  2E10 A;  3LSQ A;  1YFS A;  3V8K A;  3PCO A;  1B70 B;  1ASY A;  2ZTG A;  3QTC A;  4UP8 A;  3HFZ A;  1YFT A;  2RHS A;  2CJB A;  4BWA A;  4YPF A;  1WPY A;  4YCU A;  1Z7N A;  4LNS A;  4P71 A;  1EIY A;  4HWP A;  4XU3 A;  4HWT A;  1H4S A;  4YRE A;  1QE0 A;  4H2V A;  1VQZ A;  4CS3 A;  1C0A A;  4TVA B;  2Q7H A;  5HGQ A;  5C52 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...