4P72C

Phers in complex with compound 2a
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
249
structure length
235
Chain Sequence
ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
molecule keywords Phenylalanine--tRNA ligase beta subunit
total genus 68
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p72C01
1X2HA 2IY5A 1X54A 3QO8A 4UP9A 1USYC 3HFZA 3RKXA 2RHQB 1B7YB 5C52B 3NEMA 2AKWA 4HA8A 4ZTZB 1BBUA 4XU3A 4H2TA 3UFGA 2G4CA 3VQWA 2E5AA 3TEHA 4P73A 2EJGA 4YCVA 1G51A 2ALYB 4XEOA 3HRIA 4OP0A 2QHVA 4K86A 1KOGA 2DDZA 4TVYA 3P8TA 1YFSA 2ZXFA 3HXZA 4YRIA 4UP8A 1E1TA 2RHSA 3LC0A 2ZGWA 3RGLA 1VQZA 3ERRA 2I4MA 1QF6A 2E41A 4H2WA 2EWNA 2PMFA 12ASA 3ICAA 2DU5A 3HY0A 1IL2A 3CMQA 1B76A 1BIBA 2RHSB 3HFZB 2E10A 3MF1A 4P74A 4XTZA 1FYFA 3A5ZA 2DZCA 4Q6GA 2ZR2A 4H2UA 3WQZA 2I4NA 3RL6A 4EO4A 1X55A 1RIQA 3TEGA 3A7UA 4YRJA 1E1OA 1NJ6A 4RQFA 2DTIA 2DTOA 4P75C 1KMNA 1SRYA 4Q15A 3DSQA 5HGQA 4YRLA 3L4GB 3EFSA 2HNIA 4HWOA 1Z7NA 2ZTGA 3HRKA 4BW9A 1EQRA 2QHUA 3IKMB 5ELOA 4UP7A 1C0AA 4YP0A 1HXDA 4UPAA 3A7RA 3L4GA 3IG2A 3HXWA 4XU2A 5C51B 3RUXA 3RKWA 1B70B 4G85A 4YRGA 1H4QA 1H4SA 1WNLA 2QHTA 4YRQA 1G5HA 3MF2A 2E64A 2ZZEA 4XTXA 3RKYA 4YRCA 2DQ0A 4P3OA 3V8JA 4YYEA 2Q5HA 2AKWB 2ZIOA 4PG3A 1BIAA 1PYSB 1YFRA 3EFRA 1QE0A 4XTVA 4XEMA 4LNSA 4CS2A 2DXTA 3LSQA 4BWAA 3I7FA 1EOVA 3HXVA 2ALYA 1B7YA 4WJ4A 4RQEA 4K87A 4H02A 1EIYA 3A5YA 4TTVA 5KNNA 4P75A 3W3SA 3BFMA 4YRPA 1ATIA 2ZT6A 1J5WA 4P72A 2QHSA 3E9HA 3PCOA 2I4OA 2J3LA 1ADJA 4X5OA 3IKLA 3KFUA 4P74C 3A7AA 2XGTA 1PYSA 2E65A 4NCXA 3REUA 4YROA 3HXXA 2E3CA 4TQDA 3HTZA 1B8AA 1N9WA 3P8VA 4P3NA 2DZ9A 3VBBA 4DQ2A 2Q5IA 1Z7MA 3NENA 3UH0A 3QTCA 1H4VB 2ZZGA 3QNEA 4HWTA 4XTYA 2EJ9A 3HXYA 4HWRA 1WLEA 2I4LA 1ASZA 5K1PA 1NJ1A 3G1ZA 3LSSA 2CGHA 4XTUA 4CS4A 1NJ8A 3V7RA 2C7IA 1WU7A 1KMMA 4XU0A 1NJ5A 4H2VA 2EJFA 1X56A 3M4PA 1L0WA 1JJCB 4K88A 2EL9A 2ZINA 4YRFA 4CH3A 2AMCB 1YB3A 3A32A 4TVWA 2CJAA 3E9IA 3PCOB 2CIMA 5E3IA 3HXUA 1B70A 4H2SA 4YRRA 3V8LA 2DKGA 4YREA 2ODRD 4CS3A 4L87A 4TVAA 1YFTA 2ZR3A 3NELA 3MEYA 3V8KA 2PMEA 1EIYB 3M4QA 2ZT5A 2P0LA 4KR2A 1LYLA 1X2GA 4EX5A 2ZIMA 3FJPA 4O2DA 1NJ2A 1NYRA 4H2XA 1E24A 2DXUA 4KR3A 1WPYA 4WJ3M 2XTIA 3TEHB 3QO7A 3QO5A 1WQWA 2ZT7A 4HVCA 3OD1A 4YPFA 3A31A 1X01A 4CH5A 4P73C 3IALA 1YGBA 1G5IA 4KQEA 4HWPA 4YRTA 3UGTA 4ZTUB 1E22A 3PZCA 2DVEA 1NNHA 2ARUA 11ASA 1SESA 2Q7EA 4YCWA 3VQVA 1HTTA 5K1XA 4WF2A 3VQXA 2ZNJA 3UGQA 1USYA 4TWAA 3HY1A 4P71C 4P3PA 3R07A 2CJBA 3L2ZA 4DPGA 4RDXA 1WYDA 4WI1A 4H2XB 4XU1A 2P5IA 4OLFA 1W66A 1ADYA 2IY5B 2ZZFA 4YDQA 4ZIBA 2E1HA 4YRNA 2AMCA 4XTWA 4PHCA 3V7CA 1HC7A 4CH4A 3HFVA 3P8YA 2Q7HA 2EAYA 2DJZA 2DEQA 3RF1A 1H4TA 4AH6A 4J15A 4RMFA 3V7SA 2ZT8A 1EVLA 3A74A 3BJUA 4YCUA 1NYQA 3REXA 4HWSA 2C8MA 4YRSA 3VQYA 5F5WA 1EFWA 2DQ3A 4YRMA 2DTHA 2ODRC 4YRKA 3TUPA 3NETA 2ARTA 1SETA 3RACA 3RIRA 2FYKA 1ASYA 1BBWA 2Q7GA 2ZCEA 4TQFA 4H2YA 4CH6A 2ARSA 1SERA 2RHQA 2DU7A 2J3MA 4TVAB 1GGMA 4G84A 5ELNA 1WQ7A 1EVKA 4P72C 4E51A 3L1AA 2ZNIA 2CJ9A 1JJCA 4P71A 5C53B
chains in the Genus database with same CATH superfamily
1X2HA 2IY5A 1X54A 3QO8A 4UP9A 1USYC 3HFZA 3RKXA 2RHQB 1B7YB 5C52B 3NEMA 2AKWA 4HA8A 4ZTZB 1BBUA 4XU3A 4H2TA 3UFGA 2G4CA 3VQWA 2E5AA 3TEHA 4P73A 2EJGA 4YCVA 4LVMA 1G51A 2ALYB 4XEOA 3HRIA 4OP0A 2QHVA 4K86A 1KOGA 2DDZA 4TVYA 3P8TA 1YFSA 2ZXFA 3HXZA 4YRIA 4UP8A 1E1TA 2RHSA 3LC0A 2ZGWA 3RGLA 1VQZA 3ERRA 2I4MA 1QF6A 2E41A 4H2WA 2EWNA 2PMFA 12ASA 3ICAA 2DU5A 3HY0A 1IL2A 3CMQA 1B76A 1BIBA 2RHSB 3HFZB 2E10A 3MF1A 4P74A 4XTZA 1FYFA 3A5ZA 2DZCA 4Q6GA 4LVKA 2ZR2A 4H2UA 3WQZA 2I4NA 3RL6A 4EO4A 1X55A 1RIQA 3TEGA 3A7UA 4YRJA 1E1OA 1NJ6A 4RQFA 2DTIA 2DTOA 4P75C 1KMNA 1SRYA 4Q15A 3DSQA 5HGQA 4YRLA 3L4GB 3EFSA 2HNIA 4HWOA 1Z7NA 2ZTGA 3HRKA 4BW9A 1EQRA 2QHUA 3IKMB 5ELOA 4UP7A 1C0AA 4YP0A 1HXDA 4UPAA 3A7RA 3L4GA 3IG2A 3HXWA 4XU2A 5C51B 3RUXA 3RKWA 1B70B 4G85A 4YRGA 1H4QA 1H4SA 1WNLA 2QHTA 4YRQA 1G5HA 3MF2A 2E64A 2ZZEA 4XTXA 3RKYA 4YRCA 2DQ0A 4P3OA 3V8JA 4YYEA 2Q5HA 2AKWB 2ZIOA 4PG3A 1BIAA 1PYSB 1YFRA 3EFRA 1QE0A 4XTVA 2A8EA 4XEMA 4LNSA 4CS2A 2DXTA 3LSQA 4BWAA 3I7FA 1EOVA 3HXVA 2ALYA 1B7YA 4WJ4A 4RQEA 4K87A 4H02A 1EIYA 3A5YA 4TTVA 5KNNA 4P75A 3W3SA 3BFMA 4YRPA 1ATIA 2ZT6A 1J5WA 2NS6A 4P72A 2QHSA 3E9HA 3PCOA 2I4OA 2J3LA 1ADJA 4X5OA 3IKLA 3KFUA 4P74C 3A7AA 2XGTA 1PYSA 2E65A 4NCXA 3REUA 4YROA 3HXXA 2E3CA 4TQDA 3HTZA 1B8AA 1N9WA 3P8VA 4P3NA 2DZ9A 3VBBA 4DQ2A 2Q5IA 1Z7MA 3NENA 3UH0A 3QTCA 1H4VB 2ZZGA 3QNEA 4HWTA 4XTYA 2EJ9A 3HXYA 4HWRA 1WLEA 2I4LA 1ASZA 3MQZA 5K1PA 1NJ1A 3G1ZA 3LSSA 4HT4A 2CGHA 4XTUA 4CS4A 1NJ8A 3V7RA 2C7IA 1WU7A 1KMMA 4XU0A 1NJ5A 4H2VA 2EJFA 1X56A 3M4PA 1L0WA 1JJCB 4K88A 2EL9A 2ZINA 4YRFA 4CH3A 2AMCB 1YB3A 3A32A 4TVWA 2CJAA 3E9IA 4LVJA 3PCOB 2CIMA 5E3IA 3HXUA 1B70A 4H2SA 4YRRA 3V8LA 2DKGA 4YREA 2ODRD 4CS3A 4L87A 4TVAA 1YFTA 2ZR3A 3NELA 3MEYA 3V8KA 2PMEA 1EIYB 3M4QA 2ZT5A 2P0LA 4KR2A 1LYLA 1X2GA 4EX5A 2ZIMA 3FJPA 4O2DA 1NJ2A 1NYRA 4H2XA 1E24A 2DXUA 4KR3A 1WPYA 4WJ3M 2XTIA 3TEHB 3QO7A 3QO5A 1WQWA 2ZT7A 4HVCA 3OD1A 4YPFA 3A31A 1X01A 4CH5A 4P73C 3IALA 1YGBA 1G5IA 4KQEA 4HWPA 4YRTA 3UGTA 4ZTUB 1E22A 3PZCA 2DVEA 1NNHA 2ARUA 11ASA 1SESA 2Q7EA 4YCWA 3VQVA 1HTTA 5K1XA 4WF2A 3VQXA 2ZNJA 3UGQA 1USYA 4TWAA 3HY1A 4P71C 4P3PA 3R07A 2CJBA 3L2ZA 4DPGA 4RDXA 1WYDA 4WI1A 4LVIA 4H2XB 4XU1A 2P5IA 4OLFA 1W66A 1ADYA 2IY5B 2ZZFA 4YDQA 4ZIBA 2E1HA 4YRNA 2AMCA 4XTWA 4PHCA 3V7CA 1HC7A 4CH4A 3HFVA 3P8YA 2Q7HA 2EAYA 2DJZA 2DEQA 3RF1A 1H4TA 4AH6A 4J15A 4RMFA 3V7SA 2ZT8A 1EVLA 3A74A 3BJUA 4YCUA 1NYQA 3REXA 4HWSA 2C8MA 4YRSA 3VQYA 5F5WA 1EFWA 2DQ3A 4YRMA 2DTHA 2ODRC 4YRKA 3TUPA 3NETA 2ARTA 1SETA 4LVLA 3RACA 3RIRA 2FYKA 1ASYA 1BBWA 2Q7GA 2ZCEA 4TQFA 4H2YA 4CH6A 2ARSA 1SERA 2RHQA 2DU7A 2J3MA 4TVAB 1GGMA 4G84A 5ELNA 1WQ7A 1EVKA 4P72C 4E51A 3L1AA 2ZNIA 2CJ9A 1JJCA 4P71A 5C53B
chains in the Genus database with same CATH topology
1X2HA 2IY5A 1X54A 3QO8A 4UP9A 1USYC 3HFZA 3RKXA 2RHQB 1B7YB 5C52B 3NEMA 2AKWA 4HA8A 4ZTZB 1BBUA 4XU3A 4H2TA 3UFGA 2G4CA 3VQWA 2E5AA 3TEHA 4P73A 2EJGA 4YCVA 4LVMA 1G51A 2ALYB 4XEOA 3HRIA 4OP0A 2QHVA 4K86A 1KOGA 2DDZA 4TVYA 3P8TA 1YFSA 2ZXFA 3HXZA 4YRIA 4UP8A 1E1TA 2RHSA 3LC0A 2ZGWA 3RGLA 1VQZA 3ERRA 2I4MA 1QF6A 2E41A 4H2WA 2EWNA 2PMFA 12ASA 3ICAA 2DU5A 3HY0A 1IL2A 3CMQA 1B76A 1BIBA 2RHSB 3HFZB 2E10A 3MF1A 4P74A 4XTZA 1FYFA 3A5ZA 2DZCA 4Q6GA 4LVKA 2ZR2A 4H2UA 3WQZA 2I4NA 3RL6A 4EO4A 1X55A 1RIQA 3TEGA 3A7UA 4YRJA 1E1OA 1NJ6A 4RQFA 2DTIA 2DTOA 4P75C 1KMNA 1SRYA 4Q15A 3DSQA 5HGQA 4YRLA 3L4GB 3EFSA 2HNIA 4HWOA 1Z7NA 2ZTGA 3HRKA 4BW9A 1EQRA 2QHUA 3IKMB 5ELOA 4UP7A 1C0AA 4YP0A 1HXDA 4UPAA 3A7RA 3L4GA 3IG2A 3HXWA 4XU2A 5C51B 3RUXA 3RKWA 1B70B 4G85A 4YRGA 1H4QA 1H4SA 1WNLA 2QHTA 4YRQA 1G5HA 3MF2A 2E64A 2ZZEA 4XTXA 3RKYA 4YRCA 2DQ0A 4P3OA 3V8JA 4YYEA 2Q5HA 2AKWB 2ZIOA 4PG3A 1BIAA 1PYSB 1YFRA 3EFRA 1QE0A 4XTVA 2A8EA 4XEMA 4LNSA 4CS2A 2DXTA 3LSQA 4BWAA 3I7FA 1EOVA 3HXVA 2ALYA 1B7YA 4WJ4A 4RQEA 4K87A 4H02A 1EIYA 3A5YA 4TTVA 5KNNA 4P75A 3W3SA 3BFMA 4YRPA 1ATIA 2ZT6A 1J5WA 2NS6A 4P72A 2QHSA 3E9HA 3PCOA 2I4OA 2J3LA 1ADJA 4X5OA 3IKLA 3KFUA 4P74C 3A7AA 2XGTA 1PYSA 2E65A 4NCXA 3REUA 4YROA 3HXXA 2E3CA 4TQDA 3HTZA 1B8AA 1N9WA 3P8VA 4P3NA 2DZ9A 3VBBA 4DQ2A 2Q5IA 1Z7MA 3NENA 3UH0A 3QTCA 1H4VB 2ZZGA 3QNEA 4HWTA 4XTYA 2EJ9A 3HXYA 4HWRA 1WLEA 2I4LA 1ASZA 3MQZA 5K1PA 1NJ1A 3G1ZA 3LSSA 4HT4A 2CGHA 4XTUA 4CS4A 1NJ8A 3V7RA 2C7IA 1WU7A 1KMMA 4XU0A 1NJ5A 4H2VA 2EJFA 1X56A 3M4PA 1L0WA 1JJCB 4K88A 2EL9A 2ZINA 4YRFA 4CH3A 2AMCB 1YB3A 3A32A 4TVWA 2CJAA 3E9IA 4LVJA 3PCOB 2CIMA 5E3IA 3HXUA 1B70A 4H2SA 4YRRA 3V8LA 2DKGA 4YREA 2ODRD 4CS3A 4L87A 4TVAA 1YFTA 2ZR3A 3NELA 3MEYA 3V8KA 2PMEA 1EIYB 3M4QA 2ZT5A 2P0LA 4KR2A 1LYLA 1X2GA 4EX5A 2ZIMA 3FJPA 4O2DA 1NJ2A 1NYRA 4H2XA 1E24A 2DXUA 4KR3A 1WPYA 4WJ3M 2XTIA 3TEHB 3QO7A 3QO5A 1WQWA 2ZT7A 4HVCA 3OD1A 4YPFA 3A31A 1X01A 4CH5A 4P73C 3IALA 1YGBA 1G5IA 4KQEA 4HWPA 4YRTA 3UGTA 4ZTUB 1E22A 3PZCA 2DVEA 1NNHA 2ARUA 11ASA 1SESA 2Q7EA 4YCWA 3VQVA 1HTTA 5K1XA 4WF2A 3VQXA 2ZNJA 3UGQA 1USYA 4TWAA 3HY1A 4P71C 4P3PA 3R07A 2CJBA 3L2ZA 4DPGA 4RDXA 1WYDA 4WI1A 4LVIA 4H2XB 4XU1A 2P5IA 4OLFA 1W66A 1ADYA 2IY5B 2ZZFA 4YDQA 4ZIBA 2E1HA 4YRNA 2AMCA 4XTWA 4PHCA 3V7CA 1HC7A 4CH4A 3HFVA 3P8YA 2Q7HA 2EAYA 2DJZA 2DEQA 3RF1A 1H4TA 4AH6A 4J15A 4RMFA 3V7SA 2ZT8A 1EVLA 3A74A 3BJUA 4YCUA 1NYQA 3REXA 4HWSA 2C8MA 4YRSA 3VQYA 5F5WA 1EFWA 2DQ3A 4YRMA 2DTHA 2ODRC 4YRKA 3TUPA 3NETA 2ARTA 1SETA 4LVLA 3RACA 3RIRA 2FYKA 1ASYA 1BBWA 2Q7GA 2ZCEA 4TQFA 4H2YA 4CH6A 2ARSA 1SERA 2RHQA 2DU7A 2J3MA 4TVAB 1GGMA 4G84A 5ELNA 1WQ7A 1EVKA 4P72C 4E51A 3L1AA 2ZNIA 2CJ9A 1JJCA 4P71A 5C53B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2H A;  2IY5 A;  1X54 A;  3QO8 A;  4UP9 A;  1USY C;  3HFZ A;  3RKX A;  2RHQ B;  1B7Y B;  5C52 B;  3NEM A;  2AKW A;  4HA8 A;  4ZTZ B;  1BBU A;  4XU3 A;  4H2T A;  3UFG A;  2G4C A;  3VQW A;  2E5A A;  3TEH A;  4P73 A;  2EJG A;  4YCV A;  1G51 A;  2ALY B;  4XEO A;  3HRI A;  4OP0 A;  2QHV A;  4K86 A;  1KOG A;  2DDZ A;  4TVY A;  3P8T A;  1YFS A;  2ZXF A;  3HXZ A;  4YRI A;  4UP8 A;  1E1T A;  2RHS A;  3LC0 A;  2ZGW A;  3RGL A;  1VQZ A;  3ERR A;  2I4M A;  1QF6 A;  2E41 A;  4H2W A;  2EWN A;  2PMF A;  12AS A;  3ICA A;  2DU5 A;  3HY0 A;  1IL2 A;  3CMQ A;  1B76 A;  1BIB A;  2RHS B;  3HFZ B;  2E10 A;  3MF1 A;  4P74 A;  4XTZ A;  1FYF A;  3A5Z A;  2DZC A;  4Q6G A;  2ZR2 A;  4H2U A;  3WQZ A;  2I4N A;  3RL6 A;  4EO4 A;  1X55 A;  1RIQ A;  3TEG A;  3A7U A;  4YRJ A;  1E1O A;  1NJ6 A;  4RQF A;  2DTI A;  2DTO A;  4P75 C;  1KMN A;  1SRY A;  4Q15 A;  3DSQ A;  5HGQ A;  4YRL A;  3L4G B;  3EFS A;  2HNI A;  4HWO A;  1Z7N A;  2ZTG A;  3HRK A;  4BW9 A;  1EQR A;  2QHU A;  3IKM B;  5ELO A;  4UP7 A;  1C0A A;  4YP0 A;  1HXD A;  4UPA A;  3A7R A;  3L4G A;  3IG2 A;  3HXW A;  4XU2 A;  5C51 B;  3RUX A;  3RKW A;  1B70 B;  4G85 A;  4YRG A;  1H4Q A;  1H4S A;  1WNL A;  2QHT A;  4YRQ A;  1G5H A;  3MF2 A;  2E64 A;  2ZZE A;  4XTX A;  3RKY A;  4YRC A;  2DQ0 A;  4P3O A;  3V8J A;  4YYE A;  2Q5H A;  2AKW B;  2ZIO A;  4PG3 A;  1BIA A;  1PYS B;  1YFR A;  3EFR A;  1QE0 A;  4XTV A;  4XEM A;  4LNS A;  4CS2 A;  2DXT A;  3LSQ A;  4BWA A;  3I7F A;  1EOV A;  3HXV A;  2ALY A;  1B7Y A;  4WJ4 A;  4RQE A;  4K87 A;  4H02 A;  1EIY A;  3A5Y A;  4TTV A;  5KNN A;  4P75 A;  3W3S A;  3BFM A;  4YRP A;  1ATI A;  2ZT6 A;  1J5W A;  4P72 A;  2QHS A;  3E9H A;  3PCO A;  2I4O A;  2J3L A;  1ADJ A;  4X5O A;  3IKL A;  3KFU A;  4P74 C;  3A7A A;  2XGT A;  1PYS A;  2E65 A;  4NCX A;  3REU A;  4YRO A;  3HXX A;  2E3C A;  4TQD A;  3HTZ A;  1B8A A;  1N9W A;  3P8V A;  4P3N A;  2DZ9 A;  3VBB A;  4DQ2 A;  2Q5I A;  1Z7M A;  3NEN A;  3UH0 A;  3QTC A;  1H4V B;  2ZZG A;  3QNE A;  4HWT A;  4XTY A;  2EJ9 A;  3HXY A;  4HWR A;  1WLE A;  2I4L A;  1ASZ A;  5K1P A;  1NJ1 A;  3G1Z A;  3LSS A;  2CGH A;  4XTU A;  4CS4 A;  1NJ8 A;  3V7R A;  2C7I A;  1WU7 A;  1KMM A;  4XU0 A;  1NJ5 A;  4H2V A;  2EJF A;  1X56 A;  3M4P A;  1L0W A;  1JJC B;  4K88 A;  2EL9 A;  2ZIN A;  4YRF A;  4CH3 A;  2AMC B;  1YB3 A;  3A32 A;  4TVW A;  2CJA A;  3E9I A;  3PCO B;  2CIM A;  5E3I A;  3HXU A;  1B70 A;  4H2S A;  4YRR A;  3V8L A;  2DKG A;  4YRE A;  2ODR D;  4CS3 A;  4L87 A;  4TVA A;  1YFT A;  2ZR3 A;  3NEL A;  3MEY A;  3V8K A;  2PME A;  1EIY B;  3M4Q A;  2ZT5 A;  2P0L A;  4KR2 A;  1LYL A;  1X2G A;  4EX5 A;  2ZIM A;  3FJP A;  4O2D A;  1NJ2 A;  1NYR A;  4H2X A;  1E24 A;  2DXU A;  4KR3 A;  1WPY A;  4WJ3 M;  2XTI A;  3TEH B;  3QO7 A;  3QO5 A;  1WQW A;  2ZT7 A;  4HVC A;  3OD1 A;  4YPF A;  3A31 A;  1X01 A;  4CH5 A;  4P73 C;  3IAL A;  1YGB A;  1G5I A;  4KQE A;  4HWP A;  4YRT A;  3UGT A;  4ZTU B;  1E22 A;  3PZC A;  2DVE A;  1NNH A;  2ARU A;  11AS A;  1SES A;  2Q7E A;  4YCW A;  3VQV A;  1HTT A;  5K1X A;  4WF2 A;  3VQX A;  2ZNJ A;  3UGQ A;  1USY A;  4TWA A;  3HY1 A;  4P71 C;  4P3P A;  3R07 A;  2CJB A;  3L2Z A;  4DPG A;  4RDX A;  1WYD A;  4WI1 A;  4H2X B;  4XU1 A;  2P5I A;  4OLF A;  1W66 A;  1ADY A;  2IY5 B;  2ZZF A;  4YDQ A;  4ZIB A;  2E1H A;  4YRN A;  2AMC A;  4XTW A;  4PHC A;  3V7C A;  1HC7 A;  4CH4 A;  3HFV A;  3P8Y A;  2Q7H A;  2EAY A;  2DJZ A;  2DEQ A;  3RF1 A;  1H4T A;  4AH6 A;  4J15 A;  4RMF A;  3V7S A;  2ZT8 A;  1EVL A;  3A74 A;  3BJU A;  4YCU A;  1NYQ A;  3REX A;  4HWS A;  2C8M A;  4YRS A;  3VQY A;  5F5W A;  1EFW A;  2DQ3 A;  4YRM A;  2DTH A;  2ODR C;  4YRK A;  3TUP A;  3NET A;  2ART A;  1SET A;  3RAC A;  3RIR A;  2FYK A;  1ASY A;  1BBW A;  2Q7G A;  2ZCE A;  4TQF A;  4H2Y A;  4CH6 A;  2ARS A;  1SER A;  2RHQ A;  2DU7 A;  2J3M A;  4TVA B;  1GGM A;  4G84 A;  5ELN A;  1WQ7 A;  1EVK A;  4P72 C;  4E51 A;  3L1A A;  2ZNI A;  2CJ9 A;  1JJC A;  4P71 A;  5C53 B; 
#chains in the Genus database with same CATH topology
 1X2H A;  2IY5 A;  1X54 A;  3QO8 A;  4UP9 A;  1USY C;  3HFZ A;  3RKX A;  2RHQ B;  1B7Y B;  5C52 B;  3NEM A;  2AKW A;  4HA8 A;  4ZTZ B;  1BBU A;  4XU3 A;  4H2T A;  3UFG A;  2G4C A;  3VQW A;  2E5A A;  3TEH A;  4P73 A;  2EJG A;  4YCV A;  4LVM A;  1G51 A;  2ALY B;  4XEO A;  3HRI A;  4OP0 A;  2QHV A;  4K86 A;  1KOG A;  2DDZ A;  4TVY A;  3P8T A;  1YFS A;  2ZXF A;  3HXZ A;  4YRI A;  4UP8 A;  1E1T A;  2RHS A;  3LC0 A;  2ZGW A;  3RGL A;  1VQZ A;  3ERR A;  2I4M A;  1QF6 A;  2E41 A;  4H2W A;  2EWN A;  2PMF A;  12AS A;  3ICA A;  2DU5 A;  3HY0 A;  1IL2 A;  3CMQ A;  1B76 A;  1BIB A;  2RHS B;  3HFZ B;  2E10 A;  3MF1 A;  4P74 A;  4XTZ A;  1FYF A;  3A5Z A;  2DZC A;  4Q6G A;  4LVK A;  2ZR2 A;  4H2U A;  3WQZ A;  2I4N A;  3RL6 A;  4EO4 A;  1X55 A;  1RIQ A;  3TEG A;  3A7U A;  4YRJ A;  1E1O A;  1NJ6 A;  4RQF A;  2DTI A;  2DTO A;  4P75 C;  1KMN A;  1SRY A;  4Q15 A;  3DSQ A;  5HGQ A;  4YRL A;  3L4G B;  3EFS A;  2HNI A;  4HWO A;  1Z7N A;  2ZTG A;  3HRK A;  4BW9 A;  1EQR A;  2QHU A;  3IKM B;  5ELO A;  4UP7 A;  1C0A A;  4YP0 A;  1HXD A;  4UPA A;  3A7R A;  3L4G A;  3IG2 A;  3HXW A;  4XU2 A;  5C51 B;  3RUX A;  3RKW A;  1B70 B;  4G85 A;  4YRG A;  1H4Q A;  1H4S A;  1WNL A;  2QHT A;  4YRQ A;  1G5H A;  3MF2 A;  2E64 A;  2ZZE A;  4XTX A;  3RKY A;  4YRC A;  2DQ0 A;  4P3O A;  3V8J A;  4YYE A;  2Q5H A;  2AKW B;  2ZIO A;  4PG3 A;  1BIA A;  1PYS B;  1YFR A;  3EFR A;  1QE0 A;  4XTV A;  2A8E A;  4XEM A;  4LNS A;  4CS2 A;  2DXT A;  3LSQ A;  4BWA A;  3I7F A;  1EOV A;  3HXV A;  2ALY A;  1B7Y A;  4WJ4 A;  4RQE A;  4K87 A;  4H02 A;  1EIY A;  3A5Y A;  4TTV A;  5KNN A;  4P75 A;  3W3S A;  3BFM A;  4YRP A;  1ATI A;  2ZT6 A;  1J5W A;  2NS6 A;  4P72 A;  2QHS A;  3E9H A;  3PCO A;  2I4O A;  2J3L A;  1ADJ A;  4X5O A;  3IKL A;  3KFU A;  4P74 C;  3A7A A;  2XGT A;  1PYS A;  2E65 A;  4NCX A;  3REU A;  4YRO A;  3HXX A;  2E3C A;  4TQD A;  3HTZ A;  1B8A A;  1N9W A;  3P8V A;  4P3N A;  2DZ9 A;  3VBB A;  4DQ2 A;  2Q5I A;  1Z7M A;  3NEN A;  3UH0 A;  3QTC A;  1H4V B;  2ZZG A;  3QNE A;  4HWT A;  4XTY A;  2EJ9 A;  3HXY A;  4HWR A;  1WLE A;  2I4L A;  1ASZ A;  3MQZ A;  5K1P A;  1NJ1 A;  3G1Z A;  3LSS A;  4HT4 A;  2CGH A;  4XTU A;  4CS4 A;  1NJ8 A;  3V7R A;  2C7I A;  1WU7 A;  1KMM A;  4XU0 A;  1NJ5 A;  4H2V A;  2EJF A;  1X56 A;  3M4P A;  1L0W A;  1JJC B;  4K88 A;  2EL9 A;  2ZIN A;  4YRF A;  4CH3 A;  2AMC B;  1YB3 A;  3A32 A;  4TVW A;  2CJA A;  3E9I A;  4LVJ A;  3PCO B;  2CIM A;  5E3I A;  3HXU A;  1B70 A;  4H2S A;  4YRR A;  3V8L A;  2DKG A;  4YRE A;  2ODR D;  4CS3 A;  4L87 A;  4TVA A;  1YFT A;  2ZR3 A;  3NEL A;  3MEY A;  3V8K A;  2PME A;  1EIY B;  3M4Q A;  2ZT5 A;  2P0L A;  4KR2 A;  1LYL A;  1X2G A;  4EX5 A;  2ZIM A;  3FJP A;  4O2D A;  1NJ2 A;  1NYR A;  4H2X A;  1E24 A;  2DXU A;  4KR3 A;  1WPY A;  4WJ3 M;  2XTI A;  3TEH B;  3QO7 A;  3QO5 A;  1WQW A;  2ZT7 A;  4HVC A;  3OD1 A;  4YPF A;  3A31 A;  1X01 A;  4CH5 A;  4P73 C;  3IAL A;  1YGB A;  1G5I A;  4KQE A;  4HWP A;  4YRT A;  3UGT A;  4ZTU B;  1E22 A;  3PZC A;  2DVE A;  1NNH A;  2ARU A;  11AS A;  1SES A;  2Q7E A;  4YCW A;  3VQV A;  1HTT A;  5K1X A;  4WF2 A;  3VQX A;  2ZNJ A;  3UGQ A;  1USY A;  4TWA A;  3HY1 A;  4P71 C;  4P3P A;  3R07 A;  2CJB A;  3L2Z A;  4DPG A;  4RDX A;  1WYD A;  4WI1 A;  4LVI A;  4H2X B;  4XU1 A;  2P5I A;  4OLF A;  1W66 A;  1ADY A;  2IY5 B;  2ZZF A;  4YDQ A;  4ZIB A;  2E1H A;  4YRN A;  2AMC A;  4XTW A;  4PHC A;  3V7C A;  1HC7 A;  4CH4 A;  3HFV A;  3P8Y A;  2Q7H A;  2EAY A;  2DJZ A;  2DEQ A;  3RF1 A;  1H4T A;  4AH6 A;  4J15 A;  4RMF A;  3V7S A;  2ZT8 A;  1EVL A;  3A74 A;  3BJU A;  4YCU A;  1NYQ A;  3REX A;  4HWS A;  2C8M A;  4YRS A;  3VQY A;  5F5W A;  1EFW A;  2DQ3 A;  4YRM A;  2DTH A;  2ODR C;  4YRK A;  3TUP A;  3NET A;  2ART A;  1SET A;  4LVL A;  3RAC A;  3RIR A;  2FYK A;  1ASY A;  1BBW A;  2Q7G A;  2ZCE A;  4TQF A;  4H2Y A;  4CH6 A;  2ARS A;  1SER A;  2RHQ A;  2DU7 A;  2J3M A;  4TVA B;  1GGM A;  4G84 A;  5ELN A;  1WQ7 A;  1EVK A;  4P72 C;  4E51 A;  3L1A A;  2ZNI A;  2CJ9 A;  1JJC A;  4P71 A;  5C53 B; 
#chains in the Genus database with same CATH homology
 1X2H A;  2IY5 A;  1X54 A;  3QO8 A;  4UP9 A;  1USY C;  3HFZ A;  3RKX A;  2RHQ B;  1B7Y B;  5C52 B;  3NEM A;  2AKW A;  4HA8 A;  4ZTZ B;  1BBU A;  4XU3 A;  4H2T A;  3UFG A;  2G4C A;  3VQW A;  2E5A A;  3TEH A;  4P73 A;  2EJG A;  4YCV A;  4LVM A;  1G51 A;  2ALY B;  4XEO A;  3HRI A;  4OP0 A;  2QHV A;  4K86 A;  1KOG A;  2DDZ A;  4TVY A;  3P8T A;  1YFS A;  2ZXF A;  3HXZ A;  4YRI A;  4UP8 A;  1E1T A;  2RHS A;  3LC0 A;  2ZGW A;  3RGL A;  1VQZ A;  3ERR A;  2I4M A;  1QF6 A;  2E41 A;  4H2W A;  2EWN A;  2PMF A;  12AS A;  3ICA A;  2DU5 A;  3HY0 A;  1IL2 A;  3CMQ A;  1B76 A;  1BIB A;  2RHS B;  3HFZ B;  2E10 A;  3MF1 A;  4P74 A;  4XTZ A;  1FYF A;  3A5Z A;  2DZC A;  4Q6G A;  4LVK A;  2ZR2 A;  4H2U A;  3WQZ A;  2I4N A;  3RL6 A;  4EO4 A;  1X55 A;  1RIQ A;  3TEG A;  3A7U A;  4YRJ A;  1E1O A;  1NJ6 A;  4RQF A;  2DTI A;  2DTO A;  4P75 C;  1KMN A;  1SRY A;  4Q15 A;  3DSQ A;  5HGQ A;  4YRL A;  3L4G B;  3EFS A;  2HNI A;  4HWO A;  1Z7N A;  2ZTG A;  3HRK A;  4BW9 A;  1EQR A;  2QHU A;  3IKM B;  5ELO A;  4UP7 A;  1C0A A;  4YP0 A;  1HXD A;  4UPA A;  3A7R A;  3L4G A;  3IG2 A;  3HXW A;  4XU2 A;  5C51 B;  3RUX A;  3RKW A;  1B70 B;  4G85 A;  4YRG A;  1H4Q A;  1H4S A;  1WNL A;  2QHT A;  4YRQ A;  1G5H A;  3MF2 A;  2E64 A;  2ZZE A;  4XTX A;  3RKY A;  4YRC A;  2DQ0 A;  4P3O A;  3V8J A;  4YYE A;  2Q5H A;  2AKW B;  2ZIO A;  4PG3 A;  1BIA A;  1PYS B;  1YFR A;  3EFR A;  1QE0 A;  4XTV A;  2A8E A;  4XEM A;  4LNS A;  4CS2 A;  2DXT A;  3LSQ A;  4BWA A;  3I7F A;  1EOV A;  3HXV A;  2ALY A;  1B7Y A;  4WJ4 A;  4RQE A;  4K87 A;  4H02 A;  1EIY A;  3A5Y A;  4TTV A;  5KNN A;  4P75 A;  3W3S A;  3BFM A;  4YRP A;  1ATI A;  2ZT6 A;  1J5W A;  2NS6 A;  4P72 A;  2QHS A;  3E9H A;  3PCO A;  2I4O A;  2J3L A;  1ADJ A;  4X5O A;  3IKL A;  3KFU A;  4P74 C;  3A7A A;  2XGT A;  1PYS A;  2E65 A;  4NCX A;  3REU A;  4YRO A;  3HXX A;  2E3C A;  4TQD A;  3HTZ A;  1B8A A;  1N9W A;  3P8V A;  4P3N A;  2DZ9 A;  3VBB A;  4DQ2 A;  2Q5I A;  1Z7M A;  3NEN A;  3UH0 A;  3QTC A;  1H4V B;  2ZZG A;  3QNE A;  4HWT A;  4XTY A;  2EJ9 A;  3HXY A;  4HWR A;  1WLE A;  2I4L A;  1ASZ A;  3MQZ A;  5K1P A;  1NJ1 A;  3G1Z A;  3LSS A;  4HT4 A;  2CGH A;  4XTU A;  4CS4 A;  1NJ8 A;  3V7R A;  2C7I A;  1WU7 A;  1KMM A;  4XU0 A;  1NJ5 A;  4H2V A;  2EJF A;  1X56 A;  3M4P A;  1L0W A;  1JJC B;  4K88 A;  2EL9 A;  2ZIN A;  4YRF A;  4CH3 A;  2AMC B;  1YB3 A;  3A32 A;  4TVW A;  2CJA A;  3E9I A;  4LVJ A;  3PCO B;  2CIM A;  5E3I A;  3HXU A;  1B70 A;  4H2S A;  4YRR A;  3V8L A;  2DKG A;  4YRE A;  2ODR D;  4CS3 A;  4L87 A;  4TVA A;  1YFT A;  2ZR3 A;  3NEL A;  3MEY A;  3V8K A;  2PME A;  1EIY B;  3M4Q A;  2ZT5 A;  2P0L A;  4KR2 A;  1LYL A;  1X2G A;  4EX5 A;  2ZIM A;  3FJP A;  4O2D A;  1NJ2 A;  1NYR A;  4H2X A;  1E24 A;  2DXU A;  4KR3 A;  1WPY A;  4WJ3 M;  2XTI A;  3TEH B;  3QO7 A;  3QO5 A;  1WQW A;  2ZT7 A;  4HVC A;  3OD1 A;  4YPF A;  3A31 A;  1X01 A;  4CH5 A;  4P73 C;  3IAL A;  1YGB A;  1G5I A;  4KQE A;  4HWP A;  4YRT A;  3UGT A;  4ZTU B;  1E22 A;  3PZC A;  2DVE A;  1NNH A;  2ARU A;  11AS A;  1SES A;  2Q7E A;  4YCW A;  3VQV A;  1HTT A;  5K1X A;  4WF2 A;  3VQX A;  2ZNJ A;  3UGQ A;  1USY A;  4TWA A;  3HY1 A;  4P71 C;  4P3P A;  3R07 A;  2CJB A;  3L2Z A;  4DPG A;  4RDX A;  1WYD A;  4WI1 A;  4LVI A;  4H2X B;  4XU1 A;  2P5I A;  4OLF A;  1W66 A;  1ADY A;  2IY5 B;  2ZZF A;  4YDQ A;  4ZIB A;  2E1H A;  4YRN A;  2AMC A;  4XTW A;  4PHC A;  3V7C A;  1HC7 A;  4CH4 A;  3HFV A;  3P8Y A;  2Q7H A;  2EAY A;  2DJZ A;  2DEQ A;  3RF1 A;  1H4T A;  4AH6 A;  4J15 A;  4RMF A;  3V7S A;  2ZT8 A;  1EVL A;  3A74 A;  3BJU A;  4YCU A;  1NYQ A;  3REX A;  4HWS A;  2C8M A;  4YRS A;  3VQY A;  5F5W A;  1EFW A;  2DQ3 A;  4YRM A;  2DTH A;  2ODR C;  4YRK A;  3TUP A;  3NET A;  2ART A;  1SET A;  4LVL A;  3RAC A;  3RIR A;  2FYK A;  1ASY A;  1BBW A;  2Q7G A;  2ZCE A;  4TQF A;  4H2Y A;  4CH6 A;  2ARS A;  1SER A;  2RHQ A;  2DU7 A;  2J3M A;  4TVA B;  1GGM A;  4G84 A;  5ELN A;  1WQ7 A;  1EVK A;  4P72 C;  4E51 A;  3L1A A;  2ZNI A;  2CJ9 A;  1JJC A;  4P71 A;  5C53 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...