4P72C

Phers in complex with compound 2a
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
249
structure length
235
Chain Sequence
ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
total genus 68
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p72C01
4P74C 3TEHB 1E1TA 1ASZA 3HTZA 3RUXA 4TVYA 1NJ2A 2ZT8A 3M4QA 5ELOA 3IKMB 1B70A 3LSSA 4TQDA 2CJBA 2ZIMA 4P72C 5K1PA 4P71C 3RKYA 2DXTA 2Q5IA 2G4CA 1H4SA 1EQRA 3E9HA 4H2TA 4YCVA 1YFTA 2I4MA 2I4LA 4XTVA 4ZTZB 1WLEA 1X55A 3PZCA 1WQWA 2DQ3A 4EO4A 2J3MA 1H4TA 2Q7GA 1B7YA 3UGTA 1RIQA 4LNSA 4XTWA 2QHVA 4YYEA 4P73A 5HGQA 5K1XA 1BIAA 1YGBA 2AKWB 3HXZA 1X56A 3QO5A 3V7RA 2E1HA 2RHSA 3E9IA 3QO7A 4K87A 4Q15A 2DZCA 4O2DA 3LSQA 4H2UA 1KMMA 5C53B 3V7CA 2C7IA 3HXUA 4UP9A 4P75A 3TEHA 3UGQA 2ARTA 4YRTA 3VBBA 3W3SA 3HXXA 1NYQA 1H4VB 4H2WA 4HWSA 1B7YB 4TQFA 3VQWA 4EX5A 1Z7MA 2EJGA 4DQ2A 3A31A 4CH3A 11ASA 3G1ZA 1VQZA 3IALA 4XU3A 1WU7A 3P8TA 3A5YA 3HFZB 3HXVA 1USYC 3IG2A 3M4PA 2ZT5A 3DSQA 4YRCA 2CIMA 3HXWA 4YRFA 4HWRA 4XU0A 2EAYA 1YFSA 4YREA 4P74A 2Q5HA 3REXA 4OLFA 4YCUA 2AKWA 3L1AA 3V8JA 3BFMA 2ARSA 4XEOA 2ZR2A 1WPYA 4YP0A 4UP8A 4RQEA 4YCWA 1PYSB 4HWTA 4H02A 5C52B 1GGMA 4P3OA 2EL9A 1H4QA 4YRGA 1WQ7A 4P3PA 4P72A 4CH4A 4WF2A 1YB3A 4BW9A 4P71A 3MEYA 3L2ZA 1X2HA 4YRRA 1NNHA 3NENA 2DKGA 1J5WA 1Z7NA 4DPGA 2I4OA 2E3CA 2EJ9A 2DDZA 4YRNA 3MF2A 1ADYA 2AMCB 2ZZFA 2ARUA 2Q7HA 4XU2A 4UPAA 4P3NA 3P8VA 3REUA 2E41A 1E24A 4WI1A 1SESA 5F5WA 3EFRA 1WNLA 3NEMA 3HFZA 1G5IA 1B76A 3V8KA 2E64A 2ZT7A 2CGHA 2ZZGA 2ZNJA 3P8YA 2CJAA 1SRYA 1L0WA 2ZZEA 3FJPA 4K86A 1HC7A 1SERA 1YFRA 1EFWA 4CH5A 4J15A 1EIYB 1IL2A 4YDQA 4TWAA 4XTYA 4KR2A 1W66A 4CS4A 2ZXFA 1N9WA 4YRMA 1PYSA 3L4GB 1ATIA 3RIRA 2DTOA 3HXYA 5E3IA 4YRSA 2DQ0A 2FYKA 2XGTA 4AH6A 4TTVA 3A7RA 1G5HA 4UP7A 2PMFA 5ELNA 3RKWA 3PCOA 3KFUA 1E1OA 3UH0A 3A74A 3RF1A 4HVCA 2J3LA 2P0LA 4RDXA 1USYA 2AMCA 4OP0A 2QHUA 4HWPA 3ERRA 3OD1A 5C51B 4XTUA 1X2GA 2ODRC 3RL6A 2ZT6A 1WYDA 3HY0A 4RQFA 4ZIBA 4TVWA 4K88A 2DU5A 3NETA 4RMFA 4YPFA 3QO8A 2DJZA 4H2XA 3LC0A 3VQYA 4H2YA 2QHSA 1KOGA 4TVAB 4YROA 4G85A 2C8MA 1HXDA 1NJ5A 2XTIA 2DEQA 3R07A 3PCOB 4E51A 4YRIA 1G51A 4PG3A 2IY5B 1EIYA 1BIBA 4XEMA 2QHTA 2DTHA 3L4GA 3HRIA 2RHQA 2DXUA 2ALYB 2DVEA 3UFGA 4CS2A 4BWAA 3IKLA 4YRJA 4CH6A 3QNEA 4G84A 2EJFA 2ZNIA 3HY1A 2PMEA 1C0AA 2Q7EA 4H2XB 1QF6A 4YRLA 2E65A 3V7SA 1NJ6A 4ZTUB 2EWNA 3BJUA 1EVLA 2ZR3A 1E22A 2CJ9A 4P73C 1BBWA 3MF1A 2E5AA 3ICAA 2ZIOA 3EFSA 1JJCA 2HNIA 12ASA 1ADJA 1B70B 1NJ1A 3A32A 3QTCA 1SETA 3HFVA 1FYFA 1KMNA 1HTTA 4YRQA 4H2SA 4HA8A 2RHQB 4TVAA 3A7UA 1NJ8A 4P75C 1EVKA 1ASYA 3CMQA 4WJ4A 2DZ9A 4L87A 3RKXA 3I7FA 3WQZA 2ZINA 3RACA 4YRKA 2P5IA 2DTIA 2ODRD 1BBUA 2IY5A 4XTXA 2ZTGA 5KNNA 4H2VA 2E10A 4XU1A 2ZCEA 4Q6GA 1NYRA 2ALYA 3TEGA 4X5OA 3A7AA 3RGLA 2ZGWA 4HWOA 4YRPA 3A5ZA 1EOVA 1X01A 4PHCA 3TUPA 1X54A 3HRKA 1JJCB 2RHSB 4KR3A 1QE0A 3V8LA 4CS3A 1LYLA 3VQXA 3NELA 3VQVA 4WJ3M 1B8AA 4XTZA 2I4NA 4KQEA 2DU7A 4NCXA
chains in the Genus database with same CATH superfamily
4P74C 3TEHB 1E1TA 1ASZA 3HTZA 3RUXA 4TVYA 1NJ2A 2ZT8A 3M4QA 5ELOA 3IKMB 1B70A 3LSSA 4TQDA 2CJBA 4HT4A 2ZIMA 4P72C 5K1PA 4P71C 3RKYA 2DXTA 2Q5IA 2G4CA 1H4SA 1EQRA 3E9HA 4H2TA 4YCVA 1YFTA 2I4MA 2I4LA 4XTVA 4ZTZB 1WLEA 1X55A 3PZCA 1WQWA 2DQ3A 4EO4A 2J3MA 1H4TA 2Q7GA 1B7YA 3UGTA 1RIQA 4LNSA 4XTWA 2QHVA 4YYEA 4P73A 5HGQA 5K1XA 1BIAA 1YGBA 2AKWB 3HXZA 1X56A 3QO5A 3V7RA 2E1HA 2RHSA 3E9IA 3QO7A 4K87A 4Q15A 2DZCA 4O2DA 3LSQA 4H2UA 1KMMA 5C53B 3V7CA 2C7IA 3HXUA 4UP9A 4P75A 3TEHA 3UGQA 2ARTA 2A8EA 4YRTA 3VBBA 3W3SA 3HXXA 1NYQA 1H4VB 4H2WA 4HWSA 1B7YB 4TQFA 3VQWA 4EX5A 1Z7MA 2EJGA 4DQ2A 3A31A 4CH3A 11ASA 4LVLA 3G1ZA 1VQZA 3IALA 4XU3A 1WU7A 3P8TA 4LVIA 3A5YA 3HFZB 3HXVA 1USYC 3IG2A 3M4PA 2ZT5A 3DSQA 4YRCA 2CIMA 3HXWA 4YRFA 4HWRA 4XU0A 2EAYA 1YFSA 4YREA 4P74A 2Q5HA 3REXA 4OLFA 4YCUA 2AKWA 3L1AA 3V8JA 3BFMA 2ARSA 4XEOA 2ZR2A 1WPYA 4YP0A 4UP8A 4RQEA 4YCWA 1PYSB 4HWTA 4H02A 5C52B 1GGMA 4P3OA 2EL9A 1H4QA 4YRGA 1WQ7A 4P3PA 4P72A 4CH4A 4WF2A 1YB3A 4BW9A 4P71A 3MEYA 3L2ZA 1X2HA 4YRRA 1NNHA 3NENA 2DKGA 1J5WA 1Z7NA 4DPGA 2I4OA 2E3CA 2EJ9A 2DDZA 4YRNA 3MF2A 1ADYA 2AMCB 2ZZFA 2ARUA 2Q7HA 4XU2A 4UPAA 4P3NA 3P8VA 3REUA 2E41A 1E24A 4WI1A 1SESA 5F5WA 3EFRA 1WNLA 3NEMA 3HFZA 1G5IA 1B76A 3V8KA 2E64A 2ZT7A 2CGHA 2ZZGA 2ZNJA 3P8YA 2CJAA 1SRYA 1L0WA 2ZZEA 3FJPA 4K86A 1HC7A 1SERA 1YFRA 1EFWA 4CH5A 4J15A 1EIYB 1IL2A 4YDQA 4TWAA 4XTYA 4KR2A 1W66A 4CS4A 2ZXFA 1N9WA 4YRMA 1PYSA 3L4GB 1ATIA 3RIRA 2DTOA 3HXYA 5E3IA 4YRSA 2DQ0A 2FYKA 2XGTA 4AH6A 4TTVA 3A7RA 1G5HA 4UP7A 2PMFA 5ELNA 3RKWA 3PCOA 3KFUA 1E1OA 3UH0A 3A74A 3RF1A 4HVCA 2J3LA 2P0LA 4RDXA 1USYA 2AMCA 4OP0A 2QHUA 4HWPA 3ERRA 3OD1A 5C51B 4XTUA 1X2GA 2ODRC 3RL6A 2ZT6A 1WYDA 3HY0A 4RQFA 4ZIBA 4TVWA 4K88A 2DU5A 3NETA 4RMFA 4YPFA 3QO8A 4LVKA 2DJZA 4H2XA 3LC0A 3VQYA 4H2YA 2QHSA 1KOGA 4TVAB 4YROA 4G85A 2C8MA 1HXDA 1NJ5A 2XTIA 2DEQA 3R07A 3PCOB 4E51A 4YRIA 1G51A 4PG3A 2IY5B 1EIYA 1BIBA 4XEMA 2QHTA 2DTHA 3L4GA 3HRIA 2RHQA 2DXUA 2ALYB 2DVEA 3UFGA 4CS2A 4BWAA 3IKLA 4YRJA 4CH6A 3QNEA 4G84A 2EJFA 3MQZA 2ZNIA 3HY1A 2PMEA 1C0AA 2Q7EA 4H2XB 1QF6A 4YRLA 2E65A 3V7SA 1NJ6A 4ZTUB 2EWNA 3BJUA 1EVLA 2ZR3A 1E22A 2CJ9A 4P73C 1BBWA 3MF1A 2E5AA 3ICAA 2ZIOA 3EFSA 1JJCA 2HNIA 12ASA 4LVJA 1ADJA 1B70B 1NJ1A 3A32A 3QTCA 1SETA 3HFVA 1FYFA 1KMNA 1HTTA 4YRQA 4H2SA 4HA8A 2RHQB 4TVAA 3A7UA 1NJ8A 4P75C 1EVKA 1ASYA 3CMQA 4WJ4A 2DZ9A 4L87A 3RKXA 3I7FA 3WQZA 2ZINA 3RACA 4YRKA 2P5IA 2DTIA 2ODRD 1BBUA 2IY5A 4XTXA 2ZTGA 5KNNA 4H2VA 2E10A 4XU1A 2ZCEA 4Q6GA 1NYRA 2ALYA 3TEGA 4X5OA 3A7AA 3RGLA 2ZGWA 4HWOA 4YRPA 3A5ZA 1EOVA 1X01A 4LVMA 4PHCA 3TUPA 1X54A 3HRKA 1JJCB 2RHSB 4KR3A 1QE0A 3V8LA 4CS3A 1LYLA 3VQXA 3NELA 2NS6A 3VQVA 4WJ3M 1B8AA 4XTZA 2I4NA 4KQEA 2DU7A 4NCXA
chains in the Genus database with same CATH topology
4P74C 3TEHB 1E1TA 1ASZA 3HTZA 3RUXA 4TVYA 1NJ2A 2ZT8A 3M4QA 5ELOA 3IKMB 1B70A 3LSSA 4TQDA 2CJBA 4HT4A 2ZIMA 4P72C 5K1PA 4P71C 3RKYA 2DXTA 2Q5IA 2G4CA 1H4SA 1EQRA 3E9HA 4H2TA 4YCVA 1YFTA 2I4MA 2I4LA 4XTVA 4ZTZB 1WLEA 1X55A 3PZCA 1WQWA 2DQ3A 4EO4A 2J3MA 1H4TA 2Q7GA 1B7YA 3UGTA 1RIQA 4LNSA 4XTWA 2QHVA 4YYEA 4P73A 5HGQA 5K1XA 1BIAA 1YGBA 2AKWB 3HXZA 1X56A 3QO5A 3V7RA 2E1HA 2RHSA 3E9IA 3QO7A 4K87A 4Q15A 2DZCA 4O2DA 3LSQA 4H2UA 1KMMA 5C53B 3V7CA 2C7IA 3HXUA 4UP9A 4P75A 3TEHA 3UGQA 2ARTA 2A8EA 4YRTA 3VBBA 3W3SA 3HXXA 1NYQA 1H4VB 4H2WA 4HWSA 1B7YB 4TQFA 3VQWA 4EX5A 1Z7MA 2EJGA 4DQ2A 3A31A 4CH3A 11ASA 4LVLA 3G1ZA 1VQZA 3IALA 4XU3A 1WU7A 3P8TA 4LVIA 3A5YA 3HFZB 3HXVA 1USYC 3IG2A 3M4PA 2ZT5A 3DSQA 4YRCA 2CIMA 3HXWA 4YRFA 4HWRA 4XU0A 2EAYA 1YFSA 4YREA 4P74A 2Q5HA 3REXA 4OLFA 4YCUA 2AKWA 3L1AA 3V8JA 3BFMA 2ARSA 4XEOA 2ZR2A 1WPYA 4YP0A 4UP8A 4RQEA 4YCWA 1PYSB 4HWTA 4H02A 5C52B 1GGMA 4P3OA 2EL9A 1H4QA 4YRGA 1WQ7A 4P3PA 4P72A 4CH4A 4WF2A 1YB3A 4BW9A 4P71A 3MEYA 3L2ZA 1X2HA 4YRRA 1NNHA 3NENA 2DKGA 1J5WA 1Z7NA 4DPGA 2I4OA 2E3CA 2EJ9A 2DDZA 4YRNA 3MF2A 1ADYA 2AMCB 2ZZFA 2ARUA 2Q7HA 4XU2A 4UPAA 4P3NA 3P8VA 3REUA 2E41A 1E24A 4WI1A 1SESA 5F5WA 3EFRA 1WNLA 3NEMA 3HFZA 1G5IA 1B76A 3V8KA 2E64A 2ZT7A 2CGHA 2ZZGA 2ZNJA 3P8YA 2CJAA 1SRYA 1L0WA 2ZZEA 3FJPA 4K86A 1HC7A 1SERA 1YFRA 1EFWA 4CH5A 4J15A 1EIYB 1IL2A 4YDQA 4TWAA 4XTYA 4KR2A 1W66A 4CS4A 2ZXFA 1N9WA 4YRMA 1PYSA 3L4GB 1ATIA 3RIRA 2DTOA 3HXYA 5E3IA 4YRSA 2DQ0A 2FYKA 2XGTA 4AH6A 4TTVA 3A7RA 1G5HA 4UP7A 2PMFA 5ELNA 3RKWA 3PCOA 3KFUA 1E1OA 3UH0A 3A74A 3RF1A 4HVCA 2J3LA 2P0LA 4RDXA 1USYA 2AMCA 4OP0A 2QHUA 4HWPA 3ERRA 3OD1A 5C51B 4XTUA 1X2GA 2ODRC 3RL6A 2ZT6A 1WYDA 3HY0A 4RQFA 4ZIBA 4TVWA 4K88A 2DU5A 3NETA 4RMFA 4YPFA 3QO8A 4LVKA 2DJZA 4H2XA 3LC0A 3VQYA 4H2YA 2QHSA 1KOGA 4TVAB 4YROA 4G85A 2C8MA 1HXDA 1NJ5A 2XTIA 2DEQA 3R07A 3PCOB 4E51A 4YRIA 1G51A 4PG3A 2IY5B 1EIYA 1BIBA 4XEMA 2QHTA 2DTHA 3L4GA 3HRIA 2RHQA 2DXUA 2ALYB 2DVEA 3UFGA 4CS2A 4BWAA 3IKLA 4YRJA 4CH6A 3QNEA 4G84A 2EJFA 3MQZA 2ZNIA 3HY1A 2PMEA 1C0AA 2Q7EA 4H2XB 1QF6A 4YRLA 2E65A 3V7SA 1NJ6A 4ZTUB 2EWNA 3BJUA 1EVLA 2ZR3A 1E22A 2CJ9A 4P73C 1BBWA 3MF1A 2E5AA 3ICAA 2ZIOA 3EFSA 1JJCA 2HNIA 12ASA 4LVJA 1ADJA 1B70B 1NJ1A 3A32A 3QTCA 1SETA 3HFVA 1FYFA 1KMNA 1HTTA 4YRQA 4H2SA 4HA8A 2RHQB 4TVAA 3A7UA 1NJ8A 4P75C 1EVKA 1ASYA 3CMQA 4WJ4A 2DZ9A 4L87A 3RKXA 3I7FA 3WQZA 2ZINA 3RACA 4YRKA 2P5IA 2DTIA 2ODRD 1BBUA 2IY5A 4XTXA 2ZTGA 5KNNA 4H2VA 2E10A 4XU1A 2ZCEA 4Q6GA 1NYRA 2ALYA 3TEGA 4X5OA 3A7AA 3RGLA 2ZGWA 4HWOA 4YRPA 3A5ZA 1EOVA 1X01A 4LVMA 4PHCA 3TUPA 1X54A 3HRKA 1JJCB 2RHSB 4KR3A 1QE0A 3V8LA 4CS3A 1LYLA 3VQXA 3NELA 2NS6A 3VQVA 4WJ3M 1B8AA 4XTZA 2I4NA 4KQEA 2DU7A 4NCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P74 C;  3TEH B;  1E1T A;  1ASZ A;  3HTZ A;  3RUX A;  4TVY A;  1NJ2 A;  2ZT8 A;  3M4Q A;  5ELO A;  3IKM B;  1B70 A;  3LSS A;  4TQD A;  2CJB A;  2ZIM A;  4P72 C;  5K1P A;  4P71 C;  3RKY A;  2DXT A;  2Q5I A;  2G4C A;  1H4S A;  1EQR A;  3E9H A;  4H2T A;  4YCV A;  1YFT A;  2I4M A;  2I4L A;  4XTV A;  4ZTZ B;  1WLE A;  1X55 A;  3PZC A;  1WQW A;  2DQ3 A;  4EO4 A;  2J3M A;  1H4T A;  2Q7G A;  1B7Y A;  3UGT A;  1RIQ A;  4LNS A;  4XTW A;  2QHV A;  4YYE A;  4P73 A;  5HGQ A;  5K1X A;  1BIA A;  1YGB A;  2AKW B;  3HXZ A;  1X56 A;  3QO5 A;  3V7R A;  2E1H A;  2RHS A;  3E9I A;  3QO7 A;  4K87 A;  4Q15 A;  2DZC A;  4O2D A;  3LSQ A;  4H2U A;  1KMM A;  5C53 B;  3V7C A;  2C7I A;  3HXU A;  4UP9 A;  4P75 A;  3TEH A;  3UGQ A;  2ART A;  4YRT A;  3VBB A;  3W3S A;  3HXX A;  1NYQ A;  1H4V B;  4H2W A;  4HWS A;  1B7Y B;  4TQF A;  3VQW A;  4EX5 A;  1Z7M A;  2EJG A;  4DQ2 A;  3A31 A;  4CH3 A;  11AS A;  3G1Z A;  1VQZ A;  3IAL A;  4XU3 A;  1WU7 A;  3P8T A;  3A5Y A;  3HFZ B;  3HXV A;  1USY C;  3IG2 A;  3M4P A;  2ZT5 A;  3DSQ A;  4YRC A;  2CIM A;  3HXW A;  4YRF A;  4HWR A;  4XU0 A;  2EAY A;  1YFS A;  4YRE A;  4P74 A;  2Q5H A;  3REX A;  4OLF A;  4YCU A;  2AKW A;  3L1A A;  3V8J A;  3BFM A;  2ARS A;  4XEO A;  2ZR2 A;  1WPY A;  4YP0 A;  4UP8 A;  4RQE A;  4YCW A;  1PYS B;  4HWT A;  4H02 A;  5C52 B;  1GGM A;  4P3O A;  2EL9 A;  1H4Q A;  4YRG A;  1WQ7 A;  4P3P A;  4P72 A;  4CH4 A;  4WF2 A;  1YB3 A;  4BW9 A;  4P71 A;  3MEY A;  3L2Z A;  1X2H A;  4YRR A;  1NNH A;  3NEN A;  2DKG A;  1J5W A;  1Z7N A;  4DPG A;  2I4O A;  2E3C A;  2EJ9 A;  2DDZ A;  4YRN A;  3MF2 A;  1ADY A;  2AMC B;  2ZZF A;  2ARU A;  2Q7H A;  4XU2 A;  4UPA A;  4P3N A;  3P8V A;  3REU A;  2E41 A;  1E24 A;  4WI1 A;  1SES A;  5F5W A;  3EFR A;  1WNL A;  3NEM A;  3HFZ A;  1G5I A;  1B76 A;  3V8K A;  2E64 A;  2ZT7 A;  2CGH A;  2ZZG A;  2ZNJ A;  3P8Y A;  2CJA A;  1SRY A;  1L0W A;  2ZZE A;  3FJP A;  4K86 A;  1HC7 A;  1SER A;  1YFR A;  1EFW A;  4CH5 A;  4J15 A;  1EIY B;  1IL2 A;  4YDQ A;  4TWA A;  4XTY A;  4KR2 A;  1W66 A;  4CS4 A;  2ZXF A;  1N9W A;  4YRM A;  1PYS A;  3L4G B;  1ATI A;  3RIR A;  2DTO A;  3HXY A;  5E3I A;  4YRS A;  2DQ0 A;  2FYK A;  2XGT A;  4AH6 A;  4TTV A;  3A7R A;  1G5H A;  4UP7 A;  2PMF A;  5ELN A;  3RKW A;  3PCO A;  3KFU A;  1E1O A;  3UH0 A;  3A74 A;  3RF1 A;  4HVC A;  2J3L A;  2P0L A;  4RDX A;  1USY A;  2AMC A;  4OP0 A;  2QHU A;  4HWP A;  3ERR A;  3OD1 A;  5C51 B;  4XTU A;  1X2G A;  2ODR C;  3RL6 A;  2ZT6 A;  1WYD A;  3HY0 A;  4RQF A;  4ZIB A;  4TVW A;  4K88 A;  2DU5 A;  3NET A;  4RMF A;  4YPF A;  3QO8 A;  2DJZ A;  4H2X A;  3LC0 A;  3VQY A;  4H2Y A;  2QHS A;  1KOG A;  4TVA B;  4YRO A;  4G85 A;  2C8M A;  1HXD A;  1NJ5 A;  2XTI A;  2DEQ A;  3R07 A;  3PCO B;  4E51 A;  4YRI A;  1G51 A;  4PG3 A;  2IY5 B;  1EIY A;  1BIB A;  4XEM A;  2QHT A;  2DTH A;  3L4G A;  3HRI A;  2RHQ A;  2DXU A;  2ALY B;  2DVE A;  3UFG A;  4CS2 A;  4BWA A;  3IKL A;  4YRJ A;  4CH6 A;  3QNE A;  4G84 A;  2EJF A;  2ZNI A;  3HY1 A;  2PME A;  1C0A A;  2Q7E A;  4H2X B;  1QF6 A;  4YRL A;  2E65 A;  3V7S A;  1NJ6 A;  4ZTU B;  2EWN A;  3BJU A;  1EVL A;  2ZR3 A;  1E22 A;  2CJ9 A;  4P73 C;  1BBW A;  3MF1 A;  2E5A A;  3ICA A;  2ZIO A;  3EFS A;  1JJC A;  2HNI A;  12AS A;  1ADJ A;  1B70 B;  1NJ1 A;  3A32 A;  3QTC A;  1SET A;  3HFV A;  1FYF A;  1KMN A;  1HTT A;  4YRQ A;  4H2S A;  4HA8 A;  2RHQ B;  4TVA A;  3A7U A;  1NJ8 A;  4P75 C;  1EVK A;  1ASY A;  3CMQ A;  4WJ4 A;  2DZ9 A;  4L87 A;  3RKX A;  3I7F A;  3WQZ A;  2ZIN A;  3RAC A;  4YRK A;  2P5I A;  2DTI A;  2ODR D;  1BBU A;  2IY5 A;  4XTX A;  2ZTG A;  5KNN A;  4H2V A;  2E10 A;  4XU1 A;  2ZCE A;  4Q6G A;  1NYR A;  2ALY A;  3TEG A;  4X5O A;  3A7A A;  3RGL A;  2ZGW A;  4HWO A;  4YRP A;  3A5Z A;  1EOV A;  1X01 A;  4PHC A;  3TUP A;  1X54 A;  3HRK A;  1JJC B;  2RHS B;  4KR3 A;  1QE0 A;  3V8L A;  4CS3 A;  1LYL A;  3VQX A;  3NEL A;  3VQV A;  4WJ3 M;  1B8A A;  4XTZ A;  2I4N A;  4KQE A;  2DU7 A;  4NCX A; 
#chains in the Genus database with same CATH topology
 4P74 C;  3TEH B;  1E1T A;  1ASZ A;  3HTZ A;  3RUX A;  4TVY A;  1NJ2 A;  2ZT8 A;  3M4Q A;  5ELO A;  3IKM B;  1B70 A;  3LSS A;  4TQD A;  2CJB A;  4HT4 A;  2ZIM A;  4P72 C;  5K1P A;  4P71 C;  3RKY A;  2DXT A;  2Q5I A;  2G4C A;  1H4S A;  1EQR A;  3E9H A;  4H2T A;  4YCV A;  1YFT A;  2I4M A;  2I4L A;  4XTV A;  4ZTZ B;  1WLE A;  1X55 A;  3PZC A;  1WQW A;  2DQ3 A;  4EO4 A;  2J3M A;  1H4T A;  2Q7G A;  1B7Y A;  3UGT A;  1RIQ A;  4LNS A;  4XTW A;  2QHV A;  4YYE A;  4P73 A;  5HGQ A;  5K1X A;  1BIA A;  1YGB A;  2AKW B;  3HXZ A;  1X56 A;  3QO5 A;  3V7R A;  2E1H A;  2RHS A;  3E9I A;  3QO7 A;  4K87 A;  4Q15 A;  2DZC A;  4O2D A;  3LSQ A;  4H2U A;  1KMM A;  5C53 B;  3V7C A;  2C7I A;  3HXU A;  4UP9 A;  4P75 A;  3TEH A;  3UGQ A;  2ART A;  2A8E A;  4YRT A;  3VBB A;  3W3S A;  3HXX A;  1NYQ A;  1H4V B;  4H2W A;  4HWS A;  1B7Y B;  4TQF A;  3VQW A;  4EX5 A;  1Z7M A;  2EJG A;  4DQ2 A;  3A31 A;  4CH3 A;  11AS A;  4LVL A;  3G1Z A;  1VQZ A;  3IAL A;  4XU3 A;  1WU7 A;  3P8T A;  4LVI A;  3A5Y A;  3HFZ B;  3HXV A;  1USY C;  3IG2 A;  3M4P A;  2ZT5 A;  3DSQ A;  4YRC A;  2CIM A;  3HXW A;  4YRF A;  4HWR A;  4XU0 A;  2EAY A;  1YFS A;  4YRE A;  4P74 A;  2Q5H A;  3REX A;  4OLF A;  4YCU A;  2AKW A;  3L1A A;  3V8J A;  3BFM A;  2ARS A;  4XEO A;  2ZR2 A;  1WPY A;  4YP0 A;  4UP8 A;  4RQE A;  4YCW A;  1PYS B;  4HWT A;  4H02 A;  5C52 B;  1GGM A;  4P3O A;  2EL9 A;  1H4Q A;  4YRG A;  1WQ7 A;  4P3P A;  4P72 A;  4CH4 A;  4WF2 A;  1YB3 A;  4BW9 A;  4P71 A;  3MEY A;  3L2Z A;  1X2H A;  4YRR A;  1NNH A;  3NEN A;  2DKG A;  1J5W A;  1Z7N A;  4DPG A;  2I4O A;  2E3C A;  2EJ9 A;  2DDZ A;  4YRN A;  3MF2 A;  1ADY A;  2AMC B;  2ZZF A;  2ARU A;  2Q7H A;  4XU2 A;  4UPA A;  4P3N A;  3P8V A;  3REU A;  2E41 A;  1E24 A;  4WI1 A;  1SES A;  5F5W A;  3EFR A;  1WNL A;  3NEM A;  3HFZ A;  1G5I A;  1B76 A;  3V8K A;  2E64 A;  2ZT7 A;  2CGH A;  2ZZG A;  2ZNJ A;  3P8Y A;  2CJA A;  1SRY A;  1L0W A;  2ZZE A;  3FJP A;  4K86 A;  1HC7 A;  1SER A;  1YFR A;  1EFW A;  4CH5 A;  4J15 A;  1EIY B;  1IL2 A;  4YDQ A;  4TWA A;  4XTY A;  4KR2 A;  1W66 A;  4CS4 A;  2ZXF A;  1N9W A;  4YRM A;  1PYS A;  3L4G B;  1ATI A;  3RIR A;  2DTO A;  3HXY A;  5E3I A;  4YRS A;  2DQ0 A;  2FYK A;  2XGT A;  4AH6 A;  4TTV A;  3A7R A;  1G5H A;  4UP7 A;  2PMF A;  5ELN A;  3RKW A;  3PCO A;  3KFU A;  1E1O A;  3UH0 A;  3A74 A;  3RF1 A;  4HVC A;  2J3L A;  2P0L A;  4RDX A;  1USY A;  2AMC A;  4OP0 A;  2QHU A;  4HWP A;  3ERR A;  3OD1 A;  5C51 B;  4XTU A;  1X2G A;  2ODR C;  3RL6 A;  2ZT6 A;  1WYD A;  3HY0 A;  4RQF A;  4ZIB A;  4TVW A;  4K88 A;  2DU5 A;  3NET A;  4RMF A;  4YPF A;  3QO8 A;  4LVK A;  2DJZ A;  4H2X A;  3LC0 A;  3VQY A;  4H2Y A;  2QHS A;  1KOG A;  4TVA B;  4YRO A;  4G85 A;  2C8M A;  1HXD A;  1NJ5 A;  2XTI A;  2DEQ A;  3R07 A;  3PCO B;  4E51 A;  4YRI A;  1G51 A;  4PG3 A;  2IY5 B;  1EIY A;  1BIB A;  4XEM A;  2QHT A;  2DTH A;  3L4G A;  3HRI A;  2RHQ A;  2DXU A;  2ALY B;  2DVE A;  3UFG A;  4CS2 A;  4BWA A;  3IKL A;  4YRJ A;  4CH6 A;  3QNE A;  4G84 A;  2EJF A;  3MQZ A;  2ZNI A;  3HY1 A;  2PME A;  1C0A A;  2Q7E A;  4H2X B;  1QF6 A;  4YRL A;  2E65 A;  3V7S A;  1NJ6 A;  4ZTU B;  2EWN A;  3BJU A;  1EVL A;  2ZR3 A;  1E22 A;  2CJ9 A;  4P73 C;  1BBW A;  3MF1 A;  2E5A A;  3ICA A;  2ZIO A;  3EFS A;  1JJC A;  2HNI A;  12AS A;  4LVJ A;  1ADJ A;  1B70 B;  1NJ1 A;  3A32 A;  3QTC A;  1SET A;  3HFV A;  1FYF A;  1KMN A;  1HTT A;  4YRQ A;  4H2S A;  4HA8 A;  2RHQ B;  4TVA A;  3A7U A;  1NJ8 A;  4P75 C;  1EVK A;  1ASY A;  3CMQ A;  4WJ4 A;  2DZ9 A;  4L87 A;  3RKX A;  3I7F A;  3WQZ A;  2ZIN A;  3RAC A;  4YRK A;  2P5I A;  2DTI A;  2ODR D;  1BBU A;  2IY5 A;  4XTX A;  2ZTG A;  5KNN A;  4H2V A;  2E10 A;  4XU1 A;  2ZCE A;  4Q6G A;  1NYR A;  2ALY A;  3TEG A;  4X5O A;  3A7A A;  3RGL A;  2ZGW A;  4HWO A;  4YRP A;  3A5Z A;  1EOV A;  1X01 A;  4LVM A;  4PHC A;  3TUP A;  1X54 A;  3HRK A;  1JJC B;  2RHS B;  4KR3 A;  1QE0 A;  3V8L A;  4CS3 A;  1LYL A;  3VQX A;  3NEL A;  2NS6 A;  3VQV A;  4WJ3 M;  1B8A A;  4XTZ A;  2I4N A;  4KQE A;  2DU7 A;  4NCX A; 
#chains in the Genus database with same CATH homology
 4P74 C;  3TEH B;  1E1T A;  1ASZ A;  3HTZ A;  3RUX A;  4TVY A;  1NJ2 A;  2ZT8 A;  3M4Q A;  5ELO A;  3IKM B;  1B70 A;  3LSS A;  4TQD A;  2CJB A;  4HT4 A;  2ZIM A;  4P72 C;  5K1P A;  4P71 C;  3RKY A;  2DXT A;  2Q5I A;  2G4C A;  1H4S A;  1EQR A;  3E9H A;  4H2T A;  4YCV A;  1YFT A;  2I4M A;  2I4L A;  4XTV A;  4ZTZ B;  1WLE A;  1X55 A;  3PZC A;  1WQW A;  2DQ3 A;  4EO4 A;  2J3M A;  1H4T A;  2Q7G A;  1B7Y A;  3UGT A;  1RIQ A;  4LNS A;  4XTW A;  2QHV A;  4YYE A;  4P73 A;  5HGQ A;  5K1X A;  1BIA A;  1YGB A;  2AKW B;  3HXZ A;  1X56 A;  3QO5 A;  3V7R A;  2E1H A;  2RHS A;  3E9I A;  3QO7 A;  4K87 A;  4Q15 A;  2DZC A;  4O2D A;  3LSQ A;  4H2U A;  1KMM A;  5C53 B;  3V7C A;  2C7I A;  3HXU A;  4UP9 A;  4P75 A;  3TEH A;  3UGQ A;  2ART A;  2A8E A;  4YRT A;  3VBB A;  3W3S A;  3HXX A;  1NYQ A;  1H4V B;  4H2W A;  4HWS A;  1B7Y B;  4TQF A;  3VQW A;  4EX5 A;  1Z7M A;  2EJG A;  4DQ2 A;  3A31 A;  4CH3 A;  11AS A;  4LVL A;  3G1Z A;  1VQZ A;  3IAL A;  4XU3 A;  1WU7 A;  3P8T A;  4LVI A;  3A5Y A;  3HFZ B;  3HXV A;  1USY C;  3IG2 A;  3M4P A;  2ZT5 A;  3DSQ A;  4YRC A;  2CIM A;  3HXW A;  4YRF A;  4HWR A;  4XU0 A;  2EAY A;  1YFS A;  4YRE A;  4P74 A;  2Q5H A;  3REX A;  4OLF A;  4YCU A;  2AKW A;  3L1A A;  3V8J A;  3BFM A;  2ARS A;  4XEO A;  2ZR2 A;  1WPY A;  4YP0 A;  4UP8 A;  4RQE A;  4YCW A;  1PYS B;  4HWT A;  4H02 A;  5C52 B;  1GGM A;  4P3O A;  2EL9 A;  1H4Q A;  4YRG A;  1WQ7 A;  4P3P A;  4P72 A;  4CH4 A;  4WF2 A;  1YB3 A;  4BW9 A;  4P71 A;  3MEY A;  3L2Z A;  1X2H A;  4YRR A;  1NNH A;  3NEN A;  2DKG A;  1J5W A;  1Z7N A;  4DPG A;  2I4O A;  2E3C A;  2EJ9 A;  2DDZ A;  4YRN A;  3MF2 A;  1ADY A;  2AMC B;  2ZZF A;  2ARU A;  2Q7H A;  4XU2 A;  4UPA A;  4P3N A;  3P8V A;  3REU A;  2E41 A;  1E24 A;  4WI1 A;  1SES A;  5F5W A;  3EFR A;  1WNL A;  3NEM A;  3HFZ A;  1G5I A;  1B76 A;  3V8K A;  2E64 A;  2ZT7 A;  2CGH A;  2ZZG A;  2ZNJ A;  3P8Y A;  2CJA A;  1SRY A;  1L0W A;  2ZZE A;  3FJP A;  4K86 A;  1HC7 A;  1SER A;  1YFR A;  1EFW A;  4CH5 A;  4J15 A;  1EIY B;  1IL2 A;  4YDQ A;  4TWA A;  4XTY A;  4KR2 A;  1W66 A;  4CS4 A;  2ZXF A;  1N9W A;  4YRM A;  1PYS A;  3L4G B;  1ATI A;  3RIR A;  2DTO A;  3HXY A;  5E3I A;  4YRS A;  2DQ0 A;  2FYK A;  2XGT A;  4AH6 A;  4TTV A;  3A7R A;  1G5H A;  4UP7 A;  2PMF A;  5ELN A;  3RKW A;  3PCO A;  3KFU A;  1E1O A;  3UH0 A;  3A74 A;  3RF1 A;  4HVC A;  2J3L A;  2P0L A;  4RDX A;  1USY A;  2AMC A;  4OP0 A;  2QHU A;  4HWP A;  3ERR A;  3OD1 A;  5C51 B;  4XTU A;  1X2G A;  2ODR C;  3RL6 A;  2ZT6 A;  1WYD A;  3HY0 A;  4RQF A;  4ZIB A;  4TVW A;  4K88 A;  2DU5 A;  3NET A;  4RMF A;  4YPF A;  3QO8 A;  4LVK A;  2DJZ A;  4H2X A;  3LC0 A;  3VQY A;  4H2Y A;  2QHS A;  1KOG A;  4TVA B;  4YRO A;  4G85 A;  2C8M A;  1HXD A;  1NJ5 A;  2XTI A;  2DEQ A;  3R07 A;  3PCO B;  4E51 A;  4YRI A;  1G51 A;  4PG3 A;  2IY5 B;  1EIY A;  1BIB A;  4XEM A;  2QHT A;  2DTH A;  3L4G A;  3HRI A;  2RHQ A;  2DXU A;  2ALY B;  2DVE A;  3UFG A;  4CS2 A;  4BWA A;  3IKL A;  4YRJ A;  4CH6 A;  3QNE A;  4G84 A;  2EJF A;  3MQZ A;  2ZNI A;  3HY1 A;  2PME A;  1C0A A;  2Q7E A;  4H2X B;  1QF6 A;  4YRL A;  2E65 A;  3V7S A;  1NJ6 A;  4ZTU B;  2EWN A;  3BJU A;  1EVL A;  2ZR3 A;  1E22 A;  2CJ9 A;  4P73 C;  1BBW A;  3MF1 A;  2E5A A;  3ICA A;  2ZIO A;  3EFS A;  1JJC A;  2HNI A;  12AS A;  4LVJ A;  1ADJ A;  1B70 B;  1NJ1 A;  3A32 A;  3QTC A;  1SET A;  3HFV A;  1FYF A;  1KMN A;  1HTT A;  4YRQ A;  4H2S A;  4HA8 A;  2RHQ B;  4TVA A;  3A7U A;  1NJ8 A;  4P75 C;  1EVK A;  1ASY A;  3CMQ A;  4WJ4 A;  2DZ9 A;  4L87 A;  3RKX A;  3I7F A;  3WQZ A;  2ZIN A;  3RAC A;  4YRK A;  2P5I A;  2DTI A;  2ODR D;  1BBU A;  2IY5 A;  4XTX A;  2ZTG A;  5KNN A;  4H2V A;  2E10 A;  4XU1 A;  2ZCE A;  4Q6G A;  1NYR A;  2ALY A;  3TEG A;  4X5O A;  3A7A A;  3RGL A;  2ZGW A;  4HWO A;  4YRP A;  3A5Z A;  1EOV A;  1X01 A;  4LVM A;  4PHC A;  3TUP A;  1X54 A;  3HRK A;  1JJC B;  2RHS B;  4KR3 A;  1QE0 A;  3V8L A;  4CS3 A;  1LYL A;  3VQX A;  3NEL A;  2NS6 A;  3VQV A;  4WJ3 M;  1B8A A;  4XTZ A;  2I4N A;  4KQE A;  2DU7 A;  4NCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...