4P72C

Phers in complex with compound 2a
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
249
structure length
235
Chain Sequence
ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 68
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p72C01
4CH6A 4YRLA 3TEHA 3RKYA 3M4PA 2DDZA 2RHSB 3V8LA 1NNHA 4XTXA 2ZT7A 3IKMB 2DEQA 4XEMA 3V8JA 3NELA 2Q7GA 1YB3A 2I4LA 1GGMA 4P71A 4OP0A 4ZTZB 1W66A 12ASA 4H2XB 2EAYA 3PCOA 2Q5HA 2RHQB 4EO4A 1N9WA 2ZINA 3L1AA 2AMCA 4HWSA 2I4OA 1EIYB 4UP9A 3HXXA 3MF1A 1B7YB 1X55A 4YRGA 4XTWA 1ATIA 1G5HA 2ZIOA 4H2SA 3RIRA 2E64A 3NEMA 2ZR2A 1QF6A 2DQ3A 3L4GA 2DTOA 5F5WA 3MEYA 2HNIA 4H02A 3RL6A 11ASA 2RHSA 4CS3A 1C0AA 4XU0A 4H2WA 4HWPA 2EJGA 1HXDA 3I7FA 4H2YA 1B70A 3LC0A 3REUA 3TEHB 4YREA 2I4NA 1X56A 5E3IA 2ODRC 4K88A 3V7SA 1YFSA 2E65A 4H2TA 4XU3A 3A74A 3QTCA 4DPGA 2ZT8A 2DXTA 2DTHA 3E9HA 3M4QA 5HGQA 1WPYA 4YRSA 4H2UA 1B7YA 3NENA 4YCVA 3G1ZA 2QHUA 1SETA 2E3CA 3PCOB 3IALA 1H4QA 3P8YA 1LYLA 1B8AA 2AMCB 3RKXA 4YRJA 1E22A 2CJBA 3LSQA 4YYEA 4HWTA 3V7RA 1NYRA 1WQWA 1HC7A 2DU7A 3QO7A 4PHCA 4P73A 2ZT6A 2DTIA 4P71C 4XEOA 1ADYA 2ZZGA 3VQXA 1B76A 4YDQA 4TWAA 3TUPA 3DSQA 1B70B 2CIMA 2I4MA 4OLFA 3RUXA 1YFTA 1JJCA 2E10A 4YCUA 1YGBA 3P8TA 3E9IA 2ARSA 5C53B 4G85A 2P5IA 4LNSA 2ARTA 2PMFA 2G4CA 3HXVA 3VQVA 3V8KA 4L87A 4RMFA 3BFMA 4YRNA 1SERA 2FYKA 4P74A 4G84A 1BIBA 4YRMA 3EFSA 3HXUA 1IL2A 4EX5A 1PYSB 4YRRA 5C51B 1WU7A 4P75A 1USYC 3VQWA 1KMMA 3IKLA 3UGQA 4YRKA 3P8VA 4KQEA 4YROA 3V7CA 2DXUA 1J5WA 3FJPA 4TQDA 3UH0A 4CH4A 2ZGWA 3HXWA 4XTYA 2ARUA 4ZTUB 4DQ2A 2Q7EA 2ZT5A 1USYA 3QNEA 3A7AA 3QO5A 4HVCA 1EFWA 3RF1A 4RQEA 4RDXA 3PZCA 1NJ6A 2ODRD 1H4VB 1SESA 2J3MA 4CS4A 1WLEA 2ZCEA 3BJUA 4P3NA 4UP8A 1JJCB 4KR2A 3VQYA 4KR3A 4Q15A 3KFUA 4XTZA 2DZCA 1PYSA 1NJ5A 1WQ7A 4P73C 4CH3A 4HWOA 2DU5A 4P3PA 3RGLA 3ICAA 1X54A 3IG2A 3UGTA 2Q7HA 2ZNIA 1RIQA 4K86A 3WQZA 1BBUA 3R07A 4XTVA 3HFVA 1H4TA 3LSSA 1G51A 1QE0A 3REXA 2EJFA 3A32A 4TVAA 4TVWA 1Z7NA 3HFZA 4YP0A 2DZ9A 2XGTA 2DKGA 3EFRA 2Q5IA 2EJ9A 3RKWA 2ALYA 1WYDA 2CGHA 1ADJA 1Z7MA 3CMQA 3HY0A 3A7RA 4P74C 2QHVA 3A31A 5ELOA 4WI1A 2EWNA 4BWAA 4X5OA 1BBWA 4WJ4A 1EOVA 4XTUA 4P75C 1H4SA 4K87A 1X2HA 4WJ3M 4TQFA 4E51A 1FYFA 5ELNA 1NJ2A 2E1HA 2DQ0A 1EQRA 3NETA 3RACA 4YRIA 4XU1A 3A5ZA 2C7IA 4PG3A 4WF2A 3VBBA 2IY5B 4P72C 1E1OA 2C8MA 2QHSA 2CJAA 2AKWB 4BW9A 5K1PA 4YRFA 3TEGA 4J15A 1EVLA 2ZXFA 2ZR3A 2P0LA 5C52B 1E24A 4YRQA 4P72A 4HA8A 1EVKA 4CS2A 1X2GA 2ZZEA 4NCXA 1WNLA 1ASZA 2J3LA 1NJ1A 4P3OA 4Q6GA 2DJZA 2E41A 4TVAB 3HFZB 4H2VA 3HTZA 4XU2A 2ALYB 2ZNJA 2EL9A 1E1TA 2ZIMA 1L0WA 1SRYA 2QHTA 2PMEA 4H2XA 4YRPA 4RQFA 2DVEA 4CH5A 2IY5A 2RHQA 3HRKA 4ZIBA 3A5YA 3HRIA 4YRCA 4UP7A 3MF2A 1X01A 4TVYA 3OD1A 2ZZFA 1EIYA 3HY1A 2AKWA 1YFRA 3HXZA 2E5AA 1NYQA 1KOGA 5K1XA 1G5IA 5KNNA 1KMNA 3L2ZA 4HWRA 4YCWA 1BIAA 3HXYA 3W3SA 4AH6A 4UPAA 4O2DA 1NJ8A 3UFGA 4TTVA 4YPFA 2XTIA 2CJ9A 3ERRA 3QO8A 3A7UA 4YRTA 1ASYA 2ZTGA 1HTTA 3L4GB 1VQZA
chains in the Genus database with same CATH superfamily
4CH6A 4YRLA 3TEHA 3RKYA 3M4PA 2DDZA 2RHSB 3V8LA 1NNHA 4XTXA 2ZT7A 3IKMB 2DEQA 4XEMA 3V8JA 3NELA 2Q7GA 1YB3A 2I4LA 1GGMA 4P71A 4OP0A 4ZTZB 1W66A 12ASA 4H2XB 2EAYA 3PCOA 2Q5HA 2RHQB 4EO4A 1N9WA 2ZINA 3L1AA 2AMCA 4HWSA 2I4OA 1EIYB 4UP9A 3HXXA 3MF1A 1B7YB 1X55A 4YRGA 4XTWA 1ATIA 1G5HA 2ZIOA 4H2SA 3RIRA 2E64A 3NEMA 2ZR2A 1QF6A 2DQ3A 3L4GA 2DTOA 5F5WA 3MEYA 2HNIA 4H02A 3RL6A 11ASA 2RHSA 4CS3A 1C0AA 4XU0A 4H2WA 4HWPA 2EJGA 1HXDA 3I7FA 4H2YA 1B70A 3LC0A 3REUA 3TEHB 4YREA 4HT4A 2I4NA 1X56A 5E3IA 2ODRC 4K88A 3V7SA 1YFSA 2E65A 4H2TA 3A74A 3QTCA 4XU3A 4DPGA 2ZT8A 2DXTA 2DTHA 3E9HA 3M4QA 5HGQA 1WPYA 4YRSA 4H2UA 1B7YA 3NENA 4YCVA 3G1ZA 2QHUA 1SETA 2E3CA 3PCOB 3IALA 1H4QA 3P8YA 1LYLA 1B8AA 2AMCB 3RKXA 4YRJA 1E22A 2CJBA 3LSQA 4YYEA 4HWTA 3V7RA 1NYRA 1WQWA 1HC7A 2DU7A 3QO7A 4PHCA 4P73A 2ZT6A 2DTIA 4P71C 4XEOA 1ADYA 2ZZGA 3VQXA 1B76A 4YDQA 4TWAA 3TUPA 3DSQA 1B70B 2CIMA 2I4MA 4OLFA 3RUXA 1YFTA 1JJCA 2E10A 4YCUA 1YGBA 3P8TA 3E9IA 2ARSA 5C53B 4G85A 2P5IA 4LNSA 2ARTA 2PMFA 2G4CA 3HXVA 3VQVA 3V8KA 4L87A 4RMFA 3BFMA 4YRNA 1SERA 2FYKA 4P74A 4G84A 1BIBA 4YRMA 4LVJA 3EFSA 3HXUA 1IL2A 3MQZA 4EX5A 1PYSB 4YRRA 5C51B 1WU7A 4P75A 1USYC 3VQWA 1KMMA 3IKLA 3UGQA 4YRKA 3P8VA 4KQEA 4YROA 3V7CA 2DXUA 1J5WA 3FJPA 4TQDA 3UH0A 4CH4A 2ZGWA 3HXWA 4XTYA 2ARUA 4ZTUB 4DQ2A 2Q7EA 2ZT5A 1USYA 3QNEA 3A7AA 3QO5A 4HVCA 1EFWA 3RF1A 4RQEA 4RDXA 3PZCA 1NJ6A 2ODRD 4LVMA 1H4VB 1SESA 2J3MA 4CS4A 1WLEA 2ZCEA 3BJUA 4P3NA 4UP8A 1JJCB 4KR2A 3VQYA 4KR3A 4Q15A 3KFUA 4XTZA 2DZCA 1PYSA 1NJ5A 1WQ7A 4P73C 4CH3A 4HWOA 2DU5A 2A8EA 4P3PA 3RGLA 3ICAA 1X54A 3IG2A 3UGTA 2Q7HA 2ZNIA 4LVLA 1RIQA 4K86A 3WQZA 1BBUA 3R07A 4XTVA 3HFVA 1H4TA 3LSSA 1G51A 1QE0A 3REXA 2EJFA 3A32A 4TVAA 4TVWA 1Z7NA 3HFZA 4YP0A 2DZ9A 2XGTA 2DKGA 3EFRA 4LVKA 2Q5IA 2EJ9A 3RKWA 2ALYA 1WYDA 2CGHA 1ADJA 1Z7MA 3CMQA 3HY0A 3A7RA 4P74C 2QHVA 3A31A 2NS6A 5ELOA 4WI1A 2EWNA 4BWAA 4X5OA 1BBWA 4WJ4A 1EOVA 4XTUA 4P75C 1H4SA 4K87A 1X2HA 4WJ3M 4TQFA 4E51A 1FYFA 5ELNA 1NJ2A 2E1HA 2DQ0A 1EQRA 3NETA 3RACA 4YRIA 4XU1A 3A5ZA 2C7IA 4PG3A 4WF2A 3VBBA 2IY5B 4P72C 1E1OA 2C8MA 2QHSA 2CJAA 2AKWB 4BW9A 5K1PA 4YRFA 3TEGA 4J15A 1EVLA 2ZXFA 2ZR3A 2P0LA 5C52B 1E24A 4YRQA 4P72A 4HA8A 1EVKA 4LVIA 4CS2A 1X2GA 2ZZEA 4NCXA 1WNLA 1ASZA 2J3LA 1NJ1A 4P3OA 4Q6GA 2DJZA 2E41A 4TVAB 3HFZB 4H2VA 3HTZA 4XU2A 2ALYB 2ZNJA 2EL9A 1E1TA 2ZIMA 1L0WA 1SRYA 2QHTA 2PMEA 4H2XA 4YRPA 4RQFA 2DVEA 4CH5A 2IY5A 2RHQA 3HRKA 4ZIBA 3A5YA 3HRIA 4YRCA 4UP7A 3MF2A 1X01A 4TVYA 3OD1A 2ZZFA 1EIYA 3HY1A 2AKWA 1YFRA 3HXZA 2E5AA 1NYQA 1KOGA 5K1XA 1G5IA 5KNNA 1KMNA 3L2ZA 4HWRA 4YCWA 1BIAA 3HXYA 3W3SA 4AH6A 4UPAA 4O2DA 1NJ8A 3UFGA 4TTVA 4YPFA 2XTIA 2CJ9A 3ERRA 3QO8A 3A7UA 4YRTA 1ASYA 2ZTGA 1HTTA 3L4GB 1VQZA
chains in the Genus database with same CATH topology
4CH6A 4YRLA 3TEHA 3RKYA 3M4PA 2DDZA 2RHSB 3V8LA 1NNHA 4XTXA 2ZT7A 3IKMB 2DEQA 4XEMA 3V8JA 3NELA 2Q7GA 1YB3A 2I4LA 1GGMA 4P71A 4OP0A 4ZTZB 1W66A 12ASA 4H2XB 2EAYA 3PCOA 2Q5HA 2RHQB 4EO4A 1N9WA 2ZINA 3L1AA 2AMCA 4HWSA 2I4OA 1EIYB 4UP9A 3HXXA 3MF1A 1B7YB 1X55A 4YRGA 4XTWA 1ATIA 1G5HA 2ZIOA 4H2SA 3RIRA 2E64A 3NEMA 2ZR2A 1QF6A 2DQ3A 3L4GA 2DTOA 5F5WA 3MEYA 2HNIA 4H02A 3RL6A 11ASA 2RHSA 4CS3A 1C0AA 4XU0A 4H2WA 4HWPA 2EJGA 1HXDA 3I7FA 4H2YA 1B70A 3LC0A 3REUA 3TEHB 4YREA 4HT4A 2I4NA 1X56A 5E3IA 2ODRC 4K88A 3V7SA 1YFSA 2E65A 4H2TA 3A74A 3QTCA 4XU3A 4DPGA 2ZT8A 2DXTA 2DTHA 3E9HA 3M4QA 5HGQA 1WPYA 4YRSA 4H2UA 1B7YA 3NENA 4YCVA 3G1ZA 2QHUA 1SETA 2E3CA 3PCOB 3IALA 1H4QA 3P8YA 1LYLA 1B8AA 2AMCB 3RKXA 4YRJA 1E22A 2CJBA 3LSQA 4YYEA 4HWTA 3V7RA 1NYRA 1WQWA 1HC7A 2DU7A 3QO7A 4PHCA 4P73A 2ZT6A 2DTIA 4P71C 4XEOA 1ADYA 2ZZGA 3VQXA 1B76A 4YDQA 4TWAA 3TUPA 3DSQA 1B70B 2CIMA 2I4MA 4OLFA 3RUXA 1YFTA 1JJCA 2E10A 4YCUA 1YGBA 3P8TA 3E9IA 2ARSA 5C53B 4G85A 2P5IA 4LNSA 2ARTA 2PMFA 2G4CA 3HXVA 3VQVA 3V8KA 4L87A 4RMFA 3BFMA 4YRNA 1SERA 2FYKA 4P74A 4G84A 1BIBA 4YRMA 4LVJA 3EFSA 3HXUA 1IL2A 3MQZA 4EX5A 1PYSB 4YRRA 5C51B 1WU7A 4P75A 1USYC 3VQWA 1KMMA 3IKLA 3UGQA 4YRKA 3P8VA 4KQEA 4YROA 3V7CA 2DXUA 1J5WA 3FJPA 4TQDA 3UH0A 4CH4A 2ZGWA 3HXWA 4XTYA 2ARUA 4ZTUB 4DQ2A 2Q7EA 2ZT5A 1USYA 3QNEA 3A7AA 3QO5A 4HVCA 1EFWA 3RF1A 4RQEA 4RDXA 3PZCA 1NJ6A 2ODRD 4LVMA 1H4VB 1SESA 2J3MA 4CS4A 1WLEA 2ZCEA 3BJUA 4P3NA 4UP8A 1JJCB 4KR2A 3VQYA 4KR3A 4Q15A 3KFUA 4XTZA 2DZCA 1PYSA 1NJ5A 1WQ7A 4P73C 4CH3A 4HWOA 2DU5A 2A8EA 4P3PA 3RGLA 3ICAA 1X54A 3IG2A 3UGTA 2Q7HA 2ZNIA 4LVLA 1RIQA 4K86A 3WQZA 1BBUA 3R07A 4XTVA 3HFVA 1H4TA 3LSSA 1G51A 1QE0A 3REXA 2EJFA 3A32A 4TVAA 4TVWA 1Z7NA 3HFZA 4YP0A 2DZ9A 2XGTA 2DKGA 3EFRA 4LVKA 2Q5IA 2EJ9A 3RKWA 2ALYA 1WYDA 2CGHA 1ADJA 1Z7MA 3CMQA 3HY0A 3A7RA 4P74C 2QHVA 3A31A 2NS6A 5ELOA 4WI1A 2EWNA 4BWAA 4X5OA 1BBWA 4WJ4A 1EOVA 4XTUA 4P75C 1H4SA 4K87A 1X2HA 4WJ3M 4TQFA 4E51A 1FYFA 5ELNA 1NJ2A 2E1HA 2DQ0A 1EQRA 3NETA 3RACA 4YRIA 4XU1A 3A5ZA 2C7IA 4PG3A 4WF2A 3VBBA 2IY5B 4P72C 1E1OA 2C8MA 2QHSA 2CJAA 2AKWB 4BW9A 5K1PA 4YRFA 3TEGA 4J15A 1EVLA 2ZXFA 2ZR3A 2P0LA 5C52B 1E24A 4YRQA 4P72A 4HA8A 1EVKA 4LVIA 4CS2A 1X2GA 2ZZEA 4NCXA 1WNLA 1ASZA 2J3LA 1NJ1A 4P3OA 4Q6GA 2DJZA 2E41A 4TVAB 3HFZB 4H2VA 3HTZA 4XU2A 2ALYB 2ZNJA 2EL9A 1E1TA 2ZIMA 1L0WA 1SRYA 2QHTA 2PMEA 4H2XA 4YRPA 4RQFA 2DVEA 4CH5A 2IY5A 2RHQA 3HRKA 4ZIBA 3A5YA 3HRIA 4YRCA 4UP7A 3MF2A 1X01A 4TVYA 3OD1A 2ZZFA 1EIYA 3HY1A 2AKWA 1YFRA 3HXZA 2E5AA 1NYQA 1KOGA 5K1XA 1G5IA 5KNNA 1KMNA 3L2ZA 4HWRA 4YCWA 1BIAA 3HXYA 3W3SA 4AH6A 4UPAA 4O2DA 1NJ8A 3UFGA 4TTVA 4YPFA 2XTIA 2CJ9A 3ERRA 3QO8A 3A7UA 4YRTA 1ASYA 2ZTGA 1HTTA 3L4GB 1VQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CH6 A;  4YRL A;  3TEH A;  3RKY A;  3M4P A;  2DDZ A;  2RHS B;  3V8L A;  1NNH A;  4XTX A;  2ZT7 A;  3IKM B;  2DEQ A;  4XEM A;  3V8J A;  3NEL A;  2Q7G A;  1YB3 A;  2I4L A;  1GGM A;  4P71 A;  4OP0 A;  4ZTZ B;  1W66 A;  12AS A;  4H2X B;  2EAY A;  3PCO A;  2Q5H A;  2RHQ B;  4EO4 A;  1N9W A;  2ZIN A;  3L1A A;  2AMC A;  4HWS A;  2I4O A;  1EIY B;  4UP9 A;  3HXX A;  3MF1 A;  1B7Y B;  1X55 A;  4YRG A;  4XTW A;  1ATI A;  1G5H A;  2ZIO A;  4H2S A;  3RIR A;  2E64 A;  3NEM A;  2ZR2 A;  1QF6 A;  2DQ3 A;  3L4G A;  2DTO A;  5F5W A;  3MEY A;  2HNI A;  4H02 A;  3RL6 A;  11AS A;  2RHS A;  4CS3 A;  1C0A A;  4XU0 A;  4H2W A;  4HWP A;  2EJG A;  1HXD A;  3I7F A;  4H2Y A;  1B70 A;  3LC0 A;  3REU A;  3TEH B;  4YRE A;  2I4N A;  1X56 A;  5E3I A;  2ODR C;  4K88 A;  3V7S A;  1YFS A;  2E65 A;  4H2T A;  4XU3 A;  3A74 A;  3QTC A;  4DPG A;  2ZT8 A;  2DXT A;  2DTH A;  3E9H A;  3M4Q A;  5HGQ A;  1WPY A;  4YRS A;  4H2U A;  1B7Y A;  3NEN A;  4YCV A;  3G1Z A;  2QHU A;  1SET A;  2E3C A;  3PCO B;  3IAL A;  1H4Q A;  3P8Y A;  1LYL A;  1B8A A;  2AMC B;  3RKX A;  4YRJ A;  1E22 A;  2CJB A;  3LSQ A;  4YYE A;  4HWT A;  3V7R A;  1NYR A;  1WQW A;  1HC7 A;  2DU7 A;  3QO7 A;  4PHC A;  4P73 A;  2ZT6 A;  2DTI A;  4P71 C;  4XEO A;  1ADY A;  2ZZG A;  3VQX A;  1B76 A;  4YDQ A;  4TWA A;  3TUP A;  3DSQ A;  1B70 B;  2CIM A;  2I4M A;  4OLF A;  3RUX A;  1YFT A;  1JJC A;  2E10 A;  4YCU A;  1YGB A;  3P8T A;  3E9I A;  2ARS A;  5C53 B;  4G85 A;  2P5I A;  4LNS A;  2ART A;  2PMF A;  2G4C A;  3HXV A;  3VQV A;  3V8K A;  4L87 A;  4RMF A;  3BFM A;  4YRN A;  1SER A;  2FYK A;  4P74 A;  4G84 A;  1BIB A;  4YRM A;  3EFS A;  3HXU A;  1IL2 A;  4EX5 A;  1PYS B;  4YRR A;  5C51 B;  1WU7 A;  4P75 A;  1USY C;  3VQW A;  1KMM A;  3IKL A;  3UGQ A;  4YRK A;  3P8V A;  4KQE A;  4YRO A;  3V7C A;  2DXU A;  1J5W A;  3FJP A;  4TQD A;  3UH0 A;  4CH4 A;  2ZGW A;  3HXW A;  4XTY A;  2ARU A;  4ZTU B;  4DQ2 A;  2Q7E A;  2ZT5 A;  1USY A;  3QNE A;  3A7A A;  3QO5 A;  4HVC A;  1EFW A;  3RF1 A;  4RQE A;  4RDX A;  3PZC A;  1NJ6 A;  2ODR D;  1H4V B;  1SES A;  2J3M A;  4CS4 A;  1WLE A;  2ZCE A;  3BJU A;  4P3N A;  4UP8 A;  1JJC B;  4KR2 A;  3VQY A;  4KR3 A;  4Q15 A;  3KFU A;  4XTZ A;  2DZC A;  1PYS A;  1NJ5 A;  1WQ7 A;  4P73 C;  4CH3 A;  4HWO A;  2DU5 A;  4P3P A;  3RGL A;  3ICA A;  1X54 A;  3IG2 A;  3UGT A;  2Q7H A;  2ZNI A;  1RIQ A;  4K86 A;  3WQZ A;  1BBU A;  3R07 A;  4XTV A;  3HFV A;  1H4T A;  3LSS A;  1G51 A;  1QE0 A;  3REX A;  2EJF A;  3A32 A;  4TVA A;  4TVW A;  1Z7N A;  3HFZ A;  4YP0 A;  2DZ9 A;  2XGT A;  2DKG A;  3EFR A;  2Q5I A;  2EJ9 A;  3RKW A;  2ALY A;  1WYD A;  2CGH A;  1ADJ A;  1Z7M A;  3CMQ A;  3HY0 A;  3A7R A;  4P74 C;  2QHV A;  3A31 A;  5ELO A;  4WI1 A;  2EWN A;  4BWA A;  4X5O A;  1BBW A;  4WJ4 A;  1EOV A;  4XTU A;  4P75 C;  1H4S A;  4K87 A;  1X2H A;  4WJ3 M;  4TQF A;  4E51 A;  1FYF A;  5ELN A;  1NJ2 A;  2E1H A;  2DQ0 A;  1EQR A;  3NET A;  3RAC A;  4YRI A;  4XU1 A;  3A5Z A;  2C7I A;  4PG3 A;  4WF2 A;  3VBB A;  2IY5 B;  4P72 C;  1E1O A;  2C8M A;  2QHS A;  2CJA A;  2AKW B;  4BW9 A;  5K1P A;  4YRF A;  3TEG A;  4J15 A;  1EVL A;  2ZXF A;  2ZR3 A;  2P0L A;  5C52 B;  1E24 A;  4YRQ A;  4P72 A;  4HA8 A;  1EVK A;  4CS2 A;  1X2G A;  2ZZE A;  4NCX A;  1WNL A;  1ASZ A;  2J3L A;  1NJ1 A;  4P3O A;  4Q6G A;  2DJZ A;  2E41 A;  4TVA B;  3HFZ B;  4H2V A;  3HTZ A;  4XU2 A;  2ALY B;  2ZNJ A;  2EL9 A;  1E1T A;  2ZIM A;  1L0W A;  1SRY A;  2QHT A;  2PME A;  4H2X A;  4YRP A;  4RQF A;  2DVE A;  4CH5 A;  2IY5 A;  2RHQ A;  3HRK A;  4ZIB A;  3A5Y A;  3HRI A;  4YRC A;  4UP7 A;  3MF2 A;  1X01 A;  4TVY A;  3OD1 A;  2ZZF A;  1EIY A;  3HY1 A;  2AKW A;  1YFR A;  3HXZ A;  2E5A A;  1NYQ A;  1KOG A;  5K1X A;  1G5I A;  5KNN A;  1KMN A;  3L2Z A;  4HWR A;  4YCW A;  1BIA A;  3HXY A;  3W3S A;  4AH6 A;  4UPA A;  4O2D A;  1NJ8 A;  3UFG A;  4TTV A;  4YPF A;  2XTI A;  2CJ9 A;  3ERR A;  3QO8 A;  3A7U A;  4YRT A;  1ASY A;  2ZTG A;  1HTT A;  3L4G B;  1VQZ A; 
#chains in the Genus database with same CATH topology
 4CH6 A;  4YRL A;  3TEH A;  3RKY A;  3M4P A;  2DDZ A;  2RHS B;  3V8L A;  1NNH A;  4XTX A;  2ZT7 A;  3IKM B;  2DEQ A;  4XEM A;  3V8J A;  3NEL A;  2Q7G A;  1YB3 A;  2I4L A;  1GGM A;  4P71 A;  4OP0 A;  4ZTZ B;  1W66 A;  12AS A;  4H2X B;  2EAY A;  3PCO A;  2Q5H A;  2RHQ B;  4EO4 A;  1N9W A;  2ZIN A;  3L1A A;  2AMC A;  4HWS A;  2I4O A;  1EIY B;  4UP9 A;  3HXX A;  3MF1 A;  1B7Y B;  1X55 A;  4YRG A;  4XTW A;  1ATI A;  1G5H A;  2ZIO A;  4H2S A;  3RIR A;  2E64 A;  3NEM A;  2ZR2 A;  1QF6 A;  2DQ3 A;  3L4G A;  2DTO A;  5F5W A;  3MEY A;  2HNI A;  4H02 A;  3RL6 A;  11AS A;  2RHS A;  4CS3 A;  1C0A A;  4XU0 A;  4H2W A;  4HWP A;  2EJG A;  1HXD A;  3I7F A;  4H2Y A;  1B70 A;  3LC0 A;  3REU A;  3TEH B;  4YRE A;  4HT4 A;  2I4N A;  1X56 A;  5E3I A;  2ODR C;  4K88 A;  3V7S A;  1YFS A;  2E65 A;  4H2T A;  3A74 A;  3QTC A;  4XU3 A;  4DPG A;  2ZT8 A;  2DXT A;  2DTH A;  3E9H A;  3M4Q A;  5HGQ A;  1WPY A;  4YRS A;  4H2U A;  1B7Y A;  3NEN A;  4YCV A;  3G1Z A;  2QHU A;  1SET A;  2E3C A;  3PCO B;  3IAL A;  1H4Q A;  3P8Y A;  1LYL A;  1B8A A;  2AMC B;  3RKX A;  4YRJ A;  1E22 A;  2CJB A;  3LSQ A;  4YYE A;  4HWT A;  3V7R A;  1NYR A;  1WQW A;  1HC7 A;  2DU7 A;  3QO7 A;  4PHC A;  4P73 A;  2ZT6 A;  2DTI A;  4P71 C;  4XEO A;  1ADY A;  2ZZG A;  3VQX A;  1B76 A;  4YDQ A;  4TWA A;  3TUP A;  3DSQ A;  1B70 B;  2CIM A;  2I4M A;  4OLF A;  3RUX A;  1YFT A;  1JJC A;  2E10 A;  4YCU A;  1YGB A;  3P8T A;  3E9I A;  2ARS A;  5C53 B;  4G85 A;  2P5I A;  4LNS A;  2ART A;  2PMF A;  2G4C A;  3HXV A;  3VQV A;  3V8K A;  4L87 A;  4RMF A;  3BFM A;  4YRN A;  1SER A;  2FYK A;  4P74 A;  4G84 A;  1BIB A;  4YRM A;  4LVJ A;  3EFS A;  3HXU A;  1IL2 A;  3MQZ A;  4EX5 A;  1PYS B;  4YRR A;  5C51 B;  1WU7 A;  4P75 A;  1USY C;  3VQW A;  1KMM A;  3IKL A;  3UGQ A;  4YRK A;  3P8V A;  4KQE A;  4YRO A;  3V7C A;  2DXU A;  1J5W A;  3FJP A;  4TQD A;  3UH0 A;  4CH4 A;  2ZGW A;  3HXW A;  4XTY A;  2ARU A;  4ZTU B;  4DQ2 A;  2Q7E A;  2ZT5 A;  1USY A;  3QNE A;  3A7A A;  3QO5 A;  4HVC A;  1EFW A;  3RF1 A;  4RQE A;  4RDX A;  3PZC A;  1NJ6 A;  2ODR D;  4LVM A;  1H4V B;  1SES A;  2J3M A;  4CS4 A;  1WLE A;  2ZCE A;  3BJU A;  4P3N A;  4UP8 A;  1JJC B;  4KR2 A;  3VQY A;  4KR3 A;  4Q15 A;  3KFU A;  4XTZ A;  2DZC A;  1PYS A;  1NJ5 A;  1WQ7 A;  4P73 C;  4CH3 A;  4HWO A;  2DU5 A;  2A8E A;  4P3P A;  3RGL A;  3ICA A;  1X54 A;  3IG2 A;  3UGT A;  2Q7H A;  2ZNI A;  4LVL A;  1RIQ A;  4K86 A;  3WQZ A;  1BBU A;  3R07 A;  4XTV A;  3HFV A;  1H4T A;  3LSS A;  1G51 A;  1QE0 A;  3REX A;  2EJF A;  3A32 A;  4TVA A;  4TVW A;  1Z7N A;  3HFZ A;  4YP0 A;  2DZ9 A;  2XGT A;  2DKG A;  3EFR A;  4LVK A;  2Q5I A;  2EJ9 A;  3RKW A;  2ALY A;  1WYD A;  2CGH A;  1ADJ A;  1Z7M A;  3CMQ A;  3HY0 A;  3A7R A;  4P74 C;  2QHV A;  3A31 A;  2NS6 A;  5ELO A;  4WI1 A;  2EWN A;  4BWA A;  4X5O A;  1BBW A;  4WJ4 A;  1EOV A;  4XTU A;  4P75 C;  1H4S A;  4K87 A;  1X2H A;  4WJ3 M;  4TQF A;  4E51 A;  1FYF A;  5ELN A;  1NJ2 A;  2E1H A;  2DQ0 A;  1EQR A;  3NET A;  3RAC A;  4YRI A;  4XU1 A;  3A5Z A;  2C7I A;  4PG3 A;  4WF2 A;  3VBB A;  2IY5 B;  4P72 C;  1E1O A;  2C8M A;  2QHS A;  2CJA A;  2AKW B;  4BW9 A;  5K1P A;  4YRF A;  3TEG A;  4J15 A;  1EVL A;  2ZXF A;  2ZR3 A;  2P0L A;  5C52 B;  1E24 A;  4YRQ A;  4P72 A;  4HA8 A;  1EVK A;  4LVI A;  4CS2 A;  1X2G A;  2ZZE A;  4NCX A;  1WNL A;  1ASZ A;  2J3L A;  1NJ1 A;  4P3O A;  4Q6G A;  2DJZ A;  2E41 A;  4TVA B;  3HFZ B;  4H2V A;  3HTZ A;  4XU2 A;  2ALY B;  2ZNJ A;  2EL9 A;  1E1T A;  2ZIM A;  1L0W A;  1SRY A;  2QHT A;  2PME A;  4H2X A;  4YRP A;  4RQF A;  2DVE A;  4CH5 A;  2IY5 A;  2RHQ A;  3HRK A;  4ZIB A;  3A5Y A;  3HRI A;  4YRC A;  4UP7 A;  3MF2 A;  1X01 A;  4TVY A;  3OD1 A;  2ZZF A;  1EIY A;  3HY1 A;  2AKW A;  1YFR A;  3HXZ A;  2E5A A;  1NYQ A;  1KOG A;  5K1X A;  1G5I A;  5KNN A;  1KMN A;  3L2Z A;  4HWR A;  4YCW A;  1BIA A;  3HXY A;  3W3S A;  4AH6 A;  4UPA A;  4O2D A;  1NJ8 A;  3UFG A;  4TTV A;  4YPF A;  2XTI A;  2CJ9 A;  3ERR A;  3QO8 A;  3A7U A;  4YRT A;  1ASY A;  2ZTG A;  1HTT A;  3L4G B;  1VQZ A; 
#chains in the Genus database with same CATH homology
 4CH6 A;  4YRL A;  3TEH A;  3RKY A;  3M4P A;  2DDZ A;  2RHS B;  3V8L A;  1NNH A;  4XTX A;  2ZT7 A;  3IKM B;  2DEQ A;  4XEM A;  3V8J A;  3NEL A;  2Q7G A;  1YB3 A;  2I4L A;  1GGM A;  4P71 A;  4OP0 A;  4ZTZ B;  1W66 A;  12AS A;  4H2X B;  2EAY A;  3PCO A;  2Q5H A;  2RHQ B;  4EO4 A;  1N9W A;  2ZIN A;  3L1A A;  2AMC A;  4HWS A;  2I4O A;  1EIY B;  4UP9 A;  3HXX A;  3MF1 A;  1B7Y B;  1X55 A;  4YRG A;  4XTW A;  1ATI A;  1G5H A;  2ZIO A;  4H2S A;  3RIR A;  2E64 A;  3NEM A;  2ZR2 A;  1QF6 A;  2DQ3 A;  3L4G A;  2DTO A;  5F5W A;  3MEY A;  2HNI A;  4H02 A;  3RL6 A;  11AS A;  2RHS A;  4CS3 A;  1C0A A;  4XU0 A;  4H2W A;  4HWP A;  2EJG A;  1HXD A;  3I7F A;  4H2Y A;  1B70 A;  3LC0 A;  3REU A;  3TEH B;  4YRE A;  4HT4 A;  2I4N A;  1X56 A;  5E3I A;  2ODR C;  4K88 A;  3V7S A;  1YFS A;  2E65 A;  4H2T A;  3A74 A;  3QTC A;  4XU3 A;  4DPG A;  2ZT8 A;  2DXT A;  2DTH A;  3E9H A;  3M4Q A;  5HGQ A;  1WPY A;  4YRS A;  4H2U A;  1B7Y A;  3NEN A;  4YCV A;  3G1Z A;  2QHU A;  1SET A;  2E3C A;  3PCO B;  3IAL A;  1H4Q A;  3P8Y A;  1LYL A;  1B8A A;  2AMC B;  3RKX A;  4YRJ A;  1E22 A;  2CJB A;  3LSQ A;  4YYE A;  4HWT A;  3V7R A;  1NYR A;  1WQW A;  1HC7 A;  2DU7 A;  3QO7 A;  4PHC A;  4P73 A;  2ZT6 A;  2DTI A;  4P71 C;  4XEO A;  1ADY A;  2ZZG A;  3VQX A;  1B76 A;  4YDQ A;  4TWA A;  3TUP A;  3DSQ A;  1B70 B;  2CIM A;  2I4M A;  4OLF A;  3RUX A;  1YFT A;  1JJC A;  2E10 A;  4YCU A;  1YGB A;  3P8T A;  3E9I A;  2ARS A;  5C53 B;  4G85 A;  2P5I A;  4LNS A;  2ART A;  2PMF A;  2G4C A;  3HXV A;  3VQV A;  3V8K A;  4L87 A;  4RMF A;  3BFM A;  4YRN A;  1SER A;  2FYK A;  4P74 A;  4G84 A;  1BIB A;  4YRM A;  4LVJ A;  3EFS A;  3HXU A;  1IL2 A;  3MQZ A;  4EX5 A;  1PYS B;  4YRR A;  5C51 B;  1WU7 A;  4P75 A;  1USY C;  3VQW A;  1KMM A;  3IKL A;  3UGQ A;  4YRK A;  3P8V A;  4KQE A;  4YRO A;  3V7C A;  2DXU A;  1J5W A;  3FJP A;  4TQD A;  3UH0 A;  4CH4 A;  2ZGW A;  3HXW A;  4XTY A;  2ARU A;  4ZTU B;  4DQ2 A;  2Q7E A;  2ZT5 A;  1USY A;  3QNE A;  3A7A A;  3QO5 A;  4HVC A;  1EFW A;  3RF1 A;  4RQE A;  4RDX A;  3PZC A;  1NJ6 A;  2ODR D;  4LVM A;  1H4V B;  1SES A;  2J3M A;  4CS4 A;  1WLE A;  2ZCE A;  3BJU A;  4P3N A;  4UP8 A;  1JJC B;  4KR2 A;  3VQY A;  4KR3 A;  4Q15 A;  3KFU A;  4XTZ A;  2DZC A;  1PYS A;  1NJ5 A;  1WQ7 A;  4P73 C;  4CH3 A;  4HWO A;  2DU5 A;  2A8E A;  4P3P A;  3RGL A;  3ICA A;  1X54 A;  3IG2 A;  3UGT A;  2Q7H A;  2ZNI A;  4LVL A;  1RIQ A;  4K86 A;  3WQZ A;  1BBU A;  3R07 A;  4XTV A;  3HFV A;  1H4T A;  3LSS A;  1G51 A;  1QE0 A;  3REX A;  2EJF A;  3A32 A;  4TVA A;  4TVW A;  1Z7N A;  3HFZ A;  4YP0 A;  2DZ9 A;  2XGT A;  2DKG A;  3EFR A;  4LVK A;  2Q5I A;  2EJ9 A;  3RKW A;  2ALY A;  1WYD A;  2CGH A;  1ADJ A;  1Z7M A;  3CMQ A;  3HY0 A;  3A7R A;  4P74 C;  2QHV A;  3A31 A;  2NS6 A;  5ELO A;  4WI1 A;  2EWN A;  4BWA A;  4X5O A;  1BBW A;  4WJ4 A;  1EOV A;  4XTU A;  4P75 C;  1H4S A;  4K87 A;  1X2H A;  4WJ3 M;  4TQF A;  4E51 A;  1FYF A;  5ELN A;  1NJ2 A;  2E1H A;  2DQ0 A;  1EQR A;  3NET A;  3RAC A;  4YRI A;  4XU1 A;  3A5Z A;  2C7I A;  4PG3 A;  4WF2 A;  3VBB A;  2IY5 B;  4P72 C;  1E1O A;  2C8M A;  2QHS A;  2CJA A;  2AKW B;  4BW9 A;  5K1P A;  4YRF A;  3TEG A;  4J15 A;  1EVL A;  2ZXF A;  2ZR3 A;  2P0L A;  5C52 B;  1E24 A;  4YRQ A;  4P72 A;  4HA8 A;  1EVK A;  4LVI A;  4CS2 A;  1X2G A;  2ZZE A;  4NCX A;  1WNL A;  1ASZ A;  2J3L A;  1NJ1 A;  4P3O A;  4Q6G A;  2DJZ A;  2E41 A;  4TVA B;  3HFZ B;  4H2V A;  3HTZ A;  4XU2 A;  2ALY B;  2ZNJ A;  2EL9 A;  1E1T A;  2ZIM A;  1L0W A;  1SRY A;  2QHT A;  2PME A;  4H2X A;  4YRP A;  4RQF A;  2DVE A;  4CH5 A;  2IY5 A;  2RHQ A;  3HRK A;  4ZIB A;  3A5Y A;  3HRI A;  4YRC A;  4UP7 A;  3MF2 A;  1X01 A;  4TVY A;  3OD1 A;  2ZZF A;  1EIY A;  3HY1 A;  2AKW A;  1YFR A;  3HXZ A;  2E5A A;  1NYQ A;  1KOG A;  5K1X A;  1G5I A;  5KNN A;  1KMN A;  3L2Z A;  4HWR A;  4YCW A;  1BIA A;  3HXY A;  3W3S A;  4AH6 A;  4UPA A;  4O2D A;  1NJ8 A;  3UFG A;  4TTV A;  4YPF A;  2XTI A;  2CJ9 A;  3ERR A;  3QO8 A;  3A7U A;  4YRT A;  1ASY A;  2ZTG A;  1HTT A;  3L4G B;  1VQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...