4P72C

Phers in complex with compound 2a
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
249
structure length
235
Chain Sequence
ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
total genus 68
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p72C01
5C51B 1EOVA 5ELNA 4K87A 1B8AA 2DQ0A 2DU5A 2RHSA 3HXXA 4Q15A 2EJ9A 4YDQA 2ZT8A 4WF2A 1G5HA 3WQZA 2EJGA 4UP8A 1NYRA 2ZXFA 1WQ7A 2AKWA 4XU0A 5C53B 4TTVA 3IALA 3HFZA 3VQVA 2DXUA 2PMEA 4YRPA 3LSSA 3NETA 2XGTA 1WYDA 5E3IA 4CS4A 3HFVA 4H2XA 1BIBA 3L2ZA 4TVAA 3V8KA 3M4PA 1NNHA 4CH4A 4UP7A 4YRFA 4CH5A 3EFSA 1W66A 2I4NA 4WJ3M 1PYSA 4P3PA 4XTZA 2QHTA 4OLFA 4P71A 1EVKA 1SRYA 3TEHA 3HRIA 4KR3A 1B70B 2CJ9A 4XU3A 3RUXA 4P72A 1JJCA 4YROA 3RKXA 1X56A 2ODRD 3VQXA 4DQ2A 5F5WA 2E5AA 4PG3A 4H2YA 1G51A 4XTUA 2ALYA 2DZCA 4YCVA 2P5IA 3QO8A 3BFMA 2Q5HA 1ADJA 1G5IA 3LSQA 4ZTUB 4HWTA 3ERRA 1HTTA 3MF1A 2DEQA 2QHVA 4H2VA 3A74A 1WNLA 2ARUA 4DPGA 3MEYA 3A7AA 3A7UA 1WU7A 4K88A 3OD1A 1EIYB 2DTHA 1E22A 2ZIMA 1RIQA 1NJ8A 4NCXA 2C7IA 2ZGWA 1ATIA 1H4SA 1X2HA 4OP0A 2IY5A 4EX5A 2DU7A 5ELOA 3L4GB 1GGMA 4P3NA 4Q6GA 4TWAA 2Q7EA 2CIMA 3PZCA 3FJPA 2DVEA 4TQFA 4G85A 1ADYA 3A32A 3LC0A 3A5ZA 1QF6A 3V7SA 3HXUA 4RDXA 4TVYA 2DTIA 1SETA 2DJZA 1Z7MA 4XU2A 2EWNA 2ZINA 3HXYA 2C8MA 2RHQA 3TUPA 3P8VA 3MF2A 3ICAA 2DDZA 2AMCB 3PCOB 1Z7NA 4O2DA 2DZ9A 4XTYA 4EO4A 4H2TA 3NELA 2DXTA 1LYLA 4RQFA 3A7RA 3V7CA 1E1TA 2E41A 2ZT7A 2ZZGA 1BBUA 2EJFA 1H4VB 4WJ4A 2EAYA 4YYEA 3NENA 3G1ZA 4ZIBA 2J3MA 3HXVA 4P3OA 1EQRA 4RQEA 1B7YB 3IKLA 3RKYA 4E51A 4YRSA 4CS2A 3R07A 4XEOA 3RIRA 4HVCA 3HRKA 2RHSB 3V8LA 1SESA 4HWSA 4CS3A 2Q7GA 2Q5IA 2G4CA 3HY1A 4BW9A 4YRKA 2QHUA 4P74C 4YP0A 3RKWA 4LNSA 2DTOA 1EFWA 4CH6A 1YFTA 2FYKA 4YPFA 1IL2A 2AKWB 1YB3A 2E64A 11ASA 1HXDA 1KMMA 3HFZB 3EFRA 3I7FA 5K1PA 3IKMB 2ARSA 3V8JA 1USYC 3HY0A 4HA8A 4H2XB 2E3CA 4P73C 3RL6A 4TVAB 1NJ2A 1KMNA 4TQDA 4H2UA 1BBWA 3KFUA 3V7RA 2CJBA 4XU1A 1N9WA 1WLEA 2ZR3A 2ZNJA 4HWRA 4G84A 4HWPA 2CJAA 3BJUA 1PYSB 1BIAA 3VQYA 2ZR2A 3REUA 4P75C 1X54A 3IG2A 4YRGA 3TEHB 3UGTA 4ZTZB 2PMFA 1EVLA 3UGQA 3RGLA 1E24A 1JJCB 2J3LA 3REXA 1X01A 3VBBA 4H2WA 1ASZA 4BWAA 1YFRA 4YRQA 3RF1A 4KR2A 2I4LA 2ALYB 4CH3A 4KQEA 1H4QA 5KNNA 4YREA 1HC7A 4YRNA 3A5YA 4YRLA 2DQ3A 4XTVA 3CMQA 1WPYA 5K1XA 1FYFA 1WQWA 4UPAA 1NYQA 4K86A 3P8YA 1B76A 2I4MA 4AH6A 3HXZA 1J5WA 3L1AA 1SERA 1L0WA 4P74A 3HTZA 5C52B 4YRCA 2CGHA 1KOGA 4TVWA 1X2GA 2ZT6A 2DKGA 1EIYA 4HWOA 1YFSA 3M4QA 4YRTA 4YRIA 4RMFA 2IY5B 3RACA 1X55A 3VQWA 1USYA 4YRJA 5HGQA 3DSQA 3NEMA 12ASA 4YCUA 4P73A 2ODRC 4H02A 3L4GA 3E9IA 3P8TA 2ZZFA 2QHSA 2ZCEA 1YGBA 3UH0A 3QNEA 4P75A 3E9HA 3A31A 2RHQB 2ZT5A 2Q7HA 4XTXA 4YRMA 1H4TA 4X5OA 1NJ1A 2E1HA 3TEGA 1ASYA 4PHCA 1QE0A 2AMCA 4WI1A 3PCOA 4UP9A 3QO7A 2ZZEA 1NJ6A 4P71C 3QO5A 2I4OA 2HNIA 2P0LA 3W3SA 3QTCA 4P72C 2ZNIA 4XTWA 2ZIOA 1NJ5A 4YCWA 3HXWA 4J15A 1E1OA 2E10A 2E65A 2EL9A 3UFGA 2ZTGA 4YRRA 4H2SA 4XEMA 2XTIA 1B7YA 2ARTA 4L87A 1B70A 1C0AA 1VQZA
chains in the Genus database with same CATH superfamily
5C51B 1EOVA 5ELNA 4K87A 1B8AA 2DQ0A 2DU5A 2RHSA 3HXXA 4Q15A 2EJ9A 4YDQA 2ZT8A 4WF2A 1G5HA 3WQZA 2EJGA 4UP8A 1NYRA 2ZXFA 1WQ7A 2AKWA 4XU0A 5C53B 4TTVA 3IALA 3HFZA 3VQVA 2DXUA 2PMEA 4YRPA 3LSSA 3NETA 2XGTA 1WYDA 5E3IA 4LVKA 4CS4A 3HFVA 4H2XA 1BIBA 3L2ZA 2A8EA 4TVAA 3V8KA 3M4PA 1NNHA 4CH4A 4UP7A 4YRFA 4CH5A 3EFSA 1W66A 2I4NA 4WJ3M 1PYSA 4P3PA 4XTZA 2QHTA 4OLFA 4P71A 1EVKA 1SRYA 3TEHA 3HRIA 4KR3A 1B70B 2CJ9A 4XU3A 3RUXA 4P72A 1JJCA 4YROA 3RKXA 1X56A 2ODRD 3VQXA 4DQ2A 5F5WA 2E5AA 4PG3A 4H2YA 1G51A 4XTUA 2ALYA 2DZCA 4YCVA 2P5IA 3QO8A 3BFMA 2Q5HA 1ADJA 1G5IA 3LSQA 4ZTUB 4HWTA 3ERRA 1HTTA 3MF1A 2DEQA 2QHVA 4H2VA 3A74A 1WNLA 2ARUA 4DPGA 3MEYA 3A7AA 3A7UA 1WU7A 4K88A 3OD1A 1EIYB 2DTHA 1E22A 2ZIMA 1RIQA 1NJ8A 4NCXA 2C7IA 3MQZA 2ZGWA 1ATIA 1H4SA 1X2HA 4OP0A 2IY5A 4EX5A 2DU7A 5ELOA 3L4GB 1GGMA 4P3NA 4Q6GA 4TWAA 2Q7EA 2CIMA 3PZCA 3FJPA 2DVEA 4TQFA 4G85A 1ADYA 3A32A 3LC0A 3A5ZA 1QF6A 3V7SA 3HXUA 4RDXA 4TVYA 2DTIA 1SETA 2DJZA 1Z7MA 4XU2A 2EWNA 2ZINA 3HXYA 2C8MA 2RHQA 4LVJA 3TUPA 3P8VA 3MF2A 3ICAA 2DDZA 2AMCB 3PCOB 1Z7NA 4O2DA 2DZ9A 4XTYA 4EO4A 4H2TA 3NELA 2DXTA 1LYLA 4RQFA 3A7RA 3V7CA 1E1TA 2E41A 2ZT7A 2ZZGA 1BBUA 2EJFA 1H4VB 4WJ4A 2EAYA 4YYEA 3NENA 3G1ZA 4ZIBA 2J3MA 3HXVA 4P3OA 1EQRA 4RQEA 1B7YB 3IKLA 3RKYA 4E51A 4YRSA 4CS2A 3R07A 4XEOA 3RIRA 4HVCA 3HRKA 2RHSB 3V8LA 1SESA 4HWSA 4CS3A 2Q7GA 2Q5IA 2G4CA 3HY1A 4BW9A 4YRKA 2QHUA 4P74C 4YP0A 3RKWA 4LNSA 2DTOA 1EFWA 4CH6A 1YFTA 2FYKA 4YPFA 1IL2A 2AKWB 1YB3A 2E64A 11ASA 1HXDA 1KMMA 3HFZB 3EFRA 3I7FA 5K1PA 3IKMB 2ARSA 3V8JA 4HT4A 1USYC 3HY0A 4HA8A 4H2XB 2E3CA 4P73C 3RL6A 4TVAB 1NJ2A 1KMNA 4TQDA 4H2UA 1BBWA 3KFUA 3V7RA 2CJBA 4XU1A 1N9WA 1WLEA 2ZR3A 2ZNJA 4HWRA 4G84A 4HWPA 2CJAA 3BJUA 1PYSB 1BIAA 3VQYA 2ZR2A 4LVIA 3REUA 4P75C 1X54A 3IG2A 4YRGA 3TEHB 3UGTA 4ZTZB 2PMFA 1EVLA 3UGQA 3RGLA 1E24A 1JJCB 2J3LA 3REXA 1X01A 3VBBA 4H2WA 1ASZA 4BWAA 1YFRA 4YRQA 3RF1A 2NS6A 4KR2A 2I4LA 2ALYB 4CH3A 4KQEA 1H4QA 5KNNA 4YREA 1HC7A 4YRNA 3A5YA 4YRLA 2DQ3A 4XTVA 3CMQA 1WPYA 5K1XA 1FYFA 1WQWA 4UPAA 1NYQA 4K86A 3P8YA 1B76A 2I4MA 4AH6A 3HXZA 1J5WA 3L1AA 1SERA 1L0WA 4LVMA 4P74A 3HTZA 5C52B 4YRCA 2CGHA 1KOGA 4TVWA 1X2GA 2ZT6A 2DKGA 1EIYA 4HWOA 1YFSA 3M4QA 4YRTA 4YRIA 4RMFA 2IY5B 3RACA 1X55A 3VQWA 1USYA 4YRJA 5HGQA 3DSQA 3NEMA 12ASA 4YCUA 4P73A 2ODRC 4H02A 3L4GA 3E9IA 3P8TA 2ZZFA 2QHSA 2ZCEA 1YGBA 3UH0A 3QNEA 4P75A 3E9HA 3A31A 2RHQB 2ZT5A 4LVLA 2Q7HA 4XTXA 4YRMA 1H4TA 4X5OA 1NJ1A 2E1HA 3TEGA 1ASYA 4PHCA 1QE0A 2AMCA 4WI1A 3PCOA 4UP9A 3QO7A 2ZZEA 1NJ6A 4P71C 3QO5A 2I4OA 2HNIA 2P0LA 3W3SA 3QTCA 4P72C 2ZNIA 4XTWA 2ZIOA 1NJ5A 4YCWA 3HXWA 4J15A 1E1OA 2E10A 2E65A 2EL9A 3UFGA 2ZTGA 4YRRA 4H2SA 4XEMA 2XTIA 1B7YA 2ARTA 4L87A 1B70A 1C0AA 1VQZA
chains in the Genus database with same CATH topology
5C51B 1EOVA 5ELNA 4K87A 1B8AA 2DQ0A 2DU5A 2RHSA 3HXXA 4Q15A 2EJ9A 4YDQA 2ZT8A 4WF2A 1G5HA 3WQZA 2EJGA 4UP8A 1NYRA 2ZXFA 1WQ7A 2AKWA 4XU0A 5C53B 4TTVA 3IALA 3HFZA 3VQVA 2DXUA 2PMEA 4YRPA 3LSSA 3NETA 2XGTA 1WYDA 5E3IA 4LVKA 4CS4A 3HFVA 4H2XA 1BIBA 3L2ZA 2A8EA 4TVAA 3V8KA 3M4PA 1NNHA 4CH4A 4UP7A 4YRFA 4CH5A 3EFSA 1W66A 2I4NA 4WJ3M 1PYSA 4P3PA 4XTZA 2QHTA 4OLFA 4P71A 1EVKA 1SRYA 3TEHA 3HRIA 4KR3A 1B70B 2CJ9A 4XU3A 3RUXA 4P72A 1JJCA 4YROA 3RKXA 1X56A 2ODRD 3VQXA 4DQ2A 5F5WA 2E5AA 4PG3A 4H2YA 1G51A 4XTUA 2ALYA 2DZCA 4YCVA 2P5IA 3QO8A 3BFMA 2Q5HA 1ADJA 1G5IA 3LSQA 4ZTUB 4HWTA 3ERRA 1HTTA 3MF1A 2DEQA 2QHVA 4H2VA 3A74A 1WNLA 2ARUA 4DPGA 3MEYA 3A7AA 3A7UA 1WU7A 4K88A 3OD1A 1EIYB 2DTHA 1E22A 2ZIMA 1RIQA 1NJ8A 4NCXA 2C7IA 3MQZA 2ZGWA 1ATIA 1H4SA 1X2HA 4OP0A 2IY5A 4EX5A 2DU7A 5ELOA 3L4GB 1GGMA 4P3NA 4Q6GA 4TWAA 2Q7EA 2CIMA 3PZCA 3FJPA 2DVEA 4TQFA 4G85A 1ADYA 3A32A 3LC0A 3A5ZA 1QF6A 3V7SA 3HXUA 4RDXA 4TVYA 2DTIA 1SETA 2DJZA 1Z7MA 4XU2A 2EWNA 2ZINA 3HXYA 2C8MA 2RHQA 4LVJA 3TUPA 3P8VA 3MF2A 3ICAA 2DDZA 2AMCB 3PCOB 1Z7NA 4O2DA 2DZ9A 4XTYA 4EO4A 4H2TA 3NELA 2DXTA 1LYLA 4RQFA 3A7RA 3V7CA 1E1TA 2E41A 2ZT7A 2ZZGA 1BBUA 2EJFA 1H4VB 4WJ4A 2EAYA 4YYEA 3NENA 3G1ZA 4ZIBA 2J3MA 3HXVA 4P3OA 1EQRA 4RQEA 1B7YB 3IKLA 3RKYA 4E51A 4YRSA 4CS2A 3R07A 4XEOA 3RIRA 4HVCA 3HRKA 2RHSB 3V8LA 1SESA 4HWSA 4CS3A 2Q7GA 2Q5IA 2G4CA 3HY1A 4BW9A 4YRKA 2QHUA 4P74C 4YP0A 3RKWA 4LNSA 2DTOA 1EFWA 4CH6A 1YFTA 2FYKA 4YPFA 1IL2A 2AKWB 1YB3A 2E64A 11ASA 1HXDA 1KMMA 3HFZB 3EFRA 3I7FA 5K1PA 3IKMB 2ARSA 3V8JA 4HT4A 1USYC 3HY0A 4HA8A 4H2XB 2E3CA 4P73C 3RL6A 4TVAB 1NJ2A 1KMNA 4TQDA 4H2UA 1BBWA 3KFUA 3V7RA 2CJBA 4XU1A 1N9WA 1WLEA 2ZR3A 2ZNJA 4HWRA 4G84A 4HWPA 2CJAA 3BJUA 1PYSB 1BIAA 3VQYA 2ZR2A 4LVIA 3REUA 4P75C 1X54A 3IG2A 4YRGA 3TEHB 3UGTA 4ZTZB 2PMFA 1EVLA 3UGQA 3RGLA 1E24A 1JJCB 2J3LA 3REXA 1X01A 3VBBA 4H2WA 1ASZA 4BWAA 1YFRA 4YRQA 3RF1A 2NS6A 4KR2A 2I4LA 2ALYB 4CH3A 4KQEA 1H4QA 5KNNA 4YREA 1HC7A 4YRNA 3A5YA 4YRLA 2DQ3A 4XTVA 3CMQA 1WPYA 5K1XA 1FYFA 1WQWA 4UPAA 1NYQA 4K86A 3P8YA 1B76A 2I4MA 4AH6A 3HXZA 1J5WA 3L1AA 1SERA 1L0WA 4LVMA 4P74A 3HTZA 5C52B 4YRCA 2CGHA 1KOGA 4TVWA 1X2GA 2ZT6A 2DKGA 1EIYA 4HWOA 1YFSA 3M4QA 4YRTA 4YRIA 4RMFA 2IY5B 3RACA 1X55A 3VQWA 1USYA 4YRJA 5HGQA 3DSQA 3NEMA 12ASA 4YCUA 4P73A 2ODRC 4H02A 3L4GA 3E9IA 3P8TA 2ZZFA 2QHSA 2ZCEA 1YGBA 3UH0A 3QNEA 4P75A 3E9HA 3A31A 2RHQB 2ZT5A 4LVLA 2Q7HA 4XTXA 4YRMA 1H4TA 4X5OA 1NJ1A 2E1HA 3TEGA 1ASYA 4PHCA 1QE0A 2AMCA 4WI1A 3PCOA 4UP9A 3QO7A 2ZZEA 1NJ6A 4P71C 3QO5A 2I4OA 2HNIA 2P0LA 3W3SA 3QTCA 4P72C 2ZNIA 4XTWA 2ZIOA 1NJ5A 4YCWA 3HXWA 4J15A 1E1OA 2E10A 2E65A 2EL9A 3UFGA 2ZTGA 4YRRA 4H2SA 4XEMA 2XTIA 1B7YA 2ARTA 4L87A 1B70A 1C0AA 1VQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C51 B;  1EOV A;  5ELN A;  4K87 A;  1B8A A;  2DQ0 A;  2DU5 A;  2RHS A;  3HXX A;  4Q15 A;  2EJ9 A;  4YDQ A;  2ZT8 A;  4WF2 A;  1G5H A;  3WQZ A;  2EJG A;  4UP8 A;  1NYR A;  2ZXF A;  1WQ7 A;  2AKW A;  4XU0 A;  5C53 B;  4TTV A;  3IAL A;  3HFZ A;  3VQV A;  2DXU A;  2PME A;  4YRP A;  3LSS A;  3NET A;  2XGT A;  1WYD A;  5E3I A;  4CS4 A;  3HFV A;  4H2X A;  1BIB A;  3L2Z A;  4TVA A;  3V8K A;  3M4P A;  1NNH A;  4CH4 A;  4UP7 A;  4YRF A;  4CH5 A;  3EFS A;  1W66 A;  2I4N A;  4WJ3 M;  1PYS A;  4P3P A;  4XTZ A;  2QHT A;  4OLF A;  4P71 A;  1EVK A;  1SRY A;  3TEH A;  3HRI A;  4KR3 A;  1B70 B;  2CJ9 A;  4XU3 A;  3RUX A;  4P72 A;  1JJC A;  4YRO A;  3RKX A;  1X56 A;  2ODR D;  3VQX A;  4DQ2 A;  5F5W A;  2E5A A;  4PG3 A;  4H2Y A;  1G51 A;  4XTU A;  2ALY A;  2DZC A;  4YCV A;  2P5I A;  3QO8 A;  3BFM A;  2Q5H A;  1ADJ A;  1G5I A;  3LSQ A;  4ZTU B;  4HWT A;  3ERR A;  1HTT A;  3MF1 A;  2DEQ A;  2QHV A;  4H2V A;  3A74 A;  1WNL A;  2ARU A;  4DPG A;  3MEY A;  3A7A A;  3A7U A;  1WU7 A;  4K88 A;  3OD1 A;  1EIY B;  2DTH A;  1E22 A;  2ZIM A;  1RIQ A;  1NJ8 A;  4NCX A;  2C7I A;  2ZGW A;  1ATI A;  1H4S A;  1X2H A;  4OP0 A;  2IY5 A;  4EX5 A;  2DU7 A;  5ELO A;  3L4G B;  1GGM A;  4P3N A;  4Q6G A;  4TWA A;  2Q7E A;  2CIM A;  3PZC A;  3FJP A;  2DVE A;  4TQF A;  4G85 A;  1ADY A;  3A32 A;  3LC0 A;  3A5Z A;  1QF6 A;  3V7S A;  3HXU A;  4RDX A;  4TVY A;  2DTI A;  1SET A;  2DJZ A;  1Z7M A;  4XU2 A;  2EWN A;  2ZIN A;  3HXY A;  2C8M A;  2RHQ A;  3TUP A;  3P8V A;  3MF2 A;  3ICA A;  2DDZ A;  2AMC B;  3PCO B;  1Z7N A;  4O2D A;  2DZ9 A;  4XTY A;  4EO4 A;  4H2T A;  3NEL A;  2DXT A;  1LYL A;  4RQF A;  3A7R A;  3V7C A;  1E1T A;  2E41 A;  2ZT7 A;  2ZZG A;  1BBU A;  2EJF A;  1H4V B;  4WJ4 A;  2EAY A;  4YYE A;  3NEN A;  3G1Z A;  4ZIB A;  2J3M A;  3HXV A;  4P3O A;  1EQR A;  4RQE A;  1B7Y B;  3IKL A;  3RKY A;  4E51 A;  4YRS A;  4CS2 A;  3R07 A;  4XEO A;  3RIR A;  4HVC A;  3HRK A;  2RHS B;  3V8L A;  1SES A;  4HWS A;  4CS3 A;  2Q7G A;  2Q5I A;  2G4C A;  3HY1 A;  4BW9 A;  4YRK A;  2QHU A;  4P74 C;  4YP0 A;  3RKW A;  4LNS A;  2DTO A;  1EFW A;  4CH6 A;  1YFT A;  2FYK A;  4YPF A;  1IL2 A;  2AKW B;  1YB3 A;  2E64 A;  11AS A;  1HXD A;  1KMM A;  3HFZ B;  3EFR A;  3I7F A;  5K1P A;  3IKM B;  2ARS A;  3V8J A;  1USY C;  3HY0 A;  4HA8 A;  4H2X B;  2E3C A;  4P73 C;  3RL6 A;  4TVA B;  1NJ2 A;  1KMN A;  4TQD A;  4H2U A;  1BBW A;  3KFU A;  3V7R A;  2CJB A;  4XU1 A;  1N9W A;  1WLE A;  2ZR3 A;  2ZNJ A;  4HWR A;  4G84 A;  4HWP A;  2CJA A;  3BJU A;  1PYS B;  1BIA A;  3VQY A;  2ZR2 A;  3REU A;  4P75 C;  1X54 A;  3IG2 A;  4YRG A;  3TEH B;  3UGT A;  4ZTZ B;  2PMF A;  1EVL A;  3UGQ A;  3RGL A;  1E24 A;  1JJC B;  2J3L A;  3REX A;  1X01 A;  3VBB A;  4H2W A;  1ASZ A;  4BWA A;  1YFR A;  4YRQ A;  3RF1 A;  4KR2 A;  2I4L A;  2ALY B;  4CH3 A;  4KQE A;  1H4Q A;  5KNN A;  4YRE A;  1HC7 A;  4YRN A;  3A5Y A;  4YRL A;  2DQ3 A;  4XTV A;  3CMQ A;  1WPY A;  5K1X A;  1FYF A;  1WQW A;  4UPA A;  1NYQ A;  4K86 A;  3P8Y A;  1B76 A;  2I4M A;  4AH6 A;  3HXZ A;  1J5W A;  3L1A A;  1SER A;  1L0W A;  4P74 A;  3HTZ A;  5C52 B;  4YRC A;  2CGH A;  1KOG A;  4TVW A;  1X2G A;  2ZT6 A;  2DKG A;  1EIY A;  4HWO A;  1YFS A;  3M4Q A;  4YRT A;  4YRI A;  4RMF A;  2IY5 B;  3RAC A;  1X55 A;  3VQW A;  1USY A;  4YRJ A;  5HGQ A;  3DSQ A;  3NEM A;  12AS A;  4YCU A;  4P73 A;  2ODR C;  4H02 A;  3L4G A;  3E9I A;  3P8T A;  2ZZF A;  2QHS A;  2ZCE A;  1YGB A;  3UH0 A;  3QNE A;  4P75 A;  3E9H A;  3A31 A;  2RHQ B;  2ZT5 A;  2Q7H A;  4XTX A;  4YRM A;  1H4T A;  4X5O A;  1NJ1 A;  2E1H A;  3TEG A;  1ASY A;  4PHC A;  1QE0 A;  2AMC A;  4WI1 A;  3PCO A;  4UP9 A;  3QO7 A;  2ZZE A;  1NJ6 A;  4P71 C;  3QO5 A;  2I4O A;  2HNI A;  2P0L A;  3W3S A;  3QTC A;  4P72 C;  2ZNI A;  4XTW A;  2ZIO A;  1NJ5 A;  4YCW A;  3HXW A;  4J15 A;  1E1O A;  2E10 A;  2E65 A;  2EL9 A;  3UFG A;  2ZTG A;  4YRR A;  4H2S A;  4XEM A;  2XTI A;  1B7Y A;  2ART A;  4L87 A;  1B70 A;  1C0A A;  1VQZ A; 
#chains in the Genus database with same CATH topology
 5C51 B;  1EOV A;  5ELN A;  4K87 A;  1B8A A;  2DQ0 A;  2DU5 A;  2RHS A;  3HXX A;  4Q15 A;  2EJ9 A;  4YDQ A;  2ZT8 A;  4WF2 A;  1G5H A;  3WQZ A;  2EJG A;  4UP8 A;  1NYR A;  2ZXF A;  1WQ7 A;  2AKW A;  4XU0 A;  5C53 B;  4TTV A;  3IAL A;  3HFZ A;  3VQV A;  2DXU A;  2PME A;  4YRP A;  3LSS A;  3NET A;  2XGT A;  1WYD A;  5E3I A;  4LVK A;  4CS4 A;  3HFV A;  4H2X A;  1BIB A;  3L2Z A;  2A8E A;  4TVA A;  3V8K A;  3M4P A;  1NNH A;  4CH4 A;  4UP7 A;  4YRF A;  4CH5 A;  3EFS A;  1W66 A;  2I4N A;  4WJ3 M;  1PYS A;  4P3P A;  4XTZ A;  2QHT A;  4OLF A;  4P71 A;  1EVK A;  1SRY A;  3TEH A;  3HRI A;  4KR3 A;  1B70 B;  2CJ9 A;  4XU3 A;  3RUX A;  4P72 A;  1JJC A;  4YRO A;  3RKX A;  1X56 A;  2ODR D;  3VQX A;  4DQ2 A;  5F5W A;  2E5A A;  4PG3 A;  4H2Y A;  1G51 A;  4XTU A;  2ALY A;  2DZC A;  4YCV A;  2P5I A;  3QO8 A;  3BFM A;  2Q5H A;  1ADJ A;  1G5I A;  3LSQ A;  4ZTU B;  4HWT A;  3ERR A;  1HTT A;  3MF1 A;  2DEQ A;  2QHV A;  4H2V A;  3A74 A;  1WNL A;  2ARU A;  4DPG A;  3MEY A;  3A7A A;  3A7U A;  1WU7 A;  4K88 A;  3OD1 A;  1EIY B;  2DTH A;  1E22 A;  2ZIM A;  1RIQ A;  1NJ8 A;  4NCX A;  2C7I A;  3MQZ A;  2ZGW A;  1ATI A;  1H4S A;  1X2H A;  4OP0 A;  2IY5 A;  4EX5 A;  2DU7 A;  5ELO A;  3L4G B;  1GGM A;  4P3N A;  4Q6G A;  4TWA A;  2Q7E A;  2CIM A;  3PZC A;  3FJP A;  2DVE A;  4TQF A;  4G85 A;  1ADY A;  3A32 A;  3LC0 A;  3A5Z A;  1QF6 A;  3V7S A;  3HXU A;  4RDX A;  4TVY A;  2DTI A;  1SET A;  2DJZ A;  1Z7M A;  4XU2 A;  2EWN A;  2ZIN A;  3HXY A;  2C8M A;  2RHQ A;  4LVJ A;  3TUP A;  3P8V A;  3MF2 A;  3ICA A;  2DDZ A;  2AMC B;  3PCO B;  1Z7N A;  4O2D A;  2DZ9 A;  4XTY A;  4EO4 A;  4H2T A;  3NEL A;  2DXT A;  1LYL A;  4RQF A;  3A7R A;  3V7C A;  1E1T A;  2E41 A;  2ZT7 A;  2ZZG A;  1BBU A;  2EJF A;  1H4V B;  4WJ4 A;  2EAY A;  4YYE A;  3NEN A;  3G1Z A;  4ZIB A;  2J3M A;  3HXV A;  4P3O A;  1EQR A;  4RQE A;  1B7Y B;  3IKL A;  3RKY A;  4E51 A;  4YRS A;  4CS2 A;  3R07 A;  4XEO A;  3RIR A;  4HVC A;  3HRK A;  2RHS B;  3V8L A;  1SES A;  4HWS A;  4CS3 A;  2Q7G A;  2Q5I A;  2G4C A;  3HY1 A;  4BW9 A;  4YRK A;  2QHU A;  4P74 C;  4YP0 A;  3RKW A;  4LNS A;  2DTO A;  1EFW A;  4CH6 A;  1YFT A;  2FYK A;  4YPF A;  1IL2 A;  2AKW B;  1YB3 A;  2E64 A;  11AS A;  1HXD A;  1KMM A;  3HFZ B;  3EFR A;  3I7F A;  5K1P A;  3IKM B;  2ARS A;  3V8J A;  4HT4 A;  1USY C;  3HY0 A;  4HA8 A;  4H2X B;  2E3C A;  4P73 C;  3RL6 A;  4TVA B;  1NJ2 A;  1KMN A;  4TQD A;  4H2U A;  1BBW A;  3KFU A;  3V7R A;  2CJB A;  4XU1 A;  1N9W A;  1WLE A;  2ZR3 A;  2ZNJ A;  4HWR A;  4G84 A;  4HWP A;  2CJA A;  3BJU A;  1PYS B;  1BIA A;  3VQY A;  2ZR2 A;  4LVI A;  3REU A;  4P75 C;  1X54 A;  3IG2 A;  4YRG A;  3TEH B;  3UGT A;  4ZTZ B;  2PMF A;  1EVL A;  3UGQ A;  3RGL A;  1E24 A;  1JJC B;  2J3L A;  3REX A;  1X01 A;  3VBB A;  4H2W A;  1ASZ A;  4BWA A;  1YFR A;  4YRQ A;  3RF1 A;  2NS6 A;  4KR2 A;  2I4L A;  2ALY B;  4CH3 A;  4KQE A;  1H4Q A;  5KNN A;  4YRE A;  1HC7 A;  4YRN A;  3A5Y A;  4YRL A;  2DQ3 A;  4XTV A;  3CMQ A;  1WPY A;  5K1X A;  1FYF A;  1WQW A;  4UPA A;  1NYQ A;  4K86 A;  3P8Y A;  1B76 A;  2I4M A;  4AH6 A;  3HXZ A;  1J5W A;  3L1A A;  1SER A;  1L0W A;  4LVM A;  4P74 A;  3HTZ A;  5C52 B;  4YRC A;  2CGH A;  1KOG A;  4TVW A;  1X2G A;  2ZT6 A;  2DKG A;  1EIY A;  4HWO A;  1YFS A;  3M4Q A;  4YRT A;  4YRI A;  4RMF A;  2IY5 B;  3RAC A;  1X55 A;  3VQW A;  1USY A;  4YRJ A;  5HGQ A;  3DSQ A;  3NEM A;  12AS A;  4YCU A;  4P73 A;  2ODR C;  4H02 A;  3L4G A;  3E9I A;  3P8T A;  2ZZF A;  2QHS A;  2ZCE A;  1YGB A;  3UH0 A;  3QNE A;  4P75 A;  3E9H A;  3A31 A;  2RHQ B;  2ZT5 A;  4LVL A;  2Q7H A;  4XTX A;  4YRM A;  1H4T A;  4X5O A;  1NJ1 A;  2E1H A;  3TEG A;  1ASY A;  4PHC A;  1QE0 A;  2AMC A;  4WI1 A;  3PCO A;  4UP9 A;  3QO7 A;  2ZZE A;  1NJ6 A;  4P71 C;  3QO5 A;  2I4O A;  2HNI A;  2P0L A;  3W3S A;  3QTC A;  4P72 C;  2ZNI A;  4XTW A;  2ZIO A;  1NJ5 A;  4YCW A;  3HXW A;  4J15 A;  1E1O A;  2E10 A;  2E65 A;  2EL9 A;  3UFG A;  2ZTG A;  4YRR A;  4H2S A;  4XEM A;  2XTI A;  1B7Y A;  2ART A;  4L87 A;  1B70 A;  1C0A A;  1VQZ A; 
#chains in the Genus database with same CATH homology
 5C51 B;  1EOV A;  5ELN A;  4K87 A;  1B8A A;  2DQ0 A;  2DU5 A;  2RHS A;  3HXX A;  4Q15 A;  2EJ9 A;  4YDQ A;  2ZT8 A;  4WF2 A;  1G5H A;  3WQZ A;  2EJG A;  4UP8 A;  1NYR A;  2ZXF A;  1WQ7 A;  2AKW A;  4XU0 A;  5C53 B;  4TTV A;  3IAL A;  3HFZ A;  3VQV A;  2DXU A;  2PME A;  4YRP A;  3LSS A;  3NET A;  2XGT A;  1WYD A;  5E3I A;  4LVK A;  4CS4 A;  3HFV A;  4H2X A;  1BIB A;  3L2Z A;  2A8E A;  4TVA A;  3V8K A;  3M4P A;  1NNH A;  4CH4 A;  4UP7 A;  4YRF A;  4CH5 A;  3EFS A;  1W66 A;  2I4N A;  4WJ3 M;  1PYS A;  4P3P A;  4XTZ A;  2QHT A;  4OLF A;  4P71 A;  1EVK A;  1SRY A;  3TEH A;  3HRI A;  4KR3 A;  1B70 B;  2CJ9 A;  4XU3 A;  3RUX A;  4P72 A;  1JJC A;  4YRO A;  3RKX A;  1X56 A;  2ODR D;  3VQX A;  4DQ2 A;  5F5W A;  2E5A A;  4PG3 A;  4H2Y A;  1G51 A;  4XTU A;  2ALY A;  2DZC A;  4YCV A;  2P5I A;  3QO8 A;  3BFM A;  2Q5H A;  1ADJ A;  1G5I A;  3LSQ A;  4ZTU B;  4HWT A;  3ERR A;  1HTT A;  3MF1 A;  2DEQ A;  2QHV A;  4H2V A;  3A74 A;  1WNL A;  2ARU A;  4DPG A;  3MEY A;  3A7A A;  3A7U A;  1WU7 A;  4K88 A;  3OD1 A;  1EIY B;  2DTH A;  1E22 A;  2ZIM A;  1RIQ A;  1NJ8 A;  4NCX A;  2C7I A;  3MQZ A;  2ZGW A;  1ATI A;  1H4S A;  1X2H A;  4OP0 A;  2IY5 A;  4EX5 A;  2DU7 A;  5ELO A;  3L4G B;  1GGM A;  4P3N A;  4Q6G A;  4TWA A;  2Q7E A;  2CIM A;  3PZC A;  3FJP A;  2DVE A;  4TQF A;  4G85 A;  1ADY A;  3A32 A;  3LC0 A;  3A5Z A;  1QF6 A;  3V7S A;  3HXU A;  4RDX A;  4TVY A;  2DTI A;  1SET A;  2DJZ A;  1Z7M A;  4XU2 A;  2EWN A;  2ZIN A;  3HXY A;  2C8M A;  2RHQ A;  4LVJ A;  3TUP A;  3P8V A;  3MF2 A;  3ICA A;  2DDZ A;  2AMC B;  3PCO B;  1Z7N A;  4O2D A;  2DZ9 A;  4XTY A;  4EO4 A;  4H2T A;  3NEL A;  2DXT A;  1LYL A;  4RQF A;  3A7R A;  3V7C A;  1E1T A;  2E41 A;  2ZT7 A;  2ZZG A;  1BBU A;  2EJF A;  1H4V B;  4WJ4 A;  2EAY A;  4YYE A;  3NEN A;  3G1Z A;  4ZIB A;  2J3M A;  3HXV A;  4P3O A;  1EQR A;  4RQE A;  1B7Y B;  3IKL A;  3RKY A;  4E51 A;  4YRS A;  4CS2 A;  3R07 A;  4XEO A;  3RIR A;  4HVC A;  3HRK A;  2RHS B;  3V8L A;  1SES A;  4HWS A;  4CS3 A;  2Q7G A;  2Q5I A;  2G4C A;  3HY1 A;  4BW9 A;  4YRK A;  2QHU A;  4P74 C;  4YP0 A;  3RKW A;  4LNS A;  2DTO A;  1EFW A;  4CH6 A;  1YFT A;  2FYK A;  4YPF A;  1IL2 A;  2AKW B;  1YB3 A;  2E64 A;  11AS A;  1HXD A;  1KMM A;  3HFZ B;  3EFR A;  3I7F A;  5K1P A;  3IKM B;  2ARS A;  3V8J A;  4HT4 A;  1USY C;  3HY0 A;  4HA8 A;  4H2X B;  2E3C A;  4P73 C;  3RL6 A;  4TVA B;  1NJ2 A;  1KMN A;  4TQD A;  4H2U A;  1BBW A;  3KFU A;  3V7R A;  2CJB A;  4XU1 A;  1N9W A;  1WLE A;  2ZR3 A;  2ZNJ A;  4HWR A;  4G84 A;  4HWP A;  2CJA A;  3BJU A;  1PYS B;  1BIA A;  3VQY A;  2ZR2 A;  4LVI A;  3REU A;  4P75 C;  1X54 A;  3IG2 A;  4YRG A;  3TEH B;  3UGT A;  4ZTZ B;  2PMF A;  1EVL A;  3UGQ A;  3RGL A;  1E24 A;  1JJC B;  2J3L A;  3REX A;  1X01 A;  3VBB A;  4H2W A;  1ASZ A;  4BWA A;  1YFR A;  4YRQ A;  3RF1 A;  2NS6 A;  4KR2 A;  2I4L A;  2ALY B;  4CH3 A;  4KQE A;  1H4Q A;  5KNN A;  4YRE A;  1HC7 A;  4YRN A;  3A5Y A;  4YRL A;  2DQ3 A;  4XTV A;  3CMQ A;  1WPY A;  5K1X A;  1FYF A;  1WQW A;  4UPA A;  1NYQ A;  4K86 A;  3P8Y A;  1B76 A;  2I4M A;  4AH6 A;  3HXZ A;  1J5W A;  3L1A A;  1SER A;  1L0W A;  4LVM A;  4P74 A;  3HTZ A;  5C52 B;  4YRC A;  2CGH A;  1KOG A;  4TVW A;  1X2G A;  2ZT6 A;  2DKG A;  1EIY A;  4HWO A;  1YFS A;  3M4Q A;  4YRT A;  4YRI A;  4RMF A;  2IY5 B;  3RAC A;  1X55 A;  3VQW A;  1USY A;  4YRJ A;  5HGQ A;  3DSQ A;  3NEM A;  12AS A;  4YCU A;  4P73 A;  2ODR C;  4H02 A;  3L4G A;  3E9I A;  3P8T A;  2ZZF A;  2QHS A;  2ZCE A;  1YGB A;  3UH0 A;  3QNE A;  4P75 A;  3E9H A;  3A31 A;  2RHQ B;  2ZT5 A;  4LVL A;  2Q7H A;  4XTX A;  4YRM A;  1H4T A;  4X5O A;  1NJ1 A;  2E1H A;  3TEG A;  1ASY A;  4PHC A;  1QE0 A;  2AMC A;  4WI1 A;  3PCO A;  4UP9 A;  3QO7 A;  2ZZE A;  1NJ6 A;  4P71 C;  3QO5 A;  2I4O A;  2HNI A;  2P0L A;  3W3S A;  3QTC A;  4P72 C;  2ZNI A;  4XTW A;  2ZIO A;  1NJ5 A;  4YCW A;  3HXW A;  4J15 A;  1E1O A;  2E10 A;  2E65 A;  2EL9 A;  3UFG A;  2ZTG A;  4YRR A;  4H2S A;  4XEM A;  2XTI A;  1B7Y A;  2ART A;  4L87 A;  1B70 A;  1C0A A;  1VQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...