4P72C

Phers in complex with compound 2a
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
249
structure length
235
Chain Sequence
b'ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
total genus 68
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p72C01
2ARSA 4CS4A 1N9WA 2ZNIA 4WI1A 3UGQA 2CIMA 3CMQA 3REXA 4XEOA 1BBWA 1SRYA 2ZINA 2RHSB 1FYFA 12ASA 3ERRA 3HXVA 4XEMA 2ODRD 2Q7GA 2E64A 3VQXA 3QO8A 3V7SA 4EX5A 3ICAA 2AMCB 4YREA 2C7IA 4XTVA 3PCOB 2E41A 2DEQA 1USYA 1E24A 4YRKA 3P8VA 2I4OA 4YROA 3MF1A 5E3IA 3V7RA 1NJ8A 3P8YA 4TWAA 3E9IA 2PMEA 4P71C 3IKMB 3R07A 1X01A 3M4QA 1EOVA 4YRQA 2EJFA 3NETA 4TVYA 4K88A 4YRLA 1ATIA 2ZT6A 4CH3A 1YFTA 1E22A 2QHSA 3L4GB 2E5AA 2RHQA 3BJUA 1IL2A 2ZZGA 4P73A 1GGMA 5ELOA 2ARTA 1ADJA 1HXDA 3TEHB 5F5WA 4BWAA 2ZIMA 4DQ2A 1NNHA 3VQYA 3HTZA 4E51A 4CH5A 1ASYA 2CJAA 2ZZEA 1ASZA 3MEYA 2DQ3A 2RHSA 3RKYA 4PG3A 3V8LA 2AKWA 3QO7A 4YRFA 1X2GA 2ZT8A 3LSQA 1J5WA 4O2DA 3UGTA 2AMCA 3V7CA 1EVLA 4YRGA 1C0AA 3PZCA 4CH4A 3PCOA 4P75A 1G5HA 3RACA 4UP8A 3G1ZA 3HRIA 3NELA 4H2UA 1B70B 1BIBA 3A32A 3NENA 1WQ7A 3FJPA 1X2HA 3RKXA 4TVAA 4K87A 3REUA 1HTTA 4XTWA 4YRCA 3A7RA 1USYC 2EJGA 4L87A 2XTIA 1L0WA 4P74A 4XU1A 1SERA 4RQEA 3A5YA 1E1OA 3HFVA 1NYQA 3HRKA 3TEHA 1LYLA 2QHUA 3HY1A 4ZTUB 2E10A 1WQWA 2ZCEA 4NCXA 4LNSA 5C51B 2EAYA 2ALYA 1NJ6A 3EFSA 2CGHA 4XTXA 4G85A 1X54A 2P5IA 4P73C 4ZIBA 4TQFA 2IY5B 1H4TA 1HC7A 1B7YB 1QE0A 2ZT7A 2ZZFA 1RIQA 3HFZA 1NJ5A 4TVWA 1W66A 4YP0A 4RMFA 1WNLA 1G5IA 2C8MA 3L1AA 4BW9A 2EJ9A 2ZGWA 1ADYA 1YGBA 2Q7HA 2XGTA 4H02A 4Q15A 4TQDA 2I4MA 3V8JA 2DU7A 1B70A 4YRIA 3M4PA 3KFUA 1YB3A 4G84A 4XU0A 3QO5A 2G4CA 1WPYA 4EO4A 2DQ0A 1KOGA 1X55A 4K86A 4P75C 4P72A 4KR2A 2DKGA 3RUXA 4YYEA 4XTZA 4RQFA 4HWTA 1WU7A 1H4SA 1SESA 4H2XB 2DTOA 2J3MA 4CS2A 2DU5A 4YPFA 5HGQA 2ZNJA 1G51A 2CJBA 4H2SA 4H2TA 4HVCA 2EL9A 4Q6GA 1EQRA 2QHVA 3A7UA 4P74C 3A31A 3HXXA 4PHCA 5KNNA 5C52B 2E3CA 3E9HA 4YRJA 3OD1A 4HA8A 2DDZA 4HWPA 3HXUA 1H4QA 2RHQB 2E1HA 2E65A 3WQZA 2ZXFA 5K1PA 1EIYB 3RGLA 3DSQA 3V8KA 4P3OA 3L4GA 3IKLA 3UH0A 3RKWA 1VQZA 2ZTGA 4TTVA 3A5ZA 1KMNA 2HNIA 3RL6A 1JJCB 2ZT5A 4H2YA 3A74A 4HWOA 2ZIOA 2DZCA 2AKWB 4XTYA 1X56A 2DTHA 2QHTA 2ZR3A 3VQWA 4YRSA 4WF2A 1PYSB 4J15A 4YCWA 1E1TA 3IALA 4YRMA 4YRPA 1B76A 4ZTZB 1NJ2A 1WLEA 2DXUA 4UPAA 3TUPA 2ODRC 5ELNA 1Z7MA 5K1XA 2DJZA 4P3NA 4WJ3M 3P8TA 1EVKA 1EFWA 2ARUA 3W3SA 4H2XA 4H2WA 4XU2A 3VQVA 3HXWA 1QF6A 1YFRA 2DTIA 2FYKA 1KMMA 1H4VB 3A7AA 4P72C 4TVAB 4KQEA 4YCUA 1B8AA 1SETA 4AH6A 4HWSA 1NYRA 2J3LA 3LC0A 4YDQA 3TEGA 1BBUA 1WYDA 4DPGA 3BFMA 3RIRA 4P71A 1NJ1A 4X5OA 4OLFA 2P0LA 3I7FA 2I4LA 2I4NA 2Q5HA 4RDXA 2Q7EA 1EIYA 4P3PA 3EFRA 4UP7A 4WJ4A 2DZ9A 4KR3A 3HXYA 2ALYB 2DXTA 4CS3A 4YRTA 1JJCA 3QTCA 2DVEA 4H2VA 2ZR2A 4YRNA 3UFGA 4HWRA 3NEMA 3HFZB 1PYSA 4XTUA 4CH6A 3RF1A 3VBBA 2Q5IA 4XU3A 4YRRA 2PMFA 2CJ9A 3QNEA 4YCVA 3MF2A 2EWNA 1YFSA 3LSSA 2IY5A 11ASA 4UP9A 1B7YA 3HXZA 4OP0A 5C53B 1BIAA 1Z7NA 3HY0A 3L2ZA 3IG2A
chains in the Genus database with same CATH superfamily
2ARSA 4CS4A 1N9WA 2ZNIA 4WI1A 3UGQA 2CIMA 3CMQA 3REXA 4XEOA 1BBWA 1SRYA 2ZINA 2RHSB 1FYFA 12ASA 3ERRA 3HXVA 4XEMA 2ODRD 2Q7GA 2E64A 3VQXA 3QO8A 3V7SA 4EX5A 3ICAA 2AMCB 4YREA 2C7IA 4XTVA 3PCOB 2E41A 2DEQA 1USYA 1E24A 4YRKA 3P8VA 2I4OA 4YROA 3MF1A 5E3IA 3V7RA 1NJ8A 3P8YA 4TWAA 3E9IA 2PMEA 4P71C 3IKMB 3R07A 1X01A 3M4QA 1EOVA 4YRQA 2EJFA 3NETA 4TVYA 4K88A 4YRLA 1ATIA 2ZT6A 4LVJA 4CH3A 1YFTA 1E22A 2QHSA 3L4GB 2E5AA 2RHQA 3BJUA 1IL2A 2ZZGA 4P73A 1GGMA 5ELOA 2ARTA 1ADJA 1HXDA 3TEHB 5F5WA 4BWAA 2ZIMA 4DQ2A 4HT4A 1NNHA 3VQYA 3HTZA 4E51A 4CH5A 1ASYA 2CJAA 2ZZEA 1ASZA 3MEYA 2DQ3A 2RHSA 3RKYA 4PG3A 3V8LA 2AKWA 3QO7A 4YRFA 1X2GA 2ZT8A 3LSQA 1J5WA 4O2DA 3UGTA 2AMCA 3V7CA 1EVLA 4YRGA 1C0AA 3PZCA 4CH4A 3PCOA 4LVLA 4P75A 1G5HA 3RACA 4LVMA 4UP8A 3G1ZA 3HRIA 3NELA 4H2UA 1B70B 1BIBA 3A32A 3NENA 1WQ7A 3FJPA 1X2HA 3RKXA 4TVAA 4K87A 3REUA 1HTTA 4XTWA 4YRCA 3A7RA 1USYC 2EJGA 4L87A 2XTIA 1L0WA 4P74A 4XU1A 1SERA 4RQEA 3A5YA 1E1OA 3HFVA 1NYQA 3HRKA 3TEHA 1LYLA 2QHUA 3HY1A 4ZTUB 2E10A 1WQWA 2ZCEA 4NCXA 4LNSA 5C51B 2EAYA 2ALYA 1NJ6A 3EFSA 2CGHA 4XTXA 4G85A 1X54A 2P5IA 4P73C 4ZIBA 4TQFA 2IY5B 1H4TA 1HC7A 1B7YB 1QE0A 2ZT7A 2ZZFA 1RIQA 3HFZA 1NJ5A 4TVWA 1W66A 4YP0A 4RMFA 1WNLA 1G5IA 2C8MA 3L1AA 4BW9A 2EJ9A 2ZGWA 1ADYA 1YGBA 2Q7HA 2XGTA 4H02A 4Q15A 4TQDA 2I4MA 3V8JA 2DU7A 1B70A 4YRIA 3M4PA 3KFUA 1YB3A 4G84A 4XU0A 3QO5A 2G4CA 1WPYA 4EO4A 2DQ0A 1KOGA 1X55A 4LVKA 4K86A 4P75C 4P72A 4KR2A 2DKGA 3RUXA 4YYEA 4XTZA 4RQFA 4HWTA 1WU7A 1H4SA 1SESA 4H2XB 2DTOA 2J3MA 4CS2A 2DU5A 4YPFA 5HGQA 2ZNJA 1G51A 2CJBA 4H2SA 4H2TA 4HVCA 2A8EA 2EL9A 4Q6GA 1EQRA 2QHVA 3A7UA 4P74C 3A31A 3HXXA 4PHCA 5KNNA 5C52B 2E3CA 3E9HA 4YRJA 3OD1A 4HA8A 2DDZA 4HWPA 3HXUA 1H4QA 2RHQB 2E1HA 2E65A 3WQZA 2ZXFA 5K1PA 1EIYB 3RGLA 3DSQA 3V8KA 4P3OA 3L4GA 3IKLA 3UH0A 3RKWA 1VQZA 2ZTGA 4TTVA 3A5ZA 1KMNA 2HNIA 3RL6A 1JJCB 2ZT5A 4H2YA 3A74A 4HWOA 2ZIOA 2DZCA 2AKWB 4XTYA 1X56A 2DTHA 2QHTA 2ZR3A 3VQWA 4YRSA 4WF2A 1PYSB 4J15A 4YCWA 1E1TA 4LVIA 3IALA 4YRMA 4YRPA 1B76A 4ZTZB 1NJ2A 1WLEA 2DXUA 4UPAA 3TUPA 2ODRC 5ELNA 1Z7MA 5K1XA 2DJZA 4P3NA 4WJ3M 3P8TA 1EVKA 1EFWA 2ARUA 3W3SA 4H2XA 4H2WA 4XU2A 3VQVA 3HXWA 1QF6A 1YFRA 2DTIA 2FYKA 1KMMA 1H4VB 3A7AA 4P72C 4TVAB 2NS6A 4KQEA 4YCUA 1B8AA 1SETA 4AH6A 4HWSA 1NYRA 2J3LA 3LC0A 4YDQA 3TEGA 1BBUA 1WYDA 4DPGA 3BFMA 3RIRA 4P71A 1NJ1A 4X5OA 4OLFA 2P0LA 3I7FA 2I4LA 2I4NA 2Q5HA 4RDXA 2Q7EA 1EIYA 4P3PA 3EFRA 4UP7A 4WJ4A 2DZ9A 4KR3A 3HXYA 2ALYB 2DXTA 4CS3A 4YRTA 1JJCA 3QTCA 2DVEA 4H2VA 2ZR2A 4YRNA 3UFGA 4HWRA 3NEMA 3HFZB 1PYSA 4XTUA 4CH6A 3RF1A 3VBBA 2Q5IA 4XU3A 4YRRA 2PMFA 2CJ9A 3QNEA 4YCVA 3MF2A 2EWNA 3MQZA 1YFSA 3LSSA 2IY5A 11ASA 4UP9A 1B7YA 3HXZA 4OP0A 5C53B 1BIAA 1Z7NA 3HY0A 3L2ZA 3IG2A
chains in the Genus database with same CATH topology
2ARSA 4CS4A 1N9WA 2ZNIA 4WI1A 3UGQA 2CIMA 3CMQA 3REXA 4XEOA 1BBWA 1SRYA 2ZINA 2RHSB 1FYFA 12ASA 3ERRA 3HXVA 4XEMA 2ODRD 2Q7GA 2E64A 3VQXA 3QO8A 3V7SA 4EX5A 3ICAA 2AMCB 4YREA 2C7IA 4XTVA 3PCOB 2E41A 2DEQA 1USYA 1E24A 4YRKA 3P8VA 2I4OA 4YROA 3MF1A 5E3IA 3V7RA 1NJ8A 3P8YA 4TWAA 3E9IA 2PMEA 4P71C 3IKMB 3R07A 1X01A 3M4QA 1EOVA 4YRQA 2EJFA 3NETA 4TVYA 4K88A 4YRLA 1ATIA 2ZT6A 4LVJA 4CH3A 1YFTA 1E22A 2QHSA 3L4GB 2E5AA 2RHQA 3BJUA 1IL2A 2ZZGA 4P73A 1GGMA 5ELOA 2ARTA 1ADJA 1HXDA 3TEHB 5F5WA 4BWAA 2ZIMA 4DQ2A 4HT4A 1NNHA 3VQYA 3HTZA 4E51A 4CH5A 1ASYA 2CJAA 2ZZEA 1ASZA 3MEYA 2DQ3A 2RHSA 3RKYA 4PG3A 3V8LA 2AKWA 3QO7A 4YRFA 1X2GA 2ZT8A 3LSQA 1J5WA 4O2DA 3UGTA 2AMCA 3V7CA 1EVLA 4YRGA 1C0AA 3PZCA 4CH4A 3PCOA 4LVLA 4P75A 1G5HA 3RACA 4LVMA 4UP8A 3G1ZA 3HRIA 3NELA 4H2UA 1B70B 1BIBA 3A32A 3NENA 1WQ7A 3FJPA 1X2HA 3RKXA 4TVAA 4K87A 3REUA 1HTTA 4XTWA 4YRCA 3A7RA 1USYC 2EJGA 4L87A 2XTIA 1L0WA 4P74A 4XU1A 1SERA 4RQEA 3A5YA 1E1OA 3HFVA 1NYQA 3HRKA 3TEHA 1LYLA 2QHUA 3HY1A 4ZTUB 2E10A 1WQWA 2ZCEA 4NCXA 4LNSA 5C51B 2EAYA 2ALYA 1NJ6A 3EFSA 2CGHA 4XTXA 4G85A 1X54A 2P5IA 4P73C 4ZIBA 4TQFA 2IY5B 1H4TA 1HC7A 1B7YB 1QE0A 2ZT7A 2ZZFA 1RIQA 3HFZA 1NJ5A 4TVWA 1W66A 4YP0A 4RMFA 1WNLA 1G5IA 2C8MA 3L1AA 4BW9A 2EJ9A 2ZGWA 1ADYA 1YGBA 2Q7HA 2XGTA 4H02A 4Q15A 4TQDA 2I4MA 3V8JA 2DU7A 1B70A 4YRIA 3M4PA 3KFUA 1YB3A 4G84A 4XU0A 3QO5A 2G4CA 1WPYA 4EO4A 2DQ0A 1KOGA 1X55A 4LVKA 4K86A 4P75C 4P72A 4KR2A 2DKGA 3RUXA 4YYEA 4XTZA 4RQFA 4HWTA 1WU7A 1H4SA 1SESA 4H2XB 2DTOA 2J3MA 4CS2A 2DU5A 4YPFA 5HGQA 2ZNJA 1G51A 2CJBA 4H2SA 4H2TA 4HVCA 2A8EA 2EL9A 4Q6GA 1EQRA 2QHVA 3A7UA 4P74C 3A31A 3HXXA 4PHCA 5KNNA 5C52B 2E3CA 3E9HA 4YRJA 3OD1A 4HA8A 2DDZA 4HWPA 3HXUA 1H4QA 2RHQB 2E1HA 2E65A 3WQZA 2ZXFA 5K1PA 1EIYB 3RGLA 3DSQA 3V8KA 4P3OA 3L4GA 3IKLA 3UH0A 3RKWA 1VQZA 2ZTGA 4TTVA 3A5ZA 1KMNA 2HNIA 3RL6A 1JJCB 2ZT5A 4H2YA 3A74A 4HWOA 2ZIOA 2DZCA 2AKWB 4XTYA 1X56A 2DTHA 2QHTA 2ZR3A 3VQWA 4YRSA 4WF2A 1PYSB 4J15A 4YCWA 1E1TA 4LVIA 3IALA 4YRMA 4YRPA 1B76A 4ZTZB 1NJ2A 1WLEA 2DXUA 4UPAA 3TUPA 2ODRC 5ELNA 1Z7MA 5K1XA 2DJZA 4P3NA 4WJ3M 3P8TA 1EVKA 1EFWA 2ARUA 3W3SA 4H2XA 4H2WA 4XU2A 3VQVA 3HXWA 1QF6A 1YFRA 2DTIA 2FYKA 1KMMA 1H4VB 3A7AA 4P72C 4TVAB 2NS6A 4KQEA 4YCUA 1B8AA 1SETA 4AH6A 4HWSA 1NYRA 2J3LA 3LC0A 4YDQA 3TEGA 1BBUA 1WYDA 4DPGA 3BFMA 3RIRA 4P71A 1NJ1A 4X5OA 4OLFA 2P0LA 3I7FA 2I4LA 2I4NA 2Q5HA 4RDXA 2Q7EA 1EIYA 4P3PA 3EFRA 4UP7A 4WJ4A 2DZ9A 4KR3A 3HXYA 2ALYB 2DXTA 4CS3A 4YRTA 1JJCA 3QTCA 2DVEA 4H2VA 2ZR2A 4YRNA 3UFGA 4HWRA 3NEMA 3HFZB 1PYSA 4XTUA 4CH6A 3RF1A 3VBBA 2Q5IA 4XU3A 4YRRA 2PMFA 2CJ9A 3QNEA 4YCVA 3MF2A 2EWNA 3MQZA 1YFSA 3LSSA 2IY5A 11ASA 4UP9A 1B7YA 3HXZA 4OP0A 5C53B 1BIAA 1Z7NA 3HY0A 3L2ZA 3IG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARS A;  4CS4 A;  1N9W A;  2ZNI A;  4WI1 A;  3UGQ A;  2CIM A;  3CMQ A;  3REX A;  4XEO A;  1BBW A;  1SRY A;  2ZIN A;  2RHS B;  1FYF A;  12AS A;  3ERR A;  3HXV A;  4XEM A;  2ODR D;  2Q7G A;  2E64 A;  3VQX A;  3QO8 A;  3V7S A;  4EX5 A;  3ICA A;  2AMC B;  4YRE A;  2C7I A;  4XTV A;  3PCO B;  2E41 A;  2DEQ A;  1USY A;  1E24 A;  4YRK A;  3P8V A;  2I4O A;  4YRO A;  3MF1 A;  5E3I A;  3V7R A;  1NJ8 A;  3P8Y A;  4TWA A;  3E9I A;  2PME A;  4P71 C;  3IKM B;  3R07 A;  1X01 A;  3M4Q A;  1EOV A;  4YRQ A;  2EJF A;  3NET A;  4TVY A;  4K88 A;  4YRL A;  1ATI A;  2ZT6 A;  4CH3 A;  1YFT A;  1E22 A;  2QHS A;  3L4G B;  2E5A A;  2RHQ A;  3BJU A;  1IL2 A;  2ZZG A;  4P73 A;  1GGM A;  5ELO A;  2ART A;  1ADJ A;  1HXD A;  3TEH B;  5F5W A;  4BWA A;  2ZIM A;  4DQ2 A;  1NNH A;  3VQY A;  3HTZ A;  4E51 A;  4CH5 A;  1ASY A;  2CJA A;  2ZZE A;  1ASZ A;  3MEY A;  2DQ3 A;  2RHS A;  3RKY A;  4PG3 A;  3V8L A;  2AKW A;  3QO7 A;  4YRF A;  1X2G A;  2ZT8 A;  3LSQ A;  1J5W A;  4O2D A;  3UGT A;  2AMC A;  3V7C A;  1EVL A;  4YRG A;  1C0A A;  3PZC A;  4CH4 A;  3PCO A;  4P75 A;  1G5H A;  3RAC A;  4UP8 A;  3G1Z A;  3HRI A;  3NEL A;  4H2U A;  1B70 B;  1BIB A;  3A32 A;  3NEN A;  1WQ7 A;  3FJP A;  1X2H A;  3RKX A;  4TVA A;  4K87 A;  3REU A;  1HTT A;  4XTW A;  4YRC A;  3A7R A;  1USY C;  2EJG A;  4L87 A;  2XTI A;  1L0W A;  4P74 A;  4XU1 A;  1SER A;  4RQE A;  3A5Y A;  1E1O A;  3HFV A;  1NYQ A;  3HRK A;  3TEH A;  1LYL A;  2QHU A;  3HY1 A;  4ZTU B;  2E10 A;  1WQW A;  2ZCE A;  4NCX A;  4LNS A;  5C51 B;  2EAY A;  2ALY A;  1NJ6 A;  3EFS A;  2CGH A;  4XTX A;  4G85 A;  1X54 A;  2P5I A;  4P73 C;  4ZIB A;  4TQF A;  2IY5 B;  1H4T A;  1HC7 A;  1B7Y B;  1QE0 A;  2ZT7 A;  2ZZF A;  1RIQ A;  3HFZ A;  1NJ5 A;  4TVW A;  1W66 A;  4YP0 A;  4RMF A;  1WNL A;  1G5I A;  2C8M A;  3L1A A;  4BW9 A;  2EJ9 A;  2ZGW A;  1ADY A;  1YGB A;  2Q7H A;  2XGT A;  4H02 A;  4Q15 A;  4TQD A;  2I4M A;  3V8J A;  2DU7 A;  1B70 A;  4YRI A;  3M4P A;  3KFU A;  1YB3 A;  4G84 A;  4XU0 A;  3QO5 A;  2G4C A;  1WPY A;  4EO4 A;  2DQ0 A;  1KOG A;  1X55 A;  4K86 A;  4P75 C;  4P72 A;  4KR2 A;  2DKG A;  3RUX A;  4YYE A;  4XTZ A;  4RQF A;  4HWT A;  1WU7 A;  1H4S A;  1SES A;  4H2X B;  2DTO A;  2J3M A;  4CS2 A;  2DU5 A;  4YPF A;  5HGQ A;  2ZNJ A;  1G51 A;  2CJB A;  4H2S A;  4H2T A;  4HVC A;  2EL9 A;  4Q6G A;  1EQR A;  2QHV A;  3A7U A;  4P74 C;  3A31 A;  3HXX A;  4PHC A;  5KNN A;  5C52 B;  2E3C A;  3E9H A;  4YRJ A;  3OD1 A;  4HA8 A;  2DDZ A;  4HWP A;  3HXU A;  1H4Q A;  2RHQ B;  2E1H A;  2E65 A;  3WQZ A;  2ZXF A;  5K1P A;  1EIY B;  3RGL A;  3DSQ A;  3V8K A;  4P3O A;  3L4G A;  3IKL A;  3UH0 A;  3RKW A;  1VQZ A;  2ZTG A;  4TTV A;  3A5Z A;  1KMN A;  2HNI A;  3RL6 A;  1JJC B;  2ZT5 A;  4H2Y A;  3A74 A;  4HWO A;  2ZIO A;  2DZC A;  2AKW B;  4XTY A;  1X56 A;  2DTH A;  2QHT A;  2ZR3 A;  3VQW A;  4YRS A;  4WF2 A;  1PYS B;  4J15 A;  4YCW A;  1E1T A;  3IAL A;  4YRM A;  4YRP A;  1B76 A;  4ZTZ B;  1NJ2 A;  1WLE A;  2DXU A;  4UPA A;  3TUP A;  2ODR C;  5ELN A;  1Z7M A;  5K1X A;  2DJZ A;  4P3N A;  4WJ3 M;  3P8T A;  1EVK A;  1EFW A;  2ARU A;  3W3S A;  4H2X A;  4H2W A;  4XU2 A;  3VQV A;  3HXW A;  1QF6 A;  1YFR A;  2DTI A;  2FYK A;  1KMM A;  1H4V B;  3A7A A;  4P72 C;  4TVA B;  4KQE A;  4YCU A;  1B8A A;  1SET A;  4AH6 A;  4HWS A;  1NYR A;  2J3L A;  3LC0 A;  4YDQ A;  3TEG A;  1BBU A;  1WYD A;  4DPG A;  3BFM A;  3RIR A;  4P71 A;  1NJ1 A;  4X5O A;  4OLF A;  2P0L A;  3I7F A;  2I4L A;  2I4N A;  2Q5H A;  4RDX A;  2Q7E A;  1EIY A;  4P3P A;  3EFR A;  4UP7 A;  4WJ4 A;  2DZ9 A;  4KR3 A;  3HXY A;  2ALY B;  2DXT A;  4CS3 A;  4YRT A;  1JJC A;  3QTC A;  2DVE A;  4H2V A;  2ZR2 A;  4YRN A;  3UFG A;  4HWR A;  3NEM A;  3HFZ B;  1PYS A;  4XTU A;  4CH6 A;  3RF1 A;  3VBB A;  2Q5I A;  4XU3 A;  4YRR A;  2PMF A;  2CJ9 A;  3QNE A;  4YCV A;  3MF2 A;  2EWN A;  1YFS A;  3LSS A;  2IY5 A;  11AS A;  4UP9 A;  1B7Y A;  3HXZ A;  4OP0 A;  5C53 B;  1BIA A;  1Z7N A;  3HY0 A;  3L2Z A;  3IG2 A; 
#chains in the Genus database with same CATH topology
 2ARS A;  4CS4 A;  1N9W A;  2ZNI A;  4WI1 A;  3UGQ A;  2CIM A;  3CMQ A;  3REX A;  4XEO A;  1BBW A;  1SRY A;  2ZIN A;  2RHS B;  1FYF A;  12AS A;  3ERR A;  3HXV A;  4XEM A;  2ODR D;  2Q7G A;  2E64 A;  3VQX A;  3QO8 A;  3V7S A;  4EX5 A;  3ICA A;  2AMC B;  4YRE A;  2C7I A;  4XTV A;  3PCO B;  2E41 A;  2DEQ A;  1USY A;  1E24 A;  4YRK A;  3P8V A;  2I4O A;  4YRO A;  3MF1 A;  5E3I A;  3V7R A;  1NJ8 A;  3P8Y A;  4TWA A;  3E9I A;  2PME A;  4P71 C;  3IKM B;  3R07 A;  1X01 A;  3M4Q A;  1EOV A;  4YRQ A;  2EJF A;  3NET A;  4TVY A;  4K88 A;  4YRL A;  1ATI A;  2ZT6 A;  4LVJ A;  4CH3 A;  1YFT A;  1E22 A;  2QHS A;  3L4G B;  2E5A A;  2RHQ A;  3BJU A;  1IL2 A;  2ZZG A;  4P73 A;  1GGM A;  5ELO A;  2ART A;  1ADJ A;  1HXD A;  3TEH B;  5F5W A;  4BWA A;  2ZIM A;  4DQ2 A;  4HT4 A;  1NNH A;  3VQY A;  3HTZ A;  4E51 A;  4CH5 A;  1ASY A;  2CJA A;  2ZZE A;  1ASZ A;  3MEY A;  2DQ3 A;  2RHS A;  3RKY A;  4PG3 A;  3V8L A;  2AKW A;  3QO7 A;  4YRF A;  1X2G A;  2ZT8 A;  3LSQ A;  1J5W A;  4O2D A;  3UGT A;  2AMC A;  3V7C A;  1EVL A;  4YRG A;  1C0A A;  3PZC A;  4CH4 A;  3PCO A;  4LVL A;  4P75 A;  1G5H A;  3RAC A;  4LVM A;  4UP8 A;  3G1Z A;  3HRI A;  3NEL A;  4H2U A;  1B70 B;  1BIB A;  3A32 A;  3NEN A;  1WQ7 A;  3FJP A;  1X2H A;  3RKX A;  4TVA A;  4K87 A;  3REU A;  1HTT A;  4XTW A;  4YRC A;  3A7R A;  1USY C;  2EJG A;  4L87 A;  2XTI A;  1L0W A;  4P74 A;  4XU1 A;  1SER A;  4RQE A;  3A5Y A;  1E1O A;  3HFV A;  1NYQ A;  3HRK A;  3TEH A;  1LYL A;  2QHU A;  3HY1 A;  4ZTU B;  2E10 A;  1WQW A;  2ZCE A;  4NCX A;  4LNS A;  5C51 B;  2EAY A;  2ALY A;  1NJ6 A;  3EFS A;  2CGH A;  4XTX A;  4G85 A;  1X54 A;  2P5I A;  4P73 C;  4ZIB A;  4TQF A;  2IY5 B;  1H4T A;  1HC7 A;  1B7Y B;  1QE0 A;  2ZT7 A;  2ZZF A;  1RIQ A;  3HFZ A;  1NJ5 A;  4TVW A;  1W66 A;  4YP0 A;  4RMF A;  1WNL A;  1G5I A;  2C8M A;  3L1A A;  4BW9 A;  2EJ9 A;  2ZGW A;  1ADY A;  1YGB A;  2Q7H A;  2XGT A;  4H02 A;  4Q15 A;  4TQD A;  2I4M A;  3V8J A;  2DU7 A;  1B70 A;  4YRI A;  3M4P A;  3KFU A;  1YB3 A;  4G84 A;  4XU0 A;  3QO5 A;  2G4C A;  1WPY A;  4EO4 A;  2DQ0 A;  1KOG A;  1X55 A;  4LVK A;  4K86 A;  4P75 C;  4P72 A;  4KR2 A;  2DKG A;  3RUX A;  4YYE A;  4XTZ A;  4RQF A;  4HWT A;  1WU7 A;  1H4S A;  1SES A;  4H2X B;  2DTO A;  2J3M A;  4CS2 A;  2DU5 A;  4YPF A;  5HGQ A;  2ZNJ A;  1G51 A;  2CJB A;  4H2S A;  4H2T A;  4HVC A;  2A8E A;  2EL9 A;  4Q6G A;  1EQR A;  2QHV A;  3A7U A;  4P74 C;  3A31 A;  3HXX A;  4PHC A;  5KNN A;  5C52 B;  2E3C A;  3E9H A;  4YRJ A;  3OD1 A;  4HA8 A;  2DDZ A;  4HWP A;  3HXU A;  1H4Q A;  2RHQ B;  2E1H A;  2E65 A;  3WQZ A;  2ZXF A;  5K1P A;  1EIY B;  3RGL A;  3DSQ A;  3V8K A;  4P3O A;  3L4G A;  3IKL A;  3UH0 A;  3RKW A;  1VQZ A;  2ZTG A;  4TTV A;  3A5Z A;  1KMN A;  2HNI A;  3RL6 A;  1JJC B;  2ZT5 A;  4H2Y A;  3A74 A;  4HWO A;  2ZIO A;  2DZC A;  2AKW B;  4XTY A;  1X56 A;  2DTH A;  2QHT A;  2ZR3 A;  3VQW A;  4YRS A;  4WF2 A;  1PYS B;  4J15 A;  4YCW A;  1E1T A;  4LVI A;  3IAL A;  4YRM A;  4YRP A;  1B76 A;  4ZTZ B;  1NJ2 A;  1WLE A;  2DXU A;  4UPA A;  3TUP A;  2ODR C;  5ELN A;  1Z7M A;  5K1X A;  2DJZ A;  4P3N A;  4WJ3 M;  3P8T A;  1EVK A;  1EFW A;  2ARU A;  3W3S A;  4H2X A;  4H2W A;  4XU2 A;  3VQV A;  3HXW A;  1QF6 A;  1YFR A;  2DTI A;  2FYK A;  1KMM A;  1H4V B;  3A7A A;  4P72 C;  4TVA B;  2NS6 A;  4KQE A;  4YCU A;  1B8A A;  1SET A;  4AH6 A;  4HWS A;  1NYR A;  2J3L A;  3LC0 A;  4YDQ A;  3TEG A;  1BBU A;  1WYD A;  4DPG A;  3BFM A;  3RIR A;  4P71 A;  1NJ1 A;  4X5O A;  4OLF A;  2P0L A;  3I7F A;  2I4L A;  2I4N A;  2Q5H A;  4RDX A;  2Q7E A;  1EIY A;  4P3P A;  3EFR A;  4UP7 A;  4WJ4 A;  2DZ9 A;  4KR3 A;  3HXY A;  2ALY B;  2DXT A;  4CS3 A;  4YRT A;  1JJC A;  3QTC A;  2DVE A;  4H2V A;  2ZR2 A;  4YRN A;  3UFG A;  4HWR A;  3NEM A;  3HFZ B;  1PYS A;  4XTU A;  4CH6 A;  3RF1 A;  3VBB A;  2Q5I A;  4XU3 A;  4YRR A;  2PMF A;  2CJ9 A;  3QNE A;  4YCV A;  3MF2 A;  2EWN A;  3MQZ A;  1YFS A;  3LSS A;  2IY5 A;  11AS A;  4UP9 A;  1B7Y A;  3HXZ A;  4OP0 A;  5C53 B;  1BIA A;  1Z7N A;  3HY0 A;  3L2Z A;  3IG2 A; 
#chains in the Genus database with same CATH homology
 2ARS A;  4CS4 A;  1N9W A;  2ZNI A;  4WI1 A;  3UGQ A;  2CIM A;  3CMQ A;  3REX A;  4XEO A;  1BBW A;  1SRY A;  2ZIN A;  2RHS B;  1FYF A;  12AS A;  3ERR A;  3HXV A;  4XEM A;  2ODR D;  2Q7G A;  2E64 A;  3VQX A;  3QO8 A;  3V7S A;  4EX5 A;  3ICA A;  2AMC B;  4YRE A;  2C7I A;  4XTV A;  3PCO B;  2E41 A;  2DEQ A;  1USY A;  1E24 A;  4YRK A;  3P8V A;  2I4O A;  4YRO A;  3MF1 A;  5E3I A;  3V7R A;  1NJ8 A;  3P8Y A;  4TWA A;  3E9I A;  2PME A;  4P71 C;  3IKM B;  3R07 A;  1X01 A;  3M4Q A;  1EOV A;  4YRQ A;  2EJF A;  3NET A;  4TVY A;  4K88 A;  4YRL A;  1ATI A;  2ZT6 A;  4LVJ A;  4CH3 A;  1YFT A;  1E22 A;  2QHS A;  3L4G B;  2E5A A;  2RHQ A;  3BJU A;  1IL2 A;  2ZZG A;  4P73 A;  1GGM A;  5ELO A;  2ART A;  1ADJ A;  1HXD A;  3TEH B;  5F5W A;  4BWA A;  2ZIM A;  4DQ2 A;  4HT4 A;  1NNH A;  3VQY A;  3HTZ A;  4E51 A;  4CH5 A;  1ASY A;  2CJA A;  2ZZE A;  1ASZ A;  3MEY A;  2DQ3 A;  2RHS A;  3RKY A;  4PG3 A;  3V8L A;  2AKW A;  3QO7 A;  4YRF A;  1X2G A;  2ZT8 A;  3LSQ A;  1J5W A;  4O2D A;  3UGT A;  2AMC A;  3V7C A;  1EVL A;  4YRG A;  1C0A A;  3PZC A;  4CH4 A;  3PCO A;  4LVL A;  4P75 A;  1G5H A;  3RAC A;  4LVM A;  4UP8 A;  3G1Z A;  3HRI A;  3NEL A;  4H2U A;  1B70 B;  1BIB A;  3A32 A;  3NEN A;  1WQ7 A;  3FJP A;  1X2H A;  3RKX A;  4TVA A;  4K87 A;  3REU A;  1HTT A;  4XTW A;  4YRC A;  3A7R A;  1USY C;  2EJG A;  4L87 A;  2XTI A;  1L0W A;  4P74 A;  4XU1 A;  1SER A;  4RQE A;  3A5Y A;  1E1O A;  3HFV A;  1NYQ A;  3HRK A;  3TEH A;  1LYL A;  2QHU A;  3HY1 A;  4ZTU B;  2E10 A;  1WQW A;  2ZCE A;  4NCX A;  4LNS A;  5C51 B;  2EAY A;  2ALY A;  1NJ6 A;  3EFS A;  2CGH A;  4XTX A;  4G85 A;  1X54 A;  2P5I A;  4P73 C;  4ZIB A;  4TQF A;  2IY5 B;  1H4T A;  1HC7 A;  1B7Y B;  1QE0 A;  2ZT7 A;  2ZZF A;  1RIQ A;  3HFZ A;  1NJ5 A;  4TVW A;  1W66 A;  4YP0 A;  4RMF A;  1WNL A;  1G5I A;  2C8M A;  3L1A A;  4BW9 A;  2EJ9 A;  2ZGW A;  1ADY A;  1YGB A;  2Q7H A;  2XGT A;  4H02 A;  4Q15 A;  4TQD A;  2I4M A;  3V8J A;  2DU7 A;  1B70 A;  4YRI A;  3M4P A;  3KFU A;  1YB3 A;  4G84 A;  4XU0 A;  3QO5 A;  2G4C A;  1WPY A;  4EO4 A;  2DQ0 A;  1KOG A;  1X55 A;  4LVK A;  4K86 A;  4P75 C;  4P72 A;  4KR2 A;  2DKG A;  3RUX A;  4YYE A;  4XTZ A;  4RQF A;  4HWT A;  1WU7 A;  1H4S A;  1SES A;  4H2X B;  2DTO A;  2J3M A;  4CS2 A;  2DU5 A;  4YPF A;  5HGQ A;  2ZNJ A;  1G51 A;  2CJB A;  4H2S A;  4H2T A;  4HVC A;  2A8E A;  2EL9 A;  4Q6G A;  1EQR A;  2QHV A;  3A7U A;  4P74 C;  3A31 A;  3HXX A;  4PHC A;  5KNN A;  5C52 B;  2E3C A;  3E9H A;  4YRJ A;  3OD1 A;  4HA8 A;  2DDZ A;  4HWP A;  3HXU A;  1H4Q A;  2RHQ B;  2E1H A;  2E65 A;  3WQZ A;  2ZXF A;  5K1P A;  1EIY B;  3RGL A;  3DSQ A;  3V8K A;  4P3O A;  3L4G A;  3IKL A;  3UH0 A;  3RKW A;  1VQZ A;  2ZTG A;  4TTV A;  3A5Z A;  1KMN A;  2HNI A;  3RL6 A;  1JJC B;  2ZT5 A;  4H2Y A;  3A74 A;  4HWO A;  2ZIO A;  2DZC A;  2AKW B;  4XTY A;  1X56 A;  2DTH A;  2QHT A;  2ZR3 A;  3VQW A;  4YRS A;  4WF2 A;  1PYS B;  4J15 A;  4YCW A;  1E1T A;  4LVI A;  3IAL A;  4YRM A;  4YRP A;  1B76 A;  4ZTZ B;  1NJ2 A;  1WLE A;  2DXU A;  4UPA A;  3TUP A;  2ODR C;  5ELN A;  1Z7M A;  5K1X A;  2DJZ A;  4P3N A;  4WJ3 M;  3P8T A;  1EVK A;  1EFW A;  2ARU A;  3W3S A;  4H2X A;  4H2W A;  4XU2 A;  3VQV A;  3HXW A;  1QF6 A;  1YFR A;  2DTI A;  2FYK A;  1KMM A;  1H4V B;  3A7A A;  4P72 C;  4TVA B;  2NS6 A;  4KQE A;  4YCU A;  1B8A A;  1SET A;  4AH6 A;  4HWS A;  1NYR A;  2J3L A;  3LC0 A;  4YDQ A;  3TEG A;  1BBU A;  1WYD A;  4DPG A;  3BFM A;  3RIR A;  4P71 A;  1NJ1 A;  4X5O A;  4OLF A;  2P0L A;  3I7F A;  2I4L A;  2I4N A;  2Q5H A;  4RDX A;  2Q7E A;  1EIY A;  4P3P A;  3EFR A;  4UP7 A;  4WJ4 A;  2DZ9 A;  4KR3 A;  3HXY A;  2ALY B;  2DXT A;  4CS3 A;  4YRT A;  1JJC A;  3QTC A;  2DVE A;  4H2V A;  2ZR2 A;  4YRN A;  3UFG A;  4HWR A;  3NEM A;  3HFZ B;  1PYS A;  4XTU A;  4CH6 A;  3RF1 A;  3VBB A;  2Q5I A;  4XU3 A;  4YRR A;  2PMF A;  2CJ9 A;  3QNE A;  4YCV A;  3MF2 A;  2EWN A;  3MQZ A;  1YFS A;  3LSS A;  2IY5 A;  11AS A;  4UP9 A;  1B7Y A;  3HXZ A;  4OP0 A;  5C53 B;  1BIA A;  1Z7N A;  3HY0 A;  3L2Z A;  3IG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...