4P72C

Phers in complex with compound 2a
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
249
structure length
235
Chain Sequence
ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
molecule keywords Phenylalanine--tRNA ligase beta subunit
total genus 68
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p72C01
4TQFA 3RKYA 2Q5HA 2PMFA 3VQXA 3WQZA 1B70B 2I4MA 2DTOA 4HWSA 4TQDA 4HWTA 1ATIA 2DJZA 4XTZA 2EJFA 4OLFA 1EIYB 1BBWA 2E41A 3OD1A 2E10A 1BIBA 2E1HA 1JJCA 4ZIBA 1ASZA 4WJ3M 1USYC 3RKXA 2ZXFA 3MF2A 4CH3A 5K1XA 2ZZGA 2EWNA 4H2TA 4P73A 1ADJA 1KOGA 2ZR2A 1NJ1A 4RQEA 4YP0A 3M4PA 4YRPA 5ELOA 4EO4A 4YCUA 2PMEA 12ASA 3M4QA 3BFMA 3HXYA 2I4NA 3RGLA 3L2ZA 4L87A 4YROA 2CGHA 4TTVA 2G4CA 1WLEA 4TVAA 3PCOB 2EL9A 2EJ9A 1GGMA 4UP9A 3I7FA 2DXUA 3V8LA 3HRKA 1NJ5A 1WU7A 1BIAA 4YREA 3HXWA 1WYDA 1E1OA 1X55A 4YRFA 4YRJA 3RIRA 3QNEA 4YCVA 4XTYA 2QHSA 3RKWA 4XEMA 3RL6A 4ZTUB 2AMCB 2ZINA 1PYSA 1X01A 1QF6A 1NJ8A 1NJ2A 1NYRA 4H2YA 1SESA 3P8YA 5C51B 2I4OA 1RIQA 3V8JA 3UFGA 4YRQA 3NENA 4AH6A 4XEOA 4YRTA 4TVWA 2ARSA 4H2UA 1X56A 3V7SA 2I4LA 4YYEA 2CJBA 4KR3A 1G5HA 4DPGA 3HXUA 4P72C 3QO8A 2RHSA 5C53B 3W3SA 3A5YA 4UP8A 3RACA 3TEGA 1H4SA 3HXZA 4G84A 2DU5A 1W66A 4YRIA 4RMFA 3TUPA 1B7YB 4UPAA 4XU0A 3LSSA 4XU2A 1NJ6A 1HTTA 2ZIOA 3HFZA 1X54A 1X2HA 2ALYA 1WQ7A 1NNHA 2C7IA 1E22A 4X5OA 2RHQA 2DZCA 3EFRA 3L4GA 4XU1A 4TVAB 4YRSA 3L4GB 4NCXA 2ZT5A 3LSQA 2ZCEA 3REUA 4CH5A 1EOVA 4K86A 4LNSA 2ARTA 4KQEA 1PYSB 3CMQA 3HTZA 5KNNA 1ASYA 3G1ZA 2Q7GA 4H02A 4P3PA 3UH0A 3A74A 4P3NA 4H2SA 2P0LA 1B8AA 4P3OA 3IKLA 4RQFA 3RF1A 4YRNA 2ZT7A 1IL2A 2Q5IA 2ZZFA 4TVYA 4J15A 3A32A 1HC7A 3BJUA 2DTHA 3VBBA 4H2XB 4K88A 3TEHB 4P72A 4K87A 1J5WA 3VQWA 2ZNIA 1WQWA 5E3IA 3HRIA 3P8TA 3VQVA 2ZZEA 4P75C 2ZGWA 4EX5A 1G5IA 2DVEA 3VQYA 4OP0A 2EJGA 2AMCA 1USYA 3E9HA 4WI1A 4XTVA 1B7YA 4BWAA 1BBUA 2CIMA 3NELA 2XGTA 3HFZB 4WJ4A 4TWAA 3MEYA 4UP7A 2C8MA 1YFTA 1EIYA 3REXA 2DZ9A 2IY5B 3KFUA 2DQ3A 3UGTA 3FJPA 1SRYA 3DSQA 4P73C 4H2XA 1EQRA 2IY5A 1QE0A 2Q7HA 2CJ9A 3QO7A 1E1TA 2P5IA 4HWPA 4O2DA 3IKMB 1H4VB 3R07A 3HY0A 3E9IA 4HWOA 3V8KA 2ALYB 4YRMA 2XTIA 2ODRC 3ICAA 1FYFA 3A31A 1N9WA 2ZIMA 1JJCB 2EAYA 2J3LA 2E64A 5C52B 1ADYA 2QHVA 2ZNJA 2DXTA 3P8VA 1WNLA 3HXXA 1YFRA 1Z7NA 4ZTZB 2ZT8A 1VQZA 3LC0A 4YRCA 4H2VA 3A7RA 4HVCA 3RUXA 2E65A 3QO5A 2ZT6A 4XTWA 4PG3A 3NETA 1X2GA 2RHSB 1WPYA 5ELNA 2DEQA 4CH4A 4BW9A 4P71C 1H4QA 1B70A 4YRRA 4P71A 2DKGA 4YRGA 2E5AA 2J3MA 1SERA 4XU3A 2ODRD 2AKWB 1Z7MA 11ASA 1H4TA 4CH6A 3A7UA 3IG2A 1HXDA 3HXVA 4H2WA 3HFVA 2QHUA 1G51A 1SETA 4P74C 1L0WA 4CS2A 2DQ0A 4XTUA 4YPFA 2CJAA 1C0AA 1YB3A 4P74A 2ZTGA 4HWRA 3L1AA 4E51A 1NYQA 5K1PA 4Q15A 1B76A 1KMNA 3PCOA 3V7RA 1LYLA 4YRKA 3A7AA 2QHTA 4YDQA 4P75A 4CS3A 3PZCA 5F5WA 2E3CA 2FYKA 1EVLA 4WF2A 1EFWA 3TEHA 4G85A 2ZR3A 4YRLA 3UGQA 2RHQB 3V7CA 4PHCA 1YFSA 3NEMA 4YCWA 2DDZA 4CS4A 2DU7A 4Q6GA 4KR2A 2Q7EA 1KMMA 2AKWA 3IALA 3QTCA 3MF1A 3ERRA 4DQ2A 1YGBA 2ARUA 4HA8A 1E24A 4XTXA 3A5ZA 2HNIA 3HY1A 3EFSA 1EVKA 5HGQA 2DTIA 4RDXA
chains in the Genus database with same CATH superfamily
4TQFA 3RKYA 2Q5HA 2PMFA 3VQXA 3WQZA 1B70B 2I4MA 2DTOA 4HWSA 4TQDA 4HWTA 1ATIA 2DJZA 4XTZA 2EJFA 4OLFA 1EIYB 1BBWA 2E41A 3OD1A 2E10A 1BIBA 2E1HA 1JJCA 4ZIBA 1ASZA 4WJ3M 1USYC 3RKXA 2ZXFA 3MF2A 4CH3A 5K1XA 2ZZGA 2EWNA 4H2TA 4P73A 1ADJA 1KOGA 2ZR2A 1NJ1A 4RQEA 4YP0A 3M4PA 4YRPA 5ELOA 4EO4A 4YCUA 2PMEA 12ASA 3M4QA 3BFMA 3HXYA 2I4NA 3RGLA 3L2ZA 4L87A 4YROA 2CGHA 4TTVA 2G4CA 1WLEA 2NS6A 4TVAA 3PCOB 2EL9A 2EJ9A 1GGMA 4UP9A 3I7FA 2DXUA 3V8LA 4LVJA 3HRKA 1NJ5A 1WU7A 1BIAA 4YREA 3HXWA 1WYDA 1E1OA 1X55A 4YRFA 4YRJA 3RIRA 3QNEA 4YCVA 4XTYA 2QHSA 3RKWA 4XEMA 3RL6A 4ZTUB 2AMCB 2ZINA 1PYSA 1X01A 1QF6A 1NJ8A 1NJ2A 1NYRA 4H2YA 1SESA 3P8YA 5C51B 2I4OA 1RIQA 3V8JA 3UFGA 4YRQA 3NENA 4AH6A 4XEOA 4YRTA 4TVWA 2ARSA 4H2UA 1X56A 3V7SA 2I4LA 4YYEA 2CJBA 4KR3A 1G5HA 4DPGA 3HXUA 4P72C 3QO8A 2RHSA 5C53B 3W3SA 3A5YA 4UP8A 3RACA 3TEGA 1H4SA 3HXZA 4G84A 2DU5A 1W66A 4YRIA 4RMFA 3TUPA 1B7YB 4UPAA 4XU0A 3LSSA 4XU2A 1NJ6A 1HTTA 2ZIOA 3HFZA 1X54A 1X2HA 2ALYA 1WQ7A 1NNHA 2C7IA 1E22A 4X5OA 2RHQA 2DZCA 3EFRA 3L4GA 4XU1A 4TVAB 4YRSA 3L4GB 4NCXA 2ZT5A 3LSQA 2ZCEA 3REUA 4CH5A 1EOVA 4K86A 4LNSA 2ARTA 4KQEA 1PYSB 4HT4A 3CMQA 3HTZA 5KNNA 1ASYA 3G1ZA 2Q7GA 4H02A 4P3PA 3UH0A 3A74A 4P3NA 4H2SA 2P0LA 1B8AA 4P3OA 3IKLA 4RQFA 3RF1A 4YRNA 2ZT7A 1IL2A 2Q5IA 2ZZFA 4TVYA 4J15A 3A32A 1HC7A 3BJUA 2DTHA 3VBBA 4H2XB 4K88A 3TEHB 4P72A 4K87A 1J5WA 3VQWA 4LVLA 2ZNIA 1WQWA 5E3IA 3HRIA 3P8TA 3VQVA 2ZZEA 3MQZA 4P75C 2ZGWA 4EX5A 1G5IA 2DVEA 3VQYA 4OP0A 2EJGA 2AMCA 1USYA 3E9HA 4WI1A 4XTVA 1B7YA 4BWAA 1BBUA 2CIMA 3NELA 2XGTA 3HFZB 4WJ4A 4TWAA 3MEYA 4UP7A 2C8MA 1YFTA 1EIYA 3REXA 2DZ9A 2IY5B 3KFUA 2DQ3A 3UGTA 3FJPA 1SRYA 3DSQA 4P73C 4H2XA 1EQRA 2IY5A 1QE0A 2Q7HA 2CJ9A 3QO7A 1E1TA 2P5IA 4HWPA 4O2DA 3IKMB 1H4VB 3R07A 3HY0A 3E9IA 4LVIA 4HWOA 3V8KA 2ALYB 4YRMA 2XTIA 2ODRC 3ICAA 1FYFA 3A31A 1N9WA 2ZIMA 1JJCB 2EAYA 2J3LA 2E64A 5C52B 1ADYA 2QHVA 2ZNJA 4LVKA 2DXTA 3P8VA 1WNLA 3HXXA 1YFRA 1Z7NA 4ZTZB 2ZT8A 1VQZA 3LC0A 4YRCA 4H2VA 3A7RA 4HVCA 3RUXA 2E65A 3QO5A 2ZT6A 4XTWA 4PG3A 3NETA 1X2GA 2RHSB 1WPYA 5ELNA 2DEQA 4CH4A 4BW9A 4P71C 1H4QA 1B70A 4YRRA 4P71A 2DKGA 4YRGA 2E5AA 2J3MA 1SERA 4XU3A 2ODRD 2AKWB 1Z7MA 11ASA 1H4TA 4CH6A 3A7UA 3IG2A 1HXDA 3HXVA 4H2WA 3HFVA 2QHUA 1G51A 1SETA 4P74C 1L0WA 4CS2A 2DQ0A 4XTUA 4YPFA 2CJAA 1C0AA 1YB3A 4P74A 2ZTGA 4HWRA 3L1AA 4E51A 1NYQA 5K1PA 4Q15A 1B76A 1KMNA 3PCOA 3V7RA 1LYLA 4YRKA 3A7AA 2QHTA 4YDQA 4P75A 4CS3A 3PZCA 2A8EA 5F5WA 2E3CA 2FYKA 1EVLA 4WF2A 1EFWA 3TEHA 4G85A 4LVMA 2ZR3A 4YRLA 3UGQA 2RHQB 3V7CA 4PHCA 1YFSA 3NEMA 4YCWA 2DDZA 4CS4A 2DU7A 4Q6GA 4KR2A 2Q7EA 1KMMA 2AKWA 3IALA 3QTCA 3MF1A 3ERRA 4DQ2A 1YGBA 2ARUA 4HA8A 1E24A 4XTXA 3A5ZA 2HNIA 3HY1A 3EFSA 1EVKA 5HGQA 2DTIA 4RDXA
chains in the Genus database with same CATH topology
4TQFA 3RKYA 2Q5HA 2PMFA 3VQXA 3WQZA 1B70B 2I4MA 2DTOA 4HWSA 4TQDA 4HWTA 1ATIA 2DJZA 4XTZA 2EJFA 4OLFA 1EIYB 1BBWA 2E41A 3OD1A 2E10A 1BIBA 2E1HA 1JJCA 4ZIBA 1ASZA 4WJ3M 1USYC 3RKXA 2ZXFA 3MF2A 4CH3A 5K1XA 2ZZGA 2EWNA 4H2TA 4P73A 1ADJA 1KOGA 2ZR2A 1NJ1A 4RQEA 4YP0A 3M4PA 4YRPA 5ELOA 4EO4A 4YCUA 2PMEA 12ASA 3M4QA 3BFMA 3HXYA 2I4NA 3RGLA 3L2ZA 4L87A 4YROA 2CGHA 4TTVA 2G4CA 1WLEA 2NS6A 4TVAA 3PCOB 2EL9A 2EJ9A 1GGMA 4UP9A 3I7FA 2DXUA 3V8LA 4LVJA 3HRKA 1NJ5A 1WU7A 1BIAA 4YREA 3HXWA 1WYDA 1E1OA 1X55A 4YRFA 4YRJA 3RIRA 3QNEA 4YCVA 4XTYA 2QHSA 3RKWA 4XEMA 3RL6A 4ZTUB 2AMCB 2ZINA 1PYSA 1X01A 1QF6A 1NJ8A 1NJ2A 1NYRA 4H2YA 1SESA 3P8YA 5C51B 2I4OA 1RIQA 3V8JA 3UFGA 4YRQA 3NENA 4AH6A 4XEOA 4YRTA 4TVWA 2ARSA 4H2UA 1X56A 3V7SA 2I4LA 4YYEA 2CJBA 4KR3A 1G5HA 4DPGA 3HXUA 4P72C 3QO8A 2RHSA 5C53B 3W3SA 3A5YA 4UP8A 3RACA 3TEGA 1H4SA 3HXZA 4G84A 2DU5A 1W66A 4YRIA 4RMFA 3TUPA 1B7YB 4UPAA 4XU0A 3LSSA 4XU2A 1NJ6A 1HTTA 2ZIOA 3HFZA 1X54A 1X2HA 2ALYA 1WQ7A 1NNHA 2C7IA 1E22A 4X5OA 2RHQA 2DZCA 3EFRA 3L4GA 4XU1A 4TVAB 4YRSA 3L4GB 4NCXA 2ZT5A 3LSQA 2ZCEA 3REUA 4CH5A 1EOVA 4K86A 4LNSA 2ARTA 4KQEA 1PYSB 4HT4A 3CMQA 3HTZA 5KNNA 1ASYA 3G1ZA 2Q7GA 4H02A 4P3PA 3UH0A 3A74A 4P3NA 4H2SA 2P0LA 1B8AA 4P3OA 3IKLA 4RQFA 3RF1A 4YRNA 2ZT7A 1IL2A 2Q5IA 2ZZFA 4TVYA 4J15A 3A32A 1HC7A 3BJUA 2DTHA 3VBBA 4H2XB 4K88A 3TEHB 4P72A 4K87A 1J5WA 3VQWA 4LVLA 2ZNIA 1WQWA 5E3IA 3HRIA 3P8TA 3VQVA 2ZZEA 3MQZA 4P75C 2ZGWA 4EX5A 1G5IA 2DVEA 3VQYA 4OP0A 2EJGA 2AMCA 1USYA 3E9HA 4WI1A 4XTVA 1B7YA 4BWAA 1BBUA 2CIMA 3NELA 2XGTA 3HFZB 4WJ4A 4TWAA 3MEYA 4UP7A 2C8MA 1YFTA 1EIYA 3REXA 2DZ9A 2IY5B 3KFUA 2DQ3A 3UGTA 3FJPA 1SRYA 3DSQA 4P73C 4H2XA 1EQRA 2IY5A 1QE0A 2Q7HA 2CJ9A 3QO7A 1E1TA 2P5IA 4HWPA 4O2DA 3IKMB 1H4VB 3R07A 3HY0A 3E9IA 4LVIA 4HWOA 3V8KA 2ALYB 4YRMA 2XTIA 2ODRC 3ICAA 1FYFA 3A31A 1N9WA 2ZIMA 1JJCB 2EAYA 2J3LA 2E64A 5C52B 1ADYA 2QHVA 2ZNJA 4LVKA 2DXTA 3P8VA 1WNLA 3HXXA 1YFRA 1Z7NA 4ZTZB 2ZT8A 1VQZA 3LC0A 4YRCA 4H2VA 3A7RA 4HVCA 3RUXA 2E65A 3QO5A 2ZT6A 4XTWA 4PG3A 3NETA 1X2GA 2RHSB 1WPYA 5ELNA 2DEQA 4CH4A 4BW9A 4P71C 1H4QA 1B70A 4YRRA 4P71A 2DKGA 4YRGA 2E5AA 2J3MA 1SERA 4XU3A 2ODRD 2AKWB 1Z7MA 11ASA 1H4TA 4CH6A 3A7UA 3IG2A 1HXDA 3HXVA 4H2WA 3HFVA 2QHUA 1G51A 1SETA 4P74C 1L0WA 4CS2A 2DQ0A 4XTUA 4YPFA 2CJAA 1C0AA 1YB3A 4P74A 2ZTGA 4HWRA 3L1AA 4E51A 1NYQA 5K1PA 4Q15A 1B76A 1KMNA 3PCOA 3V7RA 1LYLA 4YRKA 3A7AA 2QHTA 4YDQA 4P75A 4CS3A 3PZCA 2A8EA 5F5WA 2E3CA 2FYKA 1EVLA 4WF2A 1EFWA 3TEHA 4G85A 4LVMA 2ZR3A 4YRLA 3UGQA 2RHQB 3V7CA 4PHCA 1YFSA 3NEMA 4YCWA 2DDZA 4CS4A 2DU7A 4Q6GA 4KR2A 2Q7EA 1KMMA 2AKWA 3IALA 3QTCA 3MF1A 3ERRA 4DQ2A 1YGBA 2ARUA 4HA8A 1E24A 4XTXA 3A5ZA 2HNIA 3HY1A 3EFSA 1EVKA 5HGQA 2DTIA 4RDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TQF A;  3RKY A;  2Q5H A;  2PMF A;  3VQX A;  3WQZ A;  1B70 B;  2I4M A;  2DTO A;  4HWS A;  4TQD A;  4HWT A;  1ATI A;  2DJZ A;  4XTZ A;  2EJF A;  4OLF A;  1EIY B;  1BBW A;  2E41 A;  3OD1 A;  2E10 A;  1BIB A;  2E1H A;  1JJC A;  4ZIB A;  1ASZ A;  4WJ3 M;  1USY C;  3RKX A;  2ZXF A;  3MF2 A;  4CH3 A;  5K1X A;  2ZZG A;  2EWN A;  4H2T A;  4P73 A;  1ADJ A;  1KOG A;  2ZR2 A;  1NJ1 A;  4RQE A;  4YP0 A;  3M4P A;  4YRP A;  5ELO A;  4EO4 A;  4YCU A;  2PME A;  12AS A;  3M4Q A;  3BFM A;  3HXY A;  2I4N A;  3RGL A;  3L2Z A;  4L87 A;  4YRO A;  2CGH A;  4TTV A;  2G4C A;  1WLE A;  4TVA A;  3PCO B;  2EL9 A;  2EJ9 A;  1GGM A;  4UP9 A;  3I7F A;  2DXU A;  3V8L A;  3HRK A;  1NJ5 A;  1WU7 A;  1BIA A;  4YRE A;  3HXW A;  1WYD A;  1E1O A;  1X55 A;  4YRF A;  4YRJ A;  3RIR A;  3QNE A;  4YCV A;  4XTY A;  2QHS A;  3RKW A;  4XEM A;  3RL6 A;  4ZTU B;  2AMC B;  2ZIN A;  1PYS A;  1X01 A;  1QF6 A;  1NJ8 A;  1NJ2 A;  1NYR A;  4H2Y A;  1SES A;  3P8Y A;  5C51 B;  2I4O A;  1RIQ A;  3V8J A;  3UFG A;  4YRQ A;  3NEN A;  4AH6 A;  4XEO A;  4YRT A;  4TVW A;  2ARS A;  4H2U A;  1X56 A;  3V7S A;  2I4L A;  4YYE A;  2CJB A;  4KR3 A;  1G5H A;  4DPG A;  3HXU A;  4P72 C;  3QO8 A;  2RHS A;  5C53 B;  3W3S A;  3A5Y A;  4UP8 A;  3RAC A;  3TEG A;  1H4S A;  3HXZ A;  4G84 A;  2DU5 A;  1W66 A;  4YRI A;  4RMF A;  3TUP A;  1B7Y B;  4UPA A;  4XU0 A;  3LSS A;  4XU2 A;  1NJ6 A;  1HTT A;  2ZIO A;  3HFZ A;  1X54 A;  1X2H A;  2ALY A;  1WQ7 A;  1NNH A;  2C7I A;  1E22 A;  4X5O A;  2RHQ A;  2DZC A;  3EFR A;  3L4G A;  4XU1 A;  4TVA B;  4YRS A;  3L4G B;  4NCX A;  2ZT5 A;  3LSQ A;  2ZCE A;  3REU A;  4CH5 A;  1EOV A;  4K86 A;  4LNS A;  2ART A;  4KQE A;  1PYS B;  3CMQ A;  3HTZ A;  5KNN A;  1ASY A;  3G1Z A;  2Q7G A;  4H02 A;  4P3P A;  3UH0 A;  3A74 A;  4P3N A;  4H2S A;  2P0L A;  1B8A A;  4P3O A;  3IKL A;  4RQF A;  3RF1 A;  4YRN A;  2ZT7 A;  1IL2 A;  2Q5I A;  2ZZF A;  4TVY A;  4J15 A;  3A32 A;  1HC7 A;  3BJU A;  2DTH A;  3VBB A;  4H2X B;  4K88 A;  3TEH B;  4P72 A;  4K87 A;  1J5W A;  3VQW A;  2ZNI A;  1WQW A;  5E3I A;  3HRI A;  3P8T A;  3VQV A;  2ZZE A;  4P75 C;  2ZGW A;  4EX5 A;  1G5I A;  2DVE A;  3VQY A;  4OP0 A;  2EJG A;  2AMC A;  1USY A;  3E9H A;  4WI1 A;  4XTV A;  1B7Y A;  4BWA A;  1BBU A;  2CIM A;  3NEL A;  2XGT A;  3HFZ B;  4WJ4 A;  4TWA A;  3MEY A;  4UP7 A;  2C8M A;  1YFT A;  1EIY A;  3REX A;  2DZ9 A;  2IY5 B;  3KFU A;  2DQ3 A;  3UGT A;  3FJP A;  1SRY A;  3DSQ A;  4P73 C;  4H2X A;  1EQR A;  2IY5 A;  1QE0 A;  2Q7H A;  2CJ9 A;  3QO7 A;  1E1T A;  2P5I A;  4HWP A;  4O2D A;  3IKM B;  1H4V B;  3R07 A;  3HY0 A;  3E9I A;  4HWO A;  3V8K A;  2ALY B;  4YRM A;  2XTI A;  2ODR C;  3ICA A;  1FYF A;  3A31 A;  1N9W A;  2ZIM A;  1JJC B;  2EAY A;  2J3L A;  2E64 A;  5C52 B;  1ADY A;  2QHV A;  2ZNJ A;  2DXT A;  3P8V A;  1WNL A;  3HXX A;  1YFR A;  1Z7N A;  4ZTZ B;  2ZT8 A;  1VQZ A;  3LC0 A;  4YRC A;  4H2V A;  3A7R A;  4HVC A;  3RUX A;  2E65 A;  3QO5 A;  2ZT6 A;  4XTW A;  4PG3 A;  3NET A;  1X2G A;  2RHS B;  1WPY A;  5ELN A;  2DEQ A;  4CH4 A;  4BW9 A;  4P71 C;  1H4Q A;  1B70 A;  4YRR A;  4P71 A;  2DKG A;  4YRG A;  2E5A A;  2J3M A;  1SER A;  4XU3 A;  2ODR D;  2AKW B;  1Z7M A;  11AS A;  1H4T A;  4CH6 A;  3A7U A;  3IG2 A;  1HXD A;  3HXV A;  4H2W A;  3HFV A;  2QHU A;  1G51 A;  1SET A;  4P74 C;  1L0W A;  4CS2 A;  2DQ0 A;  4XTU A;  4YPF A;  2CJA A;  1C0A A;  1YB3 A;  4P74 A;  2ZTG A;  4HWR A;  3L1A A;  4E51 A;  1NYQ A;  5K1P A;  4Q15 A;  1B76 A;  1KMN A;  3PCO A;  3V7R A;  1LYL A;  4YRK A;  3A7A A;  2QHT A;  4YDQ A;  4P75 A;  4CS3 A;  3PZC A;  5F5W A;  2E3C A;  2FYK A;  1EVL A;  4WF2 A;  1EFW A;  3TEH A;  4G85 A;  2ZR3 A;  4YRL A;  3UGQ A;  2RHQ B;  3V7C A;  4PHC A;  1YFS A;  3NEM A;  4YCW A;  2DDZ A;  4CS4 A;  2DU7 A;  4Q6G A;  4KR2 A;  2Q7E A;  1KMM A;  2AKW A;  3IAL A;  3QTC A;  3MF1 A;  3ERR A;  4DQ2 A;  1YGB A;  2ARU A;  4HA8 A;  1E24 A;  4XTX A;  3A5Z A;  2HNI A;  3HY1 A;  3EFS A;  1EVK A;  5HGQ A;  2DTI A;  4RDX A; 
#chains in the Genus database with same CATH topology
 4TQF A;  3RKY A;  2Q5H A;  2PMF A;  3VQX A;  3WQZ A;  1B70 B;  2I4M A;  2DTO A;  4HWS A;  4TQD A;  4HWT A;  1ATI A;  2DJZ A;  4XTZ A;  2EJF A;  4OLF A;  1EIY B;  1BBW A;  2E41 A;  3OD1 A;  2E10 A;  1BIB A;  2E1H A;  1JJC A;  4ZIB A;  1ASZ A;  4WJ3 M;  1USY C;  3RKX A;  2ZXF A;  3MF2 A;  4CH3 A;  5K1X A;  2ZZG A;  2EWN A;  4H2T A;  4P73 A;  1ADJ A;  1KOG A;  2ZR2 A;  1NJ1 A;  4RQE A;  4YP0 A;  3M4P A;  4YRP A;  5ELO A;  4EO4 A;  4YCU A;  2PME A;  12AS A;  3M4Q A;  3BFM A;  3HXY A;  2I4N A;  3RGL A;  3L2Z A;  4L87 A;  4YRO A;  2CGH A;  4TTV A;  2G4C A;  1WLE A;  2NS6 A;  4TVA A;  3PCO B;  2EL9 A;  2EJ9 A;  1GGM A;  4UP9 A;  3I7F A;  2DXU A;  3V8L A;  4LVJ A;  3HRK A;  1NJ5 A;  1WU7 A;  1BIA A;  4YRE A;  3HXW A;  1WYD A;  1E1O A;  1X55 A;  4YRF A;  4YRJ A;  3RIR A;  3QNE A;  4YCV A;  4XTY A;  2QHS A;  3RKW A;  4XEM A;  3RL6 A;  4ZTU B;  2AMC B;  2ZIN A;  1PYS A;  1X01 A;  1QF6 A;  1NJ8 A;  1NJ2 A;  1NYR A;  4H2Y A;  1SES A;  3P8Y A;  5C51 B;  2I4O A;  1RIQ A;  3V8J A;  3UFG A;  4YRQ A;  3NEN A;  4AH6 A;  4XEO A;  4YRT A;  4TVW A;  2ARS A;  4H2U A;  1X56 A;  3V7S A;  2I4L A;  4YYE A;  2CJB A;  4KR3 A;  1G5H A;  4DPG A;  3HXU A;  4P72 C;  3QO8 A;  2RHS A;  5C53 B;  3W3S A;  3A5Y A;  4UP8 A;  3RAC A;  3TEG A;  1H4S A;  3HXZ A;  4G84 A;  2DU5 A;  1W66 A;  4YRI A;  4RMF A;  3TUP A;  1B7Y B;  4UPA A;  4XU0 A;  3LSS A;  4XU2 A;  1NJ6 A;  1HTT A;  2ZIO A;  3HFZ A;  1X54 A;  1X2H A;  2ALY A;  1WQ7 A;  1NNH A;  2C7I A;  1E22 A;  4X5O A;  2RHQ A;  2DZC A;  3EFR A;  3L4G A;  4XU1 A;  4TVA B;  4YRS A;  3L4G B;  4NCX A;  2ZT5 A;  3LSQ A;  2ZCE A;  3REU A;  4CH5 A;  1EOV A;  4K86 A;  4LNS A;  2ART A;  4KQE A;  1PYS B;  4HT4 A;  3CMQ A;  3HTZ A;  5KNN A;  1ASY A;  3G1Z A;  2Q7G A;  4H02 A;  4P3P A;  3UH0 A;  3A74 A;  4P3N A;  4H2S A;  2P0L A;  1B8A A;  4P3O A;  3IKL A;  4RQF A;  3RF1 A;  4YRN A;  2ZT7 A;  1IL2 A;  2Q5I A;  2ZZF A;  4TVY A;  4J15 A;  3A32 A;  1HC7 A;  3BJU A;  2DTH A;  3VBB A;  4H2X B;  4K88 A;  3TEH B;  4P72 A;  4K87 A;  1J5W A;  3VQW A;  4LVL A;  2ZNI A;  1WQW A;  5E3I A;  3HRI A;  3P8T A;  3VQV A;  2ZZE A;  3MQZ A;  4P75 C;  2ZGW A;  4EX5 A;  1G5I A;  2DVE A;  3VQY A;  4OP0 A;  2EJG A;  2AMC A;  1USY A;  3E9H A;  4WI1 A;  4XTV A;  1B7Y A;  4BWA A;  1BBU A;  2CIM A;  3NEL A;  2XGT A;  3HFZ B;  4WJ4 A;  4TWA A;  3MEY A;  4UP7 A;  2C8M A;  1YFT A;  1EIY A;  3REX A;  2DZ9 A;  2IY5 B;  3KFU A;  2DQ3 A;  3UGT A;  3FJP A;  1SRY A;  3DSQ A;  4P73 C;  4H2X A;  1EQR A;  2IY5 A;  1QE0 A;  2Q7H A;  2CJ9 A;  3QO7 A;  1E1T A;  2P5I A;  4HWP A;  4O2D A;  3IKM B;  1H4V B;  3R07 A;  3HY0 A;  3E9I A;  4LVI A;  4HWO A;  3V8K A;  2ALY B;  4YRM A;  2XTI A;  2ODR C;  3ICA A;  1FYF A;  3A31 A;  1N9W A;  2ZIM A;  1JJC B;  2EAY A;  2J3L A;  2E64 A;  5C52 B;  1ADY A;  2QHV A;  2ZNJ A;  4LVK A;  2DXT A;  3P8V A;  1WNL A;  3HXX A;  1YFR A;  1Z7N A;  4ZTZ B;  2ZT8 A;  1VQZ A;  3LC0 A;  4YRC A;  4H2V A;  3A7R A;  4HVC A;  3RUX A;  2E65 A;  3QO5 A;  2ZT6 A;  4XTW A;  4PG3 A;  3NET A;  1X2G A;  2RHS B;  1WPY A;  5ELN A;  2DEQ A;  4CH4 A;  4BW9 A;  4P71 C;  1H4Q A;  1B70 A;  4YRR A;  4P71 A;  2DKG A;  4YRG A;  2E5A A;  2J3M A;  1SER A;  4XU3 A;  2ODR D;  2AKW B;  1Z7M A;  11AS A;  1H4T A;  4CH6 A;  3A7U A;  3IG2 A;  1HXD A;  3HXV A;  4H2W A;  3HFV A;  2QHU A;  1G51 A;  1SET A;  4P74 C;  1L0W A;  4CS2 A;  2DQ0 A;  4XTU A;  4YPF A;  2CJA A;  1C0A A;  1YB3 A;  4P74 A;  2ZTG A;  4HWR A;  3L1A A;  4E51 A;  1NYQ A;  5K1P A;  4Q15 A;  1B76 A;  1KMN A;  3PCO A;  3V7R A;  1LYL A;  4YRK A;  3A7A A;  2QHT A;  4YDQ A;  4P75 A;  4CS3 A;  3PZC A;  2A8E A;  5F5W A;  2E3C A;  2FYK A;  1EVL A;  4WF2 A;  1EFW A;  3TEH A;  4G85 A;  4LVM A;  2ZR3 A;  4YRL A;  3UGQ A;  2RHQ B;  3V7C A;  4PHC A;  1YFS A;  3NEM A;  4YCW A;  2DDZ A;  4CS4 A;  2DU7 A;  4Q6G A;  4KR2 A;  2Q7E A;  1KMM A;  2AKW A;  3IAL A;  3QTC A;  3MF1 A;  3ERR A;  4DQ2 A;  1YGB A;  2ARU A;  4HA8 A;  1E24 A;  4XTX A;  3A5Z A;  2HNI A;  3HY1 A;  3EFS A;  1EVK A;  5HGQ A;  2DTI A;  4RDX A; 
#chains in the Genus database with same CATH homology
 4TQF A;  3RKY A;  2Q5H A;  2PMF A;  3VQX A;  3WQZ A;  1B70 B;  2I4M A;  2DTO A;  4HWS A;  4TQD A;  4HWT A;  1ATI A;  2DJZ A;  4XTZ A;  2EJF A;  4OLF A;  1EIY B;  1BBW A;  2E41 A;  3OD1 A;  2E10 A;  1BIB A;  2E1H A;  1JJC A;  4ZIB A;  1ASZ A;  4WJ3 M;  1USY C;  3RKX A;  2ZXF A;  3MF2 A;  4CH3 A;  5K1X A;  2ZZG A;  2EWN A;  4H2T A;  4P73 A;  1ADJ A;  1KOG A;  2ZR2 A;  1NJ1 A;  4RQE A;  4YP0 A;  3M4P A;  4YRP A;  5ELO A;  4EO4 A;  4YCU A;  2PME A;  12AS A;  3M4Q A;  3BFM A;  3HXY A;  2I4N A;  3RGL A;  3L2Z A;  4L87 A;  4YRO A;  2CGH A;  4TTV A;  2G4C A;  1WLE A;  2NS6 A;  4TVA A;  3PCO B;  2EL9 A;  2EJ9 A;  1GGM A;  4UP9 A;  3I7F A;  2DXU A;  3V8L A;  4LVJ A;  3HRK A;  1NJ5 A;  1WU7 A;  1BIA A;  4YRE A;  3HXW A;  1WYD A;  1E1O A;  1X55 A;  4YRF A;  4YRJ A;  3RIR A;  3QNE A;  4YCV A;  4XTY A;  2QHS A;  3RKW A;  4XEM A;  3RL6 A;  4ZTU B;  2AMC B;  2ZIN A;  1PYS A;  1X01 A;  1QF6 A;  1NJ8 A;  1NJ2 A;  1NYR A;  4H2Y A;  1SES A;  3P8Y A;  5C51 B;  2I4O A;  1RIQ A;  3V8J A;  3UFG A;  4YRQ A;  3NEN A;  4AH6 A;  4XEO A;  4YRT A;  4TVW A;  2ARS A;  4H2U A;  1X56 A;  3V7S A;  2I4L A;  4YYE A;  2CJB A;  4KR3 A;  1G5H A;  4DPG A;  3HXU A;  4P72 C;  3QO8 A;  2RHS A;  5C53 B;  3W3S A;  3A5Y A;  4UP8 A;  3RAC A;  3TEG A;  1H4S A;  3HXZ A;  4G84 A;  2DU5 A;  1W66 A;  4YRI A;  4RMF A;  3TUP A;  1B7Y B;  4UPA A;  4XU0 A;  3LSS A;  4XU2 A;  1NJ6 A;  1HTT A;  2ZIO A;  3HFZ A;  1X54 A;  1X2H A;  2ALY A;  1WQ7 A;  1NNH A;  2C7I A;  1E22 A;  4X5O A;  2RHQ A;  2DZC A;  3EFR A;  3L4G A;  4XU1 A;  4TVA B;  4YRS A;  3L4G B;  4NCX A;  2ZT5 A;  3LSQ A;  2ZCE A;  3REU A;  4CH5 A;  1EOV A;  4K86 A;  4LNS A;  2ART A;  4KQE A;  1PYS B;  4HT4 A;  3CMQ A;  3HTZ A;  5KNN A;  1ASY A;  3G1Z A;  2Q7G A;  4H02 A;  4P3P A;  3UH0 A;  3A74 A;  4P3N A;  4H2S A;  2P0L A;  1B8A A;  4P3O A;  3IKL A;  4RQF A;  3RF1 A;  4YRN A;  2ZT7 A;  1IL2 A;  2Q5I A;  2ZZF A;  4TVY A;  4J15 A;  3A32 A;  1HC7 A;  3BJU A;  2DTH A;  3VBB A;  4H2X B;  4K88 A;  3TEH B;  4P72 A;  4K87 A;  1J5W A;  3VQW A;  4LVL A;  2ZNI A;  1WQW A;  5E3I A;  3HRI A;  3P8T A;  3VQV A;  2ZZE A;  3MQZ A;  4P75 C;  2ZGW A;  4EX5 A;  1G5I A;  2DVE A;  3VQY A;  4OP0 A;  2EJG A;  2AMC A;  1USY A;  3E9H A;  4WI1 A;  4XTV A;  1B7Y A;  4BWA A;  1BBU A;  2CIM A;  3NEL A;  2XGT A;  3HFZ B;  4WJ4 A;  4TWA A;  3MEY A;  4UP7 A;  2C8M A;  1YFT A;  1EIY A;  3REX A;  2DZ9 A;  2IY5 B;  3KFU A;  2DQ3 A;  3UGT A;  3FJP A;  1SRY A;  3DSQ A;  4P73 C;  4H2X A;  1EQR A;  2IY5 A;  1QE0 A;  2Q7H A;  2CJ9 A;  3QO7 A;  1E1T A;  2P5I A;  4HWP A;  4O2D A;  3IKM B;  1H4V B;  3R07 A;  3HY0 A;  3E9I A;  4LVI A;  4HWO A;  3V8K A;  2ALY B;  4YRM A;  2XTI A;  2ODR C;  3ICA A;  1FYF A;  3A31 A;  1N9W A;  2ZIM A;  1JJC B;  2EAY A;  2J3L A;  2E64 A;  5C52 B;  1ADY A;  2QHV A;  2ZNJ A;  4LVK A;  2DXT A;  3P8V A;  1WNL A;  3HXX A;  1YFR A;  1Z7N A;  4ZTZ B;  2ZT8 A;  1VQZ A;  3LC0 A;  4YRC A;  4H2V A;  3A7R A;  4HVC A;  3RUX A;  2E65 A;  3QO5 A;  2ZT6 A;  4XTW A;  4PG3 A;  3NET A;  1X2G A;  2RHS B;  1WPY A;  5ELN A;  2DEQ A;  4CH4 A;  4BW9 A;  4P71 C;  1H4Q A;  1B70 A;  4YRR A;  4P71 A;  2DKG A;  4YRG A;  2E5A A;  2J3M A;  1SER A;  4XU3 A;  2ODR D;  2AKW B;  1Z7M A;  11AS A;  1H4T A;  4CH6 A;  3A7U A;  3IG2 A;  1HXD A;  3HXV A;  4H2W A;  3HFV A;  2QHU A;  1G51 A;  1SET A;  4P74 C;  1L0W A;  4CS2 A;  2DQ0 A;  4XTU A;  4YPF A;  2CJA A;  1C0A A;  1YB3 A;  4P74 A;  2ZTG A;  4HWR A;  3L1A A;  4E51 A;  1NYQ A;  5K1P A;  4Q15 A;  1B76 A;  1KMN A;  3PCO A;  3V7R A;  1LYL A;  4YRK A;  3A7A A;  2QHT A;  4YDQ A;  4P75 A;  4CS3 A;  3PZC A;  2A8E A;  5F5W A;  2E3C A;  2FYK A;  1EVL A;  4WF2 A;  1EFW A;  3TEH A;  4G85 A;  4LVM A;  2ZR3 A;  4YRL A;  3UGQ A;  2RHQ B;  3V7C A;  4PHC A;  1YFS A;  3NEM A;  4YCW A;  2DDZ A;  4CS4 A;  2DU7 A;  4Q6G A;  4KR2 A;  2Q7E A;  1KMM A;  2AKW A;  3IAL A;  3QTC A;  3MF1 A;  3ERR A;  4DQ2 A;  1YGB A;  2ARU A;  4HA8 A;  1E24 A;  4XTX A;  3A5Z A;  2HNI A;  3HY1 A;  3EFS A;  1EVK A;  5HGQ A;  2DTI A;  4RDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...