4DPGA

Crystal structure of human lysrs: p38/aimp2 complex i
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
505
structure length
501
Chain Sequence
VDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Switch of Lysyl-tRNA Synthetase between Translation and Transcription.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/apoptosis
molecule keywords Lysine--tRNA ligase
total genus 158
structure length 501
sequence length 505
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dpgA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4dpgA02
3CC7A 3AQQA 4RMFA 4PHCA 1YI2A 1EWIA 3S16H 4YWMA 2OWOA 3K7UC 4YRRA 3UE1A 3HOYG 4NXMQ 3PCOA 4XTUA 2JA8H 3UGQA 5HGQA 4JI7L 2Q5HA 4P74C 2Y0SG 2PNHA 1D8LA 1N33Q 1YNXA 2R92G 4A3FH 4B3RQ 4X62Q 4JV5Q 4A3DH 4HWRA 4IJHA 4GLXA 4NXNL 4GS3A 1JJCA 4C2MH 1E1TA 3I4OA 1PH7A 1G5HA 2ZIOA 4X65L 3I4NG 2B63G 3NENA 3DM3A 1JJ2A 3A5ZB 4LNSA 1BIBA 3V8LA 4XEMA 4XIGS 5IP9H 2ZT7A 1E7ZA 4JCVE 4A3DG 1YEZA 3QTCA 3L2PA 2Q7GA 3IRBA 1J5EQ 4G84A 2ZR3A 2EL9A 3VBBA 3CCRA 4DR1Q 4MTNA 1AH9A 3HOUG 2ZINA 5GAGC 1PH9A 2XTIA 5IYDG 2D62A 4YWKA 1C0AA 2R7DA 4KHZA 2QHUA 2E1HA 1EFWA 2QEXA 3FP9A 1VQDA 3VQVA 1DGSA 1FJGQ 3HXZA 2BA0A 3FJPA 3T1HQ 3W1BA 3HRKA 3VDYA 1S3OA 3RF1A 2OTJA 3HOWG 2WFWA 2BH8A 3GTGH 2UUBL 1YHBA 2RHSB 3W1GA 4DV7L 4KR3A 4TTVA 2JEAI 4JI5L 3GD7A 3J81c 2EXDA 3I2ZA 4DPGA 1QZHA 4A3MH 4H02A 4BY1G 2ODRC 1CSPA 4YREA 5E3IA 3WQZA 2N3SA 3GTQH 3PO2H 1CKMA 1IYJB 3A5YA 3V7SA 1L1OC 2PQAA 2K5NA 1VQNA 1NYRA 5M3MH 2ZIMA 4LNQA 3KF6A 1LTLA 4BY1H 2ALYA 3L2ZA 3P8YA 2R7ZG 3A7AA 1B8AA 5F5WA 3ULPA 2PMEA 3I7FA 5C0XI 3RNUA 4P73A 3A31A 4UP9A 4CH4A 5IY0A 1XPUA 4LF6L 3UH0A 4ZIBA 3JC66 3U4VA 4XU0A 2F52A 3ULJA 4YHHQ 4DUZL 2XGTA 4DR2L 4R4CA 4K88A 3TREA 3M3YH 1WCMH 3E9HA 2OQ0A 2R93G 3REXA 3CC2A 2Q5IA 1K8GA 5C53B 4LF4Q 4YRKA 1SERA 3CPWA 4LFBQ 4YRGA 2ID0A 3HXWA 4GNXA 4XU1A 4H2XA 2ZTEA 4AQYQ 3GTMH 4YPFA 1YFSA 2RCNA 1Z7MA 1UEBA 2ZR2A 4NPSA 4DV5Q 4K87A 3HFZA 1X3GA 4PZ7A 2R7FA 5IWAQ 5FLMH 3PO2G 2EIFA 4CH6A 4TWAA 4YY3L 4OWTB 1MKHA 1W66A 2ZNIA 2F4VL 2CWAA 1AE3A 2V1CC 4L87A 2EAYA 1VQPA 1KRSA 3S24A 3CW2C 1Y1WH 4L5TA 2JA9A 4C3HH 3VQYA 1KXLA 1N9WA 2K75A 1HZCA 3S17H 3QO8A 4XTZA 4JI0Q 4JI6L 5BR8Q 2ZM6Q 2AWNA 3I4MG 1C9OA 1XPOA 3S1QH 4LF9Q 4YRQA 2YTXA 4HJ7A 2JE6I 4B3RL 5K1PA 2UXBL 3J7ZC 2VUMG 3PO3G 3EFSA 3HXYA 4JI4L 4IPHA 3H3VH 3IG2A 1USYA 3A7UA 4OLFA 4CS2A 1WCMG 3MF1A 3CC4A 1HZAA 3ERRA 3A7RA 3PUZA 4DR6Q 1H4VB 1EIFA 1WLEA 3BZCA 2ASBA 1IBKQ 1N36L 4CH3A 3P8TA 3D31A 3CP0A 1PH2A 3HXVA 2KENA 1RIPA 3G71A 1A63A 5C52B 1UE6A 1HNWQ 3RZOH 2OCEA 1NJ2A 1GVPA 5GADC 5M3MG 3S14H 2WAQG 1T9HA 2ZJPA 3HOWH 2HQLA 3EN2A 1WQWA 4NCXA 4DV4Q 1QVCA 4B3SL 1X3FA 1I94L 2DZ9A 3KDFA 4BBRG 1B7YB 1P8LA 1UE1A 4YCWA 2DQ0A 5HY6A 4P73C 2K5VA 1WNLA 1HR0Q 1VQ6A 3I56A 3CCQA 3CCLA 4X65Q 3RKWA 2C8MA 1Z7NA 1J6QA 1SRUA 1VQIA 1USYC 4B3MQ 3NBHB 1NJ5A 3AFQA 4ZTZB 4X62L 4ZTUB 1OXXK 1KOGA 4GLAC 2UU9Q 4OO1I 3HOXG 4POFA 3M4PA 1L1OA 3CMEA 2Q2IA 2ZM6L 3A32A 4R4IA 5LMNQ 1EVLA 3HXXA 1V43A 4AH6A 3GTOH 3HFZB 4TQUS 2EJGA 4JI3L 1QZGA 4KHPL 1TWAH 1SR3A 4OXPA 1PH6A 2BA1A 2AHOB 1NJ1A 5LMUQ 1G5IA 1EUJA 2D0OA 3G1ZA 4P71C 4DR1L 4X66Q 2AKWA 1YHAA 2KHJA 4DV3L 2AKWB 2DUDA 4YHHL 4HA8A 1YITA 4JOIC 2HNIA 5IE8A 1ASYA 3AEVA 2E5LQ 1N34Q 1KL9A 3OYYA 3J80i 2R93H 4X64Q 4A3JG 1PH3A 2YV5A 4YRPA 1BKBA 3REUA 4HVCA 2ATWA 4P75C 2DEQA 2I4MA 3S15H 4B3SQ 4WJ3M 5GQOA 3DLLA 1XMOQ 4A4IA 2IY5B 4GLVB 3CAMA 4DNIA 1X6OA 3OTOQ 4IFDI 4UY8C 2DTHA 3KF6B 2MQHA 4HJ5A 3CXCA 1XNRL 3H0GG 3MEYA 1VQKA 1NTGA 2NN6G 3UDIA 2Z6KC 2CJAA 2UXDQ 3PSIA 2ZTGA 4Y7NH 4APVA 4DR2Q 1B7YA 4UPAA 4XTVA 1RL2A 1NY4A 1PH8A 1XJVA 5M5YH 3HY0A 1Q1BA 3V8KA 2PI2A 2UU9L 2VQFL 3EFRA 3AYHB 4JI8L 1SN8A 3MXNB 2E2JH 3S1RH 4BY7H 3AFPA 3HOZG 3RUXA 3PUWA 1M1KC 4AQYL 2VQEL 1KHIA 1KQSA 2WAQE 4JI3Q 1FGUA 1YIJA 2E8GA 4GN3B 2DKGA 3PIPA 4PMWA 4Y52H 4BXXH 2HHHQ 5ELNA 4YRLA 3J81j 2E2IH 2ZT6A 1VQZA 2JQOA 2CCZA 2I4NA 3GO5A 4YROA 3VQWA 1LM0A 2Q7EA 3CQZH 12ASA 1Q46A 1HNXQ 1ASZA 4LF7Q 1X54A 1Q81C 1B76A 4P3NA 3E0EA 4DV5L 1VQ4A 1MJCA 4KR2A 1XPRA 1IBKL 3RLOA 1GGMA 4KLKA 3J80c 3GTKH 1NJIC 4OWXB 1KIXA 3CMAA 3CCVA 4A3MG 3H0GH 1B70B 2F4VQ 4YCVA 1PH5A 4NXNQ 4A3EH 2Z6KA 1P16A 3V8JA 1Z47A 2J3MA 1VQLA 4JBJA 4K0KQ 1KC8C 4JI0L 4JI6Q 5IP7H 3DSQA 3PO3H 2AMCB 1OXUA 3EBEA 2UUCQ 3BZKA 3RKXA 1QE0A 1VQMA 4JBKA 2LXJA 4A3GH 3M85A 2K52A 1BBWA 1QVFA 1VQAA 2UXBQ 1WPYA 1VCIA 3ERSX 3H15A 1LUZA 3QNEA 1QUQB 1HNZL 1BVSA 1JB7A 5C51B 4HWPA 2JA7H 2VQEQ 2NZHA 1WQ7A 1YFRA 4YRFA 4YP0A 2HIXA 5LMNL 2EQSA 4GNXB 4QJFA 2I5HA 1IXRA 3HY1A 3STBD 4JI8Q 4YRJA 1Q82C 4LF8Q 4A3IH 2MNAA 2ZJRA 2N49A 3CF5A 2F3IA 4NB3A 4CH5A 3ER0A 3I55A 4ME3A 3U58A 4X5OA 4R4OA 5JJKA 1QUQA 2MO0A 4Q15A 2HIVA 2YTVA 2IX1A 3TRZA 4A3JH 2ZZEA 4BA1I 2GVAA 1GD7A 5M5XH 3HOUH 1A62A 1D7QA 2ARUA 4DR4L 1L1OB 4XTCS 5C3EH 3HTZA 3ZJYC 4HIOA 2AMCA 1X2HA 5AJ3Q 4QIWE 4KQEA 4HJAA 4A3BH 3S1MH 5C44G 2E3CA 3K80C 2ALYB 3ICEA 4KI0A 5IYBG 3CCSA 1NBWA 4HWSA 4P72C 1IBLL 3TEHA 4K0KL 5IP7G 4O0AA 4JOIA 5C4XH 4TVWA 1VQ5A 4YDQA 4DV1L 1N8RC 1XNQQ 3KFUA 5K36G 2I5MX 4HJ9A 4JG2A 1B70A 3HOZH 4PG3A 3KF8B 2OTLA 3PF4A 3RN2A 1SFOH 1CKNA 4BBRH 2LXKA 1X3EA 3BFMA 3GTJH 4JV5L 5IYCG 2DGYA 4HIDA 4MZ9A 4LF5L 5JJIA 1E3PA 3ICAA 2CIMA 1WI5A 3UDGA 4A3CG 3L0OA 1G51A 1I6HH 2P0LA 4OWWB 1EVKA 3F2DA 1YJ9A 3PF5A 1Z9FA 3QO5A 5K1XA 2E41A 2P5IA 4YRSA 5LMUL 1AE2A 4EO4A 2IX0A 1YZ6A 3G48A 2G4CA 4DV7Q 3H3VI 4HWOA 3NETA 2NVXH 1N34L 3UDXA 4A3KH 4OX9L 1NYQA 1JE5A 1VS0A 3LGJA 4DV6Q 2DVEA 4LFCL 3K8AA 3HRIA 4DAMA 4A3BG 4H2YA 2EWNA 1XMOL 2Q2UA 4YWLA 1Q1EA 1A8VA 3A5UA 1FL0A 3PGZA 4OO1G 4IOCA 2A1AA 2DU7A 3KJOA 4GN5A 4H2VA 1JJCB 3RLNA 1N33L 2ZXFA 3LSSA 4O2DA 3GDEA 4DK3C 1V9PA 5AJ3L 1E1OA 1H95A 2CQOA 3IALA 3G6EA 4DR5Q 2VQFQ 4JBMA 2BH2A 4XTYA 1ADJA 4P74A 5GAEC 1IBLQ 3CMQA 4RDXA 4DV1Q 2IY5A 4A3IG 1HZBA 4A3LH 1VQFA 2QHVA 1SROA 1NMGA 1SE8A 1VQ8A 5FJ8G 4DUZQ 4H2SA 2Y0SE 4HIKA 1WFQA 4XTWA 1QF6A 2UUCL 2DTOA 3BJUA 4A76A 4DR6L 2ZTDA 1H4TA 4H2XB 4AYBE 1U5KA 2WP8J 1SESA 2ES2A 2N78A 4LF4L 4LFBL 4BXXG 3PV0A 4POGA 4B3TL 4DV0L 4P72A 5FJ8H 5JJLA 3TUPA 4DAYB 3T1HL 1K9MC 1SRYA 3UFGA 5LMNW 4DK6C 2JEBI 5JEAG 1EOVA 1EYGA 4DV4L 3HKZG 3P8VA 4LF8L 3WWVA 4XU3A 1OXVA 1HXDA 2CFMA 1Y1VH 1HNXL 1I3QH 1PH4A 4P3OA 4JBWA 4GOPC 2VY3A 4P75A 4LUOA 2K50A 1EIYA 1JJGA 1HTTA 4CS3A 1WYDA 2NZOA 2CKZB 4R1JA 2YTYA 3F1ZA 3TS2A 1JMCA 2E2HH 4RQEA 5IYBH 2ARTA 2PQAB 4HIMA 2DQ3A 1I5FA 5M3FH 2K14A 1CKOA 4A75A 4YRCA 3KDFB 2ZGWA 3ULLA 4JYAQ 1TWGH 4L5SA 1PYBA 2PMZE 2VS1A 5GROA 4Q6GA 1OXTA 5EAYA 1IBMQ 3W3SA 3CCEA 1XMQQ 1K83H 3A74A 1MJEA 5IYCH 2RHSA 2ZZFA 2DXTA 2ZJQA 1HJPA 2Q2TA 2JA5G 4XTXA 2C7IA 1G291 1VQHA 2Q2HA 1E24A 1VQOA 1YGBA 5M3FG 4DV2L 3HOXH 2KBNA 1I50H 2YYZA 2UXCQ 1QVGA 5H1SE 1S40A 4AIMA 4X64L 3E9IA 4IPDA 1ADYA 2QGQA 2IT1A 4TVYA 3NEMA 4BBSG 4LW1A 1X9NA 3LSQA 4H2UA 2FXQA 3OW2A 2WB1E 4JI2L 3BU2A 4JI1L 5C3EG 1KMMA 3SGIA 4H2TA 2C35B 4G85A 2KCMA 2E10A 2ZTCA 2DU5A 3S2DH 3U50C 1C7YA 4PZ8A 5BR8L 1HNWL 11ASA 2CGHA 4XEOA 4E51A 1CSQA 1PVOA 3RACA 4B3ML 1V1QA 1ATIA 1VQ9A 3UDFA 3KOJA 1VQGA 5DLQE 3HOVG 1K0RA 2VNUD 1VQBA 4LF5Q 4GKKQ 4CS4A 2ZT5A 2J3LA 1HZ9A 1IBML 4LFAL 3M7NA 1YJWA 2DDZA 4AYBG 4IOAA 1YFTA 4IPGA 2JA6G 3A0JA 4KHPQ 1BBUA 4A3GG 4LF6Q 4BWAA 1CUKA 2OQKA 4ALPA 3RZDH 1N36Q 1PYSA 1VQCA 4OP0A 1X01A 2JA7G 1HC7A 2IHEA 3JAMi 1Q8KA 5M5WH 2JA8G 4BBSH 4OX9Q 3RN5A 2GVBA 2E5LL 3J7A5 2PMFA 2DTIA 4TQDA 4DV6L 5GAHC 4DR3L 4YRMA 2AWOA 4LFCQ 2B29A 1I94Q 4JI2Q 2UXCL 2MO1A 4R4TA 3HXUA 1GM5A 2DZCA 5C0XJ 3KYHC 4A3CH 1FVIA 4DUYL 3UGTA 3TS0A 4B3TQ 4NXML 1RIQA 3RKYA 3UE0A 3V7RA 2B63H 3PZCA 3EIVA 2I0QA 1K8AC 3CCUA 4YY3Q 1TXYA 2ZZGA 4JI1Q 3HOVH 1YHQA 4HWTA 1NNHA 3S1NH 1YB3A 1HR0L 3PUYA 1K3RA 4DR5L 1PH1A 3IKLA 3MEFA 4X6AH 3QO7A 2NN6I 3RGLA 4A3KG 3J81i 4BW9A 1X2GA 4L5QA 1L2FA 2DJZA 1VQEA 4QY7A 3STBC 5C4XG 3T1YL 1XNRQ 3U4ZA 1JT8A 4MNOA 3RR5A 2ARSA 3K7AH 3PUVA 4BA2I 1PV4A 2JA6H 4GOPB 3L1AA 1H4SA 2VZAA 3I4NH 4C3JH 3V7CA 4H2WA 3W5OA 4GKKL 4X66L 2HT1A 4TVAA 1J5EL 3PUXA 5E7NA 1OXSC 2CJ9A 4EQ5A 4TQFA 4A93H 4IO9A 4GN4B 2K5HA 1L0WA 4RG1A 1SMXA 1TWFH 1KRTA 1Y14B 4K86A 1EQQA 1YBYA 2NVYH 3HKSA 1U0LA 3FKIH 3HFVA 1WU7A 1FJGL 2MFIA 4GKJL 1XMQL 4DR3Q 4YCUA 5JEAJ 3M4QA 2EJ9A 2Q7HA 4DV3Q 2HHHL 4A3LG 5KNNA 1GO3E 2ODRD 1MIUA 4JI5Q 4DV2Q 5IT9c 2D0PA 3M9BA 2NVQH 3JAMc 3OTOL 3MF2A 1IZ6A 2IHFA 2EJFA 3VQXA 4EX5A 3PIOA 2ZNJA 1EQRA 1A0IA 4LUZA 2RHQA 1BIAA 3FKIG 3K81C 3RLFA 3A5ZA 1Y1WG 4A3FG 3CCJA 1PHJA 4XU2A 3F2BA 4YYEA 2KHIA 4C3IH 3CD6A 1S72A 2E5AA 2E65A 1Q86C 2I5LX 2K4KA 4LF7L 2N8NA 4J15A 1NMFA 4OONA 3D0FA 1XNQL 3HKZE 3FHWA 3G4SA 3GTPH 1W3SA 2JK8A 5ELOA 2LSSA 4JC0A 4QQBX 1Q7YC 2UUAQ 2CWPA 1IL2A 4IFDG 1YJNA 2UXDL 1SETA 3TEGA 1Y1VG 5IP9G 3F8TA 3NELA 3PCOB 3KLWA 2KCTA 1X56A 1PA6A 1TWCH 2B3GA 4GNXC 1FYFA 4LWCA 2RHQB 4LUVA 1HH2P 4PZ6A 1X65A 4IJLA 5C44H 1E22A 4JYAL 2JA5H 1M90C 1YVCA 2E64A 2QA4A 5IYDH 4DR7Q 3GTLH 1WJJA 3RL6A 3CPFA 4WI1A 2I4LA 4LFAQ 3OD1A 1LYLA 2JJQA 3F2CA 4P71A 1HR0W 1HNZQ 3IKMB 1H4QA 1N32L 3B6YA 2NVTH 3M4OH 2ZCEA 1GKHA 1VQ7A 3KJPA 5FLXc 4R4QA 2PI2E 4HJ8A 4UP7A 3R07A 4GKJQ 1O7IA 1UE7A 4TVAB 3S2HH 2CJBA 4YRTA 1NE3A 2FYKA 3RIRA 4DQ2A 3L4GB 1VQJA 4GOPA 1SLJA 1XTDA 1WOCA 2L15A 1CKNB 2I4OA 1Q12A 2Z0SA 5IWAL 4DUYQ 4JI7Q 1OTCA 4WJ4A 1G6PA 2WB1G 4RQFA 4WF2A 2R7ZH 4DKAC 4IFDJ 3TQYA 3TEHB 4A93G 4FDBA 1J5WA 5C4JH 2R92H 3K0XA 2RF4A 4BY7G 1EIYB 2R6GA 1W2BA 2A19A 3I4MH 4IPCA 4YRIA 4L5RC 4JI4Q 3CCMA 5J3BA 4YRNA 2VL6A 1NJ6A 3L4GA 4UP8A 4P3PA 2YU9H 2UUAL 4LF9L 1NJ8A 2QHSA 3Q8DA 3L7ZC 2VUMH 3T1YQ 2GN5A 5C0XG 1UWVA 2VW9A 2QHTA 1X55A 4QGUA 1N32Q 2DXUA 4DV0Q 1K73C 2A8VA 2UUBQ 2H5XA 4QL5A 3HOYH 4DR7L 1PFSA 1R9TH 1KAWA 1PYSB 2ZT8A 1UE5A 1TWHH 5FLMG 4DR4Q 4A3EG 1KD1C 3LC0A 1KMNA
chains in the Genus database with same CATH superfamily
3CC7A 3I3CA 3AQQA 3I4NB 4RMFA 1S5FD 1A6XA 5CC4A 1XWEA 4PHCA 1WTRA 1YI2A 1EWIA 1EL0A 1W6JA 3BDLA 3S16H 3D8GA 3SEBA 3C3LA 4YWMA 3TSSA 4X3UA 1DXMA 2A5HA 2OWOA 3K7UC 1EYCA 1ZYRC 4YRRA 3UE1A 2CW0D 4NXMQ 3HOYG 3PCOA 3CQZB 4PNYA 3HOXB 4XTUA 2JA8H 3UGQA 5HGQA 2F03A 1LT4D 1SYBA 4JI7L 4CDFC 2JP1A 2Q5HA 4P74C 3VR6A 2Y0SG 2NN6H 4KN4C 1B1ZA 4FNFA 1V8QA 2F0GA 2PNHA 4TSSA 3R8BA 2F0FA 1D8LA 2WIIB 1N33Q 1YNXA 2R92G 4A3FH 4KY5A 1SYGA 4I65A 1K0SA 4IUNA 4B3RQ 2AQ1B 4X62Q 3A8IE 1A3UA 4JV5Q 1LTAD 1JOKA 2O5IC 4A3DH 4HWRA 4IJHA 4GLXA 4NXNL 4GS3A 1JJCA 4K2LA 4C2MH 2ICEC 1E1TA 5D65A 3I4OA 1PH7A 1G5HA 2ZIOA 2OF1A 3EJIA 3I4LA 4CDEC 4X65L 3A7LA 3S1QB 5C3EB 3I4NG 2J0TD 2B63G 3NENA 2CHBD 3OIQA 3DM3A 1TKWB 1JJ2A 3A5ZB 1Y8OB 4LNSA 3J7AF 1BIBA 3V8LA 4XEMA 4XIGS 1SEBD 3LX0A 3H91A 5IP9H 2ZXPA 2ZT7A 4IUPA 5CORA 1E7ZA 4G7ZC 3EROA 2JSOA 1IHZA 4JCVE 4A3DG 4RCNA 3QR8A 1YEZA 1B2TA 4H44C 3L2PA 2A6HD 2Q7GA 3QTCA 3IRBA 1KNAA 1J5EQ 4G84A 3RD4A 2ZR3A 1KDCA 2EL9A 3VBBA 3CCRA 4B9XA 4DR1Q 5IT9L 4MTNA 2F3WA 1AH9A 1DD2A 3PIP3 3HOUG 1EEID 2MGSA 2Q8TA 3NTIA 1AEXA 2J4XA 2ZINA 1CI3M 5GAGC 1BUVT 4JW0A 1PH9A 2XTIA 3BVMA 2D62A 4YWKA 5IYDG 1C0AA 3ERQA 2ENBA 2R7DA 3GTJB 4LVIA 4KHZA 1CA6A 2QHUA 2E1HA 2O5JC 1EFWA 3J7AV 4ZQ3A 3HP3A 2QEXA 3FP9A 1VQDA 3VQVA 1DGSA 1FJGQ 3HXZA 1NR2A 2BA0A 2TSSA 5CV5A 3T1HQ 3FJPA 3W1BA 3HRKA 3VDYA 1S3OA 1RODA 4ME5A 5JVH3 3RF1A 2OTJA 3HOWG 1VMPA 2WFWA 2BH8A 3GTGH 4QF4A 1NAPA 2UUBL 1YHBA 2RHSB 3W1GA 4DV7L 4MTKA 1GUGA 4KR3A 4TTVA 3BS1A 3EQLC 5C44B 2JEAI 4JI5L 3GD7A 1M8AA 3J81c 2EXDA 3I2ZA 5KEEA 4DPGA 1QZHA 1KNEA 3FDTA 4A3MH 4H02A 4BY1G 2ODRC 1CSPA 4MIUA 4YREA 5E3IA 4O1NA 1OO9B 2F0DA 3TDQA 3WQZA 2F0HA 2N3SA 3HOWB 3GTQH 2WACA 3HEJA 3PO2H 1CKMA 1IYJB 3A5YA 2QCPX 3V7SA 1L1OC 1JQYD 3D6CA 3KF8A 1BDOA 3KBXA 2PQAA 2A6ED 1STYA 1WTXA 3NTHA 4F88A 2K5NA 4UAIA 5ISRA 1STBA 5M5YB 1HRJA 1VQNA 3Q23A 1NYRA 3E0JA 1QNUA 3WDNA 4IFDH 5M3MH 4PQXA 3MHBA 2JN4A 3D4DA 3KUPA 5JPNC 4LNQA 1IKMA 2ZIMA 4LVMA 5HGTA 3KF6A 2KQ3A 4L6TB 4LMQD 1LTLA 4BY1H 2ALYA 3L2ZA 1FGBD 2EYMA 4KV6A 4C3IB 3P8YA 1GXDC 2R7ZG 3A7AA 4X3TA 1B8AA 4DK1A 5F5WA 1PRTD 3ULPA 2PMEA 3I7FA 3L3OC 5C0XI 3RNUA 2KUMA 1DCZA 1HQMC 4P73A 3A31A 4UP9A 4CH4A 1MI2A 4NW2A 5IY0A 5FKAC 5J1ZA 1XPUA 4LF6L 3UH0A 1LT5D 3OPOA 4A3MB 3NWSA 4BBRB 1H9SB 1FD7D 1KAAA 3J80E 1M4VA 4ZIBA 3JC66 4KK7A 3U4VA 2F52A 2NWGA 4XU0A 1EZ8A 3ULJA 4YHHQ 4DUZL 2XGTA 4YIJA 2ZXOA 4DR2L 4R4CA 4K88A 1WTWA 1B50A 4DAYA 3TREA 3GTOB 1BCPC 3MVVA 3R2TA 3M3YH 3ITPA 3FMCA 1KLGD 2F0KA 1F9QA 2FJ2A 3MXGA 1WCMH 4RH6A 4ZAIA 1Y8NB 3DWPA 3E9HA 4Q0FA 1ILPA 1I4RA 2OQ0A 1O7YA 3QOLA 2R93G 1AP0A 2SOBA 3CC2A 2Q5IA 3REXA 4IURA 1K8GA 5C53B 1CQFA 5EKKA 1D5XC 1SDFA 4L63B 4LF4Q 4YRKA 1SERA 2FMMA 3CPWA 1K8MA 1Q90A 2IX3A 4LFBQ 2EY2A 4K8JA 2ID0A 4YRGA 3HXWA 4GNXA 2XWBB 4XU1A 1EQTA 4H2XA 1EY0A 2ZTEA 2K33A 4AQYQ 3GTMH 1KTKA 2BCOA 3MQZA 1YFSA 4YPFA 2RCNA 2NYZD 1Z7MA 1AW7A 2WB1B 1UEBA 2ZR2A 1BO0A 4NPSA 2WV6D 3TP7A 4DV5Q 4K87A 3HFZA 2BE5C 1PDQA 1X3GA 2G5DA 4PZ7A 2R7FA 4QUCA 3HOZB 1HFGA 5IWAQ 1TU2B 2NUCA 5FLMH 3PO2G 2EIFA 4CH6A 4TWAA 4YY3L 4OWTB 1MKHA 1SNMA 2DNEA 3GP7A 3OWFA 1W66A 1XTCD 3QJYA 2LFNA 4RA8A 1RD9D 1JOOA 2C5CA 2F1MA 4EGVA 2ZNIA 2F4VL 2CWAA 2K5QA 1AE3A 2MPMA 2V1CC 4L87A 4J1MA 2EAYA 1VQPA 1KRSA 3S24A 3MTSA 3CW2C 1Y1WH 4L5TA 2JA9A 4C3HH 3VQYA 2M00A 1KXLA 5J39A 1N9WA 4HEDA 4A3DB 4A3GB 4KD3A 5G3LF 1PTOF 3DHQA 4ZYSA 2BDNA 2K75A 1HZCA 3S17H 3QO8A 3JAML 4XTZA 2X6LA 3DEOA 4JI0Q 4JI6L 1STEA 1H9RA 5BR8Q 2ZM6Q 1JICA 1LV9A 2AWNA 2X69A 2VB2X 1Z7TA 3I4MG 1C9OA 1XPOA 3S1QH 2L5TA 1V1OA 4LJZC 5COYA 4LF9Q 4DXFA 4M1UB 1EWHA 4YRQA 1H9MA 4HR7B 2YTXA 3HS0C 3I90A 1K8OA 4CKBA 4HJ7A 2JE6I 1C48A 4CDCC 3RZOB 1CK1A 5D3IB 3VR5A 4B3RL 5K1PA 4K14A 2UXBL 3J7ZC 5KIXA 1JORA 1F2LA 3FPUB 2VUMG 1IW7C 1EY8A 2MP1A 3PO3G 3EFSA 3HXYA 4C3HG 4DF7A 4JI4L 4IPHA 3H3VH 1WTVA 3IG2A 1USYA 3A7UA 1BNZA 3C2PA 2NVYB 1HHVA 1YNND 1SJHD 1LT3D 4OLFA 4CS2A 1WCMG 3SVMA 2QDBA 3U9SA 3MF1A 2LS01 4HTHA 4DN4M 1A3VA 3CC4A 1HZAA 3ERRA 3A7RA 4V190 2F0SA 3T16A 1RCVD 3VR2A 1YNJC 3TZUA 2PW5A 5EGTA 1F2YA 3PUZA 1LACA 1NSNS 4DR6Q 1H4VB 1EIFA 4OIKA 1WLEA 4R8NA 2D5DA 5M5XB 3NHHA 3BZCA 4EQOA 2ASBA 1IBKQ 1N36L 4CH3A 3P8TA 4C3JG 3D31A 3CP0A 1PH2A 3HXVA 2KENA 1RIPA 3K5OA 3G71A 3S2DB 3MXNA 4RGOS 1A63A 5C52B 1UE6A 1B9MA 1GUNA 1HNWQ 3RZOH 3KLSX 4CBVA 2OCEA 1NJ2A 1HA5A 1GVPA 2EYJA 3D6WA 5GADC 1ICFB 5M3MG 3W2DA 1RJTA 2EE1A 3S14H 2WAQG 2QKIC 1T9HA 1JOQA 2B39A 1V1PA 1H9JA 2ZJPA 3HOWH 2HQLA 3EN2A 1QWYA 3IFTA 5C4XB 4ZK9B 2F0PA 1WQWA 4NCXA 4DV4Q 2PYKA 2E76C 1QVCA 4B3SL 3DEPA 1X3FA 1I94L 2DZ9A 3KDFA 4BBRG 1TR5A 1B7YB 5LL6X 1P8LA 1UE1A 2K04A 3K5MA 4YCWA 2DQ0A 5HY6A 5FO7B 4P73C 2K5VA 1WTQA 3K7AB 1WNLA 1HR0Q 1VQ6A 3I56A 2IPKD 3CCQA 3NXWA 4HSVA 2F0EA 4C3JB 1XXGA 3CCLA 4X65Q 3RKWA 5EKLA 2C8MA 1Z7NA 1J6QA 4WJWA 1SRUA 1VQIA 3I72A 1USYC 4B3MQ 3NBHB 4XYOA 5CV9A 1MSGA 1WD1A 1C4QA 1NJ5A 3AFQA 4ZTZB 4RHSA 5AFWA 4X62L 4ZTUB 2MHVA 4FXGC 1OXXK 2RDGA 2PZTA 1KOGA 4GLAC 1JWSD 3M4YA 2EPBA 2UU9Q 4OO1I 3HOXG 3A54A 2HCCA 4POFA 3M4PA 4HCEA 3E6ZX 1TY2A 2RBMA 1L1OA 3CMEA 2Q2IA 2ZM6L 3S15B 3A32A 2E75C 4R4IA 4V0BA 5LMNQ 5FO8B 1I4PA 1EVLA 4RCOA 3J7YW 2RKSA 3HXXA 1V43A 4PMCA 4AH6A 3GTOH 3HFZB 4TQUS 2SNSA 3ND8A 1TS4A 4BBSB 3DXJC 2EJGA 4QUFA 4N8X1 4JI3L 1X32A 4OL7A 5FK9C 1QZGA 4KHPL 1TWAH 3K59A 1SR3A 4DK0A 4OXPA 2KHSA 1PH6A 1JE4A 2BA1A 2PPBC 2AHOB 1NJ1A 2R92B 5LMUQ 1G5IA 1Y1VB 1EUJA 2D0OA 3G1ZA 4P71C 5KYLA 4DR1L 3HG9A 5C5LA 4X66Q 5ELEA 1S5BD 4IUUA 2AKWA 1YHAA 2KHJA 4DV3L 1STNA 2AKWB 2DUDA 4YHHL 4HA8A 5E3FA 3EVQA 1YITA 4JOIC 2HNIA 2P5ZX 4RAUC 1PZJD 5IE8A 1ASYA 1SNOA 2F0TA 4CHTB 3E3XA 1B44D 3AEVA 2E5LQ 1N34Q 1KL9A 3OYYA 3J80i 3H94A 3HGBA 2F0MA 4FYDA 2R93H 4X64Q 4A3JG 1PH3A 2YV5A 1G2TA 4YRPA 1CFMA 1BKBA 1X3QA 2EJMA 5A2QE 3REUA 4HVCA 2F0JA 3OIPA 2B2YC 2ATWA 1I4XA 2PCFB 4P75C 2DEQA 2I4MA 1ENAA 3S15H 3E5SA 3QWNA 4B3SQ 1H9SA 4WJ3M 4ZUJA 1JCKB 5GQOA 3DLLA 1NCVA 2K28A 1XMOQ 4A4IA 2IY5B 4GLVB 3K5NA 4HCSA 3CAMA 5CMDA 4DNIA 1X6OA 1TWGB 2NZ1D 4OIJA 2F3VA 2DNCA 3GV3A 1QNKA 1WCMB 1DZ1A 3OTOQ 4IFDI 4UY8C 4BY7B 2DTHA 1BF4A 1RKNA 4IALA 2NB0A 3KF6B 1I6HB 2MQHA 4XQQA 4HJ5A 3CXCA 1XNRL 3H0GG 1LO5D 3MEYA 1VQKA 1NTGA 1EY4A 2NN6G 1B3QA 2KA7A 4HMJA 1KLUD 3UDIA 1FNWA 2Z6KC 2CJAA 3GTLB 4FVMA 1ENCA 2UXDQ 5IOCA 1TT2A 3BG3A 3PSIA 3KK7A 5C4ZA 1SMYD 2ZTGA 1I4QA 4LVJA 4Y7NH 3I91A 3QB3A 4APVA 3A8JE 5KYIA 4DR2Q 1B7YA 4IUQA 4UPAA 4XTVA 2XIWA 1AZPA 1RL2A 1UEAB 1NY4A 2G9HD 1TS5A 1PH8A 2JA8B 4ZCKA 1XJVA 5DNFA 5M5YH 3HY0A 1Q1BA 2L12A 4CKEA 1V1PB 3V8KA 5M3MB 1VDZA 2PI2A 3WOFA 2UU9L 2VQFL 3EFRA 3AYHB 2EDGA 4JI8L 4P2CB 2M2LA 2XRQD 2VXWA 1Q8IA 1SN8A 3MXNB 2E2JH 3IKJA 3S1RH 1O7ZA 2H4OA 4BY7H 1II3A 3AFPA 3HOZG 3RUXA 3PUWA 1J8IA 1M1KC 4AQYL 2VQEL 3N52A 4A3EB 1KHIA 3NSWA 4DU9A 1KQSA 2WAQE 2KOLA 4I7ZC 4LVLA 1Y69U 4JI3Q 1FGUA 4TKOB 4KHVA 1YIJA 5IGBA 2E8GA 4GN3B 2Q8RE 2DKGA 3PIPA 1U4RA 4PMWA 4HAEA 2EY5A 4Y52H 3IAYA 4UDUC 4FP5D 4BXXH 2HHHQ 5ELNA 2F0NA 4YRLA 4TRDA 5ELCA 3J81j 2E2IH 2ZT6A 1F2MA 1VQZA 2JQOA 2CCZA 2CH4W 3MZ5A 2I4NA 4JPBW 3GO5A 1CZWA 3LWUA 2R7ZB 4YROA 3VQWA 3HRZC 1QB5D 2DJGC 5EQ0A 5IT9E 1KABA 2NTSA 2B2VC 1LM0A 2Q7EA 1CM9A 3CQZH 12ASA 3N6RA 1Q46A 1HNXQ 3GQBA 1ASZA 4LF7Q 1X54A 1Q81C 4G7OC 1B76A 4P3NA 1LTBD 3E0EA 3G7LA 4DV5L 1VQ4A 1MJCA 4KR2A 1XPRA 3A8KE 1IBKL 3RLOA 4XXEA 1GGMA 1QG7A 4KLKA 1A3TA 3J80c 4PV1C 3GTKH 1NJIC 4OWXB 1KIXA 3CMAA 2GA4B 3CCVA 4A3MG 4DFAA 3H0GH 1B70B 5JPMC 2LMCB 2F4VQ 3AU7A 1HUMA 4YCVA 4U673 1WD0A 1PH5A 4NXNQ 5DAUA 4A3EH 2Z6KA 1MGSA 4G4KA 1P16A 3V8JA 2NVQB 1TWCB 5I2YA 1Z47A 2J3MA 5ELBA 1JWUD 1SYEA 1VQLA 4JBJA 4K0KQ 1KC8C 4XQJA 4JI0L 2EVBA 4JI6Q 5IP7H 4Z9CB 3OOCA 3DSQA 3PO3H 5C5MA 2AMCB 3OW7A 4KN7C 4IZ8A 1SNDA 1OXUA 3EBEA 2UUCQ 1Y1WB 1HCZA 3BZKA 5E1FA 1L0YB 3RKXA 1QE0A 4KY7A 1VQMA 4JBKA 2LXJA 5KGUA 4OO1H 4X3SA 3PO2B 4A3GH 3M85A 2K52A 3BZDB 5FO9B 4NP5A 4KKUA 1BBWA 4A3JB 1QVFA 1PTOD 1VQAA 2UXBQ 4OELB 1WPYA 2V4DA 2HQEA 1VCIA 3ERSX 1EZ6A 3H15A 1SE4A 1LUZA 3MAQA 3QNEA 1QUQB 1HNZL 1BVSA 2FFKB 1JB7A 5C51B 4HWPA 2JA7H 3KBGA 3ONAB 2F0WA 2ZXRA 2VQEQ 2BOSA 3AMUA 1B53A 4ZRZA 2NZHA 1FR3A 3K58A 1WQ7A 1YFRA 2KEDA 4YRFA 4YP0A 4K6DA 5KNDA 2HIXA 5LMNL 2EQSA 4GNXB 2N88A 4BY1B 3MC0B 4QJFA 2I5HA 1BCPD 1IXRA 3HY1A 3STBD 4JI8Q 4YRJA 2SNMA 4IQZA 1Q82C 4LF8Q 4A3IH 3T53B 3URYA 2EY6A 5CV8A 2K32A 2MNAA 5LL6S 2I46A 5I6YA 5I9OA 1UUPA 2ZJRA 2N49A 5C4HA 1JC7A 3LNNA 3FEWX 3CF5A 3PIO3 2F3IA 4DNRB 1S5DD 3A56A 3MFGA 4NB3A 2HDLA 4CH5A 3ER0A 3I55A 4ME3A 2KECA 3U58A 4X5OA 1E0BA 2KCNA 2N55A 4X3KA 5EPJA 4R4OA 5JJKA 1SNQA 2WKCA 1QUQA 2MO0A 4Q15A 3GTQB 4MHEA 4UHVA 2HIVA 1EY7A 2YTVA 2IX1A 3TRZA 1ENFA 1S5ED 4A3JH 2ZZEA 4C2MB 4BA1I 2GVAA 2ZT9C 1GD7A 5M5XH 1DYQA 3HOUH 1A62A 1D7QA 3VYSA 2ARUA 4DR4L 1JB3A 1L1OB 4XTCS 5C3EH 3HTZA 2JA7B 1B9NA 3QG1A 3ZJYC 2JA6B 5KNBA 4HIOA 2AMCA 4FF4A 1X2HA 5KNCA 4EQPA 1K83B 2AQ2B 5AJ3Q 4QIWE 4KQEA 4HJAA 4A3BH 3S1MH 5C44G 2E3CA 3K80C 3J81L 2ALYB 3ICEA 4KI0A 1IKLA 5IGEA 2F4IA 5IYBG 3CU7A 3S14B 3CCSA 1NBWA 3Q24A 4HWSA 4RGMA 4P72C 1IBLL 3TEHA 1R4QB 4K0KL 5IP7G 4O0AA 4JOIA 5C4XH 4TVWA 1VQ5A 4YDQA 4DV1L 1N8RC 1XNQQ 4BS9A 3NQTA 3KFUA 4OEMB 5K36G 2ICIA 2I5MX 4HJ9A 1DM0B 4JG2A 1B70A 3U9OA 3HOZH 3FKIB 4PG3A 3KF8B 5EBCA 1LTGD 2OTLA 2E2HB 1SE3A 3HKZB 4CJ1B 4A3FB 3PF4A 3RN2A 1SFOH 2RQXA 4XDXA 1CKNA 4GZYC 4BBRH 2LXKA 2XNAC 1SNPA 1X3EA 3BFMA 1RTOA 3GTJH 4JV5L 1PXUA 5I9PA 4KKSA 5BN3A 3CHBD 3ND9A 5IYCG 4FF2A 3UI2A 2XVSA 4DAVA 2DGYA 1HA6A 1U4MA 3NQIA 4HIDA 4MZ9A 3BYYB 4B08A 1QILA 4LF5L 4K2KA 4KJOA 5JJIA 1E3PA 3HOYB 1BCPB 3ICAA 1ONLA 2CIMA 1F2ZA 1WI5A 3UDGA 4A3CG 3L0OA 1G51A 3I8ZA 1I6HH 2JYOA 2P0LA 3FPPA 1SXTA 4OWWB 1EVKA 3TP5A 2K03A 3F2DA 4RHRA 3PF5A 1YJ9A 1Z9FA 3QO5A 3ZYYX 2A69C 1ZYRD 1SYDA 1LT6D 2E41A 2P5IA 5K1XA 1RHPA 4YRSA 5NUCA 5LMUL 1AE2A 4EO4A 2IX0A 3H6MA 2KEEA 3LWEA 1LTRD 3VR3A 2F0VA 1YZ6A 1HUNA 1RTNA 5F2DA 3G48A 2G4CA 3C1FA 4DV7Q 3TP6A 4KY6A 5CR3A 3H3VI 4HWOA 2VUMB 3NETA 2NVXH 2IWHA 1N34L 5JVG3 3GTPB 5EJWA 3UDXA 1SMYC 4A3KH 1TIID 4OX9L 1NYQA 1JE5A 1EU3A 5EKIA 1TY0A 1VS0A 1KDAA 1STGA 3BVGA 3LGJA 4CDDC 5D14A 4DV6Q 2DVEA 1BCPF 2QF7A 1WVLA 2KJXA 1Y8PB 4LFCL 3K8AA 2XRSD 3HRIA 4C3HB 4DAMA 1QCBD 4A3BG 1XYIA 2SEBD 4H2YA 2EWNA 4CJ2C 1XMOL 2Q2UA 1PMRA 4YWLA 1Q1EA 1A8VA 3A5UA 4G7HC 1K3BC 1FL0A 3PGZA 4OO1G 2AUKA 4IOCA 3FRPB 2A1AA 3MXUA 4AYBB 4FF3A 2B8GA 2DU7A 3KJOA 1LTID 4QB4A 4GN5A 4H2VA 5DEHA 1JJCB 4G57A 1J9OA 3RLNA 1EQVA 5IIFA 1N33L 2MJ8A 2ZXFA 2BDOA 3LSSA 4O42A 1PRTB 4O2DA 3GDEA 4DK3C 4KKTA 1EYAA 1V9PA 2CW0C 5JJZA 3K5LA 5AJ3L 1E1OA 3NBIA 2PQEA 1H95A 2CQOA 3IALA 4H7BA 4QMGA 1FNVA 3T56B 3G6EA 1BQQT 4DR5Q 2VQFQ 4JBMA 2BH2A 1ADJA 1EY5A 4XTYA 3MA2B 3J81E 4P74A 5GAEC 5C4JB 1IBLQ 5I4DA 1VMCA 2IJ0A 1TWFB 3M4OB 2NVTB 3CMQA 4RDXA 4DV1Q 2IY5A 4A3IG 1HZBA 4HMIA 4A3LH 1VQFA 3P20A 4R9WA 5M9OA 1SROA 3D3RA 2QHVA 3M7GA 4N9PA 1EIHA 5FLXL 1NMGA 1SE8A 5A2QL 1VQ8A 5FJ8G 4DUZQ 4H2SA 1YNJD 4FO2A 3C46A 2Y0SE 1D6EC 4HIKA 1NR4A 4LK1C 1WFQA 4XTWA 4I7AA 3S2HB 1QF6A 1T5XD 4J6HA 1VF5C 2UUCL 2DTOA 5JEAH 4OGQC 3K0YA 1CHQD 3BJUA 1K28A 4A76A 4DR6L 2ZTDA 1H4TA 4H2XB 3NTKA 2EJGC 1XX8A 2A73B 4WRDA 4AYBE 1U5KA 2WP8J 1SESA 2ES2A 1LLRD 2N78A 4LF4L 3SXHA 1E2VA 3OMCA 2K5WA 4HT4A 4LFBL 4BXXG 1F9SA 3PV0A 4B9WA 4POGA 4B3TL 2B2UC 2LY7A 1GHKA 4DV0L 4P72A 5FJ8H 1UNSA 2L9HA 4WORA 2E2JB 5JJLA 3TUPA 3F2UA 2RCFA 4DAYB 1GOZA 3T1HL 1PFMA 1FYCA 1K9MC 1SRYA 3UFGA 5LMNW 2J7ZA 4DK6C 2JEBI 5JEAG 1EOVA 1EYGA 4C1NI 4DV4L 1GUSA 3HKZG 4FXKC 4IUVA 1TWHB 3P8VA 4LF8L 2NTTA 3WWVA 3NWTA 3R2IA 3H09A 3OWEB 4IN3A 1OXVA 1HXDA 1LTSD 4XU3A 2CFMA 1Y1VH 1HNXL 1DOMA 1I3QH 1PH4A 4P3OA 3S9WA 4JBWA 4GOPC 1F77A 1TS3A 2VY3A 3NUCA 4P75A 4LUOA 1PTOB 1STAA 2I07B 4LAAA 2PZWA 5I2XA 2CH4A 4S3SA 3TMEA 2K50A 1I4HA 2K05A 1EIYA 5E4WC 1JJGA 1QOHA 3P75A 5C3WA 1I50B 3NBHA 1HTTA 3VA5A 2R93B 1E2ZA 4CS3A 3SK4A 1WYDA 1F9RA 2NZOA 1CA5A 2PNRC 2CKZB 2BE5D 2RSOA 4R1JA 2YTYA 3F1ZA 3BDOA 5T1IA 3VYTA 3TS2A 1JMCA 2E2HH 4RQEA 1Q3LA 1O7LA 5IYBH 2EYPA 1LABA 2O2LD 2ARTA 1PZKD 2PQAB 4HIMA 2DQ3A 1PTOC 1I5FA 5M3FH 2K14A 1CKOA 4A75A 4YRCA 3KDFB 4C1NK 2ZGWA 3ULLA 4JYAQ 1EY6A 2M9VA 1TWGH 1BXTA 4L5SA 1AN8A 2K01A 1PYBA 2PMZE 2VS1A 5GROA 2O4XA 1DOLA 1QE6A 4Q6GA 1OXTA 5EAYA 1IBMQ 2XN9C 5BN5A 5C3XA 3W3SA 3CCEA 1XMQQ 2EJFC 1K83H 3CRLC 3HZXA 3K6OA 3A74A 1MJEA 5IYCH 4ODGA 3R3OA 2RHSA 2ZZFA 2DXTA 2F0LA 2ZJQA 1HJPA 2Q2TA 1A2TA 1E2WA 1PTOH 2Z4IA 2JA5G 4XTXA 2C7IA 3V2TA 1PRTF 1G291 1VQHA 2Q2HA 3GTMB 4LVKA 1E24A 1VQOA 1YGBA 5M3FG 4DV2L 3HOXH 2KBNA 1I50H 2YYZA 2UXCQ 1QVGA 4Y7NB 1WTOA 4IUTA 1PLFA 1EIGA 5H1SE 2X6GA 1S40A 5JAVA 4AIMA 4X64L 2B2WA 3E9IA 3QIAA 2IW3A 4IPDA 1ADYA 3NPPA 2AUJD 2QGQA 2IT1A 4TVYA 4L8JA 1JR0D 3NEMA 5FOBB 2EY1A 3TZDA 3SR1A 4BBSG 1PRTC 4LW1A 1X9NA 3LSQA 4H2UA 4HSPA 2PW7A 3VA7A 1HFNA 3NP8A 2FXQA 3OW2A 2SDFA 1TS2A 1NNXA 1ESRA 2WB1E 4JI2L 2L0CA 2OT2A 3BU2A 5KRUA 4JI1L 3MFYA 5C3EG 1KMMA 3SGIA 3V96A 4C3IG 4H2TA 2C35B 2KCMA 4G85A 2E10A 4H13C 4A3IB 2ZTCA 2DU5A 3I73A 1PFBA 2C9OA 5EPKA 3S2DH 3U50C 1C7YA 1RF2D 4PZ8A 3V05A 3L9AX 5L37A 4ID6A 4XYQA 5BR8L 1HNWL 1SE2A 2PMZB 11ASA 1CT1D 2CGHA 4XEOA 4E51A 1WTHA 2RDHA 2LKVA 1CSQA 1IL8A 4DNTB 1PVOA 1KDBA 3RACA 4B3ML 1V1QA 1ATIA 2RA4A 1VQ9A 4DAPA 3UDFA 3KOJA 4XT3B 1VQGA 5DLQE 3HOVG 1K0RA 1O78A 3DWQA 5EBDA 2VNUD 2OXPA 1CTMA 4F7XA 1VQBA 4KMUC 5BN4A 3IL8A 3KLSA 4LF5Q 1U9RA 3Q0AA 2FINB 4K5VA 4GKKQ 1NUCA 4A3BB 2NBFA 4CS4A 2ZT5A 2J3LA 1HZ9A 1ET9A 4ZKBB 2QDLA 3A55A 3FVQA 1IBML 4NKLA 4LFAL 3M7NA 1YJWA 2DDZA 2KVMA 4RKLA 5G3LD 1G2SA 2B2YA 4AYBG 1CZGA 2PZUA 2DY7A 3GTGB 3SK8A 2E74C 4IOAA 1SBBB 1YFTA 4PMBA 4IPGA 1RDPD 3DWAA 2JA6G 4BWGB 3A0JA 4KHPQ 1BBUA 4A3GG 4LF6Q 4BWAA 1IYUA 1CUKA 2OQKA 4QCLA 2RVLA 4ALPA 3RZDH 3D4RA 1N36Q 5CBEE 2F0UA 2CVRA 1VQCA 1PYSA 4OP0A 3RUZA 1X01A 2JA7G 1HC7A 2IHEA 4KD4A 3JAMi 3PQIA 1Q8KA 2G9DA 5M5WH 4ABNA 2JA8G 4FXDA 4BBSH 2PO4A 1A15A 3M3YB 4OX9Q 1G8ZD 3TP8A 3RN5A 2GVBA 2K5DA 2E5LL 5A35A 3J7A5 5FLXE 2PMFA 1AFPA 2A74C 2DTIA 1EOTA 2EXZA 4DV6L 2Y0SB 5GAHC 4DR3L 2HDMA 4TQDA 3RMHA 4YRMA 2AWOA 3EFXD 4LFCQ 4EVOA 2B29A 4DGZA 3Q22A 4K6LA 1I94Q 4JI2Q 3J80L 2B8FA 2UXCL 2MO1A 2L4NA 1GJXA 4R4TA 1ZKOA 2Z9HA 4NDXA 3W3AA 3HXUA 1GM5A 3TBIB 2DZCA 5C0XJ 3KYHC 4A3CH 1EEFD 1FVIA 4DUYL 3UGTA 5CV7A 1I3QB 3TS0A 4B3TQ 4NXML 3SK6A 1RIQA 1G6ZA 3RKYA 3UE0A 2A69D 4N8FA 3V7RA 2B63H 1G91A 2TMPA 1U4PA 2WKDA 3PZCA 3MWYW 4A93B 3EIVA 2I0QA 1K8AC 3CCUA 4YY3Q 1BBXC 1TXYA 2ZZGA 3A7AB 2WINB 3MEHA 2B2UA 4JI1Q 1PFNA 2EYHA 3AB9A 2NVXB 3HOVH 1YHQA 1SNCA 4HWTA 1NNHA 1MD2D 5ELFA 3EA6A 1HQRD 3S1NH 1YB3A 1HR0L 3PUYA 1K3RA 4DR5L 1PH1A 3IKLA 3DUZA 3MEFA 4X6AH 4RGTA 3QO7A 2NN6I 3RGLA 3VYUA 3DM1A 1SYFA 4A3KG 1MSHA 3J81i 4BW9A 5M3FB 1X2GA 3PMFA 4L5QA 1L2FA 2DJZA 1VQEA 4QY7A 1W6KA 2B2WC 2Z6BA 3STBC 5C4XG 3T1YL 1EFID 3HOUB 1HXYD 5C6AA 1XNRQ 3U4ZA 1JT8A 4MNOA 3RR5A 3JAME 2ARSA 3K7AH 4R8IA 1GUTA 2EYOA 3PUVA 4BA2I 4N9TA 1JWMD 2A6EC 2L55A 1PV4A 2K6AA 2JA6H 4GOPB 3SK5A 3L1AA 1H4SA 2VZAA 4XT1B 1HTLD 1O80A 2XWJB 3I4NH 4C3JH 3V7CA 4H2WA 3W5OA 3X3MA 3S1MB 4GKKL 4X66L 2HT1A 4TVAA 1J5EL 1DJRD 2YU9B 3PUXA 5E7NA 1OXSC 2CJ9A 4JK1C 4EQ5A 4TQFA 4A93H 2F0IA 4IO9A 4GN4B 2K5HA 1DOKA 1L0WA 1HTPA 4RG1A 5DM73 2HD3A 1SMXA 2RSNA 3HOVB 1TWFH 1KRTA 1Y14B 4K86A 5JOBA 1EQQA 1YBYA 2NVYH 2A8EA 1YNNC 3HKSA 1U0LA 4RWSC 4NMZA 4K8IA 4C56C 3FKIH 3HFVA 1H9KA 4KTAA 2K7VA 2QW7A 1WU7A 3CRKC 1QJOA 1FJGL 2MFIA 4GKJL 1XMQL 4DR3Q 3VYRA 4YCUA 1SFOB 5JEAJ 3M4QA 5IGFA 4WFN3 5LHY1 2EJ9A 2Q7HA 4DV3Q 4K5XA 2HHHL 4A3LG 5KNNA 4RGNA 3H0GB 1GO3E 1STHA 2D2CC 2NS6A 5ELDA 5CV4A 1ZEQX 1S5CD 2ODRD 1MIUA 1PZID 4OHJA 3OSOA 1EU4A 3T51B 2QEJC 4JI5Q 2EYLA 1I6VC 4DV2Q 1ET6A 5IT9c 2D0PA 3M9BA 2NVQH 3JAMc 1ML0D 1TWAB 2L1BA 3OTOL 3MF2A 4F87A 1IZ6A 2IHFA 1D1KA 4Q5VA 2EJFA 3VQXA 4EX5A 3PIOA 2E2DC 4CGYB 3WOEA 1ILQA 2ZNJA 1EQRA 2Q8IB 1A0IA 2R3ZA 4LUZA 2RHQA 4KJNA 5IGGA 1BIAA 3FKIG 3K81C 3RLFA 3A5ZA 1Y1WG 3PO3B 1BOSA 3S16B 4A3FG 3MXPA 3BVZA 3CCJA 5HURA 1PHJA 4XU2A 3F2BA 1GUOA 4YYEA 4ZUIA 2KHIA 4C3IH 3CD6A 1S72A 2E5AA 3R93A 2E65A 1Q86C 2I5LX 2K4KA 3VR4A 4LF7L 2N8NA 3TN2A 4RFBA 4J15A 1NMFA 4OONA 3D0FA 1XNQL 5CV6A 2FHTA 3HKZE 2B2TC 2VB3X 3FHWA 5IGCA 3G4SA 2A6HC 2DN8A 3GTKB 2B2TA 5K5PA 1CHPD 3GTPH 1W3SA 4E6IA 2JK8A 4MN3A 5ELOA 3CKIB 2LSSA 4JC0A 4QQBX 3DMUA 1Q7YC 2CWPA 2UUAQ 1IL2A 2Z4HA 1YJNA 4IFDG 2UXDL 1SETA 3TEGA 1Y1VG 1Z6HA 4K5WA 2HCIA 1IW7D 4F8MA 5IP9G 3F8TA 1B3AA 2B2VA 3NELA 3PCOB 3KLWA 2KCTA 4RKBA 1BR9A 1X56A 3D4WA 1VF7A 3G6JB 1PA6A 1TWCH 2B3GA 3S1RB 3I70A 4GNXC 4LWCA 1FYFA 2RHQB 4LUVA 1HH2P 4PZ6A 1X65A 1DONA 4IJLA 5C44H 1E22A 4JYAL 1ICWA 3T13A 3SDZA 2JA5H 4H0LC 4JVZA 5IGDA 1ESFA 1M90C 1D5MC 1YVCA 2E64A 3RZDB 1ZXTA 2QA4A 5E4XA 1EYDA 4ZLTF 3P1HA 3NE5B 3T4AC 5IYDH 1SYCA 3GTLH 1WJJA 4DR7Q 1TVXA 3RL6A 2K1BA 3CPFA 4ZKCB 4WI1A 2I4LA 5K36H 4LFAQ 3OD1A 1LYLA 2JJQA 3F2CA 2E2IB 2AQ3B 5C0XH 1MBYA 4CJ0B 4P71A 1SAPA 1HR0W 2DY8A 1T5EA 1HNZQ 3IKMB 1H4QA 1N32L 3SE0A 3B6YA 3IFDA 2NVTH 3M4OH 2ZCEA 1GKHA 1VQ7A 3KJPA 2A68D 2Z8LA 2L11A 3X3NA 5FLXc 4R4QA 1UAPA 1GHJA 4XQNA 4EQNA 2PI2E 4HJ8A 2F0QA 4UP7A 3I4MB 2H1EA 3R07A 4GKJQ 1O7IA 3OHXC 1SJED 3OMGA 1UE7A 4TVAB 4DXGA 3S2HH 2CJBA 2FMCA 4YRTA 1NE3A 5IODA 1L0XB 2KCCA 2FYKA 3RIRA 2B63B 4DQ2A 3L4GB 1A2UA 1VQJA 1FNUA 4U68A 3K57A 4GOPA 1SLJA 2JA5B 1D5ZC 5CBAE 1XTDA 2OEOA 1SSOA 1WOCA 2L15A 1S4ZA 1CKNB 2I4OA 1WTPA 1Q12A 2Z0SA 4HN7A 1C8CA 5I6WA 5IWAL 4DUYQ 3BYTB 4M8AA 5M5WB 4JI7Q 1LTTD 1OTCA 4WJ4A 1G6PA 1CQVA 2WB1G 3C1EA 4RQFA 2R7ZH 4WF2A 1MHWC 2HUGA 4DKAC 4CKCA 1HPCA 5DM63 4IFDJ 3TQYA 5CGKA 3TEHB 4A93G 4FDBA 4ILWA 1R9TB 4DA2A 1EWCA 5C4JH 1J5WA 1EY9A 4ULLA 2R92H 3K0XA 1D1IA 3SHLA 2RF4A 4BY7G 1EIYB 2R6GA 2R61A 1W2BA 2EYFA 2A19A 2DJFC 2EZVA 3I4MH 4IPCA 4YRIA 4L5RC 4JI4Q 3CCMA 5J3BA 2A68C 3QOJA 4YRNA 5EPLA 2VL6A 1NJ6A 3L4GA 3H3VC 4UP8A 2IL8A 4P3PA 2YU9H 1R4PB 2UUAL 2D9UA 4J8QA 4LF9L 1F9PA 1NJ8A 1TQOA 2QHSA 1IYVA 3Q8DA 3KLRA 3L7ZC 2VUMH 2CQAA 1I4GA 3T1YQ 2GN5A 5C0XG 1UWVA 2VW9A 4A3KB 2QHTA 3S1NB 1U4LA 2RDFA 2Z1CA 3P7JA 3BDCA 1X55A 2EOTA 2JXMB 1B4OA 1X3PA 4QGUA 1N32Q 4FF1A 1PYWD 2WAQB 4QIWB 2DXUA 2QILA 3QO2A 4DV0Q 5CYUA 1K73C 2A8VA 2UUBQ 2H5XA 3NK9A 3Q6SA 4QL5A 3HOYH 1AZQA 4DR7L 1PFSA 5T1GA 1R9TH 5TSSA 2XSCA 1KAWA 3O13A 3S17B 1PYSB 2MUYA 1UE5A 1TWHH 2ZT8A 1D2BA 2F0OA 5FLMG 4DR4Q 4A3EG 5D3DA 1KD1C 1GUWA 3GV6A 3LC0A 5J22A 1KMNA
chains in the Genus database with same CATH topology
3CC7A 3AQQA 4RMFA 4PHCA 1YI2A 1EWIA 3S16H 4YWMA 2OWOA 3K7UC 4YRRA 3UE1A 3HOYG 4NXMQ 3PCOA 4XTUA 2JA8H 3UGQA 5HGQA 4JI7L 2Q5HA 4P74C 2Y0SG 2PNHA 1D8LA 1N33Q 1YNXA 2R92G 4A3FH 4B3RQ 4X62Q 4JV5Q 4A3DH 4HWRA 4IJHA 4GLXA 4NXNL 4GS3A 1JJCA 4C2MH 1E1TA 3I4OA 1PH7A 1G5HA 2ZIOA 4X65L 3I4NG 2B63G 3NENA 3DM3A 1JJ2A 3A5ZB 4LNSA 1BIBA 3V8LA 4XEMA 4XIGS 5IP9H 2ZT7A 1E7ZA 4JCVE 4A3DG 1YEZA 3QTCA 3L2PA 2Q7GA 3IRBA 1J5EQ 4G84A 2ZR3A 2EL9A 3VBBA 3CCRA 4DR1Q 4MTNA 1AH9A 3HOUG 2ZINA 5GAGC 1PH9A 2XTIA 5IYDG 2D62A 4YWKA 1C0AA 2R7DA 4LVIA 4KHZA 2QHUA 2E1HA 1EFWA 2QEXA 3FP9A 1VQDA 3VQVA 1DGSA 1FJGQ 3HXZA 2BA0A 3FJPA 3T1HQ 3W1BA 3HRKA 3VDYA 1S3OA 3RF1A 2OTJA 3HOWG 2WFWA 2BH8A 3GTGH 2UUBL 1YHBA 2RHSB 3W1GA 4DV7L 4KR3A 4TTVA 2JEAI 4JI5L 3GD7A 3J81c 2EXDA 3I2ZA 4DPGA 1QZHA 4A3MH 4H02A 4BY1G 2ODRC 1CSPA 4YREA 5E3IA 3WQZA 2N3SA 3GTQH 3PO2H 1CKMA 1IYJB 3A5YA 3V7SA 1L1OC 2PQAA 2K5NA 1VQNA 1NYRA 5M3MH 2ZIMA 4LNQA 4LVMA 3KF6A 1LTLA 4BY1H 2ALYA 3L2ZA 3P8YA 2R7ZG 3A7AA 1B8AA 5F5WA 3ULPA 2PMEA 3I7FA 5C0XI 3RNUA 4P73A 3A31A 4UP9A 4CH4A 5IY0A 1XPUA 4LF6L 3UH0A 4ZIBA 3JC66 3U4VA 4XU0A 2F52A 3ULJA 4YHHQ 4DUZL 2XGTA 4DR2L 4R4CA 4K88A 3TREA 3M3YH 1WCMH 3E9HA 2OQ0A 2R93G 3REXA 3CC2A 2Q5IA 1K8GA 5C53B 4LF4Q 4YRKA 1SERA 3CPWA 4LFBQ 4YRGA 2ID0A 3HXWA 4GNXA 4XU1A 4H2XA 2ZTEA 4AQYQ 3GTMH 3MQZA 4YPFA 1YFSA 2RCNA 1Z7MA 1UEBA 2ZR2A 4NPSA 4DV5Q 4K87A 3HFZA 1X3GA 4PZ7A 2R7FA 5IWAQ 5FLMH 3PO2G 2EIFA 4CH6A 4TWAA 4YY3L 4OWTB 1MKHA 1W66A 2ZNIA 2F4VL 2CWAA 1AE3A 2V1CC 4L87A 2EAYA 1VQPA 1KRSA 3S24A 3CW2C 1Y1WH 4L5TA 2JA9A 4C3HH 3VQYA 1KXLA 1N9WA 2K75A 1HZCA 3S17H 3QO8A 4XTZA 4JI0Q 4JI6L 5BR8Q 2ZM6Q 2AWNA 3I4MG 1C9OA 1XPOA 3S1QH 4LF9Q 4YRQA 2YTXA 4HJ7A 2JE6I 4B3RL 5K1PA 2UXBL 3J7ZC 2VUMG 3PO3G 3EFSA 3HXYA 4JI4L 4IPHA 3H3VH 3IG2A 1USYA 3A7UA 4OLFA 4CS2A 1WCMG 3MF1A 3CC4A 1HZAA 3ERRA 3A7RA 3PUZA 4DR6Q 1H4VB 1EIFA 1WLEA 3BZCA 2ASBA 1IBKQ 1N36L 4CH3A 3P8TA 3D31A 3CP0A 1PH2A 3HXVA 2KENA 1RIPA 3G71A 1A63A 5C52B 1UE6A 1HNWQ 3RZOH 2OCEA 1NJ2A 1GVPA 5GADC 5M3MG 3S14H 2WAQG 1T9HA 2ZJPA 3HOWH 2HQLA 3EN2A 1WQWA 4NCXA 4DV4Q 1QVCA 4B3SL 1X3FA 1I94L 2DZ9A 3KDFA 4BBRG 1B7YB 1P8LA 1UE1A 4YCWA 2DQ0A 5HY6A 4P73C 2K5VA 1WNLA 1HR0Q 1VQ6A 3I56A 3CCQA 3CCLA 4X65Q 3RKWA 2C8MA 1Z7NA 1J6QA 1SRUA 1VQIA 1USYC 4B3MQ 3NBHB 1NJ5A 3AFQA 4ZTZB 4X62L 4ZTUB 1OXXK 1KOGA 4GLAC 2UU9Q 4OO1I 3HOXG 4POFA 3M4PA 1L1OA 3CMEA 2Q2IA 2ZM6L 3A32A 4R4IA 5LMNQ 1EVLA 3HXXA 1V43A 4AH6A 3GTOH 3HFZB 4TQUS 2EJGA 4JI3L 1QZGA 4KHPL 1TWAH 1SR3A 4OXPA 1PH6A 2BA1A 2AHOB 1NJ1A 5LMUQ 1G5IA 1EUJA 2D0OA 3G1ZA 4P71C 4DR1L 4X66Q 2AKWA 1YHAA 2KHJA 4DV3L 2AKWB 2DUDA 4YHHL 4HA8A 1YITA 4JOIC 2HNIA 5IE8A 1ASYA 3AEVA 2E5LQ 1N34Q 1KL9A 3OYYA 3J80i 2R93H 4X64Q 4A3JG 1PH3A 2YV5A 4YRPA 1BKBA 3REUA 4HVCA 2ATWA 4P75C 2DEQA 2I4MA 3S15H 4B3SQ 4WJ3M 5GQOA 3DLLA 1XMOQ 4A4IA 2IY5B 4GLVB 3CAMA 4DNIA 1X6OA 3OTOQ 4IFDI 4UY8C 2DTHA 3KF6B 2MQHA 4HJ5A 3CXCA 1XNRL 3H0GG 3MEYA 1VQKA 1NTGA 2NN6G 3UDIA 2Z6KC 2CJAA 2UXDQ 3PSIA 2ZTGA 4LVJA 4Y7NH 4APVA 4DR2Q 1B7YA 4UPAA 4XTVA 1RL2A 1NY4A 1PH8A 1XJVA 5M5YH 3HY0A 1Q1BA 3V8KA 2PI2A 2UU9L 2VQFL 3EFRA 3AYHB 4JI8L 1SN8A 3MXNB 2E2JH 3S1RH 4BY7H 3AFPA 3HOZG 3RUXA 3PUWA 1M1KC 4AQYL 2VQEL 1KHIA 1KQSA 2WAQE 4LVLA 4JI3Q 1FGUA 1YIJA 2E8GA 4GN3B 2DKGA 3PIPA 4PMWA 4Y52H 4BXXH 2HHHQ 5ELNA 4YRLA 3J81j 2E2IH 2ZT6A 1VQZA 2JQOA 2CCZA 2I4NA 3GO5A 4YROA 3VQWA 1LM0A 2Q7EA 3CQZH 12ASA 1Q46A 1HNXQ 1ASZA 4LF7Q 1X54A 1Q81C 1B76A 4P3NA 3E0EA 4DV5L 1VQ4A 1MJCA 4KR2A 1XPRA 1IBKL 3RLOA 1GGMA 4KLKA 3J80c 3GTKH 1NJIC 4OWXB 1KIXA 3CMAA 3CCVA 4A3MG 3H0GH 1B70B 2F4VQ 4YCVA 1PH5A 4NXNQ 4A3EH 2Z6KA 1P16A 3V8JA 1Z47A 2J3MA 1VQLA 4JBJA 4K0KQ 1KC8C 4JI0L 4JI6Q 5IP7H 3DSQA 3PO3H 2AMCB 1OXUA 3EBEA 2UUCQ 3BZKA 3RKXA 1QE0A 1VQMA 4JBKA 2LXJA 4A3GH 3M85A 2K52A 1BBWA 1QVFA 1VQAA 2UXBQ 1WPYA 1VCIA 3ERSX 3H15A 1LUZA 3QNEA 1QUQB 1HNZL 1BVSA 1JB7A 5C51B 4HWPA 2JA7H 2VQEQ 2NZHA 1WQ7A 1YFRA 4YRFA 4YP0A 2HIXA 5LMNL 2EQSA 4GNXB 4QJFA 2I5HA 1IXRA 3HY1A 3STBD 4JI8Q 4YRJA 1Q82C 4LF8Q 4A3IH 2MNAA 2ZJRA 2N49A 3CF5A 2F3IA 4NB3A 4CH5A 3ER0A 3I55A 4ME3A 3U58A 4X5OA 4R4OA 5JJKA 1QUQA 2MO0A 4Q15A 2HIVA 2YTVA 2IX1A 3TRZA 4A3JH 2ZZEA 4BA1I 2GVAA 1GD7A 5M5XH 3HOUH 1A62A 1D7QA 2ARUA 4DR4L 1L1OB 4XTCS 5C3EH 3HTZA 3ZJYC 4HIOA 2AMCA 1X2HA 5AJ3Q 4QIWE 4KQEA 4HJAA 4A3BH 3S1MH 5C44G 2E3CA 3K80C 2ALYB 3ICEA 4KI0A 5IYBG 3CCSA 1NBWA 4HWSA 4P72C 1IBLL 3TEHA 4K0KL 5IP7G 4O0AA 4JOIA 5C4XH 4TVWA 1VQ5A 4YDQA 4DV1L 1N8RC 1XNQQ 3KFUA 5K36G 2I5MX 4HJ9A 4JG2A 1B70A 3HOZH 4PG3A 3KF8B 2OTLA 3PF4A 3RN2A 1SFOH 1CKNA 4BBRH 2LXKA 1X3EA 3BFMA 3GTJH 4JV5L 5IYCG 2DGYA 4HIDA 4MZ9A 4LF5L 5JJIA 1E3PA 3ICAA 2CIMA 1WI5A 3UDGA 4A3CG 3L0OA 1G51A 1I6HH 2P0LA 4OWWB 1EVKA 3F2DA 1YJ9A 3PF5A 1Z9FA 3QO5A 5K1XA 2E41A 2P5IA 4YRSA 5LMUL 1AE2A 4EO4A 2IX0A 1YZ6A 3G48A 2G4CA 4DV7Q 3H3VI 4HWOA 3NETA 2NVXH 1N34L 3UDXA 4A3KH 4OX9L 1NYQA 1JE5A 1VS0A 3LGJA 4DV6Q 2DVEA 4LFCL 3K8AA 3HRIA 4DAMA 4A3BG 4H2YA 2EWNA 1XMOL 2Q2UA 4YWLA 1Q1EA 1A8VA 3A5UA 1FL0A 3PGZA 4OO1G 4IOCA 2A1AA 2DU7A 3KJOA 4GN5A 4H2VA 1JJCB 3RLNA 1N33L 2ZXFA 3LSSA 4O2DA 3GDEA 4DK3C 1V9PA 5AJ3L 1E1OA 1H95A 2CQOA 3IALA 3G6EA 4DR5Q 2VQFQ 4JBMA 2BH2A 4XTYA 1ADJA 4P74A 5GAEC 1IBLQ 3CMQA 4RDXA 4DV1Q 2IY5A 4A3IG 1HZBA 4A3LH 1VQFA 2QHVA 1SROA 1NMGA 1SE8A 1VQ8A 5FJ8G 4DUZQ 4H2SA 2Y0SE 4HIKA 1WFQA 4XTWA 1QF6A 2UUCL 2DTOA 3BJUA 4A76A 4DR6L 2ZTDA 1H4TA 4H2XB 4AYBE 1U5KA 2WP8J 1SESA 2ES2A 2N78A 4LF4L 4HT4A 4LFBL 4BXXG 3PV0A 4POGA 4B3TL 4DV0L 4P72A 5FJ8H 5JJLA 3TUPA 4DAYB 3T1HL 1K9MC 1SRYA 3UFGA 5LMNW 4DK6C 2JEBI 5JEAG 1EOVA 1EYGA 4DV4L 3HKZG 3P8VA 4LF8L 3WWVA 4XU3A 1OXVA 1HXDA 2CFMA 1Y1VH 1HNXL 1I3QH 1PH4A 4P3OA 4JBWA 4GOPC 2VY3A 4P75A 4LUOA 2K50A 1EIYA 1JJGA 1HTTA 4CS3A 1WYDA 2NZOA 2CKZB 4R1JA 2YTYA 3F1ZA 3TS2A 1JMCA 2E2HH 4RQEA 5IYBH 2ARTA 2PQAB 4HIMA 2DQ3A 1I5FA 5M3FH 2K14A 1CKOA 4A75A 4YRCA 3KDFB 2ZGWA 3ULLA 4JYAQ 1TWGH 4L5SA 1PYBA 2PMZE 2VS1A 5GROA 4Q6GA 1OXTA 5EAYA 1IBMQ 3W3SA 3CCEA 1XMQQ 1K83H 3A74A 1MJEA 5IYCH 2RHSA 2ZZFA 2DXTA 2ZJQA 1HJPA 2Q2TA 2JA5G 4XTXA 2C7IA 1G291 1VQHA 2Q2HA 4LVKA 1E24A 1VQOA 1YGBA 5M3FG 4DV2L 3HOXH 2KBNA 1I50H 2YYZA 2UXCQ 1QVGA 5H1SE 1S40A 4AIMA 4X64L 3E9IA 4IPDA 1ADYA 2QGQA 2IT1A 4TVYA 3NEMA 4BBSG 4LW1A 1X9NA 3LSQA 4H2UA 2FXQA 3OW2A 2WB1E 4JI2L 3BU2A 4JI1L 5C3EG 1KMMA 3SGIA 4H2TA 2C35B 4G85A 2KCMA 2E10A 2ZTCA 2DU5A 3S2DH 3U50C 1C7YA 4PZ8A 5BR8L 1HNWL 11ASA 2CGHA 4XEOA 4E51A 1CSQA 1PVOA 3RACA 4B3ML 1V1QA 1ATIA 1VQ9A 3UDFA 3KOJA 1VQGA 5DLQE 3HOVG 1K0RA 2VNUD 1VQBA 4LF5Q 4GKKQ 4CS4A 2ZT5A 2J3LA 1HZ9A 1IBML 4LFAL 3M7NA 1YJWA 2DDZA 4AYBG 4IOAA 1YFTA 4IPGA 2JA6G 3A0JA 4KHPQ 1BBUA 4A3GG 4LF6Q 4BWAA 1CUKA 2OQKA 4ALPA 3RZDH 1N36Q 1PYSA 1VQCA 4OP0A 1X01A 2JA7G 1HC7A 2IHEA 3JAMi 1Q8KA 5M5WH 2JA8G 4BBSH 4OX9Q 3RN5A 2GVBA 2E5LL 3J7A5 2PMFA 2DTIA 4TQDA 4DV6L 5GAHC 4DR3L 4YRMA 2AWOA 4LFCQ 2B29A 1I94Q 4JI2Q 2UXCL 2MO1A 4R4TA 3HXUA 1GM5A 2DZCA 5C0XJ 3KYHC 4A3CH 1FVIA 4DUYL 3UGTA 3TS0A 4B3TQ 4NXML 1RIQA 3RKYA 3UE0A 3V7RA 2B63H 3PZCA 3EIVA 2I0QA 1K8AC 3CCUA 4YY3Q 1TXYA 2ZZGA 4JI1Q 3HOVH 1YHQA 4HWTA 1NNHA 3S1NH 1YB3A 1HR0L 3PUYA 1K3RA 4DR5L 1PH1A 3IKLA 3MEFA 4X6AH 3QO7A 2NN6I 3RGLA 4A3KG 3J81i 4BW9A 1X2GA 4L5QA 1L2FA 2DJZA 1VQEA 4QY7A 3STBC 5C4XG 3T1YL 1XNRQ 3U4ZA 1JT8A 4MNOA 3RR5A 2ARSA 3K7AH 3PUVA 4BA2I 1PV4A 2JA6H 4GOPB 3L1AA 1H4SA 2VZAA 3I4NH 4C3JH 3V7CA 4H2WA 3W5OA 4GKKL 4X66L 2HT1A 4TVAA 1J5EL 3PUXA 5E7NA 1OXSC 2CJ9A 4EQ5A 4TQFA 4A93H 4IO9A 4GN4B 2K5HA 1L0WA 4RG1A 1SMXA 1TWFH 1KRTA 1Y14B 4K86A 1EQQA 1YBYA 2NVYH 2A8EA 3HKSA 1U0LA 3FKIH 3HFVA 1WU7A 1FJGL 2MFIA 4GKJL 1XMQL 4DR3Q 4YCUA 5JEAJ 3M4QA 2EJ9A 2Q7HA 4DV3Q 2HHHL 4A3LG 5KNNA 1GO3E 2NS6A 2ODRD 1MIUA 4JI5Q 4DV2Q 5IT9c 2D0PA 3M9BA 2NVQH 3JAMc 3OTOL 3MF2A 1IZ6A 2IHFA 2EJFA 3VQXA 4EX5A 3PIOA 2ZNJA 1EQRA 1A0IA 4LUZA 2RHQA 1BIAA 3FKIG 3K81C 3RLFA 3A5ZA 1Y1WG 4A3FG 3CCJA 1PHJA 4XU2A 3F2BA 4YYEA 2KHIA 4C3IH 3CD6A 1S72A 2E5AA 2E65A 1Q86C 2I5LX 2K4KA 4LF7L 2N8NA 4J15A 1NMFA 4OONA 3D0FA 1XNQL 3HKZE 3FHWA 3G4SA 3GTPH 1W3SA 2JK8A 5ELOA 2LSSA 4JC0A 4QQBX 1Q7YC 2UUAQ 2CWPA 1IL2A 4IFDG 1YJNA 2UXDL 1SETA 3TEGA 1Y1VG 5IP9G 3F8TA 3NELA 3PCOB 3KLWA 2KCTA 1X56A 1PA6A 1TWCH 2B3GA 4GNXC 1FYFA 4LWCA 2RHQB 4LUVA 1HH2P 4PZ6A 1X65A 4IJLA 5C44H 1E22A 4JYAL 2JA5H 1M90C 1YVCA 2E64A 2QA4A 5IYDH 4DR7Q 3GTLH 1WJJA 3RL6A 3CPFA 4WI1A 2I4LA 4LFAQ 3OD1A 1LYLA 2JJQA 3F2CA 4P71A 1HR0W 1HNZQ 3IKMB 1H4QA 1N32L 3B6YA 2NVTH 3M4OH 2ZCEA 1GKHA 1VQ7A 3KJPA 5FLXc 4R4QA 2PI2E 4HJ8A 4UP7A 3R07A 4GKJQ 1O7IA 1UE7A 4TVAB 3S2HH 2CJBA 4YRTA 1NE3A 2FYKA 3RIRA 4DQ2A 3L4GB 1VQJA 4GOPA 1SLJA 1XTDA 1WOCA 2L15A 1CKNB 2I4OA 1Q12A 2Z0SA 5IWAL 4DUYQ 4JI7Q 1OTCA 4WJ4A 1G6PA 2WB1G 4RQFA 4WF2A 2R7ZH 4DKAC 4IFDJ 3TQYA 3TEHB 4A93G 4FDBA 1J5WA 5C4JH 2R92H 3K0XA 2RF4A 4BY7G 1EIYB 2R6GA 1W2BA 2A19A 3I4MH 4IPCA 4YRIA 4L5RC 4JI4Q 3CCMA 5J3BA 4YRNA 2VL6A 1NJ6A 3L4GA 4UP8A 4P3PA 2YU9H 2UUAL 4LF9L 1NJ8A 2QHSA 3Q8DA 3L7ZC 2VUMH 3T1YQ 2GN5A 5C0XG 1UWVA 2VW9A 2QHTA 1X55A 4QGUA 1N32Q 2DXUA 4DV0Q 1K73C 2A8VA 2UUBQ 2H5XA 4QL5A 3HOYH 4DR7L 1PFSA 1R9TH 1KAWA 1PYSB 2ZT8A 1UE5A 1TWHH 5FLMG 4DR4Q 4A3EG 1KD1C 3LC0A 1KMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 A;  3AQQ A;  4RMF A;  4PHC A;  1YI2 A;  1EWI A;  3S16 H;  4YWM A;  2OWO A;  3K7U C;  4YRR A;  3UE1 A;  3HOY G;  4NXM Q;  3PCO A;  4XTU A;  2JA8 H;  3UGQ A;  5HGQ A;  4JI7 L;  2Q5H A;  4P74 C;  2Y0S G;  2PNH A;  1D8L A;  1N33 Q;  1YNX A;  2R92 G;  4A3F H;  4B3R Q;  4X62 Q;  4JV5 Q;  4A3D H;  4HWR A;  4IJH A;  4GLX A;  4NXN L;  4GS3 A;  1JJC A;  4C2M H;  1E1T A;  3I4O A;  1PH7 A;  1G5H A;  2ZIO A;  4X65 L;  3I4N G;  2B63 G;  3NEN A;  3DM3 A;  1JJ2 A;  3A5Z B;  4LNS A;  1BIB A;  3V8L A;  4XEM A;  4XIG S;  5IP9 H;  2ZT7 A;  1E7Z A;  4JCV E;  4A3D G;  1YEZ A;  3QTC A;  3L2P A;  2Q7G A;  3IRB A;  1J5E Q;  4G84 A;  2ZR3 A;  2EL9 A;  3VBB A;  3CCR A;  4DR1 Q;  4MTN A;  1AH9 A;  3HOU G;  2ZIN A;  5GAG C;  1PH9 A;  2XTI A;  5IYD G;  2D62 A;  4YWK A;  1C0A A;  2R7D A;  4KHZ A;  2QHU A;  2E1H A;  1EFW A;  2QEX A;  3FP9 A;  1VQD A;  3VQV A;  1DGS A;  1FJG Q;  3HXZ A;  2BA0 A;  3FJP A;  3T1H Q;  3W1B A;  3HRK A;  3VDY A;  1S3O A;  3RF1 A;  2OTJ A;  3HOW G;  2WFW A;  2BH8 A;  3GTG H;  2UUB L;  1YHB A;  2RHS B;  3W1G A;  4DV7 L;  4KR3 A;  4TTV A;  2JEA I;  4JI5 L;  3GD7 A;  3J81 c;  2EXD A;  3I2Z A;  4DPG A;  1QZH A;  4A3M H;  4H02 A;  4BY1 G;  2ODR C;  1CSP A;  4YRE A;  5E3I A;  3WQZ A;  2N3S A;  3GTQ H;  3PO2 H;  1CKM A;  1IYJ B;  3A5Y A;  3V7S A;  1L1O C;  2PQA A;  2K5N A;  1VQN A;  1NYR A;  5M3M H;  2ZIM A;  4LNQ A;  3KF6 A;  1LTL A;  4BY1 H;  2ALY A;  3L2Z A;  3P8Y A;  2R7Z G;  3A7A A;  1B8A A;  5F5W A;  3ULP A;  2PME A;  3I7F A;  5C0X I;  3RNU A;  4P73 A;  3A31 A;  4UP9 A;  4CH4 A;  5IY0 A;  1XPU A;  4LF6 L;  3UH0 A;  4ZIB A;  3JC6 6;  3U4V A;  4XU0 A;  2F52 A;  3ULJ A;  4YHH Q;  4DUZ L;  2XGT A;  4DR2 L;  4R4C A;  4K88 A;  3TRE A;  3M3Y H;  1WCM H;  3E9H A;  2OQ0 A;  2R93 G;  3REX A;  3CC2 A;  2Q5I A;  1K8G A;  5C53 B;  4LF4 Q;  4YRK A;  1SER A;  3CPW A;  4LFB Q;  4YRG A;  2ID0 A;  3HXW A;  4GNX A;  4XU1 A;  4H2X A;  2ZTE A;  4AQY Q;  3GTM H;  4YPF A;  1YFS A;  2RCN A;  1Z7M A;  1UEB A;  2ZR2 A;  4NPS A;  4DV5 Q;  4K87 A;  3HFZ A;  1X3G A;  4PZ7 A;  2R7F A;  5IWA Q;  5FLM H;  3PO2 G;  2EIF A;  4CH6 A;  4TWA A;  4YY3 L;  4OWT B;  1MKH A;  1W66 A;  2ZNI A;  2F4V L;  2CWA A;  1AE3 A;  2V1C C;  4L87 A;  2EAY A;  1VQP A;  1KRS A;  3S24 A;  3CW2 C;  1Y1W H;  4L5T A;  2JA9 A;  4C3H H;  3VQY A;  1KXL A;  1N9W A;  2K75 A;  1HZC A;  3S17 H;  3QO8 A;  4XTZ A;  4JI0 Q;  4JI6 L;  5BR8 Q;  2ZM6 Q;  2AWN A;  3I4M G;  1C9O A;  1XPO A;  3S1Q H;  4LF9 Q;  4YRQ A;  2YTX A;  4HJ7 A;  2JE6 I;  4B3R L;  5K1P A;  2UXB L;  3J7Z C;  2VUM G;  3PO3 G;  3EFS A;  3HXY A;  4JI4 L;  4IPH A;  3H3V H;  3IG2 A;  1USY A;  3A7U A;  4OLF A;  4CS2 A;  1WCM G;  3MF1 A;  3CC4 A;  1HZA A;  3ERR A;  3A7R A;  3PUZ A;  4DR6 Q;  1H4V B;  1EIF A;  1WLE A;  3BZC A;  2ASB A;  1IBK Q;  1N36 L;  4CH3 A;  3P8T A;  3D31 A;  3CP0 A;  1PH2 A;  3HXV A;  2KEN A;  1RIP A;  3G71 A;  1A63 A;  5C52 B;  1UE6 A;  1HNW Q;  3RZO H;  2OCE A;  1NJ2 A;  1GVP A;  5GAD C;  5M3M G;  3S14 H;  2WAQ G;  1T9H A;  2ZJP A;  3HOW H;  2HQL A;  3EN2 A;  1WQW A;  4NCX A;  4DV4 Q;  1QVC A;  4B3S L;  1X3F A;  1I94 L;  2DZ9 A;  3KDF A;  4BBR G;  1B7Y B;  1P8L A;  1UE1 A;  4YCW A;  2DQ0 A;  5HY6 A;  4P73 C;  2K5V A;  1WNL A;  1HR0 Q;  1VQ6 A;  3I56 A;  3CCQ A;  3CCL A;  4X65 Q;  3RKW A;  2C8M A;  1Z7N A;  1J6Q A;  1SRU A;  1VQI A;  1USY C;  4B3M Q;  3NBH B;  1NJ5 A;  3AFQ A;  4ZTZ B;  4X62 L;  4ZTU B;  1OXX K;  1KOG A;  4GLA C;  2UU9 Q;  4OO1 I;  3HOX G;  4POF A;  3M4P A;  1L1O A;  3CME A;  2Q2I A;  2ZM6 L;  3A32 A;  4R4I A;  5LMN Q;  1EVL A;  3HXX A;  1V43 A;  4AH6 A;  3GTO H;  3HFZ B;  4TQU S;  2EJG A;  4JI3 L;  1QZG A;  4KHP L;  1TWA H;  1SR3 A;  4OXP A;  1PH6 A;  2BA1 A;  2AHO B;  1NJ1 A;  5LMU Q;  1G5I A;  1EUJ A;  2D0O A;  3G1Z A;  4P71 C;  4DR1 L;  4X66 Q;  2AKW A;  1YHA A;  2KHJ A;  4DV3 L;  2AKW B;  2DUD A;  4YHH L;  4HA8 A;  1YIT A;  4JOI C;  2HNI A;  5IE8 A;  1ASY A;  3AEV A;  2E5L Q;  1N34 Q;  1KL9 A;  3OYY A;  3J80 i;  2R93 H;  4X64 Q;  4A3J G;  1PH3 A;  2YV5 A;  4YRP A;  1BKB A;  3REU A;  4HVC A;  2ATW A;  4P75 C;  2DEQ A;  2I4M A;  3S15 H;  4B3S Q;  4WJ3 M;  5GQO A;  3DLL A;  1XMO Q;  4A4I A;  2IY5 B;  4GLV B;  3CAM A;  4DNI A;  1X6O A;  3OTO Q;  4IFD I;  4UY8 C;  2DTH A;  3KF6 B;  2MQH A;  4HJ5 A;  3CXC A;  1XNR L;  3H0G G;  3MEY A;  1VQK A;  1NTG A;  2NN6 G;  3UDI A;  2Z6K C;  2CJA A;  2UXD Q;  3PSI A;  2ZTG A;  4Y7N H;  4APV A;  4DR2 Q;  1B7Y A;  4UPA A;  4XTV A;  1RL2 A;  1NY4 A;  1PH8 A;  1XJV A;  5M5Y H;  3HY0 A;  1Q1B A;  3V8K A;  2PI2 A;  2UU9 L;  2VQF L;  3EFR A;  3AYH B;  4JI8 L;  1SN8 A;  3MXN B;  2E2J H;  3S1R H;  4BY7 H;  3AFP A;  3HOZ G;  3RUX A;  3PUW A;  1M1K C;  4AQY L;  2VQE L;  1KHI A;  1KQS A;  2WAQ E;  4JI3 Q;  1FGU A;  1YIJ A;  2E8G A;  4GN3 B;  2DKG A;  3PIP A;  4PMW A;  4Y52 H;  4BXX H;  2HHH Q;  5ELN A;  4YRL A;  3J81 j;  2E2I H;  2ZT6 A;  1VQZ A;  2JQO A;  2CCZ A;  2I4N A;  3GO5 A;  4YRO A;  3VQW A;  1LM0 A;  2Q7E A;  3CQZ H;  12AS A;  1Q46 A;  1HNX Q;  1ASZ A;  4LF7 Q;  1X54 A;  1Q81 C;  1B76 A;  4P3N A;  3E0E A;  4DV5 L;  1VQ4 A;  1MJC A;  4KR2 A;  1XPR A;  1IBK L;  3RLO A;  1GGM A;  4KLK A;  3J80 c;  3GTK H;  1NJI C;  4OWX B;  1KIX A;  3CMA A;  3CCV A;  4A3M G;  3H0G H;  1B70 B;  2F4V Q;  4YCV A;  1PH5 A;  4NXN Q;  4A3E H;  2Z6K A;  1P16 A;  3V8J A;  1Z47 A;  2J3M A;  1VQL A;  4JBJ A;  4K0K Q;  1KC8 C;  4JI0 L;  4JI6 Q;  5IP7 H;  3DSQ A;  3PO3 H;  2AMC B;  1OXU A;  3EBE A;  2UUC Q;  3BZK A;  3RKX A;  1QE0 A;  1VQM A;  4JBK A;  2LXJ A;  4A3G H;  3M85 A;  2K52 A;  1BBW A;  1QVF A;  1VQA A;  2UXB Q;  1WPY A;  1VCI A;  3ERS X;  3H15 A;  1LUZ A;  3QNE A;  1QUQ B;  1HNZ L;  1BVS A;  1JB7 A;  5C51 B;  4HWP A;  2JA7 H;  2VQE Q;  2NZH A;  1WQ7 A;  1YFR A;  4YRF A;  4YP0 A;  2HIX A;  5LMN L;  2EQS A;  4GNX B;  4QJF A;  2I5H A;  1IXR A;  3HY1 A;  3STB D;  4JI8 Q;  4YRJ A;  1Q82 C;  4LF8 Q;  4A3I H;  2MNA A;  2ZJR A;  2N49 A;  3CF5 A;  2F3I A;  4NB3 A;  4CH5 A;  3ER0 A;  3I55 A;  4ME3 A;  3U58 A;  4X5O A;  4R4O A;  5JJK A;  1QUQ A;  2MO0 A;  4Q15 A;  2HIV A;  2YTV A;  2IX1 A;  3TRZ A;  4A3J H;  2ZZE A;  4BA1 I;  2GVA A;  1GD7 A;  5M5X H;  3HOU H;  1A62 A;  1D7Q A;  2ARU A;  4DR4 L;  1L1O B;  4XTC S;  5C3E H;  3HTZ A;  3ZJY C;  4HIO A;  2AMC A;  1X2H A;  5AJ3 Q;  4QIW E;  4KQE A;  4HJA A;  4A3B H;  3S1M H;  5C44 G;  2E3C A;  3K80 C;  2ALY B;  3ICE A;  4KI0 A;  5IYB G;  3CCS A;  1NBW A;  4HWS A;  4P72 C;  1IBL L;  3TEH A;  4K0K L;  5IP7 G;  4O0A A;  4JOI A;  5C4X H;  4TVW A;  1VQ5 A;  4YDQ A;  4DV1 L;  1N8R C;  1XNQ Q;  3KFU A;  5K36 G;  2I5M X;  4HJ9 A;  4JG2 A;  1B70 A;  3HOZ H;  4PG3 A;  3KF8 B;  2OTL A;  3PF4 A;  3RN2 A;  1SFO H;  1CKN A;  4BBR H;  2LXK A;  1X3E A;  3BFM A;  3GTJ H;  4JV5 L;  5IYC G;  2DGY A;  4HID A;  4MZ9 A;  4LF5 L;  5JJI A;  1E3P A;  3ICA A;  2CIM A;  1WI5 A;  3UDG A;  4A3C G;  3L0O A;  1G51 A;  1I6H H;  2P0L A;  4OWW B;  1EVK A;  3F2D A;  1YJ9 A;  3PF5 A;  1Z9F A;  3QO5 A;  5K1X A;  2E41 A;  2P5I A;  4YRS A;  5LMU L;  1AE2 A;  4EO4 A;  2IX0 A;  1YZ6 A;  3G48 A;  2G4C A;  4DV7 Q;  3H3V I;  4HWO A;  3NET A;  2NVX H;  1N34 L;  3UDX A;  4A3K H;  4OX9 L;  1NYQ A;  1JE5 A;  1VS0 A;  3LGJ A;  4DV6 Q;  2DVE A;  4LFC L;  3K8A A;  3HRI A;  4DAM A;  4A3B G;  4H2Y A;  2EWN A;  1XMO L;  2Q2U A;  4YWL A;  1Q1E A;  1A8V A;  3A5U A;  1FL0 A;  3PGZ A;  4OO1 G;  4IOC A;  2A1A A;  2DU7 A;  3KJO A;  4GN5 A;  4H2V A;  1JJC B;  3RLN A;  1N33 L;  2ZXF A;  3LSS A;  4O2D A;  3GDE A;  4DK3 C;  1V9P A;  5AJ3 L;  1E1O A;  1H95 A;  2CQO A;  3IAL A;  3G6E A;  4DR5 Q;  2VQF Q;  4JBM A;  2BH2 A;  4XTY A;  1ADJ A;  4P74 A;  5GAE C;  1IBL Q;  3CMQ A;  4RDX A;  4DV1 Q;  2IY5 A;  4A3I G;  1HZB A;  4A3L H;  1VQF A;  2QHV A;  1SRO A;  1NMG A;  1SE8 A;  1VQ8 A;  5FJ8 G;  4DUZ Q;  4H2S A;  2Y0S E;  4HIK A;  1WFQ A;  4XTW A;  1QF6 A;  2UUC L;  2DTO A;  3BJU A;  4A76 A;  4DR6 L;  2ZTD A;  1H4T A;  4H2X B;  4AYB E;  1U5K A;  2WP8 J;  1SES A;  2ES2 A;  2N78 A;  4LF4 L;  4LFB L;  4BXX G;  3PV0 A;  4POG A;  4B3T L;  4DV0 L;  4P72 A;  5FJ8 H;  5JJL A;  3TUP A;  4DAY B;  3T1H L;  1K9M C;  1SRY A;  3UFG A;  5LMN W;  4DK6 C;  2JEB I;  5JEA G;  1EOV A;  1EYG A;  4DV4 L;  3HKZ G;  3P8V A;  4LF8 L;  3WWV A;  4XU3 A;  1OXV A;  1HXD A;  2CFM A;  1Y1V H;  1HNX L;  1I3Q H;  1PH4 A;  4P3O A;  4JBW A;  4GOP C;  2VY3 A;  4P75 A;  4LUO A;  2K50 A;  1EIY A;  1JJG A;  1HTT A;  4CS3 A;  1WYD A;  2NZO A;  2CKZ B;  4R1J A;  2YTY A;  3F1Z A;  3TS2 A;  1JMC A;  2E2H H;  4RQE A;  5IYB H;  2ART A;  2PQA B;  4HIM A;  2DQ3 A;  1I5F A;  5M3F H;  2K14 A;  1CKO A;  4A75 A;  4YRC A;  3KDF B;  2ZGW A;  3ULL A;  4JYA Q;  1TWG H;  4L5S A;  1PYB A;  2PMZ E;  2VS1 A;  5GRO A;  4Q6G A;  1OXT A;  5EAY A;  1IBM Q;  3W3S A;  3CCE A;  1XMQ Q;  1K83 H;  3A74 A;  1MJE A;  5IYC H;  2RHS A;  2ZZF A;  2DXT A;  2ZJQ A;  1HJP A;  2Q2T A;  2JA5 G;  4XTX A;  2C7I A;  1G29 1;  1VQH A;  2Q2H A;  1E24 A;  1VQO A;  1YGB A;  5M3F G;  4DV2 L;  3HOX H;  2KBN A;  1I50 H;  2YYZ A;  2UXC Q;  1QVG A;  5H1S E;  1S40 A;  4AIM A;  4X64 L;  3E9I A;  4IPD A;  1ADY A;  2QGQ A;  2IT1 A;  4TVY A;  3NEM A;  4BBS G;  4LW1 A;  1X9N A;  3LSQ A;  4H2U A;  2FXQ A;  3OW2 A;  2WB1 E;  4JI2 L;  3BU2 A;  4JI1 L;  5C3E G;  1KMM A;  3SGI A;  4H2T A;  2C35 B;  4G85 A;  2KCM A;  2E10 A;  2ZTC A;  2DU5 A;  3S2D H;  3U50 C;  1C7Y A;  4PZ8 A;  5BR8 L;  1HNW L;  11AS A;  2CGH A;  4XEO A;  4E51 A;  1CSQ A;  1PVO A;  3RAC A;  4B3M L;  1V1Q A;  1ATI A;  1VQ9 A;  3UDF A;  3KOJ A;  1VQG A;  5DLQ E;  3HOV G;  1K0R A;  2VNU D;  1VQB A;  4LF5 Q;  4GKK Q;  4CS4 A;  2ZT5 A;  2J3L A;  1HZ9 A;  1IBM L;  4LFA L;  3M7N A;  1YJW A;  2DDZ A;  4AYB G;  4IOA A;  1YFT A;  4IPG A;  2JA6 G;  3A0J A;  4KHP Q;  1BBU A;  4A3G G;  4LF6 Q;  4BWA A;  1CUK A;  2OQK A;  4ALP A;  3RZD H;  1N36 Q;  1PYS A;  1VQC A;  4OP0 A;  1X01 A;  2JA7 G;  1HC7 A;  2IHE A;  3JAM i;  1Q8K A;  5M5W H;  2JA8 G;  4BBS H;  4OX9 Q;  3RN5 A;  2GVB A;  2E5L L;  3J7A 5;  2PMF A;  2DTI A;  4TQD A;  4DV6 L;  5GAH C;  4DR3 L;  4YRM A;  2AWO A;  4LFC Q;  2B29 A;  1I94 Q;  4JI2 Q;  2UXC L;  2MO1 A;  4R4T A;  3HXU A;  1GM5 A;  2DZC A;  5C0X J;  3KYH C;  4A3C H;  1FVI A;  4DUY L;  3UGT A;  3TS0 A;  4B3T Q;  4NXM L;  1RIQ A;  3RKY A;  3UE0 A;  3V7R A;  2B63 H;  3PZC A;  3EIV A;  2I0Q A;  1K8A C;  3CCU A;  4YY3 Q;  1TXY A;  2ZZG A;  4JI1 Q;  3HOV H;  1YHQ A;  4HWT A;  1NNH A;  3S1N H;  1YB3 A;  1HR0 L;  3PUY A;  1K3R A;  4DR5 L;  1PH1 A;  3IKL A;  3MEF A;  4X6A H;  3QO7 A;  2NN6 I;  3RGL A;  4A3K G;  3J81 i;  4BW9 A;  1X2G A;  4L5Q A;  1L2F A;  2DJZ A;  1VQE A;  4QY7 A;  3STB C;  5C4X G;  3T1Y L;  1XNR Q;  3U4Z A;  1JT8 A;  4MNO A;  3RR5 A;  2ARS A;  3K7A H;  3PUV A;  4BA2 I;  1PV4 A;  2JA6 H;  4GOP B;  3L1A A;  1H4S A;  2VZA A;  3I4N H;  4C3J H;  3V7C A;  4H2W A;  3W5O A;  4GKK L;  4X66 L;  2HT1 A;  4TVA A;  1J5E L;  3PUX A;  5E7N A;  1OXS C;  2CJ9 A;  4EQ5 A;  4TQF A;  4A93 H;  4IO9 A;  4GN4 B;  2K5H A;  1L0W A;  4RG1 A;  1SMX A;  1TWF H;  1KRT A;  1Y14 B;  4K86 A;  1EQQ A;  1YBY A;  2NVY H;  3HKS A;  1U0L A;  3FKI H;  3HFV A;  1WU7 A;  1FJG L;  2MFI A;  4GKJ L;  1XMQ L;  4DR3 Q;  4YCU A;  5JEA J;  3M4Q A;  2EJ9 A;  2Q7H A;  4DV3 Q;  2HHH L;  4A3L G;  5KNN A;  1GO3 E;  2ODR D;  1MIU A;  4JI5 Q;  4DV2 Q;  5IT9 c;  2D0P A;  3M9B A;  2NVQ H;  3JAM c;  3OTO L;  3MF2 A;  1IZ6 A;  2IHF A;  2EJF A;  3VQX A;  4EX5 A;  3PIO A;  2ZNJ A;  1EQR A;  1A0I A;  4LUZ A;  2RHQ A;  1BIA A;  3FKI G;  3K81 C;  3RLF A;  3A5Z A;  1Y1W G;  4A3F G;  3CCJ A;  1PHJ A;  4XU2 A;  3F2B A;  4YYE A;  2KHI A;  4C3I H;  3CD6 A;  1S72 A;  2E5A A;  2E65 A;  1Q86 C;  2I5L X;  2K4K A;  4LF7 L;  2N8N A;  4J15 A;  1NMF A;  4OON A;  3D0F A;  1XNQ L;  3HKZ E;  3FHW A;  3G4S A;  3GTP H;  1W3S A;  2JK8 A;  5ELO A;  2LSS A;  4JC0 A;  4QQB X;  1Q7Y C;  2UUA Q;  2CWP A;  1IL2 A;  4IFD G;  1YJN A;  2UXD L;  1SET A;  3TEG A;  1Y1V G;  5IP9 G;  3F8T A;  3NEL A;  3PCO B;  3KLW A;  2KCT A;  1X56 A;  1PA6 A;  1TWC H;  2B3G A;  4GNX C;  1FYF A;  4LWC A;  2RHQ B;  4LUV A;  1HH2 P;  4PZ6 A;  1X65 A;  4IJL A;  5C44 H;  1E22 A;  4JYA L;  2JA5 H;  1M90 C;  1YVC A;  2E64 A;  2QA4 A;  5IYD H;  4DR7 Q;  3GTL H;  1WJJ A;  3RL6 A;  3CPF A;  4WI1 A;  2I4L A;  4LFA Q;  3OD1 A;  1LYL A;  2JJQ A;  3F2C A;  4P71 A;  1HR0 W;  1HNZ Q;  3IKM B;  1H4Q A;  1N32 L;  3B6Y A;  2NVT H;  3M4O H;  2ZCE A;  1GKH A;  1VQ7 A;  3KJP A;  5FLX c;  4R4Q A;  2PI2 E;  4HJ8 A;  4UP7 A;  3R07 A;  4GKJ Q;  1O7I A;  1UE7 A;  4TVA B;  3S2H H;  2CJB A;  4YRT A;  1NE3 A;  2FYK A;  3RIR A;  4DQ2 A;  3L4G B;  1VQJ A;  4GOP A;  1SLJ A;  1XTD A;  1WOC A;  2L15 A;  1CKN B;  2I4O A;  1Q12 A;  2Z0S A;  5IWA L;  4DUY Q;  4JI7 Q;  1OTC A;  4WJ4 A;  1G6P A;  2WB1 G;  4RQF A;  4WF2 A;  2R7Z H;  4DKA C;  4IFD J;  3TQY A;  3TEH B;  4A93 G;  4FDB A;  1J5W A;  5C4J H;  2R92 H;  3K0X A;  2RF4 A;  4BY7 G;  1EIY B;  2R6G A;  1W2B A;  2A19 A;  3I4M H;  4IPC A;  4YRI A;  4L5R C;  4JI4 Q;  3CCM A;  5J3B A;  4YRN A;  2VL6 A;  1NJ6 A;  3L4G A;  4UP8 A;  4P3P A;  2YU9 H;  2UUA L;  4LF9 L;  1NJ8 A;  2QHS A;  3Q8D A;  3L7Z C;  2VUM H;  3T1Y Q;  2GN5 A;  5C0X G;  1UWV A;  2VW9 A;  2QHT A;  1X55 A;  4QGU A;  1N32 Q;  2DXU A;  4DV0 Q;  1K73 C;  2A8V A;  2UUB Q;  2H5X A;  4QL5 A;  3HOY H;  4DR7 L;  1PFS A;  1R9T H;  1KAW A;  1PYS B;  2ZT8 A;  1UE5 A;  1TWH H;  5FLM G;  4DR4 Q;  4A3E G;  1KD1 C;  3LC0 A;  1KMN A; 
#chains in the Genus database with same CATH topology
 3CC7 A;  3I3C A;  3AQQ A;  3I4N B;  4RMF A;  1S5F D;  1A6X A;  5CC4 A;  1XWE A;  4PHC A;  1WTR A;  1YI2 A;  1EWI A;  1EL0 A;  1W6J A;  3BDL A;  3S16 H;  3D8G A;  3SEB A;  3C3L A;  4YWM A;  3TSS A;  4X3U A;  1DXM A;  2A5H A;  2OWO A;  3K7U C;  1EYC A;  1ZYR C;  4YRR A;  3UE1 A;  2CW0 D;  4NXM Q;  3HOY G;  3PCO A;  3CQZ B;  4PNY A;  3HOX B;  4XTU A;  2JA8 H;  3UGQ A;  5HGQ A;  2F03 A;  1LT4 D;  1SYB A;  4JI7 L;  4CDF C;  2JP1 A;  2Q5H A;  4P74 C;  3VR6 A;  2Y0S G;  2NN6 H;  4KN4 C;  1B1Z A;  4FNF A;  1V8Q A;  2F0G A;  2PNH A;  4TSS A;  3R8B A;  2F0F A;  1D8L A;  2WII B;  1N33 Q;  1YNX A;  2R92 G;  4A3F H;  4KY5 A;  1SYG A;  4I65 A;  1K0S A;  4IUN A;  4B3R Q;  2AQ1 B;  4X62 Q;  3A8I E;  1A3U A;  4JV5 Q;  1LTA D;  1JOK A;  2O5I C;  4A3D H;  4HWR A;  4IJH A;  4GLX A;  4NXN L;  4GS3 A;  1JJC A;  4K2L A;  4C2M H;  2ICE C;  1E1T A;  5D65 A;  3I4O A;  1PH7 A;  1G5H A;  2ZIO A;  2OF1 A;  3EJI A;  3I4L A;  4CDE C;  4X65 L;  3A7L A;  3S1Q B;  5C3E B;  3I4N G;  2J0T D;  2B63 G;  3NEN A;  2CHB D;  3OIQ A;  3DM3 A;  1TKW B;  1JJ2 A;  3A5Z B;  1Y8O B;  4LNS A;  3J7A F;  1BIB A;  3V8L A;  4XEM A;  4XIG S;  1SEB D;  3LX0 A;  3H91 A;  5IP9 H;  2ZXP A;  2ZT7 A;  4IUP A;  5COR A;  1E7Z A;  4G7Z C;  3ERO A;  2JSO A;  1IHZ A;  4JCV E;  4A3D G;  4RCN A;  3QR8 A;  1YEZ A;  1B2T A;  4H44 C;  3L2P A;  2A6H D;  2Q7G A;  3QTC A;  3IRB A;  1KNA A;  1J5E Q;  4G84 A;  3RD4 A;  2ZR3 A;  1KDC A;  2EL9 A;  3VBB A;  3CCR A;  4B9X A;  4DR1 Q;  5IT9 L;  4MTN A;  2F3W A;  1AH9 A;  1DD2 A;  3PIP 3;  3HOU G;  1EEI D;  2MGS A;  2Q8T A;  3NTI A;  1AEX A;  2J4X A;  2ZIN A;  1CI3 M;  5GAG C;  1BUV T;  4JW0 A;  1PH9 A;  2XTI A;  3BVM A;  2D62 A;  4YWK A;  5IYD G;  1C0A A;  3ERQ A;  2ENB A;  2R7D A;  3GTJ B;  4LVI A;  4KHZ A;  1CA6 A;  2QHU A;  2E1H A;  2O5J C;  1EFW A;  3J7A V;  4ZQ3 A;  3HP3 A;  2QEX A;  3FP9 A;  1VQD A;  3VQV A;  1DGS A;  1FJG Q;  3HXZ A;  1NR2 A;  2BA0 A;  2TSS A;  5CV5 A;  3T1H Q;  3FJP A;  3W1B A;  3HRK A;  3VDY A;  1S3O A;  1ROD A;  4ME5 A;  5JVH 3;  3RF1 A;  2OTJ A;  3HOW G;  1VMP A;  2WFW A;  2BH8 A;  3GTG H;  4QF4 A;  1NAP A;  2UUB L;  1YHB A;  2RHS B;  3W1G A;  4DV7 L;  4MTK A;  1GUG A;  4KR3 A;  4TTV A;  3BS1 A;  3EQL C;  5C44 B;  2JEA I;  4JI5 L;  3GD7 A;  1M8A A;  3J81 c;  2EXD A;  3I2Z A;  5KEE A;  4DPG A;  1QZH A;  1KNE A;  3FDT A;  4A3M H;  4H02 A;  4BY1 G;  2ODR C;  1CSP A;  4MIU A;  4YRE A;  5E3I A;  4O1N A;  1OO9 B;  2F0D A;  3TDQ A;  3WQZ A;  2F0H A;  2N3S A;  3HOW B;  3GTQ H;  2WAC A;  3HEJ A;  3PO2 H;  1CKM A;  1IYJ B;  3A5Y A;  2QCP X;  3V7S A;  1L1O C;  1JQY D;  3D6C A;  3KF8 A;  1BDO A;  3KBX A;  2PQA A;  2A6E D;  1STY A;  1WTX A;  3NTH A;  4F88 A;  2K5N A;  4UAI A;  5ISR A;  1STB A;  5M5Y B;  1HRJ A;  1VQN A;  3Q23 A;  1NYR A;  3E0J A;  1QNU A;  3WDN A;  4IFD H;  5M3M H;  4PQX A;  3MHB A;  2JN4 A;  3D4D A;  3KUP A;  5JPN C;  4LNQ A;  1IKM A;  2ZIM A;  4LVM A;  5HGT A;  3KF6 A;  2KQ3 A;  4L6T B;  4LMQ D;  1LTL A;  4BY1 H;  2ALY A;  3L2Z A;  1FGB D;  2EYM A;  4KV6 A;  4C3I B;  3P8Y A;  1GXD C;  2R7Z G;  3A7A A;  4X3T A;  1B8A A;  4DK1 A;  5F5W A;  1PRT D;  3ULP A;  2PME A;  3I7F A;  3L3O C;  5C0X I;  3RNU A;  2KUM A;  1DCZ A;  1HQM C;  4P73 A;  3A31 A;  4UP9 A;  4CH4 A;  1MI2 A;  4NW2 A;  5IY0 A;  5FKA C;  5J1Z A;  1XPU A;  4LF6 L;  3UH0 A;  1LT5 D;  3OPO A;  4A3M B;  3NWS A;  4BBR B;  1H9S B;  1FD7 D;  1KAA A;  3J80 E;  1M4V A;  4ZIB A;  3JC6 6;  4KK7 A;  3U4V A;  2F52 A;  2NWG A;  4XU0 A;  1EZ8 A;  3ULJ A;  4YHH Q;  4DUZ L;  2XGT A;  4YIJ A;  2ZXO A;  4DR2 L;  4R4C A;  4K88 A;  1WTW A;  1B50 A;  4DAY A;  3TRE A;  3GTO B;  1BCP C;  3MVV A;  3R2T A;  3M3Y H;  3ITP A;  3FMC A;  1KLG D;  2F0K A;  1F9Q A;  2FJ2 A;  3MXG A;  1WCM H;  4RH6 A;  4ZAI A;  1Y8N B;  3DWP A;  3E9H A;  4Q0F A;  1ILP A;  1I4R A;  2OQ0 A;  1O7Y A;  3QOL A;  2R93 G;  1AP0 A;  2SOB A;  3CC2 A;  2Q5I A;  3REX A;  4IUR A;  1K8G A;  5C53 B;  1CQF A;  5EKK A;  1D5X C;  1SDF A;  4L63 B;  4LF4 Q;  4YRK A;  1SER A;  2FMM A;  3CPW A;  1K8M A;  1Q90 A;  2IX3 A;  4LFB Q;  2EY2 A;  4K8J A;  2ID0 A;  4YRG A;  3HXW A;  4GNX A;  2XWB B;  4XU1 A;  1EQT A;  4H2X A;  1EY0 A;  2ZTE A;  2K33 A;  4AQY Q;  3GTM H;  1KTK A;  2BCO A;  3MQZ A;  1YFS A;  4YPF A;  2RCN A;  2NYZ D;  1Z7M A;  1AW7 A;  2WB1 B;  1UEB A;  2ZR2 A;  1BO0 A;  4NPS A;  2WV6 D;  3TP7 A;  4DV5 Q;  4K87 A;  3HFZ A;  2BE5 C;  1PDQ A;  1X3G A;  2G5D A;  4PZ7 A;  2R7F A;  4QUC A;  3HOZ B;  1HFG A;  5IWA Q;  1TU2 B;  2NUC A;  5FLM H;  3PO2 G;  2EIF A;  4CH6 A;  4TWA A;  4YY3 L;  4OWT B;  1MKH A;  1SNM A;  2DNE A;  3GP7 A;  3OWF A;  1W66 A;  1XTC D;  3QJY A;  2LFN A;  4RA8 A;  1RD9 D;  1JOO A;  2C5C A;  2F1M A;  4EGV A;  2ZNI A;  2F4V L;  2CWA A;  2K5Q A;  1AE3 A;  2MPM A;  2V1C C;  4L87 A;  4J1M A;  2EAY A;  1VQP A;  1KRS A;  3S24 A;  3MTS A;  3CW2 C;  1Y1W H;  4L5T A;  2JA9 A;  4C3H H;  3VQY A;  2M00 A;  1KXL A;  5J39 A;  1N9W A;  4HED A;  4A3D B;  4A3G B;  4KD3 A;  5G3L F;  1PTO F;  3DHQ A;  4ZYS A;  2BDN A;  2K75 A;  1HZC A;  3S17 H;  3QO8 A;  3JAM L;  4XTZ A;  2X6L A;  3DEO A;  4JI0 Q;  4JI6 L;  1STE A;  1H9R A;  5BR8 Q;  2ZM6 Q;  1JIC A;  1LV9 A;  2AWN A;  2X69 A;  2VB2 X;  1Z7T A;  3I4M G;  1C9O A;  1XPO A;  3S1Q H;  2L5T A;  1V1O A;  4LJZ C;  5COY A;  4LF9 Q;  4DXF A;  4M1U B;  1EWH A;  4YRQ A;  1H9M A;  4HR7 B;  2YTX A;  3HS0 C;  3I90 A;  1K8O A;  4CKB A;  4HJ7 A;  2JE6 I;  1C48 A;  4CDC C;  3RZO B;  1CK1 A;  5D3I B;  3VR5 A;  4B3R L;  5K1P A;  4K14 A;  2UXB L;  3J7Z C;  5KIX A;  1JOR A;  1F2L A;  3FPU B;  2VUM G;  1IW7 C;  1EY8 A;  2MP1 A;  3PO3 G;  3EFS A;  3HXY A;  4C3H G;  4DF7 A;  4JI4 L;  4IPH A;  3H3V H;  1WTV A;  3IG2 A;  1USY A;  3A7U A;  1BNZ A;  3C2P A;  2NVY B;  1HHV A;  1YNN D;  1SJH D;  1LT3 D;  4OLF A;  4CS2 A;  1WCM G;  3SVM A;  2QDB A;  3U9S A;  3MF1 A;  2LS0 1;  4HTH A;  4DN4 M;  1A3V A;  3CC4 A;  1HZA A;  3ERR A;  3A7R A;  4V19 0;  2F0S A;  3T16 A;  1RCV D;  3VR2 A;  1YNJ C;  3TZU A;  2PW5 A;  5EGT A;  1F2Y A;  3PUZ A;  1LAC A;  1NSN S;  4DR6 Q;  1H4V B;  1EIF A;  4OIK A;  1WLE A;  4R8N A;  2D5D A;  5M5X B;  3NHH A;  3BZC A;  4EQO A;  2ASB A;  1IBK Q;  1N36 L;  4CH3 A;  3P8T A;  4C3J G;  3D31 A;  3CP0 A;  1PH2 A;  3HXV A;  2KEN A;  1RIP A;  3K5O A;  3G71 A;  3S2D B;  3MXN A;  4RGO S;  1A63 A;  5C52 B;  1UE6 A;  1B9M A;  1GUN A;  1HNW Q;  3RZO H;  3KLS X;  4CBV A;  2OCE A;  1NJ2 A;  1HA5 A;  1GVP A;  2EYJ A;  3D6W A;  5GAD C;  1ICF B;  5M3M G;  3W2D A;  1RJT A;  2EE1 A;  3S14 H;  2WAQ G;  2QKI C;  1T9H A;  1JOQ A;  2B39 A;  1V1P A;  1H9J A;  2ZJP A;  3HOW H;  2HQL A;  3EN2 A;  1QWY A;  3IFT A;  5C4X B;  4ZK9 B;  2F0P A;  1WQW A;  4NCX A;  4DV4 Q;  2PYK A;  2E76 C;  1QVC A;  4B3S L;  3DEP A;  1X3F A;  1I94 L;  2DZ9 A;  3KDF A;  4BBR G;  1TR5 A;  1B7Y B;  5LL6 X;  1P8L A;  1UE1 A;  2K04 A;  3K5M A;  4YCW A;  2DQ0 A;  5HY6 A;  5FO7 B;  4P73 C;  2K5V A;  1WTQ A;  3K7A B;  1WNL A;  1HR0 Q;  1VQ6 A;  3I56 A;  2IPK D;  3CCQ A;  3NXW A;  4HSV A;  2F0E A;  4C3J B;  1XXG A;  3CCL A;  4X65 Q;  3RKW A;  5EKL A;  2C8M A;  1Z7N A;  1J6Q A;  4WJW A;  1SRU A;  1VQI A;  3I72 A;  1USY C;  4B3M Q;  3NBH B;  4XYO A;  5CV9 A;  1MSG A;  1WD1 A;  1C4Q A;  1NJ5 A;  3AFQ A;  4ZTZ B;  4RHS A;  5AFW A;  4X62 L;  4ZTU B;  2MHV A;  4FXG C;  1OXX K;  2RDG A;  2PZT A;  1KOG A;  4GLA C;  1JWS D;  3M4Y A;  2EPB A;  2UU9 Q;  4OO1 I;  3HOX G;  3A54 A;  2HCC A;  4POF A;  3M4P A;  4HCE A;  3E6Z X;  1TY2 A;  2RBM A;  1L1O A;  3CME A;  2Q2I A;  2ZM6 L;  3S15 B;  3A32 A;  2E75 C;  4R4I A;  4V0B A;  5LMN Q;  5FO8 B;  1I4P A;  1EVL A;  4RCO A;  3J7Y W;  2RKS A;  3HXX A;  1V43 A;  4PMC A;  4AH6 A;  3GTO H;  3HFZ B;  4TQU S;  2SNS A;  3ND8 A;  1TS4 A;  4BBS B;  3DXJ C;  2EJG A;  4QUF A;  4N8X 1;  4JI3 L;  1X32 A;  4OL7 A;  5FK9 C;  1QZG A;  4KHP L;  1TWA H;  3K59 A;  1SR3 A;  4DK0 A;  4OXP A;  2KHS A;  1PH6 A;  1JE4 A;  2BA1 A;  2PPB C;  2AHO B;  1NJ1 A;  2R92 B;  5LMU Q;  1G5I A;  1Y1V B;  1EUJ A;  2D0O A;  3G1Z A;  4P71 C;  5KYL A;  4DR1 L;  3HG9 A;  5C5L A;  4X66 Q;  5ELE A;  1S5B D;  4IUU A;  2AKW A;  1YHA A;  2KHJ A;  4DV3 L;  1STN A;  2AKW B;  2DUD A;  4YHH L;  4HA8 A;  5E3F A;  3EVQ A;  1YIT A;  4JOI C;  2HNI A;  2P5Z X;  4RAU C;  1PZJ D;  5IE8 A;  1ASY A;  1SNO A;  2F0T A;  4CHT B;  3E3X A;  1B44 D;  3AEV A;  2E5L Q;  1N34 Q;  1KL9 A;  3OYY A;  3J80 i;  3H94 A;  3HGB A;  2F0M A;  4FYD A;  2R93 H;  4X64 Q;  4A3J G;  1PH3 A;  2YV5 A;  1G2T A;  4YRP A;  1CFM A;  1BKB A;  1X3Q A;  2EJM A;  5A2Q E;  3REU A;  4HVC A;  2F0J A;  3OIP A;  2B2Y C;  2ATW A;  1I4X A;  2PCF B;  4P75 C;  2DEQ A;  2I4M A;  1ENA A;  3S15 H;  3E5S A;  3QWN A;  4B3S Q;  1H9S A;  4WJ3 M;  4ZUJ A;  1JCK B;  5GQO A;  3DLL A;  1NCV A;  2K28 A;  1XMO Q;  4A4I A;  2IY5 B;  4GLV B;  3K5N A;  4HCS A;  3CAM A;  5CMD A;  4DNI A;  1X6O A;  1TWG B;  2NZ1 D;  4OIJ A;  2F3V A;  2DNC A;  3GV3 A;  1QNK A;  1WCM B;  1DZ1 A;  3OTO Q;  4IFD I;  4UY8 C;  4BY7 B;  2DTH A;  1BF4 A;  1RKN A;  4IAL A;  2NB0 A;  3KF6 B;  1I6H B;  2MQH A;  4XQQ A;  4HJ5 A;  3CXC A;  1XNR L;  3H0G G;  1LO5 D;  3MEY A;  1VQK A;  1NTG A;  1EY4 A;  2NN6 G;  1B3Q A;  2KA7 A;  4HMJ A;  1KLU D;  3UDI A;  1FNW A;  2Z6K C;  2CJA A;  3GTL B;  4FVM A;  1ENC A;  2UXD Q;  5IOC A;  1TT2 A;  3BG3 A;  3PSI A;  3KK7 A;  5C4Z A;  1SMY D;  2ZTG A;  1I4Q A;  4LVJ A;  4Y7N H;  3I91 A;  3QB3 A;  4APV A;  3A8J E;  5KYI A;  4DR2 Q;  1B7Y A;  4IUQ A;  4UPA A;  4XTV A;  2XIW A;  1AZP A;  1RL2 A;  1UEA B;  1NY4 A;  2G9H D;  1TS5 A;  1PH8 A;  2JA8 B;  4ZCK A;  1XJV A;  5DNF A;  5M5Y H;  3HY0 A;  1Q1B A;  2L12 A;  4CKE A;  1V1P B;  3V8K A;  5M3M B;  1VDZ A;  2PI2 A;  3WOF A;  2UU9 L;  2VQF L;  3EFR A;  3AYH B;  2EDG A;  4JI8 L;  4P2C B;  2M2L A;  2XRQ D;  2VXW A;  1Q8I A;  1SN8 A;  3MXN B;  2E2J H;  3IKJ A;  3S1R H;  1O7Z A;  2H4O A;  4BY7 H;  1II3 A;  3AFP A;  3HOZ G;  3RUX A;  3PUW A;  1J8I A;  1M1K C;  4AQY L;  2VQE L;  3N52 A;  4A3E B;  1KHI A;  3NSW A;  4DU9 A;  1KQS A;  2WAQ E;  2KOL A;  4I7Z C;  4LVL A;  1Y69 U;  4JI3 Q;  1FGU A;  4TKO B;  4KHV A;  1YIJ A;  5IGB A;  2E8G A;  4GN3 B;  2Q8R E;  2DKG A;  3PIP A;  1U4R A;  4PMW A;  4HAE A;  2EY5 A;  4Y52 H;  3IAY A;  4UDU C;  4FP5 D;  4BXX H;  2HHH Q;  5ELN A;  2F0N A;  4YRL A;  4TRD A;  5ELC A;  3J81 j;  2E2I H;  2ZT6 A;  1F2M A;  1VQZ A;  2JQO A;  2CCZ A;  2CH4 W;  3MZ5 A;  2I4N A;  4JPB W;  3GO5 A;  1CZW A;  3LWU A;  2R7Z B;  4YRO A;  3VQW A;  3HRZ C;  1QB5 D;  2DJG C;  5EQ0 A;  5IT9 E;  1KAB A;  2NTS A;  2B2V C;  1LM0 A;  2Q7E A;  1CM9 A;  3CQZ H;  12AS A;  3N6R A;  1Q46 A;  1HNX Q;  3GQB A;  1ASZ A;  4LF7 Q;  1X54 A;  1Q81 C;  4G7O C;  1B76 A;  4P3N A;  1LTB D;  3E0E A;  3G7L A;  4DV5 L;  1VQ4 A;  1MJC A;  4KR2 A;  1XPR A;  3A8K E;  1IBK L;  3RLO A;  4XXE A;  1GGM A;  1QG7 A;  4KLK A;  1A3T A;  3J80 c;  4PV1 C;  3GTK H;  1NJI C;  4OWX B;  1KIX A;  3CMA A;  2GA4 B;  3CCV A;  4A3M G;  4DFA A;  3H0G H;  1B70 B;  5JPM C;  2LMC B;  2F4V Q;  3AU7 A;  1HUM A;  4YCV A;  4U67 3;  1WD0 A;  1PH5 A;  4NXN Q;  5DAU A;  4A3E H;  2Z6K A;  1MGS A;  4G4K A;  1P16 A;  3V8J A;  2NVQ B;  1TWC B;  5I2Y A;  1Z47 A;  2J3M A;  5ELB A;  1JWU D;  1SYE A;  1VQL A;  4JBJ A;  4K0K Q;  1KC8 C;  4XQJ A;  4JI0 L;  2EVB A;  4JI6 Q;  5IP7 H;  4Z9C B;  3OOC A;  3DSQ A;  3PO3 H;  5C5M A;  2AMC B;  3OW7 A;  4KN7 C;  4IZ8 A;  1SND A;  1OXU A;  3EBE A;  2UUC Q;  1Y1W B;  1HCZ A;  3BZK A;  5E1F A;  1L0Y B;  3RKX A;  1QE0 A;  4KY7 A;  1VQM A;  4JBK A;  2LXJ A;  5KGU A;  4OO1 H;  4X3S A;  3PO2 B;  4A3G H;  3M85 A;  2K52 A;  3BZD B;  5FO9 B;  4NP5 A;  4KKU A;  1BBW A;  4A3J B;  1QVF A;  1PTO D;  1VQA A;  2UXB Q;  4OEL B;  1WPY A;  2V4D A;  2HQE A;  1VCI A;  3ERS X;  1EZ6 A;  3H15 A;  1SE4 A;  1LUZ A;  3MAQ A;  3QNE A;  1QUQ B;  1HNZ L;  1BVS A;  2FFK B;  1JB7 A;  5C51 B;  4HWP A;  2JA7 H;  3KBG A;  3ONA B;  2F0W A;  2ZXR A;  2VQE Q;  2BOS A;  3AMU A;  1B53 A;  4ZRZ A;  2NZH A;  1FR3 A;  3K58 A;  1WQ7 A;  1YFR A;  2KED A;  4YRF A;  4YP0 A;  4K6D A;  5KND A;  2HIX A;  5LMN L;  2EQS A;  4GNX B;  2N88 A;  4BY1 B;  3MC0 B;  4QJF A;  2I5H A;  1BCP D;  1IXR A;  3HY1 A;  3STB D;  4JI8 Q;  4YRJ A;  2SNM A;  4IQZ A;  1Q82 C;  4LF8 Q;  4A3I H;  3T53 B;  3URY A;  2EY6 A;  5CV8 A;  2K32 A;  2MNA A;  5LL6 S;  2I46 A;  5I6Y A;  5I9O A;  1UUP A;  2ZJR A;  2N49 A;  5C4H A;  1JC7 A;  3LNN A;  3FEW X;  3CF5 A;  3PIO 3;  2F3I A;  4DNR B;  1S5D D;  3A56 A;  3MFG A;  4NB3 A;  2HDL A;  4CH5 A;  3ER0 A;  3I55 A;  4ME3 A;  2KEC A;  3U58 A;  4X5O A;  1E0B A;  2KCN A;  2N55 A;  4X3K A;  5EPJ A;  4R4O A;  5JJK A;  1SNQ A;  2WKC A;  1QUQ A;  2MO0 A;  4Q15 A;  3GTQ B;  4MHE A;  4UHV A;  2HIV A;  1EY7 A;  2YTV A;  2IX1 A;  3TRZ A;  1ENF A;  1S5E D;  4A3J H;  2ZZE A;  4C2M B;  4BA1 I;  2GVA A;  2ZT9 C;  1GD7 A;  5M5X H;  1DYQ A;  3HOU H;  1A62 A;  1D7Q A;  3VYS A;  2ARU A;  4DR4 L;  1JB3 A;  1L1O B;  4XTC S;  5C3E H;  3HTZ A;  2JA7 B;  1B9N A;  3QG1 A;  3ZJY C;  2JA6 B;  5KNB A;  4HIO A;  2AMC A;  4FF4 A;  1X2H A;  5KNC A;  4EQP A;  1K83 B;  2AQ2 B;  5AJ3 Q;  4QIW E;  4KQE A;  4HJA A;  4A3B H;  3S1M H;  5C44 G;  2E3C A;  3K80 C;  3J81 L;  2ALY B;  3ICE A;  4KI0 A;  1IKL A;  5IGE A;  2F4I A;  5IYB G;  3CU7 A;  3S14 B;  3CCS A;  1NBW A;  3Q24 A;  4HWS A;  4RGM A;  4P72 C;  1IBL L;  3TEH A;  1R4Q B;  4K0K L;  5IP7 G;  4O0A A;  4JOI A;  5C4X H;  4TVW A;  1VQ5 A;  4YDQ A;  4DV1 L;  1N8R C;  1XNQ Q;  4BS9 A;  3NQT A;  3KFU A;  4OEM B;  5K36 G;  2ICI A;  2I5M X;  4HJ9 A;  1DM0 B;  4JG2 A;  1B70 A;  3U9O A;  3HOZ H;  3FKI B;  4PG3 A;  3KF8 B;  5EBC A;  1LTG D;  2OTL A;  2E2H B;  1SE3 A;  3HKZ B;  4CJ1 B;  4A3F B;  3PF4 A;  3RN2 A;  1SFO H;  2RQX A;  4XDX A;  1CKN A;  4GZY C;  4BBR H;  2LXK A;  2XNA C;  1SNP A;  1X3E A;  3BFM A;  1RTO A;  3GTJ H;  4JV5 L;  1PXU A;  5I9P A;  4KKS A;  5BN3 A;  3CHB D;  3ND9 A;  5IYC G;  4FF2 A;  3UI2 A;  2XVS A;  4DAV A;  2DGY A;  1HA6 A;  1U4M A;  3NQI A;  4HID A;  4MZ9 A;  3BYY B;  4B08 A;  1QIL A;  4LF5 L;  4K2K A;  4KJO A;  5JJI A;  1E3P A;  3HOY B;  1BCP B;  3ICA A;  1ONL A;  2CIM A;  1F2Z A;  1WI5 A;  3UDG A;  4A3C G;  3L0O A;  1G51 A;  3I8Z A;  1I6H H;  2JYO A;  2P0L A;  3FPP A;  1SXT A;  4OWW B;  1EVK A;  3TP5 A;  2K03 A;  3F2D A;  4RHR A;  3PF5 A;  1YJ9 A;  1Z9F A;  3QO5 A;  3ZYY X;  2A69 C;  1ZYR D;  1SYD A;  1LT6 D;  2E41 A;  2P5I A;  5K1X A;  1RHP A;  4YRS A;  5NUC A;  5LMU L;  1AE2 A;  4EO4 A;  2IX0 A;  3H6M A;  2KEE A;  3LWE A;  1LTR D;  3VR3 A;  2F0V A;  1YZ6 A;  1HUN A;  1RTN A;  5F2D A;  3G48 A;  2G4C A;  3C1F A;  4DV7 Q;  3TP6 A;  4KY6 A;  5CR3 A;  3H3V I;  4HWO A;  2VUM B;  3NET A;  2NVX H;  2IWH A;  1N34 L;  5JVG 3;  3GTP B;  5EJW A;  3UDX A;  1SMY C;  4A3K H;  1TII D;  4OX9 L;  1NYQ A;  1JE5 A;  1EU3 A;  5EKI A;  1TY0 A;  1VS0 A;  1KDA A;  1STG A;  3BVG A;  3LGJ A;  4CDD C;  5D14 A;  4DV6 Q;  2DVE A;  1BCP F;  2QF7 A;  1WVL A;  2KJX A;  1Y8P B;  4LFC L;  3K8A A;  2XRS D;  3HRI A;  4C3H B;  4DAM A;  1QCB D;  4A3B G;  1XYI A;  2SEB D;  4H2Y A;  2EWN A;  4CJ2 C;  1XMO L;  2Q2U A;  1PMR A;  4YWL A;  1Q1E A;  1A8V A;  3A5U A;  4G7H C;  1K3B C;  1FL0 A;  3PGZ A;  4OO1 G;  2AUK A;  4IOC A;  3FRP B;  2A1A A;  3MXU A;  4AYB B;  4FF3 A;  2B8G A;  2DU7 A;  3KJO A;  1LTI D;  4QB4 A;  4GN5 A;  4H2V A;  5DEH A;  1JJC B;  4G57 A;  1J9O A;  3RLN A;  1EQV A;  5IIF A;  1N33 L;  2MJ8 A;  2ZXF A;  2BDO A;  3LSS A;  4O42 A;  1PRT B;  4O2D A;  3GDE A;  4DK3 C;  4KKT A;  1EYA A;  1V9P A;  2CW0 C;  5JJZ A;  3K5L A;  5AJ3 L;  1E1O A;  3NBI A;  2PQE A;  1H95 A;  2CQO A;  3IAL A;  4H7B A;  4QMG A;  1FNV A;  3T56 B;  3G6E A;  1BQQ T;  4DR5 Q;  2VQF Q;  4JBM A;  2BH2 A;  1ADJ A;  1EY5 A;  4XTY A;  3MA2 B;  3J81 E;  4P74 A;  5GAE C;  5C4J B;  1IBL Q;  5I4D A;  1VMC A;  2IJ0 A;  1TWF B;  3M4O B;  2NVT B;  3CMQ A;  4RDX A;  4DV1 Q;  2IY5 A;  4A3I G;  1HZB A;  4HMI A;  4A3L H;  1VQF A;  3P20 A;  4R9W A;  5M9O A;  1SRO A;  3D3R A;  2QHV A;  3M7G A;  4N9P A;  1EIH A;  5FLX L;  1NMG A;  1SE8 A;  5A2Q L;  1VQ8 A;  5FJ8 G;  4DUZ Q;  4H2S A;  1YNJ D;  4FO2 A;  3C46 A;  2Y0S E;  1D6E C;  4HIK A;  1NR4 A;  4LK1 C;  1WFQ A;  4XTW A;  4I7A A;  3S2H B;  1QF6 A;  1T5X D;  4J6H A;  1VF5 C;  2UUC L;  2DTO A;  5JEA H;  4OGQ C;  3K0Y A;  1CHQ D;  3BJU A;  1K28 A;  4A76 A;  4DR6 L;  2ZTD A;  1H4T A;  4H2X B;  3NTK A;  2EJG C;  1XX8 A;  2A73 B;  4WRD A;  4AYB E;  1U5K A;  2WP8 J;  1SES A;  2ES2 A;  1LLR D;  2N78 A;  4LF4 L;  3SXH A;  1E2V A;  3OMC A;  2K5W A;  4HT4 A;  4LFB L;  4BXX G;  1F9S A;  3PV0 A;  4B9W A;  4POG A;  4B3T L;  2B2U C;  2LY7 A;  1GHK A;  4DV0 L;  4P72 A;  5FJ8 H;  1UNS A;  2L9H A;  4WOR A;  2E2J B;  5JJL A;  3TUP A;  3F2U A;  2RCF A;  4DAY B;  1GOZ A;  3T1H L;  1PFM A;  1FYC A;  1K9M C;  1SRY A;  3UFG A;  5LMN W;  2J7Z A;  4DK6 C;  2JEB I;  5JEA G;  1EOV A;  1EYG A;  4C1N I;  4DV4 L;  1GUS A;  3HKZ G;  4FXK C;  4IUV A;  1TWH B;  3P8V A;  4LF8 L;  2NTT A;  3WWV A;  3NWT A;  3R2I A;  3H09 A;  3OWE B;  4IN3 A;  1OXV A;  1HXD A;  1LTS D;  4XU3 A;  2CFM A;  1Y1V H;  1HNX L;  1DOM A;  1I3Q H;  1PH4 A;  4P3O A;  3S9W A;  4JBW A;  4GOP C;  1F77 A;  1TS3 A;  2VY3 A;  3NUC A;  4P75 A;  4LUO A;  1PTO B;  1STA A;  2I07 B;  4LAA A;  2PZW A;  5I2X A;  2CH4 A;  4S3S A;  3TME A;  2K50 A;  1I4H A;  2K05 A;  1EIY A;  5E4W C;  1JJG A;  1QOH A;  3P75 A;  5C3W A;  1I50 B;  3NBH A;  1HTT A;  3VA5 A;  2R93 B;  1E2Z A;  4CS3 A;  3SK4 A;  1WYD A;  1F9R A;  2NZO A;  1CA5 A;  2PNR C;  2CKZ B;  2BE5 D;  2RSO A;  4R1J A;  2YTY A;  3F1Z A;  3BDO A;  5T1I A;  3VYT A;  3TS2 A;  1JMC A;  2E2H H;  4RQE A;  1Q3L A;  1O7L A;  5IYB H;  2EYP A;  1LAB A;  2O2L D;  2ART A;  1PZK D;  2PQA B;  4HIM A;  2DQ3 A;  1PTO C;  1I5F A;  5M3F H;  2K14 A;  1CKO A;  4A75 A;  4YRC A;  3KDF B;  4C1N K;  2ZGW A;  3ULL A;  4JYA Q;  1EY6 A;  2M9V A;  1TWG H;  1BXT A;  4L5S A;  1AN8 A;  2K01 A;  1PYB A;  2PMZ E;  2VS1 A;  5GRO A;  2O4X A;  1DOL A;  1QE6 A;  4Q6G A;  1OXT A;  5EAY A;  1IBM Q;  2XN9 C;  5BN5 A;  5C3X A;  3W3S A;  3CCE A;  1XMQ Q;  2EJF C;  1K83 H;  3CRL C;  3HZX A;  3K6O A;  3A74 A;  1MJE A;  5IYC H;  4ODG A;  3R3O A;  2RHS A;  2ZZF A;  2DXT A;  2F0L A;  2ZJQ A;  1HJP A;  2Q2T A;  1A2T A;  1E2W A;  1PTO H;  2Z4I A;  2JA5 G;  4XTX A;  2C7I A;  3V2T A;  1PRT F;  1G29 1;  1VQH A;  2Q2H A;  3GTM B;  4LVK A;  1E24 A;  1VQO A;  1YGB A;  5M3F G;  4DV2 L;  3HOX H;  2KBN A;  1I50 H;  2YYZ A;  2UXC Q;  1QVG A;  4Y7N B;  1WTO A;  4IUT A;  1PLF A;  1EIG A;  5H1S E;  2X6G A;  1S40 A;  5JAV A;  4AIM A;  4X64 L;  2B2W A;  3E9I A;  3QIA A;  2IW3 A;  4IPD A;  1ADY A;  3NPP A;  2AUJ D;  2QGQ A;  2IT1 A;  4TVY A;  4L8J A;  1JR0 D;  3NEM A;  5FOB B;  2EY1 A;  3TZD A;  3SR1 A;  4BBS G;  1PRT C;  4LW1 A;  1X9N A;  3LSQ A;  4H2U A;  4HSP A;  2PW7 A;  3VA7 A;  1HFN A;  3NP8 A;  2FXQ A;  3OW2 A;  2SDF A;  1TS2 A;  1NNX A;  1ESR A;  2WB1 E;  4JI2 L;  2L0C A;  2OT2 A;  3BU2 A;  5KRU A;  4JI1 L;  3MFY A;  5C3E G;  1KMM A;  3SGI A;  3V96 A;  4C3I G;  4H2T A;  2C35 B;  2KCM A;  4G85 A;  2E10 A;  4H13 C;  4A3I B;  2ZTC A;  2DU5 A;  3I73 A;  1PFB A;  2C9O A;  5EPK A;  3S2D H;  3U50 C;  1C7Y A;  1RF2 D;  4PZ8 A;  3V05 A;  3L9A X;  5L37 A;  4ID6 A;  4XYQ A;  5BR8 L;  1HNW L;  1SE2 A;  2PMZ B;  11AS A;  1CT1 D;  2CGH A;  4XEO A;  4E51 A;  1WTH A;  2RDH A;  2LKV A;  1CSQ A;  1IL8 A;  4DNT B;  1PVO A;  1KDB A;  3RAC A;  4B3M L;  1V1Q A;  1ATI A;  2RA4 A;  1VQ9 A;  4DAP A;  3UDF A;  3KOJ A;  4XT3 B;  1VQG A;  5DLQ E;  3HOV G;  1K0R A;  1O78 A;  3DWQ A;  5EBD A;  2VNU D;  2OXP A;  1CTM A;  4F7X A;  1VQB A;  4KMU C;  5BN4 A;  3IL8 A;  3KLS A;  4LF5 Q;  1U9R A;  3Q0A A;  2FIN B;  4K5V A;  4GKK Q;  1NUC A;  4A3B B;  2NBF A;  4CS4 A;  2ZT5 A;  2J3L A;  1HZ9 A;  1ET9 A;  4ZKB B;  2QDL A;  3A55 A;  3FVQ A;  1IBM L;  4NKL A;  4LFA L;  3M7N A;  1YJW A;  2DDZ A;  2KVM A;  4RKL A;  5G3L D;  1G2S A;  2B2Y A;  4AYB G;  1CZG A;  2PZU A;  2DY7 A;  3GTG B;  3SK8 A;  2E74 C;  4IOA A;  1SBB B;  1YFT A;  4PMB A;  4IPG A;  1RDP D;  3DWA A;  2JA6 G;  4BWG B;  3A0J A;  4KHP Q;  1BBU A;  4A3G G;  4LF6 Q;  4BWA A;  1IYU A;  1CUK A;  2OQK A;  4QCL A;  2RVL A;  4ALP A;  3RZD H;  3D4R A;  1N36 Q;  5CBE E;  2F0U A;  2CVR A;  1VQC A;  1PYS A;  4OP0 A;  3RUZ A;  1X01 A;  2JA7 G;  1HC7 A;  2IHE A;  4KD4 A;  3JAM i;  3PQI A;  1Q8K A;  2G9D A;  5M5W H;  4ABN A;  2JA8 G;  4FXD A;  4BBS H;  2PO4 A;  1A15 A;  3M3Y B;  4OX9 Q;  1G8Z D;  3TP8 A;  3RN5 A;  2GVB A;  2K5D A;  2E5L L;  5A35 A;  3J7A 5;  5FLX E;  2PMF A;  1AFP A;  2A74 C;  2DTI A;  1EOT A;  2EXZ A;  4DV6 L;  2Y0S B;  5GAH C;  4DR3 L;  2HDM A;  4TQD A;  3RMH A;  4YRM A;  2AWO A;  3EFX D;  4LFC Q;  4EVO A;  2B29 A;  4DGZ A;  3Q22 A;  4K6L A;  1I94 Q;  4JI2 Q;  3J80 L;  2B8F A;  2UXC L;  2MO1 A;  2L4N A;  1GJX A;  4R4T A;  1ZKO A;  2Z9H A;  4NDX A;  3W3A A;  3HXU A;  1GM5 A;  3TBI B;  2DZC A;  5C0X J;  3KYH C;  4A3C H;  1EEF D;  1FVI A;  4DUY L;  3UGT A;  5CV7 A;  1I3Q B;  3TS0 A;  4B3T Q;  4NXM L;  3SK6 A;  1RIQ A;  1G6Z A;  3RKY A;  3UE0 A;  2A69 D;  4N8F A;  3V7R A;  2B63 H;  1G91 A;  2TMP A;  1U4P A;  2WKD A;  3PZC A;  3MWY W;  4A93 B;  3EIV A;  2I0Q A;  1K8A C;  3CCU A;  4YY3 Q;  1BBX C;  1TXY A;  2ZZG A;  3A7A B;  2WIN B;  3MEH A;  2B2U A;  4JI1 Q;  1PFN A;  2EYH A;  3AB9 A;  2NVX B;  3HOV H;  1YHQ A;  1SNC A;  4HWT A;  1NNH A;  1MD2 D;  5ELF A;  3EA6 A;  1HQR D;  3S1N H;  1YB3 A;  1HR0 L;  3PUY A;  1K3R A;  4DR5 L;  1PH1 A;  3IKL A;  3DUZ A;  3MEF A;  4X6A H;  4RGT A;  3QO7 A;  2NN6 I;  3RGL A;  3VYU A;  3DM1 A;  1SYF A;  4A3K G;  1MSH A;  3J81 i;  4BW9 A;  5M3F B;  1X2G A;  3PMF A;  4L5Q A;  1L2F A;  2DJZ A;  1VQE A;  4QY7 A;  1W6K A;  2B2W C;  2Z6B A;  3STB C;  5C4X G;  3T1Y L;  1EFI D;  3HOU B;  1HXY D;  5C6A A;  1XNR Q;  3U4Z A;  1JT8 A;  4MNO A;  3RR5 A;  3JAM E;  2ARS A;  3K7A H;  4R8I A;  1GUT A;  2EYO A;  3PUV A;  4BA2 I;  4N9T A;  1JWM D;  2A6E C;  2L55 A;  1PV4 A;  2K6A A;  2JA6 H;  4GOP B;  3SK5 A;  3L1A A;  1H4S A;  2VZA A;  4XT1 B;  1HTL D;  1O80 A;  2XWJ B;  3I4N H;  4C3J H;  3V7C A;  4H2W A;  3W5O A;  3X3M A;  3S1M B;  4GKK L;  4X66 L;  2HT1 A;  4TVA A;  1J5E L;  1DJR D;  2YU9 B;  3PUX A;  5E7N A;  1OXS C;  2CJ9 A;  4JK1 C;  4EQ5 A;  4TQF A;  4A93 H;  2F0I A;  4IO9 A;  4GN4 B;  2K5H A;  1DOK A;  1L0W A;  1HTP A;  4RG1 A;  5DM7 3;  2HD3 A;  1SMX A;  2RSN A;  3HOV B;  1TWF H;  1KRT A;  1Y14 B;  4K86 A;  5JOB A;  1EQQ A;  1YBY A;  2NVY H;  2A8E A;  1YNN C;  3HKS A;  1U0L A;  4RWS C;  4NMZ A;  4K8I A;  4C56 C;  3FKI H;  3HFV A;  1H9K A;  4KTA A;  2K7V A;  2QW7 A;  1WU7 A;  3CRK C;  1QJO A;  1FJG L;  2MFI A;  4GKJ L;  1XMQ L;  4DR3 Q;  3VYR A;  4YCU A;  1SFO B;  5JEA J;  3M4Q A;  5IGF A;  4WFN 3;  5LHY 1;  2EJ9 A;  2Q7H A;  4DV3 Q;  4K5X A;  2HHH L;  4A3L G;  5KNN A;  4RGN A;  3H0G B;  1GO3 E;  1STH A;  2D2C C;  2NS6 A;  5ELD A;  5CV4 A;  1ZEQ X;  1S5C D;  2ODR D;  1MIU A;  1PZI D;  4OHJ A;  3OSO A;  1EU4 A;  3T51 B;  2QEJ C;  4JI5 Q;  2EYL A;  1I6V C;  4DV2 Q;  1ET6 A;  5IT9 c;  2D0P A;  3M9B A;  2NVQ H;  3JAM c;  1ML0 D;  1TWA B;  2L1B A;  3OTO L;  3MF2 A;  4F87 A;  1IZ6 A;  2IHF A;  1D1K A;  4Q5V A;  2EJF A;  3VQX A;  4EX5 A;  3PIO A;  2E2D C;  4CGY B;  3WOE A;  1ILQ A;  2ZNJ A;  1EQR A;  2Q8I B;  1A0I A;  2R3Z A;  4LUZ A;  2RHQ A;  4KJN A;  5IGG A;  1BIA A;  3FKI G;  3K81 C;  3RLF A;  3A5Z A;  1Y1W G;  3PO3 B;  1BOS A;  3S16 B;  4A3F G;  3MXP A;  3BVZ A;  3CCJ A;  5HUR A;  1PHJ A;  4XU2 A;  3F2B A;  1GUO A;  4YYE A;  4ZUI A;  2KHI A;  4C3I H;  3CD6 A;  1S72 A;  2E5A A;  3R93 A;  2E65 A;  1Q86 C;  2I5L X;  2K4K A;  3VR4 A;  4LF7 L;  2N8N A;  3TN2 A;  4RFB A;  4J15 A;  1NMF A;  4OON A;  3D0F A;  1XNQ L;  5CV6 A;  2FHT A;  3HKZ E;  2B2T C;  2VB3 X;  3FHW A;  5IGC A;  3G4S A;  2A6H C;  2DN8 A;  3GTK B;  2B2T A;  5K5P A;  1CHP D;  3GTP H;  1W3S A;  4E6I A;  2JK8 A;  4MN3 A;  5ELO A;  3CKI B;  2LSS A;  4JC0 A;  4QQB X;  3DMU A;  1Q7Y C;  2CWP A;  2UUA Q;  1IL2 A;  2Z4H A;  1YJN A;  4IFD G;  2UXD L;  1SET A;  3TEG A;  1Y1V G;  1Z6H A;  4K5W A;  2HCI A;  1IW7 D;  4F8M A;  5IP9 G;  3F8T A;  1B3A A;  2B2V A;  3NEL A;  3PCO B;  3KLW A;  2KCT A;  4RKB A;  1BR9 A;  1X56 A;  3D4W A;  1VF7 A;  3G6J B;  1PA6 A;  1TWC H;  2B3G A;  3S1R B;  3I70 A;  4GNX C;  4LWC A;  1FYF A;  2RHQ B;  4LUV A;  1HH2 P;  4PZ6 A;  1X65 A;  1DON A;  4IJL A;  5C44 H;  1E22 A;  4JYA L;  1ICW A;  3T13 A;  3SDZ A;  2JA5 H;  4H0L C;  4JVZ A;  5IGD A;  1ESF A;  1M90 C;  1D5M C;  1YVC A;  2E64 A;  3RZD B;  1ZXT A;  2QA4 A;  5E4X A;  1EYD A;  4ZLT F;  3P1H A;  3NE5 B;  3T4A C;  5IYD H;  1SYC A;  3GTL H;  1WJJ A;  4DR7 Q;  1TVX A;  3RL6 A;  2K1B A;  3CPF A;  4ZKC B;  4WI1 A;  2I4L A;  5K36 H;  4LFA Q;  3OD1 A;  1LYL A;  2JJQ A;  3F2C A;  2E2I B;  2AQ3 B;  5C0X H;  1MBY A;  4CJ0 B;  4P71 A;  1SAP A;  1HR0 W;  2DY8 A;  1T5E A;  1HNZ Q;  3IKM B;  1H4Q A;  1N32 L;  3SE0 A;  3B6Y A;  3IFD A;  2NVT H;  3M4O H;  2ZCE A;  1GKH A;  1VQ7 A;  3KJP A;  2A68 D;  2Z8L A;  2L11 A;  3X3N A;  5FLX c;  4R4Q A;  1UAP A;  1GHJ A;  4XQN A;  4EQN A;  2PI2 E;  4HJ8 A;  2F0Q A;  4UP7 A;  3I4M B;  2H1E A;  3R07 A;  4GKJ Q;  1O7I A;  3OHX C;  1SJE D;  3OMG A;  1UE7 A;  4TVA B;  4DXG A;  3S2H H;  2CJB A;  2FMC A;  4YRT A;  1NE3 A;  5IOD A;  1L0X B;  2KCC A;  2FYK A;  3RIR A;  2B63 B;  4DQ2 A;  3L4G B;  1A2U A;  1VQJ A;  1FNU A;  4U68 A;  3K57 A;  4GOP A;  1SLJ A;  2JA5 B;  1D5Z C;  5CBA E;  1XTD A;  2OEO A;  1SSO A;  1WOC A;  2L15 A;  1S4Z A;  1CKN B;  2I4O A;  1WTP A;  1Q12 A;  2Z0S A;  4HN7 A;  1C8C A;  5I6W A;  5IWA L;  4DUY Q;  3BYT B;  4M8A A;  5M5W B;  4JI7 Q;  1LTT D;  1OTC A;  4WJ4 A;  1G6P A;  1CQV A;  2WB1 G;  3C1E A;  4RQF A;  2R7Z H;  4WF2 A;  1MHW C;  2HUG A;  4DKA C;  4CKC A;  1HPC A;  5DM6 3;  4IFD J;  3TQY A;  5CGK A;  3TEH B;  4A93 G;  4FDB A;  4ILW A;  1R9T B;  4DA2 A;  1EWC A;  5C4J H;  1J5W A;  1EY9 A;  4ULL A;  2R92 H;  3K0X A;  1D1I A;  3SHL A;  2RF4 A;  4BY7 G;  1EIY B;  2R6G A;  2R61 A;  1W2B A;  2EYF A;  2A19 A;  2DJF C;  2EZV A;  3I4M H;  4IPC A;  4YRI A;  4L5R C;  4JI4 Q;  3CCM A;  5J3B A;  2A68 C;  3QOJ A;  4YRN A;  5EPL A;  2VL6 A;  1NJ6 A;  3L4G A;  3H3V C;  4UP8 A;  2IL8 A;  4P3P A;  2YU9 H;  1R4P B;  2UUA L;  2D9U A;  4J8Q A;  4LF9 L;  1F9P A;  1NJ8 A;  1TQO A;  2QHS A;  1IYV A;  3Q8D A;  3KLR A;  3L7Z C;  2VUM H;  2CQA A;  1I4G A;  3T1Y Q;  2GN5 A;  5C0X G;  1UWV A;  2VW9 A;  4A3K B;  2QHT A;  3S1N B;  1U4L A;  2RDF A;  2Z1C A;  3P7J A;  3BDC A;  1X55 A;  2EOT A;  2JXM B;  1B4O A;  1X3P A;  4QGU A;  1N32 Q;  4FF1 A;  1PYW D;  2WAQ B;  4QIW B;  2DXU A;  2QIL A;  3QO2 A;  4DV0 Q;  5CYU A;  1K73 C;  2A8V A;  2UUB Q;  2H5X A;  3NK9 A;  3Q6S A;  4QL5 A;  3HOY H;  1AZQ A;  4DR7 L;  1PFS A;  5T1G A;  1R9T H;  5TSS A;  2XSC A;  1KAW A;  3O13 A;  3S17 B;  1PYS B;  2MUY A;  1UE5 A;  1TWH H;  2ZT8 A;  1D2B A;  2F0O A;  5FLM G;  4DR4 Q;  4A3E G;  5D3D A;  1KD1 C;  1GUW A;  3GV6 A;  3LC0 A;  5J22 A;  1KMN A; 
#chains in the Genus database with same CATH homology
 3CC7 A;  3AQQ A;  4RMF A;  4PHC A;  1YI2 A;  1EWI A;  3S16 H;  4YWM A;  2OWO A;  3K7U C;  4YRR A;  3UE1 A;  3HOY G;  4NXM Q;  3PCO A;  4XTU A;  2JA8 H;  3UGQ A;  5HGQ A;  4JI7 L;  2Q5H A;  4P74 C;  2Y0S G;  2PNH A;  1D8L A;  1N33 Q;  1YNX A;  2R92 G;  4A3F H;  4B3R Q;  4X62 Q;  4JV5 Q;  4A3D H;  4HWR A;  4IJH A;  4GLX A;  4NXN L;  4GS3 A;  1JJC A;  4C2M H;  1E1T A;  3I4O A;  1PH7 A;  1G5H A;  2ZIO A;  4X65 L;  3I4N G;  2B63 G;  3NEN A;  3DM3 A;  1JJ2 A;  3A5Z B;  4LNS A;  1BIB A;  3V8L A;  4XEM A;  4XIG S;  5IP9 H;  2ZT7 A;  1E7Z A;  4JCV E;  4A3D G;  1YEZ A;  3QTC A;  3L2P A;  2Q7G A;  3IRB A;  1J5E Q;  4G84 A;  2ZR3 A;  2EL9 A;  3VBB A;  3CCR A;  4DR1 Q;  4MTN A;  1AH9 A;  3HOU G;  2ZIN A;  5GAG C;  1PH9 A;  2XTI A;  5IYD G;  2D62 A;  4YWK A;  1C0A A;  2R7D A;  4LVI A;  4KHZ A;  2QHU A;  2E1H A;  1EFW A;  2QEX A;  3FP9 A;  1VQD A;  3VQV A;  1DGS A;  1FJG Q;  3HXZ A;  2BA0 A;  3FJP A;  3T1H Q;  3W1B A;  3HRK A;  3VDY A;  1S3O A;  3RF1 A;  2OTJ A;  3HOW G;  2WFW A;  2BH8 A;  3GTG H;  2UUB L;  1YHB A;  2RHS B;  3W1G A;  4DV7 L;  4KR3 A;  4TTV A;  2JEA I;  4JI5 L;  3GD7 A;  3J81 c;  2EXD A;  3I2Z A;  4DPG A;  1QZH A;  4A3M H;  4H02 A;  4BY1 G;  2ODR C;  1CSP A;  4YRE A;  5E3I A;  3WQZ A;  2N3S A;  3GTQ H;  3PO2 H;  1CKM A;  1IYJ B;  3A5Y A;  3V7S A;  1L1O C;  2PQA A;  2K5N A;  1VQN A;  1NYR A;  5M3M H;  2ZIM A;  4LNQ A;  4LVM A;  3KF6 A;  1LTL A;  4BY1 H;  2ALY A;  3L2Z A;  3P8Y A;  2R7Z G;  3A7A A;  1B8A A;  5F5W A;  3ULP A;  2PME A;  3I7F A;  5C0X I;  3RNU A;  4P73 A;  3A31 A;  4UP9 A;  4CH4 A;  5IY0 A;  1XPU A;  4LF6 L;  3UH0 A;  4ZIB A;  3JC6 6;  3U4V A;  4XU0 A;  2F52 A;  3ULJ A;  4YHH Q;  4DUZ L;  2XGT A;  4DR2 L;  4R4C A;  4K88 A;  3TRE A;  3M3Y H;  1WCM H;  3E9H A;  2OQ0 A;  2R93 G;  3REX A;  3CC2 A;  2Q5I A;  1K8G A;  5C53 B;  4LF4 Q;  4YRK A;  1SER A;  3CPW A;  4LFB Q;  4YRG A;  2ID0 A;  3HXW A;  4GNX A;  4XU1 A;  4H2X A;  2ZTE A;  4AQY Q;  3GTM H;  3MQZ A;  4YPF A;  1YFS A;  2RCN A;  1Z7M A;  1UEB A;  2ZR2 A;  4NPS A;  4DV5 Q;  4K87 A;  3HFZ A;  1X3G A;  4PZ7 A;  2R7F A;  5IWA Q;  5FLM H;  3PO2 G;  2EIF A;  4CH6 A;  4TWA A;  4YY3 L;  4OWT B;  1MKH A;  1W66 A;  2ZNI A;  2F4V L;  2CWA A;  1AE3 A;  2V1C C;  4L87 A;  2EAY A;  1VQP A;  1KRS A;  3S24 A;  3CW2 C;  1Y1W H;  4L5T A;  2JA9 A;  4C3H H;  3VQY A;  1KXL A;  1N9W A;  2K75 A;  1HZC A;  3S17 H;  3QO8 A;  4XTZ A;  4JI0 Q;  4JI6 L;  5BR8 Q;  2ZM6 Q;  2AWN A;  3I4M G;  1C9O A;  1XPO A;  3S1Q H;  4LF9 Q;  4YRQ A;  2YTX A;  4HJ7 A;  2JE6 I;  4B3R L;  5K1P A;  2UXB L;  3J7Z C;  2VUM G;  3PO3 G;  3EFS A;  3HXY A;  4JI4 L;  4IPH A;  3H3V H;  3IG2 A;  1USY A;  3A7U A;  4OLF A;  4CS2 A;  1WCM G;  3MF1 A;  3CC4 A;  1HZA A;  3ERR A;  3A7R A;  3PUZ A;  4DR6 Q;  1H4V B;  1EIF A;  1WLE A;  3BZC A;  2ASB A;  1IBK Q;  1N36 L;  4CH3 A;  3P8T A;  3D31 A;  3CP0 A;  1PH2 A;  3HXV A;  2KEN A;  1RIP A;  3G71 A;  1A63 A;  5C52 B;  1UE6 A;  1HNW Q;  3RZO H;  2OCE A;  1NJ2 A;  1GVP A;  5GAD C;  5M3M G;  3S14 H;  2WAQ G;  1T9H A;  2ZJP A;  3HOW H;  2HQL A;  3EN2 A;  1WQW A;  4NCX A;  4DV4 Q;  1QVC A;  4B3S L;  1X3F A;  1I94 L;  2DZ9 A;  3KDF A;  4BBR G;  1B7Y B;  1P8L A;  1UE1 A;  4YCW A;  2DQ0 A;  5HY6 A;  4P73 C;  2K5V A;  1WNL A;  1HR0 Q;  1VQ6 A;  3I56 A;  3CCQ A;  3CCL A;  4X65 Q;  3RKW A;  2C8M A;  1Z7N A;  1J6Q A;  1SRU A;  1VQI A;  1USY C;  4B3M Q;  3NBH B;  1NJ5 A;  3AFQ A;  4ZTZ B;  4X62 L;  4ZTU B;  1OXX K;  1KOG A;  4GLA C;  2UU9 Q;  4OO1 I;  3HOX G;  4POF A;  3M4P A;  1L1O A;  3CME A;  2Q2I A;  2ZM6 L;  3A32 A;  4R4I A;  5LMN Q;  1EVL A;  3HXX A;  1V43 A;  4AH6 A;  3GTO H;  3HFZ B;  4TQU S;  2EJG A;  4JI3 L;  1QZG A;  4KHP L;  1TWA H;  1SR3 A;  4OXP A;  1PH6 A;  2BA1 A;  2AHO B;  1NJ1 A;  5LMU Q;  1G5I A;  1EUJ A;  2D0O A;  3G1Z A;  4P71 C;  4DR1 L;  4X66 Q;  2AKW A;  1YHA A;  2KHJ A;  4DV3 L;  2AKW B;  2DUD A;  4YHH L;  4HA8 A;  1YIT A;  4JOI C;  2HNI A;  5IE8 A;  1ASY A;  3AEV A;  2E5L Q;  1N34 Q;  1KL9 A;  3OYY A;  3J80 i;  2R93 H;  4X64 Q;  4A3J G;  1PH3 A;  2YV5 A;  4YRP A;  1BKB A;  3REU A;  4HVC A;  2ATW A;  4P75 C;  2DEQ A;  2I4M A;  3S15 H;  4B3S Q;  4WJ3 M;  5GQO A;  3DLL A;  1XMO Q;  4A4I A;  2IY5 B;  4GLV B;  3CAM A;  4DNI A;  1X6O A;  3OTO Q;  4IFD I;  4UY8 C;  2DTH A;  3KF6 B;  2MQH A;  4HJ5 A;  3CXC A;  1XNR L;  3H0G G;  3MEY A;  1VQK A;  1NTG A;  2NN6 G;  3UDI A;  2Z6K C;  2CJA A;  2UXD Q;  3PSI A;  2ZTG A;  4LVJ A;  4Y7N H;  4APV A;  4DR2 Q;  1B7Y A;  4UPA A;  4XTV A;  1RL2 A;  1NY4 A;  1PH8 A;  1XJV A;  5M5Y H;  3HY0 A;  1Q1B A;  3V8K A;  2PI2 A;  2UU9 L;  2VQF L;  3EFR A;  3AYH B;  4JI8 L;  1SN8 A;  3MXN B;  2E2J H;  3S1R H;  4BY7 H;  3AFP A;  3HOZ G;  3RUX A;  3PUW A;  1M1K C;  4AQY L;  2VQE L;  1KHI A;  1KQS A;  2WAQ E;  4LVL A;  4JI3 Q;  1FGU A;  1YIJ A;  2E8G A;  4GN3 B;  2DKG A;  3PIP A;  4PMW A;  4Y52 H;  4BXX H;  2HHH Q;  5ELN A;  4YRL A;  3J81 j;  2E2I H;  2ZT6 A;  1VQZ A;  2JQO A;  2CCZ A;  2I4N A;  3GO5 A;  4YRO A;  3VQW A;  1LM0 A;  2Q7E A;  3CQZ H;  12AS A;  1Q46 A;  1HNX Q;  1ASZ A;  4LF7 Q;  1X54 A;  1Q81 C;  1B76 A;  4P3N A;  3E0E A;  4DV5 L;  1VQ4 A;  1MJC A;  4KR2 A;  1XPR A;  1IBK L;  3RLO A;  1GGM A;  4KLK A;  3J80 c;  3GTK H;  1NJI C;  4OWX B;  1KIX A;  3CMA A;  3CCV A;  4A3M G;  3H0G H;  1B70 B;  2F4V Q;  4YCV A;  1PH5 A;  4NXN Q;  4A3E H;  2Z6K A;  1P16 A;  3V8J A;  1Z47 A;  2J3M A;  1VQL A;  4JBJ A;  4K0K Q;  1KC8 C;  4JI0 L;  4JI6 Q;  5IP7 H;  3DSQ A;  3PO3 H;  2AMC B;  1OXU A;  3EBE A;  2UUC Q;  3BZK A;  3RKX A;  1QE0 A;  1VQM A;  4JBK A;  2LXJ A;  4A3G H;  3M85 A;  2K52 A;  1BBW A;  1QVF A;  1VQA A;  2UXB Q;  1WPY A;  1VCI A;  3ERS X;  3H15 A;  1LUZ A;  3QNE A;  1QUQ B;  1HNZ L;  1BVS A;  1JB7 A;  5C51 B;  4HWP A;  2JA7 H;  2VQE Q;  2NZH A;  1WQ7 A;  1YFR A;  4YRF A;  4YP0 A;  2HIX A;  5LMN L;  2EQS A;  4GNX B;  4QJF A;  2I5H A;  1IXR A;  3HY1 A;  3STB D;  4JI8 Q;  4YRJ A;  1Q82 C;  4LF8 Q;  4A3I H;  2MNA A;  2ZJR A;  2N49 A;  3CF5 A;  2F3I A;  4NB3 A;  4CH5 A;  3ER0 A;  3I55 A;  4ME3 A;  3U58 A;  4X5O A;  4R4O A;  5JJK A;  1QUQ A;  2MO0 A;  4Q15 A;  2HIV A;  2YTV A;  2IX1 A;  3TRZ A;  4A3J H;  2ZZE A;  4BA1 I;  2GVA A;  1GD7 A;  5M5X H;  3HOU H;  1A62 A;  1D7Q A;  2ARU A;  4DR4 L;  1L1O B;  4XTC S;  5C3E H;  3HTZ A;  3ZJY C;  4HIO A;  2AMC A;  1X2H A;  5AJ3 Q;  4QIW E;  4KQE A;  4HJA A;  4A3B H;  3S1M H;  5C44 G;  2E3C A;  3K80 C;  2ALY B;  3ICE A;  4KI0 A;  5IYB G;  3CCS A;  1NBW A;  4HWS A;  4P72 C;  1IBL L;  3TEH A;  4K0K L;  5IP7 G;  4O0A A;  4JOI A;  5C4X H;  4TVW A;  1VQ5 A;  4YDQ A;  4DV1 L;  1N8R C;  1XNQ Q;  3KFU A;  5K36 G;  2I5M X;  4HJ9 A;  4JG2 A;  1B70 A;  3HOZ H;  4PG3 A;  3KF8 B;  2OTL A;  3PF4 A;  3RN2 A;  1SFO H;  1CKN A;  4BBR H;  2LXK A;  1X3E A;  3BFM A;  3GTJ H;  4JV5 L;  5IYC G;  2DGY A;  4HID A;  4MZ9 A;  4LF5 L;  5JJI A;  1E3P A;  3ICA A;  2CIM A;  1WI5 A;  3UDG A;  4A3C G;  3L0O A;  1G51 A;  1I6H H;  2P0L A;  4OWW B;  1EVK A;  3F2D A;  1YJ9 A;  3PF5 A;  1Z9F A;  3QO5 A;  5K1X A;  2E41 A;  2P5I A;  4YRS A;  5LMU L;  1AE2 A;  4EO4 A;  2IX0 A;  1YZ6 A;  3G48 A;  2G4C A;  4DV7 Q;  3H3V I;  4HWO A;  3NET A;  2NVX H;  1N34 L;  3UDX A;  4A3K H;  4OX9 L;  1NYQ A;  1JE5 A;  1VS0 A;  3LGJ A;  4DV6 Q;  2DVE A;  4LFC L;  3K8A A;  3HRI A;  4DAM A;  4A3B G;  4H2Y A;  2EWN A;  1XMO L;  2Q2U A;  4YWL A;  1Q1E A;  1A8V A;  3A5U A;  1FL0 A;  3PGZ A;  4OO1 G;  4IOC A;  2A1A A;  2DU7 A;  3KJO A;  4GN5 A;  4H2V A;  1JJC B;  3RLN A;  1N33 L;  2ZXF A;  3LSS A;  4O2D A;  3GDE A;  4DK3 C;  1V9P A;  5AJ3 L;  1E1O A;  1H95 A;  2CQO A;  3IAL A;  3G6E A;  4DR5 Q;  2VQF Q;  4JBM A;  2BH2 A;  4XTY A;  1ADJ A;  4P74 A;  5GAE C;  1IBL Q;  3CMQ A;  4RDX A;  4DV1 Q;  2IY5 A;  4A3I G;  1HZB A;  4A3L H;  1VQF A;  2QHV A;  1SRO A;  1NMG A;  1SE8 A;  1VQ8 A;  5FJ8 G;  4DUZ Q;  4H2S A;  2Y0S E;  4HIK A;  1WFQ A;  4XTW A;  1QF6 A;  2UUC L;  2DTO A;  3BJU A;  4A76 A;  4DR6 L;  2ZTD A;  1H4T A;  4H2X B;  4AYB E;  1U5K A;  2WP8 J;  1SES A;  2ES2 A;  2N78 A;  4LF4 L;  4HT4 A;  4LFB L;  4BXX G;  3PV0 A;  4POG A;  4B3T L;  4DV0 L;  4P72 A;  5FJ8 H;  5JJL A;  3TUP A;  4DAY B;  3T1H L;  1K9M C;  1SRY A;  3UFG A;  5LMN W;  4DK6 C;  2JEB I;  5JEA G;  1EOV A;  1EYG A;  4DV4 L;  3HKZ G;  3P8V A;  4LF8 L;  3WWV A;  4XU3 A;  1OXV A;  1HXD A;  2CFM A;  1Y1V H;  1HNX L;  1I3Q H;  1PH4 A;  4P3O A;  4JBW A;  4GOP C;  2VY3 A;  4P75 A;  4LUO A;  2K50 A;  1EIY A;  1JJG A;  1HTT A;  4CS3 A;  1WYD A;  2NZO A;  2CKZ B;  4R1J A;  2YTY A;  3F1Z A;  3TS2 A;  1JMC A;  2E2H H;  4RQE A;  5IYB H;  2ART A;  2PQA B;  4HIM A;  2DQ3 A;  1I5F A;  5M3F H;  2K14 A;  1CKO A;  4A75 A;  4YRC A;  3KDF B;  2ZGW A;  3ULL A;  4JYA Q;  1TWG H;  4L5S A;  1PYB A;  2PMZ E;  2VS1 A;  5GRO A;  4Q6G A;  1OXT A;  5EAY A;  1IBM Q;  3W3S A;  3CCE A;  1XMQ Q;  1K83 H;  3A74 A;  1MJE A;  5IYC H;  2RHS A;  2ZZF A;  2DXT A;  2ZJQ A;  1HJP A;  2Q2T A;  2JA5 G;  4XTX A;  2C7I A;  1G29 1;  1VQH A;  2Q2H A;  4LVK A;  1E24 A;  1VQO A;  1YGB A;  5M3F G;  4DV2 L;  3HOX H;  2KBN A;  1I50 H;  2YYZ A;  2UXC Q;  1QVG A;  5H1S E;  1S40 A;  4AIM A;  4X64 L;  3E9I A;  4IPD A;  1ADY A;  2QGQ A;  2IT1 A;  4TVY A;  3NEM A;  4BBS G;  4LW1 A;  1X9N A;  3LSQ A;  4H2U A;  2FXQ A;  3OW2 A;  2WB1 E;  4JI2 L;  3BU2 A;  4JI1 L;  5C3E G;  1KMM A;  3SGI A;  4H2T A;  2C35 B;  4G85 A;  2KCM A;  2E10 A;  2ZTC A;  2DU5 A;  3S2D H;  3U50 C;  1C7Y A;  4PZ8 A;  5BR8 L;  1HNW L;  11AS A;  2CGH A;  4XEO A;  4E51 A;  1CSQ A;  1PVO A;  3RAC A;  4B3M L;  1V1Q A;  1ATI A;  1VQ9 A;  3UDF A;  3KOJ A;  1VQG A;  5DLQ E;  3HOV G;  1K0R A;  2VNU D;  1VQB A;  4LF5 Q;  4GKK Q;  4CS4 A;  2ZT5 A;  2J3L A;  1HZ9 A;  1IBM L;  4LFA L;  3M7N A;  1YJW A;  2DDZ A;  4AYB G;  4IOA A;  1YFT A;  4IPG A;  2JA6 G;  3A0J A;  4KHP Q;  1BBU A;  4A3G G;  4LF6 Q;  4BWA A;  1CUK A;  2OQK A;  4ALP A;  3RZD H;  1N36 Q;  1PYS A;  1VQC A;  4OP0 A;  1X01 A;  2JA7 G;  1HC7 A;  2IHE A;  3JAM i;  1Q8K A;  5M5W H;  2JA8 G;  4BBS H;  4OX9 Q;  3RN5 A;  2GVB A;  2E5L L;  3J7A 5;  2PMF A;  2DTI A;  4TQD A;  4DV6 L;  5GAH C;  4DR3 L;  4YRM A;  2AWO A;  4LFC Q;  2B29 A;  1I94 Q;  4JI2 Q;  2UXC L;  2MO1 A;  4R4T A;  3HXU A;  1GM5 A;  2DZC A;  5C0X J;  3KYH C;  4A3C H;  1FVI A;  4DUY L;  3UGT A;  3TS0 A;  4B3T Q;  4NXM L;  1RIQ A;  3RKY A;  3UE0 A;  3V7R A;  2B63 H;  3PZC A;  3EIV A;  2I0Q A;  1K8A C;  3CCU A;  4YY3 Q;  1TXY A;  2ZZG A;  4JI1 Q;  3HOV H;  1YHQ A;  4HWT A;  1NNH A;  3S1N H;  1YB3 A;  1HR0 L;  3PUY A;  1K3R A;  4DR5 L;  1PH1 A;  3IKL A;  3MEF A;  4X6A H;  3QO7 A;  2NN6 I;  3RGL A;  4A3K G;  3J81 i;  4BW9 A;  1X2G A;  4L5Q A;  1L2F A;  2DJZ A;  1VQE A;  4QY7 A;  3STB C;  5C4X G;  3T1Y L;  1XNR Q;  3U4Z A;  1JT8 A;  4MNO A;  3RR5 A;  2ARS A;  3K7A H;  3PUV A;  4BA2 I;  1PV4 A;  2JA6 H;  4GOP B;  3L1A A;  1H4S A;  2VZA A;  3I4N H;  4C3J H;  3V7C A;  4H2W A;  3W5O A;  4GKK L;  4X66 L;  2HT1 A;  4TVA A;  1J5E L;  3PUX A;  5E7N A;  1OXS C;  2CJ9 A;  4EQ5 A;  4TQF A;  4A93 H;  4IO9 A;  4GN4 B;  2K5H A;  1L0W A;  4RG1 A;  1SMX A;  1TWF H;  1KRT A;  1Y14 B;  4K86 A;  1EQQ A;  1YBY A;  2NVY H;  2A8E A;  3HKS A;  1U0L A;  3FKI H;  3HFV A;  1WU7 A;  1FJG L;  2MFI A;  4GKJ L;  1XMQ L;  4DR3 Q;  4YCU A;  5JEA J;  3M4Q A;  2EJ9 A;  2Q7H A;  4DV3 Q;  2HHH L;  4A3L G;  5KNN A;  1GO3 E;  2NS6 A;  2ODR D;  1MIU A;  4JI5 Q;  4DV2 Q;  5IT9 c;  2D0P A;  3M9B A;  2NVQ H;  3JAM c;  3OTO L;  3MF2 A;  1IZ6 A;  2IHF A;  2EJF A;  3VQX A;  4EX5 A;  3PIO A;  2ZNJ A;  1EQR A;  1A0I A;  4LUZ A;  2RHQ A;  1BIA A;  3FKI G;  3K81 C;  3RLF A;  3A5Z A;  1Y1W G;  4A3F G;  3CCJ A;  1PHJ A;  4XU2 A;  3F2B A;  4YYE A;  2KHI A;  4C3I H;  3CD6 A;  1S72 A;  2E5A A;  2E65 A;  1Q86 C;  2I5L X;  2K4K A;  4LF7 L;  2N8N A;  4J15 A;  1NMF A;  4OON A;  3D0F A;  1XNQ L;  3HKZ E;  3FHW A;  3G4S A;  3GTP H;  1W3S A;  2JK8 A;  5ELO A;  2LSS A;  4JC0 A;  4QQB X;  1Q7Y C;  2UUA Q;  2CWP A;  1IL2 A;  4IFD G;  1YJN A;  2UXD L;  1SET A;  3TEG A;  1Y1V G;  5IP9 G;  3F8T A;  3NEL A;  3PCO B;  3KLW A;  2KCT A;  1X56 A;  1PA6 A;  1TWC H;  2B3G A;  4GNX C;  1FYF A;  4LWC A;  2RHQ B;  4LUV A;  1HH2 P;  4PZ6 A;  1X65 A;  4IJL A;  5C44 H;  1E22 A;  4JYA L;  2JA5 H;  1M90 C;  1YVC A;  2E64 A;  2QA4 A;  5IYD H;  4DR7 Q;  3GTL H;  1WJJ A;  3RL6 A;  3CPF A;  4WI1 A;  2I4L A;  4LFA Q;  3OD1 A;  1LYL A;  2JJQ A;  3F2C A;  4P71 A;  1HR0 W;  1HNZ Q;  3IKM B;  1H4Q A;  1N32 L;  3B6Y A;  2NVT H;  3M4O H;  2ZCE A;  1GKH A;  1VQ7 A;  3KJP A;  5FLX c;  4R4Q A;  2PI2 E;  4HJ8 A;  4UP7 A;  3R07 A;  4GKJ Q;  1O7I A;  1UE7 A;  4TVA B;  3S2H H;  2CJB A;  4YRT A;  1NE3 A;  2FYK A;  3RIR A;  4DQ2 A;  3L4G B;  1VQJ A;  4GOP A;  1SLJ A;  1XTD A;  1WOC A;  2L15 A;  1CKN B;  2I4O A;  1Q12 A;  2Z0S A;  5IWA L;  4DUY Q;  4JI7 Q;  1OTC A;  4WJ4 A;  1G6P A;  2WB1 G;  4RQF A;  4WF2 A;  2R7Z H;  4DKA C;  4IFD J;  3TQY A;  3TEH B;  4A93 G;  4FDB A;  1J5W A;  5C4J H;  2R92 H;  3K0X A;  2RF4 A;  4BY7 G;  1EIY B;  2R6G A;  1W2B A;  2A19 A;  3I4M H;  4IPC A;  4YRI A;  4L5R C;  4JI4 Q;  3CCM A;  5J3B A;  4YRN A;  2VL6 A;  1NJ6 A;  3L4G A;  4UP8 A;  4P3P A;  2YU9 H;  2UUA L;  4LF9 L;  1NJ8 A;  2QHS A;  3Q8D A;  3L7Z C;  2VUM H;  3T1Y Q;  2GN5 A;  5C0X G;  1UWV A;  2VW9 A;  2QHT A;  1X55 A;  4QGU A;  1N32 Q;  2DXU A;  4DV0 Q;  1K73 C;  2A8V A;  2UUB Q;  2H5X A;  4QL5 A;  3HOY H;  4DR7 L;  1PFS A;  1R9T H;  1KAW A;  1PYS B;  2ZT8 A;  1UE5 A;  1TWH H;  5FLM G;  4DR4 Q;  4A3E G;  1KD1 C;  3LC0 A;  1KMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...