4DPGA

Crystal structure of human lysrs: p38/aimp2 complex i
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
505
structure length
501
Chain Sequence
b'VDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine--tRNA ligase
publication title Structural Switch of Lysyl-tRNA Synthetase between Translation and Transcription.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/apoptosis
total genus 158
structure length 501
sequence length 505
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dpgA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4dpgA02
4C3HH 5AJ3Q 2BH8A 1KC8C 1XTDA 4WI1A 4G85A 1KD1C 3A7UA 3HOVH 4JOIA 4HJ5A 2ODRC 3I55A 3HY0A 4PZ8A 2B29A 2K5VA 2Z6KA 3CD6A 4ALPA 2CFMA 4P3NA 3PUYA 1XPOA 2ARUA 1PH7A 1RIQA 2J3MA 4XU3A 4X5OA 5KNNA 4CH3A 2GN5A 3KYHC 3CCEA 4RDXA 3J7ZC 2HQLA 2DVEA 4GLXA 1K9MC 2ZTDA 3HRKA 4HIKA 2EJ9A 4GOPC 1YZ6A 1VQCA 2ZR3A 2E2IH 3DM3A 1C0AA 1C9OA 2QHUA 3S24A 1BBUA 1HR0L 4YYEA 3CAMA 4LF9L 2VL6A 4P74C 1IBLL 5FLXc 4DV7Q 2Q2IA 4ZTZB 4BY1G 2JJQA 3JAMi 4XU1A 3UFGA 4GN4B 2QHTA 2CKZB 1KQSA 5LMUQ 1X55A 1Q86C 2QHSA 2AMCB 3ERSX 1CKOA 3JC66 3LSQA 2VQEL 1EIFA 1NJ6A 2ZXFA 3TUPA 3WQZA 3L1AA 3P8TA 3HOVG 4X64Q 4HJ9A 1XPRA 2JA8H 4QL5A 3M4QA 3KF6B 3J80i 3L2ZA 1AH9A 4GLVB 4E51A 5JJIA 1B70A 1G51A 3FP9A 4DR5L 2PNHA 3RNUA 2IHFA 4A3KH 1YJ9A 1VQHA 2R93G 2I5HA 1S40A 1M1KC 3H3VH 2UXDQ 4OXPA 4DR7Q 4H2XB 5F5WA 2KCMA 5IWAQ 1HNZQ 4Y52H 4UP8A 2JA5H 3HKSA 3PO3G 2YTYA 1FJGL 5JJKA 1G6PA 3HOWH 4AQYQ 4P71A 4C3IH 1VQMA 1HJPA 3NEMA 2DU7A 4BW9A 3S16H 5BR8L 2UUAL 4HIMA 4DR3L 4L5QA 3M7NA 1WQWA 2DDZA 1QUQA 4DV2L 3CPFA 2E5LL 2PMZE 4OP0A 1YHAA 3CCRA 3TEHA 1FYFA 4YCVA 3S17H 3EBEA 1JJCB 1VQ5A 2Q7EA 4NXML 3H3VI 4H2YA 2L15A 1YGBA 1ASYA 1U5KA 2PI2E 1IL2A 2UXBQ 4JI6L 4CS2A 4DUZL 4LWCA 1IBMQ 2YYZA 4Q6GA 2JA8G 2D0OA 3OW2A 2K4KA 1N8RC 3HKZE 4ME3A 3KFUA 2HHHQ 4C3JH 3RUXA 1RIPA 3UDXA 4A3IH 11ASA 1J5EQ 1L1OA 4QQBX 2ZT7A 1TWHH 5DLQE 4A75A 3HKZG 1USYA 2QGQA 3HXXA 3S1MH 1OTCA 3MEYA 3IG2A 1Q8KA 4TVAB 1NMGA 4P72C 5LMNQ 3I4MH 4DR4L 2JA5G 4LNQA 4A3EG 4JBWA 5IYCH 3HOWG 3ERRA 3PIPA 2HIXA 4JI4L 1E1OA 3QO5A 2VQFQ 4DAYB 1N36L 1BVSA 3AYHB 1PVOA 1Z9FA 2CJBA 4PHCA 1SE8A 2ZINA 1QUQB 2IX0A 3I7FA 1EWIA 1ADJA 2A8VA 1NMFA 3RN2A 2K75A 2Q5IA 3Q8DA 3KJOA 2JA9A 1IXRA 1YNXA 4CH5A 4J15A 4C2MH 1K8AC 2ZIOA 3T1YL 1UE5A 4GNXA 1Q7YC 2R92G 5HGQA 2H5XA 2OCEA 2K14A 4P73A 4P3PA 2Q2HA 2OTJA 4A4IA 5C4XG 1NE3A 4IPGA 4DV5L 4CH6A 2NN6I 2JEBI 3HTZA 4DR2L 1YHBA 1XNQQ 4RQFA 3RLOA 3V8KA 2ZIMA 1Y14B 1HR0W 3S1RH 4B3TQ 1VQFA 2RCNA 1HC7A 5C3EH 1PH5A 5C52B 4OO1I 3PZCA 2UU9L 1HNXQ 4DK3C 4JC0A 3OTOL 4DAMA 1VQ7A 4YY3L 4A3JH 2NVYH 3KJPA 1I3QH 1NJ5A 4YWKA 3I4NH 4YRMA 4DUYQ 1TWFH 1NJ1A 2I5LX 1B7YA 2N49A 2CIMA 3HY1A 3CW2C 1FGUA 1CKNB 1XNRL 3I4MG 4JI2Q 3TS0A 3CC2A 1K8GA 1SERA 5IYCG 2R6GA 3F2CA 2J3LA 1KL9A 2DGYA 2LXJA 4JI5Q 1S3OA 2I5MX 2ZJQA 1VQAA 3GTLH 2ZJPA 2ZNIA 4YWLA 2E5AA 2PQAB 1Q46A 2VNUD 4BBRH 4X65L 3GTKH 2ZTCA 3W3SA 4TQUS 2CWAA 3ZJYC 2I4OA 2PMFA 3AQQA 3VBBA 4L87A 1X56A 4GOPB 1SRYA 4B3ML 1YVCA 4A3MH 4KHPQ 4YRNA 2BA1A 3MEFA 2ARSA 2DEQA 3U50C 4CH4A 4OX9L 5C3EG 2WP8J 4P71C 2BA0A 4R4IA 2KHIA 1DGSA 5LMNW 5C44H 4A3JG 4YPFA 4X66Q 4LFCL 5GAEC 4QJFA 4O2DA 4GKJL 3HOZH 1KXLA 1IBKL 3UDGA 2UUCQ 1X2HA 4DV1L 4BWAA 4HVCA 1NYQA 4LF4L 2DXUA 3REXA 1VQEA 4ZIBA 4HWRA 1KMNA 3QTCA 1VQDA 1X3GA 3PF4A 2EJFA 4KQEA 1Z7NA 3GTJH 3PSIA 1H4SA 1OXTA 1QVGA 3PGZA 1H4TA 4K0KQ 4BBRG 3PUWA 2MO0A 3UE0A 4HIDA 1VQZA 1KIXA 3JAMc 1L1OC 1ATIA 4PMWA 3KF8B 4GLAC 1I50H 3M85A 3EN2A 3S2DH 2MQHA 4JI7Q 4A3MG 5M3MH 1UE1A 2DXTA 4DV0Q 1W2BA 1EFWA 4XTVA 3LGJA 1WU7A 4DV7L 4JBMA 1K83H 2R7ZH 5C44G 1NTGA 3J80c 5M3FH 1L2FA 4IO9A 1EIYA 2Q2UA 1G5IA 3GTOH 1G291 3M3YH 3F1ZA 5LMUL 1SROA 3HOZG 1VQLA 3A5ZB 2Q2TA 2YU9H 1VS0A 3K0XA 1XPUA 1KAWA 5M5YH 1WCMH 3PCOB 1EQQA 2I4LA 4GNXC 4APVA 4P73C 2RHQA 4X64L 2NVTH 3GO5A 1I5FA 3E9HA 4H02A 4NXNQ 4ZTUB 2JA7G 2I4MA 3K8AA 2E3CA 2WB1E 5IE8A 3CCLA 1SLJA 1PYBA 4YRFA 1MJEA 1MIUA 4AIMA 3STBD 4YRCA 2WB1G 4IOAA 1XMOL 3IALA 1TWCH 2UXDL 2Q7GA 4DR7L 3ER0A 5IWAL 4B3RQ 1HNZL 4JBKA 3PUXA 2F52A 4UP9A 5M3MG 4AQYL 1A8VA 3SGIA 1VQBA 3IRBA 4YRLA 1QF6A 2IT1A 1WLEA 2ZZEA 2HT1A 4P75A 3GTPH 4YROA 1Q82C 1N32Q 4DR6Q 5M3FG 3HXWA 4MZ9A 1OXXK 4QGUA 3ULPA 1VQKA 3W1BA 1KRTA 2DKGA 3B6YA 3OD1A 4JG2A 3VQVA 3S1QH 2E41A 4LFAQ 3HOUH 1WCMG 5E7NA 2RHQB 2UXBL 1QVCA 1IBML 5IYBH 3S15H 4YRJA 2PMEA 2K52A 2E65A 1GD7A 4R4OA 2HHHL 2LSSA 3G71A 4JI3Q 4LW1A 4L5SA 4H2TA 3ICEA 1J5EL 4KHZA 2DJZA 4DKAC 3HXYA 4JV5Q 1TWGH 3HFZA 5FLMH 3NELA 4OONA 1NJ2A 2VUMH 5M5WH 1K73C 1MJCA 5LMNL 2E2HH 4IFDJ 1GVPA 2DTIA 5C0XJ 1CSPA 4YRTA 2ZT5A 2VQFL 3TREA 3RF1A 2ZM6Q 5GADC 3A7AA 1GKHA 4H2UA 1X2GA 2P5IA 1HZAA 2CCZA 2VZAA 3P8VA 4A93H 1EOVA 3CP0A 3IKMB 1X3FA 2ZCEA 1PYSA 2A1AA 3I4OA 5IP7H 3HXVA 4B3SQ 2G4CA 4DV6L 3MF2A 3K80C 4JI8Q 1C7YA 1HNWQ 1B70B 2JA6H 1CKMA 2B63H 1UE6A 2HNIA 2OTLA 2DTHA 5GAGC 3HOUG 4A3KG 3TS2A 4IPDA 1W66A 1XNQL 3J7A5 4TWAA 5IYBG 2D0PA 1U0LA 4B3TL 1QZGA 4K86A 4X6AH 4OLFA 4YREA 1E7ZA 4GN3B 4HJAA 1HNXL 4R4TA 3T1HL 1EYGA 4DV3Q 3PF5A 4JI1Q 3HFZB 4K87A 4X62Q 1VQPA 5FLMG 1PH3A 4BXXH 3A32A 1VQNA 2ZT6A 2D62A 3CC7A 4DUYL 4NB3A 4DNIA 1D8LA 1PH1A 1YITA 4XTWA 2KENA 4YHHQ 3W5OA 1O7IA 4DQ2A 4IJLA 4A3DH 4JI2L 4WJ4A 2IY5A 3TEHB 3CPWA 1N34Q 4XU0A 2I4NA 1YFSA 2YTXA 4A93G 2WAQE 3RZOH 2C35B 3GTMH 4YDQA 3J81i 4GKKQ 1YFTA 4AYBE 5IP7G 2E8GA 3E0EA 1QE0A 4EO4A 1VQGA 3S1NH 4TQDA 3VQYA 2NZHA 4QIWE 3FHWA 2WAQG 1E1TA 1BKBA 1A63A 2JA6G 4AYBG 1SFOH 3GDEA 2B63G 4A3IG 2KCTA 1L1OB 4IFDI 3TEGA 4KR3A 5C0XI 1LM0A 1MKHA 5IY0A 4L5TA 4KHPL 1Z47A 3CC4A 2F4VQ 2NVQH 3U4VA 1UWVA 1SETA 3L7ZC 2AHOB 4XEMA 2NN6G 2Y0SE 2R7DA 3P8YA 3UGQA 1PV4A 3F8TA 3VDYA 1UEBA 4OO1G 4P75C 1SN8A 3KLWA 1BIBA 1YBYA 2Y0SG 3CCMA 3CCVA 4BXXG 3RACA 5EAYA 2ODRD 1P16A 3RGLA 1Q12A 2UUCL 4IFDG 2FXQA 5C0XG 4AH6A 4JYAL 2DZ9A 3QNEA 4OWXB 4FDBA 2NZOA 3M9BA 4GNXB 4TVWA 3W1GA 3U4ZA 1NNHA 4YRIA 4HWSA 4HJ7A 1HTTA 2RHSA 2R7FA 4XTUA 4RMFA 4LF6Q 4PZ7A 4LF8Q 4JI0Q 3RKYA 4K0KL 3ULLA 3RR5A 3V7SA 1H95A 3CMAA 4H2VA 1PFSA 3RL6A 4BA2I 3UDIA 1R9TH 2CGHA 1YJWA 4JI7L 5HY6A 4HWPA 3I4NG 1B7YB 4XTCS 2MNAA 2JQOA 1V9PA 3S2HH 3UGTA 1XNRQ 3HOXH 1P8LA 4OWWB 5AJ3L 3F2DA 5C4JH 2QHVA 5IT9c 2UXCQ 3H0GH 3QO8A 2UUBQ 4PZ6A 1LUZA 3DLLA 3HRIA 3NBHB 1X9NA 4LFBQ 1XMQQ 4IPHA 3HOYH 3A31A 4XTYA 3K7AH 1I94Q 4XU2A 4R4QA 4YRRA 3L0OA 1K3RA 4R1JA 3D0FA 3S14H 2HIVA 4JCVE 1CUKA 5ELNA 1SRUA 4DV4Q 4RQEA 3G4SA 4XTXA 1KOGA 4NXNL 4LF5Q 1AE3A 2E10A 4DR1Q 1T9HA 1GGMA 3L2PA 1WOCA 1RL2A 2JE6I 1S72A 1WFQA 4BY1H 4G84A 1GO3E 3RIRA 4IPCA 4HA8A 4B3RL 4HWTA 2IHEA 4OWTB 1HXDA 1B76A 2K5HA 2JK8A 1Y1WH 4A3GH 1SESA 4H2WA 2K5NA 3G48A 2AMCA 3HOXG 4YRKA 4YWMA 1G5HA 3OYYA 4LF7Q 2DU5A 1NY4A 3E9IA 3HXUA 1YI2A 1EQRA 3H0GG 4IOCA 1N32L 4DR6L 1YJNA 1VQ6A 4NCXA 1V1QA 3KF6A 3HOYG 1PA6A 4R4CA 1Q81C 4CS3A 1N33Q 1I6HH 1EVLA 1GM5A 4LFAL 1QVFA 2R93H 1JE5A 1B8AA 5E3IA 1WNLA 2ARTA 4H2XA 2E1HA 3REUA 1V43A 3PO3H 1VQ4A 3MXNB 3A5YA 4JI3L 3PO2H 4TTVA 1M90C 1JJGA 1BIAA 3RLNA 2F3IA 2ES2A 3R07A 4JV5L 3HFVA 3V8JA 3EFRA 2DTOA 3KOJA 3ICAA 2I0QA 2ASBA 4YP0A 4A76A 2R7ZG 2AWNA 1EIYB 2EWNA 1X65A 4UP7A 4A3FH 1UE7A 1Y1WG 5IYDH 1JJCA 5JEAJ 2LXKA 4A3GG 3GD7A 2ZM6L 1KRSA 1SR3A 3V7RA 2GVAA 3RKWA 1Q1EA 5C51B 2ZR2A 1PH8A 1VQ8A 4B3SL 1IYJB 4KLKA 2ZZGA 2C7IA 2ZGWA 2JEAI 3LC0A 3PIOA 1JMCA 4JI8L 3K7UC 3V8LA 3CMQA 2ALYA 2ZT8A 1FVIA 4NPSA 3PUZA 4MNOA 1HNWL 3FKIH 2DQ0A 2ID0A 3M4OH 1HR0Q 3CCUA 5J3BA 5IP9H 4LF9Q 3G1ZA 1XMOQ 3A7RA 1IBLQ 4YRGA 4EQ5A 1WJJA 3BFMA 4WF2A 3J81j 3IKLA 1SMXA 2A19A 1KMMA 1OXUA 1WI5A 1ADYA 1XJVA 4TVAA 3V7CA 2EJGA 1NYRA 4A3EH 1A62A 3AFPA 3PO2G 3BJUA 3A5UA 1YFRA 4DV3L 4JI1L 2IX1A 1LTLA 4X62L 1X54A 1ASZA 1WPYA 4YRQA 2VQEQ 3M4PA 3J81c 5K1PA 4RG1A 1PH6A 2ZTEA 4YHHL 4CS4A 3WWVA 1HZCA 1TXYA 1YHQA 4A3FG 2EQSA 5IYDG 2R92H 1HZBA 3RLFA 1J5WA 1N34L 2OQKA 5C4XH 4DR5Q 3DSQA 4XIGS 1JT8A 3U58A 4KR2A 2OWOA 1VQIA 4HIOA 2P0LA 1HZ9A 1VCIA 4GKKL 3G6EA 2CJAA 2Q5HA 2FYKA 5C53B 2ALYB 3LSSA 2QEXA 2K50A 1X3EA 4POGA 2VW9A 1FJGQ 3STBC 3BZKA 2GVBA 3FKIG 1X6OA 2ZJRA 1N9WA 5GAHC 5IP9G 4H2SA 1JB7A 5BR8Q 2F4VL 4P3OA 2UUAQ 4DR3Q 3NETA 4TVYA 4DV2Q 4DK6C 4HWOA 2VUMG 4YCWA 2E5LQ 1CKNA 4QY7A 5GROA 2DZCA 1PH9A 2C8MA 2N78A 4GS3A 1TWAH 4JBJA 4NXMQ 3RN5A 4JOIC 4JI5L 4JI6Q 3I2ZA 1PYSB 1HH2P 4DUZQ 3UDFA 4EX5A 1AE2A 1K0RA 4DV6Q 2Z6KC 1YB3A 2Q7HA 5JEAG 1D7QA 12ASA 3A74A 2PQAA 5FJ8H 5H1SE 4HJ8A 2CJ9A 1FL0A 4BY7H 3CCJA 2AWOA 2PI2A 2WFWA 1YIJA 2N8NA 3RKXA 3QO7A 1E22A 4GOPA 2EL9A 2NVXH 4A3LH 2MFIA 2EAYA 1Q1BA 4LF6L 1EVKA 4LF8L 2ZTGA 2AKWA 4JI0L 4TQFA 4DR4Q 1A0IA 3T1HQ 1E3PA 4P74A 4JI4Q 4MTNA 2YTVA 1N36Q 2OQ0A 3GTGH 4X66L 3MF1A 3ULJA 1J6QA 2KHJA 4KI0A 1CSQA 2ATWA 2DUDA 3BU2A 3H15A 3KDFA 4A3CH 1IZ6A 1NBWA 1WYDA 2B3GA 1WQ7A 2IY5B 4A3DG 2UXCL 3CMEA 2UUBL 3T1YQ 2YV5A 2VY3A 3HXZA 5ELOA 2RF4A 1OXVA 3AEVA 3TQYA 1KHIA 1W3SA 4PG3A 1NJ8A 2EIFA 4DV5Q 3FJPA 4POFA 4LFBL 1XMQL 4DR2Q 1NJIC 1I94L 1YEZA 4A3BH 5JJLA 4WJ3M 5K1XA 1BBWA 2N3SA 2QA4A 1Y1VH 5FJ8G 1L0WA 2XTIA 4BBSH 4BY7G 2UU9Q 3A0JA 3OTOQ 2CWPA 4DV4L 1E24A 4LF5L 4YY3Q 3UE1A 1VQJA 5K36G 4DR1L 3RZDH 2CQOA 3L4GA 4A3LG 2ZNJA 2AKWB 1JJ2A 4LUZA 3F2BA 3BZCA 3CCQA 2ZZFA 4DV0L 3UH0A 4GN5A 3EFSA 4LNSA 4L5RC 3EIVA 3K81C 3VQXA 1VQOA 2BH2A 1EUJA 3NENA 4K88A 3TRZA 5GQOA 1H4VB 2EXDA 4O0AA 3KDFB 4UY8C 4YRPA 4A3CG 4JYAQ 3A5ZA 3GTQH 3CXCA 4XTZA 3I56A 4IJHA 4LF7L 4Q15A 2Z0SA 3PCOA 3CF5A 4BA1I 4X65Q 1LYLA 4UPAA 3CQZH 2JA7H 4LUVA 1X01A 5M5XH 4YRSA 1Z7MA 2XGTA 4B3MQ 4DPGA 2RHSB 4A3BG 1N33L 3CCSA 2DQ3A 4XEOA 4Y7NH 1OXSC 1VQ9A 1H4QA 1Y1VG 4OX9Q 3AFQA 4BBSG 3VQWA 2MO1A 1USYC 2V1CC 3PUVA 1PH4A 4LFCQ 3L4GB 1QZHA 2E64A 4P72A 4YCUA 2VS1A 4GKJQ 3PV0A 1IBKQ 2E2JH 1PH2A 4DV1Q 2KBNA 4LF4Q 4LUOA 3D31A 1PHJA
chains in the Genus database with same CATH superfamily
4C3HH 1C4QA 5AJ3Q 2BH8A 1KC8C 1FYCA 3I4MB 1XTDA 4RGMA 4BS9A 4WI1A 4ABNA 4OGQC 1B3QA 4NMZA 4G85A 2EVBA 1KD1C 4UAIA 3A7UA 4XYQA 3HOVH 4DNTB 4JOIA 4KY5A 3PMFA 4HJ5A 4HMIA 2J0TD 2ODRC 4R8IA 3I55A 3HY0A 4PZ8A 1LT4D 2B29A 5KEEA 2L9HA 2BOSA 2K01A 2K5VA 2Z6KA 3CD6A 4ALPA 2CFMA 4QUCA 4P3NA 4EQOA 3PUYA 2NB0A 5C4ZA 1XPOA 1PH7A 2ARUA 1RIQA 2J3MA 4MHEA 1CHQD 4XU3A 1SNOA 4X5OA 5D3DA 5KNNA 4CH3A 2GN5A 3KYHC 3CCEA 4RDXA 3DEOA 4EQPA 3MA2B 3J7ZC 3HZXA 2HQLA 2DVEA 2RSOA 4C2MB 4GLXA 3QR8A 1K9MC 2ZTDA 3HRKA 4HIKA 2EJ9A 4GOPC 3SEBA 3G6JB 1ICFB 1YZ6A 1VQCA 5G3LD 1HRJA 2EYJA 2ZR3A 2E2IH 1Y69U 2QF7A 3VYRA 3DM3A 1C0AA 1FNVA 1A6XA 3H3VC 3OW7A 3TP6A 1C9OA 2QHUA 3S24A 1KDCA 1MSGA 1BBUA 2A6ED 3S1RB 5EKIA 1HR0L 1J9OA 4YYEA 3CAMA 4LF9L 1AW7A 2VL6A 2MHVA 4P74C 5C3EB 1IBLL 5FLXc 1SNMA 4DV7Q 2Q2IA 4ZTZB 2TSSA 5G3LF 4BY1G 2JJQA 3JAMi 3TP8A 4A3JB 4XU1A 3UFGA 2NVYB 4CGYB 1EY4A 4GN4B 2QHTA 2B2TC 4KN4C 2CKZB 5FKAC 4ZK9B 1KQSA 3NP8A 1I3QB 5LMUQ 1STBA 1X55A 4JPBW 1TWFB 4WFN3 1Q86C 4CJ2C 3KK7A 2F0FA 2QHSA 2AMCB 1B9MA 2F03A 2NZ1D 4C3HG 2F0LA 2VB2X 3ERSX 1CKOA 1YNJC 3JC66 3LSQA 2VQEL 4KD4A 1EIFA 1NJ6A 1LT5D 2ZXFA 1GUSA 5KNDA 3TUPA 3WQZA 1JCKB 3UI2A 3L1AA 3P8TA 3HOVG 4X64Q 4HJ9A 1XPRA 5ELBA 2JA8H 3MXUA 4JVZA 4QL5A 3M4QA 1SYFA 1LABA 2L4NA 3KF6B 3J80i 1PTOB 3L2ZA 1AH9A 1S5DD 3CU7A 4GLVB 2Z1CA 3GTLB 4E51A 5JJIA 1LV9A 2IPKD 1B70A 1G51A 3FP9A 4DR5L 2PNHA 3RNUA 2IHFA 4K5XA 4H13C 4A3KH 5DM63 5F2DA 1W6KA 2SNSA 4DAVA 2O4XA 1BCPC 3O13A 2F1MA 4ZQ3A 2XWBB 1YJ9A 1VQHA 4BBRB 3D3RA 2QDBA 1HUMA 2R93G 3GTKB 2I5HA 1S40A 1M1KC 4EVOA 3H3VH 1PHJA 2UXDQ 4OXPA 4DR7Q 4H2XB 4NW2A 1FNWA 4KKTA 5F5WA 2KCMA 5IWAQ 4KTAA 3LWEA 2JP1A 1HNZQ 1XXGA 4N8FA 4M1UB 2VB3X 5M9OA 4Y52H 2A5HA 4UP8A 3MQZA 2JA5H 3HKSA 3PIP3 3PO3G 2YTYA 1FJGL 5JJKA 2V4DA 2RKSA 4A3MB 4L63B 3HOWH 1G6PA 4AQYQ 4P71A 1MHWC 5FK9C 4C3IH 1VQMA 1HJPA 1QCBD 4DA2A 3NEMA 4IN3A 2DU7A 2I46A 4BW9A 2WKCA 2DNCA 5COYA 2DY7A 1PXUA 3S16H 5BR8L 3DXJC 1Q3LA 1XYIA 2UUAL 2KJXA 1A2TA 1SYDA 4HIMA 4L5QA 4DR3L 1F2MA 5JPMC 1U4MA 3M7NA 1WQWA 2DDZA 1PZJD 5C44B 1QUQA 5JVH3 4DV2L 1B44D 2D5DA 2JN4A 3CPFA 2E5LL 3BVGA 5CV5A 2PMZE 1VMPA 1SNDA 4TKOB 4OP0A 1YHAA 3MAQA 3TZUA 3CCRA 3IAYA 3HRZC 1AP0A 1FYFA 1LLRD 4YCVA 3TEHA 4C56C 3S17H 3EBEA 3HOZB 1JJCB 1I6VC 1VQ5A 2B2WC 3AB9A 2Q7EA 5BN5A 4NXML 3H3VI 4RCNA 2L15A 4H2YA 1WVLA 1YGBA 4QUFA 1ASYA 1U5KA 2PI2E 3GTQB 1IL2A 2UXBQ 4JI6L 2EPBA 4CS2A 3SK6A 4DUZL 4LWCA 5CBAE 4ZLTF 2YYZA 1IBMQ 4K8JA 2RCFA 4Q6GA 4O42A 2EJMA 3J81E 2JA8G 2D0OA 4XQJA 3SR1A 3OW2A 2K4KA 2JA7B 4OL7A 1ZKOA 5ELCA 1N8RC 1EWCA 3GTJB 3HKZE 4ME3A 3KFUA 4ZRZA 2HHHQ 1H9JA 4C3JH 2XN9C 3RUXA 1RIPA 3UDXA 4RAUC 3A8IE 4A3IH 11ASA 3VR4A 1J5EQ 1L1OA 4QQBX 2ZT7A 1TWHH 1SYEA 1PYWD 5DLQE 2EYMA 4A75A 3HKZG 1USYA 1LT3D 2QGQA 2WB1B 3S1MH 3HXXA 1OTCA 3MEYA 3A54A 1JICA 3IG2A 1Q8KA 4TVAB 2C9OA 1LT6D 1NMGA 2NN6H 4QMGA 4DK0A 2K5QA 4P72C 1I4GA 5JVG3 5LMNQ 3A8KE 4LVJA 3I4MH 1I50B 4DR4L 1TR5A 1I4PA 2JA5G 3R2IA 4LNQA 3S2DB 4A3EG 4JBWA 2MP1A 5IYCH 3HOWG 3ERRA 3PIPA 5M3MB 2HIXA 4CDCC 2PZUA 4C3IG 4JI4L 1E1OA 3QO5A 1PFNA 2VQFQ 2Z4IA 4DF7A 2E2JB 4DAYB 4X3SA 2D2CC 1N36L 1GUGA 1BVSA 5I6YA 2F0VA 3AYHB 3OIQA 1PVOA 1Z9FA 4KN7C 2CJBA 4PHCA 2HDLA 5EKKA 1SE8A 2ZINA 1K83B 1QUQB 1BUVT 2IX0A 3I7FA 4IURA 3D4DA 1EWIA 1ADJA 3I4LA 2A8VA 5CV4A 2R7ZB 1NMFA 3RN2A 5M3FB 1IKMA 2K75A 4G4KA 2Q5IA 3Q8DA 2ENBA 3IKJA 3KJOA 3GTOB 3M3YB 2EY6A 3J7YW 1GOZA 2JA9A 1IXRA 1YNXA 4ZCKA 4CH5A 4J15A 4C2MH 1K8AC 2ZIOA 4PV1C 3T1YL 2MUYA 1UE5A 4RHRA 4GNXA 3TMEA 1Q7YC 1TIID 2R92G 5HGQA 1HA5A 2H5XA 2OCEA 2K14A 4P73A 3U9OA 2YU9B 4P3PA 2Q2HA 2OTJA 4A4IA 4RH6A 5C4XG 1NE3A 4IPGA 3NUCA 4DV5L 5M5YB 4CH6A 1O7YA 1WCMB 4HT4A 2NN6I 2JEBI 3HTZA 4DR2L 1YHBA 1XNQQ 4RQFA 3RLOA 4K5VA 3V8KA 2ZIMA 1Y14B 2K1BA 2NVTB 1WTHA 1HR0W 3S1RH 4B3TQ 1VQFA 1D5MC 2RCNA 3TP7A 1TY2A 1HC7A 1CQFA 5C3EH 1PH5A 5C52B 4C3JG 4OO1I 2UU9L 3PZCA 4HTHA 1HNXQ 1EY7A 2RDFA 1JQYD 4JC0A 4DK3C 3OTOL 1DCZA 5I9OA 1R4PB 4DAMA 1NR2A 1Q90A 1B50A 1VQ7A 4YY3L 4A3JH 3NBIA 2NVYH 2WACA 1WTXA 3MVVA 1O80A 3KJPA 1I3QH 4DNRB 1NJ5A 4YWKA 3I4NH 4YRMA 4DUYQ 1TWFH 1NJ1A 1TWCB 2I5LX 1B7YA 2N49A 2RQXA 3NTIA 2CIMA 3HY1A 3CW2C 1FGUA 1STHA 5JAVA 1CKNB 2A8EA 1XNRL 1HFNA 3I4MG 4MN3A 4JI2Q 3TS0A 4KMUC 3OIPA 4PQXA 3CC2A 3VA5A 1K8GA 1SERA 5IYCG 2R6GA 1JORA 3D6WA 3QOLA 4WORA 3FEWX 3X3MA 2K5WA 2EY2A 3WDNA 3F2CA 2J3LA 1KL9A 2QCPX 5IGFA 1O78A 3EQLC 1A3UA 1PTOH 2DGYA 4HN7A 2LXJA 1H9SA 4HR7B 4JI5Q 1S3OA 1ENAA 5EJWA 3T16A 3NTKA 2I5MX 2ZJQA 1EYDA 2F3WA 1VQAA 1SYGA 3GTLH 3GTPB 1GUTA 2ZJPA 1KLUD 1HXYD 2ZNIA 4YWLA 2E5AA 2PQAB 1Q46A 2EDGA 4ODGA 2VNUD 4HCSA 4IZ8A 1IHZA 4BBRH 2KQ3A 4X65L 3GTKH 1ET9A 2CH4A 2ZTCA 2JYOA 2CWAA 4TQUS 3W3SA 3ZJYC 5CYUA 1HPCA 2I4OA 2PMFA 2L5TA 1RTNA 4FO2A 2FMMA 3AQQA 3VBBA 4KJOA 3JAML 4L87A 3S1QB 1X56A 4GOPB 4A3KB 3HOUB 3KF8A 1SRYA 1F9QA 4B3ML 1YVCA 4B08A 1IW7C 3NQIA 1O7ZA 4A3MH 4KHPQ 1DYQA 4YRNA 4V190 2BA1A 3MEFA 2ARSA 2DEQA 3S15B 3U50C 1SNCA 3X3NA 1K8MA 2LMCB 1DD2A 4OEMB 4CH4A 3FPUB 5IGDA 1WTVA 4OX9L 5C3EG 4OHJA 2WP8J 3DWPA 3TZDA 4P71C 4WJWA 2BA0A 3SHLA 4R4IA 2KHIA 1PRTC 1X3QA 1DGSA 1L0XB 3C3LA 5LMNW 5C44H 2A69C 4A3JG 4YPFA 5EQ0A 4X66Q 2A6HD 4LFCL 1HA6A 5GAEC 2O5JC 1SEBD 3SXHA 5K5PA 1TWGB 4QJFA 4O2DA 3J80L 4GKJL 3HOZH 1KXLA 1IBKL 1BXTA 3UDGA 2UUCQ 1X2HA 4DV1L 2PW5A 4BWAA 3K57A 4HVCA 1NYQA 4LF4L 3KBGA 2DXUA 5M5WB 3REXA 1VQEA 5A2QE 4ZIBA 4HWRA 3QO2A 1MSHA 1KMNA 3QTCA 2RBMA 1VQDA 4CKEA 1K28A 1RHPA 2E2HB 2B2WA 1X3GA 1SYCA 3PF4A 4LVLA 2BE5C 2EJFA 5JJZA 2F0TA 5T1IA 1TT2A 1H9SB 2KECA 2L11A 4LMQD 1GUWA 4KQEA 1KTKA 2F0JA 5IGBA 1Z7NA 3GTJH 2KCNA 3PSIA 1H4SA 1R4QB 1OXTA 3C1EA 5CGKA 4A93B 4NP5A 1ENFA 1QVGA 1IYUA 4X3TA 4E6IA 2E74C 3PGZA 4KK7A 1H4TA 5LL6S 4K0KQ 5JPNC 3C2PA 1EFID 2F0MA 2NUCA 3PUWA 4BBRG 3DUZA 2MO0A 3UE0A 1BCPB 4HIDA 3QWNA 1KIXA 1VQZA 3JAMc 5CV9A 4RHSA 3A55A 3OWFA 1H9MA 2WAQB 1L1OC 1ATIA 4PMWA 3I8ZA 1TVXA 2JA6B 4AYBB 3KF8B 2B63B 1K3BC 4A3IB 4U68A 1G8ZD 3Q0AA 3R2TA 3BVMA 3KUPA 4GLAC 1I50H 3M85A 3EN2A 5CV8A 2MQHA 4JI7Q 3S2DH 4A3MG 5M3MH 1UE1A 4QIWB 2KOLA 1ICWA 2DXTA 3S1MB 1QJOA 2OEOA 4DV0Q 1W2BA 3BYYB 4O1NA 3FRPB 1GHKA 1EFWA 4XTVA 4IUTA 3LGJA 1WU7A 4DV7L 1BR9A 4JBMA 1TS4A 1K83H 3N52A 1IYVA 4DGZA 1LTSD 2R7ZH 5CMDA 2CQAA 4KKUA 5C44G 1NTGA 2GA4B 3J80c 5M3FH 1L2FA 1F9PA 4IO9A 1EIYA 2Q2UA 1G5IA 3GTOH 1G291 4HSVA 2F0QA 3M3YH 1G2TA 1NCVA 3F1ZA 2A68D 2Y0SB 3IFTA 1SROA 5LMUL 3HOZG 2QW7A 1G91A 1KNEA 2A74C 1VQLA 4F7XA 3HG9A 3TDQA 3A5ZB 2Q2TA 2YU9H 1VS0A 3K0XA 1XPUA 1KAWA 3OOCA 4DN4M 5M5YH 4CJ1B 1CTMA 1WCMH 3PCOB 1EQQA 2I4LA 2G9DA 2G5DA 4GNXC 3EJIA 4APVA 2RVLA 1S4ZA 4P73C 2RHQA 1ZYRC 1E2VA 4X64L 1RDPD 2X6LA 3GO5A 2NVTH 1I5FA 2TMPA 3E9HA 4H02A 4NXNQ 4ZTUB 2JA7G 2I4MA 3K8AA 2IX3A 2E3CA 2WB1E 3MXPA 1Z6HA 5IE8A 3CCLA 1E0BA 1SLJA 1PYBA 1Y8OB 4YRFA 1ESFA 3RZOB 3AU7A 3K5MA 1MJEA 1ET6A 3GTMB 1JOOA 4OIKA 2B8FA 1SBBB 1I4HA 4XXEA 1MIUA 2HCCA 2NTTA 4AIMA 3STBD 4FF1A 3S1NB 3DWAA 4YRCA 2WB1G 4IOAA 1XMOL 3ND8A 4FF3A 3IALA 1TWCH 2UXDL 1W6JA 2Q7GA 4DR7L 3ER0A 5IWAL 1QB5D 4B3RQ 1HNZL 1QOHA 1MI2A 4JBKA 5C5MA 3PUXA 2F52A 2K28A 3MFGA 4GZYC 1RF2D 4UP9A 1Y8NB 5M3MG 5EBCA 4AQYL 1A8VA 4QB4A 2NVQB 3SGIA 1VQBA 3I4NB 3IRBA 4RKBA 4YRLA 1QF6A 2E76C 2IT1A 1WLEA 1BQQT 3R8BA 4DAPA 2ZZEA 1SXTA 2HT1A 4P75A 3GTPH 4YROA 1Q82C 2BCOA 1A3TA 2OT2A 1N32Q 4DR6Q 1SDFA 4B9XA 5M3FG 3HXWA 5FLXE 4MZ9A 1S5FD 2F0WA 3S9WA 1OXXK 4QGUA 1S5BD 5FOBB 3ULPA 4UHVA 1VQKA 1PTOD 1KRTA 3W1BA 2DKGA 1EY8A 3B6YA 2P5ZX 3OD1A 1WD1A 1QE6A 2QEJC 4JG2A 3VQVA 1WD0A 3S1QH 2E41A 4LFAQ 3HOUH 1WCMG 5E7NA 3TP5A 2RHQB 2UXBL 1QVCA 1PTOF 1IBML 5IYBH 3EFXD 4XT1B 3S15H 4F8MA 4YRJA 2PMEA 3V2TA 1EU3A 5EKLA 3K0YA 4CKBA 1HTPA 2K52A 3MXGA 2E65A 4KJNA 1GD7A 2EYLA 4R4OA 2O5IC 2F0SA 2HHHL 2LSSA 2FINB 5HURA 3G71A 3I91A 4JI3Q 4LW1A 1V1PA 1WTPA 1EQTA 1EY0A 4L5SA 4ZKCB 1D1KA 3VYUA 4H2TA 3ICEA 2JXMB 5JOBA 4KHZA 1WTQA 1SAPA 4DKAC 1J5EL 2DJZA 2EZVA 4RWSC 2F0IA 3HXYA 4JV5Q 1TWGH 3HFZA 4K5WA 5FLMH 1PLFA 3NELA 4OONA 4P2CB 4CKCA 2MGSA 4DK1A 1NJ2A 4LK1C 2VUMH 5M5WH 3BG3A 1K73C 4BWGB 3KLRA 1MJCA 4FYDA 5LMNL 1Y8PB 5ELFA 2E2HH 1HFGA 1GVPA 5CBEE 1R9TB 4IFDJ 2DTIA 5C0XJ 4DXGA 4CJ0B 1CSPA 3NHHA 4YRTA 2ZT5A 2DJFC 3A56A 2VQFL 2B39A 3TREA 1B3AA 3L3OC 4JK1C 3S2HB 3RF1A 3H6MA 3HOXB 2ZM6Q 5GADC 3A7AA 4HAEA 1GKHA 1QILA 4H2UA 1X2GA 2P5IA 1RODA 1HZAA 2EJFC 2CCZA 2VZAA 4OELB 3P8VA 2AUKA 5C4JB 3K5LA 2WKDA 4A93H 1EOVA 1TS5A 5DAUA 3MTSA 1AN8A 3CP0A 3IKMB 1X3FA 2ZCEA 3H0GB 2FHTA 1PYSA 2A1AA 1NAPA 1FGBD 3I4OA 4ME5A 3VR5A 5IP7H 3Q22A 3HXVA 4B3SQ 2G4CA 1TKWB 2RSNA 4DV6L 2RDGA 3MF2A 3K80C 4JI8Q 1C7YA 3A8JE 3AMUA 4K8IA 1YNND 3HOYB 2SOBA 3K7AB 1HNWQ 1B70B 1XTCD 1DXMA 3K59A 2JA6H 1CKMA 2B63H 1M8AA 1UE6A 3OWEB 3RUZA 2OTLA 2DTHA 2HNIA 5GAGC 2DNEA 4A3KG 3HOUG 3TS2A 3URYA 4IPDA 1W66A 1XNQL 3S14B 2L0CA 1DJRD 1FR3A 3QB3A 3J7A5 1JR0D 1SMYD 4TWAA 5IYBG 3M7GA 2D0PA 1U0LA 3J7AF 3WOEA 1SYBA 5LHY1 4B3TL 1JE4A 3E3XA 1V8QA 5I2YA 5EPJA 1QZGA 4K86A 2B2UC 4I7ZC 1LTGD 1ZEQX 4X6AH 4OLFA 4YREA 3LX0A 1E7ZA 4GN3B 4HJAA 1HNXL 2A6EC 2EYPA 2QILA 3ERQA 4R4TA 3OMCA 3T1HL 1CZWA 4I65A 4KY6A 1V1OA 1DOMA 1PRTB 4PMBA 1EYGA 4DV3Q 3PF5A 4JI1Q 3HFZB 4K87A 4X62Q 1BBXC 1VQPA 4OO1H 3E6ZX 2X6GA 5FLMG 1PH3A 4BXXH 4BY1B 1VQNA 2D62A 4X3UA 2ZT6A 3A32A 3CC7A 4DUYL 4NB3A 4DNIA 4IFDH 1D8LA 1PH1A 4JW0A 5C0XH 1YITA 1EQVA 4XTWA 2KENA 3HEJA 3MZ5A 4YHHQ 3W5OA 1O7IA 1F2LA 4DQ2A 4IJLA 2FFKB 2F0PA 4A3DH 4JI2L 4WJ4A 4RKLA 2IY5A 3TEHB 1QNUA 1JWSD 1HCZA 1Y1WB 3CPWA 4DFAA 5CC4A 1N34Q 4A3GB 2FMCA 3CKIB 4XU0A 1QNKA 2I4NA 1YFSA 3VYTA 3P7JA 3MEHA 2N88A 2XWJB 2YTXA 1X3PA 4J1MA 1RTOA 4A93G 2WAQE 3RZOH 2C35B 3GTMH 4YDQA 3J81i 4GKKQ 1YFTA 4AYBE 5IP7G 1F2ZA 2E8GA 3OHXC 5C5LA 2R61A 3E0EA 1A2UA 1QE0A 4EO4A 1SE4A 1VQGA 3S1NH 4TQDA 3VQYA 1PZID 2NZHA 4QIWE 2PZWA 3FHWA 1Q8IA 2WAQG 2AQ3B 1E1TA 1BKBA 1EEID 4CDDC 4EGVA 2JA6G 3OMGA 1A63A 4AYBG 1SFOH 3GDEA 2B63G 4A3IG 1I6HB 2KCTA 1EYCA 1L1OB 2BDNA 4IFDI 4TSSA 3TEGA 4KR3A 5C0XI 1LM0A 1MKHA 2B2VA 1AZPA 5IY0A 4L5TA 1F77A 4KHPL 1Z47A 3CC4A 2XRQD 2F4VQ 2NVQH 3BDLA 2D9UA 4KV6A 3U4VA 1UWVA 1SETA 5KYLA 4TRDA 3L7ZC 2AHOB 1U4PA 3NWTA 2SEBD 4XEMA 2NN6G 3FPPA 2Y0SE 2BDOA 2CW0D 3T13A 3PO2B 2R7DA 3P8YA 3UGQA 3IL8A 5J1ZA 2KCCA 5L37A 1PV4A 3F8TA 2N55A 3VDYA 5IT9L 1UEBA 4OO1G 1F2YA 5D14A 4P75C 1SN8A 3KLWA 3SK4A 1YBYA 2Y0SG 3W2DA 5J39A 3CCVA 3CCMA 4G7ZC 1CZGA 4BXXG 3RACA 2K05A 3NBHA 5EAYA 2ODRD 1P16A 3RGLA 1Q12A 2UUCL 3K5NA 4IFDG 2FXQA 1A15A 5C0XG 3K6OA 4AH6A 5I6WA 3MC0B 4JYAL 2DZ9A 3QNEA 3KLSA 4OWXB 4KKSA 1CI3M 4A3FB 4FDBA 1XWEA 2NZOA 1OO9B 1TS3A 3M9BA 2LY7A 3ONAB 2RDHA 4GNXB 1LTAD 4TVWA 3W1GA 4L8JA 2JSOA 4L6TB 4XQQA 3U4ZA 2DY8A 1JC7A 2E75C 1NNHA 2NYZD 4OIJA 4YRIA 4HWSA 4HJ7A 1HTTA 5T1GA 4XT3B 1G2SA 2RHSA 3GV6A 2R7FA 1U4LA 4XTUA 1HQRD 3VYSA 3BDOA 4RMFA 4LF6Q 4PZ7A 4LF8Q 4JI0Q 2I07B 2IJ0A 3QOJA 4K0KL 3RKYA 1HQMC 1SE3A 3ULLA 2CH4W 5DM73 2B8GA 2KEDA 3RR5A 3V7SA 3QJYA 1H95A 2AQ1B 5DNFA 3V96A 3CMAA 2F0GA 4H2VA 1PFSA 3FKIB 1CK1A 3M4OB 3RL6A 4BA2I 3UDIA 1R9TH 4ZUJA 2CGHA 1YJWA 4JI7L 1RCVD 5HY6A 3KLSX 1A3VA 4HWPA 3I4NG 1B7YB 1HTLD 1UUPA 4C1NI 4XTCS 2MNAA 2MJ8A 2JQOA 1UEAB 1V9PA 3S2HH 1SNQA 3HOXH 2PNRC 1XNRQ 3UGTA 1J8IA 2VUMB 1P8LA 3ND9A 5AJ3L 4OWWB 4KD3A 5LL6X 3F2DA 4FVMA 5C4JH 2QHVA 5IT9c 1YNJD 3H0GH 2UXCQ 4H7BA 3QO8A 3H09A 4DU9A 2UUBQ 4PZ6A 1AFPA 1LUZA 1CHPD 1ONLA 2PPBC 3E5SA 3HP3A 3DLLA 3HRIA 3A7LA 3NBHB 1CFMA 1X9NA 2MPMA 4LFBQ 1XMQQ 1LO5D 2RA4A 4G7OC 2F0DA 4IPHA 3HOYH 1T5XD 3A31A 1UNSA 4XTYA 1F9SA 3K7AH 1I94Q 1B4OA 3T53B 4XU2A 4R4QA 2DN8A 3BZDB 3F2UA 4FNFA 1MGSA 4YRRA 2IW3A 3L0OA 1K3RA 4R1JA 1EY9A 1MBYA 3M4YA 3D0FA 3S14H 2EE1A 2HIVA 4JCVE 1CUKA 5ELNA 2XSCA 3HGBA 1BCPD 2R92B 1SRUA 3ZYYX 4DV4Q 5IT9E 4RQEA 3G4SA 4XTXA 1KOGA 2CVRA 1ILPA 4NXNL 3SDZA 5E1FA 4LF5Q 1AE3A 3NQTA 2E10A 1EYAA 2DJGC 4DR1Q 4HCEA 1SNPA 3L9AX 4FP5D 3MXNA 1T9HA 2B2UA 1CT1D 5C4HA 1STYA 4DXFA 1GGMA 4WRDA 3L2PA 4YRGA 1BCPF 1WOCA 4QCLA 2M00A 3D6CA 1RL2A 3G7LA 5DEHA 2JE6I 4V0BA 1S72A 1WFQA 4BY1H 3NXWA 5EGTA 3Q6SA 3N6RA 4G84A 4FF4A 5KIXA 1GO3E 3RIRA 3D4WA 4IPCA 4YIJA 4HA8A 4B3RL 4HWTA 3JAME 2IHEA 4OWTB 1HXDA 2F0UA 1RD9D 2F3VA 3NSWA 4FXGC 4ID6A 3V05A 1B76A 4LVKA 2HD3A 2K5HA 1IKLA 4KY7A 2JK8A 1Y1WH 1VDZA 4LVIA 2A73B 2B2YC 3FDTA 4A3GH 1SJHD 1SESA 4H2WA 2K5NA 1H9RA 3G48A 2AMCA 3HOXG 3I73A 2F0NA 4YRKA 4YWMA 1G5HA 3OYYA 1PMRA 3NE5B 4LF7Q 2ZXRA 1Z7TA 3EA6A 2DU5A 1NY4A 3E9IA 3K5OA 4A3DB 3HXUA 1YI2A 4U673 1EQRA 3H0GG 4IOCA 1ML0D 1N32L 1QWYA 1C8CA 4DR6L 1PZKD 3Q24A 2IWHA 3ITPA 1EZ8A 1YJNA 1VQ6A 3PIO3 5CV7A 3RMHA 1TWAB 2SNMA 4NCXA 1V1QA 4ZUIA 3KF6A 2LS01 1F9RA 4N9TA 3J80E 3HOYG 2Z6BA 1PA6A 1I4RA 4R4CA 1Q81C 2Q8IB 4CS3A 1N33Q 1I6HH 4CBVA 3QIAA 3BDCA 1EVLA 1GM5A 4LFAL 1QVFA 5BN4A 2R93H 1JE5A 1B8AA 1EY5A 3U9SA 3DEPA 4BY7B 5E3IA 1WNLA 2OXPA 2ARTA 1JB3A 2XIWA 4H2XA 2E1HA 2B2VC 3REUA 1V43A 2PCFB 2XVSA 3DMUA 1SFOB 3PO3H 1FD7D 3MXNB 1VQ4A 3A5YA 4JI3L 2NVXB 3PO2H 4IUPA 3CRKC 1IL8A 4TTVA 1M90C 1JJGA 4RFBA 1BIAA 3RLNA 4ZKBB 2ES2A 3R07A 4JV5L 3WOFA 3HFVA 3T56B 2WINB 3V8JA 3EFRA 5AFWA 3KOJA 3TSSA 2DTOA 3ICAA 5KRUA 2I0QA 2A6HC 2AQ2B 2ASBA 2K03A 5IGGA 4YP0A 4A76A 4XDXA 2KVMA 2AWNA 2R7ZG 1EIYB 3J81L 2EWNA 1D5XC 3VR6A 1X65A 3GTGB 1QG7A 1D2BA 3QG1A 4F88A 4UP7A 4A3FH 2EYOA 1UE7A 4G7HC 2QKIC 1Y1WG 5IYDH 4FXKC 2HDMA 1JJCA 5JEAJ 2LXKA 4A3GG 2F0OA 2LKVA 3GD7A 2ZM6L 4PNYA 5FO8B 1KRSA 1SR3A 1D6EC 3V7RA 2GVAA 1SSOA 3RKWA 1Q1EA 1GJXA 2Q8TA 5C51B 2ZR2A 1PH8A 4H0LC 1I4XA 1VQ8A 4B3SL 1IYJB 4KLKA 2ZZGA 5ELEA 1K0SA 2C7IA 2ZGWA 2JEAI 3LC0A 3PIOA 3GV3A 3H94A 1JMCA 4JI8L 3K7UC 2CHBD 3V8LA 4RGNA 1E2ZA 3CMQA 2ALYA 1B1ZA 2ZT8A 1FVIA 4NPSA 3PUZA 4MNOA 5E4WC 1HNWL 2R3ZA 4A3BB 1ILQA 3FKIH 2DQ0A 5CV6A 5FO9B 2ID0A 3M4OH 1HR0Q 3E0JA 3CCUA 1EWHA 1Y1VB 5J3BA 5IP9H 4LF9Q 1K8OA 3G1ZA 1XMOQ 3A7RA 1IBLQ 2SDFA 2L1BA 3LNNA 1TS2A 5TSSA 1WJJA 4EQ5A 4X3KA 4BBSB 3BFMA 4WF2A 3J81j 1CQVA 3IKLA 1SMXA 2A19A 3EROA 1KMMA 4B9WA 1WTWA 1OXUA 4XYOA 1WI5A 1ADYA 1B53A 1M4VA 2PO4A 4ZYSA 1XJVA 4TVAA 2OF1A 3V7CA 2EJGA 1FNUA 2AUJD 1NYRA 3IFDA 5I9PA 4C1NK 4A3EH 1S5ED 1A62A 3AFPA 3RZDB 3PO2G 2VXWA 3BJUA 3A5UA 5KGUA 3EVQA 4H44C 1KDBA 1BF4A 2M2LA 1YFRA 1CM9A 3DHQA 4DV3L 4JI1L 2IX1A 1LTLA 4LJZC 5J22A 3VA7A 4X62L 4DAYA 1X54A 2F0KA 3SE0A 5BN3A 4I7AA 1STEA 4RA8A 1EZ6A 1SJED 1VF5C 3I72A 1ASZA 1WPYA 4YRQA 2VQEQ 3M4PA 2O2LD 3J81c 2EY1A 5K1PA 3SK8A 1BDOA 4RG1A 1PH6A 2ZXPA 2ZTEA 4YHHL 2A68C 4CS4A 5JEAH 3WWVA 1BIBA 1HZCA 1TXYA 1YHQA 2EY5A 4A3FG 4UDUC 1XX8A 4IUQA 3K58A 2EQSA 2PQEA 5IYDG 4IQZA 1PDQA 2R92H 1HZBA 3RLFA 3VR3A 3R93A 1J5WA 1N34L 2OQKA 2G9HD 5C4XH 4Q5VA 4DR5Q 4XIGS 3DSQA 1KDAA 4F87A 3LWUA 1JT8A 3U58A 4KR2A 5EBDA 2OWOA 1VQIA 4HIOA 2P0LA 1HZ9A 1KABA 2NBFA 2ZXOA 3D8GA 1NUCA 1ZXTA 1VCIA 3FMCA 5CR3A 1G6ZA 4GKKL 3G6EA 3CQZB 2CJAA 1IW7D 2Q5HA 2F0EA 2J4XA 1WTRA 2FYKA 1PFBA 5C53B 2ALYB 5HGTA 5M5XB 1RKNA 2QEXA 3LSSA 1TQOA 1TU2B 4IUNA 1GXDC 1V1PB 2K50A 1X3EA 5ELDA 5D65A 2VW9A 4POGA 1FJGQ 2K7VA 3STBC 3BZKA 4LAAA 2GVBA 3FKIG 1X6OA 4EQNA 4Y7NB 1LTID 4J8QA 1X32A 2ZJRA 2ICIA 1N9WA 3CRLC 3I70A 1PRTD 5GAHC 1DOLA 5IP9G 2A69D 1KLGD 5IGCA 4H2SA 1BNZA 1JB7A 3VR2A 3Q23A 5BR8Q 2F4VL 4P3OA 2WIIB 4RCOA 2UUAQ 3T51B 1CA5A 4DR3Q 1DONA 1DM0B 3NTHA 3NETA 4TVYA 1S5CD 1TY0A 3OSOA 2EOTA 4DV2Q 4DK6C 4HWOA 2VUMG 4YCWA 2E5LQ 3MHBA 1CKNA 1NR4A 4QY7A 5GROA 2B2YA 3PQIA 4K6LA 4NDXA 1PRTF 2DZCA 1STGA 4PMCA 1EU4A 1PH9A 1B2TA 5I4DA 1UAPA 3GP7A 2C8MA 2N78A 5I2XA 4KHVA 4C3HB 2BE5D 3A7AB 4GS3A 1NNXA 1EIGA 1TWAH 4JBJA 4NXMQ 2PYKA 1D1IA 3RN5A 4HEDA 4XQNA 4JOIC 4JI5L 3NK9A 1STNA 2J7ZA 4JI6Q 3FVQA 3I2ZA 5ISRA 1PYSB 1HH2P 4DUZQ 3UDFA 4EX5A 1AE2A 4FXDA 3HOVB 4FF2A 1K0RA 1PTOC 4IUVA 4DV6Q 2Z6KC 1YB3A 2Q7HA 5JEAG 1D7QA 12ASA 1CA6A 3KBXA 4CHTB 3A74A 4ZAIA 2PQAA 5FJ8H 5H1SE 4HJ8A 2CJ9A 1FL0A 4BY7H 5KNCA 3CCJA 2AWOA 2KEEA 3I90A 2K04A 2FJ2A 2PI2A 2H1EA 2WFWA 4G57A 1YIJA 4K2LA 3NWSA 2X69A 5E4XA 2N8NA 3RKXA 2PW7A 1LTBD 5IGEA 3QO7A 1E22A 5K36H 1DOKA 4GOPA 2EL9A 5KNBA 2NVXH 1GUNA 3NPPA 2K33A 1I4QA 4A3LH 2R93B 2MFIA 2EAYA 1Q1BA 4LF6L 1EVKA 3MFYA 4LF8L 2ZTGA 2AKWA 4IALA 4JI0L 2Z4HA 5A2QL 4TQFA 1U4RA 4DR4Q 1A0IA 2E2IB 3T4AC 3T1HQ 3PO3B 5IODA 1E3PA 4P74A 4K6DA 4RGOS 4JI4Q 4MTNA 2YTVA 2XRSD 5E3FA 1N36Q 2OQ0A 3GTGH 1C48A 4X66L 3DWQA 3MF1A 3ULJA 1J6QA 4S3SA 2B2TA 2KHJA 4KI0A 1CSQA 2ATWA 1KAAA 2DUDA 3BU2A 3H15A 3KDFA 3I3CA 4A3CH 2LFNA 1JWMD 4Q0FA 1IZ6A 1NBWA 1WYDA 2NWGA 2B3GA 1WQ7A 1LTTD 1T5EA 2EYHA 2IY5B 3CHBD 3OPOA 4QF4A 4A3DG 1NSNS 4NKLA 1EY6A 5EPKA 1ESRA 2ZT9C 2UXCL 4HMJA 1RJTA 4K2KA 3CMEA 2UUBL 3T1YQ 2YV5A 2VY3A 1EEFD 1AEXA 3H91A 3HXZA 5ELOA 2RF4A 1OXVA 3AEVA 3TQYA 1KHIA 4ILWA 1W3SA 4MIUA 2F0HA 1ZYRD 4PG3A 2H4OA 3BS1A 1NJ8A 1GHJA 2EIFA 3SVMA 4DV5Q 3FJPA 4POFA 2PMZB 4LFBL 2L55A 1XMQL 2HUGA 4DR2Q 1NJIC 1I94L 1PFMA 1YEZA 4A3BH 5JJLA 4WJ3M 5K1XA 1BBWA 2N3SA 2JA8B 2QA4A 1Y1VH 1YNNC 2C5CA 5FJ8G 1LTRD 1II3A 1L0WA 4ULLA 2XTIA 4BBSH 4BY7G 2UU9Q 1MD2D 2NS6A 3A0JA 3OTOQ 1JOKA 1DZ1A 2CWPA 4DV4L 2EXZA 1U9RA 4LVMA 3P1HA 1E24A 2HQEA 3TN2A 4LF5L 4YY3Q 5IIFA 4CDFC 1SMYC 1WTOA 3UE1A 1VQJA 5K36G 2M9VA 4DR1L 3RZDH 2CQOA 3HKZB 3L4GA 4A3LG 2ZNJA 2AKWB 4HSPA 1JJ2A 4LUZA 2EJGC 3F2BA 3BZCA 4R8NA 3CCQA 1BO0A 4Z9CB 5KYIA 5A35A 2ICEC 3SK5A 4IUUA 2ZZFA 4DV0L 3UH0A 4GN5A 2NTSA 3EFSA 4K14A 3MWYW 4N9PA 1ENCA 5C3WA 2JA5B 4LNSA 4CDEC 4L5RC 3EIVA 3K81C 4A3EB 3C46A 4J6HA 3HOWB 3VQXA 1VQOA 2F4IA 5D3IB 4C3IB 2BH2A 1EUJA 3NENA 1SE2A 4K88A 3TRZA 3HS0C 2K5DA 5GQOA 1H4VB 2EXDA 2XNAC 2L12A 3S16B 3BVZA 1O7LA 2KHSA 1VMCA 4O0AA 3KDFB 4UY8C 4YRPA 1STAA 2K32A 4A3CG 4JYAQ 3GQBA 3A5ZA 3R3OA 3GTQH 3CXCA 3P20A 1KNAA 3I56A 4XTZA 4IJHA 4LF7L 1EOTA 4Q15A 2Z0SA 3PCOA 3J7AV 3CF5A 3S17B 4BA1I 2KA7A 2KUMA 4X65Q 1LYLA 2HCIA 1H9KA 4UPAA 3CQZH 2JA7H 2IL8A 1B9NA 4LUVA 5CORA 3D4RA 1L0YB 4M8AA 1X01A 4R9WA 3DM1A 5M5XH 5C4XB 4YRSA 1JOQA 1VF7A 1Z7MA 2PZTA 1HHVA 1GUOA 2XGTA 4B3MQ 2Z9HA 5EPLA 3W3AA 4DPGA 5IOCA 2K6AA 2RHSB 5FO7B 1HUNA 3TBIB 4A3BG 1N33L 3CCSA 2DQ3A 4XEOA 4Y7NH 1OXSC 1VQ9A 1H4QA 2EYFA 1Y1VG 1BOSA 4OX9Q 3AFQA 1AZQA 1EIHA 2WV6D 4BBSG 3BYTB 2Q8RE 2QDLA 4C3JB 3P75A 3VQWA 2E2DC 2MO1A 4RGTA 1USYC 5NUCA 1E2WA 5FLXL 2V1CC 3PUVA 1PH4A 4N8X1 4LFCQ 3L4GB 1QZHA 2E64A 2Z8LA 1TWHB 1LACA 1D5ZC 4P72A 4YCUA 1JWUD 5C6AA 3RD4A 2VS1A 4GKJQ 3PV0A 1IBKQ 2E2JH 1EL0A 3C1FA 1PH2A 5C3XA 4DV1Q 2KBNA 4LF4Q 2CW0C 4LUOA 3D31A 2F3IA 4MTKA
chains in the Genus database with same CATH topology
4C3HH 5AJ3Q 2BH8A 1KC8C 1XTDA 4WI1A 4G85A 1KD1C 3A7UA 3HOVH 4JOIA 4HJ5A 2ODRC 3I55A 3HY0A 4PZ8A 2B29A 2K5VA 2Z6KA 3CD6A 4ALPA 2CFMA 4P3NA 3PUYA 1XPOA 2ARUA 1PH7A 1RIQA 2J3MA 4XU3A 4X5OA 5KNNA 4CH3A 2GN5A 3KYHC 3CCEA 4RDXA 3J7ZC 2HQLA 2DVEA 4GLXA 1K9MC 2ZTDA 3HRKA 4HIKA 2EJ9A 4GOPC 1YZ6A 1VQCA 2ZR3A 2E2IH 3DM3A 1C0AA 1C9OA 2QHUA 3S24A 1BBUA 1HR0L 4YYEA 3CAMA 4LF9L 2VL6A 4P74C 1IBLL 5FLXc 4DV7Q 2Q2IA 4ZTZB 4BY1G 2JJQA 3JAMi 4XU1A 3UFGA 4GN4B 2QHTA 2CKZB 1KQSA 5LMUQ 1X55A 1Q86C 2QHSA 2AMCB 3ERSX 1CKOA 3JC66 3LSQA 2VQEL 1EIFA 1NJ6A 2ZXFA 3TUPA 3WQZA 3L1AA 3P8TA 3HOVG 4X64Q 4HJ9A 1XPRA 2JA8H 4QL5A 3M4QA 3KF6B 3J80i 3L2ZA 1AH9A 4GLVB 4E51A 5JJIA 1B70A 1G51A 3FP9A 4DR5L 2PNHA 3RNUA 2IHFA 4A3KH 1YJ9A 1VQHA 2R93G 2I5HA 1S40A 1M1KC 3H3VH 2UXDQ 4OXPA 4DR7Q 4H2XB 5F5WA 2KCMA 5IWAQ 1HNZQ 4Y52H 4UP8A 3MQZA 2JA5H 3HKSA 3PO3G 2YTYA 1FJGL 5JJKA 1G6PA 3HOWH 4AQYQ 4P71A 4C3IH 1VQMA 1HJPA 3NEMA 2DU7A 4BW9A 3S16H 5BR8L 2UUAL 4HIMA 4DR3L 4L5QA 3M7NA 1WQWA 2DDZA 1QUQA 4DV2L 3CPFA 2E5LL 2PMZE 4OP0A 1YHAA 3CCRA 3TEHA 1FYFA 4YCVA 3S17H 3EBEA 1JJCB 1VQ5A 2Q7EA 4NXML 3H3VI 4H2YA 2L15A 1YGBA 1ASYA 1U5KA 2PI2E 1IL2A 2UXBQ 4JI6L 4CS2A 4DUZL 4LWCA 1IBMQ 2YYZA 4Q6GA 2JA8G 2D0OA 3OW2A 2K4KA 1N8RC 3HKZE 4ME3A 3KFUA 2HHHQ 4C3JH 3RUXA 1RIPA 3UDXA 4A3IH 11ASA 1J5EQ 1L1OA 4QQBX 2ZT7A 1TWHH 5DLQE 4A75A 3HKZG 1USYA 2QGQA 3HXXA 3S1MH 1OTCA 3MEYA 3IG2A 1Q8KA 4TVAB 1NMGA 4P72C 5LMNQ 4LVJA 3I4MH 4DR4L 2JA5G 4LNQA 4A3EG 4JBWA 5IYCH 3HOWG 3ERRA 3PIPA 2HIXA 4JI4L 1E1OA 3QO5A 2VQFQ 4DAYB 1N36L 1BVSA 3AYHB 1PVOA 1Z9FA 2CJBA 4PHCA 1SE8A 2ZINA 1QUQB 2IX0A 3I7FA 1EWIA 1ADJA 2A8VA 1NMFA 3RN2A 2K75A 2Q5IA 3Q8DA 3KJOA 2JA9A 1IXRA 1YNXA 4CH5A 4J15A 4C2MH 1K8AC 2ZIOA 3T1YL 1UE5A 4GNXA 1Q7YC 2R92G 5HGQA 2H5XA 2OCEA 2K14A 4P73A 4P3PA 2Q2HA 2OTJA 4A4IA 5C4XG 1NE3A 4IPGA 4DV5L 4CH6A 4HT4A 2NN6I 2JEBI 3HTZA 4DR2L 1YHBA 1XNQQ 4RQFA 3RLOA 3V8KA 2ZIMA 1Y14B 1HR0W 3S1RH 4B3TQ 1VQFA 2RCNA 1HC7A 5C3EH 1PH5A 5C52B 4OO1I 3PZCA 2UU9L 1HNXQ 4DK3C 4JC0A 3OTOL 4DAMA 1VQ7A 4YY3L 4A3JH 2NVYH 3KJPA 1I3QH 1NJ5A 4YWKA 3I4NH 4YRMA 4DUYQ 1TWFH 1NJ1A 2I5LX 1B7YA 2N49A 2CIMA 3HY1A 3CW2C 1FGUA 2A8EA 1CKNB 1XNRL 3I4MG 4JI2Q 3TS0A 3CC2A 1K8GA 1SERA 5IYCG 2R6GA 3F2CA 2J3LA 1KL9A 2DGYA 2LXJA 4JI5Q 1S3OA 2I5MX 2ZJQA 1VQAA 3GTLH 2ZJPA 2ZNIA 4YWLA 2E5AA 2PQAB 1Q46A 2VNUD 4BBRH 4X65L 3GTKH 2ZTCA 3W3SA 4TQUS 2CWAA 3ZJYC 2I4OA 2PMFA 3AQQA 3VBBA 4L87A 1X56A 4GOPB 1SRYA 4B3ML 1YVCA 4A3MH 4KHPQ 4YRNA 2BA1A 3MEFA 2ARSA 2DEQA 3U50C 4CH4A 4OX9L 5C3EG 2WP8J 4P71C 2BA0A 4R4IA 2KHIA 1DGSA 5LMNW 5C44H 4A3JG 4YPFA 4X66Q 4LFCL 5GAEC 4QJFA 4O2DA 4GKJL 3HOZH 1KXLA 1IBKL 3UDGA 2UUCQ 1X2HA 4DV1L 4BWAA 4HVCA 1NYQA 4LF4L 2DXUA 3REXA 1VQEA 4ZIBA 4HWRA 1KMNA 3QTCA 1VQDA 1X3GA 3PF4A 4LVLA 2EJFA 4KQEA 1Z7NA 3GTJH 3PSIA 1H4SA 1OXTA 1QVGA 3PGZA 1H4TA 4K0KQ 4BBRG 3PUWA 2MO0A 3UE0A 4HIDA 1VQZA 1KIXA 3JAMc 1L1OC 1ATIA 4PMWA 3KF8B 4GLAC 1I50H 3M85A 3EN2A 3S2DH 2MQHA 4JI7Q 4A3MG 5M3MH 1UE1A 2DXTA 4DV0Q 1W2BA 1EFWA 4XTVA 3LGJA 1WU7A 4DV7L 4JBMA 1K83H 2R7ZH 5C44G 1NTGA 3J80c 5M3FH 1L2FA 4IO9A 1EIYA 2Q2UA 1G5IA 3GTOH 1G291 3M3YH 3F1ZA 5LMUL 1SROA 3HOZG 1VQLA 3A5ZB 2Q2TA 2YU9H 1VS0A 3K0XA 1XPUA 1KAWA 5M5YH 1WCMH 3PCOB 1EQQA 2I4LA 4GNXC 4APVA 4P73C 2RHQA 4X64L 2NVTH 3GO5A 1I5FA 3E9HA 4H02A 4NXNQ 4ZTUB 2JA7G 2I4MA 3K8AA 2E3CA 2WB1E 5IE8A 3CCLA 1SLJA 1PYBA 4YRFA 1MJEA 1MIUA 4AIMA 3STBD 4YRCA 2WB1G 4IOAA 1XMOL 3IALA 1TWCH 2UXDL 2Q7GA 4DR7L 3ER0A 5IWAL 4B3RQ 1HNZL 4JBKA 3PUXA 2F52A 4UP9A 5M3MG 4AQYL 1A8VA 3SGIA 1VQBA 3IRBA 4YRLA 1QF6A 2IT1A 1WLEA 2ZZEA 2HT1A 4P75A 3GTPH 4YROA 1Q82C 1N32Q 4DR6Q 5M3FG 3HXWA 4MZ9A 1OXXK 4QGUA 3ULPA 1VQKA 3W1BA 1KRTA 2DKGA 3B6YA 3OD1A 4JG2A 3VQVA 3S1QH 2E41A 4LFAQ 3HOUH 1WCMG 5E7NA 2RHQB 2UXBL 1QVCA 1IBML 5IYBH 3S15H 4YRJA 2PMEA 2K52A 2E65A 1GD7A 4R4OA 2HHHL 2LSSA 3G71A 4JI3Q 4LW1A 4L5SA 4H2TA 3ICEA 1J5EL 4KHZA 2DJZA 4DKAC 3HXYA 4JV5Q 1TWGH 3HFZA 5FLMH 3NELA 4OONA 1NJ2A 2VUMH 5M5WH 1K73C 1MJCA 5LMNL 2E2HH 4IFDJ 1GVPA 2DTIA 5C0XJ 1CSPA 4YRTA 2ZT5A 2VQFL 3TREA 3RF1A 2ZM6Q 5GADC 3A7AA 1GKHA 4H2UA 1X2GA 2P5IA 1HZAA 2CCZA 2VZAA 3P8VA 4A93H 1EOVA 3CP0A 3IKMB 1X3FA 2ZCEA 1PYSA 2A1AA 3I4OA 5IP7H 3HXVA 4B3SQ 2G4CA 4DV6L 3MF2A 3K80C 4JI8Q 1C7YA 1HNWQ 1B70B 2JA6H 1CKMA 2B63H 1UE6A 2HNIA 2OTLA 2DTHA 5GAGC 3HOUG 4A3KG 3TS2A 4IPDA 1W66A 1XNQL 3J7A5 4TWAA 5IYBG 2D0PA 1U0LA 4B3TL 1QZGA 4K86A 4X6AH 4OLFA 4YREA 1E7ZA 4GN3B 4HJAA 1HNXL 4R4TA 3T1HL 1EYGA 4DV3Q 3PF5A 4JI1Q 3HFZB 4K87A 4X62Q 1VQPA 5FLMG 1PH3A 4BXXH 3A32A 1VQNA 2ZT6A 2D62A 3CC7A 4DUYL 4NB3A 4DNIA 1D8LA 1PH1A 1YITA 4XTWA 2KENA 4YHHQ 3W5OA 1O7IA 4DQ2A 4IJLA 4A3DH 4JI2L 4WJ4A 2IY5A 3TEHB 3CPWA 1N34Q 4XU0A 2I4NA 1YFSA 2YTXA 4A93G 2WAQE 3RZOH 2C35B 3GTMH 4YDQA 3J81i 4GKKQ 1YFTA 4AYBE 5IP7G 2E8GA 3E0EA 1QE0A 4EO4A 1VQGA 3S1NH 4TQDA 3VQYA 2NZHA 4QIWE 3FHWA 2WAQG 1E1TA 1BKBA 1A63A 2JA6G 4AYBG 1SFOH 3GDEA 2B63G 4A3IG 2KCTA 1L1OB 4IFDI 3TEGA 4KR3A 5C0XI 1LM0A 1MKHA 5IY0A 4L5TA 4KHPL 1Z47A 3CC4A 2F4VQ 2NVQH 3U4VA 1UWVA 1SETA 3L7ZC 2AHOB 4XEMA 2NN6G 2Y0SE 2R7DA 3P8YA 3UGQA 1PV4A 3F8TA 3VDYA 1UEBA 4OO1G 4P75C 1SN8A 3KLWA 1BIBA 1YBYA 2Y0SG 3CCMA 3CCVA 4BXXG 3RACA 5EAYA 2ODRD 1P16A 3RGLA 1Q12A 2UUCL 4IFDG 2FXQA 5C0XG 4AH6A 4JYAL 2DZ9A 3QNEA 4OWXB 4FDBA 2NZOA 3M9BA 4GNXB 4TVWA 3W1GA 3U4ZA 1NNHA 4YRIA 4HWSA 4HJ7A 1HTTA 2RHSA 2R7FA 4XTUA 4RMFA 4LF6Q 4PZ7A 4LF8Q 4JI0Q 3RKYA 4K0KL 3ULLA 3RR5A 3V7SA 1H95A 3CMAA 4H2VA 1PFSA 3RL6A 4BA2I 3UDIA 1R9TH 2CGHA 1YJWA 4JI7L 5HY6A 4HWPA 3I4NG 1B7YB 4XTCS 2MNAA 2JQOA 1V9PA 3S2HH 3UGTA 1XNRQ 3HOXH 1P8LA 4OWWB 5AJ3L 3F2DA 5C4JH 2QHVA 5IT9c 2UXCQ 3H0GH 3QO8A 2UUBQ 4PZ6A 1LUZA 3DLLA 3HRIA 3NBHB 1X9NA 4LFBQ 1XMQQ 4IPHA 3HOYH 3A31A 4XTYA 3K7AH 1I94Q 4XU2A 4R4QA 4YRRA 3L0OA 1K3RA 4R1JA 3D0FA 3S14H 2HIVA 4JCVE 1CUKA 5ELNA 1SRUA 4DV4Q 4RQEA 3G4SA 4XTXA 1KOGA 4NXNL 4LF5Q 1AE3A 2E10A 4DR1Q 1T9HA 1GGMA 3L2PA 1WOCA 1RL2A 2JE6I 1S72A 1WFQA 4BY1H 4G84A 1GO3E 3RIRA 4IPCA 4HA8A 4B3RL 4HWTA 2IHEA 4OWTB 1HXDA 1B76A 4LVKA 2K5HA 2JK8A 1Y1WH 4LVIA 4A3GH 1SESA 4H2WA 2K5NA 3G48A 2AMCA 3HOXG 4YRKA 4YWMA 1G5HA 3OYYA 4LF7Q 2DU5A 1NY4A 3E9IA 3HXUA 1YI2A 1EQRA 3H0GG 4IOCA 1N32L 4DR6L 1YJNA 1VQ6A 4NCXA 1V1QA 3KF6A 3HOYG 1PA6A 4R4CA 1Q81C 4CS3A 1N33Q 1I6HH 1EVLA 1GM5A 4LFAL 1QVFA 2R93H 1JE5A 1B8AA 5E3IA 1WNLA 2ARTA 4H2XA 2E1HA 3REUA 1V43A 3PO3H 1VQ4A 3MXNB 3A5YA 4JI3L 3PO2H 4TTVA 1M90C 1JJGA 1BIAA 3RLNA 2F3IA 2ES2A 3R07A 4JV5L 3HFVA 3V8JA 3EFRA 2DTOA 3KOJA 3ICAA 2I0QA 2ASBA 4YP0A 4A76A 2R7ZG 2AWNA 1EIYB 2EWNA 1X65A 4UP7A 4A3FH 1UE7A 1Y1WG 5IYDH 1JJCA 5JEAJ 2LXKA 4A3GG 3GD7A 2ZM6L 1KRSA 1SR3A 3V7RA 2GVAA 3RKWA 1Q1EA 5C51B 2ZR2A 1PH8A 1VQ8A 4B3SL 1IYJB 4KLKA 2ZZGA 2C7IA 2ZGWA 2JEAI 3LC0A 3PIOA 1JMCA 4JI8L 3K7UC 3V8LA 3CMQA 2ALYA 2ZT8A 1FVIA 4NPSA 3PUZA 4MNOA 1HNWL 3FKIH 2DQ0A 2ID0A 3M4OH 1HR0Q 3CCUA 5J3BA 5IP9H 4LF9Q 3G1ZA 1XMOQ 3A7RA 1IBLQ 4YRGA 4EQ5A 1WJJA 3BFMA 4WF2A 3J81j 3IKLA 1SMXA 2A19A 1KMMA 1OXUA 1WI5A 1ADYA 1XJVA 4TVAA 3V7CA 2EJGA 1NYRA 4A3EH 1A62A 3AFPA 3PO2G 3BJUA 3A5UA 1YFRA 4DV3L 4JI1L 2IX1A 1LTLA 4X62L 1X54A 1ASZA 1WPYA 4YRQA 2VQEQ 3M4PA 3J81c 5K1PA 4RG1A 1PH6A 2ZTEA 4YHHL 4CS4A 3WWVA 1HZCA 1TXYA 1YHQA 4A3FG 2EQSA 5IYDG 2R92H 1HZBA 3RLFA 1J5WA 1N34L 2OQKA 5C4XH 4DR5Q 3DSQA 4XIGS 1JT8A 3U58A 4KR2A 2OWOA 1VQIA 4HIOA 2P0LA 1HZ9A 1VCIA 4GKKL 3G6EA 2CJAA 2Q5HA 2FYKA 5C53B 2ALYB 3LSSA 2QEXA 2K50A 1X3EA 4POGA 2VW9A 1FJGQ 3STBC 3BZKA 2GVBA 3FKIG 1X6OA 2ZJRA 1N9WA 5GAHC 5IP9G 4H2SA 1JB7A 5BR8Q 2F4VL 4P3OA 2UUAQ 4DR3Q 3NETA 4TVYA 4DV2Q 4DK6C 4HWOA 2VUMG 4YCWA 2E5LQ 1CKNA 4QY7A 5GROA 2DZCA 1PH9A 2C8MA 2N78A 4GS3A 1TWAH 4JBJA 4NXMQ 3RN5A 4JOIC 4JI5L 4JI6Q 3I2ZA 1PYSB 1HH2P 4DUZQ 3UDFA 4EX5A 1AE2A 1K0RA 4DV6Q 2Z6KC 1YB3A 2Q7HA 5JEAG 1D7QA 12ASA 3A74A 2PQAA 5FJ8H 5H1SE 4HJ8A 2CJ9A 1FL0A 4BY7H 3CCJA 2AWOA 2PI2A 2WFWA 1YIJA 2N8NA 3RKXA 3QO7A 1E22A 4GOPA 2EL9A 2NVXH 4A3LH 2MFIA 2EAYA 1Q1BA 4LF6L 1EVKA 4LF8L 2ZTGA 2AKWA 4JI0L 4TQFA 4DR4Q 1A0IA 3T1HQ 1E3PA 4P74A 4JI4Q 4MTNA 2YTVA 1N36Q 2OQ0A 3GTGH 4X66L 3MF1A 3ULJA 1J6QA 2KHJA 4KI0A 1CSQA 2ATWA 2DUDA 3BU2A 3H15A 3KDFA 4A3CH 1IZ6A 1NBWA 1WYDA 2B3GA 1WQ7A 2IY5B 4A3DG 2UXCL 3CMEA 2UUBL 3T1YQ 2YV5A 2VY3A 3HXZA 5ELOA 2RF4A 1OXVA 3AEVA 3TQYA 1KHIA 1W3SA 4PG3A 1NJ8A 2EIFA 4DV5Q 3FJPA 4POFA 4LFBL 1XMQL 4DR2Q 1NJIC 1I94L 1YEZA 4A3BH 5JJLA 4WJ3M 5K1XA 1BBWA 2N3SA 2QA4A 1Y1VH 5FJ8G 1L0WA 2XTIA 4BBSH 4BY7G 2UU9Q 2NS6A 3A0JA 3OTOQ 2CWPA 4DV4L 4LVMA 1E24A 4LF5L 4YY3Q 3UE1A 1VQJA 5K36G 4DR1L 3RZDH 2CQOA 3L4GA 4A3LG 2ZNJA 2AKWB 1JJ2A 4LUZA 3F2BA 3BZCA 3CCQA 2ZZFA 4DV0L 3UH0A 4GN5A 3EFSA 4LNSA 4L5RC 3EIVA 3K81C 3VQXA 1VQOA 2BH2A 1EUJA 3NENA 4K88A 3TRZA 5GQOA 1H4VB 2EXDA 4O0AA 3KDFB 4UY8C 4YRPA 4A3CG 4JYAQ 3A5ZA 3GTQH 3CXCA 4XTZA 3I56A 4IJHA 4LF7L 4Q15A 2Z0SA 3PCOA 3CF5A 4BA1I 4X65Q 1LYLA 4UPAA 3CQZH 2JA7H 4LUVA 1X01A 5M5XH 4YRSA 1Z7MA 2XGTA 4B3MQ 4DPGA 2RHSB 4A3BG 1N33L 3CCSA 2DQ3A 4XEOA 4Y7NH 1OXSC 1VQ9A 1H4QA 1Y1VG 4OX9Q 3AFQA 4BBSG 3VQWA 2MO1A 1USYC 2V1CC 3PUVA 1PH4A 4LFCQ 3L4GB 1QZHA 2E64A 4P72A 4YCUA 2VS1A 4GKJQ 3PV0A 1IBKQ 2E2JH 1PH2A 4DV1Q 2KBNA 4LF4Q 4LUOA 3D31A 1PHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3H H;  5AJ3 Q;  2BH8 A;  1KC8 C;  1XTD A;  4WI1 A;  4G85 A;  1KD1 C;  3A7U A;  3HOV H;  4JOI A;  4HJ5 A;  2ODR C;  3I55 A;  3HY0 A;  4PZ8 A;  2B29 A;  2K5V A;  2Z6K A;  3CD6 A;  4ALP A;  2CFM A;  4P3N A;  3PUY A;  1XPO A;  2ARU A;  1PH7 A;  1RIQ A;  2J3M A;  4XU3 A;  4X5O A;  5KNN A;  4CH3 A;  2GN5 A;  3KYH C;  3CCE A;  4RDX A;  3J7Z C;  2HQL A;  2DVE A;  4GLX A;  1K9M C;  2ZTD A;  3HRK A;  4HIK A;  2EJ9 A;  4GOP C;  1YZ6 A;  1VQC A;  2ZR3 A;  2E2I H;  3DM3 A;  1C0A A;  1C9O A;  2QHU A;  3S24 A;  1BBU A;  1HR0 L;  4YYE A;  3CAM A;  4LF9 L;  2VL6 A;  4P74 C;  1IBL L;  5FLX c;  4DV7 Q;  2Q2I A;  4ZTZ B;  4BY1 G;  2JJQ A;  3JAM i;  4XU1 A;  3UFG A;  4GN4 B;  2QHT A;  2CKZ B;  1KQS A;  5LMU Q;  1X55 A;  1Q86 C;  2QHS A;  2AMC B;  3ERS X;  1CKO A;  3JC6 6;  3LSQ A;  2VQE L;  1EIF A;  1NJ6 A;  2ZXF A;  3TUP A;  3WQZ A;  3L1A A;  3P8T A;  3HOV G;  4X64 Q;  4HJ9 A;  1XPR A;  2JA8 H;  4QL5 A;  3M4Q A;  3KF6 B;  3J80 i;  3L2Z A;  1AH9 A;  4GLV B;  4E51 A;  5JJI A;  1B70 A;  1G51 A;  3FP9 A;  4DR5 L;  2PNH A;  3RNU A;  2IHF A;  4A3K H;  1YJ9 A;  1VQH A;  2R93 G;  2I5H A;  1S40 A;  1M1K C;  3H3V H;  2UXD Q;  4OXP A;  4DR7 Q;  4H2X B;  5F5W A;  2KCM A;  5IWA Q;  1HNZ Q;  4Y52 H;  4UP8 A;  2JA5 H;  3HKS A;  3PO3 G;  2YTY A;  1FJG L;  5JJK A;  1G6P A;  3HOW H;  4AQY Q;  4P71 A;  4C3I H;  1VQM A;  1HJP A;  3NEM A;  2DU7 A;  4BW9 A;  3S16 H;  5BR8 L;  2UUA L;  4HIM A;  4DR3 L;  4L5Q A;  3M7N A;  1WQW A;  2DDZ A;  1QUQ A;  4DV2 L;  3CPF A;  2E5L L;  2PMZ E;  4OP0 A;  1YHA A;  3CCR A;  3TEH A;  1FYF A;  4YCV A;  3S17 H;  3EBE A;  1JJC B;  1VQ5 A;  2Q7E A;  4NXM L;  3H3V I;  4H2Y A;  2L15 A;  1YGB A;  1ASY A;  1U5K A;  2PI2 E;  1IL2 A;  2UXB Q;  4JI6 L;  4CS2 A;  4DUZ L;  4LWC A;  1IBM Q;  2YYZ A;  4Q6G A;  2JA8 G;  2D0O A;  3OW2 A;  2K4K A;  1N8R C;  3HKZ E;  4ME3 A;  3KFU A;  2HHH Q;  4C3J H;  3RUX A;  1RIP A;  3UDX A;  4A3I H;  11AS A;  1J5E Q;  1L1O A;  4QQB X;  2ZT7 A;  1TWH H;  5DLQ E;  4A75 A;  3HKZ G;  1USY A;  2QGQ A;  3HXX A;  3S1M H;  1OTC A;  3MEY A;  3IG2 A;  1Q8K A;  4TVA B;  1NMG A;  4P72 C;  5LMN Q;  3I4M H;  4DR4 L;  2JA5 G;  4LNQ A;  4A3E G;  4JBW A;  5IYC H;  3HOW G;  3ERR A;  3PIP A;  2HIX A;  4JI4 L;  1E1O A;  3QO5 A;  2VQF Q;  4DAY B;  1N36 L;  1BVS A;  3AYH B;  1PVO A;  1Z9F A;  2CJB A;  4PHC A;  1SE8 A;  2ZIN A;  1QUQ B;  2IX0 A;  3I7F A;  1EWI A;  1ADJ A;  2A8V A;  1NMF A;  3RN2 A;  2K75 A;  2Q5I A;  3Q8D A;  3KJO A;  2JA9 A;  1IXR A;  1YNX A;  4CH5 A;  4J15 A;  4C2M H;  1K8A C;  2ZIO A;  3T1Y L;  1UE5 A;  4GNX A;  1Q7Y C;  2R92 G;  5HGQ A;  2H5X A;  2OCE A;  2K14 A;  4P73 A;  4P3P A;  2Q2H A;  2OTJ A;  4A4I A;  5C4X G;  1NE3 A;  4IPG A;  4DV5 L;  4CH6 A;  2NN6 I;  2JEB I;  3HTZ A;  4DR2 L;  1YHB A;  1XNQ Q;  4RQF A;  3RLO A;  3V8K A;  2ZIM A;  1Y14 B;  1HR0 W;  3S1R H;  4B3T Q;  1VQF A;  2RCN A;  1HC7 A;  5C3E H;  1PH5 A;  5C52 B;  4OO1 I;  3PZC A;  2UU9 L;  1HNX Q;  4DK3 C;  4JC0 A;  3OTO L;  4DAM A;  1VQ7 A;  4YY3 L;  4A3J H;  2NVY H;  3KJP A;  1I3Q H;  1NJ5 A;  4YWK A;  3I4N H;  4YRM A;  4DUY Q;  1TWF H;  1NJ1 A;  2I5L X;  1B7Y A;  2N49 A;  2CIM A;  3HY1 A;  3CW2 C;  1FGU A;  1CKN B;  1XNR L;  3I4M G;  4JI2 Q;  3TS0 A;  3CC2 A;  1K8G A;  1SER A;  5IYC G;  2R6G A;  3F2C A;  2J3L A;  1KL9 A;  2DGY A;  2LXJ A;  4JI5 Q;  1S3O A;  2I5M X;  2ZJQ A;  1VQA A;  3GTL H;  2ZJP A;  2ZNI A;  4YWL A;  2E5A A;  2PQA B;  1Q46 A;  2VNU D;  4BBR H;  4X65 L;  3GTK H;  2ZTC A;  3W3S A;  4TQU S;  2CWA A;  3ZJY C;  2I4O A;  2PMF A;  3AQQ A;  3VBB A;  4L87 A;  1X56 A;  4GOP B;  1SRY A;  4B3M L;  1YVC A;  4A3M H;  4KHP Q;  4YRN A;  2BA1 A;  3MEF A;  2ARS A;  2DEQ A;  3U50 C;  4CH4 A;  4OX9 L;  5C3E G;  2WP8 J;  4P71 C;  2BA0 A;  4R4I A;  2KHI A;  1DGS A;  5LMN W;  5C44 H;  4A3J G;  4YPF A;  4X66 Q;  4LFC L;  5GAE C;  4QJF A;  4O2D A;  4GKJ L;  3HOZ H;  1KXL A;  1IBK L;  3UDG A;  2UUC Q;  1X2H A;  4DV1 L;  4BWA A;  4HVC A;  1NYQ A;  4LF4 L;  2DXU A;  3REX A;  1VQE A;  4ZIB A;  4HWR A;  1KMN A;  3QTC A;  1VQD A;  1X3G A;  3PF4 A;  2EJF A;  4KQE A;  1Z7N A;  3GTJ H;  3PSI A;  1H4S A;  1OXT A;  1QVG A;  3PGZ A;  1H4T A;  4K0K Q;  4BBR G;  3PUW A;  2MO0 A;  3UE0 A;  4HID A;  1VQZ A;  1KIX A;  3JAM c;  1L1O C;  1ATI A;  4PMW A;  3KF8 B;  4GLA C;  1I50 H;  3M85 A;  3EN2 A;  3S2D H;  2MQH A;  4JI7 Q;  4A3M G;  5M3M H;  1UE1 A;  2DXT A;  4DV0 Q;  1W2B A;  1EFW A;  4XTV A;  3LGJ A;  1WU7 A;  4DV7 L;  4JBM A;  1K83 H;  2R7Z H;  5C44 G;  1NTG A;  3J80 c;  5M3F H;  1L2F A;  4IO9 A;  1EIY A;  2Q2U A;  1G5I A;  3GTO H;  1G29 1;  3M3Y H;  3F1Z A;  5LMU L;  1SRO A;  3HOZ G;  1VQL A;  3A5Z B;  2Q2T A;  2YU9 H;  1VS0 A;  3K0X A;  1XPU A;  1KAW A;  5M5Y H;  1WCM H;  3PCO B;  1EQQ A;  2I4L A;  4GNX C;  4APV A;  4P73 C;  2RHQ A;  4X64 L;  2NVT H;  3GO5 A;  1I5F A;  3E9H A;  4H02 A;  4NXN Q;  4ZTU B;  2JA7 G;  2I4M A;  3K8A A;  2E3C A;  2WB1 E;  5IE8 A;  3CCL A;  1SLJ A;  1PYB A;  4YRF A;  1MJE A;  1MIU A;  4AIM A;  3STB D;  4YRC A;  2WB1 G;  4IOA A;  1XMO L;  3IAL A;  1TWC H;  2UXD L;  2Q7G A;  4DR7 L;  3ER0 A;  5IWA L;  4B3R Q;  1HNZ L;  4JBK A;  3PUX A;  2F52 A;  4UP9 A;  5M3M G;  4AQY L;  1A8V A;  3SGI A;  1VQB A;  3IRB A;  4YRL A;  1QF6 A;  2IT1 A;  1WLE A;  2ZZE A;  2HT1 A;  4P75 A;  3GTP H;  4YRO A;  1Q82 C;  1N32 Q;  4DR6 Q;  5M3F G;  3HXW A;  4MZ9 A;  1OXX K;  4QGU A;  3ULP A;  1VQK A;  3W1B A;  1KRT A;  2DKG A;  3B6Y A;  3OD1 A;  4JG2 A;  3VQV A;  3S1Q H;  2E41 A;  4LFA Q;  3HOU H;  1WCM G;  5E7N A;  2RHQ B;  2UXB L;  1QVC A;  1IBM L;  5IYB H;  3S15 H;  4YRJ A;  2PME A;  2K52 A;  2E65 A;  1GD7 A;  4R4O A;  2HHH L;  2LSS A;  3G71 A;  4JI3 Q;  4LW1 A;  4L5S A;  4H2T A;  3ICE A;  1J5E L;  4KHZ A;  2DJZ A;  4DKA C;  3HXY A;  4JV5 Q;  1TWG H;  3HFZ A;  5FLM H;  3NEL A;  4OON A;  1NJ2 A;  2VUM H;  5M5W H;  1K73 C;  1MJC A;  5LMN L;  2E2H H;  4IFD J;  1GVP A;  2DTI A;  5C0X J;  1CSP A;  4YRT A;  2ZT5 A;  2VQF L;  3TRE A;  3RF1 A;  2ZM6 Q;  5GAD C;  3A7A A;  1GKH A;  4H2U A;  1X2G A;  2P5I A;  1HZA A;  2CCZ A;  2VZA A;  3P8V A;  4A93 H;  1EOV A;  3CP0 A;  3IKM B;  1X3F A;  2ZCE A;  1PYS A;  2A1A A;  3I4O A;  5IP7 H;  3HXV A;  4B3S Q;  2G4C A;  4DV6 L;  3MF2 A;  3K80 C;  4JI8 Q;  1C7Y A;  1HNW Q;  1B70 B;  2JA6 H;  1CKM A;  2B63 H;  1UE6 A;  2HNI A;  2OTL A;  2DTH A;  5GAG C;  3HOU G;  4A3K G;  3TS2 A;  4IPD A;  1W66 A;  1XNQ L;  3J7A 5;  4TWA A;  5IYB G;  2D0P A;  1U0L A;  4B3T L;  1QZG A;  4K86 A;  4X6A H;  4OLF A;  4YRE A;  1E7Z A;  4GN3 B;  4HJA A;  1HNX L;  4R4T A;  3T1H L;  1EYG A;  4DV3 Q;  3PF5 A;  4JI1 Q;  3HFZ B;  4K87 A;  4X62 Q;  1VQP A;  5FLM G;  1PH3 A;  4BXX H;  3A32 A;  1VQN A;  2ZT6 A;  2D62 A;  3CC7 A;  4DUY L;  4NB3 A;  4DNI A;  1D8L A;  1PH1 A;  1YIT A;  4XTW A;  2KEN A;  4YHH Q;  3W5O A;  1O7I A;  4DQ2 A;  4IJL A;  4A3D H;  4JI2 L;  4WJ4 A;  2IY5 A;  3TEH B;  3CPW A;  1N34 Q;  4XU0 A;  2I4N A;  1YFS A;  2YTX A;  4A93 G;  2WAQ E;  3RZO H;  2C35 B;  3GTM H;  4YDQ A;  3J81 i;  4GKK Q;  1YFT A;  4AYB E;  5IP7 G;  2E8G A;  3E0E A;  1QE0 A;  4EO4 A;  1VQG A;  3S1N H;  4TQD A;  3VQY A;  2NZH A;  4QIW E;  3FHW A;  2WAQ G;  1E1T A;  1BKB A;  1A63 A;  2JA6 G;  4AYB G;  1SFO H;  3GDE A;  2B63 G;  4A3I G;  2KCT A;  1L1O B;  4IFD I;  3TEG A;  4KR3 A;  5C0X I;  1LM0 A;  1MKH A;  5IY0 A;  4L5T A;  4KHP L;  1Z47 A;  3CC4 A;  2F4V Q;  2NVQ H;  3U4V A;  1UWV A;  1SET A;  3L7Z C;  2AHO B;  4XEM A;  2NN6 G;  2Y0S E;  2R7D A;  3P8Y A;  3UGQ A;  1PV4 A;  3F8T A;  3VDY A;  1UEB A;  4OO1 G;  4P75 C;  1SN8 A;  3KLW A;  1BIB A;  1YBY A;  2Y0S G;  3CCM A;  3CCV A;  4BXX G;  3RAC A;  5EAY A;  2ODR D;  1P16 A;  3RGL A;  1Q12 A;  2UUC L;  4IFD G;  2FXQ A;  5C0X G;  4AH6 A;  4JYA L;  2DZ9 A;  3QNE A;  4OWX B;  4FDB A;  2NZO A;  3M9B A;  4GNX B;  4TVW A;  3W1G A;  3U4Z A;  1NNH A;  4YRI A;  4HWS A;  4HJ7 A;  1HTT A;  2RHS A;  2R7F A;  4XTU A;  4RMF A;  4LF6 Q;  4PZ7 A;  4LF8 Q;  4JI0 Q;  3RKY A;  4K0K L;  3ULL A;  3RR5 A;  3V7S A;  1H95 A;  3CMA A;  4H2V A;  1PFS A;  3RL6 A;  4BA2 I;  3UDI A;  1R9T H;  2CGH A;  1YJW A;  4JI7 L;  5HY6 A;  4HWP A;  3I4N G;  1B7Y B;  4XTC S;  2MNA A;  2JQO A;  1V9P A;  3S2H H;  3UGT A;  1XNR Q;  3HOX H;  1P8L A;  4OWW B;  5AJ3 L;  3F2D A;  5C4J H;  2QHV A;  5IT9 c;  2UXC Q;  3H0G H;  3QO8 A;  2UUB Q;  4PZ6 A;  1LUZ A;  3DLL A;  3HRI A;  3NBH B;  1X9N A;  4LFB Q;  1XMQ Q;  4IPH A;  3HOY H;  3A31 A;  4XTY A;  3K7A H;  1I94 Q;  4XU2 A;  4R4Q A;  4YRR A;  3L0O A;  1K3R A;  4R1J A;  3D0F A;  3S14 H;  2HIV A;  4JCV E;  1CUK A;  5ELN A;  1SRU A;  4DV4 Q;  4RQE A;  3G4S A;  4XTX A;  1KOG A;  4NXN L;  4LF5 Q;  1AE3 A;  2E10 A;  4DR1 Q;  1T9H A;  1GGM A;  3L2P A;  1WOC A;  1RL2 A;  2JE6 I;  1S72 A;  1WFQ A;  4BY1 H;  4G84 A;  1GO3 E;  3RIR A;  4IPC A;  4HA8 A;  4B3R L;  4HWT A;  2IHE A;  4OWT B;  1HXD A;  1B76 A;  2K5H A;  2JK8 A;  1Y1W H;  4A3G H;  1SES A;  4H2W A;  2K5N A;  3G48 A;  2AMC A;  3HOX G;  4YRK A;  4YWM A;  1G5H A;  3OYY A;  4LF7 Q;  2DU5 A;  1NY4 A;  3E9I A;  3HXU A;  1YI2 A;  1EQR A;  3H0G G;  4IOC A;  1N32 L;  4DR6 L;  1YJN A;  1VQ6 A;  4NCX A;  1V1Q A;  3KF6 A;  3HOY G;  1PA6 A;  4R4C A;  1Q81 C;  4CS3 A;  1N33 Q;  1I6H H;  1EVL A;  1GM5 A;  4LFA L;  1QVF A;  2R93 H;  1JE5 A;  1B8A A;  5E3I A;  1WNL A;  2ART A;  4H2X A;  2E1H A;  3REU A;  1V43 A;  3PO3 H;  1VQ4 A;  3MXN B;  3A5Y A;  4JI3 L;  3PO2 H;  4TTV A;  1M90 C;  1JJG A;  1BIA A;  3RLN A;  2F3I A;  2ES2 A;  3R07 A;  4JV5 L;  3HFV A;  3V8J A;  3EFR A;  2DTO A;  3KOJ A;  3ICA A;  2I0Q A;  2ASB A;  4YP0 A;  4A76 A;  2R7Z G;  2AWN A;  1EIY B;  2EWN A;  1X65 A;  4UP7 A;  4A3F H;  1UE7 A;  1Y1W G;  5IYD H;  1JJC A;  5JEA J;  2LXK A;  4A3G G;  3GD7 A;  2ZM6 L;  1KRS A;  1SR3 A;  3V7R A;  2GVA A;  3RKW A;  1Q1E A;  5C51 B;  2ZR2 A;  1PH8 A;  1VQ8 A;  4B3S L;  1IYJ B;  4KLK A;  2ZZG A;  2C7I A;  2ZGW A;  2JEA I;  3LC0 A;  3PIO A;  1JMC A;  4JI8 L;  3K7U C;  3V8L A;  3CMQ A;  2ALY A;  2ZT8 A;  1FVI A;  4NPS A;  3PUZ A;  4MNO A;  1HNW L;  3FKI H;  2DQ0 A;  2ID0 A;  3M4O H;  1HR0 Q;  3CCU A;  5J3B A;  5IP9 H;  4LF9 Q;  3G1Z A;  1XMO Q;  3A7R A;  1IBL Q;  4YRG A;  4EQ5 A;  1WJJ A;  3BFM A;  4WF2 A;  3J81 j;  3IKL A;  1SMX A;  2A19 A;  1KMM A;  1OXU A;  1WI5 A;  1ADY A;  1XJV A;  4TVA A;  3V7C A;  2EJG A;  1NYR A;  4A3E H;  1A62 A;  3AFP A;  3PO2 G;  3BJU A;  3A5U A;  1YFR A;  4DV3 L;  4JI1 L;  2IX1 A;  1LTL A;  4X62 L;  1X54 A;  1ASZ A;  1WPY A;  4YRQ A;  2VQE Q;  3M4P A;  3J81 c;  5K1P A;  4RG1 A;  1PH6 A;  2ZTE A;  4YHH L;  4CS4 A;  3WWV A;  1HZC A;  1TXY A;  1YHQ A;  4A3F G;  2EQS A;  5IYD G;  2R92 H;  1HZB A;  3RLF A;  1J5W A;  1N34 L;  2OQK A;  5C4X H;  4DR5 Q;  3DSQ A;  4XIG S;  1JT8 A;  3U58 A;  4KR2 A;  2OWO A;  1VQI A;  4HIO A;  2P0L A;  1HZ9 A;  1VCI A;  4GKK L;  3G6E A;  2CJA A;  2Q5H A;  2FYK A;  5C53 B;  2ALY B;  3LSS A;  2QEX A;  2K50 A;  1X3E A;  4POG A;  2VW9 A;  1FJG Q;  3STB C;  3BZK A;  2GVB A;  3FKI G;  1X6O A;  2ZJR A;  1N9W A;  5GAH C;  5IP9 G;  4H2S A;  1JB7 A;  5BR8 Q;  2F4V L;  4P3O A;  2UUA Q;  4DR3 Q;  3NET A;  4TVY A;  4DV2 Q;  4DK6 C;  4HWO A;  2VUM G;  4YCW A;  2E5L Q;  1CKN A;  4QY7 A;  5GRO A;  2DZC A;  1PH9 A;  2C8M A;  2N78 A;  4GS3 A;  1TWA H;  4JBJ A;  4NXM Q;  3RN5 A;  4JOI C;  4JI5 L;  4JI6 Q;  3I2Z A;  1PYS B;  1HH2 P;  4DUZ Q;  3UDF A;  4EX5 A;  1AE2 A;  1K0R A;  4DV6 Q;  2Z6K C;  1YB3 A;  2Q7H A;  5JEA G;  1D7Q A;  12AS A;  3A74 A;  2PQA A;  5FJ8 H;  5H1S E;  4HJ8 A;  2CJ9 A;  1FL0 A;  4BY7 H;  3CCJ A;  2AWO A;  2PI2 A;  2WFW A;  1YIJ A;  2N8N A;  3RKX A;  3QO7 A;  1E22 A;  4GOP A;  2EL9 A;  2NVX H;  4A3L H;  2MFI A;  2EAY A;  1Q1B A;  4LF6 L;  1EVK A;  4LF8 L;  2ZTG A;  2AKW A;  4JI0 L;  4TQF A;  4DR4 Q;  1A0I A;  3T1H Q;  1E3P A;  4P74 A;  4JI4 Q;  4MTN A;  2YTV A;  1N36 Q;  2OQ0 A;  3GTG H;  4X66 L;  3MF1 A;  3ULJ A;  1J6Q A;  2KHJ A;  4KI0 A;  1CSQ A;  2ATW A;  2DUD A;  3BU2 A;  3H15 A;  3KDF A;  4A3C H;  1IZ6 A;  1NBW A;  1WYD A;  2B3G A;  1WQ7 A;  2IY5 B;  4A3D G;  2UXC L;  3CME A;  2UUB L;  3T1Y Q;  2YV5 A;  2VY3 A;  3HXZ A;  5ELO A;  2RF4 A;  1OXV A;  3AEV A;  3TQY A;  1KHI A;  1W3S A;  4PG3 A;  1NJ8 A;  2EIF A;  4DV5 Q;  3FJP A;  4POF A;  4LFB L;  1XMQ L;  4DR2 Q;  1NJI C;  1I94 L;  1YEZ A;  4A3B H;  5JJL A;  4WJ3 M;  5K1X A;  1BBW A;  2N3S A;  2QA4 A;  1Y1V H;  5FJ8 G;  1L0W A;  2XTI A;  4BBS H;  4BY7 G;  2UU9 Q;  3A0J A;  3OTO Q;  2CWP A;  4DV4 L;  1E24 A;  4LF5 L;  4YY3 Q;  3UE1 A;  1VQJ A;  5K36 G;  4DR1 L;  3RZD H;  2CQO A;  3L4G A;  4A3L G;  2ZNJ A;  2AKW B;  1JJ2 A;  4LUZ A;  3F2B A;  3BZC A;  3CCQ A;  2ZZF A;  4DV0 L;  3UH0 A;  4GN5 A;  3EFS A;  4LNS A;  4L5R C;  3EIV A;  3K81 C;  3VQX A;  1VQO A;  2BH2 A;  1EUJ A;  3NEN A;  4K88 A;  3TRZ A;  5GQO A;  1H4V B;  2EXD A;  4O0A A;  3KDF B;  4UY8 C;  4YRP A;  4A3C G;  4JYA Q;  3A5Z A;  3GTQ H;  3CXC A;  4XTZ A;  3I56 A;  4IJH A;  4LF7 L;  4Q15 A;  2Z0S A;  3PCO A;  3CF5 A;  4BA1 I;  4X65 Q;  1LYL A;  4UPA A;  3CQZ H;  2JA7 H;  4LUV A;  1X01 A;  5M5X H;  4YRS A;  1Z7M A;  2XGT A;  4B3M Q;  4DPG A;  2RHS B;  4A3B G;  1N33 L;  3CCS A;  2DQ3 A;  4XEO A;  4Y7N H;  1OXS C;  1VQ9 A;  1H4Q A;  1Y1V G;  4OX9 Q;  3AFQ A;  4BBS G;  3VQW A;  2MO1 A;  1USY C;  2V1C C;  3PUV A;  1PH4 A;  4LFC Q;  3L4G B;  1QZH A;  2E64 A;  4P72 A;  4YCU A;  2VS1 A;  4GKJ Q;  3PV0 A;  1IBK Q;  2E2J H;  1PH2 A;  4DV1 Q;  2KBN A;  4LF4 Q;  4LUO A;  3D31 A;  1PHJ A; 
#chains in the Genus database with same CATH topology
 4C3H H;  1C4Q A;  5AJ3 Q;  2BH8 A;  1KC8 C;  1FYC A;  3I4M B;  1XTD A;  4RGM A;  4BS9 A;  4WI1 A;  4ABN A;  4OGQ C;  1B3Q A;  4NMZ A;  4G85 A;  2EVB A;  1KD1 C;  4UAI A;  3A7U A;  4XYQ A;  3HOV H;  4DNT B;  4JOI A;  4KY5 A;  3PMF A;  4HJ5 A;  4HMI A;  2J0T D;  2ODR C;  4R8I A;  3I55 A;  3HY0 A;  4PZ8 A;  1LT4 D;  2B29 A;  5KEE A;  2L9H A;  2BOS A;  2K01 A;  2K5V A;  2Z6K A;  3CD6 A;  4ALP A;  2CFM A;  4QUC A;  4P3N A;  4EQO A;  3PUY A;  2NB0 A;  5C4Z A;  1XPO A;  1PH7 A;  2ARU A;  1RIQ A;  2J3M A;  4MHE A;  1CHQ D;  4XU3 A;  1SNO A;  4X5O A;  5D3D A;  5KNN A;  4CH3 A;  2GN5 A;  3KYH C;  3CCE A;  4RDX A;  3DEO A;  4EQP A;  3MA2 B;  3J7Z C;  3HZX A;  2HQL A;  2DVE A;  2RSO A;  4C2M B;  4GLX A;  3QR8 A;  1K9M C;  2ZTD A;  3HRK A;  4HIK A;  2EJ9 A;  4GOP C;  3SEB A;  3G6J B;  1ICF B;  1YZ6 A;  1VQC A;  5G3L D;  1HRJ A;  2EYJ A;  2ZR3 A;  2E2I H;  1Y69 U;  2QF7 A;  3VYR A;  3DM3 A;  1C0A A;  1FNV A;  1A6X A;  3H3V C;  3OW7 A;  3TP6 A;  1C9O A;  2QHU A;  3S24 A;  1KDC A;  1MSG A;  1BBU A;  2A6E D;  3S1R B;  5EKI A;  1HR0 L;  1J9O A;  4YYE A;  3CAM A;  4LF9 L;  1AW7 A;  2VL6 A;  2MHV A;  4P74 C;  5C3E B;  1IBL L;  5FLX c;  1SNM A;  4DV7 Q;  2Q2I A;  4ZTZ B;  2TSS A;  5G3L F;  4BY1 G;  2JJQ A;  3JAM i;  3TP8 A;  4A3J B;  4XU1 A;  3UFG A;  2NVY B;  4CGY B;  1EY4 A;  4GN4 B;  2QHT A;  2B2T C;  4KN4 C;  2CKZ B;  5FKA C;  4ZK9 B;  1KQS A;  3NP8 A;  1I3Q B;  5LMU Q;  1STB A;  1X55 A;  4JPB W;  1TWF B;  4WFN 3;  1Q86 C;  4CJ2 C;  3KK7 A;  2F0F A;  2QHS A;  2AMC B;  1B9M A;  2F03 A;  2NZ1 D;  4C3H G;  2F0L A;  2VB2 X;  3ERS X;  1CKO A;  1YNJ C;  3JC6 6;  3LSQ A;  2VQE L;  4KD4 A;  1EIF A;  1NJ6 A;  1LT5 D;  2ZXF A;  1GUS A;  5KND A;  3TUP A;  3WQZ A;  1JCK B;  3UI2 A;  3L1A A;  3P8T A;  3HOV G;  4X64 Q;  4HJ9 A;  1XPR A;  5ELB A;  2JA8 H;  3MXU A;  4JVZ A;  4QL5 A;  3M4Q A;  1SYF A;  1LAB A;  2L4N A;  3KF6 B;  3J80 i;  1PTO B;  3L2Z A;  1AH9 A;  1S5D D;  3CU7 A;  4GLV B;  2Z1C A;  3GTL B;  4E51 A;  5JJI A;  1LV9 A;  2IPK D;  1B70 A;  1G51 A;  3FP9 A;  4DR5 L;  2PNH A;  3RNU A;  2IHF A;  4K5X A;  4H13 C;  4A3K H;  5DM6 3;  5F2D A;  1W6K A;  2SNS A;  4DAV A;  2O4X A;  1BCP C;  3O13 A;  2F1M A;  4ZQ3 A;  2XWB B;  1YJ9 A;  1VQH A;  4BBR B;  3D3R A;  2QDB A;  1HUM A;  2R93 G;  3GTK B;  2I5H A;  1S40 A;  1M1K C;  4EVO A;  3H3V H;  1PHJ A;  2UXD Q;  4OXP A;  4DR7 Q;  4H2X B;  4NW2 A;  1FNW A;  4KKT A;  5F5W A;  2KCM A;  5IWA Q;  4KTA A;  3LWE A;  2JP1 A;  1HNZ Q;  1XXG A;  4N8F A;  4M1U B;  2VB3 X;  5M9O A;  4Y52 H;  2A5H A;  4UP8 A;  3MQZ A;  2JA5 H;  3HKS A;  3PIP 3;  3PO3 G;  2YTY A;  1FJG L;  5JJK A;  2V4D A;  2RKS A;  4A3M B;  4L63 B;  3HOW H;  1G6P A;  4AQY Q;  4P71 A;  1MHW C;  5FK9 C;  4C3I H;  1VQM A;  1HJP A;  1QCB D;  4DA2 A;  3NEM A;  4IN3 A;  2DU7 A;  2I46 A;  4BW9 A;  2WKC A;  2DNC A;  5COY A;  2DY7 A;  1PXU A;  3S16 H;  5BR8 L;  3DXJ C;  1Q3L A;  1XYI A;  2UUA L;  2KJX A;  1A2T A;  1SYD A;  4HIM A;  4L5Q A;  4DR3 L;  1F2M A;  5JPM C;  1U4M A;  3M7N A;  1WQW A;  2DDZ A;  1PZJ D;  5C44 B;  1QUQ A;  5JVH 3;  4DV2 L;  1B44 D;  2D5D A;  2JN4 A;  3CPF A;  2E5L L;  3BVG A;  5CV5 A;  2PMZ E;  1VMP A;  1SND A;  4TKO B;  4OP0 A;  1YHA A;  3MAQ A;  3TZU A;  3CCR A;  3IAY A;  3HRZ C;  1AP0 A;  1FYF A;  1LLR D;  4YCV A;  3TEH A;  4C56 C;  3S17 H;  3EBE A;  3HOZ B;  1JJC B;  1I6V C;  1VQ5 A;  2B2W C;  3AB9 A;  2Q7E A;  5BN5 A;  4NXM L;  3H3V I;  4RCN A;  2L15 A;  4H2Y A;  1WVL A;  1YGB A;  4QUF A;  1ASY A;  1U5K A;  2PI2 E;  3GTQ B;  1IL2 A;  2UXB Q;  4JI6 L;  2EPB A;  4CS2 A;  3SK6 A;  4DUZ L;  4LWC A;  5CBA E;  4ZLT F;  2YYZ A;  1IBM Q;  4K8J A;  2RCF A;  4Q6G A;  4O42 A;  2EJM A;  3J81 E;  2JA8 G;  2D0O A;  4XQJ A;  3SR1 A;  3OW2 A;  2K4K A;  2JA7 B;  4OL7 A;  1ZKO A;  5ELC A;  1N8R C;  1EWC A;  3GTJ B;  3HKZ E;  4ME3 A;  3KFU A;  4ZRZ A;  2HHH Q;  1H9J A;  4C3J H;  2XN9 C;  3RUX A;  1RIP A;  3UDX A;  4RAU C;  3A8I E;  4A3I H;  11AS A;  3VR4 A;  1J5E Q;  1L1O A;  4QQB X;  2ZT7 A;  1TWH H;  1SYE A;  1PYW D;  5DLQ E;  2EYM A;  4A75 A;  3HKZ G;  1USY A;  1LT3 D;  2QGQ A;  2WB1 B;  3S1M H;  3HXX A;  1OTC A;  3MEY A;  3A54 A;  1JIC A;  3IG2 A;  1Q8K A;  4TVA B;  2C9O A;  1LT6 D;  1NMG A;  2NN6 H;  4QMG A;  4DK0 A;  2K5Q A;  4P72 C;  1I4G A;  5JVG 3;  5LMN Q;  3A8K E;  4LVJ A;  3I4M H;  1I50 B;  4DR4 L;  1TR5 A;  1I4P A;  2JA5 G;  3R2I A;  4LNQ A;  3S2D B;  4A3E G;  4JBW A;  2MP1 A;  5IYC H;  3HOW G;  3ERR A;  3PIP A;  5M3M B;  2HIX A;  4CDC C;  2PZU A;  4C3I G;  4JI4 L;  1E1O A;  3QO5 A;  1PFN A;  2VQF Q;  2Z4I A;  4DF7 A;  2E2J B;  4DAY B;  4X3S A;  2D2C C;  1N36 L;  1GUG A;  1BVS A;  5I6Y A;  2F0V A;  3AYH B;  3OIQ A;  1PVO A;  1Z9F A;  4KN7 C;  2CJB A;  4PHC A;  2HDL A;  5EKK A;  1SE8 A;  2ZIN A;  1K83 B;  1QUQ B;  1BUV T;  2IX0 A;  3I7F A;  4IUR A;  3D4D A;  1EWI A;  1ADJ A;  3I4L A;  2A8V A;  5CV4 A;  2R7Z B;  1NMF A;  3RN2 A;  5M3F B;  1IKM A;  2K75 A;  4G4K A;  2Q5I A;  3Q8D A;  2ENB A;  3IKJ A;  3KJO A;  3GTO B;  3M3Y B;  2EY6 A;  3J7Y W;  1GOZ A;  2JA9 A;  1IXR A;  1YNX A;  4ZCK A;  4CH5 A;  4J15 A;  4C2M H;  1K8A C;  2ZIO A;  4PV1 C;  3T1Y L;  2MUY A;  1UE5 A;  4RHR A;  4GNX A;  3TME A;  1Q7Y C;  1TII D;  2R92 G;  5HGQ A;  1HA5 A;  2H5X A;  2OCE A;  2K14 A;  4P73 A;  3U9O A;  2YU9 B;  4P3P A;  2Q2H A;  2OTJ A;  4A4I A;  4RH6 A;  5C4X G;  1NE3 A;  4IPG A;  3NUC A;  4DV5 L;  5M5Y B;  4CH6 A;  1O7Y A;  1WCM B;  4HT4 A;  2NN6 I;  2JEB I;  3HTZ A;  4DR2 L;  1YHB A;  1XNQ Q;  4RQF A;  3RLO A;  4K5V A;  3V8K A;  2ZIM A;  1Y14 B;  2K1B A;  2NVT B;  1WTH A;  1HR0 W;  3S1R H;  4B3T Q;  1VQF A;  1D5M C;  2RCN A;  3TP7 A;  1TY2 A;  1HC7 A;  1CQF A;  5C3E H;  1PH5 A;  5C52 B;  4C3J G;  4OO1 I;  2UU9 L;  3PZC A;  4HTH A;  1HNX Q;  1EY7 A;  2RDF A;  1JQY D;  4JC0 A;  4DK3 C;  3OTO L;  1DCZ A;  5I9O A;  1R4P B;  4DAM A;  1NR2 A;  1Q90 A;  1B50 A;  1VQ7 A;  4YY3 L;  4A3J H;  3NBI A;  2NVY H;  2WAC A;  1WTX A;  3MVV A;  1O80 A;  3KJP A;  1I3Q H;  4DNR B;  1NJ5 A;  4YWK A;  3I4N H;  4YRM A;  4DUY Q;  1TWF H;  1NJ1 A;  1TWC B;  2I5L X;  1B7Y A;  2N49 A;  2RQX A;  3NTI A;  2CIM A;  3HY1 A;  3CW2 C;  1FGU A;  1STH A;  5JAV A;  1CKN B;  2A8E A;  1XNR L;  1HFN A;  3I4M G;  4MN3 A;  4JI2 Q;  3TS0 A;  4KMU C;  3OIP A;  4PQX A;  3CC2 A;  3VA5 A;  1K8G A;  1SER A;  5IYC G;  2R6G A;  1JOR A;  3D6W A;  3QOL A;  4WOR A;  3FEW X;  3X3M A;  2K5W A;  2EY2 A;  3WDN A;  3F2C A;  2J3L A;  1KL9 A;  2QCP X;  5IGF A;  1O78 A;  3EQL C;  1A3U A;  1PTO H;  2DGY A;  4HN7 A;  2LXJ A;  1H9S A;  4HR7 B;  4JI5 Q;  1S3O A;  1ENA A;  5EJW A;  3T16 A;  3NTK A;  2I5M X;  2ZJQ A;  1EYD A;  2F3W A;  1VQA A;  1SYG A;  3GTL H;  3GTP B;  1GUT A;  2ZJP A;  1KLU D;  1HXY D;  2ZNI A;  4YWL A;  2E5A A;  2PQA B;  1Q46 A;  2EDG A;  4ODG A;  2VNU D;  4HCS A;  4IZ8 A;  1IHZ A;  4BBR H;  2KQ3 A;  4X65 L;  3GTK H;  1ET9 A;  2CH4 A;  2ZTC A;  2JYO A;  2CWA A;  4TQU S;  3W3S A;  3ZJY C;  5CYU A;  1HPC A;  2I4O A;  2PMF A;  2L5T A;  1RTN A;  4FO2 A;  2FMM A;  3AQQ A;  3VBB A;  4KJO A;  3JAM L;  4L87 A;  3S1Q B;  1X56 A;  4GOP B;  4A3K B;  3HOU B;  3KF8 A;  1SRY A;  1F9Q A;  4B3M L;  1YVC A;  4B08 A;  1IW7 C;  3NQI A;  1O7Z A;  4A3M H;  4KHP Q;  1DYQ A;  4YRN A;  4V19 0;  2BA1 A;  3MEF A;  2ARS A;  2DEQ A;  3S15 B;  3U50 C;  1SNC A;  3X3N A;  1K8M A;  2LMC B;  1DD2 A;  4OEM B;  4CH4 A;  3FPU B;  5IGD A;  1WTV A;  4OX9 L;  5C3E G;  4OHJ A;  2WP8 J;  3DWP A;  3TZD A;  4P71 C;  4WJW A;  2BA0 A;  3SHL A;  4R4I A;  2KHI A;  1PRT C;  1X3Q A;  1DGS A;  1L0X B;  3C3L A;  5LMN W;  5C44 H;  2A69 C;  4A3J G;  4YPF A;  5EQ0 A;  4X66 Q;  2A6H D;  4LFC L;  1HA6 A;  5GAE C;  2O5J C;  1SEB D;  3SXH A;  5K5P A;  1TWG B;  4QJF A;  4O2D A;  3J80 L;  4GKJ L;  3HOZ H;  1KXL A;  1IBK L;  1BXT A;  3UDG A;  2UUC Q;  1X2H A;  4DV1 L;  2PW5 A;  4BWA A;  3K57 A;  4HVC A;  1NYQ A;  4LF4 L;  3KBG A;  2DXU A;  5M5W B;  3REX A;  1VQE A;  5A2Q E;  4ZIB A;  4HWR A;  3QO2 A;  1MSH A;  1KMN A;  3QTC A;  2RBM A;  1VQD A;  4CKE A;  1K28 A;  1RHP A;  2E2H B;  2B2W A;  1X3G A;  1SYC A;  3PF4 A;  4LVL A;  2BE5 C;  2EJF A;  5JJZ A;  2F0T A;  5T1I A;  1TT2 A;  1H9S B;  2KEC A;  2L11 A;  4LMQ D;  1GUW A;  4KQE A;  1KTK A;  2F0J A;  5IGB A;  1Z7N A;  3GTJ H;  2KCN A;  3PSI A;  1H4S A;  1R4Q B;  1OXT A;  3C1E A;  5CGK A;  4A93 B;  4NP5 A;  1ENF A;  1QVG A;  1IYU A;  4X3T A;  4E6I A;  2E74 C;  3PGZ A;  4KK7 A;  1H4T A;  5LL6 S;  4K0K Q;  5JPN C;  3C2P A;  1EFI D;  2F0M A;  2NUC A;  3PUW A;  4BBR G;  3DUZ A;  2MO0 A;  3UE0 A;  1BCP B;  4HID A;  3QWN A;  1KIX A;  1VQZ A;  3JAM c;  5CV9 A;  4RHS A;  3A55 A;  3OWF A;  1H9M A;  2WAQ B;  1L1O C;  1ATI A;  4PMW A;  3I8Z A;  1TVX A;  2JA6 B;  4AYB B;  3KF8 B;  2B63 B;  1K3B C;  4A3I B;  4U68 A;  1G8Z D;  3Q0A A;  3R2T A;  3BVM A;  3KUP A;  4GLA C;  1I50 H;  3M85 A;  3EN2 A;  5CV8 A;  2MQH A;  4JI7 Q;  3S2D H;  4A3M G;  5M3M H;  1UE1 A;  4QIW B;  2KOL A;  1ICW A;  2DXT A;  3S1M B;  1QJO A;  2OEO A;  4DV0 Q;  1W2B A;  3BYY B;  4O1N A;  3FRP B;  1GHK A;  1EFW A;  4XTV A;  4IUT A;  3LGJ A;  1WU7 A;  4DV7 L;  1BR9 A;  4JBM A;  1TS4 A;  1K83 H;  3N52 A;  1IYV A;  4DGZ A;  1LTS D;  2R7Z H;  5CMD A;  2CQA A;  4KKU A;  5C44 G;  1NTG A;  2GA4 B;  3J80 c;  5M3F H;  1L2F A;  1F9P A;  4IO9 A;  1EIY A;  2Q2U A;  1G5I A;  3GTO H;  1G29 1;  4HSV A;  2F0Q A;  3M3Y H;  1G2T A;  1NCV A;  3F1Z A;  2A68 D;  2Y0S B;  3IFT A;  1SRO A;  5LMU L;  3HOZ G;  2QW7 A;  1G91 A;  1KNE A;  2A74 C;  1VQL A;  4F7X A;  3HG9 A;  3TDQ A;  3A5Z B;  2Q2T A;  2YU9 H;  1VS0 A;  3K0X A;  1XPU A;  1KAW A;  3OOC A;  4DN4 M;  5M5Y H;  4CJ1 B;  1CTM A;  1WCM H;  3PCO B;  1EQQ A;  2I4L A;  2G9D A;  2G5D A;  4GNX C;  3EJI A;  4APV A;  2RVL A;  1S4Z A;  4P73 C;  2RHQ A;  1ZYR C;  1E2V A;  4X64 L;  1RDP D;  2X6L A;  3GO5 A;  2NVT H;  1I5F A;  2TMP A;  3E9H A;  4H02 A;  4NXN Q;  4ZTU B;  2JA7 G;  2I4M A;  3K8A A;  2IX3 A;  2E3C A;  2WB1 E;  3MXP A;  1Z6H A;  5IE8 A;  3CCL A;  1E0B A;  1SLJ A;  1PYB A;  1Y8O B;  4YRF A;  1ESF A;  3RZO B;  3AU7 A;  3K5M A;  1MJE A;  1ET6 A;  3GTM B;  1JOO A;  4OIK A;  2B8F A;  1SBB B;  1I4H A;  4XXE A;  1MIU A;  2HCC A;  2NTT A;  4AIM A;  3STB D;  4FF1 A;  3S1N B;  3DWA A;  4YRC A;  2WB1 G;  4IOA A;  1XMO L;  3ND8 A;  4FF3 A;  3IAL A;  1TWC H;  2UXD L;  1W6J A;  2Q7G A;  4DR7 L;  3ER0 A;  5IWA L;  1QB5 D;  4B3R Q;  1HNZ L;  1QOH A;  1MI2 A;  4JBK A;  5C5M A;  3PUX A;  2F52 A;  2K28 A;  3MFG A;  4GZY C;  1RF2 D;  4UP9 A;  1Y8N B;  5M3M G;  5EBC A;  4AQY L;  1A8V A;  4QB4 A;  2NVQ B;  3SGI A;  1VQB A;  3I4N B;  3IRB A;  4RKB A;  4YRL A;  1QF6 A;  2E76 C;  2IT1 A;  1WLE A;  1BQQ T;  3R8B A;  4DAP A;  2ZZE A;  1SXT A;  2HT1 A;  4P75 A;  3GTP H;  4YRO A;  1Q82 C;  2BCO A;  1A3T A;  2OT2 A;  1N32 Q;  4DR6 Q;  1SDF A;  4B9X A;  5M3F G;  3HXW A;  5FLX E;  4MZ9 A;  1S5F D;  2F0W A;  3S9W A;  1OXX K;  4QGU A;  1S5B D;  5FOB B;  3ULP A;  4UHV A;  1VQK A;  1PTO D;  1KRT A;  3W1B A;  2DKG A;  1EY8 A;  3B6Y A;  2P5Z X;  3OD1 A;  1WD1 A;  1QE6 A;  2QEJ C;  4JG2 A;  3VQV A;  1WD0 A;  3S1Q H;  2E41 A;  4LFA Q;  3HOU H;  1WCM G;  5E7N A;  3TP5 A;  2RHQ B;  2UXB L;  1QVC A;  1PTO F;  1IBM L;  5IYB H;  3EFX D;  4XT1 B;  3S15 H;  4F8M A;  4YRJ A;  2PME A;  3V2T A;  1EU3 A;  5EKL A;  3K0Y A;  4CKB A;  1HTP A;  2K52 A;  3MXG A;  2E65 A;  4KJN A;  1GD7 A;  2EYL A;  4R4O A;  2O5I C;  2F0S A;  2HHH L;  2LSS A;  2FIN B;  5HUR A;  3G71 A;  3I91 A;  4JI3 Q;  4LW1 A;  1V1P A;  1WTP A;  1EQT A;  1EY0 A;  4L5S A;  4ZKC B;  1D1K A;  3VYU A;  4H2T A;  3ICE A;  2JXM B;  5JOB A;  4KHZ A;  1WTQ A;  1SAP A;  4DKA C;  1J5E L;  2DJZ A;  2EZV A;  4RWS C;  2F0I A;  3HXY A;  4JV5 Q;  1TWG H;  3HFZ A;  4K5W A;  5FLM H;  1PLF A;  3NEL A;  4OON A;  4P2C B;  4CKC A;  2MGS A;  4DK1 A;  1NJ2 A;  4LK1 C;  2VUM H;  5M5W H;  3BG3 A;  1K73 C;  4BWG B;  3KLR A;  1MJC A;  4FYD A;  5LMN L;  1Y8P B;  5ELF A;  2E2H H;  1HFG A;  1GVP A;  5CBE E;  1R9T B;  4IFD J;  2DTI A;  5C0X J;  4DXG A;  4CJ0 B;  1CSP A;  3NHH A;  4YRT A;  2ZT5 A;  2DJF C;  3A56 A;  2VQF L;  2B39 A;  3TRE A;  1B3A A;  3L3O C;  4JK1 C;  3S2H B;  3RF1 A;  3H6M A;  3HOX B;  2ZM6 Q;  5GAD C;  3A7A A;  4HAE A;  1GKH A;  1QIL A;  4H2U A;  1X2G A;  2P5I A;  1ROD A;  1HZA A;  2EJF C;  2CCZ A;  2VZA A;  4OEL B;  3P8V A;  2AUK A;  5C4J B;  3K5L A;  2WKD A;  4A93 H;  1EOV A;  1TS5 A;  5DAU A;  3MTS A;  1AN8 A;  3CP0 A;  3IKM B;  1X3F A;  2ZCE A;  3H0G B;  2FHT A;  1PYS A;  2A1A A;  1NAP A;  1FGB D;  3I4O A;  4ME5 A;  3VR5 A;  5IP7 H;  3Q22 A;  3HXV A;  4B3S Q;  2G4C A;  1TKW B;  2RSN A;  4DV6 L;  2RDG A;  3MF2 A;  3K80 C;  4JI8 Q;  1C7Y A;  3A8J E;  3AMU A;  4K8I A;  1YNN D;  3HOY B;  2SOB A;  3K7A B;  1HNW Q;  1B70 B;  1XTC D;  1DXM A;  3K59 A;  2JA6 H;  1CKM A;  2B63 H;  1M8A A;  1UE6 A;  3OWE B;  3RUZ A;  2OTL A;  2DTH A;  2HNI A;  5GAG C;  2DNE A;  4A3K G;  3HOU G;  3TS2 A;  3URY A;  4IPD A;  1W66 A;  1XNQ L;  3S14 B;  2L0C A;  1DJR D;  1FR3 A;  3QB3 A;  3J7A 5;  1JR0 D;  1SMY D;  4TWA A;  5IYB G;  3M7G A;  2D0P A;  1U0L A;  3J7A F;  3WOE A;  1SYB A;  5LHY 1;  4B3T L;  1JE4 A;  3E3X A;  1V8Q A;  5I2Y A;  5EPJ A;  1QZG A;  4K86 A;  2B2U C;  4I7Z C;  1LTG D;  1ZEQ X;  4X6A H;  4OLF A;  4YRE A;  3LX0 A;  1E7Z A;  4GN3 B;  4HJA A;  1HNX L;  2A6E C;  2EYP A;  2QIL A;  3ERQ A;  4R4T A;  3OMC A;  3T1H L;  1CZW A;  4I65 A;  4KY6 A;  1V1O A;  1DOM A;  1PRT B;  4PMB A;  1EYG A;  4DV3 Q;  3PF5 A;  4JI1 Q;  3HFZ B;  4K87 A;  4X62 Q;  1BBX C;  1VQP A;  4OO1 H;  3E6Z X;  2X6G A;  5FLM G;  1PH3 A;  4BXX H;  4BY1 B;  1VQN A;  2D62 A;  4X3U A;  2ZT6 A;  3A32 A;  3CC7 A;  4DUY L;  4NB3 A;  4DNI A;  4IFD H;  1D8L A;  1PH1 A;  4JW0 A;  5C0X H;  1YIT A;  1EQV A;  4XTW A;  2KEN A;  3HEJ A;  3MZ5 A;  4YHH Q;  3W5O A;  1O7I A;  1F2L A;  4DQ2 A;  4IJL A;  2FFK B;  2F0P A;  4A3D H;  4JI2 L;  4WJ4 A;  4RKL A;  2IY5 A;  3TEH B;  1QNU A;  1JWS D;  1HCZ A;  1Y1W B;  3CPW A;  4DFA A;  5CC4 A;  1N34 Q;  4A3G B;  2FMC A;  3CKI B;  4XU0 A;  1QNK A;  2I4N A;  1YFS A;  3VYT A;  3P7J A;  3MEH A;  2N88 A;  2XWJ B;  2YTX A;  1X3P A;  4J1M A;  1RTO A;  4A93 G;  2WAQ E;  3RZO H;  2C35 B;  3GTM H;  4YDQ A;  3J81 i;  4GKK Q;  1YFT A;  4AYB E;  5IP7 G;  1F2Z A;  2E8G A;  3OHX C;  5C5L A;  2R61 A;  3E0E A;  1A2U A;  1QE0 A;  4EO4 A;  1SE4 A;  1VQG A;  3S1N H;  4TQD A;  3VQY A;  1PZI D;  2NZH A;  4QIW E;  2PZW A;  3FHW A;  1Q8I A;  2WAQ G;  2AQ3 B;  1E1T A;  1BKB A;  1EEI D;  4CDD C;  4EGV A;  2JA6 G;  3OMG A;  1A63 A;  4AYB G;  1SFO H;  3GDE A;  2B63 G;  4A3I G;  1I6H B;  2KCT A;  1EYC A;  1L1O B;  2BDN A;  4IFD I;  4TSS A;  3TEG A;  4KR3 A;  5C0X I;  1LM0 A;  1MKH A;  2B2V A;  1AZP A;  5IY0 A;  4L5T A;  1F77 A;  4KHP L;  1Z47 A;  3CC4 A;  2XRQ D;  2F4V Q;  2NVQ H;  3BDL A;  2D9U A;  4KV6 A;  3U4V A;  1UWV A;  1SET A;  5KYL A;  4TRD A;  3L7Z C;  2AHO B;  1U4P A;  3NWT A;  2SEB D;  4XEM A;  2NN6 G;  3FPP A;  2Y0S E;  2BDO A;  2CW0 D;  3T13 A;  3PO2 B;  2R7D A;  3P8Y A;  3UGQ A;  3IL8 A;  5J1Z A;  2KCC A;  5L37 A;  1PV4 A;  3F8T A;  2N55 A;  3VDY A;  5IT9 L;  1UEB A;  4OO1 G;  1F2Y A;  5D14 A;  4P75 C;  1SN8 A;  3KLW A;  3SK4 A;  1YBY A;  2Y0S G;  3W2D A;  5J39 A;  3CCV A;  3CCM A;  4G7Z C;  1CZG A;  4BXX G;  3RAC A;  2K05 A;  3NBH A;  5EAY A;  2ODR D;  1P16 A;  3RGL A;  1Q12 A;  2UUC L;  3K5N A;  4IFD G;  2FXQ A;  1A15 A;  5C0X G;  3K6O A;  4AH6 A;  5I6W A;  3MC0 B;  4JYA L;  2DZ9 A;  3QNE A;  3KLS A;  4OWX B;  4KKS A;  1CI3 M;  4A3F B;  4FDB A;  1XWE A;  2NZO A;  1OO9 B;  1TS3 A;  3M9B A;  2LY7 A;  3ONA B;  2RDH A;  4GNX B;  1LTA D;  4TVW A;  3W1G A;  4L8J A;  2JSO A;  4L6T B;  4XQQ A;  3U4Z A;  2DY8 A;  1JC7 A;  2E75 C;  1NNH A;  2NYZ D;  4OIJ A;  4YRI A;  4HWS A;  4HJ7 A;  1HTT A;  5T1G A;  4XT3 B;  1G2S A;  2RHS A;  3GV6 A;  2R7F A;  1U4L A;  4XTU A;  1HQR D;  3VYS A;  3BDO A;  4RMF A;  4LF6 Q;  4PZ7 A;  4LF8 Q;  4JI0 Q;  2I07 B;  2IJ0 A;  3QOJ A;  4K0K L;  3RKY A;  1HQM C;  1SE3 A;  3ULL A;  2CH4 W;  5DM7 3;  2B8G A;  2KED A;  3RR5 A;  3V7S A;  3QJY A;  1H95 A;  2AQ1 B;  5DNF A;  3V96 A;  3CMA A;  2F0G A;  4H2V A;  1PFS A;  3FKI B;  1CK1 A;  3M4O B;  3RL6 A;  4BA2 I;  3UDI A;  1R9T H;  4ZUJ A;  2CGH A;  1YJW A;  4JI7 L;  1RCV D;  5HY6 A;  3KLS X;  1A3V A;  4HWP A;  3I4N G;  1B7Y B;  1HTL D;  1UUP A;  4C1N I;  4XTC S;  2MNA A;  2MJ8 A;  2JQO A;  1UEA B;  1V9P A;  3S2H H;  1SNQ A;  3HOX H;  2PNR C;  1XNR Q;  3UGT A;  1J8I A;  2VUM B;  1P8L A;  3ND9 A;  5AJ3 L;  4OWW B;  4KD3 A;  5LL6 X;  3F2D A;  4FVM A;  5C4J H;  2QHV A;  5IT9 c;  1YNJ D;  3H0G H;  2UXC Q;  4H7B A;  3QO8 A;  3H09 A;  4DU9 A;  2UUB Q;  4PZ6 A;  1AFP A;  1LUZ A;  1CHP D;  1ONL A;  2PPB C;  3E5S A;  3HP3 A;  3DLL A;  3HRI A;  3A7L A;  3NBH B;  1CFM A;  1X9N A;  2MPM A;  4LFB Q;  1XMQ Q;  1LO5 D;  2RA4 A;  4G7O C;  2F0D A;  4IPH A;  3HOY H;  1T5X D;  3A31 A;  1UNS A;  4XTY A;  1F9S A;  3K7A H;  1I94 Q;  1B4O A;  3T53 B;  4XU2 A;  4R4Q A;  2DN8 A;  3BZD B;  3F2U A;  4FNF A;  1MGS A;  4YRR A;  2IW3 A;  3L0O A;  1K3R A;  4R1J A;  1EY9 A;  1MBY A;  3M4Y A;  3D0F A;  3S14 H;  2EE1 A;  2HIV A;  4JCV E;  1CUK A;  5ELN A;  2XSC A;  3HGB A;  1BCP D;  2R92 B;  1SRU A;  3ZYY X;  4DV4 Q;  5IT9 E;  4RQE A;  3G4S A;  4XTX A;  1KOG A;  2CVR A;  1ILP A;  4NXN L;  3SDZ A;  5E1F A;  4LF5 Q;  1AE3 A;  3NQT A;  2E10 A;  1EYA A;  2DJG C;  4DR1 Q;  4HCE A;  1SNP A;  3L9A X;  4FP5 D;  3MXN A;  1T9H A;  2B2U A;  1CT1 D;  5C4H A;  1STY A;  4DXF A;  1GGM A;  4WRD A;  3L2P A;  4YRG A;  1BCP F;  1WOC A;  4QCL A;  2M00 A;  3D6C A;  1RL2 A;  3G7L A;  5DEH A;  2JE6 I;  4V0B A;  1S72 A;  1WFQ A;  4BY1 H;  3NXW A;  5EGT A;  3Q6S A;  3N6R A;  4G84 A;  4FF4 A;  5KIX A;  1GO3 E;  3RIR A;  3D4W A;  4IPC A;  4YIJ A;  4HA8 A;  4B3R L;  4HWT A;  3JAM E;  2IHE A;  4OWT B;  1HXD A;  2F0U A;  1RD9 D;  2F3V A;  3NSW A;  4FXG C;  4ID6 A;  3V05 A;  1B76 A;  4LVK A;  2HD3 A;  2K5H A;  1IKL A;  4KY7 A;  2JK8 A;  1Y1W H;  1VDZ A;  4LVI A;  2A73 B;  2B2Y C;  3FDT A;  4A3G H;  1SJH D;  1SES A;  4H2W A;  2K5N A;  1H9R A;  3G48 A;  2AMC A;  3HOX G;  3I73 A;  2F0N A;  4YRK A;  4YWM A;  1G5H A;  3OYY A;  1PMR A;  3NE5 B;  4LF7 Q;  2ZXR A;  1Z7T A;  3EA6 A;  2DU5 A;  1NY4 A;  3E9I A;  3K5O A;  4A3D B;  3HXU A;  1YI2 A;  4U67 3;  1EQR A;  3H0G G;  4IOC A;  1ML0 D;  1N32 L;  1QWY A;  1C8C A;  4DR6 L;  1PZK D;  3Q24 A;  2IWH A;  3ITP A;  1EZ8 A;  1YJN A;  1VQ6 A;  3PIO 3;  5CV7 A;  3RMH A;  1TWA B;  2SNM A;  4NCX A;  1V1Q A;  4ZUI A;  3KF6 A;  2LS0 1;  1F9R A;  4N9T A;  3J80 E;  3HOY G;  2Z6B A;  1PA6 A;  1I4R A;  4R4C A;  1Q81 C;  2Q8I B;  4CS3 A;  1N33 Q;  1I6H H;  4CBV A;  3QIA A;  3BDC A;  1EVL A;  1GM5 A;  4LFA L;  1QVF A;  5BN4 A;  2R93 H;  1JE5 A;  1B8A A;  1EY5 A;  3U9S A;  3DEP A;  4BY7 B;  5E3I A;  1WNL A;  2OXP A;  2ART A;  1JB3 A;  2XIW A;  4H2X A;  2E1H A;  2B2V C;  3REU A;  1V43 A;  2PCF B;  2XVS A;  3DMU A;  1SFO B;  3PO3 H;  1FD7 D;  3MXN B;  1VQ4 A;  3A5Y A;  4JI3 L;  2NVX B;  3PO2 H;  4IUP A;  3CRK C;  1IL8 A;  4TTV A;  1M90 C;  1JJG A;  4RFB A;  1BIA A;  3RLN A;  4ZKB B;  2ES2 A;  3R07 A;  4JV5 L;  3WOF A;  3HFV A;  3T56 B;  2WIN B;  3V8J A;  3EFR A;  5AFW A;  3KOJ A;  3TSS A;  2DTO A;  3ICA A;  5KRU A;  2I0Q A;  2A6H C;  2AQ2 B;  2ASB A;  2K03 A;  5IGG A;  4YP0 A;  4A76 A;  4XDX A;  2KVM A;  2AWN A;  2R7Z G;  1EIY B;  3J81 L;  2EWN A;  1D5X C;  3VR6 A;  1X65 A;  3GTG B;  1QG7 A;  1D2B A;  3QG1 A;  4F88 A;  4UP7 A;  4A3F H;  2EYO A;  1UE7 A;  4G7H C;  2QKI C;  1Y1W G;  5IYD H;  4FXK C;  2HDM A;  1JJC A;  5JEA J;  2LXK A;  4A3G G;  2F0O A;  2LKV A;  3GD7 A;  2ZM6 L;  4PNY A;  5FO8 B;  1KRS A;  1SR3 A;  1D6E C;  3V7R A;  2GVA A;  1SSO A;  3RKW A;  1Q1E A;  1GJX A;  2Q8T A;  5C51 B;  2ZR2 A;  1PH8 A;  4H0L C;  1I4X A;  1VQ8 A;  4B3S L;  1IYJ B;  4KLK A;  2ZZG A;  5ELE A;  1K0S A;  2C7I A;  2ZGW A;  2JEA I;  3LC0 A;  3PIO A;  3GV3 A;  3H94 A;  1JMC A;  4JI8 L;  3K7U C;  2CHB D;  3V8L A;  4RGN A;  1E2Z A;  3CMQ A;  2ALY A;  1B1Z A;  2ZT8 A;  1FVI A;  4NPS A;  3PUZ A;  4MNO A;  5E4W C;  1HNW L;  2R3Z A;  4A3B B;  1ILQ A;  3FKI H;  2DQ0 A;  5CV6 A;  5FO9 B;  2ID0 A;  3M4O H;  1HR0 Q;  3E0J A;  3CCU A;  1EWH A;  1Y1V B;  5J3B A;  5IP9 H;  4LF9 Q;  1K8O A;  3G1Z A;  1XMO Q;  3A7R A;  1IBL Q;  2SDF A;  2L1B A;  3LNN A;  1TS2 A;  5TSS A;  1WJJ A;  4EQ5 A;  4X3K A;  4BBS B;  3BFM A;  4WF2 A;  3J81 j;  1CQV A;  3IKL A;  1SMX A;  2A19 A;  3ERO A;  1KMM A;  4B9W A;  1WTW A;  1OXU A;  4XYO A;  1WI5 A;  1ADY A;  1B53 A;  1M4V A;  2PO4 A;  4ZYS A;  1XJV A;  4TVA A;  2OF1 A;  3V7C A;  2EJG A;  1FNU A;  2AUJ D;  1NYR A;  3IFD A;  5I9P A;  4C1N K;  4A3E H;  1S5E D;  1A62 A;  3AFP A;  3RZD B;  3PO2 G;  2VXW A;  3BJU A;  3A5U A;  5KGU A;  3EVQ A;  4H44 C;  1KDB A;  1BF4 A;  2M2L A;  1YFR A;  1CM9 A;  3DHQ A;  4DV3 L;  4JI1 L;  2IX1 A;  1LTL A;  4LJZ C;  5J22 A;  3VA7 A;  4X62 L;  4DAY A;  1X54 A;  2F0K A;  3SE0 A;  5BN3 A;  4I7A A;  1STE A;  4RA8 A;  1EZ6 A;  1SJE D;  1VF5 C;  3I72 A;  1ASZ A;  1WPY A;  4YRQ A;  2VQE Q;  3M4P A;  2O2L D;  3J81 c;  2EY1 A;  5K1P A;  3SK8 A;  1BDO A;  4RG1 A;  1PH6 A;  2ZXP A;  2ZTE A;  4YHH L;  2A68 C;  4CS4 A;  5JEA H;  3WWV A;  1BIB A;  1HZC A;  1TXY A;  1YHQ A;  2EY5 A;  4A3F G;  4UDU C;  1XX8 A;  4IUQ A;  3K58 A;  2EQS A;  2PQE A;  5IYD G;  4IQZ A;  1PDQ A;  2R92 H;  1HZB A;  3RLF A;  3VR3 A;  3R93 A;  1J5W A;  1N34 L;  2OQK A;  2G9H D;  5C4X H;  4Q5V A;  4DR5 Q;  4XIG S;  3DSQ A;  1KDA A;  4F87 A;  3LWU A;  1JT8 A;  3U58 A;  4KR2 A;  5EBD A;  2OWO A;  1VQI A;  4HIO A;  2P0L A;  1HZ9 A;  1KAB A;  2NBF A;  2ZXO A;  3D8G A;  1NUC A;  1ZXT A;  1VCI A;  3FMC A;  5CR3 A;  1G6Z A;  4GKK L;  3G6E A;  3CQZ B;  2CJA A;  1IW7 D;  2Q5H A;  2F0E A;  2J4X A;  1WTR A;  2FYK A;  1PFB A;  5C53 B;  2ALY B;  5HGT A;  5M5X B;  1RKN A;  2QEX A;  3LSS A;  1TQO A;  1TU2 B;  4IUN A;  1GXD C;  1V1P B;  2K50 A;  1X3E A;  5ELD A;  5D65 A;  2VW9 A;  4POG A;  1FJG Q;  2K7V A;  3STB C;  3BZK A;  4LAA A;  2GVB A;  3FKI G;  1X6O A;  4EQN A;  4Y7N B;  1LTI D;  4J8Q A;  1X32 A;  2ZJR A;  2ICI A;  1N9W A;  3CRL C;  3I70 A;  1PRT D;  5GAH C;  1DOL A;  5IP9 G;  2A69 D;  1KLG D;  5IGC A;  4H2S A;  1BNZ A;  1JB7 A;  3VR2 A;  3Q23 A;  5BR8 Q;  2F4V L;  4P3O A;  2WII B;  4RCO A;  2UUA Q;  3T51 B;  1CA5 A;  4DR3 Q;  1DON A;  1DM0 B;  3NTH A;  3NET A;  4TVY A;  1S5C D;  1TY0 A;  3OSO A;  2EOT A;  4DV2 Q;  4DK6 C;  4HWO A;  2VUM G;  4YCW A;  2E5L Q;  3MHB A;  1CKN A;  1NR4 A;  4QY7 A;  5GRO A;  2B2Y A;  3PQI A;  4K6L A;  4NDX A;  1PRT F;  2DZC A;  1STG A;  4PMC A;  1EU4 A;  1PH9 A;  1B2T A;  5I4D A;  1UAP A;  3GP7 A;  2C8M A;  2N78 A;  5I2X A;  4KHV A;  4C3H B;  2BE5 D;  3A7A B;  4GS3 A;  1NNX A;  1EIG A;  1TWA H;  4JBJ A;  4NXM Q;  2PYK A;  1D1I A;  3RN5 A;  4HED A;  4XQN A;  4JOI C;  4JI5 L;  3NK9 A;  1STN A;  2J7Z A;  4JI6 Q;  3FVQ A;  3I2Z A;  5ISR A;  1PYS B;  1HH2 P;  4DUZ Q;  3UDF A;  4EX5 A;  1AE2 A;  4FXD A;  3HOV B;  4FF2 A;  1K0R A;  1PTO C;  4IUV A;  4DV6 Q;  2Z6K C;  1YB3 A;  2Q7H A;  5JEA G;  1D7Q A;  12AS A;  1CA6 A;  3KBX A;  4CHT B;  3A74 A;  4ZAI A;  2PQA A;  5FJ8 H;  5H1S E;  4HJ8 A;  2CJ9 A;  1FL0 A;  4BY7 H;  5KNC A;  3CCJ A;  2AWO A;  2KEE A;  3I90 A;  2K04 A;  2FJ2 A;  2PI2 A;  2H1E A;  2WFW A;  4G57 A;  1YIJ A;  4K2L A;  3NWS A;  2X69 A;  5E4X A;  2N8N A;  3RKX A;  2PW7 A;  1LTB D;  5IGE A;  3QO7 A;  1E22 A;  5K36 H;  1DOK A;  4GOP A;  2EL9 A;  5KNB A;  2NVX H;  1GUN A;  3NPP A;  2K33 A;  1I4Q A;  4A3L H;  2R93 B;  2MFI A;  2EAY A;  1Q1B A;  4LF6 L;  1EVK A;  3MFY A;  4LF8 L;  2ZTG A;  2AKW A;  4IAL A;  4JI0 L;  2Z4H A;  5A2Q L;  4TQF A;  1U4R A;  4DR4 Q;  1A0I A;  2E2I B;  3T4A C;  3T1H Q;  3PO3 B;  5IOD A;  1E3P A;  4P74 A;  4K6D A;  4RGO S;  4JI4 Q;  4MTN A;  2YTV A;  2XRS D;  5E3F A;  1N36 Q;  2OQ0 A;  3GTG H;  1C48 A;  4X66 L;  3DWQ A;  3MF1 A;  3ULJ A;  1J6Q A;  4S3S A;  2B2T A;  2KHJ A;  4KI0 A;  1CSQ A;  2ATW A;  1KAA A;  2DUD A;  3BU2 A;  3H15 A;  3KDF A;  3I3C A;  4A3C H;  2LFN A;  1JWM D;  4Q0F A;  1IZ6 A;  1NBW A;  1WYD A;  2NWG A;  2B3G A;  1WQ7 A;  1LTT D;  1T5E A;  2EYH A;  2IY5 B;  3CHB D;  3OPO A;  4QF4 A;  4A3D G;  1NSN S;  4NKL A;  1EY6 A;  5EPK A;  1ESR A;  2ZT9 C;  2UXC L;  4HMJ A;  1RJT A;  4K2K A;  3CME A;  2UUB L;  3T1Y Q;  2YV5 A;  2VY3 A;  1EEF D;  1AEX A;  3H91 A;  3HXZ A;  5ELO A;  2RF4 A;  1OXV A;  3AEV A;  3TQY A;  1KHI A;  4ILW A;  1W3S A;  4MIU A;  2F0H A;  1ZYR D;  4PG3 A;  2H4O A;  3BS1 A;  1NJ8 A;  1GHJ A;  2EIF A;  3SVM A;  4DV5 Q;  3FJP A;  4POF A;  2PMZ B;  4LFB L;  2L55 A;  1XMQ L;  2HUG A;  4DR2 Q;  1NJI C;  1I94 L;  1PFM A;  1YEZ A;  4A3B H;  5JJL A;  4WJ3 M;  5K1X A;  1BBW A;  2N3S A;  2JA8 B;  2QA4 A;  1Y1V H;  1YNN C;  2C5C A;  5FJ8 G;  1LTR D;  1II3 A;  1L0W A;  4ULL A;  2XTI A;  4BBS H;  4BY7 G;  2UU9 Q;  1MD2 D;  2NS6 A;  3A0J A;  3OTO Q;  1JOK A;  1DZ1 A;  2CWP A;  4DV4 L;  2EXZ A;  1U9R A;  4LVM A;  3P1H A;  1E24 A;  2HQE A;  3TN2 A;  4LF5 L;  4YY3 Q;  5IIF A;  4CDF C;  1SMY C;  1WTO A;  3UE1 A;  1VQJ A;  5K36 G;  2M9V A;  4DR1 L;  3RZD H;  2CQO A;  3HKZ B;  3L4G A;  4A3L G;  2ZNJ A;  2AKW B;  4HSP A;  1JJ2 A;  4LUZ A;  2EJG C;  3F2B A;  3BZC A;  4R8N A;  3CCQ A;  1BO0 A;  4Z9C B;  5KYI A;  5A35 A;  2ICE C;  3SK5 A;  4IUU A;  2ZZF A;  4DV0 L;  3UH0 A;  4GN5 A;  2NTS A;  3EFS A;  4K14 A;  3MWY W;  4N9P A;  1ENC A;  5C3W A;  2JA5 B;  4LNS A;  4CDE C;  4L5R C;  3EIV A;  3K81 C;  4A3E B;  3C46 A;  4J6H A;  3HOW B;  3VQX A;  1VQO A;  2F4I A;  5D3I B;  4C3I B;  2BH2 A;  1EUJ A;  3NEN A;  1SE2 A;  4K88 A;  3TRZ A;  3HS0 C;  2K5D A;  5GQO A;  1H4V B;  2EXD A;  2XNA C;  2L12 A;  3S16 B;  3BVZ A;  1O7L A;  2KHS A;  1VMC A;  4O0A A;  3KDF B;  4UY8 C;  4YRP A;  1STA A;  2K32 A;  4A3C G;  4JYA Q;  3GQB A;  3A5Z A;  3R3O A;  3GTQ H;  3CXC A;  3P20 A;  1KNA A;  3I56 A;  4XTZ A;  4IJH A;  4LF7 L;  1EOT A;  4Q15 A;  2Z0S A;  3PCO A;  3J7A V;  3CF5 A;  3S17 B;  4BA1 I;  2KA7 A;  2KUM A;  4X65 Q;  1LYL A;  2HCI A;  1H9K A;  4UPA A;  3CQZ H;  2JA7 H;  2IL8 A;  1B9N A;  4LUV A;  5COR A;  3D4R A;  1L0Y B;  4M8A A;  1X01 A;  4R9W A;  3DM1 A;  5M5X H;  5C4X B;  4YRS A;  1JOQ A;  1VF7 A;  1Z7M A;  2PZT A;  1HHV A;  1GUO A;  2XGT A;  4B3M Q;  2Z9H A;  5EPL A;  3W3A A;  4DPG A;  5IOC A;  2K6A A;  2RHS B;  5FO7 B;  1HUN A;  3TBI B;  4A3B G;  1N33 L;  3CCS A;  2DQ3 A;  4XEO A;  4Y7N H;  1OXS C;  1VQ9 A;  1H4Q A;  2EYF A;  1Y1V G;  1BOS A;  4OX9 Q;  3AFQ A;  1AZQ A;  1EIH A;  2WV6 D;  4BBS G;  3BYT B;  2Q8R E;  2QDL A;  4C3J B;  3P75 A;  3VQW A;  2E2D C;  2MO1 A;  4RGT A;  1USY C;  5NUC A;  1E2W A;  5FLX L;  2V1C C;  3PUV A;  1PH4 A;  4N8X 1;  4LFC Q;  3L4G B;  1QZH A;  2E64 A;  2Z8L A;  1TWH B;  1LAC A;  1D5Z C;  4P72 A;  4YCU A;  1JWU D;  5C6A A;  3RD4 A;  2VS1 A;  4GKJ Q;  3PV0 A;  1IBK Q;  2E2J H;  1EL0 A;  3C1F A;  1PH2 A;  5C3X A;  4DV1 Q;  2KBN A;  4LF4 Q;  2CW0 C;  4LUO A;  3D31 A;  2F3I A;  4MTK A; 
#chains in the Genus database with same CATH homology
 4C3H H;  5AJ3 Q;  2BH8 A;  1KC8 C;  1XTD A;  4WI1 A;  4G85 A;  1KD1 C;  3A7U A;  3HOV H;  4JOI A;  4HJ5 A;  2ODR C;  3I55 A;  3HY0 A;  4PZ8 A;  2B29 A;  2K5V A;  2Z6K A;  3CD6 A;  4ALP A;  2CFM A;  4P3N A;  3PUY A;  1XPO A;  2ARU A;  1PH7 A;  1RIQ A;  2J3M A;  4XU3 A;  4X5O A;  5KNN A;  4CH3 A;  2GN5 A;  3KYH C;  3CCE A;  4RDX A;  3J7Z C;  2HQL A;  2DVE A;  4GLX A;  1K9M C;  2ZTD A;  3HRK A;  4HIK A;  2EJ9 A;  4GOP C;  1YZ6 A;  1VQC A;  2ZR3 A;  2E2I H;  3DM3 A;  1C0A A;  1C9O A;  2QHU A;  3S24 A;  1BBU A;  1HR0 L;  4YYE A;  3CAM A;  4LF9 L;  2VL6 A;  4P74 C;  1IBL L;  5FLX c;  4DV7 Q;  2Q2I A;  4ZTZ B;  4BY1 G;  2JJQ A;  3JAM i;  4XU1 A;  3UFG A;  4GN4 B;  2QHT A;  2CKZ B;  1KQS A;  5LMU Q;  1X55 A;  1Q86 C;  2QHS A;  2AMC B;  3ERS X;  1CKO A;  3JC6 6;  3LSQ A;  2VQE L;  1EIF A;  1NJ6 A;  2ZXF A;  3TUP A;  3WQZ A;  3L1A A;  3P8T A;  3HOV G;  4X64 Q;  4HJ9 A;  1XPR A;  2JA8 H;  4QL5 A;  3M4Q A;  3KF6 B;  3J80 i;  3L2Z A;  1AH9 A;  4GLV B;  4E51 A;  5JJI A;  1B70 A;  1G51 A;  3FP9 A;  4DR5 L;  2PNH A;  3RNU A;  2IHF A;  4A3K H;  1YJ9 A;  1VQH A;  2R93 G;  2I5H A;  1S40 A;  1M1K C;  3H3V H;  2UXD Q;  4OXP A;  4DR7 Q;  4H2X B;  5F5W A;  2KCM A;  5IWA Q;  1HNZ Q;  4Y52 H;  4UP8 A;  3MQZ A;  2JA5 H;  3HKS A;  3PO3 G;  2YTY A;  1FJG L;  5JJK A;  1G6P A;  3HOW H;  4AQY Q;  4P71 A;  4C3I H;  1VQM A;  1HJP A;  3NEM A;  2DU7 A;  4BW9 A;  3S16 H;  5BR8 L;  2UUA L;  4HIM A;  4DR3 L;  4L5Q A;  3M7N A;  1WQW A;  2DDZ A;  1QUQ A;  4DV2 L;  3CPF A;  2E5L L;  2PMZ E;  4OP0 A;  1YHA A;  3CCR A;  3TEH A;  1FYF A;  4YCV A;  3S17 H;  3EBE A;  1JJC B;  1VQ5 A;  2Q7E A;  4NXM L;  3H3V I;  4H2Y A;  2L15 A;  1YGB A;  1ASY A;  1U5K A;  2PI2 E;  1IL2 A;  2UXB Q;  4JI6 L;  4CS2 A;  4DUZ L;  4LWC A;  1IBM Q;  2YYZ A;  4Q6G A;  2JA8 G;  2D0O A;  3OW2 A;  2K4K A;  1N8R C;  3HKZ E;  4ME3 A;  3KFU A;  2HHH Q;  4C3J H;  3RUX A;  1RIP A;  3UDX A;  4A3I H;  11AS A;  1J5E Q;  1L1O A;  4QQB X;  2ZT7 A;  1TWH H;  5DLQ E;  4A75 A;  3HKZ G;  1USY A;  2QGQ A;  3HXX A;  3S1M H;  1OTC A;  3MEY A;  3IG2 A;  1Q8K A;  4TVA B;  1NMG A;  4P72 C;  5LMN Q;  4LVJ A;  3I4M H;  4DR4 L;  2JA5 G;  4LNQ A;  4A3E G;  4JBW A;  5IYC H;  3HOW G;  3ERR A;  3PIP A;  2HIX A;  4JI4 L;  1E1O A;  3QO5 A;  2VQF Q;  4DAY B;  1N36 L;  1BVS A;  3AYH B;  1PVO A;  1Z9F A;  2CJB A;  4PHC A;  1SE8 A;  2ZIN A;  1QUQ B;  2IX0 A;  3I7F A;  1EWI A;  1ADJ A;  2A8V A;  1NMF A;  3RN2 A;  2K75 A;  2Q5I A;  3Q8D A;  3KJO A;  2JA9 A;  1IXR A;  1YNX A;  4CH5 A;  4J15 A;  4C2M H;  1K8A C;  2ZIO A;  3T1Y L;  1UE5 A;  4GNX A;  1Q7Y C;  2R92 G;  5HGQ A;  2H5X A;  2OCE A;  2K14 A;  4P73 A;  4P3P A;  2Q2H A;  2OTJ A;  4A4I A;  5C4X G;  1NE3 A;  4IPG A;  4DV5 L;  4CH6 A;  4HT4 A;  2NN6 I;  2JEB I;  3HTZ A;  4DR2 L;  1YHB A;  1XNQ Q;  4RQF A;  3RLO A;  3V8K A;  2ZIM A;  1Y14 B;  1HR0 W;  3S1R H;  4B3T Q;  1VQF A;  2RCN A;  1HC7 A;  5C3E H;  1PH5 A;  5C52 B;  4OO1 I;  3PZC A;  2UU9 L;  1HNX Q;  4DK3 C;  4JC0 A;  3OTO L;  4DAM A;  1VQ7 A;  4YY3 L;  4A3J H;  2NVY H;  3KJP A;  1I3Q H;  1NJ5 A;  4YWK A;  3I4N H;  4YRM A;  4DUY Q;  1TWF H;  1NJ1 A;  2I5L X;  1B7Y A;  2N49 A;  2CIM A;  3HY1 A;  3CW2 C;  1FGU A;  2A8E A;  1CKN B;  1XNR L;  3I4M G;  4JI2 Q;  3TS0 A;  3CC2 A;  1K8G A;  1SER A;  5IYC G;  2R6G A;  3F2C A;  2J3L A;  1KL9 A;  2DGY A;  2LXJ A;  4JI5 Q;  1S3O A;  2I5M X;  2ZJQ A;  1VQA A;  3GTL H;  2ZJP A;  2ZNI A;  4YWL A;  2E5A A;  2PQA B;  1Q46 A;  2VNU D;  4BBR H;  4X65 L;  3GTK H;  2ZTC A;  3W3S A;  4TQU S;  2CWA A;  3ZJY C;  2I4O A;  2PMF A;  3AQQ A;  3VBB A;  4L87 A;  1X56 A;  4GOP B;  1SRY A;  4B3M L;  1YVC A;  4A3M H;  4KHP Q;  4YRN A;  2BA1 A;  3MEF A;  2ARS A;  2DEQ A;  3U50 C;  4CH4 A;  4OX9 L;  5C3E G;  2WP8 J;  4P71 C;  2BA0 A;  4R4I A;  2KHI A;  1DGS A;  5LMN W;  5C44 H;  4A3J G;  4YPF A;  4X66 Q;  4LFC L;  5GAE C;  4QJF A;  4O2D A;  4GKJ L;  3HOZ H;  1KXL A;  1IBK L;  3UDG A;  2UUC Q;  1X2H A;  4DV1 L;  4BWA A;  4HVC A;  1NYQ A;  4LF4 L;  2DXU A;  3REX A;  1VQE A;  4ZIB A;  4HWR A;  1KMN A;  3QTC A;  1VQD A;  1X3G A;  3PF4 A;  4LVL A;  2EJF A;  4KQE A;  1Z7N A;  3GTJ H;  3PSI A;  1H4S A;  1OXT A;  1QVG A;  3PGZ A;  1H4T A;  4K0K Q;  4BBR G;  3PUW A;  2MO0 A;  3UE0 A;  4HID A;  1VQZ A;  1KIX A;  3JAM c;  1L1O C;  1ATI A;  4PMW A;  3KF8 B;  4GLA C;  1I50 H;  3M85 A;  3EN2 A;  3S2D H;  2MQH A;  4JI7 Q;  4A3M G;  5M3M H;  1UE1 A;  2DXT A;  4DV0 Q;  1W2B A;  1EFW A;  4XTV A;  3LGJ A;  1WU7 A;  4DV7 L;  4JBM A;  1K83 H;  2R7Z H;  5C44 G;  1NTG A;  3J80 c;  5M3F H;  1L2F A;  4IO9 A;  1EIY A;  2Q2U A;  1G5I A;  3GTO H;  1G29 1;  3M3Y H;  3F1Z A;  5LMU L;  1SRO A;  3HOZ G;  1VQL A;  3A5Z B;  2Q2T A;  2YU9 H;  1VS0 A;  3K0X A;  1XPU A;  1KAW A;  5M5Y H;  1WCM H;  3PCO B;  1EQQ A;  2I4L A;  4GNX C;  4APV A;  4P73 C;  2RHQ A;  4X64 L;  2NVT H;  3GO5 A;  1I5F A;  3E9H A;  4H02 A;  4NXN Q;  4ZTU B;  2JA7 G;  2I4M A;  3K8A A;  2E3C A;  2WB1 E;  5IE8 A;  3CCL A;  1SLJ A;  1PYB A;  4YRF A;  1MJE A;  1MIU A;  4AIM A;  3STB D;  4YRC A;  2WB1 G;  4IOA A;  1XMO L;  3IAL A;  1TWC H;  2UXD L;  2Q7G A;  4DR7 L;  3ER0 A;  5IWA L;  4B3R Q;  1HNZ L;  4JBK A;  3PUX A;  2F52 A;  4UP9 A;  5M3M G;  4AQY L;  1A8V A;  3SGI A;  1VQB A;  3IRB A;  4YRL A;  1QF6 A;  2IT1 A;  1WLE A;  2ZZE A;  2HT1 A;  4P75 A;  3GTP H;  4YRO A;  1Q82 C;  1N32 Q;  4DR6 Q;  5M3F G;  3HXW A;  4MZ9 A;  1OXX K;  4QGU A;  3ULP A;  1VQK A;  3W1B A;  1KRT A;  2DKG A;  3B6Y A;  3OD1 A;  4JG2 A;  3VQV A;  3S1Q H;  2E41 A;  4LFA Q;  3HOU H;  1WCM G;  5E7N A;  2RHQ B;  2UXB L;  1QVC A;  1IBM L;  5IYB H;  3S15 H;  4YRJ A;  2PME A;  2K52 A;  2E65 A;  1GD7 A;  4R4O A;  2HHH L;  2LSS A;  3G71 A;  4JI3 Q;  4LW1 A;  4L5S A;  4H2T A;  3ICE A;  1J5E L;  4KHZ A;  2DJZ A;  4DKA C;  3HXY A;  4JV5 Q;  1TWG H;  3HFZ A;  5FLM H;  3NEL A;  4OON A;  1NJ2 A;  2VUM H;  5M5W H;  1K73 C;  1MJC A;  5LMN L;  2E2H H;  4IFD J;  1GVP A;  2DTI A;  5C0X J;  1CSP A;  4YRT A;  2ZT5 A;  2VQF L;  3TRE A;  3RF1 A;  2ZM6 Q;  5GAD C;  3A7A A;  1GKH A;  4H2U A;  1X2G A;  2P5I A;  1HZA A;  2CCZ A;  2VZA A;  3P8V A;  4A93 H;  1EOV A;  3CP0 A;  3IKM B;  1X3F A;  2ZCE A;  1PYS A;  2A1A A;  3I4O A;  5IP7 H;  3HXV A;  4B3S Q;  2G4C A;  4DV6 L;  3MF2 A;  3K80 C;  4JI8 Q;  1C7Y A;  1HNW Q;  1B70 B;  2JA6 H;  1CKM A;  2B63 H;  1UE6 A;  2HNI A;  2OTL A;  2DTH A;  5GAG C;  3HOU G;  4A3K G;  3TS2 A;  4IPD A;  1W66 A;  1XNQ L;  3J7A 5;  4TWA A;  5IYB G;  2D0P A;  1U0L A;  4B3T L;  1QZG A;  4K86 A;  4X6A H;  4OLF A;  4YRE A;  1E7Z A;  4GN3 B;  4HJA A;  1HNX L;  4R4T A;  3T1H L;  1EYG A;  4DV3 Q;  3PF5 A;  4JI1 Q;  3HFZ B;  4K87 A;  4X62 Q;  1VQP A;  5FLM G;  1PH3 A;  4BXX H;  3A32 A;  1VQN A;  2ZT6 A;  2D62 A;  3CC7 A;  4DUY L;  4NB3 A;  4DNI A;  1D8L A;  1PH1 A;  1YIT A;  4XTW A;  2KEN A;  4YHH Q;  3W5O A;  1O7I A;  4DQ2 A;  4IJL A;  4A3D H;  4JI2 L;  4WJ4 A;  2IY5 A;  3TEH B;  3CPW A;  1N34 Q;  4XU0 A;  2I4N A;  1YFS A;  2YTX A;  4A93 G;  2WAQ E;  3RZO H;  2C35 B;  3GTM H;  4YDQ A;  3J81 i;  4GKK Q;  1YFT A;  4AYB E;  5IP7 G;  2E8G A;  3E0E A;  1QE0 A;  4EO4 A;  1VQG A;  3S1N H;  4TQD A;  3VQY A;  2NZH A;  4QIW E;  3FHW A;  2WAQ G;  1E1T A;  1BKB A;  1A63 A;  2JA6 G;  4AYB G;  1SFO H;  3GDE A;  2B63 G;  4A3I G;  2KCT A;  1L1O B;  4IFD I;  3TEG A;  4KR3 A;  5C0X I;  1LM0 A;  1MKH A;  5IY0 A;  4L5T A;  4KHP L;  1Z47 A;  3CC4 A;  2F4V Q;  2NVQ H;  3U4V A;  1UWV A;  1SET A;  3L7Z C;  2AHO B;  4XEM A;  2NN6 G;  2Y0S E;  2R7D A;  3P8Y A;  3UGQ A;  1PV4 A;  3F8T A;  3VDY A;  1UEB A;  4OO1 G;  4P75 C;  1SN8 A;  3KLW A;  1BIB A;  1YBY A;  2Y0S G;  3CCM A;  3CCV A;  4BXX G;  3RAC A;  5EAY A;  2ODR D;  1P16 A;  3RGL A;  1Q12 A;  2UUC L;  4IFD G;  2FXQ A;  5C0X G;  4AH6 A;  4JYA L;  2DZ9 A;  3QNE A;  4OWX B;  4FDB A;  2NZO A;  3M9B A;  4GNX B;  4TVW A;  3W1G A;  3U4Z A;  1NNH A;  4YRI A;  4HWS A;  4HJ7 A;  1HTT A;  2RHS A;  2R7F A;  4XTU A;  4RMF A;  4LF6 Q;  4PZ7 A;  4LF8 Q;  4JI0 Q;  3RKY A;  4K0K L;  3ULL A;  3RR5 A;  3V7S A;  1H95 A;  3CMA A;  4H2V A;  1PFS A;  3RL6 A;  4BA2 I;  3UDI A;  1R9T H;  2CGH A;  1YJW A;  4JI7 L;  5HY6 A;  4HWP A;  3I4N G;  1B7Y B;  4XTC S;  2MNA A;  2JQO A;  1V9P A;  3S2H H;  3UGT A;  1XNR Q;  3HOX H;  1P8L A;  4OWW B;  5AJ3 L;  3F2D A;  5C4J H;  2QHV A;  5IT9 c;  2UXC Q;  3H0G H;  3QO8 A;  2UUB Q;  4PZ6 A;  1LUZ A;  3DLL A;  3HRI A;  3NBH B;  1X9N A;  4LFB Q;  1XMQ Q;  4IPH A;  3HOY H;  3A31 A;  4XTY A;  3K7A H;  1I94 Q;  4XU2 A;  4R4Q A;  4YRR A;  3L0O A;  1K3R A;  4R1J A;  3D0F A;  3S14 H;  2HIV A;  4JCV E;  1CUK A;  5ELN A;  1SRU A;  4DV4 Q;  4RQE A;  3G4S A;  4XTX A;  1KOG A;  4NXN L;  4LF5 Q;  1AE3 A;  2E10 A;  4DR1 Q;  1T9H A;  1GGM A;  3L2P A;  1WOC A;  1RL2 A;  2JE6 I;  1S72 A;  1WFQ A;  4BY1 H;  4G84 A;  1GO3 E;  3RIR A;  4IPC A;  4HA8 A;  4B3R L;  4HWT A;  2IHE A;  4OWT B;  1HXD A;  1B76 A;  4LVK A;  2K5H A;  2JK8 A;  1Y1W H;  4LVI A;  4A3G H;  1SES A;  4H2W A;  2K5N A;  3G48 A;  2AMC A;  3HOX G;  4YRK A;  4YWM A;  1G5H A;  3OYY A;  4LF7 Q;  2DU5 A;  1NY4 A;  3E9I A;  3HXU A;  1YI2 A;  1EQR A;  3H0G G;  4IOC A;  1N32 L;  4DR6 L;  1YJN A;  1VQ6 A;  4NCX A;  1V1Q A;  3KF6 A;  3HOY G;  1PA6 A;  4R4C A;  1Q81 C;  4CS3 A;  1N33 Q;  1I6H H;  1EVL A;  1GM5 A;  4LFA L;  1QVF A;  2R93 H;  1JE5 A;  1B8A A;  5E3I A;  1WNL A;  2ART A;  4H2X A;  2E1H A;  3REU A;  1V43 A;  3PO3 H;  1VQ4 A;  3MXN B;  3A5Y A;  4JI3 L;  3PO2 H;  4TTV A;  1M90 C;  1JJG A;  1BIA A;  3RLN A;  2F3I A;  2ES2 A;  3R07 A;  4JV5 L;  3HFV A;  3V8J A;  3EFR A;  2DTO A;  3KOJ A;  3ICA A;  2I0Q A;  2ASB A;  4YP0 A;  4A76 A;  2R7Z G;  2AWN A;  1EIY B;  2EWN A;  1X65 A;  4UP7 A;  4A3F H;  1UE7 A;  1Y1W G;  5IYD H;  1JJC A;  5JEA J;  2LXK A;  4A3G G;  3GD7 A;  2ZM6 L;  1KRS A;  1SR3 A;  3V7R A;  2GVA A;  3RKW A;  1Q1E A;  5C51 B;  2ZR2 A;  1PH8 A;  1VQ8 A;  4B3S L;  1IYJ B;  4KLK A;  2ZZG A;  2C7I A;  2ZGW A;  2JEA I;  3LC0 A;  3PIO A;  1JMC A;  4JI8 L;  3K7U C;  3V8L A;  3CMQ A;  2ALY A;  2ZT8 A;  1FVI A;  4NPS A;  3PUZ A;  4MNO A;  1HNW L;  3FKI H;  2DQ0 A;  2ID0 A;  3M4O H;  1HR0 Q;  3CCU A;  5J3B A;  5IP9 H;  4LF9 Q;  3G1Z A;  1XMO Q;  3A7R A;  1IBL Q;  4YRG A;  4EQ5 A;  1WJJ A;  3BFM A;  4WF2 A;  3J81 j;  3IKL A;  1SMX A;  2A19 A;  1KMM A;  1OXU A;  1WI5 A;  1ADY A;  1XJV A;  4TVA A;  3V7C A;  2EJG A;  1NYR A;  4A3E H;  1A62 A;  3AFP A;  3PO2 G;  3BJU A;  3A5U A;  1YFR A;  4DV3 L;  4JI1 L;  2IX1 A;  1LTL A;  4X62 L;  1X54 A;  1ASZ A;  1WPY A;  4YRQ A;  2VQE Q;  3M4P A;  3J81 c;  5K1P A;  4RG1 A;  1PH6 A;  2ZTE A;  4YHH L;  4CS4 A;  3WWV A;  1HZC A;  1TXY A;  1YHQ A;  4A3F G;  2EQS A;  5IYD G;  2R92 H;  1HZB A;  3RLF A;  1J5W A;  1N34 L;  2OQK A;  5C4X H;  4DR5 Q;  3DSQ A;  4XIG S;  1JT8 A;  3U58 A;  4KR2 A;  2OWO A;  1VQI A;  4HIO A;  2P0L A;  1HZ9 A;  1VCI A;  4GKK L;  3G6E A;  2CJA A;  2Q5H A;  2FYK A;  5C53 B;  2ALY B;  3LSS A;  2QEX A;  2K50 A;  1X3E A;  4POG A;  2VW9 A;  1FJG Q;  3STB C;  3BZK A;  2GVB A;  3FKI G;  1X6O A;  2ZJR A;  1N9W A;  5GAH C;  5IP9 G;  4H2S A;  1JB7 A;  5BR8 Q;  2F4V L;  4P3O A;  2UUA Q;  4DR3 Q;  3NET A;  4TVY A;  4DV2 Q;  4DK6 C;  4HWO A;  2VUM G;  4YCW A;  2E5L Q;  1CKN A;  4QY7 A;  5GRO A;  2DZC A;  1PH9 A;  2C8M A;  2N78 A;  4GS3 A;  1TWA H;  4JBJ A;  4NXM Q;  3RN5 A;  4JOI C;  4JI5 L;  4JI6 Q;  3I2Z A;  1PYS B;  1HH2 P;  4DUZ Q;  3UDF A;  4EX5 A;  1AE2 A;  1K0R A;  4DV6 Q;  2Z6K C;  1YB3 A;  2Q7H A;  5JEA G;  1D7Q A;  12AS A;  3A74 A;  2PQA A;  5FJ8 H;  5H1S E;  4HJ8 A;  2CJ9 A;  1FL0 A;  4BY7 H;  3CCJ A;  2AWO A;  2PI2 A;  2WFW A;  1YIJ A;  2N8N A;  3RKX A;  3QO7 A;  1E22 A;  4GOP A;  2EL9 A;  2NVX H;  4A3L H;  2MFI A;  2EAY A;  1Q1B A;  4LF6 L;  1EVK A;  4LF8 L;  2ZTG A;  2AKW A;  4JI0 L;  4TQF A;  4DR4 Q;  1A0I A;  3T1H Q;  1E3P A;  4P74 A;  4JI4 Q;  4MTN A;  2YTV A;  1N36 Q;  2OQ0 A;  3GTG H;  4X66 L;  3MF1 A;  3ULJ A;  1J6Q A;  2KHJ A;  4KI0 A;  1CSQ A;  2ATW A;  2DUD A;  3BU2 A;  3H15 A;  3KDF A;  4A3C H;  1IZ6 A;  1NBW A;  1WYD A;  2B3G A;  1WQ7 A;  2IY5 B;  4A3D G;  2UXC L;  3CME A;  2UUB L;  3T1Y Q;  2YV5 A;  2VY3 A;  3HXZ A;  5ELO A;  2RF4 A;  1OXV A;  3AEV A;  3TQY A;  1KHI A;  1W3S A;  4PG3 A;  1NJ8 A;  2EIF A;  4DV5 Q;  3FJP A;  4POF A;  4LFB L;  1XMQ L;  4DR2 Q;  1NJI C;  1I94 L;  1YEZ A;  4A3B H;  5JJL A;  4WJ3 M;  5K1X A;  1BBW A;  2N3S A;  2QA4 A;  1Y1V H;  5FJ8 G;  1L0W A;  2XTI A;  4BBS H;  4BY7 G;  2UU9 Q;  2NS6 A;  3A0J A;  3OTO Q;  2CWP A;  4DV4 L;  4LVM A;  1E24 A;  4LF5 L;  4YY3 Q;  3UE1 A;  1VQJ A;  5K36 G;  4DR1 L;  3RZD H;  2CQO A;  3L4G A;  4A3L G;  2ZNJ A;  2AKW B;  1JJ2 A;  4LUZ A;  3F2B A;  3BZC A;  3CCQ A;  2ZZF A;  4DV0 L;  3UH0 A;  4GN5 A;  3EFS A;  4LNS A;  4L5R C;  3EIV A;  3K81 C;  3VQX A;  1VQO A;  2BH2 A;  1EUJ A;  3NEN A;  4K88 A;  3TRZ A;  5GQO A;  1H4V B;  2EXD A;  4O0A A;  3KDF B;  4UY8 C;  4YRP A;  4A3C G;  4JYA Q;  3A5Z A;  3GTQ H;  3CXC A;  4XTZ A;  3I56 A;  4IJH A;  4LF7 L;  4Q15 A;  2Z0S A;  3PCO A;  3CF5 A;  4BA1 I;  4X65 Q;  1LYL A;  4UPA A;  3CQZ H;  2JA7 H;  4LUV A;  1X01 A;  5M5X H;  4YRS A;  1Z7M A;  2XGT A;  4B3M Q;  4DPG A;  2RHS B;  4A3B G;  1N33 L;  3CCS A;  2DQ3 A;  4XEO A;  4Y7N H;  1OXS C;  1VQ9 A;  1H4Q A;  1Y1V G;  4OX9 Q;  3AFQ A;  4BBS G;  3VQW A;  2MO1 A;  1USY C;  2V1C C;  3PUV A;  1PH4 A;  4LFC Q;  3L4G B;  1QZH A;  2E64 A;  4P72 A;  4YCU A;  2VS1 A;  4GKJ Q;  3PV0 A;  1IBK Q;  2E2J H;  1PH2 A;  4DV1 Q;  2KBN A;  4LF4 Q;  4LUO A;  3D31 A;  1PHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...