4DPGA

Crystal structure of human lysrs: p38/aimp2 complex i
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
505
structure length
501
Chain Sequence
VDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine--tRNA ligase
publication title Structural Switch of Lysyl-tRNA Synthetase between Translation and Transcription.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/apoptosis
total genus 158
structure length 501
sequence length 505
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dpgA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4dpgA02
1RIPA 1CKMA 5M5WH 3M4OH 1XMOL 4HJ9A 4K88A 4ME3A 3P8VA 3QO7A 4C3IH 1X9NA 4DV3Q 2L15A 4OWXB 2AKWA 1C9OA 4GLAC 3TEHB 4ZTZB 1PH4A 1NJ5A 5FLMH 5C0XG 2Z0SA 3RZDH 1HH2P 3CMAA 4LW1A 1VQJA 2ZT8A 2K4KA 1HR0W 4UP7A 4HIKA 1KOGA 3F8TA 2CKZB 3OTOQ 4LFAL 3A5ZB 2A8VA 4YRMA 4GNXA 1Q1BA 5IWAL 4JI8Q 1CSPA 1X3FA 1YGBA 4A3IH 3IKMB 2UUCQ 4R4OA 2Z6KC 1TWFH 4A93H 4YRGA 3HY1A 1UE5A 3NELA 4JI6Q 2GVBA 1Z7MA 1HZCA 3R07A 1AE2A 4TQDA 5C52B 3L1AA 1FGUA 4BXXG 2UXCQ 2YTYA 3I4MH 3CPFA 4LF6L 3A0JA 5E7NA 1VQ7A 4DV0L 2AKWB 4JI2L 1N34L 2CJ9A 1PH8A 2I0QA 4YHHL 2DUDA 4H2SA 3UGQA 2E8GA 5C4XH 4JOIC 4DV4L 2DXUA 2XTIA 2E10A 1CSQA 4DV7L 1QZHA 5IT9c 1FL0A 5FLXc 4BBSH 5FJ8H 1MJEA 1G5IA 3CCUA 2JA7G 4GNXB 3HOWH 4TTVA 4LF7Q 4DR6Q 1WU7A 3KF8B 3S2HH 2WAQE 2VW9A 3UDIA 4ALPA 4HJ8A 2QHSA 1G291 4LF9Q 4L5QA 2E64A 1QVCA 3BZCA 1Q81C 4R4IA 3CCJA 3HOYG 3LGJA 1YIJA 4CS2A 1YHQA 3CW2C 3S1NH 3FJPA 4X62Q 1FYFA 2F52A 3HOZG 1OTCA 2RHSA 3PCOB 2OWOA 1QVGA 2HHHQ 3PUWA 2PMFA 1N8RC 4P72C 4JBWA 1OXVA 4WF2A 2QHUA 3HOXH 4JI4Q 4X66L 1VCIA 2B3GA 4YY3L 1K8AC 3TUPA 4JI1Q 3OYYA 3TS2A 4DUYQ 3GTJH 2N8NA 3HOVH 2DQ3A 3M4PA 1KMNA 2BA0A 2C35B 3UE1A 4DV3L 4BA1I 4CH4A 1X6OA 4A3MH 4YRTA 1G6PA 3HY0A 1JB7A 5C44G 4P74A 2VQFL 4C3HH 2Q2HA 1N9WA 1SFOH 1YFRA 3IKLA 1I5FA 4CH3A 1C7YA 3PUXA 2DGYA 1ATIA 3HXXA 2LXKA 1HC7A 3HKZG 2VNUD 2JA6H 2RHSB 3OTOL 4GLXA 4JBKA 1ADJA 4E51A 1H4SA 4ZIBA 2P5IA 4JI8L 4KR2A 1L2FA 1VQAA 3CCVA 2Q7EA 1QE0A 4POFA 2D0OA 1A62A 1XPRA 3PZCA 1N32Q 1E1TA 4BY1H 2UUCL 12ASA 3UDXA 4EX5A 5H1SE 1TWHH 1PYSB 2KENA 3CMQA 2VL6A 1GGMA 1EFWA 4JI6L 4A3FG 3PO2H 5JEAG 3PUYA 4P71C 4AQYQ 1H4VB 2UXCL 2GVAA 2JQOA 3F1ZA 3JC66 2HIVA 2CJBA 4BA2I 5JJIA 2KCMA 3K7UC 4XU0A 2UUAQ 2HIXA 3KF6A 3G4SA 4JI5Q 4RMFA 3RUXA 4DAMA 3V7CA 4A3JG 1XMQQ 1X65A 2PMEA 3MF1A 4YROA 2IHFA 4LF7L 3S2DH 4DR6L 4ZTUB 4TVAB 5BR8Q 5C53B 4B3RQ 3LSSA 2PI2E 3I56A 3CC2A 3CCLA 1K73C 2R92H 2MO1A 2K75A 5LMNQ 4JCVE 4LF9L 4WJ4A 1PH9A 1OXUA 1EYGA 4P3PA 2I4LA 2QGQA 1X56A 4DK3C 3K8AA 3I2ZA 2WB1G 2EWNA 4HIOA 1E3PA 2ZZFA 4OLFA 3CXCA 2R7ZH 4BBRH 5GADC 5C3EH 2HHHL 1JJCA 3UH0A 2ZJRA 1EUJA 3KF6B 3MEYA 1YB3A 4JI4L 1YNXA 3L2ZA 3AEVA 3MF2A 2WFWA 2D0PA 4TVWA 1IXRA 4JI1L 3B6YA 4R4TA 4XTXA 4IPHA 3M3YH 4JI7L 1QUQA 3A7RA 4UP8A 3UGTA 1IZ6A 2DZ9A 4TWAA 2KHIA 3BU2A 3RN2A 1SESA 2MFIA 3ERRA 1BVSA 1B70A 4KLKA 2E41A 3ERSX 1W2BA 1IBMQ 4DR7Q 3GTPH 2VS1A 1NYQA 3F2CA 3CMEA 4DR1Q 4TQUS 2MQHA 2DXTA 4YCWA 4O2DA 4DUZL 4AYBE 1NMGA 5HY6A 2BA1A 4QL5A 1JJCB 4WJ3M 2K52A 2EJFA 3UFGA 4H2XA 4GOPA 3QNEA 2DTOA 3RLOA 3RLFA 1KL9A 4XTWA 4HWSA 1N32L 1EOVA 4HWTA 4OWTB 1RIQA 4A3DH 1X01A 4IFDG 4FDBA 2YTXA 5IE8A 4LFBQ 2OQKA 4XU1A 2GN5A 1G5HA 1KD1C 4AQYL 1SR3A 1V43A 1KQSA 3M4QA 2E3CA 3HXYA 5C51B 2PNHA 2ZNJA 3HTZA 4DV5Q 1XPUA 2JA5G 1B70B 2I5LX 2ZR2A 2NVTH 4GKJL 1PVOA 2UUAL 4L5RC 4JI5L 4IO9A 4OX9L 1P16A 3D0FA 4HJ5A 3TRZA 4Q15A 1G51A 1EIFA 1XMQL 1YJWA 4L5TA 1KRTA 2QA4A 1SMXA 2UXBQ 3E0EA 2AWNA 1CUKA 3V8LA 4H2XB 1D8LA 4P3OA 3PO3G 4IOAA 5BR8L 1OXSC 4IPGA 2Q2TA 4B3RL 3J80c 2PQAA 3KFUA 4LF8Q 2NVXH 3H3VH 3L0OA 5LMNL 3RGLA 4WI1A 2ZTCA 4YRLA 1S3OA 5M5YH 1Q1EA 1X55A 5JJLA 1KIXA 1B7YA 3HRKA 3A31A 3GTQH 2EXDA 1SETA 2JA7H 4QQBX 1EWIA 1ASYA 4LUVA 2E1HA 3QTCA 4XIGS 2XGTA 2YU9H 3SGIA 4NCXA 2ZIOA 3REXA 2UU9Q 4LUZA 2DTIA 3AQQA 3I4OA 4J15A 1VQCA 4YRCA 4LF4Q 1Z9FA 2FXQA 3D31A 1WCMG 2YYZA 3RF1A 2JJQA 2F4VL 2B29A 1W3SA 2OCEA 4LFCQ 3OW2A 1HNWQ 3AYHB 3PUZA 1AH9A 2PQAB 3FKIG 4P75A 1VQ8A 1UE7A 3KDFA 4NB3A 3M9BA 1O7IA 2E65A 5JJKA 1IBML 1JT8A 2NN6I 5C0XI 4DR7L 2CQOA 1HR0L 4DR1L 5KNNA 3P8YA 3CD6A 3A7UA 3PCOA 4TVYA 1B7YB 4LF5Q 2E2IH 2HQLA 2ZIMA 1PH7A 4OXPA 2Y0SG 1RL2A 4PMWA 2DU7A 4UP9A 5M3MG 4X64L 2EL9A 2ZJPA 5IP9G 3ULLA 2IT1A 5C44H 3NETA 5E3IA 4JBJA 1UE6A 1BIAA 2CCZA 5F5WA 3HOUG 3V8KA 1Q82C 3IRBA 1MIUA 5FLMG 5C0XJ 1MJCA 3KDFB 1VQ9A 1X2GA 4DV5L 1Q7YC 1NMFA 5M3FH 3H3VI 3J7A5 1WLEA 3RZOH 2N3SA 3V8JA 4BW9A 4JI3L 2Q2UA 1HZAA 2K5NA 1YVCA 3J7ZC 1LTLA 4DV1Q 2IHEA 1VQ5A 2A1AA 2K5HA 4DR2L 4YDQA 3S16H 1SRUA 3GTLH 4H2WA 1YI2A 3CPWA 2UXBL 4A3FH 3CCQA 4CS4A 1HZ9A 4LUOA 2D62A 2A19A 4A3CH 2DDZA 3UDFA 1K83H 3AFPA 1WI5A 1PYSA 3IALA 4PZ8A 4LF8L 3CAMA 2Z6KA 3I4MG 4HIDA 3PF5A 4QIWE 2HT1A 3I4NG 1PFSA 1Z7NA 3ER0A 3QO5A 4A3JH 5C4XG 1J6QA 3I7FA 4LNSA 3J80i 4P73C 2C8MA 4YP0A 1L0WA 4IPDA 2UXDQ 2ZXFA 4JOIA 2UU9L 5K36G 4LF4L 4R4CA 1YHAA 4JBMA 1WYDA 1I3QH 4KR3A 3CQZH 4Q6GA 2ZTEA 4TVAA 1B76A 5IYCH 1Y1VG 4LFCL 2FYKA 1HNWL 3W1GA 2EIFA 1L1OC 3ZJYC 3G1ZA 5LMUQ 1E24A 2AWOA 1USYC 1KC8C 4Y7NH 1E7ZA 4NXNQ 1K3RA 5ELNA 4LF5L 2AMCA 3H15A 3J81i 3A32A 3E9HA 2J3MA 3DSQA 4GN5A 1UEBA 1XTDA 4XEOA 4B3SQ 4YRQA 3STBD 4DK6C 4NXMQ 1X3EA 4P72A 1IL2A 3S24A 1PH6A 3A5UA 5IYDG 2HNIA 2Q5HA 1MKHA 4A3GH 4L5SA 3EFRA 4YCUA 4RQEA 2DQ0A 4JG2A 4GOPC 1HTTA 4DV6Q 1NJ1A 1GVPA 3DLLA 2LXJA 1YHBA 4K0KQ 3K81C 1PH1A 4HJ7A 2JK8A 4BY7H 5K1XA 4RG1A 4H2YA 3HKZE 2JA6G 3S1QH 2ZNIA 4DV1L 4A3KG 3K7AH 4X62L 1WFQA 4B3TQ 5HGQA 4OO1I 5GROA 1SLJA 1KAWA 2KHJA 1PH3A 2LSSA 2DTHA 1PHJA 2AMCB 1C0AA 4HVCA 2JEAI 2NZOA 3PIOA 4OONA 1M90C 3RNUA 4UY8C 2VUMH 4A3EH 3FHWA 1U5KA 5C4JH 4GS3A 4CH5A 4PZ7A 2ZCEA 2RF4A 4DUYL 4XTUA 3VQVA 3ICAA 4MNOA 1BBWA 1Y1WH 1VS0A 4RDXA 1WOCA 2BH8A 3HRIA 1V1QA 3TQYA 4A3LH 4P71A 2ZT5A 4GN3B 4YRRA 1OXXK 5GAHC 1QVFA 1NE3A 2J3LA 2AHOB 1R9TH 2E2HH 2E5AA 4HA8A 3L2PA 1J5WA 1VQGA 4PHCA 1IBLQ 1SROA 4A3BH 2B63H 4DPGA 1NY4A 4GLVB 1KMMA 1TXYA 2G4CA 3TREA 3HXZA 4YRKA 3T1HQ 2CIMA 3HFZA 3L7ZC 1JJ2A 4B3MQ 1GD7A 4DV2Q 4GKKQ 2IX1A 3NEMA 4JV5Q 3GO5A 2MO0A 4YYEA 2PMZE 4MZ9A 1E22A 1LM0A 1V9PA 4DV4Q 2CGHA 4CH6A 1OXTA 2DKGA 4GNXC 1JJGA 2CWAA 2MNAA 1BIBA 5LMUL 4L87A 2ODRD 4JYAQ 2WB1E 3T1YQ 2I5MX 5K1PA 3RACA 2CWPA 2ZR3A 3FP9A 3S15H 3U4ZA 3WWVA 4YRJA 5C3EG 2N49A 4H2VA 2DEQA 1GM5A 2ZM6Q 1WCMH 1BKBA 1YFTA 3RKXA 4AH6A 4B3SL 1I94Q 1LYLA 1HZBA 3S1MH 4NXML 1LUZA 3FKIH 2R7FA 3RKWA 1U0LA 1J5EQ 4C3JH 1VQZA 1UWVA 4IFDI 3HFZB 2EJ9A 4BXXH 5IY0A 4QGUA 5IP7G 4DV6L 4K0KL 4HWOA 3REUA 4PG3A 2K5VA 3M7NA 5GAGC 2JEBI 1WNLA 4X65Q 2E2JH 1WPYA 4HWRA 1PV4A 4DQ2A 2JA8G 1XNQQ 5M3MH 5EAYA 5IP9H 4B3TL 4NPSA 1NJIC 1WQWA 1YITA 1WQ7A 3EBEA 2WAQG 2VQFQ 3HOUH 3GD7A 4IFDJ 4A3DG 3L4GA 3G6EA 3STBC 4HWPA 3H0GG 2NN6G 3OD1A 2UUBQ 4RQFA 3HOYH 1GKHA 2I4MA 2OTLA 3VQXA 2ALYA 3P8TA 4IJHA 4XTZA 3HOZH 4GN4B 2IX0A 4JI0Q 3J81c 4LNQA 3ULPA 1EIYA 2ZT6A 1B8AA 2ARTA 4YRSA 3LSQA 5IYBG 3CP0A 2R93G 3CF5A 5J3BA 4DR4Q 1IBLL 2R7DA 2K50A 3RLNA 4P74C 1N33Q 1S40A 1VQMA 3S17H 1X54A 3ICEA 2QHTA 1VQHA 3PV0A 3KJPA 3T1HL 3F2BA 4YWKA 3KLWA 1CKNA 4H02A 1XNRQ 4B3ML 3I4NH 4DV2L 1IBKQ 4GKKL 1X2HA 5GAEC 3L4GB 2NVQH 2QHVA 4JV5L 4TQFA 4YPFA 1TWGH 3WQZA 1EVLA 4CS3A 1NTGA 2JE6I 4LFBL 2KCTA 4JYAL 4A76A 4DR3Q 1YBYA 2ASBA 2ALYB 4JC0A 3T1YL 4XU2A 4K87A 1CKOA 3W5OA 3EN2A 4DNIA 4Y52H 2EJGA 1EIYB 2H5XA 3TEGA 3VBBA 4YCVA 2ZM6L 1Z47A 3HFVA 2ZTDA 2Q7HA 3JAMc 3KJOA 2OTJA 5M5XH 1Y1VH 2NVYH 2ZTGA 1I94L 4A4IA 4IOCA 2IY5A 2E5LQ 3A7AA 4YRNA 1QZGA 4A3IG 1J5EL 3DM3A 2Q5IA 2R6GA 4A93G 1EQRA 1CKNB 3CCSA 4QJFA 2ZT7A 3KYHC 3CC7A 2VY3A 2RHQA 1EQQA 3S1RH 1YEZA 3K0XA 5DLQE 2ES2A 3W1BA 1NYRA 1KXLA 2EAYA 4KQEA 1A8VA 1HNXQ 1BBUA 2ZZEA 4XEMA 2ODRC 4A75A 4X65L 4YWLA 1VQPA 3PGZA 1VQIA 1XNQL 2Q2IA 1PH2A 3KOJA 1Q12A 4JI7Q 1FJGQ 5IYDH 3A5YA 1KRSA 4P3NA 4BBSG 5FJ8G 3TS0A 1W66A 2Y0SE 4DAYB 1VQFA 2ATWA 1H4QA 3HOWG 1TWAH 2IY5B 3E9IA 3VDYA 2K14A 3CCEA 2UUBL 1D7QA 2DVEA 3GTOH 4DUZQ 1ASZA 4A3KH 2RHQB 1Q8KA 5M3FG 1H95A 4JI0L 3RN5A 2N78A 4QY7A 2ARSA 2WP8J 1VQBA 3HXWA 4KHPQ 1A0IA 3S14H 1GO3E 4G85A 1JMCA 2CFMA 3AFQA 4DR4L 2C7IA 2I4OA 2RCNA 3A74A 3NENA 4OWWB 1FVIA 3HOXG 4DR5Q 1N33L 3BZKA 3NBHB 3HKSA 5AJ3Q 4A3CG 1XNRL 1XJVA 4KI0A 1IBKL 1YZ6A 2I4NA 3CCRA 3HOVG 1ADYA 3Q8DA 3U50C 4YRFA 1NJ8A 3PIPA 4GKJQ 3G71A 4APVA 1PA6A 1NNHA 4A3MG 1N36Q 4OX9Q 1PH5A 2VZAA 4OO1G 4X6AH 2KBNA 4DR3L 1H4TA 3I55A 4YREA 1I6HH 1HNZQ 4AYBG 1HXDA 3EFSA 1YFSA 1UE1A 4KHZA 1VQ6A 4POGA 1HJPA 3GTKH 4X5OA 3PUVA 2VQEQ 1XMOQ 1AE3A 4P73A 1SRYA 2I5HA 4DKAC 1JE5A 4MTNA 5GQOA 2E5LL 4HJAA 4C2MH 3VQYA 3BFMA 3GTMH 1NBWA 1TWCH 1Q86C 5IYCG 1NJ6A 4BY1G 3UE0A 3RIRA 3G48A 4R1JA 3UDGA 4XTYA 1PYBA 3VQWA 3JAMi 3V7RA 1VQDA 3MEFA 5JEAJ 3PO2G 2ZGWA 1SN8A 2JA5H 4PZ6A 4H2UA 1DGSA 1L1OA 1HNXL 4LFAQ 3RKYA 3HXUA 4H2TA 4XTVA 5IWAQ 3RL6A 2OQ0A 3U4VA 1NJ2A 2EQSA 2ZZGA 1YJNA 1USYA 2BH2A 2F4VQ 4K86A 1FJGL 2ZJQA 4G84A 3LC0A 4XTCS 1I50H 1P8LA 3PO3H 1X3GA 11ASA 2YV5A 2PI2A 2UXDL 5IP7H 2F3IA 3HXVA 3QO8A 1M1KC 4EQ5A 4A3GG 2Q7GA 4LF6Q 1HR0Q 1WJJA 2ZINA 4R4QA 4DV0Q 4JI2Q 1N34Q 3CC4A 2R92G 2QEXA 2ARUA 1SERA 3U58A 4YHHQ 3EIVA 2JA8H 3MXNB 1VQEA 1VQ4A 1QF6A 4BY7G 4IPCA 4DV7Q 3BJUA 4YRIA 4LWCA 4OP0A 2JA9A 1S72A 4AIMA 3CCMA 1VQNA 1VQKA 4X64Q 1L1OB 2NZHA 4KHPL 3M85A 1K9MC 2R7ZG 4BBRG 2DZCA 1VQLA 3GTGH 3PSIA 4NXNL 3H0GH 3ULJA 4P75C 4HIMA 1QUQB 1K0RA 1A63A 1E1OA 3GDEA 4DR5L 2VUMG 4A3EG 3F2DA 5AJ3L 4EO4A 2DJZA 3IG2A 2YTVA 2V1CC 2DU5A 3TEHA 5LMNW 1Q46A 1XPOA 4JI3Q 4UPAA 1K8GA 1Y1WG 2P0LA 1KHIA 3J81j 5IYBH 1N36L 2R93H 4YWMA 4DR2Q 1IYJB 4IJLA 4A3LG 5ELOA 3A5ZA 3K80C 4BWAA 2CJAA 4O0AA 1Y14B 1HNZL 4YRPA 1SE8A 1EVKA 4XU3A 1VQOA 3PF4A 4GOPB 3W3SA 2ID0A 4X66Q 1YJ9A 4A3BG 4YY3Q 1T9HA 2B63G 3V7SA 3RR5A 2VQEL
chains in the Genus database with same CATH superfamily
3M4YA 4MTKA 1GHJA 1RIPA 4ZLTF 1CKMA 5G3LF 4DF7A 5M5WH 1ESFA 1XMOL 3M4OH 3RUZA 4A3FB 4HJ9A 1CHPD 4K88A 4ME3A 3P8VA 3QO7A 5C6AA 4XT3B 4C3IH 1SMYC 1X9NA 4DV3Q 1RCVD 3BG3A 1H9SB 4O1NA 2L15A 1DD2A 4OWXB 2AKWA 1K83B 3IKJA 2XWBB 3DXJC 1C9OA 1LTGD 4GLAC 3TEHB 4ZTZB 1PH4A 1NJ5A 5FLMH 3FPPA 1TS2A 2Z0SA 4XT1B 2A74C 4DK1A 5C0XG 3RZDH 1HH2P 4FXDA 3CMAA 4RGNA 4K8IA 4LW1A 1VQJA 4J8QA 2ZT8A 3C46A 4DAVA 2K4KA 5JPMC 4UP7A 1VF5C 5IGEA 1HR0W 4HIKA 4A3JB 2J7ZA 1BCPD 1KOGA 3F8TA 2CKZB 1DOKA 5IGBA 3OTOQ 3ND8A 1HXYD 4LFAL 1JB3A 3A5ZB 4J1MA 2A8VA 1I4RA 2D9UA 4YRMA 2BDOA 4GNXA 1Q1BA 4H44C 5IWAL 4JI8Q 1CSPA 3DM1A 4ZUJA 4KD3A 3KF8A 2C5CA 5D65A 1X3FA 1YGBA 1MI2A 4A3IH 5DM73 2HD3A 5EKIA 3IKMB 3SEBA 3FEWX 1A3UA 2UUCQ 4R4OA 2EPBA 2Z6KC 1RTOA 1TWFH 1Q8IA 2EYPA 2QW7A 4A93H 3HG9A 4YRGA 1RTNA 1KNAA 1U4LA 3HY1A 3SHLA 1UE5A 4FF2A 2PMZB 1I3QB 3NELA 4C3JG 4JI6Q 1IW7D 1STHA 2NS6A 2GVBA 1Z7MA 4XQJA 1HZCA 3R07A 1AE2A 4TQDA 5C52B 3L1AA 3T4AC 1FGUA 4BXXG 2UXCQ 2Z4IA 2YTYA 3I4MH 3CPFA 4LF6L 1FNWA 3A0JA 3I90A 3NQIA 5E7NA 2Q8IB 4F87A 1VQ7A 4DV0L 4KKTA 1W6JA 2AKWB 4JI2L 1N34L 4LVJA 3K5MA 2A6EC 4KK7A 2CJ9A 1PH8A 3WDNA 2I0QA 3MZ5A 3K58A 4YHHL 2DUDA 3D8GA 4H2SA 3UGQA 2E8GA 5C4XH 4JOIC 1NCVA 4DV4L 2DXUA 4G57A 1SYCA 2XTIA 2E10A 1CSQA 4DV7L 1LACA 5IT9c 1FL0A 5FLXc 1QZHA 2Z1CA 4Y7NB 4BBSH 5FJ8H 1Q90A 2K7VA 1F2LA 4KKSA 1MJEA 2K03A 2B2TC 4WJWA 1G5IA 3CCUA 1STEA 1PTOD 3G6JB 1HFNA 2M00A 2JA7G 3K5LA 4H0LC 4H7BA 4GNXB 3HOWH 2EY5A 4TTVA 4LF7Q 4DR6Q 5K36H 1WU7A 3KF8B 1PXUA 3S2HH 3F2UA 2WAQE 3BZDB 2VW9A 2A5HA 3J7YW 3UDIA 2IWHA 4XQNA 2HDLA 4F8MA 4ALPA 2F0HA 4HJ8A 1PRTD 4B9XA 2QHSA 1G291 1DOMA 4A3GB 3D6CA 3VR6A 4LF9Q 4L5QA 1SYGA 2QF7A 3N52A 2RDGA 2WACA 2E64A 1QVCA 2KA7A 3MQZA 3BZCA 1Q81C 4R4IA 2Q8TA 3CCJA 3HOYG 3LGJA 3Q6SA 1YIJA 4TRDA 4CS2A 1YHQA 1ILQA 3CW2C 3S1NH 2B2YC 2R92B 3FJPA 4X62Q 4C1NK 2F52A 3HOZG 1FYFA 1TU2B 5F2DA 1OTCA 2RHSA 3PCOB 1CQFA 2OWOA 1QVGA 4TSSA 2HHHQ 2ENBA 5I4DA 4BY7B 1EU3A 4ILWA 3PUWA 4HTHA 2PMFA 1N8RC 4JK1C 4P72C 3S1QB 4JBWA 1OXVA 4WF2A 2Z6BA 3VR3A 3V96A 2QHUA 3HOXH 4JI4Q 2X6LA 4IUTA 4R8NA 4X66L 3HRZC 2KECA 3I4LA 4HSVA 1VCIA 3E3XA 2B3GA 4OEMB 1G6ZA 4RGTA 4YY3L 1K8AC 3TUPA 2K32A 4JI1Q 3TDQA 3OYYA 3TS2A 2N55A 4DUYQ 3GTJH 2N8NA 3HOVH 1MSGA 2DQ3A 3M4PA 4CDDC 1KMNA 2BA0A 2SDFA 3IL8A 2VUMB 4A3EB 2C35B 3UE1A 3D6WA 4DV3L 4BA1I 4CH4A 1X6OA 4A3MH 3OMGA 4YRTA 5C4JB 1G6PA 3HY0A 3CHBD 1JB7A 5C44G 1D1KA 4P74A 2VQFL 4C3HH 5A2QL 3M3YB 3EJIA 3NHHA 5JPNC 1SE3A 2Q2HA 1F9PA 5CV5A 1N9WA 1SFOH 1YFRA 3IKLA 1I5FA 1Y1WB 4V0BA 1C7YA 4CH3A 3TZDA 3PUXA 2DGYA 1PDQA 5FO7B 1ATIA 2CVRA 3HXXA 3KBGA 2LXKA 1HC7A 4CKBA 3HKZG 2VNUD 2Q8RE 2JA6H 4HN7A 2RHSB 3OTOL 4GLXA 4JBKA 4NKLA 1ADJA 4E51A 1D6EC 1H4SA 1R9TB 2XIWA 4ZIBA 2E2HB 2P5IA 4JI8L 4FF1A 1L2FA 4KR2A 1O7YA 1VQAA 5E3FA 3CCVA 5CYUA 3R2TA 3MFGA 2Q7EA 1AEXA 1QE0A 1BDOA 2G9HD 4HCSA 4POFA 2D0OA 1A62A 4RCOA 1XPRA 4A3BB 3PZCA 2B63B 1N32Q 1E1TA 1PYWD 1EEID 4U68A 5EBDA 2UUCL 4BY1H 12ASA 4OIKA 5E4WC 2JSOA 3UDXA 5CC4A 4EX5A 3T56B 5H1SE 1TWHH 1PYSB 2KENA 1WVLA 3CMQA 2VL6A 1GGMA 1EFWA 2XNAC 4JI6L 3TP8A 1SMYD 4A3FG 2PZUA 2K33A 1U4RA 5LL6S 3PO2H 5JEAG 3PUYA 4P71C 4AQYQ 2F1MA 1H4VB 2UXCL 2GVAA 2JQOA 3F1ZA 4KJOA 3JC66 2HIVA 2L1BA 3X3MA 2CJBA 4BA2I 1HA5A 2G9DA 5JJIA 4KD4A 2DNCA 2KCMA 3K7UC 4XU0A 1I4GA 1LT4D 2ICIA 2UUAQ 2HIXA 3S15B 3KF6A 3G4SA 4JI5Q 4HSPA 4RMFA 3RUXA 4DAMA 2EYFA 3V7CA 2X69A 3R8BA 4A3JG 1BCPC 3OMCA 2XSCA 1XMQQ 1X65A 2PMEA 4XQQA 1WCMB 2E76C 3MF1A 4YROA 2IHFA 4LF7L 5C3XA 3S2DH 4DR6L 4C1NI 1X3QA 4ZTUB 1BNZA 2XN9C 4OHJA 4TVAB 5BR8Q 5K5PA 5C53B 4BWGB 5FOBB 5KGUA 4B3RQ 3S1MB 5JJZA 1FNUA 1JCKB 1CA6A 5J1ZA 3LSSA 3FKIB 1WTXA 2PI2E 3I56A 4NMZA 3CC2A 3CCLA 1K73C 2R92H 4C3JB 2MO1A 4CKCA 2K75A 5LMNQ 4JCVE 4LF9L 4WJ4A 3SR1A 1KLUD 1YNJD 3ND9A 1PH9A 4DNTB 1OXUA 1IW7C 4RA8A 4FXKC 1EYGA 4P3PA 3FDTA 2I4LA 2QGQA 1X56A 4DK3C 1MD2D 3K8AA 3I2ZA 5IT9L 5FLXL 3K57A 4LAAA 2BOSA 2WB1G 4HIOA 2EWNA 1E3PA 1D2BA 2ZZFA 4OLFA 2SNSA 1PZKD 3CXCA 2R7ZH 1B4OA 4BBRH 2KQ3A 5GADC 5C3EH 2HHHL 1JJCA 2F0FA 3UH0A 2ZJRA 4QUCA 1FGBD 1EUJA 2E2JB 2I46A 3K59A 3E5SA 1LTSD 3KF6B 2KHSA 1F77A 4WFN3 3MEYA 1YB3A 4JI4L 5M3MB 1YNXA 2VXWA 3L2ZA 3AEVA 1KDBA 2EXZA 2TSSA 3GTQB 2NTTA 3MF2A 1SYDA 2WFWA 3H09A 2D0PA 3JAML 4TVWA 4ZKCB 1IXRA 4JI1L 3B6YA 4R4TA 4XTXA 4IPHA 3SVMA 1JWMD 3OOCA 3M3YH 3IFTA 3H94A 4JI7L 1O7ZA 1QUQA 3A7RA 4UP8A 4FXGC 2A8EA 3UGTA 5NUCA 3NTKA 1IZ6A 4ZYSA 5KIXA 1X3PA 1SYBA 2DZ9A 4TWAA 2KHIA 2JN4A 4M1UB 3BU2A 1EWCA 3RN2A 1SESA 2MFIA 1LV9A 1PRTC 1A3TA 3ERRA 1BVSA 1B70A 3HOYB 1RDPD 4KLKA 2E41A 1JC7A 1ZYRD 3ERSX 1W2BA 1IBMQ 4DR7Q 3GTPH 2O4XA 2VS1A 1NYQA 2PZWA 3CMEA 3TP6A 2OT2A 3F2CA 4DR1Q 3HOZB 4TQUS 2MQHA 2DXTA 4YCWA 1JR0D 4O2DA 4I65A 4DUZL 2K5WA 4AYBE 1A2UA 4DXFA 1NMGA 2L4NA 5HY6A 2BA1A 5CORA 1F2YA 4QL5A 4IQZA 1U9RA 1JJCB 4WJ3M 2K52A 4KY5A 3X3NA 4HMJA 2EJFA 3UFGA 4H2XA 1I4QA 4GOPA 3QNEA 5I6YA 4ZRZA 2DTOA 3RLOA 3RLFA 1KL9A 2PQEA 1WTWA 4XTWA 4HWSA 1CFMA 1N32L 4F7XA 2F0QA 1EOVA 1M4VA 1Y8OB 4HWTA 4OWTB 3S17B 1RIQA 3Q0AA 4A3DH 1X01A 4IFDG 4FDBA 2YTXA 1Q3LA 5IE8A 1XXGA 2NN6H 1T5XD 2C9OA 5C0XH 4K2LA 4LFBQ 2B2WA 1NR2A 2OQKA 3I4NB 4XU1A 2B2VC 3DEOA 2GN5A 1G5HA 5JVG3 3MXUA 1KD1C 4AQYL 2NVQB 3KUPA 4RAUC 1SR3A 1V43A 2EY6A 4NDXA 5C5LA 1KQSA 3QR8A 1TWGB 3M4QA 2RSNA 2E3CA 2VB3X 3HXYA 5C51B 2PNHA 3SE0A 2ZNJA 3HTZA 4E6IA 2X6GA 4DV5Q 1XPUA 2JA5G 1B70B 2LFNA 5TSSA 2I5LX 1HQMC 2ZR2A 2NVTH 4GKJL 1PVOA 1SBBB 1EOTA 2E2DC 4F88A 2UUAL 4FVMA 4L5RC 4JI5L 3HKZB 4IO9A 4OX9L 1P16A 3D0FA 4HJ5A 3T51B 1TR5A 3TRZA 4X3KA 4Q15A 1G51A 1EIFA 1XMQL 1YJWA 4L5TA 1KRTA 1SSOA 2QA4A 1SMXA 2UXBQ 3E0EA 2AWNA 1CUKA 3V8LA 2WKCA 1HFGA 4H2XB 1BQQT 1D8LA 1FR3A 4P3OA 1DYQA 3PO3G 4IOAA 5M5XB 1Y1VB 3VYTA 1OXSC 3I73A 4IPGA 5BR8L 1JWUD 2Q2TA 2SEBD 4B3RL 5DEHA 4KN4C 5IODA 3J80c 1EYAA 2MJ8A 1STYA 2PQAA 2F3WA 1R4QB 3KFUA 4LF8Q 2NVXH 3H3VH 3L0OA 5LMNL 3RGLA 4WI1A 4QMGA 2ZTCA 3W2DA 3A54A 4YRLA 1S3OA 2F0MA 5M5YH 3AMUA 2EJGC 1Q1EA 3QG1A 4DAPA 1X55A 3S1RB 5JJLA 4LMQD 2D5DA 1KIXA 1B7YA 3HRKA 3A31A 4X3SA 3EA6A 3GTQH 2EXDA 1SETA 2JA7H 3N6RA 2F0NA 5J22A 2RA4A 3PQIA 4QQBX 1EWIA 1EY6A 1ASYA 4G7OC 1JOOA 4LUVA 2E1HA 1B9MA 3QTCA 4XIGS 2XGTA 2YU9H 3BVZA 3SGIA 4NCXA 2ZIOA 3G7LA 2F4IA 2DJFC 1WTOA 3REXA 4DA2A 2UU9Q 4LUZA 4RFBA 1Y69U 2DTIA 2DNEA 2K6AA 3AQQA 3I4OA 1SNQA 1VQCA 3P75A 4J15A 4YRCA 4LF4Q 1Z9FA 2FXQA 3D31A 1WCMG 1HCZA 1R4PB 4G7HC 2YYZA 3RF1A 1EQTA 3QB3A 3KBXA 2QKIC 4K5WA 1CQVA 2JJQA 2K5QA 3I8ZA 2F4VL 2B29A 3A8IE 1W3SA 5CMDA 2E75C 3HGBA 1PTOB 2OCEA 4ID6A 2LY7A 4LFCQ 1UNSA 1TWAB 2H4OA 3OW2A 1HNWQ 5E1FA 3D4RA 1L0YB 4HCEA 3AYHB 4K2KA 3PUZA 3QO2A 1AH9A 2PQAB 3E6ZX 3FKIG 4P75A 1VQ8A 1UE7A 2L12A 3KDFA 4NB3A 4FP5D 5ELBA 3M9BA 1O7IA 1EZ8A 3CQZB 1GUNA 5ELDA 3C1FA 2E65A 2ZXOA 5JJKA 4PV1C 4KY6A 1YNJC 3VR5A 1IBML 1A15A 1JT8A 1I6VC 2NN6I 5JAVA 5C0XI 4DR7L 2CQOA 4FO2A 1HR0L 3LX0A 1TS5A 4A3KB 2WB1B 1WTQA 2BE5D 3L3OC 4DR1L 5KNNA 3P8YA 3CD6A 1XTCD 4IUPA 2HUGA 4ABNA 3A7UA 3PCOA 1B7YB 4TVYA 1WTVA 1K8OA 4LF5Q 2E2IH 4DFAA 2LMCB 2CH4A 2SNMA 2HCCA 3S14B 1AP0A 2HDMA 2HQLA 2ZIMA 1PH7A 3QWNA 4OXPA 2Y0SG 1RL2A 5COYA 4PMWA 1DXMA 2DU7A 2N88A 4UP9A 5M3MG 4X64L 1E2VA 2EL9A 2ZJPA 5IP9G 3ULLA 1FNVA 2IT1A 5C44H 4JW0A 2EY2A 5KYLA 2RBMA 3NETA 5E3IA 1HUMA 1MSHA 4HAEA 4JBJA 1UE6A 4C3IG 1BIAA 1C4QA 3P7JA 2F0WA 3P20A 2A69D 2CCZA 5EGTA 5F5WA 1PFBA 2KVMA 3DWAA 1JICA 3HOUG 3V8KA 4B9WA 3SK8A 4XDXA 2JXMB 1Q82C 5KNBA 3IRBA 1IYVA 1MIUA 5FLMG 5C0XJ 1MJCA 1PLFA 3KDFB 1PTOF 1VQ9A 1X2GA 3J80E 4DV5L 4V190 1Q7YC 1NMFA 5M3FH 2H1EA 3H3VI 3J7A5 1WLEA 2PPBC 3RZOH 2N3SA 3V8JA 4BW9A 1ZYRC 2EYMA 4JI3L 2Q2UA 1HZAA 2K5NA 1YVCA 5JVH3 3J7ZC 1I6HB 1LTLA 1LT3D 4DV1Q 2IHEA 4K5VA 2QILA 1VQ5A 1A3VA 2A1AA 2KJXA 3MAQA 2K5HA 4DR2L 4YDQA 5EPLA 1PRTF 3S16H 1SRUA 5I9PA 3GTLH 3TP5A 3H3VC 1K28A 4H2WA 1YI2A 3MXGA 1IHZA 1DJRD 3CPWA 2UXBL 3DUZA 3C3LA 3TBIB 4A3FH 3CCQA 3K7AB 4YIJA 4CS4A 1HZ9A 4LUOA 2D62A 4QF4A 2A19A 4HT4A 1I4PA 1HTPA 2F0IA 3I91A 3T16A 4A3CH 1KTKA 1ONLA 4C2MB 2DDZA 3UDFA 1TWCB 3GTMB 1K83H 3AFPA 2NUCA 1WI5A 2EOTA 1PYSA 3IALA 3CU7A 4PZ8A 3V05A 4LF8L 1RODA 3CAMA 2Z6KA 3I4MG 4HIDA 2A68D 2E74C 1QNUA 1GJXA 3MEHA 1IKMA 1II3A 4QIWE 3PF5A 2HT1A 1B9NA 1GXDC 3I4NG 2KEEA 1PFSA 1ILPA 1Z7NA 4OO1H 3ER0A 3QO5A 4A3JH 2A6HD 2JA5B 5C4XG 3C1EA 4X3TA 1J6QA 3I7FA 4LNSA 1XX8A 4PQXA 3J80i 1JE4A 1L0XB 3J81E 4P73C 4DGZA 1CZGA 2FHTA 1IYUA 3FPUB 5CV6A 1F2ZA 2C8MA 4N9PA 4PMCA 4YP0A 5DAUA 1TS3A 1L0WA 4IPDA 4KKUA 2UXDQ 2ZXFA 3NK9A 4JOIA 1HHVA 3SK6A 2UU9L 2Z4HA 3SXHA 5K36G 2EY1A 4UHVA 1I4XA 1YNND 4LF4L 4MIUA 1SDFA 2PCFB 4R4CA 4ZAIA 1YHAA 3PO3B 4JBMA 1WYDA 2B39A 2Z8LA 4DXGA 1ET9A 1I3QH 3NE5B 1TKWB 4Q5VA 4KR3A 3CQZH 4Q6GA 2ZTEA 4TVAA 1B76A 5IYCH 1MHWC 2CQAA 1ZEQX 3OSOA 1QILA 1Y1VG 4LFCL 2FYKA 5FK9C 1HNWL 1KDAA 4ME5A 3W1GA 2EIFA 1L1OC 3NXWA 3ZJYC 4ZQ3A 3G1ZA 2F03A 5LMUQ 1J9OA 1E24A 2EZVA 2AQ3B 4OL7A 1TIID 2AWOA 1BF4A 1USYC 4JVZA 1E0BA 1LTRD 1UUPA 3K5NA 1KC8C 2JA8B 3AU7A 3EQLC 4Y7NH 1BXTA 3KK7A 4EVOA 4H13C 1E7ZA 1LLRD 4NXNQ 1K3RA 1T5EA 2BDNA 1TT2A 2DY7A 5ELNA 3NWTA 4LF5L 2AMCA 1S5FD 3H15A 1W6KA 3ONAB 3A55A 4RHRA 3J81i 3DWPA 3A32A 3E9HA 3OIQA 4S3SA 5ISRA 2J3MA 2WAQB 5KNCA 4XXEA 3DSQA 4WRDA 4GN5A 1D1IA 1UEBA 1XTDA 4XEOA 4B3SQ 3GTGB 4YRQA 3STBD 3J7AF 5EBCA 3H0GB 3R2IA 4I7AA 4DK6C 2FJ2A 4NXMQ 4FF3A 1X3EA 2J4XA 1VMPA 2AQ2B 4P72A 1IL2A 3S24A 1PH6A 3A5UA 4FYDA 4K5XA 5IYDG 2HNIA 1LTTD 2Q5HA 2A73B 1MKHA 4B08A 4A3GH 1VF7A 1WD1A 1LABA 3A8JE 4L5SA 3EFRA 4YCUA 4RQEA 3EROA 2DQ0A 2EJFC 4JG2A 2L11A 4GOPC 1HTTA 4DV6Q 1NJ1A 1GVPA 1U4PA 3DLLA 3UI2A 2LXJA 3Q24A 1YHBA 4K0KQ 3K81C 2R61A 4LJZC 5CV7A 1PH1A 3NQTA 3C2PA 4HJ7A 5D3DA 4EQOA 5EJWA 1DOLA 2JK8A 2R93B 4BY7H 5K1XA 5KNDA 4RG1A 4H2YA 3HKZE 1PFMA 2JA6G 3S1QH 2B2WC 2ZNIA 3FMCA 4DV1L 4A3KG 3K7AH 2SOBA 4X62L 1WFQA 2BE5C 4X3UA 2F0EA 1QG7A 5HGQA 4B3TQ 3I70A 4OO1I 1H9JA 3GP7A 5GROA 1SLJA 1KAWA 2KHJA 1PH3A 1S4ZA 4C56C 2LSSA 2DTHA 1PHJA 1O78A 2AMCB 2EVBA 3Q22A 2IJ0A 4IFDH 1C0AA 2F0SA 4HVCA 2JEAI 2NZOA 3PIOA 4OONA 1M90C 1PZJD 3PIO3 1QOHA 2WIIB 2Y0SB 3RNUA 1SJED 3BDOA 3M4OB 5M5WB 4UY8C 2HQEA 1VDZA 2VUMH 4A3EH 3FHWA 1DZ1A 3HS0C 2RDFA 5CV4A 1QWYA 3VA7A 1U5KA 3RD4A 4C3IB 5C4JH 4GS3A 2B2UC 4CH5A 4TKOB 3D3RA 4PZ7A 1B2TA 2ZCEA 2RF4A 4NW2A 4DUYL 4XTUA 3VQVA 3ICAA 3K6OA 3HOUB 4MNOA 1BBWA 2A69C 1Y1WH 1LT6D 1ENAA 1VS0A 4RDXA 1WOCA 2BH8A 1MBYA 3HRIA 1V1QA 3RZDB 4LVKA 3DWQA 3MFYA 3TQYA 1FYCA 4OGQC 3OWFA 4A3LH 2QCPX 4P71A 2ZT5A 5EPJA 1DONA 4GN3B 3W3AA 2MGSA 1LTAD 1OXXK 1S5BD 3LWEA 5GAHC 4YRRA 1QVFA 1NE3A 2J3LA 2AHOB 1R9TH 2E2HH 2E5AA 4HA8A 1SJHD 3BVGA 3L2PA 2F0VA 1J5WA 1VQGA 4PHCA 4KMUC 1IBLQ 2L0CA 3DMUA 4HEDA 1SE2A 1Z7TA 1SROA 1WTPA 4A3BH 2WKDA 1HQRD 4DPGA 1NY4A 1OO9B 4GLVB 4CDFC 2B63H 1U4MA 4QCLA 1KMMA 1TXYA 4A3IB 2G4CA 2FMCA 3TREA 3HXZA 5L37A 2PNRC 1EQVA 4YRKA 1BR9A 1TWFB 1F9RA 4A93B 1STBA 4K8JA 3T1HQ 2CIMA 3HFZA 3L7ZC 1JJ2A 4B3MQ 2XRQD 1GD7A 1TQOA 4DV2Q 4GKKQ 2IX1A 1SEBD 3NEMA 5FO8B 4JV5Q 3GO5A 2MO0A 4YYEA 1EIGA 2PMZE 4MZ9A 1E22A 1LM0A 1V9PA 4DV4Q 2CGHA 4CH6A 3NSWA 4KTAA 1OXTA 4ZKBB 4U673 2EE1A 3I4MB 2DKGA 3T53B 1KNEA 4GNXC 1JJGA 2CWAA 2MNAA 1IKLA 1BIBA 2RSOA 5LMUL 1A2TA 4L87A 2ODRD 4JYAQ 2A68C 4CDCC 1GUWA 2WB1E 3T1YQ 2I5MX 5K1PA 1GUSA 1KDCA 3RACA 2CWPA 2ZR3A 2AUKA 3FP9A 4L6TB 3S15H 3LWUA 3U4ZA 3WWVA 4YRJA 5C3EG 5C4XB 2N49A 2GA4B 4H2VA 2A6HC 3LNNA 4CKEA 5A35A 2DEQA 1GM5A 2ZM6Q 1WCMH 4J6HA 3TSSA 1BKBA 4CJ0B 1KABA 1X32A 4KJNA 4DNRB 1YFTA 3RKXA 4EQPA 4AH6A 4B3SL 1I94Q 1ICWA 1LYLA 1HZBA 3S1MH 4LVIA 5DM63 4NXML 1LUZA 3S2HB 3FKIH 3HZXA 2R7FA 1G91A 3RKWA 1U0LA 3GQBA 1J5EQ 1E2ZA 3MC0B 4ZCKA 4OELB 4C3JH 1VQZA 2F0PA 1UWVA 1YNNC 4IFDI 2EYLA 1LTID 3AB9A 4QB4A 1BCPB 1SE4A 3HFZB 2EJ9A 4BXXH 4IUUA 4O42A 4CHTB 2NVYB 5IY0A 1BBXC 2EYJA 1GUOA 4R8IA 1TY0A 5ELFA 3R3OA 5IP7G 4QGUA 5G3LD 1ENCA 5BN3A 1DM0B 4DV6L 2QDLA 4PNYA 3I72A 4K0KL 4HWOA 3REUA 1F2MA 4PG3A 3S1NB 2EYHA 2K5VA 3MWYW 5CGKA 1GUGA 3M7NA 2B8FA 5GAGC 3SK5A 1VMCA 3D4WA 2WINB 2JEBI 1WNLA 4X65Q 3QIAA 1KAAA 2E2JH 1WPYA 4HWRA 4BS9A 3TN2A 2K1BA 1PV4A 5C4ZA 4DQ2A 2JA8G 3MHBA 1XNQQ 5M3MH 5EAYA 5IP9H 3Q23A 4B3TL 1TS4A 1KLGD 1BO0A 4NPSA 3HOXB 1O7LA 1NJIC 1WQWA 4RGOS 3MTSA 2OF1A 3VYSA 1YITA 1WQ7A 2BCOA 4IALA 3EBEA 4Z9CB 2L9HA 1NUCA 2WAQG 4XYQA 2VQFQ 3HOUH 2NB0A 3GD7A 3HP3A 3GTJB 4IFDJ 4EQNA 4A3DG 3HOVB 3L4GA 3G6EA 3V2TA 5I2YA 3CRKC 3STBC 4KY7A 1LT5D 4CDEC 3H0GG 4HWPA 2NN6G 5JOBA 1AZPA 3OD1A 2UUBQ 4IN3A 1NAPA 2O2LD 1SYFA 4IZ8A 3IFDA 4A3MB 4RQFA 2OXPA 3HOYH 3CKIB 1GKHA 2I4MA 2OTLA 4C3HB 5HGTA 3VQXA 1Y8PB 2ALYA 1K8MA 2FMMA 3P8TA 4IJHA 5D3IB 4AYBB 3QJYA 4XTZA 1BCPF 1SFOB 3HOZH 4GN4B 2IX0A 4JI0Q 3J81c 4LNQA 3MA2B 5LHY1 2B2VA 3GTOB 5DNFA 3ULPA 1EIYA 1F9SA 2ZT6A 1QE6A 3SDZA 1B8AA 2CH4W 2ARTA 1GHKA 4YRSA 1EZ6A 5IYBG 1NNXA 3CP0A 3LSQA 1ZXTA 2ZXPA 2KOLA 1B50A 2JA6B 4KV6A 2R93G 1PRTB 1V8QA 4CJ2C 3EVQA 1Z6HA 2CW0D 3KLRA 1D5ZC 4XYOA 4JPBW 3CF5A 5J3BA 4DR4Q 1IBLL 2R7DA 2K50A 1S5ED 5CV8A 3RLNA 4P74C 5J39A 1N33Q 1S40A 1VQMA 2IL8A 3S17H 1X54A 4BY1B 3ICEA 3M7GA 2QHTA 5CBEE 1VQHA 3PV0A 4L63B 3KJPA 3T1HL 3F2BA 4YWKA 3KLWA 1CKNA 5C5MA 4H02A 1XNRQ 2CHBD 4B3ML 1TWHB 3I4NH 4DV2L 1IBKQ 4GKKL 1X2HA 1S5CD 5GAEC 3L4GB 5EKLA 1WTRA 2NVQH 2QHVA 1JOQA 3H6MA 3PO2B 4JV5L 4TQFA 4YPFA 1TWGH 3BYYB 5T1GA 3WQZA 3A8KE 1EVLA 4CS3A 2F0LA 4RH6A 1TY2A 1NTGA 2JE6I 4LFBL 2KCTA 1NR4A 1MGSA 3VR2A 2Z9HA 4A76A 4JYAL 2WV6D 1YBYA 1Y8NB 4DR3Q 1K0SA 2ASBA 2ALYB 4JC0A 2F0GA 3T1YL 1SNMA 2F0KA 3OW7A 2PYKA 4XU2A 4K87A 1QB5D 1CKOA 3W5OA 1STAA 5A2QE 1HPCA 1RJTA 1C48A 3EN2A 1SNCA 1J8IA 1G2TA 4DNIA 4Y52H 1FD7D 2LKVA 1STNA 3ZYYX 1EIYB 2EJGA 2H5XA 3TEGA 1I4HA 1D5MC 1RHPA 2R3ZA 3VBBA 4YCVA 3H91A 3BYTB 2ZM6L 1Z47A 3HFVA 2ZTDA 5FKAC 2Q7HA 4DAYA 1XYIA 3JAMc 1B1ZA 2NBFA 5IGGA 3KJOA 2OTJA 5M5XH 1Y1VH 2NVYH 1GOZA 2ZTGA 1I94L 3S2DB 4A4IA 2PO4A 4IOCA 2IY5A 2E5LQ 3A7AA 3I3CA 4YRNA 1QZGA 4A3IG 5IOCA 3DM3A 1J5EL 2Q5IA 2RCFA 2R6GA 3GTKB 2EYOA 2JYOA 2K5DA 1H9RA 3A7LA 5JEAH 3K5OA 2ZXRA 4A93G 1EQRA 2OEOA 1CKNB 3NUCA 3NBIA 1S5DD 3CCSA 4QJFA 2ZT7A 2K04A 4N8X1 3KYHC 3CC7A 2VY3A 4K6DA 2RHQA 1EQQA 5IGDA 4ULLA 3S1RH 1YEZA 2KCCA 3K0XA 5DLQE 4K14A 3W1BA 2ES2A 1NYRA 2B8GA 1KXLA 3WOFA 1EYCA 2EAYA 1EFID 4UDUC 4KQEA 1G2SA 1A8VA 1HNXQ 1BBUA 2ZZEA 2XWJB 4XEMA 2R7ZB 2ODRC 4BBRB 4A75A 3MVVA 4N9TA 2QDBA 3U9OA 5C3EB 3TMEA 4X65L 4YWLA 1VQPA 3PGZA 2M2LA 1M8AA 4RKBA 4PMBA 1VQIA 3VYUA 3S9WA 2L55A 2L5TA 1XNQL 2Q2IA 1PH2A 3KOJA 1CM9A 1Q12A 4JI7Q 1FJGQ 5IYDH 3BDCA 4DU9A 3A5YA 1KRSA 2M9VA 3EFXD 4P3NA 4BBSG 5FJ8G 1EY8A 5HURA 1B3AA 3TS0A 3NBHA 1W66A 2Y0SE 2G5DA 4DAYB 1VQFA 5KEEA 2ATWA 1H4QA 2DN8A 3HOWG 1PTOH 1TWAH 2IY5B 3J80L 3A7AB 3E9IA 3VDYA 4MHEA 2K14A 1HA6A 1I50B 5I9OA 2IW3A 3CCEA 3NPPA 2UUBL 2F3VA 1D7QA 2DVEA 3VYRA 3GTOH 2B2TA 4Q0FA 2KCNA 5E4XA 5I6WA 4DUZQ 2MHVA 2K05A 4IUVA 3BVMA 1JOKA 1ASZA 4A3KH 2RHQB 1Q8KA 3U9SA 5M3FG 1H95A 3GTPB 4JI0L 1V1OA 3RN5A 4N8FA 2N78A 1XWEA 4QY7A 4QUFA 1ML0D 4LVMA 4HR7B 1PMRA 1QJOA 1EWHA 2F0OA 1EIHA 2ARSA 2WP8J 4RWSC 5M9OA 1VQBA 2FINB 5IGFA 5D14A 3HXWA 4KHPQ 1A0IA 5FLXE 5IT9E 1GO3E 3S14H 4G85A 3NTIA 1JMCA 1EYDA 3OHXC 2CFMA 1AW7A 1RF2D 3AFQA 3K0YA 5C3WA 4G4KA 4DR4L 2RVLA 5I2XA 2C7IA 4LVLA 2I4OA 2RCNA 5AFWA 3A74A 2MPMA 3NENA 2B2YA 4OWWB 1FVIA 3HOXG 4ZUIA 2XRSD 4DR5Q 1N33L 3BZKA 1A6XA 3NBHB 4RKLA 3HKSA 2RDHA 5AJ3Q 5CR3A 1CHQD 4A3CG 1BUVT 3SK4A 4A3DB 2JP1A 3ERQA 1PZID 1XNRL 2P5ZX 1XJVA 4KI0A 2EJMA 1IBKL 1EL0A 1YZ6A 3JAME 5EKKA 2I4NA 3CCRA 4DN4M 3HOVG 3NWSA 2LS01 1ADYA 4RCNA 3Q8DA 1B53A 3U50C 1AFPA 4YRFA 1NJ8A 2ZT9C 3PIPA 4GKJQ 3G71A 3WOEA 2DY8A 3J81L 3PIP3 3OIPA 2NWGA 1EEFD 1HRJA 4APVA 1PA6A 3FVQA 1CA5A 4GZYC 2O5JC 5CV9A 1NNHA 4A3MG 1N36Q 4OX9Q 1PH5A 2VZAA 4CGYB 4OO1G 4EGVA 4X6AH 2KBNA 4C3HG 4DR3L 1H4TA 3I55A 1TVXA 3FRPB 4YREA 4K6LA 1I6HH 1C8CA 1HNZQ 4AYBG 4IURA 2NVTB 1HXDA 5EPKA 2O5IC 5BN4A 4UAIA 3QOJA 5T1IA 1QCBD 5ELEA 2RKSA 1CI3M 1YFSA 3EFSA 2F0JA 2MP1A 1UE1A 3OPOA 5EQ0A 3P1HA 1H9MA 4KHZA 1VQ6A 1UAPA 4POGA 1HJPA 2K28A 1ZKOA 2NTSA 3PMFA 4WORA 1PFNA 3GTKH 4X5OA 3PUVA 2VQEQ 2CW0C 1XMOQ 1SYEA 2F0DA 1AE3A 3NTHA 4HMIA 4P73A 1SRYA 5BN5A 2I5HA 4R9WA 1HTLD 4DKAC 1JE5A 4MTNA 4ZK9B 5GQOA 2E5LL 4HJAA 4C2MH 1EU4A 3VQYA 3BFMA 3GTMH 1NBWA 1TWCH 1Q86C 5IYCG 2V4DA 4QIWB 1NJ6A 4BY1G 3UE0A 5LL6X 3RIRA 3G48A 4R1JA 3UDGA 4G7ZC 3OWEB 2A6ED 2NVXB 4XTYA 2K01A 3T13A 1H9KA 1PYBA 3NP8A 3VQWA 3JAMi 4ODGA 3MXNA 3V7RA 1STGA 2PZTA 1VQDA 5M5YB 3MEFA 5JEAJ 1UEAB 3PO2G 2ZGWA 1SN8A 2JA5H 1V1PA 3BS1A 4PZ6A 4CJ1B 3TZUA 2ICEC 4H2UA 1WTHA 1DGSA 1L1OA 4FF4A 1HNXL 4LFAQ 3RKYA 2TMPA 2JA7B 3DEPA 1CT1D 3HXUA 4H2TA 4XTVA 2QEJC 1PTOC 5KRUA 5IWAQ 3RL6A 2OQ0A 3U4VA 3RMHA 1NJ2A 2EQSA 1WD0A 1K3BC 2KEDA 2ZZGA 1RD9D 1YJNA 2YU9B 1USYA 3GV6A 2BH2A 2F4VQ 4K86A 1FJGL 2ZJQA 3D4DA 4G84A 3LC0A 1SAPA 1CTMA 1SXTA 4XTCS 1I50H 2FFKB 1P8LA 1EY0A 4KHVA 3E0JA 4MN3A 3PO3H 1X3GA 11ASA 2KUMA 1IL8A 2AUJD 2J0TD 2YV5A 2PW5A 2PI2A 3KLSX 5CBAE 3VR4A 2UXDL 1DCZA 5IP7H 2F3IA 4P2CB 3HXVA 3QO8A 1M1KC 4EQ5A 4A3GG 3CRLC 5ELCA 5IGCA 2Q7GA 4LF6Q 1HR0Q 3J7AV 1WJJA 2AQ1B 2ZINA 4R4QA 3DHQA 4DV0Q 3IAYA 4JI2Q 1N34Q 3A56A 3CC4A 2R92G 1GUTA 3GV3A 2MUYA 2QEXA 2ARUA 1SERA 3U58A 4YHHQ 1ICFB 1SNOA 1D5XC 3EIVA 2JA8H 3MXNB 1VQEA 4RGMA 1VQ4A 4I7ZC 1F9QA 5FO9B 4IUQA 1QF6A 4BY7G 4L8JA 4IPCA 1LO5D 4DV7Q 1ENFA 4RHSA 1V1PB 3BJUA 4YRIA 4LWCA 4IUNA 4OP0A 2JA9A 1B44D 1AN8A 1S72A 4AIMA 2PW7A 3CCMA 3TP7A 1E2WA 1VQNA 1VQKA 4X64Q 1L1OB 2NZHA 4KHPL 3O13A 1EY9A 4CBVA 3M85A 1K9MC 2R7ZG 4BBRG 2E2IB 2DZCA 3KLSA 1VQLA 2EDGA 4FNFA 2NZ1D 3GTGH 3PSIA 1EY7A 3QOLA 4NXNL 2IPKD 3H0GH 5IIFA 2IX3A 4BBSB 3ULJA 1JQYD 4HIMA 4P75C 1QUQB 1K0RA 1A63A 1O80A 1E1OA 1H9SA 3GDEA 4DR5L 4OIJA 1JORA 2VUMG 4A3EG 3F2DA 5C44B 3HEJA 3L9AX 1CK1A 2D2CC 5AJ3L 4EO4A 1ET6A 2DJZA 3HOWB 3IG2A 2YTVA 1EY5A 2V1CC 2DU5A 4KN7C 3TEHA 5LMNW 1CZWA 1Q46A 1XPOA 2DJGC 1G8ZD 1B3QA 4LK1C 4JI3Q 1NSNS 1BOSA 5C4HA 4UPAA 1K8GA 1Y1WG 1QNKA 2P0LA 1KHIA 3J81j 1EY4A 5IYBH 2F0UA 3BDLA 3MXPA 5KYIA 1N36L 4DK0A 4YWMA 2R93H 2B2UA 3URYA 4DR2Q 1IYJB 3R93A 5M3FB 4IJLA 1SNDA 5ELOA 4A3LG 3A5ZA 3K80C 3RZOB 4BWAA 2CJAA 4O0AA 1AZQA 2I07B 1ESRA 1Y14B 1HNZL 4YRPA 1SE8A 1SNPA 4M8AA 2F0TA 1EVKA 2VB2X 4XU3A 1HUNA 1VQOA 3PF4A 4GOPB 2RQXA 3W3SA 1JWSD 2ID0A 4X66Q 1YJ9A 2XVSA 4NP5A 3S16B 3GTLB 3ITPA 4A3BG 4YY3Q 1LTBD 2NYZD 3VA5A 1T9HA 2B63G 2HCIA 3V7SA 3RR5A 2VQEL 1RKNA
chains in the Genus database with same CATH topology
1RIPA 1CKMA 5M5WH 3M4OH 1XMOL 4HJ9A 4K88A 4ME3A 3P8VA 3QO7A 4C3IH 1X9NA 4DV3Q 2L15A 4OWXB 2AKWA 1C9OA 4GLAC 3TEHB 4ZTZB 1PH4A 1NJ5A 5FLMH 5C0XG 2Z0SA 3RZDH 1HH2P 3CMAA 4LW1A 1VQJA 2ZT8A 2K4KA 1HR0W 4UP7A 4HIKA 1KOGA 3F8TA 2CKZB 3OTOQ 4LFAL 3A5ZB 2A8VA 4YRMA 4GNXA 1Q1BA 5IWAL 4JI8Q 1CSPA 1X3FA 1YGBA 4A3IH 3IKMB 2UUCQ 4R4OA 2Z6KC 1TWFH 4A93H 4YRGA 3HY1A 1UE5A 3NELA 4JI6Q 2NS6A 2GVBA 1Z7MA 1HZCA 3R07A 1AE2A 4TQDA 5C52B 3L1AA 1FGUA 4BXXG 2UXCQ 2YTYA 3I4MH 3CPFA 4LF6L 3A0JA 5E7NA 1VQ7A 4DV0L 2AKWB 4JI2L 1N34L 4LVJA 2CJ9A 1PH8A 2I0QA 4YHHL 2DUDA 4H2SA 3UGQA 2E8GA 5C4XH 4JOIC 4DV4L 2DXUA 2XTIA 2E10A 1CSQA 4DV7L 1QZHA 5IT9c 1FL0A 5FLXc 4BBSH 5FJ8H 1MJEA 1G5IA 3CCUA 2JA7G 4GNXB 3HOWH 4TTVA 4LF7Q 4DR6Q 1WU7A 3KF8B 3S2HH 2WAQE 2VW9A 3UDIA 4ALPA 4HJ8A 2QHSA 1G291 4LF9Q 4L5QA 2E64A 1QVCA 3MQZA 3BZCA 1Q81C 4R4IA 3CCJA 3HOYG 3LGJA 1YIJA 4CS2A 1YHQA 3CW2C 3S1NH 3FJPA 4X62Q 1FYFA 2F52A 3HOZG 1OTCA 2RHSA 3PCOB 2OWOA 1QVGA 2HHHQ 3PUWA 2PMFA 1N8RC 4P72C 4JBWA 1OXVA 4WF2A 2QHUA 3HOXH 4JI4Q 4X66L 1VCIA 2B3GA 4YY3L 1K8AC 3TUPA 4JI1Q 3OYYA 3TS2A 4DUYQ 3GTJH 2N8NA 3HOVH 2DQ3A 3M4PA 1KMNA 2BA0A 2C35B 3UE1A 4DV3L 4BA1I 4CH4A 1X6OA 4A3MH 4YRTA 1G6PA 3HY0A 1JB7A 5C44G 4P74A 2VQFL 4C3HH 2Q2HA 1N9WA 1SFOH 1YFRA 3IKLA 1I5FA 4CH3A 1C7YA 3PUXA 2DGYA 1ATIA 3HXXA 2LXKA 1HC7A 3HKZG 2VNUD 2JA6H 2RHSB 3OTOL 4GLXA 4JBKA 1ADJA 4E51A 1H4SA 4ZIBA 2P5IA 4JI8L 4KR2A 1L2FA 1VQAA 3CCVA 2Q7EA 1QE0A 4POFA 2D0OA 1A62A 1XPRA 3PZCA 1N32Q 1E1TA 4BY1H 2UUCL 12ASA 3UDXA 4EX5A 5H1SE 1TWHH 1PYSB 2KENA 3CMQA 2VL6A 1GGMA 1EFWA 4JI6L 4A3FG 3PO2H 5JEAG 3PUYA 4P71C 4AQYQ 1H4VB 2UXCL 2GVAA 2JQOA 3F1ZA 3JC66 2HIVA 2CJBA 4BA2I 5JJIA 2KCMA 3K7UC 4XU0A 2UUAQ 2HIXA 3KF6A 3G4SA 4JI5Q 4RMFA 3RUXA 4DAMA 3V7CA 4A3JG 1XMQQ 1X65A 2PMEA 3MF1A 4YROA 2IHFA 4LF7L 3S2DH 4DR6L 4ZTUB 4TVAB 5BR8Q 5C53B 4B3RQ 3LSSA 2PI2E 3I56A 3CC2A 3CCLA 1K73C 2R92H 2MO1A 2K75A 5LMNQ 4JCVE 4LF9L 4WJ4A 1PH9A 1OXUA 1EYGA 4P3PA 2I4LA 2QGQA 1X56A 4DK3C 3K8AA 3I2ZA 2WB1G 2EWNA 4HIOA 1E3PA 2ZZFA 4OLFA 3CXCA 2R7ZH 4BBRH 5GADC 5C3EH 2HHHL 1JJCA 3UH0A 2ZJRA 1EUJA 3KF6B 3MEYA 1YB3A 4JI4L 1YNXA 3L2ZA 3AEVA 3MF2A 2WFWA 2D0PA 4TVWA 1IXRA 4JI1L 3B6YA 4R4TA 4XTXA 4IPHA 3M3YH 4JI7L 1QUQA 3A7RA 4UP8A 2A8EA 3UGTA 1IZ6A 2DZ9A 4TWAA 2KHIA 3BU2A 3RN2A 1SESA 2MFIA 3ERRA 1BVSA 1B70A 4KLKA 2E41A 3ERSX 1W2BA 1IBMQ 4DR7Q 3GTPH 2VS1A 1NYQA 3F2CA 3CMEA 4DR1Q 4TQUS 2MQHA 2DXTA 4YCWA 4O2DA 4DUZL 4AYBE 1NMGA 5HY6A 2BA1A 4QL5A 1JJCB 4WJ3M 2K52A 2EJFA 3UFGA 4H2XA 4GOPA 3QNEA 2DTOA 3RLOA 3RLFA 1KL9A 4XTWA 4HWSA 1N32L 1EOVA 4HWTA 4OWTB 1RIQA 4A3DH 1X01A 4IFDG 4FDBA 2YTXA 5IE8A 4LFBQ 2OQKA 4XU1A 2GN5A 1G5HA 1KD1C 4AQYL 1SR3A 1V43A 1KQSA 3M4QA 2E3CA 3HXYA 5C51B 2PNHA 2ZNJA 3HTZA 4DV5Q 1XPUA 2JA5G 1B70B 2I5LX 2ZR2A 2NVTH 4GKJL 1PVOA 2UUAL 4L5RC 4JI5L 4IO9A 4OX9L 1P16A 3D0FA 4HJ5A 3TRZA 4Q15A 1G51A 1EIFA 1XMQL 1YJWA 4L5TA 1KRTA 2QA4A 1SMXA 2UXBQ 3E0EA 2AWNA 1CUKA 3V8LA 4H2XB 1D8LA 4P3OA 3PO3G 4IOAA 5BR8L 1OXSC 4IPGA 2Q2TA 4B3RL 3J80c 2PQAA 3KFUA 4LF8Q 2NVXH 3H3VH 3L0OA 5LMNL 3RGLA 4WI1A 2ZTCA 4YRLA 1S3OA 5M5YH 1Q1EA 1X55A 5JJLA 1KIXA 1B7YA 3HRKA 3A31A 3GTQH 2EXDA 1SETA 2JA7H 4QQBX 1EWIA 1ASYA 4LUVA 2E1HA 3QTCA 4XIGS 2XGTA 2YU9H 3SGIA 4NCXA 2ZIOA 3REXA 2UU9Q 4LUZA 2DTIA 3AQQA 3I4OA 4J15A 1VQCA 4YRCA 4LF4Q 1Z9FA 2FXQA 3D31A 1WCMG 2YYZA 3RF1A 2JJQA 2F4VL 2B29A 1W3SA 2OCEA 4LFCQ 3OW2A 1HNWQ 3AYHB 3PUZA 1AH9A 2PQAB 3FKIG 4P75A 1VQ8A 1UE7A 3KDFA 4NB3A 3M9BA 1O7IA 2E65A 5JJKA 1IBML 1JT8A 2NN6I 5C0XI 4DR7L 2CQOA 1HR0L 4DR1L 5KNNA 3P8YA 3CD6A 3A7UA 3PCOA 4TVYA 1B7YB 4LF5Q 2E2IH 2HQLA 2ZIMA 1PH7A 4OXPA 2Y0SG 1RL2A 4PMWA 2DU7A 4UP9A 5M3MG 4X64L 2EL9A 2ZJPA 5IP9G 3ULLA 2IT1A 5C44H 3NETA 5E3IA 4JBJA 1UE6A 1BIAA 2CCZA 5F5WA 3HOUG 3V8KA 1Q82C 3IRBA 1MIUA 5FLMG 5C0XJ 1MJCA 3KDFB 1VQ9A 1X2GA 4DV5L 1Q7YC 1NMFA 5M3FH 3H3VI 3J7A5 1WLEA 3RZOH 2N3SA 3V8JA 4BW9A 4JI3L 2Q2UA 1HZAA 2K5NA 1YVCA 3J7ZC 1LTLA 4DV1Q 2IHEA 1VQ5A 2A1AA 2K5HA 4DR2L 4YDQA 3S16H 1SRUA 3GTLH 4H2WA 1YI2A 3CPWA 2UXBL 4A3FH 3CCQA 4CS4A 1HZ9A 4LUOA 2D62A 2A19A 4HT4A 4A3CH 2DDZA 3UDFA 1K83H 3AFPA 1WI5A 1PYSA 3IALA 4PZ8A 4LF8L 3CAMA 2Z6KA 3I4MG 4HIDA 3PF5A 4QIWE 2HT1A 3I4NG 1PFSA 1Z7NA 3ER0A 3QO5A 4A3JH 5C4XG 1J6QA 3I7FA 4LNSA 3J80i 4P73C 2C8MA 4YP0A 1L0WA 4IPDA 2UXDQ 2ZXFA 4JOIA 2UU9L 5K36G 4LF4L 4R4CA 1YHAA 4JBMA 1WYDA 1I3QH 4KR3A 3CQZH 4Q6GA 2ZTEA 4TVAA 1B76A 5IYCH 1Y1VG 4LFCL 2FYKA 1HNWL 3W1GA 2EIFA 1L1OC 3ZJYC 3G1ZA 5LMUQ 1E24A 2AWOA 1USYC 1KC8C 4Y7NH 1E7ZA 4NXNQ 1K3RA 5ELNA 4LF5L 2AMCA 3H15A 3J81i 3A32A 3E9HA 2J3MA 3DSQA 4GN5A 1UEBA 1XTDA 4XEOA 4B3SQ 4YRQA 3STBD 4DK6C 4NXMQ 1X3EA 4P72A 1IL2A 3S24A 1PH6A 3A5UA 5IYDG 2HNIA 2Q5HA 1MKHA 4A3GH 4L5SA 3EFRA 4YCUA 4RQEA 2DQ0A 4JG2A 4GOPC 1HTTA 4DV6Q 1NJ1A 1GVPA 3DLLA 2LXJA 1YHBA 4K0KQ 3K81C 1PH1A 4HJ7A 2JK8A 4BY7H 5K1XA 4RG1A 4H2YA 3HKZE 2JA6G 3S1QH 2ZNIA 4DV1L 4A3KG 3K7AH 4X62L 1WFQA 4B3TQ 5HGQA 4OO1I 5GROA 1SLJA 1KAWA 2KHJA 1PH3A 2LSSA 2DTHA 1PHJA 2AMCB 1C0AA 4HVCA 2JEAI 2NZOA 3PIOA 4OONA 1M90C 3RNUA 4UY8C 2VUMH 4A3EH 3FHWA 1U5KA 5C4JH 4GS3A 4CH5A 4PZ7A 2ZCEA 2RF4A 4DUYL 4XTUA 3VQVA 3ICAA 4MNOA 1BBWA 1Y1WH 1VS0A 4RDXA 1WOCA 2BH8A 3HRIA 1V1QA 4LVKA 3TQYA 4A3LH 4P71A 2ZT5A 4GN3B 4YRRA 1OXXK 5GAHC 1QVFA 1NE3A 2J3LA 2AHOB 1R9TH 2E2HH 2E5AA 4HA8A 3L2PA 1J5WA 1VQGA 4PHCA 1IBLQ 1SROA 4A3BH 2B63H 4DPGA 1NY4A 4GLVB 1KMMA 1TXYA 2G4CA 3TREA 3HXZA 4YRKA 3T1HQ 2CIMA 3HFZA 3L7ZC 1JJ2A 4B3MQ 1GD7A 4DV2Q 4GKKQ 2IX1A 3NEMA 4JV5Q 3GO5A 2MO0A 4YYEA 2PMZE 4MZ9A 1E22A 1LM0A 1V9PA 4DV4Q 2CGHA 4CH6A 1OXTA 2DKGA 4GNXC 1JJGA 2CWAA 2MNAA 1BIBA 5LMUL 4L87A 2ODRD 4JYAQ 2WB1E 3T1YQ 2I5MX 5K1PA 3RACA 2CWPA 2ZR3A 3FP9A 3S15H 3U4ZA 3WWVA 4YRJA 5C3EG 2N49A 4H2VA 2DEQA 1GM5A 2ZM6Q 1WCMH 1BKBA 1YFTA 3RKXA 4AH6A 4B3SL 1I94Q 1LYLA 1HZBA 3S1MH 4LVIA 4NXML 1LUZA 3FKIH 2R7FA 3RKWA 1U0LA 1J5EQ 4C3JH 1VQZA 1UWVA 4IFDI 3HFZB 2EJ9A 4BXXH 5IY0A 4QGUA 5IP7G 4DV6L 4K0KL 4HWOA 3REUA 4PG3A 2K5VA 3M7NA 5GAGC 2JEBI 1WNLA 4X65Q 2E2JH 1WPYA 4HWRA 1PV4A 4DQ2A 2JA8G 1XNQQ 5M3MH 5EAYA 5IP9H 4B3TL 4NPSA 1NJIC 1WQWA 1YITA 1WQ7A 3EBEA 2WAQG 2VQFQ 3HOUH 3GD7A 4IFDJ 4A3DG 3L4GA 3G6EA 3STBC 4HWPA 3H0GG 2NN6G 3OD1A 2UUBQ 4RQFA 3HOYH 1GKHA 2I4MA 2OTLA 3VQXA 2ALYA 3P8TA 4IJHA 4XTZA 3HOZH 4GN4B 2IX0A 4JI0Q 3J81c 4LNQA 3ULPA 1EIYA 2ZT6A 1B8AA 2ARTA 4YRSA 3LSQA 5IYBG 3CP0A 2R93G 3CF5A 5J3BA 4DR4Q 1IBLL 2R7DA 2K50A 3RLNA 4P74C 1N33Q 1S40A 1VQMA 3S17H 1X54A 3ICEA 2QHTA 1VQHA 3PV0A 3KJPA 3T1HL 3F2BA 4YWKA 3KLWA 1CKNA 4H02A 1XNRQ 4B3ML 3I4NH 4DV2L 1IBKQ 4GKKL 1X2HA 5GAEC 3L4GB 2NVQH 2QHVA 4JV5L 4TQFA 4YPFA 1TWGH 3WQZA 1EVLA 4CS3A 1NTGA 2JE6I 4LFBL 2KCTA 4JYAL 4A76A 4DR3Q 1YBYA 2ASBA 2ALYB 4JC0A 3T1YL 4XU2A 4K87A 1CKOA 3W5OA 3EN2A 4DNIA 4Y52H 2EJGA 1EIYB 2H5XA 3TEGA 3VBBA 4YCVA 2ZM6L 1Z47A 3HFVA 2ZTDA 2Q7HA 3JAMc 3KJOA 2OTJA 5M5XH 1Y1VH 2NVYH 2ZTGA 1I94L 4A4IA 4IOCA 2IY5A 2E5LQ 3A7AA 4YRNA 1QZGA 4A3IG 1J5EL 3DM3A 2Q5IA 2R6GA 4A93G 1EQRA 1CKNB 3CCSA 4QJFA 2ZT7A 3KYHC 3CC7A 2VY3A 2RHQA 1EQQA 3S1RH 1YEZA 3K0XA 5DLQE 2ES2A 3W1BA 1NYRA 1KXLA 2EAYA 4KQEA 1A8VA 1HNXQ 1BBUA 2ZZEA 4XEMA 2ODRC 4A75A 4X65L 4YWLA 1VQPA 3PGZA 1VQIA 1XNQL 2Q2IA 1PH2A 3KOJA 1Q12A 4JI7Q 1FJGQ 5IYDH 3A5YA 1KRSA 4P3NA 4BBSG 5FJ8G 3TS0A 1W66A 2Y0SE 4DAYB 1VQFA 2ATWA 1H4QA 3HOWG 1TWAH 2IY5B 3E9IA 3VDYA 2K14A 3CCEA 2UUBL 1D7QA 2DVEA 3GTOH 4DUZQ 1ASZA 4A3KH 2RHQB 1Q8KA 5M3FG 1H95A 4JI0L 3RN5A 2N78A 4QY7A 4LVMA 2ARSA 2WP8J 1VQBA 3HXWA 4KHPQ 1A0IA 3S14H 1GO3E 4G85A 1JMCA 2CFMA 3AFQA 4DR4L 4LVLA 2C7IA 2I4OA 2RCNA 3A74A 3NENA 4OWWB 1FVIA 3HOXG 4DR5Q 1N33L 3BZKA 3NBHB 3HKSA 5AJ3Q 4A3CG 1XNRL 1XJVA 4KI0A 1IBKL 1YZ6A 2I4NA 3CCRA 3HOVG 1ADYA 3Q8DA 3U50C 4YRFA 1NJ8A 3PIPA 4GKJQ 3G71A 4APVA 1PA6A 1NNHA 4A3MG 1N36Q 4OX9Q 1PH5A 2VZAA 4OO1G 4X6AH 2KBNA 4DR3L 1H4TA 3I55A 4YREA 1I6HH 1HNZQ 4AYBG 1HXDA 3EFSA 1YFSA 1UE1A 4KHZA 1VQ6A 4POGA 1HJPA 3GTKH 4X5OA 3PUVA 2VQEQ 1XMOQ 1AE3A 4P73A 1SRYA 2I5HA 4DKAC 1JE5A 4MTNA 5GQOA 2E5LL 4HJAA 4C2MH 3VQYA 3BFMA 3GTMH 1NBWA 1TWCH 1Q86C 5IYCG 1NJ6A 4BY1G 3UE0A 3RIRA 3G48A 4R1JA 3UDGA 4XTYA 1PYBA 3VQWA 3JAMi 3V7RA 1VQDA 3MEFA 5JEAJ 3PO2G 2ZGWA 1SN8A 2JA5H 4PZ6A 4H2UA 1DGSA 1L1OA 1HNXL 4LFAQ 3RKYA 3HXUA 4H2TA 4XTVA 5IWAQ 3RL6A 2OQ0A 3U4VA 1NJ2A 2EQSA 2ZZGA 1YJNA 1USYA 2BH2A 2F4VQ 4K86A 1FJGL 2ZJQA 4G84A 3LC0A 4XTCS 1I50H 1P8LA 3PO3H 1X3GA 11ASA 2YV5A 2PI2A 2UXDL 5IP7H 2F3IA 3HXVA 3QO8A 1M1KC 4EQ5A 4A3GG 2Q7GA 4LF6Q 1HR0Q 1WJJA 2ZINA 4R4QA 4DV0Q 4JI2Q 1N34Q 3CC4A 2R92G 2QEXA 2ARUA 1SERA 3U58A 4YHHQ 3EIVA 2JA8H 3MXNB 1VQEA 1VQ4A 1QF6A 4BY7G 4IPCA 4DV7Q 3BJUA 4YRIA 4LWCA 4OP0A 2JA9A 1S72A 4AIMA 3CCMA 1VQNA 1VQKA 4X64Q 1L1OB 2NZHA 4KHPL 3M85A 1K9MC 2R7ZG 4BBRG 2DZCA 1VQLA 3GTGH 3PSIA 4NXNL 3H0GH 3ULJA 4P75C 4HIMA 1QUQB 1K0RA 1A63A 1E1OA 3GDEA 4DR5L 2VUMG 4A3EG 3F2DA 5AJ3L 4EO4A 2DJZA 3IG2A 2YTVA 2V1CC 2DU5A 3TEHA 5LMNW 1Q46A 1XPOA 4JI3Q 4UPAA 1K8GA 1Y1WG 2P0LA 1KHIA 3J81j 5IYBH 1N36L 2R93H 4YWMA 4DR2Q 1IYJB 4IJLA 4A3LG 5ELOA 3A5ZA 3K80C 4BWAA 2CJAA 4O0AA 1Y14B 1HNZL 4YRPA 1SE8A 1EVKA 4XU3A 1VQOA 3PF4A 4GOPB 3W3SA 2ID0A 4X66Q 1YJ9A 4A3BG 4YY3Q 1T9HA 2B63G 3V7SA 3RR5A 2VQEL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RIP A;  1CKM A;  5M5W H;  3M4O H;  1XMO L;  4HJ9 A;  4K88 A;  4ME3 A;  3P8V A;  3QO7 A;  4C3I H;  1X9N A;  4DV3 Q;  2L15 A;  4OWX B;  2AKW A;  1C9O A;  4GLA C;  3TEH B;  4ZTZ B;  1PH4 A;  1NJ5 A;  5FLM H;  5C0X G;  2Z0S A;  3RZD H;  1HH2 P;  3CMA A;  4LW1 A;  1VQJ A;  2ZT8 A;  2K4K A;  1HR0 W;  4UP7 A;  4HIK A;  1KOG A;  3F8T A;  2CKZ B;  3OTO Q;  4LFA L;  3A5Z B;  2A8V A;  4YRM A;  4GNX A;  1Q1B A;  5IWA L;  4JI8 Q;  1CSP A;  1X3F A;  1YGB A;  4A3I H;  3IKM B;  2UUC Q;  4R4O A;  2Z6K C;  1TWF H;  4A93 H;  4YRG A;  3HY1 A;  1UE5 A;  3NEL A;  4JI6 Q;  2GVB A;  1Z7M A;  1HZC A;  3R07 A;  1AE2 A;  4TQD A;  5C52 B;  3L1A A;  1FGU A;  4BXX G;  2UXC Q;  2YTY A;  3I4M H;  3CPF A;  4LF6 L;  3A0J A;  5E7N A;  1VQ7 A;  4DV0 L;  2AKW B;  4JI2 L;  1N34 L;  2CJ9 A;  1PH8 A;  2I0Q A;  4YHH L;  2DUD A;  4H2S A;  3UGQ A;  2E8G A;  5C4X H;  4JOI C;  4DV4 L;  2DXU A;  2XTI A;  2E10 A;  1CSQ A;  4DV7 L;  1QZH A;  5IT9 c;  1FL0 A;  5FLX c;  4BBS H;  5FJ8 H;  1MJE A;  1G5I A;  3CCU A;  2JA7 G;  4GNX B;  3HOW H;  4TTV A;  4LF7 Q;  4DR6 Q;  1WU7 A;  3KF8 B;  3S2H H;  2WAQ E;  2VW9 A;  3UDI A;  4ALP A;  4HJ8 A;  2QHS A;  1G29 1;  4LF9 Q;  4L5Q A;  2E64 A;  1QVC A;  3BZC A;  1Q81 C;  4R4I A;  3CCJ A;  3HOY G;  3LGJ A;  1YIJ A;  4CS2 A;  1YHQ A;  3CW2 C;  3S1N H;  3FJP A;  4X62 Q;  1FYF A;  2F52 A;  3HOZ G;  1OTC A;  2RHS A;  3PCO B;  2OWO A;  1QVG A;  2HHH Q;  3PUW A;  2PMF A;  1N8R C;  4P72 C;  4JBW A;  1OXV A;  4WF2 A;  2QHU A;  3HOX H;  4JI4 Q;  4X66 L;  1VCI A;  2B3G A;  4YY3 L;  1K8A C;  3TUP A;  4JI1 Q;  3OYY A;  3TS2 A;  4DUY Q;  3GTJ H;  2N8N A;  3HOV H;  2DQ3 A;  3M4P A;  1KMN A;  2BA0 A;  2C35 B;  3UE1 A;  4DV3 L;  4BA1 I;  4CH4 A;  1X6O A;  4A3M H;  4YRT A;  1G6P A;  3HY0 A;  1JB7 A;  5C44 G;  4P74 A;  2VQF L;  4C3H H;  2Q2H A;  1N9W A;  1SFO H;  1YFR A;  3IKL A;  1I5F A;  4CH3 A;  1C7Y A;  3PUX A;  2DGY A;  1ATI A;  3HXX A;  2LXK A;  1HC7 A;  3HKZ G;  2VNU D;  2JA6 H;  2RHS B;  3OTO L;  4GLX A;  4JBK A;  1ADJ A;  4E51 A;  1H4S A;  4ZIB A;  2P5I A;  4JI8 L;  4KR2 A;  1L2F A;  1VQA A;  3CCV A;  2Q7E A;  1QE0 A;  4POF A;  2D0O A;  1A62 A;  1XPR A;  3PZC A;  1N32 Q;  1E1T A;  4BY1 H;  2UUC L;  12AS A;  3UDX A;  4EX5 A;  5H1S E;  1TWH H;  1PYS B;  2KEN A;  3CMQ A;  2VL6 A;  1GGM A;  1EFW A;  4JI6 L;  4A3F G;  3PO2 H;  5JEA G;  3PUY A;  4P71 C;  4AQY Q;  1H4V B;  2UXC L;  2GVA A;  2JQO A;  3F1Z A;  3JC6 6;  2HIV A;  2CJB A;  4BA2 I;  5JJI A;  2KCM A;  3K7U C;  4XU0 A;  2UUA Q;  2HIX A;  3KF6 A;  3G4S A;  4JI5 Q;  4RMF A;  3RUX A;  4DAM A;  3V7C A;  4A3J G;  1XMQ Q;  1X65 A;  2PME A;  3MF1 A;  4YRO A;  2IHF A;  4LF7 L;  3S2D H;  4DR6 L;  4ZTU B;  4TVA B;  5BR8 Q;  5C53 B;  4B3R Q;  3LSS A;  2PI2 E;  3I56 A;  3CC2 A;  3CCL A;  1K73 C;  2R92 H;  2MO1 A;  2K75 A;  5LMN Q;  4JCV E;  4LF9 L;  4WJ4 A;  1PH9 A;  1OXU A;  1EYG A;  4P3P A;  2I4L A;  2QGQ A;  1X56 A;  4DK3 C;  3K8A A;  3I2Z A;  2WB1 G;  2EWN A;  4HIO A;  1E3P A;  2ZZF A;  4OLF A;  3CXC A;  2R7Z H;  4BBR H;  5GAD C;  5C3E H;  2HHH L;  1JJC A;  3UH0 A;  2ZJR A;  1EUJ A;  3KF6 B;  3MEY A;  1YB3 A;  4JI4 L;  1YNX A;  3L2Z A;  3AEV A;  3MF2 A;  2WFW A;  2D0P A;  4TVW A;  1IXR A;  4JI1 L;  3B6Y A;  4R4T A;  4XTX A;  4IPH A;  3M3Y H;  4JI7 L;  1QUQ A;  3A7R A;  4UP8 A;  3UGT A;  1IZ6 A;  2DZ9 A;  4TWA A;  2KHI A;  3BU2 A;  3RN2 A;  1SES A;  2MFI A;  3ERR A;  1BVS A;  1B70 A;  4KLK A;  2E41 A;  3ERS X;  1W2B A;  1IBM Q;  4DR7 Q;  3GTP H;  2VS1 A;  1NYQ A;  3F2C A;  3CME A;  4DR1 Q;  4TQU S;  2MQH A;  2DXT A;  4YCW A;  4O2D A;  4DUZ L;  4AYB E;  1NMG A;  5HY6 A;  2BA1 A;  4QL5 A;  1JJC B;  4WJ3 M;  2K52 A;  2EJF A;  3UFG A;  4H2X A;  4GOP A;  3QNE A;  2DTO A;  3RLO A;  3RLF A;  1KL9 A;  4XTW A;  4HWS A;  1N32 L;  1EOV A;  4HWT A;  4OWT B;  1RIQ A;  4A3D H;  1X01 A;  4IFD G;  4FDB A;  2YTX A;  5IE8 A;  4LFB Q;  2OQK A;  4XU1 A;  2GN5 A;  1G5H A;  1KD1 C;  4AQY L;  1SR3 A;  1V43 A;  1KQS A;  3M4Q A;  2E3C A;  3HXY A;  5C51 B;  2PNH A;  2ZNJ A;  3HTZ A;  4DV5 Q;  1XPU A;  2JA5 G;  1B70 B;  2I5L X;  2ZR2 A;  2NVT H;  4GKJ L;  1PVO A;  2UUA L;  4L5R C;  4JI5 L;  4IO9 A;  4OX9 L;  1P16 A;  3D0F A;  4HJ5 A;  3TRZ A;  4Q15 A;  1G51 A;  1EIF A;  1XMQ L;  1YJW A;  4L5T A;  1KRT A;  2QA4 A;  1SMX A;  2UXB Q;  3E0E A;  2AWN A;  1CUK A;  3V8L A;  4H2X B;  1D8L A;  4P3O A;  3PO3 G;  4IOA A;  5BR8 L;  1OXS C;  4IPG A;  2Q2T A;  4B3R L;  3J80 c;  2PQA A;  3KFU A;  4LF8 Q;  2NVX H;  3H3V H;  3L0O A;  5LMN L;  3RGL A;  4WI1 A;  2ZTC A;  4YRL A;  1S3O A;  5M5Y H;  1Q1E A;  1X55 A;  5JJL A;  1KIX A;  1B7Y A;  3HRK A;  3A31 A;  3GTQ H;  2EXD A;  1SET A;  2JA7 H;  4QQB X;  1EWI A;  1ASY A;  4LUV A;  2E1H A;  3QTC A;  4XIG S;  2XGT A;  2YU9 H;  3SGI A;  4NCX A;  2ZIO A;  3REX A;  2UU9 Q;  4LUZ A;  2DTI A;  3AQQ A;  3I4O A;  4J15 A;  1VQC A;  4YRC A;  4LF4 Q;  1Z9F A;  2FXQ A;  3D31 A;  1WCM G;  2YYZ A;  3RF1 A;  2JJQ A;  2F4V L;  2B29 A;  1W3S A;  2OCE A;  4LFC Q;  3OW2 A;  1HNW Q;  3AYH B;  3PUZ A;  1AH9 A;  2PQA B;  3FKI G;  4P75 A;  1VQ8 A;  1UE7 A;  3KDF A;  4NB3 A;  3M9B A;  1O7I A;  2E65 A;  5JJK A;  1IBM L;  1JT8 A;  2NN6 I;  5C0X I;  4DR7 L;  2CQO A;  1HR0 L;  4DR1 L;  5KNN A;  3P8Y A;  3CD6 A;  3A7U A;  3PCO A;  4TVY A;  1B7Y B;  4LF5 Q;  2E2I H;  2HQL A;  2ZIM A;  1PH7 A;  4OXP A;  2Y0S G;  1RL2 A;  4PMW A;  2DU7 A;  4UP9 A;  5M3M G;  4X64 L;  2EL9 A;  2ZJP A;  5IP9 G;  3ULL A;  2IT1 A;  5C44 H;  3NET A;  5E3I A;  4JBJ A;  1UE6 A;  1BIA A;  2CCZ A;  5F5W A;  3HOU G;  3V8K A;  1Q82 C;  3IRB A;  1MIU A;  5FLM G;  5C0X J;  1MJC A;  3KDF B;  1VQ9 A;  1X2G A;  4DV5 L;  1Q7Y C;  1NMF A;  5M3F H;  3H3V I;  3J7A 5;  1WLE A;  3RZO H;  2N3S A;  3V8J A;  4BW9 A;  4JI3 L;  2Q2U A;  1HZA A;  2K5N A;  1YVC A;  3J7Z C;  1LTL A;  4DV1 Q;  2IHE A;  1VQ5 A;  2A1A A;  2K5H A;  4DR2 L;  4YDQ A;  3S16 H;  1SRU A;  3GTL H;  4H2W A;  1YI2 A;  3CPW A;  2UXB L;  4A3F H;  3CCQ A;  4CS4 A;  1HZ9 A;  4LUO A;  2D62 A;  2A19 A;  4A3C H;  2DDZ A;  3UDF A;  1K83 H;  3AFP A;  1WI5 A;  1PYS A;  3IAL A;  4PZ8 A;  4LF8 L;  3CAM A;  2Z6K A;  3I4M G;  4HID A;  3PF5 A;  4QIW E;  2HT1 A;  3I4N G;  1PFS A;  1Z7N A;  3ER0 A;  3QO5 A;  4A3J H;  5C4X G;  1J6Q A;  3I7F A;  4LNS A;  3J80 i;  4P73 C;  2C8M A;  4YP0 A;  1L0W A;  4IPD A;  2UXD Q;  2ZXF A;  4JOI A;  2UU9 L;  5K36 G;  4LF4 L;  4R4C A;  1YHA A;  4JBM A;  1WYD A;  1I3Q H;  4KR3 A;  3CQZ H;  4Q6G A;  2ZTE A;  4TVA A;  1B76 A;  5IYC H;  1Y1V G;  4LFC L;  2FYK A;  1HNW L;  3W1G A;  2EIF A;  1L1O C;  3ZJY C;  3G1Z A;  5LMU Q;  1E24 A;  2AWO A;  1USY C;  1KC8 C;  4Y7N H;  1E7Z A;  4NXN Q;  1K3R A;  5ELN A;  4LF5 L;  2AMC A;  3H15 A;  3J81 i;  3A32 A;  3E9H A;  2J3M A;  3DSQ A;  4GN5 A;  1UEB A;  1XTD A;  4XEO A;  4B3S Q;  4YRQ A;  3STB D;  4DK6 C;  4NXM Q;  1X3E A;  4P72 A;  1IL2 A;  3S24 A;  1PH6 A;  3A5U A;  5IYD G;  2HNI A;  2Q5H A;  1MKH A;  4A3G H;  4L5S A;  3EFR A;  4YCU A;  4RQE A;  2DQ0 A;  4JG2 A;  4GOP C;  1HTT A;  4DV6 Q;  1NJ1 A;  1GVP A;  3DLL A;  2LXJ A;  1YHB A;  4K0K Q;  3K81 C;  1PH1 A;  4HJ7 A;  2JK8 A;  4BY7 H;  5K1X A;  4RG1 A;  4H2Y A;  3HKZ E;  2JA6 G;  3S1Q H;  2ZNI A;  4DV1 L;  4A3K G;  3K7A H;  4X62 L;  1WFQ A;  4B3T Q;  5HGQ A;  4OO1 I;  5GRO A;  1SLJ A;  1KAW A;  2KHJ A;  1PH3 A;  2LSS A;  2DTH A;  1PHJ A;  2AMC B;  1C0A A;  4HVC A;  2JEA I;  2NZO A;  3PIO A;  4OON A;  1M90 C;  3RNU A;  4UY8 C;  2VUM H;  4A3E H;  3FHW A;  1U5K A;  5C4J H;  4GS3 A;  4CH5 A;  4PZ7 A;  2ZCE A;  2RF4 A;  4DUY L;  4XTU A;  3VQV A;  3ICA A;  4MNO A;  1BBW A;  1Y1W H;  1VS0 A;  4RDX A;  1WOC A;  2BH8 A;  3HRI A;  1V1Q A;  3TQY A;  4A3L H;  4P71 A;  2ZT5 A;  4GN3 B;  4YRR A;  1OXX K;  5GAH C;  1QVF A;  1NE3 A;  2J3L A;  2AHO B;  1R9T H;  2E2H H;  2E5A A;  4HA8 A;  3L2P A;  1J5W A;  1VQG A;  4PHC A;  1IBL Q;  1SRO A;  4A3B H;  2B63 H;  4DPG A;  1NY4 A;  4GLV B;  1KMM A;  1TXY A;  2G4C A;  3TRE A;  3HXZ A;  4YRK A;  3T1H Q;  2CIM A;  3HFZ A;  3L7Z C;  1JJ2 A;  4B3M Q;  1GD7 A;  4DV2 Q;  4GKK Q;  2IX1 A;  3NEM A;  4JV5 Q;  3GO5 A;  2MO0 A;  4YYE A;  2PMZ E;  4MZ9 A;  1E22 A;  1LM0 A;  1V9P A;  4DV4 Q;  2CGH A;  4CH6 A;  1OXT A;  2DKG A;  4GNX C;  1JJG A;  2CWA A;  2MNA A;  1BIB A;  5LMU L;  4L87 A;  2ODR D;  4JYA Q;  2WB1 E;  3T1Y Q;  2I5M X;  5K1P A;  3RAC A;  2CWP A;  2ZR3 A;  3FP9 A;  3S15 H;  3U4Z A;  3WWV A;  4YRJ A;  5C3E G;  2N49 A;  4H2V A;  2DEQ A;  1GM5 A;  2ZM6 Q;  1WCM H;  1BKB A;  1YFT A;  3RKX A;  4AH6 A;  4B3S L;  1I94 Q;  1LYL A;  1HZB A;  3S1M H;  4NXM L;  1LUZ A;  3FKI H;  2R7F A;  3RKW A;  1U0L A;  1J5E Q;  4C3J H;  1VQZ A;  1UWV A;  4IFD I;  3HFZ B;  2EJ9 A;  4BXX H;  5IY0 A;  4QGU A;  5IP7 G;  4DV6 L;  4K0K L;  4HWO A;  3REU A;  4PG3 A;  2K5V A;  3M7N A;  5GAG C;  2JEB I;  1WNL A;  4X65 Q;  2E2J H;  1WPY A;  4HWR A;  1PV4 A;  4DQ2 A;  2JA8 G;  1XNQ Q;  5M3M H;  5EAY A;  5IP9 H;  4B3T L;  4NPS A;  1NJI C;  1WQW A;  1YIT A;  1WQ7 A;  3EBE A;  2WAQ G;  2VQF Q;  3HOU H;  3GD7 A;  4IFD J;  4A3D G;  3L4G A;  3G6E A;  3STB C;  4HWP A;  3H0G G;  2NN6 G;  3OD1 A;  2UUB Q;  4RQF A;  3HOY H;  1GKH A;  2I4M A;  2OTL A;  3VQX A;  2ALY A;  3P8T A;  4IJH A;  4XTZ A;  3HOZ H;  4GN4 B;  2IX0 A;  4JI0 Q;  3J81 c;  4LNQ A;  3ULP A;  1EIY A;  2ZT6 A;  1B8A A;  2ART A;  4YRS A;  3LSQ A;  5IYB G;  3CP0 A;  2R93 G;  3CF5 A;  5J3B A;  4DR4 Q;  1IBL L;  2R7D A;  2K50 A;  3RLN A;  4P74 C;  1N33 Q;  1S40 A;  1VQM A;  3S17 H;  1X54 A;  3ICE A;  2QHT A;  1VQH A;  3PV0 A;  3KJP A;  3T1H L;  3F2B A;  4YWK A;  3KLW A;  1CKN A;  4H02 A;  1XNR Q;  4B3M L;  3I4N H;  4DV2 L;  1IBK Q;  4GKK L;  1X2H A;  5GAE C;  3L4G B;  2NVQ H;  2QHV A;  4JV5 L;  4TQF A;  4YPF A;  1TWG H;  3WQZ A;  1EVL A;  4CS3 A;  1NTG A;  2JE6 I;  4LFB L;  2KCT A;  4JYA L;  4A76 A;  4DR3 Q;  1YBY A;  2ASB A;  2ALY B;  4JC0 A;  3T1Y L;  4XU2 A;  4K87 A;  1CKO A;  3W5O A;  3EN2 A;  4DNI A;  4Y52 H;  2EJG A;  1EIY B;  2H5X A;  3TEG A;  3VBB A;  4YCV A;  2ZM6 L;  1Z47 A;  3HFV A;  2ZTD A;  2Q7H A;  3JAM c;  3KJO A;  2OTJ A;  5M5X H;  1Y1V H;  2NVY H;  2ZTG A;  1I94 L;  4A4I A;  4IOC A;  2IY5 A;  2E5L Q;  3A7A A;  4YRN A;  1QZG A;  4A3I G;  1J5E L;  3DM3 A;  2Q5I A;  2R6G A;  4A93 G;  1EQR A;  1CKN B;  3CCS A;  4QJF A;  2ZT7 A;  3KYH C;  3CC7 A;  2VY3 A;  2RHQ A;  1EQQ A;  3S1R H;  1YEZ A;  3K0X A;  5DLQ E;  2ES2 A;  3W1B A;  1NYR A;  1KXL A;  2EAY A;  4KQE A;  1A8V A;  1HNX Q;  1BBU A;  2ZZE A;  4XEM A;  2ODR C;  4A75 A;  4X65 L;  4YWL A;  1VQP A;  3PGZ A;  1VQI A;  1XNQ L;  2Q2I A;  1PH2 A;  3KOJ A;  1Q12 A;  4JI7 Q;  1FJG Q;  5IYD H;  3A5Y A;  1KRS A;  4P3N A;  4BBS G;  5FJ8 G;  3TS0 A;  1W66 A;  2Y0S E;  4DAY B;  1VQF A;  2ATW A;  1H4Q A;  3HOW G;  1TWA H;  2IY5 B;  3E9I A;  3VDY A;  2K14 A;  3CCE A;  2UUB L;  1D7Q A;  2DVE A;  3GTO H;  4DUZ Q;  1ASZ A;  4A3K H;  2RHQ B;  1Q8K A;  5M3F G;  1H95 A;  4JI0 L;  3RN5 A;  2N78 A;  4QY7 A;  2ARS A;  2WP8 J;  1VQB A;  3HXW A;  4KHP Q;  1A0I A;  3S14 H;  1GO3 E;  4G85 A;  1JMC A;  2CFM A;  3AFQ A;  4DR4 L;  2C7I A;  2I4O A;  2RCN A;  3A74 A;  3NEN A;  4OWW B;  1FVI A;  3HOX G;  4DR5 Q;  1N33 L;  3BZK A;  3NBH B;  3HKS A;  5AJ3 Q;  4A3C G;  1XNR L;  1XJV A;  4KI0 A;  1IBK L;  1YZ6 A;  2I4N A;  3CCR A;  3HOV G;  1ADY A;  3Q8D A;  3U50 C;  4YRF A;  1NJ8 A;  3PIP A;  4GKJ Q;  3G71 A;  4APV A;  1PA6 A;  1NNH A;  4A3M G;  1N36 Q;  4OX9 Q;  1PH5 A;  2VZA A;  4OO1 G;  4X6A H;  2KBN A;  4DR3 L;  1H4T A;  3I55 A;  4YRE A;  1I6H H;  1HNZ Q;  4AYB G;  1HXD A;  3EFS A;  1YFS A;  1UE1 A;  4KHZ A;  1VQ6 A;  4POG A;  1HJP A;  3GTK H;  4X5O A;  3PUV A;  2VQE Q;  1XMO Q;  1AE3 A;  4P73 A;  1SRY A;  2I5H A;  4DKA C;  1JE5 A;  4MTN A;  5GQO A;  2E5L L;  4HJA A;  4C2M H;  3VQY A;  3BFM A;  3GTM H;  1NBW A;  1TWC H;  1Q86 C;  5IYC G;  1NJ6 A;  4BY1 G;  3UE0 A;  3RIR A;  3G48 A;  4R1J A;  3UDG A;  4XTY A;  1PYB A;  3VQW A;  3JAM i;  3V7R A;  1VQD A;  3MEF A;  5JEA J;  3PO2 G;  2ZGW A;  1SN8 A;  2JA5 H;  4PZ6 A;  4H2U A;  1DGS A;  1L1O A;  1HNX L;  4LFA Q;  3RKY A;  3HXU A;  4H2T A;  4XTV A;  5IWA Q;  3RL6 A;  2OQ0 A;  3U4V A;  1NJ2 A;  2EQS A;  2ZZG A;  1YJN A;  1USY A;  2BH2 A;  2F4V Q;  4K86 A;  1FJG L;  2ZJQ A;  4G84 A;  3LC0 A;  4XTC S;  1I50 H;  1P8L A;  3PO3 H;  1X3G A;  11AS A;  2YV5 A;  2PI2 A;  2UXD L;  5IP7 H;  2F3I A;  3HXV A;  3QO8 A;  1M1K C;  4EQ5 A;  4A3G G;  2Q7G A;  4LF6 Q;  1HR0 Q;  1WJJ A;  2ZIN A;  4R4Q A;  4DV0 Q;  4JI2 Q;  1N34 Q;  3CC4 A;  2R92 G;  2QEX A;  2ARU A;  1SER A;  3U58 A;  4YHH Q;  3EIV A;  2JA8 H;  3MXN B;  1VQE A;  1VQ4 A;  1QF6 A;  4BY7 G;  4IPC A;  4DV7 Q;  3BJU A;  4YRI A;  4LWC A;  4OP0 A;  2JA9 A;  1S72 A;  4AIM A;  3CCM A;  1VQN A;  1VQK A;  4X64 Q;  1L1O B;  2NZH A;  4KHP L;  3M85 A;  1K9M C;  2R7Z G;  4BBR G;  2DZC A;  1VQL A;  3GTG H;  3PSI A;  4NXN L;  3H0G H;  3ULJ A;  4P75 C;  4HIM A;  1QUQ B;  1K0R A;  1A63 A;  1E1O A;  3GDE A;  4DR5 L;  2VUM G;  4A3E G;  3F2D A;  5AJ3 L;  4EO4 A;  2DJZ A;  3IG2 A;  2YTV A;  2V1C C;  2DU5 A;  3TEH A;  5LMN W;  1Q46 A;  1XPO A;  4JI3 Q;  4UPA A;  1K8G A;  1Y1W G;  2P0L A;  1KHI A;  3J81 j;  5IYB H;  1N36 L;  2R93 H;  4YWM A;  4DR2 Q;  1IYJ B;  4IJL A;  4A3L G;  5ELO A;  3A5Z A;  3K80 C;  4BWA A;  2CJA A;  4O0A A;  1Y14 B;  1HNZ L;  4YRP A;  1SE8 A;  1EVK A;  4XU3 A;  1VQO A;  3PF4 A;  4GOP B;  3W3S A;  2ID0 A;  4X66 Q;  1YJ9 A;  4A3B G;  4YY3 Q;  1T9H A;  2B63 G;  3V7S A;  3RR5 A;  2VQE L; 
#chains in the Genus database with same CATH topology
 3M4Y A;  4MTK A;  1GHJ A;  1RIP A;  4ZLT F;  1CKM A;  5G3L F;  4DF7 A;  5M5W H;  1ESF A;  1XMO L;  3M4O H;  3RUZ A;  4A3F B;  4HJ9 A;  1CHP D;  4K88 A;  4ME3 A;  3P8V A;  3QO7 A;  5C6A A;  4XT3 B;  4C3I H;  1SMY C;  1X9N A;  4DV3 Q;  1RCV D;  3BG3 A;  1H9S B;  4O1N A;  2L15 A;  1DD2 A;  4OWX B;  2AKW A;  1K83 B;  3IKJ A;  2XWB B;  3DXJ C;  1C9O A;  1LTG D;  4GLA C;  3TEH B;  4ZTZ B;  1PH4 A;  1NJ5 A;  5FLM H;  3FPP A;  1TS2 A;  2Z0S A;  4XT1 B;  2A74 C;  4DK1 A;  5C0X G;  3RZD H;  1HH2 P;  4FXD A;  3CMA A;  4RGN A;  4K8I A;  4LW1 A;  1VQJ A;  4J8Q A;  2ZT8 A;  3C46 A;  4DAV A;  2K4K A;  5JPM C;  4UP7 A;  1VF5 C;  5IGE A;  1HR0 W;  4HIK A;  4A3J B;  2J7Z A;  1BCP D;  1KOG A;  3F8T A;  2CKZ B;  1DOK A;  5IGB A;  3OTO Q;  3ND8 A;  1HXY D;  4LFA L;  1JB3 A;  3A5Z B;  4J1M A;  2A8V A;  1I4R A;  2D9U A;  4YRM A;  2BDO A;  4GNX A;  1Q1B A;  4H44 C;  5IWA L;  4JI8 Q;  1CSP A;  3DM1 A;  4ZUJ A;  4KD3 A;  3KF8 A;  2C5C A;  5D65 A;  1X3F A;  1YGB A;  1MI2 A;  4A3I H;  5DM7 3;  2HD3 A;  5EKI A;  3IKM B;  3SEB A;  3FEW X;  1A3U A;  2UUC Q;  4R4O A;  2EPB A;  2Z6K C;  1RTO A;  1TWF H;  1Q8I A;  2EYP A;  2QW7 A;  4A93 H;  3HG9 A;  4YRG A;  1RTN A;  1KNA A;  1U4L A;  3HY1 A;  3SHL A;  1UE5 A;  4FF2 A;  2PMZ B;  1I3Q B;  3NEL A;  4C3J G;  4JI6 Q;  1IW7 D;  1STH A;  2NS6 A;  2GVB A;  1Z7M A;  4XQJ A;  1HZC A;  3R07 A;  1AE2 A;  4TQD A;  5C52 B;  3L1A A;  3T4A C;  1FGU A;  4BXX G;  2UXC Q;  2Z4I A;  2YTY A;  3I4M H;  3CPF A;  4LF6 L;  1FNW A;  3A0J A;  3I90 A;  3NQI A;  5E7N A;  2Q8I B;  4F87 A;  1VQ7 A;  4DV0 L;  4KKT A;  1W6J A;  2AKW B;  4JI2 L;  1N34 L;  4LVJ A;  3K5M A;  2A6E C;  4KK7 A;  2CJ9 A;  1PH8 A;  3WDN A;  2I0Q A;  3MZ5 A;  3K58 A;  4YHH L;  2DUD A;  3D8G A;  4H2S A;  3UGQ A;  2E8G A;  5C4X H;  4JOI C;  1NCV A;  4DV4 L;  2DXU A;  4G57 A;  1SYC A;  2XTI A;  2E10 A;  1CSQ A;  4DV7 L;  1LAC A;  5IT9 c;  1FL0 A;  5FLX c;  1QZH A;  2Z1C A;  4Y7N B;  4BBS H;  5FJ8 H;  1Q90 A;  2K7V A;  1F2L A;  4KKS A;  1MJE A;  2K03 A;  2B2T C;  4WJW A;  1G5I A;  3CCU A;  1STE A;  1PTO D;  3G6J B;  1HFN A;  2M00 A;  2JA7 G;  3K5L A;  4H0L C;  4H7B A;  4GNX B;  3HOW H;  2EY5 A;  4TTV A;  4LF7 Q;  4DR6 Q;  5K36 H;  1WU7 A;  3KF8 B;  1PXU A;  3S2H H;  3F2U A;  2WAQ E;  3BZD B;  2VW9 A;  2A5H A;  3J7Y W;  3UDI A;  2IWH A;  4XQN A;  2HDL A;  4F8M A;  4ALP A;  2F0H A;  4HJ8 A;  1PRT D;  4B9X A;  2QHS A;  1G29 1;  1DOM A;  4A3G B;  3D6C A;  3VR6 A;  4LF9 Q;  4L5Q A;  1SYG A;  2QF7 A;  3N52 A;  2RDG A;  2WAC A;  2E64 A;  1QVC A;  2KA7 A;  3MQZ A;  3BZC A;  1Q81 C;  4R4I A;  2Q8T A;  3CCJ A;  3HOY G;  3LGJ A;  3Q6S A;  1YIJ A;  4TRD A;  4CS2 A;  1YHQ A;  1ILQ A;  3CW2 C;  3S1N H;  2B2Y C;  2R92 B;  3FJP A;  4X62 Q;  4C1N K;  2F52 A;  3HOZ G;  1FYF A;  1TU2 B;  5F2D A;  1OTC A;  2RHS A;  3PCO B;  1CQF A;  2OWO A;  1QVG A;  4TSS A;  2HHH Q;  2ENB A;  5I4D A;  4BY7 B;  1EU3 A;  4ILW A;  3PUW A;  4HTH A;  2PMF A;  1N8R C;  4JK1 C;  4P72 C;  3S1Q B;  4JBW A;  1OXV A;  4WF2 A;  2Z6B A;  3VR3 A;  3V96 A;  2QHU A;  3HOX H;  4JI4 Q;  2X6L A;  4IUT A;  4R8N A;  4X66 L;  3HRZ C;  2KEC A;  3I4L A;  4HSV A;  1VCI A;  3E3X A;  2B3G A;  4OEM B;  1G6Z A;  4RGT A;  4YY3 L;  1K8A C;  3TUP A;  2K32 A;  4JI1 Q;  3TDQ A;  3OYY A;  3TS2 A;  2N55 A;  4DUY Q;  3GTJ H;  2N8N A;  3HOV H;  1MSG A;  2DQ3 A;  3M4P A;  4CDD C;  1KMN A;  2BA0 A;  2SDF A;  3IL8 A;  2VUM B;  4A3E B;  2C35 B;  3UE1 A;  3D6W A;  4DV3 L;  4BA1 I;  4CH4 A;  1X6O A;  4A3M H;  3OMG A;  4YRT A;  5C4J B;  1G6P A;  3HY0 A;  3CHB D;  1JB7 A;  5C44 G;  1D1K A;  4P74 A;  2VQF L;  4C3H H;  5A2Q L;  3M3Y B;  3EJI A;  3NHH A;  5JPN C;  1SE3 A;  2Q2H A;  1F9P A;  5CV5 A;  1N9W A;  1SFO H;  1YFR A;  3IKL A;  1I5F A;  1Y1W B;  4V0B A;  1C7Y A;  4CH3 A;  3TZD A;  3PUX A;  2DGY A;  1PDQ A;  5FO7 B;  1ATI A;  2CVR A;  3HXX A;  3KBG A;  2LXK A;  1HC7 A;  4CKB A;  3HKZ G;  2VNU D;  2Q8R E;  2JA6 H;  4HN7 A;  2RHS B;  3OTO L;  4GLX A;  4JBK A;  4NKL A;  1ADJ A;  4E51 A;  1D6E C;  1H4S A;  1R9T B;  2XIW A;  4ZIB A;  2E2H B;  2P5I A;  4JI8 L;  4FF1 A;  1L2F A;  4KR2 A;  1O7Y A;  1VQA A;  5E3F A;  3CCV A;  5CYU A;  3R2T A;  3MFG A;  2Q7E A;  1AEX A;  1QE0 A;  1BDO A;  2G9H D;  4HCS A;  4POF A;  2D0O A;  1A62 A;  4RCO A;  1XPR A;  4A3B B;  3PZC A;  2B63 B;  1N32 Q;  1E1T A;  1PYW D;  1EEI D;  4U68 A;  5EBD A;  2UUC L;  4BY1 H;  12AS A;  4OIK A;  5E4W C;  2JSO A;  3UDX A;  5CC4 A;  4EX5 A;  3T56 B;  5H1S E;  1TWH H;  1PYS B;  2KEN A;  1WVL A;  3CMQ A;  2VL6 A;  1GGM A;  1EFW A;  2XNA C;  4JI6 L;  3TP8 A;  1SMY D;  4A3F G;  2PZU A;  2K33 A;  1U4R A;  5LL6 S;  3PO2 H;  5JEA G;  3PUY A;  4P71 C;  4AQY Q;  2F1M A;  1H4V B;  2UXC L;  2GVA A;  2JQO A;  3F1Z A;  4KJO A;  3JC6 6;  2HIV A;  2L1B A;  3X3M A;  2CJB A;  4BA2 I;  1HA5 A;  2G9D A;  5JJI A;  4KD4 A;  2DNC A;  2KCM A;  3K7U C;  4XU0 A;  1I4G A;  1LT4 D;  2ICI A;  2UUA Q;  2HIX A;  3S15 B;  3KF6 A;  3G4S A;  4JI5 Q;  4HSP A;  4RMF A;  3RUX A;  4DAM A;  2EYF A;  3V7C A;  2X69 A;  3R8B A;  4A3J G;  1BCP C;  3OMC A;  2XSC A;  1XMQ Q;  1X65 A;  2PME A;  4XQQ A;  1WCM B;  2E76 C;  3MF1 A;  4YRO A;  2IHF A;  4LF7 L;  5C3X A;  3S2D H;  4DR6 L;  4C1N I;  1X3Q A;  4ZTU B;  1BNZ A;  2XN9 C;  4OHJ A;  4TVA B;  5BR8 Q;  5K5P A;  5C53 B;  4BWG B;  5FOB B;  5KGU A;  4B3R Q;  3S1M B;  5JJZ A;  1FNU A;  1JCK B;  1CA6 A;  5J1Z A;  3LSS A;  3FKI B;  1WTX A;  2PI2 E;  3I56 A;  4NMZ A;  3CC2 A;  3CCL A;  1K73 C;  2R92 H;  4C3J B;  2MO1 A;  4CKC A;  2K75 A;  5LMN Q;  4JCV E;  4LF9 L;  4WJ4 A;  3SR1 A;  1KLU D;  1YNJ D;  3ND9 A;  1PH9 A;  4DNT B;  1OXU A;  1IW7 C;  4RA8 A;  4FXK C;  1EYG A;  4P3P A;  3FDT A;  2I4L A;  2QGQ A;  1X56 A;  4DK3 C;  1MD2 D;  3K8A A;  3I2Z A;  5IT9 L;  5FLX L;  3K57 A;  4LAA A;  2BOS A;  2WB1 G;  4HIO A;  2EWN A;  1E3P A;  1D2B A;  2ZZF A;  4OLF A;  2SNS A;  1PZK D;  3CXC A;  2R7Z H;  1B4O A;  4BBR H;  2KQ3 A;  5GAD C;  5C3E H;  2HHH L;  1JJC A;  2F0F A;  3UH0 A;  2ZJR A;  4QUC A;  1FGB D;  1EUJ A;  2E2J B;  2I46 A;  3K59 A;  3E5S A;  1LTS D;  3KF6 B;  2KHS A;  1F77 A;  4WFN 3;  3MEY A;  1YB3 A;  4JI4 L;  5M3M B;  1YNX A;  2VXW A;  3L2Z A;  3AEV A;  1KDB A;  2EXZ A;  2TSS A;  3GTQ B;  2NTT A;  3MF2 A;  1SYD A;  2WFW A;  3H09 A;  2D0P A;  3JAM L;  4TVW A;  4ZKC B;  1IXR A;  4JI1 L;  3B6Y A;  4R4T A;  4XTX A;  4IPH A;  3SVM A;  1JWM D;  3OOC A;  3M3Y H;  3IFT A;  3H94 A;  4JI7 L;  1O7Z A;  1QUQ A;  3A7R A;  4UP8 A;  4FXG C;  2A8E A;  3UGT A;  5NUC A;  3NTK A;  1IZ6 A;  4ZYS A;  5KIX A;  1X3P A;  1SYB A;  2DZ9 A;  4TWA A;  2KHI A;  2JN4 A;  4M1U B;  3BU2 A;  1EWC A;  3RN2 A;  1SES A;  2MFI A;  1LV9 A;  1PRT C;  1A3T A;  3ERR A;  1BVS A;  1B70 A;  3HOY B;  1RDP D;  4KLK A;  2E41 A;  1JC7 A;  1ZYR D;  3ERS X;  1W2B A;  1IBM Q;  4DR7 Q;  3GTP H;  2O4X A;  2VS1 A;  1NYQ A;  2PZW A;  3CME A;  3TP6 A;  2OT2 A;  3F2C A;  4DR1 Q;  3HOZ B;  4TQU S;  2MQH A;  2DXT A;  4YCW A;  1JR0 D;  4O2D A;  4I65 A;  4DUZ L;  2K5W A;  4AYB E;  1A2U A;  4DXF A;  1NMG A;  2L4N A;  5HY6 A;  2BA1 A;  5COR A;  1F2Y A;  4QL5 A;  4IQZ A;  1U9R A;  1JJC B;  4WJ3 M;  2K52 A;  4KY5 A;  3X3N A;  4HMJ A;  2EJF A;  3UFG A;  4H2X A;  1I4Q A;  4GOP A;  3QNE A;  5I6Y A;  4ZRZ A;  2DTO A;  3RLO A;  3RLF A;  1KL9 A;  2PQE A;  1WTW A;  4XTW A;  4HWS A;  1CFM A;  1N32 L;  4F7X A;  2F0Q A;  1EOV A;  1M4V A;  1Y8O B;  4HWT A;  4OWT B;  3S17 B;  1RIQ A;  3Q0A A;  4A3D H;  1X01 A;  4IFD G;  4FDB A;  2YTX A;  1Q3L A;  5IE8 A;  1XXG A;  2NN6 H;  1T5X D;  2C9O A;  5C0X H;  4K2L A;  4LFB Q;  2B2W A;  1NR2 A;  2OQK A;  3I4N B;  4XU1 A;  2B2V C;  3DEO A;  2GN5 A;  1G5H A;  5JVG 3;  3MXU A;  1KD1 C;  4AQY L;  2NVQ B;  3KUP A;  4RAU C;  1SR3 A;  1V43 A;  2EY6 A;  4NDX A;  5C5L A;  1KQS A;  3QR8 A;  1TWG B;  3M4Q A;  2RSN A;  2E3C A;  2VB3 X;  3HXY A;  5C51 B;  2PNH A;  3SE0 A;  2ZNJ A;  3HTZ A;  4E6I A;  2X6G A;  4DV5 Q;  1XPU A;  2JA5 G;  1B70 B;  2LFN A;  5TSS A;  2I5L X;  1HQM C;  2ZR2 A;  2NVT H;  4GKJ L;  1PVO A;  1SBB B;  1EOT A;  2E2D C;  4F88 A;  2UUA L;  4FVM A;  4L5R C;  4JI5 L;  3HKZ B;  4IO9 A;  4OX9 L;  1P16 A;  3D0F A;  4HJ5 A;  3T51 B;  1TR5 A;  3TRZ A;  4X3K A;  4Q15 A;  1G51 A;  1EIF A;  1XMQ L;  1YJW A;  4L5T A;  1KRT A;  1SSO A;  2QA4 A;  1SMX A;  2UXB Q;  3E0E A;  2AWN A;  1CUK A;  3V8L A;  2WKC A;  1HFG A;  4H2X B;  1BQQ T;  1D8L A;  1FR3 A;  4P3O A;  1DYQ A;  3PO3 G;  4IOA A;  5M5X B;  1Y1V B;  3VYT A;  1OXS C;  3I73 A;  4IPG A;  5BR8 L;  1JWU D;  2Q2T A;  2SEB D;  4B3R L;  5DEH A;  4KN4 C;  5IOD A;  3J80 c;  1EYA A;  2MJ8 A;  1STY A;  2PQA A;  2F3W A;  1R4Q B;  3KFU A;  4LF8 Q;  2NVX H;  3H3V H;  3L0O A;  5LMN L;  3RGL A;  4WI1 A;  4QMG A;  2ZTC A;  3W2D A;  3A54 A;  4YRL A;  1S3O A;  2F0M A;  5M5Y H;  3AMU A;  2EJG C;  1Q1E A;  3QG1 A;  4DAP A;  1X55 A;  3S1R B;  5JJL A;  4LMQ D;  2D5D A;  1KIX A;  1B7Y A;  3HRK A;  3A31 A;  4X3S A;  3EA6 A;  3GTQ H;  2EXD A;  1SET A;  2JA7 H;  3N6R A;  2F0N A;  5J22 A;  2RA4 A;  3PQI A;  4QQB X;  1EWI A;  1EY6 A;  1ASY A;  4G7O C;  1JOO A;  4LUV A;  2E1H A;  1B9M A;  3QTC A;  4XIG S;  2XGT A;  2YU9 H;  3BVZ A;  3SGI A;  4NCX A;  2ZIO A;  3G7L A;  2F4I A;  2DJF C;  1WTO A;  3REX A;  4DA2 A;  2UU9 Q;  4LUZ A;  4RFB A;  1Y69 U;  2DTI A;  2DNE A;  2K6A A;  3AQQ A;  3I4O A;  1SNQ A;  1VQC A;  3P75 A;  4J15 A;  4YRC A;  4LF4 Q;  1Z9F A;  2FXQ A;  3D31 A;  1WCM G;  1HCZ A;  1R4P B;  4G7H C;  2YYZ A;  3RF1 A;  1EQT A;  3QB3 A;  3KBX A;  2QKI C;  4K5W A;  1CQV A;  2JJQ A;  2K5Q A;  3I8Z A;  2F4V L;  2B29 A;  3A8I E;  1W3S A;  5CMD A;  2E75 C;  3HGB A;  1PTO B;  2OCE A;  4ID6 A;  2LY7 A;  4LFC Q;  1UNS A;  1TWA B;  2H4O A;  3OW2 A;  1HNW Q;  5E1F A;  3D4R A;  1L0Y B;  4HCE A;  3AYH B;  4K2K A;  3PUZ A;  3QO2 A;  1AH9 A;  2PQA B;  3E6Z X;  3FKI G;  4P75 A;  1VQ8 A;  1UE7 A;  2L12 A;  3KDF A;  4NB3 A;  4FP5 D;  5ELB A;  3M9B A;  1O7I A;  1EZ8 A;  3CQZ B;  1GUN A;  5ELD A;  3C1F A;  2E65 A;  2ZXO A;  5JJK A;  4PV1 C;  4KY6 A;  1YNJ C;  3VR5 A;  1IBM L;  1A15 A;  1JT8 A;  1I6V C;  2NN6 I;  5JAV A;  5C0X I;  4DR7 L;  2CQO A;  4FO2 A;  1HR0 L;  3LX0 A;  1TS5 A;  4A3K B;  2WB1 B;  1WTQ A;  2BE5 D;  3L3O C;  4DR1 L;  5KNN A;  3P8Y A;  3CD6 A;  1XTC D;  4IUP A;  2HUG A;  4ABN A;  3A7U A;  3PCO A;  1B7Y B;  4TVY A;  1WTV A;  1K8O A;  4LF5 Q;  2E2I H;  4DFA A;  2LMC B;  2CH4 A;  2SNM A;  2HCC A;  3S14 B;  1AP0 A;  2HDM A;  2HQL A;  2ZIM A;  1PH7 A;  3QWN A;  4OXP A;  2Y0S G;  1RL2 A;  5COY A;  4PMW A;  1DXM A;  2DU7 A;  2N88 A;  4UP9 A;  5M3M G;  4X64 L;  1E2V A;  2EL9 A;  2ZJP A;  5IP9 G;  3ULL A;  1FNV A;  2IT1 A;  5C44 H;  4JW0 A;  2EY2 A;  5KYL A;  2RBM A;  3NET A;  5E3I A;  1HUM A;  1MSH A;  4HAE A;  4JBJ A;  1UE6 A;  4C3I G;  1BIA A;  1C4Q A;  3P7J A;  2F0W A;  3P20 A;  2A69 D;  2CCZ A;  5EGT A;  5F5W A;  1PFB A;  2KVM A;  3DWA A;  1JIC A;  3HOU G;  3V8K A;  4B9W A;  3SK8 A;  4XDX A;  2JXM B;  1Q82 C;  5KNB A;  3IRB A;  1IYV A;  1MIU A;  5FLM G;  5C0X J;  1MJC A;  1PLF A;  3KDF B;  1PTO F;  1VQ9 A;  1X2G A;  3J80 E;  4DV5 L;  4V19 0;  1Q7Y C;  1NMF A;  5M3F H;  2H1E A;  3H3V I;  3J7A 5;  1WLE A;  2PPB C;  3RZO H;  2N3S A;  3V8J A;  4BW9 A;  1ZYR C;  2EYM A;  4JI3 L;  2Q2U A;  1HZA A;  2K5N A;  1YVC A;  5JVH 3;  3J7Z C;  1I6H B;  1LTL A;  1LT3 D;  4DV1 Q;  2IHE A;  4K5V A;  2QIL A;  1VQ5 A;  1A3V A;  2A1A A;  2KJX A;  3MAQ A;  2K5H A;  4DR2 L;  4YDQ A;  5EPL A;  1PRT F;  3S16 H;  1SRU A;  5I9P A;  3GTL H;  3TP5 A;  3H3V C;  1K28 A;  4H2W A;  1YI2 A;  3MXG A;  1IHZ A;  1DJR D;  3CPW A;  2UXB L;  3DUZ A;  3C3L A;  3TBI B;  4A3F H;  3CCQ A;  3K7A B;  4YIJ A;  4CS4 A;  1HZ9 A;  4LUO A;  2D62 A;  4QF4 A;  2A19 A;  4HT4 A;  1I4P A;  1HTP A;  2F0I A;  3I91 A;  3T16 A;  4A3C H;  1KTK A;  1ONL A;  4C2M B;  2DDZ A;  3UDF A;  1TWC B;  3GTM B;  1K83 H;  3AFP A;  2NUC A;  1WI5 A;  2EOT A;  1PYS A;  3IAL A;  3CU7 A;  4PZ8 A;  3V05 A;  4LF8 L;  1ROD A;  3CAM A;  2Z6K A;  3I4M G;  4HID A;  2A68 D;  2E74 C;  1QNU A;  1GJX A;  3MEH A;  1IKM A;  1II3 A;  4QIW E;  3PF5 A;  2HT1 A;  1B9N A;  1GXD C;  3I4N G;  2KEE A;  1PFS A;  1ILP A;  1Z7N A;  4OO1 H;  3ER0 A;  3QO5 A;  4A3J H;  2A6H D;  2JA5 B;  5C4X G;  3C1E A;  4X3T A;  1J6Q A;  3I7F A;  4LNS A;  1XX8 A;  4PQX A;  3J80 i;  1JE4 A;  1L0X B;  3J81 E;  4P73 C;  4DGZ A;  1CZG A;  2FHT A;  1IYU A;  3FPU B;  5CV6 A;  1F2Z A;  2C8M A;  4N9P A;  4PMC A;  4YP0 A;  5DAU A;  1TS3 A;  1L0W A;  4IPD A;  4KKU A;  2UXD Q;  2ZXF A;  3NK9 A;  4JOI A;  1HHV A;  3SK6 A;  2UU9 L;  2Z4H A;  3SXH A;  5K36 G;  2EY1 A;  4UHV A;  1I4X A;  1YNN D;  4LF4 L;  4MIU A;  1SDF A;  2PCF B;  4R4C A;  4ZAI A;  1YHA A;  3PO3 B;  4JBM A;  1WYD A;  2B39 A;  2Z8L A;  4DXG A;  1ET9 A;  1I3Q H;  3NE5 B;  1TKW B;  4Q5V A;  4KR3 A;  3CQZ H;  4Q6G A;  2ZTE A;  4TVA A;  1B76 A;  5IYC H;  1MHW C;  2CQA A;  1ZEQ X;  3OSO A;  1QIL A;  1Y1V G;  4LFC L;  2FYK A;  5FK9 C;  1HNW L;  1KDA A;  4ME5 A;  3W1G A;  2EIF A;  1L1O C;  3NXW A;  3ZJY C;  4ZQ3 A;  3G1Z A;  2F03 A;  5LMU Q;  1J9O A;  1E24 A;  2EZV A;  2AQ3 B;  4OL7 A;  1TII D;  2AWO A;  1BF4 A;  1USY C;  4JVZ A;  1E0B A;  1LTR D;  1UUP A;  3K5N A;  1KC8 C;  2JA8 B;  3AU7 A;  3EQL C;  4Y7N H;  1BXT A;  3KK7 A;  4EVO A;  4H13 C;  1E7Z A;  1LLR D;  4NXN Q;  1K3R A;  1T5E A;  2BDN A;  1TT2 A;  2DY7 A;  5ELN A;  3NWT A;  4LF5 L;  2AMC A;  1S5F D;  3H15 A;  1W6K A;  3ONA B;  3A55 A;  4RHR A;  3J81 i;  3DWP A;  3A32 A;  3E9H A;  3OIQ A;  4S3S A;  5ISR A;  2J3M A;  2WAQ B;  5KNC A;  4XXE A;  3DSQ A;  4WRD A;  4GN5 A;  1D1I A;  1UEB A;  1XTD A;  4XEO A;  4B3S Q;  3GTG B;  4YRQ A;  3STB D;  3J7A F;  5EBC A;  3H0G B;  3R2I A;  4I7A A;  4DK6 C;  2FJ2 A;  4NXM Q;  4FF3 A;  1X3E A;  2J4X A;  1VMP A;  2AQ2 B;  4P72 A;  1IL2 A;  3S24 A;  1PH6 A;  3A5U A;  4FYD A;  4K5X A;  5IYD G;  2HNI A;  1LTT D;  2Q5H A;  2A73 B;  1MKH A;  4B08 A;  4A3G H;  1VF7 A;  1WD1 A;  1LAB A;  3A8J E;  4L5S A;  3EFR A;  4YCU A;  4RQE A;  3ERO A;  2DQ0 A;  2EJF C;  4JG2 A;  2L11 A;  4GOP C;  1HTT A;  4DV6 Q;  1NJ1 A;  1GVP A;  1U4P A;  3DLL A;  3UI2 A;  2LXJ A;  3Q24 A;  1YHB A;  4K0K Q;  3K81 C;  2R61 A;  4LJZ C;  5CV7 A;  1PH1 A;  3NQT A;  3C2P A;  4HJ7 A;  5D3D A;  4EQO A;  5EJW A;  1DOL A;  2JK8 A;  2R93 B;  4BY7 H;  5K1X A;  5KND A;  4RG1 A;  4H2Y A;  3HKZ E;  1PFM A;  2JA6 G;  3S1Q H;  2B2W C;  2ZNI A;  3FMC A;  4DV1 L;  4A3K G;  3K7A H;  2SOB A;  4X62 L;  1WFQ A;  2BE5 C;  4X3U A;  2F0E A;  1QG7 A;  5HGQ A;  4B3T Q;  3I70 A;  4OO1 I;  1H9J A;  3GP7 A;  5GRO A;  1SLJ A;  1KAW A;  2KHJ A;  1PH3 A;  1S4Z A;  4C56 C;  2LSS A;  2DTH A;  1PHJ A;  1O78 A;  2AMC B;  2EVB A;  3Q22 A;  2IJ0 A;  4IFD H;  1C0A A;  2F0S A;  4HVC A;  2JEA I;  2NZO A;  3PIO A;  4OON A;  1M90 C;  1PZJ D;  3PIO 3;  1QOH A;  2WII B;  2Y0S B;  3RNU A;  1SJE D;  3BDO A;  3M4O B;  5M5W B;  4UY8 C;  2HQE A;  1VDZ A;  2VUM H;  4A3E H;  3FHW A;  1DZ1 A;  3HS0 C;  2RDF A;  5CV4 A;  1QWY A;  3VA7 A;  1U5K A;  3RD4 A;  4C3I B;  5C4J H;  4GS3 A;  2B2U C;  4CH5 A;  4TKO B;  3D3R A;  4PZ7 A;  1B2T A;  2ZCE A;  2RF4 A;  4NW2 A;  4DUY L;  4XTU A;  3VQV A;  3ICA A;  3K6O A;  3HOU B;  4MNO A;  1BBW A;  2A69 C;  1Y1W H;  1LT6 D;  1ENA A;  1VS0 A;  4RDX A;  1WOC A;  2BH8 A;  1MBY A;  3HRI A;  1V1Q A;  3RZD B;  4LVK A;  3DWQ A;  3MFY A;  3TQY A;  1FYC A;  4OGQ C;  3OWF A;  4A3L H;  2QCP X;  4P71 A;  2ZT5 A;  5EPJ A;  1DON A;  4GN3 B;  3W3A A;  2MGS A;  1LTA D;  1OXX K;  1S5B D;  3LWE A;  5GAH C;  4YRR A;  1QVF A;  1NE3 A;  2J3L A;  2AHO B;  1R9T H;  2E2H H;  2E5A A;  4HA8 A;  1SJH D;  3BVG A;  3L2P A;  2F0V A;  1J5W A;  1VQG A;  4PHC A;  4KMU C;  1IBL Q;  2L0C A;  3DMU A;  4HED A;  1SE2 A;  1Z7T A;  1SRO A;  1WTP A;  4A3B H;  2WKD A;  1HQR D;  4DPG A;  1NY4 A;  1OO9 B;  4GLV B;  4CDF C;  2B63 H;  1U4M A;  4QCL A;  1KMM A;  1TXY A;  4A3I B;  2G4C A;  2FMC A;  3TRE A;  3HXZ A;  5L37 A;  2PNR C;  1EQV A;  4YRK A;  1BR9 A;  1TWF B;  1F9R A;  4A93 B;  1STB A;  4K8J A;  3T1H Q;  2CIM A;  3HFZ A;  3L7Z C;  1JJ2 A;  4B3M Q;  2XRQ D;  1GD7 A;  1TQO A;  4DV2 Q;  4GKK Q;  2IX1 A;  1SEB D;  3NEM A;  5FO8 B;  4JV5 Q;  3GO5 A;  2MO0 A;  4YYE A;  1EIG A;  2PMZ E;  4MZ9 A;  1E22 A;  1LM0 A;  1V9P A;  4DV4 Q;  2CGH A;  4CH6 A;  3NSW A;  4KTA A;  1OXT A;  4ZKB B;  4U67 3;  2EE1 A;  3I4M B;  2DKG A;  3T53 B;  1KNE A;  4GNX C;  1JJG A;  2CWA A;  2MNA A;  1IKL A;  1BIB A;  2RSO A;  5LMU L;  1A2T A;  4L87 A;  2ODR D;  4JYA Q;  2A68 C;  4CDC C;  1GUW A;  2WB1 E;  3T1Y Q;  2I5M X;  5K1P A;  1GUS A;  1KDC A;  3RAC A;  2CWP A;  2ZR3 A;  2AUK A;  3FP9 A;  4L6T B;  3S15 H;  3LWU A;  3U4Z A;  3WWV A;  4YRJ A;  5C3E G;  5C4X B;  2N49 A;  2GA4 B;  4H2V A;  2A6H C;  3LNN A;  4CKE A;  5A35 A;  2DEQ A;  1GM5 A;  2ZM6 Q;  1WCM H;  4J6H A;  3TSS A;  1BKB A;  4CJ0 B;  1KAB A;  1X32 A;  4KJN A;  4DNR B;  1YFT A;  3RKX A;  4EQP A;  4AH6 A;  4B3S L;  1I94 Q;  1ICW A;  1LYL A;  1HZB A;  3S1M H;  4LVI A;  5DM6 3;  4NXM L;  1LUZ A;  3S2H B;  3FKI H;  3HZX A;  2R7F A;  1G91 A;  3RKW A;  1U0L A;  3GQB A;  1J5E Q;  1E2Z A;  3MC0 B;  4ZCK A;  4OEL B;  4C3J H;  1VQZ A;  2F0P A;  1UWV A;  1YNN C;  4IFD I;  2EYL A;  1LTI D;  3AB9 A;  4QB4 A;  1BCP B;  1SE4 A;  3HFZ B;  2EJ9 A;  4BXX H;  4IUU A;  4O42 A;  4CHT B;  2NVY B;  5IY0 A;  1BBX C;  2EYJ A;  1GUO A;  4R8I A;  1TY0 A;  5ELF A;  3R3O A;  5IP7 G;  4QGU A;  5G3L D;  1ENC A;  5BN3 A;  1DM0 B;  4DV6 L;  2QDL A;  4PNY A;  3I72 A;  4K0K L;  4HWO A;  3REU A;  1F2M A;  4PG3 A;  3S1N B;  2EYH A;  2K5V A;  3MWY W;  5CGK A;  1GUG A;  3M7N A;  2B8F A;  5GAG C;  3SK5 A;  1VMC A;  3D4W A;  2WIN B;  2JEB I;  1WNL A;  4X65 Q;  3QIA A;  1KAA A;  2E2J H;  1WPY A;  4HWR A;  4BS9 A;  3TN2 A;  2K1B A;  1PV4 A;  5C4Z A;  4DQ2 A;  2JA8 G;  3MHB A;  1XNQ Q;  5M3M H;  5EAY A;  5IP9 H;  3Q23 A;  4B3T L;  1TS4 A;  1KLG D;  1BO0 A;  4NPS A;  3HOX B;  1O7L A;  1NJI C;  1WQW A;  4RGO S;  3MTS A;  2OF1 A;  3VYS A;  1YIT A;  1WQ7 A;  2BCO A;  4IAL A;  3EBE A;  4Z9C B;  2L9H A;  1NUC A;  2WAQ G;  4XYQ A;  2VQF Q;  3HOU H;  2NB0 A;  3GD7 A;  3HP3 A;  3GTJ B;  4IFD J;  4EQN A;  4A3D G;  3HOV B;  3L4G A;  3G6E A;  3V2T A;  5I2Y A;  3CRK C;  3STB C;  4KY7 A;  1LT5 D;  4CDE C;  3H0G G;  4HWP A;  2NN6 G;  5JOB A;  1AZP A;  3OD1 A;  2UUB Q;  4IN3 A;  1NAP A;  2O2L D;  1SYF A;  4IZ8 A;  3IFD A;  4A3M B;  4RQF A;  2OXP A;  3HOY H;  3CKI B;  1GKH A;  2I4M A;  2OTL A;  4C3H B;  5HGT A;  3VQX A;  1Y8P B;  2ALY A;  1K8M A;  2FMM A;  3P8T A;  4IJH A;  5D3I B;  4AYB B;  3QJY A;  4XTZ A;  1BCP F;  1SFO B;  3HOZ H;  4GN4 B;  2IX0 A;  4JI0 Q;  3J81 c;  4LNQ A;  3MA2 B;  5LHY 1;  2B2V A;  3GTO B;  5DNF A;  3ULP A;  1EIY A;  1F9S A;  2ZT6 A;  1QE6 A;  3SDZ A;  1B8A A;  2CH4 W;  2ART A;  1GHK A;  4YRS A;  1EZ6 A;  5IYB G;  1NNX A;  3CP0 A;  3LSQ A;  1ZXT A;  2ZXP A;  2KOL A;  1B50 A;  2JA6 B;  4KV6 A;  2R93 G;  1PRT B;  1V8Q A;  4CJ2 C;  3EVQ A;  1Z6H A;  2CW0 D;  3KLR A;  1D5Z C;  4XYO A;  4JPB W;  3CF5 A;  5J3B A;  4DR4 Q;  1IBL L;  2R7D A;  2K50 A;  1S5E D;  5CV8 A;  3RLN A;  4P74 C;  5J39 A;  1N33 Q;  1S40 A;  1VQM A;  2IL8 A;  3S17 H;  1X54 A;  4BY1 B;  3ICE A;  3M7G A;  2QHT A;  5CBE E;  1VQH A;  3PV0 A;  4L63 B;  3KJP A;  3T1H L;  3F2B A;  4YWK A;  3KLW A;  1CKN A;  5C5M A;  4H02 A;  1XNR Q;  2CHB D;  4B3M L;  1TWH B;  3I4N H;  4DV2 L;  1IBK Q;  4GKK L;  1X2H A;  1S5C D;  5GAE C;  3L4G B;  5EKL A;  1WTR A;  2NVQ H;  2QHV A;  1JOQ A;  3H6M A;  3PO2 B;  4JV5 L;  4TQF A;  4YPF A;  1TWG H;  3BYY B;  5T1G A;  3WQZ A;  3A8K E;  1EVL A;  4CS3 A;  2F0L A;  4RH6 A;  1TY2 A;  1NTG A;  2JE6 I;  4LFB L;  2KCT A;  1NR4 A;  1MGS A;  3VR2 A;  2Z9H A;  4A76 A;  4JYA L;  2WV6 D;  1YBY A;  1Y8N B;  4DR3 Q;  1K0S A;  2ASB A;  2ALY B;  4JC0 A;  2F0G A;  3T1Y L;  1SNM A;  2F0K A;  3OW7 A;  2PYK A;  4XU2 A;  4K87 A;  1QB5 D;  1CKO A;  3W5O A;  1STA A;  5A2Q E;  1HPC A;  1RJT A;  1C48 A;  3EN2 A;  1SNC A;  1J8I A;  1G2T A;  4DNI A;  4Y52 H;  1FD7 D;  2LKV A;  1STN A;  3ZYY X;  1EIY B;  2EJG A;  2H5X A;  3TEG A;  1I4H A;  1D5M C;  1RHP A;  2R3Z A;  3VBB A;  4YCV A;  3H91 A;  3BYT B;  2ZM6 L;  1Z47 A;  3HFV A;  2ZTD A;  5FKA C;  2Q7H A;  4DAY A;  1XYI A;  3JAM c;  1B1Z A;  2NBF A;  5IGG A;  3KJO A;  2OTJ A;  5M5X H;  1Y1V H;  2NVY H;  1GOZ A;  2ZTG A;  1I94 L;  3S2D B;  4A4I A;  2PO4 A;  4IOC A;  2IY5 A;  2E5L Q;  3A7A A;  3I3C A;  4YRN A;  1QZG A;  4A3I G;  5IOC A;  3DM3 A;  1J5E L;  2Q5I A;  2RCF A;  2R6G A;  3GTK B;  2EYO A;  2JYO A;  2K5D A;  1H9R A;  3A7L A;  5JEA H;  3K5O A;  2ZXR A;  4A93 G;  1EQR A;  2OEO A;  1CKN B;  3NUC A;  3NBI A;  1S5D D;  3CCS A;  4QJF A;  2ZT7 A;  2K04 A;  4N8X 1;  3KYH C;  3CC7 A;  2VY3 A;  4K6D A;  2RHQ A;  1EQQ A;  5IGD A;  4ULL A;  3S1R H;  1YEZ A;  2KCC A;  3K0X A;  5DLQ E;  4K14 A;  3W1B A;  2ES2 A;  1NYR A;  2B8G A;  1KXL A;  3WOF A;  1EYC A;  2EAY A;  1EFI D;  4UDU C;  4KQE A;  1G2S A;  1A8V A;  1HNX Q;  1BBU A;  2ZZE A;  2XWJ B;  4XEM A;  2R7Z B;  2ODR C;  4BBR B;  4A75 A;  3MVV A;  4N9T A;  2QDB A;  3U9O A;  5C3E B;  3TME A;  4X65 L;  4YWL A;  1VQP A;  3PGZ A;  2M2L A;  1M8A A;  4RKB A;  4PMB A;  1VQI A;  3VYU A;  3S9W A;  2L55 A;  2L5T A;  1XNQ L;  2Q2I A;  1PH2 A;  3KOJ A;  1CM9 A;  1Q12 A;  4JI7 Q;  1FJG Q;  5IYD H;  3BDC A;  4DU9 A;  3A5Y A;  1KRS A;  2M9V A;  3EFX D;  4P3N A;  4BBS G;  5FJ8 G;  1EY8 A;  5HUR A;  1B3A A;  3TS0 A;  3NBH A;  1W66 A;  2Y0S E;  2G5D A;  4DAY B;  1VQF A;  5KEE A;  2ATW A;  1H4Q A;  2DN8 A;  3HOW G;  1PTO H;  1TWA H;  2IY5 B;  3J80 L;  3A7A B;  3E9I A;  3VDY A;  4MHE A;  2K14 A;  1HA6 A;  1I50 B;  5I9O A;  2IW3 A;  3CCE A;  3NPP A;  2UUB L;  2F3V A;  1D7Q A;  2DVE A;  3VYR A;  3GTO H;  2B2T A;  4Q0F A;  2KCN A;  5E4X A;  5I6W A;  4DUZ Q;  2MHV A;  2K05 A;  4IUV A;  3BVM A;  1JOK A;  1ASZ A;  4A3K H;  2RHQ B;  1Q8K A;  3U9S A;  5M3F G;  1H95 A;  3GTP B;  4JI0 L;  1V1O A;  3RN5 A;  4N8F A;  2N78 A;  1XWE A;  4QY7 A;  4QUF A;  1ML0 D;  4LVM A;  4HR7 B;  1PMR A;  1QJO A;  1EWH A;  2F0O A;  1EIH A;  2ARS A;  2WP8 J;  4RWS C;  5M9O A;  1VQB A;  2FIN B;  5IGF A;  5D14 A;  3HXW A;  4KHP Q;  1A0I A;  5FLX E;  5IT9 E;  1GO3 E;  3S14 H;  4G85 A;  3NTI A;  1JMC A;  1EYD A;  3OHX C;  2CFM A;  1AW7 A;  1RF2 D;  3AFQ A;  3K0Y A;  5C3W A;  4G4K A;  4DR4 L;  2RVL A;  5I2X A;  2C7I A;  4LVL A;  2I4O A;  2RCN A;  5AFW A;  3A74 A;  2MPM A;  3NEN A;  2B2Y A;  4OWW B;  1FVI A;  3HOX G;  4ZUI A;  2XRS D;  4DR5 Q;  1N33 L;  3BZK A;  1A6X A;  3NBH B;  4RKL A;  3HKS A;  2RDH A;  5AJ3 Q;  5CR3 A;  1CHQ D;  4A3C G;  1BUV T;  3SK4 A;  4A3D B;  2JP1 A;  3ERQ A;  1PZI D;  1XNR L;  2P5Z X;  1XJV A;  4KI0 A;  2EJM A;  1IBK L;  1EL0 A;  1YZ6 A;  3JAM E;  5EKK A;  2I4N A;  3CCR A;  4DN4 M;  3HOV G;  3NWS A;  2LS0 1;  1ADY A;  4RCN A;  3Q8D A;  1B53 A;  3U50 C;  1AFP A;  4YRF A;  1NJ8 A;  2ZT9 C;  3PIP A;  4GKJ Q;  3G71 A;  3WOE A;  2DY8 A;  3J81 L;  3PIP 3;  3OIP A;  2NWG A;  1EEF D;  1HRJ A;  4APV A;  1PA6 A;  3FVQ A;  1CA5 A;  4GZY C;  2O5J C;  5CV9 A;  1NNH A;  4A3M G;  1N36 Q;  4OX9 Q;  1PH5 A;  2VZA A;  4CGY B;  4OO1 G;  4EGV A;  4X6A H;  2KBN A;  4C3H G;  4DR3 L;  1H4T A;  3I55 A;  1TVX A;  3FRP B;  4YRE A;  4K6L A;  1I6H H;  1C8C A;  1HNZ Q;  4AYB G;  4IUR A;  2NVT B;  1HXD A;  5EPK A;  2O5I C;  5BN4 A;  4UAI A;  3QOJ A;  5T1I A;  1QCB D;  5ELE A;  2RKS A;  1CI3 M;  1YFS A;  3EFS A;  2F0J A;  2MP1 A;  1UE1 A;  3OPO A;  5EQ0 A;  3P1H A;  1H9M A;  4KHZ A;  1VQ6 A;  1UAP A;  4POG A;  1HJP A;  2K28 A;  1ZKO A;  2NTS A;  3PMF A;  4WOR A;  1PFN A;  3GTK H;  4X5O A;  3PUV A;  2VQE Q;  2CW0 C;  1XMO Q;  1SYE A;  2F0D A;  1AE3 A;  3NTH A;  4HMI A;  4P73 A;  1SRY A;  5BN5 A;  2I5H A;  4R9W A;  1HTL D;  4DKA C;  1JE5 A;  4MTN A;  4ZK9 B;  5GQO A;  2E5L L;  4HJA A;  4C2M H;  1EU4 A;  3VQY A;  3BFM A;  3GTM H;  1NBW A;  1TWC H;  1Q86 C;  5IYC G;  2V4D A;  4QIW B;  1NJ6 A;  4BY1 G;  3UE0 A;  5LL6 X;  3RIR A;  3G48 A;  4R1J A;  3UDG A;  4G7Z C;  3OWE B;  2A6E D;  2NVX B;  4XTY A;  2K01 A;  3T13 A;  1H9K A;  1PYB A;  3NP8 A;  3VQW A;  3JAM i;  4ODG A;  3MXN A;  3V7R A;  1STG A;  2PZT A;  1VQD A;  5M5Y B;  3MEF A;  5JEA J;  1UEA B;  3PO2 G;  2ZGW A;  1SN8 A;  2JA5 H;  1V1P A;  3BS1 A;  4PZ6 A;  4CJ1 B;  3TZU A;  2ICE C;  4H2U A;  1WTH A;  1DGS A;  1L1O A;  4FF4 A;  1HNX L;  4LFA Q;  3RKY A;  2TMP A;  2JA7 B;  3DEP A;  1CT1 D;  3HXU A;  4H2T A;  4XTV A;  2QEJ C;  1PTO C;  5KRU A;  5IWA Q;  3RL6 A;  2OQ0 A;  3U4V A;  3RMH A;  1NJ2 A;  2EQS A;  1WD0 A;  1K3B C;  2KED A;  2ZZG A;  1RD9 D;  1YJN A;  2YU9 B;  1USY A;  3GV6 A;  2BH2 A;  2F4V Q;  4K86 A;  1FJG L;  2ZJQ A;  3D4D A;  4G84 A;  3LC0 A;  1SAP A;  1CTM A;  1SXT A;  4XTC S;  1I50 H;  2FFK B;  1P8L A;  1EY0 A;  4KHV A;  3E0J A;  4MN3 A;  3PO3 H;  1X3G A;  11AS A;  2KUM A;  1IL8 A;  2AUJ D;  2J0T D;  2YV5 A;  2PW5 A;  2PI2 A;  3KLS X;  5CBA E;  3VR4 A;  2UXD L;  1DCZ A;  5IP7 H;  2F3I A;  4P2C B;  3HXV A;  3QO8 A;  1M1K C;  4EQ5 A;  4A3G G;  3CRL C;  5ELC A;  5IGC A;  2Q7G A;  4LF6 Q;  1HR0 Q;  3J7A V;  1WJJ A;  2AQ1 B;  2ZIN A;  4R4Q A;  3DHQ A;  4DV0 Q;  3IAY A;  4JI2 Q;  1N34 Q;  3A56 A;  3CC4 A;  2R92 G;  1GUT A;  3GV3 A;  2MUY A;  2QEX A;  2ARU A;  1SER A;  3U58 A;  4YHH Q;  1ICF B;  1SNO A;  1D5X C;  3EIV A;  2JA8 H;  3MXN B;  1VQE A;  4RGM A;  1VQ4 A;  4I7Z C;  1F9Q A;  5FO9 B;  4IUQ A;  1QF6 A;  4BY7 G;  4L8J A;  4IPC A;  1LO5 D;  4DV7 Q;  1ENF A;  4RHS A;  1V1P B;  3BJU A;  4YRI A;  4LWC A;  4IUN A;  4OP0 A;  2JA9 A;  1B44 D;  1AN8 A;  1S72 A;  4AIM A;  2PW7 A;  3CCM A;  3TP7 A;  1E2W A;  1VQN A;  1VQK A;  4X64 Q;  1L1O B;  2NZH A;  4KHP L;  3O13 A;  1EY9 A;  4CBV A;  3M85 A;  1K9M C;  2R7Z G;  4BBR G;  2E2I B;  2DZC A;  3KLS A;  1VQL A;  2EDG A;  4FNF A;  2NZ1 D;  3GTG H;  3PSI A;  1EY7 A;  3QOL A;  4NXN L;  2IPK D;  3H0G H;  5IIF A;  2IX3 A;  4BBS B;  3ULJ A;  1JQY D;  4HIM A;  4P75 C;  1QUQ B;  1K0R A;  1A63 A;  1O80 A;  1E1O A;  1H9S A;  3GDE A;  4DR5 L;  4OIJ A;  1JOR A;  2VUM G;  4A3E G;  3F2D A;  5C44 B;  3HEJ A;  3L9A X;  1CK1 A;  2D2C C;  5AJ3 L;  4EO4 A;  1ET6 A;  2DJZ A;  3HOW B;  3IG2 A;  2YTV A;  1EY5 A;  2V1C C;  2DU5 A;  4KN7 C;  3TEH A;  5LMN W;  1CZW A;  1Q46 A;  1XPO A;  2DJG C;  1G8Z D;  1B3Q A;  4LK1 C;  4JI3 Q;  1NSN S;  1BOS A;  5C4H A;  4UPA A;  1K8G A;  1Y1W G;  1QNK A;  2P0L A;  1KHI A;  3J81 j;  1EY4 A;  5IYB H;  2F0U A;  3BDL A;  3MXP A;  5KYI A;  1N36 L;  4DK0 A;  4YWM A;  2R93 H;  2B2U A;  3URY A;  4DR2 Q;  1IYJ B;  3R93 A;  5M3F B;  4IJL A;  1SND A;  5ELO A;  4A3L G;  3A5Z A;  3K80 C;  3RZO B;  4BWA A;  2CJA A;  4O0A A;  1AZQ A;  2I07 B;  1ESR A;  1Y14 B;  1HNZ L;  4YRP A;  1SE8 A;  1SNP A;  4M8A A;  2F0T A;  1EVK A;  2VB2 X;  4XU3 A;  1HUN A;  1VQO A;  3PF4 A;  4GOP B;  2RQX A;  3W3S A;  1JWS D;  2ID0 A;  4X66 Q;  1YJ9 A;  2XVS A;  4NP5 A;  3S16 B;  3GTL B;  3ITP A;  4A3B G;  4YY3 Q;  1LTB D;  2NYZ D;  3VA5 A;  1T9H A;  2B63 G;  2HCI A;  3V7S A;  3RR5 A;  2VQE L;  1RKN A; 
#chains in the Genus database with same CATH homology
 1RIP A;  1CKM A;  5M5W H;  3M4O H;  1XMO L;  4HJ9 A;  4K88 A;  4ME3 A;  3P8V A;  3QO7 A;  4C3I H;  1X9N A;  4DV3 Q;  2L15 A;  4OWX B;  2AKW A;  1C9O A;  4GLA C;  3TEH B;  4ZTZ B;  1PH4 A;  1NJ5 A;  5FLM H;  5C0X G;  2Z0S A;  3RZD H;  1HH2 P;  3CMA A;  4LW1 A;  1VQJ A;  2ZT8 A;  2K4K A;  1HR0 W;  4UP7 A;  4HIK A;  1KOG A;  3F8T A;  2CKZ B;  3OTO Q;  4LFA L;  3A5Z B;  2A8V A;  4YRM A;  4GNX A;  1Q1B A;  5IWA L;  4JI8 Q;  1CSP A;  1X3F A;  1YGB A;  4A3I H;  3IKM B;  2UUC Q;  4R4O A;  2Z6K C;  1TWF H;  4A93 H;  4YRG A;  3HY1 A;  1UE5 A;  3NEL A;  4JI6 Q;  2NS6 A;  2GVB A;  1Z7M A;  1HZC A;  3R07 A;  1AE2 A;  4TQD A;  5C52 B;  3L1A A;  1FGU A;  4BXX G;  2UXC Q;  2YTY A;  3I4M H;  3CPF A;  4LF6 L;  3A0J A;  5E7N A;  1VQ7 A;  4DV0 L;  2AKW B;  4JI2 L;  1N34 L;  4LVJ A;  2CJ9 A;  1PH8 A;  2I0Q A;  4YHH L;  2DUD A;  4H2S A;  3UGQ A;  2E8G A;  5C4X H;  4JOI C;  4DV4 L;  2DXU A;  2XTI A;  2E10 A;  1CSQ A;  4DV7 L;  1QZH A;  5IT9 c;  1FL0 A;  5FLX c;  4BBS H;  5FJ8 H;  1MJE A;  1G5I A;  3CCU A;  2JA7 G;  4GNX B;  3HOW H;  4TTV A;  4LF7 Q;  4DR6 Q;  1WU7 A;  3KF8 B;  3S2H H;  2WAQ E;  2VW9 A;  3UDI A;  4ALP A;  4HJ8 A;  2QHS A;  1G29 1;  4LF9 Q;  4L5Q A;  2E64 A;  1QVC A;  3MQZ A;  3BZC A;  1Q81 C;  4R4I A;  3CCJ A;  3HOY G;  3LGJ A;  1YIJ A;  4CS2 A;  1YHQ A;  3CW2 C;  3S1N H;  3FJP A;  4X62 Q;  1FYF A;  2F52 A;  3HOZ G;  1OTC A;  2RHS A;  3PCO B;  2OWO A;  1QVG A;  2HHH Q;  3PUW A;  2PMF A;  1N8R C;  4P72 C;  4JBW A;  1OXV A;  4WF2 A;  2QHU A;  3HOX H;  4JI4 Q;  4X66 L;  1VCI A;  2B3G A;  4YY3 L;  1K8A C;  3TUP A;  4JI1 Q;  3OYY A;  3TS2 A;  4DUY Q;  3GTJ H;  2N8N A;  3HOV H;  2DQ3 A;  3M4P A;  1KMN A;  2BA0 A;  2C35 B;  3UE1 A;  4DV3 L;  4BA1 I;  4CH4 A;  1X6O A;  4A3M H;  4YRT A;  1G6P A;  3HY0 A;  1JB7 A;  5C44 G;  4P74 A;  2VQF L;  4C3H H;  2Q2H A;  1N9W A;  1SFO H;  1YFR A;  3IKL A;  1I5F A;  4CH3 A;  1C7Y A;  3PUX A;  2DGY A;  1ATI A;  3HXX A;  2LXK A;  1HC7 A;  3HKZ G;  2VNU D;  2JA6 H;  2RHS B;  3OTO L;  4GLX A;  4JBK A;  1ADJ A;  4E51 A;  1H4S A;  4ZIB A;  2P5I A;  4JI8 L;  4KR2 A;  1L2F A;  1VQA A;  3CCV A;  2Q7E A;  1QE0 A;  4POF A;  2D0O A;  1A62 A;  1XPR A;  3PZC A;  1N32 Q;  1E1T A;  4BY1 H;  2UUC L;  12AS A;  3UDX A;  4EX5 A;  5H1S E;  1TWH H;  1PYS B;  2KEN A;  3CMQ A;  2VL6 A;  1GGM A;  1EFW A;  4JI6 L;  4A3F G;  3PO2 H;  5JEA G;  3PUY A;  4P71 C;  4AQY Q;  1H4V B;  2UXC L;  2GVA A;  2JQO A;  3F1Z A;  3JC6 6;  2HIV A;  2CJB A;  4BA2 I;  5JJI A;  2KCM A;  3K7U C;  4XU0 A;  2UUA Q;  2HIX A;  3KF6 A;  3G4S A;  4JI5 Q;  4RMF A;  3RUX A;  4DAM A;  3V7C A;  4A3J G;  1XMQ Q;  1X65 A;  2PME A;  3MF1 A;  4YRO A;  2IHF A;  4LF7 L;  3S2D H;  4DR6 L;  4ZTU B;  4TVA B;  5BR8 Q;  5C53 B;  4B3R Q;  3LSS A;  2PI2 E;  3I56 A;  3CC2 A;  3CCL A;  1K73 C;  2R92 H;  2MO1 A;  2K75 A;  5LMN Q;  4JCV E;  4LF9 L;  4WJ4 A;  1PH9 A;  1OXU A;  1EYG A;  4P3P A;  2I4L A;  2QGQ A;  1X56 A;  4DK3 C;  3K8A A;  3I2Z A;  2WB1 G;  2EWN A;  4HIO A;  1E3P A;  2ZZF A;  4OLF A;  3CXC A;  2R7Z H;  4BBR H;  5GAD C;  5C3E H;  2HHH L;  1JJC A;  3UH0 A;  2ZJR A;  1EUJ A;  3KF6 B;  3MEY A;  1YB3 A;  4JI4 L;  1YNX A;  3L2Z A;  3AEV A;  3MF2 A;  2WFW A;  2D0P A;  4TVW A;  1IXR A;  4JI1 L;  3B6Y A;  4R4T A;  4XTX A;  4IPH A;  3M3Y H;  4JI7 L;  1QUQ A;  3A7R A;  4UP8 A;  2A8E A;  3UGT A;  1IZ6 A;  2DZ9 A;  4TWA A;  2KHI A;  3BU2 A;  3RN2 A;  1SES A;  2MFI A;  3ERR A;  1BVS A;  1B70 A;  4KLK A;  2E41 A;  3ERS X;  1W2B A;  1IBM Q;  4DR7 Q;  3GTP H;  2VS1 A;  1NYQ A;  3F2C A;  3CME A;  4DR1 Q;  4TQU S;  2MQH A;  2DXT A;  4YCW A;  4O2D A;  4DUZ L;  4AYB E;  1NMG A;  5HY6 A;  2BA1 A;  4QL5 A;  1JJC B;  4WJ3 M;  2K52 A;  2EJF A;  3UFG A;  4H2X A;  4GOP A;  3QNE A;  2DTO A;  3RLO A;  3RLF A;  1KL9 A;  4XTW A;  4HWS A;  1N32 L;  1EOV A;  4HWT A;  4OWT B;  1RIQ A;  4A3D H;  1X01 A;  4IFD G;  4FDB A;  2YTX A;  5IE8 A;  4LFB Q;  2OQK A;  4XU1 A;  2GN5 A;  1G5H A;  1KD1 C;  4AQY L;  1SR3 A;  1V43 A;  1KQS A;  3M4Q A;  2E3C A;  3HXY A;  5C51 B;  2PNH A;  2ZNJ A;  3HTZ A;  4DV5 Q;  1XPU A;  2JA5 G;  1B70 B;  2I5L X;  2ZR2 A;  2NVT H;  4GKJ L;  1PVO A;  2UUA L;  4L5R C;  4JI5 L;  4IO9 A;  4OX9 L;  1P16 A;  3D0F A;  4HJ5 A;  3TRZ A;  4Q15 A;  1G51 A;  1EIF A;  1XMQ L;  1YJW A;  4L5T A;  1KRT A;  2QA4 A;  1SMX A;  2UXB Q;  3E0E A;  2AWN A;  1CUK A;  3V8L A;  4H2X B;  1D8L A;  4P3O A;  3PO3 G;  4IOA A;  5BR8 L;  1OXS C;  4IPG A;  2Q2T A;  4B3R L;  3J80 c;  2PQA A;  3KFU A;  4LF8 Q;  2NVX H;  3H3V H;  3L0O A;  5LMN L;  3RGL A;  4WI1 A;  2ZTC A;  4YRL A;  1S3O A;  5M5Y H;  1Q1E A;  1X55 A;  5JJL A;  1KIX A;  1B7Y A;  3HRK A;  3A31 A;  3GTQ H;  2EXD A;  1SET A;  2JA7 H;  4QQB X;  1EWI A;  1ASY A;  4LUV A;  2E1H A;  3QTC A;  4XIG S;  2XGT A;  2YU9 H;  3SGI A;  4NCX A;  2ZIO A;  3REX A;  2UU9 Q;  4LUZ A;  2DTI A;  3AQQ A;  3I4O A;  4J15 A;  1VQC A;  4YRC A;  4LF4 Q;  1Z9F A;  2FXQ A;  3D31 A;  1WCM G;  2YYZ A;  3RF1 A;  2JJQ A;  2F4V L;  2B29 A;  1W3S A;  2OCE A;  4LFC Q;  3OW2 A;  1HNW Q;  3AYH B;  3PUZ A;  1AH9 A;  2PQA B;  3FKI G;  4P75 A;  1VQ8 A;  1UE7 A;  3KDF A;  4NB3 A;  3M9B A;  1O7I A;  2E65 A;  5JJK A;  1IBM L;  1JT8 A;  2NN6 I;  5C0X I;  4DR7 L;  2CQO A;  1HR0 L;  4DR1 L;  5KNN A;  3P8Y A;  3CD6 A;  3A7U A;  3PCO A;  4TVY A;  1B7Y B;  4LF5 Q;  2E2I H;  2HQL A;  2ZIM A;  1PH7 A;  4OXP A;  2Y0S G;  1RL2 A;  4PMW A;  2DU7 A;  4UP9 A;  5M3M G;  4X64 L;  2EL9 A;  2ZJP A;  5IP9 G;  3ULL A;  2IT1 A;  5C44 H;  3NET A;  5E3I A;  4JBJ A;  1UE6 A;  1BIA A;  2CCZ A;  5F5W A;  3HOU G;  3V8K A;  1Q82 C;  3IRB A;  1MIU A;  5FLM G;  5C0X J;  1MJC A;  3KDF B;  1VQ9 A;  1X2G A;  4DV5 L;  1Q7Y C;  1NMF A;  5M3F H;  3H3V I;  3J7A 5;  1WLE A;  3RZO H;  2N3S A;  3V8J A;  4BW9 A;  4JI3 L;  2Q2U A;  1HZA A;  2K5N A;  1YVC A;  3J7Z C;  1LTL A;  4DV1 Q;  2IHE A;  1VQ5 A;  2A1A A;  2K5H A;  4DR2 L;  4YDQ A;  3S16 H;  1SRU A;  3GTL H;  4H2W A;  1YI2 A;  3CPW A;  2UXB L;  4A3F H;  3CCQ A;  4CS4 A;  1HZ9 A;  4LUO A;  2D62 A;  2A19 A;  4HT4 A;  4A3C H;  2DDZ A;  3UDF A;  1K83 H;  3AFP A;  1WI5 A;  1PYS A;  3IAL A;  4PZ8 A;  4LF8 L;  3CAM A;  2Z6K A;  3I4M G;  4HID A;  3PF5 A;  4QIW E;  2HT1 A;  3I4N G;  1PFS A;  1Z7N A;  3ER0 A;  3QO5 A;  4A3J H;  5C4X G;  1J6Q A;  3I7F A;  4LNS A;  3J80 i;  4P73 C;  2C8M A;  4YP0 A;  1L0W A;  4IPD A;  2UXD Q;  2ZXF A;  4JOI A;  2UU9 L;  5K36 G;  4LF4 L;  4R4C A;  1YHA A;  4JBM A;  1WYD A;  1I3Q H;  4KR3 A;  3CQZ H;  4Q6G A;  2ZTE A;  4TVA A;  1B76 A;  5IYC H;  1Y1V G;  4LFC L;  2FYK A;  1HNW L;  3W1G A;  2EIF A;  1L1O C;  3ZJY C;  3G1Z A;  5LMU Q;  1E24 A;  2AWO A;  1USY C;  1KC8 C;  4Y7N H;  1E7Z A;  4NXN Q;  1K3R A;  5ELN A;  4LF5 L;  2AMC A;  3H15 A;  3J81 i;  3A32 A;  3E9H A;  2J3M A;  3DSQ A;  4GN5 A;  1UEB A;  1XTD A;  4XEO A;  4B3S Q;  4YRQ A;  3STB D;  4DK6 C;  4NXM Q;  1X3E A;  4P72 A;  1IL2 A;  3S24 A;  1PH6 A;  3A5U A;  5IYD G;  2HNI A;  2Q5H A;  1MKH A;  4A3G H;  4L5S A;  3EFR A;  4YCU A;  4RQE A;  2DQ0 A;  4JG2 A;  4GOP C;  1HTT A;  4DV6 Q;  1NJ1 A;  1GVP A;  3DLL A;  2LXJ A;  1YHB A;  4K0K Q;  3K81 C;  1PH1 A;  4HJ7 A;  2JK8 A;  4BY7 H;  5K1X A;  4RG1 A;  4H2Y A;  3HKZ E;  2JA6 G;  3S1Q H;  2ZNI A;  4DV1 L;  4A3K G;  3K7A H;  4X62 L;  1WFQ A;  4B3T Q;  5HGQ A;  4OO1 I;  5GRO A;  1SLJ A;  1KAW A;  2KHJ A;  1PH3 A;  2LSS A;  2DTH A;  1PHJ A;  2AMC B;  1C0A A;  4HVC A;  2JEA I;  2NZO A;  3PIO A;  4OON A;  1M90 C;  3RNU A;  4UY8 C;  2VUM H;  4A3E H;  3FHW A;  1U5K A;  5C4J H;  4GS3 A;  4CH5 A;  4PZ7 A;  2ZCE A;  2RF4 A;  4DUY L;  4XTU A;  3VQV A;  3ICA A;  4MNO A;  1BBW A;  1Y1W H;  1VS0 A;  4RDX A;  1WOC A;  2BH8 A;  3HRI A;  1V1Q A;  4LVK A;  3TQY A;  4A3L H;  4P71 A;  2ZT5 A;  4GN3 B;  4YRR A;  1OXX K;  5GAH C;  1QVF A;  1NE3 A;  2J3L A;  2AHO B;  1R9T H;  2E2H H;  2E5A A;  4HA8 A;  3L2P A;  1J5W A;  1VQG A;  4PHC A;  1IBL Q;  1SRO A;  4A3B H;  2B63 H;  4DPG A;  1NY4 A;  4GLV B;  1KMM A;  1TXY A;  2G4C A;  3TRE A;  3HXZ A;  4YRK A;  3T1H Q;  2CIM A;  3HFZ A;  3L7Z C;  1JJ2 A;  4B3M Q;  1GD7 A;  4DV2 Q;  4GKK Q;  2IX1 A;  3NEM A;  4JV5 Q;  3GO5 A;  2MO0 A;  4YYE A;  2PMZ E;  4MZ9 A;  1E22 A;  1LM0 A;  1V9P A;  4DV4 Q;  2CGH A;  4CH6 A;  1OXT A;  2DKG A;  4GNX C;  1JJG A;  2CWA A;  2MNA A;  1BIB A;  5LMU L;  4L87 A;  2ODR D;  4JYA Q;  2WB1 E;  3T1Y Q;  2I5M X;  5K1P A;  3RAC A;  2CWP A;  2ZR3 A;  3FP9 A;  3S15 H;  3U4Z A;  3WWV A;  4YRJ A;  5C3E G;  2N49 A;  4H2V A;  2DEQ A;  1GM5 A;  2ZM6 Q;  1WCM H;  1BKB A;  1YFT A;  3RKX A;  4AH6 A;  4B3S L;  1I94 Q;  1LYL A;  1HZB A;  3S1M H;  4LVI A;  4NXM L;  1LUZ A;  3FKI H;  2R7F A;  3RKW A;  1U0L A;  1J5E Q;  4C3J H;  1VQZ A;  1UWV A;  4IFD I;  3HFZ B;  2EJ9 A;  4BXX H;  5IY0 A;  4QGU A;  5IP7 G;  4DV6 L;  4K0K L;  4HWO A;  3REU A;  4PG3 A;  2K5V A;  3M7N A;  5GAG C;  2JEB I;  1WNL A;  4X65 Q;  2E2J H;  1WPY A;  4HWR A;  1PV4 A;  4DQ2 A;  2JA8 G;  1XNQ Q;  5M3M H;  5EAY A;  5IP9 H;  4B3T L;  4NPS A;  1NJI C;  1WQW A;  1YIT A;  1WQ7 A;  3EBE A;  2WAQ G;  2VQF Q;  3HOU H;  3GD7 A;  4IFD J;  4A3D G;  3L4G A;  3G6E A;  3STB C;  4HWP A;  3H0G G;  2NN6 G;  3OD1 A;  2UUB Q;  4RQF A;  3HOY H;  1GKH A;  2I4M A;  2OTL A;  3VQX A;  2ALY A;  3P8T A;  4IJH A;  4XTZ A;  3HOZ H;  4GN4 B;  2IX0 A;  4JI0 Q;  3J81 c;  4LNQ A;  3ULP A;  1EIY A;  2ZT6 A;  1B8A A;  2ART A;  4YRS A;  3LSQ A;  5IYB G;  3CP0 A;  2R93 G;  3CF5 A;  5J3B A;  4DR4 Q;  1IBL L;  2R7D A;  2K50 A;  3RLN A;  4P74 C;  1N33 Q;  1S40 A;  1VQM A;  3S17 H;  1X54 A;  3ICE A;  2QHT A;  1VQH A;  3PV0 A;  3KJP A;  3T1H L;  3F2B A;  4YWK A;  3KLW A;  1CKN A;  4H02 A;  1XNR Q;  4B3M L;  3I4N H;  4DV2 L;  1IBK Q;  4GKK L;  1X2H A;  5GAE C;  3L4G B;  2NVQ H;  2QHV A;  4JV5 L;  4TQF A;  4YPF A;  1TWG H;  3WQZ A;  1EVL A;  4CS3 A;  1NTG A;  2JE6 I;  4LFB L;  2KCT A;  4JYA L;  4A76 A;  4DR3 Q;  1YBY A;  2ASB A;  2ALY B;  4JC0 A;  3T1Y L;  4XU2 A;  4K87 A;  1CKO A;  3W5O A;  3EN2 A;  4DNI A;  4Y52 H;  2EJG A;  1EIY B;  2H5X A;  3TEG A;  3VBB A;  4YCV A;  2ZM6 L;  1Z47 A;  3HFV A;  2ZTD A;  2Q7H A;  3JAM c;  3KJO A;  2OTJ A;  5M5X H;  1Y1V H;  2NVY H;  2ZTG A;  1I94 L;  4A4I A;  4IOC A;  2IY5 A;  2E5L Q;  3A7A A;  4YRN A;  1QZG A;  4A3I G;  1J5E L;  3DM3 A;  2Q5I A;  2R6G A;  4A93 G;  1EQR A;  1CKN B;  3CCS A;  4QJF A;  2ZT7 A;  3KYH C;  3CC7 A;  2VY3 A;  2RHQ A;  1EQQ A;  3S1R H;  1YEZ A;  3K0X A;  5DLQ E;  2ES2 A;  3W1B A;  1NYR A;  1KXL A;  2EAY A;  4KQE A;  1A8V A;  1HNX Q;  1BBU A;  2ZZE A;  4XEM A;  2ODR C;  4A75 A;  4X65 L;  4YWL A;  1VQP A;  3PGZ A;  1VQI A;  1XNQ L;  2Q2I A;  1PH2 A;  3KOJ A;  1Q12 A;  4JI7 Q;  1FJG Q;  5IYD H;  3A5Y A;  1KRS A;  4P3N A;  4BBS G;  5FJ8 G;  3TS0 A;  1W66 A;  2Y0S E;  4DAY B;  1VQF A;  2ATW A;  1H4Q A;  3HOW G;  1TWA H;  2IY5 B;  3E9I A;  3VDY A;  2K14 A;  3CCE A;  2UUB L;  1D7Q A;  2DVE A;  3GTO H;  4DUZ Q;  1ASZ A;  4A3K H;  2RHQ B;  1Q8K A;  5M3F G;  1H95 A;  4JI0 L;  3RN5 A;  2N78 A;  4QY7 A;  4LVM A;  2ARS A;  2WP8 J;  1VQB A;  3HXW A;  4KHP Q;  1A0I A;  3S14 H;  1GO3 E;  4G85 A;  1JMC A;  2CFM A;  3AFQ A;  4DR4 L;  4LVL A;  2C7I A;  2I4O A;  2RCN A;  3A74 A;  3NEN A;  4OWW B;  1FVI A;  3HOX G;  4DR5 Q;  1N33 L;  3BZK A;  3NBH B;  3HKS A;  5AJ3 Q;  4A3C G;  1XNR L;  1XJV A;  4KI0 A;  1IBK L;  1YZ6 A;  2I4N A;  3CCR A;  3HOV G;  1ADY A;  3Q8D A;  3U50 C;  4YRF A;  1NJ8 A;  3PIP A;  4GKJ Q;  3G71 A;  4APV A;  1PA6 A;  1NNH A;  4A3M G;  1N36 Q;  4OX9 Q;  1PH5 A;  2VZA A;  4OO1 G;  4X6A H;  2KBN A;  4DR3 L;  1H4T A;  3I55 A;  4YRE A;  1I6H H;  1HNZ Q;  4AYB G;  1HXD A;  3EFS A;  1YFS A;  1UE1 A;  4KHZ A;  1VQ6 A;  4POG A;  1HJP A;  3GTK H;  4X5O A;  3PUV A;  2VQE Q;  1XMO Q;  1AE3 A;  4P73 A;  1SRY A;  2I5H A;  4DKA C;  1JE5 A;  4MTN A;  5GQO A;  2E5L L;  4HJA A;  4C2M H;  3VQY A;  3BFM A;  3GTM H;  1NBW A;  1TWC H;  1Q86 C;  5IYC G;  1NJ6 A;  4BY1 G;  3UE0 A;  3RIR A;  3G48 A;  4R1J A;  3UDG A;  4XTY A;  1PYB A;  3VQW A;  3JAM i;  3V7R A;  1VQD A;  3MEF A;  5JEA J;  3PO2 G;  2ZGW A;  1SN8 A;  2JA5 H;  4PZ6 A;  4H2U A;  1DGS A;  1L1O A;  1HNX L;  4LFA Q;  3RKY A;  3HXU A;  4H2T A;  4XTV A;  5IWA Q;  3RL6 A;  2OQ0 A;  3U4V A;  1NJ2 A;  2EQS A;  2ZZG A;  1YJN A;  1USY A;  2BH2 A;  2F4V Q;  4K86 A;  1FJG L;  2ZJQ A;  4G84 A;  3LC0 A;  4XTC S;  1I50 H;  1P8L A;  3PO3 H;  1X3G A;  11AS A;  2YV5 A;  2PI2 A;  2UXD L;  5IP7 H;  2F3I A;  3HXV A;  3QO8 A;  1M1K C;  4EQ5 A;  4A3G G;  2Q7G A;  4LF6 Q;  1HR0 Q;  1WJJ A;  2ZIN A;  4R4Q A;  4DV0 Q;  4JI2 Q;  1N34 Q;  3CC4 A;  2R92 G;  2QEX A;  2ARU A;  1SER A;  3U58 A;  4YHH Q;  3EIV A;  2JA8 H;  3MXN B;  1VQE A;  1VQ4 A;  1QF6 A;  4BY7 G;  4IPC A;  4DV7 Q;  3BJU A;  4YRI A;  4LWC A;  4OP0 A;  2JA9 A;  1S72 A;  4AIM A;  3CCM A;  1VQN A;  1VQK A;  4X64 Q;  1L1O B;  2NZH A;  4KHP L;  3M85 A;  1K9M C;  2R7Z G;  4BBR G;  2DZC A;  1VQL A;  3GTG H;  3PSI A;  4NXN L;  3H0G H;  3ULJ A;  4P75 C;  4HIM A;  1QUQ B;  1K0R A;  1A63 A;  1E1O A;  3GDE A;  4DR5 L;  2VUM G;  4A3E G;  3F2D A;  5AJ3 L;  4EO4 A;  2DJZ A;  3IG2 A;  2YTV A;  2V1C C;  2DU5 A;  3TEH A;  5LMN W;  1Q46 A;  1XPO A;  4JI3 Q;  4UPA A;  1K8G A;  1Y1W G;  2P0L A;  1KHI A;  3J81 j;  5IYB H;  1N36 L;  2R93 H;  4YWM A;  4DR2 Q;  1IYJ B;  4IJL A;  4A3L G;  5ELO A;  3A5Z A;  3K80 C;  4BWA A;  2CJA A;  4O0A A;  1Y14 B;  1HNZ L;  4YRP A;  1SE8 A;  1EVK A;  4XU3 A;  1VQO A;  3PF4 A;  4GOP B;  3W3S A;  2ID0 A;  4X66 Q;  1YJ9 A;  4A3B G;  4YY3 Q;  1T9H A;  2B63 G;  3V7S A;  3RR5 A;  2VQE L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...