4DPGA

Crystal structure of human lysrs: p38/aimp2 complex i
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
505
structure length
501
Chain Sequence
VDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/apoptosis
molecule keywords Lysine--tRNA ligase
publication title Structural Switch of Lysyl-tRNA Synthetase between Translation and Transcription.
pubmed doi rcsb
source organism Homo sapiens
total genus 158
structure length 501
sequence length 505
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dpgA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4dpgA02
1VQLA 2KCMA 2AKWB 4BBRG 4JI3Q 3GTKH 1L1OA 2I4OA 4A3MH 3OTOQ 1EFWA 4JBKA 1YHQA 4NB3A 4ALPA 5C44H 3LGJA 2UUBL 4P3PA 5GAGC 5JJIA 2ZZGA 4DV3Q 1HR0L 1PFSA 2B63G 4DV6Q 3IG2A 4JI6Q 2ZNJA 1TXYA 3A5UA 4JI2L 3M3YH 4TVWA 1VCIA 3BZKA 1YB3A 3J81i 3HOYG 4H2VA 1EIFA 1VQ6A 5M3FH 3A5ZB 4CS3A 3PUVA 1P16A 4YRSA 1SE8A 1G5IA 2NN6I 4LFAQ 3RLFA 2AWOA 4K88A 2YTYA 4K86A 4B3TQ 2UUCL 3AFQA 1YIJA 1FJGL 1K3RA 1QZGA 1WJJA 1X3EA 1I3QH 4LF5Q 3P8TA 3UDFA 1IBLQ 4OX9L 2OCEA 4JCVE 3CCMA 1I50H 1KD1C 4O0AA 1PVOA 1EVLA 2ZT8A 2F4VQ 3KDFB 4PHCA 2R92H 2JEBI 2KHIA 2N8NA 4OP0A 4JI4L 3T1HQ 4A3MG 4JI7Q 1J5EL 2DVEA 1YFRA 2N78A 3J80c 3HXWA 1TWAH 4LF7Q 1D8LA 2XTIA 3CW2C 2CJAA 4L5SA 4IPHA 1Z7MA 4UP7A 1JMCA 4IO9A 4YRTA 2F3IA 2DU5A 5M3FG 3CCEA 4QGUA 4L5RC 2YV5A 3A0JA 1S40A 2ZTEA 3CCRA 1QUQA 4C3JH 2ASBA 3HOXH 2NVYH 4TVYA 4GNXA 1WQ7A 2DQ0A 4XTUA 4A75A 1VQGA 2GVBA 1YGBA 5FJ8G 4H2XA 1SRUA 3G71A 5IYDG 2DKGA 2R92G 2K14A 2R7DA 2FXQA 2ID0A 4KR2A 3ERRA 2Y0SG 3PO2H 4IFDG 2VQEL 1RIQA 5J3BA 3HKZG 3RACA 3KYHC 4X66L 4XEOA 4YYEA 4RQFA 3UH0A 4TTVA 1SN8A 4L5TA 4C3HH 1WQWA 1Y1WH 1ADYA 1X6OA 3PF5A 4GLVB 2I5HA 1WI5A 1YHAA 3HRKA 2Z6KA 3W1GA 2OQKA 4LNSA 1PYBA 4YWLA 4YP0A 4B3ML 5E7NA 1NJ6A 1X54A 1B76A 4A3IH 3UDXA 2K75A 4Y52H 5LMNL 4JV5L 1U0LA 2UUAL 1SFOH 5C3EH 2ZR3A 4AYBE 1B70A 2YU9H 4MZ9A 4GOPC 4NPSA 2PI2E 2JA6H 3HOZH 1C9OA 4QJFA 1B8AA 3LSSA 2JJQA 1HXDA 3BJUA 1K0RA 2HHHL 4K87A 3V7SA 1PH1A 1V43A 3K81C 3S1NH 3W3SA 1Q1EA 4HIOA 2VUMG 4DR2Q 1VQ7A 3TS2A 4B3SL 2IX1A 4DR7Q 2RHQA 2KBNA 2I5MX 4XTCS 1L0WA 5C0XG 3F1ZA 4YCWA 5IY0A 3PO2G 4BY7H 1I94Q 2EXDA 4CH4A 2E64A 3GO5A 4A3LH 4JG2A 3EIVA 3EN2A 3V8KA 2B3GA 4DV2Q 2UXDL 1CUKA 4DPGA 3GTMH 1G51A 3RLNA 3AEVA 3G48A 3NEMA 2AHOB 3FP9A 3RUXA 2ZJQA 2UXBQ 2OWOA 2HIXA 3PIOA 2HQLA 1Q1BA 3HFZA 4A3BG 1TWHH 1Q46A 3U4VA 3TEHB 2JA6G 2PI2A 4YCUA 3HOZG 1BVSA 2WB1G 1VQFA 4JBMA 4P3OA 3J81j 4WJ4A 4YRNA 1VQCA 4JYAL 1HH2P 4GN5A 3ERSX 1USYA 3HY1A 2VNUD 1CKNA 5K1XA 1RIPA 3L1AA 4HIKA 1XNRL 1HNXQ 4DV0Q 4BW9A 5H1SE 2IY5A 2EJFA 4YRPA 2K5HA 2OTJA 3K7UC 1J6QA 1N33L 3KLWA 2JK8A 4P71A 3ULPA 1XMQL 4X64L 3L0OA 5GADC 2UUBQ 4IFDJ 4TQUS 4DKAC 1VQHA 4A3LG 3T1YL 3K0XA 4JI2Q 4YPFA 2JA8H 2EJ9A 2VZAA 2ZGWA 2QHSA 4XEMA 1KOGA 4G84A 5IP9H 2E2HH 4HWRA 2AKWA 5IWAL 1EOVA 3RZDH 4O2DA 4R4TA 2UUCQ 4YDQA 3SGIA 3M4PA 4A3FH 2C35B 5FLMH 1EQRA 3K7AH 2IHFA 1IBML 3REUA 4OX9Q 5BR8L 2RF4A 1XPRA 4TQDA 3A5ZA 3IALA 3EFSA 1IYJB 1G5HA 1HNZL 4GOPB 3MEYA 2KENA 1VQ4A 4JI4Q 1LUZA 1FVIA 2QHVA 3M4QA 2XGTA 3F2BA 2ZT7A 3PUZA 4P73A 3HOYH 3VDYA 3HXVA 4JI8L 4YY3L 5M5YH 3I2ZA 4YRMA 5C4JH 3UGQA 5GAHC 4MTNA 2JA8G 4HJ7A 3CPWA 2ARSA 3HXXA 1CSPA 3WWVA 3CD6A 3OD1A 1BBUA 1HTTA 4QY7A 1X56A 3KDFA 3AQQA 5EAYA 4P74A 5C53B 3QNEA 1CSQA 1UE7A 4X65L 5JJLA 2ZCEA 4HWPA 2CCZA 2CJBA 4DR6L 2CWPA 3HOUH 2PQAB 1HZBA 3RN2A 4BA2I 3CMEA 1H4VB 2DUDA 4A3FG 1E24A 4LF8L 5FLMG 1NBWA 4PZ8A 2P0LA 2HIVA 1JE5A 1I6HH 2P5IA 1R9TH 3GTLH 2EQSA 5C4XH 3U58A 3UE1A 2DXTA 5AJ3L 4A3EH 1LYLA 2E2IH 3VQXA 1MKHA 4IPDA 3UE0A 1IBKL 4RQEA 3A5YA 2GVAA 2MFIA 4JI1L 5IYCH 2VQEQ 3NBHB 4IOCA 3A31A 4YROA 3P8VA 2QEXA 4X66Q 1HR0W 1OXUA 1OXTA 1D7QA 4AH6A 1Y1VH 3RLOA 1K83H 1OXXK 3VBBA 1Z7NA 3ER0A 1PYSB 2E5AA 3EFRA 2DTHA 2ZXFA 5GQOA 4LF9L 1EQQA 3A74A 3JAMc 2PMFA 3TEGA 2N3SA 1SRYA 2I5LX 4K0KL 1L2FA 3RKWA 2B29A 1HZCA 1W66A 4DNIA 4B3MQ 2E65A 1ADJA 2VY3A 4JV5Q 2UUAQ 4C2MH 3HOUG 3F2CA 5FJ8H 4GKKL 4HVCA 4GNXC 3LC0A 3AYHB 4QIWE 3CCVA 1W3SA 3HKZE 4C3IH 1XMOL 3F8TA 1EVKA 5IYDH 1YFSA 3KJOA 3W5OA 3S16H 3A32A 1VQ8A 3PZCA 5C4XG 2OQ0A 2NZOA 1KIXA 3I4MH 2DZ9A 2NVTH 3S2DH 1MIUA 1V9PA 2EL9A 4B3SQ 3PCOB 4A3EG 2DTIA 2R7FA 3Q8DA 4KHPL 1G291 5LMUL 2DTOA 4LFBL 5IYCG 4ME3A 3PF4A 4ZTZB 2ZTGA 1Y1VG 3E0EA 2J3MA 2MO1A 3B6YA 1JB7A 2Z6KC 3H0GH 5M5WH 5C51B 1PH4A 4H2UA 2UXDQ 1SMXA 4DR1L 3UGTA 3HFVA 5IT9c 1KQSA 3F2DA 4OLFA 1NJ8A 3HOWH 3CAMA 3M7NA 2AMCB 4FDBA 1N32L 2DXUA 1N34L 2IHEA 3KJPA 3S2HH 1IL2A 4GKJL 3QTCA 3J81c 1A0IA 4YRKA 1CKMA 4RMFA 1NNHA 4JI0Q 2NVQH 2VUMH 2WP8J 3VQWA 2JA7G 4ZTUB 1KRSA 4A4IA 4JYAQ 2JA5G 1NYRA 3A7UA 4KHZA 4GN4B 1YITA 1Q82C 4PZ6A 3I4MG 1Z9FA 2JE6I 1MJEA 1WPYA 2EIFA 2BA0A 3FKIG 4OO1G 5ELNA 1U5KA 1Q7YC 3M85A 1LTLA 3G6EA 4MNOA 2YYZA 2MO0A 3PUXA 1OXVA 1N33Q 4BA1I 1SESA 2HT1A 4R4QA 4OXPA 4XTWA 4X64Q 3TEHA 4NXNL 1E7ZA 4JOIA 1GO3E 4DR4L 2K5VA 2WB1E 4POFA 1OTCA 4OONA 3S14H 3T1YQ 3H0GG 2ZZEA 3CCLA 1Q81C 3H3VH 3H15A 2BH8A 3RL6A 3QO5A 4XTXA 3REXA 4A3BH 5LMNW 4APVA 3HOWG 2ALYB 4B3TL 3PSIA 4H2SA 5IWAQ 1UE5A 1K73C 4KLKA 3CCUA 3GTGH 1IZ6A 5GROA 1EIYB 1TWGH 4YRFA 3HXUA 2EWNA 1IBLL 2E5LQ 4LUVA 3P8YA 1S72A 3CF5A 3HKSA 2Q2UA 5F5WA 3V7CA 1USYC 2ZIMA 1IBMQ 3I4OA 3I7FA 1XPUA 1VQ5A 2PNHA 4XU3A 4NCXA 5BR8Q 2NN6G 1YHBA 1NY4A 4RG1A 4X62L 1X9NA 11ASA 3A7AA 4A3GH 1T9HA 4DUZL 3V8LA 4YHHL 1HJPA 3JC66 2IT1A 4NXML 2I4MA 4YRIA 1DGSA 1KRTA 4YWMA 1GD7A 2ZT5A 1HC7A 1AH9A 1YZ6A 2VQFQ 3CC7A 4IPCA 3PO3H 1GVPA 4GS3A 4JI8Q 4YY3Q 4P75C 4BXXH 1KMNA 2ARTA 4TVAB 4DV5L 3QO7A 3E9IA 4L87A 2PMEA 1H4TA 4OWWB 1PH3A 4JBWA 4GOPA 4HJ8A 4DR6Q 4WJ3M 3L2PA 1W2BA 3ICEA 3I56A 2Q2HA 3BU2A 4DV1L 2D0OA 2ZTCA 3RKXA 5E3IA 2VS1A 1NE3A 3ZJYC 1K9MC 3K80C 3L4GB 1Q8KA 2QHUA 2DJZA 3M4OH 1PA6A 3U4ZA 4DV4L 2ZTDA 4R1JA 2E2JH 2ARUA 3IRBA 2D0PA 4A93G 2RCNA 2NVXH 1OXSC 1NMGA 2J3LA 5IYBH 2A8VA 2PMZE 3VQVA 3CCJA 1H95A 5FLXc 3DLLA 1E1OA 5AJ3Q 4A3GG 4R4IA 2CQOA 3GTQH 4R4CA 1IBKQ 1HR0Q 4LUOA 2CFMA 1VQBA 4XTVA 3CMQA 2PQAA 4WI1A 4JI1Q 2EAYA 4P73C 4CS4A 4IJLA 5GAEC 2Q2IA 1NMFA 4EQ5A 4H2YA 3PO3G 2R93H 5K1PA 5M3MG 4XU0A 4EX5A 4BXXG 1PHJA 1XJVA 1FL0A 3PV0A 1YJWA 1M1KC 2VW9A 2QGQA 4OWXB 2L15A 4K0KQ 4HJ9A 4TQFA 1WCMG 4UY8C 4A3CG 4P74C 1UE6A 1FJGQ 3HTZA 3CCSA 3K8AA 3UFGA 4GKKQ 4A76A 1KC8C 2Q2TA 2K5NA 2DGYA 1YI2A 1QVCA 1XMOQ 3HXYA 1PYSA 1L1OC 3S24A 1YNXA 1HNWL 5IYBG 3PUYA 1NJ1A 4LUZA 1J5EQ 4GN3B 3J7ZC 3GDEA 3HFZB 5C0XJ 3PGZA 4HJAA 4KHPQ 4YREA 1ATIA 5LMUQ 4LFBQ 2DU7A 1PH8A 3MF1A 4AIMA 2ZIOA 3CMAA 2R93G 4KR3A 2E10A 3ULJA 3NELA 1GM5A 1A62A 1BIBA 2WAQG 4JI5L 2LXKA 4DR1Q 1H4SA 4IFDI 2K52A 4LF6L 3TREA 1V1QA 4BWAA 4OO1I 1RL2A 1PH9A 3PCOA 1VQMA 4RDXA 1K8GA 3J80i 4HIDA 2F52A 4PMWA 3RZOH 1N32Q 3HRIA 1N36L 3RKYA 1AE2A 4HA8A 3KF6B 3TUPA 4GKJQ 4XU2A 2RHSB 4X6AH 2Q7GA 3KFUA 3HOVH 4AQYL 1LM0A 1QVFA 1PV4A 1X01A 1QE0A 4LF4L 2UXCL 4LWCA 2ZJRA 3I4NG 2UU9L 2AWNA 3HY0A 1YEZA 3WQZA 4A3KH 2AMCA 3IKMB 3W1BA 4BY1H 2CKZB 2Q5HA 4NXNQ 2KHJA 3CPFA 4DR5L 4DR4Q 4P72A 4YRRA 3EBEA 5HGQA 2LXJA 5C0XI 5LMNQ 2Z0SA 1A63A 2I4NA 2ZT6A 4A3DG 1C0AA 2Y0SE 1XNQL 1KL9A 3L2ZA 4G85A 2CWAA 1X3FA 1CKOA 1EYGA 4IOAA 1E1TA 2JA7H 2BH2A 3S1MH 3FHWA 1K8AC 2JA5H 4H2TA 2HHHQ 3DSQA 1KMMA 4DUYL 1Y14B 4L5QA 2ATWA 1GKHA 1N8RC 4YRQA 1B7YB 2YTXA 4LFCL 2LSSA 3HOVG 1VQKA 3FKIH 2IX0A 2I0QA 3IKLA 3LSQA 2FYKA 4R4OA 3H3VI 4DR3L 3PUWA 3V8JA 4B3RL 1NJIC 2GN5A 4CH6A 4X62Q 4XU1A 1JJCB 5JEAG 4DUZQ 3TQYA 2ALYA 4CH5A 5C44G 1BBWA 4YHHQ 4A3KG 2DQ3A 4BY1G 4NXMQ 3QO8A 2C8MA 1HZAA 3TS0A 1EIYA 1J5WA 4A3JH 4POGA 4JOIC 3L7ZC 1L1OB 1S3OA 2Q5IA 2ZM6L 4DV5Q 3AFPA 4HWOA 4JC0A 4X5OA 4DV7L 4TWAA 2CJ9A 3FJPA 3MXNB 2DEQA 3S15H 3STBD 1JJ2A 3J7A5 4UPAA 2R7ZH 4DV1Q 1MJCA 1X55A 1M90C 1E3PA 3CXCA 5K36G 3D0FA 4JI3L 1XNRQ 1SR3A 3OTOL 1XPOA 4DV4Q 2QA4A 4TVAA 4YRGA 1GGMA 1UEBA 3OYYA 1A8VA 4IJHA 3STBC 2EJGA 4DV3L 4DV6L 1NYQA 2ZNIA 4JI6L 3KF8B 1XMQQ 3GTPH 4E51A 3RR5A 4YRLA 1PH2A 3G4SA 4DK6C 1IXRA 1KAWA 3OW2A 4A3JG 3RGLA 4XTZA 4YRJA 4LFAL 3L4GA 4Y7NH 2G4CA 2ZZFA 1UE1A 1X2GA 1TWFH 1VQDA 4DQ2A 1WYDA 5JJKA 1WU7A 1I5FA 4LF5L 3A7RA 3I55A 3HOXG 4DAYB 4QQBX 2ZR2A 1WLEA 5IP7H 2F4VL 3G1ZA 2QHTA 1O7IA 1KHIA 4LW1A 2R7ZG 3TRZA 1VQZA 1SETA 4A93H 3DM3A 1PH6A 3BFMA 1QUQB 3ULLA 3T1HL 4YCVA 4JI7L 2K4KA 4IPGA 2V1CC 4J15A 4HIMA 1YJ9A 4GNXB 4HJ5A 2A19A 1HNZQ 4LF7L 4YRCA 1HNWQ 4P71C 1KXLA 1QZHA 2Q7EA 5KNNA 2E8GA 2MNAA 5M5XH 3R07A 1E22A 4H2XB 1WFQA 5M3MH 1Q12A 1WNLA 2DZCA 5JEAJ 3BZCA 1Y1WG 2I4LA 1SLJA 3CQZH 1TWCH 4HWTA 1WCMH 3GTOH 4A3CH 1C7YA 4X65Q 4A3IG 2HNIA 2ZJPA 4JI5Q 5C3EG 2DDZA 4LF6Q 3RN5A 1ASYA 3NETA 4LF8Q 4JBJA 1N36Q 4JI0L 5IP7G 1YJNA 2MQHA 1JJGA 5IE8A 2A1AA 4KQEA 1FYFA 2ES2A 1X65A 1SERA 2E1HA 1VQJA 4BBSH 1NJ5A 2ZINA 4AYBG 4WF2A 1B70B 4CS2A 12ASA 1VQNA 3HXZA 4AQYQ 3UDIA 4EO4A 4YWKA 1G6PA 2D62A 4LF4Q 2UXCQ 2K50A 3CC4A 3M9BA 3GTJH 5C52B 3KOJA 2WAQE 4BY7G 3S1RH 1Q86C 2OTLA 5HY6A 3D31A 2CIMA 2UU9Q 2VL6A 1BIAA 2E41A 1JT8A 1AE3A 1SROA 3GD7A 4QL5A 4LF9Q 4P75A 3KF6A 2RHQB 2R6GA 1VQ9A 1YFTA 2RHSA 4DR5Q 4DAMA 4Q6GA 4XIGS 4H02A 4GLXA 2NZHA 4PG3A 3E9HA 1N9WA 4GLAC 3MF2A 4Q15A 4H2WA 3S1QH 2KCTA 4OWTB 4XTYA 1XNQQ 1X3GA 1HZ9A 4KI0A 1XTDA 1PH5A 2E5LL 1VQOA 4P3NA 2C7IA 3PIPA 3CP0A 4DR2L 2H5XA 1VQEA 4DR7L 5ELOA 4DUYQ 3UDGA 4BBSG 3JAMi 2Q7HA 5DLQE 4BBRH 3CC2A 4LNQA 3I4NH 3V7RA 4LFCQ 1NTGA 1I94L 3RIRA 4ZIBA 4DR3Q 1VQIA 1WOCA 2BA1A 2YTVA 4B3RQ 4UP8A 2B63H 3ICAA 1VS0A 4DK3C 1CKNB 2JA9A 4DV2L 1YBYA 2VQFL 2ODRD 2JEAI 1X2HA 4HWSA 2N49A 1BKBA 1VQAA 2IY5B 2JQOA 2WFWA 1PH7A 4P72C 1Z47A 1ASZA 3RNUA 2UXBL 1B7YA 4A3DH 1NJ2A 2E3CA 1QF6A 1QVGA 2ZM6Q 3S17H 1P8LA 2CGHA 3NENA 3CCQA 5IP9G 1N34Q 1EWIA 2ODRC 4DV7Q 1H4QA 1FGUA 4CH3A 1EUJA 4PZ7A 1VQPA 4UP9A 3MEFA 1JJCA 3VQYA 1HNXL 1UWVA 1YVCA 4DV0L 3U50C 3RF1A
chains in the Genus database with same CATH superfamily
2P5ZX 2AQ2B 2XWJB 1STEA 1VQLA 2KCMA 4MIUA 4B08A 1TS4A 1QWYA 2AKWB 4BBSB 4BBRG 2HQEA 1PRTC 4JI3Q 3GTKH 4FF2A 3SK5A 4F88A 1L1OA 2I4OA 2RKSA 4A3MH 3OTOQ 1EFWA 3M7GA 1B3AA 3MA2B 3MZ5A 4JBKA 1Y69U 2KHSA 1Z6HA 1YHQA 4NB3A 4ALPA 4P2CB 5C44H 3LGJA 2UUBL 4P3PA 5GAGC 5JJIA 2ZZGA 4DV3Q 1HR0L 1PFSA 2B63G 2J0TD 4DV6Q 3IG2A 4DAVA 4JI6Q 2ZNJA 1TXYA 5D14A 3A5UA 1Y8OB 4JI2L 3MXNA 3M3YH 4TVWA 1VCIA 1PTOC 3BZKA 1YB3A 3J81i 3BYYB 3HOYG 3A55A 4H2VA 1EIFA 2B8FA 2LY7A 3N52A 1VQ6A 2EYLA 3WOEA 3A5ZB 5M3FH 4CS3A 1Q90A 3X3MA 3KBXA 3PUVA 1P16A 4YRSA 3NWSA 1SE8A 1G5IA 4KJNA 2NN6I 4LFAQ 4HR7B 3T53B 3RLFA 2PMZB 1FD7D 2AWOA 1STNA 4XT1B 5IGGA 4K88A 2YTYA 1PMRA 4K86A 3SK4A 4CHTB 5IGBA 1RJTA 4UAIA 4B3TQ 2UUCL 3AFQA 1YIJA 1FJGL 1HHVA 1YNJD 1PTOH 1K3RA 1LLRD 1O7ZA 1WJJA 1X3EA 1QZGA 3S1QB 1J8IA 1I3QH 4LF5Q 3P8TA 3KF8A 3UDFA 1IBLQ 4OX9L 1C48A 2OCEA 4JCVE 1CZWA 4QUFA 3R8BA 3CCMA 1I50H 5JVG3 1KD1C 4O0AA 1PVOA 1EVLA 2ZT8A 2F4VQ 3KDFB 1G2TA 4PHCA 2R92H 2JEBI 1I4XA 3D4DA 2KHIA 2OEOA 1Q8IA 1SNCA 1RTOA 2N8NA 4OP0A 1YNJC 1S5FD 4JI4L 4BBRB 3T1HQ 3UI2A 4A3MG 4WORA 4JI7Q 1J5EL 3HS0C 2FINB 2DVEA 4IFDH 1YFRA 2N78A 2E75C 1EY8A 3J80c 4F87A 3HXWA 1TWAH 4LF7Q 1D8LA 2XTIA 3CW2C 2HCIA 5ELDA 2A6HD 2CJAA 4L5SA 3VYTA 4IPHA 2B63B 1Z7MA 4UP7A 3T4AC 4NW2A 1JMCA 1QNUA 3MXGA 5IGFA 4IO9A 1A15A 4DAYA 2KOLA 4YRTA 2NUCA 1GXDC 2F3IA 4ZKCB 2DU5A 3HOYB 5M3FG 3CCEA 4QGUA 5M5YB 4L5RC 2YV5A 3A0JA 2IW3A 1XXGA 1S40A 1RTNA 4OELB 2LS01 3NP8A 2KEEA 2ZTEA 3IKJA 3CCRA 5C4JB 1S5ED 1IKMA 4ZLTF 2M00A 1QUQA 1SYCA 2XIWA 3EVQA 4C3JH 3ITPA 1V1PB 1B53A 3S17B 3FPUB 4K8JA 2ASBA 3H94A 3HOXH 2NVYH 3TSSA 4TVYA 5C4ZA 2XVSA 4DK1A 4GNXA 1HRJA 5DM73 2R3ZA 1WQ7A 2L55A 3MXUA 2DQ0A 3NQTA 4C56C 4XTUA 4A75A 1VQGA 4K5WA 2GVBA 1GUTA 5K5PA 1AZPA 1YGBA 2TMPA 5FJ8G 2PZUA 5FO9B 4HEDA 1KNAA 2F0OA 3Q24A 4H2XA 4CJ1B 5CV5A 1GUGA 1EU4A 5IGEA 2K5WA 3T16A 1A2TA 1SRUA 3G71A 4HMIA 5IYDG 2DKGA 2QDLA 2R92G 1EOTA 3H09A 4Q5VA 2ICIA 2K14A 5C3XA 2F0WA 3OPOA 5BN3A 2R7DA 1WTQA 3GTLB 2FXQA 2ID0A 2L9HA 3GTKB 4KR2A 3ERRA 2Y0SG 4A3MB 3PO2H 1SNDA 1STHA 4IFDG 2MP1A 2VQEL 1RIQA 5J3BA 3LNNA 3HKZG 4JW0A 3RACA 3KYHC 4X66L 3H3VC 1ESFA 5EPJA 4XEOA 3KUPA 5F2DA 4YYEA 4RQFA 3UH0A 2WKDA 4XDXA 4TTVA 4LVIA 2KECA 1SN8A 4L5TA 4C3HH 1QJOA 1Y1WH 1ADYA 1WQWA 1X6OA 5J39A 3PF5A 4GLVB 2I5HA 1WI5A 4ULLA 3M3YB 1YHAA 3NUCA 4FP5D 3HRKA 2Z6KA 5AFWA 2F0KA 2QCPX 2BOSA 4LK1C 3Q6SA 5M3FB 1TIID 3W1GA 1SJED 2OQKA 5G3LF 4LNSA 1K83B 1PRTB 1PYBA 4YWLA 1M8AA 4YP0A 4B3ML 5TSSA 5E7NA 3LWEA 1NJ6A 1X54A 1B76A 1IYUA 4A3IH 3UDXA 2K75A 4PV1C 1BR9A 4Y52H 5LMNL 4JV5L 1U0LA 2UUAL 1K3BC 2DNCA 1SFOH 1Z7TA 5C3EH 4C3JG 2ZR3A 4PNYA 5E4WC 4AYBE 5CBEE 1B70A 2YU9H 4MZ9A 3WOFA 4GOPC 4NPSA 2B2UC 3C1EA 2PI2E 2RDHA 2JA6H 3HOZH 1C9OA 2EXZA 4KMUC 2QEJC 4QJFA 1B8AA 3LSSA 2L4NA 1YNND 2JJQA 1PTOB 1ET9A 1HXDA 1I3QB 4C2MB 2H4OA 1BUVT 1SMYD 5EPLA 3TZDA 3BJUA 4HSPA 1LTBD 3RUZA 4ZK9B 1K0RA 2HHHL 4K87A 3V7SA 1S4ZA 1PH1A 1V43A 3K81C 3S1NH 3W3SA 2FFKB 1I50B 3K0YA 1Q1EA 4HIOA 2VUMG 4DR2Q 4N9PA 1VQ7A 3TS2A 4B3SL 2IX1A 4DR7Q 2RHQA 2KBNA 2I5MX 4XTCS 1L0WA 3RD4A 5C0XG 3F1ZA 4YCWA 3IFTA 1YNNC 3SVMA 3GV6A 4X3TA 5IY0A 3PO2G 4BY7H 1HFGA 2Y0SB 2C5CA 4QIWB 1KABA 1I94Q 3HKZB 1AEXA 1TWAB 2EXDA 1XYIA 4CH4A 4O1NA 4XXEA 4Z9CB 4C3HG 3NHHA 2E64A 3GO5A 4A3LH 3OHXC 4JG2A 3EIVA 3EN2A 3V8KA 3NWTA 2B3GA 1PZID 3C2PA 4DV2Q 4QUCA 4H13C 1V1OA 4OHJA 1CUKA 2UXDL 4DPGA 3GTMH 1G51A 3RLNA 4PMCA 3AEVA 3SR1A 2HD3A 3K5OA 3VYSA 3G48A 1EZ8A 3NEMA 3OWFA 2AHOB 3FP9A 4DXFA 3EFXD 3RUXA 2ZJQA 5M5WB 1CI3M 1IKLA 2UXBQ 5DEHA 2OWOA 3SXHA 2HIXA 2WIIB 2Z8LA 3PIOA 2Q8RE 1ZKOA 2BE5C 2HQLA 4C3JB 4KKTA 1Q1BA 1JORA 3HFZA 1E2WA 3P75A 4A3BG 1TWHH 2RBMA 1Q46A 4HAEA 2NVYB 3U4VA 3TEHB 2JA6G 2PI2A 3CRKC 1F9QA 4YCUA 4CBVA 3VYRA 1JOKA 3HOZG 4KD4A 1BVSA 2WB1G 2Z6BA 3MVVA 1VQFA 4JBMA 4P3OA 3NBIA 3J81j 4WJ4A 4YRNA 3D4RA 1VQCA 4JYAL 1HH2P 4GN5A 3ERSX 5ISRA 1USYA 3HY1A 2VNUD 1CKNA 5K1XA 3NK9A 4G7OC 1RIPA 3FRPB 2D9UA 4X3KA 3L1AA 4HIKA 1XNRL 1E0BA 2KA7A 1HNXQ 4DV0Q 2NVQB 5I2YA 2VUMB 5EKIA 4BW9A 5H1SE 3I4LA 2IY5A 3ONAB 1BXTA 5IGDA 3AB9A 1CTMA 2F0SA 2EJFA 4YRPA 2K5HA 2OTJA 3K7UC 3A8KE 1J6QA 1TT2A 1N33L 4CKCA 1V8QA 2FJ2A 4ZUJA 3KLWA 1CT1D 4J6HA 2JK8A 3PO2B 2K5QA 4P71A 2F3WA 1LT4D 3ULPA 1XMQL 4X64L 3L0OA 2CVRA 1W6JA 1SAPA 1F9SA 5GADC 3P1HA 1GHJA 2UUBQ 3BZDB 4IFDJ 3NQIA 4TQUS 4DKAC 5CR3A 3EJIA 1VQHA 4C3HB 4A3LG 3T1YL 3K0XA 4EGVA 5D3IB 4JI2Q 1EWHA 1WTXA 2XWBB 2JA8H 4YPFA 2EJ9A 2VZAA 1JCKB 2O5IC 5IIFA 3I73A 3T56B 4RWSC 3A7AB 3VYUA 3J7AF 2QHSA 2ZGWA 3S14B 4XEMA 1KOGA 3HZXA 4G84A 5IP9H 2E2HH 3TP7A 2F0FA 4HWRA 5FO7B 2AKWA 5IWAL 1EOVA 3RZDH 1STBA 1EY7A 3H6MA 3K5NA 2YU9B 5D65A 2NB0A 2V4DA 4O2DA 4A3BB 1ML0D 4R4TA 2UUCQ 2F0TA 4YDQA 3I3CA 2JA6B 4BS9A 2L1BA 3HOZB 3SGIA 3M4PA 4A3FH 1L0XB 1PRTF 4RFBA 2C35B 1H9JA 2WB1B 5LL6S 5FLMH 4N8X1 5I4DA 2JYOA 5JVH3 1EQRA 1LACA 3K7AH 4IN3A 2IHFA 1SYGA 1HTPA 1IBML 2K6AA 3REUA 5I9OA 3FMCA 4OX9Q 1AFPA 5BR8L 2RF4A 1XPRA 3CKIB 4TQDA 1DOMA 3A5ZA 2EY6A 3IALA 3EFSA 1QE6A 2A73B 1IYJB 3D6CA 2F1MA 1G5HA 1PTOF 1LTRD 1HNZL 4GOPB 4DF7A 3MEYA 3E3XA 3GV3A 2KENA 1VQ4A 5BN4A 2CH4W 4JI4Q 1LUZA 4RHRA 5KNCA 1FVIA 2QHVA 3M4QA 2XGTA 3NTHA 3F2BA 2ZT7A 3PUZA 1F2LA 4RH6A 4IUQA 4P73A 3HOYH 3VDYA 1CFMA 5HGTA 1WTPA 3HXVA 4JI8L 4YY3L 5M5YH 4K6DA 1DCZA 3I2ZA 4YRMA 5FO8B 4LVJA 1EZ6A 5C4JH 5CYUA 3UGQA 5GAHC 4KV6A 4MTNA 2JA8G 4HJ7A 3CPWA 1FYCA 3GTMB 2ARSA 3HXXA 1CSPA 3WWVA 3CD6A 4ZRZA 3OD1A 1BBUA 1HTTA 4QY7A 1X56A 2F0JA 3KDFA 3AQQA 3LWUA 5EAYA 4P74A 5C53B 2JSOA 3QNEA 1CSQA 1UE7A 4X65L 5JJLA 2ZCEA 1UNSA 4HWPA 4G7ZC 2CCZA 2CJBA 4WRDA 1CQVA 4DR6L 2CWPA 4DN4M 2CH4A 3HOUH 2PQAB 1HZBA 3C3LA 2EYFA 3RN2A 1WVLA 1PFMA 4BA2I 3DUZA 1WD0A 3CMEA 1H4VB 2DUDA 4A3FG 1E24A 4LF8L 5FLMG 5IGCA 1NBWA 4RA8A 1ENAA 4PZ8A 2P0LA 2HIVA 1JE5A 1EY0A 3BDCA 1ESRA 1HXYD 2RQXA 1I6HH 2P5IA 2EOTA 3I70A 2DY8A 1R9TH 3GTLH 1HQRD 3MXPA 3OW7A 4QMGA 1IHZA 4DFAA 1FR3A 2EQSA 5C4XH 3U58A 2K7VA 1JR0D 2A6ED 3HRZC 1GUSA 3UE1A 2DXTA 1NAPA 5AJ3L 4A3EH 2E2JB 3MC0B 1LYLA 4V190 2E2IH 3VQXA 1MKHA 4IPDA 3UE0A 1IBKL 1EU3A 4RQEA 2MJ8A 3A5YA 1GUOA 2AQ1B 5T1GA 4CDEC 2GVAA 4EVOA 2MFIA 1H9SB 4JI1L 5IYCH 1V1PA 1ONLA 3NBHB 2VQEQ 4IOCA 4N9TA 1JC7A 4RHSA 3A31A 4YROA 3P8VA 1H9MA 2QEXA 2B2VA 5CV6A 2GA4B 4X66Q 1OXUA 3J80E 1HR0W 1OXTA 1D7QA 3GTQB 4AH6A 1Y1VH 3TP5A 3RLOA 1K83H 1OXXK 3VBBA 1Z7NA 2A6EC 3ER0A 2WACA 1PYSB 2E5AA 3EFRA 3BVMA 2F0GA 5KRUA 2DTHA 2ZXFA 3P7JA 3QOLA 5GQOA 4LF9L 1LTID 1EQQA 3A74A 3JAMc 1TY2A 1U4PA 2PMFA 2N3SA 1SRYA 3IFDA 3TEGA 4BWGB 2I5LX 1H9RA 4K0KL 2B2YC 2JA8B 1JWSD 4NMZA 1L2FA 3DEPA 3RKWA 2B29A 1HZCA 2RA4A 3TMEA 1W66A 4DNIA 4B3MQ 2E65A 1ADJA 1A3VA 2VY3A 2E2HB 3I72A 2A68D 3J80L 3QOJA 4JV5Q 2UUAQ 4LVMA 4C2MH 3RZDB 3HOUG 3F2CA 5FJ8H 4GKKL 4HVCA 4GNXC 3LC0A 3AYHB 4QIWE 4EQPA 3CCVA 1W3SA 2B2TA 1I6VC 3HKZE 4A3FB 4C3IH 1XMOL 3F8TA 1EVKA 2RSNA 3K7AB 5IYDH 1YFSA 3KJOA 3QB3A 3W5OA 1G6ZA 2PW7A 3S16H 3A32A 1HA5A 3W2DA 1VQ8A 3PZCA 5C4XG 2OQ0A 2NZOA 1GUNA 1KIXA 3I4MH 2DZ9A 2Z1CA 2NVTH 4I65A 4XQQA 3S2DH 1MIUA 1V9PA 4B9WA 4DK0A 1X32A 2EL9A 2BCOA 4B3SQ 3PCOB 4A3EG 2EJGC 4OO1H 2DTIA 2F0DA 1GUWA 2R7FA 3Q8DA 1DYQA 4KHPL 4IUPA 1G291 2F4IA 1F9RA 3V96A 5LMUL 2DTOA 1MSHA 4F8MA 4LFBL 5IYCG 5C4HA 4FXKC 4ME3A 3PF4A 2F0UA 4ZTZB 2ZTGA 1Y1VG 2IJ0A 4X3SA 3E0EA 4I7ZC 2J3MA 2MO1A 1FNUA 1S5BD 2M9VA 4V0BA 3B6YA 2AUJD 1F2MA 3OIPA 1JB7A 3O13A 5EGTA 2Z6KC 2G9DA 5FOBB 3H0GH 4HT4A 5M5WH 2DN8A 3U9OA 3KLSA 5C51B 1ICFB 1FNWA 4KY7A 1PH4A 4H2UA 5FKAC 2UXDQ 2A6HC 3KLSX 1SMXA 4DR1L 3UGTA 3MEHA 1SYBA 3HFVA 5IT9c 2BDNA 1KQSA 2KCNA 2SEBD 3ND9A 3NE5B 1NSNS 3F2DA 3EA6A 3AU7A 4QCLA 1NJ8A 3HOWH 4OLFA 3CAMA 3M7NA 3CHBD 2AMCB 4FDBA 1D2BA 1N32L 3VR3A 1N34L 2IHEA 2DXUA 2EYMA 4C1NI 3KJPA 3S2HH 3HOUB 3K59A 4FF4A 2MGSA 2CW0D 1IL2A 4GKJL 1CQFA 3QTCA 3J81c 1A0IA 4YRKA 2D2CC 1Y8PB 1NR2A 2PNRC 1CKMA 4RMFA 4C3IG 1NNHA 4JI0Q 3RZOB 3K57A 2ICEC 2NVQH 2VUMH 2WP8J 3VQWA 2JA7G 4ZTUB 1KRSA 4A4IA 5KIXA 4JYAQ 4CDCC 3DWPA 1I6HB 2JA5G 1NYRA 3A7UA 5C6AA 4KHZA 2ZXPA 1R9TB 4GN4B 1YITA 5C0XH 1Q82C 1QNKA 4PZ6A 3I4MG 1Z9FA 2E76C 5C4XB 2JE6I 1MJEA 1WPYA 2EIFA 2BA0A 1LV9A 2KQ3A 1TY0A 3FKIG 2C9OA 2NYZD 4OO1G 4WJWA 4A3EB 5ELNA 1U5KA 1STAA 1Q7YC 3M85A 1LTLA 3G6EA 2O5JC 2E2IB 4MNOA 2YYZA 2FHTA 2MO0A 3PUXA 1XX8A 1OXVA 1N33Q 4BA1I 1SESA 2HT1A 4R4QA 4OXPA 3BVZA 4NP5A 4XTWA 4X64Q 1PYWD 3P20A 3TEHA 4O42A 4NXNL 2FMMA 4XQNA 1E7ZA 4JOIA 1GO3E 1L0YB 5CV9A 3MWYW 4DR4L 1Y1VB 4A3KB 2K5VA 5CGKA 2WB1E 1BOSA 3N6RA 4U68A 4POFA 1OTCA 1S5CD 4OONA 3S14H 1D5ZC 3T1YQ 2O4XA 3H0GG 5C5MA 2ZZEA 1AZQA 3URYA 3OMGA 3CCLA 4UDUC 1Q81C 1VDZA 1D1IA 3H3VH 4K8IA 2BDOA 3H15A 2L12A 2BH8A 1B3QA 2Q8IB 3TZUA 2RDGA 5IODA 3QO5A 3RL6A 4XTXA 3REXA 5I6WA 4A3BH 5LMNW 2K04A 4APVA 3HOWG 2ALYB 4B3TL 4R8IA 3PSIA 1UEAB 3ZYYX 4QB4A 4H2SA 1LT5D 5IWAQ 1B9NA 3I90A 1UE5A 1K73C 2F0VA 2NS6A 4KLKA 3CCUA 1KLGD 1IZ6A 3DWQA 3GTGH 5GROA 3FVQA 1EIYB 3M4YA 1TWGH 1G91A 4YRFA 4OEMB 3HXUA 4L6TB 3SK8A 2EWNA 1IBLL 4LVKA 2E5LQ 2QKIC 4LUVA 3P8YA 1S72A 4C3IB 3CF5A 3HKSA 2Q2UA 4GZYC 2EY2A 2QILA 3FEWX 5F5WA 3V7CA 1USYC 2EE1A 2JA7B 4J8QA 1PZJD 3S1MB 1IBMQ 2ZIMA 2HDMA 3I4OA 3I7FA 1XPUA 1VQ5A 3S16B 2JA5B 2PNHA 4XU3A 3LX0A 4NCXA 5BR8Q 2OF1A 1LTAD 1SNQA 4H0LC 2NN6G 1XWEA 3I4MB 1YHBA 3BDOA 1NY4A 3S2DB 4RG1A 2NVTB 4X62L 1SMYC 1LTTD 1X9NA 11ASA 2EJFC 1CHQD 3MHBA 3FKIB 4A3GH 1T9HA 5EJWA 3A7AA 1B44D 4DUZL 3V8LA 4YHHL 1HJPA 1K8OA 3JC66 2IT1A 4NXML 1BCPD 1DONA 5T1IA 4KN7C 2I4MA 4YRIA 3PQIA 3A8IE 3TP8A 1DGSA 2F0IA 3HEJA 1KRTA 4YWMA 1GD7A 2AUKA 3R93A 2ZT5A 1F9PA 1HC7A 1AH9A 1YZ6A 2XNAC 5C5LA 2VQFQ 1T5XD 3J7YW 4IPCA 3RMHA 3CC7A 3PO3H 1GVPA 4GS3A 4JI8Q 4YY3Q 4P75C 3NSWA 4BXXH 1IW7D 1KMNA 2ARTA 3BG3A 4TVAB 4DV5L 3PIP3 3QO7A 2XRSD 3E9IA 1CZGA 5E4XA 3H0GB 4L87A 2PMEA 4ZCKA 3K58A 4CJ0B 2MHVA 1BCPC 4DNRB 1H4TA 4OWWB 1PH3A 4G57A 3SK6A 4JBWA 1D6EC 1SSOA 3HOWB 4GOPA 4H44C 1RF2D 4HJ8A 2JP1A 2VXWA 1EEFD 4RCNA 3VR6A 4DR6Q 4WJ3M 4RGMA 3S2HB 4DNTB 1O7YA 2XN9C 4CDDC 3L2PA 1W2BA 3ICEA 3I56A 4OIJA 2F03A 2Q2HA 3BU2A 4DV1L 1EQVA 5JOBA 2D0OA 3S15B 4DA2A 3Q22A 2K33A 2ZTCA 2K01A 4FYDA 3RKXA 2SDFA 2VS1A 5E3IA 1NE3A 1D1KA 3ZJYC 1K9MC 3K80C 3L4GB 1TVXA 1Q8KA 1NCVA 2QHUA 2DJZA 3M4OH 1PA6A 3U4ZA 4DV4L 2SNMA 2ZTDA 4HN7A 4R1JA 2TSSA 2E2JH 2ARUA 3IRBA 2D0PA 4ZQ3A 1WTHA 4A93G 2RCNA 2NVXH 2IX3A 1EY4A 1OXSC 1WTWA 1NMGA 4N8FA 2J3LA 5IYBH 2A8EA 2A8VA 2PMZE 3VQVA 3CCJA 2DY7A 1H95A 2CQAA 1TKWB 2PQEA 5FLXc 3DLLA 4RGNA 1RKNA 1E1OA 5AJ3Q 4A3GG 4KJOA 4R4IA 2CQOA 3GTQH 2F0EA 1SXTA 5EKKA 4R4CA 4TSSA 1IBKQ 1HR0Q 5KEEA 1SNPA 4LUOA 4XQJA 5I2XA 2CFMA 1VQBA 4XTVA 3CMQA 2PQAA 4RAUC 4WI1A 4JI1Q 2EAYA 4P73C 4CS4A 1F2ZA 4IJLA 1TS5A 2B2WC 5GAEC 2Q2IA 1NMFA 3GTPB 3IL8A 4EQ5A 1B9MA 4H2YA 3PO3G 2R93H 1IYVA 5K1PA 5M3MG 4XU0A 4EX5A 3CU7A 4BXXG 3BYTB 1PHJA 4ZAIA 2F0NA 1XJVA 2X69A 1FL0A 4FF3A 1STYA 4K2LA 3PV0A 1YJWA 5A35A 2VW9A 1WTRA 1M1KC 1DJRD 2QGQA 1B1ZA 4OWXB 2L15A 2K03A 4K0KQ 4HJ9A 4TQFA 4B9XA 1XTCD 3DWAA 1WCMG 4UY8C 1SNOA 3QG1A 4A3CG 4P74C 1ZYRD 1UE6A 1KLUD 2HCCA 3KLRA 2ZT9C 4OIKA 4L63B 1FJGQ 2B8GA 4KKSA 3HTZA 3CCSA 3K8AA 4KN4C 1GOZA 3KK7A 3GTGB 3UFGA 2J4XA 4GKKQ 1TWGB 1H9SA 2QDBA 1NR4A 3NBHA 4A76A 1KC8C 2Q2TA 2K5NA 2DGYA 1YI2A 3CRLC 1E2ZA 4MN3A 1G8ZD 2RDFA 1QVCA 1XMOQ 2EY1A 1C8CA 3HXYA 2H1EA 1PYSA 2EYPA 2F3VA 1LABA 1RHPA 4LAAA 1L1OC 3S24A 1YNXA 1HNWL 4A93B 1QOHA 5J1ZA 1EQTA 5IYBG 1VF7A 3PUYA 2KJXA 3BS1A 1NJ1A 1VMCA 4LUZA 1J5EQ 4KY6A 3I91A 4GN3B 3J7ZC 5EQ0A 3GDEA 3HFZB 2M2LA 1AN8A 5C0XJ 3PGZA 3VR2A 1MBYA 4HJAA 4A3GB 2EVBA 2PW5A 4OGQC 4KHPQ 4YREA 1KDAA 2NZ1D 1ATIA 5LMUQ 1VMPA 4LFBQ 2DU7A 2B2VC 1U9RA 1PH8A 3PMFA 1D5MC 3MF1A 1Q3LA 4AIMA 2ZIOA 3CMAA 4ODGA 2R93G 4KR3A 2E10A 2F0PA 4ZUIA 3ND8A 3PO3B 1EYAA 1MHWC 3ULJA 3BDLA 1ZXTA 5M3MB 1A3TA 2NWGA 3U9SA 3NELA 1OO9B 1RDPD 1GM5A 1F2YA 1BBXC 3JAME 4R8NA 1A62A 2D5DA 4M8AA 1BIBA 1LT3D 2WAQG 4JI5L 1CK1A 2LXKA 3L9AX 2WV6D 4DR1Q 1H4SA 3C46A 1WCMB 4IFDI 2A69D 2K52A 4LF6L 1KDCA 3TREA 4F7XA 1V1QA 1HUMA 4BWAA 4OO1I 1RL2A 1PH9A 3PCOA 1VQMA 4RDXA 2K1BA 1K8GA 3J80i 4HIDA 2F52A 1TQOA 1O78A 4PMWA 3RZOH 1N32Q 3HRIA 1N36L 3RKYA 3A7LA 1PRTD 1SE4A 1AE2A 4HA8A 3KF6B 5ELEA 3TUPA 4GKJQ 5EBCA 4XU2A 2RHSB 4X6AH 1F77A 1PFNA 3JAML 4S3SA 2Q7GA 1LT6D 3KFUA 1DOLA 1EY6A 2A69C 1QG7A 3M4OB 5LHY1 4AQYL 1LM0A 1QVFA 3HOVH 2DJFC 1FNVA 1PV4A 1X01A 1QE0A 2EYHA 3K6OA 4LF4L 2UXCL 5ELCA 1PTOD 2I46A 4LWCA 4LJZC 2NVXB 1EY5A 4RKLA 2VB3X 2ZJRA 4KTAA 4JPBW 1S5DD 3I4NG 2WINB 2RCFA 3D4WA 4HMJA 1A6XA 3DXJC 5COYA 2UU9L 3WDNA 5LL6X 2AWNA 5JEAH 1A3UA 1EWCA 3TP6A 3HY0A 2MPMA 1YEZA 3WQZA 4A3KH 2AMCA 4X3UA 1HQMC 1PDQA 3IKMB 3W1BA 4BY1H 2CKZB 2A5HA 3GTJB 2Q5HA 3S1RB 2CHBD 2L11A 2KCCA 1J9OA 3X3NA 3SHLA 2EY5A 1TS2A 2KHJA 3CPFA 4DR5L 4NXNQ 2R93B 4DR4Q 1SYDA 4P72A 4XT3B 3EBEA 4YRRA 5HGQA 1R4PB 4Q0FA 2LXJA 3MFYA 5C0XI 5LMNQ 2Z0SA 1H9KA 1A63A 2ZXOA 3HG9A 2I4NA 2WAQB 2ZT6A 1C4QA 5D3DA 4A3DG 1C0AA 2Y0SE 1XNQL 1KL9A 2Z4IA 3L2ZA 4G85A 2CWAA 5IT9E 1GJXA 1X3FA 3VR4A 1CKOA 1QCBD 1EYGA 4IOAA 4KK7A 4JK1C 1LTSD 1U4MA 5CMDA 1E1TA 4CGYB 2JA7H 2BH2A 3S1MH 1BDOA 3FHWA 1K8AC 2JA5H 4H2TA 2HHHQ 3DSQA 1KMMA 4DUYL 1SNMA 2A68C 2OT2A 3R3OA 1Y14B 4L5QA 3J81E 2ATWA 1GKHA 1WTOA 3DHQA 1N8RC 1GHKA 4YRQA 3H91A 1B7YB 1CM9A 2YTXA 5K36H 4LFCL 2LSSA 4NDXA 4TRDA 1VQKA 3HOVG 3FKIH 1A2UA 3D8GA 1ENFA 2NTSA 4RGTA 3ERQA 4OL7A 2IX0A 5IT9L 4DXGA 1RODA 1U4RA 1HCZA 2F0MA 2I07B 2I0QA 3IKLA 2FYKA 3LSQA 3TN2A 4R4OA 3H3VI 4DR3L 3PUWA 3V8JA 3V2TA 5FK9C 4B3RL 1NJIC 1LTGD 2GN5A 3QR8A 4CH6A 2E2DC 3AMUA 1EY9A 4X62Q 3I4NB 3VA7A 1G2SA 4XU1A 1JJCB 4FVMA 5C3WA 5JEAG 4DUZQ 3TQYA 2ALYA 4CH5A 5C44G 1BBWA 4YHHQ 3J81L 4A3KG 3S9WA 3MAQA 1WTVA 2DQ3A 2K28A 4BY1G 1JOOA 4NXMQ 3C1FA 1EYDA 1EIGA 2C8MA 3QO8A 1HZAA 3TS0A 1EIYA 1JWMD 1SEBD 1J5WA 4A3JH 1HPCA 4POGA 4JOIC 2AQ3B 3Q23A 2N88A 3L7ZC 5CV7A 4CJ2C 4IUUA 1SJHD 4XYQA 1L1OB 1FGBD 2R61A 3V05A 1S3OA 2Q5IA 3GP7A 2Q8TA 2B2YA 2ZM6L 4DV5Q 1BO0A 1R4QB 3AFPA 3R2TA 3EROA 1KDBA 4HWOA 1EL0A 1DOKA 4FNFA 4JC0A 1O7LA 4X5OA 2LKVA 3OWEB 2Z9HA 4DV7L 4TWAA 1DZ1A 3I8ZA 4A3DB 2CJ9A 1PZKD 3FJPA 3MXNB 2DEQA 3S15H 2NBFA 5DNFA 5I9PA 5JJZA 4XYOA 5J22A 3STBD 1JJ2A 5DAUA 4EQOA 3J7A5 4UPAA 3QWNA 2RSOA 3VA5A 1PLFA 2WKCA 4KD3A 2R7ZH 4DV1Q 1VQZA 1MJCA 1X55A 1M90C 1E3PA 3CXCA 1PXUA 2EDGA 5K36G 2NN6H 3D0FA 4JI3L 1XNRQ 2ENBA 4QF4A 1SR3A 1W6KA 3OTOL 1IL8A 2CW0C 1XPOA 4DV4Q 3HOVB 2QA4A 4TVAA 2L0CA 4YRGA 2KUMA 1SYFA 2DNEA 1GGMA 1UEBA 5M9OA 3J7AV 3OYYA 1A8VA 4IJHA 3STBC 2EJGA 1EIHA 1JQYD 4DV3L 3NPPA 3SDZA 4IQZA 3QJYA 4DV6L 1NYQA 1NUCA 2ZNIA 4JI6L 3KF8B 1XMQQ 2QF7A 3PIO3 5CC4A 3GTPH 4E51A 3RR5A 1JB3A 4YRLA 1PH2A 2J7ZA 1LO5D 5C44B 4HTHA 3G4SA 4DK6C 1BCPF 2X6LA 3TBIB 1KTKA 3QIAA 4BY1B 1IXRA 2EZVA 1KAWA 3OW2A 3BVGA 1MI2A 4A3JG 3RGLA 1DM0B 2PPBC 3E5SA 4XTZA 4YRJA 2EPBA 1T5EA 2OXPA 3MTSA 1SYEA 2XSCA 5KNDA 4LFAL 1QB5D 1CHPD 1TU2B 4ID6A 3L4GA 4Y7NH 4IUVA 2G4CA 2ZZFA 1UE1A 1X2GA 4ABNA 3GQBA 3HP3A 1TWFH 1VQDA 4DQ2A 4DAPA 1WYDA 5JJKA 1WU7A 1I5FA 4FXGC 4IUNA 4ILWA 1B4OA 5E1FA 4DGZA 4LF5L 1CA5A 3A7RA 3SE0A 3I55A 5JPMC 1DXMA 1SE2A 4DAYB 3HOXG 4QQBX 1I4RA 3MQZA 4UHVA 1ZEQX 2ZXRA 2ZR2A 1WLEA 5IP7H 2F4VL 3G1ZA 1O7IA 2QHTA 1KHIA 2EYOA 4LW1A 4E6IA 2R7ZG 3TRZA 4FXDA 4K5XA 1SETA 4L8JA 2LFNA 2PO4A 4K2KA 4A93H 3DM3A 1PH6A 3BFMA 3W3AA 1JE4A 1QUQB 2IL8A 3ULLA 5KGUA 3T1HL 2VB2X 4LMQD 3A56A 3SEBA 4YCVA 4JI7L 1AW7A 3NXWA 2K4KA 4IPGA 2V1CC 4J15A 4HIMA 1HFNA 1YJ9A 4GNXB 4HJ5A 2A19A 1ET6A 1HNZQ 1I4HA 5EKLA 1HA6A 4IURA 1ILPA 2R92B 5ELBA 4LF7L 4YRCA 4K6LA 3T51B 1HNWQ 3NTIA 4P71C 4MHEA 1PFBA 2G9HD 1MSGA 2XRQD 1QZHA 1KXLA 2Q7EA 5IOCA 5KNNA 3HGBA 2E8GA 2MNAA 5FLXE 5M5XH 1TR5A 2PZTA 3R07A 1E22A 2K5DA 5EPKA 5CV4A 4H2XB 1WFQA 5M3MH 1Q12A 1WNLA 2DZCA 1I4PA 3E6ZX 1BF4A 4JVZA 5G3LD 1I4GA 2BE5D 5JEAJ 1QILA 3G6JB 3BZCA 1Y1WG 4A3JB 2IPKD 2HUGA 4WFN3 2I4LA 1UUPA 3DMUA 1SLJA 4EQNA 1JICA 1U4LA 3CQZH 2FMCA 1TWCH 4IALA 2F0HA 4HWTA 4FO2A 5HURA 1WCMH 1BNZA 3GTOH 2MUYA 2PCFB 1SBBB 4A3CH 1C7YA 1B50A 2JXMB 5FLXL 4X65Q 1EEID 3A8JE 4HCSA 4PQXA 4A3IG 2HNIA 3Q0AA 2B2UA 2ZJPA 2RVLA 4JI5Q 3D6WA 1IW7C 5C3EG 3VR5A 2DDZA 4LF6Q 3RN5A 2JN4A 1ASYA 3NETA 3HOXB 2PZWA 4LF8Q 4JBJA 4MTKA 1N36Q 4ME5A 4I7AA 4YIJA 4JI0L 5IP7G 3K5LA 2MQHA 1YJNA 1JJGA 5IE8A 3DM1A 2A1AA 4KQEA 3G7LA 1M4VA 1FYFA 1HTLD 2R7ZB 1NNXA 1X65A 2ES2A 1SERA 2E1HA 1VQJA 4BBSH 1NJ5A 2ZINA 1X3QA 1I4QA 4AYBG 4WF2A 1B70B 3NTKA 4CS2A 2E74C 12ASA 1VQNA 1EFID 3HXZA 4PMBA 3TDQA 3UDIA 4AQYQ 4YWKA 4EO4A 1G6PA 2D62A 2O2LD 3QO2A 4LF4Q 2A74C 2UXCQ 2K50A 4KKUA 3CC4A 3L3OC 3M9BA 3DEOA 3GTJH 2LMCB 5C52B 3KOJA 2WAQE 1JWUD 1ENCA 4BY7G 3S1RH 1Q86C 2OTLA 3IAYA 5HY6A 5E3FA 1Y8NB 3D31A 2SNSA 2CIMA 1MGSA 2UU9Q 2VL6A 2X6GA 4KY5A 1HUNA 1BIAA 2E41A 2K05A 1JT8A 1AE3A 2B39A 4RCOA 4DU9A 1SROA 2QW7A 3GD7A 4QL5A 4LF9Q 1ICWA 3KBGA 1II3A 4P75A 3KF6A 2RHQB 3T13A 1Y1WB 2R6GA 3OMCA 1VQ9A 1YFTA 2RHSA 4DR5Q 4DAMA 4Q6GA 2K32A 4XIGS 5A2QE 4H02A 4GLXA 2L5TA 4CDFC 4Y7NB 2NZHA 4PG3A 1STGA 3E9HA 1N9WA 4GLAC 3MF2A 1AP0A 1TWFB 5JPNC 4Q15A 2NTTA 4H2WA 4A3IB 5DM63 5JAVA 3S1QH 2KCTA 4OWTB 4KHVA 1SFOB 4XTYA 5KYLA 5C3EB 1XNQQ 1X3GA 4CKBA 1HZ9A 2N55A 4KI0A 2Z4HA 1XTDA 3MFGA 1PH5A 5CORA 2E5LL 1VQOA 1DD2A 5A2QL 4P3NA 1ZYRC 2C7IA 5EBDA 3PIPA 3CP0A 4DR2L 1TS3A 4NKLA 2H5XA 2HDLA 1VQEA 4DR7L 5ELOA 4DUYQ 4CKEA 3R2IA 1SDFA 3UDGA 4BBSG 3OOCA 4K5VA 5CBAE 3JAMi 2Q7HA 5DLQE 2SOBA 4BBRH 1K0SA 3CC2A 4LNQA 3S1NB 3I4NH 3V7RA 4AYBB 4LFCQ 2F0QA 4FF1A 1NTGA 1UAPA 1JOQA 1I94L 5I6YA 3RIRA 5L37A 4ZIBA 1RCVD 1CA6A 4DR3Q 4G4KA 1VQIA 1WOCA 1KAAA 1K8MA 2BA1A 2YTVA 4B3RQ 4U673 4UP8A 2B63H 4C1NK 4R9WA 1O80A 4BY7B 5NUCA 3ICAA 5M5XB 1VS0A 2DJGC 1ILQA 1KNEA 3FDTA 4DK3C 1CKNB 2JA9A 4DV2L 4M1UB 4ZYSA 2B2WA 1YBYA 2VQFL 2ODRD 2JEAI 3K5MA 1X2HA 4HWSA 2N49A 4RGOS 1MD2D 1BKBA 1VQAA 2IY5B 2F0LA 2JQOA 2WFWA 2PYKA 1PH7A 4P72C 1VF5C 1BQQT 1Z47A 3CQZB 3E0JA 3RNUA 1ASZA 1RD9D 1TWCB 1EYCA 2UXBL 1B7YA 4HSVA 4K14A 4A3DH 1NJ2A 3GTOB 2E3CA 3F2UA 1D5XC 1QF6A 1QVGA 2KEDA 2ZM6Q 1WD1A 3S17H 1P8LA 5KYIA 4H7BA 3OSOA 2CGHA 4LVLA 4HCEA 3NENA 1X3PA 4RKBA 2KVMA 3CCQA 5IP9G 1N34Q 1SE3A 1B2TA 1EWIA 3A54A 4J1MA 2ODRC 4ZKBB 4DV7Q 2EJMA 4TKOB 2B2TC 1H4QA 4G7HC 3D3RA 1FGUA 4CH3A 1EUJA 5ELFA 2EYJA 4PZ7A 1VQPA 3OIQA 2IWHA 4UP9A 3MEFA 4IZ8A 1JJCA 1TWHB 3VQYA 5CV8A 1E2VA 3EQLC 3FPPA 1K28A 2G5DA 5BN5A 5KNBA 1HNXL 4IUTA 1UWVA 1YVCA 4DV0L 3U50C 1BCPB 3RF1A
chains in the Genus database with same CATH topology
1VQLA 2KCMA 2AKWB 4BBRG 4JI3Q 3GTKH 1L1OA 2I4OA 4A3MH 3OTOQ 1EFWA 4JBKA 1YHQA 4NB3A 4ALPA 5C44H 3LGJA 2UUBL 4P3PA 5GAGC 5JJIA 2ZZGA 4DV3Q 1HR0L 1PFSA 2B63G 4DV6Q 3IG2A 4JI6Q 2ZNJA 1TXYA 3A5UA 4JI2L 3M3YH 4TVWA 1VCIA 3BZKA 1YB3A 3J81i 3HOYG 4H2VA 1EIFA 1VQ6A 5M3FH 3A5ZB 4CS3A 3PUVA 1P16A 4YRSA 1SE8A 1G5IA 2NN6I 4LFAQ 3RLFA 2AWOA 4K88A 2YTYA 4K86A 4B3TQ 2UUCL 3AFQA 1YIJA 1FJGL 1K3RA 1QZGA 1WJJA 1X3EA 1I3QH 4LF5Q 3P8TA 3UDFA 1IBLQ 4OX9L 2OCEA 4JCVE 3CCMA 1I50H 1KD1C 4O0AA 1PVOA 1EVLA 2ZT8A 2F4VQ 3KDFB 4PHCA 2R92H 2JEBI 2KHIA 2N8NA 4OP0A 4JI4L 3T1HQ 4A3MG 4JI7Q 1J5EL 2DVEA 1YFRA 2N78A 3J80c 3HXWA 1TWAH 4LF7Q 1D8LA 2XTIA 3CW2C 2CJAA 4L5SA 4IPHA 1Z7MA 4UP7A 1JMCA 4IO9A 4YRTA 2F3IA 2DU5A 5M3FG 3CCEA 4QGUA 4L5RC 2YV5A 3A0JA 1S40A 2ZTEA 3CCRA 1QUQA 4C3JH 2ASBA 3HOXH 2NVYH 4TVYA 4GNXA 1WQ7A 2DQ0A 4XTUA 4A75A 1VQGA 2GVBA 1YGBA 5FJ8G 4H2XA 1SRUA 3G71A 5IYDG 2DKGA 2R92G 2K14A 2R7DA 2FXQA 2ID0A 4KR2A 3ERRA 2Y0SG 3PO2H 4IFDG 2VQEL 1RIQA 5J3BA 3HKZG 3RACA 3KYHC 4X66L 4XEOA 4YYEA 4RQFA 3UH0A 4TTVA 4LVIA 1SN8A 4L5TA 4C3HH 1WQWA 1Y1WH 1ADYA 1X6OA 3PF5A 4GLVB 2I5HA 1WI5A 1YHAA 3HRKA 2Z6KA 3W1GA 2OQKA 4LNSA 1PYBA 4YWLA 4YP0A 4B3ML 5E7NA 1NJ6A 1X54A 1B76A 4A3IH 3UDXA 2K75A 4Y52H 5LMNL 4JV5L 1U0LA 2UUAL 1SFOH 5C3EH 2ZR3A 4AYBE 1B70A 2YU9H 4MZ9A 4GOPC 4NPSA 2PI2E 2JA6H 3HOZH 1C9OA 4QJFA 1B8AA 3LSSA 2JJQA 1HXDA 3BJUA 1K0RA 2HHHL 4K87A 3V7SA 1PH1A 1V43A 3K81C 3S1NH 3W3SA 1Q1EA 4HIOA 2VUMG 4DR2Q 1VQ7A 3TS2A 4B3SL 2IX1A 4DR7Q 2RHQA 2KBNA 2I5MX 4XTCS 1L0WA 5C0XG 3F1ZA 4YCWA 5IY0A 3PO2G 4BY7H 1I94Q 2EXDA 4CH4A 2E64A 3GO5A 4A3LH 4JG2A 3EIVA 3EN2A 3V8KA 2B3GA 4DV2Q 2UXDL 1CUKA 4DPGA 3GTMH 1G51A 3RLNA 3AEVA 3G48A 3NEMA 2AHOB 3FP9A 3RUXA 2ZJQA 2UXBQ 2OWOA 2HIXA 3PIOA 2HQLA 1Q1BA 3HFZA 4A3BG 1TWHH 1Q46A 3U4VA 3TEHB 2JA6G 2PI2A 4YCUA 3HOZG 1BVSA 2WB1G 1VQFA 4JBMA 4P3OA 3J81j 4WJ4A 4YRNA 1VQCA 4JYAL 1HH2P 4GN5A 3ERSX 1USYA 3HY1A 2VNUD 1CKNA 5K1XA 1RIPA 3L1AA 4HIKA 1XNRL 1HNXQ 4DV0Q 4BW9A 5H1SE 2IY5A 2EJFA 4YRPA 2K5HA 2OTJA 3K7UC 1J6QA 1N33L 3KLWA 2JK8A 4P71A 3ULPA 1XMQL 4X64L 3L0OA 5GADC 2UUBQ 4IFDJ 4TQUS 4DKAC 1VQHA 4A3LG 3T1YL 3K0XA 4JI2Q 4YPFA 2JA8H 2EJ9A 2VZAA 2ZGWA 2QHSA 4XEMA 1KOGA 4G84A 5IP9H 2E2HH 4HWRA 2AKWA 5IWAL 1EOVA 3RZDH 4O2DA 4R4TA 2UUCQ 4YDQA 3SGIA 3M4PA 4A3FH 2C35B 5FLMH 1EQRA 3K7AH 2IHFA 1IBML 3REUA 4OX9Q 5BR8L 2RF4A 1XPRA 4TQDA 3A5ZA 3IALA 3EFSA 1IYJB 1G5HA 1HNZL 4GOPB 3MEYA 2KENA 1VQ4A 4JI4Q 1LUZA 1FVIA 2QHVA 3M4QA 2XGTA 3F2BA 2ZT7A 3PUZA 4P73A 3HOYH 3VDYA 3HXVA 4JI8L 4YY3L 5M5YH 3I2ZA 4YRMA 4LVJA 5C4JH 3UGQA 5GAHC 4MTNA 2JA8G 4HJ7A 3CPWA 2ARSA 3HXXA 1CSPA 3WWVA 3CD6A 3OD1A 1BBUA 1HTTA 4QY7A 1X56A 3KDFA 3AQQA 5EAYA 4P74A 5C53B 3QNEA 1CSQA 1UE7A 4X65L 5JJLA 2ZCEA 4HWPA 2CCZA 2CJBA 4DR6L 2CWPA 3HOUH 2PQAB 1HZBA 3RN2A 4BA2I 3CMEA 1H4VB 2DUDA 4A3FG 1E24A 4LF8L 5FLMG 1NBWA 4PZ8A 2P0LA 2HIVA 1JE5A 1I6HH 2P5IA 1R9TH 3GTLH 2EQSA 5C4XH 3U58A 3UE1A 2DXTA 5AJ3L 4A3EH 1LYLA 2E2IH 3VQXA 1MKHA 4IPDA 3UE0A 1IBKL 4RQEA 3A5YA 2GVAA 2MFIA 4JI1L 5IYCH 2VQEQ 3NBHB 4IOCA 3A31A 4YROA 3P8VA 2QEXA 4X66Q 1HR0W 1OXUA 1OXTA 1D7QA 4AH6A 1Y1VH 3RLOA 1K83H 1OXXK 3VBBA 1Z7NA 3ER0A 1PYSB 2E5AA 3EFRA 2DTHA 2ZXFA 5GQOA 4LF9L 1EQQA 3A74A 3JAMc 2PMFA 3TEGA 2N3SA 1SRYA 2I5LX 4K0KL 1L2FA 3RKWA 2B29A 1HZCA 1W66A 4DNIA 4B3MQ 2E65A 1ADJA 2VY3A 4JV5Q 2UUAQ 4LVMA 4C2MH 3HOUG 3F2CA 5FJ8H 4GKKL 4HVCA 4GNXC 3LC0A 3AYHB 4QIWE 3CCVA 1W3SA 3HKZE 4C3IH 1XMOL 3F8TA 1EVKA 5IYDH 1YFSA 3KJOA 3W5OA 3S16H 3A32A 1VQ8A 3PZCA 5C4XG 2OQ0A 2NZOA 1KIXA 3I4MH 2DZ9A 2NVTH 3S2DH 1MIUA 1V9PA 2EL9A 4B3SQ 3PCOB 4A3EG 2DTIA 2R7FA 3Q8DA 4KHPL 1G291 5LMUL 2DTOA 4LFBL 5IYCG 4ME3A 3PF4A 4ZTZB 2ZTGA 1Y1VG 3E0EA 2J3MA 2MO1A 3B6YA 1JB7A 2Z6KC 4HT4A 3H0GH 5M5WH 5C51B 1PH4A 4H2UA 2UXDQ 1SMXA 4DR1L 3UGTA 3HFVA 5IT9c 1KQSA 3F2DA 4OLFA 1NJ8A 3HOWH 3CAMA 3M7NA 2AMCB 4FDBA 1N32L 2DXUA 1N34L 2IHEA 3KJPA 3S2HH 1IL2A 4GKJL 3QTCA 3J81c 1A0IA 4YRKA 1CKMA 4RMFA 1NNHA 4JI0Q 2NVQH 2VUMH 2WP8J 3VQWA 2JA7G 4ZTUB 1KRSA 4A4IA 4JYAQ 2JA5G 1NYRA 3A7UA 4KHZA 4GN4B 1YITA 1Q82C 4PZ6A 3I4MG 1Z9FA 2JE6I 1MJEA 1WPYA 2EIFA 2BA0A 3FKIG 4OO1G 5ELNA 1U5KA 1Q7YC 3M85A 1LTLA 3G6EA 4MNOA 2YYZA 2MO0A 3PUXA 1OXVA 1N33Q 4BA1I 1SESA 2HT1A 4R4QA 4OXPA 4XTWA 4X64Q 3TEHA 4NXNL 1E7ZA 4JOIA 1GO3E 4DR4L 2K5VA 2WB1E 4POFA 1OTCA 4OONA 3S14H 3T1YQ 3H0GG 2ZZEA 3CCLA 1Q81C 3H3VH 3H15A 2BH8A 3RL6A 3QO5A 4XTXA 3REXA 4A3BH 5LMNW 4APVA 3HOWG 2ALYB 4B3TL 3PSIA 4H2SA 5IWAQ 2NS6A 1UE5A 1K73C 4KLKA 3CCUA 3GTGH 1IZ6A 5GROA 1EIYB 1TWGH 4YRFA 3HXUA 2EWNA 1IBLL 4LVKA 2E5LQ 4LUVA 3P8YA 1S72A 3CF5A 3HKSA 2Q2UA 5F5WA 3V7CA 1USYC 2ZIMA 1IBMQ 3I4OA 3I7FA 1XPUA 1VQ5A 2PNHA 4XU3A 4NCXA 5BR8Q 2NN6G 1YHBA 1NY4A 4RG1A 4X62L 1X9NA 11ASA 3A7AA 4A3GH 1T9HA 4DUZL 3V8LA 4YHHL 1HJPA 3JC66 2IT1A 4NXML 2I4MA 4YRIA 1DGSA 1KRTA 4YWMA 1GD7A 2ZT5A 1HC7A 1AH9A 1YZ6A 2VQFQ 3CC7A 4IPCA 3PO3H 1GVPA 4GS3A 4JI8Q 4YY3Q 4P75C 4BXXH 1KMNA 2ARTA 4TVAB 4DV5L 3QO7A 3E9IA 4L87A 2PMEA 1H4TA 4OWWB 1PH3A 4JBWA 4GOPA 4HJ8A 4DR6Q 4WJ3M 3L2PA 1W2BA 3ICEA 3I56A 2Q2HA 3BU2A 4DV1L 2D0OA 2ZTCA 3RKXA 5E3IA 2VS1A 1NE3A 3ZJYC 1K9MC 3K80C 3L4GB 1Q8KA 2QHUA 2DJZA 3M4OH 1PA6A 3U4ZA 4DV4L 2ZTDA 4R1JA 2E2JH 2ARUA 3IRBA 2D0PA 4A93G 2RCNA 2NVXH 1OXSC 1NMGA 2J3LA 5IYBH 2A8EA 2A8VA 2PMZE 3VQVA 3CCJA 1H95A 5FLXc 3DLLA 1E1OA 5AJ3Q 4A3GG 4R4IA 2CQOA 3GTQH 4R4CA 1IBKQ 1HR0Q 4LUOA 2CFMA 1VQBA 4XTVA 3CMQA 2PQAA 4WI1A 4JI1Q 2EAYA 4P73C 4CS4A 4IJLA 5GAEC 2Q2IA 1NMFA 4EQ5A 4H2YA 3PO3G 2R93H 5K1PA 5M3MG 4XU0A 4EX5A 4BXXG 1PHJA 1XJVA 1FL0A 3PV0A 1YJWA 1M1KC 2VW9A 2QGQA 4OWXB 2L15A 4K0KQ 4HJ9A 4TQFA 1WCMG 4UY8C 4A3CG 4P74C 1UE6A 1FJGQ 3HTZA 3CCSA 3K8AA 3UFGA 4GKKQ 4A76A 1KC8C 2Q2TA 2K5NA 2DGYA 1YI2A 1QVCA 1XMOQ 3HXYA 1PYSA 1L1OC 3S24A 1YNXA 1HNWL 5IYBG 3PUYA 1NJ1A 4LUZA 1J5EQ 4GN3B 3J7ZC 3GDEA 3HFZB 5C0XJ 3PGZA 4HJAA 4KHPQ 4YREA 1ATIA 5LMUQ 4LFBQ 2DU7A 1PH8A 3MF1A 4AIMA 2ZIOA 3CMAA 2R93G 4KR3A 2E10A 3ULJA 3NELA 1GM5A 1A62A 1BIBA 2WAQG 4JI5L 2LXKA 4DR1Q 1H4SA 4IFDI 2K52A 4LF6L 3TREA 1V1QA 4BWAA 4OO1I 1RL2A 1PH9A 3PCOA 1VQMA 4RDXA 1K8GA 3J80i 4HIDA 2F52A 4PMWA 3RZOH 1N32Q 3HRIA 1N36L 3RKYA 1AE2A 4HA8A 3KF6B 3TUPA 4GKJQ 4XU2A 2RHSB 4X6AH 2Q7GA 3KFUA 3HOVH 4AQYL 1LM0A 1QVFA 1PV4A 1X01A 1QE0A 4LF4L 2UXCL 4LWCA 2ZJRA 3I4NG 2UU9L 2AWNA 3HY0A 1YEZA 3WQZA 4A3KH 2AMCA 3IKMB 3W1BA 4BY1H 2CKZB 2Q5HA 4NXNQ 2KHJA 3CPFA 4DR5L 4DR4Q 4P72A 4YRRA 3EBEA 5HGQA 2LXJA 5C0XI 5LMNQ 2Z0SA 1A63A 2I4NA 2ZT6A 4A3DG 1C0AA 2Y0SE 1XNQL 1KL9A 3L2ZA 4G85A 2CWAA 1X3FA 1CKOA 1EYGA 4IOAA 1E1TA 2JA7H 2BH2A 3S1MH 3FHWA 1K8AC 2JA5H 4H2TA 2HHHQ 3DSQA 1KMMA 4DUYL 1Y14B 4L5QA 2ATWA 1GKHA 1N8RC 4YRQA 1B7YB 2YTXA 4LFCL 2LSSA 3HOVG 1VQKA 3FKIH 2IX0A 2I0QA 3IKLA 3LSQA 2FYKA 4R4OA 3H3VI 4DR3L 3PUWA 3V8JA 4B3RL 1NJIC 2GN5A 4CH6A 4X62Q 4XU1A 1JJCB 5JEAG 4DUZQ 3TQYA 2ALYA 4CH5A 5C44G 1BBWA 4YHHQ 4A3KG 2DQ3A 4BY1G 4NXMQ 3QO8A 2C8MA 1HZAA 3TS0A 1EIYA 1J5WA 4A3JH 4POGA 4JOIC 3L7ZC 1L1OB 1S3OA 2Q5IA 2ZM6L 4DV5Q 3AFPA 4HWOA 4JC0A 4X5OA 4DV7L 4TWAA 2CJ9A 3FJPA 3MXNB 2DEQA 3S15H 3STBD 1JJ2A 3J7A5 4UPAA 2R7ZH 4DV1Q 1MJCA 1X55A 1M90C 1E3PA 3CXCA 5K36G 3D0FA 4JI3L 1XNRQ 1SR3A 3OTOL 1XPOA 4DV4Q 2QA4A 4TVAA 4YRGA 1GGMA 1UEBA 3OYYA 1A8VA 4IJHA 3STBC 2EJGA 4DV3L 4DV6L 1NYQA 2ZNIA 4JI6L 3KF8B 1XMQQ 3GTPH 4E51A 3RR5A 4YRLA 1PH2A 3G4SA 4DK6C 1IXRA 1KAWA 3OW2A 4A3JG 3RGLA 4XTZA 4YRJA 4LFAL 3L4GA 4Y7NH 2G4CA 2ZZFA 1UE1A 1X2GA 1TWFH 1VQDA 4DQ2A 1WYDA 5JJKA 1WU7A 1I5FA 4LF5L 3A7RA 3I55A 3HOXG 4DAYB 4QQBX 3MQZA 2ZR2A 1WLEA 5IP7H 2F4VL 3G1ZA 2QHTA 1O7IA 1KHIA 4LW1A 2R7ZG 3TRZA 1VQZA 1SETA 4A93H 3DM3A 1PH6A 3BFMA 1QUQB 3ULLA 3T1HL 4YCVA 4JI7L 2K4KA 4IPGA 2V1CC 4J15A 4HIMA 1YJ9A 4GNXB 4HJ5A 2A19A 1HNZQ 4LF7L 4YRCA 1HNWQ 4P71C 1KXLA 1QZHA 2Q7EA 5KNNA 2E8GA 2MNAA 5M5XH 3R07A 1E22A 4H2XB 1WFQA 5M3MH 1Q12A 1WNLA 2DZCA 5JEAJ 3BZCA 1Y1WG 2I4LA 1SLJA 3CQZH 1TWCH 4HWTA 1WCMH 3GTOH 4A3CH 1C7YA 4X65Q 4A3IG 2HNIA 2ZJPA 4JI5Q 5C3EG 2DDZA 4LF6Q 3RN5A 1ASYA 3NETA 4LF8Q 4JBJA 1N36Q 4JI0L 5IP7G 1YJNA 2MQHA 1JJGA 5IE8A 2A1AA 4KQEA 1FYFA 2ES2A 1X65A 1SERA 2E1HA 1VQJA 4BBSH 1NJ5A 2ZINA 4AYBG 4WF2A 1B70B 4CS2A 12ASA 1VQNA 3HXZA 4AQYQ 3UDIA 4EO4A 4YWKA 1G6PA 2D62A 4LF4Q 2UXCQ 2K50A 3CC4A 3M9BA 3GTJH 5C52B 3KOJA 2WAQE 4BY7G 3S1RH 1Q86C 2OTLA 5HY6A 3D31A 2CIMA 2UU9Q 2VL6A 1BIAA 2E41A 1JT8A 1AE3A 1SROA 3GD7A 4QL5A 4LF9Q 4P75A 3KF6A 2RHQB 2R6GA 1VQ9A 1YFTA 2RHSA 4DR5Q 4DAMA 4Q6GA 4XIGS 4H02A 4GLXA 2NZHA 4PG3A 3E9HA 1N9WA 4GLAC 3MF2A 4Q15A 4H2WA 3S1QH 2KCTA 4OWTB 4XTYA 1XNQQ 1X3GA 1HZ9A 4KI0A 1XTDA 1PH5A 2E5LL 1VQOA 4P3NA 2C7IA 3PIPA 3CP0A 4DR2L 2H5XA 1VQEA 4DR7L 5ELOA 4DUYQ 3UDGA 4BBSG 3JAMi 2Q7HA 5DLQE 4BBRH 3CC2A 4LNQA 3I4NH 3V7RA 4LFCQ 1NTGA 1I94L 3RIRA 4ZIBA 4DR3Q 1VQIA 1WOCA 2BA1A 2YTVA 4B3RQ 4UP8A 2B63H 3ICAA 1VS0A 4DK3C 1CKNB 2JA9A 4DV2L 1YBYA 2VQFL 2ODRD 2JEAI 1X2HA 4HWSA 2N49A 1BKBA 1VQAA 2IY5B 2JQOA 2WFWA 1PH7A 4P72C 1Z47A 1ASZA 3RNUA 2UXBL 1B7YA 4A3DH 1NJ2A 2E3CA 1QF6A 1QVGA 2ZM6Q 3S17H 1P8LA 2CGHA 4LVLA 3NENA 3CCQA 5IP9G 1N34Q 1EWIA 2ODRC 4DV7Q 1H4QA 1FGUA 4CH3A 1EUJA 4PZ7A 1VQPA 4UP9A 3MEFA 1JJCA 3VQYA 1HNXL 1UWVA 1YVCA 4DV0L 3U50C 3RF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL A;  2KCM A;  2AKW B;  4BBR G;  4JI3 Q;  3GTK H;  1L1O A;  2I4O A;  4A3M H;  3OTO Q;  1EFW A;  4JBK A;  1YHQ A;  4NB3 A;  4ALP A;  5C44 H;  3LGJ A;  2UUB L;  4P3P A;  5GAG C;  5JJI A;  2ZZG A;  4DV3 Q;  1HR0 L;  1PFS A;  2B63 G;  4DV6 Q;  3IG2 A;  4JI6 Q;  2ZNJ A;  1TXY A;  3A5U A;  4JI2 L;  3M3Y H;  4TVW A;  1VCI A;  3BZK A;  1YB3 A;  3J81 i;  3HOY G;  4H2V A;  1EIF A;  1VQ6 A;  5M3F H;  3A5Z B;  4CS3 A;  3PUV A;  1P16 A;  4YRS A;  1SE8 A;  1G5I A;  2NN6 I;  4LFA Q;  3RLF A;  2AWO A;  4K88 A;  2YTY A;  4K86 A;  4B3T Q;  2UUC L;  3AFQ A;  1YIJ A;  1FJG L;  1K3R A;  1QZG A;  1WJJ A;  1X3E A;  1I3Q H;  4LF5 Q;  3P8T A;  3UDF A;  1IBL Q;  4OX9 L;  2OCE A;  4JCV E;  3CCM A;  1I50 H;  1KD1 C;  4O0A A;  1PVO A;  1EVL A;  2ZT8 A;  2F4V Q;  3KDF B;  4PHC A;  2R92 H;  2JEB I;  2KHI A;  2N8N A;  4OP0 A;  4JI4 L;  3T1H Q;  4A3M G;  4JI7 Q;  1J5E L;  2DVE A;  1YFR A;  2N78 A;  3J80 c;  3HXW A;  1TWA H;  4LF7 Q;  1D8L A;  2XTI A;  3CW2 C;  2CJA A;  4L5S A;  4IPH A;  1Z7M A;  4UP7 A;  1JMC A;  4IO9 A;  4YRT A;  2F3I A;  2DU5 A;  5M3F G;  3CCE A;  4QGU A;  4L5R C;  2YV5 A;  3A0J A;  1S40 A;  2ZTE A;  3CCR A;  1QUQ A;  4C3J H;  2ASB A;  3HOX H;  2NVY H;  4TVY A;  4GNX A;  1WQ7 A;  2DQ0 A;  4XTU A;  4A75 A;  1VQG A;  2GVB A;  1YGB A;  5FJ8 G;  4H2X A;  1SRU A;  3G71 A;  5IYD G;  2DKG A;  2R92 G;  2K14 A;  2R7D A;  2FXQ A;  2ID0 A;  4KR2 A;  3ERR A;  2Y0S G;  3PO2 H;  4IFD G;  2VQE L;  1RIQ A;  5J3B A;  3HKZ G;  3RAC A;  3KYH C;  4X66 L;  4XEO A;  4YYE A;  4RQF A;  3UH0 A;  4TTV A;  1SN8 A;  4L5T A;  4C3H H;  1WQW A;  1Y1W H;  1ADY A;  1X6O A;  3PF5 A;  4GLV B;  2I5H A;  1WI5 A;  1YHA A;  3HRK A;  2Z6K A;  3W1G A;  2OQK A;  4LNS A;  1PYB A;  4YWL A;  4YP0 A;  4B3M L;  5E7N A;  1NJ6 A;  1X54 A;  1B76 A;  4A3I H;  3UDX A;  2K75 A;  4Y52 H;  5LMN L;  4JV5 L;  1U0L A;  2UUA L;  1SFO H;  5C3E H;  2ZR3 A;  4AYB E;  1B70 A;  2YU9 H;  4MZ9 A;  4GOP C;  4NPS A;  2PI2 E;  2JA6 H;  3HOZ H;  1C9O A;  4QJF A;  1B8A A;  3LSS A;  2JJQ A;  1HXD A;  3BJU A;  1K0R A;  2HHH L;  4K87 A;  3V7S A;  1PH1 A;  1V43 A;  3K81 C;  3S1N H;  3W3S A;  1Q1E A;  4HIO A;  2VUM G;  4DR2 Q;  1VQ7 A;  3TS2 A;  4B3S L;  2IX1 A;  4DR7 Q;  2RHQ A;  2KBN A;  2I5M X;  4XTC S;  1L0W A;  5C0X G;  3F1Z A;  4YCW A;  5IY0 A;  3PO2 G;  4BY7 H;  1I94 Q;  2EXD A;  4CH4 A;  2E64 A;  3GO5 A;  4A3L H;  4JG2 A;  3EIV A;  3EN2 A;  3V8K A;  2B3G A;  4DV2 Q;  2UXD L;  1CUK A;  4DPG A;  3GTM H;  1G51 A;  3RLN A;  3AEV A;  3G48 A;  3NEM A;  2AHO B;  3FP9 A;  3RUX A;  2ZJQ A;  2UXB Q;  2OWO A;  2HIX A;  3PIO A;  2HQL A;  1Q1B A;  3HFZ A;  4A3B G;  1TWH H;  1Q46 A;  3U4V A;  3TEH B;  2JA6 G;  2PI2 A;  4YCU A;  3HOZ G;  1BVS A;  2WB1 G;  1VQF A;  4JBM A;  4P3O A;  3J81 j;  4WJ4 A;  4YRN A;  1VQC A;  4JYA L;  1HH2 P;  4GN5 A;  3ERS X;  1USY A;  3HY1 A;  2VNU D;  1CKN A;  5K1X A;  1RIP A;  3L1A A;  4HIK A;  1XNR L;  1HNX Q;  4DV0 Q;  4BW9 A;  5H1S E;  2IY5 A;  2EJF A;  4YRP A;  2K5H A;  2OTJ A;  3K7U C;  1J6Q A;  1N33 L;  3KLW A;  2JK8 A;  4P71 A;  3ULP A;  1XMQ L;  4X64 L;  3L0O A;  5GAD C;  2UUB Q;  4IFD J;  4TQU S;  4DKA C;  1VQH A;  4A3L G;  3T1Y L;  3K0X A;  4JI2 Q;  4YPF A;  2JA8 H;  2EJ9 A;  2VZA A;  2ZGW A;  2QHS A;  4XEM A;  1KOG A;  4G84 A;  5IP9 H;  2E2H H;  4HWR A;  2AKW A;  5IWA L;  1EOV A;  3RZD H;  4O2D A;  4R4T A;  2UUC Q;  4YDQ A;  3SGI A;  3M4P A;  4A3F H;  2C35 B;  5FLM H;  1EQR A;  3K7A H;  2IHF A;  1IBM L;  3REU A;  4OX9 Q;  5BR8 L;  2RF4 A;  1XPR A;  4TQD A;  3A5Z A;  3IAL A;  3EFS A;  1IYJ B;  1G5H A;  1HNZ L;  4GOP B;  3MEY A;  2KEN A;  1VQ4 A;  4JI4 Q;  1LUZ A;  1FVI A;  2QHV A;  3M4Q A;  2XGT A;  3F2B A;  2ZT7 A;  3PUZ A;  4P73 A;  3HOY H;  3VDY A;  3HXV A;  4JI8 L;  4YY3 L;  5M5Y H;  3I2Z A;  4YRM A;  5C4J H;  3UGQ A;  5GAH C;  4MTN A;  2JA8 G;  4HJ7 A;  3CPW A;  2ARS A;  3HXX A;  1CSP A;  3WWV A;  3CD6 A;  3OD1 A;  1BBU A;  1HTT A;  4QY7 A;  1X56 A;  3KDF A;  3AQQ A;  5EAY A;  4P74 A;  5C53 B;  3QNE A;  1CSQ A;  1UE7 A;  4X65 L;  5JJL A;  2ZCE A;  4HWP A;  2CCZ A;  2CJB A;  4DR6 L;  2CWP A;  3HOU H;  2PQA B;  1HZB A;  3RN2 A;  4BA2 I;  3CME A;  1H4V B;  2DUD A;  4A3F G;  1E24 A;  4LF8 L;  5FLM G;  1NBW A;  4PZ8 A;  2P0L A;  2HIV A;  1JE5 A;  1I6H H;  2P5I A;  1R9T H;  3GTL H;  2EQS A;  5C4X H;  3U58 A;  3UE1 A;  2DXT A;  5AJ3 L;  4A3E H;  1LYL A;  2E2I H;  3VQX A;  1MKH A;  4IPD A;  3UE0 A;  1IBK L;  4RQE A;  3A5Y A;  2GVA A;  2MFI A;  4JI1 L;  5IYC H;  2VQE Q;  3NBH B;  4IOC A;  3A31 A;  4YRO A;  3P8V A;  2QEX A;  4X66 Q;  1HR0 W;  1OXU A;  1OXT A;  1D7Q A;  4AH6 A;  1Y1V H;  3RLO A;  1K83 H;  1OXX K;  3VBB A;  1Z7N A;  3ER0 A;  1PYS B;  2E5A A;  3EFR A;  2DTH A;  2ZXF A;  5GQO A;  4LF9 L;  1EQQ A;  3A74 A;  3JAM c;  2PMF A;  3TEG A;  2N3S A;  1SRY A;  2I5L X;  4K0K L;  1L2F A;  3RKW A;  2B29 A;  1HZC A;  1W66 A;  4DNI A;  4B3M Q;  2E65 A;  1ADJ A;  2VY3 A;  4JV5 Q;  2UUA Q;  4C2M H;  3HOU G;  3F2C A;  5FJ8 H;  4GKK L;  4HVC A;  4GNX C;  3LC0 A;  3AYH B;  4QIW E;  3CCV A;  1W3S A;  3HKZ E;  4C3I H;  1XMO L;  3F8T A;  1EVK A;  5IYD H;  1YFS A;  3KJO A;  3W5O A;  3S16 H;  3A32 A;  1VQ8 A;  3PZC A;  5C4X G;  2OQ0 A;  2NZO A;  1KIX A;  3I4M H;  2DZ9 A;  2NVT H;  3S2D H;  1MIU A;  1V9P A;  2EL9 A;  4B3S Q;  3PCO B;  4A3E G;  2DTI A;  2R7F A;  3Q8D A;  4KHP L;  1G29 1;  5LMU L;  2DTO A;  4LFB L;  5IYC G;  4ME3 A;  3PF4 A;  4ZTZ B;  2ZTG A;  1Y1V G;  3E0E A;  2J3M A;  2MO1 A;  3B6Y A;  1JB7 A;  2Z6K C;  3H0G H;  5M5W H;  5C51 B;  1PH4 A;  4H2U A;  2UXD Q;  1SMX A;  4DR1 L;  3UGT A;  3HFV A;  5IT9 c;  1KQS A;  3F2D A;  4OLF A;  1NJ8 A;  3HOW H;  3CAM A;  3M7N A;  2AMC B;  4FDB A;  1N32 L;  2DXU A;  1N34 L;  2IHE A;  3KJP A;  3S2H H;  1IL2 A;  4GKJ L;  3QTC A;  3J81 c;  1A0I A;  4YRK A;  1CKM A;  4RMF A;  1NNH A;  4JI0 Q;  2NVQ H;  2VUM H;  2WP8 J;  3VQW A;  2JA7 G;  4ZTU B;  1KRS A;  4A4I A;  4JYA Q;  2JA5 G;  1NYR A;  3A7U A;  4KHZ A;  4GN4 B;  1YIT A;  1Q82 C;  4PZ6 A;  3I4M G;  1Z9F A;  2JE6 I;  1MJE A;  1WPY A;  2EIF A;  2BA0 A;  3FKI G;  4OO1 G;  5ELN A;  1U5K A;  1Q7Y C;  3M85 A;  1LTL A;  3G6E A;  4MNO A;  2YYZ A;  2MO0 A;  3PUX A;  1OXV A;  1N33 Q;  4BA1 I;  1SES A;  2HT1 A;  4R4Q A;  4OXP A;  4XTW A;  4X64 Q;  3TEH A;  4NXN L;  1E7Z A;  4JOI A;  1GO3 E;  4DR4 L;  2K5V A;  2WB1 E;  4POF A;  1OTC A;  4OON A;  3S14 H;  3T1Y Q;  3H0G G;  2ZZE A;  3CCL A;  1Q81 C;  3H3V H;  3H15 A;  2BH8 A;  3RL6 A;  3QO5 A;  4XTX A;  3REX A;  4A3B H;  5LMN W;  4APV A;  3HOW G;  2ALY B;  4B3T L;  3PSI A;  4H2S A;  5IWA Q;  1UE5 A;  1K73 C;  4KLK A;  3CCU A;  3GTG H;  1IZ6 A;  5GRO A;  1EIY B;  1TWG H;  4YRF A;  3HXU A;  2EWN A;  1IBL L;  2E5L Q;  4LUV A;  3P8Y A;  1S72 A;  3CF5 A;  3HKS A;  2Q2U A;  5F5W A;  3V7C A;  1USY C;  2ZIM A;  1IBM Q;  3I4O A;  3I7F A;  1XPU A;  1VQ5 A;  2PNH A;  4XU3 A;  4NCX A;  5BR8 Q;  2NN6 G;  1YHB A;  1NY4 A;  4RG1 A;  4X62 L;  1X9N A;  11AS A;  3A7A A;  4A3G H;  1T9H A;  4DUZ L;  3V8L A;  4YHH L;  1HJP A;  3JC6 6;  2IT1 A;  4NXM L;  2I4M A;  4YRI A;  1DGS A;  1KRT A;  4YWM A;  1GD7 A;  2ZT5 A;  1HC7 A;  1AH9 A;  1YZ6 A;  2VQF Q;  3CC7 A;  4IPC A;  3PO3 H;  1GVP A;  4GS3 A;  4JI8 Q;  4YY3 Q;  4P75 C;  4BXX H;  1KMN A;  2ART A;  4TVA B;  4DV5 L;  3QO7 A;  3E9I A;  4L87 A;  2PME A;  1H4T A;  4OWW B;  1PH3 A;  4JBW A;  4GOP A;  4HJ8 A;  4DR6 Q;  4WJ3 M;  3L2P A;  1W2B A;  3ICE A;  3I56 A;  2Q2H A;  3BU2 A;  4DV1 L;  2D0O A;  2ZTC A;  3RKX A;  5E3I A;  2VS1 A;  1NE3 A;  3ZJY C;  1K9M C;  3K80 C;  3L4G B;  1Q8K A;  2QHU A;  2DJZ A;  3M4O H;  1PA6 A;  3U4Z A;  4DV4 L;  2ZTD A;  4R1J A;  2E2J H;  2ARU A;  3IRB A;  2D0P A;  4A93 G;  2RCN A;  2NVX H;  1OXS C;  1NMG A;  2J3L A;  5IYB H;  2A8V A;  2PMZ E;  3VQV A;  3CCJ A;  1H95 A;  5FLX c;  3DLL A;  1E1O A;  5AJ3 Q;  4A3G G;  4R4I A;  2CQO A;  3GTQ H;  4R4C A;  1IBK Q;  1HR0 Q;  4LUO A;  2CFM A;  1VQB A;  4XTV A;  3CMQ A;  2PQA A;  4WI1 A;  4JI1 Q;  2EAY A;  4P73 C;  4CS4 A;  4IJL A;  5GAE C;  2Q2I A;  1NMF A;  4EQ5 A;  4H2Y A;  3PO3 G;  2R93 H;  5K1P A;  5M3M G;  4XU0 A;  4EX5 A;  4BXX G;  1PHJ A;  1XJV A;  1FL0 A;  3PV0 A;  1YJW A;  1M1K C;  2VW9 A;  2QGQ A;  4OWX B;  2L15 A;  4K0K Q;  4HJ9 A;  4TQF A;  1WCM G;  4UY8 C;  4A3C G;  4P74 C;  1UE6 A;  1FJG Q;  3HTZ A;  3CCS A;  3K8A A;  3UFG A;  4GKK Q;  4A76 A;  1KC8 C;  2Q2T A;  2K5N A;  2DGY A;  1YI2 A;  1QVC A;  1XMO Q;  3HXY A;  1PYS A;  1L1O C;  3S24 A;  1YNX A;  1HNW L;  5IYB G;  3PUY A;  1NJ1 A;  4LUZ A;  1J5E Q;  4GN3 B;  3J7Z C;  3GDE A;  3HFZ B;  5C0X J;  3PGZ A;  4HJA A;  4KHP Q;  4YRE A;  1ATI A;  5LMU Q;  4LFB Q;  2DU7 A;  1PH8 A;  3MF1 A;  4AIM A;  2ZIO A;  3CMA A;  2R93 G;  4KR3 A;  2E10 A;  3ULJ A;  3NEL A;  1GM5 A;  1A62 A;  1BIB A;  2WAQ G;  4JI5 L;  2LXK A;  4DR1 Q;  1H4S A;  4IFD I;  2K52 A;  4LF6 L;  3TRE A;  1V1Q A;  4BWA A;  4OO1 I;  1RL2 A;  1PH9 A;  3PCO A;  1VQM A;  4RDX A;  1K8G A;  3J80 i;  4HID A;  2F52 A;  4PMW A;  3RZO H;  1N32 Q;  3HRI A;  1N36 L;  3RKY A;  1AE2 A;  4HA8 A;  3KF6 B;  3TUP A;  4GKJ Q;  4XU2 A;  2RHS B;  4X6A H;  2Q7G A;  3KFU A;  3HOV H;  4AQY L;  1LM0 A;  1QVF A;  1PV4 A;  1X01 A;  1QE0 A;  4LF4 L;  2UXC L;  4LWC A;  2ZJR A;  3I4N G;  2UU9 L;  2AWN A;  3HY0 A;  1YEZ A;  3WQZ A;  4A3K H;  2AMC A;  3IKM B;  3W1B A;  4BY1 H;  2CKZ B;  2Q5H A;  4NXN Q;  2KHJ A;  3CPF A;  4DR5 L;  4DR4 Q;  4P72 A;  4YRR A;  3EBE A;  5HGQ A;  2LXJ A;  5C0X I;  5LMN Q;  2Z0S A;  1A63 A;  2I4N A;  2ZT6 A;  4A3D G;  1C0A A;  2Y0S E;  1XNQ L;  1KL9 A;  3L2Z A;  4G85 A;  2CWA A;  1X3F A;  1CKO A;  1EYG A;  4IOA A;  1E1T A;  2JA7 H;  2BH2 A;  3S1M H;  3FHW A;  1K8A C;  2JA5 H;  4H2T A;  2HHH Q;  3DSQ A;  1KMM A;  4DUY L;  1Y14 B;  4L5Q A;  2ATW A;  1GKH A;  1N8R C;  4YRQ A;  1B7Y B;  2YTX A;  4LFC L;  2LSS A;  3HOV G;  1VQK A;  3FKI H;  2IX0 A;  2I0Q A;  3IKL A;  3LSQ A;  2FYK A;  4R4O A;  3H3V I;  4DR3 L;  3PUW A;  3V8J A;  4B3R L;  1NJI C;  2GN5 A;  4CH6 A;  4X62 Q;  4XU1 A;  1JJC B;  5JEA G;  4DUZ Q;  3TQY A;  2ALY A;  4CH5 A;  5C44 G;  1BBW A;  4YHH Q;  4A3K G;  2DQ3 A;  4BY1 G;  4NXM Q;  3QO8 A;  2C8M A;  1HZA A;  3TS0 A;  1EIY A;  1J5W A;  4A3J H;  4POG A;  4JOI C;  3L7Z C;  1L1O B;  1S3O A;  2Q5I A;  2ZM6 L;  4DV5 Q;  3AFP A;  4HWO A;  4JC0 A;  4X5O A;  4DV7 L;  4TWA A;  2CJ9 A;  3FJP A;  3MXN B;  2DEQ A;  3S15 H;  3STB D;  1JJ2 A;  3J7A 5;  4UPA A;  2R7Z H;  4DV1 Q;  1MJC A;  1X55 A;  1M90 C;  1E3P A;  3CXC A;  5K36 G;  3D0F A;  4JI3 L;  1XNR Q;  1SR3 A;  3OTO L;  1XPO A;  4DV4 Q;  2QA4 A;  4TVA A;  4YRG A;  1GGM A;  1UEB A;  3OYY A;  1A8V A;  4IJH A;  3STB C;  2EJG A;  4DV3 L;  4DV6 L;  1NYQ A;  2ZNI A;  4JI6 L;  3KF8 B;  1XMQ Q;  3GTP H;  4E51 A;  3RR5 A;  4YRL A;  1PH2 A;  3G4S A;  4DK6 C;  1IXR A;  1KAW A;  3OW2 A;  4A3J G;  3RGL A;  4XTZ A;  4YRJ A;  4LFA L;  3L4G A;  4Y7N H;  2G4C A;  2ZZF A;  1UE1 A;  1X2G A;  1TWF H;  1VQD A;  4DQ2 A;  1WYD A;  5JJK A;  1WU7 A;  1I5F A;  4LF5 L;  3A7R A;  3I55 A;  3HOX G;  4DAY B;  4QQB X;  2ZR2 A;  1WLE A;  5IP7 H;  2F4V L;  3G1Z A;  2QHT A;  1O7I A;  1KHI A;  4LW1 A;  2R7Z G;  3TRZ A;  1VQZ A;  1SET A;  4A93 H;  3DM3 A;  1PH6 A;  3BFM A;  1QUQ B;  3ULL A;  3T1H L;  4YCV A;  4JI7 L;  2K4K A;  4IPG A;  2V1C C;  4J15 A;  4HIM A;  1YJ9 A;  4GNX B;  4HJ5 A;  2A19 A;  1HNZ Q;  4LF7 L;  4YRC A;  1HNW Q;  4P71 C;  1KXL A;  1QZH A;  2Q7E A;  5KNN A;  2E8G A;  2MNA A;  5M5X H;  3R07 A;  1E22 A;  4H2X B;  1WFQ A;  5M3M H;  1Q12 A;  1WNL A;  2DZC A;  5JEA J;  3BZC A;  1Y1W G;  2I4L A;  1SLJ A;  3CQZ H;  1TWC H;  4HWT A;  1WCM H;  3GTO H;  4A3C H;  1C7Y A;  4X65 Q;  4A3I G;  2HNI A;  2ZJP A;  4JI5 Q;  5C3E G;  2DDZ A;  4LF6 Q;  3RN5 A;  1ASY A;  3NET A;  4LF8 Q;  4JBJ A;  1N36 Q;  4JI0 L;  5IP7 G;  1YJN A;  2MQH A;  1JJG A;  5IE8 A;  2A1A A;  4KQE A;  1FYF A;  2ES2 A;  1X65 A;  1SER A;  2E1H A;  1VQJ A;  4BBS H;  1NJ5 A;  2ZIN A;  4AYB G;  4WF2 A;  1B70 B;  4CS2 A;  12AS A;  1VQN A;  3HXZ A;  4AQY Q;  3UDI A;  4EO4 A;  4YWK A;  1G6P A;  2D62 A;  4LF4 Q;  2UXC Q;  2K50 A;  3CC4 A;  3M9B A;  3GTJ H;  5C52 B;  3KOJ A;  2WAQ E;  4BY7 G;  3S1R H;  1Q86 C;  2OTL A;  5HY6 A;  3D31 A;  2CIM A;  2UU9 Q;  2VL6 A;  1BIA A;  2E41 A;  1JT8 A;  1AE3 A;  1SRO A;  3GD7 A;  4QL5 A;  4LF9 Q;  4P75 A;  3KF6 A;  2RHQ B;  2R6G A;  1VQ9 A;  1YFT A;  2RHS A;  4DR5 Q;  4DAM A;  4Q6G A;  4XIG S;  4H02 A;  4GLX A;  2NZH A;  4PG3 A;  3E9H A;  1N9W A;  4GLA C;  3MF2 A;  4Q15 A;  4H2W A;  3S1Q H;  2KCT A;  4OWT B;  4XTY A;  1XNQ Q;  1X3G A;  1HZ9 A;  4KI0 A;  1XTD A;  1PH5 A;  2E5L L;  1VQO A;  4P3N A;  2C7I A;  3PIP A;  3CP0 A;  4DR2 L;  2H5X A;  1VQE A;  4DR7 L;  5ELO A;  4DUY Q;  3UDG A;  4BBS G;  3JAM i;  2Q7H A;  5DLQ E;  4BBR H;  3CC2 A;  4LNQ A;  3I4N H;  3V7R A;  4LFC Q;  1NTG A;  1I94 L;  3RIR A;  4ZIB A;  4DR3 Q;  1VQI A;  1WOC A;  2BA1 A;  2YTV A;  4B3R Q;  4UP8 A;  2B63 H;  3ICA A;  1VS0 A;  4DK3 C;  1CKN B;  2JA9 A;  4DV2 L;  1YBY A;  2VQF L;  2ODR D;  2JEA I;  1X2H A;  4HWS A;  2N49 A;  1BKB A;  1VQA A;  2IY5 B;  2JQO A;  2WFW A;  1PH7 A;  4P72 C;  1Z47 A;  1ASZ A;  3RNU A;  2UXB L;  1B7Y A;  4A3D H;  1NJ2 A;  2E3C A;  1QF6 A;  1QVG A;  2ZM6 Q;  3S17 H;  1P8L A;  2CGH A;  3NEN A;  3CCQ A;  5IP9 G;  1N34 Q;  1EWI A;  2ODR C;  4DV7 Q;  1H4Q A;  1FGU A;  4CH3 A;  1EUJ A;  4PZ7 A;  1VQP A;  4UP9 A;  3MEF A;  1JJC A;  3VQY A;  1HNX L;  1UWV A;  1YVC A;  4DV0 L;  3U50 C;  3RF1 A; 
#chains in the Genus database with same CATH topology
 2P5Z X;  2AQ2 B;  2XWJ B;  1STE A;  1VQL A;  2KCM A;  4MIU A;  4B08 A;  1TS4 A;  1QWY A;  2AKW B;  4BBS B;  4BBR G;  2HQE A;  1PRT C;  4JI3 Q;  3GTK H;  4FF2 A;  3SK5 A;  4F88 A;  1L1O A;  2I4O A;  2RKS A;  4A3M H;  3OTO Q;  1EFW A;  3M7G A;  1B3A A;  3MA2 B;  3MZ5 A;  4JBK A;  1Y69 U;  2KHS A;  1Z6H A;  1YHQ A;  4NB3 A;  4ALP A;  4P2C B;  5C44 H;  3LGJ A;  2UUB L;  4P3P A;  5GAG C;  5JJI A;  2ZZG A;  4DV3 Q;  1HR0 L;  1PFS A;  2B63 G;  2J0T D;  4DV6 Q;  3IG2 A;  4DAV A;  4JI6 Q;  2ZNJ A;  1TXY A;  5D14 A;  3A5U A;  1Y8O B;  4JI2 L;  3MXN A;  3M3Y H;  4TVW A;  1VCI A;  1PTO C;  3BZK A;  1YB3 A;  3J81 i;  3BYY B;  3HOY G;  3A55 A;  4H2V A;  1EIF A;  2B8F A;  2LY7 A;  3N52 A;  1VQ6 A;  2EYL A;  3WOE A;  3A5Z B;  5M3F H;  4CS3 A;  1Q90 A;  3X3M A;  3KBX A;  3PUV A;  1P16 A;  4YRS A;  3NWS A;  1SE8 A;  1G5I A;  4KJN A;  2NN6 I;  4LFA Q;  4HR7 B;  3T53 B;  3RLF A;  2PMZ B;  1FD7 D;  2AWO A;  1STN A;  4XT1 B;  5IGG A;  4K88 A;  2YTY A;  1PMR A;  4K86 A;  3SK4 A;  4CHT B;  5IGB A;  1RJT A;  4UAI A;  4B3T Q;  2UUC L;  3AFQ A;  1YIJ A;  1FJG L;  1HHV A;  1YNJ D;  1PTO H;  1K3R A;  1LLR D;  1O7Z A;  1WJJ A;  1X3E A;  1QZG A;  3S1Q B;  1J8I A;  1I3Q H;  4LF5 Q;  3P8T A;  3KF8 A;  3UDF A;  1IBL Q;  4OX9 L;  1C48 A;  2OCE A;  4JCV E;  1CZW A;  4QUF A;  3R8B A;  3CCM A;  1I50 H;  5JVG 3;  1KD1 C;  4O0A A;  1PVO A;  1EVL A;  2ZT8 A;  2F4V Q;  3KDF B;  1G2T A;  4PHC A;  2R92 H;  2JEB I;  1I4X A;  3D4D A;  2KHI A;  2OEO A;  1Q8I A;  1SNC A;  1RTO A;  2N8N A;  4OP0 A;  1YNJ C;  1S5F D;  4JI4 L;  4BBR B;  3T1H Q;  3UI2 A;  4A3M G;  4WOR A;  4JI7 Q;  1J5E L;  3HS0 C;  2FIN B;  2DVE A;  4IFD H;  1YFR A;  2N78 A;  2E75 C;  1EY8 A;  3J80 c;  4F87 A;  3HXW A;  1TWA H;  4LF7 Q;  1D8L A;  2XTI A;  3CW2 C;  2HCI A;  5ELD A;  2A6H D;  2CJA A;  4L5S A;  3VYT A;  4IPH A;  2B63 B;  1Z7M A;  4UP7 A;  3T4A C;  4NW2 A;  1JMC A;  1QNU A;  3MXG A;  5IGF A;  4IO9 A;  1A15 A;  4DAY A;  2KOL A;  4YRT A;  2NUC A;  1GXD C;  2F3I A;  4ZKC B;  2DU5 A;  3HOY B;  5M3F G;  3CCE A;  4QGU A;  5M5Y B;  4L5R C;  2YV5 A;  3A0J A;  2IW3 A;  1XXG A;  1S40 A;  1RTN A;  4OEL B;  2LS0 1;  3NP8 A;  2KEE A;  2ZTE A;  3IKJ A;  3CCR A;  5C4J B;  1S5E D;  1IKM A;  4ZLT F;  2M00 A;  1QUQ A;  1SYC A;  2XIW A;  3EVQ A;  4C3J H;  3ITP A;  1V1P B;  1B53 A;  3S17 B;  3FPU B;  4K8J A;  2ASB A;  3H94 A;  3HOX H;  2NVY H;  3TSS A;  4TVY A;  5C4Z A;  2XVS A;  4DK1 A;  4GNX A;  1HRJ A;  5DM7 3;  2R3Z A;  1WQ7 A;  2L55 A;  3MXU A;  2DQ0 A;  3NQT A;  4C56 C;  4XTU A;  4A75 A;  1VQG A;  4K5W A;  2GVB A;  1GUT A;  5K5P A;  1AZP A;  1YGB A;  2TMP A;  5FJ8 G;  2PZU A;  5FO9 B;  4HED A;  1KNA A;  2F0O A;  3Q24 A;  4H2X A;  4CJ1 B;  5CV5 A;  1GUG A;  1EU4 A;  5IGE A;  2K5W A;  3T16 A;  1A2T A;  1SRU A;  3G71 A;  4HMI A;  5IYD G;  2DKG A;  2QDL A;  2R92 G;  1EOT A;  3H09 A;  4Q5V A;  2ICI A;  2K14 A;  5C3X A;  2F0W A;  3OPO A;  5BN3 A;  2R7D A;  1WTQ A;  3GTL B;  2FXQ A;  2ID0 A;  2L9H A;  3GTK B;  4KR2 A;  3ERR A;  2Y0S G;  4A3M B;  3PO2 H;  1SND A;  1STH A;  4IFD G;  2MP1 A;  2VQE L;  1RIQ A;  5J3B A;  3LNN A;  3HKZ G;  4JW0 A;  3RAC A;  3KYH C;  4X66 L;  3H3V C;  1ESF A;  5EPJ A;  4XEO A;  3KUP A;  5F2D A;  4YYE A;  4RQF A;  3UH0 A;  2WKD A;  4XDX A;  4TTV A;  4LVI A;  2KEC A;  1SN8 A;  4L5T A;  4C3H H;  1QJO A;  1Y1W H;  1ADY A;  1WQW A;  1X6O A;  5J39 A;  3PF5 A;  4GLV B;  2I5H A;  1WI5 A;  4ULL A;  3M3Y B;  1YHA A;  3NUC A;  4FP5 D;  3HRK A;  2Z6K A;  5AFW A;  2F0K A;  2QCP X;  2BOS A;  4LK1 C;  3Q6S A;  5M3F B;  1TII D;  3W1G A;  1SJE D;  2OQK A;  5G3L F;  4LNS A;  1K83 B;  1PRT B;  1PYB A;  4YWL A;  1M8A A;  4YP0 A;  4B3M L;  5TSS A;  5E7N A;  3LWE A;  1NJ6 A;  1X54 A;  1B76 A;  1IYU A;  4A3I H;  3UDX A;  2K75 A;  4PV1 C;  1BR9 A;  4Y52 H;  5LMN L;  4JV5 L;  1U0L A;  2UUA L;  1K3B C;  2DNC A;  1SFO H;  1Z7T A;  5C3E H;  4C3J G;  2ZR3 A;  4PNY A;  5E4W C;  4AYB E;  5CBE E;  1B70 A;  2YU9 H;  4MZ9 A;  3WOF A;  4GOP C;  4NPS A;  2B2U C;  3C1E A;  2PI2 E;  2RDH A;  2JA6 H;  3HOZ H;  1C9O A;  2EXZ A;  4KMU C;  2QEJ C;  4QJF A;  1B8A A;  3LSS A;  2L4N A;  1YNN D;  2JJQ A;  1PTO B;  1ET9 A;  1HXD A;  1I3Q B;  4C2M B;  2H4O A;  1BUV T;  1SMY D;  5EPL A;  3TZD A;  3BJU A;  4HSP A;  1LTB D;  3RUZ A;  4ZK9 B;  1K0R A;  2HHH L;  4K87 A;  3V7S A;  1S4Z A;  1PH1 A;  1V43 A;  3K81 C;  3S1N H;  3W3S A;  2FFK B;  1I50 B;  3K0Y A;  1Q1E A;  4HIO A;  2VUM G;  4DR2 Q;  4N9P A;  1VQ7 A;  3TS2 A;  4B3S L;  2IX1 A;  4DR7 Q;  2RHQ A;  2KBN A;  2I5M X;  4XTC S;  1L0W A;  3RD4 A;  5C0X G;  3F1Z A;  4YCW A;  3IFT A;  1YNN C;  3SVM A;  3GV6 A;  4X3T A;  5IY0 A;  3PO2 G;  4BY7 H;  1HFG A;  2Y0S B;  2C5C A;  4QIW B;  1KAB A;  1I94 Q;  3HKZ B;  1AEX A;  1TWA B;  2EXD A;  1XYI A;  4CH4 A;  4O1N A;  4XXE A;  4Z9C B;  4C3H G;  3NHH A;  2E64 A;  3GO5 A;  4A3L H;  3OHX C;  4JG2 A;  3EIV A;  3EN2 A;  3V8K A;  3NWT A;  2B3G A;  1PZI D;  3C2P A;  4DV2 Q;  4QUC A;  4H13 C;  1V1O A;  4OHJ A;  1CUK A;  2UXD L;  4DPG A;  3GTM H;  1G51 A;  3RLN A;  4PMC A;  3AEV A;  3SR1 A;  2HD3 A;  3K5O A;  3VYS A;  3G48 A;  1EZ8 A;  3NEM A;  3OWF A;  2AHO B;  3FP9 A;  4DXF A;  3EFX D;  3RUX A;  2ZJQ A;  5M5W B;  1CI3 M;  1IKL A;  2UXB Q;  5DEH A;  2OWO A;  3SXH A;  2HIX A;  2WII B;  2Z8L A;  3PIO A;  2Q8R E;  1ZKO A;  2BE5 C;  2HQL A;  4C3J B;  4KKT A;  1Q1B A;  1JOR A;  3HFZ A;  1E2W A;  3P75 A;  4A3B G;  1TWH H;  2RBM A;  1Q46 A;  4HAE A;  2NVY B;  3U4V A;  3TEH B;  2JA6 G;  2PI2 A;  3CRK C;  1F9Q A;  4YCU A;  4CBV A;  3VYR A;  1JOK A;  3HOZ G;  4KD4 A;  1BVS A;  2WB1 G;  2Z6B A;  3MVV A;  1VQF A;  4JBM A;  4P3O A;  3NBI A;  3J81 j;  4WJ4 A;  4YRN A;  3D4R A;  1VQC A;  4JYA L;  1HH2 P;  4GN5 A;  3ERS X;  5ISR A;  1USY A;  3HY1 A;  2VNU D;  1CKN A;  5K1X A;  3NK9 A;  4G7O C;  1RIP A;  3FRP B;  2D9U A;  4X3K A;  3L1A A;  4HIK A;  1XNR L;  1E0B A;  2KA7 A;  1HNX Q;  4DV0 Q;  2NVQ B;  5I2Y A;  2VUM B;  5EKI A;  4BW9 A;  5H1S E;  3I4L A;  2IY5 A;  3ONA B;  1BXT A;  5IGD A;  3AB9 A;  1CTM A;  2F0S A;  2EJF A;  4YRP A;  2K5H A;  2OTJ A;  3K7U C;  3A8K E;  1J6Q A;  1TT2 A;  1N33 L;  4CKC A;  1V8Q A;  2FJ2 A;  4ZUJ A;  3KLW A;  1CT1 D;  4J6H A;  2JK8 A;  3PO2 B;  2K5Q A;  4P71 A;  2F3W A;  1LT4 D;  3ULP A;  1XMQ L;  4X64 L;  3L0O A;  2CVR A;  1W6J A;  1SAP A;  1F9S A;  5GAD C;  3P1H A;  1GHJ A;  2UUB Q;  3BZD B;  4IFD J;  3NQI A;  4TQU S;  4DKA C;  5CR3 A;  3EJI A;  1VQH A;  4C3H B;  4A3L G;  3T1Y L;  3K0X A;  4EGV A;  5D3I B;  4JI2 Q;  1EWH A;  1WTX A;  2XWB B;  2JA8 H;  4YPF A;  2EJ9 A;  2VZA A;  1JCK B;  2O5I C;  5IIF A;  3I73 A;  3T56 B;  4RWS C;  3A7A B;  3VYU A;  3J7A F;  2QHS A;  2ZGW A;  3S14 B;  4XEM A;  1KOG A;  3HZX A;  4G84 A;  5IP9 H;  2E2H H;  3TP7 A;  2F0F A;  4HWR A;  5FO7 B;  2AKW A;  5IWA L;  1EOV A;  3RZD H;  1STB A;  1EY7 A;  3H6M A;  3K5N A;  2YU9 B;  5D65 A;  2NB0 A;  2V4D A;  4O2D A;  4A3B B;  1ML0 D;  4R4T A;  2UUC Q;  2F0T A;  4YDQ A;  3I3C A;  2JA6 B;  4BS9 A;  2L1B A;  3HOZ B;  3SGI A;  3M4P A;  4A3F H;  1L0X B;  1PRT F;  4RFB A;  2C35 B;  1H9J A;  2WB1 B;  5LL6 S;  5FLM H;  4N8X 1;  5I4D A;  2JYO A;  5JVH 3;  1EQR A;  1LAC A;  3K7A H;  4IN3 A;  2IHF A;  1SYG A;  1HTP A;  1IBM L;  2K6A A;  3REU A;  5I9O A;  3FMC A;  4OX9 Q;  1AFP A;  5BR8 L;  2RF4 A;  1XPR A;  3CKI B;  4TQD A;  1DOM A;  3A5Z A;  2EY6 A;  3IAL A;  3EFS A;  1QE6 A;  2A73 B;  1IYJ B;  3D6C A;  2F1M A;  1G5H A;  1PTO F;  1LTR D;  1HNZ L;  4GOP B;  4DF7 A;  3MEY A;  3E3X A;  3GV3 A;  2KEN A;  1VQ4 A;  5BN4 A;  2CH4 W;  4JI4 Q;  1LUZ A;  4RHR A;  5KNC A;  1FVI A;  2QHV A;  3M4Q A;  2XGT A;  3NTH A;  3F2B A;  2ZT7 A;  3PUZ A;  1F2L A;  4RH6 A;  4IUQ A;  4P73 A;  3HOY H;  3VDY A;  1CFM A;  5HGT A;  1WTP A;  3HXV A;  4JI8 L;  4YY3 L;  5M5Y H;  4K6D A;  1DCZ A;  3I2Z A;  4YRM A;  5FO8 B;  4LVJ A;  1EZ6 A;  5C4J H;  5CYU A;  3UGQ A;  5GAH C;  4KV6 A;  4MTN A;  2JA8 G;  4HJ7 A;  3CPW A;  1FYC A;  3GTM B;  2ARS A;  3HXX A;  1CSP A;  3WWV A;  3CD6 A;  4ZRZ A;  3OD1 A;  1BBU A;  1HTT A;  4QY7 A;  1X56 A;  2F0J A;  3KDF A;  3AQQ A;  3LWU A;  5EAY A;  4P74 A;  5C53 B;  2JSO A;  3QNE A;  1CSQ A;  1UE7 A;  4X65 L;  5JJL A;  2ZCE A;  1UNS A;  4HWP A;  4G7Z C;  2CCZ A;  2CJB A;  4WRD A;  1CQV A;  4DR6 L;  2CWP A;  4DN4 M;  2CH4 A;  3HOU H;  2PQA B;  1HZB A;  3C3L A;  2EYF A;  3RN2 A;  1WVL A;  1PFM A;  4BA2 I;  3DUZ A;  1WD0 A;  3CME A;  1H4V B;  2DUD A;  4A3F G;  1E24 A;  4LF8 L;  5FLM G;  5IGC A;  1NBW A;  4RA8 A;  1ENA A;  4PZ8 A;  2P0L A;  2HIV A;  1JE5 A;  1EY0 A;  3BDC A;  1ESR A;  1HXY D;  2RQX A;  1I6H H;  2P5I A;  2EOT A;  3I70 A;  2DY8 A;  1R9T H;  3GTL H;  1HQR D;  3MXP A;  3OW7 A;  4QMG A;  1IHZ A;  4DFA A;  1FR3 A;  2EQS A;  5C4X H;  3U58 A;  2K7V A;  1JR0 D;  2A6E D;  3HRZ C;  1GUS A;  3UE1 A;  2DXT A;  1NAP A;  5AJ3 L;  4A3E H;  2E2J B;  3MC0 B;  1LYL A;  4V19 0;  2E2I H;  3VQX A;  1MKH A;  4IPD A;  3UE0 A;  1IBK L;  1EU3 A;  4RQE A;  2MJ8 A;  3A5Y A;  1GUO A;  2AQ1 B;  5T1G A;  4CDE C;  2GVA A;  4EVO A;  2MFI A;  1H9S B;  4JI1 L;  5IYC H;  1V1P A;  1ONL A;  3NBH B;  2VQE Q;  4IOC A;  4N9T A;  1JC7 A;  4RHS A;  3A31 A;  4YRO A;  3P8V A;  1H9M A;  2QEX A;  2B2V A;  5CV6 A;  2GA4 B;  4X66 Q;  1OXU A;  3J80 E;  1HR0 W;  1OXT A;  1D7Q A;  3GTQ B;  4AH6 A;  1Y1V H;  3TP5 A;  3RLO A;  1K83 H;  1OXX K;  3VBB A;  1Z7N A;  2A6E C;  3ER0 A;  2WAC A;  1PYS B;  2E5A A;  3EFR A;  3BVM A;  2F0G A;  5KRU A;  2DTH A;  2ZXF A;  3P7J A;  3QOL A;  5GQO A;  4LF9 L;  1LTI D;  1EQQ A;  3A74 A;  3JAM c;  1TY2 A;  1U4P A;  2PMF A;  2N3S A;  1SRY A;  3IFD A;  3TEG A;  4BWG B;  2I5L X;  1H9R A;  4K0K L;  2B2Y C;  2JA8 B;  1JWS D;  4NMZ A;  1L2F A;  3DEP A;  3RKW A;  2B29 A;  1HZC A;  2RA4 A;  3TME A;  1W66 A;  4DNI A;  4B3M Q;  2E65 A;  1ADJ A;  1A3V A;  2VY3 A;  2E2H B;  3I72 A;  2A68 D;  3J80 L;  3QOJ A;  4JV5 Q;  2UUA Q;  4LVM A;  4C2M H;  3RZD B;  3HOU G;  3F2C A;  5FJ8 H;  4GKK L;  4HVC A;  4GNX C;  3LC0 A;  3AYH B;  4QIW E;  4EQP A;  3CCV A;  1W3S A;  2B2T A;  1I6V C;  3HKZ E;  4A3F B;  4C3I H;  1XMO L;  3F8T A;  1EVK A;  2RSN A;  3K7A B;  5IYD H;  1YFS A;  3KJO A;  3QB3 A;  3W5O A;  1G6Z A;  2PW7 A;  3S16 H;  3A32 A;  1HA5 A;  3W2D A;  1VQ8 A;  3PZC A;  5C4X G;  2OQ0 A;  2NZO A;  1GUN A;  1KIX A;  3I4M H;  2DZ9 A;  2Z1C A;  2NVT H;  4I65 A;  4XQQ A;  3S2D H;  1MIU A;  1V9P A;  4B9W A;  4DK0 A;  1X32 A;  2EL9 A;  2BCO A;  4B3S Q;  3PCO B;  4A3E G;  2EJG C;  4OO1 H;  2DTI A;  2F0D A;  1GUW A;  2R7F A;  3Q8D A;  1DYQ A;  4KHP L;  4IUP A;  1G29 1;  2F4I A;  1F9R A;  3V96 A;  5LMU L;  2DTO A;  1MSH A;  4F8M A;  4LFB L;  5IYC G;  5C4H A;  4FXK C;  4ME3 A;  3PF4 A;  2F0U A;  4ZTZ B;  2ZTG A;  1Y1V G;  2IJ0 A;  4X3S A;  3E0E A;  4I7Z C;  2J3M A;  2MO1 A;  1FNU A;  1S5B D;  2M9V A;  4V0B A;  3B6Y A;  2AUJ D;  1F2M A;  3OIP A;  1JB7 A;  3O13 A;  5EGT A;  2Z6K C;  2G9D A;  5FOB B;  3H0G H;  4HT4 A;  5M5W H;  2DN8 A;  3U9O A;  3KLS A;  5C51 B;  1ICF B;  1FNW A;  4KY7 A;  1PH4 A;  4H2U A;  5FKA C;  2UXD Q;  2A6H C;  3KLS X;  1SMX A;  4DR1 L;  3UGT A;  3MEH A;  1SYB A;  3HFV A;  5IT9 c;  2BDN A;  1KQS A;  2KCN A;  2SEB D;  3ND9 A;  3NE5 B;  1NSN S;  3F2D A;  3EA6 A;  3AU7 A;  4QCL A;  1NJ8 A;  3HOW H;  4OLF A;  3CAM A;  3M7N A;  3CHB D;  2AMC B;  4FDB A;  1D2B A;  1N32 L;  3VR3 A;  1N34 L;  2IHE A;  2DXU A;  2EYM A;  4C1N I;  3KJP A;  3S2H H;  3HOU B;  3K59 A;  4FF4 A;  2MGS A;  2CW0 D;  1IL2 A;  4GKJ L;  1CQF A;  3QTC A;  3J81 c;  1A0I A;  4YRK A;  2D2C C;  1Y8P B;  1NR2 A;  2PNR C;  1CKM A;  4RMF A;  4C3I G;  1NNH A;  4JI0 Q;  3RZO B;  3K57 A;  2ICE C;  2NVQ H;  2VUM H;  2WP8 J;  3VQW A;  2JA7 G;  4ZTU B;  1KRS A;  4A4I A;  5KIX A;  4JYA Q;  4CDC C;  3DWP A;  1I6H B;  2JA5 G;  1NYR A;  3A7U A;  5C6A A;  4KHZ A;  2ZXP A;  1R9T B;  4GN4 B;  1YIT A;  5C0X H;  1Q82 C;  1QNK A;  4PZ6 A;  3I4M G;  1Z9F A;  2E76 C;  5C4X B;  2JE6 I;  1MJE A;  1WPY A;  2EIF A;  2BA0 A;  1LV9 A;  2KQ3 A;  1TY0 A;  3FKI G;  2C9O A;  2NYZ D;  4OO1 G;  4WJW A;  4A3E B;  5ELN A;  1U5K A;  1STA A;  1Q7Y C;  3M85 A;  1LTL A;  3G6E A;  2O5J C;  2E2I B;  4MNO A;  2YYZ A;  2FHT A;  2MO0 A;  3PUX A;  1XX8 A;  1OXV A;  1N33 Q;  4BA1 I;  1SES A;  2HT1 A;  4R4Q A;  4OXP A;  3BVZ A;  4NP5 A;  4XTW A;  4X64 Q;  1PYW D;  3P20 A;  3TEH A;  4O42 A;  4NXN L;  2FMM A;  4XQN A;  1E7Z A;  4JOI A;  1GO3 E;  1L0Y B;  5CV9 A;  3MWY W;  4DR4 L;  1Y1V B;  4A3K B;  2K5V A;  5CGK A;  2WB1 E;  1BOS A;  3N6R A;  4U68 A;  4POF A;  1OTC A;  1S5C D;  4OON A;  3S14 H;  1D5Z C;  3T1Y Q;  2O4X A;  3H0G G;  5C5M A;  2ZZE A;  1AZQ A;  3URY A;  3OMG A;  3CCL A;  4UDU C;  1Q81 C;  1VDZ A;  1D1I A;  3H3V H;  4K8I A;  2BDO A;  3H15 A;  2L12 A;  2BH8 A;  1B3Q A;  2Q8I B;  3TZU A;  2RDG A;  5IOD A;  3QO5 A;  3RL6 A;  4XTX A;  3REX A;  5I6W A;  4A3B H;  5LMN W;  2K04 A;  4APV A;  3HOW G;  2ALY B;  4B3T L;  4R8I A;  3PSI A;  1UEA B;  3ZYY X;  4QB4 A;  4H2S A;  1LT5 D;  5IWA Q;  1B9N A;  3I90 A;  1UE5 A;  1K73 C;  2F0V A;  2NS6 A;  4KLK A;  3CCU A;  1KLG D;  1IZ6 A;  3DWQ A;  3GTG H;  5GRO A;  3FVQ A;  1EIY B;  3M4Y A;  1TWG H;  1G91 A;  4YRF A;  4OEM B;  3HXU A;  4L6T B;  3SK8 A;  2EWN A;  1IBL L;  4LVK A;  2E5L Q;  2QKI C;  4LUV A;  3P8Y A;  1S72 A;  4C3I B;  3CF5 A;  3HKS A;  2Q2U A;  4GZY C;  2EY2 A;  2QIL A;  3FEW X;  5F5W A;  3V7C A;  1USY C;  2EE1 A;  2JA7 B;  4J8Q A;  1PZJ D;  3S1M B;  1IBM Q;  2ZIM A;  2HDM A;  3I4O A;  3I7F A;  1XPU A;  1VQ5 A;  3S16 B;  2JA5 B;  2PNH A;  4XU3 A;  3LX0 A;  4NCX A;  5BR8 Q;  2OF1 A;  1LTA D;  1SNQ A;  4H0L C;  2NN6 G;  1XWE A;  3I4M B;  1YHB A;  3BDO A;  1NY4 A;  3S2D B;  4RG1 A;  2NVT B;  4X62 L;  1SMY C;  1LTT D;  1X9N A;  11AS A;  2EJF C;  1CHQ D;  3MHB A;  3FKI B;  4A3G H;  1T9H A;  5EJW A;  3A7A A;  1B44 D;  4DUZ L;  3V8L A;  4YHH L;  1HJP A;  1K8O A;  3JC6 6;  2IT1 A;  4NXM L;  1BCP D;  1DON A;  5T1I A;  4KN7 C;  2I4M A;  4YRI A;  3PQI A;  3A8I E;  3TP8 A;  1DGS A;  2F0I A;  3HEJ A;  1KRT A;  4YWM A;  1GD7 A;  2AUK A;  3R93 A;  2ZT5 A;  1F9P A;  1HC7 A;  1AH9 A;  1YZ6 A;  2XNA C;  5C5L A;  2VQF Q;  1T5X D;  3J7Y W;  4IPC A;  3RMH A;  3CC7 A;  3PO3 H;  1GVP A;  4GS3 A;  4JI8 Q;  4YY3 Q;  4P75 C;  3NSW A;  4BXX H;  1IW7 D;  1KMN A;  2ART A;  3BG3 A;  4TVA B;  4DV5 L;  3PIP 3;  3QO7 A;  2XRS D;  3E9I A;  1CZG A;  5E4X A;  3H0G B;  4L87 A;  2PME A;  4ZCK A;  3K58 A;  4CJ0 B;  2MHV A;  1BCP C;  4DNR B;  1H4T A;  4OWW B;  1PH3 A;  4G57 A;  3SK6 A;  4JBW A;  1D6E C;  1SSO A;  3HOW B;  4GOP A;  4H44 C;  1RF2 D;  4HJ8 A;  2JP1 A;  2VXW A;  1EEF D;  4RCN A;  3VR6 A;  4DR6 Q;  4WJ3 M;  4RGM A;  3S2H B;  4DNT B;  1O7Y A;  2XN9 C;  4CDD C;  3L2P A;  1W2B A;  3ICE A;  3I56 A;  4OIJ A;  2F03 A;  2Q2H A;  3BU2 A;  4DV1 L;  1EQV A;  5JOB A;  2D0O A;  3S15 B;  4DA2 A;  3Q22 A;  2K33 A;  2ZTC A;  2K01 A;  4FYD A;  3RKX A;  2SDF A;  2VS1 A;  5E3I A;  1NE3 A;  1D1K A;  3ZJY C;  1K9M C;  3K80 C;  3L4G B;  1TVX A;  1Q8K A;  1NCV A;  2QHU A;  2DJZ A;  3M4O H;  1PA6 A;  3U4Z A;  4DV4 L;  2SNM A;  2ZTD A;  4HN7 A;  4R1J A;  2TSS A;  2E2J H;  2ARU A;  3IRB A;  2D0P A;  4ZQ3 A;  1WTH A;  4A93 G;  2RCN A;  2NVX H;  2IX3 A;  1EY4 A;  1OXS C;  1WTW A;  1NMG A;  4N8F A;  2J3L A;  5IYB H;  2A8E A;  2A8V A;  2PMZ E;  3VQV A;  3CCJ A;  2DY7 A;  1H95 A;  2CQA A;  1TKW B;  2PQE A;  5FLX c;  3DLL A;  4RGN A;  1RKN A;  1E1O A;  5AJ3 Q;  4A3G G;  4KJO A;  4R4I A;  2CQO A;  3GTQ H;  2F0E A;  1SXT A;  5EKK A;  4R4C A;  4TSS A;  1IBK Q;  1HR0 Q;  5KEE A;  1SNP A;  4LUO A;  4XQJ A;  5I2X A;  2CFM A;  1VQB A;  4XTV A;  3CMQ A;  2PQA A;  4RAU C;  4WI1 A;  4JI1 Q;  2EAY A;  4P73 C;  4CS4 A;  1F2Z A;  4IJL A;  1TS5 A;  2B2W C;  5GAE C;  2Q2I A;  1NMF A;  3GTP B;  3IL8 A;  4EQ5 A;  1B9M A;  4H2Y A;  3PO3 G;  2R93 H;  1IYV A;  5K1P A;  5M3M G;  4XU0 A;  4EX5 A;  3CU7 A;  4BXX G;  3BYT B;  1PHJ A;  4ZAI A;  2F0N A;  1XJV A;  2X69 A;  1FL0 A;  4FF3 A;  1STY A;  4K2L A;  3PV0 A;  1YJW A;  5A35 A;  2VW9 A;  1WTR A;  1M1K C;  1DJR D;  2QGQ A;  1B1Z A;  4OWX B;  2L15 A;  2K03 A;  4K0K Q;  4HJ9 A;  4TQF A;  4B9X A;  1XTC D;  3DWA A;  1WCM G;  4UY8 C;  1SNO A;  3QG1 A;  4A3C G;  4P74 C;  1ZYR D;  1UE6 A;  1KLU D;  2HCC A;  3KLR A;  2ZT9 C;  4OIK A;  4L63 B;  1FJG Q;  2B8G A;  4KKS A;  3HTZ A;  3CCS A;  3K8A A;  4KN4 C;  1GOZ A;  3KK7 A;  3GTG B;  3UFG A;  2J4X A;  4GKK Q;  1TWG B;  1H9S A;  2QDB A;  1NR4 A;  3NBH A;  4A76 A;  1KC8 C;  2Q2T A;  2K5N A;  2DGY A;  1YI2 A;  3CRL C;  1E2Z A;  4MN3 A;  1G8Z D;  2RDF A;  1QVC A;  1XMO Q;  2EY1 A;  1C8C A;  3HXY A;  2H1E A;  1PYS A;  2EYP A;  2F3V A;  1LAB A;  1RHP A;  4LAA A;  1L1O C;  3S24 A;  1YNX A;  1HNW L;  4A93 B;  1QOH A;  5J1Z A;  1EQT A;  5IYB G;  1VF7 A;  3PUY A;  2KJX A;  3BS1 A;  1NJ1 A;  1VMC A;  4LUZ A;  1J5E Q;  4KY6 A;  3I91 A;  4GN3 B;  3J7Z C;  5EQ0 A;  3GDE A;  3HFZ B;  2M2L A;  1AN8 A;  5C0X J;  3PGZ A;  3VR2 A;  1MBY A;  4HJA A;  4A3G B;  2EVB A;  2PW5 A;  4OGQ C;  4KHP Q;  4YRE A;  1KDA A;  2NZ1 D;  1ATI A;  5LMU Q;  1VMP A;  4LFB Q;  2DU7 A;  2B2V C;  1U9R A;  1PH8 A;  3PMF A;  1D5M C;  3MF1 A;  1Q3L A;  4AIM A;  2ZIO A;  3CMA A;  4ODG A;  2R93 G;  4KR3 A;  2E10 A;  2F0P A;  4ZUI A;  3ND8 A;  3PO3 B;  1EYA A;  1MHW C;  3ULJ A;  3BDL A;  1ZXT A;  5M3M B;  1A3T A;  2NWG A;  3U9S A;  3NEL A;  1OO9 B;  1RDP D;  1GM5 A;  1F2Y A;  1BBX C;  3JAM E;  4R8N A;  1A62 A;  2D5D A;  4M8A A;  1BIB A;  1LT3 D;  2WAQ G;  4JI5 L;  1CK1 A;  2LXK A;  3L9A X;  2WV6 D;  4DR1 Q;  1H4S A;  3C46 A;  1WCM B;  4IFD I;  2A69 D;  2K52 A;  4LF6 L;  1KDC A;  3TRE A;  4F7X A;  1V1Q A;  1HUM A;  4BWA A;  4OO1 I;  1RL2 A;  1PH9 A;  3PCO A;  1VQM A;  4RDX A;  2K1B A;  1K8G A;  3J80 i;  4HID A;  2F52 A;  1TQO A;  1O78 A;  4PMW A;  3RZO H;  1N32 Q;  3HRI A;  1N36 L;  3RKY A;  3A7L A;  1PRT D;  1SE4 A;  1AE2 A;  4HA8 A;  3KF6 B;  5ELE A;  3TUP A;  4GKJ Q;  5EBC A;  4XU2 A;  2RHS B;  4X6A H;  1F77 A;  1PFN A;  3JAM L;  4S3S A;  2Q7G A;  1LT6 D;  3KFU A;  1DOL A;  1EY6 A;  2A69 C;  1QG7 A;  3M4O B;  5LHY 1;  4AQY L;  1LM0 A;  1QVF A;  3HOV H;  2DJF C;  1FNV A;  1PV4 A;  1X01 A;  1QE0 A;  2EYH A;  3K6O A;  4LF4 L;  2UXC L;  5ELC A;  1PTO D;  2I46 A;  4LWC A;  4LJZ C;  2NVX B;  1EY5 A;  4RKL A;  2VB3 X;  2ZJR A;  4KTA A;  4JPB W;  1S5D D;  3I4N G;  2WIN B;  2RCF A;  3D4W A;  4HMJ A;  1A6X A;  3DXJ C;  5COY A;  2UU9 L;  3WDN A;  5LL6 X;  2AWN A;  5JEA H;  1A3U A;  1EWC A;  3TP6 A;  3HY0 A;  2MPM A;  1YEZ A;  3WQZ A;  4A3K H;  2AMC A;  4X3U A;  1HQM C;  1PDQ A;  3IKM B;  3W1B A;  4BY1 H;  2CKZ B;  2A5H A;  3GTJ B;  2Q5H A;  3S1R B;  2CHB D;  2L11 A;  2KCC A;  1J9O A;  3X3N A;  3SHL A;  2EY5 A;  1TS2 A;  2KHJ A;  3CPF A;  4DR5 L;  4NXN Q;  2R93 B;  4DR4 Q;  1SYD A;  4P72 A;  4XT3 B;  3EBE A;  4YRR A;  5HGQ A;  1R4P B;  4Q0F A;  2LXJ A;  3MFY A;  5C0X I;  5LMN Q;  2Z0S A;  1H9K A;  1A63 A;  2ZXO A;  3HG9 A;  2I4N A;  2WAQ B;  2ZT6 A;  1C4Q A;  5D3D A;  4A3D G;  1C0A A;  2Y0S E;  1XNQ L;  1KL9 A;  2Z4I A;  3L2Z A;  4G85 A;  2CWA A;  5IT9 E;  1GJX A;  1X3F A;  3VR4 A;  1CKO A;  1QCB D;  1EYG A;  4IOA A;  4KK7 A;  4JK1 C;  1LTS D;  1U4M A;  5CMD A;  1E1T A;  4CGY B;  2JA7 H;  2BH2 A;  3S1M H;  1BDO A;  3FHW A;  1K8A C;  2JA5 H;  4H2T A;  2HHH Q;  3DSQ A;  1KMM A;  4DUY L;  1SNM A;  2A68 C;  2OT2 A;  3R3O A;  1Y14 B;  4L5Q A;  3J81 E;  2ATW A;  1GKH A;  1WTO A;  3DHQ A;  1N8R C;  1GHK A;  4YRQ A;  3H91 A;  1B7Y B;  1CM9 A;  2YTX A;  5K36 H;  4LFC L;  2LSS A;  4NDX A;  4TRD A;  1VQK A;  3HOV G;  3FKI H;  1A2U A;  3D8G A;  1ENF A;  2NTS A;  4RGT A;  3ERQ A;  4OL7 A;  2IX0 A;  5IT9 L;  4DXG A;  1ROD A;  1U4R A;  1HCZ A;  2F0M A;  2I07 B;  2I0Q A;  3IKL A;  2FYK A;  3LSQ A;  3TN2 A;  4R4O A;  3H3V I;  4DR3 L;  3PUW A;  3V8J A;  3V2T A;  5FK9 C;  4B3R L;  1NJI C;  1LTG D;  2GN5 A;  3QR8 A;  4CH6 A;  2E2D C;  3AMU A;  1EY9 A;  4X62 Q;  3I4N B;  3VA7 A;  1G2S A;  4XU1 A;  1JJC B;  4FVM A;  5C3W A;  5JEA G;  4DUZ Q;  3TQY A;  2ALY A;  4CH5 A;  5C44 G;  1BBW A;  4YHH Q;  3J81 L;  4A3K G;  3S9W A;  3MAQ A;  1WTV A;  2DQ3 A;  2K28 A;  4BY1 G;  1JOO A;  4NXM Q;  3C1F A;  1EYD A;  1EIG A;  2C8M A;  3QO8 A;  1HZA A;  3TS0 A;  1EIY A;  1JWM D;  1SEB D;  1J5W A;  4A3J H;  1HPC A;  4POG A;  4JOI C;  2AQ3 B;  3Q23 A;  2N88 A;  3L7Z C;  5CV7 A;  4CJ2 C;  4IUU A;  1SJH D;  4XYQ A;  1L1O B;  1FGB D;  2R61 A;  3V05 A;  1S3O A;  2Q5I A;  3GP7 A;  2Q8T A;  2B2Y A;  2ZM6 L;  4DV5 Q;  1BO0 A;  1R4Q B;  3AFP A;  3R2T A;  3ERO A;  1KDB A;  4HWO A;  1EL0 A;  1DOK A;  4FNF A;  4JC0 A;  1O7L A;  4X5O A;  2LKV A;  3OWE B;  2Z9H A;  4DV7 L;  4TWA A;  1DZ1 A;  3I8Z A;  4A3D B;  2CJ9 A;  1PZK D;  3FJP A;  3MXN B;  2DEQ A;  3S15 H;  2NBF A;  5DNF A;  5I9P A;  5JJZ A;  4XYO A;  5J22 A;  3STB D;  1JJ2 A;  5DAU A;  4EQO A;  3J7A 5;  4UPA A;  3QWN A;  2RSO A;  3VA5 A;  1PLF A;  2WKC A;  4KD3 A;  2R7Z H;  4DV1 Q;  1VQZ A;  1MJC A;  1X55 A;  1M90 C;  1E3P A;  3CXC A;  1PXU A;  2EDG A;  5K36 G;  2NN6 H;  3D0F A;  4JI3 L;  1XNR Q;  2ENB A;  4QF4 A;  1SR3 A;  1W6K A;  3OTO L;  1IL8 A;  2CW0 C;  1XPO A;  4DV4 Q;  3HOV B;  2QA4 A;  4TVA A;  2L0C A;  4YRG A;  2KUM A;  1SYF A;  2DNE A;  1GGM A;  1UEB A;  5M9O A;  3J7A V;  3OYY A;  1A8V A;  4IJH A;  3STB C;  2EJG A;  1EIH A;  1JQY D;  4DV3 L;  3NPP A;  3SDZ A;  4IQZ A;  3QJY A;  4DV6 L;  1NYQ A;  1NUC A;  2ZNI A;  4JI6 L;  3KF8 B;  1XMQ Q;  2QF7 A;  3PIO 3;  5CC4 A;  3GTP H;  4E51 A;  3RR5 A;  1JB3 A;  4YRL A;  1PH2 A;  2J7Z A;  1LO5 D;  5C44 B;  4HTH A;  3G4S A;  4DK6 C;  1BCP F;  2X6L A;  3TBI B;  1KTK A;  3QIA A;  4BY1 B;  1IXR A;  2EZV A;  1KAW A;  3OW2 A;  3BVG A;  1MI2 A;  4A3J G;  3RGL A;  1DM0 B;  2PPB C;  3E5S A;  4XTZ A;  4YRJ A;  2EPB A;  1T5E A;  2OXP A;  3MTS A;  1SYE A;  2XSC A;  5KND A;  4LFA L;  1QB5 D;  1CHP D;  1TU2 B;  4ID6 A;  3L4G A;  4Y7N H;  4IUV A;  2G4C A;  2ZZF A;  1UE1 A;  1X2G A;  4ABN A;  3GQB A;  3HP3 A;  1TWF H;  1VQD A;  4DQ2 A;  4DAP A;  1WYD A;  5JJK A;  1WU7 A;  1I5F A;  4FXG C;  4IUN A;  4ILW A;  1B4O A;  5E1F A;  4DGZ A;  4LF5 L;  1CA5 A;  3A7R A;  3SE0 A;  3I55 A;  5JPM C;  1DXM A;  1SE2 A;  4DAY B;  3HOX G;  4QQB X;  1I4R A;  3MQZ A;  4UHV A;  1ZEQ X;  2ZXR A;  2ZR2 A;  1WLE A;  5IP7 H;  2F4V L;  3G1Z A;  1O7I A;  2QHT A;  1KHI A;  2EYO A;  4LW1 A;  4E6I A;  2R7Z G;  3TRZ A;  4FXD A;  4K5X A;  1SET A;  4L8J A;  2LFN A;  2PO4 A;  4K2K A;  4A93 H;  3DM3 A;  1PH6 A;  3BFM A;  3W3A A;  1JE4 A;  1QUQ B;  2IL8 A;  3ULL A;  5KGU A;  3T1H L;  2VB2 X;  4LMQ D;  3A56 A;  3SEB A;  4YCV A;  4JI7 L;  1AW7 A;  3NXW A;  2K4K A;  4IPG A;  2V1C C;  4J15 A;  4HIM A;  1HFN A;  1YJ9 A;  4GNX B;  4HJ5 A;  2A19 A;  1ET6 A;  1HNZ Q;  1I4H A;  5EKL A;  1HA6 A;  4IUR A;  1ILP A;  2R92 B;  5ELB A;  4LF7 L;  4YRC A;  4K6L A;  3T51 B;  1HNW Q;  3NTI A;  4P71 C;  4MHE A;  1PFB A;  2G9H D;  1MSG A;  2XRQ D;  1QZH A;  1KXL A;  2Q7E A;  5IOC A;  5KNN A;  3HGB A;  2E8G A;  2MNA A;  5FLX E;  5M5X H;  1TR5 A;  2PZT A;  3R07 A;  1E22 A;  2K5D A;  5EPK A;  5CV4 A;  4H2X B;  1WFQ A;  5M3M H;  1Q12 A;  1WNL A;  2DZC A;  1I4P A;  3E6Z X;  1BF4 A;  4JVZ A;  5G3L D;  1I4G A;  2BE5 D;  5JEA J;  1QIL A;  3G6J B;  3BZC A;  1Y1W G;  4A3J B;  2IPK D;  2HUG A;  4WFN 3;  2I4L A;  1UUP A;  3DMU A;  1SLJ A;  4EQN A;  1JIC A;  1U4L A;  3CQZ H;  2FMC A;  1TWC H;  4IAL A;  2F0H A;  4HWT A;  4FO2 A;  5HUR A;  1WCM H;  1BNZ A;  3GTO H;  2MUY A;  2PCF B;  1SBB B;  4A3C H;  1C7Y A;  1B50 A;  2JXM B;  5FLX L;  4X65 Q;  1EEI D;  3A8J E;  4HCS A;  4PQX A;  4A3I G;  2HNI A;  3Q0A A;  2B2U A;  2ZJP A;  2RVL A;  4JI5 Q;  3D6W A;  1IW7 C;  5C3E G;  3VR5 A;  2DDZ A;  4LF6 Q;  3RN5 A;  2JN4 A;  1ASY A;  3NET A;  3HOX B;  2PZW A;  4LF8 Q;  4JBJ A;  4MTK A;  1N36 Q;  4ME5 A;  4I7A A;  4YIJ A;  4JI0 L;  5IP7 G;  3K5L A;  2MQH A;  1YJN A;  1JJG A;  5IE8 A;  3DM1 A;  2A1A A;  4KQE A;  3G7L A;  1M4V A;  1FYF A;  1HTL D;  2R7Z B;  1NNX A;  1X65 A;  2ES2 A;  1SER A;  2E1H A;  1VQJ A;  4BBS H;  1NJ5 A;  2ZIN A;  1X3Q A;  1I4Q A;  4AYB G;  4WF2 A;  1B70 B;  3NTK A;  4CS2 A;  2E74 C;  12AS A;  1VQN A;  1EFI D;  3HXZ A;  4PMB A;  3TDQ A;  3UDI A;  4AQY Q;  4YWK A;  4EO4 A;  1G6P A;  2D62 A;  2O2L D;  3QO2 A;  4LF4 Q;  2A74 C;  2UXC Q;  2K50 A;  4KKU A;  3CC4 A;  3L3O C;  3M9B A;  3DEO A;  3GTJ H;  2LMC B;  5C52 B;  3KOJ A;  2WAQ E;  1JWU D;  1ENC A;  4BY7 G;  3S1R H;  1Q86 C;  2OTL A;  3IAY A;  5HY6 A;  5E3F A;  1Y8N B;  3D31 A;  2SNS A;  2CIM A;  1MGS A;  2UU9 Q;  2VL6 A;  2X6G A;  4KY5 A;  1HUN A;  1BIA A;  2E41 A;  2K05 A;  1JT8 A;  1AE3 A;  2B39 A;  4RCO A;  4DU9 A;  1SRO A;  2QW7 A;  3GD7 A;  4QL5 A;  4LF9 Q;  1ICW A;  3KBG A;  1II3 A;  4P75 A;  3KF6 A;  2RHQ B;  3T13 A;  1Y1W B;  2R6G A;  3OMC A;  1VQ9 A;  1YFT A;  2RHS A;  4DR5 Q;  4DAM A;  4Q6G A;  2K32 A;  4XIG S;  5A2Q E;  4H02 A;  4GLX A;  2L5T A;  4CDF C;  4Y7N B;  2NZH A;  4PG3 A;  1STG A;  3E9H A;  1N9W A;  4GLA C;  3MF2 A;  1AP0 A;  1TWF B;  5JPN C;  4Q15 A;  2NTT A;  4H2W A;  4A3I B;  5DM6 3;  5JAV A;  3S1Q H;  2KCT A;  4OWT B;  4KHV A;  1SFO B;  4XTY A;  5KYL A;  5C3E B;  1XNQ Q;  1X3G A;  4CKB A;  1HZ9 A;  2N55 A;  4KI0 A;  2Z4H A;  1XTD A;  3MFG A;  1PH5 A;  5COR A;  2E5L L;  1VQO A;  1DD2 A;  5A2Q L;  4P3N A;  1ZYR C;  2C7I A;  5EBD A;  3PIP A;  3CP0 A;  4DR2 L;  1TS3 A;  4NKL A;  2H5X A;  2HDL A;  1VQE A;  4DR7 L;  5ELO A;  4DUY Q;  4CKE A;  3R2I A;  1SDF A;  3UDG A;  4BBS G;  3OOC A;  4K5V A;  5CBA E;  3JAM i;  2Q7H A;  5DLQ E;  2SOB A;  4BBR H;  1K0S A;  3CC2 A;  4LNQ A;  3S1N B;  3I4N H;  3V7R A;  4AYB B;  4LFC Q;  2F0Q A;  4FF1 A;  1NTG A;  1UAP A;  1JOQ A;  1I94 L;  5I6Y A;  3RIR A;  5L37 A;  4ZIB A;  1RCV D;  1CA6 A;  4DR3 Q;  4G4K A;  1VQI A;  1WOC A;  1KAA A;  1K8M A;  2BA1 A;  2YTV A;  4B3R Q;  4U67 3;  4UP8 A;  2B63 H;  4C1N K;  4R9W A;  1O80 A;  4BY7 B;  5NUC A;  3ICA A;  5M5X B;  1VS0 A;  2DJG C;  1ILQ A;  1KNE A;  3FDT A;  4DK3 C;  1CKN B;  2JA9 A;  4DV2 L;  4M1U B;  4ZYS A;  2B2W A;  1YBY A;  2VQF L;  2ODR D;  2JEA I;  3K5M A;  1X2H A;  4HWS A;  2N49 A;  4RGO S;  1MD2 D;  1BKB A;  1VQA A;  2IY5 B;  2F0L A;  2JQO A;  2WFW A;  2PYK A;  1PH7 A;  4P72 C;  1VF5 C;  1BQQ T;  1Z47 A;  3CQZ B;  3E0J A;  3RNU A;  1ASZ A;  1RD9 D;  1TWC B;  1EYC A;  2UXB L;  1B7Y A;  4HSV A;  4K14 A;  4A3D H;  1NJ2 A;  3GTO B;  2E3C A;  3F2U A;  1D5X C;  1QF6 A;  1QVG A;  2KED A;  2ZM6 Q;  1WD1 A;  3S17 H;  1P8L A;  5KYI A;  4H7B A;  3OSO A;  2CGH A;  4LVL A;  4HCE A;  3NEN A;  1X3P A;  4RKB A;  2KVM A;  3CCQ A;  5IP9 G;  1N34 Q;  1SE3 A;  1B2T A;  1EWI A;  3A54 A;  4J1M A;  2ODR C;  4ZKB B;  4DV7 Q;  2EJM A;  4TKO B;  2B2T C;  1H4Q A;  4G7H C;  3D3R A;  1FGU A;  4CH3 A;  1EUJ A;  5ELF A;  2EYJ A;  4PZ7 A;  1VQP A;  3OIQ A;  2IWH A;  4UP9 A;  3MEF A;  4IZ8 A;  1JJC A;  1TWH B;  3VQY A;  5CV8 A;  1E2V A;  3EQL C;  3FPP A;  1K28 A;  2G5D A;  5BN5 A;  5KNB A;  1HNX L;  4IUT A;  1UWV A;  1YVC A;  4DV0 L;  3U50 C;  1BCP B;  3RF1 A; 
#chains in the Genus database with same CATH homology
 1VQL A;  2KCM A;  2AKW B;  4BBR G;  4JI3 Q;  3GTK H;  1L1O A;  2I4O A;  4A3M H;  3OTO Q;  1EFW A;  4JBK A;  1YHQ A;  4NB3 A;  4ALP A;  5C44 H;  3LGJ A;  2UUB L;  4P3P A;  5GAG C;  5JJI A;  2ZZG A;  4DV3 Q;  1HR0 L;  1PFS A;  2B63 G;  4DV6 Q;  3IG2 A;  4JI6 Q;  2ZNJ A;  1TXY A;  3A5U A;  4JI2 L;  3M3Y H;  4TVW A;  1VCI A;  3BZK A;  1YB3 A;  3J81 i;  3HOY G;  4H2V A;  1EIF A;  1VQ6 A;  5M3F H;  3A5Z B;  4CS3 A;  3PUV A;  1P16 A;  4YRS A;  1SE8 A;  1G5I A;  2NN6 I;  4LFA Q;  3RLF A;  2AWO A;  4K88 A;  2YTY A;  4K86 A;  4B3T Q;  2UUC L;  3AFQ A;  1YIJ A;  1FJG L;  1K3R A;  1QZG A;  1WJJ A;  1X3E A;  1I3Q H;  4LF5 Q;  3P8T A;  3UDF A;  1IBL Q;  4OX9 L;  2OCE A;  4JCV E;  3CCM A;  1I50 H;  1KD1 C;  4O0A A;  1PVO A;  1EVL A;  2ZT8 A;  2F4V Q;  3KDF B;  4PHC A;  2R92 H;  2JEB I;  2KHI A;  2N8N A;  4OP0 A;  4JI4 L;  3T1H Q;  4A3M G;  4JI7 Q;  1J5E L;  2DVE A;  1YFR A;  2N78 A;  3J80 c;  3HXW A;  1TWA H;  4LF7 Q;  1D8L A;  2XTI A;  3CW2 C;  2CJA A;  4L5S A;  4IPH A;  1Z7M A;  4UP7 A;  1JMC A;  4IO9 A;  4YRT A;  2F3I A;  2DU5 A;  5M3F G;  3CCE A;  4QGU A;  4L5R C;  2YV5 A;  3A0J A;  1S40 A;  2ZTE A;  3CCR A;  1QUQ A;  4C3J H;  2ASB A;  3HOX H;  2NVY H;  4TVY A;  4GNX A;  1WQ7 A;  2DQ0 A;  4XTU A;  4A75 A;  1VQG A;  2GVB A;  1YGB A;  5FJ8 G;  4H2X A;  1SRU A;  3G71 A;  5IYD G;  2DKG A;  2R92 G;  2K14 A;  2R7D A;  2FXQ A;  2ID0 A;  4KR2 A;  3ERR A;  2Y0S G;  3PO2 H;  4IFD G;  2VQE L;  1RIQ A;  5J3B A;  3HKZ G;  3RAC A;  3KYH C;  4X66 L;  4XEO A;  4YYE A;  4RQF A;  3UH0 A;  4TTV A;  4LVI A;  1SN8 A;  4L5T A;  4C3H H;  1WQW A;  1Y1W H;  1ADY A;  1X6O A;  3PF5 A;  4GLV B;  2I5H A;  1WI5 A;  1YHA A;  3HRK A;  2Z6K A;  3W1G A;  2OQK A;  4LNS A;  1PYB A;  4YWL A;  4YP0 A;  4B3M L;  5E7N A;  1NJ6 A;  1X54 A;  1B76 A;  4A3I H;  3UDX A;  2K75 A;  4Y52 H;  5LMN L;  4JV5 L;  1U0L A;  2UUA L;  1SFO H;  5C3E H;  2ZR3 A;  4AYB E;  1B70 A;  2YU9 H;  4MZ9 A;  4GOP C;  4NPS A;  2PI2 E;  2JA6 H;  3HOZ H;  1C9O A;  4QJF A;  1B8A A;  3LSS A;  2JJQ A;  1HXD A;  3BJU A;  1K0R A;  2HHH L;  4K87 A;  3V7S A;  1PH1 A;  1V43 A;  3K81 C;  3S1N H;  3W3S A;  1Q1E A;  4HIO A;  2VUM G;  4DR2 Q;  1VQ7 A;  3TS2 A;  4B3S L;  2IX1 A;  4DR7 Q;  2RHQ A;  2KBN A;  2I5M X;  4XTC S;  1L0W A;  5C0X G;  3F1Z A;  4YCW A;  5IY0 A;  3PO2 G;  4BY7 H;  1I94 Q;  2EXD A;  4CH4 A;  2E64 A;  3GO5 A;  4A3L H;  4JG2 A;  3EIV A;  3EN2 A;  3V8K A;  2B3G A;  4DV2 Q;  2UXD L;  1CUK A;  4DPG A;  3GTM H;  1G51 A;  3RLN A;  3AEV A;  3G48 A;  3NEM A;  2AHO B;  3FP9 A;  3RUX A;  2ZJQ A;  2UXB Q;  2OWO A;  2HIX A;  3PIO A;  2HQL A;  1Q1B A;  3HFZ A;  4A3B G;  1TWH H;  1Q46 A;  3U4V A;  3TEH B;  2JA6 G;  2PI2 A;  4YCU A;  3HOZ G;  1BVS A;  2WB1 G;  1VQF A;  4JBM A;  4P3O A;  3J81 j;  4WJ4 A;  4YRN A;  1VQC A;  4JYA L;  1HH2 P;  4GN5 A;  3ERS X;  1USY A;  3HY1 A;  2VNU D;  1CKN A;  5K1X A;  1RIP A;  3L1A A;  4HIK A;  1XNR L;  1HNX Q;  4DV0 Q;  4BW9 A;  5H1S E;  2IY5 A;  2EJF A;  4YRP A;  2K5H A;  2OTJ A;  3K7U C;  1J6Q A;  1N33 L;  3KLW A;  2JK8 A;  4P71 A;  3ULP A;  1XMQ L;  4X64 L;  3L0O A;  5GAD C;  2UUB Q;  4IFD J;  4TQU S;  4DKA C;  1VQH A;  4A3L G;  3T1Y L;  3K0X A;  4JI2 Q;  4YPF A;  2JA8 H;  2EJ9 A;  2VZA A;  2ZGW A;  2QHS A;  4XEM A;  1KOG A;  4G84 A;  5IP9 H;  2E2H H;  4HWR A;  2AKW A;  5IWA L;  1EOV A;  3RZD H;  4O2D A;  4R4T A;  2UUC Q;  4YDQ A;  3SGI A;  3M4P A;  4A3F H;  2C35 B;  5FLM H;  1EQR A;  3K7A H;  2IHF A;  1IBM L;  3REU A;  4OX9 Q;  5BR8 L;  2RF4 A;  1XPR A;  4TQD A;  3A5Z A;  3IAL A;  3EFS A;  1IYJ B;  1G5H A;  1HNZ L;  4GOP B;  3MEY A;  2KEN A;  1VQ4 A;  4JI4 Q;  1LUZ A;  1FVI A;  2QHV A;  3M4Q A;  2XGT A;  3F2B A;  2ZT7 A;  3PUZ A;  4P73 A;  3HOY H;  3VDY A;  3HXV A;  4JI8 L;  4YY3 L;  5M5Y H;  3I2Z A;  4YRM A;  4LVJ A;  5C4J H;  3UGQ A;  5GAH C;  4MTN A;  2JA8 G;  4HJ7 A;  3CPW A;  2ARS A;  3HXX A;  1CSP A;  3WWV A;  3CD6 A;  3OD1 A;  1BBU A;  1HTT A;  4QY7 A;  1X56 A;  3KDF A;  3AQQ A;  5EAY A;  4P74 A;  5C53 B;  3QNE A;  1CSQ A;  1UE7 A;  4X65 L;  5JJL A;  2ZCE A;  4HWP A;  2CCZ A;  2CJB A;  4DR6 L;  2CWP A;  3HOU H;  2PQA B;  1HZB A;  3RN2 A;  4BA2 I;  3CME A;  1H4V B;  2DUD A;  4A3F G;  1E24 A;  4LF8 L;  5FLM G;  1NBW A;  4PZ8 A;  2P0L A;  2HIV A;  1JE5 A;  1I6H H;  2P5I A;  1R9T H;  3GTL H;  2EQS A;  5C4X H;  3U58 A;  3UE1 A;  2DXT A;  5AJ3 L;  4A3E H;  1LYL A;  2E2I H;  3VQX A;  1MKH A;  4IPD A;  3UE0 A;  1IBK L;  4RQE A;  3A5Y A;  2GVA A;  2MFI A;  4JI1 L;  5IYC H;  2VQE Q;  3NBH B;  4IOC A;  3A31 A;  4YRO A;  3P8V A;  2QEX A;  4X66 Q;  1HR0 W;  1OXU A;  1OXT A;  1D7Q A;  4AH6 A;  1Y1V H;  3RLO A;  1K83 H;  1OXX K;  3VBB A;  1Z7N A;  3ER0 A;  1PYS B;  2E5A A;  3EFR A;  2DTH A;  2ZXF A;  5GQO A;  4LF9 L;  1EQQ A;  3A74 A;  3JAM c;  2PMF A;  3TEG A;  2N3S A;  1SRY A;  2I5L X;  4K0K L;  1L2F A;  3RKW A;  2B29 A;  1HZC A;  1W66 A;  4DNI A;  4B3M Q;  2E65 A;  1ADJ A;  2VY3 A;  4JV5 Q;  2UUA Q;  4LVM A;  4C2M H;  3HOU G;  3F2C A;  5FJ8 H;  4GKK L;  4HVC A;  4GNX C;  3LC0 A;  3AYH B;  4QIW E;  3CCV A;  1W3S A;  3HKZ E;  4C3I H;  1XMO L;  3F8T A;  1EVK A;  5IYD H;  1YFS A;  3KJO A;  3W5O A;  3S16 H;  3A32 A;  1VQ8 A;  3PZC A;  5C4X G;  2OQ0 A;  2NZO A;  1KIX A;  3I4M H;  2DZ9 A;  2NVT H;  3S2D H;  1MIU A;  1V9P A;  2EL9 A;  4B3S Q;  3PCO B;  4A3E G;  2DTI A;  2R7F A;  3Q8D A;  4KHP L;  1G29 1;  5LMU L;  2DTO A;  4LFB L;  5IYC G;  4ME3 A;  3PF4 A;  4ZTZ B;  2ZTG A;  1Y1V G;  3E0E A;  2J3M A;  2MO1 A;  3B6Y A;  1JB7 A;  2Z6K C;  4HT4 A;  3H0G H;  5M5W H;  5C51 B;  1PH4 A;  4H2U A;  2UXD Q;  1SMX A;  4DR1 L;  3UGT A;  3HFV A;  5IT9 c;  1KQS A;  3F2D A;  4OLF A;  1NJ8 A;  3HOW H;  3CAM A;  3M7N A;  2AMC B;  4FDB A;  1N32 L;  2DXU A;  1N34 L;  2IHE A;  3KJP A;  3S2H H;  1IL2 A;  4GKJ L;  3QTC A;  3J81 c;  1A0I A;  4YRK A;  1CKM A;  4RMF A;  1NNH A;  4JI0 Q;  2NVQ H;  2VUM H;  2WP8 J;  3VQW A;  2JA7 G;  4ZTU B;  1KRS A;  4A4I A;  4JYA Q;  2JA5 G;  1NYR A;  3A7U A;  4KHZ A;  4GN4 B;  1YIT A;  1Q82 C;  4PZ6 A;  3I4M G;  1Z9F A;  2JE6 I;  1MJE A;  1WPY A;  2EIF A;  2BA0 A;  3FKI G;  4OO1 G;  5ELN A;  1U5K A;  1Q7Y C;  3M85 A;  1LTL A;  3G6E A;  4MNO A;  2YYZ A;  2MO0 A;  3PUX A;  1OXV A;  1N33 Q;  4BA1 I;  1SES A;  2HT1 A;  4R4Q A;  4OXP A;  4XTW A;  4X64 Q;  3TEH A;  4NXN L;  1E7Z A;  4JOI A;  1GO3 E;  4DR4 L;  2K5V A;  2WB1 E;  4POF A;  1OTC A;  4OON A;  3S14 H;  3T1Y Q;  3H0G G;  2ZZE A;  3CCL A;  1Q81 C;  3H3V H;  3H15 A;  2BH8 A;  3RL6 A;  3QO5 A;  4XTX A;  3REX A;  4A3B H;  5LMN W;  4APV A;  3HOW G;  2ALY B;  4B3T L;  3PSI A;  4H2S A;  5IWA Q;  2NS6 A;  1UE5 A;  1K73 C;  4KLK A;  3CCU A;  3GTG H;  1IZ6 A;  5GRO A;  1EIY B;  1TWG H;  4YRF A;  3HXU A;  2EWN A;  1IBL L;  4LVK A;  2E5L Q;  4LUV A;  3P8Y A;  1S72 A;  3CF5 A;  3HKS A;  2Q2U A;  5F5W A;  3V7C A;  1USY C;  2ZIM A;  1IBM Q;  3I4O A;  3I7F A;  1XPU A;  1VQ5 A;  2PNH A;  4XU3 A;  4NCX A;  5BR8 Q;  2NN6 G;  1YHB A;  1NY4 A;  4RG1 A;  4X62 L;  1X9N A;  11AS A;  3A7A A;  4A3G H;  1T9H A;  4DUZ L;  3V8L A;  4YHH L;  1HJP A;  3JC6 6;  2IT1 A;  4NXM L;  2I4M A;  4YRI A;  1DGS A;  1KRT A;  4YWM A;  1GD7 A;  2ZT5 A;  1HC7 A;  1AH9 A;  1YZ6 A;  2VQF Q;  3CC7 A;  4IPC A;  3PO3 H;  1GVP A;  4GS3 A;  4JI8 Q;  4YY3 Q;  4P75 C;  4BXX H;  1KMN A;  2ART A;  4TVA B;  4DV5 L;  3QO7 A;  3E9I A;  4L87 A;  2PME A;  1H4T A;  4OWW B;  1PH3 A;  4JBW A;  4GOP A;  4HJ8 A;  4DR6 Q;  4WJ3 M;  3L2P A;  1W2B A;  3ICE A;  3I56 A;  2Q2H A;  3BU2 A;  4DV1 L;  2D0O A;  2ZTC A;  3RKX A;  5E3I A;  2VS1 A;  1NE3 A;  3ZJY C;  1K9M C;  3K80 C;  3L4G B;  1Q8K A;  2QHU A;  2DJZ A;  3M4O H;  1PA6 A;  3U4Z A;  4DV4 L;  2ZTD A;  4R1J A;  2E2J H;  2ARU A;  3IRB A;  2D0P A;  4A93 G;  2RCN A;  2NVX H;  1OXS C;  1NMG A;  2J3L A;  5IYB H;  2A8E A;  2A8V A;  2PMZ E;  3VQV A;  3CCJ A;  1H95 A;  5FLX c;  3DLL A;  1E1O A;  5AJ3 Q;  4A3G G;  4R4I A;  2CQO A;  3GTQ H;  4R4C A;  1IBK Q;  1HR0 Q;  4LUO A;  2CFM A;  1VQB A;  4XTV A;  3CMQ A;  2PQA A;  4WI1 A;  4JI1 Q;  2EAY A;  4P73 C;  4CS4 A;  4IJL A;  5GAE C;  2Q2I A;  1NMF A;  4EQ5 A;  4H2Y A;  3PO3 G;  2R93 H;  5K1P A;  5M3M G;  4XU0 A;  4EX5 A;  4BXX G;  1PHJ A;  1XJV A;  1FL0 A;  3PV0 A;  1YJW A;  1M1K C;  2VW9 A;  2QGQ A;  4OWX B;  2L15 A;  4K0K Q;  4HJ9 A;  4TQF A;  1WCM G;  4UY8 C;  4A3C G;  4P74 C;  1UE6 A;  1FJG Q;  3HTZ A;  3CCS A;  3K8A A;  3UFG A;  4GKK Q;  4A76 A;  1KC8 C;  2Q2T A;  2K5N A;  2DGY A;  1YI2 A;  1QVC A;  1XMO Q;  3HXY A;  1PYS A;  1L1O C;  3S24 A;  1YNX A;  1HNW L;  5IYB G;  3PUY A;  1NJ1 A;  4LUZ A;  1J5E Q;  4GN3 B;  3J7Z C;  3GDE A;  3HFZ B;  5C0X J;  3PGZ A;  4HJA A;  4KHP Q;  4YRE A;  1ATI A;  5LMU Q;  4LFB Q;  2DU7 A;  1PH8 A;  3MF1 A;  4AIM A;  2ZIO A;  3CMA A;  2R93 G;  4KR3 A;  2E10 A;  3ULJ A;  3NEL A;  1GM5 A;  1A62 A;  1BIB A;  2WAQ G;  4JI5 L;  2LXK A;  4DR1 Q;  1H4S A;  4IFD I;  2K52 A;  4LF6 L;  3TRE A;  1V1Q A;  4BWA A;  4OO1 I;  1RL2 A;  1PH9 A;  3PCO A;  1VQM A;  4RDX A;  1K8G A;  3J80 i;  4HID A;  2F52 A;  4PMW A;  3RZO H;  1N32 Q;  3HRI A;  1N36 L;  3RKY A;  1AE2 A;  4HA8 A;  3KF6 B;  3TUP A;  4GKJ Q;  4XU2 A;  2RHS B;  4X6A H;  2Q7G A;  3KFU A;  3HOV H;  4AQY L;  1LM0 A;  1QVF A;  1PV4 A;  1X01 A;  1QE0 A;  4LF4 L;  2UXC L;  4LWC A;  2ZJR A;  3I4N G;  2UU9 L;  2AWN A;  3HY0 A;  1YEZ A;  3WQZ A;  4A3K H;  2AMC A;  3IKM B;  3W1B A;  4BY1 H;  2CKZ B;  2Q5H A;  4NXN Q;  2KHJ A;  3CPF A;  4DR5 L;  4DR4 Q;  4P72 A;  4YRR A;  3EBE A;  5HGQ A;  2LXJ A;  5C0X I;  5LMN Q;  2Z0S A;  1A63 A;  2I4N A;  2ZT6 A;  4A3D G;  1C0A A;  2Y0S E;  1XNQ L;  1KL9 A;  3L2Z A;  4G85 A;  2CWA A;  1X3F A;  1CKO A;  1EYG A;  4IOA A;  1E1T A;  2JA7 H;  2BH2 A;  3S1M H;  3FHW A;  1K8A C;  2JA5 H;  4H2T A;  2HHH Q;  3DSQ A;  1KMM A;  4DUY L;  1Y14 B;  4L5Q A;  2ATW A;  1GKH A;  1N8R C;  4YRQ A;  1B7Y B;  2YTX A;  4LFC L;  2LSS A;  3HOV G;  1VQK A;  3FKI H;  2IX0 A;  2I0Q A;  3IKL A;  3LSQ A;  2FYK A;  4R4O A;  3H3V I;  4DR3 L;  3PUW A;  3V8J A;  4B3R L;  1NJI C;  2GN5 A;  4CH6 A;  4X62 Q;  4XU1 A;  1JJC B;  5JEA G;  4DUZ Q;  3TQY A;  2ALY A;  4CH5 A;  5C44 G;  1BBW A;  4YHH Q;  4A3K G;  2DQ3 A;  4BY1 G;  4NXM Q;  3QO8 A;  2C8M A;  1HZA A;  3TS0 A;  1EIY A;  1J5W A;  4A3J H;  4POG A;  4JOI C;  3L7Z C;  1L1O B;  1S3O A;  2Q5I A;  2ZM6 L;  4DV5 Q;  3AFP A;  4HWO A;  4JC0 A;  4X5O A;  4DV7 L;  4TWA A;  2CJ9 A;  3FJP A;  3MXN B;  2DEQ A;  3S15 H;  3STB D;  1JJ2 A;  3J7A 5;  4UPA A;  2R7Z H;  4DV1 Q;  1MJC A;  1X55 A;  1M90 C;  1E3P A;  3CXC A;  5K36 G;  3D0F A;  4JI3 L;  1XNR Q;  1SR3 A;  3OTO L;  1XPO A;  4DV4 Q;  2QA4 A;  4TVA A;  4YRG A;  1GGM A;  1UEB A;  3OYY A;  1A8V A;  4IJH A;  3STB C;  2EJG A;  4DV3 L;  4DV6 L;  1NYQ A;  2ZNI A;  4JI6 L;  3KF8 B;  1XMQ Q;  3GTP H;  4E51 A;  3RR5 A;  4YRL A;  1PH2 A;  3G4S A;  4DK6 C;  1IXR A;  1KAW A;  3OW2 A;  4A3J G;  3RGL A;  4XTZ A;  4YRJ A;  4LFA L;  3L4G A;  4Y7N H;  2G4C A;  2ZZF A;  1UE1 A;  1X2G A;  1TWF H;  1VQD A;  4DQ2 A;  1WYD A;  5JJK A;  1WU7 A;  1I5F A;  4LF5 L;  3A7R A;  3I55 A;  3HOX G;  4DAY B;  4QQB X;  3MQZ A;  2ZR2 A;  1WLE A;  5IP7 H;  2F4V L;  3G1Z A;  2QHT A;  1O7I A;  1KHI A;  4LW1 A;  2R7Z G;  3TRZ A;  1VQZ A;  1SET A;  4A93 H;  3DM3 A;  1PH6 A;  3BFM A;  1QUQ B;  3ULL A;  3T1H L;  4YCV A;  4JI7 L;  2K4K A;  4IPG A;  2V1C C;  4J15 A;  4HIM A;  1YJ9 A;  4GNX B;  4HJ5 A;  2A19 A;  1HNZ Q;  4LF7 L;  4YRC A;  1HNW Q;  4P71 C;  1KXL A;  1QZH A;  2Q7E A;  5KNN A;  2E8G A;  2MNA A;  5M5X H;  3R07 A;  1E22 A;  4H2X B;  1WFQ A;  5M3M H;  1Q12 A;  1WNL A;  2DZC A;  5JEA J;  3BZC A;  1Y1W G;  2I4L A;  1SLJ A;  3CQZ H;  1TWC H;  4HWT A;  1WCM H;  3GTO H;  4A3C H;  1C7Y A;  4X65 Q;  4A3I G;  2HNI A;  2ZJP A;  4JI5 Q;  5C3E G;  2DDZ A;  4LF6 Q;  3RN5 A;  1ASY A;  3NET A;  4LF8 Q;  4JBJ A;  1N36 Q;  4JI0 L;  5IP7 G;  1YJN A;  2MQH A;  1JJG A;  5IE8 A;  2A1A A;  4KQE A;  1FYF A;  2ES2 A;  1X65 A;  1SER A;  2E1H A;  1VQJ A;  4BBS H;  1NJ5 A;  2ZIN A;  4AYB G;  4WF2 A;  1B70 B;  4CS2 A;  12AS A;  1VQN A;  3HXZ A;  4AQY Q;  3UDI A;  4EO4 A;  4YWK A;  1G6P A;  2D62 A;  4LF4 Q;  2UXC Q;  2K50 A;  3CC4 A;  3M9B A;  3GTJ H;  5C52 B;  3KOJ A;  2WAQ E;  4BY7 G;  3S1R H;  1Q86 C;  2OTL A;  5HY6 A;  3D31 A;  2CIM A;  2UU9 Q;  2VL6 A;  1BIA A;  2E41 A;  1JT8 A;  1AE3 A;  1SRO A;  3GD7 A;  4QL5 A;  4LF9 Q;  4P75 A;  3KF6 A;  2RHQ B;  2R6G A;  1VQ9 A;  1YFT A;  2RHS A;  4DR5 Q;  4DAM A;  4Q6G A;  4XIG S;  4H02 A;  4GLX A;  2NZH A;  4PG3 A;  3E9H A;  1N9W A;  4GLA C;  3MF2 A;  4Q15 A;  4H2W A;  3S1Q H;  2KCT A;  4OWT B;  4XTY A;  1XNQ Q;  1X3G A;  1HZ9 A;  4KI0 A;  1XTD A;  1PH5 A;  2E5L L;  1VQO A;  4P3N A;  2C7I A;  3PIP A;  3CP0 A;  4DR2 L;  2H5X A;  1VQE A;  4DR7 L;  5ELO A;  4DUY Q;  3UDG A;  4BBS G;  3JAM i;  2Q7H A;  5DLQ E;  4BBR H;  3CC2 A;  4LNQ A;  3I4N H;  3V7R A;  4LFC Q;  1NTG A;  1I94 L;  3RIR A;  4ZIB A;  4DR3 Q;  1VQI A;  1WOC A;  2BA1 A;  2YTV A;  4B3R Q;  4UP8 A;  2B63 H;  3ICA A;  1VS0 A;  4DK3 C;  1CKN B;  2JA9 A;  4DV2 L;  1YBY A;  2VQF L;  2ODR D;  2JEA I;  1X2H A;  4HWS A;  2N49 A;  1BKB A;  1VQA A;  2IY5 B;  2JQO A;  2WFW A;  1PH7 A;  4P72 C;  1Z47 A;  1ASZ A;  3RNU A;  2UXB L;  1B7Y A;  4A3D H;  1NJ2 A;  2E3C A;  1QF6 A;  1QVG A;  2ZM6 Q;  3S17 H;  1P8L A;  2CGH A;  4LVL A;  3NEN A;  3CCQ A;  5IP9 G;  1N34 Q;  1EWI A;  2ODR C;  4DV7 Q;  1H4Q A;  1FGU A;  4CH3 A;  1EUJ A;  4PZ7 A;  1VQP A;  4UP9 A;  3MEF A;  1JJC A;  3VQY A;  1HNX L;  1UWV A;  1YVC A;  4DV0 L;  3U50 C;  3RF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...