4DPGA

Crystal structure of human lysrs: p38/aimp2 complex i
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
505
structure length
501
Chain Sequence
VDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine--tRNA ligase
publication title Structural Switch of Lysyl-tRNA Synthetase between Translation and Transcription.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/apoptosis
total genus 158
structure length 501
sequence length 505
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dpgA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4dpgA02
4P72A 2DUDA 2JQOA 2PMZE 2RF4A 5C44G 3CMQA 1HR0Q 1EVKA 4A3IH 2L15A 1ASYA 1WNLA 2J3LA 1D7QA 2JEAI 2ZIMA 3HY0A 4JI2Q 5GAGC 4IO9A 4CH5A 2HT1A 3A31A 1PA6A 2A8VA 4DUZL 1I5FA 4DR6Q 4YRMA 1EOVA 2D0PA 1IYJB 1N33L 2JA6H 4BBRH 1SN8A 2CCZA 1P16A 2Q7EA 4YROA 1C0AA 1IBLQ 2UXDL 2CJAA 2ODRC 2NVTH 4EO4A 2Q5HA 3CPFA 1PYBA 1L2FA 4P3NA 5HGQA 2H5XA 2R7DA 5DLQE 4P73A 5AJ3Q 2ZZEA 3AFQA 3REXA 1JJGA 4A3IG 3CCJA 1NYRA 1EWIA 3PUYA 4R4IA 2CJBA 3J80c 1YFTA 4X64L 4L5QA 3HOXH 4YYEA 1CKNA 1K8AC 5IP9G 4JI7L 5IYDH 3H15A 1VQEA 2VZAA 1BKBA 1J5EL 1VQ9A 1GVPA 4DV1L 3ICEA 4H2VA 4YRCA 3M4PA 2JA6G 4BBRG 1YJWA 3CCQA 2E65A 3AQQA 3F1ZA 3HOZH 5FLMG 2DVEA 1VQIA 2IHFA 1N34Q 4IFDJ 3H0GG 3RACA 3PCOA 4A3JH 1XJVA 3RKXA 4KR2A 4K87A 1NJ2A 1E22A 4TVAB 3G4SA 1S3OA 4CS2A 5F5WA 3K81C 3S1NH 4YREA 3HOXG 1N9WA 3J81j 3IKLA 4IPHA 3L2ZA 3K7AH 3TEHB 3I4MH 1NJ8A 3A7UA 3NELA 4HA8A 3I4NG 4GKKL 4YCWA 1EUJA 2E5LQ 4OX9Q 3E0EA 5H1SE 4LFBQ 1X3EA 3HOZG 3HTZA 1E3PA 3MF1A 4HIOA 5K1PA 2WP8J 2DEQA 4PZ7A 3DLLA 3QO7A 4B3TQ 4YHHQ 4DR2L 2E8GA 4PHCA 4JI4Q 1XNRL 2UUAQ 4UP7A 1OXUA 4P71C 1I94L 1NMFA 3PF5A 1XMQQ 2ZTGA 2IX0A 3TEGA 2OTLA 3OTOQ 3V7CA 3CF5A 4HJ5A 1PH2A 4CH6A 3ERRA 4LFCQ 1W66A 1VQHA 4DV3L 3RIRA 3AYHB 4PMWA 2IT1A 3PSIA 3UE0A 5IWAL 2DZCA 5FJ8H 2J3MA 5M5WH 3GD7A 4K0KQ 2KCMA 4DV4L 3UFGA 1H4TA 1BIAA 2ZNJA 3OD1A 1JJCA 2N49A 4K88A 3GTMH 1PH1A 1VS0A 2ARSA 1D8LA 5GAHC 2A19A 3IALA 2EL9A 2DQ3A 4FDBA 3K7UC 1Q12A 1HNZQ 4X66L 3LSQA 4YRKA 2AWNA 4POGA 4DV5L 2NVXH 4DQ2A 4HWOA 3PUVA 3VQYA 4BW9A 2R92G 4GNXB 4CS3A 4WI1A 3W3SA 4QGUA 3I7FA 2CJ9A 1HNXQ 4DV2L 4GN5A 3M3YH 3KF6B 4KHPQ 4XTCS 4HVCA 1XPUA 3IKMB 1UE1A 1YFRA 1KL9A 1X55A 5FJ8G 1JE5A 3FP9A 1XPOA 2VUMH 4AQYL 4OP0A 1QF6A 3RR5A 1M90C 3P8TA 3Q8DA 4DKAC 3HRIA 2VQFL 3STBD 2HHHQ 3RLNA 3UDIA 3CMEA 2JA5H 1SRYA 1Q1EA 1L1OB 3W1BA 3L2PA 4R1JA 3AFPA 4TVWA 3K80C 1FYFA 3W1GA 3T1HQ 4YDQA 1BBUA 4XIGS 2K5VA 4LF7L 1HZ9A 3CCUA 3DSQA 1QE0A 2ZT8A 3F2DA 4JI0Q 3BU2A 1HJPA 3HKZG 4QIWE 1UEBA 2UUCL 1IBKQ 2B3GA 2RCNA 1EIFA 3FJPA 4NCXA 3HOYG 1JT8A 2CQOA 4A76A 5GAEC 1Z7MA 1B70A 4XEMA 1A8VA 4GOPB 2ZM6L 2JA5G 3BZKA 4BXXG 1IBML 1HTTA 4QJFA 1OXVA 2NVYH 2HQLA 2Q2HA 4OWXB 4XTXA 2C7IA 1X2GA 3J7ZC 4YRPA 4XU1A 4ALPA 2CKZB 3CC7A 4YRQA 4B3ML 2DU5A 3DM3A 4BWAA 3JC66 2KHIA 4LF5L 3ZJYC 5HY6A 2PQAA 1MJEA 1N32Q 1K8GA 2QHTA 2OWOA 2LXJA 3A0JA 2JA7G 1IZ6A 4DV7Q 1Z7NA 4LFAQ 3GO5A 5LMNL 1FGUA 2GVAA 3HFZB 4Y7NH 3RZDH 4H2XA 2ES2A 2QHUA 1I3QH 2AHOB 4JBJA 3RNUA 1VQAA 1YI2A 3GTLH 1SETA 2EXDA 4YY3Q 2ZT5A 1N36Q 3W5OA 4DR4Q 4CH3A 4IPDA 3FKIH 2JA8H 3RN2A 3A7RA 2G4CA 2WFWA 2EWNA 1JB7A 1USYC 5C4XG 4XU3A 1IBLL 5C51B 5JJLA 1E1TA 4YWKA 1SERA 4R4CA 1YJNA 3KOJA 4IPGA 1P8LA 5C3EH 1PYSB 1PH5A 4A3FH 3ULLA 1VQ6A 3K0XA 3L4GB 4H2TA 5C52B 1FL0A 3GTQH 3HXWA 1YVCA 4A3GG 1H95A 2ZZGA 4UP8A 1HZAA 5JJIA 2E2HH 2BA1A 3T1YQ 1XTDA 3TQYA 3JAMi 4ME3A 1BBWA 4P71A 4JI5Q 4YRLA 3GDEA 2WB1E 3S2DH 3FKIG 4PZ6A 3IRBA 2N3SA 1B7YA 2VQEL 3PV0A 5BR8Q 4OWTB 4LUZA 4JI3Q 1HZBA 1I50H 1X56A 1SMXA 4DK6C 4HJ8A 3KDFB 1HNWL 1G6PA 4QL5A 5JJKA 2ZCEA 2RHQA 3MF2A 3EFSA 2RHSB 4KLKA 4LF4Q 1QVFA 2ZNIA 4DR1Q 2QA4A 2JJQA 2GN5A 4DV6L 4G84A 1S40A 1XMOL 4DV0L 4B3SL 4IOAA 4P3OA 4GLAC 3RL6A 4JI6Q 3A7AA 1Q46A 1TWCH 1X01A 4JYAL 4ZIBA 4XTWA 1VCIA 4LF6L 1J5WA 2K50A 2VL6A 2UUBL 4TVAA 3PUWA 1ASZA 1OXSC 1VQDA 2AMCB 3PIOA 3I56A 2OTJA 4JV5Q 4XTZA 1NTGA 3GTJH 1VQPA 2EJFA 2DZ9A 4JBKA 4L5RC 2CIMA 2YTYA 1WFQA 2HIVA 1WU7A 4QQBX 1EYGA 4GKJL 1GD7A 3OTOL 4P74C 3CCMA 1YBYA 2IY5A 1PH3A 4A3CH 2ALYB 1K83H 2Y0SG 3RLFA 2C8MA 2IHEA 4EQ5A 3JAMc 4LF8L 2I4OA 5GADC 1UWVA 2JE6I 3S14H 4JI1L 4DR7Q 2Q7HA 3MEYA 3EBEA 3AEVA 4A3LH 2WB1G 4HIMA 2I4LA 1EIYA 1H4VB 2K5HA 4YWMA 1Q7YC 4NXMQ 3HRKA 2OQ0A 4GLVB 1KHIA 3EIVA 4A3MH 3CCRA 1HNXL 3CCVA 4YP0A 2Q7GA 4XU2A 1VQOA 1OTCA 1X2HA 3TS2A 1KD1C 4JOIC 3J81i 1G51A 1O7IA 4HIDA 4LF9L 4E51A 4DK3C 4YRGA 3CD6A 4ZTUB 2KCTA 2I0QA 3SGIA 5IYDG 3CCSA 4A3LG 2EIFA 1U0LA 4A93H 3T1HL 1T9HA 2ZGWA 2NN6G 4L87A 4YRIA 2JA9A 4RG1A 1TWHH 1MKHA 4LNQA 4C3IH 4AYBE 2P0LA 4DUYQ 4J15A 4APVA 4GLXA 3HY1A 3I4OA 2OCEA 1G5IA 4GN4B 2K5NA 3HKZE 2PI2E 2R93H 4A3JG 3M4OH 1USYA 4A4IA 5IE8A 4A3BH 1FVIA 3M85A 1NJ1A 3U4ZA 3UE1A 3TUPA 4YRNA 2ZJPA 3KF8B 4X65Q 4IOCA 1C9OA 3M4QA 4ZTZB 2ZIOA 2VS1A 2EJ9A 4POFA 5JEAG 4DUZQ 2B63H 4JI8L 2YV5A 4DNIA 1N33Q 3ER0A 3I4MG 1PV4A 5M3FH 5KNNA 2Q2UA 3WQZA 1CKNB 1YHAA 2Q5IA 2DJZA 2GVBA 3PZCA 3E9HA 2UXDQ 4TQUS 4TWAA 1Y1VH 1WOCA 3S2HH 1CUKA 4JCVE 4BY7H 3D0FA 3RUXA 2R93G 3UH0A 2F4VL 1N32L 2AWOA 1AE2A 4A3BG 4DV7L 3LGJA 1X65A 4X64Q 1YIJA 4JI7Q 2E41A 3PCOB 2KHJA 5LMNW 1J5EQ 4YCVA 3KYHC 4B3RL 4DR3Q 3J81c 4DV1Q 1PH8A 4A3DH 1KQSA 4RQEA 1BIBA 5C0XG 2PMEA 4G85A 4H2WA 1DGSA 2LXKA 1PH9A 3HOWH 4BBSH 2B29A 5J3BA 1Y1VG 2UXBL 4H2SA 2CWAA 4WF2A 4A75A 4NPSA 4BY7G 1Y14B 3KLWA 3U4VA 4OWWB 3D31A 5IYBH 2AKWA 2ZR2A 4LNSA 3NBHB 4AYBG 3A5ZA 1RIQA 2CFMA 3L0OA 5IP7H 1PH6A 1SE8A 4X5OA 1TXYA 2ATWA 1QZGA 3A74A 3ICAA 3GTOH 3F2BA 2OQKA 3TREA 1TWFH 2UU9L 5LMUL 4R4TA 4X62L 4R4OA 4A3DG 3MEFA 2E3CA 2I5MX 2ODRD 2Q2IA 1NE3A 1WPYA 2DTOA 2ZXFA 4P74A 2VUMG 1X3GA 2HNIA 4BBSG 1X3FA 1A62A 4HIKA 2ASBA 1XNRQ 5IYBG 1JJCB 1XNQL 3FHWA 1GGMA 2MO1A 5GQOA 2DGYA 4OO1G 3LSSA 1VQMA 5IP7G 3NENA 1FJGL 2N78A 4BA2I 4TQFA 4DV3Q 4NXNL 3UDGA 1SRUA 4HJ7A 5IWAQ 3CP0A 2UXCL 2EQSA 4YRJA 4YRSA 3CQZH 4DV4Q 1WLEA 2VW9A 1V1QA 3ULPA 4GNXC 2DXUA 4PG3A 1SFOH 1Q86C 1HR0L 4RMFA 4HJ9A 4O2DA 4CH4A 4YPFA 1N8RC 5M5YH 3HXXA 4JV5L 3I2ZA 3RZOH 3CCLA 2K52A 4JI2L 4X66Q 4JOIA 2BH2A 1G291 3ERSX 4DV5Q 1Q82C 4L5SA 4DR6L 4DAMA 3BFMA 1IXRA 1KRSA 3BZCA 1K73C 3LC0A 4HWTA 4TQDA 3VQVA 4H2UA 1SLJA 1ADJA 1L1OC 1WCMH 3MXNB 2HIXA 3HOVH 3PGZA 4DV2Q 2NN6I 1Y1WH 3TRZA 1NMGA 4JC0A 1H4SA 5K1XA 1J6QA 4P75C 1EVLA 3WWVA 1PH4A 4UPAA 2KBNA 5AJ3L 2Y0SE 3CC4A 3EFRA 2VQFQ 4OONA 3HOUH 2E2IH 1A0IA 3HKSA 5C0XJ 1LTLA 1QUQB 1VQKA 2CGHA 5M3MH 4LF7Q 1B70B 3KJOA 2QHSA 2R7FA 1CSPA 1KMNA 1GM5A 2I4MA 4IFDG 2JA8G 3RLOA 1RIPA 3G48A 2Z0SA 1G5HA 1KRTA 4GOPC 2ZT7A 1VQBA 1RL2A 2R7ZH 1WCMG 1Q8KA 2UUCQ 3PUXA 1KIXA 3QO8A 1N34L 2E2JH 4IPCA 4DAYB 1Z47A 4XTUA 1AE3A 2DXTA 1SROA 2ID0A 5C3EG 2CWPA 4A3FG 4KR3A 1GO3E 2ZM6Q 5ELOA 1AH9A 1KMMA 2PQAB 3H3VH 1VQJA 1IBMQ 1MJCA 3EN2A 3CMAA 2EAYA 3P8VA 5M5XH 2R6GA 3NETA 4YCUA 1ADYA 3UGQA 1NYQA 3G71A 2DU7A 4H2XB 3GTKH 1TWAH 1H4QA 4B3MQ 3V7SA 2E5LL 4OX9L 3S1RH 2YTXA 3REUA 4OLFA 2R7ZG 4LFBL 4DUYL 4LF5Q 4HWPA 5C0XI 2V1CC 1YJ9A 1K9MC 1VQGA 5LMNQ 1VQCA 2YTVA 2K75A 4B3TL 4YHHL 1LYLA 4JBWA 3VDYA 3PO3H 4JI4L 3STBC 4L5TA 2UUAL 3TEHA 2ZJRA 4X65L 4KI0A 5EAYA 5IP9H 1XMQL 2C35B 2YU9H 1KOGA 2Z6KC 4Q15A 4LFCL 3CAMA 5ELNA 4MZ9A 2IX1A 1ATIA 2PI2A 3S15H 1BVSA 1YGBA 4K0KL 1QVGA 3F2CA 1VQZA 5FLMH 2E64A 1VQNA 3I55A 4IJHA 3H0GH 2QGQA 3U50C 2ZINA 1B7YB 3PF4A 2P5IA 3QO5A 1HNZL 3PO3G 3VQWA 2E10A 3S1QH 1CSQA 2RHQB 3S17H 1K3RA 4YRTA 1PFSA 3RKWA 4OO1I 2D0OA 1TWGH 4DR3L 4A3CG 3A32A 3CW2C 3I4NH 5C53B 2VQEQ 1WJJA 4KHPL 1KC8C 2EJGA 4XU0A 2BH8A 1I6HH 2MO0A 4DR5Q 2QHVA 3PUZA 1XPRA 1PHJA 1HNWQ 4YRRA 2HHHL 2ZR3A 1E24A 12ASA 3E9IA 4KQEA 4GNXA 4A3KH 4YWLA 4DV6Q 1SR3A 3KF6A 2JEBI 1VQ4A 1XMOQ 4DV0Q 4B3SQ 5IYCH 1W3SA 4LWCA 2D62A 1X9NA 5C4JH 4JI0L 2FYKA 1KAWA 3KFUA 4LUVA 4JYAQ 2ZZFA 3V8JA 3V8LA 1YITA 2E5AA 4A3MG 1IBKL 4LF6Q 3QTCA 1LM0A 3HXYA 4C3HH 1L1OA 2UUBQ 1WI5A 1OXXK 3U58A 1VQ7A 2IY5B 4JG2A 4TVYA 3BJUA 4P75A 3VBBA 3V7RA 4LW1A 4H02A 3TS0A 1GKHA 1YZ6A 4XEOA 3M7NA 4XTVA 4LUOA 3S24A 11ASA 4A93G 4A3KG 3RN5A 2WAQE 3L1AA 4GKJQ 3OYYA 2R92H 1YEZA 5IYCG 1PH7A 3RKYA 4IFDI 1EIYB 1VQFA 1YHQA 1NNHA 3G1ZA 5FLXc 1YFSA 3VQXA 4GOPA 2K4KA 1K0RA 4LF8Q 4MNOA 4QY7A 3CC2A 4LFAL 5IY0A 1JJ2A 1YNXA 4JI1Q 4CS4A 4MTNA 4DPGA 3CXCA 1EQRA 1EQQA 3PO2H 1HR0W 1EFWA 2B63G 4YY3L 3NEMA 1N36L 5E7NA 4JBMA 4DR4L 2F3IA 5M3FG 3OW2A 1S72A 4P72C 4WJ3M 1WYDA 3ULJA 3J7A5 1IL2A 3HFZA 2ZJQA 2XGTA 1Q81C 1V9PA 1HH2P 2E1HA 3HOYH 3UGTA 1HC7A 2VY3A 2QEXA 4LF9Q 4WJ4A 3V8KA 4RQFA 4BXXH 2I5HA 4X6AH 3T1YL 1NJIC 3PO2G 1V43A 1E1OA 1HXDA 4GKKQ 4BA1I 3H3VI 1JMCA 4JI5L 1CKMA 2BA0A 2Z6KA 3G6EA 4P73C 5BR8L 1W2BA 2ARUA 1PYSA 3HOWG 4JI3L 3S16H 3KJPA 3L4GA 1A63A 1VQ5A 2DQ0A 4DR2Q 2JA7H 2A1AA 1QUQA 2WAQG 2JK8A 2PNHA 4LF4L 2DDZA 4DR1L 1I94Q 1UE5A 4PZ8A 4IJLA 3L7ZC 1KXLA 4C2MH 3K8AA 4HJAA 4JI8Q 4JI6L 4RDXA 3CCEA 1Q1BA 3M9BA 4A3EH 3KDFA 1HZCA 1U5KA 5JEAJ 5C4XH 2RHSA 4NB3A 2DTHA 4GN3B 2F52A 3HXUA 3HXVA 2F4VQ 2DTIA 1VQLA 4BY1H 2LSSA 1WQWA 5GROA 2MNAA 4A3GH 4P3PA 2YYZA 1YHBA 4XTYA 1QZHA 1NY4A 1UE7A 4B3RQ 4UY8C 1X6OA 3GTGH 1LUZA 2AKWB 2ZTCA 4R4QA 3A5UA 3A5ZB 1UE6A 2AMCA 4A3EG 1X54A 4TTVA 4AQYQ 2ZTEA 4AIMA 4C3JH 2UXBQ 4UP9A 1NJ6A 2ZTDA 3R07A 4H2YA 2I5LX 4DR7L 2KENA 1WQ7A 3CPWA 1CKOA 1NJ5A 3HFVA 4BY1G 1M1KC 1VQ8A 1R9TH 4Q6GA 4KHZA 2ALYA 1C7YA 2XTIA 4NXML 3GTPH 1OXTA 2UU9Q 5LMUQ 4X62Q 3HOVG 2K14A 5E3IA 3J80i 1Y1WG 4Y52H 4HWSA 2NZOA 3QNEA 3F8TA 3HXZA 1L0WA 5K36G 5C44H 3B6YA 2Q2TA 1Z9FA 4AH6A 1B8AA 3RF1A 4K86A 3UDFA 4DR5L 3HOUG 1YB3A 2N8NA 2VNUD 4GS3A 4HWRA 1MIUA 3RGLA 2MQHA 1XNQQ 5M3MG 2FXQA 4YRFA 5IT9c 3S1MH 2I4NA 2MFIA 3PIPA 2ZT6A 2DKGA 2PMFA 4EX5A 4OXPA 1FJGQ 2NVQH 4NXNQ 1PVOA 1B76A 3P8YA 1NBWA 2ARTA 2UXCQ 1E7ZA 1SESA 2NZHA 3UDXA 3IG2A 3A5YA 4O0AA 1QVCA
chains in the Genus database with same CATH superfamily
3MHBA 4P72A 2DUDA 2JQOA 2PMZB 2PMZE 2RF4A 5C44G 4HCSA 3CMQA 1HR0Q 1EVKA 4A3IH 1S5CD 2L15A 2Z9HA 1QCBD 4RAUC 1FNVA 3AMUA 1ASYA 4UAIA 4K6DA 1WNLA 2J3LA 5FO9B 1D7QA 2JEAI 2ZIMA 1HQRD 3HOZB 3A7LA 3SK4A 3HY0A 2F0FA 4ME5A 5CYUA 4JI2Q 5GAGC 2J7ZA 2HD3A 4HR7B 3U9OA 4IO9A 4CH5A 2HT1A 3A31A 3TP5A 1PA6A 1BCPD 2A8VA 2F0VA 1I5FA 4DUZL 4DR6Q 4YRMA 2F0TA 4A3JB 1EOVA 2D0PA 1IYJB 1N33L 1JOKA 1IW7D 4Z9CB 2F0SA 2JA6H 2MJ8A 4BBRH 1SN8A 2XIWA 2CCZA 4X3KA 3DM1A 4G7ZC 1P16A 2Q7EA 1JB3A 4YROA 1ENCA 1WTOA 1C0AA 4U673 2VB2X 1BUVT 1D5XC 1IBLQ 2UXDL 2Q8RE 2CJAA 3SR1A 3S1NB 3KF8A 2ODRC 2NVTH 1BCPF 3L3OC 4EO4A 2Q5HA 1TQOA 3CPFA 1A15A 1PYBA 2K6AA 1C8CA 4IURA 1L2FA 4P3NA 5HGQA 2H5XA 4KHVA 2R7DA 5DLQE 1EEID 4P73A 2RSNA 2XSCA 5ELDA 2K5WA 3K7AB 5AJ3Q 2ZZEA 3I4MB 3AFQA 4HTHA 3REXA 1JJGA 4A3IG 3CCJA 1NYRA 2BDNA 3SK6A 1EWIA 3PUYA 4R4IA 1WTXA 1QWYA 2CJBA 1TWHB 3J80c 1YFTA 2F0UA 4X64L 4L5QA 3HOXH 1BNZA 2A6HC 4YYEA 1CKNA 2A5HA 5IP9G 1IYUA 1K8AC 2PYKA 4DGZA 4JI7L 5CV7A 5IYDH 3H15A 1U4MA 1VQEA 2B2WC 2VZAA 1BKBA 1J5EL 4G7OC 1VQ9A 4OHJA 4CGYB 3FPPA 1GVPA 4DV1L 3VR2A 2NN6H 3ICEA 3C1FA 4H2VA 4YRCA 3M4PA 2JA6G 4BBRG 1YJWA 3CCQA 2F3VA 2E65A 2EVBA 4CHTB 3AQQA 3F1ZA 3HOZH 3R3OA 1H9JA 4NDXA 4KY6A 5FLMG 1A3TA 1VQIA 2DVEA 2IHFA 2N55A 1N34Q 4IFDJ 1GUWA 4OIJA 3H0GG 4C1NI 5HURA 3RACA 3PCOA 4A3JH 1XJVA 1PRTC 3RKXA 2QDLA 4KR2A 5ELBA 4K87A 1NJ2A 1E22A 3J81E 4TVAB 3G4SA 1S3OA 3D4WA 3MEHA 2XRSD 4CS2A 5F5WA 5M5WB 3K81C 4HCEA 1I4QA 4ZLTF 1EOTA 4RHRA 2K1BA 1TY2A 3S1NH 4V0BA 5C3XA 4YREA 3HOXG 2R61A 2KOLA 1Z7TA 3GTMB 1N9WA 2AQ1B 1J9OA 3J81j 3CRLC 2FMCA 2B2TA 3IKLA 2NUCA 5CGKA 3N6RA 1NUCA 3E3XA 4IPHA 3L2ZA 3D3RA 1CZGA 3K7AH 3TEHB 3I4MH 4L6TB 1NJ8A 3A7UA 3NELA 4HA8A 3I4NG 3MXUA 4GKKL 4YCWA 3DWAA 1EUJA 2E5LQ 4OX9Q 3E0EA 5H1SE 4KV6A 3E5SA 4LFBQ 1X3EA 3K0YA 4O1NA 3HOZG 3HTZA 1E3PA 3NBHA 1TS3A 3MF1A 2CQAA 1STNA 3I3CA 4HIOA 5K1PA 1XXGA 2WP8J 3CHBD 4WRDA 2DEQA 1B9NA 3HKZB 4PZ7A 3A8IE 3DLLA 1B53A 4MN3A 3EFXD 3QO7A 3R8BA 1BCPB 3TN2A 4B3TQ 4YHHQ 4DR2L 2E8GA 1BF4A 3M3YB 4PHCA 1PFMA 4JI4Q 2AUJD 1XNRL 2EYJA 2F0OA 2UUAQ 2HCIA 4UP7A 1OXUA 4KY7A 4P71C 3D4DA 1SE3A 1I94L 1SBBB 1NMFA 2VUMB 3PF5A 1XMQQ 2ZTGA 2IX0A 1RJTA 2EY1A 1XX8A 2KUMA 3W3AA 2OTLA 2K05A 3MTSA 3TEGA 3OTOQ 4ILWA 4HSPA 5JPMC 3HZXA 1ZYRC 3V7CA 3CF5A 4HJ5A 3OMCA 1PH2A 3IL8A 4CH6A 3ERRA 4LFCQ 1VQHA 1W66A 4DV3L 2JA5B 3RIRA 3AYHB 3FRPB 4PMWA 2IT1A 3PSIA 4ZYSA 1LTGD 4JVZA 1PYWD 3KBXA 1E0BA 3UE0A 5IWAL 4IUNA 5F2DA 2DZCA 1GUNA 5FJ8H 2J3MA 1A3UA 1NAPA 5M5WH 3GD7A 3QOJA 4K0KQ 2KCMA 4DV4L 3UFGA 2B8FA 1H4TA 1BIAA 1I4RA 5ISRA 2ZNJA 1ET9A 3OD1A 1JJCA 5DNFA 2N49A 4K88A 3GTMH 1PH1A 1VS0A 3VYTA 1G6ZA 1D8LA 4JK1C 5ELCA 2ARSA 3ITPA 5GAHC 2A19A 3IALA 2B2VC 2EL9A 2DQ3A 4OEMB 4FDBA 3K7UC 1BO0A 1Q12A 3D6WA 1HNZQ 4X66L 3LSQA 4YRKA 2RCFA 5A2QE 5DAUA 2AWNA 4POGA 4DV5L 2NVXH 4DQ2A 4RKLA 4HWOA 3PUVA 3VQYA 3VR6A 4B08A 4BW9A 3KK7A 2R92G 3FEWX 2M9VA 4GNXB 4CS3A 4KK7A 4WI1A 3W3SA 1RF2D 3I7FA 4QGUA 2CJ9A 1HNXQ 4DV2L 4GN5A 3Q0AA 4XQQA 3M3YH 2QF7A 3KF6B 4KHPQ 4XTCS 4HVCA 1XPUA 3IKMB 1UE1A 5EPKA 1YFRA 4CDFC 1KL9A 2HDMA 1AN8A 1X55A 5FJ8G 1JE5A 3FP9A 4KD4A 1XPOA 2NVYB 2VUMH 1CT1D 1MSHA 4KKTA 4AQYL 4OP0A 2EJFC 1QF6A 3RR5A 1MSGA 2FJ2A 4I65A 1M90C 3P8TA 4CJ1B 2V4DA 3Q8DA 3BZDB 4DKAC 4LK1C 4X3UA 3STBD 2VQFL 3HRIA 2HHHQ 2BOSA 1DJRD 3RLNA 3UDIA 3CMEA 2JA5H 1SRYA 1QJOA 4WFN3 1Q1EA 2L0CA 1PXUA 1L1OB 3W1BA 1FGBD 1W6JA 4R1JA 3L2PA 3AFPA 4TVWA 1PFNA 5I6YA 3K80C 1FYFA 3W1GA 3VA7A 3T1HQ 1MD2D 1BBUA 4YDQA 4N9PA 1EQVA 4XIGS 5DM63 5D14A 2K5VA 2XWJB 1QOHA 4LF7L 1HZ9A 1EY7A 5KYLA 1JWMD 4OO1H 3CCUA 1PZJD 3DSQA 3OWEB 2EYFA 5CV4A 1QE0A 2ZT8A 4CDEC 1F9RA 1I4PA 3F2DA 4JI0Q 3BU2A 3RD4A 1HJPA 3LWEA 1JE4A 3HKZG 4Y7NB 4QIWE 3RZDB 1O7LA 1UEBA 4MTKA 1I3QB 3R93A 1B4OA 1I4XA 1SYBA 1IBKQ 2UUCL 2F0QA 1DYQA 2JP1A 4JPBW 1V1PA 2B3GA 4KTAA 2RCNA 1EIFA 3FJPA 3MXGA 4ZKBB 1YNJC 2RKSA 1SNDA 2PQEA 4NCXA 3HOYG 3BYTB 1S4ZA 1JT8A 2CQOA 5J39A 4A76A 5GAEC 2JA8B 4K14A 1Z7MA 4N9TA 1B70A 4XEMA 1A8VA 2PW5A 4I7AA 1J8IA 3TSSA 4GOPB 4NP5A 1F9PA 2ZM6L 5JPNC 2JA5G 1D5MC 3BZKA 1VF7A 4QCLA 4BXXG 1IBML 2CVRA 1IKLA 2OT2A 2Z1CA 4G4KA 5FLXL 1HTTA 4QJFA 1O78A 3MVVA 1Y8NB 1OXVA 2NVYH 2HQLA 3QG1A 2Q2HA 4OWXB 4XTXA 2C7IA 1X2GA 4K5XA 3J7ZC 3MFYA 4YRPA 5C3EB 4XU1A 4DAYA 2EYPA 4ALPA 2B2WA 4A3FB 2CKZB 4ZUJA 3CC7A 4YRQA 1SSOA 4B3ML 2DU5A 3DM3A 3P1HA 4BWAA 3GTQB 3JC66 2F1MA 2IX3A 1JC7A 3Q23A 2E2HB 2KHIA 4LF5L 4ZCKA 2E76C 5HY6A 1B3AA 3ZJYC 2PQAA 1MJEA 3KLRA 1N32Q 1K8GA 5M5YB 1GUGA 4KJNA 2QHTA 2G9HD 2OWOA 2LXJA 3A0JA 2JA7G 3DEOA 1IZ6A 1RDPD 1Y8OB 1JWUD 3PMFA 4DV7Q 1Z7NA 4LFAQ 3GO5A 5LMNL 1AZPA 3S2DB 1FGUA 5JVG3 2EJMA 2GVAA 1HFNA 3HFZB 4Y7NH 3OWFA 5KYIA 3RZDH 4H2XA 5TSSA 2FINB 3PIO3 2ES2A 2QHUA 1I3QH 2AHOB 3BVMA 4JBJA 3RNUA 1VQAA 1WTRA 3BS1A 1YI2A 3GTLH 2MP1A 4S3SA 3K59A 2BE5C 1D5ZC 1I50B 1IYVA 1SETA 3CU7A 2EXDA 4YY3Q 2ZT5A 2E2JB 1N36Q 3W5OA 4DR4Q 4CH3A 1T5EA 3NWTA 1U4PA 2BCOA 1EEFD 1SMYD 2QILA 4IPDA 3FKIH 2MGSA 2JA8H 3RN2A 3SK8A 5CMDA 2I46A 3A7RA 2G4CA 2F0JA 1O80A 2WFWA 4KJOA 2NYZD 1GHKA 4H13C 2EWNA 1RD9D 1JB7A 1USYC 1D2BA 5C4XG 1FNWA 2P5ZX 5JOBA 4FXKC 2LS01 2C9OA 5C5MA 5FO8B 4XU3A 1IBLL 3OW7A 3H91A 2OXPA 5C51B 3MXPA 5JJLA 1E1TA 1SNQA 4YWKA 1SERA 4R4CA 4B9WA 1YJNA 3KOJA 4IPGA 2RA4A 1P8LA 1LT3D 2TMPA 4ZK9B 1TWCB 5C3EH 2KHSA 2JYOA 1ILPA 1PYSB 1VMPA 1PH5A 2Y0SB 4A3FH 3ULLA 1VQ6A 5FKAC 1PMRA 4LVLA 1HQMC 3LX0A 3K0XA 3L4GB 4H2TA 5C52B 1FL0A 3GTQH 2F0DA 1YVCA 4A3GG 3HXWA 1H95A 4ABNA 2ZZGA 4KKUA 4UP8A 1HZAA 5JJIA 2E2HH 2BA1A 3ZYYX 3T1YQ 2K33A 4EQPA 1XTDA 3TQYA 1H9MA 4XDXA 3JAMi 3A8KE 4IUVA 4ME3A 1BBWA 1STYA 4P71A 1TT2A 1CHQD 3GTJB 4JI5Q 4YRLA 3GDEA 2WB1E 3S2DH 3FKIG 4PZ6A 3IRBA 2N3SA 1B7YA 1K8OA 1UNSA 2VQEL 1JWSD 3PV0A 3C3LA 5BR8Q 4P2CB 2WACA 2JN4A 4OWTB 4LUZA 4JI3Q 1HZBA 4C3JG 2Z6BA 3R2IA 1I50H 1X56A 4BWGB 3SEBA 3BVZA 1SMXA 4DK6C 2YU9B 1LTID 4CKBA 4HJ8A 3KDFB 1HNWL 5EGTA 1G6PA 4QL5A 2F0HA 5JJKA 2ZCEA 2RHQA 3MF2A 3EFSA 2RHSB 4KLKA 4LF4Q 1QVFA 2ZNIA 4DR1Q 5L37A 2QA4A 4ZKCB 1K83B 4L63B 2A6EC 4R9WA 2JJQA 2GN5A 4DV6L 2B2VA 4G84A 4QF4A 2HDLA 1S40A 2OF1A 4CDCC 1XMOL 4DV0L 4B3SL 4IOAA 4P3OA 4GLAC 2A73B 2L4NA 1D1KA 3S14B 3RL6A 2AQ2B 3NTKA 4JI6Q 3A7AA 3HP3A 3NE5B 3WOEA 1Q46A 1TWCH 5ELFA 5EPJA 1X01A 4JYAL 4HAEA 4ZIBA 4XTWA 1VCIA 4MHEA 4LF6L 1J5WA 3VR4A 4CBVA 2DY8A 2K50A 2VL6A 2Z4HA 1JR0D 2UUBL 1PTOC 4TVAA 5DEHA 2H1EA 3PUWA 1NNXA 1ASZA 1OXSC 1VQDA 2AMCB 3FPUB 3PIOA 3I56A 2OTJA 3X3MA 4JV5Q 1BOSA 4DU9A 4XTZA 1NTGA 3GTJH 3QR8A 5C6AA 5LHY1 1VQPA 2EJFA 2DZ9A 4JBKA 4L5RC 4A3MB 2CIMA 1EU3A 2YTYA 1WFQA 1RKNA 2HIVA 2DJGC 5IODA 1WU7A 4QQBX 1LLRD 1BBXC 5BN5A 3I90A 1PZID 1EYGA 2PZUA 4GKJL 2K5DA 1ESFA 1GD7A 3OTOL 4P74C 3CCMA 2RBMA 4H7BA 1EL0A 5KNCA 1YBYA 2IY5A 2K5QA 1PH3A 4A3CH 3MQZA 4DF7A 5D65A 2ALYB 1K83H 1H9KA 2Y0SG 2CW0C 3RLFA 3BDOA 4A93B 4A3KB 2IHEA 2C8MA 5G3LD 4EQ5A 3JAMc 4LF8L 5JVH3 2I4OA 5GADC 1GOZA 1UWVA 2K01A 2A69C 1WVLA 2JE6I 3S14H 4JI1L 4C3IB 3PQIA 4DR7Q 2Q7HA 3MEYA 3EBEA 1DZ1A 1BDOA 3AB9A 3AEVA 4A3LH 3GV3A 2EOTA 1GUOA 2WB1G 5CC4A 1KNAA 4HIMA 4OELB 3OPOA 4XQNA 4J6HA 4G57A 5G3LF 2I4LA 1C4QA 2E2DC 4KMUC 5FLXE 3QO2A 1EIYA 3MA2B 1H4VB 2R93B 3EJIA 3M4YA 2K5HA 3M4OB 1K8MA 4BS9A 2EY6A 4A3BB 4YWMA 1Q7YC 4NXMQ 3T51B 3HRKA 2OQ0A 4GLVB 2X6GA 1KHIA 4L8JA 3VR5A 3EIVA 3P75A 3SK5A 4EQNA 4A3MH 1SJED 4X3TA 3CCRA 4XQJA 3CCVA 1SAPA 4RH6A 1HNXL 4YP0A 3E0JA 3EROA 2Q7GA 4XU2A 3QOLA 5IT9L 1VQOA 2B63B 4RCNA 1OTCA 1EYAA 1X2HA 3TS2A 1KD1C 5M3FB 4JOIC 3J81i 1FR3A 1G51A 1O7IA 3URYA 5CV8A 4HIDA 4LF9L 2F0IA 4E51A 4IALA 4DK3C 1M4VA 3C1EA 4YRGA 3CD6A 4GZYC 4ZTUB 2F0KA 2KCTA 2XVSA 1G8ZD 1Y1VB 3HS0C 2IWHA 2I0QA 3SGIA 5IYDG 3CCSA 4A3LG 5JEAH 1SYFA 3S2HB 4K2LA 5EQ0A 2EIFA 1U0LA 4FF1A 2SDFA 4CDDC 4A93H 3T1HL 1T9HA 4RKBA 4BY7B 1KLGD 4HN7A 1JOOA 2HUGA 2ZGWA 2NN6G 1UUPA 1SE2A 2JA9A 4L87A 5CBAE 4YRIA 3OIQA 4RG1A 1TWHH 1MKHA 2EY5A 4AYBB 4C3IH 4AYBE 4LNQA 2P0LA 1TR5A 4DUYQ 4J15A 3CRKC 4RGTA 4APVA 4GLXA 4IN3A 2TSSA 5IGFA 3HY1A 3I4OA 2OCEA 1G5IA 4GN4B 2K5NA 2KEEA 3HKZE 2PI2E 4DN4M 3DXJC 1WTWA 2R93H 4A3JG 3M4OH 1USYA 1GUTA 4A3DB 4A4IA 5IE8A 1DOMA 1FVIA 3M85A 4A3BH 1NJ1A 1QB5D 3U4ZA 3UE1A 3TUPA 3VR3A 5C4HA 4YRNA 1ESRA 2ZJPA 3KF8B 1EY8A 5IIFA 4X65Q 4IOCA 1C9OA 3R2TA 2OEOA 3M4QA 1CTMA 3QJYA 1L0XB 3EA6A 4ZTZB 2ZIOA 3HOWB 1YNNC 4BBSB 2VS1A 2EJ9A 4OIKA 3OSOA 1HTPA 4POFA 5JEAG 1GHJA 2X6LA 4DUZQ 2PPBC 2B63H 4JI8L 4DFAA 2NZ1D 1SYCA 2YV5A 4DNIA 1AZQA 1N33Q 3ER0A 3I4MG 1HRJA 3SHLA 2WAQB 1PV4A 5M3FH 1NR4A 5KNNA 1F2MA 5C0XH 2Q2UA 3WQZA 1CKNB 2EY2A 1YHAA 2Q5IA 1KNEA 2GVBA 4C3IG 3E9HA 2UXDQ 2DJZA 3PZCA 4K5VA 4TQUS 3J80L 1KABA 4TWAA 2B2UC 1Y1VH 1WOCA 5FO7B 3S2HH 3D6CA 1CUKA 1H9SA 4DXFA 1MI2A 3Q22A 4JCVE 3GTOB 2X69A 4BY7H 3D0FA 3RUXA 1X32A 2R93G 1TWFB 1EY5A 3UH0A 2F4VL 1N32L 2EYOA 2AWOA 1AE2A 2KEDA 4A3BG 1STBA 4DV7L 2XWBB 2SEBD 3LGJA 2C5CA 2A68C 1JCKB 1X65A 5EKKA 4B9XA 4X64Q 4WORA 3A54A 4Q0FA 2NB0A 1YIJA 4JI7Q 2E41A 5M9OA 3PCOB 3MAQA 2KHJA 2Q8TA 2M00A 5LMNW 3SXHA 2EDGA 1J5EQ 4YCVA 3KYHC 5LL6X 4B3RL 4DR3Q 3J81c 1EZ6A 2KJXA 3A56A 4DV1Q 1PH8A 4A3DH 4HMIA 4IUTA 2G9DA 3DWQA 1KQSA 2WIIB 4RCOA 5D3DA 4RQEA 1LTRD 1BIBA 1TY0A 5C0XG 2PMEA 3RMHA 3T16A 5NUCA 4G85A 4H2WA 1DGSA 2LXKA 1D6EC 1PH9A 1QNUA 1STHA 4LJZC 4DXGA 3HOWH 2PCFB 4BBSH 2B29A 5J3BA 1Y1VG 1S5ED 3WDNA 4K6LA 1EYCA 3IAYA 2UXBL 1FD7D 4H2SA 4LMQD 4C2MB 2CWAA 5ELEA 4WF2A 3HEJA 4NPSA 4A75A 4BY7G 3OIPA 1Y14B 1I4HA 3BG3A 5LL6S 3KLWA 3U4VA 1HUMA 4OWWB 3D31A 5IYBH 1RTNA 1PDQA 1WD1A 2PNRC 1NCVA 2AKWA 1OO9B 3L9AX 2ZR2A 4LNSA 3CQZB 3NBHB 5EBCA 4AYBG 2ZXOA 3A5ZA 5KRUA 1RIQA 3MWYW 2CFMA 3L0OA 3NPPA 5IGCA 3A55A 4C1NK 1CA6A 5IP7H 3TP6A 1PH6A 1I4GA 1SE8A 4X5OA 1TXYA 1Q90A 5T1GA 3NQIA 2ATWA 1SFOB 1QZGA 1G2TA 3A74A 3BDCA 1BCPC 1KLUD 1JOQA 3ICAA 3GTOH 4E6IA 3F2BA 2OQKA 3T53B 2EZVA 3TREA 1TWFH 1ZKOA 5IGDA 4ZAIA 5LMUL 4R4TA 4X62L 2UU9L 2KCCA 1IW7C 1QNKA 2NTSA 4R4OA 3MEFA 4A3DG 2E3CA 5J22A 2I5MX 2ODRD 3RZOB 4XT1B 1DCZA 2Q2IA 3NWSA 3K5NA 1NE3A 1FYCA 1WPYA 2DTOA 2WINB 3Q24A 4K8IA 2ZXFA 2EYMA 4P74A 2VUMG 5A35A 2ICIA 1FNUA 1X3GA 1ENFA 4FO2A 3LNNA 3BYYB 2HNIA 4BBSG 1X3FA 1Y8PB 1SNCA 1A62A 1LV9A 1WCMB 3D4RA 4HIKA 2K28A 2ASBA 1F77A 4NKLA 3HOVB 2A6HD 2ZT9C 2DJFC 3HRZC 1XNRQ 3I72A 1Y1WB 1SYEA 4ID6A 5KNBA 5IYBG 1JJCB 1XNQL 1AP0A 3G7LA 3FHWA 1GGMA 2MO1A 5GQOA 5T1IA 2DGYA 4OO1G 3LSSA 2KCNA 3TBIB 1VQMA 5IP7G 2IPKD 3VYUA 4FYDA 3NENA 3A8JE 2RVLA 1FJGL 2EJGC 3HOUB 1U4RA 2N78A 4BA2I 4V190 4DV3Q 4NXNL 2E2IB 4TQFA 1D1IA 3SE0A 3UDGA 1SRUA 1WTHA 2ZXPA 5C4ZA 4HJ7A 1JICA 5IWAQ 3CP0A 2UXCL 2EQSA 2B8GA 3PIP3 4YRJA 4YRSA 3ONAB 3CQZH 5M3MB 4DV4Q 3W2DA 1WLEA 2VW9A 3DWPA 1LO5D 3NTIA 1SXTA 1EYDA 1V1QA 1PRTD 1QILA 1STAA 2F4IA 2SNMA 1LACA 3U9SA 1F9QA 5IT9E 1LABA 3ULPA 2B2YC 4GNXC 2DXUA 4PG3A 1SFOH 1Q86C 1HR0L 4RMFA 4LVJA 4HJ9A 1EIGA 3T4AC 4O2DA 4CH4A 1LT6D 3GTPB 1XTCD 1N8RC 4YPFA 5M5YH 2R7ZB 3HXXA 4JV5L 4EGVA 3I2ZA 3RZOH 1RHPA 2K52A 3CCLA 4JI2L 4X66Q 4JOIA 2ENBA 5IGEA 1PRTF 2BH2A 1G291 3ERSX 4DV5Q 1Q82C 1BXTA 1UAPA 4L5SA 4IFDH 4DR6L 4DAMA 3BFMA 1IXRA 1EWCA 1KRSA 3BZCA 1K73C 3LC0A 4HWTA 5CV9A 4TQDA 3VQVA 4H2UA 1SLJA 1ADJA 4RGOS 1L1OC 1KDAA 1WCMH 2L12A 3MXNB 4DNRB 2HIXA 2PW7A 1I6VC 1CFMA 3HOVH 3PGZA 4DV2Q 5KIXA 4LAAA 2NN6I 2Z4IA 1Y1WH 2JSOA 3TRZA 1NMGA 5M5XB 3I70A 4JC0A 1H4SA 5KNDA 1NSNS 5K1XA 1RODA 5K36H 1J6QA 4P75C 1S5DD 1GXDC 1EVLA 4F87A 3WWVA 3S1MB 1PH4A 4WJWA 4UPAA 3IFDA 2KBNA 5AJ3L 2Y0SE 3GTKB 1PZKD 3CC4A 1TWAB 5CBEE 2VQFQ 3TP8A 3EFRA 2FFKB 4OONA 1LTAD 3HOUH 2E2IH 1DXMA 4U68A 1A0IA 1ENAA 1V1PB 3HKSA 5C0XJ 1U9RA 4J8QA 3S1RB 3H09A 1JORA 1SEBD 2O4XA 1LTLA 1QUQB 1VQKA 2CGHA 1ZYRD 5M3MH 3N52A 4KY5A 1A2UA 5EKIA 4LF7Q 1MBYA 1B70B 3KJOA 2QHSA 2R7FA 1CSPA 4H0LC 1KMNA 1GM5A 1CZWA 2I4MA 4KKSA 4IFDG 3D8GA 1ILQA 2JA8G 3RLOA 1K28A 1RIPA 3G48A 4K8JA 2Z0SA 1Q8IA 1G5HA 1KRTA 4GOPC 3PO3B 4X3SA 4NMZA 2ZT7A 1STEA 2K04A 5CV5A 1VQBA 1RL2A 2LFNA 2R7ZH 5EBDA 1WCMG 1Q8KA 3J80E 4N8X1 5C5LA 2UUCQ 1EY4A 5JAVA 3PUXA 1KIXA 3QO8A 1MGSA 1N34L 2E2JH 2HQEA 4IPCA 2CH4W 3HG9A 5IGBA 1EY9A 4FF2A 4DAYB 3Q6SA 1Z47A 5EPLA 4XTUA 2B2UA 1AE3A 2LMCB 1B1ZA 1SROA 2ID0A 3WOFA 5C3EG 2CWPA 2F0EA 2K32A 4O42A 4TKOB 2J4XA 4A3FG 1IHZA 3S15B 4KR3A 1H9RA 1GO3E 5KGUA 4RFBA 5ELOA 4DAVA 2ZM6Q 1AH9A 2PQAB 2EXZA 3H3VH 1W6KA 1VQJA 5I4DA 3TZDA 3J7AF 1O7YA 1IBMQ 1MJCA 2DY7A 3EN2A 3CMAA 2EAYA 3QWNA 3P8VA 4HSVA 2B39A 5M5XH 2WKCA 4KN4C 2DNCA 2R6GA 3H0GB 4YCUA 1ADYA 1IL8A 3NETA 3UGQA 1NYQA 3G71A 1KTKA 2SNSA 2DU7A 3E6ZX 4H2XB 1ICFB 3GTKH 1PRTB 1TWAH 1LTSD 2I07B 1H4QA 4B3MQ 3V7SA 4ZQ3A 2E5LL 4OX9L 3FMCA 5IOCA 3S1RH 1XWEA 2YTXA 3REUA 4OLFA 2R7ZG 4LFBL 4DUYL 4LF5Q 4HWPA 3S1QB 3QB3A 5C0XI 1CI3M 3S17B 1QG7A 2V1CC 1YJ9A 1K9MC 2HCCA 4FP5D 2O5IC 4IUQA 1CHPD 1CQVA 1F2ZA 1VQGA 5LMNQ 1VQCA 1TWGB 2YTVA 2K75A 4B3TL 4YHHL 1LYLA 3KLSA 3I4NB 4JBWA 3VDYA 3PO3H 4JI4L 3STBC 4L5TA 2PO4A 4CKEA 2UUAL 3H3VC 3TEHA 2ZJRA 4X65L 4KI0A 1I6HB 5EAYA 5IP9H 1XMQL 2C35B 2XRQD 2YU9H 1GJXA 1KMMA 1KOGA 2Z6KC 4Q15A 2KVMA 3DHQA 1ONLA 1E2WA 4J1MA 3K57A 4OGQC 1DOLA 4LFCL 3CAMA 4N8FA 5ELNA 2NS6A 4MZ9A 2IX1A 1ATIA 2PI2A 3S15H 1BVSA 1YGBA 1YNJD 4K0KL 1QVGA 3F2CA 4PNYA 1VQZA 5FLMH 2E64A 1AFPA 3ND9A 1MHWC 2D9UA 1M8AA 1PLFA 3I55A 1VQNA 4IJHA 3H0GH 2QGQA 1EU4A 4QUCA 3U50C 2ZINA 1B7YB 5C4JB 4EVOA 1F9SA 3VYRA 2WKDA 3PF4A 3LWUA 3MFGA 5E4XA 5DM73 3OMGA 2P5IA 3QO5A 1HNZL 3PO3G 3VQWA 2E10A 2L11A 4RGMA 4C3HB 1KAAA 3GV6A 1B2TA 3MC0B 4TSSA 2D5DA 1CA5A 3S1QH 4F8MA 1CSQA 2RHQB 3S17H 1K3RA 5E3FA 2F03A 4RGNA 4YRTA 2E74C 4KN7C 1PFSA 1AW7A 3AU7A 2NTTA 3RKWA 4OO1I 2D0OA 1TWGH 4DR3L 4A3CG 3A32A 3CW2C 3ND8A 2K03A 3I4NH 4RWSC 5C53B 2QDBA 2VQEQ 1WJJA 4KHPL 1LT4D 1K3BC 3I73A 2F0LA 1KC8C 3V2TA 2EJGA 4IZ8A 3V05A 2JXMB 4OL7A 4XU0A 2BH8A 1EZ8A 1I6HH 3C2PA 1U4LA 2MO0A 3A7AB 4DR5Q 2QHVA 1TVXA 1SNOA 3PUZA 5K5PA 1XPRA 1PHJA 2R92B 5KEEA 3BDLA 1HNWQ 5IGGA 4ODGA 1A6XA 4YRRA 2FHTA 3NQTA 2HHHL 1LTTD 4M8AA 1TIID 2ZR3A 1E24A 1Z6HA 12ASA 3E9IA 1B44D 2B2YA 4GNXA 4KQEA 2KQ3A 2BE5D 3DMUA 4A3KH 4YWLA 4PV1C 5FOBB 1SJHD 3UI2A 4DV6Q 1SR3A 3NTHA 3KF6A 2VXWA 4FF3A 1F2YA 2JEBI 1VQ4A 1XMOQ 4DV0Q 4B3SQ 2RDFA 5IYCH 5I9PA 1W3SA 4LWCA 4HEDA 4F7XA 3MZ5A 2D62A 1X9NA 5C4JH 4JI0L 1II3A 3DUZA 4IQZA 2FYKA 1KAWA 4M1UB 3TMEA 1SMYC 2K7VA 3KFUA 3CKIB 4LUVA 3K58A 4JYAQ 2ZZFA 3V8JA 3V8LA 1YITA 2RDHA 2E5AA 3P20A 4A3MG 1S5FD 1IBKL 4LF6Q 3QTCA 3PO2B 1K0SA 1LM0A 3HXYA 4C3HH 4KD3A 1L1OA 3VYSA 2UUBQ 1R4QB 1EWHA 4FVMA 2KECA 1WI5A 4I7ZC 1OXXK 3U58A 2NVXB 1VQ7A 2NWGA 2IY5B 4DK1A 1Q3LA 1V8QA 4R8NA 4JG2A 5BN3A 2DN8A 4TVYA 2ICEC 3BJUA 1SYDA 4P75A 1DM0B 1TU2B 1VDZA 4R8IA 3VBBA 3V7RA 3EQLC 3OHXC 4LW1A 4H02A 3TS0A 1GKHA 3NSWA 1YZ6A 4LVIA 1DD2A 4XEOA 1HPCA 2SOBA 3M7NA 3QIAA 4XTVA 5CORA 1STGA 4LUOA 3S24A 11ASA 4A93G 4A3KG 3RN5A 4XT3B 2IJ0A 3HOYB 3NK9A 2WAQE 3L1AA 3JAML 5E1FA 2CHBD 2A74C 4GKJQ 3OOCA 3OYYA 2R92H 1YEZA 5IYCG 2RQXA 2LKVA 1PH7A 3K5MA 3RKYA 3NP8A 4IFDI 2AQ3B 1EIYB 2QKIC 3I91A 1VQFA 2Z8LA 1YHQA 1NNHA 1R4PB 3M7GA 3G1ZA 1HCZA 2E75C 3NXWA 5FLXc 1YFSA 3VQXA 4GOPA 2K4KA 1K0RA 4C3HG 3NUCA 4LF8Q 4UDUC 3TP7A 5EJWA 4MNOA 4QY7A 1AEXA 1SNMA 2EYHA 4DK0A 1TS2A 3CC2A 4LFAL 5IY0A 1JJ2A 1YNXA 4JI1Q 4FF4A 4CS4A 2GA4B 5I2XA 4FXDA 4MTNA 1E2VA 1ICWA 2A6ED 4DPGA 1O7ZA 2F0PA 3J7YW 2WV6D 3I4LA 2CH4A 3CXCA 1A3VA 1EQRA 1EQQA 3PO2H 3S16B 4G7HC 3ERQA 1HR0W 3TDQA 3VA5A 1EFWA 2B63G 3TZUA 4YY3L 2J0TD 3NEMA 1ZXTA 1N36L 5E7NA 2MHVA 4ULLA 2JA7B 4JBMA 4DR4L 2F3IA 3SVMA 5M3FG 4XXEA 1XYIA 1EY0A 3OW2A 1S72A 1HA6A 1G2SA 4P72C 1Y69U 3S9WA 4WJ3M 2PZTA 1TS5A 1WYDA 2QEJC 1PTOD 4CKCA 3ULJA 3J7A5 1IL2A 3C46A 3HFZA 3SDZA 2ZJQA 3GP7A 3KBGA 2XGTA 1Q81C 1V9PA 1HH2P 2E1HA 2MPMA 3HOYH 3UGTA 1B3QA 4PQXA 1HC7A 1C48A 2VY3A 1EFID 4A3EB 2QEXA 1E2ZA 4LF9Q 4WJ4A 1PTOF 3V8KA 1DOKA 4RQFA 3K6OA 5C4XB 4CJ2C 4PMBA 4BXXH 2I5HA 4X6AH 2XNAC 3T1YL 1NJIC 3PO2G 1V43A 3MXNA 2Q8IB 1E1OA 1CM9A 1HXDA 4RHSA 4GKKQ 1SDFA 4BA1I 1QE6A 3H3VI 2FMMA 1JMCA 4JI5L 5I9OA 2O5JC 4QB4A 1CKMA 4BY1B 2XN9C 2BA0A 1WTPA 3G6JB 2CW0D 2O2LD 2Z6KA 4HMJA 4K5WA 3J7AV 3G6EA 4P73C 5BR8L 4QIWB 1W2BA 2ARUA 1PYSA 4A3GB 3HOWG 3HGBA 4JI3L 3DEPA 3KJPA 3S16H 2KA7A 3L4GA 1PFBA 3GTLB 1A63A 2A69D 1VQ5A 2L5TA 2EPBA 5D3IB 2DQ0A 4DR2Q 3I8ZA 2JA7H 2A1AA 3GTGB 1ET6A 1QUQA 3V96A 5C3WA 2WAQG 1HFGA 2JK8A 2PNHA 2F0MA 3FKIB 1SE4A 4ZRZA 4LF4L 2DDZA 4DR1L 1I94Q 1UE5A 2F0GA 4FNFA 5I2YA 2L9HA 4HT4A 2NBFA 4TRDA 4IUPA 1H9SB 4FXGC 2H4OA 3NHHA 4PZ8A 1DONA 1CQFA 4IJLA 3KUPA 3L7ZC 1KXLA 4RA8A 1GUSA 4C3JB 1KDCA 4C2MH 5FK9C 3K8AA 4HJAA 4JI8Q 5HGTA 4JI6L 1X3QA 4RDXA 3EVQA 3CCEA 1Q1BA 3M9BA 2RDGA 5COYA 4A3EH 3KDFA 1HZCA 1U5KA 4H44C 5I6WA 5JEAJ 1ML0D 5C4XH 1R9TB 2RHSA 4NB3A 3BVGA 4LVMA 1SYGA 5EKLA 3F2UA 2DTHA 1SNPA 5AFWA 4GN3B 3H94A 2DXTA 2F52A 1RTOA 1VF5C 3HXUA 1WD0A 3HXVA 2F4VQ 1WTQA 4EQOA 3J81L 2M2LA 2DTIA 1VQLA 2F0NA 5JJZA 1EIHA 1KDBA 2QCPX 4DNTB 1NR2A 2LY7A 4BY1H 4QMGA 1ZEQX 2LSSA 4JW0A 2B2TC 5C44B 1CK1A 2EE1A 5GROA 1WQWA 2MNAA 4A3GH 4P3PA 3NBIA 1A2TA 2YYZA 3FDTA 2VB3X 1YHBA 4XTYA 1PTOB 1QZHA 1NY4A 3KLSX 1UE7A 4DA2A 4XYOA 4B3RQ 4UY8C 5BN4A 1X6OA 2AKWB 1LUZA 2ZTCA 3GTGH 4R4QA 3A5UA 4F88A 3A5ZB 1UE6A 2AMCA 2EYLA 2L55A 1F2LA 1HTLD 4MIUA 4ZUIA 4YIJA 1HXYD 4A3EG 3IFTA 1X54A 4TTVA 4AQYQ 1EY6A 2ZTEA 4AIMA 4C3JH 2UXBQ 4UP9A 1NJ6A 2ZTDA 3R07A 2F0WA 2NVQB 4IUUA 4H2YA 4LVKA 2PZWA 2I5LX 1S5BD 3P7JA 4DR7L 1JQYD 1B50A 1HA5A 2KENA 1T5XD 1WQ7A 4XYQA 2R3ZA 3CPWA 2L1BA 1V1OA 1CKOA 1YNND 1NJ5A 3HFVA 1L0YB 1TS4A 2D2CC 3RUZA 5CV6A 3IKJA 4BY1G 1M1KC 1VQ8A 1R9TH 1EQTA 2F3WA 2AUKA 1HHVA 4Q6GA 4KHZA 2ALYA 2IW3A 1C7YA 1TKWB 2XTIA 3JAME 4A3IB 4UHVA 4NXML 2A8EA 3GTPH 1OXTA 2ZXRA 4K2KA 2UU9Q 5LMUQ 4X62Q 1IKMA 2G5DA 2MUYA 3HOVG 2K14A 2N88A 5E3IA 3J80i 1Y1WG 2WB1B 3K5LA 4Y52H 1X3PA 1RCVD 4HWSA 2NZOA 1LTBD 3QNEA 3F8TA 3HXZA 1L0WA 5K36G 5C44H 3T56B 3B6YA 2Q2TA 1HUNA 1Z9FA 4AH6A 1B8AA 3H6MA 3RF1A 1PTOH 4C56C 1WTVA 2JA6B 4K86A 4BBRB 3UDFA 4DR5L 3HOUG 1YB3A 2N8NA 4DAPA 2A68D 2VNUD 3O13A 4GS3A 4QUFA 2IL8A 1MIUA 4HWRA 3RGLA 4Q5VA 2MQHA 2NVTB 5E4WC 1XNQQ 5M3MG 5A2QL 2RSOA 2FXQA 3FVQA 4YRFA 5IT9c 3S1MH 2I4NA 2MFIA 3PIPA 2ZT6A 3T13A 2DNEA 2DKGA 2PMFA 2QW7A 4EX5A 5CR3A 1BQQT 4OXPA 4PMCA 1FJGQ 2NVQH 3GQBA 4CJ0B 4NXNQ 1PVOA 1B76A 1UEAB 3P8YA 2BDOA 1BR9A 4NW2A 1NBWA 1VMCA 3K5OA 1B9MA 2ARTA 2UXCQ 3HOXB 3X3NA 1E7ZA 1SESA 2NZHA 3UDXA 3IG2A 1LT5D 3A5YA 4O0AA 5J1ZA 1QVCA 1G91A
chains in the Genus database with same CATH topology
4P72A 2DUDA 2JQOA 2PMZE 2RF4A 5C44G 3CMQA 1HR0Q 1EVKA 4A3IH 2L15A 1ASYA 1WNLA 2J3LA 1D7QA 2JEAI 2ZIMA 3HY0A 4JI2Q 5GAGC 4IO9A 4CH5A 2HT1A 3A31A 1PA6A 2A8VA 4DUZL 1I5FA 4DR6Q 4YRMA 1EOVA 2D0PA 1IYJB 1N33L 2JA6H 4BBRH 1SN8A 2CCZA 1P16A 2Q7EA 4YROA 1C0AA 1IBLQ 2UXDL 2CJAA 2ODRC 2NVTH 4EO4A 2Q5HA 3CPFA 1PYBA 1L2FA 4P3NA 5HGQA 2H5XA 2R7DA 5DLQE 4P73A 5AJ3Q 2ZZEA 3AFQA 3REXA 1JJGA 4A3IG 3CCJA 1NYRA 1EWIA 3PUYA 4R4IA 2CJBA 3J80c 1YFTA 4X64L 4L5QA 3HOXH 4YYEA 1CKNA 1K8AC 5IP9G 4JI7L 5IYDH 3H15A 1VQEA 2VZAA 1BKBA 1J5EL 1VQ9A 1GVPA 4DV1L 3ICEA 4H2VA 4YRCA 3M4PA 2JA6G 4BBRG 1YJWA 3CCQA 2E65A 3AQQA 3F1ZA 3HOZH 5FLMG 2DVEA 1VQIA 2IHFA 1N34Q 4IFDJ 3H0GG 3RACA 3PCOA 4A3JH 1XJVA 3RKXA 4KR2A 4K87A 1NJ2A 1E22A 4TVAB 3G4SA 1S3OA 4CS2A 5F5WA 3K81C 3S1NH 4YREA 3HOXG 1N9WA 3J81j 3IKLA 4IPHA 3L2ZA 3K7AH 3TEHB 3I4MH 1NJ8A 3A7UA 3NELA 4HA8A 3I4NG 4GKKL 4YCWA 1EUJA 2E5LQ 4OX9Q 3E0EA 5H1SE 4LFBQ 1X3EA 3HOZG 3HTZA 1E3PA 3MF1A 4HIOA 5K1PA 2WP8J 2DEQA 4PZ7A 3DLLA 3QO7A 4B3TQ 4YHHQ 4DR2L 2E8GA 4PHCA 4JI4Q 1XNRL 2UUAQ 4UP7A 1OXUA 4P71C 1I94L 1NMFA 3PF5A 1XMQQ 2ZTGA 2IX0A 3TEGA 2OTLA 3OTOQ 3V7CA 3CF5A 4HJ5A 1PH2A 4CH6A 3ERRA 4LFCQ 1W66A 1VQHA 4DV3L 3RIRA 3AYHB 4PMWA 2IT1A 3PSIA 3UE0A 5IWAL 2DZCA 5FJ8H 2J3MA 5M5WH 3GD7A 4K0KQ 2KCMA 4DV4L 3UFGA 1H4TA 1BIAA 2ZNJA 3OD1A 1JJCA 2N49A 4K88A 3GTMH 1PH1A 1VS0A 2ARSA 1D8LA 5GAHC 2A19A 3IALA 2EL9A 2DQ3A 4FDBA 3K7UC 1Q12A 1HNZQ 4X66L 3LSQA 4YRKA 2AWNA 4POGA 4DV5L 2NVXH 4DQ2A 4HWOA 3PUVA 3VQYA 4BW9A 2R92G 4GNXB 4CS3A 4WI1A 3W3SA 4QGUA 3I7FA 2CJ9A 1HNXQ 4DV2L 4GN5A 3M3YH 3KF6B 4KHPQ 4XTCS 4HVCA 1XPUA 3IKMB 1UE1A 1YFRA 1KL9A 1X55A 5FJ8G 1JE5A 3FP9A 1XPOA 2VUMH 4AQYL 4OP0A 1QF6A 3RR5A 1M90C 3P8TA 3Q8DA 4DKAC 3HRIA 2VQFL 3STBD 2HHHQ 3RLNA 3UDIA 3CMEA 2JA5H 1SRYA 1Q1EA 1L1OB 3W1BA 3L2PA 4R1JA 3AFPA 4TVWA 3K80C 1FYFA 3W1GA 3T1HQ 4YDQA 1BBUA 4XIGS 2K5VA 4LF7L 1HZ9A 3CCUA 3DSQA 1QE0A 2ZT8A 3F2DA 4JI0Q 3BU2A 1HJPA 3HKZG 4QIWE 1UEBA 2UUCL 1IBKQ 2B3GA 2RCNA 1EIFA 3FJPA 4NCXA 3HOYG 1JT8A 2CQOA 4A76A 5GAEC 1Z7MA 1B70A 4XEMA 1A8VA 4GOPB 2ZM6L 2JA5G 3BZKA 4BXXG 1IBML 1HTTA 4QJFA 1OXVA 2NVYH 2HQLA 2Q2HA 4OWXB 4XTXA 2C7IA 1X2GA 3J7ZC 4YRPA 4XU1A 4ALPA 2CKZB 3CC7A 4YRQA 4B3ML 2DU5A 3DM3A 4BWAA 3JC66 2KHIA 4LF5L 3ZJYC 5HY6A 2PQAA 1MJEA 1N32Q 1K8GA 2QHTA 2OWOA 2LXJA 3A0JA 2JA7G 1IZ6A 4DV7Q 1Z7NA 4LFAQ 3GO5A 5LMNL 1FGUA 2GVAA 3HFZB 4Y7NH 3RZDH 4H2XA 2ES2A 2QHUA 1I3QH 2AHOB 4JBJA 3RNUA 1VQAA 1YI2A 3GTLH 1SETA 2EXDA 4YY3Q 2ZT5A 1N36Q 3W5OA 4DR4Q 4CH3A 4IPDA 3FKIH 2JA8H 3RN2A 3A7RA 2G4CA 2WFWA 2EWNA 1JB7A 1USYC 5C4XG 4XU3A 1IBLL 5C51B 5JJLA 1E1TA 4YWKA 1SERA 4R4CA 1YJNA 3KOJA 4IPGA 1P8LA 5C3EH 1PYSB 1PH5A 4A3FH 3ULLA 1VQ6A 4LVLA 3K0XA 3L4GB 4H2TA 5C52B 1FL0A 3GTQH 3HXWA 1YVCA 4A3GG 1H95A 2ZZGA 4UP8A 1HZAA 5JJIA 2E2HH 2BA1A 3T1YQ 1XTDA 3TQYA 3JAMi 4ME3A 1BBWA 4P71A 4JI5Q 4YRLA 3GDEA 2WB1E 3S2DH 3FKIG 4PZ6A 3IRBA 2N3SA 1B7YA 2VQEL 3PV0A 5BR8Q 4OWTB 4LUZA 4JI3Q 1HZBA 1I50H 1X56A 1SMXA 4DK6C 4HJ8A 3KDFB 1HNWL 1G6PA 4QL5A 5JJKA 2ZCEA 2RHQA 3MF2A 3EFSA 2RHSB 4KLKA 4LF4Q 1QVFA 2ZNIA 4DR1Q 2QA4A 2JJQA 2GN5A 4DV6L 4G84A 1S40A 1XMOL 4DV0L 4B3SL 4IOAA 4P3OA 4GLAC 3RL6A 4JI6Q 3A7AA 1Q46A 1TWCH 1X01A 4JYAL 4ZIBA 4XTWA 1VCIA 4LF6L 1J5WA 2K50A 2VL6A 2UUBL 4TVAA 3PUWA 1ASZA 1OXSC 1VQDA 2AMCB 3PIOA 3I56A 2OTJA 4JV5Q 4XTZA 1NTGA 3GTJH 1VQPA 2EJFA 2DZ9A 4JBKA 4L5RC 2CIMA 2YTYA 1WFQA 2HIVA 1WU7A 4QQBX 1EYGA 4GKJL 1GD7A 3OTOL 4P74C 3CCMA 1YBYA 2IY5A 1PH3A 4A3CH 3MQZA 2ALYB 1K83H 2Y0SG 3RLFA 2C8MA 2IHEA 4EQ5A 3JAMc 4LF8L 2I4OA 5GADC 1UWVA 2JE6I 3S14H 4JI1L 4DR7Q 2Q7HA 3MEYA 3EBEA 3AEVA 4A3LH 2WB1G 4HIMA 2I4LA 1EIYA 1H4VB 2K5HA 4YWMA 1Q7YC 4NXMQ 3HRKA 2OQ0A 4GLVB 1KHIA 3EIVA 4A3MH 3CCRA 1HNXL 3CCVA 4YP0A 2Q7GA 4XU2A 1VQOA 1OTCA 1X2HA 3TS2A 1KD1C 4JOIC 3J81i 1G51A 1O7IA 4HIDA 4LF9L 4E51A 4DK3C 4YRGA 3CD6A 4ZTUB 2KCTA 2I0QA 3SGIA 5IYDG 3CCSA 4A3LG 2EIFA 1U0LA 4A93H 3T1HL 1T9HA 2ZGWA 2NN6G 4L87A 4YRIA 2JA9A 4RG1A 1TWHH 1MKHA 4LNQA 4C3IH 4AYBE 2P0LA 4DUYQ 4J15A 4APVA 4GLXA 3HY1A 3I4OA 2OCEA 1G5IA 4GN4B 2K5NA 3HKZE 2PI2E 2R93H 4A3JG 3M4OH 1USYA 4A4IA 5IE8A 4A3BH 1FVIA 3M85A 1NJ1A 3U4ZA 3UE1A 3TUPA 4YRNA 2ZJPA 3KF8B 4X65Q 4IOCA 1C9OA 3M4QA 4ZTZB 2ZIOA 2VS1A 2EJ9A 4POFA 5JEAG 4DUZQ 2B63H 4JI8L 2YV5A 4DNIA 1N33Q 3ER0A 3I4MG 1PV4A 5M3FH 5KNNA 2Q2UA 3WQZA 1CKNB 1YHAA 2Q5IA 2DJZA 2GVBA 3PZCA 3E9HA 2UXDQ 4TQUS 4TWAA 1Y1VH 1WOCA 3S2HH 1CUKA 4JCVE 4BY7H 3D0FA 3RUXA 2R93G 3UH0A 2F4VL 1N32L 2AWOA 1AE2A 4A3BG 4DV7L 3LGJA 1X65A 4X64Q 1YIJA 4JI7Q 2E41A 3PCOB 2KHJA 5LMNW 1J5EQ 4YCVA 3KYHC 4B3RL 4DR3Q 3J81c 4DV1Q 1PH8A 4A3DH 1KQSA 4RQEA 1BIBA 5C0XG 2PMEA 4G85A 4H2WA 1DGSA 2LXKA 1PH9A 3HOWH 4BBSH 2B29A 5J3BA 1Y1VG 2UXBL 4H2SA 2CWAA 4WF2A 4A75A 4NPSA 4BY7G 1Y14B 3KLWA 3U4VA 4OWWB 3D31A 5IYBH 2AKWA 2ZR2A 4LNSA 3NBHB 4AYBG 3A5ZA 1RIQA 2CFMA 3L0OA 5IP7H 1PH6A 1SE8A 4X5OA 1TXYA 2ATWA 1QZGA 3A74A 3ICAA 3GTOH 3F2BA 2OQKA 3TREA 1TWFH 2UU9L 5LMUL 4R4TA 4X62L 4R4OA 4A3DG 3MEFA 2E3CA 2I5MX 2ODRD 2Q2IA 1NE3A 1WPYA 2DTOA 2ZXFA 4P74A 2VUMG 1X3GA 2HNIA 4BBSG 1X3FA 1A62A 4HIKA 2ASBA 1XNRQ 5IYBG 1JJCB 1XNQL 3FHWA 1GGMA 2MO1A 5GQOA 2DGYA 4OO1G 3LSSA 1VQMA 5IP7G 3NENA 1FJGL 2N78A 4BA2I 4TQFA 4DV3Q 4NXNL 3UDGA 1SRUA 4HJ7A 5IWAQ 3CP0A 2UXCL 2EQSA 4YRJA 4YRSA 3CQZH 4DV4Q 1WLEA 2VW9A 1V1QA 3ULPA 4GNXC 2DXUA 4PG3A 1SFOH 1Q86C 1HR0L 4RMFA 4LVJA 4HJ9A 4O2DA 4CH4A 4YPFA 1N8RC 5M5YH 3HXXA 4JV5L 3I2ZA 3RZOH 3CCLA 2K52A 4JI2L 4X66Q 4JOIA 2BH2A 1G291 3ERSX 4DV5Q 1Q82C 4L5SA 4DR6L 4DAMA 3BFMA 1IXRA 1KRSA 3BZCA 1K73C 3LC0A 4HWTA 4TQDA 3VQVA 4H2UA 1SLJA 1ADJA 1L1OC 1WCMH 3MXNB 2HIXA 3HOVH 3PGZA 4DV2Q 2NN6I 1Y1WH 3TRZA 1NMGA 4JC0A 1H4SA 5K1XA 1J6QA 4P75C 1EVLA 3WWVA 1PH4A 4UPAA 2KBNA 5AJ3L 2Y0SE 3CC4A 3EFRA 2VQFQ 4OONA 3HOUH 2E2IH 1A0IA 3HKSA 5C0XJ 1LTLA 1QUQB 1VQKA 2CGHA 5M3MH 4LF7Q 1B70B 3KJOA 2QHSA 2R7FA 1CSPA 1KMNA 1GM5A 2I4MA 4IFDG 2JA8G 3RLOA 1RIPA 3G48A 2Z0SA 1G5HA 1KRTA 4GOPC 2ZT7A 1VQBA 1RL2A 2R7ZH 1WCMG 1Q8KA 2UUCQ 3PUXA 1KIXA 3QO8A 1N34L 2E2JH 4IPCA 4DAYB 1Z47A 4XTUA 1AE3A 2DXTA 1SROA 2ID0A 5C3EG 2CWPA 4A3FG 4KR3A 1GO3E 2ZM6Q 5ELOA 1AH9A 1KMMA 2PQAB 3H3VH 1VQJA 1IBMQ 1MJCA 3EN2A 3CMAA 2EAYA 3P8VA 5M5XH 2R6GA 3NETA 4YCUA 1ADYA 3UGQA 1NYQA 3G71A 2DU7A 4H2XB 3GTKH 1TWAH 1H4QA 4B3MQ 3V7SA 2E5LL 4OX9L 3S1RH 2YTXA 3REUA 4OLFA 2R7ZG 4LFBL 4DUYL 4LF5Q 4HWPA 5C0XI 2V1CC 1YJ9A 1K9MC 1VQGA 5LMNQ 1VQCA 2YTVA 2K75A 4B3TL 4YHHL 1LYLA 4JBWA 3VDYA 3PO3H 4JI4L 3STBC 4L5TA 2UUAL 3TEHA 2ZJRA 4X65L 4KI0A 5EAYA 5IP9H 1XMQL 2C35B 2YU9H 1KOGA 2Z6KC 4Q15A 4LFCL 3CAMA 5ELNA 2NS6A 4MZ9A 2IX1A 1ATIA 2PI2A 3S15H 1BVSA 1YGBA 4K0KL 1QVGA 3F2CA 1VQZA 5FLMH 2E64A 1VQNA 3I55A 4IJHA 3H0GH 2QGQA 3U50C 2ZINA 1B7YB 3PF4A 2P5IA 3QO5A 1HNZL 3PO3G 3VQWA 2E10A 3S1QH 1CSQA 2RHQB 3S17H 1K3RA 4YRTA 1PFSA 3RKWA 4OO1I 2D0OA 1TWGH 4DR3L 4A3CG 3A32A 3CW2C 3I4NH 5C53B 2VQEQ 1WJJA 4KHPL 1KC8C 2EJGA 4XU0A 2BH8A 1I6HH 2MO0A 4DR5Q 2QHVA 3PUZA 1XPRA 1PHJA 1HNWQ 4YRRA 2HHHL 2ZR3A 1E24A 12ASA 3E9IA 4KQEA 4GNXA 4A3KH 4YWLA 4DV6Q 1SR3A 3KF6A 2JEBI 1VQ4A 1XMOQ 4DV0Q 4B3SQ 5IYCH 1W3SA 4LWCA 2D62A 1X9NA 5C4JH 4JI0L 2FYKA 1KAWA 3KFUA 4LUVA 4JYAQ 2ZZFA 3V8JA 3V8LA 1YITA 2E5AA 4A3MG 1IBKL 4LF6Q 3QTCA 1LM0A 3HXYA 4C3HH 1L1OA 2UUBQ 1WI5A 1OXXK 3U58A 1VQ7A 2IY5B 4JG2A 4TVYA 3BJUA 4P75A 3VBBA 3V7RA 4LW1A 4H02A 3TS0A 1GKHA 4LVIA 1YZ6A 4XEOA 3M7NA 4XTVA 4LUOA 3S24A 11ASA 4A93G 4A3KG 3RN5A 2WAQE 3L1AA 4GKJQ 3OYYA 2R92H 1YEZA 5IYCG 1PH7A 3RKYA 4IFDI 1EIYB 1VQFA 1YHQA 1NNHA 3G1ZA 5FLXc 1YFSA 3VQXA 4GOPA 2K4KA 1K0RA 4LF8Q 4MNOA 4QY7A 3CC2A 4LFAL 5IY0A 1JJ2A 1YNXA 4JI1Q 4CS4A 4MTNA 4DPGA 3CXCA 1EQRA 1EQQA 3PO2H 1HR0W 1EFWA 2B63G 4YY3L 3NEMA 1N36L 5E7NA 4JBMA 4DR4L 2F3IA 5M3FG 3OW2A 1S72A 4P72C 4WJ3M 1WYDA 3ULJA 3J7A5 1IL2A 3HFZA 2ZJQA 2XGTA 1Q81C 1V9PA 1HH2P 2E1HA 3HOYH 3UGTA 1HC7A 2VY3A 2QEXA 4LF9Q 4WJ4A 3V8KA 4RQFA 4BXXH 2I5HA 4X6AH 3T1YL 1NJIC 3PO2G 1V43A 1E1OA 1HXDA 4GKKQ 4BA1I 3H3VI 1JMCA 4JI5L 1CKMA 2BA0A 2Z6KA 3G6EA 4P73C 5BR8L 1W2BA 2ARUA 1PYSA 3HOWG 4JI3L 3S16H 3KJPA 3L4GA 1A63A 1VQ5A 2DQ0A 4DR2Q 2JA7H 2A1AA 1QUQA 2WAQG 2JK8A 2PNHA 4LF4L 2DDZA 4DR1L 1I94Q 1UE5A 4HT4A 4PZ8A 4IJLA 3L7ZC 1KXLA 4C2MH 3K8AA 4HJAA 4JI8Q 4JI6L 4RDXA 3CCEA 1Q1BA 3M9BA 4A3EH 3KDFA 1HZCA 1U5KA 5JEAJ 5C4XH 2RHSA 4NB3A 4LVMA 2DTHA 4GN3B 2F52A 3HXUA 3HXVA 2F4VQ 2DTIA 1VQLA 4BY1H 2LSSA 1WQWA 5GROA 2MNAA 4A3GH 4P3PA 2YYZA 1YHBA 4XTYA 1QZHA 1NY4A 1UE7A 4B3RQ 4UY8C 1X6OA 3GTGH 1LUZA 2AKWB 2ZTCA 4R4QA 3A5UA 3A5ZB 1UE6A 2AMCA 4A3EG 1X54A 4TTVA 4AQYQ 2ZTEA 4AIMA 4C3JH 2UXBQ 4UP9A 1NJ6A 2ZTDA 3R07A 4LVKA 4H2YA 2I5LX 4DR7L 2KENA 1WQ7A 3CPWA 1CKOA 1NJ5A 3HFVA 4BY1G 1M1KC 1VQ8A 1R9TH 4Q6GA 4KHZA 2ALYA 1C7YA 2XTIA 2A8EA 4NXML 3GTPH 1OXTA 2UU9Q 5LMUQ 4X62Q 3HOVG 2K14A 5E3IA 3J80i 1Y1WG 4Y52H 4HWSA 2NZOA 3QNEA 3F8TA 3HXZA 1L0WA 5K36G 5C44H 3B6YA 2Q2TA 1Z9FA 4AH6A 1B8AA 3RF1A 4K86A 3UDFA 4DR5L 3HOUG 1YB3A 2N8NA 2VNUD 4GS3A 4HWRA 1MIUA 3RGLA 2MQHA 1XNQQ 5M3MG 2FXQA 4YRFA 5IT9c 3S1MH 2I4NA 2MFIA 3PIPA 2ZT6A 2DKGA 2PMFA 4EX5A 4OXPA 1FJGQ 2NVQH 4NXNQ 1PVOA 1B76A 3P8YA 1NBWA 2ARTA 2UXCQ 1E7ZA 1SESA 2NZHA 3UDXA 3IG2A 3A5YA 4O0AA 1QVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P72 A;  2DUD A;  2JQO A;  2PMZ E;  2RF4 A;  5C44 G;  3CMQ A;  1HR0 Q;  1EVK A;  4A3I H;  2L15 A;  1ASY A;  1WNL A;  2J3L A;  1D7Q A;  2JEA I;  2ZIM A;  3HY0 A;  4JI2 Q;  5GAG C;  4IO9 A;  4CH5 A;  2HT1 A;  3A31 A;  1PA6 A;  2A8V A;  4DUZ L;  1I5F A;  4DR6 Q;  4YRM A;  1EOV A;  2D0P A;  1IYJ B;  1N33 L;  2JA6 H;  4BBR H;  1SN8 A;  2CCZ A;  1P16 A;  2Q7E A;  4YRO A;  1C0A A;  1IBL Q;  2UXD L;  2CJA A;  2ODR C;  2NVT H;  4EO4 A;  2Q5H A;  3CPF A;  1PYB A;  1L2F A;  4P3N A;  5HGQ A;  2H5X A;  2R7D A;  5DLQ E;  4P73 A;  5AJ3 Q;  2ZZE A;  3AFQ A;  3REX A;  1JJG A;  4A3I G;  3CCJ A;  1NYR A;  1EWI A;  3PUY A;  4R4I A;  2CJB A;  3J80 c;  1YFT A;  4X64 L;  4L5Q A;  3HOX H;  4YYE A;  1CKN A;  1K8A C;  5IP9 G;  4JI7 L;  5IYD H;  3H15 A;  1VQE A;  2VZA A;  1BKB A;  1J5E L;  1VQ9 A;  1GVP A;  4DV1 L;  3ICE A;  4H2V A;  4YRC A;  3M4P A;  2JA6 G;  4BBR G;  1YJW A;  3CCQ A;  2E65 A;  3AQQ A;  3F1Z A;  3HOZ H;  5FLM G;  2DVE A;  1VQI A;  2IHF A;  1N34 Q;  4IFD J;  3H0G G;  3RAC A;  3PCO A;  4A3J H;  1XJV A;  3RKX A;  4KR2 A;  4K87 A;  1NJ2 A;  1E22 A;  4TVA B;  3G4S A;  1S3O A;  4CS2 A;  5F5W A;  3K81 C;  3S1N H;  4YRE A;  3HOX G;  1N9W A;  3J81 j;  3IKL A;  4IPH A;  3L2Z A;  3K7A H;  3TEH B;  3I4M H;  1NJ8 A;  3A7U A;  3NEL A;  4HA8 A;  3I4N G;  4GKK L;  4YCW A;  1EUJ A;  2E5L Q;  4OX9 Q;  3E0E A;  5H1S E;  4LFB Q;  1X3E A;  3HOZ G;  3HTZ A;  1E3P A;  3MF1 A;  4HIO A;  5K1P A;  2WP8 J;  2DEQ A;  4PZ7 A;  3DLL A;  3QO7 A;  4B3T Q;  4YHH Q;  4DR2 L;  2E8G A;  4PHC A;  4JI4 Q;  1XNR L;  2UUA Q;  4UP7 A;  1OXU A;  4P71 C;  1I94 L;  1NMF A;  3PF5 A;  1XMQ Q;  2ZTG A;  2IX0 A;  3TEG A;  2OTL A;  3OTO Q;  3V7C A;  3CF5 A;  4HJ5 A;  1PH2 A;  4CH6 A;  3ERR A;  4LFC Q;  1W66 A;  1VQH A;  4DV3 L;  3RIR A;  3AYH B;  4PMW A;  2IT1 A;  3PSI A;  3UE0 A;  5IWA L;  2DZC A;  5FJ8 H;  2J3M A;  5M5W H;  3GD7 A;  4K0K Q;  2KCM A;  4DV4 L;  3UFG A;  1H4T A;  1BIA A;  2ZNJ A;  3OD1 A;  1JJC A;  2N49 A;  4K88 A;  3GTM H;  1PH1 A;  1VS0 A;  2ARS A;  1D8L A;  5GAH C;  2A19 A;  3IAL A;  2EL9 A;  2DQ3 A;  4FDB A;  3K7U C;  1Q12 A;  1HNZ Q;  4X66 L;  3LSQ A;  4YRK A;  2AWN A;  4POG A;  4DV5 L;  2NVX H;  4DQ2 A;  4HWO A;  3PUV A;  3VQY A;  4BW9 A;  2R92 G;  4GNX B;  4CS3 A;  4WI1 A;  3W3S A;  4QGU A;  3I7F A;  2CJ9 A;  1HNX Q;  4DV2 L;  4GN5 A;  3M3Y H;  3KF6 B;  4KHP Q;  4XTC S;  4HVC A;  1XPU A;  3IKM B;  1UE1 A;  1YFR A;  1KL9 A;  1X55 A;  5FJ8 G;  1JE5 A;  3FP9 A;  1XPO A;  2VUM H;  4AQY L;  4OP0 A;  1QF6 A;  3RR5 A;  1M90 C;  3P8T A;  3Q8D A;  4DKA C;  3HRI A;  2VQF L;  3STB D;  2HHH Q;  3RLN A;  3UDI A;  3CME A;  2JA5 H;  1SRY A;  1Q1E A;  1L1O B;  3W1B A;  3L2P A;  4R1J A;  3AFP A;  4TVW A;  3K80 C;  1FYF A;  3W1G A;  3T1H Q;  4YDQ A;  1BBU A;  4XIG S;  2K5V A;  4LF7 L;  1HZ9 A;  3CCU A;  3DSQ A;  1QE0 A;  2ZT8 A;  3F2D A;  4JI0 Q;  3BU2 A;  1HJP A;  3HKZ G;  4QIW E;  1UEB A;  2UUC L;  1IBK Q;  2B3G A;  2RCN A;  1EIF A;  3FJP A;  4NCX A;  3HOY G;  1JT8 A;  2CQO A;  4A76 A;  5GAE C;  1Z7M A;  1B70 A;  4XEM A;  1A8V A;  4GOP B;  2ZM6 L;  2JA5 G;  3BZK A;  4BXX G;  1IBM L;  1HTT A;  4QJF A;  1OXV A;  2NVY H;  2HQL A;  2Q2H A;  4OWX B;  4XTX A;  2C7I A;  1X2G A;  3J7Z C;  4YRP A;  4XU1 A;  4ALP A;  2CKZ B;  3CC7 A;  4YRQ A;  4B3M L;  2DU5 A;  3DM3 A;  4BWA A;  3JC6 6;  2KHI A;  4LF5 L;  3ZJY C;  5HY6 A;  2PQA A;  1MJE A;  1N32 Q;  1K8G A;  2QHT A;  2OWO A;  2LXJ A;  3A0J A;  2JA7 G;  1IZ6 A;  4DV7 Q;  1Z7N A;  4LFA Q;  3GO5 A;  5LMN L;  1FGU A;  2GVA A;  3HFZ B;  4Y7N H;  3RZD H;  4H2X A;  2ES2 A;  2QHU A;  1I3Q H;  2AHO B;  4JBJ A;  3RNU A;  1VQA A;  1YI2 A;  3GTL H;  1SET A;  2EXD A;  4YY3 Q;  2ZT5 A;  1N36 Q;  3W5O A;  4DR4 Q;  4CH3 A;  4IPD A;  3FKI H;  2JA8 H;  3RN2 A;  3A7R A;  2G4C A;  2WFW A;  2EWN A;  1JB7 A;  1USY C;  5C4X G;  4XU3 A;  1IBL L;  5C51 B;  5JJL A;  1E1T A;  4YWK A;  1SER A;  4R4C A;  1YJN A;  3KOJ A;  4IPG A;  1P8L A;  5C3E H;  1PYS B;  1PH5 A;  4A3F H;  3ULL A;  1VQ6 A;  3K0X A;  3L4G B;  4H2T A;  5C52 B;  1FL0 A;  3GTQ H;  3HXW A;  1YVC A;  4A3G G;  1H95 A;  2ZZG A;  4UP8 A;  1HZA A;  5JJI A;  2E2H H;  2BA1 A;  3T1Y Q;  1XTD A;  3TQY A;  3JAM i;  4ME3 A;  1BBW A;  4P71 A;  4JI5 Q;  4YRL A;  3GDE A;  2WB1 E;  3S2D H;  3FKI G;  4PZ6 A;  3IRB A;  2N3S A;  1B7Y A;  2VQE L;  3PV0 A;  5BR8 Q;  4OWT B;  4LUZ A;  4JI3 Q;  1HZB A;  1I50 H;  1X56 A;  1SMX A;  4DK6 C;  4HJ8 A;  3KDF B;  1HNW L;  1G6P A;  4QL5 A;  5JJK A;  2ZCE A;  2RHQ A;  3MF2 A;  3EFS A;  2RHS B;  4KLK A;  4LF4 Q;  1QVF A;  2ZNI A;  4DR1 Q;  2QA4 A;  2JJQ A;  2GN5 A;  4DV6 L;  4G84 A;  1S40 A;  1XMO L;  4DV0 L;  4B3S L;  4IOA A;  4P3O A;  4GLA C;  3RL6 A;  4JI6 Q;  3A7A A;  1Q46 A;  1TWC H;  1X01 A;  4JYA L;  4ZIB A;  4XTW A;  1VCI A;  4LF6 L;  1J5W A;  2K50 A;  2VL6 A;  2UUB L;  4TVA A;  3PUW A;  1ASZ A;  1OXS C;  1VQD A;  2AMC B;  3PIO A;  3I56 A;  2OTJ A;  4JV5 Q;  4XTZ A;  1NTG A;  3GTJ H;  1VQP A;  2EJF A;  2DZ9 A;  4JBK A;  4L5R C;  2CIM A;  2YTY A;  1WFQ A;  2HIV A;  1WU7 A;  4QQB X;  1EYG A;  4GKJ L;  1GD7 A;  3OTO L;  4P74 C;  3CCM A;  1YBY A;  2IY5 A;  1PH3 A;  4A3C H;  2ALY B;  1K83 H;  2Y0S G;  3RLF A;  2C8M A;  2IHE A;  4EQ5 A;  3JAM c;  4LF8 L;  2I4O A;  5GAD C;  1UWV A;  2JE6 I;  3S14 H;  4JI1 L;  4DR7 Q;  2Q7H A;  3MEY A;  3EBE A;  3AEV A;  4A3L H;  2WB1 G;  4HIM A;  2I4L A;  1EIY A;  1H4V B;  2K5H A;  4YWM A;  1Q7Y C;  4NXM Q;  3HRK A;  2OQ0 A;  4GLV B;  1KHI A;  3EIV A;  4A3M H;  3CCR A;  1HNX L;  3CCV A;  4YP0 A;  2Q7G A;  4XU2 A;  1VQO A;  1OTC A;  1X2H A;  3TS2 A;  1KD1 C;  4JOI C;  3J81 i;  1G51 A;  1O7I A;  4HID A;  4LF9 L;  4E51 A;  4DK3 C;  4YRG A;  3CD6 A;  4ZTU B;  2KCT A;  2I0Q A;  3SGI A;  5IYD G;  3CCS A;  4A3L G;  2EIF A;  1U0L A;  4A93 H;  3T1H L;  1T9H A;  2ZGW A;  2NN6 G;  4L87 A;  4YRI A;  2JA9 A;  4RG1 A;  1TWH H;  1MKH A;  4LNQ A;  4C3I H;  4AYB E;  2P0L A;  4DUY Q;  4J15 A;  4APV A;  4GLX A;  3HY1 A;  3I4O A;  2OCE A;  1G5I A;  4GN4 B;  2K5N A;  3HKZ E;  2PI2 E;  2R93 H;  4A3J G;  3M4O H;  1USY A;  4A4I A;  5IE8 A;  4A3B H;  1FVI A;  3M85 A;  1NJ1 A;  3U4Z A;  3UE1 A;  3TUP A;  4YRN A;  2ZJP A;  3KF8 B;  4X65 Q;  4IOC A;  1C9O A;  3M4Q A;  4ZTZ B;  2ZIO A;  2VS1 A;  2EJ9 A;  4POF A;  5JEA G;  4DUZ Q;  2B63 H;  4JI8 L;  2YV5 A;  4DNI A;  1N33 Q;  3ER0 A;  3I4M G;  1PV4 A;  5M3F H;  5KNN A;  2Q2U A;  3WQZ A;  1CKN B;  1YHA A;  2Q5I A;  2DJZ A;  2GVB A;  3PZC A;  3E9H A;  2UXD Q;  4TQU S;  4TWA A;  1Y1V H;  1WOC A;  3S2H H;  1CUK A;  4JCV E;  4BY7 H;  3D0F A;  3RUX A;  2R93 G;  3UH0 A;  2F4V L;  1N32 L;  2AWO A;  1AE2 A;  4A3B G;  4DV7 L;  3LGJ A;  1X65 A;  4X64 Q;  1YIJ A;  4JI7 Q;  2E41 A;  3PCO B;  2KHJ A;  5LMN W;  1J5E Q;  4YCV A;  3KYH C;  4B3R L;  4DR3 Q;  3J81 c;  4DV1 Q;  1PH8 A;  4A3D H;  1KQS A;  4RQE A;  1BIB A;  5C0X G;  2PME A;  4G85 A;  4H2W A;  1DGS A;  2LXK A;  1PH9 A;  3HOW H;  4BBS H;  2B29 A;  5J3B A;  1Y1V G;  2UXB L;  4H2S A;  2CWA A;  4WF2 A;  4A75 A;  4NPS A;  4BY7 G;  1Y14 B;  3KLW A;  3U4V A;  4OWW B;  3D31 A;  5IYB H;  2AKW A;  2ZR2 A;  4LNS A;  3NBH B;  4AYB G;  3A5Z A;  1RIQ A;  2CFM A;  3L0O A;  5IP7 H;  1PH6 A;  1SE8 A;  4X5O A;  1TXY A;  2ATW A;  1QZG A;  3A74 A;  3ICA A;  3GTO H;  3F2B A;  2OQK A;  3TRE A;  1TWF H;  2UU9 L;  5LMU L;  4R4T A;  4X62 L;  4R4O A;  4A3D G;  3MEF A;  2E3C A;  2I5M X;  2ODR D;  2Q2I A;  1NE3 A;  1WPY A;  2DTO A;  2ZXF A;  4P74 A;  2VUM G;  1X3G A;  2HNI A;  4BBS G;  1X3F A;  1A62 A;  4HIK A;  2ASB A;  1XNR Q;  5IYB G;  1JJC B;  1XNQ L;  3FHW A;  1GGM A;  2MO1 A;  5GQO A;  2DGY A;  4OO1 G;  3LSS A;  1VQM A;  5IP7 G;  3NEN A;  1FJG L;  2N78 A;  4BA2 I;  4TQF A;  4DV3 Q;  4NXN L;  3UDG A;  1SRU A;  4HJ7 A;  5IWA Q;  3CP0 A;  2UXC L;  2EQS A;  4YRJ A;  4YRS A;  3CQZ H;  4DV4 Q;  1WLE A;  2VW9 A;  1V1Q A;  3ULP A;  4GNX C;  2DXU A;  4PG3 A;  1SFO H;  1Q86 C;  1HR0 L;  4RMF A;  4HJ9 A;  4O2D A;  4CH4 A;  4YPF A;  1N8R C;  5M5Y H;  3HXX A;  4JV5 L;  3I2Z A;  3RZO H;  3CCL A;  2K52 A;  4JI2 L;  4X66 Q;  4JOI A;  2BH2 A;  1G29 1;  3ERS X;  4DV5 Q;  1Q82 C;  4L5S A;  4DR6 L;  4DAM A;  3BFM A;  1IXR A;  1KRS A;  3BZC A;  1K73 C;  3LC0 A;  4HWT A;  4TQD A;  3VQV A;  4H2U A;  1SLJ A;  1ADJ A;  1L1O C;  1WCM H;  3MXN B;  2HIX A;  3HOV H;  3PGZ A;  4DV2 Q;  2NN6 I;  1Y1W H;  3TRZ A;  1NMG A;  4JC0 A;  1H4S A;  5K1X A;  1J6Q A;  4P75 C;  1EVL A;  3WWV A;  1PH4 A;  4UPA A;  2KBN A;  5AJ3 L;  2Y0S E;  3CC4 A;  3EFR A;  2VQF Q;  4OON A;  3HOU H;  2E2I H;  1A0I A;  3HKS A;  5C0X J;  1LTL A;  1QUQ B;  1VQK A;  2CGH A;  5M3M H;  4LF7 Q;  1B70 B;  3KJO A;  2QHS A;  2R7F A;  1CSP A;  1KMN A;  1GM5 A;  2I4M A;  4IFD G;  2JA8 G;  3RLO A;  1RIP A;  3G48 A;  2Z0S A;  1G5H A;  1KRT A;  4GOP C;  2ZT7 A;  1VQB A;  1RL2 A;  2R7Z H;  1WCM G;  1Q8K A;  2UUC Q;  3PUX A;  1KIX A;  3QO8 A;  1N34 L;  2E2J H;  4IPC A;  4DAY B;  1Z47 A;  4XTU A;  1AE3 A;  2DXT A;  1SRO A;  2ID0 A;  5C3E G;  2CWP A;  4A3F G;  4KR3 A;  1GO3 E;  2ZM6 Q;  5ELO A;  1AH9 A;  1KMM A;  2PQA B;  3H3V H;  1VQJ A;  1IBM Q;  1MJC A;  3EN2 A;  3CMA A;  2EAY A;  3P8V A;  5M5X H;  2R6G A;  3NET A;  4YCU A;  1ADY A;  3UGQ A;  1NYQ A;  3G71 A;  2DU7 A;  4H2X B;  3GTK H;  1TWA H;  1H4Q A;  4B3M Q;  3V7S A;  2E5L L;  4OX9 L;  3S1R H;  2YTX A;  3REU A;  4OLF A;  2R7Z G;  4LFB L;  4DUY L;  4LF5 Q;  4HWP A;  5C0X I;  2V1C C;  1YJ9 A;  1K9M C;  1VQG A;  5LMN Q;  1VQC A;  2YTV A;  2K75 A;  4B3T L;  4YHH L;  1LYL A;  4JBW A;  3VDY A;  3PO3 H;  4JI4 L;  3STB C;  4L5T A;  2UUA L;  3TEH A;  2ZJR A;  4X65 L;  4KI0 A;  5EAY A;  5IP9 H;  1XMQ L;  2C35 B;  2YU9 H;  1KOG A;  2Z6K C;  4Q15 A;  4LFC L;  3CAM A;  5ELN A;  4MZ9 A;  2IX1 A;  1ATI A;  2PI2 A;  3S15 H;  1BVS A;  1YGB A;  4K0K L;  1QVG A;  3F2C A;  1VQZ A;  5FLM H;  2E64 A;  1VQN A;  3I55 A;  4IJH A;  3H0G H;  2QGQ A;  3U50 C;  2ZIN A;  1B7Y B;  3PF4 A;  2P5I A;  3QO5 A;  1HNZ L;  3PO3 G;  3VQW A;  2E10 A;  3S1Q H;  1CSQ A;  2RHQ B;  3S17 H;  1K3R A;  4YRT A;  1PFS A;  3RKW A;  4OO1 I;  2D0O A;  1TWG H;  4DR3 L;  4A3C G;  3A32 A;  3CW2 C;  3I4N H;  5C53 B;  2VQE Q;  1WJJ A;  4KHP L;  1KC8 C;  2EJG A;  4XU0 A;  2BH8 A;  1I6H H;  2MO0 A;  4DR5 Q;  2QHV A;  3PUZ A;  1XPR A;  1PHJ A;  1HNW Q;  4YRR A;  2HHH L;  2ZR3 A;  1E24 A;  12AS A;  3E9I A;  4KQE A;  4GNX A;  4A3K H;  4YWL A;  4DV6 Q;  1SR3 A;  3KF6 A;  2JEB I;  1VQ4 A;  1XMO Q;  4DV0 Q;  4B3S Q;  5IYC H;  1W3S A;  4LWC A;  2D62 A;  1X9N A;  5C4J H;  4JI0 L;  2FYK A;  1KAW A;  3KFU A;  4LUV A;  4JYA Q;  2ZZF A;  3V8J A;  3V8L A;  1YIT A;  2E5A A;  4A3M G;  1IBK L;  4LF6 Q;  3QTC A;  1LM0 A;  3HXY A;  4C3H H;  1L1O A;  2UUB Q;  1WI5 A;  1OXX K;  3U58 A;  1VQ7 A;  2IY5 B;  4JG2 A;  4TVY A;  3BJU A;  4P75 A;  3VBB A;  3V7R A;  4LW1 A;  4H02 A;  3TS0 A;  1GKH A;  1YZ6 A;  4XEO A;  3M7N A;  4XTV A;  4LUO A;  3S24 A;  11AS A;  4A93 G;  4A3K G;  3RN5 A;  2WAQ E;  3L1A A;  4GKJ Q;  3OYY A;  2R92 H;  1YEZ A;  5IYC G;  1PH7 A;  3RKY A;  4IFD I;  1EIY B;  1VQF A;  1YHQ A;  1NNH A;  3G1Z A;  5FLX c;  1YFS A;  3VQX A;  4GOP A;  2K4K A;  1K0R A;  4LF8 Q;  4MNO A;  4QY7 A;  3CC2 A;  4LFA L;  5IY0 A;  1JJ2 A;  1YNX A;  4JI1 Q;  4CS4 A;  4MTN A;  4DPG A;  3CXC A;  1EQR A;  1EQQ A;  3PO2 H;  1HR0 W;  1EFW A;  2B63 G;  4YY3 L;  3NEM A;  1N36 L;  5E7N A;  4JBM A;  4DR4 L;  2F3I A;  5M3F G;  3OW2 A;  1S72 A;  4P72 C;  4WJ3 M;  1WYD A;  3ULJ A;  3J7A 5;  1IL2 A;  3HFZ A;  2ZJQ A;  2XGT A;  1Q81 C;  1V9P A;  1HH2 P;  2E1H A;  3HOY H;  3UGT A;  1HC7 A;  2VY3 A;  2QEX A;  4LF9 Q;  4WJ4 A;  3V8K A;  4RQF A;  4BXX H;  2I5H A;  4X6A H;  3T1Y L;  1NJI C;  3PO2 G;  1V43 A;  1E1O A;  1HXD A;  4GKK Q;  4BA1 I;  3H3V I;  1JMC A;  4JI5 L;  1CKM A;  2BA0 A;  2Z6K A;  3G6E A;  4P73 C;  5BR8 L;  1W2B A;  2ARU A;  1PYS A;  3HOW G;  4JI3 L;  3S16 H;  3KJP A;  3L4G A;  1A63 A;  1VQ5 A;  2DQ0 A;  4DR2 Q;  2JA7 H;  2A1A A;  1QUQ A;  2WAQ G;  2JK8 A;  2PNH A;  4LF4 L;  2DDZ A;  4DR1 L;  1I94 Q;  1UE5 A;  4PZ8 A;  4IJL A;  3L7Z C;  1KXL A;  4C2M H;  3K8A A;  4HJA A;  4JI8 Q;  4JI6 L;  4RDX A;  3CCE A;  1Q1B A;  3M9B A;  4A3E H;  3KDF A;  1HZC A;  1U5K A;  5JEA J;  5C4X H;  2RHS A;  4NB3 A;  2DTH A;  4GN3 B;  2F52 A;  3HXU A;  3HXV A;  2F4V Q;  2DTI A;  1VQL A;  4BY1 H;  2LSS A;  1WQW A;  5GRO A;  2MNA A;  4A3G H;  4P3P A;  2YYZ A;  1YHB A;  4XTY A;  1QZH A;  1NY4 A;  1UE7 A;  4B3R Q;  4UY8 C;  1X6O A;  3GTG H;  1LUZ A;  2AKW B;  2ZTC A;  4R4Q A;  3A5U A;  3A5Z B;  1UE6 A;  2AMC A;  4A3E G;  1X54 A;  4TTV A;  4AQY Q;  2ZTE A;  4AIM A;  4C3J H;  2UXB Q;  4UP9 A;  1NJ6 A;  2ZTD A;  3R07 A;  4H2Y A;  2I5L X;  4DR7 L;  2KEN A;  1WQ7 A;  3CPW A;  1CKO A;  1NJ5 A;  3HFV A;  4BY1 G;  1M1K C;  1VQ8 A;  1R9T H;  4Q6G A;  4KHZ A;  2ALY A;  1C7Y A;  2XTI A;  4NXM L;  3GTP H;  1OXT A;  2UU9 Q;  5LMU Q;  4X62 Q;  3HOV G;  2K14 A;  5E3I A;  3J80 i;  1Y1W G;  4Y52 H;  4HWS A;  2NZO A;  3QNE A;  3F8T A;  3HXZ A;  1L0W A;  5K36 G;  5C44 H;  3B6Y A;  2Q2T A;  1Z9F A;  4AH6 A;  1B8A A;  3RF1 A;  4K86 A;  3UDF A;  4DR5 L;  3HOU G;  1YB3 A;  2N8N A;  2VNU D;  4GS3 A;  4HWR A;  1MIU A;  3RGL A;  2MQH A;  1XNQ Q;  5M3M G;  2FXQ A;  4YRF A;  5IT9 c;  3S1M H;  2I4N A;  2MFI A;  3PIP A;  2ZT6 A;  2DKG A;  2PMF A;  4EX5 A;  4OXP A;  1FJG Q;  2NVQ H;  4NXN Q;  1PVO A;  1B76 A;  3P8Y A;  1NBW A;  2ART A;  2UXC Q;  1E7Z A;  1SES A;  2NZH A;  3UDX A;  3IG2 A;  3A5Y A;  4O0A A;  1QVC A; 
#chains in the Genus database with same CATH topology
 3MHB A;  4P72 A;  2DUD A;  2JQO A;  2PMZ B;  2PMZ E;  2RF4 A;  5C44 G;  4HCS A;  3CMQ A;  1HR0 Q;  1EVK A;  4A3I H;  1S5C D;  2L15 A;  2Z9H A;  1QCB D;  4RAU C;  1FNV A;  3AMU A;  1ASY A;  4UAI A;  4K6D A;  1WNL A;  2J3L A;  5FO9 B;  1D7Q A;  2JEA I;  2ZIM A;  1HQR D;  3HOZ B;  3A7L A;  3SK4 A;  3HY0 A;  2F0F A;  4ME5 A;  5CYU A;  4JI2 Q;  5GAG C;  2J7Z A;  2HD3 A;  4HR7 B;  3U9O A;  4IO9 A;  4CH5 A;  2HT1 A;  3A31 A;  3TP5 A;  1PA6 A;  1BCP D;  2A8V A;  2F0V A;  1I5F A;  4DUZ L;  4DR6 Q;  4YRM A;  2F0T A;  4A3J B;  1EOV A;  2D0P A;  1IYJ B;  1N33 L;  1JOK A;  1IW7 D;  4Z9C B;  2F0S A;  2JA6 H;  2MJ8 A;  4BBR H;  1SN8 A;  2XIW A;  2CCZ A;  4X3K A;  3DM1 A;  4G7Z C;  1P16 A;  2Q7E A;  1JB3 A;  4YRO A;  1ENC A;  1WTO A;  1C0A A;  4U67 3;  2VB2 X;  1BUV T;  1D5X C;  1IBL Q;  2UXD L;  2Q8R E;  2CJA A;  3SR1 A;  3S1N B;  3KF8 A;  2ODR C;  2NVT H;  1BCP F;  3L3O C;  4EO4 A;  2Q5H A;  1TQO A;  3CPF A;  1A15 A;  1PYB A;  2K6A A;  1C8C A;  4IUR A;  1L2F A;  4P3N A;  5HGQ A;  2H5X A;  4KHV A;  2R7D A;  5DLQ E;  1EEI D;  4P73 A;  2RSN A;  2XSC A;  5ELD A;  2K5W A;  3K7A B;  5AJ3 Q;  2ZZE A;  3I4M B;  3AFQ A;  4HTH A;  3REX A;  1JJG A;  4A3I G;  3CCJ A;  1NYR A;  2BDN A;  3SK6 A;  1EWI A;  3PUY A;  4R4I A;  1WTX A;  1QWY A;  2CJB A;  1TWH B;  3J80 c;  1YFT A;  2F0U A;  4X64 L;  4L5Q A;  3HOX H;  1BNZ A;  2A6H C;  4YYE A;  1CKN A;  2A5H A;  5IP9 G;  1IYU A;  1K8A C;  2PYK A;  4DGZ A;  4JI7 L;  5CV7 A;  5IYD H;  3H15 A;  1U4M A;  1VQE A;  2B2W C;  2VZA A;  1BKB A;  1J5E L;  4G7O C;  1VQ9 A;  4OHJ A;  4CGY B;  3FPP A;  1GVP A;  4DV1 L;  3VR2 A;  2NN6 H;  3ICE A;  3C1F A;  4H2V A;  4YRC A;  3M4P A;  2JA6 G;  4BBR G;  1YJW A;  3CCQ A;  2F3V A;  2E65 A;  2EVB A;  4CHT B;  3AQQ A;  3F1Z A;  3HOZ H;  3R3O A;  1H9J A;  4NDX A;  4KY6 A;  5FLM G;  1A3T A;  1VQI A;  2DVE A;  2IHF A;  2N55 A;  1N34 Q;  4IFD J;  1GUW A;  4OIJ A;  3H0G G;  4C1N I;  5HUR A;  3RAC A;  3PCO A;  4A3J H;  1XJV A;  1PRT C;  3RKX A;  2QDL A;  4KR2 A;  5ELB A;  4K87 A;  1NJ2 A;  1E22 A;  3J81 E;  4TVA B;  3G4S A;  1S3O A;  3D4W A;  3MEH A;  2XRS D;  4CS2 A;  5F5W A;  5M5W B;  3K81 C;  4HCE A;  1I4Q A;  4ZLT F;  1EOT A;  4RHR A;  2K1B A;  1TY2 A;  3S1N H;  4V0B A;  5C3X A;  4YRE A;  3HOX G;  2R61 A;  2KOL A;  1Z7T A;  3GTM B;  1N9W A;  2AQ1 B;  1J9O A;  3J81 j;  3CRL C;  2FMC A;  2B2T A;  3IKL A;  2NUC A;  5CGK A;  3N6R A;  1NUC A;  3E3X A;  4IPH A;  3L2Z A;  3D3R A;  1CZG A;  3K7A H;  3TEH B;  3I4M H;  4L6T B;  1NJ8 A;  3A7U A;  3NEL A;  4HA8 A;  3I4N G;  3MXU A;  4GKK L;  4YCW A;  3DWA A;  1EUJ A;  2E5L Q;  4OX9 Q;  3E0E A;  5H1S E;  4KV6 A;  3E5S A;  4LFB Q;  1X3E A;  3K0Y A;  4O1N A;  3HOZ G;  3HTZ A;  1E3P A;  3NBH A;  1TS3 A;  3MF1 A;  2CQA A;  1STN A;  3I3C A;  4HIO A;  5K1P A;  1XXG A;  2WP8 J;  3CHB D;  4WRD A;  2DEQ A;  1B9N A;  3HKZ B;  4PZ7 A;  3A8I E;  3DLL A;  1B53 A;  4MN3 A;  3EFX D;  3QO7 A;  3R8B A;  1BCP B;  3TN2 A;  4B3T Q;  4YHH Q;  4DR2 L;  2E8G A;  1BF4 A;  3M3Y B;  4PHC A;  1PFM A;  4JI4 Q;  2AUJ D;  1XNR L;  2EYJ A;  2F0O A;  2UUA Q;  2HCI A;  4UP7 A;  1OXU A;  4KY7 A;  4P71 C;  3D4D A;  1SE3 A;  1I94 L;  1SBB B;  1NMF A;  2VUM B;  3PF5 A;  1XMQ Q;  2ZTG A;  2IX0 A;  1RJT A;  2EY1 A;  1XX8 A;  2KUM A;  3W3A A;  2OTL A;  2K05 A;  3MTS A;  3TEG A;  3OTO Q;  4ILW A;  4HSP A;  5JPM C;  3HZX A;  1ZYR C;  3V7C A;  3CF5 A;  4HJ5 A;  3OMC A;  1PH2 A;  3IL8 A;  4CH6 A;  3ERR A;  4LFC Q;  1VQH A;  1W66 A;  4DV3 L;  2JA5 B;  3RIR A;  3AYH B;  3FRP B;  4PMW A;  2IT1 A;  3PSI A;  4ZYS A;  1LTG D;  4JVZ A;  1PYW D;  3KBX A;  1E0B A;  3UE0 A;  5IWA L;  4IUN A;  5F2D A;  2DZC A;  1GUN A;  5FJ8 H;  2J3M A;  1A3U A;  1NAP A;  5M5W H;  3GD7 A;  3QOJ A;  4K0K Q;  2KCM A;  4DV4 L;  3UFG A;  2B8F A;  1H4T A;  1BIA A;  1I4R A;  5ISR A;  2ZNJ A;  1ET9 A;  3OD1 A;  1JJC A;  5DNF A;  2N49 A;  4K88 A;  3GTM H;  1PH1 A;  1VS0 A;  3VYT A;  1G6Z A;  1D8L A;  4JK1 C;  5ELC A;  2ARS A;  3ITP A;  5GAH C;  2A19 A;  3IAL A;  2B2V C;  2EL9 A;  2DQ3 A;  4OEM B;  4FDB A;  3K7U C;  1BO0 A;  1Q12 A;  3D6W A;  1HNZ Q;  4X66 L;  3LSQ A;  4YRK A;  2RCF A;  5A2Q E;  5DAU A;  2AWN A;  4POG A;  4DV5 L;  2NVX H;  4DQ2 A;  4RKL A;  4HWO A;  3PUV A;  3VQY A;  3VR6 A;  4B08 A;  4BW9 A;  3KK7 A;  2R92 G;  3FEW X;  2M9V A;  4GNX B;  4CS3 A;  4KK7 A;  4WI1 A;  3W3S A;  1RF2 D;  3I7F A;  4QGU A;  2CJ9 A;  1HNX Q;  4DV2 L;  4GN5 A;  3Q0A A;  4XQQ A;  3M3Y H;  2QF7 A;  3KF6 B;  4KHP Q;  4XTC S;  4HVC A;  1XPU A;  3IKM B;  1UE1 A;  5EPK A;  1YFR A;  4CDF C;  1KL9 A;  2HDM A;  1AN8 A;  1X55 A;  5FJ8 G;  1JE5 A;  3FP9 A;  4KD4 A;  1XPO A;  2NVY B;  2VUM H;  1CT1 D;  1MSH A;  4KKT A;  4AQY L;  4OP0 A;  2EJF C;  1QF6 A;  3RR5 A;  1MSG A;  2FJ2 A;  4I65 A;  1M90 C;  3P8T A;  4CJ1 B;  2V4D A;  3Q8D A;  3BZD B;  4DKA C;  4LK1 C;  4X3U A;  3STB D;  2VQF L;  3HRI A;  2HHH Q;  2BOS A;  1DJR D;  3RLN A;  3UDI A;  3CME A;  2JA5 H;  1SRY A;  1QJO A;  4WFN 3;  1Q1E A;  2L0C A;  1PXU A;  1L1O B;  3W1B A;  1FGB D;  1W6J A;  4R1J A;  3L2P A;  3AFP A;  4TVW A;  1PFN A;  5I6Y A;  3K80 C;  1FYF A;  3W1G A;  3VA7 A;  3T1H Q;  1MD2 D;  1BBU A;  4YDQ A;  4N9P A;  1EQV A;  4XIG S;  5DM6 3;  5D14 A;  2K5V A;  2XWJ B;  1QOH A;  4LF7 L;  1HZ9 A;  1EY7 A;  5KYL A;  1JWM D;  4OO1 H;  3CCU A;  1PZJ D;  3DSQ A;  3OWE B;  2EYF A;  5CV4 A;  1QE0 A;  2ZT8 A;  4CDE C;  1F9R A;  1I4P A;  3F2D A;  4JI0 Q;  3BU2 A;  3RD4 A;  1HJP A;  3LWE A;  1JE4 A;  3HKZ G;  4Y7N B;  4QIW E;  3RZD B;  1O7L A;  1UEB A;  4MTK A;  1I3Q B;  3R93 A;  1B4O A;  1I4X A;  1SYB A;  1IBK Q;  2UUC L;  2F0Q A;  1DYQ A;  2JP1 A;  4JPB W;  1V1P A;  2B3G A;  4KTA A;  2RCN A;  1EIF A;  3FJP A;  3MXG A;  4ZKB B;  1YNJ C;  2RKS A;  1SND A;  2PQE A;  4NCX A;  3HOY G;  3BYT B;  1S4Z A;  1JT8 A;  2CQO A;  5J39 A;  4A76 A;  5GAE C;  2JA8 B;  4K14 A;  1Z7M A;  4N9T A;  1B70 A;  4XEM A;  1A8V A;  2PW5 A;  4I7A A;  1J8I A;  3TSS A;  4GOP B;  4NP5 A;  1F9P A;  2ZM6 L;  5JPN C;  2JA5 G;  1D5M C;  3BZK A;  1VF7 A;  4QCL A;  4BXX G;  1IBM L;  2CVR A;  1IKL A;  2OT2 A;  2Z1C A;  4G4K A;  5FLX L;  1HTT A;  4QJF A;  1O78 A;  3MVV A;  1Y8N B;  1OXV A;  2NVY H;  2HQL A;  3QG1 A;  2Q2H A;  4OWX B;  4XTX A;  2C7I A;  1X2G A;  4K5X A;  3J7Z C;  3MFY A;  4YRP A;  5C3E B;  4XU1 A;  4DAY A;  2EYP A;  4ALP A;  2B2W A;  4A3F B;  2CKZ B;  4ZUJ A;  3CC7 A;  4YRQ A;  1SSO A;  4B3M L;  2DU5 A;  3DM3 A;  3P1H A;  4BWA A;  3GTQ B;  3JC6 6;  2F1M A;  2IX3 A;  1JC7 A;  3Q23 A;  2E2H B;  2KHI A;  4LF5 L;  4ZCK A;  2E76 C;  5HY6 A;  1B3A A;  3ZJY C;  2PQA A;  1MJE A;  3KLR A;  1N32 Q;  1K8G A;  5M5Y B;  1GUG A;  4KJN A;  2QHT A;  2G9H D;  2OWO A;  2LXJ A;  3A0J A;  2JA7 G;  3DEO A;  1IZ6 A;  1RDP D;  1Y8O B;  1JWU D;  3PMF A;  4DV7 Q;  1Z7N A;  4LFA Q;  3GO5 A;  5LMN L;  1AZP A;  3S2D B;  1FGU A;  5JVG 3;  2EJM A;  2GVA A;  1HFN A;  3HFZ B;  4Y7N H;  3OWF A;  5KYI A;  3RZD H;  4H2X A;  5TSS A;  2FIN B;  3PIO 3;  2ES2 A;  2QHU A;  1I3Q H;  2AHO B;  3BVM A;  4JBJ A;  3RNU A;  1VQA A;  1WTR A;  3BS1 A;  1YI2 A;  3GTL H;  2MP1 A;  4S3S A;  3K59 A;  2BE5 C;  1D5Z C;  1I50 B;  1IYV A;  1SET A;  3CU7 A;  2EXD A;  4YY3 Q;  2ZT5 A;  2E2J B;  1N36 Q;  3W5O A;  4DR4 Q;  4CH3 A;  1T5E A;  3NWT A;  1U4P A;  2BCO A;  1EEF D;  1SMY D;  2QIL A;  4IPD A;  3FKI H;  2MGS A;  2JA8 H;  3RN2 A;  3SK8 A;  5CMD A;  2I46 A;  3A7R A;  2G4C A;  2F0J A;  1O80 A;  2WFW A;  4KJO A;  2NYZ D;  1GHK A;  4H13 C;  2EWN A;  1RD9 D;  1JB7 A;  1USY C;  1D2B A;  5C4X G;  1FNW A;  2P5Z X;  5JOB A;  4FXK C;  2LS0 1;  2C9O A;  5C5M A;  5FO8 B;  4XU3 A;  1IBL L;  3OW7 A;  3H91 A;  2OXP A;  5C51 B;  3MXP A;  5JJL A;  1E1T A;  1SNQ A;  4YWK A;  1SER A;  4R4C A;  4B9W A;  1YJN A;  3KOJ A;  4IPG A;  2RA4 A;  1P8L A;  1LT3 D;  2TMP A;  4ZK9 B;  1TWC B;  5C3E H;  2KHS A;  2JYO A;  1ILP A;  1PYS B;  1VMP A;  1PH5 A;  2Y0S B;  4A3F H;  3ULL A;  1VQ6 A;  5FKA C;  1PMR A;  4LVL A;  1HQM C;  3LX0 A;  3K0X A;  3L4G B;  4H2T A;  5C52 B;  1FL0 A;  3GTQ H;  2F0D A;  1YVC A;  4A3G G;  3HXW A;  1H95 A;  4ABN A;  2ZZG A;  4KKU A;  4UP8 A;  1HZA A;  5JJI A;  2E2H H;  2BA1 A;  3ZYY X;  3T1Y Q;  2K33 A;  4EQP A;  1XTD A;  3TQY A;  1H9M A;  4XDX A;  3JAM i;  3A8K E;  4IUV A;  4ME3 A;  1BBW A;  1STY A;  4P71 A;  1TT2 A;  1CHQ D;  3GTJ B;  4JI5 Q;  4YRL A;  3GDE A;  2WB1 E;  3S2D H;  3FKI G;  4PZ6 A;  3IRB A;  2N3S A;  1B7Y A;  1K8O A;  1UNS A;  2VQE L;  1JWS D;  3PV0 A;  3C3L A;  5BR8 Q;  4P2C B;  2WAC A;  2JN4 A;  4OWT B;  4LUZ A;  4JI3 Q;  1HZB A;  4C3J G;  2Z6B A;  3R2I A;  1I50 H;  1X56 A;  4BWG B;  3SEB A;  3BVZ A;  1SMX A;  4DK6 C;  2YU9 B;  1LTI D;  4CKB A;  4HJ8 A;  3KDF B;  1HNW L;  5EGT A;  1G6P A;  4QL5 A;  2F0H A;  5JJK A;  2ZCE A;  2RHQ A;  3MF2 A;  3EFS A;  2RHS B;  4KLK A;  4LF4 Q;  1QVF A;  2ZNI A;  4DR1 Q;  5L37 A;  2QA4 A;  4ZKC B;  1K83 B;  4L63 B;  2A6E C;  4R9W A;  2JJQ A;  2GN5 A;  4DV6 L;  2B2V A;  4G84 A;  4QF4 A;  2HDL A;  1S40 A;  2OF1 A;  4CDC C;  1XMO L;  4DV0 L;  4B3S L;  4IOA A;  4P3O A;  4GLA C;  2A73 B;  2L4N A;  1D1K A;  3S14 B;  3RL6 A;  2AQ2 B;  3NTK A;  4JI6 Q;  3A7A A;  3HP3 A;  3NE5 B;  3WOE A;  1Q46 A;  1TWC H;  5ELF A;  5EPJ A;  1X01 A;  4JYA L;  4HAE A;  4ZIB A;  4XTW A;  1VCI A;  4MHE A;  4LF6 L;  1J5W A;  3VR4 A;  4CBV A;  2DY8 A;  2K50 A;  2VL6 A;  2Z4H A;  1JR0 D;  2UUB L;  1PTO C;  4TVA A;  5DEH A;  2H1E A;  3PUW A;  1NNX A;  1ASZ A;  1OXS C;  1VQD A;  2AMC B;  3FPU B;  3PIO A;  3I56 A;  2OTJ A;  3X3M A;  4JV5 Q;  1BOS A;  4DU9 A;  4XTZ A;  1NTG A;  3GTJ H;  3QR8 A;  5C6A A;  5LHY 1;  1VQP A;  2EJF A;  2DZ9 A;  4JBK A;  4L5R C;  4A3M B;  2CIM A;  1EU3 A;  2YTY A;  1WFQ A;  1RKN A;  2HIV A;  2DJG C;  5IOD A;  1WU7 A;  4QQB X;  1LLR D;  1BBX C;  5BN5 A;  3I90 A;  1PZI D;  1EYG A;  2PZU A;  4GKJ L;  2K5D A;  1ESF A;  1GD7 A;  3OTO L;  4P74 C;  3CCM A;  2RBM A;  4H7B A;  1EL0 A;  5KNC A;  1YBY A;  2IY5 A;  2K5Q A;  1PH3 A;  4A3C H;  3MQZ A;  4DF7 A;  5D65 A;  2ALY B;  1K83 H;  1H9K A;  2Y0S G;  2CW0 C;  3RLF A;  3BDO A;  4A93 B;  4A3K B;  2IHE A;  2C8M A;  5G3L D;  4EQ5 A;  3JAM c;  4LF8 L;  5JVH 3;  2I4O A;  5GAD C;  1GOZ A;  1UWV A;  2K01 A;  2A69 C;  1WVL A;  2JE6 I;  3S14 H;  4JI1 L;  4C3I B;  3PQI A;  4DR7 Q;  2Q7H A;  3MEY A;  3EBE A;  1DZ1 A;  1BDO A;  3AB9 A;  3AEV A;  4A3L H;  3GV3 A;  2EOT A;  1GUO A;  2WB1 G;  5CC4 A;  1KNA A;  4HIM A;  4OEL B;  3OPO A;  4XQN A;  4J6H A;  4G57 A;  5G3L F;  2I4L A;  1C4Q A;  2E2D C;  4KMU C;  5FLX E;  3QO2 A;  1EIY A;  3MA2 B;  1H4V B;  2R93 B;  3EJI A;  3M4Y A;  2K5H A;  3M4O B;  1K8M A;  4BS9 A;  2EY6 A;  4A3B B;  4YWM A;  1Q7Y C;  4NXM Q;  3T51 B;  3HRK A;  2OQ0 A;  4GLV B;  2X6G A;  1KHI A;  4L8J A;  3VR5 A;  3EIV A;  3P75 A;  3SK5 A;  4EQN A;  4A3M H;  1SJE D;  4X3T A;  3CCR A;  4XQJ A;  3CCV A;  1SAP A;  4RH6 A;  1HNX L;  4YP0 A;  3E0J A;  3ERO A;  2Q7G A;  4XU2 A;  3QOL A;  5IT9 L;  1VQO A;  2B63 B;  4RCN A;  1OTC A;  1EYA A;  1X2H A;  3TS2 A;  1KD1 C;  5M3F B;  4JOI C;  3J81 i;  1FR3 A;  1G51 A;  1O7I A;  3URY A;  5CV8 A;  4HID A;  4LF9 L;  2F0I A;  4E51 A;  4IAL A;  4DK3 C;  1M4V A;  3C1E A;  4YRG A;  3CD6 A;  4GZY C;  4ZTU B;  2F0K A;  2KCT A;  2XVS A;  1G8Z D;  1Y1V B;  3HS0 C;  2IWH A;  2I0Q A;  3SGI A;  5IYD G;  3CCS A;  4A3L G;  5JEA H;  1SYF A;  3S2H B;  4K2L A;  5EQ0 A;  2EIF A;  1U0L A;  4FF1 A;  2SDF A;  4CDD C;  4A93 H;  3T1H L;  1T9H A;  4RKB A;  4BY7 B;  1KLG D;  4HN7 A;  1JOO A;  2HUG A;  2ZGW A;  2NN6 G;  1UUP A;  1SE2 A;  2JA9 A;  4L87 A;  5CBA E;  4YRI A;  3OIQ A;  4RG1 A;  1TWH H;  1MKH A;  2EY5 A;  4AYB B;  4C3I H;  4AYB E;  4LNQ A;  2P0L A;  1TR5 A;  4DUY Q;  4J15 A;  3CRK C;  4RGT A;  4APV A;  4GLX A;  4IN3 A;  2TSS A;  5IGF A;  3HY1 A;  3I4O A;  2OCE A;  1G5I A;  4GN4 B;  2K5N A;  2KEE A;  3HKZ E;  2PI2 E;  4DN4 M;  3DXJ C;  1WTW A;  2R93 H;  4A3J G;  3M4O H;  1USY A;  1GUT A;  4A3D B;  4A4I A;  5IE8 A;  1DOM A;  1FVI A;  3M85 A;  4A3B H;  1NJ1 A;  1QB5 D;  3U4Z A;  3UE1 A;  3TUP A;  3VR3 A;  5C4H A;  4YRN A;  1ESR A;  2ZJP A;  3KF8 B;  1EY8 A;  5IIF A;  4X65 Q;  4IOC A;  1C9O A;  3R2T A;  2OEO A;  3M4Q A;  1CTM A;  3QJY A;  1L0X B;  3EA6 A;  4ZTZ B;  2ZIO A;  3HOW B;  1YNN C;  4BBS B;  2VS1 A;  2EJ9 A;  4OIK A;  3OSO A;  1HTP A;  4POF A;  5JEA G;  1GHJ A;  2X6L A;  4DUZ Q;  2PPB C;  2B63 H;  4JI8 L;  4DFA A;  2NZ1 D;  1SYC A;  2YV5 A;  4DNI A;  1AZQ A;  1N33 Q;  3ER0 A;  3I4M G;  1HRJ A;  3SHL A;  2WAQ B;  1PV4 A;  5M3F H;  1NR4 A;  5KNN A;  1F2M A;  5C0X H;  2Q2U A;  3WQZ A;  1CKN B;  2EY2 A;  1YHA A;  2Q5I A;  1KNE A;  2GVB A;  4C3I G;  3E9H A;  2UXD Q;  2DJZ A;  3PZC A;  4K5V A;  4TQU S;  3J80 L;  1KAB A;  4TWA A;  2B2U C;  1Y1V H;  1WOC A;  5FO7 B;  3S2H H;  3D6C A;  1CUK A;  1H9S A;  4DXF A;  1MI2 A;  3Q22 A;  4JCV E;  3GTO B;  2X69 A;  4BY7 H;  3D0F A;  3RUX A;  1X32 A;  2R93 G;  1TWF B;  1EY5 A;  3UH0 A;  2F4V L;  1N32 L;  2EYO A;  2AWO A;  1AE2 A;  2KED A;  4A3B G;  1STB A;  4DV7 L;  2XWB B;  2SEB D;  3LGJ A;  2C5C A;  2A68 C;  1JCK B;  1X65 A;  5EKK A;  4B9X A;  4X64 Q;  4WOR A;  3A54 A;  4Q0F A;  2NB0 A;  1YIJ A;  4JI7 Q;  2E41 A;  5M9O A;  3PCO B;  3MAQ A;  2KHJ A;  2Q8T A;  2M00 A;  5LMN W;  3SXH A;  2EDG A;  1J5E Q;  4YCV A;  3KYH C;  5LL6 X;  4B3R L;  4DR3 Q;  3J81 c;  1EZ6 A;  2KJX A;  3A56 A;  4DV1 Q;  1PH8 A;  4A3D H;  4HMI A;  4IUT A;  2G9D A;  3DWQ A;  1KQS A;  2WII B;  4RCO A;  5D3D A;  4RQE A;  1LTR D;  1BIB A;  1TY0 A;  5C0X G;  2PME A;  3RMH A;  3T16 A;  5NUC A;  4G85 A;  4H2W A;  1DGS A;  2LXK A;  1D6E C;  1PH9 A;  1QNU A;  1STH A;  4LJZ C;  4DXG A;  3HOW H;  2PCF B;  4BBS H;  2B29 A;  5J3B A;  1Y1V G;  1S5E D;  3WDN A;  4K6L A;  1EYC A;  3IAY A;  2UXB L;  1FD7 D;  4H2S A;  4LMQ D;  4C2M B;  2CWA A;  5ELE A;  4WF2 A;  3HEJ A;  4NPS A;  4A75 A;  4BY7 G;  3OIP A;  1Y14 B;  1I4H A;  3BG3 A;  5LL6 S;  3KLW A;  3U4V A;  1HUM A;  4OWW B;  3D31 A;  5IYB H;  1RTN A;  1PDQ A;  1WD1 A;  2PNR C;  1NCV A;  2AKW A;  1OO9 B;  3L9A X;  2ZR2 A;  4LNS A;  3CQZ B;  3NBH B;  5EBC A;  4AYB G;  2ZXO A;  3A5Z A;  5KRU A;  1RIQ A;  3MWY W;  2CFM A;  3L0O A;  3NPP A;  5IGC A;  3A55 A;  4C1N K;  1CA6 A;  5IP7 H;  3TP6 A;  1PH6 A;  1I4G A;  1SE8 A;  4X5O A;  1TXY A;  1Q90 A;  5T1G A;  3NQI A;  2ATW A;  1SFO B;  1QZG A;  1G2T A;  3A74 A;  3BDC A;  1BCP C;  1KLU D;  1JOQ A;  3ICA A;  3GTO H;  4E6I A;  3F2B A;  2OQK A;  3T53 B;  2EZV A;  3TRE A;  1TWF H;  1ZKO A;  5IGD A;  4ZAI A;  5LMU L;  4R4T A;  4X62 L;  2UU9 L;  2KCC A;  1IW7 C;  1QNK A;  2NTS A;  4R4O A;  3MEF A;  4A3D G;  2E3C A;  5J22 A;  2I5M X;  2ODR D;  3RZO B;  4XT1 B;  1DCZ A;  2Q2I A;  3NWS A;  3K5N A;  1NE3 A;  1FYC A;  1WPY A;  2DTO A;  2WIN B;  3Q24 A;  4K8I A;  2ZXF A;  2EYM A;  4P74 A;  2VUM G;  5A35 A;  2ICI A;  1FNU A;  1X3G A;  1ENF A;  4FO2 A;  3LNN A;  3BYY B;  2HNI A;  4BBS G;  1X3F A;  1Y8P B;  1SNC A;  1A62 A;  1LV9 A;  1WCM B;  3D4R A;  4HIK A;  2K28 A;  2ASB A;  1F77 A;  4NKL A;  3HOV B;  2A6H D;  2ZT9 C;  2DJF C;  3HRZ C;  1XNR Q;  3I72 A;  1Y1W B;  1SYE A;  4ID6 A;  5KNB A;  5IYB G;  1JJC B;  1XNQ L;  1AP0 A;  3G7L A;  3FHW A;  1GGM A;  2MO1 A;  5GQO A;  5T1I A;  2DGY A;  4OO1 G;  3LSS A;  2KCN A;  3TBI B;  1VQM A;  5IP7 G;  2IPK D;  3VYU A;  4FYD A;  3NEN A;  3A8J E;  2RVL A;  1FJG L;  2EJG C;  3HOU B;  1U4R A;  2N78 A;  4BA2 I;  4V19 0;  4DV3 Q;  4NXN L;  2E2I B;  4TQF A;  1D1I A;  3SE0 A;  3UDG A;  1SRU A;  1WTH A;  2ZXP A;  5C4Z A;  4HJ7 A;  1JIC A;  5IWA Q;  3CP0 A;  2UXC L;  2EQS A;  2B8G A;  3PIP 3;  4YRJ A;  4YRS A;  3ONA B;  3CQZ H;  5M3M B;  4DV4 Q;  3W2D A;  1WLE A;  2VW9 A;  3DWP A;  1LO5 D;  3NTI A;  1SXT A;  1EYD A;  1V1Q A;  1PRT D;  1QIL A;  1STA A;  2F4I A;  2SNM A;  1LAC A;  3U9S A;  1F9Q A;  5IT9 E;  1LAB A;  3ULP A;  2B2Y C;  4GNX C;  2DXU A;  4PG3 A;  1SFO H;  1Q86 C;  1HR0 L;  4RMF A;  4LVJ A;  4HJ9 A;  1EIG A;  3T4A C;  4O2D A;  4CH4 A;  1LT6 D;  3GTP B;  1XTC D;  1N8R C;  4YPF A;  5M5Y H;  2R7Z B;  3HXX A;  4JV5 L;  4EGV A;  3I2Z A;  3RZO H;  1RHP A;  2K52 A;  3CCL A;  4JI2 L;  4X66 Q;  4JOI A;  2ENB A;  5IGE A;  1PRT F;  2BH2 A;  1G29 1;  3ERS X;  4DV5 Q;  1Q82 C;  1BXT A;  1UAP A;  4L5S A;  4IFD H;  4DR6 L;  4DAM A;  3BFM A;  1IXR A;  1EWC A;  1KRS A;  3BZC A;  1K73 C;  3LC0 A;  4HWT A;  5CV9 A;  4TQD A;  3VQV A;  4H2U A;  1SLJ A;  1ADJ A;  4RGO S;  1L1O C;  1KDA A;  1WCM H;  2L12 A;  3MXN B;  4DNR B;  2HIX A;  2PW7 A;  1I6V C;  1CFM A;  3HOV H;  3PGZ A;  4DV2 Q;  5KIX A;  4LAA A;  2NN6 I;  2Z4I A;  1Y1W H;  2JSO A;  3TRZ A;  1NMG A;  5M5X B;  3I70 A;  4JC0 A;  1H4S A;  5KND A;  1NSN S;  5K1X A;  1ROD A;  5K36 H;  1J6Q A;  4P75 C;  1S5D D;  1GXD C;  1EVL A;  4F87 A;  3WWV A;  3S1M B;  1PH4 A;  4WJW A;  4UPA A;  3IFD A;  2KBN A;  5AJ3 L;  2Y0S E;  3GTK B;  1PZK D;  3CC4 A;  1TWA B;  5CBE E;  2VQF Q;  3TP8 A;  3EFR A;  2FFK B;  4OON A;  1LTA D;  3HOU H;  2E2I H;  1DXM A;  4U68 A;  1A0I A;  1ENA A;  1V1P B;  3HKS A;  5C0X J;  1U9R A;  4J8Q A;  3S1R B;  3H09 A;  1JOR A;  1SEB D;  2O4X A;  1LTL A;  1QUQ B;  1VQK A;  2CGH A;  1ZYR D;  5M3M H;  3N52 A;  4KY5 A;  1A2U A;  5EKI A;  4LF7 Q;  1MBY A;  1B70 B;  3KJO A;  2QHS A;  2R7F A;  1CSP A;  4H0L C;  1KMN A;  1GM5 A;  1CZW A;  2I4M A;  4KKS A;  4IFD G;  3D8G A;  1ILQ A;  2JA8 G;  3RLO A;  1K28 A;  1RIP A;  3G48 A;  4K8J A;  2Z0S A;  1Q8I A;  1G5H A;  1KRT A;  4GOP C;  3PO3 B;  4X3S A;  4NMZ A;  2ZT7 A;  1STE A;  2K04 A;  5CV5 A;  1VQB A;  1RL2 A;  2LFN A;  2R7Z H;  5EBD A;  1WCM G;  1Q8K A;  3J80 E;  4N8X 1;  5C5L A;  2UUC Q;  1EY4 A;  5JAV A;  3PUX A;  1KIX A;  3QO8 A;  1MGS A;  1N34 L;  2E2J H;  2HQE A;  4IPC A;  2CH4 W;  3HG9 A;  5IGB A;  1EY9 A;  4FF2 A;  4DAY B;  3Q6S A;  1Z47 A;  5EPL A;  4XTU A;  2B2U A;  1AE3 A;  2LMC B;  1B1Z A;  1SRO A;  2ID0 A;  3WOF A;  5C3E G;  2CWP A;  2F0E A;  2K32 A;  4O42 A;  4TKO B;  2J4X A;  4A3F G;  1IHZ A;  3S15 B;  4KR3 A;  1H9R A;  1GO3 E;  5KGU A;  4RFB A;  5ELO A;  4DAV A;  2ZM6 Q;  1AH9 A;  2PQA B;  2EXZ A;  3H3V H;  1W6K A;  1VQJ A;  5I4D A;  3TZD A;  3J7A F;  1O7Y A;  1IBM Q;  1MJC A;  2DY7 A;  3EN2 A;  3CMA A;  2EAY A;  3QWN A;  3P8V A;  4HSV A;  2B39 A;  5M5X H;  2WKC A;  4KN4 C;  2DNC A;  2R6G A;  3H0G B;  4YCU A;  1ADY A;  1IL8 A;  3NET A;  3UGQ A;  1NYQ A;  3G71 A;  1KTK A;  2SNS A;  2DU7 A;  3E6Z X;  4H2X B;  1ICF B;  3GTK H;  1PRT B;  1TWA H;  1LTS D;  2I07 B;  1H4Q A;  4B3M Q;  3V7S A;  4ZQ3 A;  2E5L L;  4OX9 L;  3FMC A;  5IOC A;  3S1R H;  1XWE A;  2YTX A;  3REU A;  4OLF A;  2R7Z G;  4LFB L;  4DUY L;  4LF5 Q;  4HWP A;  3S1Q B;  3QB3 A;  5C0X I;  1CI3 M;  3S17 B;  1QG7 A;  2V1C C;  1YJ9 A;  1K9M C;  2HCC A;  4FP5 D;  2O5I C;  4IUQ A;  1CHP D;  1CQV A;  1F2Z A;  1VQG A;  5LMN Q;  1VQC A;  1TWG B;  2YTV A;  2K75 A;  4B3T L;  4YHH L;  1LYL A;  3KLS A;  3I4N B;  4JBW A;  3VDY A;  3PO3 H;  4JI4 L;  3STB C;  4L5T A;  2PO4 A;  4CKE A;  2UUA L;  3H3V C;  3TEH A;  2ZJR A;  4X65 L;  4KI0 A;  1I6H B;  5EAY A;  5IP9 H;  1XMQ L;  2C35 B;  2XRQ D;  2YU9 H;  1GJX A;  1KMM A;  1KOG A;  2Z6K C;  4Q15 A;  2KVM A;  3DHQ A;  1ONL A;  1E2W A;  4J1M A;  3K57 A;  4OGQ C;  1DOL A;  4LFC L;  3CAM A;  4N8F A;  5ELN A;  2NS6 A;  4MZ9 A;  2IX1 A;  1ATI A;  2PI2 A;  3S15 H;  1BVS A;  1YGB A;  1YNJ D;  4K0K L;  1QVG A;  3F2C A;  4PNY A;  1VQZ A;  5FLM H;  2E64 A;  1AFP A;  3ND9 A;  1MHW C;  2D9U A;  1M8A A;  1PLF A;  3I55 A;  1VQN A;  4IJH A;  3H0G H;  2QGQ A;  1EU4 A;  4QUC A;  3U50 C;  2ZIN A;  1B7Y B;  5C4J B;  4EVO A;  1F9S A;  3VYR A;  2WKD A;  3PF4 A;  3LWU A;  3MFG A;  5E4X A;  5DM7 3;  3OMG A;  2P5I A;  3QO5 A;  1HNZ L;  3PO3 G;  3VQW A;  2E10 A;  2L11 A;  4RGM A;  4C3H B;  1KAA A;  3GV6 A;  1B2T A;  3MC0 B;  4TSS A;  2D5D A;  1CA5 A;  3S1Q H;  4F8M A;  1CSQ A;  2RHQ B;  3S17 H;  1K3R A;  5E3F A;  2F03 A;  4RGN A;  4YRT A;  2E74 C;  4KN7 C;  1PFS A;  1AW7 A;  3AU7 A;  2NTT A;  3RKW A;  4OO1 I;  2D0O A;  1TWG H;  4DR3 L;  4A3C G;  3A32 A;  3CW2 C;  3ND8 A;  2K03 A;  3I4N H;  4RWS C;  5C53 B;  2QDB A;  2VQE Q;  1WJJ A;  4KHP L;  1LT4 D;  1K3B C;  3I73 A;  2F0L A;  1KC8 C;  3V2T A;  2EJG A;  4IZ8 A;  3V05 A;  2JXM B;  4OL7 A;  4XU0 A;  2BH8 A;  1EZ8 A;  1I6H H;  3C2P A;  1U4L A;  2MO0 A;  3A7A B;  4DR5 Q;  2QHV A;  1TVX A;  1SNO A;  3PUZ A;  5K5P A;  1XPR A;  1PHJ A;  2R92 B;  5KEE A;  3BDL A;  1HNW Q;  5IGG A;  4ODG A;  1A6X A;  4YRR A;  2FHT A;  3NQT A;  2HHH L;  1LTT D;  4M8A A;  1TII D;  2ZR3 A;  1E24 A;  1Z6H A;  12AS A;  3E9I A;  1B44 D;  2B2Y A;  4GNX A;  4KQE A;  2KQ3 A;  2BE5 D;  3DMU A;  4A3K H;  4YWL A;  4PV1 C;  5FOB B;  1SJH D;  3UI2 A;  4DV6 Q;  1SR3 A;  3NTH A;  3KF6 A;  2VXW A;  4FF3 A;  1F2Y A;  2JEB I;  1VQ4 A;  1XMO Q;  4DV0 Q;  4B3S Q;  2RDF A;  5IYC H;  5I9P A;  1W3S A;  4LWC A;  4HED A;  4F7X A;  3MZ5 A;  2D62 A;  1X9N A;  5C4J H;  4JI0 L;  1II3 A;  3DUZ A;  4IQZ A;  2FYK A;  1KAW A;  4M1U B;  3TME A;  1SMY C;  2K7V A;  3KFU A;  3CKI B;  4LUV A;  3K58 A;  4JYA Q;  2ZZF A;  3V8J A;  3V8L A;  1YIT A;  2RDH A;  2E5A A;  3P20 A;  4A3M G;  1S5F D;  1IBK L;  4LF6 Q;  3QTC A;  3PO2 B;  1K0S A;  1LM0 A;  3HXY A;  4C3H H;  4KD3 A;  1L1O A;  3VYS A;  2UUB Q;  1R4Q B;  1EWH A;  4FVM A;  2KEC A;  1WI5 A;  4I7Z C;  1OXX K;  3U58 A;  2NVX B;  1VQ7 A;  2NWG A;  2IY5 B;  4DK1 A;  1Q3L A;  1V8Q A;  4R8N A;  4JG2 A;  5BN3 A;  2DN8 A;  4TVY A;  2ICE C;  3BJU A;  1SYD A;  4P75 A;  1DM0 B;  1TU2 B;  1VDZ A;  4R8I A;  3VBB A;  3V7R A;  3EQL C;  3OHX C;  4LW1 A;  4H02 A;  3TS0 A;  1GKH A;  3NSW A;  1YZ6 A;  4LVI A;  1DD2 A;  4XEO A;  1HPC A;  2SOB A;  3M7N A;  3QIA A;  4XTV A;  5COR A;  1STG A;  4LUO A;  3S24 A;  11AS A;  4A93 G;  4A3K G;  3RN5 A;  4XT3 B;  2IJ0 A;  3HOY B;  3NK9 A;  2WAQ E;  3L1A A;  3JAM L;  5E1F A;  2CHB D;  2A74 C;  4GKJ Q;  3OOC A;  3OYY A;  2R92 H;  1YEZ A;  5IYC G;  2RQX A;  2LKV A;  1PH7 A;  3K5M A;  3RKY A;  3NP8 A;  4IFD I;  2AQ3 B;  1EIY B;  2QKI C;  3I91 A;  1VQF A;  2Z8L A;  1YHQ A;  1NNH A;  1R4P B;  3M7G A;  3G1Z A;  1HCZ A;  2E75 C;  3NXW A;  5FLX c;  1YFS A;  3VQX A;  4GOP A;  2K4K A;  1K0R A;  4C3H G;  3NUC A;  4LF8 Q;  4UDU C;  3TP7 A;  5EJW A;  4MNO A;  4QY7 A;  1AEX A;  1SNM A;  2EYH A;  4DK0 A;  1TS2 A;  3CC2 A;  4LFA L;  5IY0 A;  1JJ2 A;  1YNX A;  4JI1 Q;  4FF4 A;  4CS4 A;  2GA4 B;  5I2X A;  4FXD A;  4MTN A;  1E2V A;  1ICW A;  2A6E D;  4DPG A;  1O7Z A;  2F0P A;  3J7Y W;  2WV6 D;  3I4L A;  2CH4 A;  3CXC A;  1A3V A;  1EQR A;  1EQQ A;  3PO2 H;  3S16 B;  4G7H C;  3ERQ A;  1HR0 W;  3TDQ A;  3VA5 A;  1EFW A;  2B63 G;  3TZU A;  4YY3 L;  2J0T D;  3NEM A;  1ZXT A;  1N36 L;  5E7N A;  2MHV A;  4ULL A;  2JA7 B;  4JBM A;  4DR4 L;  2F3I A;  3SVM A;  5M3F G;  4XXE A;  1XYI A;  1EY0 A;  3OW2 A;  1S72 A;  1HA6 A;  1G2S A;  4P72 C;  1Y69 U;  3S9W A;  4WJ3 M;  2PZT A;  1TS5 A;  1WYD A;  2QEJ C;  1PTO D;  4CKC A;  3ULJ A;  3J7A 5;  1IL2 A;  3C46 A;  3HFZ A;  3SDZ A;  2ZJQ A;  3GP7 A;  3KBG A;  2XGT A;  1Q81 C;  1V9P A;  1HH2 P;  2E1H A;  2MPM A;  3HOY H;  3UGT A;  1B3Q A;  4PQX A;  1HC7 A;  1C48 A;  2VY3 A;  1EFI D;  4A3E B;  2QEX A;  1E2Z A;  4LF9 Q;  4WJ4 A;  1PTO F;  3V8K A;  1DOK A;  4RQF A;  3K6O A;  5C4X B;  4CJ2 C;  4PMB A;  4BXX H;  2I5H A;  4X6A H;  2XNA C;  3T1Y L;  1NJI C;  3PO2 G;  1V43 A;  3MXN A;  2Q8I B;  1E1O A;  1CM9 A;  1HXD A;  4RHS A;  4GKK Q;  1SDF A;  4BA1 I;  1QE6 A;  3H3V I;  2FMM A;  1JMC A;  4JI5 L;  5I9O A;  2O5J C;  4QB4 A;  1CKM A;  4BY1 B;  2XN9 C;  2BA0 A;  1WTP A;  3G6J B;  2CW0 D;  2O2L D;  2Z6K A;  4HMJ A;  4K5W A;  3J7A V;  3G6E A;  4P73 C;  5BR8 L;  4QIW B;  1W2B A;  2ARU A;  1PYS A;  4A3G B;  3HOW G;  3HGB A;  4JI3 L;  3DEP A;  3KJP A;  3S16 H;  2KA7 A;  3L4G A;  1PFB A;  3GTL B;  1A63 A;  2A69 D;  1VQ5 A;  2L5T A;  2EPB A;  5D3I B;  2DQ0 A;  4DR2 Q;  3I8Z A;  2JA7 H;  2A1A A;  3GTG B;  1ET6 A;  1QUQ A;  3V96 A;  5C3W A;  2WAQ G;  1HFG A;  2JK8 A;  2PNH A;  2F0M A;  3FKI B;  1SE4 A;  4ZRZ A;  4LF4 L;  2DDZ A;  4DR1 L;  1I94 Q;  1UE5 A;  2F0G A;  4FNF A;  5I2Y A;  2L9H A;  4HT4 A;  2NBF A;  4TRD A;  4IUP A;  1H9S B;  4FXG C;  2H4O A;  3NHH A;  4PZ8 A;  1DON A;  1CQF A;  4IJL A;  3KUP A;  3L7Z C;  1KXL A;  4RA8 A;  1GUS A;  4C3J B;  1KDC A;  4C2M H;  5FK9 C;  3K8A A;  4HJA A;  4JI8 Q;  5HGT A;  4JI6 L;  1X3Q A;  4RDX A;  3EVQ A;  3CCE A;  1Q1B A;  3M9B A;  2RDG A;  5COY A;  4A3E H;  3KDF A;  1HZC A;  1U5K A;  4H44 C;  5I6W A;  5JEA J;  1ML0 D;  5C4X H;  1R9T B;  2RHS A;  4NB3 A;  3BVG A;  4LVM A;  1SYG A;  5EKL A;  3F2U A;  2DTH A;  1SNP A;  5AFW A;  4GN3 B;  3H94 A;  2DXT A;  2F52 A;  1RTO A;  1VF5 C;  3HXU A;  1WD0 A;  3HXV A;  2F4V Q;  1WTQ A;  4EQO A;  3J81 L;  2M2L A;  2DTI A;  1VQL A;  2F0N A;  5JJZ A;  1EIH A;  1KDB A;  2QCP X;  4DNT B;  1NR2 A;  2LY7 A;  4BY1 H;  4QMG A;  1ZEQ X;  2LSS A;  4JW0 A;  2B2T C;  5C44 B;  1CK1 A;  2EE1 A;  5GRO A;  1WQW A;  2MNA A;  4A3G H;  4P3P A;  3NBI A;  1A2T A;  2YYZ A;  3FDT A;  2VB3 X;  1YHB A;  4XTY A;  1PTO B;  1QZH A;  1NY4 A;  3KLS X;  1UE7 A;  4DA2 A;  4XYO A;  4B3R Q;  4UY8 C;  5BN4 A;  1X6O A;  2AKW B;  1LUZ A;  2ZTC A;  3GTG H;  4R4Q A;  3A5U A;  4F88 A;  3A5Z B;  1UE6 A;  2AMC A;  2EYL A;  2L55 A;  1F2L A;  1HTL D;  4MIU A;  4ZUI A;  4YIJ A;  1HXY D;  4A3E G;  3IFT A;  1X54 A;  4TTV A;  4AQY Q;  1EY6 A;  2ZTE A;  4AIM A;  4C3J H;  2UXB Q;  4UP9 A;  1NJ6 A;  2ZTD A;  3R07 A;  2F0W A;  2NVQ B;  4IUU A;  4H2Y A;  4LVK A;  2PZW A;  2I5L X;  1S5B D;  3P7J A;  4DR7 L;  1JQY D;  1B50 A;  1HA5 A;  2KEN A;  1T5X D;  1WQ7 A;  4XYQ A;  2R3Z A;  3CPW A;  2L1B A;  1V1O A;  1CKO A;  1YNN D;  1NJ5 A;  3HFV A;  1L0Y B;  1TS4 A;  2D2C C;  3RUZ A;  5CV6 A;  3IKJ A;  4BY1 G;  1M1K C;  1VQ8 A;  1R9T H;  1EQT A;  2F3W A;  2AUK A;  1HHV A;  4Q6G A;  4KHZ A;  2ALY A;  2IW3 A;  1C7Y A;  1TKW B;  2XTI A;  3JAM E;  4A3I B;  4UHV A;  4NXM L;  2A8E A;  3GTP H;  1OXT A;  2ZXR A;  4K2K A;  2UU9 Q;  5LMU Q;  4X62 Q;  1IKM A;  2G5D A;  2MUY A;  3HOV G;  2K14 A;  2N88 A;  5E3I A;  3J80 i;  1Y1W G;  2WB1 B;  3K5L A;  4Y52 H;  1X3P A;  1RCV D;  4HWS A;  2NZO A;  1LTB D;  3QNE A;  3F8T A;  3HXZ A;  1L0W A;  5K36 G;  5C44 H;  3T56 B;  3B6Y A;  2Q2T A;  1HUN A;  1Z9F A;  4AH6 A;  1B8A A;  3H6M A;  3RF1 A;  1PTO H;  4C56 C;  1WTV A;  2JA6 B;  4K86 A;  4BBR B;  3UDF A;  4DR5 L;  3HOU G;  1YB3 A;  2N8N A;  4DAP A;  2A68 D;  2VNU D;  3O13 A;  4GS3 A;  4QUF A;  2IL8 A;  1MIU A;  4HWR A;  3RGL A;  4Q5V A;  2MQH A;  2NVT B;  5E4W C;  1XNQ Q;  5M3M G;  5A2Q L;  2RSO A;  2FXQ A;  3FVQ A;  4YRF A;  5IT9 c;  3S1M H;  2I4N A;  2MFI A;  3PIP A;  2ZT6 A;  3T13 A;  2DNE A;  2DKG A;  2PMF A;  2QW7 A;  4EX5 A;  5CR3 A;  1BQQ T;  4OXP A;  4PMC A;  1FJG Q;  2NVQ H;  3GQB A;  4CJ0 B;  4NXN Q;  1PVO A;  1B76 A;  1UEA B;  3P8Y A;  2BDO A;  1BR9 A;  4NW2 A;  1NBW A;  1VMC A;  3K5O A;  1B9M A;  2ART A;  2UXC Q;  3HOX B;  3X3N A;  1E7Z A;  1SES A;  2NZH A;  3UDX A;  3IG2 A;  1LT5 D;  3A5Y A;  4O0A A;  5J1Z A;  1QVC A;  1G91 A; 
#chains in the Genus database with same CATH homology
 4P72 A;  2DUD A;  2JQO A;  2PMZ E;  2RF4 A;  5C44 G;  3CMQ A;  1HR0 Q;  1EVK A;  4A3I H;  2L15 A;  1ASY A;  1WNL A;  2J3L A;  1D7Q A;  2JEA I;  2ZIM A;  3HY0 A;  4JI2 Q;  5GAG C;  4IO9 A;  4CH5 A;  2HT1 A;  3A31 A;  1PA6 A;  2A8V A;  4DUZ L;  1I5F A;  4DR6 Q;  4YRM A;  1EOV A;  2D0P A;  1IYJ B;  1N33 L;  2JA6 H;  4BBR H;  1SN8 A;  2CCZ A;  1P16 A;  2Q7E A;  4YRO A;  1C0A A;  1IBL Q;  2UXD L;  2CJA A;  2ODR C;  2NVT H;  4EO4 A;  2Q5H A;  3CPF A;  1PYB A;  1L2F A;  4P3N A;  5HGQ A;  2H5X A;  2R7D A;  5DLQ E;  4P73 A;  5AJ3 Q;  2ZZE A;  3AFQ A;  3REX A;  1JJG A;  4A3I G;  3CCJ A;  1NYR A;  1EWI A;  3PUY A;  4R4I A;  2CJB A;  3J80 c;  1YFT A;  4X64 L;  4L5Q A;  3HOX H;  4YYE A;  1CKN A;  1K8A C;  5IP9 G;  4JI7 L;  5IYD H;  3H15 A;  1VQE A;  2VZA A;  1BKB A;  1J5E L;  1VQ9 A;  1GVP A;  4DV1 L;  3ICE A;  4H2V A;  4YRC A;  3M4P A;  2JA6 G;  4BBR G;  1YJW A;  3CCQ A;  2E65 A;  3AQQ A;  3F1Z A;  3HOZ H;  5FLM G;  2DVE A;  1VQI A;  2IHF A;  1N34 Q;  4IFD J;  3H0G G;  3RAC A;  3PCO A;  4A3J H;  1XJV A;  3RKX A;  4KR2 A;  4K87 A;  1NJ2 A;  1E22 A;  4TVA B;  3G4S A;  1S3O A;  4CS2 A;  5F5W A;  3K81 C;  3S1N H;  4YRE A;  3HOX G;  1N9W A;  3J81 j;  3IKL A;  4IPH A;  3L2Z A;  3K7A H;  3TEH B;  3I4M H;  1NJ8 A;  3A7U A;  3NEL A;  4HA8 A;  3I4N G;  4GKK L;  4YCW A;  1EUJ A;  2E5L Q;  4OX9 Q;  3E0E A;  5H1S E;  4LFB Q;  1X3E A;  3HOZ G;  3HTZ A;  1E3P A;  3MF1 A;  4HIO A;  5K1P A;  2WP8 J;  2DEQ A;  4PZ7 A;  3DLL A;  3QO7 A;  4B3T Q;  4YHH Q;  4DR2 L;  2E8G A;  4PHC A;  4JI4 Q;  1XNR L;  2UUA Q;  4UP7 A;  1OXU A;  4P71 C;  1I94 L;  1NMF A;  3PF5 A;  1XMQ Q;  2ZTG A;  2IX0 A;  3TEG A;  2OTL A;  3OTO Q;  3V7C A;  3CF5 A;  4HJ5 A;  1PH2 A;  4CH6 A;  3ERR A;  4LFC Q;  1W66 A;  1VQH A;  4DV3 L;  3RIR A;  3AYH B;  4PMW A;  2IT1 A;  3PSI A;  3UE0 A;  5IWA L;  2DZC A;  5FJ8 H;  2J3M A;  5M5W H;  3GD7 A;  4K0K Q;  2KCM A;  4DV4 L;  3UFG A;  1H4T A;  1BIA A;  2ZNJ A;  3OD1 A;  1JJC A;  2N49 A;  4K88 A;  3GTM H;  1PH1 A;  1VS0 A;  2ARS A;  1D8L A;  5GAH C;  2A19 A;  3IAL A;  2EL9 A;  2DQ3 A;  4FDB A;  3K7U C;  1Q12 A;  1HNZ Q;  4X66 L;  3LSQ A;  4YRK A;  2AWN A;  4POG A;  4DV5 L;  2NVX H;  4DQ2 A;  4HWO A;  3PUV A;  3VQY A;  4BW9 A;  2R92 G;  4GNX B;  4CS3 A;  4WI1 A;  3W3S A;  4QGU A;  3I7F A;  2CJ9 A;  1HNX Q;  4DV2 L;  4GN5 A;  3M3Y H;  3KF6 B;  4KHP Q;  4XTC S;  4HVC A;  1XPU A;  3IKM B;  1UE1 A;  1YFR A;  1KL9 A;  1X55 A;  5FJ8 G;  1JE5 A;  3FP9 A;  1XPO A;  2VUM H;  4AQY L;  4OP0 A;  1QF6 A;  3RR5 A;  1M90 C;  3P8T A;  3Q8D A;  4DKA C;  3HRI A;  2VQF L;  3STB D;  2HHH Q;  3RLN A;  3UDI A;  3CME A;  2JA5 H;  1SRY A;  1Q1E A;  1L1O B;  3W1B A;  3L2P A;  4R1J A;  3AFP A;  4TVW A;  3K80 C;  1FYF A;  3W1G A;  3T1H Q;  4YDQ A;  1BBU A;  4XIG S;  2K5V A;  4LF7 L;  1HZ9 A;  3CCU A;  3DSQ A;  1QE0 A;  2ZT8 A;  3F2D A;  4JI0 Q;  3BU2 A;  1HJP A;  3HKZ G;  4QIW E;  1UEB A;  2UUC L;  1IBK Q;  2B3G A;  2RCN A;  1EIF A;  3FJP A;  4NCX A;  3HOY G;  1JT8 A;  2CQO A;  4A76 A;  5GAE C;  1Z7M A;  1B70 A;  4XEM A;  1A8V A;  4GOP B;  2ZM6 L;  2JA5 G;  3BZK A;  4BXX G;  1IBM L;  1HTT A;  4QJF A;  1OXV A;  2NVY H;  2HQL A;  2Q2H A;  4OWX B;  4XTX A;  2C7I A;  1X2G A;  3J7Z C;  4YRP A;  4XU1 A;  4ALP A;  2CKZ B;  3CC7 A;  4YRQ A;  4B3M L;  2DU5 A;  3DM3 A;  4BWA A;  3JC6 6;  2KHI A;  4LF5 L;  3ZJY C;  5HY6 A;  2PQA A;  1MJE A;  1N32 Q;  1K8G A;  2QHT A;  2OWO A;  2LXJ A;  3A0J A;  2JA7 G;  1IZ6 A;  4DV7 Q;  1Z7N A;  4LFA Q;  3GO5 A;  5LMN L;  1FGU A;  2GVA A;  3HFZ B;  4Y7N H;  3RZD H;  4H2X A;  2ES2 A;  2QHU A;  1I3Q H;  2AHO B;  4JBJ A;  3RNU A;  1VQA A;  1YI2 A;  3GTL H;  1SET A;  2EXD A;  4YY3 Q;  2ZT5 A;  1N36 Q;  3W5O A;  4DR4 Q;  4CH3 A;  4IPD A;  3FKI H;  2JA8 H;  3RN2 A;  3A7R A;  2G4C A;  2WFW A;  2EWN A;  1JB7 A;  1USY C;  5C4X G;  4XU3 A;  1IBL L;  5C51 B;  5JJL A;  1E1T A;  4YWK A;  1SER A;  4R4C A;  1YJN A;  3KOJ A;  4IPG A;  1P8L A;  5C3E H;  1PYS B;  1PH5 A;  4A3F H;  3ULL A;  1VQ6 A;  4LVL A;  3K0X A;  3L4G B;  4H2T A;  5C52 B;  1FL0 A;  3GTQ H;  3HXW A;  1YVC A;  4A3G G;  1H95 A;  2ZZG A;  4UP8 A;  1HZA A;  5JJI A;  2E2H H;  2BA1 A;  3T1Y Q;  1XTD A;  3TQY A;  3JAM i;  4ME3 A;  1BBW A;  4P71 A;  4JI5 Q;  4YRL A;  3GDE A;  2WB1 E;  3S2D H;  3FKI G;  4PZ6 A;  3IRB A;  2N3S A;  1B7Y A;  2VQE L;  3PV0 A;  5BR8 Q;  4OWT B;  4LUZ A;  4JI3 Q;  1HZB A;  1I50 H;  1X56 A;  1SMX A;  4DK6 C;  4HJ8 A;  3KDF B;  1HNW L;  1G6P A;  4QL5 A;  5JJK A;  2ZCE A;  2RHQ A;  3MF2 A;  3EFS A;  2RHS B;  4KLK A;  4LF4 Q;  1QVF A;  2ZNI A;  4DR1 Q;  2QA4 A;  2JJQ A;  2GN5 A;  4DV6 L;  4G84 A;  1S40 A;  1XMO L;  4DV0 L;  4B3S L;  4IOA A;  4P3O A;  4GLA C;  3RL6 A;  4JI6 Q;  3A7A A;  1Q46 A;  1TWC H;  1X01 A;  4JYA L;  4ZIB A;  4XTW A;  1VCI A;  4LF6 L;  1J5W A;  2K50 A;  2VL6 A;  2UUB L;  4TVA A;  3PUW A;  1ASZ A;  1OXS C;  1VQD A;  2AMC B;  3PIO A;  3I56 A;  2OTJ A;  4JV5 Q;  4XTZ A;  1NTG A;  3GTJ H;  1VQP A;  2EJF A;  2DZ9 A;  4JBK A;  4L5R C;  2CIM A;  2YTY A;  1WFQ A;  2HIV A;  1WU7 A;  4QQB X;  1EYG A;  4GKJ L;  1GD7 A;  3OTO L;  4P74 C;  3CCM A;  1YBY A;  2IY5 A;  1PH3 A;  4A3C H;  3MQZ A;  2ALY B;  1K83 H;  2Y0S G;  3RLF A;  2C8M A;  2IHE A;  4EQ5 A;  3JAM c;  4LF8 L;  2I4O A;  5GAD C;  1UWV A;  2JE6 I;  3S14 H;  4JI1 L;  4DR7 Q;  2Q7H A;  3MEY A;  3EBE A;  3AEV A;  4A3L H;  2WB1 G;  4HIM A;  2I4L A;  1EIY A;  1H4V B;  2K5H A;  4YWM A;  1Q7Y C;  4NXM Q;  3HRK A;  2OQ0 A;  4GLV B;  1KHI A;  3EIV A;  4A3M H;  3CCR A;  1HNX L;  3CCV A;  4YP0 A;  2Q7G A;  4XU2 A;  1VQO A;  1OTC A;  1X2H A;  3TS2 A;  1KD1 C;  4JOI C;  3J81 i;  1G51 A;  1O7I A;  4HID A;  4LF9 L;  4E51 A;  4DK3 C;  4YRG A;  3CD6 A;  4ZTU B;  2KCT A;  2I0Q A;  3SGI A;  5IYD G;  3CCS A;  4A3L G;  2EIF A;  1U0L A;  4A93 H;  3T1H L;  1T9H A;  2ZGW A;  2NN6 G;  4L87 A;  4YRI A;  2JA9 A;  4RG1 A;  1TWH H;  1MKH A;  4LNQ A;  4C3I H;  4AYB E;  2P0L A;  4DUY Q;  4J15 A;  4APV A;  4GLX A;  3HY1 A;  3I4O A;  2OCE A;  1G5I A;  4GN4 B;  2K5N A;  3HKZ E;  2PI2 E;  2R93 H;  4A3J G;  3M4O H;  1USY A;  4A4I A;  5IE8 A;  4A3B H;  1FVI A;  3M85 A;  1NJ1 A;  3U4Z A;  3UE1 A;  3TUP A;  4YRN A;  2ZJP A;  3KF8 B;  4X65 Q;  4IOC A;  1C9O A;  3M4Q A;  4ZTZ B;  2ZIO A;  2VS1 A;  2EJ9 A;  4POF A;  5JEA G;  4DUZ Q;  2B63 H;  4JI8 L;  2YV5 A;  4DNI A;  1N33 Q;  3ER0 A;  3I4M G;  1PV4 A;  5M3F H;  5KNN A;  2Q2U A;  3WQZ A;  1CKN B;  1YHA A;  2Q5I A;  2DJZ A;  2GVB A;  3PZC A;  3E9H A;  2UXD Q;  4TQU S;  4TWA A;  1Y1V H;  1WOC A;  3S2H H;  1CUK A;  4JCV E;  4BY7 H;  3D0F A;  3RUX A;  2R93 G;  3UH0 A;  2F4V L;  1N32 L;  2AWO A;  1AE2 A;  4A3B G;  4DV7 L;  3LGJ A;  1X65 A;  4X64 Q;  1YIJ A;  4JI7 Q;  2E41 A;  3PCO B;  2KHJ A;  5LMN W;  1J5E Q;  4YCV A;  3KYH C;  4B3R L;  4DR3 Q;  3J81 c;  4DV1 Q;  1PH8 A;  4A3D H;  1KQS A;  4RQE A;  1BIB A;  5C0X G;  2PME A;  4G85 A;  4H2W A;  1DGS A;  2LXK A;  1PH9 A;  3HOW H;  4BBS H;  2B29 A;  5J3B A;  1Y1V G;  2UXB L;  4H2S A;  2CWA A;  4WF2 A;  4A75 A;  4NPS A;  4BY7 G;  1Y14 B;  3KLW A;  3U4V A;  4OWW B;  3D31 A;  5IYB H;  2AKW A;  2ZR2 A;  4LNS A;  3NBH B;  4AYB G;  3A5Z A;  1RIQ A;  2CFM A;  3L0O A;  5IP7 H;  1PH6 A;  1SE8 A;  4X5O A;  1TXY A;  2ATW A;  1QZG A;  3A74 A;  3ICA A;  3GTO H;  3F2B A;  2OQK A;  3TRE A;  1TWF H;  2UU9 L;  5LMU L;  4R4T A;  4X62 L;  4R4O A;  4A3D G;  3MEF A;  2E3C A;  2I5M X;  2ODR D;  2Q2I A;  1NE3 A;  1WPY A;  2DTO A;  2ZXF A;  4P74 A;  2VUM G;  1X3G A;  2HNI A;  4BBS G;  1X3F A;  1A62 A;  4HIK A;  2ASB A;  1XNR Q;  5IYB G;  1JJC B;  1XNQ L;  3FHW A;  1GGM A;  2MO1 A;  5GQO A;  2DGY A;  4OO1 G;  3LSS A;  1VQM A;  5IP7 G;  3NEN A;  1FJG L;  2N78 A;  4BA2 I;  4TQF A;  4DV3 Q;  4NXN L;  3UDG A;  1SRU A;  4HJ7 A;  5IWA Q;  3CP0 A;  2UXC L;  2EQS A;  4YRJ A;  4YRS A;  3CQZ H;  4DV4 Q;  1WLE A;  2VW9 A;  1V1Q A;  3ULP A;  4GNX C;  2DXU A;  4PG3 A;  1SFO H;  1Q86 C;  1HR0 L;  4RMF A;  4LVJ A;  4HJ9 A;  4O2D A;  4CH4 A;  4YPF A;  1N8R C;  5M5Y H;  3HXX A;  4JV5 L;  3I2Z A;  3RZO H;  3CCL A;  2K52 A;  4JI2 L;  4X66 Q;  4JOI A;  2BH2 A;  1G29 1;  3ERS X;  4DV5 Q;  1Q82 C;  4L5S A;  4DR6 L;  4DAM A;  3BFM A;  1IXR A;  1KRS A;  3BZC A;  1K73 C;  3LC0 A;  4HWT A;  4TQD A;  3VQV A;  4H2U A;  1SLJ A;  1ADJ A;  1L1O C;  1WCM H;  3MXN B;  2HIX A;  3HOV H;  3PGZ A;  4DV2 Q;  2NN6 I;  1Y1W H;  3TRZ A;  1NMG A;  4JC0 A;  1H4S A;  5K1X A;  1J6Q A;  4P75 C;  1EVL A;  3WWV A;  1PH4 A;  4UPA A;  2KBN A;  5AJ3 L;  2Y0S E;  3CC4 A;  3EFR A;  2VQF Q;  4OON A;  3HOU H;  2E2I H;  1A0I A;  3HKS A;  5C0X J;  1LTL A;  1QUQ B;  1VQK A;  2CGH A;  5M3M H;  4LF7 Q;  1B70 B;  3KJO A;  2QHS A;  2R7F A;  1CSP A;  1KMN A;  1GM5 A;  2I4M A;  4IFD G;  2JA8 G;  3RLO A;  1RIP A;  3G48 A;  2Z0S A;  1G5H A;  1KRT A;  4GOP C;  2ZT7 A;  1VQB A;  1RL2 A;  2R7Z H;  1WCM G;  1Q8K A;  2UUC Q;  3PUX A;  1KIX A;  3QO8 A;  1N34 L;  2E2J H;  4IPC A;  4DAY B;  1Z47 A;  4XTU A;  1AE3 A;  2DXT A;  1SRO A;  2ID0 A;  5C3E G;  2CWP A;  4A3F G;  4KR3 A;  1GO3 E;  2ZM6 Q;  5ELO A;  1AH9 A;  1KMM A;  2PQA B;  3H3V H;  1VQJ A;  1IBM Q;  1MJC A;  3EN2 A;  3CMA A;  2EAY A;  3P8V A;  5M5X H;  2R6G A;  3NET A;  4YCU A;  1ADY A;  3UGQ A;  1NYQ A;  3G71 A;  2DU7 A;  4H2X B;  3GTK H;  1TWA H;  1H4Q A;  4B3M Q;  3V7S A;  2E5L L;  4OX9 L;  3S1R H;  2YTX A;  3REU A;  4OLF A;  2R7Z G;  4LFB L;  4DUY L;  4LF5 Q;  4HWP A;  5C0X I;  2V1C C;  1YJ9 A;  1K9M C;  1VQG A;  5LMN Q;  1VQC A;  2YTV A;  2K75 A;  4B3T L;  4YHH L;  1LYL A;  4JBW A;  3VDY A;  3PO3 H;  4JI4 L;  3STB C;  4L5T A;  2UUA L;  3TEH A;  2ZJR A;  4X65 L;  4KI0 A;  5EAY A;  5IP9 H;  1XMQ L;  2C35 B;  2YU9 H;  1KOG A;  2Z6K C;  4Q15 A;  4LFC L;  3CAM A;  5ELN A;  2NS6 A;  4MZ9 A;  2IX1 A;  1ATI A;  2PI2 A;  3S15 H;  1BVS A;  1YGB A;  4K0K L;  1QVG A;  3F2C A;  1VQZ A;  5FLM H;  2E64 A;  1VQN A;  3I55 A;  4IJH A;  3H0G H;  2QGQ A;  3U50 C;  2ZIN A;  1B7Y B;  3PF4 A;  2P5I A;  3QO5 A;  1HNZ L;  3PO3 G;  3VQW A;  2E10 A;  3S1Q H;  1CSQ A;  2RHQ B;  3S17 H;  1K3R A;  4YRT A;  1PFS A;  3RKW A;  4OO1 I;  2D0O A;  1TWG H;  4DR3 L;  4A3C G;  3A32 A;  3CW2 C;  3I4N H;  5C53 B;  2VQE Q;  1WJJ A;  4KHP L;  1KC8 C;  2EJG A;  4XU0 A;  2BH8 A;  1I6H H;  2MO0 A;  4DR5 Q;  2QHV A;  3PUZ A;  1XPR A;  1PHJ A;  1HNW Q;  4YRR A;  2HHH L;  2ZR3 A;  1E24 A;  12AS A;  3E9I A;  4KQE A;  4GNX A;  4A3K H;  4YWL A;  4DV6 Q;  1SR3 A;  3KF6 A;  2JEB I;  1VQ4 A;  1XMO Q;  4DV0 Q;  4B3S Q;  5IYC H;  1W3S A;  4LWC A;  2D62 A;  1X9N A;  5C4J H;  4JI0 L;  2FYK A;  1KAW A;  3KFU A;  4LUV A;  4JYA Q;  2ZZF A;  3V8J A;  3V8L A;  1YIT A;  2E5A A;  4A3M G;  1IBK L;  4LF6 Q;  3QTC A;  1LM0 A;  3HXY A;  4C3H H;  1L1O A;  2UUB Q;  1WI5 A;  1OXX K;  3U58 A;  1VQ7 A;  2IY5 B;  4JG2 A;  4TVY A;  3BJU A;  4P75 A;  3VBB A;  3V7R A;  4LW1 A;  4H02 A;  3TS0 A;  1GKH A;  4LVI A;  1YZ6 A;  4XEO A;  3M7N A;  4XTV A;  4LUO A;  3S24 A;  11AS A;  4A93 G;  4A3K G;  3RN5 A;  2WAQ E;  3L1A A;  4GKJ Q;  3OYY A;  2R92 H;  1YEZ A;  5IYC G;  1PH7 A;  3RKY A;  4IFD I;  1EIY B;  1VQF A;  1YHQ A;  1NNH A;  3G1Z A;  5FLX c;  1YFS A;  3VQX A;  4GOP A;  2K4K A;  1K0R A;  4LF8 Q;  4MNO A;  4QY7 A;  3CC2 A;  4LFA L;  5IY0 A;  1JJ2 A;  1YNX A;  4JI1 Q;  4CS4 A;  4MTN A;  4DPG A;  3CXC A;  1EQR A;  1EQQ A;  3PO2 H;  1HR0 W;  1EFW A;  2B63 G;  4YY3 L;  3NEM A;  1N36 L;  5E7N A;  4JBM A;  4DR4 L;  2F3I A;  5M3F G;  3OW2 A;  1S72 A;  4P72 C;  4WJ3 M;  1WYD A;  3ULJ A;  3J7A 5;  1IL2 A;  3HFZ A;  2ZJQ A;  2XGT A;  1Q81 C;  1V9P A;  1HH2 P;  2E1H A;  3HOY H;  3UGT A;  1HC7 A;  2VY3 A;  2QEX A;  4LF9 Q;  4WJ4 A;  3V8K A;  4RQF A;  4BXX H;  2I5H A;  4X6A H;  3T1Y L;  1NJI C;  3PO2 G;  1V43 A;  1E1O A;  1HXD A;  4GKK Q;  4BA1 I;  3H3V I;  1JMC A;  4JI5 L;  1CKM A;  2BA0 A;  2Z6K A;  3G6E A;  4P73 C;  5BR8 L;  1W2B A;  2ARU A;  1PYS A;  3HOW G;  4JI3 L;  3S16 H;  3KJP A;  3L4G A;  1A63 A;  1VQ5 A;  2DQ0 A;  4DR2 Q;  2JA7 H;  2A1A A;  1QUQ A;  2WAQ G;  2JK8 A;  2PNH A;  4LF4 L;  2DDZ A;  4DR1 L;  1I94 Q;  1UE5 A;  4HT4 A;  4PZ8 A;  4IJL A;  3L7Z C;  1KXL A;  4C2M H;  3K8A A;  4HJA A;  4JI8 Q;  4JI6 L;  4RDX A;  3CCE A;  1Q1B A;  3M9B A;  4A3E H;  3KDF A;  1HZC A;  1U5K A;  5JEA J;  5C4X H;  2RHS A;  4NB3 A;  4LVM A;  2DTH A;  4GN3 B;  2F52 A;  3HXU A;  3HXV A;  2F4V Q;  2DTI A;  1VQL A;  4BY1 H;  2LSS A;  1WQW A;  5GRO A;  2MNA A;  4A3G H;  4P3P A;  2YYZ A;  1YHB A;  4XTY A;  1QZH A;  1NY4 A;  1UE7 A;  4B3R Q;  4UY8 C;  1X6O A;  3GTG H;  1LUZ A;  2AKW B;  2ZTC A;  4R4Q A;  3A5U A;  3A5Z B;  1UE6 A;  2AMC A;  4A3E G;  1X54 A;  4TTV A;  4AQY Q;  2ZTE A;  4AIM A;  4C3J H;  2UXB Q;  4UP9 A;  1NJ6 A;  2ZTD A;  3R07 A;  4LVK A;  4H2Y A;  2I5L X;  4DR7 L;  2KEN A;  1WQ7 A;  3CPW A;  1CKO A;  1NJ5 A;  3HFV A;  4BY1 G;  1M1K C;  1VQ8 A;  1R9T H;  4Q6G A;  4KHZ A;  2ALY A;  1C7Y A;  2XTI A;  2A8E A;  4NXM L;  3GTP H;  1OXT A;  2UU9 Q;  5LMU Q;  4X62 Q;  3HOV G;  2K14 A;  5E3I A;  3J80 i;  1Y1W G;  4Y52 H;  4HWS A;  2NZO A;  3QNE A;  3F8T A;  3HXZ A;  1L0W A;  5K36 G;  5C44 H;  3B6Y A;  2Q2T A;  1Z9F A;  4AH6 A;  1B8A A;  3RF1 A;  4K86 A;  3UDF A;  4DR5 L;  3HOU G;  1YB3 A;  2N8N A;  2VNU D;  4GS3 A;  4HWR A;  1MIU A;  3RGL A;  2MQH A;  1XNQ Q;  5M3M G;  2FXQ A;  4YRF A;  5IT9 c;  3S1M H;  2I4N A;  2MFI A;  3PIP A;  2ZT6 A;  2DKG A;  2PMF A;  4EX5 A;  4OXP A;  1FJG Q;  2NVQ H;  4NXN Q;  1PVO A;  1B76 A;  3P8Y A;  1NBW A;  2ART A;  2UXC Q;  1E7Z A;  1SES A;  2NZH A;  3UDX A;  3IG2 A;  3A5Y A;  4O0A A;  1QVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...