4DPGA

Crystal structure of human lysrs: p38/aimp2 complex i
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
505
structure length
501
Chain Sequence
VDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Switch of Lysyl-tRNA Synthetase between Translation and Transcription.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/apoptosis
molecule keywords Lysine--tRNA ligase
total genus 158
structure length 501
sequence length 505
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dpgA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4dpgA02
1PH4A 3DSQA 4JV5Q 2DQ0A 2ZZGA 1VQLA 4RQFA 1Q82C 1WQ7A 5GADC 2LXKA 1YZ6A 2VUMH 4RQEA 4PZ6A 3GTGH 4QGUA 3RKYA 3PO3H 5C52B 4QQBX 4BY7H 4DKAC 3I4NH 1B7YB 2Q5IA 1UE5A 1VQCA 1VQIA 3A5UA 3TS2A 3HFVA 3QO8A 1U0LA 2IY5A 1Q12A 2KBNA 2D0OA 1PVOA 3S1NH 4QJFA 1T9HA 1YI2A 4TQFA 1KC8C 4IOCA 4CS4A 3GTLH 2K52A 1QF6A 1JE5A 2EIFA 3J81c 4LW1A 4R4OA 3TUPA 2ZIMA 1VQMA 1KQSA 3EIVA 4A3EG 2I4LA 3ER0A 3G71A 4KLKA 2DEQA 1OTCA 2OQKA 2HNIA 3TEHA 1CKOA 5C53B 3ULJA 4DV2L 2B63H 1XNRQ 5AJ3Q 2RHQB 4O2DA 2A1AA 1GO3E 5EAYA 4LF8L 1W3SA 3KF6B 4OONA 5GAHC 2JA6G 1KXLA 1SESA 4JYAQ 2K75A 4GNXC 5KNNA 2R7ZG 4IFDI 4IJLA 4K0KQ 1IYJB 4GNXA 3PIPA 3CCVA 1UWVA 2R92G 3L0OA 2CIMA 3LC0A 2ZJRA 2JA5H 4HA8A 2ARUA 1U5KA 2N78A 1HZAA 4PZ7A 4H2UA 2JA6H 2R93H 1ADJA 1E7ZA 5M5YH 1PYSB 3E9IA 4X65L 5C0XG 3IKLA 5C0XI 1NMGA 1G5HA 1WJJA 1Q81C 2JJQA 4TTVA 1TWAH 4L5RC 2I0QA 4LF7Q 4A3CG 4YY3Q 3EBEA 2Q2TA 4YRGA 3H0GG 2DXTA 4BXXH 3CMAA 4WF2A 3CCUA 1H4SA 1FJGQ 4JI0L 2ZXFA 3UDXA 4O0AA 5C4XG 1KAWA 3CCQA 1VQZA 5K1PA 1Y1VH 1PA6A 3EN2A 4LUOA 3PGZA 4L5QA 2JA8G 4CH6A 1N34L 1J5WA 5H1SE 4A3MG 3HOUG 1IBML 1G51A 2IT1A 4TVYA 1OXXK 3JC66 2UUCL 2MO1A 2AWNA 1L1OC 2ZCEA 2QHUA 3K0XA 2Q7HA 1SN8A 2ZT6A 5M3MG 4LUVA 4P71C 5IYDG 3HXUA 4DV5Q 3UFGA 4OXPA 4A3CH 1XNQQ 2ZNJA 2IHFA 4MTNA 4GLAC 3RN2A 2E3CA 4DR2Q 2DUDA 1KD1C 1S3OA 4TQDA 1VQPA 4B3TQ 5C3EG 4HWRA 2Q5HA 3EFRA 2JE6I 4GS3A 1NJ6A 2ZTEA 1IBKQ 2UXCL 3M3YH 5M3MH 2Z6KC 3K7UC 4IFDG 2ALYB 4P73C 5ELOA 1FGUA 2NZOA 1JT8A 4XU1A 1OXTA 2HHHL 1HNWL 2CJAA 1AE3A 1Q1EA 2CFMA 4HWTA 4JI6L 4ZIBA 1IBKL 4YRNA 1FJGL 2YU9H 1R9TH 3I4NG 1H95A 3A5YA 4CS2A 4JI1Q 4LF4L 2AWOA 4J15A 2D62A 4UP7A 2OTJA 4YYEA 2EAYA 1Z9FA 4KQEA 2Y0SE 2I4MA 2EJGA 4XIGS 3S16H 4R4TA 3S1QH 2CQOA 4JI5L 2ALYA 4BY1H 2Z0SA 4BW9A 2VW9A 3BZKA 1YGBA 2MQHA 4JOIC 3CCEA 3QNEA 1VQHA 4XU3A 1LM0A 3HOYG 2QHTA 2OQ0A 2K14A 3V7CA 4YDQA 2Z6KA 1BIBA 4YHHQ 3CC7A 1PYSA 1SLJA 4B3RQ 4A3KH 1MKHA 1X2HA 4GOPB 3J81j 1JB7A 4XEOA 3UDIA 1PFSA 12ASA 1YHQA 1I3QH 4H2TA 3T1YQ 4YRQA 2F4VQ 4R4QA 2K5VA 2K5NA 3I56A 1NBWA 3L4GB 1X56A 1V9PA 4YWLA 1NY4A 3QTCA 2R7ZH 3BU2A 4GKKL 2UUAQ 4YRSA 3FHWA 2OTLA 4A3GG 3A32A 3I55A 1TWCH 1H4QA 2JA9A 4DR1Q 3HXWA 5IP9G 2PQAA 1QZHA 3ZJYC 3BZCA 1BBUA 4YRJA 1WLEA 1H4VB 4JOIA 4IFDJ 4P72A 4K86A 1N32L 4XTXA 2R93G 4B3ML 3GTJH 1OXUA 4YRMA 2RCNA 2VZAA 2WFWA 2ZTCA 1TWFH 1OXVA 4P3NA 1VQOA 4POGA 2UU9L 4DR4Q 3GTQH 1K3RA 4KHZA 4A3JH 2KCMA 4H2VA 4C3JH 1V1QA 5BR8L 1XMOL 1PH6A 4DR3Q 4DV0Q 1NNHA 2CJBA 5LMNL 3OYYA 3M4PA 3ICEA 2UXCQ 1VS0A 3PCOA 2ZZEA 2BA0A 3KJPA 2LXJA 4DR5L 3V8JA 2DU7A 1RIPA 2FXQA 2JQOA 2WAQG 4JI5Q 3MEFA 5IWAQ 3CXCA 2UXDQ 1NJ1A 2QHVA 3LGJA 4EX5A 2VQEQ 1I5FA 1XPUA 4DPGA 1J5EQ 3ULLA 3CMQA 3REUA 1BBWA 1EVKA 3HOWG 4LFBL 5IT9c 2ZIOA 4DR3L 1ATIA 3HOVH 2R7FA 4DV7Q 3HOZH 4OLFA 5GROA 1HNXQ 2KENA 5FLMG 1IBMQ 3KOJA 3CF5A 5J3BA 2I5LX 1N34Q 1YFTA 2UUBL 4LF9L 3QO7A 4XTCS 3HRIA 4C3IH 1L1OA 4OO1G 2UUCQ 2B3GA 2RHSA 4RDXA 3NELA 3RNUA 3M7NA 4XEMA 4BXXG 2KCTA 2Y0SG 1YJNA 4X62L 3HFZB 3PUXA 2NVTH 4KR2A 2E64A 4YY3L 2QEXA 2K4KA 4BBSH 3KDFA 3VQVA 1VQJA 3A7UA 1N8RC 4X6AH 1UE6A 4CH3A 3E0EA 2JA8H 5K36G 4AQYQ 3CCMA 2UU9Q 3A0JA 1HNZL 1E1TA 3V8LA 3F1ZA 4DR6L 3TEHB 4B3MQ 4XTWA 3CQZH 4JBJA 1EQRA 4H02A 2I4OA 3V7RA 1IBLQ 4IPCA 1WCMH 3HKZG 2I5HA 3IALA 4YRFA 1L1OB 4X66Q 2L15A 3F2CA 4C3HH 1K8AC 4XU2A 4LF6Q 4KR3A 4TVAB 3G1ZA 1YIJA 2A19A 4BY7G 3NETA 3PSIA 2XGTA 1CSPA 3B6YA 1HNZQ 4LNQA 3NENA 3S1MH 4DUZL 3HXZA 3FP9A 2CGHA 4DR4L 3PF4A 1VQ5A 3STBD 3ERRA 2DZCA 4WJ4A 3HOXG 1TWGH 1LYLA 4X64Q 5IP7H 2E1HA 2JA7G 4GN4B 2ZM6L 3PO2G 2ZNIA 4LFAQ 4OP0A 4HJ9A 4FDBA 4GLVB 2HT1A 2C35B 1QVFA 1AH9A 1SMXA 2HHHQ 1PH1A 1YHAA 2F3IA 3RZDH 2EL9A 4YCWA 2KHJA 1UE1A 5IYCH 3GO5A 4DR1L 3BFMA 1E1OA 5K1XA 3UE0A 1Z7MA 3AYHB 3RLOA 4KHPQ 5IP9H 4X64L 3KDFB 2Q7GA 4BY1G 4JYAL 2B63G 2ZR2A 3A7AA 4DV3Q 4OO1I 5JJKA 2WP8J 4A4IA 4GKKQ 4H2WA 2CCZA 4YREA 5E7NA 4UP8A 4P75C 1E22A 4A3KG 4POFA 2ZJPA 1XTDA 3V8KA 3E9HA 2H5XA 4AH6A 3A5ZB 3RLFA 4JBWA 2ODRD 4JCVE 5HY6A 1PH2A 3IKMB 4YRTA 3CD6A 5IYBG 3U58A 1SE8A 4DNIA 3ICAA 1B76A 2UUBQ 1XPOA 3V7SA 1SETA 3CPWA 4LFCL 4OWXB 1B70A 4YRLA 2EXDA 4A3GH 4A75A 2N3SA 3S2DH 4YWKA 1MJEA 4X5OA 4HVCA 1Q46A 4LF8Q 3CCLA 4H2XA 4JI1L 4L5SA 1WOCA 4R1JA 4DV4L 3A74A 4YROA 3HRKA 4A3DH 4MZ9A 3CC4A 1YEZA 4A3BG 1X2GA 1EVLA 2VQEL 2E8GA 1I94L 3PUZA 4JC0A 2PMZE 2R7DA 5C44H 3PF5A 2ZGWA 4LFCQ 4KI0A 3G6EA 2DVEA 4DV6Q 1VQNA 3S15H 3S24A 3TREA 2AHOB 4P75A 2YTYA 3G4SA 4JI0Q 3KYHC 1K9MC 2MO0A 3GTOH 3VQWA 4JI7Q 1CSQA 4BBRH 5ELNA 4A3BH 4B3SQ 3GTMH 5C0XJ 1YFSA 2DTIA 1TWHH 1WYDA 4B3TL 4K87A 2D0PA 3L2PA 4P72C 3U4VA 4KHPL 1FVIA 3UE1A 1BKBA 4TQUS 2VQFL 3K7AH 4IPDA 4OX9L 1SRYA 1USYC 4A3LH 4X62Q 3MXNB 3CCRA 4P73A 3CC2A 3KF6A 4UP9A 4PHCA 2BA1A 2ASBA 4E51A 4EO4A 2QHSA 1YITA 5LMNW 1Y1VG 1WU7A 4OX9Q 3A7RA 4NXNL 1EWIA 1CUKA 1PH8A 1IBLL 4JI4Q 1WQWA 2DTOA 3STBC 3D0FA 1Z47A 2YTXA 1N33Q 1C9OA 1KOGA 3NEMA 4H2XB 1KL9A 2R6GA 3CMEA 1HZBA 4A76A 4WI1A 4YCUA 4DV2Q 2AKWA 2NVYH 3TEGA 4A3MH 3HOUH 2ARTA 2VNUD 5M3FG 2ZTDA 4BWAA 1H4TA 3PO2H 4CS3A 1X9NA 4JBKA 4PG3A 11ASA 5C51B 4GKJL 4C2MH 2NVXH 1OXSC 2ODRC 3BJUA 4DV4Q 3T1HQ 2IY5B 2P0LA 4LF5L 1E3PA 3G48A 1GGMA 2A8VA 1E24A 4UPAA 2VQFQ 3RGLA 3L7ZC 2YYZA 1NJ5A 1SROA 5FJ8G 4JI3L 3OTOL 5C3EH 3KJOA 3CW2C 4DR2L 3IG2A 4NXMQ 2B29A 4HWOA 4HWPA 4UY8C 2VS1A 3U4ZA 3J7A5 1C0AA 1VQ9A 1N32Q 4LF4Q 1XMQL 3PUVA 1XNRL 4LFBQ 1JJCB 4LWCA 3CPFA 4DV6L 5AJ3L 1X3GA 1ADYA 2E65A 1PH3A 4R4IA 1Y14B 5FJ8H 3RR5A 5IP7G 2JA7H 1B7YA 1O7IA 1M1KC 1B70B 1P8LA 3I4MG 5FLXc 3F2BA 1N33L 4K88A 2ATWA 2UXBQ 4YRCA 1VCIA 5GAEC 1K83H 1X55A 1HR0W 3PCOB 2GVBA 3LSQA 1VQ6A 4DV7L 4P3PA 4X65Q 4HJ5A 1RIQA 4YHHL 5IWAL 1VQ8A 1K0RA 2GN5A 1PH5A 5LMUL 1EIYA 4PMWA 3I4OA 2E2IH 4RG1A 2ZZFA 4ALPA 2VL6A 1V43A 3D31A 4A93G 2DTHA 1NTGA 4DV0L 1N9WA 1Z7NA 1IXRA 2JEBI 2YV5A 3TQYA 1HNXL 4DV1L 1YB3A 4CH4A 3JAMc 1G291 4YRRA 1W2BA 3J7ZC 2HIXA 3UDGA 3HOWH 2J3MA 4Q6GA 4A3FH 2E41A 4HIDA 2NVQH 3RIRA 2AKWB 4L87A 4HIKA 4LF6L 3GD7A 1HNWQ 5FLMH 1VQKA 2WB1E 3Q8DA 1XJVA 2BH8A 1VQ7A 3OD1A 2QA4A 1C7YA 2WB1G 5GAGC 3WQZA 4DR5Q 2UUAL 1J6QA 1HJPA 4X66L 4CH5A 1NYRA 1VQDA 2PMEA 5M5XH 3SGIA 2DDZA 2MFIA 2JA5G 1PHJA 3RLNA 4HJ7A 4AQYL 5E3IA 2LSSA 2CJ9A 2V1CC 4LF7L 4P74C 4DUYL 4JI4L 3VBBA 4DR7Q 3M4OH 4NB3A 4HIOA 1Y1WH 3P8VA 2ZT5A 1HH2P 2ZJQA 4XTVA 2K50A 2KHIA 3HXXA 3P8TA 1WCMG 4JI6Q 2Q2IA 3EFSA 3RACA 2NN6G 3VQXA 2DU5A 3UGQA 1EIFA 1X6OA 2PQAB 1ASZA 4YRPA 3J80i 1KRSA 3RN5A 1QUQB 4MNOA 2MNAA 2JEAI 2DGYA 1WI5A 4GN3B 4Y7NH 4BBRG 2XTIA 2PI2E 1YVCA 1D7QA 3RUXA 4OWWB 4GLXA 1HZCA 3HXVA 1G6PA 3VQYA 3UGTA 4TVAA 3U50C 1Y1WG 2UXDL 2ZT8A 3CP0A 1BVSA 2HIVA 1KMNA 3FJPA 4P3OA 2E5LQ 5JJIA 1BIAA 5GQOA 1MIUA 2CKZB 3OW2A 4B3RL 3A5ZA 2QGQA 4DUZQ 3MF1A 1QE0A 4OWTB 3TS0A 1N36L 1NE3A 4XU0A 1IL2A 3CCSA 2IX0A 1I94Q 3TRZA 3JAMi 3K8AA 4LFAL 1PYBA 2EJFA 2WAQE 4HJAA 1NJ8A 4LF9Q 1K73C 4IOAA 1FL0A 3PV0A 5IYCG 4EQ5A 2E5LL 4K0KL 1YJWA 3KF8B 3A31A 1XMOQ 5DLQE 2DJZA 1KHIA 1SFOH 1EIYB 4YRKA 4B3SL 2IHEA 2E2JH 1VQ4A 4YPFA 4TWAA 1HR0Q 3P8YA 1JJGA 1I6HH 3LSSA 3AFPA 2ES2A 1Q1BA 1J5EL 2NZHA 1L0WA 3HKSA 2DZ9A 4ZTUB 3HOXH 4APVA 3T1HL 1PV4A 1EOVA 4JV5L 1WPYA 2HQLA 3H3VI 5JJLA 4ME3A 4NCXA 2ZR3A 2AMCA 2OCEA 4YWMA 1VQEA 1A62A 3PO3G 1X65A 1SERA 5BR8Q 1A0IA 4DR7L 2EWNA 4DUYQ 3I2ZA 2NN6I 3T1YL 4QY7A 1USYA 3HY0A 3L1AA 3S1RH 4DAYB 4JI8L 2VY3A 5JEAG 3HOYH 5IY0A 4JI7L 1PH7A 1A63A 3DLLA 3UDFA 2IX1A 3WWVA 4A3DG 3REXA 4DV1Q 2DQ3A 2DXUA 1GD7A 1QVCA 1Q86C 3RKXA 1NYQA 1YNXA 3S17H 4XTZA 5M5WH 1KIXA 1X3EA 3I4MH 3NBHB 2AMCB 1EQQA 4A3EH 3PUYA 1XPRA 2E2HH 2F52A 3AEVA 3M85A 1S72A 1YFRA 3UH0A 1GKHA 1GVPA 4DV3L 5IYBH 2Q7EA 4P74A 4WJ3M 3H3VH 1FYFA 3FKIH 1L2FA 1AE2A 1G5IA 2BH2A 4NXML 2YTVA 3PIOA 4HIMA 2Q2UA 3H15A 1HXDA 3K80C 2ZTGA 2CWAA 1UEBA 1SR3A 4A3JG 3W5OA 3GDEA 4BA2I 4HWSA 1DGSA 2PNHA 4A93H 3IRBA 4Q15A 4L5TA 1X54A 1M90C 4AYBG 2ID0A 4GN5A 3L4GA 1VQBA 1NJIC 1KRTA 2R92H 3M9BA 1NJ2A 3FKIG 4DR6Q 4PZ8A 2ZINA 1XNQL 2ZT7A 3R07A 4DV5L 4GOPA 3RZOH 1WNLA 2RHSB 1HZ9A 3RL6A 3W1GA 1EUJA 3HXYA 3HTZA 4BA1I 3I7FA 3M4QA 1Q7YC 5C44G 4RMFA 4AYBE 1VQGA 1HR0L 3VDYA 4JI3Q 1QZGA 3AFQA 2G4CA 5F5WA 2P5IA 2N49A 3S14H 4XTUA 3H0GH 2JK8A 4G85A 1QVGA 4H2SA 1CKMA 1CKNB 4IPHA 1JJ2A 4Y52H 3W3SA 1A8VA 3AQQA 4GNXB 5C4XH 2RF4A 3CAMA 1EYGA 2K5HA 2E5AA 4IO9A 4IPGA 3HY1A 1PH9A 1SRUA 4JG2A 2ZM6Q 1YHBA 2E10A 1HTTA 4A3LG 4NXNQ 4JI8Q 2I5MX 2EQSA 2UXBL 4JI2L 1UE7A 4BBSG 3ERSX 3W1BA 1Q8KA 4TVWA 3S2HH 1S40A 4LUZA 4G84A 1WFQA 4YP0A 1I50H 2N8NA 1D8LA 4NPSA 1B8AA 3J81i 1YJ9A 1VQAA 1X3FA 2DKGA 1K8GA 3RF1A 2I4NA 1W66A 3PUWA 2PMFA 3K81C 5C4JH 1EFWA 5IE8A 3GTPH 5M3FH 4A3IG 1LUZA 4DAMA 1JMCA 1IZ6A 4QL5A 3HOVG 1LTLA 3PZCA 5HGQA 5LMNQ 1X01A 4HJ8A 3OTOQ 1XMQQ 4JBMA 3HOZG 2J3LA 4GOPC 1MJCA 2OWOA 2CWPA 1RL2A 4H2YA 1N36Q 3CCJA 1HC7A 4YRIA 5JEAJ 3J80c 1TXYA 4DQ2A 3ULPA 4A3IH 1KMMA 4R4CA 4DK3C 3HKZE 4LF5Q 1VQFA 2EJ9A 2PI2A 2VUMG 1NMFA 3MEYA 3DM3A 4GKJQ 4ZTZB 5LMUQ 3GTKH 4XTYA 4AIMA 5IYDH 2C8MA 4DK6C 3L2ZA 3HFZA 2GVAA 3KLWA 4YCVA 2RHQA 2FYKA 1CKNA 2C7IA 1JJCA 4JI2Q 3MF2A 4QIWE 1ASYA 1YBYA 3KFUA 3F8TA 4A3FG 2Q2HA 2ARSA 1QUQA 4LNSA 2F4VL 3RKWA 1GM5A 3QO5A 4IJHA 1P16A 3F2DA 4P71A
chains in the Genus database with same CATH superfamily
1PH4A 3DSQA 2DY8A 2ENBA 4HCSA 4JV5Q 2DQ0A 2ZZGA 5C4HA 1VQLA 4RQFA 4KJNA 1Q82C 3EQLC 2VB2X 1WQ7A 2M2LA 3DWAA 5GADC 2LXKA 1A6XA 1YZ6A 2VUMH 4RQEA 4PZ6A 4LK1C 3GTGH 4IZ8A 4QGUA 3RKYA 1SSOA 3PO3H 5C52B 4QQBX 3MFGA 1CK1A 3WOEA 4BY7H 3SK4A 4DKAC 3I4NH 1B7YB 2Q5IA 2B2UC 1UE5A 1VQCA 1VQIA 3A5UA 4QUCA 5BN5A 3TS2A 3HFVA 4KKUA 3QO8A 2OT2A 2AQ1B 1U0LA 2IY5A 3OSOA 1GHJA 1PZID 1Q12A 2KBNA 3H09A 3SDZA 1B4OA 2D0OA 1PVOA 3S1NH 1I3QB 4QJFA 1T9HA 1YI2A 3NTHA 4TQFA 1DOMA 1KC8C 4IOCA 4CS4A 1BOSA 3BYTB 3KLSA 3GTLH 4X3KA 3J80E 2K52A 2BE5C 2F0KA 1QF6A 5FO7B 3IL8A 3DM1A 1JE5A 1F9QA 3ITPA 5C3XA 2EIFA 3J81c 1FNWA 1T5XD 4LW1A 5EKIA 1FD7D 4R4OA 3TUPA 2ZIMA 1PYWD 1VQMA 1KQSA 4BWGB 1I4GA 3EIVA 4A3BB 3E0JA 4A3EG 4NP5A 4BBRB 5KIXA 3M4OB 1S5CD 4I7AA 2A6HC 1CHQD 5J39A 1BF4A 2I4LA 3ER0A 1WTVA 4EQNA 1BCPB 3G71A 1HCZA 3CU7A 4NKLA 1KDAA 1TY0A 1FNUA 4KLKA 2DEQA 1OTCA 2OQKA 2HNIA 3D8GA 5CORA 4CKEA 5EPKA 3TZUA 3TEHA 1CKOA 5C53B 3ULJA 4ZUIA 2B2VA 4X3TA 1RTNA 4DV2L 2B63H 1CI3M 1XNRQ 2EPBA 5AJ3Q 2RHQB 4O2DA 1RCVD 3K6OA 2A1AA 1G91A 1GO3E 1NUCA 3D4DA 5EAYA 2RVLA 4N8X1 4LF8L 1W3SA 4E6IA 3KF6B 4OONA 5GAHC 2JA6G 1KXLA 1SESA 2NVQB 4JYAQ 2K75A 2F3WA 4GNXC 2ZXPA 1PRTD 1CZGA 3FDTA 4M1UB 4FF1A 5KNNA 1XXGA 4DNRB 2R7ZG 2LMCB 4IJLA 4IFDI 4K0KQ 5ISRA 1B2TA 1O7ZA 1IYJB 4ZK9B 1AFPA 2B39A 4GNXA 4ZRZA 3PIPA 3K57A 2K05A 3TN2A 3CCVA 4LVKA 1Y1VB 1UWVA 2R92G 3L0OA 2L1BA 1EY9A 1B50A 1QB5D 2CIMA 1E2WA 4DK0A 2EJFC 3LC0A 2ZJRA 1I4XA 2IX3A 2JA5H 4HA8A 2CH4W 2ARUA 1F77A 2K7VA 1PDQA 4CDEC 1U5KA 2EY1A 2N78A 2OF1A 1HZAA 1BDOA 1M8AA 4PZ7A 4C3IG 4H2UA 2JA6H 2R93H 4F8MA 1ADJA 3NUCA 1E7ZA 4U673 1D1IA 1ZEQX 2NVYB 4EQOA 5M5YH 2F0QA 3GP7A 1SYEA 1PYSB 2F0EA 3TP6A 3EROA 3E9IA 3T13A 4X65L 1TS3A 5C0XG 3IKLA 5C0XI 1NMGA 1G5HA 1WJJA 1E2VA 1Q81C 5I9OA 2JJQA 4TTVA 1MSGA 1TWAH 4L5RC 2I0QA 4LF7Q 4A3CG 1STBA 4YY3Q 3EBEA 4H44C 1HQRD 3H0GG 2Q2TA 2PYKA 2DXTA 4YRGA 1ZKOA 1TR5A 3VYRA 4BXXH 1LLRD 3KBXA 3AMUA 4LMQD 1H9SB 2R61A 3CMAA 4WF2A 3CCUA 1H4SA 1FJGQ 4JI0L 2ZXFA 3UDXA 4O0AA 3K59A 5C4XG 3HS0C 2C9OA 1KAWA 3CCQA 1ILQA 2R3ZA 1VQZA 5K1PA 4C56C 1Y1VH 4UHVA 3EN2A 5T1IA 1PA6A 2I46A 4K5VA 4LUOA 3PGZA 2EY5A 4L5QA 3DWQA 2JA8G 5K36H 1Y1WB 4CH6A 3GQBA 3I3CA 1WTPA 2EOTA 1N34L 1J5WA 5H1SE 1WVLA 1STEA 5CBEE 4HMIA 3X3MA 4DXFA 4A3MG 3HOUG 5E4WC 1IBML 2EZVA 1G51A 2PZWA 2IT1A 2Q8RE 3MEHA 4TVYA 3GTMB 1OXXK 3JC66 2B8FA 2UUCL 2MO1A 1YNNC 3WOFA 2AWNA 1D1KA 1L1OC 5CYUA 2ZCEA 2QHUA 3K0XA 2Q7HA 1SN8A 4BY7B 2ZT6A 5M3MG 1G2SA 4CDDC 1NR4A 4LUVA 4HSVA 1T5EA 4K2LA 1LTTD 2BCOA 4P71C 5IYDG 3HXUA 3S9WA 4DV5Q 3UFGA 1B9MA 4OXPA 4A3CH 1XNQQ 3Q23A 2ZNJA 1TWAB 1F9RA 2IHFA 3Q0AA 4MTNA 1IW7C 4GLAC 3RN2A 2E3CA 4DR2Q 2DUDA 1KD1C 1S3OA 4TQDA 3A8JE 1VQPA 1TWGB 1CA5A 4RGMA 4B3TQ 5C3EG 4HWRA 2MPMA 1DONA 1DYQA 3BVMA 4ODGA 2PPBC 1HUMA 2Q5HA 3EFRA 1SNMA 2JE6I 4GS3A 1NJ6A 2F0MA 2F0WA 2ZTEA 1IBKQ 1HA5A 2F4IA 2F0DA 2UXCL 2XVSA 5IGFA 3M3YH 5M3MH 1LTID 2NWGA 2Z6KC 3K7UC 5EGTA 4IFDG 2WKDA 2ALYB 2M9VA 2ICIA 4P73C 1ML0D 4KY5A 5ELOA 1FGUA 2NZOA 4C3JB 1JT8A 4XU1A 1OXTA 4RH6A 2HHHL 1HNWL 2CJAA 1QJOA 1AE3A 2MUYA 2Z1CA 1VMCA 4XT1B 1Q1EA 2CFMA 4HWTA 4JI6L 4ZIBA 4BS9A 3AU7A 5JJZA 1IBKL 4YRNA 1KDCA 1FJGL 2YU9H 1R9TH 4FO2A 3I4NG 2XN9C 1H95A 3A5YA 4CS2A 2AUKA 4JI1Q 1E2ZA 4LF4L 1SNPA 2AWOA 4J15A 2D62A 4UP7A 3S2DB 2OTJA 4YYEA 2EAYA 1CT1D 3MXPA 1Z9FA 4KQEA 3Q22A 1EYCA 1B9NA 5C5MA 2Y0SE 3IFDA 2B63B 2EJGA 2I4MA 3M7GA 5M5WB 1QCBD 4XIGS 2MJ8A 5C4ZA 1K8MA 3S16H 4R4TA 2EVBA 3DEOA 3S1QH 2CQOA 4JI5L 5CV6A 1B3QA 2ALYA 4BY1H 2A6ED 2Z0SA 4BW9A 5FOBB 2VW9A 3I8ZA 2IJ0A 3BZKA 3KF8A 5L37A 4DAYA 1YGBA 3WDNA 5CV4A 3KLSX 2MQHA 3NTIA 4JOIC 3CCEA 3H6MA 1VQHA 2K28A 3QNEA 4XU3A 3VYUA 1LM0A 4IFDH 4OL7A 5F2DA 3HOYG 2SOBA 2QHTA 2OQ0A 2K14A 3V7CA 4YDQA 2Z6KA 2VB3X 3SR1A 2DJGC 3T56B 1BIBA 4YHHQ 3RD4A 5I9PA 2G9DA 3CC7A 1PYSA 2SEBD 1SLJA 1AN8A 4B3RQ 3TBIB 4A3KH 1MKHA 1X2HA 4FP5D 4GOPB 3J81j 4ZLTF 4ZQ3A 4ZUJA 4JPBW 1JB7A 2RDGA 3SE0A 2JA7B 2Q8TA 1QNUA 1ZXTA 4XEOA 5KRUA 3UDIA 1PFSA 12ASA 5IIFA 1YHQA 1I3QH 1F9PA 1Y8NB 4H2TA 1PFBA 3OW7A 3T1YQ 2X6GA 4YRQA 2F4VQ 1TS4A 3J7AV 4PQXA 2K5VA 4R4QA 2PMZB 3GV6A 2F0GA 3HEJA 2K5NA 2K5DA 3I56A 1NBWA 3L4GB 1X56A 1V9PA 4YWLA 1NY4A 1HFNA 1Y8OB 4XQQA 1A15A 3QTCA 3PMFA 1Z7TA 2R7ZH 3BU2A 4GKKL 2UUAQ 4YRSA 3FHWA 4V0BA 2OTLA 4A3GG 3A32A 3I55A 5EKLA 4ZYSA 1TWCH 1EQTA 4ULLA 1H4QA 2JA9A 4DR1Q 3HXWA 3R2IA 5IP9G 3DEPA 1Q8IA 2PQAA 3MXUA 1QZHA 4G57A 2K03A 3ZJYC 2BDNA 2PZUA 1I6HB 3BZCA 3HKZB 3FMCA 3JAML 1BBUA 5KNBA 4YRJA 4R8NA 1WLEA 3TDQA 4JOIA 1H4VB 1G2TA 2R93B 4IFDJ 4P72A 1H9KA 3FVQA 4K86A 1GUOA 1N32L 4XTXA 5E4XA 2R93G 4B3ML 3GTJH 1PTOB 1OXUA 4RWSC 5EKKA 1MSHA 4ZKCB 4YRMA 1AZPA 1UEAB 2F0FA 2RCNA 2VZAA 4OGQC 2WFWA 2ZTCA 1JOQA 4L63B 3FPPA 1TWFH 1ONLA 1OXVA 3P1HA 4P3NA 1I4RA 1VQOA 4POGA 1ESRA 2GA4B 1Q3LA 1ZYRC 4B9WA 2UU9L 1GHKA 4DR4Q 4QIWB 3GTQH 1K3RA 4KHZA 4A3JH 2KCMA 1LT6D 2FMCA 4H2VA 1EOTA 4C3JH 1V1QA 5BR8L 4O42A 1XMOL 1PH6A 3MHBA 4DR3Q 4DV0Q 1O80A 4CJ0B 5KYIA 2HCIA 1NNHA 2CJBA 4J6HA 3OYYA 3M4PA 5LMNL 3ICEA 3K58A 1VS0A 2UXCQ 3OHXC 3PCOA 2ZZEA 2BA0A 3KJPA 2LXJA 2Y0SB 4DR5L 3V8JA 2DU7A 1VF7A 1RIPA 2PQEA 4C3HB 5IGEA 1PZKD 3D3RA 4YIJA 1JWSD 5EPLA 2O5JC 2A8EA 1PRTF 2KCCA 2FXQA 4DAPA 2JQOA 2WAQG 4Z9CB 3VA5A 3MEFA 5IWAQ 3CXCA 4JI5Q 1LT5D 2UXDQ 1NJ1A 2QHVA 3LGJA 4EX5A 4LVIA 3T53B 2VQEQ 1DCZA 1I5FA 1XPUA 5CR3A 1EZ8A 3H3VC 2B2TC 1LTAD 2EYOA 4DPGA 1J5EQ 3ULLA 3CMQA 3REUA 2QW7A 1BBWA 1EEID 1EVKA 3HOWG 4K6DA 2E2IB 4LFBL 5IT9c 4IUPA 1JICA 2ZIOA 4DR3L 1ATIA 3HOVH 2R7FA 1HTPA 5CMDA 1A3UA 5DAUA 3RMHA 3QG1A 1K0SA 2KEDA 3K5LA 4DV7Q 4K8IA 3HOZH 4OLFA 2K5WA 5GROA 1HNXQ 2KENA 5FLMG 5M3FB 3OWEB 3KOJA 1IBMQ 4IUUA 3LWEA 3CF5A 3P75A 4RCNA 5J3BA 2RKSA 2I5LX 4CGYB 1N34Q 1YFTA 2UUBL 4LF9L 3QO7A 2K1BA 3H94A 2L12A 4XTCS 3HRIA 4C3IH 3IAYA 1L1OA 2WINB 2CW0D 1KTKA 4OO1G 2UUCQ 2B3GA 2NUCA 2MHVA 1D5MC 2RA4A 2RHSA 4RDXA 1V1PB 5J22A 3NELA 3RNUA 2QCPX 3M7NA 4XEMA 4BXXG 2EYJA 2KCTA 2F1MA 1EFID 2Y0SG 1YJNA 4X62L 3HFZB 2NBFA 3PUXA 3S2HB 2NVTH 1QG7A 1TT2A 4KR2A 5D14A 4PNYA 5KGUA 2E64A 5D65A 3EVQA 4YY3L 2QEXA 2K4KA 4FVMA 4BBSH 3KDFA 4DGZA 4A3KB 3VQVA 1VQJA 3A7UA 2B2YC 1G6ZA 1N8RC 4X6AH 1UE6A 5G3LD 3E0EA 4CH3A 2JA8H 5K36G 2RCFA 4AQYQ 3CCMA 2UU9Q 3A0JA 1HNZL 1E1TA 1GUSA 3V8LA 3VR6A 3V2TA 2L9HA 5IOCA 3F1ZA 4DR6L 1AP0A 4C1NK 3SVMA 3QR8A 4QCLA 3TEHB 4BY1B 4B3MQ 4XTWA 3CQZH 4DF7A 4JBJA 1WTHA 2E2JB 5IGGA 1EQRA 4H02A 2KUMA 2I4OA 3V7RA 1IBLQ 1CFMA 1WCMH 2TMPA 4IPCA 2O2LD 3I72A 3HKZG 4DK1A 5CBAE 2I5HA 1CQVA 2Q8IB 4RAUC 3IALA 4YRFA 1L1OB 4X66Q 1KLUD 5EPJA 3S1RB 2L15A 4XDXA 2A69D 5IODA 4KKTA 3F2CA 4C3HH 1IYUA 1K8AC 4XU2A 4LF6Q 4KR3A 2B2WC 5IGCA 4MIUA 4TVAB 4IQZA 4A3GB 3DWPA 4OHJA 2KHSA 3G1ZA 1YIJA 4QB4A 2XIWA 1D2BA 2A19A 4JK1C 4BY7G 3NETA 3PSIA 4DXGA 2XGTA 1CSPA 3B6YA 3I70A 1HNZQ 3BG3A 1PTOH 4LNQA 1GUWA 3NENA 3S1MH 1FYCA 4DUZL 3HXZA 3FP9A 1R4PB 2CGHA 4DR4L 3PF4A 1VQ5A 3STBD 2DNEA 3MZ5A 3DHQA 3ERRA 3QOLA 2K32A 2DZCA 4WJ4A 3HOXG 1TWGH 4FXDA 2KVMA 3RZOB 4M8AA 3NXWA 1LYLA 4ME5A 4X64Q 5IP7H 5M9OA 2E1HA 4RKBA 2JA7G 4GN4B 4XT3B 2ZM6L 3PO2G 3SK5A 2ZNIA 3BDCA 3OMCA 4LFAQ 1BR9A 1ENAA 5JAVA 4OP0A 5FKAC 3C3LA 4RCOA 1U4PA 2B2TA 2WACA 3ONAB 4HJ9A 4FDBA 4GLVB 2WIIB 2HT1A 1LT3D 1RD9D 5E3FA 1O7YA 2KECA 2X6LA 2C35B 3URYA 2EYLA 4RHSA 1QVFA 3HOYB 1AH9A 1SMXA 2ZT9C 1YNJC 1GOZA 4O1NA 2HHHQ 1CHPD 1PH1A 1PZJD 1YHAA 2F3IA 4CJ2C 3RZDH 2EL9A 4YCWA 2SNSA 3NQIA 1LTBD 1K83B 2KHJA 1UE1A 3TZDA 4ZKBB 5IYCH 3GO5A 4DR1L 3BFMA 1E1OA 5K1XA 3UE0A 1Z7MA 3AYHB 3NWSA 3RLOA 4KHPQ 5IP9H 4X64L 5J1ZA 1TQOA 3KDFB 2Q7GA 3Q6SA 4BY1G 2B63G 4JYAL 1F2YA 2ZR2A 3A7AA 4DV3Q 4OO1I 1LT4D 2RSOA 2WP8J 5JJKA 1BBXC 1HPCA 3O13A 1SYCA 4A4IA 4GKKQ 4C3IB 4H2WA 1STNA 3DMUA 1B44D 4DAVA 4K14A 2CCZA 4YREA 2HQEA 1EYAA 3I4NB 5E7NA 3A56A 4QUFA 1LABA 1STGA 4H13C 4N9PA 4UP8A 4P75C 3HP3A 2QDBA 4UAIA 1E22A 3TP7A 4I65A 1PTOC 3K5NA 4A3KG 4Q0FA 4POFA 4J8QA 2ZJPA 1XTDA 3V8KA 1TIID 3VA7A 3CKIB 1WTOA 3E9HA 4OELB 2H5XA 3S17B 4AH6A 2WV6D 3A5ZB 4C3JG 3RLFA 4R9WA 4JBWA 1A2UA 2ODRD 2ZXOA 1I4HA 4JCVE 1MHWC 5HY6A 2A69C 3NBHA 1SDFA 1PH2A 3IKMB 2Z9HA 4YRTA 1U4MA 4ZAIA 3CD6A 1WTQA 1ET6A 3ZYYX 2EYHA 5IYBG 3HRZC 3U58A 4HEDA 1SE8A 2KEEA 4EQPA 4DNIA 2F03A 1JB3A 3ICAA 1B76A 2RBMA 4IUNA 2UUBQ 1XPOA 4Y7NB 3V7SA 1SETA 1VDZA 1C48A 3NQTA 3CPWA 3LNNA 5C3EB 4LFCL 5M5YB 1NR2A 5I6WA 1DOLA 4ID6A 4OWXB 1B70A 4RGTA 4YRLA 3W2DA 2EXDA 1Y69U 4A3GH 4A75A 2N3SA 3S2DH 4YWKA 1QILA 1MJEA 4X5OA 1KABA 4HVCA 1Q46A 4LF8Q 4QMGA 5IT9E 4I7ZC 3CCLA 2XWJB 4JI1L 4H2XA 4L5SA 1WOCA 5C5LA 5BN3A 5M3MB 4R1JA 3C1EA 2NVXB 1SYGA 4OEMB 1RJTA 3A74A 4DV4L 1II3A 4K5WA 4YROA 3HRKA 4A3DH 4MZ9A 4CKBA 3CC4A 1YEZA 4A3BG 1X2GA 4XXEA 1EVLA 2VQEL 2E8GA 3BS1A 3PO2B 5ELFA 1I94L 2PW5A 3PUZA 2E76C 2K5QA 4JC0A 2PMZE 2WAQB 2R7DA 4A3MB 5C44H 5ELDA 3HOUB 4F88A 3PF5A 3HOXB 2ZGWA 4LFCQ 2B2WA 3A7AB 4KI0A 1DJRD 3G6EA 2DVEA 5EQ0A 3KUPA 4DV6Q 2JA8B 5I2XA 3K0YA 2A5HA 1VQNA 3DUZA 1PLFA 5FLXE 2NN6H 3S15H 1JORA 1YNND 4KKSA 3S24A 1BXTA 1EY5A 3TREA 2AHOB 4P75A 2YTYA 2Z4IA 3NSWA 2O5IC 3G4SA 4JI0Q 2NVTB 3TP5A 3KYHC 3X3NA 1K9MC 2PNRC 2MO0A 1KNEA 1ICWA 3GTOH 3VQWA 4JI7Q 1CSQA 4BBRH 3C1FA 5ELNA 5IGDA 3D4WA 3NTKA 4A3BH 1XWEA 2EJGC 2RSNA 4B3SQ 3GTMH 5C0XJ 4JW0A 1YFSA 1TWHH 2DTIA 1WYDA 1CTMA 4IURA 5ELCA 4B3TL 2A73B 4K87A 2EE1A 5C6AA 1X3PA 2D0PA 3MXNA 3L2PA 4P72C 3U4VA 3I90A 4KHPL 2J4XA 1FVIA 3UE1A 1TS2A 1PTOD 3NPPA 1BKBA 2B2YA 4TQUS 4WORA 2VQFL 3K7AH 4IPDA 4OX9L 1SRYA 1USYC 1UNSA 4A3LH 1BNZA 4X62Q 1QE6A 5D3DA 3D6WA 4KN7C 3MXNB 3CCRA 3MAQA 2D2CC 4P73A 4XYQA 1JC7A 4ZCKA 3GTLB 2IPKD 1SBBB 3CC2A 3KF6A 2F0SA 4UP9A 3S1NB 5COYA 2L5TA 4PHCA 2BA1A 2ASBA 3P7JA 4E51A 4EO4A 2QHSA 1EWCA 3SEBA 1TWHB 3NBIA 3NHHA 1MD2D 5TSSA 1YITA 2VXWA 5LMNW 1Y1VG 1WU7A 3J81L 1HUNA 4OX9Q 3A7RA 4NXNL 1EWIA 1CUKA 1CQFA 1PH8A 1IBLL 1JWMD 4JI4Q 3S16B 1WQWA 2JYOA 2DTOA 4MTKA 1Z47A 3D0FA 2YTXA 3STBC 1N33Q 5DM63 1C9OA 2ZXRA 3IKJA 5ELBA 4N9TA 1KOGA 1EEFD 1U4LA 3NEMA 2XRSD 3QWNA 2JA6B 4G7ZC 3M4YA 4H2XB 1KL9A 1BO0A 2R6GA 3CMEA 2EJMA 1BQQT 1HZBA 2N88A 4A76A 3S1QB 3BVZA 4WI1A 1K3BC 4YCUA 4DV2Q 1R9TB 3MVVA 4TKOB 2NVYH 2AKWA 3TEGA 3D6CA 4A3MH 3HOUH 2ARTA 3RUZA 2SDFA 1EY8A 2VNUD 5M3FG 2D9UA 2H4OA 2ZTDA 4BWAA 3OWFA 1H4TA 2AQ2B 3PO2H 4CS3A 1X9NA 2B2VC 2DY7A 4JBKA 3T16A 3GTQB 3L9AX 4PG3A 2QKIC 2F0IA 11ASA 2F0HA 5C51B 1EIGA 1C8CA 4K8JA 4K5XA 4C2MH 2NVXH 4GKJL 1OXSC 2EYFA 2ODRC 3BJUA 4DV4Q 1H9MA 4NDXA 1EZ6A 3R8BA 3T1HQ 5DNFA 1KAAA 2IY5B 2NS6A 3HOWB 2P0LA 4LF5L 4UDUC 1E3PA 1U9RA 3G48A 1GGMA 2E74C 2A8VA 4CDFC 1E24A 4UPAA 4H7BA 2VQFQ 2M00A 3RGLA 1WD0A 1SE4A 1ET9A 3L7ZC 2YYZA 2JSOA 5JVG3 1NJ5A 1SROA 5FJ8G 4JI3L 3OTOL 2IW3A 5C3EH 3J7AF 2AUJD 3KJOA 3CW2C 4DR2L 3IG2A 4NXMQ 3CRLC 2B29A 4HWOA 3GTJB 1PRTC 5ELEA 4HWPA 4UY8C 4C3HG 2VS1A 3CRKC 3U4ZA 4RHRA 2MGSA 3J7A5 1C0AA 1TWCB 1VQ9A 3MTSA 5DEHA 4LF4Q 1N32Q 2IWHA 3JAME 3C2PA 1C4QA 4DNTB 1XMQL 3PUVA 3F2UA 1I4PA 1XNRL 4LFBQ 1HA6A 1JJCB 1XYIA 1CM9A 4LWCA 4XQNA 3CPFA 1JE4A 4HCEA 5CGKA 3J81E 1LTRD 4WRDA 4DV6L 5AJ3L 2RDFA 1X3GA 1ADYA 2E65A 4F87A 3NK9A 4J1MA 1EL0A 1SNCA 3OPOA 2CVRA 1LO5D 1PH3A 4R4IA 1Y14B 5FJ8H 2SNMA 5JPMC 1YNJD 1RDPD 3RR5A 1RTOA 5IP7G 2X69A 4OIJA 2JA7H 1B7YA 4TRDA 1O7IA 1WD1A 1PFMA 1M1KC 2DN8A 1B70B 1P8LA 2FHTA 3I4MG 1HQMC 5FLXc 2CH4A 3F2BA 4U68A 3GV3A 1N33L 4LVJA 5KEEA 1CA6A 1B1ZA 2ATWA 4K88A 2UXBQ 4A3FB 4HMJA 4C2MB 4FXKC 2E2HB 2EYMA 4HSPA 5C3WA 4YRCA 1VCIA 4R8IA 5GAEC 1NNXA 4IN3A 1K83H 1X55A 1O78A 1HR0W 3PCOB 1DXMA 1HFGA 2GVBA 1TU2B 3LSQA 1I50B 1VQ6A 4DV7L 4P3PA 4X65Q 4HJ5A 1RIQA 4FXGC 4YHHL 5IWAL 1VQ8A 1K0RA 4MN3A 3G6JB 2GN5A 1PH5A 5LMUL 1LTGD 1EIYA 4PMWA 3I4OA 3VR3A 2E2IH 4K6LA 4RG1A 2ZZFA 4HTHA 2G9HD 2VUMB 4ALPA 1W6KA 2VL6A 2MP1A 1X32A 1ILPA 1V43A 4L6TB 1JWUD 3MC0B 3D31A 4X3SA 1S5BD 4A93G 5LL6S 1NTGA 2DTHA 1MGSA 3QIAA 4DV0L 1N9WA 1Z7NA 1KDBA 1VMPA 1QWYA 1IXRA 2JEBI 2YV5A 3TQYA 1HNXL 4DV1L 1YB3A 2G5DA 4CH4A 3JAMc 1G291 4YRRA 1W2BA 5C4XB 3ND8A 1BUVT 5JEAH 3J7ZC 2HD3A 2HIXA 4AYBB 3UDGA 1ZYRD 3HOWH 2J3MA 1SEBD 4A3FH 2E41A 4Q6GA 1PXUA 4HIDA 3M3YB 3H0GB 2NVQH 2PW7A 3RIRA 1XX8A 2Z6BA 2AKWB 3J7YW 4PMBA 4A3JB 4L87A 1EU3A 1DM0B 4HIKA 4LF6L 3GD7A 4A3IB 1HNWQ 1SNOA 1JOOA 1EU4A 5FLMH 1VQKA 2D5DA 1V1PA 4KHVA 2WB1E 3Q8DA 2HDMA 1XJVA 2BH8A 1BCPF 1EY6A 2XSCA 1EWHA 2CW0C 1VQ7A 3LX0A 3OD1A 1H9RA 1F2ZA 2QA4A 1C7YA 2WB1G 5GAGC 3WQZA 4DR5Q 2UUAL 4OO1H 1J6QA 1HJPA 4X66L 3GTOB 4CH5A 1NYRA 1VQDA 2PMEA 5I6YA 3FEWX 5M5XH 1STYA 3SGIA 2L11A 2DDZA 2MFIA 2JA5G 3SHLA 1WTWA 1PHJA 3RLNA 4HJ7A 4AQYL 4KTAA 5E3IA 3S15B 2LSSA 1GUGA 5JOBA 2CJ9A 1X3QA 4BBSB 2V1CC 4LF7L 1ICFB 4P74C 1QNKA 2KA7A 2R7ZB 4DUYL 4JI4L 1SXTA 2BE5D 4KD4A 4DR7Q 1TS5A 3M4OH 2A68D 3VBBA 4NB3A 4HIOA 3A8IE 4XYOA 1Y1WH 3P8VA 2ZT5A 1SYFA 1F2LA 1HH2P 2ZJQA 4XTVA 3OIQA 4EGVA 4CJ1B 2J0TD 1SJED 4CKCA 2K50A 3N52A 2LFNA 4LAAA 2KHIA 3HXXA 5C4JB 1D5XC 3P8TA 4NW2A 1WCMG 3K7AB 4JI6Q 3TMEA 2Q2IA 3KK7A 1L0YB 2JXMB 1EYDA 1PTOF 3TSSA 4B08A 3EFSA 3RACA 1NSNS 2NN6G 3VQXA 2DU5A 3UGQA 1EIFA 4FF4A 3FPUB 1X6OA 2PQAB 1ASZA 1HHVA 4YRPA 3QOJA 3J80i 1V8QA 1KRSA 3RN5A 1QUQB 1S4ZA 4MNOA 1B3AA 2MNAA 2JEAI 2DGYA 1WI5A 4GN3B 4Y7NH 3H91A 4BBRG 2XTIA 3ERQA 3PO3B 2PI2E 1YVCA 1D7QA 3RUXA 4OWWB 4GLXA 1Z6HA 1HTLD 1HZCA 1SAPA 3OIPA 3HXVA 1G6PA 3VQYA 1IKMA 3UGTA 4LJZC 4TVAA 1J9OA 3NE5B 3CHBD 3U50C 1Y1WG 2UXDL 5T1GA 2F0TA 3CP0A 2ZT8A 1BVSA 2HIVA 1KMNA 3FJPA 4DA2A 1DOKA 1SNDA 4P3OA 2E5LQ 5JJIA 1BIAA 2B2UA 5GQOA 3TP8A 1MIUA 4KY6A 1TKWB 2CKZB 3OW2A 4B3RL 3HG9A 2XNAC 3A5ZA 2QGQA 4DUZQ 3MF1A 1KNAA 3BVGA 1QE0A 1H9JA 1EY4A 1K28A 3HZXA 4OWTB 3TS0A 1L0XB 1N36L 1JCKB 2WKCA 1NE3A 4XU0A 1IL2A 3CCSA 2IX0A 1I94Q 3TRZA 2KOLA 3MA2B 3JAMi 3K8AA 4LFAL 1PYBA 1VF5C 2EJFA 2WAQE 2B8GA 4HJAA 5EBDA 1NJ8A 4LF9Q 5FO8B 1K73C 2HDLA 4IOAA 1RHPA 4G7OC 2HUGA 1FL0A 3PV0A 5IYCG 5LHY1 5C0XH 4EQ5A 2E5LL 4K0KL 1YJWA 3KF8B 1B53A 3A31A 1Y8PB 1XMOQ 2IL8A 5DLQE 2DJZA 1KHIA 1SFOH 2FINB 3A7LA 1EIYB 4LVLA 4YRKA 5A2QL 5CV7A 3RZDB 4B3SL 2IHEA 2E2JH 1R4QB 1VQ4A 4YPFA 3HGBA 5KNCA 1QOHA 1IL8A 4KD3A 1STAA 4G4KA 4TWAA 1HR0Q 2JP1A 3P8YA 5CC4A 2OEOA 3L3OC 1I6HH 1JJGA 3LSSA 2L0CA 5M5XB 3OOCA 3AFPA 4FF2A 2ES2A 1Q1BA 4K2KA 3R93A 1J5EL 1F9SA 2R92B 1WTXA 3NWTA 4RGNA 2NZHA 1L0WA 5LL6X 1H9SA 2A6HD 2F0LA 3HKSA 4V190 2DZ9A 5FK9C 1EY0A 4ZTUB 1GUNA 3HOXH 4KMUC 4X3UA 5CV5A 4APVA 3T1HL 1PV4A 4B9XA 1EOVA 4JV5L 1O7LA 2Z8LA 1WPYA 2HQLA 1LACA 3H3VI 5JJLA 3A55A 2XRQD 4ME3A 1GJXA 4NCXA 4A3DB 2ZR3A 2KCNA 2AMCA 2OCEA 3KBGA 4YWMA 2DNCA 4QF4A 4ILWA 1TVXA 2K6AA 1GXDC 1A62A 1VQEA 3VR5A 1X65A 5FO9B 3PO3G 1SMYD 3G7LA 4DFAA 1SERA 1E0BA 1EIHA 5BR8Q 1A0IA 2HCCA 4DR7L 1XTCD 2EWNA 4DUYQ 1ENCA 3I2ZA 3KLRA 3MXGA 2NN6I 1JR0D 2F0OA 4P2CB 3T1YL 4QY7A 1USYA 3HY0A 3L1AA 2QF7A 3S1RH 1S5FD 3I73A 4DAYB 3HOZB 2PCFB 4JI8L 5NUCA 2VY3A 5KYLA 5JEAG 1KLGD 3HOYH 5IY0A 4JI7L 2K04A 5A2QE 2BDOA 1PH7A 4A3EB 1A63A 3DLLA 3SXHA 3UDFA 2IX1A 3T51B 4PV1C 2NTTA 3CQZB 5HURA 5HGTA 3WWVA 1Q90A 4A3DG 1NCVA 3REXA 4DV1Q 1GUTA 2DQ3A 2DXUA 1GD7A 1QVCA 1Q86C 3RKXA 1NYQA 3QB3A 2JN4A 2EYPA 1YNXA 3S17H 1WTRA 4XTZA 2O4XA 5M5WH 1KIXA 1X3EA 3I4MH 3NBHB 1J8IA 2RQXA 1D5ZC 3I4LA 1SNQA 2AMCB 3R3OA 1EQQA 4A3EH 3PUYA 1XPRA 2E2HH 1SE3A 2PZTA 2YU9B 2F52A 3AEVA 5BN4A 3GTKB 3V96A 3E6ZX 3M85A 1S72A 1YFRA 3UH0A 1ESFA 1GKHA 1GVPA 5E1FA 4DV3L 2E2DC 5IYBH 2Q7EA 4S3SA 4HN7A 2WB1B 4P74A 4WJ3M 2A68C 3H3VH 1FYFA 1W6JA 3FKIH 1L2FA 1AE2A 1G5IA 3LWUA 2BH2A 4NXML 2YTVA 1FGBD 2LS01 3PIOA 4HIMA 2Q2UA 3H15A 1HXDA 2L4NA 3K80C 1MBYA 1PFNA 2FJ2A 2ZTGA 5KNDA 2RDHA 4EVOA 1F2MA 2CWAA 2A6EC 1UEBA 1SR3A 4A3JG 3W5OA 4FF3A 3GDEA 2ICEC 4BA2I 4HWSA 1DGSA 2PNHA 4A93H 3IRBA 4Q15A 3C46A 1IYVA 4L5TA 2KQ3A 3I91A 1X54A 4Q5VA 1OO9B 1M90C 4OIKA 1HRJA 4KJOA 4AYBG 2ID0A 1RKNA 4GN5A 3L4GA 1HXYD 5G3LF 1VQBA 1NJIC 3MQZA 1KRTA 2R92H 2OXPA 3M9BA 3MFYA 1NJ2A 3FKIG 3U9OA 4DR6Q 4PZ8A 3GTPB 2ZINA 1XNQL 3Q24A 2ZT7A 3R07A 4DV5L 4GOPA 3RZOH 1WNLA 2NTSA 2RHSB 1HZ9A 5C44B 3BDLA 4A93B 3RL6A 4WFN3 3EFXD 3K5MA 4G7HC 3W1GA 1EUJA 3HXYA 3HTZA 1BCPC 4CHTB 4BA1I 3I7FA 3M4QA 4C1NI 2LY7A 2C5CA 2FFKB 1Q7YC 2Z4HA 5C44G 3SK6A 4RMFA 4AYBE 4H0LC 1VQGA 1HR0L 3VDYA 2CHBD 4JI3Q 1QZGA 3AFQA 3VR2A 2G4CA 1UAPA 3FKIB 2N55A 1AZQA 3SK8A 4PMCA 2K33A 1LV9A 1SJHD 5F5WA 2XWBB 2P5IA 2N49A 3AB9A 5A35A 2J7ZA 3S14H 4XTUA 4IUQA 3H0GH 2JK8A 4G85A 1QVGA 4WJWA 4H2SA 1CKMA 1K8OA 1CKNB 4IPHA 1JJ2A 1WCMB 4Y52H 3VYTA 3W3SA 3HOVB 1ENFA 5CV8A 4GZYC 4KV6A 1A8VA 5CV9A 3AQQA 4GNXB 5C4XH 3E3XA 4RGOS 4HT4A 2RF4A 3CAMA 3GTGB 1FNVA 1EYGA 2K5HA 3D4RA 2E5AA 2V4DA 2QDLA 3T4AC 5IT9L 4IO9A 3I4MB 1FR3A 2L55A 4RA8A 4IPGA 3HY1A 4MHEA 3E5SA 1PH9A 2EY6A 1SRUA 3W3AA 4JG2A 3A8KE 2ZM6Q 2F0NA 5D3IB 2K01A 1YHBA 1S5ED 3R2TA 2E10A 1HTTA 4KK7A 4A3LG 4NXNQ 1TY2A 4JI8Q 2I5MX 2EQSA 2H1EA 5DM73 2UXBL 2F0JA 4JI2L 4ABNA 1UE7A 4TSSA 4BBSG 3ERSX 3UI2A 2AQ3B 1A3TA 3W1BA 1Q8KA 4TVWA 1EY7A 3S2HH 1S40A 1EQVA 4LUZA 4DU9A 2JA5B 2A74C 4G84A 1I4QA 5EJWA 1WFQA 2FMMA 1PRTB 4YP0A 1I50H 2N8NA 3S14B 1D8LA 3BYYB 4NPSA 1B8AA 4FYDA 3J81i 2F0PA 1YJ9A 2I07B 1VQAA 4CBVA 2EY2A 5K5PA 3V05A 2F0UA 1X3FA 2DKGA 5I4DA 4IUTA 1K8GA 1PMRA 3RF1A 2I4NA 1TWFB 1A2TA 3BZDB 1U4RA 3K81C 3PUWA 5C4JH 1W66A 2PMFA 1EFWA 4N8FA 1JOKA 4RFBA 5IE8A 1D6EC 1SMYC 2TSSA 5I2YA 3GTPH 5JPNC 5M3FH 3PIO3 4CDCC 4A3IG 1UUPA 5IGBA 1LUZA 1DZ1A 4DAMA 2EDGA 1JMCA 2QEJC 1IZ6A 1I6VC 2P5ZX 3EJIA 4QL5A 3HOVG 1LTLA 3PZCA 4JVZA 5HGQA 2NZ1D 2NYZD 5LMNQ 1X01A 1IW7D 1SYDA 3P20A 4HJ8A 3PQIA 3OTOQ 1XMQQ 4JBMA 3HOZG 1M4VA 3DXJC 5JVH3 2J3LA 3FRPB 4GOPC 2BOSA 1CZWA 1MJCA 2OWOA 4RKLA 2KJXA 1SE2A 4DN4M 3N6RA 2CWPA 1LTSD 1RL2A 2F0VA 1G8ZD 1SFOB 4H2YA 4HAEA 1N36Q 3CCJA 1HC7A 4YRIA 5JEAJ 3J80c 1TXYA 4DQ2A 3ULPA 4A3IH 2CQAA 1IKLA 1KMMA 2EXZA 4R4CA 4DK3C 3MWYW 3EA6A 3HKZE 4L8JA 1AW7A 3QO2A 3S1MB 4LF5Q 1VQFA 2EJ9A 2PI2A 1S5DD 1A3VA 3ND9A 2VUMG 1NMFA 2QILA 1IHZA 4F7XA 3K5OA 3MEYA 3A54A 3DM3A 4XQJA 4GKJQ 4ZTZB 4FNFA 1STHA 4IALA 5LMUQ 3OMGA 1AEXA 3GTKH 1SYBA 3PIP3 4XTYA 4AIMA 5IYDH 2C8MA 4DK6C 3U9SA 3IFTA 5AFWA 3L2ZA 3HFZA 3J80L 2GVAA 3KLWA 4YCVA 1RF2D 2RHQA 2FYKA 1CKNA 2C7IA 3VR4A 1RODA 1JJCA 4JI2Q 3MF2A 4QIWE 4LVMA 3QJYA 2F3VA 1YBYA 1ASYA 3KFUA 1DD2A 3NP8A 5FLXL 2PO4A 4IUVA 1V1OA 4KY7A 3F8TA 3VYSA 4A3FG 2Q2HA 4HR7B 2ARSA 1MI2A 2DJFC 5EBCA 2LKVA 1QUQA 4LNSA 2F4VL 1BCPD 3RKWA 3BDOA 2NB0A 4KN4C 1GM5A 4NMZA 3QO5A 1NAPA 2E75C 1P16A 4IJHA 3F2DA 4P71A 1JQYD
chains in the Genus database with same CATH topology
1PH4A 3DSQA 4JV5Q 2DQ0A 2ZZGA 1VQLA 4RQFA 1Q82C 1WQ7A 5GADC 2LXKA 1YZ6A 2VUMH 4RQEA 4PZ6A 3GTGH 4QGUA 3RKYA 3PO3H 5C52B 4QQBX 4BY7H 4DKAC 3I4NH 1B7YB 2Q5IA 1UE5A 1VQCA 1VQIA 3A5UA 3TS2A 3HFVA 3QO8A 1U0LA 2IY5A 1Q12A 2KBNA 2D0OA 1PVOA 3S1NH 4QJFA 1T9HA 1YI2A 4TQFA 1KC8C 4IOCA 4CS4A 3GTLH 2K52A 1QF6A 1JE5A 2EIFA 3J81c 4LW1A 4R4OA 3TUPA 2ZIMA 1VQMA 1KQSA 3EIVA 4A3EG 2I4LA 3ER0A 3G71A 4KLKA 2DEQA 1OTCA 2OQKA 2HNIA 3TEHA 1CKOA 5C53B 3ULJA 4DV2L 2B63H 1XNRQ 5AJ3Q 2RHQB 4O2DA 2A1AA 1GO3E 5EAYA 4LF8L 1W3SA 3KF6B 4OONA 5GAHC 2JA6G 1KXLA 1SESA 4JYAQ 2K75A 4GNXC 5KNNA 2R7ZG 4IFDI 4IJLA 4K0KQ 1IYJB 4GNXA 3PIPA 3CCVA 4LVKA 1UWVA 2R92G 3L0OA 2CIMA 3LC0A 2ZJRA 2JA5H 4HA8A 2ARUA 1U5KA 2N78A 1HZAA 4PZ7A 4H2UA 2JA6H 2R93H 1ADJA 1E7ZA 5M5YH 1PYSB 3E9IA 4X65L 5C0XG 3IKLA 5C0XI 1NMGA 1G5HA 1WJJA 1Q81C 2JJQA 4TTVA 1TWAH 4L5RC 2I0QA 4LF7Q 4A3CG 4YY3Q 3EBEA 2Q2TA 4YRGA 3H0GG 2DXTA 4BXXH 3CMAA 4WF2A 3CCUA 1H4SA 1FJGQ 4JI0L 2ZXFA 3UDXA 4O0AA 5C4XG 1KAWA 3CCQA 1VQZA 5K1PA 1Y1VH 1PA6A 3EN2A 4LUOA 3PGZA 4L5QA 2JA8G 4CH6A 1N34L 1J5WA 5H1SE 4A3MG 3HOUG 1IBML 1G51A 2IT1A 4TVYA 1OXXK 3JC66 2UUCL 2MO1A 2AWNA 1L1OC 2ZCEA 2QHUA 3K0XA 2Q7HA 1SN8A 2ZT6A 5M3MG 4LUVA 4P71C 5IYDG 3HXUA 4DV5Q 3UFGA 4OXPA 4A3CH 1XNQQ 2ZNJA 2IHFA 4MTNA 4GLAC 3RN2A 2E3CA 4DR2Q 2DUDA 1KD1C 1S3OA 4TQDA 1VQPA 4B3TQ 5C3EG 4HWRA 2Q5HA 3EFRA 2JE6I 4GS3A 1NJ6A 2ZTEA 1IBKQ 2UXCL 3M3YH 5M3MH 2Z6KC 3K7UC 4IFDG 2ALYB 4P73C 5ELOA 1FGUA 2NZOA 1JT8A 4XU1A 1OXTA 2HHHL 1HNWL 2CJAA 1AE3A 1Q1EA 2CFMA 4HWTA 4JI6L 4ZIBA 1IBKL 4YRNA 1FJGL 2YU9H 1R9TH 3I4NG 1H95A 3A5YA 4CS2A 4JI1Q 4LF4L 2AWOA 4J15A 2D62A 4UP7A 2OTJA 4YYEA 2EAYA 1Z9FA 4KQEA 2Y0SE 2I4MA 2EJGA 4XIGS 3S16H 4R4TA 3S1QH 2CQOA 4JI5L 2ALYA 4BY1H 2Z0SA 4BW9A 2VW9A 3BZKA 1YGBA 2MQHA 4JOIC 3CCEA 3QNEA 1VQHA 4XU3A 1LM0A 3HOYG 2QHTA 2OQ0A 2K14A 3V7CA 4YDQA 2Z6KA 1BIBA 4YHHQ 3CC7A 1PYSA 1SLJA 4B3RQ 4A3KH 1MKHA 1X2HA 4GOPB 3J81j 1JB7A 4XEOA 3UDIA 1PFSA 12ASA 1YHQA 1I3QH 4H2TA 3T1YQ 4YRQA 2F4VQ 4R4QA 2K5VA 2K5NA 3I56A 1NBWA 3L4GB 1X56A 1V9PA 4YWLA 1NY4A 3QTCA 2R7ZH 3BU2A 4GKKL 2UUAQ 4YRSA 3FHWA 2OTLA 4A3GG 3A32A 3I55A 1TWCH 1H4QA 2JA9A 4DR1Q 3HXWA 5IP9G 2PQAA 1QZHA 3ZJYC 3BZCA 1BBUA 4YRJA 1WLEA 1H4VB 4JOIA 4IFDJ 4P72A 4K86A 1N32L 4XTXA 2R93G 4B3ML 3GTJH 1OXUA 4YRMA 2RCNA 2VZAA 2WFWA 2ZTCA 1TWFH 1OXVA 4P3NA 1VQOA 4POGA 2UU9L 4DR4Q 3GTQH 1K3RA 4KHZA 4A3JH 2KCMA 4H2VA 4C3JH 1V1QA 5BR8L 1XMOL 1PH6A 4DR3Q 4DV0Q 1NNHA 2CJBA 5LMNL 3OYYA 3M4PA 3ICEA 2UXCQ 1VS0A 3PCOA 2ZZEA 2BA0A 3KJPA 2LXJA 4DR5L 3V8JA 2DU7A 1RIPA 2A8EA 2FXQA 2JQOA 2WAQG 4JI5Q 3MEFA 5IWAQ 3CXCA 2UXDQ 1NJ1A 2QHVA 3LGJA 4EX5A 4LVIA 2VQEQ 1I5FA 1XPUA 4DPGA 1J5EQ 3ULLA 3CMQA 3REUA 1BBWA 1EVKA 3HOWG 4LFBL 5IT9c 2ZIOA 4DR3L 1ATIA 3HOVH 2R7FA 4DV7Q 3HOZH 4OLFA 5GROA 1HNXQ 2KENA 5FLMG 1IBMQ 3KOJA 3CF5A 5J3BA 2I5LX 1N34Q 1YFTA 2UUBL 4LF9L 3QO7A 4XTCS 3HRIA 4C3IH 1L1OA 4OO1G 2UUCQ 2B3GA 2RHSA 4RDXA 3NELA 3RNUA 3M7NA 4XEMA 4BXXG 2KCTA 2Y0SG 1YJNA 4X62L 3HFZB 3PUXA 2NVTH 4KR2A 2E64A 4YY3L 2QEXA 2K4KA 4BBSH 3KDFA 3VQVA 1VQJA 3A7UA 1N8RC 4X6AH 1UE6A 4CH3A 3E0EA 2JA8H 5K36G 4AQYQ 3CCMA 2UU9Q 3A0JA 1HNZL 1E1TA 3V8LA 3F1ZA 4DR6L 3TEHB 4B3MQ 4XTWA 3CQZH 4JBJA 1EQRA 4H02A 2I4OA 3V7RA 1IBLQ 4IPCA 1WCMH 3HKZG 2I5HA 3IALA 4YRFA 1L1OB 4X66Q 2L15A 3F2CA 4C3HH 1K8AC 4XU2A 4LF6Q 4KR3A 4TVAB 3G1ZA 1YIJA 2A19A 4BY7G 3NETA 3PSIA 2XGTA 1CSPA 3B6YA 1HNZQ 4LNQA 3NENA 3S1MH 4DUZL 3HXZA 3FP9A 2CGHA 4DR4L 3PF4A 1VQ5A 3STBD 3ERRA 2DZCA 4WJ4A 3HOXG 1TWGH 1LYLA 4X64Q 5IP7H 2E1HA 2JA7G 4GN4B 2ZM6L 3PO2G 2ZNIA 4LFAQ 4OP0A 4HJ9A 4FDBA 4GLVB 2HT1A 2C35B 1QVFA 1AH9A 1SMXA 2HHHQ 1PH1A 1YHAA 2F3IA 3RZDH 2EL9A 4YCWA 2KHJA 1UE1A 5IYCH 3GO5A 4DR1L 3BFMA 1E1OA 5K1XA 3UE0A 1Z7MA 3AYHB 3RLOA 4KHPQ 5IP9H 4X64L 3KDFB 2Q7GA 4BY1G 4JYAL 2B63G 2ZR2A 3A7AA 4DV3Q 4OO1I 5JJKA 2WP8J 4A4IA 4GKKQ 4H2WA 2CCZA 4YREA 5E7NA 4UP8A 4P75C 1E22A 4A3KG 4POFA 2ZJPA 1XTDA 3V8KA 3E9HA 2H5XA 4AH6A 3A5ZB 3RLFA 4JBWA 2ODRD 4JCVE 5HY6A 1PH2A 3IKMB 4YRTA 3CD6A 5IYBG 3U58A 1SE8A 4DNIA 3ICAA 1B76A 2UUBQ 1XPOA 3V7SA 1SETA 3CPWA 4LFCL 4OWXB 1B70A 4YRLA 2EXDA 4A3GH 4A75A 2N3SA 3S2DH 4YWKA 1MJEA 4X5OA 4HVCA 1Q46A 4LF8Q 3CCLA 4H2XA 4JI1L 4L5SA 1WOCA 4R1JA 4DV4L 3A74A 4YROA 3HRKA 4A3DH 4MZ9A 3CC4A 1YEZA 4A3BG 1X2GA 1EVLA 2VQEL 2E8GA 1I94L 3PUZA 4JC0A 2PMZE 2R7DA 5C44H 3PF5A 2ZGWA 4LFCQ 4KI0A 3G6EA 2DVEA 4DV6Q 1VQNA 3S15H 3S24A 3TREA 2AHOB 4P75A 2YTYA 3G4SA 4JI0Q 3KYHC 1K9MC 2MO0A 3GTOH 3VQWA 4JI7Q 1CSQA 4BBRH 5ELNA 4A3BH 4B3SQ 3GTMH 5C0XJ 1YFSA 2DTIA 1TWHH 1WYDA 4B3TL 4K87A 2D0PA 3L2PA 4P72C 3U4VA 4KHPL 1FVIA 3UE1A 1BKBA 4TQUS 2VQFL 3K7AH 4IPDA 4OX9L 1SRYA 1USYC 4A3LH 4X62Q 3MXNB 3CCRA 4P73A 3CC2A 3KF6A 4UP9A 4PHCA 2BA1A 2ASBA 4E51A 4EO4A 2QHSA 1YITA 5LMNW 1Y1VG 1WU7A 4OX9Q 3A7RA 4NXNL 1EWIA 1CUKA 1PH8A 1IBLL 4JI4Q 1WQWA 2DTOA 3STBC 3D0FA 1Z47A 2YTXA 1N33Q 1C9OA 1KOGA 3NEMA 4H2XB 1KL9A 2R6GA 3CMEA 1HZBA 4A76A 4WI1A 4YCUA 4DV2Q 2AKWA 2NVYH 3TEGA 4A3MH 3HOUH 2ARTA 2VNUD 5M3FG 2ZTDA 4BWAA 1H4TA 3PO2H 4CS3A 1X9NA 4JBKA 4PG3A 11ASA 5C51B 4GKJL 4C2MH 2NVXH 1OXSC 2ODRC 3BJUA 4DV4Q 3T1HQ 2IY5B 2NS6A 2P0LA 4LF5L 1E3PA 3G48A 1GGMA 2A8VA 1E24A 4UPAA 2VQFQ 3RGLA 3L7ZC 2YYZA 1NJ5A 1SROA 5FJ8G 4JI3L 3OTOL 5C3EH 3KJOA 3CW2C 4DR2L 3IG2A 4NXMQ 2B29A 4HWOA 4HWPA 4UY8C 2VS1A 3U4ZA 3J7A5 1C0AA 1VQ9A 1N32Q 4LF4Q 1XMQL 3PUVA 1XNRL 4LFBQ 1JJCB 4LWCA 3CPFA 4DV6L 5AJ3L 1X3GA 1ADYA 2E65A 1PH3A 4R4IA 1Y14B 5FJ8H 3RR5A 5IP7G 2JA7H 1B7YA 1O7IA 1M1KC 1B70B 1P8LA 3I4MG 5FLXc 3F2BA 1N33L 4LVJA 4K88A 2ATWA 2UXBQ 4YRCA 1VCIA 5GAEC 1K83H 1X55A 1HR0W 3PCOB 2GVBA 3LSQA 1VQ6A 4DV7L 4P3PA 4X65Q 4HJ5A 1RIQA 4YHHL 5IWAL 1VQ8A 1K0RA 2GN5A 1PH5A 5LMUL 1EIYA 4PMWA 3I4OA 2E2IH 4RG1A 2ZZFA 4ALPA 2VL6A 1V43A 3D31A 4A93G 2DTHA 1NTGA 4DV0L 1N9WA 1Z7NA 1IXRA 2JEBI 2YV5A 3TQYA 1HNXL 4DV1L 1YB3A 4CH4A 3JAMc 1G291 4YRRA 1W2BA 3J7ZC 2HIXA 3UDGA 3HOWH 2J3MA 4Q6GA 4A3FH 2E41A 4HIDA 2NVQH 3RIRA 2AKWB 4L87A 4HIKA 4LF6L 3GD7A 1HNWQ 5FLMH 1VQKA 2WB1E 3Q8DA 1XJVA 2BH8A 1VQ7A 3OD1A 2QA4A 1C7YA 2WB1G 5GAGC 3WQZA 4DR5Q 2UUAL 1J6QA 1HJPA 4X66L 4CH5A 1NYRA 1VQDA 2PMEA 5M5XH 3SGIA 2DDZA 2MFIA 2JA5G 1PHJA 3RLNA 4HJ7A 4AQYL 5E3IA 2LSSA 2CJ9A 2V1CC 4LF7L 4P74C 4DUYL 4JI4L 3VBBA 4DR7Q 3M4OH 4NB3A 4HIOA 1Y1WH 3P8VA 2ZT5A 1HH2P 2ZJQA 4XTVA 2K50A 2KHIA 3HXXA 3P8TA 1WCMG 4JI6Q 2Q2IA 3EFSA 3RACA 2NN6G 3VQXA 2DU5A 3UGQA 1EIFA 1X6OA 2PQAB 1ASZA 4YRPA 3J80i 1KRSA 3RN5A 1QUQB 4MNOA 2MNAA 2JEAI 2DGYA 1WI5A 4GN3B 4Y7NH 4BBRG 2XTIA 2PI2E 1YVCA 1D7QA 3RUXA 4OWWB 4GLXA 1HZCA 3HXVA 1G6PA 3VQYA 3UGTA 4TVAA 3U50C 1Y1WG 2UXDL 2ZT8A 3CP0A 1BVSA 2HIVA 1KMNA 3FJPA 4P3OA 2E5LQ 5JJIA 1BIAA 5GQOA 1MIUA 2CKZB 3OW2A 4B3RL 3A5ZA 2QGQA 4DUZQ 3MF1A 1QE0A 4OWTB 3TS0A 1N36L 1NE3A 4XU0A 1IL2A 3CCSA 2IX0A 1I94Q 3TRZA 3JAMi 3K8AA 4LFAL 1PYBA 2EJFA 2WAQE 4HJAA 1NJ8A 4LF9Q 1K73C 4IOAA 1FL0A 3PV0A 5IYCG 4EQ5A 2E5LL 4K0KL 1YJWA 3KF8B 3A31A 1XMOQ 5DLQE 2DJZA 1KHIA 1SFOH 4LVLA 1EIYB 4YRKA 4B3SL 2IHEA 2E2JH 1VQ4A 4YPFA 4TWAA 1HR0Q 3P8YA 1JJGA 1I6HH 3LSSA 3AFPA 2ES2A 1Q1BA 1J5EL 2NZHA 1L0WA 3HKSA 2DZ9A 4ZTUB 3HOXH 4APVA 3T1HL 1PV4A 1EOVA 4JV5L 1WPYA 2HQLA 3H3VI 5JJLA 4ME3A 4NCXA 2ZR3A 2AMCA 2OCEA 4YWMA 1VQEA 1A62A 3PO3G 1X65A 1SERA 5BR8Q 1A0IA 4DR7L 2EWNA 4DUYQ 3I2ZA 2NN6I 3T1YL 4QY7A 1USYA 3HY0A 3L1AA 3S1RH 4DAYB 4JI8L 2VY3A 5JEAG 3HOYH 5IY0A 4JI7L 1PH7A 1A63A 3DLLA 3UDFA 2IX1A 3WWVA 4A3DG 3REXA 4DV1Q 2DQ3A 2DXUA 1GD7A 1QVCA 1Q86C 3RKXA 1NYQA 1YNXA 3S17H 4XTZA 5M5WH 1KIXA 1X3EA 3I4MH 3NBHB 2AMCB 1EQQA 4A3EH 3PUYA 1XPRA 2E2HH 2F52A 3AEVA 3M85A 1S72A 1YFRA 3UH0A 1GKHA 1GVPA 4DV3L 5IYBH 2Q7EA 4P74A 4WJ3M 3H3VH 1FYFA 3FKIH 1L2FA 1AE2A 1G5IA 2BH2A 4NXML 2YTVA 3PIOA 4HIMA 2Q2UA 3H15A 1HXDA 3K80C 2ZTGA 2CWAA 1UEBA 1SR3A 4A3JG 3W5OA 3GDEA 4BA2I 4HWSA 1DGSA 2PNHA 4A93H 3IRBA 4Q15A 4L5TA 1X54A 1M90C 4AYBG 2ID0A 4GN5A 3L4GA 1VQBA 1NJIC 3MQZA 1KRTA 2R92H 3M9BA 1NJ2A 3FKIG 4DR6Q 4PZ8A 2ZINA 1XNQL 2ZT7A 3R07A 4DV5L 4GOPA 3RZOH 1WNLA 2RHSB 1HZ9A 3RL6A 3W1GA 1EUJA 3HXYA 3HTZA 4BA1I 3I7FA 3M4QA 1Q7YC 5C44G 4RMFA 4AYBE 1VQGA 1HR0L 3VDYA 4JI3Q 1QZGA 3AFQA 2G4CA 5F5WA 2P5IA 2N49A 3S14H 4XTUA 3H0GH 2JK8A 4G85A 1QVGA 4H2SA 1CKMA 1CKNB 4IPHA 1JJ2A 4Y52H 3W3SA 1A8VA 3AQQA 4GNXB 5C4XH 4HT4A 2RF4A 3CAMA 1EYGA 2K5HA 2E5AA 4IO9A 4IPGA 3HY1A 1PH9A 1SRUA 4JG2A 2ZM6Q 1YHBA 2E10A 1HTTA 4A3LG 4NXNQ 4JI8Q 2I5MX 2EQSA 2UXBL 4JI2L 1UE7A 4BBSG 3ERSX 3W1BA 1Q8KA 4TVWA 3S2HH 1S40A 4LUZA 4G84A 1WFQA 4YP0A 1I50H 2N8NA 1D8LA 4NPSA 1B8AA 3J81i 1YJ9A 1VQAA 1X3FA 2DKGA 1K8GA 3RF1A 2I4NA 1W66A 3PUWA 2PMFA 3K81C 5C4JH 1EFWA 5IE8A 3GTPH 5M3FH 4A3IG 1LUZA 4DAMA 1JMCA 1IZ6A 4QL5A 3HOVG 1LTLA 3PZCA 5HGQA 5LMNQ 1X01A 4HJ8A 3OTOQ 1XMQQ 4JBMA 3HOZG 2J3LA 4GOPC 1MJCA 2OWOA 2CWPA 1RL2A 4H2YA 1N36Q 3CCJA 1HC7A 4YRIA 5JEAJ 3J80c 1TXYA 4DQ2A 3ULPA 4A3IH 1KMMA 4R4CA 4DK3C 3HKZE 4LF5Q 1VQFA 2EJ9A 2PI2A 2VUMG 1NMFA 3MEYA 3DM3A 4GKJQ 4ZTZB 5LMUQ 3GTKH 4XTYA 4AIMA 5IYDH 2C8MA 4DK6C 3L2ZA 3HFZA 2GVAA 3KLWA 4YCVA 2RHQA 2FYKA 1CKNA 2C7IA 1JJCA 4JI2Q 3MF2A 4QIWE 4LVMA 1ASYA 1YBYA 3KFUA 3F8TA 4A3FG 2Q2HA 2ARSA 1QUQA 4LNSA 2F4VL 3RKWA 1GM5A 3QO5A 4IJHA 1P16A 3F2DA 4P71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH4 A;  3DSQ A;  4JV5 Q;  2DQ0 A;  2ZZG A;  1VQL A;  4RQF A;  1Q82 C;  1WQ7 A;  5GAD C;  2LXK A;  1YZ6 A;  2VUM H;  4RQE A;  4PZ6 A;  3GTG H;  4QGU A;  3RKY A;  3PO3 H;  5C52 B;  4QQB X;  4BY7 H;  4DKA C;  3I4N H;  1B7Y B;  2Q5I A;  1UE5 A;  1VQC A;  1VQI A;  3A5U A;  3TS2 A;  3HFV A;  3QO8 A;  1U0L A;  2IY5 A;  1Q12 A;  2KBN A;  2D0O A;  1PVO A;  3S1N H;  4QJF A;  1T9H A;  1YI2 A;  4TQF A;  1KC8 C;  4IOC A;  4CS4 A;  3GTL H;  2K52 A;  1QF6 A;  1JE5 A;  2EIF A;  3J81 c;  4LW1 A;  4R4O A;  3TUP A;  2ZIM A;  1VQM A;  1KQS A;  3EIV A;  4A3E G;  2I4L A;  3ER0 A;  3G71 A;  4KLK A;  2DEQ A;  1OTC A;  2OQK A;  2HNI A;  3TEH A;  1CKO A;  5C53 B;  3ULJ A;  4DV2 L;  2B63 H;  1XNR Q;  5AJ3 Q;  2RHQ B;  4O2D A;  2A1A A;  1GO3 E;  5EAY A;  4LF8 L;  1W3S A;  3KF6 B;  4OON A;  5GAH C;  2JA6 G;  1KXL A;  1SES A;  4JYA Q;  2K75 A;  4GNX C;  5KNN A;  2R7Z G;  4IFD I;  4IJL A;  4K0K Q;  1IYJ B;  4GNX A;  3PIP A;  3CCV A;  1UWV A;  2R92 G;  3L0O A;  2CIM A;  3LC0 A;  2ZJR A;  2JA5 H;  4HA8 A;  2ARU A;  1U5K A;  2N78 A;  1HZA A;  4PZ7 A;  4H2U A;  2JA6 H;  2R93 H;  1ADJ A;  1E7Z A;  5M5Y H;  1PYS B;  3E9I A;  4X65 L;  5C0X G;  3IKL A;  5C0X I;  1NMG A;  1G5H A;  1WJJ A;  1Q81 C;  2JJQ A;  4TTV A;  1TWA H;  4L5R C;  2I0Q A;  4LF7 Q;  4A3C G;  4YY3 Q;  3EBE A;  2Q2T A;  4YRG A;  3H0G G;  2DXT A;  4BXX H;  3CMA A;  4WF2 A;  3CCU A;  1H4S A;  1FJG Q;  4JI0 L;  2ZXF A;  3UDX A;  4O0A A;  5C4X G;  1KAW A;  3CCQ A;  1VQZ A;  5K1P A;  1Y1V H;  1PA6 A;  3EN2 A;  4LUO A;  3PGZ A;  4L5Q A;  2JA8 G;  4CH6 A;  1N34 L;  1J5W A;  5H1S E;  4A3M G;  3HOU G;  1IBM L;  1G51 A;  2IT1 A;  4TVY A;  1OXX K;  3JC6 6;  2UUC L;  2MO1 A;  2AWN A;  1L1O C;  2ZCE A;  2QHU A;  3K0X A;  2Q7H A;  1SN8 A;  2ZT6 A;  5M3M G;  4LUV A;  4P71 C;  5IYD G;  3HXU A;  4DV5 Q;  3UFG A;  4OXP A;  4A3C H;  1XNQ Q;  2ZNJ A;  2IHF A;  4MTN A;  4GLA C;  3RN2 A;  2E3C A;  4DR2 Q;  2DUD A;  1KD1 C;  1S3O A;  4TQD A;  1VQP A;  4B3T Q;  5C3E G;  4HWR A;  2Q5H A;  3EFR A;  2JE6 I;  4GS3 A;  1NJ6 A;  2ZTE A;  1IBK Q;  2UXC L;  3M3Y H;  5M3M H;  2Z6K C;  3K7U C;  4IFD G;  2ALY B;  4P73 C;  5ELO A;  1FGU A;  2NZO A;  1JT8 A;  4XU1 A;  1OXT A;  2HHH L;  1HNW L;  2CJA A;  1AE3 A;  1Q1E A;  2CFM A;  4HWT A;  4JI6 L;  4ZIB A;  1IBK L;  4YRN A;  1FJG L;  2YU9 H;  1R9T H;  3I4N G;  1H95 A;  3A5Y A;  4CS2 A;  4JI1 Q;  4LF4 L;  2AWO A;  4J15 A;  2D62 A;  4UP7 A;  2OTJ A;  4YYE A;  2EAY A;  1Z9F A;  4KQE A;  2Y0S E;  2I4M A;  2EJG A;  4XIG S;  3S16 H;  4R4T A;  3S1Q H;  2CQO A;  4JI5 L;  2ALY A;  4BY1 H;  2Z0S A;  4BW9 A;  2VW9 A;  3BZK A;  1YGB A;  2MQH A;  4JOI C;  3CCE A;  3QNE A;  1VQH A;  4XU3 A;  1LM0 A;  3HOY G;  2QHT A;  2OQ0 A;  2K14 A;  3V7C A;  4YDQ A;  2Z6K A;  1BIB A;  4YHH Q;  3CC7 A;  1PYS A;  1SLJ A;  4B3R Q;  4A3K H;  1MKH A;  1X2H A;  4GOP B;  3J81 j;  1JB7 A;  4XEO A;  3UDI A;  1PFS A;  12AS A;  1YHQ A;  1I3Q H;  4H2T A;  3T1Y Q;  4YRQ A;  2F4V Q;  4R4Q A;  2K5V A;  2K5N A;  3I56 A;  1NBW A;  3L4G B;  1X56 A;  1V9P A;  4YWL A;  1NY4 A;  3QTC A;  2R7Z H;  3BU2 A;  4GKK L;  2UUA Q;  4YRS A;  3FHW A;  2OTL A;  4A3G G;  3A32 A;  3I55 A;  1TWC H;  1H4Q A;  2JA9 A;  4DR1 Q;  3HXW A;  5IP9 G;  2PQA A;  1QZH A;  3ZJY C;  3BZC A;  1BBU A;  4YRJ A;  1WLE A;  1H4V B;  4JOI A;  4IFD J;  4P72 A;  4K86 A;  1N32 L;  4XTX A;  2R93 G;  4B3M L;  3GTJ H;  1OXU A;  4YRM A;  2RCN A;  2VZA A;  2WFW A;  2ZTC A;  1TWF H;  1OXV A;  4P3N A;  1VQO A;  4POG A;  2UU9 L;  4DR4 Q;  3GTQ H;  1K3R A;  4KHZ A;  4A3J H;  2KCM A;  4H2V A;  4C3J H;  1V1Q A;  5BR8 L;  1XMO L;  1PH6 A;  4DR3 Q;  4DV0 Q;  1NNH A;  2CJB A;  5LMN L;  3OYY A;  3M4P A;  3ICE A;  2UXC Q;  1VS0 A;  3PCO A;  2ZZE A;  2BA0 A;  3KJP A;  2LXJ A;  4DR5 L;  3V8J A;  2DU7 A;  1RIP A;  2FXQ A;  2JQO A;  2WAQ G;  4JI5 Q;  3MEF A;  5IWA Q;  3CXC A;  2UXD Q;  1NJ1 A;  2QHV A;  3LGJ A;  4EX5 A;  2VQE Q;  1I5F A;  1XPU A;  4DPG A;  1J5E Q;  3ULL A;  3CMQ A;  3REU A;  1BBW A;  1EVK A;  3HOW G;  4LFB L;  5IT9 c;  2ZIO A;  4DR3 L;  1ATI A;  3HOV H;  2R7F A;  4DV7 Q;  3HOZ H;  4OLF A;  5GRO A;  1HNX Q;  2KEN A;  5FLM G;  1IBM Q;  3KOJ A;  3CF5 A;  5J3B A;  2I5L X;  1N34 Q;  1YFT A;  2UUB L;  4LF9 L;  3QO7 A;  4XTC S;  3HRI A;  4C3I H;  1L1O A;  4OO1 G;  2UUC Q;  2B3G A;  2RHS A;  4RDX A;  3NEL A;  3RNU A;  3M7N A;  4XEM A;  4BXX G;  2KCT A;  2Y0S G;  1YJN A;  4X62 L;  3HFZ B;  3PUX A;  2NVT H;  4KR2 A;  2E64 A;  4YY3 L;  2QEX A;  2K4K A;  4BBS H;  3KDF A;  3VQV A;  1VQJ A;  3A7U A;  1N8R C;  4X6A H;  1UE6 A;  4CH3 A;  3E0E A;  2JA8 H;  5K36 G;  4AQY Q;  3CCM A;  2UU9 Q;  3A0J A;  1HNZ L;  1E1T A;  3V8L A;  3F1Z A;  4DR6 L;  3TEH B;  4B3M Q;  4XTW A;  3CQZ H;  4JBJ A;  1EQR A;  4H02 A;  2I4O A;  3V7R A;  1IBL Q;  4IPC A;  1WCM H;  3HKZ G;  2I5H A;  3IAL A;  4YRF A;  1L1O B;  4X66 Q;  2L15 A;  3F2C A;  4C3H H;  1K8A C;  4XU2 A;  4LF6 Q;  4KR3 A;  4TVA B;  3G1Z A;  1YIJ A;  2A19 A;  4BY7 G;  3NET A;  3PSI A;  2XGT A;  1CSP A;  3B6Y A;  1HNZ Q;  4LNQ A;  3NEN A;  3S1M H;  4DUZ L;  3HXZ A;  3FP9 A;  2CGH A;  4DR4 L;  3PF4 A;  1VQ5 A;  3STB D;  3ERR A;  2DZC A;  4WJ4 A;  3HOX G;  1TWG H;  1LYL A;  4X64 Q;  5IP7 H;  2E1H A;  2JA7 G;  4GN4 B;  2ZM6 L;  3PO2 G;  2ZNI A;  4LFA Q;  4OP0 A;  4HJ9 A;  4FDB A;  4GLV B;  2HT1 A;  2C35 B;  1QVF A;  1AH9 A;  1SMX A;  2HHH Q;  1PH1 A;  1YHA A;  2F3I A;  3RZD H;  2EL9 A;  4YCW A;  2KHJ A;  1UE1 A;  5IYC H;  3GO5 A;  4DR1 L;  3BFM A;  1E1O A;  5K1X A;  3UE0 A;  1Z7M A;  3AYH B;  3RLO A;  4KHP Q;  5IP9 H;  4X64 L;  3KDF B;  2Q7G A;  4BY1 G;  4JYA L;  2B63 G;  2ZR2 A;  3A7A A;  4DV3 Q;  4OO1 I;  5JJK A;  2WP8 J;  4A4I A;  4GKK Q;  4H2W A;  2CCZ A;  4YRE A;  5E7N A;  4UP8 A;  4P75 C;  1E22 A;  4A3K G;  4POF A;  2ZJP A;  1XTD A;  3V8K A;  3E9H A;  2H5X A;  4AH6 A;  3A5Z B;  3RLF A;  4JBW A;  2ODR D;  4JCV E;  5HY6 A;  1PH2 A;  3IKM B;  4YRT A;  3CD6 A;  5IYB G;  3U58 A;  1SE8 A;  4DNI A;  3ICA A;  1B76 A;  2UUB Q;  1XPO A;  3V7S A;  1SET A;  3CPW A;  4LFC L;  4OWX B;  1B70 A;  4YRL A;  2EXD A;  4A3G H;  4A75 A;  2N3S A;  3S2D H;  4YWK A;  1MJE A;  4X5O A;  4HVC A;  1Q46 A;  4LF8 Q;  3CCL A;  4H2X A;  4JI1 L;  4L5S A;  1WOC A;  4R1J A;  4DV4 L;  3A74 A;  4YRO A;  3HRK A;  4A3D H;  4MZ9 A;  3CC4 A;  1YEZ A;  4A3B G;  1X2G A;  1EVL A;  2VQE L;  2E8G A;  1I94 L;  3PUZ A;  4JC0 A;  2PMZ E;  2R7D A;  5C44 H;  3PF5 A;  2ZGW A;  4LFC Q;  4KI0 A;  3G6E A;  2DVE A;  4DV6 Q;  1VQN A;  3S15 H;  3S24 A;  3TRE A;  2AHO B;  4P75 A;  2YTY A;  3G4S A;  4JI0 Q;  3KYH C;  1K9M C;  2MO0 A;  3GTO H;  3VQW A;  4JI7 Q;  1CSQ A;  4BBR H;  5ELN A;  4A3B H;  4B3S Q;  3GTM H;  5C0X J;  1YFS A;  2DTI A;  1TWH H;  1WYD A;  4B3T L;  4K87 A;  2D0P A;  3L2P A;  4P72 C;  3U4V A;  4KHP L;  1FVI A;  3UE1 A;  1BKB A;  4TQU S;  2VQF L;  3K7A H;  4IPD A;  4OX9 L;  1SRY A;  1USY C;  4A3L H;  4X62 Q;  3MXN B;  3CCR A;  4P73 A;  3CC2 A;  3KF6 A;  4UP9 A;  4PHC A;  2BA1 A;  2ASB A;  4E51 A;  4EO4 A;  2QHS A;  1YIT A;  5LMN W;  1Y1V G;  1WU7 A;  4OX9 Q;  3A7R A;  4NXN L;  1EWI A;  1CUK A;  1PH8 A;  1IBL L;  4JI4 Q;  1WQW A;  2DTO A;  3STB C;  3D0F A;  1Z47 A;  2YTX A;  1N33 Q;  1C9O A;  1KOG A;  3NEM A;  4H2X B;  1KL9 A;  2R6G A;  3CME A;  1HZB A;  4A76 A;  4WI1 A;  4YCU A;  4DV2 Q;  2AKW A;  2NVY H;  3TEG A;  4A3M H;  3HOU H;  2ART A;  2VNU D;  5M3F G;  2ZTD A;  4BWA A;  1H4T A;  3PO2 H;  4CS3 A;  1X9N A;  4JBK A;  4PG3 A;  11AS A;  5C51 B;  4GKJ L;  4C2M H;  2NVX H;  1OXS C;  2ODR C;  3BJU A;  4DV4 Q;  3T1H Q;  2IY5 B;  2P0L A;  4LF5 L;  1E3P A;  3G48 A;  1GGM A;  2A8V A;  1E24 A;  4UPA A;  2VQF Q;  3RGL A;  3L7Z C;  2YYZ A;  1NJ5 A;  1SRO A;  5FJ8 G;  4JI3 L;  3OTO L;  5C3E H;  3KJO A;  3CW2 C;  4DR2 L;  3IG2 A;  4NXM Q;  2B29 A;  4HWO A;  4HWP A;  4UY8 C;  2VS1 A;  3U4Z A;  3J7A 5;  1C0A A;  1VQ9 A;  1N32 Q;  4LF4 Q;  1XMQ L;  3PUV A;  1XNR L;  4LFB Q;  1JJC B;  4LWC A;  3CPF A;  4DV6 L;  5AJ3 L;  1X3G A;  1ADY A;  2E65 A;  1PH3 A;  4R4I A;  1Y14 B;  5FJ8 H;  3RR5 A;  5IP7 G;  2JA7 H;  1B7Y A;  1O7I A;  1M1K C;  1B70 B;  1P8L A;  3I4M G;  5FLX c;  3F2B A;  1N33 L;  4K88 A;  2ATW A;  2UXB Q;  4YRC A;  1VCI A;  5GAE C;  1K83 H;  1X55 A;  1HR0 W;  3PCO B;  2GVB A;  3LSQ A;  1VQ6 A;  4DV7 L;  4P3P A;  4X65 Q;  4HJ5 A;  1RIQ A;  4YHH L;  5IWA L;  1VQ8 A;  1K0R A;  2GN5 A;  1PH5 A;  5LMU L;  1EIY A;  4PMW A;  3I4O A;  2E2I H;  4RG1 A;  2ZZF A;  4ALP A;  2VL6 A;  1V43 A;  3D31 A;  4A93 G;  2DTH A;  1NTG A;  4DV0 L;  1N9W A;  1Z7N A;  1IXR A;  2JEB I;  2YV5 A;  3TQY A;  1HNX L;  4DV1 L;  1YB3 A;  4CH4 A;  3JAM c;  1G29 1;  4YRR A;  1W2B A;  3J7Z C;  2HIX A;  3UDG A;  3HOW H;  2J3M A;  4Q6G A;  4A3F H;  2E41 A;  4HID A;  2NVQ H;  3RIR A;  2AKW B;  4L87 A;  4HIK A;  4LF6 L;  3GD7 A;  1HNW Q;  5FLM H;  1VQK A;  2WB1 E;  3Q8D A;  1XJV A;  2BH8 A;  1VQ7 A;  3OD1 A;  2QA4 A;  1C7Y A;  2WB1 G;  5GAG C;  3WQZ A;  4DR5 Q;  2UUA L;  1J6Q A;  1HJP A;  4X66 L;  4CH5 A;  1NYR A;  1VQD A;  2PME A;  5M5X H;  3SGI A;  2DDZ A;  2MFI A;  2JA5 G;  1PHJ A;  3RLN A;  4HJ7 A;  4AQY L;  5E3I A;  2LSS A;  2CJ9 A;  2V1C C;  4LF7 L;  4P74 C;  4DUY L;  4JI4 L;  3VBB A;  4DR7 Q;  3M4O H;  4NB3 A;  4HIO A;  1Y1W H;  3P8V A;  2ZT5 A;  1HH2 P;  2ZJQ A;  4XTV A;  2K50 A;  2KHI A;  3HXX A;  3P8T A;  1WCM G;  4JI6 Q;  2Q2I A;  3EFS A;  3RAC A;  2NN6 G;  3VQX A;  2DU5 A;  3UGQ A;  1EIF A;  1X6O A;  2PQA B;  1ASZ A;  4YRP A;  3J80 i;  1KRS A;  3RN5 A;  1QUQ B;  4MNO A;  2MNA A;  2JEA I;  2DGY A;  1WI5 A;  4GN3 B;  4Y7N H;  4BBR G;  2XTI A;  2PI2 E;  1YVC A;  1D7Q A;  3RUX A;  4OWW B;  4GLX A;  1HZC A;  3HXV A;  1G6P A;  3VQY A;  3UGT A;  4TVA A;  3U50 C;  1Y1W G;  2UXD L;  2ZT8 A;  3CP0 A;  1BVS A;  2HIV A;  1KMN A;  3FJP A;  4P3O A;  2E5L Q;  5JJI A;  1BIA A;  5GQO A;  1MIU A;  2CKZ B;  3OW2 A;  4B3R L;  3A5Z A;  2QGQ A;  4DUZ Q;  3MF1 A;  1QE0 A;  4OWT B;  3TS0 A;  1N36 L;  1NE3 A;  4XU0 A;  1IL2 A;  3CCS A;  2IX0 A;  1I94 Q;  3TRZ A;  3JAM i;  3K8A A;  4LFA L;  1PYB A;  2EJF A;  2WAQ E;  4HJA A;  1NJ8 A;  4LF9 Q;  1K73 C;  4IOA A;  1FL0 A;  3PV0 A;  5IYC G;  4EQ5 A;  2E5L L;  4K0K L;  1YJW A;  3KF8 B;  3A31 A;  1XMO Q;  5DLQ E;  2DJZ A;  1KHI A;  1SFO H;  1EIY B;  4YRK A;  4B3S L;  2IHE A;  2E2J H;  1VQ4 A;  4YPF A;  4TWA A;  1HR0 Q;  3P8Y A;  1JJG A;  1I6H H;  3LSS A;  3AFP A;  2ES2 A;  1Q1B A;  1J5E L;  2NZH A;  1L0W A;  3HKS A;  2DZ9 A;  4ZTU B;  3HOX H;  4APV A;  3T1H L;  1PV4 A;  1EOV A;  4JV5 L;  1WPY A;  2HQL A;  3H3V I;  5JJL A;  4ME3 A;  4NCX A;  2ZR3 A;  2AMC A;  2OCE A;  4YWM A;  1VQE A;  1A62 A;  3PO3 G;  1X65 A;  1SER A;  5BR8 Q;  1A0I A;  4DR7 L;  2EWN A;  4DUY Q;  3I2Z A;  2NN6 I;  3T1Y L;  4QY7 A;  1USY A;  3HY0 A;  3L1A A;  3S1R H;  4DAY B;  4JI8 L;  2VY3 A;  5JEA G;  3HOY H;  5IY0 A;  4JI7 L;  1PH7 A;  1A63 A;  3DLL A;  3UDF A;  2IX1 A;  3WWV A;  4A3D G;  3REX A;  4DV1 Q;  2DQ3 A;  2DXU A;  1GD7 A;  1QVC A;  1Q86 C;  3RKX A;  1NYQ A;  1YNX A;  3S17 H;  4XTZ A;  5M5W H;  1KIX A;  1X3E A;  3I4M H;  3NBH B;  2AMC B;  1EQQ A;  4A3E H;  3PUY A;  1XPR A;  2E2H H;  2F52 A;  3AEV A;  3M85 A;  1S72 A;  1YFR A;  3UH0 A;  1GKH A;  1GVP A;  4DV3 L;  5IYB H;  2Q7E A;  4P74 A;  4WJ3 M;  3H3V H;  1FYF A;  3FKI H;  1L2F A;  1AE2 A;  1G5I A;  2BH2 A;  4NXM L;  2YTV A;  3PIO A;  4HIM A;  2Q2U A;  3H15 A;  1HXD A;  3K80 C;  2ZTG A;  2CWA A;  1UEB A;  1SR3 A;  4A3J G;  3W5O A;  3GDE A;  4BA2 I;  4HWS A;  1DGS A;  2PNH A;  4A93 H;  3IRB A;  4Q15 A;  4L5T A;  1X54 A;  1M90 C;  4AYB G;  2ID0 A;  4GN5 A;  3L4G A;  1VQB A;  1NJI C;  1KRT A;  2R92 H;  3M9B A;  1NJ2 A;  3FKI G;  4DR6 Q;  4PZ8 A;  2ZIN A;  1XNQ L;  2ZT7 A;  3R07 A;  4DV5 L;  4GOP A;  3RZO H;  1WNL A;  2RHS B;  1HZ9 A;  3RL6 A;  3W1G A;  1EUJ A;  3HXY A;  3HTZ A;  4BA1 I;  3I7F A;  3M4Q A;  1Q7Y C;  5C44 G;  4RMF A;  4AYB E;  1VQG A;  1HR0 L;  3VDY A;  4JI3 Q;  1QZG A;  3AFQ A;  2G4C A;  5F5W A;  2P5I A;  2N49 A;  3S14 H;  4XTU A;  3H0G H;  2JK8 A;  4G85 A;  1QVG A;  4H2S A;  1CKM A;  1CKN B;  4IPH A;  1JJ2 A;  4Y52 H;  3W3S A;  1A8V A;  3AQQ A;  4GNX B;  5C4X H;  2RF4 A;  3CAM A;  1EYG A;  2K5H A;  2E5A A;  4IO9 A;  4IPG A;  3HY1 A;  1PH9 A;  1SRU A;  4JG2 A;  2ZM6 Q;  1YHB A;  2E10 A;  1HTT A;  4A3L G;  4NXN Q;  4JI8 Q;  2I5M X;  2EQS A;  2UXB L;  4JI2 L;  1UE7 A;  4BBS G;  3ERS X;  3W1B A;  1Q8K A;  4TVW A;  3S2H H;  1S40 A;  4LUZ A;  4G84 A;  1WFQ A;  4YP0 A;  1I50 H;  2N8N A;  1D8L A;  4NPS A;  1B8A A;  3J81 i;  1YJ9 A;  1VQA A;  1X3F A;  2DKG A;  1K8G A;  3RF1 A;  2I4N A;  1W66 A;  3PUW A;  2PMF A;  3K81 C;  5C4J H;  1EFW A;  5IE8 A;  3GTP H;  5M3F H;  4A3I G;  1LUZ A;  4DAM A;  1JMC A;  1IZ6 A;  4QL5 A;  3HOV G;  1LTL A;  3PZC A;  5HGQ A;  5LMN Q;  1X01 A;  4HJ8 A;  3OTO Q;  1XMQ Q;  4JBM A;  3HOZ G;  2J3L A;  4GOP C;  1MJC A;  2OWO A;  2CWP A;  1RL2 A;  4H2Y A;  1N36 Q;  3CCJ A;  1HC7 A;  4YRI A;  5JEA J;  3J80 c;  1TXY A;  4DQ2 A;  3ULP A;  4A3I H;  1KMM A;  4R4C A;  4DK3 C;  3HKZ E;  4LF5 Q;  1VQF A;  2EJ9 A;  2PI2 A;  2VUM G;  1NMF A;  3MEY A;  3DM3 A;  4GKJ Q;  4ZTZ B;  5LMU Q;  3GTK H;  4XTY A;  4AIM A;  5IYD H;  2C8M A;  4DK6 C;  3L2Z A;  3HFZ A;  2GVA A;  3KLW A;  4YCV A;  2RHQ A;  2FYK A;  1CKN A;  2C7I A;  1JJC A;  4JI2 Q;  3MF2 A;  4QIW E;  1ASY A;  1YBY A;  3KFU A;  3F8T A;  4A3F G;  2Q2H A;  2ARS A;  1QUQ A;  4LNS A;  2F4V L;  3RKW A;  1GM5 A;  3QO5 A;  4IJH A;  1P16 A;  3F2D A;  4P71 A; 
#chains in the Genus database with same CATH topology
 1PH4 A;  3DSQ A;  2DY8 A;  2ENB A;  4HCS A;  4JV5 Q;  2DQ0 A;  2ZZG A;  5C4H A;  1VQL A;  4RQF A;  4KJN A;  1Q82 C;  3EQL C;  2VB2 X;  1WQ7 A;  2M2L A;  3DWA A;  5GAD C;  2LXK A;  1A6X A;  1YZ6 A;  2VUM H;  4RQE A;  4PZ6 A;  4LK1 C;  3GTG H;  4IZ8 A;  4QGU A;  3RKY A;  1SSO A;  3PO3 H;  5C52 B;  4QQB X;  3MFG A;  1CK1 A;  3WOE A;  4BY7 H;  3SK4 A;  4DKA C;  3I4N H;  1B7Y B;  2Q5I A;  2B2U C;  1UE5 A;  1VQC A;  1VQI A;  3A5U A;  4QUC A;  5BN5 A;  3TS2 A;  3HFV A;  4KKU A;  3QO8 A;  2OT2 A;  2AQ1 B;  1U0L A;  2IY5 A;  3OSO A;  1GHJ A;  1PZI D;  1Q12 A;  2KBN A;  3H09 A;  3SDZ A;  1B4O A;  2D0O A;  1PVO A;  3S1N H;  1I3Q B;  4QJF A;  1T9H A;  1YI2 A;  3NTH A;  4TQF A;  1DOM A;  1KC8 C;  4IOC A;  4CS4 A;  1BOS A;  3BYT B;  3KLS A;  3GTL H;  4X3K A;  3J80 E;  2K52 A;  2BE5 C;  2F0K A;  1QF6 A;  5FO7 B;  3IL8 A;  3DM1 A;  1JE5 A;  1F9Q A;  3ITP A;  5C3X A;  2EIF A;  3J81 c;  1FNW A;  1T5X D;  4LW1 A;  5EKI A;  1FD7 D;  4R4O A;  3TUP A;  2ZIM A;  1PYW D;  1VQM A;  1KQS A;  4BWG B;  1I4G A;  3EIV A;  4A3B B;  3E0J A;  4A3E G;  4NP5 A;  4BBR B;  5KIX A;  3M4O B;  1S5C D;  4I7A A;  2A6H C;  1CHQ D;  5J39 A;  1BF4 A;  2I4L A;  3ER0 A;  1WTV A;  4EQN A;  1BCP B;  3G71 A;  1HCZ A;  3CU7 A;  4NKL A;  1KDA A;  1TY0 A;  1FNU A;  4KLK A;  2DEQ A;  1OTC A;  2OQK A;  2HNI A;  3D8G A;  5COR A;  4CKE A;  5EPK A;  3TZU A;  3TEH A;  1CKO A;  5C53 B;  3ULJ A;  4ZUI A;  2B2V A;  4X3T A;  1RTN A;  4DV2 L;  2B63 H;  1CI3 M;  1XNR Q;  2EPB A;  5AJ3 Q;  2RHQ B;  4O2D A;  1RCV D;  3K6O A;  2A1A A;  1G91 A;  1GO3 E;  1NUC A;  3D4D A;  5EAY A;  2RVL A;  4N8X 1;  4LF8 L;  1W3S A;  4E6I A;  3KF6 B;  4OON A;  5GAH C;  2JA6 G;  1KXL A;  1SES A;  2NVQ B;  4JYA Q;  2K75 A;  2F3W A;  4GNX C;  2ZXP A;  1PRT D;  1CZG A;  3FDT A;  4M1U B;  4FF1 A;  5KNN A;  1XXG A;  4DNR B;  2R7Z G;  2LMC B;  4IJL A;  4IFD I;  4K0K Q;  5ISR A;  1B2T A;  1O7Z A;  1IYJ B;  4ZK9 B;  1AFP A;  2B39 A;  4GNX A;  4ZRZ A;  3PIP A;  3K57 A;  2K05 A;  3TN2 A;  3CCV A;  4LVK A;  1Y1V B;  1UWV A;  2R92 G;  3L0O A;  2L1B A;  1EY9 A;  1B50 A;  1QB5 D;  2CIM A;  1E2W A;  4DK0 A;  2EJF C;  3LC0 A;  2ZJR A;  1I4X A;  2IX3 A;  2JA5 H;  4HA8 A;  2CH4 W;  2ARU A;  1F77 A;  2K7V A;  1PDQ A;  4CDE C;  1U5K A;  2EY1 A;  2N78 A;  2OF1 A;  1HZA A;  1BDO A;  1M8A A;  4PZ7 A;  4C3I G;  4H2U A;  2JA6 H;  2R93 H;  4F8M A;  1ADJ A;  3NUC A;  1E7Z A;  4U67 3;  1D1I A;  1ZEQ X;  2NVY B;  4EQO A;  5M5Y H;  2F0Q A;  3GP7 A;  1SYE A;  1PYS B;  2F0E A;  3TP6 A;  3ERO A;  3E9I A;  3T13 A;  4X65 L;  1TS3 A;  5C0X G;  3IKL A;  5C0X I;  1NMG A;  1G5H A;  1WJJ A;  1E2V A;  1Q81 C;  5I9O A;  2JJQ A;  4TTV A;  1MSG A;  1TWA H;  4L5R C;  2I0Q A;  4LF7 Q;  4A3C G;  1STB A;  4YY3 Q;  3EBE A;  4H44 C;  1HQR D;  3H0G G;  2Q2T A;  2PYK A;  2DXT A;  4YRG A;  1ZKO A;  1TR5 A;  3VYR A;  4BXX H;  1LLR D;  3KBX A;  3AMU A;  4LMQ D;  1H9S B;  2R61 A;  3CMA A;  4WF2 A;  3CCU A;  1H4S A;  1FJG Q;  4JI0 L;  2ZXF A;  3UDX A;  4O0A A;  3K59 A;  5C4X G;  3HS0 C;  2C9O A;  1KAW A;  3CCQ A;  1ILQ A;  2R3Z A;  1VQZ A;  5K1P A;  4C56 C;  1Y1V H;  4UHV A;  3EN2 A;  5T1I A;  1PA6 A;  2I46 A;  4K5V A;  4LUO A;  3PGZ A;  2EY5 A;  4L5Q A;  3DWQ A;  2JA8 G;  5K36 H;  1Y1W B;  4CH6 A;  3GQB A;  3I3C A;  1WTP A;  2EOT A;  1N34 L;  1J5W A;  5H1S E;  1WVL A;  1STE A;  5CBE E;  4HMI A;  3X3M A;  4DXF A;  4A3M G;  3HOU G;  5E4W C;  1IBM L;  2EZV A;  1G51 A;  2PZW A;  2IT1 A;  2Q8R E;  3MEH A;  4TVY A;  3GTM B;  1OXX K;  3JC6 6;  2B8F A;  2UUC L;  2MO1 A;  1YNN C;  3WOF A;  2AWN A;  1D1K A;  1L1O C;  5CYU A;  2ZCE A;  2QHU A;  3K0X A;  2Q7H A;  1SN8 A;  4BY7 B;  2ZT6 A;  5M3M G;  1G2S A;  4CDD C;  1NR4 A;  4LUV A;  4HSV A;  1T5E A;  4K2L A;  1LTT D;  2BCO A;  4P71 C;  5IYD G;  3HXU A;  3S9W A;  4DV5 Q;  3UFG A;  1B9M A;  4OXP A;  4A3C H;  1XNQ Q;  3Q23 A;  2ZNJ A;  1TWA B;  1F9R A;  2IHF A;  3Q0A A;  4MTN A;  1IW7 C;  4GLA C;  3RN2 A;  2E3C A;  4DR2 Q;  2DUD A;  1KD1 C;  1S3O A;  4TQD A;  3A8J E;  1VQP A;  1TWG B;  1CA5 A;  4RGM A;  4B3T Q;  5C3E G;  4HWR A;  2MPM A;  1DON A;  1DYQ A;  3BVM A;  4ODG A;  2PPB C;  1HUM A;  2Q5H A;  3EFR A;  1SNM A;  2JE6 I;  4GS3 A;  1NJ6 A;  2F0M A;  2F0W A;  2ZTE A;  1IBK Q;  1HA5 A;  2F4I A;  2F0D A;  2UXC L;  2XVS A;  5IGF A;  3M3Y H;  5M3M H;  1LTI D;  2NWG A;  2Z6K C;  3K7U C;  5EGT A;  4IFD G;  2WKD A;  2ALY B;  2M9V A;  2ICI A;  4P73 C;  1ML0 D;  4KY5 A;  5ELO A;  1FGU A;  2NZO A;  4C3J B;  1JT8 A;  4XU1 A;  1OXT A;  4RH6 A;  2HHH L;  1HNW L;  2CJA A;  1QJO A;  1AE3 A;  2MUY A;  2Z1C A;  1VMC A;  4XT1 B;  1Q1E A;  2CFM A;  4HWT A;  4JI6 L;  4ZIB A;  4BS9 A;  3AU7 A;  5JJZ A;  1IBK L;  4YRN A;  1KDC A;  1FJG L;  2YU9 H;  1R9T H;  4FO2 A;  3I4N G;  2XN9 C;  1H95 A;  3A5Y A;  4CS2 A;  2AUK A;  4JI1 Q;  1E2Z A;  4LF4 L;  1SNP A;  2AWO A;  4J15 A;  2D62 A;  4UP7 A;  3S2D B;  2OTJ A;  4YYE A;  2EAY A;  1CT1 D;  3MXP A;  1Z9F A;  4KQE A;  3Q22 A;  1EYC A;  1B9N A;  5C5M A;  2Y0S E;  3IFD A;  2B63 B;  2EJG A;  2I4M A;  3M7G A;  5M5W B;  1QCB D;  4XIG S;  2MJ8 A;  5C4Z A;  1K8M A;  3S16 H;  4R4T A;  2EVB A;  3DEO A;  3S1Q H;  2CQO A;  4JI5 L;  5CV6 A;  1B3Q A;  2ALY A;  4BY1 H;  2A6E D;  2Z0S A;  4BW9 A;  5FOB B;  2VW9 A;  3I8Z A;  2IJ0 A;  3BZK A;  3KF8 A;  5L37 A;  4DAY A;  1YGB A;  3WDN A;  5CV4 A;  3KLS X;  2MQH A;  3NTI A;  4JOI C;  3CCE A;  3H6M A;  1VQH A;  2K28 A;  3QNE A;  4XU3 A;  3VYU A;  1LM0 A;  4IFD H;  4OL7 A;  5F2D A;  3HOY G;  2SOB A;  2QHT A;  2OQ0 A;  2K14 A;  3V7C A;  4YDQ A;  2Z6K A;  2VB3 X;  3SR1 A;  2DJG C;  3T56 B;  1BIB A;  4YHH Q;  3RD4 A;  5I9P A;  2G9D A;  3CC7 A;  1PYS A;  2SEB D;  1SLJ A;  1AN8 A;  4B3R Q;  3TBI B;  4A3K H;  1MKH A;  1X2H A;  4FP5 D;  4GOP B;  3J81 j;  4ZLT F;  4ZQ3 A;  4ZUJ A;  4JPB W;  1JB7 A;  2RDG A;  3SE0 A;  2JA7 B;  2Q8T A;  1QNU A;  1ZXT A;  4XEO A;  5KRU A;  3UDI A;  1PFS A;  12AS A;  5IIF A;  1YHQ A;  1I3Q H;  1F9P A;  1Y8N B;  4H2T A;  1PFB A;  3OW7 A;  3T1Y Q;  2X6G A;  4YRQ A;  2F4V Q;  1TS4 A;  3J7A V;  4PQX A;  2K5V A;  4R4Q A;  2PMZ B;  3GV6 A;  2F0G A;  3HEJ A;  2K5N A;  2K5D A;  3I56 A;  1NBW A;  3L4G B;  1X56 A;  1V9P A;  4YWL A;  1NY4 A;  1HFN A;  1Y8O B;  4XQQ A;  1A15 A;  3QTC A;  3PMF A;  1Z7T A;  2R7Z H;  3BU2 A;  4GKK L;  2UUA Q;  4YRS A;  3FHW A;  4V0B A;  2OTL A;  4A3G G;  3A32 A;  3I55 A;  5EKL A;  4ZYS A;  1TWC H;  1EQT A;  4ULL A;  1H4Q A;  2JA9 A;  4DR1 Q;  3HXW A;  3R2I A;  5IP9 G;  3DEP A;  1Q8I A;  2PQA A;  3MXU A;  1QZH A;  4G57 A;  2K03 A;  3ZJY C;  2BDN A;  2PZU A;  1I6H B;  3BZC A;  3HKZ B;  3FMC A;  3JAM L;  1BBU A;  5KNB A;  4YRJ A;  4R8N A;  1WLE A;  3TDQ A;  4JOI A;  1H4V B;  1G2T A;  2R93 B;  4IFD J;  4P72 A;  1H9K A;  3FVQ A;  4K86 A;  1GUO A;  1N32 L;  4XTX A;  5E4X A;  2R93 G;  4B3M L;  3GTJ H;  1PTO B;  1OXU A;  4RWS C;  5EKK A;  1MSH A;  4ZKC B;  4YRM A;  1AZP A;  1UEA B;  2F0F A;  2RCN A;  2VZA A;  4OGQ C;  2WFW A;  2ZTC A;  1JOQ A;  4L63 B;  3FPP A;  1TWF H;  1ONL A;  1OXV A;  3P1H A;  4P3N A;  1I4R A;  1VQO A;  4POG A;  1ESR A;  2GA4 B;  1Q3L A;  1ZYR C;  4B9W A;  2UU9 L;  1GHK A;  4DR4 Q;  4QIW B;  3GTQ H;  1K3R A;  4KHZ A;  4A3J H;  2KCM A;  1LT6 D;  2FMC A;  4H2V A;  1EOT A;  4C3J H;  1V1Q A;  5BR8 L;  4O42 A;  1XMO L;  1PH6 A;  3MHB A;  4DR3 Q;  4DV0 Q;  1O80 A;  4CJ0 B;  5KYI A;  2HCI A;  1NNH A;  2CJB A;  4J6H A;  3OYY A;  3M4P A;  5LMN L;  3ICE A;  3K58 A;  1VS0 A;  2UXC Q;  3OHX C;  3PCO A;  2ZZE A;  2BA0 A;  3KJP A;  2LXJ A;  2Y0S B;  4DR5 L;  3V8J A;  2DU7 A;  1VF7 A;  1RIP A;  2PQE A;  4C3H B;  5IGE A;  1PZK D;  3D3R A;  4YIJ A;  1JWS D;  5EPL A;  2O5J C;  2A8E A;  1PRT F;  2KCC A;  2FXQ A;  4DAP A;  2JQO A;  2WAQ G;  4Z9C B;  3VA5 A;  3MEF A;  5IWA Q;  3CXC A;  4JI5 Q;  1LT5 D;  2UXD Q;  1NJ1 A;  2QHV A;  3LGJ A;  4EX5 A;  4LVI A;  3T53 B;  2VQE Q;  1DCZ A;  1I5F A;  1XPU A;  5CR3 A;  1EZ8 A;  3H3V C;  2B2T C;  1LTA D;  2EYO A;  4DPG A;  1J5E Q;  3ULL A;  3CMQ A;  3REU A;  2QW7 A;  1BBW A;  1EEI D;  1EVK A;  3HOW G;  4K6D A;  2E2I B;  4LFB L;  5IT9 c;  4IUP A;  1JIC A;  2ZIO A;  4DR3 L;  1ATI A;  3HOV H;  2R7F A;  1HTP A;  5CMD A;  1A3U A;  5DAU A;  3RMH A;  3QG1 A;  1K0S A;  2KED A;  3K5L A;  4DV7 Q;  4K8I A;  3HOZ H;  4OLF A;  2K5W A;  5GRO A;  1HNX Q;  2KEN A;  5FLM G;  5M3F B;  3OWE B;  3KOJ A;  1IBM Q;  4IUU A;  3LWE A;  3CF5 A;  3P75 A;  4RCN A;  5J3B A;  2RKS A;  2I5L X;  4CGY B;  1N34 Q;  1YFT A;  2UUB L;  4LF9 L;  3QO7 A;  2K1B A;  3H94 A;  2L12 A;  4XTC S;  3HRI A;  4C3I H;  3IAY A;  1L1O A;  2WIN B;  2CW0 D;  1KTK A;  4OO1 G;  2UUC Q;  2B3G A;  2NUC A;  2MHV A;  1D5M C;  2RA4 A;  2RHS A;  4RDX A;  1V1P B;  5J22 A;  3NEL A;  3RNU A;  2QCP X;  3M7N A;  4XEM A;  4BXX G;  2EYJ A;  2KCT A;  2F1M A;  1EFI D;  2Y0S G;  1YJN A;  4X62 L;  3HFZ B;  2NBF A;  3PUX A;  3S2H B;  2NVT H;  1QG7 A;  1TT2 A;  4KR2 A;  5D14 A;  4PNY A;  5KGU A;  2E64 A;  5D65 A;  3EVQ A;  4YY3 L;  2QEX A;  2K4K A;  4FVM A;  4BBS H;  3KDF A;  4DGZ A;  4A3K B;  3VQV A;  1VQJ A;  3A7U A;  2B2Y C;  1G6Z A;  1N8R C;  4X6A H;  1UE6 A;  5G3L D;  3E0E A;  4CH3 A;  2JA8 H;  5K36 G;  2RCF A;  4AQY Q;  3CCM A;  2UU9 Q;  3A0J A;  1HNZ L;  1E1T A;  1GUS A;  3V8L A;  3VR6 A;  3V2T A;  2L9H A;  5IOC A;  3F1Z A;  4DR6 L;  1AP0 A;  4C1N K;  3SVM A;  3QR8 A;  4QCL A;  3TEH B;  4BY1 B;  4B3M Q;  4XTW A;  3CQZ H;  4DF7 A;  4JBJ A;  1WTH A;  2E2J B;  5IGG A;  1EQR A;  4H02 A;  2KUM A;  2I4O A;  3V7R A;  1IBL Q;  1CFM A;  1WCM H;  2TMP A;  4IPC A;  2O2L D;  3I72 A;  3HKZ G;  4DK1 A;  5CBA E;  2I5H A;  1CQV A;  2Q8I B;  4RAU C;  3IAL A;  4YRF A;  1L1O B;  4X66 Q;  1KLU D;  5EPJ A;  3S1R B;  2L15 A;  4XDX A;  2A69 D;  5IOD A;  4KKT A;  3F2C A;  4C3H H;  1IYU A;  1K8A C;  4XU2 A;  4LF6 Q;  4KR3 A;  2B2W C;  5IGC A;  4MIU A;  4TVA B;  4IQZ A;  4A3G B;  3DWP A;  4OHJ A;  2KHS A;  3G1Z A;  1YIJ A;  4QB4 A;  2XIW A;  1D2B A;  2A19 A;  4JK1 C;  4BY7 G;  3NET A;  3PSI A;  4DXG A;  2XGT A;  1CSP A;  3B6Y A;  3I70 A;  1HNZ Q;  3BG3 A;  1PTO H;  4LNQ A;  1GUW A;  3NEN A;  3S1M H;  1FYC A;  4DUZ L;  3HXZ A;  3FP9 A;  1R4P B;  2CGH A;  4DR4 L;  3PF4 A;  1VQ5 A;  3STB D;  2DNE A;  3MZ5 A;  3DHQ A;  3ERR A;  3QOL A;  2K32 A;  2DZC A;  4WJ4 A;  3HOX G;  1TWG H;  4FXD A;  2KVM A;  3RZO B;  4M8A A;  3NXW A;  1LYL A;  4ME5 A;  4X64 Q;  5IP7 H;  5M9O A;  2E1H A;  4RKB A;  2JA7 G;  4GN4 B;  4XT3 B;  2ZM6 L;  3PO2 G;  3SK5 A;  2ZNI A;  3BDC A;  3OMC A;  4LFA Q;  1BR9 A;  1ENA A;  5JAV A;  4OP0 A;  5FKA C;  3C3L A;  4RCO A;  1U4P A;  2B2T A;  2WAC A;  3ONA B;  4HJ9 A;  4FDB A;  4GLV B;  2WII B;  2HT1 A;  1LT3 D;  1RD9 D;  5E3F A;  1O7Y A;  2KEC A;  2X6L A;  2C35 B;  3URY A;  2EYL A;  4RHS A;  1QVF A;  3HOY B;  1AH9 A;  1SMX A;  2ZT9 C;  1YNJ C;  1GOZ A;  4O1N A;  2HHH Q;  1CHP D;  1PH1 A;  1PZJ D;  1YHA A;  2F3I A;  4CJ2 C;  3RZD H;  2EL9 A;  4YCW A;  2SNS A;  3NQI A;  1LTB D;  1K83 B;  2KHJ A;  1UE1 A;  3TZD A;  4ZKB B;  5IYC H;  3GO5 A;  4DR1 L;  3BFM A;  1E1O A;  5K1X A;  3UE0 A;  1Z7M A;  3AYH B;  3NWS A;  3RLO A;  4KHP Q;  5IP9 H;  4X64 L;  5J1Z A;  1TQO A;  3KDF B;  2Q7G A;  3Q6S A;  4BY1 G;  2B63 G;  4JYA L;  1F2Y A;  2ZR2 A;  3A7A A;  4DV3 Q;  4OO1 I;  1LT4 D;  2RSO A;  2WP8 J;  5JJK A;  1BBX C;  1HPC A;  3O13 A;  1SYC A;  4A4I A;  4GKK Q;  4C3I B;  4H2W A;  1STN A;  3DMU A;  1B44 D;  4DAV A;  4K14 A;  2CCZ A;  4YRE A;  2HQE A;  1EYA A;  3I4N B;  5E7N A;  3A56 A;  4QUF A;  1LAB A;  1STG A;  4H13 C;  4N9P A;  4UP8 A;  4P75 C;  3HP3 A;  2QDB A;  4UAI A;  1E22 A;  3TP7 A;  4I65 A;  1PTO C;  3K5N A;  4A3K G;  4Q0F A;  4POF A;  4J8Q A;  2ZJP A;  1XTD A;  3V8K A;  1TII D;  3VA7 A;  3CKI B;  1WTO A;  3E9H A;  4OEL B;  2H5X A;  3S17 B;  4AH6 A;  2WV6 D;  3A5Z B;  4C3J G;  3RLF A;  4R9W A;  4JBW A;  1A2U A;  2ODR D;  2ZXO A;  1I4H A;  4JCV E;  1MHW C;  5HY6 A;  2A69 C;  3NBH A;  1SDF A;  1PH2 A;  3IKM B;  2Z9H A;  4YRT A;  1U4M A;  4ZAI A;  3CD6 A;  1WTQ A;  1ET6 A;  3ZYY X;  2EYH A;  5IYB G;  3HRZ C;  3U58 A;  4HED A;  1SE8 A;  2KEE A;  4EQP A;  4DNI A;  2F03 A;  1JB3 A;  3ICA A;  1B76 A;  2RBM A;  4IUN A;  2UUB Q;  1XPO A;  4Y7N B;  3V7S A;  1SET A;  1VDZ A;  1C48 A;  3NQT A;  3CPW A;  3LNN A;  5C3E B;  4LFC L;  5M5Y B;  1NR2 A;  5I6W A;  1DOL A;  4ID6 A;  4OWX B;  1B70 A;  4RGT A;  4YRL A;  3W2D A;  2EXD A;  1Y69 U;  4A3G H;  4A75 A;  2N3S A;  3S2D H;  4YWK A;  1QIL A;  1MJE A;  4X5O A;  1KAB A;  4HVC A;  1Q46 A;  4LF8 Q;  4QMG A;  5IT9 E;  4I7Z C;  3CCL A;  2XWJ B;  4JI1 L;  4H2X A;  4L5S A;  1WOC A;  5C5L A;  5BN3 A;  5M3M B;  4R1J A;  3C1E A;  2NVX B;  1SYG A;  4OEM B;  1RJT A;  3A74 A;  4DV4 L;  1II3 A;  4K5W A;  4YRO A;  3HRK A;  4A3D H;  4MZ9 A;  4CKB A;  3CC4 A;  1YEZ A;  4A3B G;  1X2G A;  4XXE A;  1EVL A;  2VQE L;  2E8G A;  3BS1 A;  3PO2 B;  5ELF A;  1I94 L;  2PW5 A;  3PUZ A;  2E76 C;  2K5Q A;  4JC0 A;  2PMZ E;  2WAQ B;  2R7D A;  4A3M B;  5C44 H;  5ELD A;  3HOU B;  4F88 A;  3PF5 A;  3HOX B;  2ZGW A;  4LFC Q;  2B2W A;  3A7A B;  4KI0 A;  1DJR D;  3G6E A;  2DVE A;  5EQ0 A;  3KUP A;  4DV6 Q;  2JA8 B;  5I2X A;  3K0Y A;  2A5H A;  1VQN A;  3DUZ A;  1PLF A;  5FLX E;  2NN6 H;  3S15 H;  1JOR A;  1YNN D;  4KKS A;  3S24 A;  1BXT A;  1EY5 A;  3TRE A;  2AHO B;  4P75 A;  2YTY A;  2Z4I A;  3NSW A;  2O5I C;  3G4S A;  4JI0 Q;  2NVT B;  3TP5 A;  3KYH C;  3X3N A;  1K9M C;  2PNR C;  2MO0 A;  1KNE A;  1ICW A;  3GTO H;  3VQW A;  4JI7 Q;  1CSQ A;  4BBR H;  3C1F A;  5ELN A;  5IGD A;  3D4W A;  3NTK A;  4A3B H;  1XWE A;  2EJG C;  2RSN A;  4B3S Q;  3GTM H;  5C0X J;  4JW0 A;  1YFS A;  1TWH H;  2DTI A;  1WYD A;  1CTM A;  4IUR A;  5ELC A;  4B3T L;  2A73 B;  4K87 A;  2EE1 A;  5C6A A;  1X3P A;  2D0P A;  3MXN A;  3L2P A;  4P72 C;  3U4V A;  3I90 A;  4KHP L;  2J4X A;  1FVI A;  3UE1 A;  1TS2 A;  1PTO D;  3NPP A;  1BKB A;  2B2Y A;  4TQU S;  4WOR A;  2VQF L;  3K7A H;  4IPD A;  4OX9 L;  1SRY A;  1USY C;  1UNS A;  4A3L H;  1BNZ A;  4X62 Q;  1QE6 A;  5D3D A;  3D6W A;  4KN7 C;  3MXN B;  3CCR A;  3MAQ A;  2D2C C;  4P73 A;  4XYQ A;  1JC7 A;  4ZCK A;  3GTL B;  2IPK D;  1SBB B;  3CC2 A;  3KF6 A;  2F0S A;  4UP9 A;  3S1N B;  5COY A;  2L5T A;  4PHC A;  2BA1 A;  2ASB A;  3P7J A;  4E51 A;  4EO4 A;  2QHS A;  1EWC A;  3SEB A;  1TWH B;  3NBI A;  3NHH A;  1MD2 D;  5TSS A;  1YIT A;  2VXW A;  5LMN W;  1Y1V G;  1WU7 A;  3J81 L;  1HUN A;  4OX9 Q;  3A7R A;  4NXN L;  1EWI A;  1CUK A;  1CQF A;  1PH8 A;  1IBL L;  1JWM D;  4JI4 Q;  3S16 B;  1WQW A;  2JYO A;  2DTO A;  4MTK A;  1Z47 A;  3D0F A;  2YTX A;  3STB C;  1N33 Q;  5DM6 3;  1C9O A;  2ZXR A;  3IKJ A;  5ELB A;  4N9T A;  1KOG A;  1EEF D;  1U4L A;  3NEM A;  2XRS D;  3QWN A;  2JA6 B;  4G7Z C;  3M4Y A;  4H2X B;  1KL9 A;  1BO0 A;  2R6G A;  3CME A;  2EJM A;  1BQQ T;  1HZB A;  2N88 A;  4A76 A;  3S1Q B;  3BVZ A;  4WI1 A;  1K3B C;  4YCU A;  4DV2 Q;  1R9T B;  3MVV A;  4TKO B;  2NVY H;  2AKW A;  3TEG A;  3D6C A;  4A3M H;  3HOU H;  2ART A;  3RUZ A;  2SDF A;  1EY8 A;  2VNU D;  5M3F G;  2D9U A;  2H4O A;  2ZTD A;  4BWA A;  3OWF A;  1H4T A;  2AQ2 B;  3PO2 H;  4CS3 A;  1X9N A;  2B2V C;  2DY7 A;  4JBK A;  3T16 A;  3GTQ B;  3L9A X;  4PG3 A;  2QKI C;  2F0I A;  11AS A;  2F0H A;  5C51 B;  1EIG A;  1C8C A;  4K8J A;  4K5X A;  4C2M H;  2NVX H;  4GKJ L;  1OXS C;  2EYF A;  2ODR C;  3BJU A;  4DV4 Q;  1H9M A;  4NDX A;  1EZ6 A;  3R8B A;  3T1H Q;  5DNF A;  1KAA A;  2IY5 B;  2NS6 A;  3HOW B;  2P0L A;  4LF5 L;  4UDU C;  1E3P A;  1U9R A;  3G48 A;  1GGM A;  2E74 C;  2A8V A;  4CDF C;  1E24 A;  4UPA A;  4H7B A;  2VQF Q;  2M00 A;  3RGL A;  1WD0 A;  1SE4 A;  1ET9 A;  3L7Z C;  2YYZ A;  2JSO A;  5JVG 3;  1NJ5 A;  1SRO A;  5FJ8 G;  4JI3 L;  3OTO L;  2IW3 A;  5C3E H;  3J7A F;  2AUJ D;  3KJO A;  3CW2 C;  4DR2 L;  3IG2 A;  4NXM Q;  3CRL C;  2B29 A;  4HWO A;  3GTJ B;  1PRT C;  5ELE A;  4HWP A;  4UY8 C;  4C3H G;  2VS1 A;  3CRK C;  3U4Z A;  4RHR A;  2MGS A;  3J7A 5;  1C0A A;  1TWC B;  1VQ9 A;  3MTS A;  5DEH A;  4LF4 Q;  1N32 Q;  2IWH A;  3JAM E;  3C2P A;  1C4Q A;  4DNT B;  1XMQ L;  3PUV A;  3F2U A;  1I4P A;  1XNR L;  4LFB Q;  1HA6 A;  1JJC B;  1XYI A;  1CM9 A;  4LWC A;  4XQN A;  3CPF A;  1JE4 A;  4HCE A;  5CGK A;  3J81 E;  1LTR D;  4WRD A;  4DV6 L;  5AJ3 L;  2RDF A;  1X3G A;  1ADY A;  2E65 A;  4F87 A;  3NK9 A;  4J1M A;  1EL0 A;  1SNC A;  3OPO A;  2CVR A;  1LO5 D;  1PH3 A;  4R4I A;  1Y14 B;  5FJ8 H;  2SNM A;  5JPM C;  1YNJ D;  1RDP D;  3RR5 A;  1RTO A;  5IP7 G;  2X69 A;  4OIJ A;  2JA7 H;  1B7Y A;  4TRD A;  1O7I A;  1WD1 A;  1PFM A;  1M1K C;  2DN8 A;  1B70 B;  1P8L A;  2FHT A;  3I4M G;  1HQM C;  5FLX c;  2CH4 A;  3F2B A;  4U68 A;  3GV3 A;  1N33 L;  4LVJ A;  5KEE A;  1CA6 A;  1B1Z A;  2ATW A;  4K88 A;  2UXB Q;  4A3F B;  4HMJ A;  4C2M B;  4FXK C;  2E2H B;  2EYM A;  4HSP A;  5C3W A;  4YRC A;  1VCI A;  4R8I A;  5GAE C;  1NNX A;  4IN3 A;  1K83 H;  1X55 A;  1O78 A;  1HR0 W;  3PCO B;  1DXM A;  1HFG A;  2GVB A;  1TU2 B;  3LSQ A;  1I50 B;  1VQ6 A;  4DV7 L;  4P3P A;  4X65 Q;  4HJ5 A;  1RIQ A;  4FXG C;  4YHH L;  5IWA L;  1VQ8 A;  1K0R A;  4MN3 A;  3G6J B;  2GN5 A;  1PH5 A;  5LMU L;  1LTG D;  1EIY A;  4PMW A;  3I4O A;  3VR3 A;  2E2I H;  4K6L A;  4RG1 A;  2ZZF A;  4HTH A;  2G9H D;  2VUM B;  4ALP A;  1W6K A;  2VL6 A;  2MP1 A;  1X32 A;  1ILP A;  1V43 A;  4L6T B;  1JWU D;  3MC0 B;  3D31 A;  4X3S A;  1S5B D;  4A93 G;  5LL6 S;  1NTG A;  2DTH A;  1MGS A;  3QIA A;  4DV0 L;  1N9W A;  1Z7N A;  1KDB A;  1VMP A;  1QWY A;  1IXR A;  2JEB I;  2YV5 A;  3TQY A;  1HNX L;  4DV1 L;  1YB3 A;  2G5D A;  4CH4 A;  3JAM c;  1G29 1;  4YRR A;  1W2B A;  5C4X B;  3ND8 A;  1BUV T;  5JEA H;  3J7Z C;  2HD3 A;  2HIX A;  4AYB B;  3UDG A;  1ZYR D;  3HOW H;  2J3M A;  1SEB D;  4A3F H;  2E41 A;  4Q6G A;  1PXU A;  4HID A;  3M3Y B;  3H0G B;  2NVQ H;  2PW7 A;  3RIR A;  1XX8 A;  2Z6B A;  2AKW B;  3J7Y W;  4PMB A;  4A3J B;  4L87 A;  1EU3 A;  1DM0 B;  4HIK A;  4LF6 L;  3GD7 A;  4A3I B;  1HNW Q;  1SNO A;  1JOO A;  1EU4 A;  5FLM H;  1VQK A;  2D5D A;  1V1P A;  4KHV A;  2WB1 E;  3Q8D A;  2HDM A;  1XJV A;  2BH8 A;  1BCP F;  1EY6 A;  2XSC A;  1EWH A;  2CW0 C;  1VQ7 A;  3LX0 A;  3OD1 A;  1H9R A;  1F2Z A;  2QA4 A;  1C7Y A;  2WB1 G;  5GAG C;  3WQZ A;  4DR5 Q;  2UUA L;  4OO1 H;  1J6Q A;  1HJP A;  4X66 L;  3GTO B;  4CH5 A;  1NYR A;  1VQD A;  2PME A;  5I6Y A;  3FEW X;  5M5X H;  1STY A;  3SGI A;  2L11 A;  2DDZ A;  2MFI A;  2JA5 G;  3SHL A;  1WTW A;  1PHJ A;  3RLN A;  4HJ7 A;  4AQY L;  4KTA A;  5E3I A;  3S15 B;  2LSS A;  1GUG A;  5JOB A;  2CJ9 A;  1X3Q A;  4BBS B;  2V1C C;  4LF7 L;  1ICF B;  4P74 C;  1QNK A;  2KA7 A;  2R7Z B;  4DUY L;  4JI4 L;  1SXT A;  2BE5 D;  4KD4 A;  4DR7 Q;  1TS5 A;  3M4O H;  2A68 D;  3VBB A;  4NB3 A;  4HIO A;  3A8I E;  4XYO A;  1Y1W H;  3P8V A;  2ZT5 A;  1SYF A;  1F2L A;  1HH2 P;  2ZJQ A;  4XTV A;  3OIQ A;  4EGV A;  4CJ1 B;  2J0T D;  1SJE D;  4CKC A;  2K50 A;  3N52 A;  2LFN A;  4LAA A;  2KHI A;  3HXX A;  5C4J B;  1D5X C;  3P8T A;  4NW2 A;  1WCM G;  3K7A B;  4JI6 Q;  3TME A;  2Q2I A;  3KK7 A;  1L0Y B;  2JXM B;  1EYD A;  1PTO F;  3TSS A;  4B08 A;  3EFS A;  3RAC A;  1NSN S;  2NN6 G;  3VQX A;  2DU5 A;  3UGQ A;  1EIF A;  4FF4 A;  3FPU B;  1X6O A;  2PQA B;  1ASZ A;  1HHV A;  4YRP A;  3QOJ A;  3J80 i;  1V8Q A;  1KRS A;  3RN5 A;  1QUQ B;  1S4Z A;  4MNO A;  1B3A A;  2MNA A;  2JEA I;  2DGY A;  1WI5 A;  4GN3 B;  4Y7N H;  3H91 A;  4BBR G;  2XTI A;  3ERQ A;  3PO3 B;  2PI2 E;  1YVC A;  1D7Q A;  3RUX A;  4OWW B;  4GLX A;  1Z6H A;  1HTL D;  1HZC A;  1SAP A;  3OIP A;  3HXV A;  1G6P A;  3VQY A;  1IKM A;  3UGT A;  4LJZ C;  4TVA A;  1J9O A;  3NE5 B;  3CHB D;  3U50 C;  1Y1W G;  2UXD L;  5T1G A;  2F0T A;  3CP0 A;  2ZT8 A;  1BVS A;  2HIV A;  1KMN A;  3FJP A;  4DA2 A;  1DOK A;  1SND A;  4P3O A;  2E5L Q;  5JJI A;  1BIA A;  2B2U A;  5GQO A;  3TP8 A;  1MIU A;  4KY6 A;  1TKW B;  2CKZ B;  3OW2 A;  4B3R L;  3HG9 A;  2XNA C;  3A5Z A;  2QGQ A;  4DUZ Q;  3MF1 A;  1KNA A;  3BVG A;  1QE0 A;  1H9J A;  1EY4 A;  1K28 A;  3HZX A;  4OWT B;  3TS0 A;  1L0X B;  1N36 L;  1JCK B;  2WKC A;  1NE3 A;  4XU0 A;  1IL2 A;  3CCS A;  2IX0 A;  1I94 Q;  3TRZ A;  2KOL A;  3MA2 B;  3JAM i;  3K8A A;  4LFA L;  1PYB A;  1VF5 C;  2EJF A;  2WAQ E;  2B8G A;  4HJA A;  5EBD A;  1NJ8 A;  4LF9 Q;  5FO8 B;  1K73 C;  2HDL A;  4IOA A;  1RHP A;  4G7O C;  2HUG A;  1FL0 A;  3PV0 A;  5IYC G;  5LHY 1;  5C0X H;  4EQ5 A;  2E5L L;  4K0K L;  1YJW A;  3KF8 B;  1B53 A;  3A31 A;  1Y8P B;  1XMO Q;  2IL8 A;  5DLQ E;  2DJZ A;  1KHI A;  1SFO H;  2FIN B;  3A7L A;  1EIY B;  4LVL A;  4YRK A;  5A2Q L;  5CV7 A;  3RZD B;  4B3S L;  2IHE A;  2E2J H;  1R4Q B;  1VQ4 A;  4YPF A;  3HGB A;  5KNC A;  1QOH A;  1IL8 A;  4KD3 A;  1STA A;  4G4K A;  4TWA A;  1HR0 Q;  2JP1 A;  3P8Y A;  5CC4 A;  2OEO A;  3L3O C;  1I6H H;  1JJG A;  3LSS A;  2L0C A;  5M5X B;  3OOC A;  3AFP A;  4FF2 A;  2ES2 A;  1Q1B A;  4K2K A;  3R93 A;  1J5E L;  1F9S A;  2R92 B;  1WTX A;  3NWT A;  4RGN A;  2NZH A;  1L0W A;  5LL6 X;  1H9S A;  2A6H D;  2F0L A;  3HKS A;  4V19 0;  2DZ9 A;  5FK9 C;  1EY0 A;  4ZTU B;  1GUN A;  3HOX H;  4KMU C;  4X3U A;  5CV5 A;  4APV A;  3T1H L;  1PV4 A;  4B9X A;  1EOV A;  4JV5 L;  1O7L A;  2Z8L A;  1WPY A;  2HQL A;  1LAC A;  3H3V I;  5JJL A;  3A55 A;  2XRQ D;  4ME3 A;  1GJX A;  4NCX A;  4A3D B;  2ZR3 A;  2KCN A;  2AMC A;  2OCE A;  3KBG A;  4YWM A;  2DNC A;  4QF4 A;  4ILW A;  1TVX A;  2K6A A;  1GXD C;  1A62 A;  1VQE A;  3VR5 A;  1X65 A;  5FO9 B;  3PO3 G;  1SMY D;  3G7L A;  4DFA A;  1SER A;  1E0B A;  1EIH A;  5BR8 Q;  1A0I A;  2HCC A;  4DR7 L;  1XTC D;  2EWN A;  4DUY Q;  1ENC A;  3I2Z A;  3KLR A;  3MXG A;  2NN6 I;  1JR0 D;  2F0O A;  4P2C B;  3T1Y L;  4QY7 A;  1USY A;  3HY0 A;  3L1A A;  2QF7 A;  3S1R H;  1S5F D;  3I73 A;  4DAY B;  3HOZ B;  2PCF B;  4JI8 L;  5NUC A;  2VY3 A;  5KYL A;  5JEA G;  1KLG D;  3HOY H;  5IY0 A;  4JI7 L;  2K04 A;  5A2Q E;  2BDO A;  1PH7 A;  4A3E B;  1A63 A;  3DLL A;  3SXH A;  3UDF A;  2IX1 A;  3T51 B;  4PV1 C;  2NTT A;  3CQZ B;  5HUR A;  5HGT A;  3WWV A;  1Q90 A;  4A3D G;  1NCV A;  3REX A;  4DV1 Q;  1GUT A;  2DQ3 A;  2DXU A;  1GD7 A;  1QVC A;  1Q86 C;  3RKX A;  1NYQ A;  3QB3 A;  2JN4 A;  2EYP A;  1YNX A;  3S17 H;  1WTR A;  4XTZ A;  2O4X A;  5M5W H;  1KIX A;  1X3E A;  3I4M H;  3NBH B;  1J8I A;  2RQX A;  1D5Z C;  3I4L A;  1SNQ A;  2AMC B;  3R3O A;  1EQQ A;  4A3E H;  3PUY A;  1XPR A;  2E2H H;  1SE3 A;  2PZT A;  2YU9 B;  2F52 A;  3AEV A;  5BN4 A;  3GTK B;  3V96 A;  3E6Z X;  3M85 A;  1S72 A;  1YFR A;  3UH0 A;  1ESF A;  1GKH A;  1GVP A;  5E1F A;  4DV3 L;  2E2D C;  5IYB H;  2Q7E A;  4S3S A;  4HN7 A;  2WB1 B;  4P74 A;  4WJ3 M;  2A68 C;  3H3V H;  1FYF A;  1W6J A;  3FKI H;  1L2F A;  1AE2 A;  1G5I A;  3LWU A;  2BH2 A;  4NXM L;  2YTV A;  1FGB D;  2LS0 1;  3PIO A;  4HIM A;  2Q2U A;  3H15 A;  1HXD A;  2L4N A;  3K80 C;  1MBY A;  1PFN A;  2FJ2 A;  2ZTG A;  5KND A;  2RDH A;  4EVO A;  1F2M A;  2CWA A;  2A6E C;  1UEB A;  1SR3 A;  4A3J G;  3W5O A;  4FF3 A;  3GDE A;  2ICE C;  4BA2 I;  4HWS A;  1DGS A;  2PNH A;  4A93 H;  3IRB A;  4Q15 A;  3C46 A;  1IYV A;  4L5T A;  2KQ3 A;  3I91 A;  1X54 A;  4Q5V A;  1OO9 B;  1M90 C;  4OIK A;  1HRJ A;  4KJO A;  4AYB G;  2ID0 A;  1RKN A;  4GN5 A;  3L4G A;  1HXY D;  5G3L F;  1VQB A;  1NJI C;  3MQZ A;  1KRT A;  2R92 H;  2OXP A;  3M9B A;  3MFY A;  1NJ2 A;  3FKI G;  3U9O A;  4DR6 Q;  4PZ8 A;  3GTP B;  2ZIN A;  1XNQ L;  3Q24 A;  2ZT7 A;  3R07 A;  4DV5 L;  4GOP A;  3RZO H;  1WNL A;  2NTS A;  2RHS B;  1HZ9 A;  5C44 B;  3BDL A;  4A93 B;  3RL6 A;  4WFN 3;  3EFX D;  3K5M A;  4G7H C;  3W1G A;  1EUJ A;  3HXY A;  3HTZ A;  1BCP C;  4CHT B;  4BA1 I;  3I7F A;  3M4Q A;  4C1N I;  2LY7 A;  2C5C A;  2FFK B;  1Q7Y C;  2Z4H A;  5C44 G;  3SK6 A;  4RMF A;  4AYB E;  4H0L C;  1VQG A;  1HR0 L;  3VDY A;  2CHB D;  4JI3 Q;  1QZG A;  3AFQ A;  3VR2 A;  2G4C A;  1UAP A;  3FKI B;  2N55 A;  1AZQ A;  3SK8 A;  4PMC A;  2K33 A;  1LV9 A;  1SJH D;  5F5W A;  2XWB B;  2P5I A;  2N49 A;  3AB9 A;  5A35 A;  2J7Z A;  3S14 H;  4XTU A;  4IUQ A;  3H0G H;  2JK8 A;  4G85 A;  1QVG A;  4WJW A;  4H2S A;  1CKM A;  1K8O A;  1CKN B;  4IPH A;  1JJ2 A;  1WCM B;  4Y52 H;  3VYT A;  3W3S A;  3HOV B;  1ENF A;  5CV8 A;  4GZY C;  4KV6 A;  1A8V A;  5CV9 A;  3AQQ A;  4GNX B;  5C4X H;  3E3X A;  4RGO S;  4HT4 A;  2RF4 A;  3CAM A;  3GTG B;  1FNV A;  1EYG A;  2K5H A;  3D4R A;  2E5A A;  2V4D A;  2QDL A;  3T4A C;  5IT9 L;  4IO9 A;  3I4M B;  1FR3 A;  2L55 A;  4RA8 A;  4IPG A;  3HY1 A;  4MHE A;  3E5S A;  1PH9 A;  2EY6 A;  1SRU A;  3W3A A;  4JG2 A;  3A8K E;  2ZM6 Q;  2F0N A;  5D3I B;  2K01 A;  1YHB A;  1S5E D;  3R2T A;  2E10 A;  1HTT A;  4KK7 A;  4A3L G;  4NXN Q;  1TY2 A;  4JI8 Q;  2I5M X;  2EQS A;  2H1E A;  5DM7 3;  2UXB L;  2F0J A;  4JI2 L;  4ABN A;  1UE7 A;  4TSS A;  4BBS G;  3ERS X;  3UI2 A;  2AQ3 B;  1A3T A;  3W1B A;  1Q8K A;  4TVW A;  1EY7 A;  3S2H H;  1S40 A;  1EQV A;  4LUZ A;  4DU9 A;  2JA5 B;  2A74 C;  4G84 A;  1I4Q A;  5EJW A;  1WFQ A;  2FMM A;  1PRT B;  4YP0 A;  1I50 H;  2N8N A;  3S14 B;  1D8L A;  3BYY B;  4NPS A;  1B8A A;  4FYD A;  3J81 i;  2F0P A;  1YJ9 A;  2I07 B;  1VQA A;  4CBV A;  2EY2 A;  5K5P A;  3V05 A;  2F0U A;  1X3F A;  2DKG A;  5I4D A;  4IUT A;  1K8G A;  1PMR A;  3RF1 A;  2I4N A;  1TWF B;  1A2T A;  3BZD B;  1U4R A;  3K81 C;  3PUW A;  5C4J H;  1W66 A;  2PMF A;  1EFW A;  4N8F A;  1JOK A;  4RFB A;  5IE8 A;  1D6E C;  1SMY C;  2TSS A;  5I2Y A;  3GTP H;  5JPN C;  5M3F H;  3PIO 3;  4CDC C;  4A3I G;  1UUP A;  5IGB A;  1LUZ A;  1DZ1 A;  4DAM A;  2EDG A;  1JMC A;  2QEJ C;  1IZ6 A;  1I6V C;  2P5Z X;  3EJI A;  4QL5 A;  3HOV G;  1LTL A;  3PZC A;  4JVZ A;  5HGQ A;  2NZ1 D;  2NYZ D;  5LMN Q;  1X01 A;  1IW7 D;  1SYD A;  3P20 A;  4HJ8 A;  3PQI A;  3OTO Q;  1XMQ Q;  4JBM A;  3HOZ G;  1M4V A;  3DXJ C;  5JVH 3;  2J3L A;  3FRP B;  4GOP C;  2BOS A;  1CZW A;  1MJC A;  2OWO A;  4RKL A;  2KJX A;  1SE2 A;  4DN4 M;  3N6R A;  2CWP A;  1LTS D;  1RL2 A;  2F0V A;  1G8Z D;  1SFO B;  4H2Y A;  4HAE A;  1N36 Q;  3CCJ A;  1HC7 A;  4YRI A;  5JEA J;  3J80 c;  1TXY A;  4DQ2 A;  3ULP A;  4A3I H;  2CQA A;  1IKL A;  1KMM A;  2EXZ A;  4R4C A;  4DK3 C;  3MWY W;  3EA6 A;  3HKZ E;  4L8J A;  1AW7 A;  3QO2 A;  3S1M B;  4LF5 Q;  1VQF A;  2EJ9 A;  2PI2 A;  1S5D D;  1A3V A;  3ND9 A;  2VUM G;  1NMF A;  2QIL A;  1IHZ A;  4F7X A;  3K5O A;  3MEY A;  3A54 A;  3DM3 A;  4XQJ A;  4GKJ Q;  4ZTZ B;  4FNF A;  1STH A;  4IAL A;  5LMU Q;  3OMG A;  1AEX A;  3GTK H;  1SYB A;  3PIP 3;  4XTY A;  4AIM A;  5IYD H;  2C8M A;  4DK6 C;  3U9S A;  3IFT A;  5AFW A;  3L2Z A;  3HFZ A;  3J80 L;  2GVA A;  3KLW A;  4YCV A;  1RF2 D;  2RHQ A;  2FYK A;  1CKN A;  2C7I A;  3VR4 A;  1ROD A;  1JJC A;  4JI2 Q;  3MF2 A;  4QIW E;  4LVM A;  3QJY A;  2F3V A;  1YBY A;  1ASY A;  3KFU A;  1DD2 A;  3NP8 A;  5FLX L;  2PO4 A;  4IUV A;  1V1O A;  4KY7 A;  3F8T A;  3VYS A;  4A3F G;  2Q2H A;  4HR7 B;  2ARS A;  1MI2 A;  2DJF C;  5EBC A;  2LKV A;  1QUQ A;  4LNS A;  2F4V L;  1BCP D;  3RKW A;  3BDO A;  2NB0 A;  4KN4 C;  1GM5 A;  4NMZ A;  3QO5 A;  1NAP A;  2E75 C;  1P16 A;  4IJH A;  3F2D A;  4P71 A;  1JQY D; 
#chains in the Genus database with same CATH homology
 1PH4 A;  3DSQ A;  4JV5 Q;  2DQ0 A;  2ZZG A;  1VQL A;  4RQF A;  1Q82 C;  1WQ7 A;  5GAD C;  2LXK A;  1YZ6 A;  2VUM H;  4RQE A;  4PZ6 A;  3GTG H;  4QGU A;  3RKY A;  3PO3 H;  5C52 B;  4QQB X;  4BY7 H;  4DKA C;  3I4N H;  1B7Y B;  2Q5I A;  1UE5 A;  1VQC A;  1VQI A;  3A5U A;  3TS2 A;  3HFV A;  3QO8 A;  1U0L A;  2IY5 A;  1Q12 A;  2KBN A;  2D0O A;  1PVO A;  3S1N H;  4QJF A;  1T9H A;  1YI2 A;  4TQF A;  1KC8 C;  4IOC A;  4CS4 A;  3GTL H;  2K52 A;  1QF6 A;  1JE5 A;  2EIF A;  3J81 c;  4LW1 A;  4R4O A;  3TUP A;  2ZIM A;  1VQM A;  1KQS A;  3EIV A;  4A3E G;  2I4L A;  3ER0 A;  3G71 A;  4KLK A;  2DEQ A;  1OTC A;  2OQK A;  2HNI A;  3TEH A;  1CKO A;  5C53 B;  3ULJ A;  4DV2 L;  2B63 H;  1XNR Q;  5AJ3 Q;  2RHQ B;  4O2D A;  2A1A A;  1GO3 E;  5EAY A;  4LF8 L;  1W3S A;  3KF6 B;  4OON A;  5GAH C;  2JA6 G;  1KXL A;  1SES A;  4JYA Q;  2K75 A;  4GNX C;  5KNN A;  2R7Z G;  4IFD I;  4IJL A;  4K0K Q;  1IYJ B;  4GNX A;  3PIP A;  3CCV A;  4LVK A;  1UWV A;  2R92 G;  3L0O A;  2CIM A;  3LC0 A;  2ZJR A;  2JA5 H;  4HA8 A;  2ARU A;  1U5K A;  2N78 A;  1HZA A;  4PZ7 A;  4H2U A;  2JA6 H;  2R93 H;  1ADJ A;  1E7Z A;  5M5Y H;  1PYS B;  3E9I A;  4X65 L;  5C0X G;  3IKL A;  5C0X I;  1NMG A;  1G5H A;  1WJJ A;  1Q81 C;  2JJQ A;  4TTV A;  1TWA H;  4L5R C;  2I0Q A;  4LF7 Q;  4A3C G;  4YY3 Q;  3EBE A;  2Q2T A;  4YRG A;  3H0G G;  2DXT A;  4BXX H;  3CMA A;  4WF2 A;  3CCU A;  1H4S A;  1FJG Q;  4JI0 L;  2ZXF A;  3UDX A;  4O0A A;  5C4X G;  1KAW A;  3CCQ A;  1VQZ A;  5K1P A;  1Y1V H;  1PA6 A;  3EN2 A;  4LUO A;  3PGZ A;  4L5Q A;  2JA8 G;  4CH6 A;  1N34 L;  1J5W A;  5H1S E;  4A3M G;  3HOU G;  1IBM L;  1G51 A;  2IT1 A;  4TVY A;  1OXX K;  3JC6 6;  2UUC L;  2MO1 A;  2AWN A;  1L1O C;  2ZCE A;  2QHU A;  3K0X A;  2Q7H A;  1SN8 A;  2ZT6 A;  5M3M G;  4LUV A;  4P71 C;  5IYD G;  3HXU A;  4DV5 Q;  3UFG A;  4OXP A;  4A3C H;  1XNQ Q;  2ZNJ A;  2IHF A;  4MTN A;  4GLA C;  3RN2 A;  2E3C A;  4DR2 Q;  2DUD A;  1KD1 C;  1S3O A;  4TQD A;  1VQP A;  4B3T Q;  5C3E G;  4HWR A;  2Q5H A;  3EFR A;  2JE6 I;  4GS3 A;  1NJ6 A;  2ZTE A;  1IBK Q;  2UXC L;  3M3Y H;  5M3M H;  2Z6K C;  3K7U C;  4IFD G;  2ALY B;  4P73 C;  5ELO A;  1FGU A;  2NZO A;  1JT8 A;  4XU1 A;  1OXT A;  2HHH L;  1HNW L;  2CJA A;  1AE3 A;  1Q1E A;  2CFM A;  4HWT A;  4JI6 L;  4ZIB A;  1IBK L;  4YRN A;  1FJG L;  2YU9 H;  1R9T H;  3I4N G;  1H95 A;  3A5Y A;  4CS2 A;  4JI1 Q;  4LF4 L;  2AWO A;  4J15 A;  2D62 A;  4UP7 A;  2OTJ A;  4YYE A;  2EAY A;  1Z9F A;  4KQE A;  2Y0S E;  2I4M A;  2EJG A;  4XIG S;  3S16 H;  4R4T A;  3S1Q H;  2CQO A;  4JI5 L;  2ALY A;  4BY1 H;  2Z0S A;  4BW9 A;  2VW9 A;  3BZK A;  1YGB A;  2MQH A;  4JOI C;  3CCE A;  3QNE A;  1VQH A;  4XU3 A;  1LM0 A;  3HOY G;  2QHT A;  2OQ0 A;  2K14 A;  3V7C A;  4YDQ A;  2Z6K A;  1BIB A;  4YHH Q;  3CC7 A;  1PYS A;  1SLJ A;  4B3R Q;  4A3K H;  1MKH A;  1X2H A;  4GOP B;  3J81 j;  1JB7 A;  4XEO A;  3UDI A;  1PFS A;  12AS A;  1YHQ A;  1I3Q H;  4H2T A;  3T1Y Q;  4YRQ A;  2F4V Q;  4R4Q A;  2K5V A;  2K5N A;  3I56 A;  1NBW A;  3L4G B;  1X56 A;  1V9P A;  4YWL A;  1NY4 A;  3QTC A;  2R7Z H;  3BU2 A;  4GKK L;  2UUA Q;  4YRS A;  3FHW A;  2OTL A;  4A3G G;  3A32 A;  3I55 A;  1TWC H;  1H4Q A;  2JA9 A;  4DR1 Q;  3HXW A;  5IP9 G;  2PQA A;  1QZH A;  3ZJY C;  3BZC A;  1BBU A;  4YRJ A;  1WLE A;  1H4V B;  4JOI A;  4IFD J;  4P72 A;  4K86 A;  1N32 L;  4XTX A;  2R93 G;  4B3M L;  3GTJ H;  1OXU A;  4YRM A;  2RCN A;  2VZA A;  2WFW A;  2ZTC A;  1TWF H;  1OXV A;  4P3N A;  1VQO A;  4POG A;  2UU9 L;  4DR4 Q;  3GTQ H;  1K3R A;  4KHZ A;  4A3J H;  2KCM A;  4H2V A;  4C3J H;  1V1Q A;  5BR8 L;  1XMO L;  1PH6 A;  4DR3 Q;  4DV0 Q;  1NNH A;  2CJB A;  5LMN L;  3OYY A;  3M4P A;  3ICE A;  2UXC Q;  1VS0 A;  3PCO A;  2ZZE A;  2BA0 A;  3KJP A;  2LXJ A;  4DR5 L;  3V8J A;  2DU7 A;  1RIP A;  2A8E A;  2FXQ A;  2JQO A;  2WAQ G;  4JI5 Q;  3MEF A;  5IWA Q;  3CXC A;  2UXD Q;  1NJ1 A;  2QHV A;  3LGJ A;  4EX5 A;  4LVI A;  2VQE Q;  1I5F A;  1XPU A;  4DPG A;  1J5E Q;  3ULL A;  3CMQ A;  3REU A;  1BBW A;  1EVK A;  3HOW G;  4LFB L;  5IT9 c;  2ZIO A;  4DR3 L;  1ATI A;  3HOV H;  2R7F A;  4DV7 Q;  3HOZ H;  4OLF A;  5GRO A;  1HNX Q;  2KEN A;  5FLM G;  1IBM Q;  3KOJ A;  3CF5 A;  5J3B A;  2I5L X;  1N34 Q;  1YFT A;  2UUB L;  4LF9 L;  3QO7 A;  4XTC S;  3HRI A;  4C3I H;  1L1O A;  4OO1 G;  2UUC Q;  2B3G A;  2RHS A;  4RDX A;  3NEL A;  3RNU A;  3M7N A;  4XEM A;  4BXX G;  2KCT A;  2Y0S G;  1YJN A;  4X62 L;  3HFZ B;  3PUX A;  2NVT H;  4KR2 A;  2E64 A;  4YY3 L;  2QEX A;  2K4K A;  4BBS H;  3KDF A;  3VQV A;  1VQJ A;  3A7U A;  1N8R C;  4X6A H;  1UE6 A;  4CH3 A;  3E0E A;  2JA8 H;  5K36 G;  4AQY Q;  3CCM A;  2UU9 Q;  3A0J A;  1HNZ L;  1E1T A;  3V8L A;  3F1Z A;  4DR6 L;  3TEH B;  4B3M Q;  4XTW A;  3CQZ H;  4JBJ A;  1EQR A;  4H02 A;  2I4O A;  3V7R A;  1IBL Q;  4IPC A;  1WCM H;  3HKZ G;  2I5H A;  3IAL A;  4YRF A;  1L1O B;  4X66 Q;  2L15 A;  3F2C A;  4C3H H;  1K8A C;  4XU2 A;  4LF6 Q;  4KR3 A;  4TVA B;  3G1Z A;  1YIJ A;  2A19 A;  4BY7 G;  3NET A;  3PSI A;  2XGT A;  1CSP A;  3B6Y A;  1HNZ Q;  4LNQ A;  3NEN A;  3S1M H;  4DUZ L;  3HXZ A;  3FP9 A;  2CGH A;  4DR4 L;  3PF4 A;  1VQ5 A;  3STB D;  3ERR A;  2DZC A;  4WJ4 A;  3HOX G;  1TWG H;  1LYL A;  4X64 Q;  5IP7 H;  2E1H A;  2JA7 G;  4GN4 B;  2ZM6 L;  3PO2 G;  2ZNI A;  4LFA Q;  4OP0 A;  4HJ9 A;  4FDB A;  4GLV B;  2HT1 A;  2C35 B;  1QVF A;  1AH9 A;  1SMX A;  2HHH Q;  1PH1 A;  1YHA A;  2F3I A;  3RZD H;  2EL9 A;  4YCW A;  2KHJ A;  1UE1 A;  5IYC H;  3GO5 A;  4DR1 L;  3BFM A;  1E1O A;  5K1X A;  3UE0 A;  1Z7M A;  3AYH B;  3RLO A;  4KHP Q;  5IP9 H;  4X64 L;  3KDF B;  2Q7G A;  4BY1 G;  4JYA L;  2B63 G;  2ZR2 A;  3A7A A;  4DV3 Q;  4OO1 I;  5JJK A;  2WP8 J;  4A4I A;  4GKK Q;  4H2W A;  2CCZ A;  4YRE A;  5E7N A;  4UP8 A;  4P75 C;  1E22 A;  4A3K G;  4POF A;  2ZJP A;  1XTD A;  3V8K A;  3E9H A;  2H5X A;  4AH6 A;  3A5Z B;  3RLF A;  4JBW A;  2ODR D;  4JCV E;  5HY6 A;  1PH2 A;  3IKM B;  4YRT A;  3CD6 A;  5IYB G;  3U58 A;  1SE8 A;  4DNI A;  3ICA A;  1B76 A;  2UUB Q;  1XPO A;  3V7S A;  1SET A;  3CPW A;  4LFC L;  4OWX B;  1B70 A;  4YRL A;  2EXD A;  4A3G H;  4A75 A;  2N3S A;  3S2D H;  4YWK A;  1MJE A;  4X5O A;  4HVC A;  1Q46 A;  4LF8 Q;  3CCL A;  4H2X A;  4JI1 L;  4L5S A;  1WOC A;  4R1J A;  4DV4 L;  3A74 A;  4YRO A;  3HRK A;  4A3D H;  4MZ9 A;  3CC4 A;  1YEZ A;  4A3B G;  1X2G A;  1EVL A;  2VQE L;  2E8G A;  1I94 L;  3PUZ A;  4JC0 A;  2PMZ E;  2R7D A;  5C44 H;  3PF5 A;  2ZGW A;  4LFC Q;  4KI0 A;  3G6E A;  2DVE A;  4DV6 Q;  1VQN A;  3S15 H;  3S24 A;  3TRE A;  2AHO B;  4P75 A;  2YTY A;  3G4S A;  4JI0 Q;  3KYH C;  1K9M C;  2MO0 A;  3GTO H;  3VQW A;  4JI7 Q;  1CSQ A;  4BBR H;  5ELN A;  4A3B H;  4B3S Q;  3GTM H;  5C0X J;  1YFS A;  2DTI A;  1TWH H;  1WYD A;  4B3T L;  4K87 A;  2D0P A;  3L2P A;  4P72 C;  3U4V A;  4KHP L;  1FVI A;  3UE1 A;  1BKB A;  4TQU S;  2VQF L;  3K7A H;  4IPD A;  4OX9 L;  1SRY A;  1USY C;  4A3L H;  4X62 Q;  3MXN B;  3CCR A;  4P73 A;  3CC2 A;  3KF6 A;  4UP9 A;  4PHC A;  2BA1 A;  2ASB A;  4E51 A;  4EO4 A;  2QHS A;  1YIT A;  5LMN W;  1Y1V G;  1WU7 A;  4OX9 Q;  3A7R A;  4NXN L;  1EWI A;  1CUK A;  1PH8 A;  1IBL L;  4JI4 Q;  1WQW A;  2DTO A;  3STB C;  3D0F A;  1Z47 A;  2YTX A;  1N33 Q;  1C9O A;  1KOG A;  3NEM A;  4H2X B;  1KL9 A;  2R6G A;  3CME A;  1HZB A;  4A76 A;  4WI1 A;  4YCU A;  4DV2 Q;  2AKW A;  2NVY H;  3TEG A;  4A3M H;  3HOU H;  2ART A;  2VNU D;  5M3F G;  2ZTD A;  4BWA A;  1H4T A;  3PO2 H;  4CS3 A;  1X9N A;  4JBK A;  4PG3 A;  11AS A;  5C51 B;  4GKJ L;  4C2M H;  2NVX H;  1OXS C;  2ODR C;  3BJU A;  4DV4 Q;  3T1H Q;  2IY5 B;  2NS6 A;  2P0L A;  4LF5 L;  1E3P A;  3G48 A;  1GGM A;  2A8V A;  1E24 A;  4UPA A;  2VQF Q;  3RGL A;  3L7Z C;  2YYZ A;  1NJ5 A;  1SRO A;  5FJ8 G;  4JI3 L;  3OTO L;  5C3E H;  3KJO A;  3CW2 C;  4DR2 L;  3IG2 A;  4NXM Q;  2B29 A;  4HWO A;  4HWP A;  4UY8 C;  2VS1 A;  3U4Z A;  3J7A 5;  1C0A A;  1VQ9 A;  1N32 Q;  4LF4 Q;  1XMQ L;  3PUV A;  1XNR L;  4LFB Q;  1JJC B;  4LWC A;  3CPF A;  4DV6 L;  5AJ3 L;  1X3G A;  1ADY A;  2E65 A;  1PH3 A;  4R4I A;  1Y14 B;  5FJ8 H;  3RR5 A;  5IP7 G;  2JA7 H;  1B7Y A;  1O7I A;  1M1K C;  1B70 B;  1P8L A;  3I4M G;  5FLX c;  3F2B A;  1N33 L;  4LVJ A;  4K88 A;  2ATW A;  2UXB Q;  4YRC A;  1VCI A;  5GAE C;  1K83 H;  1X55 A;  1HR0 W;  3PCO B;  2GVB A;  3LSQ A;  1VQ6 A;  4DV7 L;  4P3P A;  4X65 Q;  4HJ5 A;  1RIQ A;  4YHH L;  5IWA L;  1VQ8 A;  1K0R A;  2GN5 A;  1PH5 A;  5LMU L;  1EIY A;  4PMW A;  3I4O A;  2E2I H;  4RG1 A;  2ZZF A;  4ALP A;  2VL6 A;  1V43 A;  3D31 A;  4A93 G;  2DTH A;  1NTG A;  4DV0 L;  1N9W A;  1Z7N A;  1IXR A;  2JEB I;  2YV5 A;  3TQY A;  1HNX L;  4DV1 L;  1YB3 A;  4CH4 A;  3JAM c;  1G29 1;  4YRR A;  1W2B A;  3J7Z C;  2HIX A;  3UDG A;  3HOW H;  2J3M A;  4Q6G A;  4A3F H;  2E41 A;  4HID A;  2NVQ H;  3RIR A;  2AKW B;  4L87 A;  4HIK A;  4LF6 L;  3GD7 A;  1HNW Q;  5FLM H;  1VQK A;  2WB1 E;  3Q8D A;  1XJV A;  2BH8 A;  1VQ7 A;  3OD1 A;  2QA4 A;  1C7Y A;  2WB1 G;  5GAG C;  3WQZ A;  4DR5 Q;  2UUA L;  1J6Q A;  1HJP A;  4X66 L;  4CH5 A;  1NYR A;  1VQD A;  2PME A;  5M5X H;  3SGI A;  2DDZ A;  2MFI A;  2JA5 G;  1PHJ A;  3RLN A;  4HJ7 A;  4AQY L;  5E3I A;  2LSS A;  2CJ9 A;  2V1C C;  4LF7 L;  4P74 C;  4DUY L;  4JI4 L;  3VBB A;  4DR7 Q;  3M4O H;  4NB3 A;  4HIO A;  1Y1W H;  3P8V A;  2ZT5 A;  1HH2 P;  2ZJQ A;  4XTV A;  2K50 A;  2KHI A;  3HXX A;  3P8T A;  1WCM G;  4JI6 Q;  2Q2I A;  3EFS A;  3RAC A;  2NN6 G;  3VQX A;  2DU5 A;  3UGQ A;  1EIF A;  1X6O A;  2PQA B;  1ASZ A;  4YRP A;  3J80 i;  1KRS A;  3RN5 A;  1QUQ B;  4MNO A;  2MNA A;  2JEA I;  2DGY A;  1WI5 A;  4GN3 B;  4Y7N H;  4BBR G;  2XTI A;  2PI2 E;  1YVC A;  1D7Q A;  3RUX A;  4OWW B;  4GLX A;  1HZC A;  3HXV A;  1G6P A;  3VQY A;  3UGT A;  4TVA A;  3U50 C;  1Y1W G;  2UXD L;  2ZT8 A;  3CP0 A;  1BVS A;  2HIV A;  1KMN A;  3FJP A;  4P3O A;  2E5L Q;  5JJI A;  1BIA A;  5GQO A;  1MIU A;  2CKZ B;  3OW2 A;  4B3R L;  3A5Z A;  2QGQ A;  4DUZ Q;  3MF1 A;  1QE0 A;  4OWT B;  3TS0 A;  1N36 L;  1NE3 A;  4XU0 A;  1IL2 A;  3CCS A;  2IX0 A;  1I94 Q;  3TRZ A;  3JAM i;  3K8A A;  4LFA L;  1PYB A;  2EJF A;  2WAQ E;  4HJA A;  1NJ8 A;  4LF9 Q;  1K73 C;  4IOA A;  1FL0 A;  3PV0 A;  5IYC G;  4EQ5 A;  2E5L L;  4K0K L;  1YJW A;  3KF8 B;  3A31 A;  1XMO Q;  5DLQ E;  2DJZ A;  1KHI A;  1SFO H;  4LVL A;  1EIY B;  4YRK A;  4B3S L;  2IHE A;  2E2J H;  1VQ4 A;  4YPF A;  4TWA A;  1HR0 Q;  3P8Y A;  1JJG A;  1I6H H;  3LSS A;  3AFP A;  2ES2 A;  1Q1B A;  1J5E L;  2NZH A;  1L0W A;  3HKS A;  2DZ9 A;  4ZTU B;  3HOX H;  4APV A;  3T1H L;  1PV4 A;  1EOV A;  4JV5 L;  1WPY A;  2HQL A;  3H3V I;  5JJL A;  4ME3 A;  4NCX A;  2ZR3 A;  2AMC A;  2OCE A;  4YWM A;  1VQE A;  1A62 A;  3PO3 G;  1X65 A;  1SER A;  5BR8 Q;  1A0I A;  4DR7 L;  2EWN A;  4DUY Q;  3I2Z A;  2NN6 I;  3T1Y L;  4QY7 A;  1USY A;  3HY0 A;  3L1A A;  3S1R H;  4DAY B;  4JI8 L;  2VY3 A;  5JEA G;  3HOY H;  5IY0 A;  4JI7 L;  1PH7 A;  1A63 A;  3DLL A;  3UDF A;  2IX1 A;  3WWV A;  4A3D G;  3REX A;  4DV1 Q;  2DQ3 A;  2DXU A;  1GD7 A;  1QVC A;  1Q86 C;  3RKX A;  1NYQ A;  1YNX A;  3S17 H;  4XTZ A;  5M5W H;  1KIX A;  1X3E A;  3I4M H;  3NBH B;  2AMC B;  1EQQ A;  4A3E H;  3PUY A;  1XPR A;  2E2H H;  2F52 A;  3AEV A;  3M85 A;  1S72 A;  1YFR A;  3UH0 A;  1GKH A;  1GVP A;  4DV3 L;  5IYB H;  2Q7E A;  4P74 A;  4WJ3 M;  3H3V H;  1FYF A;  3FKI H;  1L2F A;  1AE2 A;  1G5I A;  2BH2 A;  4NXM L;  2YTV A;  3PIO A;  4HIM A;  2Q2U A;  3H15 A;  1HXD A;  3K80 C;  2ZTG A;  2CWA A;  1UEB A;  1SR3 A;  4A3J G;  3W5O A;  3GDE A;  4BA2 I;  4HWS A;  1DGS A;  2PNH A;  4A93 H;  3IRB A;  4Q15 A;  4L5T A;  1X54 A;  1M90 C;  4AYB G;  2ID0 A;  4GN5 A;  3L4G A;  1VQB A;  1NJI C;  3MQZ A;  1KRT A;  2R92 H;  3M9B A;  1NJ2 A;  3FKI G;  4DR6 Q;  4PZ8 A;  2ZIN A;  1XNQ L;  2ZT7 A;  3R07 A;  4DV5 L;  4GOP A;  3RZO H;  1WNL A;  2RHS B;  1HZ9 A;  3RL6 A;  3W1G A;  1EUJ A;  3HXY A;  3HTZ A;  4BA1 I;  3I7F A;  3M4Q A;  1Q7Y C;  5C44 G;  4RMF A;  4AYB E;  1VQG A;  1HR0 L;  3VDY A;  4JI3 Q;  1QZG A;  3AFQ A;  2G4C A;  5F5W A;  2P5I A;  2N49 A;  3S14 H;  4XTU A;  3H0G H;  2JK8 A;  4G85 A;  1QVG A;  4H2S A;  1CKM A;  1CKN B;  4IPH A;  1JJ2 A;  4Y52 H;  3W3S A;  1A8V A;  3AQQ A;  4GNX B;  5C4X H;  4HT4 A;  2RF4 A;  3CAM A;  1EYG A;  2K5H A;  2E5A A;  4IO9 A;  4IPG A;  3HY1 A;  1PH9 A;  1SRU A;  4JG2 A;  2ZM6 Q;  1YHB A;  2E10 A;  1HTT A;  4A3L G;  4NXN Q;  4JI8 Q;  2I5M X;  2EQS A;  2UXB L;  4JI2 L;  1UE7 A;  4BBS G;  3ERS X;  3W1B A;  1Q8K A;  4TVW A;  3S2H H;  1S40 A;  4LUZ A;  4G84 A;  1WFQ A;  4YP0 A;  1I50 H;  2N8N A;  1D8L A;  4NPS A;  1B8A A;  3J81 i;  1YJ9 A;  1VQA A;  1X3F A;  2DKG A;  1K8G A;  3RF1 A;  2I4N A;  1W66 A;  3PUW A;  2PMF A;  3K81 C;  5C4J H;  1EFW A;  5IE8 A;  3GTP H;  5M3F H;  4A3I G;  1LUZ A;  4DAM A;  1JMC A;  1IZ6 A;  4QL5 A;  3HOV G;  1LTL A;  3PZC A;  5HGQ A;  5LMN Q;  1X01 A;  4HJ8 A;  3OTO Q;  1XMQ Q;  4JBM A;  3HOZ G;  2J3L A;  4GOP C;  1MJC A;  2OWO A;  2CWP A;  1RL2 A;  4H2Y A;  1N36 Q;  3CCJ A;  1HC7 A;  4YRI A;  5JEA J;  3J80 c;  1TXY A;  4DQ2 A;  3ULP A;  4A3I H;  1KMM A;  4R4C A;  4DK3 C;  3HKZ E;  4LF5 Q;  1VQF A;  2EJ9 A;  2PI2 A;  2VUM G;  1NMF A;  3MEY A;  3DM3 A;  4GKJ Q;  4ZTZ B;  5LMU Q;  3GTK H;  4XTY A;  4AIM A;  5IYD H;  2C8M A;  4DK6 C;  3L2Z A;  3HFZ A;  2GVA A;  3KLW A;  4YCV A;  2RHQ A;  2FYK A;  1CKN A;  2C7I A;  1JJC A;  4JI2 Q;  3MF2 A;  4QIW E;  4LVM A;  1ASY A;  1YBY A;  3KFU A;  3F8T A;  4A3F G;  2Q2H A;  2ARS A;  1QUQ A;  4LNS A;  2F4V L;  3RKW A;  1GM5 A;  3QO5 A;  4IJH A;  1P16 A;  3F2D A;  4P71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...