4XTZA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 69 that has a fluorine in place of the ribose 2'oh
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 93
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtzA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtzA01
1C0AA 3A5ZA 4V2SA 4M7AE 4Q15A 5F5WA 2P5IA 2DZ9A 4PJOC 1G5IA 5LJ3j 5C53B 4RCCA 3QO8A 1LOJA 4HT8A 2P0LA 5ELOA 4C8QC 1B34A 4YRQA 1BBWA 4ZTUB 4PJOB 3SB2A 4M75E 3QO7A 3VQYA 3SWNC 4P74C 4NL3A 4PJOG 3EFSA 3E9IA 3V7SA 3HFZA 5GANd 4P75C 1I4K1 1USYC 5LJ3h 1G51A 2E5AA 4XTUA 5GANg 4C8QG 4WF2A 5GMKm 1H4VB 2AMCA 1M8VA 5HGQA 5LJ3e 4H2XA 3REXA 4ZIBA 3JCMf 1HXDA 3L2ZA 3TEHA 3HY1A 3LC0A 4TQFA 1QE0A 2ZZGA 2EAYA 1NYQA 4CH4A 5GAOl 3VQWA 3QUIA 1PYSB 4BWAA 3P8VA 3JCMW 3V7RA 4DQ2A 2Q7GA 3P8TA 4YRFA 4H2SA 4M78F 3JCMJ 1LYLA 4TTVA 2DU5A 3A7RA 2EJ9A 4M77B 1EQRA 1Z7NA 3JCMP 3TEGA 3IKMB 4M77F 4J5YA 4XTYA 1WQWA 2RB6A 4H02A 4C92A 1EFWA 3RKXA 5C52B 3ERRA 3HXUA 4P3OA 3AHUA 3RUXA 1B34B 4EX5A 3JCMQ 4DPGA 4MMLA 4C92D 1I5LA 3HSBA 12ASA 2RHSA 4M7DE 1B70B 3IKLA 2PMFA 2Q5IA 2E1HA 2ZINA 3HFZB 4OLFA 1H641 2CIMA 3W3SA 3JB9G 4YCVA 2AMCB 1I8FA 2VC8A 4H2XB 3RL6A 2ZT6A 11ASA 2JN0A 1GGMA 4JRKA 2ZCEA 3JCMX 3PCOA 5GAOm 1HC7A 2ZGWA 1MGQA 4PJOA 1LNXA 1EVKA 4F7UF 2DTOA 3HXYA 4PHCA 1U1TA 4C92C 2DVEA 5LJ5g 3JCMh 1JBMA 3IG2A 4UP7A 2I4LA 1SESA 3V8JA 3JCMe 3LSSA 5GAOp 4YYEA 2J3LA 2ZZEA 2EJFA 5GMKl 1E22A 4P72A 3RGLA 4HA8A 4C8QE 3BJUA 3HY0A 3RKYA 4C92G 3HXXA 3GIBA 3HXZA 4EMKB 3VQXA 2E10A 4XEMA 4M78A 3A7AA 2ZXFA 4Y91A 2AKWA 2RHSB 2QHVA 1LJOA 1SRYA 5GMKi 3A31A 4HWOA 4YDQA 4P71A 3UFGA 4M77A 2DZCA 4M78D 2J3MA 2DKGA 3BDUA 4NL2A 4XU0A 2ZT8A 4HVCA 3R07A 4EMGA 4HWSA 3VBBA 1VQZA 4M77D 4N0AA 2I2LA 2YHTA 3JB9H 4QVCA 1WLEA 4XTXA 3JCMc 2VXEA 3RKWA 4XQ3A 3M4PA 1JJCA 3RERA 2HNIA 4M7DF 3PCOB 4EO4A 3A7UA 2QHTA 5KNNA 4P72C 3A74A 1QF6A 2EL9A 1B70A 3QO5A 3VQVA 2EWNA 3L1AA 3HFVA 5LJ3g 4BW9A 4J6YA 4K86A 3JB9I 4EMHA 2DU7A 5GAMf 4YCWA 1SERA 4M78C 3NENA 1E1TA 2ZNIA 4P71C 4F7UA 4M77C 4H2TA 2ZTGA 2ARUA 4RQEA 3L4GB 4YRIA 4WJ3M 1KMNA 4M78B 1G5HA 4TQDA 4M78G 2AKWB 4N0AC 3A5YA 4WI1A 3NELA 5K1PA 3LSQA 4AH6A 1NJ8A 4E51A 4C8QF 4M77G 3JCMV 4XTZA 2EJGA 4P73A 3M4QA 4K88A 4MMKA 4XTVA 2DDZA 4CH6A 1YFSA 2ARTA 4H2YA 4M7AB 1JJCB 4EMKA 4C92E 4QVDA 2QHUA 4RQFA 4YRNA 4YRSA 2XGTA 4HWTA 4M7AF 4YRTA 5GAMj 2ALYA 2C7IA 2Q7HA 3I7FA 4PNOA 1BIAA 3FJPA 5CAIA 3JCMb 4TWAA 1KMMA 3PZCA 4HT9A 4YRRA 4M75B 4NOYA 3EFRA 4WJ4A 2IY5B 1B8AA 4KQEA 3V8LA 5GAOn 4M7DA 2CGHA 5GAMg 4M75F 5DY9A 2E65A 4F7UB 1WU7A 1ADJA 2ARSA 5ELNA 1KQ2A 2Y90A 1NJ2A 2RA2A 3QO3A 4F7UG 4G84A 5LJ5d 5GAMh 3FIFA 3JCMg 4A54A 2E41A 4M7DD 1IL2A 2ZNJA 4P73C 4YP0A 5GAMe 3ICAA 2DXTA 1H4QA 3BW1A 2ZR2A 4YCUA 4PJOE 5GAOq 3INZA 3JB9F 1EVLA 4EMKC 3PGGA 5GAN7 4YRPA 4RMFA 4TVAA 3E9HA 4XTWA 4OP0A 5E3IA 2ZT7A 4H2WA 3JB9J 1H4TA 4YRGA 2CJ9A 3L4GA 3MF2A 5GANf 4XU1A 2ZT5A 1N9WA 2DTHA 5GAN3 4M7DC 2ALYB 1WQ7A 2PMEA 3UGQA 1HTTA 4YRKA 2ZR3A 1Y96A 1H4SA 4LNSA 1KQ1A 4O2DA 4C8QD 4UP8A 4M77E 3VU3C 1NJ6A 1ASYA 4CH5A 4M7DB 4K87A 3M4GA 4TVWA 4CS2A 3CMQA 4M7DG 1WYDA 4M7AA 5C51B 5GMKj 4A53A 5LJ3d 4H2UA 2I4OA 1EOVA 2CJBA 2DEQA 3HXVA 4NCXA 4M7AD 2C8MA 2ZIOA 1RIQA 2QHSA 4H2VA 3BY7A 2Q5HA 1YCYA 3WQZA 3NETA 4L87A 1W66A 4M75A 1YGBA 4TVAB 3P8YA 2IY5A 4HWRA 4ZTZB 1FYFA 1SETA 5GMKh 1X56A 5GANj 2E64A 2K57A 3KFUA 3RIRA 5GAN4 1EIYB 1HK9A 4M75D 5GMKe 1D3BA 3OD1A 3FB9A 1U1SA 4PJOF 4F7UE 1J5WA 3MEYA 4C8QB 4J6WA 4UP9A 1Y96B 4M7AC 4YRCA 3SWNB 1Z7MA 3JB9D 3HRKA 1B7YA 3V8KA 2I4MA 5GANh 2RHQB 1ATIA 2YLCA 4Q6GA 1NNHA 5LJ5f 5GAN8 3V7CA 5GANe 4X9DA 4X9CA 2E3CA 2QTXA 4JUVA 1ASZA 4YRJA 4CS4A 4JRIA 1YB3A 2DXUA 4M7AG 1NYRA 2ODRD 4M75C 4P3NA 5GAN2 1WNLA 2ZIMA 3A32A 3TUPA 5K1XA 2FYKA 2I4NA 1L0WA 5GAN6 3RESA 1E24A 4HWPA 3G1ZA 4X5OA 3QNEA 5GAMd 1X55A 4M75G 4XU3A 5GAOr 3JCMd 1BIBA 3RF1A 1X2GA 1I81A 2CJAA 4XU2A 3REUA 2XTIA 3HXWA 2DJZA 1D3BB 4YREA 3UGTA 4KR3A 2Q7EA 4P3PA 1WPYA 1X2HA 2ODRC 1KOGA 3HFOA 4RCBA 2RD1A 5LJ5j 3IALA 2DTIA 4JLIA 1B7YB 1YFRA 2ZZFA 2DQ0A 3DSQA 4UPAA 1ADYA 3TEHB 5I21A 3HTZA 4CH3A 3RACA 3HFNA 1BBUA 4YRMA 5LJ3f 4J6XA 4YROA 1B76A 1EIYA 4RDXA 1JRIA 4PG3A 1NJ5A 2YLBA 4YPFA 4G85A 1N9SA 2FB7A 4PJOD 1NJ1A 5LJ5h 4C8QA 1X54A 2G4CA 4XEOA 2VXFA 1N9RA 4M78E 1M5Q1 4CS3A 4KR2A 5GAN5 1X01A 3QHSA 5LJ5e 3SWNA 4P74A 1E1OA 4C92B 3MF1A 1TH7A 2RHQA 3QTCA 2DQ3A 4J15A 2RM4A 3UH0A 4C92F 4P75A 1USYA 1YFTA 4TVYA 4YRLA 3QSUA 1PYSA 3BFMA 3HRIA 3NEMA
chains in the Genus database with same CATH superfamily
3CC7Q 1ZBXA 3CMAA 1GCQA 2MMPA 5KYYA 1CKAA 3PFSA 4V2SA 4OMQA 4M7AE 1NPRA 4Q15A 4RTVA 4BY6B 2P5IA 1WX6A 1K8AR 4AFUC 1Y0MA 1G5IA 5LJ3j 1AEYA 1TS9A 1LOJA 4HT8A 2QDLA 1PRMC 1D0XA 4ZTUB 1NEGA 3SB2A 3QO7A 4LXCA 1IZ6A 4AMCA 2HDAA 3LH5A 4NL3A 2MYSA 3CMET 3EFSA 1K9MR 2HL5C 1YFNA 4DEYA 4C0GA 1YIJT 1T3LA 1I4K1 2LCLA 2E5AA 2RPNA 2RI5A 1ABQA 1M8VA 5HGQA 3OYHA 2HCKA 3VS7A 1OX9A 1KFZA 1X2KA 4J9BA 2WACA 3HY1A 3I35A 1WHMA 2KROA 1UGPB 3DB4A 3QUIA 1PYSB 2MCNA 4J7IA 3JCMW 2KRNA 3V7RA 4YRFA 3MEVA 1SRLA 3JCMJ 4TTVA 2DU5A 3A7RA 2EJ9A 2HMAA 4DOWA 1MMDA 1VYVA 5AYFA 4MZPA 5IT9E 3PTAA 3OYLA 2RQVA 4XTYA 1WQWA 2RB6A 2KGTA 2EYZA 1YI2A 1KC8U 3S6WA 3C12A 1YJNQ 4P3OA 3QG1A 1M1KR 2NWMA 2XDDA 2YUNA 4MMLA 1I5LA 2H8HA 1VQ5Q 12ASA 1VUBA 5J39A 2Q5IA 2F5TX 2M1HA 2QEXA 1UG1A 2NYSA 1GXIE 1PC0A 3GNGA 2M9UA 3MJXA 3WVEB 1KC8C 3QBYA 2PUOB 3HHTB 2DEUA 1VQ7T 4J8OA 4JRKA 4A4GA 2AZSA 2CUDA 4J9HA 3TSWA 3JCMX 3I56A 1WLPB 4L6V5 4F7UF 4FU6A 2A28A 1U1TA 4C92C 4OB2B 2HQXA 1JBMA 3CCJA 3KXTA 4UP7A 2I4LA 3JCMe 7AT1B 3CMAQ 3M0QA 1QMCA 3G71A 1SHGA 4E7IA 3J7AF 4OB1B 3QDRB 2DBKA 4PLIA 2P84A 4C92G 1KK7A 5IXFA 4BI8B 4UC4A 5D6YA 4A63B 2D8JA 1UDLA 1OYXA 1UUEA 1WHHA 4Y91A 1LJOA 5GMKi 2YDLA 3A31A 1TUDA 2X4XA 2DZCA 3AT1B 1QQJA 4XU0A 4HVCA 3R07A 3EFOA 4QQDA 1QCOA 4EPCA 4OB3B 3JB9H 4QVCA 3RKWA 1UGRB 3SHWA 3G1JA 4XAXB 3EG3A 2K3YA 4D8DA 1KQSA 2O4XA 3L2WA 2HBPA 4J6YA 1BK2A 1X6GA 3JB9I 3CMAT 4OMFB 9ATCB 2AT1B 2RI3A 3TEEA 5CK9A 1X75C 2DO3A 3EG0A 3LW5E 1R0BG 3EHQA 1S72A 1PM3A 1YI2Q 5CCAA 1K4US 2EVRA 3L4GB 4YRIA 4WJ3M 1D1BA 2COZA 1OZ3A 2XIDA 5KYNA 4TQDA 2RO0A 2E6NA 1VIEA 4N0AC 3TVTA 3A5YA 4WI1A 1M9SA 2JXBA 4AH6A 1EX4A 1NJ8A 2OAWA 4XTZA 4KH1B 2QEXQ 2CUBA 3EG1A 1HYOA 4BE1A 4MMKA 3UF4A 4XTVA 4CH6A 2QDYB 4DBFA 4H2YA 1GFCA 3D7SB 3S3OA 4C92E 2XGTA 4HWTA 1UGSB 3M0RA 3EGXA 2O4XB 3KUFA 3VS3A 3I56Q 4RUGA 2Q7HA 2LQNA 2G3RA 4N4GA 1BIAA 3FJPA 2BKDN 3X25B 3CPFA 1AHJB 3PZCA 3CCJQ 5ECAA 1UHFA 3EFRA 2ZAEA 2CREA 3HL8A 1KG1A 2IY5B 1B8AA 4ATOA 2KXCA 3V8LA 1QVFP 1BYMA 3G71Q 1YI2T 5DY9A 1KQ2A 4F7UG 4VUBA 1WXTA 1IL2A 2DL7A 1YITA 1C1AA 2EGCA 4YP0A 5GAMe 2RI2A 1IHVA 4YCUA 2D0QB 3OSVA 1SPKA 3JB9F 2QEXT 2QTVA 3CXCA 4EMKC 2CP5A 5GAN7 4XTWA 3OS1A 1JB0E 3NHNA 3QWYA 2CJ9A 2FZGB 1ZHIA 3QWXX 4XU1A 1TWBA 5CO7A 3OMGA 3I56T 4DA4A 1X6BA 3EGXB 3RR6A 1N9WA 1XJWB 3VYHB 2QI2A 2CP0A 1JJ2S 3CCJT 2ZR3A 3UA7A 1BI2A 3OW2S 3G71T 1ASYA 2J6KA 5A2QE 2EIFA 1WYXA 3M4GA 2YRDA 3CMQA 3VYGA 1I1JA 1S72Q 1EOVA 3TSZA 2CJBA 2DEQA 2LQKA 2ROTA 5DLOA 4Y92A 2D0NA 2KDSA 5FLXE 2DPPB 2RQWA 2R5MA 4M75A 1P92A 2GQIA 1BCMA 5GANj 4LDXA 5GAN4 1HK9A 1OQKA 4JJBA 5GMKe 3O5ZA 3CC2A 3OD1A 2PU9B 1YJ9Q 4F7UE 3I9QA 2CYZB 2X35A 4C8QB 4LN2A 4QKUA 3VS0A 2WSCE 2LQWA 2W0ZA 2L0AA 1W4SA 1B7YA 2I4MA 2RHQB 5EG2A 2RMOA 3OYFA 5GAN8 3VKIA 4X9DA 1VQ9A 4J9IA 2E3CA 3DKMA 4YRJA 2JTFA 1N8RC 1YB3A 3CPWA 4P3NA 4ZN3A 8AT1B 2ZIMA 1HJDA 5K1XA 1SEMA 3M9QA 1YITQ 3CQTA 1L0WA 1WDXA 4GBQA 2CT4A 4CC7A 3QNEA 5KE3A 1UECA 1FX7A 1X2QA 3ER0A 3JCMd 1BIBA 2NUPA 5AT1B 1I81A 1ZUKA 4GY5A 4XU2A 3EGUA 4Z02A 3EH2A 3OYBA 5FRMA 4YREA 2RJDA 2MI6A 4P3PA 4IKFA 3EGDA 2ODRC 1OOTA 1SHFA 3HFOA 5EC7A 2DM1A 3T9NA 4LUDA 5LJ5j 1B7YB 2PVGB 1YFRA 2ZZFA 2H3JA 2DK3A 1B07A 4OGEA 4QQ6A 2EYWA 4K11A 2EQMA 4YRMA 5LJ3f 4J6XA 2DIGA 1KQSP 2KT8A 4PG3A 2BTTA 3EAEA 4BD3A 1Q7YU 2JUFA 3ASKA 5KH6A 3M57A 2FB7A 3QJ6A 2G4CA 1YITT 1X54A 2X3XD 4M78E 3MP8A 2FZCB 2DYBA 1NJIU 3QHSA 1MNDA 3M0TA 1E1OA 1TH7A 5FRNA 3FEOA 4KUIA 1RAIB 4OMOA 3QTCA 2DQ3A 3UH0A 4JS5A 4P75A 1VQMA 2NUPB 2KY9A 5FW9A 2RH2A 1M90R 3I55A 2EQUA 4WCIA 3CCLT 1BI0A 2L5QA 3EGDB 3CC2Q 2MIOA 1YWOA 2DZ9A 4PK4A 1HD3A 3OYNA 2LJ3A 1GBQA 2QASA 4IUUA 2QYZA 2LNHB 2DA9A 5ELOA 2LCSA 4PJOB 1QCFA 3L42A 3X24B 4FT4A 3SWNC 4DBQA 2HL3A 1VQ9Q 2O01E 3HFZA 5D7UA 2LZ6B 2O88A 1SF9A 1PNJA 5LJ3h 1G51A 2FPDA 4WF2A 3ZEHA 2K7AA 2KYMA 3REXA 1Q7YR 2ZZGA 3GPLA 2EAYA 1NYQA 4O5VA 1U5SA 2PVDB 2JMCA 5HY6A 3ME9A 1D0YA 1KD1R 1RLQC 1NJIR 2Q7GA 4CC3A 3CCQA 2ED1A 1Q95G 1Y7XA 2VGNA 5M9OA 2P0QA 2LNVA 4M77B 3ZBDA 3CXCP 1Z7NA 1MUZA 2BE9B 1RI0A 3LGLA 4LD6A 4J5YA 2LQ8A 4EDUA 4H02A 4NS5A 2HZYA 1VQ7A 1Q82R 3RMQA 5C52B 3RUXA 5HCKA 4IURA 3LX7A 2QQAA 3HSBA 2KI7A 4AFSC 2BZ8A 2OJ2A 3CCRA 1VQ9T 3PE0A 3X20B 2RHSA 4M7DE 2K5IA 2ZINA 1RAHB 3HFZB 4OLFA 2M16A 1JEGA 2HAXA 2DAQA 2PQWA 2JVVA 2E4HA 1OULA 1Q81U 2SRCA 3M0SA 2PNIA 3PCOA 1EVKA 2DTOA 2WSEE 1M2VB 4PHCA 1SSFA 1WGSA 2RQTA 1VQMQ 3E1SA 2HKQB 5KE2A 3V8JA 3LSSA 3I55Q 1PD1A 4YYEA 2DX1A 2J3LA 2ZZEA 2EJFA 1FMVA 5GMKl 1B7TA 3RGLA 1U3OA 1MMGA 1Q81C 2EQIA 2XG8D 3OYCA 5HKCA 3OS5A 4QW2A 3GIBA 3HXZA 1J3TA 4XEMA 2L3PA 2DRKA 3A7AA 2ZXFA 2AKWA 2RHSB 4AG2C 1Y07A 1SRYA 1YP5A 3EG9B 2R5AA 4YDQA 4P71A 1UE9A 4M78D 3BDUA 4NL2A 2ZT8A 2F2WA 1FXXA 4HWSA 1I5OB 2K3XA 4M77D 5IHNA 2I2LA 2YHTA 1W2BS 3MEAA 3JCMc 3JSCA 2VXEA 2ZZDA 4XQ3A 3M4PA 1QVFS 1FYNA 3PCOB 3CPWP 4EO4A 1NBEB 2XHCA 1VQMT 2X3WD 3UA6A 3QO5A 3VQVA 2EWNA 3HFVA 5LJ3g 3I55T 4K86A 5D6WA 1IRXA 2RNAA 1EZZB 2DU7A 3CCQQ 1K9AA 2EYQA 4E7LA 2Z0WA 2J6OA 5KCHA 5HK3A 1VQ7Q 1IB8A 1G5HA 2E70A 2VUBA 2F2XA 2AKWB 2JTEA 4D6WA 5I2SA 2ZPBB 2GTOA 4E7JA 3CCRQ 4JZ3A 3H0FA 4E51A 4C8QF 3S3MA 1QVGA 4M4ZA 3L2RA 1BI1A 2V8KA 2NUTB 1Z9ZA 2X4YA 5KYXB 1TOVA 1OPKA 1VQ6A 3OB9A 5KYUA 4M7AB 4II1A 3QIIA 2CZ1B 2ENMA 4YRNA 4YRSA 4LVIA 2IG0A 2J05A 5CKDA 2L3SA 3LGFA 4YRTA 4FCYA 3LLRA 1C0MA 2C7IA 4PFZA 3OSSC 6AT1B 3CCQT 4JJCA 3KFVA 4PNOA 2CSIA 4HT9A 3X26B 4FT2A 1ZSGA 4M75F 3WVDB 2E65A 2ARSA 1VIFA 2E5QA 3MP6A 3QO3A 3VRZA 3FIFA 4M7DD 2SEMA 4RTUA 5I22A 4RTTA 3CCRT 3BW1A 2BZXA 4LVMA 1OU8A 2MK5A 1W6XA 3L2QA 2GGRA 1K0SA 4D8KA 2IVWA 4RMFA 3E9HA 4BDYA 4OP0A 2FPFA 5E3IA 3CCVA 2ZT7A 1KIKA 2KMTA 2PZ1A 4HCZA 2RF0A 5KYUB 2O31A 4YRGA 3L4GA 2NS6A 3MF2A 5GANf 2QQRA 3VS5A 3J81E 1OU9A 1AWOA 5IN1A 5GAN3 1KC8R 4LD9K 2CSQA 2Y4XA 1Y96A 1SRMA 4LNSA 1X69A 1G8XA 2RHZA 3VU3C 1NJ6A 1SG5A 2RK2A 4CH5A 2D9TA 4K87A 4TVWA 2QXFA 4FSXA 4PJLA 1WYDA 2RQUA 3HP9A 1EIFA 1KHCA 4MDXA 2X9HA 2FEIA 1UGVA 4H2UA 1ZX6A 3OBWA 2QGGA 4M7AD 2E12A 2ZIOA 2Y4YA 2LJ0A 1RIQA 3U23A 2LT4A 2QHSA 2AIRB 2R58A 3BY7A 1AWXA 2OTJT 4ESRA 1YCYA 5CR2A 5D6XA 2HSEB 1VQ8A 3Q1JA 2FZKB 2IY5A 4HWRA 1SETA 3R6OA 1X56A 2E64A 4MDWA 2K2MA 3S3NA 2A37A 3FB9A 4Z89A 1KQSS 1N27A 1RAFB 1T0HA 4PJOF 3CCEA 3L2VA 2JT4A 1J5WA 1VQ6Q 2CP6A 2DD5A 1KJWA 1XQHA 1IGUA 4ORZA 4DOVA 5IXBA 1E7OA 1Y96B 1Z7MA 3HRKA 1BI3A 1PSEA 5GANh 4HXJA 1UGQB 3I5RA 1N6AA 5LJ5f 1LVKA 5FWCA 3J80E 2BZYA 2JS2A 2GFAA 1PKTA 2CP2A 2QTXA 3META 4JUVA 1YJWA 4DBHA 2BE7D 3FLGA 1NE8A 4KGVB 4M75C 5GAN2 4R56A 3MKDA 2VGMA 3THKA 2JOYA 1ZBJA 4LDUA 3G6EA 4OB0B 2K2VA 1E24A 5GJVB 3EHRA 1D09B 2K5FA 4M75G 5GAOr 2F1LA 3RF1A 1RAGB 3CEYA 2RHXA 3REUA 4ZN1A 1VQ6T 3CCVQ 2RHIA 4Z8AA 3SFMA 4KR3A 2Q7EA 4E2FB 3LWHA 2DL4A 3QZ9B 1Y57A 1X2HA 4RCBA 2ECZA 3H8ZA 2DTIA 4IUTA 4JLIA 1GL5A 1E6GA 5C6SA 2A0FB 5A0GA 3ZFJA 2EYYA 3TEHB 2GNCA 2HSPA 3TQ7P 3E9FA 2LT1A 4RDXA 1JRIA 2RN8A 3CCLA 2NUZA 4YPFA 1N9SA 5L8RE 1V1CA 1OZ2A 3FC3A 5CKFA 5LJ5h 4C8QA 1GBRA 1N9RA 4CS3A 3CXCS 5GAN5 3LH0A 1PKSA 1AT1B 4P74A 4ANJA 4C92B 2XDBA 3MF1A 2HQHA 2RHQA 2EYXA 2W10A 1USYA 1BB9A 1YFTA 4TVYA 3A8MB 1VQ8Q 3CCVT 1TXQA 2IPOB 3CC4A 3HRIA 5C0MA 3H0HA 4C0FA 2CP3A 2ESWA 1C0AA 4KUDK 2QGFB 1MHNA 1F1BB 3UWNA 4R55A 2V8IA 1JXOA 5F5WA 1QVGP 1D0ZA 2WSFE 1D1AA 4J9DA 4PJOC 2EQJA 3JRZA 5C53B 1M1FA 2OX7A 2XD0A 4CC4B 2P0LA 3OS2A 2AKKA 2GTJA 4YRQA 1BBWA 4BDZA 4M75E 4RKUE 4PJOG 4L59A 1N8RU 2OTLA 2F5KA 3V7SA 1TG0A 1B3QA 1V29B 5GANd 1YJWQ 2GF7A 4AT1B 4P75C 2VASA 4XTUA 3EG2A 5GANg 3RNJA 8ATCB 2AMCA 2L3RA 2OI3A 5LJ3e 4JPBW 3OYEA 4H2XA 3L2ZA 2KAFA 4PL6A 3G6EQ 1QE0A 5CIUA 3GBQA 3OYKA 3LC0A 4FW2A 1CSKA 1VQ8T 3KBGA 4RTWA 1YNZA 4CH4A 3QZ5B 3OYMA 1K73U 3VQWA 1G3SA 1HSQA 1YHQT 4BWAA 4IUPA 2DD4A 1ZSZA 3HRSA 1JO8A 4DQ2A 1WJSA 1PRLC 3FDRA 3VUBA 1WJQA 2ROLA 3M55A 3CCET 1IO6A 3JCMP 4PLLA 3HTRA 3IKMB 1PG5B 3NMZC 1QCNA 2DE0X 4RTYA 4J9GA 1UTIA 3M54A 4BE0A 5IHKA 1K73C 4DPGA 4C92D 2I0NA 4LE9A 3CPWS 1YJWT 1B70B 3IKLA 2PMFA 4ELYC 1UB4A 4BI4A 4C5HA 1TU0B 2CIMA 3W3SA 4C0DB 3CCLQ 3JB9G 1WHLA 4YCVA 3UATA 4LVLA 3H9NA 4HKEA 2P0KA 2JMAA 2AMCB 1I8FA 4Z88A 2DNUA 4H2XB 3RL6A 3G6ET 2ZT6A 11ASA 5IAYA 4TVRA 4QQGA 4MZMA 1N8RR 1TSFA 4WTOB 3SEMA 3MEUA 2ZCEA 5GAOm 1HC7A 4OVAA 4PJOA 4JS4A 3HXYA 1ZSZB 2YSQA 2DVEA 5LJ5g 3SDZA 3CC4Q 4HVWA 1M90C 1SESA 3FJ5A 1YCSB 1FMWA 4P72A 4HA8A 1UJ0A 2FHDA 1PCXA 2MWPA 3BJUA 4CC2A 3HY0A 4FYVB 1G3TA 3RKYA 2DILA 1X27A 1SSHA 3PNWC 4HT4A 4BY6C 4EMKB 2E10A 4KRTA 4M78A 1VQ4A 2KK4A 4AG1C 2QHVA 2QQSA 3X28B 4KT0E 4HWOA 3MP1A 3ZL7C 3UFGA 4M77A 4YTLA 1I0CA 2BIVA 2XK0A 2ZPFB 2OTLQ 3URGA 4AFQC 4IUVA 2LCCA 1VQZA 3WXMB 3H41A 2MOXA 2AKLA 4XTXA 2RHYA 1AZGB 1M1GA 2PVOB 1PSFA 1QP2A 3RERA 1JJCA 2O9VA 1A0NB 2C0IA 2DF6A 1NYGA 2QHTA 3A7UA 1AWJA 2D6FA 2K4YA 3QJYA 2EL9A 3CC4T 4BW9A 2HQEA 3RDVA 2LDMA 4EMHA 4JRPA 3VS4A 3VUZA 4E7ZA 1ZA2B 3NENA 5J3BA 2ZNIA 4P71C 4IUQA 4R0KA 4H2TA 2ZTGA 2L89A 1CKBA 4RQEA 1WFWA 4M78B 3UDCA 4ZTFA 1M2VA 3R6NA 5K1PA 3LWIA 2DFUA 2OTLT 4B9XA 1SKUB 1VOMA 3LSQA 2YT6A 3JCMV 3OYIA 2EJGA 3JAME 1YBYA 2DJQA 1Q86U 4P73A 3M4QA 3LYIA 4K88A 2DDZA 2O2OA 2QAZA 2ARTA 4BB7A 1H3ZA 1JJCB 2QHUA 3CBOA 4QVDA 5LL6S 1T0JA 2VB6A 4ZGJB 2ABLA 2JTMA 5GAMj 3EG9A 1NPPA 5CKHA 2ZPHB 3I7FA 3MHXA 1G5VA 4AFZC 5CAIA 4TWAA 3JCMb 5CQYA 3A98A 4J83A 1Q86C 3DB3A 4YRRA 4WJ4A 4LVJA 3PIPA 2KNBB 1S1NA 3C95A 4KQEA 5GAOn 4M7DA 2CGHA 1K8AU 5GAMg 1WU7A 2R57A 1ADJA 5ELNA 2V1RA 2Y90A 2D8HA 4IIMA 4G84A 4QT7A 3E19A 2EFIA 1NZ9A 3N5BB 3VS2A 2HBWA 2DXTA 1RL2A 4A4EA 1VQ4Q 2QK0A 2ZR2A 1BU1A 1TUGB 1QVPA 2P0PA 1EVLA 5CQXA 1BCOA 1OV3A 1BBZA 2X4WA 1K8AC 4H2WA 1NG2A 2RJFA 4F14A 1VQKA 1LPLA 1RACB 4JJNK 2ZT5A 1R77A 2VYTA 3HKSA 1WQ7A 1HTTA 2CH4A 2OTJA 2JW4A 3OQ5A 2XKOC 1K9MC 1X43A 4J9CA 1VA7A 2NUTA 3H6ZA 4M7DB 4PJMA 3A8HB 4QVZA 4F04B 5KYXA 2CS7A 4M7AA 5C51B 4OF1A 4CI0C 5GMKj 2ZPGB 4A53A 5LJ3d 2M51A 2DXBA 2YUPA 2I4OA 4OMPA 5CVIA 5I2MA 1VQ4T 1M1KU 2DVJA 2KT1A 4NCXA 2C8MA 1Q81R 2YRCA 4H2VA 2Q5HA 2FRWA 3NETA 4BE2A 1YGBA 2ED0A 1NEBA 1WJRA 4ZTZB 1FYFA 2ZCFB 3NTKA 1XOVA 5FU6B 2V1QA 1EIYB 4MZTA 1D3BA 3CCSA 2YUOA 4PFPA 1U1SA 1W70A 2DYIA 3PVLA 1KSWA 1M1KC 3MEYA 5FROA 3MO8A 4OMMA 4J6WA 5A0DA 2ZPEB 1VQNA 1M4ZA 2XU8A 3SWNB 2RHUA 3JB9D 2EGAA 3V8KA 4FYWB 2YLCA 3OBYA 2A36A 1NNHA 2XICA 3OA6A 3BDLA 3V7CA 5GANe 4FSSA 2O9SA 2X51A 3CC7T 4KBMB 2MAMA 1RI9A 3CBMA 2V26A 4KULA 4CS4A 4JRIA 3PMTA 5KYYB 2ODRD 2E3IA 3A32A 1MMNA 3G7ZA 4C0ZA 4X1VA 1QVGS 5GAN6 3RESA 4HVUA 3REAB 3BE3A 4J9EA 4HWPA 3G4SA 1IHWA 1X55A 2JNGA 2MPXC 4A4HA 2QA4A 2XI9A 3QYGB 2J06A 2XTIA 1N5ZA 1D3BB 2DJZA 2C06A 1RABB 3ULRB 1I07A 4N4IA 1V76A 3I5SA 1VQKQ 1OEBA 2RD1A 1BKBA 3IALA 2LC4A 1QKXA 3M4YA 2LMJA 2LP5A 2OTJQ 1FWZA 2DQ0A 3DSQA 4UPAA 3SD4A 5I21A 1VQPA 3HTZA 3RACA 4CH3A 5HK0A 2DL8A 2FRYA 4RTZA 4BACA 1ZLMA 1M3AA 4BUGA 5CKEA 1NJ1A 1RAEB 2VXFA 4P5NA 1M5Q1 1X01A 5LJ5e 1ABOA 1YJNT 2HEQA 4J15A 2RM4A 2RQRA 2VVKA 3C4SA 2LRQA 1VQ5T 1YN8A 4OGCA 3QSUA 1NLOC 3BFMA 4A4KA 3NEMA 1UEBA 3M56A 2CT3A 3A8GB 1M27C 4GLKA 3M59A 2FL7A 3A5ZA 5FU7B 1VQKT 2FG0A 4C5IA 3CCSQ 3P8HA 3PT9A 1M8MA 1LCKA 1AWWA 4RCCA 1IGQA 3QO8A 1UHCA 1OX8A 2B86A 1VQNQ 3HRTA 1ZA1B 2MF2A 1B34A 2CP7A 4C8QC 1YHQA 4OMNA 3CCMA 3VQYA 4P74C 2K9GA 4ELZC 2KEAA 2LVMA 3E9IA 2KRMA 4X34A 3E9GA 3DLLA 2LX9A 2DLPA 1OPLA 1USYC 2G6FX 4C8QG 5GMKm 1H4VB 1IREB 4ZIBA 3JCMf 2VKNA 1HXDA 3TEHA 4TQFA 2E5KA 5KYWA 2KQWA 5GAOl 3G4SQ 2OAUA 2EQKA 2IIMA 3P8VA 2GBQA 1VYUA 3P8TA 4H2SA 1WHGA 4M78F 4FIBA 2QA4Q 1LYLA 1U8RA 3CCST 1T3SA 3A5ZB 1EQRA 1NM7A 3OYJA 4HCKA 3TEGA 4ZNXA 1PD0A 4PKCC 2DBMA 4M77F 1ZUUA 3EFOB 3RMSA 2E3HA 4C92A 1VQNT 1EFWA 3TREA 3RKXA 3QDFA 3ERRA 1YJ9A 3HXUA 2KXDA 2M02A 3AHUA 4DEXA 4E7HA 4C0DC 1B34B 3RBBB 4EX5A 3JCMQ 2GQVA 2LTOA 3EH1A 4BI3A 1VQPQ 2KVQG 4JDSA 1VYTA 1O75A 4FW1A 2E1HA 2EW3A 1G3YA 1VQOA 1H641 1DJ7B 3VRYA 1W2BP 3CBPA 1RLPC 2VC8A 1ZSZC 3A8LB 2JN0A 1VQLA 3CCUA 1MNEA 2J6FA 1GGMA 1W1FA 4RMOA 3G4ST 5KYWB 3MPUB 2ZGWA 1MGQA 5IHIA 1LNXA 2QQBA 5KCOA 2QA4T 1WHJA 1EFNA 3M5AA 3PVQA 3JCMh 3IG2A 4FYXB 2B8AA 4EIKA 5I11A 4HCCA 1JJ2A 1K76A 1PHTA 1WA7A 2L8DA 5GAOp 2DMOA 1ARKA 2D1XA 1E22A 3OW2A 4PJNA 2MWOA 4C8QE 2KYBA 3MCAB 3NTIA 3HXXA 1RUWA 4L5GA 2HKNA 2CZ6B 4IIOA 1VQPT 3VQXA 2XDPA 2COYA 2VV5A 2A08A 2RJCA 1JQQA 2COWA 2DL5A 2H3EB 4LDWA 4FYYB 1M3CA 1YHQQ 3OYAA 4JZ4A 3CCMQ 1WZOA 1MV3A 2DKGA 2J3MA 1UJYA 1WXBA 1AOJA 3CCEQ 4EMGA 4DBRA 3VBBA 4N0AA 2JJ9A 1KHIA 3DLMA 1WLEA 4GLMA 2L2PA 3C94A 2YWWA 2HNIA 3A8OB 4M7DF 2HD0A 1GFDA 5KNNA 1MMAA 2EBPA 1XNIA 4P72C 3A74A 1QF6A 1B70A 4RTXA 2GFUA 2AK5A 3L1AA 4FL6A 4JLGA 4ZGDB 5GAMf 4YCWA 1SERA 4M78C 1UFFA 3UPUA 4E7SA 1XTDA 4C5GA 1YWPA 1E1TA 2DL3A 3HPWA 4F7UA 4M77C 4A4FA 1G3WA 2GCXA 2ARUA 1KMNA 1IXDA 2K79A 3E2UA 3OYYA 4M78G 3CCMT 1PWTA 3NPFA 2CDTA 3NELA 3GP8A 4M77G 4N4HA 3QXEB 1H8KA 3M53A 3MQZA 2C0TA 1VQOQ 3QYHB 2RJEA 1FMKA 5L23A 4J7FA 1ZQ1A 1YFSA 4F17A 1NLPC 5FWBA 3M0PA 1S72T 1O9SA 3TCJA 4EMKA 4RQFA 2V8JA 1VQLQ 2JS0A 2PUKB 4J9FA 3CCUQ 2CKKA 3QPHA 4M7AF 1U06A 3FRNA 2ALYA 1H92A 1M90U 2DIQA 2XMFA 2K5LA 1NYFA 2K6DA 1KMMA 3VV0A 1JXMA 4M75B 4NOYA 2QQ9A 2LJ1A 2KR3A 2YXYA 2KE9A 4F7UB 1YJ9T 1AZEA 4O6JA 3CD6A 1NJ2A 2DRMA 2RA2A 4E6RA 5LJ5d 5GAMh 5A0LA 4A54A 2JM9A 3JCMg 2E41A 3QKJA 3PIOA 2ZNJA 4P73C 4JJDA 4C5EA 3ICAA 1H4QA 1K0XA 4LUEA 4PJOE 5GAOq 1D1CA 3INZA 1TUCA 1VQOT 3PGGA 1K73R 1QP3A 2VWFA 4YRPA 1RADB 4TVAA 4XK8E 4B6MA 1TTHB 1VQLT 4OMLA 3JB9J 3CCUT 1H4TA 1G2BA 2A7YA 3REBB 1RAAB 2DTHA 2PMEA 3GLXA 4M7DC 2ALYB 1Z9QA 3UGQA 1GRIA 2M0YA 4YRKA 1KD1U 2KRSA 1AVZC 1H4SA 1M3BA 2YRVA 1KQ1A 1QWEA 1MV0B 4O2DA 4C8QD 4UP8A 1WI7A 3O8VA 4M77E 2P4RA 4CS2A 2F2VA 4M7DG 5DM7R 2FVUA 3CMEA 1Q82U 1Q7YC 2KBTA 4F16A 1YIJA 4LDYA 3NFCA 4Y28E 3HXVA 3OMCA 5FU6C 2M0OA 3NGPA 3A1PA 1KD1C 3L2UA 1NJIC 3WQZA 4L87A 3M58A 1W66A 4FM4B 3F70A 4TVAB 3P8YA 1E6HA 3CC7A 5GMKh 2K3BA 2K57A 3KFUA 3RIRA 2JM8A 4M75D 5IH2A 1WHKA 1Q82C 5DLQE 2PTKA 2FPEA 4KGZB 4JRQA 2DXCA 2ATCB 1QLYA 4UP9A 4KGXB 3OYDA 2NLUA 4M7AC 4YRCA 4RG2A 1ZUYA 2AZVA 2A3LA 1GCQC 4HVVA 3OYGA 1ATIA 4Q6GA 3TU4K 2L3QA 3HRUA 2F69A 3OY9A 4X9CA 2P4TA 3P8DA 3VS1A 1ASZA 2ZPIB 4E47A 2DXUA 2KSSA 4HCBA 2CZ7B 4M7AG 1NYRA 2C0OA 1JJ2P 3CC2T 1WNLA 4ZGEB 3CD6Q 3TUPA 1JU5C 3OW2P 2FYKA 2I4NA 1OI1A 4PJJA 2J7IA 4E7KA 4Q5WA 1G83A 5J26A 2E6ZA 3IQLA 3G1ZA 2EPDA 4X5OA 5GAMd 1C6VX 5GJWB 5CKBA 1AD5A 4XU3A 2JZ2A 2CH4W 1QKWA 4CRIA 3NTHA 2LX7A 1X2GA 2CJAA 4LDVA 3HXWA 3P8BB 3UGTA 3VJPA 1M30A 1WXUA 1WPYA 1KOGA 2FO0A 3JV3A 1YJNA 1R0CB 1QW1A 4LVKA 1K9MU 2A8EA 4LNPA 1X6OA 1R8OB 2YUQA 3OS0A 1ADYA 1VQ5A 3H0IA 2CZ0B 3HFNA 1BBUA 3UT1A 2DETA 3PMIA 4YROA 1B76A 2EKHA 1EIYA 3MEWA 1NJ5A 2YLBA 4KH0B 3CD6T 2BUDA 4G85A 2X4JA 4B9WA 1Q86R 3CMEQ 4PJOD 1H3HA 3M0UA 3GNFB 2DERA 4XEOA 4ZTJA 1Y71A 1K1ZA 4KR2A 1YIJQ 1M2OA 1QWFA 2RK1A 1WIEA 2AHJB 2EGEA 2EKOA 3SWNA 3GOXA 4RG8A 3GF5A 1W2BA 5FU7C 3C0CA 1ACMB 4C92F 1GCPA 3VS6A 4PFOA 4ME7A 1QVFA 4YRLA 1PYSA 2QG9B
chains in the Genus database with same CATH topology
1ZBXA 3CMAA 2MMPA 3PFSA 4V2SA 4M7AE 1NPRA 4Q15A 4BY6B 2P5IA 1G5IA 5LJ3j 1LOJA 4HT8A 4ZTUB 3SB2A 3QO7A 1IZ6A 4NL3A 3CMET 3EFSA 4C0GA 1YIJT 1I4K1 2LCLA 2E5AA 2RI5A 1M8VA 5HGQA 3OYHA 3HY1A 2WACA 1UGPB 3DB4A 3QUIA 1PYSB 4J7IA 3JCMW 3V7RA 4YRFA 3MEVA 3JCMJ 4TTVA 2DU5A 3A7RA 2EJ9A 4DOWA 5AYFA 4MZPA 5IT9E 3PTAA 3OYLA 4XTYA 1WQWA 2RB6A 1YI2A 1KC8U 3S6WA 3C12A 4P3OA 3QG1A 2XDDA 4MMLA 1I5LA 12ASA 1VUBA 5J39A 2Q5IA 2F5TX 2M1HA 2QEXA 1GXIE 3GNGA 2M9UA 3WVEB 1KC8C 3QBYA 2PUOB 3HHTB 1VQ7T 4J8OA 4JRKA 4A4GA 3JCMX 3I56A 4L6V5 4F7UF 4FU6A 1U1TA 4C92C 4OB2B 2HQXA 1JBMA 3CCJA 3KXTA 4UP7A 2I4LA 3JCMe 3G71A 4E7IA 3J7AF 4OB1B 3QDRB 4PLIA 4C92G 4BI8B 4UC4A 5D6YA 1OYXA 4Y91A 1LJOA 5GMKi 3A31A 2X4XA 2DZCA 4XU0A 4HVCA 3R07A 4QQDA 4EPCA 4OB3B 3JB9H 4QVCA 3RKWA 1UGRB 4XAXB 2K3YA 1KQSA 2O4XA 3L2WA 2HBPA 4J6YA 3CMAT 3JB9I 4OMFB 2RI3A 3TEEA 5CK9A 1X75C 2DO3A 3LW5E 1S72A 5CCAA 3L4GB 4YRIA 4WJ3M 1OZ3A 2XIDA 4TQDA 2RO0A 2E6NA 1VIEA 4N0AC 3A5YA 4WI1A 1M9SA 4AH6A 1NJ8A 4XTZA 4BE1A 4MMKA 4XTVA 4CH6A 2QDYB 4H2YA 3S3OA 4C92E 2XGTA 4HWTA 1UGSB 2O4XB 3KUFA 2Q7HA 2G3RA 4N4GA 1BIAA 3FJPA 2BKDN 3X25B 3CPFA 1AHJB 3PZCA 3EFRA 3HL8A 1KG1A 2IY5B 1B8AA 4ATOA 3V8LA 1BYMA 1YI2T 5DY9A 1KQ2A 4F7UG 4VUBA 1IL2A 1YITA 4YP0A 5GAMe 2RI2A 4YCUA 2D0QB 3OSVA 3JB9F 2QEXT 3CXCA 4EMKC 5GAN7 4XTWA 3OS1A 1JB0E 2CJ9A 1ZHIA 4XU1A 5CO7A 3I56T 3OMGA 4DA4A 1N9WA 3VYHB 2QI2A 1JJ2S 3CCJT 2ZR3A 1BI2A 3OW2S 3G71T 1ASYA 5A2QE 2EIFA 3M4GA 3CMQA 3VYGA 1EOVA 2CJBA 2DEQA 2LQKA 5DLOA 2KDSA 5FLXE 2DPPB 2R5MA 4M75A 1P92A 5GANj 4LDXA 5GAN4 1HK9A 5GMKe 3CC2A 3OD1A 2PU9B 4F7UE 2CYZB 2X35A 4C8QB 2WSCE 1W4SA 1B7YA 2I4MA 2RHQB 5EG2A 3OYFA 5GAN8 3VKIA 4X9DA 1VQ9A 2E3CA 3DKMA 4YRJA 2JTFA 1N8RC 1YB3A 3CPWA 4P3NA 4ZN3A 2ZIMA 5K1XA 3M9QA 1L0WA 3QNEA 5KE3A 1FX7A 3ER0A 3JCMd 1BIBA 1I81A 4GY5A 4XU2A 3OYBA 4Z02A 5FRMA 4YREA 2RJDA 2MI6A 4P3PA 4IKFA 2ODRC 3HFOA 3T9NA 5LJ5j 1B7YB 2PVGB 1YFRA 2ZZFA 2H3JA 2DK3A 4OGEA 4QQ6A 2EQMA 4YRMA 5LJ3f 4J6XA 2DIGA 4PG3A 3EAEA 4BD3A 1Q7YU 2JUFA 3ASKA 5KH6A 3M57A 2FB7A 3QJ6A 2G4CA 1X54A 1YITT 4M78E 3MP8A 1NJIU 3QHSA 1E1OA 1TH7A 5FRNA 3FEOA 4KUIA 3QTCA 2DQ3A 3UH0A 4JS5A 4P75A 1VQMA 2KY9A 2RH2A 3I55A 2EQUA 3CCLT 1BI0A 2L5QA 2DZ9A 3OYNA 4IUUA 5ELOA 4PJOB 3L42A 3X24B 4FT4A 3SWNC 2O01E 3HFZA 5LJ3h 1G51A 4WF2A 3ZEHA 3REXA 2ZZGA 3GPLA 2EAYA 1NYQA 4O5VA 2PVDB 5HY6A 3ME9A 2Q7GA 3CCQA 1Y7XA 2VGNA 5M9OA 2P0QA 2LNVA 4M77B 3ZBDA 1Z7NA 1RI0A 3LGLA 4LD6A 2LQ8A 4J5YA 4EDUA 4H02A 4NS5A 1VQ7A 3RMQA 5C52B 3RUXA 4IURA 3LX7A 2QQAA 3HSBA 3CCRA 1VQ9T 2RHSA 3X20B 4M7DE 2K5IA 2ZINA 3HFZB 4OLFA 2M16A 2HAXA 2DAQA 2PQWA 2JVVA 1Q81U 3PCOA 1EVKA 2DTOA 2WSEE 4PHCA 1SSFA 1WGSA 3E1SA 5KE2A 3V8JA 3LSSA 4YYEA 2J3LA 2ZZEA 2EJFA 5GMKl 3RGLA 1Q81C 2XG8D 3OYCA 5HKCA 3OS5A 4QW2A 3GIBA 3HXZA 4XEMA 3A7AA 2ZXFA 2AKWA 2RHSB 1Y07A 1SRYA 2R5AA 4YDQA 4P71A 4M78D 3BDUA 4NL2A 2ZT8A 1FXXA 4HWSA 2K3XA 4M77D 2I2LA 2YHTA 1W2BS 3MEAA 3JCMc 3JSCA 2VXEA 2ZZDA 4XQ3A 3M4PA 1QVFS 3PCOB 4EO4A 2XHCA 1VQMT 3QO5A 3VQVA 2EWNA 3HFVA 5LJ3g 3I55T 4K86A 5D6WA 2DU7A 2EYQA 4E7LA 5KCHA 5HK3A 1G5HA 2E70A 2VUBA 2AKWB 4D6WA 5I2SA 2ZPBB 4E7JA 4E51A 4C8QF 3S3MA 1QVGA 3L2RA 1BI1A 2V8KA 2X4YA 1VQ6A 3OB9A 4M7AB 4II1A 3QIIA 2CZ1B 4LVIA 4YRNA 4YRSA 2IG0A 5CKDA 3LGFA 4YRTA 3LLRA 2C7IA 3OSSC 3CCQT 4PNOA 4HT9A 3X26B 4FT2A 4M75F 3WVDB 2E65A 2ARSA 1VIFA 2E5QA 3MP6A 3QO3A 3FIFA 4M7DD 3CCRT 3BW1A 4LVMA 3L2QA 2IVWA 4RMFA 3E9HA 4BDYA 4OP0A 5E3IA 3CCVA 2ZT7A 2KMTA 4HCZA 4YRGA 3L4GA 2NS6A 3MF2A 5GANf 2QQRA 3J81E 5IN1A 5GAN3 4LD9K 2Y4XA 1Y96A 4LNSA 2RHZA 3VU3C 1NJ6A 2RK2A 4CH5A 2D9TA 4K87A 4TVWA 2QXFA 4FSXA 1WYDA 3HP9A 1KHCA 1EIFA 4MDXA 4H2UA 3OBWA 4M7AD 2E12A 2ZIOA 2Y4YA 1RIQA 2LT4A 2QHSA 3BY7A 2R58A 2OTJT 1YCYA 5CR2A 5D6XA 1VQ8A 3Q1JA 2IY5A 4HWRA 1SETA 3R6OA 1X56A 2E64A 4MDWA 3S3NA 3FB9A 1KQSS 1N27A 4PJOF 3CCEA 3L2VA 1J5WA 2DD5A 1XQHA 4DOVA 1Y96B 1Z7MA 3HRKA 1BI3A 1PSEA 5GANh 1UGQB 1N6AA 5LJ5f 3J80E 2GFAA 3META 2QTXA 4JUVA 1YJWA 3FLGA 1NE8A 4M75C 5GAN2 4R56A 2VGMA 2JOYA 4LDUA 3G6EA 4OB0B 2K2VA 1E24A 2K5FA 4M75G 5GAOr 3RF1A 3CEYA 2RHXA 3REUA 4ZN1A 1VQ6T 2RHIA 3SFMA 4KR3A 2Q7EA 3LWHA 3QZ9B 1X2HA 4RCBA 3H8ZA 2DTIA 4IUTA 4JLIA 5C6SA 5A0GA 3ZFJA 3TEHB 3E9FA 2LT1A 4RDXA 1JRIA 3CCLA 4YPFA 1N9SA 5L8RE 1OZ2A 3FC3A 5CKFA 5LJ5h 4C8QA 1N9RA 4CS3A 3CXCS 5GAN5 3LH0A 4P74A 4C92B 2XDBA 3MF1A 2RHQA 1USYA 1YFTA 4TVYA 3A8MB 3CCVT 3HRIA 3CC4A 5C0MA 4C0FA 1C0AA 4KUDK 1MHNA 3UWNA 4R55A 2V8IA 5F5WA 2WSFE 4PJOC 2EQJA 3JRZA 5C53B 1M1FA 2P0LA 2XD0A 3OS2A 4YRQA 1BBWA 4BDZA 4M75E 4RKUE 4PJOG 4L59A 1N8RU 2OTLA 2F5KA 3V7SA 5GANd 1V29B 2GF7A 4P75C 4XTUA 5GANg 2AMCA 2L3RA 5LJ3e 3OYEA 4H2XA 3L2ZA 2KAFA 4PL6A 3LC0A 1QE0A 5CIUA 3OYKA 1VQ8T 3KBGA 4CH4A 3QZ5B 3OYMA 1K73U 3VQWA 1G3SA 1YHQT 4BWAA 4IUPA 2DD4A 3HRSA 4DQ2A 1WJSA 3VUBA 3FDRA 1WJQA 3M55A 3CCET 3JCMP 4PLLA 3IKMB 3M54A 4BE0A 1K73C 4DPGA 4C92D 3CPWS 1YJWT 1B70B 3IKLA 2PMFA 4ELYC 1UB4A 4BI4A 4C5HA 2CIMA 3W3SA 4C0DB 3JB9G 4YCVA 4LVLA 4HKEA 2P0KA 2AMCB 1I8FA 4H2XB 3RL6A 3G6ET 2ZT6A 11ASA 5IAYA 4TVRA 4QQGA 4MZMA 3MEUA 2ZCEA 5GAOm 1HC7A 4OVAA 4PJOA 4JS4A 3HXYA 2DVEA 5LJ5g 3SDZA 1M90C 1SESA 4P72A 4HA8A 2FHDA 2MWPA 3BJUA 3HY0A 3RKYA 1G3TA 3PNWC 4HT4A 4BY6C 4EMKB 2E10A 4M78A 1VQ4A 2KK4A 2QHVA 2QQSA 3X28B 4KT0E 4HWOA 3MP1A 3UFGA 4M77A 4YTLA 2BIVA 2XK0A 2ZPFB 3URGA 4IUVA 2LCCA 1VQZA 3WXMB 4XTXA 2RHYA 1M1GA 2PVOB 1PSFA 1QP2A 3RERA 1JJCA 3A7UA 2QHTA 2D6FA 2K4YA 3QJYA 2EL9A 3CC4T 4BW9A 2HQEA 2LDMA 4EMHA 4JRPA 3VUZA 3NENA 5J3BA 2ZNIA 4P71C 4IUQA 4H2TA 2ZTGA 2L89A 4RQEA 4M78B 3UDCA 4ZTFA 5K1PA 3LWIA 2OTLT 3LSQA 4B9XA 3JCMV 3OYIA 2EJGA 3JAME 1YBYA 1Q86U 4P73A 3M4QA 3LYIA 4K88A 2DDZA 2ARTA 4BB7A 1H3ZA 1JJCB 2QHUA 3CBOA 4QVDA 5LL6S 4ZGJB 2JTMA 5GAMj 1NPPA 5CKHA 2ZPHB 3I7FA 3MHXA 1G5VA 5CAIA 4TWAA 3JCMb 5CQYA 4J83A 1Q86C 3DB3A 4YRRA 4WJ4A 4LVJA 3PIPA 3C95A 4KQEA 5GAOn 4M7DA 2CGHA 1K8AU 5GAMg 1WU7A 2R57A 1ADJA 5ELNA 2Y90A 4G84A 3E19A 2EFIA 1NZ9A 3N5BB 2DXTA 1RL2A 4A4EA 2ZR2A 1QVPA 2P0PA 1EVLA 5CQXA 2X4WA 1K8AC 4H2WA 2RJFA 1VQKA 4JJNK 2ZT5A 2VYTA 3HKSA 1WQ7A 1HTTA 2OTJA 3OQ5A 2XKOC 1K9MC 3H6ZA 4M7DB 3A8HB 4QVZA 2CS7A 4M7AA 5C51B 4OF1A 4CI0C 5GMKj 2ZPGB 4A53A 5LJ3d 2DXBA 2I4OA 5CVIA 5I2MA 1VQ4T 1M1KU 4NCXA 2C8MA 4H2VA 2Q5HA 3NETA 4BE2A 1YGBA 1WJRA 4ZTZB 1FYFA 2ZCFB 3NTKA 1XOVA 5FU6B 1EIYB 4MZTA 1D3BA 3CCSA 1U1SA 1M1KC 3MEYA 5FROA 3MO8A 4J6WA 5A0DA 2ZPEB 1VQNA 1M4ZA 2XU8A 3SWNB 2RHUA 3JB9D 3V8KA 2YLCA 3OBYA 1NNHA 2XICA 3OA6A 3BDLA 3V7CA 5GANe 3CC7T 2MAMA 4KBMB 3CBMA 4KULA 4CS4A 4JRIA 3PMTA 2ODRD 3A32A 3G7ZA 4C0ZA 1QVGS 5GAN6 3RESA 4HWPA 3G4SA 1X55A 2JNGA 4A4HA 2QA4A 2XI9A 3QYGB 2XTIA 1D3BB 2DJZA 2C06A 4N4IA 2RD1A 1BKBA 3IALA 2LC4A 3M4YA 2DQ0A 3DSQA 1FWZA 4UPAA 3SD4A 5I21A 1VQPA 3HTZA 3RACA 4CH3A 5HK0A 4BACA 4BUGA 5CKEA 1NJ1A 2VXFA 4P5NA 1M5Q1 1X01A 5LJ5e 1YJNT 4J15A 2RM4A 3C4SA 2LRQA 1VQ5T 4OGCA 3QSUA 3BFMA 4A4KA 3NEMA 1UEBA 3M56A 3A8GB 4GLKA 3M59A 2FL7A 3A5ZA 5FU7B 1VQKT 4C5IA 3P8HA 3PT9A 4RCCA 3QO8A 3HRTA 2MF2A 1B34A 4C8QC 1YHQA 3CCMA 3VQYA 4P74C 4ELZC 2LVMA 3E9IA 4X34A 3E9GA 3DLLA 2LX9A 1USYC 4C8QG 5GMKm 1H4VB 1IREB 4ZIBA 3JCMf 1HXDA 3TEHA 4TQFA 2KQWA 5GAOl 2OAUA 2EQKA 3P8VA 3P8TA 4H2SA 4M78F 4FIBA 1LYLA 1U8RA 3CCST 3A5ZB 1EQRA 3OYJA 3TEGA 4PKCC 4M77F 3RMSA 4C92A 1VQNT 1EFWA 3TREA 3RKXA 3ERRA 1YJ9A 3HXUA 3AHUA 4E7HA 4C0DC 1B34B 4EX5A 3JCMQ 2GQVA 2LTOA 4BI3A 2KVQG 4JDSA 1O75A 2E1HA 1G3YA 1VQOA 1H641 1DJ7B 3CBPA 2VC8A 3A8LB 2JN0A 1VQLA 3CCUA 1GGMA 4RMOA 3G4ST 2ZGWA 1MGQA 1LNXA 2QQBA 5KCOA 2QA4T 3M5AA 3JCMh 3IG2A 4HCCA 2B8AA 1JJ2A 2L8DA 5GAOp 1E22A 3OW2A 2MWOA 4C8QE 3MCAB 3NTIA 3HXXA 4L5GA 2CZ6B 1VQPT 3VQXA 2XDPA 2VV5A 2RJCA 4LDWA 3OYAA 2J3MA 2DKGA 4EMGA 3VBBA 4N0AA 1KHIA 3DLMA 1WLEA 3C94A 2HNIA 3A8OB 4M7DF 2HD0A 5KNNA 1XNIA 4P72C 3A74A 1QF6A 1B70A 2GFUA 3L1AA 4FL6A 4JLGA 4ZGDB 5GAMf 4YCWA 1SERA 4M78C 3UPUA 1XTDA 4C5GA 1E1TA 3HPWA 4F7UA 4M77C 4A4FA 1G3WA 2GCXA 2ARUA 1KMNA 3OYYA 4M78G 3CCMT 3NELA 3GP8A 4M77G 4N4HA 3QXEB 3M53A 3MQZA 3QYHB 2RJEA 4J7FA 1ZQ1A 1YFSA 1S72T 1O9SA 3TCJA 4EMKA 4RQFA 2V8JA 2PUKB 2CKKA 3QPHA 4M7AF 3FRNA 2ALYA 1M90U 2DIQA 2K5LA 1KMMA 3VV0A 4M75B 4NOYA 2QQ9A 4F7UB 1YJ9T 4O6JA 3CD6A 1NJ2A 2RA2A 5LJ5d 5GAMh 5A0LA 4A54A 3JCMg 2E41A 3QKJA 3PIOA 2ZNJA 4P73C 4C5EA 3ICAA 1H4QA 4PJOE 5GAOq 3INZA 1VQOT 3PGGA 1QP3A 4YRPA 4TVAA 4XK8E 1VQLT 3JB9J 3CCUT 1H4TA 2A7YA 2DTHA 2PMEA 3GLXA 4M7DC 2ALYB 3UGQA 4YRKA 1KD1U 1H4SA 2YRVA 1KQ1A 4O2DA 4C8QD 4UP8A 3O8VA 4M77E 4CS2A 4M7DG 5DM7R 2FVUA 3CMEA 1Q82U 1Q7YC 1YIJA 4LDYA 3NFCA 4Y28E 3HXVA 3OMCA 5FU6C 2M0OA 1KD1C 3L2UA 1NJIC 3WQZA 4L87A 3M58A 1W66A 4FM4B 3F70A 4TVAB 3P8YA 3CC7A 5GMKh 2K57A 3KFUA 3RIRA 4M75D 1Q82C 5DLQE 4JRQA 2DXCA 4UP9A 3OYDA 2NLUA 4M7AC 4YRCA 4RG2A 2A3LA 3OYGA 1ATIA 4Q6GA 3TU4K 3HRUA 2F69A 3OY9A 4X9CA 2P4TA 3P8DA 1ASZA 2ZPIB 4E47A 1NYRA 2DXUA 2KSSA 2CZ7B 4HCBA 4M7AG 3CC2T 1WNLA 4ZGEB 3TUPA 2FYKA 2I4NA 1OI1A 4E7KA 4Q5WA 5J26A 2E6ZA 3G1ZA 4X5OA 5GAMd 5CKBA 4XU3A 2JZ2A 4CRIA 3NTHA 1X2GA 2CJAA 4LDVA 3HXWA 3P8BB 3UGTA 3VJPA 1WPYA 1KOGA 1YJNA 1QW1A 4LVKA 1K9MU 2A8EA 1X6OA 1R8OB 3OS0A 1ADYA 1VQ5A 2CZ0B 3HFNA 1BBUA 3UT1A 3PMIA 4YROA 1B76A 1EIYA 3MEWA 1NJ5A 2YLBA 3CD6T 2BUDA 4G85A 2X4JA 4B9WA 4PJOD 3GNFB 4XEOA 4ZTJA 1Y71A 4KR2A 2EKOA 2AHJB 2RK1A 3SWNA 3GOXA 4RG8A 3GF5A 1W2BA 5FU7C 4C92F 1QVFA 4ME7A 4YRLA 1PYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C0A A;  3A5Z A;  4V2S A;  4M7A E;  4Q15 A;  5F5W A;  2P5I A;  2DZ9 A;  4PJO C;  1G5I A;  5LJ3 j;  5C53 B;  4RCC A;  3QO8 A;  1LOJ A;  4HT8 A;  2P0L A;  5ELO A;  4C8Q C;  1B34 A;  4YRQ A;  1BBW A;  4ZTU B;  4PJO B;  3SB2 A;  4M75 E;  3QO7 A;  3VQY A;  3SWN C;  4P74 C;  4NL3 A;  4PJO G;  3EFS A;  3E9I A;  3V7S A;  3HFZ A;  5GAN d;  4P75 C;  1I4K 1;  1USY C;  5LJ3 h;  1G51 A;  2E5A A;  4XTU A;  5GAN g;  4C8Q G;  4WF2 A;  5GMK m;  1H4V B;  2AMC A;  1M8V A;  5HGQ A;  5LJ3 e;  4H2X A;  3REX A;  4ZIB A;  3JCM f;  1HXD A;  3L2Z A;  3TEH A;  3HY1 A;  3LC0 A;  4TQF A;  1QE0 A;  2ZZG A;  2EAY A;  1NYQ A;  4CH4 A;  5GAO l;  3VQW A;  3QUI A;  1PYS B;  4BWA A;  3P8V A;  3JCM W;  3V7R A;  4DQ2 A;  2Q7G A;  3P8T A;  4YRF A;  4H2S A;  4M78 F;  3JCM J;  1LYL A;  4TTV A;  2DU5 A;  3A7R A;  2EJ9 A;  4M77 B;  1EQR A;  1Z7N A;  3JCM P;  3TEG A;  3IKM B;  4M77 F;  4J5Y A;  4XTY A;  1WQW A;  2RB6 A;  4H02 A;  4C92 A;  1EFW A;  3RKX A;  5C52 B;  3ERR A;  3HXU A;  4P3O A;  3AHU A;  3RUX A;  1B34 B;  4EX5 A;  3JCM Q;  4DPG A;  4MML A;  4C92 D;  1I5L A;  3HSB A;  12AS A;  2RHS A;  4M7D E;  1B70 B;  3IKL A;  2PMF A;  2Q5I A;  2E1H A;  2ZIN A;  3HFZ B;  4OLF A;  1H64 1;  2CIM A;  3W3S A;  3JB9 G;  4YCV A;  2AMC B;  1I8F A;  2VC8 A;  4H2X B;  3RL6 A;  2ZT6 A;  11AS A;  2JN0 A;  1GGM A;  4JRK A;  2ZCE A;  3JCM X;  3PCO A;  5GAO m;  1HC7 A;  2ZGW A;  1MGQ A;  4PJO A;  1LNX A;  1EVK A;  4F7U F;  2DTO A;  3HXY A;  4PHC A;  1U1T A;  4C92 C;  2DVE A;  5LJ5 g;  3JCM h;  1JBM A;  3IG2 A;  4UP7 A;  2I4L A;  1SES A;  3V8J A;  3JCM e;  3LSS A;  5GAO p;  4YYE A;  2J3L A;  2ZZE A;  2EJF A;  5GMK l;  1E22 A;  4P72 A;  3RGL A;  4HA8 A;  4C8Q E;  3BJU A;  3HY0 A;  3RKY A;  4C92 G;  3HXX A;  3GIB A;  3HXZ A;  4EMK B;  3VQX A;  2E10 A;  4XEM A;  4M78 A;  3A7A A;  2ZXF A;  4Y91 A;  2AKW A;  2RHS B;  2QHV A;  1LJO A;  1SRY A;  5GMK i;  3A31 A;  4HWO A;  4YDQ A;  4P71 A;  3UFG A;  4M77 A;  2DZC A;  4M78 D;  2J3M A;  2DKG A;  3BDU A;  4NL2 A;  4XU0 A;  2ZT8 A;  4HVC A;  3R07 A;  4EMG A;  4HWS A;  3VBB A;  1VQZ A;  4M77 D;  4N0A A;  2I2L A;  2YHT A;  3JB9 H;  4QVC A;  1WLE A;  4XTX A;  3JCM c;  2VXE A;  3RKW A;  4XQ3 A;  3M4P A;  1JJC A;  3RER A;  2HNI A;  4M7D F;  3PCO B;  4EO4 A;  3A7U A;  2QHT A;  5KNN A;  4P72 C;  3A74 A;  1QF6 A;  2EL9 A;  1B70 A;  3QO5 A;  3VQV A;  2EWN A;  3L1A A;  3HFV A;  5LJ3 g;  4BW9 A;  4J6Y A;  4K86 A;  3JB9 I;  4EMH A;  2DU7 A;  5GAM f;  4YCW A;  1SER A;  4M78 C;  3NEN A;  1E1T A;  2ZNI A;  4P71 C;  4F7U A;  4M77 C;  4H2T A;  2ZTG A;  2ARU A;  4RQE A;  3L4G B;  4YRI A;  4WJ3 M;  1KMN A;  4M78 B;  1G5H A;  4TQD A;  4M78 G;  2AKW B;  4N0A C;  3A5Y A;  4WI1 A;  3NEL A;  5K1P A;  3LSQ A;  4AH6 A;  1NJ8 A;  4E51 A;  4C8Q F;  4M77 G;  3JCM V;  4XTZ A;  2EJG A;  4P73 A;  3M4Q A;  4K88 A;  4MMK A;  4XTV A;  2DDZ A;  4CH6 A;  1YFS A;  2ART A;  4H2Y A;  4M7A B;  1JJC B;  4EMK A;  4C92 E;  4QVD A;  2QHU A;  4RQF A;  4YRN A;  4YRS A;  2XGT A;  4HWT A;  4M7A F;  4YRT A;  5GAM j;  2ALY A;  2C7I A;  2Q7H A;  3I7F A;  4PNO A;  1BIA A;  3FJP A;  5CAI A;  3JCM b;  4TWA A;  1KMM A;  3PZC A;  4HT9 A;  4YRR A;  4M75 B;  4NOY A;  3EFR A;  4WJ4 A;  2IY5 B;  1B8A A;  4KQE A;  3V8L A;  5GAO n;  4M7D A;  2CGH A;  5GAM g;  4M75 F;  5DY9 A;  2E65 A;  4F7U B;  1WU7 A;  1ADJ A;  2ARS A;  5ELN A;  1KQ2 A;  2Y90 A;  1NJ2 A;  2RA2 A;  3QO3 A;  4F7U G;  4G84 A;  5LJ5 d;  5GAM h;  3FIF A;  3JCM g;  4A54 A;  2E41 A;  4M7D D;  1IL2 A;  2ZNJ A;  4P73 C;  4YP0 A;  5GAM e;  3ICA A;  2DXT A;  1H4Q A;  3BW1 A;  2ZR2 A;  4YCU A;  4PJO E;  5GAO q;  3INZ A;  3JB9 F;  1EVL A;  4EMK C;  3PGG A;  5GAN 7;  4YRP A;  4RMF A;  4TVA A;  3E9H A;  4XTW A;  4OP0 A;  5E3I A;  2ZT7 A;  4H2W A;  3JB9 J;  1H4T A;  4YRG A;  2CJ9 A;  3L4G A;  3MF2 A;  5GAN f;  4XU1 A;  2ZT5 A;  1N9W A;  2DTH A;  5GAN 3;  4M7D C;  2ALY B;  1WQ7 A;  2PME A;  3UGQ A;  1HTT A;  4YRK A;  2ZR3 A;  1Y96 A;  1H4S A;  4LNS A;  1KQ1 A;  4O2D A;  4C8Q D;  4UP8 A;  4M77 E;  3VU3 C;  1NJ6 A;  1ASY A;  4CH5 A;  4M7D B;  4K87 A;  3M4G A;  4TVW A;  4CS2 A;  3CMQ A;  4M7D G;  1WYD A;  4M7A A;  5C51 B;  5GMK j;  4A53 A;  5LJ3 d;  4H2U A;  2I4O A;  1EOV A;  2CJB A;  2DEQ A;  3HXV A;  4NCX A;  4M7A D;  2C8M A;  2ZIO A;  1RIQ A;  2QHS A;  4H2V A;  3BY7 A;  2Q5H A;  1YCY A;  3WQZ A;  3NET A;  4L87 A;  1W66 A;  4M75 A;  1YGB A;  4TVA B;  3P8Y A;  2IY5 A;  4HWR A;  4ZTZ B;  1FYF A;  1SET A;  5GMK h;  1X56 A;  5GAN j;  2E64 A;  2K57 A;  3KFU A;  3RIR A;  5GAN 4;  1EIY B;  1HK9 A;  4M75 D;  5GMK e;  1D3B A;  3OD1 A;  3FB9 A;  1U1S A;  4PJO F;  4F7U E;  1J5W A;  3MEY A;  4C8Q B;  4J6W A;  4UP9 A;  1Y96 B;  4M7A C;  4YRC A;  3SWN B;  1Z7M A;  3JB9 D;  3HRK A;  1B7Y A;  3V8K A;  2I4M A;  5GAN h;  2RHQ B;  1ATI A;  2YLC A;  4Q6G A;  1NNH A;  5LJ5 f;  5GAN 8;  3V7C A;  5GAN e;  4X9D A;  4X9C A;  2E3C A;  2QTX A;  4JUV A;  1ASZ A;  4YRJ A;  4CS4 A;  4JRI A;  1YB3 A;  2DXU A;  4M7A G;  1NYR A;  2ODR D;  4M75 C;  4P3N A;  5GAN 2;  1WNL A;  2ZIM A;  3A32 A;  3TUP A;  5K1X A;  2FYK A;  2I4N A;  1L0W A;  5GAN 6;  3RES A;  1E24 A;  4HWP A;  3G1Z A;  4X5O A;  3QNE A;  5GAM d;  1X55 A;  4M75 G;  4XU3 A;  5GAO r;  3JCM d;  1BIB A;  3RF1 A;  1X2G A;  1I81 A;  2CJA A;  4XU2 A;  3REU A;  2XTI A;  3HXW A;  2DJZ A;  1D3B B;  4YRE A;  3UGT A;  4KR3 A;  2Q7E A;  4P3P A;  1WPY A;  1X2H A;  2ODR C;  1KOG A;  3HFO A;  4RCB A;  2RD1 A;  5LJ5 j;  3IAL A;  2DTI A;  4JLI A;  1B7Y B;  1YFR A;  2ZZF A;  2DQ0 A;  3DSQ A;  4UPA A;  1ADY A;  3TEH B;  5I21 A;  3HTZ A;  4CH3 A;  3RAC A;  3HFN A;  1BBU A;  4YRM A;  5LJ3 f;  4J6X A;  4YRO A;  1B76 A;  1EIY A;  4RDX A;  1JRI A;  4PG3 A;  1NJ5 A;  2YLB A;  4YPF A;  4G85 A;  1N9S A;  2FB7 A;  4PJO D;  1NJ1 A;  5LJ5 h;  4C8Q A;  1X54 A;  2G4C A;  4XEO A;  2VXF A;  1N9R A;  4M78 E;  1M5Q 1;  4CS3 A;  4KR2 A;  5GAN 5;  1X01 A;  3QHS A;  5LJ5 e;  3SWN A;  4P74 A;  1E1O A;  4C92 B;  3MF1 A;  1TH7 A;  2RHQ A;  3QTC A;  2DQ3 A;  4J15 A;  2RM4 A;  3UH0 A;  4C92 F;  4P75 A;  1USY A;  1YFT A;  4TVY A;  4YRL A;  3QSU A;  1PYS A;  3BFM A;  3HRI A;  3NEM A; 
#chains in the Genus database with same CATH topology
 3CC7 Q;  1ZBX A;  3CMA A;  1GCQ A;  2MMP A;  5KYY A;  1CKA A;  3PFS A;  4V2S A;  4OMQ A;  4M7A E;  1NPR A;  4Q15 A;  4RTV A;  4BY6 B;  2P5I A;  1WX6 A;  1K8A R;  4AFU C;  1Y0M A;  1G5I A;  5LJ3 j;  1AEY A;  1TS9 A;  1LOJ A;  4HT8 A;  2QDL A;  1PRM C;  1D0X A;  4ZTU B;  1NEG A;  3SB2 A;  3QO7 A;  4LXC A;  1IZ6 A;  4AMC A;  2HDA A;  3LH5 A;  4NL3 A;  2MYS A;  3CME T;  3EFS A;  1K9M R;  2HL5 C;  1YFN A;  4DEY A;  4C0G A;  1YIJ T;  1T3L A;  1I4K 1;  2LCL A;  2E5A A;  2RPN A;  2RI5 A;  1ABQ A;  1M8V A;  5HGQ A;  3OYH A;  2HCK A;  3VS7 A;  1OX9 A;  1KFZ A;  1X2K A;  4J9B A;  2WAC A;  3HY1 A;  3I35 A;  1WHM A;  2KRO A;  1UGP B;  3DB4 A;  3QUI A;  1PYS B;  2MCN A;  4J7I A;  3JCM W;  2KRN A;  3V7R A;  4YRF A;  3MEV A;  1SRL A;  3JCM J;  4TTV A;  2DU5 A;  3A7R A;  2EJ9 A;  2HMA A;  4DOW A;  1MMD A;  1VYV A;  5AYF A;  4MZP A;  5IT9 E;  3PTA A;  3OYL A;  2RQV A;  4XTY A;  1WQW A;  2RB6 A;  2KGT A;  2EYZ A;  1YI2 A;  1KC8 U;  3S6W A;  3C12 A;  1YJN Q;  4P3O A;  3QG1 A;  1M1K R;  2NWM A;  2XDD A;  2YUN A;  4MML A;  1I5L A;  2H8H A;  1VQ5 Q;  12AS A;  1VUB A;  5J39 A;  2Q5I A;  2F5T X;  2M1H A;  2QEX A;  1UG1 A;  2NYS A;  1GXI E;  1PC0 A;  3GNG A;  2M9U A;  3MJX A;  3WVE B;  1KC8 C;  3QBY A;  2PUO B;  3HHT B;  2DEU A;  1VQ7 T;  4J8O A;  4JRK A;  4A4G A;  2AZS A;  2CUD A;  4J9H A;  3TSW A;  3JCM X;  3I56 A;  1WLP B;  4L6V 5;  4F7U F;  4FU6 A;  2A28 A;  1U1T A;  4C92 C;  4OB2 B;  2HQX A;  1JBM A;  3CCJ A;  3KXT A;  4UP7 A;  2I4L A;  3JCM e;  7AT1 B;  3CMA Q;  3M0Q A;  1QMC A;  3G71 A;  1SHG A;  4E7I A;  3J7A F;  4OB1 B;  3QDR B;  2DBK A;  4PLI A;  2P84 A;  4C92 G;  1KK7 A;  5IXF A;  4BI8 B;  4UC4 A;  5D6Y A;  4A63 B;  2D8J A;  1UDL A;  1OYX A;  1UUE A;  1WHH A;  4Y91 A;  1LJO A;  5GMK i;  2YDL A;  3A31 A;  1TUD A;  2X4X A;  2DZC A;  3AT1 B;  1QQJ A;  4XU0 A;  4HVC A;  3R07 A;  3EFO A;  4QQD A;  1QCO A;  4EPC A;  4OB3 B;  3JB9 H;  4QVC A;  3RKW A;  1UGR B;  3SHW A;  3G1J A;  4XAX B;  3EG3 A;  2K3Y A;  4D8D A;  1KQS A;  2O4X A;  3L2W A;  2HBP A;  4J6Y A;  1BK2 A;  1X6G A;  3JB9 I;  3CMA T;  4OMF B;  9ATC B;  2AT1 B;  2RI3 A;  3TEE A;  5CK9 A;  1X75 C;  2DO3 A;  3EG0 A;  3LW5 E;  1R0B G;  3EHQ A;  1S72 A;  1PM3 A;  1YI2 Q;  5CCA A;  1K4U S;  2EVR A;  3L4G B;  4YRI A;  4WJ3 M;  1D1B A;  2COZ A;  1OZ3 A;  2XID A;  5KYN A;  4TQD A;  2RO0 A;  2E6N A;  1VIE A;  4N0A C;  3TVT A;  3A5Y A;  4WI1 A;  1M9S A;  2JXB A;  4AH6 A;  1EX4 A;  1NJ8 A;  2OAW A;  4XTZ A;  4KH1 B;  2QEX Q;  2CUB A;  3EG1 A;  1HYO A;  4BE1 A;  4MMK A;  3UF4 A;  4XTV A;  4CH6 A;  2QDY B;  4DBF A;  4H2Y A;  1GFC A;  3D7S B;  3S3O A;  4C92 E;  2XGT A;  4HWT A;  1UGS B;  3M0R A;  3EGX A;  2O4X B;  3KUF A;  3VS3 A;  3I56 Q;  4RUG A;  2Q7H A;  2LQN A;  2G3R A;  4N4G A;  1BIA A;  3FJP A;  2BKD N;  3X25 B;  3CPF A;  1AHJ B;  3PZC A;  3CCJ Q;  5ECA A;  1UHF A;  3EFR A;  2ZAE A;  2CRE A;  3HL8 A;  1KG1 A;  2IY5 B;  1B8A A;  4ATO A;  2KXC A;  3V8L A;  1QVF P;  1BYM A;  3G71 Q;  1YI2 T;  5DY9 A;  1KQ2 A;  4F7U G;  4VUB A;  1WXT A;  1IL2 A;  2DL7 A;  1YIT A;  1C1A A;  2EGC A;  4YP0 A;  5GAM e;  2RI2 A;  1IHV A;  4YCU A;  2D0Q B;  3OSV A;  1SPK A;  3JB9 F;  2QEX T;  2QTV A;  3CXC A;  4EMK C;  2CP5 A;  5GAN 7;  4XTW A;  3OS1 A;  1JB0 E;  3NHN A;  3QWY A;  2CJ9 A;  2FZG B;  1ZHI A;  3QWX X;  4XU1 A;  1TWB A;  5CO7 A;  3OMG A;  3I56 T;  4DA4 A;  1X6B A;  3EGX B;  3RR6 A;  1N9W A;  1XJW B;  3VYH B;  2QI2 A;  2CP0 A;  1JJ2 S;  3CCJ T;  2ZR3 A;  3UA7 A;  1BI2 A;  3OW2 S;  3G71 T;  1ASY A;  2J6K A;  5A2Q E;  2EIF A;  1WYX A;  3M4G A;  2YRD A;  3CMQ A;  3VYG A;  1I1J A;  1S72 Q;  1EOV A;  3TSZ A;  2CJB A;  2DEQ A;  2LQK A;  2ROT A;  5DLO A;  4Y92 A;  2D0N A;  2KDS A;  5FLX E;  2DPP B;  2RQW A;  2R5M A;  4M75 A;  1P92 A;  2GQI A;  1BCM A;  5GAN j;  4LDX A;  5GAN 4;  1HK9 A;  1OQK A;  4JJB A;  5GMK e;  3O5Z A;  3CC2 A;  3OD1 A;  2PU9 B;  1YJ9 Q;  4F7U E;  3I9Q A;  2CYZ B;  2X35 A;  4C8Q B;  4LN2 A;  4QKU A;  3VS0 A;  2WSC E;  2LQW A;  2W0Z A;  2L0A A;  1W4S A;  1B7Y A;  2I4M A;  2RHQ B;  5EG2 A;  2RMO A;  3OYF A;  5GAN 8;  3VKI A;  4X9D A;  1VQ9 A;  4J9I A;  2E3C A;  3DKM A;  4YRJ A;  2JTF A;  1N8R C;  1YB3 A;  3CPW A;  4P3N A;  4ZN3 A;  8AT1 B;  2ZIM A;  1HJD A;  5K1X A;  1SEM A;  3M9Q A;  1YIT Q;  3CQT A;  1L0W A;  1WDX A;  4GBQ A;  2CT4 A;  4CC7 A;  3QNE A;  5KE3 A;  1UEC A;  1FX7 A;  1X2Q A;  3ER0 A;  3JCM d;  1BIB A;  2NUP A;  5AT1 B;  1I81 A;  1ZUK A;  4GY5 A;  4XU2 A;  3EGU A;  4Z02 A;  3EH2 A;  3OYB A;  5FRM A;  4YRE A;  2RJD A;  2MI6 A;  4P3P A;  4IKF A;  3EGD A;  2ODR C;  1OOT A;  1SHF A;  3HFO A;  5EC7 A;  2DM1 A;  3T9N A;  4LUD A;  5LJ5 j;  1B7Y B;  2PVG B;  1YFR A;  2ZZF A;  2H3J A;  2DK3 A;  1B07 A;  4OGE A;  4QQ6 A;  2EYW A;  4K11 A;  2EQM A;  4YRM A;  5LJ3 f;  4J6X A;  2DIG A;  1KQS P;  2KT8 A;  4PG3 A;  2BTT A;  3EAE A;  4BD3 A;  1Q7Y U;  2JUF A;  3ASK A;  5KH6 A;  3M57 A;  2FB7 A;  3QJ6 A;  2G4C A;  1YIT T;  1X54 A;  2X3X D;  4M78 E;  3MP8 A;  2FZC B;  2DYB A;  1NJI U;  3QHS A;  1MND A;  3M0T A;  1E1O A;  1TH7 A;  5FRN A;  3FEO A;  4KUI A;  1RAI B;  4OMO A;  3QTC A;  2DQ3 A;  3UH0 A;  4JS5 A;  4P75 A;  1VQM A;  2NUP B;  2KY9 A;  5FW9 A;  2RH2 A;  1M90 R;  3I55 A;  2EQU A;  4WCI A;  3CCL T;  1BI0 A;  2L5Q A;  3EGD B;  3CC2 Q;  2MIO A;  1YWO A;  2DZ9 A;  4PK4 A;  1HD3 A;  3OYN A;  2LJ3 A;  1GBQ A;  2QAS A;  4IUU A;  2QYZ A;  2LNH B;  2DA9 A;  5ELO A;  2LCS A;  4PJO B;  1QCF A;  3L42 A;  3X24 B;  4FT4 A;  3SWN C;  4DBQ A;  2HL3 A;  1VQ9 Q;  2O01 E;  3HFZ A;  5D7U A;  2LZ6 B;  2O88 A;  1SF9 A;  1PNJ A;  5LJ3 h;  1G51 A;  2FPD A;  4WF2 A;  3ZEH A;  2K7A A;  2KYM A;  3REX A;  1Q7Y R;  2ZZG A;  3GPL A;  2EAY A;  1NYQ A;  4O5V A;  1U5S A;  2PVD B;  2JMC A;  5HY6 A;  3ME9 A;  1D0Y A;  1KD1 R;  1RLQ C;  1NJI R;  2Q7G A;  4CC3 A;  3CCQ A;  2ED1 A;  1Q95 G;  1Y7X A;  2VGN A;  5M9O A;  2P0Q A;  2LNV A;  4M77 B;  3ZBD A;  3CXC P;  1Z7N A;  1MUZ A;  2BE9 B;  1RI0 A;  3LGL A;  4LD6 A;  4J5Y A;  2LQ8 A;  4EDU A;  4H02 A;  4NS5 A;  2HZY A;  1VQ7 A;  1Q82 R;  3RMQ A;  5C52 B;  3RUX A;  5HCK A;  4IUR A;  3LX7 A;  2QQA A;  3HSB A;  2KI7 A;  4AFS C;  2BZ8 A;  2OJ2 A;  3CCR A;  1VQ9 T;  3PE0 A;  3X20 B;  2RHS A;  4M7D E;  2K5I A;  2ZIN A;  1RAH B;  3HFZ B;  4OLF A;  2M16 A;  1JEG A;  2HAX A;  2DAQ A;  2PQW A;  2JVV A;  2E4H A;  1OUL A;  1Q81 U;  2SRC A;  3M0S A;  2PNI A;  3PCO A;  1EVK A;  2DTO A;  2WSE E;  1M2V B;  4PHC A;  1SSF A;  1WGS A;  2RQT A;  1VQM Q;  3E1S A;  2HKQ B;  5KE2 A;  3V8J A;  3LSS A;  3I55 Q;  1PD1 A;  4YYE A;  2DX1 A;  2J3L A;  2ZZE A;  2EJF A;  1FMV A;  5GMK l;  1B7T A;  3RGL A;  1U3O A;  1MMG A;  1Q81 C;  2EQI A;  2XG8 D;  3OYC A;  5HKC A;  3OS5 A;  4QW2 A;  3GIB A;  3HXZ A;  1J3T A;  4XEM A;  2L3P A;  2DRK A;  3A7A A;  2ZXF A;  2AKW A;  2RHS B;  4AG2 C;  1Y07 A;  1SRY A;  1YP5 A;  3EG9 B;  2R5A A;  4YDQ A;  4P71 A;  1UE9 A;  4M78 D;  3BDU A;  4NL2 A;  2ZT8 A;  2F2W A;  1FXX A;  4HWS A;  1I5O B;  2K3X A;  4M77 D;  5IHN A;  2I2L A;  2YHT A;  1W2B S;  3MEA A;  3JCM c;  3JSC A;  2VXE A;  2ZZD A;  4XQ3 A;  3M4P A;  1QVF S;  1FYN A;  3PCO B;  3CPW P;  4EO4 A;  1NBE B;  2XHC A;  1VQM T;  2X3W D;  3UA6 A;  3QO5 A;  3VQV A;  2EWN A;  3HFV A;  5LJ3 g;  3I55 T;  4K86 A;  5D6W A;  1IRX A;  2RNA A;  1EZZ B;  2DU7 A;  3CCQ Q;  1K9A A;  2EYQ A;  4E7L A;  2Z0W A;  2J6O A;  5KCH A;  5HK3 A;  1VQ7 Q;  1IB8 A;  1G5H A;  2E70 A;  2VUB A;  2F2X A;  2AKW B;  2JTE A;  4D6W A;  5I2S A;  2ZPB B;  2GTO A;  4E7J A;  3CCR Q;  4JZ3 A;  3H0F A;  4E51 A;  4C8Q F;  3S3M A;  1QVG A;  4M4Z A;  3L2R A;  1BI1 A;  2V8K A;  2NUT B;  1Z9Z A;  2X4Y A;  5KYX B;  1TOV A;  1OPK A;  1VQ6 A;  3OB9 A;  5KYU A;  4M7A B;  4II1 A;  3QII A;  2CZ1 B;  2ENM A;  4YRN A;  4YRS A;  4LVI A;  2IG0 A;  2J05 A;  5CKD A;  2L3S A;  3LGF A;  4YRT A;  4FCY A;  3LLR A;  1C0M A;  2C7I A;  4PFZ A;  3OSS C;  6AT1 B;  3CCQ T;  4JJC A;  3KFV A;  4PNO A;  2CSI A;  4HT9 A;  3X26 B;  4FT2 A;  1ZSG A;  4M75 F;  3WVD B;  2E65 A;  2ARS A;  1VIF A;  2E5Q A;  3MP6 A;  3QO3 A;  3VRZ A;  3FIF A;  4M7D D;  2SEM A;  4RTU A;  5I22 A;  4RTT A;  3CCR T;  3BW1 A;  2BZX A;  4LVM A;  1OU8 A;  2MK5 A;  1W6X A;  3L2Q A;  2GGR A;  1K0S A;  4D8K A;  2IVW A;  4RMF A;  3E9H A;  4BDY A;  4OP0 A;  2FPF A;  5E3I A;  3CCV A;  2ZT7 A;  1KIK A;  2KMT A;  2PZ1 A;  4HCZ A;  2RF0 A;  5KYU B;  2O31 A;  4YRG A;  3L4G A;  2NS6 A;  3MF2 A;  5GAN f;  2QQR A;  3VS5 A;  3J81 E;  1OU9 A;  1AWO A;  5IN1 A;  5GAN 3;  1KC8 R;  4LD9 K;  2CSQ A;  2Y4X A;  1Y96 A;  1SRM A;  4LNS A;  1X69 A;  1G8X A;  2RHZ A;  3VU3 C;  1NJ6 A;  1SG5 A;  2RK2 A;  4CH5 A;  2D9T A;  4K87 A;  4TVW A;  2QXF A;  4FSX A;  4PJL A;  1WYD A;  2RQU A;  3HP9 A;  1EIF A;  1KHC A;  4MDX A;  2X9H A;  2FEI A;  1UGV A;  4H2U A;  1ZX6 A;  3OBW A;  2QGG A;  4M7A D;  2E12 A;  2ZIO A;  2Y4Y A;  2LJ0 A;  1RIQ A;  3U23 A;  2LT4 A;  2QHS A;  2AIR B;  2R58 A;  3BY7 A;  1AWX A;  2OTJ T;  4ESR A;  1YCY A;  5CR2 A;  5D6X A;  2HSE B;  1VQ8 A;  3Q1J A;  2FZK B;  2IY5 A;  4HWR A;  1SET A;  3R6O A;  1X56 A;  2E64 A;  4MDW A;  2K2M A;  3S3N A;  2A37 A;  3FB9 A;  4Z89 A;  1KQS S;  1N27 A;  1RAF B;  1T0H A;  4PJO F;  3CCE A;  3L2V A;  2JT4 A;  1J5W A;  1VQ6 Q;  2CP6 A;  2DD5 A;  1KJW A;  1XQH A;  1IGU A;  4ORZ A;  4DOV A;  5IXB A;  1E7O A;  1Y96 B;  1Z7M A;  3HRK A;  1BI3 A;  1PSE A;  5GAN h;  4HXJ A;  1UGQ B;  3I5R A;  1N6A A;  5LJ5 f;  1LVK A;  5FWC A;  3J80 E;  2BZY A;  2JS2 A;  2GFA A;  1PKT A;  2CP2 A;  2QTX A;  3MET A;  4JUV A;  1YJW A;  4DBH A;  2BE7 D;  3FLG A;  1NE8 A;  4KGV B;  4M75 C;  5GAN 2;  4R56 A;  3MKD A;  2VGM A;  3THK A;  2JOY A;  1ZBJ A;  4LDU A;  3G6E A;  4OB0 B;  2K2V A;  1E24 A;  5GJV B;  3EHR A;  1D09 B;  2K5F A;  4M75 G;  5GAO r;  2F1L A;  3RF1 A;  1RAG B;  3CEY A;  2RHX A;  3REU A;  4ZN1 A;  1VQ6 T;  3CCV Q;  2RHI A;  4Z8A A;  3SFM A;  4KR3 A;  2Q7E A;  4E2F B;  3LWH A;  2DL4 A;  3QZ9 B;  1Y57 A;  1X2H A;  4RCB A;  2ECZ A;  3H8Z A;  2DTI A;  4IUT A;  4JLI A;  1GL5 A;  1E6G A;  5C6S A;  2A0F B;  5A0G A;  3ZFJ A;  2EYY A;  3TEH B;  2GNC A;  2HSP A;  3TQ7 P;  3E9F A;  2LT1 A;  4RDX A;  1JRI A;  2RN8 A;  3CCL A;  2NUZ A;  4YPF A;  1N9S A;  5L8R E;  1V1C A;  1OZ2 A;  3FC3 A;  5CKF A;  5LJ5 h;  4C8Q A;  1GBR A;  1N9R A;  4CS3 A;  3CXC S;  5GAN 5;  3LH0 A;  1PKS A;  1AT1 B;  4P74 A;  4ANJ A;  4C92 B;  2XDB A;  3MF1 A;  2HQH A;  2RHQ A;  2EYX A;  2W10 A;  1USY A;  1BB9 A;  1YFT A;  4TVY A;  3A8M B;  1VQ8 Q;  3CCV T;  1TXQ A;  2IPO B;  3CC4 A;  3HRI A;  5C0M A;  3H0H A;  4C0F A;  2CP3 A;  2ESW A;  1C0A A;  4KUD K;  2QGF B;  1MHN A;  1F1B B;  3UWN A;  4R55 A;  2V8I A;  1JXO A;  5F5W A;  1QVG P;  1D0Z A;  2WSF E;  1D1A A;  4J9D A;  4PJO C;  2EQJ A;  3JRZ A;  5C53 B;  1M1F A;  2OX7 A;  2XD0 A;  4CC4 B;  2P0L A;  3OS2 A;  2AKK A;  2GTJ A;  4YRQ A;  1BBW A;  4BDZ A;  4M75 E;  4RKU E;  4PJO G;  4L59 A;  1N8R U;  2OTL A;  2F5K A;  3V7S A;  1TG0 A;  1B3Q A;  1V29 B;  5GAN d;  1YJW Q;  2GF7 A;  4AT1 B;  4P75 C;  2VAS A;  4XTU A;  3EG2 A;  5GAN g;  3RNJ A;  8ATC B;  2AMC A;  2L3R A;  2OI3 A;  5LJ3 e;  4JPB W;  3OYE A;  4H2X A;  3L2Z A;  2KAF A;  4PL6 A;  3G6E Q;  1QE0 A;  5CIU A;  3GBQ A;  3OYK A;  3LC0 A;  4FW2 A;  1CSK A;  1VQ8 T;  3KBG A;  4RTW A;  1YNZ A;  4CH4 A;  3QZ5 B;  3OYM A;  1K73 U;  3VQW A;  1G3S A;  1HSQ A;  1YHQ T;  4BWA A;  4IUP A;  2DD4 A;  1ZSZ A;  3HRS A;  1JO8 A;  4DQ2 A;  1WJS A;  1PRL C;  3FDR A;  3VUB A;  1WJQ A;  2ROL A;  3M55 A;  3CCE T;  1IO6 A;  3JCM P;  4PLL A;  3HTR A;  3IKM B;  1PG5 B;  3NMZ C;  1QCN A;  2DE0 X;  4RTY A;  4J9G A;  1UTI A;  3M54 A;  4BE0 A;  5IHK A;  1K73 C;  4DPG A;  4C92 D;  2I0N A;  4LE9 A;  3CPW S;  1YJW T;  1B70 B;  3IKL A;  2PMF A;  4ELY C;  1UB4 A;  4BI4 A;  4C5H A;  1TU0 B;  2CIM A;  3W3S A;  4C0D B;  3CCL Q;  3JB9 G;  1WHL A;  4YCV A;  3UAT A;  4LVL A;  3H9N A;  4HKE A;  2P0K A;  2JMA A;  2AMC B;  1I8F A;  4Z88 A;  2DNU A;  4H2X B;  3RL6 A;  3G6E T;  2ZT6 A;  11AS A;  5IAY A;  4TVR A;  4QQG A;  4MZM A;  1N8R R;  1TSF A;  4WTO B;  3SEM A;  3MEU A;  2ZCE A;  5GAO m;  1HC7 A;  4OVA A;  4PJO A;  4JS4 A;  3HXY A;  1ZSZ B;  2YSQ A;  2DVE A;  5LJ5 g;  3SDZ A;  3CC4 Q;  4HVW A;  1M90 C;  1SES A;  3FJ5 A;  1YCS B;  1FMW A;  4P72 A;  4HA8 A;  1UJ0 A;  2FHD A;  1PCX A;  2MWP A;  3BJU A;  4CC2 A;  3HY0 A;  4FYV B;  1G3T A;  3RKY A;  2DIL A;  1X27 A;  1SSH A;  3PNW C;  4HT4 A;  4BY6 C;  4EMK B;  2E10 A;  4KRT A;  4M78 A;  1VQ4 A;  2KK4 A;  4AG1 C;  2QHV A;  2QQS A;  3X28 B;  4KT0 E;  4HWO A;  3MP1 A;  3ZL7 C;  3UFG A;  4M77 A;  4YTL A;  1I0C A;  2BIV A;  2XK0 A;  2ZPF B;  2OTL Q;  3URG A;  4AFQ C;  4IUV A;  2LCC A;  1VQZ A;  3WXM B;  3H41 A;  2MOX A;  2AKL A;  4XTX A;  2RHY A;  1AZG B;  1M1G A;  2PVO B;  1PSF A;  1QP2 A;  3RER A;  1JJC A;  2O9V A;  1A0N B;  2C0I A;  2DF6 A;  1NYG A;  2QHT A;  3A7U A;  1AWJ A;  2D6F A;  2K4Y A;  3QJY A;  2EL9 A;  3CC4 T;  4BW9 A;  2HQE A;  3RDV A;  2LDM A;  4EMH A;  4JRP A;  3VS4 A;  3VUZ A;  4E7Z A;  1ZA2 B;  3NEN A;  5J3B A;  2ZNI A;  4P71 C;  4IUQ A;  4R0K A;  4H2T A;  2ZTG A;  2L89 A;  1CKB A;  4RQE A;  1WFW A;  4M78 B;  3UDC A;  4ZTF A;  1M2V A;  3R6N A;  5K1P A;  3LWI A;  2DFU A;  2OTL T;  4B9X A;  1SKU B;  1VOM A;  3LSQ A;  2YT6 A;  3JCM V;  3OYI A;  2EJG A;  3JAM E;  1YBY A;  2DJQ A;  1Q86 U;  4P73 A;  3M4Q A;  3LYI A;  4K88 A;  2DDZ A;  2O2O A;  2QAZ A;  2ART A;  4BB7 A;  1H3Z A;  1JJC B;  2QHU A;  3CBO A;  4QVD A;  5LL6 S;  1T0J A;  2VB6 A;  4ZGJ B;  2ABL A;  2JTM A;  5GAM j;  3EG9 A;  1NPP A;  5CKH A;  2ZPH B;  3I7F A;  3MHX A;  1G5V A;  4AFZ C;  5CAI A;  4TWA A;  3JCM b;  5CQY A;  3A98 A;  4J83 A;  1Q86 C;  3DB3 A;  4YRR A;  4WJ4 A;  4LVJ A;  3PIP A;  2KNB B;  1S1N A;  3C95 A;  4KQE A;  5GAO n;  4M7D A;  2CGH A;  1K8A U;  5GAM g;  1WU7 A;  2R57 A;  1ADJ A;  5ELN A;  2V1R A;  2Y90 A;  2D8H A;  4IIM A;  4G84 A;  4QT7 A;  3E19 A;  2EFI A;  1NZ9 A;  3N5B B;  3VS2 A;  2HBW A;  2DXT A;  1RL2 A;  4A4E A;  1VQ4 Q;  2QK0 A;  2ZR2 A;  1BU1 A;  1TUG B;  1QVP A;  2P0P A;  1EVL A;  5CQX A;  1BCO A;  1OV3 A;  1BBZ A;  2X4W A;  1K8A C;  4H2W A;  1NG2 A;  2RJF A;  4F14 A;  1VQK A;  1LPL A;  1RAC B;  4JJN K;  2ZT5 A;  1R77 A;  2VYT A;  3HKS A;  1WQ7 A;  1HTT A;  2CH4 A;  2OTJ A;  2JW4 A;  3OQ5 A;  2XKO C;  1K9M C;  1X43 A;  4J9C A;  1VA7 A;  2NUT A;  3H6Z A;  4M7D B;  4PJM A;  3A8H B;  4QVZ A;  4F04 B;  5KYX A;  2CS7 A;  4M7A A;  5C51 B;  4OF1 A;  4CI0 C;  5GMK j;  2ZPG B;  4A53 A;  5LJ3 d;  2M51 A;  2DXB A;  2YUP A;  2I4O A;  4OMP A;  5CVI A;  5I2M A;  1VQ4 T;  1M1K U;  2DVJ A;  2KT1 A;  4NCX A;  2C8M A;  1Q81 R;  2YRC A;  4H2V A;  2Q5H A;  2FRW A;  3NET A;  4BE2 A;  1YGB A;  2ED0 A;  1NEB A;  1WJR A;  4ZTZ B;  1FYF A;  2ZCF B;  3NTK A;  1XOV A;  5FU6 B;  2V1Q A;  1EIY B;  4MZT A;  1D3B A;  3CCS A;  2YUO A;  4PFP A;  1U1S A;  1W70 A;  2DYI A;  3PVL A;  1KSW A;  1M1K C;  3MEY A;  5FRO A;  3MO8 A;  4OMM A;  4J6W A;  5A0D A;  2ZPE B;  1VQN A;  1M4Z A;  2XU8 A;  3SWN B;  2RHU A;  3JB9 D;  2EGA A;  3V8K A;  4FYW B;  2YLC A;  3OBY A;  2A36 A;  1NNH A;  2XIC A;  3OA6 A;  3BDL A;  3V7C A;  5GAN e;  4FSS A;  2O9S A;  2X51 A;  3CC7 T;  4KBM B;  2MAM A;  1RI9 A;  3CBM A;  2V26 A;  4KUL A;  4CS4 A;  4JRI A;  3PMT A;  5KYY B;  2ODR D;  2E3I A;  3A32 A;  1MMN A;  3G7Z A;  4C0Z A;  4X1V A;  1QVG S;  5GAN 6;  3RES A;  4HVU A;  3REA B;  3BE3 A;  4J9E A;  4HWP A;  3G4S A;  1IHW A;  1X55 A;  2JNG A;  2MPX C;  4A4H A;  2QA4 A;  2XI9 A;  3QYG B;  2J06 A;  2XTI A;  1N5Z A;  1D3B B;  2DJZ A;  2C06 A;  1RAB B;  3ULR B;  1I07 A;  4N4I A;  1V76 A;  3I5S A;  1VQK Q;  1OEB A;  2RD1 A;  1BKB A;  3IAL A;  2LC4 A;  1QKX A;  3M4Y A;  2LMJ A;  2LP5 A;  2OTJ Q;  1FWZ A;  2DQ0 A;  3DSQ A;  4UPA A;  3SD4 A;  5I21 A;  1VQP A;  3HTZ A;  3RAC A;  4CH3 A;  5HK0 A;  2DL8 A;  2FRY A;  4RTZ A;  4BAC A;  1ZLM A;  1M3A A;  4BUG A;  5CKE A;  1NJ1 A;  1RAE B;  2VXF A;  4P5N A;  1M5Q 1;  1X01 A;  5LJ5 e;  1ABO A;  1YJN T;  2HEQ A;  4J15 A;  2RM4 A;  2RQR A;  2VVK A;  3C4S A;  2LRQ A;  1VQ5 T;  1YN8 A;  4OGC A;  3QSU A;  1NLO C;  3BFM A;  4A4K A;  3NEM A;  1UEB A;  3M56 A;  2CT3 A;  3A8G B;  1M27 C;  4GLK A;  3M59 A;  2FL7 A;  3A5Z A;  5FU7 B;  1VQK T;  2FG0 A;  4C5I A;  3CCS Q;  3P8H A;  3PT9 A;  1M8M A;  1LCK A;  1AWW A;  4RCC A;  1IGQ A;  3QO8 A;  1UHC A;  1OX8 A;  2B86 A;  1VQN Q;  3HRT A;  1ZA1 B;  2MF2 A;  1B34 A;  2CP7 A;  4C8Q C;  1YHQ A;  4OMN A;  3CCM A;  3VQY A;  4P74 C;  2K9G A;  4ELZ C;  2KEA A;  2LVM A;  3E9I A;  2KRM A;  4X34 A;  3E9G A;  3DLL A;  2LX9 A;  2DLP A;  1OPL A;  1USY C;  2G6F X;  4C8Q G;  5GMK m;  1H4V B;  1IRE B;  4ZIB A;  3JCM f;  2VKN A;  1HXD A;  3TEH A;  4TQF A;  2E5K A;  5KYW A;  2KQW A;  5GAO l;  3G4S Q;  2OAU A;  2EQK A;  2IIM A;  3P8V A;  2GBQ A;  1VYU A;  3P8T A;  4H2S A;  1WHG A;  4M78 F;  4FIB A;  2QA4 Q;  1LYL A;  1U8R A;  3CCS T;  1T3S A;  3A5Z B;  1EQR A;  1NM7 A;  3OYJ A;  4HCK A;  3TEG A;  4ZNX A;  1PD0 A;  4PKC C;  2DBM A;  4M77 F;  1ZUU A;  3EFO B;  3RMS A;  2E3H A;  4C92 A;  1VQN T;  1EFW A;  3TRE A;  3RKX A;  3QDF A;  3ERR A;  1YJ9 A;  3HXU A;  2KXD A;  2M02 A;  3AHU A;  4DEX A;  4E7H A;  4C0D C;  1B34 B;  3RBB B;  4EX5 A;  3JCM Q;  2GQV A;  2LTO A;  3EH1 A;  4BI3 A;  1VQP Q;  2KVQ G;  4JDS A;  1VYT A;  1O75 A;  4FW1 A;  2E1H A;  2EW3 A;  1G3Y A;  1VQO A;  1H64 1;  1DJ7 B;  3VRY A;  1W2B P;  3CBP A;  1RLP C;  2VC8 A;  1ZSZ C;  3A8L B;  2JN0 A;  1VQL A;  3CCU A;  1MNE A;  2J6F A;  1GGM A;  1W1F A;  4RMO A;  3G4S T;  5KYW B;  3MPU B;  2ZGW A;  1MGQ A;  5IHI A;  1LNX A;  2QQB A;  5KCO A;  2QA4 T;  1WHJ A;  1EFN A;  3M5A A;  3PVQ A;  3JCM h;  3IG2 A;  4FYX B;  2B8A A;  4EIK A;  5I11 A;  4HCC A;  1JJ2 A;  1K76 A;  1PHT A;  1WA7 A;  2L8D A;  5GAO p;  2DMO A;  1ARK A;  2D1X A;  1E22 A;  3OW2 A;  4PJN A;  2MWO A;  4C8Q E;  2KYB A;  3MCA B;  3NTI A;  3HXX A;  1RUW A;  4L5G A;  2HKN A;  2CZ6 B;  4IIO A;  1VQP T;  3VQX A;  2XDP A;  2COY A;  2VV5 A;  2A08 A;  2RJC A;  1JQQ A;  2COW A;  2DL5 A;  2H3E B;  4LDW A;  4FYY B;  1M3C A;  1YHQ Q;  3OYA A;  4JZ4 A;  3CCM Q;  1WZO A;  1MV3 A;  2DKG A;  2J3M A;  1UJY A;  1WXB A;  1AOJ A;  3CCE Q;  4EMG A;  4DBR A;  3VBB A;  4N0A A;  2JJ9 A;  1KHI A;  3DLM A;  1WLE A;  4GLM A;  2L2P A;  3C94 A;  2YWW A;  2HNI A;  3A8O B;  4M7D F;  2HD0 A;  1GFD A;  5KNN A;  1MMA A;  2EBP A;  1XNI A;  4P72 C;  3A74 A;  1QF6 A;  1B70 A;  4RTX A;  2GFU A;  2AK5 A;  3L1A A;  4FL6 A;  4JLG A;  4ZGD B;  5GAM f;  4YCW A;  1SER A;  4M78 C;  1UFF A;  3UPU A;  4E7S A;  1XTD A;  4C5G A;  1YWP A;  1E1T A;  2DL3 A;  3HPW A;  4F7U A;  4M77 C;  4A4F A;  1G3W A;  2GCX A;  2ARU A;  1KMN A;  1IXD A;  2K79 A;  3E2U A;  3OYY A;  4M78 G;  3CCM T;  1PWT A;  3NPF A;  2CDT A;  3NEL A;  3GP8 A;  4M77 G;  4N4H A;  3QXE B;  1H8K A;  3M53 A;  3MQZ A;  2C0T A;  1VQO Q;  3QYH B;  2RJE A;  1FMK A;  5L23 A;  4J7F A;  1ZQ1 A;  1YFS A;  4F17 A;  1NLP C;  5FWB A;  3M0P A;  1S72 T;  1O9S A;  3TCJ A;  4EMK A;  4RQF A;  2V8J A;  1VQL Q;  2JS0 A;  2PUK B;  4J9F A;  3CCU Q;  2CKK A;  3QPH A;  4M7A F;  1U06 A;  3FRN A;  2ALY A;  1H92 A;  1M90 U;  2DIQ A;  2XMF A;  2K5L A;  1NYF A;  2K6D A;  1KMM A;  3VV0 A;  1JXM A;  4M75 B;  4NOY A;  2QQ9 A;  2LJ1 A;  2KR3 A;  2YXY A;  2KE9 A;  4F7U B;  1YJ9 T;  1AZE A;  4O6J A;  3CD6 A;  1NJ2 A;  2DRM A;  2RA2 A;  4E6R A;  5LJ5 d;  5GAM h;  5A0L A;  4A54 A;  2JM9 A;  3JCM g;  2E41 A;  3QKJ A;  3PIO A;  2ZNJ A;  4P73 C;  4JJD A;  4C5E A;  3ICA A;  1H4Q A;  1K0X A;  4LUE A;  4PJO E;  5GAO q;  1D1C A;  3INZ A;  1TUC A;  1VQO T;  3PGG A;  1K73 R;  1QP3 A;  2VWF A;  4YRP A;  1RAD B;  4TVA A;  4XK8 E;  4B6M A;  1TTH B;  1VQL T;  4OML A;  3JB9 J;  3CCU T;  1H4T A;  1G2B A;  2A7Y A;  3REB B;  1RAA B;  2DTH A;  2PME A;  3GLX A;  4M7D C;  2ALY B;  1Z9Q A;  3UGQ A;  1GRI A;  2M0Y A;  4YRK A;  1KD1 U;  2KRS A;  1AVZ C;  1H4S A;  1M3B A;  2YRV A;  1KQ1 A;  1QWE A;  1MV0 B;  4O2D A;  4C8Q D;  4UP8 A;  1WI7 A;  3O8V A;  4M77 E;  2P4R A;  4CS2 A;  2F2V A;  4M7D G;  5DM7 R;  2FVU A;  3CME A;  1Q82 U;  1Q7Y C;  2KBT A;  4F16 A;  1YIJ A;  4LDY A;  3NFC A;  4Y28 E;  3HXV A;  3OMC A;  5FU6 C;  2M0O A;  3NGP A;  3A1P A;  1KD1 C;  3L2U A;  1NJI C;  3WQZ A;  4L87 A;  3M58 A;  1W66 A;  4FM4 B;  3F70 A;  4TVA B;  3P8Y A;  1E6H A;  3CC7 A;  5GMK h;  2K3B A;  2K57 A;  3KFU A;  3RIR A;  2JM8 A;  4M75 D;  5IH2 A;  1WHK A;  1Q82 C;  5DLQ E;  2PTK A;  2FPE A;  4KGZ B;  4JRQ A;  2DXC A;  2ATC B;  1QLY A;  4UP9 A;  4KGX B;  3OYD A;  2NLU A;  4M7A C;  4YRC A;  4RG2 A;  1ZUY A;  2AZV A;  2A3L A;  1GCQ C;  4HVV A;  3OYG A;  1ATI A;  4Q6G A;  3TU4 K;  2L3Q A;  3HRU A;  2F69 A;  3OY9 A;  4X9C A;  2P4T A;  3P8D A;  3VS1 A;  1ASZ A;  2ZPI B;  4E47 A;  2DXU A;  2KSS A;  4HCB A;  2CZ7 B;  4M7A G;  1NYR A;  2C0O A;  1JJ2 P;  3CC2 T;  1WNL A;  4ZGE B;  3CD6 Q;  3TUP A;  1JU5 C;  3OW2 P;  2FYK A;  2I4N A;  1OI1 A;  4PJJ A;  2J7I A;  4E7K A;  4Q5W A;  1G83 A;  5J26 A;  2E6Z A;  3IQL A;  3G1Z A;  2EPD A;  4X5O A;  5GAM d;  1C6V X;  5GJW B;  5CKB A;  1AD5 A;  4XU3 A;  2JZ2 A;  2CH4 W;  1QKW A;  4CRI A;  3NTH A;  2LX7 A;  1X2G A;  2CJA A;  4LDV A;  3HXW A;  3P8B B;  3UGT A;  3VJP A;  1M30 A;  1WXU A;  1WPY A;  1KOG A;  2FO0 A;  3JV3 A;  1YJN A;  1R0C B;  1QW1 A;  4LVK A;  1K9M U;  2A8E A;  4LNP A;  1X6O A;  1R8O B;  2YUQ A;  3OS0 A;  1ADY A;  1VQ5 A;  3H0I A;  2CZ0 B;  3HFN A;  1BBU A;  3UT1 A;  2DET A;  3PMI A;  4YRO A;  1B76 A;  2EKH A;  1EIY A;  3MEW A;  1NJ5 A;  2YLB A;  4KH0 B;  3CD6 T;  2BUD A;  4G85 A;  2X4J A;  4B9W A;  1Q86 R;  3CME Q;  4PJO D;  1H3H A;  3M0U A;  3GNF B;  2DER A;  4XEO A;  4ZTJ A;  1Y71 A;  1K1Z A;  4KR2 A;  1YIJ Q;  1M2O A;  1QWF A;  2RK1 A;  1WIE A;  2AHJ B;  2EGE A;  2EKO A;  3SWN A;  3GOX A;  4RG8 A;  3GF5 A;  1W2B A;  5FU7 C;  3C0C A;  1ACM B;  4C92 F;  1GCP A;  3VS6 A;  4PFO A;  4ME7 A;  1QVF A;  4YRL A;  1PYS A;  2QG9 B; 
#chains in the Genus database with same CATH homology
 1ZBX A;  3CMA A;  2MMP A;  3PFS A;  4V2S A;  4M7A E;  1NPR A;  4Q15 A;  4BY6 B;  2P5I A;  1G5I A;  5LJ3 j;  1LOJ A;  4HT8 A;  4ZTU B;  3SB2 A;  3QO7 A;  1IZ6 A;  4NL3 A;  3CME T;  3EFS A;  4C0G A;  1YIJ T;  1I4K 1;  2LCL A;  2E5A A;  2RI5 A;  1M8V A;  5HGQ A;  3OYH A;  3HY1 A;  2WAC A;  1UGP B;  3DB4 A;  3QUI A;  1PYS B;  4J7I A;  3JCM W;  3V7R A;  4YRF A;  3MEV A;  3JCM J;  4TTV A;  2DU5 A;  3A7R A;  2EJ9 A;  4DOW A;  5AYF A;  4MZP A;  5IT9 E;  3PTA A;  3OYL A;  4XTY A;  1WQW A;  2RB6 A;  1YI2 A;  1KC8 U;  3S6W A;  3C12 A;  4P3O A;  3QG1 A;  2XDD A;  4MML A;  1I5L A;  12AS A;  1VUB A;  5J39 A;  2Q5I A;  2F5T X;  2M1H A;  2QEX A;  1GXI E;  3GNG A;  2M9U A;  3WVE B;  1KC8 C;  3QBY A;  2PUO B;  3HHT B;  1VQ7 T;  4J8O A;  4JRK A;  4A4G A;  3JCM X;  3I56 A;  4L6V 5;  4F7U F;  4FU6 A;  1U1T A;  4C92 C;  4OB2 B;  2HQX A;  1JBM A;  3CCJ A;  3KXT A;  4UP7 A;  2I4L A;  3JCM e;  3G71 A;  4E7I A;  3J7A F;  4OB1 B;  3QDR B;  4PLI A;  4C92 G;  4BI8 B;  4UC4 A;  5D6Y A;  1OYX A;  4Y91 A;  1LJO A;  5GMK i;  3A31 A;  2X4X A;  2DZC A;  4XU0 A;  4HVC A;  3R07 A;  4QQD A;  4EPC A;  4OB3 B;  3JB9 H;  4QVC A;  3RKW A;  1UGR B;  4XAX B;  2K3Y A;  1KQS A;  2O4X A;  3L2W A;  2HBP A;  4J6Y A;  3CMA T;  3JB9 I;  4OMF B;  2RI3 A;  3TEE A;  5CK9 A;  1X75 C;  2DO3 A;  3LW5 E;  1S72 A;  5CCA A;  3L4G B;  4YRI A;  4WJ3 M;  1OZ3 A;  2XID A;  4TQD A;  2RO0 A;  2E6N A;  1VIE A;  4N0A C;  3A5Y A;  4WI1 A;  1M9S A;  4AH6 A;  1NJ8 A;  4XTZ A;  4BE1 A;  4MMK A;  4XTV A;  4CH6 A;  2QDY B;  4H2Y A;  3S3O A;  4C92 E;  2XGT A;  4HWT A;  1UGS B;  2O4X B;  3KUF A;  2Q7H A;  2G3R A;  4N4G A;  1BIA A;  3FJP A;  2BKD N;  3X25 B;  3CPF A;  1AHJ B;  3PZC A;  3EFR A;  3HL8 A;  1KG1 A;  2IY5 B;  1B8A A;  4ATO A;  3V8L A;  1BYM A;  1YI2 T;  5DY9 A;  1KQ2 A;  4F7U G;  4VUB A;  1IL2 A;  1YIT A;  4YP0 A;  5GAM e;  2RI2 A;  4YCU A;  2D0Q B;  3OSV A;  3JB9 F;  2QEX T;  3CXC A;  4EMK C;  5GAN 7;  4XTW A;  3OS1 A;  1JB0 E;  2CJ9 A;  1ZHI A;  4XU1 A;  5CO7 A;  3I56 T;  3OMG A;  4DA4 A;  1N9W A;  3VYH B;  2QI2 A;  1JJ2 S;  3CCJ T;  2ZR3 A;  1BI2 A;  3OW2 S;  3G71 T;  1ASY A;  5A2Q E;  2EIF A;  3M4G A;  3CMQ A;  3VYG A;  1EOV A;  2CJB A;  2DEQ A;  2LQK A;  5DLO A;  2KDS A;  5FLX E;  2DPP B;  2R5M A;  4M75 A;  1P92 A;  5GAN j;  4LDX A;  5GAN 4;  1HK9 A;  5GMK e;  3CC2 A;  3OD1 A;  2PU9 B;  4F7U E;  2CYZ B;  2X35 A;  4C8Q B;  2WSC E;  1W4S A;  1B7Y A;  2I4M A;  2RHQ B;  5EG2 A;  3OYF A;  5GAN 8;  3VKI A;  4X9D A;  1VQ9 A;  2E3C A;  3DKM A;  4YRJ A;  2JTF A;  1N8R C;  1YB3 A;  3CPW A;  4P3N A;  4ZN3 A;  2ZIM A;  5K1X A;  3M9Q A;  1L0W A;  3QNE A;  5KE3 A;  1FX7 A;  3ER0 A;  3JCM d;  1BIB A;  1I81 A;  4GY5 A;  4XU2 A;  3OYB A;  4Z02 A;  5FRM A;  4YRE A;  2RJD A;  2MI6 A;  4P3P A;  4IKF A;  2ODR C;  3HFO A;  3T9N A;  5LJ5 j;  1B7Y B;  2PVG B;  1YFR A;  2ZZF A;  2H3J A;  2DK3 A;  4OGE A;  4QQ6 A;  2EQM A;  4YRM A;  5LJ3 f;  4J6X A;  2DIG A;  4PG3 A;  3EAE A;  4BD3 A;  1Q7Y U;  2JUF A;  3ASK A;  5KH6 A;  3M57 A;  2FB7 A;  3QJ6 A;  2G4C A;  1X54 A;  1YIT T;  4M78 E;  3MP8 A;  1NJI U;  3QHS A;  1E1O A;  1TH7 A;  5FRN A;  3FEO A;  4KUI A;  3QTC A;  2DQ3 A;  3UH0 A;  4JS5 A;  4P75 A;  1VQM A;  2KY9 A;  2RH2 A;  3I55 A;  2EQU A;  3CCL T;  1BI0 A;  2L5Q A;  2DZ9 A;  3OYN A;  4IUU A;  5ELO A;  4PJO B;  3L42 A;  3X24 B;  4FT4 A;  3SWN C;  2O01 E;  3HFZ A;  5LJ3 h;  1G51 A;  4WF2 A;  3ZEH A;  3REX A;  2ZZG A;  3GPL A;  2EAY A;  1NYQ A;  4O5V A;  2PVD B;  5HY6 A;  3ME9 A;  2Q7G A;  3CCQ A;  1Y7X A;  2VGN A;  5M9O A;  2P0Q A;  2LNV A;  4M77 B;  3ZBD A;  1Z7N A;  1RI0 A;  3LGL A;  4LD6 A;  2LQ8 A;  4J5Y A;  4EDU A;  4H02 A;  4NS5 A;  1VQ7 A;  3RMQ A;  5C52 B;  3RUX A;  4IUR A;  3LX7 A;  2QQA A;  3HSB A;  3CCR A;  1VQ9 T;  2RHS A;  3X20 B;  4M7D E;  2K5I A;  2ZIN A;  3HFZ B;  4OLF A;  2M16 A;  2HAX A;  2DAQ A;  2PQW A;  2JVV A;  1Q81 U;  3PCO A;  1EVK A;  2DTO A;  2WSE E;  4PHC A;  1SSF A;  1WGS A;  3E1S A;  5KE2 A;  3V8J A;  3LSS A;  4YYE A;  2J3L A;  2ZZE A;  2EJF A;  5GMK l;  3RGL A;  1Q81 C;  2XG8 D;  3OYC A;  5HKC A;  3OS5 A;  4QW2 A;  3GIB A;  3HXZ A;  4XEM A;  3A7A A;  2ZXF A;  2AKW A;  2RHS B;  1Y07 A;  1SRY A;  2R5A A;  4YDQ A;  4P71 A;  4M78 D;  3BDU A;  4NL2 A;  2ZT8 A;  1FXX A;  4HWS A;  2K3X A;  4M77 D;  2I2L A;  2YHT A;  1W2B S;  3MEA A;  3JCM c;  3JSC A;  2VXE A;  2ZZD A;  4XQ3 A;  3M4P A;  1QVF S;  3PCO B;  4EO4 A;  2XHC A;  1VQM T;  3QO5 A;  3VQV A;  2EWN A;  3HFV A;  5LJ3 g;  3I55 T;  4K86 A;  5D6W A;  2DU7 A;  2EYQ A;  4E7L A;  5KCH A;  5HK3 A;  1G5H A;  2E70 A;  2VUB A;  2AKW B;  4D6W A;  5I2S A;  2ZPB B;  4E7J A;  4E51 A;  4C8Q F;  3S3M A;  1QVG A;  3L2R A;  1BI1 A;  2V8K A;  2X4Y A;  1VQ6 A;  3OB9 A;  4M7A B;  4II1 A;  3QII A;  2CZ1 B;  4LVI A;  4YRN A;  4YRS A;  2IG0 A;  5CKD A;  3LGF A;  4YRT A;  3LLR A;  2C7I A;  3OSS C;  3CCQ T;  4PNO A;  4HT9 A;  3X26 B;  4FT2 A;  4M75 F;  3WVD B;  2E65 A;  2ARS A;  1VIF A;  2E5Q A;  3MP6 A;  3QO3 A;  3FIF A;  4M7D D;  3CCR T;  3BW1 A;  4LVM A;  3L2Q A;  2IVW A;  4RMF A;  3E9H A;  4BDY A;  4OP0 A;  5E3I A;  3CCV A;  2ZT7 A;  2KMT A;  4HCZ A;  4YRG A;  3L4G A;  2NS6 A;  3MF2 A;  5GAN f;  2QQR A;  3J81 E;  5IN1 A;  5GAN 3;  4LD9 K;  2Y4X A;  1Y96 A;  4LNS A;  2RHZ A;  3VU3 C;  1NJ6 A;  2RK2 A;  4CH5 A;  2D9T A;  4K87 A;  4TVW A;  2QXF A;  4FSX A;  1WYD A;  3HP9 A;  1KHC A;  1EIF A;  4MDX A;  4H2U A;  3OBW A;  4M7A D;  2E12 A;  2ZIO A;  2Y4Y A;  1RIQ A;  2LT4 A;  2QHS A;  3BY7 A;  2R58 A;  2OTJ T;  1YCY A;  5CR2 A;  5D6X A;  1VQ8 A;  3Q1J A;  2IY5 A;  4HWR A;  1SET A;  3R6O A;  1X56 A;  2E64 A;  4MDW A;  3S3N A;  3FB9 A;  1KQS S;  1N27 A;  4PJO F;  3CCE A;  3L2V A;  1J5W A;  2DD5 A;  1XQH A;  4DOV A;  1Y96 B;  1Z7M A;  3HRK A;  1BI3 A;  1PSE A;  5GAN h;  1UGQ B;  1N6A A;  5LJ5 f;  3J80 E;  2GFA A;  3MET A;  2QTX A;  4JUV A;  1YJW A;  3FLG A;  1NE8 A;  4M75 C;  5GAN 2;  4R56 A;  2VGM A;  2JOY A;  4LDU A;  3G6E A;  4OB0 B;  2K2V A;  1E24 A;  2K5F A;  4M75 G;  5GAO r;  3RF1 A;  3CEY A;  2RHX A;  3REU A;  4ZN1 A;  1VQ6 T;  2RHI A;  3SFM A;  4KR3 A;  2Q7E A;  3LWH A;  3QZ9 B;  1X2H A;  4RCB A;  3H8Z A;  2DTI A;  4IUT A;  4JLI A;  5C6S A;  5A0G A;  3ZFJ A;  3TEH B;  3E9F A;  2LT1 A;  4RDX A;  1JRI A;  3CCL A;  4YPF A;  1N9S A;  5L8R E;  1OZ2 A;  3FC3 A;  5CKF A;  5LJ5 h;  4C8Q A;  1N9R A;  4CS3 A;  3CXC S;  5GAN 5;  3LH0 A;  4P74 A;  4C92 B;  2XDB A;  3MF1 A;  2RHQ A;  1USY A;  1YFT A;  4TVY A;  3A8M B;  3CCV T;  3HRI A;  3CC4 A;  5C0M A;  4C0F A;  1C0A A;  4KUD K;  1MHN A;  3UWN A;  4R55 A;  2V8I A;  5F5W A;  2WSF E;  4PJO C;  2EQJ A;  3JRZ A;  5C53 B;  1M1F A;  2P0L A;  2XD0 A;  3OS2 A;  4YRQ A;  1BBW A;  4BDZ A;  4M75 E;  4RKU E;  4PJO G;  4L59 A;  1N8R U;  2OTL A;  2F5K A;  3V7S A;  5GAN d;  1V29 B;  2GF7 A;  4P75 C;  4XTU A;  5GAN g;  2AMC A;  2L3R A;  5LJ3 e;  3OYE A;  4H2X A;  3L2Z A;  2KAF A;  4PL6 A;  3LC0 A;  1QE0 A;  5CIU A;  3OYK A;  1VQ8 T;  3KBG A;  4CH4 A;  3QZ5 B;  3OYM A;  1K73 U;  3VQW A;  1G3S A;  1YHQ T;  4BWA A;  4IUP A;  2DD4 A;  3HRS A;  4DQ2 A;  1WJS A;  3VUB A;  3FDR A;  1WJQ A;  3M55 A;  3CCE T;  3JCM P;  4PLL A;  3IKM B;  3M54 A;  4BE0 A;  1K73 C;  4DPG A;  4C92 D;  3CPW S;  1YJW T;  1B70 B;  3IKL A;  2PMF A;  4ELY C;  1UB4 A;  4BI4 A;  4C5H A;  2CIM A;  3W3S A;  4C0D B;  3JB9 G;  4YCV A;  4LVL A;  4HKE A;  2P0K A;  2AMC B;  1I8F A;  4H2X B;  3RL6 A;  3G6E T;  2ZT6 A;  11AS A;  5IAY A;  4TVR A;  4QQG A;  4MZM A;  3MEU A;  2ZCE A;  5GAO m;  1HC7 A;  4OVA A;  4PJO A;  4JS4 A;  3HXY A;  2DVE A;  5LJ5 g;  3SDZ A;  1M90 C;  1SES A;  4P72 A;  4HA8 A;  2FHD A;  2MWP A;  3BJU A;  3HY0 A;  3RKY A;  1G3T A;  3PNW C;  4HT4 A;  4BY6 C;  4EMK B;  2E10 A;  4M78 A;  1VQ4 A;  2KK4 A;  2QHV A;  2QQS A;  3X28 B;  4KT0 E;  4HWO A;  3MP1 A;  3UFG A;  4M77 A;  4YTL A;  2BIV A;  2XK0 A;  2ZPF B;  3URG A;  4IUV A;  2LCC A;  1VQZ A;  3WXM B;  4XTX A;  2RHY A;  1M1G A;  2PVO B;  1PSF A;  1QP2 A;  3RER A;  1JJC A;  3A7U A;  2QHT A;  2D6F A;  2K4Y A;  3QJY A;  2EL9 A;  3CC4 T;  4BW9 A;  2HQE A;  2LDM A;  4EMH A;  4JRP A;  3VUZ A;  3NEN A;  5J3B A;  2ZNI A;  4P71 C;  4IUQ A;  4H2T A;  2ZTG A;  2L89 A;  4RQE A;  4M78 B;  3UDC A;  4ZTF A;  5K1P A;  3LWI A;  2OTL T;  3LSQ A;  4B9X A;  3JCM V;  3OYI A;  2EJG A;  3JAM E;  1YBY A;  1Q86 U;  4P73 A;  3M4Q A;  3LYI A;  4K88 A;  2DDZ A;  2ART A;  4BB7 A;  1H3Z A;  1JJC B;  2QHU A;  3CBO A;  4QVD A;  5LL6 S;  4ZGJ B;  2JTM A;  5GAM j;  1NPP A;  5CKH A;  2ZPH B;  3I7F A;  3MHX A;  1G5V A;  5CAI A;  4TWA A;  3JCM b;  5CQY A;  4J83 A;  1Q86 C;  3DB3 A;  4YRR A;  4WJ4 A;  4LVJ A;  3PIP A;  3C95 A;  4KQE A;  5GAO n;  4M7D A;  2CGH A;  1K8A U;  5GAM g;  1WU7 A;  2R57 A;  1ADJ A;  5ELN A;  2Y90 A;  4G84 A;  3E19 A;  2EFI A;  1NZ9 A;  3N5B B;  2DXT A;  1RL2 A;  4A4E A;  2ZR2 A;  1QVP A;  2P0P A;  1EVL A;  5CQX A;  2X4W A;  1K8A C;  4H2W A;  2RJF A;  1VQK A;  4JJN K;  2ZT5 A;  2VYT A;  3HKS A;  1WQ7 A;  1HTT A;  2OTJ A;  3OQ5 A;  2XKO C;  1K9M C;  3H6Z A;  4M7D B;  3A8H B;  4QVZ A;  2CS7 A;  4M7A A;  5C51 B;  4OF1 A;  4CI0 C;  5GMK j;  2ZPG B;  4A53 A;  5LJ3 d;  2DXB A;  2I4O A;  5CVI A;  5I2M A;  1VQ4 T;  1M1K U;  4NCX A;  2C8M A;  4H2V A;  2Q5H A;  3NET A;  4BE2 A;  1YGB A;  1WJR A;  4ZTZ B;  1FYF A;  2ZCF B;  3NTK A;  1XOV A;  5FU6 B;  1EIY B;  4MZT A;  1D3B A;  3CCS A;  1U1S A;  1M1K C;  3MEY A;  5FRO A;  3MO8 A;  4J6W A;  5A0D A;  2ZPE B;  1VQN A;  1M4Z A;  2XU8 A;  3SWN B;  2RHU A;  3JB9 D;  3V8K A;  2YLC A;  3OBY A;  1NNH A;  2XIC A;  3OA6 A;  3BDL A;  3V7C A;  5GAN e;  3CC7 T;  2MAM A;  4KBM B;  3CBM A;  4KUL A;  4CS4 A;  4JRI A;  3PMT A;  2ODR D;  3A32 A;  3G7Z A;  4C0Z A;  1QVG S;  5GAN 6;  3RES A;  4HWP A;  3G4S A;  1X55 A;  2JNG A;  4A4H A;  2QA4 A;  2XI9 A;  3QYG B;  2XTI A;  1D3B B;  2DJZ A;  2C06 A;  4N4I A;  2RD1 A;  1BKB A;  3IAL A;  2LC4 A;  3M4Y A;  2DQ0 A;  3DSQ A;  1FWZ A;  4UPA A;  3SD4 A;  5I21 A;  1VQP A;  3HTZ A;  3RAC A;  4CH3 A;  5HK0 A;  4BAC A;  4BUG A;  5CKE A;  1NJ1 A;  2VXF A;  4P5N A;  1M5Q 1;  1X01 A;  5LJ5 e;  1YJN T;  4J15 A;  2RM4 A;  3C4S A;  2LRQ A;  1VQ5 T;  4OGC A;  3QSU A;  3BFM A;  4A4K A;  3NEM A;  1UEB A;  3M56 A;  3A8G B;  4GLK A;  3M59 A;  2FL7 A;  3A5Z A;  5FU7 B;  1VQK T;  4C5I A;  3P8H A;  3PT9 A;  4RCC A;  3QO8 A;  3HRT A;  2MF2 A;  1B34 A;  4C8Q C;  1YHQ A;  3CCM A;  3VQY A;  4P74 C;  4ELZ C;  2LVM A;  3E9I A;  4X34 A;  3E9G A;  3DLL A;  2LX9 A;  1USY C;  4C8Q G;  5GMK m;  1H4V B;  1IRE B;  4ZIB A;  3JCM f;  1HXD A;  3TEH A;  4TQF A;  2KQW A;  5GAO l;  2OAU A;  2EQK A;  3P8V A;  3P8T A;  4H2S A;  4M78 F;  4FIB A;  1LYL A;  1U8R A;  3CCS T;  3A5Z B;  1EQR A;  3OYJ A;  3TEG A;  4PKC C;  4M77 F;  3RMS A;  4C92 A;  1VQN T;  1EFW A;  3TRE A;  3RKX A;  3ERR A;  1YJ9 A;  3HXU A;  3AHU A;  4E7H A;  4C0D C;  1B34 B;  4EX5 A;  3JCM Q;  2GQV A;  2LTO A;  4BI3 A;  2KVQ G;  4JDS A;  1O75 A;  2E1H A;  1G3Y A;  1VQO A;  1H64 1;  1DJ7 B;  3CBP A;  2VC8 A;  3A8L B;  2JN0 A;  1VQL A;  3CCU A;  1GGM A;  4RMO A;  3G4S T;  2ZGW A;  1MGQ A;  1LNX A;  2QQB A;  5KCO A;  2QA4 T;  3M5A A;  3JCM h;  3IG2 A;  4HCC A;  2B8A A;  1JJ2 A;  2L8D A;  5GAO p;  1E22 A;  3OW2 A;  2MWO A;  4C8Q E;  3MCA B;  3NTI A;  3HXX A;  4L5G A;  2CZ6 B;  1VQP T;  3VQX A;  2XDP A;  2VV5 A;  2RJC A;  4LDW A;  3OYA A;  2J3M A;  2DKG A;  4EMG A;  3VBB A;  4N0A A;  1KHI A;  3DLM A;  1WLE A;  3C94 A;  2HNI A;  3A8O B;  4M7D F;  2HD0 A;  5KNN A;  1XNI A;  4P72 C;  3A74 A;  1QF6 A;  1B70 A;  2GFU A;  3L1A A;  4FL6 A;  4JLG A;  4ZGD B;  5GAM f;  4YCW A;  1SER A;  4M78 C;  3UPU A;  1XTD A;  4C5G A;  1E1T A;  3HPW A;  4F7U A;  4M77 C;  4A4F A;  1G3W A;  2GCX A;  2ARU A;  1KMN A;  3OYY A;  4M78 G;  3CCM T;  3NEL A;  3GP8 A;  4M77 G;  4N4H A;  3QXE B;  3M53 A;  3MQZ A;  3QYH B;  2RJE A;  4J7F A;  1ZQ1 A;  1YFS A;  1S72 T;  1O9S A;  3TCJ A;  4EMK A;  4RQF A;  2V8J A;  2PUK B;  2CKK A;  3QPH A;  4M7A F;  3FRN A;  2ALY A;  1M90 U;  2DIQ A;  2K5L A;  1KMM A;  3VV0 A;  4M75 B;  4NOY A;  2QQ9 A;  4F7U B;  1YJ9 T;  4O6J A;  3CD6 A;  1NJ2 A;  2RA2 A;  5LJ5 d;  5GAM h;  5A0L A;  4A54 A;  3JCM g;  2E41 A;  3QKJ A;  3PIO A;  2ZNJ A;  4P73 C;  4C5E A;  3ICA A;  1H4Q A;  4PJO E;  5GAO q;  3INZ A;  1VQO T;  3PGG A;  1QP3 A;  4YRP A;  4TVA A;  4XK8 E;  1VQL T;  3JB9 J;  3CCU T;  1H4T A;  2A7Y A;  2DTH A;  2PME A;  3GLX A;  4M7D C;  2ALY B;  3UGQ A;  4YRK A;  1KD1 U;  1H4S A;  2YRV A;  1KQ1 A;  4O2D A;  4C8Q D;  4UP8 A;  3O8V A;  4M77 E;  4CS2 A;  4M7D G;  5DM7 R;  2FVU A;  3CME A;  1Q82 U;  1Q7Y C;  1YIJ A;  4LDY A;  3NFC A;  4Y28 E;  3HXV A;  3OMC A;  5FU6 C;  2M0O A;  1KD1 C;  3L2U A;  1NJI C;  3WQZ A;  4L87 A;  3M58 A;  1W66 A;  4FM4 B;  3F70 A;  4TVA B;  3P8Y A;  3CC7 A;  5GMK h;  2K57 A;  3KFU A;  3RIR A;  4M75 D;  1Q82 C;  5DLQ E;  4JRQ A;  2DXC A;  4UP9 A;  3OYD A;  2NLU A;  4M7A C;  4YRC A;  4RG2 A;  2A3L A;  3OYG A;  1ATI A;  4Q6G A;  3TU4 K;  3HRU A;  2F69 A;  3OY9 A;  4X9C A;  2P4T A;  3P8D A;  1ASZ A;  2ZPI B;  4E47 A;  1NYR A;  2DXU A;  2KSS A;  2CZ7 B;  4HCB A;  4M7A G;  3CC2 T;  1WNL A;  4ZGE B;  3TUP A;  2FYK A;  2I4N A;  1OI1 A;  4E7K A;  4Q5W A;  5J26 A;  2E6Z A;  3G1Z A;  4X5O A;  5GAM d;  5CKB A;  4XU3 A;  2JZ2 A;  4CRI A;  3NTH A;  1X2G A;  2CJA A;  4LDV A;  3HXW A;  3P8B B;  3UGT A;  3VJP A;  1WPY A;  1KOG A;  1YJN A;  1QW1 A;  4LVK A;  1K9M U;  2A8E A;  1X6O A;  1R8O B;  3OS0 A;  1ADY A;  1VQ5 A;  2CZ0 B;  3HFN A;  1BBU A;  3UT1 A;  3PMI A;  4YRO A;  1B76 A;  1EIY A;  3MEW A;  1NJ5 A;  2YLB A;  3CD6 T;  2BUD A;  4G85 A;  2X4J A;  4B9W A;  4PJO D;  3GNF B;  4XEO A;  4ZTJ A;  1Y71 A;  4KR2 A;  2EKO A;  2AHJ B;  2RK1 A;  3SWN A;  3GOX A;  4RG8 A;  3GF5 A;  1W2B A;  5FU7 C;  4C92 F;  1QVF A;  4ME7 A;  4YRL A;  1PYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...