4XTZA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 69 that has a fluorine in place of the ribose 2'oh
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 93
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtzA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtzA01
3RESA 3HFNA 4RCBA 5GAOn 1QE0A 5ELOA 4F7UF 4EX5A 3ERRA 3P8VA 2ZZGA 3NENA 2ALYB 3P8TA 4HWTA 4M75C 1JRIA 4H2XB 2ZINA 4M7DF 3JCMc 1JJCB 3V7RA 2J3LA 5DY9A 4C8QB 3HSBA 4P71A 4CH4A 2E1HA 1G5HA 4Q6GA 3JCMh 3JB9F 1WYDA 2RHQB 4CS3A 4C92G 3V8KA 5GMKj 1ADJA 2DQ3A 4NL2A 4M7AE 2FYKA 3EFSA 3RKXA 3HRKA 5C53B 1ASYA 2VXEA 3JCMJ 1U1TA 3GIBA 3M4GA 5GANj 1D3BA 5GAMe 5GAMg 2DZ9A 2QHTA 3M4PA 4M75B 4M75D 1EVKA 2XGTA 3REUA 1B8AA 3JCMe 4A54A 2ZT5A 5F5WA 4O2DA 4UP7A 4M7AA 4XQ3A 1X56A 1Z7NA 1WLEA 3JB9H 2DTIA 1KMMA 2ZZFA 4M7DC 4J5YA 5GAN4 4M7AD 3UFGA 4YRJA 1EFWA 2JN0A 3A7RA 4M7AG 1I5LA 3JCMd 5LJ3h 4A53A 4WJ3M 3IKLA 1H4SA 3HY0A 3RL6A 3HXWA 4NOYA 1E1TA 3VQWA 4TQDA 4P3PA 2DZCA 4H2UA 4OP0A 1NJ6A 2P5IA 1YFTA 4RMFA 1C0AA 2DEQA 4F7UB 1B76A 2XTIA 3MF2A 3JCMQ 3A74A 2AMCA 5LJ3e 4YRTA 4RQEA 4M7DB 2ZIOA 4XU3A 1ADYA 3JB9J 2EJGA 2AMCB 3V7SA 4CH6A 5GANf 1JBMA 3P8YA 1IL2A 2CJBA 1G51A 2QHSA 3PCOA 3RERA 3QHSA 5LJ3d 2E65A 2Q7EA 4XTUA 4XTWA 4YREA 4HWRA 4YCUA 4C92F 4CS4A 3PCOB 4TVAB 2EWNA 2EJ9A 2DXTA 5LJ5h 1LOJA 1E22A 2EAYA 3VQYA 4DPGA 3FIFA 3HY1A 3FJPA 2RHSA 3JCMX 2I4LA 3A5ZA 3HFZB 5KNNA 3SB2A 1NJ2A 3TEHB 2ZCEA 4YRLA 5GAN7 4X9DA 2RB6A 1L0WA 5LJ5e 2VXFA 2ZR3A 3E9HA 4P74A 4YCVA 3RGLA 4P73C 1H4TA 12ASA 3QTCA 4M7AF 1Y96A 3JCMV 4TVWA 1YFSA 2ARTA 4L87A 4X5OA 4HWPA 3UGTA 2DU7A 4C92C 5GAN8 5GAN3 1LJOA 3G1ZA 4HVCA 4H2WA 1Y96B 2E5AA 4PHCA 5LJ5d 3HXZA 4P3NA 1PYSA 1NYRA 1QF6A 4QVCA 1HC7A 2Q7HA 4M77G 5K1XA 1B70A 4P72A 3V7CA 4EO4A 4P73A 4AH6A 1WU7A 1MGQA 2DJZA 2EL9A 3L1AA 3L4GA 5GAN2 4C92A 4PJOE 1USYA 3HRIA 1LYLA 4Q15A 3HXXA 5GAMh 3L4GB 1NJ8A 1GGMA 3A32A 4BWAA 4C92B 4C92D 3RKYA 4YDQA 4LNSA 3QO3A 4M7AC 2CJ9A 2YLCA 4M78E 3HXUA 5GMKl 1NNHA 3FB9A 4K88A 4YRCA 1NJ1A 1YCYA 2HNIA 4CH5A 1EIYA 3HFOA 4OLFA 1HK9A 3SWNA 1D3BB 5ELNA 4PJOG 3IG2A 1EIYB 4M78A 4C8QG 4M7AB 5GAMd 2RD1A 2Y90A 1X2HA 5GAOr 3ICAA 4HWOA 4H2YA 4K86A 4M78G 1RIQA 3JCMf 3HFVA 3HXYA 3QO5A 2E41A 3RACA 2ZT7A 1B7YA 4YRPA 5K1PA 4YRIA 3HTZA 4JLIA 2J3MA 4V2SA 2Q7GA 3UH0A 4ZIBA 2RA2A 4XEMA 2ARUA 2YLBA 4YRSA 4K87A 1NJ5A 1KQ2A 3JB9I 4HA8A 4RCCA 4P75A 2DQ0A 4YRQA 4RQFA 2C7IA 2ODRC 3E9IA 1BIBA 1HXDA 1LNXA 5GMKe 1EOVA 3QO7A 4YRGA 5I21A 4UP9A 1YGBA 5GANe 5GANg 1BIAA 3INZA 2PMEA 3V8LA 4N0AA 4F7UG 3PZCA 3JCMP 4P74C 3WQZA 4M7DG 3NELA 1HTTA 2ODRD 3W3SA 4YCWA 2Q5HA 1WPYA 4MMLA 3VBBA 1ASZA 4M77E 3JB9G 2ZNJA 2RHSB 4PJOF 2E3CA 5C52B 3V8JA 4YRMA 3QSUA 4KR3A 4KR2A 5E3IA 4P72C 1WQWA 5GAOl 2I4NA 2IY5A 4WJ4A 1EVLA 3DSQA 3L2ZA 1I8FA 4XU2A 1Z7MA 4M78F 4NCXA 4RDXA 3RF1A 4M77A 2AKWA 1USYC 4YP0A 1X01A 3UGQA 1FYFA 5LJ5f 4ZTUB 4J6XA 4M77D 4X9CA 5GAOp 3QNEA 5GAMj 2I4MA 3KFUA 1SETA 2DXUA 4XTYA 2K57A 3M4QA 1PYSB 2G4CA 4TWAA 3EFRA 1B34A 4EMKA 4EMHA 1N9RA 3RKWA 3REXA 4PJOC 4YYEA 1B70B 1NYQA 1G5IA 5C51B 4JRIA 4C8QE 2DTOA 4PNOA 3BFMA 3JCMb 3SWNC 2QHVA 4H02A 2EJFA 4YRFA 1SERA 4M78C 1BBWA 4UP8A 3JCMW 2ALYA 4XTVA 2E64A 1U1SA 4H2XA 2CGHA 2ZNIA 4PJOA 1JJCA 1W66A 2RM4A 4C8QA 2DVEA 3LSQA 3OD1A 4M75E 1N9SA 3CMQA 4PJOB 4PJOD 2RHQA 5LJ3j 4C8QD 4YROA 1KOGA 3NEMA 2C8MA 4BW9A 1KMNA 4JUVA 4XU0A 3RIRA 3SWNB 4Y91A 4M78B 5GAMf 4M78D 2DDZA 5GAOm 4JRKA 2Q5IA 4M75A 3I7FA 4P75C 1X54A 3BW1A 2DKGA 4YRRA 1E1OA 2VC8A 4J6YA 3BDUA 2I2LA 1I81A 3JCMg 5GMKh 3AHUA 4M75G 2QTXA 4F7UE 2I4OA 1VQZA 4H2SA 4H2TA 2ZZEA 1B7YB 2ZGWA 4HWSA 4WF2A 1H4VB 5GANh 4QVDA 1WQ7A 4J6WA 1EQRA 1H4QA 4M77F 4M7DE 4N0AC 1E24A 4EMGA 3VQXA 4DQ2A 2ZTGA 3LC0A 4TTVA 5LJ5j 2ZR2A 1N9WA 4F7UA 4WI1A 3PGGA 3HXVA 3NETA 4YPFA 4MMKA 5LJ3f 1SESA 4M7DA 1YB3A 5GMKm 2CIMA 3IKMB 3TEGA 2ZIMA 4HT9A 4ZTZB 3A7UA 5LJ3g 2ZXFA 4M7DD 2ZT6A 5HGQA 5GAN6 3QUIA 5GAN5 4YRNA 4CH3A 4YRKA 1M8VA 5GANd 2PMFA 1H641 3JB9D 4KQEA 4M77C 4E51A 4P3OA 1WNLA 4NL3A 4TVAA 3A31A 4G85A 1X55A 4C8QF 3LSSA 3BY7A 4HT8A 3R07A 1ATIA 3MEYA 4G84A 2DU5A 1I4K1 3A7AA 4TVYA 2E10A 1M5Q1 3VU3C 3QO8A 5CAIA 4EMKC 3HFZA 5GAOq 3MF1A 3TEHA 2IY5B 4PG3A 2DTHA 1J5WA 4M77B 2AKWB 4M75F 2ARSA 3IALA 1BBUA 4TQFA 1TH7A 3RUXA 3TUPA 5LJ5g 5GMKi 3VQVA 4J15A 1X2GA 2CJAA 4XTXA 4C8QC 3BJUA 3A5YA 1B34B 4H2VA 2ZT8A 4EMKB 2QHUA 11ASA 2YHTA 4XEOA 1YFRA 2FB7A 4C92E 4XU1A 4UPAA 4CS2A 4XTZA 1KQ1A 4P71C 1SRYA 2P0LA
chains in the Genus database with same CATH superfamily
3RESA 3HFNA 5CCAA 2DD4A 3EGXA 5ELOA 3VS0A 2M51A 3ERRA 4D8KA 3VS2A 3CPWA 3QYHB 3M0UA 2QEXQ 3LX7A 2ZINA 2J3LA 7AT1B 1UJYA 4CH4A 2E1HA 4Q6GA 3SFMA 3NFCA 1ADJA 3D7SB 4OGEA 2HQEA 4LXCA 3I56T 1VQ4A 1U1TA 1LPLA 3GOXA 1GBQA 2QYZA 1KQSS 1G3YA 1YIJA 1W2BS 5GAMe 1LCKA 1K73U 2QHTA 3M4PA 2GGRA 1OV3A 1B8AA 3JCMe 4O2DA 1K73R 4UP7A 4XQ3A 1X56A 2J7IA 1Z7NA 1WLEA 1RI0A 3L2RA 2ZZFA 4M7DC 2DAQA 3UFGA 1EFWA 3A7RA 2XG8D 1GFDA 1YJNA 1NJIU 3JCMd 1ZBXA 2QGGA 1P92A 1NJIR 3VQWA 2K7AA 1GL5A 2PZ1A 4JDSA 1JJ2A 1UJ0A 4RMFA 1QLYA 4LNPA 4F7UB 3DB4A 2WSEE 4LN2A 3JCMQ 2AMCA 3G7ZA 4YRTA 4M7DB 4AMCA 1TOVA 3JB9J 2BE9B 2LMJA 1JBMA 4IUTA 3P8YA 1IL2A 1VQMT 1G51A 4RTXA 2QTVA 3PCOA 4X1VA 1SSHA 4BACA 2DERA 3CCMQ 4JRPA 1WIEA 2D6FA 2EWNA 2EJ9A 1WDXA 2CYZB 2DXTA 2EAYA 2K4YA 4DPGA 3FJPA 5FRNA 1BI1A 3CMAQ 4JLGA 5KNNA 1KG1A 4IUPA 3TEHB 3G4ST 1JJ2P 2EVRA 2ESWA 2YDLA 3E9HA 1KQSP 2MMPA 4A4EA 1Q82C 4M7AF 1Y96A 1UHCA 4TVWA 2ARTA 2DU7A 4C92C 1LJOA 3G1ZA 3UA7A 2CH4A 3MEWA 3CCJT 2R5MA 1PWTA 4PKCC 5CKFA 1YWPA 3RDVA 2L3QA 2QA4Q 2LNHB 1WU7A 1D0XA 2ROTA 2V8IA 1RACB 3A98A 3LW5E 5FROA 3ZFJA 1USYA 1KC8C 3HXXA 2X9HA 4X34A 5GAMh 1GGMA 4BWAA 4C92B 1VQKQ 2J05A 3LH0A 4YDQA 4LNSA 1H3ZA 2QEXT 2YUPA 5IN1A 4M78E 5DLQE 5J26A 4ZGDB 2K5LA 3FB9A 4YRCA 4LVMA 4FCYA 2X51A 1Q7YC 3CCSA 1EIYA 3QWYA 2XDPA 1YFNA 3QKJA 3WVDB 3DLLA 4FSSA 2H3JA 2VV5A 1QP3A 2VWFA 2RD1A 4PLIA 1X2HA 4M78G 3G6EA 1RIQA 4N4GA 3QO5A 1SHGA 1NG2A 2OTLA 1H8KA 3CD6Q 2JM8A 4YRPA 4ELYC 1PKTA 4ANJA 2Q7GA 3VYHB 4HXJA 2K79A 4IURA 1D09B 2YLBA 2LTOA 1G5VA 4K87A 2MCNA 2E12A 4HA8A 4P75A 1ABOA 1K9MC 2KYMA 1YI2T 2COYA 2EQIA 3OS0A 1VQ7Q 2PUOB 4K11A 1EOVA 2M16A 1C0MA 1VQPQ 2IVWA 2AZVA 1OU9A 2JMAA 5GANe 4BI8B 3I55A 2EKHA 1VQ5A 3A8MB 1OX8A 1QVFS 2A0FB 1RAHB 3GLXA 2XDBA 4R0KA 4QT7A 4OMMA 1KSWA 1TS9A 3JCMP 3WQZA 1EIFA 2JTMA 3NELA 3F70A 1K8AC 3CCMT 2LC4A 2ODRD 3OYKA 3S3OA 3JB9G 4LDUA 3DB3A 3V8JA 4YRMA 3QSUA 4KR3A 4KR2A 2FVUA 1WQWA 5GAOl 2IY5A 4WJ4A 3DSQA 1I8FA 3WXMB 1Z7MA 2KR3A 1MMGA 4NCXA 4RDXA 2HZYA 5IH2A 2KXCA 1USYC 1UE9A 1VQOT 4AFSC 1VQ9A 1ARKA 4RUGA 1T3LA 5AYFA 4J6XA 4X9CA 3P8BB 2FO0A 3KFUA 4XTYA 3OYAA 3M4QA 3PTAA 1Y57A 4TWAA 3CCLQ 1B34A 1N9RA 2MI6A 4ZGJB 1CKAA 5HKCA 3CC2A 2NYSA 5C51B 2ZPFB 5KYYB 2W10A 2QA4T 3M54A 1FMKA 4PNOA 3P8DA 5ECAA 1YJ9A 2KDSA 3JCMb 4PJNA 4H02A 1SERA 4UP8A 2ALYA 1KJWA 1BI3A 2X35A 1MMNA 3HRUA 2GQIA 1JJCA 3CC4Q 4C0FA 1Q81C 1KHCA 3CCQT 4F16A 4PFPA 1NEGA 3EG2A 1T0HA 2F1LA 1KOGA 3NEMA 2C8MA 4BW9A 1N8RU 1KMNA 1KFZA 5FLXE 5CKDA 2EYZA 3CCVT 4KT0E 2YSQA 3QZ9B 4Y91A 2DF6A 1QVFP 1N8RR 2O9VA 2C06A 4M78D 5GAMf 4M75A 3ER0A 1PD0A 4P75C 3QIIA 3QJYA 5KYXA 2DKGA 4YRRA 2VC8A 3BDUA 3BE3A 1VQ8T 4LVJA 3H0FA 2RJEA 2BZXA 2QTXA 4F7UE 3P8HA 5D6WA 2ZZDA 3VJPA 4HWSA 3MP1A 5GANh 4LE9A 3CBPA 3MKDA 4J6WA 3CD6T 1EQRA 4M77F 4M7DE 1GCPA 3A8GB 2J6FA 4HVVA 3C94A 1X69A 1UHFA 3CCEQ 2PQWA 2ZTGA 1X2KA 3LC0A 2LQ8A 2LQWA 5LJ5j 2ZR2A 2HCKA 1G83A 1C6VX 3NETA 1TUCA 4MMKA 1H92A 2YRVA 3TQ7P 1KHIA 2OJ2A 5GMKm 1ZUKA 2EGAA 1PKSA 1VA7A 2E6ZA 1WHGA 1S72T 1G2BA 4CH3A 4QQGA 1YHQQ 2E5KA 1BKBA 3JB9D 1Y7XA 4E51A 5A0DA 4TVAA 4IIOA 4O6JA 3QDFA 1ZX6A 4C8QF 3R07A 3BDLA 3TCJA 1ATIA 2PUKB 3PE0A 1PC0A 2RHZA 3QO8A 1O75A 4JPBW 3HFZA 4R56A 1TG0A 5GAOq 1HYOA 3MF1A 2E5QA 2IY5B 2DBKA 4PG3A 1Q82U 2JT4A 1QCOA 3HTRA 1VQLA 3HKSA 4MZPA 1Q82R 3RUXA 1QCNA 5LJ5g 2DILA 3M58A 3VQVA 4J15A 1UECA 4XTXA 2BE7D 4ZGEB 5KYNA 2P0PA 3A5YA 1B34B 4XAXB 1V76A 2MPXC 2ZPGB 4XEOA 2RMOA 4C92E 2KI7A 3CCLT 3VS6A 3RMQA 2GTJA 1KQ1A 2WSCE 4P71C 1KC8U 2DL5A 2KT1A 5GAOn 2DYIA 4DBHA 1KC8R 2DRKA 4FT2A 2MOXA 4EX5A 5J3BA 3NENA 2ALYB 4BE2A 2KYBA 4M75C 4J9IA 1OI1A 4FM4B 4ZTFA 2FRYA 1JJCB 2L2PA 5DY9A 5M9OA 1G5HA 1Q7YU 3CC4T 1J3TA 3GBQA 2GNCA 2FZCB 2VUBA 4C92G 2DQ3A 5FRMA 6AT1B 4NL2A 2FYKA 3RKXA 3KFVA 2A08A 4AFUC 1Q7YR 1ASYA 1UEBA 2QI2A 3E19A 4DBQA 3JCMJ 3CC7Q 2E3IA 1KK7A 2JUFA 1K1ZA 2M9UA 1QWFA 2JNGA 1YITT 4M75B 1EVKA 2XGTA 5KYXB 3CQTA 4L6V5 1N5ZA 1B3QA 2KEAA 4DOVA 4A63B 3JB9H 1IXDA 3OQ5A 1A0NB 5CKEA 4YRJA 1G8XA 1VQNT 2BZYA 3EGUA 4AG2C 1I5LA 5LJ3h 1TXQA 4OB0B 3MQZA 4WJ3M 3IKLA 3HY0A 2GFUA 3GNFB 4ELZC 1VQ6A 3HXWA 4P3PA 1BK2A 2DZCA 1M90U 4C0GA 1T3SA 3PFSA 4H2UA 4OMFB 2P5IA 1C0AA 1M90R 3M55A 1NLOC 3KBGA 3MF2A 2HL5C 3EGDA 3M9QA 4C0DC 2F2WA 1OULA 3CMEQ 1WGSA 2K6DA 4OF1A 2D8JA 2QASA 2AK5A 4CH6A 5CIUA 3M0SA 5GANf 4HCCA 4Y28E 2CJBA 4EIKA 3H41A 1PHTA 2A7YA 3G71A 1K8AU 5KYUB 2DX1A 3QHSA 4B9XA 2DBMA 4XTWA 4HWRA 4YCUA 1YBYA 1K8AR 5IHNA 3HP9A 4HCBA 4TVAB 4C0DB 1VYUA 3PIPA 2HAXA 2CDTA 4F04B 1ABQA 4KGVB 3HFZB 5I2SA 5IHKA 4IKFA 5LL6S 2FZKB 5GAN7 2RN8A 4P73C 5HK0A 2DEUA 4LVIA 1AWWA 3JCMV 4PFOA 4X5OA 5DM7R 1ZA2B 4FYVB 4H2WA 2E5AA 2X4JA 1KD1C 3QPHA 4WCIA 2Q7HA 1YN8A 2Y4XA 4EO4A 4E7JA 4AH6A 2DXCA 2H3EB 4ZTJA 1G3TA 2DJZA 2IG0A 3L1AA 5GAN2 1OX9A 2O01E 4C92A 1I5OB 1NPRA 2R57A 4A4FA 4KUIA 4Q15A 1NJ8A 4PK4A 4C92D 2YRDA 3QO3A 3OMCA 1V29B 3HXUA 2EYYA 4E6RA 2K3YA 2L5QA 3UF4A 2QXFA 3CCRA 3NGPA 1S1NA 1H3HA 1NJ1A 1OYXA 3RNJA 4CH5A 5HCKA 2IIMA 3CPFA 3A1PA 5KYWB 3CC7T 1HK9A 5KCOA 1JB0E 3O8VA 1X6OA 1WHJA 2O9SA 1OQKA 5GAMd 1VQMA 2LJ1A 2BUDA 4H2YA 2PVOB 3HFVA 2ROLA 4QQ6A 1BCMA 1AHJB 2GQVA 3EG1A 2ZT7A 3H6ZA 3HTZA 5C6SA 1YI2Q 2H8HA 3ASKA 2RA2A 1W1FA 2JXBA 3QJ6A 1KQSA 2L8DA 4O5VA 1NJ5A 1KQ2A 2KK4A 3JB9I 1W2BA 4CC3A 3TSWA 1M2VA 2OI3A 4YRQA 3EGDB 2C7IA 3E9IA 2JM9A 3G4SA 2P84A 1HXDA 2DK3A 5GMKe 1QMCA 2CZ6B 1BI2A 2VVKA 5J39A 1VQ4T 3CMET 3U23A 4E7ZA 3PVLA 2AZSA 5I21A 4ESRA 3C12A 1YIJT 1BIAA 3QDRB 2PMEA 2K5IA 1W6XA 2YUQA 4DOWA 2FG0A 2XMFA 3CCJA 1WJQA 1YNZA 1HD3A 4J7IA 1HTTA 2V1QA 1IGQA 2P0KA 4HVUA 3W3SA 4YCWA 2Q5HA 3OW2S 1WX6A 4RTWA 2HSEB 1YJNT 2V1RA 3MP8A 1GCQA 3S6WA 4LD9K 2JW4A 3VUZA 5C52B 1IHVA 1RAFB 2OAWA 1VQOQ 1AWXA 2O2OA 4KH0B 3ULRB 1EVLA 3L2ZA 1PSFA 4DA4A 4XU2A 4M78F 1W2BP 3LWHA 2F5TX 2ZPIB 2QQ9A 4OVAA 1X01A 3PNWC 4ZTUB 1NYFA 2DE0X 4MZTA 2L3RA 5GAMj 4RG8A 2KRNA 2NS6A 5A0LA 2G4CA 4XK8E 1RLQC 3OBWA 4EMKA 5KYYA 1V1CA 1Y0MA 2DMOA 3MEVA 4VUBA 4PJOC 2DIQA 1G5IA 2QDYB 2DTOA 3BFMA 3FJ5A 4F14A 5IT9E 4OB2B 4DBFA 2OTJA 3RMSA 2DA9A 2EJFA 4YRFA 3CCQQ 3MEAA 2KBTA 3ME9A 1X2QA 3UATA 4ZN3A 1QVGS 1R0BG 2MWOA 3H0IA 1U3OA 2DVEA 2RI2A 4R55A 3OS2A 2LNVA 3OD1A 4M75E 1N9SA 3CCVQ 4PJOB 2RHQA 1VUBA 4RTZA 2QK0A 4D8DA 4E7SA 4YROA 3UWNA 2ZPEB 2AHJB 3QBYA 2C0TA 1G3WA 2O4XB 1VQ8Q 3LGFA 5GAOm 2CUBA 1K4US 1X54A 3HHTB 1NLPC 4FT4A 4J6YA 2DD5A 2XD0A 3JCMg 5GMKh 4M75G 3HRSA 2ENMA 4WF2A 1H4VB 3CCMA 3M0QA 3EFOA 5AT1B 2LT4A 3OB9A 1MV3A 4MDXA 3VQXA 3OYBA 1C1AA 4TTVA 2RHIA 3OMGA 1M2VB 2COZA 2HD0A 1N9WA 1AT1B 3CMAA 3HXVA 1D0YA 1S72Q 3MCAB 4JRQA 3CCST 1K0XA 4LDYA 1GCQC 4JS4A 1JEGA 3A7UA 4OMQA 2ZT6A 5GAN6 1AZEA 4YRKA 2CREA 2K9GA 5GANd 4CC7A 1H641 4KQEA 2HBWA 2QQSA 1UDLA 4NL3A 4LD6A 2LX9A 2G3RA 3G6ET 2QQRA 1UGRB 3A31A 1I0CA 2D0QB 1WJRA 3BY7A 2OTLT 2QG9B 3JRZA 4BE1A 2EW3A 2XICA 3R6OA 1U8RA 3MEYA 4G84A 1I4K1 2QA4A 1M27C 2E10A 2D8HA 4BUGA 1M5Q1 1WLPB 2CP3A 3VS5A 4A4HA 2NLUA 4EMKC 5HK3A 2KQWA 2QGFB 1W4SA 2B8AA 2CZ0B 2DETA 5A0GA 4D6WA 5KE3A 4LUDA 3QXEB 1QVFA 1VQKA 2MWPA 4BE0A 4AG1C 3L2WA 4C5HA 1M1GA 1BBUA 1CSKA 1TH7A 3TUPA 1KD1U 5GMKi 2PTKA 3VS7A 3MJXA 1VQ5T 1KD1R 3BJUA 2KSSA 5D6YA 4H2VA 4EMKB 2L0AA 2YHTA 2FB7A 4QQDA 3RR6A 4XU1A 1SPKA 1VIEA 4XTZA 1FX7A 1SRYA 2VKNA 1OZ2A 4RCBA 1XNIA 1QE0A 4MDWA 3MP6A 4HCKA 4F7UF 4OMNA 3P8VA 4LDXA 2ZZGA 3EH1A 3P8TA 1JRIA 2R58A 2HDAA 2P0QA 2JS2A 4M7DF 3JCMc 2E3HA 1YJWQ 4M4ZA 2B86A 3HSBA 4KGXB 1AVZC 2RNAA 4P71A 1T0JA 2RHQB 1PM3A 3V8KA 3EFSA 3REAB 1YITQ 1M1KC 2VXEA 3GIBA 1HJDA 5GANj 1D3BA 4FU6A 1VQ7A 1D1BA 3CCUQ 4M75D 3REUA 1VQPA 4A54A 2ZT5A 1DJ7B 4QVZA 1VQNQ 3PIOA 4M7AA 3CXCS 3CC2T 2EQUA 1KMMA 1UGSB 2FPDA 2RHUA 4J5YA 5GAN4 4M7AD 1K73C 1YJ9T 4WTOB 1XQHA 4A53A 1LVKA 5I11A 2ED1A 3EFOB 4J9DA 2LJ0A 4NOYA 4UC4A 4TQDA 2KRMA 2RO0A 4OP0A 1NJ6A 2RI3A 2RK2A 2DEQA 1B76A 2XTIA 4F17A 2HMAA 4FL6A 2F5KA 5LJ3e 1ZQ1A 1JU5C 1ACMB 4RTUA 3LYIA 4A4KA 4XU3A 3H9NA 2AIRB 2EJGA 8AT1B 3V7SA 2CT4A 5KYUA 3OYFA 3CXCA 3X28B 2BIVA 2QHSA 1WXTA 2HQHA 3RERA 5LJ3d 2KXDA 2Q7EA 3HPWA 3I9QA 4C92F 4CS4A 1UFFA 3DLMA 3X26B 4E7IA 1JXMA 2A3LA 2WSFE 2XI9A 1SKUB 2KRSA 3PMIA 5LJ5h 1E22A 3FIFA 2Z0WA 3L2QA 2RHSA 2VYTA 3VS3A 2CH4W 3UPUA 2QQAA 3PT9A 3GP8A 3SB2A 2X4WA 3CBMA 1NJ2A 2ZCEA 2RH2A 3JSCA 4EPCA 5C0MA 3RBBB 3X24B 2RB6A 5L23A 1L0WA 1ZHIA 2VXFA 2ZR3A 3OSVA 4B9WA 3RGLA 2A28A 1OOTA 1H4TA 3VV0A 4JJCA 2RHXA 4L87A 3UGTA 1E7OA 1EX4A 4AT1B 5GAN8 5GAN3 3TU4K 1D1AA 5CO7A 4HVCA 2M1HA 4PHCA 4BI3A 1PYSA 4J9BA 3CXCP 1NYRA 1QF6A 2NWMA 2D9TA 4M77G 3OS5A 4JS5A 1UTIA 4P72A 3V7CA 4P73A 4OMPA 3CEYA 1UGVA 2CSQA 2L89A 1M8MA 4PJOE 1LYLA 3VRZA 1UG1A 3L4GB 3A32A 4BB7A 2LZ6B 1EFNA 1RUWA 2V8KA 4OB3B 4OMLA 3RKYA 3SD4A 3E9FA 4M7AC 1CKBA 2CJ9A 2YLCA 1MNDA 3UA6A 5GMKl 1YJWT 1NNHA 3EHRA 4RMOA 4K88A 2CT3A 5KYWA 1VIFA 3OYLA 3CCEA 1YCYA 2HNIA 4KGZB 1NBEB 2RJCA 3R6NA 1D3BB 5ELNA 1TTHB 1D0ZA 4PJOG 3IG2A 4C8QG 1UUEA 2K2MA 1GRIA 2RJDA 2Y4YA 3CCUT 2ZCFB 4A4GA 4M7AB 3NPFA 2FHDA 4HWOA 2EQMA 4K86A 3HXYA 1YHQA 5CQXA 2L3PA 3WVEB 3TVTA 4C0ZA 2D0NA 1K9MU 4YRIA 2J3MA 4V2SA 2E4HA 4FIBA 1M3BA 1WXBA 4IIMA 3UH0A 2LCSA 1K9MR 3PMTA 4XEMA 2ARUA 3I35A 1K0SA 2LJ3A 4E2FB 1RABB 4PL6A 1ZSZC 1VQ4Q 2QQBA 2DQ0A 4AFZC 3QZ5B 1YIJQ 2A8EA 1BIBA 1LNXA 1BBZA 1YP5A 2F2XA 2J6OA 4JJBA 3ZL7C 2K3BA 2YUOA 3TSZA 2DIGA 4PLLA 4E47A 2YXYA 4J83A 4YTLA 4CC4B 3J80E 4N0AA 3KXTA 1K9AA 3I5SA 1NZ9A 3PZCA 1YJNQ 1JQQA 1ZSZB 4J9CA 2LX7A 1B07A 3MEUA 1IREB 2JTFA 3FRNA 2RK1A 3VBBA 1ASZA 1WPYA 1AOJA 2RQWA 3UDCA 2ZNJA 2RHSB 2A36A 3EH2A 2DM1A 2E3CA 2EYXA 2KAFA 4ZNXA 1NM7A 2FPEA 4RKUE 4P72C 5E3IA 1O9SA 2I4NA 2V8JA 3J81E 3NMZC 4M77A 1PRLC 4YP0A 3CPWS 3I56A 2CP2A 3UGQA 1FYFA 5LJ5f 3LH5A 4M77D 3QNEA 1SETA 2DXUA 2IPOB 1Q86C 1UGQB 2K2VA 1PYSB 2RJFA 3EFRA 4HVWA 4LDWA 3RKWA 1FXXA 4YYEA 1MMDA 1M9SA 2LQNA 2FL7A 2M02A 4OGCA 1Q81U 4L5GA 2EQJA 1BBWA 1MNEA 1Q81R 1NYGA 1IB8A 2PU9B 1WFWA 4H2XA 4Y92A 1AWOA 4TVRA 2CGHA 1PSEA 2ZNIA 3OYDA 4PJOA 1W66A 4C8QA 3LSQA 1QQJA 1M1KU 3A8OB 5IHIA 4KH1B 1QVPA 2ECZA 4PJOD 1IZ6A 4CC2A 1M2OA 4C8QD 1M1KR 4HT4A 2DL4A 4FYYB 5CKBA 4GLKA 2O4XA 3J7AF 1GXIE 4JUVA 2L3SA 1X75C 3VYGA 5KE2A 1JJ2S 2DJQA 3M56A 3T9NA 5GJVB 4J9GA 3H8ZA 1OPKA 4Z02A 3CMEA 2EGEA 4JRKA 2Q5IA 2A37A 4RTVA 1GBRA 2LCCA 3BW1A 1N8RC 1RADB 2CZ1B 5IXFA 1E1OA 2YUNA 3OYYA 2I2LA 2W0ZA 3M0RA 3AHUA 2D1XA 2OTJQ 4H2TA 2CUDA 3LWIA 2ZZEA 1EZZB 4QVDA 5DLOA 3URGA 1H4QA 1WI7A 4RTTA 4N0AC 2CSIA 2VGMA 1QWEA 2OAUA 2MK5A 4EDUA 3CCSQ 1VOMA 2PNIA 4BI4A 2ZPHB 3CPWP 3CCRT 4WI1A 1BI0A 2VASA 1AZGB 5LJ3f 1SESA 2KROA 3TREA 2CIMA 3IKMB 1UB4A 3TEGA 2ZIMA 4HT9A 3GF5A 4C5EA 2ZXFA 5HGQA 2RHYA 1TUGB 5GAN5 3G6EQ 1QP2A 2FPFA 4FYXB 2CS7A 2OTLQ 2PMFA 1QCFA 5CK9A 4M77C 4P3OA 1WNLA 2SEMA 1NPPA 4KUDK 5CR2A 3LSSA 4HT8A 2DU5A 1ZBJA 1ZA1B 2DXBA 3GNGA 3VU3C 2DO3A 2YWWA 2QEXA 2CKKA 3A8LB 1M3CA 2HEQA 3OSSC 2SRCA 3A8HB 3S3NA 4M77B 4M75F 3I55Q 2ARSA 1VQ5Q 3IALA 4KRTA 1M30A 4L59A 2JOYA 4HKEA 2GFAA 2KMTA 1X2GA 3VKIA 2LDMA 4BDYA 2F69A 2EYQA 3OW2A 1YCSB 1E6HA 4C8QC 3OA6A 1RAAB 11ASA 3EHQA 2LVMA 4UPAA 2GBQA 1F1BB 2J06A 4RTYA 2PVGB 3HL8A 2XK0A 2BTTA 5FWBA 5FU7C 4PJMA 4HWTA 4KULA 2RQVA 4H2XB 3EGXB 4ZN1A 3Q1JA 3V7RA 1VQ9Q 4C8QB 1R8OB 4JJDA 3CBOA 3JCMh 3JB9F 3I5RA 1YI2A 1NEBA 3E2UA 1WYDA 4CS3A 5GMKj 4M7AE 3HRKA 3GPLA 5C53B 4PJJA 1FMVA 3M59A 4ORZA 1PG5B 3M4GA 2P4RA 2CP0A 1Q95G 2EQKA 3CC2Q 5FU7B 5GAMg 4NS5A 4LDVA 2DZ9A 2EYWA 3SEMA 3OW2P 4LVLA 1YJ9Q 5F5WA 2GCXA 2VB6A 2DTIA 4BDZA 1QVGA 1M4ZA 2GTOA 4MZMA 3FLGA 1MUZA 2JN0A 3REBB 5KH6A 4M7AG 2OTJT 3C95A 1M3AA 1H4SA 5FW9A 5EG2A 3RL6A 1E1TA 1OZ3A 4FW2A 2DRMA 5HY6A 4Z88A 2XU8A 3C0CA 1YFTA 2RPNA 2FZGB 2CP5A 1AWJA 3A74A 3AT1B 1VQOA 4RQEA 2ZIOA 1SHFA 1M90C 1ADYA 3E1SA 3KUFA 2JS0A 1MV0B 2AMCB 3OYCA 2JJ9A 2NUPA 3L2VA 3X25B 4DEXA 4IUUA 1NE8A 3MPUB 1KIKA 2LRQA 2E65A 4XTUA 4YREA 1U5SA 3NHNA 4GBQA 3PCOB 1WZOA 2DYBA 5EC7A 1QVGP 1LOJA 4Z8AA 3S3MA 3EG3A 3VQYA 3HY1A 2XKOC 1TU0B 2ED0A 1PRMC 3META 3JCMX 2I4LA 4HCZA 3A5ZA 2ZAEA 3OYJA 4PJLA 2QDLA 3M57A 2HKNA 5A2QE 2R5AA 9ATCB 1E6GA 2MF2A 3N5BB 1M1FA 2AKKA 4YRLA 2MIOA 3CCQA 4X9DA 2CZ7B 4J9HA 3OYIA 3CMAT 3THKA 5LJ5e 4P74A 1IGUA 4YCVA 1Q86U 2AT1B 12ASA 3I55T 3QTCA 3M4YA 2JVVA 3CCVA 1YFSA 3MHXA 4HWPA 1Q86R 2ZPBB 1N27A 3NTIA 2QAZA 1Y96B 1RI9A 1WJSA 2DNUA 5LJ5d 3HXZA 4P3NA 4J9FA 1AD5A 1RAGB 4QVCA 1HC7A 3JAME 4PFZA 5K1XA 2DLPA 2HBPA 3FEOA 1B70A 2HKQB 3M0PA 1VQ8A 1MGQA 2HSPA 5L8RE 2EL9A 1SG5A 2KE9A 2KY9A 3L4GA 3HRIA 3CD6A 4ATOA 3JV3A 1VQLQ 1OEBA 1IRXA 3OYHA 4C5IA 3G1JA 1WYXA 5CQYA 1RAIB 2XDDA 1OU8A 1VQ9T 1WHHA 2AKLA 1VQKT 1ZUYA 4J9EA 1K76A 3HFOA 1WA7A 1GFCA 4Z89A 3OYMA 2EGCA 2KGTA 4OLFA 1YWOA 3SWNA 2HQXA 3E9GA 2JMCA 1EIYB 3ZEHA 4M78A 1S72A 5I22A 3OYEA 1BB9A 1W70A 2Y90A 1VYTA 5GAOr 3ICAA 2VGNA 2KVQG 3JCMf 4II1A 2X4YA 2LT1A 2E41A 3C4SA 1WXUA 2M0OA 3RACA 1B7YA 5K1PA 2YRCA 2M0YA 4JLIA 3VUBA 2FRWA 5CKHA 4ZIBA 2HL3A 4E7KA 1NJIC 1BU1A 4YRSA 4RCCA 4J8OA 4RQFA 5IAYA 2LP5A 2ODRC 5D6XA 1JXOA 2BZ8A 3TEEA 2MAMA 1U06A 8ATCB 2K5FA 2WACA 3QO7A 3OYNA 4YRGA 4UP9A 1Y71A 1YGBA 5GANg 2NUPB 3INZA 1HSQA 1VQ7T 1ZSZA 1TUDA 3V8LA 3VRYA 4F7UG 1VQPT 3CCLA 4E7LA 3EG9A 5D7UA 1PNJA 3OBYA 3FDRA 4CRIA 4P74C 3NTHA 4N4HA 4M7DG 2MYSA 1VQ6Q 2O31A 2E70A 2XHCA 4MMLA 1TSFA 1Z9QA 1FWZA 1ZLMA 4M77E 2RF0A 4PJOF 1MHNA 3A5ZB 4GY5A 1WHKA 4FW1A 1BCOA 2LQKA 5FU6C 1R0CB 5CVIA 1QW1A 4IUVA 3CC4A 2F2VA 3RF1A 2AKWA 1SRMA 1YJWA 4FYWB 2NUTA 4KBMB 4OMOA 3G71Q 1RL2A 1OPLA 5GAOp 1G3SA 2KNBB 2I4MA 2DPPB 1YITA 2K57A 2DL3A 1RAEB 2DVJA 2K3XA 3X20B 2XIDA 4EMHA 3REXA 1SEMA 4DBRA 1B70B 1NYQA 2OX7A 4JRIA 5FU6B 4C8QE 3CCUA 2NUZA 1QKWA 2COWA 1X43A 1VQNA 2EBPA 3SWNC 3OS1A 4LVKA 2QHVA 4P5NA 2DFUA 4M78C 3JCMW 4E7HA 1X6BA 3IQLA 4XTVA 2E64A 1U1SA 4CI0C 4Q5WA 2GF7A 4JZ4A 2RQTA 1VQLT 2RM4A 1FYNA 3EAEA 3CMQA 3FC3A 5LJ3j 3I56Q 1SRLA 4N4IA 3MO8A 2X3XD 2EIFA 2X4XA 1ZUUA 4LUEA 4ME7A 2LCLA 2FEIA 1FMWA 4XU0A 3RIRA 3SWNB 2DL7A 3M53A 1SF9A 4M78B 1Y07A 1I1JA 5IXBA 2DDZA 3OY9A 4BY6C 3I7FA 3QWXX 5KCHA 1RLPC 2RQRA 3LGLA 4B6MA 3OYGA 1I81A 1UGPB 3L42A 2I4OA 3DKMA 1VQZA 4H2SA 1B7YB 2JTEA 2ZGWA 1WHLA 3O5ZA 3M0TA 1WQ7A 3CCRQ 1E24A 4EMGA 3M5AA 4JJNK 2O88A 4DQ2A 2P4TA 4BY6B 3SHWA 1WHMA 4AFQC 4F7UA 1AEYA 1IHWA 4RG2A 3PGGA 3H0HA 1B7TA 4YPFA 3CCET 3L2UA 2CP6A 2ATCB 2C0IA 4M7DA 3SDZA 1YB3A 1IO6A 2G6FX 4C5GA 1XTDA 2EKOA 5I2MA 1VQMQ 4ZTZB 2BKDN 3NTKA 5LJ3g 2RQUA 4M7DD 3LLRA 4GLMA 3QUIA 4YRNA 1N6AA 1R77A 1X27A 1BYMA 1M8VA 2JZ2A 5GJWB 1I07A 1TWBA 5FWCA 3EG0A 3EG9B 4JZ3A 1MMAA 2EFIA 2E6NA 4QW2A 1PD1A 3ZBDA 1XJWB 2PVDB 4G85A 1YHQT 1X55A 3UT1A 1VQ6T 1Z9ZA 1XOVA 1PCXA 3A7AA 4TVYA 2I0NA 4DEYA 3VS1A 4BD3A 2YT6A 3HRTA 5CAIA 4IUQA 4J7FA 3G4SQ 1D1CA 3VS4A 3TEHA 1VYVA 2DTHA 4OB1B 1J5WA 2AKWB 2X3WD 4FSXA 2NUTB 3QG1A 1X6GA 3PVQA 4TQFA 2EPDA 1QKXA 1SSFA 3QYGB 2CP7A 2KT8A 3CC7A 1ZSGA 3G71T 2CJAA 4QKUA 3CCJQ 2C0OA 1JO8A 2ABLA 2ZT8A 2QHUA 2V26A 2J6KA 1YFRA 2DL8A 4CS2A 2RI5A 2P0LA
chains in the Genus database with same CATH topology
3RESA 3HFNA 5CCAA 2DD4A 5ELOA 3ERRA 3CPWA 3QYHB 3LX7A 2ZINA 2J3LA 4CH4A 2E1HA 4Q6GA 3SFMA 3NFCA 1ADJA 4OGEA 2HQEA 3I56T 1VQ4A 1U1TA 3GOXA 1KQSS 1G3YA 1YIJA 1W2BS 5GAMe 2QHTA 1K73U 3M4PA 1B8AA 3JCMe 4O2DA 4UP7A 4XQ3A 1X56A 1Z7NA 1WLEA 1RI0A 3L2RA 2ZZFA 4M7DC 2DAQA 3UFGA 1EFWA 3A7RA 2XG8D 1YJNA 1NJIU 3JCMd 1ZBXA 1P92A 3VQWA 4JDSA 1JJ2A 4RMFA 4F7UB 3DB4A 2WSEE 3JCMQ 2AMCA 3G7ZA 4YRTA 4M7DB 3JB9J 1JBMA 4IUTA 3P8YA 1IL2A 1VQMT 1G51A 3PCOA 4BACA 4JRPA 2D6FA 2EWNA 2EJ9A 2CYZB 2DXTA 2EAYA 2K4YA 4DPGA 3FJPA 5FRNA 1BI1A 4JLGA 5KNNA 1KG1A 4IUPA 3TEHB 3G4ST 3E9HA 2MMPA 4A4EA 1Q82C 4M7AF 1Y96A 4TVWA 2ARTA 2DU7A 4C92C 1LJOA 3G1ZA 3MEWA 3CCJT 2R5MA 4PKCC 5CKFA 1WU7A 2V8IA 3LW5E 5FROA 3ZFJA 1USYA 1KC8C 3HXXA 5GAMh 4X34A 1GGMA 4BWAA 4C92B 3LH0A 4YDQA 4LNSA 1H3ZA 2QEXT 5IN1A 4M78E 5DLQE 5J26A 4ZGDB 2K5LA 3FB9A 4YRCA 4LVMA 1Q7YC 3CCSA 1EIYA 2XDPA 3QKJA 3WVDB 3DLLA 2H3JA 2VV5A 1QP3A 2RD1A 4PLIA 1X2HA 4M78G 3G6EA 1RIQA 4N4GA 3QO5A 2OTLA 4YRPA 4ELYC 2Q7GA 3VYHB 4IURA 2YLBA 2LTOA 1G5VA 4K87A 2E12A 4HA8A 4P75A 1K9MC 1YI2T 3OS0A 2PUOB 1EOVA 2M16A 2IVWA 5GANe 4BI8B 3I55A 1VQ5A 3A8MB 1QVFS 3GLXA 2XDBA 3JCMP 3WQZA 1EIFA 2JTMA 3NELA 3F70A 1K8AC 3CCMT 2LC4A 2ODRD 3OYKA 3S3OA 3JB9G 4LDUA 3DB3A 3V8JA 4YRMA 3QSUA 4KR3A 4KR2A 2FVUA 1WQWA 5GAOl 2IY5A 4WJ4A 3DSQA 1Z7MA 1I8FA 3WXMB 4NCXA 4RDXA 1USYC 1VQOT 1VQ9A 5AYFA 4J6XA 4X9CA 3P8BB 3KFUA 4XTYA 3OYAA 3M4QA 3PTAA 4TWAA 1B34A 1N9RA 2MI6A 4ZGJB 5HKCA 3CC2A 5C51B 2ZPFB 2QA4T 3M54A 4PNOA 3P8DA 1YJ9A 2KDSA 3JCMb 4H02A 1SERA 4UP8A 2ALYA 1BI3A 2X35A 3HRUA 1JJCA 4C0FA 1Q81C 1KHCA 3CCQT 1KOGA 3NEMA 2C8MA 4BW9A 1N8RU 1KMNA 5FLXE 5CKDA 3CCVT 4KT0E 3QZ9B 4Y91A 2C06A 4M78D 5GAMf 4M75A 3ER0A 4P75C 3QIIA 3QJYA 2DKGA 4YRRA 2VC8A 3BDUA 1VQ8T 4LVJA 2RJEA 2QTXA 4F7UE 3P8HA 5D6WA 2ZZDA 3VJPA 4HWSA 3MP1A 5GANh 3CBPA 4J6WA 3CD6T 1EQRA 4M77F 4M7DE 3A8GB 3C94A 2PQWA 2ZTGA 3LC0A 2LQ8A 5LJ5j 2ZR2A 3NETA 4MMKA 2YRVA 1KHIA 5GMKm 2E6ZA 1S72T 4CH3A 4QQGA 1BKBA 3JB9D 1Y7XA 4E51A 5A0DA 4TVAA 4O6JA 4C8QF 3R07A 1ATIA 3BDLA 3TCJA 2PUKB 2RHZA 3QO8A 1O75A 3HFZA 4R56A 5GAOq 3MF1A 2E5QA 2IY5B 4PG3A 1Q82U 1VQLA 3HKSA 4MZPA 3RUXA 5LJ5g 3M58A 3VQVA 4J15A 4XTXA 4ZGEB 2P0PA 3A5YA 1B34B 4XAXB 2ZPGB 4XEOA 4C92E 3CCLT 3RMQA 1KQ1A 2WSCE 4P71C 1KC8U 5GAOn 4FT2A 4EX5A 5J3BA 3NENA 2ALYB 4BE2A 4M75C 1OI1A 4FM4B 4ZTFA 1JJCB 5DY9A 5M9OA 1G5HA 1Q7YU 3CC4T 2VUBA 4C92G 2DQ3A 5FRMA 4NL2A 2FYKA 3RKXA 1ASYA 1UEBA 2QI2A 3E19A 3JCMJ 2JUFA 2M9UA 2JNGA 1YITT 4M75B 1EVKA 2XGTA 4L6V5 4DOVA 3JB9H 3OQ5A 5CKEA 4YRJA 1VQNT 1I5LA 5LJ3h 4OB0B 3MQZA 4WJ3M 3IKLA 3HY0A 2GFUA 3GNFB 4ELZC 1VQ6A 3HXWA 4P3PA 2DZCA 1M90U 4C0GA 3PFSA 4H2UA 4OMFB 2P5IA 1C0AA 3M55A 3KBGA 3MF2A 3M9QA 4C0DC 1WGSA 4OF1A 4CH6A 5CIUA 5GANf 4HCCA 4Y28E 2CJBA 2A7YA 3G71A 1K8AU 3QHSA 4B9XA 4XTWA 4HWRA 4YCUA 1YBYA 3HP9A 4HCBA 4TVAB 4C0DB 3PIPA 2HAXA 3HFZB 5I2SA 4IKFA 5LL6S 5GAN7 4P73C 5HK0A 4LVIA 3JCMV 4X5OA 5DM7R 4H2WA 2E5AA 2X4JA 1KD1C 3QPHA 2Q7HA 2Y4XA 4EO4A 4E7JA 4AH6A 2DXCA 4ZTJA 1G3TA 2DJZA 2IG0A 3L1AA 5GAN2 2O01E 4C92A 1NPRA 2R57A 4A4FA 4KUIA 4Q15A 1NJ8A 4C92D 3QO3A 3OMCA 1V29B 3HXUA 2K3YA 2L5QA 3CCRA 2QXFA 1NJ1A 1OYXA 4CH5A 3CPFA 3CC7T 1HK9A 5KCOA 1JB0E 3O8VA 1X6OA 5GAMd 1VQMA 2BUDA 4H2YA 2PVOB 3HFVA 4QQ6A 1AHJB 2GQVA 2ZT7A 3H6ZA 3HTZA 5C6SA 3ASKA 2RA2A 3QJ6A 1KQSA 2L8DA 4O5VA 1NJ5A 1KQ2A 2KK4A 3JB9I 1W2BA 4YRQA 2C7IA 3E9IA 3G4SA 1HXDA 2DK3A 5GMKe 2CZ6B 1BI2A 5J39A 1VQ4T 3CMET 5I21A 3C12A 1YIJT 1BIAA 3QDRB 2PMEA 2K5IA 4DOWA 3CCJA 1WJQA 4J7IA 1HTTA 2P0KA 3W3SA 4YCWA 2Q5HA 3OW2S 1YJNT 3MP8A 4LD9K 3S6WA 3VUZA 5C52B 1EVLA 4DA4A 3L2ZA 1PSFA 4XU2A 4M78F 3LWHA 2F5TX 2ZPIB 2QQ9A 4OVAA 1X01A 3PNWC 4ZTUB 4MZTA 2L3RA 5GAMj 4RG8A 2NS6A 5A0LA 2G4CA 4XK8E 3OBWA 4EMKA 3MEVA 4VUBA 4PJOC 2DIQA 1G5IA 2QDYB 2DTOA 3BFMA 5IT9E 4OB2B 2OTJA 3RMSA 2EJFA 4YRFA 3MEAA 3ME9A 4ZN3A 1QVGS 2MWOA 2DVEA 2RI2A 4R55A 3OS2A 2LNVA 3OD1A 4M75E 1N9SA 4PJOB 2RHQA 1VUBA 4YROA 3UWNA 2ZPEB 2AHJB 3QBYA 1G3WA 2O4XB 3LGFA 5GAOm 1X54A 3HHTB 4FT4A 4J6YA 2DD5A 2XD0A 3JCMg 5GMKh 4M75G 3HRSA 4WF2A 1H4VB 3CCMA 4MDXA 2LT4A 3OB9A 3VQXA 3OYBA 4TTVA 2RHIA 3OMGA 2HD0A 1N9WA 3CMAA 3HXVA 3MCAB 4JRQA 3CCST 4LDYA 4JS4A 3A7UA 2ZT6A 5GAN6 4YRKA 5GANd 1H641 4KQEA 2QQSA 4NL3A 4LD6A 2LX9A 2G3RA 3G6ET 2QQRA 1UGRB 3A31A 2D0QB 1WJRA 3BY7A 2OTLT 3JRZA 4BE1A 2XICA 3R6OA 1U8RA 3MEYA 4G84A 1I4K1 2QA4A 2E10A 4BUGA 1M5Q1 4A4HA 2NLUA 4EMKC 5HK3A 2KQWA 1W4SA 2B8AA 2CZ0B 5A0GA 4D6WA 5KE3A 3QXEB 1QVFA 1VQKA 2MWPA 4BE0A 3L2WA 4C5HA 1M1GA 1BBUA 1TH7A 3TUPA 1KD1U 5GMKi 1VQ5T 3BJUA 2KSSA 5D6YA 4H2VA 4EMKB 2YHTA 2FB7A 4QQDA 4XU1A 1VIEA 4XTZA 1FX7A 1SRYA 1OZ2A 4RCBA 1XNIA 1QE0A 4MDWA 3MP6A 4F7UF 3P8VA 4LDXA 2ZZGA 3P8TA 1JRIA 2R58A 2P0QA 4M7DF 3JCMc 3HSBA 4P71A 2RHQB 3V8KA 3EFSA 1M1KC 2VXEA 3GIBA 5GANj 1D3BA 4FU6A 1VQ7A 4M75D 3REUA 1VQPA 4A54A 2ZT5A 1DJ7B 4QVZA 3PIOA 4M7AA 3CXCS 3CC2T 2EQUA 1KMMA 1UGSB 2RHUA 4J5YA 5GAN4 4M7AD 1K73C 1YJ9T 1XQHA 4A53A 4NOYA 4UC4A 4TQDA 2RO0A 4OP0A 1NJ6A 2RI3A 2RK2A 2DEQA 1B76A 2XTIA 4FL6A 2F5KA 5LJ3e 1ZQ1A 3LYIA 4A4KA 4XU3A 2EJGA 3V7SA 3OYFA 3CXCA 3X28B 2BIVA 2QHSA 3RERA 5LJ3d 2Q7EA 3HPWA 4C92F 4CS4A 3DLMA 3X26B 4E7IA 2A3LA 2WSFE 2XI9A 3PMIA 5LJ5h 1E22A 3FIFA 3L2QA 2RHSA 2VYTA 3UPUA 2QQAA 3PT9A 3GP8A 3SB2A 2X4WA 3CBMA 1NJ2A 2ZCEA 2RH2A 3JSCA 4EPCA 5C0MA 3X24B 2RB6A 1L0WA 1ZHIA 2VXFA 2ZR3A 3OSVA 4B9WA 3RGLA 1H4TA 3VV0A 2RHXA 4L87A 3UGTA 5GAN8 5GAN3 3TU4K 5CO7A 4HVCA 2M1HA 4PHCA 4BI3A 1PYSA 1NYRA 1QF6A 2D9TA 4M77G 3OS5A 4JS5A 4P72A 3V7CA 4P73A 3CEYA 2L89A 4PJOE 1LYLA 3L4GB 3A32A 4BB7A 3RKYA 4OB3B 3SD4A 2V8KA 3E9FA 4M7AC 2CJ9A 2YLCA 5GMKl 1YJWT 1NNHA 4RMOA 4K88A 1VIFA 3OYLA 3CCEA 1YCYA 2HNIA 2RJCA 1D3BB 5ELNA 4PJOG 3IG2A 4C8QG 2RJDA 2Y4YA 3CCUT 2ZCFB 4A4GA 4M7AB 2FHDA 4HWOA 2EQMA 4K86A 3HXYA 1YHQA 5CQXA 3WVEB 4C0ZA 1K9MU 4YRIA 2J3MA 4V2SA 4FIBA 3UH0A 3PMTA 4XEMA 2ARUA 4PL6A 2QQBA 2DQ0A 3QZ5B 2A8EA 1BIBA 1LNXA 2DIGA 4PLLA 4E47A 4J83A 4YTLA 3J80E 4N0AA 3KXTA 1NZ9A 3PZCA 3MEUA 1IREB 2JTFA 3FRNA 2RK1A 3VBBA 1ASZA 1WPYA 3UDCA 2ZNJA 2RHSB 2E3CA 2KAFA 4RKUE 4P72C 5E3IA 1O9SA 2I4NA 2V8JA 3J81E 4M77A 4YP0A 3CPWS 3I56A 3UGQA 1FYFA 5LJ5f 4M77D 3QNEA 1SETA 2DXUA 1Q86C 1UGQB 2K2VA 1PYSB 2RJFA 3EFRA 4LDWA 3RKWA 1FXXA 4YYEA 1M9SA 2FL7A 4OGCA 1Q81U 4L5GA 2EQJA 1BBWA 2PU9B 4H2XA 4TVRA 2CGHA 1PSEA 2ZNIA 3OYDA 4PJOA 1W66A 4C8QA 3LSQA 1M1KU 3A8OB 1QVPA 4PJOD 1IZ6A 4C8QD 4HT4A 5CKBA 4GLKA 2O4XA 3J7AF 1GXIE 4JUVA 1X75C 3VYGA 5KE2A 1JJ2S 3M56A 3T9NA 3H8ZA 4Z02A 3CMEA 4JRKA 2Q5IA 2LCCA 3BW1A 1N8RC 2CZ1B 1E1OA 3OYYA 2I2LA 3AHUA 4H2TA 3LWIA 2ZZEA 4QVDA 5DLOA 3URGA 1H4QA 4N0AC 2VGMA 2OAUA 4EDUA 4BI4A 2ZPHB 3CCRT 4WI1A 1BI0A 5LJ3f 1SESA 3TREA 2CIMA 3IKMB 1UB4A 3TEGA 2ZIMA 4HT9A 3GF5A 4C5EA 2ZXFA 5HGQA 2RHYA 5GAN5 1QP2A 2CS7A 2PMFA 5CK9A 4M77C 4P3OA 1WNLA 1NPPA 4KUDK 5CR2A 3LSSA 4HT8A 2DU5A 2DXBA 3GNGA 3VU3C 2DO3A 2QEXA 2CKKA 3A8LB 3OSSC 3A8HB 3S3NA 4M77B 4M75F 2ARSA 3IALA 4L59A 2JOYA 4HKEA 2GFAA 2KMTA 1X2GA 3VKIA 2LDMA 4BDYA 2F69A 2EYQA 3OW2A 4C8QC 3OA6A 11ASA 2LVMA 4UPAA 2PVGB 3HL8A 2XK0A 5FU7C 4HWTA 4KULA 4H2XB 4ZN1A 3Q1JA 3V7RA 4C8QB 1R8OB 3CBOA 3JCMh 3JB9F 1YI2A 1WYDA 4CS3A 5GMKj 4M7AE 3HRKA 3GPLA 5C53B 3M59A 3M4GA 2EQKA 5FU7B 5GAMg 4NS5A 4LDVA 2DZ9A 4LVLA 5F5WA 2GCXA 2DTIA 4BDZA 1QVGA 1M4ZA 4MZMA 3FLGA 2JN0A 5KH6A 4M7AG 2OTJT 3C95A 1H4SA 5EG2A 3RL6A 1E1TA 1OZ3A 5HY6A 2XU8A 1YFTA 3A74A 1VQOA 4RQEA 2ZIOA 1M90C 1ADYA 3E1SA 3KUFA 2AMCB 3OYCA 3L2VA 3X25B 4IUUA 1NE8A 2LRQA 2E65A 4XTUA 4YREA 3PCOB 1LOJA 3S3MA 3VQYA 3HY1A 2XKOC 3META 3JCMX 2I4LA 4HCZA 3A5ZA 3OYJA 3M57A 5A2QE 2R5AA 2MF2A 3N5BB 1M1FA 4YRLA 3CCQA 4X9DA 2CZ7B 3CMAT 3OYIA 5LJ5e 4P74A 4YCVA 1Q86U 12ASA 3I55T 3QTCA 3M4YA 2JVVA 3CCVA 1YFSA 3MHXA 4HWPA 2ZPBB 1N27A 3NTIA 1Y96B 1WJSA 5LJ5d 3HXZA 4P3NA 4QVCA 1HC7A 3JAME 5K1XA 2HBPA 3FEOA 1B70A 1VQ8A 1MGQA 5L8RE 2EL9A 3L4GA 2KY9A 3HRIA 3CD6A 4ATOA 3OYHA 4C5IA 5CQYA 2XDDA 1VQ9T 1VQKT 3HFOA 3OYMA 4OLFA 3SWNA 2HQXA 3E9GA 1EIYB 3ZEHA 4M78A 1S72A 3OYEA 2Y90A 5GAOr 3ICAA 2VGNA 2KVQG 3JCMf 4II1A 2X4YA 2LT1A 2E41A 3C4SA 2M0OA 3RACA 1B7YA 5K1PA 4JLIA 3VUBA 5CKHA 4ZIBA 4E7KA 1NJIC 4YRSA 4RCCA 4J8OA 4RQFA 5IAYA 2ODRC 5D6XA 3TEEA 2MAMA 2K5FA 2WACA 3QO7A 3OYNA 4YRGA 4UP9A 1Y71A 1YGBA 5GANg 3INZA 1VQ7T 3V8LA 4F7UG 1VQPT 3CCLA 4E7LA 3OBYA 3FDRA 4CRIA 4P74C 3NTHA 4N4HA 4M7DG 2E70A 2XHCA 4MMLA 1FWZA 4M77E 4PJOF 1MHNA 3A5ZB 4GY5A 2LQKA 5FU6C 3CC4A 5CVIA 1QW1A 4IUVA 3RF1A 2AKWA 1YJWA 4KBMB 1RL2A 5GAOp 1G3SA 2I4MA 2DPPB 1YITA 2K57A 2K3XA 3X20B 2XIDA 4EMHA 3REXA 1B70B 1NYQA 4JRIA 5FU6B 4C8QE 3CCUA 1VQNA 3SWNC 3OS1A 4LVKA 2QHVA 4P5NA 4M78C 3JCMW 4E7HA 4XTVA 2E64A 1U1SA 4CI0C 4Q5WA 2GF7A 1VQLT 2RM4A 3EAEA 3CMQA 3FC3A 5LJ3j 4N4IA 3MO8A 2EIFA 2X4XA 4ME7A 2LCLA 4XU0A 3RIRA 3SWNB 3M53A 4M78B 1Y07A 2DDZA 3OY9A 4BY6C 3I7FA 5KCHA 3OYGA 3LGLA 1I81A 1UGPB 3L42A 2I4OA 3DKMA 1VQZA 4H2SA 1B7YB 2ZGWA 1WQ7A 1E24A 4EMGA 3M5AA 4JJNK 4DQ2A 2P4TA 4BY6B 4F7UA 4RG2A 3PGGA 4YPFA 3CCET 3L2UA 4M7DA 3SDZA 1YB3A 4C5GA 1XTDA 2EKOA 5I2MA 4ZTZB 2BKDN 3NTKA 5LJ3g 4M7DD 3LLRA 3QUIA 4YRNA 1N6AA 1BYMA 1M8VA 2JZ2A 2EFIA 2E6NA 4QW2A 3ZBDA 2PVDB 4G85A 1YHQT 1X55A 3UT1A 1VQ6T 1XOVA 3A7AA 4TVYA 4BD3A 3HRTA 5CAIA 4IUQA 4J7FA 3TEHA 2DTHA 4OB1B 1J5WA 2AKWB 4FSXA 3QG1A 4TQFA 1SSFA 3QYGB 3CC7A 3G71T 2CJAA 2ZT8A 2QHUA 1YFRA 4CS2A 2RI5A 2P0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RES A;  3HFN A;  4RCB A;  5GAO n;  1QE0 A;  5ELO A;  4F7U F;  4EX5 A;  3ERR A;  3P8V A;  2ZZG A;  3NEN A;  2ALY B;  3P8T A;  4HWT A;  4M75 C;  1JRI A;  4H2X B;  2ZIN A;  4M7D F;  3JCM c;  1JJC B;  3V7R A;  2J3L A;  5DY9 A;  4C8Q B;  3HSB A;  4P71 A;  4CH4 A;  2E1H A;  1G5H A;  4Q6G A;  3JCM h;  3JB9 F;  1WYD A;  2RHQ B;  4CS3 A;  4C92 G;  3V8K A;  5GMK j;  1ADJ A;  2DQ3 A;  4NL2 A;  4M7A E;  2FYK A;  3EFS A;  3RKX A;  3HRK A;  5C53 B;  1ASY A;  2VXE A;  3JCM J;  1U1T A;  3GIB A;  3M4G A;  5GAN j;  1D3B A;  5GAM e;  5GAM g;  2DZ9 A;  2QHT A;  3M4P A;  4M75 B;  4M75 D;  1EVK A;  2XGT A;  3REU A;  1B8A A;  3JCM e;  4A54 A;  2ZT5 A;  5F5W A;  4O2D A;  4UP7 A;  4M7A A;  4XQ3 A;  1X56 A;  1Z7N A;  1WLE A;  3JB9 H;  2DTI A;  1KMM A;  2ZZF A;  4M7D C;  4J5Y A;  5GAN 4;  4M7A D;  3UFG A;  4YRJ A;  1EFW A;  2JN0 A;  3A7R A;  4M7A G;  1I5L A;  3JCM d;  5LJ3 h;  4A53 A;  4WJ3 M;  3IKL A;  1H4S A;  3HY0 A;  3RL6 A;  3HXW A;  4NOY A;  1E1T A;  3VQW A;  4TQD A;  4P3P A;  2DZC A;  4H2U A;  4OP0 A;  1NJ6 A;  2P5I A;  1YFT A;  4RMF A;  1C0A A;  2DEQ A;  4F7U B;  1B76 A;  2XTI A;  3MF2 A;  3JCM Q;  3A74 A;  2AMC A;  5LJ3 e;  4YRT A;  4RQE A;  4M7D B;  2ZIO A;  4XU3 A;  1ADY A;  3JB9 J;  2EJG A;  2AMC B;  3V7S A;  4CH6 A;  5GAN f;  1JBM A;  3P8Y A;  1IL2 A;  2CJB A;  1G51 A;  2QHS A;  3PCO A;  3RER A;  3QHS A;  5LJ3 d;  2E65 A;  2Q7E A;  4XTU A;  4XTW A;  4YRE A;  4HWR A;  4YCU A;  4C92 F;  4CS4 A;  3PCO B;  4TVA B;  2EWN A;  2EJ9 A;  2DXT A;  5LJ5 h;  1LOJ A;  1E22 A;  2EAY A;  3VQY A;  4DPG A;  3FIF A;  3HY1 A;  3FJP A;  2RHS A;  3JCM X;  2I4L A;  3A5Z A;  3HFZ B;  5KNN A;  3SB2 A;  1NJ2 A;  3TEH B;  2ZCE A;  4YRL A;  5GAN 7;  4X9D A;  2RB6 A;  1L0W A;  5LJ5 e;  2VXF A;  2ZR3 A;  3E9H A;  4P74 A;  4YCV A;  3RGL A;  4P73 C;  1H4T A;  12AS A;  3QTC A;  4M7A F;  1Y96 A;  3JCM V;  4TVW A;  1YFS A;  2ART A;  4L87 A;  4X5O A;  4HWP A;  3UGT A;  2DU7 A;  4C92 C;  5GAN 8;  5GAN 3;  1LJO A;  3G1Z A;  4HVC A;  4H2W A;  1Y96 B;  2E5A A;  4PHC A;  5LJ5 d;  3HXZ A;  4P3N A;  1PYS A;  1NYR A;  1QF6 A;  4QVC A;  1HC7 A;  2Q7H A;  4M77 G;  5K1X A;  1B70 A;  4P72 A;  3V7C A;  4EO4 A;  4P73 A;  4AH6 A;  1WU7 A;  1MGQ A;  2DJZ A;  2EL9 A;  3L1A A;  3L4G A;  5GAN 2;  4C92 A;  4PJO E;  1USY A;  3HRI A;  1LYL A;  4Q15 A;  3HXX A;  5GAM h;  3L4G B;  1NJ8 A;  1GGM A;  3A32 A;  4BWA A;  4C92 B;  4C92 D;  3RKY A;  4YDQ A;  4LNS A;  3QO3 A;  4M7A C;  2CJ9 A;  2YLC A;  4M78 E;  3HXU A;  5GMK l;  1NNH A;  3FB9 A;  4K88 A;  4YRC A;  1NJ1 A;  1YCY A;  2HNI A;  4CH5 A;  1EIY A;  3HFO A;  4OLF A;  1HK9 A;  3SWN A;  1D3B B;  5ELN A;  4PJO G;  3IG2 A;  1EIY B;  4M78 A;  4C8Q G;  4M7A B;  5GAM d;  2RD1 A;  2Y90 A;  1X2H A;  5GAO r;  3ICA A;  4HWO A;  4H2Y A;  4K86 A;  4M78 G;  1RIQ A;  3JCM f;  3HFV A;  3HXY A;  3QO5 A;  2E41 A;  3RAC A;  2ZT7 A;  1B7Y A;  4YRP A;  5K1P A;  4YRI A;  3HTZ A;  4JLI A;  2J3M A;  4V2S A;  2Q7G A;  3UH0 A;  4ZIB A;  2RA2 A;  4XEM A;  2ARU A;  2YLB A;  4YRS A;  4K87 A;  1NJ5 A;  1KQ2 A;  3JB9 I;  4HA8 A;  4RCC A;  4P75 A;  2DQ0 A;  4YRQ A;  4RQF A;  2C7I A;  2ODR C;  3E9I A;  1BIB A;  1HXD A;  1LNX A;  5GMK e;  1EOV A;  3QO7 A;  4YRG A;  5I21 A;  4UP9 A;  1YGB A;  5GAN e;  5GAN g;  1BIA A;  3INZ A;  2PME A;  3V8L A;  4N0A A;  4F7U G;  3PZC A;  3JCM P;  4P74 C;  3WQZ A;  4M7D G;  3NEL A;  1HTT A;  2ODR D;  3W3S A;  4YCW A;  2Q5H A;  1WPY A;  4MML A;  3VBB A;  1ASZ A;  4M77 E;  3JB9 G;  2ZNJ A;  2RHS B;  4PJO F;  2E3C A;  5C52 B;  3V8J A;  4YRM A;  3QSU A;  4KR3 A;  4KR2 A;  5E3I A;  4P72 C;  1WQW A;  5GAO l;  2I4N A;  2IY5 A;  4WJ4 A;  1EVL A;  3DSQ A;  3L2Z A;  1I8F A;  4XU2 A;  1Z7M A;  4M78 F;  4NCX A;  4RDX A;  3RF1 A;  4M77 A;  2AKW A;  1USY C;  4YP0 A;  1X01 A;  3UGQ A;  1FYF A;  5LJ5 f;  4ZTU B;  4J6X A;  4M77 D;  4X9C A;  5GAO p;  3QNE A;  5GAM j;  2I4M A;  3KFU A;  1SET A;  2DXU A;  4XTY A;  2K57 A;  3M4Q A;  1PYS B;  2G4C A;  4TWA A;  3EFR A;  1B34 A;  4EMK A;  4EMH A;  1N9R A;  3RKW A;  3REX A;  4PJO C;  4YYE A;  1B70 B;  1NYQ A;  1G5I A;  5C51 B;  4JRI A;  4C8Q E;  2DTO A;  4PNO A;  3BFM A;  3JCM b;  3SWN C;  2QHV A;  4H02 A;  2EJF A;  4YRF A;  1SER A;  4M78 C;  1BBW A;  4UP8 A;  3JCM W;  2ALY A;  4XTV A;  2E64 A;  1U1S A;  4H2X A;  2CGH A;  2ZNI A;  4PJO A;  1JJC A;  1W66 A;  2RM4 A;  4C8Q A;  2DVE A;  3LSQ A;  3OD1 A;  4M75 E;  1N9S A;  3CMQ A;  4PJO B;  4PJO D;  2RHQ A;  5LJ3 j;  4C8Q D;  4YRO A;  1KOG A;  3NEM A;  2C8M A;  4BW9 A;  1KMN A;  4JUV A;  4XU0 A;  3RIR A;  3SWN B;  4Y91 A;  4M78 B;  5GAM f;  4M78 D;  2DDZ A;  5GAO m;  4JRK A;  2Q5I A;  4M75 A;  3I7F A;  4P75 C;  1X54 A;  3BW1 A;  2DKG A;  4YRR A;  1E1O A;  2VC8 A;  4J6Y A;  3BDU A;  2I2L A;  1I81 A;  3JCM g;  5GMK h;  3AHU A;  4M75 G;  2QTX A;  4F7U E;  2I4O A;  1VQZ A;  4H2S A;  4H2T A;  2ZZE A;  1B7Y B;  2ZGW A;  4HWS A;  4WF2 A;  1H4V B;  5GAN h;  4QVD A;  1WQ7 A;  4J6W A;  1EQR A;  1H4Q A;  4M77 F;  4M7D E;  4N0A C;  1E24 A;  4EMG A;  3VQX A;  4DQ2 A;  2ZTG A;  3LC0 A;  4TTV A;  5LJ5 j;  2ZR2 A;  1N9W A;  4F7U A;  4WI1 A;  3PGG A;  3HXV A;  3NET A;  4YPF A;  4MMK A;  5LJ3 f;  1SES A;  4M7D A;  1YB3 A;  5GMK m;  2CIM A;  3IKM B;  3TEG A;  2ZIM A;  4HT9 A;  4ZTZ B;  3A7U A;  5LJ3 g;  2ZXF A;  4M7D D;  2ZT6 A;  5HGQ A;  5GAN 6;  3QUI A;  5GAN 5;  4YRN A;  4CH3 A;  4YRK A;  1M8V A;  5GAN d;  2PMF A;  1H64 1;  3JB9 D;  4KQE A;  4M77 C;  4E51 A;  4P3O A;  1WNL A;  4NL3 A;  4TVA A;  3A31 A;  4G85 A;  1X55 A;  4C8Q F;  3LSS A;  3BY7 A;  4HT8 A;  3R07 A;  1ATI A;  3MEY A;  4G84 A;  2DU5 A;  1I4K 1;  3A7A A;  4TVY A;  2E10 A;  1M5Q 1;  3VU3 C;  3QO8 A;  5CAI A;  4EMK C;  3HFZ A;  5GAO q;  3MF1 A;  3TEH A;  2IY5 B;  4PG3 A;  2DTH A;  1J5W A;  4M77 B;  2AKW B;  4M75 F;  2ARS A;  3IAL A;  1BBU A;  4TQF A;  1TH7 A;  3RUX A;  3TUP A;  5LJ5 g;  5GMK i;  3VQV A;  4J15 A;  1X2G A;  2CJA A;  4XTX A;  4C8Q C;  3BJU A;  3A5Y A;  1B34 B;  4H2V A;  2ZT8 A;  4EMK B;  2QHU A;  11AS A;  2YHT A;  4XEO A;  1YFR A;  2FB7 A;  4C92 E;  4XU1 A;  4UPA A;  4CS2 A;  4XTZ A;  1KQ1 A;  4P71 C;  1SRY A;  2P0L A; 
#chains in the Genus database with same CATH topology
 3RES A;  3HFN A;  5CCA A;  2DD4 A;  3EGX A;  5ELO A;  3VS0 A;  2M51 A;  3ERR A;  4D8K A;  3VS2 A;  3CPW A;  3QYH B;  3M0U A;  2QEX Q;  3LX7 A;  2ZIN A;  2J3L A;  7AT1 B;  1UJY A;  4CH4 A;  2E1H A;  4Q6G A;  3SFM A;  3NFC A;  1ADJ A;  3D7S B;  4OGE A;  2HQE A;  4LXC A;  3I56 T;  1VQ4 A;  1U1T A;  1LPL A;  3GOX A;  1GBQ A;  2QYZ A;  1KQS S;  1G3Y A;  1YIJ A;  1W2B S;  5GAM e;  1LCK A;  1K73 U;  2QHT A;  3M4P A;  2GGR A;  1OV3 A;  1B8A A;  3JCM e;  4O2D A;  1K73 R;  4UP7 A;  4XQ3 A;  1X56 A;  2J7I A;  1Z7N A;  1WLE A;  1RI0 A;  3L2R A;  2ZZF A;  4M7D C;  2DAQ A;  3UFG A;  1EFW A;  3A7R A;  2XG8 D;  1GFD A;  1YJN A;  1NJI U;  3JCM d;  1ZBX A;  2QGG A;  1P92 A;  1NJI R;  3VQW A;  2K7A A;  1GL5 A;  2PZ1 A;  4JDS A;  1JJ2 A;  1UJ0 A;  4RMF A;  1QLY A;  4LNP A;  4F7U B;  3DB4 A;  2WSE E;  4LN2 A;  3JCM Q;  2AMC A;  3G7Z A;  4YRT A;  4M7D B;  4AMC A;  1TOV A;  3JB9 J;  2BE9 B;  2LMJ A;  1JBM A;  4IUT A;  3P8Y A;  1IL2 A;  1VQM T;  1G51 A;  4RTX A;  2QTV A;  3PCO A;  4X1V A;  1SSH A;  4BAC A;  2DER A;  3CCM Q;  4JRP A;  1WIE A;  2D6F A;  2EWN A;  2EJ9 A;  1WDX A;  2CYZ B;  2DXT A;  2EAY A;  2K4Y A;  4DPG A;  3FJP A;  5FRN A;  1BI1 A;  3CMA Q;  4JLG A;  5KNN A;  1KG1 A;  4IUP A;  3TEH B;  3G4S T;  1JJ2 P;  2EVR A;  2ESW A;  2YDL A;  3E9H A;  1KQS P;  2MMP A;  4A4E A;  1Q82 C;  4M7A F;  1Y96 A;  1UHC A;  4TVW A;  2ART A;  2DU7 A;  4C92 C;  1LJO A;  3G1Z A;  3UA7 A;  2CH4 A;  3MEW A;  3CCJ T;  2R5M A;  1PWT A;  4PKC C;  5CKF A;  1YWP A;  3RDV A;  2L3Q A;  2QA4 Q;  2LNH B;  1WU7 A;  1D0X A;  2ROT A;  2V8I A;  1RAC B;  3A98 A;  3LW5 E;  5FRO A;  3ZFJ A;  1USY A;  1KC8 C;  3HXX A;  2X9H A;  4X34 A;  5GAM h;  1GGM A;  4BWA A;  4C92 B;  1VQK Q;  2J05 A;  3LH0 A;  4YDQ A;  4LNS A;  1H3Z A;  2QEX T;  2YUP A;  5IN1 A;  4M78 E;  5DLQ E;  5J26 A;  4ZGD B;  2K5L A;  3FB9 A;  4YRC A;  4LVM A;  4FCY A;  2X51 A;  1Q7Y C;  3CCS A;  1EIY A;  3QWY A;  2XDP A;  1YFN A;  3QKJ A;  3WVD B;  3DLL A;  4FSS A;  2H3J A;  2VV5 A;  1QP3 A;  2VWF A;  2RD1 A;  4PLI A;  1X2H A;  4M78 G;  3G6E A;  1RIQ A;  4N4G A;  3QO5 A;  1SHG A;  1NG2 A;  2OTL A;  1H8K A;  3CD6 Q;  2JM8 A;  4YRP A;  4ELY C;  1PKT A;  4ANJ A;  2Q7G A;  3VYH B;  4HXJ A;  2K79 A;  4IUR A;  1D09 B;  2YLB A;  2LTO A;  1G5V A;  4K87 A;  2MCN A;  2E12 A;  4HA8 A;  4P75 A;  1ABO A;  1K9M C;  2KYM A;  1YI2 T;  2COY A;  2EQI A;  3OS0 A;  1VQ7 Q;  2PUO B;  4K11 A;  1EOV A;  2M16 A;  1C0M A;  1VQP Q;  2IVW A;  2AZV A;  1OU9 A;  2JMA A;  5GAN e;  4BI8 B;  3I55 A;  2EKH A;  1VQ5 A;  3A8M B;  1OX8 A;  1QVF S;  2A0F B;  1RAH B;  3GLX A;  2XDB A;  4R0K A;  4QT7 A;  4OMM A;  1KSW A;  1TS9 A;  3JCM P;  3WQZ A;  1EIF A;  2JTM A;  3NEL A;  3F70 A;  1K8A C;  3CCM T;  2LC4 A;  2ODR D;  3OYK A;  3S3O A;  3JB9 G;  4LDU A;  3DB3 A;  3V8J A;  4YRM A;  3QSU A;  4KR3 A;  4KR2 A;  2FVU A;  1WQW A;  5GAO l;  2IY5 A;  4WJ4 A;  3DSQ A;  1I8F A;  3WXM B;  1Z7M A;  2KR3 A;  1MMG A;  4NCX A;  4RDX A;  2HZY A;  5IH2 A;  2KXC A;  1USY C;  1UE9 A;  1VQO T;  4AFS C;  1VQ9 A;  1ARK A;  4RUG A;  1T3L A;  5AYF A;  4J6X A;  4X9C A;  3P8B B;  2FO0 A;  3KFU A;  4XTY A;  3OYA A;  3M4Q A;  3PTA A;  1Y57 A;  4TWA A;  3CCL Q;  1B34 A;  1N9R A;  2MI6 A;  4ZGJ B;  1CKA A;  5HKC A;  3CC2 A;  2NYS A;  5C51 B;  2ZPF B;  5KYY B;  2W10 A;  2QA4 T;  3M54 A;  1FMK A;  4PNO A;  3P8D A;  5ECA A;  1YJ9 A;  2KDS A;  3JCM b;  4PJN A;  4H02 A;  1SER A;  4UP8 A;  2ALY A;  1KJW A;  1BI3 A;  2X35 A;  1MMN A;  3HRU A;  2GQI A;  1JJC A;  3CC4 Q;  4C0F A;  1Q81 C;  1KHC A;  3CCQ T;  4F16 A;  4PFP A;  1NEG A;  3EG2 A;  1T0H A;  2F1L A;  1KOG A;  3NEM A;  2C8M A;  4BW9 A;  1N8R U;  1KMN A;  1KFZ A;  5FLX E;  5CKD A;  2EYZ A;  3CCV T;  4KT0 E;  2YSQ A;  3QZ9 B;  4Y91 A;  2DF6 A;  1QVF P;  1N8R R;  2O9V A;  2C06 A;  4M78 D;  5GAM f;  4M75 A;  3ER0 A;  1PD0 A;  4P75 C;  3QII A;  3QJY A;  5KYX A;  2DKG A;  4YRR A;  2VC8 A;  3BDU A;  3BE3 A;  1VQ8 T;  4LVJ A;  3H0F A;  2RJE A;  2BZX A;  2QTX A;  4F7U E;  3P8H A;  5D6W A;  2ZZD A;  3VJP A;  4HWS A;  3MP1 A;  5GAN h;  4LE9 A;  3CBP A;  3MKD A;  4J6W A;  3CD6 T;  1EQR A;  4M77 F;  4M7D E;  1GCP A;  3A8G B;  2J6F A;  4HVV A;  3C94 A;  1X69 A;  1UHF A;  3CCE Q;  2PQW A;  2ZTG A;  1X2K A;  3LC0 A;  2LQ8 A;  2LQW A;  5LJ5 j;  2ZR2 A;  2HCK A;  1G83 A;  1C6V X;  3NET A;  1TUC A;  4MMK A;  1H92 A;  2YRV A;  3TQ7 P;  1KHI A;  2OJ2 A;  5GMK m;  1ZUK A;  2EGA A;  1PKS A;  1VA7 A;  2E6Z A;  1WHG A;  1S72 T;  1G2B A;  4CH3 A;  4QQG A;  1YHQ Q;  2E5K A;  1BKB A;  3JB9 D;  1Y7X A;  4E51 A;  5A0D A;  4TVA A;  4IIO A;  4O6J A;  3QDF A;  1ZX6 A;  4C8Q F;  3R07 A;  3BDL A;  3TCJ A;  1ATI A;  2PUK B;  3PE0 A;  1PC0 A;  2RHZ A;  3QO8 A;  1O75 A;  4JPB W;  3HFZ A;  4R56 A;  1TG0 A;  5GAO q;  1HYO A;  3MF1 A;  2E5Q A;  2IY5 B;  2DBK A;  4PG3 A;  1Q82 U;  2JT4 A;  1QCO A;  3HTR A;  1VQL A;  3HKS A;  4MZP A;  1Q82 R;  3RUX A;  1QCN A;  5LJ5 g;  2DIL A;  3M58 A;  3VQV A;  4J15 A;  1UEC A;  4XTX A;  2BE7 D;  4ZGE B;  5KYN A;  2P0P A;  3A5Y A;  1B34 B;  4XAX B;  1V76 A;  2MPX C;  2ZPG B;  4XEO A;  2RMO A;  4C92 E;  2KI7 A;  3CCL T;  3VS6 A;  3RMQ A;  2GTJ A;  1KQ1 A;  2WSC E;  4P71 C;  1KC8 U;  2DL5 A;  2KT1 A;  5GAO n;  2DYI A;  4DBH A;  1KC8 R;  2DRK A;  4FT2 A;  2MOX A;  4EX5 A;  5J3B A;  3NEN A;  2ALY B;  4BE2 A;  2KYB A;  4M75 C;  4J9I A;  1OI1 A;  4FM4 B;  4ZTF A;  2FRY A;  1JJC B;  2L2P A;  5DY9 A;  5M9O A;  1G5H A;  1Q7Y U;  3CC4 T;  1J3T A;  3GBQ A;  2GNC A;  2FZC B;  2VUB A;  4C92 G;  2DQ3 A;  5FRM A;  6AT1 B;  4NL2 A;  2FYK A;  3RKX A;  3KFV A;  2A08 A;  4AFU C;  1Q7Y R;  1ASY A;  1UEB A;  2QI2 A;  3E19 A;  4DBQ A;  3JCM J;  3CC7 Q;  2E3I A;  1KK7 A;  2JUF A;  1K1Z A;  2M9U A;  1QWF A;  2JNG A;  1YIT T;  4M75 B;  1EVK A;  2XGT A;  5KYX B;  3CQT A;  4L6V 5;  1N5Z A;  1B3Q A;  2KEA A;  4DOV A;  4A63 B;  3JB9 H;  1IXD A;  3OQ5 A;  1A0N B;  5CKE A;  4YRJ A;  1G8X A;  1VQN T;  2BZY A;  3EGU A;  4AG2 C;  1I5L A;  5LJ3 h;  1TXQ A;  4OB0 B;  3MQZ A;  4WJ3 M;  3IKL A;  3HY0 A;  2GFU A;  3GNF B;  4ELZ C;  1VQ6 A;  3HXW A;  4P3P A;  1BK2 A;  2DZC A;  1M90 U;  4C0G A;  1T3S A;  3PFS A;  4H2U A;  4OMF B;  2P5I A;  1C0A A;  1M90 R;  3M55 A;  1NLO C;  3KBG A;  3MF2 A;  2HL5 C;  3EGD A;  3M9Q A;  4C0D C;  2F2W A;  1OUL A;  3CME Q;  1WGS A;  2K6D A;  4OF1 A;  2D8J A;  2QAS A;  2AK5 A;  4CH6 A;  5CIU A;  3M0S A;  5GAN f;  4HCC A;  4Y28 E;  2CJB A;  4EIK A;  3H41 A;  1PHT A;  2A7Y A;  3G71 A;  1K8A U;  5KYU B;  2DX1 A;  3QHS A;  4B9X A;  2DBM A;  4XTW A;  4HWR A;  4YCU A;  1YBY A;  1K8A R;  5IHN A;  3HP9 A;  4HCB A;  4TVA B;  4C0D B;  1VYU A;  3PIP A;  2HAX A;  2CDT A;  4F04 B;  1ABQ A;  4KGV B;  3HFZ B;  5I2S A;  5IHK A;  4IKF A;  5LL6 S;  2FZK B;  5GAN 7;  2RN8 A;  4P73 C;  5HK0 A;  2DEU A;  4LVI A;  1AWW A;  3JCM V;  4PFO A;  4X5O A;  5DM7 R;  1ZA2 B;  4FYV B;  4H2W A;  2E5A A;  2X4J A;  1KD1 C;  3QPH A;  4WCI A;  2Q7H A;  1YN8 A;  2Y4X A;  4EO4 A;  4E7J A;  4AH6 A;  2DXC A;  2H3E B;  4ZTJ A;  1G3T A;  2DJZ A;  2IG0 A;  3L1A A;  5GAN 2;  1OX9 A;  2O01 E;  4C92 A;  1I5O B;  1NPR A;  2R57 A;  4A4F A;  4KUI A;  4Q15 A;  1NJ8 A;  4PK4 A;  4C92 D;  2YRD A;  3QO3 A;  3OMC A;  1V29 B;  3HXU A;  2EYY A;  4E6R A;  2K3Y A;  2L5Q A;  3UF4 A;  2QXF A;  3CCR A;  3NGP A;  1S1N A;  1H3H A;  1NJ1 A;  1OYX A;  3RNJ A;  4CH5 A;  5HCK A;  2IIM A;  3CPF A;  3A1P A;  5KYW B;  3CC7 T;  1HK9 A;  5KCO A;  1JB0 E;  3O8V A;  1X6O A;  1WHJ A;  2O9S A;  1OQK A;  5GAM d;  1VQM A;  2LJ1 A;  2BUD A;  4H2Y A;  2PVO B;  3HFV A;  2ROL A;  4QQ6 A;  1BCM A;  1AHJ B;  2GQV A;  3EG1 A;  2ZT7 A;  3H6Z A;  3HTZ A;  5C6S A;  1YI2 Q;  2H8H A;  3ASK A;  2RA2 A;  1W1F A;  2JXB A;  3QJ6 A;  1KQS A;  2L8D A;  4O5V A;  1NJ5 A;  1KQ2 A;  2KK4 A;  3JB9 I;  1W2B A;  4CC3 A;  3TSW A;  1M2V A;  2OI3 A;  4YRQ A;  3EGD B;  2C7I A;  3E9I A;  2JM9 A;  3G4S A;  2P84 A;  1HXD A;  2DK3 A;  5GMK e;  1QMC A;  2CZ6 B;  1BI2 A;  2VVK A;  5J39 A;  1VQ4 T;  3CME T;  3U23 A;  4E7Z A;  3PVL A;  2AZS A;  5I21 A;  4ESR A;  3C12 A;  1YIJ T;  1BIA A;  3QDR B;  2PME A;  2K5I A;  1W6X A;  2YUQ A;  4DOW A;  2FG0 A;  2XMF A;  3CCJ A;  1WJQ A;  1YNZ A;  1HD3 A;  4J7I A;  1HTT A;  2V1Q A;  1IGQ A;  2P0K A;  4HVU A;  3W3S A;  4YCW A;  2Q5H A;  3OW2 S;  1WX6 A;  4RTW A;  2HSE B;  1YJN T;  2V1R A;  3MP8 A;  1GCQ A;  3S6W A;  4LD9 K;  2JW4 A;  3VUZ A;  5C52 B;  1IHV A;  1RAF B;  2OAW A;  1VQO Q;  1AWX A;  2O2O A;  4KH0 B;  3ULR B;  1EVL A;  3L2Z A;  1PSF A;  4DA4 A;  4XU2 A;  4M78 F;  1W2B P;  3LWH A;  2F5T X;  2ZPI B;  2QQ9 A;  4OVA A;  1X01 A;  3PNW C;  4ZTU B;  1NYF A;  2DE0 X;  4MZT A;  2L3R A;  5GAM j;  4RG8 A;  2KRN A;  2NS6 A;  5A0L A;  2G4C A;  4XK8 E;  1RLQ C;  3OBW A;  4EMK A;  5KYY A;  1V1C A;  1Y0M A;  2DMO A;  3MEV A;  4VUB A;  4PJO C;  2DIQ A;  1G5I A;  2QDY B;  2DTO A;  3BFM A;  3FJ5 A;  4F14 A;  5IT9 E;  4OB2 B;  4DBF A;  2OTJ A;  3RMS A;  2DA9 A;  2EJF A;  4YRF A;  3CCQ Q;  3MEA A;  2KBT A;  3ME9 A;  1X2Q A;  3UAT A;  4ZN3 A;  1QVG S;  1R0B G;  2MWO A;  3H0I A;  1U3O A;  2DVE A;  2RI2 A;  4R55 A;  3OS2 A;  2LNV A;  3OD1 A;  4M75 E;  1N9S A;  3CCV Q;  4PJO B;  2RHQ A;  1VUB A;  4RTZ A;  2QK0 A;  4D8D A;  4E7S A;  4YRO A;  3UWN A;  2ZPE B;  2AHJ B;  3QBY A;  2C0T A;  1G3W A;  2O4X B;  1VQ8 Q;  3LGF A;  5GAO m;  2CUB A;  1K4U S;  1X54 A;  3HHT B;  1NLP C;  4FT4 A;  4J6Y A;  2DD5 A;  2XD0 A;  3JCM g;  5GMK h;  4M75 G;  3HRS A;  2ENM A;  4WF2 A;  1H4V B;  3CCM A;  3M0Q A;  3EFO A;  5AT1 B;  2LT4 A;  3OB9 A;  1MV3 A;  4MDX A;  3VQX A;  3OYB A;  1C1A A;  4TTV A;  2RHI A;  3OMG A;  1M2V B;  2COZ A;  2HD0 A;  1N9W A;  1AT1 B;  3CMA A;  3HXV A;  1D0Y A;  1S72 Q;  3MCA B;  4JRQ A;  3CCS T;  1K0X A;  4LDY A;  1GCQ C;  4JS4 A;  1JEG A;  3A7U A;  4OMQ A;  2ZT6 A;  5GAN 6;  1AZE A;  4YRK A;  2CRE A;  2K9G A;  5GAN d;  4CC7 A;  1H64 1;  4KQE A;  2HBW A;  2QQS A;  1UDL A;  4NL3 A;  4LD6 A;  2LX9 A;  2G3R A;  3G6E T;  2QQR A;  1UGR B;  3A31 A;  1I0C A;  2D0Q B;  1WJR A;  3BY7 A;  2OTL T;  2QG9 B;  3JRZ A;  4BE1 A;  2EW3 A;  2XIC A;  3R6O A;  1U8R A;  3MEY A;  4G84 A;  1I4K 1;  2QA4 A;  1M27 C;  2E10 A;  2D8H A;  4BUG A;  1M5Q 1;  1WLP B;  2CP3 A;  3VS5 A;  4A4H A;  2NLU A;  4EMK C;  5HK3 A;  2KQW A;  2QGF B;  1W4S A;  2B8A A;  2CZ0 B;  2DET A;  5A0G A;  4D6W A;  5KE3 A;  4LUD A;  3QXE B;  1QVF A;  1VQK A;  2MWP A;  4BE0 A;  4AG1 C;  3L2W A;  4C5H A;  1M1G A;  1BBU A;  1CSK A;  1TH7 A;  3TUP A;  1KD1 U;  5GMK i;  2PTK A;  3VS7 A;  3MJX A;  1VQ5 T;  1KD1 R;  3BJU A;  2KSS A;  5D6Y A;  4H2V A;  4EMK B;  2L0A A;  2YHT A;  2FB7 A;  4QQD A;  3RR6 A;  4XU1 A;  1SPK A;  1VIE A;  4XTZ A;  1FX7 A;  1SRY A;  2VKN A;  1OZ2 A;  4RCB A;  1XNI A;  1QE0 A;  4MDW A;  3MP6 A;  4HCK A;  4F7U F;  4OMN A;  3P8V A;  4LDX A;  2ZZG A;  3EH1 A;  3P8T A;  1JRI A;  2R58 A;  2HDA A;  2P0Q A;  2JS2 A;  4M7D F;  3JCM c;  2E3H A;  1YJW Q;  4M4Z A;  2B86 A;  3HSB A;  4KGX B;  1AVZ C;  2RNA A;  4P71 A;  1T0J A;  2RHQ B;  1PM3 A;  3V8K A;  3EFS A;  3REA B;  1YIT Q;  1M1K C;  2VXE A;  3GIB A;  1HJD A;  5GAN j;  1D3B A;  4FU6 A;  1VQ7 A;  1D1B A;  3CCU Q;  4M75 D;  3REU A;  1VQP A;  4A54 A;  2ZT5 A;  1DJ7 B;  4QVZ A;  1VQN Q;  3PIO A;  4M7A A;  3CXC S;  3CC2 T;  2EQU A;  1KMM A;  1UGS B;  2FPD A;  2RHU A;  4J5Y A;  5GAN 4;  4M7A D;  1K73 C;  1YJ9 T;  4WTO B;  1XQH A;  4A53 A;  1LVK A;  5I11 A;  2ED1 A;  3EFO B;  4J9D A;  2LJ0 A;  4NOY A;  4UC4 A;  4TQD A;  2KRM A;  2RO0 A;  4OP0 A;  1NJ6 A;  2RI3 A;  2RK2 A;  2DEQ A;  1B76 A;  2XTI A;  4F17 A;  2HMA A;  4FL6 A;  2F5K A;  5LJ3 e;  1ZQ1 A;  1JU5 C;  1ACM B;  4RTU A;  3LYI A;  4A4K A;  4XU3 A;  3H9N A;  2AIR B;  2EJG A;  8AT1 B;  3V7S A;  2CT4 A;  5KYU A;  3OYF A;  3CXC A;  3X28 B;  2BIV A;  2QHS A;  1WXT A;  2HQH A;  3RER A;  5LJ3 d;  2KXD A;  2Q7E A;  3HPW A;  3I9Q A;  4C92 F;  4CS4 A;  1UFF A;  3DLM A;  3X26 B;  4E7I A;  1JXM A;  2A3L A;  2WSF E;  2XI9 A;  1SKU B;  2KRS A;  3PMI A;  5LJ5 h;  1E22 A;  3FIF A;  2Z0W A;  3L2Q A;  2RHS A;  2VYT A;  3VS3 A;  2CH4 W;  3UPU A;  2QQA A;  3PT9 A;  3GP8 A;  3SB2 A;  2X4W A;  3CBM A;  1NJ2 A;  2ZCE A;  2RH2 A;  3JSC A;  4EPC A;  5C0M A;  3RBB B;  3X24 B;  2RB6 A;  5L23 A;  1L0W A;  1ZHI A;  2VXF A;  2ZR3 A;  3OSV A;  4B9W A;  3RGL A;  2A28 A;  1OOT A;  1H4T A;  3VV0 A;  4JJC A;  2RHX A;  4L87 A;  3UGT A;  1E7O A;  1EX4 A;  4AT1 B;  5GAN 8;  5GAN 3;  3TU4 K;  1D1A A;  5CO7 A;  4HVC A;  2M1H A;  4PHC A;  4BI3 A;  1PYS A;  4J9B A;  3CXC P;  1NYR A;  1QF6 A;  2NWM A;  2D9T A;  4M77 G;  3OS5 A;  4JS5 A;  1UTI A;  4P72 A;  3V7C A;  4P73 A;  4OMP A;  3CEY A;  1UGV A;  2CSQ A;  2L89 A;  1M8M A;  4PJO E;  1LYL A;  3VRZ A;  1UG1 A;  3L4G B;  3A32 A;  4BB7 A;  2LZ6 B;  1EFN A;  1RUW A;  2V8K A;  4OB3 B;  4OML A;  3RKY A;  3SD4 A;  3E9F A;  4M7A C;  1CKB A;  2CJ9 A;  2YLC A;  1MND A;  3UA6 A;  5GMK l;  1YJW T;  1NNH A;  3EHR A;  4RMO A;  4K88 A;  2CT3 A;  5KYW A;  1VIF A;  3OYL A;  3CCE A;  1YCY A;  2HNI A;  4KGZ B;  1NBE B;  2RJC A;  3R6N A;  1D3B B;  5ELN A;  1TTH B;  1D0Z A;  4PJO G;  3IG2 A;  4C8Q G;  1UUE A;  2K2M A;  1GRI A;  2RJD A;  2Y4Y A;  3CCU T;  2ZCF B;  4A4G A;  4M7A B;  3NPF A;  2FHD A;  4HWO A;  2EQM A;  4K86 A;  3HXY A;  1YHQ A;  5CQX A;  2L3P A;  3WVE B;  3TVT A;  4C0Z A;  2D0N A;  1K9M U;  4YRI A;  2J3M A;  4V2S A;  2E4H A;  4FIB A;  1M3B A;  1WXB A;  4IIM A;  3UH0 A;  2LCS A;  1K9M R;  3PMT A;  4XEM A;  2ARU A;  3I35 A;  1K0S A;  2LJ3 A;  4E2F B;  1RAB B;  4PL6 A;  1ZSZ C;  1VQ4 Q;  2QQB A;  2DQ0 A;  4AFZ C;  3QZ5 B;  1YIJ Q;  2A8E A;  1BIB A;  1LNX A;  1BBZ A;  1YP5 A;  2F2X A;  2J6O A;  4JJB A;  3ZL7 C;  2K3B A;  2YUO A;  3TSZ A;  2DIG A;  4PLL A;  4E47 A;  2YXY A;  4J83 A;  4YTL A;  4CC4 B;  3J80 E;  4N0A A;  3KXT A;  1K9A A;  3I5S A;  1NZ9 A;  3PZC A;  1YJN Q;  1JQQ A;  1ZSZ B;  4J9C A;  2LX7 A;  1B07 A;  3MEU A;  1IRE B;  2JTF A;  3FRN A;  2RK1 A;  3VBB A;  1ASZ A;  1WPY A;  1AOJ A;  2RQW A;  3UDC A;  2ZNJ A;  2RHS B;  2A36 A;  3EH2 A;  2DM1 A;  2E3C A;  2EYX A;  2KAF A;  4ZNX A;  1NM7 A;  2FPE A;  4RKU E;  4P72 C;  5E3I A;  1O9S A;  2I4N A;  2V8J A;  3J81 E;  3NMZ C;  4M77 A;  1PRL C;  4YP0 A;  3CPW S;  3I56 A;  2CP2 A;  3UGQ A;  1FYF A;  5LJ5 f;  3LH5 A;  4M77 D;  3QNE A;  1SET A;  2DXU A;  2IPO B;  1Q86 C;  1UGQ B;  2K2V A;  1PYS B;  2RJF A;  3EFR A;  4HVW A;  4LDW A;  3RKW A;  1FXX A;  4YYE A;  1MMD A;  1M9S A;  2LQN A;  2FL7 A;  2M02 A;  4OGC A;  1Q81 U;  4L5G A;  2EQJ A;  1BBW A;  1MNE A;  1Q81 R;  1NYG A;  1IB8 A;  2PU9 B;  1WFW A;  4H2X A;  4Y92 A;  1AWO A;  4TVR A;  2CGH A;  1PSE A;  2ZNI A;  3OYD A;  4PJO A;  1W66 A;  4C8Q A;  3LSQ A;  1QQJ A;  1M1K U;  3A8O B;  5IHI A;  4KH1 B;  1QVP A;  2ECZ A;  4PJO D;  1IZ6 A;  4CC2 A;  1M2O A;  4C8Q D;  1M1K R;  4HT4 A;  2DL4 A;  4FYY B;  5CKB A;  4GLK A;  2O4X A;  3J7A F;  1GXI E;  4JUV A;  2L3S A;  1X75 C;  3VYG A;  5KE2 A;  1JJ2 S;  2DJQ A;  3M56 A;  3T9N A;  5GJV B;  4J9G A;  3H8Z A;  1OPK A;  4Z02 A;  3CME A;  2EGE A;  4JRK A;  2Q5I A;  2A37 A;  4RTV A;  1GBR A;  2LCC A;  3BW1 A;  1N8R C;  1RAD B;  2CZ1 B;  5IXF A;  1E1O A;  2YUN A;  3OYY A;  2I2L A;  2W0Z A;  3M0R A;  3AHU A;  2D1X A;  2OTJ Q;  4H2T A;  2CUD A;  3LWI A;  2ZZE A;  1EZZ B;  4QVD A;  5DLO A;  3URG A;  1H4Q A;  1WI7 A;  4RTT A;  4N0A C;  2CSI A;  2VGM A;  1QWE A;  2OAU A;  2MK5 A;  4EDU A;  3CCS Q;  1VOM A;  2PNI A;  4BI4 A;  2ZPH B;  3CPW P;  3CCR T;  4WI1 A;  1BI0 A;  2VAS A;  1AZG B;  5LJ3 f;  1SES A;  2KRO A;  3TRE A;  2CIM A;  3IKM B;  1UB4 A;  3TEG A;  2ZIM A;  4HT9 A;  3GF5 A;  4C5E A;  2ZXF A;  5HGQ A;  2RHY A;  1TUG B;  5GAN 5;  3G6E Q;  1QP2 A;  2FPF A;  4FYX B;  2CS7 A;  2OTL Q;  2PMF A;  1QCF A;  5CK9 A;  4M77 C;  4P3O A;  1WNL A;  2SEM A;  1NPP A;  4KUD K;  5CR2 A;  3LSS A;  4HT8 A;  2DU5 A;  1ZBJ A;  1ZA1 B;  2DXB A;  3GNG A;  3VU3 C;  2DO3 A;  2YWW A;  2QEX A;  2CKK A;  3A8L B;  1M3C A;  2HEQ A;  3OSS C;  2SRC A;  3A8H B;  3S3N A;  4M77 B;  4M75 F;  3I55 Q;  2ARS A;  1VQ5 Q;  3IAL A;  4KRT A;  1M30 A;  4L59 A;  2JOY A;  4HKE A;  2GFA A;  2KMT A;  1X2G A;  3VKI A;  2LDM A;  4BDY A;  2F69 A;  2EYQ A;  3OW2 A;  1YCS B;  1E6H A;  4C8Q C;  3OA6 A;  1RAA B;  11AS A;  3EHQ A;  2LVM A;  4UPA A;  2GBQ A;  1F1B B;  2J06 A;  4RTY A;  2PVG B;  3HL8 A;  2XK0 A;  2BTT A;  5FWB A;  5FU7 C;  4PJM A;  4HWT A;  4KUL A;  2RQV A;  4H2X B;  3EGX B;  4ZN1 A;  3Q1J A;  3V7R A;  1VQ9 Q;  4C8Q B;  1R8O B;  4JJD A;  3CBO A;  3JCM h;  3JB9 F;  3I5R A;  1YI2 A;  1NEB A;  3E2U A;  1WYD A;  4CS3 A;  5GMK j;  4M7A E;  3HRK A;  3GPL A;  5C53 B;  4PJJ A;  1FMV A;  3M59 A;  4ORZ A;  1PG5 B;  3M4G A;  2P4R A;  2CP0 A;  1Q95 G;  2EQK A;  3CC2 Q;  5FU7 B;  5GAM g;  4NS5 A;  4LDV A;  2DZ9 A;  2EYW A;  3SEM A;  3OW2 P;  4LVL A;  1YJ9 Q;  5F5W A;  2GCX A;  2VB6 A;  2DTI A;  4BDZ A;  1QVG A;  1M4Z A;  2GTO A;  4MZM A;  3FLG A;  1MUZ A;  2JN0 A;  3REB B;  5KH6 A;  4M7A G;  2OTJ T;  3C95 A;  1M3A A;  1H4S A;  5FW9 A;  5EG2 A;  3RL6 A;  1E1T A;  1OZ3 A;  4FW2 A;  2DRM A;  5HY6 A;  4Z88 A;  2XU8 A;  3C0C A;  1YFT A;  2RPN A;  2FZG B;  2CP5 A;  1AWJ A;  3A74 A;  3AT1 B;  1VQO A;  4RQE A;  2ZIO A;  1SHF A;  1M90 C;  1ADY A;  3E1S A;  3KUF A;  2JS0 A;  1MV0 B;  2AMC B;  3OYC A;  2JJ9 A;  2NUP A;  3L2V A;  3X25 B;  4DEX A;  4IUU A;  1NE8 A;  3MPU B;  1KIK A;  2LRQ A;  2E65 A;  4XTU A;  4YRE A;  1U5S A;  3NHN A;  4GBQ A;  3PCO B;  1WZO A;  2DYB A;  5EC7 A;  1QVG P;  1LOJ A;  4Z8A A;  3S3M A;  3EG3 A;  3VQY A;  3HY1 A;  2XKO C;  1TU0 B;  2ED0 A;  1PRM C;  3MET A;  3JCM X;  2I4L A;  4HCZ A;  3A5Z A;  2ZAE A;  3OYJ A;  4PJL A;  2QDL A;  3M57 A;  2HKN A;  5A2Q E;  2R5A A;  9ATC B;  1E6G A;  2MF2 A;  3N5B B;  1M1F A;  2AKK A;  4YRL A;  2MIO A;  3CCQ A;  4X9D A;  2CZ7 B;  4J9H A;  3OYI A;  3CMA T;  3THK A;  5LJ5 e;  4P74 A;  1IGU A;  4YCV A;  1Q86 U;  2AT1 B;  12AS A;  3I55 T;  3QTC A;  3M4Y A;  2JVV A;  3CCV A;  1YFS A;  3MHX A;  4HWP A;  1Q86 R;  2ZPB B;  1N27 A;  3NTI A;  2QAZ A;  1Y96 B;  1RI9 A;  1WJS A;  2DNU A;  5LJ5 d;  3HXZ A;  4P3N A;  4J9F A;  1AD5 A;  1RAG B;  4QVC A;  1HC7 A;  3JAM E;  4PFZ A;  5K1X A;  2DLP A;  2HBP A;  3FEO A;  1B70 A;  2HKQ B;  3M0P A;  1VQ8 A;  1MGQ A;  2HSP A;  5L8R E;  2EL9 A;  1SG5 A;  2KE9 A;  2KY9 A;  3L4G A;  3HRI A;  3CD6 A;  4ATO A;  3JV3 A;  1VQL Q;  1OEB A;  1IRX A;  3OYH A;  4C5I A;  3G1J A;  1WYX A;  5CQY A;  1RAI B;  2XDD A;  1OU8 A;  1VQ9 T;  1WHH A;  2AKL A;  1VQK T;  1ZUY A;  4J9E A;  1K76 A;  3HFO A;  1WA7 A;  1GFC A;  4Z89 A;  3OYM A;  2EGC A;  2KGT A;  4OLF A;  1YWO A;  3SWN A;  2HQX A;  3E9G A;  2JMC A;  1EIY B;  3ZEH A;  4M78 A;  1S72 A;  5I22 A;  3OYE A;  1BB9 A;  1W70 A;  2Y90 A;  1VYT A;  5GAO r;  3ICA A;  2VGN A;  2KVQ G;  3JCM f;  4II1 A;  2X4Y A;  2LT1 A;  2E41 A;  3C4S A;  1WXU A;  2M0O A;  3RAC A;  1B7Y A;  5K1P A;  2YRC A;  2M0Y A;  4JLI A;  3VUB A;  2FRW A;  5CKH A;  4ZIB A;  2HL3 A;  4E7K A;  1NJI C;  1BU1 A;  4YRS A;  4RCC A;  4J8O A;  4RQF A;  5IAY A;  2LP5 A;  2ODR C;  5D6X A;  1JXO A;  2BZ8 A;  3TEE A;  2MAM A;  1U06 A;  8ATC B;  2K5F A;  2WAC A;  3QO7 A;  3OYN A;  4YRG A;  4UP9 A;  1Y71 A;  1YGB A;  5GAN g;  2NUP B;  3INZ A;  1HSQ A;  1VQ7 T;  1ZSZ A;  1TUD A;  3V8L A;  3VRY A;  4F7U G;  1VQP T;  3CCL A;  4E7L A;  3EG9 A;  5D7U A;  1PNJ A;  3OBY A;  3FDR A;  4CRI A;  4P74 C;  3NTH A;  4N4H A;  4M7D G;  2MYS A;  1VQ6 Q;  2O31 A;  2E70 A;  2XHC A;  4MML A;  1TSF A;  1Z9Q A;  1FWZ A;  1ZLM A;  4M77 E;  2RF0 A;  4PJO F;  1MHN A;  3A5Z B;  4GY5 A;  1WHK A;  4FW1 A;  1BCO A;  2LQK A;  5FU6 C;  1R0C B;  5CVI A;  1QW1 A;  4IUV A;  3CC4 A;  2F2V A;  3RF1 A;  2AKW A;  1SRM A;  1YJW A;  4FYW B;  2NUT A;  4KBM B;  4OMO A;  3G71 Q;  1RL2 A;  1OPL A;  5GAO p;  1G3S A;  2KNB B;  2I4M A;  2DPP B;  1YIT A;  2K57 A;  2DL3 A;  1RAE B;  2DVJ A;  2K3X A;  3X20 B;  2XID A;  4EMH A;  3REX A;  1SEM A;  4DBR A;  1B70 B;  1NYQ A;  2OX7 A;  4JRI A;  5FU6 B;  4C8Q E;  3CCU A;  2NUZ A;  1QKW A;  2COW A;  1X43 A;  1VQN A;  2EBP A;  3SWN C;  3OS1 A;  4LVK A;  2QHV A;  4P5N A;  2DFU A;  4M78 C;  3JCM W;  4E7H A;  1X6B A;  3IQL A;  4XTV A;  2E64 A;  1U1S A;  4CI0 C;  4Q5W A;  2GF7 A;  4JZ4 A;  2RQT A;  1VQL T;  2RM4 A;  1FYN A;  3EAE A;  3CMQ A;  3FC3 A;  5LJ3 j;  3I56 Q;  1SRL A;  4N4I A;  3MO8 A;  2X3X D;  2EIF A;  2X4X A;  1ZUU A;  4LUE A;  4ME7 A;  2LCL A;  2FEI A;  1FMW A;  4XU0 A;  3RIR A;  3SWN B;  2DL7 A;  3M53 A;  1SF9 A;  4M78 B;  1Y07 A;  1I1J A;  5IXB A;  2DDZ A;  3OY9 A;  4BY6 C;  3I7F A;  3QWX X;  5KCH A;  1RLP C;  2RQR A;  3LGL A;  4B6M A;  3OYG A;  1I81 A;  1UGP B;  3L42 A;  2I4O A;  3DKM A;  1VQZ A;  4H2S A;  1B7Y B;  2JTE A;  2ZGW A;  1WHL A;  3O5Z A;  3M0T A;  1WQ7 A;  3CCR Q;  1E24 A;  4EMG A;  3M5A A;  4JJN K;  2O88 A;  4DQ2 A;  2P4T A;  4BY6 B;  3SHW A;  1WHM A;  4AFQ C;  4F7U A;  1AEY A;  1IHW A;  4RG2 A;  3PGG A;  3H0H A;  1B7T A;  4YPF A;  3CCE T;  3L2U A;  2CP6 A;  2ATC B;  2C0I A;  4M7D A;  3SDZ A;  1YB3 A;  1IO6 A;  2G6F X;  4C5G A;  1XTD A;  2EKO A;  5I2M A;  1VQM Q;  4ZTZ B;  2BKD N;  3NTK A;  5LJ3 g;  2RQU A;  4M7D D;  3LLR A;  4GLM A;  3QUI A;  4YRN A;  1N6A A;  1R77 A;  1X27 A;  1BYM A;  1M8V A;  2JZ2 A;  5GJW B;  1I07 A;  1TWB A;  5FWC A;  3EG0 A;  3EG9 B;  4JZ3 A;  1MMA A;  2EFI A;  2E6N A;  4QW2 A;  1PD1 A;  3ZBD A;  1XJW B;  2PVD B;  4G85 A;  1YHQ T;  1X55 A;  3UT1 A;  1VQ6 T;  1Z9Z A;  1XOV A;  1PCX A;  3A7A A;  4TVY A;  2I0N A;  4DEY A;  3VS1 A;  4BD3 A;  2YT6 A;  3HRT A;  5CAI A;  4IUQ A;  4J7F A;  3G4S Q;  1D1C A;  3VS4 A;  3TEH A;  1VYV A;  2DTH A;  4OB1 B;  1J5W A;  2AKW B;  2X3W D;  4FSX A;  2NUT B;  3QG1 A;  1X6G A;  3PVQ A;  4TQF A;  2EPD A;  1QKX A;  1SSF A;  3QYG B;  2CP7 A;  2KT8 A;  3CC7 A;  1ZSG A;  3G71 T;  2CJA A;  4QKU A;  3CCJ Q;  2C0O A;  1JO8 A;  2ABL A;  2ZT8 A;  2QHU A;  2V26 A;  2J6K A;  1YFR A;  2DL8 A;  4CS2 A;  2RI5 A;  2P0L A; 
#chains in the Genus database with same CATH homology
 3RES A;  3HFN A;  5CCA A;  2DD4 A;  5ELO A;  3ERR A;  3CPW A;  3QYH B;  3LX7 A;  2ZIN A;  2J3L A;  4CH4 A;  2E1H A;  4Q6G A;  3SFM A;  3NFC A;  1ADJ A;  4OGE A;  2HQE A;  3I56 T;  1VQ4 A;  1U1T A;  3GOX A;  1KQS S;  1G3Y A;  1YIJ A;  1W2B S;  5GAM e;  2QHT A;  1K73 U;  3M4P A;  1B8A A;  3JCM e;  4O2D A;  4UP7 A;  4XQ3 A;  1X56 A;  1Z7N A;  1WLE A;  1RI0 A;  3L2R A;  2ZZF A;  4M7D C;  2DAQ A;  3UFG A;  1EFW A;  3A7R A;  2XG8 D;  1YJN A;  1NJI U;  3JCM d;  1ZBX A;  1P92 A;  3VQW A;  4JDS A;  1JJ2 A;  4RMF A;  4F7U B;  3DB4 A;  2WSE E;  3JCM Q;  2AMC A;  3G7Z A;  4YRT A;  4M7D B;  3JB9 J;  1JBM A;  4IUT A;  3P8Y A;  1IL2 A;  1VQM T;  1G51 A;  3PCO A;  4BAC A;  4JRP A;  2D6F A;  2EWN A;  2EJ9 A;  2CYZ B;  2DXT A;  2EAY A;  2K4Y A;  4DPG A;  3FJP A;  5FRN A;  1BI1 A;  4JLG A;  5KNN A;  1KG1 A;  4IUP A;  3TEH B;  3G4S T;  3E9H A;  2MMP A;  4A4E A;  1Q82 C;  4M7A F;  1Y96 A;  4TVW A;  2ART A;  2DU7 A;  4C92 C;  1LJO A;  3G1Z A;  3MEW A;  3CCJ T;  2R5M A;  4PKC C;  5CKF A;  1WU7 A;  2V8I A;  3LW5 E;  5FRO A;  3ZFJ A;  1USY A;  1KC8 C;  3HXX A;  5GAM h;  4X34 A;  1GGM A;  4BWA A;  4C92 B;  3LH0 A;  4YDQ A;  4LNS A;  1H3Z A;  2QEX T;  5IN1 A;  4M78 E;  5DLQ E;  5J26 A;  4ZGD B;  2K5L A;  3FB9 A;  4YRC A;  4LVM A;  1Q7Y C;  3CCS A;  1EIY A;  2XDP A;  3QKJ A;  3WVD B;  3DLL A;  2H3J A;  2VV5 A;  1QP3 A;  2RD1 A;  4PLI A;  1X2H A;  4M78 G;  3G6E A;  1RIQ A;  4N4G A;  3QO5 A;  2OTL A;  4YRP A;  4ELY C;  2Q7G A;  3VYH B;  4IUR A;  2YLB A;  2LTO A;  1G5V A;  4K87 A;  2E12 A;  4HA8 A;  4P75 A;  1K9M C;  1YI2 T;  3OS0 A;  2PUO B;  1EOV A;  2M16 A;  2IVW A;  5GAN e;  4BI8 B;  3I55 A;  1VQ5 A;  3A8M B;  1QVF S;  3GLX A;  2XDB A;  3JCM P;  3WQZ A;  1EIF A;  2JTM A;  3NEL A;  3F70 A;  1K8A C;  3CCM T;  2LC4 A;  2ODR D;  3OYK A;  3S3O A;  3JB9 G;  4LDU A;  3DB3 A;  3V8J A;  4YRM A;  3QSU A;  4KR3 A;  4KR2 A;  2FVU A;  1WQW A;  5GAO l;  2IY5 A;  4WJ4 A;  3DSQ A;  1Z7M A;  1I8F A;  3WXM B;  4NCX A;  4RDX A;  1USY C;  1VQO T;  1VQ9 A;  5AYF A;  4J6X A;  4X9C A;  3P8B B;  3KFU A;  4XTY A;  3OYA A;  3M4Q A;  3PTA A;  4TWA A;  1B34 A;  1N9R A;  2MI6 A;  4ZGJ B;  5HKC A;  3CC2 A;  5C51 B;  2ZPF B;  2QA4 T;  3M54 A;  4PNO A;  3P8D A;  1YJ9 A;  2KDS A;  3JCM b;  4H02 A;  1SER A;  4UP8 A;  2ALY A;  1BI3 A;  2X35 A;  3HRU A;  1JJC A;  4C0F A;  1Q81 C;  1KHC A;  3CCQ T;  1KOG A;  3NEM A;  2C8M A;  4BW9 A;  1N8R U;  1KMN A;  5FLX E;  5CKD A;  3CCV T;  4KT0 E;  3QZ9 B;  4Y91 A;  2C06 A;  4M78 D;  5GAM f;  4M75 A;  3ER0 A;  4P75 C;  3QII A;  3QJY A;  2DKG A;  4YRR A;  2VC8 A;  3BDU A;  1VQ8 T;  4LVJ A;  2RJE A;  2QTX A;  4F7U E;  3P8H A;  5D6W A;  2ZZD A;  3VJP A;  4HWS A;  3MP1 A;  5GAN h;  3CBP A;  4J6W A;  3CD6 T;  1EQR A;  4M77 F;  4M7D E;  3A8G B;  3C94 A;  2PQW A;  2ZTG A;  3LC0 A;  2LQ8 A;  5LJ5 j;  2ZR2 A;  3NET A;  4MMK A;  2YRV A;  1KHI A;  5GMK m;  2E6Z A;  1S72 T;  4CH3 A;  4QQG A;  1BKB A;  3JB9 D;  1Y7X A;  4E51 A;  5A0D A;  4TVA A;  4O6J A;  4C8Q F;  3R07 A;  1ATI A;  3BDL A;  3TCJ A;  2PUK B;  2RHZ A;  3QO8 A;  1O75 A;  3HFZ A;  4R56 A;  5GAO q;  3MF1 A;  2E5Q A;  2IY5 B;  4PG3 A;  1Q82 U;  1VQL A;  3HKS A;  4MZP A;  3RUX A;  5LJ5 g;  3M58 A;  3VQV A;  4J15 A;  4XTX A;  4ZGE B;  2P0P A;  3A5Y A;  1B34 B;  4XAX B;  2ZPG B;  4XEO A;  4C92 E;  3CCL T;  3RMQ A;  1KQ1 A;  2WSC E;  4P71 C;  1KC8 U;  5GAO n;  4FT2 A;  4EX5 A;  5J3B A;  3NEN A;  2ALY B;  4BE2 A;  4M75 C;  1OI1 A;  4FM4 B;  4ZTF A;  1JJC B;  5DY9 A;  5M9O A;  1G5H A;  1Q7Y U;  3CC4 T;  2VUB A;  4C92 G;  2DQ3 A;  5FRM A;  4NL2 A;  2FYK A;  3RKX A;  1ASY A;  1UEB A;  2QI2 A;  3E19 A;  3JCM J;  2JUF A;  2M9U A;  2JNG A;  1YIT T;  4M75 B;  1EVK A;  2XGT A;  4L6V 5;  4DOV A;  3JB9 H;  3OQ5 A;  5CKE A;  4YRJ A;  1VQN T;  1I5L A;  5LJ3 h;  4OB0 B;  3MQZ A;  4WJ3 M;  3IKL A;  3HY0 A;  2GFU A;  3GNF B;  4ELZ C;  1VQ6 A;  3HXW A;  4P3P A;  2DZC A;  1M90 U;  4C0G A;  3PFS A;  4H2U A;  4OMF B;  2P5I A;  1C0A A;  3M55 A;  3KBG A;  3MF2 A;  3M9Q A;  4C0D C;  1WGS A;  4OF1 A;  4CH6 A;  5CIU A;  5GAN f;  4HCC A;  4Y28 E;  2CJB A;  2A7Y A;  3G71 A;  1K8A U;  3QHS A;  4B9X A;  4XTW A;  4HWR A;  4YCU A;  1YBY A;  3HP9 A;  4HCB A;  4TVA B;  4C0D B;  3PIP A;  2HAX A;  3HFZ B;  5I2S A;  4IKF A;  5LL6 S;  5GAN 7;  4P73 C;  5HK0 A;  4LVI A;  3JCM V;  4X5O A;  5DM7 R;  4H2W A;  2E5A A;  2X4J A;  1KD1 C;  3QPH A;  2Q7H A;  2Y4X A;  4EO4 A;  4E7J A;  4AH6 A;  2DXC A;  4ZTJ A;  1G3T A;  2DJZ A;  2IG0 A;  3L1A A;  5GAN 2;  2O01 E;  4C92 A;  1NPR A;  2R57 A;  4A4F A;  4KUI A;  4Q15 A;  1NJ8 A;  4C92 D;  3QO3 A;  3OMC A;  1V29 B;  3HXU A;  2K3Y A;  2L5Q A;  3CCR A;  2QXF A;  1NJ1 A;  1OYX A;  4CH5 A;  3CPF A;  3CC7 T;  1HK9 A;  5KCO A;  1JB0 E;  3O8V A;  1X6O A;  5GAM d;  1VQM A;  2BUD A;  4H2Y A;  2PVO B;  3HFV A;  4QQ6 A;  1AHJ B;  2GQV A;  2ZT7 A;  3H6Z A;  3HTZ A;  5C6S A;  3ASK A;  2RA2 A;  3QJ6 A;  1KQS A;  2L8D A;  4O5V A;  1NJ5 A;  1KQ2 A;  2KK4 A;  3JB9 I;  1W2B A;  4YRQ A;  2C7I A;  3E9I A;  3G4S A;  1HXD A;  2DK3 A;  5GMK e;  2CZ6 B;  1BI2 A;  5J39 A;  1VQ4 T;  3CME T;  5I21 A;  3C12 A;  1YIJ T;  1BIA A;  3QDR B;  2PME A;  2K5I A;  4DOW A;  3CCJ A;  1WJQ A;  4J7I A;  1HTT A;  2P0K A;  3W3S A;  4YCW A;  2Q5H A;  3OW2 S;  1YJN T;  3MP8 A;  4LD9 K;  3S6W A;  3VUZ A;  5C52 B;  1EVL A;  4DA4 A;  3L2Z A;  1PSF A;  4XU2 A;  4M78 F;  3LWH A;  2F5T X;  2ZPI B;  2QQ9 A;  4OVA A;  1X01 A;  3PNW C;  4ZTU B;  4MZT A;  2L3R A;  5GAM j;  4RG8 A;  2NS6 A;  5A0L A;  2G4C A;  4XK8 E;  3OBW A;  4EMK A;  3MEV A;  4VUB A;  4PJO C;  2DIQ A;  1G5I A;  2QDY B;  2DTO A;  3BFM A;  5IT9 E;  4OB2 B;  2OTJ A;  3RMS A;  2EJF A;  4YRF A;  3MEA A;  3ME9 A;  4ZN3 A;  1QVG S;  2MWO A;  2DVE A;  2RI2 A;  4R55 A;  3OS2 A;  2LNV A;  3OD1 A;  4M75 E;  1N9S A;  4PJO B;  2RHQ A;  1VUB A;  4YRO A;  3UWN A;  2ZPE B;  2AHJ B;  3QBY A;  1G3W A;  2O4X B;  3LGF A;  5GAO m;  1X54 A;  3HHT B;  4FT4 A;  4J6Y A;  2DD5 A;  2XD0 A;  3JCM g;  5GMK h;  4M75 G;  3HRS A;  4WF2 A;  1H4V B;  3CCM A;  4MDX A;  2LT4 A;  3OB9 A;  3VQX A;  3OYB A;  4TTV A;  2RHI A;  3OMG A;  2HD0 A;  1N9W A;  3CMA A;  3HXV A;  3MCA B;  4JRQ A;  3CCS T;  4LDY A;  4JS4 A;  3A7U A;  2ZT6 A;  5GAN 6;  4YRK A;  5GAN d;  1H64 1;  4KQE A;  2QQS A;  4NL3 A;  4LD6 A;  2LX9 A;  2G3R A;  3G6E T;  2QQR A;  1UGR B;  3A31 A;  2D0Q B;  1WJR A;  3BY7 A;  2OTL T;  3JRZ A;  4BE1 A;  2XIC A;  3R6O A;  1U8R A;  3MEY A;  4G84 A;  1I4K 1;  2QA4 A;  2E10 A;  4BUG A;  1M5Q 1;  4A4H A;  2NLU A;  4EMK C;  5HK3 A;  2KQW A;  1W4S A;  2B8A A;  2CZ0 B;  5A0G A;  4D6W A;  5KE3 A;  3QXE B;  1QVF A;  1VQK A;  2MWP A;  4BE0 A;  3L2W A;  4C5H A;  1M1G A;  1BBU A;  1TH7 A;  3TUP A;  1KD1 U;  5GMK i;  1VQ5 T;  3BJU A;  2KSS A;  5D6Y A;  4H2V A;  4EMK B;  2YHT A;  2FB7 A;  4QQD A;  4XU1 A;  1VIE A;  4XTZ A;  1FX7 A;  1SRY A;  1OZ2 A;  4RCB A;  1XNI A;  1QE0 A;  4MDW A;  3MP6 A;  4F7U F;  3P8V A;  4LDX A;  2ZZG A;  3P8T A;  1JRI A;  2R58 A;  2P0Q A;  4M7D F;  3JCM c;  3HSB A;  4P71 A;  2RHQ B;  3V8K A;  3EFS A;  1M1K C;  2VXE A;  3GIB A;  5GAN j;  1D3B A;  4FU6 A;  1VQ7 A;  4M75 D;  3REU A;  1VQP A;  4A54 A;  2ZT5 A;  1DJ7 B;  4QVZ A;  3PIO A;  4M7A A;  3CXC S;  3CC2 T;  2EQU A;  1KMM A;  1UGS B;  2RHU A;  4J5Y A;  5GAN 4;  4M7A D;  1K73 C;  1YJ9 T;  1XQH A;  4A53 A;  4NOY A;  4UC4 A;  4TQD A;  2RO0 A;  4OP0 A;  1NJ6 A;  2RI3 A;  2RK2 A;  2DEQ A;  1B76 A;  2XTI A;  4FL6 A;  2F5K A;  5LJ3 e;  1ZQ1 A;  3LYI A;  4A4K A;  4XU3 A;  2EJG A;  3V7S A;  3OYF A;  3CXC A;  3X28 B;  2BIV A;  2QHS A;  3RER A;  5LJ3 d;  2Q7E A;  3HPW A;  4C92 F;  4CS4 A;  3DLM A;  3X26 B;  4E7I A;  2A3L A;  2WSF E;  2XI9 A;  3PMI A;  5LJ5 h;  1E22 A;  3FIF A;  3L2Q A;  2RHS A;  2VYT A;  3UPU A;  2QQA A;  3PT9 A;  3GP8 A;  3SB2 A;  2X4W A;  3CBM A;  1NJ2 A;  2ZCE A;  2RH2 A;  3JSC A;  4EPC A;  5C0M A;  3X24 B;  2RB6 A;  1L0W A;  1ZHI A;  2VXF A;  2ZR3 A;  3OSV A;  4B9W A;  3RGL A;  1H4T A;  3VV0 A;  2RHX A;  4L87 A;  3UGT A;  5GAN 8;  5GAN 3;  3TU4 K;  5CO7 A;  4HVC A;  2M1H A;  4PHC A;  4BI3 A;  1PYS A;  1NYR A;  1QF6 A;  2D9T A;  4M77 G;  3OS5 A;  4JS5 A;  4P72 A;  3V7C A;  4P73 A;  3CEY A;  2L89 A;  4PJO E;  1LYL A;  3L4G B;  3A32 A;  4BB7 A;  3RKY A;  4OB3 B;  3SD4 A;  2V8K A;  3E9F A;  4M7A C;  2CJ9 A;  2YLC A;  5GMK l;  1YJW T;  1NNH A;  4RMO A;  4K88 A;  1VIF A;  3OYL A;  3CCE A;  1YCY A;  2HNI A;  2RJC A;  1D3B B;  5ELN A;  4PJO G;  3IG2 A;  4C8Q G;  2RJD A;  2Y4Y A;  3CCU T;  2ZCF B;  4A4G A;  4M7A B;  2FHD A;  4HWO A;  2EQM A;  4K86 A;  3HXY A;  1YHQ A;  5CQX A;  3WVE B;  4C0Z A;  1K9M U;  4YRI A;  2J3M A;  4V2S A;  4FIB A;  3UH0 A;  3PMT A;  4XEM A;  2ARU A;  4PL6 A;  2QQB A;  2DQ0 A;  3QZ5 B;  2A8E A;  1BIB A;  1LNX A;  2DIG A;  4PLL A;  4E47 A;  4J83 A;  4YTL A;  3J80 E;  4N0A A;  3KXT A;  1NZ9 A;  3PZC A;  3MEU A;  1IRE B;  2JTF A;  3FRN A;  2RK1 A;  3VBB A;  1ASZ A;  1WPY A;  3UDC A;  2ZNJ A;  2RHS B;  2E3C A;  2KAF A;  4RKU E;  4P72 C;  5E3I A;  1O9S A;  2I4N A;  2V8J A;  3J81 E;  4M77 A;  4YP0 A;  3CPW S;  3I56 A;  3UGQ A;  1FYF A;  5LJ5 f;  4M77 D;  3QNE A;  1SET A;  2DXU A;  1Q86 C;  1UGQ B;  2K2V A;  1PYS B;  2RJF A;  3EFR A;  4LDW A;  3RKW A;  1FXX A;  4YYE A;  1M9S A;  2FL7 A;  4OGC A;  1Q81 U;  4L5G A;  2EQJ A;  1BBW A;  2PU9 B;  4H2X A;  4TVR A;  2CGH A;  1PSE A;  2ZNI A;  3OYD A;  4PJO A;  1W66 A;  4C8Q A;  3LSQ A;  1M1K U;  3A8O B;  1QVP A;  4PJO D;  1IZ6 A;  4C8Q D;  4HT4 A;  5CKB A;  4GLK A;  2O4X A;  3J7A F;  1GXI E;  4JUV A;  1X75 C;  3VYG A;  5KE2 A;  1JJ2 S;  3M56 A;  3T9N A;  3H8Z A;  4Z02 A;  3CME A;  4JRK A;  2Q5I A;  2LCC A;  3BW1 A;  1N8R C;  2CZ1 B;  1E1O A;  3OYY A;  2I2L A;  3AHU A;  4H2T A;  3LWI A;  2ZZE A;  4QVD A;  5DLO A;  3URG A;  1H4Q A;  4N0A C;  2VGM A;  2OAU A;  4EDU A;  4BI4 A;  2ZPH B;  3CCR T;  4WI1 A;  1BI0 A;  5LJ3 f;  1SES A;  3TRE A;  2CIM A;  3IKM B;  1UB4 A;  3TEG A;  2ZIM A;  4HT9 A;  3GF5 A;  4C5E A;  2ZXF A;  5HGQ A;  2RHY A;  5GAN 5;  1QP2 A;  2CS7 A;  2PMF A;  5CK9 A;  4M77 C;  4P3O A;  1WNL A;  1NPP A;  4KUD K;  5CR2 A;  3LSS A;  4HT8 A;  2DU5 A;  2DXB A;  3GNG A;  3VU3 C;  2DO3 A;  2QEX A;  2CKK A;  3A8L B;  3OSS C;  3A8H B;  3S3N A;  4M77 B;  4M75 F;  2ARS A;  3IAL A;  4L59 A;  2JOY A;  4HKE A;  2GFA A;  2KMT A;  1X2G A;  3VKI A;  2LDM A;  4BDY A;  2F69 A;  2EYQ A;  3OW2 A;  4C8Q C;  3OA6 A;  11AS A;  2LVM A;  4UPA A;  2PVG B;  3HL8 A;  2XK0 A;  5FU7 C;  4HWT A;  4KUL A;  4H2X B;  4ZN1 A;  3Q1J A;  3V7R A;  4C8Q B;  1R8O B;  3CBO A;  3JCM h;  3JB9 F;  1YI2 A;  1WYD A;  4CS3 A;  5GMK j;  4M7A E;  3HRK A;  3GPL A;  5C53 B;  3M59 A;  3M4G A;  2EQK A;  5FU7 B;  5GAM g;  4NS5 A;  4LDV A;  2DZ9 A;  4LVL A;  5F5W A;  2GCX A;  2DTI A;  4BDZ A;  1QVG A;  1M4Z A;  4MZM A;  3FLG A;  2JN0 A;  5KH6 A;  4M7A G;  2OTJ T;  3C95 A;  1H4S A;  5EG2 A;  3RL6 A;  1E1T A;  1OZ3 A;  5HY6 A;  2XU8 A;  1YFT A;  3A74 A;  1VQO A;  4RQE A;  2ZIO A;  1M90 C;  1ADY A;  3E1S A;  3KUF A;  2AMC B;  3OYC A;  3L2V A;  3X25 B;  4IUU A;  1NE8 A;  2LRQ A;  2E65 A;  4XTU A;  4YRE A;  3PCO B;  1LOJ A;  3S3M A;  3VQY A;  3HY1 A;  2XKO C;  3MET A;  3JCM X;  2I4L A;  4HCZ A;  3A5Z A;  3OYJ A;  3M57 A;  5A2Q E;  2R5A A;  2MF2 A;  3N5B B;  1M1F A;  4YRL A;  3CCQ A;  4X9D A;  2CZ7 B;  3CMA T;  3OYI A;  5LJ5 e;  4P74 A;  4YCV A;  1Q86 U;  12AS A;  3I55 T;  3QTC A;  3M4Y A;  2JVV A;  3CCV A;  1YFS A;  3MHX A;  4HWP A;  2ZPB B;  1N27 A;  3NTI A;  1Y96 B;  1WJS A;  5LJ5 d;  3HXZ A;  4P3N A;  4QVC A;  1HC7 A;  3JAM E;  5K1X A;  2HBP A;  3FEO A;  1B70 A;  1VQ8 A;  1MGQ A;  5L8R E;  2EL9 A;  3L4G A;  2KY9 A;  3HRI A;  3CD6 A;  4ATO A;  3OYH A;  4C5I A;  5CQY A;  2XDD A;  1VQ9 T;  1VQK T;  3HFO A;  3OYM A;  4OLF A;  3SWN A;  2HQX A;  3E9G A;  1EIY B;  3ZEH A;  4M78 A;  1S72 A;  3OYE A;  2Y90 A;  5GAO r;  3ICA A;  2VGN A;  2KVQ G;  3JCM f;  4II1 A;  2X4Y A;  2LT1 A;  2E41 A;  3C4S A;  2M0O A;  3RAC A;  1B7Y A;  5K1P A;  4JLI A;  3VUB A;  5CKH A;  4ZIB A;  4E7K A;  1NJI C;  4YRS A;  4RCC A;  4J8O A;  4RQF A;  5IAY A;  2ODR C;  5D6X A;  3TEE A;  2MAM A;  2K5F A;  2WAC A;  3QO7 A;  3OYN A;  4YRG A;  4UP9 A;  1Y71 A;  1YGB A;  5GAN g;  3INZ A;  1VQ7 T;  3V8L A;  4F7U G;  1VQP T;  3CCL A;  4E7L A;  3OBY A;  3FDR A;  4CRI A;  4P74 C;  3NTH A;  4N4H A;  4M7D G;  2E70 A;  2XHC A;  4MML A;  1FWZ A;  4M77 E;  4PJO F;  1MHN A;  3A5Z B;  4GY5 A;  2LQK A;  5FU6 C;  3CC4 A;  5CVI A;  1QW1 A;  4IUV A;  3RF1 A;  2AKW A;  1YJW A;  4KBM B;  1RL2 A;  5GAO p;  1G3S A;  2I4M A;  2DPP B;  1YIT A;  2K57 A;  2K3X A;  3X20 B;  2XID A;  4EMH A;  3REX A;  1B70 B;  1NYQ A;  4JRI A;  5FU6 B;  4C8Q E;  3CCU A;  1VQN A;  3SWN C;  3OS1 A;  4LVK A;  2QHV A;  4P5N A;  4M78 C;  3JCM W;  4E7H A;  4XTV A;  2E64 A;  1U1S A;  4CI0 C;  4Q5W A;  2GF7 A;  1VQL T;  2RM4 A;  3EAE A;  3CMQ A;  3FC3 A;  5LJ3 j;  4N4I A;  3MO8 A;  2EIF A;  2X4X A;  4ME7 A;  2LCL A;  4XU0 A;  3RIR A;  3SWN B;  3M53 A;  4M78 B;  1Y07 A;  2DDZ A;  3OY9 A;  4BY6 C;  3I7F A;  5KCH A;  3OYG A;  3LGL A;  1I81 A;  1UGP B;  3L42 A;  2I4O A;  3DKM A;  1VQZ A;  4H2S A;  1B7Y B;  2ZGW A;  1WQ7 A;  1E24 A;  4EMG A;  3M5A A;  4JJN K;  4DQ2 A;  2P4T A;  4BY6 B;  4F7U A;  4RG2 A;  3PGG A;  4YPF A;  3CCE T;  3L2U A;  4M7D A;  3SDZ A;  1YB3 A;  4C5G A;  1XTD A;  2EKO A;  5I2M A;  4ZTZ B;  2BKD N;  3NTK A;  5LJ3 g;  4M7D D;  3LLR A;  3QUI A;  4YRN A;  1N6A A;  1BYM A;  1M8V A;  2JZ2 A;  2EFI A;  2E6N A;  4QW2 A;  3ZBD A;  2PVD B;  4G85 A;  1YHQ T;  1X55 A;  3UT1 A;  1VQ6 T;  1XOV A;  3A7A A;  4TVY A;  4BD3 A;  3HRT A;  5CAI A;  4IUQ A;  4J7F A;  3TEH A;  2DTH A;  4OB1 B;  1J5W A;  2AKW B;  4FSX A;  3QG1 A;  4TQF A;  1SSF A;  3QYG B;  3CC7 A;  3G71 T;  2CJA A;  2ZT8 A;  2QHU A;  1YFR A;  4CS2 A;  2RI5 A;  2P0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...