1WPYA

Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3 in complex with biotin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 61
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wpyA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wpyA01
5GAN3 2ZTGA 4M7AC 1EIYA 1H4SA 3VQYA 3RUXA 4M78A 2EL9A 4YRIA 1EIYB 1X55A 1YFTA 4M78B 2EJ9A 1SESA 3VQXA 4MMLA 5GMKl 3JCMf 1WLEA 3JCMh 3V8KA 2CJAA 3QNEA 5GAN7 1RIQA 3REXA 2YLCA 2DZ9A 3RGLA 2PMFA 2ZR3A 1SETA 4YRCA 2HNIA 1USYA 4PNOA 4PJOG 4F7UE 4M77G 3P8YA 4P74C 3PCOA 4K87A 3ICAA 3SWNB 1M5Q1 4G84A 4P71C 5GAOq 4OP0A 1B76A 4XEOA 2RHQA 4C8QE 1H4TA 4OLFA 4NOYA 2I4MA 3WQZA 1WNLA 2ZNJA 3BY7A 3LSSA 5GAOl 1X2HA 4M78G 4JRKA 3HXXA 1ADYA 1Z7MA 5DY9A 3JB9H 4P72C 4C92F 2DTIA 3EFSA 3L1AA 4NCXA 2E65A 3HFNA 1EFWA 4M75D 4A54A 4HWTA 3HSBA 1I81A 1H4VB 2ZXFA 3IALA 3NETA 4QVDA 1NNHA 4KQEA 3HRKA 4XU3A 4YCVA 4YPFA 4L87A 5I21A 1EVLA 5E3IA 4UP7A 4E51A 2ZIMA 3JB9I 4RCBA 3VU3C 3MEYA 4YCUA 1BIAA 4EO4A 1N9WA 2DXUA 2PMEA 2DJZA 4EMKC 4M7AF 4YRLA 4CH3A 4YDQA 1QE0A 4HWSA 5GAMe 4YRMA 1U1SA 3HXWA 4C92E 1HC7A 3QO3A 5LJ3e 3A7UA 3HTZA 4TQFA 4CH4A 3RL6A 3JCMX 2Q7GA 3G1ZA 3FB9A 1IL2A 4JRIA 1WQWA 4M77D 2QHTA 1X54A 5GMKm 4PG3A 2IY5B 4YP0A 3JCMV 1E22A 4JLIA 5GANf 1U1TA 1ATIA 3PGGA 2ZT8A 1H4QA 5GANh 4C92C 4K86A 1LYLA 3V8JA 4XTWA 4BW9A 4RQFA 4X9CA 4YRTA 3A7AA 2E64A 4HT8A 1E24A 2DKGA 4M78D 4P75A 2VC8A 3JCMb 4M77C 3FJPA 4X9DA 4H2VA 4PJOA 2XTIA 5LJ5e 5ELOA 2ODRD 1X56A 5GAMd 2DXTA 4K88A 4UP8A 5LJ3d 5CAIA 3VQVA 4QVCA 2RD1A 3NENA 4HWRA 2CIMA 3DSQA 1NJ1A 4YRGA 1LOJA 3RF1A 3QO7A 5LJ5j 4LNSA 1G51A 3V7RA 1ASYA 2DTOA 3QUIA 5GAN2 3JCMe 4M7DA 4H2XB 2ARSA 3HXZA 4M7DB 1B70B 4M75F 1USYC 3BDUA 3GIBA 4XEMA 4H2UA 1WQ7A 4DQ2A 3QHSA 2EAYA 5C53B 3SWNA 2Q5HA 4M7AB 4ZTZB 1J5WA 3RKXA 2Q7HA 4CS3A 4WJ3M 1GGMA 3MF1A 3V8LA 3RESA 4H2SA 1KQ2A 5GAMg 3KFUA 3SB2A 1D3BB 3M4QA 2AKWB 3A74A 1JBMA 2YLBA 3UGQA 1I4K1 3UFGA 2VXEA 4RCCA 4J6XA 4XTYA 5LJ3g 2ZT7A 3MF2A 1NJ6A 2ZINA 3BJUA 5ELNA 3EFRA 5GMKi 5K1PA 4EMGA 4M7DG 3NELA 1YB3A 1QF6A 2DZCA 4M75E 3ERRA 4M77F 4KR3A 3JCMd 1NJ8A 1E1TA 4XTZA 3A5ZA 4G85A 4WJ4A 4F7UA 4M7AG 3JB9D 5K1XA 2E5AA 1BBWA 4F7UB 5HGQA 3PZCA 4N0AA 1G5IA 1JJCB 4WF2A 4TVAB 4C8QA 4HVCA 2ARTA 1KMMA 4C8QB 4M75C 2RA2A 5GMKh 4M78F 4J6YA 1I8FA 5LJ5g 4BWAA 1YFSA 4DPGA 1B34B 4CH5A 3TEGA 1NYQA 3IKLA 4YRKA 2EWNA 1M8VA 4H2TA 4PJOD 1YCYA 4NL2A 4XU1A 2IY5A 4V2SA 2C8MA 2C7IA 3RKWA 2RHSB 4PHCA 4M77E 4UP9A 2ZNIA 1EQRA 2E10A 2Q5IA 4EMKA 4WI1A 3M4PA 4F7UG 4YYEA 4EMKB 5GAOn 3JCMP 3L4GA 4YRRA 3JB9J 3L4GB 3JCMg 5GANe 1Z7NA 3HXYA 1L0WA 4C8QG 3RIRA 1KOGA 3TUPA 4P75C 1N9RA 3V7CA 4PJOC 3R07A 4XU2A 1X01A 4M78E 3I7FA 4H2WA 4YRPA 3IG2A 3A32A 2ZGWA 1TH7A 3JCMQ 2ZIOA 1G5HA 1N9SA 4TVYA 1C0AA 4M7DD 4ZTUB 4C92A 4A53A 3P8TA 2CGHA 4C92B 5GANj 2FYKA 4H2YA 4MMKA 4M78C 2EJGA 3RKYA 4M7AD 1WU7A 3AHUA 1SRYA 1SERA 4J6WA 1HTTA 4YRNA 2ODRC 3QO8A 2I2LA 3P8VA 2YHTA 2J3LA 1BBUA 4H2XA 3HXVA 1B70A 1PYSB 2ZT6A 4P73A 2P0LA 5F5WA 1EVKA 3SWNC 5GANd 1HXDA 3HRIA 1ASZA 1EOVA 1HK9A 2ZZGA 1ADJA 4TTVA 4M7AA 1NJ2A 3JB9F 5KNNA 3NEMA 4C92G 4HWOA 4P3NA 5LJ5d 3HXUA 1NYRA 4EMHA 2ZR2A 1D3BA 3E9IA 4ZIBA 2AKWA 4CS4A 4HA8A 11ASA 2DDZA 4UPAA 4YCWA 3A31A 4XTUA 3PCOB 4C8QD 2I4NA 3HFZA 4P74A 2Q7EA 3HFZB 3UGTA 1WPYA 2E3CA 1X2GA 4P71A 2RHQB 2XGTA 1I5LA 5GAN4 4RDXA 3IKMB 2VXFA 2CJBA 2J3MA 2G4CA 5GAOr 4PJOF 3QTCA 2DTHA 3JCMW 3HY1A 3QSUA 3JCMJ 1B8AA 2QHVA 5GAN6 4N0AC 5GANg 1LNXA 1B7YA 1JJCA 4TVAA 3W3SA 3LC0A 4C8QC 1B7YB 4XQ3A 4P72A 3TEHA 2DQ0A 3QO5A 3TEHB 4RMFA 4HT9A 1YGBA 3UH0A 4TVWA 2ALYA 2DVEA 2ALYB 2E41A 2DEQA 5GMKe 4TWAA 1B34A 4NL3A 2ZT5A 3BW1A 2QHUA 1WYDA 4Q15A 4YRSA 3OD1A 4O2DA 4M7DF 4RQEA 2ZZFA 4CH6A 2I4LA 3HFOA 2RHSA 5GAMf 3M4GA 1KQ1A 4JUVA 1KMNA 4X5OA 5GAMh 4PJOE 3V7SA 4M75A 3HFVA 4CS2A 4XU0A 4M75B 4YRFA 3E9HA 1BIBA 2QTXA 5LJ3f 2RM4A 4C92D 5GMKj 2JN0A 5LJ3h 4TQDA 4P3PA 3A5YA 1W66A 2E1HA 1JRIA 2EJFA 2I4OA 4EX5A 1FYFA 2DU5A 4J15A 5GAN5 2CJ9A 1LJOA 2ARUA 2DU7A 4YROA 5GAOp 1VQZA 3JCMc 4AH6A 2ZCEA 3INZA 2DQ3A 1MGQA 3BFMA 5C52B 1Y96A 5GAMj 1Y96B 4KR2A 2ZZEA 1H641 12ASA 4M7DE 5GAN8 4YRQA 3RACA 3A7RA 2Y90A 5C51B 3REUA 4HWPA 4YREA 5LJ3j 4Y91A 2RB6A 1E1OA 5LJ5f 4M75G 4XTVA 5LJ5h 2QHSA 4F7UF 4M7AE 4M77A 4YRJA 2FB7A 4XTXA 4PJOB 4M77B 4Q6GA 4J5YA 3CMQA 3HY0A 4C8QF 3FIFA 4M7DC 2P5IA 1YFRA 3RERA 1PYSA 4P73C 3VBBA 4P3OA 2K57A 3JB9G 1NJ5A 2AMCA 5GAOm 2AMCB 3L2ZA 3LSQA 3VQWA 4H02A
chains in the Genus database with same CATH superfamily
2MK5A 2E3IA 2J6FA 1H4SA 2K6DA 2HAXA 2AT1B 3GBQA 2R5AA 3OS0A 3J7AF 1YFTA 2D1XA 2CZ7B 1QWFA 3CMEA 1SESA 1BCMA 1IHVA 1OOTA 1RLPC 2CJAA 1PWTA 1M90C 3CCLT 3Q1JA 4FSSA 3RGLA 2BZXA 1IB8A 2DL3A 2HBPA 2ZR3A 2NS6A 1USYA 4PNOA 4BE0A 2KGTA 4P74C 1WJRA 3ICAA 2M0OA 4P71C 1KHIA 4OP0A 2CT3A 5GAOq 1B76A 3CPWP 1NJIR 3MEVA 1YIJA 4NOYA 4JZ4A 1K73R 1K8AC 3U23A 2LX9A 1WNLA 2ZNJA 1KQSA 3LSSA 2DEUA 1MHNA 5GAOl 3M54A 2O31A 2CZ1B 4M78G 2X9HA 4JJCA 4Z8AA 3LWHA 4ZGDB 4J9CA 1O75A 4LE9A 5CIUA 1VQLA 3N5BB 4NCXA 1EFWA 3MCAB 4M75D 1YBYA 4IUPA 5HY6A 4D8KA 2ZXFA 4HT4A 1MUZA 2V8IA 4FM4B 1VQMT 1K9AA 1MNEA 4BY6B 3E2UA 2QDLA 1ZUYA 2OAWA 2K2MA 2O4XB 4XAXB 5DLOA 2A36A 1QP2A 4RKUE 1EVLA 1W6XA 4RCBA 1BIAA 1MV3A 2QK0A 1PSEA 1N9WA 4M7AF 1ZQ1A 1Z9ZA 1ZUKA 3CCJA 4YRMA 1K73U 1U1SA 3NMZC 2ENMA 3OYYA 2KY9A 4AFZC 4C0ZA 1VA7A 2DM1A 2F2WA 3QO3A 1WXBA 5LJ3e 2RJFA 4CH4A 2E4HA 1RI0A 3G1ZA 2ZPEB 3FB9A 2GQVA 1WJSA 4JZ3A 4M77D 2IY5B 4YP0A 1HSQA 2P84A 1ATIA 2E6NA 3PGGA 3CCUA 2ZT8A 2KYBA 2EGCA 4PJJA 5A0LA 3PVLA 5DM7R 4F17A 1QVFA 1M90U 1NLPC 3SD4A 1I0CA 6AT1B 3CCLA 5KYWA 4HT8A 2RI5A 2ROLA 3JCMb 2RI3A 3FJPA 4R55A 2NLUA 2XTIA 3JV3A 1LVKA 2X51A 2OTJA 5LJ5e 5ELOA 2ODRD 2CDTA 1PC0A 3UPUA 2YRVA 3G4ST 4LDUA 5GAMd 2DXTA 4OMPA 3HPWA 2LJ0A 2KQWA 4UP8A 4YTLA 5CAIA 2DD4A 2RD1A 2OX7A 2CIMA 4DBHA 3DSQA 2M1HA 1X6BA 2L0AA 1NJ1A 2PNIA 3V7RA 1VQ7Q 2VKNA 3QUIA 4H2XB 5FU7C 3HXZA 1CKAA 1B70B 2PTKA 1NG2A 2DA9A 4XEMA 2ED1A 1LCKA 1ZBJA 2AKLA 1X69A 1VQMA 2EAYA 4N4HA 2YUPA 1RAIB 3M0UA 3S3MA 4QW2A 4FSXA 3OYLA 1IZ6A 4CS3A 3LX7A 1VQNT 2MIOA 3G6ET 4H2SA 2ESWA 4X34A 3KFUA 3SB2A 2AKWB 3A74A 1KC8C 3CCQT 3CC4T 3MO8A 1OQKA 2COYA 3R6OA 3BDLA 1NJ6A 2RH2A 3EFRA 2IVWA 5GMKi 3GOXA 2HL3A 3NELA 1QF6A 2DZCA 2P0QA 1G3SA 3X24B 4KRTA 3AT1B 1MMNA 4L59A 2PZ1A 2DYBA 2KSSA 4E7SA 3JCMd 3CXCS 4M7AG 5C0MA 2M51A 3RBBB 4AFQC 4WF2A 2HCKA 2JM8A 2ARTA 4LXCA 1NLOC 2MF2A 3M57A 5CO7A 2K4YA 4FIBA 1I8FA 3UT1A 3I56Q 5KYUB 1YFSA 1BI1A 1TUDA 1B34B 4CH5A 1VQ9T 3G4SA 2AKKA 3L2RA 1M1KC 2AZVA 1KD1C 2X4XA 1AWXA 1YCSB 2E10A 2LJ3A 1W70A 5IHKA 4WI1A 1UJYA 4E7ZA 3L4GA 3QZ9B 2EQKA 1M27C 1TSFA 3L4GB 1GBRA 1Y0MA 7AT1B 3VKIA 1L0WA 2YUQA 4C8QG 1KOGA 2K3BA 1G3TA 3M9QA 1JXMA 2HMAA 2JTEA 5IT9E 2LC4A 2DL7A 4M78E 1I07A 4YRPA 1VYVA 3A32A 2X4WA 3JCMQ 5J3BA 4AT1B 1PKTA 3CPFA 1VQOA 1N9SA 2DYIA 2QQSA 3OYNA 4JJBA 4QVZA 3M0RA 4B9WA 1AWWA 3EGDA 4J7IA 2D8JA 2XU8A 1M30A 2EJGA 4M78C 4OB3B 4E47A 3VS1A 4F16A 3G71Q 2VYTA 1QMCA 4M4ZA 3L2UA 1PD0A 1C6VX 1JQQA 3CCQA 3QO8A 4HCCA 2MAMA 1BBUA 3CBPA 1PKSA 3CC7Q 1WFWA 2ZT6A 2QGFB 2XD0A 1NEGA 2P0LA 1ZA2B 2PU9B 1KQSS 2L3PA 3CD6Q 4OMOA 5GANd 3HRIA 1HK9A 1M1FA 3OB9A 2BZYA 2R5MA 2XDBA 3UA7A 2RI2A 3OYCA 1G5VA 1JO8A 3CBMA 3PIOA 3H0IA 3HXUA 5IN1A 4EMHA 4E2FB 3CC2A 2RJDA 2GQIA 3NTHA 1VQ5T 1FX7A 5FU7B 2HKNA 3A8GB 1XNIA 3VS6A 1VQ8T 4KULA 2E3CA 1ZA1B 4IIMA 1RL2A 1T3LA 1VQ9A 1M4ZA 2VXFA 2RK2A 2G4CA 4PJOF 4ELZC 2LT4A 1KD1U 4O6JA 3HY1A 3QSUA 4PFPA 2LQWA 8AT1B 3H0HA 4TVAA 2DF6A 3REBB 2L8DA 5HCKA 3E9FA 2DQ0A 3QO5A 2KRNA 4OGEA 1T3SA 4Y28E 3OMCA 4HT9A 4BDYA 2CKKA 2RO0A 1OI1A 2E41A 2DEQA 2JZ2A 1H3HA 1SG5A 2ZT5A 2QHUA 1WYDA 1G3WA 1ZHIA 3M59A 3PFSA 3L2VA 3C94A 4M7DF 4RQEA 5M9OA 2ABLA 2ZZFA 3OYEA 4MZPA 3M4GA 4X5OA 5GAMh 1Q86C 3MEUA 5HK3A 3CBOA 1G8XA 2QTXA 2DX1A 5KCHA 1C1AA 1MNDA 1H92A 2KI7A 1QQJA 4YROA 2ARUA 2QA4Q 2DU7A 1V76A 4PJLA 3CMAQ 1VQZA 2GTJA 4AH6A 1TXQA 1YI2Q 2V1QA 2GNCA 3INZA 1IREB 2E12A 2FL7A 3BFMA 4DBQA 3OYIA 1Y96A 4WCIA 1Y96B 4KR2A 3C4SA 1VQ7T 12ASA 2LP5A 3OBYA 5GAN8 2H3JA 2PVGB 3RACA 2H8HA 2Y90A 5C51B 3REUA 5LJ3j 4J9DA 1MMAA 5FRMA 1E1OA 1VQPT 2QHSA 1YJNT 1ZUUA 1WGSA 1VQ5A 4M7AE 2CH4W 2D0NA 2FB7A 2JS0A 1O9SA 1WHHA 3M4YA 3CMQA 1GFDA 3FIFA 2X4JA 1PYSA 3VBBA 3OA6A 4P3OA 1FYNA 3TREA 3URGA 5GAOm 3LSQA 2JMAA 4J15A 1X2KA 2ZTGA 3EGXB 4M7AC 3P8DA 1FMWA 2EL9A 4M78A 4M78B 1Y7XA 1YHQT 2EJ9A 1K76A 5GMKl 2CZ0B 3JCMh 1JXOA 1YP5A 3V8KA 3QNEA 5GAN7 2IIMA 1WYXA 1KIKA 2MWPA 1R0BG 4HVUA 1EX4A 2DZ9A 3LH0A 1OU9A 1KJWA 1SETA 2HDAA 1H8KA 5EG2A 4PJOG 2KBTA 3P8YA 4OMFB 4LUEA 2RHQA 2GFUA 2Y4YA 3I5RA 4C8QE 1H4TA 2K3XA 4OGCA 2JW4A 3WQZA 1HYOA 3BY7A 1QVFP 4P5NA 4J9IA 1UUEA 1Q86U 3I56T 1ZLMA 2FZKB 3JSCA 4JRKA 1QVGP 3H0FA 1FMKA 5FWBA 4C92F 2FRYA 3L1AA 3HFNA 5D6YA 2VWFA 2KR3A 2JJ9A 2NUPB 1D0YA 2FEIA 2K9GA 4LDWA 4VUBA 2X35A 4C0FA 1WA7A 3IALA 2PUKB 1TTHB 3CCEQ 4QVDA 1NNHA 4E7JA 3MJXA 3P8HA 2RF0A 1G2BA 4XU3A 2DNUA 2RQVA 3A5ZB 2O88A 4YCVA 3LH5A 2P0PA 1AHJB 1VQ7A 4PFOA 1LPLA 2DRKA 3VU3C 1WHLA 2DXUA 1EIFA 4YRLA 4HWSA 4ZGJB 3H9NA 1M8MA 3CXCA 4JPBW 2HEQA 2PVDB 1Q95G 2O9SA 3FEOA 2FPEA 2I0NA 3A7UA 2V8KA 2X3XD 3WXMB 3OY9A 4PL6A 2Q7GA 3UATA 1IL2A 4JRIA 1WQWA 3X20B 1X54A 2VGMA 3T9NA 1EFNA 5GANh 4KUIA 4OB2B 2DERA 2CUBA 3V8JA 4XTWA 4J7FA 2RQTA 3CC7T 3ZFJA 1RACB 1AZGB 4X9CA 1H3ZA 2F5KA 2CP5A 2KT1A 1M2VA 1OYXA 2DKGA 4M78D 4X1VA 3CD6T 1R77A 4GY5A 2RMOA 1R8OB 1NJIC 2D6FA 1RAAB 1K73C 2RPNA 1Q81R 2RHZA 1V1CA 1D1CA 1NZ9A 2X3WD 2EQJA 3X26B 1PHTA 1G3YA 4AG1C 1YITT 4K88A 4A63B 5LJ3d 5EC7A 3I56A 3CCUT 4HWRA 2E70A 4MDWA 1SF9A 3I5SA 4YRGA 1N8RU 1M3AA 1G51A 2MMPA 4QQGA 3PNWC 2JNGA 1BI3A 1GCQA 2EQUA 4M75F 2EQMA 2HQHA 1T0HA 4H2UA 2RHIA 4DQ2A 2J05A 3EG1A 4ZTFA 2Q5HA 2KYMA 2OTJT 2CP3A 2DRMA 4Q5WA 4M7AB 1J5WA 1AT1B 1AWOA 3FLGA 3EH2A 2EQIA 2YT6A 1CSKA 4WJ3M 1GGMA 3MF1A 3V8LA 9ATCB 1KQ2A 5GAMg 4KGXB 4C5GA 3UGQA 1JBMA 2YLBA 1I4K1 3TEEA 4RCCA 4J6XA 4XTYA 5KH6A 2ZT7A 1J3TA 2A7YA 1W2BS 3MP1A 4GLMA 3QIIA 3G71A 4M77F 2EYZA 1IXDA 5CK9A 2DD5A 3EHQA 1E1TA 4N4IA 2K3YA 4XTZA 1NJ8A 4WJ4A 2O4XA 5KE3A 3JB9D 1QCNA 1BBWA 5IXFA 1KSWA 2NYSA 4J9BA 3VS4A 4C5HA 2L3RA 4B9XA 1G5IA 1GFCA 3CC7A 2GF7A 4C8QA 4C8QB 2QA4T 3CMAT 1RLQC 1YI2T 5GMKh 3CD6A 1IO6A 2WACA 5CR2A 2J6KA 4MDXA 1ARKA 2AK5A 1NJIU 1GL5A 3M5AA 3F70A 3TEGA 1WHJA 1NYQA 2J6OA 3LGFA 3IKLA 4YRKA 3PMIA 1M8VA 4ZTJA 2XHCA 1VIFA 1YITA 4HKEA 4OB1B 1YCYA 1RI9A 4XU1A 2YWWA 5CKBA 4V2SA 2C8MA 2IY5A 2RQRA 2RHSB 3QWXX 1WZOA 3OYMA 2D0QB 4YYEA 4F7UG 1QWEA 2HBWA 2DXCA 1VQ4Q 3JB9J 4KH1B 3JCMg 4L5GA 3RIRA 4P75C 2EVRA 4RUGA 1P92A 4PJOC 2JXBA 4J9FA 1JJ2A 2LX7A 4H2WA 2JTMA 1BI0A 4EIKA 3G1JA 4N4GA 1UFFA 3LLRA 1TH7A 1TU0B 4DOWA 3MQZA 5KYNA 1N5ZA 3OYAA 1WHMA 2QAZA 4TVYA 5KYXB 4TVRA 2COZA 3P8TA 5GANj 4LN2A 2CUDA 2RN8A 3RKYA 4Z88A 3SDZA 4M7AD 1WU7A 2DILA 5CKFA 4RTVA 3AHUA 1Z9QA 4YRNA 1AD5A 3FC3A 4DEXA 5A0DA 4GLKA 1NEBA 2EPDA 2AIRB 4H2XA 4J9GA 1B70A 4LNPA 4J8OA 4DBFA 3SWNC 1ASZA 1EOVA 3I55Q 4A4KA 2XMFA 2ZZGA 1ADJA 3OYJA 1VQOT 1M1GA 3QYHB 2FHDA 2CSIA 3HP9A 1S72Q 4OMLA 2RHUA 2CP7A 4AFSC 1D0XA 4P3NA 3RDVA 2QA4A 3CMAA 1NYRA 2ZR2A 3O8VA 1YI2A 1SRMA 2AKWA 2K5FA 4CS4A 1QCOA 5IXBA 2AHJB 1E7OA 1PSFA 2V1RA 3RR6A 4C8QD 2I4NA 3HFZA 3PCOB 5A2QE 4P74A 3HFZB 2Q7EA 3UGTA 4P71A 4IIOA 5GAN4 1PM3A 1FWZA 2V26A 3QTCA 2DTHA 3JCMJ 1B8AA 2ZPIB 3MEAA 3VV0A 2L2PA 3OS5A 4N0AC 5GANg 1LNXA 3W3SA 1G83A 4XQ3A 3MKDA 1VYUA 2JOYA 4RMFA 1BYMA 2MPXC 5IHNA 3GP8A 3CC2T 5KYUA 3NHNA 2QEXT 2PVOB 2L89A 1B34A 4NL3A 3BW1A 1HD3A 3QDFA 3EHRA 4RMOA 3MEWA 1D1AA 2LQKA 1VQ6Q 3V7SA 1ZSZC 3HFVA 3I9QA 4J9HA 4YRFA 2EYWA 5GMKj 5LJ3h 1OEBA 1YJWQ 2FPFA 4MZTA 4EX5A 2EJFA 2DU5A 3S6WA 5GAN5 1KC8R 4BI3A 4CC2A 5GAOp 1SSFA 2DQ3A 4PJMA 2W10A 4EDUA 3CPWA 1PCXA 1H641 2O2OA 3PIPA 4IKFA 3A7RA 3EFOB 2B8AA 4A4GA 2JMCA 4Y91A 2DJQA 4F04B 2QG9B 4XTVA 4C5EA 5LJ5h 3CCEA 2KVQG 3OYGA 4PJOB 4Q6GA 2XG8D 3CQTA 3HY0A 4JRPA 1YFRA 1SKUB 3CCRQ 3RERA 4P73C 1PG5B 2C0IA 3OYFA 4PFZA 1SHFA 1WX6A 2LCCA 4FYXB 2RQWA 4FU6A 2E6ZA 1V29B 3VQWA 2O9VA 4H02A 1UGRB 1RUWA 3OW2S 1KFZA 3RUXA 4YRIA 3ER0A 1EIYA 1EIYB 1M1KR 2MOXA 5CKDA 4MMLA 4PLLA 3VQXA 3CXCP 1RAFB 3HRTA 5D6WA 1RIQA 2YLCA 2PMFA 2VUBA 2HD0A 2HNIA 1SEMA 2QQRA 1TOVA 2F69A 1YJ9Q 2W0ZA 4JRQA 4KGZB 5L23A 4F7UE 4CI0C 2QEXA 4OB0B 3M55A 3SWNB 4G84A 2RNAA 4OMMA 4XEOA 1WJQA 2EW3A 2I4MA 2QGGA 1X43A 2C06A 1PD1A 3CCMQ 1X6OA 4NS5A 2DMOA 4LDXA 1X2HA 2VGNA 3J81E 4OF1A 2JM9A 4J9EA 3P8BB 2YUOA 4P72C 3CEYA 1B3QA 2DTIA 3FRNA 4LVJA 3ZL7C 3VRZA 3KUFA 3IQLA 4A54A 4HWTA 3PE0A 3HSBA 3UF4A 4LD9K 3NETA 1GRIA 1BU1A 2P0KA 4KQEA 3M0TA 4IURA 2M0YA 1WHGA 2E5QA 2FG0A 3JRZA 5I21A 4L87A 4YPFA 1W2BA 4E51A 2QASA 3JB9I 4ESRA 1JJ2S 2PMEA 4QQ6A 2DJZA 4EMKC 4CH3A 1NPPA 4YDQA 4ORZA 1DJ7B 4E7LA 2D9TA 2F1LA 2HZYA 1HC7A 2RJCA 3HTZA 4TQFA 3RL6A 1YNZA 3QBYA 1AVZC 2DK3A 3VYGA 4PG3A 4DBRA 3OS2A 1KQSP 1M9SA 3H6ZA 3JCMV 2LTOA 1H4QA 2GBQA 1ZSZB 4K86A 4FYYB 4BW9A 1I5OB 4RQFA 4YRTA 2DBKA 1E24A 1YN8A 2VC8A 4M77C 1NM7A 1MMDA 3I55T 4H2VA 3CCVQ 1TUGB 1PRMC 1S72T 1Y57A 1X56A 4BI4A 4KBMB 2EGEA 1U06A 1UJ0A 1ACMB 3EGXA 2EKHA 1E6GA 1OX9A 2AZSA 1TS9A 1IGQA 2C0TA 3RF1A 3FJ5A 3QO7A 5LJ5j 2CYZB 2DTOA 1T0JA 5GAN2 1USYC 1E6HA 3BDUA 1WQ7A 3OSVA 3EH1A 3OMGA 3LGLA 2L3SA 2QQAA 2CZ6B 4ZTZB 1VQ4A 4FT2A 1Q82R 4HXJA 5D7UA 3RKXA 3KXTA 3ASKA 4XK8E 1BI2A 1X6GA 1FMVA 3VS0A 1D3BB 3M4QA 2M02A 3EG0A 2G6FX 3DB4A 3CCSQ 2ZAEA 5IHIA 3UFGA 2VXEA 2YUNA 1N8RC 4LUDA 5LJ3g 3MF2A 4WTOB 4HVWA 2ZINA 2NUPA 2A3LA 1U8RA 2COWA 4M7DG 3O5ZA 1YB3A 3NTKA 3ERRA 2CREA 2RHXA 1SSHA 4BD3A 2BKDN 4KR3A 4G85A 2R57A 3A5ZA 2K79A 4F7UA 3DLLA 5K1XA 2HQXA 3BE3A 4F7UB 5HGQA 1YJWT 1JJCB 1X27A 4BDZA 3VS2A 1KMMA 2MYSA 2RA2A 2DETA 2MI6A 4M78F 4D8DA 1VQNQ 2RJEA 3G6EQ 3I55A 5LJ5g 3QWYA 2DL4A 4F14A 3OS1A 2BTTA 3CPWS 1S72A 2D8HA 3HHTB 1ZBXA 3CC4Q 5GJVB 2EWNA 2KXDA 3G71T 3L2QA 4NL2A 2MCNA 2K7AA 2DIQA 2C7IA 4PHCA 1ABOA 3NGPA 4UP9A 1EQRA 2NUTA 4R0KA 4EMKA 2NUTB 5L8RE 1UEBA 3H41A 4EMKB 5GAOn 3OYDA 2PUOB 4YRRA 2MWOA 3SFMA 3DB3A 1Z7NA 3HXYA 2YRDA 2F2VA 2DFUA 2QXFA 1RAEB 3QG1A 3TUPA 1D1BA 1B07A 2F2XA 4XU2A 1D09B 3I7FA 3IG2A 2RK1A 3QPHA 2FZGB 4OVAA 1KG1A 1G5HA 2X4YA 1C0AA 4AMCA 4A53A 1MMGA 2ZZDA 1X75C 1BB9A 4MMKA 4H2YA 4O5VA 4IUUA 3KFVA 3RMSA 1UG1A 1SERA 1HTTA 2I2LA 1TWBA 1D0ZA 1UGPB 5F5WA 1M3BA 3M58A 1VQ6A 1EVKA 1PNJA 2R58A 2FO0A 1HXDA 1M2OA 4KUDK 1YWOA 2IPOB 4CRIA 2QQ9A 3NTIA 4M7AA 3S3NA 4JJDA 1QCFA 3JB9F 1KK7A 2VV5A 3OYHA 1YJWA 5KNNA 4C92G 2KEAA 3QYGB 1K4US 4HWOA 5LJ5d 2GFAA 5FROA 3QDRB 3M0QA 1Q81U 3E9IA 4ZIBA 3X25B 3M56A 4K11A 1K9MR 4HA8A 11ASA 3OW2A 2DDZA 2M16A 2VB6A 3C12A 3VUZA 2LCSA 3A31A 1B7TA 2EFIA 1WPYA 1WI7A 4FW2A 1K0XA 4KGVB 4LDVA 2XGTA 4L6V5 3OQ5A 1QKWA 3IKMB 1QKXA 1K0SA 2OJ2A 3X28B 2CJBA 1N6AA 2J3MA 1AEYA 3JCMW 5I2SA 1WLPB 2A28A 3A98A 1CKBA 2QHVA 5GAN6 1Q7YR 3A8OB 1IHWA 1UGSB 5GJWB 3CCRA 4RG8A 3M53A 5FW9A 3TEHA 5CKHA 3TEHB 1XQHA 4MZMA 1A0NB 1RADB 2DVEA 5I2MA 2SRCA 1M90R 4TWAA 1VQ5Q 2KRMA 2DL8A 4YRSA 1VQ8Q 3OD1A 4HCKA 4HCZA 4RTYA 3R6NA 4B6MA 4CH6A 1K9MU 1VYTA 1BCOA 3MPUB 3EAEA 3WVDB 3G7ZA 3HFOA 2RHSA 5GAMf 1OZ2A 4QQDA 2BIVA 3CCVT 1YJ9A 2LRQA 4PJNA 4PJOE 3L42A 4XU0A 3E9HA 1UGQB 1K8AR 1BIBA 3S3OA 2YXYA 2ATCB 2RM4A 2JN0A 4TQDA 1GBQA 1RABB 1JRIA 3SHWA 2LNVA 3CCMA 1XOVA 1LJOA 4C0DC 1VOMA 3MP8A 1Q7YU 1UECA 1MGQA 1W1FA 2RQUA 1SPKA 2XDDA 5C52B 5KYXA 1XTDA 2ZZEA 4M7DE 4ZN1A 1OPLA 4FL6A 5FWCA 4E7IA 4HWPA 2P4RA 3VYHB 3ZBDA 1OU8A 1NPRA 5KYWB 4M75G 1QVGA 3RMQA 1IGUA 4YRJA 1VUBA 4XTXA 2KK4A 4BI8B 1SHGA 1OZ3A 5CVIA 2JUFA 4J5YA 2C0OA 2EBPA 4C8QF 1QP3A 4M7DC 2Y4XA 3JB9G 2A0FB 4IUQA 3TSWA 3L2ZA 2XDPA 1W2BP 1K8AU 5GAN3 2ZPFB 2K5IA 5FU6C 3CCST 3VQYA 1X55A 2J06A 5A0GA 1GXIE 3JCMf 1UTIA 1WLEA 4BACA 4BE2A 3REXA 4R56A 2OTLQ 4C5IA 3DKMA 2EKOA 4YRCA 3CCET 1YWPA 1TUCA 3FDRA 1VQPQ 4M77G 1QLYA 3UA6A 3PCOA 1YJNQ 4K87A 4BUGA 2KAFA 1M5Q1 3C95A 3ZEHA 5CCAA 3LW5E 4OLFA 2B86A 4CC7A 3QZ5B 4JS4A 2GGRA 4OMNA 3CCVA 4KT0E 2K5LA 3HXXA 5HK0A 4Y92A 1UGVA 2CSQA 4PKCC 5DY9A 3JB9H 1ADYA 2FRWA 1Z7MA 3EFSA 2KT8A 1YHQQ 2QTVA 2EYXA 2E65A 3VJPA 4ATOA 1M3CA 2DPPB 2LJ1A 1I81A 1H4VB 2L3QA 5LL6S 4BB7A 3GLXA 1TG0A 4LVKA 3LWIA 3HRKA 2KXCA 2QDYB 3A8MB 3PMTA 4LVIA 4JDSA 5E3IA 1HJDA 4UP7A 4LD6A 2ZIMA 3JAME 5IAYA 3EGUA 3MEYA 4YCUA 1VQKQ 4EO4A 2HL5C 3THKA 4A4FA 1QE0A 1W4SA 5AYFA 5GAMe 2EYQA 2CP0A 2XI9A 5ECAA 3CMEQ 3HXWA 3EG3A 3ME9A 4C92E 3OBWA 3JCMX 4PLIA 4IUVA 2LMJA 2QHTA 5GMKm 4CC3A 3CCSA 1E22A 3TCJA 1YFNA 4JLIA 1U1TA 5GANf 1XJWB 2HSPA 2K2VA 4C92C 3HRUA 5CKEA 4RTTA 4IUTA 4Z89A 1LYLA 4RG2A 3EFOA 1YIJQ 3E9GA 3A7AA 2E64A 3META 3MHXA 1Y07A 3GF5A 4LDYA 4P75A 3VUBA 4ANJA 1BK2A 4X9DA 4PJOA 4C0DB 1UHFA 3REAB 1S1NA 2NUZA 2LVMA 1VQLQ 2FVUA 5J39A 2PQWA 4ZN3A 3UWNA 1NE8A 3EGDB 4AG2C 1VQNA 3G6EA 2LCLA 4ZGEB 4DA4A 4QT7A 3VQVA 4QVCA 3NENA 2HQEA 1LOJA 1KD1R 2WSFE 3CC4A 2DIGA 1KC8U 4LNSA 3NFCA 1U5SA 1ASYA 1BBZA 1UHCA 4KH0B 4M7DA 3JCMe 2BZ8A 1AOJA 2ARSA 1FXXA 4M7DB 1JU5C 3GIBA 2CS7A 3QHSA 5C53B 1RAHB 2RHYA 3SWNA 2FZCB 2M9UA 3CCJQ 2HKQB 2ZPBB 4DEYA 4DOVA 2DXBA 1SRLA 3SEMA 2DE0X 4ME7A 5FU6B 1JB0E 3VS3A 3QKJA 2Q7HA 2XK0A 1N27A 2V8JA 5C6SA 1NYFA 1YITQ 3RESA 4E7KA 4HCBA 4E7HA 1JEGA 1NYGA 1IRXA 2KNBB 2F5TX 2BUDA 3CCUQ 2KE9A 1MV0B 1UB4A 3BJUA 2ZPHB 5ELNA 3TU4K 5K1PA 4EMGA 1GCPA 3CCLQ 4M75E 1M1KU 4D6WA 3A8HB 4EPCA 1VQ4T 2OTJQ 2E5AA 3GNFB 2GTOA 3PZCA 4N0AA 1OPKA 4TVAB 2LNHB 4HVCA 2DO3A 2YRCA 4M75C 2JS2A 2DLPA 4J6YA 1AWJA 4RTZA 2XICA 2P4TA 3HRSA 2EIFA 4BWAA 4DPGA 1R0CB 2DL5A 4ZNXA 2DBMA 1C0MA 3TVTA 4CC4B 4H2TA 1U3OA 1QVFS 1I1JA 1WDXA 4PJOD 3OYKA 4FYWB 1QVGS 2IG0A 3RKWA 4M77E 1VQMQ 2ZNIA 1VIEA 3HKSA 1ZSZA 2Q5IA 3M4PA 3OW2P 2HSEB 3JCMP 2YDLA 3EG2A 5GANe 3LYIA 2DAQA 4C0GA 1N9RA 2LQ8A 4HVVA 3V7CA 5AT1B 1Q82C 2XIDA 3R07A 2KMTA 1X01A 3NPFA 2ECZA 2ZGWA 1ABQA 5D6XA 2ZIOA 2CH4A 2E5KA 4JJNK 2WSEE 3DLMA 4M7DD 4ZTUB 2YSQA 4C92A 2CGHA 4C92B 2FYKA 2SEMA 2OI3A 1EZZB 2OTLT 3QJ6A 4AFUC 3GNGA 3KBGA 1OX8A 2OAUA 1PRLC 4LVMA 1SRYA 4QKUA 4J6WA 2QI2A 2ODRC 2JVVA 3P8VA 2KDSA 1VQ8A 1Q86R 2YHTA 2J3LA 1GCQC 3HXVA 2A37A 2LT1A 4ELYC 1PYSB 4P73A 5FRNA 1WIEA 1OULA 5I11A 4PK4A 2ZCFB 4TTVA 4E6RA 4J83A 1NJ2A 5KYYA 1F1BB 3HTRA 3VS5A 5KYYB 1Y71A 2LQNA 2O01E 1RAGB 3NEMA 3TSZA 3G4SQ 5CQXA 3J80E 5HKCA 2JT4A 1OV3A 1D3BA 3C0CA 2ZPGB 3VS7A 3H8ZA 2ROTA 2EGAA 1JJ2P 4UPAA 4YCWA 2EYYA 3E19A 4XTUA 2VVKA 2CP2A 3A8LB 4II1A 1X2GA 3OYBA 3QJYA 2JTFA 2RHQB 3UDCA 1K1ZA 5CQYA 1I5LA 5IH2A 4RDXA 1KHCA 1VQKT 1VQ6T 4BY6C 8ATCB 3GPLA 5GAOr 1QVPA 3PTAA 2A8EA 2LZ6B 5J26A 4LVLA 2ED0A 3CMET 1B7YA 1VQOQ 1JJCA 3LC0A 4C8QC 1B7YB 4OMQA 2L5QA 4P72A 2CT4A 1NBEB 3OSSC 2E3HA 2VASA 2A08A 2FPDA 4UC4A 3WVEB 1Q81C 1UDLA 1YGBA 3UH0A 4TVWA 3QXEB 2ALYA 1Q82U 1AZEA 4FW1A 2ALYB 3RNJA 5KE2A 1WXUA 5GMKe 4Z02A 4RTUA 3CCQQ 4Q15A 5DLQE 2QQBA 5FLXE 4O2DA 4RTXA 1YIJT 2J7IA 2I4LA 3MP6A 2LDMA 3HL8A 3ULRB 4A4EA 2NWMA 2CP6A 2OTLA 3M0PA 1KMNA 1KQ1A 4JUVA 2Z0WA 4M75A 4CS2A 1VQPA 4M75B 5KCOA 1YJNA 1ZSGA 1WHKA 5LJ3f 4C92D 4P3PA 3CCRT 3A5YA 2QYZA 1W66A 5I22A 2WSCE 1VQLT 2E1HA 4A4HA 2I4OA 1FYFA 4BE1A 2BE7D 4RTWA 1ZX6A 2CJ9A 1N8RR 3D7SB 3JCMc 3PT9A 4FYVB 2ZCEA 2KROA 3A1PA 4JLGA 3CC2Q 2BE9B 4FT4A 1QW1A 2DVJA 2QEXQ 1YHQA 5GAMj 2G3RA 2H3EB 3I35A 1K9MC 3VRYA 1VQ9Q 4FCYA 4YRQA 3EG9A 2XKOC 4YREA 3EG9B 1UE9A 1YJ9T 2RB6A 1M2VB 2GCXA 5LJ5f 3TQ7P 3M0SA 4F7UF 3CCJT 4M77A 4GBQA 4M77B 1X2QA 2P5IA 4JS5A 3PVQA 1BKBA 2KRSA 2K57A 1NJ5A 3CCMT 2AMCA 1WXTA 2AMCB 1Q7YC 1VQKA 3L2WA 3E1SA
chains in the Genus database with same CATH topology
1H4SA 2HAXA 3J7AF 1YFTA 2R5AA 3OS0A 2CZ7B 3CMEA 1SESA 2CJAA 1M90C 3CCLT 3Q1JA 3RGLA 2HBPA 2ZR3A 2NS6A 1USYA 4PNOA 4BE0A 4P74C 1WJRA 3ICAA 2M0OA 4P71C 1KHIA 4OP0A 5GAOq 1B76A 3MEVA 1YIJA 4NOYA 1K8AC 2LX9A 1WNLA 2ZNJA 1KQSA 3LSSA 1MHNA 5GAOl 3M54A 2CZ1B 4M78G 3LWHA 4ZGDB 5CIUA 1O75A 1VQLA 3N5BB 4NCXA 1EFWA 3MCAB 4M75D 1YBYA 4IUPA 5HY6A 2ZXFA 4HT4A 2V8IA 4FM4B 1VQMT 4BY6B 2O4XB 4XAXB 5DLOA 4RKUE 1QP2A 1EVLA 4RCBA 1BIAA 1PSEA 1N9WA 4M7AF 1ZQ1A 3CCJA 4YRMA 1K73U 1U1SA 3OYYA 4C0ZA 2KY9A 3QO3A 5LJ3e 2RJFA 4CH4A 1RI0A 3G1ZA 2ZPEB 3FB9A 2GQVA 1WJSA 4M77D 2IY5B 4YP0A 1ATIA 2E6NA 3PGGA 3CCUA 2ZT8A 5A0LA 5DM7R 1QVFA 1M90U 3SD4A 3CCLA 4HT8A 2RI5A 3JCMb 2RI3A 3FJPA 4R55A 2NLUA 2XTIA 2OTJA 5LJ5e 5ELOA 2ODRD 3UPUA 2YRVA 3G4ST 4LDUA 5GAMd 2DXTA 3HPWA 2KQWA 4UP8A 4YTLA 5CAIA 2DD4A 2RD1A 2CIMA 3DSQA 2M1HA 1NJ1A 3V7RA 3QUIA 4H2XB 5FU7C 3HXZA 1B70B 4XEMA 1VQMA 2EAYA 4N4HA 3S3MA 4QW2A 4FSXA 3OYLA 1IZ6A 4CS3A 3LX7A 1VQNT 3G6ET 4H2SA 4X34A 3KFUA 3SB2A 2AKWB 3A74A 1KC8C 3CCQT 3CC4T 3MO8A 3R6OA 3BDLA 1NJ6A 2RH2A 3EFRA 2IVWA 5GMKi 3GOXA 3NELA 1QF6A 2DZCA 2P0QA 1G3SA 3X24B 4L59A 2KSSA 3CXCS 3JCMd 4M7AG 5C0MA 4WF2A 2ARTA 2MF2A 3M57A 5CO7A 2K4YA 4FIBA 1I8FA 3UT1A 1YFSA 1BI1A 1B34B 4CH5A 1VQ9T 3G4SA 3L2RA 1M1KC 1KD1C 2X4XA 2E10A 4WI1A 3L4GA 3QZ9B 2EQKA 3L4GB 3VKIA 1L0WA 4C8QG 1KOGA 1G3TA 3M9QA 5IT9E 2LC4A 4M78E 4YRPA 3A32A 2X4WA 3JCMQ 5J3BA 3CPFA 1VQOA 1N9SA 2QQSA 3OYNA 4QVZA 4B9WA 4J7IA 2XU8A 4M78C 2EJGA 4OB3B 4E47A 2VYTA 3L2UA 3CCQA 3QO8A 4HCCA 2MAMA 1BBUA 3CBPA 2ZT6A 2XD0A 2P0LA 2PU9B 1KQSS 5GANd 3HRIA 1HK9A 1M1FA 3OB9A 2R5MA 2XDBA 2RI2A 3OYCA 1G5VA 3CBMA 3PIOA 3HXUA 5IN1A 4EMHA 3CC2A 2RJDA 3NTHA 1VQ5T 1FX7A 5FU7B 3A8GB 1XNIA 1VQ8T 4KULA 2E3CA 1RL2A 1VQ9A 1M4ZA 2VXFA 2RK2A 2G4CA 4PJOF 4ELZC 2LT4A 1KD1U 4O6JA 3HY1A 3QSUA 4TVAA 2L8DA 3E9FA 2DQ0A 3QO5A 4OGEA 4Y28E 3OMCA 4HT9A 4BDYA 2CKKA 2RO0A 1OI1A 2E41A 2DEQA 2JZ2A 2ZT5A 2QHUA 1WYDA 1G3WA 1ZHIA 3M59A 3PFSA 3L2VA 3C94A 4M7DF 4RQEA 5M9OA 2ZZFA 3OYEA 4MZPA 3M4GA 4X5OA 5GAMh 1Q86C 3MEUA 5HK3A 3CBOA 2QTXA 5KCHA 4YROA 2ARUA 2DU7A 1VQZA 4AH6A 3INZA 1IREB 2E12A 2FL7A 3BFMA 3OYIA 1Y96A 1Y96B 4KR2A 3C4SA 1VQ7T 12ASA 3OBYA 5GAN8 2H3JA 2PVGB 3RACA 2Y90A 5C51B 3REUA 5LJ3j 5FRMA 1E1OA 1VQPT 2QHSA 1YJNT 1VQ5A 1WGSA 4M7AE 2FB7A 1O9SA 3M4YA 3CMQA 3FIFA 2X4JA 1PYSA 3VBBA 3OA6A 4P3OA 3TREA 3URGA 5GAOm 3LSQA 4J15A 2ZTGA 4M7AC 3P8DA 2EL9A 4M78A 4M78B 1Y7XA 1YHQT 2EJ9A 5GMKl 2CZ0B 3JCMh 3V8KA 3QNEA 5GAN7 2MWPA 2DZ9A 3LH0A 1SETA 5EG2A 4PJOG 3P8YA 4OMFB 2RHQA 2GFUA 2Y4YA 4C8QE 1H4TA 2K3XA 4OGCA 3WQZA 3BY7A 4P5NA 1Q86U 3I56T 3JSCA 4JRKA 4C92F 3L1AA 3HFNA 5D6YA 4LDWA 4VUBA 2X35A 4C0FA 3IALA 2PUKB 4QVDA 1NNHA 4E7JA 3P8HA 4XU3A 3A5ZB 4YCVA 2P0PA 1AHJB 1VQ7A 3VU3C 2DXUA 1EIFA 4YRLA 4HWSA 4ZGJB 3CXCA 2PVDB 3FEOA 3A7UA 2V8KA 3WXMB 3OY9A 4PL6A 2Q7GA 1IL2A 4JRIA 1WQWA 3X20B 1X54A 2VGMA 3T9NA 5GANh 4KUIA 4OB2B 3V8JA 4XTWA 4J7FA 3CC7T 3ZFJA 4X9CA 1H3ZA 2F5KA 1OYXA 2DKGA 4M78D 3CD6T 4GY5A 1R8OB 1NJIC 2D6FA 1K73C 2RHZA 1NZ9A 2EQJA 3X26B 1G3YA 1YITT 4K88A 5LJ3d 3I56A 3CCUT 4HWRA 2E70A 4MDWA 4YRGA 1N8RU 1G51A 2MMPA 4QQGA 3PNWC 2JNGA 1BI3A 2EQUA 4M75F 2EQMA 4H2UA 2RHIA 4DQ2A 4ZTFA 2Q5HA 2OTJT 4Q5WA 4M7AB 1J5WA 3FLGA 4WJ3M 1GGMA 3MF1A 3V8LA 1KQ2A 5GAMg 4C5GA 3UGQA 1JBMA 2YLBA 1I4K1 3TEEA 4RCCA 4J6XA 4XTYA 5KH6A 2ZT7A 2A7YA 1W2BS 3MP1A 3QIIA 3G71A 4M77F 5CK9A 2DD5A 1NJ8A 1E1TA 4N4IA 2K3YA 4XTZA 4WJ4A 2O4XA 5KE3A 3JB9D 1BBWA 4C5HA 2L3RA 4B9XA 1G5IA 3CC7A 2GF7A 4C8QA 4C8QB 2QA4T 3CMAT 1YI2T 5GMKh 3CD6A 2WACA 5CR2A 4MDXA 1NJIU 3M5AA 3F70A 3TEGA 1NYQA 3LGFA 3IKLA 4YRKA 3PMIA 1M8VA 4ZTJA 2XHCA 1VIFA 1YITA 4HKEA 4OB1B 1YCYA 4XU1A 5CKBA 2IY5A 4V2SA 2C8MA 2RHSB 3OYMA 2D0QB 4YYEA 4F7UG 2DXCA 3JB9J 3JCMg 4L5GA 3RIRA 4P75C 1P92A 4PJOC 1JJ2A 4H2WA 2JTMA 1BI0A 4N4GA 4DOWA 3LLRA 1TH7A 3MQZA 3OYAA 4TVYA 4TVRA 3P8TA 5GANj 3RKYA 3SDZA 4M7AD 1WU7A 5CKFA 3AHUA 4YRNA 3FC3A 5A0DA 4GLKA 4H2XA 1B70A 4J8OA 3SWNC 1ASZA 1EOVA 4A4KA 2ZZGA 1ADJA 3OYJA 1VQOT 1M1GA 3QYHB 2FHDA 3HP9A 2RHUA 4P3NA 2QA4A 3CMAA 1NYRA 2ZR2A 3O8VA 1YI2A 2AKWA 2K5FA 4CS4A 2AHJB 1PSFA 4C8QD 2I4NA 3HFZA 3PCOB 4P74A 2Q7EA 5A2QE 3HFZB 3UGTA 4P71A 5GAN4 1FWZA 3QTCA 2DTHA 3JCMJ 1B8AA 2ZPIB 3MEAA 3VV0A 3OS5A 4N0AC 5GANg 1LNXA 3W3SA 4XQ3A 2JOYA 4RMFA 1BYMA 3GP8A 3CC2T 2QEXT 2PVOB 2L89A 1B34A 4NL3A 3BW1A 4RMOA 3MEWA 2LQKA 3V7SA 3HFVA 4YRFA 5GMKj 5LJ3h 4MZTA 4EX5A 2EJFA 2DU5A 3S6WA 5GAN5 4BI3A 5GAOp 1SSFA 2DQ3A 4EDUA 3CPWA 1H641 3PIPA 4IKFA 3A7RA 2B8AA 4A4GA 4Y91A 4XTVA 4C5EA 5LJ5h 3CCEA 2KVQG 3OYGA 4PJOB 4Q6GA 2XG8D 3HY0A 4JRPA 1YFRA 3RERA 4P73C 3OYFA 2LCCA 4FU6A 2E6ZA 1V29B 3VQWA 4H02A 1UGRB 1EIYA 3OW2S 3RUXA 4YRIA 3ER0A 1EIYB 5CKDA 4MMLA 4PLLA 3VQXA 3HRTA 5D6WA 1RIQA 2YLCA 2PMFA 2VUBA 2HD0A 2HNIA 2QQRA 2F69A 4JRQA 4F7UE 4CI0C 2QEXA 4OB0B 3M55A 3SWNB 4G84A 4XEOA 1WJQA 2I4MA 2C06A 1X6OA 4NS5A 4LDXA 1X2HA 2VGNA 3J81E 4OF1A 3P8BB 4P72C 3CEYA 2DTIA 3FRNA 4LVJA 3KUFA 4A54A 4HWTA 3HSBA 4LD9K 3NETA 2P0KA 4KQEA 4IURA 2E5QA 3JRZA 4L87A 4YPFA 5I21A 1W2BA 4E51A 3JB9I 1JJ2S 2PMEA 4QQ6A 2DJZA 4EMKC 4CH3A 1NPPA 4YDQA 1DJ7B 4E7LA 2D9TA 1HC7A 2RJCA 3HTZA 4TQFA 3RL6A 3QBYA 2DK3A 3VYGA 4PG3A 3OS2A 1M9SA 3H6ZA 3JCMV 2LTOA 1H4QA 4K86A 4BW9A 4RQFA 4YRTA 1E24A 2VC8A 4M77C 3I55T 4H2VA 1S72T 1X56A 4BI4A 4KBMB 3RF1A 3QO7A 5LJ5j 2CYZB 2DTOA 5GAN2 1USYC 3BDUA 1WQ7A 3OSVA 3OMGA 3LGLA 2QQAA 2CZ6B 4ZTZB 1VQ4A 4FT2A 3RKXA 3KXTA 3ASKA 4XK8E 1BI2A 1D3BB 3M4QA 3DB4A 3UFGA 2VXEA 1N8RC 5LJ3g 3MF2A 2ZINA 2A3LA 1U8RA 4M7DG 1YB3A 3NTKA 3ERRA 2RHXA 4BD3A 2BKDN 4KR3A 4G85A 2R57A 3A5ZA 4F7UA 3DLLA 5K1XA 2HQXA 4F7UB 5HGQA 1YJWT 1JJCB 4BDZA 1KMMA 2RA2A 2MI6A 4M78F 2RJEA 3I55A 5LJ5g 3OS1A 3CPWS 1S72A 3HHTB 1ZBXA 2EWNA 3G71T 3L2QA 4NL2A 2DIQA 2C7IA 4PHCA 4UP9A 1EQRA 4EMKA 5L8RE 1UEBA 4EMKB 5GAOn 3OYDA 2PUOB 4YRRA 2MWOA 3SFMA 3DB3A 1Z7NA 3HXYA 2QXFA 3QG1A 3TUPA 4XU2A 3I7FA 3IG2A 2RK1A 3QPHA 4OVAA 1KG1A 1G5HA 2X4YA 1C0AA 4A53A 2ZZDA 1X75C 4H2YA 4MMKA 4O5VA 4IUUA 3RMSA 1SERA 1HTTA 2I2LA 1UGPB 5F5WA 3M58A 1VQ6A 1EVKA 2R58A 1HXDA 4KUDK 4CRIA 2QQ9A 3NTIA 4M7AA 3S3NA 3JB9F 2VV5A 3OYHA 1YJWA 5KNNA 4C92G 3QYGB 4HWOA 5LJ5d 2GFAA 5FROA 3QDRB 1Q81U 3E9IA 4ZIBA 3X25B 3M56A 4HA8A 11ASA 3OW2A 2DDZA 2M16A 3C12A 3VUZA 3A31A 2EFIA 1WPYA 4LDVA 2XGTA 4L6V5 3OQ5A 3IKMB 3X28B 2CJBA 1N6AA 2J3MA 3JCMW 5I2SA 2QHVA 5GAN6 3A8OB 1UGSB 3CCRA 4RG8A 3M53A 3TEHA 5CKHA 3TEHB 1XQHA 4MZMA 2DVEA 5I2MA 4TWAA 4YRSA 3OD1A 4HCZA 4CH6A 1K9MU 3EAEA 3WVDB 3G7ZA 3HFOA 2RHSA 5GAMf 1OZ2A 4QQDA 2BIVA 3CCVT 1YJ9A 2LRQA 4PJOE 3L42A 4XU0A 3E9HA 1UGQB 1BIBA 3S3OA 2RM4A 2JN0A 4TQDA 1JRIA 2LNVA 3CCMA 1XOVA 1LJOA 4C0DC 3MP8A 1Q7YU 1MGQA 2XDDA 5C52B 1XTDA 2ZZEA 4M7DE 4ZN1A 4FL6A 4E7IA 4HWPA 3VYHB 3ZBDA 1NPRA 4M75G 1QVGA 3RMQA 4YRJA 1VUBA 4XTXA 2KK4A 4BI8B 1OZ3A 5CVIA 2JUFA 4J5YA 4C8QF 1QP3A 4M7DC 2Y4XA 3JB9G 4IUQA 3L2ZA 2XDPA 1K8AU 5GAN3 2ZPFB 2K5IA 5FU6C 3CCST 3VQYA 1X55A 5A0GA 1GXIE 3JCMf 1WLEA 4BACA 4BE2A 3REXA 4R56A 4C5IA 3DKMA 2EKOA 4YRCA 3CCET 3FDRA 4M77G 3PCOA 4K87A 4BUGA 2KAFA 1M5Q1 3C95A 3ZEHA 5CCAA 3LW5E 4OLFA 4JS4A 3QZ5B 3CCVA 4KT0E 2K5LA 3HXXA 5HK0A 4PKCC 1ADYA 1Z7MA 5DY9A 3JB9H 3EFSA 2E65A 3VJPA 4ATOA 2DPPB 1I81A 1H4VB 5LL6S 4BB7A 3GLXA 4LVKA 3LWIA 3HRKA 2QDYB 3A8MB 3PMTA 4LVIA 4JDSA 5E3IA 4UP7A 4LD6A 2ZIMA 3JAME 5IAYA 3MEYA 4YCUA 4EO4A 4A4FA 1QE0A 1W4SA 5AYFA 5GAMe 2EYQA 2XI9A 3HXWA 3ME9A 4C92E 3OBWA 3JCMX 4PLIA 4IUVA 2QHTA 5GMKm 3CCSA 1E22A 3TCJA 4JLIA 5GANf 1U1TA 2K2VA 4C92C 3HRUA 5CKEA 1LYLA 4IUTA 4RG2A 3E9GA 3A7AA 2E64A 3META 3MHXA 1Y07A 3GF5A 4LDYA 4P75A 3VUBA 4X9DA 4PJOA 4C0DB 2LVMA 2FVUA 5J39A 2PQWA 4ZN3A 3UWNA 1NE8A 1VQNA 3G6EA 2LCLA 4ZGEB 4DA4A 3VQVA 4QVCA 3NENA 2HQEA 1LOJA 2WSFE 3CC4A 2DIGA 1KC8U 4LNSA 3NFCA 1ASYA 4M7DA 3JCMe 2ARSA 1FXXA 4M7DB 3GIBA 2CS7A 3QHSA 5C53B 2RHYA 3SWNA 2M9UA 2ZPBB 4DOVA 2DXBA 4ME7A 5FU6B 1JB0E 3QKJA 2Q7HA 2XK0A 1N27A 2V8JA 5C6SA 3RESA 4E7KA 4HCBA 4E7HA 2F5TX 2BUDA 1UB4A 3BJUA 2ZPHB 5ELNA 3TU4K 5K1PA 4EMGA 4M75E 1M1KU 4D6WA 3A8HB 4EPCA 1VQ4T 2E5AA 3GNFB 3PZCA 4N0AA 4TVAB 4HVCA 2DO3A 4M75C 4J6YA 2XICA 2P4TA 3HRSA 2EIFA 4BWAA 4DPGA 4H2TA 1QVFS 4PJOD 3OYKA 1QVGS 2IG0A 3RKWA 4M77E 2ZNIA 1VIEA 3HKSA 2Q5IA 3M4PA 3JCMP 5GANe 3LYIA 2DAQA 4C0GA 1N9RA 2LQ8A 3V7CA 1Q82C 2XIDA 3R07A 2KMTA 1X01A 2ZGWA 5D6XA 2ZIOA 4JJNK 2WSEE 3DLMA 4M7DD 4ZTUB 4C92A 2CGHA 4C92B 2FYKA 2OTLT 3QJ6A 3GNGA 3KBGA 2OAUA 4LVMA 1SRYA 4J6WA 2QI2A 2ODRC 2JVVA 3P8VA 2KDSA 1VQ8A 2YHTA 2J3LA 3HXVA 2LT1A 4ELYC 1PYSB 4P73A 5FRNA 2ZCFB 4TTVA 4J83A 1NJ2A 1Y71A 2O01E 3NEMA 5CQXA 3J80E 5HKCA 1D3BA 2ZPGB 3H8ZA 4UPAA 4YCWA 3E19A 4XTUA 3A8LB 4II1A 1X2GA 3OYBA 3QJYA 2JTFA 2RHQB 3UDCA 1I5LA 5CQYA 4RDXA 1KHCA 1VQKT 1VQ6T 4BY6C 3GPLA 5GAOr 1QVPA 3PTAA 2A8EA 5J26A 4LVLA 3CMET 1B7YA 1JJCA 3LC0A 4C8QC 1B7YB 2L5QA 4P72A 3OSSC 4UC4A 3WVEB 1Q81C 1YGBA 3UH0A 4TVWA 3QXEB 2ALYA 1Q82U 2ALYB 5KE2A 5GMKe 4Z02A 4Q15A 5DLQE 2QQBA 5FLXE 4O2DA 1YIJT 2I4LA 3MP6A 2LDMA 3HL8A 4A4EA 2OTLA 1KMNA 1KQ1A 4JUVA 4M75A 4CS2A 1VQPA 4M75B 5KCOA 1YJNA 5LJ3f 4C92D 4P3PA 3CCRT 3A5YA 1W66A 1VQLT 2WSCE 2E1HA 4A4HA 2I4OA 1FYFA 4BE1A 2CJ9A 3JCMc 3PT9A 2ZCEA 4JLGA 4FT4A 1QW1A 1YHQA 5GAMj 2G3RA 1K9MC 4YRQA 2XKOC 4YREA 1YJ9T 2RB6A 2GCXA 5LJ5f 4F7UF 3CCJT 4M77A 4M77B 2P5IA 4JS5A 1BKBA 2K57A 1NJ5A 3CCMT 2AMCA 2AMCB 1Q7YC 1VQKA 3L2WA 3E1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 3;  2ZTG A;  4M7A C;  1EIY A;  1H4S A;  3VQY A;  3RUX A;  4M78 A;  2EL9 A;  4YRI A;  1EIY B;  1X55 A;  1YFT A;  4M78 B;  2EJ9 A;  1SES A;  3VQX A;  4MML A;  5GMK l;  3JCM f;  1WLE A;  3JCM h;  3V8K A;  2CJA A;  3QNE A;  5GAN 7;  1RIQ A;  3REX A;  2YLC A;  2DZ9 A;  3RGL A;  2PMF A;  2ZR3 A;  1SET A;  4YRC A;  2HNI A;  1USY A;  4PNO A;  4PJO G;  4F7U E;  4M77 G;  3P8Y A;  4P74 C;  3PCO A;  4K87 A;  3ICA A;  3SWN B;  1M5Q 1;  4G84 A;  4P71 C;  5GAO q;  4OP0 A;  1B76 A;  4XEO A;  2RHQ A;  4C8Q E;  1H4T A;  4OLF A;  4NOY A;  2I4M A;  3WQZ A;  1WNL A;  2ZNJ A;  3BY7 A;  3LSS A;  5GAO l;  1X2H A;  4M78 G;  4JRK A;  3HXX A;  1ADY A;  1Z7M A;  5DY9 A;  3JB9 H;  4P72 C;  4C92 F;  2DTI A;  3EFS A;  3L1A A;  4NCX A;  2E65 A;  3HFN A;  1EFW A;  4M75 D;  4A54 A;  4HWT A;  3HSB A;  1I81 A;  1H4V B;  2ZXF A;  3IAL A;  3NET A;  4QVD A;  1NNH A;  4KQE A;  3HRK A;  4XU3 A;  4YCV A;  4YPF A;  4L87 A;  5I21 A;  1EVL A;  5E3I A;  4UP7 A;  4E51 A;  2ZIM A;  3JB9 I;  4RCB A;  3VU3 C;  3MEY A;  4YCU A;  1BIA A;  4EO4 A;  1N9W A;  2DXU A;  2PME A;  2DJZ A;  4EMK C;  4M7A F;  4YRL A;  4CH3 A;  4YDQ A;  1QE0 A;  4HWS A;  5GAM e;  4YRM A;  1U1S A;  3HXW A;  4C92 E;  1HC7 A;  3QO3 A;  5LJ3 e;  3A7U A;  3HTZ A;  4TQF A;  4CH4 A;  3RL6 A;  3JCM X;  2Q7G A;  3G1Z A;  3FB9 A;  1IL2 A;  4JRI A;  1WQW A;  4M77 D;  2QHT A;  1X54 A;  5GMK m;  4PG3 A;  2IY5 B;  4YP0 A;  3JCM V;  1E22 A;  4JLI A;  5GAN f;  1U1T A;  1ATI A;  3PGG A;  2ZT8 A;  1H4Q A;  5GAN h;  4C92 C;  4K86 A;  1LYL A;  3V8J A;  4XTW A;  4BW9 A;  4RQF A;  4X9C A;  4YRT A;  3A7A A;  2E64 A;  4HT8 A;  1E24 A;  2DKG A;  4M78 D;  4P75 A;  2VC8 A;  3JCM b;  4M77 C;  3FJP A;  4X9D A;  4H2V A;  4PJO A;  2XTI A;  5LJ5 e;  5ELO A;  2ODR D;  1X56 A;  5GAM d;  2DXT A;  4K88 A;  4UP8 A;  5LJ3 d;  5CAI A;  3VQV A;  4QVC A;  2RD1 A;  3NEN A;  4HWR A;  2CIM A;  3DSQ A;  1NJ1 A;  4YRG A;  1LOJ A;  3RF1 A;  3QO7 A;  5LJ5 j;  4LNS A;  1G51 A;  3V7R A;  1ASY A;  2DTO A;  3QUI A;  5GAN 2;  3JCM e;  4M7D A;  4H2X B;  2ARS A;  3HXZ A;  4M7D B;  1B70 B;  4M75 F;  1USY C;  3BDU A;  3GIB A;  4XEM A;  4H2U A;  1WQ7 A;  4DQ2 A;  3QHS A;  2EAY A;  5C53 B;  3SWN A;  2Q5H A;  4M7A B;  4ZTZ B;  1J5W A;  3RKX A;  2Q7H A;  4CS3 A;  4WJ3 M;  1GGM A;  3MF1 A;  3V8L A;  3RES A;  4H2S A;  1KQ2 A;  5GAM g;  3KFU A;  3SB2 A;  1D3B B;  3M4Q A;  2AKW B;  3A74 A;  1JBM A;  2YLB A;  3UGQ A;  1I4K 1;  3UFG A;  2VXE A;  4RCC A;  4J6X A;  4XTY A;  5LJ3 g;  2ZT7 A;  3MF2 A;  1NJ6 A;  2ZIN A;  3BJU A;  5ELN A;  3EFR A;  5GMK i;  5K1P A;  4EMG A;  4M7D G;  3NEL A;  1YB3 A;  1QF6 A;  2DZC A;  4M75 E;  3ERR A;  4M77 F;  4KR3 A;  3JCM d;  1NJ8 A;  1E1T A;  4XTZ A;  3A5Z A;  4G85 A;  4WJ4 A;  4F7U A;  4M7A G;  3JB9 D;  5K1X A;  2E5A A;  1BBW A;  4F7U B;  5HGQ A;  3PZC A;  4N0A A;  1G5I A;  1JJC B;  4WF2 A;  4TVA B;  4C8Q A;  4HVC A;  2ART A;  1KMM A;  4C8Q B;  4M75 C;  2RA2 A;  5GMK h;  4M78 F;  4J6Y A;  1I8F A;  5LJ5 g;  4BWA A;  1YFS A;  4DPG A;  1B34 B;  4CH5 A;  3TEG A;  1NYQ A;  3IKL A;  4YRK A;  2EWN A;  1M8V A;  4H2T A;  4PJO D;  1YCY A;  4NL2 A;  4XU1 A;  2IY5 A;  4V2S A;  2C8M A;  2C7I A;  3RKW A;  2RHS B;  4PHC A;  4M77 E;  4UP9 A;  2ZNI A;  1EQR A;  2E10 A;  2Q5I A;  4EMK A;  4WI1 A;  3M4P A;  4F7U G;  4YYE A;  4EMK B;  5GAO n;  3JCM P;  3L4G A;  4YRR A;  3JB9 J;  3L4G B;  3JCM g;  5GAN e;  1Z7N A;  3HXY A;  1L0W A;  4C8Q G;  3RIR A;  1KOG A;  3TUP A;  4P75 C;  1N9R A;  3V7C A;  4PJO C;  3R07 A;  4XU2 A;  1X01 A;  4M78 E;  3I7F A;  4H2W A;  4YRP A;  3IG2 A;  3A32 A;  2ZGW A;  1TH7 A;  3JCM Q;  2ZIO A;  1G5H A;  1N9S A;  4TVY A;  1C0A A;  4M7D D;  4ZTU B;  4C92 A;  4A53 A;  3P8T A;  2CGH A;  4C92 B;  5GAN j;  2FYK A;  4H2Y A;  4MMK A;  4M78 C;  2EJG A;  3RKY A;  4M7A D;  1WU7 A;  3AHU A;  1SRY A;  1SER A;  4J6W A;  1HTT A;  4YRN A;  2ODR C;  3QO8 A;  2I2L A;  3P8V A;  2YHT A;  2J3L A;  1BBU A;  4H2X A;  3HXV A;  1B70 A;  1PYS B;  2ZT6 A;  4P73 A;  2P0L A;  5F5W A;  1EVK A;  3SWN C;  5GAN d;  1HXD A;  3HRI A;  1ASZ A;  1EOV A;  1HK9 A;  2ZZG A;  1ADJ A;  4TTV A;  4M7A A;  1NJ2 A;  3JB9 F;  5KNN A;  3NEM A;  4C92 G;  4HWO A;  4P3N A;  5LJ5 d;  3HXU A;  1NYR A;  4EMH A;  2ZR2 A;  1D3B A;  3E9I A;  4ZIB A;  2AKW A;  4CS4 A;  4HA8 A;  11AS A;  2DDZ A;  4UPA A;  4YCW A;  3A31 A;  4XTU A;  3PCO B;  4C8Q D;  2I4N A;  3HFZ A;  4P74 A;  2Q7E A;  3HFZ B;  3UGT A;  1WPY A;  2E3C A;  1X2G A;  4P71 A;  2RHQ B;  2XGT A;  1I5L A;  5GAN 4;  4RDX A;  3IKM B;  2VXF A;  2CJB A;  2J3M A;  2G4C A;  5GAO r;  4PJO F;  3QTC A;  2DTH A;  3JCM W;  3HY1 A;  3QSU A;  3JCM J;  1B8A A;  2QHV A;  5GAN 6;  4N0A C;  5GAN g;  1LNX A;  1B7Y A;  1JJC A;  4TVA A;  3W3S A;  3LC0 A;  4C8Q C;  1B7Y B;  4XQ3 A;  4P72 A;  3TEH A;  2DQ0 A;  3QO5 A;  3TEH B;  4RMF A;  4HT9 A;  1YGB A;  3UH0 A;  4TVW A;  2ALY A;  2DVE A;  2ALY B;  2E41 A;  2DEQ A;  5GMK e;  4TWA A;  1B34 A;  4NL3 A;  2ZT5 A;  3BW1 A;  2QHU A;  1WYD A;  4Q15 A;  4YRS A;  3OD1 A;  4O2D A;  4M7D F;  4RQE A;  2ZZF A;  4CH6 A;  2I4L A;  3HFO A;  2RHS A;  5GAM f;  3M4G A;  1KQ1 A;  4JUV A;  1KMN A;  4X5O A;  5GAM h;  4PJO E;  3V7S A;  4M75 A;  3HFV A;  4CS2 A;  4XU0 A;  4M75 B;  4YRF A;  3E9H A;  1BIB A;  2QTX A;  5LJ3 f;  2RM4 A;  4C92 D;  5GMK j;  2JN0 A;  5LJ3 h;  4TQD A;  4P3P A;  3A5Y A;  1W66 A;  2E1H A;  1JRI A;  2EJF A;  2I4O A;  4EX5 A;  1FYF A;  2DU5 A;  4J15 A;  5GAN 5;  2CJ9 A;  1LJO A;  2ARU A;  2DU7 A;  4YRO A;  5GAO p;  1VQZ A;  3JCM c;  4AH6 A;  2ZCE A;  3INZ A;  2DQ3 A;  1MGQ A;  3BFM A;  5C52 B;  1Y96 A;  5GAM j;  1Y96 B;  4KR2 A;  2ZZE A;  1H64 1;  12AS A;  4M7D E;  5GAN 8;  4YRQ A;  3RAC A;  3A7R A;  2Y90 A;  5C51 B;  3REU A;  4HWP A;  4YRE A;  5LJ3 j;  4Y91 A;  2RB6 A;  1E1O A;  5LJ5 f;  4M75 G;  4XTV A;  5LJ5 h;  2QHS A;  4F7U F;  4M7A E;  4M77 A;  4YRJ A;  2FB7 A;  4XTX A;  4PJO B;  4M77 B;  4Q6G A;  4J5Y A;  3CMQ A;  3HY0 A;  4C8Q F;  3FIF A;  4M7D C;  2P5I A;  1YFR A;  3RER A;  1PYS A;  4P73 C;  3VBB A;  4P3O A;  2K57 A;  3JB9 G;  1NJ5 A;  2AMC A;  5GAO m;  2AMC B;  3L2Z A;  3LSQ A;  3VQW A;  4H02 A; 
#chains in the Genus database with same CATH topology
 2MK5 A;  2E3I A;  2J6F A;  1H4S A;  2K6D A;  2HAX A;  2AT1 B;  3GBQ A;  2R5A A;  3OS0 A;  3J7A F;  1YFT A;  2D1X A;  2CZ7 B;  1QWF A;  3CME A;  1SES A;  1BCM A;  1IHV A;  1OOT A;  1RLP C;  2CJA A;  1PWT A;  1M90 C;  3CCL T;  3Q1J A;  4FSS A;  3RGL A;  2BZX A;  1IB8 A;  2DL3 A;  2HBP A;  2ZR3 A;  2NS6 A;  1USY A;  4PNO A;  4BE0 A;  2KGT A;  4P74 C;  1WJR A;  3ICA A;  2M0O A;  4P71 C;  1KHI A;  4OP0 A;  2CT3 A;  5GAO q;  1B76 A;  3CPW P;  1NJI R;  3MEV A;  1YIJ A;  4NOY A;  4JZ4 A;  1K73 R;  1K8A C;  3U23 A;  2LX9 A;  1WNL A;  2ZNJ A;  1KQS A;  3LSS A;  2DEU A;  1MHN A;  5GAO l;  3M54 A;  2O31 A;  2CZ1 B;  4M78 G;  2X9H A;  4JJC A;  4Z8A A;  3LWH A;  4ZGD B;  4J9C A;  1O75 A;  4LE9 A;  5CIU A;  1VQL A;  3N5B B;  4NCX A;  1EFW A;  3MCA B;  4M75 D;  1YBY A;  4IUP A;  5HY6 A;  4D8K A;  2ZXF A;  4HT4 A;  1MUZ A;  2V8I A;  4FM4 B;  1VQM T;  1K9A A;  1MNE A;  4BY6 B;  3E2U A;  2QDL A;  1ZUY A;  2OAW A;  2K2M A;  2O4X B;  4XAX B;  5DLO A;  2A36 A;  1QP2 A;  4RKU E;  1EVL A;  1W6X A;  4RCB A;  1BIA A;  1MV3 A;  2QK0 A;  1PSE A;  1N9W A;  4M7A F;  1ZQ1 A;  1Z9Z A;  1ZUK A;  3CCJ A;  4YRM A;  1K73 U;  1U1S A;  3NMZ C;  2ENM A;  3OYY A;  2KY9 A;  4AFZ C;  4C0Z A;  1VA7 A;  2DM1 A;  2F2W A;  3QO3 A;  1WXB A;  5LJ3 e;  2RJF A;  4CH4 A;  2E4H A;  1RI0 A;  3G1Z A;  2ZPE B;  3FB9 A;  2GQV A;  1WJS A;  4JZ3 A;  4M77 D;  2IY5 B;  4YP0 A;  1HSQ A;  2P84 A;  1ATI A;  2E6N A;  3PGG A;  3CCU A;  2ZT8 A;  2KYB A;  2EGC A;  4PJJ A;  5A0L A;  3PVL A;  5DM7 R;  4F17 A;  1QVF A;  1M90 U;  1NLP C;  3SD4 A;  1I0C A;  6AT1 B;  3CCL A;  5KYW A;  4HT8 A;  2RI5 A;  2ROL A;  3JCM b;  2RI3 A;  3FJP A;  4R55 A;  2NLU A;  2XTI A;  3JV3 A;  1LVK A;  2X51 A;  2OTJ A;  5LJ5 e;  5ELO A;  2ODR D;  2CDT A;  1PC0 A;  3UPU A;  2YRV A;  3G4S T;  4LDU A;  5GAM d;  2DXT A;  4OMP A;  3HPW A;  2LJ0 A;  2KQW A;  4UP8 A;  4YTL A;  5CAI A;  2DD4 A;  2RD1 A;  2OX7 A;  2CIM A;  4DBH A;  3DSQ A;  2M1H A;  1X6B A;  2L0A A;  1NJ1 A;  2PNI A;  3V7R A;  1VQ7 Q;  2VKN A;  3QUI A;  4H2X B;  5FU7 C;  3HXZ A;  1CKA A;  1B70 B;  2PTK A;  1NG2 A;  2DA9 A;  4XEM A;  2ED1 A;  1LCK A;  1ZBJ A;  2AKL A;  1X69 A;  1VQM A;  2EAY A;  4N4H A;  2YUP A;  1RAI B;  3M0U A;  3S3M A;  4QW2 A;  4FSX A;  3OYL A;  1IZ6 A;  4CS3 A;  3LX7 A;  1VQN T;  2MIO A;  3G6E T;  4H2S A;  2ESW A;  4X34 A;  3KFU A;  3SB2 A;  2AKW B;  3A74 A;  1KC8 C;  3CCQ T;  3CC4 T;  3MO8 A;  1OQK A;  2COY A;  3R6O A;  3BDL A;  1NJ6 A;  2RH2 A;  3EFR A;  2IVW A;  5GMK i;  3GOX A;  2HL3 A;  3NEL A;  1QF6 A;  2DZC A;  2P0Q A;  1G3S A;  3X24 B;  4KRT A;  3AT1 B;  1MMN A;  4L59 A;  2PZ1 A;  2DYB A;  2KSS A;  4E7S A;  3JCM d;  3CXC S;  4M7A G;  5C0M A;  2M51 A;  3RBB B;  4AFQ C;  4WF2 A;  2HCK A;  2JM8 A;  2ART A;  4LXC A;  1NLO C;  2MF2 A;  3M57 A;  5CO7 A;  2K4Y A;  4FIB A;  1I8F A;  3UT1 A;  3I56 Q;  5KYU B;  1YFS A;  1BI1 A;  1TUD A;  1B34 B;  4CH5 A;  1VQ9 T;  3G4S A;  2AKK A;  3L2R A;  1M1K C;  2AZV A;  1KD1 C;  2X4X A;  1AWX A;  1YCS B;  2E10 A;  2LJ3 A;  1W70 A;  5IHK A;  4WI1 A;  1UJY A;  4E7Z A;  3L4G A;  3QZ9 B;  2EQK A;  1M27 C;  1TSF A;  3L4G B;  1GBR A;  1Y0M A;  7AT1 B;  3VKI A;  1L0W A;  2YUQ A;  4C8Q G;  1KOG A;  2K3B A;  1G3T A;  3M9Q A;  1JXM A;  2HMA A;  2JTE A;  5IT9 E;  2LC4 A;  2DL7 A;  4M78 E;  1I07 A;  4YRP A;  1VYV A;  3A32 A;  2X4W A;  3JCM Q;  5J3B A;  4AT1 B;  1PKT A;  3CPF A;  1VQO A;  1N9S A;  2DYI A;  2QQS A;  3OYN A;  4JJB A;  4QVZ A;  3M0R A;  4B9W A;  1AWW A;  3EGD A;  4J7I A;  2D8J A;  2XU8 A;  1M30 A;  2EJG A;  4M78 C;  4OB3 B;  4E47 A;  3VS1 A;  4F16 A;  3G71 Q;  2VYT A;  1QMC A;  4M4Z A;  3L2U A;  1PD0 A;  1C6V X;  1JQQ A;  3CCQ A;  3QO8 A;  4HCC A;  2MAM A;  1BBU A;  3CBP A;  1PKS A;  3CC7 Q;  1WFW A;  2ZT6 A;  2QGF B;  2XD0 A;  1NEG A;  2P0L A;  1ZA2 B;  2PU9 B;  1KQS S;  2L3P A;  3CD6 Q;  4OMO A;  5GAN d;  3HRI A;  1HK9 A;  1M1F A;  3OB9 A;  2BZY A;  2R5M A;  2XDB A;  3UA7 A;  2RI2 A;  3OYC A;  1G5V A;  1JO8 A;  3CBM A;  3PIO A;  3H0I A;  3HXU A;  5IN1 A;  4EMH A;  4E2F B;  3CC2 A;  2RJD A;  2GQI A;  3NTH A;  1VQ5 T;  1FX7 A;  5FU7 B;  2HKN A;  3A8G B;  1XNI A;  3VS6 A;  1VQ8 T;  4KUL A;  2E3C A;  1ZA1 B;  4IIM A;  1RL2 A;  1T3L A;  1VQ9 A;  1M4Z A;  2VXF A;  2RK2 A;  2G4C A;  4PJO F;  4ELZ C;  2LT4 A;  1KD1 U;  4O6J A;  3HY1 A;  3QSU A;  4PFP A;  2LQW A;  8AT1 B;  3H0H A;  4TVA A;  2DF6 A;  3REB B;  2L8D A;  5HCK A;  3E9F A;  2DQ0 A;  3QO5 A;  2KRN A;  4OGE A;  1T3S A;  4Y28 E;  3OMC A;  4HT9 A;  4BDY A;  2CKK A;  2RO0 A;  1OI1 A;  2E41 A;  2DEQ A;  2JZ2 A;  1H3H A;  1SG5 A;  2ZT5 A;  2QHU A;  1WYD A;  1G3W A;  1ZHI A;  3M59 A;  3PFS A;  3L2V A;  3C94 A;  4M7D F;  4RQE A;  5M9O A;  2ABL A;  2ZZF A;  3OYE A;  4MZP A;  3M4G A;  4X5O A;  5GAM h;  1Q86 C;  3MEU A;  5HK3 A;  3CBO A;  1G8X A;  2QTX A;  2DX1 A;  5KCH A;  1C1A A;  1MND A;  1H92 A;  2KI7 A;  1QQJ A;  4YRO A;  2ARU A;  2QA4 Q;  2DU7 A;  1V76 A;  4PJL A;  3CMA Q;  1VQZ A;  2GTJ A;  4AH6 A;  1TXQ A;  1YI2 Q;  2V1Q A;  2GNC A;  3INZ A;  1IRE B;  2E12 A;  2FL7 A;  3BFM A;  4DBQ A;  3OYI A;  1Y96 A;  4WCI A;  1Y96 B;  4KR2 A;  3C4S A;  1VQ7 T;  12AS A;  2LP5 A;  3OBY A;  5GAN 8;  2H3J A;  2PVG B;  3RAC A;  2H8H A;  2Y90 A;  5C51 B;  3REU A;  5LJ3 j;  4J9D A;  1MMA A;  5FRM A;  1E1O A;  1VQP T;  2QHS A;  1YJN T;  1ZUU A;  1WGS A;  1VQ5 A;  4M7A E;  2CH4 W;  2D0N A;  2FB7 A;  2JS0 A;  1O9S A;  1WHH A;  3M4Y A;  3CMQ A;  1GFD A;  3FIF A;  2X4J A;  1PYS A;  3VBB A;  3OA6 A;  4P3O A;  1FYN A;  3TRE A;  3URG A;  5GAO m;  3LSQ A;  2JMA A;  4J15 A;  1X2K A;  2ZTG A;  3EGX B;  4M7A C;  3P8D A;  1FMW A;  2EL9 A;  4M78 A;  4M78 B;  1Y7X A;  1YHQ T;  2EJ9 A;  1K76 A;  5GMK l;  2CZ0 B;  3JCM h;  1JXO A;  1YP5 A;  3V8K A;  3QNE A;  5GAN 7;  2IIM A;  1WYX A;  1KIK A;  2MWP A;  1R0B G;  4HVU A;  1EX4 A;  2DZ9 A;  3LH0 A;  1OU9 A;  1KJW A;  1SET A;  2HDA A;  1H8K A;  5EG2 A;  4PJO G;  2KBT A;  3P8Y A;  4OMF B;  4LUE A;  2RHQ A;  2GFU A;  2Y4Y A;  3I5R A;  4C8Q E;  1H4T A;  2K3X A;  4OGC A;  2JW4 A;  3WQZ A;  1HYO A;  3BY7 A;  1QVF P;  4P5N A;  4J9I A;  1UUE A;  1Q86 U;  3I56 T;  1ZLM A;  2FZK B;  3JSC A;  4JRK A;  1QVG P;  3H0F A;  1FMK A;  5FWB A;  4C92 F;  2FRY A;  3L1A A;  3HFN A;  5D6Y A;  2VWF A;  2KR3 A;  2JJ9 A;  2NUP B;  1D0Y A;  2FEI A;  2K9G A;  4LDW A;  4VUB A;  2X35 A;  4C0F A;  1WA7 A;  3IAL A;  2PUK B;  1TTH B;  3CCE Q;  4QVD A;  1NNH A;  4E7J A;  3MJX A;  3P8H A;  2RF0 A;  1G2B A;  4XU3 A;  2DNU A;  2RQV A;  3A5Z B;  2O88 A;  4YCV A;  3LH5 A;  2P0P A;  1AHJ B;  1VQ7 A;  4PFO A;  1LPL A;  2DRK A;  3VU3 C;  1WHL A;  2DXU A;  1EIF A;  4YRL A;  4HWS A;  4ZGJ B;  3H9N A;  1M8M A;  3CXC A;  4JPB W;  2HEQ A;  2PVD B;  1Q95 G;  2O9S A;  3FEO A;  2FPE A;  2I0N A;  3A7U A;  2V8K A;  2X3X D;  3WXM B;  3OY9 A;  4PL6 A;  2Q7G A;  3UAT A;  1IL2 A;  4JRI A;  1WQW A;  3X20 B;  1X54 A;  2VGM A;  3T9N A;  1EFN A;  5GAN h;  4KUI A;  4OB2 B;  2DER A;  2CUB A;  3V8J A;  4XTW A;  4J7F A;  2RQT A;  3CC7 T;  3ZFJ A;  1RAC B;  1AZG B;  4X9C A;  1H3Z A;  2F5K A;  2CP5 A;  2KT1 A;  1M2V A;  1OYX A;  2DKG A;  4M78 D;  4X1V A;  3CD6 T;  1R77 A;  4GY5 A;  2RMO A;  1R8O B;  1NJI C;  2D6F A;  1RAA B;  1K73 C;  2RPN A;  1Q81 R;  2RHZ A;  1V1C A;  1D1C A;  1NZ9 A;  2X3W D;  2EQJ A;  3X26 B;  1PHT A;  1G3Y A;  4AG1 C;  1YIT T;  4K88 A;  4A63 B;  5LJ3 d;  5EC7 A;  3I56 A;  3CCU T;  4HWR A;  2E70 A;  4MDW A;  1SF9 A;  3I5S A;  4YRG A;  1N8R U;  1M3A A;  1G51 A;  2MMP A;  4QQG A;  3PNW C;  2JNG A;  1BI3 A;  1GCQ A;  2EQU A;  4M75 F;  2EQM A;  2HQH A;  1T0H A;  4H2U A;  2RHI A;  4DQ2 A;  2J05 A;  3EG1 A;  4ZTF A;  2Q5H A;  2KYM A;  2OTJ T;  2CP3 A;  2DRM A;  4Q5W A;  4M7A B;  1J5W A;  1AT1 B;  1AWO A;  3FLG A;  3EH2 A;  2EQI A;  2YT6 A;  1CSK A;  4WJ3 M;  1GGM A;  3MF1 A;  3V8L A;  9ATC B;  1KQ2 A;  5GAM g;  4KGX B;  4C5G A;  3UGQ A;  1JBM A;  2YLB A;  1I4K 1;  3TEE A;  4RCC A;  4J6X A;  4XTY A;  5KH6 A;  2ZT7 A;  1J3T A;  2A7Y A;  1W2B S;  3MP1 A;  4GLM A;  3QII A;  3G71 A;  4M77 F;  2EYZ A;  1IXD A;  5CK9 A;  2DD5 A;  3EHQ A;  1E1T A;  4N4I A;  2K3Y A;  4XTZ A;  1NJ8 A;  4WJ4 A;  2O4X A;  5KE3 A;  3JB9 D;  1QCN A;  1BBW A;  5IXF A;  1KSW A;  2NYS A;  4J9B A;  3VS4 A;  4C5H A;  2L3R A;  4B9X A;  1G5I A;  1GFC A;  3CC7 A;  2GF7 A;  4C8Q A;  4C8Q B;  2QA4 T;  3CMA T;  1RLQ C;  1YI2 T;  5GMK h;  3CD6 A;  1IO6 A;  2WAC A;  5CR2 A;  2J6K A;  4MDX A;  1ARK A;  2AK5 A;  1NJI U;  1GL5 A;  3M5A A;  3F70 A;  3TEG A;  1WHJ A;  1NYQ A;  2J6O A;  3LGF A;  3IKL A;  4YRK A;  3PMI A;  1M8V A;  4ZTJ A;  2XHC A;  1VIF A;  1YIT A;  4HKE A;  4OB1 B;  1YCY A;  1RI9 A;  4XU1 A;  2YWW A;  5CKB A;  4V2S A;  2C8M A;  2IY5 A;  2RQR A;  2RHS B;  3QWX X;  1WZO A;  3OYM A;  2D0Q B;  4YYE A;  4F7U G;  1QWE A;  2HBW A;  2DXC A;  1VQ4 Q;  3JB9 J;  4KH1 B;  3JCM g;  4L5G A;  3RIR A;  4P75 C;  2EVR A;  4RUG A;  1P92 A;  4PJO C;  2JXB A;  4J9F A;  1JJ2 A;  2LX7 A;  4H2W A;  2JTM A;  1BI0 A;  4EIK A;  3G1J A;  4N4G A;  1UFF A;  3LLR A;  1TH7 A;  1TU0 B;  4DOW A;  3MQZ A;  5KYN A;  1N5Z A;  3OYA A;  1WHM A;  2QAZ A;  4TVY A;  5KYX B;  4TVR A;  2COZ A;  3P8T A;  5GAN j;  4LN2 A;  2CUD A;  2RN8 A;  3RKY A;  4Z88 A;  3SDZ A;  4M7A D;  1WU7 A;  2DIL A;  5CKF A;  4RTV A;  3AHU A;  1Z9Q A;  4YRN A;  1AD5 A;  3FC3 A;  4DEX A;  5A0D A;  4GLK A;  1NEB A;  2EPD A;  2AIR B;  4H2X A;  4J9G A;  1B70 A;  4LNP A;  4J8O A;  4DBF A;  3SWN C;  1ASZ A;  1EOV A;  3I55 Q;  4A4K A;  2XMF A;  2ZZG A;  1ADJ A;  3OYJ A;  1VQO T;  1M1G A;  3QYH B;  2FHD A;  2CSI A;  3HP9 A;  1S72 Q;  4OML A;  2RHU A;  2CP7 A;  4AFS C;  1D0X A;  4P3N A;  3RDV A;  2QA4 A;  3CMA A;  1NYR A;  2ZR2 A;  3O8V A;  1YI2 A;  1SRM A;  2AKW A;  2K5F A;  4CS4 A;  1QCO A;  5IXB A;  2AHJ B;  1E7O A;  1PSF A;  2V1R A;  3RR6 A;  4C8Q D;  2I4N A;  3HFZ A;  3PCO B;  5A2Q E;  4P74 A;  3HFZ B;  2Q7E A;  3UGT A;  4P71 A;  4IIO A;  5GAN 4;  1PM3 A;  1FWZ A;  2V26 A;  3QTC A;  2DTH A;  3JCM J;  1B8A A;  2ZPI B;  3MEA A;  3VV0 A;  2L2P A;  3OS5 A;  4N0A C;  5GAN g;  1LNX A;  3W3S A;  1G83 A;  4XQ3 A;  3MKD A;  1VYU A;  2JOY A;  4RMF A;  1BYM A;  2MPX C;  5IHN A;  3GP8 A;  3CC2 T;  5KYU A;  3NHN A;  2QEX T;  2PVO B;  2L89 A;  1B34 A;  4NL3 A;  3BW1 A;  1HD3 A;  3QDF A;  3EHR A;  4RMO A;  3MEW A;  1D1A A;  2LQK A;  1VQ6 Q;  3V7S A;  1ZSZ C;  3HFV A;  3I9Q A;  4J9H A;  4YRF A;  2EYW A;  5GMK j;  5LJ3 h;  1OEB A;  1YJW Q;  2FPF A;  4MZT A;  4EX5 A;  2EJF A;  2DU5 A;  3S6W A;  5GAN 5;  1KC8 R;  4BI3 A;  4CC2 A;  5GAO p;  1SSF A;  2DQ3 A;  4PJM A;  2W10 A;  4EDU A;  3CPW A;  1PCX A;  1H64 1;  2O2O A;  3PIP A;  4IKF A;  3A7R A;  3EFO B;  2B8A A;  4A4G A;  2JMC A;  4Y91 A;  2DJQ A;  4F04 B;  2QG9 B;  4XTV A;  4C5E A;  5LJ5 h;  3CCE A;  2KVQ G;  3OYG A;  4PJO B;  4Q6G A;  2XG8 D;  3CQT A;  3HY0 A;  4JRP A;  1YFR A;  1SKU B;  3CCR Q;  3RER A;  4P73 C;  1PG5 B;  2C0I A;  3OYF A;  4PFZ A;  1SHF A;  1WX6 A;  2LCC A;  4FYX B;  2RQW A;  4FU6 A;  2E6Z A;  1V29 B;  3VQW A;  2O9V A;  4H02 A;  1UGR B;  1RUW A;  3OW2 S;  1KFZ A;  3RUX A;  4YRI A;  3ER0 A;  1EIY A;  1EIY B;  1M1K R;  2MOX A;  5CKD A;  4MML A;  4PLL A;  3VQX A;  3CXC P;  1RAF B;  3HRT A;  5D6W A;  1RIQ A;  2YLC A;  2PMF A;  2VUB A;  2HD0 A;  2HNI A;  1SEM A;  2QQR A;  1TOV A;  2F69 A;  1YJ9 Q;  2W0Z A;  4JRQ A;  4KGZ B;  5L23 A;  4F7U E;  4CI0 C;  2QEX A;  4OB0 B;  3M55 A;  3SWN B;  4G84 A;  2RNA A;  4OMM A;  4XEO A;  1WJQ A;  2EW3 A;  2I4M A;  2QGG A;  1X43 A;  2C06 A;  1PD1 A;  3CCM Q;  1X6O A;  4NS5 A;  2DMO A;  4LDX A;  1X2H A;  2VGN A;  3J81 E;  4OF1 A;  2JM9 A;  4J9E A;  3P8B B;  2YUO A;  4P72 C;  3CEY A;  1B3Q A;  2DTI A;  3FRN A;  4LVJ A;  3ZL7 C;  3VRZ A;  3KUF A;  3IQL A;  4A54 A;  4HWT A;  3PE0 A;  3HSB A;  3UF4 A;  4LD9 K;  3NET A;  1GRI A;  1BU1 A;  2P0K A;  4KQE A;  3M0T A;  4IUR A;  2M0Y A;  1WHG A;  2E5Q A;  2FG0 A;  3JRZ A;  5I21 A;  4L87 A;  4YPF A;  1W2B A;  4E51 A;  2QAS A;  3JB9 I;  4ESR A;  1JJ2 S;  2PME A;  4QQ6 A;  2DJZ A;  4EMK C;  4CH3 A;  1NPP A;  4YDQ A;  4ORZ A;  1DJ7 B;  4E7L A;  2D9T A;  2F1L A;  2HZY A;  1HC7 A;  2RJC A;  3HTZ A;  4TQF A;  3RL6 A;  1YNZ A;  3QBY A;  1AVZ C;  2DK3 A;  3VYG A;  4PG3 A;  4DBR A;  3OS2 A;  1KQS P;  1M9S A;  3H6Z A;  3JCM V;  2LTO A;  1H4Q A;  2GBQ A;  1ZSZ B;  4K86 A;  4FYY B;  4BW9 A;  1I5O B;  4RQF A;  4YRT A;  2DBK A;  1E24 A;  1YN8 A;  2VC8 A;  4M77 C;  1NM7 A;  1MMD A;  3I55 T;  4H2V A;  3CCV Q;  1TUG B;  1PRM C;  1S72 T;  1Y57 A;  1X56 A;  4BI4 A;  4KBM B;  2EGE A;  1U06 A;  1UJ0 A;  1ACM B;  3EGX A;  2EKH A;  1E6G A;  1OX9 A;  2AZS A;  1TS9 A;  1IGQ A;  2C0T A;  3RF1 A;  3FJ5 A;  3QO7 A;  5LJ5 j;  2CYZ B;  2DTO A;  1T0J A;  5GAN 2;  1USY C;  1E6H A;  3BDU A;  1WQ7 A;  3OSV A;  3EH1 A;  3OMG A;  3LGL A;  2L3S A;  2QQA A;  2CZ6 B;  4ZTZ B;  1VQ4 A;  4FT2 A;  1Q82 R;  4HXJ A;  5D7U A;  3RKX A;  3KXT A;  3ASK A;  4XK8 E;  1BI2 A;  1X6G A;  1FMV A;  3VS0 A;  1D3B B;  3M4Q A;  2M02 A;  3EG0 A;  2G6F X;  3DB4 A;  3CCS Q;  2ZAE A;  5IHI A;  3UFG A;  2VXE A;  2YUN A;  1N8R C;  4LUD A;  5LJ3 g;  3MF2 A;  4WTO B;  4HVW A;  2ZIN A;  2NUP A;  2A3L A;  1U8R A;  2COW A;  4M7D G;  3O5Z A;  1YB3 A;  3NTK A;  3ERR A;  2CRE A;  2RHX A;  1SSH A;  4BD3 A;  2BKD N;  4KR3 A;  4G85 A;  2R57 A;  3A5Z A;  2K79 A;  4F7U A;  3DLL A;  5K1X A;  2HQX A;  3BE3 A;  4F7U B;  5HGQ A;  1YJW T;  1JJC B;  1X27 A;  4BDZ A;  3VS2 A;  1KMM A;  2MYS A;  2RA2 A;  2DET A;  2MI6 A;  4M78 F;  4D8D A;  1VQN Q;  2RJE A;  3G6E Q;  3I55 A;  5LJ5 g;  3QWY A;  2DL4 A;  4F14 A;  3OS1 A;  2BTT A;  3CPW S;  1S72 A;  2D8H A;  3HHT B;  1ZBX A;  3CC4 Q;  5GJV B;  2EWN A;  2KXD A;  3G71 T;  3L2Q A;  4NL2 A;  2MCN A;  2K7A A;  2DIQ A;  2C7I A;  4PHC A;  1ABO A;  3NGP A;  4UP9 A;  1EQR A;  2NUT A;  4R0K A;  4EMK A;  2NUT B;  5L8R E;  1UEB A;  3H41 A;  4EMK B;  5GAO n;  3OYD A;  2PUO B;  4YRR A;  2MWO A;  3SFM A;  3DB3 A;  1Z7N A;  3HXY A;  2YRD A;  2F2V A;  2DFU A;  2QXF A;  1RAE B;  3QG1 A;  3TUP A;  1D1B A;  1B07 A;  2F2X A;  4XU2 A;  1D09 B;  3I7F A;  3IG2 A;  2RK1 A;  3QPH A;  2FZG B;  4OVA A;  1KG1 A;  1G5H A;  2X4Y A;  1C0A A;  4AMC A;  4A53 A;  1MMG A;  2ZZD A;  1X75 C;  1BB9 A;  4MMK A;  4H2Y A;  4O5V A;  4IUU A;  3KFV A;  3RMS A;  1UG1 A;  1SER A;  1HTT A;  2I2L A;  1TWB A;  1D0Z A;  1UGP B;  5F5W A;  1M3B A;  3M58 A;  1VQ6 A;  1EVK A;  1PNJ A;  2R58 A;  2FO0 A;  1HXD A;  1M2O A;  4KUD K;  1YWO A;  2IPO B;  4CRI A;  2QQ9 A;  3NTI A;  4M7A A;  3S3N A;  4JJD A;  1QCF A;  3JB9 F;  1KK7 A;  2VV5 A;  3OYH A;  1YJW A;  5KNN A;  4C92 G;  2KEA A;  3QYG B;  1K4U S;  4HWO A;  5LJ5 d;  2GFA A;  5FRO A;  3QDR B;  3M0Q A;  1Q81 U;  3E9I A;  4ZIB A;  3X25 B;  3M56 A;  4K11 A;  1K9M R;  4HA8 A;  11AS A;  3OW2 A;  2DDZ A;  2M16 A;  2VB6 A;  3C12 A;  3VUZ A;  2LCS A;  3A31 A;  1B7T A;  2EFI A;  1WPY A;  1WI7 A;  4FW2 A;  1K0X A;  4KGV B;  4LDV A;  2XGT A;  4L6V 5;  3OQ5 A;  1QKW A;  3IKM B;  1QKX A;  1K0S A;  2OJ2 A;  3X28 B;  2CJB A;  1N6A A;  2J3M A;  1AEY A;  3JCM W;  5I2S A;  1WLP B;  2A28 A;  3A98 A;  1CKB A;  2QHV A;  5GAN 6;  1Q7Y R;  3A8O B;  1IHW A;  1UGS B;  5GJW B;  3CCR A;  4RG8 A;  3M53 A;  5FW9 A;  3TEH A;  5CKH A;  3TEH B;  1XQH A;  4MZM A;  1A0N B;  1RAD B;  2DVE A;  5I2M A;  2SRC A;  1M90 R;  4TWA A;  1VQ5 Q;  2KRM A;  2DL8 A;  4YRS A;  1VQ8 Q;  3OD1 A;  4HCK A;  4HCZ A;  4RTY A;  3R6N A;  4B6M A;  4CH6 A;  1K9M U;  1VYT A;  1BCO A;  3MPU B;  3EAE A;  3WVD B;  3G7Z A;  3HFO A;  2RHS A;  5GAM f;  1OZ2 A;  4QQD A;  2BIV A;  3CCV T;  1YJ9 A;  2LRQ A;  4PJN A;  4PJO E;  3L42 A;  4XU0 A;  3E9H A;  1UGQ B;  1K8A R;  1BIB A;  3S3O A;  2YXY A;  2ATC B;  2RM4 A;  2JN0 A;  4TQD A;  1GBQ A;  1RAB B;  1JRI A;  3SHW A;  2LNV A;  3CCM A;  1XOV A;  1LJO A;  4C0D C;  1VOM A;  3MP8 A;  1Q7Y U;  1UEC A;  1MGQ A;  1W1F A;  2RQU A;  1SPK A;  2XDD A;  5C52 B;  5KYX A;  1XTD A;  2ZZE A;  4M7D E;  4ZN1 A;  1OPL A;  4FL6 A;  5FWC A;  4E7I A;  4HWP A;  2P4R A;  3VYH B;  3ZBD A;  1OU8 A;  1NPR A;  5KYW B;  4M75 G;  1QVG A;  3RMQ A;  1IGU A;  4YRJ A;  1VUB A;  4XTX A;  2KK4 A;  4BI8 B;  1SHG A;  1OZ3 A;  5CVI A;  2JUF A;  4J5Y A;  2C0O A;  2EBP A;  4C8Q F;  1QP3 A;  4M7D C;  2Y4X A;  3JB9 G;  2A0F B;  4IUQ A;  3TSW A;  3L2Z A;  2XDP A;  1W2B P;  1K8A U;  5GAN 3;  2ZPF B;  2K5I A;  5FU6 C;  3CCS T;  3VQY A;  1X55 A;  2J06 A;  5A0G A;  1GXI E;  3JCM f;  1UTI A;  1WLE A;  4BAC A;  4BE2 A;  3REX A;  4R56 A;  2OTL Q;  4C5I A;  3DKM A;  2EKO A;  4YRC A;  3CCE T;  1YWP A;  1TUC A;  3FDR A;  1VQP Q;  4M77 G;  1QLY A;  3UA6 A;  3PCO A;  1YJN Q;  4K87 A;  4BUG A;  2KAF A;  1M5Q 1;  3C95 A;  3ZEH A;  5CCA A;  3LW5 E;  4OLF A;  2B86 A;  4CC7 A;  3QZ5 B;  4JS4 A;  2GGR A;  4OMN A;  3CCV A;  4KT0 E;  2K5L A;  3HXX A;  5HK0 A;  4Y92 A;  1UGV A;  2CSQ A;  4PKC C;  5DY9 A;  3JB9 H;  1ADY A;  2FRW A;  1Z7M A;  3EFS A;  2KT8 A;  1YHQ Q;  2QTV A;  2EYX A;  2E65 A;  3VJP A;  4ATO A;  1M3C A;  2DPP B;  2LJ1 A;  1I81 A;  1H4V B;  2L3Q A;  5LL6 S;  4BB7 A;  3GLX A;  1TG0 A;  4LVK A;  3LWI A;  3HRK A;  2KXC A;  2QDY B;  3A8M B;  3PMT A;  4LVI A;  4JDS A;  5E3I A;  1HJD A;  4UP7 A;  4LD6 A;  2ZIM A;  3JAM E;  5IAY A;  3EGU A;  3MEY A;  4YCU A;  1VQK Q;  4EO4 A;  2HL5 C;  3THK A;  4A4F A;  1QE0 A;  1W4S A;  5AYF A;  5GAM e;  2EYQ A;  2CP0 A;  2XI9 A;  5ECA A;  3CME Q;  3HXW A;  3EG3 A;  3ME9 A;  4C92 E;  3OBW A;  3JCM X;  4PLI A;  4IUV A;  2LMJ A;  2QHT A;  5GMK m;  4CC3 A;  3CCS A;  1E22 A;  3TCJ A;  1YFN A;  4JLI A;  1U1T A;  5GAN f;  1XJW B;  2HSP A;  2K2V A;  4C92 C;  3HRU A;  5CKE A;  4RTT A;  4IUT A;  4Z89 A;  1LYL A;  4RG2 A;  3EFO A;  1YIJ Q;  3E9G A;  3A7A A;  2E64 A;  3MET A;  3MHX A;  1Y07 A;  3GF5 A;  4LDY A;  4P75 A;  3VUB A;  4ANJ A;  1BK2 A;  4X9D A;  4PJO A;  4C0D B;  1UHF A;  3REA B;  1S1N A;  2NUZ A;  2LVM A;  1VQL Q;  2FVU A;  5J39 A;  2PQW A;  4ZN3 A;  3UWN A;  1NE8 A;  3EGD B;  4AG2 C;  1VQN A;  3G6E A;  2LCL A;  4ZGE B;  4DA4 A;  4QT7 A;  3VQV A;  4QVC A;  3NEN A;  2HQE A;  1LOJ A;  1KD1 R;  2WSF E;  3CC4 A;  2DIG A;  1KC8 U;  4LNS A;  3NFC A;  1U5S A;  1ASY A;  1BBZ A;  1UHC A;  4KH0 B;  4M7D A;  3JCM e;  2BZ8 A;  1AOJ A;  2ARS A;  1FXX A;  4M7D B;  1JU5 C;  3GIB A;  2CS7 A;  3QHS A;  5C53 B;  1RAH B;  2RHY A;  3SWN A;  2FZC B;  2M9U A;  3CCJ Q;  2HKQ B;  2ZPB B;  4DEY A;  4DOV A;  2DXB A;  1SRL A;  3SEM A;  2DE0 X;  4ME7 A;  5FU6 B;  1JB0 E;  3VS3 A;  3QKJ A;  2Q7H A;  2XK0 A;  1N27 A;  2V8J A;  5C6S A;  1NYF A;  1YIT Q;  3RES A;  4E7K A;  4HCB A;  4E7H A;  1JEG A;  1NYG A;  1IRX A;  2KNB B;  2F5T X;  2BUD A;  3CCU Q;  2KE9 A;  1MV0 B;  1UB4 A;  3BJU A;  2ZPH B;  5ELN A;  3TU4 K;  5K1P A;  4EMG A;  1GCP A;  3CCL Q;  4M75 E;  1M1K U;  4D6W A;  3A8H B;  4EPC A;  1VQ4 T;  2OTJ Q;  2E5A A;  3GNF B;  2GTO A;  3PZC A;  4N0A A;  1OPK A;  4TVA B;  2LNH B;  4HVC A;  2DO3 A;  2YRC A;  4M75 C;  2JS2 A;  2DLP A;  4J6Y A;  1AWJ A;  4RTZ A;  2XIC A;  2P4T A;  3HRS A;  2EIF A;  4BWA A;  4DPG A;  1R0C B;  2DL5 A;  4ZNX A;  2DBM A;  1C0M A;  3TVT A;  4CC4 B;  4H2T A;  1U3O A;  1QVF S;  1I1J A;  1WDX A;  4PJO D;  3OYK A;  4FYW B;  1QVG S;  2IG0 A;  3RKW A;  4M77 E;  1VQM Q;  2ZNI A;  1VIE A;  3HKS A;  1ZSZ A;  2Q5I A;  3M4P A;  3OW2 P;  2HSE B;  3JCM P;  2YDL A;  3EG2 A;  5GAN e;  3LYI A;  2DAQ A;  4C0G A;  1N9R A;  2LQ8 A;  4HVV A;  3V7C A;  5AT1 B;  1Q82 C;  2XID A;  3R07 A;  2KMT A;  1X01 A;  3NPF A;  2ECZ A;  2ZGW A;  1ABQ A;  5D6X A;  2ZIO A;  2CH4 A;  2E5K A;  4JJN K;  2WSE E;  3DLM A;  4M7D D;  4ZTU B;  2YSQ A;  4C92 A;  2CGH A;  4C92 B;  2FYK A;  2SEM A;  2OI3 A;  1EZZ B;  2OTL T;  3QJ6 A;  4AFU C;  3GNG A;  3KBG A;  1OX8 A;  2OAU A;  1PRL C;  4LVM A;  1SRY A;  4QKU A;  4J6W A;  2QI2 A;  2ODR C;  2JVV A;  3P8V A;  2KDS A;  1VQ8 A;  1Q86 R;  2YHT A;  2J3L A;  1GCQ C;  3HXV A;  2A37 A;  2LT1 A;  4ELY C;  1PYS B;  4P73 A;  5FRN A;  1WIE A;  1OUL A;  5I11 A;  4PK4 A;  2ZCF B;  4TTV A;  4E6R A;  4J83 A;  1NJ2 A;  5KYY A;  1F1B B;  3HTR A;  3VS5 A;  5KYY B;  1Y71 A;  2LQN A;  2O01 E;  1RAG B;  3NEM A;  3TSZ A;  3G4S Q;  5CQX A;  3J80 E;  5HKC A;  2JT4 A;  1OV3 A;  1D3B A;  3C0C A;  2ZPG B;  3VS7 A;  3H8Z A;  2ROT A;  2EGA A;  1JJ2 P;  4UPA A;  4YCW A;  2EYY A;  3E19 A;  4XTU A;  2VVK A;  2CP2 A;  3A8L B;  4II1 A;  1X2G A;  3OYB A;  3QJY A;  2JTF A;  2RHQ B;  3UDC A;  1K1Z A;  5CQY A;  1I5L A;  5IH2 A;  4RDX A;  1KHC A;  1VQK T;  1VQ6 T;  4BY6 C;  8ATC B;  3GPL A;  5GAO r;  1QVP A;  3PTA A;  2A8E A;  2LZ6 B;  5J26 A;  4LVL A;  2ED0 A;  3CME T;  1B7Y A;  1VQO Q;  1JJC A;  3LC0 A;  4C8Q C;  1B7Y B;  4OMQ A;  2L5Q A;  4P72 A;  2CT4 A;  1NBE B;  3OSS C;  2E3H A;  2VAS A;  2A08 A;  2FPD A;  4UC4 A;  3WVE B;  1Q81 C;  1UDL A;  1YGB A;  3UH0 A;  4TVW A;  3QXE B;  2ALY A;  1Q82 U;  1AZE A;  4FW1 A;  2ALY B;  3RNJ A;  5KE2 A;  1WXU A;  5GMK e;  4Z02 A;  4RTU A;  3CCQ Q;  4Q15 A;  5DLQ E;  2QQB A;  5FLX E;  4O2D A;  4RTX A;  1YIJ T;  2J7I A;  2I4L A;  3MP6 A;  2LDM A;  3HL8 A;  3ULR B;  4A4E A;  2NWM A;  2CP6 A;  2OTL A;  3M0P A;  1KMN A;  1KQ1 A;  4JUV A;  2Z0W A;  4M75 A;  4CS2 A;  1VQP A;  4M75 B;  5KCO A;  1YJN A;  1ZSG A;  1WHK A;  5LJ3 f;  4C92 D;  4P3P A;  3CCR T;  3A5Y A;  2QYZ A;  1W66 A;  5I22 A;  2WSC E;  1VQL T;  2E1H A;  4A4H A;  2I4O A;  1FYF A;  4BE1 A;  2BE7 D;  4RTW A;  1ZX6 A;  2CJ9 A;  1N8R R;  3D7S B;  3JCM c;  3PT9 A;  4FYV B;  2ZCE A;  2KRO A;  3A1P A;  4JLG A;  3CC2 Q;  2BE9 B;  4FT4 A;  1QW1 A;  2DVJ A;  2QEX Q;  1YHQ A;  5GAM j;  2G3R A;  2H3E B;  3I35 A;  1K9M C;  3VRY A;  1VQ9 Q;  4FCY A;  4YRQ A;  3EG9 A;  2XKO C;  4YRE A;  3EG9 B;  1UE9 A;  1YJ9 T;  2RB6 A;  1M2V B;  2GCX A;  5LJ5 f;  3TQ7 P;  3M0S A;  4F7U F;  3CCJ T;  4M77 A;  4GBQ A;  4M77 B;  1X2Q A;  2P5I A;  4JS5 A;  3PVQ A;  1BKB A;  2KRS A;  2K57 A;  1NJ5 A;  3CCM T;  2AMC A;  1WXT A;  2AMC B;  1Q7Y C;  1VQK A;  3L2W A;  3E1S A; 
#chains in the Genus database with same CATH homology
 1H4S A;  2HAX A;  3J7A F;  1YFT A;  2R5A A;  3OS0 A;  2CZ7 B;  3CME A;  1SES A;  2CJA A;  1M90 C;  3CCL T;  3Q1J A;  3RGL A;  2HBP A;  2ZR3 A;  2NS6 A;  1USY A;  4PNO A;  4BE0 A;  4P74 C;  1WJR A;  3ICA A;  2M0O A;  4P71 C;  1KHI A;  4OP0 A;  5GAO q;  1B76 A;  3MEV A;  1YIJ A;  4NOY A;  1K8A C;  2LX9 A;  1WNL A;  2ZNJ A;  1KQS A;  3LSS A;  1MHN A;  5GAO l;  3M54 A;  2CZ1 B;  4M78 G;  3LWH A;  4ZGD B;  5CIU A;  1O75 A;  1VQL A;  3N5B B;  4NCX A;  1EFW A;  3MCA B;  4M75 D;  1YBY A;  4IUP A;  5HY6 A;  2ZXF A;  4HT4 A;  2V8I A;  4FM4 B;  1VQM T;  4BY6 B;  2O4X B;  4XAX B;  5DLO A;  4RKU E;  1QP2 A;  1EVL A;  4RCB A;  1BIA A;  1PSE A;  1N9W A;  4M7A F;  1ZQ1 A;  3CCJ A;  4YRM A;  1K73 U;  1U1S A;  3OYY A;  4C0Z A;  2KY9 A;  3QO3 A;  5LJ3 e;  2RJF A;  4CH4 A;  1RI0 A;  3G1Z A;  2ZPE B;  3FB9 A;  2GQV A;  1WJS A;  4M77 D;  2IY5 B;  4YP0 A;  1ATI A;  2E6N A;  3PGG A;  3CCU A;  2ZT8 A;  5A0L A;  5DM7 R;  1QVF A;  1M90 U;  3SD4 A;  3CCL A;  4HT8 A;  2RI5 A;  3JCM b;  2RI3 A;  3FJP A;  4R55 A;  2NLU A;  2XTI A;  2OTJ A;  5LJ5 e;  5ELO A;  2ODR D;  3UPU A;  2YRV A;  3G4S T;  4LDU A;  5GAM d;  2DXT A;  3HPW A;  2KQW A;  4UP8 A;  4YTL A;  5CAI A;  2DD4 A;  2RD1 A;  2CIM A;  3DSQ A;  2M1H A;  1NJ1 A;  3V7R A;  3QUI A;  4H2X B;  5FU7 C;  3HXZ A;  1B70 B;  4XEM A;  1VQM A;  2EAY A;  4N4H A;  3S3M A;  4QW2 A;  4FSX A;  3OYL A;  1IZ6 A;  4CS3 A;  3LX7 A;  1VQN T;  3G6E T;  4H2S A;  4X34 A;  3KFU A;  3SB2 A;  2AKW B;  3A74 A;  1KC8 C;  3CCQ T;  3CC4 T;  3MO8 A;  3R6O A;  3BDL A;  1NJ6 A;  2RH2 A;  3EFR A;  2IVW A;  5GMK i;  3GOX A;  3NEL A;  1QF6 A;  2DZC A;  2P0Q A;  1G3S A;  3X24 B;  4L59 A;  2KSS A;  3CXC S;  3JCM d;  4M7A G;  5C0M A;  4WF2 A;  2ART A;  2MF2 A;  3M57 A;  5CO7 A;  2K4Y A;  4FIB A;  1I8F A;  3UT1 A;  1YFS A;  1BI1 A;  1B34 B;  4CH5 A;  1VQ9 T;  3G4S A;  3L2R A;  1M1K C;  1KD1 C;  2X4X A;  2E10 A;  4WI1 A;  3L4G A;  3QZ9 B;  2EQK A;  3L4G B;  3VKI A;  1L0W A;  4C8Q G;  1KOG A;  1G3T A;  3M9Q A;  5IT9 E;  2LC4 A;  4M78 E;  4YRP A;  3A32 A;  2X4W A;  3JCM Q;  5J3B A;  3CPF A;  1VQO A;  1N9S A;  2QQS A;  3OYN A;  4QVZ A;  4B9W A;  4J7I A;  2XU8 A;  4M78 C;  2EJG A;  4OB3 B;  4E47 A;  2VYT A;  3L2U A;  3CCQ A;  3QO8 A;  4HCC A;  2MAM A;  1BBU A;  3CBP A;  2ZT6 A;  2XD0 A;  2P0L A;  2PU9 B;  1KQS S;  5GAN d;  3HRI A;  1HK9 A;  1M1F A;  3OB9 A;  2R5M A;  2XDB A;  2RI2 A;  3OYC A;  1G5V A;  3CBM A;  3PIO A;  3HXU A;  5IN1 A;  4EMH A;  3CC2 A;  2RJD A;  3NTH A;  1VQ5 T;  1FX7 A;  5FU7 B;  3A8G B;  1XNI A;  1VQ8 T;  4KUL A;  2E3C A;  1RL2 A;  1VQ9 A;  1M4Z A;  2VXF A;  2RK2 A;  2G4C A;  4PJO F;  4ELZ C;  2LT4 A;  1KD1 U;  4O6J A;  3HY1 A;  3QSU A;  4TVA A;  2L8D A;  3E9F A;  2DQ0 A;  3QO5 A;  4OGE A;  4Y28 E;  3OMC A;  4HT9 A;  4BDY A;  2CKK A;  2RO0 A;  1OI1 A;  2E41 A;  2DEQ A;  2JZ2 A;  2ZT5 A;  2QHU A;  1WYD A;  1G3W A;  1ZHI A;  3M59 A;  3PFS A;  3L2V A;  3C94 A;  4M7D F;  4RQE A;  5M9O A;  2ZZF A;  3OYE A;  4MZP A;  3M4G A;  4X5O A;  5GAM h;  1Q86 C;  3MEU A;  5HK3 A;  3CBO A;  2QTX A;  5KCH A;  4YRO A;  2ARU A;  2DU7 A;  1VQZ A;  4AH6 A;  3INZ A;  1IRE B;  2E12 A;  2FL7 A;  3BFM A;  3OYI A;  1Y96 A;  1Y96 B;  4KR2 A;  3C4S A;  1VQ7 T;  12AS A;  3OBY A;  5GAN 8;  2H3J A;  2PVG B;  3RAC A;  2Y90 A;  5C51 B;  3REU A;  5LJ3 j;  5FRM A;  1E1O A;  1VQP T;  2QHS A;  1YJN T;  1VQ5 A;  1WGS A;  4M7A E;  2FB7 A;  1O9S A;  3M4Y A;  3CMQ A;  3FIF A;  2X4J A;  1PYS A;  3VBB A;  3OA6 A;  4P3O A;  3TRE A;  3URG A;  5GAO m;  3LSQ A;  4J15 A;  2ZTG A;  4M7A C;  3P8D A;  2EL9 A;  4M78 A;  4M78 B;  1Y7X A;  1YHQ T;  2EJ9 A;  5GMK l;  2CZ0 B;  3JCM h;  3V8K A;  3QNE A;  5GAN 7;  2MWP A;  2DZ9 A;  3LH0 A;  1SET A;  5EG2 A;  4PJO G;  3P8Y A;  4OMF B;  2RHQ A;  2GFU A;  2Y4Y A;  4C8Q E;  1H4T A;  2K3X A;  4OGC A;  3WQZ A;  3BY7 A;  4P5N A;  1Q86 U;  3I56 T;  3JSC A;  4JRK A;  4C92 F;  3L1A A;  3HFN A;  5D6Y A;  4LDW A;  4VUB A;  2X35 A;  4C0F A;  3IAL A;  2PUK B;  4QVD A;  1NNH A;  4E7J A;  3P8H A;  4XU3 A;  3A5Z B;  4YCV A;  2P0P A;  1AHJ B;  1VQ7 A;  3VU3 C;  2DXU A;  1EIF A;  4YRL A;  4HWS A;  4ZGJ B;  3CXC A;  2PVD B;  3FEO A;  3A7U A;  2V8K A;  3WXM B;  3OY9 A;  4PL6 A;  2Q7G A;  1IL2 A;  4JRI A;  1WQW A;  3X20 B;  1X54 A;  2VGM A;  3T9N A;  5GAN h;  4KUI A;  4OB2 B;  3V8J A;  4XTW A;  4J7F A;  3CC7 T;  3ZFJ A;  4X9C A;  1H3Z A;  2F5K A;  1OYX A;  2DKG A;  4M78 D;  3CD6 T;  4GY5 A;  1R8O B;  1NJI C;  2D6F A;  1K73 C;  2RHZ A;  1NZ9 A;  2EQJ A;  3X26 B;  1G3Y A;  1YIT T;  4K88 A;  5LJ3 d;  3I56 A;  3CCU T;  4HWR A;  2E70 A;  4MDW A;  4YRG A;  1N8R U;  1G51 A;  2MMP A;  4QQG A;  3PNW C;  2JNG A;  1BI3 A;  2EQU A;  4M75 F;  2EQM A;  4H2U A;  2RHI A;  4DQ2 A;  4ZTF A;  2Q5H A;  2OTJ T;  4Q5W A;  4M7A B;  1J5W A;  3FLG A;  4WJ3 M;  1GGM A;  3MF1 A;  3V8L A;  1KQ2 A;  5GAM g;  4C5G A;  3UGQ A;  1JBM A;  2YLB A;  1I4K 1;  3TEE A;  4RCC A;  4J6X A;  4XTY A;  5KH6 A;  2ZT7 A;  2A7Y A;  1W2B S;  3MP1 A;  3QII A;  3G71 A;  4M77 F;  5CK9 A;  2DD5 A;  1NJ8 A;  1E1T A;  4N4I A;  2K3Y A;  4XTZ A;  4WJ4 A;  2O4X A;  5KE3 A;  3JB9 D;  1BBW A;  4C5H A;  2L3R A;  4B9X A;  1G5I A;  3CC7 A;  2GF7 A;  4C8Q A;  4C8Q B;  2QA4 T;  3CMA T;  1YI2 T;  5GMK h;  3CD6 A;  2WAC A;  5CR2 A;  4MDX A;  1NJI U;  3M5A A;  3F70 A;  3TEG A;  1NYQ A;  3LGF A;  3IKL A;  4YRK A;  3PMI A;  1M8V A;  4ZTJ A;  2XHC A;  1VIF A;  1YIT A;  4HKE A;  4OB1 B;  1YCY A;  4XU1 A;  5CKB A;  2IY5 A;  4V2S A;  2C8M A;  2RHS B;  3OYM A;  2D0Q B;  4YYE A;  4F7U G;  2DXC A;  3JB9 J;  3JCM g;  4L5G A;  3RIR A;  4P75 C;  1P92 A;  4PJO C;  1JJ2 A;  4H2W A;  2JTM A;  1BI0 A;  4N4G A;  4DOW A;  3LLR A;  1TH7 A;  3MQZ A;  3OYA A;  4TVY A;  4TVR A;  3P8T A;  5GAN j;  3RKY A;  3SDZ A;  4M7A D;  1WU7 A;  5CKF A;  3AHU A;  4YRN A;  3FC3 A;  5A0D A;  4GLK A;  4H2X A;  1B70 A;  4J8O A;  3SWN C;  1ASZ A;  1EOV A;  4A4K A;  2ZZG A;  1ADJ A;  3OYJ A;  1VQO T;  1M1G A;  3QYH B;  2FHD A;  3HP9 A;  2RHU A;  4P3N A;  2QA4 A;  3CMA A;  1NYR A;  2ZR2 A;  3O8V A;  1YI2 A;  2AKW A;  2K5F A;  4CS4 A;  2AHJ B;  1PSF A;  4C8Q D;  2I4N A;  3HFZ A;  3PCO B;  4P74 A;  2Q7E A;  5A2Q E;  3HFZ B;  3UGT A;  4P71 A;  5GAN 4;  1FWZ A;  3QTC A;  2DTH A;  3JCM J;  1B8A A;  2ZPI B;  3MEA A;  3VV0 A;  3OS5 A;  4N0A C;  5GAN g;  1LNX A;  3W3S A;  4XQ3 A;  2JOY A;  4RMF A;  1BYM A;  3GP8 A;  3CC2 T;  2QEX T;  2PVO B;  2L89 A;  1B34 A;  4NL3 A;  3BW1 A;  4RMO A;  3MEW A;  2LQK A;  3V7S A;  3HFV A;  4YRF A;  5GMK j;  5LJ3 h;  4MZT A;  4EX5 A;  2EJF A;  2DU5 A;  3S6W A;  5GAN 5;  4BI3 A;  5GAO p;  1SSF A;  2DQ3 A;  4EDU A;  3CPW A;  1H64 1;  3PIP A;  4IKF A;  3A7R A;  2B8A A;  4A4G A;  4Y91 A;  4XTV A;  4C5E A;  5LJ5 h;  3CCE A;  2KVQ G;  3OYG A;  4PJO B;  4Q6G A;  2XG8 D;  3HY0 A;  4JRP A;  1YFR A;  3RER A;  4P73 C;  3OYF A;  2LCC A;  4FU6 A;  2E6Z A;  1V29 B;  3VQW A;  4H02 A;  1UGR B;  1EIY A;  3OW2 S;  3RUX A;  4YRI A;  3ER0 A;  1EIY B;  5CKD A;  4MML A;  4PLL A;  3VQX A;  3HRT A;  5D6W A;  1RIQ A;  2YLC A;  2PMF A;  2VUB A;  2HD0 A;  2HNI A;  2QQR A;  2F69 A;  4JRQ A;  4F7U E;  4CI0 C;  2QEX A;  4OB0 B;  3M55 A;  3SWN B;  4G84 A;  4XEO A;  1WJQ A;  2I4M A;  2C06 A;  1X6O A;  4NS5 A;  4LDX A;  1X2H A;  2VGN A;  3J81 E;  4OF1 A;  3P8B B;  4P72 C;  3CEY A;  2DTI A;  3FRN A;  4LVJ A;  3KUF A;  4A54 A;  4HWT A;  3HSB A;  4LD9 K;  3NET A;  2P0K A;  4KQE A;  4IUR A;  2E5Q A;  3JRZ A;  4L87 A;  4YPF A;  5I21 A;  1W2B A;  4E51 A;  3JB9 I;  1JJ2 S;  2PME A;  4QQ6 A;  2DJZ A;  4EMK C;  4CH3 A;  1NPP A;  4YDQ A;  1DJ7 B;  4E7L A;  2D9T A;  1HC7 A;  2RJC A;  3HTZ A;  4TQF A;  3RL6 A;  3QBY A;  2DK3 A;  3VYG A;  4PG3 A;  3OS2 A;  1M9S A;  3H6Z A;  3JCM V;  2LTO A;  1H4Q A;  4K86 A;  4BW9 A;  4RQF A;  4YRT A;  1E24 A;  2VC8 A;  4M77 C;  3I55 T;  4H2V A;  1S72 T;  1X56 A;  4BI4 A;  4KBM B;  3RF1 A;  3QO7 A;  5LJ5 j;  2CYZ B;  2DTO A;  5GAN 2;  1USY C;  3BDU A;  1WQ7 A;  3OSV A;  3OMG A;  3LGL A;  2QQA A;  2CZ6 B;  4ZTZ B;  1VQ4 A;  4FT2 A;  3RKX A;  3KXT A;  3ASK A;  4XK8 E;  1BI2 A;  1D3B B;  3M4Q A;  3DB4 A;  3UFG A;  2VXE A;  1N8R C;  5LJ3 g;  3MF2 A;  2ZIN A;  2A3L A;  1U8R A;  4M7D G;  1YB3 A;  3NTK A;  3ERR A;  2RHX A;  4BD3 A;  2BKD N;  4KR3 A;  4G85 A;  2R57 A;  3A5Z A;  4F7U A;  3DLL A;  5K1X A;  2HQX A;  4F7U B;  5HGQ A;  1YJW T;  1JJC B;  4BDZ A;  1KMM A;  2RA2 A;  2MI6 A;  4M78 F;  2RJE A;  3I55 A;  5LJ5 g;  3OS1 A;  3CPW S;  1S72 A;  3HHT B;  1ZBX A;  2EWN A;  3G71 T;  3L2Q A;  4NL2 A;  2DIQ A;  2C7I A;  4PHC A;  4UP9 A;  1EQR A;  4EMK A;  5L8R E;  1UEB A;  4EMK B;  5GAO n;  3OYD A;  2PUO B;  4YRR A;  2MWO A;  3SFM A;  3DB3 A;  1Z7N A;  3HXY A;  2QXF A;  3QG1 A;  3TUP A;  4XU2 A;  3I7F A;  3IG2 A;  2RK1 A;  3QPH A;  4OVA A;  1KG1 A;  1G5H A;  2X4Y A;  1C0A A;  4A53 A;  2ZZD A;  1X75 C;  4H2Y A;  4MMK A;  4O5V A;  4IUU A;  3RMS A;  1SER A;  1HTT A;  2I2L A;  1UGP B;  5F5W A;  3M58 A;  1VQ6 A;  1EVK A;  2R58 A;  1HXD A;  4KUD K;  4CRI A;  2QQ9 A;  3NTI A;  4M7A A;  3S3N A;  3JB9 F;  2VV5 A;  3OYH A;  1YJW A;  5KNN A;  4C92 G;  3QYG B;  4HWO A;  5LJ5 d;  2GFA A;  5FRO A;  3QDR B;  1Q81 U;  3E9I A;  4ZIB A;  3X25 B;  3M56 A;  4HA8 A;  11AS A;  3OW2 A;  2DDZ A;  2M16 A;  3C12 A;  3VUZ A;  3A31 A;  2EFI A;  1WPY A;  4LDV A;  2XGT A;  4L6V 5;  3OQ5 A;  3IKM B;  3X28 B;  2CJB A;  1N6A A;  2J3M A;  3JCM W;  5I2S A;  2QHV A;  5GAN 6;  3A8O B;  1UGS B;  3CCR A;  4RG8 A;  3M53 A;  3TEH A;  5CKH A;  3TEH B;  1XQH A;  4MZM A;  2DVE A;  5I2M A;  4TWA A;  4YRS A;  3OD1 A;  4HCZ A;  4CH6 A;  1K9M U;  3EAE A;  3WVD B;  3G7Z A;  3HFO A;  2RHS A;  5GAM f;  1OZ2 A;  4QQD A;  2BIV A;  3CCV T;  1YJ9 A;  2LRQ A;  4PJO E;  3L42 A;  4XU0 A;  3E9H A;  1UGQ B;  1BIB A;  3S3O A;  2RM4 A;  2JN0 A;  4TQD A;  1JRI A;  2LNV A;  3CCM A;  1XOV A;  1LJO A;  4C0D C;  3MP8 A;  1Q7Y U;  1MGQ A;  2XDD A;  5C52 B;  1XTD A;  2ZZE A;  4M7D E;  4ZN1 A;  4FL6 A;  4E7I A;  4HWP A;  3VYH B;  3ZBD A;  1NPR A;  4M75 G;  1QVG A;  3RMQ A;  4YRJ A;  1VUB A;  4XTX A;  2KK4 A;  4BI8 B;  1OZ3 A;  5CVI A;  2JUF A;  4J5Y A;  4C8Q F;  1QP3 A;  4M7D C;  2Y4X A;  3JB9 G;  4IUQ A;  3L2Z A;  2XDP A;  1K8A U;  5GAN 3;  2ZPF B;  2K5I A;  5FU6 C;  3CCS T;  3VQY A;  1X55 A;  5A0G A;  1GXI E;  3JCM f;  1WLE A;  4BAC A;  4BE2 A;  3REX A;  4R56 A;  4C5I A;  3DKM A;  2EKO A;  4YRC A;  3CCE T;  3FDR A;  4M77 G;  3PCO A;  4K87 A;  4BUG A;  2KAF A;  1M5Q 1;  3C95 A;  3ZEH A;  5CCA A;  3LW5 E;  4OLF A;  4JS4 A;  3QZ5 B;  3CCV A;  4KT0 E;  2K5L A;  3HXX A;  5HK0 A;  4PKC C;  1ADY A;  1Z7M A;  5DY9 A;  3JB9 H;  3EFS A;  2E65 A;  3VJP A;  4ATO A;  2DPP B;  1I81 A;  1H4V B;  5LL6 S;  4BB7 A;  3GLX A;  4LVK A;  3LWI A;  3HRK A;  2QDY B;  3A8M B;  3PMT A;  4LVI A;  4JDS A;  5E3I A;  4UP7 A;  4LD6 A;  2ZIM A;  3JAM E;  5IAY A;  3MEY A;  4YCU A;  4EO4 A;  4A4F A;  1QE0 A;  1W4S A;  5AYF A;  5GAM e;  2EYQ A;  2XI9 A;  3HXW A;  3ME9 A;  4C92 E;  3OBW A;  3JCM X;  4PLI A;  4IUV A;  2QHT A;  5GMK m;  3CCS A;  1E22 A;  3TCJ A;  4JLI A;  5GAN f;  1U1T A;  2K2V A;  4C92 C;  3HRU A;  5CKE A;  1LYL A;  4IUT A;  4RG2 A;  3E9G A;  3A7A A;  2E64 A;  3MET A;  3MHX A;  1Y07 A;  3GF5 A;  4LDY A;  4P75 A;  3VUB A;  4X9D A;  4PJO A;  4C0D B;  2LVM A;  2FVU A;  5J39 A;  2PQW A;  4ZN3 A;  3UWN A;  1NE8 A;  1VQN A;  3G6E A;  2LCL A;  4ZGE B;  4DA4 A;  3VQV A;  4QVC A;  3NEN A;  2HQE A;  1LOJ A;  2WSF E;  3CC4 A;  2DIG A;  1KC8 U;  4LNS A;  3NFC A;  1ASY A;  4M7D A;  3JCM e;  2ARS A;  1FXX A;  4M7D B;  3GIB A;  2CS7 A;  3QHS A;  5C53 B;  2RHY A;  3SWN A;  2M9U A;  2ZPB B;  4DOV A;  2DXB A;  4ME7 A;  5FU6 B;  1JB0 E;  3QKJ A;  2Q7H A;  2XK0 A;  1N27 A;  2V8J A;  5C6S A;  3RES A;  4E7K A;  4HCB A;  4E7H A;  2F5T X;  2BUD A;  1UB4 A;  3BJU A;  2ZPH B;  5ELN A;  3TU4 K;  5K1P A;  4EMG A;  4M75 E;  1M1K U;  4D6W A;  3A8H B;  4EPC A;  1VQ4 T;  2E5A A;  3GNF B;  3PZC A;  4N0A A;  4TVA B;  4HVC A;  2DO3 A;  4M75 C;  4J6Y A;  2XIC A;  2P4T A;  3HRS A;  2EIF A;  4BWA A;  4DPG A;  4H2T A;  1QVF S;  4PJO D;  3OYK A;  1QVG S;  2IG0 A;  3RKW A;  4M77 E;  2ZNI A;  1VIE A;  3HKS A;  2Q5I A;  3M4P A;  3JCM P;  5GAN e;  3LYI A;  2DAQ A;  4C0G A;  1N9R A;  2LQ8 A;  3V7C A;  1Q82 C;  2XID A;  3R07 A;  2KMT A;  1X01 A;  2ZGW A;  5D6X A;  2ZIO A;  4JJN K;  2WSE E;  3DLM A;  4M7D D;  4ZTU B;  4C92 A;  2CGH A;  4C92 B;  2FYK A;  2OTL T;  3QJ6 A;  3GNG A;  3KBG A;  2OAU A;  4LVM A;  1SRY A;  4J6W A;  2QI2 A;  2ODR C;  2JVV A;  3P8V A;  2KDS A;  1VQ8 A;  2YHT A;  2J3L A;  3HXV A;  2LT1 A;  4ELY C;  1PYS B;  4P73 A;  5FRN A;  2ZCF B;  4TTV A;  4J83 A;  1NJ2 A;  1Y71 A;  2O01 E;  3NEM A;  5CQX A;  3J80 E;  5HKC A;  1D3B A;  2ZPG B;  3H8Z A;  4UPA A;  4YCW A;  3E19 A;  4XTU A;  3A8L B;  4II1 A;  1X2G A;  3OYB A;  3QJY A;  2JTF A;  2RHQ B;  3UDC A;  1I5L A;  5CQY A;  4RDX A;  1KHC A;  1VQK T;  1VQ6 T;  4BY6 C;  3GPL A;  5GAO r;  1QVP A;  3PTA A;  2A8E A;  5J26 A;  4LVL A;  3CME T;  1B7Y A;  1JJC A;  3LC0 A;  4C8Q C;  1B7Y B;  2L5Q A;  4P72 A;  3OSS C;  4UC4 A;  3WVE B;  1Q81 C;  1YGB A;  3UH0 A;  4TVW A;  3QXE B;  2ALY A;  1Q82 U;  2ALY B;  5KE2 A;  5GMK e;  4Z02 A;  4Q15 A;  5DLQ E;  2QQB A;  5FLX E;  4O2D A;  1YIJ T;  2I4L A;  3MP6 A;  2LDM A;  3HL8 A;  4A4E A;  2OTL A;  1KMN A;  1KQ1 A;  4JUV A;  4M75 A;  4CS2 A;  1VQP A;  4M75 B;  5KCO A;  1YJN A;  5LJ3 f;  4C92 D;  4P3P A;  3CCR T;  3A5Y A;  1W66 A;  1VQL T;  2WSC E;  2E1H A;  4A4H A;  2I4O A;  1FYF A;  4BE1 A;  2CJ9 A;  3JCM c;  3PT9 A;  2ZCE A;  4JLG A;  4FT4 A;  1QW1 A;  1YHQ A;  5GAM j;  2G3R A;  1K9M C;  4YRQ A;  2XKO C;  4YRE A;  1YJ9 T;  2RB6 A;  2GCX A;  5LJ5 f;  4F7U F;  3CCJ T;  4M77 A;  4M77 B;  2P5I A;  4JS5 A;  1BKB A;  2K57 A;  1NJ5 A;  3CCM T;  2AMC A;  2AMC B;  1Q7Y C;  1VQK A;  3L2W A;  3E1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...