1WPYA

Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3 in complex with biotin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
235
structure length
235
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 61
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wpyA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wpyA01
1YFSA 2QHUA 4YCVA 2ZGWA 4M7AE 4YRNA 4WF2A 4M78D 1D3BA 2DXTA 5GAOl 2PMEA 1B76A 3HY0A 3QTCA 1ASYA 4H2XB 2K57A 1BIAA 3HXXA 4DQ2A 1L0WA 4M78B 2E5AA 1KMMA 2RHSB 1H4QA 4A53A 4M7DD 1G5IA 1KMNA 4O2DA 4P71A 5GANh 4XTWA 4YRRA 1QF6A 5GAOr 5GAMe 4PJOC 2EL9A 2P0LA 1B7YB 1WYDA 4M7AA 1QE0A 2ZZGA 3TEGA 2ZTGA 3JCMg 3HFZA 4XU1A 1X01A 4F7UF 2Q7HA 4M75C 4KR3A 4RQFA 2ODRC 5GAN3 2ZNIA 1H4VB 4YRJA 1YCYA 3ICAA 3A5ZA 2ZT7A 4TQDA 1H641 3VQYA 3IKLA 1D3BB 5GANj 2FB7A 2I4MA 3M4PA 3HY1A 5DY9A 1B34A 1M8VA 3NETA 1NYQA 4MMKA 4J6WA 3QNEA 2YLBA 4H2VA 4EMHA 4P72A 3EFSA 2Y90A 1JJCB 4M78C 4HA8A 3VQWA 4HT8A 4UPAA 5GMKm 3FJPA 3JCMV 2CGHA 1FYFA 2AKWA 2QHSA 2ZXFA 1Y96A 4P3NA 3QO8A 5LJ5d 1JRIA 3V7CA 4H02A 4Q6GA 4C8QD 4M77F 4M7DC 5GAOm 4RQEA 3HXVA 3V8KA 4YRCA 1I8FA 5GAN8 4YRIA 4J6XA 5GANe 5GAMf 1M5Q1 3M4QA 2DJZA 4UP9A 2EJGA 4TQFA 1KQ1A 2DVEA 2E3CA 2EAYA 4QVDA 1B34B 5E3IA 3CMQA 4KR2A 3HXZA 4C92F 2RM4A 5LJ3h 3GIBA 2DU7A 4YCUA 3PZCA 3OD1A 4YRKA 1LNXA 5CAIA 2ARTA 4JRKA 4OLFA 4P75C 4CS4A 4P73A 3RKYA 1U1TA 2C8MA 4F7UA 4HWOA 3HTZA 3HFOA 4E51A 4UP7A 4C92G 4M7DE 1N9WA 4YCWA 1SERA 5GAOn 4YRSA 3JCMJ 3JCMW 5LJ5j 4YRQA 3FB9A 3V7SA 3P8YA 4C8QC 3JCMd 2QHVA 1E24A 1X2GA 2C7IA 2P5IA 4TVWA 2ZCEA 5GAN6 5GMKl 3E9IA 5GANf 1EIYA 1YFRA 3RKWA 1HTTA 4C8QG 1HXDA 5GAMg 3JB9G 1HC7A 2XGTA 1I5LA 1WPYA 3WQZA 4XEOA 4PHCA 4XQ3A 1YGBA 1N9RA 5ELOA 1NJ2A 3RERA 4M77A 2E64A 4C92E 1X2HA 5LJ5e 1WU7A 4YREA 4F7UB 3QSUA 3L4GB 3PCOA 3JCMh 4N0AC 3LC0A 5GAOp 2Q5IA 3SWNA 1X56A 4RCCA 1G51A 3A74A 4BW9A 5F5WA 2PMFA 4WJ3M 4PJOG 2ZZFA 4YRFA 2I4LA 1J5WA 4Q15A 4C8QE 2DZ9A 3HFVA 3R07A 4C92A 4HWSA 1EIYB 2ARUA 2I2LA 1BIBA 4H2UA 5GMKh 4M75G 4YROA 3QO7A 2RB6A 4JRIA 3JCMQ 3RGLA 4NOYA 4M78F 3E9HA 3REUA 1USYA 1IL2A 5GANg 4XTYA 4M77B 4PNOA 4NL3A 3PCOB 4M7AD 4EMKA 2AMCA 4M7DF 2IY5A 1H4TA 1I81A 4CH4A 5GMKi 4PJOE 3A7UA 4M7AB 4K86A 4M78G 3EFRA 5LJ3d 5GMKj 4P74C 5LJ5f 5I21A 3HFZB 4XTVA 1W66A 3TEHA 4HVCA 1B8AA 3JCMe 2ZIMA 2DTOA 4CH3A 1E1TA 4QVCA 4P3OA 1KOGA 4EMGA 4M75E 3QUIA 3L1AA 4Y91A 3QHSA 2RHQA 4LNSA 5ELNA 3RACA 4CS2A 4M7DG 4YDQA 4JUVA 3JCMc 1U1SA 3VQXA 1H4SA 3HXUA 3MEYA 1EVKA 3RUXA 3BW1A 5C52B 2CJ9A 4YP0A 4PJOA 1HK9A 3A7AA 1PYSA 4CH6A 2VXFA 3RL6A 3RF1A 4CS3A 2Q5HA 2E65A 3HXWA 1NJ8A 5GMKe 1TH7A 4M75A 3ERRA 2E41A 3FIFA 4M78E 3RIRA 2AMCB 1SESA 3KFUA 11ASA 2DKGA 3MF1A 4P71C 2AKWB 2RA2A 3HXYA 1Y96B 4EO4A 1X55A 5KNNA 2VC8A 4J6YA 4H2YA 4YRLA 4M7AC 2EJFA 3MF2A 4C8QF 3QO3A 3JB9F 2RHQB 5GAMh 1I4K1 5LJ3j 3V8LA 4H2WA 3HFNA 4M78A 3IKMB 2ZIOA 2ZT8A 3UFGA 2DZCA 4HWRA 5HGQA 5LJ5g 4HT9A 3A7RA 3JCMf 5GAN5 1SRYA 5C53B 3JCMX 1LOJA 4RDXA 4H2SA 12ASA 2DDZA 1Z7NA 4RCBA 1NJ5A 4G85A 1B7YA 3UH0A 2ZR2A 4M7DA 3RESA 2I4OA 4NCXA 4YYEA 3JCMb 4ZIBA 4P72C 4G84A 3HRIA 4PJOF 2HNIA 3JB9H 5LJ3e 4H2TA 4BWAA 3V7RA 4XU2A 3I7FA 2ZT6A 4K88A 2EWNA 4M75F 1E22A 3G1ZA 1LYLA 2QTXA 1ADJA 2ALYA 1KQ2A 1YB3A 5K1XA 3IG2A 4AH6A 3JCMP 4YRGA 3JB9I 2ZR3A 2XTIA 4CH5A 3JB9J 4L87A 1JJCA 4P75A 2J3MA 4ZTZB 2DQ0A 5K1PA 2FYKA 4OP0A 4X9DA 4M7DB 4M77D 3REXA 4JLIA 2E1HA 4TVYA 2RD1A 3TUPA 1ADYA 4WI1A 2Q7EA 3BY7A 2CJBA 3V8JA 3IALA 4YRTA 1SETA 4C8QA 4TWAA 4V2SA 1WQ7A 4P73C 4XTZA 2DU5A 4YPFA 3SWNB 2DEQA 3NEMA 2ALYB 3VQVA 2JN0A 1NJ6A 3UGTA 4YRPA 1C0AA 4C92D 4F7UG 1NNHA 3INZA 3L2ZA 5LJ3f 4XEMA 3A31A 2G4CA 3M4GA 1RIQA 3SB2A 4WJ4A 4C92B 3VBBA 3PGGA 3LSSA 1YFTA 3BJUA 1NYRA 3RKXA 4J15A 4XTUA 4N0AA 2YHTA 1JBMA 1G5HA 1EFWA 2Q7GA 1E1OA 4PG3A 4TVAA 2CJAA 1B70A 4NL2A 1GGMA 4UP8A 1ASZA 4X9CA 5GAOq 3JB9D 3W3SA 4P3PA 2YLCA 5GAMd 3P8TA 4XTXA 2DQ3A 1EVLA 4C8QB 4EMKB 4M77C 2DTIA 3BFMA 2IY5B 4M7AF 2EJ9A 1WLEA 4TTVA 3NELA 4HWTA 4F7UE 3P8VA 3AHUA 4M77G 3SWNC 3VU3C 1WNLA 1NJ1A 3DSQA 1VQZA 4XU3A 5GAN2 1BBWA 3TEHB 4A54A 2I4NA 5LJ5h 4J5YA 2ZINA 2CIMA 2ZT5A 4XU0A 2QHTA 3QO5A 4MMLA 5C51B 3A32A 3HSBA 4M7AG 4PJOD 5GAN4 4H2XA 2J3LA 2ZZEA 4C92C 2RHSA 3UGQA 1LJOA 4TVAB 4PJOB 5LJ3g 1B70B 3L4GA 2DXUA 4ZTUB 4KQEA 1PYSB 4M75D 1EOVA 4K87A 1X54A 3BDUA 2ARSA 2VXEA 2ODRD 5GAN7 4P74A 3A5YA 1BBUA 1ATIA 1N9SA 1USYC 4M75B 4EX5A 1WQWA 4DPGA 4M77E 1Z7MA 4RMFA 3LSQA 3NENA 4X5OA 1MGQA 4YRMA 5GAMj 4EMKC 2E10A 5GANd 2ZNJA 1EQRA 4HWPA 3HRKA 2DTHA
chains in the Genus database with same CATH superfamily
2AZVA 4LUEA 1YFSA 3A8HB 5HK3A 2FZGB 4YRNA 1F1BB 1R0CB 4IKFA 2DXTA 2C06A 3OYGA 3FC3A 3QTCA 2EQKA 4DQ2A 1EZZB 2QQRA 2CP3A 2LQWA 3OSVA 2MIOA 1JXOA 5FW9A 1KMNA 4P71A 2KQWA 1UECA 4XTWA 2O9SA 2LDMA 1OZ2A 2RI3A 2Y4XA 3CBMA 2RHUA 2CSIA 2ZZGA 1X6OA 2ZTGA 3JCMg 3HFZA 3QPHA 1X01A 4F7UF 4M75C 2ODRC 4LDVA 4FT4A 2F5KA 2V8JA 4YRJA 3G7ZA 2R5MA 3OW2S 1H641 2A0FB 3C0CA 1TSFA 2BTTA 2FB7A 5GANj 1UE9A 2DYIA 2QI2A 5DY9A 2FVUA 1RAIB 1VQ5Q 1NYQA 4MMKA 1RLQC 5KYXB 4EMHA 3EFOA 3EFSA 1JJCB 2YUNA 1VQ5T 2XHCA 4M78C 2QA4Q 2K9GA 2IG0A 1K9MC 1T3LA 3VQWA 5GMKm 1JJ2A 2HBPA 2QA4T 2ZXFA 3GOXA 1JRIA 4KH1B 3CD6Q 2RJCA 1GCQA 1YHQQ 2RJDA 3CC7Q 2KYBA 1LPLA 3CD6T 4O5VA 2EGEA 4J6XA 1RAAB 5KCOA 1YHQT 5GAMf 1M5Q1 3CC7T 1OX8A 2EQJA 4QKUA 3M5AA 2YUOA 2FHDA 4BE0A 4TQFA 1Y57A 4C5IA 4JZ4A 2QGFB 2PVOB 4QVDA 5E3IA 1G8XA 3I5SA 2KT8A 1CSKA 3HXZA 4C92F 5DLQE 1K0SA 5I11A 3OD1A 2EYYA 3OYBA 3L2UA 1LNXA 2M02A 5CAIA 2ARTA 2VUBA 4L59A 2RHIA 3HHTB 4OMQA 3CC4A 4R0KA 1I0CA 4P75C 1OX9A 3HRSA 4CS4A 2DF6A 3QWYA 4HWOA 3HTZA 1KC8C 1X75C 5J3BA 5CQYA 3PMTA 4M7DE 4KRTA 1PKSA 1SERA 4YRSA 1OI1A 3JCMW 3G4SQ 2D1XA 4YRQA 3FB9A 3P8YA 4C8QC 3G4ST 5IXFA 2P4TA 2AKLA 5GMKl 3E9IA 1EIYA 3L42A 2LT4A 1HXDA 1VIFA 1HC7A 2XU8A 2QG9B 2XGTA 1ABOA 3RR6A 1OU9A 2A8EA 2BKDN 1YGBA 3OW2A 9ATCB 2IIMA 3BE3A 3MHXA 2EKHA 3VKIA 2X51A 2W0ZA 2RQTA 3JCMh 4QT7A 3LX7A 1W2BS 2KXDA 5GAOp 5L23A 3LWHA 5F5WA 4WJ3M 4PKCC 1K0XA 2DEUA 4NS5A 1C1AA 2QASA 2RF0A 3VS3A 3PNWC 5IH2A 4C5HA 2DBKA 4BACA 3I5RA 2DZ9A 2R57A 4L6V5 1WHKA 4M75G 3EHQA 4YROA 3QO7A 4FT2A 2J05A 1WI7A 4JRIA 1Q82C 2D0NA 1GFDA 4E7KA 3RGLA 3E9HA 1YWPA 5CKDA 5GANg 4M77B 1SEMA 1QVPA 2COWA 3IQLA 2NWMA 5D6YA 1UGSB 3GNGA 2A3LA 3PIOA 3QYHB 4M7AB 4M78G 1X43A 1NLOC 5LJ3d 4MZTA 4P74C 2YRCA 4XTVA 2A7YA 2ZIMA 2DTOA 3OYAA 4CH3A 1YJ9Q 1WYXA 4DEYA 1NEBA 1E1TA 4M75E 3RACA 1FYNA 2NLUA 3I56T 1N8RR 4JRPA 1YJ9T 3VQXA 1UB4A 2OTLA 4LDYA 3HPWA 2RO0A 1EVKA 2KNBB 5KYUB 2P0PA 1S72A 3GBQA 4E6RA 5C0MA 3OMCA 4EDUA 1TTHB 1RUWA 3PMIA 1M3AA 1SHGA 2E65A 3E9GA 1AWWA 2F2XA 1VQ8Q 1XNIA 4DOWA 3ERRA 4M78E 3OYDA 4LDWA 4A4GA 2EGCA 4J7FA 1VQ8T 2DKGA 4F04B 4P71C 2KVQG 1Y96B 2ATCB 2M0YA 2KRNA 4OVAA 4J6YA 1XJWB 2ED0A 4YRLA 4OMOA 2QAZA 2L3PA 1N8RU 3LH5A 2QQ9A 4AFQC 1SF9A 5KYYB 2LX9A 1VQ9Q 1QCNA 4UC4A 4HT9A 2JUFA 3JCMf 1SRYA 1LOJA 3CMEQ 4RCBA 1IGQA 3QJ6A 2LCCA 4M7DA 3MEUA 1TOVA 1WA7A 4NCXA 3CMET 4YYEA 4JJDA 3P8HA 1K73C 1IRXA 2M0OA 3QBYA 4XAXB 3M55A 2DAQA 5LJ3e 1ZBXA 1B3QA 4KT0E 1TUGB 2BIVA 2EWNA 2JOYA 1GCQC 2V26A 2QTXA 3EG9B 3ZBDA 3OB9A 5A0LA 2RQRA 4E7IA 3H41A 3ZFJA 4AH6A 2HQEA 5CKHA 2NYSA 1JJCA 4PJLA 2MK5A 2ZPFB 5FU6C 2CUDA 4MDWA 4J9DA 3DB4A 3QKJA 1SSFA 2LCSA 3GP8A 3CCUQ 2FYKA 4OP0A 2A08A 3M58A 4HXJA 1Y0MA 3CCUT 3CD6A 5L8RE 1BI2A 3M53A 1YHQA 2MMPA 3CC7A 2AIRB 2CJBA 5D7UA 3EG0A 4LNPA 2O4XA 3A8GB 3CPWP 1M3CA 1WQ7A 3GNFB 3KBGA 3TU4K 4HCZA 1NJ6A 1C0AA 3EGUA 1NG2A 2XKOC 1V76A 4F7UG 3INZA 1ABQA 1OZ3A 3A31A 3OYNA 1X2QA 3SB2A 4C92B 3X25B 1U8RA 4QQGA 2DD4A 1QWEA 3UT1A 4E7LA 1IZ6A 4N0AA 1LVKA 7AT1B 1B70A 1GGMA 2J6FA 2A37A 3VYGA 2QDYB 4UP8A 4X9CA 1M2VB 5GAMd 1YJNQ 3NPFA 4XTXA 5FROA 1VYUA 2DQ3A 3G4SA 3QYGB 2BUDA 1YJNT 4C0DC 3WXMB 2GTJA 2EJ9A 4E47A 2CT4A 4F7UE 3P8VA 1MNEA 1WNLA 1CKAA 2LNVA 4A54A 2I4NA 1MV3A 3LGLA 3T9NA 2LJ1A 1YI2Q 2JM8A 4XU0A 2QHTA 1BI3A 5I22A 5C51B 3A8OB 3A32A 4OMMA 1YI2T 2L3SA 4OMFB 1K8AR 1KD1R 4PJOB 4YTLA 1KHCA 1FMKA 3CMAA 1PYSB 5CKBA 4M75D 2JW4A 2PUKB 3BDUA 2ODRD 1GRIA 2COYA 4LD6A 2PU9B 3ME9A 3CPFA 1ATIA 3UA7A 1WHHA 3H9NA 2YRVA 1QMCA 3LSQA 3NENA 1X27A 2M9UA 4YRMA 2VV5A 2YDLA 1PCXA 3OQ5A 4J9EA 3C12A 2DTHA 4JZ3A 4WF2A 4M78D 1IREB 5GAOl 3UF4A 1JXMA 2L3RA 1B76A 3HY0A 1TWBA 2AK5A 1Y7XA 4H2XB 2H8HA 1BIAA 1K8AU 1KD1U 3QDFA 2RHSB 1SKUB 3I35A 1H4QA 4A53A 2L5QA 3KFVA 1G5IA 1KK7A 2OTJQ 2FRWA 3HL8A 1K9AA 2FL7A 1JU5C 2RHZA 5GAMe 1VQLQ 4LVMA 2RJEA 4RTYA 1O75A 3OMGA 1B7YB 1WYDA 2OTJT 1VQPQ 4M7AA 4BI4A 3FLGA 1X69A 1VQLT 2W10A 3HRTA 4J9IA 1VQPT 4IUPA 4XU1A 3I56A 1VQOQ 2O2OA 1VIEA 1KSWA 2CH4W 1YJ9A 4KR3A 2CUBA 5A2QE 1Q81R 4QQ6A 1ZA2B 2FRYA 3VRYA 1VQOT 4ZGEB 2IVWA 3ICAA 3A5ZA 4E2FB 4TQDA 2PTKA 3CCVQ 2HQHA 1PG5B 3VS2A 3VQYA 2EQIA 5KYUA 1D3BB 3THKA 3VRZA 2DIGA 2I4MA 3M4PA 3CCVT 2YRDA 3M0UA 4KUIA 2GFAA 1WJSA 5KCHA 3G71Q 1QLYA 2K3YA 1PD1A 1VQ8A 1D1AA 1WHJA 1TUDA 3G71T 4HT8A 1CKBA 1M2OA 3JCMV 2QQSA 2QHSA 2LCLA 3PTAA 1Y96A 4P3NA 4RKUE 3QO8A 3V7CA 4Q6GA 4C8QD 1WLPB 4M77F 4M7DC 1QW1A 1ACMB 4RQEA 2HSEB 2RHXA 1W4SA 4YRCA 2FO0A 1Q81U 4YRIA 2C0OA 1BCOA 3M4QA 4C0FA 4JDSA 1V29B 2M1HA 2EJGA 4BDYA 1YITQ 2KMTA 2RI5A 4KGXB 2E3CA 1B34B 1YITT 3EGXB 2PQWA 1VQ7Q 4E7ZA 2MYSA 2RM4A 1YFNA 4BD3A 3GIBA 2DU7A 1VQ7T 4J7IA 4ORZA 2E3HA 4AFUC 2PVDB 1ZHIA 1GXIE 4J83A 1OQKA 1QVFP 1U1TA 4F7UA 4J9FA 2KRSA 4BB7A 1M90C 1NEGA 4YCWA 3CEYA 4WTOB 3CCJQ 1YJWQ 1X6GA 1UGQB 1B07A 4PJJA 3JCMd 1E24A 3CCJT 1YJWT 2HMAA 1X6BA 3S3NA 2ZCEA 1BYMA 5GAN6 4ZTJA 1MMGA 2YUQA 3CCUA 2VGMA 4CRIA 1G3SA 3QJYA 3TEEA 4XEOA 5J39A 1N9RA 1WFWA 4E7JA 1NJ2A 4LDXA 2CZ1B 1RACB 2A28A 1X2HA 1T3SA 3M56A 1V1CA 4YREA 3RDVA 3MJXA 2M16A 3CXCS 4PK4A 1PD0A 4N0AC 3LH0A 3LC0A 2Q5IA 2J6KA 1UDLA 3E19A 5IXBA 2GF7A 1EFNA 3A8MB 2X35A 3MCAB 2O9VA 2LJ0A 4JS5A 3PT9A 4YRFA 4Q15A 1I07A 3HKSA 2LMJA 3VV0A 1YN8A 2E5QA 4C92A 4HWSA 2ARUA 2I2LA 3UATA 3PVQA 5HKCA 1AZEA 5GMKh 1SSHA 4FIBA 2RB6A 2HD0A 4JRQA 3JCMQ 2PNIA 3PVLA 1G3YA 2BZ8A 1M2VA 4FU6A 3REUA 1YJNA 1USYA 3OA6A 1QKXA 3PCOB 1Y07A 1R8OB 2AMCA 1E7OA 1ZUKA 1H4TA 4OGCA 4AFSC 1KQSA 2E70A 4PLIA 2P4RA 4ZNXA 2KE9A 5LJ5f 2D6FA 1W66A 3META 3S6WA 1B8AA 3JCMe 1PKTA 4QVCA 4EMGA 1NJIR 5KYWA 3QUIA 2RHQA 1YI2A 1UEBA 2K7AA 3ASKA 4M7DG 3S3OA 2FEIA 4RTTA 4PJOA 2BZXA 2F69A 3S3MA 2VASA 1PYSA 4CH6A 1UHCA 3RL6A 4CS3A 4BY6C 1U3OA 3L2WA 2Q5HA 1ZSGA 2MCNA 1XQHA 1MNDA 3HXWA 4JPBW 1T0HA 3TVTA 4AT1B 1NJ8A 2PZ1A 2E41A 1FXXA 3RIRA 1K8AC 2MWPA 4JJCA 4R55A 3MF1A 2AKWB 2RA2A 3HXYA 1M3BA 2JZ2A 2ZPEB 2LP5A 3SDZA 4M7AC 1K76A 1M1KC 3MF2A 1NJIU 2ZPHB 3JB9F 3A98A 4OMNA 2QXFA 3CXCA 1WJRA 2K79A 5LJ3j 3V8LA 4H2WA 2DO3A 2ZIOA 3UFGA 2DZCA 3A7RA 2X3XD 4RTWA 2QQBA 4RDXA 12ASA 2F2VA 3R6OA 2OTJA 1EX4A 1VQLA 4PLLA 1B7YA 4HT4A 1BK2A 3RESA 1VQPA 4Z88A 2Z0WA 3JCMb 1Q7YR 3J7AF 4G84A 4HVWA 4PJOF 1VQOA 2RMOA 4IIMA 3R6NA 3M9QA 3VUZA 3JB9H 1IHWA 2JS2A 1ZSZB 2E3IA 1WX6A 1VUBA 4BWAA 3I7FA 1OYXA 2ROLA 2V1QA 3CCVA 1LYLA 2V8KA 2XD0A 2KXCA 2LX7A 1KQ2A 5K1XA 3ULRB 4X34A 1JQQA 3IG2A 4OB1B 1P92A 1QKWA 2XTIA 3G71A 2BE9B 4AFZC 1BI1A 2NUTB 1GBRA 2J3MA 4QW2A 2EW3A 4X9DA 3OS1A 1Q7YU 3REXA 2E1HA 1D1CA 4TVYA 3TUPA 2LTOA 2GQVA 2DVJA 3UWNA 3BY7A 1PM3A 4D8KA 3V8JA 3A1PA 3IALA 1SETA 4GY5A 4YRTA 3PE0A 4TWAA 4GLKA 1SRLA 3FJ5A 4V2SA 1MMNA 4ZGDB 3SWNB 3EH2A 1YITA 3AT1B 2DEQA 4CC7A 2CP0A 2ALYB 3VQVA 1VQNQ 4RTXA 4YRPA 4QVZA 3A8LB 2J7IA 2KBTA 1GCPA 2ZZDA 3CCEQ 3L2RA 1VQ7A 3EGDB 4XEMA 1VQNT 4F16A 1RADB 2G4CA 3M4GA 2GNCA 4WJ4A 4Y92A 3PGGA 1MMAA 2EYXA 2XIDA 1YFTA 3BJUA 1BU1A 1E6GA 4J9GA 1NYRA 3ZEHA 1R77A 4ELZC 2YHTA 1JBMA 5HY6A 1RAHB 2Q7GA 2CS7A 2CJAA 1JJ2P 2EFIA 1ASZA 3W3SA 4P3PA 2YLCA 2HL3A 2HKNA 1D0YA 3P8TA 1X2KA 1AT1B 1JO8A 5IHNA 3G1JA 4C8QB 2CP7A 3CCJA 1O9SA 4EMKB 1YJWA 1YNZA 4HCCA 5GJVB 1WLEA 4TTVA 4OF1A 2KROA 2KY9A 2DIQA 3OYJA 4M77G 1VQZA 4XU3A 5GAN2 1BBWA 3TEHB 4OMPA 4BE2A 2ZINA 1PSFA 2CIMA 3HP9A 2RN8A 3QO5A 4MMLA 2PVGB 3EHRA 1WIEA 3Q1JA 4M7AG 4RG2A 1W2BA 1FMWA 1S1NA 3FDRA 4C92C 3LW5E 3H0IA 2L89A 3UGQA 4TVAB 5LJ3g 2DXUA 5FU7B 4ZTUB 1VQ9T 1VA7A 4KQEA 1EOVA 4K87A 1KJWA 4B6MA 1FMVA 3QDRB 2ROTA 3CCLQ 1VYVA 1USYC 1WQWA 5IHKA 4M77E 4Z02A 3MO8A 1MGQA 3CCLT 5GAMj 2HZYA 2XG8D 5LL6S 3M59A 4FYWB 2MWOA 4M7AE 4A4EA 3FEOA 1VQ5A 1L0WA 3H6ZA 5KYXA 3MEAA 4LN2A 1KMMA 3OW2P 1SHFA 2CZ6B 2XK0A 4M7DD 2K6DA 4CC3A 3OYMA 2COZA 1VQ4Q 5KE2A 2QA4A 4O2DA 2X3WD 2LQ8A 5GANh 3C95A 4YRRA 2F1LA 1D09B 2R5AA 2DXCA 4PJOC 4Z8AA 3QZ5B 2P0LA 1VQ6Q 3N5BB 1VQ4T 2RH2A 2XI9A 1T0JA 3MEVA 1QE0A 3MKDA 3DB3A 1VQ6T 2EBPA 2J06A 3SFMA 1OOTA 4J9HA 4R56A 2X4YA 4RQFA 2E6NA 4LDUA 1H4VB 2DE0X 1YP5A 4D8DA 2X4WA 3IKLA 1NM7A 3OBYA 1ZLMA 2LZ6B 1PRLC 3NETA 1PC0A 4LUDA 4TVRA 3QNEA 2YLBA 2ZPGB 4H2VA 4P72A 2ZPIB 2Y90A 4EPCA 2ABLA 2DILA 4N4IA 4LXCA 3OY9A 4HA8A 3I9QA 3NFCA 3FJPA 1AZGB 4J9CA 3GPLA 2AKWA 2YXYA 5LJ5d 2DMOA 1R0BG 4H02A 1VQKQ 5GAOm 3CCMQ 3HXVA 1I8FA 3VS7A 1BI0A 1TG0A 1VOMA 1VQKT 2QYZA 3CCMT 3UA6A 1ZQ1A 3X24B 2DJZA 1WXBA 5I2SA 1G3TA 2DVEA 2EAYA 2BZYA 5HK0A 3CMQA 2HQXA 3L2QA 1QWFA 2CDTA 1YIJQ 1RABB 1RI0A 3EFOB 3TQ7P 5LJ3h 4PJMA 4FW1A 3VJPA 3OS0A 4YCUA 1YIJT 1K1ZA 2ZAEA 1GBQA 2EVRA 4JRKA 3CQTA 4OLFA 5A0GA 4P73A 3RKYA 1LCKA 3HFOA 1ZSZA 4E51A 4UP7A 2QTVA 4C92G 3E9FA 1N9WA 2B86A 5GAOn 1NPPA 4FW2A 1Q86R 1IXDA 2OI3A 2DLPA 2HL5C 3NMZC 2HCKA 2QHVA 1ZX6A 5FU6B 1X2GA 2DXBA 5GANf 1YFRA 3RKWA 5GAMg 3JB9G 1ARKA 1KC8R 2K5FA 4BUGA 2FZCB 1WPYA 3WQZA 2QK0A 5CKEA 2X4XA 4XQ3A 3CC2Q 4XK8E 4IUVA 3OYKA 3RERA 4M77A 4C92E 2MF2A 3CC2T 1Z9QA 5LJ5e 4B9WA 1WU7A 3QSUA 3L4GB 4IURA 4MZPA 2RJFA 1Q86U 1MUZA 3SWNA 5CCAA 1SRMA 2CP2A 4BW9A 1VQNA 2PMFA 2D8JA 4JJBA 2YWWA 4PJOG 2I4LA 2ZZFA 1J5WA 2ZPBB 3NTHA 3HFVA 2DNUA 3R07A 4LD9K 1UJYA 4JJNK 1KC8U 1EIYB 1BIBA 4H2UA 1M27C 3DKMA 2OAUA 1KFZA 4NOYA 3M54A 4M78F 2JMAA 2ED1A 2MPXC 8ATCB 1IL2A 4XTYA 1N8RC 2B8AA 2GBQA 4NL3A 2JS0A 4M7AD 4EMKA 4N4HA 5I2MA 1I81A 1IB8A 3FRNA 2Y4YA 4PJOE 4C5GA 3A7UA 4K86A 4K11A 1G5VA 2KRMA 1Q82R 1UUEA 1HYOA 2F2WA 2CP6A 2KDSA 3TEHA 4P3OA 3O5ZA 3L1AA 1N27A 4LNSA 5KYYA 4KBMB 1U1SA 4A4FA 3JSCA 1IO6A 2P0QA 3HXUA 3MEYA 3RUXA 2DX1A 4DBFA 1VQ9A 5CKFA 5C52B 2K3XA 1HK9A 1AOJA 3OYEA 3MP8A 3CCRQ 3JV3A 2VXFA 4KH0B 3CMEA 3QZ9B 2GFUA 2JT4A 2VGNA 3CCRT 5GMKe 3CCLA 2QEXQ 1TH7A 2R58A 3M0QA 4OB2B 1RLPC 1SESA 3KFUA 11ASA 4FSSA 2LNHB 2QEXT 1M1FA 2CZ0B 1NPRA 1Q82U 1X55A 1OPLA 5CK9A 2VC8A 3QG1A 1Q95G 4HKEA 4C8QF 2EPDA 2EKOA 2DETA 3EG9A 3MP6A 1QVGP 1QP2A 4J8OA 2DERA 5GAMh 1RAGB 2EYZA 3M57A 2PUOB 3VS0A 1HD3A 3QIIA 2GTOA 2ZT8A 5HGQA 4HWRA 4OB3B 2P0KA 5GAN5 5C53B 3JCMX 3OYLA 2C0IA 1VQ4A 2DDZA 1Z7NA 1NJ5A 4G85A 1H3ZA 2ZR2A 1VQ6A 2L8DA 2I4OA 4ZIBA 1MMDA 4P72C 1ZUUA 3EAEA 4FYVB 3HRIA 1UGVA 4JLGA 3TCJA 1W1FA 2AKKA 1U5SA 3C4SA 2H3JA 4H2TA 3M0PA 2BE7D 4L5GA 2H3EB 2ZT6A 2MOXA 3REAB 3C94A 4F14A 2L0AA 1E22A 3G1ZA 5HCKA 1WHMA 2DL7A 2E5KA 2KGTA 1K73R 3X28B 2K5LA 3JB9I 2HAXA 2ZR3A 5D6WA 1HSQA 4CH5A 3JB9J 4ZN1A 3H0FA 2WSEE 4ZTZB 2DQ0A 4PFOA 2DL3A 2RQVA 3GF5A 4IUQA 3UPUA 4ESRA 2NUPB 4RMOA 3RBBB 2IPOB 4M7DB 1OEBA 4JLIA 2VWFA 2RD1A 1VQKA 1ADYA 2D8HA 3CCMA 4WI1A 2Q7EA 2M51A 1BKBA 1C6VX 3OYCA 1NBEB 2RI2A 4P73C 3MQZA 2RK2A 1UTIA 2DU5A 3GLXA 4YPFA 2JVVA 1ZSZC 3OS5A 4MZMA 4RG8A 2SRCA 4Z89A 1NLPC 1K73U 1WHLA 4HVVA 4C92D 1NNHA 3L2ZA 2DK3A 3MPUB 1YIJA 4ZGJB 3SD4A 1GL5A 2CH4A 3DLMA 2NUZA 4FYYB 4OMLA 2LC4A 2P84A 5EG2A 2VYTA 1MHNA 4CC2A 3CPWS 1AWJA 3ZL7C 4DEXA 3TSZA 1YCSB 4PG3A 4DOVA 4FSXA 4A63B 4HVUA 4M4ZA 3JB9D 2DPPB 4IUTA 2LVMA 3E1SA 2O4XB 1XTDA 1KG1A 2RK1A 2EIFA 4M77C 2HKQB 1KD1C 2DTIA 3BFMA 2EGAA 1A0NB 2IY5B 2CSQA 3NELA 3EG3A 2O01E 4HWTA 3CCQQ 4BI8B 3AHUA 1D0XA 3SWNC 3VU3C 2EQUA 3DSQA 1QCOA 3VUBA 3URGA 2XDDA 1Q86C 2YT6A 3CCQT 2D9TA 4J5YA 2ZT5A 1VYTA 1D0ZA 4LE9A 2ENMA 3HSBA 5A0DA 4PJOD 4H2XA 3CC2A 1KIKA 3LLRA 5AT1B 3PFSA 5FRMA 2I0NA 2ZZEA 4E7HA 1NZ9A 2RHSA 1WDXA 3OYHA 5DM7R 1B70B 3L4GA 2X9HA 1X54A 2VXEA 2WSCE 5GAN7 1PSEA 3A5YA 1AHJB 2EQMA 1BBUA 1N9SA 2CT3A 2CP5A 4M75B 3OYIA 1HJDA 4EX5A 2GCXA 2KK4A 3OSSC 1Z7MA 4X5OA 4EMKC 5GANd 2E12A 4J9BA 2ZNJA 1UHFA 2RQWA 4ANJA 2JXBA 3HRKA 4ZTFA 4Y28E 2CREA 2DRMA 4QQDA 2QHUA 1FX7A 1WXTA 2SEMA 3VS4A 2ZGWA 4YCVA 1D3BA 1M8MA 3O8VA 2PMEA 3CBPA 1ASYA 4HCKA 1E6HA 2K57A 3HXXA 2D0QB 4M78B 1PWTA 2NS6A 1Q81C 2E5AA 4ATOA 4DBRA 3H8ZA 1KHIA 4FL6A 1BBZA 2L2PA 3CMAQ 1QF6A 2XDPA 5GAOr 2EL9A 4D6WA 3DLLA 5FU7C 3LWIA 2KYMA 3CMAT 5AYFA 1D1BA 2VB6A 3TEGA 3CPWA 2Q7HA 1M4ZA 1PNJA 4CI0C 1M30A 5GAN3 2ZNIA 1YCYA 2OX7A 2ZT7A 2DJQA 4BDZA 2VVKA 2A36A 3CCSQ 3X26B 4BY6B 3HY1A 1B34A 1M8VA 1RL2A 3EGXA 3CCRA 4J6WA 3QWXX 1I5OB 3CCST 3NHNA 1EIFA 3RMQA 3P8DA 4GLMA 3VS5A 3CCET 1QCFA 2ESWA 2FZKB 2QEXA 1OV3A 4UPAA 1Y71A 4C5EA 2CGHA 1FYFA 3I55Q 5DLOA 1OPKA 2F5TX 1KQSP 4C0GA 2JTFA 3JAME 2GQIA 3QXEB 3I55T 3I56Q 2LQNA 3V8KA 5GAN8 2FPFA 5GANe 5ECAA 4OB0B 1U06A 4UP9A 1ZA1B 3A5ZB 2DYBA 1N5ZA 1KQ1A 2LRQA 3J80E 2JTEA 2CYZB 4KR2A 8AT1B 4PFPA 2HEQA 1VQMQ 2OJ2A 3PZCA 2XICA 4YRKA 4O6JA 3PIPA 2FG0A 3OS2A 3M4YA 5FWBA 3ER0A 3SHWA 2K2MA 2OAWA 1VQMT 1UGPB 2DBMA 2C8MA 2QDLA 2G6FX 2YSQA 3J81E 4IIOA 3M0RA 1IHVA 2LJ3A 1W6XA 4ELYC 4IUUA 2DRKA 3JCMJ 1AD5A 3VYHB 4EIKA 2FPDA 5LJ5j 5KYNA 3F70A 3V7SA 3CXCP 5EC7A 2KAFA 2C7IA 1WXUA 2P5IA 4RUGA 1TU0B 4TVWA 4LVKA 3H0HA 4FYXB 2K2VA 1HTTA 1QVFS 4C8QG 4N4GA 2C0TA 4PJNA 1M90R 2NUPA 1I5LA 1M1GA 1AEYA 4PHCA 1H8KA 5ELOA 1QVGS 2WSFE 2E64A 3G6EQ 1UGRB 2X4JA 1QQJA 1UFFA 4F7UB 3PCOA 1M9SA 4RTVA 3G6ET 1Z9ZA 3REBB 1X56A 4RCCA 1G51A 3A74A 3TREA 2G3RA 2AHJB 4KGVB 2K4YA 4C8QE 1G83A 1M90U 2RNAA 2J6OA 1G3WA 3RMSA 1NYFA 3VS6A 2O88A 2KT1A 1NJIC 2EYWA 1C0MA 5FLXE 4PNOA 2JM9A 5CVIA 4DA4A 1J3TA 5C6SA 4C0ZA 4MDXA 1JEGA 2V1RA 4M7DF 4KGZB 2IY5A 4CH4A 5GMKi 3EG2A 1WGSA 3EFRA 5GMKj 3CCQA 1FWZA 4JS4A 5I21A 4WCIA 3HFZB 4HVCA 6AT1B 1KOGA 5CQXA 4Y91A 5ELNA 3QHSA 1BCMA 4CS2A 4YDQA 1SPKA 4LVJA 4JUVA 2KSSA 3JCMc 2XDBA 1H4SA 1XOVA 1K9MR 3LGFA 2ECZA 3BW1A 2CJ9A 4AG1C 4YP0A 2V8IA 1NYGA 1N6AA 3KXTA 3A7AA 4VUBA 4A4HA 3RF1A 2LQKA 5KE3A 2JMCA 3BDLA 4II1A 4X1VA 4M75A 3FIFA 3D7SB 2AMCB 5CR2A 1QVFA 4ME7A 1RAFB 3OBWA 4EO4A 2L3QA 4KULA 5KNNA 1BB9A 4PFZA 1TS9A 2ZCFB 4H2YA 2AZSA 4P5NA 4AG2C 2EJFA 1QVGA 4KUDK 1OULA 3QO3A 1Q7YC 2KI7A 1K4US 5KYWB 2RHQB 2K3BA 3UDCA 1QP3A 1I4K1 1K9MU 1ZUYA 2CKKA 3HFNA 2WACA 1AWXA 4BE1A 3JRZA 4M78A 3IKMB 4RTUA 1W2BP 5LJ5g 2DA9A 1AWOA 2NUTA 4DBHA 4H2SA 3U23A 1SG5A 3NGPA 1JB0E 4E7SA 3UH0A 2JJ9A 4RTZA 1M1KR 2YUPA 3M0TA 1B7TA 3MEWA 3CC4Q 1WJQA 3SEMA 4B9XA 2HNIA 2DL8A 1RAEB 3LYIA 1WZOA 3CC4T 3WVEB 3RNJA 3V7RA 4XU2A 4FCYA 4K88A 2E6ZA 4M75F 1I1JA 1ADJA 4AMCA 4A4KA 2ALYA 4BI3A 3CCSA 1H92A 1YB3A 5CIUA 5IT9E 3EGDA 3CCEA 3JCMP 4YRGA 2JTMA 2XMFA 4ZN3A 3OYYA 4L87A 3WVDB 4P75A 3M0SA 5FRNA 2DL5A 4OGEA 5K1PA 1UG1A 1M1KU 3EG1A 2HDAA 3I55A 4M77D 2HSPA 4LVLA 5CO7A 3VS1A 4C0DB 2QQAA 4HCBA 3EH1A 1WHGA 5GJWB 4GBQA 4C8QA 1RI9A 2MAMA 3E2UA 2AT1B 4XTZA 5D6XA 2QGGA 3MP1A 2E4HA 2KR3A 3NEMA 1W70A 2JN0A 3UGTA 5IN1A 3OYFA 1OU8A 1GFCA 2K5IA 3NTIA 1AVZC 5LJ3f 2RPNA 1RIQA 2RHYA 4LVIA 4PL6A 1H3HA 2VKNA 3VBBA 1VQMA 3LSSA 4FM4B 3RKXA 4J15A 4XTUA 4Q5WA 1PHTA 1G5HA 1EFWA 1E1OA 4TVAA 2JNGA 4NL2A 4CC4B 2HBWA 5GAOq 3HRUA 2LT1A 3L2VA 2RQUA 1EVLA 1IGUA 2MI6A 1DJ7B 4M7AF 1TUCA 2KEAA 3KUFA 1UJ0A 1G2BA 5IHIA 1NJ1A 2O31A 5KH6A 5LJ5h 1KQSS 1JJ2S 5IAYA 3P8BB 2EYQA 3HTRA 2DL4A 2GGRA 3X20B 2DFUA 2DM1A 5GAN4 2OTLQ 2J3LA 1TXQA 4DBQA 5M9OA 1LJOA 3G6EA 1S72Q 1MV0B 2OTLT 2DD5A 1PRMC 4F17A 1S72T 2ARSA 4P74A 1YBYA 2FPEA 5J26A 5FWCA 1ZBJA 4DPGA 3CBOA 3NTKA 4RMFA 1NE8A 2E10A 1EQRA 2CZ7B 4HWPA 3TSWA 1YWOA
chains in the Genus database with same CATH topology
1YFSA 3A8HB 5HK3A 4YRNA 4IKFA 2DXTA 2C06A 3OYGA 3FC3A 3QTCA 2EQKA 4DQ2A 2QQRA 3OSVA 1KMNA 4P71A 2KQWA 4XTWA 2LDMA 1OZ2A 2RI3A 2Y4XA 3CBMA 2RHUA 2ZZGA 1X6OA 2ZTGA 3JCMg 3HFZA 3QPHA 1X01A 4F7UF 4M75C 2ODRC 4LDVA 4FT4A 2F5KA 2V8JA 4YRJA 3G7ZA 2R5MA 3OW2S 1H641 5GANj 2FB7A 2QI2A 5DY9A 2FVUA 1NYQA 4MMKA 4EMHA 3EFSA 1JJCB 1VQ5T 2XHCA 4M78C 2IG0A 1K9MC 3VQWA 5GMKm 1JJ2A 2HBPA 2ZXFA 2QA4T 3GOXA 1JRIA 2RJCA 2RJDA 3CD6T 4O5VA 4J6XA 5KCOA 1YHQT 5GAMf 1M5Q1 3CC7T 2EQJA 3M5AA 2FHDA 4BE0A 4TQFA 4C5IA 2PVOB 4QVDA 5E3IA 3HXZA 4C92F 5DLQE 3OD1A 3OYBA 3L2UA 1LNXA 5CAIA 2ARTA 2VUBA 4L59A 2RHIA 3HHTB 3CC4A 4P75C 3HRSA 4CS4A 4HWOA 3HTZA 1KC8C 1X75C 5J3BA 5CQYA 3PMTA 4M7DE 1SERA 4YRSA 1OI1A 3JCMW 4YRQA 3FB9A 3P8YA 4C8QC 3G4ST 2P4TA 5GMKl 3E9IA 1EIYA 3L42A 2LT4A 1HXDA 1VIFA 1HC7A 2XU8A 2XGTA 2A8EA 2BKDN 1YGBA 3OW2A 3MHXA 3VKIA 3JCMh 3LX7A 1W2BS 5GAOp 3LWHA 5F5WA 4WJ3M 4PKCC 4NS5A 3PNWC 4C5HA 4BACA 2DZ9A 2R57A 4L6V5 4M75G 4YROA 3QO7A 4FT2A 1Q82C 4JRIA 4E7KA 3RGLA 3E9HA 5CKDA 5GANg 4M77B 1QVPA 5D6YA 1UGSB 3GNGA 2A3LA 3PIOA 3QYHB 4M7AB 4M78G 5LJ3d 4MZTA 4P74C 4XTVA 2A7YA 2ZIMA 2DTOA 3OYAA 4CH3A 1E1TA 4M75E 3RACA 2NLUA 3I56T 4JRPA 1YJ9T 3VQXA 1UB4A 2OTLA 4LDYA 3HPWA 2RO0A 1EVKA 2P0PA 1S72A 5C0MA 3OMCA 4EDUA 3PMIA 2E65A 3E9GA 1XNIA 4DOWA 3ERRA 4M78E 3OYDA 4LDWA 4A4GA 4J7FA 1VQ8T 2DKGA 4P71C 2KVQG 1Y96B 4OVAA 4J6YA 4YRLA 1N8RU 2QQ9A 2LX9A 4UC4A 4HT9A 2JUFA 3JCMf 1SRYA 1LOJA 4RCBA 3QJ6A 2LCCA 4M7DA 3MEUA 4NCXA 3CMET 4YYEA 3P8HA 1K73C 2M0OA 3QBYA 4XAXB 3M55A 2DAQA 5LJ3e 1ZBXA 4KT0E 2BIVA 2EWNA 2JOYA 2QTXA 3ZBDA 3OB9A 5A0LA 4E7IA 3ZFJA 4AH6A 2HQEA 5CKHA 1JJCA 2ZPFB 5FU6C 4MDWA 3DB4A 3QKJA 1SSFA 3GP8A 2FYKA 4OP0A 3M58A 3CCUT 3CD6A 5L8RE 1BI2A 3M53A 1YHQA 2MMPA 3CC7A 2CJBA 2O4XA 3A8GB 1WQ7A 3GNFB 3KBGA 3TU4K 4HCZA 1NJ6A 1C0AA 2XKOC 4F7UG 3INZA 1OZ3A 3A31A 3OYNA 3SB2A 4C92B 3X25B 1U8RA 4QQGA 2DD4A 3UT1A 4E7LA 1IZ6A 4N0AA 1B70A 1GGMA 3VYGA 2QDYB 4UP8A 4X9CA 5GAMd 4XTXA 5FROA 2DQ3A 3G4SA 1YJNT 3QYGB 2BUDA 4C0DC 3WXMB 2EJ9A 4E47A 4F7UE 3P8VA 1WNLA 2LNVA 4A54A 2I4NA 3LGLA 3T9NA 4XU0A 2QHTA 1BI3A 5C51B 3A8OB 3A32A 1YI2T 4OMFB 4PJOB 4YTLA 1KHCA 3CMAA 1PYSB 5CKBA 4M75D 2PUKB 2ODRD 3BDUA 4LD6A 2PU9B 3ME9A 3CPFA 1ATIA 2YRVA 3LSQA 3NENA 2M9UA 4YRMA 2VV5A 3OQ5A 3C12A 2DTHA 4WF2A 4M78D 1IREB 5GAOl 2L3RA 1B76A 3HY0A 1Y7XA 4H2XB 1BIAA 1K8AU 1KD1U 2RHSB 1H4QA 4A53A 2L5QA 1G5IA 3HL8A 2FL7A 2RHZA 5GAMe 4LVMA 2RJEA 1O75A 3OMGA 1WYDA 1B7YB 2OTJT 4M7AA 4BI4A 3FLGA 1VQLT 3HRTA 1VQPT 4IUPA 4XU1A 3I56A 1VIEA 1YJ9A 4KR3A 5A2QE 4QQ6A 1VQOT 4ZGEB 2IVWA 3ICAA 3A5ZA 4TQDA 3VQYA 1D3BB 2DIGA 2I4MA 3M4PA 3CCVT 4KUIA 2GFAA 1WJSA 5KCHA 2K3YA 1VQ8A 3G71T 4HT8A 3JCMV 2QQSA 2QHSA 2LCLA 3PTAA 1Y96A 4P3NA 4RKUE 3QO8A 3V7CA 4Q6GA 4C8QD 4M77F 4M7DC 1QW1A 4RQEA 2RHXA 1W4SA 4YRCA 1Q81U 4YRIA 3M4QA 4C0FA 4JDSA 1V29B 2M1HA 2EJGA 4BDYA 2KMTA 2RI5A 2E3CA 1B34B 1YITT 2PQWA 2RM4A 4BD3A 3GIBA 2DU7A 1VQ7T 4J7IA 2PVDB 1ZHIA 1GXIE 4J83A 1U1TA 4F7UA 4BB7A 1M90C 4YCWA 3CEYA 1UGQB 3JCMd 1E24A 3CCJT 1YJWT 3S3NA 2ZCEA 1BYMA 5GAN6 4ZTJA 3CCUA 2VGMA 4CRIA 1G3SA 3QJYA 3TEEA 4XEOA 5J39A 1N9RA 4E7JA 1NJ2A 4LDXA 2CZ1B 1X2HA 3M56A 4YREA 2M16A 3CXCS 4N0AC 3LH0A 3LC0A 2Q5IA 3E19A 2GF7A 3A8MB 2X35A 3MCAB 4JS5A 3PT9A 4YRFA 4Q15A 3HKSA 3VV0A 2E5QA 4C92A 4HWSA 2ARUA 2I2LA 5HKCA 5GMKh 4FIBA 2RB6A 2HD0A 4JRQA 3JCMQ 1G3YA 4FU6A 3REUA 1YJNA 1USYA 3OA6A 3PCOB 1Y07A 1R8OB 2AMCA 1H4TA 4OGCA 1KQSA 2E70A 4PLIA 5LJ5f 2D6FA 1W66A 3META 3S6WA 1B8AA 3JCMe 4QVCA 4EMGA 3QUIA 2RHQA 1YI2A 1UEBA 3ASKA 4M7DG 3S3OA 4PJOA 2F69A 3S3MA 1PYSA 4CH6A 3RL6A 4CS3A 4BY6C 3L2WA 2Q5HA 1XQHA 3HXWA 1NJ8A 2E41A 1FXXA 3RIRA 1K8AC 2MWPA 3MF1A 4R55A 2AKWB 2RA2A 3HXYA 2JZ2A 2ZPEB 3SDZA 4M7AC 1M1KC 3MF2A 1NJIU 2ZPHB 3JB9F 2QXFA 3CXCA 1WJRA 5LJ3j 3V8LA 4H2WA 2DO3A 2ZIOA 3UFGA 2DZCA 3A7RA 2QQBA 4RDXA 12ASA 2OTJA 3R6OA 1VQLA 4PLLA 1B7YA 4HT4A 3RESA 1VQPA 3JCMb 3J7AF 4G84A 4PJOF 1VQOA 3M9QA 3VUZA 3JB9H 1VUBA 4BWAA 3I7FA 1OYXA 3CCVA 1LYLA 2V8KA 2XD0A 1KQ2A 5K1XA 4X34A 3IG2A 4OB1B 1P92A 2XTIA 3G71A 1BI1A 2J3MA 4QW2A 4X9DA 3OS1A 1Q7YU 3REXA 2E1HA 4TVYA 3TUPA 2LTOA 2GQVA 3UWNA 3BY7A 3V8JA 3IALA 4YRTA 1SETA 4GY5A 4TWAA 4GLKA 4V2SA 4ZGDB 3SWNB 1YITA 2DEQA 2ALYB 3VQVA 4YRPA 4QVZA 3A8LB 2ZZDA 3L2RA 1VQ7A 4XEMA 1VQNT 2G4CA 3M4GA 4WJ4A 3PGGA 1YFTA 2XIDA 3BJUA 1NYRA 3ZEHA 4ELZC 2YHTA 1JBMA 5HY6A 2Q7GA 2CS7A 2CJAA 2EFIA 1ASZA 3W3SA 4P3PA 2YLCA 3P8TA 4C8QB 3CCJA 1O9SA 4EMKB 1YJWA 4HCCA 1WLEA 4TTVA 4OF1A 2KY9A 2DIQA 3OYJA 4M77G 1VQZA 4XU3A 5GAN2 1BBWA 3TEHB 4BE2A 2ZINA 1PSFA 2CIMA 3HP9A 3QO5A 2PVGB 4MMLA 3Q1JA 4M7AG 4RG2A 1W2BA 3FDRA 4C92C 3LW5E 2L89A 3UGQA 4TVAB 5LJ3g 2DXUA 5FU7B 4ZTUB 1VQ9T 4KQEA 1EOVA 4K87A 3QDRB 1USYC 1WQWA 4M77E 4Z02A 3MO8A 1MGQA 3CCLT 5GAMj 2XG8D 5LL6S 3M59A 2MWOA 4M7AE 4A4EA 3FEOA 1VQ5A 1L0WA 3H6ZA 3MEAA 1KMMA 2CZ6B 2XK0A 4M7DD 4O2DA 3OYMA 5KE2A 2QA4A 2LQ8A 5GANh 3C95A 4YRRA 2R5AA 2DXCA 4PJOC 2P0LA 3QZ5B 3N5BB 1VQ4T 2RH2A 2XI9A 1QE0A 3MEVA 3DB3A 1VQ6T 3SFMA 4R56A 2X4YA 4RQFA 2E6NA 4LDUA 1H4VB 2X4WA 3IKLA 3OBYA 3NETA 4TVRA 3QNEA 2YLBA 2ZPGB 4H2VA 4P72A 2ZPIB 2Y90A 4EPCA 4N4IA 3OY9A 4HA8A 3NFCA 3FJPA 2AKWA 3GPLA 5LJ5d 4H02A 5GAOm 3HXVA 1I8FA 1BI0A 1VQKT 3CCMT 3X24B 1ZQ1A 2DJZA 5I2SA 1G3TA 2DVEA 2EAYA 5HK0A 3CMQA 2HQXA 3L2QA 1RI0A 5LJ3h 3VJPA 3OS0A 4YCUA 1YIJT 4JRKA 4OLFA 5A0GA 4P73A 3RKYA 3HFOA 4E51A 4UP7A 4C92G 3E9FA 1N9WA 5GAOn 1NPPA 2QHVA 5FU6B 1X2GA 2DXBA 5GANf 1YFRA 3RKWA 5GAMg 3JB9G 2K5FA 4BUGA 1WPYA 3WQZA 5CKEA 2X4XA 4XQ3A 4XK8E 4IUVA 3OYKA 3RERA 4M77A 4C92E 2MF2A 3CC2T 5LJ5e 4B9WA 1WU7A 3QSUA 3L4GB 4IURA 4MZPA 2RJFA 1Q86U 3SWNA 5CCAA 4BW9A 1VQNA 2PMFA 4PJOG 2ZZFA 2I4LA 1J5WA 2ZPBB 3NTHA 3HFVA 3R07A 4LD9K 1EIYB 4JJNK 1KC8U 1BIBA 4H2UA 3DKMA 2OAUA 4NOYA 3M54A 4M78F 1IL2A 4XTYA 1N8RC 2B8AA 4NL3A 4M7AD 4EMKA 4N4HA 5I2MA 1I81A 3FRNA 2Y4YA 4PJOE 4C5GA 3A7UA 4K86A 1G5VA 2KDSA 3TEHA 4P3OA 3L1AA 1N27A 4LNSA 4KBMB 1U1SA 4A4FA 3JSCA 3HXUA 2P0QA 3MEYA 3RUXA 1VQ9A 5C52B 5CKFA 2K3XA 1HK9A 3OYEA 3MP8A 2VXFA 3CMEA 3QZ9B 2GFUA 2VGNA 3CCRT 5GMKe 3CCLA 1TH7A 2R58A 4OB2B 1SESA 3KFUA 11ASA 2QEXT 1M1FA 2CZ0B 1NPRA 1Q82U 1X55A 5CK9A 2VC8A 3QG1A 4HKEA 4C8QF 2EKOA 3MP6A 1QP2A 4J8OA 5GAMh 3M57A 2PUOB 3QIIA 2ZT8A 5HGQA 4HWRA 4OB3B 2P0KA 5GAN5 5C53B 3JCMX 3OYLA 1VQ4A 2DDZA 1Z7NA 1NJ5A 4G85A 1H3ZA 2ZR2A 1VQ6A 2L8DA 2I4OA 4ZIBA 4P72C 3EAEA 3HRIA 4JLGA 3TCJA 3C4SA 2H3JA 4H2TA 4L5GA 2ZT6A 3C94A 1E22A 3G1ZA 3X28B 2ZR3A 2K5LA 3JB9I 2HAXA 5D6WA 4CH5A 3JB9J 4ZN1A 2WSEE 4ZTZB 2DQ0A 3GF5A 4IUQA 3UPUA 4RMOA 4M7DB 4JLIA 2RD1A 1VQKA 1ADYA 4WI1A 3CCMA 2Q7EA 1BKBA 3OYCA 2RI2A 4P73C 3MQZA 2RK2A 2DU5A 3GLXA 4YPFA 2JVVA 4MZMA 3OS5A 4RG8A 1K73U 4C92D 1NNHA 3L2ZA 2DK3A 1YIJA 4ZGJB 3SD4A 3DLMA 2LC4A 5EG2A 2VYTA 1MHNA 3CPWS 4PG3A 4DOVA 4FSXA 3JB9D 2DPPB 4IUTA 2LVMA 3E1SA 2O4XB 1XTDA 1KG1A 2RK1A 2EIFA 4M77C 1KD1C 2DTIA 3BFMA 2IY5B 3NELA 2O01E 4HWTA 4BI8B 3AHUA 3SWNC 3VU3C 2EQUA 3DSQA 3VUBA 3URGA 2XDDA 1Q86C 3CCQT 2D9TA 4J5YA 2ZT5A 3HSBA 5A0DA 4PJOD 4H2XA 3CC2A 3LLRA 3PFSA 5FRMA 2ZZEA 4E7HA 1NZ9A 2RHSA 3OYHA 5DM7R 1B70B 3L4GA 1X54A 2WSCE 2VXEA 5GAN7 1PSEA 3A5YA 1AHJB 2EQMA 1BBUA 1N9SA 4EX5A 4M75B 3OYIA 2GCXA 2KK4A 3OSSC 1Z7MA 4X5OA 4EMKC 5GANd 2E12A 2ZNJA 3HRKA 4ZTFA 4Y28E 4QQDA 2QHUA 1FX7A 4YCVA 2ZGWA 1D3BA 3O8VA 2PMEA 3CBPA 1ASYA 2K57A 3HXXA 2D0QB 4M78B 2NS6A 1Q81C 2E5AA 4ATOA 3H8ZA 1KHIA 4FL6A 1QF6A 2XDPA 5GAOr 2EL9A 3DLLA 4D6WA 5FU7C 3LWIA 3CMAT 5AYFA 3TEGA 3CPWA 2Q7HA 1M4ZA 4CI0C 5GAN3 2ZNIA 1YCYA 2ZT7A 4BDZA 3X26B 4BY6B 3HY1A 1B34A 1M8VA 1RL2A 3CCRA 4J6WA 3CCST 1EIFA 3RMQA 3P8DA 3CCET 2QEXA 4UPAA 1Y71A 4C5EA 2CGHA 1FYFA 5DLOA 2F5TX 4C0GA 2JTFA 3JAME 3QXEB 3I55T 3V8KA 5GAN8 5GANe 4OB0B 4UP9A 3A5ZB 1KQ1A 2LRQA 3J80E 2CYZB 4KR2A 3PZCA 2XICA 4YRKA 4O6JA 3PIPA 3OS2A 3M4YA 3ER0A 1VQMT 1UGPB 2C8MA 3J81E 4ELYC 4IUUA 3JCMJ 3VYHB 5LJ5j 3F70A 3V7SA 2KAFA 2C7IA 2P5IA 4TVWA 4LVKA 2K2VA 1HTTA 1QVFS 4C8QG 4N4GA 1I5LA 1M1GA 4PHCA 5ELOA 1QVGS 2WSFE 2E64A 1UGRB 2X4JA 4F7UB 3PCOA 1M9SA 3G6ET 1X56A 4RCCA 1G51A 3A74A 3TREA 2G3RA 2AHJB 2K4YA 4C8QE 1M90U 1G3WA 3RMSA 1NJIC 5FLXE 4PNOA 5CVIA 4DA4A 5C6SA 4C0ZA 4MDXA 4M7DF 2IY5A 4CH4A 5GMKi 1WGSA 3EFRA 5GMKj 3CCQA 1FWZA 4JS4A 5I21A 3HFZB 4HVCA 1KOGA 5CQXA 4Y91A 5ELNA 3QHSA 4CS2A 4YDQA 4LVJA 4JUVA 2KSSA 3JCMc 2XDBA 1H4SA 1XOVA 3LGFA 3BW1A 2CJ9A 4YP0A 2V8IA 1N6AA 3KXTA 3A7AA 4VUBA 4A4HA 3RF1A 2LQKA 5KE3A 3BDLA 4II1A 4M75A 3FIFA 2AMCB 5CR2A 1QVFA 4ME7A 3OBWA 4EO4A 4KULA 5KNNA 2ZCFB 4H2YA 4P5NA 2EJFA 1QVGA 4KUDK 3QO3A 1Q7YC 2RHQB 3UDCA 1QP3A 1I4K1 1K9MU 2CKKA 3HFNA 2WACA 4BE1A 3JRZA 4M78A 3IKMB 5LJ5g 4H2SA 1JB0E 3UH0A 3MEWA 1WJQA 4B9XA 2HNIA 3LYIA 3CC4T 3WVEB 3V7RA 4XU2A 4K88A 2E6ZA 4M75F 1ADJA 2ALYA 4A4KA 4BI3A 3CCSA 1YB3A 5CIUA 5IT9E 3CCEA 3JCMP 4YRGA 2JTMA 4ZN3A 3OYYA 4L87A 3WVDB 4P75A 5FRNA 4OGEA 5K1PA 1M1KU 3I55A 4M77D 4LVLA 5CO7A 4C0DB 2QQAA 4HCBA 4C8QA 2MAMA 4XTZA 5D6XA 3MP1A 3NEMA 2JN0A 3UGTA 5IN1A 3OYFA 2K5IA 3NTIA 5LJ3f 1RIQA 2RHYA 4LVIA 4PL6A 3VBBA 1VQMA 3LSSA 4FM4B 3RKXA 4J15A 4XTUA 4Q5WA 1G5HA 1EFWA 1E1OA 4TVAA 2JNGA 4NL2A 5GAOq 3HRUA 2LT1A 3L2VA 1EVLA 2MI6A 1DJ7B 4M7AF 3KUFA 1NJ1A 5KH6A 5LJ5h 1KQSS 1JJ2S 5IAYA 3P8BB 2EYQA 3X20B 5GAN4 2J3LA 5M9OA 3G6EA 1LJOA 2OTLT 2DD5A 1S72T 2ARSA 4P74A 1YBYA 5J26A 4DPGA 3CBOA 3NTKA 4RMFA 1NE8A 2E10A 1EQRA 2CZ7B 4HWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFS A;  2QHU A;  4YCV A;  2ZGW A;  4M7A E;  4YRN A;  4WF2 A;  4M78 D;  1D3B A;  2DXT A;  5GAO l;  2PME A;  1B76 A;  3HY0 A;  3QTC A;  1ASY A;  4H2X B;  2K57 A;  1BIA A;  3HXX A;  4DQ2 A;  1L0W A;  4M78 B;  2E5A A;  1KMM A;  2RHS B;  1H4Q A;  4A53 A;  4M7D D;  1G5I A;  1KMN A;  4O2D A;  4P71 A;  5GAN h;  4XTW A;  4YRR A;  1QF6 A;  5GAO r;  5GAM e;  4PJO C;  2EL9 A;  2P0L A;  1B7Y B;  1WYD A;  4M7A A;  1QE0 A;  2ZZG A;  3TEG A;  2ZTG A;  3JCM g;  3HFZ A;  4XU1 A;  1X01 A;  4F7U F;  2Q7H A;  4M75 C;  4KR3 A;  4RQF A;  2ODR C;  5GAN 3;  2ZNI A;  1H4V B;  4YRJ A;  1YCY A;  3ICA A;  3A5Z A;  2ZT7 A;  4TQD A;  1H64 1;  3VQY A;  3IKL A;  1D3B B;  5GAN j;  2FB7 A;  2I4M A;  3M4P A;  3HY1 A;  5DY9 A;  1B34 A;  1M8V A;  3NET A;  1NYQ A;  4MMK A;  4J6W A;  3QNE A;  2YLB A;  4H2V A;  4EMH A;  4P72 A;  3EFS A;  2Y90 A;  1JJC B;  4M78 C;  4HA8 A;  3VQW A;  4HT8 A;  4UPA A;  5GMK m;  3FJP A;  3JCM V;  2CGH A;  1FYF A;  2AKW A;  2QHS A;  2ZXF A;  1Y96 A;  4P3N A;  3QO8 A;  5LJ5 d;  1JRI A;  3V7C A;  4H02 A;  4Q6G A;  4C8Q D;  4M77 F;  4M7D C;  5GAO m;  4RQE A;  3HXV A;  3V8K A;  4YRC A;  1I8F A;  5GAN 8;  4YRI A;  4J6X A;  5GAN e;  5GAM f;  1M5Q 1;  3M4Q A;  2DJZ A;  4UP9 A;  2EJG A;  4TQF A;  1KQ1 A;  2DVE A;  2E3C A;  2EAY A;  4QVD A;  1B34 B;  5E3I A;  3CMQ A;  4KR2 A;  3HXZ A;  4C92 F;  2RM4 A;  5LJ3 h;  3GIB A;  2DU7 A;  4YCU A;  3PZC A;  3OD1 A;  4YRK A;  1LNX A;  5CAI A;  2ART A;  4JRK A;  4OLF A;  4P75 C;  4CS4 A;  4P73 A;  3RKY A;  1U1T A;  2C8M A;  4F7U A;  4HWO A;  3HTZ A;  3HFO A;  4E51 A;  4UP7 A;  4C92 G;  4M7D E;  1N9W A;  4YCW A;  1SER A;  5GAO n;  4YRS A;  3JCM J;  3JCM W;  5LJ5 j;  4YRQ A;  3FB9 A;  3V7S A;  3P8Y A;  4C8Q C;  3JCM d;  2QHV A;  1E24 A;  1X2G A;  2C7I A;  2P5I A;  4TVW A;  2ZCE A;  5GAN 6;  5GMK l;  3E9I A;  5GAN f;  1EIY A;  1YFR A;  3RKW A;  1HTT A;  4C8Q G;  1HXD A;  5GAM g;  3JB9 G;  1HC7 A;  2XGT A;  1I5L A;  1WPY A;  3WQZ A;  4XEO A;  4PHC A;  4XQ3 A;  1YGB A;  1N9R A;  5ELO A;  1NJ2 A;  3RER A;  4M77 A;  2E64 A;  4C92 E;  1X2H A;  5LJ5 e;  1WU7 A;  4YRE A;  4F7U B;  3QSU A;  3L4G B;  3PCO A;  3JCM h;  4N0A C;  3LC0 A;  5GAO p;  2Q5I A;  3SWN A;  1X56 A;  4RCC A;  1G51 A;  3A74 A;  4BW9 A;  5F5W A;  2PMF A;  4WJ3 M;  4PJO G;  2ZZF A;  4YRF A;  2I4L A;  1J5W A;  4Q15 A;  4C8Q E;  2DZ9 A;  3HFV A;  3R07 A;  4C92 A;  4HWS A;  1EIY B;  2ARU A;  2I2L A;  1BIB A;  4H2U A;  5GMK h;  4M75 G;  4YRO A;  3QO7 A;  2RB6 A;  4JRI A;  3JCM Q;  3RGL A;  4NOY A;  4M78 F;  3E9H A;  3REU A;  1USY A;  1IL2 A;  5GAN g;  4XTY A;  4M77 B;  4PNO A;  4NL3 A;  3PCO B;  4M7A D;  4EMK A;  2AMC A;  4M7D F;  2IY5 A;  1H4T A;  1I81 A;  4CH4 A;  5GMK i;  4PJO E;  3A7U A;  4M7A B;  4K86 A;  4M78 G;  3EFR A;  5LJ3 d;  5GMK j;  4P74 C;  5LJ5 f;  5I21 A;  3HFZ B;  4XTV A;  1W66 A;  3TEH A;  4HVC A;  1B8A A;  3JCM e;  2ZIM A;  2DTO A;  4CH3 A;  1E1T A;  4QVC A;  4P3O A;  1KOG A;  4EMG A;  4M75 E;  3QUI A;  3L1A A;  4Y91 A;  3QHS A;  2RHQ A;  4LNS A;  5ELN A;  3RAC A;  4CS2 A;  4M7D G;  4YDQ A;  4JUV A;  3JCM c;  1U1S A;  3VQX A;  1H4S A;  3HXU A;  3MEY A;  1EVK A;  3RUX A;  3BW1 A;  5C52 B;  2CJ9 A;  4YP0 A;  4PJO A;  1HK9 A;  3A7A A;  1PYS A;  4CH6 A;  2VXF A;  3RL6 A;  3RF1 A;  4CS3 A;  2Q5H A;  2E65 A;  3HXW A;  1NJ8 A;  5GMK e;  1TH7 A;  4M75 A;  3ERR A;  2E41 A;  3FIF A;  4M78 E;  3RIR A;  2AMC B;  1SES A;  3KFU A;  11AS A;  2DKG A;  3MF1 A;  4P71 C;  2AKW B;  2RA2 A;  3HXY A;  1Y96 B;  4EO4 A;  1X55 A;  5KNN A;  2VC8 A;  4J6Y A;  4H2Y A;  4YRL A;  4M7A C;  2EJF A;  3MF2 A;  4C8Q F;  3QO3 A;  3JB9 F;  2RHQ B;  5GAM h;  1I4K 1;  5LJ3 j;  3V8L A;  4H2W A;  3HFN A;  4M78 A;  3IKM B;  2ZIO A;  2ZT8 A;  3UFG A;  2DZC A;  4HWR A;  5HGQ A;  5LJ5 g;  4HT9 A;  3A7R A;  3JCM f;  5GAN 5;  1SRY A;  5C53 B;  3JCM X;  1LOJ A;  4RDX A;  4H2S A;  12AS A;  2DDZ A;  1Z7N A;  4RCB A;  1NJ5 A;  4G85 A;  1B7Y A;  3UH0 A;  2ZR2 A;  4M7D A;  3RES A;  2I4O A;  4NCX A;  4YYE A;  3JCM b;  4ZIB A;  4P72 C;  4G84 A;  3HRI A;  4PJO F;  2HNI A;  3JB9 H;  5LJ3 e;  4H2T A;  4BWA A;  3V7R A;  4XU2 A;  3I7F A;  2ZT6 A;  4K88 A;  2EWN A;  4M75 F;  1E22 A;  3G1Z A;  1LYL A;  2QTX A;  1ADJ A;  2ALY A;  1KQ2 A;  1YB3 A;  5K1X A;  3IG2 A;  4AH6 A;  3JCM P;  4YRG A;  3JB9 I;  2ZR3 A;  2XTI A;  4CH5 A;  3JB9 J;  4L87 A;  1JJC A;  4P75 A;  2J3M A;  4ZTZ B;  2DQ0 A;  5K1P A;  2FYK A;  4OP0 A;  4X9D A;  4M7D B;  4M77 D;  3REX A;  4JLI A;  2E1H A;  4TVY A;  2RD1 A;  3TUP A;  1ADY A;  4WI1 A;  2Q7E A;  3BY7 A;  2CJB A;  3V8J A;  3IAL A;  4YRT A;  1SET A;  4C8Q A;  4TWA A;  4V2S A;  1WQ7 A;  4P73 C;  4XTZ A;  2DU5 A;  4YPF A;  3SWN B;  2DEQ A;  3NEM A;  2ALY B;  3VQV A;  2JN0 A;  1NJ6 A;  3UGT A;  4YRP A;  1C0A A;  4C92 D;  4F7U G;  1NNH A;  3INZ A;  3L2Z A;  5LJ3 f;  4XEM A;  3A31 A;  2G4C A;  3M4G A;  1RIQ A;  3SB2 A;  4WJ4 A;  4C92 B;  3VBB A;  3PGG A;  3LSS A;  1YFT A;  3BJU A;  1NYR A;  3RKX A;  4J15 A;  4XTU A;  4N0A A;  2YHT A;  1JBM A;  1G5H A;  1EFW A;  2Q7G A;  1E1O A;  4PG3 A;  4TVA A;  2CJA A;  1B70 A;  4NL2 A;  1GGM A;  4UP8 A;  1ASZ A;  4X9C A;  5GAO q;  3JB9 D;  3W3S A;  4P3P A;  2YLC A;  5GAM d;  3P8T A;  4XTX A;  2DQ3 A;  1EVL A;  4C8Q B;  4EMK B;  4M77 C;  2DTI A;  3BFM A;  2IY5 B;  4M7A F;  2EJ9 A;  1WLE A;  4TTV A;  3NEL A;  4HWT A;  4F7U E;  3P8V A;  3AHU A;  4M77 G;  3SWN C;  3VU3 C;  1WNL A;  1NJ1 A;  3DSQ A;  1VQZ A;  4XU3 A;  5GAN 2;  1BBW A;  3TEH B;  4A54 A;  2I4N A;  5LJ5 h;  4J5Y A;  2ZIN A;  2CIM A;  2ZT5 A;  4XU0 A;  2QHT A;  3QO5 A;  4MML A;  5C51 B;  3A32 A;  3HSB A;  4M7A G;  4PJO D;  5GAN 4;  4H2X A;  2J3L A;  2ZZE A;  4C92 C;  2RHS A;  3UGQ A;  1LJO A;  4TVA B;  4PJO B;  5LJ3 g;  1B70 B;  3L4G A;  2DXU A;  4ZTU B;  4KQE A;  1PYS B;  4M75 D;  1EOV A;  4K87 A;  1X54 A;  3BDU A;  2ARS A;  2VXE A;  2ODR D;  5GAN 7;  4P74 A;  3A5Y A;  1BBU A;  1ATI A;  1N9S A;  1USY C;  4M75 B;  4EX5 A;  1WQW A;  4DPG A;  4M77 E;  1Z7M A;  4RMF A;  3LSQ A;  3NEN A;  4X5O A;  1MGQ A;  4YRM A;  5GAM j;  4EMK C;  2E10 A;  5GAN d;  2ZNJ A;  1EQR A;  4HWP A;  3HRK A;  2DTH A; 
#chains in the Genus database with same CATH topology
 2AZV A;  4LUE A;  1YFS A;  3A8H B;  5HK3 A;  2FZG B;  4YRN A;  1F1B B;  1R0C B;  4IKF A;  2DXT A;  2C06 A;  3OYG A;  3FC3 A;  3QTC A;  2EQK A;  4DQ2 A;  1EZZ B;  2QQR A;  2CP3 A;  2LQW A;  3OSV A;  2MIO A;  1JXO A;  5FW9 A;  1KMN A;  4P71 A;  2KQW A;  1UEC A;  4XTW A;  2O9S A;  2LDM A;  1OZ2 A;  2RI3 A;  2Y4X A;  3CBM A;  2RHU A;  2CSI A;  2ZZG A;  1X6O A;  2ZTG A;  3JCM g;  3HFZ A;  3QPH A;  1X01 A;  4F7U F;  4M75 C;  2ODR C;  4LDV A;  4FT4 A;  2F5K A;  2V8J A;  4YRJ A;  3G7Z A;  2R5M A;  3OW2 S;  1H64 1;  2A0F B;  3C0C A;  1TSF A;  2BTT A;  2FB7 A;  5GAN j;  1UE9 A;  2DYI A;  2QI2 A;  5DY9 A;  2FVU A;  1RAI B;  1VQ5 Q;  1NYQ A;  4MMK A;  1RLQ C;  5KYX B;  4EMH A;  3EFO A;  3EFS A;  1JJC B;  2YUN A;  1VQ5 T;  2XHC A;  4M78 C;  2QA4 Q;  2K9G A;  2IG0 A;  1K9M C;  1T3L A;  3VQW A;  5GMK m;  1JJ2 A;  2HBP A;  2QA4 T;  2ZXF A;  3GOX A;  1JRI A;  4KH1 B;  3CD6 Q;  2RJC A;  1GCQ A;  1YHQ Q;  2RJD A;  3CC7 Q;  2KYB A;  1LPL A;  3CD6 T;  4O5V A;  2EGE A;  4J6X A;  1RAA B;  5KCO A;  1YHQ T;  5GAM f;  1M5Q 1;  3CC7 T;  1OX8 A;  2EQJ A;  4QKU A;  3M5A A;  2YUO A;  2FHD A;  4BE0 A;  4TQF A;  1Y57 A;  4C5I A;  4JZ4 A;  2QGF B;  2PVO B;  4QVD A;  5E3I A;  1G8X A;  3I5S A;  2KT8 A;  1CSK A;  3HXZ A;  4C92 F;  5DLQ E;  1K0S A;  5I11 A;  3OD1 A;  2EYY A;  3OYB A;  3L2U A;  1LNX A;  2M02 A;  5CAI A;  2ART A;  2VUB A;  4L59 A;  2RHI A;  3HHT B;  4OMQ A;  3CC4 A;  4R0K A;  1I0C A;  4P75 C;  1OX9 A;  3HRS A;  4CS4 A;  2DF6 A;  3QWY A;  4HWO A;  3HTZ A;  1KC8 C;  1X75 C;  5J3B A;  5CQY A;  3PMT A;  4M7D E;  4KRT A;  1PKS A;  1SER A;  4YRS A;  1OI1 A;  3JCM W;  3G4S Q;  2D1X A;  4YRQ A;  3FB9 A;  3P8Y A;  4C8Q C;  3G4S T;  5IXF A;  2P4T A;  2AKL A;  5GMK l;  3E9I A;  1EIY A;  3L42 A;  2LT4 A;  1HXD A;  1VIF A;  1HC7 A;  2XU8 A;  2QG9 B;  2XGT A;  1ABO A;  3RR6 A;  1OU9 A;  2A8E A;  2BKD N;  1YGB A;  3OW2 A;  9ATC B;  2IIM A;  3BE3 A;  3MHX A;  2EKH A;  3VKI A;  2X51 A;  2W0Z A;  2RQT A;  3JCM h;  4QT7 A;  3LX7 A;  1W2B S;  2KXD A;  5GAO p;  5L23 A;  3LWH A;  5F5W A;  4WJ3 M;  4PKC C;  1K0X A;  2DEU A;  4NS5 A;  1C1A A;  2QAS A;  2RF0 A;  3VS3 A;  3PNW C;  5IH2 A;  4C5H A;  2DBK A;  4BAC A;  3I5R A;  2DZ9 A;  2R57 A;  4L6V 5;  1WHK A;  4M75 G;  3EHQ A;  4YRO A;  3QO7 A;  4FT2 A;  2J05 A;  1WI7 A;  4JRI A;  1Q82 C;  2D0N A;  1GFD A;  4E7K A;  3RGL A;  3E9H A;  1YWP A;  5CKD A;  5GAN g;  4M77 B;  1SEM A;  1QVP A;  2COW A;  3IQL A;  2NWM A;  5D6Y A;  1UGS B;  3GNG A;  2A3L A;  3PIO A;  3QYH B;  4M7A B;  4M78 G;  1X43 A;  1NLO C;  5LJ3 d;  4MZT A;  4P74 C;  2YRC A;  4XTV A;  2A7Y A;  2ZIM A;  2DTO A;  3OYA A;  4CH3 A;  1YJ9 Q;  1WYX A;  4DEY A;  1NEB A;  1E1T A;  4M75 E;  3RAC A;  1FYN A;  2NLU A;  3I56 T;  1N8R R;  4JRP A;  1YJ9 T;  3VQX A;  1UB4 A;  2OTL A;  4LDY A;  3HPW A;  2RO0 A;  1EVK A;  2KNB B;  5KYU B;  2P0P A;  1S72 A;  3GBQ A;  4E6R A;  5C0M A;  3OMC A;  4EDU A;  1TTH B;  1RUW A;  3PMI A;  1M3A A;  1SHG A;  2E65 A;  3E9G A;  1AWW A;  2F2X A;  1VQ8 Q;  1XNI A;  4DOW A;  3ERR A;  4M78 E;  3OYD A;  4LDW A;  4A4G A;  2EGC A;  4J7F A;  1VQ8 T;  2DKG A;  4F04 B;  4P71 C;  2KVQ G;  1Y96 B;  2ATC B;  2M0Y A;  2KRN A;  4OVA A;  4J6Y A;  1XJW B;  2ED0 A;  4YRL A;  4OMO A;  2QAZ A;  2L3P A;  1N8R U;  3LH5 A;  2QQ9 A;  4AFQ C;  1SF9 A;  5KYY B;  2LX9 A;  1VQ9 Q;  1QCN A;  4UC4 A;  4HT9 A;  2JUF A;  3JCM f;  1SRY A;  1LOJ A;  3CME Q;  4RCB A;  1IGQ A;  3QJ6 A;  2LCC A;  4M7D A;  3MEU A;  1TOV A;  1WA7 A;  4NCX A;  3CME T;  4YYE A;  4JJD A;  3P8H A;  1K73 C;  1IRX A;  2M0O A;  3QBY A;  4XAX B;  3M55 A;  2DAQ A;  5LJ3 e;  1ZBX A;  1B3Q A;  4KT0 E;  1TUG B;  2BIV A;  2EWN A;  2JOY A;  1GCQ C;  2V26 A;  2QTX A;  3EG9 B;  3ZBD A;  3OB9 A;  5A0L A;  2RQR A;  4E7I A;  3H41 A;  3ZFJ A;  4AH6 A;  2HQE A;  5CKH A;  2NYS A;  1JJC A;  4PJL A;  2MK5 A;  2ZPF B;  5FU6 C;  2CUD A;  4MDW A;  4J9D A;  3DB4 A;  3QKJ A;  1SSF A;  2LCS A;  3GP8 A;  3CCU Q;  2FYK A;  4OP0 A;  2A08 A;  3M58 A;  4HXJ A;  1Y0M A;  3CCU T;  3CD6 A;  5L8R E;  1BI2 A;  3M53 A;  1YHQ A;  2MMP A;  3CC7 A;  2AIR B;  2CJB A;  5D7U A;  3EG0 A;  4LNP A;  2O4X A;  3A8G B;  3CPW P;  1M3C A;  1WQ7 A;  3GNF B;  3KBG A;  3TU4 K;  4HCZ A;  1NJ6 A;  1C0A A;  3EGU A;  1NG2 A;  2XKO C;  1V76 A;  4F7U G;  3INZ A;  1ABQ A;  1OZ3 A;  3A31 A;  3OYN A;  1X2Q A;  3SB2 A;  4C92 B;  3X25 B;  1U8R A;  4QQG A;  2DD4 A;  1QWE A;  3UT1 A;  4E7L A;  1IZ6 A;  4N0A A;  1LVK A;  7AT1 B;  1B70 A;  1GGM A;  2J6F A;  2A37 A;  3VYG A;  2QDY B;  4UP8 A;  4X9C A;  1M2V B;  5GAM d;  1YJN Q;  3NPF A;  4XTX A;  5FRO A;  1VYU A;  2DQ3 A;  3G4S A;  3QYG B;  2BUD A;  1YJN T;  4C0D C;  3WXM B;  2GTJ A;  2EJ9 A;  4E47 A;  2CT4 A;  4F7U E;  3P8V A;  1MNE A;  1WNL A;  1CKA A;  2LNV A;  4A54 A;  2I4N A;  1MV3 A;  3LGL A;  3T9N A;  2LJ1 A;  1YI2 Q;  2JM8 A;  4XU0 A;  2QHT A;  1BI3 A;  5I22 A;  5C51 B;  3A8O B;  3A32 A;  4OMM A;  1YI2 T;  2L3S A;  4OMF B;  1K8A R;  1KD1 R;  4PJO B;  4YTL A;  1KHC A;  1FMK A;  3CMA A;  1PYS B;  5CKB A;  4M75 D;  2JW4 A;  2PUK B;  3BDU A;  2ODR D;  1GRI A;  2COY A;  4LD6 A;  2PU9 B;  3ME9 A;  3CPF A;  1ATI A;  3UA7 A;  1WHH A;  3H9N A;  2YRV A;  1QMC A;  3LSQ A;  3NEN A;  1X27 A;  2M9U A;  4YRM A;  2VV5 A;  2YDL A;  1PCX A;  3OQ5 A;  4J9E A;  3C12 A;  2DTH A;  4JZ3 A;  4WF2 A;  4M78 D;  1IRE B;  5GAO l;  3UF4 A;  1JXM A;  2L3R A;  1B76 A;  3HY0 A;  1TWB A;  2AK5 A;  1Y7X A;  4H2X B;  2H8H A;  1BIA A;  1K8A U;  1KD1 U;  3QDF A;  2RHS B;  1SKU B;  3I35 A;  1H4Q A;  4A53 A;  2L5Q A;  3KFV A;  1G5I A;  1KK7 A;  2OTJ Q;  2FRW A;  3HL8 A;  1K9A A;  2FL7 A;  1JU5 C;  2RHZ A;  5GAM e;  1VQL Q;  4LVM A;  2RJE A;  4RTY A;  1O75 A;  3OMG A;  1B7Y B;  1WYD A;  2OTJ T;  1VQP Q;  4M7A A;  4BI4 A;  3FLG A;  1X69 A;  1VQL T;  2W10 A;  3HRT A;  4J9I A;  1VQP T;  4IUP A;  4XU1 A;  3I56 A;  1VQO Q;  2O2O A;  1VIE A;  1KSW A;  2CH4 W;  1YJ9 A;  4KR3 A;  2CUB A;  5A2Q E;  1Q81 R;  4QQ6 A;  1ZA2 B;  2FRY A;  3VRY A;  1VQO T;  4ZGE B;  2IVW A;  3ICA A;  3A5Z A;  4E2F B;  4TQD A;  2PTK A;  3CCV Q;  2HQH A;  1PG5 B;  3VS2 A;  3VQY A;  2EQI A;  5KYU A;  1D3B B;  3THK A;  3VRZ A;  2DIG A;  2I4M A;  3M4P A;  3CCV T;  2YRD A;  3M0U A;  4KUI A;  2GFA A;  1WJS A;  5KCH A;  3G71 Q;  1QLY A;  2K3Y A;  1PD1 A;  1VQ8 A;  1D1A A;  1WHJ A;  1TUD A;  3G71 T;  4HT8 A;  1CKB A;  1M2O A;  3JCM V;  2QQS A;  2QHS A;  2LCL A;  3PTA A;  1Y96 A;  4P3N A;  4RKU E;  3QO8 A;  3V7C A;  4Q6G A;  4C8Q D;  1WLP B;  4M77 F;  4M7D C;  1QW1 A;  1ACM B;  4RQE A;  2HSE B;  2RHX A;  1W4S A;  4YRC A;  2FO0 A;  1Q81 U;  4YRI A;  2C0O A;  1BCO A;  3M4Q A;  4C0F A;  4JDS A;  1V29 B;  2M1H A;  2EJG A;  4BDY A;  1YIT Q;  2KMT A;  2RI5 A;  4KGX B;  2E3C A;  1B34 B;  1YIT T;  3EGX B;  2PQW A;  1VQ7 Q;  4E7Z A;  2MYS A;  2RM4 A;  1YFN A;  4BD3 A;  3GIB A;  2DU7 A;  1VQ7 T;  4J7I A;  4ORZ A;  2E3H A;  4AFU C;  2PVD B;  1ZHI A;  1GXI E;  4J83 A;  1OQK A;  1QVF P;  1U1T A;  4F7U A;  4J9F A;  2KRS A;  4BB7 A;  1M90 C;  1NEG A;  4YCW A;  3CEY A;  4WTO B;  3CCJ Q;  1YJW Q;  1X6G A;  1UGQ B;  1B07 A;  4PJJ A;  3JCM d;  1E24 A;  3CCJ T;  1YJW T;  2HMA A;  1X6B A;  3S3N A;  2ZCE A;  1BYM A;  5GAN 6;  4ZTJ A;  1MMG A;  2YUQ A;  3CCU A;  2VGM A;  4CRI A;  1G3S A;  3QJY A;  3TEE A;  4XEO A;  5J39 A;  1N9R A;  1WFW A;  4E7J A;  1NJ2 A;  4LDX A;  2CZ1 B;  1RAC B;  2A28 A;  1X2H A;  1T3S A;  3M56 A;  1V1C A;  4YRE A;  3RDV A;  3MJX A;  2M16 A;  3CXC S;  4PK4 A;  1PD0 A;  4N0A C;  3LH0 A;  3LC0 A;  2Q5I A;  2J6K A;  1UDL A;  3E19 A;  5IXB A;  2GF7 A;  1EFN A;  3A8M B;  2X35 A;  3MCA B;  2O9V A;  2LJ0 A;  4JS5 A;  3PT9 A;  4YRF A;  4Q15 A;  1I07 A;  3HKS A;  2LMJ A;  3VV0 A;  1YN8 A;  2E5Q A;  4C92 A;  4HWS A;  2ARU A;  2I2L A;  3UAT A;  3PVQ A;  5HKC A;  1AZE A;  5GMK h;  1SSH A;  4FIB A;  2RB6 A;  2HD0 A;  4JRQ A;  3JCM Q;  2PNI A;  3PVL A;  1G3Y A;  2BZ8 A;  1M2V A;  4FU6 A;  3REU A;  1YJN A;  1USY A;  3OA6 A;  1QKX A;  3PCO B;  1Y07 A;  1R8O B;  2AMC A;  1E7O A;  1ZUK A;  1H4T A;  4OGC A;  4AFS C;  1KQS A;  2E70 A;  4PLI A;  2P4R A;  4ZNX A;  2KE9 A;  5LJ5 f;  2D6F A;  1W66 A;  3MET A;  3S6W A;  1B8A A;  3JCM e;  1PKT A;  4QVC A;  4EMG A;  1NJI R;  5KYW A;  3QUI A;  2RHQ A;  1YI2 A;  1UEB A;  2K7A A;  3ASK A;  4M7D G;  3S3O A;  2FEI A;  4RTT A;  4PJO A;  2BZX A;  2F69 A;  3S3M A;  2VAS A;  1PYS A;  4CH6 A;  1UHC A;  3RL6 A;  4CS3 A;  4BY6 C;  1U3O A;  3L2W A;  2Q5H A;  1ZSG A;  2MCN A;  1XQH A;  1MND A;  3HXW A;  4JPB W;  1T0H A;  3TVT A;  4AT1 B;  1NJ8 A;  2PZ1 A;  2E41 A;  1FXX A;  3RIR A;  1K8A C;  2MWP A;  4JJC A;  4R55 A;  3MF1 A;  2AKW B;  2RA2 A;  3HXY A;  1M3B A;  2JZ2 A;  2ZPE B;  2LP5 A;  3SDZ A;  4M7A C;  1K76 A;  1M1K C;  3MF2 A;  1NJI U;  2ZPH B;  3JB9 F;  3A98 A;  4OMN A;  2QXF A;  3CXC A;  1WJR A;  2K79 A;  5LJ3 j;  3V8L A;  4H2W A;  2DO3 A;  2ZIO A;  3UFG A;  2DZC A;  3A7R A;  2X3X D;  4RTW A;  2QQB A;  4RDX A;  12AS A;  2F2V A;  3R6O A;  2OTJ A;  1EX4 A;  1VQL A;  4PLL A;  1B7Y A;  4HT4 A;  1BK2 A;  3RES A;  1VQP A;  4Z88 A;  2Z0W A;  3JCM b;  1Q7Y R;  3J7A F;  4G84 A;  4HVW A;  4PJO F;  1VQO A;  2RMO A;  4IIM A;  3R6N A;  3M9Q A;  3VUZ A;  3JB9 H;  1IHW A;  2JS2 A;  1ZSZ B;  2E3I A;  1WX6 A;  1VUB A;  4BWA A;  3I7F A;  1OYX A;  2ROL A;  2V1Q A;  3CCV A;  1LYL A;  2V8K A;  2XD0 A;  2KXC A;  2LX7 A;  1KQ2 A;  5K1X A;  3ULR B;  4X34 A;  1JQQ A;  3IG2 A;  4OB1 B;  1P92 A;  1QKW A;  2XTI A;  3G71 A;  2BE9 B;  4AFZ C;  1BI1 A;  2NUT B;  1GBR A;  2J3M A;  4QW2 A;  2EW3 A;  4X9D A;  3OS1 A;  1Q7Y U;  3REX A;  2E1H A;  1D1C A;  4TVY A;  3TUP A;  2LTO A;  2GQV A;  2DVJ A;  3UWN A;  3BY7 A;  1PM3 A;  4D8K A;  3V8J A;  3A1P A;  3IAL A;  1SET A;  4GY5 A;  4YRT A;  3PE0 A;  4TWA A;  4GLK A;  1SRL A;  3FJ5 A;  4V2S A;  1MMN A;  4ZGD B;  3SWN B;  3EH2 A;  1YIT A;  3AT1 B;  2DEQ A;  4CC7 A;  2CP0 A;  2ALY B;  3VQV A;  1VQN Q;  4RTX A;  4YRP A;  4QVZ A;  3A8L B;  2J7I A;  2KBT A;  1GCP A;  2ZZD A;  3CCE Q;  3L2R A;  1VQ7 A;  3EGD B;  4XEM A;  1VQN T;  4F16 A;  1RAD B;  2G4C A;  3M4G A;  2GNC A;  4WJ4 A;  4Y92 A;  3PGG A;  1MMA A;  2EYX A;  2XID A;  1YFT A;  3BJU A;  1BU1 A;  1E6G A;  4J9G A;  1NYR A;  3ZEH A;  1R77 A;  4ELZ C;  2YHT A;  1JBM A;  5HY6 A;  1RAH B;  2Q7G A;  2CS7 A;  2CJA A;  1JJ2 P;  2EFI A;  1ASZ A;  3W3S A;  4P3P A;  2YLC A;  2HL3 A;  2HKN A;  1D0Y A;  3P8T A;  1X2K A;  1AT1 B;  1JO8 A;  5IHN A;  3G1J A;  4C8Q B;  2CP7 A;  3CCJ A;  1O9S A;  4EMK B;  1YJW A;  1YNZ A;  4HCC A;  5GJV B;  1WLE A;  4TTV A;  4OF1 A;  2KRO A;  2KY9 A;  2DIQ A;  3OYJ A;  4M77 G;  1VQZ A;  4XU3 A;  5GAN 2;  1BBW A;  3TEH B;  4OMP A;  4BE2 A;  2ZIN A;  1PSF A;  2CIM A;  3HP9 A;  2RN8 A;  3QO5 A;  4MML A;  2PVG B;  3EHR A;  1WIE A;  3Q1J A;  4M7A G;  4RG2 A;  1W2B A;  1FMW A;  1S1N A;  3FDR A;  4C92 C;  3LW5 E;  3H0I A;  2L89 A;  3UGQ A;  4TVA B;  5LJ3 g;  2DXU A;  5FU7 B;  4ZTU B;  1VQ9 T;  1VA7 A;  4KQE A;  1EOV A;  4K87 A;  1KJW A;  4B6M A;  1FMV A;  3QDR B;  2ROT A;  3CCL Q;  1VYV A;  1USY C;  1WQW A;  5IHK A;  4M77 E;  4Z02 A;  3MO8 A;  1MGQ A;  3CCL T;  5GAM j;  2HZY A;  2XG8 D;  5LL6 S;  3M59 A;  4FYW B;  2MWO A;  4M7A E;  4A4E A;  3FEO A;  1VQ5 A;  1L0W A;  3H6Z A;  5KYX A;  3MEA A;  4LN2 A;  1KMM A;  3OW2 P;  1SHF A;  2CZ6 B;  2XK0 A;  4M7D D;  2K6D A;  4CC3 A;  3OYM A;  2COZ A;  1VQ4 Q;  5KE2 A;  2QA4 A;  4O2D A;  2X3W D;  2LQ8 A;  5GAN h;  3C95 A;  4YRR A;  2F1L A;  1D09 B;  2R5A A;  2DXC A;  4PJO C;  4Z8A A;  3QZ5 B;  2P0L A;  1VQ6 Q;  3N5B B;  1VQ4 T;  2RH2 A;  2XI9 A;  1T0J A;  3MEV A;  1QE0 A;  3MKD A;  3DB3 A;  1VQ6 T;  2EBP A;  2J06 A;  3SFM A;  1OOT A;  4J9H A;  4R56 A;  2X4Y A;  4RQF A;  2E6N A;  4LDU A;  1H4V B;  2DE0 X;  1YP5 A;  4D8D A;  2X4W A;  3IKL A;  1NM7 A;  3OBY A;  1ZLM A;  2LZ6 B;  1PRL C;  3NET A;  1PC0 A;  4LUD A;  4TVR A;  3QNE A;  2YLB A;  2ZPG B;  4H2V A;  4P72 A;  2ZPI B;  2Y90 A;  4EPC A;  2ABL A;  2DIL A;  4N4I A;  4LXC A;  3OY9 A;  4HA8 A;  3I9Q A;  3NFC A;  3FJP A;  1AZG B;  4J9C A;  3GPL A;  2AKW A;  2YXY A;  5LJ5 d;  2DMO A;  1R0B G;  4H02 A;  1VQK Q;  5GAO m;  3CCM Q;  3HXV A;  1I8F A;  3VS7 A;  1BI0 A;  1TG0 A;  1VOM A;  1VQK T;  2QYZ A;  3CCM T;  3UA6 A;  1ZQ1 A;  3X24 B;  2DJZ A;  1WXB A;  5I2S A;  1G3T A;  2DVE A;  2EAY A;  2BZY A;  5HK0 A;  3CMQ A;  2HQX A;  3L2Q A;  1QWF A;  2CDT A;  1YIJ Q;  1RAB B;  1RI0 A;  3EFO B;  3TQ7 P;  5LJ3 h;  4PJM A;  4FW1 A;  3VJP A;  3OS0 A;  4YCU A;  1YIJ T;  1K1Z A;  2ZAE A;  1GBQ A;  2EVR A;  4JRK A;  3CQT A;  4OLF A;  5A0G A;  4P73 A;  3RKY A;  1LCK A;  3HFO A;  1ZSZ A;  4E51 A;  4UP7 A;  2QTV A;  4C92 G;  3E9F A;  1N9W A;  2B86 A;  5GAO n;  1NPP A;  4FW2 A;  1Q86 R;  1IXD A;  2OI3 A;  2DLP A;  2HL5 C;  3NMZ C;  2HCK A;  2QHV A;  1ZX6 A;  5FU6 B;  1X2G A;  2DXB A;  5GAN f;  1YFR A;  3RKW A;  5GAM g;  3JB9 G;  1ARK A;  1KC8 R;  2K5F A;  4BUG A;  2FZC B;  1WPY A;  3WQZ A;  2QK0 A;  5CKE A;  2X4X A;  4XQ3 A;  3CC2 Q;  4XK8 E;  4IUV A;  3OYK A;  3RER A;  4M77 A;  4C92 E;  2MF2 A;  3CC2 T;  1Z9Q A;  5LJ5 e;  4B9W A;  1WU7 A;  3QSU A;  3L4G B;  4IUR A;  4MZP A;  2RJF A;  1Q86 U;  1MUZ A;  3SWN A;  5CCA A;  1SRM A;  2CP2 A;  4BW9 A;  1VQN A;  2PMF A;  2D8J A;  4JJB A;  2YWW A;  4PJO G;  2I4L A;  2ZZF A;  1J5W A;  2ZPB B;  3NTH A;  3HFV A;  2DNU A;  3R07 A;  4LD9 K;  1UJY A;  4JJN K;  1KC8 U;  1EIY B;  1BIB A;  4H2U A;  1M27 C;  3DKM A;  2OAU A;  1KFZ A;  4NOY A;  3M54 A;  4M78 F;  2JMA A;  2ED1 A;  2MPX C;  8ATC B;  1IL2 A;  4XTY A;  1N8R C;  2B8A A;  2GBQ A;  4NL3 A;  2JS0 A;  4M7A D;  4EMK A;  4N4H A;  5I2M A;  1I81 A;  1IB8 A;  3FRN A;  2Y4Y A;  4PJO E;  4C5G A;  3A7U A;  4K86 A;  4K11 A;  1G5V A;  2KRM A;  1Q82 R;  1UUE A;  1HYO A;  2F2W A;  2CP6 A;  2KDS A;  3TEH A;  4P3O A;  3O5Z A;  3L1A A;  1N27 A;  4LNS A;  5KYY A;  4KBM B;  1U1S A;  4A4F A;  3JSC A;  1IO6 A;  2P0Q A;  3HXU A;  3MEY A;  3RUX A;  2DX1 A;  4DBF A;  1VQ9 A;  5CKF A;  5C52 B;  2K3X A;  1HK9 A;  1AOJ A;  3OYE A;  3MP8 A;  3CCR Q;  3JV3 A;  2VXF A;  4KH0 B;  3CME A;  3QZ9 B;  2GFU A;  2JT4 A;  2VGN A;  3CCR T;  5GMK e;  3CCL A;  2QEX Q;  1TH7 A;  2R58 A;  3M0Q A;  4OB2 B;  1RLP C;  1SES A;  3KFU A;  11AS A;  4FSS A;  2LNH B;  2QEX T;  1M1F A;  2CZ0 B;  1NPR A;  1Q82 U;  1X55 A;  1OPL A;  5CK9 A;  2VC8 A;  3QG1 A;  1Q95 G;  4HKE A;  4C8Q F;  2EPD A;  2EKO A;  2DET A;  3EG9 A;  3MP6 A;  1QVG P;  1QP2 A;  4J8O A;  2DER A;  5GAM h;  1RAG B;  2EYZ A;  3M57 A;  2PUO B;  3VS0 A;  1HD3 A;  3QII A;  2GTO A;  2ZT8 A;  5HGQ A;  4HWR A;  4OB3 B;  2P0K A;  5GAN 5;  5C53 B;  3JCM X;  3OYL A;  2C0I A;  1VQ4 A;  2DDZ A;  1Z7N A;  1NJ5 A;  4G85 A;  1H3Z A;  2ZR2 A;  1VQ6 A;  2L8D A;  2I4O A;  4ZIB A;  1MMD A;  4P72 C;  1ZUU A;  3EAE A;  4FYV B;  3HRI A;  1UGV A;  4JLG A;  3TCJ A;  1W1F A;  2AKK A;  1U5S A;  3C4S A;  2H3J A;  4H2T A;  3M0P A;  2BE7 D;  4L5G A;  2H3E B;  2ZT6 A;  2MOX A;  3REA B;  3C94 A;  4F14 A;  2L0A A;  1E22 A;  3G1Z A;  5HCK A;  1WHM A;  2DL7 A;  2E5K A;  2KGT A;  1K73 R;  3X28 B;  2K5L A;  3JB9 I;  2HAX A;  2ZR3 A;  5D6W A;  1HSQ A;  4CH5 A;  3JB9 J;  4ZN1 A;  3H0F A;  2WSE E;  4ZTZ B;  2DQ0 A;  4PFO A;  2DL3 A;  2RQV A;  3GF5 A;  4IUQ A;  3UPU A;  4ESR A;  2NUP B;  4RMO A;  3RBB B;  2IPO B;  4M7D B;  1OEB A;  4JLI A;  2VWF A;  2RD1 A;  1VQK A;  1ADY A;  2D8H A;  3CCM A;  4WI1 A;  2Q7E A;  2M51 A;  1BKB A;  1C6V X;  3OYC A;  1NBE B;  2RI2 A;  4P73 C;  3MQZ A;  2RK2 A;  1UTI A;  2DU5 A;  3GLX A;  4YPF A;  2JVV A;  1ZSZ C;  3OS5 A;  4MZM A;  4RG8 A;  2SRC A;  4Z89 A;  1NLP C;  1K73 U;  1WHL A;  4HVV A;  4C92 D;  1NNH A;  3L2Z A;  2DK3 A;  3MPU B;  1YIJ A;  4ZGJ B;  3SD4 A;  1GL5 A;  2CH4 A;  3DLM A;  2NUZ A;  4FYY B;  4OML A;  2LC4 A;  2P84 A;  5EG2 A;  2VYT A;  1MHN A;  4CC2 A;  3CPW S;  1AWJ A;  3ZL7 C;  4DEX A;  3TSZ A;  1YCS B;  4PG3 A;  4DOV A;  4FSX A;  4A63 B;  4HVU A;  4M4Z A;  3JB9 D;  2DPP B;  4IUT A;  2LVM A;  3E1S A;  2O4X B;  1XTD A;  1KG1 A;  2RK1 A;  2EIF A;  4M77 C;  2HKQ B;  1KD1 C;  2DTI A;  3BFM A;  2EGA A;  1A0N B;  2IY5 B;  2CSQ A;  3NEL A;  3EG3 A;  2O01 E;  4HWT A;  3CCQ Q;  4BI8 B;  3AHU A;  1D0X A;  3SWN C;  3VU3 C;  2EQU A;  3DSQ A;  1QCO A;  3VUB A;  3URG A;  2XDD A;  1Q86 C;  2YT6 A;  3CCQ T;  2D9T A;  4J5Y A;  2ZT5 A;  1VYT A;  1D0Z A;  4LE9 A;  2ENM A;  3HSB A;  5A0D A;  4PJO D;  4H2X A;  3CC2 A;  1KIK A;  3LLR A;  5AT1 B;  3PFS A;  5FRM A;  2I0N A;  2ZZE A;  4E7H A;  1NZ9 A;  2RHS A;  1WDX A;  3OYH A;  5DM7 R;  1B70 B;  3L4G A;  2X9H A;  1X54 A;  2VXE A;  2WSC E;  5GAN 7;  1PSE A;  3A5Y A;  1AHJ B;  2EQM A;  1BBU A;  1N9S A;  2CT3 A;  2CP5 A;  4M75 B;  3OYI A;  1HJD A;  4EX5 A;  2GCX A;  2KK4 A;  3OSS C;  1Z7M A;  4X5O A;  4EMK C;  5GAN d;  2E12 A;  4J9B A;  2ZNJ A;  1UHF A;  2RQW A;  4ANJ A;  2JXB A;  3HRK A;  4ZTF A;  4Y28 E;  2CRE A;  2DRM A;  4QQD A;  2QHU A;  1FX7 A;  1WXT A;  2SEM A;  3VS4 A;  2ZGW A;  4YCV A;  1D3B A;  1M8M A;  3O8V A;  2PME A;  3CBP A;  1ASY A;  4HCK A;  1E6H A;  2K57 A;  3HXX A;  2D0Q B;  4M78 B;  1PWT A;  2NS6 A;  1Q81 C;  2E5A A;  4ATO A;  4DBR A;  3H8Z A;  1KHI A;  4FL6 A;  1BBZ A;  2L2P A;  3CMA Q;  1QF6 A;  2XDP A;  5GAO r;  2EL9 A;  4D6W A;  3DLL A;  5FU7 C;  3LWI A;  2KYM A;  3CMA T;  5AYF A;  1D1B A;  2VB6 A;  3TEG A;  3CPW A;  2Q7H A;  1M4Z A;  1PNJ A;  4CI0 C;  1M30 A;  5GAN 3;  2ZNI A;  1YCY A;  2OX7 A;  2ZT7 A;  2DJQ A;  4BDZ A;  2VVK A;  2A36 A;  3CCS Q;  3X26 B;  4BY6 B;  3HY1 A;  1B34 A;  1M8V A;  1RL2 A;  3EGX A;  3CCR A;  4J6W A;  3QWX X;  1I5O B;  3CCS T;  3NHN A;  1EIF A;  3RMQ A;  3P8D A;  4GLM A;  3VS5 A;  3CCE T;  1QCF A;  2ESW A;  2FZK B;  2QEX A;  1OV3 A;  4UPA A;  1Y71 A;  4C5E A;  2CGH A;  1FYF A;  3I55 Q;  5DLO A;  1OPK A;  2F5T X;  1KQS P;  4C0G A;  2JTF A;  3JAM E;  2GQI A;  3QXE B;  3I55 T;  3I56 Q;  2LQN A;  3V8K A;  5GAN 8;  2FPF A;  5GAN e;  5ECA A;  4OB0 B;  1U06 A;  4UP9 A;  1ZA1 B;  3A5Z B;  2DYB A;  1N5Z A;  1KQ1 A;  2LRQ A;  3J80 E;  2JTE A;  2CYZ B;  4KR2 A;  8AT1 B;  4PFP A;  2HEQ A;  1VQM Q;  2OJ2 A;  3PZC A;  2XIC A;  4YRK A;  4O6J A;  3PIP A;  2FG0 A;  3OS2 A;  3M4Y A;  5FWB A;  3ER0 A;  3SHW A;  2K2M A;  2OAW A;  1VQM T;  1UGP B;  2DBM A;  2C8M A;  2QDL A;  2G6F X;  2YSQ A;  3J81 E;  4IIO A;  3M0R A;  1IHV A;  2LJ3 A;  1W6X A;  4ELY C;  4IUU A;  2DRK A;  3JCM J;  1AD5 A;  3VYH B;  4EIK A;  2FPD A;  5LJ5 j;  5KYN A;  3F70 A;  3V7S A;  3CXC P;  5EC7 A;  2KAF A;  2C7I A;  1WXU A;  2P5I A;  4RUG A;  1TU0 B;  4TVW A;  4LVK A;  3H0H A;  4FYX B;  2K2V A;  1HTT A;  1QVF S;  4C8Q G;  4N4G A;  2C0T A;  4PJN A;  1M90 R;  2NUP A;  1I5L A;  1M1G A;  1AEY A;  4PHC A;  1H8K A;  5ELO A;  1QVG S;  2WSF E;  2E64 A;  3G6E Q;  1UGR B;  2X4J A;  1QQJ A;  1UFF A;  4F7U B;  3PCO A;  1M9S A;  4RTV A;  3G6E T;  1Z9Z A;  3REB B;  1X56 A;  4RCC A;  1G51 A;  3A74 A;  3TRE A;  2G3R A;  2AHJ B;  4KGV B;  2K4Y A;  4C8Q E;  1G83 A;  1M90 U;  2RNA A;  2J6O A;  1G3W A;  3RMS A;  1NYF A;  3VS6 A;  2O88 A;  2KT1 A;  1NJI C;  2EYW A;  1C0M A;  5FLX E;  4PNO A;  2JM9 A;  5CVI A;  4DA4 A;  1J3T A;  5C6S A;  4C0Z A;  4MDX A;  1JEG A;  2V1R A;  4M7D F;  4KGZ B;  2IY5 A;  4CH4 A;  5GMK i;  3EG2 A;  1WGS A;  3EFR A;  5GMK j;  3CCQ A;  1FWZ A;  4JS4 A;  5I21 A;  4WCI A;  3HFZ B;  4HVC A;  6AT1 B;  1KOG A;  5CQX A;  4Y91 A;  5ELN A;  3QHS A;  1BCM A;  4CS2 A;  4YDQ A;  1SPK A;  4LVJ A;  4JUV A;  2KSS A;  3JCM c;  2XDB A;  1H4S A;  1XOV A;  1K9M R;  3LGF A;  2ECZ A;  3BW1 A;  2CJ9 A;  4AG1 C;  4YP0 A;  2V8I A;  1NYG A;  1N6A A;  3KXT A;  3A7A A;  4VUB A;  4A4H A;  3RF1 A;  2LQK A;  5KE3 A;  2JMC A;  3BDL A;  4II1 A;  4X1V A;  4M75 A;  3FIF A;  3D7S B;  2AMC B;  5CR2 A;  1QVF A;  4ME7 A;  1RAF B;  3OBW A;  4EO4 A;  2L3Q A;  4KUL A;  5KNN A;  1BB9 A;  4PFZ A;  1TS9 A;  2ZCF B;  4H2Y A;  2AZS A;  4P5N A;  4AG2 C;  2EJF A;  1QVG A;  4KUD K;  1OUL A;  3QO3 A;  1Q7Y C;  2KI7 A;  1K4U S;  5KYW B;  2RHQ B;  2K3B A;  3UDC A;  1QP3 A;  1I4K 1;  1K9M U;  1ZUY A;  2CKK A;  3HFN A;  2WAC A;  1AWX A;  4BE1 A;  3JRZ A;  4M78 A;  3IKM B;  4RTU A;  1W2B P;  5LJ5 g;  2DA9 A;  1AWO A;  2NUT A;  4DBH A;  4H2S A;  3U23 A;  1SG5 A;  3NGP A;  1JB0 E;  4E7S A;  3UH0 A;  2JJ9 A;  4RTZ A;  1M1K R;  2YUP A;  3M0T A;  1B7T A;  3MEW A;  3CC4 Q;  1WJQ A;  3SEM A;  4B9X A;  2HNI A;  2DL8 A;  1RAE B;  3LYI A;  1WZO A;  3CC4 T;  3WVE B;  3RNJ A;  3V7R A;  4XU2 A;  4FCY A;  4K88 A;  2E6Z A;  4M75 F;  1I1J A;  1ADJ A;  4AMC A;  4A4K A;  2ALY A;  4BI3 A;  3CCS A;  1H92 A;  1YB3 A;  5CIU A;  5IT9 E;  3EGD A;  3CCE A;  3JCM P;  4YRG A;  2JTM A;  2XMF A;  4ZN3 A;  3OYY A;  4L87 A;  3WVD B;  4P75 A;  3M0S A;  5FRN A;  2DL5 A;  4OGE A;  5K1P A;  1UG1 A;  1M1K U;  3EG1 A;  2HDA A;  3I55 A;  4M77 D;  2HSP A;  4LVL A;  5CO7 A;  3VS1 A;  4C0D B;  2QQA A;  4HCB A;  3EH1 A;  1WHG A;  5GJW B;  4GBQ A;  4C8Q A;  1RI9 A;  2MAM A;  3E2U A;  2AT1 B;  4XTZ A;  5D6X A;  2QGG A;  3MP1 A;  2E4H A;  2KR3 A;  3NEM A;  1W70 A;  2JN0 A;  3UGT A;  5IN1 A;  3OYF A;  1OU8 A;  1GFC A;  2K5I A;  3NTI A;  1AVZ C;  5LJ3 f;  2RPN A;  1RIQ A;  2RHY A;  4LVI A;  4PL6 A;  1H3H A;  2VKN A;  3VBB A;  1VQM A;  3LSS A;  4FM4 B;  3RKX A;  4J15 A;  4XTU A;  4Q5W A;  1PHT A;  1G5H A;  1EFW A;  1E1O A;  4TVA A;  2JNG A;  4NL2 A;  4CC4 B;  2HBW A;  5GAO q;  3HRU A;  2LT1 A;  3L2V A;  2RQU A;  1EVL A;  1IGU A;  2MI6 A;  1DJ7 B;  4M7A F;  1TUC A;  2KEA A;  3KUF A;  1UJ0 A;  1G2B A;  5IHI A;  1NJ1 A;  2O31 A;  5KH6 A;  5LJ5 h;  1KQS S;  1JJ2 S;  5IAY A;  3P8B B;  2EYQ A;  3HTR A;  2DL4 A;  2GGR A;  3X20 B;  2DFU A;  2DM1 A;  5GAN 4;  2OTL Q;  2J3L A;  1TXQ A;  4DBQ A;  5M9O A;  1LJO A;  3G6E A;  1S72 Q;  1MV0 B;  2OTL T;  2DD5 A;  1PRM C;  4F17 A;  1S72 T;  2ARS A;  4P74 A;  1YBY A;  2FPE A;  5J26 A;  5FWC A;  1ZBJ A;  4DPG A;  3CBO A;  3NTK A;  4RMF A;  1NE8 A;  2E10 A;  1EQR A;  2CZ7 B;  4HWP A;  3TSW A;  1YWO A; 
#chains in the Genus database with same CATH homology
 1YFS A;  3A8H B;  5HK3 A;  4YRN A;  4IKF A;  2DXT A;  2C06 A;  3OYG A;  3FC3 A;  3QTC A;  2EQK A;  4DQ2 A;  2QQR A;  3OSV A;  1KMN A;  4P71 A;  2KQW A;  4XTW A;  2LDM A;  1OZ2 A;  2RI3 A;  2Y4X A;  3CBM A;  2RHU A;  2ZZG A;  1X6O A;  2ZTG A;  3JCM g;  3HFZ A;  3QPH A;  1X01 A;  4F7U F;  4M75 C;  2ODR C;  4LDV A;  4FT4 A;  2F5K A;  2V8J A;  4YRJ A;  3G7Z A;  2R5M A;  3OW2 S;  1H64 1;  5GAN j;  2FB7 A;  2QI2 A;  5DY9 A;  2FVU A;  1NYQ A;  4MMK A;  4EMH A;  3EFS A;  1JJC B;  1VQ5 T;  2XHC A;  4M78 C;  2IG0 A;  1K9M C;  3VQW A;  5GMK m;  1JJ2 A;  2HBP A;  2ZXF A;  2QA4 T;  3GOX A;  1JRI A;  2RJC A;  2RJD A;  3CD6 T;  4O5V A;  4J6X A;  5KCO A;  1YHQ T;  5GAM f;  1M5Q 1;  3CC7 T;  2EQJ A;  3M5A A;  2FHD A;  4BE0 A;  4TQF A;  4C5I A;  2PVO B;  4QVD A;  5E3I A;  3HXZ A;  4C92 F;  5DLQ E;  3OD1 A;  3OYB A;  3L2U A;  1LNX A;  5CAI A;  2ART A;  2VUB A;  4L59 A;  2RHI A;  3HHT B;  3CC4 A;  4P75 C;  3HRS A;  4CS4 A;  4HWO A;  3HTZ A;  1KC8 C;  1X75 C;  5J3B A;  5CQY A;  3PMT A;  4M7D E;  1SER A;  4YRS A;  1OI1 A;  3JCM W;  4YRQ A;  3FB9 A;  3P8Y A;  4C8Q C;  3G4S T;  2P4T A;  5GMK l;  3E9I A;  1EIY A;  3L42 A;  2LT4 A;  1HXD A;  1VIF A;  1HC7 A;  2XU8 A;  2XGT A;  2A8E A;  2BKD N;  1YGB A;  3OW2 A;  3MHX A;  3VKI A;  3JCM h;  3LX7 A;  1W2B S;  5GAO p;  3LWH A;  5F5W A;  4WJ3 M;  4PKC C;  4NS5 A;  3PNW C;  4C5H A;  4BAC A;  2DZ9 A;  2R57 A;  4L6V 5;  4M75 G;  4YRO A;  3QO7 A;  4FT2 A;  1Q82 C;  4JRI A;  4E7K A;  3RGL A;  3E9H A;  5CKD A;  5GAN g;  4M77 B;  1QVP A;  5D6Y A;  1UGS B;  3GNG A;  2A3L A;  3PIO A;  3QYH B;  4M7A B;  4M78 G;  5LJ3 d;  4MZT A;  4P74 C;  4XTV A;  2A7Y A;  2ZIM A;  2DTO A;  3OYA A;  4CH3 A;  1E1T A;  4M75 E;  3RAC A;  2NLU A;  3I56 T;  4JRP A;  1YJ9 T;  3VQX A;  1UB4 A;  2OTL A;  4LDY A;  3HPW A;  2RO0 A;  1EVK A;  2P0P A;  1S72 A;  5C0M A;  3OMC A;  4EDU A;  3PMI A;  2E65 A;  3E9G A;  1XNI A;  4DOW A;  3ERR A;  4M78 E;  3OYD A;  4LDW A;  4A4G A;  4J7F A;  1VQ8 T;  2DKG A;  4P71 C;  2KVQ G;  1Y96 B;  4OVA A;  4J6Y A;  4YRL A;  1N8R U;  2QQ9 A;  2LX9 A;  4UC4 A;  4HT9 A;  2JUF A;  3JCM f;  1SRY A;  1LOJ A;  4RCB A;  3QJ6 A;  2LCC A;  4M7D A;  3MEU A;  4NCX A;  3CME T;  4YYE A;  3P8H A;  1K73 C;  2M0O A;  3QBY A;  4XAX B;  3M55 A;  2DAQ A;  5LJ3 e;  1ZBX A;  4KT0 E;  2BIV A;  2EWN A;  2JOY A;  2QTX A;  3ZBD A;  3OB9 A;  5A0L A;  4E7I A;  3ZFJ A;  4AH6 A;  2HQE A;  5CKH A;  1JJC A;  2ZPF B;  5FU6 C;  4MDW A;  3DB4 A;  3QKJ A;  1SSF A;  3GP8 A;  2FYK A;  4OP0 A;  3M58 A;  3CCU T;  3CD6 A;  5L8R E;  1BI2 A;  3M53 A;  1YHQ A;  2MMP A;  3CC7 A;  2CJB A;  2O4X A;  3A8G B;  1WQ7 A;  3GNF B;  3KBG A;  3TU4 K;  4HCZ A;  1NJ6 A;  1C0A A;  2XKO C;  4F7U G;  3INZ A;  1OZ3 A;  3A31 A;  3OYN A;  3SB2 A;  4C92 B;  3X25 B;  1U8R A;  4QQG A;  2DD4 A;  3UT1 A;  4E7L A;  1IZ6 A;  4N0A A;  1B70 A;  1GGM A;  3VYG A;  2QDY B;  4UP8 A;  4X9C A;  5GAM d;  4XTX A;  5FRO A;  2DQ3 A;  3G4S A;  1YJN T;  3QYG B;  2BUD A;  4C0D C;  3WXM B;  2EJ9 A;  4E47 A;  4F7U E;  3P8V A;  1WNL A;  2LNV A;  4A54 A;  2I4N A;  3LGL A;  3T9N A;  4XU0 A;  2QHT A;  1BI3 A;  5C51 B;  3A8O B;  3A32 A;  1YI2 T;  4OMF B;  4PJO B;  4YTL A;  1KHC A;  3CMA A;  1PYS B;  5CKB A;  4M75 D;  2PUK B;  2ODR D;  3BDU A;  4LD6 A;  2PU9 B;  3ME9 A;  3CPF A;  1ATI A;  2YRV A;  3LSQ A;  3NEN A;  2M9U A;  4YRM A;  2VV5 A;  3OQ5 A;  3C12 A;  2DTH A;  4WF2 A;  4M78 D;  1IRE B;  5GAO l;  2L3R A;  1B76 A;  3HY0 A;  1Y7X A;  4H2X B;  1BIA A;  1K8A U;  1KD1 U;  2RHS B;  1H4Q A;  4A53 A;  2L5Q A;  1G5I A;  3HL8 A;  2FL7 A;  2RHZ A;  5GAM e;  4LVM A;  2RJE A;  1O75 A;  3OMG A;  1WYD A;  1B7Y B;  2OTJ T;  4M7A A;  4BI4 A;  3FLG A;  1VQL T;  3HRT A;  1VQP T;  4IUP A;  4XU1 A;  3I56 A;  1VIE A;  1YJ9 A;  4KR3 A;  5A2Q E;  4QQ6 A;  1VQO T;  4ZGE B;  2IVW A;  3ICA A;  3A5Z A;  4TQD A;  3VQY A;  1D3B B;  2DIG A;  2I4M A;  3M4P A;  3CCV T;  4KUI A;  2GFA A;  1WJS A;  5KCH A;  2K3Y A;  1VQ8 A;  3G71 T;  4HT8 A;  3JCM V;  2QQS A;  2QHS A;  2LCL A;  3PTA A;  1Y96 A;  4P3N A;  4RKU E;  3QO8 A;  3V7C A;  4Q6G A;  4C8Q D;  4M77 F;  4M7D C;  1QW1 A;  4RQE A;  2RHX A;  1W4S A;  4YRC A;  1Q81 U;  4YRI A;  3M4Q A;  4C0F A;  4JDS A;  1V29 B;  2M1H A;  2EJG A;  4BDY A;  2KMT A;  2RI5 A;  2E3C A;  1B34 B;  1YIT T;  2PQW A;  2RM4 A;  4BD3 A;  3GIB A;  2DU7 A;  1VQ7 T;  4J7I A;  2PVD B;  1ZHI A;  1GXI E;  4J83 A;  1U1T A;  4F7U A;  4BB7 A;  1M90 C;  4YCW A;  3CEY A;  1UGQ B;  3JCM d;  1E24 A;  3CCJ T;  1YJW T;  3S3N A;  2ZCE A;  1BYM A;  5GAN 6;  4ZTJ A;  3CCU A;  2VGM A;  4CRI A;  1G3S A;  3QJY A;  3TEE A;  4XEO A;  5J39 A;  1N9R A;  4E7J A;  1NJ2 A;  4LDX A;  2CZ1 B;  1X2H A;  3M56 A;  4YRE A;  2M16 A;  3CXC S;  4N0A C;  3LH0 A;  3LC0 A;  2Q5I A;  3E19 A;  2GF7 A;  3A8M B;  2X35 A;  3MCA B;  4JS5 A;  3PT9 A;  4YRF A;  4Q15 A;  3HKS A;  3VV0 A;  2E5Q A;  4C92 A;  4HWS A;  2ARU A;  2I2L A;  5HKC A;  5GMK h;  4FIB A;  2RB6 A;  2HD0 A;  4JRQ A;  3JCM Q;  1G3Y A;  4FU6 A;  3REU A;  1YJN A;  1USY A;  3OA6 A;  3PCO B;  1Y07 A;  1R8O B;  2AMC A;  1H4T A;  4OGC A;  1KQS A;  2E70 A;  4PLI A;  5LJ5 f;  2D6F A;  1W66 A;  3MET A;  3S6W A;  1B8A A;  3JCM e;  4QVC A;  4EMG A;  3QUI A;  2RHQ A;  1YI2 A;  1UEB A;  3ASK A;  4M7D G;  3S3O A;  4PJO A;  2F69 A;  3S3M A;  1PYS A;  4CH6 A;  3RL6 A;  4CS3 A;  4BY6 C;  3L2W A;  2Q5H A;  1XQH A;  3HXW A;  1NJ8 A;  2E41 A;  1FXX A;  3RIR A;  1K8A C;  2MWP A;  3MF1 A;  4R55 A;  2AKW B;  2RA2 A;  3HXY A;  2JZ2 A;  2ZPE B;  3SDZ A;  4M7A C;  1M1K C;  3MF2 A;  1NJI U;  2ZPH B;  3JB9 F;  2QXF A;  3CXC A;  1WJR A;  5LJ3 j;  3V8L A;  4H2W A;  2DO3 A;  2ZIO A;  3UFG A;  2DZC A;  3A7R A;  2QQB A;  4RDX A;  12AS A;  2OTJ A;  3R6O A;  1VQL A;  4PLL A;  1B7Y A;  4HT4 A;  3RES A;  1VQP A;  3JCM b;  3J7A F;  4G84 A;  4PJO F;  1VQO A;  3M9Q A;  3VUZ A;  3JB9 H;  1VUB A;  4BWA A;  3I7F A;  1OYX A;  3CCV A;  1LYL A;  2V8K A;  2XD0 A;  1KQ2 A;  5K1X A;  4X34 A;  3IG2 A;  4OB1 B;  1P92 A;  2XTI A;  3G71 A;  1BI1 A;  2J3M A;  4QW2 A;  4X9D A;  3OS1 A;  1Q7Y U;  3REX A;  2E1H A;  4TVY A;  3TUP A;  2LTO A;  2GQV A;  3UWN A;  3BY7 A;  3V8J A;  3IAL A;  4YRT A;  1SET A;  4GY5 A;  4TWA A;  4GLK A;  4V2S A;  4ZGD B;  3SWN B;  1YIT A;  2DEQ A;  2ALY B;  3VQV A;  4YRP A;  4QVZ A;  3A8L B;  2ZZD A;  3L2R A;  1VQ7 A;  4XEM A;  1VQN T;  2G4C A;  3M4G A;  4WJ4 A;  3PGG A;  1YFT A;  2XID A;  3BJU A;  1NYR A;  3ZEH A;  4ELZ C;  2YHT A;  1JBM A;  5HY6 A;  2Q7G A;  2CS7 A;  2CJA A;  2EFI A;  1ASZ A;  3W3S A;  4P3P A;  2YLC A;  3P8T A;  4C8Q B;  3CCJ A;  1O9S A;  4EMK B;  1YJW A;  4HCC A;  1WLE A;  4TTV A;  4OF1 A;  2KY9 A;  2DIQ A;  3OYJ A;  4M77 G;  1VQZ A;  4XU3 A;  5GAN 2;  1BBW A;  3TEH B;  4BE2 A;  2ZIN A;  1PSF A;  2CIM A;  3HP9 A;  3QO5 A;  2PVG B;  4MML A;  3Q1J A;  4M7A G;  4RG2 A;  1W2B A;  3FDR A;  4C92 C;  3LW5 E;  2L89 A;  3UGQ A;  4TVA B;  5LJ3 g;  2DXU A;  5FU7 B;  4ZTU B;  1VQ9 T;  4KQE A;  1EOV A;  4K87 A;  3QDR B;  1USY C;  1WQW A;  4M77 E;  4Z02 A;  3MO8 A;  1MGQ A;  3CCL T;  5GAM j;  2XG8 D;  5LL6 S;  3M59 A;  2MWO A;  4M7A E;  4A4E A;  3FEO A;  1VQ5 A;  1L0W A;  3H6Z A;  3MEA A;  1KMM A;  2CZ6 B;  2XK0 A;  4M7D D;  4O2D A;  3OYM A;  5KE2 A;  2QA4 A;  2LQ8 A;  5GAN h;  3C95 A;  4YRR A;  2R5A A;  2DXC A;  4PJO C;  2P0L A;  3QZ5 B;  3N5B B;  1VQ4 T;  2RH2 A;  2XI9 A;  1QE0 A;  3MEV A;  3DB3 A;  1VQ6 T;  3SFM A;  4R56 A;  2X4Y A;  4RQF A;  2E6N A;  4LDU A;  1H4V B;  2X4W A;  3IKL A;  3OBY A;  3NET A;  4TVR A;  3QNE A;  2YLB A;  2ZPG B;  4H2V A;  4P72 A;  2ZPI B;  2Y90 A;  4EPC A;  4N4I A;  3OY9 A;  4HA8 A;  3NFC A;  3FJP A;  2AKW A;  3GPL A;  5LJ5 d;  4H02 A;  5GAO m;  3HXV A;  1I8F A;  1BI0 A;  1VQK T;  3CCM T;  3X24 B;  1ZQ1 A;  2DJZ A;  5I2S A;  1G3T A;  2DVE A;  2EAY A;  5HK0 A;  3CMQ A;  2HQX A;  3L2Q A;  1RI0 A;  5LJ3 h;  3VJP A;  3OS0 A;  4YCU A;  1YIJ T;  4JRK A;  4OLF A;  5A0G A;  4P73 A;  3RKY A;  3HFO A;  4E51 A;  4UP7 A;  4C92 G;  3E9F A;  1N9W A;  5GAO n;  1NPP A;  2QHV A;  5FU6 B;  1X2G A;  2DXB A;  5GAN f;  1YFR A;  3RKW A;  5GAM g;  3JB9 G;  2K5F A;  4BUG A;  1WPY A;  3WQZ A;  5CKE A;  2X4X A;  4XQ3 A;  4XK8 E;  4IUV A;  3OYK A;  3RER A;  4M77 A;  4C92 E;  2MF2 A;  3CC2 T;  5LJ5 e;  4B9W A;  1WU7 A;  3QSU A;  3L4G B;  4IUR A;  4MZP A;  2RJF A;  1Q86 U;  3SWN A;  5CCA A;  4BW9 A;  1VQN A;  2PMF A;  4PJO G;  2ZZF A;  2I4L A;  1J5W A;  2ZPB B;  3NTH A;  3HFV A;  3R07 A;  4LD9 K;  1EIY B;  4JJN K;  1KC8 U;  1BIB A;  4H2U A;  3DKM A;  2OAU A;  4NOY A;  3M54 A;  4M78 F;  1IL2 A;  4XTY A;  1N8R C;  2B8A A;  4NL3 A;  4M7A D;  4EMK A;  4N4H A;  5I2M A;  1I81 A;  3FRN A;  2Y4Y A;  4PJO E;  4C5G A;  3A7U A;  4K86 A;  1G5V A;  2KDS A;  3TEH A;  4P3O A;  3L1A A;  1N27 A;  4LNS A;  4KBM B;  1U1S A;  4A4F A;  3JSC A;  3HXU A;  2P0Q A;  3MEY A;  3RUX A;  1VQ9 A;  5C52 B;  5CKF A;  2K3X A;  1HK9 A;  3OYE A;  3MP8 A;  2VXF A;  3CME A;  3QZ9 B;  2GFU A;  2VGN A;  3CCR T;  5GMK e;  3CCL A;  1TH7 A;  2R58 A;  4OB2 B;  1SES A;  3KFU A;  11AS A;  2QEX T;  1M1F A;  2CZ0 B;  1NPR A;  1Q82 U;  1X55 A;  5CK9 A;  2VC8 A;  3QG1 A;  4HKE A;  4C8Q F;  2EKO A;  3MP6 A;  1QP2 A;  4J8O A;  5GAM h;  3M57 A;  2PUO B;  3QII A;  2ZT8 A;  5HGQ A;  4HWR A;  4OB3 B;  2P0K A;  5GAN 5;  5C53 B;  3JCM X;  3OYL A;  1VQ4 A;  2DDZ A;  1Z7N A;  1NJ5 A;  4G85 A;  1H3Z A;  2ZR2 A;  1VQ6 A;  2L8D A;  2I4O A;  4ZIB A;  4P72 C;  3EAE A;  3HRI A;  4JLG A;  3TCJ A;  3C4S A;  2H3J A;  4H2T A;  4L5G A;  2ZT6 A;  3C94 A;  1E22 A;  3G1Z A;  3X28 B;  2ZR3 A;  2K5L A;  3JB9 I;  2HAX A;  5D6W A;  4CH5 A;  3JB9 J;  4ZN1 A;  2WSE E;  4ZTZ B;  2DQ0 A;  3GF5 A;  4IUQ A;  3UPU A;  4RMO A;  4M7D B;  4JLI A;  2RD1 A;  1VQK A;  1ADY A;  4WI1 A;  3CCM A;  2Q7E A;  1BKB A;  3OYC A;  2RI2 A;  4P73 C;  3MQZ A;  2RK2 A;  2DU5 A;  3GLX A;  4YPF A;  2JVV A;  4MZM A;  3OS5 A;  4RG8 A;  1K73 U;  4C92 D;  1NNH A;  3L2Z A;  2DK3 A;  1YIJ A;  4ZGJ B;  3SD4 A;  3DLM A;  2LC4 A;  5EG2 A;  2VYT A;  1MHN A;  3CPW S;  4PG3 A;  4DOV A;  4FSX A;  3JB9 D;  2DPP B;  4IUT A;  2LVM A;  3E1S A;  2O4X B;  1XTD A;  1KG1 A;  2RK1 A;  2EIF A;  4M77 C;  1KD1 C;  2DTI A;  3BFM A;  2IY5 B;  3NEL A;  2O01 E;  4HWT A;  4BI8 B;  3AHU A;  3SWN C;  3VU3 C;  2EQU A;  3DSQ A;  3VUB A;  3URG A;  2XDD A;  1Q86 C;  3CCQ T;  2D9T A;  4J5Y A;  2ZT5 A;  3HSB A;  5A0D A;  4PJO D;  4H2X A;  3CC2 A;  3LLR A;  3PFS A;  5FRM A;  2ZZE A;  4E7H A;  1NZ9 A;  2RHS A;  3OYH A;  5DM7 R;  1B70 B;  3L4G A;  1X54 A;  2WSC E;  2VXE A;  5GAN 7;  1PSE A;  3A5Y A;  1AHJ B;  2EQM A;  1BBU A;  1N9S A;  4EX5 A;  4M75 B;  3OYI A;  2GCX A;  2KK4 A;  3OSS C;  1Z7M A;  4X5O A;  4EMK C;  5GAN d;  2E12 A;  2ZNJ A;  3HRK A;  4ZTF A;  4Y28 E;  4QQD A;  2QHU A;  1FX7 A;  4YCV A;  2ZGW A;  1D3B A;  3O8V A;  2PME A;  3CBP A;  1ASY A;  2K57 A;  3HXX A;  2D0Q B;  4M78 B;  2NS6 A;  1Q81 C;  2E5A A;  4ATO A;  3H8Z A;  1KHI A;  4FL6 A;  1QF6 A;  2XDP A;  5GAO r;  2EL9 A;  3DLL A;  4D6W A;  5FU7 C;  3LWI A;  3CMA T;  5AYF A;  3TEG A;  3CPW A;  2Q7H A;  1M4Z A;  4CI0 C;  5GAN 3;  2ZNI A;  1YCY A;  2ZT7 A;  4BDZ A;  3X26 B;  4BY6 B;  3HY1 A;  1B34 A;  1M8V A;  1RL2 A;  3CCR A;  4J6W A;  3CCS T;  1EIF A;  3RMQ A;  3P8D A;  3CCE T;  2QEX A;  4UPA A;  1Y71 A;  4C5E A;  2CGH A;  1FYF A;  5DLO A;  2F5T X;  4C0G A;  2JTF A;  3JAM E;  3QXE B;  3I55 T;  3V8K A;  5GAN 8;  5GAN e;  4OB0 B;  4UP9 A;  3A5Z B;  1KQ1 A;  2LRQ A;  3J80 E;  2CYZ B;  4KR2 A;  3PZC A;  2XIC A;  4YRK A;  4O6J A;  3PIP A;  3OS2 A;  3M4Y A;  3ER0 A;  1VQM T;  1UGP B;  2C8M A;  3J81 E;  4ELY C;  4IUU A;  3JCM J;  3VYH B;  5LJ5 j;  3F70 A;  3V7S A;  2KAF A;  2C7I A;  2P5I A;  4TVW A;  4LVK A;  2K2V A;  1HTT A;  1QVF S;  4C8Q G;  4N4G A;  1I5L A;  1M1G A;  4PHC A;  5ELO A;  1QVG S;  2WSF E;  2E64 A;  1UGR B;  2X4J A;  4F7U B;  3PCO A;  1M9S A;  3G6E T;  1X56 A;  4RCC A;  1G51 A;  3A74 A;  3TRE A;  2G3R A;  2AHJ B;  2K4Y A;  4C8Q E;  1M90 U;  1G3W A;  3RMS A;  1NJI C;  5FLX E;  4PNO A;  5CVI A;  4DA4 A;  5C6S A;  4C0Z A;  4MDX A;  4M7D F;  2IY5 A;  4CH4 A;  5GMK i;  1WGS A;  3EFR A;  5GMK j;  3CCQ A;  1FWZ A;  4JS4 A;  5I21 A;  3HFZ B;  4HVC A;  1KOG A;  5CQX A;  4Y91 A;  5ELN A;  3QHS A;  4CS2 A;  4YDQ A;  4LVJ A;  4JUV A;  2KSS A;  3JCM c;  2XDB A;  1H4S A;  1XOV A;  3LGF A;  3BW1 A;  2CJ9 A;  4YP0 A;  2V8I A;  1N6A A;  3KXT A;  3A7A A;  4VUB A;  4A4H A;  3RF1 A;  2LQK A;  5KE3 A;  3BDL A;  4II1 A;  4M75 A;  3FIF A;  2AMC B;  5CR2 A;  1QVF A;  4ME7 A;  3OBW A;  4EO4 A;  4KUL A;  5KNN A;  2ZCF B;  4H2Y A;  4P5N A;  2EJF A;  1QVG A;  4KUD K;  3QO3 A;  1Q7Y C;  2RHQ B;  3UDC A;  1QP3 A;  1I4K 1;  1K9M U;  2CKK A;  3HFN A;  2WAC A;  4BE1 A;  3JRZ A;  4M78 A;  3IKM B;  5LJ5 g;  4H2S A;  1JB0 E;  3UH0 A;  3MEW A;  1WJQ A;  4B9X A;  2HNI A;  3LYI A;  3CC4 T;  3WVE B;  3V7R A;  4XU2 A;  4K88 A;  2E6Z A;  4M75 F;  1ADJ A;  2ALY A;  4A4K A;  4BI3 A;  3CCS A;  1YB3 A;  5CIU A;  5IT9 E;  3CCE A;  3JCM P;  4YRG A;  2JTM A;  4ZN3 A;  3OYY A;  4L87 A;  3WVD B;  4P75 A;  5FRN A;  4OGE A;  5K1P A;  1M1K U;  3I55 A;  4M77 D;  4LVL A;  5CO7 A;  4C0D B;  2QQA A;  4HCB A;  4C8Q A;  2MAM A;  4XTZ A;  5D6X A;  3MP1 A;  3NEM A;  2JN0 A;  3UGT A;  5IN1 A;  3OYF A;  2K5I A;  3NTI A;  5LJ3 f;  1RIQ A;  2RHY A;  4LVI A;  4PL6 A;  3VBB A;  1VQM A;  3LSS A;  4FM4 B;  3RKX A;  4J15 A;  4XTU A;  4Q5W A;  1G5H A;  1EFW A;  1E1O A;  4TVA A;  2JNG A;  4NL2 A;  5GAO q;  3HRU A;  2LT1 A;  3L2V A;  1EVL A;  2MI6 A;  1DJ7 B;  4M7A F;  3KUF A;  1NJ1 A;  5KH6 A;  5LJ5 h;  1KQS S;  1JJ2 S;  5IAY A;  3P8B B;  2EYQ A;  3X20 B;  5GAN 4;  2J3L A;  5M9O A;  3G6E A;  1LJO A;  2OTL T;  2DD5 A;  1S72 T;  2ARS A;  4P74 A;  1YBY A;  5J26 A;  4DPG A;  3CBO A;  3NTK A;  4RMF A;  1NE8 A;  2E10 A;  1EQR A;  2CZ7 B;  4HWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...