1WPYA

Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3 in complex with biotin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 61
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wpyA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wpyA01
4E51A 1TH7A 4DQ2A 5GMKj 4KQEA 3RACA 4YRSA 4YRRA 1M8VA 4X9DA 5LJ5g 2I4MA 4G84A 1HK9A 2DQ0A 4MMKA 1N9RA 3RESA 3QSUA 2QHTA 3PCOA 4M7AB 4F7UE 1JJCB 4M77C 4P3OA 5GAMd 3HXUA 4H2SA 2PMEA 5GAN5 4YRKA 3JCMQ 1I8FA 3L4GA 4P75A 3HRKA 2C7IA 1ASZA 4RMFA 5LJ5j 1Z7NA 1VQZA 5C52B 1E24A 1D3BA 2I2LA 1PYSA 1BIBA 4H2XB 4EO4A 4YDQA 2E3CA 5LJ3f 4M78G 1NYQA 3SWNB 1KMNA 4M78B 4M7DB 4A53A 2DJZA 1X56A 4YRFA 4M7DF 4HT8A 4H2VA 3VBBA 3JCMJ 5LJ3e 1KMMA 4CH4A 4DPGA 5GAMe 3PZCA 5GAN7 1WYDA 4HWOA 3VQYA 3BFMA 2E41A 1ATIA 2Q5IA 4JRIA 3RKYA 3FB9A 4M77B 3HRIA 2ZINA 3RKXA 3P8VA 2J3LA 4CH3A 3P8YA 3JB9I 4CS2A 1ADYA 2ZT8A 5GAOq 3KFUA 2ZT7A 3JB9D 3JCMd 5GAMh 4J6WA 4PJOB 5LJ3h 4YRTA 4AH6A 3E9IA 3IKLA 4YRQA 3QO3A 5GMKl 11ASA 4OP0A 2EWNA 4XEMA 4ZTZB 1KOGA 2RHSA 1N9WA 2DXTA 4O2DA 4M7DD 4K87A 3RL6A 2ZIMA 2RHQA 1H4TA 2C8MA 4L87A 3EFRA 4PJOE 3DSQA 1Y96B 4C8QF 4XTXA 1BBWA 1YCYA 3HXXA 4P72A 2VC8A 4YRIA 3A7UA 4EMGA 2Q5HA 1G5HA 4HWRA 1EFWA 4RCBA 5GAOn 4C92G 4WF2A 4YCWA 3A5ZA 3SB2A 4ZIBA 5ELOA 1EVKA 2XGTA 4M77F 2DTIA 5GMKe 4QVCA 5LJ5d 2IY5A 4HWSA 4QVDA 2RD1A 5CAIA 1E22A 1H4VB 3HY1A 4P72C 4P3PA 4YRNA 4M75F 2DU5A 4C8QB 2XTIA 1B34A 2EL9A 4M77G 4P3NA 2ZIOA 3LSQA 2IY5B 3BY7A 3NENA 4M75E 2EJGA 1NNHA 4YRJA 2Q7GA 4KR3A 1W66A 2AKWA 1USYC 1B8AA 3QO5A 4C8QG 4H2WA 2FYKA 3HFZB 1LOJA 4M75C 4A54A 1HXDA 5KNNA 4XU1A 5GAN6 4M75G 1LYLA 1NJ2A 1B7YA 4N0AC 1HC7A 3BJUA 4M78F 3TUPA 3HTZA 2CGHA 3PCOB 3V8LA 3EFSA 3HFOA 4TQDA 1MGQA 3JCMc 2ARTA 5GANe 3A31A 4EMKA 2Q7HA 1E1TA 3M4QA 4M7DA 4PJOA 4K86A 5GMKm 3I7FA 3OD1A 4XU0A 3MF2A 1HTTA 4ZTUB 1WNLA 3L4GB 4YROA 4NL3A 4TVYA 4Q15A 1WQ7A 1I5LA 1EIYB 2RHSB 4LNSA 4YRMA 1EVLA 3HFVA 4CH5A 1E1OA 4TTVA 1X54A 4YCUA 3JB9F 4NOYA 3V8KA 1NYRA 4XU3A 3RUXA 3QNEA 5ELNA 2J3MA 1SRYA 3VQVA 3E9HA 3RGLA 3JCMW 1B70A 2DQ3A 5GAN3 3BW1A 4M7AD 4BWAA 4UP9A 4K88A 2ODRD 3HXWA 1IL2A 5K1PA 5GAOl 3V7SA 1X2HA 4HA8A 1ASYA 1YFSA 2DDZA 4YRGA 4M77E 1X55A 3V7CA 2YLCA 4C8QD 2AMCA 3FJPA 3JCMg 4EMKC 4MMLA 2I4OA 4M7AE 4PJOD 3JB9J 2ALYA 3HFNA 2ZZGA 2DVEA 4M7DG 3AHUA 4PJOC 5GAN2 4NL2A 2AMCB 1N9SA 4N0AA 1B7YB 1EQRA 4H2YA 1LJOA 4M78A 2ZTGA 3JCMb 3QHSA 3V8JA 2I4NA 2ZXFA 4YRLA 1J5WA 1BBUA 3R07A 4C92E 3GIBA 4YP0A 5GAMj 2VXFA 4Q6GA 3REUA 4EMHA 1YFRA 3ICAA 4J5YA 2ODRC 1M5Q1 4H2TA 5HGQA 5GAMf 4YPFA 4RQFA 5GAN8 2CJBA 5LJ3g 3P8TA 1PYSB 5GANf 2ZGWA 4PG3A 5GMKi 3BDUA 4M7AA 3HXVA 2Y90A 5GANg 3L1AA 3SWNC 4C92B 1NJ5A 3ERRA 3A32A 4YCVA 2DXUA 2YHTA 2EJFA 5LJ5e 1H4QA 3UGTA 5GMKh 4PNOA 1WU7A 4OLFA 4XTWA 1QE0A 4M78C 4C92C 4M77A 1FYFA 2ARUA 5LJ3j 4J6XA 4HVCA 3VU3C 4XU2A 4C92D 1B70B 3HXYA 2I4LA 3W3SA 3TEHA 2DEQA 2QHSA 2RB6A 1Y96A 3UGQA 1NJ6A 4J15A 3NETA 3IALA 4UP8A 1L0WA 4KR2A 3JCMP 4M78E 4HT9A 4M75B 3LSSA 3G1ZA 2JN0A 4TWAA 2CJ9A 5GANh 4C92A 2RA2A 4WJ4A 4JLIA 4H02A 4YRCA 4F7UA 3RERA 2ZT5A 2ALYB 3HSBA 3CMQA 4HWTA 5F5WA 4EX5A 4XEOA 2DTHA 1YB3A 3JCMe 1EOVA 1EIYA 1B34B 4C92F 2ZR3A 2G4CA 1JJCA 2QHVA 1WLEA 3NEMA 3REXA 3VQWA 5GAN4 3VQXA 3RKWA 2VXEA 4EMKB 5GAMg 3IG2A 4TVAB 1LNXA 4P73A 3QTCA 2P5IA 4M77D 3JB9G 2DKGA 2EAYA 2E1HA 4J6YA 3HXZA 3MEYA 4P74C 4PJOF 2ZNIA 4F7UG 4XTZA 4M7AF 2ZZEA 3QO8A 2ZR2A 3L2ZA 2P0LA 3MF1A 3INZA 3RF1A 1SESA 1I4K1 2FB7A 4C8QA 3A74A 1U1SA 1SERA 4JRKA 4UPAA 4M7DE 2K57A 1B76A 1C0AA 4TVWA 4P74A 4CS3A 3M4GA 1H641 4HWPA 5K1XA 1I81A 5DY9A 2E5AA 4Y91A 2RHQB 4P71A 5GANd 4CH6A 1BIAA 2HNIA 2YLBA 2QHUA 3JCMV 3JCMh 2RM4A 4TVAA 1QF6A 4UP7A 1USYA 2ZZFA 4M75D 4C8QE 4PJOG 3A5YA 3NELA 1U1TA 4H2XA 3RIRA 2ARSA 3HY0A 4YRPA 5LJ3d 4X9CA 5E3IA 1NJ8A 4RCCA 1SETA 4XTYA 2ZCEA 4P75C 4G85A 3JCMX 2AKWB 1KQ2A 1ADJA 3WQZA 4PHCA 1JBMA 2ZT6A 4YYEA 5C51B 1GGMA 12ASA 1G5IA 2E64A 4BW9A 1YGBA 5LJ5f 3HFZA 4P71C 1G51A 5GAOm 4V2SA 3FIFA 1YFTA 3QUIA 4CS4A 4RQEA 4M7DC 3JCMf 1WPYA 1X01A 1H4SA 3TEGA 1Z7MA 4F7UB 4TQFA 3V7RA 3M4PA 1NJ1A 4F7UF 4M7AG 1JRIA 1X2GA 5GANj 3LC0A 4C8QC 2DU7A 1KQ1A 2E10A 5GAOr 4NCXA 2CJAA 1D3BB 4M75A 4WJ3M 4P73C 4XTVA 3UFGA 3SWNA 2QTXA 4M78D 2E65A 2Q7EA 4M7AC 5LJ5h 3JB9H 4XTUA 2DZCA 3TEHB 5C53B 3A7RA 3QO7A 4X5OA 4WI1A 2DTOA 2DZ9A 4JUVA 2CIMA 2ZNJA 2PMFA 3UH0A 3PGGA 1RIQA 4H2UA 4YREA 4RDXA 5I21A 4XQ3A 3IKMB 1WQWA 3A7AA 5GAOp 2EJ9A
chains in the Genus database with same CATH superfamily
1ZSZB 1TH7A 1IXDA 4E2FB 2BE7D 1JB0E 4KQEA 3RACA 3MQZA 4KRTA 1NYFA 1AT1B 5LJ5g 2I4MA 1O75A 4E6RA 4BACA 2E4HA 1HK9A 3VS5A 4MMKA 3RESA 3QSUA 3PCOA 1ZHIA 1Z9ZA 2L89A 3VS2A 2PMEA 4YRKA 1I8FA 2H8HA 2ZPGB 2I0NA 1Q7YR 3L4GA 1AD5A 4P75A 2DJQA 1HSQA 2KSSA 4HKEA 2DF6A 2K2MA 2C7IA 4KGXB 1M1KU 2M16A 3OYAA 4PKCC 4JJCA 3VJPA 2MMPA 1D3BA 1JJ2S 3CC7Q 2YDLA 6AT1B 4PLIA 3CMEA 5FU6B 4F17A 2XK0A 5LJ3f 3EHQA 4J9EA 1KSWA 1KMNA 2R5MA 3LX7A 2L8DA 1KK7A 1AWXA 1UGPB 3VUBA 1UECA 5GAMe 1X6GA 2Y4YA 2BTTA 3BFMA 3MO8A 1ATIA 4JRIA 3SHWA 2MCNA 4DBQA 2V8KA 3P8YA 1VQLA 5FROA 3MPUB 4FW2A 4EIKA 1GFCA 2KE9A 3HRTA 1X6BA 4TVRA 1M90U 1EZZB 3MJXA 3OYCA 1YIJT 1YHQQ 2O31A 2EWNA 3LW5E 1KOGA 3CCUQ 1KQSA 4O2DA 3PIOA 1OX9A 2ZIMA 4ELYC 2W0ZA 2QAZA 1Y96B 4XTXA 1YCYA 1RAIB 3HXXA 1RAEB 3OS5A 4R56A 1HD3A 3CC4A 4HWRA 3JRZA 1OEBA 4C92G 1K8AR 1KQSP 2GBQA 1D1AA 4WF2A 2VVKA 3CCJT 1K9MU 3A5ZA 3THKA 1IGQA 4BY6B 1G3WA 2MK5A 1ZSGA 1EVKA 4J9BA 2XGTA 2DTIA 4QVCA 1VQ4Q 4QVDA 2RD1A 5CAIA 1AZEA 2RO0A 3QPHA 3HY1A 4CI0C 4LVJA 2FPFA 1VQ9A 1B34A 2XTIA 4ZGDB 1QCNA 2ZIOA 2YUOA 3H9NA 3LSQA 2IY5B 5I2SA 2RK1A 1WHKA 1SRMA 3CXCA 2EJGA 1YITA 4YRJA 2PVGB 1RAHB 2FVUA 4JJNK 2PQWA 2X4YA 2MI6A 3U23A 4H2WA 1BI1A 1LOJA 1JXMA 3CPWP 1VIFA 2O9SA 5GAN6 1M90R 1SF9A 4N0AC 1HC7A 1WHLA 2OJ2A 3GPLA 1ABOA 2GF7A 3V8LA 1VYVA 1SHGA 2QQAA 2WSFE 1QVFS 1QWEA 2D0NA 2DPPB 1FYNA 4EMKA 2K6DA 2Q7HA 1BCOA 1SHFA 3HTRA 4LVKA 4M7DA 3OYEA 3CCLA 4K86A 3OD1A 1AWWA 1HTTA 1Q81C 1WNLA 4IUTA 1OQKA 4E7IA 3OS1A 2R58A 5KYYB 1YHQT 1YIJQ 3TQ7P 1RLPC 1EIYB 3M9QA 1Q82R 3OBWA 2RQWA 1TWBA 2L0AA 1MNEA 1SSHA 1OYXA 1RL2A 1WJSA 2K9GA 4RG2A 1E1OA 1VQOQ 1TSFA 4NOYA 2HBPA 5ELNA 2EQIA 2J3MA 3GP8A 5J39A 1WZOA 5IT9E 3JCMW 4JJBA 3RGLA 3MCAB 2R5AA 2DM1A 4BWAA 2AKKA 1VQNQ 1FX7A 1PG5B 3CCVT 2HKQB 4K88A 4DEYA 2CKKA 5K1PA 5GAOl 1Q7YU 3A8OB 4J8OA 4JS4A 4OMNA 1VIEA 4AT1B 1WDXA 1VQ7Q 3FJPA 3JCMg 3FC3A 2CS7A 1UGVA 1KIKA 2I4OA 5FRMA 2ALYA 3HFNA 3OYMA 1BI3A 2KYBA 3AHUA 4PJOC 1JJ2A 2AMCB 4N0AA 4H2YA 2KI7A 1OV3A 3KBGA 3MP8A 3V8JA 1YWOA 3DB4A 2X4WA 2LCSA 4C92E 3TSWA 5FW9A 3UWNA 3L2QA 3REUA 3EG9A 2ODRC 2EYWA 4A4GA 4FYWB 5GAN8 5CKHA 5LJ3g 3WVEB 1PYSB 2X3WD 2DRMA 4IUUA 4M7AA 2GGRA 2L2PA 4ME7A 5CQXA 4LDYA 2DD4A 2XMFA 1Q7YC 2DX1A 2J7IA 1VQ6A 3GF5A 1SEMA 4PNOA 2AIRB 2EYXA 1Q82U 2X4XA 1VQPT 2F2XA 1QW1A 4XU2A 3VU3C 1B70B 3UATA 1WYXA 2A0FB 2DEQA 1P92A 3UGQA 3QBYA 2QQBA 3ME9A 4M4ZA 1NJ6A 2DVJA 4J15A 4E7ZA 1JEGA 3VS6A 2CP3A 4JRPA 4HT9A 3LSSA 2QI2A 3ZL7C 3L2VA 3CXCS 2JN0A 1KC8R 2HAXA 4C92A 2GFAA 2RI3A 2RA2A 5KCOA 4HWTA 5F5WA 4EX5A 2EQUA 5D6XA 3OW2A 3JCMe 3OS0A 3QJ6A 5CKBA 1EOVA 1B34B 1QVGS 3MEAA 4QQDA 4FM4B 3SEMA 1JJCA 2QHVA 2HSPA 2MPXC 4J9GA 4L59A 3VQWA 3RKWA 3L2RA 5GAMg 4TVAB 3IG2A 2J06A 1FMKA 2DKGA 2EAYA 2ZNIA 1R0CB 3M55A 3CCST 1O9SA 2LT4A 2PUOB 4CC4B 2LDMA 1VQ9T 1W1FA 1NJIU 3G4ST 3CD6A 3RF1A 4C8QA 2FZKB 4B6MA 4M7DE 5HY6A 4OMFB 1QVFP 5GJWB 2RQUA 2JM8A 2K3YA 2RMOA 1X69A 3PTAA 4A63B 5K1XA 3QYHB 3OY9A 2E5AA 2LX9A 1K1ZA 1YJNT 2RHQB 5GANd 4CH6A 2YLBA 2EKOA 4FYVB 2P4TA 4TVAA 1WHHA 4JZ4A 1M2OA 4UP7A 4MZTA 2O4XA 1DJ7B 4H2XA 3I55Q 3CMAQ 3M0TA 4ZTFA 2ARSA 3QKJA 2DIQA 3CCSA 5E3IA 3MEUA 3HRUA 1W6XA 4OB1B 4LVMA 1VQKQ 1N27A 4Y28E 2RJDA 3ZBDA 12ASA 1QCFA 1G5IA 4BW9A 1YGBA 3GOXA 2A36A 5LJ5f 4P71C 5GAOm 3VS3A 4V2SA 3FIFA 2DBMA 1YFTA 1KFZA 1VQ9Q 2RHYA 2RJEA 4LDUA 2CUBA 1AOJA 1RUWA 1XJWB 3PIPA 4M7AG 1H8KA 1JRIA 3LGLA 3EH1A 2XG8D 1WIEA 5KE2A 2QDLA 1I07A 3OSVA 3CCVQ 2XIDA 4NCXA 1D3BB 3LWHA 1T3LA 3A8LB 3J81E 4KULA 1PSFA 4WJ3M 2QK0A 1NBEB 2KROA 3M0UA 1D0ZA 4RTYA 4HCBA 2L3PA 4IIOA 2NUZA 4M78D 3O8VA 2Q7EA 2A7YA 2CZ1B 4JS5A 3JB9H 5FRNA 3E2UA 2DZCA 3CMAT 1RAGB 1K9MR 3E1SA 4BD3A 1KHIA 1E7OA 1MMGA 4HCZA 3QO7A 2DTOA 1BI0A 2O9VA 5KYUB 1R8OB 2V1QA 4JUVA 2KRNA 2O01E 4PFOA 1RAAB 3EGDB 3OMGA 4H2UA 2FZGB 3LH5A 1FMWA 3NTKA 4JRQA 5IXBA 3MKDA 4XQ3A 1W4SA 5A0LA 3A7AA 2EJ9A 4E51A 2M9UA 5GMKj 2E12A 3TEEA 1QLYA 4DBHA 4E7SA 4X9DA 1GRIA 4G84A 2DQ0A 1I5OB 1N9RA 2QHTA 4RTXA 4P3OA 1XTDA 1Y07A 3M4YA 3NHNA 2VWFA 3R6NA 1EX4A 3JCMQ 3RMQA 5A0DA 2DXCA 4KBMB 3VUZA 4KGZB 4RMFA 1X75C 1VQZA 2HQEA 1E24A 1BIBA 2CSIA 4FIBA 5DLQE 4YDQA 2E3CA 2BUDA 1WXBA 4M78G 3FDRA 4FYYB 3MEVA 4OMOA 3SWNB 2KYMA 4E7KA 4M78B 1XOVA 4YRFA 2HZYA 2DAQA 2JVVA 4H2VA 2CZ0B 2DO3A 4AMCA 5LJ3e 1GFDA 3M0RA 1KMMA 4HWOA 3ZEHA 1QWFA 1VQ4A 2NS6A 1MUZA 3PMIA 4M77B 3HRIA 1VQMT 4BE0A 2ZINA 2K3BA 1WXUA 2EGAA 3P8VA 2J3LA 4CH3A 2PTKA 3JB9I 4CS2A 2M0YA 1G3TA 2WACA 2JT4A 4ZN3A 4LVIA 1OPLA 2ZT7A 4LUDA 3CBMA 4J6WA 4PJOB 1PD1A 1Q81R 4YRTA 2JW4A 3E9FA 3OW2S 3M5AA 1VQ5Q 4AH6A 4ELZC 1M8MA 1K76A 1YCSB 3QO3A 1M1GA 5GMKl 5CCAA 11ASA 3VS7A 5KYNA 5IH2A 2RHSA 2DNUA 4M7DD 4K87A 3CC2T 1XNIA 2RHQA 1H4TA 1Z9QA 1TUGB 2GFUA 3C12A 2OTJQ 1BBWA 3O5ZA 4ANJA 2F1LA 4AFQC 2FHDA 1PM3A 1TUCA 1YHQA 1GBQA 4LUEA 1EFNA 3NPFA 2VKNA 1IREB 3SD4A 1YJNQ 3CCEA 4YCWA 3SB2A 1K73C 1RI9A 5CQYA 3CCLT 1KC8U 4ZIBA 3G6EQ 3ER0A 2D1XA 1TXQA 1VQ8Q 2MYSA 4M77F 1U8RA 1TG0A 3OBYA 3PNWC 2E5QA 1VQ8T 4P72C 4P3PA 3S3MA 4ZNXA 4P3NA 2LT1A 2EGEA 4F14A 4J7FA 3BY7A 1VQ8A 3NENA 2ENMA 4M75E 3QZ5B 1ZQ1A 1NNHA 1YP5A 3CC7A 1D1BA 4KR3A 5FU6C 3EFOA 5GJVB 2AKWA 4JDSA 2XDDA 1USYC 3P8DA 4D6WA 4OF1A 2HL3A 4PFZA 2FL7A 4FW1A 1IGUA 4C8QG 2YWWA 2DXBA 4IUVA 2FYKA 4RTWA 3HFZB 1M9SA 1KG1A 4M75C 1SKUB 4A54A 2O4XB 2FPDA 4M75G 1OULA 2QQSA 1B7YA 5FLXE 4RTUA 5HCKA 4PJNA 3PFSA 4M78F 3HTZA 2CGHA 2E6ZA 1VQ5A 3X28B 3CC4T 1E6GA 3CCLQ 5KYYA 1PKSA 4ESRA 5GANe 1UHFA 1Y71A 2E70A 2L3QA 3A31A 3M4QA 2JTMA 3GNFB 4AG2C 1PD0A 1G3SA 3I7FA 4Y92A 4ZTUB 2A28A 2GTOA 4PL6A 3PVQA 2CDTA 1VQNT 1K0SA 2F5TX 1N5ZA 2KK4A 2RHSB 3CPWS 1EVLA 5IHKA 1MV3A 2YXYA 4YCUA 4Z8AA 2DYBA 4XU3A 3QNEA 2ROLA 5I22A 1B70A 5GAN3 3MEWA 1D09B 2LRQA 2AKLA 3BW1A 4M7AD 2HBWA 1IRXA 4UP9A 2JNGA 3RBBB 4BE1A 4J9FA 3FLGA 5HKCA 3V7SA 4CC7A 2DDZA 5C0MA 3I55A 3V7CA 1X55A 2AMCA 3GLXA 4EMKC 3CBPA 2DD5A 2XI9A 3H41A 4MMLA 2J6KA 1W2BP 1M2VA 4MDWA 4KH1B 3S6WA 4M7DG 5GAN2 3S3OA 1J3TA 2EYQA 2EYYA 2C0OA 3QHSA 2I4NA 2ZXFA 4FSSA 3R07A 5GAMj 5ECAA 4Q6GA 1YFRA 2LJ3A 1BCMA 3ICAA 4J5YA 3NTIA 3X20B 4H2TA 5KH6A 5HGQA 5GAMf 3G7ZA 4VUBA 2ZGWA 3N5BB 2MWPA 5GMKi 3HXVA 5GANg 3LGFA 3SWNC 1NJ5A 1VYUA 2JTEA 2G3RA 3A32A 3ERRA 4YCVA 2DXUA 1RACB 2EJFA 2YHTA 3CC2A 2YUPA 2L3SA 4P5NA 4M78C 4C92C 3G1JA 4KUDK 4C92D 4FT4A 3EG3A 4EDUA 2H3EB 4RKUE 3W3SA 1QVGP 2OTLT 1MMDA 2RB6A 1G83A 2L3RA 3IALA 1MV0B 4RTZA 4M78E 2XKOC 1VQMA 2KQWA 4TWAA 2CJ9A 1OU9A 2K7AA 3F70A 3PMTA 4H02A 3UPUA 1YWPA 5IAYA 1ACMB 3G6EA 1WXTA 2ALYB 3CMQA 5FWBA 3CCRQ 5CKEA 4ORZA 1YI2T 1X6OA 2C06A 4QT7A 1EIYA 3VS4A 3CCRT 2JM9A 1VQKA 2G4CA 2AZSA 3REXA 3C95A 1TOVA 2JZ2A 2IG0A 2SEMA 3VQXA 2VUBA 2VXEA 2YSQA 1NEBA 2P5IA 3DB3A 4M77D 4J9CA 3FJ5A 3JB9G 2B86A 4P74C 4J6YA 4OB0B 3MEYA 4F7UG 4XTZA 3QO8A 2DL3A 4KUIA 3TU4K 3GNGA 2E5KA 2P0LA 2YRCA 2L5QA 3INZA 1SESA 5C6SA 2X3XD 1I4K1 2FB7A 1U1SA 1SERA 4UPAA 1MMAA 4P74A 4CS3A 2DERA 1H641 2F2WA 1WJRA 2AZVA 1CKBA 3VS0A 1I81A 2BZ8A 2O2OA 2KNBB 2ZPFB 4R55A 4RUGA 2QHUA 1VQOT 3JCMh 1M1KR 2HL5C 3TSZA 3CD6Q 2DILA 3NELA 4FSXA 1U1TA 3RIRA 2IIMA 1PRMC 1IHWA 1SETA 4XTYA 1M3BA 3OQ5A 4D8KA 4G85A 3KFVA 2AKWB 3CCEQ 3CCQA 4J7IA 4ZTJA 3WQZA 2ZT6A 4HVUA 1I0CA 3CMET 2ZPBB 2GCXA 1B7TA 3M0SA 5DM7R 3G71Q 2ZPIB 2QASA 1TU0B 4MZMA 2IPOB 1PSEA 2WSEE 4RQEA 4M7DC 2QGFB 1H4SA 1AWOA 1WJQA 3G4SA 2RJCA 3V7RA 3OMCA 1NJ1A 5L8RE 2W10A 3LC0A 4C0FA 1QVPA 1KQ1A 5GAOr 2KVQG 3CCQT 2LX7A 1IHVA 4ZN1A 3M57A 2F5KA 3BE3A 1WHGA 3PVLA 3UFGA 2RI5A 1QKWA 3FRNA 2XU8A 4DA4A 2E65A 4M7AC 1Q82C 5LJ5h 1VQ6Q 3VRYA 2YUQA 3QZ9B 2F69A 2LJ0A 4J9HA 1M1KC 4KGVB 2EQKA 4N4GA 4X5OA 3QXEB 4FL6A 1BU1A 1YJ9A 1KC8C 4ZGJB 4CC2A 3EFOB 2DZ9A 3CCET 4Z02A 2ZNJA 2PMFA 2ED0A 3CPWA 1VYTA 4GLMA 3PGGA 1JO8A 2EIFA 4HVVA 4YREA 3I56Q 1T0HA 2A08A 3OYNA 2NUPB 2HEQA 3IKMB 2EKHA 1GBRA 1X43A 5HK3A 3TCJA 1BK2A 4DQ2A 3T9NA 1VQPA 1QCOA 2MOXA 3L2WA 1IB8A 2RH2A 1TS9A 2HQXA 4M7AB 1JJCB 5KYXA 4PK4A 3HXUA 1CSKA 4H2SA 3OYHA 2DL4A 3QYGB 2H3JA 1B07A 3VYHB 3HRKA 3EG2A 3EG1A 1ASZA 1WA7A 2XHCA 5LJ5j 2M0OA 2JUFA 4QQGA 5C52B 1OU8A 3REBB 1X27A 1D1CA 1IO6A 1VQKT 2I2LA 1RADB 2VYTA 1JXOA 4H2XB 4EO4A 1M4ZA 3A8MB 8AT1B 1X2KA 4HT4A 2EQJA 3P8HA 3X24B 1B3QA 2M02A 3VBBA 4OB2B 4RTVA 5M9OA 3JCMJ 4CH4A 1UGRB 2RQRA 5GAN7 1WYDA 4LDXA 2P84A 2E41A 1LPLA 1GCQA 3RKYA 3FB9A 1V29B 1LCKA 1FMVA 4DOVA 4A4KA 3CC7T 1VOMA 3EAEA 1ADYA 2ZT8A 2KGTA 2HD0A 3CCQQ 2P0KA 4AFUC 2NWMA 3JCMd 4PJJA 5GAMh 5LJ3h 3CCVA 3HPWA 3CEYA 3E9IA 4YRQA 5CVIA 1Y7XA 3P8BB 4OP0A 4A4FA 4AFZC 4B9XA 4XEMA 1YJWQ 4ZTZB 3UA7A 1MMNA 3RL6A 2C8MA 4L87A 2D8HA 3S3NA 3DSQA 2RHUA 4C8QF 2KRSA 3EH2A 3CMEQ 4P72A 2A37A 4YRIA 1SPKA 4O6JA 4EMGA 3OYDA 2Q5HA 1ZUUA 3OYKA 1EFWA 5GAOn 3D7SB 4QQ6A 2KXDA 1A0NB 3VRZA 1UHCA 5HK0A 4LN2A 1YITQ 2CP0A 1NJIC 5ELOA 3VS1A 2PNIA 1BKBA 2X51A 1M3AA 4LXCA 2FRWA 3A8HB 3OSSC 3BDLA 3UA6A 1E22A 1H4VB 4YRNA 4L5GA 2EL9A 2RJFA 4M77G 2FEIA 5IHNA 5KCHA 5CK9A 3CPFA 3WXMB 2X4JA 1JQQA 1KD1C 1VQ4T 5A0GA 2COZA 2R57A 4QW2A 2BKDN 1VQLQ 3RR6A 1NJIR 2LC4A 2QDYB 3C94A 5I11A 1HXDA 1UG1A 2DFUA 1LYLA 1NJ2A 3HKSA 1VQ7A 2CSQA 3HFOA 4X34A 4TQDA 1MGQA 3JCMc 2ARTA 2Y4XA 2DIGA 3EGXA 3RMSA 5GMKm 4Z89A 3MF2A 4OVAA 2AHJB 2QQ9A 4YROA 1XQHA 1M27C 4NL3A 4OMLA 2RHIA 4TVYA 1K0XA 4BE2A 1QVFA 4Q15A 1X2QA 2QEXQ 4YRMA 2GQIA 3PT9A 2HQHA 4CH5A 1YNZA 3RNJA 3SFMA 1VQ7T 1X54A 3JB9F 4OMPA 1NYRA 3RUXA 2PU9B 1SG5A 3UDCA 1SRYA 3VQVA 1H92A 3MP1A 5KYUA 4F16A 2DBKA 2K3XA 1UB4A 2OTJT 4FU6A 2YRVA 3M53A 2ZAEA 3JV3A 2XDPA 2D8JA 3GBQA 1Q95G 2DMOA 2A8EA 1G8XA 1OZ3A 2RN8A 3OYLA 4HA8A 1ASYA 1S72A 1N8RR 2ECZA 1YFSA 2LNVA 3HRSA 1U06A 1OI1A 4YRGA 4M77E 1R0BG 2YLCA 1T3SA 4KT0E 2KR3A 2LP5A 1C0MA 3MP6A 4L6V5 1D0XA 4M7AE 4PJOD 1HJDA 2ZZGA 3JAME 4BDYA 1N9SA 4QVZA 1B7YB 2CP5A 2ZTGA 3JCMb 1F1BB 2ZPHB 4J9IA 2FZCB 3GIBA 5KYWA 1S72T 3C0CA 4YP0A 4II1A 4EMHA 1YFNA 1WHJA 1M5Q1 1K73R 3P8TA 3IQLA 1UE9A 4FT2A 3L1AA 4C92B 2SRCA 2JMCA 4C5HA 2DL7A 4BB7A 3CBOA 3H6ZA 3OA6A 4J83A 4C0DC 1YJWA 1NPRA 2KXCA 2VV5A 1VQMQ 3UGTA 4RMOA 3CCJA 4DEXA 3OW2P 2E3HA 1WU7A 3A98A 4XTWA 3NMZC 2OTLQ 2CZ7B 3LH0A 4M77A 4XAXB 1FYFA 1PKTA 4J6XA 5LJ3j 2XDBA 2ARUA 4HVCA 4FYXB 2I4LA 1CKAA 1Y96A 2FPEA 4C0DB 3EG9B 2EQMA 4UP8A 2LCLA 1YJ9Q 4KR2A 3JCMP 2XD0A 2Z0WA 3HP9A 5J26A 3G1ZA 3ZFJA 4KH0B 2M1HA 3A5ZB 3ASKA 1AEYA 2BIVA 4WTOB 4OGCA 1JJ2P 2YT6A 4WJ4A 1FWZA 4HXJA 4C0GA 4YRCA 4F7UA 1N8RU 2RK2A 4E47A 1S72Q 8ATCB 3OYIA 2WSCE 3CCMQ 7AT1B 2ABLA 4C92F 2HCKA 1ZSZC 3CCMT 2ZR3A 1BB9A 4JLGA 1WLEA 2FG0A 1Q86C 2P0QA 1ABQA 2DK3A 1VUBA 3AT1B 4P73A 3QTCA 4OMMA 2KEAA 3CCUA 1K8AU 4GBQA 2ZZEA 2NYSA 1K9MC 2ZR2A 3L2ZA 3MF1A 1K73U 2COWA 2LMJA 2QTVA 4JRKA 3RDVA 2K57A 1M1FA 2GNCA 3DKMA 1C0AA 3M4GA 1W2BA 1MNDA 3DLLA 2PVDB 1S1NA 1NPPA 5DY9A 1NM7A 2OTLA 4LVLA 1BIAA 1WFWA 2JXBA 1QP3A 2QYZA 2CP6A 2EPDA 2JTFA 2RM4A 4FCYA 1QF6A 4C5GA 3WVDB 2J6OA 1GXIE 1D0YA 3A5YA 2K79A 3EHRA 4OMQA 2CH4W 4YRPA 1NJ8A 4RCCA 3QDFA 4D8DA 3LYIA 2AT1B 3JCMX 3M58A 1KQ2A 4PHCA 5A2QE 5C51B 1GGMA 2E3IA 2E64A 2ZCFB 1V76A 1G51A 3KXTA 2KT8A 3JCMf 3I35A 3MHXA 2DA9A 3TEGA 1Z7MA 4F7UB 1QVGA 4F7UF 4C0ZA 4LD9K 2LQWA 2DU7A 2CT4A 2C0TA 2P4RA 5FU7B 2CJAA 1ZA1B 3NFCA 2CT3A 1ZLMA 4M75A 3G6ET 1RABB 4XTVA 2QA4Q 2KBTA 1JU5C 2QTXA 3PE0A 2LCCA 2D9TA 2QA4T 4XTUA 1UJYA 2RQTA 2V8JA 3TEHB 2V8IA 1NG2A 4ATOA 2EVRA 2O88A 3VKIA 4OB3B 3A7RA 4MDXA 4WI1A 1QQJA 2GQVA 1UGSB 2LVMA 2HSEB 2CIMA 2CP7A 1R77A 3EG0A 3Q1JA 1H3HA 2DRKA 4X1VA 3NTHA 1QMCA 1YJNA 1YI2Q 4LD6A 1VQ5T 4PJMA 2J05A 4IUQA 2QQRA 3J7AF 2QGGA 1YJWT 4YRSA 1TUDA 4YRRA 1M8VA 2OAUA 3CC2Q 1T0JA 1Y57A 2K2VA 1NEGA 1K4US 2PZ1A 2KY9A 2EW3A 4F7UE 1TTHB 4M77C 3QIIA 5GAMd 4IIMA 4PJLA 1YIJA 5GAN5 1PCXA 1ZUYA 4LDVA 3OYJA 3H0IA 2RF0A 4RTTA 2B8AA 1GL5A 3EGDA 1Z7NA 3OS2A 1KJWA 2CP2A 3H0HA 3I9QA 1PYSA 1U5SA 4J9DA 4BI4A 2CUDA 2GTJA 4LDWA 4GLKA 3JSCA 1NYQA 1OOTA 1V1CA 4MZPA 4A53A 2DJZA 1WGSA 4M7DB 1X56A 1W2BS 4HT8A 4M7DF 4IUPA 4DPGA 4PFPA 3PZCA 3VQYA 2Q5IA 1SRLA 3E19A 1PC0A 3RKXA 1UFFA 2NLUA 2BE9B 4K11A 3X26B 2C0IA 3TVTA 5GAOq 1N6AA 1YBYA 4WCIA 3KFUA 1NYGA 1KQSS 3JB9D 4DOWA 3UF4A 3EGUA 1ZSZA 1AZGB 2V26A 3IKLA 2D0QB 2JS0A 3J80E 2ROTA 5D6YA 5IHIA 1N9WA 2DXTA 2JOYA 2MAMA 2FO0A 2K5LA 5CIUA 5KYWB 3R6OA 3EFRA 4PJOE 1NLPC 4PLLA 2HKNA 2OAWA 2VC8A 3A7UA 2QG9B 3EGXB 1G5HA 4RCBA 5EC7A 4CRIA 2PVOB 3REAB 1M30A 3META 1RLQC 4QKUA 3L2UA 1PRLC 5GMKe 5LJ5d 2IY5A 4HWSA 4DBRA 4LNPA 4DBFA 4C5EA 4M75F 2DU5A 1QKXA 3OYGA 4C8QB 3VV0A 1M2VB 2OI3A 2RQVA 4BI3A 3FEOA 2DETA 4C5IA 4IKFA 2A3LA 3G71A 1EIFA 1GCPA 4LE9A 3G71T 2Q7GA 4A4EA 1W66A 1B8AA 3C4SA 4JZ3A 2JS2A 2KMTA 3QO5A 3LWIA 2D6FA 1C1AA 1NZ9A 1HYOA 5IN1A 2NUPA 3KUFA 5KNNA 4XU1A 2ED1A 3A8GB 1UGQB 1AWJA 2QEXA 3HL8A 3L42A 3BJUA 3TUPA 2DE0X 2X9HA 1VQPQ 3PCOB 3EFSA 5EG2A 2AK5A 1IZ6A 5KYXB 3M0PA 2HDAA 1E1TA 4N4IA 4PJOA 2KDSA 3I56A 4XU0A 3L4GB 1N8RC 5I2MA 4F04B 1WQ7A 1I5LA 4O5VA 4LNSA 3H8ZA 3CMAA 3HFVA 1K9AA 3H0FA 3I5RA 1ZA2B 4Q5WA 4XK8E 4TTVA 1M90C 4NS5A 1MHNA 3V8KA 2ESWA 1Q86U 1UEBA 3E9HA 4B9WA 2DQ3A 3ULRB 2PUKB 1K8AC 2ODRD 4BY6C 3HXWA 4AG1C 1IL2A 2EFIA 3A1PA 1X2HA 1YITT 1W70A 2NUTB 2RHXA 4C8QD 2JMAA 2RPNA 2YRDA 3I55T 3JB9J 3M56A 5LL6S 2DVEA 2FRYA 1ARKA 4NL2A 1GCQC 1EQRA 1LJOA 4M78A 3VYGA 2MF2A 4YRLA 4JPBW 5CKDA 1J5WA 1BBUA 1VQNA 4CC3A 2VXFA 5AYFA 9ATCB 2K5FA 4YPFA 4RQFA 2CJBA 5J3BA 5GANf 4PG3A 2DLPA 2OTJA 2VGMA 3BDUA 2EBPA 2ZPEB 2Y90A 2ZZDA 1PWTA 2P0PA 4RG8A 2YUNA 1I1JA 2EGCA 3M59A 5LJ5e 1YJ9T 1H4QA 2XICA 3UT1A 5GMKh 3OYBA 2OX7A 1WI7A 4OLFA 2CYZB 1QE0A 5L23A 1OPKA 3OYYA 2QA4A 2CREA 2VB6A 3HXYA 2CZ6B 3TEHA 2QHSA 1OX8A 1Q86R 3CD6T 1KD1R 2DYIA 4N4HA 4GY5A 3QDRB 3NETA 1L0WA 1H3ZA 3CQTA 3M0QA 5D7UA 1UDLA 4M75B 5DLOA 1BYMA 1RI0A 1WHMA 5GANh 4AFSC 2E6NA 2VASA 4JLIA 4Z88A 1Q81U 3RERA 2ZT5A 3HSBA 2HMAA 4IURA 4XEOA 2DTHA 1YB3A 1VQLT 1PNJA 2RHZA 1ZUKA 1M3CA 3QWYA 3URGA 3NEMA 4OGEA 5GAN4 3CCRA 4BUGA 1VA7A 4EMKB 1LNXA 1WX6A 2LQ8A 2E1HA 3HXZA 4PJOF 1KHCA 4M7AF 3E9GA 1ZBJA 2MIOA 2F2VA 2K4YA 4HCKA 1UJ0A 1U3OA 3A74A 2COYA 3I5SA 2IVWA 1B76A 2KRMA 4YTLA 1YN8A 4TVWA 4EPCA 2MWOA 1Y0MA 2ATCB 4HWPA 2LZ6B 1G5VA 1VQ6T 5CKFA 4Y91A 4P71A 3CCSQ 2HNIA 2CH4A 1WLPB 3JCMV 1BBZA 5IXFA 5FU7C 3QWXX 1VQOA 2LJ1A 1USYA 2ZZFA 2K5IA 4M75D 4C8QE 4PJOG 2BZXA 1ZX6A 1KD1U 5CO7A 1NLOC 3HY0A 4E7JA 5LJ3d 3I56T 4X9CA 3OB9A 1RAFB 2DL5A 3M54A 2ZCEA 3CCUT 1PHTA 4E7LA 4P75C 1LVKA 3OYFA 2LQKA 2QXFA 2X35A 3HHTB 1ADJA 4E7HA 3LLRA 4R0KA 1JBMA 4YYEA 4JJDA 3TREA 3CCMA 1G3YA 3HFZA 1G2BA 2QEXT 5AT1B 1SSFA 1OZ2A 3QUIA 5D6WA 4CS4A 2J6FA 5CR2A 3G4SQ 1WPYA 3CCJQ 1X01A 3CXCP 1NE8A 4TQFA 2RNAA 3M4PA 4HVWA 1X2GA 5GANj 1ZBXA 2NUTA 4C8QC 3QJYA 3QG1A 2E10A 3NGPA 4BI8B 2RI2A 2EYZA 2V1RA 1YI2A 2DEUA 1E6HA 2LNHB 4UC4A 4P73C 2VGNA 1UUEA 5FWCA 3SWNA 5KE3A 1AHJB 3X25B 2KAFA 1C6VX 1FXXA 2LQNA 5C53B 1QP2A 1UTIA 2LTOA 2BZYA 2G6FX 2KT1A 3UH0A 1RIQA 2M51A 1AVZC 4ZGEB 3SDZA 4RDXA 4BDZA 4A4HA 2JJ9A 4HCCA 3DLMA 5I21A 1WQWA 1BI2A 5GAOp 3CC4Q 2DL8A
chains in the Genus database with same CATH topology
1TH7A 1JB0E 4KQEA 3RACA 3MQZA 5LJ5g 2I4MA 1O75A 4BACA 1HK9A 4MMKA 3RESA 3QSUA 3PCOA 1ZHIA 2L89A 2PMEA 4YRKA 1I8FA 2ZPGB 3L4GA 4P75A 2KSSA 4HKEA 2C7IA 1M1KU 2M16A 3OYAA 4PKCC 3VJPA 2MMPA 1D3BA 1JJ2S 4PLIA 3CMEA 5FU6B 2XK0A 5LJ3f 1KMNA 2R5MA 3LX7A 2L8DA 1UGPB 3VUBA 5GAMe 2Y4YA 3BFMA 3MO8A 1ATIA 4JRIA 2V8KA 3P8YA 1VQLA 5FROA 3HRTA 4TVRA 1M90U 3OYCA 1YIJT 2EWNA 3LW5E 1KOGA 1KQSA 4O2DA 3PIOA 2ZIMA 4ELYC 1Y96B 4XTXA 1YCYA 3HXXA 3OS5A 4R56A 3CC4A 4HWRA 3JRZA 4C92G 4WF2A 1K9MU 3CCJT 3A5ZA 4BY6B 1G3WA 1EVKA 2XGTA 2DTIA 4QVCA 4QVDA 2RD1A 5CAIA 2RO0A 3QPHA 3HY1A 4CI0C 4LVJA 1VQ9A 1B34A 2XTIA 4ZGDB 2ZIOA 3LSQA 2IY5B 5I2SA 2RK1A 3CXCA 2EJGA 1YITA 4YRJA 2PVGB 2FVUA 4JJNK 2PQWA 2X4YA 2MI6A 4H2WA 1BI1A 1LOJA 1VIFA 5GAN6 4N0AC 1HC7A 3GPLA 2GF7A 3V8LA 2QQAA 2WSFE 1QVFS 2DPPB 4EMKA 2Q7HA 4LVKA 4M7DA 3OYEA 3CCLA 4K86A 3OD1A 1HTTA 1Q81C 1WNLA 4IUTA 4E7IA 3OS1A 2R58A 1YHQT 1EIYB 3M9QA 3OBWA 4RG2A 1OYXA 1RL2A 1WJSA 1E1OA 4NOYA 2HBPA 5ELNA 2J3MA 3GP8A 5J39A 3RGLA 5IT9E 3JCMW 3MCAB 2R5AA 4BWAA 1FX7A 3CCVT 4K88A 2CKKA 5K1PA 5GAOl 1Q7YU 3A8OB 4J8OA 4JS4A 1VIEA 3FJPA 3JCMg 3FC3A 2CS7A 2I4OA 5FRMA 2ALYA 3HFNA 3OYMA 1BI3A 3AHUA 4PJOC 1JJ2A 2AMCB 4N0AA 4H2YA 3KBGA 3MP8A 3V8JA 3DB4A 2X4WA 4C92E 3UWNA 3REUA 3L2QA 2ODRC 4A4GA 5GAN8 5CKHA 5LJ3g 3WVEB 1PYSB 4IUUA 4M7AA 4ME7A 5CQXA 4LDYA 2DD4A 1Q7YC 1VQ6A 3GF5A 4PNOA 1Q82U 2X4XA 1VQPT 3VU3C 1QW1A 4XU2A 1B70B 2DEQA 1P92A 3UGQA 3QBYA 2QQBA 3ME9A 1NJ6A 4J15A 4JRPA 4HT9A 3LSSA 2QI2A 3L2VA 3CXCS 2JN0A 2HAXA 4C92A 2GFAA 2RI3A 2RA2A 5KCOA 4HWTA 5F5WA 4EX5A 2EQUA 5D6XA 3OW2A 3JCMe 3OS0A 3QJ6A 5CKBA 1EOVA 1B34B 1QVGS 3MEAA 4QQDA 4FM4B 1JJCA 2QHVA 4L59A 3VQWA 3RKWA 3L2RA 5GAMg 4TVAB 3IG2A 2DKGA 2EAYA 2ZNIA 3M55A 3CCST 1O9SA 2LT4A 2PUOB 2LDMA 1VQ9T 1NJIU 3CD6A 3G4ST 3RF1A 4C8QA 4M7DE 5HY6A 4OMFB 2K3YA 3PTAA 5K1XA 3QYHB 3OY9A 2E5AA 2LX9A 1YJNT 2RHQB 5GANd 4CH6A 2YLBA 2EKOA 2P4TA 4TVAA 4UP7A 4MZTA 2O4XA 1DJ7B 4H2XA 2ARSA 4ZTFA 3QKJA 2DIQA 3CCSA 5E3IA 3MEUA 3HRUA 4OB1B 4LVMA 1N27A 4Y28E 2RJDA 3ZBDA 12ASA 1G5IA 4BW9A 1YGBA 3GOXA 5LJ5f 4P71C 5GAOm 4V2SA 3FIFA 1YFTA 2RHYA 2RJEA 4LDUA 3PIPA 4M7AG 1JRIA 3LGLA 2XG8D 5KE2A 3OSVA 2XIDA 4NCXA 1D3BB 3LWHA 3A8LB 3J81E 4KULA 1PSFA 4WJ3M 4HCBA 4M78D 3O8VA 2Q7EA 2A7YA 2CZ1B 4JS5A 3JB9H 5FRNA 2DZCA 3CMAT 3E1SA 4BD3A 1KHIA 4HCZA 3QO7A 2DTOA 1BI0A 1R8OB 4JUVA 2O01E 3OMGA 4H2UA 3NTKA 4JRQA 4XQ3A 1W4SA 5A0LA 3A7AA 2EJ9A 4E51A 2M9UA 5GMKj 2E12A 3TEEA 4X9DA 4G84A 2DQ0A 2QHTA 1N9RA 4P3OA 1XTDA 1Y07A 3M4YA 3JCMQ 3RMQA 5A0DA 2DXCA 4KBMB 3VUZA 4RMFA 1X75C 1VQZA 2HQEA 1E24A 1BIBA 4FIBA 5DLQE 4YDQA 2E3CA 2BUDA 4M78G 3FDRA 3MEVA 3SWNB 4E7KA 4M78B 1XOVA 4YRFA 2DAQA 2JVVA 4H2VA 2CZ0B 2DO3A 5LJ3e 1KMMA 4HWOA 3ZEHA 1VQ4A 2NS6A 3PMIA 4M77B 3HRIA 1VQMT 4BE0A 2ZINA 3P8VA 2J3LA 4CH3A 3JB9I 4CS2A 1G3TA 2WACA 4ZN3A 4LVIA 2ZT7A 3CBMA 4J6WA 4PJOB 4YRTA 3E9FA 3OW2S 3M5AA 4AH6A 4ELZC 3QO3A 1M1GA 5GMKl 5CCAA 11ASA 2RHSA 4M7DD 4K87A 3CC2T 1XNIA 2RHQA 1H4TA 2GFUA 3C12A 1BBWA 2FHDA 1YHQA 1IREB 3SD4A 4YCWA 3CCEA 3SB2A 1K73C 5CQYA 3CCLT 1KC8U 4ZIBA 3ER0A 4M77F 1U8RA 3OBYA 3PNWC 2E5QA 1VQ8T 4P72C 4P3PA 3S3MA 4P3NA 2LT1A 1VQ8A 4J7FA 3BY7A 3NENA 4M75E 3QZ5B 1ZQ1A 1NNHA 3CC7A 4KR3A 5FU6C 2AKWA 4JDSA 2XDDA 1USYC 3P8DA 4D6WA 4OF1A 2FL7A 4C8QG 2DXBA 4IUVA 2FYKA 3HFZB 1M9SA 1KG1A 4M75C 4A54A 2O4XB 4M75G 2QQSA 1B7YA 5FLXE 3PFSA 4M78F 3HTZA 2CGHA 2E6ZA 1VQ5A 3X28B 3CC4T 5GANe 1Y71A 3A31A 2E70A 3M4QA 2JTMA 3GNFB 1G3SA 3I7FA 4ZTUB 4PL6A 1VQNT 2F5TX 2KK4A 2RHSB 3CPWS 1EVLA 4YCUA 4XU3A 3QNEA 1B70A 5GAN3 3MEWA 2LRQA 3BW1A 4M7AD 4UP9A 2JNGA 4BE1A 3FLGA 5HKCA 3V7SA 2DDZA 5C0MA 3I55A 3V7CA 1X55A 2AMCA 3GLXA 4EMKC 3CBPA 2DD5A 2XI9A 4MMLA 4MDWA 3S6WA 4M7DG 5GAN2 3S3OA 2EYQA 3QHSA 2I4NA 2ZXFA 3R07A 5GAMj 4Q6GA 1YFRA 3ICAA 4J5YA 3NTIA 3X20B 4H2TA 5KH6A 5HGQA 5GAMf 3G7ZA 4VUBA 2ZGWA 3N5BB 2MWPA 5GMKi 3HXVA 5GANg 3LGFA 3SWNC 1NJ5A 2G3RA 3A32A 3ERRA 4YCVA 2DXUA 2YHTA 2EJFA 3CC2A 4P5NA 4M78C 4C92C 4KUDK 4C92D 4FT4A 4EDUA 4RKUE 3W3SA 2OTLT 2RB6A 2L3RA 3IALA 4M78E 2XKOC 1VQMA 2KQWA 4TWAA 2CJ9A 3F70A 3PMTA 4H02A 3UPUA 5IAYA 3G6EA 2ALYB 3CMQA 5CKEA 1YI2T 1X6OA 2C06A 1EIYA 3CCRT 1VQKA 2G4CA 3REXA 3C95A 2JZ2A 2IG0A 3VQXA 2VUBA 2VXEA 2P5IA 3DB3A 4M77D 3JB9G 4P74C 4J6YA 4OB0B 3MEYA 4F7UG 4XTZA 3QO8A 4KUIA 3TU4K 3GNGA 2P0LA 2L5QA 3INZA 1SESA 5C6SA 1I4K1 2FB7A 1U1SA 1SERA 4UPAA 4P74A 4CS3A 1H641 1WJRA 1I81A 2ZPFB 4R55A 2QHUA 1VQOT 3JCMh 3NELA 4FSXA 1U1TA 3RIRA 1SETA 4XTYA 3OQ5A 4G85A 2AKWB 3CCQA 4J7IA 4ZTJA 3WQZA 2ZT6A 3CMET 2ZPBB 2GCXA 5DM7R 2ZPIB 4MZMA 1PSEA 2WSEE 4RQEA 4M7DC 1H4SA 1WJQA 3G4SA 2RJCA 3V7RA 3OMCA 1NJ1A 5L8RE 3LC0A 4C0FA 1QVPA 1KQ1A 5GAOr 2KVQG 3CCQT 4ZN1A 3M57A 2F5KA 3UFGA 2RI5A 3FRNA 2XU8A 4DA4A 2E65A 4M7AC 1Q82C 5LJ5h 3QZ9B 2F69A 1M1KC 2EQKA 4N4GA 4X5OA 3QXEB 4FL6A 1YJ9A 1KC8C 4ZGJB 2DZ9A 3CCET 4Z02A 2ZNJA 2PMFA 3CPWA 3PGGA 2EIFA 4YREA 3OYNA 3IKMB 5HK3A 3TCJA 4DQ2A 3T9NA 1VQPA 3L2WA 2RH2A 2HQXA 4M7AB 1JJCB 3HXUA 4H2SA 3OYHA 3QYGB 2H3JA 3VYHB 3HRKA 1ASZA 2XHCA 5LJ5j 2M0OA 2JUFA 4QQGA 5C52B 1VQKT 2I2LA 2VYTA 4H2XB 4EO4A 1M4ZA 3A8MB 4HT4A 2EQJA 3P8HA 3X24B 3VBBA 4OB2B 5M9OA 3JCMJ 4CH4A 1UGRB 5GAN7 1WYDA 4LDXA 2E41A 3RKYA 3FB9A 1V29B 4DOVA 4A4KA 3CC7T 3EAEA 1ADYA 2ZT8A 2HD0A 2P0KA 3JCMd 5GAMh 5LJ3h 3CCVA 3HPWA 3CEYA 3E9IA 4YRQA 5CVIA 1Y7XA 3P8BB 4OP0A 4A4FA 4B9XA 4XEMA 4ZTZB 3RL6A 2C8MA 4L87A 3S3NA 3DSQA 2RHUA 4C8QF 4P72A 4YRIA 4O6JA 4EMGA 3OYDA 2Q5HA 3OYKA 1EFWA 5GAOn 4QQ6A 5HK0A 1NJIC 5ELOA 1BKBA 3A8HB 3OSSC 3BDLA 1E22A 1H4VB 4YRNA 4L5GA 2EL9A 2RJFA 4M77G 5KCHA 5CK9A 3CPFA 3WXMB 2X4JA 1KD1C 1VQ4T 5A0GA 2R57A 4QW2A 2BKDN 2LC4A 2QDYB 3C94A 1HXDA 1LYLA 1NJ2A 3HKSA 1VQ7A 3HFOA 4X34A 4TQDA 1MGQA 3JCMc 2ARTA 2Y4XA 2DIGA 3RMSA 5GMKm 3MF2A 4OVAA 2AHJB 2QQ9A 4YROA 1XQHA 4NL3A 2RHIA 4TVYA 4BE2A 1QVFA 4Q15A 4YRMA 4CH5A 3PT9A 3SFMA 1VQ7T 1X54A 3JB9F 1NYRA 3RUXA 2PU9B 3UDCA 1SRYA 3VQVA 3MP1A 2K3XA 1UB4A 2OTJT 4FU6A 2YRVA 3M53A 2XDPA 2A8EA 1OZ3A 3OYLA 4HA8A 1ASYA 1S72A 1YFSA 2LNVA 3HRSA 1OI1A 4YRGA 4M77E 2YLCA 4KT0E 3MP6A 4L6V5 4M7AE 4PJOD 2ZZGA 3JAME 4BDYA 1N9SA 4QVZA 1B7YB 2ZTGA 3JCMb 2ZPHB 3GIBA 1S72T 4YP0A 4II1A 4EMHA 1M5Q1 3P8TA 4FT2A 3L1AA 4C92B 4C5HA 4BB7A 3CBOA 3H6ZA 3OA6A 4J83A 4C0DC 1YJWA 1NPRA 2VV5A 3UGTA 4RMOA 3CCJA 1WU7A 4XTWA 2CZ7B 3LH0A 4M77A 2ARUA 4XAXB 5LJ3j 4J6XA 2XDBA 1FYFA 4HVCA 2I4LA 1Y96A 4C0DB 2EQMA 4UP8A 2LCLA 4KR2A 3JCMP 2XD0A 3HP9A 5J26A 3G1ZA 3ZFJA 2M1HA 3A5ZB 3ASKA 2BIVA 4OGCA 4WJ4A 1FWZA 4C0GA 4YRCA 4F7UA 1N8RU 2RK2A 4E47A 3OYIA 2WSCE 4C92F 3CCMT 2ZR3A 4JLGA 1WLEA 1Q86C 2P0QA 2DK3A 1VUBA 4P73A 3QTCA 3CCUA 1K8AU 2ZZEA 1K9MC 2ZR2A 3L2ZA 3MF1A 1K73U 4JRKA 2K57A 1M1FA 3DKMA 1C0AA 3M4GA 1W2BA 3DLLA 2PVDB 1NPPA 5DY9A 2OTLA 4LVLA 1BIAA 1QP3A 2JTFA 2RM4A 1QF6A 4C5GA 3WVDB 1GXIE 3A5YA 4YRPA 1NJ8A 4RCCA 3LYIA 3JCMX 3M58A 1KQ2A 4PHCA 5A2QE 5C51B 1GGMA 2E64A 2ZCFB 1G51A 3KXTA 3JCMf 3MHXA 3TEGA 1Z7MA 4F7UB 1QVGA 4F7UF 4C0ZA 4LD9K 2DU7A 5FU7B 2CJAA 3NFCA 4M75A 3G6ET 4XTVA 2QTXA 2LCCA 2D9TA 2QA4T 4XTUA 2V8JA 3TEHB 2V8IA 4ATOA 3VKIA 4OB3B 3A7RA 4MDXA 4WI1A 2GQVA 1UGSB 2LVMA 2CIMA 3Q1JA 3NTHA 1YJNA 4LD6A 1VQ5T 4IUQA 2QQRA 3J7AF 1YJWT 4YRSA 4YRRA 1M8VA 2OAUA 2K2VA 2KY9A 4F7UE 4M77C 3QIIA 5GAMd 1YIJA 5GAN5 4LDVA 3OYJA 2B8AA 1Z7NA 3OS2A 1PYSA 4BI4A 4LDWA 4GLKA 3JSCA 1NYQA 4MZPA 4A53A 2DJZA 1WGSA 1X56A 4M7DB 1W2BS 4HT8A 4M7DF 4IUPA 4DPGA 3PZCA 3VQYA 2Q5IA 3E19A 3RKXA 2NLUA 3X26B 5GAOq 1N6AA 1YBYA 3KFUA 1KQSS 3JB9D 4DOWA 3IKLA 2D0QB 3J80E 5D6YA 1N9WA 2DXTA 2JOYA 2MAMA 2K5LA 5CIUA 3R6OA 3EFRA 4PJOE 4PLLA 2VC8A 3A7UA 1G5HA 4RCBA 4CRIA 2PVOB 3META 3L2UA 5GMKe 5LJ5d 2IY5A 4HWSA 4C5EA 4M75F 2DU5A 3OYGA 4C8QB 3VV0A 4BI3A 3FEOA 4C5IA 4IKFA 2A3LA 3G71A 1EIFA 3G71T 2Q7GA 4A4EA 1W66A 1B8AA 3C4SA 2KMTA 3QO5A 3LWIA 2D6FA 1NZ9A 5IN1A 3KUFA 5KNNA 4XU1A 3A8GB 1UGQB 2QEXA 3HL8A 3L42A 3BJUA 3TUPA 3PCOB 3EFSA 5EG2A 1IZ6A 1E1TA 4N4IA 4PJOA 2KDSA 3I56A 4XU0A 3L4GB 1N8RC 5I2MA 1WQ7A 1I5LA 4O5VA 4LNSA 3H8ZA 3CMAA 3HFVA 4Q5WA 4XK8E 4TTVA 1M90C 4NS5A 1MHNA 3V8KA 1Q86U 1UEBA 3E9HA 4B9WA 2DQ3A 2PUKB 1K8AC 2ODRD 4BY6C 3HXWA 1IL2A 2EFIA 1X2HA 1YITT 2RHXA 4C8QD 3I55T 3JB9J 3M56A 5LL6S 2DVEA 4NL2A 1EQRA 1LJOA 4M78A 3VYGA 2MF2A 4YRLA 5CKDA 1J5WA 1BBUA 1VQNA 2VXFA 5AYFA 2K5FA 4YPFA 4RQFA 2CJBA 5J3BA 5GANf 4PG3A 2OTJA 2VGMA 3BDUA 2ZPEB 2Y90A 2ZZDA 2P0PA 4RG8A 3M59A 5LJ5e 1YJ9T 1H4QA 2XICA 3UT1A 5GMKh 3OYBA 4OLFA 2CYZB 1QE0A 3OYYA 2QA4A 3HXYA 2CZ6B 3TEHA 2QHSA 3CD6T 4N4HA 4GY5A 3QDRB 3NETA 1L0WA 1H3ZA 5DLOA 1BYMA 4M75B 1RI0A 5GANh 2E6NA 4JLIA 1Q81U 3RERA 2ZT5A 3HSBA 4IURA 4XEOA 2DTHA 1YB3A 1VQLT 2RHZA 3URGA 3NEMA 4OGEA 5GAN4 3CCRA 4BUGA 4EMKB 1LNXA 2LQ8A 2E1HA 3HXZA 4PJOF 1KHCA 4M7AF 3E9GA 2K4YA 3A74A 2IVWA 1B76A 4YTLA 4TVWA 4EPCA 2MWOA 4HWPA 1G5VA 1VQ6T 5CKFA 4Y91A 4P71A 2HNIA 3JCMV 5FU7C 1VQOA 1USYA 2ZZFA 2K5IA 4M75D 4C8QE 4PJOG 1KD1U 5CO7A 3HY0A 4E7JA 5LJ3d 3I56T 4X9CA 3OB9A 3M54A 2ZCEA 3CCUT 4E7LA 4P75C 3OYFA 2LQKA 2QXFA 2X35A 3HHTB 1ADJA 4E7HA 3LLRA 1JBMA 4YYEA 3TREA 3CCMA 1G3YA 3HFZA 2QEXT 1SSFA 1OZ2A 3QUIA 5D6WA 4CS4A 5CR2A 1WPYA 1X01A 1NE8A 4TQFA 3M4PA 1X2GA 5GANj 1ZBXA 4C8QC 3QJYA 3QG1A 2E10A 4BI8B 2RI2A 1YI2A 4UC4A 4P73C 2VGNA 3SWNA 5KE3A 1AHJB 3X25B 2KAFA 1FXXA 5C53B 1QP2A 2LTOA 3UH0A 1RIQA 4ZGEB 3SDZA 4RDXA 4BDZA 4A4HA 4HCCA 3DLMA 5I21A 1WQWA 1BI2A 5GAOp
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E51 A;  1TH7 A;  4DQ2 A;  5GMK j;  4KQE A;  3RAC A;  4YRS A;  4YRR A;  1M8V A;  4X9D A;  5LJ5 g;  2I4M A;  4G84 A;  1HK9 A;  2DQ0 A;  4MMK A;  1N9R A;  3RES A;  3QSU A;  2QHT A;  3PCO A;  4M7A B;  4F7U E;  1JJC B;  4M77 C;  4P3O A;  5GAM d;  3HXU A;  4H2S A;  2PME A;  5GAN 5;  4YRK A;  3JCM Q;  1I8F A;  3L4G A;  4P75 A;  3HRK A;  2C7I A;  1ASZ A;  4RMF A;  5LJ5 j;  1Z7N A;  1VQZ A;  5C52 B;  1E24 A;  1D3B A;  2I2L A;  1PYS A;  1BIB A;  4H2X B;  4EO4 A;  4YDQ A;  2E3C A;  5LJ3 f;  4M78 G;  1NYQ A;  3SWN B;  1KMN A;  4M78 B;  4M7D B;  4A53 A;  2DJZ A;  1X56 A;  4YRF A;  4M7D F;  4HT8 A;  4H2V A;  3VBB A;  3JCM J;  5LJ3 e;  1KMM A;  4CH4 A;  4DPG A;  5GAM e;  3PZC A;  5GAN 7;  1WYD A;  4HWO A;  3VQY A;  3BFM A;  2E41 A;  1ATI A;  2Q5I A;  4JRI A;  3RKY A;  3FB9 A;  4M77 B;  3HRI A;  2ZIN A;  3RKX A;  3P8V A;  2J3L A;  4CH3 A;  3P8Y A;  3JB9 I;  4CS2 A;  1ADY A;  2ZT8 A;  5GAO q;  3KFU A;  2ZT7 A;  3JB9 D;  3JCM d;  5GAM h;  4J6W A;  4PJO B;  5LJ3 h;  4YRT A;  4AH6 A;  3E9I A;  3IKL A;  4YRQ A;  3QO3 A;  5GMK l;  11AS A;  4OP0 A;  2EWN A;  4XEM A;  4ZTZ B;  1KOG A;  2RHS A;  1N9W A;  2DXT A;  4O2D A;  4M7D D;  4K87 A;  3RL6 A;  2ZIM A;  2RHQ A;  1H4T A;  2C8M A;  4L87 A;  3EFR A;  4PJO E;  3DSQ A;  1Y96 B;  4C8Q F;  4XTX A;  1BBW A;  1YCY A;  3HXX A;  4P72 A;  2VC8 A;  4YRI A;  3A7U A;  4EMG A;  2Q5H A;  1G5H A;  4HWR A;  1EFW A;  4RCB A;  5GAO n;  4C92 G;  4WF2 A;  4YCW A;  3A5Z A;  3SB2 A;  4ZIB A;  5ELO A;  1EVK A;  2XGT A;  4M77 F;  2DTI A;  5GMK e;  4QVC A;  5LJ5 d;  2IY5 A;  4HWS A;  4QVD A;  2RD1 A;  5CAI A;  1E22 A;  1H4V B;  3HY1 A;  4P72 C;  4P3P A;  4YRN A;  4M75 F;  2DU5 A;  4C8Q B;  2XTI A;  1B34 A;  2EL9 A;  4M77 G;  4P3N A;  2ZIO A;  3LSQ A;  2IY5 B;  3BY7 A;  3NEN A;  4M75 E;  2EJG A;  1NNH A;  4YRJ A;  2Q7G A;  4KR3 A;  1W66 A;  2AKW A;  1USY C;  1B8A A;  3QO5 A;  4C8Q G;  4H2W A;  2FYK A;  3HFZ B;  1LOJ A;  4M75 C;  4A54 A;  1HXD A;  5KNN A;  4XU1 A;  5GAN 6;  4M75 G;  1LYL A;  1NJ2 A;  1B7Y A;  4N0A C;  1HC7 A;  3BJU A;  4M78 F;  3TUP A;  3HTZ A;  2CGH A;  3PCO B;  3V8L A;  3EFS A;  3HFO A;  4TQD A;  1MGQ A;  3JCM c;  2ART A;  5GAN e;  3A31 A;  4EMK A;  2Q7H A;  1E1T A;  3M4Q A;  4M7D A;  4PJO A;  4K86 A;  5GMK m;  3I7F A;  3OD1 A;  4XU0 A;  3MF2 A;  1HTT A;  4ZTU B;  1WNL A;  3L4G B;  4YRO A;  4NL3 A;  4TVY A;  4Q15 A;  1WQ7 A;  1I5L A;  1EIY B;  2RHS B;  4LNS A;  4YRM A;  1EVL A;  3HFV A;  4CH5 A;  1E1O A;  4TTV A;  1X54 A;  4YCU A;  3JB9 F;  4NOY A;  3V8K A;  1NYR A;  4XU3 A;  3RUX A;  3QNE A;  5ELN A;  2J3M A;  1SRY A;  3VQV A;  3E9H A;  3RGL A;  3JCM W;  1B70 A;  2DQ3 A;  5GAN 3;  3BW1 A;  4M7A D;  4BWA A;  4UP9 A;  4K88 A;  2ODR D;  3HXW A;  1IL2 A;  5K1P A;  5GAO l;  3V7S A;  1X2H A;  4HA8 A;  1ASY A;  1YFS A;  2DDZ A;  4YRG A;  4M77 E;  1X55 A;  3V7C A;  2YLC A;  4C8Q D;  2AMC A;  3FJP A;  3JCM g;  4EMK C;  4MML A;  2I4O A;  4M7A E;  4PJO D;  3JB9 J;  2ALY A;  3HFN A;  2ZZG A;  2DVE A;  4M7D G;  3AHU A;  4PJO C;  5GAN 2;  4NL2 A;  2AMC B;  1N9S A;  4N0A A;  1B7Y B;  1EQR A;  4H2Y A;  1LJO A;  4M78 A;  2ZTG A;  3JCM b;  3QHS A;  3V8J A;  2I4N A;  2ZXF A;  4YRL A;  1J5W A;  1BBU A;  3R07 A;  4C92 E;  3GIB A;  4YP0 A;  5GAM j;  2VXF A;  4Q6G A;  3REU A;  4EMH A;  1YFR A;  3ICA A;  4J5Y A;  2ODR C;  1M5Q 1;  4H2T A;  5HGQ A;  5GAM f;  4YPF A;  4RQF A;  5GAN 8;  2CJB A;  5LJ3 g;  3P8T A;  1PYS B;  5GAN f;  2ZGW A;  4PG3 A;  5GMK i;  3BDU A;  4M7A A;  3HXV A;  2Y90 A;  5GAN g;  3L1A A;  3SWN C;  4C92 B;  1NJ5 A;  3ERR A;  3A32 A;  4YCV A;  2DXU A;  2YHT A;  2EJF A;  5LJ5 e;  1H4Q A;  3UGT A;  5GMK h;  4PNO A;  1WU7 A;  4OLF A;  4XTW A;  1QE0 A;  4M78 C;  4C92 C;  4M77 A;  1FYF A;  2ARU A;  5LJ3 j;  4J6X A;  4HVC A;  3VU3 C;  4XU2 A;  4C92 D;  1B70 B;  3HXY A;  2I4L A;  3W3S A;  3TEH A;  2DEQ A;  2QHS A;  2RB6 A;  1Y96 A;  3UGQ A;  1NJ6 A;  4J15 A;  3NET A;  3IAL A;  4UP8 A;  1L0W A;  4KR2 A;  3JCM P;  4M78 E;  4HT9 A;  4M75 B;  3LSS A;  3G1Z A;  2JN0 A;  4TWA A;  2CJ9 A;  5GAN h;  4C92 A;  2RA2 A;  4WJ4 A;  4JLI A;  4H02 A;  4YRC A;  4F7U A;  3RER A;  2ZT5 A;  2ALY B;  3HSB A;  3CMQ A;  4HWT A;  5F5W A;  4EX5 A;  4XEO A;  2DTH A;  1YB3 A;  3JCM e;  1EOV A;  1EIY A;  1B34 B;  4C92 F;  2ZR3 A;  2G4C A;  1JJC A;  2QHV A;  1WLE A;  3NEM A;  3REX A;  3VQW A;  5GAN 4;  3VQX A;  3RKW A;  2VXE A;  4EMK B;  5GAM g;  3IG2 A;  4TVA B;  1LNX A;  4P73 A;  3QTC A;  2P5I A;  4M77 D;  3JB9 G;  2DKG A;  2EAY A;  2E1H A;  4J6Y A;  3HXZ A;  3MEY A;  4P74 C;  4PJO F;  2ZNI A;  4F7U G;  4XTZ A;  4M7A F;  2ZZE A;  3QO8 A;  2ZR2 A;  3L2Z A;  2P0L A;  3MF1 A;  3INZ A;  3RF1 A;  1SES A;  1I4K 1;  2FB7 A;  4C8Q A;  3A74 A;  1U1S A;  1SER A;  4JRK A;  4UPA A;  4M7D E;  2K57 A;  1B76 A;  1C0A A;  4TVW A;  4P74 A;  4CS3 A;  3M4G A;  1H64 1;  4HWP A;  5K1X A;  1I81 A;  5DY9 A;  2E5A A;  4Y91 A;  2RHQ B;  4P71 A;  5GAN d;  4CH6 A;  1BIA A;  2HNI A;  2YLB A;  2QHU A;  3JCM V;  3JCM h;  2RM4 A;  4TVA A;  1QF6 A;  4UP7 A;  1USY A;  2ZZF A;  4M75 D;  4C8Q E;  4PJO G;  3A5Y A;  3NEL A;  1U1T A;  4H2X A;  3RIR A;  2ARS A;  3HY0 A;  4YRP A;  5LJ3 d;  4X9C A;  5E3I A;  1NJ8 A;  4RCC A;  1SET A;  4XTY A;  2ZCE A;  4P75 C;  4G85 A;  3JCM X;  2AKW B;  1KQ2 A;  1ADJ A;  3WQZ A;  4PHC A;  1JBM A;  2ZT6 A;  4YYE A;  5C51 B;  1GGM A;  12AS A;  1G5I A;  2E64 A;  4BW9 A;  1YGB A;  5LJ5 f;  3HFZ A;  4P71 C;  1G51 A;  5GAO m;  4V2S A;  3FIF A;  1YFT A;  3QUI A;  4CS4 A;  4RQE A;  4M7D C;  3JCM f;  1WPY A;  1X01 A;  1H4S A;  3TEG A;  1Z7M A;  4F7U B;  4TQF A;  3V7R A;  3M4P A;  1NJ1 A;  4F7U F;  4M7A G;  1JRI A;  1X2G A;  5GAN j;  3LC0 A;  4C8Q C;  2DU7 A;  1KQ1 A;  2E10 A;  5GAO r;  4NCX A;  2CJA A;  1D3B B;  4M75 A;  4WJ3 M;  4P73 C;  4XTV A;  3UFG A;  3SWN A;  2QTX A;  4M78 D;  2E65 A;  2Q7E A;  4M7A C;  5LJ5 h;  3JB9 H;  4XTU A;  2DZC A;  3TEH B;  5C53 B;  3A7R A;  3QO7 A;  4X5O A;  4WI1 A;  2DTO A;  2DZ9 A;  4JUV A;  2CIM A;  2ZNJ A;  2PMF A;  3UH0 A;  3PGG A;  1RIQ A;  4H2U A;  4YRE A;  4RDX A;  5I21 A;  4XQ3 A;  3IKM B;  1WQW A;  3A7A A;  5GAO p;  2EJ9 A; 
#chains in the Genus database with same CATH topology
 1ZSZ B;  1TH7 A;  1IXD A;  4E2F B;  2BE7 D;  1JB0 E;  4KQE A;  3RAC A;  3MQZ A;  4KRT A;  1NYF A;  1AT1 B;  5LJ5 g;  2I4M A;  1O75 A;  4E6R A;  4BAC A;  2E4H A;  1HK9 A;  3VS5 A;  4MMK A;  3RES A;  3QSU A;  3PCO A;  1ZHI A;  1Z9Z A;  2L89 A;  3VS2 A;  2PME A;  4YRK A;  1I8F A;  2H8H A;  2ZPG B;  2I0N A;  1Q7Y R;  3L4G A;  1AD5 A;  4P75 A;  2DJQ A;  1HSQ A;  2KSS A;  4HKE A;  2DF6 A;  2K2M A;  2C7I A;  4KGX B;  1M1K U;  2M16 A;  3OYA A;  4PKC C;  4JJC A;  3VJP A;  2MMP A;  1D3B A;  1JJ2 S;  3CC7 Q;  2YDL A;  6AT1 B;  4PLI A;  3CME A;  5FU6 B;  4F17 A;  2XK0 A;  5LJ3 f;  3EHQ A;  4J9E A;  1KSW A;  1KMN A;  2R5M A;  3LX7 A;  2L8D A;  1KK7 A;  1AWX A;  1UGP B;  3VUB A;  1UEC A;  5GAM e;  1X6G A;  2Y4Y A;  2BTT A;  3BFM A;  3MO8 A;  1ATI A;  4JRI A;  3SHW A;  2MCN A;  4DBQ A;  2V8K A;  3P8Y A;  1VQL A;  5FRO A;  3MPU B;  4FW2 A;  4EIK A;  1GFC A;  2KE9 A;  3HRT A;  1X6B A;  4TVR A;  1M90 U;  1EZZ B;  3MJX A;  3OYC A;  1YIJ T;  1YHQ Q;  2O31 A;  2EWN A;  3LW5 E;  1KOG A;  3CCU Q;  1KQS A;  4O2D A;  3PIO A;  1OX9 A;  2ZIM A;  4ELY C;  2W0Z A;  2QAZ A;  1Y96 B;  4XTX A;  1YCY A;  1RAI B;  3HXX A;  1RAE B;  3OS5 A;  4R56 A;  1HD3 A;  3CC4 A;  4HWR A;  3JRZ A;  1OEB A;  4C92 G;  1K8A R;  1KQS P;  2GBQ A;  1D1A A;  4WF2 A;  2VVK A;  3CCJ T;  1K9M U;  3A5Z A;  3THK A;  1IGQ A;  4BY6 B;  1G3W A;  2MK5 A;  1ZSG A;  1EVK A;  4J9B A;  2XGT A;  2DTI A;  4QVC A;  1VQ4 Q;  4QVD A;  2RD1 A;  5CAI A;  1AZE A;  2RO0 A;  3QPH A;  3HY1 A;  4CI0 C;  4LVJ A;  2FPF A;  1VQ9 A;  1B34 A;  2XTI A;  4ZGD B;  1QCN A;  2ZIO A;  2YUO A;  3H9N A;  3LSQ A;  2IY5 B;  5I2S A;  2RK1 A;  1WHK A;  1SRM A;  3CXC A;  2EJG A;  1YIT A;  4YRJ A;  2PVG B;  1RAH B;  2FVU A;  4JJN K;  2PQW A;  2X4Y A;  2MI6 A;  3U23 A;  4H2W A;  1BI1 A;  1LOJ A;  1JXM A;  3CPW P;  1VIF A;  2O9S A;  5GAN 6;  1M90 R;  1SF9 A;  4N0A C;  1HC7 A;  1WHL A;  2OJ2 A;  3GPL A;  1ABO A;  2GF7 A;  3V8L A;  1VYV A;  1SHG A;  2QQA A;  2WSF E;  1QVF S;  1QWE A;  2D0N A;  2DPP B;  1FYN A;  4EMK A;  2K6D A;  2Q7H A;  1BCO A;  1SHF A;  3HTR A;  4LVK A;  4M7D A;  3OYE A;  3CCL A;  4K86 A;  3OD1 A;  1AWW A;  1HTT A;  1Q81 C;  1WNL A;  4IUT A;  1OQK A;  4E7I A;  3OS1 A;  2R58 A;  5KYY B;  1YHQ T;  1YIJ Q;  3TQ7 P;  1RLP C;  1EIY B;  3M9Q A;  1Q82 R;  3OBW A;  2RQW A;  1TWB A;  2L0A A;  1MNE A;  1SSH A;  1OYX A;  1RL2 A;  1WJS A;  2K9G A;  4RG2 A;  1E1O A;  1VQO Q;  1TSF A;  4NOY A;  2HBP A;  5ELN A;  2EQI A;  2J3M A;  3GP8 A;  5J39 A;  1WZO A;  5IT9 E;  3JCM W;  4JJB A;  3RGL A;  3MCA B;  2R5A A;  2DM1 A;  4BWA A;  2AKK A;  1VQN Q;  1FX7 A;  1PG5 B;  3CCV T;  2HKQ B;  4K88 A;  4DEY A;  2CKK A;  5K1P A;  5GAO l;  1Q7Y U;  3A8O B;  4J8O A;  4JS4 A;  4OMN A;  1VIE A;  4AT1 B;  1WDX A;  1VQ7 Q;  3FJP A;  3JCM g;  3FC3 A;  2CS7 A;  1UGV A;  1KIK A;  2I4O A;  5FRM A;  2ALY A;  3HFN A;  3OYM A;  1BI3 A;  2KYB A;  3AHU A;  4PJO C;  1JJ2 A;  2AMC B;  4N0A A;  4H2Y A;  2KI7 A;  1OV3 A;  3KBG A;  3MP8 A;  3V8J A;  1YWO A;  3DB4 A;  2X4W A;  2LCS A;  4C92 E;  3TSW A;  5FW9 A;  3UWN A;  3L2Q A;  3REU A;  3EG9 A;  2ODR C;  2EYW A;  4A4G A;  4FYW B;  5GAN 8;  5CKH A;  5LJ3 g;  3WVE B;  1PYS B;  2X3W D;  2DRM A;  4IUU A;  4M7A A;  2GGR A;  2L2P A;  4ME7 A;  5CQX A;  4LDY A;  2DD4 A;  2XMF A;  1Q7Y C;  2DX1 A;  2J7I A;  1VQ6 A;  3GF5 A;  1SEM A;  4PNO A;  2AIR B;  2EYX A;  1Q82 U;  2X4X A;  1VQP T;  2F2X A;  1QW1 A;  4XU2 A;  3VU3 C;  1B70 B;  3UAT A;  1WYX A;  2A0F B;  2DEQ A;  1P92 A;  3UGQ A;  3QBY A;  2QQB A;  3ME9 A;  4M4Z A;  1NJ6 A;  2DVJ A;  4J15 A;  4E7Z A;  1JEG A;  3VS6 A;  2CP3 A;  4JRP A;  4HT9 A;  3LSS A;  2QI2 A;  3ZL7 C;  3L2V A;  3CXC S;  2JN0 A;  1KC8 R;  2HAX A;  4C92 A;  2GFA A;  2RI3 A;  2RA2 A;  5KCO A;  4HWT A;  5F5W A;  4EX5 A;  2EQU A;  5D6X A;  3OW2 A;  3JCM e;  3OS0 A;  3QJ6 A;  5CKB A;  1EOV A;  1B34 B;  1QVG S;  3MEA A;  4QQD A;  4FM4 B;  3SEM A;  1JJC A;  2QHV A;  2HSP A;  2MPX C;  4J9G A;  4L59 A;  3VQW A;  3RKW A;  3L2R A;  5GAM g;  4TVA B;  3IG2 A;  2J06 A;  1FMK A;  2DKG A;  2EAY A;  2ZNI A;  1R0C B;  3M55 A;  3CCS T;  1O9S A;  2LT4 A;  2PUO B;  4CC4 B;  2LDM A;  1VQ9 T;  1W1F A;  1NJI U;  3G4S T;  3CD6 A;  3RF1 A;  4C8Q A;  2FZK B;  4B6M A;  4M7D E;  5HY6 A;  4OMF B;  1QVF P;  5GJW B;  2RQU A;  2JM8 A;  2K3Y A;  2RMO A;  1X69 A;  3PTA A;  4A63 B;  5K1X A;  3QYH B;  3OY9 A;  2E5A A;  2LX9 A;  1K1Z A;  1YJN T;  2RHQ B;  5GAN d;  4CH6 A;  2YLB A;  2EKO A;  4FYV B;  2P4T A;  4TVA A;  1WHH A;  4JZ4 A;  1M2O A;  4UP7 A;  4MZT A;  2O4X A;  1DJ7 B;  4H2X A;  3I55 Q;  3CMA Q;  3M0T A;  4ZTF A;  2ARS A;  3QKJ A;  2DIQ A;  3CCS A;  5E3I A;  3MEU A;  3HRU A;  1W6X A;  4OB1 B;  4LVM A;  1VQK Q;  1N27 A;  4Y28 E;  2RJD A;  3ZBD A;  12AS A;  1QCF A;  1G5I A;  4BW9 A;  1YGB A;  3GOX A;  2A36 A;  5LJ5 f;  4P71 C;  5GAO m;  3VS3 A;  4V2S A;  3FIF A;  2DBM A;  1YFT A;  1KFZ A;  1VQ9 Q;  2RHY A;  2RJE A;  4LDU A;  2CUB A;  1AOJ A;  1RUW A;  1XJW B;  3PIP A;  4M7A G;  1H8K A;  1JRI A;  3LGL A;  3EH1 A;  2XG8 D;  1WIE A;  5KE2 A;  2QDL A;  1I07 A;  3OSV A;  3CCV Q;  2XID A;  4NCX A;  1D3B B;  3LWH A;  1T3L A;  3A8L B;  3J81 E;  4KUL A;  1PSF A;  4WJ3 M;  2QK0 A;  1NBE B;  2KRO A;  3M0U A;  1D0Z A;  4RTY A;  4HCB A;  2L3P A;  4IIO A;  2NUZ A;  4M78 D;  3O8V A;  2Q7E A;  2A7Y A;  2CZ1 B;  4JS5 A;  3JB9 H;  5FRN A;  3E2U A;  2DZC A;  3CMA T;  1RAG B;  1K9M R;  3E1S A;  4BD3 A;  1KHI A;  1E7O A;  1MMG A;  4HCZ A;  3QO7 A;  2DTO A;  1BI0 A;  2O9V A;  5KYU B;  1R8O B;  2V1Q A;  4JUV A;  2KRN A;  2O01 E;  4PFO A;  1RAA B;  3EGD B;  3OMG A;  4H2U A;  2FZG B;  3LH5 A;  1FMW A;  3NTK A;  4JRQ A;  5IXB A;  3MKD A;  4XQ3 A;  1W4S A;  5A0L A;  3A7A A;  2EJ9 A;  4E51 A;  2M9U A;  5GMK j;  2E12 A;  3TEE A;  1QLY A;  4DBH A;  4E7S A;  4X9D A;  1GRI A;  4G84 A;  2DQ0 A;  1I5O B;  1N9R A;  2QHT A;  4RTX A;  4P3O A;  1XTD A;  1Y07 A;  3M4Y A;  3NHN A;  2VWF A;  3R6N A;  1EX4 A;  3JCM Q;  3RMQ A;  5A0D A;  2DXC A;  4KBM B;  3VUZ A;  4KGZ B;  4RMF A;  1X75 C;  1VQZ A;  2HQE A;  1E24 A;  1BIB A;  2CSI A;  4FIB A;  5DLQ E;  4YDQ A;  2E3C A;  2BUD A;  1WXB A;  4M78 G;  3FDR A;  4FYY B;  3MEV A;  4OMO A;  3SWN B;  2KYM A;  4E7K A;  4M78 B;  1XOV A;  4YRF A;  2HZY A;  2DAQ A;  2JVV A;  4H2V A;  2CZ0 B;  2DO3 A;  4AMC A;  5LJ3 e;  1GFD A;  3M0R A;  1KMM A;  4HWO A;  3ZEH A;  1QWF A;  1VQ4 A;  2NS6 A;  1MUZ A;  3PMI A;  4M77 B;  3HRI A;  1VQM T;  4BE0 A;  2ZIN A;  2K3B A;  1WXU A;  2EGA A;  3P8V A;  2J3L A;  4CH3 A;  2PTK A;  3JB9 I;  4CS2 A;  2M0Y A;  1G3T A;  2WAC A;  2JT4 A;  4ZN3 A;  4LVI A;  1OPL A;  2ZT7 A;  4LUD A;  3CBM A;  4J6W A;  4PJO B;  1PD1 A;  1Q81 R;  4YRT A;  2JW4 A;  3E9F A;  3OW2 S;  3M5A A;  1VQ5 Q;  4AH6 A;  4ELZ C;  1M8M A;  1K76 A;  1YCS B;  3QO3 A;  1M1G A;  5GMK l;  5CCA A;  11AS A;  3VS7 A;  5KYN A;  5IH2 A;  2RHS A;  2DNU A;  4M7D D;  4K87 A;  3CC2 T;  1XNI A;  2RHQ A;  1H4T A;  1Z9Q A;  1TUG B;  2GFU A;  3C12 A;  2OTJ Q;  1BBW A;  3O5Z A;  4ANJ A;  2F1L A;  4AFQ C;  2FHD A;  1PM3 A;  1TUC A;  1YHQ A;  1GBQ A;  4LUE A;  1EFN A;  3NPF A;  2VKN A;  1IRE B;  3SD4 A;  1YJN Q;  3CCE A;  4YCW A;  3SB2 A;  1K73 C;  1RI9 A;  5CQY A;  3CCL T;  1KC8 U;  4ZIB A;  3G6E Q;  3ER0 A;  2D1X A;  1TXQ A;  1VQ8 Q;  2MYS A;  4M77 F;  1U8R A;  1TG0 A;  3OBY A;  3PNW C;  2E5Q A;  1VQ8 T;  4P72 C;  4P3P A;  3S3M A;  4ZNX A;  4P3N A;  2LT1 A;  2EGE A;  4F14 A;  4J7F A;  3BY7 A;  1VQ8 A;  3NEN A;  2ENM A;  4M75 E;  3QZ5 B;  1ZQ1 A;  1NNH A;  1YP5 A;  3CC7 A;  1D1B A;  4KR3 A;  5FU6 C;  3EFO A;  5GJV B;  2AKW A;  4JDS A;  2XDD A;  1USY C;  3P8D A;  4D6W A;  4OF1 A;  2HL3 A;  4PFZ A;  2FL7 A;  4FW1 A;  1IGU A;  4C8Q G;  2YWW A;  2DXB A;  4IUV A;  2FYK A;  4RTW A;  3HFZ B;  1M9S A;  1KG1 A;  4M75 C;  1SKU B;  4A54 A;  2O4X B;  2FPD A;  4M75 G;  1OUL A;  2QQS A;  1B7Y A;  5FLX E;  4RTU A;  5HCK A;  4PJN A;  3PFS A;  4M78 F;  3HTZ A;  2CGH A;  2E6Z A;  1VQ5 A;  3X28 B;  3CC4 T;  1E6G A;  3CCL Q;  5KYY A;  1PKS A;  4ESR A;  5GAN e;  1UHF A;  1Y71 A;  2E70 A;  2L3Q A;  3A31 A;  3M4Q A;  2JTM A;  3GNF B;  4AG2 C;  1PD0 A;  1G3S A;  3I7F A;  4Y92 A;  4ZTU B;  2A28 A;  2GTO A;  4PL6 A;  3PVQ A;  2CDT A;  1VQN T;  1K0S A;  2F5T X;  1N5Z A;  2KK4 A;  2RHS B;  3CPW S;  1EVL A;  5IHK A;  1MV3 A;  2YXY A;  4YCU A;  4Z8A A;  2DYB A;  4XU3 A;  3QNE A;  2ROL A;  5I22 A;  1B70 A;  5GAN 3;  3MEW A;  1D09 B;  2LRQ A;  2AKL A;  3BW1 A;  4M7A D;  2HBW A;  1IRX A;  4UP9 A;  2JNG A;  3RBB B;  4BE1 A;  4J9F A;  3FLG A;  5HKC A;  3V7S A;  4CC7 A;  2DDZ A;  5C0M A;  3I55 A;  3V7C A;  1X55 A;  2AMC A;  3GLX A;  4EMK C;  3CBP A;  2DD5 A;  2XI9 A;  3H41 A;  4MML A;  2J6K A;  1W2B P;  1M2V A;  4MDW A;  4KH1 B;  3S6W A;  4M7D G;  5GAN 2;  3S3O A;  1J3T A;  2EYQ A;  2EYY A;  2C0O A;  3QHS A;  2I4N A;  2ZXF A;  4FSS A;  3R07 A;  5GAM j;  5ECA A;  4Q6G A;  1YFR A;  2LJ3 A;  1BCM A;  3ICA A;  4J5Y A;  3NTI A;  3X20 B;  4H2T A;  5KH6 A;  5HGQ A;  5GAM f;  3G7Z A;  4VUB A;  2ZGW A;  3N5B B;  2MWP A;  5GMK i;  3HXV A;  5GAN g;  3LGF A;  3SWN C;  1NJ5 A;  1VYU A;  2JTE A;  2G3R A;  3A32 A;  3ERR A;  4YCV A;  2DXU A;  1RAC B;  2EJF A;  2YHT A;  3CC2 A;  2YUP A;  2L3S A;  4P5N A;  4M78 C;  4C92 C;  3G1J A;  4KUD K;  4C92 D;  4FT4 A;  3EG3 A;  4EDU A;  2H3E B;  4RKU E;  3W3S A;  1QVG P;  2OTL T;  1MMD A;  2RB6 A;  1G83 A;  2L3R A;  3IAL A;  1MV0 B;  4RTZ A;  4M78 E;  2XKO C;  1VQM A;  2KQW A;  4TWA A;  2CJ9 A;  1OU9 A;  2K7A A;  3F70 A;  3PMT A;  4H02 A;  3UPU A;  1YWP A;  5IAY A;  1ACM B;  3G6E A;  1WXT A;  2ALY B;  3CMQ A;  5FWB A;  3CCR Q;  5CKE A;  4ORZ A;  1YI2 T;  1X6O A;  2C06 A;  4QT7 A;  1EIY A;  3VS4 A;  3CCR T;  2JM9 A;  1VQK A;  2G4C A;  2AZS A;  3REX A;  3C95 A;  1TOV A;  2JZ2 A;  2IG0 A;  2SEM A;  3VQX A;  2VUB A;  2VXE A;  2YSQ A;  1NEB A;  2P5I A;  3DB3 A;  4M77 D;  4J9C A;  3FJ5 A;  3JB9 G;  2B86 A;  4P74 C;  4J6Y A;  4OB0 B;  3MEY A;  4F7U G;  4XTZ A;  3QO8 A;  2DL3 A;  4KUI A;  3TU4 K;  3GNG A;  2E5K A;  2P0L A;  2YRC A;  2L5Q A;  3INZ A;  1SES A;  5C6S A;  2X3X D;  1I4K 1;  2FB7 A;  1U1S A;  1SER A;  4UPA A;  1MMA A;  4P74 A;  4CS3 A;  2DER A;  1H64 1;  2F2W A;  1WJR A;  2AZV A;  1CKB A;  3VS0 A;  1I81 A;  2BZ8 A;  2O2O A;  2KNB B;  2ZPF B;  4R55 A;  4RUG A;  2QHU A;  1VQO T;  3JCM h;  1M1K R;  2HL5 C;  3TSZ A;  3CD6 Q;  2DIL A;  3NEL A;  4FSX A;  1U1T A;  3RIR A;  2IIM A;  1PRM C;  1IHW A;  1SET A;  4XTY A;  1M3B A;  3OQ5 A;  4D8K A;  4G85 A;  3KFV A;  2AKW B;  3CCE Q;  3CCQ A;  4J7I A;  4ZTJ A;  3WQZ A;  2ZT6 A;  4HVU A;  1I0C A;  3CME T;  2ZPB B;  2GCX A;  1B7T A;  3M0S A;  5DM7 R;  3G71 Q;  2ZPI B;  2QAS A;  1TU0 B;  4MZM A;  2IPO B;  1PSE A;  2WSE E;  4RQE A;  4M7D C;  2QGF B;  1H4S A;  1AWO A;  1WJQ A;  3G4S A;  2RJC A;  3V7R A;  3OMC A;  1NJ1 A;  5L8R E;  2W10 A;  3LC0 A;  4C0F A;  1QVP A;  1KQ1 A;  5GAO r;  2KVQ G;  3CCQ T;  2LX7 A;  1IHV A;  4ZN1 A;  3M57 A;  2F5K A;  3BE3 A;  1WHG A;  3PVL A;  3UFG A;  2RI5 A;  1QKW A;  3FRN A;  2XU8 A;  4DA4 A;  2E65 A;  4M7A C;  1Q82 C;  5LJ5 h;  1VQ6 Q;  3VRY A;  2YUQ A;  3QZ9 B;  2F69 A;  2LJ0 A;  4J9H A;  1M1K C;  4KGV B;  2EQK A;  4N4G A;  4X5O A;  3QXE B;  4FL6 A;  1BU1 A;  1YJ9 A;  1KC8 C;  4ZGJ B;  4CC2 A;  3EFO B;  2DZ9 A;  3CCE T;  4Z02 A;  2ZNJ A;  2PMF A;  2ED0 A;  3CPW A;  1VYT A;  4GLM A;  3PGG A;  1JO8 A;  2EIF A;  4HVV A;  4YRE A;  3I56 Q;  1T0H A;  2A08 A;  3OYN A;  2NUP B;  2HEQ A;  3IKM B;  2EKH A;  1GBR A;  1X43 A;  5HK3 A;  3TCJ A;  1BK2 A;  4DQ2 A;  3T9N A;  1VQP A;  1QCO A;  2MOX A;  3L2W A;  1IB8 A;  2RH2 A;  1TS9 A;  2HQX A;  4M7A B;  1JJC B;  5KYX A;  4PK4 A;  3HXU A;  1CSK A;  4H2S A;  3OYH A;  2DL4 A;  3QYG B;  2H3J A;  1B07 A;  3VYH B;  3HRK A;  3EG2 A;  3EG1 A;  1ASZ A;  1WA7 A;  2XHC A;  5LJ5 j;  2M0O A;  2JUF A;  4QQG A;  5C52 B;  1OU8 A;  3REB B;  1X27 A;  1D1C A;  1IO6 A;  1VQK T;  2I2L A;  1RAD B;  2VYT A;  1JXO A;  4H2X B;  4EO4 A;  1M4Z A;  3A8M B;  8AT1 B;  1X2K A;  4HT4 A;  2EQJ A;  3P8H A;  3X24 B;  1B3Q A;  2M02 A;  3VBB A;  4OB2 B;  4RTV A;  5M9O A;  3JCM J;  4CH4 A;  1UGR B;  2RQR A;  5GAN 7;  1WYD A;  4LDX A;  2P84 A;  2E41 A;  1LPL A;  1GCQ A;  3RKY A;  3FB9 A;  1V29 B;  1LCK A;  1FMV A;  4DOV A;  4A4K A;  3CC7 T;  1VOM A;  3EAE A;  1ADY A;  2ZT8 A;  2KGT A;  2HD0 A;  3CCQ Q;  2P0K A;  4AFU C;  2NWM A;  3JCM d;  4PJJ A;  5GAM h;  5LJ3 h;  3CCV A;  3HPW A;  3CEY A;  3E9I A;  4YRQ A;  5CVI A;  1Y7X A;  3P8B B;  4OP0 A;  4A4F A;  4AFZ C;  4B9X A;  4XEM A;  1YJW Q;  4ZTZ B;  3UA7 A;  1MMN A;  3RL6 A;  2C8M A;  4L87 A;  2D8H A;  3S3N A;  3DSQ A;  2RHU A;  4C8Q F;  2KRS A;  3EH2 A;  3CME Q;  4P72 A;  2A37 A;  4YRI A;  1SPK A;  4O6J A;  4EMG A;  3OYD A;  2Q5H A;  1ZUU A;  3OYK A;  1EFW A;  5GAO n;  3D7S B;  4QQ6 A;  2KXD A;  1A0N B;  3VRZ A;  1UHC A;  5HK0 A;  4LN2 A;  1YIT Q;  2CP0 A;  1NJI C;  5ELO A;  3VS1 A;  2PNI A;  1BKB A;  2X51 A;  1M3A A;  4LXC A;  2FRW A;  3A8H B;  3OSS C;  3BDL A;  3UA6 A;  1E22 A;  1H4V B;  4YRN A;  4L5G A;  2EL9 A;  2RJF A;  4M77 G;  2FEI A;  5IHN A;  5KCH A;  5CK9 A;  3CPF A;  3WXM B;  2X4J A;  1JQQ A;  1KD1 C;  1VQ4 T;  5A0G A;  2COZ A;  2R57 A;  4QW2 A;  2BKD N;  1VQL Q;  3RR6 A;  1NJI R;  2LC4 A;  2QDY B;  3C94 A;  5I11 A;  1HXD A;  1UG1 A;  2DFU A;  1LYL A;  1NJ2 A;  3HKS A;  1VQ7 A;  2CSQ A;  3HFO A;  4X34 A;  4TQD A;  1MGQ A;  3JCM c;  2ART A;  2Y4X A;  2DIG A;  3EGX A;  3RMS A;  5GMK m;  4Z89 A;  3MF2 A;  4OVA A;  2AHJ B;  2QQ9 A;  4YRO A;  1XQH A;  1M27 C;  4NL3 A;  4OML A;  2RHI A;  4TVY A;  1K0X A;  4BE2 A;  1QVF A;  4Q15 A;  1X2Q A;  2QEX Q;  4YRM A;  2GQI A;  3PT9 A;  2HQH A;  4CH5 A;  1YNZ A;  3RNJ A;  3SFM A;  1VQ7 T;  1X54 A;  3JB9 F;  4OMP A;  1NYR A;  3RUX A;  2PU9 B;  1SG5 A;  3UDC A;  1SRY A;  3VQV A;  1H92 A;  3MP1 A;  5KYU A;  4F16 A;  2DBK A;  2K3X A;  1UB4 A;  2OTJ T;  4FU6 A;  2YRV A;  3M53 A;  2ZAE A;  3JV3 A;  2XDP A;  2D8J A;  3GBQ A;  1Q95 G;  2DMO A;  2A8E A;  1G8X A;  1OZ3 A;  2RN8 A;  3OYL A;  4HA8 A;  1ASY A;  1S72 A;  1N8R R;  2ECZ A;  1YFS A;  2LNV A;  3HRS A;  1U06 A;  1OI1 A;  4YRG A;  4M77 E;  1R0B G;  2YLC A;  1T3S A;  4KT0 E;  2KR3 A;  2LP5 A;  1C0M A;  3MP6 A;  4L6V 5;  1D0X A;  4M7A E;  4PJO D;  1HJD A;  2ZZG A;  3JAM E;  4BDY A;  1N9S A;  4QVZ A;  1B7Y B;  2CP5 A;  2ZTG A;  3JCM b;  1F1B B;  2ZPH B;  4J9I A;  2FZC B;  3GIB A;  5KYW A;  1S72 T;  3C0C A;  4YP0 A;  4II1 A;  4EMH A;  1YFN A;  1WHJ A;  1M5Q 1;  1K73 R;  3P8T A;  3IQL A;  1UE9 A;  4FT2 A;  3L1A A;  4C92 B;  2SRC A;  2JMC A;  4C5H A;  2DL7 A;  4BB7 A;  3CBO A;  3H6Z A;  3OA6 A;  4J83 A;  4C0D C;  1YJW A;  1NPR A;  2KXC A;  2VV5 A;  1VQM Q;  3UGT A;  4RMO A;  3CCJ A;  4DEX A;  3OW2 P;  2E3H A;  1WU7 A;  3A98 A;  4XTW A;  3NMZ C;  2OTL Q;  2CZ7 B;  3LH0 A;  4M77 A;  4XAX B;  1FYF A;  1PKT A;  4J6X A;  5LJ3 j;  2XDB A;  2ARU A;  4HVC A;  4FYX B;  2I4L A;  1CKA A;  1Y96 A;  2FPE A;  4C0D B;  3EG9 B;  2EQM A;  4UP8 A;  2LCL A;  1YJ9 Q;  4KR2 A;  3JCM P;  2XD0 A;  2Z0W A;  3HP9 A;  5J26 A;  3G1Z A;  3ZFJ A;  4KH0 B;  2M1H A;  3A5Z B;  3ASK A;  1AEY A;  2BIV A;  4WTO B;  4OGC A;  1JJ2 P;  2YT6 A;  4WJ4 A;  1FWZ A;  4HXJ A;  4C0G A;  4YRC A;  4F7U A;  1N8R U;  2RK2 A;  4E47 A;  1S72 Q;  8ATC B;  3OYI A;  2WSC E;  3CCM Q;  7AT1 B;  2ABL A;  4C92 F;  2HCK A;  1ZSZ C;  3CCM T;  2ZR3 A;  1BB9 A;  4JLG A;  1WLE A;  2FG0 A;  1Q86 C;  2P0Q A;  1ABQ A;  2DK3 A;  1VUB A;  3AT1 B;  4P73 A;  3QTC A;  4OMM A;  2KEA A;  3CCU A;  1K8A U;  4GBQ A;  2ZZE A;  2NYS A;  1K9M C;  2ZR2 A;  3L2Z A;  3MF1 A;  1K73 U;  2COW A;  2LMJ A;  2QTV A;  4JRK A;  3RDV A;  2K57 A;  1M1F A;  2GNC A;  3DKM A;  1C0A A;  3M4G A;  1W2B A;  1MND A;  3DLL A;  2PVD B;  1S1N A;  1NPP A;  5DY9 A;  1NM7 A;  2OTL A;  4LVL A;  1BIA A;  1WFW A;  2JXB A;  1QP3 A;  2QYZ A;  2CP6 A;  2EPD A;  2JTF A;  2RM4 A;  4FCY A;  1QF6 A;  4C5G A;  3WVD B;  2J6O A;  1GXI E;  1D0Y A;  3A5Y A;  2K79 A;  3EHR A;  4OMQ A;  2CH4 W;  4YRP A;  1NJ8 A;  4RCC A;  3QDF A;  4D8D A;  3LYI A;  2AT1 B;  3JCM X;  3M58 A;  1KQ2 A;  4PHC A;  5A2Q E;  5C51 B;  1GGM A;  2E3I A;  2E64 A;  2ZCF B;  1V76 A;  1G51 A;  3KXT A;  2KT8 A;  3JCM f;  3I35 A;  3MHX A;  2DA9 A;  3TEG A;  1Z7M A;  4F7U B;  1QVG A;  4F7U F;  4C0Z A;  4LD9 K;  2LQW A;  2DU7 A;  2CT4 A;  2C0T A;  2P4R A;  5FU7 B;  2CJA A;  1ZA1 B;  3NFC A;  2CT3 A;  1ZLM A;  4M75 A;  3G6E T;  1RAB B;  4XTV A;  2QA4 Q;  2KBT A;  1JU5 C;  2QTX A;  3PE0 A;  2LCC A;  2D9T A;  2QA4 T;  4XTU A;  1UJY A;  2RQT A;  2V8J A;  3TEH B;  2V8I A;  1NG2 A;  4ATO A;  2EVR A;  2O88 A;  3VKI A;  4OB3 B;  3A7R A;  4MDX A;  4WI1 A;  1QQJ A;  2GQV A;  1UGS B;  2LVM A;  2HSE B;  2CIM A;  2CP7 A;  1R77 A;  3EG0 A;  3Q1J A;  1H3H A;  2DRK A;  4X1V A;  3NTH A;  1QMC A;  1YJN A;  1YI2 Q;  4LD6 A;  1VQ5 T;  4PJM A;  2J05 A;  4IUQ A;  2QQR A;  3J7A F;  2QGG A;  1YJW T;  4YRS A;  1TUD A;  4YRR A;  1M8V A;  2OAU A;  3CC2 Q;  1T0J A;  1Y57 A;  2K2V A;  1NEG A;  1K4U S;  2PZ1 A;  2KY9 A;  2EW3 A;  4F7U E;  1TTH B;  4M77 C;  3QII A;  5GAM d;  4IIM A;  4PJL A;  1YIJ A;  5GAN 5;  1PCX A;  1ZUY A;  4LDV A;  3OYJ A;  3H0I A;  2RF0 A;  4RTT A;  2B8A A;  1GL5 A;  3EGD A;  1Z7N A;  3OS2 A;  1KJW A;  2CP2 A;  3H0H A;  3I9Q A;  1PYS A;  1U5S A;  4J9D A;  4BI4 A;  2CUD A;  2GTJ A;  4LDW A;  4GLK A;  3JSC A;  1NYQ A;  1OOT A;  1V1C A;  4MZP A;  4A53 A;  2DJZ A;  1WGS A;  4M7D B;  1X56 A;  1W2B S;  4HT8 A;  4M7D F;  4IUP A;  4DPG A;  4PFP A;  3PZC A;  3VQY A;  2Q5I A;  1SRL A;  3E19 A;  1PC0 A;  3RKX A;  1UFF A;  2NLU A;  2BE9 B;  4K11 A;  3X26 B;  2C0I A;  3TVT A;  5GAO q;  1N6A A;  1YBY A;  4WCI A;  3KFU A;  1NYG A;  1KQS S;  3JB9 D;  4DOW A;  3UF4 A;  3EGU A;  1ZSZ A;  1AZG B;  2V26 A;  3IKL A;  2D0Q B;  2JS0 A;  3J80 E;  2ROT A;  5D6Y A;  5IHI A;  1N9W A;  2DXT A;  2JOY A;  2MAM A;  2FO0 A;  2K5L A;  5CIU A;  5KYW B;  3R6O A;  3EFR A;  4PJO E;  1NLP C;  4PLL A;  2HKN A;  2OAW A;  2VC8 A;  3A7U A;  2QG9 B;  3EGX B;  1G5H A;  4RCB A;  5EC7 A;  4CRI A;  2PVO B;  3REA B;  1M30 A;  3MET A;  1RLQ C;  4QKU A;  3L2U A;  1PRL C;  5GMK e;  5LJ5 d;  2IY5 A;  4HWS A;  4DBR A;  4LNP A;  4DBF A;  4C5E A;  4M75 F;  2DU5 A;  1QKX A;  3OYG A;  4C8Q B;  3VV0 A;  1M2V B;  2OI3 A;  2RQV A;  4BI3 A;  3FEO A;  2DET A;  4C5I A;  4IKF A;  2A3L A;  3G71 A;  1EIF A;  1GCP A;  4LE9 A;  3G71 T;  2Q7G A;  4A4E A;  1W66 A;  1B8A A;  3C4S A;  4JZ3 A;  2JS2 A;  2KMT A;  3QO5 A;  3LWI A;  2D6F A;  1C1A A;  1NZ9 A;  1HYO A;  5IN1 A;  2NUP A;  3KUF A;  5KNN A;  4XU1 A;  2ED1 A;  3A8G B;  1UGQ B;  1AWJ A;  2QEX A;  3HL8 A;  3L42 A;  3BJU A;  3TUP A;  2DE0 X;  2X9H A;  1VQP Q;  3PCO B;  3EFS A;  5EG2 A;  2AK5 A;  1IZ6 A;  5KYX B;  3M0P A;  2HDA A;  1E1T A;  4N4I A;  4PJO A;  2KDS A;  3I56 A;  4XU0 A;  3L4G B;  1N8R C;  5I2M A;  4F04 B;  1WQ7 A;  1I5L A;  4O5V A;  4LNS A;  3H8Z A;  3CMA A;  3HFV A;  1K9A A;  3H0F A;  3I5R A;  1ZA2 B;  4Q5W A;  4XK8 E;  4TTV A;  1M90 C;  4NS5 A;  1MHN A;  3V8K A;  2ESW A;  1Q86 U;  1UEB A;  3E9H A;  4B9W A;  2DQ3 A;  3ULR B;  2PUK B;  1K8A C;  2ODR D;  4BY6 C;  3HXW A;  4AG1 C;  1IL2 A;  2EFI A;  3A1P A;  1X2H A;  1YIT T;  1W70 A;  2NUT B;  2RHX A;  4C8Q D;  2JMA A;  2RPN A;  2YRD A;  3I55 T;  3JB9 J;  3M56 A;  5LL6 S;  2DVE A;  2FRY A;  1ARK A;  4NL2 A;  1GCQ C;  1EQR A;  1LJO A;  4M78 A;  3VYG A;  2MF2 A;  4YRL A;  4JPB W;  5CKD A;  1J5W A;  1BBU A;  1VQN A;  4CC3 A;  2VXF A;  5AYF A;  9ATC B;  2K5F A;  4YPF A;  4RQF A;  2CJB A;  5J3B A;  5GAN f;  4PG3 A;  2DLP A;  2OTJ A;  2VGM A;  3BDU A;  2EBP A;  2ZPE B;  2Y90 A;  2ZZD A;  1PWT A;  2P0P A;  4RG8 A;  2YUN A;  1I1J A;  2EGC A;  3M59 A;  5LJ5 e;  1YJ9 T;  1H4Q A;  2XIC A;  3UT1 A;  5GMK h;  3OYB A;  2OX7 A;  1WI7 A;  4OLF A;  2CYZ B;  1QE0 A;  5L23 A;  1OPK A;  3OYY A;  2QA4 A;  2CRE A;  2VB6 A;  3HXY A;  2CZ6 B;  3TEH A;  2QHS A;  1OX8 A;  1Q86 R;  3CD6 T;  1KD1 R;  2DYI A;  4N4H A;  4GY5 A;  3QDR B;  3NET A;  1L0W A;  1H3Z A;  3CQT A;  3M0Q A;  5D7U A;  1UDL A;  4M75 B;  5DLO A;  1BYM A;  1RI0 A;  1WHM A;  5GAN h;  4AFS C;  2E6N A;  2VAS A;  4JLI A;  4Z88 A;  1Q81 U;  3RER A;  2ZT5 A;  3HSB A;  2HMA A;  4IUR A;  4XEO A;  2DTH A;  1YB3 A;  1VQL T;  1PNJ A;  2RHZ A;  1ZUK A;  1M3C A;  3QWY A;  3URG A;  3NEM A;  4OGE A;  5GAN 4;  3CCR A;  4BUG A;  1VA7 A;  4EMK B;  1LNX A;  1WX6 A;  2LQ8 A;  2E1H A;  3HXZ A;  4PJO F;  1KHC A;  4M7A F;  3E9G A;  1ZBJ A;  2MIO A;  2F2V A;  2K4Y A;  4HCK A;  1UJ0 A;  1U3O A;  3A74 A;  2COY A;  3I5S A;  2IVW A;  1B76 A;  2KRM A;  4YTL A;  1YN8 A;  4TVW A;  4EPC A;  2MWO A;  1Y0M A;  2ATC B;  4HWP A;  2LZ6 B;  1G5V A;  1VQ6 T;  5CKF A;  4Y91 A;  4P71 A;  3CCS Q;  2HNI A;  2CH4 A;  1WLP B;  3JCM V;  1BBZ A;  5IXF A;  5FU7 C;  3QWX X;  1VQO A;  2LJ1 A;  1USY A;  2ZZF A;  2K5I A;  4M75 D;  4C8Q E;  4PJO G;  2BZX A;  1ZX6 A;  1KD1 U;  5CO7 A;  1NLO C;  3HY0 A;  4E7J A;  5LJ3 d;  3I56 T;  4X9C A;  3OB9 A;  1RAF B;  2DL5 A;  3M54 A;  2ZCE A;  3CCU T;  1PHT A;  4E7L A;  4P75 C;  1LVK A;  3OYF A;  2LQK A;  2QXF A;  2X35 A;  3HHT B;  1ADJ A;  4E7H A;  3LLR A;  4R0K A;  1JBM A;  4YYE A;  4JJD A;  3TRE A;  3CCM A;  1G3Y A;  3HFZ A;  1G2B A;  2QEX T;  5AT1 B;  1SSF A;  1OZ2 A;  3QUI A;  5D6W A;  4CS4 A;  2J6F A;  5CR2 A;  3G4S Q;  1WPY A;  3CCJ Q;  1X01 A;  3CXC P;  1NE8 A;  4TQF A;  2RNA A;  3M4P A;  4HVW A;  1X2G A;  5GAN j;  1ZBX A;  2NUT A;  4C8Q C;  3QJY A;  3QG1 A;  2E10 A;  3NGP A;  4BI8 B;  2RI2 A;  2EYZ A;  2V1R A;  1YI2 A;  2DEU A;  1E6H A;  2LNH B;  4UC4 A;  4P73 C;  2VGN A;  1UUE A;  5FWC A;  3SWN A;  5KE3 A;  1AHJ B;  3X25 B;  2KAF A;  1C6V X;  1FXX A;  2LQN A;  5C53 B;  1QP2 A;  1UTI A;  2LTO A;  2BZY A;  2G6F X;  2KT1 A;  3UH0 A;  1RIQ A;  2M51 A;  1AVZ C;  4ZGE B;  3SDZ A;  4RDX A;  4BDZ A;  4A4H A;  2JJ9 A;  4HCC A;  3DLM A;  5I21 A;  1WQW A;  1BI2 A;  5GAO p;  3CC4 Q;  2DL8 A; 
#chains in the Genus database with same CATH homology
 1TH7 A;  1JB0 E;  4KQE A;  3RAC A;  3MQZ A;  5LJ5 g;  2I4M A;  1O75 A;  4BAC A;  1HK9 A;  4MMK A;  3RES A;  3QSU A;  3PCO A;  1ZHI A;  2L89 A;  2PME A;  4YRK A;  1I8F A;  2ZPG B;  3L4G A;  4P75 A;  2KSS A;  4HKE A;  2C7I A;  1M1K U;  2M16 A;  3OYA A;  4PKC C;  3VJP A;  2MMP A;  1D3B A;  1JJ2 S;  4PLI A;  3CME A;  5FU6 B;  2XK0 A;  5LJ3 f;  1KMN A;  2R5M A;  3LX7 A;  2L8D A;  1UGP B;  3VUB A;  5GAM e;  2Y4Y A;  3BFM A;  3MO8 A;  1ATI A;  4JRI A;  2V8K A;  3P8Y A;  1VQL A;  5FRO A;  3HRT A;  4TVR A;  1M90 U;  3OYC A;  1YIJ T;  2EWN A;  3LW5 E;  1KOG A;  1KQS A;  4O2D A;  3PIO A;  2ZIM A;  4ELY C;  1Y96 B;  4XTX A;  1YCY A;  3HXX A;  3OS5 A;  4R56 A;  3CC4 A;  4HWR A;  3JRZ A;  4C92 G;  4WF2 A;  1K9M U;  3CCJ T;  3A5Z A;  4BY6 B;  1G3W A;  1EVK A;  2XGT A;  2DTI A;  4QVC A;  4QVD A;  2RD1 A;  5CAI A;  2RO0 A;  3QPH A;  3HY1 A;  4CI0 C;  4LVJ A;  1VQ9 A;  1B34 A;  2XTI A;  4ZGD B;  2ZIO A;  3LSQ A;  2IY5 B;  5I2S A;  2RK1 A;  3CXC A;  2EJG A;  1YIT A;  4YRJ A;  2PVG B;  2FVU A;  4JJN K;  2PQW A;  2X4Y A;  2MI6 A;  4H2W A;  1BI1 A;  1LOJ A;  1VIF A;  5GAN 6;  4N0A C;  1HC7 A;  3GPL A;  2GF7 A;  3V8L A;  2QQA A;  2WSF E;  1QVF S;  2DPP B;  4EMK A;  2Q7H A;  4LVK A;  4M7D A;  3OYE A;  3CCL A;  4K86 A;  3OD1 A;  1HTT A;  1Q81 C;  1WNL A;  4IUT A;  4E7I A;  3OS1 A;  2R58 A;  1YHQ T;  1EIY B;  3M9Q A;  3OBW A;  4RG2 A;  1OYX A;  1RL2 A;  1WJS A;  1E1O A;  4NOY A;  2HBP A;  5ELN A;  2J3M A;  3GP8 A;  5J39 A;  3RGL A;  5IT9 E;  3JCM W;  3MCA B;  2R5A A;  4BWA A;  1FX7 A;  3CCV T;  4K88 A;  2CKK A;  5K1P A;  5GAO l;  1Q7Y U;  3A8O B;  4J8O A;  4JS4 A;  1VIE A;  3FJP A;  3JCM g;  3FC3 A;  2CS7 A;  2I4O A;  5FRM A;  2ALY A;  3HFN A;  3OYM A;  1BI3 A;  3AHU A;  4PJO C;  1JJ2 A;  2AMC B;  4N0A A;  4H2Y A;  3KBG A;  3MP8 A;  3V8J A;  3DB4 A;  2X4W A;  4C92 E;  3UWN A;  3REU A;  3L2Q A;  2ODR C;  4A4G A;  5GAN 8;  5CKH A;  5LJ3 g;  3WVE B;  1PYS B;  4IUU A;  4M7A A;  4ME7 A;  5CQX A;  4LDY A;  2DD4 A;  1Q7Y C;  1VQ6 A;  3GF5 A;  4PNO A;  1Q82 U;  2X4X A;  1VQP T;  3VU3 C;  1QW1 A;  4XU2 A;  1B70 B;  2DEQ A;  1P92 A;  3UGQ A;  3QBY A;  2QQB A;  3ME9 A;  1NJ6 A;  4J15 A;  4JRP A;  4HT9 A;  3LSS A;  2QI2 A;  3L2V A;  3CXC S;  2JN0 A;  2HAX A;  4C92 A;  2GFA A;  2RI3 A;  2RA2 A;  5KCO A;  4HWT A;  5F5W A;  4EX5 A;  2EQU A;  5D6X A;  3OW2 A;  3JCM e;  3OS0 A;  3QJ6 A;  5CKB A;  1EOV A;  1B34 B;  1QVG S;  3MEA A;  4QQD A;  4FM4 B;  1JJC A;  2QHV A;  4L59 A;  3VQW A;  3RKW A;  3L2R A;  5GAM g;  4TVA B;  3IG2 A;  2DKG A;  2EAY A;  2ZNI A;  3M55 A;  3CCS T;  1O9S A;  2LT4 A;  2PUO B;  2LDM A;  1VQ9 T;  1NJI U;  3CD6 A;  3G4S T;  3RF1 A;  4C8Q A;  4M7D E;  5HY6 A;  4OMF B;  2K3Y A;  3PTA A;  5K1X A;  3QYH B;  3OY9 A;  2E5A A;  2LX9 A;  1YJN T;  2RHQ B;  5GAN d;  4CH6 A;  2YLB A;  2EKO A;  2P4T A;  4TVA A;  4UP7 A;  4MZT A;  2O4X A;  1DJ7 B;  4H2X A;  2ARS A;  4ZTF A;  3QKJ A;  2DIQ A;  3CCS A;  5E3I A;  3MEU A;  3HRU A;  4OB1 B;  4LVM A;  1N27 A;  4Y28 E;  2RJD A;  3ZBD A;  12AS A;  1G5I A;  4BW9 A;  1YGB A;  3GOX A;  5LJ5 f;  4P71 C;  5GAO m;  4V2S A;  3FIF A;  1YFT A;  2RHY A;  2RJE A;  4LDU A;  3PIP A;  4M7A G;  1JRI A;  3LGL A;  2XG8 D;  5KE2 A;  3OSV A;  2XID A;  4NCX A;  1D3B B;  3LWH A;  3A8L B;  3J81 E;  4KUL A;  1PSF A;  4WJ3 M;  4HCB A;  4M78 D;  3O8V A;  2Q7E A;  2A7Y A;  2CZ1 B;  4JS5 A;  3JB9 H;  5FRN A;  2DZC A;  3CMA T;  3E1S A;  4BD3 A;  1KHI A;  4HCZ A;  3QO7 A;  2DTO A;  1BI0 A;  1R8O B;  4JUV A;  2O01 E;  3OMG A;  4H2U A;  3NTK A;  4JRQ A;  4XQ3 A;  1W4S A;  5A0L A;  3A7A A;  2EJ9 A;  4E51 A;  2M9U A;  5GMK j;  2E12 A;  3TEE A;  4X9D A;  4G84 A;  2DQ0 A;  2QHT A;  1N9R A;  4P3O A;  1XTD A;  1Y07 A;  3M4Y A;  3JCM Q;  3RMQ A;  5A0D A;  2DXC A;  4KBM B;  3VUZ A;  4RMF A;  1X75 C;  1VQZ A;  2HQE A;  1E24 A;  1BIB A;  4FIB A;  5DLQ E;  4YDQ A;  2E3C A;  2BUD A;  4M78 G;  3FDR A;  3MEV A;  3SWN B;  4E7K A;  4M78 B;  1XOV A;  4YRF A;  2DAQ A;  2JVV A;  4H2V A;  2CZ0 B;  2DO3 A;  5LJ3 e;  1KMM A;  4HWO A;  3ZEH A;  1VQ4 A;  2NS6 A;  3PMI A;  4M77 B;  3HRI A;  1VQM T;  4BE0 A;  2ZIN A;  3P8V A;  2J3L A;  4CH3 A;  3JB9 I;  4CS2 A;  1G3T A;  2WAC A;  4ZN3 A;  4LVI A;  2ZT7 A;  3CBM A;  4J6W A;  4PJO B;  4YRT A;  3E9F A;  3OW2 S;  3M5A A;  4AH6 A;  4ELZ C;  3QO3 A;  1M1G A;  5GMK l;  5CCA A;  11AS A;  2RHS A;  4M7D D;  4K87 A;  3CC2 T;  1XNI A;  2RHQ A;  1H4T A;  2GFU A;  3C12 A;  1BBW A;  2FHD A;  1YHQ A;  1IRE B;  3SD4 A;  4YCW A;  3CCE A;  3SB2 A;  1K73 C;  5CQY A;  3CCL T;  1KC8 U;  4ZIB A;  3ER0 A;  4M77 F;  1U8R A;  3OBY A;  3PNW C;  2E5Q A;  1VQ8 T;  4P72 C;  4P3P A;  3S3M A;  4P3N A;  2LT1 A;  1VQ8 A;  4J7F A;  3BY7 A;  3NEN A;  4M75 E;  3QZ5 B;  1ZQ1 A;  1NNH A;  3CC7 A;  4KR3 A;  5FU6 C;  2AKW A;  4JDS A;  2XDD A;  1USY C;  3P8D A;  4D6W A;  4OF1 A;  2FL7 A;  4C8Q G;  2DXB A;  4IUV A;  2FYK A;  3HFZ B;  1M9S A;  1KG1 A;  4M75 C;  4A54 A;  2O4X B;  4M75 G;  2QQS A;  1B7Y A;  5FLX E;  3PFS A;  4M78 F;  3HTZ A;  2CGH A;  2E6Z A;  1VQ5 A;  3X28 B;  3CC4 T;  5GAN e;  1Y71 A;  3A31 A;  2E70 A;  3M4Q A;  2JTM A;  3GNF B;  1G3S A;  3I7F A;  4ZTU B;  4PL6 A;  1VQN T;  2F5T X;  2KK4 A;  2RHS B;  3CPW S;  1EVL A;  4YCU A;  4XU3 A;  3QNE A;  1B70 A;  5GAN 3;  3MEW A;  2LRQ A;  3BW1 A;  4M7A D;  4UP9 A;  2JNG A;  4BE1 A;  3FLG A;  5HKC A;  3V7S A;  2DDZ A;  5C0M A;  3I55 A;  3V7C A;  1X55 A;  2AMC A;  3GLX A;  4EMK C;  3CBP A;  2DD5 A;  2XI9 A;  4MML A;  4MDW A;  3S6W A;  4M7D G;  5GAN 2;  3S3O A;  2EYQ A;  3QHS A;  2I4N A;  2ZXF A;  3R07 A;  5GAM j;  4Q6G A;  1YFR A;  3ICA A;  4J5Y A;  3NTI A;  3X20 B;  4H2T A;  5KH6 A;  5HGQ A;  5GAM f;  3G7Z A;  4VUB A;  2ZGW A;  3N5B B;  2MWP A;  5GMK i;  3HXV A;  5GAN g;  3LGF A;  3SWN C;  1NJ5 A;  2G3R A;  3A32 A;  3ERR A;  4YCV A;  2DXU A;  2YHT A;  2EJF A;  3CC2 A;  4P5N A;  4M78 C;  4C92 C;  4KUD K;  4C92 D;  4FT4 A;  4EDU A;  4RKU E;  3W3S A;  2OTL T;  2RB6 A;  2L3R A;  3IAL A;  4M78 E;  2XKO C;  1VQM A;  2KQW A;  4TWA A;  2CJ9 A;  3F70 A;  3PMT A;  4H02 A;  3UPU A;  5IAY A;  3G6E A;  2ALY B;  3CMQ A;  5CKE A;  1YI2 T;  1X6O A;  2C06 A;  1EIY A;  3CCR T;  1VQK A;  2G4C A;  3REX A;  3C95 A;  2JZ2 A;  2IG0 A;  3VQX A;  2VUB A;  2VXE A;  2P5I A;  3DB3 A;  4M77 D;  3JB9 G;  4P74 C;  4J6Y A;  4OB0 B;  3MEY A;  4F7U G;  4XTZ A;  3QO8 A;  4KUI A;  3TU4 K;  3GNG A;  2P0L A;  2L5Q A;  3INZ A;  1SES A;  5C6S A;  1I4K 1;  2FB7 A;  1U1S A;  1SER A;  4UPA A;  4P74 A;  4CS3 A;  1H64 1;  1WJR A;  1I81 A;  2ZPF B;  4R55 A;  2QHU A;  1VQO T;  3JCM h;  3NEL A;  4FSX A;  1U1T A;  3RIR A;  1SET A;  4XTY A;  3OQ5 A;  4G85 A;  2AKW B;  3CCQ A;  4J7I A;  4ZTJ A;  3WQZ A;  2ZT6 A;  3CME T;  2ZPB B;  2GCX A;  5DM7 R;  2ZPI B;  4MZM A;  1PSE A;  2WSE E;  4RQE A;  4M7D C;  1H4S A;  1WJQ A;  3G4S A;  2RJC A;  3V7R A;  3OMC A;  1NJ1 A;  5L8R E;  3LC0 A;  4C0F A;  1QVP A;  1KQ1 A;  5GAO r;  2KVQ G;  3CCQ T;  4ZN1 A;  3M57 A;  2F5K A;  3UFG A;  2RI5 A;  3FRN A;  2XU8 A;  4DA4 A;  2E65 A;  4M7A C;  1Q82 C;  5LJ5 h;  3QZ9 B;  2F69 A;  1M1K C;  2EQK A;  4N4G A;  4X5O A;  3QXE B;  4FL6 A;  1YJ9 A;  1KC8 C;  4ZGJ B;  2DZ9 A;  3CCE T;  4Z02 A;  2ZNJ A;  2PMF A;  3CPW A;  3PGG A;  2EIF A;  4YRE A;  3OYN A;  3IKM B;  5HK3 A;  3TCJ A;  4DQ2 A;  3T9N A;  1VQP A;  3L2W A;  2RH2 A;  2HQX A;  4M7A B;  1JJC B;  3HXU A;  4H2S A;  3OYH A;  3QYG B;  2H3J A;  3VYH B;  3HRK A;  1ASZ A;  2XHC A;  5LJ5 j;  2M0O A;  2JUF A;  4QQG A;  5C52 B;  1VQK T;  2I2L A;  2VYT A;  4H2X B;  4EO4 A;  1M4Z A;  3A8M B;  4HT4 A;  2EQJ A;  3P8H A;  3X24 B;  3VBB A;  4OB2 B;  5M9O A;  3JCM J;  4CH4 A;  1UGR B;  5GAN 7;  1WYD A;  4LDX A;  2E41 A;  3RKY A;  3FB9 A;  1V29 B;  4DOV A;  4A4K A;  3CC7 T;  3EAE A;  1ADY A;  2ZT8 A;  2HD0 A;  2P0K A;  3JCM d;  5GAM h;  5LJ3 h;  3CCV A;  3HPW A;  3CEY A;  3E9I A;  4YRQ A;  5CVI A;  1Y7X A;  3P8B B;  4OP0 A;  4A4F A;  4B9X A;  4XEM A;  4ZTZ B;  3RL6 A;  2C8M A;  4L87 A;  3S3N A;  3DSQ A;  2RHU A;  4C8Q F;  4P72 A;  4YRI A;  4O6J A;  4EMG A;  3OYD A;  2Q5H A;  3OYK A;  1EFW A;  5GAO n;  4QQ6 A;  5HK0 A;  1NJI C;  5ELO A;  1BKB A;  3A8H B;  3OSS C;  3BDL A;  1E22 A;  1H4V B;  4YRN A;  4L5G A;  2EL9 A;  2RJF A;  4M77 G;  5KCH A;  5CK9 A;  3CPF A;  3WXM B;  2X4J A;  1KD1 C;  1VQ4 T;  5A0G A;  2R57 A;  4QW2 A;  2BKD N;  2LC4 A;  2QDY B;  3C94 A;  1HXD A;  1LYL A;  1NJ2 A;  3HKS A;  1VQ7 A;  3HFO A;  4X34 A;  4TQD A;  1MGQ A;  3JCM c;  2ART A;  2Y4X A;  2DIG A;  3RMS A;  5GMK m;  3MF2 A;  4OVA A;  2AHJ B;  2QQ9 A;  4YRO A;  1XQH A;  4NL3 A;  2RHI A;  4TVY A;  4BE2 A;  1QVF A;  4Q15 A;  4YRM A;  4CH5 A;  3PT9 A;  3SFM A;  1VQ7 T;  1X54 A;  3JB9 F;  1NYR A;  3RUX A;  2PU9 B;  3UDC A;  1SRY A;  3VQV A;  3MP1 A;  2K3X A;  1UB4 A;  2OTJ T;  4FU6 A;  2YRV A;  3M53 A;  2XDP A;  2A8E A;  1OZ3 A;  3OYL A;  4HA8 A;  1ASY A;  1S72 A;  1YFS A;  2LNV A;  3HRS A;  1OI1 A;  4YRG A;  4M77 E;  2YLC A;  4KT0 E;  3MP6 A;  4L6V 5;  4M7A E;  4PJO D;  2ZZG A;  3JAM E;  4BDY A;  1N9S A;  4QVZ A;  1B7Y B;  2ZTG A;  3JCM b;  2ZPH B;  3GIB A;  1S72 T;  4YP0 A;  4II1 A;  4EMH A;  1M5Q 1;  3P8T A;  4FT2 A;  3L1A A;  4C92 B;  4C5H A;  4BB7 A;  3CBO A;  3H6Z A;  3OA6 A;  4J83 A;  4C0D C;  1YJW A;  1NPR A;  2VV5 A;  3UGT A;  4RMO A;  3CCJ A;  1WU7 A;  4XTW A;  2CZ7 B;  3LH0 A;  4M77 A;  2ARU A;  4XAX B;  5LJ3 j;  4J6X A;  2XDB A;  1FYF A;  4HVC A;  2I4L A;  1Y96 A;  4C0D B;  2EQM A;  4UP8 A;  2LCL A;  4KR2 A;  3JCM P;  2XD0 A;  3HP9 A;  5J26 A;  3G1Z A;  3ZFJ A;  2M1H A;  3A5Z B;  3ASK A;  2BIV A;  4OGC A;  4WJ4 A;  1FWZ A;  4C0G A;  4YRC A;  4F7U A;  1N8R U;  2RK2 A;  4E47 A;  3OYI A;  2WSC E;  4C92 F;  3CCM T;  2ZR3 A;  4JLG A;  1WLE A;  1Q86 C;  2P0Q A;  2DK3 A;  1VUB A;  4P73 A;  3QTC A;  3CCU A;  1K8A U;  2ZZE A;  1K9M C;  2ZR2 A;  3L2Z A;  3MF1 A;  1K73 U;  4JRK A;  2K57 A;  1M1F A;  3DKM A;  1C0A A;  3M4G A;  1W2B A;  3DLL A;  2PVD B;  1NPP A;  5DY9 A;  2OTL A;  4LVL A;  1BIA A;  1QP3 A;  2JTF A;  2RM4 A;  1QF6 A;  4C5G A;  3WVD B;  1GXI E;  3A5Y A;  4YRP A;  1NJ8 A;  4RCC A;  3LYI A;  3JCM X;  3M58 A;  1KQ2 A;  4PHC A;  5A2Q E;  5C51 B;  1GGM A;  2E64 A;  2ZCF B;  1G51 A;  3KXT A;  3JCM f;  3MHX A;  3TEG A;  1Z7M A;  4F7U B;  1QVG A;  4F7U F;  4C0Z A;  4LD9 K;  2DU7 A;  5FU7 B;  2CJA A;  3NFC A;  4M75 A;  3G6E T;  4XTV A;  2QTX A;  2LCC A;  2D9T A;  2QA4 T;  4XTU A;  2V8J A;  3TEH B;  2V8I A;  4ATO A;  3VKI A;  4OB3 B;  3A7R A;  4MDX A;  4WI1 A;  2GQV A;  1UGS B;  2LVM A;  2CIM A;  3Q1J A;  3NTH A;  1YJN A;  4LD6 A;  1VQ5 T;  4IUQ A;  2QQR A;  3J7A F;  1YJW T;  4YRS A;  4YRR A;  1M8V A;  2OAU A;  2K2V A;  2KY9 A;  4F7U E;  4M77 C;  3QII A;  5GAM d;  1YIJ A;  5GAN 5;  4LDV A;  3OYJ A;  2B8A A;  1Z7N A;  3OS2 A;  1PYS A;  4BI4 A;  4LDW A;  4GLK A;  3JSC A;  1NYQ A;  4MZP A;  4A53 A;  2DJZ A;  1WGS A;  1X56 A;  4M7D B;  1W2B S;  4HT8 A;  4M7D F;  4IUP A;  4DPG A;  3PZC A;  3VQY A;  2Q5I A;  3E19 A;  3RKX A;  2NLU A;  3X26 B;  5GAO q;  1N6A A;  1YBY A;  3KFU A;  1KQS S;  3JB9 D;  4DOW A;  3IKL A;  2D0Q B;  3J80 E;  5D6Y A;  1N9W A;  2DXT A;  2JOY A;  2MAM A;  2K5L A;  5CIU A;  3R6O A;  3EFR A;  4PJO E;  4PLL A;  2VC8 A;  3A7U A;  1G5H A;  4RCB A;  4CRI A;  2PVO B;  3MET A;  3L2U A;  5GMK e;  5LJ5 d;  2IY5 A;  4HWS A;  4C5E A;  4M75 F;  2DU5 A;  3OYG A;  4C8Q B;  3VV0 A;  4BI3 A;  3FEO A;  4C5I A;  4IKF A;  2A3L A;  3G71 A;  1EIF A;  3G71 T;  2Q7G A;  4A4E A;  1W66 A;  1B8A A;  3C4S A;  2KMT A;  3QO5 A;  3LWI A;  2D6F A;  1NZ9 A;  5IN1 A;  3KUF A;  5KNN A;  4XU1 A;  3A8G B;  1UGQ B;  2QEX A;  3HL8 A;  3L42 A;  3BJU A;  3TUP A;  3PCO B;  3EFS A;  5EG2 A;  1IZ6 A;  1E1T A;  4N4I A;  4PJO A;  2KDS A;  3I56 A;  4XU0 A;  3L4G B;  1N8R C;  5I2M A;  1WQ7 A;  1I5L A;  4O5V A;  4LNS A;  3H8Z A;  3CMA A;  3HFV A;  4Q5W A;  4XK8 E;  4TTV A;  1M90 C;  4NS5 A;  1MHN A;  3V8K A;  1Q86 U;  1UEB A;  3E9H A;  4B9W A;  2DQ3 A;  2PUK B;  1K8A C;  2ODR D;  4BY6 C;  3HXW A;  1IL2 A;  2EFI A;  1X2H A;  1YIT T;  2RHX A;  4C8Q D;  3I55 T;  3JB9 J;  3M56 A;  5LL6 S;  2DVE A;  4NL2 A;  1EQR A;  1LJO A;  4M78 A;  3VYG A;  2MF2 A;  4YRL A;  5CKD A;  1J5W A;  1BBU A;  1VQN A;  2VXF A;  5AYF A;  2K5F A;  4YPF A;  4RQF A;  2CJB A;  5J3B A;  5GAN f;  4PG3 A;  2OTJ A;  2VGM A;  3BDU A;  2ZPE B;  2Y90 A;  2ZZD A;  2P0P A;  4RG8 A;  3M59 A;  5LJ5 e;  1YJ9 T;  1H4Q A;  2XIC A;  3UT1 A;  5GMK h;  3OYB A;  4OLF A;  2CYZ B;  1QE0 A;  3OYY A;  2QA4 A;  3HXY A;  2CZ6 B;  3TEH A;  2QHS A;  3CD6 T;  4N4H A;  4GY5 A;  3QDR B;  3NET A;  1L0W A;  1H3Z A;  5DLO A;  1BYM A;  4M75 B;  1RI0 A;  5GAN h;  2E6N A;  4JLI A;  1Q81 U;  3RER A;  2ZT5 A;  3HSB A;  4IUR A;  4XEO A;  2DTH A;  1YB3 A;  1VQL T;  2RHZ A;  3URG A;  3NEM A;  4OGE A;  5GAN 4;  3CCR A;  4BUG A;  4EMK B;  1LNX A;  2LQ8 A;  2E1H A;  3HXZ A;  4PJO F;  1KHC A;  4M7A F;  3E9G A;  2K4Y A;  3A74 A;  2IVW A;  1B76 A;  4YTL A;  4TVW A;  4EPC A;  2MWO A;  4HWP A;  1G5V A;  1VQ6 T;  5CKF A;  4Y91 A;  4P71 A;  2HNI A;  3JCM V;  5FU7 C;  1VQO A;  1USY A;  2ZZF A;  2K5I A;  4M75 D;  4C8Q E;  4PJO G;  1KD1 U;  5CO7 A;  3HY0 A;  4E7J A;  5LJ3 d;  3I56 T;  4X9C A;  3OB9 A;  3M54 A;  2ZCE A;  3CCU T;  4E7L A;  4P75 C;  3OYF A;  2LQK A;  2QXF A;  2X35 A;  3HHT B;  1ADJ A;  4E7H A;  3LLR A;  1JBM A;  4YYE A;  3TRE A;  3CCM A;  1G3Y A;  3HFZ A;  2QEX T;  1SSF A;  1OZ2 A;  3QUI A;  5D6W A;  4CS4 A;  5CR2 A;  1WPY A;  1X01 A;  1NE8 A;  4TQF A;  3M4P A;  1X2G A;  5GAN j;  1ZBX A;  4C8Q C;  3QJY A;  3QG1 A;  2E10 A;  4BI8 B;  2RI2 A;  1YI2 A;  4UC4 A;  4P73 C;  2VGN A;  3SWN A;  5KE3 A;  1AHJ B;  3X25 B;  2KAF A;  1FXX A;  5C53 B;  1QP2 A;  2LTO A;  3UH0 A;  1RIQ A;  4ZGE B;  3SDZ A;  4RDX A;  4BDZ A;  4A4H A;  4HCC A;  3DLM A;  5I21 A;  1WQW A;  1BI2 A;  5GAO p; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...