1WPYA

Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3 in complex with biotin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 61
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wpyA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wpyA01
1NJ1A 4H2UA 1H641 4K86A 4EX5A 4YDQA 1EIYA 4C92G 1G5HA 1E22A 4CH5A 3JCMW 2DTIA 2RHQA 5GAOr 4YRFA 3JCMf 4N0AA 1J5WA 1N9SA 3LSSA 3HXZA 11ASA 3E9IA 5GAOn 1U1TA 1B34B 4P73A 2RA2A 4C8QD 2J3MA 4UP8A 4C92E 2CJ9A 4YRLA 1ASZA 2I2LA 1EOVA 4YRGA 2Q7EA 4RDXA 1LJOA 2FYKA 2Q7HA 3IG2A 4PJOC 4PJOB 2ARTA 2E3CA 4HWPA 4M75D 5GAMg 3REXA 5LJ3h 5GANd 1BBUA 4OP0A 1I4K1 2DZCA 1Z7NA 3MF1A 4JUVA 2Q5IA 4YRIA 1D3BA 2DTOA 4J6WA 4UP7A 4Y91A 1E24A 2I4OA 3QNEA 1QF6A 2ARUA 1WNLA 4CH6A 4HWOA 4P72C 4HVCA 4M75C 4H2WA 2E5AA 5ELOA 4M7AA 4XTUA 1H4VB 3JB9F 3FIFA 5GANf 2DVEA 4XU0A 5GAOm 5LJ5j 2AMCA 1USYA 3TEHA 3R07A 2IY5B 3KFUA 4XTYA 3JCMX 3EFSA 5C51B 1B7YA 4PJOF 4EMKA 4C92B 4XU2A 1FYFA 4YYEA 3HFZA 3JCMh 1X2GA 3IKMB 1IL2A 1JJCB 3MF2A 1Y96B 4TQDA 3VU3C 3M4PA 3A31A 1NYRA 3JCMV 4YCVA 4RQEA 4YRMA 1YFSA 1B8AA 4H2XB 3JB9G 4P75C 2DZ9A 4M75F 1WYDA 4M77D 3E9HA 3JCMc 2XGTA 3PCOB 4PJOG 2AKWA 5GAMd 3HRKA 4HA8A 5GMKh 3P8YA 1E1OA 4C8QG 3NETA 4M77C 4O2DA 4ZTZB 4M78D 5DY9A 4G84A 1U1SA 3MEYA 4YCWA 3QHSA 1H4TA 3FJPA 2VXEA 4YRJA 3GIBA 3RKXA 1WU7A 2ZINA 3RKWA 4RQFA 2ZR3A 4P74A 4C8QE 4M75G 4K87A 5GANh 3HRIA 5GAMf 2ZIOA 2RHSA 2DU5A 4H2TA 2K57A 4M7DC 4XQ3A 4NCXA 4M7DB 4JLIA 4P3PA 4YROA 3IKLA 2RB6A 3LSQA 4M75E 4EMHA 1B76A 3QSUA 3FB9A 2QTXA 4P3OA 4QVCA 1W66A 3I7FA 3QUIA 3SWNA 5GAOq 3AHUA 2ALYB 3WQZA 2YLCA 2YLBA 3CMQA 4HWRA 5LJ3j 1KQ2A 2DQ3A 3QO5A 1NJ6A 4M77F 3PZCA 1YB3A 2ODRC 4TVAA 2EWNA 3HTZA 4YRSA 4YRRA 4P73C 4X9DA 2EJ9A 2EJFA 4K88A 3JCMP 3VQVA 4H2SA 3OD1A 4XU1A 1G5IA 4M7DF 1E1TA 2ZCEA 3HXWA 5GAOp 2DXTA 4CS3A 1HXDA 2E10A 2I4MA 1HTTA 4C8QC 4C8QB 1B34A 4M7AD 3RF1A 1KOGA 2G4CA 4CH4A 4TVWA 1B70A 1H4SA 3A5ZA 1Z7MA 3L4GB 1I5LA 4M77G 1D3BB 1YCYA 5LJ5e 4H2YA 5KNNA 4F7UG 4PJOA 4KR3A 3HFVA 4NL2A 4M75B 4RMFA 5GAMh 4J15A 4UPAA 5E3IA 2FB7A 4XTVA 2DU7A 1X54A 2Q7GA 4J6XA 3V8KA 4M77E 4PG3A 2ZIMA 4M7DG 3A7RA 4M78G 4A54A 2P5IA 4F7UE 3ERRA 1USYC 4PHCA 2DTHA 5C52B 1HK9A 4DPGA 2CJAA 1B7YB 4EMKC 2DKGA 4C8QF 4M7DE 1M5Q1 3UFGA 3HXXA 3HFZB 4M78E 2I4LA 1N9WA 2QHSA 5GMKj 4DQ2A 3UGTA 1WQ7A 3RIRA 2ZZGA 1LYLA 5LJ5g 1WPYA 4C92A 1SERA 5GAN7 2DQ0A 3BW1A 2PMFA 3JB9H 1X55A 4HWTA 1JJCA 1BIBA 1Y96A 4HT8A 1PYSB 3A7AA 3PGGA 4JRKA 3RL6A 5GANj 3QO3A 3JCMb 1M8VA 2AKWB 1NYQA 4H2XA 4CH3A 2ZNJA 4HT9A 4M77B 3RACA 2CIMA 5GAOl 4V2SA 3L1AA 4F7UB 4P71C 3RGLA 4YP0A 5F5WA 1NJ8A 3PCOA 2EAYA 2QHTA 5GAN3 2PMEA 3HSBA 3L2ZA 4P74C 4HWSA 2RM4A 4M7AG 4M78C 4M78B 2Y90A 4AH6A 4G85A 5LJ3e 1YGBA 2ZT5A 4XTZA 1WQWA 1GGMA 4ZIBA 2DEQA 2ZXFA 4M7AE 3TUPA 2VC8A 4CS4A 4A53A 1BBWA 2DJZA 3HXUA 4XU3A 1EIYB 4M7DA 4RCBA 1JRIA 3JCMd 2RHQB 4N0AC 3A74A 3M4QA 4RCCA 4F7UF 3TEGA 1N9RA 3DSQA 2VXFA 1YFTA 4P3NA 4TVAB 5LJ5d 3JB9D 3G1ZA 4LNSA 4WF2A 3BJUA 1BIAA 2ALYA 3VQYA 4XTWA 1ATIA 5GAMj 3HFOA 3REUA 4BW9A 3VBBA 4M78F 4YRCA 2ARSA 3QO8A 4PJOD 3JCMe 3LC0A 3P8TA 5LJ3g 3NENA 2QHUA 3A7UA 4CS2A 5LJ5f 3BFMA 4MMLA 1G51A 2DXUA 1B70B 3HXYA 1X01A 4TTVA 3A32A 4KQEA 1NJ5A 2I4NA 4BWAA 1SRYA 2HNIA 4M7AC 4TVYA 3VQWA 3BY7A 4M7AB 4C8QA 3RERA 3M4GA 3NELA 3IALA 3EFRA 5GAN6 5I21A 5CAIA 4EO4A 4TQFA 3L4GA 1I81A 4XTXA 4EMGA 2AMCB 4J5YA 5GMKe 3TEHB 5GMKm 4X9CA 5K1PA 1WLEA 3HXVA 4P72A 2ZT6A 4YCUA 1LNXA 2JN0A 4M75A 3QO7A 1VQZA 4Q15A 4EMKB 4H2VA 1NJ2A 4C92D 2ZNIA 4YRQA 2ZTGA 3ICAA 3RKYA 3JCMg 4UP9A 2ZT7A 4ZTUB 3INZA 2IY5A 1ADJA 3JCMQ 5GANe 3HY1A 1KQ1A 2C7IA 2P0LA 3RESA 5HGQA 2CGHA 2RD1A 1SESA 1L0WA 4MMKA 1QE0A 4E51A 4C92C 4M7AF 4XEOA 3SB2A 1EVLA 4H02A 3HFNA 4YRTA 1TH7A 2ZZEA 4YREA 5K1XA 3P8VA 4YRKA 2ZGWA 4WI1A 3JB9I 5C53B 3NEMA 2YHTA 4J6YA 3V7RA 5GAN2 1KMNA 3QTCA 3W3SA 5LJ5h 2ZR2A 5LJ3d 4P75A 4NL3A 4Q6GA 4PNOA 3V8JA 2EL9A 1MGQA 2Q5HA 2ZT8A 1HC7A 1H4QA 1YFRA 1ASYA 4NOYA 5GAN5 1PYSA 4YRPA 1EVKA 3UGQA 5GMKl 2J3LA 1RIQA 2E1HA 3RUXA 4YRNA 3JB9J 3V7CA 5GANg 1SETA 4WJ4A 4QVDA 2RHSB 4YPFA 1JBMA 4M77A 5LJ3f 2QHVA 1X2HA 4M7DD 4L87A 4C92F 4F7UA 3BDUA 2DDZA 4P71A 4OLFA 3JCMJ 4KR2A 4XEMA 4PJOE 1I8FA 2E41A 5GAN4 2E65A 1ADYA 5GMKi 4TWAA 2ZZFA 1C0AA 3V7SA 1EQRA 1KMMA 5GAN8 2EJGA 3SWNC 3SWNB 4M78A 3VQXA 2CJBA 3A5YA 5GAMe 3HY0A 3UH0A 2C8MA 3V8LA 2XTIA 5ELNA 1EFWA 1X56A 4WJ3M 4X5OA 4JRIA 1LOJA 2ODRD 12ASA 2E64A 1NNHA
chains in the Genus database with same CATH superfamily
1AZEA 2K3BA 2CUDA 3CCQT 1EIYA 4C92G 2DBKA 3HTRA 3CD6A 2AKKA 1KD1U 1AEYA 3S6WA 3LSSA 4RMOA 11ASA 3H6ZA 1BCMA 2A36A 2RA2A 4F17A 1SSFA 4YRLA 1ASZA 2I2LA 1EOVA 1TU0B 1X43A 3A98A 3NPFA 2Q7EA 2EGAA 1VA7A 3O8VA 4IIOA 1LJOA 5KYUB 3CCQA 2E6ZA 1TTHB 2O4XB 3QIIA 3X20B 4PJOC 4PJOB 7AT1B 1M3BA 3O5ZA 2E3CA 4M75D 5GAMg 2BZYA 2LX9A 4PJMA 5LJ3h 1YJ9T 1G83A 4BI3A 1BBUA 1EFNA 2K4YA 1S72T 1BI0A 2Q5IA 3VRYA 4Y91A 1E24A 1QVFA 2KBTA 2ZPIB 3A8LB 1FX7A 4P72C 3HRSA 4HXJA 2DEUA 3OS1A 5GANf 1B3QA 3NMZC 2F2XA 2AMCA 3CCMA 2MWOA 2O88A 1W2BP 2F1LA 2IY5B 1S72A 2HQEA 4XTYA 3CPWA 2GCXA 2YXYA 3DB4A 1OU9A 5HK0A 1K9MC 3EHQA 3TCJA 5KH6A 3UPUA 1NEBA 2K5LA 1Y96B 3GLXA 2H8HA 1EX4A 2KE9A 3VS0A 2DO3A 1VQ9T 3A31A 3CCRT 2CDTA 2EYZA 1T0JA 1K73C 2EYXA 3JB9G 1SF9A 3OY9A 4J9GA 1N6AA 1F1BB 2MAMA 1G3YA 2YUQA 3JCMc 2CH4W 2CZ1B 4EPCA 2NUZA 1MV3A 2GGRA 1VQ9A 1NNHA 4CC4B 1TWBA 4A4FA 1E1OA 3CCRA 4JZ4A 2DBMA 2P4RA 3CC4T 3M0QA 1VQ8T 2X4YA 2Z0WA 1X6BA 4AFSC 3FJPA 3LH0A 2VXEA 4IUTA 4M75G 4K87A 1ZSZC 4F16A 3RMQA 1ZSZB 5GAMf 3S3MA 4H2TA 3CCSQ 3VYGA 1RLPC 3QWYA 4BDYA 2P0QA 2E3HA 4PLIA 1VQ8A 4BY6C 4MDXA 4HVUA 4BY6B 2VV5A 3I7FA 3QUIA 3AHUA 2ALYB 3WQZA 4CC2A 1NLOC 5HK3A 1ZA1B 2YLBA 4FT4A 2DQ3A 4BI4A 1NJ6A 4M77F 1Q7YR 5KCHA 1SEMA 1VQNT 4Z8AA 2ODRC 4TVAA 1VQOA 3M4YA 4PJJA 4YRSA 1VQPT 3CEYA 1ZA2B 4KGZB 3VQVA 4PFOA 2LQNA 1X6OA 2CZ6B 2LP5A 2IG0A 3HXWA 4CS3A 2E10A 1YHQA 2EGEA 4L59A 1SG5A 2K79A 3VYHB 1KOGA 1VQNA 2RO0A 1WX6A 1VQLT 1KG1A 4TVWA 2QQBA 3ZEHA 2JT4A 4OMFB 3OYDA 3AT1B 1I5LA 5KYUA 1D3BB 4FW2A 1YCYA 2EVRA 2HEQA 2MI6A 1HD3A 4OB1B 3VS3A 3VS6A 1GBQA 2O4XA 4AFQC 4VUBA 4F7UG 4PJOA 4KR3A 1BKBA 1VQ7A 4KBMB 2WSCE 4J15A 5E3IA 1YCSB 3VS2A 2DU7A 1X54A 4QT7A 1AHJB 2ZPHB 3R6OA 1MHNA 3V8KA 2EKOA 1WGSA 1PM3A 2LZ6B 2DFUA 2P5IA 1USYC 4QQDA 2DTHA 1OULA 1PHTA 1KHIA 1NYGA 5CKEA 4F04B 1YITQ 2CJAA 2XICA 4EMKC 1B7YB 1Z9QA 4C0ZA 3HFZB 1M1FA 2QHSA 4IURA 1I5OB 2CP2A 1CKBA 2VUBA 4JZ3A 2JTEA 2KYBA 3BW1A 3G6EA 3JB9H 1JJ2A 1H8KA 1BIBA 1Y96A 3PGGA 3PVLA 2QK0A 1PKSA 2ZPEB 1AVZC 5CVIA 1EIFA 2X3XD 5A0LA 1NJIR 1UGQB 1UG1A 2HKNA 4BACA 2CIMA 4RTYA 1GXIE 3I35A 3TEEA 4J8OA 4HVWA 4LNPA 4PJNA 5F5WA 2KSSA 2QXFA 1ZBJA 1IZ6A 1FXXA 2RQTA 1VQ4T 4P74C 5FU7C 2WACA 5FU7B 4M78C 1NG2A 4M78B 2CP6A 1Q81R 1Q82C 1VQKT 1WJQA 4JDSA 3CQTA 4XTZA 1M1KC 1WQWA 4KGXB 3SDZA 3VS4A 3MP6A 1IREB 2AK5A 1BK2A 2DL5A 4QQGA 1KC8R 1ZSZA 4CS4A 3HXUA 2HDAA 2O9VA 1WHHA 5ECAA 2XMFA 2QTVA 3CMEQ 2RHQB 1M1GA 4Z89A 2JS0A 4RCCA 4KUDK 3C12A 3HHTB 1T0HA 2VVKA 4FU6A 1N9RA 3RDVA 1VQKA 1G3TA 3FRNA 1X69A 1UGRB 2MMPA 4LN2A 2ALYA 3OYIA 1QKWA 3HFOA 3G7ZA 3OYBA 2RHUA 2ED0A 4PJOD 1FMVA 3PT9A 2LT1A 3P8TA 3VJPA 4DOVA 3NENA 4FT2A 5A0DA 2DXUA 3CCJQ 2WSEE 1B70B 1VQ5Q 3OYLA 4LVKA 1OPKA 2KYMA 1TUCA 2DXBA 4A4GA 1A0NB 4BWAA 3M54A 4KH1B 4RKUE 4M7AC 3VQWA 4M7AB 1UDLA 2O31A 2LCLA 4UC4A 3VUZA 4AMCA 4E7HA 5GAN6 1MNDA 4GBQA 4LDYA 4EO4A 4ZNXA 3TEHB 4X9CA 4DEYA 3CMAQ 1GFDA 3I56Q 1K8AC 2CZ7B 3THKA 4YRQA 4JJNK 2ZTGA 2AZSA 3JCMg 2FHDA 3INZA 3OW2S 2RK2A 2RHYA 1AT1B 1UGPB 1KQ1A 2C7IA 1RI0A 3MO8A 4ZTFA 5HGQA 5DM7R 4HKEA 1Y7XA 2ENMA 4MMKA 4E51A 4FW1A 1N8RC 3SB2A 2E4HA 1EVLA 4H02A 2B8AA 3MJXA 5K1XA 1QMCA 2EQIA 2ZGWA 3ZBDA 1PRMC 3C94A 4J6YA 5HY6A 1OU8A 5LJ5h 1KQSP 2C0IA 5CKDA 3OS5A 3V8JA 4AFZC 2D6FA 1HC7A 1PCXA 2YUPA 4NOYA 5GAN5 3CPWS 1EVKA 2DLPA 1PNJA 1TOVA 2JW4A 2E1HA 3CCUQ 4PJLA 3CCEQ 2A7YA 4YPFA 2XI9A 4XK8E 1X2HA 1W70A 4E6RA 3META 4C92F 1RACB 3BDUA 1JO8A 3MEWA 1MNEA 4KR2A 1VUBA 4DBFA 1I8FA 2E41A 2QGFB 1ADYA 4TWAA 2V26A 1C0AA 3V7SA 1IO6A 1EQRA 3BE3A 2EJGA 4N4HA 3TVTA 1RUWA 4PK4A 4M78A 3CCVA 2YDLA 3HY0A 2DX1A 2C8MA 3UH0A 2BZ8A 2LCCA 4JRIA 5KYNA 1LOJA 3EGUA 2ODRD 2JVVA 1YBYA 4J7FA 1VQMQ 1M1KU 1RI9A 4GY5A 3OYEA 1I1JA 4EX5A 3J7AF 1PKTA 2XG8D 1G5HA 3G71A 3JCMW 2EQUA 2RHQA 5GAOr 1YP5A 3JCMf 1UGVA 4J9EA 4QQ6A 3VV0A 3M59A 3HXZA 3SD4A 3EH1A 1QWEA 3EGXB 2GBQA 3E9IA 1ACMB 2RQVA 4YRGA 4HVVA 2KT1A 2PVDB 3CCLT 4RDXA 3QPHA 2EPDA 4AG2C 2E5KA 4X1VA 1MMAA 2D0NA 4TVRA 4O6JA 2CP3A 3REXA 4ZGJB 6AT1B 1PRLC 2COWA 4OMQA 1YWPA 2L89A 3RMSA 4OP0A 1I4K1 3I55T 1WYXA 1Z7NA 4JUVA 5IT9E 3A1PA 4OB0B 2I4OA 3VS5A 1WLPB 3QNEA 2ARUA 4ORZA 4DA4A 1WNLA 2QEXT 1NPPA 2DPPB 2LT4A 4M7AA 3CC7T 4ZN1A 3NGPA 2R5MA 4XTUA 2H3JA 2ESWA 3JB9F 3HPWA 4HCBA 3PIOA 3QYGB 3ME9A 3TEHA 3R07A 3KFUA 3CCQQ 3C4SA 2QDLA 2LC4A 3EFSA 4LVMA 1NYFA 3C0CA 5KYWB 3LWIA 3S3OA 3CC7A 3IKMB 1JU5C 4J9BA 4MZTA 2KMTA 2IVWA 4OGCA 1TUGB 4BE2A 3JCMV 1RADB 3X25B 4YCVA 3OSVA 3EGDB 1W2BA 1M90R 2DILA 4JRQA 1B8AA 2DM1A 4H2XB 2DZ9A 4FYVB 4M75F 1WYDA 2VGNA 1R0CB 3E9HA 2W10A 2QQ9A 1YJ9Q 4ATOA 1IXDA 3PCOB 2PUOB 1S72Q 1UJ0A 1AZGB 2AKWA 2L3RA 1OEBA 2KK4A 1QVGA 3NETA 2DETA 4M77C 4O2DA 4M78D 3TSZA 1TUDA 2KI7A 3M0TA 3OYMA 5I2MA 1H4TA 1C1AA 4ELZC 3KBGA 2JMCA 3FLGA 3CD6T 2ZINA 4C8QE 1TS9A 5GANh 4OVAA 4JLIA 4IKFA 3RBBB 2QGGA 2K5IA 2A28A 3QSUA 3FB9A 2Y4XA 1ABQA 4OGEA 1VQ9Q 1W66A 3MPUB 1WI7A 2ZPBB 3CCRQ 3ER0A 3OYFA 2YLCA 4JLGA 5LJ3j 1KQ2A 2EQJA 1LVKA 1YB3A 2ECZA 2EWNA 3HTZA 3CXCS 3QG1A 3H0HA 4YRRA 2OTLA 4P73C 5IN1A 4BE1A 2EJ9A 2EJFA 4WTOB 3MEAA 3CBMA 1D09B 2F2WA 4D8DA 4XU1A 2EBPA 4QW2A 1E1TA 2QDYB 2ZCEA 1WZOA 3OW2A 2LJ3A 2I4MA 1HTTA 2NUPA 1Y71A 3G4SA 4M7AD 3RF1A 3CCMT 2COZA 3CC4Q 3WXMB 1BI1A 4CH4A 1VQ8Q 1YJWA 2K7AA 3S3NA 1H4SA 1Z7MA 5A2QE 3L4GB 1HSQA 1ZQ1A 1V29B 4JRPA 3QJ6A 2GNCA 5J26A 2M51A 3HFVA 4B6MA 3L2UA 5GAMh 4XTVA 2V8JA 2K6DA 2CP7A 1JB0E 3OS0A 2XDDA 1QP3A 2Q7GA 1K0XA 2DL4A 4M77E 3EG1A 2ZIMA 4M7DG 1M27C 1QVPA 4M78G 4ZTJA 1SRMA 5C52B 5FW9A 1MMNA 2FPEA 4KUIA 1MMDA 2JS2A 2DKGA 4C8QF 1VQNQ 1C6VX 4LVJA 2CKKA 1VQPQ 4XAXB 1PG5B 1TXQA 1VIEA 1KIKA 1UEBA 1WQ7A 3RIRA 4AG1C 4FSXA 2ZZGA 1LYLA 4PKCC 1SERA 5GAN7 2PMFA 4J7IA 2BKDN 1X55A 4HWTA 4Y28E 3A7AA 4JRKA 3UATA 4DBQA 1VQLQ 3EGDA 2X4WA 2ZZDA 3JCMb 4WCIA 3NFCA 1VQ6A 4H2XA 1WHKA 3L2RA 2EQKA 3CBPA 3RACA 1JXMA 4V2SA 3L1AA 1UUEA 1GCPA 1NBEB 3E9GA 1IHVA 1SKUB 3PCOA 2LJ1A 3VS1A 4BI8B 2PMEA 3P8DA 3PE0A 3OYCA 4HWSA 2RM4A 1M2OA 2FZCB 4E7IA 4M7AG 1UE9A 2XK0A 3LX7A 1VQOT 3L2WA 2FPFA 1NEGA 2ZAEA 5LJ3e 2GTJA 3CC2T 3F70A 5FLXE 2CREA 4LUDA 3EAEA 1WHJA 1AD5A 2EGCA 5KYYB 3UT1A 3TUPA 2GQVA 1TSFA 2J6FA 2LRQA 3IQLA 1GBRA 1BBWA 4XU3A 1YHQT 1KK7A 4R55A 3E2UA 1JRIA 3MEUA 4RTVA 4B9WA 4FIBA 1VOMA 1LCKA 1YFTA 4X34A 2FEIA 3CC2A 3G1ZA 4WF2A 2NLUA 2PTKA 2EQMA 1BIAA 2HSPA 1VQ7T 3VQYA 4XTWA 1ATIA 2X4JA 3H9NA 4YRCA 1K9AA 2YWWA 2G3RA 3GOXA 2ARSA 1K9MR 1NJIC 4JJBA 2KROA 4NS5A 2KY9A 3BFMA 4MMLA 1QVFP 4HCZA 1Y57A 1K73R 1X01A 2RJDA 2DYIA 3Q1JA 3FC3A 3A32A 2DL3A 4TTVA 3OYHA 1VQ4Q 1DJ7B 1SRYA 2QQRA 4LD6A 5CKFA 3PFSA 2HNIA 2M02A 3RERA 3M4GA 3IALA 1VQKQ 5FRNA 4IUVA 2GF7A 3X24B 4AT1B 3A8HB 5CAIA 4TQFA 3L4GA 3DLMA 4XTXA 4EMGA 5CQXA 3KUFA 4Z02A 5K1PA 2JXBA 1WLEA 3G6ET 2ZT6A 4P72A 3UA6A 1LNXA 3QO7A 4FCYA 1VQZA 4Q15A 2A8EA 4A4HA 4EMKB 2J6OA 1NJ2A 4H2VA 2LMJA 2ZNIA 4J9DA 3RKYA 4UP9A 4ZTUB 1ZUYA 2IY5A 3JV3A 1E7OA 2P0LA 4CRIA 2P4TA 1ZHIA 3J80E 1QE0A 1AWJA 4C92C 2DRKA 4IIMA 2QG9B 3HFNA 2A37A 1Q7YU 2J6KA 3NTHA 4YRKA 2O9SA 3M55A 2LTOA 2PQWA 2RK1A 5FWCA 2ZR2A 3MP8A 2KAFA 4Q5WA 5LJ3d 4Q6GA 4NL3A 1ZSGA 5CKBA 4ESRA 3OB9A 1BYMA 2EL9A 2Q5HA 1ASYA 3CCSA 1RAGB 4YRPA 4C5EA 2BUDA 3UGQA 2J3LA 2DE0X 2FG0A 3CBOA 3JB9J 3ZFJA 3CXCA 2KQWA 4WJ4A 4QVDA 2RHSB 3L42A 2LQWA 2VB6A 3EH2A 2QHVA 5D6WA 2DJQA 2YUNA 1W2BS 2HQXA 3LH5A 1Q95G 3A8MB 2E12A 1X75C 5GAN4 2E65A 2ZZFA 3MP1A 2KRSA 1KMMA 1U3OA 4J9IA 3SWNC 4FYXB 3SWNB 3VKIA 3VQXA 1BBZA 4J83A 3RNJA 3OYAA 2HL5C 1NZ9A 3DLLA 5ELNA 2M0OA 5KYYA 1QVGS 12ASA 4BD3A 4ELYC 2EYWA 1JQQA 1NJ1A 4H2UA 1H641 4K86A 4YDQA 2LNVA 4CH5A 2DTIA 1NE8A 2RHZA 4YRFA 1J5WA 2DERA 2BE9B 2DIGA 3M0UA 1G2BA 1U1TA 3OMGA 2HZYA 4C92E 2JTMA 3PVQA 2CJ9A 2H3EB 5AT1B 3ZL7C 4PL6A 3MHXA 2FYKA 3MEVA 2AKLA 1OV3A 3QDFA 2E70A 1RLQC 1OZ3A 2ARTA 1WA7A 3FEOA 3H0IA 4HWPA 1YITA 1NJIU 1M8MA 1QCFA 2AZVA 2CP0A 2DZCA 5KYXB 4YRIA 1D3BA 2GFUA 4UP7A 2L3SA 1QF6A 1WJSA 5CKHA 4CH6A 4L5GA 1R77A 2J05A 4M75C 1WXUA 4H2WA 5ELOA 2W0ZA 2QA4T 2LDMA 1M4ZA 1H4VB 3FIFA 2KRMA 2RPNA 4XU0A 3SEMA 3D7SB 5GAOm 5LJ5j 4JS5A 1USYA 2YRCA 2RI5A 4RTTA 1XOVA 5C51B 1B7YA 1Q82R 4EMKA 4XU2A 2I0NA 1JJ2P 1M2VB 2E6NA 3HFZA 3JCMh 2RN8A 2MCNA 1M1KR 1X2GA 4RTWA 1JJCB 3C95A 1D0XA 2QA4A 3JRZA 2YT6A 3VU3C 1NYRA 4RQEA 1G8XA 5I22A 2HAXA 1YFSA 3CCLQ 4P75C 3PMTA 1PWTA 2LX7A 4MZPA 2D8HA 1BB9A 1X6GA 1OPLA 4LE9A 3VRZA 2RMOA 3I55Q 3CCVT 4PJOG 3FDRA 3HRKA 2MIOA 5GMKh 3P8YA 3EG2A 2QEXQ 3CMEA 4ZTZB 3H8ZA 2JM9A 3OYGA 4G84A 1PD0A 5J3BA 3CC7Q 1U1SA 2RQWA 3MEYA 1QKXA 3G71T 2FRYA 4LD9K 1WU7A 4RQFA 3RKWA 1WHMA 2ZR3A 4P74A 2HKQB 2ZIOA 2RHSA 3JSCA 3HRTA 1BI3A 2K57A 4NCXA 4P3PA 3L2VA 2RJCA 4YROA 3QKJA 1H3ZA 1YNZA 1YFNA 3M0SA 2RB6A 3LSQA 1FMWA 3OS2A 3EFOB 3I5RA 1K4US 4M75E 1B76A 1GFCA 4P3OA 1PSFA 3P8BB 4QVCA 2NYSA 5IHKA 5L8RE 3SWNA 1WHLA 2IIMA 2MOXA 3EHRA 5GJWB 1K8AR 1VQ5A 3CMQA 1PSEA 3HKSA 2A3LA 4LDWA 1IB8A 4JPBW 3PZCA 4C0GA 3GPLA 3H41A 5CR2A 4X9DA 1KHCA 2AHJB 3TREA 2AT1B 2OAUA 1RL2A 1QLYA 4OB2B 1WXTA 4L6V5 3CMAA 4M7DF 1Q86C 4J9CA 5GAOp 4K11A 3I56A 2PNIA 5HKCA 1N8RR 5IHNA 4C8QC 4C8QB 2DA9A 3GNGA 3LW5E 2G4CA 2VKNA 1YJNT 1GL5A 1B70A 4J9FA 1IHWA 5IAYA 2BIVA 5FU6C 3CD6Q 3M0PA 5FU6B 5LJ5e 1HJDA 5KNNA 3NHNA 2M9UA 4ZGEB 4UPAA 2KEAA 4R0KA 1FYNA 2VGMA 2DF6A 3OSSC 1IGUA 4J6XA 5KYXA 4PG3A 3A8OB 3A7RA 4F7UE 2L2PA 1YJNA 2RQUA 4BUGA 2KNBB 2FO0A 4RTZA 1HK9A 3A8GB 4DPGA 1G3SA 1M3CA 2R57A 1X2QA 3HXXA 1WIEA 2KGTA 2RF0A 3WVEB 3DKMA 1KD1R 8AT1B 3UGTA 2KXCA 3CCUA 2HD0A 1XJWB 2COYA 3CCEA 3U23A 4KT0E 1AOJA 2YUOA 2JJ9A 4KH0B 3N5BB 2PU9B 1JJCA 3RL6A 3CCMQ 3QJYA 5GANj 1ZUKA 1NYQA 3TU4K 2ZNJA 2ED1A 4M77B 4ME7A 1SPKA 3GNFB 2P0PA 2EFIA 4P71C 3QXEB 4YP0A 3OYKA 4IUUA 1NJ8A 2QHTA 1VQMA 5GAN3 2Y4YA 2CT4A 2OTJT 3L2ZA 3RR6A 3R6NA 3MQZA 5DLOA 1BU1A 3REBB 2KRNA 4AFUC 2OTLT 4C0FA 2JUFA 2V8KA 1UECA 1YI2T 2RNAA 1BI2A 5KCOA 1G3WA 1SRLA 2OTJA 2QYZA 1UJYA 2CSQA 4RCBA 3JCMd 4E2FB 5GJVB 3G4ST 4N0AC 3A74A 1X2KA 1YJWT 4F7UF 5HCKA 3TEGA 4OMNA 1D0YA 2RHIA 4TVAB 2GFAA 5LJ5d 3JB9D 4LNSA 5AYFA 3GP8A 3BJUA 2SRCA 3E1SA 1YI2A 4OMLA 5GAMj 2NS6A 3VBBA 3EGXA 4ZN3A 1M90U 2E5QA 4E7ZA 3EG0A 1U06A 2DIQA 5DLQE 1Y0MA 4LVLA 5KE3A 3REAB 3LC0A 5LJ3g 1K76A 5J39A 3A7UA 2HMAA 1G51A 1PC0A 1YN8A 3HXYA 3OA6A 4KQEA 3QBYA 2V8IA 2QASA 3J81E 2JMAA 2KT8A 1VQOQ 1Q86U 3M53A 3PNWC 4RTUA 4GLMA 4C8QA 3NELA 3OMCA 4QKUA 1VYTA 3CC2Q 2QI2A 5I21A 4BE0A 1HYOA 1I81A 5EG2A 4E7SA 4R56A 4J5YA 5GMKm 2YRVA 1FMKA 4II1A 3HXVA 4C5IA 1CKAA 4FL6A 4YCUA 1YHQQ 4QVZA 4PFPA 1Q7YC 4YTLA 2F5KA 1YIJT 4KGVB 2ZT7A 5FROA 1RAIB 2J7IA 1YJ9A 1CSKA 1VQ6T 2HBWA 3FJ5A 3UF4A 3JCMQ 5GANe 2DYBA 4D8KA 1VQ7Q 2VWFA 4EDUA 5KYWA 4HT4A 5D6YA 4F14A 2JM8A 2FRWA 1G5VA 1TH7A 2ZZEA 3E19A 1N27A 3P8VA 3ULRB 3V7RA 1N5ZA 1YIJA 3QTCA 3KXTA 3W3SA 1QVGP 2ZCFB 1RABB 5I11A 3OQ5A 1ZLMA 4IUQA 2DXCA 2L3QA 1YFRA 1I07A 4Z88A 3SFMA 3QZ5B 2EYYA 5GMKl 3LWHA 2DVJA 1SHFA 3EG9B 2JTFA 1RIQA 3RUXA 2DD5A 2QQAA 1GCQC 3V7CA 3QWXX 4LXCA 4M77A 1UFFA 5LJ3f 3G6EQ 3HP9A 4DEXA 1QQJA 2MK5A 4L87A 2PZ1A 4P71A 2CP5A 4N4GA 4XEMA 2C06A 2BZXA 4PJOE 3LYIA 1OX8A 4ANJA 3M58A 2HBPA 1QCNA 5GAN8 1V76A 1KJWA 5M9OA 3A5YA 5D7UA 5GAMe 3UA7A 1X56A 2YRDA 2BTTA 2X4XA 2E64A 3CC4A 1W4SA 2X9HA 3MCAB 1D0ZA 4P5NA 1E22A 1W1FA 3OW2P 4N0AA 1N9SA 1O9SA 2ATCB 2L5QA 2CZ0B 5GAOn 1B34B 4P73A 4C8QD 2J3MA 2M0YA 2XKOC 3PTAA 2K2MA 4UP8A 1C0MA 3A5ZB 3GBQA 2XDPA 3QZ9B 5C0MA 3M0RA 3I9QA 1MMGA 1OI1A 2Q7HA 3IG2A 5KE2A 1XTDA 1RAEB 1UHCA 1AWWA 1XNIA 1Q81C 5IXFA 3ASKA 2CS7A 2F5TX 5GANd 4D6WA 2D9TA 5FRMA 2SEMA 3MF1A 4KRTA 5D6XA 1VQPA 2DTOA 4J6WA 1KC8C 4E7KA 3UWNA 1ABOA 3CPWP 4CC3A 4A4EA 4FSSA 4HWOA 4HVCA 2E5AA 1U5SA 2VYTA 2NUTB 5L23A 4IUPA 3M5AA 2DVEA 5IHIA 1VQLA 4LVIA 1UGSB 3JCMX 4Y92A 3CCST 2QAZA 1IRXA 4E7LA 4PJOF 3HRUA 4C92B 2R5AA 1FYFA 2LVMA 2X35A 4YYEA 1IL2A 3MF2A 4OF1A 4TQDA 3M4PA 1MUZA 1M3AA 1I0CA 5FWBA 4YRMA 3LGFA 2HSEB 1T3SA 2K5FA 1MV0B 4M77D 3PMIA 2RI2A 1WHGA 1K9MU 1KFZA 2L3PA 3I5SA 2XGTA 1OOTA 5CIUA 2EW3A 5C6SA 5GAMd 4HA8A 1V1CA 4C8QG 3DB3A 1K73U 1NPRA 1KQSA 2XIDA 5DY9A 2ROLA 5LL6S 2QA4Q 3H0FA 3SHWA 4YCWA 2OJ2A 4HCKA 3EG9A 3QHSA 4DBRA 1R8OB 4YRJA 3GIBA 3RKXA 4CC7A 1GCQA 1OZ2A 3HRIA 2DU5A 1M30A 2F2VA 4M7DC 4XQ3A 4M7DB 4O5VA 1RAAB 4MZMA 1X27A 2EYQA 3IKLA 1W6XA 5IXBA 1K0SA 1U8RA 2NWMA 4LDUA 2AIRB 4EMHA 4KULA 2QTXA 1NM7A 3M57A 2K2VA 3T9NA 4MDWA 5GAOq 1IGQA 2K9GA 3X28B 4FM4B 4HWRA 1YITT 2JOYA 1VQ4A 3QO5A 1M9SA 4OB3B 3X26B 1H92A 1UB4A 2HCKA 5A0GA 4C0DC 4K88A 4C0DB 3JCMP 4H2SA 1KSWA 3OD1A 3CCVQ 2X51A 2PUKB 1G5IA 1BCOA 2DXTA 1SSHA 1HXDA 2LQKA 4C5GA 2ZPGB 1AWOA 1B34A 2FZGB 4HCCA 3OBYA 2XU8A 2P0KA 3JAME 1H3HA 3A5ZA 1WXBA 3WVDB 3G71Q 4M77G 2DL8A 2KDSA 4H2YA 3EG3A 3TQ7P 1QCOA 4NL2A 2OAWA 4M75B 3L2QA 4RMFA 2FB7A 2IPOB 1K1ZA 2A0FB 2D8JA 2V1RA 1Z9ZA 3NTKA 1Q81U 4JJCA 1TG0A 2HL3A 4A54A 3URGA 3ERRA 3VS7A 4PHCA 1VYVA 9ATCB 1FWZA 2O2OA 1D1AA 1KC8U 1Y07A 3BDLA 2NUTA 1B07A 4A4KA 2LJ0A 4DOWA 1E6GA 2A08A 4M7DE 1M5Q1 3UFGA 4M78E 2I4LA 1N9WA 4E7JA 5IH2A 4CI0C 5GMKj 1T3LA 2CUBA 4DQ2A 2M16A 3CMET 2RQRA 5LJ5g 1WPYA 4C92A 2DQ0A 1D1BA 3OBWA 1OYXA 1QVFS 1SHGA 1ZX6A 4HT8A 4J9HA 1PYSB 4OMPA 4LDVA 2DRMA 3QO3A 2DMOA 1YJNQ 3CXCP 3OYYA 1QW1A 2QQSA 1M8VA 2AKWB 3LGLA 2G6FX 4CH3A 2OI3A 2K3XA 2KVQG 2RHXA 4HT9A 4E47A 3TSWA 5GAOl 4B9XA 4F7UB 1LPLA 2D0QB 3RGLA 3CCJT 2EAYA 3HSBA 1VQ5T 3GF5A 1VYUA 2LCSA 5CK9A 2Y90A 2XDBA 4BB7A 4AH6A 4G85A 2MPXC 1RAHB 8ATCB 1YGBA 2ZT5A 3KFVA 1GGMA 2CH4A 2EKHA 2FPDA 4ZIBA 2DEQA 2BE7D 2L0AA 2C0OA 4M7AE 2ZXFA 2VC8A 3CMAT 4OMOA 3CCJA 4A53A 2DJZA 3M56A 1KD1C 3I56T 1EIYB 2D1XA 4M7DA 1M90C 2RI3A 1QP2A 3M4QA 2C0TA 2PVGB 1Q82U 2ZPFB 2MF2A 1R0BG 2P84A 2VXFA 4M4ZA 3DSQA 4P3NA 3PIPA 4PFZA 3E9FA 4JS4A 3REUA 2MYSA 3UDCA 4BW9A 1D1CA 2CT3A 4M78F 2EIFA 1XQHA 2FVUA 2GTOA 3QO8A 2LNHB 3JCMe 2NUPB 2PVOB 1VIFA 1OX9A 1QWFA 2QHUA 1S1NA 4CS2A 4JJDA 2K3YA 5LJ5f 3OYNA 3M9QA 2KXDA 1WJRA 2DNUA 2OTJQ 1NJ5A 1PD1A 4RG8A 2I4NA 2DAQA 2CSIA 1E6HA 4TVYA 1WDXA 3BY7A 1J3TA 3EFRA 1B7TA 2E3IA 2OTLQ 1AWXA 1ARKA 2OX7A 1WFWA 2JNGA 3CCUT 3CCET 1YI2Q 2AMCB 3MKDA 5GMKe 5CCAA 1O75A 3QYHB 4M75A 2JN0A 2M1HA 3G4SQ 2GQIA 2J06A 3CCLA 4C92D 4RTXA 4C5HA 4BDZA 2KR3A 2O01E 1YJWQ 4FYYB 3OYJA 3ICAA 3VUBA 1GRIA 1P92A 4A63B 2B86A 2DK3A 1ADJA 2FZKB 3HY1A 3I55A 3P8HA 1JXOA 4OMMA 3RESA 2CGHA 2RD1A 1SESA 1M2VA 1L0WA 4ZGDB 4M7AF 2QEXA 1K8AU 5CO7A 3QDRB 5CQYA 4XEOA 1UHFA 1ZBXA 1VQMT 4YRTA 4YREA 4WI1A 3JB9I 5I2SA 5C53B 2MWPA 3NEMA 2DL7A 2YHTA 2F69A 5GAN2 1OQKA 2DD4A 1KMNA 2CYZB 4RG2A 4P75A 1EZZB 2ABLA 4PNOA 2VASA 1MGQA 2ZT8A 4DBHA 1H4QA 1ZUUA 1PYSA 1N8RU 2RJFA 4YRNA 2XHCA 3HL8A 2RJEA 5GANg 1SETA 1Q86R 1JBMA 4PLLA 3LLRA 4M7DD 4F7UA 2DDZA 2RH2A 4OLFA 3JCMJ 4RUGA 4EIKA 2V1QA 4LDXA 5EC7A 4N4IA 2HQHA 4GLKA 3CPFA 1YIJQ 5GMKi 1NLPC 1VQ6Q 2YSQA 3NTIA 1JJ2S 1RAFB 1YWOA 2LQ8A 2CJBA 2WSFE 2X3WD 3V8LA 1UTIA 1JEGA 2XTIA 2R58A 1EFWA 4WJ3M 3EFOA 2XD0A 4X5OA 4LUEA 2ROTA 2JZ2A 3G1JA 1KQSS 2FL7A 2L8DA 4FYWB
chains in the Genus database with same CATH topology
3CCQT 1EIYA 4C92G 3CD6A 1KD1U 3S6WA 3LSSA 4RMOA 11ASA 3H6ZA 2RA2A 1SSFA 4YRLA 1ASZA 2I2LA 1EOVA 2Q7EA 3O8VA 1LJOA 3CCQA 2E6ZA 2O4XB 3QIIA 3X20B 4PJOC 4PJOB 2E3CA 4M75D 5GAMg 2LX9A 5LJ3h 1YJ9T 4BI3A 1BBUA 2K4YA 1S72T 1BI0A 2Q5IA 4Y91A 1E24A 1QVFA 2ZPIB 3A8LB 1FX7A 4P72C 3HRSA 3OS1A 5GANf 2AMCA 3CCMA 2MWOA 2IY5B 1S72A 2HQEA 4XTYA 3CPWA 2GCXA 3DB4A 5HK0A 1K9MC 3TCJA 5KH6A 3UPUA 2K5LA 1Y96B 3GLXA 1VQ9T 2DO3A 3A31A 3CCRT 1K73C 3JB9G 3OY9A 1N6AA 2MAMA 1G3YA 3JCMc 2CZ1B 4EPCA 1VQ9A 4A4FA 1E1OA 3CCRA 3CC4T 1VQ8T 2X4YA 3FJPA 3LH0A 2VXEA 4IUTA 4M75G 4K87A 3RMQA 3S3MA 5GAMf 4H2TA 3VYGA 4BDYA 2P0QA 4PLIA 1VQ8A 4BY6C 4MDXA 4BY6B 2VV5A 3I7FA 3QUIA 3AHUA 2ALYB 3WQZA 5HK3A 2YLBA 4FT4A 2DQ3A 4BI4A 1NJ6A 4M77F 1VQNT 5KCHA 2ODRC 4TVAA 1VQOA 3M4YA 4YRSA 1VQPT 3CEYA 3VQVA 1X6OA 2CZ6B 2IG0A 3HXWA 4CS3A 2E10A 1YHQA 4L59A 3VYHB 1KOGA 1VQNA 2RO0A 1VQLT 1KG1A 4TVWA 2QQBA 3ZEHA 4OMFB 3OYDA 1I5LA 1D3BB 1YCYA 2MI6A 4OB1B 2O4XA 4F7UG 4VUBA 4PJOA 4KR3A 1BKBA 1VQ7A 4KBMB 2WSCE 4J15A 5E3IA 2DU7A 1X54A 1AHJB 2ZPHB 3R6OA 1MHNA 3V8KA 2EKOA 1WGSA 2P5IA 1USYC 4QQDA 2DTHA 1KHIA 5CKEA 2CJAA 2XICA 4EMKC 1B7YB 4C0ZA 3HFZB 1M1FA 2QHSA 4IURA 2VUBA 3BW1A 3G6EA 3JB9H 1JJ2A 1BIBA 1Y96A 3PGGA 2ZPEB 5CVIA 1EIFA 5A0LA 1UGQB 4BACA 2CIMA 1GXIE 3TEEA 4J8OA 5F5WA 2KSSA 2QXFA 1IZ6A 1FXXA 1VQ4T 4P74C 5FU7C 2WACA 5FU7B 4M78C 4M78B 1Q82C 1VQKT 1WJQA 4JDSA 4XTZA 1M1KC 1WQWA 3SDZA 3MP6A 1IREB 4CS4A 4QQGA 3HXUA 2RHQB 1M1GA 4RCCA 4KUDK 3C12A 3HHTB 4FU6A 1N9RA 1VQKA 1G3TA 3FRNA 1UGRB 2MMPA 2ALYA 3OYIA 3HFOA 3G7ZA 3OYBA 2RHUA 4PJOD 3PT9A 2LT1A 3P8TA 3VJPA 4DOVA 3NENA 4FT2A 5A0DA 2DXUA 1B70B 2WSEE 2L8DA 3OYLA 4LVKA 4BWAA 2DXBA 4A4GA 3M54A 4RKUE 4M7AC 3VQWA 4M7AB 2LCLA 4UC4A 3VUZA 4E7HA 5GAN6 4LDYA 4EO4A 3TEHB 4X9CA 1K8AC 2CZ7B 4YRQA 4JJNK 2ZTGA 3JCMg 2FHDA 3INZA 3OW2S 2RK2A 2RHYA 1UGPB 1KQ1A 2C7IA 1RI0A 3MO8A 4ZTFA 5HGQA 5DM7R 4HKEA 1Y7XA 4MMKA 4E51A 1N8RC 3SB2A 1EVLA 4H02A 2B8AA 5K1XA 2ZGWA 3ZBDA 3C94A 4J6YA 5HY6A 5LJ5h 5CKDA 3OS5A 3V8JA 2D6FA 1HC7A 4NOYA 5GAN5 3CPWS 1EVKA 2E1HA 2A7YA 4YPFA 2XI9A 4XK8E 1X2HA 3META 4C92F 3BDUA 3MEWA 4KR2A 1VUBA 1I8FA 2E41A 1ADYA 4TWAA 1C0AA 3V7SA 1EQRA 2EJGA 4N4HA 4M78A 3CCVA 3HY0A 3UH0A 2C8MA 2LCCA 4JRIA 1LOJA 2ODRD 2JVVA 1YBYA 1M1KU 4GY5A 3OYEA 4EX5A 3J7AF 2XG8D 1G5HA 3G71A 3JCMW 2EQUA 2RHQA 5GAOr 3JCMf 4QQ6A 3VV0A 3M59A 3HXZA 3SD4A 3E9IA 4YRGA 2PVDB 3CCLT 4RDXA 3QPHA 4TVRA 4O6JA 3REXA 4ZGJB 2L89A 3RMSA 4OP0A 1I4K1 3I55T 1Z7NA 4JUVA 5IT9E 4OB0B 2I4OA 3QNEA 2ARUA 4DA4A 1WNLA 2QEXT 1NPPA 2DPPB 2LT4A 4M7AA 3CC7T 4ZN1A 2R5MA 4XTUA 2H3JA 3JB9F 3HPWA 4HCBA 3PIOA 3QYGB 3ME9A 3TEHA 3R07A 3KFUA 3C4SA 2LC4A 3EFSA 4LVMA 3LWIA 3S3OA 3CC7A 3IKMB 4MZTA 2KMTA 2IVWA 4OGCA 4BE2A 3JCMV 3X25B 4YCVA 3OSVA 1W2BA 4JRQA 1B8AA 4H2XB 2DZ9A 4M75F 1WYDA 2VGNA 3E9HA 2QQ9A 4ATOA 3PCOB 2PUOB 2AKWA 2L3RA 2KK4A 1QVGA 3NETA 4M77C 4O2DA 4M78D 3OYMA 5I2MA 1H4TA 4ELZC 3KBGA 3FLGA 3CD6T 2ZINA 4C8QE 5GANh 4OVAA 4JLIA 4IKFA 2K5IA 3QSUA 3FB9A 2Y4XA 4OGEA 1W66A 2ZPBB 3ER0A 3OYFA 2YLCA 4JLGA 5LJ3j 1KQ2A 2EQJA 1YB3A 2EWNA 3HTZA 3CXCS 3QG1A 4YRRA 2OTLA 4P73C 5IN1A 4BE1A 2EJ9A 2EJFA 3MEAA 3CBMA 4XU1A 4QW2A 1E1TA 2QDYB 2ZCEA 3OW2A 2I4MA 1HTTA 1Y71A 3G4SA 4M7AD 3RF1A 3CCMT 3WXMB 1BI1A 4CH4A 1YJWA 3S3NA 1H4SA 1Z7MA 5A2QE 3L4GB 1ZQ1A 1V29B 4JRPA 3QJ6A 5J26A 3HFVA 3L2UA 5GAMh 4XTVA 2V8JA 3OS0A 1JB0E 2XDDA 1QP3A 2Q7GA 4M77E 2ZIMA 4M7DG 1QVPA 4M78G 4ZTJA 5C52B 4KUIA 2DKGA 4C8QF 4LVJA 2CKKA 4XAXB 1VIEA 1UEBA 1WQ7A 3RIRA 4FSXA 2ZZGA 1LYLA 4PKCC 1SERA 5GAN7 2PMFA 4J7IA 2BKDN 1X55A 4HWTA 4Y28E 3A7AA 4JRKA 2X4WA 2ZZDA 3JCMb 3NFCA 1VQ6A 4H2XA 3L2RA 2EQKA 3CBPA 3RACA 4V2SA 3L1AA 3E9GA 3PCOA 4BI8B 2PMEA 3P8DA 3OYCA 4HWSA 2RM4A 4E7IA 4M7AG 2XK0A 3LX7A 1VQOT 3L2WA 5LJ3e 3CC2T 3F70A 5FLXE 3EAEA 3UT1A 3TUPA 2GQVA 2LRQA 1BBWA 4XU3A 1YHQT 4R55A 1JRIA 3MEUA 4B9WA 4FIBA 1YFTA 4X34A 3CC2A 3G1ZA 4WF2A 2NLUA 2EQMA 1BIAA 1VQ7T 3VQYA 4XTWA 1ATIA 2X4JA 4YRCA 3GOXA 2G3RA 2ARSA 1NJIC 4NS5A 2KY9A 3BFMA 4MMLA 4HCZA 1X01A 2RJDA 3Q1JA 3FC3A 3A32A 4TTVA 3OYHA 1DJ7B 1SRYA 2QQRA 4LD6A 5CKFA 3PFSA 2HNIA 3RERA 3M4GA 3IALA 5FRNA 4IUVA 2GF7A 3X24B 3A8HB 5CAIA 4TQFA 3L4GA 3DLMA 4XTXA 4EMGA 5CQXA 3KUFA 4Z02A 5K1PA 1WLEA 3G6ET 2ZT6A 4P72A 1LNXA 3QO7A 1VQZA 4Q15A 2A8EA 4A4HA 4EMKB 4H2VA 1NJ2A 2ZNIA 3RKYA 4UP9A 4ZTUB 2IY5A 2P0LA 4CRIA 2P4TA 1ZHIA 3J80E 1QE0A 4C92C 3HFNA 1Q7YU 3NTHA 4YRKA 3M55A 2LTOA 2PQWA 2RK1A 2ZR2A 3MP8A 2KAFA 4Q5WA 5LJ3d 4Q6GA 4NL3A 5CKBA 3OB9A 1BYMA 2EL9A 2Q5HA 1ASYA 3CCSA 4YRPA 4C5EA 2BUDA 3UGQA 2J3LA 3CBOA 3JB9J 3ZFJA 3CXCA 2KQWA 4WJ4A 4QVDA 2RHSB 3L42A 2QHVA 5D6WA 1W2BS 2HQXA 3A8MB 2E12A 1X75C 5GAN4 2E65A 2ZZFA 3MP1A 1KMMA 3SWNC 3VKIA 3SWNB 3VQXA 4J83A 3OYAA 1NZ9A 3DLLA 5ELNA 2M0OA 12ASA 1QVGS 4BD3A 4ELYC 1NJ1A 4H2UA 1H641 4K86A 4YDQA 2LNVA 4CH5A 2DTIA 1NE8A 2RHZA 4YRFA 1J5WA 2DIGA 1U1TA 3OMGA 4C92E 2JTMA 2CJ9A 4PL6A 3MHXA 2FYKA 3MEVA 2E70A 2ARTA 1OZ3A 4HWPA 3FEOA 1YITA 1NJIU 2DZCA 4YRIA 1D3BA 2GFUA 4UP7A 1QF6A 1WJSA 5CKHA 4CH6A 4L5GA 4M75C 4H2WA 5ELOA 2QA4T 2LDMA 1M4ZA 1H4VB 3FIFA 4XU0A 5GAOm 5LJ5j 4JS5A 1USYA 2RI5A 1XOVA 5C51B 1B7YA 4EMKA 4XU2A 2E6NA 3HFZA 3JCMh 1X2GA 1JJCB 3C95A 2QA4A 3JRZA 3VU3C 1NYRA 4RQEA 2HAXA 1YFSA 4P75C 3PMTA 4MZPA 3CCVT 4PJOG 3FDRA 3HRKA 5GMKh 3P8YA 3CMEA 4ZTZB 3H8ZA 3OYGA 4G84A 5J3BA 1U1SA 3MEYA 3G71T 4LD9K 1WU7A 4RQFA 3RKWA 2ZR3A 4P74A 2ZIOA 2RHSA 3JSCA 3HRTA 1BI3A 2K57A 4NCXA 4P3PA 3L2VA 2RJCA 4YROA 3QKJA 1H3ZA 2RB6A 3LSQA 3OS2A 4M75E 1B76A 4P3OA 1PSFA 3P8BB 4QVCA 5L8RE 3SWNA 3CMQA 1VQ5A 1PSEA 3HKSA 2A3LA 4LDWA 3PZCA 4C0GA 3GPLA 5CR2A 4X9DA 1KHCA 2AHJB 3TREA 2OAUA 1RL2A 4OB2B 4L6V5 3CMAA 4M7DF 1Q86C 5GAOp 3I56A 5HKCA 4C8QC 4C8QB 2G4CA 3GNGA 3LW5E 1B70A 1YJNT 5IAYA 2BIVA 5FU6C 5FU6B 5LJ5e 5KNNA 2M9UA 4ZGEB 4UPAA 2VGMA 3OSSC 4J6XA 4PG3A 3A8OB 3A7RA 4F7UE 1YJNA 4BUGA 1HK9A 3A8GB 4DPGA 1G3SA 2R57A 3HXXA 3WVEB 3DKMA 3UGTA 3CCUA 2HD0A 3CCEA 4KT0E 3N5BB 2PU9B 1JJCA 3RL6A 3QJYA 5GANj 1NYQA 3TU4K 2ZNJA 4M77B 4ME7A 3GNFB 2P0PA 2EFIA 4P71C 3QXEB 4YP0A 3OYKA 4IUUA 1NJ8A 2QHTA 1VQMA 5GAN3 2Y4YA 2OTJT 3L2ZA 3MQZA 5DLOA 2OTLT 4C0FA 2JUFA 2V8KA 1YI2T 1BI2A 5KCOA 1G3WA 2OTJA 4RCBA 3JCMd 3G4ST 4N0AC 3A74A 1YJWT 4F7UF 3TEGA 2RHIA 4TVAB 2GFAA 5LJ5d 3JB9D 4LNSA 5AYFA 3GP8A 3BJUA 3E1SA 1YI2A 5GAMj 2NS6A 3VBBA 4ZN3A 1M90U 2E5QA 4LVLA 2DIQA 5DLQE 5KE3A 3LC0A 5LJ3g 5J39A 3A7UA 1G51A 3HXYA 3OA6A 4KQEA 3QBYA 2V8IA 3J81E 1Q86U 3M53A 3PNWC 4C8QA 3NELA 3OMCA 2QI2A 5I21A 4BE0A 5EG2A 1I81A 4R56A 4J5YA 5GMKm 2YRVA 4II1A 3HXVA 4C5IA 4FL6A 4YCUA 4QVZA 1Q7YC 4YTLA 2F5KA 1YIJT 2ZT7A 5FROA 1YJ9A 1VQ6T 3JCMQ 5GANe 4EDUA 4HT4A 5D6YA 1G5VA 1TH7A 2ZZEA 3E19A 1N27A 3P8VA 3V7RA 1YIJA 3QTCA 3KXTA 3W3SA 2ZCFB 3OQ5A 4IUQA 2DXCA 1YFRA 3SFMA 3QZ5B 5GMKl 3LWHA 2JTFA 1RIQA 3RUXA 2DD5A 2QQAA 3V7CA 4M77A 5LJ3f 3HP9A 4L87A 4P71A 4N4GA 4XEMA 2C06A 4PJOE 3LYIA 3M58A 2HBPA 5GAN8 5M9OA 3A5YA 5GAMe 1X56A 2X4XA 2E64A 3CC4A 1W4SA 3MCAB 4P5NA 1E22A 4N0AA 1N9SA 1O9SA 2L5QA 2CZ0B 5GAOn 1B34B 4P73A 4C8QD 2J3MA 2XKOC 3PTAA 4UP8A 3A5ZB 2XDPA 3QZ9B 5C0MA 1OI1A 2Q7HA 3IG2A 5KE2A 1XTDA 1XNIA 1Q81C 3ASKA 2CS7A 2F5TX 5GANd 4D6WA 2D9TA 5FRMA 3MF1A 5D6XA 1VQPA 2DTOA 4J6WA 1KC8C 4E7KA 3UWNA 4A4EA 4HWOA 4HVCA 2E5AA 2VYTA 4IUPA 3M5AA 2DVEA 1VQLA 4LVIA 1UGSB 3JCMX 3CCST 4E7LA 4PJOF 3HRUA 4C92B 2R5AA 1FYFA 2LVMA 2X35A 4YYEA 1IL2A 3MF2A 4OF1A 4TQDA 3M4PA 4YRMA 3LGFA 2K5FA 4M77D 3PMIA 2RI2A 1K9MU 2XGTA 5CIUA 5C6SA 5GAMd 4HA8A 4C8QG 3DB3A 1K73U 1NPRA 1KQSA 2XIDA 5DY9A 5LL6S 4YCWA 3QHSA 1R8OB 4YRJA 3GIBA 3RKXA 1OZ2A 3HRIA 2DU5A 4M7DC 4XQ3A 4M7DB 4O5VA 4MZMA 2EYQA 3IKLA 1U8RA 4LDUA 4EMHA 4KULA 2QTXA 3M57A 2K2VA 3T9NA 4MDWA 5GAOq 3X28B 4FM4B 4HWRA 1YITT 2JOYA 1VQ4A 3QO5A 1M9SA 4OB3B 3X26B 1UB4A 5A0GA 4C0DC 4K88A 4C0DB 3JCMP 4H2SA 3OD1A 2PUKB 1G5IA 2DXTA 1HXDA 2LQKA 4C5GA 2ZPGB 1B34A 4HCCA 3OBYA 2XU8A 2P0KA 3JAME 3A5ZA 3WVDB 4M77G 2KDSA 4H2YA 4NL2A 4M75B 3L2QA 4RMFA 2FB7A 1Q81U 3NTKA 4A54A 3ERRA 3URGA 4PHCA 1FWZA 1KC8U 1Y07A 3BDLA 4A4KA 4DOWA 4M7DE 1M5Q1 3UFGA 4M78E 2I4LA 1N9WA 4E7JA 4CI0C 5GMKj 4DQ2A 2M16A 3CMET 5LJ5g 1WPYA 4C92A 2DQ0A 3OBWA 1OYXA 1QVFS 4HT8A 1PYSB 4LDVA 3QO3A 3OYYA 1QW1A 2QQSA 1M8VA 2AKWB 3LGLA 4CH3A 2K3XA 2KVQG 2RHXA 4HT9A 4E47A 5GAOl 4B9XA 4F7UB 2D0QB 3RGLA 3CCJT 2EAYA 3HSBA 1VQ5T 3GF5A 5CK9A 2Y90A 2XDBA 4BB7A 4AH6A 4G85A 1YGBA 2ZT5A 1GGMA 4ZIBA 2DEQA 2ZXFA 4M7AE 2VC8A 3CMAT 3CCJA 4A53A 2DJZA 3M56A 1KD1C 3I56T 1EIYB 4M7DA 1M90C 2RI3A 1QP2A 3M4QA 2PVGB 1Q82U 2ZPFB 2MF2A 2VXFA 3DSQA 4P3NA 3PIPA 3E9FA 4JS4A 3REUA 3UDCA 4BW9A 4M78F 2EIFA 1XQHA 2FVUA 3QO8A 3JCMe 2PVOB 1VIFA 2QHUA 4CS2A 2K3YA 5LJ5f 3OYNA 3M9QA 1WJRA 1NJ5A 4RG8A 2I4NA 2DAQA 4TVYA 3BY7A 3EFRA 2JNGA 3CCUT 3CCET 2AMCB 5GMKe 5CCAA 1O75A 3QYHB 4M75A 2JN0A 2M1HA 3CCLA 4C92D 4C5HA 4BDZA 2O01E 3OYJA 3ICAA 3VUBA 1P92A 2DK3A 1ADJA 3HY1A 3I55A 3P8HA 3RESA 2CGHA 2RD1A 1SESA 1L0WA 4ZGDB 4M7AF 2QEXA 1K8AU 5CO7A 3QDRB 5CQYA 4XEOA 1ZBXA 1VQMT 4YRTA 4YREA 4WI1A 3JB9I 5I2SA 5C53B 2MWPA 3NEMA 2YHTA 2F69A 5GAN2 2DD4A 1KMNA 2CYZB 4RG2A 4P75A 4PNOA 1MGQA 2ZT8A 1H4QA 1PYSA 1N8RU 2RJFA 4YRNA 2XHCA 3HL8A 2RJEA 5GANg 1SETA 1JBMA 4PLLA 3LLRA 4M7DD 4F7UA 2DDZA 2RH2A 4OLFA 3JCMJ 4LDXA 4N4IA 4GLKA 3CPFA 5GMKi 3NTIA 1JJ2S 2LQ8A 2CJBA 2WSFE 3V8LA 2XTIA 2R58A 1EFWA 4WJ3M 2XD0A 4X5OA 2JZ2A 1KQSS 2FL7A 1NNHA 4J7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJ1 A;  4H2U A;  1H64 1;  4K86 A;  4EX5 A;  4YDQ A;  1EIY A;  4C92 G;  1G5H A;  1E22 A;  4CH5 A;  3JCM W;  2DTI A;  2RHQ A;  5GAO r;  4YRF A;  3JCM f;  4N0A A;  1J5W A;  1N9S A;  3LSS A;  3HXZ A;  11AS A;  3E9I A;  5GAO n;  1U1T A;  1B34 B;  4P73 A;  2RA2 A;  4C8Q D;  2J3M A;  4UP8 A;  4C92 E;  2CJ9 A;  4YRL A;  1ASZ A;  2I2L A;  1EOV A;  4YRG A;  2Q7E A;  4RDX A;  1LJO A;  2FYK A;  2Q7H A;  3IG2 A;  4PJO C;  4PJO B;  2ART A;  2E3C A;  4HWP A;  4M75 D;  5GAM g;  3REX A;  5LJ3 h;  5GAN d;  1BBU A;  4OP0 A;  1I4K 1;  2DZC A;  1Z7N A;  3MF1 A;  4JUV A;  2Q5I A;  4YRI A;  1D3B A;  2DTO A;  4J6W A;  4UP7 A;  4Y91 A;  1E24 A;  2I4O A;  3QNE A;  1QF6 A;  2ARU A;  1WNL A;  4CH6 A;  4HWO A;  4P72 C;  4HVC A;  4M75 C;  4H2W A;  2E5A A;  5ELO A;  4M7A A;  4XTU A;  1H4V B;  3JB9 F;  3FIF A;  5GAN f;  2DVE A;  4XU0 A;  5GAO m;  5LJ5 j;  2AMC A;  1USY A;  3TEH A;  3R07 A;  2IY5 B;  3KFU A;  4XTY A;  3JCM X;  3EFS A;  5C51 B;  1B7Y A;  4PJO F;  4EMK A;  4C92 B;  4XU2 A;  1FYF A;  4YYE A;  3HFZ A;  3JCM h;  1X2G A;  3IKM B;  1IL2 A;  1JJC B;  3MF2 A;  1Y96 B;  4TQD A;  3VU3 C;  3M4P A;  3A31 A;  1NYR A;  3JCM V;  4YCV A;  4RQE A;  4YRM A;  1YFS A;  1B8A A;  4H2X B;  3JB9 G;  4P75 C;  2DZ9 A;  4M75 F;  1WYD A;  4M77 D;  3E9H A;  3JCM c;  2XGT A;  3PCO B;  4PJO G;  2AKW A;  5GAM d;  3HRK A;  4HA8 A;  5GMK h;  3P8Y A;  1E1O A;  4C8Q G;  3NET A;  4M77 C;  4O2D A;  4ZTZ B;  4M78 D;  5DY9 A;  4G84 A;  1U1S A;  3MEY A;  4YCW A;  3QHS A;  1H4T A;  3FJP A;  2VXE A;  4YRJ A;  3GIB A;  3RKX A;  1WU7 A;  2ZIN A;  3RKW A;  4RQF A;  2ZR3 A;  4P74 A;  4C8Q E;  4M75 G;  4K87 A;  5GAN h;  3HRI A;  5GAM f;  2ZIO A;  2RHS A;  2DU5 A;  4H2T A;  2K57 A;  4M7D C;  4XQ3 A;  4NCX A;  4M7D B;  4JLI A;  4P3P A;  4YRO A;  3IKL A;  2RB6 A;  3LSQ A;  4M75 E;  4EMH A;  1B76 A;  3QSU A;  3FB9 A;  2QTX A;  4P3O A;  4QVC A;  1W66 A;  3I7F A;  3QUI A;  3SWN A;  5GAO q;  3AHU A;  2ALY B;  3WQZ A;  2YLC A;  2YLB A;  3CMQ A;  4HWR A;  5LJ3 j;  1KQ2 A;  2DQ3 A;  3QO5 A;  1NJ6 A;  4M77 F;  3PZC A;  1YB3 A;  2ODR C;  4TVA A;  2EWN A;  3HTZ A;  4YRS A;  4YRR A;  4P73 C;  4X9D A;  2EJ9 A;  2EJF A;  4K88 A;  3JCM P;  3VQV A;  4H2S A;  3OD1 A;  4XU1 A;  1G5I A;  4M7D F;  1E1T A;  2ZCE A;  3HXW A;  5GAO p;  2DXT A;  4CS3 A;  1HXD A;  2E10 A;  2I4M A;  1HTT A;  4C8Q C;  4C8Q B;  1B34 A;  4M7A D;  3RF1 A;  1KOG A;  2G4C A;  4CH4 A;  4TVW A;  1B70 A;  1H4S A;  3A5Z A;  1Z7M A;  3L4G B;  1I5L A;  4M77 G;  1D3B B;  1YCY A;  5LJ5 e;  4H2Y A;  5KNN A;  4F7U G;  4PJO A;  4KR3 A;  3HFV A;  4NL2 A;  4M75 B;  4RMF A;  5GAM h;  4J15 A;  4UPA A;  5E3I A;  2FB7 A;  4XTV A;  2DU7 A;  1X54 A;  2Q7G A;  4J6X A;  3V8K A;  4M77 E;  4PG3 A;  2ZIM A;  4M7D G;  3A7R A;  4M78 G;  4A54 A;  2P5I A;  4F7U E;  3ERR A;  1USY C;  4PHC A;  2DTH A;  5C52 B;  1HK9 A;  4DPG A;  2CJA A;  1B7Y B;  4EMK C;  2DKG A;  4C8Q F;  4M7D E;  1M5Q 1;  3UFG A;  3HXX A;  3HFZ B;  4M78 E;  2I4L A;  1N9W A;  2QHS A;  5GMK j;  4DQ2 A;  3UGT A;  1WQ7 A;  3RIR A;  2ZZG A;  1LYL A;  5LJ5 g;  1WPY A;  4C92 A;  1SER A;  5GAN 7;  2DQ0 A;  3BW1 A;  2PMF A;  3JB9 H;  1X55 A;  4HWT A;  1JJC A;  1BIB A;  1Y96 A;  4HT8 A;  1PYS B;  3A7A A;  3PGG A;  4JRK A;  3RL6 A;  5GAN j;  3QO3 A;  3JCM b;  1M8V A;  2AKW B;  1NYQ A;  4H2X A;  4CH3 A;  2ZNJ A;  4HT9 A;  4M77 B;  3RAC A;  2CIM A;  5GAO l;  4V2S A;  3L1A A;  4F7U B;  4P71 C;  3RGL A;  4YP0 A;  5F5W A;  1NJ8 A;  3PCO A;  2EAY A;  2QHT A;  5GAN 3;  2PME A;  3HSB A;  3L2Z A;  4P74 C;  4HWS A;  2RM4 A;  4M7A G;  4M78 C;  4M78 B;  2Y90 A;  4AH6 A;  4G85 A;  5LJ3 e;  1YGB A;  2ZT5 A;  4XTZ A;  1WQW A;  1GGM A;  4ZIB A;  2DEQ A;  2ZXF A;  4M7A E;  3TUP A;  2VC8 A;  4CS4 A;  4A53 A;  1BBW A;  2DJZ A;  3HXU A;  4XU3 A;  1EIY B;  4M7D A;  4RCB A;  1JRI A;  3JCM d;  2RHQ B;  4N0A C;  3A74 A;  3M4Q A;  4RCC A;  4F7U F;  3TEG A;  1N9R A;  3DSQ A;  2VXF A;  1YFT A;  4P3N A;  4TVA B;  5LJ5 d;  3JB9 D;  3G1Z A;  4LNS A;  4WF2 A;  3BJU A;  1BIA A;  2ALY A;  3VQY A;  4XTW A;  1ATI A;  5GAM j;  3HFO A;  3REU A;  4BW9 A;  3VBB A;  4M78 F;  4YRC A;  2ARS A;  3QO8 A;  4PJO D;  3JCM e;  3LC0 A;  3P8T A;  5LJ3 g;  3NEN A;  2QHU A;  3A7U A;  4CS2 A;  5LJ5 f;  3BFM A;  4MML A;  1G51 A;  2DXU A;  1B70 B;  3HXY A;  1X01 A;  4TTV A;  3A32 A;  4KQE A;  1NJ5 A;  2I4N A;  4BWA A;  1SRY A;  2HNI A;  4M7A C;  4TVY A;  3VQW A;  3BY7 A;  4M7A B;  4C8Q A;  3RER A;  3M4G A;  3NEL A;  3IAL A;  3EFR A;  5GAN 6;  5I21 A;  5CAI A;  4EO4 A;  4TQF A;  3L4G A;  1I81 A;  4XTX A;  4EMG A;  2AMC B;  4J5Y A;  5GMK e;  3TEH B;  5GMK m;  4X9C A;  5K1P A;  1WLE A;  3HXV A;  4P72 A;  2ZT6 A;  4YCU A;  1LNX A;  2JN0 A;  4M75 A;  3QO7 A;  1VQZ A;  4Q15 A;  4EMK B;  4H2V A;  1NJ2 A;  4C92 D;  2ZNI A;  4YRQ A;  2ZTG A;  3ICA A;  3RKY A;  3JCM g;  4UP9 A;  2ZT7 A;  4ZTU B;  3INZ A;  2IY5 A;  1ADJ A;  3JCM Q;  5GAN e;  3HY1 A;  1KQ1 A;  2C7I A;  2P0L A;  3RES A;  5HGQ A;  2CGH A;  2RD1 A;  1SES A;  1L0W A;  4MMK A;  1QE0 A;  4E51 A;  4C92 C;  4M7A F;  4XEO A;  3SB2 A;  1EVL A;  4H02 A;  3HFN A;  4YRT A;  1TH7 A;  2ZZE A;  4YRE A;  5K1X A;  3P8V A;  4YRK A;  2ZGW A;  4WI1 A;  3JB9 I;  5C53 B;  3NEM A;  2YHT A;  4J6Y A;  3V7R A;  5GAN 2;  1KMN A;  3QTC A;  3W3S A;  5LJ5 h;  2ZR2 A;  5LJ3 d;  4P75 A;  4NL3 A;  4Q6G A;  4PNO A;  3V8J A;  2EL9 A;  1MGQ A;  2Q5H A;  2ZT8 A;  1HC7 A;  1H4Q A;  1YFR A;  1ASY A;  4NOY A;  5GAN 5;  1PYS A;  4YRP A;  1EVK A;  3UGQ A;  5GMK l;  2J3L A;  1RIQ A;  2E1H A;  3RUX A;  4YRN A;  3JB9 J;  3V7C A;  5GAN g;  1SET A;  4WJ4 A;  4QVD A;  2RHS B;  4YPF A;  1JBM A;  4M77 A;  5LJ3 f;  2QHV A;  1X2H A;  4M7D D;  4L87 A;  4C92 F;  4F7U A;  3BDU A;  2DDZ A;  4P71 A;  4OLF A;  3JCM J;  4KR2 A;  4XEM A;  4PJO E;  1I8F A;  2E41 A;  5GAN 4;  2E65 A;  1ADY A;  5GMK i;  4TWA A;  2ZZF A;  1C0A A;  3V7S A;  1EQR A;  1KMM A;  5GAN 8;  2EJG A;  3SWN C;  3SWN B;  4M78 A;  3VQX A;  2CJB A;  3A5Y A;  5GAM e;  3HY0 A;  3UH0 A;  2C8M A;  3V8L A;  2XTI A;  5ELN A;  1EFW A;  1X56 A;  4WJ3 M;  4X5O A;  4JRI A;  1LOJ A;  2ODR D;  12AS A;  2E64 A;  1NNH A; 
#chains in the Genus database with same CATH topology
 1AZE A;  2K3B A;  2CUD A;  3CCQ T;  1EIY A;  4C92 G;  2DBK A;  3HTR A;  3CD6 A;  2AKK A;  1KD1 U;  1AEY A;  3S6W A;  3LSS A;  4RMO A;  11AS A;  3H6Z A;  1BCM A;  2A36 A;  2RA2 A;  4F17 A;  1SSF A;  4YRL A;  1ASZ A;  2I2L A;  1EOV A;  1TU0 B;  1X43 A;  3A98 A;  3NPF A;  2Q7E A;  2EGA A;  1VA7 A;  3O8V A;  4IIO A;  1LJO A;  5KYU B;  3CCQ A;  2E6Z A;  1TTH B;  2O4X B;  3QII A;  3X20 B;  4PJO C;  4PJO B;  7AT1 B;  1M3B A;  3O5Z A;  2E3C A;  4M75 D;  5GAM g;  2BZY A;  2LX9 A;  4PJM A;  5LJ3 h;  1YJ9 T;  1G83 A;  4BI3 A;  1BBU A;  1EFN A;  2K4Y A;  1S72 T;  1BI0 A;  2Q5I A;  3VRY A;  4Y91 A;  1E24 A;  1QVF A;  2KBT A;  2ZPI B;  3A8L B;  1FX7 A;  4P72 C;  3HRS A;  4HXJ A;  2DEU A;  3OS1 A;  5GAN f;  1B3Q A;  3NMZ C;  2F2X A;  2AMC A;  3CCM A;  2MWO A;  2O88 A;  1W2B P;  2F1L A;  2IY5 B;  1S72 A;  2HQE A;  4XTY A;  3CPW A;  2GCX A;  2YXY A;  3DB4 A;  1OU9 A;  5HK0 A;  1K9M C;  3EHQ A;  3TCJ A;  5KH6 A;  3UPU A;  1NEB A;  2K5L A;  1Y96 B;  3GLX A;  2H8H A;  1EX4 A;  2KE9 A;  3VS0 A;  2DO3 A;  1VQ9 T;  3A31 A;  3CCR T;  2CDT A;  2EYZ A;  1T0J A;  1K73 C;  2EYX A;  3JB9 G;  1SF9 A;  3OY9 A;  4J9G A;  1N6A A;  1F1B B;  2MAM A;  1G3Y A;  2YUQ A;  3JCM c;  2CH4 W;  2CZ1 B;  4EPC A;  2NUZ A;  1MV3 A;  2GGR A;  1VQ9 A;  1NNH A;  4CC4 B;  1TWB A;  4A4F A;  1E1O A;  3CCR A;  4JZ4 A;  2DBM A;  2P4R A;  3CC4 T;  3M0Q A;  1VQ8 T;  2X4Y A;  2Z0W A;  1X6B A;  4AFS C;  3FJP A;  3LH0 A;  2VXE A;  4IUT A;  4M75 G;  4K87 A;  1ZSZ C;  4F16 A;  3RMQ A;  1ZSZ B;  5GAM f;  3S3M A;  4H2T A;  3CCS Q;  3VYG A;  1RLP C;  3QWY A;  4BDY A;  2P0Q A;  2E3H A;  4PLI A;  1VQ8 A;  4BY6 C;  4MDX A;  4HVU A;  4BY6 B;  2VV5 A;  3I7F A;  3QUI A;  3AHU A;  2ALY B;  3WQZ A;  4CC2 A;  1NLO C;  5HK3 A;  1ZA1 B;  2YLB A;  4FT4 A;  2DQ3 A;  4BI4 A;  1NJ6 A;  4M77 F;  1Q7Y R;  5KCH A;  1SEM A;  1VQN T;  4Z8A A;  2ODR C;  4TVA A;  1VQO A;  3M4Y A;  4PJJ A;  4YRS A;  1VQP T;  3CEY A;  1ZA2 B;  4KGZ B;  3VQV A;  4PFO A;  2LQN A;  1X6O A;  2CZ6 B;  2LP5 A;  2IG0 A;  3HXW A;  4CS3 A;  2E10 A;  1YHQ A;  2EGE A;  4L59 A;  1SG5 A;  2K79 A;  3VYH B;  1KOG A;  1VQN A;  2RO0 A;  1WX6 A;  1VQL T;  1KG1 A;  4TVW A;  2QQB A;  3ZEH A;  2JT4 A;  4OMF B;  3OYD A;  3AT1 B;  1I5L A;  5KYU A;  1D3B B;  4FW2 A;  1YCY A;  2EVR A;  2HEQ A;  2MI6 A;  1HD3 A;  4OB1 B;  3VS3 A;  3VS6 A;  1GBQ A;  2O4X A;  4AFQ C;  4VUB A;  4F7U G;  4PJO A;  4KR3 A;  1BKB A;  1VQ7 A;  4KBM B;  2WSC E;  4J15 A;  5E3I A;  1YCS B;  3VS2 A;  2DU7 A;  1X54 A;  4QT7 A;  1AHJ B;  2ZPH B;  3R6O A;  1MHN A;  3V8K A;  2EKO A;  1WGS A;  1PM3 A;  2LZ6 B;  2DFU A;  2P5I A;  1USY C;  4QQD A;  2DTH A;  1OUL A;  1PHT A;  1KHI A;  1NYG A;  5CKE A;  4F04 B;  1YIT Q;  2CJA A;  2XIC A;  4EMK C;  1B7Y B;  1Z9Q A;  4C0Z A;  3HFZ B;  1M1F A;  2QHS A;  4IUR A;  1I5O B;  2CP2 A;  1CKB A;  2VUB A;  4JZ3 A;  2JTE A;  2KYB A;  3BW1 A;  3G6E A;  3JB9 H;  1JJ2 A;  1H8K A;  1BIB A;  1Y96 A;  3PGG A;  3PVL A;  2QK0 A;  1PKS A;  2ZPE B;  1AVZ C;  5CVI A;  1EIF A;  2X3X D;  5A0L A;  1NJI R;  1UGQ B;  1UG1 A;  2HKN A;  4BAC A;  2CIM A;  4RTY A;  1GXI E;  3I35 A;  3TEE A;  4J8O A;  4HVW A;  4LNP A;  4PJN A;  5F5W A;  2KSS A;  2QXF A;  1ZBJ A;  1IZ6 A;  1FXX A;  2RQT A;  1VQ4 T;  4P74 C;  5FU7 C;  2WAC A;  5FU7 B;  4M78 C;  1NG2 A;  4M78 B;  2CP6 A;  1Q81 R;  1Q82 C;  1VQK T;  1WJQ A;  4JDS A;  3CQT A;  4XTZ A;  1M1K C;  1WQW A;  4KGX B;  3SDZ A;  3VS4 A;  3MP6 A;  1IRE B;  2AK5 A;  1BK2 A;  2DL5 A;  4QQG A;  1KC8 R;  1ZSZ A;  4CS4 A;  3HXU A;  2HDA A;  2O9V A;  1WHH A;  5ECA A;  2XMF A;  2QTV A;  3CME Q;  2RHQ B;  1M1G A;  4Z89 A;  2JS0 A;  4RCC A;  4KUD K;  3C12 A;  3HHT B;  1T0H A;  2VVK A;  4FU6 A;  1N9R A;  3RDV A;  1VQK A;  1G3T A;  3FRN A;  1X69 A;  1UGR B;  2MMP A;  4LN2 A;  2ALY A;  3OYI A;  1QKW A;  3HFO A;  3G7Z A;  3OYB A;  2RHU A;  2ED0 A;  4PJO D;  1FMV A;  3PT9 A;  2LT1 A;  3P8T A;  3VJP A;  4DOV A;  3NEN A;  4FT2 A;  5A0D A;  2DXU A;  3CCJ Q;  2WSE E;  1B70 B;  1VQ5 Q;  3OYL A;  4LVK A;  1OPK A;  2KYM A;  1TUC A;  2DXB A;  4A4G A;  1A0N B;  4BWA A;  3M54 A;  4KH1 B;  4RKU E;  4M7A C;  3VQW A;  4M7A B;  1UDL A;  2O31 A;  2LCL A;  4UC4 A;  3VUZ A;  4AMC A;  4E7H A;  5GAN 6;  1MND A;  4GBQ A;  4LDY A;  4EO4 A;  4ZNX A;  3TEH B;  4X9C A;  4DEY A;  3CMA Q;  1GFD A;  3I56 Q;  1K8A C;  2CZ7 B;  3THK A;  4YRQ A;  4JJN K;  2ZTG A;  2AZS A;  3JCM g;  2FHD A;  3INZ A;  3OW2 S;  2RK2 A;  2RHY A;  1AT1 B;  1UGP B;  1KQ1 A;  2C7I A;  1RI0 A;  3MO8 A;  4ZTF A;  5HGQ A;  5DM7 R;  4HKE A;  1Y7X A;  2ENM A;  4MMK A;  4E51 A;  4FW1 A;  1N8R C;  3SB2 A;  2E4H A;  1EVL A;  4H02 A;  2B8A A;  3MJX A;  5K1X A;  1QMC A;  2EQI A;  2ZGW A;  3ZBD A;  1PRM C;  3C94 A;  4J6Y A;  5HY6 A;  1OU8 A;  5LJ5 h;  1KQS P;  2C0I A;  5CKD A;  3OS5 A;  3V8J A;  4AFZ C;  2D6F A;  1HC7 A;  1PCX A;  2YUP A;  4NOY A;  5GAN 5;  3CPW S;  1EVK A;  2DLP A;  1PNJ A;  1TOV A;  2JW4 A;  2E1H A;  3CCU Q;  4PJL A;  3CCE Q;  2A7Y A;  4YPF A;  2XI9 A;  4XK8 E;  1X2H A;  1W70 A;  4E6R A;  3MET A;  4C92 F;  1RAC B;  3BDU A;  1JO8 A;  3MEW A;  1MNE A;  4KR2 A;  1VUB A;  4DBF A;  1I8F A;  2E41 A;  2QGF B;  1ADY A;  4TWA A;  2V26 A;  1C0A A;  3V7S A;  1IO6 A;  1EQR A;  3BE3 A;  2EJG A;  4N4H A;  3TVT A;  1RUW A;  4PK4 A;  4M78 A;  3CCV A;  2YDL A;  3HY0 A;  2DX1 A;  2C8M A;  3UH0 A;  2BZ8 A;  2LCC A;  4JRI A;  5KYN A;  1LOJ A;  3EGU A;  2ODR D;  2JVV A;  1YBY A;  4J7F A;  1VQM Q;  1M1K U;  1RI9 A;  4GY5 A;  3OYE A;  1I1J A;  4EX5 A;  3J7A F;  1PKT A;  2XG8 D;  1G5H A;  3G71 A;  3JCM W;  2EQU A;  2RHQ A;  5GAO r;  1YP5 A;  3JCM f;  1UGV A;  4J9E A;  4QQ6 A;  3VV0 A;  3M59 A;  3HXZ A;  3SD4 A;  3EH1 A;  1QWE A;  3EGX B;  2GBQ A;  3E9I A;  1ACM B;  2RQV A;  4YRG A;  4HVV A;  2KT1 A;  2PVD B;  3CCL T;  4RDX A;  3QPH A;  2EPD A;  4AG2 C;  2E5K A;  4X1V A;  1MMA A;  2D0N A;  4TVR A;  4O6J A;  2CP3 A;  3REX A;  4ZGJ B;  6AT1 B;  1PRL C;  2COW A;  4OMQ A;  1YWP A;  2L89 A;  3RMS A;  4OP0 A;  1I4K 1;  3I55 T;  1WYX A;  1Z7N A;  4JUV A;  5IT9 E;  3A1P A;  4OB0 B;  2I4O A;  3VS5 A;  1WLP B;  3QNE A;  2ARU A;  4ORZ A;  4DA4 A;  1WNL A;  2QEX T;  1NPP A;  2DPP B;  2LT4 A;  4M7A A;  3CC7 T;  4ZN1 A;  3NGP A;  2R5M A;  4XTU A;  2H3J A;  2ESW A;  3JB9 F;  3HPW A;  4HCB A;  3PIO A;  3QYG B;  3ME9 A;  3TEH A;  3R07 A;  3KFU A;  3CCQ Q;  3C4S A;  2QDL A;  2LC4 A;  3EFS A;  4LVM A;  1NYF A;  3C0C A;  5KYW B;  3LWI A;  3S3O A;  3CC7 A;  3IKM B;  1JU5 C;  4J9B A;  4MZT A;  2KMT A;  2IVW A;  4OGC A;  1TUG B;  4BE2 A;  3JCM V;  1RAD B;  3X25 B;  4YCV A;  3OSV A;  3EGD B;  1W2B A;  1M90 R;  2DIL A;  4JRQ A;  1B8A A;  2DM1 A;  4H2X B;  2DZ9 A;  4FYV B;  4M75 F;  1WYD A;  2VGN A;  1R0C B;  3E9H A;  2W10 A;  2QQ9 A;  1YJ9 Q;  4ATO A;  1IXD A;  3PCO B;  2PUO B;  1S72 Q;  1UJ0 A;  1AZG B;  2AKW A;  2L3R A;  1OEB A;  2KK4 A;  1QVG A;  3NET A;  2DET A;  4M77 C;  4O2D A;  4M78 D;  3TSZ A;  1TUD A;  2KI7 A;  3M0T A;  3OYM A;  5I2M A;  1H4T A;  1C1A A;  4ELZ C;  3KBG A;  2JMC A;  3FLG A;  3CD6 T;  2ZIN A;  4C8Q E;  1TS9 A;  5GAN h;  4OVA A;  4JLI A;  4IKF A;  3RBB B;  2QGG A;  2K5I A;  2A28 A;  3QSU A;  3FB9 A;  2Y4X A;  1ABQ A;  4OGE A;  1VQ9 Q;  1W66 A;  3MPU B;  1WI7 A;  2ZPB B;  3CCR Q;  3ER0 A;  3OYF A;  2YLC A;  4JLG A;  5LJ3 j;  1KQ2 A;  2EQJ A;  1LVK A;  1YB3 A;  2ECZ A;  2EWN A;  3HTZ A;  3CXC S;  3QG1 A;  3H0H A;  4YRR A;  2OTL A;  4P73 C;  5IN1 A;  4BE1 A;  2EJ9 A;  2EJF A;  4WTO B;  3MEA A;  3CBM A;  1D09 B;  2F2W A;  4D8D A;  4XU1 A;  2EBP A;  4QW2 A;  1E1T A;  2QDY B;  2ZCE A;  1WZO A;  3OW2 A;  2LJ3 A;  2I4M A;  1HTT A;  2NUP A;  1Y71 A;  3G4S A;  4M7A D;  3RF1 A;  3CCM T;  2COZ A;  3CC4 Q;  3WXM B;  1BI1 A;  4CH4 A;  1VQ8 Q;  1YJW A;  2K7A A;  3S3N A;  1H4S A;  1Z7M A;  5A2Q E;  3L4G B;  1HSQ A;  1ZQ1 A;  1V29 B;  4JRP A;  3QJ6 A;  2GNC A;  5J26 A;  2M51 A;  3HFV A;  4B6M A;  3L2U A;  5GAM h;  4XTV A;  2V8J A;  2K6D A;  2CP7 A;  1JB0 E;  3OS0 A;  2XDD A;  1QP3 A;  2Q7G A;  1K0X A;  2DL4 A;  4M77 E;  3EG1 A;  2ZIM A;  4M7D G;  1M27 C;  1QVP A;  4M78 G;  4ZTJ A;  1SRM A;  5C52 B;  5FW9 A;  1MMN A;  2FPE A;  4KUI A;  1MMD A;  2JS2 A;  2DKG A;  4C8Q F;  1VQN Q;  1C6V X;  4LVJ A;  2CKK A;  1VQP Q;  4XAX B;  1PG5 B;  1TXQ A;  1VIE A;  1KIK A;  1UEB A;  1WQ7 A;  3RIR A;  4AG1 C;  4FSX A;  2ZZG A;  1LYL A;  4PKC C;  1SER A;  5GAN 7;  2PMF A;  4J7I A;  2BKD N;  1X55 A;  4HWT A;  4Y28 E;  3A7A A;  4JRK A;  3UAT A;  4DBQ A;  1VQL Q;  3EGD A;  2X4W A;  2ZZD A;  3JCM b;  4WCI A;  3NFC A;  1VQ6 A;  4H2X A;  1WHK A;  3L2R A;  2EQK A;  3CBP A;  3RAC A;  1JXM A;  4V2S A;  3L1A A;  1UUE A;  1GCP A;  1NBE B;  3E9G A;  1IHV A;  1SKU B;  3PCO A;  2LJ1 A;  3VS1 A;  4BI8 B;  2PME A;  3P8D A;  3PE0 A;  3OYC A;  4HWS A;  2RM4 A;  1M2O A;  2FZC B;  4E7I A;  4M7A G;  1UE9 A;  2XK0 A;  3LX7 A;  1VQO T;  3L2W A;  2FPF A;  1NEG A;  2ZAE A;  5LJ3 e;  2GTJ A;  3CC2 T;  3F70 A;  5FLX E;  2CRE A;  4LUD A;  3EAE A;  1WHJ A;  1AD5 A;  2EGC A;  5KYY B;  3UT1 A;  3TUP A;  2GQV A;  1TSF A;  2J6F A;  2LRQ A;  3IQL A;  1GBR A;  1BBW A;  4XU3 A;  1YHQ T;  1KK7 A;  4R55 A;  3E2U A;  1JRI A;  3MEU A;  4RTV A;  4B9W A;  4FIB A;  1VOM A;  1LCK A;  1YFT A;  4X34 A;  2FEI A;  3CC2 A;  3G1Z A;  4WF2 A;  2NLU A;  2PTK A;  2EQM A;  1BIA A;  2HSP A;  1VQ7 T;  3VQY A;  4XTW A;  1ATI A;  2X4J A;  3H9N A;  4YRC A;  1K9A A;  2YWW A;  2G3R A;  3GOX A;  2ARS A;  1K9M R;  1NJI C;  4JJB A;  2KRO A;  4NS5 A;  2KY9 A;  3BFM A;  4MML A;  1QVF P;  4HCZ A;  1Y57 A;  1K73 R;  1X01 A;  2RJD A;  2DYI A;  3Q1J A;  3FC3 A;  3A32 A;  2DL3 A;  4TTV A;  3OYH A;  1VQ4 Q;  1DJ7 B;  1SRY A;  2QQR A;  4LD6 A;  5CKF A;  3PFS A;  2HNI A;  2M02 A;  3RER A;  3M4G A;  3IAL A;  1VQK Q;  5FRN A;  4IUV A;  2GF7 A;  3X24 B;  4AT1 B;  3A8H B;  5CAI A;  4TQF A;  3L4G A;  3DLM A;  4XTX A;  4EMG A;  5CQX A;  3KUF A;  4Z02 A;  5K1P A;  2JXB A;  1WLE A;  3G6E T;  2ZT6 A;  4P72 A;  3UA6 A;  1LNX A;  3QO7 A;  4FCY A;  1VQZ A;  4Q15 A;  2A8E A;  4A4H A;  4EMK B;  2J6O A;  1NJ2 A;  4H2V A;  2LMJ A;  2ZNI A;  4J9D A;  3RKY A;  4UP9 A;  4ZTU B;  1ZUY A;  2IY5 A;  3JV3 A;  1E7O A;  2P0L A;  4CRI A;  2P4T A;  1ZHI A;  3J80 E;  1QE0 A;  1AWJ A;  4C92 C;  2DRK A;  4IIM A;  2QG9 B;  3HFN A;  2A37 A;  1Q7Y U;  2J6K A;  3NTH A;  4YRK A;  2O9S A;  3M55 A;  2LTO A;  2PQW A;  2RK1 A;  5FWC A;  2ZR2 A;  3MP8 A;  2KAF A;  4Q5W A;  5LJ3 d;  4Q6G A;  4NL3 A;  1ZSG A;  5CKB A;  4ESR A;  3OB9 A;  1BYM A;  2EL9 A;  2Q5H A;  1ASY A;  3CCS A;  1RAG B;  4YRP A;  4C5E A;  2BUD A;  3UGQ A;  2J3L A;  2DE0 X;  2FG0 A;  3CBO A;  3JB9 J;  3ZFJ A;  3CXC A;  2KQW A;  4WJ4 A;  4QVD A;  2RHS B;  3L42 A;  2LQW A;  2VB6 A;  3EH2 A;  2QHV A;  5D6W A;  2DJQ A;  2YUN A;  1W2B S;  2HQX A;  3LH5 A;  1Q95 G;  3A8M B;  2E12 A;  1X75 C;  5GAN 4;  2E65 A;  2ZZF A;  3MP1 A;  2KRS A;  1KMM A;  1U3O A;  4J9I A;  3SWN C;  4FYX B;  3SWN B;  3VKI A;  3VQX A;  1BBZ A;  4J83 A;  3RNJ A;  3OYA A;  2HL5 C;  1NZ9 A;  3DLL A;  5ELN A;  2M0O A;  5KYY A;  1QVG S;  12AS A;  4BD3 A;  4ELY C;  2EYW A;  1JQQ A;  1NJ1 A;  4H2U A;  1H64 1;  4K86 A;  4YDQ A;  2LNV A;  4CH5 A;  2DTI A;  1NE8 A;  2RHZ A;  4YRF A;  1J5W A;  2DER A;  2BE9 B;  2DIG A;  3M0U A;  1G2B A;  1U1T A;  3OMG A;  2HZY A;  4C92 E;  2JTM A;  3PVQ A;  2CJ9 A;  2H3E B;  5AT1 B;  3ZL7 C;  4PL6 A;  3MHX A;  2FYK A;  3MEV A;  2AKL A;  1OV3 A;  3QDF A;  2E70 A;  1RLQ C;  1OZ3 A;  2ART A;  1WA7 A;  3FEO A;  3H0I A;  4HWP A;  1YIT A;  1NJI U;  1M8M A;  1QCF A;  2AZV A;  2CP0 A;  2DZC A;  5KYX B;  4YRI A;  1D3B A;  2GFU A;  4UP7 A;  2L3S A;  1QF6 A;  1WJS A;  5CKH A;  4CH6 A;  4L5G A;  1R77 A;  2J05 A;  4M75 C;  1WXU A;  4H2W A;  5ELO A;  2W0Z A;  2QA4 T;  2LDM A;  1M4Z A;  1H4V B;  3FIF A;  2KRM A;  2RPN A;  4XU0 A;  3SEM A;  3D7S B;  5GAO m;  5LJ5 j;  4JS5 A;  1USY A;  2YRC A;  2RI5 A;  4RTT A;  1XOV A;  5C51 B;  1B7Y A;  1Q82 R;  4EMK A;  4XU2 A;  2I0N A;  1JJ2 P;  1M2V B;  2E6N A;  3HFZ A;  3JCM h;  2RN8 A;  2MCN A;  1M1K R;  1X2G A;  4RTW A;  1JJC B;  3C95 A;  1D0X A;  2QA4 A;  3JRZ A;  2YT6 A;  3VU3 C;  1NYR A;  4RQE A;  1G8X A;  5I22 A;  2HAX A;  1YFS A;  3CCL Q;  4P75 C;  3PMT A;  1PWT A;  2LX7 A;  4MZP A;  2D8H A;  1BB9 A;  1X6G A;  1OPL A;  4LE9 A;  3VRZ A;  2RMO A;  3I55 Q;  3CCV T;  4PJO G;  3FDR A;  3HRK A;  2MIO A;  5GMK h;  3P8Y A;  3EG2 A;  2QEX Q;  3CME A;  4ZTZ B;  3H8Z A;  2JM9 A;  3OYG A;  4G84 A;  1PD0 A;  5J3B A;  3CC7 Q;  1U1S A;  2RQW A;  3MEY A;  1QKX A;  3G71 T;  2FRY A;  4LD9 K;  1WU7 A;  4RQF A;  3RKW A;  1WHM A;  2ZR3 A;  4P74 A;  2HKQ B;  2ZIO A;  2RHS A;  3JSC A;  3HRT A;  1BI3 A;  2K57 A;  4NCX A;  4P3P A;  3L2V A;  2RJC A;  4YRO A;  3QKJ A;  1H3Z A;  1YNZ A;  1YFN A;  3M0S A;  2RB6 A;  3LSQ A;  1FMW A;  3OS2 A;  3EFO B;  3I5R A;  1K4U S;  4M75 E;  1B76 A;  1GFC A;  4P3O A;  1PSF A;  3P8B B;  4QVC A;  2NYS A;  5IHK A;  5L8R E;  3SWN A;  1WHL A;  2IIM A;  2MOX A;  3EHR A;  5GJW B;  1K8A R;  1VQ5 A;  3CMQ A;  1PSE A;  3HKS A;  2A3L A;  4LDW A;  1IB8 A;  4JPB W;  3PZC A;  4C0G A;  3GPL A;  3H41 A;  5CR2 A;  4X9D A;  1KHC A;  2AHJ B;  3TRE A;  2AT1 B;  2OAU A;  1RL2 A;  1QLY A;  4OB2 B;  1WXT A;  4L6V 5;  3CMA A;  4M7D F;  1Q86 C;  4J9C A;  5GAO p;  4K11 A;  3I56 A;  2PNI A;  5HKC A;  1N8R R;  5IHN A;  4C8Q C;  4C8Q B;  2DA9 A;  3GNG A;  3LW5 E;  2G4C A;  2VKN A;  1YJN T;  1GL5 A;  1B70 A;  4J9F A;  1IHW A;  5IAY A;  2BIV A;  5FU6 C;  3CD6 Q;  3M0P A;  5FU6 B;  5LJ5 e;  1HJD A;  5KNN A;  3NHN A;  2M9U A;  4ZGE B;  4UPA A;  2KEA A;  4R0K A;  1FYN A;  2VGM A;  2DF6 A;  3OSS C;  1IGU A;  4J6X A;  5KYX A;  4PG3 A;  3A8O B;  3A7R A;  4F7U E;  2L2P A;  1YJN A;  2RQU A;  4BUG A;  2KNB B;  2FO0 A;  4RTZ A;  1HK9 A;  3A8G B;  4DPG A;  1G3S A;  1M3C A;  2R57 A;  1X2Q A;  3HXX A;  1WIE A;  2KGT A;  2RF0 A;  3WVE B;  3DKM A;  1KD1 R;  8AT1 B;  3UGT A;  2KXC A;  3CCU A;  2HD0 A;  1XJW B;  2COY A;  3CCE A;  3U23 A;  4KT0 E;  1AOJ A;  2YUO A;  2JJ9 A;  4KH0 B;  3N5B B;  2PU9 B;  1JJC A;  3RL6 A;  3CCM Q;  3QJY A;  5GAN j;  1ZUK A;  1NYQ A;  3TU4 K;  2ZNJ A;  2ED1 A;  4M77 B;  4ME7 A;  1SPK A;  3GNF B;  2P0P A;  2EFI A;  4P71 C;  3QXE B;  4YP0 A;  3OYK A;  4IUU A;  1NJ8 A;  2QHT A;  1VQM A;  5GAN 3;  2Y4Y A;  2CT4 A;  2OTJ T;  3L2Z A;  3RR6 A;  3R6N A;  3MQZ A;  5DLO A;  1BU1 A;  3REB B;  2KRN A;  4AFU C;  2OTL T;  4C0F A;  2JUF A;  2V8K A;  1UEC A;  1YI2 T;  2RNA A;  1BI2 A;  5KCO A;  1G3W A;  1SRL A;  2OTJ A;  2QYZ A;  1UJY A;  2CSQ A;  4RCB A;  3JCM d;  4E2F B;  5GJV B;  3G4S T;  4N0A C;  3A74 A;  1X2K A;  1YJW T;  4F7U F;  5HCK A;  3TEG A;  4OMN A;  1D0Y A;  2RHI A;  4TVA B;  2GFA A;  5LJ5 d;  3JB9 D;  4LNS A;  5AYF A;  3GP8 A;  3BJU A;  2SRC A;  3E1S A;  1YI2 A;  4OML A;  5GAM j;  2NS6 A;  3VBB A;  3EGX A;  4ZN3 A;  1M90 U;  2E5Q A;  4E7Z A;  3EG0 A;  1U06 A;  2DIQ A;  5DLQ E;  1Y0M A;  4LVL A;  5KE3 A;  3REA B;  3LC0 A;  5LJ3 g;  1K76 A;  5J39 A;  3A7U A;  2HMA A;  1G51 A;  1PC0 A;  1YN8 A;  3HXY A;  3OA6 A;  4KQE A;  3QBY A;  2V8I A;  2QAS A;  3J81 E;  2JMA A;  2KT8 A;  1VQO Q;  1Q86 U;  3M53 A;  3PNW C;  4RTU A;  4GLM A;  4C8Q A;  3NEL A;  3OMC A;  4QKU A;  1VYT A;  3CC2 Q;  2QI2 A;  5I21 A;  4BE0 A;  1HYO A;  1I81 A;  5EG2 A;  4E7S A;  4R56 A;  4J5Y A;  5GMK m;  2YRV A;  1FMK A;  4II1 A;  3HXV A;  4C5I A;  1CKA A;  4FL6 A;  4YCU A;  1YHQ Q;  4QVZ A;  4PFP A;  1Q7Y C;  4YTL A;  2F5K A;  1YIJ T;  4KGV B;  2ZT7 A;  5FRO A;  1RAI B;  2J7I A;  1YJ9 A;  1CSK A;  1VQ6 T;  2HBW A;  3FJ5 A;  3UF4 A;  3JCM Q;  5GAN e;  2DYB A;  4D8K A;  1VQ7 Q;  2VWF A;  4EDU A;  5KYW A;  4HT4 A;  5D6Y A;  4F14 A;  2JM8 A;  2FRW A;  1G5V A;  1TH7 A;  2ZZE A;  3E19 A;  1N27 A;  3P8V A;  3ULR B;  3V7R A;  1N5Z A;  1YIJ A;  3QTC A;  3KXT A;  3W3S A;  1QVG P;  2ZCF B;  1RAB B;  5I11 A;  3OQ5 A;  1ZLM A;  4IUQ A;  2DXC A;  2L3Q A;  1YFR A;  1I07 A;  4Z88 A;  3SFM A;  3QZ5 B;  2EYY A;  5GMK l;  3LWH A;  2DVJ A;  1SHF A;  3EG9 B;  2JTF A;  1RIQ A;  3RUX A;  2DD5 A;  2QQA A;  1GCQ C;  3V7C A;  3QWX X;  4LXC A;  4M77 A;  1UFF A;  5LJ3 f;  3G6E Q;  3HP9 A;  4DEX A;  1QQJ A;  2MK5 A;  4L87 A;  2PZ1 A;  4P71 A;  2CP5 A;  4N4G A;  4XEM A;  2C06 A;  2BZX A;  4PJO E;  3LYI A;  1OX8 A;  4ANJ A;  3M58 A;  2HBP A;  1QCN A;  5GAN 8;  1V76 A;  1KJW A;  5M9O A;  3A5Y A;  5D7U A;  5GAM e;  3UA7 A;  1X56 A;  2YRD A;  2BTT A;  2X4X A;  2E64 A;  3CC4 A;  1W4S A;  2X9H A;  3MCA B;  1D0Z A;  4P5N A;  1E22 A;  1W1F A;  3OW2 P;  4N0A A;  1N9S A;  1O9S A;  2ATC B;  2L5Q A;  2CZ0 B;  5GAO n;  1B34 B;  4P73 A;  4C8Q D;  2J3M A;  2M0Y A;  2XKO C;  3PTA A;  2K2M A;  4UP8 A;  1C0M A;  3A5Z B;  3GBQ A;  2XDP A;  3QZ9 B;  5C0M A;  3M0R A;  3I9Q A;  1MMG A;  1OI1 A;  2Q7H A;  3IG2 A;  5KE2 A;  1XTD A;  1RAE B;  1UHC A;  1AWW A;  1XNI A;  1Q81 C;  5IXF A;  3ASK A;  2CS7 A;  2F5T X;  5GAN d;  4D6W A;  2D9T A;  5FRM A;  2SEM A;  3MF1 A;  4KRT A;  5D6X A;  1VQP A;  2DTO A;  4J6W A;  1KC8 C;  4E7K A;  3UWN A;  1ABO A;  3CPW P;  4CC3 A;  4A4E A;  4FSS A;  4HWO A;  4HVC A;  2E5A A;  1U5S A;  2VYT A;  2NUT B;  5L23 A;  4IUP A;  3M5A A;  2DVE A;  5IHI A;  1VQL A;  4LVI A;  1UGS B;  3JCM X;  4Y92 A;  3CCS T;  2QAZ A;  1IRX A;  4E7L A;  4PJO F;  3HRU A;  4C92 B;  2R5A A;  1FYF A;  2LVM A;  2X35 A;  4YYE A;  1IL2 A;  3MF2 A;  4OF1 A;  4TQD A;  3M4P A;  1MUZ A;  1M3A A;  1I0C A;  5FWB A;  4YRM A;  3LGF A;  2HSE B;  1T3S A;  2K5F A;  1MV0 B;  4M77 D;  3PMI A;  2RI2 A;  1WHG A;  1K9M U;  1KFZ A;  2L3P A;  3I5S A;  2XGT A;  1OOT A;  5CIU A;  2EW3 A;  5C6S A;  5GAM d;  4HA8 A;  1V1C A;  4C8Q G;  3DB3 A;  1K73 U;  1NPR A;  1KQS A;  2XID A;  5DY9 A;  2ROL A;  5LL6 S;  2QA4 Q;  3H0F A;  3SHW A;  4YCW A;  2OJ2 A;  4HCK A;  3EG9 A;  3QHS A;  4DBR A;  1R8O B;  4YRJ A;  3GIB A;  3RKX A;  4CC7 A;  1GCQ A;  1OZ2 A;  3HRI A;  2DU5 A;  1M30 A;  2F2V A;  4M7D C;  4XQ3 A;  4M7D B;  4O5V A;  1RAA B;  4MZM A;  1X27 A;  2EYQ A;  3IKL A;  1W6X A;  5IXB A;  1K0S A;  1U8R A;  2NWM A;  4LDU A;  2AIR B;  4EMH A;  4KUL A;  2QTX A;  1NM7 A;  3M57 A;  2K2V A;  3T9N A;  4MDW A;  5GAO q;  1IGQ A;  2K9G A;  3X28 B;  4FM4 B;  4HWR A;  1YIT T;  2JOY A;  1VQ4 A;  3QO5 A;  1M9S A;  4OB3 B;  3X26 B;  1H92 A;  1UB4 A;  2HCK A;  5A0G A;  4C0D C;  4K88 A;  4C0D B;  3JCM P;  4H2S A;  1KSW A;  3OD1 A;  3CCV Q;  2X51 A;  2PUK B;  1G5I A;  1BCO A;  2DXT A;  1SSH A;  1HXD A;  2LQK A;  4C5G A;  2ZPG B;  1AWO A;  1B34 A;  2FZG B;  4HCC A;  3OBY A;  2XU8 A;  2P0K A;  3JAM E;  1H3H A;  3A5Z A;  1WXB A;  3WVD B;  3G71 Q;  4M77 G;  2DL8 A;  2KDS A;  4H2Y A;  3EG3 A;  3TQ7 P;  1QCO A;  4NL2 A;  2OAW A;  4M75 B;  3L2Q A;  4RMF A;  2FB7 A;  2IPO B;  1K1Z A;  2A0F B;  2D8J A;  2V1R A;  1Z9Z A;  3NTK A;  1Q81 U;  4JJC A;  1TG0 A;  2HL3 A;  4A54 A;  3URG A;  3ERR A;  3VS7 A;  4PHC A;  1VYV A;  9ATC B;  1FWZ A;  2O2O A;  1D1A A;  1KC8 U;  1Y07 A;  3BDL A;  2NUT A;  1B07 A;  4A4K A;  2LJ0 A;  4DOW A;  1E6G A;  2A08 A;  4M7D E;  1M5Q 1;  3UFG A;  4M78 E;  2I4L A;  1N9W A;  4E7J A;  5IH2 A;  4CI0 C;  5GMK j;  1T3L A;  2CUB A;  4DQ2 A;  2M16 A;  3CME T;  2RQR A;  5LJ5 g;  1WPY A;  4C92 A;  2DQ0 A;  1D1B A;  3OBW A;  1OYX A;  1QVF S;  1SHG A;  1ZX6 A;  4HT8 A;  4J9H A;  1PYS B;  4OMP A;  4LDV A;  2DRM A;  3QO3 A;  2DMO A;  1YJN Q;  3CXC P;  3OYY A;  1QW1 A;  2QQS A;  1M8V A;  2AKW B;  3LGL A;  2G6F X;  4CH3 A;  2OI3 A;  2K3X A;  2KVQ G;  2RHX A;  4HT9 A;  4E47 A;  3TSW A;  5GAO l;  4B9X A;  4F7U B;  1LPL A;  2D0Q B;  3RGL A;  3CCJ T;  2EAY A;  3HSB A;  1VQ5 T;  3GF5 A;  1VYU A;  2LCS A;  5CK9 A;  2Y90 A;  2XDB A;  4BB7 A;  4AH6 A;  4G85 A;  2MPX C;  1RAH B;  8ATC B;  1YGB A;  2ZT5 A;  3KFV A;  1GGM A;  2CH4 A;  2EKH A;  2FPD A;  4ZIB A;  2DEQ A;  2BE7 D;  2L0A A;  2C0O A;  4M7A E;  2ZXF A;  2VC8 A;  3CMA T;  4OMO A;  3CCJ A;  4A53 A;  2DJZ A;  3M56 A;  1KD1 C;  3I56 T;  1EIY B;  2D1X A;  4M7D A;  1M90 C;  2RI3 A;  1QP2 A;  3M4Q A;  2C0T A;  2PVG B;  1Q82 U;  2ZPF B;  2MF2 A;  1R0B G;  2P84 A;  2VXF A;  4M4Z A;  3DSQ A;  4P3N A;  3PIP A;  4PFZ A;  3E9F A;  4JS4 A;  3REU A;  2MYS A;  3UDC A;  4BW9 A;  1D1C A;  2CT3 A;  4M78 F;  2EIF A;  1XQH A;  2FVU A;  2GTO A;  3QO8 A;  2LNH B;  3JCM e;  2NUP B;  2PVO B;  1VIF A;  1OX9 A;  1QWF A;  2QHU A;  1S1N A;  4CS2 A;  4JJD A;  2K3Y A;  5LJ5 f;  3OYN A;  3M9Q A;  2KXD A;  1WJR A;  2DNU A;  2OTJ Q;  1NJ5 A;  1PD1 A;  4RG8 A;  2I4N A;  2DAQ A;  2CSI A;  1E6H A;  4TVY A;  1WDX A;  3BY7 A;  1J3T A;  3EFR A;  1B7T A;  2E3I A;  2OTL Q;  1AWX A;  1ARK A;  2OX7 A;  1WFW A;  2JNG A;  3CCU T;  3CCE T;  1YI2 Q;  2AMC B;  3MKD A;  5GMK e;  5CCA A;  1O75 A;  3QYH B;  4M75 A;  2JN0 A;  2M1H A;  3G4S Q;  2GQI A;  2J06 A;  3CCL A;  4C92 D;  4RTX A;  4C5H A;  4BDZ A;  2KR3 A;  2O01 E;  1YJW Q;  4FYY B;  3OYJ A;  3ICA A;  3VUB A;  1GRI A;  1P92 A;  4A63 B;  2B86 A;  2DK3 A;  1ADJ A;  2FZK B;  3HY1 A;  3I55 A;  3P8H A;  1JXO A;  4OMM A;  3RES A;  2CGH A;  2RD1 A;  1SES A;  1M2V A;  1L0W A;  4ZGD B;  4M7A F;  2QEX A;  1K8A U;  5CO7 A;  3QDR B;  5CQY A;  4XEO A;  1UHF A;  1ZBX A;  1VQM T;  4YRT A;  4YRE A;  4WI1 A;  3JB9 I;  5I2S A;  5C53 B;  2MWP A;  3NEM A;  2DL7 A;  2YHT A;  2F69 A;  5GAN 2;  1OQK A;  2DD4 A;  1KMN A;  2CYZ B;  4RG2 A;  4P75 A;  1EZZ B;  2ABL A;  4PNO A;  2VAS A;  1MGQ A;  2ZT8 A;  4DBH A;  1H4Q A;  1ZUU A;  1PYS A;  1N8R U;  2RJF A;  4YRN A;  2XHC A;  3HL8 A;  2RJE A;  5GAN g;  1SET A;  1Q86 R;  1JBM A;  4PLL A;  3LLR A;  4M7D D;  4F7U A;  2DDZ A;  2RH2 A;  4OLF A;  3JCM J;  4RUG A;  4EIK A;  2V1Q A;  4LDX A;  5EC7 A;  4N4I A;  2HQH A;  4GLK A;  3CPF A;  1YIJ Q;  5GMK i;  1NLP C;  1VQ6 Q;  2YSQ A;  3NTI A;  1JJ2 S;  1RAF B;  1YWO A;  2LQ8 A;  2CJB A;  2WSF E;  2X3W D;  3V8L A;  1UTI A;  1JEG A;  2XTI A;  2R58 A;  1EFW A;  4WJ3 M;  3EFO A;  2XD0 A;  4X5O A;  4LUE A;  2ROT A;  2JZ2 A;  3G1J A;  1KQS S;  2FL7 A;  2L8D A;  4FYW B; 
#chains in the Genus database with same CATH homology
 3CCQ T;  1EIY A;  4C92 G;  3CD6 A;  1KD1 U;  3S6W A;  3LSS A;  4RMO A;  11AS A;  3H6Z A;  2RA2 A;  1SSF A;  4YRL A;  1ASZ A;  2I2L A;  1EOV A;  2Q7E A;  3O8V A;  1LJO A;  3CCQ A;  2E6Z A;  2O4X B;  3QII A;  3X20 B;  4PJO C;  4PJO B;  2E3C A;  4M75 D;  5GAM g;  2LX9 A;  5LJ3 h;  1YJ9 T;  4BI3 A;  1BBU A;  2K4Y A;  1S72 T;  1BI0 A;  2Q5I A;  4Y91 A;  1E24 A;  1QVF A;  2ZPI B;  3A8L B;  1FX7 A;  4P72 C;  3HRS A;  3OS1 A;  5GAN f;  2AMC A;  3CCM A;  2MWO A;  2IY5 B;  1S72 A;  2HQE A;  4XTY A;  3CPW A;  2GCX A;  3DB4 A;  5HK0 A;  1K9M C;  3TCJ A;  5KH6 A;  3UPU A;  2K5L A;  1Y96 B;  3GLX A;  1VQ9 T;  2DO3 A;  3A31 A;  3CCR T;  1K73 C;  3JB9 G;  3OY9 A;  1N6A A;  2MAM A;  1G3Y A;  3JCM c;  2CZ1 B;  4EPC A;  1VQ9 A;  4A4F A;  1E1O A;  3CCR A;  3CC4 T;  1VQ8 T;  2X4Y A;  3FJP A;  3LH0 A;  2VXE A;  4IUT A;  4M75 G;  4K87 A;  3RMQ A;  3S3M A;  5GAM f;  4H2T A;  3VYG A;  4BDY A;  2P0Q A;  4PLI A;  1VQ8 A;  4BY6 C;  4MDX A;  4BY6 B;  2VV5 A;  3I7F A;  3QUI A;  3AHU A;  2ALY B;  3WQZ A;  5HK3 A;  2YLB A;  4FT4 A;  2DQ3 A;  4BI4 A;  1NJ6 A;  4M77 F;  1VQN T;  5KCH A;  2ODR C;  4TVA A;  1VQO A;  3M4Y A;  4YRS A;  1VQP T;  3CEY A;  3VQV A;  1X6O A;  2CZ6 B;  2IG0 A;  3HXW A;  4CS3 A;  2E10 A;  1YHQ A;  4L59 A;  3VYH B;  1KOG A;  1VQN A;  2RO0 A;  1VQL T;  1KG1 A;  4TVW A;  2QQB A;  3ZEH A;  4OMF B;  3OYD A;  1I5L A;  1D3B B;  1YCY A;  2MI6 A;  4OB1 B;  2O4X A;  4F7U G;  4VUB A;  4PJO A;  4KR3 A;  1BKB A;  1VQ7 A;  4KBM B;  2WSC E;  4J15 A;  5E3I A;  2DU7 A;  1X54 A;  1AHJ B;  2ZPH B;  3R6O A;  1MHN A;  3V8K A;  2EKO A;  1WGS A;  2P5I A;  1USY C;  4QQD A;  2DTH A;  1KHI A;  5CKE A;  2CJA A;  2XIC A;  4EMK C;  1B7Y B;  4C0Z A;  3HFZ B;  1M1F A;  2QHS A;  4IUR A;  2VUB A;  3BW1 A;  3G6E A;  3JB9 H;  1JJ2 A;  1BIB A;  1Y96 A;  3PGG A;  2ZPE B;  5CVI A;  1EIF A;  5A0L A;  1UGQ B;  4BAC A;  2CIM A;  1GXI E;  3TEE A;  4J8O A;  5F5W A;  2KSS A;  2QXF A;  1IZ6 A;  1FXX A;  1VQ4 T;  4P74 C;  5FU7 C;  2WAC A;  5FU7 B;  4M78 C;  4M78 B;  1Q82 C;  1VQK T;  1WJQ A;  4JDS A;  4XTZ A;  1M1K C;  1WQW A;  3SDZ A;  3MP6 A;  1IRE B;  4CS4 A;  4QQG A;  3HXU A;  2RHQ B;  1M1G A;  4RCC A;  4KUD K;  3C12 A;  3HHT B;  4FU6 A;  1N9R A;  1VQK A;  1G3T A;  3FRN A;  1UGR B;  2MMP A;  2ALY A;  3OYI A;  3HFO A;  3G7Z A;  3OYB A;  2RHU A;  4PJO D;  3PT9 A;  2LT1 A;  3P8T A;  3VJP A;  4DOV A;  3NEN A;  4FT2 A;  5A0D A;  2DXU A;  1B70 B;  2WSE E;  2L8D A;  3OYL A;  4LVK A;  4BWA A;  2DXB A;  4A4G A;  3M54 A;  4RKU E;  4M7A C;  3VQW A;  4M7A B;  2LCL A;  4UC4 A;  3VUZ A;  4E7H A;  5GAN 6;  4LDY A;  4EO4 A;  3TEH B;  4X9C A;  1K8A C;  2CZ7 B;  4YRQ A;  4JJN K;  2ZTG A;  3JCM g;  2FHD A;  3INZ A;  3OW2 S;  2RK2 A;  2RHY A;  1UGP B;  1KQ1 A;  2C7I A;  1RI0 A;  3MO8 A;  4ZTF A;  5HGQ A;  5DM7 R;  4HKE A;  1Y7X A;  4MMK A;  4E51 A;  1N8R C;  3SB2 A;  1EVL A;  4H02 A;  2B8A A;  5K1X A;  2ZGW A;  3ZBD A;  3C94 A;  4J6Y A;  5HY6 A;  5LJ5 h;  5CKD A;  3OS5 A;  3V8J A;  2D6F A;  1HC7 A;  4NOY A;  5GAN 5;  3CPW S;  1EVK A;  2E1H A;  2A7Y A;  4YPF A;  2XI9 A;  4XK8 E;  1X2H A;  3MET A;  4C92 F;  3BDU A;  3MEW A;  4KR2 A;  1VUB A;  1I8F A;  2E41 A;  1ADY A;  4TWA A;  1C0A A;  3V7S A;  1EQR A;  2EJG A;  4N4H A;  4M78 A;  3CCV A;  3HY0 A;  3UH0 A;  2C8M A;  2LCC A;  4JRI A;  1LOJ A;  2ODR D;  2JVV A;  1YBY A;  1M1K U;  4GY5 A;  3OYE A;  4EX5 A;  3J7A F;  2XG8 D;  1G5H A;  3G71 A;  3JCM W;  2EQU A;  2RHQ A;  5GAO r;  3JCM f;  4QQ6 A;  3VV0 A;  3M59 A;  3HXZ A;  3SD4 A;  3E9I A;  4YRG A;  2PVD B;  3CCL T;  4RDX A;  3QPH A;  4TVR A;  4O6J A;  3REX A;  4ZGJ B;  2L89 A;  3RMS A;  4OP0 A;  1I4K 1;  3I55 T;  1Z7N A;  4JUV A;  5IT9 E;  4OB0 B;  2I4O A;  3QNE A;  2ARU A;  4DA4 A;  1WNL A;  2QEX T;  1NPP A;  2DPP B;  2LT4 A;  4M7A A;  3CC7 T;  4ZN1 A;  2R5M A;  4XTU A;  2H3J A;  3JB9 F;  3HPW A;  4HCB A;  3PIO A;  3QYG B;  3ME9 A;  3TEH A;  3R07 A;  3KFU A;  3C4S A;  2LC4 A;  3EFS A;  4LVM A;  3LWI A;  3S3O A;  3CC7 A;  3IKM B;  4MZT A;  2KMT A;  2IVW A;  4OGC A;  4BE2 A;  3JCM V;  3X25 B;  4YCV A;  3OSV A;  1W2B A;  4JRQ A;  1B8A A;  4H2X B;  2DZ9 A;  4M75 F;  1WYD A;  2VGN A;  3E9H A;  2QQ9 A;  4ATO A;  3PCO B;  2PUO B;  2AKW A;  2L3R A;  2KK4 A;  1QVG A;  3NET A;  4M77 C;  4O2D A;  4M78 D;  3OYM A;  5I2M A;  1H4T A;  4ELZ C;  3KBG A;  3FLG A;  3CD6 T;  2ZIN A;  4C8Q E;  5GAN h;  4OVA A;  4JLI A;  4IKF A;  2K5I A;  3QSU A;  3FB9 A;  2Y4X A;  4OGE A;  1W66 A;  2ZPB B;  3ER0 A;  3OYF A;  2YLC A;  4JLG A;  5LJ3 j;  1KQ2 A;  2EQJ A;  1YB3 A;  2EWN A;  3HTZ A;  3CXC S;  3QG1 A;  4YRR A;  2OTL A;  4P73 C;  5IN1 A;  4BE1 A;  2EJ9 A;  2EJF A;  3MEA A;  3CBM A;  4XU1 A;  4QW2 A;  1E1T A;  2QDY B;  2ZCE A;  3OW2 A;  2I4M A;  1HTT A;  1Y71 A;  3G4S A;  4M7A D;  3RF1 A;  3CCM T;  3WXM B;  1BI1 A;  4CH4 A;  1YJW A;  3S3N A;  1H4S A;  1Z7M A;  5A2Q E;  3L4G B;  1ZQ1 A;  1V29 B;  4JRP A;  3QJ6 A;  5J26 A;  3HFV A;  3L2U A;  5GAM h;  4XTV A;  2V8J A;  3OS0 A;  1JB0 E;  2XDD A;  1QP3 A;  2Q7G A;  4M77 E;  2ZIM A;  4M7D G;  1QVP A;  4M78 G;  4ZTJ A;  5C52 B;  4KUI A;  2DKG A;  4C8Q F;  4LVJ A;  2CKK A;  4XAX B;  1VIE A;  1UEB A;  1WQ7 A;  3RIR A;  4FSX A;  2ZZG A;  1LYL A;  4PKC C;  1SER A;  5GAN 7;  2PMF A;  4J7I A;  2BKD N;  1X55 A;  4HWT A;  4Y28 E;  3A7A A;  4JRK A;  2X4W A;  2ZZD A;  3JCM b;  3NFC A;  1VQ6 A;  4H2X A;  3L2R A;  2EQK A;  3CBP A;  3RAC A;  4V2S A;  3L1A A;  3E9G A;  3PCO A;  4BI8 B;  2PME A;  3P8D A;  3OYC A;  4HWS A;  2RM4 A;  4E7I A;  4M7A G;  2XK0 A;  3LX7 A;  1VQO T;  3L2W A;  5LJ3 e;  3CC2 T;  3F70 A;  5FLX E;  3EAE A;  3UT1 A;  3TUP A;  2GQV A;  2LRQ A;  1BBW A;  4XU3 A;  1YHQ T;  4R55 A;  1JRI A;  3MEU A;  4B9W A;  4FIB A;  1YFT A;  4X34 A;  3CC2 A;  3G1Z A;  4WF2 A;  2NLU A;  2EQM A;  1BIA A;  1VQ7 T;  3VQY A;  4XTW A;  1ATI A;  2X4J A;  4YRC A;  3GOX A;  2G3R A;  2ARS A;  1NJI C;  4NS5 A;  2KY9 A;  3BFM A;  4MML A;  4HCZ A;  1X01 A;  2RJD A;  3Q1J A;  3FC3 A;  3A32 A;  4TTV A;  3OYH A;  1DJ7 B;  1SRY A;  2QQR A;  4LD6 A;  5CKF A;  3PFS A;  2HNI A;  3RER A;  3M4G A;  3IAL A;  5FRN A;  4IUV A;  2GF7 A;  3X24 B;  3A8H B;  5CAI A;  4TQF A;  3L4G A;  3DLM A;  4XTX A;  4EMG A;  5CQX A;  3KUF A;  4Z02 A;  5K1P A;  1WLE A;  3G6E T;  2ZT6 A;  4P72 A;  1LNX A;  3QO7 A;  1VQZ A;  4Q15 A;  2A8E A;  4A4H A;  4EMK B;  4H2V A;  1NJ2 A;  2ZNI A;  3RKY A;  4UP9 A;  4ZTU B;  2IY5 A;  2P0L A;  4CRI A;  2P4T A;  1ZHI A;  3J80 E;  1QE0 A;  4C92 C;  3HFN A;  1Q7Y U;  3NTH A;  4YRK A;  3M55 A;  2LTO A;  2PQW A;  2RK1 A;  2ZR2 A;  3MP8 A;  2KAF A;  4Q5W A;  5LJ3 d;  4Q6G A;  4NL3 A;  5CKB A;  3OB9 A;  1BYM A;  2EL9 A;  2Q5H A;  1ASY A;  3CCS A;  4YRP A;  4C5E A;  2BUD A;  3UGQ A;  2J3L A;  3CBO A;  3JB9 J;  3ZFJ A;  3CXC A;  2KQW A;  4WJ4 A;  4QVD A;  2RHS B;  3L42 A;  2QHV A;  5D6W A;  1W2B S;  2HQX A;  3A8M B;  2E12 A;  1X75 C;  5GAN 4;  2E65 A;  2ZZF A;  3MP1 A;  1KMM A;  3SWN C;  3VKI A;  3SWN B;  3VQX A;  4J83 A;  3OYA A;  1NZ9 A;  3DLL A;  5ELN A;  2M0O A;  12AS A;  1QVG S;  4BD3 A;  4ELY C;  1NJ1 A;  4H2U A;  1H64 1;  4K86 A;  4YDQ A;  2LNV A;  4CH5 A;  2DTI A;  1NE8 A;  2RHZ A;  4YRF A;  1J5W A;  2DIG A;  1U1T A;  3OMG A;  4C92 E;  2JTM A;  2CJ9 A;  4PL6 A;  3MHX A;  2FYK A;  3MEV A;  2E70 A;  2ART A;  1OZ3 A;  4HWP A;  3FEO A;  1YIT A;  1NJI U;  2DZC A;  4YRI A;  1D3B A;  2GFU A;  4UP7 A;  1QF6 A;  1WJS A;  5CKH A;  4CH6 A;  4L5G A;  4M75 C;  4H2W A;  5ELO A;  2QA4 T;  2LDM A;  1M4Z A;  1H4V B;  3FIF A;  4XU0 A;  5GAO m;  5LJ5 j;  4JS5 A;  1USY A;  2RI5 A;  1XOV A;  5C51 B;  1B7Y A;  4EMK A;  4XU2 A;  2E6N A;  3HFZ A;  3JCM h;  1X2G A;  1JJC B;  3C95 A;  2QA4 A;  3JRZ A;  3VU3 C;  1NYR A;  4RQE A;  2HAX A;  1YFS A;  4P75 C;  3PMT A;  4MZP A;  3CCV T;  4PJO G;  3FDR A;  3HRK A;  5GMK h;  3P8Y A;  3CME A;  4ZTZ B;  3H8Z A;  3OYG A;  4G84 A;  5J3B A;  1U1S A;  3MEY A;  3G71 T;  4LD9 K;  1WU7 A;  4RQF A;  3RKW A;  2ZR3 A;  4P74 A;  2ZIO A;  2RHS A;  3JSC A;  3HRT A;  1BI3 A;  2K57 A;  4NCX A;  4P3P A;  3L2V A;  2RJC A;  4YRO A;  3QKJ A;  1H3Z A;  2RB6 A;  3LSQ A;  3OS2 A;  4M75 E;  1B76 A;  4P3O A;  1PSF A;  3P8B B;  4QVC A;  5L8R E;  3SWN A;  3CMQ A;  1VQ5 A;  1PSE A;  3HKS A;  2A3L A;  4LDW A;  3PZC A;  4C0G A;  3GPL A;  5CR2 A;  4X9D A;  1KHC A;  2AHJ B;  3TRE A;  2OAU A;  1RL2 A;  4OB2 B;  4L6V 5;  3CMA A;  4M7D F;  1Q86 C;  5GAO p;  3I56 A;  5HKC A;  4C8Q C;  4C8Q B;  2G4C A;  3GNG A;  3LW5 E;  1B70 A;  1YJN T;  5IAY A;  2BIV A;  5FU6 C;  5FU6 B;  5LJ5 e;  5KNN A;  2M9U A;  4ZGE B;  4UPA A;  2VGM A;  3OSS C;  4J6X A;  4PG3 A;  3A8O B;  3A7R A;  4F7U E;  1YJN A;  4BUG A;  1HK9 A;  3A8G B;  4DPG A;  1G3S A;  2R57 A;  3HXX A;  3WVE B;  3DKM A;  3UGT A;  3CCU A;  2HD0 A;  3CCE A;  4KT0 E;  3N5B B;  2PU9 B;  1JJC A;  3RL6 A;  3QJY A;  5GAN j;  1NYQ A;  3TU4 K;  2ZNJ A;  4M77 B;  4ME7 A;  3GNF B;  2P0P A;  2EFI A;  4P71 C;  3QXE B;  4YP0 A;  3OYK A;  4IUU A;  1NJ8 A;  2QHT A;  1VQM A;  5GAN 3;  2Y4Y A;  2OTJ T;  3L2Z A;  3MQZ A;  5DLO A;  2OTL T;  4C0F A;  2JUF A;  2V8K A;  1YI2 T;  1BI2 A;  5KCO A;  1G3W A;  2OTJ A;  4RCB A;  3JCM d;  3G4S T;  4N0A C;  3A74 A;  1YJW T;  4F7U F;  3TEG A;  2RHI A;  4TVA B;  2GFA A;  5LJ5 d;  3JB9 D;  4LNS A;  5AYF A;  3GP8 A;  3BJU A;  3E1S A;  1YI2 A;  5GAM j;  2NS6 A;  3VBB A;  4ZN3 A;  1M90 U;  2E5Q A;  4LVL A;  2DIQ A;  5DLQ E;  5KE3 A;  3LC0 A;  5LJ3 g;  5J39 A;  3A7U A;  1G51 A;  3HXY A;  3OA6 A;  4KQE A;  3QBY A;  2V8I A;  3J81 E;  1Q86 U;  3M53 A;  3PNW C;  4C8Q A;  3NEL A;  3OMC A;  2QI2 A;  5I21 A;  4BE0 A;  5EG2 A;  1I81 A;  4R56 A;  4J5Y A;  5GMK m;  2YRV A;  4II1 A;  3HXV A;  4C5I A;  4FL6 A;  4YCU A;  4QVZ A;  1Q7Y C;  4YTL A;  2F5K A;  1YIJ T;  2ZT7 A;  5FRO A;  1YJ9 A;  1VQ6 T;  3JCM Q;  5GAN e;  4EDU A;  4HT4 A;  5D6Y A;  1G5V A;  1TH7 A;  2ZZE A;  3E19 A;  1N27 A;  3P8V A;  3V7R A;  1YIJ A;  3QTC A;  3KXT A;  3W3S A;  2ZCF B;  3OQ5 A;  4IUQ A;  2DXC A;  1YFR A;  3SFM A;  3QZ5 B;  5GMK l;  3LWH A;  2JTF A;  1RIQ A;  3RUX A;  2DD5 A;  2QQA A;  3V7C A;  4M77 A;  5LJ3 f;  3HP9 A;  4L87 A;  4P71 A;  4N4G A;  4XEM A;  2C06 A;  4PJO E;  3LYI A;  3M58 A;  2HBP A;  5GAN 8;  5M9O A;  3A5Y A;  5GAM e;  1X56 A;  2X4X A;  2E64 A;  3CC4 A;  1W4S A;  3MCA B;  4P5N A;  1E22 A;  4N0A A;  1N9S A;  1O9S A;  2L5Q A;  2CZ0 B;  5GAO n;  1B34 B;  4P73 A;  4C8Q D;  2J3M A;  2XKO C;  3PTA A;  4UP8 A;  3A5Z B;  2XDP A;  3QZ9 B;  5C0M A;  1OI1 A;  2Q7H A;  3IG2 A;  5KE2 A;  1XTD A;  1XNI A;  1Q81 C;  3ASK A;  2CS7 A;  2F5T X;  5GAN d;  4D6W A;  2D9T A;  5FRM A;  3MF1 A;  5D6X A;  1VQP A;  2DTO A;  4J6W A;  1KC8 C;  4E7K A;  3UWN A;  4A4E A;  4HWO A;  4HVC A;  2E5A A;  2VYT A;  4IUP A;  3M5A A;  2DVE A;  1VQL A;  4LVI A;  1UGS B;  3JCM X;  3CCS T;  4E7L A;  4PJO F;  3HRU A;  4C92 B;  2R5A A;  1FYF A;  2LVM A;  2X35 A;  4YYE A;  1IL2 A;  3MF2 A;  4OF1 A;  4TQD A;  3M4P A;  4YRM A;  3LGF A;  2K5F A;  4M77 D;  3PMI A;  2RI2 A;  1K9M U;  2XGT A;  5CIU A;  5C6S A;  5GAM d;  4HA8 A;  4C8Q G;  3DB3 A;  1K73 U;  1NPR A;  1KQS A;  2XID A;  5DY9 A;  5LL6 S;  4YCW A;  3QHS A;  1R8O B;  4YRJ A;  3GIB A;  3RKX A;  1OZ2 A;  3HRI A;  2DU5 A;  4M7D C;  4XQ3 A;  4M7D B;  4O5V A;  4MZM A;  2EYQ A;  3IKL A;  1U8R A;  4LDU A;  4EMH A;  4KUL A;  2QTX A;  3M57 A;  2K2V A;  3T9N A;  4MDW A;  5GAO q;  3X28 B;  4FM4 B;  4HWR A;  1YIT T;  2JOY A;  1VQ4 A;  3QO5 A;  1M9S A;  4OB3 B;  3X26 B;  1UB4 A;  5A0G A;  4C0D C;  4K88 A;  4C0D B;  3JCM P;  4H2S A;  3OD1 A;  2PUK B;  1G5I A;  2DXT A;  1HXD A;  2LQK A;  4C5G A;  2ZPG B;  1B34 A;  4HCC A;  3OBY A;  2XU8 A;  2P0K A;  3JAM E;  3A5Z A;  3WVD B;  4M77 G;  2KDS A;  4H2Y A;  4NL2 A;  4M75 B;  3L2Q A;  4RMF A;  2FB7 A;  1Q81 U;  3NTK A;  4A54 A;  3ERR A;  3URG A;  4PHC A;  1FWZ A;  1KC8 U;  1Y07 A;  3BDL A;  4A4K A;  4DOW A;  4M7D E;  1M5Q 1;  3UFG A;  4M78 E;  2I4L A;  1N9W A;  4E7J A;  4CI0 C;  5GMK j;  4DQ2 A;  2M16 A;  3CME T;  5LJ5 g;  1WPY A;  4C92 A;  2DQ0 A;  3OBW A;  1OYX A;  1QVF S;  4HT8 A;  1PYS B;  4LDV A;  3QO3 A;  3OYY A;  1QW1 A;  2QQS A;  1M8V A;  2AKW B;  3LGL A;  4CH3 A;  2K3X A;  2KVQ G;  2RHX A;  4HT9 A;  4E47 A;  5GAO l;  4B9X A;  4F7U B;  2D0Q B;  3RGL A;  3CCJ T;  2EAY A;  3HSB A;  1VQ5 T;  3GF5 A;  5CK9 A;  2Y90 A;  2XDB A;  4BB7 A;  4AH6 A;  4G85 A;  1YGB A;  2ZT5 A;  1GGM A;  4ZIB A;  2DEQ A;  2ZXF A;  4M7A E;  2VC8 A;  3CMA T;  3CCJ A;  4A53 A;  2DJZ A;  3M56 A;  1KD1 C;  3I56 T;  1EIY B;  4M7D A;  1M90 C;  2RI3 A;  1QP2 A;  3M4Q A;  2PVG B;  1Q82 U;  2ZPF B;  2MF2 A;  2VXF A;  3DSQ A;  4P3N A;  3PIP A;  3E9F A;  4JS4 A;  3REU A;  3UDC A;  4BW9 A;  4M78 F;  2EIF A;  1XQH A;  2FVU A;  3QO8 A;  3JCM e;  2PVO B;  1VIF A;  2QHU A;  4CS2 A;  2K3Y A;  5LJ5 f;  3OYN A;  3M9Q A;  1WJR A;  1NJ5 A;  4RG8 A;  2I4N A;  2DAQ A;  4TVY A;  3BY7 A;  3EFR A;  2JNG A;  3CCU T;  3CCE T;  2AMC B;  5GMK e;  5CCA A;  1O75 A;  3QYH B;  4M75 A;  2JN0 A;  2M1H A;  3CCL A;  4C92 D;  4C5H A;  4BDZ A;  2O01 E;  3OYJ A;  3ICA A;  3VUB A;  1P92 A;  2DK3 A;  1ADJ A;  3HY1 A;  3I55 A;  3P8H A;  3RES A;  2CGH A;  2RD1 A;  1SES A;  1L0W A;  4ZGD B;  4M7A F;  2QEX A;  1K8A U;  5CO7 A;  3QDR B;  5CQY A;  4XEO A;  1ZBX A;  1VQM T;  4YRT A;  4YRE A;  4WI1 A;  3JB9 I;  5I2S A;  5C53 B;  2MWP A;  3NEM A;  2YHT A;  2F69 A;  5GAN 2;  2DD4 A;  1KMN A;  2CYZ B;  4RG2 A;  4P75 A;  4PNO A;  1MGQ A;  2ZT8 A;  1H4Q A;  1PYS A;  1N8R U;  2RJF A;  4YRN A;  2XHC A;  3HL8 A;  2RJE A;  5GAN g;  1SET A;  1JBM A;  4PLL A;  3LLR A;  4M7D D;  4F7U A;  2DDZ A;  2RH2 A;  4OLF A;  3JCM J;  4LDX A;  4N4I A;  4GLK A;  3CPF A;  5GMK i;  3NTI A;  1JJ2 S;  2LQ8 A;  2CJB A;  2WSF E;  3V8L A;  2XTI A;  2R58 A;  1EFW A;  4WJ3 M;  2XD0 A;  4X5O A;  2JZ2 A;  1KQS S;  2FL7 A;  1NNH A;  4J7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...