1WPYA

Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3 in complex with biotin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 61
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wpyA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wpyA01
4XEOA 1LYLA 3HXXA 2I2LA 1E22A 4EX5A 3HFNA 2ZIMA 2YHTA 3QO7A 5I21A 4H2WA 2VXFA 1YFTA 2RHQB 4TVWA 4NOYA 4C8QD 3IG2A 3RGLA 3JCMQ 4M77B 3JCMJ 3V8LA 3CMQA 4C8QE 3UFGA 1USYA 3EFSA 4YRQA 3JCMc 4OP0A 4YROA 4C92A 5LJ5h 4WJ4A 4H2YA 4F7UE 1SESA 4YRFA 3RERA 2EAYA 5GMKh 1BBUA 2P0LA 4MMLA 2ARTA 4M75C 3RUXA 2ZZFA 5E3IA 4PJOC 3V7SA 5C53B 3QUIA 2QTXA 3L4GB 1I81A 1NJ8A 3MF1A 4M7DB 3BFMA 4X9CA 3HXUA 2RB6A 4XTZA 2RHSB 3HXVA 4HWTA 1ASYA 2EJFA 3JCMV 1X54A 5GAMf 4P71C 3PGGA 4P74C 3E9IA 3JCMX 5LJ5e 4YRLA 5GAMe 5GAN2 3KFUA 4M7AC 5C51B 4K86A 3VQWA 3VBBA 2Q7HA 3MF2A 1IL2A 4YYEA 2DU5A 3ICAA 4C8QA 4HT9A 4HWPA 1G51A 2AKWA 4L87A 2I4LA 3NELA 4NL3A 3RIRA 1B8AA 2DXUA 1NNHA 1BBWA 4P73C 1Z7NA 2E5AA 4TVYA 2E65A 4J6WA 3JCMW 4ZTUB 4M75G 5C52B 1LNXA 3PCOB 4PJOG 5GAOl 1M5Q1 5GANg 1FYFA 4YRJA 3HRKA 1QF6A 3REXA 2DTIA 4XTYA 5GMKj 1B76A 4M78B 3A5ZA 1WYDA 3A31A 1JRIA 4C92F 5HGQA 4M75D 3JB9F 1G5IA 2CJBA 2IY5A 3UGTA 4YCVA 4PJOD 1M8VA 1YFSA 4M75E 5F5WA 4RDXA 5GAOq 5GANd 5GAN4 2ZINA 4M7AG 2FB7A 1EQRA 4EMKB 2DXTA 4PJOE 5LJ3g 1VQZA 4BWAA 5GANf 2QHVA 3BY7A 4CH6A 1NJ1A 2Q7GA 5K1PA 4TWAA 1KOGA 5ELNA 5GANe 4YCUA 1ASZA 3SWNA 4M7AD 3HFZB 4P72C 5LJ3d 1H4TA 2PMFA 1Y96A 4PG3A 2ZT7A 4JRKA 4M7AE 1LJOA 1HXDA 4WI1A 3JB9H 4M78D 1YGBA 4P3PA 5LJ3f 4DQ2A 4H2XA 3NETA 4P75A 4M77C 1TH7A 3JCMh 4HA8A 3VQXA 4C8QF 4UP8A 5LJ3e 4DPGA 2C8MA 3A7AA 1N9SA 4JRIA 2QHUA 3V7RA 1NYQA 4JUVA 4J5YA 4F7UF 4F7UG 1X2HA 4N0AA 4OLFA 4X9DA 1JJCA 2ZR3A 3BDUA 1WU7A 4PJOA 3M4QA 4KR2A 3LSQA 11ASA 3JCMP 3IKLA 4HVCA 1L0WA 1B34A 2QHSA 1SETA 4YCWA 4BW9A 1B7YA 4YRMA 4V2SA 3UH0A 1B70A 4M7DC 1RIQA 2HNIA 4YRNA 3PZCA 5ELOA 4EO4A 5LJ5g 5GAMg 3JCMe 2E3CA 1EVLA 1EVKA 1X56A 4P74A 2IY5B 2EJGA 1U1TA 2DVEA 4CH5A 3BW1A 1EIYB 4QVCA 3HSBA 4M7AA 4TVAA 3VQYA 2DZ9A 3QTCA 1LOJA 4YPFA 4M77G 5LJ5d 4P3OA 5GAMd 2ALYB 1E1OA 3RESA 2ZIOA 3LSSA 2DQ0A 5LJ5f 3IKMB 4M77D 4TQDA 3OD1A 5GMKe 1SERA 2ZNIA 3W3SA 4M77E 4E51A 4YRIA 4CS2A 1H641 1QE0A 3HTZA 1NJ5A 3QO8A 4WF2A 4XEMA 1BIBA 4M78C 4M7DG 1D3BA 1PYSA 2RM4A 4XU0A 4F7UA 3E9HA 2CGHA 1H4VB 2Q5HA 5GMKi 4M75F 4CH3A 3RKXA 1Z7MA 4EMKC 1GGMA 4PJOF 4M7DD 1W66A 2K57A 5GAOm 4XTWA 4AH6A 1JBMA 4M7DE 4A54A 2Y90A 3QNEA 1E24A 3RL6A 1B70B 4C92B 2ZT8A 4P72A 3TUPA 1X01A 5GAN3 3HFOA 3P8TA 1HK9A 4HT8A 3RACA 2DZCA 5GMKl 2RHQA 2ZT6A 4M7AF 5K1XA 3RF1A 5CAIA 4A53A 4YP0A 4TVAB 2CJ9A 3QO5A 1G5HA 2P5IA 4XTXA 4EMHA 4HWOA 2DDZA 4M78F 1KMMA 4M78G 3TEHA 4PHCA 5DY9A 4H2TA 1U1SA 2YLBA 1KQ2A 2VC8A 4RMFA 4K87A 2CJAA 2YLCA 1KQ1A 3HXYA 2ODRC 3IALA 4TQFA 5GAN5 3RKYA 2ZT5A 4KR3A 3L4GA 2DTOA 4YRRA 2DEQA 3JCMg 4HWSA 3JB9D 2ZXFA 2ZGWA 4M78E 4C8QB 2QHTA 2ZNJA 2EJ9A 2RHSA 2E10A 3MEYA 2AKWB 1PYSB 2E1HA 4JLIA 5GAN7 3A5YA 1EFWA 3QO3A 4F7UB 1HC7A 4NL2A 3A7RA 4YRSA 4M75A 4RCCA 3BJUA 3HXWA 4J6XA 1NYRA 4YRKA 3JCMd 4P3NA 4X5OA 2E41A 1H4SA 5KNNA 2DKGA 3JCMf 1I8FA 2Q5IA 2FYKA 3RKWA 3L1AA 4WJ3M 4P71A 2ZTGA 3SWNC 2I4NA 1ADJA 2E64A 4UP7A 4YRCA 5GANj 3V7CA 3VU3C 3ERRA 2RD1A 4XU1A 1WQ7A 1WQWA 3FJPA 4XQ3A 3PCOA 2AMCA 1E1TA 5GAN8 4M77F 4MMKA 4NCXA 4P75C 4EMGA 4M78A 4Q15A 1NJ2A 2C7IA 4H2VA 2ZZGA 5GAMh 1N9WA 4O2DA 4P73A 3HRIA 3SWNB 4XTVA 3L2ZA 3FB9A 5LJ3j 2ODRD 3TEHB 2CIMA 4YDQA 4LNSA 1C0AA 4CH4A 4Y91A 4N0AC 3HFVA 1Y96B 3REUA 4EMKA 1N9RA 3QHSA 2VXEA 2J3MA 2ZCEA 3JB9I 4H2XB 1YFRA 4M7DF 1USYC 5GAN6 4C92C 3HFZA 3R07A 3AHUA 2ARSA 4YRPA 4CS4A 4ZTZB 3HXZA 3P8VA 4YREA 4RQFA 2DJZA 1H4QA 4M75B 1X2GA 3HY0A 2DTHA 4UP9A 1JJCB 3M4PA 1BIAA 4XU3A 4PJOB 3NENA 5GAOr 1B34B 3JCMb 2I4MA 4KQEA 1ADYA 3SB2A 3INZA 1B7YB 3DSQA 1I5LA 1YCYA 2DQ3A 3QSUA 2J3LA 4YRTA 3VQVA 2ZR2A 4M7AB 1I4K1 4G84A 3A32A 4G85A 5GMKm 3A7UA 2DU7A 3GIBA 2AMCB 5LJ5j 5GAMj 5GANh 2G4CA 4M77A 1KMNA 4K88A 4UPAA 3EFRA 3TEGA 4C8QC 4XTUA 5GAOp 1MGQA 3JB9J 4PNOA 3UGQA 4C92G 3JB9G 1WNLA 2RA2A 1WPYA 3HY1A 1EIYA 2Q7EA 4CS3A 2PMEA 3WQZA 3G1ZA 4J15A 2XTIA 2ZZEA 3I7FA 1EOVA 1WLEA 4Q6GA 5LJ3h 3V8KA 2XGTA 3FIFA 4H2SA 12ASA 4C92D 3V8JA 2ALYA 1YB3A 2JN0A 2ARUA 1X55A 4YRGA 4RQEA 4M7DA 2I4OA 4ZIBA 1J5WA 4C92E 1D3BB 4HWRA 1NJ6A 2EL9A 4QVDA 1HTTA 1SRYA 3M4GA 5GAOn 4H2UA 2EWNA 3P8YA 3LC0A 3NEMA 4J6YA 3A74A 4XU2A 4TTVA 4RCBA 1ATIA 4H02A 4C8QG
chains in the Genus database with same CATH superfamily
3HXXA 1E22A 2X4YA 2PUKB 2ZIMA 1WJRA 3CCEQ 3H0FA 4C8QD 3LW5E 3CMQA 3V8LA 3UFGA 2OJ2A 3CCST 1USYA 2R5AA 4YROA 1VYVA 5LJ5h 1X69A 4LVIA 4WJ4A 3J80E 5CCAA 4F7UE 1SESA 4YRFA 1X6BA 2EAYA 2ARTA 4M75C 3RUXA 5E3IA 1IGQA 4PJOC 2VV5A 1YBYA 4OF1A 1I81A 1VQ7Q 3U23A 1VQKA 2DD5A 3WVDB 1YJ9T 2D6FA 2RHSB 4RTWA 1JXMA 2BZ8A 3JCMV 2KAFA 4ESRA 4P71C 2COWA 2KK4A 5LJ5e 5GAMe 4YRLA 1PM3A 2R57A 2XDDA 3QDFA 4K86A 3REAB 2QQSA 3VBBA 2YRVA 4YYEA 2CP6A 3JRZA 3MEVA 4HT9A 4LXCA 2L3RA 2AKWA 4L87A 1VQ4T 2I4LA 2L8DA 3NELA 3CCMT 1B8AA 1K1ZA 1TWBA 3HRTA 2RQTA 4J9EA 2O4XB 1IHVA 3PIPA 3JCMW 2LP5A 2QTVA 5C52B 1ZUKA 1M5Q1 5GANg 1FYFA 1QF6A 3OYJA 2DTIA 4XTYA 2ATCB 3FEOA 4LVJA 3A31A 1JRIA 2V8KA 3LGFA 4C92F 1Q82C 2K2VA 4M75D 3CMAT 3JB9F 3VS0A 1MNDA 3M0PA 4PJOD 3M56A 5GAOq 1XJWB 3C94A 2FB7A 2OTJQ 4E2FB 1EQRA 3CCUA 1V76A 2PVDB 5M9OA 1KQSA 3A8HB 5HK3A 1WJSA 3QZ9B 1G3TA 3BY7A 4L6V5 1NJ1A 2K5LA 2V1RA 5K1PA 4TWAA 2LT1A 3HPWA 3A8LB 5ELNA 3G6EQ 4BDZA 3CCQQ 3HFZB 4P72C 4II1A 4KGZB 5KE2A 3CCVQ 2HL5C 4JRKA 4M7AE 1LJOA 4WI1A 1N6AA 3JB9H 2DXCA 4PL6A 1BK2A 4P3PA 5LJ3f 3QYGB 4DQ2A 2YT6A 3NETA 3M0QA 1EX4A 2AKKA 1R77A 1BKBA 4D8KA 3OS2A 4DPGA 2C8MA 2RHZA 1EIFA 3VS5A 3A7AA 2GFUA 3M0UA 3V7RA 3EGDA 4F7UF 3LH0A 4DA4A 2HD0A 2LX7A 3THKA 3UF4A 2RQUA 2RHIA 4Y92A 3M4QA 3J81E 4J9BA 2EQUA 3JCMP 3SDZA 1FMKA 2MWOA 1GBRA 5A2QE 4C5GA 1B7YA 2W0ZA 1UTIA 2LQ8A 2QQRA 2HNIA 2J05A 2DL5A 1YJWA 1AWWA 3PZCA 5LJ5g 5GAMg 1W4SA 2DVEA 4CH5A 3BW1A 1EIYB 1QWEA 4QVCA 3HSBA 1VQPA 1LPLA 2P84A 3D7SB 3QTCA 5IT9E 4M77G 4P3OA 2QA4T 2CREA 1NJIU 1K9MR 1E1OA 1WGSA 5HCKA 3LSSA 1E6GA 2NWMA 5A0DA 2XU8A 3A8OB 3FJ5A 2VWFA 1NBEB 3C0CA 3DLMA 3FRNA 2KY9A 2DM1A 2XKOC 1Q86U 1QWFA 4KUIA 3OD1A 4PJNA 2GNCA 1PNJA 1H3ZA 1H641 3HTZA 1OPLA 4M78C 2L3SA 4M7DG 3QPHA 2RM4A 4DEYA 2YDLA 3E9HA 3RMSA 3CC7T 2EFIA 1N8RC 2Q5HA 1PSFA 5I11A 4EMKC 2EYYA 1T0HA 4RMOA 2SEMA 1OX8A 1VYTA 4XTWA 2KRMA 1NJIR 4B6MA 4AH6A 2NUZA 3QNEA 5CQYA 4OMMA 3OYBA 2DEUA 1WHKA 1M1KU 1HK9A 1RAHB 2ZT6A 1Q86R 4M7AF 3RF1A 1W1FA 4OMLA 5CAIA 4A53A 3M4YA 2Y4YA 1HD3A 2OX7A 1OZ2A 1R8OB 4OB2B 4EMHA 3CCET 4HWOA 2D0NA 2ED0A 2F5KA 3M9QA 3TEHA 1AOJA 2E3HA 2DVJA 1KFZA 3EHRA 2DYBA 2DYIA 1U8RA 1KQSS 2LJ1A 2YLCA 3CCRT 4TQFA 5GAN5 2JTEA 3A8GB 3UDCA 2DTOA 2DF6A 1M3AA 2ZGWA 3MJXA 3P8HA 2O2OA 3QYHB 2HBWA 3MEYA 2LCLA 2IVWA 4FU6A 3LH5A 3PIOA 2VASA 1ZA2B 5GAN7 3A5YA 1EFWA 3QO3A 1ABOA 1VQ7T 3R6NA 4RCCA 2HSPA 1M1KR 2EBPA 1NEGA 2YRCA 3MKDA 1VQNQ 1NYRA 3MCAB 1RADB 2P0QA 3OYEA 4P3NA 1VQMA 1Q82U 2DKGA 3JCMf 2JJ9A 1VQ5A 3H41A 4WTOB 2FYKA 3L1AA 3M58A 2ZTGA 2CUBA 3C4SA 4J9IA 1ADJA 4E47A 3CQTA 3E9FA 4UP7A 5L23A 2J6OA 4N4GA 4OB3B 1WQWA 3FJPA 2ZCFB 1E1TA 2L89A 2GCXA 3LX7A 2CP2A 5KYWA 4IKFA 1PD1A 4NCXA 4P75C 4AT1B 1QKXA 2V1QA 2C7IA 4HVVA 3HRIA 3TEHB 3FB9A 4PFOA 5LJ3j 1MHNA 3CC2A 3TEEA 1C0AA 3QWYA 4K11A 1Y96B 2YUNA 7AT1B 1N9RA 1ZSZA 2VXEA 3G71Q 2E6ZA 3CMET 5GJVB 2QEXA 3C95A 3L2QA 1QVFA 4JPBW 2KYBA 3EH1A 3CPWP 2K7AA 5ECAA 2FPFA 2OTJT 4C92C 4X34A 4HXJA 3R07A 1YHQT 2BZXA 1RUWA 4YRPA 4CS4A 4ORZA 2RNAA 4Q5WA 1FWZA 2AKLA 3A98A 3HXZA 3P8VA 3ASKA 1H4QA 4JZ4A 2DJZA 5CKDA 3HY0A 3M4PA 4XU3A 3G6ET 2ZPBB 4C5HA 1IREB 2RJCA 2J6KA 3CCQT 2I4MA 3CCVT 3A1PA 3ZL7C 1BYMA 2QDLA 1V29B 4RTZA 3VS4A 3GBQA 3EFOA 2DQ3A 1YIJT 3QSUA 3SHWA 2K6DA 1I4K1 5GMKm 2DU7A 1ZBJA 4IUVA 1YJNA 2HKNA 4ZN3A 1YN8A 1WFWA 2SRCA 4HCZA 4FSXA 1HSQA 2JS0A 1D0YA 2ZZEA 2O88A 1EOVA 5LJ3h 3V8KA 5IHKA 2QASA 4KBMB 4C92D 4KT0E 1PSEA 2DNUA 2ARUA 4J9CA 1T0JA 4ZIBA 1J5WA 4LDVA 1OOTA 1KK7A 1D3BB 2EPDA 1N8RU 4HWRA 5EG2A 2F5TX 4FYWB 2DX1A 1HTTA 2PVGB 1G5VA 3X20B 2EYXA 2CZ1B 5FRNA 3QZ5B 2CSQA 4OMNA 4O6JA 2CYZB 1Q7YR 4TTVA 1FYNA 3CCLQ 1UJ0A 2XICA 4C8QG 1S72A 1IRXA 3PMTA 2I2LA 2DL8A 3HFNA 2W10A 3E1SA 4C0DB 1WHLA 1Y57A 3EFOB 1UECA 4JJNK 1VQOA 3QO7A 4H2WA 1YFTA 1BCMA 2RHQB 5KCOA 3LWIA 3CC4Q 3JCMQ 1BI1A 4ATOA 1PG5B 3EFSA 3JCMc 2DL4A 2LCCA 5GMKh 1BBUA 4R55A 4E7IA 3M59A 1QLYA 1OV3A 2P4TA 3QUIA 2V8IA 3L4GB 2JNGA 2B8AA 4RKUE 4BACA 1VIFA 3HXVA 2KNBB 1ASYA 1X54A 3MHXA 2FEIA 4A63B 1YI2A 3OYFA 2BE9B 3OYDA 4P74C 2H8HA 1QVFS 1MMAA 4M7AC 4BD3A 2NUPB 1BBZA 2E12A 1IL2A 2O01E 1M30A 2DU5A 2ECZA 4C8QA 3MEUA 2MK5A 2KI7A 4HWPA 1G51A 2B86A 5KYUA 4CC3A 4NL3A 2HL3A 2DBMA 2MF2A 2E5AA 2AIRB 4ZTUB 1WHGA 4M75G 3META 1YITQ 2YUOA 3PCOB 1SF9A 1VQ9T 2KEAA 4PJOG 3RDVA 4ZGJB 3OYIA 4GLKA 5IAYA 2ZAEA 3PTAA 3HRKA 2X3WD 3HP9A 1M90U 3A5ZA 2EQIA 1WYDA 1VQNT 5HGQA 3NMZC 4JRPA 2OTLA 1E7OA 1G5IA 2CJBA 2IY5A 1PKTA 4YCVA 4LDUA 1JXOA 1YFSA 4RDXA 2LNHB 5GANd 4D8DA 3I56Q 1ZUUA 2DXTA 1UDLA 3QKJA 1JU5C 5LJ3g 3RBBB 2QHVA 2RMOA 1EZZB 1K73R 3I55A 2M0OA 4RTYA 1KOGA 5GANe 1JB0E 4M7AD 2AZSA 3OYHA 5CKEA 1BI3A 1TG0A 3UA7A 1H4TA 1U5SA 3EH2A 2ZT7A 1HXDA 3VV0A 4BI4A 1YGBA 3PT9A 4LUEA 3JCMh 1TH7A 4Y28E 2O31A 2XDBA 1M90R 3QG1A 4UP8A 3M0SA 5FWCA 1VYUA 2IIMA 4ELYC 1YWOA 2JTFA 3G71T 2LT4A 4JUVA 2IG0A 3EG3A 4E7HA 4N0AA 4OLFA 1QCFA 4X9DA 4DOWA 2ZR3A 3BDUA 4PJJA 1WU7A 4PJOA 2X4JA 4IUUA 4BI3A 3LSQA 2ED1A 2QHSA 4BW9A 1UHCA 2MYSA 1IHWA 1VQ8Q 4EO4A 4Z02A 5CVIA 3JCMe 2O9SA 1EVLA 2IY5B 2RQWA 1Y07A 4M4ZA 1KQSP 3VQYA 3OMGA 1BB9A 5CR2A 4BY6B 1LOJA 2FPEA 2H3EB 4PJMA 5LJ5d 2JMAA 5GAMd 1M27C 1ZA1B 1FXXA 1EFNA 3OS1A 5GJWB 1ACMB 2AK5A 1KC8C 2DQ0A 1VQ6Q 3OYNA 1VQLA 1B3QA 1PCXA 2JM9A 5FRMA 4J8OA 5D6YA 2FZCB 4TQDA 4VUBA 1SERA 2H3JA 2ROTA 4CS2A 3L2RA 5C0MA 1NJ5A 3QO8A 4WF2A 4LDXA 1X43A 3QWXX 1Y7XA 4XU0A 4ZGEB 4JS5A 2JTMA 3HRSA 4FCYA 2AT1B 1SRMA 2FVUA 1WDXA 1ZQ1A 1Z7MA 2LRQA 3EAEA 4CC4B 2E4HA 3OQ5A 4OB0B 2QAZA 1MNEA 2FRYA 1WX6A 2K57A 3VRZA 3CCJQ 5FU6C 4PK4A 3ZFJA 3GOXA 2CP3A 1M1GA 2KROA 1E24A 3I35A 3LWHA 1LCKA 1K8AU 4P72A 2KYMA 4FT4A 1M2OA 2QYZA 2P4RA 3CCLT 4FIBA 4HT8A 3I9QA 4TVRA 3GP8A 4YP0A 1G5HA 3CD6Q 4NS5A 2EGCA 2LQWA 1AWJA 1UGSB 1X27A 5FU6B 4LDWA 2D1XA 1KMMA 4M78G 2FRWA 1AT1B 4OB1B 1Z9QA 2RN8A 4PHCA 5DY9A 1K4US 2CKKA 3CC4T 1V1CA 4FM4B 2HZYA 1KQ2A 3T9NA 2NLUA 3UA6A 1KQ1A 3HXYA 2ODRC 1AD5A 2CS7A 3VRYA 2P0KA 3IALA 2EYQA 4DBFA 3HL8A 4YRRA 2DERA 2D9TA 2DEQA 3JCMg 5CKHA 5J39A 2ZXFA 2QHTA 1Q95G 2E10A 3OW2A 3TQ7P 2AKWB 3G4ST 1K8AR 4XAXB 2HQHA 1G2BA 4NL2A 3G7ZA 3A7RA 4YRSA 4D6WA 4HKEA 3CCSA 4XK8E 2MI6A 4X5OA 1WA7A 2E41A 2EQMA 1WJQA 5KNNA 2X4XA 1I8FA 2GGRA 2A3LA 1BU1A 2CDTA 2LC4A 5KE3A 2I4NA 1VA7A 1QMCA 3WVEB 3CPFA 4YRCA 2KSSA 1NZ9A 2RD1A 2QI2A 1M3BA 4XQ3A 5GAN8 1IGUA 1QVPA 1YJ9A 4MDXA 4MMKA 1K0XA 2BE7D 4EMGA 4M78A 2GF7A 2RJEA 2ZZGA 1YITT 3EGXA 5AYFA 5HKCA 4P73A 3KUFA 4XTVA 4C0GA 3L2ZA 2ODRD 2YXYA 2GQVA 4YDQA 2HDAA 4Y91A 4C5EA 5IHIA 4EMKA 5L8RE 1D1AA 2J3MA 3VUBA 2ZCEA 2RK1A 2RI3A 1I0CA 1VQ4A 2DXBA 2HAXA 3CCMA 4RTXA 2M16A 2QK0A 3I56T 2M9UA 4OMOA 1IXDA 2ZPHB 1Q81C 2YRDA 3EGDB 3X28B 4QQ6A 3FC3A 4RQFA 1MMNA 4OMFB 1UFFA 2DTHA 2EIFA 3KBGA 2QGFB 1AHJB 5IH2A 2CSIA 3NENA 4JRQA 4QW2A 3JCMb 3CMAA 2DPPB 1B7YB 1GBQA 5DLOA 2G3RA 3OS5A 3DSQA 1KD1C 5HY6A 1I5LA 1PRMC 2AHJB 4IURA 4BI8B 1YCYA 3M57A 1ARKA 1GFDA 3N5BB 2MMPA 3NTIA 3VQVA 2HMAA 5FU7B 5CK9A 4G85A 1BI2A 1K0SA 2G4CA 4M77A 1A0NB 1KMNA 3DLLA 2KT1A 3TEGA 2GTOA 4C0FA 2EYZA 4XTUA 3OSVA 3OYKA 3JB9J 4PNOA 4KUDK 4C92G 1D1CA 2CH4A 1GXIE 3JB9G 1WNLA 4KGVB 5I2MA 4CS3A 5J3BA 4CC7A 1YCSB 1QVFP 4Q6GA 1VQ8T 2QG9B 3L42A 5IXFA 3FIFA 1VQKQ 2ALYA 3OYLA 1X55A 4RQEA 2KGTA 3EG1A 4M7DA 6AT1B 1TXQA 2K3BA 1VQLQ 1W70A 1KG1A 4P5NA 2F2XA 3ER0A 2MAMA 4QVDA 2PU9B 2NS6A 4A4EA 3SEMA 3H6ZA 3QXEB 1VQ6T 1K9AA 2XK0A 5I22A 4R56A 1RL2A 2WACA 4FW2A 4AFUC 2R58A 1PD0A 4H02A 2VUBA 2NUTA 2JOYA 1MV0B 2YHTA 1T3LA 2EVRA 2VXFA 2QA4A 3E9GA 1AWXA 2LX9A 4GBQA 1ZLMA 4M77B 3FDRA 5KYNA 3QDRB 4C92A 1IB8A 2K4YA 4FYXB 1K76A 2LJ3A 4MZPA 4H2YA 1RACB 1ZX6A 4FW1A 4A4FA 3CCJT 2FHDA 4MMLA 3CCUQ 1WZOA 1X6OA 2CP5A 3VS1A 4FYVB 4J9FA 2DFUA 2DK3A 1OZ3A 2NYSA 3MEWA 3V7SA 2QTXA 1N27A 2RO0A 1Q82R 4KULA 1H8KA 3L2VA 3MF1A 1XNIA 4M7DB 2KDSA 3BFMA 3VS6A 3CC7A 3L2UA 2ROLA 1TUCA 1MMGA 5GAMf 1UG1A 3CD6T 3PGGA 2RQRA 4Z8AA 1FMVA 4OGCA 4IUQA 3NHNA 3KFUA 5C51B 2R5MA 4EPCA 4HCBA 2QDYB 1IO6A 3LLRA 1OU8A 2Q7HA 3MF2A 3H8ZA 2EKOA 3EG9A 2E5KA 2C06A 3JAME 3EHQA 3RIRA 1BCOA 5EC7A 1NNHA 1S1NA 4MZMA 4RG2A 2JT4A 2E65A 3M0TA 4J6WA 2MCNA 3CCEA 2HCKA 2F1LA 1E6HA 1LNXA 4LVLA 1BI0A 5GAOl 1NYGA 3PVQA 4YRJA 1YJWQ 3REXA 5KYWB 5GMKj 3PE0A 4JS4A 4F16A 3F70A 5C6SA 2D8JA 3CCRA 2RI5A 4RTUA 2DJQA 2L2PA 2OI3A 1VQPQ 2EYWA 5F5WA 2JVVA 1W2BP 4HCCA 4N4HA 1WI7A 4M7AG 2ZINA 1ZSZB 3RR6A 4GY5A 5A0GA 1TS9A 4CH6A 1P92A 5D6WA 3OYAA 1VQ7A 2KQWA 1GL5A 3SWNA 4F14A 4ME7A 2FG0A 1CKAA 1Y0MA 4C0DC 2L5QA 5LJ3d 3L2WA 2PMFA 4PG3A 2YUQA 4H2XA 2OAWA 1RLPC 2PZ1A 4HA8A 4N4IA 5LJ3e 1YFNA 1VOMA 4PLLA 1N9SA 5IN1A 4JRIA 4J5YA 1AVZC 3RMQA 2Y4XA 4E7LA 1JJCA 4B9XA 3OBYA 3S3NA 2ENMA 1B34A 1G8XA 3VYGA 4JJBA 2M51A 1KIKA 1OYXA 4V2SA 1D0XA 1B70A 4YRNA 5ELOA 2COZA 1ZBXA 4A4KA 5DLQE 2E3CA 1N8RR 2ZPIB 1QQJA 2WSCE 3OS0A 4P74A 1D1BA 3CMEA 2HEQA 4M7AA 3X24B 3ULRB 1C6VX 1NPPA 3CBMA 1C1AA 1QW1A 2OTJA 3VS3A 2PTKA 1W2BA 3OMCA 1YHQA 2K79A 3NTHA 3VS7A 2WSFE 1M2VA 5CO7A 3RESA 4JDSA 3SFMA 2ZIOA 4FT2A 1WLPB 3G6EA 3CCQA 2VGMA 2DILA 4BE1A 3CCVA 4QQGA 4E7ZA 5GMKe 3AT1B 2ZNIA 4M77E 3BE3A 4BDYA 1UGRB 4J83A 1QE0A 1QCOA 1YIJA 4XEMA 1BIBA 1W6XA 1GRIA 3P8BB 1PYSA 2C0TA 1PRLC 3M54A 1WXTA 1NLPC 1VQKT 1H4VB 3TREA 4AFQC 2BTTA 4CH3A 4DBRA 1NEBA 2EKHA 5FLXE 1VQMQ 2X9HA 1GGMA 1MMDA 1W66A 5J26A 5KYXA 1SRLA 4R0KA 2XG8D 1VQ5Q 4JZ3A 4M7DE 3WXMB 3RL6A 2X4WA 1B70B 1K9MC 4UC4A 4FL6A 2J06A 3RNJA 1U06A 1UJYA 4DBQA 3TUPA 2X35A 1X01A 5GAN3 1GCQC 1UGVA 2RK2A 3E19A 1TU0B 4QT7A 4XTXA 1JJ2P 1WXUA 2DDZA 4AFZC 4M78F 1PHTA 1M2VB 3UT1A 3CC2Q 3OA6A 2KT8A 1OULA 1HYOA 2DLPA 2FZGB 2KBTA 1AEYA 4F17A 2YLBA 2EGEA 2QEXQ 1OX9A 4ANJA 3MQZA 1D0ZA 1TUGB 4IIOA 3VJPA 1T3SA 1AWOA 1YNZA 4C8QB 3CCUT 2ZNJA 2EJ9A 4AMCA 2RHSA 2RJDA 5KYUB 1NJIC 1PYSB 2E1HA 1PWTA 1RAFB 1HC7A 3CXCP 1UHFA 1WHHA 5CKBA 4M75A 3BJUA 3OYYA 4J6XA 3OYCA 3JCMd 3LYIA 4AG1C 1Q86C 2C0IA 1O75A 2RHUA 4BY6C 1B7TA 1AZEA 1RAEB 3A5ZB 3RKWA 3CBPA 4P71A 1I1JA 2E64A 3MO8A 2O4XA 3V7CA 3VUZA 3ERRA 2BKDN 1WQ7A 4XU1A 3H0IA 4JJCA 1YJNQ 2AMCA 4L59A 2ZPFB 1UUEA 3C12A 9ATCB 4OGEA 4M77F 2MWPA 3MEAA 2KRSA 4LD6A 1JJ2A 3CCRQ 3H0HA 5GAMh 1N9WA 1R0CB 1SG5A 2CIMA 1RAAB 1SHGA 4LNSA 1TSFA 3E2UA 1YJWT 1W2BS 1PC0A 2HSEB 4N0AC 3KXTA 3HFVA 3QHSA 4KRTA 4LE9A 4J7IA 1M1KC 2LCSA 3JB9I 3OW2P 5KH6A 2WSEE 1VQPT 5FW9A 4M7DF 1USYC 3HFZA 3Q1JA 2GQIA 2KE9A 4ZTZB 1VQ9A 4M75B 2QQ9A 3CXCA 2K5FA 4UP9A 1BIAA 4PJOB 1VQNA 1OU9A 4AFSC 3EGUA 4PFPA 2FL7A 1S72Q 4CI0C 4KQEA 1WIEA 2RHYA 2A0FB 2C0OA 4RUGA 5DM7R 1JEGA 1C0MA 1UB4A 1VQOQ 3TCJA 1QP3A 2F2VA 2XI9A 3J7AF 3A32A 2FZKB 1X2QA 2AMCB 2CH4W 1B07A 3O8VA 2JS2A 4UPAA 2XHCA 1LVKA 2DL3A 2LTOA 4C5IA 4Z89A 1MGQA 1M1FA 4J9HA 1GCPA 3CMEQ 4DOVA 1RAIB 3ZEHA 1WPYA 2ZZDA 3HY1A 1EIYA 2PUOB 3WQZA 2OAUA 4J15A 2XTIA 3I7FA 2A36A 4QVZA 1YHQQ 4H2SA 2K3YA 3G71A 1YB3A 1WHMA 3H9NA 2I4OA 5IXBA 1ZUYA 3VYHB 1YI2Q 2LVMA 2RI2A 2EL9A 3M5AA 1SRYA 4H2UA 2EWNA 3P8YA 3LC0A 2JZ2A 4KGXB 3OY9A 3NEMA 4J6YA 3PMIA 3A74A 3TU4K 4XU2A 4WCIA 1YIJQ 1K9MU 3NTKA 1ATIA 2A37A 1G3WA 4XEOA 1LYLA 1TTHB 2HKQB 4EX5A 2K2MA 1SSHA 2D8HA 4GLMA 1XTDA 2E5QA 5I21A 3G1JA 2XMFA 2DL7A 4TVWA 2QQAA 4NOYA 5FWBA 3IG2A 2LJ0A 1G3YA 3RGLA 1JO8A 2LQKA 3JCMJ 1CKBA 4C8QE 2JUFA 4YRQA 2OTLQ 4OP0A 4OMQA 1YWPA 1IZ6A 1VQMT 4MZTA 2CP0A 4JLGA 3RERA 2P0LA 1KSWA 1VQ5T 3S3MA 1I07A 3EG0A 2LZ6B 5KYYA 5I2SA 2ZZFA 1FMWA 2DAQA 1JJ2S 5C53B 2J7IA 3DKMA 3I55Q 2EQJA 5LL6S 1Q7YC 1NJ8A 4X9CA 2A28A 3HXUA 2RB6A 4OVAA 4XTZA 4HWTA 3M53A 2EJFA 3QJ6A 3E9IA 1XQHA 3JCMX 5GAN2 5FU7C 1RAGB 3CC2T 1Y71A 3VQWA 4HVWA 3ICAA 2L3PA 4EIKA 1TUDA 2GBQA 3CCLA 2QEXT 2E6NA 4FYYB 3CXCS 2DXUA 1BBWA 4P73C 1Z7NA 2RPNA 2XD0A 4TVYA 4KH1B 3M0RA 2P0PA 3HTRA 2VB6A 4X1VA 1ZHIA 2DETA 1KC8U 2L0AA 1CSKA 3CC4A 1B76A 4M78B 4DEXA 5D7UA 1G83A 3EGXB 2I0NA 2AZVA 5IHNA 4E7KA 3UGTA 2KRNA 3X26B 3MPUB 4B9WA 2LDMA 4L5GA 3QIIA 1M8VA 4M75E 2L3QA 3SD4A 5GAN4 5KYYB 2YWWA 2DRMA 4EMKB 4PJOE 2BUDA 2O9VA 4HCKA 5CQXA 1WHJA 1VQZA 4PLIA 4BWAA 3VKIA 5GANf 3G4SA 1RABB 2E70A 4LNPA 2Q7GA 1JQQA 1RI9A 1YJNT 4YCUA 2EGAA 2CZ7B 1ASZA 2K9GA 1M4ZA 2BIVA 2CT3A 5CIUA 2RF0A 3GPLA 1NLOC 2GFAA 2G6FX 3HRUA 5A0LA 1Y96A 1WYXA 1SKUB 3BDLA 1O9SA 2BZYA 2PVOB 4M78D 3OW2S 1SPKA 2PQWA 2RQVA 4M77C 4P75A 1KC8R 2J6FA 1KHCA 3VQXA 2JMCA 4C8QF 2CT4A 1XOVA 1VQ9Q 4C0ZA 2QHUA 2KR3A 1NYQA 4F7UG 1VUBA 4BB7A 1X2HA 2RH2A 2LMJA 2RJFA 1QVGP 3MP6A 1H92A 1N5ZA 2LNVA 2KMTA 4ZNXA 4KR2A 11ASA 3IKLA 1X2KA 1UGQB 3GF5A 4HVCA 1L0WA 1YITA 4EDUA 1SETA 4YCWA 4IUPA 4IUTA 2DE0X 3UH0A 1RIQA 4M7DC 3REBB 3I5SA 4ZTFA 3R6OA 1K73C 1EVKA 1X56A 4F04B 2EJGA 1S72T 1U1TA 2QQBA 5CKFA 3FLGA 4TVAA 2DZ9A 3MP8A 3I56A 1VQOT 4ZTJA 1R0BG 3MP1A 4YPFA 1WXBA 2ALYB 1MUZA 2K5IA 2M1HA 1M90C 5LJ5f 1Z9ZA 1U3OA 3IKMB 4J7FA 4M77D 2A8EA 2DIQA 2X3XD 4OMPA 3W3SA 4E51A 4YRIA 2CP7A 3GLXA 2RHXA 1OI1A 2HQXA 1D3BA 2NUTB 3UWNA 1OEBA 3OBWA 4E7SA 3URGA 4F7UA 2ZPEB 4DBHA 2CGHA 4LD9K 3CCSQ 5GMKi 4M75F 3RKXA 1VIEA 3JSCA 3HKSA 1M3CA 1YI2T 1SHFA 1QVGA 4PJOF 1ZSZC 4M7DD 4LVMA 4J9GA 1QP2A 1OQKA 4ZGDB 4RTVA 5GAOm 1JBMA 3X25B 4A54A 2Y90A 4E6RA 2DBKA 4C92B 2DIGA 1H3HA 2ZT8A 4E7JA 1VQ8A 2MIOA 1NG2A 3HFOA 3P8TA 3RACA 1MV3A 2DZCA 5GMKl 2RHQA 1UE9A 2JW4A 5K1XA 1YJ9Q 3OB9A 4TVAB 2CJ9A 1Q7YU 3QO5A 2CZ6B 1YP5A 2P5IA 2YUPA 2ZPGB 1SEMA 1TOVA 3NFCA 8AT1B 3GNFB 1Q81U 1GFCA 5D6XA 3PFSA 1FX7A 4H2TA 1KHIA 1U1SA 1X75C 4LN2A 2HBPA 1VQ6A 2VC8A 3OYMA 4RMFA 4K87A 3M55A 2CJAA 2OTLT 1VQ4Q 3CCMQ 3RKYA 2ZT5A 4KR3A 3JV3A 3L4GA 4LVKA 4HWSA 2V8JA 3EG9B 3S6WA 3JB9D 2EW3A 1KD1U 4M78E 1M8MA 4HVUA 3HHTB 4ZN1A 4ELZC 3CPWA 3EG2A 4JLIA 4F7UB 4BE0A 4LUDA 3I55T 4PJLA 3HXWA 4QQDA 4YRKA 2NUPA 8ATCB 4MDWA 4RTTA 2KVQG 3CMAQ 2Z0WA 4PKCC 1H4SA 4HT4A 3I5RA 1NE8A 3NPFA 1G3SA 2XIDA 2Q5IA 3CCJA 4FSSA 1Q81R 5FROA 4WJ3M 3SWNC 5HK0A 3UPUA 2ABLA 5GANj 2FO0A 3VU3C 1D09B 3PVLA 3ZBDA 1QCNA 2M0YA 3PCOA 3QBYA 3TSWA 4CC2A 1KJWA 1UEBA 2D0QB 3TVTA 4CRIA 3CD6A 4BE2A 1KD1R 2VKNA 4Q15A 1NM7A 1NJ2A 2QXFA 1I5OB 4H2VA 4LDYA 4O2DA 1NYFA 3SWNB 4BUGA 2EQKA 4CH4A 1K8AC 3REUA 1ZSGA 5KCHA 2E3IA 3G4SQ 1NPRA 3DB4A 2MPXC 4RG8A 4H2XB 4QKUA 1YFRA 4O5VA 3ME9A 2COYA 4Z88A 5GAN6 2KXCA 3AHUA 2A08A 2ARSA 1GCQA 4A4GA 4YREA 2K3XA 1X2GA 1VQLT 4JJDA 4J9DA 1JJCB 2VVKA 5GAOr 1B34B 4KH0B 1ADYA 1RI0A 3SB2A 2HQEA 3DB3A 2JXBA 1K73U 3INZA 2CZ0B 3CEYA 2KXDA 3NGPA 3TSZA 1OPKA 1QVGS 1ABQA 2QA4Q 2J3LA 4YRTA 2LQNA 2ZR2A 4M7AB 4G84A 3OSSC 2IPOB 3A7UA 2JM8A 1X6GA 2X51A 3GIBA 5LJ5j 5GAMj 5GANh 2CUDA 4K88A 2PNIA 2QGGA 3EFRA 4IIMA 2MOXA 5AT1B 1DJ7B 4C8QC 3KFVA 5GAOp 3UGQA 2V26A 3CBOA 2RA2A 4AG2C 2Q7EA 3O5ZA 2PMEA 3G1ZA 3S3OA 2YSQA 1WLEA 2VGNA 2A7YA 2XGTA 1F1BB 3IQLA 12ASA 4A4HA 3QJYA 2DMOA 3V8JA 2JN0A 3CC7Q 2DA9A 2ESWA 3A8MB 4YRGA 1QKWA 1SSFA 4C92E 2F2WA 1RLQC 3LGLA 2XDPA 1NJ6A 2GTJA 3P8DA 2F69A 3M4GA 5GAOn 2M02A 3PNWC 1PKSA 2DO3A 2VYTA 2DRKA 3UATA 1AZGB 1M9SA 1J3TA 1UGPB 2DD4A 3CPWS 4YTLA 5KYXB 4PFZA 3OYGA 4RCBA 1HJDA 3GNGA 4YRMA 2FPDA 3VS2A
chains in the Genus database with same CATH topology
3HXXA 1E22A 2X4YA 2PUKB 2ZIMA 1WJRA 4C8QD 3LW5E 3CMQA 3V8LA 3UFGA 3CCST 1USYA 2R5AA 4YROA 5LJ5h 4LVIA 4WJ4A 3J80E 5CCAA 4F7UE 1SESA 4YRFA 2EAYA 2ARTA 4M75C 3RUXA 5E3IA 4PJOC 2VV5A 1YBYA 4OF1A 1I81A 1VQKA 2DD5A 3WVDB 1YJ9T 2D6FA 2RHSB 3JCMV 2KAFA 4P71C 2KK4A 5LJ5e 5GAMe 4YRLA 2R57A 2XDDA 4K86A 2QQSA 3VBBA 2YRVA 4YYEA 3JRZA 3MEVA 4HT9A 2L3RA 2AKWA 4L87A 1VQ4T 2I4LA 2L8DA 3NELA 3CCMT 1B8AA 3HRTA 2O4XB 3PIPA 3JCMW 5C52B 1M5Q1 5GANg 1FYFA 1QF6A 3OYJA 2DTIA 4XTYA 3FEOA 4LVJA 3A31A 1JRIA 2V8KA 3LGFA 4C92F 1Q82C 2K2VA 4M75D 3CMAT 3JB9F 4PJOD 3M56A 5GAOq 3C94A 2FB7A 1EQRA 3CCUA 2PVDB 5M9OA 1KQSA 3A8HB 5HK3A 1WJSA 3QZ9B 1G3TA 3BY7A 4L6V5 1NJ1A 2K5LA 5K1PA 4TWAA 2LT1A 3HPWA 3A8LB 5ELNA 4BDZA 3HFZB 4P72C 4II1A 5KE2A 4JRKA 4M7AE 1LJOA 4WI1A 1N6AA 3JB9H 2DXCA 4PL6A 4P3PA 5LJ3f 3QYGB 4DQ2A 3NETA 1BKBA 3OS2A 4DPGA 2C8MA 2RHZA 1EIFA 3A7AA 2GFUA 3V7RA 4F7UF 3LH0A 4DA4A 2HD0A 2RHIA 3M4QA 3J81E 2EQUA 3JCMP 3SDZA 2MWOA 5A2QE 4C5GA 1B7YA 2LQ8A 2QQRA 2HNIA 1YJWA 3PZCA 5LJ5g 5GAMg 1W4SA 2DVEA 4CH5A 3BW1A 1EIYB 4QVCA 3HSBA 1VQPA 3QTCA 5IT9E 4M77G 4P3OA 2QA4T 1NJIU 1E1OA 1WGSA 3LSSA 5A0DA 2XU8A 3A8OB 3FRNA 3DLMA 2KY9A 2XKOC 1Q86U 4KUIA 3OD1A 1H3ZA 1H641 3HTZA 4M78C 4M7DG 3QPHA 2RM4A 3E9HA 3RMSA 3CC7T 2EFIA 1N8RC 2Q5HA 1PSFA 4EMKC 4RMOA 4XTWA 4AH6A 3QNEA 5CQYA 3OYBA 1M1KU 1HK9A 2ZT6A 4M7AF 3RF1A 5CAIA 4A53A 3M4YA 2Y4YA 1OZ2A 1R8OB 4OB2B 4EMHA 3CCET 4HWOA 2F5KA 3M9QA 3TEHA 1KQSS 1U8RA 2YLCA 3CCRT 4TQFA 5GAN5 3A8GB 3UDCA 2DTOA 2ZGWA 3P8HA 3QYHB 3MEYA 2LCLA 2IVWA 4FU6A 3PIOA 5GAN7 3A5YA 1EFWA 3QO3A 1VQ7T 4RCCA 1NYRA 3MCAB 2P0QA 3OYEA 4P3NA 1VQMA 1Q82U 2DKGA 3JCMf 1VQ5A 2FYKA 3L1AA 3M58A 2ZTGA 3C4SA 1ADJA 4E47A 3E9FA 4UP7A 4N4GA 4OB3B 1WQWA 3FJPA 2ZCFB 1E1TA 2L89A 2GCXA 3LX7A 4NCXA 4IKFA 4P75C 2C7IA 3HRIA 3TEHB 3FB9A 5LJ3j 1MHNA 3CC2A 3TEEA 1C0AA 1Y96B 1N9RA 2VXEA 2E6ZA 3CMET 2QEXA 3C95A 3L2QA 1QVFA 2OTJT 4C92C 4X34A 3R07A 1YHQT 4YRPA 4CS4A 4Q5WA 1FWZA 3HXZA 3P8VA 3ASKA 1H4QA 2DJZA 5CKDA 3HY0A 3M4PA 4XU3A 3G6ET 2ZPBB 4C5HA 1IREB 2RJCA 3CCQT 2I4MA 3CCVT 1BYMA 1V29B 2DQ3A 1YIJT 3QSUA 1I4K1 5GMKm 2DU7A 4IUVA 1YJNA 4ZN3A 4HCZA 4FSXA 2ZZEA 1EOVA 5LJ3h 3V8KA 4KBMB 4C92D 4KT0E 1PSEA 2ARUA 4ZIBA 1J5WA 4LDVA 1D3BB 1N8RU 4HWRA 5EG2A 2F5TX 1HTTA 2PVGB 1G5VA 3X20B 2CZ1B 5FRNA 3QZ5B 4O6JA 2CYZB 4TTVA 2XICA 4C8QG 1S72A 3PMTA 2I2LA 3HFNA 3E1SA 4C0DB 4JJNK 1VQOA 3QO7A 4H2WA 1YFTA 2RHQB 5KCOA 3LWIA 3JCMQ 1BI1A 4ATOA 3EFSA 3JCMc 2LCCA 5GMKh 1BBUA 4R55A 4E7IA 3M59A 2P4TA 3QUIA 2V8IA 3L4GB 2JNGA 2B8AA 4RKUE 4BACA 1VIFA 3HXVA 1ASYA 1X54A 3MHXA 1YI2A 3OYFA 3OYDA 4P74C 1QVFS 4M7AC 4BD3A 2E12A 1IL2A 2O01E 2DU5A 4C8QA 3MEUA 4HWPA 1G51A 4NL3A 2MF2A 2E5AA 4ZTUB 4M75G 3META 3PCOB 1VQ9T 4PJOG 4ZGJB 3OYIA 4GLKA 5IAYA 3PTAA 3HRKA 3HP9A 1M90U 3A5ZA 1WYDA 1VQNT 5HGQA 4JRPA 2OTLA 1G5IA 2CJBA 2IY5A 4YCVA 4LDUA 1YFSA 4RDXA 5GANd 2DXTA 3QKJA 5LJ3g 2QHVA 3I55A 2M0OA 1KOGA 5GANe 1JB0E 4M7AD 3OYHA 5CKEA 1BI3A 1H4TA 2ZT7A 1HXDA 3VV0A 4BI4A 1YGBA 3PT9A 3JCMh 1TH7A 4Y28E 2XDBA 4UP8A 3QG1A 4ELYC 2JTFA 3G71T 2LT4A 4JUVA 2IG0A 4E7HA 4N0AA 4OLFA 4X9DA 4DOWA 2ZR3A 3BDUA 1WU7A 4PJOA 2X4JA 4IUUA 4BI3A 3LSQA 2QHSA 4BW9A 4EO4A 4Z02A 5CVIA 3JCMe 1EVLA 2IY5B 1Y07A 3VQYA 3OMGA 5CR2A 4BY6B 1LOJA 5LJ5d 5GAMd 1FXXA 3OS1A 1KC8C 2DQ0A 3OYNA 1VQLA 5FRMA 4J8OA 5D6YA 4TQDA 4VUBA 1SERA 2H3JA 4CS2A 3L2RA 5C0MA 1NJ5A 3QO8A 4WF2A 4LDXA 1Y7XA 4XU0A 4ZGEB 4JS5A 2JTMA 3HRSA 2FVUA 1ZQ1A 1Z7MA 2LRQA 3EAEA 3OQ5A 4OB0B 2K57A 5FU6C 3ZFJA 3GOXA 1M1GA 1E24A 3LWHA 1K8AU 4P72A 4FT4A 3CCLT 4FIBA 4HT8A 4TVRA 3GP8A 4YP0A 1G5HA 4NS5A 1UGSB 5FU6B 4LDWA 1KMMA 4M78G 4OB1B 4PHCA 5DY9A 2CKKA 3CC4T 4FM4B 1KQ2A 3T9NA 2NLUA 1KQ1A 3HXYA 2ODRC 2CS7A 3IALA 2P0KA 2EYQA 3HL8A 4YRRA 2D9TA 2DEQA 3JCMg 5CKHA 5J39A 2ZXFA 2QHTA 2E10A 3OW2A 2AKWB 3G4ST 4XAXB 3A7RA 4NL2A 3G7ZA 4YRSA 4D6WA 4HKEA 3CCSA 4XK8E 2MI6A 4X5OA 2E41A 2EQMA 1WJQA 5KNNA 2X4XA 1I8FA 2A3LA 2LC4A 5KE3A 2I4NA 3WVEB 3CPFA 4YRCA 2KSSA 1NZ9A 2RD1A 2QI2A 4XQ3A 5GAN8 1QVPA 1YJ9A 4MDXA 4MMKA 4EMGA 4M78A 2GF7A 2RJEA 2ZZGA 1YITT 5AYFA 5HKCA 4P73A 3KUFA 4XTVA 4C0GA 3L2ZA 2ODRD 4YDQA 2GQVA 4Y91A 4C5EA 4EMKA 5L8RE 2J3MA 3VUBA 2ZCEA 2RK1A 2RI3A 1VQ4A 2DXBA 2HAXA 3CCMA 2M16A 3I56T 2M9UA 2ZPHB 1Q81C 3X28B 4QQ6A 3FC3A 4RQFA 4OMFB 2DTHA 2EIFA 3KBGA 1AHJB 3NENA 4JRQA 4QW2A 3JCMb 3CMAA 2DPPB 1B7YB 5DLOA 2G3RA 3OS5A 3DSQA 1KD1C 5HY6A 1I5LA 2AHJB 4IURA 4BI8B 1YCYA 3M57A 3N5BB 2MMPA 3NTIA 3VQVA 5FU7B 5CK9A 4G85A 1BI2A 2G4CA 4M77A 1KMNA 3DLLA 3TEGA 4C0FA 4XTUA 3OSVA 3OYKA 3JB9J 4PNOA 4KUDK 4C92G 1GXIE 3JB9G 1WNLA 5I2MA 4CS3A 5J3BA 4Q6GA 1VQ8T 3L42A 3FIFA 2ALYA 3OYLA 1X55A 4RQEA 4M7DA 1KG1A 4P5NA 3ER0A 2MAMA 4QVDA 2PU9B 2NS6A 4A4EA 3H6ZA 3QXEB 1VQ6T 2XK0A 4R56A 1RL2A 2WACA 2R58A 4H02A 2VUBA 2JOYA 2YHTA 2VXFA 2QA4A 3E9GA 2LX9A 4M77B 3FDRA 3QDRB 4C92A 2K4YA 4MZPA 4H2YA 4A4FA 3CCJT 2FHDA 4MMLA 1X6OA 2DK3A 1OZ3A 3MEWA 3V7SA 2QTXA 1N27A 2RO0A 4KULA 3L2VA 3MF1A 1XNIA 4M7DB 2KDSA 3BFMA 3CC7A 3L2UA 5GAMf 3CD6T 3PGGA 4OGCA 4IUQA 3KFUA 5C51B 2R5MA 4EPCA 4HCBA 2QDYB 3LLRA 2Q7HA 3MF2A 3H8ZA 2EKOA 2C06A 3JAME 3RIRA 1NNHA 4MZMA 4RG2A 2E65A 4J6WA 3CCEA 1LNXA 4LVLA 1BI0A 5GAOl 4YRJA 3REXA 5GMKj 4JS4A 3F70A 5C6SA 3CCRA 2RI5A 5F5WA 2JVVA 4HCCA 2ZINA 4N4HA 4M7AG 4GY5A 5A0GA 4CH6A 1P92A 5D6WA 3OYAA 1VQ7A 2KQWA 3SWNA 4ME7A 4C0DC 2L5QA 5LJ3d 3L2WA 2PMFA 4PG3A 4H2XA 4HA8A 4N4IA 5LJ3e 4PLLA 1N9SA 5IN1A 4JRIA 4J5YA 3RMQA 2Y4XA 4E7LA 1JJCA 4B9XA 3OBYA 3S3NA 1B34A 3VYGA 1OYXA 4V2SA 1B70A 4YRNA 5ELOA 1ZBXA 4A4KA 5DLQE 2E3CA 2ZPIB 2WSCE 3OS0A 4P74A 3CMEA 4M7AA 3X24B 1NPPA 3CBMA 1QW1A 2OTJA 1W2BA 3OMCA 1YHQA 3NTHA 2WSFE 5CO7A 3RESA 4JDSA 3SFMA 2ZIOA 4FT2A 3G6EA 3CCQA 2VGMA 4BE1A 3CCVA 4QQGA 5GMKe 2ZNIA 4M77E 4BDYA 1UGRB 1QE0A 4J83A 1YIJA 4XEMA 1BIBA 3P8BB 1PYSA 3M54A 1VQKT 1H4VB 3TREA 4CH3A 5FLXE 1GGMA 1W66A 5J26A 2XG8D 4M7DE 3WXMB 3RL6A 2X4WA 1B70B 1K9MC 4UC4A 4FL6A 3TUPA 2X35A 1X01A 5GAN3 2RK2A 3E19A 4XTXA 2DDZA 4M78F 3UT1A 3OA6A 2YLBA 3MQZA 3VJPA 4C8QB 3CCUT 2ZNJA 2EJ9A 2RHSA 2RJDA 1NJIC 1PYSB 2E1HA 1HC7A 5CKBA 4M75A 3BJUA 3OYYA 4J6XA 3OYCA 3JCMd 3LYIA 1Q86C 1O75A 2RHUA 4BY6C 3A5ZB 3RKWA 3CBPA 4P71A 2E64A 3MO8A 2O4XA 3V7CA 3VUZA 3ERRA 2BKDN 1WQ7A 4XU1A 2AMCA 4L59A 2ZPFB 3C12A 4OGEA 4M77F 2MWPA 3MEAA 4LD6A 1JJ2A 5GAMh 1N9WA 2CIMA 4LNSA 1W2BS 1YJWT 4N0AC 3KXTA 3HFVA 3QHSA 4J7IA 1M1KC 3JB9I 5KH6A 2WSEE 1VQPT 4M7DF 1USYC 3HFZA 3Q1JA 4ZTZB 1VQ9A 4M75B 2QQ9A 3CXCA 2K5FA 4UP9A 1BIAA 4PJOB 1VQNA 2FL7A 4CI0C 4KQEA 2RHYA 5DM7R 1UB4A 3TCJA 1QP3A 2XI9A 3J7AF 3A32A 2AMCB 3O8VA 4UPAA 2XHCA 2LTOA 4C5IA 1MGQA 1M1FA 4DOVA 3ZEHA 1WPYA 2ZZDA 3HY1A 1EIYA 2PUOB 3WQZA 2OAUA 4J15A 2XTIA 3I7FA 4QVZA 4H2SA 2K3YA 3G71A 1YB3A 2I4OA 3VYHB 2LVMA 2EL9A 2RI2A 3M5AA 1SRYA 4H2UA 2EWNA 3P8YA 3LC0A 2JZ2A 3OY9A 3NEMA 4J6YA 3PMIA 3A74A 3TU4K 4XU2A 1K9MU 3NTKA 1ATIA 1G3WA 4XEOA 1LYLA 4EX5A 1XTDA 2E5QA 5I21A 4TVWA 2QQAA 4NOYA 3IG2A 1G3YA 3RGLA 2LQKA 3JCMJ 4C8QE 2JUFA 4YRQA 4OP0A 1IZ6A 1VQMT 4MZTA 4JLGA 3RERA 2P0LA 1VQ5T 3S3MA 5I2SA 2ZZFA 2DAQA 1JJ2S 5C53B 3DKMA 2EQJA 5LL6S 1Q7YC 1NJ8A 4X9CA 3HXUA 2RB6A 4OVAA 4XTZA 4HWTA 3M53A 2EJFA 3QJ6A 3E9IA 1XQHA 3JCMX 5GAN2 5FU7C 3CC2T 1Y71A 3VQWA 3ICAA 3CCLA 2QEXT 2E6NA 3CXCS 2DXUA 1BBWA 4P73C 1Z7NA 2XD0A 4TVYA 2P0PA 1ZHIA 1KC8U 3CC4A 1B76A 4M78B 4E7KA 3UGTA 3X26B 4B9WA 2LDMA 4L5GA 3QIIA 1M8VA 4M75E 3SD4A 5GAN4 4EMKB 4PJOE 2BUDA 5CQXA 1VQZA 4PLIA 4BWAA 3VKIA 5GANf 3G4SA 2E70A 2Q7GA 1YJNT 4YCUA 1ASZA 2CZ7B 1M4ZA 2BIVA 5CIUA 3GPLA 2GFAA 3HRUA 5A0LA 1Y96A 3BDLA 1O9SA 2PVOB 4M78D 3OW2S 2PQWA 4M77C 4P75A 1KHCA 3VQXA 4C8QF 1XOVA 4C0ZA 2QHUA 1NYQA 4F7UG 1VUBA 4BB7A 1X2HA 2RH2A 2RJFA 3MP6A 2LNVA 2KMTA 4KR2A 11ASA 3IKLA 3GF5A 1UGQB 4HVCA 1L0WA 1YITA 4EDUA 1SETA 4YCWA 4IUPA 4IUTA 3UH0A 1RIQA 4M7DC 4ZTFA 3R6OA 1K73C 1EVKA 1X56A 2EJGA 1S72T 1U1TA 2QQBA 5CKFA 3FLGA 4TVAA 2DZ9A 3MP8A 3I56A 1VQOT 4ZTJA 3MP1A 4YPFA 2ALYB 2K5IA 2M1HA 1M90C 5LJ5f 3IKMB 4J7FA 4M77D 2A8EA 2DIQA 3W3SA 4E51A 4YRIA 3GLXA 2RHXA 1OI1A 2HQXA 1D3BA 3UWNA 3OBWA 3URGA 4F7UA 2ZPEB 2CGHA 4LD9K 5GMKi 4M75F 3RKXA 1VIEA 3JSCA 3HKSA 1YI2T 1QVGA 4PJOF 4M7DD 4LVMA 1QP2A 4ZGDB 5GAOm 1JBMA 3X25B 4A54A 2Y90A 4C92B 2DIGA 2ZT8A 4E7JA 1VQ8A 3HFOA 3P8TA 3RACA 2DZCA 5GMKl 2RHQA 5K1XA 3OB9A 4TVAB 2CJ9A 1Q7YU 3QO5A 2CZ6B 2P5IA 2ZPGB 3NFCA 3GNFB 1Q81U 5D6XA 3PFSA 1FX7A 4H2TA 1KHIA 1U1SA 1X75C 2HBPA 1VQ6A 2VC8A 3OYMA 4RMFA 4K87A 3M55A 2CJAA 2OTLT 3RKYA 2ZT5A 4KR3A 3L4GA 4LVKA 4HWSA 2V8JA 3JB9D 3S6WA 1KD1U 4M78E 3HHTB 4ZN1A 4ELZC 3CPWA 4JLIA 4F7UB 4BE0A 3I55T 3HXWA 4QQDA 4YRKA 4MDWA 2KVQG 4PKCC 1H4SA 4HT4A 1NE8A 1G3SA 2XIDA 2Q5IA 3CCJA 5FROA 4WJ3M 3SWNC 5HK0A 3UPUA 5GANj 3VU3C 3ZBDA 3PCOA 3QBYA 1UEBA 2D0QB 4CRIA 3CD6A 4BE2A 4Q15A 1NJ2A 2QXFA 4H2VA 4LDYA 4O2DA 3SWNB 4BUGA 2EQKA 4CH4A 1K8AC 3REUA 5KCHA 1NPRA 3DB4A 4RG8A 4H2XB 1YFRA 4O5VA 3ME9A 5GAN6 3AHUA 2ARSA 4A4GA 4YREA 2K3XA 1X2GA 1VQLT 1JJCB 5GAOr 1B34B 1ADYA 1RI0A 3SB2A 2HQEA 3DB3A 1K73U 3INZA 2CZ0B 3CEYA 1QVGS 2J3LA 4YRTA 2ZR2A 4M7AB 4G84A 3OSSC 3A7UA 3GIBA 5LJ5j 5GAMj 5GANh 4K88A 3EFRA 1DJ7B 4C8QC 5GAOp 3UGQA 3CBOA 2RA2A 2Q7EA 2PMEA 3G1ZA 3S3OA 1WLEA 2VGNA 2A7YA 2XGTA 12ASA 4A4HA 3QJYA 3V8JA 2JN0A 3A8MB 4YRGA 1SSFA 4C92E 3LGLA 2XDPA 1NJ6A 3P8DA 2F69A 3M4GA 5GAOn 3PNWC 2DO3A 2VYTA 1M9SA 1UGPB 2DD4A 3CPWS 4YTLA 3OYGA 4RCBA 3GNGA 4YRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XEO A;  1LYL A;  3HXX A;  2I2L A;  1E22 A;  4EX5 A;  3HFN A;  2ZIM A;  2YHT A;  3QO7 A;  5I21 A;  4H2W A;  2VXF A;  1YFT A;  2RHQ B;  4TVW A;  4NOY A;  4C8Q D;  3IG2 A;  3RGL A;  3JCM Q;  4M77 B;  3JCM J;  3V8L A;  3CMQ A;  4C8Q E;  3UFG A;  1USY A;  3EFS A;  4YRQ A;  3JCM c;  4OP0 A;  4YRO A;  4C92 A;  5LJ5 h;  4WJ4 A;  4H2Y A;  4F7U E;  1SES A;  4YRF A;  3RER A;  2EAY A;  5GMK h;  1BBU A;  2P0L A;  4MML A;  2ART A;  4M75 C;  3RUX A;  2ZZF A;  5E3I A;  4PJO C;  3V7S A;  5C53 B;  3QUI A;  2QTX A;  3L4G B;  1I81 A;  1NJ8 A;  3MF1 A;  4M7D B;  3BFM A;  4X9C A;  3HXU A;  2RB6 A;  4XTZ A;  2RHS B;  3HXV A;  4HWT A;  1ASY A;  2EJF A;  3JCM V;  1X54 A;  5GAM f;  4P71 C;  3PGG A;  4P74 C;  3E9I A;  3JCM X;  5LJ5 e;  4YRL A;  5GAM e;  5GAN 2;  3KFU A;  4M7A C;  5C51 B;  4K86 A;  3VQW A;  3VBB A;  2Q7H A;  3MF2 A;  1IL2 A;  4YYE A;  2DU5 A;  3ICA A;  4C8Q A;  4HT9 A;  4HWP A;  1G51 A;  2AKW A;  4L87 A;  2I4L A;  3NEL A;  4NL3 A;  3RIR A;  1B8A A;  2DXU A;  1NNH A;  1BBW A;  4P73 C;  1Z7N A;  2E5A A;  4TVY A;  2E65 A;  4J6W A;  3JCM W;  4ZTU B;  4M75 G;  5C52 B;  1LNX A;  3PCO B;  4PJO G;  5GAO l;  1M5Q 1;  5GAN g;  1FYF A;  4YRJ A;  3HRK A;  1QF6 A;  3REX A;  2DTI A;  4XTY A;  5GMK j;  1B76 A;  4M78 B;  3A5Z A;  1WYD A;  3A31 A;  1JRI A;  4C92 F;  5HGQ A;  4M75 D;  3JB9 F;  1G5I A;  2CJB A;  2IY5 A;  3UGT A;  4YCV A;  4PJO D;  1M8V A;  1YFS A;  4M75 E;  5F5W A;  4RDX A;  5GAO q;  5GAN d;  5GAN 4;  2ZIN A;  4M7A G;  2FB7 A;  1EQR A;  4EMK B;  2DXT A;  4PJO E;  5LJ3 g;  1VQZ A;  4BWA A;  5GAN f;  2QHV A;  3BY7 A;  4CH6 A;  1NJ1 A;  2Q7G A;  5K1P A;  4TWA A;  1KOG A;  5ELN A;  5GAN e;  4YCU A;  1ASZ A;  3SWN A;  4M7A D;  3HFZ B;  4P72 C;  5LJ3 d;  1H4T A;  2PMF A;  1Y96 A;  4PG3 A;  2ZT7 A;  4JRK A;  4M7A E;  1LJO A;  1HXD A;  4WI1 A;  3JB9 H;  4M78 D;  1YGB A;  4P3P A;  5LJ3 f;  4DQ2 A;  4H2X A;  3NET A;  4P75 A;  4M77 C;  1TH7 A;  3JCM h;  4HA8 A;  3VQX A;  4C8Q F;  4UP8 A;  5LJ3 e;  4DPG A;  2C8M A;  3A7A A;  1N9S A;  4JRI A;  2QHU A;  3V7R A;  1NYQ A;  4JUV A;  4J5Y A;  4F7U F;  4F7U G;  1X2H A;  4N0A A;  4OLF A;  4X9D A;  1JJC A;  2ZR3 A;  3BDU A;  1WU7 A;  4PJO A;  3M4Q A;  4KR2 A;  3LSQ A;  11AS A;  3JCM P;  3IKL A;  4HVC A;  1L0W A;  1B34 A;  2QHS A;  1SET A;  4YCW A;  4BW9 A;  1B7Y A;  4YRM A;  4V2S A;  3UH0 A;  1B70 A;  4M7D C;  1RIQ A;  2HNI A;  4YRN A;  3PZC A;  5ELO A;  4EO4 A;  5LJ5 g;  5GAM g;  3JCM e;  2E3C A;  1EVL A;  1EVK A;  1X56 A;  4P74 A;  2IY5 B;  2EJG A;  1U1T A;  2DVE A;  4CH5 A;  3BW1 A;  1EIY B;  4QVC A;  3HSB A;  4M7A A;  4TVA A;  3VQY A;  2DZ9 A;  3QTC A;  1LOJ A;  4YPF A;  4M77 G;  5LJ5 d;  4P3O A;  5GAM d;  2ALY B;  1E1O A;  3RES A;  2ZIO A;  3LSS A;  2DQ0 A;  5LJ5 f;  3IKM B;  4M77 D;  4TQD A;  3OD1 A;  5GMK e;  1SER A;  2ZNI A;  3W3S A;  4M77 E;  4E51 A;  4YRI A;  4CS2 A;  1H64 1;  1QE0 A;  3HTZ A;  1NJ5 A;  3QO8 A;  4WF2 A;  4XEM A;  1BIB A;  4M78 C;  4M7D G;  1D3B A;  1PYS A;  2RM4 A;  4XU0 A;  4F7U A;  3E9H A;  2CGH A;  1H4V B;  2Q5H A;  5GMK i;  4M75 F;  4CH3 A;  3RKX A;  1Z7M A;  4EMK C;  1GGM A;  4PJO F;  4M7D D;  1W66 A;  2K57 A;  5GAO m;  4XTW A;  4AH6 A;  1JBM A;  4M7D E;  4A54 A;  2Y90 A;  3QNE A;  1E24 A;  3RL6 A;  1B70 B;  4C92 B;  2ZT8 A;  4P72 A;  3TUP A;  1X01 A;  5GAN 3;  3HFO A;  3P8T A;  1HK9 A;  4HT8 A;  3RAC A;  2DZC A;  5GMK l;  2RHQ A;  2ZT6 A;  4M7A F;  5K1X A;  3RF1 A;  5CAI A;  4A53 A;  4YP0 A;  4TVA B;  2CJ9 A;  3QO5 A;  1G5H A;  2P5I A;  4XTX A;  4EMH A;  4HWO A;  2DDZ A;  4M78 F;  1KMM A;  4M78 G;  3TEH A;  4PHC A;  5DY9 A;  4H2T A;  1U1S A;  2YLB A;  1KQ2 A;  2VC8 A;  4RMF A;  4K87 A;  2CJA A;  2YLC A;  1KQ1 A;  3HXY A;  2ODR C;  3IAL A;  4TQF A;  5GAN 5;  3RKY A;  2ZT5 A;  4KR3 A;  3L4G A;  2DTO A;  4YRR A;  2DEQ A;  3JCM g;  4HWS A;  3JB9 D;  2ZXF A;  2ZGW A;  4M78 E;  4C8Q B;  2QHT A;  2ZNJ A;  2EJ9 A;  2RHS A;  2E10 A;  3MEY A;  2AKW B;  1PYS B;  2E1H A;  4JLI A;  5GAN 7;  3A5Y A;  1EFW A;  3QO3 A;  4F7U B;  1HC7 A;  4NL2 A;  3A7R A;  4YRS A;  4M75 A;  4RCC A;  3BJU A;  3HXW A;  4J6X A;  1NYR A;  4YRK A;  3JCM d;  4P3N A;  4X5O A;  2E41 A;  1H4S A;  5KNN A;  2DKG A;  3JCM f;  1I8F A;  2Q5I A;  2FYK A;  3RKW A;  3L1A A;  4WJ3 M;  4P71 A;  2ZTG A;  3SWN C;  2I4N A;  1ADJ A;  2E64 A;  4UP7 A;  4YRC A;  5GAN j;  3V7C A;  3VU3 C;  3ERR A;  2RD1 A;  4XU1 A;  1WQ7 A;  1WQW A;  3FJP A;  4XQ3 A;  3PCO A;  2AMC A;  1E1T A;  5GAN 8;  4M77 F;  4MMK A;  4NCX A;  4P75 C;  4EMG A;  4M78 A;  4Q15 A;  1NJ2 A;  2C7I A;  4H2V A;  2ZZG A;  5GAM h;  1N9W A;  4O2D A;  4P73 A;  3HRI A;  3SWN B;  4XTV A;  3L2Z A;  3FB9 A;  5LJ3 j;  2ODR D;  3TEH B;  2CIM A;  4YDQ A;  4LNS A;  1C0A A;  4CH4 A;  4Y91 A;  4N0A C;  3HFV A;  1Y96 B;  3REU A;  4EMK A;  1N9R A;  3QHS A;  2VXE A;  2J3M A;  2ZCE A;  3JB9 I;  4H2X B;  1YFR A;  4M7D F;  1USY C;  5GAN 6;  4C92 C;  3HFZ A;  3R07 A;  3AHU A;  2ARS A;  4YRP A;  4CS4 A;  4ZTZ B;  3HXZ A;  3P8V A;  4YRE A;  4RQF A;  2DJZ A;  1H4Q A;  4M75 B;  1X2G A;  3HY0 A;  2DTH A;  4UP9 A;  1JJC B;  3M4P A;  1BIA A;  4XU3 A;  4PJO B;  3NEN A;  5GAO r;  1B34 B;  3JCM b;  2I4M A;  4KQE A;  1ADY A;  3SB2 A;  3INZ A;  1B7Y B;  3DSQ A;  1I5L A;  1YCY A;  2DQ3 A;  3QSU A;  2J3L A;  4YRT A;  3VQV A;  2ZR2 A;  4M7A B;  1I4K 1;  4G84 A;  3A32 A;  4G85 A;  5GMK m;  3A7U A;  2DU7 A;  3GIB A;  2AMC B;  5LJ5 j;  5GAM j;  5GAN h;  2G4C A;  4M77 A;  1KMN A;  4K88 A;  4UPA A;  3EFR A;  3TEG A;  4C8Q C;  4XTU A;  5GAO p;  1MGQ A;  3JB9 J;  4PNO A;  3UGQ A;  4C92 G;  3JB9 G;  1WNL A;  2RA2 A;  1WPY A;  3HY1 A;  1EIY A;  2Q7E A;  4CS3 A;  2PME A;  3WQZ A;  3G1Z A;  4J15 A;  2XTI A;  2ZZE A;  3I7F A;  1EOV A;  1WLE A;  4Q6G A;  5LJ3 h;  3V8K A;  2XGT A;  3FIF A;  4H2S A;  12AS A;  4C92 D;  3V8J A;  2ALY A;  1YB3 A;  2JN0 A;  2ARU A;  1X55 A;  4YRG A;  4RQE A;  4M7D A;  2I4O A;  4ZIB A;  1J5W A;  4C92 E;  1D3B B;  4HWR A;  1NJ6 A;  2EL9 A;  4QVD A;  1HTT A;  1SRY A;  3M4G A;  5GAO n;  4H2U A;  2EWN A;  3P8Y A;  3LC0 A;  3NEM A;  4J6Y A;  3A74 A;  4XU2 A;  4TTV A;  4RCB A;  1ATI A;  4H02 A;  4C8Q G; 
#chains in the Genus database with same CATH topology
 3HXX A;  1E22 A;  2X4Y A;  2PUK B;  2ZIM A;  1WJR A;  3CCE Q;  3H0F A;  4C8Q D;  3LW5 E;  3CMQ A;  3V8L A;  3UFG A;  2OJ2 A;  3CCS T;  1USY A;  2R5A A;  4YRO A;  1VYV A;  5LJ5 h;  1X69 A;  4LVI A;  4WJ4 A;  3J80 E;  5CCA A;  4F7U E;  1SES A;  4YRF A;  1X6B A;  2EAY A;  2ART A;  4M75 C;  3RUX A;  5E3I A;  1IGQ A;  4PJO C;  2VV5 A;  1YBY A;  4OF1 A;  1I81 A;  1VQ7 Q;  3U23 A;  1VQK A;  2DD5 A;  3WVD B;  1YJ9 T;  2D6F A;  2RHS B;  4RTW A;  1JXM A;  2BZ8 A;  3JCM V;  2KAF A;  4ESR A;  4P71 C;  2COW A;  2KK4 A;  5LJ5 e;  5GAM e;  4YRL A;  1PM3 A;  2R57 A;  2XDD A;  3QDF A;  4K86 A;  3REA B;  2QQS A;  3VBB A;  2YRV A;  4YYE A;  2CP6 A;  3JRZ A;  3MEV A;  4HT9 A;  4LXC A;  2L3R A;  2AKW A;  4L87 A;  1VQ4 T;  2I4L A;  2L8D A;  3NEL A;  3CCM T;  1B8A A;  1K1Z A;  1TWB A;  3HRT A;  2RQT A;  4J9E A;  2O4X B;  1IHV A;  3PIP A;  3JCM W;  2LP5 A;  2QTV A;  5C52 B;  1ZUK A;  1M5Q 1;  5GAN g;  1FYF A;  1QF6 A;  3OYJ A;  2DTI A;  4XTY A;  2ATC B;  3FEO A;  4LVJ A;  3A31 A;  1JRI A;  2V8K A;  3LGF A;  4C92 F;  1Q82 C;  2K2V A;  4M75 D;  3CMA T;  3JB9 F;  3VS0 A;  1MND A;  3M0P A;  4PJO D;  3M56 A;  5GAO q;  1XJW B;  3C94 A;  2FB7 A;  2OTJ Q;  4E2F B;  1EQR A;  3CCU A;  1V76 A;  2PVD B;  5M9O A;  1KQS A;  3A8H B;  5HK3 A;  1WJS A;  3QZ9 B;  1G3T A;  3BY7 A;  4L6V 5;  1NJ1 A;  2K5L A;  2V1R A;  5K1P A;  4TWA A;  2LT1 A;  3HPW A;  3A8L B;  5ELN A;  3G6E Q;  4BDZ A;  3CCQ Q;  3HFZ B;  4P72 C;  4II1 A;  4KGZ B;  5KE2 A;  3CCV Q;  2HL5 C;  4JRK A;  4M7A E;  1LJO A;  4WI1 A;  1N6A A;  3JB9 H;  2DXC A;  4PL6 A;  1BK2 A;  4P3P A;  5LJ3 f;  3QYG B;  4DQ2 A;  2YT6 A;  3NET A;  3M0Q A;  1EX4 A;  2AKK A;  1R77 A;  1BKB A;  4D8K A;  3OS2 A;  4DPG A;  2C8M A;  2RHZ A;  1EIF A;  3VS5 A;  3A7A A;  2GFU A;  3M0U A;  3V7R A;  3EGD A;  4F7U F;  3LH0 A;  4DA4 A;  2HD0 A;  2LX7 A;  3THK A;  3UF4 A;  2RQU A;  2RHI A;  4Y92 A;  3M4Q A;  3J81 E;  4J9B A;  2EQU A;  3JCM P;  3SDZ A;  1FMK A;  2MWO A;  1GBR A;  5A2Q E;  4C5G A;  1B7Y A;  2W0Z A;  1UTI A;  2LQ8 A;  2QQR A;  2HNI A;  2J05 A;  2DL5 A;  1YJW A;  1AWW A;  3PZC A;  5LJ5 g;  5GAM g;  1W4S A;  2DVE A;  4CH5 A;  3BW1 A;  1EIY B;  1QWE A;  4QVC A;  3HSB A;  1VQP A;  1LPL A;  2P84 A;  3D7S B;  3QTC A;  5IT9 E;  4M77 G;  4P3O A;  2QA4 T;  2CRE A;  1NJI U;  1K9M R;  1E1O A;  1WGS A;  5HCK A;  3LSS A;  1E6G A;  2NWM A;  5A0D A;  2XU8 A;  3A8O B;  3FJ5 A;  2VWF A;  1NBE B;  3C0C A;  3DLM A;  3FRN A;  2KY9 A;  2DM1 A;  2XKO C;  1Q86 U;  1QWF A;  4KUI A;  3OD1 A;  4PJN A;  2GNC A;  1PNJ A;  1H3Z A;  1H64 1;  3HTZ A;  1OPL A;  4M78 C;  2L3S A;  4M7D G;  3QPH A;  2RM4 A;  4DEY A;  2YDL A;  3E9H A;  3RMS A;  3CC7 T;  2EFI A;  1N8R C;  2Q5H A;  1PSF A;  5I11 A;  4EMK C;  2EYY A;  1T0H A;  4RMO A;  2SEM A;  1OX8 A;  1VYT A;  4XTW A;  2KRM A;  1NJI R;  4B6M A;  4AH6 A;  2NUZ A;  3QNE A;  5CQY A;  4OMM A;  3OYB A;  2DEU A;  1WHK A;  1M1K U;  1HK9 A;  1RAH B;  2ZT6 A;  1Q86 R;  4M7A F;  3RF1 A;  1W1F A;  4OML A;  5CAI A;  4A53 A;  3M4Y A;  2Y4Y A;  1HD3 A;  2OX7 A;  1OZ2 A;  1R8O B;  4OB2 B;  4EMH A;  3CCE T;  4HWO A;  2D0N A;  2ED0 A;  2F5K A;  3M9Q A;  3TEH A;  1AOJ A;  2E3H A;  2DVJ A;  1KFZ A;  3EHR A;  2DYB A;  2DYI A;  1U8R A;  1KQS S;  2LJ1 A;  2YLC A;  3CCR T;  4TQF A;  5GAN 5;  2JTE A;  3A8G B;  3UDC A;  2DTO A;  2DF6 A;  1M3A A;  2ZGW A;  3MJX A;  3P8H A;  2O2O A;  3QYH B;  2HBW A;  3MEY A;  2LCL A;  2IVW A;  4FU6 A;  3LH5 A;  3PIO A;  2VAS A;  1ZA2 B;  5GAN 7;  3A5Y A;  1EFW A;  3QO3 A;  1ABO A;  1VQ7 T;  3R6N A;  4RCC A;  2HSP A;  1M1K R;  2EBP A;  1NEG A;  2YRC A;  3MKD A;  1VQN Q;  1NYR A;  3MCA B;  1RAD B;  2P0Q A;  3OYE A;  4P3N A;  1VQM A;  1Q82 U;  2DKG A;  3JCM f;  2JJ9 A;  1VQ5 A;  3H41 A;  4WTO B;  2FYK A;  3L1A A;  3M58 A;  2ZTG A;  2CUB A;  3C4S A;  4J9I A;  1ADJ A;  4E47 A;  3CQT A;  3E9F A;  4UP7 A;  5L23 A;  2J6O A;  4N4G A;  4OB3 B;  1WQW A;  3FJP A;  2ZCF B;  1E1T A;  2L89 A;  2GCX A;  3LX7 A;  2CP2 A;  5KYW A;  4IKF A;  1PD1 A;  4NCX A;  4P75 C;  4AT1 B;  1QKX A;  2V1Q A;  2C7I A;  4HVV A;  3HRI A;  3TEH B;  3FB9 A;  4PFO A;  5LJ3 j;  1MHN A;  3CC2 A;  3TEE A;  1C0A A;  3QWY A;  4K11 A;  1Y96 B;  2YUN A;  7AT1 B;  1N9R A;  1ZSZ A;  2VXE A;  3G71 Q;  2E6Z A;  3CME T;  5GJV B;  2QEX A;  3C95 A;  3L2Q A;  1QVF A;  4JPB W;  2KYB A;  3EH1 A;  3CPW P;  2K7A A;  5ECA A;  2FPF A;  2OTJ T;  4C92 C;  4X34 A;  4HXJ A;  3R07 A;  1YHQ T;  2BZX A;  1RUW A;  4YRP A;  4CS4 A;  4ORZ A;  2RNA A;  4Q5W A;  1FWZ A;  2AKL A;  3A98 A;  3HXZ A;  3P8V A;  3ASK A;  1H4Q A;  4JZ4 A;  2DJZ A;  5CKD A;  3HY0 A;  3M4P A;  4XU3 A;  3G6E T;  2ZPB B;  4C5H A;  1IRE B;  2RJC A;  2J6K A;  3CCQ T;  2I4M A;  3CCV T;  3A1P A;  3ZL7 C;  1BYM A;  2QDL A;  1V29 B;  4RTZ A;  3VS4 A;  3GBQ A;  3EFO A;  2DQ3 A;  1YIJ T;  3QSU A;  3SHW A;  2K6D A;  1I4K 1;  5GMK m;  2DU7 A;  1ZBJ A;  4IUV A;  1YJN A;  2HKN A;  4ZN3 A;  1YN8 A;  1WFW A;  2SRC A;  4HCZ A;  4FSX A;  1HSQ A;  2JS0 A;  1D0Y A;  2ZZE A;  2O88 A;  1EOV A;  5LJ3 h;  3V8K A;  5IHK A;  2QAS A;  4KBM B;  4C92 D;  4KT0 E;  1PSE A;  2DNU A;  2ARU A;  4J9C A;  1T0J A;  4ZIB A;  1J5W A;  4LDV A;  1OOT A;  1KK7 A;  1D3B B;  2EPD A;  1N8R U;  4HWR A;  5EG2 A;  2F5T X;  4FYW B;  2DX1 A;  1HTT A;  2PVG B;  1G5V A;  3X20 B;  2EYX A;  2CZ1 B;  5FRN A;  3QZ5 B;  2CSQ A;  4OMN A;  4O6J A;  2CYZ B;  1Q7Y R;  4TTV A;  1FYN A;  3CCL Q;  1UJ0 A;  2XIC A;  4C8Q G;  1S72 A;  1IRX A;  3PMT A;  2I2L A;  2DL8 A;  3HFN A;  2W10 A;  3E1S A;  4C0D B;  1WHL A;  1Y57 A;  3EFO B;  1UEC A;  4JJN K;  1VQO A;  3QO7 A;  4H2W A;  1YFT A;  1BCM A;  2RHQ B;  5KCO A;  3LWI A;  3CC4 Q;  3JCM Q;  1BI1 A;  4ATO A;  1PG5 B;  3EFS A;  3JCM c;  2DL4 A;  2LCC A;  5GMK h;  1BBU A;  4R55 A;  4E7I A;  3M59 A;  1QLY A;  1OV3 A;  2P4T A;  3QUI A;  2V8I A;  3L4G B;  2JNG A;  2B8A A;  4RKU E;  4BAC A;  1VIF A;  3HXV A;  2KNB B;  1ASY A;  1X54 A;  3MHX A;  2FEI A;  4A63 B;  1YI2 A;  3OYF A;  2BE9 B;  3OYD A;  4P74 C;  2H8H A;  1QVF S;  1MMA A;  4M7A C;  4BD3 A;  2NUP B;  1BBZ A;  2E12 A;  1IL2 A;  2O01 E;  1M30 A;  2DU5 A;  2ECZ A;  4C8Q A;  3MEU A;  2MK5 A;  2KI7 A;  4HWP A;  1G51 A;  2B86 A;  5KYU A;  4CC3 A;  4NL3 A;  2HL3 A;  2DBM A;  2MF2 A;  2E5A A;  2AIR B;  4ZTU B;  1WHG A;  4M75 G;  3MET A;  1YIT Q;  2YUO A;  3PCO B;  1SF9 A;  1VQ9 T;  2KEA A;  4PJO G;  3RDV A;  4ZGJ B;  3OYI A;  4GLK A;  5IAY A;  2ZAE A;  3PTA A;  3HRK A;  2X3W D;  3HP9 A;  1M90 U;  3A5Z A;  2EQI A;  1WYD A;  1VQN T;  5HGQ A;  3NMZ C;  4JRP A;  2OTL A;  1E7O A;  1G5I A;  2CJB A;  2IY5 A;  1PKT A;  4YCV A;  4LDU A;  1JXO A;  1YFS A;  4RDX A;  2LNH B;  5GAN d;  4D8D A;  3I56 Q;  1ZUU A;  2DXT A;  1UDL A;  3QKJ A;  1JU5 C;  5LJ3 g;  3RBB B;  2QHV A;  2RMO A;  1EZZ B;  1K73 R;  3I55 A;  2M0O A;  4RTY A;  1KOG A;  5GAN e;  1JB0 E;  4M7A D;  2AZS A;  3OYH A;  5CKE A;  1BI3 A;  1TG0 A;  3UA7 A;  1H4T A;  1U5S A;  3EH2 A;  2ZT7 A;  1HXD A;  3VV0 A;  4BI4 A;  1YGB A;  3PT9 A;  4LUE A;  3JCM h;  1TH7 A;  4Y28 E;  2O31 A;  2XDB A;  1M90 R;  3QG1 A;  4UP8 A;  3M0S A;  5FWC A;  1VYU A;  2IIM A;  4ELY C;  1YWO A;  2JTF A;  3G71 T;  2LT4 A;  4JUV A;  2IG0 A;  3EG3 A;  4E7H A;  4N0A A;  4OLF A;  1QCF A;  4X9D A;  4DOW A;  2ZR3 A;  3BDU A;  4PJJ A;  1WU7 A;  4PJO A;  2X4J A;  4IUU A;  4BI3 A;  3LSQ A;  2ED1 A;  2QHS A;  4BW9 A;  1UHC A;  2MYS A;  1IHW A;  1VQ8 Q;  4EO4 A;  4Z02 A;  5CVI A;  3JCM e;  2O9S A;  1EVL A;  2IY5 B;  2RQW A;  1Y07 A;  4M4Z A;  1KQS P;  3VQY A;  3OMG A;  1BB9 A;  5CR2 A;  4BY6 B;  1LOJ A;  2FPE A;  2H3E B;  4PJM A;  5LJ5 d;  2JMA A;  5GAM d;  1M27 C;  1ZA1 B;  1FXX A;  1EFN A;  3OS1 A;  5GJW B;  1ACM B;  2AK5 A;  1KC8 C;  2DQ0 A;  1VQ6 Q;  3OYN A;  1VQL A;  1B3Q A;  1PCX A;  2JM9 A;  5FRM A;  4J8O A;  5D6Y A;  2FZC B;  4TQD A;  4VUB A;  1SER A;  2H3J A;  2ROT A;  4CS2 A;  3L2R A;  5C0M A;  1NJ5 A;  3QO8 A;  4WF2 A;  4LDX A;  1X43 A;  3QWX X;  1Y7X A;  4XU0 A;  4ZGE B;  4JS5 A;  2JTM A;  3HRS A;  4FCY A;  2AT1 B;  1SRM A;  2FVU A;  1WDX A;  1ZQ1 A;  1Z7M A;  2LRQ A;  3EAE A;  4CC4 B;  2E4H A;  3OQ5 A;  4OB0 B;  2QAZ A;  1MNE A;  2FRY A;  1WX6 A;  2K57 A;  3VRZ A;  3CCJ Q;  5FU6 C;  4PK4 A;  3ZFJ A;  3GOX A;  2CP3 A;  1M1G A;  2KRO A;  1E24 A;  3I35 A;  3LWH A;  1LCK A;  1K8A U;  4P72 A;  2KYM A;  4FT4 A;  1M2O A;  2QYZ A;  2P4R A;  3CCL T;  4FIB A;  4HT8 A;  3I9Q A;  4TVR A;  3GP8 A;  4YP0 A;  1G5H A;  3CD6 Q;  4NS5 A;  2EGC A;  2LQW A;  1AWJ A;  1UGS B;  1X27 A;  5FU6 B;  4LDW A;  2D1X A;  1KMM A;  4M78 G;  2FRW A;  1AT1 B;  4OB1 B;  1Z9Q A;  2RN8 A;  4PHC A;  5DY9 A;  1K4U S;  2CKK A;  3CC4 T;  1V1C A;  4FM4 B;  2HZY A;  1KQ2 A;  3T9N A;  2NLU A;  3UA6 A;  1KQ1 A;  3HXY A;  2ODR C;  1AD5 A;  2CS7 A;  3VRY A;  2P0K A;  3IAL A;  2EYQ A;  4DBF A;  3HL8 A;  4YRR A;  2DER A;  2D9T A;  2DEQ A;  3JCM g;  5CKH A;  5J39 A;  2ZXF A;  2QHT A;  1Q95 G;  2E10 A;  3OW2 A;  3TQ7 P;  2AKW B;  3G4S T;  1K8A R;  4XAX B;  2HQH A;  1G2B A;  4NL2 A;  3G7Z A;  3A7R A;  4YRS A;  4D6W A;  4HKE A;  3CCS A;  4XK8 E;  2MI6 A;  4X5O A;  1WA7 A;  2E41 A;  2EQM A;  1WJQ A;  5KNN A;  2X4X A;  1I8F A;  2GGR A;  2A3L A;  1BU1 A;  2CDT A;  2LC4 A;  5KE3 A;  2I4N A;  1VA7 A;  1QMC A;  3WVE B;  3CPF A;  4YRC A;  2KSS A;  1NZ9 A;  2RD1 A;  2QI2 A;  1M3B A;  4XQ3 A;  5GAN 8;  1IGU A;  1QVP A;  1YJ9 A;  4MDX A;  4MMK A;  1K0X A;  2BE7 D;  4EMG A;  4M78 A;  2GF7 A;  2RJE A;  2ZZG A;  1YIT T;  3EGX A;  5AYF A;  5HKC A;  4P73 A;  3KUF A;  4XTV A;  4C0G A;  3L2Z A;  2ODR D;  2YXY A;  2GQV A;  4YDQ A;  2HDA A;  4Y91 A;  4C5E A;  5IHI A;  4EMK A;  5L8R E;  1D1A A;  2J3M A;  3VUB A;  2ZCE A;  2RK1 A;  2RI3 A;  1I0C A;  1VQ4 A;  2DXB A;  2HAX A;  3CCM A;  4RTX A;  2M16 A;  2QK0 A;  3I56 T;  2M9U A;  4OMO A;  1IXD A;  2ZPH B;  1Q81 C;  2YRD A;  3EGD B;  3X28 B;  4QQ6 A;  3FC3 A;  4RQF A;  1MMN A;  4OMF B;  1UFF A;  2DTH A;  2EIF A;  3KBG A;  2QGF B;  1AHJ B;  5IH2 A;  2CSI A;  3NEN A;  4JRQ A;  4QW2 A;  3JCM b;  3CMA A;  2DPP B;  1B7Y B;  1GBQ A;  5DLO A;  2G3R A;  3OS5 A;  3DSQ A;  1KD1 C;  5HY6 A;  1I5L A;  1PRM C;  2AHJ B;  4IUR A;  4BI8 B;  1YCY A;  3M57 A;  1ARK A;  1GFD A;  3N5B B;  2MMP A;  3NTI A;  3VQV A;  2HMA A;  5FU7 B;  5CK9 A;  4G85 A;  1BI2 A;  1K0S A;  2G4C A;  4M77 A;  1A0N B;  1KMN A;  3DLL A;  2KT1 A;  3TEG A;  2GTO A;  4C0F A;  2EYZ A;  4XTU A;  3OSV A;  3OYK A;  3JB9 J;  4PNO A;  4KUD K;  4C92 G;  1D1C A;  2CH4 A;  1GXI E;  3JB9 G;  1WNL A;  4KGV B;  5I2M A;  4CS3 A;  5J3B A;  4CC7 A;  1YCS B;  1QVF P;  4Q6G A;  1VQ8 T;  2QG9 B;  3L42 A;  5IXF A;  3FIF A;  1VQK Q;  2ALY A;  3OYL A;  1X55 A;  4RQE A;  2KGT A;  3EG1 A;  4M7D A;  6AT1 B;  1TXQ A;  2K3B A;  1VQL Q;  1W70 A;  1KG1 A;  4P5N A;  2F2X A;  3ER0 A;  2MAM A;  4QVD A;  2PU9 B;  2NS6 A;  4A4E A;  3SEM A;  3H6Z A;  3QXE B;  1VQ6 T;  1K9A A;  2XK0 A;  5I22 A;  4R56 A;  1RL2 A;  2WAC A;  4FW2 A;  4AFU C;  2R58 A;  1PD0 A;  4H02 A;  2VUB A;  2NUT A;  2JOY A;  1MV0 B;  2YHT A;  1T3L A;  2EVR A;  2VXF A;  2QA4 A;  3E9G A;  1AWX A;  2LX9 A;  4GBQ A;  1ZLM A;  4M77 B;  3FDR A;  5KYN A;  3QDR B;  4C92 A;  1IB8 A;  2K4Y A;  4FYX B;  1K76 A;  2LJ3 A;  4MZP A;  4H2Y A;  1RAC B;  1ZX6 A;  4FW1 A;  4A4F A;  3CCJ T;  2FHD A;  4MML A;  3CCU Q;  1WZO A;  1X6O A;  2CP5 A;  3VS1 A;  4FYV B;  4J9F A;  2DFU A;  2DK3 A;  1OZ3 A;  2NYS A;  3MEW A;  3V7S A;  2QTX A;  1N27 A;  2RO0 A;  1Q82 R;  4KUL A;  1H8K A;  3L2V A;  3MF1 A;  1XNI A;  4M7D B;  2KDS A;  3BFM A;  3VS6 A;  3CC7 A;  3L2U A;  2ROL A;  1TUC A;  1MMG A;  5GAM f;  1UG1 A;  3CD6 T;  3PGG A;  2RQR A;  4Z8A A;  1FMV A;  4OGC A;  4IUQ A;  3NHN A;  3KFU A;  5C51 B;  2R5M A;  4EPC A;  4HCB A;  2QDY B;  1IO6 A;  3LLR A;  1OU8 A;  2Q7H A;  3MF2 A;  3H8Z A;  2EKO A;  3EG9 A;  2E5K A;  2C06 A;  3JAM E;  3EHQ A;  3RIR A;  1BCO A;  5EC7 A;  1NNH A;  1S1N A;  4MZM A;  4RG2 A;  2JT4 A;  2E65 A;  3M0T A;  4J6W A;  2MCN A;  3CCE A;  2HCK A;  2F1L A;  1E6H A;  1LNX A;  4LVL A;  1BI0 A;  5GAO l;  1NYG A;  3PVQ A;  4YRJ A;  1YJW Q;  3REX A;  5KYW B;  5GMK j;  3PE0 A;  4JS4 A;  4F16 A;  3F70 A;  5C6S A;  2D8J A;  3CCR A;  2RI5 A;  4RTU A;  2DJQ A;  2L2P A;  2OI3 A;  1VQP Q;  2EYW A;  5F5W A;  2JVV A;  1W2B P;  4HCC A;  4N4H A;  1WI7 A;  4M7A G;  2ZIN A;  1ZSZ B;  3RR6 A;  4GY5 A;  5A0G A;  1TS9 A;  4CH6 A;  1P92 A;  5D6W A;  3OYA A;  1VQ7 A;  2KQW A;  1GL5 A;  3SWN A;  4F14 A;  4ME7 A;  2FG0 A;  1CKA A;  1Y0M A;  4C0D C;  2L5Q A;  5LJ3 d;  3L2W A;  2PMF A;  4PG3 A;  2YUQ A;  4H2X A;  2OAW A;  1RLP C;  2PZ1 A;  4HA8 A;  4N4I A;  5LJ3 e;  1YFN A;  1VOM A;  4PLL A;  1N9S A;  5IN1 A;  4JRI A;  4J5Y A;  1AVZ C;  3RMQ A;  2Y4X A;  4E7L A;  1JJC A;  4B9X A;  3OBY A;  3S3N A;  2ENM A;  1B34 A;  1G8X A;  3VYG A;  4JJB A;  2M51 A;  1KIK A;  1OYX A;  4V2S A;  1D0X A;  1B70 A;  4YRN A;  5ELO A;  2COZ A;  1ZBX A;  4A4K A;  5DLQ E;  2E3C A;  1N8R R;  2ZPI B;  1QQJ A;  2WSC E;  3OS0 A;  4P74 A;  1D1B A;  3CME A;  2HEQ A;  4M7A A;  3X24 B;  3ULR B;  1C6V X;  1NPP A;  3CBM A;  1C1A A;  1QW1 A;  2OTJ A;  3VS3 A;  2PTK A;  1W2B A;  3OMC A;  1YHQ A;  2K79 A;  3NTH A;  3VS7 A;  2WSF E;  1M2V A;  5CO7 A;  3RES A;  4JDS A;  3SFM A;  2ZIO A;  4FT2 A;  1WLP B;  3G6E A;  3CCQ A;  2VGM A;  2DIL A;  4BE1 A;  3CCV A;  4QQG A;  4E7Z A;  5GMK e;  3AT1 B;  2ZNI A;  4M77 E;  3BE3 A;  4BDY A;  1UGR B;  4J83 A;  1QE0 A;  1QCO A;  1YIJ A;  4XEM A;  1BIB A;  1W6X A;  1GRI A;  3P8B B;  1PYS A;  2C0T A;  1PRL C;  3M54 A;  1WXT A;  1NLP C;  1VQK T;  1H4V B;  3TRE A;  4AFQ C;  2BTT A;  4CH3 A;  4DBR A;  1NEB A;  2EKH A;  5FLX E;  1VQM Q;  2X9H A;  1GGM A;  1MMD A;  1W66 A;  5J26 A;  5KYX A;  1SRL A;  4R0K A;  2XG8 D;  1VQ5 Q;  4JZ3 A;  4M7D E;  3WXM B;  3RL6 A;  2X4W A;  1B70 B;  1K9M C;  4UC4 A;  4FL6 A;  2J06 A;  3RNJ A;  1U06 A;  1UJY A;  4DBQ A;  3TUP A;  2X35 A;  1X01 A;  5GAN 3;  1GCQ C;  1UGV A;  2RK2 A;  3E19 A;  1TU0 B;  4QT7 A;  4XTX A;  1JJ2 P;  1WXU A;  2DDZ A;  4AFZ C;  4M78 F;  1PHT A;  1M2V B;  3UT1 A;  3CC2 Q;  3OA6 A;  2KT8 A;  1OUL A;  1HYO A;  2DLP A;  2FZG B;  2KBT A;  1AEY A;  4F17 A;  2YLB A;  2EGE A;  2QEX Q;  1OX9 A;  4ANJ A;  3MQZ A;  1D0Z A;  1TUG B;  4IIO A;  3VJP A;  1T3S A;  1AWO A;  1YNZ A;  4C8Q B;  3CCU T;  2ZNJ A;  2EJ9 A;  4AMC A;  2RHS A;  2RJD A;  5KYU B;  1NJI C;  1PYS B;  2E1H A;  1PWT A;  1RAF B;  1HC7 A;  3CXC P;  1UHF A;  1WHH A;  5CKB A;  4M75 A;  3BJU A;  3OYY A;  4J6X A;  3OYC A;  3JCM d;  3LYI A;  4AG1 C;  1Q86 C;  2C0I A;  1O75 A;  2RHU A;  4BY6 C;  1B7T A;  1AZE A;  1RAE B;  3A5Z B;  3RKW A;  3CBP A;  4P71 A;  1I1J A;  2E64 A;  3MO8 A;  2O4X A;  3V7C A;  3VUZ A;  3ERR A;  2BKD N;  1WQ7 A;  4XU1 A;  3H0I A;  4JJC A;  1YJN Q;  2AMC A;  4L59 A;  2ZPF B;  1UUE A;  3C12 A;  9ATC B;  4OGE A;  4M77 F;  2MWP A;  3MEA A;  2KRS A;  4LD6 A;  1JJ2 A;  3CCR Q;  3H0H A;  5GAM h;  1N9W A;  1R0C B;  1SG5 A;  2CIM A;  1RAA B;  1SHG A;  4LNS A;  1TSF A;  3E2U A;  1YJW T;  1W2B S;  1PC0 A;  2HSE B;  4N0A C;  3KXT A;  3HFV A;  3QHS A;  4KRT A;  4LE9 A;  4J7I A;  1M1K C;  2LCS A;  3JB9 I;  3OW2 P;  5KH6 A;  2WSE E;  1VQP T;  5FW9 A;  4M7D F;  1USY C;  3HFZ A;  3Q1J A;  2GQI A;  2KE9 A;  4ZTZ B;  1VQ9 A;  4M75 B;  2QQ9 A;  3CXC A;  2K5F A;  4UP9 A;  1BIA A;  4PJO B;  1VQN A;  1OU9 A;  4AFS C;  3EGU A;  4PFP A;  2FL7 A;  1S72 Q;  4CI0 C;  4KQE A;  1WIE A;  2RHY A;  2A0F B;  2C0O A;  4RUG A;  5DM7 R;  1JEG A;  1C0M A;  1UB4 A;  1VQO Q;  3TCJ A;  1QP3 A;  2F2V A;  2XI9 A;  3J7A F;  3A32 A;  2FZK B;  1X2Q A;  2AMC B;  2CH4 W;  1B07 A;  3O8V A;  2JS2 A;  4UPA A;  2XHC A;  1LVK A;  2DL3 A;  2LTO A;  4C5I A;  4Z89 A;  1MGQ A;  1M1F A;  4J9H A;  1GCP A;  3CME Q;  4DOV A;  1RAI B;  3ZEH A;  1WPY A;  2ZZD A;  3HY1 A;  1EIY A;  2PUO B;  3WQZ A;  2OAU A;  4J15 A;  2XTI A;  3I7F A;  2A36 A;  4QVZ A;  1YHQ Q;  4H2S A;  2K3Y A;  3G71 A;  1YB3 A;  1WHM A;  3H9N A;  2I4O A;  5IXB A;  1ZUY A;  3VYH B;  1YI2 Q;  2LVM A;  2RI2 A;  2EL9 A;  3M5A A;  1SRY A;  4H2U A;  2EWN A;  3P8Y A;  3LC0 A;  2JZ2 A;  4KGX B;  3OY9 A;  3NEM A;  4J6Y A;  3PMI A;  3A74 A;  3TU4 K;  4XU2 A;  4WCI A;  1YIJ Q;  1K9M U;  3NTK A;  1ATI A;  2A37 A;  1G3W A;  4XEO A;  1LYL A;  1TTH B;  2HKQ B;  4EX5 A;  2K2M A;  1SSH A;  2D8H A;  4GLM A;  1XTD A;  2E5Q A;  5I21 A;  3G1J A;  2XMF A;  2DL7 A;  4TVW A;  2QQA A;  4NOY A;  5FWB A;  3IG2 A;  2LJ0 A;  1G3Y A;  3RGL A;  1JO8 A;  2LQK A;  3JCM J;  1CKB A;  4C8Q E;  2JUF A;  4YRQ A;  2OTL Q;  4OP0 A;  4OMQ A;  1YWP A;  1IZ6 A;  1VQM T;  4MZT A;  2CP0 A;  4JLG A;  3RER A;  2P0L A;  1KSW A;  1VQ5 T;  3S3M A;  1I07 A;  3EG0 A;  2LZ6 B;  5KYY A;  5I2S A;  2ZZF A;  1FMW A;  2DAQ A;  1JJ2 S;  5C53 B;  2J7I A;  3DKM A;  3I55 Q;  2EQJ A;  5LL6 S;  1Q7Y C;  1NJ8 A;  4X9C A;  2A28 A;  3HXU A;  2RB6 A;  4OVA A;  4XTZ A;  4HWT A;  3M53 A;  2EJF A;  3QJ6 A;  3E9I A;  1XQH A;  3JCM X;  5GAN 2;  5FU7 C;  1RAG B;  3CC2 T;  1Y71 A;  3VQW A;  4HVW A;  3ICA A;  2L3P A;  4EIK A;  1TUD A;  2GBQ A;  3CCL A;  2QEX T;  2E6N A;  4FYY B;  3CXC S;  2DXU A;  1BBW A;  4P73 C;  1Z7N A;  2RPN A;  2XD0 A;  4TVY A;  4KH1 B;  3M0R A;  2P0P A;  3HTR A;  2VB6 A;  4X1V A;  1ZHI A;  2DET A;  1KC8 U;  2L0A A;  1CSK A;  3CC4 A;  1B76 A;  4M78 B;  4DEX A;  5D7U A;  1G83 A;  3EGX B;  2I0N A;  2AZV A;  5IHN A;  4E7K A;  3UGT A;  2KRN A;  3X26 B;  3MPU B;  4B9W A;  2LDM A;  4L5G A;  3QII A;  1M8V A;  4M75 E;  2L3Q A;  3SD4 A;  5GAN 4;  5KYY B;  2YWW A;  2DRM A;  4EMK B;  4PJO E;  2BUD A;  2O9V A;  4HCK A;  5CQX A;  1WHJ A;  1VQZ A;  4PLI A;  4BWA A;  3VKI A;  5GAN f;  3G4S A;  1RAB B;  2E70 A;  4LNP A;  2Q7G A;  1JQQ A;  1RI9 A;  1YJN T;  4YCU A;  2EGA A;  2CZ7 B;  1ASZ A;  2K9G A;  1M4Z A;  2BIV A;  2CT3 A;  5CIU A;  2RF0 A;  3GPL A;  1NLO C;  2GFA A;  2G6F X;  3HRU A;  5A0L A;  1Y96 A;  1WYX A;  1SKU B;  3BDL A;  1O9S A;  2BZY A;  2PVO B;  4M78 D;  3OW2 S;  1SPK A;  2PQW A;  2RQV A;  4M77 C;  4P75 A;  1KC8 R;  2J6F A;  1KHC A;  3VQX A;  2JMC A;  4C8Q F;  2CT4 A;  1XOV A;  1VQ9 Q;  4C0Z A;  2QHU A;  2KR3 A;  1NYQ A;  4F7U G;  1VUB A;  4BB7 A;  1X2H A;  2RH2 A;  2LMJ A;  2RJF A;  1QVG P;  3MP6 A;  1H92 A;  1N5Z A;  2LNV A;  2KMT A;  4ZNX A;  4KR2 A;  11AS A;  3IKL A;  1X2K A;  1UGQ B;  3GF5 A;  4HVC A;  1L0W A;  1YIT A;  4EDU A;  1SET A;  4YCW A;  4IUP A;  4IUT A;  2DE0 X;  3UH0 A;  1RIQ A;  4M7D C;  3REB B;  3I5S A;  4ZTF A;  3R6O A;  1K73 C;  1EVK A;  1X56 A;  4F04 B;  2EJG A;  1S72 T;  1U1T A;  2QQB A;  5CKF A;  3FLG A;  4TVA A;  2DZ9 A;  3MP8 A;  3I56 A;  1VQO T;  4ZTJ A;  1R0B G;  3MP1 A;  4YPF A;  1WXB A;  2ALY B;  1MUZ A;  2K5I A;  2M1H A;  1M90 C;  5LJ5 f;  1Z9Z A;  1U3O A;  3IKM B;  4J7F A;  4M77 D;  2A8E A;  2DIQ A;  2X3X D;  4OMP A;  3W3S A;  4E51 A;  4YRI A;  2CP7 A;  3GLX A;  2RHX A;  1OI1 A;  2HQX A;  1D3B A;  2NUT B;  3UWN A;  1OEB A;  3OBW A;  4E7S A;  3URG A;  4F7U A;  2ZPE B;  4DBH A;  2CGH A;  4LD9 K;  3CCS Q;  5GMK i;  4M75 F;  3RKX A;  1VIE A;  3JSC A;  3HKS A;  1M3C A;  1YI2 T;  1SHF A;  1QVG A;  4PJO F;  1ZSZ C;  4M7D D;  4LVM A;  4J9G A;  1QP2 A;  1OQK A;  4ZGD B;  4RTV A;  5GAO m;  1JBM A;  3X25 B;  4A54 A;  2Y90 A;  4E6R A;  2DBK A;  4C92 B;  2DIG A;  1H3H A;  2ZT8 A;  4E7J A;  1VQ8 A;  2MIO A;  1NG2 A;  3HFO A;  3P8T A;  3RAC A;  1MV3 A;  2DZC A;  5GMK l;  2RHQ A;  1UE9 A;  2JW4 A;  5K1X A;  1YJ9 Q;  3OB9 A;  4TVA B;  2CJ9 A;  1Q7Y U;  3QO5 A;  2CZ6 B;  1YP5 A;  2P5I A;  2YUP A;  2ZPG B;  1SEM A;  1TOV A;  3NFC A;  8AT1 B;  3GNF B;  1Q81 U;  1GFC A;  5D6X A;  3PFS A;  1FX7 A;  4H2T A;  1KHI A;  1U1S A;  1X75 C;  4LN2 A;  2HBP A;  1VQ6 A;  2VC8 A;  3OYM A;  4RMF A;  4K87 A;  3M55 A;  2CJA A;  2OTL T;  1VQ4 Q;  3CCM Q;  3RKY A;  2ZT5 A;  4KR3 A;  3JV3 A;  3L4G A;  4LVK A;  4HWS A;  2V8J A;  3EG9 B;  3S6W A;  3JB9 D;  2EW3 A;  1KD1 U;  4M78 E;  1M8M A;  4HVU A;  3HHT B;  4ZN1 A;  4ELZ C;  3CPW A;  3EG2 A;  4JLI A;  4F7U B;  4BE0 A;  4LUD A;  3I55 T;  4PJL A;  3HXW A;  4QQD A;  4YRK A;  2NUP A;  8ATC B;  4MDW A;  4RTT A;  2KVQ G;  3CMA Q;  2Z0W A;  4PKC C;  1H4S A;  4HT4 A;  3I5R A;  1NE8 A;  3NPF A;  1G3S A;  2XID A;  2Q5I A;  3CCJ A;  4FSS A;  1Q81 R;  5FRO A;  4WJ3 M;  3SWN C;  5HK0 A;  3UPU A;  2ABL A;  5GAN j;  2FO0 A;  3VU3 C;  1D09 B;  3PVL A;  3ZBD A;  1QCN A;  2M0Y A;  3PCO A;  3QBY A;  3TSW A;  4CC2 A;  1KJW A;  1UEB A;  2D0Q B;  3TVT A;  4CRI A;  3CD6 A;  4BE2 A;  1KD1 R;  2VKN A;  4Q15 A;  1NM7 A;  1NJ2 A;  2QXF A;  1I5O B;  4H2V A;  4LDY A;  4O2D A;  1NYF A;  3SWN B;  4BUG A;  2EQK A;  4CH4 A;  1K8A C;  3REU A;  1ZSG A;  5KCH A;  2E3I A;  3G4S Q;  1NPR A;  3DB4 A;  2MPX C;  4RG8 A;  4H2X B;  4QKU A;  1YFR A;  4O5V A;  3ME9 A;  2COY A;  4Z88 A;  5GAN 6;  2KXC A;  3AHU A;  2A08 A;  2ARS A;  1GCQ A;  4A4G A;  4YRE A;  2K3X A;  1X2G A;  1VQL T;  4JJD A;  4J9D A;  1JJC B;  2VVK A;  5GAO r;  1B34 B;  4KH0 B;  1ADY A;  1RI0 A;  3SB2 A;  2HQE A;  3DB3 A;  2JXB A;  1K73 U;  3INZ A;  2CZ0 B;  3CEY A;  2KXD A;  3NGP A;  3TSZ A;  1OPK A;  1QVG S;  1ABQ A;  2QA4 Q;  2J3L A;  4YRT A;  2LQN A;  2ZR2 A;  4M7A B;  4G84 A;  3OSS C;  2IPO B;  3A7U A;  2JM8 A;  1X6G A;  2X51 A;  3GIB A;  5LJ5 j;  5GAM j;  5GAN h;  2CUD A;  4K88 A;  2PNI A;  2QGG A;  3EFR A;  4IIM A;  2MOX A;  5AT1 B;  1DJ7 B;  4C8Q C;  3KFV A;  5GAO p;  3UGQ A;  2V26 A;  3CBO A;  2RA2 A;  4AG2 C;  2Q7E A;  3O5Z A;  2PME A;  3G1Z A;  3S3O A;  2YSQ A;  1WLE A;  2VGN A;  2A7Y A;  2XGT A;  1F1B B;  3IQL A;  12AS A;  4A4H A;  3QJY A;  2DMO A;  3V8J A;  2JN0 A;  3CC7 Q;  2DA9 A;  2ESW A;  3A8M B;  4YRG A;  1QKW A;  1SSF A;  4C92 E;  2F2W A;  1RLQ C;  3LGL A;  2XDP A;  1NJ6 A;  2GTJ A;  3P8D A;  2F69 A;  3M4G A;  5GAO n;  2M02 A;  3PNW C;  1PKS A;  2DO3 A;  2VYT A;  2DRK A;  3UAT A;  1AZG B;  1M9S A;  1J3T A;  1UGP B;  2DD4 A;  3CPW S;  4YTL A;  5KYX B;  4PFZ A;  3OYG A;  4RCB A;  1HJD A;  3GNG A;  4YRM A;  2FPD A;  3VS2 A; 
#chains in the Genus database with same CATH homology
 3HXX A;  1E22 A;  2X4Y A;  2PUK B;  2ZIM A;  1WJR A;  4C8Q D;  3LW5 E;  3CMQ A;  3V8L A;  3UFG A;  3CCS T;  1USY A;  2R5A A;  4YRO A;  5LJ5 h;  4LVI A;  4WJ4 A;  3J80 E;  5CCA A;  4F7U E;  1SES A;  4YRF A;  2EAY A;  2ART A;  4M75 C;  3RUX A;  5E3I A;  4PJO C;  2VV5 A;  1YBY A;  4OF1 A;  1I81 A;  1VQK A;  2DD5 A;  3WVD B;  1YJ9 T;  2D6F A;  2RHS B;  3JCM V;  2KAF A;  4P71 C;  2KK4 A;  5LJ5 e;  5GAM e;  4YRL A;  2R57 A;  2XDD A;  4K86 A;  2QQS A;  3VBB A;  2YRV A;  4YYE A;  3JRZ A;  3MEV A;  4HT9 A;  2L3R A;  2AKW A;  4L87 A;  1VQ4 T;  2I4L A;  2L8D A;  3NEL A;  3CCM T;  1B8A A;  3HRT A;  2O4X B;  3PIP A;  3JCM W;  5C52 B;  1M5Q 1;  5GAN g;  1FYF A;  1QF6 A;  3OYJ A;  2DTI A;  4XTY A;  3FEO A;  4LVJ A;  3A31 A;  1JRI A;  2V8K A;  3LGF A;  4C92 F;  1Q82 C;  2K2V A;  4M75 D;  3CMA T;  3JB9 F;  4PJO D;  3M56 A;  5GAO q;  3C94 A;  2FB7 A;  1EQR A;  3CCU A;  2PVD B;  5M9O A;  1KQS A;  3A8H B;  5HK3 A;  1WJS A;  3QZ9 B;  1G3T A;  3BY7 A;  4L6V 5;  1NJ1 A;  2K5L A;  5K1P A;  4TWA A;  2LT1 A;  3HPW A;  3A8L B;  5ELN A;  4BDZ A;  3HFZ B;  4P72 C;  4II1 A;  5KE2 A;  4JRK A;  4M7A E;  1LJO A;  4WI1 A;  1N6A A;  3JB9 H;  2DXC A;  4PL6 A;  4P3P A;  5LJ3 f;  3QYG B;  4DQ2 A;  3NET A;  1BKB A;  3OS2 A;  4DPG A;  2C8M A;  2RHZ A;  1EIF A;  3A7A A;  2GFU A;  3V7R A;  4F7U F;  3LH0 A;  4DA4 A;  2HD0 A;  2RHI A;  3M4Q A;  3J81 E;  2EQU A;  3JCM P;  3SDZ A;  2MWO A;  5A2Q E;  4C5G A;  1B7Y A;  2LQ8 A;  2QQR A;  2HNI A;  1YJW A;  3PZC A;  5LJ5 g;  5GAM g;  1W4S A;  2DVE A;  4CH5 A;  3BW1 A;  1EIY B;  4QVC A;  3HSB A;  1VQP A;  3QTC A;  5IT9 E;  4M77 G;  4P3O A;  2QA4 T;  1NJI U;  1E1O A;  1WGS A;  3LSS A;  5A0D A;  2XU8 A;  3A8O B;  3FRN A;  3DLM A;  2KY9 A;  2XKO C;  1Q86 U;  4KUI A;  3OD1 A;  1H3Z A;  1H64 1;  3HTZ A;  4M78 C;  4M7D G;  3QPH A;  2RM4 A;  3E9H A;  3RMS A;  3CC7 T;  2EFI A;  1N8R C;  2Q5H A;  1PSF A;  4EMK C;  4RMO A;  4XTW A;  4AH6 A;  3QNE A;  5CQY A;  3OYB A;  1M1K U;  1HK9 A;  2ZT6 A;  4M7A F;  3RF1 A;  5CAI A;  4A53 A;  3M4Y A;  2Y4Y A;  1OZ2 A;  1R8O B;  4OB2 B;  4EMH A;  3CCE T;  4HWO A;  2F5K A;  3M9Q A;  3TEH A;  1KQS S;  1U8R A;  2YLC A;  3CCR T;  4TQF A;  5GAN 5;  3A8G B;  3UDC A;  2DTO A;  2ZGW A;  3P8H A;  3QYH B;  3MEY A;  2LCL A;  2IVW A;  4FU6 A;  3PIO A;  5GAN 7;  3A5Y A;  1EFW A;  3QO3 A;  1VQ7 T;  4RCC A;  1NYR A;  3MCA B;  2P0Q A;  3OYE A;  4P3N A;  1VQM A;  1Q82 U;  2DKG A;  3JCM f;  1VQ5 A;  2FYK A;  3L1A A;  3M58 A;  2ZTG A;  3C4S A;  1ADJ A;  4E47 A;  3E9F A;  4UP7 A;  4N4G A;  4OB3 B;  1WQW A;  3FJP A;  2ZCF B;  1E1T A;  2L89 A;  2GCX A;  3LX7 A;  4NCX A;  4IKF A;  4P75 C;  2C7I A;  3HRI A;  3TEH B;  3FB9 A;  5LJ3 j;  1MHN A;  3CC2 A;  3TEE A;  1C0A A;  1Y96 B;  1N9R A;  2VXE A;  2E6Z A;  3CME T;  2QEX A;  3C95 A;  3L2Q A;  1QVF A;  2OTJ T;  4C92 C;  4X34 A;  3R07 A;  1YHQ T;  4YRP A;  4CS4 A;  4Q5W A;  1FWZ A;  3HXZ A;  3P8V A;  3ASK A;  1H4Q A;  2DJZ A;  5CKD A;  3HY0 A;  3M4P A;  4XU3 A;  3G6E T;  2ZPB B;  4C5H A;  1IRE B;  2RJC A;  3CCQ T;  2I4M A;  3CCV T;  1BYM A;  1V29 B;  2DQ3 A;  1YIJ T;  3QSU A;  1I4K 1;  5GMK m;  2DU7 A;  4IUV A;  1YJN A;  4ZN3 A;  4HCZ A;  4FSX A;  2ZZE A;  1EOV A;  5LJ3 h;  3V8K A;  4KBM B;  4C92 D;  4KT0 E;  1PSE A;  2ARU A;  4ZIB A;  1J5W A;  4LDV A;  1D3B B;  1N8R U;  4HWR A;  5EG2 A;  2F5T X;  1HTT A;  2PVG B;  1G5V A;  3X20 B;  2CZ1 B;  5FRN A;  3QZ5 B;  4O6J A;  2CYZ B;  4TTV A;  2XIC A;  4C8Q G;  1S72 A;  3PMT A;  2I2L A;  3HFN A;  3E1S A;  4C0D B;  4JJN K;  1VQO A;  3QO7 A;  4H2W A;  1YFT A;  2RHQ B;  5KCO A;  3LWI A;  3JCM Q;  1BI1 A;  4ATO A;  3EFS A;  3JCM c;  2LCC A;  5GMK h;  1BBU A;  4R55 A;  4E7I A;  3M59 A;  2P4T A;  3QUI A;  2V8I A;  3L4G B;  2JNG A;  2B8A A;  4RKU E;  4BAC A;  1VIF A;  3HXV A;  1ASY A;  1X54 A;  3MHX A;  1YI2 A;  3OYF A;  3OYD A;  4P74 C;  1QVF S;  4M7A C;  4BD3 A;  2E12 A;  1IL2 A;  2O01 E;  2DU5 A;  4C8Q A;  3MEU A;  4HWP A;  1G51 A;  4NL3 A;  2MF2 A;  2E5A A;  4ZTU B;  4M75 G;  3MET A;  3PCO B;  1VQ9 T;  4PJO G;  4ZGJ B;  3OYI A;  4GLK A;  5IAY A;  3PTA A;  3HRK A;  3HP9 A;  1M90 U;  3A5Z A;  1WYD A;  1VQN T;  5HGQ A;  4JRP A;  2OTL A;  1G5I A;  2CJB A;  2IY5 A;  4YCV A;  4LDU A;  1YFS A;  4RDX A;  5GAN d;  2DXT A;  3QKJ A;  5LJ3 g;  2QHV A;  3I55 A;  2M0O A;  1KOG A;  5GAN e;  1JB0 E;  4M7A D;  3OYH A;  5CKE A;  1BI3 A;  1H4T A;  2ZT7 A;  1HXD A;  3VV0 A;  4BI4 A;  1YGB A;  3PT9 A;  3JCM h;  1TH7 A;  4Y28 E;  2XDB A;  4UP8 A;  3QG1 A;  4ELY C;  2JTF A;  3G71 T;  2LT4 A;  4JUV A;  2IG0 A;  4E7H A;  4N0A A;  4OLF A;  4X9D A;  4DOW A;  2ZR3 A;  3BDU A;  1WU7 A;  4PJO A;  2X4J A;  4IUU A;  4BI3 A;  3LSQ A;  2QHS A;  4BW9 A;  4EO4 A;  4Z02 A;  5CVI A;  3JCM e;  1EVL A;  2IY5 B;  1Y07 A;  3VQY A;  3OMG A;  5CR2 A;  4BY6 B;  1LOJ A;  5LJ5 d;  5GAM d;  1FXX A;  3OS1 A;  1KC8 C;  2DQ0 A;  3OYN A;  1VQL A;  5FRM A;  4J8O A;  5D6Y A;  4TQD A;  4VUB A;  1SER A;  2H3J A;  4CS2 A;  3L2R A;  5C0M A;  1NJ5 A;  3QO8 A;  4WF2 A;  4LDX A;  1Y7X A;  4XU0 A;  4ZGE B;  4JS5 A;  2JTM A;  3HRS A;  2FVU A;  1ZQ1 A;  1Z7M A;  2LRQ A;  3EAE A;  3OQ5 A;  4OB0 B;  2K57 A;  5FU6 C;  3ZFJ A;  3GOX A;  1M1G A;  1E24 A;  3LWH A;  1K8A U;  4P72 A;  4FT4 A;  3CCL T;  4FIB A;  4HT8 A;  4TVR A;  3GP8 A;  4YP0 A;  1G5H A;  4NS5 A;  1UGS B;  5FU6 B;  4LDW A;  1KMM A;  4M78 G;  4OB1 B;  4PHC A;  5DY9 A;  2CKK A;  3CC4 T;  4FM4 B;  1KQ2 A;  3T9N A;  2NLU A;  1KQ1 A;  3HXY A;  2ODR C;  2CS7 A;  3IAL A;  2P0K A;  2EYQ A;  3HL8 A;  4YRR A;  2D9T A;  2DEQ A;  3JCM g;  5CKH A;  5J39 A;  2ZXF A;  2QHT A;  2E10 A;  3OW2 A;  2AKW B;  3G4S T;  4XAX B;  3A7R A;  4NL2 A;  3G7Z A;  4YRS A;  4D6W A;  4HKE A;  3CCS A;  4XK8 E;  2MI6 A;  4X5O A;  2E41 A;  2EQM A;  1WJQ A;  5KNN A;  2X4X A;  1I8F A;  2A3L A;  2LC4 A;  5KE3 A;  2I4N A;  3WVE B;  3CPF A;  4YRC A;  2KSS A;  1NZ9 A;  2RD1 A;  2QI2 A;  4XQ3 A;  5GAN 8;  1QVP A;  1YJ9 A;  4MDX A;  4MMK A;  4EMG A;  4M78 A;  2GF7 A;  2RJE A;  2ZZG A;  1YIT T;  5AYF A;  5HKC A;  4P73 A;  3KUF A;  4XTV A;  4C0G A;  3L2Z A;  2ODR D;  4YDQ A;  2GQV A;  4Y91 A;  4C5E A;  4EMK A;  5L8R E;  2J3M A;  3VUB A;  2ZCE A;  2RK1 A;  2RI3 A;  1VQ4 A;  2DXB A;  2HAX A;  3CCM A;  2M16 A;  3I56 T;  2M9U A;  2ZPH B;  1Q81 C;  3X28 B;  4QQ6 A;  3FC3 A;  4RQF A;  4OMF B;  2DTH A;  2EIF A;  3KBG A;  1AHJ B;  3NEN A;  4JRQ A;  4QW2 A;  3JCM b;  3CMA A;  2DPP B;  1B7Y B;  5DLO A;  2G3R A;  3OS5 A;  3DSQ A;  1KD1 C;  5HY6 A;  1I5L A;  2AHJ B;  4IUR A;  4BI8 B;  1YCY A;  3M57 A;  3N5B B;  2MMP A;  3NTI A;  3VQV A;  5FU7 B;  5CK9 A;  4G85 A;  1BI2 A;  2G4C A;  4M77 A;  1KMN A;  3DLL A;  3TEG A;  4C0F A;  4XTU A;  3OSV A;  3OYK A;  3JB9 J;  4PNO A;  4KUD K;  4C92 G;  1GXI E;  3JB9 G;  1WNL A;  5I2M A;  4CS3 A;  5J3B A;  4Q6G A;  1VQ8 T;  3L42 A;  3FIF A;  2ALY A;  3OYL A;  1X55 A;  4RQE A;  4M7D A;  1KG1 A;  4P5N A;  3ER0 A;  2MAM A;  4QVD A;  2PU9 B;  2NS6 A;  4A4E A;  3H6Z A;  3QXE B;  1VQ6 T;  2XK0 A;  4R56 A;  1RL2 A;  2WAC A;  2R58 A;  4H02 A;  2VUB A;  2JOY A;  2YHT A;  2VXF A;  2QA4 A;  3E9G A;  2LX9 A;  4M77 B;  3FDR A;  3QDR B;  4C92 A;  2K4Y A;  4MZP A;  4H2Y A;  4A4F A;  3CCJ T;  2FHD A;  4MML A;  1X6O A;  2DK3 A;  1OZ3 A;  3MEW A;  3V7S A;  2QTX A;  1N27 A;  2RO0 A;  4KUL A;  3L2V A;  3MF1 A;  1XNI A;  4M7D B;  2KDS A;  3BFM A;  3CC7 A;  3L2U A;  5GAM f;  3CD6 T;  3PGG A;  4OGC A;  4IUQ A;  3KFU A;  5C51 B;  2R5M A;  4EPC A;  4HCB A;  2QDY B;  3LLR A;  2Q7H A;  3MF2 A;  3H8Z A;  2EKO A;  2C06 A;  3JAM E;  3RIR A;  1NNH A;  4MZM A;  4RG2 A;  2E65 A;  4J6W A;  3CCE A;  1LNX A;  4LVL A;  1BI0 A;  5GAO l;  4YRJ A;  3REX A;  5GMK j;  4JS4 A;  3F70 A;  5C6S A;  3CCR A;  2RI5 A;  5F5W A;  2JVV A;  4HCC A;  2ZIN A;  4N4H A;  4M7A G;  4GY5 A;  5A0G A;  4CH6 A;  1P92 A;  5D6W A;  3OYA A;  1VQ7 A;  2KQW A;  3SWN A;  4ME7 A;  4C0D C;  2L5Q A;  5LJ3 d;  3L2W A;  2PMF A;  4PG3 A;  4H2X A;  4HA8 A;  4N4I A;  5LJ3 e;  4PLL A;  1N9S A;  5IN1 A;  4JRI A;  4J5Y A;  3RMQ A;  2Y4X A;  4E7L A;  1JJC A;  4B9X A;  3OBY A;  3S3N A;  1B34 A;  3VYG A;  1OYX A;  4V2S A;  1B70 A;  4YRN A;  5ELO A;  1ZBX A;  4A4K A;  5DLQ E;  2E3C A;  2ZPI B;  2WSC E;  3OS0 A;  4P74 A;  3CME A;  4M7A A;  3X24 B;  1NPP A;  3CBM A;  1QW1 A;  2OTJ A;  1W2B A;  3OMC A;  1YHQ A;  3NTH A;  2WSF E;  5CO7 A;  3RES A;  4JDS A;  3SFM A;  2ZIO A;  4FT2 A;  3G6E A;  3CCQ A;  2VGM A;  4BE1 A;  3CCV A;  4QQG A;  5GMK e;  2ZNI A;  4M77 E;  4BDY A;  1UGR B;  1QE0 A;  4J83 A;  1YIJ A;  4XEM A;  1BIB A;  3P8B B;  1PYS A;  3M54 A;  1VQK T;  1H4V B;  3TRE A;  4CH3 A;  5FLX E;  1GGM A;  1W66 A;  5J26 A;  2XG8 D;  4M7D E;  3WXM B;  3RL6 A;  2X4W A;  1B70 B;  1K9M C;  4UC4 A;  4FL6 A;  3TUP A;  2X35 A;  1X01 A;  5GAN 3;  2RK2 A;  3E19 A;  4XTX A;  2DDZ A;  4M78 F;  3UT1 A;  3OA6 A;  2YLB A;  3MQZ A;  3VJP A;  4C8Q B;  3CCU T;  2ZNJ A;  2EJ9 A;  2RHS A;  2RJD A;  1NJI C;  1PYS B;  2E1H A;  1HC7 A;  5CKB A;  4M75 A;  3BJU A;  3OYY A;  4J6X A;  3OYC A;  3JCM d;  3LYI A;  1Q86 C;  1O75 A;  2RHU A;  4BY6 C;  3A5Z B;  3RKW A;  3CBP A;  4P71 A;  2E64 A;  3MO8 A;  2O4X A;  3V7C A;  3VUZ A;  3ERR A;  2BKD N;  1WQ7 A;  4XU1 A;  2AMC A;  4L59 A;  2ZPF B;  3C12 A;  4OGE A;  4M77 F;  2MWP A;  3MEA A;  4LD6 A;  1JJ2 A;  5GAM h;  1N9W A;  2CIM A;  4LNS A;  1W2B S;  1YJW T;  4N0A C;  3KXT A;  3HFV A;  3QHS A;  4J7I A;  1M1K C;  3JB9 I;  5KH6 A;  2WSE E;  1VQP T;  4M7D F;  1USY C;  3HFZ A;  3Q1J A;  4ZTZ B;  1VQ9 A;  4M75 B;  2QQ9 A;  3CXC A;  2K5F A;  4UP9 A;  1BIA A;  4PJO B;  1VQN A;  2FL7 A;  4CI0 C;  4KQE A;  2RHY A;  5DM7 R;  1UB4 A;  3TCJ A;  1QP3 A;  2XI9 A;  3J7A F;  3A32 A;  2AMC B;  3O8V A;  4UPA A;  2XHC A;  2LTO A;  4C5I A;  1MGQ A;  1M1F A;  4DOV A;  3ZEH A;  1WPY A;  2ZZD A;  3HY1 A;  1EIY A;  2PUO B;  3WQZ A;  2OAU A;  4J15 A;  2XTI A;  3I7F A;  4QVZ A;  4H2S A;  2K3Y A;  3G71 A;  1YB3 A;  2I4O A;  3VYH B;  2LVM A;  2EL9 A;  2RI2 A;  3M5A A;  1SRY A;  4H2U A;  2EWN A;  3P8Y A;  3LC0 A;  2JZ2 A;  3OY9 A;  3NEM A;  4J6Y A;  3PMI A;  3A74 A;  3TU4 K;  4XU2 A;  1K9M U;  3NTK A;  1ATI A;  1G3W A;  4XEO A;  1LYL A;  4EX5 A;  1XTD A;  2E5Q A;  5I21 A;  4TVW A;  2QQA A;  4NOY A;  3IG2 A;  1G3Y A;  3RGL A;  2LQK A;  3JCM J;  4C8Q E;  2JUF A;  4YRQ A;  4OP0 A;  1IZ6 A;  1VQM T;  4MZT A;  4JLG A;  3RER A;  2P0L A;  1VQ5 T;  3S3M A;  5I2S A;  2ZZF A;  2DAQ A;  1JJ2 S;  5C53 B;  3DKM A;  2EQJ A;  5LL6 S;  1Q7Y C;  1NJ8 A;  4X9C A;  3HXU A;  2RB6 A;  4OVA A;  4XTZ A;  4HWT A;  3M53 A;  2EJF A;  3QJ6 A;  3E9I A;  1XQH A;  3JCM X;  5GAN 2;  5FU7 C;  3CC2 T;  1Y71 A;  3VQW A;  3ICA A;  3CCL A;  2QEX T;  2E6N A;  3CXC S;  2DXU A;  1BBW A;  4P73 C;  1Z7N A;  2XD0 A;  4TVY A;  2P0P A;  1ZHI A;  1KC8 U;  3CC4 A;  1B76 A;  4M78 B;  4E7K A;  3UGT A;  3X26 B;  4B9W A;  2LDM A;  4L5G A;  3QII A;  1M8V A;  4M75 E;  3SD4 A;  5GAN 4;  4EMK B;  4PJO E;  2BUD A;  5CQX A;  1VQZ A;  4PLI A;  4BWA A;  3VKI A;  5GAN f;  3G4S A;  2E70 A;  2Q7G A;  1YJN T;  4YCU A;  1ASZ A;  2CZ7 B;  1M4Z A;  2BIV A;  5CIU A;  3GPL A;  2GFA A;  3HRU A;  5A0L A;  1Y96 A;  3BDL A;  1O9S A;  2PVO B;  4M78 D;  3OW2 S;  2PQW A;  4M77 C;  4P75 A;  1KHC A;  3VQX A;  4C8Q F;  1XOV A;  4C0Z A;  2QHU A;  1NYQ A;  4F7U G;  1VUB A;  4BB7 A;  1X2H A;  2RH2 A;  2RJF A;  3MP6 A;  2LNV A;  2KMT A;  4KR2 A;  11AS A;  3IKL A;  3GF5 A;  1UGQ B;  4HVC A;  1L0W A;  1YIT A;  4EDU A;  1SET A;  4YCW A;  4IUP A;  4IUT A;  3UH0 A;  1RIQ A;  4M7D C;  4ZTF A;  3R6O A;  1K73 C;  1EVK A;  1X56 A;  2EJG A;  1S72 T;  1U1T A;  2QQB A;  5CKF A;  3FLG A;  4TVA A;  2DZ9 A;  3MP8 A;  3I56 A;  1VQO T;  4ZTJ A;  3MP1 A;  4YPF A;  2ALY B;  2K5I A;  2M1H A;  1M90 C;  5LJ5 f;  3IKM B;  4J7F A;  4M77 D;  2A8E A;  2DIQ A;  3W3S A;  4E51 A;  4YRI A;  3GLX A;  2RHX A;  1OI1 A;  2HQX A;  1D3B A;  3UWN A;  3OBW A;  3URG A;  4F7U A;  2ZPE B;  2CGH A;  4LD9 K;  5GMK i;  4M75 F;  3RKX A;  1VIE A;  3JSC A;  3HKS A;  1YI2 T;  1QVG A;  4PJO F;  4M7D D;  4LVM A;  1QP2 A;  4ZGD B;  5GAO m;  1JBM A;  3X25 B;  4A54 A;  2Y90 A;  4C92 B;  2DIG A;  2ZT8 A;  4E7J A;  1VQ8 A;  3HFO A;  3P8T A;  3RAC A;  2DZC A;  5GMK l;  2RHQ A;  5K1X A;  3OB9 A;  4TVA B;  2CJ9 A;  1Q7Y U;  3QO5 A;  2CZ6 B;  2P5I A;  2ZPG B;  3NFC A;  3GNF B;  1Q81 U;  5D6X A;  3PFS A;  1FX7 A;  4H2T A;  1KHI A;  1U1S A;  1X75 C;  2HBP A;  1VQ6 A;  2VC8 A;  3OYM A;  4RMF A;  4K87 A;  3M55 A;  2CJA A;  2OTL T;  3RKY A;  2ZT5 A;  4KR3 A;  3L4G A;  4LVK A;  4HWS A;  2V8J A;  3JB9 D;  3S6W A;  1KD1 U;  4M78 E;  3HHT B;  4ZN1 A;  4ELZ C;  3CPW A;  4JLI A;  4F7U B;  4BE0 A;  3I55 T;  3HXW A;  4QQD A;  4YRK A;  4MDW A;  2KVQ G;  4PKC C;  1H4S A;  4HT4 A;  1NE8 A;  1G3S A;  2XID A;  2Q5I A;  3CCJ A;  5FRO A;  4WJ3 M;  3SWN C;  5HK0 A;  3UPU A;  5GAN j;  3VU3 C;  3ZBD A;  3PCO A;  3QBY A;  1UEB A;  2D0Q B;  4CRI A;  3CD6 A;  4BE2 A;  4Q15 A;  1NJ2 A;  2QXF A;  4H2V A;  4LDY A;  4O2D A;  3SWN B;  4BUG A;  2EQK A;  4CH4 A;  1K8A C;  3REU A;  5KCH A;  1NPR A;  3DB4 A;  4RG8 A;  4H2X B;  1YFR A;  4O5V A;  3ME9 A;  5GAN 6;  3AHU A;  2ARS A;  4A4G A;  4YRE A;  2K3X A;  1X2G A;  1VQL T;  1JJC B;  5GAO r;  1B34 B;  1ADY A;  1RI0 A;  3SB2 A;  2HQE A;  3DB3 A;  1K73 U;  3INZ A;  2CZ0 B;  3CEY A;  1QVG S;  2J3L A;  4YRT A;  2ZR2 A;  4M7A B;  4G84 A;  3OSS C;  3A7U A;  3GIB A;  5LJ5 j;  5GAM j;  5GAN h;  4K88 A;  3EFR A;  1DJ7 B;  4C8Q C;  5GAO p;  3UGQ A;  3CBO A;  2RA2 A;  2Q7E A;  2PME A;  3G1Z A;  3S3O A;  1WLE A;  2VGN A;  2A7Y A;  2XGT A;  12AS A;  4A4H A;  3QJY A;  3V8J A;  2JN0 A;  3A8M B;  4YRG A;  1SSF A;  4C92 E;  3LGL A;  2XDP A;  1NJ6 A;  3P8D A;  2F69 A;  3M4G A;  5GAO n;  3PNW C;  2DO3 A;  2VYT A;  1M9S A;  1UGP B;  2DD4 A;  3CPW S;  4YTL A;  3OYG A;  4RCB A;  3GNG A;  4YRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...