3RIRA

Crystal strucrture of biotin protein ligase from s. aureus
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
322
structure length
322
Chain Sequence
b'SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Crystal Strucrture of Biotin Protein Ligase from S. aureus
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 102
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rirA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rirA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rirA02
3QAHA 5HDNA 4HF1A 1XDSA 3M4PA 4HWRA 1P2FA 5K5QA 5CLSA 1HC7A 3CLOA 4L5JA 4O2DA 3B73A 4JRIA 5GAOn 4XSXF 4IHTA 2EJFA 1LNWA 3R07A 2IW5A 4BHCA 2FQ3A 4RQFA 2LDUA 5J6XA 1RUOA 4N9IA 2CFXA 3RACA 4P96A 3WG9A 3JCMg 2RB6A 3OD1A 1H4QA 3R0AA 2F2EA 2HQNA 2IT0A 2XHKA 1DPRA 1KU3A 1U6GA 3L4GB 4NQWA 4AIKA 1LJ9A 2VC8A 1XDUA 3HXUA 1USTA 4P73C 1FY7A 1TQPA 1LQ1A 4CH3A 1OKRA 2KJCA 3BY7A 3HHHA 2BBYA 3FXUA 5BQTA 3BFMA 2DDZA 4F7UG 2AMCB 5F5WA 4FX4A 1LEBA 1ODDA 2FB7A 3TGNA 1WRJA 5HLGA 2KJBA 1W5TA 4HA8A 4IJAA 3HSEA 2QBYA 1BC7C 4WJ4A 5E1WA 3T5XA 1E24A 4BHBA 3EETA 1ZN2A 4EV0A 2STTA 4OIPF 4B09A 1Q1HA 3BROA 5DCMB 5ERIA 4XEOA 3BJ6A 2J5PA 4ESBA 3LFKA 1IRGA 1Z6TA 2ALYB 3HY1A 2XAHA 3VQWA 3H3ZA 3GYHX 4MQ9F 3LSTA 1MJBA 3BJUA 4MMLA 3BPXA 3IWZA 4ASNA 2WWYA 5IT9Z 4MGRA 1K7AA 4J6WA 2M5WA 4I01A 2H27A 1YFTA 1FPQA 5GAN8 3HY0A 1KMNA 2MLGA 4M75F 4F7UE 2W25A 2HOEA 2H6CA 3BP8A 3S2WA 4XU1A 3RPQA 4EMHA 1ZRFA 5GAN7 3LQRA 3Q9SA 3EDPA 4RGRA 2RC4A 1REPC 1B70A 4EMKC 2GXBA 3B02A 2A6EF 4YRLA 2XTIA 2EFNA 4EGYA 1D8JA 4M7DA 4YRFA 4A0XA 3MFKA 5J8FA 3ERRA 3BZ6A 4WI1A 4K88A 1X54A 4KQEA 1PP8F 2XUBA 3PFIA 4LK1F 1FLIA 3K69A 1KQ8A 1F9NA 3WE3A 4ZZDA 2E7XA 5F64A 5L3EA 1O3RA 4YFKF 2E65A 5FFZA 2XKOA 5GMKe 1SD7A 5DDGA 5HDKA 3IG2A 4ETSA 4LK0F 2AS5F 2CO5A 1U3EM 5TJJA 2ZKZA 4FHTA 4I2OA 2L3DA 1YS6A 5DV5A 4P74C 2WC2A 2GXGA 1TW2A 3U2RA 4MQVA 4YRNA 2Z99A 4M7AD 3R4KA 4G9YA 5DUIA 2K57A 1ZAOA 4DPGA 1ZG5A 1FBSA 2Q2EA 3PZCA 4OIRF 5JVTA 2UXXA 1TNSA 1ZG1A 2I4MA 4C8QD 4M75G 5GAMg 2CWEA 4RGSA 4H0EA 3RDIA 2J3MA 1W7PB 1U8RA 5KNNA 5LHIA 1EVLA 4A54A 1IXSB 5HGQA 1YFRA 1NNHA 2MBFA 4M75A 1G3TA 2JN0A 3SQNA 4PJOF 11ASA 5ICCA 3I58A 3R61A 5K5OA 4XU3A 5IT9K 3M1EA 2O0YA 2W85A 4EGZA 3ZMSA 2DQLA 3CO6C 4KICA 2YLCA 1YCYA 1J59A 2O6GE 2YX4A 2B0LA 4ENKA 4HV5A 3A7AA 4Y91A 2ODRC 5DD8A 2V1XA 1KQ2A 1VTNC 5L3GA 2E64A 4Q15A 3NENA 3BOQA 1X56A 3C3WA 5EEHA 3ZMTA 4NL2A 1KYZA 3TO7A 4FT8A 3QTCA 1XSVA 4M6XA 4NB5A 2M45A 2Y90A 2OD5A 2PMUA 1RZ4A 3GXOA 2HKOA 4L0YB 1HSTA 2ADUA 3NEMA 1R5GA 3V4GA 2E1HA 2VXFA 5GAN4 2OU2A 2EFPA 2XV4S 2M30A 3JCMb 3RESA 2QBYB 2DK8A 3QU3A 2Z9OA 3JAMK 4R79A 3L00A 1FZPB 2D45A 1D3YA 2ZIOA 4M9ZA 3W6KB 3HXZA 4A6DA 4IXAA 1USSA 2ZR2A 4YRKA 1IF1A 2P8TA 2J5OA 2DXTA 2RM4A 1XB4A 2GZWA 3T8TA 1HK9A 1H4VB 5LEKA 2VC1A 3DV8A 2JPCA 4U88A 4L0ZB 4K87A 5LJ3f 5GAN6 1YFSA 3QUIA 4RMFA 1I5ZA 3O2PE 2V9VA 5ICEA 2EJ9A 2ZJ2A 3WTSC 4Y15A 4M78F 1QNTA 1I81A 1XGNA 1WQWA 1QZYA 1YIOA 3A7UA 1TLHB 3T0YA 2A07F 4X5OA 2FMYA 4HW0A 1SMTA 1MGQA 2P5IA 1LVAA 1FYMA 4PJOA 3V8LA 4WK8F 1B70B 4I0BA 5LJ3j 3GVAA 4M7DB 5FLXK 1RIOH 2OQRA 2I2LA 1KU7A 2ZXJA 1KQ9A 1FYLA 3ELKA 3EFRA 4YG2F 5LJ5d 3DKWA 1W5SA 1ZRCA 3F8CA 4M77B 2FOKA 2EFQA 4UVCA 1J7KA 2QQAA 4I02A 3E5UA 3K1MA 2GAUA 1O7LA 1TQIA 1OPCA 2A5YB 3WTVC 1V4RA 2F5EA 2VBYA 1S6LA 4KIBA 4A5MA 1LNXA 5GAOr 3REXA 4CS3A 2M8EA 1X55A 3ERED 4IRIA 4J6XA 1RNLA 2XAQA 4RB0A 4M7DC 5E17F 3FB9A 2Z5UA 4KFCA 2ZR3A 5D4RA 5FFXA 1F5TA 3VQVA 1ON2A 1J5WA 5GMKi 3LAJA 4RS8A 2X4HA 1IN8A 4M77C 2LF8A 3E6CC 4HWTA 4EX5A 4PHCA 3HRUA 3FJPA 5LJ5h 2ELHA 3SWNA 1MKMA 4G94A 2VT2A 5ELOA 4M78G 2HEOA 4XTWA 4P9UA 2JRTA 4MEXF 4M9XA 4C92D 2QHTA 1B9MA 1EH6A 3RKWA 1KQ1A 1X01A 4LB5A 1BI3A 3HSRA 1S3JA 1F4KA 4XEMA 1IZ1A 3EYYA 2QLZA 2OAZA 4M78A 3UFGA 4H2WA 1WNLA 3DEUA 3K1PA 4G85A 2XGTA 5DYMA 1XGMA 4M75B 3TUPA 3QO8A 1D8KA 3WGGA 5ILUA 4EM2A 1YB3A 4HWPA 1NJ8A 3U9GA 3BW1A 5AIPA 5GAN5 1G3WA 1YQAA 2E1CA 1HW2A 1IRFA 5K1YA 4NHJA 1W4MA 1T6SA 2LF7A 4LGWA 5A2QZ 4UVAA 1TTYA 2ZNZA 5GMKh 2NS0A 2GWRA 1PDNC 1BI0A 1I6XA 2JPBA 3VODA 1IUYA 1FX7A 4M74A 2DTRA 4M71A 5E20A 4I7HA 4KA4A 5BPDA 3V7CA 2CGHA 2WV0A 3ISPA 4H2XA 4NCXA 2DTIA 4XRFA 3MCZA 2DAOA 5IT3A 3TQNA 3A31A 2OBPA 2Q5IA 1YYVA 1D5VA 5GANf 4ZZLA 1HW5A 1YTYA 2DI3A 4CH5A 3N4MA 3L2ZA 2DQ3A 4HLXA 2VODA 3CUQC 3IKVA 4A5NA 1WQ7A 2HTJA 2NNYA 3P7NA 2A6HF 1YW9A 2XASA 2NRAC 3GFLA 3HXWA 5HS8A 3CMQA 3JW4A 1X2GA 1J9IA 3GF2A 1UCRA 3HXXA 1SERA 1SD4A 5GANj 5K5RA 1H641 4UV8A 2Z33A 5E8GA 2DW4A 2KRFA 4JLIA 3NETA 2UWMA 2IA0A 2ZO4A 4G6DA 3ZMZA 2MA3A 1IW7F 5CVVA 1QBJA 5D5WB 3RUXA 3WU0A 1QZZA 1P92A 3R0JA 5GANe 5AONA 5HOOA 4J6YA 4PJOB 3RYRA 3GEZA 2E1NA 4YYEA 4KMFA 3GFJA 2L4MA 5DY9A 2HNIA 4MNUA 4A2UA 1U78A 1GHCA 3IKTA 4Q48A 2L02A 4AIJA 1HKQA 4N0BA 1YLFA 1PUEE 2RHQA 1SFXA 2VE8A 4UNOA 2O61A 4UPAA 4PJOC 4YPFA 2K7LA 3FMSA 1BBWA 2FU4A 2W84A 5LJ3g 2VE9A 1B76A 1JJCA 1ZGJA 3ZQ7A 1WLEA 3KEQA 5GMKl 1K6OA 1G6NA 2Q7HA 1W66A 4WCGA 3AHUA 1S7AA 1Z7UA 3RPUA 4CHUA 3F8MA 1GXQA 2ISZA 4WF2A 3N97A 2EV6A 4C8QG 2CGPA 3JSPA 1K78A 1ZLKA 3E6BA 3HRSA 5C51B 2RV8A 1HKSA 3F72A 1N9RA 5JFRA 2HZTA 2PJPA 1H4SA 3FIFA 3E5QA 2ACJA 1JBMA 1E1OA 3VQYA 3IWFA 2OQGA 1EOVA 3VBBA 1T98A 4PG3A 4CGZA 1J0RA 5LGUA 3FM5A 1CF7B 1SRYA 3P8YA 1QE0A 1SD6A 4M78B 3KLOA 1WKMA 1LDJA 3REOA 3JCMd 4F7UA 3HIFA 1ZARA 2ZINA 3HFNA 5L3CA 3FHZA 1LJOA 4M7AE 3FMRA 4EJUA 3CJNA 4HBLA 5DCFA 4XTXA 1YW8A 3M8FA 4YRGA 3QU6A 4BQAA 1BOAA 2KIMA 4P5OA 2M1BA 4AWXB 3QO5A 3A5ZA 3J81K 2ZMEB 4LG0A 3SZPA 4OIOF 4C8QE 2TDXA 2QUFA 5HLHA 4M78C 4TQDA 4P55A 4RDXA 2JTVA 4H2TA 4HT9A 2K86A 4G84A 1BM9A 3TEHA 1B1BA 2YR2A 5CVIA 5GAOp 4H2SA 3ZP5A 3HTUA 1FSHA 3JCMh 5K1PA 3L09A 2PI0A 1Z9CA 4H2XB 5E1ZB 4QVDA 1LEAA 4CICA 4UVBA 4XTYA 1EH8A 5HVQC 4U0VA 4BWAA 3K9TA 4AVPA 4BHPA 1FSEA 1O3QA 1M8VA 3C7JA 1OYWA 2HS5A 2HQRA 3JB9H 1C0AA 3NEUA 1R7JA 3OOPA 1SETA 4NL3A 4LNSA 4YCVA 3R6SA 3HYIA 4L5IA 1ZRDA 3HRKA 4IVNA 4EJWA 4E51A 6PAXA 4RCBA 4TVAA 1SMYF 2ODRD 4C92F 2E3CA 4YRQA 3I54A 4HF0A 1PYSA 2ZNYA 4KDPA 3CDHA 4L9TA 3JCMQ 2DFIA 2K02A 4KT5C 4YIIA 2FRHA 2K27A 1EV7A 2PQ8A 3HRMA 3HFZB 3ZMVA 1UHMA 2CJ9A 5D8KB 4HT8A 4WJ3M 3MF2A 3FWEA 3ZMDA 2P6TA 1HXDA 3IALA 4ZYGA 2RVCA 2DU7A 4N0AC 5GANg 4H02A 2V79A 3ZPLA 4XTZA 2I4OA 4Q47A 2ZT6A 4UHTA 4L9JA 4K86A 1J5YA 4P71A 3Q9VA 2WTEA 3JB9J 4R1HA 2K4JA 1YGBA 5BOXA 5CAIA 1KOGA 2FNAA 1SAXA 2VT3A 2YU3A 2RHQB 5DD4A 2DO7A 3JCMX 4BH9A 3KP6A 4A0YA 2XVCA 4IF4A 4DNCA 3KFUA 1JJCB 4OLFA 4XU0A 3VB2A 5GAMd 3FZVA 4PCQA 3ECHA 1O3TA 1IN7A 3ABTA 4EQQA 3GO5A 3PCOA 3M8EA 1KU9A 3FX3A 2VONA 2IY5A 4HV6A 3MWMA 2VOOA 2IRFG 2XAGA 1FBQA 1Y0UA 1C0WA 3J80Z 4C92G 1SFEA 1K78B 1WQ2A 4YRPA 1T2KA 3M9AA 4G6QA 3RKYA 4WXDA 3COAC 5HDGA 3F6VA 1M5Q1 1D3BA 4XU2A 4TQFA 4YRJA 2NYXA 2XGXA 3WU1B 2ZT5A 3QHSA 4D0PA 2RKHA 4XLNF 1I5LA 3K1NA 2E7WA 3U1DA 3TO9A 1YS7A 1Z1DA 2HDCA 5ICFA 4MTDA 2DPDA 5GAMh 4WWCA 2DK5A 3P9IA 3HUGA 2JZYA 4LFUA 1T0FA 3FMQA 3IRRA 1XN7A 1JRIA 4M7DD 4F7UB 4KNYA 4F7ZA 3BPVA 5FGMA 3CO7C 2P5KA 1IN4A 1R58A 4U7DA 2C6YA 5LHGA 5CYVA 5E8IA 3P9KA 1NYQA 2IPQX 3KETA 4M77D 4HDVA 4RAZA 3MEXA 4OP0A 1MDMA 4BW9A 5I21A 1E17A 3INZA 1LYLA 1BIBA 3WGIA 4C92E 4LG0B 4KIGA 2Z3YA 3V8KA 4EVIA 5GAN3 4EJTA 3HTZA 1P4WA 3TEHB 5L3FA 1FBUA 2D1HA 1G3SA 3IL2A 3HSFA 2DZ9A 2Y48A 2RD1A 2Y75A 2ARUA 3KP2A 3D0SA 1NHAA 2I4LA 4MTEA 4N9HA 2CSOA 2RGVA 1UB9A 5D6FA 4LLLA 2EFOA 4KUMA 5FD6A 2Q7GA 3I53A 1OMIA 3LA7A 5L3BA 4I0AA 1USYA 4YROA 3F23A 3EYIA 1AWCA 5FO5A 5F6FA 5LEJA 1P4AA 3W3SA 2QHSA 1BI1A 1XMKA 3MZYA 4GYIA 5JR3A 1R36A 4QVCA 2FBIA 5JHUA 1KMMA 4TVAB 3GFIA 4P75A 4WX9A 1IL2A 2NNNA 2J3LA 1PYSB 3C18A 3J80K 2G9WA 3HXYA 4KN7X 2XKPA 2ZNIA 5GAOm 1JHHA 1LDDA 3WTTC 3QP6A 3EUHA 2IP2A 1WSUA 1N9SA 3PGGA 4X9CA 2IJLA 4I98B 4U0WA 1IXRC 1S8NA 4CO8A 2PMHA 1LB2A 3I0TA 1GVJA 2H94A 3KFWX 3HRIA 3TKYA 3RIRA 3LC0A 1B4AA 4CH4A 3F6OA 4PZJA 3DPTA 4KR2A 3LAPA 3L4GA 3ZN0A 2ISYA 3JCMV 1B7YA 2E5AA 2ESHA 3C1DA 3ABUA 5ICGA 1QGPA 5KVRA 3K0LA 2STWA 4I09A 3FM3A 4XTUA 4DQ2A 1ONVA 1X3UA 4L18B 4H2UA 3O3KA 1XCBA 2FEZA 4ENMA 3E9IA 4HOBA 4P3OA 1ADYA 1VQZA 4E70A 2VBXA 2ZXFA 2FMLA 3PCOB 1NJ1A 2COMA 5K1XA 1Z91A 2IY5B 3LWFA 4G8XA 4M75C 5FB2A 12ASA 2HGCA 2ETHA 2MH2A 3BDUA 3KLNA 4KYWA 4EMKA 4MHGA 1ZH5A 4BNCA 2ARSA 5D8LB 3P8VA 3DP7A 5FD5A 1D3BB 4UP8A 2EL9A 5F1RA 3L7WA 1TQMA 4JQFA 3T1BA 1ZLJA 2L4AA 4HZFA 4HX8A 5E18F 4ON0A 1G4DA 2D1VA 1LOJA 3I4PA 1EQRA 4YRSA 3V7RA 1R5HA 4PJOD 1ASZA 2RDPA 3RERA 3E6MA 2CG4A 4M7AF 1JXSA 4G7ZF 1G51A 2BE5F 2CQKA 1IXCA 1Z6RA 4H2VA 4EMGA 3GZ5A 4LJZF 1JE8A 4H2YA 3RKXA 4OIQF 3JTHA 2ZZEA 3GW2A 1FYFA 4G7OF 5D5VB 1MDMB 2E41A 3V7SA 4C8QF 1R1UA 2RQPA 1R22A 4YRRA 1ON1A 2KKOA 1EIYA 2R3SA 3VEPA 2EV5A 2KIUA 1BJAA 4ZYEA 2QQBA 3MQ0A 2H09A 3JSOA 1H4TA 3PQJA 4AH6A 4FX0A 2CW0F 1WU7A 1B9NA 2ZCEA 3KP4A 3VOEA 5CVUA 5GAOl 2DVEA 3GX4X 4A12A 2ZBKA 3CTAA 1MJAA 2M87A 4PGHA 1XGSA 1B34A 4IRGA 3GLXA 3RL6A 5LGTA 1L0OC 4XTVA 3HXVA 2ARTA 3KZZA 1H0MA 2HFHA 3WTXC 1N9WA 3KP3A 3L9FA 3IC7A 5H6QA 1NJ5A 2A3SA 1S7OA 3V8JA 1ZG3A 4K2EA 5A2QK 4Z2YA 4M78D 3TDUC 3LSSA 4HWOA 1KYWA 3TOAA 3EQLF 1L0WA 2EJRA 4M7AG 1ZREA 1B8AA 1HW1A 1R23A 2ZFWA 1GGMA 2HYFA 1I8FA 1DP7P 4WXCA 2FYKA 1XGOA 4PNOA 3P9CA 4JK1X 4LLNA 4YDQA 4P3NA 4M7DF 1XSDA 3TEGA 3DF8A 3SWNB 4M7AA 5D4SA 2MD5A 1MZBA 4HYEA 3RYPA 3QO7A 4RB2C 4RGUA 3MEYA 1IN5A 4TTVA 5LJ3d 4ZTUB 1JGSA 2V6CA 4M77F 2CYYA 4NOYA 2XAJA 4P75C 2FA5A 3AAFA 4P72A 3KEOA 3SZTA 3DPLC 4EJVA 5LJ5f 2OA4A 4C8QA 2ZT8A 4CYDA 1E1TA 2VXZA 4A53A 1YO5C 3M4QA 3HFVA 2P4WA 1AOYA 5DUKA 3KP7A 1B7YB 1V3FA 2EV0A 3SWNC 3REUA 1X2HA 1FOKA 4AD9A 4LD5A 1U1TA 3LSQA 1EFWA 3VFZA 2G7UA 3TDZC 2EAYA 1NYRA 1J2XA 2PN6A 3RGLA 5LJ5j 3WODF 1I4K1 3BJAA 2DLLA 3WTUC 5LJ3h 2ZTGA 2MLKA 5TRDA 3KCCA 1BBYA 3ZMUA 3RTRA 1ADJA 1T38A 4CXFA 1TNTA 3H92A 1UHWA 4HDUA 1J75A 3H3UA 1SFUA 3O6BB 4Y17A 5ILSA 1G5HA 4A6EA 2QZ8A 1ULYA 1P6RA 3LQQA 3JCMP 5ILVA 4HVCA 2DU9A 1T39A 1FT9A 2O3FA 4EMKB 5LJ5e 2X0LA 2XRNA 5E1XA 2Q7EA 2G4CA 3MF1A 1OR7A 1Y96A 4OOIA 3JB9D 4HAMA 5DEQA 4GYGA 4CS2A 2ZNJA 4M7DG 3DQVC 4ZH4F 4GCVA 3HFOA 2LKPA 3GFMA 2FXAA 3SHFA 3GWZA 4JUVA 4EO4A 2BV6A 5C53B 2XIGA 2F5DA 2YPRA 4O6JA 3RJPA 1ZYRF 5CVRA 4M77G 3Q5FA 4ZYDA 3BDDA 4KR3A 1ZHFA 4WXHA 3QNEA 2EA4A 2PBIA 4YRIA 2DPUA 5GMKj 4HX7A 2PMFA 1I1SA 1W7PD 2NAZA 2V1DA 2Q0OA 3W6JB 1MJ9A 4M77A 4YRTA 2L01A 3QSUA 3JTGA 5AIQA 5D5UB 5LHHA 2DXUA 1XMAA 5CJ9A 1NJ6A 3WTWC 2HWVA 2L54A 1EIYB 5D6EA 3JAMZ 2YHTA 4M72A 5KK1A 2VXEA 1WI9A 1I27A 2HTSA 1P4XA 2PFBA 1XCVA 3A74A 1E2XA 2DQRA 3UH0A 4M7DE 3QPHA 3F8BA 3KP5A 3WTYC 2DTOA 5E3IA 3K2ZA 2R7FA 3P8TA 3DSQA 5LLQA 2RA2A 4TVYA 1KA8A 1XD7A 4M77E 4YFNF 5BMZA 4IRHA 3UGTA 3I7FA 2FNPA 2LSOA 1B34B 4OMZA 3DXJF 2EA2A 4L9VA 2BYVE 2JSCA 2O03A 2RHSA 2C7IA 1ZGAA 2GA2A 2QVOA 2EB7A 1FC3A 4CZZA 2UZKA 3HRTA 2Q8KA 4Y13A 2YX7A 1SESA 4OINF 3NRVA 5J8CA 4HQEA 3MZHA 3F8FA 4ENJA 5H20A 2RN7A 4B8XA 3E5XA 5D5XB 3KZYA 1RUNA 2IVMA 5FLXZ 3JCMc 2LNBA 5GANd 4OMYA 3BJOA 2EK5A 4UXNA 4S05A 3QOPA 3RI4A 3KE2A 2CJBA 4ZTZB 5ED4A 3WTZA 2AKWA 2PEXA 3NQOA 2A61A 5CVJA 1R1VA 4HWSA 1DPUA 5LJ3e 3I5UA 2VBZA 4MMKA 2HKXA 4PDKA 1U5TA 4JRKA 4UUVA 5GAN2 4M7AB 3OV8A 2Y0MA 2PG4A 1DDNA 4KMUX 1IN6A 1LDKB 3DFGA 4L9NA 1B6AA 2D2WA 4GO1A 3E9HA 1FNNA 4YCWA 1WPYA 4C92A 5EEGA 3ULQB 3CUQA 4C8QB 2ZZGA 2GIVA 2ZZFA 1H9TA 4RGXA 4AIHA 5GANh 4M75E 3UGQA 3WE2A 2H6BA 3FXQA 4YFXF 3EFSA 4M7AC 4O5VA 4L87A 3VU3C 1CGPA 1Z7MA 3WQZA 2W24A 2V1UA 2DJZA 1FP2A 4Q5SF 2P6SA 5L3DA 3IKMB 2XAFA 4P72C 3TO6A 2QENA 1O57A 2UXNA 4C8QC 1HQCA 4M9SA 4OU0A 3SFZA 1MGTA 3IRQA 4TVWA 3CUOA 2VC0A 3F3XA 3QO3A 4UP9A 4EM1A 2RNJA 5H6RA 3HOTA 5BS6A 3SXYA 1QPMA 4UV9A 1G5IA 1Y96B 3QP5A 1R00A 4PJOG 4IHSA 5LJ5g 3FXRA 3F8NA 5HLIA 4MEYF 3I71A 1YG2A 1TH7A 1RI7A 3GUDA 2R7DA 3FF5A 5LBQA 2VN2A 3JCMf 2CIMA 4S04A 3ICAA 1A04A 3ROUA 1O3SA 4XLPF 2HYGD 3G1ZA 3J7AO 4P3PA 3I59A 1QQIA 2EWNA 4P9FA 1XSXA 1EVKA 4YREA 2ESNA 2DQ0A 1Z7NA 3WGHA 3F21A 1PP7U 4J15A 4HLYA 3TOBA 3HSBA 4G7HF 1I1GA 4GXOA 1JHFA 4M75D 2DZCA 2FBKA 1HTTA 2KIFA 2JT1A 3E6DA 4LMYA 2W57A 3ZN1A 4RB1A 5JI6A 4QWQA 3I64A 2GA1A 3T8RA 1FYKA 3GIBA 4PJOE 1G3YA 2ZT7A 4P73A 2IA1A 3VQXA 4RQEA 5GAOq 2VOPA 2GQQA 1K79A 2E10A 4ENNA 3L1AA 3JCMe 1TW3A 4R8HA 1KU2A 4ZYHA 1H9GA 2A69F 4TWAA 3LA2A 1YFHA 4J5YA 3A32A 1NJ2A 2I4NA 4EM0B 3G73A 2FBHA 4LLGF 1B59A 1BN5A 1DUXC 3HOSA 4RB3C 2RHSB 4JBAA 5LRSA 3ECOA 2FSWA 3IHUA 4CS4A 2AMCA 4UP7A 1WYDA 2DT5A 2QYOA 1S29A 1WWXA 1KGSA 4RAYA 1OYYA 1U2WA 4BAYA 1CF7A 3LA3A 4V2SA 2PLYA 2F5CA 1EH7A 3JB9F 4HQMA 4RCCA 3BY6A 2A68F 4KIFA 4CDGA 4U7BA 2G7HA 2P7CB 1ASYA 5HS7A 2HR3A 5LRRA 4M73A 5GMKm 4Q6GA 2DU5A 4P71C 2PMEA 2AKWB 5DCMA 4YRCA 1STZA 2O8XA 1UFMA 4HF2A 1U5TB 4YIFA 4XBFA 1IAWA 1RIQA 5ELNA 2ALYA 4A0ZA 2P5VA 2ZGWA 2ZMEA 4IPAA 4TV7A 2P7VB 1HBXG 5HS9A 3G3ZA 4ZIBA 3HHGA 4BYYA 5BPIA 4M78E 4XQ3A 1KQ0A 4C92B 2YLBA 3HTSB 3CUQB 4EJOA 4Q4ZF 2BGCA 2FF4A 4LB6B 2P0LA 4HX4A 3F22A 4ESJA 2MH9A 1FP1D 3NELA 1F1ZA 3IKLA 2DTHA 1U5TC 3GZ6A 2XROA 2FE3A 5C52B 2ZIMA 2AXLA 2ZCWA 4KN4X 3QRFF 3M4GA 5GAMf 1BI2A 3QPTA 2DKGA 4GGGA 4C92C 2QQ9A 4P74A 2YSRA 4QLCU 4ESFA 1ATIA 1QO0D 1YW7A 2EFWA 1Z05A 1QF6A 3JB9G 2DEQA 4M6YA 3SB2A 4EMSA 2C8MA 3PQKA 2QTXA 3JB9I 2OZ6A 1FWZA 3A5YA 3JCMJ 1MD0A 4N0AA 2QWWA 4O3MA 3M7GA 4U0YA 5GAMj 3L2CA 4YRMA 3D5LA 1SD5A 4PGGA 2CJAA 4F7UF 4CH6A 1OYIA 2F5FA 3J81Z 2QM3A 1E22A 2IA2A 3HFZA 1BBUA 4X9DA 1BC8C 5GAMe 2Q5HA 1HSJA 2VBWA 1HKTA 4XSZF 3ML6A 3I59B 2DBBA 1TBXA 2MC3A 1O7FA 2OZUA 2EJGA 3A7RA 3MAJA 4BXUA 1L3LA 1W7PA 3JCMW 4YCUA 2K4BA 5LGNA 1U1SA 4YP0A 2P5LC 2BEOA 3E3VA 1GXPA 2QHVA 3E97A 1USYC 3RF1A 1BIAA 2QHUA 3BWGA 1R1TA 3R60A
chains in the Genus database with same CATH superfamily
5HDNA 2GGRA 4HF1A 4HWRA 1HC7A 2CUEA 2BZYA 2EJFA 4BHCA 4OMFB 4RQFA 2WSCE 2HQNA 1WCMJ 2DBKA 1U6GA 4II1A 4J19A 2VC8A 3HXUA 1FMVA 1TQPA 1LQ1A 4CH3A 2V6EA 1N25A 3FXUA 1EA3A 4F7UG 1KG1A 2AMCB 4FX4A 1NK2P 1W5TA 5KHDA 2EZLA 4WJ4A 5E1WA 2MYSA 3EETA 1ZN2A 1ZTRA 1K9MR 3W2AA 1H92A 4R55A 2R5MA 4B09A 1Q1HA 1P7JA 2V1RA 3OYGA 5ERIA 2J5PA 4AYBA 2ALYB 3HY1A 2XAHA 2BY3A 1Y39A 2Z1DA 5IH2A 2H8RA 4F16A 2EFIA 1IHWA 1ZELA 1FPQA 5GAN8 5EGOA 1Z3XA 2W25A 2HOEA 2KQRA 4XU1A 4OMMA 1M1KU 4A93J 3EDPA 1LUJB 1REPC 4C3HJ 2CMPA 3B02A 2A6EF 4YRLA 4A0XA 3URGA 5HY6A 4K88A 1OCRH 2PUKB 4L5GA 5GADJ 4LK1F 3X26B 2MWOA 5CR2A 1OCTC 4ZZDA 2RHXA 2DLPA 4C0DC 1Z67A 5L3EA 1O3RA 3TW6A 1Y1VJ 1WZOA 1W36D 1T08B 3DKYA 5HDKA 4LK0F 2K2MA 5TJJA 2E60A 1JKQC 1YS6A 2WC2A 2EIKH 4B3XA 2GXGA 3HGGA 3H1CA 3WHBA 4M7AD 2KFDA 3WVDB 2K57A 4ITVA 2AT1B 4DPGA 1WHUA 5C4XJ 1VQPT 2Q2EA 1VYTA 3ME9A 2BY1A 3QWLA 2VQGA 4C8QD 4M75G 1AHDP 2EH3A 2BE9B 1AZEA 4RGSA 2FPFA 1X1CA 5CQXA 2YUOA 4MLOA 2NUZA 1U8RA 1B7TA 1IXSB 1TS9A 1IG7A 5KCOA 3L2WA 1YFRA 2MBFA 4UY8I 3H8ZA 3VS2A 5ICCA 4KH1B 2M0YA 4XU3A 1DGRM 2O0YA 3GP8A 2KAFA 2MABA 2DQLA 3CO6C 4KICA 2E4HA 2KEAA 2NS8A 1I5OB 1GVDA 2E64A 3NENA 4BL0B 3VS6A 5HCKA 4LVMA 3TO7A 3QTCA 2LT4A 3MO8A 3GXOA 2HKOA 2P0KA 3V4GA 2E1HA 2VXFA 2XV4S 1IV8A 3JCMb 4MFDA 3L00A 3KXTA 3HXZA 2DMNA 1VQNQ 1IF1A 3CP8A 2LKXA 2J5OA 3LMMA 2A36A 2RM4A 2LYCA 3PNYA 1HK9A 1ZLMA 5F27A 4MIMA 5M5XJ 2V9VA 3GBQA 2L9NA 4Y15A 1SAUA 3NWSA 4Z88A 4QPQA 2F6CA 3FRNA 3T0YA 2A07F 4X5OA 1XMXA 3GTPJ 3SDGA 1MGQA 4PJOA 1Y8QB 1OYXA 3CCRQ 1KU7A 1FYLA 2HI3A 1W5SA 3TP0A 1H3ZA 2R5YA 1FEXA 2FOKA 3L1PA 2QQAA 3REXA 5FKMA 5FKLA 2DYIA 2GOXB 5D7UA 4BEHB 4J6XA 4DYQA 4RB0A 3DBHB 1VQLT 2Z5UA 3QDRB 5CKFA 3E1SA 5M3FJ 1JKPC 1N6AA 2X4HA 3DTEA 3E6CC 3EGXA 2JK3A 3ZEHA 4Z89A 3FJPA 1XTAA 1YITT 5LJ5h 3SWNA 2XRLA 1PUFA 4M78G 2HEOA 2HPMA 1X1DA 1M3BA 3OSFA 1EH6A 1X01A 2FEIA 1BI3A 3HSRA 2HEQA 1IGUA 1F4KA 1AT1B 2RJDA 3HTRA 1IZ1A 4RTYA 3K1PA 3A02A 1BW5A 3BR5A 2V9KA 1V76A 5J3BA 4G85A 4YIRX 1UECA 1D8KA 4PJNA 3PIOF 1NG7A 3BW1A 2JN6A 3MKZA 2E1CA 2FQ4A 3GTMJ 2HPIA 1XG1A 3FXKA 5A2QZ 5CPRB 2GWRA 1BI0A 4M74A 2F1LA 1OOTA 4I7HA 4KA4A 3CMET 3K10A 3CCSI 2LOOA 4C0GA 3QYHB 3DWLE 2QQSA 4IO9F 2OBPA 3CCSA 1D5VA 5GANf 2DQ3A 4IL6C 2VODA 3CUQC 3IKVA 3CC2T 1ZGWA 5B66C 2HDAA 2NNYA 2KNBB 4LUDA 2A6HF 3PMTA 3FDYA 1V29B 1PWTA 2K3YA 3GFLA 3GF2A 1Z77A 2JM8A 4HCCA 1LPQA 3SDZA 5E8GA 2KRFA 1UGSB 4HCKA 2UWMA 4G6DA 1EJ9A 3RSNA 2YRDA 3RUXA 3MEVA 3CCLQ 5AONA 5J1RA 3BCAA 3TCJA 4PJOB 3H3VK 3D5RC 2XPUA 3O8HA 3GEZA 2COYA 2K4YA 4JDSA 1WHLA 4A2UA 4BY7J 1U78A 2JOYA 2QGGA 4A3FJ 3IKTA 2R5YB 2CYZB 2BZXA 4MZMA 4N0BA 2GCXA 2KMTA 2RHQA 3HL2A 4YPFA 1IHVA 3OMYA 2FU4A 2VE9A 3G1MA 1RPWA 2DXBA 1G6NA 1MHNA 2X3WD 2RNGA 2FRWA 3BTJA 5DLOA 3F8MA 4D1QA 3EGXB 1QPIA 1FIPA 1ZLKA 3E6BA 1WJRA 1PUFB 5C51B 1HKSA 2PJPA 3LYIA 4FQGA 2FPEA 4IUQA 3VQYA 2X9DA 1ZR2A 1VQ8I 2OQGA 3VBBA 4PG3A 4B6MA 2ENMA 3EG9A 3FM5A 1CF7B 4OVAA 1VQ8A 1SRYA 1QE0A 1UAAA 1EZZB 3IP4B 2L0AA 1LDJA 3KBGA 4F7UA 2ZINA 4B47A 1UEBA 3FMRA 3CJNA 5DCFA 2QQ8A 5M5YJ 4JPBW 1BW6A 2EQRA 3A5ZA 4LG0A 3SZPA 2QUFA 5I22A 4M78C 2DETA 3PNWC 5J40A 1I1JA 4RDXA 2RJFA 1QVGP 4G84A 3TEHA 3W6VA 4A4HA 2CS3A 4H2SA 3HTUA 3L09A 1Z9CA 4QVDA 1FTTA 1ETWA 3DEWA 4M3EA 4I6ZA 2ZMEC 4U0VA 2JA6J 4FYXB 4BWAA 4PJ0C 3K9TA 2O4XA 4C5EA 4BHPA 1O3QA 5FRMA 4BUPA 2XF5A 4GDFA 2HQRA 1C0AA 1CQTA 1PSEA 4LNSA 1QVFP 2R58A 1X6BA 4L5IA 2BUDA 1ZRDA 4TVAA 1SMYF 3N5BB 4JX4A 2WY8Q 1KD1C 4J9CA 3CDHA 2K02A 2DMUA 3OR1C 2KR3A 1GBQA 1GCQA 3MF2A 2A28A 1W5CC 1UHSA 4HEA2 5A0GA 1QHHD 2DL5A 5GANg 3DLLA 4K86A 1J3TA 3P8DA 2XF6A 2WTEA 2GM4A 4R1HA 5EEAA 2NWMA 1O75A 2WACA 2YU3A 2RHQB 3AL0C 2Y30A 3KP6A 4DNCA 4OLFA 2FZKB 2DF6A 4CRIA 4PCQA 3ECHA 1O3TA 4EQQA 1M90C 3DLMA 4D9JA 2TRTA 3MWMA 1TWFJ 3SEZA 1FBQA 3J80Z 2KK4A 5IXFA 3GTLJ 3RKYA 1M5Q1 1D3BA 3DLAA 1G8XA 4A4FA 5B1AH 2DN0A 4XLNF 3K1NA 1CKBA 1Z1DA 3EG9B 5ICFA 4AC0A 1JJ6C 2XIDA 2VLAA 5GAMh 3J7AY 2QXFA 1JRIA 4F7UB 1R58A 2VJIA 5I2MA 3P9KA 4RMOA 2K9MA 1MDMA 4BW9A 1E17A 3RDVA 3A5ZB 2CQXA 4LG0B 3V8KA 1JUMA 1Q81U 5FU6B 2IVWA 3TEHB 3VYGA 4LDWA 2Y48A 3OYLA 2RD1A 2CREA 2L0KA 2BHZA 3D0SA 1NJIR 1VQNT 2EYWA 4MTEA 5F08A 2RGVA 3J7ZI 2O4XB 2H8HA 1UB9A 1WZ2A 3I53A 1OZ3A 1OMIA 4XONA 1USYA 1ACMB 1AWCA 3LNQA 1S9HA 3KZIC 1BI1A 4UB8C 2MOXA 3HM5A 3A4CA 1R36A 5JHUA 4TVAB 1OX8A 3ONQA 3GFIA 2MC4A 3J80K 4Q5WA 3HXYA 2D8HA 2XKPA 3U21A 3X25B 1N9SA 5HLTA 4X9CA 1BR2A 3I0TA 1Q7YU 2H94A 1WI3A 5DTDA 4PZJA 2R5AA 5FW9A 4KR2A 2LREA 3LAPA 3ZN0A 3K2AA 5ICGA 2FUG2 4A4EA 4BUGA 1QGPA 5KVRA 3K0LA 3CC4I 2STWA 3QDFA 4XN3A 3EH2A 4L18B 2YDLA 1Y1WJ 3CC4A 4ENMA 3E9IA 4P3OA 3DB4A 2NVXJ 4E70A 1U0JA 2LH9A 1NJ1A 2L89A 3QWYA 3HPGA 4A3CJ 2HGCA 4KYWA 4EMKA 3MKWB 4BNCA 5D8LB 1D3BB 2CKKA 4XLFA 1DU0A 4JQFA 1YI2I 4A69C 2QASA 4Z6YA 1LOJA 1WLPB 2L7ZA 1WHHA 1YI2A 3M9QA 4XK8E 3RERA 2GOMA 1VI0A 2CG4A 1G51A 2CQQA 4LG3A 2ECZA 1Z6RA 2NS7A 1KHCA 1UGVA 4H2YA 3LSHA 3GTGJ 3GW2A 2CZ6B 1MDMB 1MBHA 3CPWA 2E41A 1WHGA 2NVYJ 4ELZC 3H0FA 1ON1A 3LOCA 1YNZA 4LUEA 2M34A 2EV5A 3Q3SA 1A0NB 3JSOA 4FX0A 3SFMA 1MV0B 1N8RR 2CW0F 1B9NA 1ZUUA 1D0XA 5L23A 4FT2A 5GAOl 2DRMA 2PQWA 3GX4X 2R7RA 2ZBKA 3HL8A 1MJAA 1CSKA 2VJ4A 2OF7A 1JJ2A 3GLXA 5LGTA 1AWXA 2ARTA 2VKVA 1UMQA 2HFHA 3L9FA 2KGTA 3V8JA 2QQRA 1KQSP 5CKHA 4GBQA 4M78D 3S14J 3LSSA 4MO7A 3TOAA 4IHWA 3CCLT 3PT9A 1HW1A 4YELA 4WXCA 2EBPA 3K4NA 4JK1X 3BDLA 1QA6A 1XSDA 2DERA 1FMKA 4WTOB 2MD5A 1MZBA 4KBMB 5IN1A 3OW2S 2YRVA 4RB2C 3CF2A 4RGUA 3VSLA 4TTVA 1JGSA 1YHQI 4P75C 2FA5A 3KEOA 3PE0A 4EJVA 3BTLA 5LJ5f 1DP3A 4PSXA 3ZQQA 1X2NA 3C2BA 3M4QA 2BXYA 2IGNA 1YHQA 3HFVA 1RAIB 1VUBA 3SWNC 2VKNA 1X2HA 4ZGJB 3E19A 4LITA 1WJCA 3RGLA 3WODF 1I4K1 3BJAA 4G6TB 2ZTGA 2MLKA 3OR2C 2A05A 1BBYA 2O7OA 2EYQA 3EAEA 4KISA 3ZRGA 3H92A 3H3UA 3CCUT 4A6EA 1ULYA 3JCMP 4HVCA 4XLHA 4EMKB 2DVJA 2XRNA 3DEEA 3MF1A 1IO6A 1LFBA 4HAMA 2L2OA 4RLQA 4QVZA 4M7DG 2L7FP 2Y4YA 5CVRA 3CDIA 4M77G 2HQ5A 3QQAA 2KRNA 4WXHA 3BE3A 4BY1J 5GMKj 1W0UA 1I1SA 2CV2A 3CCEI 2Q0OA 4LVJA 5LHHA 3NTIA 3WTWC 2HWVA 4R0KA 4MDXA 5KNLA 3CCEA 3JAMZ 5KK1A 1M9SA 2TCTA 4BBRJ 4B48A 2QKMB 4LDXA 3K2ZA 2R7FA 2WSFE 1RESA 4KUIA 3DSQA 2QYZA 1JGGA 1XD7A 4TVYA 3FXJA 3JCUC 3OBWA 3UGTA 4EIKA 3I7FA 3REAB 4OMZA 1N27A 4L9VA 4JZ3A 2JSCA 2DODA 2RHSA 2KI7A 4J9IA 2XD0A 4Y13A 5A0DA 2GF7A 4OMOA 3NRVA 5J8CA 4HQEA 4MZPA 3TW7A 4B8XA 5D5XB 3A8LB 1RUNA 5FLXZ 2RQWA 5GANd 3G6EQ 2D8JA 4QQ6A 4ZTZB 1WXTA 2AKWA 5CVJA 3A03A 4MMKA 4PDKA 1U5TA 1WI7A 4JRKA 2FOWA 3HOXJ 2Y0MA 1DDNA 2JT4A 1LDKB 3ASOH 2VYTA 4GO1A 4PK4A 1WPYA 4QIWN 1K0SA 2ZZGA 4RGXA 2PMZA 1CKAA 2LFBA 1U9OA 4ZN3A 4FT4A 2XICA 2DMTA 2EQIA 2V1UA 4Q5SF 3BQZA 3IKMB 4P72C 1QKXA 2QENA 1O57A 2UXNA 2IS1A 2LX7A 4W97A 4OU0A 3SFZA 1MGTA 2VC0A 3OS5A 1RRJA 3ZXSA 3HOTA 3LSIA 2JM9A 1QPMA 4UV9A 3CJRB 4AU7A 4D6WA 2HQXA 1X4PA 5F0HA 1IO2A 4IHSA 5LJ5g 3FXRA 2HOTA 3I71A 1YG2A 1TH7A 4XK4A 3GUDA 5CQEA 1RABB 3HXLA 5LBQA 2FX0A 5FU6C 4S04A 2CJJA 2HYJA 2XK0A 1O3SA 5IHKA 2HYGD 4HVWA 2GQIA 5HK3A 3G1ZA 4LNPA 2EWNA 3M59A 1A31A 2ESNA 2ZXHA 3I56A 1VQ6Q 3I9V2 3VPRA 2QGFB 1JHFA 4GLMA 3UPUA 3G1JA 2JT1A 2O88A 2BY0A 1R8OB 2Y69H 4RB1A 3J80E 2VUBA 3AG3H 1VYVA 2EGEA 3VQXA 4EPCA 5GAOq 2DNUA 4AG1C 4HCBA 3JCMe 4R8HA 4ZYHA 2MK5A 1EKEA 2A69F 1UJ0A 3LA2A 3X2QH 2JJ7A 4EM0B 4BE2A 4LLGF 1B59A 2M7AA 3HOSA 4RB3C 1OPLA 2RHSB 3SDBA 2AO9A 3I9QA 1GCQC 1S29A 2LY1A 4BXFA 3P8BB 4V2SA 1Y7XA 4HVVA 2CQNA 3TU4K 1IUFA 1IJWC 2EKHA 2HU9A 1ASYA 5LRRA 4M73A 4Q6GA 2PMEA 2AKWB 2DT6A 4YRCA 3CPFA 3O8VA 1JJ2S 4HF2A 1U5TB 1QVPA 2HZYA 4YIFA 4A0ZA 4ZYAA 2ZGWA 2RJCA 4ZIBA 2QI2A 4GRIA 3VDXA 3UA7A 3HTSB 4Q4ZF 2FF4A 5IXBA 4MFEA 3F22A 4C5IA 1HF0A 1F1ZA 2XROA 2FE3A 3DB3A 2DMOA 1M1KR 5GAMf 1SF9A 3S32A 2YSRA 1ATIA 3HOWJ 4TVRA 1QF6A 3NHNA 3JB9G 1FMWA 4M6YA 1YHQQ 1S72Q 2QTXA 2F4IA 3A5YA 3GTKJ 3JCMJ 2BVMA 1MD0A 4N0AA 2CUFA 2DM1A 5J4YA 3LWHA 4CH7A 4PGGA 8ATCB 2AZVA 1VQ9I 1W2BA 2CJAA 3CQZJ 1QLYA 3QWXX 1VQ7I 3S2DJ 3HFZA 2GQVA 2WAQN 1VQ9A 1BC8C 1HSJA 1NLPC 4FISA 1UJYA 3TP3A 4XSZF 3MKLA 1VQ7A 3ML6A 1BJZA 2DIQA 1O7FA 1L3LA 4E7LA 1N77A 4BS9A 2P5LC 4FW2A 3E3VA 1H8KA 2QHVA 1USYC 2CS7A 2QHUA 1PG5B 2HOSA 1XDSA 5CLSA 2X4WA 3CLOA 4L5JA 4O2DA 3CC7I 4IHTA 2EQUA 5KYYA 3R07A 2EYZA 1YBYA 4RM2A 1RUOA 3CC7A 2CFXA 4NC6A 3OD1A 4PL6A 2Z2SB 5TGTA 2LP5A 2PU9B 1XDUA 4P73C 2CRGA 2KJCA 2E36A 4AIDA 3BFMA 2VJ5A 1LEBA 1X4OA 2H3EB 4CC3A 1BR1A 3M1CA 3TGNA 1HOMA 3EPZA 3OSSC 4IJAA 3S17J 2FD5A 4XR6A 1VQMQ 2HBWA 3T5XA 2VQHA 3GTOJ 1OU9A 2KDZA 3BROA 4XEOA 3EG2A 2A7YA 5IHNA 2I10A 1IRGA 5IY5H 3JRGA 2KRSA 3LSTA 3HOZJ 1MJBA 3BJUA 4MMLA 3BPXA 3IWZA 3FC3A 4MGRA 2H27A 1YFTA 2AHQA 2AQFA 3UR3C 1KMNA 2MLGA 3OYFA 4EMHA 4RGRA 1C1AA 1I0CA 3LGFA 4EMKC 2XTIA 2EFNA 1D8JA 4M7DA 4YRFA 1G2HA 2I5UA 2EIMH 4AUXA 1N5ZA 4L5EA 1H8AC 1X54A 2NXNB 3PFIA 2V8IA 3K69A 4V2GA 5FJ8J 1KQ8A 3WE3A 2XGEA 1RLPC 2E7XA 4C0ZA 4E7SA 2G3RA 1PC0A 4YFKF 4CCNA 2E65A 2XKOA 1MMAA 1WPKA 5DDGA 2I8DA 1TUCA 3IG2A 1RACB 2LZ6B 4KULA 2DOAA 2F4OB 2Z99A 1GXIE 2IEKA 3HOYJ 3CCJI 1FBSA 2O2OA 3PZCA 4OIRF 2HNHA 3ASKA 2LT1A 1TNSA 3WXMB 3CCJA 1KSWA 5GAMg 5K7ZA 2X4YA 3NMZC 3RDIA 5KNNA 1Z7LA 1W6XA 5HGQA 2M8GX 1ZQ3P 2LTPA 1MW7A 2ELJA 2Q1ZB 4XLCA 3SQNA 4PJOF 1SRMA 2HVSA 3I58A 2W85A 2L9VA 2YLCA 1J59A 2O6GE 2ZAEA 1SVMA 2L9SA 2V1XA 4RMNA 3KFVA 4DZPA 5L3GA 4X1VA 3I56Q 1K8AR 3C3WA 1X56A 5EEHA 3ZMTA 4NL2A 2VXDA 1ETQA 5EJCA 4FT8A 3C2GA 3G6ET 4M6XA 4NB5A 2V8JA 5H2FC 1RZ4A 4LXCA 2EKOA 5GAN4 2M30A 3I3LA 2JUFA 2DK8A 2Z9OA 1FZPB 1D3YA 5KAIC 2ZIOA 4A6DA 4IXAA 2EQJA 3O5ZA 2P0PA 4J9FA 3LX7A 4OMPA 1H4VB 4K87A 5GTIC 4RMFA 4CC2A 3J7YJ 5ECAA 2EZKA 1G83A 2ZJ2A 3VS4A 4AG2C 2ESWA 1QZYA 1YIOA 3QYFA 1TLHB 1SMTA 4X6AJ 4WK8F 4F17A 5LJ3j 2KMUA 4M7DB 2XB0X 1KC8R 2ZXJA 1KQ9A 1VQ5T 4LDYA 2E5QA 3OS1A 2BKDN 1YX3A 3H9GA 1Q82C 4YG2F 5LJ5d 3OYEA 1ZRCA 3F8CA 4M77B 4UVCA 3E5UA 1UHFA 1TQIA 5LJ3e 1LNXA 2F5EA 4A5MA 5GAOr 4CS3A 1S6LA 4YRVA 1O9SA 3ERED 4IRIA 3PUBA 5E17F 2RI2A 5FFXA 3VQVA 1QCNA 3LAJA 4RS8A 1IN8A 4PHCA 3G7ZA 2X35A 1QKWA 1MKMA 4QTRA 3GOXA 1VQ6T 5ELOA 1WIEA 2HXIA 2JRTA 3SFIA 4A3GJ 4DYRA 1B9MA 4LB5A 2KPMA 3H5RA 1M3CA 1K73U 4M4ZA 3CXCA 3CCMT 2OAZA 3UFGA 2P0WA 3RBBB 4F14A 3DEUA 1VQLI 3PVLA 2FO0A 2MI6A 5CKDA 1YQAA 1G3WA 4CCMA 1VQ9Q 1VQLA 1HW2A 5K1YA 4HXJA 1W4MA 1T6SA 2LF7A 3NARA 2QEXQ 4LGWA 4UVAA 3LLRA 4C5HA 3BZCA 1PDNC 2PVOB 1IUYA 3VODA 1FX7A 2LVMA 2JA5J 4M71A 2IXSA 4XAXB 4H2XA 2KT0A 2DT7B 2DAOA 3O8GA 4PFOA 5IT3A 1NYGA 1RAHB 1HW5A 1YTYA 3K4JA 2DI3A 3N4MA 3L2ZA 4HLXA 4LVIA 5B1BH 2J6KA 4DA4A 2AQEA 1WQ7A 2HTJA 1ETVA 1YIJA 4LVLA 4AYBN 1J9IA 1UCRA 3HXXA 2Z33A 4C0FA 4JLIA 3NETA 3G2BA 1QWFA 1KIKA 3CMEI 2IA0A 3DU5A 2MA3A 5CVVA 2WA0A 1QZZA 2JA2A 3CMEA 1P92A 3R0JA 2Y2ZA 5HOOA 4D7MA 2XPWA 3PIPA 2RQQA 4YYEA 3GFJA 3F9KA 2P4TA 2M4KA 1S72T 4Q48A 2ICWG 2L02A 1Y0NA 1OCPA 4DGWB 4ZGDB 1SFXA 2O61A 4UPAA 2K7LA 1BBWA 3CJTB 2D6FA 1B76A 1JJCA 5K7HA 1MNEA 1JI8A 4FSXA 4R56A 1S7AA 1ZA1B 1Z7UA 4CHUA 2DA2A 2ISZA 2QTVA 2K3XA 2EV6A 2EPFA 3AG2H 2Y4XA 1ENHA 4C8QG 4KGVB 3HRSA 3F72A 2HZTA 3E5QA 3LL7A 4HKEA 1T98A 1A36A 5KCMA 3JRZA 1J0RA 3K7AJ 2L2PA 2RNAA 3P8YA 3KLOA 1WHJA 3HIFA 1SC7A 3HFNA 3FHZA 1U8BA 4HNUA 5FKKA 4YRGA 3M53A 3QODA 2DYBA 4CUGA 4P5OA 3OS2A 3DLLF 3QO5A 3J81K 5HLHA 3CCJQ 1OISA 2OCEA 3UATA 2PJRA 4H2TA 2R92J 2K86A 2XPVA 3LH0A 3ZP5A 1Q81R 1VQMT 5K1PA 4H2XB 4CICA 2JA7J 4XTYA 4VUBA 4RTWA 4AVPA 3Q0VA 1FSEA 5TISC 1IGNA 1RLQC 3C7JA 3GNFB 3AG4H 1SEMA 4J9BA 1E3HA 2COZA 1ZQ1A 4YCVA 3PFSA 3LWIA 1QQJA 3I54A 4HF0A 1PYSA 2KXDA 2ZNYA 3JCMQ 1RUWA 1VQOT 5GPAA 4KT5C 1T56A 4YIIA 1A35A 2PQ8A 1E6HA 1RC9A 3Q0WA 3ZMDA 2DU7A 4N0AC 1Q7YR 3ZPLA 4XTZA 2I4OA 2HOAA 3PJRA 4Q47A 1Q86U 4UHTA 4L9JA 1UG0A 2LG4A 4XM3A 1ERDA 2K4JA 1MBKA 3ASNH 4XRSA 4DOZA 1ZUYA 2FNAA 1SAXA 2DO7A 4OB2B 3OY9A 3KFUA 1JJCB 2CUZA 3VB2A 1AOJA 1R5ID 5GAMd 4IUUA 1Y0MA 1IN7A 3ABTA 3GO5A 3PCOA 3CXCP 2IY5A 4HV6A 2VOOA 2IRFG 4B3AA 1Y0UA 2R4GA 4YRPA 1WQ2A 1T2KA 2CW7A 2KIQA 4YRJA 1TWAJ 2XGXA 2ZT5A 3QHSA 4D0PA 1K4US 2M1HA 3A01A 1PM3A 2E7WA 3U1DA 4BQOA 2RH2A 1ZR4A 4Y92A 2N8GA 3KEYA 1K9MU 4XIDA 4WWCA 4F92B 3P9IA 3HUGA 3BR6A 3LSMA 3IRRA 1XN7A 3Q0UA 4KNYA 1B07A 1IZ6A 1IN4A 1TT0A 4CA0A 2C6YA 3ULRB 2IGKA 2LCLA 1X6OA 3I56T 5D6WA 3KETA 1Y07A 3MEXA 4OP0A 2QF7A 5FLMJ 4C30A 4HCZA 3BG3A 1JT6A 2K9LA 3WGIA 4C92E 4KIGA 2R7WA 2MWPA 2O9SA 2PJRB 5GAN3 3OMGA 3HTZA 3OL4A 1K4SA 2Z0WA 2ARUA 2CQ7A 3I55I 3JV3A 2I4LA 2BZTA 1XX5A 3MMYB 1Y71A 4X0GA 1NZ9A 4ZDLA 5FD6A 3UKGA 3I55A 3LA7A 4YROA 5GAEJ 3F23A 3N05A 4X1EA 5F6FA 1WVRA 1TWHJ 1P4AA 3W3SA 1XMKA 3MZYA 2KZGA 4N4IA 2EYXA 4QVCA 3OYYA 4CC4B 4WX9A 1PYSB 4IQJA 3C18A 3MVPA 2E19A 5EC7A 4F3QA 2LR8A 1JHHA 2K5LA 1LDDA 3OYIA 1VF9A 2DIGA 4BI4A 3EUHA 2IP2A 2Y0SN 1VQNI 3WG7H 4QPOA 2A8EA 2XKOC 1IXRC 2GTJA 1QHGA 3MKDA 1UGPB 1LB2A 3KFWX 2NVUB 3HRIA 4ZJZA 2JSPA 1VQNA 1GBRA 1YIJQ 3F6OA 2ISYA 3JCMV 1B7YA 1DJ7B 2ESHA 4IUTA 2E5AA 4A3BJ 2R5ZB 1JTYA 3TMOA 3FM3A 1M2OA 3ZCOA 1D1AA 2BZ8A 1X3UA 4HOBA 1ADYA 3CCYA 2VBXA 5FU7B 3PCOB 3S3OA 5IP7J 2K9SA 4AVZA 2IY5B 2MPXC 2X4XA 3CD6Q 1R4MB 3C4SA 12ASA 2VB6A 4J7FA 3QG1A 4MHGA 4UUSA 1TP4A 2EL9A 1TQMA 1ZBJA 3VKIA 4JZ4A 3A01B 4D8KA 1Q82U 4YRSA 3J7AF 3HUGB 2JQ7A 2QEXT 1JXSA 4QKUA 2CQKA 1WHKA 2AHJB 3EG1A 4F91B 2LBFA 3JTHA 2ZZEA 1FYFA 2C0TA 2XAUA 3WU2C 1T0HA 2E34A 1EIYA 2CT3A 2R3SA 4C9YA 2ZZDA 1T0FC 2KIUA 1BJAA 1TT5B 3EHQA 1H4TA 2CT4A 2ECCA 3LGLA 2ZCEA 3KP4A 3VOEA 1NEGA 5CVUA 2DVEA 4A12A 3JSCA 4JJNK 2AK5A 3UDCA 2M87A 3S1QJ 1B34A 4D7NA 2HKNA 3CESA 4HVUA 4BI3A 1TTHB 3WTXC 1N9WA 3KP3A 5H6QA 5CKBA 2A3SA 1S7OA 3I5SA 2Z16A 1JJ8C 4Z2YA 2RF0A 4KT0E 1L0WA 1ZREA 2JW4A 4BU2A 2XSDC 2OCCH 1GGMA 1JU5C 2RAEA 1DP7P 2R7XA 3HDDA 5B5EC 5JLXA 3RMSA 2QDLA 3FISA 2RO0A 3DF8A 4BJ5C 3OS0A 2DMQA 4M7AA 5D4SA 4CZCA 3RYPA 2CUJA 1IN5A 1ETXA 3S15J 1BKBA 2LTOA 3AAFA 1M1GA 2QAZA 2OA4A 4C8QA 2ELKA 2ZT8A 4LOCA 1YO5C 3AT1B 4JJDA 1NG6A 2MIOA 1B7YB 2CZ7B 2EV0A 1FOKA 3K4LA 4LD5A 3CCLI 3VFZA 3VS0A 3TDZC 2JJ9A 3HPWA 2F4MB 3DTKA 2DLLA 5TRDA 3CCLA 1ADJA 3BR2A 1KD1R 1T38A 4CXFA 1TNTA 3K70C 5KYWA 3J81E 1SFUA 4Y17A 5ILSA 3CMAQ 5CIUA 4M3DA 1T39A 3I5RA 4UUSB 4II2A 2G4CA 1OR7A 5DEQA 3HGYA 2LKPA 1GT0C 1K9AA 3SHFA 1AWJA 1O4XA 3GWZA 4JUVA 5C53B 2WV1A 3GMEA 3RJPA 4QQDA 3Q5FA 3CCJT 1ZHFA 2R0QC 2A3LA 3QNEA 3QXEB 4YRIA 2DPUA 3FBIB 5M3MJ 1I07A 3ABLH 2LBFB 2NAZA 3OYKA 2HDDA 1MJ9A 2L01A 5E3LA 2DXUA 3CCUI 3BLYA 2JVGA 2L54A 1EIYB 3QZ9B 2KVQG 5D6EA 4BACA 4BEHA 3LSRA 1M90R 1WI9A 4B9WA 4DBQA 3CCUA 4EEFG 2HTSA 1P4XA 3DPUA 2OUMA 2VL8A 3BG6A 3QPHA 2FJ1A 3F8BA 5E3IA 2DFHA 3RPUD 9ANTA 2K5IA 3ZQHA 4NS5A 5DS9A 4LN2A 4YFNF 1Q81C 4IRHA 1U9NA 1C0MA 2FNPA 4FE4A 2LSOA 1B34B 3DXJF 1H3HA 2EA2A 4XMYA 3WVEB 2CW8A 2QVOA 1FC3A 1W4SA 1JT0A 4FTHA 1V54H 3MZHA 2FL7A 4XKBA 3FBNB 2RN7A 2JMWA 2JS0A 2IVMA 2X6OA 5IAYA 2LNBA 2RPNA 2LVSA 2EK5A 4UXNA 1VYUA 2ZFUA 3ZQGA 5ED4A 2HSPA 2PEXA 3NQOA 2R7UA 2A61A 3I55Q 2VBZA 2HKXA 4M7AB 2WBMA 3E9HA 4YCWA 2NOJB 3ZQLA 5EEGA 3ULQB 4C8QB 1H9TA 4AIHA 3PUFA 3WE2A 4YFXF 1PNJA 2DK3A 1IGQA 1Q7YC 1Z7MA 1CGPA 3WQZA 2OTLI 4DEXA 4IOAF 1FP2A 4YTLA 4BJTA 1SG5A 2P6SA 5L3DA 2XAFA 1QWEA 2OTLA 2JVVA 1HQCA 4AFZC 3MN2A 5KYWB 2F2XA 4UP9A 2ABLA 5H6RA 1Y8RB 3ABMH 2FG0A 2FPDA 2EIFA 1AD5A 2WB1A 1UELB 4MEYF 5J39A 2J05A 1ZSZC 2IBDA 1RI7A 3META 2R7DA 1E0EA 2VN2A 2DEUA 4F55A 3ROUA 4XLPF 4P3PA 2IS2A 2CH4W 3NAUA 5EG0A 4RBOA 3TOBA 5E3NA 4G7HF 2MF2A 2M4GA 4LMYA 1K76A 5JI6A 1TC3C 1FYKA 4PJOE 2ZT7A 2RHZA 5DM7F 3A0HC 3X28B 2VOPA 2GQQA 1K79A 2DYSH 1Y57A 2V8KA 1TOVA 4XN0A 4TWAA 2E1MB 2P81A 2DBMA 3PL8A 1V5FA 2QGUA 4Z02A 2I4NA 5GAHJ 2X6XA 4KT6A 4J83A 5LRSA 3IHUA 3E2UA 2QYOA 3OYMA 2ZB9A 4LD6A 3S1NJ 1CF7A 5GP9A 2PLYA 1EH7A 4DYCA 4II3A 4CDGA 2W7NA 2G7HA 2P7CB 2KRMA 4V2FA 2DU5A 3EFOA 1STZA 2GLOA 1QP2A 1YIJT 1LPLA 3IUOA 4C5GA 1IAWA 3RZOJ 2ROTA 4TV7A 1HBXG 1HA8A 5D6XA 4OF1A 3G3ZA 4IKFA 4J8OA 1S5LC 2IPOB 3M0SA 3HHTB 2BGCA 2P0LA 3HOUJ 4F93B 2WADA 2MH9A 2DTHA 1PVEA 2AXLA 3QRFF 2A5WA 1WXUA 1ZHIA 2WAFA 3CD6T 3HEFA 3ZFJA 3FXOA 1YJWT 4C92C 2QQ9A 3OSVA 4ESFA 2FVUA 1LKXA 3VRZA 1YW7A 4B1RA 3JRDA 3H0HA 2DEQA 3SB2A 4EDUA 1HDDC 2ID3A 2OAUA 1NJIU 2KSSA 5J1YA 2QWWA 4O3MA 4U0YA 3L2CA 4YRMA 3D5LA 2VGNA 4CH6A 4ABZA 1E22A 2IA2A 2RQUA 3VJPA 5IYBJ 4FL6A 1BBUA 5C4JJ 4X9DA 1HKTA 2LRQA 1RAGB 3H41A 4RTZA 2DBBA 3PO2J 2JTMA 2W82A 2NVQJ 3H0IA 4L6V5 3A7RA 3QPSA 4BXUA 5EG0B 3K70D 3E9GA 5I11A 2K4BA 5LGNA 1ZUKA 4OB0B 2ZPIB 2BEOA 1M4ZA 1GXPA 1NPPA 4KUDK 2L9RA 1BIAA 3BWGA 3R60A 1H88C 3M4PA 1P2FA 5K5QA 2PNIA 3B73A 2NUTA 5GAOn 1LNWA 3A8MB 4DBRA 2D1XA 4E7JA 4A3IJ 3PTAA 3CMMA 2G0EA 2KHMA 3R0AA 2F2EA 2IT0A 2XHKA 1DPRA 1KU3A 3L4GB 3RMQA 1LJ9A 9ATCB 3EUHC 2KT8A 5F5WA 2BBYA 5BQTA 1GDTA 2DDZA 5E3MA 1ODDA 2VASA 3CCUQ 1WRJA 2KJBA 2A0FB 4PLIA 2E5KA 2M0OA 3RQ4A 4FCYA 1E24A 4PLLA 3EFOB 3PSIA 1I6HJ 3BJ6A 3LFKA 1Z6TA 3VQWA 3H3ZA 4QSHA 3GYHX 4MQ9F 2FZCB 4IIOA 1BU1A 5IT9Z 1QMCA 1K7AA 2M5WA 4I01A 4IHYA 2EIJH 3OA6A 3HY0A 4F7UE 2H6CA 2KDSA 4C2MJ 1G2BA 4B44A 5GAN7 3LQRA 3Q9SA 2RC4A 2PMZN 1B70A 2GXBA 4EGYA 3MZ8A 3MFKA 5J8FA 1SVLA 3CMAT 1PP8F 1NM7A 1MNDA 1YOVB 1FLIA 3OW2A 1F9NA 1MBEA 1NTCA 4DZJA 1N8RU 4IOCF 5FFZA 2DCEA 1B72A 3BT9A 5KAFC 4ETSA 2AS5F 2CO5A 2ZKZA 2K5CA 2L3DA 4P74C 1PKSA 3NFCA 1SFOJ 1TW2A 4YRNA 7AT1B 5DLQE 3ZBDA 3R4KA 2OTLQ 5DUIA 3FK6A 4Y4RA 1XQHA 5JVTA 2HAXA 2A6TA 2QA4I 4ZTJA 2CWEA 2DXIA 2J3MA 2QA4A 4A54A 1RR7A 4IX7A 3FHNA 1JO8A 3GLLA 1K73R 4B4CA 4M75A 1NNHA 2L3RA 2LJ0A 1UHCA 3R61A 5K5OA 3S1RJ 2RK1A 5IT9K 1ETKA 3M1EA 4EGZA 2H1LA 4GFBA 2BOLA 2ECBA 1R0CB 3ZMSA 2NUTB 1YCYA 3I4MJ 2YX4A 2B0LA 4HV5A 4FASD 3A7AA 1RR8C 5DD8A 1VTNC 1Y56A 4Q15A 2EBIA 3RQIA 2KRHA 2HSEB 1D0YA 1POGA 4RTUA 1KYZA 4I99C 1UZCA 1UGQB 2M45A 1B8IA 2Y90A 2OD5A 2PMUA 3OWTA 4E47A 2LC4A 4L0YB 1BK2A 3NEMA 1R5GA 3R6NA 2OU2A 3I55T 1DU6A 3RESA 4R79A 1D5YA 4JLGA 2V9PA 4M9ZA 1USSA 4YRKA 1XS9A 5GJWB 3K4KA 1Z9ZA 2GZWA 4E6RA 4U87A 2ZXWH 2VC1A 4U88A 4L0ZB 2OTJT 2LDMA 3BTIA 1QCOA 1YFSA 1X69A 3QUIA 3MEUA 4CSWA 5DM6F 2ZCFB 5ICEA 1QNTA 3G1LA 1I81A 1XGNA 1WQWA 3A7UA 3G6EI 1G59A 2P5IA 1FYMA 3G6EA 1B70B 3PO3J 3H9JA 5AYFA 2OQRA 2LQNA 4J9DA 4DOWA 1MV3A 1QCFA 3EFRA 1YWOA 2EFQA 1UG1A 3OYDA 3A2KA 3K1MA 4HG2A 1OPCA 2VBYA 1V4RA 2XB5A 2M8EA 1X55A 1RNLA 3FB9A 5E79C 2XGDA 1B72B 4KFCA 2X6WA 5D4RA 1F5TA 1ON2A 3TL4X 2KZVA 1YX5A 2LF8A 4HWTA 4EX5A 3NWTA 3HRUA 2RHIA 1ZK8A 2RQTA 1TXQA 2OI3A 2OX7A 3VRYA 2B86A 2R7ZJ 1D09B 3SJMA 2VT2A 1VQ5I 4XTWA 4P9UA 3G4ST 2GTOA 3RR6A 4MEXF 4C92D 2QHTA 3RKWA 2QG9B 3LW5E 1VIFA 1VQ5A 1S3JA 4XEMA 2DL7A 2E1MC 2QLZA 4M78A 4H2WA 2XU8A 2XGTA 3OYBA 1JXOA 2E6NA 4M75B 3TUPA 3WGGA 2LJ1A 3BG9A 3QIIA 5ILUA 1BCOA 1YB3A 4HWPA 4E2FB 3PIPF 1AZGB 3MHXA 1YJ9Q 1VQKI 2KRCA 3E0JB 1IXDA 2ZNZA 3VYUB 4A3KJ 1E6GA 5GMKh 1I6XA 2JPBA 2V1QA 1F1BB 1KHIA 1VQ6I 3U23A 1VQKA 4GY5A 5E20A 4ZN1A 2MFZA 2MAMA 5BPDA 3M56A 2CGHA 2WV0A 1VQ6A 2IS6A 4NCXA 2DTIA 1B8IB 4NNJA 5IP6A 4MZTA 3MCZA 2HVQA 3TQNA 1SEUA 3CCMI 2ZPBB 3A31A 2Q5IA 1YYVA 1M8MA 4ZZLA 1MMNA 4CH5A 2D5VA 1AVZC 3CCMA 1MIJA 2RREA 3P7NA 1SPKA 2E3HA 4J9EA 2VJJA 1SERA 2JNGA 3OB9A 1SD4A 5GANj 4HNVA 1GFDA 4A63B 3LSKA 4UV8A 2JA8J 5F1JA 5J47A 2LY9A 1IW7F 1TWBA 1QBJA 5D5WB 3BR1A 2DTZA 3WU0A 4C2TA 5BNGA 5GANe 3DBRB 2R7OA 2M0CA 1XTDA 3GPLA 4QT7A 3H5AA 2HNIA 1GHCA 2K85A 3NGPA 5C0MA 1HKQA 2L7KA 1Q86R 2VUMJ 4BY6B 4JX6A 3NTHA 1SSHA 1YLFA 1PUEE 4UNOA 4PJOC 1M3AA 2W84A 1ZGJA 3ZQ7A 1WLEA 3KEQA 1YCSB 1K6OA 2Q7HA 1W66A 1ABOA 1GXQA 2HCKA 2GBQA 3FLGA 1T8IA 1VNDA 3JSPA 2X51A 5JFRA 2YWWA 4ZTFA 1H4SA 3FIFA 1JBMA 1E1OA 1S72I 4XORA 1EOVA 3DU6A 4CGZA 2ZJRF 5LGUA 1KK7A 1GL5A 5C6SA 1S72A 2RQVA 1SD6A 3OYNA 3MPUB 4J9GA 4M78B 1WKMA 1UJ8A 1R49A 1ZARA 1LJOA 4HBLA 1WJQA 2JZ2A 3GTQJ 3QU6A 3OBYA 1RAAB 3EG3A 1BOAA 2KIMA 2R7TA 2M1BA 4AFUC 1EX4A 2ZMEB 2VPRA 2NUPA 2TDXA 1VZ0A 5IOYA 2E2JJ 3C12A 3M0TA 2JVHA 4TQDA 4P55A 3JRBA 2LQWA 4HT9A 1H89C 2IS4A 1BM9A 4FE7A 2QSFX 3G71T 2QA4Q 4XQFA 4DJAA 3W3CA 3JCMh 2PI0A 2DFEA 4UVBA 3MP1A 4PSWA 1DQUA 2X4JA 4LD9K 1WDXA 1FIAA 2DFFA 1RL2A 3NEUA 5FKNA 2YSQA 3H5NA 1SETA 3LFUA 2KDOA 4ZGEB 4E51A 4RCBA 1UDLA 3MD2A 4C92F 2E3CA 4YRQA 2RI3A 2KQWA 2O9LA 3A0BC 2K27A 4Y3OA 1VQMI 3SYTA 1EV7A 3HRMA 3NPFA 3ZMVA 1UHMA 3X20B 3AL0B 1VQMA 3FWEA 3IALA 1HXDA 4ZYGA 2ZJPF 4H02A 4JS4A 2V79A 2ZT6A 4KITB 1RI0A 2PZ1A 4E7ZA 3Q9VA 1YGBA 5CAIA 2P84A 5DD4A 2PUOB 4BH9A 3CEYA 1M30A 2XVCA 4E7IA 1VQOI 2OTLT 1HSQA 3FXLA 4OWRB 5IT9E 1VQOA 4HPQA 2C0IA 2V7FA 2YUQA 3S3MA 2HQEA 4ZDPA 2KP6A 2XAGA 1C0WA 3PVQA 1SFEA 3M9AA 1WH5A 3COAC 5HDGA 3M4YA 3M8JA 4TQFA 3WU1B 2CV1A 2RKHA 1I5LA 2XI9A 4CCJA 1YS7A 2HDCA 4MTDA 2DK5A 3C0CA 2M3AA 1QVGA 2DOEA 1Q82R 2L7MP 4XLAA 2JRMA 4F7ZA 3BPVA 2P5KA 1ETOA 1PHTA 4U7DA 1YJNQ 3BG5A 5LHGA 5CYVA 5E8IA 1NYQA 2IPQX 4HDVA 4RAZA 1K73C 5I21A 4RTVA 1LYLA 4KH0B 1BIBA 2F2VA 3CCVI 2NUPB 3D1NI 4EVIA 1VQ5Q 2R7VA 1RAEB 2JTFA 3CCVA 5EGOB 3IL2A 1QVFA 2DZ9A 2K3BA 3L2UA 5LD2C 2VVKA 3DBLB 2KYBA 3KP2A 3SHWA 1NHAA 2XMFA 3CPWP 2CSOA 1OX9A 5D6FA 2DJIA 3QOEA 2EFOA 4KUMA 2E5NA 2Q7GA 1OULA 5L3BA 2ZPGB 1U3OA 2IIMA 3EYIA 3FIWA 4DW6A 3I56I 1VQKQ 2J7IA 2QHSA 4GYIA 4HRIA 2FBIA 3WHCA 1JKOC 1QRYA 4P75A 3DKMA 1MNMC 2G9WA 1JJ2P 8AT1B 4RG8A 2SEMA 1D1CA 2DA3A 2ZNIA 2JTEA 4CC7A 1HJDA 1RI9A 3QYEA 3CJQB 1MUZA 3WTTC 3QP6A 1UUEA 3PGGA 2OJ2A 3CCMQ 1N78A 5HODA 3L2VA 4I98B 2XDDA 2MD0A 4CO8A 2Q2EB 2RHYA 2PMHA 1GVJA 3CDLA 3TKYA 3HBLA 1B4AA 1PKTA 1JQQA 2GFAA 2YUPA 1RADB 2LX9A 4IUVA 3RCOA 3MKYB 2KXCA 4I09A 4XTUA 4DQ2A 1ONVA 1GFCA 5E3OA 3FKIJ 1QU3A 3S6WA 1VQZA 2ZXFA 3CQTA 1K8AU 2EQMA 5K1XA 2LQKA 3LWFA 1Q95G 4G8XA 3REBB 1OCZH 4UB6C 5J4VA 4M75C 2ETHA 2MH2A 3KLNA 2ARSA 3P8VA 3E7LA 2KISA 4UP8A 1R4NB 2KE9A 3L7WA 4XICA 3LSGA 1WJBA 3T1BA 1ZLJA 3FXMA 2L4AA 5E18F 1BBZA 1APLC 2D1VA 3KYCB 3I4PA 1EQRA 1W1FA 4PJOD 1YJ9T 3OIOA 3MEWA 2I0NA 3E6MA 4M7AF 5GJVB 1W70A 2BE5F 1IXCA 4E4HA 4EMGA 3K4BA 3RKXA 4OIQF 2OC6A 4G7OF 5D5VB 3HZJA 4C8QF 4V19K 1R1UA 4YRRA 2DRKA 3THKA 3QBYA 4ZYEA 3H0GJ 2QQBA 2Y0SA 1K6YA 3PQJA 4AH6A 2X48A 1YP5A 2ZC2A 2DA4A 1WU7A 1JB0E 4OGEA 1KC8U 1WA7A 2HD0A 5LL6S 3CTAA 2VWFA 1BOBA 1XGSA 2QEXI 4IRGA 3HKZN 1L0OC 4XTVA 3HXVA 1H0MA 3ZQFA 2QEXA 1ZKGA 4A3LJ 1NJ5A 5JHFA 2QSGX 1OLTA 2NS6A 1D1BA 1ZG3A 5A2QK 1R9TJ 2EGAA 1KYWA 3EQLF 1B8AA 1R23A 2HYFA 3UA6A 1I8FA 2FYKA 4QW2A 3VUBA 3CCQI 3V42A 2XSJC 4PNOA 3P9CA 4BY6C 1YWPA 4YDQA 1UTIA 3ESWB 4P3NA 3SWNB 1LFUP 1HDPA 3CBPA 2ROLA 2X85A 3CCQA 2L5QA 5JLWA 4ZTUB 4NOYA 2XAJA 4P72A 3SZTA 3DPLC 1MMDA 3W2WA 2VXZA 4A53A 5KYXA 2Y9YA 2KROA 3CLQA 1AOYA 3IH2A 1LVKA 1PSFA 4AD9A 2ZJQF 2XDBA 1T3SA 2OV7A 5FWBA 1OJLA 1R6RA 3K6GA 3LSQA 4UC4A 4F04B 1Q86C 2PN6A 5LJ5j 2XDPA 3EHRA 4XOTA 5LJ3h 5DM7R 4PFZA 3ZMUA 3GBGA 1J75A 5FROA 3ZL7C 4OMNA 1G5HA 3LQQA 1P6RA 1K0XA 2VGMA 2DU9A 1FT9A 2O3FA 5LJ5e 4ZDOA 5E1XA 2Q7EA 2K40A 3A8HB 4OOIA 5GAGJ 1PYVA 3EUKL 4GYGA 4CS2A 4KGZB 4ZH4F 3HFOA 4PJJA 4ME7A 2BV6A 2XIGA 2F5DA 3PNVA 2YPRA 1ZYRF 1Z0XA 1VQOQ 4ZYDA 3BDDA 5CKEA 4Z8AA 1RETA 4DOVA 2EA4A 4HX7A 2PMFA 3PM1A 2LC2A 2V1DA 2QA4T 1K9MC 2DFUA 4M77A 5KH6A 3JTGA 5AIQA 5D5UB 3IH4A 3OMCA 1JKRC 1XMAA 5CJ9A 3C95A 2P4RA 1NJ6A 1PJRA 2V1NA 3AG1H 2LRDA 3IV5A 2X1CA 2GIZA 2YS9A 4M72A 1WH7A 1I27A 4FYYB 3HP9A 4AFSC 2PFBA 1XCVA 2YU9J 1E2XA 1YE9A 2DQRA 3B6AA 4M7DE 2R93J 2LMDA 4D5CA 1QVGS 4DBHA 2DTOA 1XNIA 3P8TA 2EINH 5JVGF 1KQSA 4BQNA 4M77E 1KFZA 4FYWB 3GNGA 1T95A 2BYVE 4IUPA 2C7IA 2UZKA 3HRTA 2JMCA 2AXTC 4OINF 3CCVQ 4ENJA 5H20A 1VQ4I 1QVFS 3KZYA 2LD5A 4BKXA 1X1PA 2K9NA 4OMYA 3BJOA 5D6YA 3QOPA 3RI4A 2CJBA 1VQ4A 1HLVA 1QVUA 1X75C 1R1VA 2KY9A 1DPUA 3I5UA 2JWTA 1NG2A 3S1MJ 4UUVA 5GAN2 2H1KA 3C94A 5FWCA 4KMUX 3ZQIA 4N4GA 1B6AA 2SRCA 2D2WA 2G6FX 1FNNA 1ZSGA 2FRYA 2GIVA 3EUAA 3JREA 5KYXB 3UGQA 2L8DA 1N75A 3W2VA 4L87A 1JUSA 1S7EA 2DJZA 4HSTA 4ZNXA 2CP3A 2CH0A 3TO6A 4FU6A 3IRQA 3HOVJ 3CUOA 5J26A 4S0HB 3I35A 1UGRB 2D0NA 3F3XA 2RNJA 1YN8A 4N4NB 2XDVA 1R00A 1XC5A 3M07A 1M27C 3F8NA 3HG9A 5EZGA 1YJNT 3TSWA 1X1BA 2JUCA 1OV3A 3JCMf 1ZX6A 2ATCB 2NLUA 3OIPA 1BB9A 2BHYA 1PRMC 5CQYA 3J7AO 3I59A 1XSXA 4YREA 1MH3A 3TSZA 2DQ0A 3WGHA 1W2BP 1NBEB 1PP7U 4J15A 4HLYA 1Q1VA 3HSBA 2W0ZA 3S8PA 4GXOA 4B43A 4M75D 5K7FA 3CCSQ 3CCRT 3ZN1A 1NPRA 4QWQA 3I64A 2GA1A 2HZDA 3HC7A 4P73A 4RQEA 4BD3A 2AKLA 5IYDJ 1OQYA 3L1AA 1TW3A 1X58A 2CP2A 1MBJA 1VQKT 3MP6A 4J5YA 2L3PA 3A32A 1NJ2A 1VA7A 4RTXA 1UB4A 1BN5A 1DUXC 4JBAA 3X24B 3ECOA 4UP7A 1WGXA 4JRQA 1KGSA 1OYYA 1U2WA 4BAYA 3LA3A 2F5CA 3FEOA 3BY6A 2A68F 1BCMA 2DL8A 4U7BA 1HC8A 1IRZA 5HS7A 2HR3A 5DCMA 3VS1A 2O8XA 4N4HA 5KYUA 1RIQA 2P5VA 1TU0B 2P7VB 5HS9A 1ZA2B 2YXYA 4CCLA 3ER0A 4PJLA 1ORKA 2QSHX 2YLBA 4EJOA 3I4NJ 4LB6B 4EATA 1SSFA 3HKSA 1FP1D 2LMJA 3IKLA 2VPLA 1U5TC 3OYJA 5C52B 2ZIMA 4OB3B 3M4GA 2DOFA 1BI2A 3K4MA 3QPTA 3CCQQ 2DKGA 4QLCU 4RKUE 5L8RE 2QCOA 4K11A 1YIJI 2EFWA 2B63J 1V5EA 4DBFA 4EMSA 1VQ8Q 3JB9I 2OZ6A 1FWZA 4W1UA 3VV0A 2CP5A 3M7GA 5GAMj 1SD5A 2A08A 3CP2A 4F7UF 1OYIA 3J81Z 2QM3A 3M54A 2HL5C 1I39A 4BXXJ 3E9FA 1EIFA 2MGQA 5GAMe 2VBWA 2RMOA 3CD6I 3IH3A 1SFKA 3DKXA 3I59B 1YJWI 1TBXA 2EJGA 1AA7A 3MAJA 3CD6A 1W7PA 4IHVA 3JCMW 4YCUA 1YJWA 3LSJA 1U1SA 5A2QE 4YP0A 2DA1A 2EPDA 3E97A 2O9VA 1QVTA 2QKLB 3OL3A 4XLEA 1R1TA 3QAHA 3T9NA 5C3EJ 3DTIA 4JRIA 4XSXF 2LNHB 3LSPA 2IW5A 2OJED 2FQ3A 1E3PA 2LDUA 5J6XA 3M58A 1NK3P 2EW3A 4N9IA 3RACA 4P96A 1J09A 3WG9A 3JCMg 3BCBA 2RB6A 2LJ3A 1H4QA 2ED1A 4NC8A 4NQWA 4AIKA 4BJ6C 1USTA 2K6DA 1FY7A 1OKRA 3BY7A 2AKKA 3HHHA 2FB7A 1XOVA 4DEYA 5HLGA 5C44J 4HA8A 1TUDA 3QPLA 3HSEA 2QBYA 1BC7C 4BHBA 1KQSS 4EV0A 2STTA 1YRNA 2GNCA 4OIPF 1W0TA 4NUBA 5DCMB 4CCOA 4ESBA 3OYCA 4IHXA 5KYUB 3H9NA 4OB1B 2E70A 2DL4A 4B9XA 5KCHA 3P8HA 2LKSA 4ASNA 2WWYA 4J6WA 5F0FA 3BQYA 2XHCA 5EDNA 4M75F 1PRLC 3BP8A 3S2WA 3RPQA 4RG2A 3M57A 1ZRFA 2HQAA 4P5NA 1VQ4Q 3HPHA 1DGWY 3ERRA 3BZ6A 2XF7A 4WI1A 4KQEA 1E3OC 2XUBA 5F64A 3CZ6A 4X34A 4BB7A 5F0CA 5EYRA 3TVTA 2BVLA 2RHUA 5GMKe 2PVDB 1SD7A 3HB9A 2K9QA 1FOWA 1ABQA 3M4OJ 1U3EM 4JOMA 4FHTA 4I2OA 2W4SA 3VS3A 5DV5A 4JX5A 3U2RA 2M16A 4MQVA 1FXXA 2WB1N 2XGCA 4G9YA 3ABKH 4OMLA 1ZAOA 1ZG5A 3VSKA 1SANA 1LE8A 5EF6A 3TREA 1JEGA 3CMAI 2UXXA 3FKJA 1ZG1A 2I4MA 5A0LA 4D5FA 2LP0A 2ZPEB 4H0EA 1X1AA 3CMAA 1W7PB 5LHIA 1EVLA 2DA6A 3D5SC 2HQHA 2ED0A 2R5ZA 4LIVA 1BYMA 1A5JA 1G3TA 1FTZA 2JN0A 11ASA 4IZZA 3ZR8X 4LVKA 1GV2A 3QKJA 4RLFA 5IYCJ 4ENKA 4Y91A 2ODRC 2DE0X 1KQ2A 5HKCA 3CCVT 3QZ5B 1MMSA 3BOQA 2K79A 2DILA 3L2RA 4NQWB 1G5VA 1I3AA 1WX6A 1XSVA 3A98A 2X9HA 3JRCA 1HSTA 2ADUA 2CFOA 2M9UA 2EFPA 1X6GA 3EGUA 2QBYB 3QU3A 1VIEA 3JAMK 1KD1U 3MP8A 2D45A 2M02A 1ETYA 3W6KB 1YRNB 2ZR2A 4OAZA 2GFUA 1F43A 2P8TA 1PD1A 2DXTA 3VYRB 1XB4A 3T8TA 1GCPA 2E12A 5LEKA 3DV8A 2E6ZA 2JPCA 1W1WE 5AT1B 5LJ3f 5GAN6 1GV5A 2E2IJ 2BTTA 5CK9A 1I5ZA 3O2PE 2CP6A 2VQLA 2EJ9A 4M78F 3WTSC 3VYHB 2ZXIA 3CC4Q 2FMYA 4HW0A 2DA5A 1LVAA 1K61A 3V8LA 1TUGB 2EILH 4I0BA 2LK2A 4NC7A 3GVAA 2E71A 5FLXK 1RIOH 2M9HA 2I2LA 3JRAA 2XG8D 3ELKA 1WJFA 4GLKA 2COWA 2NYSA 2H8WA 2RQRA 4JJCA 3DKWA 2E2HJ 3A8GB 1J7KA 1M90U 4I02A 2GAUA 1O7LA 2A5YB 3WTVC 4KIBA 2OTJI 1T0JA 2XAQA 4C2UA 4M7DC 1YI2Q 2OTJA 2ZR3A 4M3FA 1J5WA 5GMKi 2KBTA 3JR9A 4M77C 3BTCA 2C0OA 1HCRA 3M0QA 2ELHA 3CPWS 4G94A 1NJIC 1LE8B 4LE9A 2EGCA 3UNGC 4E7KA 4M9XA 3CCST 1KQ1A 4JJBA 2VKEA 2CUDA 3M55A 1X2KA 2BE7D 3EYYA 3BC8A 1WNLA 4OGCA 2VIXA 1X19A 4C3IJ 5DYMA 1X2QA 1XGMA 2DXCA 2DX1A 3QO8A 4EM2A 1NJ8A 3U9GA 1K83J 5AIPA 1R0BG 5GAN5 1IRFA 4NHJA 1FYNA 2QDYB 1TTYA 3G1OA 2NS0A 2DPPB 2E35A 1UG2A 4IURA 2DTRA 4OMQA 1WGSA 3G4SI 1YJWQ 3H0DA 2W00A 3V7CA 3B6CA 1SVOA 3ISPA 1TL8A 4XRFA 2IG0A 3G4SA 3C2HA 1WXBA 1SHGA 1A6IA 3SEQA 1AU7A 4A5NA 1ITYA 4HNTA 1YW9A 1PD0A 2XASA 2NRAC 3IAM2 4MDWA 5HS8A 3HXWA 3CMQA 3JW4A 1X2GA 1VFCA 5K5RA 1H641 3CBOA 2DW4A 3A1Y