3RIRA

Crystal strucrture of biotin protein ligase from s. aureus
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Crystal Strucrture of Biotin Protein Ligase from S. aureus
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 102
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rirA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rirA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rirA02
4K87A 1YTYA 4P72C 4KICA 1KU2A 2P8TA 2ZKZA 3JCMf 2ZT6A 3BJAA 1RUOA 1BBWA 3DP7A 1T0FA 1H0MA 4M73A 1QO0D 1FT9A 1BI0A 2E1CA 1L0OC 1SD5A 4LGWA 3JB9J 3ML6A 4A6EA 3SHFA 1Z6TA 5F64A 4H2TA 1QE0A 3HIFA 3FX3A 5EEGA 2ZIOA 4WJ4A 2VC8A 4HA8A 3HFOA 1Z05A 3PFIA 1NJ5A 4IPAA 2CG4A 3TUPA 2JPCA 1F9NA 1QPMA 2JSCA 3JCMP 3I4PA 2K4BA 4YFNF 5GMKh 2E10A 4HVCA 5H20A 2K86A 1Z91A 2UXXA 5HS8A 4XBFA 3E6MA 2MH9A 2DU7A 2NS0A 3CMQA 5TJJA 4NOYA 5GAN6 1ZLKA 1HKSA 1ASZA 3ABUA 3HFVA 2F2EA 3SWNC 4PDKA 2GXGA 3V8LA 2XVCA 3DXJF 2CYYA 3HHGA 1E24A 3HFZB 1FSEA 1ZN2A 3QU6A 2FXAA 1Z9CA 4M78F 3ICAA 4KMFA 1W7PD 4L5JA 5LJ3g 1N9RA 2JZYA 3RESA 1WI9A 2HWVA 2ZO4A 4M77D 1LDJA 3JCMJ 4ZYGA 1ADJA 4PJOB 5HVQC 4YG2F 5E8GA 5D6FA 3TO6A 5K1YA 4F7UG 1J7KA 2P6TA 2DPDA 4PGHA 1EFWA 4CS4A 3WODF 4HDUA 4CICA 2E65A 1J59A 4MTDA 5ED4A 5GANg 2ZJ2A 1W66A 1IAWA 4CH4A 1TH7A 2ESNA 1HBXG 4M7DC 2IY5B 1BC8C 4G7OF 2EV6A 4I01A 2Z33A 2P5KA 3U9GA 1I6XA 1VQZA 1O57A 2DI3A 2Q7GA 1XCBA 4L9JA 1JJCB 4P3PA 2M45A 5ILVA 1HSJA 2BEOA 4C92D 4XU2A 3KP6A 2I4LA 2XUBA 2DEQA 1Y96B 3ZMSA 2LF8A 1FBQA 1D3BB 2DW4A 4OOIA 2CSOA 4P71C 4ZZDA 3HXUA 2NYXA 3REXA 4OP0A 3CUQA 3JCMh 4M7AD 4KIFA 4KDPA 4Q47A 1SAXA 1XMKA 2ZR3A 1RIQA 4PJOE 3UFGA 2ODRC 1FYLA 4FHTA 1I1SA 3SB2A 1JBMA 4EVIA 3F8FA 4BH9A 2C8MA 1K78A 4IRIA 3VODA 1X56A 3M8EA 1ZG5A 3BY7A 3IRQA 5ERIA 3BDDA 2KIUA 2VOOA 4NCXA 1W7PA 2K27A 5DDGA 1DP7P 2GIVA 4M77A 3K0LA 1SMTA 4CHUA 2DU5A 3HXWA 2MLGA 4J6XA 2CFXA 2DXUA 4YRMA 2PN6A 2O6GE 3DF8A 2R7DA 1VTNC 2AMCB 2FRHA 4M78B 4I0AA 1V3FA 4X9CA 4YRPA 4Q15A 4RCBA 4AWXB 4HWPA 2E64A 5I21A 2FB7A 4P9UA 2QENA 2W84A 4KNYA 1R00A 2ZZGA 4NB5A 3HY0A 2G7HA 1LJ9A 3AHUA 3MF2A 1CGPA 1XB4A 3RKXA 3J80Z 4C92A 3KLOA 4CH5A 1S8NA 1O7LA 2CW0F 4YCWA 1BN5A 5LJ3e 4ENJA 1YFHA 4Y91A 2QQAA 4KA4A 4PHCA 2KKOA 3GW2A 4H2UA 3TDUC 2D2WA 3QAHA 1MGTA 1EH7A 4TVAA 3L4GB 4M7AA 3T8RA 3E9HA 3F6VA 2EJFA 4HW0A 4YCUA 3D5LA 4UPAA 1MKMA 2KIMA 1U6GA 1X01A 1FYMA 4U88A 2FMYA 4KUMA 4RCCA 4HWSA 4MGRA 4LLLA 2RKHA 3H3UA 4PZJA 4P73A 1R58A 1X55A 5K5QA 5DD8A 2FA5A 4HYEA 2STWA 2EWNA 4RB2C 4M78G 3KP2A 1IXRC 1B70B 1G5HA 1B76A 1P6RA 2ZCWA 3L1AA 2DO7A 3IWZA 1SD6A 4G94A 3GZ6A 5GAN3 4GXOA 2H6BA 2OQGA 4KFCA 2LKPA 4KR2A 1IN8A 4A6DA 3QTCA 1GHCA 4C8QC 5LJ3d 2W24A 1BIBA 1ADYA 4FX0A 2XAJA 5EEHA 5L3GA 4UVAA 2DBBA 2WWYA 1WQWA 4OMYA 4UHTA 2IPQX 4ZYEA 4YRQA 2DQRA 4M9SA 3AAFA 2OQRA 2XAFA 5AIQA 4M75F 3JCMg 3HXXA 2Z99A 4RGXA 1G4DA 3BDUA 4N0AC 3J81K 2HFHA 2CJBA 3KE2A 1PUEE 3COAC 1JHFA 4I98B 5LLQA 2IA2A 4YRCA 1NHAA 2P5VA 1UCRA 3W3SA 3RKWA 3V4GA 2EFWA 2XGTA 3A31A 5GAN5 5ELNA 4YREA 1G5IA 1Z7MA 2CIMA 4XEMA 3KEQA 2GAUA 4CZZA 1ODDA 1ON1A 1U5TB 3QPTA 3E5UA 1USSA 3QUIA 5D5WB 3SXYA 2GXBA 2ZNIA 4ASNA 5HLHA 3JCMc 3T5XA 3L09A 11ASA 2XKOA 3KZZA 3HFZA 2FQ3A 5GMKe 2XGXA 4YIIA 3EFSA 2IA0A 4Q48A 2PFBA 2ACJA 1SD4A 3CTAA 2FBKA 1J75A 3IKVA 1MJ9A 2CGPA 4XLPF 5DYMA 1IN5A 3EETA 5LBQA 1L0WA 2FYKA 1MGQA 3OV8A 4HAMA 5F1RA 2ZINA 4CH6A 4RQEA 2X0LA 1UHWA 1AWCA 2QZ8A 3VBBA 2DQ3A 1BI3A 5JI6A 1AOYA 4EMGA 2ZZEA 4M78D 4IF4A 3TKYA 2V1UA 3FHZA 5IT3A 3WQZA 3C7JA 2IY5A 1CF7B 1R1UA 2PG4A 1L3LA 4IJAA 4HWOA 4RS8A 2AKWB 4CS2A 1BBYA 3LA7A 5GMKm 4P9FA 4OLFA 4JRKA 3HXZA 1JJCA 4YP0A 3F8MA 1TQMA 1O3RA 4L9NA 1IRGA 2XRNA 4HDVA 3K1PA 1Y96A 4EJTA 3WTSC 1D3BA 2OZ6A 4ZIBA 5GANj 1FC3A 1IF1A 4FX4A 3DQVC 1XSXA 3O3KA 1TNSA 4G85A 4LK0F 1BOAA 1NJ8A 4M75B 5L3FA 5CJ9A 1W7PB 1B1BA 2OD5A 4ZTUB 3E3VA 3E5QA 2EV0A 1O3TA 1IXSB 1R1VA 5DEQA 2D1VA 3K9TA 3CUQC 4WXCA 5DV5A 3M4GA 2CO5A 3WG9A 3F23A 3JCMe 3LC0A 1WSUA 4R1HA 5DY9A 2CJAA 1Z6RA 5ILSA 4P3OA 2P4WA 5CVJA 3QRFF 5K5RA 3IL2A 1R23A 3R61A 5GAN2 4WK8F 4EJVA 2EA2A 1W5SA 3O2PE 2XAGA 3S2WA 1R22A 1YQAA 3EFRA 1TQIA 3NENA 5FB2A 2DJZA 4LNSA 2FNAA 3IKTA 2J5OA 1G51A 2YR2A 4OIOF 4A5MA 1WLEA 4M77C 2IA1A 1IRFA 4M78A 1X3UA 4EMKB 2ARTA 3HTUA 3WGIA 1YFSA 2I2LA 1SRYA 4G7HF 2RVCA 3I7FA 2VT3A 3IALA 2PQ8A 4LK1F 4BHCA 3RI4A 1GXQA 4M77E 2EK5A 3JCMQ 2E3CA 1Z1DA 3BPVA 3Q9SA 1GXPA 6PAXA 4R79A 4YRSA 2OU2A 3JCMd 5E1XA 4M7DF 3M4QA 4HX4A 2Z9OA 1KU9A 4NL3A 4UV9A 1EV7A 4XU3A 3RPQA 2HR3A 1FOKA 2XV4S 1G3SA 3HTZA 4XU1A 4C92C 3L4GA 1H4TA 4YYEA 1LJOA 1R7JA 4L18B 1D5VA 1SESA 2EFOA 2K57A 5GMKj 4PG3A 2VT2A 3JAMZ 5K1PA 4IRGA 2FNPA 3FXUA 1H9GA 3BWGA 4MQVA 3P9KA 3HY1A 2DZCA 4M7AC 4H0EA 4WX9A 1E1TA 4C92E 3NELA 3ERRA 2HDCA 1TNTA 2EJ9A 5D5XB 1KYWA 2CGHA 2Y0MA 3TEGA 1J0RA 4P74A 4XLNF 2PMEA 1B70A 4M7AE 2RGVA 2HEOA 3ISPA 2WV0A 1YYVA 1U1TA 1B34B 1QNTA 4G9YA 3DPTA 4UP8A 4F7UB 1HC7A 4JUVA 1XD7A 4EO4A 1EIYA 2ZCEA 2DT5A 3M8FA 1B59A 3I59B 2QHUA 4E51A 5HLIA 1TBXA 2HYGD 1RIOH 3ERED 4ESBA 2D1HA 4LD5A 5IT9Z 4LG0B 4XTVA 3I54A 4Y17A 1B8AA 5FO5A 4CO8A 2PJPA 2W57A 1SD7A 3R0JA 4YRRA 5GAMh 4P3NA 1IXCA 4JK1X 1LDDA 2DTIA 3FXQA 3REUA 3TQNA 1FWZA 4RGSA 1JRIA 5A2QZ 2PLYA 2FEZA 2BYVE 1NYQA 4XTXA 2A69F 4G6QA 3HRUA 2ISYA 3R60A 2C6YA 2ZXJA 3HRKA 4M75D 2FSWA 3P8TA 1U5TA 3R6SA 1V4RA 4M9XA 4M9ZA 3A5ZA 4F7UE 1NJ2A 3RUXA 1U78A 2Z3YA 4CH3A 1U2WA 4S04A 4EM2A 5K5OA 4M7DB 1FPQA 4Y15A 1TQPA 3E6DA 2M1BA 1HW2A 5LJ5j 1RZ4A 4DNCA 2QQ9A 3WGHA 4RGRA 4I7HA 4PNOA 1ZREA 1F5TA 1O3QA 4GYIA 1I4K1 2YU3A 4RB1A 3J80K 4NQWA 2I4MA 2RDPA 2FBHA 3SZTA 2P5LC 3HSEA 4I09A 4UVBA 2F5DA 4LJZF 3Q5FA 2L54A 3H92A 4MHGA 1YW8A 3MAJA 1JHHA 4WJ3M 3JB9G 3HRTA 4AD9A 4HWRA 4PJOC 1A04A 5D4RA 5CVRA 2BV6A 2VE9A 2QHTA 2RHSA 1ZRCA 4TWAA 3MF1A 1STZA 1CF7A 3F21A 2UXNA 2AKWA 3V7SA 4DPGA 3KP3A 1E1OA 5FGMA 4RB3C 3LWFA 1EQRA 4YPFA 1HKQA 2A68F 3BJ6A 4YIFA 1JE8A 5HLGA 2VONA 1G6NA 4TTVA 1WNLA 4AIJA 3V7RA 2RM4A 4P96A 1H641 3VFZA 4UUVA 1YFTA 4M7DG 4A54A 1KQ1A 2EJGA 5H6QA 2W25A 2HQNA 3NEMA 1RNLA 2L4AA 3I53A 3L7WA 3QO7A 3ZMUA 1C0WA 4BW9A 4M75A 1KU7A 1KMNA 4AVPA 3IRRA 1FP1D 4A53A 2QBYB 2M87A 2VC1A 5L3BA 4O3MA 2C7IA 3U1DA 3ABTA 5CLSA 1XGOA 4JBAA 1OPCA 3R0AA 5FFXA 2M8EA 2DFIA 2XKPA 3QU3A 4HF2A 4LLGF 1P2FA 4EMHA 2QTXA 2ZT5A 3VQYA 5GAN7 4EQQA 1XSVA 4XTWA 3C18A 1I1GA 4Q4ZF 1MJBA 2DZ9A 4A0YA 3M1EA 5GAN4 4HF0A 1TLHB 2KJCA 2J3MA 1K79A 3VU3C 3HXVA 4YRFA 4UNOA 2FE3A 3ZP5A 1E17A 1FP2A 4BWAA 4TQFA 4EMKA 2RNJA 2VC0A 1E22A 4PCQA 3L00A 1KQ8A 3JSOA 3BOQA 4XTZA 2QUFA 3IWFA 3P9CA 4FT8A 2ZT8A 2DK8A 4YRNA 1X2HA 3ZMDA 3V8KA 4M78C 1MD0A 2P7VB 4EJOA 1PDNC 1QQIA 1YCYA 3HHHA 2PMFA 2OAZA 3N97A 3LSSA 3CO7C 3GWZA 3E6BA 1S7AA 2DAOA 5E3IA 3WU1B 4HBLA 3GUDA 5J8CA 3FB9A 3TEHB 3NEUA 4S05A 3JTHA 4M78E 1XCVA 1FZPB 2CJ9A 2A3SA 2ZIMA 1ONVA 3WTZA 1P4AA 3JB9I 2O61A 1B7YB 1KU3A 1N9WA 2JTVA 2JT1A 3U2RA 4XU0A 4UV8A 1GGMA 2V1XA 4B8XA 4WCGA 1G3YA 4G6DA 3C3WA 1QZZA 3WTWC 4L9VA 2G7UA 4M7DD 5GAOm 1T6SA 1T98A 5LRSA 1EIYB 3OD1A 2DQLA 2QLZA 2GA2A 3HRMA 3MWMA 1Z7NA 3MZYA 5FLXK 2HOEA 3DKWA 2OZUA 2G9WA 2IRFG 1B34A 1XSDA 1J9IA 4OMZA 4HX8A 4F7UA 4P74C 4QWQA 3GFIA 3RJPA 4HOBA 2KJBA 2Y90A 3RDIA 1B9MA 1RUNA 3JCMb 2ARSA 1RI7A 3I59A 1H4VB 4KYWA 4RB0A 4L87A 1QZYA 3EUHA 4YRKA 2V9VA 4LG0A 2LNBA 3BZ6A 1K6OA 3ELKA 1WU7A 4LFUA 1BC7C 4C8QG 1BM9A 4H2XB 4R8HA 3ZMVA 1T39A 3JB9H 1IN6A 1QF6A 4NHJA 4UVCA 4AIKA 1FLIA 1X2GA 3IKLA 2O8XA 3K1MA 3KETA 2VOPA 3VQWA 3VB2A 2ZZFA 3LFKA 2XHKA 1WRJA 5DCMB 2O03A 3TO7A 1P4WA 4A12A 5HDGA 2ZFWA 3REOA 1UHMA 1XGNA 3TOBA 4HT8A 5GAMe 4E70A 1YG2A 1F1ZA 4XRFA 5HDNA 3JCMW 4M6YA 12ASA 3INZA 3WTVC 5DUIA 1WPYA 5ILUA 2WC2A 3JCMX 4M7DA 1U5TC 1IN7A 3RPUA 1ZGAA 2DTHA 3R07A 4OIQF 1E2XA 2DKGA 5ICEA 5KK1A 2M30A 3F3XA 4GGGA 1J2XA 1IW7F 2F5FA 3F8CA 2RHSB 4XTUA 2A6HF 4OU0A 3FMQA 4P55A 5LJ3j 5CVVA 2Q5IA 4LB6B 4B09A 4YCVA 1BI1A 5E17F 1YS6A 3A7RA 1EH8A 5LRRA 5JVTA 3HSFA 2IT0A 2M5WA 5E1ZB 4HV5A 4U0YA 1USYA 3F22A 3DPLC 4MEYF 2ZXFA 3HFNA 3H3ZA 1ZRDA 3JAMK 3CJNA 1LB2A 5GAMd 2K7LA 1O7FA 2NNNA 1EH6A 2FU4A 2OBPA 1Z7UA 1LQ1A 5JFRA 3VEPA 3GFJA 3RERA 3PZCA 4XSZF 4A2UA 2RC4A 3GF2A 1M5Q1 3D0SA 5C51B 4ENKA 3J81Z 1OR7A 3HOTA 1KOGA 2A5YB 3LAPA 2EA4A 3F72A 4UXNA 4U0WA 5GMKl 4L9TA 3KFUA 3CUOA 3F6OA 4KIBA 4WXHA 1YB3A 1D8JA 1SFXA 2VBXA 3WTUC 4EJWA 1HKTA 1FYFA 3PCOB 2L02A 1XDSA 5LHHA 4TQDA 5GAMf 2MH2A 2QBYA 4IHSA 3WTYC 2FBIA 1YS7A 2ADUA 3GIBA 2A07F 3LSTA 4ESJA 4M75C 1MDMA 3FMRA 1SFUA 4JRIA 2EL9A 4KR3A 3JB9F 4MNUA 4EM0B 3UGQA 2J3LA 4HWTA 2UWMA 5BOXA 2HNIA 2HZTA 3I64A 4X5OA 1S29A 4KN4X 4M75E 2DTOA 4DQ2A 5FD5A 2HKXA 5E20A 3FM3A 1ZG3A 1WKMA 4JQFA 5A2QK 5C53B 4AIHA 1P92A 4N0BA 1PP8F 1KGSA 5LEKA 5GANh 1S7OA 4RDXA 1TW3A 2VXEA 1B4AA 1IN4A 1QBJA 4LLNA 3KEOA 4UP7A 4QVCA 2CWEA 2ZR2A 3A74A 1JGSA 2H94A 3W6JB 2QQBA 3FM5A 4EMKC 4OIRF 3TDZC 2XTIA 4H2WA 3BJOA 1HW5A 3LA3A 4PJOF 4I02A 1YW9A 4KMUX 2DLLA 5LEJA 4YRIA 5HS9A 3O6BB 3TEHA 1XGSA 2V6CA 2ISZA 1ULYA 2J5PA 3I0TA 3FZVA 3IC7A 5D5UB 1XMAA 3BROA 2PI0A 4YROA 2IVMA 5ICCA 2E5AA 4MMLA 2MLKA 5GAN8 3I58A 4UP9A 2RV8A 1B7YA 5J6XA 2BBYA 2FF4A 2ZTGA 4P73C 3VQXA 3KP4A 5CVIA 2FMLA 3QP5A 2EFQA 1R5HA 3A5YA 5L3EA 2YLBA 2XASA 4JLIA 1BBUA 2WTEA 4EJUA 3L2ZA 2RN7A 4C92G 2COMA 2DPUA 4H02A 3WU0A 2VXZA 2K4JA 3QO3A 2MBFA 4N0AA 4L0ZB 2O3FA 1I8FA 2P5IA 1WQ7A 2ARUA 3KP5A 1OMIA 4M7AG 4CGZA 2DK5A 2NRAC 3SWNB 4A0ZA 4TVWA 1MZBA 5LJ5f 5D5VB 5BPIA 3MEXA 3ULQB 4MMKA 1LOJA 4ZYDA 1YFRA 2PBIA 5ICGA 1B6AA 2ZNZA 2Z5UA 3L9FA 1XN7A 3WTXC 2FOKA 1NJ6A 2QHVA 5BQTA 2ELHA 2QHSA 5HDKA 2BE5F 3M7GA 1ZG1A 1KYZA 1FBSA 1ZGJA 3SZPA 2AXLA 4RAZA 3HSRA 4YFKF 3FF5A 1H9TA 4BHBA 2VODA 1N9SA 3QO5A 3GO5A 3WE3A 4I0BA 4XEOA 4GCVA 1HQCA 3F8NA 3OOPA 4H2XA 4U0VA 2MA3A 2Q8KA 5HGQA 3KP7A 3FWEA 1PP7U 3NRVA 1UFMA 3NQOA 5DCMA 1USTA 1YIOA 5D8LB 5LHIA 2HKOA 2CQKA 2JN0A 3G1ZA 1ATIA 3P7NA 4YRGA 2VBWA 2L4MA 3Q9VA 4CYDA 1FYKA 1D8KA 2Q0OA 2YHTA 3FIFA 3A7AA 5BPDA 2AS5F 1W4MA 5LGNA 4N9IA 1ZHFA 4HT9A 2XAQA 5D8KB 3RGLA 2XIGA 4OINF 2JPBA 2V79A 3ECHA 1BIAA 3LQRA 4M6XA 3RACA 4XQ3A 3HXYA 4HZFA 2MD5A 3GXOA 4K88A 4HLYA 2F5CA 2Q2EA 3VQVA 3K1NA 1ON2A 3QHSA 1YW7A 1LYLA 4C8QF 4YDQA 1I5LA 1WWXA 2ZMEB 3GEZA 1U3EM 2E1HA 4M7DE 3RF1A 2QM3A 1C0AA 4Q5SF 5JR3A 2K02A 4G84A 2X4HA 2I4OA 3K2ZA 5L3CA 1OYYA 4J6YA 4WXDA 2RA2A 3ECOA 2BGCA 1USYC 4ENNA 2RHQB 1UB9A 1HK9A 2XROA 5DCFA 2EFPA 3TGNA 4ENMA 5JHUA 4YRJA 1S6LA 3GFLA 4ZZLA 2VBYA 3WTTC 1FBUA 4PJOG 5E8IA 2RQPA 3CLOA 2B0LA 5LJ5h 5GMKi 4I2OA 2YSRA 3N4MA 3IHUA 1MDMB 1LEAA 2H27A 3RL6A 4QVDA 1X54A 2IP2A 1TTYA 1B9NA 1ASYA 3BW1A 4L0YB 1DPRA 1I27A 1OYIA 2YLCA 3PCOA 1NYRA 2ALYB 2E7WA 4G8XA 3DEUA 1PYSB 4A5NA 3RIRA 2G4CA 3EDPA 1BI2A 1BJAA 3LA2A 3ZQ7A 1GVJA 2D45A 4RQFA 3HUGA 1XDUA 3M4PA 4EGYA 5GAMg 4P5OA 3MZHA 4RMFA 1LNXA 1FY7A 2A61A 2UZKA 2P6SA 4MTEA 1JXSA 2LDUA 5CYVA 1IZ1A 3FJPA 4P75A 5C52B 2R3SA 4RGUA 4TV7A 3E97A 3T0YA 2DVEA 2PMUA 4ZYHA 2QVOA 4GO1A 4KT5C 3WE2A 1R36A 2RD1A 3LSQA 3LQQA 1IL2A 3BFMA 3JB9D 2Q5HA 1MJAA 5AONA 2OA4A 4WF2A 1YO5C 3CDHA 4N9HA 3QO8A 1WQ2A 5AIPA 5CVUA 2YX7A 4C8QB 4P72A 5GANe 4M74A 3SFZA 3IG2A 5TRDA 4BHPA 2ZBKA 1DUXC 4ZTZB 2PEXA 4KN7X 3HTSB 2EAYA 2EB7A 1EVKA 5GAOq 3JTGA 1H4QA 1LEBA 1ZH5A 2HYFA 4Z2YA 3GFMA 3GX4X 2H09A 1SERA 3DV8A 3UH0A 4YFXF 3ZN0A 1LDKB 3BJUA 3W6KB 3QOPA 4RAYA 4HLXA 3FMSA 5GAOn 1TW2A 4PJOD 1KQ2A 2GQQA 1O3SA 4KIGA 5K1XA 5CAIA 3V8JA 3I5UA 3P9IA 3BP8A 2A6EF 1F4KA 4YRLA 1ZLJA 2V1DA 1EVLA 2HTSA 3RKYA 3HRIA 3LAJA 4LB5A 2H6CA 4M71A 1Y0UA 1J5YA 2PMHA 3TO9A 3T8TA 3ZMTA 1YLFA 3JW4A 3SQNA 2ODRD 3QPHA 3JSPA 4C8QE 4QLCU 5GAOl 5GANd 3SWNA 2IJLA 4J5YA 1Q1HA 4L5IA 3DFGA 2Q7EA 1SMYF 1J5WA 4X9DA 3VOEA 4F7ZA 3KLNA 3KFWX 4M77F 2NAZA 3BPXA 1DPUA 1T2KA 4XSXF 1HW1A 4EX5A 2DDZA 2MC3A 3G3ZA 3P8YA 5LJ3f 3L2CA 5LJ5g 2QWWA 1U8RA 4V2SA 2HGCA 3MFKA 1XGMA 4MQ9F 3CO6C 2F5EA 3B02A 2ZNJA 3TOAA 4BAYA 3R4KA 5J8FA 3M9AA 2ZGWA 3RTRA 2DQ0A 3NETA 2HS5A 1KA8A 3GYHX 3T1BA 4ZH4F 2KRFA 3A7UA 5GANf 4O6JA 1H4SA 4C92F 4BYYA 2HTJA 4BQAA 3PGGA 1G3WA 1WYDA 5F5WA 3HRSA 2RB6A 1LVAA 5L3DA 1SFEA 3HSBA 4H2SA 4O2DA 1OYWA 2VE8A 4M7AF 4EMSA 2VBZA 1HSTA 2ETHA 2LSOA 3PQKA 4PJOA 4M72A 3A32A 3J7AO 1DDNA 4HV6A 4P71A 2VXFA 2JRTA 1ZARA 1HXDA 2E1NA 2EJRA 4IRHA 2I4NA 5DUKA 3HYIA 3CUQB 5KNNA 3V7CA 3ROUA 5BMZA 1ZAOA 4AH6A 4O5VA 5FLXZ 2ZMEA 1HTTA 1K7AA 1FX7A 3ZN1A 2E41A 1G3TA 1ZRFA 4HF1A 5DD4A 5KVRA 1I81A 2DTRA 5LGTA 2KIFA 5GAOr 2O0YA 3BY6A 3B73A 2Y48A 3RYPA 1K78B 1IUYA 2IW5A 3K69A 3QSUA 3MCZA 2GZWA 4MEXF 4K2EA 4BXUA 3GLXA 5HOOA 4XTYA 3WGGA 2RHQA 4WWCA 4C8QD 2L3DA 4PGGA 4CDGA 2STTA 3PQJA 1REPC 2GWRA 4U7BA 4M77B 3E9IA 4CS3A 1U1SA 4F7UF 4GYGA 3HOSA 2HQRA 2EV5A 4J6WA 5H6RA 1R1TA 3C1DA 5LHGA 5HS7A 2QYOA 1NJ1A 3EYYA 1FSHA 4D0PA 5E18F 3KCCA 4Y13A 5LGUA 2Q7HA 3QNEA 2DXTA 2R7FA 5IT9K 4H2VA 1LNWA 4YRTA 1SETA 2LF7A 1KQ9A 2Y75A 1QGPA 2NNYA 5LJ3h 4U7DA 3JCMV 2ALYA 1PYSA 3FXRA 4WI1A 4ESFA 3KZYA 5D6EA 5GAOp 5LJ5e 2XAHA 4KQEA 1NNHA 4K86A 1I5ZA 4EGZA 1FNNA 2EFNA 3GVAA 3DSQA 2YX4A 1KQ0A 4C92B 4HX7A 3IKMB 4IHTA 2VN2A 3F8BA 5E1WA 4ETSA 2AMCA 2L01A 4A0XA 2ZNYA 3MQ0A 5BS6A 3EYIA 2YPRA 5ELOA 4EV0A 5F6FA 4OIPF 5D4SA 4TVAB 3P8VA 4M7AB 4H2YA 5FD6A 3QP6A 4M75G 3G73A 2ZT7A 3ZMZA 4G7ZF 3ZPLA 1KMMA 4EM1A 4HQEA 4NL2A 1ZYRF 2P7CB 4P75C 3UGTA 4M77G 5GAMj 2ESHA 1YGBA 4CXFA 1OKRA 4IVNA 3EQLF 1S3JA 3E6CC 2W85A 4ON0A 2E7XA 2DU9A 3MEYA 2GA1A 4J15A 1D3YA 1P4XA 4C8QA 5LJ5d 4BNCA 3I71A 4IXAA 3RYRA 4TVYA 2TDXA 3E5XA 2P0LA 1EOVA 4LMYA 4HQMA 1T38A 4Q6GA 5ICFA 1W5TA 3GZ5A 1R5GA 1M8VA 5FFZA
chains in the Genus database with same CATH superfamily
2ELJA 5IN1A 3BJAA 1RUOA 4M73A 1FT9A 4F92B 3ML6A 4A6EA 2DA3A 2IGMA 4BJ5C 2O9LA 4LE9A 2C06A 3SYTA 1MBKA 2ZIOA 1ZR4A 3HFOA 1VQMA 1Z05A 4B43A 3WVDB 3PFIA 1YJNA 2CG4A 1QPMA 4JLGA 2LBFA 8AT1B 2K4BA 1KQSA 2CW7A 2ZPFB 2IVWA 1WXUA 3BTJA 5E79C 2R4GA 4XBFA 2DU7A 2MH9A 1QVFA 2NS0A 1VIEA 3EGXB 3ABUA 2YSQA 2XGEA 2CYYA 3HHGA 1E24A 1FSEA 2FXAA 4M78F 1ZTRA 5FRNA 2CREA 1QP3A 2L7KA 5LJ3g 3K7AJ 2HWVA 3OR2C 2ZO4A 1PSFA 2AXTC 1WI3A 2ZXIA 3TO6A 5D6FA 1M1KU 5KYYB 3FDRA 1EFWA 3OSVA 2R92J 2LJ1A 2X6YA 1DU0A 2HKQB 2E65A 4QQDA 1J59A 1VQKA 3WG7H 1KONA 4FQGA 3W2VA 2PZ1A 2IY5B 1BC8C 2D6FA 2Z33A 3U9GA 1I6XA 2DI3A 3U23A 4P3PA 2BEOA 3VS7A 2P0QA 1Y96B 1LVKA 1ZSZC 2HVSA 1X1CA 1UUEA 3ZR8X 2MGQA 2XPUA 3REXA 3JCMh 4PFOA 4KDPA 4GRIA 4Q47A 1RIQA 3S14J 3BTIA 4FHTA 2PUOB 2FUG2 3QKJA 2KLOA 1RKWA 2ZMEC 1X56A 2COZA 3BY7A 2QI2A 2DFUA 4RG2A 1YFNA 3PIOF 3BR3A 2K27A 3TQ7P 5DDGA 1DP7P 1M2VA 5C0MA 2QASA 2Z16A 1S9HA 2MLGA 4FW1A 4J6XA 1Q82C 1DU6A 2MW8A 5IT9E 1WXTA 2PQWA 3MKLA 2O6GE 1WHGA 2AMCB 4BD3A 2FZGB 3HOXJ 3HKZA 1PKSA 4J9HA 3FXKA 2DN0A 3K2AA 4HWPA 2FB7A 4P9UA 2LY2A 3HY0A 3MF2A 3CD6A 3PMIA 3RKXA 3M0QA 4CH5A 1S8NA 1O7LA 4ENJA 2KDOA 3EGDA 1Y8RB 3VRZA 4KA4A 3QAHA 1MGTA 2AQFA 3HDDA 3T8RA 3E9HA 5IYDJ 3D5LA 3CF2A 2KIMA 1TWCJ 2VVKA 4PZJA 2ROTA 1R58A 1VQPA 3K10A 4HYEA 2STWA 1M9SA 3TSWA 1VA7A 2RHZA 1Q7YC 2BE7D 4RM2A 2QG9B 2PU9B 4KT6A 3I4MJ 4XLCA 1YHQQ 1SD6A 4LXCA 5GAN3 4KFCA 2LJ0A 4KR2A 4A6DA 2DL4A 4E6KG 4C8QC 5LJ3d 1BIBA 3G71A 4FX0A 2P4RA 2L9RA 1MMDA 5L3GA 1E3OC 4UVAA 3JRIA 3B6CA 1OCRH 2LVSA 2YRCA 3W3CA 2GBQA 1PC0A 4OMYA 4YRQA 2DQRA 5CQGA 2GQVA 5FKOA 3AAFA 3OYFA 1POGA 2PVGB 4QSHA 1G4DA 1X1BA 4N0AC 4ZTJA 3KE2A 1KD1R 1EX4A 2CP3A 4E4HA 1HC8A 3RKWA 2L9NA 3CD6Q 5ELNA 1GV5A 1G5IA 2NVUB 3PO3J 1V5EA 3QPTA 4KJZA 5F08A 3SXYA 2ZNIA 5CPRB 1OQKA 3T5XA 3L09A 11ASA 2YU9J 3HFZA 2FQ3A 5GMKe 2XGXA 4DBFA 1NLOC 3CTAA 3IKVA 2QGGA 1YI2I 4AM3A 5LL6S 4HT4A 3OV8A 4HAMA 5IY5H 4RQEA 2X0LA 3CC2Q 5M5WJ 1BI3A 3FXMA 4EMGA 4IF4A 3OSSC 2V1UA 4PL6A 3FHZA 2HI3A 2VQCA 1L3LA 4HWOA 4RS8A 2AKWB 4BEHB 3LA7A 3H0HA 4OLFA 1JJCA 3F8MA 1VQ8A 3G2BA 4DEYA 3G1OA 5GANj 1FC3A 1PYVA 2VKEA 5IXBA 1W2BS 4G85A 4LK0F 5DM7R 4M75B 5L3FA 1W7PB 3GCMA 5J47A 3GTLJ 1LKXA 1M90R 2CP2A 5DV5A 2CO5A 4CH7A 5EGOB 4OMOA 1MNDA 1WSUA 5ILSA 4B3XA 5CVJA 4C0DB 3SJMA 4QQGA 3R61A 4WK8F 3E2UA 2XAGA 3ER0A 1R22A 1YQAA 3EFRA 2DFFA 2DJZA 4LNSA 1K9MU 1FOWA 2J5OA 3C12A 1CSKA 2JUGA 3ZOBA 1AWWA 3VS5A 2ARTA 4LIVA 3ONQA 3A0HC 3HTUA 2I2LA 3I7FA 2RVCA 2VT3A 4RLQA 2L3PA 1GXQA 3CDIA 2MYSA 3OL3A 3SDZA 3JCMQ 3Q9SA 4IQJA 3H1CA 6PAXA 2BZTA 1W0UA 2OJ2A 2CUZA 4F55A 4A4HA 2KZVA 4NL3A 4XU3A 2HR3A 2XV4S 2AHJB 1VQ8Q 2L9SA 5GMKj 4PG3A 1ETVA 2FNPA 3BWGA 1PKTA 3P9KA 2LDMA 2JMAA 3I9QA 3CCMT 4RM3A 4WX9A 4XLFA 4C92E 2PX9A 1UZCA 1AOJA 1MBHA 2EJ9A 3OMGA 1I3AA 2IXSA 4OB3B 4OAYA 4ZDPA 2Y0MA 3IH4A 2WAQN 3DLLA 2IS4A 1U06A 1X2KA 4HNUA 4M7AE 3ISPA 2AK5A 1RUWA 1YYVA 1U1TA 1VQNT 1VQ6T 3JR9A 2EQKA 1RAIB 4D7NA 2EIJH 1W2BP 4EO4A 5J1YA 5HLIA 1QWEA 2VIXA 4MLOA 2DXCA 3X28B 4ESBA 2D1HA 4XTVA 3I54A 4Y17A 2J6KA 4CO8A 2W57A 1SD7A 3BR1A 2CUDA 2HMAA 4FYXB 4JK1X 1LDDA 1HCRA 2DTIA 1FWZA 4RGSA 2ZPGB 2LCSA 1H3HA 1MMNA 2RJFA 2KRSA 3JRHA 2NS8A 2FEZA 1EIFA 3FRNA 1NYQA 2SRCA 4ESRA 2XSJC 1M3AA 3R60A 2DIQA 5FKMA 2ZXJA 3BZKA 4A4KA 3KEYA 3R6SA 4M9ZA 1YN8A 3RUXA 4C3HJ 1PUFA 3A2KA 2VKVA 3DLAA 2GM4A 5L23A 2O5RA 1TQPA 3HP9A 2RMOA 3DB3A 1RZ4A 1X3ZB 3UT1A 2QQ9A 3WGHA 4RGRA 1ZREA 1IG7A 3VRYA 1YHQI 2YU3A 1ZSZB 2DA2A 1OX9A 2RDPA 5EG2A 3SZTA 3OMCA 3HSEA 1RAGB 2CW8A 4I09A 2KL4A 3K4MA 4LJZF 1Y71A 2ZFUA 1VQ9A 4WJ3M 3JB9G 1WFXA 4HWRA 5D4RA 2BV6A 4I99C 2VE9A 5HK0A 4XN0A 4TWAA 1Z3XA 2J7IA 3K70D 4C0ZA 1CF7A 4XONA 4DPGA 4UB8C 3JRCA 1E1OA 4XRMA 4YPFA 3SEMA 1HKQA 2A68F 1QMCA 1G6NA 4TTVA 1WNLA 4AIJA 1K73C 3HXLA 4Z6YA 1H641 3CD6I 1YFTA 2XB5A 4M7DG 1JJ8C 4H4KC 5H6QA 5KAFC 3VS4A 3ZMUA 1HF0A 1GBRA 2VB6A 3T9NA 2M87A 2VC1A 1QW1A 4O3MA 2C7IA 1V54H 4PJ0C 3RQ4A 2M8EA 5EDNA 2DFIA 1ZUYA 2R57A 2CQQA 3QU3A 4HF2A 2R58A 4Z8AA 3ABLH 1Q86U 1P2FA 1M27C 3TSZA 1I1GA 4Q4ZF 2CH4A 1FMVA 4A0YA 2K40A 1MMGA 3VYUB 4YRFA 3KYLA 4UNOA 2FE3A 1FP2A 5J1UA 4TQFA 4EMKA 2IS6A 2FRYA 3JSOA 1TG0A 5EF6A 1VQ9Q 5IHNA 3GMEA 1YCYA 1GUUA 2ME0A 4NDLA 1S7AA 4MFEA 2EIFA 2CU7A 5K7FA 1Q7YU 3DBHB 3LSMA 3QWYA 2JA5J 2A3SA 1SAUA 3JB9I 1Y39A 3CMEQ 4WCGA 2HDDA 2FPFA 1DGRM 2LMJA 2RI3A 1TSFA 5LRSA 2A0FB 3CCLA 2QLZA 3MWMA 1Z7NA 2LRDA 1X6BA 5IOZA 1ABQA 3DKWA 1B34A 4F7UA 1W0TA 2RQUA 4QWQA 3GFIA 2X1EA 2ARSA 1RUNA 1Z3YA 1V5GA 4KYWA 2V8JA 1QZYA 2NVTJ 3GTQJ 1BC7C 1JTXA 1QVGA 1BM9A 2QDLA 4NHJA 4AIKA 1PJRA 4UUTA 3K1MA 2VOPA 2ZZFA 1WRJA 5DM7F 2M34A 1VQ8I 4A12A 2EGAA 1UHMA 3NWSA 1YG2A 2DA5A 1PWTA 3JCMW 1PRLC 4HRIA 4CSWA 2DTHA 1E2XA 4JX4A 1IO2A 5ICEA 3VYGA 2VQHA 3PJRA 2X9DA 3CPWA 3FMQA 2Q2EB 5LJ3j 3CCLQ 4B09A 2MWOA 1BI1A 2HPIA 5E17F 4I6ZA 3G4SA 5JVTA 5E1ZB 3S17J 4U0YA 1WFWA 3CMYA 4MEYF 2EGEA 3E9FA 3JAMK 2W1OA 1LB2A 2K7LA 2JM9A 1O7FA 1EH6A 2VL8A 2F2WA 2FU4A 2OPTA 2OBPA 2VJJA 1IJWC 3KFVA 3GFJA 3RR6A 2K3PA 4XSZF 1JKRC 1LFPA 4BI8B 1M5Q1 1ZQ1A 1OR7A 3HOTA 2YRVA 2A5YB 3EFOB 1N8RC 1HKTA 2VI6A 2L02A 2M0MA 5LHHA 4PJJA 3I5RA 3CCQA 3S1QJ 2QBYA 1AZGB 1YS7A 4QPOA 2IGNA 2ADUA 3ERMA 2HVRA 3LSTA 1MDMA 3FMRA 3TU4K 3CCYA 2EBPA 2UWMA 3M0UA 4IUVA 3I64A 4X5OA 3ABMH 2DILA 1G8XA 2ZXWH 2NXNB 1I6HJ 1P92A 1YBYA 1PP8F 2KMUA 1S7OA 3MMYB 4UUSB 2B86A 4RTWA 5HNFA 2CWEA 2QEXQ 3EG2A 2R7VA 5J39A 2HYJA 4M3BA 3W6JB 3FM5A 4EMKC 1TWBA 3BJOA 1HW5A 3LA3A 4F93B 1YW9A 4JZ4A 5HS9A 5HODA 3B6AA 1XMAA 2MOXA 2IVMA 3VSKA 3S8PA 2MLKA 4BGDA 2CUJA 5J6XA 2ZTGA 1LPLA 3VQXA 2FMLA 1HOMA 5L3EA 2PNIA 2XASA 2IBDA 4EJUA 5FRMA 3FK6A 2OTLA 5HNHA 1IDYA 1GCPA 3LWHA 3CCQQ 1NJIU 3RQIA 4BY1J 2NUPB 2LC2A 2DK5A 2P0PA 2M7AA 3SWNB 2F6CA 4TVWA 1MZBA 2OV7A 2WAQA 5BPIA 1SSHA 3ULQB 1B72B 2PBIA 1B6AA 4LDWA 4A3EJ 3WTXC 2K79A 2CUBA 1VQ9I 3QO5A 4J9EA 1NH3A 1ETWA 3S2HJ 1V29B 3OOPA 4JPBW 3CC4A 2KXDA 3FWEA 1UFMA 3CCJA 5KNLA 4A3CJ 4JZ3A 3NQOA 5DCMA 3W2AA 1RI9A 2HKOA 3G1ZA 2GXAA 4YRGA 5KCMA 3CMEI 3CDLA 4EEFG 1D8KA 2Q0OA 1M3CA 2W0ZA 2V9PA 2AS5F 3HJEA 3OR1C 4MO7A 3OB9A 5IHIA 5D8KB 1WHKA 2CSQA 3LQRA 3X24B 3RACA 2ME6A 4A93J 2OTLQ 3FXOA 1HD3A 3S6WA 1ITYA 4YDQA 3GEZA 4C5GA 1K73U 1CKAA 3JAME 4M7DE 3GTJJ 4Q5SF 3RKQA 1OOTA 4AFZC 1ORKA 2K02A 2I4OA 3K2ZA 5L3CA 1QLYA 4WXDA 2QTVA 2RA2A 4ENNA 2XROA 2EFPA 2HPMA 5JHUA 2LFBA 2FVUA 1S6LA 1N75A 3WTTC 2LR8A 1TTHB 4LVKA 3CLOA 5GMKi 2YSRA 3RL6A 2A6TA 1MIJA 3M53A 1B9NA 3BW1A 1MH3A 1DPRA 1OYIA 2YLCA 2NOJB 2DYSH 4AT1B 3EDPA 2M0YA 2BW3A 3ZQ7A 1GVJA 3CJTB 2D45A 2L9VA 3NFCA 3HUGA 1TUCA 4P5OA 3MZHA 4RMFA 1LNXA 4BE0A 1YI2T 1TU0B 3CCLI 3E19A 4CUGA 4TV7A 2BHYA 3DTEA 2DVEA 2NS6A 2PMUA 3MKZA 2L0AA 4GO1A 4KT5C 1CQTA 2QXFA 4FYYB 4MDWA 3BFMA 2FD5A 2Q5HA 3U21A 4WF2A 1FOXA 3I55Q 3CDHA 4ELYC 3QO8A 1WQ2A 2MAMA 1A36A 3LL7A 3A8MB 4HXJA 2HSEB 2ZBKA 4RKUE 2PEXA 4KN7X 3RSNA 2KGTA 2GLOA 1R9TJ 2L5QA 3P8BB 1EVKA 1K76A 3JTGA 5GAOq 1H4QA 3GF5A 1SRMA 2M4KA 3AT1B 5B5EC 4DBRA 4JRPA 2HYFA 3VS6A 4CA0A 2Y2ZA 3DV8A 3ZN0A 5J26A 1C6VX 1D1CA 4RAYA 4HLXA 3FMSA 1TW2A 4PJOD 2GQQA 1O3SA 4KIGA 3I5UA 4XICA 1OQYA 3BP8A 3QODA 2A6EF 2V1DA 3HRIA 4LB5A 3VS1A 1J5YA 3T8TA 3JSPA 1XTDA 3OSGA 4QLCU 3GTKJ 2MPXC 2KP6A 2L2OA 2PJRA 4X9DA 3KFWX 4XOTA 1OU8A 4OB2B 1QU3A 2DVJA 4EX5A 3M56A 1X1PA 2ZPIB 2CT4A 2QEXI 4V2SA 5LJ5g 2QWWA 1U8RA 4RUGA 4HKEA 1XGMA 4MQ9F 2WB1N 4A3MJ 4BAYA 5EC7A 5J8FA 4OVAA 3M9AA 3RTRA 2DQ0A 2LREA 2P0WA 2QA4Q 1S72A 3A7UA 1APLC 3TP3A 4E2FB 2DCEA 4C92F 4BYYA 5F5WA 2HXIA 5CKTA 1OX8A 3HSBA 2XB0X 1OYWA 1MUZA 3X26B 1AHJB 4M7AF 1A31A 2ATCB 3H6ZA 2P4TA 1HSTA 4PJOA 4M72A 2R7WA 2H3EB 3GBGA 2WBMA 3CCQI 3RNJA 2M2EA 3OYDA 4AC0A 1Q81C 5GPCA 1TOVA 3BZCA 5DUKA 3CUQB 4L59A 2VJIA 5FLXZ 1HTTA 1HLVA 1ZRFA 2EKOA 2K5FA 4DEXA 3BG7A 5GAOr 2Y48A 3QDFA 2V8IA 1OPKA 4CRIA 2GZWA 1N8RU 4BI3A 4K2EA 1NEBA 3GLXA 1VQLA 3WGGA 5E3NA 3E9IA 3PSIA 5F04A 1WZ2A 1R1TA 3C1DA 3EGUA 2R5ZB 1RKTA 3KCCA 5LGUA 3H9NA 3QNEA 4H2VA 4DYRA 1QGPA 1ZK8A 1X75C 2HVQA 5EZGA 3ZEHA 4CCKA 2ALYA 5M5XJ 4WI1A 1W36C 3A02A 5GAOp 1I5ZA 2XDDA 2EFNA 3GVAA 2YX4A 3TBIA 2VN2A 5E1WA 4FE4A 3BG9A 5F6FA 3ZQLA 2OTLI 5IH2A 4II1A 4CZCA 2ZT7A 3ZMZA 3OW2S 4HQEA 1J3TA 1ZYRF 2NYSA 1SC7A 4CXFA 1OKRA 4IVNA 3HOUJ 3E6CC 3TEDA 2W85A 1T0JA 2HCKA 2E7XA 2GA1A 5E3MA 4J15A 1D3YA 1P4XA 4KT0E 5LJ5d 3DEWA 5FKNA 4IXAA 3RYRA 2BXZA 3OYGA 2P0LA 2X3XD 4HQMA 5ICFA 3MCAB 1VQLQ 3ZFJA 3CD6T 1QVUA 1A6QA 2V4JC 3K4JA 4DZJA 1HJDA 2E60A 4Y92A 3MD2A 1VQOQ 1QO0D 2Z0WA 1WX6A 1SD5A 1YWPA 1TWAJ 2OCEA 3HIFA 4WJ4A 2VC8A 3LLRA 1M1KR 2RHYA 1NJ5A 1I3QJ 2HDWA 4BY6B 3ESWB 3GTMJ 4LVJA 2JSCA 3JCMP 4YFNF 5GMKh 2ZAEA 4IUPA 4HVCA 3OYKA 1Z91A 2UXXA 4CCMA 3CMQA 4Y3OA 5GAN6 3J7AF 1HKSA 3HFVA 2F2EA 4PDKA 2VV5A 1RAEB 4P1WA 3V8LA 2XVCA 4A3KJ 5KYUB 3S3NA 4IIOA 3I55I 1ZN2A 4W97A 1YIJQ 1BBZA 3ICAA 1BJZA 1V1CA 4HG2A 2FG0A 5GPAA 1Y57A 4A3FJ 3RESA 3SHWA 4JJNK 4IUTA 4M77D 1ADJA 5HVQC 4YG2F 5K1YA 4EPCA 1J7KA 4X0GA 2ZJQF 4PGHA 3SDBA 4CS4A 3WODF 4CICA 1UG1A 4XRSG 3OW2P 1SANA 1IAWA 2CQNA 2K5LA 3CCUA 2ESNA 1HBXG 1YJ9A 2EV6A 1VQZA 2M45A 4B48A 4IQ4A 2O01E 2DA9A 2I4LA 2XUBA 3OBWA 4E6RA 3PIPF 5L8RE 2LF8A 1FBQA 1D3BB 3LYIA 4BUPA 2CSOA 1Y7XA 4ZZDA 3HXUA 3WVEB 4QQ6A 2KE9A 2VYTA 4OP0A 2B9SA 4XKWA 1SAXA 2ZR3A 4C2UA 4JX6A 2O8KA 1R0CB 3UFGA 3CMAQ 1Z9QA 1I1SA 3SB2A 2GOMA 4EVIA 3F8FA 4BH9A 2VQLA 2C8MA 4IRIA 3QJYA 3M1CA 2D0NA 4F14A 1ZG5A 1FEXA 3IRQA 1FIPA 2KIUA 2VOOA 2QA4I 2E70A 4M77A 3K0LA 4BJ6C 2DU5A 3PNVA 3I3LA 5FLMJ 1VQ8T 3DF8A 2BY3A 2FRHA 4M78B 1WJRA 3VS2A 2HBWA 2HL3A 4M3GA 3CCMA 2QENA 1LJ9A 2EQIA 3S32A 1W6XA 3CCUQ 3TW7A 3J80Z 3QZ9B 1IC8A 2KKOA 1VYUA 2D2WA 5KYNA 5J3LA 1VQNA 1EH7A 4TVAA 3L4GB 2AKKA 1GXIE 1VQ5A 2EJFA 4HW0A 3HC7A 1U9OA 2DL5A 3NAUA 1U6GA 1X01A 3BG5A 4U88A 3KZIC 4DW6A 2Y31A 2RKHA 3VYHB 3H3UA 3D1NI 1X55A 3WHCA 2UUZA 2JUFA 5K5QA 1UHCA 3ZGKA 3C2GA 1B76A 2ZCWA 1IGQA 4LN2A 3QOEA 1UJ0A 2H6BA 2OQGA 3FISA 2XAJA 1S72I 1Y07A 2VUMJ 1P7JA 1UECA 4XKBA 4ZYEA 2OQRA 3AKZA 2XAFA 5AIQA 4KISA 2M02A 3JCMg 2X48A 4M6VA 2HFHA 1AVZC 5JVGF 1JHFA 4I98B 5LLQA 2IA2A 3A8HB 4BU2A 3V4GA 2W7NA 2XGTA 1Z7MA 4XEMA 2EBIA 4CZZA 2JVHA 1ODDA 1ON1A 2E2IJ 2X9HA 2I5UA 5D5WB 2GXBA 3TEEA 3EG1A 4ASNA 3EGXA 2DD5A 1YITA 3KZZA 2JA7J 4YIIA 4NS5A 3EFSA 2IA0A 2LT1A 2LCCA 4Q48A 4OMQA 4BBSJ 5A0GA 1UGPB 2CZ0B 2CGPA 1IN5A 3EETA 4NQWB 3QWLA 1VQLI 1BCOA 1W2BA 3A1PA 5F1RA 2WB1A 5KYYA 3CXCS 4A3LJ 2DL3A 3VV0A 2DQ3A 1Q81U 3KX2A 2ZZEA 3Q0UA 1VQOI 9ANTA 4X6AJ 5IT3A 4FYVB 1OCZH 3C7JA 2KT8A 4C5HA 2IY5A 1MBJA 2IG0A 2HDAA 4EIKA 4CS2A 2L0KA 4P9FA 1AWOA 3HXZA 3NMZC 1RADB 1TQMA 1O3RA 1YP5A 1IRGA 2XRNA 3K1PA 1Y96A 2K4YA 3WTSC 2YT6A 2L89A 2E1OA 2K5CA 2A36A 1OFCX 3OS2A 2FO0A 1M4ZA 2VASA 2M1HA 1JQQA 4J9DA 1NJ8A 4J19A 5M5YJ 5CJ9A 3E1SA 2X35A 1O3TA 3K9TA 2XDBA 1WLPB 3WG9A 4WTOB 2BVLA 1NZ9A 1VQ9T 2O31A 4R1HA 1Z6RA 2P4WA 1TUGB 1BW6A 1YITQ 1R23A 4EJVA 3HOVJ 1V76A 4X1VA 2RNAA 4A3DJ 1K4SA 1NBEB 5CKHA 3A0BC 1PD1A 3IKTA 1X19A 2OJED 4M77C 2IA1A 1X3UA 4ATOA 1E3HA 3CMET 3WGIA 3IALA 2PQ8A 3O5ZA 1Z67A 2EK5A 3VJPA 1Z1DA 1GXPA 3PUFA 1G2HA 2EQMA 4BQNA 1B07A 4HVVA 3DKYA 1LPQA 3JCMd 4M7DF 1R5ID 1KU9A 4LDVA 3CCRA 1H89C 2RK1A 1G3SA 1H4TA 1OCPA 1LJOA 3CXCP 1SESA 1Z21A 2EFOA 2K57A 4ZDLA 2XPVA 1K0XA 2RQWA 1QVGP 1H9GA 2EYYA 4FYWB 2DZCA 1KC8C 2E1MC 4LVLA 3QBYA 3ERRA 4F3QA 2HDCA 1UGVA 3S1NJ 2AO9A 1KYWA 2NVXJ 2FPEA 2XPWA 1BU1A 3L2WA 3MQZA 4XLNF 4IHWA 2RGVA 2HEOA 1MNMC 4N4NB 1T08B 1QNTA 1HC7A 4JUVA 3DCFA 5IHKA 1ABOA 2A8EA 2D8JA 4G12A 1JXOA 1R0BG 3M8FA 1O75A 1B59A 5FLVA 4LD5A 3DU5A 1QA6A 3GZNB 5FO5A 2PJPA 3CCUI 2E4HA 4YRRA 2X51A 1IXCA 3NTHA 1YJ9I 1WDXA 3G1MA 3REUA 4F04B 1JRIA 2MFZA 3LSJA 1ENHA 5A2QZ 2PLYA 3OYEA 3CCLT 1G59A 3HRUA 2ISYA 4HCKA 1KFZA 2M51A 4M75D 4M9XA 1U78A 2Z3YA 4BBRJ 1U2WA 4CH3A 3JRBA 3BTCA 2MK5A 1JEGA 2MF2A 3QG1A 3DB4A 1FPQA 4Y15A 2M1BA 1HW2A 5LJ5j 1X4PA 2A28A 1G5VA 4PNOA 2RQTA 4RB1A 3I56Q 1JUPA 2DXIA 2I4MA 4F16A 2JVGA 4CCNA 5F27A 2O7OA 2CP5A 4UVBA 2F5DA 2DRKA 4MHGA 3MAJA 3A8LB 1Q1VA 3MF1A 1STZA 9ATCB 2UXNA 2AKWA 3KP3A 4BEHA 3LWFA 4RBOA 3BJ6A 4YIFA 1K4TA 1JE8A 2KT1A 1PRMC 2RM4A 5KE2A 3BR0A 4KBMB 2W4SA 4A3GJ 2EJGA 2DL8A 1NPPA 5IXFA 2W25A 5ECAA 3NEMA 3I53A 3L7WA 3QO7A 2RJEA 4YELA 1C0WA 2B8AA 4M75A 1KMNA 4E7JA 2XC7A 4QT7A 4A53A 4FETA 2XGDA 2C0IA 1VQ5I 2LRQA 3U1DA 5TISC 2E6NA 3G4ST 1XGOA 4JBAA 5EGOA 2XKPA 1QKWA 1WHMA 1Q7YR 4LLGF 3CBPA 4EMHA 3M3YJ 3VQYA 1VYVA 5J1RA 2NWMA 4KRTA 5GAN4 2KJCA 2J3MA 2FOWA 1K79A 5M3FJ 2AZVA 2DOEA 2K9MA 2X6XA 2VC0A 4RTXA 2LKSA 3L00A 3OYYA 3BOQA 3Q1JA 4XTZA 2M9UA 2EIKH 3IWFA 3P9CA 1W1FA 2P0KA 1U0JA 1EFNA 3ZMDA 2P7VB 5FWCA 4Y52J 4ME7A 1ERDA 3LSSA 3CCQT 4E7SA 3E6BA 2DAOA 5E3IA 3WU1B 1D09B 3TEHB 2E5ZA 1Y1WJ 2CJ9A 4FT2A 2DOFA 2O61A 1B7YB 3CEYA 2JTVA 2JT1A 3MHXA 1ZBJA 4G6DA 3GP8A 2ICWG 4L9VA 3EPZA 1YITI 1SSFA 3LW5E 3MZYA 5FLXK 2HOEA 3JRZA 3D5SC 2OZUA 2IRFG 1GRIA 4OMZA 4HOBA 2KJBA 2Y90A 2ID6A 3RDIA 1B9MA 1T56A 2LVMA 2VPRA 3EUHA 3M57A 2V9VA 1C1AA 2LNBA 1K6OA 1P9QC 1WU7A 2DBKA 4LFUA 2DO3A 3OBYA 2O8XA 3HTRA 3JRAA 3J7ZI 2ECCA 2OTLT 3LFKA 2O03A 3ZQHA 5CKEA 2DETA 4ZN1A 1S5LC 3REOA 1WI7A 4C2TA 5GAMe 1RESA 3Q0VA 2QKLB 4M6YA 5KYXB 2GNCA 3MN2A 5ILUA 3OIOA 3OYNA 1IN7A 1ZA1B 3UATA 1J2XA 2F5FA 3F8CA 1JKPC 1I1JA 3PUBA 2A6HF 4P55A 4J9CA 1ZSZA 2C0OA 4B9WA 2Q5IA 4LB6B 1GCQA 5IYCJ 3NGPA 5LRRA 3HSFA 1D0XA 4LIUA 5E3LA 2P81A 3S1MJ 2LCLA 3HFNA 3H3ZA 2L7ZA 3LWIA 1VQ7Q 4N4IA 3VEPA 1WYXA 4ZC3A 2DXBA 1PM3A 2RJCA 3EAEA 3QYGB 4A2UA 2RC4A 3GF2A 1YJWA 1YI2A 3BTLA 3LAPA 2MWPA 2EA4A 4UXNA 3W2WA 4U0WA 5GMKl 3F6OA 2DE0X 1YB3A 1SFXA 3PCOB 3CCRI 1IB8A 2W48A 1OI1A 1U9NA 4TQDA 2MH2A 3WTYC 2FBIA 1XMXA 2RHXA 2BY2A 4M75C 1JB0E 2DD4A 4KR3A 3DBRB 2ZPEB 2RF0A 4CC3A 4FE7A 3K6GA 3I56I 2HZTA 4KN4X 1Y0MA 2K3BA 3IUOA 1UG2A 2AZSA 3FM3A 1ZG3A 5KYWB 4J8OA 5GJVB 4C0DC 4N0BA 2FHDA 1M90U 1K9MC 2HNHA 1KGSA 5IOYA 3UA7A 3AG4H 1IN4A 4LLNA 4UP7A 2ZR2A 3A74A 2OUMA 1JGSA 2H94A 1D0ZA 2O4XB 4AFSC 4JYKA 5KCOA 4ZTFA 1VQ4A 5C4JJ 2ISZA 3HL8A 1ULYA 3I0TA 3BROA 4FM4B 2E5AA 4KULA 1YJWQ 2RV8A 2FF4A 4P73C 2BIVA 2HKNA 7AT1B 3QYBA 4JLIA 4BUGA 3L2ZA 2VKDA 3TP0A 4C92G 2VXZA 1TWGJ 4RAFA 5FLXE 2MBFA 2WY7Q 4N0AA 5IP7J 8ATCB 1I8FA 2QA4T 2ARUA 1VF9A 2KSSA 1T0HA 4M7AG 5GP9A 2DA1A 4E7HA 4CGZA 3CF5F 4A0ZA 4R0KA 4DBHA 3NTIA 4M3FA 3JRDA 3AG1H 4J7FA 3MEXA 1WJDA 1LOJA 1YFRA 4HNVA 2D5VA 2Z5UA 3L9FA 1NJ6A 2FOKA 2QHSA 5HDKA 3UKGA 1ZG1A 1KYZA 1FBSA 3SZPA 3HSRA 3LH5A 1N9SA 3GO5A 3WE3A 3QXEB 4I0BA 1RLPC 1UHSA 4N4GA 3P8HA 4BE2A 4GCVA 1HQCA 3F8NA 3EUHC 4U0VA 3S1RJ 4MZTA 3ME9A 2E71A 3L2VA 1K73R 4KUDK 2JSPA 3PFYA 2JW4A 1RI0A 5LHIA 1X2MA 1VQ4Q 5EJCA 4JJDA 3R6OA 2XKOC 2JJ9A 4KGZB 2GTOA 3L42A 4RTUA 5JLXA 4N9IA 2K9QA 2VKNA 3DKXA 3SZGA 2JPBA 2V79A 1ETQA 3ECHA 5EG0B 4M6XA 3WHBA 2KRMA 4XQ3A 2MD5A 2Q2EA 1X1DA 3QHSA 2QGFB 1LYLA 4C8QF 3KBGA 1I5LA 1QP2A 1WWXA 3DEEA 1D1AA 1ZR2A 4HCZA 1U3EM 3G1LA 1MMSA 2E1HA 2CH0A 1S72T 4DYQA 1GCQC 3VWBA 2R0QC 1UAAA 2X4XA 4ITVA 1XS9A 5D6YA 2KQWA 1W1WE 2BXYA 3OYAA 2K9SA 5DCFA 3GFLA 4ZZLA 2VBYA 4PJOG 3HOYJ 1YHQA 1MDMB 2H27A 3A03A 4QVDA 1X54A 1I39A 3EFOA 2IP2A 1Z9ZA 1MMAA 3JV3A 1NLPC 4G8XA 1PYSB 4A5NA 1BI2A 1OCOH 5EYRA 3EUAA 4RQFA 2XK0A 1SKUB 1XDUA 3M4PA 5GAMg 4OGEA 4Q5WA 2KZGA 2L8DA 2RN8A 3GNFB 1FY7A 1Q86C 2UZKA 2DFHA 4MTEA 1IZ1A 5LD2C 1VQLT 1QCOA 3PMTA 4ZYHA 3WE2A 2ZJRF 3LQQA 3JB9D 3EG9A 1N77A 4UUSA 2GCXA 1VQ7I 5IAYA 3OIPA 2OA4A 3AL0B 1YO5C 4N9HA 2IEKA 5AIPA 1IDZA 3RZOJ 4DYCA 1OV3A 4P72A 2QQRA 2W00A 5GANe 3CLQA 3SFZA 3IG2A 3LH0A 4RMOA 3BG6A 1YRNB 2VPLA 3H5AA 5F0HA 3HTSB 2EAYA 2EB7A 1K4US 3GBQA 3GX4X 2KBTA 3CC2A 1SERA 2VXDA 3BJUA 3QOPA 5GAOn 4UB6C 4II3A 3UWNA 4DA4A 1ZLJA 3MP8A 1F1BB 2LY9A 2PMHA 2KEAA 3ZMTA 3SQNA 3L2UA 2LKXA 2NUPA 2O9SA 3FBIB 2QQ8A 5GAOl 3SWNA 1Q1HA 1MSEC 2RQRA 4F52A 4F7ZA 2R93J 1B72A 2NAZA 4XSXF 1HW1A 2DDZA 4C9YA 3HGYA 5GAGJ 5LJ3f 3L2CA 2J05A 1VQ6Q 3R4KA 2CJJA 2R7SA 1I50J 3QYFA 3FJ5A 1UGRB 3FIWA 2EPFA 2KRFA 4JOMA 3CCEA 2DJNA 2RHIA 1EA3A 2JMCA 4KH1B 1H4SA 2IPOB 3FDYA 1LVAA 4VUBA 1YJWI 5L3DA 1N8RR 4H2SA 2CMPA 1SRLA 2VE8A 2X6OA 3I9V2 3M0SA 2VBZA 4E7KA 1IO6A 2ETHA 4P71A 4HV6A 4IHYA 2VXFA 2XICA 1UFFA 1HXDA 3A8GB 3PE0A 2LH9A 2FL7A 5I11A 1MSFC 2I4NA 2F4OB 2COYA 5KNNA 3V7CA 4BQQA 3ROUA 1ZAOA 2H1KA 2E3IA 2V26A 1K7AA 2E41A 3KPHA 1G3TA 5IP9J 4HF1A 2X1DA 1T8IA 2DTRA 3RYPA 1K78B 5KCHA 3SEZA 3QSUA 4AYBN 5HOOA 4XTYA 1PG5B 3CCUT 2L3DA 4J9BA 2STTA 2GWRA 4U7BA 1GFDA 1YJ9T 2EYXA 2HQRA 3H8ZA 4A4FA 5LHGA 5HS7A 2QYOA 1FSHA 1DP3A 2Q7HA 1VQ4I 2J6FA 3OW2A 3H5NA 3FLGA 2DYBA 3CCEQ 2Y75A 3D7SB 2BTTA 4LD6A 3VDXA 4KGXB 3TCJA 1WHUA 3KZYA 3S93A 2V8KA 4OB0B 1KQ0A 4C92B 2LX9A 3IKMB 2R5AA 5IP6A 2Y4XA 2L01A 3UNGC 2DYRH 4OIPF 3DPUA 1BL0A 5D4SA 1W70A 4M7AB 4H2YA 2V1NA 1I07A 3QP6A 1G83A 1KMMA 4NL2A 1FMWA 4XOPA 2P7CB 2WADA 1LCKA 3UGTA 1BR4A 4M77G 5FWBA 3EQLF 4IIMA 2EZHA 5GJWB 1JJ2S 2B7EA 3H0FA 1ZQ3P 4AUXA 1QRYA 3E5XA 4CI0C 4LD9K 2YUNA 1EOVA 1T38A 1R71A 1R5GA 1M8VA 5AYFA 2K6DA 4P72C 3LMMA 4M3DA 3U1KA 4KICA 3OYIA 4XQFA 3I5SA 2P8TA 2ZKZA 4UY8I 4KITB 2YS9A 4C3JJ 1BI0A 2DDBA 3JB9J 1VQ5T 3REBB 4D8DA 1D0YA 1Z6TA 5EEGA 1TC3C 1NJIC 4IPAA 4TVRA 1F9NA 1HSQA 3I4PA 4OMNA 1FIAA 1R4MB 2E10A 4P5NA 1YX5A 4UC4A 2ID3A 1R4NB 5DTDA 4NOYA 2QSHX 1JKOC 1AEYA 5J3BA 3SWNC 4QVZA 2XDVA 3DXJF 1OYXA 3H9JA 3QU6A 4L5JA 3ASNH 4NC8A 2XAUA 2JT4A 3JCMJ 4ZYGA 3E0JB 4PJOB 5E8GA 1Y8QB 4HDUA 3MO8A 3F9KA 2V1QA 2A37A 2JTFA 5ED4A 5GANg 1UB4A 1W66A 4RG8A 1TH7A 4M7DC 4WCIA 5FU6B 4G7OF 4I01A 1VFCA 2P5KA 2Q7GA 4L9JA 5ILVA 1JJ2P 1HSJA 5A0DA 2LP5A 1WGXA 1IZ6A 2DEQA 2FZCB 3ZMSA 2DW4A 1YITT 4OOIA 4M4ZA 1NK3P 4P71C 3DLLF 1B8IB 3VS0A 3CUQA 4KIFA 2EQUA 2VUBA 1XMKA 4PJOE 2H1LA 4C0GA 1JBMA 3JREA 4ANJA 5FKLA 2DODA 1VQ6I 4RDUA 3CMEA 3VODA 1TXQA 3M8EA 4JDSA 1AKHB 3BDDA 4NBQA 2CP0A 1MBFA 3TMOA 4BACA 4CHUA 4ZYAA 1WH5A 2COBA 5B3SH 1RR7A 4YRMA 4FL6A 3J7YJ 1VTNC 1WIEA 4I0AA 2CUEA 4X9CA 1SHFA 4YRPA 4Q15A 4LUDA 5I21A 2ZZGA 2W84A 4KNYA 2LMDA 4NB5A 2G7HA 3GOXA 3CC2I 3AHUA 2L3QA 4OGCA 3QPSA 5K7ZA 1BYMA 1XB4A 3KLOA 4DOWA 2DPPB 2CW0F 1BN5A 5LJ3e 1YFHA 4Y91A 2QQAA 4H2UA 1W5CC 2A7YA 3HOWJ 3OQ5A 5M3MJ 3F6VA 4UPAA 2IS1A 3OS1A 4L6V5 3G7ZA 4KUMA 4RCCA 4HWSA 2HD0A 2KXCA 5GTIC 3LFUA 4FU6A 2HL5C 4RB2C 1IXRC 1B70B 2EGCA 1P6RA 1CKBA 2OTJQ 3L1AA 3IWZA 2ZPBB 4G94A 2R7XA 3GZ6A 3META 4GXOA 4XIDA 3M4YA 2LKPA 1IN8A 1U8BA 1ADYA 3CCEI 5CKBA 2DBBA 1WQWA 1WJBA 3CCRT 2IPQX 3OA6A 1RABB 4OMMA 4U87A 4RGXA 1FTZA 3BDUA 4DOVA 2KYBA 1PUEE 2EYZA 4OMPA 1NHAA 2P5VA 3W3SA 1Q81R 3A31A 5GAN5 3I56T 2M7BA 3AG2H 3CXCA 2GAUA 3J7AY 1U5TB 1TP4A 3E5UA 3A5ZB 5F0FA 4HSTA 3QUIA 1SVLA 2V9KA 2L3RA 3FBNB 2AQEA 2WSCE 4BXXJ 1RL2A 5KYUA 2MG4A 2ACJA 5F0CA 2NUZA 3G6EQ 1MV0B 4FT4A 5DYMA 5DLOA 5LBQA 3ZCOA 1MGQA 1IUFA 3NHNA 2ZINA 1UHWA 4HSRA 2QZ8A 5JI6A 1AOYA 4M78D 3TKYA 3BQYA 3WQZA 3IV5A 1R1UA 2PG4A 4LUEA 2Y9YA 2K9LA 1BBYA 5GMKm 2QEXA 5EZHA 4YP0A 1WJFA 5KE3A 1GLNA 1D3BA 2OZ6A 4M3EA 4ZIBA 3M8JA 4BB7A 3A01B 1IF1A 2JA2A 2F4IA 3DQVC 1XSXA 3O3KA 2JM8A 2MI6A 4OMLA 4Y33A 1B1BA 4ZTUB 3CUQC 4WXCA 3EH2A 3M4GA 2RO0A 4DIQA 2KYMA 1YWOA 2CJAA 1N27A 4XK8E 5K5RA 1WHJA 3IL2A 3CCSQ 3NARA 3UR3C 4X34A 2EA2A 1W5SA 3O2PE 2DOAA 2GOXB 3S2WA 1TQIA 4AYBA 2ENMA 2FNAA 4B4CA 4D8KA 1G51A 4M78A 2EINH 4YRVA 1XC5A 1IXDA 1FOYA 2GTJA 3OOUA 3D5RC 4G7HF 4LNPA 4B9XA 4AG2C 1MNEA 4BHCA 1YX3A 3H9QA 4M77E 2JN6A 2DMQA 4QTRA 2E3CA 3BPVA 1NPRA 5E1XA 2QCOA 1B7TA 4HX4A 3M4QA 2Z9OA 1EV7A 4XKCA 3RPQA 1FOKA 3M0TA 4XU1A 3L4GA 2DJQA 4MZMA 2BKDN 1R7JA 1D5VA 3JAMZ 2DJIA 4IRGA 4MQVA 3HY1A 2QKMB 4H0EA 3NELA 3TREA 1TNTA 2BOLA 3URGA 1T33A 2EILH 3EG0A 5D6XA 5D5XB 2CGHA 2A3LA 3VUBA 3TEGA 2TCTA 4P74A 2PMEA 5TGTA 1WPKA 3CJRB 2WV0A 3CBMA 3TW6A 3G1JA 4G9YA 4UP8A 4FISA 1D5YA 1WJ5A 1XD7A 1EIYA 1NYGA 2ZCEA 3MP6A 2E5NA 2QHUA 3I59B 2XHCA 4E51A 1TWFJ 2CP6A 2HYGD 1RIOH 3EHQA 3PIOA 3EG3A 1KIKA 3BR6A 4LG0B 1ZUKA 4PLLA 2JTEA 1B8AA 2HXOA 3R0JA 5JHFA 5GAMh 4DBQA 3UPUA 3FXQA 3TQNA 1K83J 2FEIA 1H8AC 4LOCA 2BYVE 2A69F 4G6QA 2XRLA 3RDVA 3BC8A 4BY6C 3P8TA 2FSWA 4F91B 1WA7A 2DEUA 3S2DJ 1NJ2A 2R7OA 1K1ZA 1K9AA 5FU7B 3OY9A 4EM2A 4ZDOA 4M7DB 3QIIA 2I10A 2KDZA 1VQ7T 1W36D 2HQ5A 5HLTA 2BHZA 3CMMA 2OTJI 1F5TA 2RQQA 2XGCA 1O3QA 2YRDA 2QSFX 1I4K1 4NQWA 1OZ3A 2FBHA 2P5LC 2Z1DA 3SDGA 2W82A 4XLEA 2L54A 1JHHA 2M0OA 1JUSA 4HPQA 1A04A 2QHTA 5CVRA 2RHSA 1ZRCA 1ETYA 4BI4A 2HZDA 3F21A 2HQEA 1OEBA 1VQMQ 2QF7A 4RB3C 1YJNQ 4OAZA 3I55A 5HLGA 4P96A 2M16A 4UUVA 1KHCA 2LNHB 4A54A 1KQ1A 1A5JA 2HQNA 4J83A 3VPRA 2DF6A 2E5QA 2DX1A 3M55A 4AVPA 2F48A 2HBPA 3IRRA 3ZL7C 2J06A 5L3BA 1WJSA 2VJ5A 1NG2A 2MMPA 3BE3A 1OPCA 3R0AA 4DOZA 2BUDA 4J9FA 1JJ6C 3G6EI 1UEBA 1KZHA 2WSEE 2NVYJ 4EQQA 1XSVA 4QKUA 1MJBA 3L2QA 2L3SA 4HF0A 2MSYA 1TLHB 3HZJA 1VQKQ 4NC7A 3VU3C 3HXVA 3V42A 2R5YB 3F0CA 3JRGA 4B6MA 1ZX6A 1E17A 2JTMA 1YJWT 1E22A 3K4NA 1KQ8A 2QUFA 2Z2SB 2DK8A 4YRNA 1X2HA 2DMOA 4M78C 4PSXA 1QQIA 2OAZA 2DYIA 2CYZB 2YUPA 3K4CA 2Y0SN 2D8HA 3VYRB 2L2PA 3GUDA 5J8CA 3NEUA 2QA4A 4S05A 2CUFA 3WXMB 3MEAA 1M2OA 5J4YA 1AWJA 4X1EA 2RNGA 1ONVA 3WTZA 2RI5A 3HHTB 1N9WA 3BCAA 3U2RA 1GGMA 3OL4A 3KIOA 3JSCA 3C3WA 1WJEA 2EZKA 4IEJA 3CZ6A 1WJCA 2G7UA 3PNTA 5GAOm 1T6SA 2DQLA 2K3FA 2DIGA 1QQJA 2GA2A 1KHIA 3CCSI 3UDCA 5GAEJ 1GBQA 2ZJPF 1W4SA 2G9WA 4R56A 4XAXB 1XSDA 1J9IA 2K85A 4IOAF 5K7HA 4P74C 1Z77A 4RTZA 3RJPA 1UG0A 3X25B 3JCMb 4D1QA 1VQ4T 4HCCA 1X2NA 4XRSA 4RB0A 2YWWA 2ECBA 4YRKA 3BZ6A 3HPGA 4C8QG 4H2XB 4R8HA 1IN6A 1OZ2A 2OX7A 3IKLA 3RCOA 3VB2A 2KK4A 5EEAA 4L5EA 5HKCA 5HDGA 2BZ8A 2GFUA 2XF7A 3TOBA 3OYLA 2KRCA 1VNDA 1H88C 2V7FA 4XRFA 2QAZA 5HDNA 4YIRX 4AIDA 1VQPQ 5DUIA 1WPYA 1TUDA 2WC2A 4ZNXA 1YE9A 1ZGAA 3R07A 2DKGA 4BDYA 2BZXA 5KK1A 1UJYA 1IW7F 4XTUA 2DTZA 4OU0A 2WY8Q 4Z02A 3S15J 3G71Q 5CVVA 4FASD 3A7RA 1EH8A 5C4XJ 2M5WA 2ED0A 1USYA 3DPLC 1ZRDA 2C0TA 3CJNA 2AIRB 1LQ1A 1M3BA 3RERA 2A08A 3PZCA 1TT5B 3D0SA 5C51B 4ENKA 1AT1B 2IGKA 2LG4A 3J81Z 3F72A 5BNGA 3KFUA 2DRMA 2CQ7A 2HU9A 1D8JA 3CC7A 1K0SA 2VBXA 4EJWA 1XDSA 4IHSA 4HVWA 4FW2A 3GIBA 1VQOA 2HQXA 2KRNA 1KC8R 1SFUA 2E6ZA 4JRIA 2EL9A 3LX7A 2A5WA 4EM0B 4HWTA 2HZYA 1QHGA 5CKFA 4M75E 2DT6A 2DTOA 4DQ2A 5E20A 1WKMA 4JQFA 4C2MJ 2EYQA 5C53B 4C5IA 3CQZJ 3I35A 1XTAA 5LEKA 5GANh 4RDXA 2VXEA 4CC2A 3E7LA 4E7LA 1YHQT 4L5GA 2R7TA 1VQMI 2F5VA 1YJNI 3L1PA 2QQBA 1YIJA 1M8MA 2LTOA 5A0LA 2K2MA 2WAEA 4PJOF 4B3AA 4CC4B 4YRIA 3O6BB 3TEHA 3ZQQA 1RAFB 3IC7A 5D5UB 2PI0A 4YROA 5ICCA 1ETKA 2QGUA 4MMLA 5GAN8 3I58A 2E5KA 1OCCH 2DMPA 1B7YA 2JMWA 3LOCA 4QIWN 3KP4A 1K8AC 3ZRGA 1R5HA 3LSPA 3A5YA 1TT0A 1BBUA 3CC7Q 2COMA 1MHNA 1UELB 1LFUP 4PFZA 2O3FA 3OYMA 2H8WA 1OMIA 3FK7A 2NRAC 1ZBXA 1VQKI 3H0IA 5LJ5f 5D5VB 3UF4A 4ZYDA 2ZC2A 3O8VA 5ICGA 3CQTA 1AD5A 6AT1B 5CKDA 2QHVA 5BQTA 3CMAA 2ELHA 4BXFA 2AXLA 4RAZA 4YFKF 2VODA 2AKLA 1BK2A 2CKKA 3CC2T 2LQ8A 4XL9A 3OS5A 2Q8KA 4LDUA 3KP7A 1PCXA 3IH3A 4XLHA 3HGGA 2E2HJ 1USTA 1YIOA 5D8LB 1VOMA 4NUBA 3CJQB 1ATIA 3P7NA 2IGOA 3LNQA 2L4MA 3Q9VA 2YHTA 2GF7A 2NUTA 3A7AA 5BPDA 5KYXA 1W4MA 5LGNA 1WXBA 4HT9A 1QVPA 1WH7A 4A69C 3RGLA 4CYCB 2XIGA 1X69A 4OINF 2CS3A 1LE8B 2EFIA 3GXOA 3BR5A 4HLYA 2F5CA 3VQVA 3K1NA 1ZLMA 3S3MA 2ZMEB 3CCET 2QM3A 1C0AA 2ED1A 1WVRA 2X4HA 1NG6A 1OYYA 1PNJA 1E6GA 2DA7A 1J09A 3ECOA 1USYC 5FROA 1PD0A 3W6VA 1UB9A 2RHQB 1HK9A 2HOSA 2HQHA 3TGNA 2DFEA 4ENMA 1V5FA 4IZZA 3H41A 5E8IA 1ZSGA 3QPLA 2XI9A 1ARKA 1Q82U 4I2OA 3PSFA 2CRGA 1C0MA 2LD5A 3QQAA 2R7RA 4L0YB 1I27A 3PCOA 1VQPI 3DEUA 2G4CA 3MP1A 1BJAA 2KY9A 3ULRB 1RETA 2WSFE 1RLQC 4E47A 3GTPJ 2LQWA 1M30A 1LFBA 2LZ6B 2A61A 2P6SA 4XORA 1E0EA 3AG3H 1JXSA 3M07A 3G71I 3JCUC 3FJPA 4P75A 5C52B 2R3SA 5KYWA 4AFQC 1HA8A 2QVOA 4A4GA 3ZQIA 1R36A 2RD1A 3LSQA 2COWA 1MJAA 5AONA 1SVMA 1GFCA 2O4XA 2XDPA 4C8QB 4M74A 4BHPA 5CR2A 4ZTZB 2YUQA 3GLLA 3R6NA 1BR1A 2VGMA 1LEBA 3ZQFA 4II2A 4Z2YA 3GFMA 2Y0SA 3UH0A 4YFXF 1LDKB 1F43A 4IO9F 3MVPA 1KQ2A 1XQHA 5K1XA 4XLAA 1F4KA 4YRLA 4QW2A 2O9VA 2HTSA 2OCCH 4BE1A 3LAJA 4M71A 4G6TB 1Y0UA 1YLFA 2LBFB 2QDYB 2ODRD 3QPHA 4C8QE 2PMZN 2IJLA 4J5YA 4L5IA 2Q7EA 1J5WA 5CO7A 4D5CA 4M77F 4LVMA 1DPUA 3BPXA 1BW5A 1T2KA 2MC3A 3G3ZA 3OWTA 2OF7A 4GBQA 4IUQA 1IV6A 3B02A 2ROLA 2ZNJA 1FXXA 3WU2C 3X20B 2FJ1A 3SD4A 3NETA 3GYHX 2YXYA 2EH3A 4HCBA 3TL4X 1BA5A 3PFSA 4O6JA 3P5JA 4BQAA 1G3WA 2F2VA 3C2HA 3HRSA 3BR2A 3DWLE 1SFEA 4O2DA 1PHTA 1X6OA 4LG3A 1T95A 1M1GA 2NLUA 4EMSA 1DQUA 3PQKA 3CC7I 2ZZDA 1KD1C 2JRTA 1KJWA 1ZARA 4E7IA 1ZA2B 4B1RA 3KYDB 1XX5A 5EG0A 5HY6A 2CZ7B 4IRHA 2MIOA 1WHLA 4MDXA 5BMZA 5I22A 2CQXA 1JGGA 4A3IJ 4AH6A 4O5VA 2X4WA 1T3LA 1MV3A 2VKHA 2IAIA 4ZN3A 1K9MR 5KVRA 2KIFA 3BY6A 4MEXF 2KQRA 4BXUA 3M4OJ 4CDGA 1REPC 4GFBA 1M2VB 4CS3A 1U1SA 3THKA 3KYCB 3HOSA 2DAQA 2EV5A 1TWHJ 2FZKB 3N5BB 4J6WA 1YIJI 2JXBA 1NJ1A 3A98A 1X2QA 4D0PA 5E18F 4YRTA 2LTPA 1SETA 2ZSHB 1WHHA 4ZJZA 5LJ3h 4U7DA 3JCMV 1PYSA 1RAHB 2SEMA 3FXRA 2M8GX 4ESFA 5LJ5e 2XAHA 4KQEA 1NNHA 1JJ2A 4EGZA 1WJQA 1JO8A 3F8BA 2AMCA 3MQ0A 5BS6A 1RC9A 3EGDB 2YPRA 2CDTA 5ELOA 4EV0A 3EG9B 2OTJT 2CP7A 3G4SQ 5FD6A 3G73A 2XF5A 2Y4YA 4G7ZF 3ZPLA 4EM1A 1M90C 4P75C 1XG1A 3K70C 2KNBB 1S3JA 4ON0A 2E12A 3MZ8A 3VSLA 2E34A 3MEYA 3PVLA 3CMAI 4YEJA 1ETOA 2EQJA 1K8AU 3I71A 2TDXA 2RH2A 4Q6GA 1W5TA 1YRNA 2BY0A 5FFZA 3I56A 3HOZJ 4K87A 1YTYA 4Y28E 3H9GA 1KU2A 1X3WB 3JCMf 2ZT6A 1BBWA 3DP7A 2BZYA 1T0FA 1H0MA 4BL0B 2E1CA 3OSFA 1L0OC 4LGWA 3MEWA 2OC6A 3SHFA 5F64A 4R55A 4H2TA 1QE0A 3FX3A 5FJ8J 4HA8A 3TUPA 2JPCA 3G6ET 1QCFA 1IV8A 1G2BA 1GT0C 2X1CA 4ELZC 1SF9A 3VYTB 4PJLA 5H20A 2K86A 3GTGJ 5HS8A 4BDZA 3E6MA 4S0HB 3UA6A 4HEA2 5TJJA 4IKFA 1ZLKA 1ASZA 2GXGA 2KDSA 1IGNA 2OAWA 3HFZB 1XPXA 3ASOH 4KGVB 1Z9CA 4KMFA 1W7PD 2F1LA 1N9RA 2PVDB 2JZYA 1VIFA 1WI9A 1LDJA 3OYJA 3QJ6A 2XMFA 4F7UG 2W10A 2P6TA 2DPDA 1KQSS 4A4EA 3CESA 4W1UA 2DL7A 4MTDA 2PVOB 5GTHC 1QVFS 2ZJ2A 4IHXA 4CH4A 1UDLA 2I0NA 4FSSA 3PNWC 1O57A 1XCBA 1JJCB 4J7IA 4C92D 4XU2A 3KP6A 3JRFA 3CCST 2LNVA 1YCSB 1Q86R 2EW3A 2V1RA 2NYXA 4A3BJ 4M7AD 2JNGA 3GTOJ 3LSIA 2XD0A 4DZPA 4ZGJB 5CCAA 1GV2A 2ODRC 3HG9A 1FYLA 3LSHA 1Y0NA 1K78A 2CH4W 2GBYA 1YOVB 3M9QA 1AZEA 4C0FA 5ERIA 3CC4Q 4BQOA 4NCXA 1W7PA 1OR7C 2F4MB 3CCJQ 3RZDJ 2VGNA 1NM7A 2GIVA 1SMTA 3HXWA 2KI7A 1UGQB 2QEXT 2CFXA 2DXUA 2ZXHA 2PN6A 2HOAA 2R7DA 1A6IA 2GFAA 2R5MA 1V3FA 2KISA 2DNUA 4RCBA 4AWXB 2PUKB 5D6WA 3CCVA 1OULA 2CSIA 2E64A 2JOYA 1R00A 4XR6A 5B66C 1CGPA 4C92A 1A35A 4YCWA 3M5AA 3GNGA 4PHCA 3GW2A 3TDUC 4N4HA 4M7AA 1KQSP 1MW7A 4YCUA 1QVTA 1MKMA 1FYMA 1QVFP 2FMYA 4ZGEB 4MGRA 3IAM2 3EH1A 4GLKA 3PNYA 4LLLA 1SG5A 3HM5A 4P73A 5DD8A 4PUSA 2FA5A 2LYCA 2EWNA 2EZIA 4V2GA 4M78G 2G6FX 3KP2A 1G5HA 1R77A 2DO7A 2WA0A 3AL0C 2DK3A 2KAFA 3QTCA 1GHCA 1QWFA 2W24A 1U3OA 5EEHA 3H5RA 1WGSA 2RAEA 2WWYA 2D1XA 4CCJA 3FC3A 1Y56A 2FQ4A 5JLWA 4IX7A 1AWXA 3VUZA 4UHTA 1A0NB 4M9SA 4RA2A 2CV1A 4M75F 1NYFA 3HXXA 2Z99A 1RR8C 4IHVA 1VQ7A 3J81K 1T0FC 2KHMA 2CJBA 2Q1ZB 2F69A 3COAC 2DDAA 3A1YA 3CCVQ 4YRCA 2RHUA 1HDPA 1UCRA 1EF4A 2DERA 2EIMH 1WJAA 2K5IA 2K3XA 2EFWA 2H3JA 3G4SI 4YREA 2K7AA 2CIMA 3KEQA 3OYHA 3GPLA 4QPQA 1USSA 1PUFB 4FIBA 5HLHA 2QK0A 2PMZA 4EATA 1MBEA 4OWRB 3JCMc 2XKOA 2F5TX 1RACB 3FEOA 1VQMT 2PFBA 1YJNT 1FYNA 1SD4A 2FBKA 1M1FA 1J75A 4LITA 1MJ9A 4XLPF 1K61A 1ACMB 2DMUA 2VQGA 2WACA 2XG8D 1VUBA 1L0WA 2FYKA 1EKEA 1KD1U 4CH6A 1ZGWA 1LUJB 1AWCA 2D9TA 3VBBA 3K4LA 3FKIJ 3LSRA 3ABKH 4CC7A 2X85A 4J9GA 2ZPHB 1YNZA 1CF7B 4IJAA 2QQSA 3DKMA 4JRKA 3DBLB 4KUIA 1R6RA 1KG1A 2E2JJ 4JS5A 4L9NA 4D5FA 1UHFA 4HDVA 4EJTA 5GADJ 2FRWA 4FX4A 4NC6A 1B8IA 1TNSA 1BOAA 1VQKT 3PT9A 2DT7B 2JJ7A 2OD5A 3E3VA 3E5QA 2EV0A 1IXSB 3BDLA 1Q95G 3S16J 1R1VA 5DEQA 2D1VA 5DM6F 1E3PA 3F23A 3JCMe 1JUMA 1AKHA 3LC0A 5DY9A 1M1EB 1S72Q 4P3OA 3QRFF 2E35A 5GAN2 4RAGA 3OMYA 5E3OA 2Y30A