3RIRA

Crystal strucrture of biotin protein ligase from s. aureus
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Strucrture of Biotin Protein Ligase from S. aureus
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 102
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rirA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rirA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rirA02
4J15A 1N9SA 2W57A 2P5KA 1O57A 2CJBA 5ILUA 4L0ZB 4R1HA 5E18F 3EQLF 4LMYA 2ZGWA 2DW4A 3IWZA 3HYIA 4K2EA 5GAMd 5C51B 1R1TA 2K02A 1H641 1XD7A 1R00A 5K5RA 2ZZGA 5L3BA 5D5UB 4V2SA 1D3BA 5GMKi 5LBQA 2QWWA 2ARUA 4ZZDA 2JPCA 4P72A 3BJAA 5E8IA 3GYHX 1ODDA 3LA3A 5FFZA 3VBBA 4KNYA 2G7UA 3JCMf 4XU2A 4M6YA 1LEBA 4F7UG 2ISYA 3MZYA 3BY7A 4L9TA 5L3EA 5HLHA 5GANe 5F6FA 5IT9K 4YRCA 4YCVA 5JHUA 2FYKA 1MDMB 3HFNA 2Q7HA 4EJWA 3BDDA 4YROA 2DLLA 3ZMDA 4HDUA 2CFXA 3JCMX 5KNNA 3P8YA 4LLNA 4HDVA 1H4VB 2MD5A 1T0FA 2GA1A 4X9CA 4S05A 3QP5A 3HHHA 3E6CC 2BEOA 2MH2A 1HK9A 4PCQA 4P3NA 2YU3A 3T1BA 2RVCA 1TNTA 2HDCA 4P71A 4K88A 3WTUC 4ZYEA 3HXYA 4HX4A 4Y91A 1ADYA 1TW3A 4ETSA 1ON2A 1J2XA 3HTSB 2K4JA 4P75C 1JXSA 3KFUA 1BBUA 3K0LA 3CO7C 4M7DE 1YW7A 5DDGA 3A5YA 4HT9A 2XUBA 2ZIMA 2ZKZA 4EO4A 2DEQA 1MGQA 5EEHA 4LK0F 3HXZA 5HDGA 1FYMA 1HTTA 2QVOA 4AIJA 1I4K1 2RHSA 1BIAA 5BQTA 4HWOA 2DI3A 1TTYA 5EEGA 3NRVA 1QPMA 1K79A 3KCCA 3WGGA 2K4BA 2ZTGA 1IL2A 3ABUA 3BROA 1STZA 3LSSA 4IRHA 3QNEA 2CO5A 1U3EM 3KP6A 3QUIA 2D45A 1S3JA 3J81K 3M4QA 2QHTA 2V1XA 2XVCA 3R60A 1QNTA 4BXUA 2NYXA 3FXUA 1IZ1A 3M7GA 5J8FA 4HQMA 4PZJA 1ZRDA 2HFHA 1LDKB 3ICAA 4Y17A 4XTWA 3RYRA 2XAJA 1UCRA 2IA2A 5E8GA 4Q47A 5H6RA 3BJ6A 1HW5A 2V9VA 3MFKA 2P5IA 3DKWA 3R0AA 5GAMj 1G3YA 5H20A 1KU7A 1JJCA 5GAOn 1USYC 4XU3A 2EWNA 3JW4A 4UP9A 2FRHA 1EQRA 4YFNF 1M8VA 1K6OA 3DFGA 3E9HA 1OMIA 3TDUC 4M7AF 4XTXA 3SZPA 4KUMA 4E70A 4HV5A 2A6HF 4YRKA 2JN0A 2HWVA 4MMLA 2ZT6A 2FMYA 4RQFA 4EJVA 4M78D 1L3LA 4KICA 4UXNA 2KIUA 4KIFA 4Y15A 3RIRA 1U78A 2DU7A 1V3FA 2CGHA 4N0AC 2P7CB 3G3ZA 3HTUA 4OIOF 5GANh 2K57A 2UWMA 4C92F 4OIQF 4NL2A 2STTA 2TDXA 4RCCA 3JCMb 2ZR3A 2A68F 2QTXA 3I64A 3W6JB 3RJPA 5F5WA 2FNAA 3OOPA 3EFRA 2ALYA 4H2XA 2E64A 1EVLA 3E9IA 1R7JA 2YR2A 4M78A 5E1WA 2P6TA 2OU2A 1EV7A 1W4MA 2PBIA 1I5LA 4HLXA 3JCMQ 1B8AA 2OQRA 4X5OA 5ILVA 1X56A 3I71A 4NOYA 3P9CA 2PI0A 2ZO4A 4CH3A 1FYLA 2LF8A 1YW9A 3MCZA 1SFEA 1G51A 4M7DF 3RF1A 4GO1A 4RCBA 4KFCA 4FX0A 4WXCA 3I53A 2KJBA 3H3ZA 3JCMc 2M1BA 1A04A 2O3FA 3CUOA 4M9SA 2Q7EA 2DZ9A 2VBWA 4O3MA 3MF2A 4BHCA 2DQRA 4M77A 1X2HA 1TQIA 4IHSA 5KVRA 5K5QA 3HIFA 4TVAB 2VOOA 4KYWA 3KP5A 5GAMe 1G3WA 2VE9A 3TOBA 3ZMVA 1WLEA 1P4AA 3HXVA 4A6DA 3IKVA 3FB9A 1IXRC 3O2PE 1R36A 4CDGA 4WXHA 1U1SA 1Z6TA 4UV9A 1P4WA 1RIQA 5LJ3e 3D0SA 3GX4X 1IF1A 4M77F 3IKMB 2XRNA 2EJGA 4YYEA 1K7AA 4HT8A 4EMKC 4HWTA 5FB2A 4AD9A 4Q15A 1FP2A 1FBSA 5ELOA 2FEZA 3VEPA 1O3RA 4P55A 3WTVC 4UUVA 3P9IA 3WE3A 1Z9CA 1IN7A 3NEUA 4KMUX 2COMA 2V79A 4OIPF 2CG4A 1S7AA 3HY0A 1ZH5A 5DY9A 4OOIA 5E1ZB 2DPDA 3JCMh 3M4GA 2CGPA 1USTA 2D1VA 3F6OA 1KGSA 1KQ1A 3GZ5A 2BBYA 4H2WA 4J6XA 4A0ZA 1FNNA 2HR3A 4A53A 4XTUA 4A0YA 1X54A 4K86A 3V8JA 2ZJ2A 2P0LA 1PP7U 4CXFA 1ZRFA 5JI6A 4PHCA 2Z99A 1ATIA 1MD0A 4AVPA 1B4AA 1PP8F 3RKWA 4P5OA 3HSRA 3QP6A 4G9YA 1MJBA 4U0WA 4FHTA 1I6XA 1EOVA 4CO8A 4OMZA 4CHUA 5FD5A 4AIHA 4G7ZF 4XTYA 3KZYA 6PAXA 1DDNA 5HLIA 1B34B 3QOPA 1JJCB 5FO5A 2ELHA 3PGGA 3DEUA 4GCVA 4Q5SF 1ZYRF 3EYIA 3T5XA 4PJOE 1LDJA 1ZGAA 4A54A 4EQQA 2DXUA 4WF2A 3I54A 1LNWA 4GGGA 4L9JA 1F4KA 5GAOp 2FQ3A 2VXFA 5CLSA 4Q4ZF 4M78C 2G4CA 1HSTA 5J8CA 3HFZA 1KU3A 2QYOA 3ECOA 4BHBA 4ESFA 3V8KA 5GMKm 2KJCA 4OINF 3ISPA 2RB6A 4H02A 4H2VA 1H9GA 3K1MA 1I1SA 2QUFA 2IW5A 4M77E 1Z91A 3CMQA 3V7SA 2H6CA 5GAOq 2OZ6A 3FX3A 2A6EF 2HEOA 1WQWA 2R3SA 4EM0B 3NQOA 1YQAA 3EFSA 4RAZA 3FMSA 1R5GA 5DUKA 3ULQB 1E1OA 3E5QA 4XU1A 3FZVA 1B7YB 3Q9VA 2EA2A 2W24A 3JB9I 1D3YA 4OIRF 4TVWA 4LLGF 3FMRA 2ZXFA 1FP1D 2FU4A 4BNCA 3BP8A 4XSZF 1DUXC 3IKTA 5C52B 4HLYA 4B8XA 2PMFA 3K69A 1YFHA 4EMKB 2FA5A 5CVJA 1U6GA 2FXAA 2O61A 2RD1A 1USYA 2DZCA 2MBFA 4N9HA 3JB9J 1U2WA 1XGNA 3CO6C 3ZP5A 3FMQA 1UFMA 4YCWA 5LHHA 3JSOA 4DNCA 4NB5A 4TQDA 3JCMP 5ICCA 2FBKA 1YLFA 4RMFA 2ZXJA 3EETA 2ZNYA 3L2ZA 4NQWA 3F23A 2E65A 3INZA 5L3GA 2I4MA 2XKPA 3DP7A 3F8MA 1MDMA 1AWCA 2ZZFA 2ETHA 4G7OF 4YREA 2QHVA 2RN7A 1G3TA 1SFUA 5GANf 5HS8A 3C1DA 3JCMW 2RA2A 2LKPA 4MEYF 2XGXA 4M7DD 3GVAA 4U88A 4NHJA 2A07F 1GXPA 3VQVA 1M5Q1 3F22A 5GMKe 2EFNA 2RKHA 2GQQA 3WG9A 3A32A 5LJ5g 1O3SA 5LGNA 2HNIA 5HDKA 1G6NA 2PLYA 4WI1A 2ZINA 2UXNA 3HTZA 2RQPA 2RC4A 4CH5A 1BBWA 2JSCA 3DPTA 1TLHB 1XMKA 2C8MA 3W6KB 4I7HA 2VT3A 3I58A 1SD6A 3JSPA 2JTVA 5GAN7 2ODRD 4ZIBA 1B9NA 4MTDA 2XAQA 3G1ZA 1U5TC 5FGMA 2IT0A 1QQIA 3BW1A 4QWQA 3JAMK 2DFIA 4P71C 4CH6A 3EDPA 4TVAA 3RYPA 1Y96B 3TGNA 4M72A 1W7PB 3QPHA 3TEHA 4HA8A 3CDHA 2ZT5A 4HYEA 2DU9A 4G7HF 4BAYA 2DK8A 3ZQ7A 2XAFA 3I0TA 2PFBA 3F8FA 1PYSB 2DAOA 1NJ8A 2PMHA 4HX7A 3WU0A 4PJOC 1BM9A 1EH6A 1E22A 2D2WA 1BIBA 2NNYA 1RZ4A 2E1HA 2DPUA 2Q0OA 3BJUA 1ULYA 2QHUA 3JCMg 2K7LA 3P7NA 3I5UA 4G6QA 1IAWA 4KDPA 2DQLA 2E7WA 4TVYA 5K1PA 2HYGD 3G73A 2Q2EA 4YRQA 3DPLC 1IUYA 2Q5HA 5H6QA 5ICGA 5D5VB 2JT1A 1SETA 5GAN2 3IL2A 2WV0A 3REXA 4M77C 4BWAA 1LOJA 3TKYA 5DUIA 1XMAA 3GF2A 5ICEA 5GANd 2EB7A 3GO5A 2ZIOA 3IKLA 5GANg 1BC8C 2H94A 4I98B 3ZN0A 3SHFA 4M73A 3DF8A 2O8XA 4LLLA 5I21A 1JHFA 2WC2A 2X0LA 3M1EA 4JBAA 2DBBA 2Y75A 3R4KA 3QO3A 3W3SA 4Q48A 1FT9A 4A6EA 1MKMA 5BOXA 4E51A 3A31A 4PJOF 2V6CA 5GAN6 1QBJA 3DSQA 4YRLA 3P9KA 1LJOA 2KIFA 4C92E 4EMKA 1XCVA 2DVEA 1USSA 3VODA 4YRJA 4H0EA 1NJ2A 1UHMA 2RDPA 1R22A 4G6DA 3A7AA 2ZNIA 1EVKA 2VXZA 2EFPA 5FFXA 2ARTA 3A7UA 1HXDA 3ABTA 2DO7A 2GWRA 3BWGA 3B73A 1HQCA 2Z3YA 1FYKA 4HAMA 1BC7C 3CTAA 3MAJA 1TQMA 1NNHA 1KQ0A 3SXYA 4WCGA 2OZUA 3WTTC 3HSFA 4M7AE 4H2YA 1YW8A 2B0LA 5DCMB 5GAMf 4M9ZA 3RTRA 4WK8F 3HHGA 4J6WA 1BJAA 5LHIA 4M7AA 1WPYA 4JUVA 1J59A 3K1PA 3ZMTA 5K1YA 1D8KA 1YCYA 4M7DB 4ZYDA 1YG2A 5L3DA 4WX9A 3LSQA 2D1HA 4UVBA 1J5YA 4L0YB 1ZGJA 3LA2A 4KR3A 1R23A 2ESHA 4HV6A 1CF7B 3M4PA 2VBXA 1ZHFA 3L2CA 2DTOA 4OLFA 4WXDA 4EM2A 3IG2A 3LFKA 3MEXA 3GLXA 4HF0A 1T38A 2KRFA 4C92A 5GMKj 4EM1A 1T98A 4C92B 1E1TA 1FOKA 1QE0A 4BH9A 3MZHA 1ZRCA 2R7FA 5D4SA 1SMTA 5DEQA 4H2XB 2UXXA 2ALYB 1NJ5A 3UGQA 4OP0A 4C8QG 5J6XA 3JTHA 3CUQA 2YLBA 4XSXF 1GHCA 4UPAA 2YX7A 3SFZA 1REPC 4YRTA 3T8TA 2HKXA 3TUPA 2ZNJA 3B02A 4M7DA 1SD5A 3WTZA 2FSWA 3TOAA 2HGCA 1RNLA 1SERA 4M7AB 4HBLA 4KIBA 3O6BB 3E3VA 2E7XA 3HOTA 1TNSA 2MA3A 4ZYHA 2UZKA 1U5TB 2RM4A 5DCMA 1C0WA 2EJ9A 4YIFA 4YFXF 3KETA 3OD1A 4HF2A 1WQ2A 2OBPA 2W85A 4G84A 3LA7A 2AKWA 3F72A 2QENA 1JHHA 3VU3C 1EIYB 3IRQA 4GYGA 1WNLA 4P9FA 3GW2A 4UV8A 2NS0A 2DJZA 4M71A 4J5YA 1F1ZA 2HYFA 3IHUA 1D3BB 4RB0A 3HRIA 4EX5A 5CJ9A 2BE5F 2DTRA 1RUNA 3HFOA 1ZG5A 2L4MA 2DTIA 5K5OA 3BDUA 4RB3C 4M7DC 2Y0MA 3LAJA 1YIOA 1I1GA 2ZBKA 4EJOA 5A2QZ 3MEYA 1MJ9A 1IRGA 1HKTA 3GFLA 5LGUA 1FZPB 4IHTA 2Z9OA 2E1CA 1J7KA 1GXQA 2YPRA 3UFGA 3E6BA 2M30A 4PGGA 1OYYA 1X3UA 4CYDA 2A69F 4XEOA 1Z1DA 2JZYA 4A5MA 5LGTA 3GXOA 1D8JA 1B76A 4BHPA 4XLNF 2IRFG 1KU9A 4IVNA 1IN5A 5AIPA 1JRIA 4P73A 4C92C 3R61A 4MNUA 3LWFA 3WGIA 3J80K 1YYVA 3MF1A 4G8XA 5ILSA 3GUDA 4BQAA 4M75D 3TEHB 2ZFWA 3V4GA 3TO9A 2OA4A 2DKGA 1H4QA 1J0RA 3F6VA 2MH9A 5D4RA 2GAUA 3KZZA 2M5WA 4M7AG 5L3FA 1S7OA 4L87A 5LJ3j 3A7RA 3Q5FA 1PDNC 3WQZA 1V4RA 1CF7A 4M77B 4LJZF 2OQGA 2ZCEA 4M7AC 2ACJA 1BOAA 4XTZA 5GMKh 4YRMA 5JR3A 4KN7X 1SFXA 5LEKA 1I27A 4ZYGA 1SESA 4Y13A 4F7ZA 2KIMA 1YFTA 4U0VA 4O6JA 4U0YA 3KP2A 3PQJA 2RV8A 1TW2A 4YRGA 1ZLJA 1L0OC 3L00A 3F8CA 3O3KA 4LB6B 4JQFA 3RUXA 1T6SA 1Z05A 4YRIA 3V7CA 4M75B 3SB2A 3RL6A 5FLXZ 1E2XA 4HWRA 1DP7P 3R6SA 3GEZA 3T0YA 1YFSA 1FLIA 2VC8A 3U1DA 2WTEA 11ASA 3RERA 4ENJA 3M8EA 2L01A 5F64A 3HXXA 2EA4A 3IWFA 3H92A 2FMLA 4M7DG 1KMMA 3DXJF 1ZLKA 4M78G 1H4SA 4NCXA 3A74A 4I02A 4LK1F 3E6DA 5LRSA 2V1UA 2MC3A 2L02A 4A2UA 1IXCA 4YFKF 3R07A 4WWCA 1IXSB 4L5IA 1UB9A 1KYZA 4ON0A 1SD4A 2CQKA 3FM5A 1C0AA 1G3SA 4FT8A 4ESBA 4WJ3M 1H9TA 1NYRA 5ICFA 4G94A 1WKMA 3TO7A 3RACA 2P4WA 4AIKA 5LEJA 1EH8A 2EV5A 5GAN3 3HXUA 3SWNA 2W84A 12ASA 1RUOA 4M77G 2AMCA 3P8TA 4NL3A 2BV6A 2E10A 4F7UB 3CUQB 2YLCA 1B7YA 2RHSB 5A2QK 3UGTA 4PJOA 3JB9D 3JB9F 3PZCA 1FX7A 4S04A 3BZ6A 4YP0A 1RIOH 2IY5A 1X2GA 3I4PA 2LDUA 4QLCU 4MQVA 3S2WA 3QO8A 2EAYA 1W66A 3U9GA 1TBXA 5GAN5 3A5ZA 1K78B 1VQZA 1OPCA 3P8VA 2IPQX 3K1NA 4FX4A 2M87A 1XDSA 2L3DA 4M75G 4EGYA 4RGSA 3HRMA 4M78E 4MEXF 5LJ5j 2E5AA 4JK1X 3FIFA 2H6BA 1MJAA 3VOEA 4Z2YA 3N97A 2GZWA 4R8HA 2VE8A 1LJ9A 1QZZA 3LQQA 2ESNA 1WWXA 3MWMA 3WE2A 2VODA 3HRUA 1TH7A 2P5LC 1LQ1A 3D5LA 4HQEA 4M78B 3VQXA 3JCMJ 2HQNA 3ML6A 4C8QB 1E17A 4YRRA 3KEOA 2YX4A 2AXLA 1L0WA 4DPGA 1B9MA 4G85A 4A5NA 3JB9H 3J7AO 4YIIA 1D5VA 4R79A 4P9UA 5E1XA 4C92D 3REOA 4MMKA 3HRSA 3RGLA 2YSRA 2J3LA 1KU2A 1BI0A 4XTVA 5AIQA 1HW1A 5HLGA 2HTSA 4UVAA 3QO5A 3QHSA 4JRKA 1O7LA 2FB7A 2EJRA 4CS4A 1FPQA 1KYWA 4UVCA 4DQ2A 4IRIA 5TRDA 1Z7NA 5HS9A 4TQFA 3ERRA 3KP4A 2BYVE 3VFZA 4EMSA 4EGZA 3QRFF 5D8KB 4F7UF 4IXAA 4HOBA 2L54A 3BOQA 1ASYA 5D6FA 2OD5A 1AOYA 2FBHA 4ENNA 3ZMZA 1LB2A 4M7AD 2K27A 1KOGA 3TQNA 3ZPLA 4N0AA 1J9IA 1DPRA 2A3SA 1FWZA 5D8LB 5BPDA 3BFMA 3AHUA 4YRNA 5D5WB 5LJ5e 2I2LA 1B70A 3PCOA 2PMEA 1FBQA 2VN2A 3L9FA 4XLPF 4OMYA 3KEQA 4C8QF 2F5CA 3NEMA 2PG4A 1T39A 1ON1A 4J6YA 4PNOA 3DQVC 2QQAA 3TDZC 3REUA 2PJPA 3GWZA 1KQ8A 1QO0D 3LSTA 4P3OA 5DYMA 5E17F 5LJ5f 1IN8A 2QQ9A 2OAZA 3V8LA 4M77D 1SD7A 4CICA 4XBFA 4HW0A 1WU7A 1IW7F 1B59A 5HVQC 1X01A 3QO7A 5L3CA 3FHZA 3HSEA 2QBYB 1BI2A 3BY6A 3IALA 3ROUA 3HRKA 1BI1A 2FF4A 4F7UE 5AONA 1NHAA 1FBUA 5LJ3d 3VQYA 3WTXC 1ONVA 2GA2A 2XASA 3F21A 3I7FA 4EV0A 4AWXB 1PYSA 2F5DA 4C8QC 2VC0A 2O0YA 3KP7A 4MTEA 1S6LA 4P75A 4ASNA 3J81Z 4YDQA 1BN5A 4M75F 2I4LA 3JCMe 4N0BA 2HS5A 4XU0A 1H4TA 2IVMA 1VTNC 5GMKl 3HSBA 2ZT8A 1IRFA 1CGPA 2Y48A 2ZT7A 4L5JA 2IY5B 3HFVA 1JBMA 1R1UA 1XCBA 4I2OA 2DK5A 4TTVA 4I0AA 1GVJA 1FYFA 3GZ6A 3BJOA 5DD8A 1Q1HA 1R5HA 1EH7A 1P92A 1K78A 3ZMUA 1JE8A 1YO5C 4F7UA 2L4AA 3C18A 3M8FA 5CVIA 5CVRA 4ZZLA 1X55A 1W7PD 3NENA 4GXOA 4CS2A 3F3XA 1R1VA 3H3UA 4IF4A 4LG0B 1WYDA 2DQ3A 4PJOB 1XGOA 1TQPA 2FBIA 4OU0A 1HSJA 3L1AA 3KLOA 5JFRA 2MLGA 4P72C 4XEMA 5CYVA 1LYLA 4EMHA 1B70B 3PCOB 5LJ3f 4YRSA 3ERED 3E5UA 1YS7A 3IRRA 3C3WA 1XGSA 2HKOA 5ED4A 5FLXK 4AH6A 1T2KA 1YFRA 3CUQC 4X9DA 4LG0A 2ZCWA 5HS7A 4LFUA 3LAPA 1OKRA 2NAZA 2YHTA 2XHKA 3E5XA 3TO6A 5LJ5d 1XB4A 4MQ9F 1QGPA 4BW9A 4H2TA 1QF6A 2RHQA 1QZYA 2XKOA 5DV5A 4N9IA 4EVIA 1I5ZA 2CW0F 5JVTA 4KIGA 4HWPA 2C7IA 2PN6A 2G9WA 2V1DA 4B09A 3GFIA 4KMFA 3JTGA 2CJ9A 2I4NA 1P2FA 3UH0A 4M74A 2FOKA 3KE2A 3T8RA 1KA8A 3L4GA 4UHTA 2PQ8A 1SAXA 4IJAA 1KQ9A 1E24A 3FF5A 2VT2A 2VC1A 5K1XA 2J5OA 4A0XA 2HTJA 3RI4A 1KMNA 4RDXA 4XQ3A 3OV8A 5IT3A 1DPUA 4M75A 2K86A 2M8EA 2XAGA 4M6XA 3F8BA 3RKXA 4HF1A 2W25A 2EFOA 1BBYA 4EJUA 1KQ2A 3QAHA 1O7FA 5ERIA 1BI3A 3WODF 2O03A 4PJOG 4CS3A 2GXBA 1P6RA 4RQEA 1MZBA 3C7JA 4PDKA 2EV6A 1HC7A 4P74A 2E1NA 1ZG3A 4IPAA 3SWNC 2Z5UA 3RDIA 4HZFA 2Q7GA 3WTSC 4EMGA 2GIVA 3FXQA 1N9RA 1R58A 2G7HA 1GGMA 4KA4A 3HRTA 3COAC 4H2UA 5BS6A 3VB2A 4QVCA 5GAN4 2ADUA 3I59B 3GFMA 2QM3A 2QBYA 1B34A 2ZR2A 4C8QD 1MGTA 4M75E 1XDUA 5GAMg 2EFWA 2XGTA 5LHGA 2ZNZA 1XSDA 4UP8A 2QQBA 4JRIA 4O5VA 2HZTA 2IP2A 4PG3A 4I01A 4XRFA 1G5IA 3RKYA 1ASZA 3VQWA 4HVCA 2A61A 2F2EA 5LJ3g 2RHQB 3QPTA 2MLKA 3K9TA 2DDZA 1HKQA 4A12A 1Y0UA 2NRAC 5IT9Z 1Z7MA 1FC3A 1XSXA 2IA1A 4TV7A 4P73C 5C53B 4P74C 2EV0A 5E3IA 1ZARA 1SMYF 3PQKA 4D0PA 2C6YA 2LSOA 1YS6A 4YPFA 3EYYA 3U2RA 2VONA 4LNSA 2P5VA 4L9NA 4ZTZB 3SZTA 2IA0A 5CVUA 3WTYC 5LJ5h 3Q9SA 4LGWA 3I59A 1I81A 2P6SA 5HGQA 1EIYA 4MGRA 2VOPA 4YG2F 4GYIA 4JLIA 2FE3A 2Y90A 2AKWB 4YRFA 2XAHA 1ADJA 1HBXG 2LNBA 3LQRA 5GAN8 1G5HA 2DQ0A 1U5TA 1WI9A 5GAOr 3E6MA 2PEXA 2FNPA 1W5SA 1LNXA 2RGVA 5LLQA 1S29A 3E97A 1NJ1A 2XTIA 2CJAA 2QLZA 4KQEA 4ZH4F 4C8QA 4KR2A 1WSUA 1F9NA 3NETA 2BGCA 4RGUA 3N4MA 2DT5A 2ZMEA 2ARSA 4ZTUB 1XN7A 3RPUA 4ESJA 4KN4X 2XROA 5E20A 3WTWC 3FM3A 4C92G 5DCFA 4H2SA 3K2ZA 5CVVA 2JPBA 1XGMA 3SWNB 2E3CA 1N9WA 4P3PA 2KKOA 1WRJA 5HDNA 2GXGA 3ELKA 3J80Z 3RPQA 5CAIA 5KK1A 1LEAA 2CYYA 4L18B 3HFZB 3QTCA 2HOEA 4K87A 2VXEA 1HKSA 1XSVA 2DXTA 2ODRC 1B1BA 2O6GE 3HXWA 1OYWA 4BYYA 2I4OA 2Q5IA 4M9XA 4HWSA 1OR7A 3QU3A 4EJTA 2RNJA 1LDDA 3R0JA 4MHGA 4LD5A 5LJ3h 3KFWX 2J3MA 4RB2C 3RESA 3HOSA 4CH4A 4RGRA 1IN4A 2AMCB 3MQ0A 5FD6A 4I0BA 1I8FA 3GFJA 3WGHA 4U7DA 5BMZA 1YGBA 2P7VB 3FJPA 1S8NA 4WJ4A 2WWYA 4I09A 5D5XB 3NELA 3V7RA 4YRPA 3KLNA 5LRRA 1OYIA 2LF7A 1YTYA 2PMUA 4PJOD 3JCMV 4RGXA 2IJLA 2M45A 4L9VA 3M9AA 1FSEA 2EJFA 1NJ6A 4QVDA 5DD4A 3CLOA 3L09A 2Z33A 4M78F 2J5PA 1F5TA 2R7DA 4RB1A 1O3TA 5GAMh 4P96A 3FWEA 2AS5F 1LVAA 4RAYA 1J75A 1Z6RA 3JB9G 4CGZA 4M75C 1J5WA 3HUGA 4RS8A 2XV4S 3CJNA 2VBZA 5GAOl 1HW2A 2EFQA 2JRTA 3JAMZ 1B6AA 4UP7A 4C8QE 3HY1A 3BPVA 5D6EA 2E41A 3QSUA 1NYQA 2NNNA 1ZREA 3TEGA 3KP3A 1UHWA 1W5TA 1JGSA 2Q8KA 4HX8A 4IRGA 1FSHA 5GAOm 1YB3A 3L7WA 4KT5C 1ZN2A 4LB5A 3F8NA 3SQNA 3ZN1A 4O2DA 4YCUA 2QZ8A 5HOOA 3PFIA 5TJJA 1ZAOA 3LC0A 2VBYA 2ISZA 2EK5A 2XIGA 2A5YB 2STWA 3ZMSA 1IN6A 1U1TA 3GIBA 2F5EA 1FY7A 2ZZEA 2QHSA 2H27A 1ZG1A 5ELNA 3IC7A 3ECHA 2HQRA 1H0MA 4ENKA 2P8TA 5BPIA 4U7BA 2F5FA 3EUHA 2CIMA 4CZZA 2DU5A 3QU6A 1RI7A 5GANj 1EFWA 1W7PA 2CWEA 2H09A 4PGHA 4TWAA 1Y96A 1SRYA 2ZMEB 1P4XA 2DTHA 2CSOA 3WU1B 1PUEE 3DV8A 3L4GB 4UNOA 3JCMd 1O3QA 4ENMA 2X4HA 1WQ7A 3BPXA 1Z7UA 1G4DA 5F1RA 3AAFA 4Q6GA 1U8RA 2EL9A 3FXRA
chains in the Genus database with same CATH superfamily
3JRAA 3UKGA 4J15A 1N9SA 4XQFA 2W57A 3H0DA 4A3JJ 3BLYA 2D1XA 2QXFA 1JT6A 2P5KA 1O57A 2CQNA 2EQUA 1KG1A 2RH2A 1ACIA 2CJBA 3CJQB 1WJEA 5ILUA 4L0ZB 2XK0A 2LNHB 4R1HA 5E18F 1NK2P 3EQLF 4LMYA 5K7HA 1VQPI 1O4XA 2DW4A 3IWZA 1MNDA 2ZGWA 5CKEA 3QYHB 3HYIA 4K2EA 3KYCB 5GAMd 2OTJI 3VKIA 5C51B 1R1TA 2LY9A 2EPFA 2QGGA 2K02A 1H641 1XD7A 5EJCA 3AG3H 1PUFB 1R00A 5K5RA 3VS0A 3OL3A 2NOJB 1HLVA 4A93J 1TU0B 2GBQA 3X20B 2ZZGA 5FU6C 4A3BJ 5L3BA 5D5UB 3C12A 4B9XA 4V2SA 1D3BA 3LOCA 5GMKi 5CKHA 5LBQA 3OBWA 5GAHJ 2QWWA 3G2BA 1VQ7I 5F0FA 4E7SA 4ZZDA 2JPCA 3ER0A 1KC8U 3BJAA 2BXZA 2V26A 3M8JA 4PSWA 3RQIA 1ODDA 3LA3A 2IGNA 5FFZA 5E8IA 3GYHX 5I22A 4KNYA 4R55A 3VBBA 2G7UA 3JCMf 2GQIA 3C0CA 1YIJT 2JVVA 4P1WA 1N8RU 4XU2A 4M6YA 1LEBA 1IRXA 3OYBA 2ISYA 3IAM2 4AU7A 3MZYA 1NG2A 1WHGA 2VUBA 2VI6A 3BY7A 4HKEA 3FK6A 4L9TA 5JVGF 2E2JJ 5L3EA 5HLHA 5GANe 5F6FA 5IT9K 2ELJA 2VJ4A 4YRCA 1YRNB 4YCVA 5JHUA 3CCVT 2FYKA 2XRLA 1MDMB 3HFNA 1SFKA 3BG9A 5C3EJ 4IKFA 4EJWA 3BDDA 2Q7HA 2DLLA 2DOFA 4YROA 1UGPB 2F5KA 2IEKA 5EGOB 3GTQJ 3ZMDA 4HDUA 3J7AF 3OS1A 1VQ4I 2CS3A 2M8GX 2CFXA 2IS4A 1ZUYA 3CCMA 1M90U 4FISA 3CD6T 2HOTA 3JCMX 5KNNA 1JU5C 3P8YA 4RLQA 2RHUA 2ZCFB 4C0ZA 4LLNA 2WSCE 4HDVA 1H4VB 3OYNA 2MD5A 4E7LA 1G59A 4PJOD 3FBNB 1T0FA 2QDYB 3NWSA 2GA1A 2H3EB 3ULRB 2JUFA 3CCLI 2HDAA 4X9CA 3SEMA 1A6IA 2BVMA 5FJ8J 3ZXSA 4S05A 1IO6A 3S1NJ 1YJWI 3QP5A 3HGYA 3HHHA 2BEOA 3OYAA 2MH2A 3E6CC 4PCQA 1HK9A 2KNBB 4CS2A 1S72Q 4LD6A 4P3NA 2YU3A 4DYRA 5DM7F 5E3LA 4AFUC 3T1BA 2RVCA 1TNTA 2E3IA 2HDCA 3CCLT 4P71A 5IHNA 1WH5A 4K88A 4BQNA 3WTUC 1M4ZA 2VGMA 4ZYEA 1SANA 4C3JJ 5M5XJ 2PVGB 4OMOA 3HXYA 4HX4A 2BZXA 3DBRB 1RESA 4Y91A 2CREA 3CDIA 1TW3A 2YSQA 4XLEA 4J83A 1ADYA 4J5YA 2VWFA 4ETSA 1ON2A 3HOWJ 2NXNB 1VYTA 1J2XA 3HTSB 1OPKA 2L5QA 2K4JA 4JPBW 3Q0VA 4P75C 1JXSA 3KFUA 3CCYA 4PJJA 2O5RA 3J80E 1BBUA 2FPFA 5CCAA 3K0LA 3CO7C 1SHGA 1YW7A 2DMPA 5DDGA 4D7MA 2R0QC 4IOCF 3CC2I 3ZEHA 3S3OA 3A5YA 1Y1VJ 4HT9A 2XUBA 2ZIMA 2ZKZA 2KROA 4EO4A 3N05A 2GBYA 2V7FA 2DEQA 2IPOB 1SVLA 3I9QA 1VQLA 2LC2A 2RQQA 1MGQA 1VQ4T 5EEHA 4LK0F 4RM2A 2EKOA 4BBSJ 3HXZA 4C5IA 2DMNA 5HDGA 1FYMA 1HTTA 2QVOA 4AIJA 1HF0A 1I4K1 3CC2A 1BB9A 1X2MA 1BIAA 4HRIA 2E2HJ 2AKKA 2RHSA 2CV0A 1VQNQ 1W36D 1USYA 2Y4YA 1G5VA 5BQTA 5AT1B 2Q5HA 3MKZA 4HWOA 1UEBA 3SZGA 3EUAA 2DI3A 4ZNXA 3KUFA 1TTYA 1WPKA 3NRVA 1QPMA 5EEGA 1K79A 1RAEB 3KCCA 3WGGA 1T3LA 2HQXA 2K3XA 4IUQA 4G85A 3CCQT 3H9GA 1YHQA 1A36A 4JLGA 2K4BA 2ZTGA 1IL2A 3ABUA 1W4SA 3BROA 1STZA 3LSSA 4IRHA 2EPDA 2RQTA 1MNEA 3AG1H 2MWPA 4BI8B 3QNEA 2CO5A 1U3EM 3KP6A 1MBEA 1VIFA 3QUIA 5CQYA 2VUMJ 2W10A 2D45A 1S3JA 2E35A 4OVAA 1W6XA 2OTJQ 3J81K 2JWTA 4N4OB 2HMAA 1T08B 1R77A 4XLAA 3OWTA 4BDZA 3P8BB 2QHTA 1X3ZB 2BXYA 2V1XA 2XVCA 3WVDB 2YUNA 3R60A 1QNTA 1HOMA 4BXUA 1M2VA 2NYXA 1U06A 2PVOB 3FXUA 4D1QA 4FYWB 4Y92A 2QEXA 1IZ1A 3M7GA 3S2DJ 3REBB 5J8FA 2ZMEC 1QW1A 3QKJA 4HQMA 4PZJA 1ZRDA 2MGQA 4LN2A 3K4MA 2MW8A 2HFHA 1LDKB 3ICAA 3P8DA 5M5YJ 4M3EA 4Y17A 1DGWY 4MFEA 1NLPC 1K4TA 4XTWA 3RYRA 2XAJA 1UCRA 2IA2A 2L7KA 1ZBXA 2RK1A 5E8GA 1OQYA 4Q47A 5H6RA 2MFZA 3BJ6A 1J3TA 1UZCA 3KYLA 4YIRX 1ETQA 1HW5A 2V9VA 3RCOA 3MFKA 1TWCJ 1I39A 1V5EA 3DKWA 1Y71A 2K4YA 3R0AA 5HK3A 2FVUA 5GAMj 1G3YA 3ERMA 3QDRB 2DO3A 2W0ZA 4LDWA 1PVEA 5H20A 5CIUA 3UR3C 1HA8A 4HT4A 3AL0C 2J7IA 1X1BA 2VKNA 1KU7A 2RQRA 3TQ7P 1JJCA 5GAOn 1USYC 4XU3A 1M1KU 2EWNA 3JW4A 1AKHB 1VQKI 4UP9A 5IHKA 2E1MC 1LFPA 2V1NA 1LVKA 4W97A 2XC7A 2ATCB 2P4TA 2Y9YA 2FRHA 1RLQC 1W2BS 3CCSA 1EQRA 3GZNB 4YFNF 1QP2A 1M8VA 4UPAA 4OMNA 1K9AA 1RACB 4JOMA 3OD1A 1K6OA 3DFGA 1M90C 3E9HA 1OMIA 3TDUC 2LG4A 4M7AF 5IOYA 4XTXA 3SZPA 3DB4A 3A8LB 4KUMA 3ZOBA 1VFCA 4CC3A 2HSEB 2HDDA 4E70A 4HV5A 2A6HF 2WADA 2LCCA 4YRKA 1E6HA 2JN0A 4UUSB 5L8RE 2HCKA 2HWVA 2EBPA 2QEXQ 4MMLA 3CP8A 2FMYA 4BI4A 2ZT6A 4RQFA 1XC5A 4EJVA 2O31A 4WTOB 4M78D 1FOXA 1L3LA 4KICA 4UXNA 1M1KC 1APLC 1DQUA 3K2AA 2EKHA 5LL6S 2KIUA 4KIFA 1QCOA 4Y15A 3VS4A 4NC7A 3IUOA 4CCLA 2RJDA 3CMAI 3RIRA 1TXQA 4RG8A 1U78A 1YJNI 3X28B 2DU7A 1MIJA 2VGNA 4L5EA 1IGNA 2DL3A 3EGUA 2LP0A 1M2VB 1V3FA 2ZXWH 2CGHA 3H0HA 2FX0A 2JA5J 3I4NJ 2CV2A 2P7CB 4N0AC 3G3ZA 3HTUA 4OIOF 5GANh 5KYNA 2K57A 5KAFC 3CC4T 3CCJA 2UWMA 2KRHA 2YUSA 3FDYA 2DYIA 5LJ5f 4C92F 4OIQF 1N75A 3OOUA 3S1MJ 4NL2A 4GDFA 1VQ5Q 4A3MJ 2L3QA 2PJRB 2STTA 3CCRT 2TDXA 1YITI 1TG0A 2Q2EB 4RCCA 3W6VA 3JCMb 2ZR3A 2A68F 2XSDC 4D8DA 2QTXA 3I56T 2OTJT 3I64A 2HOAA 2QA4Q 3H36A 3W6JB 2R92J 8AT1B 2B7EA 2E36A 3RJPA 1ZR4A 3THKA 3ZBDA 1SG5A 2CKKA 2FNAA 5F5WA 2O8KA 2LQNA 3OOPA 3EFRA 2ALYA 4H2XA 2E64A 1EVLA 4HNVA 2BVLA 3E9IA 1R7JA 2WY8Q 1UFFA 2YR2A 4M78A 2LCSA 5E1WA 2P6TA 2OU2A 2JNGA 1BW6A 3OSGA 1EV7A 1W4MA 2PBIA 3QYGB 2M4KA 1M9SA 2C0OA 4OB2B 2LBFA 4HLXA 3JCMQ 2OQRA 5GJWB 1I5LA 1B8AA 2XPVA 5ILVA 1NEGA 2NUPA 4FL6A 1X56A 3I71A 1I5OB 4NOYA 3P9CA 2EYQA 2M0YA 4GLKA 1LPLA 2XD0A 5GTHC 2ZO4A 2V4JC 1FYLA 2PI0A 2LF8A 2DA5A 3LX7A 1YW9A 1VQOT 4CH3A 3MCZA 1TL8A 1SFEA 2DJQA 1G51A 3A8OB 3NHNA 4M7DF 3RF1A 2QQ8A 4GO1A 4RCBA 4KFCA 4FX0A 2NVTJ 4WXCA 3I53A 2KJBA 4AMCA 4IHWA 1ABOA 3H3ZA 2DA9A 2XGEA 3JCMc 2M1BA 1A04A 2O3FA 3CUOA 3FXJA 4M9SA 4BEHA 3I4MJ 1G2BA 3SD4A 2DA1A 4NC6A 3JAME 3F0CA 2Q7EA 3M1CA 2R5ZA 2VBWA 2DZ9A 1EX4A 4C9YA 4O3MA 5FRNA 3CC4I 3MF2A 1Y8RB 4BHCA 1OU8A 2DQRA 4M77A 4II3A 1X2HA 1TQIA 2GOMA 4IHSA 4Y7NJ 3CPWP 1QPIA 5KVRA 5CK9A 5K5QA 3L42A 1ZR2A 3HIFA 2R5AA 4E47A 5KE2A 3KXTA 2BY2A 4TVAB 5F1JA 4FE7A 2DDAA 2VOOA 2J6OA 2UUZA 4KYWA 3KP5A 2M51A 3FHNA 5GAMe 1K73U 1G3WA 2MI6A 2VE9A 1PWTA 3TOBA 3ZMVA 1VUBA 4M4ZA 1WLEA 1KC8R 1P4AA 3V42A 4KGZB 4A6DA 3HXVA 3IKVA 3FB9A 1IXRC 3O2PE 2LJ1A 3GTKJ 1SKUB 2X85A 3JV3A 1R36A 4CDGA 1VQ5T 4WXHA 4JZ4A 2LH9A 3NMZC 1U1SA 4M6VA 4DBHA 2CV1A 5FRMA 4ZN3A 1Z6TA 1KD1R 4UV9A 1P4WA 2OX7A 4QPOA 1H8AC 1VQKA 3ABMH 4PSXA 2NYSA 3MJXA 1LKXA 4RUGA 3D0SA 3CLQA 5LJ3e 1ARKA 3GX4X 1RIQA 3LSGA 1IF1A 2F2XA 4M77F 5EC7A 1M1EB 1VQOQ 3IKMB 2XRNA 4ANJA 5K7ZA 1QVUA 1GRIA 2DL5A 5IP7J 3N5BB 3WVEB 2EJGA 4YYEA 1K7AA 2HQAA 4HT8A 1RI0A 3REAB 4EMKC 1YHQT 4HWTA 5FB2A 2JT4A 1EFWA 4C3IJ 1YRNA 5GTIC 2X4XA 4AD9A 3LYIA 3TCJA 4C30A 4Q15A 1FP2A 2DRKA 1FBSA 1KHCA 5ELOA 3DLLF 3BG5A 2HYJA 3A1YA 3C95A 2FEZA 2MG4A 3VEPA 1O3RA 1V5FA 4P55A 2A5WA 3FXOA 1BA5A 1FYNA 4LOCA 4HCKA 2DETA 3WTVC 4CYCA 4FE4A 3P9IA 4UUVA 3WE3A 5F0HA 3PT9A 3LSHA 1Z9CA 1IN7A 3NEUA 1IRZA 3ZFJA 4LVLA 3T9NA 2XI9A 4KMUX 3TSWA 1XPXA 2COMA 1WJ5A 2V79A 3OB9A 1Z77A 3CPWS 4OIPF 1EKEA 2CG4A 1S7AA 2OCEA 3HY0A 2W4SA 1WIEA 1ZH5A 2HQEA 5DY9A 4M3BA 4OOIA 5E1ZB 2EGAA 3K10A 4EEFG 1MBGA 2DPDA 3CBPA 1JEGA 3JCMh 3M4GA 4IL6C 2A37A 2CGPA 1KZHA 4IHYA 1USTA 2D1VA 3F6OA 1WXTA 4B9WA 1KGSA 1KQ1A 3S6WA 3GZ5A 3MKWB 1M30A 2BBYA 1Q7YR 4H2WA 5E3MA 2KMUA 3GLLA 5B1BH 2FG0A 2M3AA 4FQGA 2JA2A 3SFIA 3P8HA 4J6XA 4A0ZA 4JJDA 4LE9A 1FNNA 5J1UA 2HR3A 2HOSA 1JXOA 2L3PA 4A53A 4XTUA 1B72B 4JDSA 2E3HA 4ESRA 2M7AA 2E5KA 4A0YA 1X54A 4PUSA 4K86A 3V8JA 2ZJ2A 3MP6A 3QPSA 4CCJA 3PO2J 1MSEC 2P0LA 1PP7U 4CXFA 2NS6A 1U0JA 2L7FP 2XPWA 5JI6A 1ZRFA 2NUTB 4PHCA 3BG3A 3OSVA 3EUKL 3OIPA 2B9SA 1IUFA 2DILA 4XLHA 2Z99A 2L89A 3X26B 1YOVB 4CYCB 3HPHA 1ATIA 3M59A 4II2A 1MD0A 4AVPA 1B4AA 1PP8F 3ABLH 3RKWA 2NS7A 4M7DA 4B3AA 1T0HA 4A4FA 4P5OA 3HSRA 2QSHX 3QP6A 4G9YA 1MJBA 4U0WA 4FSXA 4FHTA 1I6XA 3CDLA 2VQLA 1ZUKA 4BXFA 3I56A 1EOVA 4CO8A 1QCNA 4AFZC 1Y1WJ 4OMZA 4CHUA 4AM3A 3HKSA 2BZYA 1QU3A 3F9KA 5FD5A 3TW6A 4AIHA 4G7ZF 1JB0E 1M3AA 4D5CA 2EFIA 3M54A 4XTYA 1G8XA 3KZYA 6PAXA 2XMFA 1DDNA 5HLIA 1B34B 3QOPA 3VYTB 1JJCB 2ZXIA 5FO5A 2ELHA 3ZGKA 1WJBA 5E79C 1G83A 2ARUA 4UB6C 2ZFUA 2EGEA 3PGGA 1ZSGA 3DEUA 4GCVA 3S17J 2IG0A 3QXEB 4L5GA 2BY0A 4Q5SF 3GTMJ 2CIMA 1ZYRF 1AU7A 4N4NB 3EYIA 3T5XA 1RKTA 4PJOE 3VDXA 2P5IA 4MIMA 2JJ7A 4FU6A 4BUPA 3BG6A 2BUDA 1LDJA 1ZGAA 3LSMA 3M4OJ 1N6AA 2EQMA 4A54A 5FKKA 3CMEA 4C2MJ 4EQQA 3CCST 3L1PA 2NUZA 3S3NA 4WF2A 4J01A 3I54A 2DXUA 4XKWA 3JRGA 1HCRA 1LNWA 4BDYA 3PTAA 1A31A 4GGGA 1YJNT 4L9JA 1VQLQ 1F4KA 5GADJ 2XGCA 3MPUB 3P5JA 4QKUA 5KYYB 3Q0WA 5GAOp 2FQ3A 2BHZA 2KHMA 5J1YA 3ZRGA 2VXFA 5CLSA 4Q4ZF 4PKCC 4M78C 2KIQA 2G4CA 1HSTA 5J8CA 3A8MB 1VQ9Q 3HFZA 1KU3A 1T33A 2QYOA 3IV5A 4OB0B 3ECOA 4BHBA 4ESFA 3V8KA 4LDYA 2LTOA 1Q82R 5GMKm 2KJCA 2JK3A 4OINF 3ISPA 2E6ZA 2DMTA 2RB6A 4H02A 4H2VA 1H9GA 2M7BA 2R7XA 1F1BB 2XAUA 3K1MA 1GCQA 1I1SA 3WXMB 2QUFA 1X19A 2IW5A 4M77E 1Z91A 3CMQA 3V7SA 2H6CA 4ZGJB 1GFCA 5GAOq 1PG5B 2OZ6A 2NVUB 3KEYA 3FX3A 3QJYA 2A6EF 2CT4A 3IH3A 4EPCA 3EGDB 2GIZA 2HEOA 1WQWA 2R3SA 4AUXA 4DGWB 4EM0B 3TEDA 2VLAA 1XOVA 1HD3A 2H8WA 3NQOA 3RDVA 1YQAA 3EFSA 4RAZA 3FMSA 5FLMJ 2Q1ZB 4V19K 1RUWA 1EA3A 3PNVA 2O9LA 1R5GA 2P84A 5DUKA 4HCZA 4V2GA 3ULQB 3D1NI 1E1OA 1WJAA 3E5QA 3QG1A 2CQXA 3FZVA 2DL8A 4XU1A 5IY5H 1K4SA 2DOAA 2X1EA 3RZDJ 2DLPA 2F69A 2KXCA 4RLFA 2MK5A 1Z9ZA 1B7YB 2DM1A 1VQKQ 3Q9VA 2WAFA 1VQ8Q 3MKDA 3DLLA 2E5ZA 5D6WA 2EA2A 2W24A 2KT0A 3PFYA 3JB9I 4CC2A 3SEQA 1D3YA 4OIRF 5M3MJ 2FPEA 4C0DB 1W70A 5IXFA 1RAAB 1I3QJ 5IHIA 3NTIA 4TVWA 4LLGF 1Q1VA 3FMRA 2ZXFA 2O88A 1FP1D 2FU4A 4RA2A 3GTJJ 5CKTA 3BP8A 4XSZF 4BNCA 1K9MC 1DUXC 3IKTA 5C52B 2J6FA 2WA0A 4LIUA 4HLYA 4B8XA 4FSSA 3I5SA 2WAQA 2PMFA 3K69A 1YN8A 3S16J 1YJNQ 1YFHA 2CW7A 3CCVQ 3H9NA 4EMKB 5F04A 5FW9A 2KZVA 2WV1A 1T0JA 2FA5A 2OTLA 2JJ9A 3FXLA 5CVJA 1U6GA 2FXAA 3LSKA 3G71I 2O61A 3C2GA 1OYXA 2MBFA 3G6EI 2DZCA 4N9HA 2RD1A 4A63B 1UGVA 3JB9J 3A02A 5E3NA 2M9HA 4RTTA 6AT1B 1U2WA 3LFUA 1XGNA 2VJJA 4DZPA 2MOXA 3KFVA 3CO6C 5DTDA 1VF9A 3GMEA 2K2VA 5M3FJ 1VQ5I 4FTHA 2PUOB 3UDCA 3G6EQ 4PJNA 3ZP5A 3FMQA 1UFMA 3NGPA 1GL5A 5LHHA 4YCWA 4HNTA 3JSOA 1SEMA 3LWIA 2QA4T 4XOPA 2DIGA 2VB6A 2GFAA 1YX3A 4DNCA 4NB5A 5DS9A 2BZ8A 4CSWA 3FXKA 3JCMP 5ICCA 4BY6C 4TQDA 1QP3A 3I35A 3S3MA 2FBKA 2QQSA 1Q81R 1KC8C 1YLFA 2VIXA 3FJ5A 4F17A 3VYHB 1AT1B 2ZXJA 2DFFA 3EETA 2LLKA 1V76A 2ZNYA 1WXBA 3L2ZA 4LUEA 1IXDA 4NQWA 1WJSA 2P0PA 5FLXE 2CZ7B 3F23A 3FIFA 1MBJA 5F27A 1W2BA 2E65A 3INZA 3ZQHA 5KAIC 5L3GA 1GV2A 3EHQA 2FUG2 1UGRB 4C2TA 2LKXA 1VQOA 2I4MA 2XKPA 3DP7A 1NPPA 2E60A 3F8MA 1MDMA 1AWCA 3J7AY 1XMXA 2AQEA 1FXXA 2ETHA 2ZZFA 4G7OF 4YREA 2OCCH 2QHVA 2RN7A 2DMUA 1G3TA 3W2WA 1SFUA 2JOYA 3QZ9B 1MMGA 4F16A 4YRTA 1QQJA 4C0FA 3RPUD 5HS8A 5GANf 2RI2A 3C1DA 4MLOA 3JCMW 1TWBA 3OYFA 2RA2A 2LKPA 4MEYF 1UMQA 3BG7A 5EG2A 2XGXA 4M7DD 3VYRB 3M5AA 1UELB 3GVAA 3OYGA 3WHBA 2D5VA 4U88A 1AZGB 1QVPA 2JM9A 3VS3A 3EG1A 4NHJA 2HKQB 2A07F 3LGLA 1GXPA 3EPZA 3M4YA 2DD5A 3VQVA 3G6ET 1M5Q1 1ZK8A 3G1OA 1PYVA 3F22A 2F2WA 1X1AA 2EFNA 2RKHA 2GQQA 2R7TA 5GMKe 5I2SA 1VQPQ 3WG9A 2LY1A 3BT9A 1NJIR 3A32A 5LJ5g 1O3SA 5LGNA 2HNIA 2WSFE 5HDKA 3A98A 1G6NA 2PLYA 4WI1A 2ZINA 2UXNA 3HTZA 2RQPA 3S1RJ 2RC4A 3CCSI 1IC8A 4LVMA 4CH5A 1BBWA 3DKMA 2JSCA 1S72T 1K1ZA 3DPTA 1TLHB 1XMKA 2C8MA 3W6KB 4I7HA 3JSCA 2HNHA 3WHCA 2VT3A 3GTLJ 3I58A 2X9DA 1SD6A 2PMZN 3JRDA 2D8HA 4BBRJ 1ZSZA 4AG1C 3QJ6A 4P73A 3JSPA 3CC2Q 1PRLC 3H5AA 2ZPHB 3K70D 2JTVA 2X51A 5GAN7 2ODRD 3ZQQA 1Q95G 2DX1A 3META 1B9NA 2UV1A 4MTDA 2FL7A 1K9MU 4ZIBA 1Y0MA 2XAQA 4FW1A 4ZTFA 1MBHA 1NH3A 5JLWA 5C6SA 2W1OA 1U5TC 1UJ8A 5FGMA 3D5SC 1QQIA 4XRSG 4QWQA 3JAMK 2IT0A 3BW1A 3H35A 1XTDA 4OMLA 5KYUA 4L59A 1DP3A 1PC0A 2DFIA 3PUBA 2C0IA 4P71C 3JRZA 4CH6A 3EDPA 2L7MP 4TVAA 4XK8E 3RYPA 1Y96B 5IXBA 2A3LA 5D7UA 3TGNA 4M72A 4CC4B 3JR9A 1W7PB 3QPHA 2H1KA 2LP5A 4HA8A 3TEHA 3CDHA 2HD0A 2XHCA 3R6OA 4DBFA 3LH0A 3VJPA 2ZT5A 4HYEA 4GY5A 3M53A 4HWPA 2DU9A 4G7HF 4BAYA 2DK8A 4AT1B 2NS8A 2XAFA 2KFDA 3ZQ7A 1T0FC 4JP0A 1MW7A 3RSNA 2PJRA 5B5EC 1HC8A 2I5UA 4HPQA 3I0TA 4OMMA 2IGMA 2PFBA 3BTLA 3F8FA 3J7ZI 2RMOA 1PYSB 1NM7A 1YJWQ 1Q7YC 2DAOA 1T56A 5J26A 2PMHA 1OULA 1NJ8A 4HX7A 2ZPEB 4JJBA 3WU0A 4PJOC 2QF7A 2E12A 1BM9A 1EH6A 3RKQA 2N8GA 1OOTA 4XM3A 1E22A 2D2WA 1WHUA 1BIBA 2WAEA 1QVGP 3K4NA 2NNYA 1RZ4A 2E1HA 2DPUA 2NUPB 2LY2A 2HPIA 3CCEQ 1RR7A 2Q0OA 2QA4A 2X6WA 4IHXA 2BKDN 1WZ2A 1ULYA 1WI3A 2F4MB 1W0TA 2O4XB 3H9JA 3JCMg 2QHUA 2K7LA 2XG8D 4AYBN 2WY7Q 3P7NA 3I5UA 1TWGJ 3Q0UA 4G6QA 1IAWA 4F7UG 2EIFA 4KDPA 2DQLA 9ATCB 4EATA 2E7WA 4TVYA 4OMQA 1JQQA 1R49A 1QMCA 2WAQN 5K1PA 2HYGD 2D6FA 2QI2A 1VQ8A 2DT7B 2Q2EA 3DPUA 3G73A 3MHXA 3QIIA 2W7NA 3DPLC 4LITA 1IUYA 5H6QA 5ICGA 2G6FX 3PNWC 1FMVA 2JT1A 3S32A 3K7AJ 5D5VB 2Y9ZA 3IL2A 5GAN2 1SETA 2WV0A 3OR2C 3REXA 4C5GA 4OMPA 2M9UA 3OYCA 3OL4A 4CC7A 2DN0A 1K73R 4M77C 1RRJA 4BWAA 2RPNA 3DLMA 3HOYJ 3TKYA 1LOJA 5DUIA 2RJFA 4OB3B 3RMSA 1XMAA 3AG2H 3GF2A 4DZJA 5ICEA 5GANd 2CU7A 2EB7A 3GO5A 2KLOA 5EF6A 2XF5A 2ZIOA 3IKLA 2VV5A 3I56Q 1U8BA 5GANg 1BC8C 2H94A 4I98B 3ZN0A 3SHFA 4M73A 3DF8A 2O8XA 4LLLA 3H0IA 3IQLA 5I21A 2DBMA 2XB0X 3SEZA 3E9GA 1JHFA 1OFCX 2WC2A 1ETXA 4AG2C 2X0LA 3W2AA 3M1EA 4JBAA 1YP5A 3A0BC 2DBBA 2Y75A 3R4KA 2CZ6B 2PUKB 3QO3A 3GOXA 1R71A 1MBFA 1W36C 5J1RA 4DA4A 3W3SA 1K0XA 4Q48A 4A4GA 2ESWA 1FT9A 4A6EA 2COYA 4FETA 3OYDA 2ENMA 1QVGS 1K8AC 2QGFB 3UT1A 1Q81U 1MKMA 5BOXA 3CMMA 5DM7R 2K5CA 3IH2A 1PUFA 2COWA 4PJOF 2V6CA 5GAN6 1QBJA 2HXOA 3TP0A 5H2FC 1C1AA 3BR1A 5A0DA 3P9KA 1LJOA 3DSQA 4YRLA 4BY1J 2LMDA 1Q81C 2KIFA 2MAMA 5C44J 2V1QA 4C92E 3CCQI 1NTCA 2ZC2A 3OYKA 1XCVA 2HVRA 1USSA 5TISC 2DDBA 3VODA 2DVEA 2HBWA 1E3HA 2KDSA 1SRMA 4YRJA 2IS6A 4XR6A 4H0EA 1NJ2A 1VQ9T 1UHMA 2RDPA 1GVDA 1R22A 3DTEA 2E1OA 4G6DA 2VVKA 3A7AA 2ZNIA 3CF5F 3OYJA 3CMEQ 1EVKA 2VXZA 1YHQQ 2EFPA 3TL4X 1TZLA 3QWLA 5FFXA 2EZLA 2ARTA 1QVTA 3EFOB 2F1LA 1VQMI 4YELA 2CUJA 1SRLA 3NTHA 3A7UA 1HXDA 3ABTA 2ZNJA 2DO7A 2GWRA 4DEXA 3TW7A 1A35A 3BWGA 3B73A 2EVRA 4IZZA 2X35A 2YUOA 4CI0C 3CCMQ 1HQCA 3HG9A 2Z3YA 1FYKA 2P4RA 2KQRA 1UECA 4HAMA 1BC7C 3CTAA 2AZVA 3MAJA 2O9SA 2JTMA 1MV3A 1PKTA 1S5LC 1TQMA 1NNHA 1KQ0A 3HTRA 3SXYA 4WCGA 2OZUA 1R4MB 2IS2A 3WTTC 4XKBA 3HSFA 5EYRA 2XICA 4E6KG 4M7AE 4H2YA 2VL8A 1UDLA 1DGRM 2OTJA 1YW8A 2B0LA 5DCMB 3VYUB 4QIWN 3S93A 1UUEA 3CD6A 5GAMf 5J40A 3PIPA 2AT1B 4XORA 2DA7A 5KNLA 4M9ZA 3F70A 1Y56A 3RTRA 4WK8F 2XDVA 3HHGA 1ZA2B 4J6WA 1BJAA 3C4SA 5LHIA 4M7AA 3GTPJ 1WPYA 4JUVA 4BI3A 2RHIA 4XNFA 3E2UA 4XICA 3K1PA 3ZMTA 1J59A 5K1YA 1D8KA 1YCYA 4MDWA 1KQSP 4M7DB 1YG2A 5L3DA 4ZYDA 2L0AA 4WX9A 3LSQA 2D1HA 1S72I 4UVBA 2DPPB 2FZKB 1YITA 4FIBA 1J5YA 4L0YB 1POGA 1ZGJA 1BK2A 3LA2A 3FLGA 4KR3A 2X4WA 3G1JA 1R23A 2ESHA 3TVTA 2OTLI 4HV6A 3M0QA 1NG7A 3OYIA 3PIPF 1OU9A 2LX9A 1CF7B 2LQ8A 3M0TA 3CCUI 4BEHB 3M4PA 2VBXA 1ZHFA 3L2CA 2DTOA 2QKMB 2ZSHB 2X3WD 3ASKA 4OLFA 4WXDA 2V8KA 4KRTA 4ZN1A 4EM2A 3IG2A 2IXSA 3LFKA 3MEXA 1JKQC 1WI7A 4AFSC 2PVDB 2CSQA 2MSYA 3GLXA 3OSSC 4HF0A 1KJWA 3CJRB 3OQ5A 1T38A 2KRFA 1YBYA 4C92A 5GMKj 3M3YJ 4OAYA 4EM1A 4QQDA 3L2VA 2EQJA 1T98A 2FRWA 3CCUT 3UPUA 1YITQ 4BQQA 4C92B 5DLOA 4X0GA 3NARA 1BCMA 1E1TA 2DJNA 1UGQB 1VQ8T 1TUDA 2KEAA 4FYVB 4EDUA 2AKLA 1FOKA 1QE0A 4C3HJ 4BH9A 3MZHA 1ZRCA 3H0GJ 2R7FA 5D4SA 1NYGA 4F3QA 1TTHB 1SMTA 1QKXA 5DEQA 5HNHA 4H2XB 2UXXA 4XAXB 1NJ5A 2ALYB 1QWEA 4OP0A 3UGQA 2JMAA 4C8QG 5J6XA 2PZ1A 4OGEA 3JTHA 3A01A 4IX7A 1YJ9I 3OYHA 2JVHA 2K3BA 3FKIJ 4Y3OA 3CUQA 3HHTB 3A31A 2CUFA 1QRYA 1M1FA 2YLBA 2BHYA 1E24A 1B7YA 4XSXF 1PD0A 1GBRA 2MF2A 4LUDA 4ATOA 1GHCA 3NFCA 2YX7A 3SFZA 1REPC 3DKXA 1V55H 2ED0A 3T8TA 2HKNA 4KULA 5L23A 2HKXA 5IOZA 2XIDA 1D1AA 4ZDOA 2BY1A 3B02A 1SD5A 4MFDA 3LGFA 2RQVA 2R7QA 1OQKA 4DIQA 4N4GA 3WTZA 7AT1B 2FSWA 3TOAA 2HGCA 1RNLA 5HLTA 5IH2A 3H3VK 1SERA 3B6CA 2X4YA 2DAQA 4M7AB 5IP6A 4E6RA 4HBLA 4KIBA 4IIOA 3O6BB 3E3VA 2E7XA 3G1LA 2XF6A 1AEYA 1NYFA 2MIOA 5HODA 3HOTA 1TNSA 3PFSA 4LDVA 2K9MA 2MA3A 4OB1B 5GANj 1Q7YU 4ZYHA 2UZKA 1U5TB 3TBIA 5DCMA 1C0WA 2RM4A 2EJ9A 3BZKA 2R93J 4YIFA 4YFXF 4H4KC 1IO2A 3KETA 2HSPA 4HF2A 4BXXJ 2RI3A 2FPDA 3VS2A 1JJ2S 4B3XA 1WQ2A 1ZBJA 2OBPA 2W85A 3SJMA 3WU2C 4G84A 3LA7A 2MC4A 4IUUA 4R0KA 2MPXC 2AKWA 3F72A 2ZJPF 2QENA 1TP4A 5TGTA 1EIFA 1R8OB 5IAYA 1JHHA 1XG1A 3QQAA 3VU3C 2F2VA 3CP2A 3IRQA 2RF0A 2E19A 2L9NA 4GYGA 3G4SA 3LLRA 1EIYB 2YU9J 2AK5A 1WNLA 4P9FA 3GW2A 4UV8A 4XN0A 1WHJA 2NS0A 4JRQA 4YRQA 2DJZA 4J9IA 2LC4A 4M71A 2EZKA 2KRCA 1QA6A 3A8GB 1E7OA 1Z9QA 1F1ZA 2HYFA 1OCZH 3BTCA 2F4OB 3IHUA 4I76A 1D3BB 1UHCA 3EHRA 1WZOA 1X27A 1VQLT 4RB0A 3HRIA 4EX5A 5CJ9A 5F08A 2BE5F 5LFAA 2DTRA 4BY7J 1FIPA 4J19A 1F43A 1YFNA 1X43A 1RUNA 5KYWA 4LDXA 1JJ6C 3HFOA 1ZG5A 2L4MA 2R7WA 2DTIA 4QQGA 1Y8QB 4CCNA 3DKYA 5K5OA 1IHVA 3BDUA 3ASNH 1VQOI 5DM6F 2AZSA 2XSJC 3E0JB 4LDUA 3CCJT 3KYDB 4J9DA 3GCMA 4RB3C 2KK4A 4M7DC 4RAFA 2Y0MA 2O2OA 3RBBB 3LAJA 2IVWA 2EYZA 3HPWA 3HM5A 1YIOA 2LJ0A 2ZPGB 1I1GA 3AL0B 3CC7Q 3D7SB 2DFEA 1GT0C 2ZBKA 4EJOA 4CCOA 5A2QZ 2O4XA 4ITVA 3MEYA 2LX7A 4KITB 2DNUA 4JJCA 1MJ9A 2X6XA 3PNYA 1IRGA 3CCJQ 1HKTA 3GFLA 5LGUA 4XRMA 3JRBA 2M0CA 1FZPB 3RQ4A 2E1CA 2W00A 2Z9OA 1J7KA 2ZXHA 4IHTA 1PKSA 1GXQA 2QEXI 4HVWA 2YPRA 3UFGA 3E6BA 3FXMA 2K9GA 3LW5E 2M30A 3I55T 1Z0XA 2ZJQF 4PGGA 1ETVA 1H89C 3UWNA 1OYYA 1WJCA 2A69F 1X3UA 4CYDA 1WVRA 4I99C 3A01B 1OV3A 2KXDA 4J8OA 1Z1DA 2JZYA 4A5MA 3VRZA 4XEOA 1IHWA 1SVMA 2K85A 2DODA 3GXOA 5LGTA 3K4LA 1D8JA 1BU1A 3BE3A 1AWOA 1B76A 4HSRA 4IOAF 4BHPA 2CSIA 4XLNF 4G12A 1ETOA 1KU9A 4IVNA 1IN5A 4Y4RA 2A6TA 5AIPA 2IRFG 1JRIA 4C92C 3R61A 1N77A 1LE8A 4MNUA 4MZPA 1MMNA 3LWFA 3WGIA 2D0NA 2V8IA 3VS6A 3J80K 1YYVA 3K70C 2GCXA 2CP2A 3MF1A 4G8XA 2LVMA 5ILSA 3GUDA 4BQAA 1PM3A 4M75D 4E4HA 2ZFWA 3V4GA 2E70A 3TO9A 3TEHB 2LJ3A 2OA4A 2DKGA 2F48A 1UG0A 4PFZA 5HY6A 1H4QA 1J0RA 3F6VA 3UNGC 1M3CA 2Z16A 2MH9A 5D4RA 2GAUA 4KH0B 2GGRA 3H6ZA 3KZZA 1YJ9Q 5KYXB 2M5WA 3FIWA 1TSFA 5L3FA 4RMOA 4M7AG 1S7OA 2CP3A 3M4QA 4L87A 5J4YA 2KL4A 5LJ3j 1MV0B 2MYSA 3JRHA 3A7RA 3Q5FA 2X3XD 5B3SH 1PDNC 4EIKA 4M3FA 3ZCOA 1RAHB 3WQZA 1V4RA 1CF7A 1WJRA 4M77B 1RETA 4LJZF 1XS9A 2K7AA 4UC4A 5GPCA 2OUMA 4X5OA 2K5LA 2OTLT 2KDOA 4PL6A 4FT2A 2OQGA 2ZCEA 4M7AC 3QBYA 3H0FA 2ACJA 1BOAA 4XLFA 4XTZA 5GMKh 3ONQA 2L2OA 4ORZA 5A0LA 4YRMA 3MO8A 5JR3A 1QZEA 4YEJA 4HSTA 4BJTA 4KN7X 4EMKA 1SFXA 3JRCA 3OBYA 5LEKA 1I27A 4ZYGA 3HOZJ 1SESA 4Y13A 1N8RC 1UAAA 1LCKA 2X1CA 3QZ5B 4F7ZA 1U9NA 2GNCA 4XOTA 2KIMA 4XL9A 2CH0A 2KPMA 1TUCA 1YFTA 2KAFA 1SSHA 3CJTB 3OA6A 4U0VA 4O6JA 4U0YA 1RAIB 2YS9A 3KP2A 2FO0A 2R5MA 5KE3A 4ZTJA 3CCQA 3PQJA 2RV8A 3OIOA 1H4SA 1TW2A 4XN3A 1YI2I 5KYUB 2ICWG 2AHQA 3CC4Q 5EZGA 2ID6A 4YRGA 4M7DE 1D0YA 1ZLJA 3S2HJ 3X24B 1L0OC 2L3SA 3VSLA 4IQ4A 3L00A 3F8CA 3O3KA 3IP4B 4LB6B 4JQFA 1CKBA 1T6SA 3PSIA 5LD2C 3RUXA 1VQPA 1Z05A 3BR5A 2KISA 3V7CA 4M75B 3SB2A 2DCEA 3RL6A 4YRIA 3MEWA 5CKFA 5FLXZ 2DEUA 1E2XA 2LRDA 3ESWB 1DP7P 3R6SA 1HJDA 3CMEI 4HWRA 1IV8A 3GEZA 3O5ZA 1GFDA 2CH4W 4A3FJ 3T0YA 4ZDLA 1YFSA 1FLIA 2VC8A 3U1DA 3LMMA 2WTEA 3BDLA 11ASA 3RERA 4ENJA 1VQMQ 2CH4A 3DCFA 3M8EA 5A2QE 2L01A 4Z89A 5F64A 3HXXA 2EA4A 4K11A 4P72A 3IWFA 2M0OA 3H92A 1OISA 1VI0A 1AHDP 4ABZA 2FMLA 3LSRA 4NQWB 4M7DG 1X58A 1R0CB 4RAGA 3DU5A 1KMMA 3DXJF 2HQ5A 1ZLKA 1RLPC 1SAUA 4M78G 3CCUA 3A74A 4NCXA 4I02A 2FZGB 4ELYC 4LK1F 3QPLA 2L0KA 3E6DA 3LH5A 3GPLA 5LRSA 2LQKA 1A0NB 3PE0A 1Z3XA 4Q5WA 2RREA 2V1UA 2MC3A 1W1WE 1X1PA 2L02A 4A2UA 4D9JA 3E7LA 1IXCA 4YFKF 4UY8I 3R07A 4WWCA 1U9OA 2EINH 2F5VA 1D1BA 2DFUA 1IXSB 4L5IA 4R56A 2JUCA 1UB9A 5GP9A 1KYZA 1MHNA 3OS5A 4ON0A 5D6XA 1SD4A 2CQKA 3LNQA 2HDWA 2BZTA 3FM5A 3MQZA 1C0AA 2A28A 2LTPA 1G3SA 3PIOF 3A4CA 1S7EA 2R7SA 1YJ9T 4FT8A 3CCJI 4ESBA 2B8AA 4D6WA 5IT9E 3W2VA 1OCRH 1X4OA 2CZ0B 3G4SQ 4WJ3M 1H9TA 2VQGA 1IG7A 4RMFA 1VA7A 1X2NA 3CC7I 5IYBJ 5HK0A 1NYRA 3MD2A 5ICFA 4G94A 1WKMA 5E3OA 3I55I 1EZZB 3TO7A 2KT1A 1QVFP 3VS5A 3RACA 2DA3A 5C4JJ 2P4WA 5LEJA 4AIKA 1EH8A 2DRMA 4IUTA 2EV5A 3EG2A 1BYMA 1SSFA 2HU9A 1GBQA 5GAN3 4CH7A 4BS9A 2OTLQ 1AWWA 3SWNA 3CC2T 2LKSA 3HXUA 2W84A 12ASA 2DMOA 3O8HA 3MZ8A 1RUOA 2KDZA 1C0MA 4M77G 1Q86C 3CCUQ 2AMCA 1FIAA 1AWXA 1WHMA 2ZPBB 1WA7A 3P8TA 4NL3A 2BV6A 2I10A 3G71Q 2E10A 4KT0E 3VYSB 1KONA 2JA6J 4F7UB 3CUQB 2CJJA 2YLCA 2NVYJ 1WHLA 5HCKA 4F92B 1O9SA 4GRIA 2KVQG 2L7ZA 3FDRA 1R6RA 1ERDA 3E19A 1H8KA 4YTLA 1MSFC 3MN2A 1YIJI 2VASA 1VQMA 4DYQA 4D8KA 1BL0A 2RHSB 1VQMT 5A2QK 3UGTA 4ZC3A 5K7FA 4PJOA 3G6EA 3JB9D 3JB9F 3PZCA 1FX7A 2K79A 3AG4H 1FOYA 3QODA 4UUTA 3BZ6A 4S04A 1K61A 4Z02A 4YP0A 1RIOH 2IY5A 1X2GA 3I4PA 2LDUA 4QLCU 4MQVA 2YUQA 1JKPC 4ELZC 1UJYA 3S2WA 1D0XA 3S8PA 2PQWA 4DEYA 3QO8A 2LVSA 2PMZA 2EAYA 2JMCA 4B48A 2CP0A 3EG3A 3U9GA 1TBXA 1MUZA 4QTRA 2DE0X 5GAN5 1VQ6A 3K4JA 1W66A 2X4JA 3CC4A 3A5ZA 1K78B 1VQZA 1OPCA 2Y30A 1WGXA 4Y52J 2EIMH 3P8VA 2IPQX 3K1NA 4FX4A 4DBQA 1OX8A 2M87A 1XDSA 2L3DA 3CCRI 2AIRB 4XIDA 3X25B 4BY6B 1FTTA 1P9QC 4A69C 4RGSA 3HRMA 4EGYA 1OPLA 2FHDA 2C0TA 4M75G 1IZ6A 3HKZA 2DK3A 4MEXF 4M78E 1WHKA 2X9HA 3UF4A 4JK1X 5LJ5j 2E5AA 1UHFA 2NVXJ 2GQVA 4Z8AA 1GLNA 2EYWA 2H6BA 2DA4A 3M07A 1VQNI 1MJAA 2DT6A 2FD5A 4Z2YA 3VOEA 3N97A 3EGXA 5FWBA 2GZWA 4R8HA 2VE8A 1VQPT 1LJ9A 2OJED 1QZZA 3LQQA 2EH3A 2ESNA 2VPRA 3TP3A 1WWXA 3MWMA 3SDBA 3WE2A 1H88C 2YRVA 1CSKA 3PJRA 4CCMA 1WCMJ 2VODA 2WBMA 5I2MA 1ZSZC 3HRUA 1TH7A 2FQ4A 3QOEA 1SFOJ 2P5LC 2EIJH 1LQ1A 2KRNA 2QSFX 1EFNA 5GPAA 1BJZA 3EGDA 4QQ6A 3D5LA 4HQEA 1LFUP 4M78B 1TOVA 2K9LA 5FU7B 4BUGA 2VJ5A 3VSKA 3VQXA 1E3PA 1AOJA 2HQNA 3JCMJ 3CEYA 2JUGA 2Y31A 1TWHJ 3ML6A 2OF7A 1E17A 1PSFA 2RNAA 4C8QB 4D7NA 4YRRA 3KEOA 2YX4A 2AXLA 1L0WA 1SC7A 1K76A 4DPGA 1B9MA 2B86A 5J39A 2HXIA 2M2EA 4A5NA 2ZSIB 3J7AO 4OF1A 1D5YA 3CCSQ 4YIIA 4B1RA 1D5VA 3JB9H 1YNZA 3CF2A 1BR1A 4R79A 4GFBA 3QWYA 4P9UA 5E1XA 4C92D 4XRSA 3REOA 1EF4A 3SFMA 4MDXA 4MMKA 3IH4A 3KBGA 3HRSA 3RGLA 2YSRA 4QPQA 3PO3J 1KU2A 2J3LA 1BI0A 4XTVA 5BNGA 1ZELA 5AIQA 1NG6A 2BW3A 2Y0SA 1SHFA 2G3RA 1HW1A 5HLGA 5KYYA 2HTSA 4UVAA 3QO5A 3BTJA 3QHSA 4JRKA 2JTEA 1O7LA 1TT5B 3O8GA 1MNMC 4LVJA 2FB7A 2EJRA 3DEWA 1Q82C 1FPQA 1KYWA 4UVCA 4DQ2A 4IRIA 4CS4A 5TRDA 1Z7NA 5HS9A 4TQFA 3ERRA 3KP4A 2BYVE 3Q1JA 3VFZA 3DBLB 5C4XJ 4EMSA 4EGZA 3QRFF 5D8KB 2VKHA 4F7UF 1VQNT 3A03A 2M02A 2V9PA 2JM8A 4TVRA 4IXAA 4HOBA 2L54A 3BOQA 3LSJA 2DERA 1ASYA 3HXLA 1ABQA 5D6FA 2OD5A 4ZDPA 1K6YA 2DXIA 1AOYA 3I55Q 2ROTA 1I3AA 2FBHA 4PFPA 4ENNA 2EQIA 2F6CA 3ZMZA 2Z0WA 4BKXA 1LB2A 1I50J 1O75A 2K27A 4M7AD 3CXCS 1VQ4Q 1KOGA 3CPWA 2A7YA 3TQNA 2HVSA 3ZPLA 4BL0B 3TEEA 3GNGA 4CRIA 1OI1A 3K6GA 4JS5A 4N0AA 1J9IA 1DPRA 2A3SA 2OPTA 3KIOA 2JA7J 1FWZA 5D8LB 4X34A 5BPDA 3BFMA 4F91B 1PSEA 1RL2A 1R5ID 3OR1C 2BY3A 2K40A 3FK7A 1JJ2A 3LWHA 2HI3A 5IYCJ 1OCTC 3PMTA 3AHUA 4YRNA 5D5WB 3UATA 1KQSS 4IO9F 2I2LA 5AYFA 2CQ7A 5LJ5e 1B70A 1JUPA 2KRSA 4DW6A 3M56A 3PCOA 2PMEA 1FBQA 5KYWB 3ZQLA 4U87A 4Y33A 2GTJA 3CCLA 4PK4A 2VN2A 3L9FA 4XLPF 4A3LJ 4OMYA 3KEQA 1TS9A 1M3BA 2F5CA 4AYBA 2KY9A 3HP9A 4C8QF 4KT6A 5J47A 4RG2A 4JS4A 2CZ1B 3NEMA 4J9BA 3SDGA 2R7UA 1V1CA 2BE7D 1MBKA 4MO7A 2PG4A 1ETYA 5CQGA 1UHSA 1T39A 1FTZA 1N27A 5IYDJ 1ON1A 4XONA 3MP8A 3ZQCA 1B72A 4J6YA 2LR8A 3DQVC 4PNOA 4F04B 2QQAA 3TDZC 1K73C 3KPHA 4BJ5C 2R5YB 3REUA 2PJPA 4OGCA 3GWZA 1KQ8A 3G1MA 1M8MA 1JI8A 1QO0D 3LSTA 4P3OA 1W0UA 1JUMA 2IAIA 2OV7A 5DYMA 2X6YA 1E3OC 5E17F 1UJ0A 1IN8A 2BW3B 2QQ9A 4Z6YA 2OAZA 1JXMA 2E5QA 2V1RA 3CCMT 4L6V5 2JZ2A 1YE9A 3BJUA 2K2MA 1I07A 4PLLA 3V8LA 4M77D 1SD7A 4ZJZA 2DYRH 2COBA 2WB1A 4HW0A 4XBFA 4CICA 4FCYA 1IW7F 1B59A 2NVQJ 3TREA 1WJFA 1S72A 1WU7A 5HVQC 1X01A 4C5HA 3QO7A 4RTUA 5EG0A 4XLCA 5L3CA 3FHZA 1IDZA 1RABB 3NAUA 3HSEA 2QBYB 1BI2A 3BY6A 1ETWA 2ME6A 3ROUA 3PVLA 3IALA 3HRKA 2HQHA 2LT4A 1BI1A 1AA7A 1OZ2A 2CRGA 4PJLA 2FF4A 4D5FA 4PJ0C 1B3QA 1WYXA 2KGTA 1VNDA 4CZCA 4F7UE 3CXCA 4AIDA 3AKZA 4QVZA 4JRPA 4KJZA 3CMAA 3DBHB 1NHAA 5AONA 1FBUA 1ZUUA 5HNFA 3M0RA 5LJ3d 2WB1N 2Z2SB 1ONVA 3WTXC 4N4HA 2GA2A 2XASA 3H5RA 4LVKA 3F21A 1XNIA 3I7FA 2DA6A 4EV0A 4AWXB 3NTKA 3CCET 2KI7A 1PYSA 1H92A 2XU8A 3SHWA 3M0PA 1R4NB 2YUPA 2F5DA 4C8QC 2CP7A 1TT0A 1U3OA 2VC0A 2O0YA 4E2FB 1KQSA 3KP7A 2M4GA 4MTEA 1S6LA 2GXAA 4A3GJ 4P75A 2DMQA 4ASNA 1R9TJ 3J81Z 2K3PA 2JQ7A 4JJNK 4YDQA 1Y57A 3C94A 1BN5A 1BBZA 4M75F 5ECAA 1Y07A 2I4LA 2M34A 4BB7A 4YRVA 4N0BA 3JCMe 2EBIA 2HS5A 1HDDC 3H1CA 1LPQA 3QYEA 1VQ9I 2JVGA 4BACA 1ACMB 1W5CC 4OWRB 1Z3YA 3JRIA 1NLOC 2CT3A 2NLUA 1YHQI 4XU0A 1V29B 2R4GA 2RHZA 1H4TA 3RR6A 1K9MR 4S0HB 1NK3P 2RHXA 5J3BA 5CR2A 2IVMA 1N8RR 1VTNC 1M1KR 5GMKl 3HSBA 2ZT8A 1IRFA 4F14A 3FISA 3ME9A 1CGPA 2YDLA 2Y48A 2ZT7A 4L5JA 2IY5B 2KT8A 1RAGB 1E6GA 4OMFB 4JX5A 9ANTA 1ZSZB 5IN1A 4UB8C 2R7VA 3OMGA 1JBMA 1R1UA 1XCBA 2P0KA 2R5ZB 3HFVA 2VKDA 4I2OA 3MEUA 4MZMA 1MMSA 3PNTA 3HKZN 2DK5A 4TTVA 4I0AA 4KUDK 4DOWA 1GVJA 2DVJA 2W48A 4W1UA 1FYFA 1TWFJ 3BJOA 2CQQA 2IGOA 5DD8A 3GZ6A 1Q1HA 1C6VX 1R5HA 2CDTA 1EH7A 2CMPA 1P92A 2HZDA 4NDLA 1AWJA 2HL3A 2JS2A 3HB9A 1VQ7T 3K4BA 3ZMUA 1K78A 2LT1A 1JE8A 2YWWA 1YO5C 3A5ZB 2L4AA 4F7UA 3C18A 3M8FA 2LD5A 5CVIA 3QDFA 5CVRA 2VKEA 4ZZLA 2HL5C 2ZPFB 4FYYB 4XMYA 1X55A 2KZGA 1W7PD 3NENA 4GXOA 2V6EA 4BE1A 3F3XA 2L3RA 1R1VA 3H3UA 3HDDA 1VQ5A 4IF4A 3LSPA 5FLVA 1I1JA 4LG0B 2DL4A 2WSEE 5KHDA 1WYDA 1WJDA 2DQ3A 4PJOB 3MVPA 5C0MA 1XGOA 1TQPA 2FBIA 4IEJA 4OU0A 3QYBA 1HSJA 3OYEA 2VPLA 1ITYA 3L1AA 4GLMA 2TRTA 2FEIA 5I11A 3KLOA 2E4HA 1AZEA 1IV6A 1BKBA 2MD0A 5JFRA 2MLGA 3RMQA 4P72C 4XEMA 5CYVA 2KYBA 3GNFB 1LYLA 4PLIA 4EMHA 1B70B 3PCOB 2QDLA 5LJ3f 2LZ6B 5DLQE 2HPMA 3R6NA 4FYXB 3GTOJ 3M57A 4YRSA 5J3LA 2XF7A 3OYMA 3ERED 3E5UA 3QWXX 1YS7A 3IRRA 3C3WA 1XGSA 3EG9B 1YITT 1P7JA 2HKOA 3OYLA 5ED4A 5FLXK 1XJWB 2NUTA 4AH6A 1T2KA 2AQFA 1FJLA 3EAEA 1YJWT 1YFRA 3CUQC 2DFHA 1ZQ3P 4X9DA 4LG0A 3HUGB 1YI2T 2QAZA 4JX4A 1A6QA 2ZCWA 2LDMA 5HS7A 4LFUA 1BR2A 1WFXA 1TWAJ 3LAPA 1OKRA 2NAZA 3VPRA 4E7KA 4IQJA 2YHTA 1YIJQ 4HCCA 4QW2A 3BR6A 3I3LA 3M9QA 2XHKA 3E5XA 3PM1A 4E7HA 3TO6A 2P0QA 2KBTA 2CP5A 2L8DA 5LJ5d 1XB4A 3CZ6A 4MQ9F 1QGPA 4P5NA 5FU7C 4BW9A 4H2TA 1QF6A 3CMYA 1VQ6I 3VUBA 1KIKA 2RHQA 2A36A 1QZYA 2ZZDA 2XKOA 5DV5A 4N9IA 3EG9A 2XDBA 2ZPIB 3A0HC 5D6YA 3EH2A 1UTIA 4CUGA 4EVIA 1I5ZA 2CW0F 1Z21A 4KIGA 5JVTA 2VJIA 2KQWA 2C7IA 2PN6A 2G9WA 2V1DA 1GCQC 4B09A 3GFIA 4B47A 4KMFA 1QLYA 4BE2A 4E51A 3JTGA 2CJ9A 1VZ0A 2SEMA 2I4NA 4IURA 3JREA 1P2FA 1U5SA 4M74A 3UH0A 2L9RA 2FOKA 2E5NA 3KE2A 3T8RA 3CCRQ 5M5WJ 2OAWA 1KA8A 2R7ZJ 2M1HA 3L4GA 1RC9A 1JT0A 2D0QB 4UHTA 2PQ8A 1X69A 1SAXA 1A5JA 2RK2A 4IJAA 4E7JA 1ZTRA 2Y4XA 1KQ9A 3OS0A 2EZHA 3FF5A 2EYXA 2RJCA 3G7ZA 2QSGX 2VT2A 2XGDA 2QG9B 1DU0A 2VC1A 3L2RA 1VQ9A 2A0FB 2Y0SN 5K1XA 2J5OA 4A0XA 1YWPA 3BC8A 4NUBA 2QK0A 4F55A 2HTJA 5CO7A 3D5RC 3RI4A 1KMNA 4B44A 2QYZA 1MH4A 4RDXA 1ETKA 4XQ3A 3CCVA 5CKBA 2R58A 1MMAA 3OV8A 4HEA2 3S14J 3E9FA 2Y69H 5IT3A 3CCMI 3A2KA 2H3JA 1DPUA 4M75A 2K86A 2EQRA 2M8EA 2J05A 1VQLI 2XAGA 4M6XA 4IHVA 3JCUC 2K9NA 1Z7LA 2QGUA 2VKVA 1KK7A 3S1QJ 2JA8J 3F8BA 3W3CA 3IAS2 3FBIB 4Z88A 3OIQA 4AVZA 2RNGA 3DEEA 1S1NA 1JUSA 3RKXA 1X3WB 4HF1A 2W25A 2EFOA 2VYTA 1BBYA 1RPWA 2CUEA 2OAUA 4EJUA 3BR2A 1AVZC 1KQ2A 5KH6A 3QAHA 2VQHA 3O8VA 4IIMA 1X6GA 4NBQA 1O7FA 4ZYAA 5ERIA 4N4IA 3DU6A 1BI3A 3WODF 2SRCA 2O03A 5KYXA 4PJOG 1Q82U 3CD6Q 4CS3A 2BE9B 1IGQA 2GXBA 1ZA1B 1P6RA 2E34A 4RQEA 1MZBA 2DL7A 4X6AJ 3C7JA 4PDKA 2C06A 2EV6A 2DXBA 1HC7A 3ZR8X 2G0EA 3EH1A 4HG2A 3TMOA 3M58A 3SDZA 1OJLA 1OLTA 1ZG3A 2E1NA 4IPAA 4BD3A 3SWNC 3PSFA 2Z5UA 2EYYA 1YCSB 1YI2A 3RDIA 1M1GA 4HZFA 2Q7GA 1YJWA 3WTSC 2YXYA 1W1FA 4RTYA 1D1CA 4EMGA 5CQEA 2GIVA 3FXQA 4J00A 3I9V2 2K5IA 3TUPA 2NOGA 2PNIA 1N9RA 1R58A 1WJQA 2ELKA 1QHHD 2G7HA 4XKCA 4A3EJ 2RQWA 1VQNA 1GGMA 4KA4A 5GAEJ 3MCAB 4J9FA 1TC3C 1BCOA 3HRTA 3COAC 2DA2A 4H2UA 1N5ZA 1KFZA 5BS6A 4ME7A 2H1LA 3U21A 3VB2A 3QYFA 3CCVI 4QVCA 2O01E 5GAN4 3CCLQ 2ADUA 1JTXA 3GBGA 5IP9J 2QEXT 4ZGDB 2TCTA 1QKWA 1HDPA 2P81A 1XQHA 2XKOC 4DJAA 1KD1C 3BTIA 1MH3A 3I59B 4RDUA 3HOXJ 1SEUA 2CUZA 1B8IB 4A3DJ 3GFMA 2JW4A 3VRYA 3GBQA 2QM3A 2QBYA 2EZIA 1B34A 2DYSH 3I5RA 4C8QD 2ZR2A 1MGTA 1ZGWA 2CUDA 4B6MA 3CCEI 2EILH 5EG0B 4I6ZA 4P74A 4BJ6C 4DYCA 4M75E 1XDUA 4BU2A 5GAMg 2FZCB 2LYCA 2EFWA 2XGTA 5LHGA 1Y0NA 1UGSB 4A4EA 4RMNA