3RIRA

Crystal strucrture of biotin protein ligase from s. aureus
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Crystal Strucrture of Biotin Protein Ligase from S. aureus
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 102
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rirA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rirA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rirA02
4KICA 1N9SA 3KP2A 5JVTA 3BW1A 2J5OA 4YRQA 1BIBA 3JB9H 3QRFF 4J6YA 1B9NA 3TKYA 5E1XA 2GQQA 2VT2A 3VU3C 2Q2EA 3HRTA 2VBWA 2MLGA 2DPDA 2GIVA 1I5LA 4L0ZB 5K5QA 2EV6A 4ON0A 2VE9A 2ZR3A 3DKWA 3LSQA 4H2UA 5FO5A 1U5TA 4M7AE 3P8VA 4HVCA 2COMA 3BP8A 2K86A 5GAMh 2RQPA 3JB9J 4KN7X 1EOVA 5EEHA 3QPTA 4IXAA 5C52B 4N0AA 2EB7A 4WJ3M 2XKOA 1YCYA 4MTEA 4OU0A 3GYHX 3HSEA 5KK1A 2O3FA 4L5JA 1LQ1A 4YYEA 1JJCB 2XTIA 5GAN5 2ALYA 2Q7GA 2CO5A 2DDZA 3ABUA 3SXYA 3BY7A 4L18B 3QO5A 1EIYA 3JCMb 2VN2A 3I53A 3HFVA 2PMUA 2VONA 3C3WA 4XTXA 2IRFG 1QZYA 1FYMA 4EV0A 5CLSA 4WX9A 2FQ3A 3KZZA 1KA8A 2L4MA 5GMKh 1WQWA 4H2XB 2FRHA 5E18F 2E1HA 5LGUA 3GXOA 3AHUA 2EJ9A 5GANj 4KMFA 3TO7A 2ZT8A 1XB4A 4XU2A 2NS0A 1R00A 3LA3A 3I54A 2EFWA 4PGHA 3PCOB 5FGMA 1WSUA 1KU7A 1ON1A 2BGCA 4M75E 1Q1HA 2A5YB 5LJ5h 3JCMe 5LHIA 1DDNA 3A7UA 2MLKA 3GFLA 3P7NA 3Q5FA 4F7UG 1JE8A 1F9NA 4KNYA 2GA2A 5GMKl 4LLNA 5LEJA 1TQIA 3GZ5A 4ASNA 4F7UF 2A6HF 4UHTA 2QQ9A 5ED4A 3J80Z 3H3ZA 3UH0A 2NNNA 5BMZA 5LHGA 2DTIA 4PZJA 3T0YA 1WI9A 1RNLA 4HV6A 1DPUA 3HFOA 4ZYDA 1IXCA 1IZ1A 2DXTA 3A7RA 4JUVA 3KCCA 2E64A 4PGGA 2OQRA 1UHMA 2FA5A 4HX7A 4BHCA 2A69F 1OMIA 2R7FA 4M7AA 4Y13A 3LWFA 2P6TA 1DP7P 3W3SA 5GAN4 1MJAA 1YW7A 1XSXA 1XSVA 1SMTA 2VXEA 3SWNC 1TW3A 3BROA 1B34B 2JZYA 5E8GA 1M5Q1 3E5UA 2BBYA 3LA7A 3R4KA 1TBXA 2ZMEB 5GMKm 1G5IA 1U1SA 2EFOA 3OD1A 2E10A 4RS8A 2O61A 2RHQB 4KUMA 2IJLA 4A5NA 2V1UA 4G6QA 1P2FA 1JBMA 3HOTA 3DPLC 3RGLA 2O03A 1B59A 4Q15A 4YRRA 5GANg 4F7ZA 4M78D 2W84A 2EJGA 1W4MA 2Y90A 4CS2A 5HDNA 3IG2A 3BPVA 1SD4A 4ENNA 1Z6TA 3R61A 4UPAA 1XCVA 3FJPA 1NJ5A 2RA2A 2M5WA 5EEGA 2OBPA 4P9FA 2XAJA 5AONA 1HKTA 1TQPA 4A6EA 4M75A 4E70A 3CJNA 4PJOB 3PQJA 1YYVA 1G4DA 1XMAA 5GAN2 3CTAA 1YW9A 4HDUA 3WGGA 2QHSA 2CSOA 4L0YB 2D1HA 2LF7A 2YU3A 2YSRA 2ZO4A 5FLXK 2GXGA 1KQ1A 1KMNA 3JW4A 4KYWA 2M1BA 1KMMA 3HXVA 3K69A 1XSDA 1A04A 4C92B 2E3CA 5LJ3e 2Q5HA 2IA0A 1FNNA 3GF2A 3PZCA 2L4AA 1IN7A 5L3FA 1FOKA 3JCMX 4Q5SF 2W57A 5BOXA 4RB2C 2EV0A 2Q5IA 4KIBA 2QHUA 2DZCA 3CUQA 4EGYA 4RDXA 5IT3A 1P92A 2DTOA 1BI1A 2EAYA 4YCWA 3IKVA 4U0VA 2Q7HA 2RHSA 4OOIA 1PUEE 3F21A 4LB6B 2I4OA 3PCOA 5ILUA 3I59B 4KN4X 2Q7EA 4CS4A 3WGHA 4HWRA 5BQTA 4Q47A 3IHUA 1C0WA 4LG0B 5FD5A 1ZH5A 2F5CA 2EWNA 2ACJA 3HFNA 1F4KA 4KR3A 4H02A 4OMZA 4F7UE 4G94A 4HLXA 2JN0A 3VQYA 5E1ZB 4WI1A 1K7AA 4M78C 2CJ9A 3CDHA 3ZN0A 2OZUA 2WTEA 3P8YA 1TW2A 4YRTA 3RYRA 3B73A 3DF8A 5BPIA 3RPUA 4P3NA 3FXUA 4UXNA 4CH3A 4I0AA 4YREA 3R0JA 5D5UB 1ODDA 4A0ZA 4ZZLA 3JCMf 2P5KA 2YR2A 3LA2A 1L3LA 3QNEA 1ASYA 3RESA 2ZIMA 3JTHA 3JB9I 2XAHA 4OIPF 1AOYA 2RM4A 2NRAC 2PMEA 2DKGA 5ICFA 3LAPA 1BI2A 2V79A 2M45A 2RGVA 3FF5A 3VODA 3GLXA 2QZ8A 2X4HA 1SFUA 2HS5A 3A5ZA 4GXOA 3A7AA 2P0LA 5DYMA 4CS3A 3CMQA 4EJWA 3HXZA 4K2EA 2W85A 5ILSA 3HRIA 1SAXA 3INZA 3HSBA 1YO5C 3MZHA 1X54A 2CIMA 2A68F 4YRNA 4KT5C 1B70A 2JSCA 1LYLA 5FLXZ 4BYYA 1XDSA 2RDPA 2EK5A 3K1PA 3QO8A 1O3QA 3RUXA 2CWEA 4A12A 1T2KA 3ISPA 3MQ0A 3KETA 4YFKF 3P8TA 1JHHA 3FIFA 3RPQA 3T8TA 5LHHA 5L3BA 3RACA 4EJOA 4HW0A 1IW7F 2FSWA 2P5VA 1QZZA 3BJ6A 3K9TA 5E1WA 4ETSA 4B09A 4KDPA 5CJ9A 2H27A 4HQMA 3NETA 1U5TB 3ULQB 4XSZF 4M78G 1SMYF 4LB5A 1JGSA 4H2VA 3R07A 4F7UA 3FM5A 4M9SA 4TTVA 3RYPA 1U8RA 1R36A 2XKPA 5DCMB 3M1EA 2ZCEA 1KU9A 3L2ZA 4HAMA 2V9VA 1USYA 3Q9SA 1H0MA 2GZWA 2Z5UA 2ALYB 3WGIA 3O3KA 11ASA 3T5XA 5CVRA 1QPMA 1X55A 1EIYB 4EO4A 2Y48A 3KP7A 5ELOA 1OPCA 5GAN6 4IJAA 2EA2A 3ZMUA 4CDGA 5C53B 3ML6A 1XGOA 4IPAA 2YPRA 4Y15A 5GMKj 4RCBA 1S8NA 3GFMA 5CVUA 4OMYA 3DQVC 1JHFA 3I59A 3RF1A 3JCMh 3G73A 1P4AA 5GAMd 1O3TA 4O5VA 4M77C 4M7DG 5DUIA 1LJ9A 2D1VA 5LJ3f 1B4AA 4PJOD 1STZA 3MFKA 4BHPA 2FMLA 2ZCWA 4WXCA 2DU9A 4M7DF 4P73C 3M4PA 3JB9D 3QO7A 2FEZA 4EM1A 2YX7A 4AIJA 2FBIA 4YRSA 3E3VA 1G5HA 1T39A 1REPC 2P7CB 3DPTA 5LEKA 3E5XA 4C92D 3RKYA 3WQZA 3E9IA 3BDDA 5GANe 4EMGA 3WTTC 2Z99A 3BWGA 4P96A 4Z2YA 4UVAA 4MMKA 5K5OA 4JRKA 2YLCA 3L1AA 2L3DA 1T6SA 5J8FA 4LLLA 4P72C 2FE3A 3LSSA 2RKHA 5ELNA 1SERA 3SZTA 1LNXA 1L0WA 2VC1A 1Z9CA 2ZBKA 4U0YA 3BFMA 2GWRA 1O57A 3A31A 2I4LA 5JR3A 4M7AB 3P9CA 4JLIA 5KNNA 5LJ5d 3S2WA 2ESNA 2FYKA 2DVEA 1RI7A 1I1SA 1ONVA 2M30A 3F22A 3FMQA 3DSQA 4TVYA 3BOQA 2JPCA 3J80K 4P9UA 3N4MA 2ISYA 4M73A 2K4JA 4AH6A 1ON2A 3A74A 5F5WA 5E17F 1ZYRF 1J5YA 4RAZA 4UVBA 2DT5A 2CJBA 1SESA 1IUYA 1HSJA 3OV8A 2NNYA 1HQCA 4M77G 1BI0A 2CQKA 2D2WA 4WXHA 3M4QA 2IA1A 4M77F 1B1BA 2LSOA 1NJ2A 2DTHA 1QGPA 2VXFA 2XIGA 3COAC 1KYZA 1HBXG 2XASA 1NJ6A 4TQDA 1FSHA 3IWZA 4O6JA 3UGTA 4IHTA 2XUBA 5CVVA 2DZ9A 3BDUA 5L3EA 1U3EM 3MZYA 1F1ZA 1HW1A 2FOKA 4M78E 4M75B 3D5LA 1BN5A 1BC7C 3FXRA 5DCMA 3T1BA 3KP6A 2P5IA 4EMKC 4UP8A 4RGSA 1ZRCA 1PYSB 3GUDA 1GHCA 4P71A 2EFPA 1SD7A 2EA4A 1FBQA 4NL3A 3HTZA 1GXQA 1J0RA 3EFSA 4P3OA 5GAOq 4YRFA 2QWWA 4ZYHA 4D0PA 2KJCA 3M8EA 3CUQB 3HY1A 2QHTA 1FT9A 2OU2A 3JCMQ 3LAJA 1QBJA 2PN6A 4JRIA 1RUOA 2JPBA 1J9IA 2EJFA 1ZG3A 3U1DA 2RHSB 4M7DE 4LFUA 4YROA 4DPGA 3QSUA 4DNCA 4C8QD 1EQRA 5L3CA 5HDGA 4CGZA 3HSFA 4LJZF 3NQOA 2C6YA 2QQAA 2DI3A 3F23A 2E1NA 1R5GA 3I5UA 5TRDA 4AVPA 5C51B 4K88A 3OOPA 3TO9A 2BV6A 1HKSA 4YRGA 4IRGA 3NEMA 3EDPA 4BXUA 4YRPA 2HTJA 1KGSA 3KE2A 1Z05A 1BC8C 1QF6A 3LQRA 1B9MA 4BH9A 3N97A 1WU7A 1LEBA 4XTUA 5GANf 3FWEA 3GEZA 3JSPA 4CH5A 4QVCA 1R22A 4ZTZB 5DV5A 1ZHFA 1BJAA 1MD0A 1HC7A 2AKWA 1IL2A 3ZPLA 1K78B 1YFHA 4AIHA 1FYFA 2FF4A 2FNAA 5GMKi 3ZN1A 2L01A 3I58A 4X9DA 1YW8A 1BIAA 1NJ8A 2V1DA 4RQFA 4A5MA 1E1OA 1IRFA 1E22A 2G9WA 2QQBA 2ZJ2A 1TTYA 1WWXA 1ZRFA 4J15A 1B70B 2ZR2A 2NYXA 3WE2A 4CXFA 1U78A 1LOJA 5GAN8 1EH7A 3IL2A 1OYIA 3UGQA 4EX5A 1S7OA 1U5TC 3M7GA 2P5LC 2RB6A 3MEYA 2WC2A 4XTYA 2G4CA 1U2WA 4I02A 4UVCA 4M77E 4YP0A 5DD4A 1H4QA 3IKLA 4N0AC 2MC3A 3EFRA 4R1HA 4C8QC 1Z91A 4HX8A 5E20A 3EETA 1I27A 3KLOA 2ADUA 2ETHA 4IVNA 3U9GA 2CW0F 4ZYGA 4M7DA 1USSA 3HY0A 5LGTA 4ZTUB 1LDJA 2BE5F 1K79A 3KFWX 2DBBA 1W7PA 5LBQA 4P74A 1IXSB 1ZAOA 4LNSA 5D6FA 3IRQA 4RGXA 3TGNA 2L02A 4L9NA 2YHTA 1PYSA 4YIIA 2CJAA 4CICA 1YS7A 4F7UB 3IKTA 3KEQA 1R1VA 3F6VA 2PQ8A 1MGTA 2J3MA 4M72A 4EJUA 1ZREA 4IF4A 3FM3A 2FBKA 4H2YA 3MCZA 1G51A 1V3FA 4ENKA 2ZXJA 3MEXA 1PDNC 2E7XA 4CHUA 5LRSA 5GAMe 1XGSA 2YLBA 3V7SA 3TQNA 2E1CA 3R0AA 3REXA 1G3SA 3JAMZ 1H9TA 3WTZA 1XGNA 2ZNYA 1RUNA 5D4RA 3F6OA 2ZZEA 4ESFA 3QU3A 2HTSA 1HXDA 4NCXA 4PCQA 4FHTA 3E5QA 5HS8A 3HHGA 5LRRA 3VQVA 5GMKe 2HYGD 3ECOA 5HLGA 1H4TA 2EFNA 1J75A 1TLHB 2Q0OA 3M9AA 4GO1A 3TO6A 5CYVA 4C8QG 1C0AA 3RIRA 2IPQX 4C8QF 3J81Z 5HDKA 3QAHA 4P55A 2QENA 4M77A 1PP8F 2FB7A 4P5OA 1YIOA 2HDCA 2HFHA 5BPDA 2P8TA 1EV7A 3LQQA 4RB1A 4P73A 4HDVA 2ELHA 3JCMd 2K27A 4YCVA 4YRLA 3GO5A 1LDDA 3NENA 4AWXB 5I21A 1R5HA 3E97A 1D5VA 5D8LB 3VQXA 1WNLA 2KKOA 1CGPA 3CO7C 1K78A 3W6JB 4A54A 5GAOn 1H4VB 2DU7A 4MTDA 1SETA 3SFZA 5D8KB 4CYDA 3L4GB 4J6XA 1SFEA 2RVCA 2F5EA 1LB2A 2IY5B 4Q6GA 3WU0A 5BS6A 2UXNA 2AMCA 4XLNF 4WWCA 2P7VB 2HWVA 3E6BA 2QLZA 4G84A 2H6CA 3HSRA 2JT1A 4X5OA 1WLEA 2XAGA 2MH2A 1E2XA 3VBBA 2F5DA 2PMFA 2DQ3A 2FXAA 2QYOA 5AIQA 3KFUA 3VFZA 3K0LA 2E65A 1Z7NA 2DJZA 3SWNB 1L0OC 3HRSA 2VBYA 3K1NA 4RAYA 4LK1F 1I1GA 3RKWA 4IHSA 2VOOA 1IN4A 1UFMA 2PFBA 4HQEA 2F5FA 4DQ2A 2VBZA 1T0FA 2X0LA 1E1TA 4OLFA 3JTGA 2CFXA 5GAMj 3V4GA 3O6BB 4M78F 1IRGA 4ESBA 3L7WA 1FPQA 4YRCA 4HLYA 4G8XA 2HOEA 5GAOp 4YPFA 2AXLA 1QO0D 3DXJF 1WQ2A 2VC0A 2UWMA 1GXPA 1HSTA 1I8FA 4EGZA 1FP1D 3BJAA 1EFWA 1GVJA 2LNBA 1FLIA 2HGCA 2XGXA 3JCMP 1N9WA 4EJVA 2KRFA 4LLGF 3E6DA 4V2SA 3ROUA 3VOEA 3O2PE 2DPUA 4ZZDA 2I4MA 1Z6RA 4U88A 2STWA 1DUXC 3DV8A 3IRRA 3NELA 3WG9A 1UCRA 2ESHA 3ERED 3RKXA 2IA2A 3SHFA 4EMKA 2CYYA 3KEOA 1S6LA 2PBIA 4I0BA 1D3BA 5LJ3d 1U6GA 2FMYA 4MEXF 6PAXA 3DFGA 2Z33A 2FBHA 1WKMA 1ATIA 4HF1A 3QPHA 2VBXA 4UV8A 4QWQA 2Q8KA 1NYRA 4J5YA 4AIKA 5LJ5j 4HYEA 1NYQA 1Y0UA 3HYIA 1E24A 4Q48A 4P3PA 2PG4A 2XV4S 3ZMZA 4HZFA 1SD5A 2XVCA 4YG2F 5FD6A 2LF8A 5GAOl 2R3SA 2YX4A 4JQFA 4MHGA 4XTVA 3WTXC 4BNCA 5DDGA 1W5TA 2KIUA 2ZFWA 1BI3A 3BJUA 1HW2A 4NB5A 4C8QE 3ZMSA 2QBYA 2W24A 2ZGWA 2RV8A 1UHWA 3RJPA 4MGRA 4NQWA 4P75C 2RC4A 2XAQA 4WCGA 1VTNC 5FFZA 4ZIBA 2JTVA 3ERRA 1W5SA 1NJ1A 2XROA 2UZKA 2O8XA 1I5ZA 1FX7A 4U7DA 3HRMA 4XEOA 5ILVA 1TQMA 3V7RA 2CG4A 3D0SA 1SRYA 5CVJA 4GCVA 4XU0A 1B7YA 5GAMg 1NHAA 5TJJA 2K4BA 1IN8A 4JBAA 4KMUX 3L4GA 5HVQC 4XTWA 3HHHA 5HOOA 4NL2A 1I81A 3L00A 3BY6A 4A53A 2AKWB 2IY5A 3B02A 2HQNA 2ODRD 4XQ3A 2QHVA 1ASZA 4M6YA 2OQGA 1QNTA 4Y17A 5E8IA 5GAOm 2DW4A 3EQLF 4M9XA 2B0LA 3C18A 1X3UA 1FC3A 1FZPB 4UP7A 2DAOA 3GW2A 3H92A 5FB2A 3KLNA 3AAFA 1YQAA 4R79A 1T98A 1LJOA 2DK5A 1J7KA 4G7OF 2ZZGA 3WTVC 2VXZA 5DEQA 3I7FA 4PJOC 3KP5A 4XU3A 1SD6A 3HFZA 2W25A 2G7UA 1D8JA 3SWNA 1USTA 1XMKA 2VE8A 2GA1A 5JHUA 4WJ4A 3WODF 5JFRA 4ESJA 1FWZA 1WQ7A 2MA3A 3RTRA 3E9HA 1YTYA 3RDIA 4C92C 4A6DA 4ENMA 2OA4A 3VB2A 4YDQA 2IT0A 4M7DB 3I64A 1XDUA 1USYC 5LJ5g 2C8MA 3ZMTA 1O3RA 3SQNA 1TNTA 5LJ3h 1W7PB 4GYGA 4YFXF 2ZZFA 2MBFA 5E3IA 4HX4A 3I0TA 2ZIOA 1MKMA 1ZG1A 2DK8A 4HOBA 1PP7U 1MZBA 1BOAA 1OKRA 4KR2A 1CF7A 2M8EA 4C8QA 1TNSA 1KQ8A 4K87A 1IF1A 2DTRA 1KOGA 2CGHA 3MF1A 4CO8A 2ZNIA 2J3LA 3TEHA 3ZMVA 3ICAA 4GYIA 3HRKA 2Z9OA 1B6AA 2NAZA 3HXYA 4EM0B 1SFXA 3P9IA 3LFKA 1K6OA 4WK8F 4FX0A 1XN7A 1MJ9A 2ODRC 1XD7A 3BPXA 1MDMB 2VC8A 4ENJA 1QE0A 3V8JA 3FMSA 4H2TA 5ICEA 1RZ4A 3F8BA 2K57A 4LK0F 2XAFA 3QOPA 4MMLA 3EYYA 1ZGAA 4OIQF 4J6WA 4MQ9F 2A3SA 4PJOG 4OIOF 2E5AA 3QO3A 3I4PA 3JB9G 5KVRA 5HLHA 4I7HA 4PJOF 4TVAA 1R1UA 3GFIA 3JB9F 1HTTA 1ADJA 4FX4A 4LMYA 2ZT7A 4KIFA 2XHKA 1ZRDA 3M8FA 3NEUA 1LVAA 4C92G 3JAMK 5JI6A 3UFGA 2CGPA 4YRKA 1ULYA 4M77B 3LSTA 4M6XA 4C92F 1FBUA 5D5VB 2E7WA 2PEXA 2DO7A 4YFNF 4HWOA 1IAWA 1X56A 5HGQA 3PQKA 1FY7A 4PNOA 5GANd 3U2RA 1ZG5A 1YFRA 4M78A 2EL9A 4RGRA 5A2QK 4EQQA 3FZVA 2UXXA 4M9ZA 1QQIA 4KQEA 4G85A 4YRMA 3GX4X 2E41A 4S04A 2KIMA 4YCUA 4N0BA 3Q9VA 4XSXF 1RIOH 4S05A 2OZ6A 5CAIA 2XGTA 3GFJA 3JCMJ 5DY9A 3M4GA 1X01A 2HR3A 4KA4A 1KU2A 1B76A 5H20A 5K1XA 4O3MA 1Y96A 1W66A 3J81K 3TOBA 3V8LA 2AMCB 1VQZA 1GGMA 4M74A 4L87A 4L5IA 3RI4A 4EMHA 4R8HA 3JCMc 2RD1A 2ARTA 3ZP5A 3E6CC 3TOAA 1BBYA 1I6XA 5LGNA 1P4XA 1ZLKA 5CVIA 3BZ6A 1XGMA 1DPRA 4M7AD 2OAZA 1ZARA 2I2LA 5L3GA 2A6EF 5DCFA 4OINF 2DFIA 5F6FA 1R58A 1J2XA 4XRFA 1Z1DA 4P71C 1OR7A 2R7DA 3TDZC 4N9IA 2P6SA 5DD8A 5H6RA 3TUPA 2DQ0A 2DU5A 1FSEA 1YLFA 2VT3A 2V6CA 5IT9K 1N9RA 5K5RA 2V1XA 3RERA 1EVKA 3K1MA 1ADYA 2PMHA 3WTWC 4I09A 1FYKA 3HTUA 2HEOA 1ZGJA 4BHBA 2G7HA 3JCMV 2PI0A 1XCBA 3BJOA 3KZYA 2KIFA 3HTSB 2JRTA 4A0XA 1JJCA 1YB3A 2STTA 3HOSA 4PHCA 2FNPA 3A5YA 4OIRF 3JCMW 4RGUA 1F5TA 3MF2A 2ARUA 3HUGA 3F8MA 1MDMA 1YS6A 4M7DD 4H2XA 4CH6A 2D45A 1J59A 1KYWA 3QP5A 3PGGA 4GGGA 4B8XA 2ISZA 4NHJA 4M75D 2H6BA 4U0WA 2K7LA 2L54A 5GANh 1MJBA 1W7PD 4EMKB 1OYYA 1O7FA 4G9YA 1IXRC 4BAYA 4G7HF 5D5WB 2WV0A 4XBFA 4WXDA 1D3BB 5A2QZ 1G3TA 3SZPA 3PFIA 1LDKB 4H0EA 2ARSA 3RL6A 4EM2A 2M87A 3L09A 4QLCU 4PJOE 4RB0A 4A0YA 5J8CA 4ZH4F 1WYDA 2ZKZA 3F8NA 4M7AC 3WTUC 2XRNA 2O6GE 4M71A 1MGQA 4L9VA 1S7AA 4UP9A 1FYLA 3W6KB 2A61A 2DQRA 4JK1X 2OD5A 2QBYB 4HBLA 3G3ZA 4O2DA 4TQFA 1R7JA 3QU6A 1HK9A 4C92E 5LJ5e 4UV9A 2QTXA 2P4WA 2HKOA 1YFSA 4RMFA 4NOYA 3TDUC 3E6MA 2H09A 4TVWA 4KFCA 3EYIA 5K1PA 4EMSA 3KP4A 3CO6C 4YRIA 2ZT6A 3H3UA 4EVIA 1X2GA 3R60A 2BEOA 4I2OA 5F1RA 1WRJA 3TEGA 1B7YB 4YRJA 5H6QA 2C7IA 3J7AO 5DUKA 3EUHA 5ICGA 4CH4A 1R1TA 2MH9A 3G1ZA 2AS5F 4KIGA 2EJRA 5D5XB 3V7CA 1B34A 4XU1A 2F2EA 4P75A 5IT9Z 5HLIA 4G6DA 3ABTA 3ZMDA 2ZMEA 4TV7A 4EJTA 4P72A 2KJBA 4HWTA 1IN5A 1EH8A 2RHQA 4M7DC 2TDXA 1HKQA 1FBSA 1V4RA 1ZLJA 3QUIA 4M77D 3WU1B 3IALA 4MQVA 2I4NA 2DXUA 3QHSA 4M75C 1O7LA 3ELKA 1HW5A 3SB2A 1O3SA 4P74C 1J5WA 2LDUA 4QVDA 1M8VA 12ASA 1YGBA 3HFZB 3K2ZA 2PJPA 3JCMg 1KU3A 1S3JA 2ZXFA 3WTSC 4PG3A 3LC0A 1H9GA 4TWAA 4HA8A 3REOA 3ZQ7A 5D6EA 5J6XA 4H2WA 3C7JA 2WWYA 3P9KA 4UUVA 4HT8A 4I98B 1JXSA 3FX3A 3F72A 2Y0MA 4HV5A 5GAN3 1P4WA 4WF2A 3WTYC 2O0YA 3IC7A 4M7AG 4U7BA 2PLYA 5LJ3j 4Y91A 4CZZA 4G7ZF 3R6SA 3F8CA 4M7AF 5K1YA 3CUQC 4PJOA 2QM3A 2EFQA 3FHZA 3CUOA 3F3XA 4IRIA 3L2CA 3DEUA 2LKPA 2H94A 3GIBA 1CF7B 1E17A 2VOPA 4C8QB 1D3YA 1G3YA 1BM9A 3GZ6A 4L9JA 4MEYF 1KQ2A 2QUFA 4C92A 2QVOA 1BBUA 3TEHB 3GVAA 1YFTA 3REUA 3CLOA 4N9HA 4HF0A 4XLPF 3JSOA 4XEMA 1KQ9A 3MAJA 2Y75A 1S29A 3IKMB 3MWMA 4A2UA 2ZNZA 3WE3A 4RCCA 3QTCA 2VODA 5HS9A 3KP3A 1YG2A 1UB9A 3NRVA 2HKXA 4ZYEA 4LGWA 4MNUA 2HYFA 5AIPA 1H641 4RQEA 4I01A 3ECHA 1JRIA 2Z3YA 5GAMf 1Z7UA 3HIFA 3QP6A 3A32A 1I4K1 4PDKA 2MD5A 1TH7A 2HNIA 5D4SA 2ZT5A 1FP2A 1G3WA 3FMRA 3I71A 1KQ0A 2IP2A 1RIQA 4LG0A 1NNHA 4L9TA 4M75G 5ERIA 3IWFA 1LEAA 3HXUA 3HXWA 1B8AA 2DEQA 5HS7A 4M75F 1X2HA 2IVMA 5LLQA 4XTZA 2DLLA 4HT9A 1D8KA 3C1DA 3VQWA 2HQRA 4TVAB 4BWAA 2FU4A 2J5PA 2ZINA 1ZN2A 2A07F 2IW5A 5GAN7 3V8KA 1Z7MA 2HZTA 1EVLA 4RB3C 4AD9A 1G6NA 1EH6A 4IRHA 5FFXA 2EV5A 3HXXA 2RN7A 4OP0A 2RNJA 4K86A 3DP7A 4Q4ZF 5ICCA 1WPYA 5LJ3g 4HF2A 3T8RA 1T38A 4M78B 1OYWA 1U1TA 4BQAA 1IN6A 3HRUA 5GAOr 2ZTGA 5LJ5f 4UNOA 1P6RA 4H2SA 3GWZA 3F8FA 3L9FA 2GAUA 4X9CA 4LD5A 2GXBA 3FXQA 3FB9A 1H4SA 3VEPA 4HWSA 5F64A 4HWPA 2ZNJA 5L3DA 1BBWA 1LNWA 4BW9A 1R23A 4YIFA 4FT8A 1AWCA 2DQLA 2BYVE 1Y96B 4E51A 2K02A
chains in the Genus database with same CATH superfamily
2JTMA 4HNVA 3BW1A 3RMSA 2J5OA 1IB8A 3MJXA 1HOMA 4J6YA 2CMPA 4J9BA 2L2PA 1QQJA 4IX7A 3HRTA 4PUSA 2HQ5A 2GIVA 4RTUA 4XR6A 4GBQA 1U5TA 5J3BA 3P8VA 2COMA 2COYA 3IAS2 3MKYB 5EEHA 1OOTA 2EQJA 2XKOA 5GJVB 3CC7Q 4OU0A 4C5GA 2O3FA 2DETA 3LSHA 4L5JA 4YYEA 2XTIA 1IRXA 1QP2A 1V55H 2ALYA 2Q7GA 3G6EI 4L18B 4RTZA 3I53A 4M3DA 1HF0A 2KIQA 3C3WA 1XTAA 1FYMA 2FD5A 3KZZA 5CPRB 3BR5A 3PIPA 3MO8A 5E18F 3AHUA 2ZT8A 1XB4A 2LTOA 5FKKA 2VGNA 3M55A 2CRGA 5C3EJ 3GBQA 5FGMA 1ON1A 1VQNA 1D0YA 4V2FA 2MLKA 3P7NA 3Q5FA 4F7UG 4B9XA 4KNYA 5GMKl 4LLNA 2A6HF 2QQ9A 3J80Z 2D8HA 1E3PA 3G7ZA 2W4SA 5LHGA 2ENMA 3HFOA 4R55A 1IXCA 1IZ1A 2R92J 1VQ6I 2V7FA 2KRMA 3CCSQ 2JS0A 5CQYA 2QKLB 4BHCA 3HOVJ 1OMIA 2FJ1A 1WJAA 1YW7A 2Y9ZA 1XSVA 1TW3A 3ZQIA 4E7LA 2NOGA 2RNGA 1MH3A 2E10A 4FISA 1X2KA 3DPUA 3ZBDA 2IJLA 2V1UA 1P2FA 3DPLC 1A0NB 2E70A 1UJ8A 3RGLA 3UNGC 4GY5A 3CMYA 1LE8B 1QVPA 5M5XJ 3NAUA 2ECCA 3N05A 3BPVA 3DLMA 4PJMA 2XAJA 1ZA1B 4M75A 3IUOA 5B5EC 3CJNA 1YW9A 4HDUA 4A4HA 2CSOA 2D1HA 3G4ST 2XPUA 2IGMA 3FK7A 1KQ1A 1KMMA 3K4MA 3K69A 1XSDA 1A04A 2MAMA 2IA0A 1MNMC 1IN7A 5L3FA 1FOKA 1W0TA 2VYTA 4RB2C 2EV0A 1TZLA 2DZCA 2P84A 3CUQA 4RDXA 5IT3A 2DTOA 1BI1A 1M2VA 2RHXA 2EAYA 3IKVA 3PJRA 1PCXA 4B1RA 4OOIA 1PUEE 1D0XA 2Q7EA 1ZKGA 4ITVA 3BDLA 4HWRA 5BQTA 4LG0B 3BLYA 1VQ7I 2F5CA 1F4KA 4RKUE 2BTTA 1K0SA 4H02A 5FU7C 2JM9A 2JN0A 1QA6A 4AFSC 1SVMA 2BZXA 2OZUA 2WTEA 4PJLA 4RM3A 1SRMA 3UDCA 3G71I 3M0UA 4LVKA 1ODDA 2J06A 2YR2A 1WA7A 1ASYA 4FCYA 3RESA 4BJ6C 3JB9I 2XAHA 4CI0C 2RM4A 2NRAC 3GCMA 1K8AC 2XF5A 4C2UA 3CCVI 3EFOB 1D09B 3VODA 4AC0A 1NK3P 2H1KA 4ZNXA 4GXOA 3A7AA 1X6BA 5DYMA 4Z88A 4LUDA 3CMQA 1HA8A 2EQKA 2CS7A 3CC2T 2A68F 4KT5C 4BYYA 2P0KA 3RUXA 1U06A 4A12A 3CCJT 3VS6A 3CMEA 1B72A 3ISPA 3MQ0A 3QPLA 3KETA 1JHHA 2IS1A 3S2HJ 3OR1C 3BJ6A 2JUCA 2SRCA 5J47A 2H27A 2MF2A 2DOFA 1U5TB 4XSZF 4HCBA 3ABKH 3BR1A 1JGSA 1PM3A 3JRCA 5F08A 4B3XA 2BE9B 2JW4A 2GFUA 3R07A 3N5BB 2OPTA 4IHWA 4M9SA 4TTVA 2XF6A 3PTAA 2IGOA 5DCMB 3UT1A 4RLQA 5KAIC 1USYA 3OOUA 2MFZA 3M54A 3WGIA 2ALYB 3GP8A 4LVJA 3JRFA 4IJAA 4PLLA 2EA2A 3ML6A 4IQ4A 2D9TA 2RREA 4Y15A 4RCBA 3S3OA 1S8NA 3DQVC 1JHFA 3G73A 5GAMd 1O3TA 5J40A 4M7DG 1LJ9A 4ZJZA 3QYGB 3MFKA 2YXYA 2ZCWA 2E2IJ 3JB9D 4GLKA 3LSPA 2M0OA 2FEZA 3E3VA 1K9MR 1MSEC 3DPTA 3D5RC 4NBQA 3ZQCA 3BDDA 1BW5A 3EUAA 1M4ZA 4HNUA 1JKQC 3BWGA 4Z2YA 1E6GA 1UEBA 2ED0A 3G71Q 3FIWA 2E1MB 1PD1A 1T6SA 5J8FA 2FE3A 1SERA 1AU7A 2DEUA 1K9MU 2K9LA 5CO7A 1DQUA 2I4LA 1WZOA 5KNNA 3M0PA 2O01E 2LX7A 5LJ5d 1XJWB 1LUJB 2DVEA 4ELYC 2FPFA 1I1SA 1SSHA 3F22A 2H8WA 1K61A 2K40A 1KG1A 1MHNA 2JPCA 4P9UA 3N4MA 2WV1A 4E7JA 1K73C 1T56A 1PVEA 2LP0A 1HSJA 3T9NA 4IEJA 2QK0A 4PK4A 2D2WA 2LSOA 1VQNI 1QGPA 2ZPHB 1HBXG 1ETVA 1FSHA 4O6JA 4J9HA 2OTLA 1ETKA 3OYFA 3A0BC 3OW2S 1YITA 2X6WA 1HW1A 3KPHA 4M75B 3D5LA 1BC7C 2RHZA 3E9GA 1TWFJ 3H3VK 2JTEA 1SD7A 3G4SA 2XSJC 1GXQA 4LVMA 3EFSA 2DIGA 4P3OA 2PTKA 3O5ZA 4HVVA 3OS5A 3NARA 4YRFA 3QDFA 4ZYHA 4D0PA 3CUQB 3SZGA 1IGUA 2QCOA 2OX7A 4D5CA 4XKCA 1X43A 1M2VB 4JRIA 1RUOA 3I4NJ 1J9IA 5HK0A 4KH1B 1SHGA 1QCNA 4OWRB 2R7XA 5EZHA 1WI7A 1EZZB 1SF9A 3A8GB 2E1NA 2CDTA 3L1PA 4RMNA 1RC9A 5TRDA 3AL0C 5J3LA 4RTXA 5F27A 3TO9A 2BV6A 1HKSA 2WAQA 1Y7XA 5IHIA 2DL5A 1KGSA 3KE2A 2UUZA 4NC6A 4BH9A 3FXLA 1LEBA 2HQEA 1Z9QA 5GANf 4JX6A 3GEZA 1QKWA 1D0ZA 3M59A 1MD0A 1IO2A 3LGFA 3VRZA 2FF4A 2M8GX 3K4CA 2YRVA 4UB6C 4RMOA 2KYMA 2JA8J 2VJ4A 2WADA 2ECZA 4M3FA 5F04A 2P5LC 1HLVA 4KGXB 3CC2A 3MEYA 1U2WA 1NG2A 2M7AA 1B72B 2ZJRF 5DD4A 1H4QA 3EFRA 4A3GJ 4HX8A 3HOXJ 1I27A 3KLOA 2ADUA 4A4KA 4IVNA 3CCJA 5LGTA 3C2GA 3HKZA 2BE5F 2ZSIB 3KFWX 1X3ZB 2HKNA 2LK2A 5LBQA 1IXSB 2F1LA 3IRQA 4UC4A 3TGNA 2L02A 4L9NA 1PKTA 3A1PA 2FG0A 4CICA 1YS7A 2HOSA 2K9GA 2PQ8A 3ZRGA 1NYFA 3H41A 4XRMA 1WHLA 2FBKA 4H2YA 3J81E 4FQGA 3MEXA 5GAMe 4CHUA 5LRSA 5IH2A 3V7SA 4RTTA 3M53A 2IG0A 2WA0A 3JAMZ 4RAFA 4F16A 1RUNA 3F9KA 5D4RA 4FU6A 4ESFA 3QU3A 2DJNA 3OS2A 1RKWA 4OGCA 1YI2T 3E5QA 3CD6T 4BEHA 5KHDA 1FTTA 3CMEI 5GMKe 5IT9E 2LG4A 1H4TA 3X24B 2HL3A 3FRNA 4C8QG 2EKHA 1TUCA 3TCJA 2IPQX 2OV7A 3KX2A 2EILH 4P5OA 3HXLA 1EV7A 3JCMd 4E6KG 1GRIA 1S9HA 1UTIA 4YRLA 1LDDA 3OW2P 4PJNA 1YP5A 3E97A 5D8LB 1WNLA 3ZQHA 3SFZA 4CYDA 1SFEA 4WCIA 2F5EA 3FK6A 3PNWC 2K2VA 1OR7C 3JSCA 2AMCA 3JRZA 5KE3A 3HSRA 2JT1A 1UGVA 4X5OA 4HCKA 2H1LA 2F5DA 2PMFA 2DQ3A 1U9OA 5AIQA 3KFUA 3K0LA 2E65A 1Z7NA 2DJZA 3PFYA 2WSFE 1KZHA 3UA6A 3HRSA 2D0NA 3QQAA 3K1NA 2DA3A 4QPQA 1I1GA 3RKWA 2CP7A 1IN4A 2YUNA 4HQEA 4DQ2A 1LVKA 1WFXA 1E1TA 4OLFA 2CFXA 1H8KA 3QKJA 2HOAA 4BU2A 2JUFA 2K79A 4M78F 3QZ9B 4ESBA 3L7WA 1FPQA 4YRCA 1N75A 1EFNA 2LRQA 4NS5A 4YPFA 1UHSA 2AXLA 3DXJF 2VC0A 2UWMA 1HSTA 3BJAA 1FOXA 1EJ9A 2LNBA 2HGCA 3HHTB 3JCMP 2BW3A 2KYBA 3VOEA 3OWTA 1QVTA 1JTXA 1JU5C 1Z6RA 4BKXA 1M1KC 3NELA 3WG9A 1OQKA 3ERED 2NXNB 2HQAA 3SHFA 4XQFA 2PBIA 4I0BA 1BJZA 5LJ3d 4MEXF 3KXTA 1NLPC 1YJWT 2KXDA 4QWQA 1NYRA 4HYEA 1Y0UA 3EGUA 3ZMZA 1X2QA 2XVCA 5CK9A 2LF8A 3G1MA 3SJMA 2RJEA 3EUHC 4XTVA 5DDGA 1W5TA 3PO2J 1BI3A 4CUGA 3QYEA 1HW2A 3ZMSA 1WJ5A 3TMOA 3KYCB 2JXBA 1VTNC 4FE4A 4DOVA 5EZGA 2OTLI 3CXCP 1W5SA 1NJ1A 1YITI 4OVAA 1T95A 5ILVA 3V7RA 1SRYA 3I56Q 3HJEA 4XU0A 2ME0A 1B7YA 5TJJA 2DJQA 5FU7B 4E7ZA 5HVQC 4XTWA 5HOOA 1IDZA 1MBGA 1I81A 3L00A 4A53A 2F48A 2IY5A 2K3FA 2HQNA 2J6KA 3G4SI 1TWGJ 4Y17A 2CP2A 5E8IA 2K3BA 2LP5A 3BTJA 4M9XA 3TP3A 2B0LA 4FYXB 1X3UA 2DAOA 1TWAJ 5D6WA 4PJOC 2X3XD 3RSNA 3VYUB 5FKMA 1USTA 2VE8A 2MIOA 2CFOA 4C3HJ 1WQ7A 3E9HA 4VUBA 4ZGEB 1QVFS 3RDIA 2JS2A 4C2TA 3ZXSA 3OSVA 3ZMTA 5LJ3h 3BQZA 2ZZFA 2CH4W 5E3IA 2ESWA 1MKMA 3LH5A 1QU3A 4HOBA 1PP7U 1QWFA 3VV0A 4KR2A 1KOGA 2ZNIA 4V2GA 2Z9OA 2NAZA 2NUTA 1SFXA 2NWMA 1PNJA 3LFKA 1OISA 2VKEA 1Y39A 3FC3A 4ME7A 3OSSC 2VKDA 2QG9B 2ODRC 1XD7A 4ENJA 4ZN3A 1GCQC 5ICEA 2K57A 2M0CA 4LK0F 2XAFA 2HQHA 4N4HA 3META 3BC8A 2KE9A 5C0MA 3AG1H 3RR6A 2O31A 2ZZDA 2ZPBB 3CC2I 4BEHB 4OIOF 1IHWA 3I4PA 2PQWA 3JB9G 4PJOF 1YI2A 5B66C 3CD6A 1R1UA 2E4HA 3NTKA 1QVGS 1JJ8C 3CCJI 1ADJA 4FX4A 4LMYA 5M3MJ 2ZT7A 2QASA 4JZ3A 3DBHB 3M8FA 3RQIA 2DPPB 5D5VB 4XOPA 2OTLQ 4YFNF 1X4OA 1X56A 1Y71A 3MP8A 4F91B 1YITQ 1APLC 3SD4A 3RDVA 2ZPGB 4M78A 2EL9A 1WH7A 3M1CA 4M9ZA 2ROLA 3EH1A 4LVIA 4YRMA 3GX4X 2E41A 2KIMA 1AT1B 1RIOH 2I10A 5CAIA 2DD5A 3W2AA 1X01A 1KU2A 3EH2A 1B76A 2MABA 1Y96A 2CSQA 1W66A 4L59A 2AMCB 5J4VA 1VQLT 2LYCA 4M74A 3JR9A 3JCMc 1T8IA 4X34A 1IUFA 1P4XA 1ZLKA 1XGMA 1JXMA 4M7AD 2X4XA 3PFSA 4BY1J 4OMLA 1OR7A 2R7DA 3CDIA 1N5ZA 3TUPA 2DU5A 1FSEA 2VT3A 3UKGA 1JJ2S 3ZCOA 2OC6A 3QYBA 3LX7A 1SVLA 2PI0A 3KZYA 3JRAA 2KIFA 1UFFA 1N8RR 1YB3A 1XG1A 2L3SA 5AT1B 1QWEA 4PHCA 2BW3B 3A5YA 4RGUA 2HD0A 1YIJA 1UG0A 3MF2A 2ELKA 4ZDLA 3X2QH 1YS6A 2DDBA 4J7FA 1NM7A 2D45A 3QP5A 2E2JJ 2RHYA 4B8XA 4NHJA 2IXSA 2BOLA 1ENHA 2DL8A 1O7FA 4G9YA 1IXRC 1GV5A 4BAYA 2WV0A 2LX9A 1N8RU 3PFIA 4EM2A 1GBQA 1GV2A 2HXIA 2KT1A 4JS5A 2I5UA 2R5AA 5KYYA 3ASNH 4DOZA 1YJWA 4RB0A 3CC2Q 2LT1A 4CZCA 4L9VA 1FYLA 1Y1VJ 3X26B 4JPBW 4JK1X 1VQ8Q 2M9UA 2AHJB 1QVFP 4RMFA 4NOYA 4TVWA 1VQ9Q 3EYIA 4EMSA 2HVSA 3HC7A 3H3UA 5GPAA 4EVIA 2BEOA 1B7YB 4Y92A 3EUHA 2L0AA 1VQMQ 4CH4A 1X75C 1B34A 3WG7H 4D1QA 2MWPA 2RJCA 5EDNA 5HLIA 3MEUA 3K4BA 2XICA 3CPWP 1QP3A 2KJBA 1IXDA 4HWTA 4AFZC 4M7DC 3QZ5B 3CF5F 1WX6A 4DEYA 1OX8A 4E7KA 4MQVA 2I4NA 3CP2A 4A4GA 1RABB 3CCET 1O3SA 4ATOA 3LFUA 5HLTA 2ZXFA 3H5RA 2LJ3A 4TWAA 4HA8A 1Q86C 2DYIA 4H2WA 3C7JA 2WWYA 2HPMA 2Y0MA 4HV5A 3I3LA 3WTYC 2DN0A 2VGMA 3OY9A 1X2MA 4XLFA 4PJOA 4IRIA 3DEUA 2A5WA 1HD3A 2H94A 4MDXA 4IUQA 5KCOA 4BUPA 1E17A 2CUEA 1D3YA 3GZ6A 4L9JA 2QUFA 1OCOH 5IOZA 2QVOA 3NMZC 3GVAA 1YFTA 2FVUA 1A31A 2JJ9A 1K4US 1KQ9A 4KISA 4A2UA 2VODA 5HS9A 1ORKA 2VPLA 2KL4A 3B6AA 1JJ6C 3GTKJ 2CYZB 3BTIA 3A32A 2FOWA 3VRYA 1NNHA 1F43A 4M75G 5ERIA 1WH5A 1X1CA 2DEQA 4LDWA 2DO3A 4XTZA 2DLLA 1WJCA 2HQRA 4BWAA 2DL7A 3CLQA 5CR2A 4AG1C 2FU4A 2J5PA 3NTHA 1O75A 2ID3A 2DVJA 3OYJA 2IW5A 1BCOA 1RLQC 2QXFA 4RB3C 2K3PA 1GCQA 3UWNA 1VQOQ 3GBGA 2NUPA 3F70A 1QRYA 2CUDA 2DD4A 2QKMB 3IAM2 5ICCA 4HF2A 4M78B 4BQAA 4F3QA 4CRIA 2YDLA 3KFVA 1P6RA 2WACA 1WHMA 3F8FA 2GAUA 3KYDB 4LD5A 2GXBA 3FXQA 1HC8A 4HWPA 4MO7A 2MGQA 1D1CA 1Y96B 4E51A 2RQRA 2RK2A 4XK4A 3DB4A 1Q7YR 4ZN1A 3JB9H 1KQSS 3H8ZA 1B9NA 3LSRA 1VYTA 1VQLA 1KONA 2MMPA 3S2DJ 3VU3C 2Q2EA 3W3CA 2ICWG 3B6CA 2MLGA 1K9AA 2PZ1A 3RZDJ 3I5SA 4L0ZB 5K5QA 1YI2I 2EV6A 4ON0A 2VE9A 2ZR3A 3CD6I 3DKWA 2KR3A 4M7AE 1JUPA 2YSQA 4HVCA 3BP8A 1Z9ZA 1Q7YU 3QPTA 4IXAA 2F6CA 3GMEA 3GLLA 3CEYA 2R5YA 4MTEA 2DL3A 1LQ1A 3J80E 1Q82C 5GAN5 2CO5A 3ABUA 1W2BS 4P5NA 1ETYA 3JCMb 1RAHB 3HBLA 2IRFG 1QZYA 1W0UA 3P8DA 4WX9A 4JX4A 2OJED 1KA8A 2L4MA 5KNLA 1WQWA 4LE9A 1WJSA 2FRHA 3CMMA 3GXOA 2LQKA 1U0JA 2XB0X 3D5SC 4J9FA 2A0FB 3S17J 1K6YA 2EFWA 2EPDA 3M4OJ 2DA5A 1WSUA 2A5YB 1IV6A 1DDNA 2IS2A 1JE8A 1Y57A 2DA6A 4CC3A 5K7HA 2R7ZJ 1M3CA 2CUFA 3UH0A 3CC7T 5M9OA 1WI9A 1RNLA 1XNIA 2SEMA 4ZYDA 2DXTA 3A7RA 3KCCA 2OQRA 2ZB9A 3F0CA 4Y13A 3LWFA 2FRYA 1MJAA 3H9GA 4HRIA 5KE2A 1XSXA 1Q81U 1SMTA 2VXEA 4DYCA 3SWNC 4XNFA 3BROA 1B34B 1VZ0A 4KBMB 1YIJI 5M3FJ 2X51A 5GMKm 2LJ1A 4QPOA 1YN8A 3CCMQ 4AIDA 4JP0A 4BJ5C 3THKA 3HOTA 1NE8A 2IGNA 4FSXA 1B59A 4Q15A 3CCEA 4M78D 3E19A 2W84A 4CS2A 2LY1A 1YJWI 3R61A 4UPAA 3FJPA 1NJ5A 2RA2A 3RQ4A 2M5WA 3LH0A 2OBPA 3EHQA 1HKTA 4E70A 4PJOB 1XMAA 5C4XJ 1PRMC 3HOYJ 2QHSA 4XLEA 4IIOA 2DT6A 2YSRA 3MEVA 2RHIA 3HDDA 1KMNA 3JW4A 2M1BA 1W36D 3PM1A 1YOVB 2Q5HA 1X1AA 3GF2A 2L4AA 2EGCA 2W57A 4DIQA 2ABLA 1UELB 2QHUA 4KIBA 5JLWA 3ZEHA 1WHGA 4CCJA 4EGYA 4CCOA 1KD1R 4YCWA 4U0VA 2Q7HA 4DEXA 2DA1A 3PCOA 3K7AJ 3I59B 3WGHA 1T0HA 3IHUA 5H2FC 5FD5A 2KZVA 1KQSP 2W48A 3A8OB 1OFCX 2P81A 1Y1WJ 4G94A 1K7AA 1SEMA 3H5AA 3DF8A 3UF4A 1KD1U 4P3NA 4UXNA 2B7EA 4CH3A 4F17A 4ZZLA 1Z0XA 4HPQA 1K76A 3H36A 3JTHA 1IJWC 2EQUA 4OIPF 1AOYA 4PSXA 1PC0A 1WHHA 3LAPA 1SFKA 3I55T 1Q1VA 3QWXX 2V79A 2RGVA 1VIFA 4X0GA 2DMTA 4CS3A 2DT7B 4K2EA 3P5JA 1YIJQ 1YO5C 1W2BP 3TQ7P 2P4RA 2CV0A 3MZHA 2CIMA 4MZMA 4YRNA 2HL5C 1XDSA 1FMKA 2RDPA 1O3QA 3OQ5A 2DBKA 4ELZC 3AFHA 2VJJA 1RACB 1X19A 1TP4A 1I6HJ 3P8TA 1ZHIA 3GNGA 2H8RA 3RPQA 2HAXA 4P1WA 3H1CA 2HCKA 2Q2EB 3RACA 4EJOA 2LLKA 4FT4A 1IW7F 2FSWA 2P5VA 3K9TA 4OMPA 4B09A 4KDPA 5CJ9A 2KRHA 1SMYF 4LB5A 1SG5A 4H2VA 2BHZA 2E6NA 1RR8C 3FM5A 5IYCJ 3C95A 2PVGB 3A0HC 2GQIA 1GT0C 2R5YB 4N4OB 2XKPA 4W97A 3M1EA 4BI3A 1GFDA 2V9VA 3SEZA 3OIPA 4JJBA 1UGQB 3O3KA 1MIJA 3T5XA 1X55A 4ZTFA 5ELOA 1OPCA 1UDLA 4LN2A 3ZMUA 4CDGA 1DJ7B 2QYZA 1XGOA 5GMKj 3GFMA 2A08A 1IV8A 3K4NA 5CVUA 4OMYA 4AFUC 4JRPA 4O5VA 3OYAA 1B4AA 4PJOD 2PVDB 4FW2A 2CZ1B 4A4EA 3QO7A 3DTIA 2JUGA 4LD6A 5E3OA 1N77A 1VQLI 2FBIA 1G5HA 2P7CB 4LNPA 3VS1A 5LEKA 5IN1A 3RKYA 5GANe 2DX1A 2RF0A 1N25A 4UUSA 2E6ZA 4EMGA 3TW6A 2RQUA 4JRKA 4A3KJ 5TISC 2KI7A 1H89C 1BOBA 4RDUA 4LLLA 1GFCA 1Y8RB 5EYRA 3LSSA 2DRKA 1QVGA 4U0YA 1HYOA 1N78A 2MW8A 3CJQB 2GBQA 3P9CA 5A0LA 2ESNA 2M30A 1SANA 2V1NA 2QTVA 1MBKA 3DSQA 1LKXA 3LSKA 2ISYA 3GTQJ 3BZKA 3HM5A 4M73A 2K4JA 4AH6A 5IY5H 2CV1A 1J5YA 4RAZA 2PMZN 2EFIA 4BGDA 2E5KA 4BE1A 4WXHA 1U8BA 3VYTB 1NJ2A 4J7IA 2WB1N 3BQYA 2VXFA 1X6OA 5CKEA 1KYZA 1NJ6A 3IWZA 3UGTA 2CQ7A 2K4YA 1WHUA 2XMFA 2DZ9A 3BDUA 3W6VA 2NVTJ 2L7ZA 1F1ZA 4M78E 1VQPT 1A35A 1FIPA 1PYSB 5CKFA 4G6TB 4P71A 3AG4H 4GLMA 4D5FA 1SPKA 2HZYA 5IP6A 2RO0A 2EA4A 4NL3A 3IH2A 1UB4A 1J0RA 1JJ2A 1YJNA 1TTHB 5GAOq 2QWWA 3PE0A 2KJCA 3JCMQ 4HEA2 2JPBA 4IO9F 1ZG3A 1MNEA 1OJLA 2FO0A 2QSFX 4DPGA 3QSUA 3DLAA 4DNCA 4QKUA 5DM6F 2LMJA 3CBPA 4CGZA 3CQTA 3NQOA 2QQAA 3CCEI 2YWWA 3I5UA 1R71A 2GLOA 3OS1A 5C51B 3EAEA 4L5EA 5CQXA 4D7MA 2KLOA 1XMXA 4IRGA 3NEMA 4BXUA 4YRPA 2HTJA 1Z05A 3LWIA 4A3EJ 2DMPA 1WU7A 3PIOF 4XTUA 3JSPA 3TEEA 4HCCA 2WY8Q 4A63B 4OMQA 2AKWA 1YE9A 2CQXA 2AKLA 4ANJA 1YFHA 4PJJA 4AIHA 1FYFA 1VQKQ 3PUBA 3I55A 4F92B 4X9DA 1YW8A 4F52A 1M90U 2XRLA 4RQFA 1PYVA 1TTYA 1WWXA 1ZRFA 2HQXA 2ZR2A 1FYNA 1JTYA 3WE2A 1U78A 1LOJA 2EYYA 5GAN8 1OYIA 1U5TC 2RB6A 2WC2A 2PJRA 8AT1B 3VSKA 1SAUA 4MIMA 1WXBA 3EGDA 4M77E 1QW1A 4C3JJ 3IKLA 2MC3A 2CQNA 3JAME 1Z91A 3EETA 1NLOC 1GL5A 1PHTA 4XICA 1R6RA 4PFZA 5I22A 1USSA 3M9QA 1K79A 4P74A 4LNSA 3ZR8X 4OMMA 1JKOC 1RUWA 2DOEA 3LWHA 2HVQA 3IKTA 3MEWA 1GCPA 1R1VA 3Q3SA 1MGTA 2X1CA 4CCKA 1M1EB 4EJUA 4ZDPA 2WSEE 1ETWA 1BR4A 2N8GA 2ZXJA 4HNTA 2YLBA 2E1CA 5JHFA 3R0AA 3H0FA 3REXA 3MKZA 3LSIA 4BD3A 1MBFA 3VS4A 4EATA 2PMZA 2NLUA 2X1EA 3H6ZA 4UY8I 1PG5B 3PMIA 2KEAA 2GCXA 2V9PA 2WB1A 3L2VA 2Z16A 3HHGA 5LRRA 4C5HA 1WJEA 4GFBA 4GO1A 3RIRA 4UUSB 4OB0B 3QAHA 4P55A 1PP8F 5IOYA 2HDCA 2HFHA 4A3CJ 2P8TA 4HXJA 4YCVA 2ID6A 3GO5A 1CGPA 1K78A 3PVQA 1GUUA 1H4VB 3OBWA 2OCEA 2DU7A 4XRSG 2GNCA 1K9MC 3DKXA 2DODA 2L5QA 3L4GB 2RVCA 1LB2A 3M0SA 3WU0A 4H4KC 4WWCA 2HWVA 3E6BA 2QLZA 4XOTA 3MKWB 2H6CA 1ZUKA 2LCSA 3FHNA 1WLEA 2XAGA 1HSQA 1E2XA 4PKCC 3AKZA 2QYOA 3PSIA 2AZVA 3VFZA 2D5VA 3OYKA 3SWNB 4J9CA 1L0OC 3TL4X 1CKBA 4PL6A 1JT0A 5DS9A 1JO8A 4IHSA 1UFMA 2PFBA 4BI8B 2F5FA 3LOCA 2LOOA 2MI6A 1T0FA 2JTFA 4Y4RA 1K4TA 3CDLA 1IRGA 1V54H 4HLYA 3FXJA 4G8XA 2HOEA 5IYDJ 2LREA 1WQ2A 1ABQA 3CCYA 1H92A 1VQPA 1KIKA 1YWPA 3D7SB 1EFWA 3CCLT 2E36A 3E7LA 4D8KA 3E6DA 2LNHB 4OB2B 3SFIA 3R6OA 4C0FA 3SYTA 3PIOA 4II1A 2I4MA 2HMAA 4U88A 3VS0A 2GOXB 2EYQA 3H0HA 3DV8A 2IVWA 3S1NJ 4BDYA 1GDTA 2CYYA 1NJIR 6PAXA 2A3LA 4B44A 1WKMA 2XD0A 2HDAA 5E3MA 2EBIA 1RETA 4L6V5 2DRMA 3J7YJ 4FM4B 3DCFA 4HZFA 1SD5A 4OGEA 2JRMA 5GAOl 1PJRA 4JQFA 2FL7A 2OAUA 2KIUA 3BJUA 1NH3A 2RV8A 2KSSA 4MGRA 1ZTRA 5FFZA 1NJIU 1TU0B 3ERRA 1ARKA 1FX7A 3D0SA 4MZTA 1WIEA 1X6GA 4JBAA 4KMUX 4NL2A 4RAGA 1UHFA 1YBYA 2AKWB 3A8LB 2QHVA 2CJJA 2OQGA 1YJNI 1EX4A 3W2VA 3M07A 1FC3A 3KLNA 4R79A 3HOZJ 1ETQA 1T98A 1LJOA 2NYSA 5DEQA 1S7EA 2QDLA 1UAAA 2W25A 1XMKA 2PJRB 3QYFA 2CP3A 1B07A 1FWZA 3EGDB 3OBYA 2MA3A 3RTRA 5EJCA 1MBJA 3M4YA 5HODA 4ENMA 1FEXA 3VB2A 2IT0A 3SDBA 1XDUA 1USYC 3I56T 1VYVA 2X9DA 3JREA 1CF7A 2M8EA 4CYCA 1IF1A 3CF2A 4CO8A 2J3LA 3ZMVA 1B6AA 3P9IA 2CW8A 1K6OA 4FX0A 1MJ9A 3BPXA 1J09A 3I55I 4B47A 4FIBA 3HG9A 2VC8A 3V8JA 3FMSA 1X69A 3FDRA 1RZ4A 3MZ8A 2RH2A 2M3AA 3URGA 4OIQF 2LR8A 2QA4Q 4MQ9F 2A3SA 4PJOG 3UPUA 3GTOJ 2E5AA 2EYXA 2IBDA 3KZIC 1H3HA 1VIEA 5CCAA 5FLVA 3NEUA 3UFGA 2CGPA 1ULYA 3GTMJ 2PEXA 2V1RA 3E2UA 2COBA 3PQKA 3EHRA 3TSZA 1RPWA 2HVRA 1FXXA 1XS9A 4G85A 4S04A 1CSKA 3Q9VA 4S05A 1LPLA 4MZPA 2XGTA 3JCMJ 5DY9A 3S1QJ 3OYGA 2HR3A 4O3MA 1OV3A 1YJNQ 2R7VA 3TOBA 3V8LA 2NUZA 2RI3A 3CBMA 4EMHA 5KAFC 2ARTA 5LGNA 2K3YA 1DPRA 2O2OA 2F2VA 2HSEB 2BZYA 5L3GA 3A01A 1NPRA 2DFIA 5EGOA 5F6FA 1YWOA 3EG0A 2CUBA 3I4MJ 1Z1DA 2HI3A 1TUDA 2OTLT 2CQQA 4N9IA 2P6SA 5DD8A 5H6RA 2V8KA 1V76A 2DQ0A 2VUMJ 1YITT 1B7TA 1EVKA 1TT5B 1ADYA 2PMHA 3U1KA 3HTUA 2HEOA 2G7HA 3JCMV 2Q1ZB 3BJOA 3HTSB 1JJCA 1NEBA 1MUZA 1VI0A 2G0EA 3DBLB 4C0DB 2FNPA 2M51A 2AHQA 1F5TA 3CCLA 2ARUA 3EPZA 1MDMA 4H2XA 1FOYA 1J59A 2XDDA 3PGGA 2K7LA 3ABLH 4OF1A 3I55Q 1OYYA 1RR7A 2MD0A 4J9IA 5D5WB 5A2QZ 2ARSA 3MP6A 4ZGJB 2CKKA 1G83A 2HU9A 5CQEA 4QLCU 3FJ5A 4A0YA 5J8CA 4ZH4F 4M7AC 2XRNA 3PVLA 4M71A 5FJ8J 3QDRB 4UP9A 2A61A 5HNFA 4O2DA 1JKPC 4TQFA 1R7JA 2VUBA 1HK9A 1WCMJ 4C92E 1Y07A 2VPRA 3TDUC 2HXOA 4KFCA 5K1PA 3KP4A 2KBTA 2CH4A 2LT4A 3MPUB 4DW6A 2O5RA 1X2GA 3R60A 5DLOA 1WRJA 2C7IA 3J7AO 1VQPI 3G1ZA 1H88C 1BR2A 3BE3A 3ZQLA 3V7CA 1V1CA 5EEAA 2FEIA 5IT9Z 2DXCA 4G6DA 1AHJB 3ZMDA 3EG1A 4P72A 3S6WA 1IN5A 1EH8A 2BVLA 5D7UA 5TGTA 2ZJPF 2RHQA 2TDXA 1FBSA 3WU1B 3QHSA 1NEGA 1HW5A 1S72Q 1J5WA 2BIVA 1M8VA 3TEDA 4FYVB 1H9GA 1VQ8T 5D6EA 2XDPA 2EZIA 5J6XA 2BHYA 3WHBA 1AEYA 3P9KA 3OYMA 1LFUP 4RTWA 1VQ9T 2CZ6B 1RRJA 2O0YA 3IC7A 2DMQA 1XOVA 2KROA 4G7ZF 4JYKA 1FOWA 3R6SA 1D5YA 4M7AF 2QM3A 2EFQA 3S8PA 4A3DJ 1VQMT 3FHZA 3CUOA 3I56A 2LKPA 3EGXA 1JGGA 1CF7B 5FW9A 4CYCB 2WAQN 3H35A 2K9NA 1ZSZA 3TW7A 5J39A 3REUA 2ME6A 3DB3A 5JVGF 4XEMA 3ZQGA 2Y75A 2DFHA 3MWMA 3TREA 3QTCA 3KP3A 5CKBA 5IYBJ 2ZXIA 4I99C 1UB9A 3NRVA 3LGLA 2HKXA 4LGWA 4MNUA 4XONA 4ZYEA 4AG2C 3BG5A 4E47A 3ECHA 1Y56A 2KNBB 5GAMf 2GGRA 1I07A 1I4K1 4XL9A 4PDKA 2MD5A 1ITYA 4LVLA 3FXOA 2NS6A 1W4SA 5M5YJ 3JCUC 4XN3A 3IWFA 3HXWA 2B8AA 2IVMA 4HT9A 4E7HA 3C1DA 2W82A 5FWBA 1ZN2A 2DA9A 5GAN7 2HZTA 1EVLA 1G6NA 1KHCA 1IREB 1R0BG 3FXMA 1UZCA 2L0KA 2EV5A 3I5RA 3HOWJ 3NFCA 4AMCA 5F0CA 3HKZN 1H8AC 2BZ8A 5IXBA 3DP7A 3M57A 3T8RA 1T38A 1U1TA 1VNDA 1AD5A 3HRUA 2PX9A 5GAOr 1VQPQ 5LJ5f 4UNOA 2LQNA 4H2SA 3GWZA 4EEFG 4EDUA 3L9FA 3GTGJ 4AU7A 3FB9A 2XI9A 1H4SA 3VEPA 2KISA 3BTCA 1R23A 2DQLA 1TWCJ 2K02A 4KICA 1N9SA 2BXYA 4LIUA 5IHNA 1BIBA 4M3EA 3QRFF 3TKYA 5I11A 5E1XA 3PNYA 4RLFA 2LJ0A 2K5CA 1VQOT 4XLAA 2VBWA 5B1BH 3A01B 5EGOB 2YU9J 3WVEB 2CT3A 2D1XA 3O8HA 2RK1A 1TXQA 4PLIA 5GAMh 4KN7X 1EOVA 5C52B 2PUKB 4N0AA 2EB7A 4WJ3M 1YCYA 4F93B 2YT6A 2LC4A 1YX5A 1OU8A 2LKXA 1DU6A 1JJCB 1MH4A 2M16A 2DDZA 3Q0VA 4MFDA 2VN2A 2GF7A 2PMUA 1P9QC 4XTXA 4PFPA 5CLSA 1IDYA 2FQ3A 5GMKh 4H2XB 2X85A 1ZQ1A 2EJ9A 3OSFA 5GANj 4KMFA 2HKQB 3TO7A 2DILA 4XU2A 1R00A 2H3EB 3I54A 4PGHA 5GAEJ 2VB6A 5GADJ 1Q1HA 5LJ5h 1SRLA 2CZ0B 1N8RC 1T3SA 3I9V2 2K9SA 2JM8A 2GA2A 3UA7A 3GZ5A 4U87A 1X4PA 4ASNA 1NZ9A 4IZZA 4UHTA 3MD2A 3S32A 3MMYB 2JOYA 2DTIA 4PZJA 2JJ7A 2X6XA 2M9HA 1A6IA 4JUVA 2MSYA 5EG0A 2FA5A 3MCAB 2A69F 4M7AA 4XORA 4ZC3A 3W3SA 3HKSA 5GAN4 3LMMA 1Y0MA 4IIMA 5E8GA 1M5Q1 4N4GA 5J1RA 3LA7A 3CCLI 1G5IA 2EFOA 3KUFA 2RHQB 4A5NA 1Q82R 3CP8A 3DTEA 4G6QA 2LH9A 1JBMA 4G12A 2LC2A 3TU4K 3S15J 4YRRA 5GANg 1NBEB 1KK7A 1TSFA 3IG2A 2FPEA 1VQ8A 2DNUA 3CXCS 2DA4A 5EEGA 5FLMJ 3OB9A 4P9FA 4MLOA 1VQ9A 1BCMA 3HZJA 3PQJA 1G4DA 1RAEB 3CTAA 5B1AH 1UGSB 3EGXB 2K9MA 1VQMA 2GXGA 4KYWA 2Z1DA 3WVDB 2DYSH 1YRNA 3HXVA 3BR3A 1FNNA 3PZCA 3MHXA 3CCMT 3JCMX 1QMCA 3PT9A 2LDMA 4HSRA 3OR2C 3NGPA 3X25B 1P92A 2DM1A 4LD9K 4KN4X 4CS4A 1VA7A 2P0PA 1MNDA 4L5GA 1BYMA 3ESWB 1C0WA 1HDPA 1ZH5A 3HFNA 5FWCA 4C2MJ 4OMZA 4F7UE 3S1RJ 4WI1A 4M78C 3ZN0A 4YRTA 3RYRA 3CCQT 3B73A 3S93A 2E5QA 4Y52J 1RI9A 3RPUA 4YREA 2LRDA 5D5UB 3JCMf 1L3LA 2C0IA 3QNEA 1SHFA 2AZSA 2OTJT 3I56I 2MCNA 2DA2A 5IP7J 3CESA 1POGA 5ICFA 5GTIC 1BI2A 3FF5A 3OYCA 3GLXA 2X4HA 1W36C 1C6VX 2AQFA 1I0CA 3HXZA 3VUZA 3HRIA 1UHCA 3HSBA 4F04B 4CC7A 3CCLQ 1Y8QB 2F5KA 1X54A 4R56A 4FYYB 2JSCA 3HPHA 2TRTA 3CMAT 4XKVA 1LYLA 1ACMB 5FLXZ 2VQCA 2PU9B 2EK5A 5HKCA 3K1PA 2HSPA 5KCMA 3QO8A 2G3RA 2CWEA 3DEEA 1LE8A 2NVUB 2C06A 3EUKL 4KITB 1YCSB 1O4XA 3C12A 3T8TA 4YTLA 3M56A 5L3BA 4AYBN 1Z67A 4HW0A 2RJDA 5E1WA 2O88A 2L8DA 1VQOA 4HQMA 3NETA 4XAXB 2QF7A 5IXFA 1IGNA 2WBMA 3IH3A 3CCRA 1KFZA 1WXUA 3RYPA 1IRZA 1R36A 2Y0SA 1Q7YC 1KU9A 3L2ZA 4HAMA 2XDVA 1YIJT 2KZGA 3Q9SA 1H0MA 4HVWA 2GZWA 1QHGA 2CV2A 1QPMA 2DYBA 2O9SA 1J3TA 2Y48A 5C53B 2YPRA 5DM7R 3RF1A 3JCMh 1AOJA 1P4AA 5BNGA 4KH0B 4M77C 5DUIA 5LJ3f 2D1VA 1R4MB 1STZA 4BHPA 3SFMA 2I8DA 4BE2A 2FMLA 4WXCA 4P73C 4J8OA 3M4PA 3OA6A 3VS2A 5CQGA 4JX5A 2YX7A 1T39A 1REPC 2IIMA 3E5XA 1HDDC 4B4CA 3WQZA 2RAEA 2KK4A 3H0IA 3DBRB 1NPPA 2B63J 4K11A 2YRCA 3PO3J 4P96A 4IKFA 4MMKA 5K5OA 2VKNA 1WI3A 2YLCA 2QI2A 3L1AA 1ZBXA 3DU6A 3OYIA 4TVRA 2JNGA 2L9SA 2RKHA 5ELNA 3SZTA 1LNXA 1L0WA 2VC1A 2XGDA 3S3NA 5GPCA 2ZBKA 3BFMA 3EFOA 2GWRA 1O57A 3A31A 4M7AB 3GTLJ 2ZFUA 2OCCH 5KYNA 3S2WA 1D1BA 1RI7A 1ONVA 1IC8A 2DFEA 4HKEA 4TVYA 3BOQA 2Y69H 2R7WA 1Q81C 3EG9A 1ON2A 3A74A 4MDWA 4A3LJ 1G2BA 4UVBA 2CJBA 3JRDA 1RAIB 3VYRB 1BI0A 2EBPA 2CQKA 4YRVA 3OYBA 2QDYB 2VKVA 3BG7A 4M77F 4FE7A 1MMNA 3H5NA 2W00A 1ZELA 5CVVA 1CKAA 3LSJA 3K70D 1U3EM 2DERA 3FXRA 5DCMA 4KUIA 2GTJA 4EMKC 4RGSA 2XC7A 1X1PA 3GUDA 3FLGA 1GHCA 3OMGA 2EIJH 1WFWA 3GZNB 1ZK8A 1FBQA 1YRNB 3VS5A 3HTZA 2AT1B 3CPWS 3CCUT 2JQ7A 4QQ6A 3A98A 3LSMA 3HY1A 2QHTA 3CCMA 1FT9A 2OU2A 1QBJA 1GXIE 3M5AA 4M7DE 2ZPFB 4AYBA 3OYHA 3QWYA 4C8QD 2O8KA 1EQRA 1UG1A 5L3CA 5HDGA 2VQLA 1IZ6A 3HSFA 4LJZF 4BBSJ 2C6YA 2DI3A 3RKQA 4C5IA 3I9QA 3FKJA 2GXAA 4K88A 3IQLA 1VQ8I 4UUTA 2ZXWH 3CCQA 1BC8C 3LQRA 2JMAA 1B9MA 1VQ9I 1Z3YA 3J7AF 1KD1C 3N97A 3MKDA 2RQWA 3M0RA 3FWEA 4CH5A 2JVVA 2EZLA 1BW6A 1U5SA 1VQMI 3PNTA 1HC7A 2OTJA 1ABOA 1IL2A 2V9KA 1MV0B 2FNAA 1W1FA 2TCTA 3ZN1A 3RNJA 3FBIB 3I58A 1BIAA 1NJ8A 2V1DA 2EVRA 4D7NA 2QQBA 5CKTA 5LD2C 1V5GA 2ZJ2A 4ZTJA 1QVUA 4J15A 4IL6C 2DMUA 1PRLC 3IL2A 4Y28E 3UGQA 3L2UA 2VVKA 2KMTA 4QTRA 4NUBA 2G4CA 3CMAA 4I02A 4UVCA 4YP0A 4R1HA 1PUFA 1EKEA 4ZYGA 1S5LC 4ZTUB 1LDJA 5GJWB 2QEXT 2DBBA 1ETOA 1NYGA 1Q95G 1IO6A 4RGXA 2YHTA 5L23A 2KMUA 2CUZA 3F6VA 1TWBA 1VQKT 2ZSHB 4M72A 3FKIJ 1OPKA 1DU0A 1ZREA 3G6EQ 3MCZA 1G51A 4ENKA 2DLPA 4JS4A 2E7XA 3OIQA 6AT1B 3GOXA 1XGNA 2ZNYA 1SVOA 3H9QA 2R7SA 3KEYA 3IV5A 1HXDA 4PCQA 4FHTA 3MN2A 3WXMB 2HYGD 5HLGA 1FIAA 2V6EA 1J75A 1TLHB 2RQQA 2Q0OA 3TO6A 5CYVA 2KQWA 3OL3A 1C0AA 1C0MA 2LFBA 1WLPB 2O4XA 5HDKA 4C30A 2QENA 4M77A 1VQOI 4R0KA 5BPDA 3LQQA 2XHCA 4P73A 1VQ6Q 2ELHA 2K27A 3R6NA 2LVMA 4JLGA 4D8DA 3NENA 3CCRI 1D5VA 2VKHA 2KKOA 4PFOA 2KAFA 4BI4A 1KC8R 5GAOn 1WYXA 4MTDA 4BB7A 4J6XA 2JVGA 2IY5B 4Q6GA 1R8OB 2UXNA 4XLNF 5D6YA 3EG9B 5J4YA 4G84A 3G1JA 3RPUD 2OAWA 4S0HB 2LBFA 1KC8U 2R5ZA 1EF4A 3LLRA 2FXAA 2IGKA 2GFAA 4RAYA 3NWTA 4GRIA 1WJBA 4FASD 1M27C 2VBZA 2COWA 3PMTA 1SFOJ 2A05A 3E9FA 1U3OA 5GAOp 3OIOA 2LMDA 2EGEA 2KRSA 2XGXA 1PSFA 4EJVA 4LLGF 1MBHA 1NG7A 3ROUA 3O2PE 2DPUA 1AKHA 2LKSA 4ZZDA 3OW2A 2BE7D 2NUTB 2STWA 1DUXC 4Q5WA 3IRRA 2ZCFB 3QJYA 3PNVA 3CCUA 2ESHA 3RKXA 4EMKA 2FMYA 3DFGA 1AWOA 2Z33A 2FBHA 4J00A 3SHWA 1IG7A 1N6AA 2VBXA 4UV8A 2CU7A 2Q8KA 1NYQA 1GVDA 4HG2A 1E24A 4Q48A 4P3PA 1VQ7Q 1JT6A 2PG4A 4YG2F 2GIZA 2CSIA 2YX4A 4MHGA 3A8HB 2QGFB 4BNCA 2ZFWA 2NVQJ 3VDXA 4JJDA 4NB5A 2EQIA 2X35A 4C8QE 4XLHA 2ZGWA 3RJPA 2R7UA 3MQZA 4NQWA 4P75C 3TSWA 3HGGA 4WCGA 1OCPA 2ZMEC 2JTVA 3GTPJ 2XROA 2UZKA 3HRMA 1PKSA 1MSFC 2FHDA 1TQMA 3BZCA 5CVJA 9ANTA 1OX9A 2R4GA 1NHAA 2C0OA 3CCRQ 4BY6B 3OYNA 3CCVQ 3BY6A 1RAAB 3B02A 8ATCB 4XQ3A 4M6YA 2HZDA 3QBYA 5GAOm 2DW4A 4A3IJ 1JKRC 3EQLF 3C18A 3GW2A 1YQAA 2AKKA 2NVYJ 3CCMI 3SDGA 2DK5A 2QQSA 3S16J 4G7OF 1AHDP 1M90C 3WTVC 2VXZA 3I7FA 3KP5A 4UB8C 2R7RA 2G7UA 1D8JA 2GA1A 5JHUA 3LL7A 4KT0E 3WODF 4ESJA 4JZ4A 3BG3A 4E6RA 4OB3B 1G8XA 1M2OA 4C92C 1PUFB 4A6DA 4YDQA 1I50J 2VQHA 1V5EA 3I64A 4GDFA 4DBFA 3DKMA 2XB5A 2HEQA 5LFAA 3PSFA 5FKOA 3SQNA 4OMNA 2F5VA 4YFXF 2MBFA 4BS9A 1VQ5T 2QEXA 3I0TA 2DK8A 2E1OA 5A0GA 3CCQI 1BOAA 1GBRA 2G6FX 1W5CC 2DTRA 2CGHA 3CXCA 3MF1A 3ICAA 4GYIA 4IHXA 4CC2A 3HRKA 2DK3A 1VQKA 1JUMA 3HXYA 1AWWA 4XIDA 2WAEA 1OCTC 2XPWA 4YIRX 2OTJI 2JN6A 3V42A 3A03A 4WK8F 2VJ5A 4LITA 2AXTC 1ZBJA 1QE0A 3A8MB 3F8BA 4JJCA 4MMLA 3BR2A 3G1LA 3DTKA 4BQOA 1AZGB 2KRCA 1ZGAA 5KYUA 4D6WA 3G2BA 4NC8A 4J6WA 1W1WE 3CMAI 2CT4A 4I7HA 3BT9A 2F4MB 5KYYB 1ETXA 2EQRA 3KBGA 1ZRDA 1R4NB 3SEQA 2O4XB 3RZOJ 4M77B 3LSTA 3OS0A 4C92F 1FBUA 5HGQA 2Y4YA 1FY7A 2J05A 3A02A 4CA0A 4PNOA 5GANd 3U2RA 1BR1A 4B6MA 1ZG5A 4Y7NJ 5HK3A 2X1DA 4RGRA 5A2QK 3L2WA 3FZVA 1MMSA 2UXXA 3EG2A 1QQIA 4A93J 3QYHB 4KQEA 4XSXF 4FW1A 4B9WA 1ZR2A 5CKDA 3BG6A 4DYRA 4E4HA 1UGRB 4E7SA 3RCOA 3P8BB 3J81K 3HB9A 1VQZA 1GGMA 1SC7A 2QA4T 1W70A 4L5IA 3RI4A 4XK8E 1Y6IA 1VFCA 3TOAA 3Q1JA 2EZKA 2LBFB 2R5ZB 3BZ6A 2OAZA 1ZARA 1K83J 2I2LA 1X3WB 2K2MA 2A6EF 4QQGA 1VQNQ 1R58A 1J2XA 4XRFA 4P71C 3TDZC 5A2QE 4C3IJ 3UATA 3ASOH 2V6CA 5IT9K 3CC4T 3K1MA 3CZ6A 3WTWC 1FYKA 3S1MJ 1ZGJA 4BHBA 3C2HA 1XCBA 4DJAA 2JRTA 4A0XA 2KXCA 2PNIA 2FPDA 3CCQQ 1JB0E 2STTA 3HOSA 4OIRF 4OMFB 1OCCH 1YJNT 4OAZA 3HUGA 2RNAA 3DU5A 1AKHB 2IS6A 3F8MA 2HDDA 2GQVA 3NTIA 2OTJQ 4CH6A 3X28B 1KYWA 4F55A 4GGGA 3JRHA 2ISZA 4M75D 5GANh 1MJBA 4EMKB 4WXDA 1LDKB 2O9LA 4BUGA 4C5EA 3RL6A 1BBZA 3L09A 2K5LA 2R7TA 3CBOA 3HGYA 1WYDA 2ZKZA 3F8NA 3CMAQ 3WTUC 2O6GE 3A1YA 3HL2A 1S7AA 5IHKA 4A3BJ 4RTVA 2ZPEB 3QU6A 2BY1A 4NQWB 5LJ5e 4UV9A 5DTDA 2P4WA 4JJNK 1YFSA 1SKUB 2RN8A 1U9NA 2H09A 2NUPB 2L7KA 3CO6C 4YRIA 1NJIC 1TL8A 5F1RA 3TEGA 5H6QA 5DUKA 3L2RA 4XU1A 2F2EA 4P75A 3KYLA 2ZMEA 2BZTA 2JWTA 4OMOA 4A3FJ 3FEOA 1PD0A 3ONQA 3CCUI 4M77D 1ZLJA 2NVXJ 2DXUA 1O7LA 5AYFA 2JA2A 3SB2A 4P74C 4Y33A 3K2ZA 2PJPA 2OI3A 2RI5A 1WGSA 2I0NA 3WTSC 4PG3A 3LC0A 3REOA 4RTYA 2ED1A 3AG2H 4UUVA 4HT8A 4I98B 1JXSA 3F72A 4WF2A 4M7AG 3JRBA 4X1VA 4Y91A 2QQRA 2L3QA 2F5TX 2KDOA 1SEUA 1M1GA 3H0DA 1VQ5A 2VOPA 1G3YA 4IUUA 2PVOB 4MEYF 1XTDA 1A5JA 1QVFA 4C92A 1JXOA 2Y30A 3CLOA 4N9HA 4HF0A 4XLPF 4W1UA 3MAJA 2R7QA 2XK0A 3IKMB 1S72T 4RCCA 2RPNA 2LCLA 1YG2A 4XLCA 1H641 3JV3A 4I01A 2HBWA 2Z3YA 1Z7UA 3HIFA 1TH7A 1K8AR 5D4SA 2V1QA 3RBBB 3CPWA 1G3WA 3FMRA 4XN0A 4A69C 3C0CA 1LEAA 2KVQG 5KYUB 3CMEQ 4AT1B 4M3BA 5HS7A 1X2HA 1YHQT 5LLQA 3HPGA 5M5WJ 3VQWA 4DZJA 2P4TA 2ZINA 1I1JA 2CW7A 1Z7MA 2RI2A 2VIXA 1VQ4T 1X1BA 4XMYA 5FFXA 2AQEA 1K8AU 2RN7A 4FL6A 2RNJA 2QEXI 3OYYA 2B9SA 2XF7A 4Q4ZF 5FU6C 2V8JA 1HCRA 2YUQA 1NK2P 2MPXC 4X9CA 2A28A 1VQKI 1JQQA 2ZNJA 1BBWA 1LNWA 4BW9A 1M3BA 4YIFA 4FT8A 2BYVE 2XU8A 5KCHA 2JSPA 2VQGA 3KP2A 5JVTA 1G59A 4YRQA 1T0FC 1KJWA 4QSHA 3CCUQ 2L9NA 2QA4A 2GQQA 2VT2A 2V4JC 1FMWA 3ZOBA 2DPDA 3ZFJA 3REAB 1I5LA 4CCNA 2WY7Q 4BJTA 4C0DC 1I39A 2DE0X 1E3OC 3LSQA 4H2UA 5FO5A 1OPLA 2K86A 4JOMA 2RQPA 3JB9J 2K3XA 2NS8A 5J1UA 3DWLE 1AVZC 2XGCA 3GYHX 5FKLA 3CC4A 1H3ZA 3HSEA 5KK1A 2JA5J 2JT4A 4IUTA 1E6HA 1LCKA 3SXYA 3BY7A 4ZYAA 4ESRA 3K10A 1OEBA 3QO5A 1EIYA 1K0XA 2ATCB 3HFVA 2VONA 3HUGB 4EV0A 1VF9A 4E2FB 1AWJA 1RI0A 2E1HA 3P8HA 5LGUA 4XRSA 4CC4B 2NS0A 3LA3A 1Z21A 2KDZA 4JRQA 4KGZB 1E0EA 2QSHX 3PCOB 1KU7A 1WXTA 2DMNA 2BGCA 4B3AA 2E2HJ 3J7AY 4M75E 3HL8A 2J6FA 3H9JA 3JCMe 4CSWA 5LHIA 3A7UA 3GFLA 2M0MA 1DGRM 1F9NA 2DFUA 4LDUA 5LEJA 1TQIA 4F7UF 1K73R 4ORZA 2MG4A 5ED4A 3H3ZA 2F2XA 2NNNA 5BMZA 2V26A 3T0YA 4HV6A 1DPUA 2EH3A 1BU1A 1V5FA 1MMGA 4XKBA 2E64A 3MVPA 4PGGA 4FT2A 2QGUA 1UHMA 1CQTA 2IPOB 4HX7A 2QEXQ 2J7IA 3SDZA 5GTHC 1YFNA 1ZGWA 2R7FA 2LY9A 2P6TA 1DP7P 2VI6A 4LXCA 4C0GA 2MOXA 1K73U 2DMOA 3G4SQ 2JZYA 3ER0A 3QWLA 3E5UA 2BBYA 3R4KA 1TBXA 4I76A 2ZMEB 1U1SA 3OD1A 4RS8A 1ZUUA 2O61A 4KUMA 4BXFA 2DJIA 4II2A 5EF6A 2E3HA 3NWSA 3VJPA 2O03A 4CH7A 1MBEA 4CCMA 3VYGA 2OUMA 4F7ZA 2EJGA 1W4MA 2Y90A 4NC7A 3ERMA 4X6AJ 2JK3A 5HDNA 3ZGKA 1SD4A 4ENNA 1Z6TA 3ABMH 3LW5E 1XQHA 1XCVA 1QPIA 2IEKA 2BY2A 4MFEA 5AONA 1TQPA 4A6EA 4FSSA 4II3A 2XDBA 1YYVA 5GAN2 1M8MA 3WGGA 2W7NA 1UE9A 4L0YB 2LF7A 2YU3A 2JMWA 4BBRJ 2ZO4A 5FLXK 1E7OA 4C92B 2E3CA 5LJ3e 1F36A 4J9GA 4Q5SF 5BOXA 2CZ7B 1RESA 2Q5IA 4XM3A 4FETA 4CCLA 1YX3A 2F2WA 2RHSA 5E3NA 2Y9YA 3F21A 1S72A 4LB6B 2I4OA 3VPRA 5ILUA 2FZGB 4YEJA 1M1FA 4Q47A 2EGAA 2CP6A 2EWNA 2ACJA 2KT8A 5F0HA 4KR3A 1K4SA 4KT6A 2D6FA 4HLXA 3VQYA 5E1ZB 3CCJQ 4PJ0C 2CJ9A 3CDHA 5FLXE 3P8YA 1TW2A 1YHQA 2M4KA 5BPIA 1T0JA 1DP3A 2B86A 1OZ3A 3FXUA 4ZDOA 1B8IA 3OMYA 4I0AA 3R0JA 4A0ZA 3OL4A 2P5KA 3LA2A 1G2HA 2XSDC 1VQ4A 2ZIMA 3A4CA 2PMEA 3AL0B 2DKGA 4EIKA 1OLTA 5IPAA 1VQ5I 2YRDA 2M45A 4XKWA 2QZ8A 1SFUA 2HS5A 3A5ZA 2P0LA 4JDSA 4EJWA 2W85A 5ILSA 1SAXA 3INZA 2V8IA 3TBIA 2LY2A 3K4LA 1B70A 2DL4A 1FTZA 1ACIA 2CP5A 1T2KA 3PUFA 4DZPA 3WU2C 2A8EA 4YFKF 1UGPB 3FIFA 3IH4A 5LHHA 2BXZA 5K7ZA 2M02A 3X20B 4AM3A 3HTRA 2AK5A 1QZZA 4ETSA 4QQDA 3VKIA 2L9VA 2LD5A 4BQQA 1QVGP 3ULQB 1KQSA 4M78G 4AVZA 4B48A 4F7UA 1U8RA 2GM4A 2ZCEA 2QAZA 1S1NA 2Z5UA 4J9DA 11ASA 5CVRA 2M2EA 1EIYB 3H0GJ 1PSEA 5J1YA 4EO4A 3KP7A 2EIKH 5GAN6 4IPAA 2F4IA 3NPFA 5IAYA 3I59A 1QCFA 1O9SA 1B3QA 3ME9A 2DU9A 4M7DF 3O8GA 3TVTA 5E3LA 1W2BA 4IOAF 1UUEA 4EM1A 4OB1B 1TUGB 1MW7A 4AIJA 4YRSA 2FX0A 3K6GA 2X6YA 2QA4I 1UMQA 1ZQ3P 4C92D 3E9IA 3A2KA 3C4SA 3WTTC 2Z99A 3VSLA 1AA7A 2X6OA 3BR6A 4UVAA 2ZXHA 3QXEB 2D0QB 3QODA 2JA7J 2H8HA 2L3DA 2K5IA 4QIWN 1I3AA 4P72C 1JJ2P 4Z6YA 1Z9CA 4QVZA 3CC4I 2DFFA 5JR3A 2WAFA 4JLIA 2K7AA 1M9SA 5FKNA 3CPFA 2FYKA 1VQ5Q 1RAFB 3QIIA 4DBQA 3FMQA 3J80K 5I2MA 1RADB 1XPXA 5F5WA 5E17F 2EW3A 1ZYRF 4IHVA 3L2QA 1YJ9T 2DT5A 4M6VA 4IHYA 2FRWA