3RIRA

Crystal strucrture of biotin protein ligase from s. aureus
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Strucrture of Biotin Protein Ligase from S. aureus
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 102
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rirA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rirA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rirA02
3WE3A 4MNUA 3RKYA 3KZZA 1V4RA 5DD4A 2A3SA 1YFHA 4EMGA 1H9GA 4M6XA 4KR3A 3WTWC 3VFZA 4C92C 4XLPF 2HGCA 3MF1A 4BNCA 3SZTA 3ZP5A 1F1ZA 3HRMA 3E6MA 4YG2F 5CAIA 3BJAA 4M73A 3ERED 3L2ZA 1IRGA 2UZKA 4LB6B 3KETA 1SRYA 2PN6A 1YG2A 2COMA 4EJVA 2BYVE 1H4SA 1E1OA 5GMKl 1QF6A 4V2SA 3BDDA 4PZJA 4UV8A 5C53B 4YCVA 4GCVA 1PP7U 4EX5A 2YU3A 4WK8F 2FE3A 2V9VA 4F7UE 4BW9A 1O3RA 4QVDA 1Z7MA 1J7KA 2P4WA 3A5YA 2DVEA 4HOBA 4L9VA 2YLCA 4HV5A 1JGSA 4M6YA 2GA1A 4O5VA 2HQNA 2JN0A 2GIVA 5CVRA 3HSBA 2BV6A 1SERA 1YGBA 2VXEA 4RB3C 3U1DA 4M7DA 3P8VA 4LK1F 3CJNA 4RAYA 2HKOA 2KRFA 3HRSA 5FO5A 4ASNA 4AIHA 2P5VA 2VBXA 3KEQA 4OIRF 4J5YA 4P96A 4XTYA 1TLHB 1U78A 2C7IA 3JTGA 4PJOG 1BC7C 2H6CA 2IA0A 1B70B 2DI3A 2AKWA 2HR3A 1KU3A 1XCVA 1BM9A 5LJ5f 1P2FA 2Z33A 1USYC 2K86A 1IN6A 3AHUA 3WGGA 1G51A 5LJ5j 3HSFA 4YYEA 3HXXA 5HOOA 4WXCA 5K5RA 2GXGA 4XLNF 2L54A 3QHSA 1SETA 4P3OA 1BI2A 3K0LA 2M30A 3CDHA 1ZAOA 3OD1A 3V8LA 4HZFA 1CF7B 2YHTA 1YW9A 1WRJA 1U6GA 3KP2A 4M75G 3FHZA 4MMKA 4OMZA 5GANd 4IRGA 2I4NA 2V1DA 5LHHA 5F1RA 2UXXA 3I59A 3PCOB 2GWRA 4A12A 1T38A 1H9TA 2H09A 2MLKA 3PFIA 1B7YB 4B8XA 1I5ZA 2CYYA 4C92B 2MC3A 3SHFA 4XTUA 1P92A 2A6EF 1JJCA 1ZGJA 3WTYC 2UXNA 1YS7A 3KP7A 1X3UA 3B73A 3CUOA 4LLGF 1YIOA 1FOKA 3R4KA 3L4GB 2XV4S 5F64A 1FC3A 5GAOn 2OAZA 3UFGA 2DQRA 3M1EA 4F7UG 3J80Z 4JLIA 1ZLKA 4RAZA 5E1WA 4U0YA 4YRSA 4ESJA 4S05A 5IT9K 3ZMUA 1NNHA 3BPXA 1O3SA 5K1XA 4YRMA 2VXFA 2HDCA 4KNYA 3A7RA 4OLFA 4HF2A 4CICA 1FBSA 4QLCU 4NHJA 1E2XA 4FX4A 3E9HA 1GVJA 3ABUA 2L02A 2K4BA 1D8JA 2V1UA 2IA1A 4J6WA 2AKWB 2Z5UA 4PJOA 3WQZA 3EUHA 4P9FA 2IVMA 3TO9A 4EM2A 1TW3A 4PJOB 3R6SA 2ZNYA 4EM0B 4CGZA 2ZNZA 3BFMA 4M7DG 2CSOA 4A0XA 1KMMA 4TTVA 4YRGA 4AIKA 4M71A 4M77B 4C8QE 1U3EM 1F9NA 2PQ8A 2HNIA 3J81Z 3HFZA 4P71C 4EV0A 2VC1A 1YW8A 2ZXFA 2P6TA 3UGTA 1KQ8A 1USTA 2DPDA 4I2OA 4M7AG 1NYRA 4TVWA 2ZMEA 4EGZA 3GLXA 1J59A 2M8EA 3I71A 4DQ2A 3HTSB 4O6JA 1W66A 4H2TA 5GANj 2Q7EA 4HA8A 1J0RA 3JTHA 3VQYA 3I64A 2OQGA 3QU6A 4U7BA 1XMAA 2DTHA 2VXZA 1W7PA 1B8AA 2DXTA 2ZIMA 2QTXA 2CJAA 2Q7GA 4WX9A 1BI0A 3J81K 4BQAA 1Y96B 2LKPA 3BROA 4M75D 2P5LC 3GIBA 1J9IA 4L5IA 3F3XA 5CLSA 2IJLA 5LEKA 2XROA 3P7NA 1P6RA 2QLZA 1QNTA 1I81A 2IPQX 3GEZA 2MLGA 4WF2A 2KIFA 1WQWA 4M77A 2A69F 4HQMA 2DU7A 3KFUA 2XTIA 1B76A 1HQCA 2XVCA 4IJAA 4H0EA 1G6NA 5CVJA 4AD9A 2HOEA 4WJ3M 2QQBA 4M7AA 3T0YA 4XU3A 3P9KA 4KDPA 1JBMA 3IKLA 3PQKA 3ROUA 3HFZB 1LDJA 3JSOA 5LJ5g 5GAN8 5J8CA 2DW4A 1RNLA 4X9DA 3KCCA 2ELHA 1FBQA 2RHSA 2VC8A 4NCXA 1XB4A 1E1TA 4ZZLA 5ICEA 5LJ3h 2ZCWA 3NQOA 4ETSA 1WPYA 5JFRA 5K5QA 5D5VB 5E20A 2QQAA 1KQ1A 1LQ1A 4RGSA 4G6QA 4KN7X 3G73A 2RQPA 2EB7A 2ZNIA 4AIJA 2V1XA 3QNEA 1MZBA 1IL2A 2E10A 4LB5A 4ENMA 4M7DB 2L01A 1MJAA 3RERA 3I53A 2W25A 2OD5A 3ZMVA 3QAHA 4KYWA 1XSVA 4I98B 1RUNA 3SXYA 1I27A 2OA4A 4HWOA 4KIBA 1QO0D 4MQVA 1G3YA 3QSUA 1TNSA 4CH6A 2PMEA 1T39A 3K9TA 1SAXA 4GYGA 5E3IA 1N9SA 1REPC 4Z2YA 3RIRA 3SWNC 3DFGA 4KN4X 1R00A 5GANe 2QHTA 4YRCA 2H27A 4YRQA 1S8NA 1TQMA 4N9IA 2ZZEA 1ZREA 4E51A 2V79A 2RA2A 2ZIOA 2MH9A 1EV7A 4UV9A 4HWPA 2DTRA 3E97A 3EYIA 1SMYF 3WG9A 1U5TC 4M75F 4YRPA 2ALYB 1IRFA 1K79A 4K87A 4OP0A 5FD5A 5FGMA 1HSJA 1FYMA 4YIFA 4A6EA 4E70A 1RUOA 2Q7HA 1YTYA 1ZG1A 2PLYA 5CVVA 2Z99A 5FB2A 1QBJA 4FT8A 2RHSB 3GX4X 5A2QK 4A2UA 3ML6A 1IAWA 1S3JA 3ZN1A 4KIFA 1O7FA 4M75E 2FXAA 3W6JB 1EVLA 1J5YA 3F22A 5ICFA 5ICCA 3VODA 1PYSA 3A32A 2ARUA 2W85A 1HXDA 1UB9A 4J15A 5GAOp 1N9RA 3E5XA 3V4GA 4EJTA 2RKHA 1IZ1A 4TVYA 1EIYB 5IT3A 3MF2A 2FEZA 1CGPA 1TW2A 1I5LA 3ZMTA 1X2HA 3JCMc 3RESA 1VTNC 1Z91A 3FJPA 4J6YA 2XAHA 1SMTA 3LSQA 3I7FA 3NETA 4M78F 3LQRA 2ZT8A 1BN5A 4EJUA 5D5WB 4L87A 3ULQB 3KP5A 2BE5F 2DKGA 1IF1A 1S6LA 4ON0A 6PAXA 1YFTA 1OKRA 3JCMe 2JTVA 3KLNA 1TQIA 1BBUA 3HXYA 3UGQA 1LNXA 2XAJA 3JB9J 3FXUA 3R61A 3C18A 2ALYA 4XQ3A 5BQTA 2AS5F 2K02A 2CW0F 2LDUA 2K7LA 5LJ3d 3GF2A 1NJ5A 4CH5A 4P73A 1FZPB 4MTEA 3CTAA 3RACA 2EV6A 4H2WA 2JZYA 4YFXF 1ULYA 1XN7A 2CWEA 5GAOl 5JR3A 1UHMA 3PZCA 4A5MA 3HFOA 3JCMb 5LGTA 4KQEA 3HXWA 4M72A 4O2DA 4M7DC 1ZRDA 1D3BA 4PGHA 4EMKC 5GAOr 2QUFA 2GAUA 2MD5A 2NAZA 3OV8A 2XKOA 1H4QA 3L4GA 2NYXA 5TRDA 5E1ZB 3M4QA 1EFWA 5DUIA 2YPRA 3E6DA 3K1PA 4D0PA 4RCBA 1J75A 4G9YA 5LBQA 4YFNF 4C92F 3KLOA 5ERIA 1OMIA 1T2KA 3HRKA 4PG3A 4BXUA 4KFCA 2G7HA 2PBIA 3DQVC 4I0AA 1ODDA 1ZHFA 3HFVA 4OINF 3BJUA 5H6RA 5EEGA 3EDPA 3ICAA 5JHUA 3RKXA 4GGGA 4ZYGA 1ONVA 1WSUA 1B70A 2F5EA 4HW0A 4KR2A 4TVAA 1HW5A 1DUXC 4P3PA 1ATIA 3MFKA 4IRHA 3VBBA 4M7AD 1YS6A 2ZKZA 3E6BA 4MEXF 3VEPA 2GQQA 2RN7A 4RS8A 1ZH5A 4PNOA 2XGTA 2F5DA 2XUBA 4CS4A 5HLHA 4YRJA 1QPMA 4PGGA 2ESNA 1EQRA 1KA8A 1YQAA 1WLEA 1W7PB 1PUEE 1LB2A 3CMQA 3ZPLA 3LAJA 2HTJA 3LC0A 3JB9H 2X0LA 4N9HA 3Q9VA 3CUQC 3JCMg 3RKWA 5ILVA 3NELA 1EIYA 5HGQA 3F23A 1L0OC 3AAFA 3FX3A 4LLLA 1F5TA 3HTUA 1RIOH 1LDKB 3DF8A 2ZT6A 1LEAA 3FMQA 2FMYA 1QZYA 2XAGA 4KICA 2A07F 1B9MA 4GYIA 4YDQA 4NQWA 3NEMA 2QBYB 3EQLF 1C0WA 4CXFA 3NEUA 2JT1A 2DLLA 1O3QA 4HDUA 3HUGA 2ZJ2A 2OZUA 2RHQB 4GXOA 3R0AA 1S29A 1FYLA 3IHUA 3KP3A 4WI1A 3QO7A 2MA3A 2ESHA 4OIOF 4C92D 1SD4A 1R1VA 2WC2A 1R7JA 1L3LA 2QHSA 3S2WA 4BHBA 3BOQA 4YRRA 2Q8KA 4FHTA 4GO1A 5E18F 1B34A 4IVNA 4RB2C 2IA2A 2TDXA 5I21A 4UUVA 1SD5A 2E64A 1ZG5A 1WQ2A 1YLFA 2XIGA 2HYFA 3IWFA 3QU3A 4H2VA 1R1TA 3P9CA 3QTCA 3WU1B 3Q5FA 3QO8A 1MJBA 2O6GE 1HBXG 5GAMh 3SWNB 2KJBA 4G94A 3GFMA 3QOPA 3E6CC 5H6QA 5FFZA 2RNJA 5LHIA 2HQRA 5KNNA 1V3FA 3MAJA 2CJ9A 1GXQA 4PDKA 4I7HA 3PQJA 3FF5A 2ISZA 3SQNA 3V8KA 3NENA 1BBYA 3MZHA 1JRIA 3FM5A 3WE2A 3DV8A 1IXRC 3GVAA 4U7DA 4XTWA 4C8QA 3TKYA 5LRRA 1I1SA 3WU0A 1UHWA 5GAMg 2RB6A 2CJBA 3O3KA 4TVAB 1B7YA 4C8QB 3L9FA 5GANg 1HW1A 5AIQA 1KU9A 4A5NA 1FSHA 2ZR2A 2DXUA 2ZO4A 2NNYA 1B4AA 4XBFA 1FLIA 2H94A 2P7CB 4CH3A 4RGXA 3V8JA 4U0WA 4RB0A 1IN7A 4EM1A 1ASZA 2YR2A 1B34B 4M7AF 4TQDA 3J7AO 1SD6A 2VN2A 1Z9CA 4CO8A 3IC7A 2JPBA 3KFWX 4I01A 5KK1A 3M4GA 4ENJA 3ERRA 1NHAA 3TEHB 4BAYA 4B09A 4AWXB 5GAMf 2XHKA 5E1XA 1FP1D 1SD7A 1XSDA 4EMSA 1ZARA 4CS3A 4EMHA 1WKMA 3JW4A 3PGGA 4U0VA 3ABTA 4LLNA 3IRRA 4M78A 3IL2A 1YFRA 1QZZA 3I0TA 2WTEA 2EFOA 2IP2A 1HKTA 2RV8A 2PEXA 4HLXA 4TWAA 2CGHA 3GO5A 2JRTA 1LOJA 3FXQA 3I4PA 1KQ9A 4ZIBA 4HF1A 4P55A 3FM3A 2DBBA 2VE8A 3DP7A 4JUVA 3M9AA 3F6VA 4RGUA 1DPUA 2LSOA 3RYPA 5J8FA 1STZA 3Q9SA 1H641 3KP4A 1WU7A 2EFQA 1ZG3A 1FPQA 2Y90A 5D4RA 1K7AA 1FBUA 3DPLC 3JCMV 2ZT7A 4NB5A 2I4MA 1MD0A 5CJ9A 4LG0A 5GAN4 4YRTA 2B0LA 1JHHA 1BIAA 2E1NA 5LJ3g 1L0WA 5HLIA 3LSSA 3RPQA 2D45A 4O3MA 3CUQA 2LF7A 2Q2EA 3JCMW 5LJ5h 3P8TA 1Z7UA 4UVAA 2ZT5A 4UHTA 2DTIA 4IHTA 3G3ZA 3COAC 5BMZA 3JCMX 1WYDA 3HXVA 5FFXA 3HXZA 4C92G 2ODRD 1E17A 3N4MA 2DTOA 1OPCA 3F8CA 3K1MA 2XKPA 4N0BA 2W24A 3GZ6A 4M75A 1LYLA 1K6OA 4YRNA 3E9IA 1JXSA 3IKMB 2Y0MA 1D3YA 3WTVC 1UCRA 4M9ZA 4S04A 4RMFA 4UXNA 4HX4A 2ZFWA 1IW7F 4I02A 1Z05A 1XSXA 1E24A 3T5XA 2PJPA 3ZMZA 4UPAA 2OBPA 3M7GA 5GAMd 4LGWA 1BI1A 1I8FA 1NJ6A 5K1YA 5BPDA 4CS2A 2WV0A 4YPFA 2XRNA 3MQ0A 4KIGA 4EMKB 4H2YA 2IY5A 5BOXA 5DD8A 3IRQA 3UH0A 5D6EA 5GAN6 2FB7A 2GA2A 2RD1A 4XEMA 1Z6TA 2D1HA 1YYVA 2P5KA 1X54A 4XSZF 2ARTA 1HKQA 2FBHA 4WCGA 3ECHA 4HX7A 5BS6A 5LHGA 4JRKA 4P5OA 1TBXA 2F5CA 5LGUA 2A5YB 4HVCA 4OIPF 4LJZF 3SFZA 5GMKj 3I54A 3T8TA 2EA2A 5DYMA 4C8QF 4HT8A 5LJ5e 4JBAA 1ZGAA 2QWWA 4Q48A 4C8QD 3VOEA 2YSRA 4Y15A 2BBYA 2LNBA 3HRTA 3KZYA 4KUMA 2ZMEB 3VB2A 2PMHA 4KMFA 5DUKA 1AWCA 4OOIA 3JB9I 3JAMK 4K86A 2FRHA 2VOPA 3F8NA 2FU4A 1RZ4A 5EEHA 1UFMA 1PP8F 2BEOA 4RGRA 2HS5A 2O0YA 5GAN5 1YCYA 3REXA 3HTZA 2VODA 4P74C 4M7DE 1IXCA 4F7UA 4HWRA 3HFNA 3INZA 4P72A 3L00A 4PJOF 1KYZA 2PI0A 5HVQC 5A2QZ 5LJ3f 4XSXF 3F6OA 4C92A 4WXHA 4JK1X 5LJ3j 2QYOA 4YRLA 1FSEA 1NYQA 4P73C 1ZLJA 4PHCA 3T8RA 1TH7A 1H0MA 5FLXK 1IUYA 3IWZA 2OU2A 4P72C 3HXUA 3KP6A 1KYWA 2W57A 3L7WA 3F72A 3SB2A 3LFKA 2EL9A 4P74A 3W3SA 4HDVA 1SESA 3F8MA 4ZYDA 5L3CA 3ZQ7A 5CYVA 4HV6A 4EGYA 5BPIA 1AOYA 3JCMQ 2OZ6A 3TQNA 2DPUA 4C8QC 2VE9A 3BJOA 5LRSA 2YLBA 1J5WA 4WWCA 1BBWA 5GAN2 4ESBA 2E5AA 3GW2A 4IPAA 1XGOA 3LA3A 5GAOq 4M77C 2DQ0A 4L5JA 2A6HF 2VBZA 2PMUA 2E3CA 1S7OA 4XTZA 3BWGA 4BYYA 2CQKA 5FLXZ 3HIFA 2J5OA 3U9GA 2C6YA 4L0YB 2NNNA 2FQ3A 2DFIA 3JSPA 1PYSB 2KKOA 2WWYA 4KT5C 3BJ6A 3LSTA 3JCMJ 2FF4A 2ZINA 1Z1DA 3WTTC 2P6SA 5D8LB 5D8KB 2EV5A 2ZNJA 1Y0UA 3ECOA 2ADUA 4CZZA 4G7ZF 5ED4A 4M77D 4LK0F 2ZR3A 2O8XA 4UNOA 3GFIA 1T98A 2EJ9A 3KE2A 5HS9A 2ZBKA 3TOBA 5E8IA 4M77F 2EFNA 4YREA 3TOAA 2CGPA 4M78C 1XDUA 5D5XB 2M1BA 1IN4A 1Y96A 1X55A 4HF0A 5L3GA 2HZTA 3RTRA 3P8YA 4L9TA 3LWFA 2FMLA 5GAN7 1HKSA 1JE8A 1P4AA 4RB1A 1XGSA 1BI3A 2M5WA 4R1HA 2DU5A 2A61A 3JCMP 1ASYA 4JQFA 4M77E 5GAOm 1MDMB 1LEBA 2DO7A 3P9IA 1YO5C 5GAMe 4Y17A 2HYGD 2L4AA 2XAQA 4HAMA 3CO6C 4G7OF 2EFWA 4PJOE 4L18B 3JB9G 1H4TA 1Z7NA 1QQIA 3L1AA 5F5WA 2EJFA 4DPGA 3IG2A 3BY6A 2XGXA 3QRFF 1K78B 2H6BA 3V7SA 4M75B 4M7AC 1I4K1 4UP7A 2ZXJA 1ZRCA 2RDPA 3HSRA 3O2PE 4OU0A 4M75C 2FNAA 2KJCA 3F21A 1NJ8A 3R0JA 4HT9A 5ICGA 1JJCB 1W7PD 4PJOD 1O7LA 4QVCA 5K1PA 4Q5SF 2QHUA 4Y91A 1XD7A 1R36A 2HKXA 4M78B 1XGNA 3TDZC 2O03A 3CUQB 1U1TA 4R79A 2QQ9A 3ZN0A 3WTSC 5JI6A 5HLGA 3DSQA 1TTYA 1G3WA 3WTXC 3A7AA 1YFSA 2P8TA 5GANf 3QUIA 5AIPA 2FBKA 3WTUC 1M5Q1 4A53A 5E17F 2ISYA 1USYA 1OYIA 2Z9OA 3RL6A 1XDSA 3CLOA 3EYYA 2HWVA 4BHPA 2UWMA 4XU0A 4P3NA 1DP7P 4WXDA 4EJWA 1RI7A 2AMCA 4ZTUB 1KQ0A 4P71A 5AONA 1FYFA 3HOSA 5F6FA 2AMCB 1HC7A 1OYYA 2D2WA 2QZ8A 2W84A 3H3ZA 4M74A 1EH8A 1U2WA 3WGIA 3GFLA 3G1ZA 2VC0A 5CVIA 2ZZGA 4A54A 1YW7A 3HY1A 1E22A 4MHGA 4M7AE 5HS7A 3QP6A 1D3BB 4RQFA 3H92A 4EO4A 1K78A 4NL3A 1T0FA 3FXRA 4Q15A 4P75A 3L09A 4ZH4F 3V7RA 2CIMA 2Y75A 2G9WA 4U88A 1XGMA 4R8HA 2STWA 4H2XA 11ASA 1R1UA 2PFBA 1SFXA 1KGSA 4F7UF 3T1BA 4Q6GA 2L3DA 1PDNC 1HW2A 3HOTA 1GGMA 4YRIA 1B1BA 1ZYRF 1MGTA 2NRAC 3C1DA 3OOPA 4H2UA 1HTTA 3VQWA 4YCUA 3HY0A 1B6AA 3GXOA 1EVKA 1GHCA 4ENNA 4ESFA 4HLYA 2VBWA 4OMYA 3E5UA 1IXSB 3I5UA 1G3TA 1O3TA 4HYEA 5D4SA 4LD5A 3GYHX 1KU7A 3TEGA 3RYRA 5DY9A 2E1CA 2RVCA 4F7ZA 4PJOC 1P4XA 1FT9A 1IN8A 2RGVA 3FB9A 2E7XA 4BH9A 1LNWA 2CO5A 4IF4A 3JCMd 2I2LA 1NJ1A 4P75C 2CG4A 4N0AA 3RF1A 2VOOA 1X56A 3EFSA 4HBLA 4M7DD 2AXLA 2RM4A 2PMFA 1ADJA 2R7DA 1QE0A 3DXJF 4ENKA 1MDMA 3L2CA 3C3WA 2E41A 2IW5A 2MH2A 4J6XA 1KOGA 4Q4ZF 2YX7A 4H02A 1IN5A 3KEOA 3GFJA 3A74A 3RDIA 5LJ5d 5L3FA 1O57A 3GUDA 1BJAA 5H20A 4A0ZA 1FYKA 2DAOA 2Y48A 2EJRA 1LJ9A 3ZMSA 2EA4A 3HHHA 4A0YA 2DDZA 2FA5A 3E3VA 2IRFG 1H4VB 5C51B 3IKTA 5IT9Z 5L3DA 1FNNA 3FZVA 4M7DF 2DQ3A 2DQLA 3NRVA 2DZCA 1G4DA 2YX4A 3SWNA 3LA2A 4HQEA 4CDGA 1W5SA 2DK8A 1WI9A 1HK9A 2FOKA 4KMUX 2MBFA 2KIMA 1W4MA 3DPTA 4M78D 5ELOA 1G5HA 1LVAA 5DCMA 1I6XA 3BZ6A 1DDNA 2NS0A 3K1NA 2K27A 3FWEA 5LLQA 5E8GA 1G3SA 2ZCEA 3E5QA 2J3MA 3RGLA 5JVTA 2FSWA 1C0AA 2EJGA 3IKVA 3QPHA 5HDNA 4RCCA 4KA4A 5KVRA 3BW1A 4XTXA 1LJOA 3HHGA 4LMYA 4A6DA 2F2EA 1FY7A 5TJJA 3GZ5A 4HWTA 4G6DA 2DU9A 2RHQA 5GMKe 3ISPA 1B59A 2QBYA 3QP5A 1ADYA 4XU1A 1BIBA 1I1GA 3MEXA 4XTVA 5L3EA 4G85A 2ODRC 3JAMZ 4HWSA 5C52B 2J5PA 2QHVA 4TQFA 5LJ3e 2E65A 5DV5A 1TNTA 3QPTA 2DJZA 2DT5A 2O61A 4M7AB 4BHCA 5DCFA 5HDGA 5D5UB 1NJ2A 1VQZA 4YFKF 3VQXA 3A31A 2ZZFA 1R5GA 4M77G 3BP8A 3QO3A 2EAYA 1Q1HA 4RQEA 3V7CA 1J2XA 4CYDA 3I59B 2ACJA 2F5FA 4C92E 4LNSA 3TUPA 3ZMDA 3MCZA 3RJPA 1B9NA 4H2SA 4X9CA 4TV7A 2X4HA 4FX0A 4MEYF 5ILUA 1GXPA 4EVIA 4UVCA 5ELNA 2G7UA 5GMKh 1U8RA 1ZN2A 4CHUA 4Y13A 5HS8A 5K5OA 2PG4A 4UP9A 2VT2A 1OR7A 2BGCA 3FMSA 5J6XA 2P0LA 4PCQA 2ETHA 2ZGWA 3B02A 1WQ7A 1BC8C 2G4CA 2I4LA 4M78G 4MMLA 1FP2A 3EFRA 12ASA 1T6SA 1TQPA 2FBIA 3D5LA 4M78E 3F8BA 4ZYHA 1M8VA 4ZZDA 3REOA 1U5TB 1OYWA 1ZRFA 2I4OA 4DNCA 2EFPA 1MKMA 3TEHA 2HFHA 3JCMf 2ZTGA 2M45A 5GAMj 1U5TA 3MZYA 1EOVA 2C8MA 3MWMA 2ARSA 3K2ZA 3J80K 4IHSA 3JCMh 3RI4A 3I58A 1KQ2A 1U1SA 5DCMB 2GXBA 5GAN3 1G5IA 4BWAA 1QGPA 4YROA 4UP8A 1USSA 3HYIA 1D5VA 4IRIA 3A5ZA 1YB3A 4K2EA 3SZPA 2VBYA 3BDUA 2LF8A 3GWZA 5LGNA 2Q0OA 4K88A 4H2XB 4C8QG 4YRFA 5FD6A 3BPVA 3RPUA 4F7UB 2EWNA 2R3SA 3W6KB 3IALA 4LG0B 3TO7A 2HEOA 2OQRA 5L3BA 3DKWA 4QWQA 3BY7A 3HRIA 4AH6A 5DDGA 4Q47A 3C7JA 3FMRA 2Q5IA 3A7UA 2VT3A 1X2GA 2STTA 1F4KA 1JHFA 5GANh 3FIFA 5GMKm 5DEQA 1MGQA 4X5OA 2DZ9A 3H3UA 3R07A 4MGRA 4OIQF 3VQVA 4RDXA 3HSEA 3RUXA 5HDKA 4L9NA 2M87A 3VU3C 3EETA 2O3FA 2VONA 1KMNA 1A04A 3QO5A 1BOAA 3JB9F 1R5HA 4YRKA 2K57A 3ELKA 1KU2A 3WODF 1EH6A 5D6FA 2E1HA 3LAPA 2GZWA 2HTSA 2Q5HA 2IT0A 3WTZA 4G8XA 3LQQA 2P5IA 5GMKi 1WWXA 2JPCA 4G84A 4MQ9F 3LA7A 3N97A 4XEOA 4EMKA 3REUA 2L4MA 2QVOA 4IXAA 1R23A 4XRFA 2JSCA 1ON2A 2V6CA 1R58A 1XMKA 5LEJA 2P7VB 2K4JA 1HSTA 1D8KA 3TO6A 2QM3A 1CF7A 3DEUA 1FX7A 4NL2A 1SFUA 2FNPA 4XU2A 2EV0A 3TDUC 3M8EA 1LDDA 2Z3YA 1Z6RA 2RC4A 1XCBA 3HRUA 4JRIA 4WJ4A 1FWZA 4MTDA 4EQQA 2XASA 4P9UA 4YCWA 1MJ9A 4YP0A 3TGNA 1W5TA 4NOYA 1EH7A 2XAFA 2E7WA 2R7FA 4LFUA 4ZYEA 4L0ZB 4UVBA 1X01A 2D1VA 3D0SA 3CO7C 1R22A 4N0AC 2IY5B 1DPRA 3O6BB 4G7HF 4ZTZB 1WNLA 4I09A 2KIUA 2EK5A 4M9XA 1N9WA 4M9SA 4HX8A 1P4WA 1ON1A 2DK5A 3R60A 3MEYA 4YIIA 3PCOA 3K69A 2DEQA 2J3LA 1SFEA 2CFXA 1S7AA 3U2RA 2FYKA 4CH4A 3M4PA 4I0BA 3JB9D 2QENA 5CVUA 2A68F 3WGHA 4EJOA 3M8FA 3F8FA 4L9JA 5ILSA 1RIQA 4AVPA
chains in the Genus database with same CATH superfamily
3WE3A 4MNUA 1WLPB 4D7MA 3RKYA 3KZZA 2GTJA 1V4RA 5DD4A 2DOAA 1K61A 2EKOA 2A3SA 1OCPA 1YFHA 4EMGA 1H9GA 4M6XA 5DLOA 1VQ8T 5B1AH 4KR3A 3I55T 3WTWC 3CCRA 3VFZA 2LDMA 1I3QJ 4XLPF 2HGCA 4IQJA 2PZ1A 1Y0NA 2DYRH 3SZTA 1FOYA 4BNCA 2R7SA 2ZAEA 3ZP5A 3CCQA 1YJNA 2GXAA 1M30A 4A93J 2RQUA 2D0NA 3AG4H 2YDLA 1VF9A 4LXCA 4JJCA 4LVLA 1F1ZA 2OAWA 3HRMA 3E6MA 3PMTA 3TU4K 4YG2F 4MLOA 2DBKA 3L2WA 2DAQA 2DDBA 3PMIA 4J7IA 3BJAA 2HD0A 4M73A 2XICA 5CAIA 2A0FB 2IY5B 3ERED 2JW4A 3L2ZA 1IRGA 2UZKA 3E0JB 4LB6B 2JMCA 2IEKA 5J40A 3KETA 2DVJA 4ZGEB 2RQVA 3JRBA 3EGXA 4LUDA 2PN6A 1SRYA 5KH6A 3TMOA 1YG2A 2COMA 1VYUA 4Y7NJ 4EJVA 2F1LA 3X24B 1TWHJ 2BYVE 3QPSA 4OAZA 1TS9A 3QYHB 1E1OA 5GMKl 1H4SA 1QF6A 4V2SA 3BDDA 4PZJA 2E3HA 1MMSA 1QVUA 2GOMA 4UV8A 3BTLA 2LY1A 1T3SA 4YCVA 5C53B 5L8RE 4GCVA 2GQIA 1PP7U 3L42A 4EX5A 1TWCJ 2YU3A 4KBMB 2K7AA 2K5FA 1S72A 4WK8F 1JQQA 2IAIA 1ZK8A 2FE3A 2V9VA 1RL2A 1AKHA 2KXCA 4F7UE 1VQKA 3WVDB 4BW9A 1O3RA 1FEXA 1D0XA 4QVDA 1Z7MA 3E1SA 1J7KA 2LNHB 2P4WA 2DL4A 4Y3OA 3C4SA 1HLVA 3A5YA 2ZSHB 1P9QC 2DVEA 2KFDA 1G5VA 4HOBA 3RNJA 4L9VA 2RQQA 5F08A 3CMYA 2CH0A 4XK4A 2R5YA 2YLCA 4LUEA 2AT1B 4ZNXA 5GJVB 4HV5A 1JGSA 4M6YA 2NVQJ 2GA1A 3HOWJ 3A98A 4O5VA 2HQNA 1VQ9T 1WI3A 2DA5A 1RABB 2IGKA 1PSFA 4RUGA 2JN0A 1W2BP 2GIVA 5CVRA 3HSBA 2LJ0A 1V76A 2ECBA 2LJ3A 1VQ7T 2BV6A 1GDTA 1YGBA 1SERA 3QQAA 2K5CA 2LY9A 4CYCB 1KQSS 2OCCH 2VXEA 3ME9A 1BJZA 4RB3C 4JZ3A 3CCMA 2X9HA 3FJ5A 3U1DA 2DA3A 4M7DA 3UT1A 3P8VA 4HVWA 4LK1F 3CJNA 4RAYA 2HKOA 2KRFA 3HRSA 5FO5A 2LKXA 4RA2A 1R6RA 4B9XA 4C5HA 1YI2T 4ASNA 4AIHA 2M16A 2P5VA 2VBXA 3KEQA 3CMEI 2ZJQF 4QSHA 5JVGF 4OIRF 1NLPC 2FPEA 2L2PA 4J5YA 4P96A 4XTYA 3IAS2 3CC7T 1TLHB 1U78A 2C7IA 3JTGA 3PIOF 4PJOG 3G6ET 1BC7C 2X48A 1JKRC 2F5KA 2R7OA 1X1CA 2H6CA 2IA0A 2DI3A 3HBLA 2HR3A 2OPTA 3VS4A 1B70B 1FTZA 1KU3A 1XCVA 2EPDA 2JS2A 3KPHA 2DT6A 1BM9A 3PFYA 1KONA 1P2FA 3JRCA 1AHDP 3ASNH 2Z33A 2IIMA 3EHQA 3FLGA 2B63J 2K86A 2OAUA 1YJWQ 2LC2A 2CYZB 1IN6A 3H5RA 3AHUA 3WGGA 1G51A 2NS6A 4C0DC 5LJ5j 3HSFA 4FIBA 4YYEA 4BI4A 2VOPA 2M34A 1Q82C 1ETYA 3HXXA 3CBMA 5HOOA 3BTJA 4KITB 4HEA2 4WXCA 2M0MA 5K5RA 2GXGA 1FMKA 1QWFA 4EDUA 4XLNF 4HSTA 4C30A 2L54A 2A28A 3QHSA 1SETA 4P3OA 2AQFA 1BI2A 3VWBA 3K0LA 2M30A 3CDHA 1ZAOA 2VKDA 3V8LA 2L9SA 2CP6A 2K9QA 2Q7GA 2JUFA 3OD1A 3X20B 4BB7A 4HZFA 4W97A 1R49A 2CQNA 2F4IA 3A32A 1K8AU 4JOMA 3CPWS 4PFOA 3CCUI 1YW9A 1CF7B 1IGQA 1SF9A 2P4RA 1WRJA 1U6GA 2ZXIA 3KP2A 3FHZA 2DJIA 4OMZA 2VGMA 2QSHX 4M75G 4MMKA 5GANd 1G83A 1GV2A 3CPWA 4IRGA 2I4NA 2OI3A 3FK6A 2ROTA 4C0DB 2V1DA 3MZ8A 1GUUA 3H1CA 2EIKH 4XN3A 2WAQA 4X1EA 3HXLA 4MO7A 4AC0A 5F1RA 5LHHA 2HBWA 3M5AA 2UXXA 4OMOA 3I59A 2KE9A 3PCOB 2GWRA 4A12A 1I0CA 1T38A 2DA7A 3JRDA 1W36D 4BE1A 2H09A 1H9TA 2MLKA 3PFIA 1TC3C 2HOTA 2NLUA 3R6NA 3G4SA 1B7YB 4B8XA 1I5ZA 2CYYA 4C92B 2Z1DA 2MC3A 2QSGX 3SHFA 2V1RA 5E3MA 1M3AA 2CZ1B 4XTUA 5IAYA 2QEXT 1P92A 2VUMJ 4FSSA 2A6EF 2HVQA 1ZGJA 1BR4A 1JJCA 3WTYC 2MD0A 2EZHA 2UXNA 1YS7A 2XGEA 3KP7A 4BXXJ 1X3UA 1K9MC 3VS7A 2PVOB 3B73A 4OMMA 5EGOA 2DL7A 3CUOA 1VQOT 2K9MA 5M3FJ 3AL0C 2A8EA 4LLGF 1YIOA 1FOKA 3R4KA 4W1UA 3DTIA 5EYRA 3L4GB 2XV4S 1MSFC 4HRIA 4LDYA 2KDSA 5F64A 1FC3A 4CSWA 1G59A 5GAOn 2OAZA 3UFGA 2DA6A 2DQRA 3N05A 3M1EA 4XQFA 1YRNB 3NARA 4F7UG 3PVLA 3J80Z 3REBB 4JLIA 1ZLKA 1YIJQ 3L2UA 4RAZA 5E1WA 4CCOA 4U0YA 1RR8C 4ESJA 4V2GA 3FHNA 4S05A 5IT9K 3ZMUA 1NNHA 3BPXA 1O3SA 3QJ6A 2CV2A 4YRMA 5K1XA 3ZCOA 2HDCA 3PO2J 2VXFA 2Y2ZA 4KNYA 1T56A 3A7RA 4OLFA 2IBDA 1UGRB 4AM3A 2LTPA 2HXOA 3ZXSA 2BHYA 4CICA 4HF2A 1FBSA 4QLCU 4Q5WA 3C2GA 1X6OA 3IP4B 2L9VA 1VQ5A 1VZ0A 2BW3A 2RJDA 4E47A 4NHJA 5FKMA 1E2XA 4FX4A 3AL0B 4D6WA 3E9HA 2VL8A 1GVJA 3B6CA 1TT5B 2QQ8A 3ABUA 1KC8U 4IL6C 2L02A 1QVPA 2DRKA 2K4BA 3D7SB 2BXYA 1D8JA 2DYBA 3MJXA 3PE0A 5K7FA 2V1UA 3EFOB 1NG2A 1DGWY 2IA1A 1HA8A 4J6WA 4A3GJ 1YI2A 2AKWB 3PUBA 1VIFA 2Z5UA 4PJOA 3WQZA 2R5AA 3W6VA 5IH2A 3EUHA 3FXLA 2LR8A 3ABLH 3GNFB 3EFOA 2QG9B 4P9FA 4Y33A 4ZYAA 3AG3H 3OYBA 3M3YJ 3LSKA 2IVMA 1VA7A 3TO9A 4CCKA 3ABMH 4EM2A 1TW3A 3MKZA 3GP8A 3PNWC 4PJOB 3R6SA 1TU0B 2ZNYA 4EM0B 4CGZA 5KHDA 1E0EA 2ZNZA 1MW7A 3BFMA 4M7DG 2JJ9A 2CSOA 2YRCA 1A0NB 1X6GA 3CD6A 1MMGA 2JUGA 1WX6A 1WXUA 4J9DA 4A0XA 1KMMA 4TTVA 4YRGA 5FLVA 1LE8B 4AIKA 5J3LA 4E7LA 4M71A 4M77B 3MEWA 4C8QE 1TUCA 4R56A 5HNFA 4C0GA 1U3EM 1DU6A 1OX9A 2O01E 4OGEA 1F9NA 2PQ8A 2HNIA 3J81Z 3MEVA 5I22A 2A05A 4EV0A 3JRFA 3C94A 3CXCP 2O88A 3HFZA 4P71C 2R0QC 1K8AC 3FRNA 2VC1A 2JTMA 1JUPA 4II1A 1YW8A 1QMCA 2O2OA 2LVMA 2MGQA 1KD1U 1M2VA 2ZXFA 4LG3A 2P6TA 3UGTA 5D6XA 4FISA 1ZTRA 2YHTA 1KQ8A 2PNIA 5DLQE 1YHQI 1USTA 2DPDA 4I2OA 1VQLI 3HPGA 4M7AG 4J19A 5DTDA 1NYRA 4MZMA 1WJQA 4TVWA 2ZMEA 1JTYA 1RETA 4XIDA 4EGZA 2H3JA 2Y4YA 2DMTA 4J9FA 3GLXA 1K9MR 1Z9QA 4IUTA 3BZKA 1Q7YC 2RQWA 3CCEI 3VKIA 2DF6A 1J59A 4VUBA 2M8EA 3CCUA 3I71A 4DQ2A 1KK7A 3M54A 3HTSB 4O6JA 4BJ6C 2BW3B 1VQLT 1W66A 4H2TA 2EYWA 3I9QA 5GANj 3GLLA 5CQGA 2YUNA 2Q7EA 3HOXJ 4HA8A 1J0RA 2ECCA 2OV7A 2Q2EB 3JTHA 3I64A 2OQGA 3M1CA 1JJ6C 1T0HA 4C2UA 1MBHA 4CCJA 3CF5F 2FEIA 3QU6A 1K8AR 4U7BA 1XMAA 2E60A 1PNJA 2VXZA 1ZUYA 2XGDA 1W7PA 2DTHA 2DXTA 1B8AA 2ZIMA 5F27A 1KFZA 4BQNA 5FLXE 2QTXA 1VQ4A 2GOXB 3M56A 2VJ5A 1YJNQ 2CUFA 1K83J 3SDGA 1BI0A 4WX9A 3J81K 1SEUA 3K70C 2LKPA 3BROA 3A01A 4BQAA 1Y96B 4M75D 2P5LC 4FU6A 1VQ5Q 1JKPC 3GIBA 2EYYA 1J9IA 4L5IA 1ABOA 3O8VA 1Y8QB 3FXJA 2EQMA 3F3XA 5CLSA 2KY9A 2XPUA 1MBKA 2IJLA 5LD2C 1E6HA 2KYMA 2DMQA 5LEKA 2XROA 3P7NA 1P6RA 2QLZA 3W2VA 1QNTA 2DOFA 3G1OA 1E6GA 2EBPA 3QYFA 2XU8A 4OGCA 3HOUJ 1I81A 2IPQX 5IHNA 3DPUA 3BR2A 2H1KA 3GEZA 2MLGA 4WF2A 3OYJA 2O8KA 3W3CA 1AD5A 1WYDA 2KIFA 2L0AA 4IX7A 3CJRB 2KEAA 1JKOC 3RBBB 3CXCA 2CW7A 1V54H 3NWTA 4BEHA 4E4HA 1WQWA 3OS0A 1BCOA 4BY7J 3MP1A 4M77A 1ORKA 1AA7A 2A69F 1K4TA 2JS0A 1X58A 4HQMA 4CH7A 2DU7A 6AT1B 3LGLA 3TQ7P 3KFUA 2MF2A 2W10A 2XTIA 4D8KA 1UECA 2BY1A 1NEBA 2P0QA 2XKOC 4B47A 5F0HA 1B76A 1HQCA 4ANJA 4MFEA 2DYSH 2XVCA 4IJAA 1Z21A 1XTAA 1IGUA 2XHCA 4H0EA 3CPFA 1RKTA 3Q3SA 3EG2A 1KHIA 2KBTA 9ATCB 3UPUA 2DOEA 4L59A 1G6NA 5CVJA 4AD9A 2HOEA 4CA0A 3G6EI 2O31A 3BC8A 2QQBA 4WJ3M 3OY9A 4M7AA 3T0YA 4DEXA 1NPPA 3JB9J 2X1DA 3PM1A 2VQHA 4XU3A 3KIOA 3P9KA 4RBOA 1U9OA 5CKDA 1UTIA 4KDPA 1JBMA 1X4OA 3PQKA 2KT1A 4B9WA 3ROUA 1QVFS 2OTJQ 3JRGA 3HFZB 1CSKA 2D8HA 1LDJA 3JSOA 2M51A 1RR7A 1UZCA 2K9LA 5LJ5g 5GAN8 2X4WA 5J8CA 1KZHA 2HDWA 2DW4A 1RNLA 5F0FA 1QP3A 1LE8A 2HVSA 2WB1A 3KCCA 2ELHA 4X9DA 1FBQA 2RHSA 2VC8A 3A0HC 4NCXA 1XB4A 4MZPA 2LMJA 3C12A 5BNGA 1E1TA 4ZZLA 5ICEA 5LJ3h 1G8XA 3BR0A 2R4GA 2ZFUA 2ZCWA 3BZCA 1X27A 3NQOA 4ETSA 3OYCA 5JFRA 1WPYA 5K5QA 3G6EA 1YITI 2Y31A 5CQXA 5D5VB 5E20A 3ZBDA 4KUIA 2QSFX 3OOUA 4BGDA 2QQAA 1OV3A 1KQ1A 1LQ1A 4RGSA 2MW8A 2YUPA 4G6QA 4KN7X 5F04A 2WY7Q 3G73A 2VKEA 1ETWA 2RQPA 4P3NA 4E7HA 1O75A 2EB7A 2EQIA 1VQNA 4AIJA 2ZNIA 1OQYA 4ZTFA 2LD5A 2V1XA 3TCJA 2B9SA 3QNEA 2BZTA 4AMCA 1QLYA 1MZBA 1IL2A 3GTKJ 4LB5A 2E10A 3V42A 2X6OA 4ZN1A 4ENMA 4XRMA 2JM9A 3H35A 4M7DB 2L01A 1RI0A 3P8DA 1ETXA 1V5EA 2L9NA 3JR9A 1MJAA 3LYIA 1IRXA 2F2XA 5ECAA 3RERA 3I53A 2CZ0B 2W25A 5KYUA 1S72Q 3N5BB 3OSGA 1WHGA 2LZ6B 1X3ZB 2OD5A 2O9VA 1VQLA 1VQNQ 3ZMVA 3QAHA 4KYWA 3HTRA 1XSVA 4I98B 1TL8A 3ZR8X 1RUNA 3SXYA 5A0DA 1I27A 5FKKA 2BOLA 2ZSIB 2OA4A 4KGXB 4HWOA 3HOYJ 3SEQA 3OYHA 1JU5C 3HM5A 1QQJA 4KIBA 4BEHB 1UFFA 2V1QA 3KUFA 1QO0D 1IDYA 4MQVA 4ZDLA 2PJRB 4DOVA 2OC6A 2DFFA 1G3YA 3QSUA 1TNSA 4CH6A 2RJEA 2PMEA 1T39A 2ATCB 3K9TA 1C6VX 2IVWA 1SAXA 4RG8A 2BTTA 2L8DA 1KIKA 4OB0B 4C0ZA 4GYGA 1W1WE 3CCST 1M8MA 1FMVA 2O9LA 2RHZA 1E3OC 5E3IA 2I10A 1N9SA 1REPC 4DOZA 4Z2YA 2VKVA 3RIRA 1UGPB 3SWNC 1MV0B 2OCEA 1I5OB 3DFGA 1IV6A 2LRDA 4KN4X 1R00A 3OYMA 4J9BA 1M3CA 5GANe 2BHZA 1VQ6T 3CD6T 2QHTA 1IDZA 2HEQA 2H27A 3OS5A 3PTAA 4ZC3A 3NTIA 4YRCA 4YRQA 1MH3A 3OSFA 1Y39A 2CH4A 1S8NA 1TQMA 4N9IA 2LQNA 2ZZEA 2JA5J 1ZREA 5C3EJ 1LFUP 3CBOA 3CC2Q 4E51A 2QYZA 2V79A 4BKXA 1I07A 2RA2A 1CQTA 1ETOA 3L2QA 2E5KA 2EQUA 3P5JA 3M0PA 1YI2I 2QA4T 1NJIC 4BQOA 2ZIOA 2YU9J 2MH9A 1EV7A 3HEFA 4UV9A 2DTRA 5FW9A 1H88C 5FU6B 1N78A 4HWPA 3E97A 1X2NA 2ICWG 3EYIA 1PVEA 1SMYF 3BCBA 3WG9A 1GT0C 4Y52J 1U5TC 3UDCA 3CCMT 4GDFA 4M75F 4OB1B 1H3ZA 3VYTB 1UMQA 4JPBW 4YRPA 2ALYB 1K4US 1A35A 1IRFA 2LFBA 4AIDA 2PVDB 4RM3A 3EH1A 3M0TA 4HNVA 1K79A 4K87A 2AXTC 3G1MA 4XLAA 4OP0A 2M9HA 5FD5A 4OVAA 3TEGA 1WXBA 2LBFB 1SANA 5FGMA 1HSJA 1FYMA 2X4JA 1M90C 2VVKA 4YIFA 3OIQA 4A6EA 2VI6A 4E70A 1RUOA 4F55A 1A36A 1M27C 1N27A 1OQKA 1UGVA 4OF1A 2JK3A 3CCUT 1E3HA 1ZSGA 4B3AA 2Q7HA 1YTYA 1WHHA 2QAZA 2RF0A 4GBQA 3VQYA 5HKCA 1R5ID 1ZG1A 2PLYA 1AT1B 4HG2A 1A5JA 4J01A 3URGA 5CVVA 3RMSA 2Z99A 5FB2A 1QBJA 2NUPB 2M0CA 3S3OA 4FT8A 1VQMT 2RHSB 3GX4X 5A2QK 3OB9A 2EIFA 4A2UA 4BXFA 3ML6A 3S32A 1IAWA 1S3JA 3ZN1A 4KIFA 3BG3A 2JRMA 1O7FA 3OYLA 4M75E 3EGUA 2FXAA 3W6JB 1EVLA 3G71I 1J5YA 3HZJA 3F22A 3BG5A 5ICFA 5ICCA 5KAIC 3VODA 4AUXA 2CZ7B 2KQWA 2W85A 1HXDA 2EKHA 2RNAA 1UB9A 4J7FA 4G12A 3CCQI 2CSIA 5D6WA 4A4EA 1N9RA 1UJYA 2MWOA 5GAOp 4J15A 3E5XA 3V4GA 1ZSZC 3OYKA 4EJTA 2PU9B 1D0YA 3Q0UA 3QOEA 2RKHA 3C95A 4FYVB 1PG5B 5IP6A 1X2KA 4A3CJ 1IZ1A 2M9UA 4TVYA 2B7EA 5IT3A 5FU7B 2FEZA 1CGPA 1TW2A 3MF2A 1EIYB 1BL0A 1POGA 1I5LA 3ZMTA 3OL3A 3S1NJ 1WXTA 5KYXB 1X2HA 3JCMc 3RESA 4FQGA 3BR6A 2FG0A 1VTNC 1Z91A 3I5RA 3FJPA 4J6YA 2XAHA 3GTPJ 4R0KA 1SMTA 4ZDOA 2D8JA 1Y8RB 3LSQA 2NVYJ 1VQ6A 3G2BA 3I7FA 3GTOJ 5FU6C 1SHGA 2W0ZA 3NETA 4XM3A 3HGGA 3LQRA 4M78F 2ZT8A 2HCKA 1BN5A 4EJUA 2WADA 2WY8Q 5D5WB 3LSRA 1VQ7I 1SC7A 2CP0A 1PYSA 4L87A 3ULQB 3KP5A 4PL6A 2BE5F 5HK3A 2DKGA 1IF1A 4IHXA 1S6LA 1QRYA 1XG1A 4ON0A 2CW8A 4BE0A 3IAM2 6PAXA 2JOYA 2LCCA 4LDWA 2NS8A 2ZPIB 1KJWA 2M8GX 3CXCS 1YFTA 3QG1A 3TL4X 1OKRA 2PMZN 1UJ8A 2K2VA 2ROLA 3JCMe 3NGPA 2JTVA 3KLNA 1TQIA 1PCXA 5M9OA 2E1MB 2XGCA 3TW6A 5EG0B 1BBUA 3HXYA 1AWJA 3UGQA 3BQZA 4RMOA 3LOCA 3A01B 5KYWB 2CP3A 3ZQQA 1LNXA 3ZOBA 1X4PA 2XAJA 1VQPI 3FXUA 3R61A 1OZ2A 1TXQA 3C18A 1PC0A 2FVUA 2QQSA 4XQ3A 2ALYA 5GTHC 2ME0A 5BQTA 5J39A 1T0FC 3GZNB 3DU5A 3F9KA 4IEJA 2K02A 2AO9A 2AS5F 2V7FA 4AG1C 2CW0F 2LDUA 2K7LA 1ZBJA 2FRYA 3GF2A 1K6YA 4N4OB 2E5QA 2QGFB 1NJ5A 4P73A 4CH5A 1FZPB 4MTEA 4CC7A 4B43A 3H6ZA 4N4HA 3CTAA 3RACA 1BR2A 2ZC2A 5M3MJ 3PUFA 2EV6A 2V9PA 1JI8A 3IKLA 4H2WA 2JZYA 3KEYA 4YFXF 2EGCA 2FZCB 4RAGA 1ULYA 3MQZA 1XN7A 2CWEA 3OYNA 5GAOl 5JR3A 2ABLA 4C3JJ 4GFBA 1UHMA 2OF7A 4LOCA 1AWXA 4IIOA 2BZ8A 2JJ7A 1IRZA 4A5MA 4AFUC 2YRDA 3HFOA 3PZCA 3JCMb 5LGTA 4KQEA 3HXWA 3G7ZA 4M72A 4DYCA 4O2DA 4M7DC 1ZRDA 3CCMQ 1D3BA 4PGHA 1VQNT 1S9HA 4EMKC 4E6RA 2QUFA 2GAUA 2MD5A 2NAZA 1R71A 5GAOr 3OV8A 2XKOA 4NDLA 1X2QA 1IJWC 2ED0A 2X4YA 1H4QA 3L4GA 1EZZB 2NYXA 5TRDA 5E1ZB 3CCQQ 1H89C 1WJFA 3CC2T 3I3LA 3LNQA 3M4QA 2DL3A 1EFWA 5DUIA 2YPRA 3E6DA 3K1PA 1M4ZA 1QHGA 4D0PA 1WJBA 1J75A 2NVTJ 4RCBA 4LD9K 1VQ5T 3VSLA 4G9YA 2LLKA 5LBQA 4YFNF 4M3GA 3HPWA 2GTOA 2LBFA 4C92F 1VQ8I 3MO8A 3G71T 2LX9A 3KLOA 5ERIA 1OMIA 1T2KA 4AU7A 1UUEA 3M55A 1YJWA 1OZ3A 4JX4A 3TEEA 3C0CA 3HRKA 4BXUA 4PG3A 4KFCA 2G7HA 2PBIA 1WZOA 2AIRB 3DQVC 4I0AA 1ODDA 1OLTA 1K0XA 1ZHFA 5JLWA 1Q86C 2LQ8A 4OINF 3HFVA 3BJUA 3LLRA 3O8GA 5H6RA 1TUDA 5EEGA 1WHMA 4M7AB 2BVLA 2RH2A 3EDPA 4M3BA 2QASA 5JHUA 3RQ4A 3ICAA 3RKXA 1IC8A 3S2DJ 5KYYB 4GGGA 4ZYGA 1VQ7Q 1ONVA 1QCOA 5FKLA 2ED1A 1WSUA 1A6IA 2A7YA 1B70A 1WJEA 3CC4T 1PYVA 2P0KA 1PD1A 2F5EA 4HW0A 1B72B 2RPNA 4KR2A 3LFUA 3IQLA 4TVAA 4XL9A 3OYIA 5CKBA 1HW5A 3KX2A 3TP3A 2MABA 3JV3A 4FT2A 2XK0A 2CT4A 1MMNA 1DUXC 2JVHA 5J4YA 1SAUA 1CKAA 2WSCE 4PKCC 4OWRB 3QPLA 4P3PA 2VYTA 2RK2A 1PJRA 4IUUA 3TREA 3MFKA 1XNIA 1DP3A 1Y07A 4AFSC 4IRHA 2E2IJ 3VBBA 3VS0A 2NVUB 2X51A 4M7AD 2VUBA 3ZL7C 2PX9A 1YS6A 2ZKZA 3E6BA 4MEXF 3VEPA 2OTJI 3LW5E 4X1VA 5B1BH 2GQQA 2RN7A 2IGNA 1SVLA 4RS8A 1ZH5A 1HF0A 4PNOA 3QWLA 5EG0A 3MKYB 2EQRA 4BBRJ 2EQJA 3H0GJ 3KFVA 2XGTA 1IV8A 2W7NA 2E70A 2PMZA 1XS9A 2F5DA 4Y28E 2XUBA 3CJQB 1WA7A 4CS4A 1Z3XA 5HLHA 2RHUA 3I55Q 4KULA 4YRJA 3K4MA 3DBRB 2XRLA 1KQSA 1QPMA 4PGGA 3IUOA 4C2TA 2ESNA 1EQRA 1KA8A 2JUCA 4DBFA 1YQAA 1WLEA 3CF2A 1Q7YR 1W7PB 1PUEE 2F2WA 1LB2A 1N6AA 2ENMA 3CMQA 3ZPLA 2O4XA 3LAJA 2HTJA 3Q0WA 3LC0A 2KT0A 1RAEB 3VYUB 2XB0X 3VYRB 3JB9H 2HI3A 2DXBA 3FXKA 2X0LA 4M3EA 4N9HA 5M5XJ 3Q9VA 4HT4A 3CUQC 2H1LA 4XAXB 3JCMg 2LCSA 3RKWA 5ILVA 3NELA 1EIYA 5HGQA 3F23A 3M8JA 5GAEJ 2LCLA 1L0OC 3AAFA 3FX3A 2QGUA 1SVMA 2X6YA 3H0HA 4LLLA 3K4JA 1F5TA 3UATA 3CCJQ 2CZ6B 3D5RC 3HTUA 1RIOH 3LH0A 2LNVA 2XPVA 1LDKB 1QKXA 3DF8A 5IHKA 2ZT6A 1LEAA 1WHUA 4QPOA 3FMQA 4BY1J 2FMYA 3ZQIA 2BKDN 2OTJT 1QZYA 1NYGA 2COZA 3CMEA 2E1OA 2XAGA 3L2VA 2MOXA 2X1EA 4G6TB 2JVGA 1N8RR 2C0TA 2IPOB 4KICA 2A07F 3G1JA 4CC3A 4D8DA 1B9MA 1YRNA 4KGZB 1YJWT 4GYIA 2DDAA 2V8JA 4YDQA 1NBEB 3RQIA 4NQWA 3NEMA 3I55A 2QBYB 3EQLF 1C0WA 4CXFA 3BG6A 3NEUA 2JT1A 5CCAA 2DLLA 3CCET 1A6QA 2KRSA 3H8ZA 1O3QA 4HDUA 3HUGA 1RLPC 1UELB 2ZJ2A 2OZUA 2NXNB 2KXDA 2L7FP 1M1KR 3GNGA 2RHQB 4GXOA 3GTLJ 4BJTA 1FOWA 3QWXX 4FT4A 2EH3A 1S29A 3R0AA 3IHUA 3KP3A 1FYLA 2CMPA 3GF5A 4HVVA 1VQKT 4QT7A 3FKIJ 2MA3A 3CD6I 3QO7A 2ESHA 2NOJB 4OIOF 2C0IA 2BY3A 1AOJA 4C92D 3L2RA 4NC8A 1SD4A 1R1VA 1TT0A 2DA1A 2WC2A 2COBA 4RLQA 3M0SA 1R7JA 1L3LA 2KRHA 2WV1A 3S2WA 2QHSA 4BHBA 4AYBA 3BOQA 1W2BS 4YRRA 2CH4W 4CCNA 2QI2A 3LH5A 2Q8KA 4FHTA 4GO1A 4CCMA 5E18F 4L5EA 1K76A 2VIXA 5JHFA 5K7HA 1B34A 2R7WA 2OTLA 3MEUA 2XD0A 2E1MC 2VQGA 4XNFA 4IVNA 2IS2A 1AWOA 4RB2C 2IA2A 2TDXA 5I21A 1E7OA 3H9GA 2LP5A 3DLLA 4MDWA 4UUVA 3J81E 5J26A 3QXEB 1N77A 1SD5A 2E64A 1ZG5A 1WQ2A 1YLFA 2XIGA 3FDYA 4JX6A 2E12A 2HYFA 3IWFA 3QU3A 2W48A 3K4KA 5FROA 1RAIB 4H2VA 1VQNI 1R1TA 3P9CA 3I56Q 3QTCA 4II2A 3VSKA 3CESA 3WU1B 5M5WJ 4E7IA 1MJBA 1Z0XA 5EF6A 3Q5FA 1HBXG 3SFIA 2O6GE 1YWOA 4J8OA 2KJBA 3SWNB 2KZGA 3A0BC 5GAMh 4G94A 1R0BG 2BE9B 3GFMA 2R7RA 3QOPA 1MIJA 3MN2A 3KYLA 5H6QA 2XB5A 3E6CC 1M1FA 3OMGA 5FFZA 2EW3A 3A8OB 2RNJA 5LHIA 2L7ZA 1QVGP 2HQRA 5KNNA 1V3FA 3MAJA 3SZGA 2CJ9A 1GXQA 2A36A 4PDKA 4D5FA 2JMWA 4CC2A 4I7HA 2HQHA 4Z89A 1JT0A 3J7ZI 1R4MB 1WJCA 3PQJA 3FF5A 1WGSA 2YT6A 3L1PA 2M0YA 2ISZA 1D1BA 1YIJA 1R0CB 3SQNA 3V8KA 3NENA 1BBYA 3MZHA 4E6KG 1JRIA 3FM5A 2E2JJ 3WE2A 3EG9A 2WAFA 3DV8A 1IXRC 1F1BB 1OULA 3GVAA 2V6EA 1MBFA 4U7DA 4XTWA 4C8QA 2WA0A 2OTJA 3TP0A 1R9TJ 3UH0A 4IQ4A 3UA7A 3PSFA 3TKYA 1I3AA 5LRRA 4YRVA 2KDZA 3WU0A 1I1SA 2QDYB 2RQRA 1UHWA 5GAMg 3I56A 2P84A 2HYJA 2RB6A 4C8QB 2DQ0A 4FE7A 4LIUA 3O3KA 2M02A 1B7YA 2CJBA 4TVAB 4C3HJ 1QWEA 2ZPGB 3L9FA 1X1PA 1HW1A 4F3QA 1A31A 1WFWA 2J6OA 4E7ZA 2JXBA 2NYSA 5AIQA 4L6V5 3ABKH 2DL5A 2F69A 2K6DA 1KU9A 1D5YA 2ECZA 4A5NA 2ZPHB 1FSHA 3DKMA 2ZR2A 2DXUA 2ZO4A 2NNYA 1B4AA 2EBIA 4XBFA 1FLIA 2H94A 2P7CB 1Z9ZA 3Q1JA 3X26B 4CH3A 4RGXA 3V8JA 1VQPA 3R07A 4U0WA 4RB0A 1IN7A 2E4HA 5L23A 4BDZA 4EM1A 4I76A 4LD6A 1ASZA 2DMPA 2YXYA 3HGYA 2YR2A 4DIQA 1B34B 5C4XJ 3EG3A 4M7AF 4TQDA 1OCOH 2K2MA 2BIVA 3H5NA 2J05A 3J7AO 1SD6A 2VN2A 1Z9CA 1QZEA 4CO8A 3W2WA 3IC7A 2JPBA 4MIMA 3KFWX 4I01A 1BCMA 1H3HA 5KK1A 3M4GA 4HCCA 1RKWA 1MNMC 3OYAA 4ENJA 3DBHB 1D1CA 1RI9A 2X9DA 2ZZDA 1BYMA 3ERRA 4KISA 1NHAA 2V1NA 4X0GA 3TEHB 4BAYA 4B09A 4AWXB 3RZDJ 3WXMB 5GAMf 2XHKA 3W2AA 2F48A 2G0EA 5E1XA 1HC8A 1FP1D 1YJNT 3S1QJ 1SD7A 1XSDA 2DMUA 2MYSA 4EMSA 2L5QA 1WJSA 4CRIA 1ZARA 3NFCA 4CS3A 3EUAA 4EMHA 3SEZA 1O9SA 1WKMA 2E34A 1NTCA 3JW4A 2KRNA 3PGGA 4U0VA 4R55A 3ABTA 4DYQA 1W0TA 4CZCA 4LLNA 3IRRA 4M78A 3IL2A 3QDRB 1M1KC 1YFRA 1ACIA 2TCTA 2R7XA 1QZZA 1OCZH 2KZVA 3I0TA 2WTEA 5LFAA 1U06A 2MMPA 2X3WD 3AG2H 4RG2A 3CMAI 4DBQA 4IOCF 2EFOA 3G4ST 3CCJA 2IP2A 1HKTA 2EFIA 2RV8A 2PEXA 4HLXA 3CDLA 1RLQC 2EINH 3EHRA 2RK1A 3E9GA 1MBJA 4TWAA 2CGHA 3GO5A 3VS5A 2LKSA 2JRTA 3DBLB 4XMYA 5IOZA 1LOJA 3FXQA 2F5VA 2LC4A 3RKQA 3I4PA 1KQ9A 1MBGA 1UDLA 2VB6A 4ZIBA 3HJEA 4HF1A 3HG9A 4P55A 2K40A 3FM3A 3H0DA 2DBBA 2VE8A 3DP7A 4JUVA 3M9AA 3F6VA 5J47A 4WCIA 3RDVA 4RGUA 2AHQA 1DPUA 4IURA 2LSOA 1GCQA 1WYXA 3S3MA 2X1CA 3RYPA 5J8FA 1STZA 1IG7A 3Q9SA 5HLTA 3DLMA 2QK0A 3BQYA 4OMLA 1MNDA 4DYRA 1H641 3KP4A 1WU7A 2P4TA 3M4YA 2DD5A 2EFQA 2R5ZB 1RAGB 2MI6A 1ZG3A 1FPQA 2Y90A 5D4RA 1GV5A 1JXMA 1MSEC 5IYBJ 1K7AA 1FBUA 2WAQN 4BJ5C 3DPLC 3JCMV 3OBYA 2ZT7A 2M4GA 4S0HB 2VLAA 4NB5A 2I4MA 1MD0A 5E3OA 5CJ9A 4LG0A 2JTEA 5GAN4 2B0LA 5EZHA 1JHHA 1BIAA 4NC6A 2E1NA 1GFCA 1K73U 4YRTA 5HODA 1X69A 5LJ3g 1L0WA 5HLIA 4UUSA 3M0QA 3BR5A 2B86A 1R77A 3LSSA 3RPQA 3CEYA 1WH5A 2D45A 4O3MA 4J00A 1XX5A 3CUQA 1G2BA 2VGNA 5IYDJ 5KE3A 3WVEB 3ONQA 2KPMA 2LF7A 3CCSI 4RTTA 2Q2EA 3RPUD 1RC9A 3JCMW 5LJ5h 2Z16A 3CC2A 3P8TA 3I35A 1Z7UA 4UVAA 3EPZA 2ZT5A 1W4SA 2IS6A 4UHTA 2DTIA 4LVJA 4IHTA 3G3ZA 1B72A 1ZA2B 3VUZA 3M07A 3COAC 5BMZA 3EGXB 3HKSA 4XR6A 3JCMX 1B8IA 2DMNA 1MHNA 2MK5A 1X1DA 5FFXA 2MAMA 3EG0A 5KCMA 1YNZA 2DPPB 5LL6S 3HXVA 3HXZA 5J3BA 1X6BA 3LSJA 2QQRA 4C92G 2ODRD 4A3KJ 1E17A 3A8MB 5E3LA 3A2KA 2J06A 1K9AA 3N4MA 3BR3A 2DTOA 5EDNA 2GGRA 1OPCA 3F8CA 3OYEA 3K1MA 2XKPA 4N0BA 2EYQA 4FW2A 4ATOA 1QVFP 1RPWA 1DQUA 2W24A 1VQ6Q 3QJYA 3PNYA 4XKWA 3GZ6A 4M75A 4E7SA 1VQ8A 3A8GB 1QVFA 3FC3A 2K3PA 3VDXA 4NNJA 1LYLA 2GFAA 1K6OA 1PSEA 4YRNA 3ER0A 3OW2P 3E9IA 1GFDA 3QYGB 2LYCA 3E7LA 4KT0E 3CC7Q 1JXSA 3IKMB 3O5ZA 2Y0MA 1D3YA 5GP9A 4DW6A 3ZQFA 3BTCA 3WTVC 1ZSZA 1UCRA 1Q86U 1SVOA 4M9ZA 4LE9A 4S04A 4RMFA 3H9QA 2GQVA 4FW1A 1V55H 4UXNA 3K4NA 4DZJA 4HX4A 3QZ5B 2CUDA 2EYXA 1U5SA 3WHBA 1VQPT 2ZFWA 4LIVA 2QTVA 2JVVA 1IW7F 1U9NA 4I02A 3GCMA 1Z05A 1XSXA 1UHCA 1NJIU 3T5XA 1E24A 2PJPA 4N4IA 3ZMZA 4UPAA 1NJIR 4IUQA 2L89A 2OBPA 3M7GA 4XKVA 5CQYA 2NWMA 1V29B 5GAMd 3TSZA 4LGWA 2W4SA 4CC4B 2M7BA 1BI1A 3TEDA 1I8FA 1NJ6A 5K1YA 2OTLI 1QCFA 2L7MP 2VPRA 5BPDA 1VQ4Q 4CS2A 2WV0A 4YPFA 2LT1A 2XRNA 3MQ0A 3ASOH 5H2FC 4RKUE 4KIGA 4PSWA 2HMAA 4EMKB 4U87A 4H2YA 5TISC 3J7YJ 2IY5A 2PVGB 5BOXA 5DD8A 3IRQA 1OI1A 5D6EA 2BZXA 2E3IA 4NUBA 2LTOA 1AHJB 5B3SH 1QKWA 2Y9ZA 2K9SA 2FB7A 2GA2A 2RD1A 5GAN6 1M90U 4XEMA 1Z6TA 2D1HA 1YYVA 2P5KA 2FJ1A 3X28B 2XI9A 1X54A 4XSZF 3FBIB 2L2OA 2ARTA 1HKQA 2FBHA 4WCGA 3ECHA 4HX7A 1HYOA 5BS6A 1KSWA 5LHGA 5J4VA 1RACB 4JLGA 4JRKA 5KYYA 4OMNA 4P5OA 2Y69H 4XLHA 1TBXA 5J1UA 2F5CA 5LGUA 3QBYA 4JDSA 2A5YB 5CIUA 1VQ9A 1DJ7B 2FD5A 3NMZC 4HVCA 1OISA 3JRHA 4OIPF 2QKMB 3NPFA 2HDAA 4LJZF 1LUJB 3SFZA 3PVQA 5CKTA 3I54A 5GMKj 2X6XA 1MMAA 3DEEA 1I50J 2MPXC 2R5MA 3VYSB 3WU2C 2R5YB 2LT4A 3T8TA 3DB4A 2EA2A 5DYMA 1WIEA 1Y71A 2KR3A 3ASKA 3NAUA 4C8QF 4HT8A 5LJ5e 3PJRA 3REAB 1UB4A 4JBAA 1ZGAA 2QWWA 2KIQA 3HB9A 4Q48A 1HD3A 2FHDA 2M0OA 4C8QD 3GOXA 3RR6A 2HPIA 3VOEA 4RTZA 1G2HA 2KISA 1N8RU 1HJDA 2JNGA 2YSRA 2XDVA 4Y15A 2KSSA 2KT8A 3HHTB 4BDYA 3IH4A 4HCZA 2J6KA 2BBYA 2RHXA 1SSHA 1UE9A 2LNBA 3OS2A 2YWWA 3JCUC 4UY8I 2JZ2A 2KYBA 3J80E 4AYBN 3HRTA 4UUSB 4X34A 2NOGA 4YEJA 1OEBA 3KZYA 3S1RJ 4KUMA 1YI2Q 2ZMEB 2PMHA 3VB2A 2JA2A 2WBMA 4KMFA 5DUKA 1AWCA 1GCPA 1UGSB 2PUOB 4L5GA 4QVZA 4UC4A 3G71A 4F52A 2QA4A 4OOIA 3JB9I 4PLLA 4XLFA 2BZYA 1BK2A 2YUSA 3JAMK 3BE3A 2FRHA 1NH3A 4K86A 3CJTB 3F8NA 2FUG2 3OMYA 3OYFA 2FU4A 1RZ4A 3FKJA 5EEHA 1UFMA 4D9JA 5IYCJ 3IV5A 2CFOA 1PP8F 3MP6A 4C9YA 3PO3J 3I56T 2BEOA 3A8LB 1RAAB 4RGRA 2NUTA 2N8GA 2I0NA 2HS5A 1KD1C 1OCTC 3S1MJ 2O0YA 2DNUA 4WI1A 3ESWB 2CQQA 5GAN5 1W36C 5F0CA 1AU7A 1YCYA 1AZEA 1HSQA 2MCNA 4EEFG 3A03A 3MKWB 3HTZA 2VODA 1Q81R 2IXSA 3REXA 4II3A 4P74C 3MP8A 4M7DE 1IXCA 4F7UA 3H0FA 4HWRA 1HOMA 1IXDA 2BY2A 3PFSA 2ZPFB 3HFNA 3INZA 3CMET 4P72A 1ZR4A 3L00A 3RZOJ 1JUSA 1KYZA 4HXJA 5FWBA 2PI0A 1N5ZA 5HVQC 3P8HA 2XF7A 4PJOF 3THKA 3TBIA 3H3VK 3MCAB 2ELJA 2BXZA 5A2QZ 3CCLQ 5LJ3f 4XSXF 3OR2C 3F6OA 1K73R 3I4NJ 4C92A 1UG0A 4WXHA 4JK1X 2W00A 1WH7A 2AK5A 5LJ3j 1RUWA 1JB0E 1SRMA 2L3SA 2QYOA 4LVIA 1YP5A 4YRLA 2GFUA 1XC5A 2RI2A 1VQ9I 2HXIA 2P0WA 1FSEA 1NYQA 4P73C 3PIPA 3BG7A 2AKWA 2K3YA 4V19K 1ZLJA 1I6HJ 4PHCA 5EGOB 2VJIA 3T8RA 4BACA 1TH7A 1H0MA 3DEWA 5FLXK 1IUYA 2ZPBB 3IWZA 2OU2A 4P72C 3HXUA 1JTXA 3KP6A 1T08B 4PK4A 1YHQA 4A3FJ 1KYWA 2XMFA 5GAHJ 3QO8A 2W57A 2O4XB 3L7WA 3VYHB 2RHYA 3G4SI 3F72A 3CMAT 3SB2A 3LFKA 2EL9A 4P74A 3W3SA 4HDVA 1SSFA 4H4KC 1SESA 3F8MA 4ZYDA 3OIPA 2RJFA 5M5YJ 5E79C 5L3CA 3ZQ7A 2QKLB 2HOSA 5CYVA 1FOXA 1QHHD 4HV6A 4EGYA 5BPIA 1AOYA 4QIWN 1TOVA 2CP5A 3JCMQ 2L0KA 2OZ6A 5B5EC 3UWNA 3TQNA 4AFQC 2DPUA 5FLMJ 1ZA1B 4C8QC 3A8HB 4AFZC 2K79A 4FASD 3GTQJ 2VJJA 2ZXHA 4PSXA 2VE9A 4RDUA 3BJOA 5A0LA 1RESA 4RTUA 5LRSA 1FIPA 2YLBA 2OJED 4WWCA 1BBZA 5GAN2 1OFCX 5A2QE 1BBWA 2X6WA 4ESBA 2E5AA 3GW2A 4Z6YA 2EVRA 4IPAA 1XGOA 4XLEA 3LA3A 1BW6A 5I2SA 4M77C 1W0UA 5KE2A 2FPFA 4L5JA 2OX7A 5GAOq 2A6HF 2K4YA 2VBZA 3U1KA 2PMUA 1GRIA 4CI0C 2E3CA 1S7OA 3S17J 1X2MA 4XTZA 3BWGA 3VS3A 4ZTJA 4BYYA 2CQKA 5KNLA 5FLXZ 1IO6A 3HIFA 2Q1ZB 4DGWB 2J5OA 2LK2A 3U9GA 2C6YA 4L0YB 1WJRA 2SRCA 1YITT 3CCVT 2NNNA 1QCNA 2FQ3A 2DFIA 3JSPA 1Z67A 2KKOA 1PYSB 2WWYA 1W2BA 4KT5C 4JX5A 1SHFA 3BJ6A 3LSTA 2VKNA 3NHNA 3JCMJ 4D7NA 3DCFA 2HQXA 2FF4A 2HQEA 4QQGA 1ZKGA 2KL4A 1Z1DA 4J9GA 3WTTC 3HL2A 2P6SA 2ZINA 3ZFJA 5D8LB 2DIQA 5D8KB 2EV5A 2ZNJA 4DBHA 1Y0UA 3ECOA 2ADUA 2V8IA 2R7UA 4MDXA 4CZZA 4G7ZF 5ED4A 4M77D 4LK0F 2V8KA 2ZR3A 2HNHA 2O8XA 4UNOA 2JA7J 1M90R 4MFDA 4CCLA 4HNTA 3GFIA 1T98A 2EJ9A 2LRQA 3KE2A 1APLC 4J9IA 4AT1B 3OA6A 1QPIA 2R5ZA 5HS9A 2ZBKA 3TOBA 2HDDA 3E2UA 5E8IA 3CCLA 2XG8D 1OYXA 4M77F 1ZBXA 1X19A 4RTWA 4IOAF 2EFNA 4YREA 3TOAA 2CGPA 4M78C 4C0FA 1XDUA 1M1KU 3GMEA 4PFZA 5D5XB 2ZCFB 2KHMA 2M1BA 1IN4A 4Y4RA 1UHSA 1W6XA 1Y96A 1OX8A 3BCAA 3CCQT 4HF0A 3MHXA 3OW2A 1X55A 4JJBA 1OCRH 5L3GA 3LSMA 4EPCA 5FKOA 1TTHB 2HZTA 4BQQA 3I56I 4XORA 1YJ9I 4A3LJ 1RAFB 2WACA 2X35A 4FSXA 3RTRA 3AG1H 3HOZJ 2R7TA 2K5IA 4L9TA 3P8YA 1EX4A 2HPMA 2DTZA 2FMLA 3LWFA 1YFNA 3S16J 1TWAJ 1NG6A 5GAN7 1YHQQ 3FXMA 1HKSA 4E7KA 1P4AA 1JE8A 1XJWB 2EILH 4JS5A 4RB1A 1XGSA 1BI3A 1YOVB 4JZ4A 2LVSA 1EF4A 3CCJT 4FYYB 4A53A 2M5WA 4R1HA 2HL3A 2A61A 2DU5A 5HCKA 3JCMP 5I11A 3C2HA 3DU6A 1JT6A 3M9QA 5KYNA 1ASYA 4JQFA 1PRLC 4QKUA 4M77E 2A5WA 2Y30A 1WI7A 1YN8A 3EG9B 5CKHA 1MDMB 1JGGA 1LEBA 1TSFA 4ZJZA 5GAOm 3CPWP 1Y56A 3DLLF 3OWTA 2DO7A 4J9EA 3P9IA 1YO5C 5GAMe 3H5AA 4Y17A 2HYGD 1KG1A 4YTLA 3QDFA 2L4AA 2XAQA 4HAMA 3NWSA 2XSDC 4BL0B 2DJQA 2ZJPF 3CO6C 1YJNI 4G7OF 4CH4A 2EFWA 4IHWA 4PJOE 4L18B 3JB9G 2HSPA 1H4TA 4N0AC 1Z7NA 1QQIA 3S93A 3L1AA 3CCRQ 1BKBA 1VQ5I 1SG5A 2DFUA 4XKBA 2EJFA 4PJ0C 1D1AA 2MIOA 4YRFA 3IG2A 3BY6A 1HDDC 1Q81U 2XGXA 3QRFF 4DPGA 5J1RA 3HL8A 1K78B 1ETVA 2EYZA 2H6BA 2W82A 2R92J 3V7SA 4IUVA 3CC7I 5CKFA 4IIMA 4M75B 3VPRA 4M7AC 1Q81C 2RREA 1Y1VJ 2R58A 1I4K1 4UP7A 2ZXJA 1ZRCA 2RDPA 3HSRA 3O2PE 4OU0A 4YIRX 4M75C 1YHQT 2FNAA 2KJCA 3F21A 2GLOA 2JQ7A 3M4OJ 2NUTB 1R4NB 2CUZA 5AT1B 1WPKA 2D5VA 3VS6A 2VASA 4LN2A 2D1XA 1NJ8A 3R0JA 2AZSA 2K9NA 4HT9A 3FK7A 5ICGA 1JJCB 1M1EB 1W7PD 2IS4A 3S3NA 4PJOD 1O7LA 4QVCA 1I1JA 1WHLA 4M4ZA 5K1PA 4Q5SF 2EIMH 2QHUA 4Y91A 2HAXA 3S15J 1XD7A 2MFZA 1JKQC 4PJMA 2COWA 2IG0A 5C0MA 3ZGKA 1R36A 1BB9A 1SKUB 4N4NB 3BTIA 3JRAA 2CT3A 2C06A 4ORZA 4EIKA 2HKXA 3FXOA 1VUBA 2X3XD 1GXIE 4LDUA 4M78B 1S5LC 2OUMA 1XGNA 3WHCA 3TDZC 5GPCA 1LFBA 2O03A 2R7QA 3CUQB 1U1TA 4R79A 2QQ9A 5GAGJ 1NM7A 3ZN0A 1D0ZA 3RCOA 2VKHA 3WTSC 3CMAQ 5JI6A 5HLGA 4XKCA 1NPRA 3DSQA 1S7EA 1TTYA 1W5CC 1G3WA 1MV3A 5KCHA 2XDDA 3WTXC 4A63B 3A7AA 4JS4A 2LQKA 3ERMA 2DFEA 2JWTA 2P8TA 3OS1A 1NLOC 1UJ0A 2K3XA 5GANf 3QUIA 1ARKA 2ESWA 1USYC 1RRJA 4YRSA 2XAUA 1ZR2A 5AIPA 1WCMJ 2FBKA 1X1BA 3WTUC 5E17F 4QPQA 4D5CA 1M5Q1 1ZUUA 3GPLA 2XDBA 2ISYA 2FZGB 1USYA 1OYIA 3OR1C 2Z9OA 3HPHA 4C3IJ 3C2BA 4OB3B 2E2HJ 3RL6A 1XDSA 1GGMA 3CLOA 3EYYA 2HWVA 4P1WA 4BHPA 2UWMA 2CKKA 4XU0A 1DP7P 2QEXA 3CD6Q 2XPWA 1YCSB 4WXDA 2DXIA 3X25B 4EJWA 5FJ8J 5EZGA 2BY0A 2A37A 1RI7A 2PTKA 3OBWA 4JJDA 3SEMA 4DEYA 2AMCA 4M3FA 5IXBA 1TP4A 1PKTA 4ZTUB 1KQ0A 3H9JA 2HQAA 4XRSG 4P71A 5AONA 1Q82R 1FYFA 3HOSA 2YUQA 4AG2C 3UKGA 2H3EB 4PLIA 7AT1B 5F6FA 2AMCB 3Q0VA 1OYYA 1HC7A 2D2WA 2QZ8A 1WHKA 1KC8R 3IH2A 3K4LA 1M2VB 1GVDA 2W84A 1LFPA 1P7JA 3H3ZA 1NG7A 4KT6A 4M74A 1EH8A 5CKEA 4LDXA 2C0OA 1YIJI 3FDRA 1U2WA 5FRMA 4GLKA 3WGIA 3GFLA 2KMUA 2VC0A 3ZQLA 3G1ZA 5CVIA 2ZZGA 4FE4A 4A54A 1YW7A 9ANTA 1TG0A 2JMAA 1QW1A 1ENHA 2WSFE 3HUGB 1YBYA 2KAFA 3K10A 3OYYA 4ABZA 2L9RA 3U21A 3HY1A 1E22A 3BR1A 1VQOA 4XICA 4MHGA 1T8IA 3CCVI 1MBEA 2DODA 4PFPA 1IGNA 1LVKA 2DX1A 2NUPA 4HVUA 5CO7A 5LJ5f 4M7AE 4YELA 3ZQGA 4FYWB 1FJLA 1YE9A 5DS9A 1TWFJ 5HS7A 3QP6A 1D3BB 1OPKA 3FEOA 4RQFA 3H92A 4A4KA 4EO4A 1K78A 3CCSA 1H92A 3OQ5A 1WJAA 3KYCB 3CMMA 1FXXA 2DE0X 3P8BB 3MKDA 4NL3A 1VYVA 3HOVJ 1OU8A 4B48A 4V2FA 1T0FA 4FCYA 4IZZA 1W70A 3FXRA 3CMAA 4MZTA 4Q15A 3CCLI 4P75A 3L09A 2H8RA 2QXFA 2DLPA 2FOWA 4ZH4F 2E19A 2G6FX 2DJNA 3V7RA 1S1NA 2CIMA 2Y75A 3AKZA 1U8BA 2GCXA 1TUGB 2G9WA 2CUJA 5HK0A 4U88A 1XGMA 5IOYA 4R8HA 1YX3A 2M2EA 2STWA 2Y4XA 4J9CA 3SFMA 4H2XA 11ASA 1R1UA 3E19A 2PFBA 1SFXA 1KGSA 4F7UF 3CMEQ 4JRPA 5CPRB 2LP0A 3T1BA 3WG7H 1UHFA 3HC7A 2RO0A 2MC4A 3M0UA 4Q6GA 2GBYA 1OJLA 2L3DA 4DJAA 1JO8A 2K3BA 1EKEA 1PDNC 2NVXJ 3HP9A 1KQSP 1HW2A 3LSIA 3HOTA 1ITYA 2EZKA 3SDBA 1IZ6A 3LSPA 1GCQC 1VYTA 1B1BA 1ZYRF 2HOAA 4FTHA 1MGTA 2NRAC 2BE7D 2YRVA 4YRIA 2OJ2A 3M57A 3C1DA 3OOPA 3M53A 4F17A 1HTTA 4H2UA 2ME6A 4YCUA 3VQWA 3HY0A 2KRCA 4J9HA 1VQMI 1XMXA 4A3DJ 1B6AA 1VQMQ 3GXOA 1Y7XA 4PJLA 1GHCA 4GY5A 1EVKA 2CP2A 4ENNA 2BUDA 4ESFA 1V5FA 4HLYA 2VBWA 2L3QA 4B1RA 2GBQA 3S6WA 4OMYA 3E5UA 3LL7A 1IXSB 2HZDA 3I5UA 1G3TA 1BU1A 2CQXA 3TW7A 4A3IJ 1O3TA 3CCSQ 3MVPA 4HYEA 4LD5A 5D4SA 3PIPF 3GYHX 1KU7A 2JTFA 2DN0A 4JJNK 3RYRA 1X1AA 1JJ8C 1VQ4I 5DY9A 2E1CA 3CBPA 5F5WA 2RVCA 3A02A 1X3WB 2CS3A 4F7ZA 1NEGA 1P4XA 1VNDA 3NTKA 3SHWA 1FT9A 2HU9A 2IS1A 4PJOC 5GPAA 1IN8A 2RGVA 2FL7A 2YSQA 4HCKA 3CCEA 2DETA 1KD1R 2I8DA 1SFKA 3FB9A 2E7XA 1VIEA 2FX0A 1LNWA 2CO5A 4IF4A 4BH9A 5IP7J 4ZGDB 1YFSA 3JCMd 2UUZA 4BE2A 2I2LA 1NJ1A 5IT9E 4WTOB 4P75C 1PRMC 3JRIA 1NK2P 3AFHA 5AYFA 2CG4A 1Y57A 3K2AA 4KGVB 5C6SA 4N0AA 2JM8A 2VOOA 3RF1A 2LH9A 1U3OA 1X56A 3EFSA 1BA5A 4HBLA 3OW2S 3CCVQ 2AXLA 2O5RA 4M7DD 2RM4A 2PMFA 3SYTA 1ADJA 2R7DA 2QA4Q 3DXJF 1QE0A 4ENKA 1MDMA 2A08A 3L2CA 2Y0SA 3CC4Q 2BVMA 3F0CA 4FL6A 1DGRM 2OTLT 3C3WA 2WSEE 3CCUQ 2E41A 2IW5A 3CP8A 2MH2A 4J6XA 1U0JA 4F91B 5KAFC 1KOGA 4Q4ZF 2YX7A 3I4MJ 4H02A 1IN5A 3KEOA 2CJJA 4JRQA 4PUSA 1TWBA 1OPLA 1M1GA 5D6YA 2B8AA 1N25A 2R7VA 2KQRA 3OIOA 3GFJA 4OMFB 3A5ZB 1GL5A 3A74A 3ZQHA 2A6TA 2K3FA 2A3LA 3GBGA 2P81A 3RDIA 4ZGJB 5L3FA 4NS5A 5LJ5d 1O57A 1OR7C 1BJAA 3GUDA 5H20A 4A0ZA 1RADB 1FYKA 3R6OA 2DAOA 2K5LA 2Y48A 2EJRA 1LJ9A 4RMNA 3K4BA 3ZMSA 3OSVA 2EA4A 3HHHA 2DFHA 4A3MJ 4A0YA 2DDZA 2FA5A 3E3VA 2IRFG 1UGQB 1H4VB 1WVRA 5C51B 3IKTA 2ZB9A 4NQWB 3HKZN 3OYGA 5IT9Z 5L3DA 3JREA 4DOWA 1FNNA 2MWPA 3FZVA 4M7DF 4RTXA 2DQ3A 2DILA 2DIGA 2DQLA 2RI3A 4FETA 2VJ4A 4A4HA 2L7KA 3S8PA 3NRVA 2CUEA 1VQOQ 2DZCA 3ZEHA 1YJ9Q 1G4DA 2YX4A 2P0PA 3SWNA 3LA2A 2F4MB 4HQEA 1VQPQ 4CDGA 1CKBA 1FYNA 3J7AY 3CCLT 1W5SA 2DK8A 2KVQG 5FU7C 1WI9A 2KGTA 1HK9A 3BDLA 2FOKA 4B44A 1JEGA 2D0QB 4KMUX 2JA6J 2MBFA 1O4XA 2KIMA 4UB8C 1W4MA 3DPTA 3G1LA 5KYWA 1VQLQ 3MPUB 4M78D 4ESRA 1AEYA 5ELOA 1G5HA 1LVAA 5KYUB 5DCMA 1I6XA 3BZ6A 1DDNA 2ZJRF 2DXCA 2NS0A 3K1NA 2K27A 5GTIC 3I55I 3FWEA 4FYXB 5LLQA 5E8GA 1G3SA 3B6AA 2ZCEA 3CCVA 3E5QA 1C1AA 1MNEA 2J3MA 3RGLA 5JVTA 2FSWA 1C0AA 1BOBA 3CCEQ 2YS9A 3KYDB 4P5NA 2TRTA 1TWGJ 2EJGA 2WB1N 3FBNB 2W1OA 1UG1A 1PUFA 3TSWA 5IY5H 3IKVA 2IGOA 3KBGA 3QPHA 2MSYA 5HDNA 4RCCA 1NE8A 4KA4A 3ZQCA 5KVRA 1WZ2A 2V4JC 3BW1A 5I2MA 2CRGA 1K9MU 4XTXA 3BLYA 3LWIA 3D5SC 3QYBA 1LJOA 2VQCA 3IH3A 2CREA 4KH0B 3HHGA 3CCRI 1ETQA 4LMYA 3LMMA 4A6DA 2F2EA 1FY7A 5TJJA 3GZ5A 4HWTA 4G6DA 1N8RC 3OYDA 1VFCA 4Y92A 4DBRA 2DU9A 2RHQA 2ZMEC 2G3RA 5B66C 3OMCA 5GMKe 2LREA 3T9NA 1VQMA 3ISPA 4CUGA 1B59A 3DTKA 3MKLA