3RIRA

Crystal strucrture of biotin protein ligase from s. aureus
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Crystal Strucrture of Biotin Protein Ligase from S. aureus
rcsb
source organism Staphylococcus aureus
total genus 102
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rirA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rirA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rirA02
3MCZA 2RHQB 3O6BB 2VE8A 1Z7NA 2DXTA 5GAN7 4L5IA 1O3RA 2A69F 4K2EA 3O2PE 5D4RA 2I4LA 4RGSA 3IKLA 5ILUA 4P72C 3GFJA 2VC0A 2O6GE 4H2TA 2O03A 1QNTA 4AIKA 1K78B 3S2WA 1U2WA 3ZMUA 2BEOA 4N0BA 2ZGWA 2R7FA 1ZGJA 3E3VA 3QAHA 1NNHA 4PJOG 1DUXC 3SWNA 3JCMe 5CVUA 4MEYF 2CWEA 5E8IA 4CH6A 4UNOA 4K87A 4ZZDA 4G6DA 2VT3A 4PJOD 1YFSA 4M75F 1NJ8A 4HLXA 3F8CA 3EFRA 5HLHA 1O3TA 1QGPA 1XSDA 4QVDA 1S3JA 2LF7A 2ISYA 2OZ6A 3JCMb 3ZMSA 4RCCA 5GAOq 4YRQA 3J80Z 1YFHA 1ZREA 2JSCA 4CICA 3ROUA 4N0AC 5LGUA 2PI0A 1USTA 2BV6A 5FO5A 1RUNA 4EO4A 3WGGA 5LJ5h 5HS7A 3I53A 4PJOB 1TH7A 3GVAA 5LHHA 3JSPA 3HRSA 4RB3C 2Q0OA 2C6YA 1GGMA 4HQEA 2G7UA 4YRRA 2MH9A 4HT9A 1BBYA 1USSA 1I1SA 4UP7A 2EV6A 5CVVA 2PN6A 2X4HA 1R1TA 4QVCA 2CW0F 3BZ6A 2Q7HA 4YRTA 5LEJA 5C52B 2EK5A 4PJOE 2V1XA 3NEMA 1B6AA 2EA4A 2EWNA 4ESBA 4XU1A 1E1TA 1ZLJA 4C92A 1R1UA 2TDXA 2CGHA 5HOOA 1B59A 3DQVC 1JGSA 3NENA 3L2CA 4M74A 2YHTA 2MD5A 5GAOm 4BHBA 4Q15A 1YFRA 3TEHA 4O2DA 4M7DC 2M5WA 3HFOA 1B34B 1A04A 1WSUA 3PFIA 4TVWA 1D8JA 1B7YA 1L0WA 5HDKA 4BNCA 3HRKA 2ADUA 1X2GA 4M78G 5CLSA 1IL2A 1Y0UA 1YFTA 2ETHA 1WRJA 1F5TA 2D1HA 3CMQA 4M78D 2HNIA 2XKOA 2J5OA 4I0AA 3IRRA 3WQZA 3SZTA 2L3DA 5GMKe 2FBHA 5HLGA 3F8BA 5KVRA 2A68F 1B7YB 2ZNIA 2EFWA 3RYRA 2HZTA 2E1HA 1GVJA 3A5ZA 1Z7MA 1LNXA 1MJ9A 4LFUA 3OV8A 4YRKA 1O57A 4HV5A 4EM1A 3TEGA 4LK0F 4XTUA 3F6OA 1D8KA 2EV5A 3CJNA 2ALYA 1FBSA 4P74A 4C8QC 2AXLA 2UWMA 1LDKB 3RDIA 1XB4A 3K1MA 2OQGA 1W5SA 4M78B 4RQFA 5D5WB 4KIBA 3M1EA 3JCMJ 2STTA 5C53B 4WX9A 4P72A 1HW5A 2QHUA 3DPTA 3ZQ7A 1E24A 2O8XA 3OD1A 1OYIA 1G5IA 2ARUA 3JCMQ 2UXXA 3P9CA 5CVRA 4M78E 5D8LB 1C0WA 5LJ5f 2RHSA 5ICFA 2VE9A 3H3ZA 4HF0A 2DU9A 2E7XA 1C0AA 4A2UA 4LG0A 1I4K1 1ZH5A 1V4RA 5J6XA 2V1DA 3HIFA 3MQ0A 5K1XA 1LQ1A 3HHHA 2J5PA 2VC1A 4DPGA 4UPAA 4KICA 4S05A 2I2LA 3KLOA 2HWVA 1R22A 2RHSB 3JAMK 4G7OF 1LVAA 3UGQA 3V7SA 3PGGA 2ZZGA 3ZPLA 3MEYA 4AIJA 1ON2A 2DDZA 3A31A 3ZN0A 5AONA 3FHZA 3BY7A 3TOBA 1T38A 5D5UB 4PG3A 1Z6TA 3SQNA 3BP8A 1YCYA 4BAYA 2K02A 3HXYA 3Q9VA 2Z5UA 3N4MA 2H94A 2FE3A 5BQTA 1SD7A 1KMMA 1SETA 2PG4A 4F7UG 3I59A 4OP0A 2F5FA 2EJFA 3JCMf 2FU4A 2GQQA 2Y90A 1IN7A 5ILSA 3QPTA 2DW4A 1SESA 4LB6B 3JAMZ 3WU1B 1GXQA 4F7UA 2ZIMA 3KP4A 2EB7A 2EJGA 4HAMA 4HBLA 3I59B 2PMFA 4HVCA 2QQ9A 2FA5A 3H3UA 3K2ZA 5FLXZ 4M7DA 4LLNA 2A07F 1N9RA 4I09A 3RPUA 2MC3A 5TRDA 3SXYA 4F7UB 3HHGA 2DO7A 4KYWA 1REPC 2ACJA 5A2QK 3LSTA 4XLPF 1KQ9A 3EFSA 2DPUA 4I7HA 4H02A 4M71A 2G9WA 1GXPA 2RM4A 3HRUA 3GWZA 4PGHA 4HWOA 3LWFA 2GIVA 3QU6A 1JJCA 4RDXA 1ZRFA 4NL3A 4C8QG 3NETA 1D5VA 4WWCA 4J6XA 4GCVA 2YLCA 3ERED 1EV7A 5HLIA 1OYWA 3ICAA 2DVEA 2K27A 4C8QD 2LSOA 4P96A 1SD5A 3RKXA 4I2OA 3I64A 5FFZA 1XGNA 3K9TA 3VB2A 4C8QA 4KDPA 4L87A 3R6SA 3A32A 1ZYRF 2E3CA 2I4MA 2DU7A 1R7JA 5L3FA 1I1GA 3E97A 5A2QZ 4A5MA 1K79A 3HFNA 3V7RA 5GAOn 3DF8A 2ZFWA 2A3SA 1WI9A 1U6GA 1NJ5A 4C8QB 4JRIA 2IT0A 2XKPA 5H20A 2QWWA 2ZKZA 1TQPA 4M77D 2EFQA 4P9FA 3NRVA 1WLEA 3A7UA 4MMLA 5GAN2 3QOPA 2WV0A 3WGHA 2ZMEA 1YW9A 3KFUA 4A6DA 1J0RA 1XN7A 2MLKA 3GEZA 1JRIA 3RERA 3GYHX 2WC2A 4ZYGA 3H92A 1IW7F 1S6LA 3PQJA 3F23A 3FX3A 4G7HF 4OIRF 3ERRA 1KA8A 1MDMB 3ZN1A 3BJAA 2NYXA 2ODRC 4AD9A 3RL6A 3LA2A 5ELOA 3NQOA 4Y15A 3BJ6A 3T5XA 2QHSA 2ZMEB 1KYZA 1WQWA 1O7FA 2DI3A 1JXSA 1SFEA 4XLNF 3TO6A 2LDUA 1AOYA 1FBQA 3VQVA 3HSRA 2YX7A 2VXEA 3LA7A 1FYMA 3RF1A 4PZJA 5E1WA 5L3BA 2K7LA 1KQ1A 4M77E 4GYGA 2IA0A 2IRFG 5J8FA 4Y17A 4Z2YA 2EFPA 3R07A 2WWYA 1E2XA 1IN5A 2IY5B 3L4GA 4M7AF 3FB9A 2O0YA 4H2XB 5DCFA 2DFIA 3JTHA 5TJJA 4MGRA 4PHCA 4PJOC 4ZTUB 4YIFA 3VQWA 2L02A 4G85A 3L00A 1XMAA 3EDPA 2CGPA 4X9DA 2VT2A 4L9TA 4YRIA 1FSHA 4YRFA 3WG9A 2R7DA 4L18B 2QQAA 2V9VA 3GF2A 4TWAA 4KMFA 4CS3A 2HFHA 2GAUA 2WTEA 4M75E 4WI1A 2V1UA 3U1DA 2Z33A 2E1CA 4J6WA 1OPCA 2ZIOA 3JW4A 5F64A 5ICGA 1YB3A 3HFZA 3R4KA 4ETSA 3I58A 3R61A 1WU7A 2ZNZA 3P7NA 5DV5A 3WTTC 3CUQB 2A5YB 2ZT6A 2H09A 2FF4A 1R5GA 1RZ4A 2CQKA 2OQRA 1IZ1A 3BDDA 4UUVA 2ZXJA 2ZJ2A 1T39A 4GO1A 4YRSA 4RGUA 5CJ9A 3T1BA 3HFZB 1FY7A 4ON0A 3CO7C 4D0PA 3T8RA 2GA2A 3VFZA 1IN6A 1LEBA 5JI6A 4RQEA 2M45A 5F6FA 4J6YA 3FMQA 3F6VA 2FNAA 2P5LC 4JUVA 4YCVA 2HEOA 1SD6A 4HOBA 2DQRA 5JFRA 1R1VA 1JHFA 1J2XA 2FNPA 4CS2A 3QTCA 3SZPA 3FIFA 2DEQA 1X55A 2RQPA 3JB9H 5FFXA 3KP5A 3E6CC 3L2ZA 4XTWA 1LEAA 2RHQA 1ZARA 12ASA 1KU9A 2XGXA 4YFKF 2JN0A 1FP1D 4K86A 3MF1A 2L54A 1K78A 1ON1A 5K1YA 4XU0A 3DV8A 1IN4A 3IKMB 4ESJA 3QRFF 1ZRCA 1J5YA 5CVJA 4P5OA 3NELA 3QO7A 1UHWA 1KGSA 5LJ3e 4BW9A 4M9XA 1W7PD 2CJ9A 5F5WA 3FM5A 3R60A 5LJ5d 3LAJA 3QO3A 2XAHA 4U0WA 1F4KA 2COMA 3CUOA 2K86A 3WGIA 1KU3A 1LOJA 4ZTZB 1DPRA 4WJ4A 3RACA 3CDHA 2CO5A 3KP6A 4L0ZB 2W24A 1YS7A 3QO8A 2MBFA 3LQQA 4HF1A 4F7ZA 2ZT8A 4M9ZA 1YO5C 4M9SA 2I4NA 4HWSA 3HTZA 1W7PB 4ZH4F 1IF1A 4PJOA 3KZYA 5LJ3d 2YLBA 3BFMA 1P92A 4CO8A 1NHAA 2IP2A 2IW5A 3R0AA 2VOOA 3TDZC 1H4TA 4UP8A 2IA1A 4R8HA 1YTYA 5LEKA 2DU5A 2DTOA 2IJLA 3HOSA 4HT8A 1HQCA 3BWGA 2HR3A 2JTVA 1O3SA 4X5OA 3GW2A 3JCMd 1T2KA 2RD1A 1B70B 4LJZF 1QZZA 5HGQA 3V8KA 2ZCEA 4HW0A 1Z05A 3REXA 1BJAA 5KNNA 2UXNA 5IT3A 2VONA 1FLIA 4A0YA 1K6OA 1FPQA 1B4AA 2XAQA 3GXOA 1B34A 2DTHA 2YR2A 2GXGA 1S29A 2QVOA 3QUIA 1FSEA 3HY0A 3HOTA 4KFCA 2A6HF 3BY6A 2CJBA 1BI1A 3E5XA 4I02A 5LJ3h 4CH3A 4A12A 4NHJA 1EQRA 4WCGA 2F2EA 4KA4A 4ZYEA 3SB2A 1XDSA 1PP7U 1G51A 11ASA 1HSJA 3KP3A 1RNLA 1KU2A 4HDVA 2QTXA 1SAXA 2JPBA 1Y96A 1O3QA 3DEUA 5L3EA 4H2UA 2ELHA 4CHUA 4GGGA 4IRIA 3QO5A 3JCMh 2ZINA 1BN5A 3VU3C 1X54A 1PYSB 4N9IA 5LGNA 2VXZA 1U78A 5GANe 1TQIA 1EFWA 3HYIA 1EH8A 1HKTA 1J7KA 2ESNA 2P0LA 2Q2EA 3K0LA 4ZZLA 4M78A 2Z9OA 1Y96B 3QP5A 5ELNA 3IC7A 2JT1A 1KQ8A 3ZMVA 4BHCA 2P7CB 2GA1A 2X0LA 2RKHA 3M4PA 4XTXA 3WTUC 3F8FA 4P73C 1IXCA 3JB9G 1OMIA 1B9NA 3T0YA 4YRPA 2M1BA 1FNNA 4YROA 5LJ5g 4L5JA 1QBJA 1TBXA 3JB9D 4RB0A 2VODA 1YIOA 2QZ8A 3PZCA 1YQAA 4U7BA 5F1RA 5EEHA 3BOQA 4ZYDA 1G5HA 4CS4A 4M73A 4LNSA 3ELKA 5DUKA 2OBPA 3QU3A 3M8FA 4U0YA 4P9UA 2A61A 1HW2A 4A6EA 2E1NA 3RYPA 2KIUA 3P8VA 4YDQA 3ISPA 1X2HA 1HTTA 5ILVA 3TGNA 1PDNC 4M77C 5LJ3g 3UGTA 1D3BB 4JQFA 3I5UA 5GMKm 1EIYB 3WE3A 4RMFA 5GMKl 2VN2A 1G3YA 3I0TA 1WNLA 1BBUA 1DDNA 1K7AA 1WWXA 2PJPA 3SHFA 1J5WA 5E1XA 5LJ3f 4N0AA 2DLLA 5JR3A 3QP6A 1ZG3A 5CYVA 1T6SA 2CJAA 3F22A 2ZR3A 4IVNA 3JCMg 1U1TA 1SMYF 1KOGA 2OAZA 1R36A 3U9GA 1LDJA 1BIBA 4OLFA 1P4AA 4MMKA 5LJ5j 2KJBA 4G84A 5GMKh 3GZ6A 1CGPA 4M75C 4HZFA 4KMUX 4BWAA 2XTIA 3IWFA 1SFXA 4GYIA 2ZNYA 4UXNA 3JCMV 4TQDA 2HKXA 3HSFA 2RA2A 5LGTA 1YLFA 2EV0A 3P9IA 4P55A 3G73A 5BPDA 1RIOH 1ZLKA 3GO5A 3RESA 3E6MA 4H2WA 3JCMX 2RV8A 1BI2A 2AKWA 4IPAA 4JK1X 1HKQA 1XGMA 2DTIA 3A7RA 4KN7X 1YW8A 1Z6RA 3HY1A 3L9FA 3INZA 4P75C 2O3FA 1ASYA 1NJ1A 5L3CA 5K5QA 2MLGA 3HFVA 3CUQC 4HWTA 4M7AE 5LBQA 4AWXB 4C92F 2ZBKA 4S04A 4ENKA 4Q6GA 3BPVA 4EM0B 5HS9A 2FYKA 1WQ2A 2W25A 2AKWB 1ASZA 5FB2A 4P3NA 2F5CA 3M7GA 2HKOA 2HTSA 3WTYC 3ZMTA 1LJOA 2HQNA 2IA2A 4MTEA 3MF2A 1S8NA 1U8RA 1BIAA 4KR3A 2KJCA 2C8MA 2PLYA 4EM2A 4KNYA 4WXHA 3REOA 2FMYA 2C7IA 2FMLA 4EV0A 4PNOA 2J3MA 3TUPA 3MZHA 2BE5F 4MTDA 2W85A 4L9VA 3IKTA 2YX4A 2B0LA 4IF4A 2DTRA 1FP2A 3VOEA 3TDUC 1ATIA 2NNYA 4M78F 2DBBA 3QPHA 2ZCWA 4U88A 2ZNJA 1IXSB 1J9IA 1H4SA 4M77G 4HWPA 1YYVA 1NJ2A 2Y48A 3DP7A 2DPDA 2JZYA 1Q1HA 3MZYA 1N9WA 1MDMA 1UFMA 2GXBA 1W66A 4IRGA 1EOVA 5ICEA 3A7AA 4G94A 4WXDA 4M77A 3HXXA 3WU0A 3RPQA 2P8TA 1SRYA 4RB2C 2VBZA 2FBKA 3LA3A 4I98B 3D0SA 1ZRDA 2XUBA 2Q8KA 3ECOA 2LNBA 2FQ3A 3N97A 2ZT7A 4M77B 4M75G 1ZGAA 1I6XA 2BYVE 4QWQA 2IY5A 1TW3A 4LB5A 3WTZA 3KETA 2Z99A 4BQAA 4H2XA 2W84A 3C18A 4M75D 1IUYA 5JHUA 3P8TA 3GFIA 4A54A 4M75A 3F72A 5H6RA 3E6DA 4CGZA 1O7LA 5JVTA 2YSRA 3ECHA 3PQKA 5GMKj 1AWCA 2G7HA 2HGCA 4A53A 1MZBA 1PUEE 3F3XA 4XTZA 3BROA 2H6BA 2DZCA 3BJUA 4LGWA 1XSVA 2EAYA 3HXWA 3KP2A 4M75B 2PEXA 5L3GA 2YU3A 2FRHA 5ED4A 2V79A 1TW2A 2RN7A 4H2YA 2IVMA 2P6SA 4JRKA 2RVCA 3CUQA 3LSQA 1ADJA 2AS5F 5E17F 4PCQA 1W4MA 3BW1A 1QF6A 3DXJF 4F7UF 2MH2A 4IRHA 1WYDA 3HXZA 3EUHA 3RTRA 1IN8A 4G8XA 5BS6A 5HDNA 4EQQA 1TTYA 2GWRA 3A74A 4P3PA 5ICCA 3COAC 2QM3A 4YPFA 4KR2A 3L09A 3LQRA 4CXFA 3V4GA 3W6JB 4M7DF 2DK5A 5GAOr 3K1NA 3FMRA 2AMCA 1FZPB 4RB1A 2VBYA 4IHSA 3K1PA 4Q47A 3P9KA 3CO6C 4YFXF 2FXAA 3JCMW 4XBFA 5FGMA 4YRGA 1RI7A 1NJ6A 2EJRA 3ABTA 1L3LA 2QLZA 1H9TA 1Z9CA 1QPMA 5E18F 4UV8A 4C92C 3CLOA 4RAYA 3KE2A 1GHCA 2AMCB 5GAN6 2Y75A 2G4CA 2KKOA 1CF7A 1JHHA 1VTNC 4YCWA 4N9HA 3T8TA 3QHSA 1I5LA 3WTSC 2DAOA 2DK8A 4C8QF 1MD0A 1XGSA 2QQBA 2PMHA 2P5VA 1R00A 4U7DA 1B8AA 2F5DA 3DKWA 1CF7B 2ZXFA 4EJOA 4E70A 5GMKi 4CH4A 3GLXA 4YRCA 2Z3YA 1T0FA 1VQZA 4RS8A 1LYLA 4FHTA 1G4DA 2M8EA 3M8EA 3VQXA 3FZVA 5BOXA 3WTVC 2EL9A 5DD4A 3OOPA 2NS0A 5DCMA 3V7CA 4WXCA 2VXFA 2QYOA 3DFGA 4G7ZF 1XMKA 1FYKA 3LAPA 4EJTA 5D4SA 1XD7A 3HSBA 1L0OC 1W7PA 1XCVA 4ENMA 4XEMA 1STZA 5GAMe 4M6YA 2Q5HA 4TQFA 4MQ9F 2DZ9A 4YRJA 3P8YA 4EX5A 4KIFA 5CVIA 1USYC 1R23A 3J80K 5GAN3 5DCMB 4EJUA 1HKSA 5EEGA 3SFZA 1U1SA 2VC8A 2ZTGA 3O3KA 2XHKA 3W6KB 3Q5FA 1E17A 2ZT5A 5GAN8 2P5IA 2HTJA 2J3LA 2FSWA 3KEQA 3UH0A 4XTYA 3G3ZA 3JB9I 1RUOA 4YG2F 1B70A 4TVAA 1EVKA 1UCRA 5D6EA 4ZIBA 3WE2A 2E64A 2P5KA 4B8XA 1BC7C 1W5TA 2L4AA 5KK1A 4RCBA 1B1BA 5J8CA 5GAMd 2HOEA 3VODA 3I71A 3EETA 4LK1F 4R79A 2ZO4A 2DQ3A 3E5QA 5LRRA 1WKMA 3HRIA 1LB2A 1MJBA 3C3WA 3SWNB 4L9NA 4TVAB 1ONVA 5E1ZB 1ZG1A 1KMNA 2Q7GA 3IRQA 4EGYA 4M7AC 2XROA 1P2FA 1SERA 2GZWA 1G6NA 2L4MA 3C1DA 3TQNA 3F8NA 4OOIA 4C92G 4NQWA 3ZMDA 5L3DA 1HC7A 1M8VA 3JCMc 4QLCU 4V2SA 4C92D 4E51A 3FXQA 4GXOA 1PYSA 3CTAA 1RIQA 1F1ZA 4KUMA 1HXDA 2PMUA 4J15A 2LF8A 4A0ZA 3KP7A 4TV7A 4U0VA 2K57A 4JLIA 5GAOp 5GAMh 1PP8F 3PCOA 2OU2A 2XAJA 3I54A 5D8KB 2EFOA 4CDGA 4I01A 5HS8A 1QE0A 1DP7P 1Z91A 4HX4A 1P6RA 1LJ9A 2ZZEA 5GAOl 2E5AA 3JCMP 3BDUA 3L7WA 4LD5A 1MGTA 4C92B 3F8MA 1D3YA 3FM3A 3HRMA 3PCOB 4R1HA 3GFLA 1OR7A 1E1OA 3E9IA 1F9NA 5DDGA 4OIPF 1G3WA 3V8JA 4Y91A 3EYYA 4C92E 1KQ0A 1XCBA 2EJ9A 5IT9K 3TEHB 1MJAA 3HSEA 5GAN4 5D6FA 2OZUA 4FX0A 1X01A 4EVIA 4HDUA 3RKWA 4X9CA 4K88A 2DXUA 3MAJA 4BH9A 4EMGA 1R5HA 2DQLA 1D3BA 3LFKA 3FXUA 1EIYA 4EMHA 2R3SA 5GANd 2F5EA 4ENJA 1UB9A 2M87A 1USYA 1HBXG 1B9MA 2DQ0A 3IKVA 4XRFA 4L0YB 4RGRA 1XGOA 2RNJA 3GX4X 4IJAA 2E65A 4P3OA 5I21A 4WF2A 4UVAA 3U2RA 3JTGA 1M5Q1 2OA4A 2FB7A 4MEXF 1U5TC 2FEZA 3A5YA 3FXRA 3FWEA 5IT9Z 1KYWA 4O6JA 2ALYB 6PAXA 4YYEA 4ZYHA 4WK8F 2M30A 4H2VA 4NL2A 4YCUA 5GAMg 3KFWX 4ENNA 3Q9SA 2DKGA 4XTVA 1ZHFA 5DEQA 4NCXA 2K4JA 2V6CA 2XIGA 4M7AG 2PFBA 4FX4A 4NOYA 4EMKC 1ADYA 4XEOA 1X3UA 3BJOA 4Q4ZF 2JRTA 5GAMf 5GANh 3WTWC 1KQ2A 4M7AD 2FBIA 1ODDA 3E5UA 2BBYA 4LG0B 4PJOF 3REUA 4M7AA 5FLXK 4H2SA 4XU3A 3HRTA 2IPQX 4KT5C 1BC8C 4M72A 5E8GA 4TTVA 3W3SA 4PGGA 1DPUA 1TLHB 1LDDA 1BI3A 4LMYA 1B76A 4BHPA 1R58A 4RAZA 2HDCA 1QZYA 2D1VA 3KZZA 1J59A 4ESFA 5BMZA 1Z7UA 2CYYA 3E9HA 1T98A 3IHUA 4M7AB 3RKYA 2ARSA 3I4PA 3FF5A 3R0JA 2STWA 3KCCA 2D45A 5LJ3j 1JBMA 5BPIA 4HF2A 4M7DG 1X56A 2PQ8A 4UV9A 2A6EF 1YS6A 4YFNF 5H6QA 2VOPA 1FT9A 2NAZA 2CSOA 4M7DD 3DPLC 1I5ZA 1QQIA 3TKYA 1MGQA 5GAMj 5LRSA 2O61A 4I0BA 2RDPA 2KRFA 2EFNA 1H4QA 4YP0A 3D5LA 2HQRA 3ULQB 4AVPA 2H6CA 2ZZFA 2D2WA 2QUFA 4IXAA 3QNEA 1SFUA 3QSUA 3TO9A 1BI0A 1IAWA 4HLYA 4EJVA 2HS5A 3V8LA 3TOAA 4YREA 2QHVA 2FOKA 3ZP5A 2QHTA 1MKMA 4P73A 1FYLA 1I27A 1H0MA 3GZ5A 4M7DB 1IRFA 4F7UE 4OMZA 4M6XA 2H27A 5GAN5 1ZN2A 3HUGA 3M9AA 3IL2A 5GANg 4HX7A 4LLGF 4UP9A 4YRLA 4M7DE 1G3TA 2XAGA 5DY9A 1S7AA 5LLQA 2PMEA 2NRAC 3EQLF 4YIIA 2UZKA 2RGVA 2Y0MA 4ASNA 4EMSA 3UFGA 5D5XB 1YG2A 5LHGA 1JE8A 1YGBA 3GFMA 1JJCB 4HYEA 4OU0A 3B02A 5GANf 4P71C 4KN4X 4AIHA 3E6BA 3C7JA 2XGTA 3GIBA 4XSXF 5HVQC 3G1ZA 1EH6A 1EH7A 1U5TA 1NYQA 5HDGA 2XRNA 4YRNA 2E41A 4MNUA 3JB9F 4HV6A 2KIFA 1TQMA 4L9JA 1I8FA 1I81A 1EVLA 4B09A 5K5OA 2CIMA 2HYGD 4C8QE 4DQ2A 1U5TB 4EMKA 3MWMA 2PBIA 4Y13A 3WODF 2EA2A 4UHTA 1G3SA 3LSSA 4PDKA 3RJPA 4OMYA 3B73A 2W57A 2LKPA 1U3EM 3MFKA 1YW7A 4HQMA 5GANj 2ARTA 1WPYA 2Q7EA 1NYRA 4KIGA 2P7VB 2I4OA 4EMKB 3HTSB 1UHMA 3M4GA 4G6QA 1J75A 3J7AO 4CYDA 5K1PA 2QBYA 4J5YA 1ULYA 5E3IA 4FT8A 4H0EA 1P4XA 1XSXA 3SWNC 3KEOA 4Q5SF 4CH5A 2K4BA 3BPXA 2BGCA 1E22A 4XQ3A 4P75A 5E20A 4OIQF 3IG2A 2VBWA 2YPRA 2E10A 2JPCA 1FBUA 1SMTA 2QBYB 5AIQA 5AIPA 1LNWA 1IXRC 1SD4A 2CFXA 1FC3A 1HK9A 2CG4A 2E7WA 5DD8A 4G9YA 2QENA 4HX8A 1OYYA 3HTUA 3HXUA 4RGXA 3M4QA 3K69A 3JSOA 2HYFA 3L4GB 3FMSA 1FWZA 3RI4A 5K5RA 5LHIA 3I7FA 2MA3A 4CZZA 4EGZA 3F21A 5DUIA 3WTXC 4BYYA 1H641 1TNTA 1TNSA 4EJWA 2L01A 2XVCA 3ZMZA 4HWRA 1FX7A 1ZAOA 1OKRA 3IWZA 1Z1DA 1ZG5A 3JB9J 2KIMA 4TVYA 4OIOF 1H9GA 4UVCA 3IALA 1S7OA 4HA8A 1WQ7A 1HSTA 2ZR2A 1BBWA 1KU7A 2DT5A 4NB5A 5DYMA 4O5VA 5C51B 4A5NA 3J81K 3TO7A 1XDUA 2NNNA 4DNCA 4MQVA 1IRGA 3ML6A 4P71A 4YRMA 3KLNA 1N9SA 1FOKA 2P4WA 5FD6A 3NEUA 2XAFA 4IHTA 4KQEA 3FJPA 5ERIA 2VBXA 2P6TA 3GUDA 3RIRA 3AAFA 2RC4A 4MHGA 3ABUA 4JBAA 4A0XA 3L1AA 4Q48A 3VEPA 1HW1A 3DSQA 5LJ5e 1BM9A 4BXUA 4UVBA 1H4VB 4LLLA 1V3FA 3RUXA 2OD5A 4M78C 3RGLA 4XSZF 2ESHA 5CAIA 4WJ3M 3AHUA 3LC0A 2RB6A 4OINF 2Q5IA 3VQYA 3VBBA 1QO0D 2DJZA 3J81Z 4O3MA 3HXVA 3EYIA 1BOAA 1FYFA 4M77F 2ODRD 4AH6A 2ISZA 2XASA 4XU2A 5D5VB 4P74C 2XV4S 3MEXA 1P4WA 5FD5A
chains in the Genus database with same CATH superfamily
2RHQB 3O6BB 1ZELA 2VE8A 1O3RA 1K9MC 1UG0A 1R4NB 2Z1DA 3CD6I 2O6GE 3CMAT 3MVPA 4BD3A 4AIKA 4C0GA 5CCAA 1K9MU 3HPHA 3QAHA 1VUBA 4BUPA 5CVUA 3Q0WA 1Q7YR 2CWEA 2X85A 1YHQT 4OMNA 3EG9A 4G6DA 2DFHA 2E34A 4HLXA 3J7ZI 5HLHA 1O3TA 3LGLA 1XSDA 2KXDA 4QVDA 1WFXA 2LF7A 2ISYA 3GZNB 4Z6YA 2EGCA 4YRQA 2R5MA 3J80Z 1ZREA 4BACA 1YJ9I 4N0AC 3CQZJ 2BV6A 2M4GA 4J9DA 2PQWA 5FO5A 1Y8RB 3QKJA 5HS7A 4KGZB 5LHHA 3FRNA 3K4JA 3HRSA 2HQ5A 1BBYA 3BG9A 3H0IA 2W48A 4UP7A 1RKWA 1R1TA 4FE4A 5J26A 2Q7HA 5LEJA 5C52B 2EA4A 3CMMA 2HSEB 2K40A 2TDXA 2IS4A 5DM7R 3NENA 1K61A 3L2CA 5E3LA 2NUPB 1RESA 2JA5J 1K1ZA 1WCMJ 2NVYJ 3TEHA 3VWBA 3PFIA 4TVWA 1D8JA 1L0WA 4BNCA 2LZ6B 2V8JA 2XGDA 2JSPA 1Q1VA 5L8RE 1Y0UA 2BUDA 3S15J 1Y56A 1WRJA 2D1HA 1PRMC 1MIJA 2MABA 2CKKA 1X3WB 2LJ0A 3DLLF 2J5OA 4I0AA 3SZTA 5KYXA 2FBHA 5GMKe 1B7YB 1O9SA 2G6FX 2E1HA 1GVJA 2E1MC 1LNXA 1MJ9A 5GTIC 3EHQA 1NLPC 3FXOA 4YRKA 3VDXA 1VQPT 3TEGA 3TEEA 4C8QC 3IUOA 1QVGA 2AXLA 3EG2A 1LDKB 1E0EA 2QQRA 1XB4A 1X1PA 2OQGA 1W5SA 4M78B 1GT0C 3M1EA 2STTA 5C53B 2MCNA 2WACA 2AK5A 1HW5A 1YJNQ 3DPTA 1E24A 3A5ZB 1MBJA 2RHSA 2VE9A 3A2KA 2KPMA 4JPBW 4QVZA 2DVJA 3DBHB 3WHBA 3BQYA 5K1XA 2RQTA 2X1EA 4DPGA 1N5ZA 1QA6A 3PMIA 3KLOA 2HWVA 3CBOA 1QLYA 4G7OF 4JX5A 3V7SA 5IHKA 1JKRC 3EG1A 3DPUA 4CCNA 1C0MA 3BY7A 1CKAA 1T38A 1Z6TA 2ZJPF 3S1MJ 2FE3A 1MBEA 4R56A 1KMMA 4F7UG 3I59A 1LUJB 2R7RA 3OYKA 3G6ET 2EYYA 1SESA 3GTPJ 3H1CA 3E2UA 3K70C 2EJGA 3RPUD 2JOYA 1YI2Q 2RK2A 2A07F 3OYGA 5HNHA 1N8RR 3BG5A 4QQDA 1R6RA 5A2QK 1KQ9A 3EFSA 1PJRA 4I7HA 2OTJI 4H02A 4M71A 3HRUA 3GWZA 4HWOA 3NETA 2ID6A 2Z0WA 3ERED 1EV7A 5HLIA 2MWPA 1OYWA 1VQ6I 2K27A 1AEYA 2VJ4A 3EFOA 3L2WA 1KZHA 1IREB 3I64A 2SEMA 4L87A 1PUFB 3R6SA 1ZYRF 4E7HA 3H5AA 1LE8A 4GFBA 2AHJB 2E1MB 2RHUA 3MD2A 2V4JC 2A3SA 2DMUA 4C8QB 4JRIA 4XIDA 2QWWA 2ZKZA 2EFQA 4L59A 2M7BA 4P9FA 4QW2A 3NRVA 2KMUA 4MMLA 2WV0A 3WGHA 4A6DA 2MLKA 3GEZA 1WXUA 3RERA 3GYHX 2WC2A 4E2FB 3H92A 2R5ZB 3FX3A 3ERRA 1F43A 2VPRA 3BJAA 4PJJA 2NYXA 4AD9A 2OTLI 3TMOA 3RL6A 3LA2A 4K11A 3NQOA 4Y15A 3HP9A 1WQWA 1O7FA 3GTJJ 5J1YA 3LFUA 5J1RA 3OSFA 3THKA 4CC2A 2VXEA 3LA7A 1FYMA 3RF1A 4PZJA 2K7LA 4MZMA 5J8FA 4LG3A 4CSWA 1AZGB 3I5RA 4Y17A 2EFPA 4V2GA 1BU1A 1X1CA 3L4GA 2Y30A 2V1QA 3JCUC 2O0YA 2NS7A 5DCFA 4CCKA 3JTHA 4PHCA 4ZTUB 4KGXB 1DQUA 1X2QA 1MHNA 1R0BG 3EDPA 2EH3A 1VQNT 2VT2A 3A01B 2ZSHB 3REAB 2R7DA 3FXMA 2FD5A 3CBPA 1WXTA 2DXBA 4TWAA 4KMFA 4HKEA 2BOLA 3P8BB 4LITA 4WI1A 3U1DA 2LH9A 1OU8A 3CMAQ 1RUWA 3O5ZA 2A0FB 1D1CA 5ICGA 2G0EA 3I58A 2H3EB 2ZNZA 3CUQB 2ZT6A 2LOOA 2FF4A 1YHQQ 2Q1ZB 1RZ4A 1U0JA 2EGEA 1IZ1A 3URGA 4UUVA 1T39A 4GO1A 2JJ7A 1MV0B 4ON0A 2H8HA 1BB9A 2DA6A 5JI6A 4CC7A 2FNAA 2P5LC 4RTXA 2PMZA 3I56I 2DQRA 1J2XA 4CS2A 4A4FA 1S9HA 1R8OB 1X55A 4I99C 3E6CC 4XTWA 1LEAA 1RRJA 1KU9A 1QVUA 3NHNA 1K0XA 2JN0A 5KYYB 3E0JB 4K86A 2M4KA 2TCTA 1XTDA 3SDBA 3OL3A 2CUFA 1ON1A 1IN4A 2EBIA 5CVJA 5FW9A 4XRSG 1UHWA 5LJ3e 2COYA 2CJ9A 5F5WA 1OISA 3A8GB 3EH1A 1YE9A 2COMA 3OR1C 4XKVA 3BTJA 3CDHA 4L0ZB 4XL9A 2WAQN 5CQXA 1VQ9I 3HOWJ 4DBFA 1YO5C 1W7PB 2YLBA 3BFMA 1VQPQ 2IW5A 3R0AA 2FZKB 1H4TA 3FIWA 4R0KA 1JTXA 2CH4A 3HOSA 1HQCA 3BWGA 1B8IB 3DU6A 3UWNA 2JTVA 5GP9A 1B70B 4LJZF 5AT1B 3REXA 2R7XA 1YFNA 2HPIA 1FLIA 1B4AA 3GXOA 1B34A 2DTHA 4OB0B 3N5BB 1S29A 2M51A 2A6HF 3BY6A 1JKOC 1BI1A 4I02A 2F2EA 4KA4A 2ECZA 2HOAA 5FROA 1VQ8I 2KEAA 11ASA 1VQKA 4HDVA 1Y1WJ 4FSSA 5GADJ 2LTOA 3LH5A 1O3QA 5L3EA 3U23A 4QPOA 4CHUA 4GGGA 1ZBXA 3QO5A 5I2SA 1BN5A 3FJ5A 4PUSA 5LGNA 2NXNB 2HI3A 2DF6A 1HKTA 2JUFA 3CCYA 2ESNA 5EF6A 1XS9A 2Q2EA 1SPKA 4AG2C 3QP5A 3G6EQ 3H41A 2QTVA 2P7CB 1TUCA 2V9PA 2RKHA 4A3DJ 5M3MJ 3O8GA 2YRDA 2O5RA 3F8FA 2HQXA 3JB9G 3T0YA 2RAEA 2L7KA 3M54A 1VYTA 1JT0A 2VASA 4U7BA 5F1RA 5IXBA 2LD5A 3CC2A 3BOQA 5IYCJ 3FEOA 1MSFC 2DLPA 5DUKA 4RLFA 3MKLA 4RTYA 4RA2A 2E1NA 2KIUA 5JLXA 4E7KA 4IZZA 1HTTA 2DL5A 3TGNA 2E2HJ 5KYWB 4GLKA 3WE3A 4RMFA 4AFUC 1G3YA 1K7AA 3LSRA 3CDLA 3SHFA 3OW2A 2COZA 4C2UA 3QP6A 3JCMg 2OAZA 4OMFB 4HXJA 1N75A 1K8AC 2OCCH 4YIRX 5GJVB 5LJ5j 4G84A 5GMKh 4RUGA 3GZ6A 1CGPA 2DEUA 3IWFA 1SFXA 2BE7D 1K8AU 1I3AA 2HKXA 5LGTA 1YLFA 4ABZA 3MPUB 2CP7A 1ZLKA 2FZCB 2HYJA 3GO5A 1BJZA 5I11A 4IPAA 4JK1X 3BR0A 1FTZA 5B3SH 1ASYA 4KBMB 5CR2A 5L3CA 2ROTA 3OS5A 5K5QA 3HFVA 2ZBKA 3BPVA 1YJNI 5IAYA 3CCQA 3MP8A 4DGWB 4W97A 3WTYC 2HQNA 1OPLA 4XLCA 1BIAA 2KJCA 2C8MA 4EM2A 1QMCA 4V2FA 1VQMQ 2YDLA 3MZHA 1DGWY 2JTFA 2JT4A 2L9NA 2X1CA 2W85A 1M1EB 4L9VA 4A3KJ 3MEUA 4C5GA 3HC7A 3NTKA 4HNUA 1WZOA 1FP2A 1VQNQ 1ATIA 3EGUA 2DBBA 3QPHA 5IP6A 2ZCWA 4HWPA 2Y69H 1NJ2A 3IH2A 1BOBA 2DOAA 2XF6A 2BIVA 1JO8A 2VUBA 1DP3A 2CYZB 1VA7A 3HUGB 1UFMA 1EOVA 2QQSA 3CCEA 4G94A 3HXXA 5H2FC 2BKDN 3LSHA 4RB2C 2VBZA 4QTRA 2OPTA 2ATCB 5IH2A 2R7ZJ 4M75G 1ZGAA 2BYVE 3WTZA 3KETA 1YI2I 2KQRA 3JREA 1R0CB 3P8TA 3GFIA 2A3LA 3M0PA 1QVGP 1KQSA 3ECHA 1K6YA 2LP5A 4PSWA 2G7HA 2DBMA 2CREA 1PUEE 1ETQA 3PIPA 3I3LA 2WA0A 2MGQA 5L3GA 4N4NB 3L1PA 2V79A 2DE0X 1ITYA 2IVMA 3G71T 1Q81R 3DB4A 1MV3A 3EUHA 4AFZC 4G8XA 4EQQA 2BE9B 3COAC 4NC8A 3L2QA 3IV5A 1G59A 3RDVA 5GAOr 2IPOB 2QXFA 1GRIA 4IHSA 4XKCA 3CC7T 3JCMW 4IKFA 1QKXA 4YRGA 2HVSA 2EJRA 3J7AY 3S14J 2CU7A 3F0CA 2DT6A 2I8DA 5J40A 4UV8A 4A4GA 3W2VA 4C92C 3CLOA 3EH2A 2EIKH 1WFWA 2O4XB 2IS6A 2G4CA 2JRMA 3CDIA 1Q7YU 1X1DA 2DK8A 1LFPA 2VYTA 1WXBA 4DZPA 4E70A 3BR6A 3ULRB 2K2MA 1VQKT 2V1RA 2J6KA 5B1BH 2WAQA 3OYCA 5BOXA 5DD4A 2NS0A 5DCMA 3VUZA 2QYOA 1EA3A 4G7ZF 1FYKA 1AWJA 2TRTA 2BY0A 2XDVA 5IPAA 2KL4A 4ENMA 3P8YA 4PFPA 1H3ZA 5CVIA 4JRPA 5GAN3 2CQQA 1N78A 2ZTGA 3X26B 2VC8A 3CMAI 3Q5FA 4Y28E 2P5IA 4IUTA 2J3LA 2KYMA 2FSWA 4C3JJ 2O7OA 1JJ2A 3G3ZA 4J00A 1YHQI 4PSXA 3JB9I 4C9YA 1UCRA 3I55T 2R93J 4DOWA 5KCHA 4RCBA 1JQQA 1FYNA 3PIOF 3OA6A 1PSEA 2HOEA 3EETA 2JA7J 4TVAB 1ONVA 3ZL7C 1KMNA 2Q7GA 2LBFA 4QQGA 5HK0A 4D8DA 3AKZA 2GZWA 2L4MA 4PFZA 3ZRGA 1IUFA 4II2A 1JJ6C 3QYGB 4NQWA 5L3DA 2BTTA 3QWLA 4J9IA 3ZQGA 4A4EA 5IOZA 1OV3A 1M8VA 4V2SA 3NARA 4E51A 2L7ZA 1ETOA 1PYSA 3CTAA 1RIQA 4B4CA 1F1ZA 1WIEA 4KUMA 2PMUA 3OYFA 1TWAJ 1OQKA 1QWFA 2XAJA 2F6CA 4CDGA 5HS8A 4FT4A 4IUVA 1QE0A 1VQ7T 5IP7J 4S0HB 1I07A 4C92B 4MLOA 3MKYB 2CP6A 3QQAA 3CCMA 4D6WA 3PCOB 1Y39A 3DLAA 1ZR2A 3UATA 3SDZA 1XCBA 3VS0A 2EJ9A 3CD6A 1QPIA 3TREA 1MJAA 2DA2A 1IJWC 3HKSA 5GAN4 3ME9A 2PUKB 2FPDA 4K88A 3SDGA 3M59A 2OJED 3TP3A 1VQPI 2R5AA 4VUBA 1UZCA 2BW3A 2X4YA 4BI8B 1EIYA 4EMHA 2CMPA 4MZPA 3CCQT 3M07A 4ENJA 2M87A 1USYA 5CKDA 2RNJA 2GLOA 4UVAA 5IHNA 3JTGA 2DERA 4MEXF 4L6V5 2ME6A 1AKHA 4A3BJ 1C1AA 1YJ9A 3B6AA 3FXRA 5M5YJ 3EGXB 1KIKA 1AOJA 1OCZH 1Y7XA 3C12A 3Q9SA 1ZSGA 4C0ZA 4XTVA 1ZHFA 1A36A 3AG3H 4XN3A 2PFBA 3RZOJ 4NOYA 2HKNA 4AT1B 3BJOA 2DYBA 4HCKA 1KQ2A 4M7AD 2RI2A 3I4NJ 2FBIA 1D1BA 1ODDA 3LLRA 4A4KA 2BBYA 3BCAA 3MEWA 4JYKA 1P7IA 5EJCA 3AG2H 4AC0A 4H2SA 1M90R 4XU3A 3HRTA 4KT5C 4B6MA 1E3OC 4M72A 4TTVA 4PGGA 1DPUA 1SEUA 4BHPA 1R58A 3QDFA 4ESFA 5BMZA 3ZEHA 1Z7UA 2CYYA 3C2GA 1ZUKA 3IH4A 2RH2A 4DOVA 3NPFA 4LDVA 2PQ8A 1WHLA 2RHYA 2NAZA 4OAZA 5IT9E 5GAMj 1Z21A 2L2OA 2YUNA 2LTPA 2KVQG 4YP0A 3OMCA 1W2BA 4HNVA 1SFUA 1BI0A 4HLYA 2EYXA 1OULA 2HS5A 3V8LA 2FOKA 2PU9B 1GFDA 4P73A 1FYLA 1I27A 1MBHA 4M7DB 4CCOA 3VYTB 3KIOA 2H27A 1VYVA 4CI0C 2X51A 4HX7A 1XJWB 4UP9A 2XAGA 3G71Q 5DY9A 4YIIA 2Y0MA 4EMSA 1JE8A 4HYEA 2KYBA 4AIHA 4A3EJ 3C7JA 1EH7A 1U5TA 1FOWA 4MNUA 3PNYA 2WAEA 3BR1A 3CC7Q 2RNAA 5M3FJ 2LDMA 1QKWA 4EMKA 5IOYA 2ENMA 2XIDA 4BEHB 4Y13A 1I50J 3LSSA 4PDKA 2ZPIB 1HDPA 3B73A 4NUBA 2LKPA 3HL2A 5GANj 2ARTA 4KIGA 2RPNA 4CYDA 1NK3P 4L5GA 1ULYA 3IAM2 1IV8A 2W0ZA 4MO7A 1TOVA 3HG9A 1P4XA 1VQKQ 4Q5SF 4CH5A 2FZGB 4LVMA 2XK0A 2BGCA 1T95A 1VQMI 1VIEA 5J47A 5E20A 1PCXA 3IG2A 2VBWA 2YPRA 4ZDPA 2OTJA 2JPCA 2HQHA 5AIPA 1GXIE 1IXRC 3VYRB 1VQNI 1S1NA 1K4SA 1RR7A 3DWLE 5FWBA 3M4QA 2KZGA 1VQ6A 1SKUB 2RJDA 3OW2P 1FWZA 3I7FA 3K4KA 2MA3A 1ZUUA 5KH6A 4CZZA 4EGZA 5DUIA 1SFOJ 3WTXC 4BYYA 4RKUE 4RAFA 2EYQA 5IHIA 4HWRA 1ZAOA 4ZTJA 3JB9J 2FRWA 4OIOF 1H9GA 2K5LA 3DBLB 5FKKA 1GDTA 3I55Q 2VJJA 3E1SA 1UGRB 2DT5A 4LD9K 4A5NA 3J81K 2DA4A 2DFFA 4M3GA 1IRGA 1N9SA 1FOKA 1ETVA 2P4WA 1H88C 3JR9A 3FJPA 5ERIA 2VBXA 3RIRA 1ZLMA 3UDCA 3NAUA 3L1AA 1WGSA 2X35A 4Q48A 3DSQA 2DMQA 2KRMA 1X69A 2KE9A 1BM9A 1H4VB 4ZGEB 4A3GJ 3BLYA 1KC8C 4XSZF 5CAIA 4BQOA 1N27A 3LC0A 9ANTA 4B47A 3QYEA 3VQYA 3VBBA 2DJZA 4O3MA 1FYFA 2ODRD 4AH6A 3PNVA 1HDDC 3UA7A 2XASA 2XV4S 1KC8U 2F2WA 1VQ7Q 1KQSS 2M0CA 3HGYA 2DXTA 5GAN7 4K2EA 5IY5H 1FMKA 1WA7A 3G2BA 5A0DA 4H2TA 2O03A 3PO3J 1K78B 1U2WA 3ZMUA 4N0BA 3O8VA 2R7FA 1ZGJA 1X2KA 3E3VA 3MKWB 3ASNH 2L7FP 3SWNA 3JCMe 4MEYF 1UELB 2L3QA 1AA7A 5GAHJ 4LD6A 1VQLT 4UNOA 4ZZDA 1S72T 1NJ8A 3OYYA 3F8CA 1UGQB 3SHWA 1OJLA 3LW5E 2OZ6A 5GAOq 4B9WA 2DA3A 2K9GA 1X1AA 2IXSA 2JSCA 4PL6A 3CCQQ 3PIPF 2ZAEA 1ETYA 2BVMA 4XK4A 3QPSA 3WGGA 5LJ5h 2V8IA 3I53A 4PJOB 4U87A 1JUMA 3GVAA 2R58A 2Q0OA 2C6YA 2L3RA 2G7UA 4NDLA 1USSA 5CVVA 3BZCA 2ZPGB 2PX9A 2M2EA 2VQCA 4QVCA 3BZ6A 4N4GA 2EK5A 3ABKH 2V1XA 3M0QA 5LD2C 4ESBA 3I56A 4FU6A 3WG7H 2CGHA 5HOOA 4A93J 1BCMA 3DQVC 5CIUA 4LE9A 1KQSP 2YRVA 1JGSA 2VKEA 2E3IA 1ZSZC 2G3RA 2MD5A 1MW7A 2QQ8A 5GAOm 2PVOB 2QI2A 2F4IA 1W4SA 1ZUYA 1K9MR 4O2DA 1VQ5T 1A04A 4PKCC 3HRKA 3RR6A 4AUXA 2MK5A 1R9TJ 1IL2A 4AIDA 3VS3A 2ETHA 4PFOA 3CMQA 2HNHA 4M78D 3WQZA 2ZB9A 1Z7LA 3F8BA 5KVRA 2A68F 2ZNIA 2EFWA 2X48A 1ZK8A 3LSPA 1NK2P 1O57A 4HV5A 1D8KA 2EV5A 1VQ9A 2ALYA 2UWMA 3H0FA 2Y4YA 3K1MA 5KYXB 1PSFA 5D5WB 3JCMJ 1GBRA 1BW5A 4F04B 4P72A 2QHUA 3ZQ7A 2O8XA 1C6VX 2ARUA 1JJ2S 1KJWA 2D8HA 1XNIA 1C0WA 1TSFA 5LJ5f 2K3BA 1WJDA 1M2VB 1RAHB 4HF0A 1I4K1 2QEXI 2RF0A 1LQ1A 2J5PA 5CQGA 2NVUB 2GTOA 1GCQA 2X6XA 1LPLA 4BE1A 2RHSB 1LVAA 2BHYA 3UGQA 5FKOA 2F69A 3K6GA 1B3QA 1QVFA 5AONA 1PC0A 3E9GA 5D5UB 4PG3A 3KYCB 3SQNA 4BAYA 2K02A 3HXYA 3N4MA 1WGXA 1VQ8A 2H94A 3CCRT 5BQTA 1SD7A 3CXCP 1ZBJA 2MPXC 3IAS2 2F5FA 2EJFA 2GQQA 4J7IA 1IHVA 1M1GA 2O01E 4F7UA 3KP4A 2R7VA 4HBLA 3I59B 2MYSA 1P9QC 1QZEA 2KY9A 1D0YA 5CKBA 4LLNA 1X4PA 2CT3A 1N9RA 2Z2SB 2GF7A 2M0YA 3M0UA 1FIPA 4X1EA 1Z3YA 1SHGA 1ZSZB 4KYWA 1UHSA 4XLPF 4RM2A 2G9WA 3ZOBA 2XRLA 3LWFA 2OTJT 2B63J 2GIVA 3QU6A 5F27A 1JJCA 1FOYA 4NL3A 1D5VA 4RTUA 4DA4A 3BDLA 2CZ0B 4C8QD 2LSOA 2NOGA 2CDTA 1MBKA 3RKXA 5FFZA 3K9TA 3QYHB 1NPPA 2XSJC 2M3AA 2I4MA 1I1GA 2E3HA 4A5MA 1CKBA 1KFZA 3EFOB 1K79A 4HPQA 3HFNA 5GAOn 1XG1A 2BY2A 2X4WA 4Z02A 1SG5A 5H20A 3ZBDA 2DAQA 1LE8B 3A7UA 2ZMEA 3KFUA 1XN7A 2JK3A 1JRIA 4ZYGA 4G7HF 1YIJT 1MDMB 4E7IA 3ZN1A 2EW3A 1AD5A 1Z67A 3BC8A 3Q0VA 2HOSA 3LL7A 2DI3A 2OTLT 1SFEA 1AOYA 5D6WA 2LFBA 1FBQA 3VQVA 3FBNB 3HSRA 4IUQA 5L3BA 1KQ1A 5B66C 4FYVB 4Z2YA 4OMOA 3R07A 3G7ZA 1IN5A 2IY5B 3K70D 2LKSA 1YJNA 2DFIA 2V26A 4FTHA 2BZ8A 4OF1A 3M0RA 4YIFA 2E5ZA 2Y31A 3RKQA 4G85A 2CGPA 4X9DA 3K4NA 3T9NA 4PLLA 3G71I 3I9V2 4YRIA 3HXLA 4L18B 4XICA 2L89A 2A6TA 4CS3A 2WTEA 3ONQA 4QSHA 1OPCA 3PVLA 1SVLA 4ESRA 3QYFA 2E36A 2X6OA 3HFZA 1NTCA 3R61A 3K4CA 5DV5A 1VQLQ 3BE3A 1R5GA 3CC7I 1S72Q 2CQKA 2OQRA 1XQHA 3BT9A 2O9SA 4M3BA 2ZJ2A 4RGUA 5CJ9A 1RAEB 3S1NJ 1FY7A 3SFIA 3CO7C 3CCLT 1Y6IA 4RQEA 2MD0A 3F6VA 4RDUA 3ZFJA 2MAMA 4YCVA 2QCOA 3N05A 8AT1B 4HOBA 5JFRA 4E6RA 1TT0A 1TUGB 1ETWA 4KT6A 2RQPA 4F92B 1YI2A 3LNQA 2RHZA 2RHQA 3CC4T 4YFKF 1W2BP 3PUBA 2F5VA 1NE8A 4F91B 2EIFA 3DV8A 2KQWA 3QIIA 1UG1A 3AT1B 2ZPFB 3K10A 3QO7A 3FDYA 4M9XA 1VQ5Q 1NG7A 1W7PD 3FM5A 3QG1A 2X9HA 3LAJA 4U0WA 3OMYA 1APLC 2NUTB 2K86A 1LOJA 4ZTZB 1XOVA 4XRSA 2CO5A 1G2BA 1QHHD 1OI1A 1YS7A 5HODA 3DTKA 3QO8A 4HF1A 4F7ZA 4M9ZA 4A3LJ 4IOAF 1BKBA 5CKEA 2IBDA 1VQ9T 3GTKJ 2X9DA 3KZYA 4OMMA 2N8GA 3I55I 2K6DA 3ZQHA 3FDRA 1W1FA 4RTVA 4N4HA 4JJCA 4UP8A 3VS5A 4LDXA 4R8HA 3QDRB 5HCKA 4N4IA 3GW2A 3JCMd 2LK2A 1OCOH 3KZIC 1T2KA 3J81E 2RD1A 5HGQA 1QZZA 2ZCEA 4HW0A 1Z05A 5IT3A 2GFAA 2VONA 2NUPA 3IP4B 1IGUA 4XKWA 2CSQA 1VNDA 4XQFA 2NVQJ 2QVOA 3GNGA 1BR4A 3DU5A 4NC6A 4A12A 4NHJA 3KXTA 5KAIC 2R5YA 3SB2A 1RNLA 2EYWA 1G5VA 1JJ8C 1VQ7I 4KT0E 2ELHA 4BGDA 3LH0A 4IRIA 3JCMh 2CV0A 3CP2A 3RQIA 3CCRQ 1EFWA 3HYIA 1EH8A 2KNBB 2P0LA 3VUBA 4M78A 4A3MJ 2E71A 2JT1A 4BHCA 2X0LA 4J9GA 3CMAA 1B9NA 1RPWA 1M90U 1U9OA 4L5JA 4RB0A 2VODA 1YIOA 3GTOJ 1YHQA 1G5HA 3HKZN 4HCBA 1WHJA 4P9UA 1WJSA 1HW2A 1H92A 3RYPA 3VRZA 3ISPA 1X2HA 3SEQA 5ILVA 5LJ3g 3UGTA 1D3BB 1NEBA 5GMKm 2CP3A 1RLPC 5GMKl 3IQLA 3HM5A 1AHDP 1WWXA 1V54H 1T0HA 3EG3A 2R7OA 4N0AA 2HDAA 2XDDA 2EBPA 5CYVA 4A63B 2CJAA 3F22A 1SMYF 3R6OA 2L9VA 3U9GA 4PLIA 1LDJA 1DGRM 4MMKA 1BR1A 3W2WA 4HZFA 3M8JA 3G1OA 2XTIA 2XAUA 4EATA 4GYIA 4UXNA 3JCMV 3HSFA 2RA2A 5EZGA 3P9IA 1RL2A 4P55A 1RIOH 5IP9J 2E35A 2AKWA 3A7RA 2LMJA 4JX6A 2GFUA 4BE2A 1YIJQ 2DO3A 2NUZA 1KD1C 3EPZA 4IX7A 5LBQA 4AWXB 2OTLQ 4S04A 4ENKA 4Q6GA 3ZXSA 1WQ2A 2W25A 4P3NA 4FQGA 1PUFA 1VQPA 3M7GA 1KD1U 2HTSA 3DB3A 1LJOA 2DFUA 2IA2A 4MTEA 4OB2B 2EZHA 4JX4A 3FHNA 2PLYA 4KNYA 2FMYA 2QASA 1V1CA 2BE5F 1UGVA 4MTDA 3IKTA 3X20B 4JS5A 2YX4A 2DTRA 2YUSA 3TU4K 3H8ZA 2GNCA 2BXZA 5F0FA 2FUG2 1J9IA 4M77G 1YYVA 2Y48A 3DP7A 2LQ8A 2JZYA 3W3CA 3MZYA 2R5ZA 2DCEA 5DTDA 4XRMA 1W66A 4IRGA 2VPLA 4A3IJ 5ICEA 3EGDA 4UUSA 4WXDA 4BJ5C 2D0NA 1IO2A 3VYUB 5B1AH 3JV3A 3LA3A 3D0SA 2JA8J 3PSFA 2XUBA 2Q8KA 2D8JA 1QVFS 2FQ3A 1N6AA 2WB1N 1I6XA 3CCLQ 1TW3A 2P4TA 4BQAA 3C18A 5JHUA 3GPLA 4A54A 1NPRA 4M75A 3F72A 5H6RA 5EG0A 3BR5A 2YSRA 5GMKj 5I2MA 5E79C 3CC4Q 3OB9A 1GLNA 2EPFA 2XPWA 4J83A 2LRQA 1U06A 2ZZDA 4LGWA 1WHUA 2EAYA 1I1JA 1M4ZA 2R7SA 2PEXA 2E12A 2DFEA 5ED4A 1MBFA 2JWTA 2P6SA 4JRKA 3G4SI 3CUQA 4L5EA 2K5FA 2AS5F 4XORA 1K0SA 1W4MA 3BW1A 4F7UF 1YRNA 3HXZA 1IN8A 2GWRA 5EG2A 3LQRA 1WJCA 4CXFA 1RABB 3V4GA 4DJAA 2BY1A 3K1NA 2AMCA 2DPPB 1QVFP 1VQ9Q 1RC9A 4C30A 3P9KA 2FXAA 5FGMA 5DLOA 3CP8A 5CO7A 1Z9CA 5E18F 2MG4A 3X2QH 2E70A 4RAYA 4F93B 2Y75A 5M9OA 4DW6A 2KKOA 1CF7A 1JHHA 4LIVA 3GOXA 1XX5A 4N9HA 3T8TA 2HZDA 1P7JA 3WTSC 2DAOA 3TVTA 1MD0A 1XGSA 4C2MJ 5J4YA 3OSSC 2PMHA 2P5VA 3PE0A 1QCNA 4KITB 2WAFA 4U7DA 1B8AA 3CESA 5ECAA 1NYGA 5GMKi 5KYNA 1GV5A 2M1HA 4YRCA 1T0FA 3OBWA 4FHTA 4LDWA 2M8EA 3OIPA 3VQXA 3FZVA 3M3YJ 3WTVC 3JRBA 2EL9A 3V7CA 4WXCA 2VXFA 3DFGA 1XMKA 1XMXA 5D4SA 3HSBA 1W7PA 2CZ7B 4JJDA 5GAMe 2Q5HA 5F0CA 1VQMA 2DZ9A 4YRJA 1USYC 1R23A 5DCMB 4BL0B 5EEGA 3SFZA 2YUOA 3EAEA 3O3KA 2PJRA 1VQNA 4BKXA 1E17A 2ZT5A 4M4ZA 5GAN8 1B8IA 1IC8A 4ELZC 3KEQA 1VQLI 1MH4A 1RUOA 1UMQA 1B70A 1S72I 3D1NI 2MIOA 5D6EA 4ZIBA 2P5KA 1B1BA 2Z16A 4CA0A 2DQ3A 3E5QA 1WKMA 1T3LA 2KROA 2EGAA 1MJBA 4B1RA 1ZG1A 2EQUA 4EGYA 2DD5A 3NFCA 2XROA 1P2FA 2DJQA 3TQNA 3F8NA 4OOIA 3ZMDA 1TTHB 1MNDA 3HPWA 2UUZA 2WY8Q 1ZTRA 2A28A 4AMCA 4C92D 3OYLA 2WV1A 4XOTA 3FXQA 4GXOA 1IRXA 2EIJH 3LMMA 3LWHA 3B6CA 1OU9A 3VYGA 2E1OA 2LF8A 3KP7A 4TV7A 3ZGKA 2OU2A 3MQZA 5CKFA 4ELYC 2E2JJ 4D1QA 3G1JA 2LQKA 1Z91A 3PM1A 1VQ5I 4HX4A 2A8EA 2RQWA 3RMQA 1P6RA 2KK4A 2E5AA 3L7WA 4F14A 1PKTA 2KRCA 2D9TA 1OZ2A 3FM3A 1E1OA 3HKZA 2E6NA 2W4SA 2DA9A 4KULA 4FW2A 4AFQC 4Y52J 2XC7A 1PWTA 1RAGB 4FX0A 4EVIA 4HDUA 2DXUA 1TUDA 1VYUA 3MAJA 5D7UA 4EMGA 9ATCB 4FW1A 2J6FA 5KYWA 3H36A 2KBTA 3GMEA 4DBRA 3P5JA 1UB9A 3GTLJ 3CCST 4DYQA 2HQAA 1B9MA 3M5AA 4XRFA 4I6ZA 2ZPHB 2E65A 5I21A 1E7OA 2BW3B 2VGNA 4BY1J 2IGOA 1U5TC 3A5YA 3CCJT 1NJIC 5IT9Z 3BZKA 2QDLA 2KDOA 4ZYHA 4WK8F 4H2VA 4YCUA 1IV6A 1VQOT 4ENNA 5D6XA 2PNIA 4NCXA 2M34A 3KFVA 1GCPA 1NJIU 4M7AG 4EMKC 1AKHB 2AZSA 1X3UA 2FHDA 2YUQA 2DOEA 1WJFA 4Q4ZF 2JRTA 3K4LA 1M2OA 5CQYA 2RJEA 3AFHA 3Q0UA 4J9HA 3UT1A 3OMGA 4LG0B 3REUA 2EPDA 5E3OA 5FLXK 1Y0MA 3BCBA 5E8GA 2LX9A 3W3SA 3CCRI 4JLGA 2E19A 4RAZA 1QZYA 1J59A 2KLOA 2YWWA 2ARSA 4BBRJ 2STWA 2WADA 5LJ3j 3EUAA 5BPIA 2DOFA 4GLMA 2W1OA 5H6QA 2VOPA 2BHZA 2WBMA 2CSOA 4M7DD 1QQIA 5FLVA 4NBQA 2H8WA 4AFSC 1QVPA 2ZZFA 2YXYA 2QUFA 1HF0A 2Y9YA 2B86A 3TO9A 3PSIA 1T8IA 1EF4A 4YREA 2QHVA 1SF9A 1UTIA 3WHCA 4F7UE 4A3JJ 3S2DJ 4RTWA 3QYBA 5GAN5 3HUGA 4LLGF 2RMOA 3BQZA 2J06A 1QVTA 1WYXA 2L9RA 3FISA 2K7AA 1D0ZA 4ASNA 5D5XB 3CPWA 2QEXA 3PTAA 1YGBA 2NWMA 4KN4X 2M16A 2CP0A 4D5FA 2WB1A 3HB9A 2C0IA 2M0MA 2A08A 2K85A 1OYXA 3OSGA 2IAIA 2XRNA 2EKHA 3H9NA 1X27A 3JB9F 1I81A 2XB5A 2X6WA 4B09A 1AWWA 2KIQA 4NS5A 2XDBA 5IYBJ 1U5TB 3E9FA 3WODF 1YIJI 4UHTA 4XONA 5E3NA 1Y57A 2RNGA 2Q7EA 1XC5A 2J05A 1T0JA 2H3JA 1W1WE 4EMKB 5K1PA 2QBYA 4J5YA 4YRVA 3GTGJ 2JW4A 4RAGA 1LKXA 3SWNC 1I3QJ 2CS7A 2K4BA 2D5VA 1E22A 2E10A 4OB1B 1VQMT 3X25B 1SD4A 4LVJA 1K9AA 4DZJA 2CG4A 1HK9A 2E7WA 4G9YA 1LFBA 2UV1A 3PL8A 2QENA 4HX8A 2RQVA 3HTUA 3M0TA 4RGXA 2DDAA 3K69A 2K2VA 1TP4A 2LG4A 5IXFA 3FMSA 5KNLA 1T3SA 5LHIA 1D09B 3FKJA 3UKGA 1TNTA 1TNSA 3OS2A 3SEMA 4EJWA 2L01A 2ECCA 3VKIA 4TVYA 3IALA 1S7OA 2EFIA 2ZR2A 4XK8E 2FEIA 2JQ7A 1BK2A 1GL5A 4GBQA 4NB5A 1A31A 3H6ZA 3CCLI 2QK0A 2LR8A 4E7LA 1XDUA 3A1PA 4OMPA 3KLNA 4E7JA 1I5OB 3NEUA 3GLLA 1AT1B 3GUDA 2RC4A 4MHGA 3ABUA 1IO6A 1ZQ1A 3FXKA 1HW1A 4DEYA 5GAGJ 3CC4I 4BXUA 3META 4LLLA 2XPUA 1V3FA 3RUXA 1VQ4T 2OD5A 5CK9A 1QU3A 4WJ3M 3REBB 5FRMA 2RB6A 3ZQQA 2XB0X 2Q5IA 1QO0D 3HXVA 1WJQA 2VQGA 4WCIA 5CQEA 2F4OB 5D5VB 3MEXA 4CH7A 1P4WA 5FD5A 1UECA 2XF5A 1Z7NA 3L2UA 2CP2A 2A69F 3O2PE 5D4RA 3GF5A 2I4LA 1ZR4A 4P72C 3GFJA 1DU6A 5EEAA 2VC0A 1QNTA 1X43A 1PHTA 1QP3A 2FJ1A 3G71A 3S2WA 1E6HA 2BEOA 5EGOA 4HCCA 1IG7A 1QCOA 5E8IA 4CH6A 3GP8A 1K83J 4PJOD 4M75F 2HBWA 2OCEA 4Y3OA 3EFRA 4BUGA 3M4OJ 4KH0B 5A0LA 1QGPA 1GCQC 2BXYA 3I35A 3ZMSA 3IH3A 4KGVB 4CICA 2Y9ZA 1NG2A 1UHFA 3CC7A 1GUUA 3CCSQ 3H9QA 5LGUA 3VSLA 2PI0A 2DT7B 5K7HA 1RUNA 3VS4A 4EO4A 3JSPA 4RB3C 1GGMA 1MNEA 3CCJQ 2MH9A 1I1SA 2EV6A 2PN6A 2R7WA 1KC8R 1OFCX 2CW0F 4YRTA 1OCPA 2K3XA 4JJNK 2COWA 2EWNA 1E1TA 4C92A 1VQOQ 1VIFA 1R1UA 1UE9A 4M74A 2YHTA 3KPHA 3TP0A 4BHBA 4Q15A 1YFRA 4IOCF 3HFOA 2KRSA 3ZCOA 1X2GA 4M78G 4F16A 4CC4B 3W2AA 2FX0A 1F5TA 2M9HA 3HOUJ 2GGRA 2QSGX 3H9GA 4LN2A 2XKOA 3H0DA 4LVLA 3IRRA 2C06A 2YU9J 3RYRA 2WSCE 2HZTA 1YP5A 1Z7MA 3OV8A 4EM1A 3EGXA 3F6OA 1Y07A 4Z88A 3RDIA 2OF7A 1OCCH 1M3CA 2Y2ZA 4WX9A 3I55A 1OYIA 1G5IA 3JCMQ 3P9CA 5CVRA 3D5SC 4M78E 3AG4H 4D5CA 4OB3B 3H3ZA 2DU9A 1C0AA 4A2UA 2VQLA 1MNMC 1V4RA 2V1DA 3TL4X 3HIFA 3RNJA 2VC1A 4UPAA 2ZMEC 1QW1A 2I2LA 2QEXT 3PGGA 2ZZGA 3ZPLA 4AIJA 2RO0A 1ON2A 2DDZA 3A31A 2ELKA 3FHZA 3S3OA 3VS6A 3TOBA 1G83A 1YCYA 3Q9VA 4CCMA 1PNJA 1S5LC 2LYCA 3C2BA 1GV2A 1UFFA 1EKEA 1VQ7A 2PZ1A 2ZSIB 2XF7A 3W6VA 2Y90A 1IN7A 5ILSA 4LB6B 1TU0B 3JAMZ 1DU0A 1WHHA 5FRNA 4HAMA 5EZHA 3SFMA 4BY7J 4HVCA 4ZGJB 3K2ZA 1A6QA 2LP0A 1DJ7B 4M7DA 2P0QA 4JS4A 3RPUA 2MC3A 3A4CA 5TRDA 3SXYA 4IURA 4F7UB 1NBEB 3HHGA 2DO7A 1REPC 2ACJA 3LSTA 1I0CA 2LCSA 1FMWA 2DPUA 4HSTA 5HNFA 2MI6A 3OBYA 4CYCA 4RDXA 1ZRFA 4C8QG 4II3A 4WWCA 1BYMA 4GCVA 3ICAA 2DVEA 1MH3A 3LSIA 5LL6S 5KYUB 1F1BB 4P96A 1SD5A 3CMEI 3OS1A 4QKUA 1QRYA 4I2OA 3VB2A 4KDPA 4BS9A 4II1A 3A32A 1YOVB 1XTAA 2W7NA 3A98A 2GQIA 2CJJA 1M8MA 1WLPB 5L3FA 3E97A 2VXDA 2DYSH 3V7RA 3NTHA 2ZFWA 1WI9A 4BEHA 5F04A 1NJ5A 3QJ6A 4M77D 3WXMB 5FLXE 1VF9A 5KAFC 1K73C 1TWFJ 5GAN2 3QOPA 5DM6F 1JB0E 1YW9A 4M6VA 4OAYA 4CCJA 3F23A 2JNGA 1J09A 4HVWA 1K73U 1RETA 2ODRC 4HNTA 1A6IA 1GVDA 2GQVA 5ELOA 2F5TX 3BJ6A 1RI0A 2LC4A 2QHSA 2ZMEB 1KYZA 3QODA 4XLNF 3SD4A 2A36A 4LVIA 1U5SA 4BBSJ 2EZIA 2YX7A 2K9LA 4UB6C 2IRFG 3K7AJ 3UR3C 2O9VA 4C5IA 3NGPA 2E2IJ 4FT2A 1VQ4Q 1Y0NA 3FB9A 5A2QE 2D6FA 4H2XB 3ERMA 3J7YJ 4MGRA 3VQWA 3WVEB 4C5EA 1XMAA 2K3FA 3WU2C 2KSSA 4L9TA 3P8DA 4YRFA 3WG9A 2QQAA 3OR2C 2GXAA 3GF2A 2GAUA 4M75E 2AIRB 1WHKA 2V1UA 2Z33A 2E1CA 1RLQC 4J6WA 4XLEA 3M55A 3JW4A 1OLTA 4ETSA 3P7NA 3WTTC 2EKOA 1M30A 2H09A 4Q5WA 1POGA 2QDYB 3BDDA 3CPWS 3HOVJ 2ZXJA 2FVUA 2HXOA 2V7FA 3HFZB 3L2VA 4D0PA 4HCZA 5J1UA 2GA2A 3VFZA 3AL0C 4JDSA 2LNVA 1TG0A 3BG3A 1U3OA 4AM3A 1R1VA 3QTCA 3SZPA 1R5ID 1OPKA 3FIFA 4C3HJ 3KP5A 3L2ZA 3PJRA 4LDUA 12ASA 2XGXA 3MJXA 2QA4T 3VYSB 1R4MB 1KSWA 1K78A 5K1YA 4XU0A 3IKMB 4ESJA 3QRFF 4FE7A 1ZRCA 3OYAA 3NELA 3QZ5B 3M0SA 4BW9A 3R60A 2XAHA 3CUOA 3WGIA 1KU3A 4WJ4A 3KP6A 3QBYA 2W24A 3G4SA 2L9SA 1X6OA 3CPWP 2ZT8A 1WVRA 2I4NA 4HWSA 4BY6C 3HTZA 4ZH4F 2ZXHA 4PJOA 1HOMA 2DIGA 5LJ3d 5KE3A 1P92A 4CO8A 2CUJA 4D7MA 2IP2A 2VOOA 3TDZC 4OWRB 2DL4A 4GY5A 2OX7A 1YTYA 2DU5A 4HT8A 3DKMA 1O3SA 4X5OA 3MZ8A 1NM7A 4CRIA 1BJAA 5KNNA 1FPQA 2XAQA 2JS0A 4HVUA 2GXGA 3QUIA 1FSEA 1YNZA 3HY0A 2FO0A 3HOTA 3RMSA 2QEXQ 3E5XA 1MMNA 5LJ3h 3DTIA 1EQRA 1ZA1B 3UF4A 1ZQ3P 1PP7U 2MMPA 1G51A 4CC3A 3KP3A 1AWXA 3CCUT 2QTXA 5KCOA 3TW7A 1SAXA 1Y96A 4Z8AA 2KT8A 3DEUA 3OWTA 4H2UA 3DEWA 2ZINA 4ZDOA 1X54A 3CF5F 2R5YB 1TC3C 1U78A 3AL0B 2C0OA 1J7KA 2HCKA 2CH0A 4PK4A 4ZZLA 1GBQA 2Z9OA 5LFAA 5ELNA 3OYNA 3IC7A 5C3EJ 1KQ8A 3ZMVA 2GA1A 3M4PA 1ACIA 3WTUC 2M1BA 3R6NA 1MSEC 1M2VA 1YITI 1FNNA 5LJ5g 1QBJA 1TBXA 2LJ3A 2Y4XA 2A5WA 2YS9A 3PMTA 3PZCA 4UY8I 1VQLA 5EEHA 2L3PA 4CS4A 1S72A 3CCSI 4M73A 3QWXX 2M02A 3GBQA 1OX8A 2A61A 2KAFA 1YJWI 3QZ9B 3P8VA 1MMDA 4YDQA 3CCJI 3KBGA 3QOEA 1R77A 4PJLA 2VKHA 4GDFA 3SZGA 2VN2A 1VQOI 2KHMA 3CCVT 2LX7A 5E1XA 5LJ3f 3ZQFA 2DLLA 5JR3A 1ZG3A 1V5GA 4PJNA 5CPRB 4BE0A 2GIZA 4BY6B 4B48A 1P4AA 4IO9F 4C2TA 2CV2A 2L0AA 2LMDA 5TGTA 4M75C 3OYJA 2ZFUA 2ZNYA 1VQ5A 2IVWA 5EYRA 3G73A 5BPDA 1ZSZA 4TVRA 1HYOA 3E6MA 1BI2A 4BI4A 1HKQA 1XGMA 2DTIA 1UEBA 4FL6A 4KN7X 1YW8A 3HY1A 4P75C 2L2PA 1NJ1A 5CKTA 3CUQC 1JUPA 4C92F 3H0HA 2KDZA 2FYKA 5HS9A 2AKWB 1ASZA 3Q3SA 4X34A 2EQIA 1M27C 2F5CA 3HL8A 5HLTA 2XI9A 3ZMTA 1ZX6A 1PG5B 2VGMA 4KR3A 4EPCA 4WXHA 3REOA 4D7NA 2C7IA 2FMLA 1UJ8A 4PNOA 3TUPA 2DL3A 2VWFA 1CQTA 1H3HA 3OYHA 2B0LA 2NNYA 3CZ6A 4U88A 2FOWA 2ZNJA 1IXSB 6AT1B 2V1NA 1OX9A 1W36C 3A8LB 5DM7F 1N9WA 2CUDA 3S32A 1MDMA 2KI7A 1FJLA 1K4TA 1SVMA 2DD4A 4M77A 3WU0A 4FASD 3RPQA 2O31A 2P8TA 1SRYA 1Q82R 1RAFB 2FBKA 4LUDA 1T0FC 1ZRDA 3A0BC 5FU7C 2E6ZA 1F36A 2NLUA 3CCRA 2OAWA 2ZXWH 1KD1R 3ECOA 4KRTA 2LNBA 3EGDB 4UUSB 4YEJA 3N97A 2IY5A 4F52A 1N25A 4LB5A 2K5IA 5DS9A 2Z99A 2F48A 2W84A 2HBPA 2KP6A 1X3ZB 2W10A 2NS6A 4XKBA 4MZTA 4RLQA 4M3FA 2DJNA 3E6DA 3PIOA 1KONA 2LT4A 2DA5A 2BZTA 1UGSB 2IG0A 4XTZA 3BROA 2AHQA 3ABLH 2QA4Q 2H6BA 2DZCA 3BJUA 2XPVA 3VRYA 3HXWA 4J9CA 4M75B 5EG0B 2YU3A 2FRHA 1MUZA 3PVQA 4H2YA 2RVCA 3LSQA 4J7FA 3G4ST 3DXJF 2MH2A 1WYDA 3RTRA 5BS6A 5HDNA 1TTYA 3A74A 4P3PA 4KR2A 3L09A 1JUSA 3W6JB 2L5QA 4M7DF 2DK5A 1FZPB 5IN1A 4RB1A 1UGPB 2JA6J 5L23A 1SSFA 3K4BA 1YRNB 1RI7A 1AU7A 4DOZA 2P84A 1H9TA 1QPMA 3TBIA 2F2XA 3BTCA 3KE2A 1QQJA 1GHCA 2AMCB 3S3NA 3FC3A 2HD0A 2BZXA 2YT6A 1I5LA 3VS1A 4WTOB 2QQBA 1YIJA 4H4KC 2M8GX 2VQHA 1R00A 3C0CA 2F5DA 1CF7B 2HDDA 3L42A 2ZXFA 2OTLA 2A7YA 3JRGA 2Z3YA 1VQ4I 2NUTA 1VQZA 4RS8A 5KHDA 1LYLA 1R71A 5K7ZA 2NVXJ 4ZYAA 2YUPA 3M8EA 2JUCA 4ZTFA 1B72A 3OOPA 3H5RA 4EJTA 3CCUQ 1L0OC 2VKDA 2EILH 4M6YA 1H8KA 5FU7B 2DODA 1WPKA 3OS0A 3J80K 4J01A 1HKSA 1U1SA 3W6KB 2CQNA 2OUMA 2HTJA 2VJ5A 3UH0A 1BL0A 4XTYA 3HPGA 1EVKA 2I0NA 2E64A 1BC7C 2L4AA 2PJRB 5J8CA 4NC7A 1M1KC 4LK1F 4IIMA 4Y92A 4ZN3A 3I4MJ 2ZO4A 4BDYA 1LCKA 3I5SA 3HRIA 5M5XJ 4ANJA 2DMPA 1N77A 2CSIA 4A3FJ 2FG0A 3MP1A 5E1ZB 3IRQA 3EG9B 1SERA 1M1KU 1TT5B 2M7AA 2HQEA 3C1DA 4XLHA 3E7LA 3CCLA 4C92G 4B3XA 1MMGA 1HC7A 4AYBN 1ABQA 3FKIJ 2AKLA 3QPLA 3G1MA 3CCVQ 4IIOA 4A0ZA 4IHVA 4U0VA 4JLIA 1ETKA 4ORZA 3CC4A 2ZPBB 1OOTA 3I54A 5D8KB 1ZGWA 1DP7P 3M57A 1BR2A 1LJ9A 5GAOl 4FYWB 3BDUA 2EZKA 4LD5A 4FM4B 1MGTA 3A8MB 1WH5A 3F8MA 4IUPA 3HRMA 4R1HA 1OR7A 3E9IA 3MP6A 3JSCA 4OIPF 3EYYA 4C92E 1KQ0A 1V76A 2CQXA 3C2HA 1ERDA 5IT9K 3TEHB 5D6FA 2F4MB 1X01A 3RKWA 1IDYA 4BH9A 3LX7A 1R5HA 4IQ4A 1D3BA 3LFKA 2VUMJ 1HSQA 5KCMA 3DKYA 2DETA 8ATCB 3ZQIA 3EUKL 1OEBA 4IUUA 4FYYB 4BQNA 2DQ0A 4XR6A 4IJAA 4WF2A 1WHMA 2AZVA 3FWEA 6PAXA 4YYEA 3FBIB 2QKLB 3JRFA 3GTQJ 3QJYA 1UHCA 2M30A 1SEMA 4NL2A 2PUOB 5GAMg 3S17J 1O4XA 2DK3A 1TS9A 2DXIA 1CSKA 1JXMA 1JKPC 1ADYA 4XEOA 2X6YA 2CQ7A 3WTWC 3E5UA 4PJOF 1J3TA 4M7AA 4CCLA 2IPQX 1BC8C 1G8XA 4JRQA 1LDDA 1BI3A 4LMYA 4QQ6A 1B76A 5C6SA 2MWOA 2HDCA 2GBYA 2MF2A 2IS2A 1NH3A 2R7TA 1EFNA 1ZA2B 5HKCA 1T98A 1T33A 5FKNA 1JXOA 3I4PA 2D45A 2DJIA 1RAIB 1JBMA 4M7DG 4UV9A 2A6EF 3HEFA 5C44J 1YS6A 4HG2A 4W1UA 4J8OA 3DPLC 1I5ZA 3TKYA 4RM3A 3NWTA 1MGQA 5LRSA 2O61A 4I0BA 1JJ2P 4AVPA 2HVQA 3LOCA 2H6CA 2CRGA 4IXAA 5GPAA 2W82A 3QNEA 1NJIR 4ZN1A 1VFCA 2XDPA 3ZP5A 1QVGS 4B43A 3S2HJ 4B3AA 4AVZA 2SRCA 4M6XA 5F1JA 3J7AF 2CUZA 1OCTC 2LLKA 5GANg 2RQQA 5AYFA 4M7DE 2LY2A 1S7AA 3EQLF 3M9QA 1Q86R 2XGEA 2P0PA 2ESWA 3UFGA 5LHGA 3KEYA 3G4SQ 3JRHA 3OYEA 3B02A 2AKKA 4BXFA 3LWIA 1EH6A 1D1AA 1NYQA 2KR3A 2E41A 4MIMA 2KIFA 2B8AA 4L9JA 3H3VK 2LT1A 3BTIA 4A69C 3HOXJ 1WJRA 4ZC3A 5K5OA 3PUFA 2HYGD 1AHJB 4R55A 4DQ2A 1A0NB 2KT1A 1G3SA 3RJPA 5IYDJ 3CPFA 2RK1A 1MMAA 1HD3A 1WPYA 2DBKA 3OYIA 2B7EA 2P7VB 2I4OA 1G2HA 1M3BA 3M4GA 1YX3A 4LNPA 1J75A 1X6BA 3J7AO 3BR2A 1H89C 3CJQB 5E3IA 2KISA 4H0EA 2L3SA 1XSXA 5K7FA 3KEOA 1EIFA 5GJWB 4OIQF 1X75C 3X24B 5KE2A 1FBUA 2QBYB 1SRMA 1LNWA 2CFXA 4IHXA 1M9SA 2OI3A 1U8BA 5DD8A 5HY6A 1OYYA 1UAAA 3HXUA 2HYFA 4LVKA 3L4GB 3CMEA 2KT0A 3S1RJ 4EEFG 3RI4A 4LOCA 2JA2A 3Q1JA 5FLMJ 2ID3A 1IXDA 1BBZA 2XVCA 1FX7A 1OKRA 3IWZA 1ZG5A 2CUBA 4HEA2 4UVCA 1WQ7A 2DXCA 1GFCA 2DL8A 1Q7YC 1HSTA 2HKQB 2KZVA 5F0HA 3O8HA 1BBWA 1KU7A 2JTMA 1M3AA 1HCRA 1KHCA 3SYTA 3TO7A 2NNNA 4DNCA 4MQVA 4P71A 1UJ0A 5FD6A 4KISA 1HC8A 2P6TA 3AAFA 4F17A 4JBAA 4A0XA 2R0QC 3DTEA 3ESWB 5LJ5e 2E60A 2XKOC 2MSYA 1Z9ZA 2QA4I 3SEZA 3RGLA 1OQYA 2ESHA 1EJ9A 3PNTA 2LVMA 2JM9A 3GBGA 1D5YA 4V19K 3CXCA 2FRYA 3JRCA 2DL7A 4M77F 1HLVA 2EVRA 1ACMB 3MCZA 1JGGA 2ZPEB 3FLGA 4L5IA 3FXLA 4ZDLA 3KX2A 4RGSA 3IKLA 5ILUA 2O2OA 2E4HA 1B07A 2Y0SN 4ZJZA 2GCXA 2ZGWA 1NNHA 1YCSB 4PJOG 2ZJRF 1DUXC 1QP2A 2GBQA 3CC2T 4K87A 2R57A 2VT3A 1YFSA 1X1BA 4FETA 1WI7A 4JZ4A 1OZ3A 4AYBA 1S3JA 2WSEE 3JCMb 4RCCA 5EGOB 1Z3XA 2VV5A 4Y4RA 1MBGA 1YFHA 3S3MA 4BQQA 2ABLA 3VSKA 3CLQA 2IS1A 3ROUA 4JP0A 3MHXA 4E6KG 2K3PA 1USTA 1JT6A 3WVDB 4P1WA 1X19A 2CW8A 1TH7A 4LIUA 4HQEA 3JRAA 4YRRA 4HT9A 4UB8C 1IGQA 2X4HA 2K9QA 2AT1B 4PJOE 2X4JA 3JRZA 3NEMA 1B6AA 4XU1A 1ZLJA 1ENHA 4Z89A 4BJ6C 3D5RC 1B59A 4QPQA 3LYIA 4XMYA 1ARKA 1FIAA 1Y1VJ 2IGNA 3DBRB 2KRNA 2JM8A 3CCUI 2B9SA 2QKMB 4M7DC 2M5WA 3AG1H 2VLAA 1B34B 1WSUA 1W0TA 3S16J 1B7YA 5HDKA 2ADUA 5CLSA 2O88A 3MEVA 2RN8A 1YFTA 2HNIA 3J80E 2E5NA 2L3DA 5HLGA 1ABOA 2V6EA 2VKVA 4X6AJ 4MDXA 3A5ZA 3MKDA 4LFUA 1B7TA 2EQRA 4LK0F 3EG0A 4XTUA 3CJNA 1FBSA 2DYRH 5TISC 4P74A 2HL5C 2Q2EB 4G12A 4RQFA 3S1QJ 4KIBA 2AQFA 4ATOA 1K4US 3OD1A 2UXXA 1N8RC 5D8LB 2J6OA 4JOMA 2V8KA 5ICFA 5C0MA 5C4JJ 1JTYA 2E7XA 4PJ0C 3ABMH 4LG0A 4Y7NJ 1ZH5A 5J6XA 3MQ0A 2V9KA 3HHHA 4XM3A 4KICA 4S05A 1N8RU 1R22A 2GTJA 3JAMK 3CCVI 3HOZJ 3CCET 3MEYA 1PVEA 3ZN0A 3BTLA 2MOXA 2L0KA 1QCFA 3D7SB 3BP8A 2Z5UA 3G1LA 3GNFB 3P8HA 1SETA 2PG4A 1PD1A 4OP0A 3OIOA 4Y33A 3G6EI 3OQ5A 3JCMf 2FU4A 3QPTA 2O8KA 2DW4A 2E5KA 3WU1B 1GXQA 2ZIMA 1ZKGA 2EB7A 1IZ6A 2XHCA 1Q82C 2PMFA 3TQ7P 4DYRA 2QQ9A 2FA5A 4OGEA 3H3UA 5FLXZ 3OYBA 4I09A 1Q82U 2XG8D 5FU6C 3K2AA 1YITA 1AZEA 1GXPA 4E7ZA 3EUHC 2RM4A 4PGHA 3VPRA 3CCSA 1PKSA 4J6XA 4LUEA 2YLCA 3FK6A 1YJWA 1XGNA 5GAEJ 1PRLC 4C8QA 3CMET 3CCJA 4CYCB 2E3CA 2DU7A 1R7JA 1VQOA 2GOMA 5A2QZ 5CKHA 5A0GA 1UDLA 3DF8A 3GCMA 1Q95G 2DN0A 1U6GA 1W5CC 2IT0A 3OW2S 1K76A 4BU2A 2XKPA 2YSQA 1TQPA 4XN0A 3OY9A 2EYZA 5JLWA 3HGGA 4NNJA 2BVLA 1WLEA 3A0HC 5BNGA 1J0RA 1RACB 1M1FA 1X6GA 2DMTA 1QWEA 2P0KA 4I76A 1IW7F 1S6LA 1VI0A 3E19A 2R7QA 3X28B 3PQJA 2ED1A 4OIRF 3PNWC 1KA8A 4MFDA 3PFYA 3M56A 3T5XA 1JXSA 2DRMA 3TO6A 2LDUA 3ASKA 2ZCFB 2HXIA 1H8AC 1WI3A 5E1WA 4M77E 4GYGA 2IA0A 2VI6A 4ZNXA 3A01A 2WWYA 1E2XA 1WJAA 2P81A 3UNGC 4M7AF 2ZXIA 1E6GA 4MDWA 3OL4A 2ROLA 2M0OA 1UUEA 2K79A 2LKXA 5TJJA 4PJOC 3VYHB 2OV7A 2L02A 3L00A 5C4XJ 3BG6A 3HTRA 1FSHA 2EQMA 2V9VA 1Y8QB 3ASOH 4QIWN 2HFHA 2X3WD 3BG7A 2DMOA 2ZIOA 4GRIA 5F64A 2RQUA 1BA5A 1FOXA 1K73R 1YB3A 3R4KA 1WU7A 3CC2Q 2