3I7FA

Aspartyl trna synthetase from entamoeba histolytica
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
535
structure length
485
Chain Sequence
QLPPVVLLKTPELVSGENFKVMPMHQSQPCYKTGLKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKEFVQFCQKISAESICDITGIVKAVEKPIEKATQQDVEIHVTSIAVVSLAEYPLPMQIEDLTFPSSVFKKQEEDIAKVKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHLTEFEGLDIEMEIVENYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Aspartyl-tRNA synthetase
publication title Crystal structure of the aspartyl-tRNA synthetase from Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 129
structure length 485
sequence length 535
chains with identical sequence B
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i7fA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3i7fA02
5C51B 5C44H 1PVOA 3HOWH 4DV1Q 3GD7A 3GTLH 2UXCL 2OTJA 3ULLA 3UFGA 4ZTZB 3H3VI 2PQAB 2Q2HA 4LF8Q 4L5QA 2K52A 3KDFB 3EFRA 1EIYB 4ZTUB 1J5WA 2CWPA 4HJ8A 1NTGA 3TUPA 5M3MG 1H4SA 2VUMG 2DDZA 1K83H 1OXVA 2KBNA 4DV0L 4HWRA 5IYCH 1BVSA 4LNQA 1B70B 1V9PA 4BXXG 4HIMA 1HH2P 1VCIA 1YJ9A 4IPHA 1WU7A 5IWAL 1VQEA 3G1ZA 1J5EQ 1I50H 3RZDH 3WQZA 4K86A 1YZ6A 1YBYA 3PIOA 4B3ML 4JI6L 2ALYA 4DV4L 2P0LA 3MEFA 3ULPA 2A1AA 4JI3Q 3R07A 3S15H 1MJEA 4DV6Q 2NVXH 3QO8A 4LFBQ 3NETA 3H0GG 4LF7L 2CJBA 4A76A 3D0FA 1VQDA 2RHQB 3MF2A 1VQ5A 4G85A 2DU5A 1SR3A 1IBKL 2F4VQ 4A3CH 1OXUA 5JEAG 3I4MG 2ZM6L 1YNXA 3B6YA 4DR3Q 2CKZB 1VQIA 3L7ZC 2ES2A 3CCVA 3VBBA 3S2DH 2E2HH 1I94Q 3A5ZA 5C52B 3VQYA 3OD1A 4C3HH 2UXDL 4LF9L 4A3MH 2C7IA 4XTWA 1UE5A 1M1KC 4AIMA 3TEHA 4BWAA 1Y1VH 3RF1A 2UUCQ 1VQZA 2JEBI 2ZZGA 3HKZG 3PO3H 2WAQE 2RF4A 4IFDJ 1SESA 1LYLA 3PV0A 4OONA 3KJPA 2Q2TA 2QEXA 4JCVE 1WPYA 3GTMH 4LUVA 5LMNL 1NNHA 4UY8C 4JI7Q 3UGTA 4C3IH 3OTOL 3T1YL 2KHIA 3QNEA 4DR4L 1HNWL 2Z0SA 2RHSA 3PZCA 2ZZFA 2OCEA 1X2GA 1S3OA 4X5OA 1VS0A 4WI1A 1Y1WH 1IBLQ 4XU1A 4AH6A 3NBHB 4OX9L 3J81i 4GOPC 1G5HA 1USYC 3V8KA 1YEZA 2UUAQ 5HGQA 4HWOA 3G4SA 1H4VB 3J7ZC 4BBSH 2DZ9A 3TQYA 2WP8J 4YCVA 2WAQG 2ARTA 4YPFA 1CSQA 2ZNJA 4LF6L 4YCUA 1H95A 4DV2Q 1Q1EA 3UE0A 3K81C 3HOUH 2BA1A 3HKSA 4A3JG 4BBRG 3L4GB 4JI1L 4GOPB 3L2PA 4Y52H 4QIWE 2E10A 3P8YA 2C35B 2Q5HA 2E5LQ 2CIMA 4KR3A 2MNAA 4A3DH 3V8JA 2YYZA 1Q8KA 4NXNQ 1E22A 1YVCA 2Q7HA 3REUA 5HY6A 3UE1A 3W1BA 3V8LA 1AE2A 1X2HA 2E2JH 1PFSA 1VQBA 3CXCA 4XEOA 1PH4A 1SETA 1TWAH 5C4XG 2YTYA 4TQFA 1HNZL 4YRCA 3W5OA 4GKJQ 1AE3A 2GVBA 3J81c 1L1OA 2ODRC 3NEMA 5FLMG 1SN8A 4DR2L 2VW9A 4A3FH 4POFA 3RLOA 4PG3A 4YWLA 1IL2A 4DPGA 2H5XA 3A32A 4JBWA 1DGSA 2ARSA 2MFIA 4P71C 3IRBA 3I56A 1HXDA 2I4MA 2HQLA 4A3LH 5GAHC 4YHHL 2DXUA 5GQOA 2AKWA 2OQKA 1VQOA 1HNXQ 2R93G 2LSSA 1WLEA 2XTIA 4DR5Q 3S24A 2V1CC 2CWAA 5IYDG 1ADYA 4HWTA 2ZT8A 3ZJYC 1SFOH 1G5IA 1S40A 4DUYL 3CMAA 4JBMA 1K73C 1Q46A 3CAMA 1N33Q 3HOXG 3K7AH 4JI8Q 2PMEA 1UEBA 2CCZA 1NYQA 1PA6A 1QVCA 2QHUA 4BA2I 2K5HA 2RCNA 2BA0A 4X62L 4UP7A 1XPOA 1ASZA 4YRIA 3PUYA 4P75C 4X66Q 4YY3Q 2I4OA 3CD6A 1QZHA 3STBD 4GKKL 4OWXB 4LF5Q 4DAMA 1SE8A 2PMZE 1QUQB 3HTZA 4JI4L 2I4LA 3A31A 2HHHQ 3PUXA 5C3EG 1JT8A 1JB7A 5JJKA 1TWCH 2GN5A 3KFUA 1SROA 3M4PA 2EJFA 5EAYA 1CKOA 3RKYA 1JJCB 3AEVA 1YHBA 2KHJA 4A3KG 2VS1A 2VQEL 4H2YA 4TVWA 4A3GH 4DKAC 4JI5Q 4DV3Q 4H2XB 1PH1A 2R7ZG 2KENA 2UU9L 2DEQA 1Q82C 2I5HA 2IHFA 1BIBA 5LMNW 3PCOB 3A5UA 4L5SA 4OO1G 2DJZA 2HNIA 3T1HL 3IALA 1XNQQ 4LW1A 4YRQA 1EQQA 4RG1A 1PH8A 3U4VA 1NJ6A 3W3SA 1Q81C 3PO2G 1I3QH 3EN2A 4LUOA 4JOIC 1HC7A 3RGLA 1HR0L 4P3NA 4CS2A 4YDQA 1YITA 2JA8H 4XTYA 3A5ZB 1FVIA 1RL2A 1UE1A 2KCTA 3TEHB 3HOVH 2WFWA 4XTXA 2ZIOA 4IJHA 3S16H 4OO1I 2ATWA 4EO4A 4IFDG 4A3BH 4BY1H 2Z6KC 4POGA 4DV5L 2PI2E 4BW9A 1IZ6A 4UP9A 1PYSA 4JI2L 4Q15A 3K7UC 2MQHA 4X64Q 4GNXA 4B3TL 1HJPA 1BBWA 1YHAA 5E3IA 4YRJA 4JI0Q 2E3CA 4TWAA 4LFCL 1X9NA 1CUKA 4H2TA 4LF8L 3E9IA 1K9MC 2RHSB 4R1JA 1VQFA 1L2FA 4OWTB 3AFQA 3RL6A 2K5VA 2NN6G 1NMFA 3CCUA 3RN2A 2ZT6A 1FJGQ 3NENA 3P8TA 2JEAI 1E3PA 3A7RA 4HJ7A 4A75A 1XMOQ 3HXVA 2VQFL 1YFRA 1A63A 1YHQA 1J5EL 1KXLA 4P72C 2IT1A 4P3PA 3QTCA 1B8AA 4ALPA 2ZJQA 1X3FA 3BZCA 4UP8A 3HY1A 4H2SA 3OW2A 4NCXA 2JA9A 2E5AA 2IY5A 1SRYA 1CKNA 4DV6L 4LFBL 1YIJA 3IKLA 3RNUA 5JJLA 1GVPA 1KC8C 3MEYA 2F4VL 3REXA 4GN3B 3TS2A 2P5IA 1ASYA 2JA5H 2A19A 4R4TA 3GDEA 3PSIA 3HXUA 3KJOA 2B63H 4YRGA 2BH8A 3RLNA 1WCMH 1EVKA 5H1SE 2R92G 4OWWB 1L1OB 2DTHA 2HIVA 1CSPA 2VL6A 2UXBQ 3KF6A 1BKBA 4GN4B 1WFQA 2PMFA 2K4KA 1KD1C 2UUCL 2AMCB 4JYAL 1KIXA 4H2VA 2DGYA 1VQCA 2XGTA 4K0KQ 1N8RC 1TWFH 1B76A 3E0EA 4P3OA 4DV4Q 2NVQH 4LF4Q 3OYYA 3GTKH 1XPRA 4TQUS 1P16A 4DQ2A 4JI7L 2ZR3A 2AWNA 1TXYA 4LF7Q 3TEGA 3S1RH 2WB1E 2EWNA 3HOZH 2AHOB 3KF8B 4AQYL 4IOCA 1NMGA 1VQGA 2OWOA 4DK3C 1EIFA 3S1NH 2ZM6Q 4OP0A 1GD7A 2YV5A 2N3SA 1IBLL 2CGHA 4CS3A 1PH9A 2DQ3A 4RDXA 2N8NA 3DM3A 2JA7G 3CCEA 4KLKA 3A0JA 4JBJA 3UDIA 2NZOA 3RKXA 1WI5A 2VZAA 4B3SL 4LF9Q 3L2ZA 4A3EH 1NE3A 3CC4A 3MXNB 2VNUD 2DQ0A 1Q12A 3VQWA 1UWVA 4KHPL 1VQ8A 1TWGH 1VQJA 3BJUA 3HXZA 1HZAA 1EOVA 2ZGWA 1VQ4A 2E5LL 4TVAB 3LC0A 1OTCA 2ZNIA 4A3IH 1OXXK 5LMNQ 1NJ5A 1X55A 3UDXA 4BY7H 2Q5IA 4P73C 1ATIA 1CKMA 3T1YQ 1HR0W 4DR4Q 1XNRQ 5IYBG 4UPAA 4YRSA 1NJIC 3CMEA 4Y7NH 2ZJRA 5IP7G 4XEMA 1EIYA 5IP9H 3GTGH 4K88A 3KOJA 2DXTA 3CCJA 5KNNA 3I7FA 4OX9Q 1TWHH 3CPWA 3DLLA 1I5FA 1I6HH 1EYGA 1YJNA 5C44G 4DR7L 4LF6Q 3HOWG 4XTZA 1PYBA 2PI2A 3U58A 1J6QA 4WJ3M 4DV7L 1GGMA 4JI1Q 1X3EA 3CW2C 3KYHC 1T9HA 5FJ8H 1IXRA 1PH2A 1KMMA 2GVAA 3H3VH 3FKIH 4YCWA 4C3JH 4YRPA 1VQAA 1X6OA 3A74A 1PHJA 3VDYA 1NY4A 5C0XG 2RHQA 5IYCG 2EAYA 1HNXL 3CMQA 4IOAA 4DR5L 2ZIMA 2C8MA 2Q2UA 5JEAJ 1IBML 4DR1L 3F1ZA 4L87A 4XTCS 3ERRA 2NVTH 3I55A 1E1OA 3HXXA 3CCQA 3HOYH 5M3FH 2EJGA 4E51A 3GTQH 1XJVA 1N33L 3K0XA 4DUZL 3RLFA 1D7QA 4DR2Q 1VQHA 1XTDA 4YRKA 3J7A5 4NXML 4YP0A 1A62A 2B63G 2F3IA 4LFAL 2VY3A 2Y0SE 5K1PA 1PYSB 4DNIA 4YWMA 4LNSA 4XTUA 4TTVA 4XU2A 4IO9A 4MNOA 2UUBQ 1Z47A 2ZTDA 1LM0A 5C0XI 5AJ3L 2DTIA 4A3CG 2JQOA 1P8LA 2LXJA 2Q2IA 1MKHA 4KI0A 5M3MH 2MO0A 1PV4A 1B7YA 1Q7YC 1BIAA 2BH2A 5C4JH 4BXXH 1VQ6A 4YHHQ 4H2UA 1H4QA 1NJ2A 2HHHL 4JV5L 4WF2A 2EIFA 2D62A 4A3MG 4OXPA 1N34Q 1Y1VG 2B29A 1N36L 1N32L 3AFPA 3PUZA 2K14A 4HJAA 2ZT5A 3PO3G 4DUYQ 1EWIA 5IT9c 3F2CA 2CJAA 2Y0SG 3P8VA 4IPGA 4JI5L 1C0AA 4DV3L 3H0GH 1QF6A 1XPUA 4R4OA 4GOPA 1USYA 3HFVA 5IY0A 3HRIA 3I4MH 1V1QA 4X62Q 4DR6L 3IKMB 3HFZA 1VQ9A 1W3SA 3E9HA 1Y1WG 4XTVA 3S14H 2ODRD 1OXTA 4PZ7A 3GO5A 1WQWA 2ALYB 4GKKQ 4JI4Q 4BBSG 4RMFA 3SGIA 1QE0A 3NELA 4H2WA 4GS3A 3S1MH 3GTJH 3RN5A 3EIVA 2Q7GA 2R7FA 2E65A 1SERA 3HOUG 1YJWA 1D8LA 5BR8Q 1N9WA 3I4OA 4KHZA 3UH0A 4LUZA 2VQEQ 2I5MX 3KF6B 4KQEA 5ELNA 4A3DG 1WQ7A 2CJ9A 3TRZA 1X3GA 2QA4A 3IG2A 4X65L 1JJGA 2I5LX 3BZKA 1SMXA 3A7AA 3T1HQ 1SRUA 2DKGA 1EQRA 2EJ9A 4H02A 3DSQA 3WWVA 3ERSX 1XMQQ 5M5YH 1U5KA 4YRMA 3HY0A 4J15A 2DZCA 3CP0A 3K8AA 3TREA 1X01A 1HR0Q 3LGJA 4DV1L 3PF5A 4P71A 3JC66 2J3MA 3BFMA 4BBRH 4B3RQ 5ELOA 3GTOH 4A3FG 3KLWA 4HA8A 4QL5A 1XMOL 3VQXA 5FLXc 3ICAA 4YRFA 3CQZH 4CH4A 3VQVA 4YROA 2OTLA 3CCSA 3EFSA 3CCRA 2B3GA 4A3LG 4EX5A 3HOYG 1Q1BA 4CH6A 2K75A 4IFDI 5LMUQ 4P74A 4JI2Q 3CC2A 2JJQA 3F2BA 2DU7A 4B3TQ 5C53B 5C4XH 4LFCQ 3S1QH 1VQLA 4APVA 2ZINA 4MTNA 1QUQA 1MJCA 3FHWA 1JMCA 1HZBA 4JI3L 5FLMH 1LTLA 2EL9A 1FL0A 3RR5A 2NN6I 4P75A 2UXCQ 1Q86C 3J80c 2ZTCA 1JJCA 1A0IA 3M7NA 1VQPA 2VQFQ 4R4QA 1L1OC 2UXBL 4GLXA 5JJIA 4HIKA 2IX0A 5E7NA 4DR3L 1O7IA 1KRTA 4K0KL 3G71A 4H2XA 2K5NA 1NBWA 1HTTA 1I94L 4DV0Q 4X6AH 4YYEA 2R93H 4LF4L 3K80C 3HKZE 4A93H 3PCOA 2F52A 2NVYH 2I4NA 5IWAQ 5IYDH 3FJPA 4G84A 3ULJA 1VQKA 1RIPA 4XU3A 3UGQA 4HIDA 2R6GA 2JA6H 2AWOA 3I4NH 1ADJA 1KAWA 4HWPA 1Z7NA 4B3MQ 2HT1A 4JI6Q 4Q6GA 4YWKA 1KMNA 1JE5A 1LUZA 4CS4A 3CF5A 1VQMA 4A3GG 1G6PA 1KRSA 3AYHB 3HOXH 2A8VA 1G51A 1KQSA 3QO5A 2L15A 1YFTA 1L0WA 2AKWB 4YRRA 2G4CA 4QGUA 4YRLA 1E24A 1OXSC 1IBKQ 2E8GA 4JOIA 3I2ZA 1YB3A 4CH3A 3PUWA 4AYBE 2KCMA 1KHIA 3M9BA 1GO3E 4DAYB 2ZR2A 4JYAQ 1PH3A 1NYRA 2JE6I 1JJ2A 2UUAL 3PF4A 2YU9H 4RQEA 3ER0A 1UE6A 2MO1A 4GLVB 3JAMi 1YFSA 3HXYA 5C3EH 2UXDQ 1VQ7A 4DV2L 1B7YB 2QHSA 4GN5A 3V7SA 2Z6KA 4FDBA 4A3KH 1XNRL 2JA8G 4XU0A 3S17H 1IYJB 4YREA 2ASBA 4AQYQ 3L1AA 4HJ9A 3HOVG 1S72A 4HVCA 2WB1G 2R7ZH 4NXNL 4PZ8A 1QVFA 3OTOQ 2ZXFA 4A3BG 4BY1G 4AYBG 2ZTEA 1Z7MA 3HRKA 3PGZA 1HNWQ 4IJLA 2ID0A 2PQAA 4BA1I 4B3SQ 4O0AA 1QVGA 3KDFA 4YRNA 3V7CA 4RQFA 4KHPQ 4TVYA 3M4OH 1PH7A 2Q7EA 2ZJPA 4YRTA 4TQDA 1RIQA 3PO2H 5K1XA 1M90C 4GKJL 2CQOA 1B70A 4KR2A 3HFZB 4IPDA 4NB3A 3STBC 3JAMc 3G48A 4JBKA 4P72A 4LWCA 2QGQA 3LSSA 4OLFA 3CC7A 1EFWA 3A5YA 3CPFA 3U4ZA 5GADC 1K3RA 1NJ8A 2EXDA 12ASA 4HWSA 1WYDA 4K87A 2PNHA 3F2DA 4ME3A 2I0QA 3EBEA 3LSQA 2N49A 4DR7Q 2QHVA 1WNLA 2AMCA 1FYFA 4DV7Q 4DK6C 3CCLA 4IPCA 1HNZQ 2ZZEA 4PHCA 2UUBL 1E1TA 2FYKA 4L5RC 1EUJA 4QJFA 4GNXC 2DVEA 2JA5G 3A7UA 4JI8L 4R4IA 3Q8DA 2ZT7A 1H4TA 1WCMG 2QHTA 4A93G 3S2HH 1N34L 4GNXB 1C9OA 3BU2A 1PH5A 1IBMQ 3FP9A 4DR1Q 2VUMH 4X66L 4YY3L 5K36G 1E7ZA 3RIRA 2JA6G 1PH6A 2D0PA 5M5XH 3I4NG 4LF5L 1NJ1A 4GLAC 4JC0A 4P74C 3M3YH 2NZHA 2DUDA 3AQQA 4DUZQ 1SLJA 3RACA 3MF1A 4NPSA 4NXMQ 2LXKA 4LFAQ 4EQ5A 3HOZG 1WOCA 3PUVA 2E2IH 3UDGA 2IHEA 5AJ3Q 4TVAA 2ZTGA 4XIGS 5DLQE 2E1HA 2HIXA 3RUXA 1G291 4PZ6A 3D31A 4O2DA 3L4GA 2R92H 4R4CA 1KOGA 4A4IA 4JV5Q 1WJJA 1BBUA 2IY5B 2J3LA 1XNQL 1CKNB 2ZCEA 2E64A 2YTXA 4A3EG 4JG2A 5IE8A 1QZGA 2CFMA 3W1GA 3L0OA 1KL9A 5BR8L 4P73A 1N36Q 1N32Q 4PMWA 4ZIBA 1GKHA 3J81j 2N78A 4C2MH 4A3IG 2D0OA 4BY7G 2ARUA 1C7YA 4HIOA 1X54A 3GTPH 3TS0A 2DTOA 2IX1A 1FGUA 5J3BA 2OQ0A 2EQSA 4DR6Q 1A8VA 1Z9FA 5IP9G 4QQBX 1K0RA 2JA7H 1X65A 1XMQL 5F5WA 2UU9Q 2JK8A 1V43A 5C0XJ 5GAEC 4L5TA 3F8TA 4X64L 1K8AC 3RKWA 4JI0L 1VQNA 4B3RL 3PIPA 1Y14B 1R9TH 1X56A 4HJ5A 3H15A 1GM5A 2K50A 3M4QA 3UDFA 1MIUA 11ASA 5FJ8G 2R7DA 5M5WH 3J80i 4QY7A 1W66A 1YGBA 1FJGL 4A3JH 3ICEA 3FKIG 1EVLA 2YTVA 1UE7A 5GAGC 5IYBH 4MZ9A 4X65Q 3QO7A 5LMUL 4WJ4A 3HXWA 1W2BA 1HZCA 5IP7H 5GROA 3G6EA 3CCMA 1YI2A 2E41A 3U50C 3V7RA 2FXQA 3M85A 1U0LA 1AH9A 1HZ9A 4DV5Q 3RZOH 4CH5A 1K8GA 5M3FG
chains in the Genus database with same CATH superfamily
3TBIB 5C51B 5C44H 3DHQA 4RCNA 1PVOA 1EWHA 2QF7A 3HOWH 4DV1Q 1FNWA 3K5LA 5LL6X 3GD7A 3FKIB 3X3MA 3GTLH 2UXCL 2OTJA 4C3JB 2ICEC 3ULLA 3CRLC 1SE4A 5NUCA 2RBMA 2QDBA 3UFGA 1UNSA 3SVMA 4ZTZB 1LTSD 5ELCA 3H3VI 2PQAB 2Q2HA 4KHVA 4LF8Q 2B2WC 3BYTB 4L5QA 2Q8RE 2K52A 3KDFB 1JWUD 3EFRA 3WDNA 1EIYB 4ZTUB 1J5WA 3Q23A 2CWPA 2EOTA 4HJ8A 2B2YC 2E75C 4HSPA 1NTGA 3TUPA 5M3MG 2NVTB 2VUMG 1I4RA 1H4SA 3NE5B 2DDZA 1K83H 1OXVA 2KBNA 4JW0A 2WINB 4DV0L 4HWRA 3HOYB 5C0XH 2F0DA 5IYCH 1BVSA 2BOSA 4LNQA 1B70B 1V9PA 3OWFA 3BDLA 1LT3D 1SE3A 3FVQA 1HTLD 4BXXG 4H0LC 1HH2P 1VCIA 4HIMA 1YJ9A 4IPHA 1WU7A 1S5DD 1BF4A 5J1ZA 1WTQA 5IWAL 2KVMA 5EJWA 1VQEA 3G1ZA 1J5EQ 1J9OA 2AUJD 1I50H 1BNZA 3RZDH 1FNVA 3WQZA 1CFMA 3A7LA 3V96A 4K86A 2HDMA 5HGTA 1YZ6A 1H9SB 1YBYA 3PIOA 1D5XC 4FF4A 3QIAA 3QG1A 4B3ML 4JI6L 2XNAC 2ALYA 4DV4L 5JOBA 2P0LA 2E2DC 2NZ1D 3MEFA 3ULPA 4ID6A 4C1NI 2A1AA 2A73B 1ML0D 4JI3Q 3R07A 3S15H 1MJEA 3N52A 3D3RA 4DV6Q 2NVXH 3QO8A 2SEBD 4XYOA 3K7AB 3OOCA 4LFBQ 3NETA 3H0GG 4LF7L 2CJBA 4A76A 3D0FA 1PZKD 1VQDA 3KBGA 5EQ0A 3TDQA 2D2CC 2RHQB 1RCVD 1GUTA 3MF2A 4YRGA 2EJGC 1VQ5A 4G85A 2DU5A 1SR3A 1A3UA 2MGSA 1IBKL 3Q0AA 2F4VQ 3SHLA 4A3CH 3HRZC 5TSSA 1OXUA 4H44C 5JEAG 3I4MG 2ZM6L 5IGEA 3NTIA 1YNXA 2HD3A 3R8BA 3B6YA 4DR3Q 2B8GA 2CKZB 1VQIA 3L7ZC 2ES2A 3CCVA 4U673 3VBBA 1PTOD 3S2DH 1QJOA 2A6HC 5IT9L 2NBFA 2E2HH 1I94Q 1F9SA 2EYPA 2QEJC 3RMHA 3A5ZA 3NSWA 3BG3A 5C52B 3TZUA 3VQYA 3OD1A 4C3HH 1JQYD 4LF9L 4A3MH 2UXDL 2C7IA 1UE5A 1M1KC 1SNCA 4XTWA 4AIMA 3DXJC 3TEHA 4BWAA 1Y1VH 3RF1A 1KNEA 2WKCA 1S5FD 4CKCA 2UUCQ 2XSCA 1VQZA 1SYGA 2JEBI 2ZZGA 3HKZG 2WACA 3PO3H 2WAQE 3IKJA 1STAA 2RF4A 1ET9A 4IFDJ 4MTKA 1CTMA 3TP7A 1SESA 1LYLA 3PV0A 2ICIA 4OONA 3R2TA 3KJPA 2Q2TA 1FGBD 4LJZC 5BN5A 2QEXA 2A74C 1WTXA 3NP8A 4WORA 4A3GB 1A2TA 5ELEA 1RF2D 4JCVE 1DZ1A 2FHTA 1WPYA 3ZYYX 3GTMH 4LUVA 5LMNL 1NNHA 4UY8C 3C1FA 3SK5A 4JI7Q 3UGTA 4C3IH 3OTOL 3DUZA 3T1YL 2KHIA 3IFTA 3QNEA 5HURA 2X6GA 4I7ZC 4DR4L 3LWEA 1F77A 4TRDA 3BVZA 2Z0SA 1HNWL 3MAQA 2RHSA 3MXUA 3S1MB 1E2VA 3GTJB 3M7GA 3PZCA 1Z7TA 4N9PA 2ZZFA 2OCEA 4IZ8A 1XYIA 1X2GA 1S3OA 4X5OA 1VS0A 4WI1A 2F0IA 3D4RA 3QJYA 4EQNA 1Y1WH 1IBLQ 1JORA 1QWYA 2EE1A 4XU1A 2EVBA 3QB3A 4AH6A 1SNDA 3NBHB 4OX9L 1B50A 3J81i 4GOPC 1G5HA 1USYC 3V8KA 1YEZA 4K8IA 1I3QB 5HGQA 2UUAQ 1STYA 4HWOA 1BCPF 3G4SA 1H4VB 3J7ZC 4BBSH 2DZ9A 3TQYA 2WP8J 4YCVA 2WAQG 2ARTA 4YPFA 1CSQA 2ZNJA 3J7AF 1V1PB 4LF6L 4YCUA 1SEBD 1X3QA 2XIWA 3NBIA 1H95A 4DV2Q 1Q1EA 2EY6A 3UE0A 3K81C 1UAPA 3HOUH 2BA1A 5CV4A 5I6WA 3HKSA 4A3JG 4BBRG 2JA8B 2PW7A 1B44D 2C9OA 4JI1L 3L4GB 1ILPA 4GOPB 3L2PA 4Y52H 4QIWE 4OL7A 5CV8A 2KA7A 2E10A 3P8YA 2C35B 2Q5HA 2E5LQ 3HOVB 2CIMA 3Q22A 2WB1B 4KR3A 1TKWB 2MNAA 4A3DH 1D1KA 3V8JA 5T1GA 1HHVA 1Q90A 2OXPA 2F4IA 2YYZA 1Q8KA 5IODA 3S16B 5I9OA 1EZ6A 4G4KA 4NXNQ 4JVZA 2A69C 4A3BB 4BY1B 2DY8A 1E22A 4CBVA 4AYBB 1YVCA 1Q8IA 1R4PB 2Q7HA 3REUA 2DNCA 1VMPA 5HY6A 3UE1A 1I6VC 3W1BA 3V8LA 1AE2A 3WOEA 1JWMD 1X2HA 2E2JH 1HFGA 3K0YA 1PFSA 2F1MA 1VQBA 2K5DA 3CXCA 4CDFC 3RD4A 4XEOA 1PH4A 1EIHA 3T56B 3E6ZX 4RH6A 1GUGA 4BBRB 2VXWA 2CH4W 4IFDH 2FJ2A 1SETA 1TWAH 2CHBD 3S9WA 5FLXL 4X3SA 5C4XG 2YTYA 4TQFA 1HNZL 2JYOA 4YRCA 3W5OA 4GKJQ 1AE3A 4FYDA 2L55A 4Z9CB 1TS2A 2GVBA 2HQEA 3J81c 2A6HD 1PZJD 1EY9A 1L1OA 4OELB 1ZYRD 4DNRB 2ODRC 3URYA 3NEMA 2XRQD 5FLMG 4HT4A 1LT6D 4X3TA 1SN8A 4DR2L 1KDAA 2VW9A 4KK7A 1JB3A 4ME5A 2NS6A 4A3FH 2DJGC 3K57A 2O5JC 4POFA 1NAPA 3RLOA 2MP1A 4M8AA 4PG3A 2BE5C 4OIJA 2NTSA 4LAAA 4YWLA 4R9WA 2VB3X 1IL2A 4DPGA 2H5XA 3A32A 2F3VA 2NN6H 4JBWA 1DGSA 2ARSA 1JCKB 2MFIA 4P71C 5DAUA 3IRBA 1SNOA 1GHJA 3V2TA 3I56A 2Z4HA 1HXDA 5ELBA 2I4MA 2HQLA 2K1BA 4A3LH 5GAHC 2RSNA 3ND9A 4YHHL 2DXUA 2L1BA 5GQOA 2AKWA 2IJ0A 2OQKA 3MWYW 1VQOA 1L0XB 1HNXQ 2LSSA 2R93G 1WLEA 1SYFA 2XTIA 3W3AA 4DR5Q 4ODGA 3S24A 2V1CC 4QB4A 3J80L 2HUGA 2CWAA 2KCNA 5IYDG 1ADYA 2HDLA 4HWTA 3RUZA 1WD0A 2ZT8A 3ZJYC 1SFOH 1A6XA 3BVGA 1U4PA 1G5IA 1XTCD 1S40A 1MI2A 4DUYL 5IGBA 3TN2A 3CMAA 2O4XA 4JBMA 1K73C 1AFPA 3A8JE 1Q46A 1GUNA 4HMJA 3CAMA 2B8FA 1N33Q 1K3BC 2JA5B 1IHZA 3HOXG 3K7AH 3MHBA 4JI8Q 2PMEA 4LVMA 1UEBA 2CCZA 2L12A 2Z6BA 1WCMB 3CHBD 1PA6A 1NYQA 2N88A 1RTOA 2R93B 1QVCA 1I4HA 2QHUA 4A93B 4BA2I 2K5HA 5JVG3 5G3LF 1KABA 2RCNA 2BA0A 4K2KA 4X62L 4UP7A 1XPOA 1ASZA 4YRIA 3BDCA 3PUYA 4P75C 5KNBA 4X66Q 4YY3Q 2JA6B 2PO4A 2I4OA 3CD6A 1QZHA 3I4NB 2XWJB 1B9NA 1UEAB 3STBD 4GKKL 4OWXB 4LF5Q 1MBYA 3VYSA 4DAMA 1SE8A 2PMZE 1EWCA 1QUQB 3NK9A 4JI4L 3HTZA 2I4LA 5KEEA 4M1UB 4EGVA 3A31A 2HHHQ 3PUXA 3GTKB 4JK1C 5C3EG 1JT8A 1D6EC 4B9XA 2OT2A 1JB7A 3SXHA 5JJKA 3HGBA 1TWCH 1IW7D 1C4QA 2GN5A 3KFUA 1SROA 2EYJA 3M4PA 1DOKA 2B2VC 4F87A 3S1RB 1J8IA 5KYLA 2EJFA 5EAYA 1CKOA 3RKYA 1JJCB 2TSSA 3AEVA 1NCVA 1YHBA 2KHJA 4A3KG 1B9MA 1DOLA 3HOZB 4CKEA 1PZID 2VS1A 1GHKA 2VQEL 1Y8NB 5M9OA 4DK1A 4H2YA 1EY8A 4TVWA 2XN9C 4A3GH 1K28A 5CR3A 3C3LA 5EBCA 2ZXOA 4N9TA 4DKAC 4JI5Q 3DM1A 2L11A 3IFDA 4DV3Q 4H2XB 1PH1A 2R7ZG 4FXGC 2R61A 1EEID 2KENA 2UU9L 3R93A 2DEQA 1Q82C 4LVIA 2I5HA 1MHWC 2IHFA 1NUCA 1EL0A 3Q6SA 1Y69U 1BIBA 2PZUA 5LMNW 3PCOB 3A5UA 4L5SA 4CJ1B 4DK0A 4OO1G 1HUNA 2DJZA 2HNIA 3T1HL 3OPOA 4A3EB 3IALA 1XNQQ 4LW1A 3NXWA 5EBDA 4XQQA 4YRQA 1EQQA 4RG1A 3T16A 1PH8A 3U4VA 2L9HA 2BCOA 1NJ6A 3NHHA 1TWGB 3W3SA 1A2UA 1K0SA 1Q81C 2RDGA 1CZGA 1NR4A 3PO2G 1I3QH 2EJMA 3EN2A 1U4RA 1SBBB 1JOQA 1CM9A 4LUOA 1AW7A 4JOIC 1D5MC 4N8FA 1I4GA 1HC7A 3RGLA 1YNNC 1HR0L 1STEA 1S4ZA 4RKLA 3SK4A 1B3AA 2KUMA 2MPMA 4BY7B 4P3NA 1YITA 4CS2A 3QR8A 4YDQA 5C4ZA 1F2ZA 3E0JA 2JA8H 4XTYA 3A5ZB 4B9WA 1SMYC 4LMQD 1A3TA 1FVIA 1RL2A 1UE1A 2KCTA 1IYVA 3TEHB 3HOVH 2DN8A 2WFWA 1HCZA 4XTXA 2ZIOA 5C6AA 4IJHA 3S16H 4OO1I 3GTGB 3AB9A 2ATWA 2K7VA 4EO4A 3J81E 4IFDG 4A3BH 4BY1H 2Z6KC 1BO0A 1QNKA 4XQJA 3NQTA 4POGA 4DV5L 2QCPX 3D6WA 1TWHB 2PI2E 1ICFB 4BW9A 4IURA 1IZ6A 4UP9A 5KNCA 4PNYA 3JAML 1PYSA 5A2QL 4JI2L 3EVQA 4Q15A 3K7UC 2MQHA 1HXYD 4X64Q 4GNXA 1SYBA 4B3TL 1HJPA 1BBWA 1YHAA 5E3IA 4YRJA 4JI0Q 2E3CA 3H3VC 4TWAA 2EYHA 5I9PA 4LFCL 4EQPA 1X9NA 1WD1A 1CUKA 4H2TA 3ERQA 5BN4A 4LF8L 2K5WA 3E9IA 1Y8PB 2F0PA 2RHSB 1K9MC 2X6LA 1SJHD 4R1JA 5EKLA 1VQFA 1L2FA 1UUPA 3AFQA 4OWTB 3RL6A 2K5VA 2NN6G 1NMFA 1NR2A 4F8MA 1VMCA 3CCUA 1LTTD 1HTPA 3RN2A 2ZT6A 2Z1CA 1FJGQ 3NENA 3P8TA 2JEAI 1E3PA 2RVLA 3J81L 3A7RA 5CBAE 2AQ2B 3SEBA 4HJ7A 2NUCA 2G9HD 4A75A 1XMOQ 3HXVA 2VQFL 2AQ3B 1RKNA 1YFRA 4G7OC 2NB0A 1A63A 1YHQA 1J5EL 1G2SA 2KECA 1PXUA 5ISRA 1KXLA 4P72C 4FP5D 2IT1A 4P3PA 3QTCA 1B8AA 4ALPA 2ZJQA 1X3FA 1WVLA 3BZCA 4UP8A 5M3FB 3HY1A 3GTQB 4H2SA 2CW0D 3OW2A 4NCXA 2JA9A 2E5AA 3QOLA 1ESFA 2H4OA 1ESRA 2EDGA 2IY5A 4ILWA 2KJXA 1SRYA 3Q24A 1CKNA 4DV6L 5IIFA 3KUPA 4LFBL 2EYOA 1YIJA 1SNMA 1F9QA 3IKLA 3RNUA 1O7ZA 5JJLA 1GVPA 1KC8C 3A55A 3MEYA 1JE4A 1H9KA 3N6RA 3BVMA 4KKSA 3QO2A 2F4VL 3REXA 4GN3B 3I70A 3TS2A 2JP1A 3D4DA 2P5IA 1ASYA 4KY7A 2JA5H 2IX3A 2A19A 1BCPC 4R4TA 3GDEA 5M3MB 2VUMB 3PSIA 3VR5A 4C56C 1JR0D 3HXUA 3MTSA 3KJOA 2B63H 1V1OA 5CV7A 3TZDA 3VYTA 2BH8A 1PTOF 1WCMH 3RLNA 5C4JB 1EVKA 5H1SE 4R8NA 1LTGD 3D8GA 2R92G 4OWWB 1L1OB 2DTHA 2HIVA 1CSPA 1QCBD 1KDBA 2VL6A 3BDOA 2K33A 2UXBQ 3KF6A 4X3UA 4GN4B 1BKBA 1BCPB 1ICWA 1WFQA 3T51B 2PMFA 2K4KA 1KD1C 2UUCL 2AMCB 4K5WA 4JYAL 3OMCA 1KIXA 5K36H 4H2VA 2DGYA 1VQCA 2XGTA 2K03A 1N8RC 4K0KQ 3VYRA 1QILA 1TWFH 1B76A 3E0EA 1TS4A 4P3OA 4DV4Q 2NVQH 2V4DA 3DMUA 4LF4Q 1AEXA 3OYYA 1D5ZC 3GTKH 2WV6D 1XPRA 4TQUS 1HQMC 4IALA 1P16A 1X32A 5CMDA 1WTVA 4DQ2A 4JI7L 3H0GB 2ZR3A 1I4QA 2AWNA 1TXYA 4LF7Q 3TEGA 1EQVA 3S1RH 2A68D 2IW3A 2WB1E 1KDCA 2EWNA 3HOZH 2AHOB 3KF8B 2B2UA 3M4YA 4AQYL 1ZKOA 2K01A 4IOCA 1NMGA 3I4MB 1VQGA 2OWOA 1D2BA 4DK3C 1EIFA 3S1NH 4DNTB 5COYA 2ZM6Q 5D65A 4OP0A 1GD7A 2YV5A 4QF4A 4CKBA 2N3SA 1IBLL 4RGNA 2EY1A 2CGHA 5C3XA 4CS3A 3P75A 1PH9A 2DQ3A 2B2TC 1L0YB 2N8NA 5I2XA 3MFGA 3S14B 4RDXA 4KTAA 3DM3A 2JA7G 3CCEA 4KLKA 3A0JA 1SYCA 2RDHA 3BYYB 4Q5VA 3MXGA 5D3IB 4NKLA 4JBJA 3UDIA 2NZOA 3EQLC 3J7AV 3RKXA 1WI5A 2VZAA 4B3SL 4LF9Q 5F2DA 3L2ZA 4A3EH 5BN3A 1NE3A 3CC4A 1STBA 3MXNB 2VNUD 2DQ0A 1SNQA 1Q12A 4ZLTF 2MHVA 3VQWA 1UWVA 4KHPL 1LTBD 3HKZB 2RQXA 1VQ8A 1CA6A 1TWGH 1VQJA 3BJUA 3HXZA 1HZAA 1EOVA 2B39A 3HEJA 1SYDA 2ZGWA 4IUUA 1VQ4A 1JOKA 2E5LL 4G7HC 4DU9A 3CU7A 4TVAB 3LC0A 1OTCA 1TIID 4XT3B 4PQXA 2ZNIA 5FO9B 1TQOA 4A3IH 1OXXK 3WOFA 5CGKA 1DCZA 5LMNQ 1X55A 2RSOA 1NJ5A 3UDXA 4BY7H 2Q5IA 1LT5D 4P73C 1ATIA 1CKMA 1LTRD 3T1YQ 3C2PA 1BBXC 1HR0W 4DR4Q 1XNRQ 5IYBG 4UPAA 4DN4M 2XRSD 4OHJA 4YRSA 1IYUA 1NJIC 1GXDC 3O13A 5D3DA 3CMEA 1B3QA 4Y7NH 3PIP3 4IUNA 1KLGD 2ZJRA 5C5LA 5IP7G 4XEMA 1I4XA 1EIYA 3IAYA 5IP9H 3GTGH 4K88A 3KOJA 2F0WA 2DXTA 3CCJA 3H6MA 4NP5A 3F2UA 5KNNA 3HG9A 4KD4A 3I7FA 3D6CA 4OX9Q 5M5YB 3EROA 1TWHH 3CPWA 3DLLA 1I5FA 2A6EC 2B2WA 1I6HH 2WAQB 1EYGA 1YJNA 5C44G 4DR7L 2F0UA 4LF6Q 3HOWG 4XTZA 2B2YA 1PYBA 2PI2A 2VB2X 4OGQC 3U58A 4A3JB 1J6QA 4WJ3M 4DV7L 1PRTC 1EU4A 3GTOB 5JPNC 1TS3A 1GGMA 4JI1Q 1H9SA 1X3EA 1QB5D 3CW2C 3KYHC 1T9HA 4FVMA 2LFNA 3VR3A 5FJ8H 1IXRA 1CT1D 3CQZB 1PH2A 4IUPA 4CDCC 1KMMA 1RJTA 3E5SA 3VR2A 1CK1A 2GVAA 4X3KA 2LKVA 3H3VH 2D5DA 1STNA 3FKIH 4YCWA 1ET6A 1PRTB 4C3JH 3P1HA 2F0GA 4YRPA 1O7YA 1VQAA 4XQNA 1X6OA 3A74A 1PHJA 3VDYA 1NY4A 5C0XG 1MD2D 2RHQA 5IYCG 5IOCA 1GUWA 4FO2A 1TY0A 1HNXL 2EAYA 3CMQA 4IOAA 4FF2A 3MZ5A 4DR5L 5EPKA 2ZIMA 3HOWB 1EU3A 4YIJA 1W6JA 2C8MA 2Q2UA 5JEAJ 1IBML 4DR1L 3F1ZA 5JVH3 3SK6A 4L87A 4XTCS 1CZWA 3ERRA 2NVTH 3SE0A 3I55A 2PNRC 3EJIA 1E1OA 4RKBA 5IGGA 5C4XB 2SNMA 2OEOA 3S1QB 3HXXA 4UHVA 3CCQA 3HOYH 3MXPA 5M3FH 2EJGA 4E51A 3GTQH 2F0MA 4WRDA 1XJVA 4TKOB 4OIKA 4QIWB 5CORA 5DM73 1N33L 3K0XA 4ZUJA 4DUZL 3RLFA 1GUSA 5CV9A 1D7QA 3UI2A 4DR2Q 1VQHA 3EFXD 1XTDA 1R4QB 4YRKA 3J7A5 4DAYA 3KBXA 4NXML 4YP0A 3GQBA 1A62A 2B63G 2F3IA 4LFAL 1CQFA 2VY3A 2Y0SE 3MQZA 5K1PA 1JWSD 5T1IA 1PYSB 2DY7A 4DNIA 4YWMA 1F2MA 1XXGA 4LNSA 2PZWA 4XTUA 4TTVA 1SE2A 4XU2A 4IO9A 4MNOA 1ENCA 2UUBQ 1Z47A 1TU2B 2ZTDA 2F0JA 1LM0A 3X3NA 5C0XI 5AJ3L 2DTIA 4A3CG 2JQOA 4QCLA 1P8LA 2LXJA 4RHSA 3PIO3 1I50B 2Q2IA 1MKHA 4KI0A 4DF7A 5M3MH 1F2LA 1YNJC 2H1EA 2M2LA 2MO0A 1PV4A 1B7YA 1Q7YC 1BIAA 2BH2A 5C4JH 1AZPA 4BXXH 1VQ6A 4YHHQ 4RAUC 5CBEE 2MJ8A 4H2UA 2EYFA 1H4QA 1NJ2A 1DJRD 2G9DA 3MVVA 2HHHL 4JV5L 4WF2A 4DGZA 2NVYB 2EIFA 1PRTF 2D62A 4C3HG 4A3MG 4OXPA 1N34Q 2L4NA 4DAPA 3I72A 2K05A 1Y1VG 2Q8IB 1XX8A 3A8KE 4BS9A 2ZXPA 4UDUC 1H9RA 2B29A 1N36L 1N32L 1Q3LA 3AFPA 3PUZA 4JPBW 1RTNA 2K14A 4HJAA 2ZT5A 3PO3G 2Z8LA 3R2IA 3NBHA 3W2DA 3DWAA 1LO5D 1DM0B 4DUYQ 5JPMC 2A69D 1EWIA 5IT9c 1A3VA 5FO8B 5KGUA 4MIUA 1CI3M 3F2CA 2CJAA 2L0CA 2Y0SG 3P8VA 4IPGA 1V1PA 4JI5L 1C0AA 4QMGA 4DV3L 3HOXB 3H0GH 3GV3A 1PFMA 1QF6A 5I2YA 1RHPA 4C3IG 1SSOA 1XPUA 1V8QA 2E2HB 4R4OA 2WIIB 1WTPA 1S5CD 4GOPA 1USYA 3HFVA 1GJXA 4FXDA 4EVOA 5IY0A 3HRIA 3I4MH 5JEAH 1V1QA 4X62Q 4DR6L 3IKMB 3HFZA 1VQ9A 2K04A 1W3SA 2K32A 3E9HA 1Y1WG 4XTVA 3S14H 2ODRD 2NYZD 1OXTA 4PZ7A 1SNPA 3GO5A 1WQWA 2ALYB 4GKKQ 2YU9B 4CDEC 1F2YA 4KJOA 4JI4Q 2QW7A 1M8AA 4BBSG 4RMFA 3SGIA 4FF1A 1QE0A 3NELA 5C3EB 1CHQD 4H2WA 4GS3A 3S1MH 3GTJH 4HAEA 3RN5A 4RHRA 2F0SA 3EIVA 2BE5D 2Q7GA 4HEDA 2R7FA 4NMZA 2E65A 3HZXA 1SERA 1SDFA 1HFNA 3HOUG 1YJWA 1D8LA 5BR8Q 2F0TA 1N9WA 3I4OA 4KHZA 4A3KB 3V05A 3S17B 4K8JA 3UH0A 4LUZA 2VQEQ 1U4MA 2EY2A 2I5MX 1LTID 3KF6B 4KQEA 1BOSA 4IUVA 5ELNA 5C4HA 1FYCA 2XWBB 3CKIB 4ABNA 4A3DG 4ZKBB 3OMGA 2R7ZB 1WQ7A 2F0NA 2CJ9A 3TRZA 2KHSA 3HS0C 1X3GA 2QA4A 2Z4IA 1WTHA 3IG2A 4X65L 4IUTA 2K5QA 1JJGA 2I5LX 2AQ1B 3BZKA 1SMXA 3A7AA 4B08A 3T1HQ 3NPPA 1SRUA 2PMZB 2I07B 4E6IA 2DKGA 5E4WC 4KJNA 3HOUB 1EQRA 1LT4D 4ZAIA 3H94A 2EJ9A 2EXZA 3M4OB 4H02A 1VF7A 3DSQA 4KV6A 3WWVA 3ERSX 1XMQQ 3PO2B 5M5YH 1U5KA 4YRMA 3HY0A 4J15A 1QOHA 1DOMA 1RDPD 2DZCA 3CP0A 3K8AA 5E4XA 5FK9C 3TREA 2E76C 4DA2A 1PTOC 4A3DB 1X01A 1HR0Q 4ZYSA 3LGJA 4DV1L 1B53A 3PF5A 4P71A 3JC66 4KD3A 2J3MA 5C5MA 3VR4A 3BFMA 4BBRH 5D14A 1H9JA 4B3RQ 4C3JG 1HA5A 5ELOA 3GTOH 1NNXA 4A3FG 3KLWA 4HA8A 3BS1A 4KN7C 4QL5A 3OIPA 4RGMA 1BQQT 3U9SA 1XMOL 2E2JB 1TY2A 3VQXA 2J0TD 2K6AA 2RA4A 5IGCA 3PMFA 4ULLA 1ILQA 5FLXc 3ICAA 4YRFA 2F0KA 5DEHA 4QUFA 1PTOB 1PYWD 3CQZH 4CH4A 1OO9B 2NTTA 3K6OA 3VQVA 3H91A 1HRJA 4YROA 4MN3A 2A5HA 1KLUD 2OTLA 1QE6A 1TWAB 3CCSA 3EFSA 3CCRA 1PFNA 2B3GA 1QG7A 1S5ED 1DXMA 4A3LG 3GP7A 4EX5A 4LK1C 3HOYG 2EY5A 3LWUA 1Q1BA 4CH6A 2K75A 4IFDI 1HA6A 5LMUQ 2SDFA 4P74A 4JI2Q 2EYLA 3CC2A 4GZYC 1RODA 2JJQA 3F2BA 2F3WA 2HCCA 4HCSA 2DU7A 4B3TQ 1ONLA 1EYAA 5ELFA 4A3FB 1E2WA 3VA5A 5C53B 5C4XH 4ZKCB 4LFCQ 3S1QH 1VQLA 4APVA 2ZINA 2BDOA 1EYDA 4IUQA 4MTNA 5FKAC 3DEPA 1QUQA 2M00A 1MJCA 3FHWA 1JMCA 1HZBA 4JI3L 5FLMH 1LTLA 5EGTA 2EL9A 5EPJA 4WFN3 4FXKC 1FL0A 1O78A 1HPCA 3RR5A 1VDZA 2NN6I 4P75A 2UXCQ 2O2LD 1TR5A 1Q86C 3J80c 1IL8A 2IPKD 2ZTCA 4KY5A 4K6LA 1JJCA 5K5PA 4KY6A 1A0IA 3M7NA 4ZUIA 1VQPA 2VQFQ 4R4QA 1L1OC 1EOTA 5KIXA 3S2HB 2UXBL 5IGDA 4GLXA 5JJIA 4HIKA 4S3SA 2IX0A 4J1MA 5E7NA 4DR3L 1O7IA 1KRTA 4K0KL 3G71A 5IT9E 1DD2A 4H2XA 1YNND 2K5NA 2B2VA 1NBWA 1SFOB 4L8JA 1HTTA 5M5XB 1I94L 4DV0Q 4X6AH 3H09A 4YYEA 2NWGA 5JJZA 1X3PA 2R93H 4LF4L 3K80C 3HKZE 4A93H 3M3YB 3PCOA 3I73A 2F52A 2NVYH 1SMYD 2I4NA 4NW2A 5IWAQ 5IYDH 3FJPA 4G84A 4U68A 1TT2A 3ULJA 4LVKA 1VQKA 1RIPA 3L3OC 4XU3A 3UGQA 4HIDA 2R6GA 2JA6H 2K28A 3KLSX 2IL8A 2AWOA 1O7LA 3I4NH 2SNSA 1ADJA 1KAWA 1ZEQX 4HWPA 1Z7NA 4B3MQ 2HT1A 5FOBB 1PMRA 4JI6Q 1SAPA 4Q6GA 4YWKA 1KMNA 2E2IB 3LX0A 4ZQ3A 1JE5A 1LUZA 4CS4A 3CF5A 1VQMA 4A3GG 1G6PA 1KRSA 3LNNA 3K5MA 3AYHB 3HOXH 3CRKC 5JAVA 2A8VA 1G51A 1KQSA 3FEWX 4K14A 3MEHA 3QO5A 1RD9D 2L15A 1YFTA 1ZYRC 1GOZA 1EIGA 2F0LA 4RFBA 4O1NA 1L0WA 2AKWB 2R92B 1KAAA 1PFBA 2QKIC 2G4CA 1ZXTA 4QGUA 4YRLA 4YRRA 1E24A 1OXSC 1IBKQ 2E8GA 3NQIA 3OSOA 4JOIA 4CJ2C 4PMCA 3I2ZA 1YB3A 4CH3A 2RDFA 3PUWA 4AYBE 2KCMA 4ZK9B 1KHIA 3M9BA 1GO3E 1TWCB 4DAYB 1LABA 2ZR2A 4JYAQ 1PH3A 1KTKA 5A35A 1S5BD 1NYRA 2JE6I 3T13A 4G7ZC 2PCFB 3A56A 4P2CB 2Z9HA 4PMBA 1JJ2A 2UUAL 1K8OA 3PF4A 2YU9H 4HSVA 2EYMA 4RQEA 3ER0A 1UE6A 2MO1A 4GLVB 3JAMi 3NWSA 1YFSA 2F0VA 3HXYA 5C3EH 2UXDQ 4L6TB 2TMPA 1VQ7A 4DV2L 3OHXC 4C2MB 1SJED 2ENBA 1B7YB 2QHSA 1IKLA 1EY7A 4GN5A 3V7SA 3VA7A 2Z6KA 4FDBA 4A3KH 4XXEA 1XNRL 2JA8G 4XU0A 3S17H 2KOLA 1IYJB 2IWHA 4YREA 2ASBA 4AQYQ 1WTOA 3GTPB 3L1AA 4OEMB 1B4OA 4HJ9A 1S72A 3HOVG 4HVCA 2C5CA 2M9VA 2WB1G 1GUOA 3K58A 2R7ZH 4NXNL 4PZ8A 2LY7A 1AP0A 1EY0A 1QVFA 3C46A 2JA7B 2EJFC 3OTOQ 2ZXFA 4A3BG 4BY1G 2O5IC 4AYBG 4DFAA 2ZTEA 3EA6A 2OF1A 4G57A 4ZCKA 1Z7MA 3AU7A 5L37A 3HRKA 3PGZA 4IQZA 4L63B 4OO1H 4IJLA 1HNWQ 2ID0A 2PQAA 4BA1I 4B3SQ 4RA8A 5E1FA 4O0AA 1QVGA 3KDFA 2CH4A 4YRNA 1I4PA 3DEOA 3V7CA 4RQFA 2LS01 2LMCB 5FLXE 2F0HA 4KHPQ 1HUMA 1KNAA 1U4LA 4CJ0B 1LACA 3M4OH 4I65A 4TVYA 1PH7A 2Q7EA 2ZJPA 1R9TB 1CHPD 4YRTA 4TQDA 4XT1B 1Y8OB 1RIQA 3PO2H 2A8EA 5K1XA 1TS5A 1M90C 1BCPD 4GKJL 2CQOA 2QDLA 1E2ZA 3E3XA 1WTRA 1B70A 4KR2A 3L9AX 3MC0B 1MSGA 5CV6A 3HFZB 4IPDA 4HTHA 5M5WB 4NB3A 4K5XA 2RCFA 4K6DA 3STBC 3I3CA 3JAMc 3G48A 3P20A 1AZQA 4JBKA 1SYEA 2KEEA 4P72A 4LWCA 2QGQA 3OW7A 1JC7A 5KRUA 3LSSA 4OLFA 2JSOA 2PPBC 4HMIA 3CC7A 1CQVA 5DM63 1EFWA 1B2TA 3NTKA 1W6KA 3I4LA 3TP8A 4CGYB 3A5YA 1BR9A 1IW7C 3CPFA 2JXMB 3DWQA 4XYQA 4R8IA 3ND8A 1PTOH 3U9OA 3U4ZA 4UAIA 5GADC 1K3RA 4N8X1 1BXTA 1NJ8A 1D1IA 2EXDA 5E3FA 2N55A 4C1NK 3K5OA 3KLRA 3C1EA 3A54A 12ASA 1QNUA 4HWSA 5KYIA 1WYDA 4K87A 2PZTA 4EQOA 3A8IE 4KKTA 2PNHA 3RZOB 2FMMA 2QILA 3F2DA 1Z6HA 4ME3A 3AMUA 5C44B 3FRPB 3J80E 2I0QA 3EBEA 3LSQA 1FD7D 2N49A 4DR7Q 4MHEA 4V0BA 2QHVA 1WNLA 3PQIA 3GTLB 1G8ZD 1PLFA 2FINB 3FMCA 5KNDA 2AMCA 2FMCA 1FYFA 4DV7Q 4DK6C 1G91A 5DNFA 3CCLA 3K59A 4IPCA 5I4DA 2AUKA 1HNZQ 1DYQA 2ZZEA 4PHCA 5FO7B 3A7AB 2UUBL 1B1ZA 1E1TA 2FYKA 4KN4C 4L5RC 1EUJA 4DXFA 1IKMA 4QJFA 4GNXC 2DVEA 4H13C 5CC4A 1LV9A 4WJWA 2JA5G 3KLSA 3A7UA 3K5NA 4JI8L 4O42A 2Q8TA 2L5TA 1T5EA 4R4IA 3Q8DA 2R3ZA 3OWEB 1K83B 2ZT7A 1K8MA 1H4TA 1WCMG 1ENAA 4XDXA 5LHY1 3G7LA 2QHTA 3ITPA 2F03A 4CHTB 2DJFC 3KF8A 2EZVA 1TVXA 4A93G 2KCCA 3S2HH 1LLRD 2SOBA 1N34L 4GNXB 1U9RA 1T5XD 1C9OA 3BU2A 1PH5A 4BWGB 1ENFA 5EPLA 3RZDB 1IBMQ 3FP9A 4DR1Q 2VUMH 4X66L 4YY3L 3SR1A 5K36G 1E7ZA 3RIRA 3FPUB 2JA6G 1PH6A 2D0PA 5M5XH 3I4NG 4LF5L 1NJ1A 4GLAC 4ZRZA 4JC0A 4P74C 1XWEA 3M3YH 1MSHA 3MFYA 2NZHA 4FF3A 2DUDA 3AQQA 3J7YW 5J22A 4DUZQ 3S15B 3MXNA 1FR3A 1NSNS 1SLJA 2NVXB 3RACA 4KKUA 5C3WA 4CDDC 3MF1A 2B63B 4NPSA 2B2TA 4NXMQ 2BDNA 2LXKA 4LFAQ 4EQ5A 3HOZG 1WOCA 3PUVA 1EY4A 2E2IH 3UDGA 2E74C 2IHEA 4RWSC 5AJ3Q 4TVAA 2ZTGA 4LVLA 1JICA 2KEDA 4HN7A 4XIGS 2X69A 2A6ED 5DLQE 1EFID 4PV1C 2F0OA 3HP3A 2E1HA 2HIXA 3T4AC 2EPBA 1TWFB 2PQEA 5J39A 3SDZA 3S2DB 3RUXA 1G291 4PZ6A 3D31A 3ONAB 4O2DA 3L4GA 3I8ZA 4R4CA 2R92H 2NVQB 5AFWA 1KOGA 5G3LD 4A4IA 4C3HB 1PRTD 3I90A 4A3MB 1WJJA 4JV5Q 1DONA 1BBUA 3P7JA 2IY5B 1XNQL 2J3LA 1CKNB 1EQTA 2ZCEA 1MGSA 2E64A 2YTXA 1F9PA 1Y1VB 4A3EG 4JG2A 5IGFA 5IE8A 1QZGA 3GV6A 2CFMA 3W1GA 3TSSA 2HCIA 3L0OA 3OIQA 1KL9A 5BR8L 1STGA 4P73A 1N36Q 4K2LA 3PO3B 1N32Q 3SK8A 3R3OA 3IL8A 4TSSA 1LTAD 1HQRD 4PMWA 3VR6A 4ZIBA 2ZT9C 1PDQA 1GKHA 2PYKA 3TMEA 2PW5A 2J4XA 2J7ZA 2Y0SB 3S1NB 2CVRA 1G2TA 3J81j 4HR7B 2N78A 3GTMB 1G6ZA 5I6YA 4C2MH 4A3IG 4F7XA 2D0OA 2CW0C 4BY7G 4C3IB 1M4VA 4KMUC 1EYCA 2ARUA 1C7YA 1STHA 4HIOA 3G6JB 1EY5A 1X54A 3FPPA 4DXGA 5LL6S 2FFKB 4Q0FA 3GTPH 3TS0A 4LVJA 2DTOA 3KK7A 1E0BA 3NUCA 2XVSA 2IX1A 1C48A 1FGUA 5J3BA 5ELDA 2OQ0A 2EQSA 4DR6Q 4J6HA 1Y1WB 1A8VA 1Z9FA 5IP9G 4QQBX 2DNEA 1K0RA 2JA7H 1X65A 1VF5C 1SXTA 1XMQL 4HCEA 2UU9Q 5F5WA 2JN4A 2JK8A 3I91A 3JAME 1V43A 5EKIA 2I46A 2B2UC 5A2QE 4BBSB 2G5DA 4H7BA 5C0XJ 4DAVA 5CV5A 3BZDB 5GAEC 2KQ3A 4L5TA 3F8TA 1BUVT 4QUCA 4X64L 2ZXRA 4A3IB 4V190 4FNFA 1K8AC 2RKSA 3RKWA 4JI0L 1VQNA 3TP6A 4B3RL 3PIPA 1Y14B 3T53B 3NTHA 1CA5A 1R9TH 1X56A 1JOOA 4HJ5A 3H15A 4F88A 1GM5A 2K50A 3M4QA 3UDFA 2D9UA 3MA2B 1MIUA 1YNJD 1F9RA 2F0EA 4RCOA 11ASA 5FJ8G 2R7DA 1FNUA 4Y7NB 4J8QA 1EEFD 5M5WH 3VYUA 4RGTA 2CQAA 3QOJA 3J80i 4K5VA 4QY7A 1W66A 1YGBA 1O80A 2F0FA 1FJGL 4IN3A 2P5ZX 3FDTA 1H9MA 4A3JH 3ICEA 2WKDA 3FKIG 1A15A 1EVLA 2YTVA 3D4WA 3QWNA 1UE7A 5GAGC 5EKKA 5IYBH 4MZ9A 4NDXA 4X65Q 3QO7A 5LMUL 1I6HB 1AN8A 1BDOA 4WJ4A 3DWPA 3HXWA 1EZ8A 2MUYA 2F0QA 1W2BA 3NWTA 1HZCA 5IP7H 2A68C 5GROA 3G6EA 5CYUA 3CCMA 1YI2A 2E41A 3U50C 3V7RA 2FXQA 4I7AA 1WTWA 4RGOS 3M85A 1EY6A 1II3A 2GA4B 1U0LA 1AH9A 1HZ9A 1C8CA 4DV5Q 3RZOH 3TP5A 4CH5A 1K8GA 5M3FG
chains in the Genus database with same CATH topology
5C51B 5C44H 1PVOA 3HOWH 4DV1Q 3GD7A 3GTLH 2UXCL 2OTJA 3ULLA 3UFGA 4ZTZB 3H3VI 2PQAB 2Q2HA 4LF8Q 4L5QA 2K52A 3KDFB 3EFRA 1EIYB 4ZTUB 1J5WA 2CWPA 4HJ8A 1NTGA 3TUPA 5M3MG 1H4SA 2VUMG 2DDZA 1K83H 1OXVA 2KBNA 4DV0L 4HWRA 5IYCH 1BVSA 4LNQA 1B70B 1V9PA 4BXXG 4HIMA 1HH2P 1VCIA 1YJ9A 4IPHA 1WU7A 5IWAL 1VQEA 3G1ZA 1J5EQ 1I50H 3RZDH 3WQZA 4K86A 1YZ6A 1YBYA 3PIOA 4B3ML 4JI6L 2ALYA 4DV4L 2P0LA 3MEFA 3ULPA 2A1AA 4JI3Q 3R07A 3S15H 1MJEA 4DV6Q 2NVXH 3QO8A 4LFBQ 3NETA 3H0GG 4LF7L 2CJBA 4A76A 3D0FA 1VQDA 2RHQB 3MF2A 1VQ5A 4G85A 2DU5A 1SR3A 1IBKL 2F4VQ 4A3CH 1OXUA 5JEAG 3I4MG 2ZM6L 1YNXA 3B6YA 4DR3Q 2CKZB 1VQIA 3L7ZC 2ES2A 3CCVA 3VBBA 3S2DH 2E2HH 1I94Q 3A5ZA 5C52B 3VQYA 3OD1A 4C3HH 2UXDL 4LF9L 4A3MH 2C7IA 4XTWA 1UE5A 1M1KC 4AIMA 3TEHA 4BWAA 1Y1VH 3RF1A 2UUCQ 1VQZA 2JEBI 2ZZGA 3HKZG 3PO3H 2WAQE 2RF4A 4IFDJ 1SESA 1LYLA 3PV0A 4OONA 3KJPA 2Q2TA 2QEXA 4JCVE 1WPYA 3GTMH 4LUVA 5LMNL 1NNHA 4UY8C 4JI7Q 3UGTA 4C3IH 3OTOL 3T1YL 2KHIA 3QNEA 4DR4L 1HNWL 2Z0SA 2RHSA 3PZCA 2ZZFA 2OCEA 1X2GA 1S3OA 4X5OA 1VS0A 4WI1A 1Y1WH 1IBLQ 4XU1A 4AH6A 3NBHB 4OX9L 3J81i 4GOPC 1G5HA 1USYC 3V8KA 1YEZA 2UUAQ 5HGQA 4HWOA 3G4SA 1H4VB 3J7ZC 4BBSH 2DZ9A 3TQYA 2WP8J 4YCVA 2WAQG 2ARTA 4YPFA 1CSQA 2ZNJA 4LF6L 4YCUA 1H95A 4DV2Q 1Q1EA 3UE0A 3K81C 3HOUH 2BA1A 3HKSA 4A3JG 4BBRG 3L4GB 4JI1L 4GOPB 3L2PA 4Y52H 4QIWE 2E10A 3P8YA 2C35B 2Q5HA 2E5LQ 2CIMA 4KR3A 2MNAA 4A3DH 3V8JA 2YYZA 1Q8KA 4NXNQ 1E22A 1YVCA 2Q7HA 3REUA 5HY6A 3UE1A 3W1BA 3V8LA 1AE2A 1X2HA 2E2JH 1PFSA 1VQBA 3CXCA 4XEOA 1PH4A 1SETA 1TWAH 5C4XG 2YTYA 4TQFA 1HNZL 4YRCA 3W5OA 4GKJQ 1AE3A 2GVBA 3J81c 1L1OA 2ODRC 3NEMA 5FLMG 4HT4A 1SN8A 4DR2L 2VW9A 2NS6A 4A3FH 4POFA 3RLOA 4PG3A 4YWLA 1IL2A 4DPGA 2H5XA 3A32A 4JBWA 1DGSA 2ARSA 2MFIA 4P71C 3IRBA 3I56A 1HXDA 2I4MA 2HQLA 4A3LH 5GAHC 4YHHL 2DXUA 5GQOA 2AKWA 2OQKA 1VQOA 1HNXQ 2R93G 2LSSA 1WLEA 2XTIA 4DR5Q 3S24A 2V1CC 2CWAA 5IYDG 1ADYA 4HWTA 2ZT8A 3ZJYC 1SFOH 1G5IA 1S40A 4DUYL 3CMAA 4JBMA 1K73C 1Q46A 3CAMA 1N33Q 3HOXG 3K7AH 4JI8Q 2PMEA 4LVMA 1UEBA 2CCZA 1NYQA 1PA6A 1QVCA 2QHUA 4BA2I 2K5HA 2RCNA 2BA0A 4X62L 4UP7A 1XPOA 1ASZA 4YRIA 3PUYA 4P75C 4X66Q 4YY3Q 2I4OA 3CD6A 1QZHA 3STBD 4GKKL 4OWXB 4LF5Q 4DAMA 1SE8A 2PMZE 1QUQB 3HTZA 4JI4L 2I4LA 3A31A 2HHHQ 3PUXA 5C3EG 1JT8A 1JB7A 5JJKA 1TWCH 2GN5A 3KFUA 1SROA 3M4PA 2EJFA 5EAYA 1CKOA 3RKYA 1JJCB 3AEVA 1YHBA 2KHJA 4A3KG 2VS1A 2VQEL 4H2YA 4TVWA 4A3GH 4DKAC 4JI5Q 4DV3Q 4H2XB 1PH1A 2R7ZG 2KENA 2UU9L 2DEQA 1Q82C 4LVIA 2I5HA 2IHFA 1BIBA 5LMNW 3PCOB 3A5UA 4L5SA 4OO1G 2DJZA 2HNIA 3T1HL 3IALA 1XNQQ 4LW1A 4YRQA 1EQQA 4RG1A 1PH8A 3U4VA 1NJ6A 3W3SA 1Q81C 3PO2G 1I3QH 3EN2A 4LUOA 4JOIC 1HC7A 3RGLA 1HR0L 4P3NA 4CS2A 4YDQA 1YITA 2JA8H 4XTYA 3A5ZB 1FVIA 1RL2A 1UE1A 2KCTA 3TEHB 3HOVH 2WFWA 4XTXA 2ZIOA 4IJHA 3S16H 4OO1I 2ATWA 4EO4A 4IFDG 4A3BH 4BY1H 2Z6KC 4POGA 4DV5L 2PI2E 4BW9A 1IZ6A 4UP9A 1PYSA 4JI2L 4Q15A 3K7UC 2MQHA 4X64Q 4GNXA 4B3TL 1HJPA 1BBWA 1YHAA 5E3IA 4YRJA 4JI0Q 2E3CA 4TWAA 4LFCL 1X9NA 1CUKA 4H2TA 4LF8L 3E9IA 1K9MC 2RHSB 4R1JA 1VQFA 1L2FA 4OWTB 3AFQA 3RL6A 2K5VA 2NN6G 1NMFA 3CCUA 3RN2A 2ZT6A 1FJGQ 3NENA 3P8TA 2JEAI 1E3PA 3A7RA 4HJ7A 4A75A 1XMOQ 3HXVA 2VQFL 1YFRA 1A63A 1YHQA 1J5EL 1KXLA 4P72C 2IT1A 4P3PA 3QTCA 1B8AA 4ALPA 2ZJQA 1X3FA 3BZCA 4UP8A 3HY1A 4H2SA 3OW2A 4NCXA 2JA9A 2E5AA 2IY5A 1SRYA 1CKNA 4DV6L 4LFBL 1YIJA 3IKLA 3RNUA 5JJLA 1GVPA 1KC8C 3MEYA 2F4VL 3REXA 4GN3B 3TS2A 2P5IA 1ASYA 2JA5H 2A19A 4R4TA 3GDEA 3PSIA 3HXUA 3KJOA 2B63H 4YRGA 2BH8A 3RLNA 1WCMH 1EVKA 5H1SE 2R92G 4OWWB 1L1OB 2DTHA 2HIVA 1CSPA 2VL6A 2UXBQ 3KF6A 1BKBA 4GN4B 1WFQA 2PMFA 2K4KA 1KD1C 2UUCL 2AMCB 4JYAL 1KIXA 4H2VA 2DGYA 1VQCA 2XGTA 4K0KQ 1N8RC 1TWFH 1B76A 3E0EA 4P3OA 4DV4Q 2NVQH 4LF4Q 3OYYA 3GTKH 1XPRA 4TQUS 1P16A 4DQ2A 4JI7L 2ZR3A 2AWNA 1TXYA 4LF7Q 3TEGA 3S1RH 2WB1E 2EWNA 3HOZH 2AHOB 3KF8B 4AQYL 4IOCA 1NMGA 1VQGA 2OWOA 4DK3C 1EIFA 3S1NH 2ZM6Q 4OP0A 1GD7A 2YV5A 2N3SA 1IBLL 2CGHA 4CS3A 1PH9A 2DQ3A 4RDXA 2N8NA 3DM3A 2JA7G 3CCEA 4KLKA 3A0JA 4JBJA 3UDIA 2NZOA 3RKXA 1WI5A 2VZAA 4B3SL 4LF9Q 3L2ZA 4A3EH 1NE3A 3CC4A 3MXNB 2VNUD 2DQ0A 1Q12A 3VQWA 1UWVA 4KHPL 1VQ8A 1TWGH 1VQJA 3BJUA 3HXZA 1HZAA 1EOVA 2ZGWA 1VQ4A 2E5LL 4TVAB 3LC0A 1OTCA 2ZNIA 4A3IH 1OXXK 5LMNQ 1NJ5A 1X55A 3UDXA 4BY7H 2Q5IA 4P73C 1ATIA 1CKMA 3T1YQ 1HR0W 4DR4Q 1XNRQ 5IYBG 4UPAA 4YRSA 1NJIC 3CMEA 4Y7NH 2ZJRA 5IP7G 4XEMA 1EIYA 5IP9H 3GTGH 4K88A 3KOJA 2DXTA 3CCJA 5KNNA 3I7FA 4OX9Q 1TWHH 3CPWA 3DLLA 1I5FA 1I6HH 1EYGA 1YJNA 5C44G 4DR7L 4LF6Q 3HOWG 4XTZA 1PYBA 2PI2A 3U58A 1J6QA 4WJ3M 4DV7L 1GGMA 4JI1Q 1X3EA 3CW2C 3KYHC 1T9HA 5FJ8H 1IXRA 1PH2A 1KMMA 2GVAA 3H3VH 3FKIH 4YCWA 4C3JH 4YRPA 1VQAA 1X6OA 3A74A 1PHJA 3VDYA 1NY4A 5C0XG 2RHQA 5IYCG 2EAYA 1HNXL 3CMQA 4IOAA 4DR5L 2ZIMA 2C8MA 2Q2UA 5JEAJ 1IBML 4DR1L 3F1ZA 4L87A 4XTCS 3ERRA 2NVTH 3I55A 1E1OA 3HXXA 3CCQA 3HOYH 5M3FH 2EJGA 4E51A 3GTQH 1XJVA 1N33L 3K0XA 4DUZL 3RLFA 1D7QA 4DR2Q 1VQHA 1XTDA 4YRKA 3J7A5 4NXML 4YP0A 1A62A 2B63G 2F3IA 4LFAL 2VY3A 2Y0SE 3MQZA 5K1PA 1PYSB 4DNIA 4YWMA 4LNSA 4XTUA 4TTVA 4XU2A 4IO9A 4MNOA 2UUBQ 1Z47A 2ZTDA 1LM0A 5C0XI 5AJ3L 2DTIA 4A3CG 2JQOA 1P8LA 2LXJA 2Q2IA 1MKHA 4KI0A 5M3MH 2MO0A 1PV4A 1B7YA 1Q7YC 1BIAA 2BH2A 5C4JH 4BXXH 1VQ6A 4YHHQ 4H2UA 1H4QA 1NJ2A 2HHHL 4JV5L 4WF2A 2EIFA 2D62A 4A3MG 4OXPA 1N34Q 1Y1VG 2B29A 1N36L 1N32L 3AFPA 3PUZA 2K14A 4HJAA 2ZT5A 3PO3G 4DUYQ 1EWIA 5IT9c 3F2CA 2CJAA 2Y0SG 3P8VA 4IPGA 4JI5L 1C0AA 4DV3L 3H0GH 1QF6A 1XPUA 4R4OA 4GOPA 1USYA 3HFVA 5IY0A 3HRIA 3I4MH 1V1QA 4X62Q 4DR6L 3IKMB 3HFZA 1VQ9A 1W3SA 3E9HA 1Y1WG 4XTVA 3S14H 2ODRD 1OXTA 4PZ7A 3GO5A 1WQWA 2ALYB 4GKKQ 4JI4Q 4BBSG 4RMFA 3SGIA 1QE0A 3NELA 4H2WA 4GS3A 3S1MH 3GTJH 3RN5A 3EIVA 2Q7GA 2R7FA 2E65A 1SERA 3HOUG 1YJWA 1D8LA 5BR8Q 1N9WA 3I4OA 4KHZA 3UH0A 4LUZA 2VQEQ 2I5MX 3KF6B 4KQEA 5ELNA 4A3DG 1WQ7A 2CJ9A 3TRZA 1X3GA 2QA4A 3IG2A 4X65L 1JJGA 2I5LX 3BZKA 1SMXA 3A7AA 3T1HQ 1SRUA 2DKGA 1EQRA 2EJ9A 4H02A 3DSQA 3WWVA 3ERSX 1XMQQ 5M5YH 1U5KA 4YRMA 3HY0A 4J15A 2DZCA 3CP0A 3K8AA 3TREA 1X01A 1HR0Q 3LGJA 4DV1L 3PF5A 4P71A 3JC66 2J3MA 3BFMA 4BBRH 4B3RQ 5ELOA 3GTOH 4A3FG 3KLWA 4HA8A 4QL5A 1XMOL 3VQXA 5FLXc 3ICAA 4YRFA 3CQZH 4CH4A 3VQVA 4YROA 2OTLA 3CCSA 3EFSA 3CCRA 2B3GA 4A3LG 4EX5A 3HOYG 1Q1BA 4CH6A 2K75A 4IFDI 5LMUQ 4P74A 4JI2Q 3CC2A 2JJQA 3F2BA 2DU7A 4B3TQ 5C53B 5C4XH 4LFCQ 3S1QH 1VQLA 4APVA 2ZINA 4MTNA 1QUQA 1MJCA 3FHWA 1JMCA 1HZBA 4JI3L 5FLMH 1LTLA 2EL9A 1FL0A 3RR5A 2NN6I 4P75A 2UXCQ 1Q86C 3J80c 2ZTCA 1JJCA 1A0IA 3M7NA 1VQPA 2VQFQ 4R4QA 1L1OC 2UXBL 4GLXA 5JJIA 4HIKA 2IX0A 5E7NA 4DR3L 1O7IA 1KRTA 4K0KL 3G71A 4H2XA 2K5NA 1NBWA 1HTTA 1I94L 4DV0Q 4X6AH 4YYEA 2R93H 4LF4L 3K80C 3HKZE 4A93H 3PCOA 2F52A 2NVYH 2I4NA 5IWAQ 5IYDH 3FJPA 4G84A 3ULJA 4LVKA 1VQKA 1RIPA 4XU3A 3UGQA 4HIDA 2R6GA 2JA6H 2AWOA 3I4NH 1ADJA 1KAWA 4HWPA 1Z7NA 4B3MQ 2HT1A 4JI6Q 4Q6GA 4YWKA 1KMNA 1JE5A 1LUZA 4CS4A 3CF5A 1VQMA 4A3GG 1G6PA 1KRSA 3AYHB 3HOXH 2A8VA 1G51A 1KQSA 3QO5A 2L15A 1YFTA 1L0WA 2AKWB 4YRRA 2G4CA 4QGUA 4YRLA 1E24A 1OXSC 1IBKQ 2E8GA 4JOIA 3I2ZA 1YB3A 4CH3A 3PUWA 4AYBE 2KCMA 1KHIA 3M9BA 1GO3E 4DAYB 2ZR2A 4JYAQ 1PH3A 1NYRA 2JE6I 1JJ2A 2UUAL 3PF4A 2YU9H 4RQEA 3ER0A 1UE6A 2MO1A 4GLVB 3JAMi 1YFSA 3HXYA 5C3EH 2UXDQ 1VQ7A 4DV2L 1B7YB 2QHSA 4GN5A 3V7SA 2Z6KA 4FDBA 4A3KH 1XNRL 2JA8G 4XU0A 3S17H 1IYJB 4YREA 2ASBA 4AQYQ 3L1AA 4HJ9A 3HOVG 1S72A 4HVCA 2WB1G 2R7ZH 4NXNL 4PZ8A 1QVFA 3OTOQ 2ZXFA 4A3BG 4BY1G 4AYBG 2ZTEA 1Z7MA 3HRKA 3PGZA 1HNWQ 4IJLA 2ID0A 2PQAA 4BA1I 4B3SQ 4O0AA 1QVGA 3KDFA 4YRNA 3V7CA 4RQFA 4KHPQ 4TVYA 3M4OH 1PH7A 2Q7EA 2ZJPA 4YRTA 4TQDA 1RIQA 3PO2H 2A8EA 5K1XA 1M90C 4GKJL 2CQOA 1B70A 4KR2A 3HFZB 4IPDA 4NB3A 3STBC 3JAMc 3G48A 4JBKA 4P72A 4LWCA 2QGQA 3LSSA 4OLFA 3CC7A 1EFWA 3A5YA 3CPFA 3U4ZA 5GADC 1K3RA 1NJ8A 2EXDA 12ASA 4HWSA 1WYDA 4K87A 2PNHA 3F2DA 4ME3A 2I0QA 3EBEA 3LSQA 2N49A 4DR7Q 2QHVA 1WNLA 2AMCA 1FYFA 4DV7Q 4DK6C 3CCLA 4IPCA 1HNZQ 2ZZEA 4PHCA 2UUBL 1E1TA 2FYKA 4L5RC 1EUJA 4QJFA 4GNXC 2DVEA 2JA5G 3A7UA 4JI8L 4R4IA 3Q8DA 2ZT7A 1H4TA 1WCMG 2QHTA 4A93G 3S2HH 1N34L 4GNXB 1C9OA 3BU2A 1PH5A 1IBMQ 3FP9A 4DR1Q 2VUMH 4X66L 4YY3L 5K36G 1E7ZA 3RIRA 2JA6G 1PH6A 2D0PA 5M5XH 3I4NG 4LF5L 1NJ1A 4GLAC 4JC0A 4P74C 3M3YH 2NZHA 2DUDA 3AQQA 4DUZQ 1SLJA 3RACA 3MF1A 4NPSA 4NXMQ 2LXKA 4LFAQ 4EQ5A 3HOZG 1WOCA 3PUVA 2E2IH 3UDGA 2IHEA 5AJ3Q 4TVAA 2ZTGA 4LVLA 4XIGS 5DLQE 2E1HA 2HIXA 3RUXA 1G291 4PZ6A 3D31A 4O2DA 3L4GA 2R92H 4R4CA 1KOGA 4A4IA 4JV5Q 1WJJA 1BBUA 2IY5B 2J3LA 1XNQL 1CKNB 2ZCEA 2E64A 2YTXA 4A3EG 4JG2A 5IE8A 1QZGA 2CFMA 3W1GA 3L0OA 1KL9A 5BR8L 4P73A 1N36Q 1N32Q 4PMWA 4ZIBA 1GKHA 3J81j 2N78A 4C2MH 4A3IG 2D0OA 4BY7G 2ARUA 1C7YA 4HIOA 1X54A 3GTPH 4LVJA 3TS0A 2DTOA 2IX1A 1FGUA 5J3BA 2OQ0A 2EQSA 4DR6Q 1A8VA 1Z9FA 5IP9G 4QQBX 1K0RA 2JA7H 1X65A 1XMQL 5F5WA 2UU9Q 2JK8A 1V43A 5C0XJ 5GAEC 4L5TA 3F8TA 4X64L 1K8AC 3RKWA 4JI0L 1VQNA 4B3RL 3PIPA 1Y14B 1R9TH 1X56A 4HJ5A 3H15A 1GM5A 2K50A 3M4QA 3UDFA 1MIUA 11ASA 5FJ8G 2R7DA 5M5WH 3J80i 4QY7A 1W66A 1YGBA 1FJGL 4A3JH 3ICEA 3FKIG 1EVLA 2YTVA 1UE7A 5GAGC 5IYBH 4MZ9A 4X65Q 3QO7A 5LMUL 4WJ4A 3HXWA 1W2BA 1HZCA 5IP7H 5GROA 3G6EA 3CCMA 1YI2A 2E41A 3U50C 3V7RA 2FXQA 3M85A 1U0LA 1AH9A 1HZ9A 4DV5Q 3RZOH 4CH5A 1K8GA 5M3FG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C51 B;  5C44 H;  1PVO A;  3HOW H;  4DV1 Q;  3GD7 A;  3GTL H;  2UXC L;  2OTJ A;  3ULL A;  3UFG A;  4ZTZ B;  3H3V I;  2PQA B;  2Q2H A;  4LF8 Q;  4L5Q A;  2K52 A;  3KDF B;  3EFR A;  1EIY B;  4ZTU B;  1J5W A;  2CWP A;  4HJ8 A;  1NTG A;  3TUP A;  5M3M G;  1H4S A;  2VUM G;  2DDZ A;  1K83 H;  1OXV A;  2KBN A;  4DV0 L;  4HWR A;  5IYC H;  1BVS A;  4LNQ A;  1B70 B;  1V9P A;  4BXX G;  4HIM A;  1HH2 P;  1VCI A;  1YJ9 A;  4IPH A;  1WU7 A;  5IWA L;  1VQE A;  3G1Z A;  1J5E Q;  1I50 H;  3RZD H;  3WQZ A;  4K86 A;  1YZ6 A;  1YBY A;  3PIO A;  4B3M L;  4JI6 L;  2ALY A;  4DV4 L;  2P0L A;  3MEF A;  3ULP A;  2A1A A;  4JI3 Q;  3R07 A;  3S15 H;  1MJE A;  4DV6 Q;  2NVX H;  3QO8 A;  4LFB Q;  3NET A;  3H0G G;  4LF7 L;  2CJB A;  4A76 A;  3D0F A;  1VQD A;  2RHQ B;  3MF2 A;  1VQ5 A;  4G85 A;  2DU5 A;  1SR3 A;  1IBK L;  2F4V Q;  4A3C H;  1OXU A;  5JEA G;  3I4M G;  2ZM6 L;  1YNX A;  3B6Y A;  4DR3 Q;  2CKZ B;  1VQI A;  3L7Z C;  2ES2 A;  3CCV A;  3VBB A;  3S2D H;  2E2H H;  1I94 Q;  3A5Z A;  5C52 B;  3VQY A;  3OD1 A;  4C3H H;  2UXD L;  4LF9 L;  4A3M H;  2C7I A;  4XTW A;  1UE5 A;  1M1K C;  4AIM A;  3TEH A;  4BWA A;  1Y1V H;  3RF1 A;  2UUC Q;  1VQZ A;  2JEB I;  2ZZG A;  3HKZ G;  3PO3 H;  2WAQ E;  2RF4 A;  4IFD J;  1SES A;  1LYL A;  3PV0 A;  4OON A;  3KJP A;  2Q2T A;  2QEX A;  4JCV E;  1WPY A;  3GTM H;  4LUV A;  5LMN L;  1NNH A;  4UY8 C;  4JI7 Q;  3UGT A;  4C3I H;  3OTO L;  3T1Y L;  2KHI A;  3QNE A;  4DR4 L;  1HNW L;  2Z0S A;  2RHS A;  3PZC A;  2ZZF A;  2OCE A;  1X2G A;  1S3O A;  4X5O A;  1VS0 A;  4WI1 A;  1Y1W H;  1IBL Q;  4XU1 A;  4AH6 A;  3NBH B;  4OX9 L;  3J81 i;  4GOP C;  1G5H A;  1USY C;  3V8K A;  1YEZ A;  2UUA Q;  5HGQ A;  4HWO A;  3G4S A;  1H4V B;  3J7Z C;  4BBS H;  2DZ9 A;  3TQY A;  2WP8 J;  4YCV A;  2WAQ G;  2ART A;  4YPF A;  1CSQ A;  2ZNJ A;  4LF6 L;  4YCU A;  1H95 A;  4DV2 Q;  1Q1E A;  3UE0 A;  3K81 C;  3HOU H;  2BA1 A;  3HKS A;  4A3J G;  4BBR G;  3L4G B;  4JI1 L;  4GOP B;  3L2P A;  4Y52 H;  4QIW E;  2E10 A;  3P8Y A;  2C35 B;  2Q5H A;  2E5L Q;  2CIM A;  4KR3 A;  2MNA A;  4A3D H;  3V8J A;  2YYZ A;  1Q8K A;  4NXN Q;  1E22 A;  1YVC A;  2Q7H A;  3REU A;  5HY6 A;  3UE1 A;  3W1B A;  3V8L A;  1AE2 A;  1X2H A;  2E2J H;  1PFS A;  1VQB A;  3CXC A;  4XEO A;  1PH4 A;  1SET A;  1TWA H;  5C4X G;  2YTY A;  4TQF A;  1HNZ L;  4YRC A;  3W5O A;  4GKJ Q;  1AE3 A;  2GVB A;  3J81 c;  1L1O A;  2ODR C;  3NEM A;  5FLM G;  1SN8 A;  4DR2 L;  2VW9 A;  4A3F H;  4POF A;  3RLO A;  4PG3 A;  4YWL A;  1IL2 A;  4DPG A;  2H5X A;  3A32 A;  4JBW A;  1DGS A;  2ARS A;  2MFI A;  4P71 C;  3IRB A;  3I56 A;  1HXD A;  2I4M A;  2HQL A;  4A3L H;  5GAH C;  4YHH L;  2DXU A;  5GQO A;  2AKW A;  2OQK A;  1VQO A;  1HNX Q;  2R93 G;  2LSS A;  1WLE A;  2XTI A;  4DR5 Q;  3S24 A;  2V1C C;  2CWA A;  5IYD G;  1ADY A;  4HWT A;  2ZT8 A;  3ZJY C;  1SFO H;  1G5I A;  1S40 A;  4DUY L;  3CMA A;  4JBM A;  1K73 C;  1Q46 A;  3CAM A;  1N33 Q;  3HOX G;  3K7A H;  4JI8 Q;  2PME A;  1UEB A;  2CCZ A;  1NYQ A;  1PA6 A;  1QVC A;  2QHU A;  4BA2 I;  2K5H A;  2RCN A;  2BA0 A;  4X62 L;  4UP7 A;  1XPO A;  1ASZ A;  4YRI A;  3PUY A;  4P75 C;  4X66 Q;  4YY3 Q;  2I4O A;  3CD6 A;  1QZH A;  3STB D;  4GKK L;  4OWX B;  4LF5 Q;  4DAM A;  1SE8 A;  2PMZ E;  1QUQ B;  3HTZ A;  4JI4 L;  2I4L A;  3A31 A;  2HHH Q;  3PUX A;  5C3E G;  1JT8 A;  1JB7 A;  5JJK A;  1TWC H;  2GN5 A;  3KFU A;  1SRO A;  3M4P A;  2EJF A;  5EAY A;  1CKO A;  3RKY A;  1JJC B;  3AEV A;  1YHB A;  2KHJ A;  4A3K G;  2VS1 A;  2VQE L;  4H2Y A;  4TVW A;  4A3G H;  4DKA C;  4JI5 Q;  4DV3 Q;  4H2X B;  1PH1 A;  2R7Z G;  2KEN A;  2UU9 L;  2DEQ A;  1Q82 C;  2I5H A;  2IHF A;  1BIB A;  5LMN W;  3PCO B;  3A5U A;  4L5S A;  4OO1 G;  2DJZ A;  2HNI A;  3T1H L;  3IAL A;  1XNQ Q;  4LW1 A;  4YRQ A;  1EQQ A;  4RG1 A;  1PH8 A;  3U4V A;  1NJ6 A;  3W3S A;  1Q81 C;  3PO2 G;  1I3Q H;  3EN2 A;  4LUO A;  4JOI C;  1HC7 A;  3RGL A;  1HR0 L;  4P3N A;  4CS2 A;  4YDQ A;  1YIT A;  2JA8 H;  4XTY A;  3A5Z B;  1FVI A;  1RL2 A;  1UE1 A;  2KCT A;  3TEH B;  3HOV H;  2WFW A;  4XTX A;  2ZIO A;  4IJH A;  3S16 H;  4OO1 I;  2ATW A;  4EO4 A;  4IFD G;  4A3B H;  4BY1 H;  2Z6K C;  4POG A;  4DV5 L;  2PI2 E;  4BW9 A;  1IZ6 A;  4UP9 A;  1PYS A;  4JI2 L;  4Q15 A;  3K7U C;  2MQH A;  4X64 Q;  4GNX A;  4B3T L;  1HJP A;  1BBW A;  1YHA A;  5E3I A;  4YRJ A;  4JI0 Q;  2E3C A;  4TWA A;  4LFC L;  1X9N A;  1CUK A;  4H2T A;  4LF8 L;  3E9I A;  1K9M C;  2RHS B;  4R1J A;  1VQF A;  1L2F A;  4OWT B;  3AFQ A;  3RL6 A;  2K5V A;  2NN6 G;  1NMF A;  3CCU A;  3RN2 A;  2ZT6 A;  1FJG Q;  3NEN A;  3P8T A;  2JEA I;  1E3P A;  3A7R A;  4HJ7 A;  4A75 A;  1XMO Q;  3HXV A;  2VQF L;  1YFR A;  1A63 A;  1YHQ A;  1J5E L;  1KXL A;  4P72 C;  2IT1 A;  4P3P A;  3QTC A;  1B8A A;  4ALP A;  2ZJQ A;  1X3F A;  3BZC A;  4UP8 A;  3HY1 A;  4H2S A;  3OW2 A;  4NCX A;  2JA9 A;  2E5A A;  2IY5 A;  1SRY A;  1CKN A;  4DV6 L;  4LFB L;  1YIJ A;  3IKL A;  3RNU A;  5JJL A;  1GVP A;  1KC8 C;  3MEY A;  2F4V L;  3REX A;  4GN3 B;  3TS2 A;  2P5I A;  1ASY A;  2JA5 H;  2A19 A;  4R4T A;  3GDE A;  3PSI A;  3HXU A;  3KJO A;  2B63 H;  4YRG A;  2BH8 A;  3RLN A;  1WCM H;  1EVK A;  5H1S E;  2R92 G;  4OWW B;  1L1O B;  2DTH A;  2HIV A;  1CSP A;  2VL6 A;  2UXB Q;  3KF6 A;  1BKB A;  4GN4 B;  1WFQ A;  2PMF A;  2K4K A;  1KD1 C;  2UUC L;  2AMC B;  4JYA L;  1KIX A;  4H2V A;  2DGY A;  1VQC A;  2XGT A;  4K0K Q;  1N8R C;  1TWF H;  1B76 A;  3E0E A;  4P3O A;  4DV4 Q;  2NVQ H;  4LF4 Q;  3OYY A;  3GTK H;  1XPR A;  4TQU S;  1P16 A;  4DQ2 A;  4JI7 L;  2ZR3 A;  2AWN A;  1TXY A;  4LF7 Q;  3TEG A;  3S1R H;  2WB1 E;  2EWN A;  3HOZ H;  2AHO B;  3KF8 B;  4AQY L;  4IOC A;  1NMG A;  1VQG A;  2OWO A;  4DK3 C;  1EIF A;  3S1N H;  2ZM6 Q;  4OP0 A;  1GD7 A;  2YV5 A;  2N3S A;  1IBL L;  2CGH A;  4CS3 A;  1PH9 A;  2DQ3 A;  4RDX A;  2N8N A;  3DM3 A;  2JA7 G;  3CCE A;  4KLK A;  3A0J A;  4JBJ A;  3UDI A;  2NZO A;  3RKX A;  1WI5 A;  2VZA A;  4B3S L;  4LF9 Q;  3L2Z A;  4A3E H;  1NE3 A;  3CC4 A;  3MXN B;  2VNU D;  2DQ0 A;  1Q12 A;  3VQW A;  1UWV A;  4KHP L;  1VQ8 A;  1TWG H;  1VQJ A;  3BJU A;  3HXZ A;  1HZA A;  1EOV A;  2ZGW A;  1VQ4 A;  2E5L L;  4TVA B;  3LC0 A;  1OTC A;  2ZNI A;  4A3I H;  1OXX K;  5LMN Q;  1NJ5 A;  1X55 A;  3UDX A;  4BY7 H;  2Q5I A;  4P73 C;  1ATI A;  1CKM A;  3T1Y Q;  1HR0 W;  4DR4 Q;  1XNR Q;  5IYB G;  4UPA A;  4YRS A;  1NJI C;  3CME A;  4Y7N H;  2ZJR A;  5IP7 G;  4XEM A;  1EIY A;  5IP9 H;  3GTG H;  4K88 A;  3KOJ A;  2DXT A;  3CCJ A;  5KNN A;  3I7F A;  4OX9 Q;  1TWH H;  3CPW A;  3DLL A;  1I5F A;  1I6H H;  1EYG A;  1YJN A;  5C44 G;  4DR7 L;  4LF6 Q;  3HOW G;  4XTZ A;  1PYB A;  2PI2 A;  3U58 A;  1J6Q A;  4WJ3 M;  4DV7 L;  1GGM A;  4JI1 Q;  1X3E A;  3CW2 C;  3KYH C;  1T9H A;  5FJ8 H;  1IXR A;  1PH2 A;  1KMM A;  2GVA A;  3H3V H;  3FKI H;  4YCW A;  4C3J H;  4YRP A;  1VQA A;  1X6O A;  3A74 A;  1PHJ A;  3VDY A;  1NY4 A;  5C0X G;  2RHQ A;  5IYC G;  2EAY A;  1HNX L;  3CMQ A;  4IOA A;  4DR5 L;  2ZIM A;  2C8M A;  2Q2U A;  5JEA J;  1IBM L;  4DR1 L;  3F1Z A;  4L87 A;  4XTC S;  3ERR A;  2NVT H;  3I55 A;  1E1O A;  3HXX A;  3CCQ A;  3HOY H;  5M3F H;  2EJG A;  4E51 A;  3GTQ H;  1XJV A;  1N33 L;  3K0X A;  4DUZ L;  3RLF A;  1D7Q A;  4DR2 Q;  1VQH A;  1XTD A;  4YRK A;  3J7A 5;  4NXM L;  4YP0 A;  1A62 A;  2B63 G;  2F3I A;  4LFA L;  2VY3 A;  2Y0S E;  5K1P A;  1PYS B;  4DNI A;  4YWM A;  4LNS A;  4XTU A;  4TTV A;  4XU2 A;  4IO9 A;  4MNO A;  2UUB Q;  1Z47 A;  2ZTD A;  1LM0 A;  5C0X I;  5AJ3 L;  2DTI A;  4A3C G;  2JQO A;  1P8L A;  2LXJ A;  2Q2I A;  1MKH A;  4KI0 A;  5M3M H;  2MO0 A;  1PV4 A;  1B7Y A;  1Q7Y C;  1BIA A;  2BH2 A;  5C4J H;  4BXX H;  1VQ6 A;  4YHH Q;  4H2U A;  1H4Q A;  1NJ2 A;  2HHH L;  4JV5 L;  4WF2 A;  2EIF A;  2D62 A;  4A3M G;  4OXP A;  1N34 Q;  1Y1V G;  2B29 A;  1N36 L;  1N32 L;  3AFP A;  3PUZ A;  2K14 A;  4HJA A;  2ZT5 A;  3PO3 G;  4DUY Q;  1EWI A;  5IT9 c;  3F2C A;  2CJA A;  2Y0S G;  3P8V A;  4IPG A;  4JI5 L;  1C0A A;  4DV3 L;  3H0G H;  1QF6 A;  1XPU A;  4R4O A;  4GOP A;  1USY A;  3HFV A;  5IY0 A;  3HRI A;  3I4M H;  1V1Q A;  4X62 Q;  4DR6 L;  3IKM B;  3HFZ A;  1VQ9 A;  1W3S A;  3E9H A;  1Y1W G;  4XTV A;  3S14 H;  2ODR D;  1OXT A;  4PZ7 A;  3GO5 A;  1WQW A;  2ALY B;  4GKK Q;  4JI4 Q;  4BBS G;  4RMF A;  3SGI A;  1QE0 A;  3NEL A;  4H2W A;  4GS3 A;  3S1M H;  3GTJ H;  3RN5 A;  3EIV A;  2Q7G A;  2R7F A;  2E65 A;  1SER A;  3HOU G;  1YJW A;  1D8L A;  5BR8 Q;  1N9W A;  3I4O A;  4KHZ A;  3UH0 A;  4LUZ A;  2VQE Q;  2I5M X;  3KF6 B;  4KQE A;  5ELN A;  4A3D G;  1WQ7 A;  2CJ9 A;  3TRZ A;  1X3G A;  2QA4 A;  3IG2 A;  4X65 L;  1JJG A;  2I5L X;  3BZK A;  1SMX A;  3A7A A;  3T1H Q;  1SRU A;  2DKG A;  1EQR A;  2EJ9 A;  4H02 A;  3DSQ A;  3WWV A;  3ERS X;  1XMQ Q;  5M5Y H;  1U5K A;  4YRM A;  3HY0 A;  4J15 A;  2DZC A;  3CP0 A;  3K8A A;  3TRE A;  1X01 A;  1HR0 Q;  3LGJ A;  4DV1 L;  3PF5 A;  4P71 A;  3JC6 6;  2J3M A;  3BFM A;  4BBR H;  4B3R Q;  5ELO A;  3GTO H;  4A3F G;  3KLW A;  4HA8 A;  4QL5 A;  1XMO L;  3VQX A;  5FLX c;  3ICA A;  4YRF A;  3CQZ H;  4CH4 A;  3VQV A;  4YRO A;  2OTL A;  3CCS A;  3EFS A;  3CCR A;  2B3G A;  4A3L G;  4EX5 A;  3HOY G;  1Q1B A;  4CH6 A;  2K75 A;  4IFD I;  5LMU Q;  4P74 A;  4JI2 Q;  3CC2 A;  2JJQ A;  3F2B A;  2DU7 A;  4B3T Q;  5C53 B;  5C4X H;  4LFC Q;  3S1Q H;  1VQL A;  4APV A;  2ZIN A;  4MTN A;  1QUQ A;  1MJC A;  3FHW A;  1JMC A;  1HZB A;  4JI3 L;  5FLM H;  1LTL A;  2EL9 A;  1FL0 A;  3RR5 A;  2NN6 I;  4P75 A;  2UXC Q;  1Q86 C;  3J80 c;  2ZTC A;  1JJC A;  1A0I A;  3M7N A;  1VQP A;  2VQF Q;  4R4Q A;  1L1O C;  2UXB L;  4GLX A;  5JJI A;  4HIK A;  2IX0 A;  5E7N A;  4DR3 L;  1O7I A;  1KRT A;  4K0K L;  3G71 A;  4H2X A;  2K5N A;  1NBW A;  1HTT A;  1I94 L;  4DV0 Q;  4X6A H;  4YYE A;  2R93 H;  4LF4 L;  3K80 C;  3HKZ E;  4A93 H;  3PCO A;  2F52 A;  2NVY H;  2I4N A;  5IWA Q;  5IYD H;  3FJP A;  4G84 A;  3ULJ A;  1VQK A;  1RIP A;  4XU3 A;  3UGQ A;  4HID A;  2R6G A;  2JA6 H;  2AWO A;  3I4N H;  1ADJ A;  1KAW A;  4HWP A;  1Z7N A;  4B3M Q;  2HT1 A;  4JI6 Q;  4Q6G A;  4YWK A;  1KMN A;  1JE5 A;  1LUZ A;  4CS4 A;  3CF5 A;  1VQM A;  4A3G G;  1G6P A;  1KRS A;  3AYH B;  3HOX H;  2A8V A;  1G51 A;  1KQS A;  3QO5 A;  2L15 A;  1YFT A;  1L0W A;  2AKW B;  4YRR A;  2G4C A;  4QGU A;  4YRL A;  1E24 A;  1OXS C;  1IBK Q;  2E8G A;  4JOI A;  3I2Z A;  1YB3 A;  4CH3 A;  3PUW A;  4AYB E;  2KCM A;  1KHI A;  3M9B A;  1GO3 E;  4DAY B;  2ZR2 A;  4JYA Q;  1PH3 A;  1NYR A;  2JE6 I;  1JJ2 A;  2UUA L;  3PF4 A;  2YU9 H;  4RQE A;  3ER0 A;  1UE6 A;  2MO1 A;  4GLV B;  3JAM i;  1YFS A;  3HXY A;  5C3E H;  2UXD Q;  1VQ7 A;  4DV2 L;  1B7Y B;  2QHS A;  4GN5 A;  3V7S A;  2Z6K A;  4FDB A;  4A3K H;  1XNR L;  2JA8 G;  4XU0 A;  3S17 H;  1IYJ B;  4YRE A;  2ASB A;  4AQY Q;  3L1A A;  4HJ9 A;  3HOV G;  1S72 A;  4HVC A;  2WB1 G;  2R7Z H;  4NXN L;  4PZ8 A;  1QVF A;  3OTO Q;  2ZXF A;  4A3B G;  4BY1 G;  4AYB G;  2ZTE A;  1Z7M A;  3HRK A;  3PGZ A;  1HNW Q;  4IJL A;  2ID0 A;  2PQA A;  4BA1 I;  4B3S Q;  4O0A A;  1QVG A;  3KDF A;  4YRN A;  3V7C A;  4RQF A;  4KHP Q;  4TVY A;  3M4O H;  1PH7 A;  2Q7E A;  2ZJP A;  4YRT A;  4TQD A;  1RIQ A;  3PO2 H;  5K1X A;  1M90 C;  4GKJ L;  2CQO A;  1B70 A;  4KR2 A;  3HFZ B;  4IPD A;  4NB3 A;  3STB C;  3JAM c;  3G48 A;  4JBK A;  4P72 A;  4LWC A;  2QGQ A;  3LSS A;  4OLF A;  3CC7 A;  1EFW A;  3A5Y A;  3CPF A;  3U4Z A;  5GAD C;  1K3R A;  1NJ8 A;  2EXD A;  12AS A;  4HWS A;  1WYD A;  4K87 A;  2PNH A;  3F2D A;  4ME3 A;  2I0Q A;  3EBE A;  3LSQ A;  2N49 A;  4DR7 Q;  2QHV A;  1WNL A;  2AMC A;  1FYF A;  4DV7 Q;  4DK6 C;  3CCL A;  4IPC A;  1HNZ Q;  2ZZE A;  4PHC A;  2UUB L;  1E1T A;  2FYK A;  4L5R C;  1EUJ A;  4QJF A;  4GNX C;  2DVE A;  2JA5 G;  3A7U A;  4JI8 L;  4R4I A;  3Q8D A;  2ZT7 A;  1H4T A;  1WCM G;  2QHT A;  4A93 G;  3S2H H;  1N34 L;  4GNX B;  1C9O A;  3BU2 A;  1PH5 A;  1IBM Q;  3FP9 A;  4DR1 Q;  2VUM H;  4X66 L;  4YY3 L;  5K36 G;  1E7Z A;  3RIR A;  2JA6 G;  1PH6 A;  2D0P A;  5M5X H;  3I4N G;  4LF5 L;  1NJ1 A;  4GLA C;  4JC0 A;  4P74 C;  3M3Y H;  2NZH A;  2DUD A;  3AQQ A;  4DUZ Q;  1SLJ A;  3RAC A;  3MF1 A;  4NPS A;  4NXM Q;  2LXK A;  4LFA Q;  4EQ5 A;  3HOZ G;  1WOC A;  3PUV A;  2E2I H;  3UDG A;  2IHE A;  5AJ3 Q;  4TVA A;  2ZTG A;  4XIG S;  5DLQ E;  2E1H A;  2HIX A;  3RUX A;  1G29 1;  4PZ6 A;  3D31 A;  4O2D A;  3L4G A;  2R92 H;  4R4C A;  1KOG A;  4A4I A;  4JV5 Q;  1WJJ A;  1BBU A;  2IY5 B;  2J3L A;  1XNQ L;  1CKN B;  2ZCE A;  2E64 A;  2YTX A;  4A3E G;  4JG2 A;  5IE8 A;  1QZG A;  2CFM A;  3W1G A;  3L0O A;  1KL9 A;  5BR8 L;  4P73 A;  1N36 Q;  1N32 Q;  4PMW A;  4ZIB A;  1GKH A;  3J81 j;  2N78 A;  4C2M H;  4A3I G;  2D0O A;  4BY7 G;  2ARU A;  1C7Y A;  4HIO A;  1X54 A;  3GTP H;  3TS0 A;  2DTO A;  2IX1 A;  1FGU A;  5J3B A;  2OQ0 A;  2EQS A;  4DR6 Q;  1A8V A;  1Z9F A;  5IP9 G;  4QQB X;  1K0R A;  2JA7 H;  1X65 A;  1XMQ L;  5F5W A;  2UU9 Q;  2JK8 A;  1V43 A;  5C0X J;  5GAE C;  4L5T A;  3F8T A;  4X64 L;  1K8A C;  3RKW A;  4JI0 L;  1VQN A;  4B3R L;  3PIP A;  1Y14 B;  1R9T H;  1X56 A;  4HJ5 A;  3H15 A;  1GM5 A;  2K50 A;  3M4Q A;  3UDF A;  1MIU A;  11AS A;  5FJ8 G;  2R7D A;  5M5W H;  3J80 i;  4QY7 A;  1W66 A;  1YGB A;  1FJG L;  4A3J H;  3ICE A;  3FKI G;  1EVL A;  2YTV A;  1UE7 A;  5GAG C;  5IYB H;  4MZ9 A;  4X65 Q;  3QO7 A;  5LMU L;  4WJ4 A;  3HXW A;  1W2B A;  1HZC A;  5IP7 H;  5GRO A;  3G6E A;  3CCM A;  1YI2 A;  2E41 A;  3U50 C;  3V7R A;  2FXQ A;  3M85 A;  1U0L A;  1AH9 A;  1HZ9 A;  4DV5 Q;  3RZO H;  4CH5 A;  1K8G A;  5M3F G; 
#chains in the Genus database with same CATH topology
 3TBI B;  5C51 B;  5C44 H;  3DHQ A;  4RCN A;  1PVO A;  1EWH A;  2QF7 A;  3HOW H;  4DV1 Q;  1FNW A;  3K5L A;  5LL6 X;  3GD7 A;  3FKI B;  3X3M A;  3GTL H;  2UXC L;  2OTJ A;  4C3J B;  2ICE C;  3ULL A;  3CRL C;  1SE4 A;  5NUC A;  2RBM A;  2QDB A;  3UFG A;  1UNS A;  3SVM A;  4ZTZ B;  1LTS D;  5ELC A;  3H3V I;  2PQA B;  2Q2H A;  4KHV A;  4LF8 Q;  2B2W C;  3BYT B;  4L5Q A;  2Q8R E;  2K52 A;  3KDF B;  1JWU D;  3EFR A;  3WDN A;  1EIY B;  4ZTU B;  1J5W A;  3Q23 A;  2CWP A;  2EOT A;  4HJ8 A;  2B2Y C;  2E75 C;  4HSP A;  1NTG A;  3TUP A;  5M3M G;  2NVT B;  2VUM G;  1I4R A;  1H4S A;  3NE5 B;  2DDZ A;  1K83 H;  1OXV A;  2KBN A;  4JW0 A;  2WIN B;  4DV0 L;  4HWR A;  3HOY B;  5C0X H;  2F0D A;  5IYC H;  1BVS A;  2BOS A;  4LNQ A;  1B70 B;  1V9P A;  3OWF A;  3BDL A;  1LT3 D;  1SE3 A;  3FVQ A;  1HTL D;  4BXX G;  4H0L C;  1HH2 P;  1VCI A;  4HIM A;  1YJ9 A;  4IPH A;  1WU7 A;  1S5D D;  1BF4 A;  5J1Z A;  1WTQ A;  5IWA L;  2KVM A;  5EJW A;  1VQE A;  3G1Z A;  1J5E Q;  1J9O A;  2AUJ D;  1I50 H;  1BNZ A;  3RZD H;  1FNV A;  3WQZ A;  1CFM A;  3A7L A;  3V96 A;  4K86 A;  2HDM A;  5HGT A;  1YZ6 A;  1H9S B;  1YBY A;  3PIO A;  1D5X C;  4FF4 A;  3QIA A;  3QG1 A;  4B3M L;  4JI6 L;  2XNA C;  2ALY A;  4DV4 L;  5JOB A;  2P0L A;  2E2D C;  2NZ1 D;  3MEF A;  3ULP A;  4ID6 A;  4C1N I;  2A1A A;  2A73 B;  1ML0 D;  4JI3 Q;  3R07 A;  3S15 H;  1MJE A;  3N52 A;  3D3R A;  4DV6 Q;  2NVX H;  3QO8 A;  2SEB D;  4XYO A;  3K7A B;  3OOC A;  4LFB Q;  3NET A;  3H0G G;  4LF7 L;  2CJB A;  4A76 A;  3D0F A;  1PZK D;  1VQD A;  3KBG A;  5EQ0 A;  3TDQ A;  2D2C C;  2RHQ B;  1RCV D;  1GUT A;  3MF2 A;  4YRG A;  2EJG C;  1VQ5 A;  4G85 A;  2DU5 A;  1SR3 A;  1A3U A;  2MGS A;  1IBK L;  3Q0A A;  2F4V Q;  3SHL A;  4A3C H;  3HRZ C;  5TSS A;  1OXU A;  4H44 C;  5JEA G;  3I4M G;  2ZM6 L;  5IGE A;  3NTI A;  1YNX A;  2HD3 A;  3R8B A;  3B6Y A;  4DR3 Q;  2B8G A;  2CKZ B;  1VQI A;  3L7Z C;  2ES2 A;  3CCV A;  4U67 3;  3VBB A;  1PTO D;  3S2D H;  1QJO A;  2A6H C;  5IT9 L;  2NBF A;  2E2H H;  1I94 Q;  1F9S A;  2EYP A;  2QEJ C;  3RMH A;  3A5Z A;  3NSW A;  3BG3 A;  5C52 B;  3TZU A;  3VQY A;  3OD1 A;  4C3H H;  1JQY D;  4LF9 L;  4A3M H;  2UXD L;  2C7I A;  1UE5 A;  1M1K C;  1SNC A;  4XTW A;  4AIM A;  3DXJ C;  3TEH A;  4BWA A;  1Y1V H;  3RF1 A;  1KNE A;  2WKC A;  1S5F D;  4CKC A;  2UUC Q;  2XSC A;  1VQZ A;  1SYG A;  2JEB I;  2ZZG A;  3HKZ G;  2WAC A;  3PO3 H;  2WAQ E;  3IKJ A;  1STA A;  2RF4 A;  1ET9 A;  4IFD J;  4MTK A;  1CTM A;  3TP7 A;  1SES A;  1LYL A;  3PV0 A;  2ICI A;  4OON A;  3R2T A;  3KJP A;  2Q2T A;  1FGB D;  4LJZ C;  5BN5 A;  2QEX A;  2A74 C;  1WTX A;  3NP8 A;  4WOR A;  4A3G B;  1A2T A;  5ELE A;  1RF2 D;  4JCV E;  1DZ1 A;  2FHT A;  1WPY A;  3ZYY X;  3GTM H;  4LUV A;  5LMN L;  1NNH A;  4UY8 C;  3C1F A;  3SK5 A;  4JI7 Q;  3UGT A;  4C3I H;  3OTO L;  3DUZ A;  3T1Y L;  2KHI A;  3IFT A;  3QNE A;  5HUR A;  2X6G A;  4I7Z C;  4DR4 L;  3LWE A;  1F77 A;  4TRD A;  3BVZ A;  2Z0S A;  1HNW L;  3MAQ A;  2RHS A;  3MXU A;  3S1M B;  1E2V A;  3GTJ B;  3M7G A;  3PZC A;  1Z7T A;  4N9P A;  2ZZF A;  2OCE A;  4IZ8 A;  1XYI A;  1X2G A;  1S3O A;  4X5O A;  1VS0 A;  4WI1 A;  2F0I A;  3D4R A;  3QJY A;  4EQN A;  1Y1W H;  1IBL Q;  1JOR A;  1QWY A;  2EE1 A;  4XU1 A;  2EVB A;  3QB3 A;  4AH6 A;  1SND A;  3NBH B;  4OX9 L;  1B50 A;  3J81 i;  4GOP C;  1G5H A;  1USY C;  3V8K A;  1YEZ A;  4K8I A;  1I3Q B;  5HGQ A;  2UUA Q;  1STY A;  4HWO A;  1BCP F;  3G4S A;  1H4V B;  3J7Z C;  4BBS H;  2DZ9 A;  3TQY A;  2WP8 J;  4YCV A;  2WAQ G;  2ART A;  4YPF A;  1CSQ A;  2ZNJ A;  3J7A F;  1V1P B;  4LF6 L;  4YCU A;  1SEB D;  1X3Q A;  2XIW A;  3NBI A;  1H95 A;  4DV2 Q;  1Q1E A;  2EY6 A;  3UE0 A;  3K81 C;  1UAP A;  3HOU H;  2BA1 A;  5CV4 A;  5I6W A;  3HKS A;  4A3J G;  4BBR G;  2JA8 B;  2PW7 A;  1B44 D;  2C9O A;  4JI1 L;  3L4G B;  1ILP A;  4GOP B;  3L2P A;  4Y52 H;  4QIW E;  4OL7 A;  5CV8 A;  2KA7 A;  2E10 A;  3P8Y A;  2C35 B;  2Q5H A;  2E5L Q;  3HOV B;  2CIM A;  3Q22 A;  2WB1 B;  4KR3 A;  1TKW B;  2MNA A;  4A3D H;  1D1K A;  3V8J A;  5T1G A;  1HHV A;  1Q90 A;  2OXP A;  2F4I A;  2YYZ A;  1Q8K A;  5IOD A;  3S16 B;  5I9O A;  1EZ6 A;  4G4K A;  4NXN Q;  4JVZ A;  2A69 C;  4A3B B;  4BY1 B;  2DY8 A;  1E22 A;  4CBV A;  4AYB B;  1YVC A;  1Q8I A;  1R4P B;  2Q7H A;  3REU A;  2DNC A;  1VMP A;  5HY6 A;  3UE1 A;  1I6V C;  3W1B A;  3V8L A;  1AE2 A;  3WOE A;  1JWM D;  1X2H A;  2E2J H;  1HFG A;  3K0Y A;  1PFS A;  2F1M A;  1VQB A;  2K5D A;  3CXC A;  4CDF C;  3RD4 A;  4XEO A;  1PH4 A;  1EIH A;  3T56 B;  3E6Z X;  4RH6 A;  1GUG A;  4BBR B;  2VXW A;  2CH4 W;  4IFD H;  2FJ2 A;  1SET A;  1TWA H;  2CHB D;  3S9W A;  5FLX L;  4X3S A;  5C4X G;  2YTY A;  4TQF A;  1HNZ L;  2JYO A;  4YRC A;  3W5O A;  4GKJ Q;  1AE3 A;  4FYD A;  2L55 A;  4Z9C B;  1TS2 A;  2GVB A;  2HQE A;  3J81 c;  2A6H D;  1PZJ D;  1EY9 A;  1L1O A;  4OEL B;  1ZYR D;  4DNR B;  2ODR C;  3URY A;  3NEM A;  2XRQ D;  5FLM G;  4HT4 A;  1LT6 D;  4X3T A;  1SN8 A;  4DR2 L;  1KDA A;  2VW9 A;  4KK7 A;  1JB3 A;  4ME5 A;  2NS6 A;  4A3F H;  2DJG C;  3K57 A;  2O5J C;  4POF A;  1NAP A;  3RLO A;  2MP1 A;  4M8A A;  4PG3 A;  2BE5 C;  4OIJ A;  2NTS A;  4LAA A;  4YWL A;  4R9W A;  2VB3 X;  1IL2 A;  4DPG A;  2H5X A;  3A32 A;  2F3V A;  2NN6 H;  4JBW A;  1DGS A;  2ARS A;  1JCK B;  2MFI A;  4P71 C;  5DAU A;  3IRB A;  1SNO A;  1GHJ A;  3V2T A;  3I56 A;  2Z4H A;  1HXD A;  5ELB A;  2I4M A;  2HQL A;  2K1B A;  4A3L H;  5GAH C;  2RSN A;  3ND9 A;  4YHH L;  2DXU A;  2L1B A;  5GQO A;  2AKW A;  2IJ0 A;  2OQK A;  3MWY W;  1VQO A;  1L0X B;  1HNX Q;  2LSS A;  2R93 G;  1WLE A;  1SYF A;  2XTI A;  3W3A A;  4DR5 Q;  4ODG A;  3S24 A;  2V1C C;  4QB4 A;  3J80 L;  2HUG A;  2CWA A;  2KCN A;  5IYD G;  1ADY A;  2HDL A;  4HWT A;  3RUZ A;  1WD0 A;  2ZT8 A;  3ZJY C;  1SFO H;  1A6X A;  3BVG A;  1U4P A;  1G5I A;  1XTC D;  1S40 A;  1MI2 A;  4DUY L;  5IGB A;  3TN2 A;  3CMA A;  2O4X A;  4JBM A;  1K73 C;  1AFP A;  3A8J E;  1Q46 A;  1GUN A;  4HMJ A;  3CAM A;  2B8F A;  1N33 Q;  1K3B C;  2JA5 B;  1IHZ A;  3HOX G;  3K7A H;  3MHB A;  4JI8 Q;  2PME A;  4LVM A;  1UEB A;  2CCZ A;  2L12 A;  2Z6B A;  1WCM B;  3CHB D;  1PA6 A;  1NYQ A;  2N88 A;  1RTO A;  2R93 B;  1QVC A;  1I4H A;  2QHU A;  4A93 B;  4BA2 I;  2K5H A;  5JVG 3;  5G3L F;  1KAB A;  2RCN A;  2BA0 A;  4K2K A;  4X62 L;  4UP7 A;  1XPO A;  1ASZ A;  4YRI A;  3BDC A;  3PUY A;  4P75 C;  5KNB A;  4X66 Q;  4YY3 Q;  2JA6 B;  2PO4 A;  2I4O A;  3CD6 A;  1QZH A;  3I4N B;  2XWJ B;  1B9N A;  1UEA B;  3STB D;  4GKK L;  4OWX B;  4LF5 Q;  1MBY A;  3VYS A;  4DAM A;  1SE8 A;  2PMZ E;  1EWC A;  1QUQ B;  3NK9 A;  4JI4 L;  3HTZ A;  2I4L A;  5KEE A;  4M1U B;  4EGV A;  3A31 A;  2HHH Q;  3PUX A;  3GTK B;  4JK1 C;  5C3E G;  1JT8 A;  1D6E C;  4B9X A;  2OT2 A;  1JB7 A;  3SXH A;  5JJK A;  3HGB A;  1TWC H;  1IW7 D;  1C4Q A;  2GN5 A;  3KFU A;  1SRO A;  2EYJ A;  3M4P A;  1DOK A;  2B2V C;  4F87 A;  3S1R B;  1J8I A;  5KYL A;  2EJF A;  5EAY A;  1CKO A;  3RKY A;  1JJC B;  2TSS A;  3AEV A;  1NCV A;  1YHB A;  2KHJ A;  4A3K G;  1B9M A;  1DOL A;  3HOZ B;  4CKE A;  1PZI D;  2VS1 A;  1GHK A;  2VQE L;  1Y8N B;  5M9O A;  4DK1 A;  4H2Y A;  1EY8 A;  4TVW A;  2XN9 C;  4A3G H;  1K28 A;  5CR3 A;  3C3L A;  5EBC A;  2ZXO A;  4N9T A;  4DKA C;  4JI5 Q;  3DM1 A;  2L11 A;  3IFD A;  4DV3 Q;  4H2X B;  1PH1 A;  2R7Z G;  4FXG C;  2R61 A;  1EEI D;  2KEN A;  2UU9 L;  3R93 A;  2DEQ A;  1Q82 C;  4LVI A;  2I5H A;  1MHW C;  2IHF A;  1NUC A;  1EL0 A;  3Q6S A;  1Y69 U;  1BIB A;  2PZU A;  5LMN W;  3PCO B;  3A5U A;  4L5S A;  4CJ1 B;  4DK0 A;  4OO1 G;  1HUN A;  2DJZ A;  2HNI A;  3T1H L;  3OPO A;  4A3E B;  3IAL A;  1XNQ Q;  4LW1 A;  3NXW A;  5EBD A;  4XQQ A;  4YRQ A;  1EQQ A;  4RG1 A;  3T16 A;  1PH8 A;  3U4V A;  2L9H A;  2BCO A;  1NJ6 A;  3NHH A;  1TWG B;  3W3S A;  1A2U A;  1K0S A;  1Q81 C;  2RDG A;  1CZG A;  1NR4 A;  3PO2 G;  1I3Q H;  2EJM A;  3EN2 A;  1U4R A;  1SBB B;  1JOQ A;  1CM9 A;  4LUO A;  1AW7 A;  4JOI C;  1D5M C;  4N8F A;  1I4G A;  1HC7 A;  3RGL A;  1YNN C;  1HR0 L;  1STE A;  1S4Z A;  4RKL A;  3SK4 A;  1B3A A;  2KUM A;  2MPM A;  4BY7 B;  4P3N A;  1YIT A;  4CS2 A;  3QR8 A;  4YDQ A;  5C4Z A;  1F2Z A;  3E0J A;  2JA8 H;  4XTY A;  3A5Z B;  4B9W A;  1SMY C;  4LMQ D;  1A3T A;  1FVI A;  1RL2 A;  1UE1 A;  2KCT A;  1IYV A;  3TEH B;  3HOV H;  2DN8 A;  2WFW A;  1HCZ A;  4XTX A;  2ZIO A;  5C6A A;  4IJH A;  3S16 H;  4OO1 I;  3GTG B;  3AB9 A;  2ATW A;  2K7V A;  4EO4 A;  3J81 E;  4IFD G;  4A3B H;  4BY1 H;  2Z6K C;  1BO0 A;  1QNK A;  4XQJ A;  3NQT A;  4POG A;  4DV5 L;  2QCP X;  3D6W A;  1TWH B;  2PI2 E;  1ICF B;  4BW9 A;  4IUR A;  1IZ6 A;  4UP9 A;  5KNC A;  4PNY A;  3JAM L;  1PYS A;  5A2Q L;  4JI2 L;  3EVQ A;  4Q15 A;  3K7U C;  2MQH A;  1HXY D;  4X64 Q;  4GNX A;  1SYB A;  4B3T L;  1HJP A;  1BBW A;  1YHA A;  5E3I A;  4YRJ A;  4JI0 Q;  2E3C A;  3H3V C;  4TWA A;  2EYH A;  5I9P A;  4LFC L;  4EQP A;  1X9N A;  1WD1 A;  1CUK A;  4H2T A;  3ERQ A;  5BN4 A;  4LF8 L;  2K5W A;  3E9I A;  1Y8P B;  2F0P A;  2RHS B;  1K9M C;  2X6L A;  1SJH D;  4R1J A;  5EKL A;  1VQF A;  1L2F A;  1UUP A;  3AFQ A;  4OWT B;  3RL6 A;  2K5V A;  2NN6 G;  1NMF A;  1NR2 A;  4F8M A;  1VMC A;  3CCU A;  1LTT D;  1HTP A;  3RN2 A;  2ZT6 A;  2Z1C A;  1FJG Q;  3NEN A;  3P8T A;  2JEA I;  1E3P A;  2RVL A;  3J81 L;  3A7R A;  5CBA E;  2AQ2 B;  3SEB A;  4HJ7 A;  2NUC A;  2G9H D;  4A75 A;  1XMO Q;  3HXV A;  2VQF L;  2AQ3 B;  1RKN A;  1YFR A;  4G7O C;  2NB0 A;  1A63 A;  1YHQ A;  1J5E L;  1G2S A;  2KEC A;  1PXU A;  5ISR A;  1KXL A;  4P72 C;  4FP5 D;  2IT1 A;  4P3P A;  3QTC A;  1B8A A;  4ALP A;  2ZJQ A;  1X3F A;  1WVL A;  3BZC A;  4UP8 A;  5M3F B;  3HY1 A;  3GTQ B;  4H2S A;  2CW0 D;  3OW2 A;  4NCX A;  2JA9 A;  2E5A A;  3QOL A;  1ESF A;  2H4O A;  1ESR A;  2EDG A;  2IY5 A;  4ILW A;  2KJX A;  1SRY A;  3Q24 A;  1CKN A;  4DV6 L;  5IIF A;  3KUP A;  4LFB L;  2EYO A;  1YIJ A;  1SNM A;  1F9Q A;  3IKL A;  3RNU A;  1O7Z A;  5JJL A;  1GVP A;  1KC8 C;  3A55 A;  3MEY A;  1JE4 A;  1H9K A;  3N6R A;  3BVM A;  4KKS A;  3QO2 A;  2F4V L;  3REX A;  4GN3 B;  3I70 A;  3TS2 A;  2JP1 A;  3D4D A;  2P5I A;  1ASY A;  4KY7 A;  2JA5 H;  2IX3 A;  2A19 A;  1BCP C;  4R4T A;  3GDE A;  5M3M B;  2VUM B;  3PSI A;  3VR5 A;  4C56 C;  1JR0 D;  3HXU A;  3MTS A;  3KJO A;  2B63 H;  1V1O A;  5CV7 A;  3TZD A;  3VYT A;  2BH8 A;  1PTO F;  1WCM H;  3RLN A;  5C4J B;  1EVK A;  5H1S E;  4R8N A;  1LTG D;  3D8G A;  2R92 G;  4OWW B;  1L1O B;  2DTH A;  2HIV A;  1CSP A;  1QCB D;  1KDB A;  2VL6 A;  3BDO A;  2K33 A;  2UXB Q;  3KF6 A;  4X3U A;  4GN4 B;  1BKB A;  1BCP B;  1ICW A;  1WFQ A;  3T51 B;  2PMF A;  2K4K A;  1KD1 C;  2UUC L;  2AMC B;  4K5W A;  4JYA L;  3OMC A;  1KIX A;  5K36 H;  4H2V A;  2DGY A;  1VQC A;  2XGT A;  2K03 A;  1N8R C;  4K0K Q;  3VYR A;  1QIL A;  1TWF H;  1B76 A;  3E0E A;  1TS4 A;  4P3O A;  4DV4 Q;  2NVQ H;  2V4D A;  3DMU A;  4LF4 Q;  1AEX A;  3OYY A;  1D5Z C;  3GTK H;  2WV6 D;  1XPR A;  4TQU S;  1HQM C;  4IAL A;  1P16 A;  1X32 A;  5CMD A;  1WTV A;  4DQ2 A;  4JI7 L;  3H0G B;  2ZR3 A;  1I4Q A;  2AWN A;  1TXY A;  4LF7 Q;  3TEG A;  1EQV A;  3S1R H;  2A68 D;  2IW3 A;  2WB1 E;  1KDC A;  2EWN A;  3HOZ H;  2AHO B;  3KF8 B;  2B2U A;  3M4Y A;  4AQY L;  1ZKO A;  2K01 A;  4IOC A;  1NMG A;  3I4M B;  1VQG A;  2OWO A;  1D2B A;  4DK3 C;  1EIF A;  3S1N H;  4DNT B;  5COY A;  2ZM6 Q;  5D65 A;  4OP0 A;  1GD7 A;  2YV5 A;  4QF4 A;  4CKB A;  2N3S A;  1IBL L;  4RGN A;  2EY1 A;  2CGH A;  5C3X A;  4CS3 A;  3P75 A;  1PH9 A;  2DQ3 A;  2B2T C;  1L0Y B;  2N8N A;  5I2X A;  3MFG A;  3S14 B;  4RDX A;  4KTA A;  3DM3 A;  2JA7 G;  3CCE A;  4KLK A;  3A0J A;  1SYC A;  2RDH A;  3BYY B;  4Q5V A;  3MXG A;  5D3I B;  4NKL A;  4JBJ A;  3UDI A;  2NZO A;  3EQL C;  3J7A V;  3RKX A;  1WI5 A;  2VZA A;  4B3S L;  4LF9 Q;  5F2D A;  3L2Z A;  4A3E H;  5BN3 A;  1NE3 A;  3CC4 A;  1STB A;  3MXN B;  2VNU D;  2DQ0 A;  1SNQ A;  1Q12 A;  4ZLT F;  2MHV A;  3VQW A;  1UWV A;  4KHP L;  1LTB D;  3HKZ B;  2RQX A;  1VQ8 A;  1CA6 A;  1TWG H;  1VQJ A;  3BJU A;  3HXZ A;  1HZA A;  1EOV A;  2B39 A;  3HEJ A;  1SYD A;  2ZGW A;  4IUU A;  1VQ4 A;  1JOK A;  2E5L L;  4G7H C;  4DU9 A;  3CU7 A;  4TVA B;  3LC0 A;  1OTC A;  1TII D;  4XT3 B;  4PQX A;  2ZNI A;  5FO9 B;  1TQO A;  4A3I H;  1OXX K;  3WOF A;  5CGK A;  1DCZ A;  5LMN Q;  1X55 A;  2RSO A;  1NJ5 A;  3UDX A;  4BY7 H;  2Q5I A;  1LT5 D;  4P73 C;  1ATI A;  1CKM A;  1LTR D;  3T1Y Q;  3C2P A;  1BBX C;  1HR0 W;  4DR4 Q;  1XNR Q;  5IYB G;  4UPA A;  4DN4 M;  2XRS D;  4OHJ A;  4YRS A;  1IYU A;  1NJI C;  1GXD C;  3O13 A;  5D3D A;  3CME A;  1B3Q A;  4Y7N H;  3PIP 3;  4IUN A;  1KLG D;  2ZJR A;  5C5L A;  5IP7 G;  4XEM A;  1I4X A;  1EIY A;  3IAY A;  5IP9 H;  3GTG H;  4K88 A;  3KOJ A;  2F0W A;  2DXT A;  3CCJ A;  3H6M A;  4NP5 A;  3F2U A;  5KNN A;  3HG9 A;  4KD4 A;  3I7F A;  3D6C A;  4OX9 Q;  5M5Y B;  3ERO A;  1TWH H;  3CPW A;  3DLL A;  1I5F A;  2A6E C;  2B2W A;  1I6H H;  2WAQ B;  1EYG A;  1YJN A;  5C44 G;  4DR7 L;  2F0U A;  4LF6 Q;  3HOW G;  4XTZ A;  2B2Y A;  1PYB A;  2PI2 A;  2VB2 X;  4OGQ C;  3U58 A;  4A3J B;  1J6Q A;  4WJ3 M;  4DV7 L;  1PRT C;  1EU4 A;  3GTO B;  5JPN C;  1TS3 A;  1GGM A;  4JI1 Q;  1H9S A;  1X3E A;  1QB5 D;  3CW2 C;  3KYH C;  1T9H A;  4FVM A;  2LFN A;  3VR3 A;  5FJ8 H;  1IXR A;  1CT1 D;  3CQZ B;  1PH2 A;  4IUP A;  4CDC C;  1KMM A;  1RJT A;  3E5S A;  3VR2 A;  1CK1 A;  2GVA A;  4X3K A;  2LKV A;  3H3V H;  2D5D A;  1STN A;  3FKI H;  4YCW A;  1ET6 A;  1PRT B;  4C3J H;  3P1H A;  2F0G A;  4YRP A;  1O7Y A;  1VQA A;  4XQN A;  1X6O A;  3A74 A;  1PHJ A;  3VDY A;  1NY4 A;  5C0X G;  1MD2 D;  2RHQ A;  5IYC G;  5IOC A;  1GUW A;  4FO2 A;  1TY0 A;  1HNX L;  2EAY A;  3CMQ A;  4IOA A;  4FF2 A;  3MZ5 A;  4DR5 L;  5EPK A;  2ZIM A;  3HOW B;  1EU3 A;  4YIJ A;  1W6J A;  2C8M A;  2Q2U A;  5JEA J;  1IBM L;  4DR1 L;  3F1Z A;  5JVH 3;  3SK6 A;  4L87 A;  4XTC S;  1CZW A;  3ERR A;  2NVT H;  3SE0 A;  3I55 A;  2PNR C;  3EJI A;  1E1O A;  4RKB A;  5IGG A;  5C4X B;  2SNM A;  2OEO A;  3S1Q B;  3HXX A;  4UHV A;  3CCQ A;  3HOY H;  3MXP A;  5M3F H;  2EJG A;  4E51 A;  3GTQ H;  2F0M A;  4WRD A;  1XJV A;  4TKO B;  4OIK A;  4QIW B;  5COR A;  5DM7 3;  1N33 L;  3K0X A;  4ZUJ A;  4DUZ L;  3RLF A;  1GUS A;  5CV9 A;  1D7Q A;  3UI2 A;  4DR2 Q;  1VQH A;  3EFX D;  1XTD A;  1R4Q B;  4YRK A;  3J7A 5;  4DAY A;  3KBX A;  4NXM L;  4YP0 A;  3GQB A;  1A62 A;  2B63 G;  2F3I A;  4LFA L;  1CQF A;  2VY3 A;  2Y0S E;  3MQZ A;  5K1P A;  1JWS D;  5T1I A;  1PYS B;  2DY7 A;  4DNI A;  4YWM A;  1F2M A;  1XXG A;  4LNS A;  2PZW A;  4XTU A;  4TTV A;  1SE2 A;  4XU2 A;  4IO9 A;  4MNO A;  1ENC A;  2UUB Q;  1Z47 A;  1TU2 B;  2ZTD A;  2F0J A;  1LM0 A;  3X3N A;  5C0X I;  5AJ3 L;  2DTI A;  4A3C G;  2JQO A;  4QCL A;  1P8L A;  2LXJ A;  4RHS A;  3PIO 3;  1I50 B;  2Q2I A;  1MKH A;  4KI0 A;  4DF7 A;  5M3M H;  1F2L A;  1YNJ C;  2H1E A;  2M2L A;  2MO0 A;  1PV4 A;  1B7Y A;  1Q7Y C;  1BIA A;  2BH2 A;  5C4J H;  1AZP A;  4BXX H;  1VQ6 A;  4YHH Q;  4RAU C;  5CBE E;  2MJ8 A;  4H2U A;  2EYF A;  1H4Q A;  1NJ2 A;  1DJR D;  2G9D A;  3MVV A;  2HHH L;  4JV5 L;  4WF2 A;  4DGZ A;  2NVY B;  2EIF A;  1PRT F;  2D62 A;  4C3H G;  4A3M G;  4OXP A;  1N34 Q;  2L4N A;  4DAP A;  3I72 A;  2K05 A;  1Y1V G;  2Q8I B;  1XX8 A;  3A8K E;  4BS9 A;  2ZXP A;  4UDU C;  1H9R A;  2B29 A;  1N36 L;  1N32 L;  1Q3L A;  3AFP A;  3PUZ A;  4JPB W;  1RTN A;  2K14 A;  4HJA A;  2ZT5 A;  3PO3 G;  2Z8L A;  3R2I A;  3NBH A;  3W2D A;  3DWA A;  1LO5 D;  1DM0 B;  4DUY Q;  5JPM C;  2A69 D;  1EWI A;  5IT9 c;  1A3V A;  5FO8 B;  5KGU A;  4MIU A;  1CI3 M;  3F2C A;  2CJA A;  2L0C A;  2Y0S G;  3P8V A;  4IPG A;  1V1P A;  4JI5 L;  1C0A A;  4QMG A;  4DV3 L;  3HOX B;  3H0G H;  3GV3 A;  1PFM A;  1QF6 A;  5I2Y A;  1RHP A;  4C3I G;  1SSO A;  1XPU A;  1V8Q A;  2E2H B;  4R4O A;  2WII B;  1WTP A;  1S5C D;  4GOP A;  1USY A;  3HFV A;  1GJX A;  4FXD A;  4EVO A;  5IY0 A;  3HRI A;  3I4M H;  5JEA H;  1V1Q A;  4X62 Q;  4DR6 L;  3IKM B;  3HFZ A;  1VQ9 A;  2K04 A;  1W3S A;  2K32 A;  3E9H A;  1Y1W G;  4XTV A;  3S14 H;  2ODR D;  2NYZ D;  1OXT A;  4PZ7 A;  1SNP A;  3GO5 A;  1WQW A;  2ALY B;  4GKK Q;  2YU9 B;  4CDE C;  1F2Y A;  4KJO A;  4JI4 Q;  2QW7 A;  1M8A A;  4BBS G;  4RMF A;  3SGI A;  4FF1 A;  1QE0 A;  3NEL A;  5C3E B;  1CHQ D;  4H2W A;  4GS3 A;  3S1M H;  3GTJ H;  4HAE A;  3RN5 A;  4RHR A;  2F0S A;  3EIV A;  2BE5 D;  2Q7G A;  4HED A;  2R7F A;  4NMZ A;  2E65 A;  3HZX A;  1SER A;  1SDF A;  1HFN A;  3HOU G;  1YJW A;  1D8L A;  5BR8 Q;  2F0T A;  1N9W A;  3I4O A;  4KHZ A;  4A3K B;  3V05 A;  3S17 B;  4K8J A;  3UH0 A;  4LUZ A;  2VQE Q;  1U4M A;  2EY2 A;  2I5M X;  1LTI D;  3KF6 B;  4KQE A;  1BOS A;  4IUV A;  5ELN A;  5C4H A;  1FYC A;  2XWB B;  3CKI B;  4ABN A;  4A3D G;  4ZKB B;  3OMG A;  2R7Z B;  1WQ7 A;  2F0N A;  2CJ9 A;  3TRZ A;  2KHS A;  3HS0 C;  1X3G A;  2QA4 A;  2Z4I A;  1WTH A;  3IG2 A;  4X65 L;  4IUT A;  2K5Q A;  1JJG A;  2I5L X;  2AQ1 B;  3BZK A;  1SMX A;  3A7A A;  4B08 A;  3T1H Q;  3NPP A;  1SRU A;  2PMZ B;  2I07 B;  4E6I A;  2DKG A;  5E4W C;  4KJN A;  3HOU B;  1EQR A;  1LT4 D;  4ZAI A;  3H94 A;  2EJ9 A;  2EXZ A;  3M4O B;  4H02 A;  1VF7 A;  3DSQ A;  4KV6 A;  3WWV A;  3ERS X;  1XMQ Q;  3PO2 B;  5M5Y H;  1U5K A;  4YRM A;  3HY0 A;  4J15 A;  1QOH A;  1DOM A;  1RDP D;  2DZC A;  3CP0 A;  3K8A A;  5E4X A;  5FK9 C;  3TRE A;  2E76 C;  4DA2 A;  1PTO C;  4A3D B;  1X01 A;  1HR0 Q;  4ZYS A;  3LGJ A;  4DV1 L;  1B53 A;  3PF5 A;  4P71 A;  3JC6 6;  4KD3 A;  2J3M A;  5C5M A;  3VR4 A;  3BFM A;  4BBR H;  5D14 A;  1H9J A;  4B3R Q;  4C3J G;  1HA5 A;  5ELO A;  3GTO H;  1NNX A;  4A3F G;  3KLW A;  4HA8 A;  3BS1 A;  4KN7 C;  4QL5 A;  3OIP A;  4RGM A;  1BQQ T;  3U9S A;  1XMO L;  2E2J B;  1TY2 A;  3VQX A;  2J0T D;  2K6A A;  2RA4 A;  5IGC A;  3PMF A;  4ULL A;  1ILQ A;  5FLX c;  3ICA A;  4YRF A;  2F0K A;  5DEH A;  4QUF A;  1PTO B;  1PYW D;  3CQZ H;  4CH4 A;  1OO9 B;  2NTT A;  3K6O A;  3VQV A;  3H91 A;  1HRJ A;  4YRO A;  4MN3 A;  2A5H A;  1KLU D;  2OTL A;  1QE6 A;  1TWA B;  3CCS A;  3EFS A;  3CCR A;  1PFN A;  2B3G A;  1QG7 A;  1S5E D;  1DXM A;  4A3L G;  3GP7 A;  4EX5 A;  4LK1 C;  3HOY G;  2EY5 A;  3LWU A;  1Q1B A;  4CH6 A;  2K75 A;  4IFD I;  1HA6 A;  5LMU Q;  2SDF A;  4P74 A;  4JI2 Q;  2EYL A;  3CC2 A;  4GZY C;  1ROD A;  2JJQ A;  3F2B A;  2F3W A;  2HCC A;  4HCS A;  2DU7 A;  4B3T Q;  1ONL A;  1EYA A;  5ELF A;  4A3F B;  1E2W A;  3VA5 A;  5C53 B;  5C4X H;  4ZKC B;  4LFC Q;  3S1Q H;  1VQL A;  4APV A;  2ZIN A;  2BDO A;  1EYD A;  4IUQ A;  4MTN A;  5FKA C;  3DEP A;  1QUQ A;  2M00 A;  1MJC A;  3FHW A;  1JMC A;  1HZB A;  4JI3 L;  5FLM H;  1LTL A;  5EGT A;  2EL9 A;  5EPJ A;  4WFN 3;  4FXK C;  1FL0 A;  1O78 A;  1HPC A;  3RR5 A;  1VDZ A;  2NN6 I;  4P75 A;  2UXC Q;  2O2L D;  1TR5 A;  1Q86 C;  3J80 c;  1IL8 A;  2IPK D;  2ZTC A;  4KY5 A;  4K6L A;  1JJC A;  5K5P A;  4KY6 A;  1A0I A;  3M7N A;  4ZUI A;  1VQP A;  2VQF Q;  4R4Q A;  1L1O C;  1EOT A;  5KIX A;  3S2H B;  2UXB L;  5IGD A;  4GLX A;  5JJI A;  4HIK A;  4S3S A;  2IX0 A;  4J1M A;  5E7N A;  4DR3 L;  1O7I A;  1KRT A;  4K0K L;  3G71 A;  5IT9 E;  1DD2 A;  4H2X A;  1YNN D;  2K5N A;  2B2V A;  1NBW A;  1SFO B;  4L8J A;  1HTT A;  5M5X B;  1I94 L;  4DV0 Q;  4X6A H;  3H09 A;  4YYE A;  2NWG A;  5JJZ A;  1X3P A;  2R93 H;  4LF4 L;  3K80 C;  3HKZ E;  4A93 H;  3M3Y B;  3PCO A;  3I73 A;  2F52 A;  2NVY H;  1SMY D;  2I4N A;  4NW2 A;  5IWA Q;  5IYD H;  3FJP A;  4G84 A;  4U68 A;  1TT2 A;  3ULJ A;  4LVK A;  1VQK A;  1RIP A;  3L3O C;  4XU3 A;  3UGQ A;  4HID A;  2R6G A;  2JA6 H;  2K28 A;  3KLS X;  2IL8 A;  2AWO A;  1O7L A;  3I4N H;  2SNS A;  1ADJ A;  1KAW A;  1ZEQ X;  4HWP A;  1Z7N A;  4B3M Q;  2HT1 A;  5FOB B;  1PMR A;  4JI6 Q;  1SAP A;  4Q6G A;  4YWK A;  1KMN A;  2E2I B;  3LX0 A;  4ZQ3 A;  1JE5 A;  1LUZ A;  4CS4 A;  3CF5 A;  1VQM A;  4A3G G;  1G6P A;  1KRS A;  3LNN A;  3K5M A;  3AYH B;  3HOX H;  3CRK C;  5JAV A;  2A8V A;  1G51 A;  1KQS A;  3FEW X;  4K14 A;  3MEH A;  3QO5 A;  1RD9 D;  2L15 A;  1YFT A;  1ZYR C;  1GOZ A;  1EIG A;  2F0L A;  4RFB A;  4O1N A;  1L0W A;  2AKW B;  2R92 B;  1KAA A;  1PFB A;  2QKI C;  2G4C A;  1ZXT A;  4QGU A;  4YRL A;  4YRR A;  1E24 A;  1OXS C;  1IBK Q;  2E8G A;  3NQI A;  3OSO A;  4JOI A;  4CJ2 C;  4PMC A;  3I2Z A;  1YB3 A;  4CH3 A;  2RDF A;  3PUW A;  4AYB E;  2KCM A;  4ZK9 B;  1KHI A;  3M9B A;  1GO3 E;  1TWC B;  4DAY B;  1LAB A;  2ZR2 A;  4JYA Q;  1PH3 A;  1KTK A;  5A35 A;  1S5B D;  1NYR A;  2JE6 I;  3T13 A;  4G7Z C;  2PCF B;  3A56 A;  4P2C B;  2Z9H A;  4PMB A;  1JJ2 A;  2UUA L;  1K8O A;  3PF4 A;  2YU9 H;  4HSV A;  2EYM A;  4RQE A;  3ER0 A;  1UE6 A;  2MO1 A;  4GLV B;  3JAM i;  3NWS A;  1YFS A;  2F0V A;  3HXY A;  5C3E H;  2UXD Q;  4L6T B;  2TMP A;  1VQ7 A;  4DV2 L;  3OHX C;  4C2M B;  1SJE D;  2ENB A;  1B7Y B;  2QHS A;  1IKL A;  1EY7 A;  4GN5 A;  3V7S A;  3VA7 A;  2Z6K A;  4FDB A;  4A3K H;  4XXE A;  1XNR L;  2JA8 G;  4XU0 A;  3S17 H;  2KOL A;  1IYJ B;  2IWH A;  4YRE A;  2ASB A;  4AQY Q;  1WTO A;  3GTP B;  3L1A A;  4OEM B;  1B4O A;  4HJ9 A;  1S72 A;  3HOV G;  4HVC A;  2C5C A;  2M9V A;  2WB1 G;  1GUO A;  3K58 A;  2R7Z H;  4NXN L;  4PZ8 A;  2LY7 A;  1AP0 A;  1EY0 A;  1QVF A;  3C46 A;  2JA7 B;  2EJF C;  3OTO Q;  2ZXF A;  4A3B G;  4BY1 G;  2O5I C;  4AYB G;  4DFA A;  2ZTE A;  3EA6 A;  2OF1 A;  4G57 A;  4ZCK A;  1Z7M A;  3AU7 A;  5L37 A;  3HRK A;  3PGZ A;  4IQZ A;  4L63 B;  4OO1 H;  4IJL A;  1HNW Q;  2ID0 A;  2PQA A;  4BA1 I;  4B3S Q;  4RA8 A;  5E1F A;  4O0A A;  1QVG A;  3KDF A;  2CH4 A;  4YRN A;  1I4P A;  3DEO A;  3V7C A;  4RQF A;  2LS0 1;  2LMC B;  5FLX E;  2F0H A;  4KHP Q;  1HUM A;  1KNA A;  1U4L A;  4CJ0 B;  1LAC A;  3M4O H;  4I65 A;  4TVY A;  1PH7 A;  2Q7E A;  2ZJP A;  1R9T B;  1CHP D;  4YRT A;  4TQD A;  4XT1 B;  1Y8O B;  1RIQ A;  3PO2 H;  2A8E A;  5K1X A;  1TS5 A;  1M90 C;  1BCP D;  4GKJ L;  2CQO A;  2QDL A;  1E2Z A;  3E3X A;  1WTR A;  1B70 A;  4KR2 A;  3L9A X;  3MC0 B;  1MSG A;  5CV6 A;  3HFZ B;  4IPD A;  4HTH A;  5M5W B;  4NB3 A;  4K5X A;  2RCF A;  4K6D A;  3STB C;  3I3C A;  3JAM c;  3G48 A;  3P20 A;  1AZQ A;  4JBK A;  1SYE A;  2KEE A;  4P72 A;  4LWC A;  2QGQ A;  3OW7 A;  1JC7 A;  5KRU A;  3LSS A;  4OLF A;  2JSO A;  2PPB C;  4HMI A;  3CC7 A;  1CQV A;  5DM6 3;  1EFW A;  1B2T A;  3NTK A;  1W6K A;  3I4L A;  3TP8 A;  4CGY B;  3A5Y A;  1BR9 A;  1IW7 C;  3CPF A;  2JXM B;  3DWQ A;  4XYQ A;  4R8I A;  3ND8 A;  1PTO H;  3U9O A;  3U4Z A;  4UAI A;  5GAD C;  1K3R A;  4N8X 1;  1BXT A;  1NJ8 A;  1D1I A;  2EXD A;  5E3F A;  2N55 A;  4C1N K;  3K5O A;  3KLR A;  3C1E A;  3A54 A;  12AS A;  1QNU A;  4HWS A;  5KYI A;  1WYD A;  4K87 A;  2PZT A;  4EQO A;  3A8I E;  4KKT A;  2PNH A;  3RZO B;  2FMM A;  2QIL A;  3F2D A;  1Z6H A;  4ME3 A;  3AMU A;  5C44 B;  3FRP B;  3J80 E;  2I0Q A;  3EBE A;  3LSQ A;  1FD7 D;  2N49 A;  4DR7 Q;  4MHE A;  4V0B A;  2QHV A;  1WNL A;  3PQI A;  3GTL B;  1G8Z D;  1PLF A;  2FIN B;  3FMC A;  5KND A;  2AMC A;  2FMC A;  1FYF A;  4DV7 Q;  4DK6 C;  1G91 A;  5DNF A;  3CCL A;  3K59 A;  4IPC A;  5I4D A;  2AUK A;  1HNZ Q;  1DYQ A;  2ZZE A;  4PHC A;  5FO7 B;  3A7A B;  2UUB L;  1B1Z A;  1E1T A;  2FYK A;  4KN4 C;  4L5R C;  1EUJ A;  4DXF A;  1IKM A;  4QJF A;  4GNX C;  2DVE A;  4H13 C;  5CC4 A;  1LV9 A;  4WJW A;  2JA5 G;  3KLS A;  3A7U A;  3K5N A;  4JI8 L;  4O42 A;  2Q8T A;  2L5T A;  1T5E A;  4R4I A;  3Q8D A;  2R3Z A;  3OWE B;  1K83 B;  2ZT7 A;  1K8M A;  1H4T A;  1WCM G;  1ENA A;  4XDX A;  5LHY 1;  3G7L A;  2QHT A;  3ITP A;  2F03 A;  4CHT B;  2DJF C;  3KF8 A;  2EZV A;  1TVX A;  4A93 G;  2KCC A;  3S2H H;  1LLR D;  2SOB A;  1N34 L;  4GNX B;  1U9R A;  1T5X D;  1C9O A;  3BU2 A;  1PH5 A;  4BWG B;  1ENF A;  5EPL A;  3RZD B;  1IBM Q;  3FP9 A;  4DR1 Q;  2VUM H;  4X66 L;  4YY3 L;  3SR1 A;  5K36 G;  1E7Z A;  3RIR A;  3FPU B;  2JA6 G;  1PH6 A;  2D0P A;  5M5X H;  3I4N G;  4LF5 L;  1NJ1 A;  4GLA C;  4ZRZ A;  4JC0 A;  4P74 C;  1XWE A;  3M3Y H;  1MSH A;  3MFY A;  2NZH A;  4FF3 A;  2DUD A;  3AQQ A;  3J7Y W;  5J22 A;  4DUZ Q;  3S15 B;  3MXN A;  1FR3 A;  1NSN S;  1SLJ A;  2NVX B;  3RAC A;  4KKU A;  5C3W A;  4CDD C;  3MF1 A;  2B63 B;  4NPS A;  2B2T A;  4NXM Q;  2BDN A;  2LXK A;  4LFA Q;  4EQ5 A;  3HOZ G;  1WOC A;  3PUV A;  1EY4 A;  2E2I H;  3UDG A;  2E74 C;  2IHE A;  4RWS C;  5AJ3 Q;  4TVA A;  2ZTG A;  4LVL A;  1JIC A;  2KED A;  4HN7 A;  4XIG S;  2X69 A;  2A6E D;  5DLQ E;  1EFI D;  4PV1 C;  2F0O A;  3HP3 A;  2E1H A;  2HIX A;  3T4A C;  2EPB A;  1TWF B;  2PQE A;  5J39 A;  3SDZ A;  3S2D B;  3RUX A;  1G29 1;  4PZ6 A;  3D31 A;  3ONA B;  4O2D A;  3L4G A;  3I8Z A;  4R4C A;  2R92 H;  2NVQ B;  5AFW A;  1KOG A;  5G3L D;  4A4I A;  4C3H B;  1PRT D;  3I90 A;  4A3M B;  1WJJ A;  4JV5 Q;  1DON A;  1BBU A;  3P7J A;  2IY5 B;  1XNQ L;  2J3L A;  1CKN B;  1EQT A;  2ZCE A;  1MGS A;  2E64 A;  2YTX A;  1F9P A;  1Y1V B;  4A3E G;  4JG2 A;  5IGF A;  5IE8 A;  1QZG A;  3GV6 A;  2CFM A;  3W1G A;  3TSS A;  2HCI A;  3L0O A;  3OIQ A;  1KL9 A;  5BR8 L;  1STG A;  4P73 A;  1N36 Q;  4K2L A;  3PO3 B;  1N32 Q;  3SK8 A;  3R3O A;  3IL8 A;  4TSS A;  1LTA D;  1HQR D;  4PMW A;  3VR6 A;  4ZIB A;  2ZT9 C;  1PDQ A;  1GKH A;  2PYK A;  3TME A;  2PW5 A;  2J4X A;  2J7Z A;  2Y0S B;  3S1N B;  2CVR A;  1G2T A;  3J81 j;  4HR7 B;  2N78 A;  3GTM B;  1G6Z A;  5I6Y A;  4C2M H;  4A3I G;  4F7X A;  2D0O A;  2CW0 C;  4BY7 G;  4C3I B;  1M4V A;  4KMU C;  1EYC A;  2ARU A;  1C7Y A;  1STH A;  4HIO A;  3G6J B;  1EY5 A;  1X54 A;  3FPP A;  4DXG A;  5LL6 S;  2FFK B;  4Q0F A;  3GTP H;  3TS0 A;  4LVJ A;  2DTO A;  3KK7 A;  1E0B A;  3NUC A;  2XVS A;  2IX1 A;  1C48 A;  1FGU A;  5J3B A;  5ELD A;  2OQ0 A;  2EQS A;  4DR6 Q;  4J6H A;  1Y1W B;  1A8V A;  1Z9F A;  5IP9 G;  4QQB X;  2DNE A;  1K0R A;  2JA7 H;  1X65 A;  1VF5 C;  1SXT A;  1XMQ L;  4HCE A;  2UU9 Q;  5F5W A;  2JN4 A;  2JK8 A;  3I91 A;  3JAM E;  1V43 A;  5EKI A;  2I46 A;  2B2U C;  5A2Q E;  4BBS B;  2G5D A;  4H7B A;  5C0X J;  4DAV A;  5CV5 A;  3BZD B;  5GAE C;  2KQ3 A;  4L5T A;  3F8T A;  1BUV T;  4QUC A;  4X64 L;  2ZXR A;  4A3I B;  4V19 0;  4FNF A;  1K8A C;  2RKS A;  3RKW A;  4JI0 L;  1VQN A;  3TP6 A;  4B3R L;  3PIP A;  1Y14 B;  3T53 B;  3NTH A;  1CA5 A;  1R9T H;  1X56 A;  1JOO A;  4HJ5 A;  3H15 A;  4F88 A;  1GM5 A;  2K50 A;  3M4Q A;  3UDF A;  2D9U A;  3MA2 B;  1MIU A;  1YNJ D;  1F9R A;  2F0E A;  4RCO A;  11AS A;  5FJ8 G;  2R7D A;  1FNU A;  4Y7N B;  4J8Q A;  1EEF D;  5M5W H;  3VYU A;  4RGT A;  2CQA A;  3QOJ A;  3J80 i;  4K5V A;  4QY7 A;  1W66 A;  1YGB A;  1O80 A;  2F0F A;  1FJG L;  4IN3 A;  2P5Z X;  3FDT A;  1H9M A;  4A3J H;  3ICE A;  2WKD A;  3FKI G;  1A15 A;  1EVL A;  2YTV A;  3D4W A;  3QWN A;  1UE7 A;  5GAG C;  5EKK A;  5IYB H;  4MZ9 A;  4NDX A;  4X65 Q;  3QO7 A;  5LMU L;  1I6H B;  1AN8 A;  1BDO A;  4WJ4 A;  3DWP A;  3HXW A;  1EZ8 A;  2MUY A;  2F0Q A;  1W2B A;  3NWT A;  1HZC A;  5IP7 H;  2A68 C;  5GRO A;  3G6E A;  5CYU A;  3CCM A;  1YI2 A;  2E41 A;  3U50 C;  3V7R A;  2FXQ A;  4I7A A;  1WTW A;  4RGO S;  3M85 A;  1EY6 A;  1II3 A;  2GA4 B;  1U0L A;  1AH9 A;  1HZ9 A;  1C8C A;  4DV5 Q;  3RZO H;  3TP5 A;  4CH5 A;  1K8G A;  5M3F G; 
#chains in the Genus database with same CATH homology
 5C51 B;  5C44 H;  1PVO A;  3HOW H;  4DV1 Q;  3GD7 A;  3GTL H;  2UXC L;  2OTJ A;  3ULL A;  3UFG A;  4ZTZ B;  3H3V I;  2PQA B;  2Q2H A;  4LF8 Q;  4L5Q A;  2K52 A;  3KDF B;  3EFR A;  1EIY B;  4ZTU B;  1J5W A;  2CWP A;  4HJ8 A;  1NTG A;  3TUP A;  5M3M G;  1H4S A;  2VUM G;  2DDZ A;  1K83 H;  1OXV A;  2KBN A;  4DV0 L;  4HWR A;  5IYC H;  1BVS A;  4LNQ A;  1B70 B;  1V9P A;  4BXX G;  4HIM A;  1HH2 P;  1VCI A;  1YJ9 A;  4IPH A;  1WU7 A;  5IWA L;  1VQE A;  3G1Z A;  1J5E Q;  1I50 H;  3RZD H;  3WQZ A;  4K86 A;  1YZ6 A;  1YBY A;  3PIO A;  4B3M L;  4JI6 L;  2ALY A;  4DV4 L;  2P0L A;  3MEF A;  3ULP A;  2A1A A;  4JI3 Q;  3R07 A;  3S15 H;  1MJE A;  4DV6 Q;  2NVX H;  3QO8 A;  4LFB Q;  3NET A;  3H0G G;  4LF7 L;  2CJB A;  4A76 A;  3D0F A;  1VQD A;  2RHQ B;  3MF2 A;  1VQ5 A;  4G85 A;  2DU5 A;  1SR3 A;  1IBK L;  2F4V Q;  4A3C H;  1OXU A;  5JEA G;  3I4M G;  2ZM6 L;  1YNX A;  3B6Y A;  4DR3 Q;  2CKZ B;  1VQI A;  3L7Z C;  2ES2 A;  3CCV A;  3VBB A;  3S2D H;  2E2H H;  1I94 Q;  3A5Z A;  5C52 B;  3VQY A;  3OD1 A;  4C3H H;  2UXD L;  4LF9 L;  4A3M H;  2C7I A;  4XTW A;  1UE5 A;  1M1K C;  4AIM A;  3TEH A;  4BWA A;  1Y1V H;  3RF1 A;  2UUC Q;  1VQZ A;  2JEB I;  2ZZG A;  3HKZ G;  3PO3 H;  2WAQ E;  2RF4 A;  4IFD J;  1SES A;  1LYL A;  3PV0 A;  4OON A;  3KJP A;  2Q2T A;  2QEX A;  4JCV E;  1WPY A;  3GTM H;  4LUV A;  5LMN L;  1NNH A;  4UY8 C;  4JI7 Q;  3UGT A;  4C3I H;  3OTO L;  3T1Y L;  2KHI A;  3QNE A;  4DR4 L;  1HNW L;  2Z0S A;  2RHS A;  3PZC A;  2ZZF A;  2OCE A;  1X2G A;  1S3O A;  4X5O A;  1VS0 A;  4WI1 A;  1Y1W H;  1IBL Q;  4XU1 A;  4AH6 A;  3NBH B;  4OX9 L;  3J81 i;  4GOP C;  1G5H A;  1USY C;  3V8K A;  1YEZ A;  2UUA Q;  5HGQ A;  4HWO A;  3G4S A;  1H4V B;  3J7Z C;  4BBS H;  2DZ9 A;  3TQY A;  2WP8 J;  4YCV A;  2WAQ G;  2ART A;  4YPF A;  1CSQ A;  2ZNJ A;  4LF6 L;  4YCU A;  1H95 A;  4DV2 Q;  1Q1E A;  3UE0 A;  3K81 C;  3HOU H;  2BA1 A;  3HKS A;  4A3J G;  4BBR G;  3L4G B;  4JI1 L;  4GOP B;  3L2P A;  4Y52 H;  4QIW E;  2E10 A;  3P8Y A;  2C35 B;  2Q5H A;  2E5L Q;  2CIM A;  4KR3 A;  2MNA A;  4A3D H;  3V8J A;  2YYZ A;  1Q8K A;  4NXN Q;  1E22 A;  1YVC A;  2Q7H A;  3REU A;  5HY6 A;  3UE1 A;  3W1B A;  3V8L A;  1AE2 A;  1X2H A;  2E2J H;  1PFS A;  1VQB A;  3CXC A;  4XEO A;  1PH4 A;  1SET A;  1TWA H;  5C4X G;  2YTY A;  4TQF A;  1HNZ L;  4YRC A;  3W5O A;  4GKJ Q;  1AE3 A;  2GVB A;  3J81 c;  1L1O A;  2ODR C;  3NEM A;  5FLM G;  4HT4 A;  1SN8 A;  4DR2 L;  2VW9 A;  2NS6 A;  4A3F H;  4POF A;  3RLO A;  4PG3 A;  4YWL A;  1IL2 A;  4DPG A;  2H5X A;  3A32 A;  4JBW A;  1DGS A;  2ARS A;  2MFI A;  4P71 C;  3IRB A;  3I56 A;  1HXD A;  2I4M A;  2HQL A;  4A3L H;  5GAH C;  4YHH L;  2DXU A;  5GQO A;  2AKW A;  2OQK A;  1VQO A;  1HNX Q;  2R93 G;  2LSS A;  1WLE A;  2XTI A;  4DR5 Q;  3S24 A;  2V1C C;  2CWA A;  5IYD G;  1ADY A;  4HWT A;  2ZT8 A;  3ZJY C;  1SFO H;  1G5I A;  1S40 A;  4DUY L;  3CMA A;  4JBM A;  1K73 C;  1Q46 A;  3CAM A;  1N33 Q;  3HOX G;  3K7A H;  4JI8 Q;  2PME A;  4LVM A;  1UEB A;  2CCZ A;  1NYQ A;  1PA6 A;  1QVC A;  2QHU A;  4BA2 I;  2K5H A;  2RCN A;  2BA0 A;  4X62 L;  4UP7 A;  1XPO A;  1ASZ A;  4YRI A;  3PUY A;  4P75 C;  4X66 Q;  4YY3 Q;  2I4O A;  3CD6 A;  1QZH A;  3STB D;  4GKK L;  4OWX B;  4LF5 Q;  4DAM A;  1SE8 A;  2PMZ E;  1QUQ B;  3HTZ A;  4JI4 L;  2I4L A;  3A31 A;  2HHH Q;  3PUX A;  5C3E G;  1JT8 A;  1JB7 A;  5JJK A;  1TWC H;  2GN5 A;  3KFU A;  1SRO A;  3M4P A;  2EJF A;  5EAY A;  1CKO A;  3RKY A;  1JJC B;  3AEV A;  1YHB A;  2KHJ A;  4A3K G;  2VS1 A;  2VQE L;  4H2Y A;  4TVW A;  4A3G H;  4DKA C;  4JI5 Q;  4DV3 Q;  4H2X B;  1PH1 A;  2R7Z G;  2KEN A;  2UU9 L;  2DEQ A;  1Q82 C;  4LVI A;  2I5H A;  2IHF A;  1BIB A;  5LMN W;  3PCO B;  3A5U A;  4L5S A;  4OO1 G;  2DJZ A;  2HNI A;  3T1H L;  3IAL A;  1XNQ Q;  4LW1 A;  4YRQ A;  1EQQ A;  4RG1 A;  1PH8 A;  3U4V A;  1NJ6 A;  3W3S A;  1Q81 C;  3PO2 G;  1I3Q H;  3EN2 A;  4LUO A;  4JOI C;  1HC7 A;  3RGL A;  1HR0 L;  4P3N A;  4CS2 A;  4YDQ A;  1YIT A;  2JA8 H;  4XTY A;  3A5Z B;  1FVI A;  1RL2 A;  1UE1 A;  2KCT A;  3TEH B;  3HOV H;  2WFW A;  4XTX A;  2ZIO A;  4IJH A;  3S16 H;  4OO1 I;  2ATW A;  4EO4 A;  4IFD G;  4A3B H;  4BY1 H;  2Z6K C;  4POG A;  4DV5 L;  2PI2 E;  4BW9 A;  1IZ6 A;  4UP9 A;  1PYS A;  4JI2 L;  4Q15 A;  3K7U C;  2MQH A;  4X64 Q;  4GNX A;  4B3T L;  1HJP A;  1BBW A;  1YHA A;  5E3I A;  4YRJ A;  4JI0 Q;  2E3C A;  4TWA A;  4LFC L;  1X9N A;  1CUK A;  4H2T A;  4LF8 L;  3E9I A;  1K9M C;  2RHS B;  4R1J A;  1VQF A;  1L2F A;  4OWT B;  3AFQ A;  3RL6 A;  2K5V A;  2NN6 G;  1NMF A;  3CCU A;  3RN2 A;  2ZT6 A;  1FJG Q;  3NEN A;  3P8T A;  2JEA I;  1E3P A;  3A7R A;  4HJ7 A;  4A75 A;  1XMO Q;  3HXV A;  2VQF L;  1YFR A;  1A63 A;  1YHQ A;  1J5E L;  1KXL A;  4P72 C;  2IT1 A;  4P3P A;  3QTC A;  1B8A A;  4ALP A;  2ZJQ A;  1X3F A;  3BZC A;  4UP8 A;  3HY1 A;  4H2S A;  3OW2 A;  4NCX A;  2JA9 A;  2E5A A;  2IY5 A;  1SRY A;  1CKN A;  4DV6 L;  4LFB L;  1YIJ A;  3IKL A;  3RNU A;  5JJL A;  1GVP A;  1KC8 C;  3MEY A;  2F4V L;  3REX A;  4GN3 B;  3TS2 A;  2P5I A;  1ASY A;  2JA5 H;  2A19 A;  4R4T A;  3GDE A;  3PSI A;  3HXU A;  3KJO A;  2B63 H;  4YRG A;  2BH8 A;  3RLN A;  1WCM H;  1EVK A;  5H1S E;  2R92 G;  4OWW B;  1L1O B;  2DTH A;  2HIV A;  1CSP A;  2VL6 A;  2UXB Q;  3KF6 A;  1BKB A;  4GN4 B;  1WFQ A;  2PMF A;  2K4K A;  1KD1 C;  2UUC L;  2AMC B;  4JYA L;  1KIX A;  4H2V A;  2DGY A;  1VQC A;  2XGT A;  4K0K Q;  1N8R C;  1TWF H;  1B76 A;  3E0E A;  4P3O A;  4DV4 Q;  2NVQ H;  4LF4 Q;  3OYY A;  3GTK H;  1XPR A;  4TQU S;  1P16 A;  4DQ2 A;  4JI7 L;  2ZR3 A;  2AWN A;  1TXY A;  4LF7 Q;  3TEG A;  3S1R H;  2WB1 E;  2EWN A;  3HOZ H;  2AHO B;  3KF8 B;  4AQY L;  4IOC A;  1NMG A;  1VQG A;  2OWO A;  4DK3 C;  1EIF A;  3S1N H;  2ZM6 Q;  4OP0 A;  1GD7 A;  2YV5 A;  2N3S A;  1IBL L;  2CGH A;  4CS3 A;  1PH9 A;  2DQ3 A;  4RDX A;  2N8N A;  3DM3 A;  2JA7 G;  3CCE A;  4KLK A;  3A0J A;  4JBJ A;  3UDI A;  2NZO A;  3RKX A;  1WI5 A;  2VZA A;  4B3S L;  4LF9 Q;  3L2Z A;  4A3E H;  1NE3 A;  3CC4 A;  3MXN B;  2VNU D;  2DQ0 A;  1Q12 A;  3VQW A;  1UWV A;  4KHP L;  1VQ8 A;  1TWG H;  1VQJ A;  3BJU A;  3HXZ A;  1HZA A;  1EOV A;  2ZGW A;  1VQ4 A;  2E5L L;  4TVA B;  3LC0 A;  1OTC A;  2ZNI A;  4A3I H;  1OXX K;  5LMN Q;  1NJ5 A;  1X55 A;  3UDX A;  4BY7 H;  2Q5I A;  4P73 C;  1ATI A;  1CKM A;  3T1Y Q;  1HR0 W;  4DR4 Q;  1XNR Q;  5IYB G;  4UPA A;  4YRS A;  1NJI C;  3CME A;  4Y7N H;  2ZJR A;  5IP7 G;  4XEM A;  1EIY A;  5IP9 H;  3GTG H;  4K88 A;  3KOJ A;  2DXT A;  3CCJ A;  5KNN A;  3I7F A;  4OX9 Q;  1TWH H;  3CPW A;  3DLL A;  1I5F A;  1I6H H;  1EYG A;  1YJN A;  5C44 G;  4DR7 L;  4LF6 Q;  3HOW G;  4XTZ A;  1PYB A;  2PI2 A;  3U58 A;  1J6Q A;  4WJ3 M;  4DV7 L;  1GGM A;  4JI1 Q;  1X3E A;  3CW2 C;  3KYH C;  1T9H A;  5FJ8 H;  1IXR A;  1PH2 A;  1KMM A;  2GVA A;  3H3V H;  3FKI H;  4YCW A;  4C3J H;  4YRP A;  1VQA A;  1X6O A;  3A74 A;  1PHJ A;  3VDY A;  1NY4 A;  5C0X G;  2RHQ A;  5IYC G;  2EAY A;  1HNX L;  3CMQ A;  4IOA A;  4DR5 L;  2ZIM A;  2C8M A;  2Q2U A;  5JEA J;  1IBM L;  4DR1 L;  3F1Z A;  4L87 A;  4XTC S;  3ERR A;  2NVT H;  3I55 A;  1E1O A;  3HXX A;  3CCQ A;  3HOY H;  5M3F H;  2EJG A;  4E51 A;  3GTQ H;  1XJV A;  1N33 L;  3K0X A;  4DUZ L;  3RLF A;  1D7Q A;  4DR2 Q;  1VQH A;  1XTD A;  4YRK A;  3J7A 5;  4NXM L;  4YP0 A;  1A62 A;  2B63 G;  2F3I A;  4LFA L;  2VY3 A;  2Y0S E;  3MQZ A;  5K1P A;  1PYS B;  4DNI A;  4YWM A;  4LNS A;  4XTU A;  4TTV A;  4XU2 A;  4IO9 A;  4MNO A;  2UUB Q;  1Z47 A;  2ZTD A;  1LM0 A;  5C0X I;  5AJ3 L;  2DTI A;  4A3C G;  2JQO A;  1P8L A;  2LXJ A;  2Q2I A;  1MKH A;  4KI0 A;  5M3M H;  2MO0 A;  1PV4 A;  1B7Y A;  1Q7Y C;  1BIA A;  2BH2 A;  5C4J H;  4BXX H;  1VQ6 A;  4YHH Q;  4H2U A;  1H4Q A;  1NJ2 A;  2HHH L;  4JV5 L;  4WF2 A;  2EIF A;  2D62 A;  4A3M G;  4OXP A;  1N34 Q;  1Y1V G;  2B29 A;  1N36 L;  1N32 L;  3AFP A;  3PUZ A;  2K14 A;  4HJA A;  2ZT5 A;  3PO3 G;  4DUY Q;  1EWI A;  5IT9 c;  3F2C A;  2CJA A;  2Y0S G;  3P8V A;  4IPG A;  4JI5 L;  1C0A A;  4DV3 L;  3H0G H;  1QF6 A;  1XPU A;  4R4O A;  4GOP A;  1USY A;  3HFV A;  5IY0 A;  3HRI A;  3I4M H;  1V1Q A;  4X62 Q;  4DR6 L;  3IKM B;  3HFZ A;  1VQ9 A;  1W3S A;  3E9H A;  1Y1W G;  4XTV A;  3S14 H;  2ODR D;  1OXT A;  4PZ7 A;  3GO5 A;  1WQW A;  2ALY B;  4GKK Q;  4JI4 Q;  4BBS G;  4RMF A;  3SGI A;  1QE0 A;  3NEL A;  4H2W A;  4GS3 A;  3S1M H;  3GTJ H;  3RN5 A;  3EIV A;  2Q7G A;  2R7F A;  2E65 A;  1SER A;  3HOU G;  1YJW A;  1D8L A;  5BR8 Q;  1N9W A;  3I4O A;  4KHZ A;  3UH0 A;  4LUZ A;  2VQE Q;  2I5M X;  3KF6 B;  4KQE A;  5ELN A;  4A3D G;  1WQ7 A;  2CJ9 A;  3TRZ A;  1X3G A;  2QA4 A;  3IG2 A;  4X65 L;  1JJG A;  2I5L X;  3BZK A;  1SMX A;  3A7A A;  3T1H Q;  1SRU A;  2DKG A;  1EQR A;  2EJ9 A;  4H02 A;  3DSQ A;  3WWV A;  3ERS X;  1XMQ Q;  5M5Y H;  1U5K A;  4YRM A;  3HY0 A;  4J15 A;  2DZC A;  3CP0 A;  3K8A A;  3TRE A;  1X01 A;  1HR0 Q;  3LGJ A;  4DV1 L;  3PF5 A;  4P71 A;  3JC6 6;  2J3M A;  3BFM A;  4BBR H;  4B3R Q;  5ELO A;  3GTO H;  4A3F G;  3KLW A;  4HA8 A;  4QL5 A;  1XMO L;  3VQX A;  5FLX c;  3ICA A;  4YRF A;  3CQZ H;  4CH4 A;  3VQV A;  4YRO A;  2OTL A;  3CCS A;  3EFS A;  3CCR A;  2B3G A;  4A3L G;  4EX5 A;  3HOY G;  1Q1B A;  4CH6 A;  2K75 A;  4IFD I;  5LMU Q;  4P74 A;  4JI2 Q;  3CC2 A;  2JJQ A;  3F2B A;  2DU7 A;  4B3T Q;  5C53 B;  5C4X H;  4LFC Q;  3S1Q H;  1VQL A;  4APV A;  2ZIN A;  4MTN A;  1QUQ A;  1MJC A;  3FHW A;  1JMC A;  1HZB A;  4JI3 L;  5FLM H;  1LTL A;  2EL9 A;  1FL0 A;  3RR5 A;  2NN6 I;  4P75 A;  2UXC Q;  1Q86 C;  3J80 c;  2ZTC A;  1JJC A;  1A0I A;  3M7N A;  1VQP A;  2VQF Q;  4R4Q A;  1L1O C;  2UXB L;  4GLX A;  5JJI A;  4HIK A;  2IX0 A;  5E7N A;  4DR3 L;  1O7I A;  1KRT A;  4K0K L;  3G71 A;  4H2X A;  2K5N A;  1NBW A;  1HTT A;  1I94 L;  4DV0 Q;  4X6A H;  4YYE A;  2R93 H;  4LF4 L;  3K80 C;  3HKZ E;  4A93 H;  3PCO A;  2F52 A;  2NVY H;  2I4N A;  5IWA Q;  5IYD H;  3FJP A;  4G84 A;  3ULJ A;  4LVK A;  1VQK A;  1RIP A;  4XU3 A;  3UGQ A;  4HID A;  2R6G A;  2JA6 H;  2AWO A;  3I4N H;  1ADJ A;  1KAW A;  4HWP A;  1Z7N A;  4B3M Q;  2HT1 A;  4JI6 Q;  4Q6G A;  4YWK A;  1KMN A;  1JE5 A;  1LUZ A;  4CS4 A;  3CF5 A;  1VQM A;  4A3G G;  1G6P A;  1KRS A;  3AYH B;  3HOX H;  2A8V A;  1G51 A;  1KQS A;  3QO5 A;  2L15 A;  1YFT A;  1L0W A;  2AKW B;  4YRR A;  2G4C A;  4QGU A;  4YRL A;  1E24 A;  1OXS C;  1IBK Q;  2E8G A;  4JOI A;  3I2Z A;  1YB3 A;  4CH3 A;  3PUW A;  4AYB E;  2KCM A;  1KHI A;  3M9B A;  1GO3 E;  4DAY B;  2ZR2 A;  4JYA Q;  1PH3 A;  1NYR A;  2JE6 I;  1JJ2 A;  2UUA L;  3PF4 A;  2YU9 H;  4RQE A;  3ER0 A;  1UE6 A;  2MO1 A;  4GLV B;  3JAM i;  1YFS A;  3HXY A;  5C3E H;  2UXD Q;  1VQ7 A;  4DV2 L;  1B7Y B;  2QHS A;  4GN5 A;  3V7S A;  2Z6K A;  4FDB A;  4A3K H;  1XNR L;  2JA8 G;  4XU0 A;  3S17 H;  1IYJ B;  4YRE A;  2ASB A;  4AQY Q;  3L1A A;  4HJ9 A;  3HOV G;  1S72 A;  4HVC A;  2WB1 G;  2R7Z H;  4NXN L;  4PZ8 A;  1QVF A;  3OTO Q;  2ZXF A;  4A3B G;  4BY1 G;  4AYB G;  2ZTE A;  1Z7M A;  3HRK A;  3PGZ A;  1HNW Q;  4IJL A;  2ID0 A;  2PQA A;  4BA1 I;  4B3S Q;  4O0A A;  1QVG A;  3KDF A;  4YRN A;  3V7C A;  4RQF A;  4KHP Q;  4TVY A;  3M4O H;  1PH7 A;  2Q7E A;  2ZJP A;  4YRT A;  4TQD A;  1RIQ A;  3PO2 H;  2A8E A;  5K1X A;  1M90 C;  4GKJ L;  2CQO A;  1B70 A;  4KR2 A;  3HFZ B;  4IPD A;  4NB3 A;  3STB C;  3JAM c;  3G48 A;  4JBK A;  4P72 A;  4LWC A;  2QGQ A;  3LSS A;  4OLF A;  3CC7 A;  1EFW A;  3A5Y A;  3CPF A;  3U4Z A;  5GAD C;  1K3R A;  1NJ8 A;  2EXD A;  12AS A;  4HWS A;  1WYD A;  4K87 A;  2PNH A;  3F2D A;  4ME3 A;  2I0Q A;  3EBE A;  3LSQ A;  2N49 A;  4DR7 Q;  2QHV A;  1WNL A;  2AMC A;  1FYF A;  4DV7 Q;  4DK6 C;  3CCL A;  4IPC A;  1HNZ Q;  2ZZE A;  4PHC A;  2UUB L;  1E1T A;  2FYK A;  4L5R C;  1EUJ A;  4QJF A;  4GNX C;  2DVE A;  2JA5 G;  3A7U A;  4JI8 L;  4R4I A;  3Q8D A;  2ZT7 A;  1H4T A;  1WCM G;  2QHT A;  4A93 G;  3S2H H;  1N34 L;  4GNX B;  1C9O A;  3BU2 A;  1PH5 A;  1IBM Q;  3FP9 A;  4DR1 Q;  2VUM H;  4X66 L;  4YY3 L;  5K36 G;  1E7Z A;  3RIR A;  2JA6 G;  1PH6 A;  2D0P A;  5M5X H;  3I4N G;  4LF5 L;  1NJ1 A;  4GLA C;  4JC0 A;  4P74 C;  3M3Y H;  2NZH A;  2DUD A;  3AQQ A;  4DUZ Q;  1SLJ A;  3RAC A;  3MF1 A;  4NPS A;  4NXM Q;  2LXK A;  4LFA Q;  4EQ5 A;  3HOZ G;  1WOC A;  3PUV A;  2E2I H;  3UDG A;  2IHE A;  5AJ3 Q;  4TVA A;  2ZTG A;  4LVL A;  4XIG S;  5DLQ E;  2E1H A;  2HIX A;  3RUX A;  1G29 1;  4PZ6 A;  3D31 A;  4O2D A;  3L4G A;  2R92 H;  4R4C A;  1KOG A;  4A4I A;  4JV5 Q;  1WJJ A;  1BBU A;  2IY5 B;  2J3L A;  1XNQ L;  1CKN B;  2ZCE A;  2E64 A;  2YTX A;  4A3E G;  4JG2 A;  5IE8 A;  1QZG A;  2CFM A;  3W1G A;  3L0O A;  1KL9 A;  5BR8 L;  4P73 A;  1N36 Q;  1N32 Q;  4PMW A;  4ZIB A;  1GKH A;  3J81 j;  2N78 A;  4C2M H;  4A3I G;  2D0O A;  4BY7 G;  2ARU A;  1C7Y A;  4HIO A;  1X54 A;  3GTP H;  4LVJ A;  3TS0 A;  2DTO A;  2IX1 A;  1FGU A;  5J3B A;  2OQ0 A;  2EQS A;  4DR6 Q;  1A8V A;  1Z9F A;  5IP9 G;  4QQB X;  1K0R A;  2JA7 H;  1X65 A;  1XMQ L;  5F5W A;  2UU9 Q;  2JK8 A;  1V43 A;  5C0X J;  5GAE C;  4L5T A;  3F8T A;  4X64 L;  1K8A C;  3RKW A;  4JI0 L;  1VQN A;  4B3R L;  3PIP A;  1Y14 B;  1R9T H;  1X56 A;  4HJ5 A;  3H15 A;  1GM5 A;  2K50 A;  3M4Q A;  3UDF A;  1MIU A;  11AS A;  5FJ8 G;  2R7D A;  5M5W H;  3J80 i;  4QY7 A;  1W66 A;  1YGB A;  1FJG L;  4A3J H;  3ICE A;  3FKI G;  1EVL A;  2YTV A;  1UE7 A;  5GAG C;  5IYB H;  4MZ9 A;  4X65 Q;  3QO7 A;  5LMU L;  4WJ4 A;  3HXW A;  1W2B A;  1HZC A;  5IP7 H;  5GRO A;  3G6E A;  3CCM A;  1YI2 A;  2E41 A;  3U50 C;  3V7R A;  2FXQ A;  3M85 A;  1U0L A;  1AH9 A;  1HZ9 A;  4DV5 Q;  3RZO H;  4CH5 A;  1K8G A;  5M3F G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...