3I7FA

Aspartyl trna synthetase from entamoeba histolytica
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
535
structure length
485
Chain Sequence
QLPPVVLLKTPELVSGENFKVMPMHQSQPCYKTGLKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKEFVQFCQKISAESICDITGIVKAVEKPIEKATQQDVEIHVTSIAVVSLAEYPLPMQIEDLTFPSSVFKKQEEDIAKVKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHLTEFEGLDIEMEIVENYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartyl-tRNA synthetase
publication title Crystal structure of the aspartyl-tRNA synthetase from Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Ligase
total genus 129
structure length 485
sequence length 535
chains with identical sequence B
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i7fA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3i7fA02
5M3FG 2VUMG 4YDQA 2UXCL 1XPOA 3ULLA 3A7UA 3PF5A 1ATIA 1EFWA 1H4TA 3RNUA 1Q82C 4R4OA 4QY7A 3EFSA 4OP0A 2DVEA 5IP9H 2VUMH 2ATWA 3HOWG 4G85A 2E1HA 1IBLL 4DV1L 1YJ9A 2LSSA 3JAMc 5IWAL 3E9IA 3PSIA 3I4OA 4YWMA 2E3CA 4B3RL 3CC4A 2HIVA 1AE2A 3EN2A 4UY8C 4AQYL 4PZ6A 4A3KG 3VQWA 4K86A 1XPRA 3BJUA 3RN5A 4HWRA 3ULJA 2IX0A 3RKYA 3K0XA 2PMFA 4YRKA 4G84A 3KOJA 4CH6A 5HGQA 4P3PA 4A3GH 1VQMA 3A31A 4DV0Q 1YFTA 1ASZA 4JV5L 3FKIH 4UP8A 3IG2A 1LUZA 5LMNW 1OXXK 1DGSA 3AEVA 3I4NH 2I4OA 2BA1A 4EX5A 4OWWB 5C4XH 3HXXA 2QA4A 1X3GA 5C44G 3I4MG 3H0GG 4IPCA 4IFDG 4YRCA 4HJ9A 3M7NA 4JI4L 3EIVA 4NXNQ 2BA0A 2BH2A 2VQFL 4NCXA 2HIXA 5FLMH 1G5IA 3NELA 2R7FA 2EL9A 2ZJRA 1NYRA 4HWPA 3KYHC 4YWLA 4GN5A 4DK6C 1VQLA 1Z7MA 1EVKA 2E65A 4XU2A 1E24A 1PV4A 4ALPA 2JA8G 1Y14B 2QHVA 4BW9A 4A3DG 4JI3Q 4CH4A 1KRSA 2I4LA 4CS4A 3VQYA 4X62L 4EO4A 4XEOA 4P3NA 1X55A 1E3PA 1KHIA 3KLWA 4KLKA 1CKMA 1Q7YC 1WI5A 3ERRA 3PUWA 4HA8A 1BBUA 4POFA 3M4OH 2NVTH 3A5UA 1IYJB 1HR0Q 2I4MA 3RKWA 4NB3A 4IFDI 2ZM6L 5JJKA 3ICEA 3QTCA 5GADC 3A32A 1VQ7A 4XTXA 3HFZB 5IYBG 3VDYA 3RKXA 4P72A 1HNWQ 3WQZA 3BZCA 3UDFA 5LMUQ 1T9HA 4DV4L 4HWTA 1WQWA 1CKNA 2NZHA 3NEMA 2I5LX 4LFCL 2ZJQA 4UPAA 1CSQA 4AYBG 3RLNA 2HNIA 4DR2Q 1WCMH 1W3SA 4P72C 5EAYA 1FGUA 4YRFA 2N8NA 2MFIA 1G5HA 4BY7G 2CJAA 1EIFA 4A3FH 3HOZG 2DKGA 1LYLA 1A8VA 5ELNA 1K9MC 1CUKA 2K5VA 1JJCB 4GN3B 3K80C 1EYGA 3RLFA 4CH3A 2K50A 3RLOA 4O2DA 11ASA 3NETA 4LF5Q 1XNRL 5K1PA 4GOPC 2A19A 3HOUH 2C7IA 2ARSA 1X2GA 3PV0A 3RZDH 1H4VB 2DU7A 1WPYA 2CWPA 3GTMH 3K81C 3KJOA 2ZNIA 3GO5A 3MF2A 4RQFA 3STBC 3IKLA 1PH3A 1X2HA 2MNAA 3L2ZA 4GLAC 5IP7G 4Q15A 2P0LA 1NMGA 4A76A 3QO8A 4LNQA 2JQOA 3GD7A 4K87A 4LUOA 4LFAQ 4A3JG 1YNXA 4LF8Q 4A3MH 1V43A 4ZTUB 1PA6A 1C9OA 3F2BA 4HWOA 3S15H 4XTZA 1YBYA 3CC7A 4WF2A 4IOCA 5JJLA 3EFRA 4XTUA 5M5XH 3TEHA 2E41A 4DR7L 3MF1A 5C4JH 4A3JH 4E51A 1HZBA 1HH2P 1SLJA 3RUXA 3RGLA 1JB7A 4P71C 3TS0A 1KD1C 1M90C 2OQ0A 2K14A 2DJZA 3UE1A 1XJVA 3LSQA 1XTDA 4HJ8A 4BA2I 2R93H 4L5TA 2KENA 3OTOQ 3HXVA 2UUBQ 4YRJA 3UH0A 4DR6Q 2K52A 4MNOA 1VQBA 3KF6A 3OYYA 2WAQG 2R6GA 3HRIA 5C52B 2E64A 4HWSA 4JI1Q 3K8AA 1WQ7A 2WB1G 1YEZA 4TWAA 4GNXB 4P74C 1D7QA 2ZZGA 4NXNL 2ES2A 5E7NA 5IYCG 4KHPQ 4A3BH 4R4CA 1K73C 5ELOA 2Q2HA 4POGA 1C0AA 4ZTZB 1SESA 4A3IG 4MTNA 1VQOA 4B3TQ 4XTWA 1YIJA 5JEAJ 3M4QA 2MQHA 2EJ9A 1SROA 3HY0A 5GAEC 5IYCH 1MKHA 1CKNB 1LM0A 2R7DA 2VL6A 1USYC 3IALA 4KHZA 5IE8A 4JI3L 1K83H 3CCJA 4TTVA 1V9PA 3KFUA 3CW2C 1S40A 5GROA 1WYDA 1UWVA 4YY3Q 1EVLA 4BXXG 4P73A 1RIQA 4QGUA 4YREA 1ASYA 2E5AA 3S1NH 3T1HQ 2ZR2A 3CCLA 1HR0L 1BVSA 1IBKQ 2UU9L 3I56A 3VQXA 2PI2A 1PYSA 4BXXH 1Y1WG 2ZR3A 4IPGA 4LFBQ 3I55A 3GTPH 4OO1G 2DEQA 1VQ8A 1JMCA 3RACA 2AWNA 5LMUL 2DXUA 1SN8A 1Z47A 1JJ2A 1QVCA 1NJIC 2OWOA 1VQZA 4GN4B 4GS3A 4BBSH 5C51B 2E10A 1SRYA 4JI2Q 1M1KC 2B3GA 2HQLA 2DU5A 2QHTA 4DR2L 2JA9A 5IP9G 4UP7A 2DXTA 1N9WA 4A4IA 2JEAI 2Q2IA 2YU9H 1VQCA 4JI8Q 1OXTA 3BFMA 2K75A 4OXPA 1KOGA 1Q86C 2B29A 4RQEA 4DR1Q 3ERSX 2ID0A 2E8GA 3BU2A 1D8LA 1X54A 3F8TA 1NJ6A 2EWNA 1J6QA 3TEHB 1NJ8A 2JK8A 3GTJH 3G71A 4HVCA 1J5EL 4GKJQ 1B76A 4BBRH 1JJCA 1Z7NA 4LNSA 1PH8A 4C2MH 2CCZA 5AJ3Q 2UXBQ 1B70A 5M3MH 2DQ0A 3G6EA 2YTVA 1PH6A 1UE1A 3HRKA 4H2WA 3AFQA 2RF4A 1GVPA 2GVAA 1QF6A 4YROA 2ALYA 1EQRA 2Q7EA 4A3GG 5M5YH 4HIOA 1I6HH 1N34Q 1PYBA 2GVBA 1XMQQ 4H02A 1HR0W 1TWAH 2UUCQ 1H4SA 1GO3E 3FKIG 3KF6B 1KMNA 1VQ4A 4YWKA 4H2VA 4JBWA 3PUYA 4A3EG 4C3HH 3S1RH 1C7YA 1EWIA 4QL5A 1VQ6A 3I4NG 2WFWA 2N49A 1HZAA 1SE8A 3L1AA 5C4XG 3W1BA 1V1QA 4JG2A 1WJJA 4AIMA 3H3VH 3S1MH 2QEXA 4BA1I 3DLLA 2UXDQ 4DV3Q 1NE3A 1YHAA 1SFOH 4CS2A 4A3EH 4H2XA 2AMCA 1Q12A 3EBEA 2ARTA 1I5FA 4XEMA 2EAYA 2Q7GA 4TQUS 1NYQA 4JOIA 5FLMG 1EUJA 1X3FA 4KI0A 1XNQL 3V7RA 2CJBA 4YCUA 4LW1A 4DR5Q 3MEFA 1O7IA 2ZT6A 2CKZB 3S14H 2ZTEA 4BWAA 2VQEL 3HOYH 3OTOL 1YVCA 2ZZEA 3J7ZC 2UUBL 3HOVG 5DLQE 3K7UC 4JOIC 2DTHA 4DR6L 1PH9A 2KHJA 2L15A 4LF7Q 1OTCA 1S72A 1TWGH 2K5NA 2Q5IA 3P8VA 3CXCA 4XU3A 2VW9A 4DKAC 4DV5Q 4O0AA 3HOVH 4APVA 4ME3A 3I7FA 4LF4Q 3J81j 1B7YA 3FP9A 4KHPL 4DAYB 1YITA 1PYSB 2GN5A 2E2JH 2JA6G 4BY1G 3PUZA 4X64L 1FJGL 3H15A 2E2HH 2ZINA 4K88A 4UP9A 4B3TL 2EJGA 2HT1A 1GM5A 1EOVA 2P5IA 5FJ8G 3T1YL 5FLXc 2YTYA 2OTJA 1TXYA 3GTKH 2JA6H 3LC0A 4GNXA 4BY1H 2IHFA 1YJWA 2KBNA 1VQ9A 4GLXA 3K7AH 1PH7A 5FJ8H 2V1CC 2AWOA 3AFPA 3CCQA 2OQKA 1WCMG 2ZIMA 4OX9L 1VQHA 4YHHQ 4JI6Q 2ZCEA 4YY3L 3UDGA 5GQOA 4A3FG 4H2TA 4GNXC 2RHSA 3PCOA 4A93H 1YB3A 1G291 2ZTDA 4YCWA 5K36G 5M5WH 3T1HL 4FDBA 3S17H 2LXKA 1R9TH 3TEGA 4NXMQ 4JI7L 1YI2A 1K8AC 1IBKL 4CH5A 5F5WA 3CP0A 4CS3A 4YRPA 3GTGH 3HOUG 4LFBL 4K0KQ 5LMNQ 4L5SA 1Y1VH 1B70B 2F52A 3U4ZA 1X9NA 4IJHA 2RHQA 2UXCQ 3V7CA 4HJ7A 3S2DH 1HJPA 3W3SA 2ALYB 1N36L 4WI1A 4JI2L 4HIMA 1VQ5A 2I0QA 1Q1EA 4DV7Q 1YHQA 2IHEA 3G4SA 1J5WA 4X6AH 1BIAA 3REXA 5C0XJ 1N32Q 3HY1A 1G51A 5C3EH 4DR1L 2AKWA 4IPDA 1KC8C 3TUPA 3S1QH 4MZ9A 3CPFA 4A3MG 3AQQA 1KAWA 2WP8J 3A5ZA 4HIDA 2B63H 3U50C 4H2XB 2AMCB 4Y7NH 5JEAG 2ZJPA 2KCMA 1NJ5A 5BR8Q 3CC2A 1BBWA 5AJ3L 2UXBL 4X65Q 1K0RA 4JC0A 3PF4A 2J3LA 2A8VA 3CCRA 3CMQA 3HXUA 4OWXB 1N34L 3KJPA 2R93G 2UUCL 1RIPA 1RL2A 4DR3Q 2ZT7A 1Z9FA 4JV5Q 1UE6A 4P75A 2Q5HA 1TWCH 1PVOA 1NTGA 4TVYA 2R92G 4DV0L 1A63A 1B7YB 4QIWE 4KR2A 3CAMA 3F2DA 1VQIA 4X66Q 2ZGWA 3JC66 4OWTB 2UXDL 4KR3A 4DV3L 3REUA 2VNUD 3ICAA 3UE0A 4H2UA 2ZTCA 5E3IA 1FYFA 4JI4Q 4A3BG 2R92H 2DTIA 1L1OA 1U5KA 1VQAA 3M85A 5KNNA 5JJIA 3D31A 1HNZQ 1K3RA 1U0LA 4JBKA 1KRTA 5IYDH 1VCIA 3TREA 2JA5G 4DQ2A 5GAHC 2JA7H 2LXJA 2EXDA 4LF7L 4P3OA 2J3MA 5GAGC 2IY5B 3ZJYC 1PFSA 2KCTA 1G6PA 2RHSB 4YCVA 3PCOB 2HHHQ 4DPGA 4X62Q 2JA5H 4LF4L 4AH6A 2R7ZG 4WJ4A 2PMEA 4AYBE 2I5MX 4L5RC 3CCMA 1Q81C 1P8LA 5H1SE 4DR4Q 3CMEA 4RG1A 2ZXFA 1W2BA 1IBMQ 3U58A 1MJEA 4PG3A 2R7ZH 2RHQB 3A7RA 4Y52H 4PZ8A 3S2HH 3HTZA 2F3IA 3PIOA 2Q2TA 3V8LA 4DV4Q 1X6OA 4BBSG 3PO3H 1TWFH 2N3SA 4H2SA 4P73C 4DUZQ 3QO7A 1WFQA 4LFCQ 1HNWL 2DUDA 2CQOA 1KMMA 1NY4A 4JI6L 2PNHA 2Q7HA 2JJQA 3J81c 2E5LQ 3QNEA 4C3JH 1PHJA 3PUVA 1I94Q 2AKWB 1QVFA 3TS2A 2C8MA 3A5ZB 4NXML 2YV5A 1HNXQ 4YRLA 3A5YA 1P16A 4TVWA 2ZIOA 4YRSA 4K0KL 2FXQA 1OXSC 3NBHB 4DV2Q 2Z6KA 3TRZA 4DV6Q 1OXVA 1NNHA 1Q1BA 4BBRG 2ZZFA 4TQFA 2XTIA 2VY3A 4LF5L 2CIMA 5M3MG 3WWVA 2JEBI 4A3CH 2QHUA 3DSQA 4YRIA 3M9BA 3J7A5 2Z6KC 4R4TA 3P8YA 5M3FH 4DV7L 4JYAQ 2XGTA 4LF9Q 4OO1I 2ZT5A 3FJPA 3CMAA 3VBBA 5J3BA 1FL0A 1N32L 4DUYQ 3UGQA 4JI0Q 4OONA 3G48A 1CKOA 4IJLA 2MO1A 4DAMA 2CJ9A 1A62A 3CCSA 2BH8A 3HOWH 1VQPA 12ASA 1VQKA 3GTQH 3RR5A 2H5XA 4JI5Q 1PH1A 5BR8L 1XMOQ 2WAQE 4TVAA 1QUQA 4LFAL 1L1OB 4X65L 4DR7Q 3L4GA 4LF8L 1WLEA 1UE7A 4NPSA 1AH9A 3PIPA 2E2IH 4JBMA 5C53B 2K4KA 2WB1E 1LTLA 4A3KH 1QZHA 1S3OA 1A0IA 3HOYG 3W5OA 2NVYH 1KXLA 1IZ6A 4DR3L 4OLFA 1EQQA 4IPHA 1YFSA 3A74A 2NZOA 2N78A 4GKKQ 3UGTA 3V8JA 4WJ3M 1PH5A 1N33Q 2K5HA 2VS1A 2DDZA 1WNLA 3RL6A 4X66L 4GLVB 3J80i 3GDEA 2UUAQ 1FVIA 4RDXA 1X56A 3H3VI 2AHOB 3STBD 5K1XA 3MEYA 2EQSA 4JI1L 3S24A 4J15A 2EIFA 4JCVE 5C44H 3I4MH 4Q6GA 4LF6Q 3CQZH 2DZ9A 1L0WA 3HKZG 3H0GH 3VQVA 1EIYA 1HNZL 4B3MQ 2Y0SG 1CSPA 4LUVA 1GD7A 2NVXH 2CFMA 3OD1A 1IL2A 4C3IH 1NJ1A 3HXYA 5C0XG 2EJFA 3PZCA 4XIGS 3CPWA 4HJ5A 2DTOA 1AE3A 2YYZA 3IKMB 3UDIA 2HHHL 1BKBA 1JJGA 3CCEA 1X3EA 2JA8H 3TQYA 1GGMA 2NN6G 4A93G 3BZKA 2PI2E 4A3DH 1KIXA 3J81i 4L87A 3CCVA 4LWCA 1SMXA 4B3SQ 2NVQH 1N8RC 1QVGA 1H95A 3I2ZA 2ARUA 4DR4L 3V7SA 2IY5A 2VZAA 2UU9Q 1IBML 2Z0SA 4XU0A 4L5QA 2PQAA 3RZOH 1Y1VG 2D0PA 5IT9c 1VQNA 4R1JA 3RF1A 3L0OA 3RIRA 2IT1A 4DUZL 5IYBH 2DZCA 4IFDJ 4EQ5A 1VQDA 1L2FA 1K8GA 4YRQA 4YRMA 4YRGA 4GOPA 1QZGA 2E5LL 2F4VQ 4LUZA 5C0XI 1HC7A 3KDFA 4X5OA 3IRBA 1I94L 3R07A 4DNIA 2OCEA 1HTTA 3ULPA 2IX1A 1SETA 1Q46A 5C3EG 1VQJA 1BIBA 1HNXL 2C35B 4TQDA 1OXUA 2NN6I 1MJCA 4BY7H 4JI8L 4IOAA 3HKSA 2D0OA 3HOZH 2B63G 3NENA 3F1ZA 3LSSA 3JAMi 5IY0A 4TVAB 4DV2L 4YRRA 2ZT8A 4DV6L 1QUQB 2QHSA 1IBLQ 4DV1Q 3L4GB 1JE5A 1J5EQ 2ODRD 5IWAQ 3HFVA 1IXRA 3E9HA 3CD6A 4XTYA 3L2PA 3GTLH 2CWAA 3F2CA 4B3RQ 4YYEA 4YRNA 1MIUA 4GKJL 4HIKA 1VQFA 3SGIA 1ADYA 4AQYQ 4PHCA 4IO9A 1E7ZA 1JT8A 4JYAL 4LF9L 1TWHH 1KL9A 1SR3A 4DUYL 1H4QA 4JI0L 2QGQA 4DK3C 1YHBA 1XMQL 2DQ3A 1NBWA 3S16H 4P71A 1XPUA 3MXNB 4QJFA 5IP7H 1VQEA 1HZ9A 2D62A 4JI5L 1XMOL 3QO5A 3GTOH 1X01A 1NMFA 3P8TA 1YGBA 1EIYB 3HXWA 1XNQQ 1YJNA 1YZ6A 4RMFA 1WOCA 3HKZE 4P75C 2PMZE 1PH2A 3CCUA 2Y0SE 4XTVA 1UE5A 3LGJA 2VQEQ 5IYDG 2VQFQ 3M3YH 4HJAA 1ADJA 2Q2UA 3PUXA 4XTCS 1HXDA 4DR5L 3A0JA 4P74A 2JA7G 4JBJA 4GKKL 3Q8DA 2RCNA 1UEBA 1N33L 1NJ2A 1QE0A 2MO0A 1L1OC 2UUAL 3PGZA 3V8KA 2JE6I 3J80c 3UDXA 2OTLA 4KQEA 3M4PA 1USYA 3AYHB 4DV5L 2PQAB 4LF6L 3CF5A 4A3LG 3ER0A 4X64Q 1FJGQ 5HY6A 1SERA 1Q8KA 3W1GA 3UFGA 4B3ML 3T1YQ 3OW2A 3DM3A 4A3LH 2ZM6Q 4A3IH 4YP0A 3PO3G 2ODRC 1E22A 4GOPB 1HZCA 4R4QA 1WU7A 3KDFB 4XU1A 3PO2G 1I3QH 4YRTA 4OX9Q 3U4VA 2ZNJA 4YPFA 4R4IA 1I50H 2YTXA 3G1ZA 1W66A 3E0EA 1X65A 3B6YA 4B3SL 1VS0A 1GKHA 4QQBX 3PO2H 2A1AA 3L7ZC 4YHHL 4JI7Q 3FHWA 1SRUA 4PMWA 4A75A 2ASBA 2I5HA 2G4CA 4H2YA 1KQSA 2FYKA 2KHIA 3HOXG 3D0FA 4PZ7A 1PH4A 2CGHA 1XNRQ 3RN2A 1Y1WH 1VQGA 4A3CG 1E1OA 1N36Q 5LMNL 1E1TA 1YFRA 2ZTGA 4ZIBA 3HXZA 2DGYA 3KF8B 1B8AA 3A7AA 3HFZA 3HOXH 2F4VL 2I4NA
chains in the Genus database with same CATH superfamily
5M3FG 2VUMG 4YDQA 2UXCL 1XPOA 1EQVA 3ULLA 3A7UA 3PF5A 4XYQA 5FO8B 1ATIA 5E4WC 1EFWA 4M8AA 1H4TA 5TSSA 1CT1D 3RNUA 1M4VA 2DNCA 2EPBA 4R4OA 1Q82C 4K2LA 4ODGA 5FLXL 4QY7A 3M3YB 3EFSA 4OP0A 2DVEA 5IP9H 1HXYD 4KKSA 1SYBA 4FYDA 2F0NA 2VUMH 4KKTA 1H9JA 3TSSA 4OL7A 2ATWA 3HOWG 4G85A 4RKLA 2CQAA 2E1HA 1IBLL 4DV1L 1YJ9A 3R93A 1GUGA 3DWQA 5LL6S 2N55A 5KIXA 2LSSA 2HQEA 3JAMc 1DYQA 4BS9A 1SNDA 5IWAL 1S5BD 3E9IA 3PSIA 1GXDC 3I4OA 4YWMA 2E3CA 4B3RL 1LT3D 3CC4A 2HIVA 1AE2A 1MGSA 3EN2A 1WTPA 4UY8C 4AQYL 4PZ6A 1GJXA 5JVH3 4A3KG 3VQWA 1Y8PB 4K86A 1XPRA 1SEBD 3BJUA 2EDGA 4ZYSA 3RN5A 4HWRA 3ULJA 3R8BA 2IX0A 3MEHA 4ZUIA 2F1MA 1A3VA 3RKYA 2EY2A 3K0XA 2PMFA 4YRKA 3MHBA 4RKBA 3SVMA 4G84A 1R4PB 3NQIA 2EY1A 5KYIA 1BO0A 1E2WA 4QB4A 2K01A 4RGMA 3KOJA 4CH6A 5HGQA 4P3PA 4A3GH 1VQMA 4A3IB 3A31A 4DV0Q 5C4HA 1YFTA 3QWNA 1ASZA 2K7VA 4PNYA 4JV5L 3FKIH 1WTVA 3PIP3 5CGKA 2NS6A 2EJMA 4UP8A 1I3QB 1F77A 3J7AF 2RQXA 1LUZA 3IG2A 4QMGA 5KGUA 5LMNW 1BF4A 1OXXK 1DGSA 3AEVA 1KNEA 3I4NH 1G2SA 1O7ZA 1HTPA 2I4OA 2BA1A 2KEDA 4EX5A 4OWWB 5C4XH 3HXXA 1I50B 2QA4A 3HZXA 1X3GA 5C44G 3I4MG 3BVGA 4XT1B 1PTOF 3H0GG 3PO2B 4I65A 4IPCA 1LTAD 4IFDG 4FF3A 1PRTC 1E2ZA 4YRCA 4HJ9A 1EIGA 3M7NA 4JI4L 3EIVA 2OF1A 4NXNQ 2BA0A 2BH2A 2VQFL 4NCXA 2HIXA 5FLMH 1G5IA 5KYLA 3NELA 2R7FA 2KQ3A 2EL9A 4C3IG 2ZJRA 1NYRA 4HWPA 4O1NA 3KYHC 4HCSA 4YWLA 2WV6D 2A8EA 4GN5A 1SE4A 4DK6C 1Y1WB 2F0EA 2F0KA 4N9PA 1VQLA 1Z7MA 1EVKA 4LJZC 4K8IA 3X3NA 3NTIA 2E65A 4XU2A 1E24A 1WTWA 1PV4A 2WKCA 4ALPA 2JA8G 1Y14B 4NP5A 1BOSA 2QHVA 5KRUA 1U4MA 3HGBA 3HOXB 4BW9A 4A3DG 4JI3Q 4CH4A 1KRSA 1D1IA 1TY0A 4N8X1 2KOLA 5D14A 5DEHA 2I4LA 3G7LA 4CS4A 2B2TA 2WACA 4CJ2C 2K05A 4ZRZA 5CV8A 3VQYA 3RD4A 1WD0A 1EYDA 1SYFA 4X62L 4EO4A 4XEOA 5BN3A 4HT4A 2K28A 5KNCA 1H9RA 4P3NA 1A6XA 2QF7A 3MFYA 1X55A 2HD3A 1E3PA 1KHIA 4BWGB 4FP5D 1JORA 3KLWA 1A15A 4KLKA 1CKMA 1IW7C 2VUMB 1FNVA 1Q7YC 1AW7A 2HCCA 3R2IA 1WI5A 3ERRA 3PUWA 4G7OC 4U673 4HA8A 1BBUA 5ELBA 3M4YA 2IPKD 5JPMC 4G7HC 4POFA 3M4OH 2NVTH 3A5UA 3IFDA 1IYJB 1HR0Q 2I4MA 3RKWA 2KUMA 2K1BA 4NB3A 4Q0FA 2ZM6L 4IFDI 5JJKA 1MD2D 3ICEA 3QTCA 5GADC 1XX8A 2V4DA 3A7AB 3A32A 5C6AA 1VQ7A 4XTXA 4FNFA 3HFZB 5IYBG 1I4QA 3VDYA 3CRKC 3RKXA 4P72A 1HNWQ 3QO2A 4K2KA 2X69A 3WQZA 3BZCA 3KLRA 3UDFA 5LMUQ 1B9MA 1T9HA 3KBGA 3MZ5A 4DV4L 4HWTA 3LWUA 1WQWA 1CKNA 2NZHA 1BCPB 2QDLA 3K57A 3NEMA 4TRDA 2I5LX 4LFCL 2ZJQA 4UPAA 2EYFA 1CSQA 4AYBG 3RLNA 4JW0A 2HNIA 2F0DA 4DR2Q 1WCMH 1W3SA 1HQRD 5EAYA 4P72C 1FGUA 3OMCA 4YRFA 2N8NA 2MFIA 4DXGA 1G5HA 4BY7G 2CJAA 1EIFA 4A3FH 3HOZG 1CZWA 4FVMA 2DKGA 2DNEA 1LYLA 1A8VA 5ELNA 1K9MC 4A3GB 1CUKA 4C1NI 2K5VA 1JJCB 4GN3B 3K80C 5K36H 1MSGA 1EYGA 3NWTA 1RTNA 4DU9A 5EKKA 3RLFA 5DM63 4CH3A 2XSCA 3FKIB 2K50A 3RLOA 1VMCA 4O2DA 1GUNA 11ASA 3NETA 4LF5Q 1XNRL 3C2PA 5K1PA 1JOOA 2K5QA 4GOPC 2RVLA 2A19A 3I4NB 5JOBA 3HOUH 2EZVA 5HGTA 5C4XB 2K6AA 2C7IA 2ARSA 1NAPA 3HG9A 4IURA 1X2GA 1PTOD 1YNJD 3PV0A 3A55A 3RZDH 1H4VB 2DU7A 3X3MA 1WPYA 3I91A 2CWPA 3GTMH 3K81C 3KJOA 2A6EC 2Z8LA 2ZNIA 1BNZA 1PZKD 3GO5A 3E5SA 3MF2A 5COYA 4RQFA 4HSPA 4RHSA 2K32A 4OEMB 3STBC 3IKLA 3I72A 2ZXPA 1PH3A 4CKEA 1B44D 1I6VC 1TKWB 1X2HA 2Z4IA 1AN8A 2MNAA 1EZ8A 3L2ZA 4GLAC 1XXGA 5IP7G 4Q15A 4EQNA 1W6JA 2SNSA 3N6RA 2KCNA 2P0LA 1NMGA 1TT2A 5IODA 1Q8IA 4A76A 3QO8A 4LNQA 2JQOA 3J81L 3GD7A 4K87A 3DEOA 4LUOA 4LFAQ 4A3JG 1YNXA 4LF8Q 4A3MH 1V43A 3RUZA 4ZTUB 1PA6A 1C9OA 3P20A 1Q3LA 1HA6A 3F2BA 4HWOA 5FKAC 2O2LD 3S15H 4XTZA 1YBYA 3CC7A 4KTAA 4KN7C 4WF2A 4IOCA 5JEAH 1PXUA 3MXPA 4QIWB 5JJLA 2KCCA 2B39A 3EFRA 4XTUA 3PMFA 1T5EA 5M5XH 3TEHA 2E41A 4TKOB 4DR7L 3MF1A 5C4JH 4A3JH 4E51A 2L55A 1HZBA 1G8ZD 1HH2P 1WTXA 1SLJA 2O5IC 3RUXA 4IZ8A 3RGLA 3NTKA 2PMZB 1JB7A 4P71C 3TS0A 1KD1C 4JVZA 1M90C 3K59A 3M4OB 2OQ0A 2NVTB 2K14A 2G5DA 2DJZA 3UE1A 4X3KA 1XJVA 3KUPA 1TS2A 3LSQA 2B2WC 1XTDA 4HJ8A 2AQ1B 4BA2I 2R93H 1VF7A 4L5TA 1QCBD 2KENA 4X3UA 3OTOQ 4RH6A 3HXVA 1DCZA 2UUBQ 4YRJA 4E6IA 3UH0A 3D6WA 4DR6Q 1DONA 2K52A 1A3UA 4MNOA 1VQBA 2EYJA 3KF6A 3OYYA 2WAQG 1K28A 4DA2A 3IKJA 2R6GA 3HRIA 5C52B 2E64A 4HWSA 4JI1Q 5FLXE 3K8AA 3ERQA 1WQ7A 2AUKA 4CDFC 1WCMB 2WB1G 1YEZA 4KY7A 2E75C 3E6ZX 1JOQA 4TWAA 4HTHA 4GNXB 4P74C 1D7QA 2ZZGA 4A3FB 3SK4A 3NXWA 2R3ZA 4NXNL 2ES2A 5E7NA 5IYCG 4KHPQ 4A3BH 4R4CA 1K73C 5ELOA 2Q2HA 4DGZA 4POGA 1C0AA 4AYBB 3FEWX 4ZTZB 1EOTA 1SESA 4A3IG 4MTNA 1ZYRD 2SDFA 2C5CA 3OMGA 1VQOA 1VF5C 2NTTA 4B3TQ 4XTWA 1YIJA 5JEAJ 2LKVA 3M4QA 2XNAC 2MQHA 2EJ9A 5EKIA 1KDBA 1SROA 3HY0A 5GAEC 3MC0B 5IYCH 1CFMA 1MKHA 1CKNB 1LM0A 4ZKCB 1LTSD 2R7DA 3HOUB 1H9SA 2VL6A 1WTQA 1SJHD 4KJOA 3LWEA 4J6HA 1USYC 2O4XA 3IALA 3GP7A 3RZDB 4KHZA 5IE8A 2TSSA 4JI3L 1SYCA 3GTMB 1K83H 3CCJA 4TTVA 1V9PA 2XRQD 3KFUA 3CW2C 1ET9A 5T1GA 1S40A 3QJYA 5GROA 4C1NK 1WYDA 3C1EA 1H9MA 1UWVA 1KDCA 4YY3Q 1VMPA 1EVLA 4BXXG 4P73A 4LVMA 1PTOH 1TR5A 5C4ZA 1RIQA 4ID6A 1HRJA 4QGUA 5CYUA 1JE4A 2ZXRA 4YREA 1ASYA 3TP7A 2E5AA 3I3CA 3S1NH 3T1HQ 2ZR2A 1DXMA 3IL8A 3CCLA 2MJ8A 1HR0L 1VDZA 1BVSA 3A56A 5CV6A 1IBKQ 2FINB 2WKDA 1LV9A 2UU9L 4DAYA 3I56A 3VQXA 4GZYC 2PI2A 3H09A 1PYSA 1E0BA 3NTHA 4BXXH 1Y1WG 1AZPA 2ZR3A 4IPGA 1EY0A 1R4QB 2CW0D 2PZTA 4LFBQ 2Z4HA 3I55A 3GTPH 2BE5D 4OO1G 1VQ8A 2DEQA 4A3MB 1JMCA 3RACA 1I4RA 3E0JA 2AWNA 4DNTB 5G3LF 5LMUL 2DXUA 1GHJA 1SN8A 3S15B 1Z47A 1ZKOA 1K8MA 3Q22A 1JJ2A 2F3VA 1QVCA 2Z6BA 2K04A 1KLUD 2SEBD 5M5XB 3BS1A 1NJIC 2OWOA 1VQZA 4GN4B 5E1FA 4GS3A 4BBSH 5C51B 4RWSC 5C4JB 2E10A 1SRYA 3VYRA 4A3JB 4OO1H 4JI2Q 1PYWD 4MN3A 5HURA 1M1KC 2B3GA 2HQLA 2DU5A 3MXGA 2QHTA 4DR2L 2ENBA 3T51B 5I9PA 2JA9A 5IP9G 4UP7A 2DXTA 1N9WA 1SYEA 3WDNA 4A4IA 2JEAI 2CH4A 2A6HC 4H0LC 2Q2IA 2YU9H 1VQCA 4JI8Q 1OXTA 3BFMA 1U4RA 2E76C 2OEOA 2K75A 1RCVD 4OXPA 2R93B 1KOGA 1Q86C 2B29A 1I4HA 1SNCA 1TS5A 4RQEA 4DR1Q 2L5TA 2ICIA 3ERSX 2ID0A 2B2VC 2E8GA 2R61A 4DNRB 3BU2A 4ZQ3A 1D8LA 4UDUC 1X54A 3F8TA 1XYIA 3QOJA 1NJ6A 1CZGA 2EWNA 1J6QA 2Z1CA 3TEHB 1NJ8A 3TN2A 2JK8A 3GTJH 2XIWA 3G71A 4HVCA 1EFID 2LS01 1J5EL 2FFKB 1XWEA 4GKJQ 1QNUA 1B76A 4BBRH 1U4LA 1JJCA 1Z7NA 4LNSA 1PH8A 4C2MH 1BCPC 4K5VA 1CA6A 2CCZA 2FJ2A 5AJ3Q 2UXBQ 1I4XA 1B70A 5M3MH 2DQ0A 3G6EA 4R8IA 2WAQB 2YTVA 3RMHA 2K5WA 1PH6A 1UE1A 1O78A 3HRKA 4H2WA 3AFQA 4A3BB 2RF4A 1S4ZA 1GVPA 4EVOA 2GVAA 4KHVA 5ELDA 2D9UA 1QF6A 5IT9L 4YROA 2ALYA 1EQRA 3MA2B 2Q7EA 4R9WA 4A3GG 2K5DA 2MGSA 5M5YH 4HIOA 1I6HH 1N34Q 4DFAA 1EEID 1PYBA 2GVBA 4V0BA 1XMQQ 5J39A 4H02A 1HR0W 1TWAH 2E74C 2WB1B 4R8NA 1ZYRC 2UUCQ 1WTRA 1H4SA 1GO3E 2RDHA 3FKIG 3KF6B 4PV1C 1KMNA 1VQ4A 4YWKA 4H2VA 4JBWA 3PUYA 2RKSA 3MAQA 4C3HH 4A3EG 3S1RH 4CKCA 1C7YA 1EWIA 2LMCB 4QL5A 1VQ6A 3I4NG 1SNMA 2WFWA 2N49A 1TS3A 4IQZA 1IYUA 1HZAA 1ENFA 1SE8A 2H4OA 4MHEA 5C4XG 3W1BA 3L1AA 1V1QA 1K83B 3I73A 4JG2A 1WJJA 2P5ZX 4AIMA 3H3VH 5ELFA 3S1MH 2QEXA 1SE2A 4HAEA 4QUCA 1JWUD 4BA1I 1SDFA 3DLLA 3W3AA 1KTKA 2UXDQ 5ISRA 4DAVA 4DV3Q 1NE3A 1YHAA 1A2UA 5D65A 1SFOH 4A3EH 4CS2A 4H2XA 2AMCA 1STNA 1HFGA 2LFNA 1Q12A 3EBEA 2ARTA 1PTOB 1I5FA 4XEMA 5BN5A 2EAYA 2Q7GA 1DOLA 4TQUS 1NYQA 4JOIA 5FLMG 2B2UA 1EUJA 1X3FA 4KI0A 1XNQL 3S1NB 3V7RA 5LL6X 5E4XA 2CJBA 4P2CB 4YCUA 4S3SA 4C56C 3H6MA 4LW1A 4DR5Q 1HCZA 3R3OA 1S5CD 3MEFA 1H9SB 1O7IA 3C1FA 2ZT6A 2CKZB 1RJTA 4IN3A 3S14H 3D4DA 2ZTEA 4BWAA 2A68C 3C3LA 4LVIA 4PQXA 3OIPA 4B08A 2VQEL 3HOYH 1EU4A 3VYSA 4CBVA 3OTOL 1YVCA 3GTPB 3J7ZC 2ZZEA 2UUBL 3HOVG 1QWYA 1M8AA 5G3LD 4K14A 5DLQE 3BYTB 3K7UC 4JOIC 2BE5C 4DR6L 2DTHA 1PH9A 4ME5A 2KHJA 5T1IA 3EA6A 1EIHA 3TP5A 2O5JC 2L15A 1WD1A 1UAPA 1BBXC 2B8FA 4LF7Q 1STAA 1OTCA 1S72A 1TWGH 2K5NA 2Q5IA 3VYTA 1DM0B 1PZID 3P8VA 2EOTA 3CXCA 4XU3A 4BBSB 2VW9A 2EYLA 2EXZA 1RODA 4DKAC 2JSOA 4DV5Q 2XVSA 4O0AA 4Z9CB 4APVA 3HOVH 1L0XB 4ME3A 1K0SA 2L0CA 1GOZA 3I7FA 4LF4Q 3J81j 2HUGA 1B7YA 3FP9A 2YU9B 1K8OA 1BR9A 4KHPL 4DAYB 1YITA 1PYSB 2BDOA 2GN5A 2E2JH 4PMBA 2JA6G 4BY1G 3OWFA 1QJOA 3NK9A 3FPPA 5I9OA 1C8CA 3PUZA 4X64L 1FJGL 3H15A 4IUTA 2E2HH 4PMCA 1MBYA 2ZINA 4K88A 4UP9A 2J7ZA 3J81E 4KKUA 4B3TL 2EJGA 2HT1A 1GM5A 1EOVA 2P5IA 1NNXA 5FJ8G 1EWCA 3T1YL 2JN4A 1U4PA 1BDOA 5FLXc 3UI2A 2YTYA 2OTJA 1TXYA 3GTKH 2JA6H 2M2LA 3GTJB 4RAUC 3T4AC 3LC0A 4GNXA 2B2TC 4BY1H 1LTTD 2IHFA 2RA4A 1YJWA 1ICFB 3Q24A 1DD2A 2KBNA 3T53B 4BBRB 1VQ9A 1X3QA 3P75A 4GLXA 3K7AH 5C0XH 2F0UA 5KNDA 4C2MB 1PH7A 1QOHA 2G9HD 5FJ8H 2V1CC 1WVLA 5M3MB 1RKNA 2IWHA 1ONLA 2AWOA 4CJ0B 4WJWA 3AFPA 3CCQA 2OQKA 1WCMG 2ZIMA 1CTMA 4OX9L 1VQHA 4YHHQ 1K3BC 4RGTA 4JI6Q 2ZCEA 4YY3L 1HA5A 3UDGA 5GQOA 4A3FG 4H2TA 3U9SA 4GNXC 2F0SA 2NN6H 5M5YB 1I6HB 2RHSA 3PCOA 4A93H 2I07B 1G291 2ZTDA 4YCWA 1YB3A 5EBDA 5K36G 1D5MC 5M5WH 1TWAB 4OHJA 3T1HL 4FDBA 5C3WA 3S17H 2LXKA 1R9TH 2F0OA 2IX3A 5J1ZA 4MTKA 2I46A 4ULLA 3TEGA 4NXMQ 4JI7L 2XWBB 1YI2A 1K8AC 1IBKL 4CH5A 5F5WA 3NUCA 1EWHA 4LVJA 3CP0A 3S1RB 4C3HB 4CS3A 4YRPA 3GTGH 4ILWA 1SE3A 3HOUG 4J1MA 4LFBL 3MVVA 3J80L 4K0KQ 2FMCA 5LMNQ 4L5SA 1SBBB 4ABNA 1Y1VH 4CJ1B 4NKLA 1B70B 2F52A 3K6OA 3S1MB 3U4ZA 4X3SA 2X6LA 3HEJA 3M7GA 3G6JB 2NBFA 4DK1A 1X9NA 4IJHA 2RHQA 2UXCQ 3V7CA 4HJ7A 1SFOB 4A3EB 3S2DH 1HJPA 3W3SA 2A73B 2ALYB 4QF4A 4LMQD 1N36L 4WI1A 2A69D 4JI2L 1A2TA 1F9QA 4HIMA 4IUPA 1VQ5A 2F3WA 2KEEA 2I0QA 3TDQA 1Q1EA 1HFNA 1NSNS 2E2DC 2NB0A 4DXFA 5L37A 4DV7Q 3GV3A 1YHQA 1ML0D 2IHEA 3S14B 3G4SA 1J5WA 4X6AH 1BIAA 3REXA 1I4PA 3BG3A 3HOYB 2WINB 5C0XJ 1D5XC 1N32Q 3HY1A 1G51A 5C3EH 2Q8RE 4ZLTF 4DR1L 3EJIA 2AKWA 4IPDA 2AUJD 1KC8C 4XQNA 3TUPA 3S1QH 1ZXTA 5A2QL 4F87A 1EYCA 1JR0D 5CR3A 1CHQD 4MZ9A 3CPFA 4A3MG 1BUVT 3FVQA 4WFN3 3AQQA 1KAWA 2WP8J 5DNFA 1UEAB 2PNRC 2NZ1D 3TBIB 3VR4A 4HIDA 3A5ZA 3N52A 2B63H 3U50C 4H2XB 1TWGB 3U9OA 2AMCB 3NWSA 4IUUA 3VR2A 4Y7NH 5JEAG 3D3RA 1AZQA 2ZJPA 2KCMA 3HOVB 1NJ5A 4M1UB 5BR8Q 2JXMB 3CC2A 3NBHA 1BBWA 4HEDA 5AJ3L 2UXBL 4X65Q 2OXPA 4LVLA 1K0RA 1RTOA 4JC0A 3PF4A 2J3LA 2H1EA 1I4GA 2A8VA 3CCRA 4K8JA 2E2JB 3CMQA 4XQQA 3HXUA 1PRTF 4G57A 1S5DD 1TU2B 3GV6A 4F88A 3J7YW 4OWXB 1N34L 3KJPA 2E2HB 3MQZA 5EKLA 2R93G 2FMMA 1KLGD 3HKZB 3Q6SA 2UUCL 4N9TA 2IJ0A 1RIPA 1TY2A 2EYOA 3EVQA 1RL2A 4DR3Q 3VR3A 2ZT7A 1Z9FA 4JV5Q 1FNWA 2Y0SB 1UE6A 2A74C 4P75A 2Q5HA 3GTKB 2JA6B 1TWCH 1PVOA 4BY1B 1NTGA 4TVYA 3QIAA 3QB3A 3SR1A 2R92G 4DV0L 1A63A 3K7AB 1STHA 1B7YB 4QIWE 4KR2A 3CAMA 3F2DA 1VQIA 4X66Q 3LNNA 3KK7A 2ZGWA 3JC66 1RD9D 3HP3A 3BYYB 4OWTB 3IAYA 2UXDL 4KR3A 4DV3L 3REUA 2VNUD 3ICAA 3UE0A 2L11A 4H2UA 1IKMA 2ZTCA 3K5OA 3D4RA 5E3IA 1FYFA 1B9NA 1GUWA 4JI4Q 4LAAA 4A3BG 4A93B 1STYA 2R92H 2DTIA 5M5WB 3H94A 1RF2D 3S17B 1L1OA 1R9TB 3P7JA 4L8JA 1U5KA 1VQAA 4WRDA 2CVRA 3M85A 4L6TB 5KNNA 5CV7A 3JAML 5JJIA 1WTHA 3D31A 2EVBA 1HNZQ 1X32A 3GTGB 1K3RA 1SJED 1DZ1A 1U0LA 4B9XA 4JBKA 1KRTA 5KEEA 5IYDH 1Y1VB 5KNBA 1VCIA 3TREA 2JA5G 4DQ2A 4OGQC 2KHSA 5GAHC 3K58A 4HMIA 2JA7H 2LXJA 1IYVA 2EXDA 5IGGA 1EY6A 2AQ3B 3CKIB 4XXEA 4LF7L 2G9DA 1JB3A 2L1BA 2J3MA 4P3OA 5GAGC 2IY5B 3S2DB 1SMYD 1W6KA 3ZJYC 4RCOA 1PFSA 3AMUA 2KCTA 1G6PA 1B3QA 3NPPA 2RHSB 4YCVA 3PCOB 2HHHQ 5IGEA 1PFNA 3I90A 3VR5A 4DPGA 4X62Q 2A69C 2JA5H 5IT9E 1G6ZA 4LF4L 1PTOC 4AH6A 1YNJC 4KD3A 2R7ZG 2F0MA 1Y69U 4WJ4A 3CU7A 5C3XA 2PMEA 4AYBE 5K5PA 3VYUA 2I5MX 4L5RC 3CCMA 4DAPA 1Q81C 1P8LA 5H1SE 4DR4Q 1ESRA 3DEPA 5C3EB 3CMEA 4RG1A 2ZXFA 1G91A 1W2BA 1IBMQ 1XTCD 2Z9HA 1UUPA 3S1QB 3U58A 3D6CA 5EGTA 1MJEA 4PG3A 2R7ZH 2RHQB 2QILA 2B63B 3A7RA 3P1HA 4PZ8A 4Y52H 3S2HH 2MP1A 2D2CC 4UAIA 3HTZA 5I6WA 2F0VA 2F3IA 5I6YA 3PIOA 4Y7NB 2Q2TA 3V8LA 4DV4Q 1MI2A 3VA7A 1EY9A 4TSSA 4LK1C 1X6OA 4BBSG 3PO3H 3V2TA 1TWFH 2N3SA 4H2SA 4P73C 4DUZQ 3QO7A 1WFQA 2NYZD 4LFCQ 2F03A 3OSOA 1SNPA 1HNWL 2DUDA 2CH4W 2CQOA 2PO4A 1PRTD 1KMMA 3BDOA 5JAVA 1NY4A 4CHTB 1YNND 5DM73 4JI6L 2PNHA 3SE0A 2Q7HA 2JJQA 3J81c 2E5LQ 3QNEA 3L3OC 4C3JH 1PHJA 3PUVA 1I94Q 1J8IA 2AKWB 1QVFA 5IGBA 3TS2A 1CI3M 5FO9B 5M9OA 2C8MA 3A5ZB 4NXML 2YV5A 5CORA 4CDEC 1HNXQ 4YRLA 1SYGA 3A5YA 1TWCB 1P16A 4TVWA 5I2YA 2ZIOA 4G7ZC 4YRSA 4K0KL 1ENCA 1HQMC 2FXQA 1OXSC 3NBHB 3EFXD 5DAUA 1F2LA 2Z6KA 2K03A 4DV2Q 4DV6Q 3TRZA 1OXVA 2F0IA 1NNHA 3MWYW 1Q1BA 2RSNA 4BBRG 2ZZFA 3I4LA 4TQFA 2XTIA 1UNSA 2VY3A 3OIQA 4LF5L 5F2DA 3MXUA 2JP1A 2CIMA 5M3MG 3WWVA 2JEBI 4A3CH 2QHUA 3DSQA 4YRIA 4F8MA 2R92B 1ZEQX 1NUCA 3M9BA 5C5LA 1WTOA 1BQQT 4ZKBB 2QW7A 3TZUA 3J7A5 2Z6KC 1IW7D 3NE5B 3V96A 4X3TA 3VR6A 1CHPD 4R4TA 4RGOS 3P8YA 1F9SA 5M3FH 4DV7L 1PFBA 4FXDA 1LT5D 2C9OA 2XGTA 4LF9Q 4JYAQ 4OO1I 2ZT5A 3FJPA 1A3TA 5CV4A 3CMAA 1B3AA 3T56B 5J3BA 1FL0A 3VBBA 2RBMA 1DOKA 1N32L 4DUYQ 4MIUA 3UGQA 1SXTA 4C3HG 4JI0Q 1J9OA 1RDPD 4OONA 3Q23A 3FMCA 1LT4D 4NDXA 3G48A 1CKOA 4IJLA 2JA7B 3BVZA 3OWEB 2MO1A 4DAMA 2CJ9A 3GQBA 1FNUA 2MPMA 3H3VC 3LX0A 1EY5A 1A62A 2EYPA 2BH8A 3BZDB 3CCSA 4UHVA 3HOWH 1B50A 1JICA 1VQPA 4L63B 1VQKA 12ASA 3GTQH 1SMYC 3RR5A 2H5XA 5EPJA 4JI5Q 1PH1A 5BR8L 1JQYD 1V1PA 1SSOA 2F4IA 1XMOQ 5EPLA 2JA5B 2WAQE 4TVAA 2PW7A 5E3FA 1QUQA 2ZXOA 1L1OB 4X65L 4LFAL 4DR7Q 3L4GA 4LF8L 4LVKA 1WLEA 3URYA 1UE7A 4NPSA 5EQ0A 4U68A 3KLSA 1AH9A 2DJGC 3PIPA 2EYHA 3FDTA 2E2IH 2JYOA 4JBMA 5C53B 1ET6A 1O80A 3A7LA 2K4KA 1TS4A 2RDGA 1STBA 2WB1E 2FHTA 1LTLA 1FGBD 4A3KH 3DUZA 4CKBA 1S3OA 1QZHA 1A0IA 4K6LA 3VA5A 3HOYG 4B9WA 3W5OA 2NVYH 1KXLA 1IZ6A 4DR3L 4OLFA 1EQQA 4IPHA 1YFSA 3J80E 2B8GA 2PZUA 2R7ZB 3A74A 4CDDC 1S5FD 3S2HB 2NZOA 3TZDA 2EE1A 4IUNA 2N78A 4GKKQ 3UGTA 1ICWA 3OHXC 4DF7A 3V05A 1O7YA 2J0TD 3V8JA 4WJ3M 2RDFA 1PH5A 4KV6A 3PO3B 1N33Q 1TWFB 4EQPA 2K5HA 1JC7A 2VS1A 3A54A 4H7BA 1WNLA 2DDZA 3RL6A 1SAPA 3FPUB 4X66L 2CW0C 2A6ED 4GLVB 4H44C 2B2UC 1FR3A 3J80i 3GDEA 3T16A 4CDCC 3SDZA 4F7XA 3MXNA 1NCVA 2ZT9C 1EZ6A 2UUAQ 1FVIA 4RDXA 1HUNA 1YNNC 1X56A 2J4XA 3Q0AA 2ICEC 3E3XA 1H9KA 4C3JB 3H3VI 2AHOB 3STBD 5K1XA 5J22A 3MEYA 2EQSA 4HR7B 4JI1L 2Q8TA 3S24A 4J15A 2EIFA 4JCVE 5C44H 4RFBA 1C4QA 3SEBA 1PMRA 3I4MH 4Q6GA 1KAAA 3CQZH 4LF6Q 2DZ9A 1L0WA 1KDAA 2F0QA 3HKZG 3H0GH 3VQVA 1EIYA 4IFDH 5A2QE 3K5LA 1HNZL 4B3MQ 2IL8A 2Y0SG 1QNKA 3H91A 1CSPA 1QB5D 3KLSX 2RCFA 4LUVA 1GD7A 2NVXH 2EY5A 3QG1A 1Y8OB 2CFMA 3TMEA 1IL2A 3OD1A 2BOSA 3DMUA 3HRZC 3BVMA 4C3IH 1NJ1A 4O42A 3HXYA 5C0XG 2HDLA 2EJFA 3PZCA 4XIGS 3CPWA 5FOBB 4HJ5A 2DTOA 1AE3A 1QG7A 3DWAA 2YYZA 1DOMA 3IKMB 1ILQA 3UDIA 2HHHL 4JK1C 1S5ED 1EU3A 4ZCKA 1Y8NB 1Z7TA 1BKBA 1JJGA 3SHLA 1O7LA 1X3EA 2QDBA 4NMZA 5D3DA 3CCEA 2JA8H 3TQYA 1GGMA 2NN6G 3DWPA 2BDNA 4A93G 3BZKA 2PI2E 2KECA 4A3DH 3T13A 5M3FB 4WORA 1KIXA 4J8QA 2EJFC 3J81i 4L87A 2EJGC 3CCVA 2QKIC 4LWCA 1SMXA 3O13A 4XDXA 5CMDA 4B3SQ 2NVQH 1D1KA 1N8RC 1QVGA 1H95A 1GUTA 3I2ZA 4DR4L 2ARUA 3V7SA 4FF4A 4FXGC 2IY5A 5AFWA 1TVXA 1EEFD 1SYDA 2VZAA 2UU9Q 1PFMA 1IBML 1GHKA 5I2XA 2Z0SA 4XU0A 2BCOA 4L5QA 3I70A 3WOFA 2PQAA 4HMJA 3RZOH 5IIFA 1IHZA 1Y1VG 2D0PA 4H13C 2PZWA 3HOWB 3TP8A 5IT9c 1VQNA 1EY8A 1EY7A 3D4WA 3GTQB 4R1JA 3RF1A 3L0OA 3RIRA 1LTRD 5ELEA 2IT1A 4DUZL 1B2TA 2L12A 1DJRD 5IYBH 2DZCA 4IFDJ 4EQ5A 2DJFC 1VQDA 1L2FA 1B4OA 1K8GA 1ILPA 4YRQA 4YRMA 1BCPF 4YRGA 2E2IB 2IW3A 3OW7A 4EGVA 4GOPA 1QZGA 2E5LL 2F4VQ 2HDMA 4LUZA 5A35A 3JAME 5C0XI 1HC7A 2EY6A 3D8GA 2LY7A 3KDFA 4X5OA 3IRBA 1F2ZA 4A3KB 1I94L 4FF2A 3I8ZA 4DNIA 3R07A 2OCEA 4KMUC 1HTTA 3NP8A 3ULPA 2IX1A 2SOBA 2NVYB 1SETA 3HS0C 1GUSA 1U9RA 1B53A 1X3PA 1Q46A 5C3EG 4FXKC 1JOKA 1IKLA 1VQJA 1BIBA 2CHBD 2F0FA 2F0TA 3SXHA 1HNXL 4HN7A 1AFPA 2C35B 5FK9C 1LLRD 4TQDA 1OXUA 2NN6I 1MJCA 4BY7H 4JI8L 4IOAA 3HKSA 2D0OA 3HOZH 3ONAB 4N8FA 3A8IE 2B63G 3TP6A 3NENA 3F1ZA 1V1PB 3LSSA 3JAMi 5IY0A 4TVAB 4DV2L 4YRRA 1AP0A 2ZT8A 4DV6L 1LABA 1QUQB 4YIJA 2QHSA 3AU7A 1IBLQ 4DV1Q 3L4GB 2XWJB 1JE5A 5FO7B 1J5EQ 2QEJC 2ODRD 1QE6A 4K5WA 1ESFA 4EQOA 5IWAQ 3HFVA 1IXRA 3E9HA 3CD6A 4XTYA 2F0PA 3L2PA 3GTLH 2CWAA 2MHVA 3F2CA 1V8QA 4B3RQ 2A5HA 2N88A 5NUCA 4YYEA 1HTLD 1SNQA 4IUVA 4YRNA 1MIUA 1TIID 4GKJL 1GUOA 4HIKA 1VQFA 2AQ2B 2KA7A 3IFTA 3SGIA 1ADYA 4IUQA 3DXJC 4AQYQ 5C44B 3I4MB 1C48A 3W2DA 3CQZB 4PHCA 4IO9A 1JWSD 3H0GB 1PRTB 4XYOA 1CM9A 1E7ZA 2F0LA 1JT8A 4JYAL 2TMPA 4LF9L 1Z6HA 3KF8A 1D5ZC 1TWHH 1KL9A 4XQJA 1SR3A 4DUYL 4OELB 1H4QA 4XT3B 1RHPA 2OT2A 4JI0L 2QGQA 2NVXB 4DK3C 2HCIA 3K5MA 1T5XD 1YHBA 1XMQL 4Q5VA 2DQ3A 4C3IB 4RGNA 1NBWA 2PQEA 3S16H 2PPBC 4P71A 1XPUA 3MXNB 3ND9A 4RHRA 1LTGD 1LTBD 2VB2X 4QJFA 5IP7H 2KJXA 5CV5A 1VQEA 1HZ9A 5IGFA 2D62A 4JI5L 2B2WA 2PYKA 1PZJD 1XMOL 3OPOA 2KVMA 2M00A 3QO5A 3GTOH 1X01A 1NMFA 2JA8B 1FYCA 2B2YA 3NBIA 3P8TA 4A3DB 1YGBA 1EIYB 1LT6D 2F0WA 1G2TA 3HXWA 4KY5A 1KNAA 2A6HD 2XRSD 1YZ6A 1YJNA 1XNQQ 2GA4B 2NVQB 1MHWC 4RMFA 3J7AV 1WOCA 2WIIB 3MFGA 5JPNC 3HKZE 4P75C 1EL0A 3FRPB 1L0YB 2DN8A 2D5DA 2PCFB 2F0HA 2PMZE 1PH2A 3CCUA 1CA5A 2Y0SE 3S9WA 4XTVA 3SK5A 3RZOB 1UE5A 3LGJA 2PW5A 2VQEQ 1KABA 2B2YC 3QR8A 5IYDG 2NTSA 2VQFQ 3M3YH 5BN4A 2Q8IB 4HCEA 4HJAA 1ADJA 2Q2UA 2VB3X 3PUXA 2MUYA 5IOCA 3DHQA 4XTCS 1HXDA 1PLFA 4DR5L 3A0JA 4P74A 2JA7G 4JBJA 4GKKL 1SNOA 1STGA 2DY8A 3Q8DA 4FF1A 3CHBD 2RCNA 5I4DA 3K5NA 1UEBA 1F9PA 1JCKB 2XN9C 5EBCA 5JVG3 1N33L 4FO2A 1NJ2A 4DN4M 3QOLA 3KBXA 5LHY1 1QE0A 4NW2A 5IGCA 5C5MA 1BCPD 2MO0A 1L1OC 2UUAL 3PGZA 3V8KA 2JE6I 1HPCA 3ITPA 3NSWA 4G4KA 4KN4C 3J80c 3UDXA 2OTLA 4KQEA 5EPKA 3M4PA 1USYA 3AYHB 4DV5L 2PQAB 3WOEA 1ENAA 1MSHA 3L9AX 4LF6L 3CF5A 5ELCA 1CQVA 4A3LG 1F2YA 1AEXA 3ER0A 3R2TA 5HY6A 4CGYB 4ZUJA 1LO5D 4I7AA 4X64Q 1FJGQ 1SERA 1LTID 1Q8KA 3W1GA 3UFGA 4BY7B 4B3ML 2NWGA 2X6GA 1F9RA 4IALA 4JPBW 3T1YQ 3HOZB 4KJNA 3ND8A 4K5XA 3EROA 4V190 3OW2A 3SK6A 2L9HA 3DM3A 5CBEE 1OO9B 1JWMD 4A3LH 2ZM6Q 2K33A 4A3IH 3CRLC 1E2VA 3OOCA 4YP0A 3PO3G 2ODRC 1E22A 3NQTA 2DY7A 3GTLB 1QILA 4GOPB 1D6EC 1TQOA 1HZCA 4R4QA 2F0GA 1WU7A 3KDFB 4XU1A 3PO2G 4I7ZC 1I3QH 1EQTA 4YRTA 4OX9Q 4ZAIA 3SK8A 3U4VA 4QCLA 1B1ZA 5CV9A 4KK7A 4C3JG 2VXWA 1V1OA 4ZK9B 2ZNJA 4YPFA 5CC4A 4R4IA 1I50H 2YTXA 3G1ZA 1W66A 1IL8A 3F2UA 4OIJA 1FD7D 3E0EA 1X65A 4OIKA 1NR4A 3BDCA 3B6YA 4B3SL 1VS0A 1TWHB 1GKHA 4QQBX 2F0JA 1CQFA 3PO2H 2A1AA 3L7ZC 3PIO3 4YHHL 4JI7Q 3MTSA 2EYMA 2A68D 3FHWA 4HSVA 3A8JE 1SRUA 4PMWA 1NR2A 4A75A 2ASBA 1HHVA 2SNMA 2I5HA 4QUFA 3S16B 1HUMA 5D3IB 1PDQA 2G4CA 1CK1A 4H2YA 1KQSA 5IGDA 2FYKA 1LACA 2KHIA 2M9VA 3NHHA 1BXTA 3HOXG 3D0FA 2RSOA 4PZ7A 3C46A 1PH4A 2CGHA 1XNRQ 4DK0A 3RN2A 1D2BA 1STEA 3GTOB 3PQIA 1Y1WH 1VQGA 4KD4A 3EQLC 4A3CG 5CBAE 1E1OA 3BDLA 3ZYYX 5LMNL 1N36Q 1F2MA 1E1TA 1YFRA 1II3A 2ZTGA 4ZIBA 2B2VA 3K0YA 5EJWA 2L4NA 3A8KE 2QCPX 2DGYA 4RA8A 5JJZA 3HXZA 3KF8B 1B8AA 3A7AA 1Q90A 3AB9A 1EYAA 2NUCA 3DM1A 4KY6A 4K6DA 3HFZA 4RCNA 3HOXH 1EY4A 2F4VL 2I4NA
chains in the Genus database with same CATH topology
5M3FG 2VUMG 4YDQA 2UXCL 1XPOA 3ULLA 3A7UA 3PF5A 1ATIA 1EFWA 1H4TA 3RNUA 1Q82C 4R4OA 4QY7A 3EFSA 4OP0A 2DVEA 5IP9H 2VUMH 2ATWA 3HOWG 4G85A 2E1HA 1IBLL 4DV1L 1YJ9A 2LSSA 3JAMc 5IWAL 3E9IA 3PSIA 3I4OA 4YWMA 2E3CA 4B3RL 3CC4A 2HIVA 1AE2A 3EN2A 4UY8C 4AQYL 4PZ6A 4A3KG 3VQWA 4K86A 1XPRA 3BJUA 3RN5A 4HWRA 3ULJA 2IX0A 3RKYA 3K0XA 2PMFA 4YRKA 4G84A 3KOJA 4CH6A 5HGQA 4P3PA 4A3GH 1VQMA 3A31A 4DV0Q 1YFTA 1ASZA 4JV5L 3FKIH 2NS6A 4UP8A 3IG2A 1LUZA 5LMNW 1OXXK 1DGSA 3AEVA 3I4NH 2I4OA 2BA1A 4EX5A 4OWWB 5C4XH 3HXXA 2QA4A 1X3GA 5C44G 3I4MG 3H0GG 4IPCA 4IFDG 4YRCA 4HJ9A 3M7NA 4JI4L 3EIVA 4NXNQ 2BA0A 2BH2A 2VQFL 4NCXA 2HIXA 5FLMH 1G5IA 3NELA 2R7FA 2EL9A 2ZJRA 1NYRA 4HWPA 3KYHC 4YWLA 2A8EA 4GN5A 4DK6C 1VQLA 1Z7MA 1EVKA 2E65A 4XU2A 1E24A 1PV4A 4ALPA 2JA8G 1Y14B 2QHVA 4BW9A 4A3DG 4JI3Q 4CH4A 1KRSA 2I4LA 4CS4A 3VQYA 4X62L 4EO4A 4XEOA 4HT4A 4P3NA 1X55A 1E3PA 1KHIA 3KLWA 4KLKA 1CKMA 1Q7YC 1WI5A 3ERRA 3PUWA 4HA8A 1BBUA 4POFA 3M4OH 2NVTH 3A5UA 1IYJB 1HR0Q 2I4MA 3RKWA 4NB3A 4IFDI 2ZM6L 5JJKA 3ICEA 3QTCA 5GADC 3A32A 1VQ7A 4XTXA 3HFZB 5IYBG 3VDYA 3RKXA 4P72A 1HNWQ 3WQZA 3BZCA 3UDFA 5LMUQ 1T9HA 4DV4L 4HWTA 1WQWA 1CKNA 2NZHA 3NEMA 2I5LX 4LFCL 2ZJQA 4UPAA 1CSQA 4AYBG 3RLNA 2HNIA 4DR2Q 1WCMH 1W3SA 4P72C 5EAYA 1FGUA 4YRFA 2N8NA 2MFIA 1G5HA 4BY7G 2CJAA 1EIFA 4A3FH 3HOZG 2DKGA 1LYLA 1A8VA 5ELNA 1K9MC 1CUKA 2K5VA 1JJCB 4GN3B 3K80C 1EYGA 3RLFA 4CH3A 2K50A 3RLOA 4O2DA 11ASA 3NETA 4LF5Q 1XNRL 5K1PA 4GOPC 2A19A 3HOUH 2C7IA 2ARSA 1X2GA 3PV0A 3RZDH 1H4VB 2DU7A 1WPYA 2CWPA 3GTMH 3K81C 3KJOA 2ZNIA 3GO5A 3MF2A 4RQFA 3STBC 3IKLA 1PH3A 1X2HA 2MNAA 3L2ZA 4GLAC 5IP7G 4Q15A 2P0LA 1NMGA 4A76A 3QO8A 4LNQA 2JQOA 3GD7A 4K87A 4LUOA 4LFAQ 4A3JG 1YNXA 4LF8Q 4A3MH 1V43A 4ZTUB 1PA6A 1C9OA 3F2BA 4HWOA 3S15H 4XTZA 1YBYA 3CC7A 4WF2A 4IOCA 5JJLA 3EFRA 4XTUA 5M5XH 3TEHA 2E41A 4DR7L 3MF1A 5C4JH 4A3JH 4E51A 1HZBA 1HH2P 1SLJA 3RUXA 3RGLA 1JB7A 4P71C 3TS0A 1KD1C 1M90C 2OQ0A 2K14A 2DJZA 3UE1A 1XJVA 3LSQA 1XTDA 4HJ8A 4BA2I 2R93H 4L5TA 2KENA 3OTOQ 3HXVA 2UUBQ 4YRJA 3UH0A 4DR6Q 2K52A 4MNOA 1VQBA 3KF6A 3OYYA 2WAQG 2R6GA 3HRIA 5C52B 2E64A 4HWSA 4JI1Q 3K8AA 1WQ7A 2WB1G 1YEZA 4TWAA 4GNXB 4P74C 1D7QA 2ZZGA 4NXNL 2ES2A 5E7NA 5IYCG 4KHPQ 4A3BH 4R4CA 1K73C 5ELOA 2Q2HA 4POGA 1C0AA 4ZTZB 1SESA 4A3IG 4MTNA 1VQOA 4B3TQ 4XTWA 1YIJA 5JEAJ 3M4QA 2MQHA 2EJ9A 1SROA 3HY0A 5GAEC 5IYCH 1MKHA 1CKNB 1LM0A 2R7DA 2VL6A 1USYC 3IALA 4KHZA 5IE8A 4JI3L 1K83H 3CCJA 4TTVA 1V9PA 3KFUA 3CW2C 1S40A 5GROA 1WYDA 1UWVA 4YY3Q 1EVLA 4BXXG 4P73A 4LVMA 1RIQA 4QGUA 4YREA 1ASYA 2E5AA 3S1NH 3T1HQ 2ZR2A 3CCLA 1HR0L 1BVSA 1IBKQ 2UU9L 3I56A 3VQXA 2PI2A 1PYSA 4BXXH 1Y1WG 2ZR3A 4IPGA 4LFBQ 3I55A 3GTPH 4OO1G 2DEQA 1VQ8A 1JMCA 3RACA 2AWNA 5LMUL 2DXUA 1SN8A 1Z47A 1JJ2A 1QVCA 1NJIC 2OWOA 1VQZA 4GN4B 4GS3A 4BBSH 5C51B 2E10A 1SRYA 4JI2Q 1M1KC 2B3GA 2HQLA 2DU5A 2QHTA 4DR2L 2JA9A 5IP9G 4UP7A 2DXTA 1N9WA 4A4IA 2JEAI 2Q2IA 2YU9H 1VQCA 4JI8Q 1OXTA 3BFMA 2K75A 4OXPA 1KOGA 1Q86C 2B29A 4RQEA 4DR1Q 3ERSX 2ID0A 2E8GA 3BU2A 1D8LA 1X54A 3F8TA 1NJ6A 2EWNA 1J6QA 3TEHB 1NJ8A 2JK8A 3GTJH 3G71A 4HVCA 1J5EL 4GKJQ 1B76A 4BBRH 1JJCA 1Z7NA 4LNSA 1PH8A 4C2MH 2CCZA 5AJ3Q 2UXBQ 1B70A 5M3MH 2DQ0A 3G6EA 2YTVA 1PH6A 1UE1A 3HRKA 4H2WA 3AFQA 2RF4A 1GVPA 2GVAA 1QF6A 4YROA 2ALYA 1EQRA 2Q7EA 4A3GG 5M5YH 4HIOA 1I6HH 1N34Q 1PYBA 2GVBA 1XMQQ 4H02A 1HR0W 1TWAH 2UUCQ 1H4SA 1GO3E 3FKIG 3KF6B 1KMNA 1VQ4A 4YWKA 4H2VA 4JBWA 3PUYA 4A3EG 4C3HH 3S1RH 1C7YA 1EWIA 4QL5A 1VQ6A 3I4NG 2WFWA 2N49A 1HZAA 1SE8A 3L1AA 5C4XG 3W1BA 1V1QA 4JG2A 1WJJA 4AIMA 3H3VH 3S1MH 2QEXA 4BA1I 3DLLA 2UXDQ 4DV3Q 1NE3A 1YHAA 1SFOH 4CS2A 4A3EH 4H2XA 2AMCA 1Q12A 3EBEA 2ARTA 1I5FA 4XEMA 2EAYA 2Q7GA 4TQUS 1NYQA 4JOIA 5FLMG 1EUJA 1X3FA 4KI0A 1XNQL 3V7RA 2CJBA 4YCUA 4LW1A 4DR5Q 3MEFA 1O7IA 2ZT6A 2CKZB 3S14H 2ZTEA 4BWAA 4LVIA 2VQEL 3HOYH 3OTOL 1YVCA 2ZZEA 3J7ZC 2UUBL 3HOVG 5DLQE 3K7UC 4JOIC 2DTHA 4DR6L 1PH9A 2KHJA 2L15A 4LF7Q 1OTCA 1S72A 1TWGH 2K5NA 2Q5IA 3P8VA 3CXCA 4XU3A 2VW9A 4DKAC 4DV5Q 4O0AA 3HOVH 4APVA 4ME3A 3I7FA 4LF4Q 3J81j 1B7YA 3FP9A 4KHPL 4DAYB 1YITA 1PYSB 2GN5A 2E2JH 2JA6G 4BY1G 3PUZA 4X64L 1FJGL 3H15A 2E2HH 2ZINA 4K88A 4UP9A 4B3TL 2EJGA 2HT1A 1GM5A 1EOVA 2P5IA 5FJ8G 3T1YL 5FLXc 2YTYA 2OTJA 1TXYA 3GTKH 2JA6H 3LC0A 4GNXA 4BY1H 2IHFA 1YJWA 2KBNA 1VQ9A 4GLXA 3K7AH 1PH7A 5FJ8H 2V1CC 2AWOA 3AFPA 3CCQA 2OQKA 1WCMG 2ZIMA 4OX9L 1VQHA 4YHHQ 4JI6Q 2ZCEA 4YY3L 3UDGA 5GQOA 4A3FG 4H2TA 4GNXC 2RHSA 3PCOA 4A93H 1YB3A 1G291 2ZTDA 4YCWA 5K36G 5M5WH 3T1HL 4FDBA 3S17H 2LXKA 1R9TH 3TEGA 4NXMQ 4JI7L 1YI2A 1K8AC 1IBKL 4CH5A 5F5WA 4LVJA 3CP0A 4CS3A 4YRPA 3GTGH 3HOUG 4LFBL 4K0KQ 5LMNQ 4L5SA 1Y1VH 1B70B 2F52A 3U4ZA 1X9NA 4IJHA 2RHQA 2UXCQ 3V7CA 4HJ7A 3S2DH 1HJPA 3W3SA 2ALYB 1N36L 4WI1A 4JI2L 4HIMA 1VQ5A 2I0QA 1Q1EA 4DV7Q 1YHQA 2IHEA 3G4SA 1J5WA 4X6AH 1BIAA 3REXA 5C0XJ 1N32Q 3HY1A 1G51A 5C3EH 4DR1L 2AKWA 4IPDA 1KC8C 3TUPA 3S1QH 4MZ9A 3CPFA 4A3MG 3AQQA 1KAWA 2WP8J 3A5ZA 4HIDA 2B63H 3U50C 4H2XB 2AMCB 4Y7NH 5JEAG 2ZJPA 2KCMA 1NJ5A 5BR8Q 3CC2A 1BBWA 5AJ3L 2UXBL 4X65Q 4LVLA 1K0RA 4JC0A 3PF4A 2J3LA 2A8VA 3CCRA 3CMQA 3HXUA 4OWXB 1N34L 3KJPA 3MQZA 2R93G 2UUCL 1RIPA 1RL2A 4DR3Q 2ZT7A 1Z9FA 4JV5Q 1UE6A 4P75A 2Q5HA 1TWCH 1PVOA 1NTGA 4TVYA 2R92G 4DV0L 1A63A 1B7YB 4QIWE 4KR2A 3CAMA 3F2DA 1VQIA 4X66Q 2ZGWA 3JC66 4OWTB 2UXDL 4KR3A 4DV3L 3REUA 2VNUD 3ICAA 3UE0A 4H2UA 2ZTCA 5E3IA 1FYFA 4JI4Q 4A3BG 2R92H 2DTIA 1L1OA 1U5KA 1VQAA 3M85A 5KNNA 5JJIA 3D31A 1HNZQ 1K3RA 1U0LA 4JBKA 1KRTA 5IYDH 1VCIA 3TREA 2JA5G 4DQ2A 5GAHC 2JA7H 2LXJA 2EXDA 4LF7L 4P3OA 2J3MA 5GAGC 2IY5B 3ZJYC 1PFSA 2KCTA 1G6PA 2RHSB 4YCVA 3PCOB 2HHHQ 4DPGA 4X62Q 2JA5H 4LF4L 4AH6A 2R7ZG 4WJ4A 2PMEA 4AYBE 2I5MX 4L5RC 3CCMA 1Q81C 1P8LA 5H1SE 4DR4Q 3CMEA 4RG1A 2ZXFA 1W2BA 1IBMQ 3U58A 1MJEA 4PG3A 2R7ZH 2RHQB 3A7RA 4Y52H 4PZ8A 3S2HH 3HTZA 2F3IA 3PIOA 2Q2TA 3V8LA 4DV4Q 1X6OA 4BBSG 3PO3H 1TWFH 2N3SA 4H2SA 4P73C 4DUZQ 3QO7A 1WFQA 4LFCQ 1HNWL 2DUDA 2CQOA 1KMMA 1NY4A 4JI6L 2PNHA 2Q7HA 2JJQA 3J81c 2E5LQ 3QNEA 4C3JH 1PHJA 3PUVA 1I94Q 2AKWB 1QVFA 3TS2A 2C8MA 3A5ZB 4NXML 2YV5A 1HNXQ 4YRLA 3A5YA 1P16A 4TVWA 2ZIOA 4YRSA 4K0KL 2FXQA 1OXSC 3NBHB 4DV2Q 2Z6KA 3TRZA 4DV6Q 1OXVA 1NNHA 1Q1BA 4BBRG 2ZZFA 4TQFA 2XTIA 2VY3A 4LF5L 2CIMA 5M3MG 3WWVA 2JEBI 4A3CH 2QHUA 3DSQA 4YRIA 3M9BA 3J7A5 2Z6KC 4R4TA 3P8YA 5M3FH 4DV7L 4JYAQ 2XGTA 4LF9Q 4OO1I 2ZT5A 3FJPA 3CMAA 3VBBA 5J3BA 1FL0A 1N32L 4DUYQ 3UGQA 4JI0Q 4OONA 3G48A 1CKOA 4IJLA 2MO1A 4DAMA 2CJ9A 1A62A 3CCSA 2BH8A 3HOWH 1VQPA 12ASA 1VQKA 3GTQH 3RR5A 2H5XA 4JI5Q 1PH1A 5BR8L 1XMOQ 2WAQE 4TVAA 1QUQA 4LFAL 1L1OB 4X65L 4LVKA 4DR7Q 3L4GA 4LF8L 1WLEA 1UE7A 4NPSA 1AH9A 3PIPA 2E2IH 4JBMA 5C53B 2K4KA 2WB1E 1LTLA 4A3KH 1QZHA 1S3OA 1A0IA 3HOYG 3W5OA 2NVYH 1KXLA 1IZ6A 4DR3L 4OLFA 1EQQA 4IPHA 1YFSA 3A74A 2NZOA 2N78A 4GKKQ 3UGTA 3V8JA 4WJ3M 1PH5A 1N33Q 2K5HA 2VS1A 2DDZA 1WNLA 3RL6A 4X66L 4GLVB 3J80i 3GDEA 2UUAQ 1FVIA 4RDXA 1X56A 3H3VI 2AHOB 3STBD 5K1XA 3MEYA 2EQSA 4JI1L 3S24A 4J15A 2EIFA 4JCVE 5C44H 3I4MH 4Q6GA 4LF6Q 3CQZH 2DZ9A 1L0WA 3HKZG 3H0GH 3VQVA 1EIYA 1HNZL 4B3MQ 2Y0SG 1CSPA 4LUVA 1GD7A 2NVXH 2CFMA 3OD1A 1IL2A 4C3IH 1NJ1A 3HXYA 5C0XG 2EJFA 3PZCA 4XIGS 3CPWA 4HJ5A 2DTOA 1AE3A 2YYZA 3IKMB 3UDIA 2HHHL 1BKBA 1JJGA 3CCEA 1X3EA 2JA8H 3TQYA 1GGMA 2NN6G 4A93G 3BZKA 2PI2E 4A3DH 1KIXA 3J81i 4L87A 3CCVA 4LWCA 1SMXA 4B3SQ 2NVQH 1N8RC 1QVGA 1H95A 3I2ZA 2ARUA 4DR4L 3V7SA 2IY5A 2VZAA 2UU9Q 1IBML 2Z0SA 4XU0A 4L5QA 2PQAA 3RZOH 1Y1VG 2D0PA 5IT9c 1VQNA 4R1JA 3RF1A 3L0OA 3RIRA 2IT1A 4DUZL 5IYBH 2DZCA 4IFDJ 4EQ5A 1VQDA 1L2FA 1K8GA 4YRQA 4YRMA 4YRGA 4GOPA 1QZGA 2E5LL 2F4VQ 4LUZA 5C0XI 1HC7A 3KDFA 4X5OA 3IRBA 1I94L 3R07A 4DNIA 2OCEA 1HTTA 3ULPA 2IX1A 1SETA 1Q46A 5C3EG 1VQJA 1BIBA 1HNXL 2C35B 4TQDA 1OXUA 2NN6I 1MJCA 4BY7H 4JI8L 4IOAA 3HKSA 2D0OA 3HOZH 2B63G 3NENA 3F1ZA 3LSSA 3JAMi 5IY0A 4TVAB 4DV2L 4YRRA 2ZT8A 4DV6L 1QUQB 2QHSA 1IBLQ 4DV1Q 3L4GB 1JE5A 1J5EQ 2ODRD 5IWAQ 3HFVA 1IXRA 3E9HA 3CD6A 4XTYA 3L2PA 3GTLH 2CWAA 3F2CA 4B3RQ 4YYEA 4YRNA 1MIUA 4GKJL 4HIKA 1VQFA 3SGIA 1ADYA 4AQYQ 4PHCA 4IO9A 1E7ZA 1JT8A 4JYAL 4LF9L 1TWHH 1KL9A 1SR3A 4DUYL 1H4QA 4JI0L 2QGQA 4DK3C 1YHBA 1XMQL 2DQ3A 1NBWA 3S16H 4P71A 1XPUA 3MXNB 4QJFA 5IP7H 1VQEA 1HZ9A 2D62A 4JI5L 1XMOL 3QO5A 3GTOH 1X01A 1NMFA 3P8TA 1YGBA 1EIYB 3HXWA 1XNQQ 1YJNA 1YZ6A 4RMFA 1WOCA 3HKZE 4P75C 2PMZE 1PH2A 3CCUA 2Y0SE 4XTVA 1UE5A 3LGJA 2VQEQ 5IYDG 2VQFQ 3M3YH 4HJAA 1ADJA 2Q2UA 3PUXA 4XTCS 1HXDA 4DR5L 3A0JA 4P74A 2JA7G 4JBJA 4GKKL 3Q8DA 2RCNA 1UEBA 1N33L 1NJ2A 1QE0A 2MO0A 1L1OC 2UUAL 3PGZA 3V8KA 2JE6I 3J80c 3UDXA 2OTLA 4KQEA 3M4PA 1USYA 3AYHB 4DV5L 2PQAB 4LF6L 3CF5A 4A3LG 3ER0A 4X64Q 1FJGQ 5HY6A 1SERA 1Q8KA 3W1GA 3UFGA 4B3ML 3T1YQ 3OW2A 3DM3A 4A3LH 2ZM6Q 4A3IH 4YP0A 3PO3G 2ODRC 1E22A 4GOPB 1HZCA 4R4QA 1WU7A 3KDFB 4XU1A 3PO2G 1I3QH 4YRTA 4OX9Q 3U4VA 2ZNJA 4YPFA 4R4IA 1I50H 2YTXA 3G1ZA 1W66A 3E0EA 1X65A 3B6YA 4B3SL 1VS0A 1GKHA 4QQBX 3PO2H 2A1AA 3L7ZC 4YHHL 4JI7Q 3FHWA 1SRUA 4PMWA 4A75A 2ASBA 2I5HA 2G4CA 4H2YA 1KQSA 2FYKA 2KHIA 3HOXG 3D0FA 4PZ7A 1PH4A 2CGHA 1XNRQ 3RN2A 1Y1WH 1VQGA 4A3CG 1E1OA 1N36Q 5LMNL 1E1TA 1YFRA 2ZTGA 4ZIBA 3HXZA 2DGYA 3KF8B 1B8AA 3A7AA 3HFZA 3HOXH 2F4VL 2I4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3F G;  2VUM G;  4YDQ A;  2UXC L;  1XPO A;  3ULL A;  3A7U A;  3PF5 A;  1ATI A;  1EFW A;  1H4T A;  3RNU A;  1Q82 C;  4R4O A;  4QY7 A;  3EFS A;  4OP0 A;  2DVE A;  5IP9 H;  2VUM H;  2ATW A;  3HOW G;  4G85 A;  2E1H A;  1IBL L;  4DV1 L;  1YJ9 A;  2LSS A;  3JAM c;  5IWA L;  3E9I A;  3PSI A;  3I4O A;  4YWM A;  2E3C A;  4B3R L;  3CC4 A;  2HIV A;  1AE2 A;  3EN2 A;  4UY8 C;  4AQY L;  4PZ6 A;  4A3K G;  3VQW A;  4K86 A;  1XPR A;  3BJU A;  3RN5 A;  4HWR A;  3ULJ A;  2IX0 A;  3RKY A;  3K0X A;  2PMF A;  4YRK A;  4G84 A;  3KOJ A;  4CH6 A;  5HGQ A;  4P3P A;  4A3G H;  1VQM A;  3A31 A;  4DV0 Q;  1YFT A;  1ASZ A;  4JV5 L;  3FKI H;  4UP8 A;  3IG2 A;  1LUZ A;  5LMN W;  1OXX K;  1DGS A;  3AEV A;  3I4N H;  2I4O A;  2BA1 A;  4EX5 A;  4OWW B;  5C4X H;  3HXX A;  2QA4 A;  1X3G A;  5C44 G;  3I4M G;  3H0G G;  4IPC A;  4IFD G;  4YRC A;  4HJ9 A;  3M7N A;  4JI4 L;  3EIV A;  4NXN Q;  2BA0 A;  2BH2 A;  2VQF L;  4NCX A;  2HIX A;  5FLM H;  1G5I A;  3NEL A;  2R7F A;  2EL9 A;  2ZJR A;  1NYR A;  4HWP A;  3KYH C;  4YWL A;  4GN5 A;  4DK6 C;  1VQL A;  1Z7M A;  1EVK A;  2E65 A;  4XU2 A;  1E24 A;  1PV4 A;  4ALP A;  2JA8 G;  1Y14 B;  2QHV A;  4BW9 A;  4A3D G;  4JI3 Q;  4CH4 A;  1KRS A;  2I4L A;  4CS4 A;  3VQY A;  4X62 L;  4EO4 A;  4XEO A;  4P3N A;  1X55 A;  1E3P A;  1KHI A;  3KLW A;  4KLK A;  1CKM A;  1Q7Y C;  1WI5 A;  3ERR A;  3PUW A;  4HA8 A;  1BBU A;  4POF A;  3M4O H;  2NVT H;  3A5U A;  1IYJ B;  1HR0 Q;  2I4M A;  3RKW A;  4NB3 A;  4IFD I;  2ZM6 L;  5JJK A;  3ICE A;  3QTC A;  5GAD C;  3A32 A;  1VQ7 A;  4XTX A;  3HFZ B;  5IYB G;  3VDY A;  3RKX A;  4P72 A;  1HNW Q;  3WQZ A;  3BZC A;  3UDF A;  5LMU Q;  1T9H A;  4DV4 L;  4HWT A;  1WQW A;  1CKN A;  2NZH A;  3NEM A;  2I5L X;  4LFC L;  2ZJQ A;  4UPA A;  1CSQ A;  4AYB G;  3RLN A;  2HNI A;  4DR2 Q;  1WCM H;  1W3S A;  4P72 C;  5EAY A;  1FGU A;  4YRF A;  2N8N A;  2MFI A;  1G5H A;  4BY7 G;  2CJA A;  1EIF A;  4A3F H;  3HOZ G;  2DKG A;  1LYL A;  1A8V A;  5ELN A;  1K9M C;  1CUK A;  2K5V A;  1JJC B;  4GN3 B;  3K80 C;  1EYG A;  3RLF A;  4CH3 A;  2K50 A;  3RLO A;  4O2D A;  11AS A;  3NET A;  4LF5 Q;  1XNR L;  5K1P A;  4GOP C;  2A19 A;  3HOU H;  2C7I A;  2ARS A;  1X2G A;  3PV0 A;  3RZD H;  1H4V B;  2DU7 A;  1WPY A;  2CWP A;  3GTM H;  3K81 C;  3KJO A;  2ZNI A;  3GO5 A;  3MF2 A;  4RQF A;  3STB C;  3IKL A;  1PH3 A;  1X2H A;  2MNA A;  3L2Z A;  4GLA C;  5IP7 G;  4Q15 A;  2P0L A;  1NMG A;  4A76 A;  3QO8 A;  4LNQ A;  2JQO A;  3GD7 A;  4K87 A;  4LUO A;  4LFA Q;  4A3J G;  1YNX A;  4LF8 Q;  4A3M H;  1V43 A;  4ZTU B;  1PA6 A;  1C9O A;  3F2B A;  4HWO A;  3S15 H;  4XTZ A;  1YBY A;  3CC7 A;  4WF2 A;  4IOC A;  5JJL A;  3EFR A;  4XTU A;  5M5X H;  3TEH A;  2E41 A;  4DR7 L;  3MF1 A;  5C4J H;  4A3J H;  4E51 A;  1HZB A;  1HH2 P;  1SLJ A;  3RUX A;  3RGL A;  1JB7 A;  4P71 C;  3TS0 A;  1KD1 C;  1M90 C;  2OQ0 A;  2K14 A;  2DJZ A;  3UE1 A;  1XJV A;  3LSQ A;  1XTD A;  4HJ8 A;  4BA2 I;  2R93 H;  4L5T A;  2KEN A;  3OTO Q;  3HXV A;  2UUB Q;  4YRJ A;  3UH0 A;  4DR6 Q;  2K52 A;  4MNO A;  1VQB A;  3KF6 A;  3OYY A;  2WAQ G;  2R6G A;  3HRI A;  5C52 B;  2E64 A;  4HWS A;  4JI1 Q;  3K8A A;  1WQ7 A;  2WB1 G;  1YEZ A;  4TWA A;  4GNX B;  4P74 C;  1D7Q A;  2ZZG A;  4NXN L;  2ES2 A;  5E7N A;  5IYC G;  4KHP Q;  4A3B H;  4R4C A;  1K73 C;  5ELO A;  2Q2H A;  4POG A;  1C0A A;  4ZTZ B;  1SES A;  4A3I G;  4MTN A;  1VQO A;  4B3T Q;  4XTW A;  1YIJ A;  5JEA J;  3M4Q A;  2MQH A;  2EJ9 A;  1SRO A;  3HY0 A;  5GAE C;  5IYC H;  1MKH A;  1CKN B;  1LM0 A;  2R7D A;  2VL6 A;  1USY C;  3IAL A;  4KHZ A;  5IE8 A;  4JI3 L;  1K83 H;  3CCJ A;  4TTV A;  1V9P A;  3KFU A;  3CW2 C;  1S40 A;  5GRO A;  1WYD A;  1UWV A;  4YY3 Q;  1EVL A;  4BXX G;  4P73 A;  1RIQ A;  4QGU A;  4YRE A;  1ASY A;  2E5A A;  3S1N H;  3T1H Q;  2ZR2 A;  3CCL A;  1HR0 L;  1BVS A;  1IBK Q;  2UU9 L;  3I56 A;  3VQX A;  2PI2 A;  1PYS A;  4BXX H;  1Y1W G;  2ZR3 A;  4IPG A;  4LFB Q;  3I55 A;  3GTP H;  4OO1 G;  2DEQ A;  1VQ8 A;  1JMC A;  3RAC A;  2AWN A;  5LMU L;  2DXU A;  1SN8 A;  1Z47 A;  1JJ2 A;  1QVC A;  1NJI C;  2OWO A;  1VQZ A;  4GN4 B;  4GS3 A;  4BBS H;  5C51 B;  2E10 A;  1SRY A;  4JI2 Q;  1M1K C;  2B3G A;  2HQL A;  2DU5 A;  2QHT A;  4DR2 L;  2JA9 A;  5IP9 G;  4UP7 A;  2DXT A;  1N9W A;  4A4I A;  2JEA I;  2Q2I A;  2YU9 H;  1VQC A;  4JI8 Q;  1OXT A;  3BFM A;  2K75 A;  4OXP A;  1KOG A;  1Q86 C;  2B29 A;  4RQE A;  4DR1 Q;  3ERS X;  2ID0 A;  2E8G A;  3BU2 A;  1D8L A;  1X54 A;  3F8T A;  1NJ6 A;  2EWN A;  1J6Q A;  3TEH B;  1NJ8 A;  2JK8 A;  3GTJ H;  3G71 A;  4HVC A;  1J5E L;  4GKJ Q;  1B76 A;  4BBR H;  1JJC A;  1Z7N A;  4LNS A;  1PH8 A;  4C2M H;  2CCZ A;  5AJ3 Q;  2UXB Q;  1B70 A;  5M3M H;  2DQ0 A;  3G6E A;  2YTV A;  1PH6 A;  1UE1 A;  3HRK A;  4H2W A;  3AFQ A;  2RF4 A;  1GVP A;  2GVA A;  1QF6 A;  4YRO A;  2ALY A;  1EQR A;  2Q7E A;  4A3G G;  5M5Y H;  4HIO A;  1I6H H;  1N34 Q;  1PYB A;  2GVB A;  1XMQ Q;  4H02 A;  1HR0 W;  1TWA H;  2UUC Q;  1H4S A;  1GO3 E;  3FKI G;  3KF6 B;  1KMN A;  1VQ4 A;  4YWK A;  4H2V A;  4JBW A;  3PUY A;  4A3E G;  4C3H H;  3S1R H;  1C7Y A;  1EWI A;  4QL5 A;  1VQ6 A;  3I4N G;  2WFW A;  2N49 A;  1HZA A;  1SE8 A;  3L1A A;  5C4X G;  3W1B A;  1V1Q A;  4JG2 A;  1WJJ A;  4AIM A;  3H3V H;  3S1M H;  2QEX A;  4BA1 I;  3DLL A;  2UXD Q;  4DV3 Q;  1NE3 A;  1YHA A;  1SFO H;  4CS2 A;  4A3E H;  4H2X A;  2AMC A;  1Q12 A;  3EBE A;  2ART A;  1I5F A;  4XEM A;  2EAY A;  2Q7G A;  4TQU S;  1NYQ A;  4JOI A;  5FLM G;  1EUJ A;  1X3F A;  4KI0 A;  1XNQ L;  3V7R A;  2CJB A;  4YCU A;  4LW1 A;  4DR5 Q;  3MEF A;  1O7I A;  2ZT6 A;  2CKZ B;  3S14 H;  2ZTE A;  4BWA A;  2VQE L;  3HOY H;  3OTO L;  1YVC A;  2ZZE A;  3J7Z C;  2UUB L;  3HOV G;  5DLQ E;  3K7U C;  4JOI C;  2DTH A;  4DR6 L;  1PH9 A;  2KHJ A;  2L15 A;  4LF7 Q;  1OTC A;  1S72 A;  1TWG H;  2K5N A;  2Q5I A;  3P8V A;  3CXC A;  4XU3 A;  2VW9 A;  4DKA C;  4DV5 Q;  4O0A A;  3HOV H;  4APV A;  4ME3 A;  3I7F A;  4LF4 Q;  3J81 j;  1B7Y A;  3FP9 A;  4KHP L;  4DAY B;  1YIT A;  1PYS B;  2GN5 A;  2E2J H;  2JA6 G;  4BY1 G;  3PUZ A;  4X64 L;  1FJG L;  3H15 A;  2E2H H;  2ZIN A;  4K88 A;  4UP9 A;  4B3T L;  2EJG A;  2HT1 A;  1GM5 A;  1EOV A;  2P5I A;  5FJ8 G;  3T1Y L;  5FLX c;  2YTY A;  2OTJ A;  1TXY A;  3GTK H;  2JA6 H;  3LC0 A;  4GNX A;  4BY1 H;  2IHF A;  1YJW A;  2KBN A;  1VQ9 A;  4GLX A;  3K7A H;  1PH7 A;  5FJ8 H;  2V1C C;  2AWO A;  3AFP A;  3CCQ A;  2OQK A;  1WCM G;  2ZIM A;  4OX9 L;  1VQH A;  4YHH Q;  4JI6 Q;  2ZCE A;  4YY3 L;  3UDG A;  5GQO A;  4A3F G;  4H2T A;  4GNX C;  2RHS A;  3PCO A;  4A93 H;  1YB3 A;  1G29 1;  2ZTD A;  4YCW A;  5K36 G;  5M5W H;  3T1H L;  4FDB A;  3S17 H;  2LXK A;  1R9T H;  3TEG A;  4NXM Q;  4JI7 L;  1YI2 A;  1K8A C;  1IBK L;  4CH5 A;  5F5W A;  3CP0 A;  4CS3 A;  4YRP A;  3GTG H;  3HOU G;  4LFB L;  4K0K Q;  5LMN Q;  4L5S A;  1Y1V H;  1B70 B;  2F52 A;  3U4Z A;  1X9N A;  4IJH A;  2RHQ A;  2UXC Q;  3V7C A;  4HJ7 A;  3S2D H;  1HJP A;  3W3S A;  2ALY B;  1N36 L;  4WI1 A;  4JI2 L;  4HIM A;  1VQ5 A;  2I0Q A;  1Q1E A;  4DV7 Q;  1YHQ A;  2IHE A;  3G4S A;  1J5W A;  4X6A H;  1BIA A;  3REX A;  5C0X J;  1N32 Q;  3HY1 A;  1G51 A;  5C3E H;  4DR1 L;  2AKW A;  4IPD A;  1KC8 C;  3TUP A;  3S1Q H;  4MZ9 A;  3CPF A;  4A3M G;  3AQQ A;  1KAW A;  2WP8 J;  3A5Z A;  4HID A;  2B63 H;  3U50 C;  4H2X B;  2AMC B;  4Y7N H;  5JEA G;  2ZJP A;  2KCM A;  1NJ5 A;  5BR8 Q;  3CC2 A;  1BBW A;  5AJ3 L;  2UXB L;  4X65 Q;  1K0R A;  4JC0 A;  3PF4 A;  2J3L A;  2A8V A;  3CCR A;  3CMQ A;  3HXU A;  4OWX B;  1N34 L;  3KJP A;  2R93 G;  2UUC L;  1RIP A;  1RL2 A;  4DR3 Q;  2ZT7 A;  1Z9F A;  4JV5 Q;  1UE6 A;  4P75 A;  2Q5H A;  1TWC H;  1PVO A;  1NTG A;  4TVY A;  2R92 G;  4DV0 L;  1A63 A;  1B7Y B;  4QIW E;  4KR2 A;  3CAM A;  3F2D A;  1VQI A;  4X66 Q;  2ZGW A;  3JC6 6;  4OWT B;  2UXD L;  4KR3 A;  4DV3 L;  3REU A;  2VNU D;  3ICA A;  3UE0 A;  4H2U A;  2ZTC A;  5E3I A;  1FYF A;  4JI4 Q;  4A3B G;  2R92 H;  2DTI A;  1L1O A;  1U5K A;  1VQA A;  3M85 A;  5KNN A;  5JJI A;  3D31 A;  1HNZ Q;  1K3R A;  1U0L A;  4JBK A;  1KRT A;  5IYD H;  1VCI A;  3TRE A;  2JA5 G;  4DQ2 A;  5GAH C;  2JA7 H;  2LXJ A;  2EXD A;  4LF7 L;  4P3O A;  2J3M A;  5GAG C;  2IY5 B;  3ZJY C;  1PFS A;  2KCT A;  1G6P A;  2RHS B;  4YCV A;  3PCO B;  2HHH Q;  4DPG A;  4X62 Q;  2JA5 H;  4LF4 L;  4AH6 A;  2R7Z G;  4WJ4 A;  2PME A;  4AYB E;  2I5M X;  4L5R C;  3CCM A;  1Q81 C;  1P8L A;  5H1S E;  4DR4 Q;  3CME A;  4RG1 A;  2ZXF A;  1W2B A;  1IBM Q;  3U58 A;  1MJE A;  4PG3 A;  2R7Z H;  2RHQ B;  3A7R A;  4Y52 H;  4PZ8 A;  3S2H H;  3HTZ A;  2F3I A;  3PIO A;  2Q2T A;  3V8L A;  4DV4 Q;  1X6O A;  4BBS G;  3PO3 H;  1TWF H;  2N3S A;  4H2S A;  4P73 C;  4DUZ Q;  3QO7 A;  1WFQ A;  4LFC Q;  1HNW L;  2DUD A;  2CQO A;  1KMM A;  1NY4 A;  4JI6 L;  2PNH A;  2Q7H A;  2JJQ A;  3J81 c;  2E5L Q;  3QNE A;  4C3J H;  1PHJ A;  3PUV A;  1I94 Q;  2AKW B;  1QVF A;  3TS2 A;  2C8M A;  3A5Z B;  4NXM L;  2YV5 A;  1HNX Q;  4YRL A;  3A5Y A;  1P16 A;  4TVW A;  2ZIO A;  4YRS A;  4K0K L;  2FXQ A;  1OXS C;  3NBH B;  4DV2 Q;  2Z6K A;  3TRZ A;  4DV6 Q;  1OXV A;  1NNH A;  1Q1B A;  4BBR G;  2ZZF A;  4TQF A;  2XTI A;  2VY3 A;  4LF5 L;  2CIM A;  5M3M G;  3WWV A;  2JEB I;  4A3C H;  2QHU A;  3DSQ A;  4YRI A;  3M9B A;  3J7A 5;  2Z6K C;  4R4T A;  3P8Y A;  5M3F H;  4DV7 L;  4JYA Q;  2XGT A;  4LF9 Q;  4OO1 I;  2ZT5 A;  3FJP A;  3CMA A;  3VBB A;  5J3B A;  1FL0 A;  1N32 L;  4DUY Q;  3UGQ A;  4JI0 Q;  4OON A;  3G48 A;  1CKO A;  4IJL A;  2MO1 A;  4DAM A;  2CJ9 A;  1A62 A;  3CCS A;  2BH8 A;  3HOW H;  1VQP A;  12AS A;  1VQK A;  3GTQ H;  3RR5 A;  2H5X A;  4JI5 Q;  1PH1 A;  5BR8 L;  1XMO Q;  2WAQ E;  4TVA A;  1QUQ A;  4LFA L;  1L1O B;  4X65 L;  4DR7 Q;  3L4G A;  4LF8 L;  1WLE A;  1UE7 A;  4NPS A;  1AH9 A;  3PIP A;  2E2I H;  4JBM A;  5C53 B;  2K4K A;  2WB1 E;  1LTL A;  4A3K H;  1QZH A;  1S3O A;  1A0I A;  3HOY G;  3W5O A;  2NVY H;  1KXL A;  1IZ6 A;  4DR3 L;  4OLF A;  1EQQ A;  4IPH A;  1YFS A;  3A74 A;  2NZO A;  2N78 A;  4GKK Q;  3UGT A;  3V8J A;  4WJ3 M;  1PH5 A;  1N33 Q;  2K5H A;  2VS1 A;  2DDZ A;  1WNL A;  3RL6 A;  4X66 L;  4GLV B;  3J80 i;  3GDE A;  2UUA Q;  1FVI A;  4RDX A;  1X56 A;  3H3V I;  2AHO B;  3STB D;  5K1X A;  3MEY A;  2EQS A;  4JI1 L;  3S24 A;  4J15 A;  2EIF A;  4JCV E;  5C44 H;  3I4M H;  4Q6G A;  4LF6 Q;  3CQZ H;  2DZ9 A;  1L0W A;  3HKZ G;  3H0G H;  3VQV A;  1EIY A;  1HNZ L;  4B3M Q;  2Y0S G;  1CSP A;  4LUV A;  1GD7 A;  2NVX H;  2CFM A;  3OD1 A;  1IL2 A;  4C3I H;  1NJ1 A;  3HXY A;  5C0X G;  2EJF A;  3PZC A;  4XIG S;  3CPW A;  4HJ5 A;  2DTO A;  1AE3 A;  2YYZ A;  3IKM B;  3UDI A;  2HHH L;  1BKB A;  1JJG A;  3CCE A;  1X3E A;  2JA8 H;  3TQY A;  1GGM A;  2NN6 G;  4A93 G;  3BZK A;  2PI2 E;  4A3D H;  1KIX A;  3J81 i;  4L87 A;  3CCV A;  4LWC A;  1SMX A;  4B3S Q;  2NVQ H;  1N8R C;  1QVG A;  1H95 A;  3I2Z A;  2ARU A;  4DR4 L;  3V7S A;  2IY5 A;  2VZA A;  2UU9 Q;  1IBM L;  2Z0S A;  4XU0 A;  4L5Q A;  2PQA A;  3RZO H;  1Y1V G;  2D0P A;  5IT9 c;  1VQN A;  4R1J A;  3RF1 A;  3L0O A;  3RIR A;  2IT1 A;  4DUZ L;  5IYB H;  2DZC A;  4IFD J;  4EQ5 A;  1VQD A;  1L2F A;  1K8G A;  4YRQ A;  4YRM A;  4YRG A;  4GOP A;  1QZG A;  2E5L L;  2F4V Q;  4LUZ A;  5C0X I;  1HC7 A;  3KDF A;  4X5O A;  3IRB A;  1I94 L;  3R07 A;  4DNI A;  2OCE A;  1HTT A;  3ULP A;  2IX1 A;  1SET A;  1Q46 A;  5C3E G;  1VQJ A;  1BIB A;  1HNX L;  2C35 B;  4TQD A;  1OXU A;  2NN6 I;  1MJC A;  4BY7 H;  4JI8 L;  4IOA A;  3HKS A;  2D0O A;  3HOZ H;  2B63 G;  3NEN A;  3F1Z A;  3LSS A;  3JAM i;  5IY0 A;  4TVA B;  4DV2 L;  4YRR A;  2ZT8 A;  4DV6 L;  1QUQ B;  2QHS A;  1IBL Q;  4DV1 Q;  3L4G B;  1JE5 A;  1J5E Q;  2ODR D;  5IWA Q;  3HFV A;  1IXR A;  3E9H A;  3CD6 A;  4XTY A;  3L2P A;  3GTL H;  2CWA A;  3F2C A;  4B3R Q;  4YYE A;  4YRN A;  1MIU A;  4GKJ L;  4HIK A;  1VQF A;  3SGI A;  1ADY A;  4AQY Q;  4PHC A;  4IO9 A;  1E7Z A;  1JT8 A;  4JYA L;  4LF9 L;  1TWH H;  1KL9 A;  1SR3 A;  4DUY L;  1H4Q A;  4JI0 L;  2QGQ A;  4DK3 C;  1YHB A;  1XMQ L;  2DQ3 A;  1NBW A;  3S16 H;  4P71 A;  1XPU A;  3MXN B;  4QJF A;  5IP7 H;  1VQE A;  1HZ9 A;  2D62 A;  4JI5 L;  1XMO L;  3QO5 A;  3GTO H;  1X01 A;  1NMF A;  3P8T A;  1YGB A;  1EIY B;  3HXW A;  1XNQ Q;  1YJN A;  1YZ6 A;  4RMF A;  1WOC A;  3HKZ E;  4P75 C;  2PMZ E;  1PH2 A;  3CCU A;  2Y0S E;  4XTV A;  1UE5 A;  3LGJ A;  2VQE Q;  5IYD G;  2VQF Q;  3M3Y H;  4HJA A;  1ADJ A;  2Q2U A;  3PUX A;  4XTC S;  1HXD A;  4DR5 L;  3A0J A;  4P74 A;  2JA7 G;  4JBJ A;  4GKK L;  3Q8D A;  2RCN A;  1UEB A;  1N33 L;  1NJ2 A;  1QE0 A;  2MO0 A;  1L1O C;  2UUA L;  3PGZ A;  3V8K A;  2JE6 I;  3J80 c;  3UDX A;  2OTL A;  4KQE A;  3M4P A;  1USY A;  3AYH B;  4DV5 L;  2PQA B;  4LF6 L;  3CF5 A;  4A3L G;  3ER0 A;  4X64 Q;  1FJG Q;  5HY6 A;  1SER A;  1Q8K A;  3W1G A;  3UFG A;  4B3M L;  3T1Y Q;  3OW2 A;  3DM3 A;  4A3L H;  2ZM6 Q;  4A3I H;  4YP0 A;  3PO3 G;  2ODR C;  1E22 A;  4GOP B;  1HZC A;  4R4Q A;  1WU7 A;  3KDF B;  4XU1 A;  3PO2 G;  1I3Q H;  4YRT A;  4OX9 Q;  3U4V A;  2ZNJ A;  4YPF A;  4R4I A;  1I50 H;  2YTX A;  3G1Z A;  1W66 A;  3E0E A;  1X65 A;  3B6Y A;  4B3S L;  1VS0 A;  1GKH A;  4QQB X;  3PO2 H;  2A1A A;  3L7Z C;  4YHH L;  4JI7 Q;  3FHW A;  1SRU A;  4PMW A;  4A75 A;  2ASB A;  2I5H A;  2G4C A;  4H2Y A;  1KQS A;  2FYK A;  2KHI A;  3HOX G;  3D0F A;  4PZ7 A;  1PH4 A;  2CGH A;  1XNR Q;  3RN2 A;  1Y1W H;  1VQG A;  4A3C G;  1E1O A;  1N36 Q;  5LMN L;  1E1T A;  1YFR A;  2ZTG A;  4ZIB A;  3HXZ A;  2DGY A;  3KF8 B;  1B8A A;  3A7A A;  3HFZ A;  3HOX H;  2F4V L;  2I4N A; 
#chains in the Genus database with same CATH topology
 5M3F G;  2VUM G;  4YDQ A;  2UXC L;  1XPO A;  1EQV A;  3ULL A;  3A7U A;  3PF5 A;  4XYQ A;  5FO8 B;  1ATI A;  5E4W C;  1EFW A;  4M8A A;  1H4T A;  5TSS A;  1CT1 D;  3RNU A;  1M4V A;  2DNC A;  2EPB A;  4R4O A;  1Q82 C;  4K2L A;  4ODG A;  5FLX L;  4QY7 A;  3M3Y B;  3EFS A;  4OP0 A;  2DVE A;  5IP9 H;  1HXY D;  4KKS A;  1SYB A;  4FYD A;  2F0N A;  2VUM H;  4KKT A;  1H9J A;  3TSS A;  4OL7 A;  2ATW A;  3HOW G;  4G85 A;  4RKL A;  2CQA A;  2E1H A;  1IBL L;  4DV1 L;  1YJ9 A;  3R93 A;  1GUG A;  3DWQ A;  5LL6 S;  2N55 A;  5KIX A;  2LSS A;  2HQE A;  3JAM c;  1DYQ A;  4BS9 A;  1SND A;  5IWA L;  1S5B D;  3E9I A;  3PSI A;  1GXD C;  3I4O A;  4YWM A;  2E3C A;  4B3R L;  1LT3 D;  3CC4 A;  2HIV A;  1AE2 A;  1MGS A;  3EN2 A;  1WTP A;  4UY8 C;  4AQY L;  4PZ6 A;  1GJX A;  5JVH 3;  4A3K G;  3VQW A;  1Y8P B;  4K86 A;  1XPR A;  1SEB D;  3BJU A;  2EDG A;  4ZYS A;  3RN5 A;  4HWR A;  3ULJ A;  3R8B A;  2IX0 A;  3MEH A;  4ZUI A;  2F1M A;  1A3V A;  3RKY A;  2EY2 A;  3K0X A;  2PMF A;  4YRK A;  3MHB A;  4RKB A;  3SVM A;  4G84 A;  1R4P B;  3NQI A;  2EY1 A;  5KYI A;  1BO0 A;  1E2W A;  4QB4 A;  2K01 A;  4RGM A;  3KOJ A;  4CH6 A;  5HGQ A;  4P3P A;  4A3G H;  1VQM A;  4A3I B;  3A31 A;  4DV0 Q;  5C4H A;  1YFT A;  3QWN A;  1ASZ A;  2K7V A;  4PNY A;  4JV5 L;  3FKI H;  1WTV A;  3PIP 3;  5CGK A;  2NS6 A;  2EJM A;  4UP8 A;  1I3Q B;  1F77 A;  3J7A F;  2RQX A;  1LUZ A;  3IG2 A;  4QMG A;  5KGU A;  5LMN W;  1BF4 A;  1OXX K;  1DGS A;  3AEV A;  1KNE A;  3I4N H;  1G2S A;  1O7Z A;  1HTP A;  2I4O A;  2BA1 A;  2KED A;  4EX5 A;  4OWW B;  5C4X H;  3HXX A;  1I50 B;  2QA4 A;  3HZX A;  1X3G A;  5C44 G;  3I4M G;  3BVG A;  4XT1 B;  1PTO F;  3H0G G;  3PO2 B;  4I65 A;  4IPC A;  1LTA D;  4IFD G;  4FF3 A;  1PRT C;  1E2Z A;  4YRC A;  4HJ9 A;  1EIG A;  3M7N A;  4JI4 L;  3EIV A;  2OF1 A;  4NXN Q;  2BA0 A;  2BH2 A;  2VQF L;  4NCX A;  2HIX A;  5FLM H;  1G5I A;  5KYL A;  3NEL A;  2R7F A;  2KQ3 A;  2EL9 A;  4C3I G;  2ZJR A;  1NYR A;  4HWP A;  4O1N A;  3KYH C;  4HCS A;  4YWL A;  2WV6 D;  2A8E A;  4GN5 A;  1SE4 A;  4DK6 C;  1Y1W B;  2F0E A;  2F0K A;  4N9P A;  1VQL A;  1Z7M A;  1EVK A;  4LJZ C;  4K8I A;  3X3N A;  3NTI A;  2E65 A;  4XU2 A;  1E24 A;  1WTW A;  1PV4 A;  2WKC A;  4ALP A;  2JA8 G;  1Y14 B;  4NP5 A;  1BOS A;  2QHV A;  5KRU A;  1U4M A;  3HGB A;  3HOX B;  4BW9 A;  4A3D G;  4JI3 Q;  4CH4 A;  1KRS A;  1D1I A;  1TY0 A;  4N8X 1;  2KOL A;  5D14 A;  5DEH A;  2I4L A;  3G7L A;  4CS4 A;  2B2T A;  2WAC A;  4CJ2 C;  2K05 A;  4ZRZ A;  5CV8 A;  3VQY A;  3RD4 A;  1WD0 A;  1EYD A;  1SYF A;  4X62 L;  4EO4 A;  4XEO A;  5BN3 A;  4HT4 A;  2K28 A;  5KNC A;  1H9R A;  4P3N A;  1A6X A;  2QF7 A;  3MFY A;  1X55 A;  2HD3 A;  1E3P A;  1KHI A;  4BWG B;  4FP5 D;  1JOR A;  3KLW A;  1A15 A;  4KLK A;  1CKM A;  1IW7 C;  2VUM B;  1FNV A;  1Q7Y C;  1AW7 A;  2HCC A;  3R2I A;  1WI5 A;  3ERR A;  3PUW A;  4G7O C;  4U67 3;  4HA8 A;  1BBU A;  5ELB A;  3M4Y A;  2IPK D;  5JPM C;  4G7H C;  4POF A;  3M4O H;  2NVT H;  3A5U A;  3IFD A;  1IYJ B;  1HR0 Q;  2I4M A;  3RKW A;  2KUM A;  2K1B A;  4NB3 A;  4Q0F A;  2ZM6 L;  4IFD I;  5JJK A;  1MD2 D;  3ICE A;  3QTC A;  5GAD C;  1XX8 A;  2V4D A;  3A7A B;  3A32 A;  5C6A A;  1VQ7 A;  4XTX A;  4FNF A;  3HFZ B;  5IYB G;  1I4Q A;  3VDY A;  3CRK C;  3RKX A;  4P72 A;  1HNW Q;  3QO2 A;  4K2K A;  2X69 A;  3WQZ A;  3BZC A;  3KLR A;  3UDF A;  5LMU Q;  1B9M A;  1T9H A;  3KBG A;  3MZ5 A;  4DV4 L;  4HWT A;  3LWU A;  1WQW A;  1CKN A;  2NZH A;  1BCP B;  2QDL A;  3K57 A;  3NEM A;  4TRD A;  2I5L X;  4LFC L;  2ZJQ A;  4UPA A;  2EYF A;  1CSQ A;  4AYB G;  3RLN A;  4JW0 A;  2HNI A;  2F0D A;  4DR2 Q;  1WCM H;  1W3S A;  1HQR D;  5EAY A;  4P72 C;  1FGU A;  3OMC A;  4YRF A;  2N8N A;  2MFI A;  4DXG A;  1G5H A;  4BY7 G;  2CJA A;  1EIF A;  4A3F H;  3HOZ G;  1CZW A;  4FVM A;  2DKG A;  2DNE A;  1LYL A;  1A8V A;  5ELN A;  1K9M C;  4A3G B;  1CUK A;  4C1N I;  2K5V A;  1JJC B;  4GN3 B;  3K80 C;  5K36 H;  1MSG A;  1EYG A;  3NWT A;  1RTN A;  4DU9 A;  5EKK A;  3RLF A;  5DM6 3;  4CH3 A;  2XSC A;  3FKI B;  2K50 A;  3RLO A;  1VMC A;  4O2D A;  1GUN A;  11AS A;  3NET A;  4LF5 Q;  1XNR L;  3C2P A;  5K1P A;  1JOO A;  2K5Q A;  4GOP C;  2RVL A;  2A19 A;  3I4N B;  5JOB A;  3HOU H;  2EZV A;  5HGT A;  5C4X B;  2K6A A;  2C7I A;  2ARS A;  1NAP A;  3HG9 A;  4IUR A;  1X2G A;  1PTO D;  1YNJ D;  3PV0 A;  3A55 A;  3RZD H;  1H4V B;  2DU7 A;  3X3M A;  1WPY A;  3I91 A;  2CWP A;  3GTM H;  3K81 C;  3KJO A;  2A6E C;  2Z8L A;  2ZNI A;  1BNZ A;  1PZK D;  3GO5 A;  3E5S A;  3MF2 A;  5COY A;  4RQF A;  4HSP A;  4RHS A;  2K32 A;  4OEM B;  3STB C;  3IKL A;  3I72 A;  2ZXP A;  1PH3 A;  4CKE A;  1B44 D;  1I6V C;  1TKW B;  1X2H A;  2Z4I A;  1AN8 A;  2MNA A;  1EZ8 A;  3L2Z A;  4GLA C;  1XXG A;  5IP7 G;  4Q15 A;  4EQN A;  1W6J A;  2SNS A;  3N6R A;  2KCN A;  2P0L A;  1NMG A;  1TT2 A;  5IOD A;  1Q8I A;  4A76 A;  3QO8 A;  4LNQ A;  2JQO A;  3J81 L;  3GD7 A;  4K87 A;  3DEO A;  4LUO A;  4LFA Q;  4A3J G;  1YNX A;  4LF8 Q;  4A3M H;  1V43 A;  3RUZ A;  4ZTU B;  1PA6 A;  1C9O A;  3P20 A;  1Q3L A;  1HA6 A;  3F2B A;  4HWO A;  5FKA C;  2O2L D;  3S15 H;  4XTZ A;  1YBY A;  3CC7 A;  4KTA A;  4KN7 C;  4WF2 A;  4IOC A;  5JEA H;  1PXU A;  3MXP A;  4QIW B;  5JJL A;  2KCC A;  2B39 A;  3EFR A;  4XTU A;  3PMF A;  1T5E A;  5M5X H;  3TEH A;  2E41 A;  4TKO B;  4DR7 L;  3MF1 A;  5C4J H;  4A3J H;  4E51 A;  2L55 A;  1HZB A;  1G8Z D;  1HH2 P;  1WTX A;  1SLJ A;  2O5I C;  3RUX A;  4IZ8 A;  3RGL A;  3NTK A;  2PMZ B;  1JB7 A;  4P71 C;  3TS0 A;  1KD1 C;  4JVZ A;  1M90 C;  3K59 A;  3M4O B;  2OQ0 A;  2NVT B;  2K14 A;  2G5D A;  2DJZ A;  3UE1 A;  4X3K A;  1XJV A;  3KUP A;  1TS2 A;  3LSQ A;  2B2W C;  1XTD A;  4HJ8 A;  2AQ1 B;  4BA2 I;  2R93 H;  1VF7 A;  4L5T A;  1QCB D;  2KEN A;  4X3U A;  3OTO Q;  4RH6 A;  3HXV A;  1DCZ A;  2UUB Q;  4YRJ A;  4E6I A;  3UH0 A;  3D6W A;  4DR6 Q;  1DON A;  2K52 A;  1A3U A;  4MNO A;  1VQB A;  2EYJ A;  3KF6 A;  3OYY A;  2WAQ G;  1K28 A;  4DA2 A;  3IKJ A;  2R6G A;  3HRI A;  5C52 B;  2E64 A;  4HWS A;  4JI1 Q;  5FLX E;  3K8A A;  3ERQ A;  1WQ7 A;  2AUK A;  4CDF C;  1WCM B;  2WB1 G;  1YEZ A;  4KY7 A;  2E75 C;  3E6Z X;  1JOQ A;  4TWA A;  4HTH A;  4GNX B;  4P74 C;  1D7Q A;  2ZZG A;  4A3F B;  3SK4 A;  3NXW A;  2R3Z A;  4NXN L;  2ES2 A;  5E7N A;  5IYC G;  4KHP Q;  4A3B H;  4R4C A;  1K73 C;  5ELO A;  2Q2H A;  4DGZ A;  4POG A;  1C0A A;  4AYB B;  3FEW X;  4ZTZ B;  1EOT A;  1SES A;  4A3I G;  4MTN A;  1ZYR D;  2SDF A;  2C5C A;  3OMG A;  1VQO A;  1VF5 C;  2NTT A;  4B3T Q;  4XTW A;  1YIJ A;  5JEA J;  2LKV A;  3M4Q A;  2XNA C;  2MQH A;  2EJ9 A;  5EKI A;  1KDB A;  1SRO A;  3HY0 A;  5GAE C;  3MC0 B;  5IYC H;  1CFM A;  1MKH A;  1CKN B;  1LM0 A;  4ZKC B;  1LTS D;  2R7D A;  3HOU B;  1H9S A;  2VL6 A;  1WTQ A;  1SJH D;  4KJO A;  3LWE A;  4J6H A;  1USY C;  2O4X A;  3IAL A;  3GP7 A;  3RZD B;  4KHZ A;  5IE8 A;  2TSS A;  4JI3 L;  1SYC A;  3GTM B;  1K83 H;  3CCJ A;  4TTV A;  1V9P A;  2XRQ D;  3KFU A;  3CW2 C;  1ET9 A;  5T1G A;  1S40 A;  3QJY A;  5GRO A;  4C1N K;  1WYD A;  3C1E A;  1H9M A;  1UWV A;  1KDC A;  4YY3 Q;  1VMP A;  1EVL A;  4BXX G;  4P73 A;  4LVM A;  1PTO H;  1TR5 A;  5C4Z A;  1RIQ A;  4ID6 A;  1HRJ A;  4QGU A;  5CYU A;  1JE4 A;  2ZXR A;  4YRE A;  1ASY A;  3TP7 A;  2E5A A;  3I3C A;  3S1N H;  3T1H Q;  2ZR2 A;  1DXM A;  3IL8 A;  3CCL A;  2MJ8 A;  1HR0 L;  1VDZ A;  1BVS A;  3A56 A;  5CV6 A;  1IBK Q;  2FIN B;  2WKD A;  1LV9 A;  2UU9 L;  4DAY A;  3I56 A;  3VQX A;  4GZY C;  2PI2 A;  3H09 A;  1PYS A;  1E0B A;  3NTH A;  4BXX H;  1Y1W G;  1AZP A;  2ZR3 A;  4IPG A;  1EY0 A;  1R4Q B;  2CW0 D;  2PZT A;  4LFB Q;  2Z4H A;  3I55 A;  3GTP H;  2BE5 D;  4OO1 G;  1VQ8 A;  2DEQ A;  4A3M B;  1JMC A;  3RAC A;  1I4R A;  3E0J A;  2AWN A;  4DNT B;  5G3L F;  5LMU L;  2DXU A;  1GHJ A;  1SN8 A;  3S15 B;  1Z47 A;  1ZKO A;  1K8M A;  3Q22 A;  1JJ2 A;  2F3V A;  1QVC A;  2Z6B A;  2K04 A;  1KLU D;  2SEB D;  5M5X B;  3BS1 A;  1NJI C;  2OWO A;  1VQZ A;  4GN4 B;  5E1F A;  4GS3 A;  4BBS H;  5C51 B;  4RWS C;  5C4J B;  2E10 A;  1SRY A;  3VYR A;  4A3J B;  4OO1 H;  4JI2 Q;  1PYW D;  4MN3 A;  5HUR A;  1M1K C;  2B3G A;  2HQL A;  2DU5 A;  3MXG A;  2QHT A;  4DR2 L;  2ENB A;  3T51 B;  5I9P A;  2JA9 A;  5IP9 G;  4UP7 A;  2DXT A;  1N9W A;  1SYE A;  3WDN A;  4A4I A;  2JEA I;  2CH4 A;  2A6H C;  4H0L C;  2Q2I A;  2YU9 H;  1VQC A;  4JI8 Q;  1OXT A;  3BFM A;  1U4R A;  2E76 C;  2OEO A;  2K75 A;  1RCV D;  4OXP A;  2R93 B;  1KOG A;  1Q86 C;  2B29 A;  1I4H A;  1SNC A;  1TS5 A;  4RQE A;  4DR1 Q;  2L5T A;  2ICI A;  3ERS X;  2ID0 A;  2B2V C;  2E8G A;  2R61 A;  4DNR B;  3BU2 A;  4ZQ3 A;  1D8L A;  4UDU C;  1X54 A;  3F8T A;  1XYI A;  3QOJ A;  1NJ6 A;  1CZG A;  2EWN A;  1J6Q A;  2Z1C A;  3TEH B;  1NJ8 A;  3TN2 A;  2JK8 A;  3GTJ H;  2XIW A;  3G71 A;  4HVC A;  1EFI D;  2LS0 1;  1J5E L;  2FFK B;  1XWE A;  4GKJ Q;  1QNU A;  1B76 A;  4BBR H;  1U4L A;  1JJC A;  1Z7N A;  4LNS A;  1PH8 A;  4C2M H;  1BCP C;  4K5V A;  1CA6 A;  2CCZ A;  2FJ2 A;  5AJ3 Q;  2UXB Q;  1I4X A;  1B70 A;  5M3M H;  2DQ0 A;  3G6E A;  4R8I A;  2WAQ B;  2YTV A;  3RMH A;  2K5W A;  1PH6 A;  1UE1 A;  1O78 A;  3HRK A;  4H2W A;  3AFQ A;  4A3B B;  2RF4 A;  1S4Z A;  1GVP A;  4EVO A;  2GVA A;  4KHV A;  5ELD A;  2D9U A;  1QF6 A;  5IT9 L;  4YRO A;  2ALY A;  1EQR A;  3MA2 B;  2Q7E A;  4R9W A;  4A3G G;  2K5D A;  2MGS A;  5M5Y H;  4HIO A;  1I6H H;  1N34 Q;  4DFA A;  1EEI D;  1PYB A;  2GVB A;  4V0B A;  1XMQ Q;  5J39 A;  4H02 A;  1HR0 W;  1TWA H;  2E74 C;  2WB1 B;  4R8N A;  1ZYR C;  2UUC Q;  1WTR A;  1H4S A;  1GO3 E;  2RDH A;  3FKI G;  3KF6 B;  4PV1 C;  1KMN A;  1VQ4 A;  4YWK A;  4H2V A;  4JBW A;  3PUY A;  2RKS A;  3MAQ A;  4C3H H;  4A3E G;  3S1R H;  4CKC A;  1C7Y A;  1EWI A;  2LMC B;  4QL5 A;  1VQ6 A;  3I4N G;  1SNM A;  2WFW A;  2N49 A;  1TS3 A;  4IQZ A;  1IYU A;  1HZA A;  1ENF A;  1SE8 A;  2H4O A;  4MHE A;  5C4X G;  3W1B A;  3L1A A;  1V1Q A;  1K83 B;  3I73 A;  4JG2 A;  1WJJ A;  2P5Z X;  4AIM A;  3H3V H;  5ELF A;  3S1M H;  2QEX A;  1SE2 A;  4HAE A;  4QUC A;  1JWU D;  4BA1 I;  1SDF A;  3DLL A;  3W3A A;  1KTK A;  2UXD Q;  5ISR A;  4DAV A;  4DV3 Q;  1NE3 A;  1YHA A;  1A2U A;  5D65 A;  1SFO H;  4A3E H;  4CS2 A;  4H2X A;  2AMC A;  1STN A;  1HFG A;  2LFN A;  1Q12 A;  3EBE A;  2ART A;  1PTO B;  1I5F A;  4XEM A;  5BN5 A;  2EAY A;  2Q7G A;  1DOL A;  4TQU S;  1NYQ A;  4JOI A;  5FLM G;  2B2U A;  1EUJ A;  1X3F A;  4KI0 A;  1XNQ L;  3S1N B;  3V7R A;  5LL6 X;  5E4X A;  2CJB A;  4P2C B;  4YCU A;  4S3S A;  4C56 C;  3H6M A;  4LW1 A;  4DR5 Q;  1HCZ A;  3R3O A;  1S5C D;  3MEF A;  1H9S B;  1O7I A;  3C1F A;  2ZT6 A;  2CKZ B;  1RJT A;  4IN3 A;  3S14 H;  3D4D A;  2ZTE A;  4BWA A;  2A68 C;  3C3L A;  4LVI A;  4PQX A;  3OIP A;  4B08 A;  2VQE L;  3HOY H;  1EU4 A;  3VYS A;  4CBV A;  3OTO L;  1YVC A;  3GTP B;  3J7Z C;  2ZZE A;  2UUB L;  3HOV G;  1QWY A;  1M8A A;  5G3L D;  4K14 A;  5DLQ E;  3BYT B;  3K7U C;  4JOI C;  2BE5 C;  4DR6 L;  2DTH A;  1PH9 A;  4ME5 A;  2KHJ A;  5T1I A;  3EA6 A;  1EIH A;  3TP5 A;  2O5J C;  2L15 A;  1WD1 A;  1UAP A;  1BBX C;  2B8F A;  4LF7 Q;  1STA A;  1OTC A;  1S72 A;  1TWG H;  2K5N A;  2Q5I A;  3VYT A;  1DM0 B;  1PZI D;  3P8V A;  2EOT A;  3CXC A;  4XU3 A;  4BBS B;  2VW9 A;  2EYL A;  2EXZ A;  1ROD A;  4DKA C;  2JSO A;  4DV5 Q;  2XVS A;  4O0A A;  4Z9C B;  4APV A;  3HOV H;  1L0X B;  4ME3 A;  1K0S A;  2L0C A;  1GOZ A;  3I7F A;  4LF4 Q;  3J81 j;  2HUG A;  1B7Y A;  3FP9 A;  2YU9 B;  1K8O A;  1BR9 A;  4KHP L;  4DAY B;  1YIT A;  1PYS B;  2BDO A;  2GN5 A;  2E2J H;  4PMB A;  2JA6 G;  4BY1 G;  3OWF A;  1QJO A;  3NK9 A;  3FPP A;  5I9O A;  1C8C A;  3PUZ A;  4X64 L;  1FJG L;  3H15 A;  4IUT A;  2E2H H;  4PMC A;  1MBY A;  2ZIN A;  4K88 A;  4UP9 A;  2J7Z A;  3J81 E;  4KKU A;  4B3T L;  2EJG A;  2HT1 A;  1GM5 A;  1EOV A;  2P5I A;  1NNX A;  5FJ8 G;  1EWC A;  3T1Y L;  2JN4 A;  1U4P A;  1BDO A;  5FLX c;  3UI2 A;  2YTY A;  2OTJ A;  1TXY A;  3GTK H;  2JA6 H;  2M2L A;  3GTJ B;  4RAU C;  3T4A C;  3LC0 A;  4GNX A;  2B2T C;  4BY1 H;  1LTT D;  2IHF A;  2RA4 A;  1YJW A;  1ICF B;  3Q24 A;  1DD2 A;  2KBN A;  3T53 B;  4BBR B;  1VQ9 A;  1X3Q A;  3P75 A;  4GLX A;  3K7A H;  5C0X H;  2F0U A;  5KND A;  4C2M B;  1PH7 A;  1QOH A;  2G9H D;  5FJ8 H;  2V1C C;  1WVL A;  5M3M B;  1RKN A;  2IWH A;  1ONL A;  2AWO A;  4CJ0 B;  4WJW A;  3AFP A;  3CCQ A;  2OQK A;  1WCM G;  2ZIM A;  1CTM A;  4OX9 L;  1VQH A;  4YHH Q;  1K3B C;  4RGT A;  4JI6 Q;  2ZCE A;  4YY3 L;  1HA5 A;  3UDG A;  5GQO A;  4A3F G;  4H2T A;  3U9S A;  4GNX C;  2F0S A;  2NN6 H;  5M5Y B;  1I6H B;  2RHS A;  3PCO A;  4A93 H;  2I07 B;  1G29 1;  2ZTD A;  4YCW A;  1YB3 A;  5EBD A;  5K36 G;  1D5M C;  5M5W H;  1TWA B;  4OHJ A;  3T1H L;  4FDB A;  5C3W A;  3S17 H;  2LXK A;  1R9T H;  2F0O A;  2IX3 A;  5J1Z A;  4MTK A;  2I46 A;  4ULL A;  3TEG A;  4NXM Q;  4JI7 L;  2XWB B;  1YI2 A;  1K8A C;  1IBK L;  4CH5 A;  5F5W A;  3NUC A;  1EWH A;  4LVJ A;  3CP0 A;  3S1R B;  4C3H B;  4CS3 A;  4YRP A;  3GTG H;  4ILW A;  1SE3 A;  3HOU G;  4J1M A;  4LFB L;  3MVV A;  3J80 L;  4K0K Q;  2FMC A;  5LMN Q;  4L5S A;  1SBB B;  4ABN A;  1Y1V H;  4CJ1 B;  4NKL A;  1B70 B;  2F52 A;  3K6O A;  3S1M B;  3U4Z A;  4X3S A;  2X6L A;  3HEJ A;  3M7G A;  3G6J B;  2NBF A;  4DK1 A;  1X9N A;  4IJH A;  2RHQ A;  2UXC Q;  3V7C A;  4HJ7 A;  1SFO B;  4A3E B;  3S2D H;  1HJP A;  3W3S A;  2A73 B;  2ALY B;  4QF4 A;  4LMQ D;  1N36 L;  4WI1 A;  2A69 D;  4JI2 L;  1A2T A;  1F9Q A;  4HIM A;  4IUP A;  1VQ5 A;  2F3W A;  2KEE A;  2I0Q A;  3TDQ A;  1Q1E A;  1HFN A;  1NSN S;  2E2D C;  2NB0 A;  4DXF A;  5L37 A;  4DV7 Q;  3GV3 A;  1YHQ A;  1ML0 D;  2IHE A;  3S14 B;  3G4S A;  1J5W A;  4X6A H;  1BIA A;  3REX A;  1I4P A;  3BG3 A;  3HOY B;  2WIN B;  5C0X J;  1D5X C;  1N32 Q;  3HY1 A;  1G51 A;  5C3E H;  2Q8R E;  4ZLT F;  4DR1 L;  3EJI A;  2AKW A;  4IPD A;  2AUJ D;  1KC8 C;  4XQN A;  3TUP A;  3S1Q H;  1ZXT A;  5A2Q L;  4F87 A;  1EYC A;  1JR0 D;  5CR3 A;  1CHQ D;  4MZ9 A;  3CPF A;  4A3M G;  1BUV T;  3FVQ A;  4WFN 3;  3AQQ A;  1KAW A;  2WP8 J;  5DNF A;  1UEA B;  2PNR C;  2NZ1 D;  3TBI B;  3VR4 A;  4HID A;  3A5Z A;  3N52 A;  2B63 H;  3U50 C;  4H2X B;  1TWG B;  3U9O A;  2AMC B;  3NWS A;  4IUU A;  3VR2 A;  4Y7N H;  5JEA G;  3D3R A;  1AZQ A;  2ZJP A;  2KCM A;  3HOV B;  1NJ5 A;  4M1U B;  5BR8 Q;  2JXM B;  3CC2 A;  3NBH A;  1BBW A;  4HED A;  5AJ3 L;  2UXB L;  4X65 Q;  2OXP A;  4LVL A;  1K0R A;  1RTO A;  4JC0 A;  3PF4 A;  2J3L A;  2H1E A;  1I4G A;  2A8V A;  3CCR A;  4K8J A;  2E2J B;  3CMQ A;  4XQQ A;  3HXU A;  1PRT F;  4G57 A;  1S5D D;  1TU2 B;  3GV6 A;  4F88 A;  3J7Y W;  4OWX B;  1N34 L;  3KJP A;  2E2H B;  3MQZ A;  5EKL A;  2R93 G;  2FMM A;  1KLG D;  3HKZ B;  3Q6S A;  2UUC L;  4N9T A;  2IJ0 A;  1RIP A;  1TY2 A;  2EYO A;  3EVQ A;  1RL2 A;  4DR3 Q;  3VR3 A;  2ZT7 A;  1Z9F A;  4JV5 Q;  1FNW A;  2Y0S B;  1UE6 A;  2A74 C;  4P75 A;  2Q5H A;  3GTK B;  2JA6 B;  1TWC H;  1PVO A;  4BY1 B;  1NTG A;  4TVY A;  3QIA A;  3QB3 A;  3SR1 A;  2R92 G;  4DV0 L;  1A63 A;  3K7A B;  1STH A;  1B7Y B;  4QIW E;  4KR2 A;  3CAM A;  3F2D A;  1VQI A;  4X66 Q;  3LNN A;  3KK7 A;  2ZGW A;  3JC6 6;  1RD9 D;  3HP3 A;  3BYY B;  4OWT B;  3IAY A;  2UXD L;  4KR3 A;  4DV3 L;  3REU A;  2VNU D;  3ICA A;  3UE0 A;  2L11 A;  4H2U A;  1IKM A;  2ZTC A;  3K5O A;  3D4R A;  5E3I A;  1FYF A;  1B9N A;  1GUW A;  4JI4 Q;  4LAA A;  4A3B G;  4A93 B;  1STY A;  2R92 H;  2DTI A;  5M5W B;  3H94 A;  1RF2 D;  3S17 B;  1L1O A;  1R9T B;  3P7J A;  4L8J A;  1U5K A;  1VQA A;  4WRD A;  2CVR A;  3M85 A;  4L6T B;  5KNN A;  5CV7 A;  3JAM L;  5JJI A;  1WTH A;  3D31 A;  2EVB A;  1HNZ Q;  1X32 A;  3GTG B;  1K3R A;  1SJE D;  1DZ1 A;  1U0L A;  4B9X A;  4JBK A;  1KRT A;  5KEE A;  5IYD H;  1Y1V B;  5KNB A;  1VCI A;  3TRE A;  2JA5 G;  4DQ2 A;  4OGQ C;  2KHS A;  5GAH C;  3K58 A;  4HMI A;  2JA7 H;  2LXJ A;  1IYV A;  2EXD A;  5IGG A;  1EY6 A;  2AQ3 B;  3CKI B;  4XXE A;  4LF7 L;  2G9D A;  1JB3 A;  2L1B A;  2J3M A;  4P3O A;  5GAG C;  2IY5 B;  3S2D B;  1SMY D;  1W6K A;  3ZJY C;  4RCO A;  1PFS A;  3AMU A;  2KCT A;  1G6P A;  1B3Q A;  3NPP A;  2RHS B;  4YCV A;  3PCO B;  2HHH Q;  5IGE A;  1PFN A;  3I90 A;  3VR5 A;  4DPG A;  4X62 Q;  2A69 C;  2JA5 H;  5IT9 E;  1G6Z A;  4LF4 L;  1PTO C;  4AH6 A;  1YNJ C;  4KD3 A;  2R7Z G;  2F0M A;  1Y69 U;  4WJ4 A;  3CU7 A;  5C3X A;  2PME A;  4AYB E;  5K5P A;  3VYU A;  2I5M X;  4L5R C;  3CCM A;  4DAP A;  1Q81 C;  1P8L A;  5H1S E;  4DR4 Q;  1ESR A;  3DEP A;  5C3E B;  3CME A;  4RG1 A;  2ZXF A;  1G91 A;  1W2B A;  1IBM Q;  1XTC D;  2Z9H A;  1UUP A;  3S1Q B;  3U58 A;  3D6C A;  5EGT A;  1MJE A;  4PG3 A;  2R7Z H;  2RHQ B;  2QIL A;  2B63 B;  3A7R A;  3P1H A;  4PZ8 A;  4Y52 H;  3S2H H;  2MP1 A;  2D2C C;  4UAI A;  3HTZ A;  5I6W A;  2F0V A;  2F3I A;  5I6Y A;  3PIO A;  4Y7N B;  2Q2T A;  3V8L A;  4DV4 Q;  1MI2 A;  3VA7 A;  1EY9 A;  4TSS A;  4LK1 C;  1X6O A;  4BBS G;  3PO3 H;  3V2T A;  1TWF H;  2N3S A;  4H2S A;  4P73 C;  4DUZ Q;  3QO7 A;  1WFQ A;  2NYZ D;  4LFC Q;  2F03 A;  3OSO A;  1SNP A;  1HNW L;  2DUD A;  2CH4 W;  2CQO A;  2PO4 A;  1PRT D;  1KMM A;  3BDO A;  5JAV A;  1NY4 A;  4CHT B;  1YNN D;  5DM7 3;  4JI6 L;  2PNH A;  3SE0 A;  2Q7H A;  2JJQ A;  3J81 c;  2E5L Q;  3QNE A;  3L3O C;  4C3J H;  1PHJ A;  3PUV A;  1I94 Q;  1J8I A;  2AKW B;  1QVF A;  5IGB A;  3TS2 A;  1CI3 M;  5FO9 B;  5M9O A;  2C8M A;  3A5Z B;  4NXM L;  2YV5 A;  5COR A;  4CDE C;  1HNX Q;  4YRL A;  1SYG A;  3A5Y A;  1TWC B;  1P16 A;  4TVW A;  5I2Y A;  2ZIO A;  4G7Z C;  4YRS A;  4K0K L;  1ENC A;  1HQM C;  2FXQ A;  1OXS C;  3NBH B;  3EFX D;  5DAU A;  1F2L A;  2Z6K A;  2K03 A;  4DV2 Q;  4DV6 Q;  3TRZ A;  1OXV A;  2F0I A;  1NNH A;  3MWY W;  1Q1B A;  2RSN A;  4BBR G;  2ZZF A;  3I4L A;  4TQF A;  2XTI A;  1UNS A;  2VY3 A;  3OIQ A;  4LF5 L;  5F2D A;  3MXU A;  2JP1 A;  2CIM A;  5M3M G;  3WWV A;  2JEB I;  4A3C H;  2QHU A;  3DSQ A;  4YRI A;  4F8M A;  2R92 B;  1ZEQ X;  1NUC A;  3M9B A;  5C5L A;  1WTO A;  1BQQ T;  4ZKB B;  2QW7 A;  3TZU A;  3J7A 5;  2Z6K C;  1IW7 D;  3NE5 B;  3V96 A;  4X3T A;  3VR6 A;  1CHP D;  4R4T A;  4RGO S;  3P8Y A;  1F9S A;  5M3F H;  4DV7 L;  1PFB A;  4FXD A;  1LT5 D;  2C9O A;  2XGT A;  4LF9 Q;  4JYA Q;  4OO1 I;  2ZT5 A;  3FJP A;  1A3T A;  5CV4 A;  3CMA A;  1B3A A;  3T56 B;  5J3B A;  1FL0 A;  3VBB A;  2RBM A;  1DOK A;  1N32 L;  4DUY Q;  4MIU A;  3UGQ A;  1SXT A;  4C3H G;  4JI0 Q;  1J9O A;  1RDP D;  4OON A;  3Q23 A;  3FMC A;  1LT4 D;  4NDX A;  3G48 A;  1CKO A;  4IJL A;  2JA7 B;  3BVZ A;  3OWE B;  2MO1 A;  4DAM A;  2CJ9 A;  3GQB A;  1FNU A;  2MPM A;  3H3V C;  3LX0 A;  1EY5 A;  1A62 A;  2EYP A;  2BH8 A;  3BZD B;  3CCS A;  4UHV A;  3HOW H;  1B50 A;  1JIC A;  1VQP A;  4L63 B;  1VQK A;  12AS A;  3GTQ H;  1SMY C;  3RR5 A;  2H5X A;  5EPJ A;  4JI5 Q;  1PH1 A;  5BR8 L;  1JQY D;  1V1P A;  1SSO A;  2F4I A;  1XMO Q;  5EPL A;  2JA5 B;  2WAQ E;  4TVA A;  2PW7 A;  5E3F A;  1QUQ A;  2ZXO A;  1L1O B;  4X65 L;  4LFA L;  4DR7 Q;  3L4G A;  4LF8 L;  4LVK A;  1WLE A;  3URY A;  1UE7 A;  4NPS A;  5EQ0 A;  4U68 A;  3KLS A;  1AH9 A;  2DJG C;  3PIP A;  2EYH A;  3FDT A;  2E2I H;  2JYO A;  4JBM A;  5C53 B;  1ET6 A;  1O80 A;  3A7L A;  2K4K A;  1TS4 A;  2RDG A;  1STB A;  2WB1 E;  2FHT A;  1LTL A;  1FGB D;  4A3K H;  3DUZ A;  4CKB A;  1S3O A;  1QZH A;  1A0I A;  4K6L A;  3VA5 A;  3HOY G;  4B9W A;  3W5O A;  2NVY H;  1KXL A;  1IZ6 A;  4DR3 L;  4OLF A;  1EQQ A;  4IPH A;  1YFS A;  3J80 E;  2B8G A;  2PZU A;  2R7Z B;  3A74 A;  4CDD C;  1S5F D;  3S2H B;  2NZO A;  3TZD A;  2EE1 A;  4IUN A;  2N78 A;  4GKK Q;  3UGT A;  1ICW A;  3OHX C;  4DF7 A;  3V05 A;  1O7Y A;  2J0T D;  3V8J A;  4WJ3 M;  2RDF A;  1PH5 A;  4KV6 A;  3PO3 B;  1N33 Q;  1TWF B;  4EQP A;  2K5H A;  1JC7 A;  2VS1 A;  3A54 A;  4H7B A;  1WNL A;  2DDZ A;  3RL6 A;  1SAP A;  3FPU B;  4X66 L;  2CW0 C;  2A6E D;  4GLV B;  4H44 C;  2B2U C;  1FR3 A;  3J80 i;  3GDE A;  3T16 A;  4CDC C;  3SDZ A;  4F7X A;  3MXN A;  1NCV A;  2ZT9 C;  1EZ6 A;  2UUA Q;  1FVI A;  4RDX A;  1HUN A;  1YNN C;  1X56 A;  2J4X A;  3Q0A A;  2ICE C;  3E3X A;  1H9K A;  4C3J B;  3H3V I;  2AHO B;  3STB D;  5K1X A;  5J22 A;  3MEY A;  2EQS A;  4HR7 B;  4JI1 L;  2Q8T A;  3S24 A;  4J15 A;  2EIF A;  4JCV E;  5C44 H;  4RFB A;  1C4Q A;  3SEB A;  1PMR A;  3I4M H;  4Q6G A;  1KAA A;  3CQZ H;  4LF6 Q;  2DZ9 A;  1L0W A;  1KDA A;  2F0Q A;  3HKZ G;  3H0G H;  3VQV A;  1EIY A;  4IFD H;  5A2Q E;  3K5L A;  1HNZ L;  4B3M Q;  2IL8 A;  2Y0S G;  1QNK A;  3H91 A;  1CSP A;  1QB5 D;  3KLS X;  2RCF A;  4LUV A;  1GD7 A;  2NVX H;  2EY5 A;  3QG1 A;  1Y8O B;  2CFM A;  3TME A;  1IL2 A;  3OD1 A;  2BOS A;  3DMU A;  3HRZ C;  3BVM A;  4C3I H;  1NJ1 A;  4O42 A;  3HXY A;  5C0X G;  2HDL A;  2EJF A;  3PZC A;  4XIG S;  3CPW A;  5FOB B;  4HJ5 A;  2DTO A;  1AE3 A;  1QG7 A;  3DWA A;  2YYZ A;  1DOM A;  3IKM B;  1ILQ A;  3UDI A;  2HHH L;  4JK1 C;  1S5E D;  1EU3 A;  4ZCK A;  1Y8N B;  1Z7T A;  1BKB A;  1JJG A;  3SHL A;  1O7L A;  1X3E A;  2QDB A;  4NMZ A;  5D3D A;  3CCE A;  2JA8 H;  3TQY A;  1GGM A;  2NN6 G;  3DWP A;  2BDN A;  4A93 G;  3BZK A;  2PI2 E;  2KEC A;  4A3D H;  3T13 A;  5M3F B;  4WOR A;  1KIX A;  4J8Q A;  2EJF C;  3J81 i;  4L87 A;  2EJG C;  3CCV A;  2QKI C;  4LWC A;  1SMX A;  3O13 A;  4XDX A;  5CMD A;  4B3S Q;  2NVQ H;  1D1K A;  1N8R C;  1QVG A;  1H95 A;  1GUT A;  3I2Z A;  4DR4 L;  2ARU A;  3V7S A;  4FF4 A;  4FXG C;  2IY5 A;  5AFW A;  1TVX A;  1EEF D;  1SYD A;  2VZA A;  2UU9 Q;  1PFM A;  1IBM L;  1GHK A;  5I2X A;  2Z0S A;  4XU0 A;  2BCO A;  4L5Q A;  3I70 A;  3WOF A;  2PQA A;  4HMJ A;  3RZO H;  5IIF A;  1IHZ A;  1Y1V G;  2D0P A;  4H13 C;  2PZW A;  3HOW B;  3TP8 A;  5IT9 c;  1VQN A;  1EY8 A;  1EY7 A;  3D4W A;  3GTQ B;  4R1J A;  3RF1 A;  3L0O A;  3RIR A;  1LTR D;  5ELE A;  2IT1 A;  4DUZ L;  1B2T A;  2L12 A;  1DJR D;  5IYB H;  2DZC A;  4IFD J;  4EQ5 A;  2DJF C;  1VQD A;  1L2F A;  1B4O A;  1K8G A;  1ILP A;  4YRQ A;  4YRM A;  1BCP F;  4YRG A;  2E2I B;  2IW3 A;  3OW7 A;  4EGV A;  4GOP A;  1QZG A;  2E5L L;  2F4V Q;  2HDM A;  4LUZ A;  5A35 A;  3JAM E;  5C0X I;  1HC7 A;  2EY6 A;  3D8G A;  2LY7 A;  3KDF A;  4X5O A;  3IRB A;  1F2Z A;  4A3K B;  1I94 L;  4FF2 A;  3I8Z A;  4DNI A;  3R07 A;  2OCE A;  4KMU C;  1HTT A;  3NP8 A;  3ULP A;  2IX1 A;  2SOB A;  2NVY B;  1SET A;  3HS0 C;  1GUS A;  1U9R A;  1B53 A;  1X3P A;  1Q46 A;  5C3E G;  4FXK C;  1JOK A;  1IKL A;  1VQJ A;  1BIB A;  2CHB D;  2F0F A;  2F0T A;  3SXH A;  1HNX L;  4HN7 A;  1AFP A;  2C35 B;  5FK9 C;  1LLR D;  4TQD A;  1OXU A;  2NN6 I;  1MJC A;  4BY7 H;  4JI8 L;  4IOA A;  3HKS A;  2D0O A;  3HOZ H;  3ONA B;  4N8F A;  3A8I E;  2B63 G;  3TP6 A;  3NEN A;  3F1Z A;  1V1P B;  3LSS A;  3JAM i;  5IY0 A;  4TVA B;  4DV2 L;  4YRR A;  1AP0 A;  2ZT8 A;  4DV6 L;  1LAB A;  1QUQ B;  4YIJ A;  2QHS A;  3AU7 A;  1IBL Q;  4DV1 Q;  3L4G B;  2XWJ B;  1JE5 A;  5FO7 B;  1J5E Q;  2QEJ C;  2ODR D;  1QE6 A;  4K5W A;  1ESF A;  4EQO A;  5IWA Q;  3HFV A;  1IXR A;  3E9H A;  3CD6 A;  4XTY A;  2F0P A;  3L2P A;  3GTL H;  2CWA A;  2MHV A;  3F2C A;  1V8Q A;  4B3R Q;  2A5H A;  2N88 A;  5NUC A;  4YYE A;  1HTL D;  1SNQ A;  4IUV A;  4YRN A;  1MIU A;  1TII D;  4GKJ L;  1GUO A;  4HIK A;  1VQF A;  2AQ2 B;  2KA7 A;  3IFT A;  3SGI A;  1ADY A;  4IUQ A;  3DXJ C;  4AQY Q;  5C44 B;  3I4M B;  1C48 A;  3W2D A;  3CQZ B;  4PHC A;  4IO9 A;  1JWS D;  3H0G B;  1PRT B;  4XYO A;  1CM9 A;  1E7Z A;  2F0L A;  1JT8 A;  4JYA L;  2TMP A;  4LF9 L;  1Z6H A;  3KF8 A;  1D5Z C;  1TWH H;  1KL9 A;  4XQJ A;  1SR3 A;  4DUY L;  4OEL B;  1H4Q A;  4XT3 B;  1RHP A;  2OT2 A;  4JI0 L;  2QGQ A;  2NVX B;  4DK3 C;  2HCI A;  3K5M A;  1T5X D;  1YHB A;  1XMQ L;  4Q5V A;  2DQ3 A;  4C3I B;  4RGN A;  1NBW A;  2PQE A;  3S16 H;  2PPB C;  4P71 A;  1XPU A;  3MXN B;  3ND9 A;  4RHR A;  1LTG D;  1LTB D;  2VB2 X;  4QJF A;  5IP7 H;  2KJX A;  5CV5 A;  1VQE A;  1HZ9 A;  5IGF A;  2D62 A;  4JI5 L;  2B2W A;  2PYK A;  1PZJ D;  1XMO L;  3OPO A;  2KVM A;  2M00 A;  3QO5 A;  3GTO H;  1X01 A;  1NMF A;  2JA8 B;  1FYC A;  2B2Y A;  3NBI A;  3P8T A;  4A3D B;  1YGB A;  1EIY B;  1LT6 D;  2F0W A;  1G2T A;  3HXW A;  4KY5 A;  1KNA A;  2A6H D;  2XRS D;  1YZ6 A;  1YJN A;  1XNQ Q;  2GA4 B;  2NVQ B;  1MHW C;  4RMF A;  3J7A V;  1WOC A;  2WII B;  3MFG A;  5JPN C;  3HKZ E;  4P75 C;  1EL0 A;  3FRP B;  1L0Y B;  2DN8 A;  2D5D A;  2PCF B;  2F0H A;  2PMZ E;  1PH2 A;  3CCU A;  1CA5 A;  2Y0S E;  3S9W A;  4XTV A;  3SK5 A;  3RZO B;  1UE5 A;  3LGJ A;  2PW5 A;  2VQE Q;  1KAB A;  2B2Y C;  3QR8 A;  5IYD G;  2NTS A;  2VQF Q;  3M3Y H;  5BN4 A;  2Q8I B;  4HCE A;  4HJA A;  1ADJ A;  2Q2U A;  2VB3 X;  3PUX A;  2MUY A;  5IOC A;  3DHQ A;  4XTC S;  1HXD A;  1PLF A;  4DR5 L;  3A0J A;  4P74 A;  2JA7 G;  4JBJ A;  4GKK L;  1SNO A;  1STG A;  2DY8 A;  3Q8D A;  4FF1 A;  3CHB D;  2RCN A;  5I4D A;  3K5N A;  1UEB A;  1F9P A;  1JCK B;  2XN9 C;  5EBC A;  5JVG 3;  1N33 L;  4FO2 A;  1NJ2 A;  4DN4 M;  3QOL A;  3KBX A;  5LHY 1;  1QE0 A;  4NW2 A;  5IGC A;  5C5M A;  1BCP D;  2MO0 A;  1L1O C;  2UUA L;  3PGZ A;  3V8K A;  2JE6 I;  1HPC A;  3ITP A;  3NSW A;  4G4K A;  4KN4 C;  3J80 c;  3UDX A;  2OTL A;  4KQE A;  5EPK A;  3M4P A;  1USY A;  3AYH B;  4DV5 L;  2PQA B;  3WOE A;  1ENA A;  1MSH A;  3L9A X;  4LF6 L;  3CF5 A;  5ELC A;  1CQV A;  4A3L G;  1F2Y A;  1AEX A;  3ER0 A;  3R2T A;  5HY6 A;  4CGY B;  4ZUJ A;  1LO5 D;  4I7A A;  4X64 Q;  1FJG Q;  1SER A;  1LTI D;  1Q8K A;  3W1G A;  3UFG A;  4BY7 B;  4B3M L;  2NWG A;  2X6G A;  1F9R A;  4IAL A;  4JPB W;  3T1Y Q;  3HOZ B;  4KJN A;  3ND8 A;  4K5X A;  3ERO A;  4V19 0;  3OW2 A;  3SK6 A;  2L9H A;  3DM3 A;  5CBE E;  1OO9 B;  1JWM D;  4A3L H;  2ZM6 Q;  2K33 A;  4A3I H;  3CRL C;  1E2V A;  3OOC A;  4YP0 A;  3PO3 G;  2ODR C;  1E22 A;  3NQT A;  2DY7 A;  3GTL B;  1QIL A;  4GOP B;  1D6E C;  1TQO A;  1HZC A;  4R4Q A;  2F0G A;  1WU7 A;  3KDF B;  4XU1 A;  3PO2 G;  4I7Z C;  1I3Q H;  1EQT A;  4YRT A;  4OX9 Q;  4ZAI A;  3SK8 A;  3U4V A;  4QCL A;  1B1Z A;  5CV9 A;  4KK7 A;  4C3J G;  2VXW A;  1V1O A;  4ZK9 B;  2ZNJ A;  4YPF A;  5CC4 A;  4R4I A;  1I50 H;  2YTX A;  3G1Z A;  1W66 A;  1IL8 A;  3F2U A;  4OIJ A;  1FD7 D;  3E0E A;  1X65 A;  4OIK A;  1NR4 A;  3BDC A;  3B6Y A;  4B3S L;  1VS0 A;  1TWH B;  1GKH A;  4QQB X;  2F0J A;  1CQF A;  3PO2 H;  2A1A A;  3L7Z C;  3PIO 3;  4YHH L;  4JI7 Q;  3MTS A;  2EYM A;  2A68 D;  3FHW A;  4HSV A;  3A8J E;  1SRU A;  4PMW A;  1NR2 A;  4A75 A;  2ASB A;  1HHV A;  2SNM A;  2I5H A;  4QUF A;  3S16 B;  1HUM A;  5D3I B;  1PDQ A;  2G4C A;  1CK1 A;  4H2Y A;  1KQS A;  5IGD A;  2FYK A;  1LAC A;  2KHI A;  2M9V A;  3NHH A;  1BXT A;  3HOX G;  3D0F A;  2RSO A;  4PZ7 A;  3C46 A;  1PH4 A;  2CGH A;  1XNR Q;  4DK0 A;  3RN2 A;  1D2B A;  1STE A;  3GTO B;  3PQI A;  1Y1W H;  1VQG A;  4KD4 A;  3EQL C;  4A3C G;  5CBA E;  1E1O A;  3BDL A;  3ZYY X;  5LMN L;  1N36 Q;  1F2M A;  1E1T A;  1YFR A;  1II3 A;  2ZTG A;  4ZIB A;  2B2V A;  3K0Y A;  5EJW A;  2L4N A;  3A8K E;  2QCP X;  2DGY A;  4RA8 A;  5JJZ A;  3HXZ A;  3KF8 B;  1B8A A;  3A7A A;  1Q90 A;  3AB9 A;  1EYA A;  2NUC A;  3DM1 A;  4KY6 A;  4K6D A;  3HFZ A;  4RCN A;  3HOX H;  1EY4 A;  2F4V L;  2I4N A; 
#chains in the Genus database with same CATH homology
 5M3F G;  2VUM G;  4YDQ A;  2UXC L;  1XPO A;  3ULL A;  3A7U A;  3PF5 A;  1ATI A;  1EFW A;  1H4T A;  3RNU A;  1Q82 C;  4R4O A;  4QY7 A;  3EFS A;  4OP0 A;  2DVE A;  5IP9 H;  2VUM H;  2ATW A;  3HOW G;  4G85 A;  2E1H A;  1IBL L;  4DV1 L;  1YJ9 A;  2LSS A;  3JAM c;  5IWA L;  3E9I A;  3PSI A;  3I4O A;  4YWM A;  2E3C A;  4B3R L;  3CC4 A;  2HIV A;  1AE2 A;  3EN2 A;  4UY8 C;  4AQY L;  4PZ6 A;  4A3K G;  3VQW A;  4K86 A;  1XPR A;  3BJU A;  3RN5 A;  4HWR A;  3ULJ A;  2IX0 A;  3RKY A;  3K0X A;  2PMF A;  4YRK A;  4G84 A;  3KOJ A;  4CH6 A;  5HGQ A;  4P3P A;  4A3G H;  1VQM A;  3A31 A;  4DV0 Q;  1YFT A;  1ASZ A;  4JV5 L;  3FKI H;  2NS6 A;  4UP8 A;  3IG2 A;  1LUZ A;  5LMN W;  1OXX K;  1DGS A;  3AEV A;  3I4N H;  2I4O A;  2BA1 A;  4EX5 A;  4OWW B;  5C4X H;  3HXX A;  2QA4 A;  1X3G A;  5C44 G;  3I4M G;  3H0G G;  4IPC A;  4IFD G;  4YRC A;  4HJ9 A;  3M7N A;  4JI4 L;  3EIV A;  4NXN Q;  2BA0 A;  2BH2 A;  2VQF L;  4NCX A;  2HIX A;  5FLM H;  1G5I A;  3NEL A;  2R7F A;  2EL9 A;  2ZJR A;  1NYR A;  4HWP A;  3KYH C;  4YWL A;  2A8E A;  4GN5 A;  4DK6 C;  1VQL A;  1Z7M A;  1EVK A;  2E65 A;  4XU2 A;  1E24 A;  1PV4 A;  4ALP A;  2JA8 G;  1Y14 B;  2QHV A;  4BW9 A;  4A3D G;  4JI3 Q;  4CH4 A;  1KRS A;  2I4L A;  4CS4 A;  3VQY A;  4X62 L;  4EO4 A;  4XEO A;  4HT4 A;  4P3N A;  1X55 A;  1E3P A;  1KHI A;  3KLW A;  4KLK A;  1CKM A;  1Q7Y C;  1WI5 A;  3ERR A;  3PUW A;  4HA8 A;  1BBU A;  4POF A;  3M4O H;  2NVT H;  3A5U A;  1IYJ B;  1HR0 Q;  2I4M A;  3RKW A;  4NB3 A;  4IFD I;  2ZM6 L;  5JJK A;  3ICE A;  3QTC A;  5GAD C;  3A32 A;  1VQ7 A;  4XTX A;  3HFZ B;  5IYB G;  3VDY A;  3RKX A;  4P72 A;  1HNW Q;  3WQZ A;  3BZC A;  3UDF A;  5LMU Q;  1T9H A;  4DV4 L;  4HWT A;  1WQW A;  1CKN A;  2NZH A;  3NEM A;  2I5L X;  4LFC L;  2ZJQ A;  4UPA A;  1CSQ A;  4AYB G;  3RLN A;  2HNI A;  4DR2 Q;  1WCM H;  1W3S A;  4P72 C;  5EAY A;  1FGU A;  4YRF A;  2N8N A;  2MFI A;  1G5H A;  4BY7 G;  2CJA A;  1EIF A;  4A3F H;  3HOZ G;  2DKG A;  1LYL A;  1A8V A;  5ELN A;  1K9M C;  1CUK A;  2K5V A;  1JJC B;  4GN3 B;  3K80 C;  1EYG A;  3RLF A;  4CH3 A;  2K50 A;  3RLO A;  4O2D A;  11AS A;  3NET A;  4LF5 Q;  1XNR L;  5K1P A;  4GOP C;  2A19 A;  3HOU H;  2C7I A;  2ARS A;  1X2G A;  3PV0 A;  3RZD H;  1H4V B;  2DU7 A;  1WPY A;  2CWP A;  3GTM H;  3K81 C;  3KJO A;  2ZNI A;  3GO5 A;  3MF2 A;  4RQF A;  3STB C;  3IKL A;  1PH3 A;  1X2H A;  2MNA A;  3L2Z A;  4GLA C;  5IP7 G;  4Q15 A;  2P0L A;  1NMG A;  4A76 A;  3QO8 A;  4LNQ A;  2JQO A;  3GD7 A;  4K87 A;  4LUO A;  4LFA Q;  4A3J G;  1YNX A;  4LF8 Q;  4A3M H;  1V43 A;  4ZTU B;  1PA6 A;  1C9O A;  3F2B A;  4HWO A;  3S15 H;  4XTZ A;  1YBY A;  3CC7 A;  4WF2 A;  4IOC A;  5JJL A;  3EFR A;  4XTU A;  5M5X H;  3TEH A;  2E41 A;  4DR7 L;  3MF1 A;  5C4J H;  4A3J H;  4E51 A;  1HZB A;  1HH2 P;  1SLJ A;  3RUX A;  3RGL A;  1JB7 A;  4P71 C;  3TS0 A;  1KD1 C;  1M90 C;  2OQ0 A;  2K14 A;  2DJZ A;  3UE1 A;  1XJV A;  3LSQ A;  1XTD A;  4HJ8 A;  4BA2 I;  2R93 H;  4L5T A;  2KEN A;  3OTO Q;  3HXV A;  2UUB Q;  4YRJ A;  3UH0 A;  4DR6 Q;  2K52 A;  4MNO A;  1VQB A;  3KF6 A;  3OYY A;  2WAQ G;  2R6G A;  3HRI A;  5C52 B;  2E64 A;  4HWS A;  4JI1 Q;  3K8A A;  1WQ7 A;  2WB1 G;  1YEZ A;  4TWA A;  4GNX B;  4P74 C;  1D7Q A;  2ZZG A;  4NXN L;  2ES2 A;  5E7N A;  5IYC G;  4KHP Q;  4A3B H;  4R4C A;  1K73 C;  5ELO A;  2Q2H A;  4POG A;  1C0A A;  4ZTZ B;  1SES A;  4A3I G;  4MTN A;  1VQO A;  4B3T Q;  4XTW A;  1YIJ A;  5JEA J;  3M4Q A;  2MQH A;  2EJ9 A;  1SRO A;  3HY0 A;  5GAE C;  5IYC H;  1MKH A;  1CKN B;  1LM0 A;  2R7D A;  2VL6 A;  1USY C;  3IAL A;  4KHZ A;  5IE8 A;  4JI3 L;  1K83 H;  3CCJ A;  4TTV A;  1V9P A;  3KFU A;  3CW2 C;  1S40 A;  5GRO A;  1WYD A;  1UWV A;  4YY3 Q;  1EVL A;  4BXX G;  4P73 A;  4LVM A;  1RIQ A;  4QGU A;  4YRE A;  1ASY A;  2E5A A;  3S1N H;  3T1H Q;  2ZR2 A;  3CCL A;  1HR0 L;  1BVS A;  1IBK Q;  2UU9 L;  3I56 A;  3VQX A;  2PI2 A;  1PYS A;  4BXX H;  1Y1W G;  2ZR3 A;  4IPG A;  4LFB Q;  3I55 A;  3GTP H;  4OO1 G;  2DEQ A;  1VQ8 A;  1JMC A;  3RAC A;  2AWN A;  5LMU L;  2DXU A;  1SN8 A;  1Z47 A;  1JJ2 A;  1QVC A;  1NJI C;  2OWO A;  1VQZ A;  4GN4 B;  4GS3 A;  4BBS H;  5C51 B;  2E10 A;  1SRY A;  4JI2 Q;  1M1K C;  2B3G A;  2HQL A;  2DU5 A;  2QHT A;  4DR2 L;  2JA9 A;  5IP9 G;  4UP7 A;  2DXT A;  1N9W A;  4A4I A;  2JEA I;  2Q2I A;  2YU9 H;  1VQC A;  4JI8 Q;  1OXT A;  3BFM A;  2K75 A;  4OXP A;  1KOG A;  1Q86 C;  2B29 A;  4RQE A;  4DR1 Q;  3ERS X;  2ID0 A;  2E8G A;  3BU2 A;  1D8L A;  1X54 A;  3F8T A;  1NJ6 A;  2EWN A;  1J6Q A;  3TEH B;  1NJ8 A;  2JK8 A;  3GTJ H;  3G71 A;  4HVC A;  1J5E L;  4GKJ Q;  1B76 A;  4BBR H;  1JJC A;  1Z7N A;  4LNS A;  1PH8 A;  4C2M H;  2CCZ A;  5AJ3 Q;  2UXB Q;  1B70 A;  5M3M H;  2DQ0 A;  3G6E A;  2YTV A;  1PH6 A;  1UE1 A;  3HRK A;  4H2W A;  3AFQ A;  2RF4 A;  1GVP A;  2GVA A;  1QF6 A;  4YRO A;  2ALY A;  1EQR A;  2Q7E A;  4A3G G;  5M5Y H;  4HIO A;  1I6H H;  1N34 Q;  1PYB A;  2GVB A;  1XMQ Q;  4H02 A;  1HR0 W;  1TWA H;  2UUC Q;  1H4S A;  1GO3 E;  3FKI G;  3KF6 B;  1KMN A;  1VQ4 A;  4YWK A;  4H2V A;  4JBW A;  3PUY A;  4A3E G;  4C3H H;  3S1R H;  1C7Y A;  1EWI A;  4QL5 A;  1VQ6 A;  3I4N G;  2WFW A;  2N49 A;  1HZA A;  1SE8 A;  3L1A A;  5C4X G;  3W1B A;  1V1Q A;  4JG2 A;  1WJJ A;  4AIM A;  3H3V H;  3S1M H;  2QEX A;  4BA1 I;  3DLL A;  2UXD Q;  4DV3 Q;  1NE3 A;  1YHA A;  1SFO H;  4CS2 A;  4A3E H;  4H2X A;  2AMC A;  1Q12 A;  3EBE A;  2ART A;  1I5F A;  4XEM A;  2EAY A;  2Q7G A;  4TQU S;  1NYQ A;  4JOI A;  5FLM G;  1EUJ A;  1X3F A;  4KI0 A;  1XNQ L;  3V7R A;  2CJB A;  4YCU A;  4LW1 A;  4DR5 Q;  3MEF A;  1O7I A;  2ZT6 A;  2CKZ B;  3S14 H;  2ZTE A;  4BWA A;  4LVI A;  2VQE L;  3HOY H;  3OTO L;  1YVC A;  2ZZE A;  3J7Z C;  2UUB L;  3HOV G;  5DLQ E;  3K7U C;  4JOI C;  2DTH A;  4DR6 L;  1PH9 A;  2KHJ A;  2L15 A;  4LF7 Q;  1OTC A;  1S72 A;  1TWG H;  2K5N A;  2Q5I A;  3P8V A;  3CXC A;  4XU3 A;  2VW9 A;  4DKA C;  4DV5 Q;  4O0A A;  3HOV H;  4APV A;  4ME3 A;  3I7F A;  4LF4 Q;  3J81 j;  1B7Y A;  3FP9 A;  4KHP L;  4DAY B;  1YIT A;  1PYS B;  2GN5 A;  2E2J H;  2JA6 G;  4BY1 G;  3PUZ A;  4X64 L;  1FJG L;  3H15 A;  2E2H H;  2ZIN A;  4K88 A;  4UP9 A;  4B3T L;  2EJG A;  2HT1 A;  1GM5 A;  1EOV A;  2P5I A;  5FJ8 G;  3T1Y L;  5FLX c;  2YTY A;  2OTJ A;  1TXY A;  3GTK H;  2JA6 H;  3LC0 A;  4GNX A;  4BY1 H;  2IHF A;  1YJW A;  2KBN A;  1VQ9 A;  4GLX A;  3K7A H;  1PH7 A;  5FJ8 H;  2V1C C;  2AWO A;  3AFP A;  3CCQ A;  2OQK A;  1WCM G;  2ZIM A;  4OX9 L;  1VQH A;  4YHH Q;  4JI6 Q;  2ZCE A;  4YY3 L;  3UDG A;  5GQO A;  4A3F G;  4H2T A;  4GNX C;  2RHS A;  3PCO A;  4A93 H;  1YB3 A;  1G29 1;  2ZTD A;  4YCW A;  5K36 G;  5M5W H;  3T1H L;  4FDB A;  3S17 H;  2LXK A;  1R9T H;  3TEG A;  4NXM Q;  4JI7 L;  1YI2 A;  1K8A C;  1IBK L;  4CH5 A;  5F5W A;  4LVJ A;  3CP0 A;  4CS3 A;  4YRP A;  3GTG H;  3HOU G;  4LFB L;  4K0K Q;  5LMN Q;  4L5S A;  1Y1V H;  1B70 B;  2F52 A;  3U4Z A;  1X9N A;  4IJH A;  2RHQ A;  2UXC Q;  3V7C A;  4HJ7 A;  3S2D H;  1HJP A;  3W3S A;  2ALY B;  1N36 L;  4WI1 A;  4JI2 L;  4HIM A;  1VQ5 A;  2I0Q A;  1Q1E A;  4DV7 Q;  1YHQ A;  2IHE A;  3G4S A;  1J5W A;  4X6A H;  1BIA A;  3REX A;  5C0X J;  1N32 Q;  3HY1 A;  1G51 A;  5C3E H;  4DR1 L;  2AKW A;  4IPD A;  1KC8 C;  3TUP A;  3S1Q H;  4MZ9 A;  3CPF A;  4A3M G;  3AQQ A;  1KAW A;  2WP8 J;  3A5Z A;  4HID A;  2B63 H;  3U50 C;  4H2X B;  2AMC B;  4Y7N H;  5JEA G;  2ZJP A;  2KCM A;  1NJ5 A;  5BR8 Q;  3CC2 A;  1BBW A;  5AJ3 L;  2UXB L;  4X65 Q;  4LVL A;  1K0R A;  4JC0 A;  3PF4 A;  2J3L A;  2A8V A;  3CCR A;  3CMQ A;  3HXU A;  4OWX B;  1N34 L;  3KJP A;  3MQZ A;  2R93 G;  2UUC L;  1RIP A;  1RL2 A;  4DR3 Q;  2ZT7 A;  1Z9F A;  4JV5 Q;  1UE6 A;  4P75 A;  2Q5H A;  1TWC H;  1PVO A;  1NTG A;  4TVY A;  2R92 G;  4DV0 L;  1A63 A;  1B7Y B;  4QIW E;  4KR2 A;  3CAM A;  3F2D A;  1VQI A;  4X66 Q;  2ZGW A;  3JC6 6;  4OWT B;  2UXD L;  4KR3 A;  4DV3 L;  3REU A;  2VNU D;  3ICA A;  3UE0 A;  4H2U A;  2ZTC A;  5E3I A;  1FYF A;  4JI4 Q;  4A3B G;  2R92 H;  2DTI A;  1L1O A;  1U5K A;  1VQA A;  3M85 A;  5KNN A;  5JJI A;  3D31 A;  1HNZ Q;  1K3R A;  1U0L A;  4JBK A;  1KRT A;  5IYD H;  1VCI A;  3TRE A;  2JA5 G;  4DQ2 A;  5GAH C;  2JA7 H;  2LXJ A;  2EXD A;  4LF7 L;  4P3O A;  2J3M A;  5GAG C;  2IY5 B;  3ZJY C;  1PFS A;  2KCT A;  1G6P A;  2RHS B;  4YCV A;  3PCO B;  2HHH Q;  4DPG A;  4X62 Q;  2JA5 H;  4LF4 L;  4AH6 A;  2R7Z G;  4WJ4 A;  2PME A;  4AYB E;  2I5M X;  4L5R C;  3CCM A;  1Q81 C;  1P8L A;  5H1S E;  4DR4 Q;  3CME A;  4RG1 A;  2ZXF A;  1W2B A;  1IBM Q;  3U58 A;  1MJE A;  4PG3 A;  2R7Z H;  2RHQ B;  3A7R A;  4Y52 H;  4PZ8 A;  3S2H H;  3HTZ A;  2F3I A;  3PIO A;  2Q2T A;  3V8L A;  4DV4 Q;  1X6O A;  4BBS G;  3PO3 H;  1TWF H;  2N3S A;  4H2S A;  4P73 C;  4DUZ Q;  3QO7 A;  1WFQ A;  4LFC Q;  1HNW L;  2DUD A;  2CQO A;  1KMM A;  1NY4 A;  4JI6 L;  2PNH A;  2Q7H A;  2JJQ A;  3J81 c;  2E5L Q;  3QNE A;  4C3J H;  1PHJ A;  3PUV A;  1I94 Q;  2AKW B;  1QVF A;  3TS2 A;  2C8M A;  3A5Z B;  4NXM L;  2YV5 A;  1HNX Q;  4YRL A;  3A5Y A;  1P16 A;  4TVW A;  2ZIO A;  4YRS A;  4K0K L;  2FXQ A;  1OXS C;  3NBH B;  4DV2 Q;  2Z6K A;  3TRZ A;  4DV6 Q;  1OXV A;  1NNH A;  1Q1B A;  4BBR G;  2ZZF A;  4TQF A;  2XTI A;  2VY3 A;  4LF5 L;  2CIM A;  5M3M G;  3WWV A;  2JEB I;  4A3C H;  2QHU A;  3DSQ A;  4YRI A;  3M9B A;  3J7A 5;  2Z6K C;  4R4T A;  3P8Y A;  5M3F H;  4DV7 L;  4JYA Q;  2XGT A;  4LF9 Q;  4OO1 I;  2ZT5 A;  3FJP A;  3CMA A;  3VBB A;  5J3B A;  1FL0 A;  1N32 L;  4DUY Q;  3UGQ A;  4JI0 Q;  4OON A;  3G48 A;  1CKO A;  4IJL A;  2MO1 A;  4DAM A;  2CJ9 A;  1A62 A;  3CCS A;  2BH8 A;  3HOW H;  1VQP A;  12AS A;  1VQK A;  3GTQ H;  3RR5 A;  2H5X A;  4JI5 Q;  1PH1 A;  5BR8 L;  1XMO Q;  2WAQ E;  4TVA A;  1QUQ A;  4LFA L;  1L1O B;  4X65 L;  4LVK A;  4DR7 Q;  3L4G A;  4LF8 L;  1WLE A;  1UE7 A;  4NPS A;  1AH9 A;  3PIP A;  2E2I H;  4JBM A;  5C53 B;  2K4K A;  2WB1 E;  1LTL A;  4A3K H;  1QZH A;  1S3O A;  1A0I A;  3HOY G;  3W5O A;  2NVY H;  1KXL A;  1IZ6 A;  4DR3 L;  4OLF A;  1EQQ A;  4IPH A;  1YFS A;  3A74 A;  2NZO A;  2N78 A;  4GKK Q;  3UGT A;  3V8J A;  4WJ3 M;  1PH5 A;  1N33 Q;  2K5H A;  2VS1 A;  2DDZ A;  1WNL A;  3RL6 A;  4X66 L;  4GLV B;  3J80 i;  3GDE A;  2UUA Q;  1FVI A;  4RDX A;  1X56 A;  3H3V I;  2AHO B;  3STB D;  5K1X A;  3MEY A;  2EQS A;  4JI1 L;  3S24 A;  4J15 A;  2EIF A;  4JCV E;  5C44 H;  3I4M H;  4Q6G A;  4LF6 Q;  3CQZ H;  2DZ9 A;  1L0W A;  3HKZ G;  3H0G H;  3VQV A;  1EIY A;  1HNZ L;  4B3M Q;  2Y0S G;  1CSP A;  4LUV A;  1GD7 A;  2NVX H;  2CFM A;  3OD1 A;  1IL2 A;  4C3I H;  1NJ1 A;  3HXY A;  5C0X G;  2EJF A;  3PZC A;  4XIG S;  3CPW A;  4HJ5 A;  2DTO A;  1AE3 A;  2YYZ A;  3IKM B;  3UDI A;  2HHH L;  1BKB A;  1JJG A;  3CCE A;  1X3E A;  2JA8 H;  3TQY A;  1GGM A;  2NN6 G;  4A93 G;  3BZK A;  2PI2 E;  4A3D H;  1KIX A;  3J81 i;  4L87 A;  3CCV A;  4LWC A;  1SMX A;  4B3S Q;  2NVQ H;  1N8R C;  1QVG A;  1H95 A;  3I2Z A;  2ARU A;  4DR4 L;  3V7S A;  2IY5 A;  2VZA A;  2UU9 Q;  1IBM L;  2Z0S A;  4XU0 A;  4L5Q A;  2PQA A;  3RZO H;  1Y1V G;  2D0P A;  5IT9 c;  1VQN A;  4R1J A;  3RF1 A;  3L0O A;  3RIR A;  2IT1 A;  4DUZ L;  5IYB H;  2DZC A;  4IFD J;  4EQ5 A;  1VQD A;  1L2F A;  1K8G A;  4YRQ A;  4YRM A;  4YRG A;  4GOP A;  1QZG A;  2E5L L;  2F4V Q;  4LUZ A;  5C0X I;  1HC7 A;  3KDF A;  4X5O A;  3IRB A;  1I94 L;  3R07 A;  4DNI A;  2OCE A;  1HTT A;  3ULP A;  2IX1 A;  1SET A;  1Q46 A;  5C3E G;  1VQJ A;  1BIB A;  1HNX L;  2C35 B;  4TQD A;  1OXU A;  2NN6 I;  1MJC A;  4BY7 H;  4JI8 L;  4IOA A;  3HKS A;  2D0O A;  3HOZ H;  2B63 G;  3NEN A;  3F1Z A;  3LSS A;  3JAM i;  5IY0 A;  4TVA B;  4DV2 L;  4YRR A;  2ZT8 A;  4DV6 L;  1QUQ B;  2QHS A;  1IBL Q;  4DV1 Q;  3L4G B;  1JE5 A;  1J5E Q;  2ODR D;  5IWA Q;  3HFV A;  1IXR A;  3E9H A;  3CD6 A;  4XTY A;  3L2P A;  3GTL H;  2CWA A;  3F2C A;  4B3R Q;  4YYE A;  4YRN A;  1MIU A;  4GKJ L;  4HIK A;  1VQF A;  3SGI A;  1ADY A;  4AQY Q;  4PHC A;  4IO9 A;  1E7Z A;  1JT8 A;  4JYA L;  4LF9 L;  1TWH H;  1KL9 A;  1SR3 A;  4DUY L;  1H4Q A;  4JI0 L;  2QGQ A;  4DK3 C;  1YHB A;  1XMQ L;  2DQ3 A;  1NBW A;  3S16 H;  4P71 A;  1XPU A;  3MXN B;  4QJF A;  5IP7 H;  1VQE A;  1HZ9 A;  2D62 A;  4JI5 L;  1XMO L;  3QO5 A;  3GTO H;  1X01 A;  1NMF A;  3P8T A;  1YGB A;  1EIY B;  3HXW A;  1XNQ Q;  1YJN A;  1YZ6 A;  4RMF A;  1WOC A;  3HKZ E;  4P75 C;  2PMZ E;  1PH2 A;  3CCU A;  2Y0S E;  4XTV A;  1UE5 A;  3LGJ A;  2VQE Q;  5IYD G;  2VQF Q;  3M3Y H;  4HJA A;  1ADJ A;  2Q2U A;  3PUX A;  4XTC S;  1HXD A;  4DR5 L;  3A0J A;  4P74 A;  2JA7 G;  4JBJ A;  4GKK L;  3Q8D A;  2RCN A;  1UEB A;  1N33 L;  1NJ2 A;  1QE0 A;  2MO0 A;  1L1O C;  2UUA L;  3PGZ A;  3V8K A;  2JE6 I;  3J80 c;  3UDX A;  2OTL A;  4KQE A;  3M4P A;  1USY A;  3AYH B;  4DV5 L;  2PQA B;  4LF6 L;  3CF5 A;  4A3L G;  3ER0 A;  4X64 Q;  1FJG Q;  5HY6 A;  1SER A;  1Q8K A;  3W1G A;  3UFG A;  4B3M L;  3T1Y Q;  3OW2 A;  3DM3 A;  4A3L H;  2ZM6 Q;  4A3I H;  4YP0 A;  3PO3 G;  2ODR C;  1E22 A;  4GOP B;  1HZC A;  4R4Q A;  1WU7 A;  3KDF B;  4XU1 A;  3PO2 G;  1I3Q H;  4YRT A;  4OX9 Q;  3U4V A;  2ZNJ A;  4YPF A;  4R4I A;  1I50 H;  2YTX A;  3G1Z A;  1W66 A;  3E0E A;  1X65 A;  3B6Y A;  4B3S L;  1VS0 A;  1GKH A;  4QQB X;  3PO2 H;  2A1A A;  3L7Z C;  4YHH L;  4JI7 Q;  3FHW A;  1SRU A;  4PMW A;  4A75 A;  2ASB A;  2I5H A;  2G4C A;  4H2Y A;  1KQS A;  2FYK A;  2KHI A;  3HOX G;  3D0F A;  4PZ7 A;  1PH4 A;  2CGH A;  1XNR Q;  3RN2 A;  1Y1W H;  1VQG A;  4A3C G;  1E1O A;  1N36 Q;  5LMN L;  1E1T A;  1YFR A;  2ZTG A;  4ZIB A;  3HXZ A;  2DGY A;  3KF8 B;  1B8A A;  3A7A A;  3HFZ A;  3HOX H;  2F4V L;  2I4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...