3I7FA

Aspartyl trna synthetase from entamoeba histolytica
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
535
structure length
485
Chain Sequence
QLPPVVLLKTPELVSGENFKVMPMHQSQPCYKTGLKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKEFVQFCQKISAESICDITGIVKAVEKPIEKATQQDVEIHVTSIAVVSLAEYPLPMQIEDLTFPSSVFKKQEEDIAKVKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHLTEFEGLDIEMEIVENYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartyl-tRNA synthetase
publication title Crystal structure of the aspartyl-tRNA synthetase from Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Ligase
total genus 129
structure length 485
sequence length 535
chains with identical sequence B
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i7fA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3i7fA02
3J7A5 2JEAI 1WPYA 2NVTH 3K8AA 3QO7A 3GTKH 4A3BG 4JI5L 4YRIA 3I4NH 2EJGA 4DR1Q 2E5LQ 3S1RH 4HJ5A 4A3BH 1XNRQ 4BBSG 3CCVA 1XJVA 3ERSX 4BBSH 3QNEA 4LNQA 4YHHQ 2R7DA 1N36L 4TTVA 2R7ZG 1PH2A 4JI2L 2CJ9A 1WYDA 2I0QA 2HHHQ 3DSQA 2MO1A 1S72A 2R7ZH 1XNQL 3S15H 1E1OA 3RN2A 4L5SA 1J5EQ 3NETA 1X56A 1HNZQ 2LSSA 4YP0A 4HWRA 4YCUA 3A0JA 4ZTZB 4DV1L 3HOXG 4HIKA 4LF6Q 4FDBA 3CCQA 3CCEA 5FLMH 4JI6Q 4BY1H 1G5IA 2DQ3A 1UEBA 3KJOA 1X3GA 3KF6A 4RQFA 2XGTA 3PUZA 4DKAC 3IG2A 4EX5A 1XPOA 2F4VL 4H2XA 4DV3L 4JBKA 3PCOB 3H3VH 3FP9A 1FJGQ 3CCMA 3U4VA 4A3FG 3PF4A 1CSQA 2DXUA 3M4OH 1MKHA 3TS0A 1YI2A 4A3FH 2FYKA 5LMUL 1VQ9A 1YFRA 3I2ZA 1QF6A 1KRSA 1BBWA 2G4CA 1VQ7A 1WCMG 2CWAA 1U5KA 1H4VB 3ULJA 1PA6A 1X6OA 3I4MG 2ZNIA 4XEMA 3H0GG 4BY7H 2BA1A 3J7ZC 2R93G 4J15A 5BR8L 2ARUA 4B3SL 3H0GH 3S1MH 3NBHB 1IZ6A 3CPFA 3I7FA 2PI2E 2I5HA 2Q7GA 4DV2L 4OWWB 3RL6A 2IHEA 1E24A 2E2IH 3P8YA 1EVLA 4DV0Q 4NXML 4NB3A 4P74C 1Q7YC 2PQAB 2C35B 5E7NA 2JA6H 3PIPA 2UXBL 4P3NA 2AWOA 1QZHA 2AWNA 3GTQH 1C9OA 2MFIA 4EO4A 2JA7G 1IL2A 3A5YA 2A19A 1QE0A 1EQRA 4A3LG 1M90C 3KDFA 1YBYA 2CJAA 5E3IA 2UUCQ 1YJWA 4JI1L 5IP7G 2I5LX 1V1QA 4XTUA 2N8NA 4X64Q 5M3MG 5K1XA 1YJ9A 2DKGA 4PZ7A 3VQVA 1WOCA 1XPUA 1IBKQ 4OP0A 1SETA 1TXYA 3V8KA 5LMNQ 3L1AA 1XMQL 1YHBA 2YYZA 4LFCQ 4NXNQ 4JYAL 3G6EA 4HVCA 4JI8Q 1XMOL 3M4PA 4POFA 3J80i 2ZZEA 3JAMc 4OWTB 3RKWA 2GVBA 1N33L 4YRFA 1PYBA 4HIOA 3SGIA 2KENA 3HKZE 2DVEA 4TVAB 2Q7HA 2NZOA 4H2SA 2UUBQ 4X6AH 3RACA 3ERRA 5C3EH 4BW9A 4YREA 4HWPA 1YIJA 1KD1C 1MJEA 4LFBQ 4XU1A 2R7FA 2P5IA 4HIDA 1W66A 3V8JA 1B7YA 1QVGA 4A3CG 4CH6A 1NTGA 4A3CH 1HJPA 4P75C 1EIYB 2HIVA 1PH9A 4X62Q 2RF4A 2N3SA 2MO0A 3Q8DA 3CPWA 4KR3A 1HR0L 4EQ5A 1JE5A 4XTYA 5C44H 2DQ0A 2PMZE 4DR5Q 2ZCEA 1AH9A 2P0LA 1QUQB 2UXCL 4DR3Q 4Q15A 1KQSA 1N9WA 4A75A 4K0KQ 1H4TA 3AEVA 4YWLA 4X66L 2WAQE 1Y1WG 3EBEA 2JEBI 3DLLA 2B63G 1Q81C 2NVYH 4JBJA 1N34L 3MEYA 1VQ6A 3LSSA 5GAGC 3HRKA 5IWAQ 5GQOA 2K75A 4DUZQ 3HOUG 4RQEA 4YRRA 1X3EA 3GTLH 2DTOA 1E22A 2ODRD 2PI2A 3J81i 3HOWH 1VQBA 4R1JA 1NY4A 3HFZA 3WQZA 3REXA 4LWCA 1X2HA 2UU9Q 1ATIA 3HOVG 2K52A 3ICAA 2RHQB 4LF9L 3RLOA 4IOAA 2QHVA 2OWOA 1VQ4A 2MNAA 3IKLA 4AYBE 2QEXA 5M3FG 1HNXL 4YRPA 4O2DA 2RHSA 1VQJA 4X5OA 3OD1A 3HOYH 3KF8B 1K3RA 4CH5A 4TVYA 3WWVA 1VQLA 3RKXA 3VQYA 1PH5A 5JJLA 5AJ3L 2YTYA 1PH3A 4DK3C 4BA1I 5IY0A 4JBMA 4LF5L 2DU5A 4A3KH 3OTOL 3A7UA 2HQLA 4POGA 1VQGA 3HKSA 1FGUA 3U58A 2JQOA 4DR4Q 2LXJA 4GN3B 2WB1G 4A4IA 1NJ5A 3IALA 4QY7A 1GGMA 4JG2A 1Q82C 3PO2H 4K86A 4GOPC 3BZKA 1X55A 3IKMB 3PZCA 2K4KA 4JI2Q 2VW9A 4YRLA 1CSPA 4KHPL 4R4IA 3HOZG 4GS3A 1SR3A 3KOJA 1HNWL 4DUYL 3AFPA 1E7ZA 3CC4A 1RL2A 4QL5A 3HOZH 1U0LA 1VQCA 3STBC 1E3PA 1FVIA 3TS2A 1UWVA 3H15A 3PUYA 3I55A 3S2DH 2KCTA 3ULLA 4JI4Q 1PYSA 4DV7L 2DEQA 4DV5L 1Q1BA 1EVKA 2ZM6L 5J3BA 1X9NA 1H95A 3AYHB 2JA8H 3RR5A 2F4VQ 4P74A 1A0IA 1GD7A 5IYBH 3S24A 1WU7A 2ZTDA 3TEHB 4XTXA 5C4JH 4MZ9A 4JI7Q 3RLNA 3VQXA 4OONA 1VQKA 3HFVA 4R4TA 4GLVB 4XU3A 4YRTA 1HTTA 1AE3A 5LMUQ 2I4LA 1PH4A 12ASA 4LUVA 1OTCA 3VDYA 1Q1EA 1L0WA 1IXRA 3I4NG 2D62A 1JJCA 1PH6A 1I94Q 1I6HH 4GNXA 1JB7A 5C0XG 2JA5G 2GVAA 1MJCA 3V7RA 4OX9Q 1LYLA 1BIAA 4B3SQ 4B3TQ 2JA5H 3L2PA 2OTLA 1EUJA 1I3QH 4DR7L 1WQ7A 3K80C 2ZNJA 5C4XH 4TVWA 4JBWA 2N78A 3CCRA 1Q8KA 3S17H 4YRKA 2AMCA 1EIFA 3BZCA 1WQWA 2UXBQ 3L2ZA 4DQ2A 3BFMA 1JJCB 4HJ8A 3FHWA 3RN5A 5FLMG 3RZOH 4B3RL 4BY1G 2NN6G 3M9BA 3LC0A 2ES2A 4B3ML 3TRZA 3M3YH 4H2YA 1IBLL 5JJKA 4KQEA 4JI1Q 1IYJB 4LF8L 1SRUA 3CD6A 1VQNA 2CJBA 4UP9A 4MNOA 1WI5A 4YRQA 3GDEA 4YROA 1N32Q 4TWAA 1USYC 1G291 4WJ4A 4P75A 3E9IA 1Q12A 4A3GH 1XMQQ 4LF7L 4P72C 2GN5A 3RNUA 1VQMA 1XPRA 4YRMA 1UE5A 2UXDL 1VQPA 4H2TA 3UE0A 1X3FA 2FXQA 1IBML 1AE2A 2A8VA 1YNXA 2Q5IA 3K81C 4A76A 3KF6B 3U50C 3NEMA 4BY7G 4WJ3M 1TWHH 4HIMA 2UUAL 4YCWA 4PZ6A 4JC0A 2D0OA 4X65L 1YJNA 1VQ8A 4NCXA 2VQEL 1NJIC 4H2XB 2ZT8A 4MTNA 1CKNA 2IY5A 1Y1VH 3E9HA 1S3OA 3TUPA 4K88A 4IJLA 1YHQA 2JA6G 5IE8A 4YPFA 2ZINA 4TQDA 4IPCA 4P73C 1HXDA 1Z47A 2E5LL 1L1OA 4RG1A 4GKJQ 1XNRL 4Q6GA 2CFMA 5C0XI 5C53B 4XU0A 4YHHL 2F3IA 4JI3Q 4A3JH 4HWOA 2DU7A 2E10A 3TQYA 2VUMH 3RF1A 1SESA 4X66Q 2ZXFA 1J5EL 3R07A 4PHCA 1SMXA 4GNXC 4IOCA 2EJ9A 1J6QA 2ZT7A 1YITA 2HNIA 1PFSA 3K7UC 1D8LA 4Y7NH 4QQBX 2Z6KC 1K73C 1GO3E 1C0AA 4H2WA 2NN6I 4YCVA 3U4ZA 4CS4A 2KHIA 3HTZA 2KCMA 3W5OA 3A5ZA 4IO9A 3K0XA 2DXTA 4P3PA 4ALPA 2JK8A 3KDFB 1DGSA 3A74A 1Z7MA 2RCNA 5C3EG 4P3OA 2ALYA 3RGLA 4ZIBA 4XTVA 3T1YQ 1ADYA 1H4QA 1S40A 1A8VA 1W3SA 3H3VI 1JJ2A 3HY0A 5GAEC 3CF5A 2VQFL 4GOPA 2KBNA 3STBD 4R4OA 1B8AA 4YY3L 4LF9Q 3GO5A 1C7YA 1G51A 1P16A 2DUDA 4OLFA 1NYQA 2K5NA 4JV5Q 2DZ9A 1KMMA 1G5HA 1KXLA 4UY8C 1PHJA 4BBRG 1JJGA 3UGQA 1JMCA 4C2MH 3EFSA 2ARTA 3QTCA 2EWNA 5AJ3Q 4BBRH 3M85A 1R9TH 1YEZA 5C44G 3PGZA 4ZTUB 2E8GA 1K8AC 3PUXA 2EJFA 3OTOQ 4DR2Q 3GD7A 4DV0L 2CQOA 1N8RC 3UE1A 4OXPA 3MXNB 2KHJA 2ID0A 3HKZG 4A3EG 5JJIA 1KOGA 1B7YB 4DV4Q 2BH2A 2B3GA 5LMNW 4BA2I 3CC7A 3TREA 4JI0L 2XTIA 2J3MA 5FJ8H 4C3HH 3J80c 4A3EH 3S14H 5IYDH 1B70A 3GTOH 3GTMH 3S1NH 3J81j 1PH8A 4KHPQ 3CMAA 1TWGH 2UUCL 1VQEA 4DNIA 2HT1A 3HOWG 1SRYA 4LF4L 4X64L 4UP8A 1RIPA 2ZTCA 1HZBA 1L1OC 4GN4B 4KLKA 1LM0A 4JOIC 2QGQA 3S16H 4A93H 4WF2A 5KNNA 2NZHA 2VNUD 1SERA 4CS3A 1O7IA 3CCJA 4YYEA 3V8LA 1W2BA 1FL0A 3D31A 3ZJYC 5IT9c 1VQIA 2WP8J 2Y0SE 2WAQG 3HOYG 2JA9A 5GADC 3GTGH 1NE3A 4A3IH 1HZAA 3HXYA 3HFZB 3EFRA 4A3KG 2H5XA 4GLXA 2NVQH 3FKIH 2OQ0A 4XEOA 4DR6L 3E0EA 4JI5Q 3L7ZC 3W1GA 3RKYA 4H02A 1SFOH 4YWMA 2DDZA 3P8TA 1USYA 3PO2G 4JCVE 3HXVA 2RHSB 4G85A 4BXXH 1PV4A 3HXZA 4TQUS 3S2HH 4P72A 4APVA 3J81c 2ZTEA 1N36Q 1K8GA 2I5MX 3G1ZA 1BKBA 3PO3H 1Q46A 4K0KL 4AQYL 2A1AA 2K14A 1YFSA 3CQZH 1PVOA 2Q2TA 4IFDJ 1XNQQ 4AYBG 3W3SA 1BBUA 4DV1Q 1NYRA 2AKWA 4HA8A 2CKZB 3UDGA 4ME3A 2E2JH 4B3MQ 4OO1G 2DJZA 3KFUA 3F2BA 2EIFA 2E41A 4P71C 1M1KC 4PG3A 2JA8G 4DK6C 4DUZL 4H2VA 1L2FA 4LNSA 1SROA 3RIRA 4A3DH 5IYBG 1ASYA 3OW2A 2EXDA 3ER0A 4P73A 4DV3Q 2WFWA 3T1HL 1LUZA 4IPDA 4E51A 4LF7Q 2PMEA 2E2HH 3PSIA 2AKWB 3DM3A 4TQFA 1NJ8A 2E5AA 1YVCA 1VQZA 1IBMQ 1PYSB 2I4NA 5GROA 4YDQA 5IYCH 4YRNA 4LUOA 4KI0A 2PNHA 2ZGWA 4QJFA 3AFQA 4X65Q 1YGBA 2ARSA 1VS0A 1K9MC 2VQEQ 1QVFA 1CKOA 1P8LA 5BR8Q 3GTPH 3VQWA 1VQAA 1UE6A 1X2GA 2OCEA 1KC8C 2B29A 3F2CA 2Z6KA 4XTZA 5M5YH 5C52B 5C4XG 1TWCH 1HZCA 4DV2Q 2QHTA 3CMQA 4NXMQ 4DAMA 1ADJA 5K36G 4DR4L 3W1BA 1Y14B 2ODRC 4GNXB 4GKKL 5EAYA 4YRGA 4IJHA 2Q7EA 1ASZA 2K50A 1VQOA 4LFAL 1K83H 4XIGS 1VQHA 4A3MG 1VQDA 2E65A 3CMEA 3D0FA 2VY3A 2VL6A 1UE1A 4XTCS 4C3IH 4A3MH 2YU9H 4L87A 2F52A 3PCOA 1QVCA 1BVSA 1WLEA 3CW2C 3NELA 1GVPA 3M7NA 1V43A 3ULPA 1E1TA 2AMCB 4A3GG 2ZJRA 1I50H 2D0PA 2Q2UA 4Y52H 3HOXH 2R6GA 3CAMA 4DV6L 1HZ9A 4JI4L 2L15A 4NPSA 2QHSA 1HH2P 1UE7A 4JYAQ 1X01A 1XMOQ 4OO1I 2MQHA 1N33Q 5FLXc 4IPGA 1NJ6A 2BA0A 4JI7L 2OTJA 3UDFA 4C3JH 4DPGA 2VQFQ 2C8MA 1Y1VG 2QHUA 3MEFA 4YY3Q 2CGHA 1NNHA 2PQAA 1KHIA 3HRIA 1OXSC 1BIBA 4CS2A 3I56A 3L4GA 4L5TA 1WCMH 2PMFA 1I94L 2I4OA 1TWAH 3VBBA 4DR1L 5JEAJ 2VZAA 4OX9L 3I4MH 2K5HA 4JOIA 4B3TL 3F1ZA 3UH0A 2ASBA 2R93H 3OYYA 1H4SA 4YRJA 3JAMi 3REUA 1WNLA 4A3JG 3A7AA 3ICEA 2VUMG 1HR0Q 3I4OA 1KL9A 3V7CA 1CKNB 2ZJQA 2UXCQ 2IY5B 1NMFA 2HHHL 2YTVA 2Z0SA 3G71A 3L4GB 3F2DA 4JI0Q 1G6PA 2EL9A 1HNZL 3KLWA 1N34Q 2E1HA 1SE8A 2ZT5A 1L1OB 4LF6L 2Q5HA 3A31A 4JI6L 2EAYA 1TWFH 4CH4A 2JA7H 3GTJH 3UDIA 5HGQA 1FYFA 5M5XH 1NJ1A 3F8TA 2AHOB 2DTIA 4TVAA 4A3LH 2Q2HA 4LF4Q 1SN8A 3IRBA 5K1PA 3BJUA 4IFDG 5IP7H 1N32L 3MF2A 5M3MH 2BH8A 1FJGL 4H2UA 4RDXA 1NBWA 3CCUA 3HY1A 5ELOA 3UFGA 1PH7A 1OXUA 1WFQA 1EFWA 4QIWE 5GAHC 5C0XJ 5IP9G 1EIYA 2E3CA 2EQSA 2DGYA 1J5WA 5IP9H 1K0RA 1HNXQ 1HR0W 3A5ZB 3RZDH 2IHFA 1VQ5A 2ZZFA 1A63A 1QUQA 2ALYB 1X54A 3RUXA 2ATWA 3P8VA 3FJPA 4K87A 4LF5Q 1KAWA 3BU2A 5ELNA 4P71A 1CUKA 4LW1A 4DR6Q 1JT8A 4PZ8A 4R4QA 3A32A 4GOPB 1KMNA 4RMFA 4YWKA 2NVXH 11ASA 1X65A 4GKJL 5FJ8G 1Z7NA 3CP0A 3PV0A 4KR2A 4PMWA 4DAYB 4BWAA 5IYDG 5C51B 4JI3L 2ZIOA 1OXVA 2JE6I 3LGJA 1GKHA 3MF1A 2HIXA 4AQYQ 2ZIMA 2ZT6A 1MIUA 1A62A 1V9PA 1HNWQ 4DUYQ 1Q86C 3KYHC 1T9HA 1Y1WH 1VQFA 4L5RC 4A93G 2B63H 5F5WA 1PH1A 2ZZGA 1EYGA 1IBKL 2RHQA 3HXXA 3G4SA 3RLFA 3PIOA 5LMNL 3L0OA 2LXKA 4HWSA 3UGTA 4DV7Q 3TEGA 4LFCL 4NXNL 4DV5Q 3CXCA 4JI8L 1B70B 2DZCA 1WJJA 2ZM6Q 4IPHA 3HOUH 3A7RA 3M4QA 2IX0A 2WB1E 3PUWA 3T1HQ 4HJ7A 2ZJPA 3T1YL 4AIMA 2UUBL 4QGUA 4A3IG 4IFDI 5HY6A 3HXUA 4OWXB 4LFBL 2K5VA 3FKIG 1YZ6A 3HOVH 4HWTA 2ZTGA 2R92G 4JV5L 3QO8A 4LUZA 4YRCA 3CCLA 4UPAA 2R92H 1EQQA 5M3FH 4GN5A 3QO5A 4BXXG 1B76A 1OXXK 4X62L 1QZGA 4DR2L 2CWPA 3EN2A 3PO3G 4DR7Q 4DR5L 1NMGA 1EWIA 2DTHA 3K7AH 3PF5A 1NJ2A 3B6YA 4DR3L 1KIXA 2YV5A 1YHAA 4XU2A 4O0AA 2Y0SG 4DV4L 2CCZA 4WI1A 4GKKQ 5JEAG 1YFTA 2N49A 4B3RQ 4LFAQ 4L5QA 4G84A 3CC2A 1SLJA 3HXWA 2QA4A 1IBLQ 5IWAL 4R4CA 1OXTA 4A3DG 3TEHA 3G48A 1EOVA 4AH6A 4LF8Q 4HJ9A 3PUVA 2J3LA 3EIVA 2I4MA 3A5UA 4GLAC 2Q2IA 1GM5A 5M5WH 2OQKA 4KHZA 2VS1A 2ZR2A 4UP7A 4DV6Q 2E64A 3KJPA 1I5FA 2YTXA 5H1SE 3NENA 2UU9L 1LTLA 3JC66 4HJAA 1VCIA 5DLQE 2IX1A 2UXDQ 2CIMA 3S1QH 2V1CC 2JJQA 5IYCG 1Z9FA 2IT1A 1CKMA 1YB3A 3V7SA 1XTDA 2UUAQ 3UDXA 1D7QA 3LSQA 4YRSA 1KRTA 1HC7A 3CCSA 4XTWA 4CH3A 2C7IA 3AQQA 1RIQA 2ZR3A
chains in the Genus database with same CATH superfamily
2K1BA 1X32A 3J7A5 2JEAI 1WPYA 2NVTH 3K8AA 3QO7A 3GTKH 4A3BG 4JI5L 4YRIA 2D5DA 3I4NH 2EJGA 4DR1Q 5C6AA 2E5LQ 3S1RH 4HJ5A 1WTXA 5C0XH 4KTAA 4A3BH 1JE4A 2E76C 3TZUA 1XNRQ 4LVLA 4BBSG 1I4GA 3V96A 2CH4A 3CKIB 5DEHA 3CCVA 3FKIB 2A6HD 4MIUA 1XJVA 3A7LA 1Z7TA 3ERSX 4HN7A 4BBSH 2R92B 1S5BD 3QNEA 4HAEA 4YHHQ 4LNQA 2R7DA 1N36L 4TTVA 4LK1C 1F9SA 2R7ZG 1SFOB 1QG7A 4MHEA 4C3IG 1PH2A 2RSNA 4JI2L 2CJ9A 1WYDA 2I0QA 2HHHQ 3DSQA 2MO1A 2K01A 1PMRA 4QMGA 1S72A 2R7ZH 1XNQL 4CJ0B 3S15H 1E1OA 3RN2A 4L5SA 1J5EQ 3NETA 1CHPD 2NBFA 1X56A 1C48A 1HNZQ 2LSSA 4YP0A 4HWRA 4YCUA 3A0JA 4K6LA 4ZTZB 1CZGA 4DV1L 1AW7A 2G9HD 3HOXG 4HIKA 2EY5A 3PO3B 2AUJD 4LF6Q 4WJWA 5EJWA 4FDBA 3CCQA 2B2UA 3BDCA 3CCEA 1PRTF 3KUPA 5FLMH 4JI6Q 3C3LA 3CQZB 1E2WA 2DJGC 2SDFA 3NWTA 4XQJA 4BY1H 1G5IA 2NN6H 2DQ3A 1UEBA 1WTWA 1EQTA 5EBDA 3KJOA 1EZ8A 1EOTA 1X3GA 3KF6A 3BDLA 3P75A 2Y0SB 3A8IE 2R61A 3K6OA 4OEMB 4RQFA 4RCOA 5IGGA 2XGTA 3K5NA 4ID6A 1DONA 1TKWB 4K2LA 3PUZA 4DKAC 2KEDA 3IG2A 4EX5A 5FKAC 1XPOA 2F4VL 1JQYD 2A73B 4H2XA 4DV3L 4JBKA 3PCOB 3H3VH 3FP9A 3MTSA 1FJGQ 3CCMA 4KMUC 3U4VA 4A3FG 3PF4A 1CSQA 2DXUA 4C3JG 3NUCA 3M4OH 1MKHA 3TS0A 1YI2A 4IURA 5IOCA 4A3DB 2K5QA 1FNWA 1JCKB 4L6TB 4A3FH 1EEID 2FYKA 5LMUL 1VQ9A 3NWSA 1JWUD 1YFRA 3CU7A 3I2ZA 3VR2A 1QF6A 1KRSA 1BBWA 2G4CA 1VQ7A 1WCMG 2CWAA 1U5KA 1H4VB 3T16A 3ULJA 2L12A 1SBBB 1PA6A 2E2HB 1X6OA 3I4MG 2ZNIA 5CBAE 3OPOA 4U673 4XEMA 3S1QB 3H0GG 5I9OA 4BY7H 4PQXA 2BA1A 3J7ZC 2R93G 4J15A 5BR8L 1D5XC 2ARUA 5JPMC 1WTHA 4B3SL 3H0GH 3S1MH 2NWGA 1JOQA 3NBHB 1IZ6A 5A2QE 4EVOA 3CPFA 3I7FA 2H1EA 2PI2E 4B9WA 2I5HA 2Q7GA 5FLXL 4DV2L 4OWWB 3RL6A 2M00A 2IHEA 1E24A 2E2IH 3P8YA 1IHZA 1EVLA 4DV0Q 2IPKD 3MHBA 4NXML 4NB3A 4P74C 1YNNC 1Q7YC 3GTPB 2PQAB 5F2DA 2C35B 5E7NA 1JWSD 1D6EC 1JOKA 1DOKA 2JA6H 1HQMC 4UDUC 3PIPA 2UXBL 5M5YB 1TWCB 3C2PA 4P3NA 2AWOA 1QZHA 2AWNA 3GTKB 4IN3A 3HP3A 5LHY1 1IW7C 2SOBA 3GTQH 1FNVA 3OHXC 2IW3A 1C9OA 2MFIA 4EO4A 4YIJA 1IL2A 2JA7G 1DZ1A 3A5YA 2A19A 4DF7A 1QE0A 2WV6D 1ET9A 4A3BB 1D1IA 2KHSA 4HCSA 1EQRA 1UEAB 4A3LG 2HD3A 1M90C 1SNCA 2DJFC 3KDFA 4WFN3 1YBYA 3I3CA 1PLFA 2CJAA 5E3IA 3A7AB 1H9JA 1K8MA 4KD3A 5CV6A 1YJWA 2UUCQ 4JI1L 1ET6A 4BBSB 5CMDA 5IP7G 3A55A 2I5LX 1V1QA 2XVSA 2N8NA 5CV9A 4XTUA 1HTPA 4X64Q 1OO9B 5M3MG 5K1XA 1D5MC 1I4RA 1YJ9A 3TSSA 1MBYA 2DKGA 4PZ7A 3VQVA 4X3UA 2R7ZB 1LV9A 4JK1C 1WOCA 1XPUA 1IBKQ 4OP0A 4C3IB 2YU9B 2OXPA 1SETA 1TXYA 3V8KA 5LMNQ 4KKSA 3L1AA 1XMQL 1YHBA 1B53A 2YYZA 4M8AA 5KEEA 1VMPA 4LFCQ 4NXNQ 4JYAL 3G6EA 1A3VA 2A6ED 4HVCA 5FOBB 4JI8Q 3SHLA 1XMOL 3Q24A 3M4PA 4POFA 1RD9D 3J80i 2ZZEA 1I50B 1JC7A 2L9HA 3NQTA 3JAMc 4OWTB 3RKWA 2GVBA 3H94A 3HOXB 1N33L 2RDHA 4YRFA 1PYBA 4HIOA 3SGIA 2KENA 2AUKA 3BYTB 1PFBA 3HKZE 2DVEA 3G7LA 4TVAB 2Q7HA 2NZOA 5E4WC 3IFTA 3KLSX 4H2SA 2UUBQ 4X6AH 3T56B 3RACA 3ERRA 5C3EH 4ILWA 2IWHA 1QJOA 3FRPB 4BW9A 4YREA 4HWPA 2B2UC 1AN8A 1YIJA 1F2YA 1B9NA 3NK9A 1KD1C 4N8X1 3M7GA 1MJEA 4L63B 4NMZA 4LFBQ 4XU1A 2R7FA 3MXNA 1FR3A 2P5IA 4HIDA 3A8KE 3QG1A 1W66A 3V8JA 1ENFA 2A5HA 2DY8A 1HA6A 1L0XB 1B7YA 1DOLA 1AEXA 1QVGA 4A3CG 4DN4M 1UAPA 1F77A 3EROA 3K59A 4A3FB 4C3JB 3DEOA 4CH6A 1NTGA 4A3CH 1HJPA 4P75C 1RDPD 2PZUA 1EIYB 3W2DA 4R9WA 2HIVA 1PH9A 1S5ED 4I7AA 1ILQA 4X62Q 2RF4A 2N3SA 2MO0A 4NDXA 1WCMB 3Q8DA 3CPWA 4KR3A 2X6LA 1MD2D 1TWAB 2A68D 1HR0L 1B3AA 1AZQA 5LL6S 4EQ5A 1JE5A 4DAPA 4XTYA 4TSSA 5C44H 2DQ0A 2PMZE 2I07B 4DR5Q 3I73A 3PIO3 2ZCEA 1AH9A 2P0LA 3I4MB 1QUQB 2UXCL 1QNUA 1B4OA 1F9QA 4DR3Q 3H0GB 4Q15A 1KQSA 3D4RA 1N9WA 4A75A 4K0KQ 1M4VA 1H4TA 2R93B 1SYDA 4EGVA 4YWLA 3AEVA 4X66L 2WAQE 1Y1WG 1SMYD 2KA7A 3H09A 3EBEA 3OWEB 2JEBI 4RHRA 2CH4W 3DLLA 2E2IB 2B63G 1Q81C 2BDNA 2NVYH 4JBJA 1N34L 5I6YA 3MEYA 1EYAA 2AQ3B 2HCCA 2WKCA 1VQ6A 4IUTA 3LSSA 2J4XA 2PO4A 1RTNA 5GAGC 1IL8A 2KVMA 4F8MA 3HRKA 5KNDA 1IKMA 3K0YA 5IWAQ 5GQOA 2ZT9C 2K75A 2F0LA 3SK5A 4DUZQ 3HOUG 4RQEA 1LTRD 4YRRA 1NSNS 3QB3A 1X3EA 3GTLH 2DTOA 4CKEA 1E22A 4OIJA 1LACA 1GOZA 4OELB 2ODRD 2PI2A 3OSOA 4KY7A 3J81i 1EWCA 3MQZA 3HOWH 1TWFB 4ZLTF 3GTJB 1VQBA 4R1JA 1NY4A 5M5XB 3HFZA 3WQZA 3I4LA 5KRUA 3J80E 4J6HA 4TKOB 2K5DA 4LVMA 3REXA 2EY2A 4LWCA 3TDQA 1X2HA 4HSVA 3EA6A 3DM1A 2UU9Q 1ATIA 5JAVA 3HOVG 4YPFA 2K03A 4ZKBB 2JP1A 1DXMA 1O7YA 5CBEE 5M3MB 2K52A 3ICAA 2RHQB 4LF9L 3RLOA 3MXGA 4IOAA 4RFBA 2QHVA 3AB9A 2OWOA 1VQ4A 2F03A 2MNAA 3IKLA 4AYBE 1R4PB 2QEXA 5M3FG 1HNXL 4YRPA 4O2DA 3MXPA 2RHSA 1VQJA 2F0TA 4X5OA 3OD1A 5IGBA 3HOYH 3GV6A 3KF8B 1WTRA 1K3RA 4CH5A 4TVYA 1EYDA 3WWVA 3I91A 2PW7A 1VQLA 3RKXA 3VQYA 1LTSD 1I4QA 4DU9A 1PH5A 5JJLA 5AJ3L 1BCPD 3CRLC 2YTYA 1PH3A 4DK3C 2O5JC 4BA1I 2RBMA 2XIWA 2EJMA 5IY0A 4JBMA 1PFMA 3GP7A 4LF5L 2DU5A 4A3KH 3BDOA 3OTOL 3A7UA 2HQLA 4POGA 1TQOA 1VQGA 3K5MA 4EQOA 3HKSA 1FGUA 2F0JA 1SE4A 3U58A 4K2KA 1JB3A 1I4XA 2JQOA 4DR4Q 2LXJA 4GN3B 5EPKA 1EFID 2L5TA 2WB1G 1Y8NB 2F4IA 4A4IA 3LWEA 5IIFA 1NJ5A 3D8GA 4QY7A 3IALA 4JPBW 4I7ZC 3QWNA 3S9WA 1GGMA 4JG2A 1Q82C 2F1MA 1D2BA 3PO2H 2XWJB 4K86A 2EYOA 4GOPC 1SYBA 3BZKA 2NVXB 2XWBB 3I90A 1X55A 2SNMA 3IKMB 3PZCA 2K4KA 4JI2Q 1RHPA 3KLSA 3KBXA 2VW9A 2B8FA 3NPPA 4YRLA 4U68A 1CSPA 1ESFA 4KHPL 4R4IA 1K8OA 3HOZG 4GS3A 1SR3A 1STHA 3KOJA 1HNWL 4DUYL 3AFPA 1E7ZA 2L4NA 1IYUA 3CC4A 1RL2A 2SNSA 4QL5A 5JVG3 1W6JA 3HOZH 1U0LA 1VQCA 4QUCA 2V4DA 3EQLC 3STBC 1E3PA 4C1NK 1FVIA 1TS5A 4CKCA 3TS2A 2HCIA 1BCPB 1NR4A 1S5DD 2B2TC 1UWVA 1YNND 3H15A 4FF1A 3PUYA 3I55A 4QIWB 2EJFC 3S2DH 1PRTD 1D1KA 3BZDB 4EQPA 2KCTA 5A35A 3J81E 4LF9Q 3E0JA 3ULLA 4JI4Q 1PYSA 1Y1WB 4OO1H 4DV7L 2DEQA 4DV5L 2B63B 1Q1BA 5ELBA 2PZTA 1EVKA 1HQRD 2ZM6L 3NHHA 5J3BA 1X9NA 1H95A 3AYHB 2JA8H 3RR5A 5HURA 2F4VQ 4P74A 1X3QA 1A0IA 1GD7A 4F7XA 5IYBH 1E2VA 3S24A 1WU7A 5ELDA 2L11A 2ZTDA 3TEHB 4XTXA 5C4JH 4MZ9A 5I9PA 4JI7Q 1PXUA 3RLNA 3VQXA 4OONA 4OL7A 1VQKA 5TSSA 3HFVA 2BOSA 4R4TA 4GLVB 4XU3A 4YRTA 1ENCA 1HTTA 1AE3A 4H44C 5LMUQ 3HOUB 2I4LA 1PH4A 12ASA 2EYFA 1EWHA 4LUVA 4GZYC 1OTCA 1HTLD 3VDYA 1FYCA 4CHTB 5IGCA 3MC0B 3RD4A 1B3QA 1Q1EA 1L0WA 2H4OA 3OW7A 3URYA 5LL6X 1IXRA 3I4NG 2D9UA 2D62A 1JJCA 1DYQA 1UNSA 1PH6A 1I94Q 1I6HH 3VYTA 4GNXA 1JB7A 5C0XG 1BNZA 5E3FA 4F88A 2JA5G 2GVAA 2K04A 3VYRA 2MPMA 1MJCA 3TMEA 1XWEA 4OX9Q 3V7RA 1LYLA 3HOVB 1BIAA 4B3SQ 1CA6A 4J8QA 1PRTB 1WTPA 4B3TQ 2JA5H 2QCPX 3ND9A 4BWGB 3L2PA 2OTLA 3J7AV 1SYGA 1EUJA 4IUPA 4ZYSA 3H91A 1I3QH 3SEBA 2WKDA 3HRZC 5C4ZA 4DR7L 5M3FB 1WQ7A 2XNAC 3K80C 2ZNJA 1H9MA 5C4XH 4TVWA 4UAIA 4JBWA 2FMCA 3TN2A 2N78A 2OEOA 3CCRA 1Q8KA 5CV8A 3S17H 4YRKA 2AMCA 3FPPA 1EIFA 3BZCA 1D5ZC 3R3OA 4RKBA 1WQWA 1DCZA 2UXBQ 3L2ZA 4DQ2A 2NTSA 1JJCB 5K36H 3BFMA 4XT3B 3BYYB 4HJ8A 3FHWA 3RN5A 1YNJC 5G3LF 5KYIA 3HS0C 1U4MA 5FLMG 3RZOH 4KJOA 4B3RL 2PQEA 3K7AB 4FP5D 2NN6G 4BY1G 2HDMA 3M9BA 1ZYRC 2K05A 1O7ZA 4PMBA 5ELEA 4PV1C 3NTHA 3LC0A 2ES2A 1E0BA 1NNXA 1PTOF 4B3ML 3TRZA 4KK7A 1CA5A 1DJRD 3M3YH 5J1ZA 4H2YA 1IBLL 5JJKA 4KQEA 4HEDA 4JI1Q 2WB1B 1IYJB 5KYLA 5KIXA 4LF8L 1SRUA 1BUVT 3CD6A 1EU3A 2F0WA 1EY5A 1VQNA 2O4XA 4UP9A 2CJBA 4MNOA 1WI5A 3L9AX 2F0QA 4BS9A 3J7AF 2ZXOA 4IUQA 4YRQA 1GUOA 3GDEA 4LMQD 4YROA 4B9XA 1N32Q 2EE1A 4CKBA 5IODA 4TWAA 1H9KA 1USYC 1G291 4WJ4A 5AFWA 4P75A 1AZPA 3E9IA 1Q12A 4A3GH 1XMQQ 4LF7L 4P72C 2GN5A 3RNUA 1A2TA 3HOZB 2F0VA 4UHVA 1VQMA 4WORA 3TP6A 1BDOA 2NTTA 1II3A 3Q22A 1XPRA 4YRMA 1UE5A 2UXDL 1HFGA 3T13A 5M5WB 3KBGA 4FXGC 1VQPA 4H2TA 3UE0A 3GV3A 1X3FA 2FXQA 4HMJA 1IBML 2AQ2B 1AE2A 2A8VA 2D2CC 4PMCA 1YNXA 3A8JE 2Q5IA 1VDZA 3K81C 4A76A 3KF6B 1Y69U 3R2IA 1GUGA 1STBA 3NEMA 3U50C 4BY7G 4WJ3M 2LFNA 1TWHH 4HIMA 4CJ2C 2UUAL 4YCWA 4PZ6A 4JC0A 2D0OA 1HCZA 1XX8A 4X65L 1YJNA 1VQ8A 4NCXA 3PIP3 2VQEL 1NJIC 4H2XB 2J0TD 5C4HA 2ZT8A 4MTNA 1CKNA 1GUSA 2IY5A 4RGTA 1Y1VH 3E9HA 3QR8A 4V0BA 1S3OA 1ONLA 3OMGA 3TUPA 4K88A 5T1IA 1BF4A 4IJLA 1F2MA 4B08A 1YHQA 4CJ1B 2JA6G 5IE8A 1S5CD 4N9PA 3VR4A 4V190 1A3TA 4IPCA 3AMUA 2ZINA 4P73C 4HSPA 4TQDA 1HXDA 1QNKA 1Z47A 2E5LL 4E6IA 1L1OA 3K57A 2GA4B 5C5LA 4RG1A 4GKJQ 2Q8RE 1XNRL 1PTOC 1NUCA 2HQEA 2JSOA 2A8EA 1B9MA 4Q6GA 1TR5A 3IKJA 2CFMA 5C0XI 5C53B 1CQFA 1SNOA 1I6HB 2NVTB 4XU0A 4YHHL 2F3IA 4JI3Q 3I4NB 4A3JH 4HWOA 2DU7A 1XTCD 2CQAA 1HXYD 2E10A 1EIHA 3S1RB 3TQYA 2VUMH 2CW0D 2JA5B 5FO8B 3RF1A 3T51B 1SESA 4C1NI 1AFPA 4X66Q 5DNFA 1SYCA 3NBIA 3DWQA 4CBVA 2ZXFA 1J5EL 3R07A 3SK8A 1I3QB 4PHCA 1SMXA 4GNXC 4IOCA 2EJ9A 1J6QA 3P1HA 3VYUA 1U4PA 2ZT7A 1YITA 1PDQA 5DM73 1Z6HA 2HNIA 3OWFA 1PFSA 1EQVA 3K7UC 3S17B 5ELFA 1CK1A 1D8LA 1DOMA 3IAYA 4Y7NH 4QQBX 3ERQA 2RVLA 3S15B 2Z6KC 1K73C 1I6VC 4ABNA 4ODGA 1T5EA 1GO3E 1GJXA 2J7ZA 1C0AA 1LTID 4H2WA 1HPCA 2NN6I 4N9TA 4YCVA 3U4ZA 4CS4A 2Z8LA 2KHIA 3HTZA 2BE5C 2KCMA 3W5OA 4IO9A 3A5ZA 3K0XA 2DXTA 4P3PA 4ALPA 3D6WA 4R8NA 2JK8A 2K6AA 3KDFB 4K5WA 4BY1B 1DGSA 3A74A 3E5SA 3H6MA 3MFGA 1Z7MA 1ZEQX 2RCNA 3BVGA 5C3EG 3QOLA 4P3OA 4QUFA 2ALYA 2G5DA 1MSHA 3RGLA 4XTVA 4ZIBA 3T1YQ 1SE2A 1ADYA 1H4QA 4P2CB 1A8VA 1S40A 1W3SA 2TMPA 3F2UA 1TS3A 2EY1A 3H3VI 2VB2X 1C4QA 4K8IA 1JJ2A 4R8IA 1Y8PB 4EQNA 1LTBD 1F9PA 2VB3X 5FO9B 3HY0A 5GAEC 1V8QA 3CF5A 2VQFL 4GOPA 1XYIA 2KBNA 2QILA 1F2LA 1B8AA 3C1FA 4R4OA 5CV4A 3STBD 4YY3L 1F9RA 2A6HC 3GO5A 1C7YA 1G51A 1P16A 2DUDA 4OLFA 4JW0A 1NYQA 3M4OB 5BN4A 2K5NA 4O42A 5E4XA 4JV5Q 1TU2B 4NW2A 1G2TA 1K3BC 4DAYA 3IFDA 3UI2A 2DZ9A 1KMMA 1G5HA 4FXDA 3PQIA 3MVVA 1KXLA 1PHJA 4UY8C 4BBRG 3MAQA 1JJGA 3UGQA 3K5OA 1JMCA 4C2MH 4ME5A 3EFSA 2ARTA 3QTCA 2EWNA 5AJ3Q 5M9OA 1H9SA 4BBRH 2B2TA 3JAML 3M85A 1R9TH 1YEZA 5C44G 5EKLA 3PGZA 5EPLA 1GHKA 4ZTUB 2E8GA 3WOFA 1K8AC 3I8ZA 3HZXA 3PUXA 3OTOQ 2EJFA 4DR2Q 3GD7A 4FF4A 4BY7B 3DWAA 4DV0L 2CQOA 1N8RC 2RDFA 3UE1A 4OXPA 3MXNB 2KHJA 2ZXRA 2KOLA 1CQVA 1MGSA 4OGQC 3S1MB 2ID0A 1QOHA 3HKZG 4A3EG 2F0DA 4ZUIA 5JJIA 1KOGA 1B7YB 1R4QB 4DV4Q 2BH2A 2B3GA 5LMNW 4BA2I 2M9VA 3CC7A 3TREA 2NUCA 4JI0L 2XTIA 3R2TA 2J3MA 5FJ8H 5KGUA 4C3HH 3L3OC 3J80c 4XYOA 4A3EH 1STNA 4HMIA 3N52A 1V1PA 3S14H 4DXFA 4FYDA 2BDOA 5IYDH 1B70A 2OT2A 3GTOH 3GTMH 2JA6B 3S1NH 3FPUB 4PNYA 1LLRD 1LTAD 3J81j 1PH8A 4G7HC 4KHPQ 4TRDA 3CMAA 1TWGH 2UUCL 3NSWA 1CM9A 1VQEA 3GTQB 4DNIA 2HT1A 3HOWG 1KNAA 1WTQA 2MJ8A 4LF4L 1SRYA 3MA2B 4X64L 4CDCC 4UP8A 1RIPA 2ZTCA 3D4DA 1HZBA 2O5IC 1L1OC 4GN4B 5CV7A 4KLKA 4MTKA 1LM0A 4JOIC 1HFNA 2PPBC 2F0PA 2QGQA 3E3XA 2KUMA 3X3MA 3S16H 4A93H 2F0GA 1FGBD 4WF2A 5KNNA 1UUPA 2NZHA 2VNUD 1DD2A 1SERA 4CS3A 2B2YA 1O7IA 1TY0A 3CCJA 3ZYYX 1V1PB 4YYEA 3V8LA 3FDTA 1W2BA 3SR1A 1QCBD 1FL0A 1SNMA 1YNJD 3D31A 5I2XA 3ZJYC 3BS1A 4NKLA 4K5XA 5IT9c 2XSCA 1W6KA 1VQIA 2X69A 3ITPA 3TP5A 1ZYRD 1TVXA 2WP8J 2Y0SE 2WAQG 2F0UA 3HOYG 1EY0A 2JA9A 1PTOH 1KLUD 2RSOA 4J1MA 2EYHA 5GADC 1U4RA 3GTGH 1BQQT 3TZDA 4DNTB 3EFXD 2CHBD 4RH6A 1NE3A 4A3IH 1BO0A 2L0CA 1HZAA 3HXYA 3HFZB 2F3WA 3EFRA 2WACA 4A3KG 2H5XA 4GLXA 1DM0B 2NVQH 5C3EB 2ENBA 2F0IA 3FKIH 2OQ0A 4XEOA 4F87A 2RCFA 4DGZA 2KQ3A 1ILPA 4DR6L 5IT9E 3E0EA 4JI5Q 3V05A 3L7ZC 3W1GA 2PNRC 3SXHA 1KLGD 3RKYA 1SEBD 3PMFA 4H02A 1SFOH 1MI2A 1LT5D 4K8JA 1EZ6A 4YWMA 2DDZA 1HUNA 3P8TA 1USYA 2LKVA 4LJZC 3PO2G 4JCVE 3HXVA 2RHSB 2TSSA 4G85A 4BXXH 1PV4A 3FEWX 3HXZA 4TQUS 3S2HH 4P72A 4APVA 3J81c 5EGTA 2ZTEA 1CHQD 1N36Q 1K8GA 2I5MX 4ZKCB 3G1ZA 1BKBA 1LT4D 3PO3H 1Q46A 4K0KL 4CDFC 4BBRB 4AQYL 1SYFA 2A1AA 2K14A 1YFSA 4X3TA 3CQZH 1PVOA 2Q2TA 5IGFA 4IFDJ 3BG3A 1JICA 3DMUA 1XNQQ 2NZ1D 2A6EC 4AYBG 5IGDA 5DM63 3M4YA 1PZJD 4ZCKA 5C44B 3W3SA 1B44D 2K32A 3ONAB 2MHVA 1BBUA 2EOTA 4DV1Q 5JEAH 3I70A 1ESRA 1NYRA 2AKWA 4HA8A 5D14A 2CKZB 3HG9A 2K28A 1PZID 4ME3A 3UDGA 2ICEC 2E2JH 4B3MQ 4OO1G 1LT6D 3KFUA 2DJZA 3F2BA 4H7BA 2EIFA 2E41A 4Q0FA 4P71C 2NVYB 5JOBA 1RODA 1M1KC 4PG3A 1BR9A 3HKZB 4A3EB 3DXJC 2JA8G 1EY9A 3J7YW 4DK6C 4DUZL 4H2VA 2F0HA 1L2FA 1JOOA 4LNSA 1PYWD 1SROA 3SK6A 3RIRA 3NTKA 4A3DH 5IYBG 3S1NB 1ASYA 1IW7D 1RF2D 2EXDA 3OW2A 1JR0D 3ER0A 5C5MA 3P7JA 4P73A 4DV3Q 3MXUA 2WFWA 2B2VC 3T1HL 1LUZA 4IPDA 4ZQ3A 5I2YA 4E51A 4LF7Q 1GHJA 1SE3A 3LWUA 4M1UB 5I4DA 3OIQA 2PMEA 3C46A 3GTLB 3D6CA 2E2HH 3PSIA 1O78A 2FFKB 5CR3A 2FMMA 4KHVA 2AKWB 3DM3A 3HOWB 4TQFA 1NJ8A 2E5AA 2IL8A 1YVCA 1K28A 3KK7A 1VQZA 1EEFD 1IBMQ 2FHTA 4CDEC 2SEBD 2RQXA 1PYSB 1STEA 3TP8A 5GROA 2I4NA 4YDQA 5IYCH 4YRNA 2LY7A 4LUOA 4KJNA 1JORA 4WRDA 3IL8A 4KI0A 2PNHA 3RUZA 2ZGWA 1ENAA 3NTIA 2ICIA 1SJED 4QJFA 4KKUA 3AFQA 4X65Q 1YGBA 2ARSA 4OIKA 1EL0A 2XRSD 1VS0A 1K9MC 2VQEQ 1QVFA 1SJHD 1BCPF 1CKOA 1P8LA 1PFNA 1IYVA 3A54A 5BR8Q 2PMZB 2BE5D 2IX3A 3GTPH 1AP0A 2F0SA 3VQWA 1VQAA 1UE6A 1X2GA 2QDLA 2B2YC 2OCEA 1KC8C 2NS6A 2PW5A 2B29A 3F2CA 4FF2A 2Z6KA 4XTZA 5M5YH 5C52B 5C4XG 1TWCH 1HZCA 2WAQB 4IZ8A 4DV2Q 2QHTA 3HOYB 3CMQA 5CC4A 3VR6A 1A15A 3GTGB 1BBXC 1GXDC 4A3IB 2F0OA 4NXMQ 4KY6A 1G8ZD 4DAMA 1ADJA 1FNUA 4NP5A 1STYA 5K36G 5EPJA 4JVZA 4DR4L 5EKKA 3GQBA 3W1BA 1CFMA 2NVQB 1KDAA 3NXWA 1Y14B 2Z4HA 3G6JB 4A3KB 2RKSA 3HEJA 4MN3A 4RWSC 4FF3A 2ODRC 4GNXB 4GKKL 5EAYA 4YRGA 4IJHA 4XQQA 2Q7EA 2F0NA 1ASZA 3O13A 3QOJA 2K50A 4X3SA 1VQOA 1EY4A 4LFAL 1K83H 1M8AA 1VQHA 4XIGS 4A3MG 1KAAA 1KNEA 2WINB 4CGYB 1VQDA 2XN9C 1RJTA 2O2LD 3T4AC 2JN4A 2E65A 3CMEA 3D0FA 2VY3A 1LT3D 2VL6A 3CHBD 1UE1A 1H9RA 4IALA 4G7ZC 4XTCS 4C3IH 4A3MH 2YU9H 3C1EA 2F52A 3PCOA 4L87A 1QVCA 1BVSA 1WLEA 3VR3A 3S2HB 3PO2B 3CW2C 3WDNA 3NELA 1GVPA 5ELCA 1S5FD 4HCEA 3M7NA 1V43A 3ULPA 5JPNC 1WVLA 1E1TA 2NB0A 2AMCB 4A3GG 2ZJRA 4RCNA 4K5VA 1I50H 2D0PA 2Q2UA 3EVQA 4Y52H 3HOXH 2EVBA 3U9OA 2R6GA 3CAMA 2AQ1B 4DV6L 1HZ9A 1GUNA 4JI4L 2L15A 4NPSA 4ULLA 3DWPA 2QHSA 1HH2P 4AYBB 1UE7A 4JYAQ 1X01A 1XMOQ 1KTKA 4DXGA 3T53B 5CV5A 4OO1I 4KD4A 2HUGA 1BCPC 2E2JB 2MQHA 2K33A 1N33Q 5FLXc 3S2DB 2MUYA 3BVZA 4IPGA 1NJ6A 3NBHA 2BA0A 4JI7L 5EKIA 3QO2A 3LX0A 2HDLA 2OTJA 3UDFA 4DFAA 2JA8B 4O1NA 4C3JH 1RTOA 4G4KA 1SAPA 4DPGA 2VQFQ 2C8MA 1Y1VG 2QHUA 2N88A 1BOSA 3MEFA 4YY3Q 2CGHA 1NNHA 2PQAA 4IUNA 1KHIA 5C4JB 3HRIA 1OXSC 3BVMA 1BIBA 4CS2A 3I56A 1EU4A 3L4GA 4L5TA 1WTVA 1TIID 1WCMH 1VF5C 4ZAIA 2PMFA 1I94L 2I4OA 1TWAH 3VBBA 1HA5A 2VXWA 4LAAA 5A2QL 4RA8A 1WD1A 4DR1L 5JEAJ 4I65A 2VZAA 3FMCA 5FLXE 4OX9L 3I4MH 2K5HA 4KN7C 2A74C 4JOIA 4B3TL 3F1ZA 1V1OA 4X3KA 3UH0A 2ASBA 2R93H 3OYYA 1H4SA 4YRJA 3JAMi 3REUA 1I4PA 1WNLA 4A3JG 1T5XD 3TBIB 3FVQA 3A7AA 1QE6A 3ICEA 2B2WC 1RKNA 2QF7A 1HR0Q 2VUMG 5KNBA 3I4OA 1KL9A 3VR5A 2C5CA 3V7CA 1CKNB 2ZJQA 2UXCQ 1J8IA 2IY5B 3I72A 1QWYA 1PRTC 1NMFA 2HHHL 4K14A 1ZKOA 2YTVA 2Z0SA 3G71A 3L4GB 3F2DA 2WIIB 1HUMA 4JI0Q 1SDFA 1G6PA 2EL9A 1HNZL 3KLWA 1N34Q 2E1HA 1SE8A 1G2SA 1EY7A 2RDGA 3NP8A 5C4XB 2ZT5A 1QB5D 1K0SA 1L1OB 2FINB 4LF6L 1SSOA 2Q5HA 4IUUA 2F0EA 4JI6L 2EAYA 3A31A 1TWFH 4CH4A 2JA7H 3GTJH 3UDIA 4QCLA 5HGQA 1FYFA 5M5XH 2A69C 4QF4A 2Z6BA 3F8TA 1NJ1A 2AHOB 2DTIA 4TVAA 4A3LH 2Q2HA 1LTGD 4IQZA 3RZOB 1WTOA 1A3UA 2EJGC 4LF4Q 3DEPA 2MGSA 1SNQA 4DK1A 1SN8A 1K83B 3E6ZX 3IRBA 5K1PA 3BJUA 4IFDG 4RGOS 5IP7H 1N32L 2JXMB 1TS2A 2EYLA 1E2ZA 3MF2A 2B39A 5M3MH 3KLRA 3QJYA 5NUCA 4Q5VA 4A3MB 3M3YB 2BH8A 4ZRZA 4IFDH 1FJGL 4H2UA 1GUTA 4RDXA 1NBWA 3WOEA 3CCUA 3HY1A 5ELOA 3UFGA 4DK0A 1PH7A 2K5WA 1OXUA 1CZWA 4CDDC 1GUWA 1WFQA 1EFWA 3D3RA 4QIWE 5GAHC 1ZXTA 5C0XJ 1FD7D 5IP9G 1EIYA 4A3GB 1SYEA 4HR7B 2E3CA 5BN3A 2EQSA 1CTMA 2QEJC 2DGYA 4ZUJA 3HGBA 2KECA 5K5PA 1J5WA 3R8BA 1EIGA 1K0RA 1O7LA 1U4LA 2N55A 5IP9H 1HNXQ 1HR0W 3Q0AA 3EJIA 3A5ZB 4KV6A 4C56C 3RZDH 1A6XA 2IHFA 1VQ5A 4G57A 4K6DA 3SK4A 4XYQA 1A63A 1B50A 2ZZFA 4RAUC 4S3SA 1QUQA 1JWMD 2ALYB 1X54A 1IKLA 3RUXA 2ATWA 4RHSA 3P8VA 5BN5A 2OF1A 1O80A 1STAA 3FJPA 1TWHB 4K87A 2EDGA 5I6WA 4LF5Q 1KAWA 3BU2A 5ELNA 4P71A 1CUKA 4LW1A 3CRKC 4DR6Q 4KY5A 1JT8A 4PZ8A 4G7OC 3JAME 4R4QA 3A32A 2R3ZA 4GOPB 1KMNA 4RMFA 4YWKA 2NVXH 11ASA 3A56A 5T1GA 1X65A 4GKJL 5FJ8G 1Z7NA 1Y1VB 4C3HG 2LS01 3CP0A 3PV0A 3N6RA 1ICFB 4KR2A 4PMWA 2B2VA 2DY7A 4DAYB 4BWAA 5IYDG 5D3IB 2BCOA 1LABA 4JI3L 5C51B 2ZIOA 2QKIC 1OXVA 4H0LC 2JE6I 1HHVA 1STGA 3LGJA 4DA2A 1GKHA 3MF1A 2HIXA 3ND8A 1H9SB 4AQYQ 2ZIMA 2ZT6A 1BXTA 1MIUA 1A62A 5CORA 5L37A 2EY6A 5E1FA 2F3VA 1V9PA 3SVMA 5COYA 2KJXA 1HNWQ 4DUYQ 1Q86C 3KYHC 5JVH3 1T9HA 2LMCB 1VMCA 1Y1WH 1VQFA 4A3JB 2Z4IA 4L5RC 3AU7A 4A93G 2E74C 2VUMB 1MSGA 1U9RA 2EYJA 2B63H 5F5WA 5DAUA 2PZWA 1PH1A 2ZZGA 2JYOA 1LTTD 1EYGA 4FO2A 1SNPA 1IBKL 2RHQA 3HXXA 3SDZA 1EYCA 2X6GA 3G4SA 3RLFA 3PIOA 5LMNL 5HGTA 3X3NA 2F0KA 4DNRB 2Q8TA 1SXTA 4LVJA 1Q3LA 2LXKA 3L0OA 4HWSA 3UGTA 3NE5B 4DV7Q 2E75C 3TEGA 2KCCA 4LFCL 4NXNL 2EYPA 3U9SA 5CYUA 4DV5Q 3CXCA 3Q6SA 4JI8L 3VYSA 1B70B 2DZCA 1WJJA 2ZM6Q 1NR2A 4Y7NB 3J80L 1CI3M 1TT2A 3KF8A 4IPHA 3HOUH 2JA7B 3A7RA 3M4QA 2IX0A 2WB1E 3PUWA 3SE0A 4HT4A 3T1HQ 4HJ7A 4HTHA 3RMHA 2ZJPA 5J39A 3T1YL 4AIMA 2IJ0A 2UUBL 2C9OA 3OIPA 1KDBA 4QGUA 4A3IG 4IFDI 3DHQA 5HY6A 4XXEA 1WD0A 3HXUA 4OWXB 2K7VA 4RGMA 1TY2A 4LFBL 2K5VA 1HRJA 3FKIG 4LVKA 1YZ6A 3HOVH 4HWTA 1G6ZA 4Z9CB 2ZTGA 2R92G 4JV5L 4FVMA 3QO8A 1J9OA 4LUZA 2I46A 1TS4A 3D4WA 4YRCA 2KEEA 1I4HA 1KABA 2P5ZX 2QW7A 3P20A 4H13C 2CW0C 3MWYW 3CCLA 4UPAA 4XDXA 3K5LA 2R92H 2Z1CA 1EQQA 5M3FH 4GN5A 4LVIA 3H3VC 1C8CA 3QO5A 3MEHA 4BXXG 1VF7A 5IT9L 1B76A 1ICWA 1CT1D 1OXXK 4X62L 1XXGA 1QZGA 1EY6A 1S4ZA 4DR2L 2CWPA 1A2UA 4XQNA 3EN2A 3RZDB 5EBCA 3PO3G 1MHWC 2QDBA 2EPBA 2NYZD 3R93A 4DR7Q 4DR5L 2RA4A 1NMGA 1EWIA 4C2MB 5JJZA 2FJ2A 2DTHA 1B1ZA 5KNCA 3K7AH 3PF5A 1NJ2A 2EXZA 3B6YA 4DR3L 1KIXA 2YV5A 4QB4A 1YHAA 1R9TB 4XU2A 4O0AA 2EZVA 4L8JA 5D3DA 4ZK9B 2Y0SG 4DV4L 1Y8OB 3OMCA 4XT1B 2DNCA 2CCZA 4WI1A 2E2DC 5CGKA 4GKKQ 3W3AA 5JEAG 1YFTA 2N49A 1B2TA 4B3RQ 2EYMA 1G91A 1ML0D 4LFAQ 4L5QA 5G3LD 2L55A 5IGEA 4G84A 1Q8IA 3CC2A 3NQIA 2G9DA 5J22A 1QILA 1SLJA 3MFYA 3HXWA 2QA4A 1IBLQ 5IWAL 4OHJA 3VA5A 4R4CA 1LO5D 1OXTA 4C3HB 4A3DG 1PTOD 2PYKA 1RCVD 3TEHA 3G48A 1EOVA 2B8GA 2MP1A 4AH6A 4HJ9A 4LF8Q 3S14B 3PUVA 4KKTA 1Q90A 4KN4C 2J3LA 3GTOB 3GTMB 3VA7A 3EIVA 3J81L 3Q23A 2I4MA 1F2ZA 3A5UA 4N8FA 4GLAC 2Q2IA 1GM5A 5M5WH 2OQKA 4KHZA 1SNDA 1NAPA 2DN8A 2VS1A 3LNNA 1TWGB 3DUZA 5EQ0A 2ZR2A 4UP7A 4DV6Q 2E64A 3V2TA 5D65A 3KJPA 1I5FA 3MZ5A 5C3WA 2YTXA 4DAVA 5H1SE 2L1BA 3NENA 2UU9L 5ISRA 1LTLA 3JC66 4HJAA 3TP7A 2F0MA 1VCIA 2B2WA 5DLQE 1EY8A 2IX1A 2UXDQ 2CIMA 3S1QH 3S16B 2KCNA 2CVRA 4IUVA 2XRQD 2V1CC 5C3XA 4A93B 4FNFA 2JJQA 5IYCG 2M2LA 1Z9FA 2IT1A 1CKMA 2A68C 1PZKD 1L0YB 1YB3A 4FXKC 3V7SA 1X3PA 1XTDA 2A69D 2UUAQ 3UDXA 1D7QA 2F0FA 3LSQA 4YRSA 4RKLA 3K58A 5FO7B 1NCVA 1KRTA 1HC7A 3OOCA 3CCSA 4XTWA 1SMYC 4CH3A 2C7IA 1KDCA 2PCFB 4RGNA 5FK9C 2Z9HA 3QIAA 3AQQA 1PTOB 1RIQA 2ZR3A 2ZXPA 2Q8IB 2DNEA
chains in the Genus database with same CATH topology
3J7A5 2JEAI 1WPYA 2NVTH 3K8AA 3QO7A 3GTKH 4A3BG 4JI5L 4YRIA 3I4NH 2EJGA 4DR1Q 2E5LQ 3S1RH 4HJ5A 4A3BH 4LVLA 1XNRQ 4BBSG 3CCVA 1XJVA 3ERSX 4BBSH 3QNEA 4LNQA 4YHHQ 2R7DA 1N36L 4TTVA 2R7ZG 1PH2A 4JI2L 2CJ9A 1WYDA 2I0QA 2HHHQ 3DSQA 2MO1A 1S72A 2R7ZH 1XNQL 3S15H 1E1OA 3RN2A 4L5SA 1J5EQ 3NETA 1X56A 1HNZQ 2LSSA 4YP0A 4HWRA 4YCUA 3A0JA 4ZTZB 4DV1L 3HOXG 4HIKA 4LF6Q 4FDBA 3CCQA 3CCEA 5FLMH 4JI6Q 4BY1H 1G5IA 2DQ3A 1UEBA 3KJOA 1X3GA 3KF6A 4RQFA 2XGTA 3PUZA 4DKAC 3IG2A 4EX5A 1XPOA 2F4VL 4H2XA 4DV3L 4JBKA 3PCOB 3H3VH 3FP9A 1FJGQ 3CCMA 3U4VA 4A3FG 3PF4A 1CSQA 2DXUA 3M4OH 1MKHA 3TS0A 1YI2A 4A3FH 2FYKA 5LMUL 1VQ9A 1YFRA 3I2ZA 1QF6A 1KRSA 1BBWA 2G4CA 1VQ7A 1WCMG 2CWAA 1U5KA 1H4VB 3ULJA 1PA6A 1X6OA 3I4MG 2ZNIA 4XEMA 3H0GG 4BY7H 2BA1A 3J7ZC 2R93G 4J15A 5BR8L 2ARUA 4B3SL 3H0GH 3S1MH 3NBHB 1IZ6A 3CPFA 3I7FA 2PI2E 2I5HA 2Q7GA 4DV2L 4OWWB 3RL6A 2IHEA 1E24A 2E2IH 3P8YA 1EVLA 4DV0Q 4NXML 4NB3A 4P74C 1Q7YC 2PQAB 2C35B 5E7NA 2JA6H 3PIPA 2UXBL 4P3NA 2AWOA 1QZHA 2AWNA 3GTQH 1C9OA 2MFIA 4EO4A 2JA7G 1IL2A 3A5YA 2A19A 1QE0A 1EQRA 4A3LG 1M90C 3KDFA 1YBYA 2CJAA 5E3IA 2UUCQ 1YJWA 4JI1L 5IP7G 2I5LX 1V1QA 4XTUA 2N8NA 4X64Q 5M3MG 5K1XA 1YJ9A 2DKGA 4PZ7A 3VQVA 1WOCA 1XPUA 1IBKQ 4OP0A 1SETA 1TXYA 3V8KA 5LMNQ 3L1AA 1XMQL 1YHBA 2YYZA 4LFCQ 4NXNQ 4JYAL 3G6EA 4HVCA 4JI8Q 1XMOL 3M4PA 4POFA 3J80i 2ZZEA 3JAMc 4OWTB 3RKWA 2GVBA 1N33L 4YRFA 1PYBA 4HIOA 3SGIA 2KENA 3HKZE 2DVEA 4TVAB 2Q7HA 2NZOA 4H2SA 2UUBQ 4X6AH 3RACA 3ERRA 5C3EH 4BW9A 4YREA 4HWPA 1YIJA 1KD1C 1MJEA 4LFBQ 4XU1A 2R7FA 2P5IA 4HIDA 1W66A 3V8JA 1B7YA 1QVGA 4A3CG 4CH6A 1NTGA 4A3CH 1HJPA 4P75C 1EIYB 2HIVA 1PH9A 4X62Q 2RF4A 2N3SA 2MO0A 3Q8DA 3CPWA 4KR3A 1HR0L 4EQ5A 1JE5A 4XTYA 5C44H 2DQ0A 2PMZE 4DR5Q 2ZCEA 1AH9A 2P0LA 1QUQB 2UXCL 4DR3Q 4Q15A 1KQSA 1N9WA 4A75A 4K0KQ 1H4TA 3AEVA 4YWLA 4X66L 2WAQE 1Y1WG 3EBEA 2JEBI 3DLLA 2B63G 1Q81C 2NVYH 4JBJA 1N34L 3MEYA 1VQ6A 3LSSA 5GAGC 3HRKA 5IWAQ 5GQOA 2K75A 4DUZQ 3HOUG 4RQEA 4YRRA 1X3EA 3GTLH 2DTOA 1E22A 2ODRD 2PI2A 3J81i 3MQZA 3HOWH 1VQBA 4R1JA 1NY4A 3HFZA 3WQZA 4LVMA 3REXA 4LWCA 1X2HA 2UU9Q 1ATIA 3HOVG 2K52A 3ICAA 2RHQB 4LF9L 3RLOA 4IOAA 2QHVA 2OWOA 1VQ4A 2MNAA 3IKLA 4AYBE 2QEXA 5M3FG 1HNXL 4YRPA 4O2DA 2RHSA 1VQJA 4X5OA 3OD1A 3HOYH 3KF8B 1K3RA 4CH5A 4TVYA 3WWVA 1VQLA 3RKXA 3VQYA 1PH5A 5JJLA 5AJ3L 2YTYA 1PH3A 4DK3C 4BA1I 5IY0A 4JBMA 4LF5L 2DU5A 4A3KH 3OTOL 3A7UA 2HQLA 4POGA 1VQGA 3HKSA 1FGUA 3U58A 2JQOA 4DR4Q 2LXJA 4GN3B 2WB1G 4A4IA 1NJ5A 3IALA 4QY7A 1GGMA 4JG2A 1Q82C 3PO2H 4K86A 4GOPC 3BZKA 1X55A 3IKMB 3PZCA 2K4KA 4JI2Q 2VW9A 4YRLA 1CSPA 4KHPL 4R4IA 3HOZG 4GS3A 1SR3A 3KOJA 1HNWL 4DUYL 3AFPA 1E7ZA 3CC4A 1RL2A 4QL5A 3HOZH 1U0LA 1VQCA 3STBC 1E3PA 1FVIA 3TS2A 1UWVA 3H15A 3PUYA 3I55A 3S2DH 2KCTA 3ULLA 4JI4Q 1PYSA 4DV7L 2DEQA 4DV5L 1Q1BA 1EVKA 2ZM6L 5J3BA 1X9NA 1H95A 3AYHB 2JA8H 3RR5A 2F4VQ 4P74A 1A0IA 1GD7A 5IYBH 3S24A 1WU7A 2ZTDA 3TEHB 4XTXA 5C4JH 4MZ9A 4JI7Q 3RLNA 3VQXA 4OONA 1VQKA 3HFVA 4R4TA 4GLVB 4XU3A 4YRTA 1HTTA 1AE3A 5LMUQ 2I4LA 1PH4A 12ASA 4LUVA 1OTCA 3VDYA 1Q1EA 1L0WA 1IXRA 3I4NG 2D62A 1JJCA 1PH6A 1I94Q 1I6HH 4GNXA 1JB7A 5C0XG 2JA5G 2GVAA 1MJCA 3V7RA 4OX9Q 1LYLA 1BIAA 4B3SQ 4B3TQ 2JA5H 3L2PA 2OTLA 1EUJA 1I3QH 4DR7L 1WQ7A 3K80C 2ZNJA 5C4XH 4TVWA 4JBWA 2N78A 3CCRA 1Q8KA 3S17H 4YRKA 2AMCA 1EIFA 3BZCA 1WQWA 2UXBQ 3L2ZA 4DQ2A 3BFMA 1JJCB 4HJ8A 3FHWA 3RN5A 5FLMG 3RZOH 4B3RL 4BY1G 2NN6G 3M9BA 3LC0A 2ES2A 4B3ML 3TRZA 3M3YH 4H2YA 1IBLL 5JJKA 4KQEA 4JI1Q 1IYJB 4LF8L 1SRUA 3CD6A 1VQNA 2CJBA 4UP9A 4MNOA 1WI5A 4YRQA 3GDEA 4YROA 1N32Q 4TWAA 1USYC 1G291 4WJ4A 4P75A 3E9IA 1Q12A 4A3GH 1XMQQ 4LF7L 4P72C 2GN5A 3RNUA 1VQMA 1XPRA 4YRMA 1UE5A 2UXDL 1VQPA 4H2TA 3UE0A 1X3FA 2FXQA 1IBML 1AE2A 2A8VA 1YNXA 2Q5IA 3K81C 4A76A 3KF6B 3U50C 3NEMA 4BY7G 4WJ3M 1TWHH 4HIMA 2UUAL 4YCWA 4PZ6A 4JC0A 2D0OA 4X65L 1YJNA 1VQ8A 4NCXA 2VQEL 1NJIC 4H2XB 2ZT8A 4MTNA 1CKNA 2IY5A 1Y1VH 3E9HA 1S3OA 3TUPA 4K88A 4IJLA 1YHQA 2JA6G 5IE8A 4YPFA 2ZINA 4TQDA 4IPCA 4P73C 1HXDA 1Z47A 2E5LL 1L1OA 4RG1A 4GKJQ 1XNRL 2A8EA 4Q6GA 2CFMA 5C0XI 5C53B 4XU0A 4YHHL 2F3IA 4JI3Q 4A3JH 4HWOA 2DU7A 2E10A 3TQYA 2VUMH 3RF1A 1SESA 4X66Q 2ZXFA 1J5EL 3R07A 4PHCA 1SMXA 4GNXC 4IOCA 2EJ9A 1J6QA 2ZT7A 1YITA 2HNIA 1PFSA 3K7UC 1D8LA 4Y7NH 4QQBX 2Z6KC 1K73C 1GO3E 1C0AA 4H2WA 2NN6I 4YCVA 3U4ZA 4CS4A 2KHIA 3HTZA 2KCMA 3W5OA 3A5ZA 4IO9A 3K0XA 2DXTA 4P3PA 4ALPA 2JK8A 3KDFB 1DGSA 3A74A 1Z7MA 2RCNA 5C3EG 4P3OA 2ALYA 3RGLA 4ZIBA 4XTVA 3T1YQ 1ADYA 1H4QA 1S40A 1A8VA 1W3SA 3H3VI 1JJ2A 3HY0A 5GAEC 3CF5A 2VQFL 4GOPA 2KBNA 3STBD 4R4OA 1B8AA 4YY3L 4LF9Q 3GO5A 1C7YA 1G51A 1P16A 2DUDA 4OLFA 1NYQA 2K5NA 4JV5Q 2DZ9A 1KMMA 1G5HA 1KXLA 4UY8C 1PHJA 4BBRG 1JJGA 3UGQA 1JMCA 4C2MH 3EFSA 2ARTA 3QTCA 2EWNA 5AJ3Q 4BBRH 3M85A 1R9TH 1YEZA 5C44G 3PGZA 4ZTUB 2E8GA 1K8AC 3PUXA 2EJFA 3OTOQ 4DR2Q 3GD7A 4DV0L 2CQOA 1N8RC 3UE1A 4OXPA 3MXNB 2KHJA 2ID0A 3HKZG 4A3EG 5JJIA 1KOGA 1B7YB 4DV4Q 2BH2A 2B3GA 5LMNW 4BA2I 3CC7A 3TREA 4JI0L 2XTIA 2J3MA 5FJ8H 4C3HH 3J80c 4A3EH 3S14H 5IYDH 1B70A 3GTOH 3GTMH 3S1NH 3J81j 1PH8A 4KHPQ 3CMAA 1TWGH 2UUCL 1VQEA 4DNIA 2HT1A 3HOWG 1SRYA 4LF4L 4X64L 4UP8A 1RIPA 2ZTCA 1HZBA 1L1OC 4GN4B 4KLKA 1LM0A 4JOIC 2QGQA 3S16H 4A93H 4WF2A 5KNNA 2NZHA 2VNUD 1SERA 4CS3A 1O7IA 3CCJA 4YYEA 3V8LA 1W2BA 1FL0A 3D31A 3ZJYC 5IT9c 1VQIA 2WP8J 2Y0SE 2WAQG 3HOYG 2JA9A 5GADC 3GTGH 1NE3A 4A3IH 1HZAA 3HXYA 3HFZB 3EFRA 4A3KG 2H5XA 4GLXA 2NVQH 3FKIH 2OQ0A 4XEOA 4DR6L 3E0EA 4JI5Q 3L7ZC 3W1GA 3RKYA 4H02A 1SFOH 4YWMA 2DDZA 3P8TA 1USYA 3PO2G 4JCVE 3HXVA 2RHSB 4G85A 4BXXH 1PV4A 3HXZA 4TQUS 3S2HH 4P72A 4APVA 3J81c 2ZTEA 1N36Q 1K8GA 2I5MX 3G1ZA 1BKBA 3PO3H 1Q46A 4K0KL 4AQYL 2A1AA 2K14A 1YFSA 3CQZH 1PVOA 2Q2TA 4IFDJ 1XNQQ 4AYBG 3W3SA 1BBUA 4DV1Q 1NYRA 2AKWA 4HA8A 2CKZB 3UDGA 4ME3A 2E2JH 4B3MQ 4OO1G 2DJZA 3KFUA 3F2BA 2EIFA 2E41A 4P71C 1M1KC 4PG3A 2JA8G 4DK6C 4DUZL 4H2VA 1L2FA 4LNSA 1SROA 3RIRA 4A3DH 5IYBG 1ASYA 3OW2A 2EXDA 3ER0A 4P73A 4DV3Q 2WFWA 3T1HL 1LUZA 4IPDA 4E51A 4LF7Q 2PMEA 2E2HH 3PSIA 2AKWB 3DM3A 4TQFA 1NJ8A 2E5AA 1YVCA 1VQZA 1IBMQ 1PYSB 2I4NA 5GROA 4YDQA 5IYCH 4YRNA 4LUOA 4KI0A 2PNHA 2ZGWA 4QJFA 3AFQA 4X65Q 1YGBA 2ARSA 1VS0A 1K9MC 2VQEQ 1QVFA 1CKOA 1P8LA 5BR8Q 3GTPH 3VQWA 1VQAA 1UE6A 1X2GA 2OCEA 1KC8C 2NS6A 2B29A 3F2CA 2Z6KA 4XTZA 5M5YH 5C52B 5C4XG 1TWCH 1HZCA 4DV2Q 2QHTA 3CMQA 4NXMQ 4DAMA 1ADJA 5K36G 4DR4L 3W1BA 1Y14B 2ODRC 4GNXB 4GKKL 5EAYA 4YRGA 4IJHA 2Q7EA 1ASZA 2K50A 1VQOA 4LFAL 1K83H 4XIGS 1VQHA 4A3MG 1VQDA 2E65A 3CMEA 3D0FA 2VY3A 2VL6A 1UE1A 4XTCS 4C3IH 4A3MH 2YU9H 4L87A 2F52A 3PCOA 1QVCA 1BVSA 1WLEA 3CW2C 3NELA 1GVPA 3M7NA 1V43A 3ULPA 1E1TA 2AMCB 4A3GG 2ZJRA 1I50H 2D0PA 2Q2UA 4Y52H 3HOXH 2R6GA 3CAMA 4DV6L 1HZ9A 4JI4L 2L15A 4NPSA 2QHSA 1HH2P 1UE7A 4JYAQ 1X01A 1XMOQ 4OO1I 2MQHA 1N33Q 5FLXc 4IPGA 1NJ6A 2BA0A 4JI7L 2OTJA 3UDFA 4C3JH 4DPGA 2VQFQ 2C8MA 1Y1VG 2QHUA 3MEFA 4YY3Q 2CGHA 1NNHA 2PQAA 1KHIA 3HRIA 1OXSC 1BIBA 4CS2A 3I56A 3L4GA 4L5TA 1WCMH 2PMFA 1I94L 2I4OA 1TWAH 3VBBA 4DR1L 5JEAJ 2VZAA 4OX9L 3I4MH 2K5HA 4JOIA 4B3TL 3F1ZA 3UH0A 2ASBA 2R93H 3OYYA 1H4SA 4YRJA 3JAMi 3REUA 1WNLA 4A3JG 3A7AA 3ICEA 2VUMG 1HR0Q 3I4OA 1KL9A 3V7CA 1CKNB 2ZJQA 2UXCQ 2IY5B 1NMFA 2HHHL 2YTVA 2Z0SA 3G71A 3L4GB 3F2DA 4JI0Q 1G6PA 2EL9A 1HNZL 3KLWA 1N34Q 2E1HA 1SE8A 2ZT5A 1L1OB 4LF6L 2Q5HA 3A31A 4JI6L 2EAYA 1TWFH 4CH4A 2JA7H 3GTJH 3UDIA 5HGQA 1FYFA 5M5XH 1NJ1A 3F8TA 2AHOB 2DTIA 4TVAA 4A3LH 2Q2HA 4LF4Q 1SN8A 3IRBA 5K1PA 3BJUA 4IFDG 5IP7H 1N32L 3MF2A 5M3MH 2BH8A 1FJGL 4H2UA 4RDXA 1NBWA 3CCUA 3HY1A 5ELOA 3UFGA 1PH7A 1OXUA 1WFQA 1EFWA 4QIWE 5GAHC 5C0XJ 5IP9G 1EIYA 2E3CA 2EQSA 2DGYA 1J5WA 5IP9H 1K0RA 1HNXQ 1HR0W 3A5ZB 3RZDH 2IHFA 1VQ5A 2ZZFA 1A63A 1QUQA 2ALYB 1X54A 3RUXA 2ATWA 3P8VA 3FJPA 4K87A 4LF5Q 1KAWA 3BU2A 5ELNA 4P71A 1CUKA 4LW1A 4DR6Q 1JT8A 4PZ8A 4R4QA 3A32A 4GOPB 1KMNA 4RMFA 4YWKA 2NVXH 11ASA 1X65A 4GKJL 5FJ8G 1Z7NA 3CP0A 3PV0A 4KR2A 4PMWA 4DAYB 4BWAA 5IYDG 5C51B 4JI3L 2ZIOA 1OXVA 2JE6I 3LGJA 1GKHA 3MF1A 2HIXA 4AQYQ 2ZIMA 2ZT6A 1MIUA 1A62A 1V9PA 1HNWQ 4DUYQ 1Q86C 3KYHC 1T9HA 1Y1WH 1VQFA 4L5RC 4A93G 2B63H 5F5WA 1PH1A 2ZZGA 1EYGA 1IBKL 2RHQA 3HXXA 3G4SA 3RLFA 3PIOA 5LMNL 4LVJA 3L0OA 2LXKA 4HWSA 3UGTA 4DV7Q 3TEGA 4LFCL 4NXNL 4DV5Q 3CXCA 4JI8L 1B70B 2DZCA 1WJJA 2ZM6Q 4IPHA 3HOUH 3A7RA 3M4QA 2IX0A 2WB1E 3PUWA 4HT4A 3T1HQ 4HJ7A 2ZJPA 3T1YL 4AIMA 2UUBL 4QGUA 4A3IG 4IFDI 5HY6A 3HXUA 4OWXB 4LFBL 2K5VA 3FKIG 4LVKA 1YZ6A 3HOVH 4HWTA 2ZTGA 2R92G 4JV5L 3QO8A 4LUZA 4YRCA 3CCLA 4UPAA 2R92H 1EQQA 5M3FH 4GN5A 4LVIA 3QO5A 4BXXG 1B76A 1OXXK 4X62L 1QZGA 4DR2L 2CWPA 3EN2A 3PO3G 4DR7Q 4DR5L 1NMGA 1EWIA 2DTHA 3K7AH 3PF5A 1NJ2A 3B6YA 4DR3L 1KIXA 2YV5A 1YHAA 4XU2A 4O0AA 2Y0SG 4DV4L 2CCZA 4WI1A 4GKKQ 5JEAG 1YFTA 2N49A 4B3RQ 4LFAQ 4L5QA 4G84A 3CC2A 1SLJA 3HXWA 2QA4A 1IBLQ 5IWAL 4R4CA 1OXTA 4A3DG 3TEHA 3G48A 1EOVA 4AH6A 4LF8Q 4HJ9A 3PUVA 2J3LA 3EIVA 2I4MA 3A5UA 4GLAC 2Q2IA 1GM5A 5M5WH 2OQKA 4KHZA 2VS1A 2ZR2A 4UP7A 4DV6Q 2E64A 3KJPA 1I5FA 2YTXA 5H1SE 3NENA 2UU9L 1LTLA 3JC66 4HJAA 1VCIA 5DLQE 2IX1A 2UXDQ 2CIMA 3S1QH 2V1CC 2JJQA 5IYCG 1Z9FA 2IT1A 1CKMA 1YB3A 3V7SA 1XTDA 2UUAQ 3UDXA 1D7QA 3LSQA 4YRSA 1KRTA 1HC7A 3CCSA 4XTWA 4CH3A 2C7IA 3AQQA 1RIQA 2ZR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A 5;  2JEA I;  1WPY A;  2NVT H;  3K8A A;  3QO7 A;  3GTK H;  4A3B G;  4JI5 L;  4YRI A;  3I4N H;  2EJG A;  4DR1 Q;  2E5L Q;  3S1R H;  4HJ5 A;  4A3B H;  1XNR Q;  4BBS G;  3CCV A;  1XJV A;  3ERS X;  4BBS H;  3QNE A;  4LNQ A;  4YHH Q;  2R7D A;  1N36 L;  4TTV A;  2R7Z G;  1PH2 A;  4JI2 L;  2CJ9 A;  1WYD A;  2I0Q A;  2HHH Q;  3DSQ A;  2MO1 A;  1S72 A;  2R7Z H;  1XNQ L;  3S15 H;  1E1O A;  3RN2 A;  4L5S A;  1J5E Q;  3NET A;  1X56 A;  1HNZ Q;  2LSS A;  4YP0 A;  4HWR A;  4YCU A;  3A0J A;  4ZTZ B;  4DV1 L;  3HOX G;  4HIK A;  4LF6 Q;  4FDB A;  3CCQ A;  3CCE A;  5FLM H;  4JI6 Q;  4BY1 H;  1G5I A;  2DQ3 A;  1UEB A;  3KJO A;  1X3G A;  3KF6 A;  4RQF A;  2XGT A;  3PUZ A;  4DKA C;  3IG2 A;  4EX5 A;  1XPO A;  2F4V L;  4H2X A;  4DV3 L;  4JBK A;  3PCO B;  3H3V H;  3FP9 A;  1FJG Q;  3CCM A;  3U4V A;  4A3F G;  3PF4 A;  1CSQ A;  2DXU A;  3M4O H;  1MKH A;  3TS0 A;  1YI2 A;  4A3F H;  2FYK A;  5LMU L;  1VQ9 A;  1YFR A;  3I2Z A;  1QF6 A;  1KRS A;  1BBW A;  2G4C A;  1VQ7 A;  1WCM G;  2CWA A;  1U5K A;  1H4V B;  3ULJ A;  1PA6 A;  1X6O A;  3I4M G;  2ZNI A;  4XEM A;  3H0G G;  4BY7 H;  2BA1 A;  3J7Z C;  2R93 G;  4J15 A;  5BR8 L;  2ARU A;  4B3S L;  3H0G H;  3S1M H;  3NBH B;  1IZ6 A;  3CPF A;  3I7F A;  2PI2 E;  2I5H A;  2Q7G A;  4DV2 L;  4OWW B;  3RL6 A;  2IHE A;  1E24 A;  2E2I H;  3P8Y A;  1EVL A;  4DV0 Q;  4NXM L;  4NB3 A;  4P74 C;  1Q7Y C;  2PQA B;  2C35 B;  5E7N A;  2JA6 H;  3PIP A;  2UXB L;  4P3N A;  2AWO A;  1QZH A;  2AWN A;  3GTQ H;  1C9O A;  2MFI A;  4EO4 A;  2JA7 G;  1IL2 A;  3A5Y A;  2A19 A;  1QE0 A;  1EQR A;  4A3L G;  1M90 C;  3KDF A;  1YBY A;  2CJA A;  5E3I A;  2UUC Q;  1YJW A;  4JI1 L;  5IP7 G;  2I5L X;  1V1Q A;  4XTU A;  2N8N A;  4X64 Q;  5M3M G;  5K1X A;  1YJ9 A;  2DKG A;  4PZ7 A;  3VQV A;  1WOC A;  1XPU A;  1IBK Q;  4OP0 A;  1SET A;  1TXY A;  3V8K A;  5LMN Q;  3L1A A;  1XMQ L;  1YHB A;  2YYZ A;  4LFC Q;  4NXN Q;  4JYA L;  3G6E A;  4HVC A;  4JI8 Q;  1XMO L;  3M4P A;  4POF A;  3J80 i;  2ZZE A;  3JAM c;  4OWT B;  3RKW A;  2GVB A;  1N33 L;  4YRF A;  1PYB A;  4HIO A;  3SGI A;  2KEN A;  3HKZ E;  2DVE A;  4TVA B;  2Q7H A;  2NZO A;  4H2S A;  2UUB Q;  4X6A H;  3RAC A;  3ERR A;  5C3E H;  4BW9 A;  4YRE A;  4HWP A;  1YIJ A;  1KD1 C;  1MJE A;  4LFB Q;  4XU1 A;  2R7F A;  2P5I A;  4HID A;  1W66 A;  3V8J A;  1B7Y A;  1QVG A;  4A3C G;  4CH6 A;  1NTG A;  4A3C H;  1HJP A;  4P75 C;  1EIY B;  2HIV A;  1PH9 A;  4X62 Q;  2RF4 A;  2N3S A;  2MO0 A;  3Q8D A;  3CPW A;  4KR3 A;  1HR0 L;  4EQ5 A;  1JE5 A;  4XTY A;  5C44 H;  2DQ0 A;  2PMZ E;  4DR5 Q;  2ZCE A;  1AH9 A;  2P0L A;  1QUQ B;  2UXC L;  4DR3 Q;  4Q15 A;  1KQS A;  1N9W A;  4A75 A;  4K0K Q;  1H4T A;  3AEV A;  4YWL A;  4X66 L;  2WAQ E;  1Y1W G;  3EBE A;  2JEB I;  3DLL A;  2B63 G;  1Q81 C;  2NVY H;  4JBJ A;  1N34 L;  3MEY A;  1VQ6 A;  3LSS A;  5GAG C;  3HRK A;  5IWA Q;  5GQO A;  2K75 A;  4DUZ Q;  3HOU G;  4RQE A;  4YRR A;  1X3E A;  3GTL H;  2DTO A;  1E22 A;  2ODR D;  2PI2 A;  3J81 i;  3HOW H;  1VQB A;  4R1J A;  1NY4 A;  3HFZ A;  3WQZ A;  3REX A;  4LWC A;  1X2H A;  2UU9 Q;  1ATI A;  3HOV G;  2K52 A;  3ICA A;  2RHQ B;  4LF9 L;  3RLO A;  4IOA A;  2QHV A;  2OWO A;  1VQ4 A;  2MNA A;  3IKL A;  4AYB E;  2QEX A;  5M3F G;  1HNX L;  4YRP A;  4O2D A;  2RHS A;  1VQJ A;  4X5O A;  3OD1 A;  3HOY H;  3KF8 B;  1K3R A;  4CH5 A;  4TVY A;  3WWV A;  1VQL A;  3RKX A;  3VQY A;  1PH5 A;  5JJL A;  5AJ3 L;  2YTY A;  1PH3 A;  4DK3 C;  4BA1 I;  5IY0 A;  4JBM A;  4LF5 L;  2DU5 A;  4A3K H;  3OTO L;  3A7U A;  2HQL A;  4POG A;  1VQG A;  3HKS A;  1FGU A;  3U58 A;  2JQO A;  4DR4 Q;  2LXJ A;  4GN3 B;  2WB1 G;  4A4I A;  1NJ5 A;  3IAL A;  4QY7 A;  1GGM A;  4JG2 A;  1Q82 C;  3PO2 H;  4K86 A;  4GOP C;  3BZK A;  1X55 A;  3IKM B;  3PZC A;  2K4K A;  4JI2 Q;  2VW9 A;  4YRL A;  1CSP A;  4KHP L;  4R4I A;  3HOZ G;  4GS3 A;  1SR3 A;  3KOJ A;  1HNW L;  4DUY L;  3AFP A;  1E7Z A;  3CC4 A;  1RL2 A;  4QL5 A;  3HOZ H;  1U0L A;  1VQC A;  3STB C;  1E3P A;  1FVI A;  3TS2 A;  1UWV A;  3H15 A;  3PUY A;  3I55 A;  3S2D H;  2KCT A;  3ULL A;  4JI4 Q;  1PYS A;  4DV7 L;  2DEQ A;  4DV5 L;  1Q1B A;  1EVK A;  2ZM6 L;  5J3B A;  1X9N A;  1H95 A;  3AYH B;  2JA8 H;  3RR5 A;  2F4V Q;  4P74 A;  1A0I A;  1GD7 A;  5IYB H;  3S24 A;  1WU7 A;  2ZTD A;  3TEH B;  4XTX A;  5C4J H;  4MZ9 A;  4JI7 Q;  3RLN A;  3VQX A;  4OON A;  1VQK A;  3HFV A;  4R4T A;  4GLV B;  4XU3 A;  4YRT A;  1HTT A;  1AE3 A;  5LMU Q;  2I4L A;  1PH4 A;  12AS A;  4LUV A;  1OTC A;  3VDY A;  1Q1E A;  1L0W A;  1IXR A;  3I4N G;  2D62 A;  1JJC A;  1PH6 A;  1I94 Q;  1I6H H;  4GNX A;  1JB7 A;  5C0X G;  2JA5 G;  2GVA A;  1MJC A;  3V7R A;  4OX9 Q;  1LYL A;  1BIA A;  4B3S Q;  4B3T Q;  2JA5 H;  3L2P A;  2OTL A;  1EUJ A;  1I3Q H;  4DR7 L;  1WQ7 A;  3K80 C;  2ZNJ A;  5C4X H;  4TVW A;  4JBW A;  2N78 A;  3CCR A;  1Q8K A;  3S17 H;  4YRK A;  2AMC A;  1EIF A;  3BZC A;  1WQW A;  2UXB Q;  3L2Z A;  4DQ2 A;  3BFM A;  1JJC B;  4HJ8 A;  3FHW A;  3RN5 A;  5FLM G;  3RZO H;  4B3R L;  4BY1 G;  2NN6 G;  3M9B A;  3LC0 A;  2ES2 A;  4B3M L;  3TRZ A;  3M3Y H;  4H2Y A;  1IBL L;  5JJK A;  4KQE A;  4JI1 Q;  1IYJ B;  4LF8 L;  1SRU A;  3CD6 A;  1VQN A;  2CJB A;  4UP9 A;  4MNO A;  1WI5 A;  4YRQ A;  3GDE A;  4YRO A;  1N32 Q;  4TWA A;  1USY C;  1G29 1;  4WJ4 A;  4P75 A;  3E9I A;  1Q12 A;  4A3G H;  1XMQ Q;  4LF7 L;  4P72 C;  2GN5 A;  3RNU A;  1VQM A;  1XPR A;  4YRM A;  1UE5 A;  2UXD L;  1VQP A;  4H2T A;  3UE0 A;  1X3F A;  2FXQ A;  1IBM L;  1AE2 A;  2A8V A;  1YNX A;  2Q5I A;  3K81 C;  4A76 A;  3KF6 B;  3U50 C;  3NEM A;  4BY7 G;  4WJ3 M;  1TWH H;  4HIM A;  2UUA L;  4YCW A;  4PZ6 A;  4JC0 A;  2D0O A;  4X65 L;  1YJN A;  1VQ8 A;  4NCX A;  2VQE L;  1NJI C;  4H2X B;  2ZT8 A;  4MTN A;  1CKN A;  2IY5 A;  1Y1V H;  3E9H A;  1S3O A;  3TUP A;  4K88 A;  4IJL A;  1YHQ A;  2JA6 G;  5IE8 A;  4YPF A;  2ZIN A;  4TQD A;  4IPC A;  4P73 C;  1HXD A;  1Z47 A;  2E5L L;  1L1O A;  4RG1 A;  4GKJ Q;  1XNR L;  4Q6G A;  2CFM A;  5C0X I;  5C53 B;  4XU0 A;  4YHH L;  2F3I A;  4JI3 Q;  4A3J H;  4HWO A;  2DU7 A;  2E10 A;  3TQY A;  2VUM H;  3RF1 A;  1SES A;  4X66 Q;  2ZXF A;  1J5E L;  3R07 A;  4PHC A;  1SMX A;  4GNX C;  4IOC A;  2EJ9 A;  1J6Q A;  2ZT7 A;  1YIT A;  2HNI A;  1PFS A;  3K7U C;  1D8L A;  4Y7N H;  4QQB X;  2Z6K C;  1K73 C;  1GO3 E;  1C0A A;  4H2W A;  2NN6 I;  4YCV A;  3U4Z A;  4CS4 A;  2KHI A;  3HTZ A;  2KCM A;  3W5O A;  3A5Z A;  4IO9 A;  3K0X A;  2DXT A;  4P3P A;  4ALP A;  2JK8 A;  3KDF B;  1DGS A;  3A74 A;  1Z7M A;  2RCN A;  5C3E G;  4P3O A;  2ALY A;  3RGL A;  4ZIB A;  4XTV A;  3T1Y Q;  1ADY A;  1H4Q A;  1S40 A;  1A8V A;  1W3S A;  3H3V I;  1JJ2 A;  3HY0 A;  5GAE C;  3CF5 A;  2VQF L;  4GOP A;  2KBN A;  3STB D;  4R4O A;  1B8A A;  4YY3 L;  4LF9 Q;  3GO5 A;  1C7Y A;  1G51 A;  1P16 A;  2DUD A;  4OLF A;  1NYQ A;  2K5N A;  4JV5 Q;  2DZ9 A;  1KMM A;  1G5H A;  1KXL A;  4UY8 C;  1PHJ A;  4BBR G;  1JJG A;  3UGQ A;  1JMC A;  4C2M H;  3EFS A;  2ART A;  3QTC A;  2EWN A;  5AJ3 Q;  4BBR H;  3M85 A;  1R9T H;  1YEZ A;  5C44 G;  3PGZ A;  4ZTU B;  2E8G A;  1K8A C;  3PUX A;  2EJF A;  3OTO Q;  4DR2 Q;  3GD7 A;  4DV0 L;  2CQO A;  1N8R C;  3UE1 A;  4OXP A;  3MXN B;  2KHJ A;  2ID0 A;  3HKZ G;  4A3E G;  5JJI A;  1KOG A;  1B7Y B;  4DV4 Q;  2BH2 A;  2B3G A;  5LMN W;  4BA2 I;  3CC7 A;  3TRE A;  4JI0 L;  2XTI A;  2J3M A;  5FJ8 H;  4C3H H;  3J80 c;  4A3E H;  3S14 H;  5IYD H;  1B70 A;  3GTO H;  3GTM H;  3S1N H;  3J81 j;  1PH8 A;  4KHP Q;  3CMA A;  1TWG H;  2UUC L;  1VQE A;  4DNI A;  2HT1 A;  3HOW G;  1SRY A;  4LF4 L;  4X64 L;  4UP8 A;  1RIP A;  2ZTC A;  1HZB A;  1L1O C;  4GN4 B;  4KLK A;  1LM0 A;  4JOI C;  2QGQ A;  3S16 H;  4A93 H;  4WF2 A;  5KNN A;  2NZH A;  2VNU D;  1SER A;  4CS3 A;  1O7I A;  3CCJ A;  4YYE A;  3V8L A;  1W2B A;  1FL0 A;  3D31 A;  3ZJY C;  5IT9 c;  1VQI A;  2WP8 J;  2Y0S E;  2WAQ G;  3HOY G;  2JA9 A;  5GAD C;  3GTG H;  1NE3 A;  4A3I H;  1HZA A;  3HXY A;  3HFZ B;  3EFR A;  4A3K G;  2H5X A;  4GLX A;  2NVQ H;  3FKI H;  2OQ0 A;  4XEO A;  4DR6 L;  3E0E A;  4JI5 Q;  3L7Z C;  3W1G A;  3RKY A;  4H02 A;  1SFO H;  4YWM A;  2DDZ A;  3P8T A;  1USY A;  3PO2 G;  4JCV E;  3HXV A;  2RHS B;  4G85 A;  4BXX H;  1PV4 A;  3HXZ A;  4TQU S;  3S2H H;  4P72 A;  4APV A;  3J81 c;  2ZTE A;  1N36 Q;  1K8G A;  2I5M X;  3G1Z A;  1BKB A;  3PO3 H;  1Q46 A;  4K0K L;  4AQY L;  2A1A A;  2K14 A;  1YFS A;  3CQZ H;  1PVO A;  2Q2T A;  4IFD J;  1XNQ Q;  4AYB G;  3W3S A;  1BBU A;  4DV1 Q;  1NYR A;  2AKW A;  4HA8 A;  2CKZ B;  3UDG A;  4ME3 A;  2E2J H;  4B3M Q;  4OO1 G;  2DJZ A;  3KFU A;  3F2B A;  2EIF A;  2E41 A;  4P71 C;  1M1K C;  4PG3 A;  2JA8 G;  4DK6 C;  4DUZ L;  4H2V A;  1L2F A;  4LNS A;  1SRO A;  3RIR A;  4A3D H;  5IYB G;  1ASY A;  3OW2 A;  2EXD A;  3ER0 A;  4P73 A;  4DV3 Q;  2WFW A;  3T1H L;  1LUZ A;  4IPD A;  4E51 A;  4LF7 Q;  2PME A;  2E2H H;  3PSI A;  2AKW B;  3DM3 A;  4TQF A;  1NJ8 A;  2E5A A;  1YVC A;  1VQZ A;  1IBM Q;  1PYS B;  2I4N A;  5GRO A;  4YDQ A;  5IYC H;  4YRN A;  4LUO A;  4KI0 A;  2PNH A;  2ZGW A;  4QJF A;  3AFQ A;  4X65 Q;  1YGB A;  2ARS A;  1VS0 A;  1K9M C;  2VQE Q;  1QVF A;  1CKO A;  1P8L A;  5BR8 Q;  3GTP H;  3VQW A;  1VQA A;  1UE6 A;  1X2G A;  2OCE A;  1KC8 C;  2B29 A;  3F2C A;  2Z6K A;  4XTZ A;  5M5Y H;  5C52 B;  5C4X G;  1TWC H;  1HZC A;  4DV2 Q;  2QHT A;  3CMQ A;  4NXM Q;  4DAM A;  1ADJ A;  5K36 G;  4DR4 L;  3W1B A;  1Y14 B;  2ODR C;  4GNX B;  4GKK L;  5EAY A;  4YRG A;  4IJH A;  2Q7E A;  1ASZ A;  2K50 A;  1VQO A;  4LFA L;  1K83 H;  4XIG S;  1VQH A;  4A3M G;  1VQD A;  2E65 A;  3CME A;  3D0F A;  2VY3 A;  2VL6 A;  1UE1 A;  4XTC S;  4C3I H;  4A3M H;  2YU9 H;  4L87 A;  2F52 A;  3PCO A;  1QVC A;  1BVS A;  1WLE A;  3CW2 C;  3NEL A;  1GVP A;  3M7N A;  1V43 A;  3ULP A;  1E1T A;  2AMC B;  4A3G G;  2ZJR A;  1I50 H;  2D0P A;  2Q2U A;  4Y52 H;  3HOX H;  2R6G A;  3CAM A;  4DV6 L;  1HZ9 A;  4JI4 L;  2L15 A;  4NPS A;  2QHS A;  1HH2 P;  1UE7 A;  4JYA Q;  1X01 A;  1XMO Q;  4OO1 I;  2MQH A;  1N33 Q;  5FLX c;  4IPG A;  1NJ6 A;  2BA0 A;  4JI7 L;  2OTJ A;  3UDF A;  4C3J H;  4DPG A;  2VQF Q;  2C8M A;  1Y1V G;  2QHU A;  3MEF A;  4YY3 Q;  2CGH A;  1NNH A;  2PQA A;  1KHI A;  3HRI A;  1OXS C;  1BIB A;  4CS2 A;  3I56 A;  3L4G A;  4L5T A;  1WCM H;  2PMF A;  1I94 L;  2I4O A;  1TWA H;  3VBB A;  4DR1 L;  5JEA J;  2VZA A;  4OX9 L;  3I4M H;  2K5H A;  4JOI A;  4B3T L;  3F1Z A;  3UH0 A;  2ASB A;  2R93 H;  3OYY A;  1H4S A;  4YRJ A;  3JAM i;  3REU A;  1WNL A;  4A3J G;  3A7A A;  3ICE A;  2VUM G;  1HR0 Q;  3I4O A;  1KL9 A;  3V7C A;  1CKN B;  2ZJQ A;  2UXC Q;  2IY5 B;  1NMF A;  2HHH L;  2YTV A;  2Z0S A;  3G71 A;  3L4G B;  3F2D A;  4JI0 Q;  1G6P A;  2EL9 A;  1HNZ L;  3KLW A;  1N34 Q;  2E1H A;  1SE8 A;  2ZT5 A;  1L1O B;  4LF6 L;  2Q5H A;  3A31 A;  4JI6 L;  2EAY A;  1TWF H;  4CH4 A;  2JA7 H;  3GTJ H;  3UDI A;  5HGQ A;  1FYF A;  5M5X H;  1NJ1 A;  3F8T A;  2AHO B;  2DTI A;  4TVA A;  4A3L H;  2Q2H A;  4LF4 Q;  1SN8 A;  3IRB A;  5K1P A;  3BJU A;  4IFD G;  5IP7 H;  1N32 L;  3MF2 A;  5M3M H;  2BH8 A;  1FJG L;  4H2U A;  4RDX A;  1NBW A;  3CCU A;  3HY1 A;  5ELO A;  3UFG A;  1PH7 A;  1OXU A;  1WFQ A;  1EFW A;  4QIW E;  5GAH C;  5C0X J;  5IP9 G;  1EIY A;  2E3C A;  2EQS A;  2DGY A;  1J5W A;  5IP9 H;  1K0R A;  1HNX Q;  1HR0 W;  3A5Z B;  3RZD H;  2IHF A;  1VQ5 A;  2ZZF A;  1A63 A;  1QUQ A;  2ALY B;  1X54 A;  3RUX A;  2ATW A;  3P8V A;  3FJP A;  4K87 A;  4LF5 Q;  1KAW A;  3BU2 A;  5ELN A;  4P71 A;  1CUK A;  4LW1 A;  4DR6 Q;  1JT8 A;  4PZ8 A;  4R4Q A;  3A32 A;  4GOP B;  1KMN A;  4RMF A;  4YWK A;  2NVX H;  11AS A;  1X65 A;  4GKJ L;  5FJ8 G;  1Z7N A;  3CP0 A;  3PV0 A;  4KR2 A;  4PMW A;  4DAY B;  4BWA A;  5IYD G;  5C51 B;  4JI3 L;  2ZIO A;  1OXV A;  2JE6 I;  3LGJ A;  1GKH A;  3MF1 A;  2HIX A;  4AQY Q;  2ZIM A;  2ZT6 A;  1MIU A;  1A62 A;  1V9P A;  1HNW Q;  4DUY Q;  1Q86 C;  3KYH C;  1T9H A;  1Y1W H;  1VQF A;  4L5R C;  4A93 G;  2B63 H;  5F5W A;  1PH1 A;  2ZZG A;  1EYG A;  1IBK L;  2RHQ A;  3HXX A;  3G4S A;  3RLF A;  3PIO A;  5LMN L;  3L0O A;  2LXK A;  4HWS A;  3UGT A;  4DV7 Q;  3TEG A;  4LFC L;  4NXN L;  4DV5 Q;  3CXC A;  4JI8 L;  1B70 B;  2DZC A;  1WJJ A;  2ZM6 Q;  4IPH A;  3HOU H;  3A7R A;  3M4Q A;  2IX0 A;  2WB1 E;  3PUW A;  3T1H Q;  4HJ7 A;  2ZJP A;  3T1Y L;  4AIM A;  2UUB L;  4QGU A;  4A3I G;  4IFD I;  5HY6 A;  3HXU A;  4OWX B;  4LFB L;  2K5V A;  3FKI G;  1YZ6 A;  3HOV H;  4HWT A;  2ZTG A;  2R92 G;  4JV5 L;  3QO8 A;  4LUZ A;  4YRC A;  3CCL A;  4UPA A;  2R92 H;  1EQQ A;  5M3F H;  4GN5 A;  3QO5 A;  4BXX G;  1B76 A;  1OXX K;  4X62 L;  1QZG A;  4DR2 L;  2CWP A;  3EN2 A;  3PO3 G;  4DR7 Q;  4DR5 L;  1NMG A;  1EWI A;  2DTH A;  3K7A H;  3PF5 A;  1NJ2 A;  3B6Y A;  4DR3 L;  1KIX A;  2YV5 A;  1YHA A;  4XU2 A;  4O0A A;  2Y0S G;  4DV4 L;  2CCZ A;  4WI1 A;  4GKK Q;  5JEA G;  1YFT A;  2N49 A;  4B3R Q;  4LFA Q;  4L5Q A;  4G84 A;  3CC2 A;  1SLJ A;  3HXW A;  2QA4 A;  1IBL Q;  5IWA L;  4R4C A;  1OXT A;  4A3D G;  3TEH A;  3G48 A;  1EOV A;  4AH6 A;  4LF8 Q;  4HJ9 A;  3PUV A;  2J3L A;  3EIV A;  2I4M A;  3A5U A;  4GLA C;  2Q2I A;  1GM5 A;  5M5W H;  2OQK A;  4KHZ A;  2VS1 A;  2ZR2 A;  4UP7 A;  4DV6 Q;  2E64 A;  3KJP A;  1I5F A;  2YTX A;  5H1S E;  3NEN A;  2UU9 L;  1LTL A;  3JC6 6;  4HJA A;  1VCI A;  5DLQ E;  2IX1 A;  2UXD Q;  2CIM A;  3S1Q H;  2V1C C;  2JJQ A;  5IYC G;  1Z9F A;  2IT1 A;  1CKM A;  1YB3 A;  3V7S A;  1XTD A;  2UUA Q;  3UDX A;  1D7Q A;  3LSQ A;  4YRS A;  1KRT A;  1HC7 A;  3CCS A;  4XTW A;  4CH3 A;  2C7I A;  3AQQ A;  1RIQ A;  2ZR3 A; 
#chains in the Genus database with same CATH topology
 2K1B A;  1X32 A;  3J7A 5;  2JEA I;  1WPY A;  2NVT H;  3K8A A;  3QO7 A;  3GTK H;  4A3B G;  4JI5 L;  4YRI A;  2D5D A;  3I4N H;  2EJG A;  4DR1 Q;  5C6A A;  2E5L Q;  3S1R H;  4HJ5 A;  1WTX A;  5C0X H;  4KTA A;  4A3B H;  1JE4 A;  2E76 C;  3TZU A;  1XNR Q;  4LVL A;  4BBS G;  1I4G A;  3V96 A;  2CH4 A;  3CKI B;  5DEH A;  3CCV A;  3FKI B;  2A6H D;  4MIU A;  1XJV A;  3A7L A;  1Z7T A;  3ERS X;  4HN7 A;  4BBS H;  2R92 B;  1S5B D;  3QNE A;  4HAE A;  4YHH Q;  4LNQ A;  2R7D A;  1N36 L;  4TTV A;  4LK1 C;  1F9S A;  2R7Z G;  1SFO B;  1QG7 A;  4MHE A;  4C3I G;  1PH2 A;  2RSN A;  4JI2 L;  2CJ9 A;  1WYD A;  2I0Q A;  2HHH Q;  3DSQ A;  2MO1 A;  2K01 A;  1PMR A;  4QMG A;  1S72 A;  2R7Z H;  1XNQ L;  4CJ0 B;  3S15 H;  1E1O A;  3RN2 A;  4L5S A;  1J5E Q;  3NET A;  1CHP D;  2NBF A;  1X56 A;  1C48 A;  1HNZ Q;  2LSS A;  4YP0 A;  4HWR A;  4YCU A;  3A0J A;  4K6L A;  4ZTZ B;  1CZG A;  4DV1 L;  1AW7 A;  2G9H D;  3HOX G;  4HIK A;  2EY5 A;  3PO3 B;  2AUJ D;  4LF6 Q;  4WJW A;  5EJW A;  4FDB A;  3CCQ A;  2B2U A;  3BDC A;  3CCE A;  1PRT F;  3KUP A;  5FLM H;  4JI6 Q;  3C3L A;  3CQZ B;  1E2W A;  2DJG C;  2SDF A;  3NWT A;  4XQJ A;  4BY1 H;  1G5I A;  2NN6 H;  2DQ3 A;  1UEB A;  1WTW A;  1EQT A;  5EBD A;  3KJO A;  1EZ8 A;  1EOT A;  1X3G A;  3KF6 A;  3BDL A;  3P75 A;  2Y0S B;  3A8I E;  2R61 A;  3K6O A;  4OEM B;  4RQF A;  4RCO A;  5IGG A;  2XGT A;  3K5N A;  4ID6 A;  1DON A;  1TKW B;  4K2L A;  3PUZ A;  4DKA C;  2KED A;  3IG2 A;  4EX5 A;  5FKA C;  1XPO A;  2F4V L;  1JQY D;  2A73 B;  4H2X A;  4DV3 L;  4JBK A;  3PCO B;  3H3V H;  3FP9 A;  3MTS A;  1FJG Q;  3CCM A;  4KMU C;  3U4V A;  4A3F G;  3PF4 A;  1CSQ A;  2DXU A;  4C3J G;  3NUC A;  3M4O H;  1MKH A;  3TS0 A;  1YI2 A;  4IUR A;  5IOC A;  4A3D B;  2K5Q A;  1FNW A;  1JCK B;  4L6T B;  4A3F H;  1EEI D;  2FYK A;  5LMU L;  1VQ9 A;  3NWS A;  1JWU D;  1YFR A;  3CU7 A;  3I2Z A;  3VR2 A;  1QF6 A;  1KRS A;  1BBW A;  2G4C A;  1VQ7 A;  1WCM G;  2CWA A;  1U5K A;  1H4V B;  3T16 A;  3ULJ A;  2L12 A;  1SBB B;  1PA6 A;  2E2H B;  1X6O A;  3I4M G;  2ZNI A;  5CBA E;  3OPO A;  4U67 3;  4XEM A;  3S1Q B;  3H0G G;  5I9O A;  4BY7 H;  4PQX A;  2BA1 A;  3J7Z C;  2R93 G;  4J15 A;  5BR8 L;  1D5X C;  2ARU A;  5JPM C;  1WTH A;  4B3S L;  3H0G H;  3S1M H;  2NWG A;  1JOQ A;  3NBH B;  1IZ6 A;  5A2Q E;  4EVO A;  3CPF A;  3I7F A;  2H1E A;  2PI2 E;  4B9W A;  2I5H A;  2Q7G A;  5FLX L;  4DV2 L;  4OWW B;  3RL6 A;  2M00 A;  2IHE A;  1E24 A;  2E2I H;  3P8Y A;  1IHZ A;  1EVL A;  4DV0 Q;  2IPK D;  3MHB A;  4NXM L;  4NB3 A;  4P74 C;  1YNN C;  1Q7Y C;  3GTP B;  2PQA B;  5F2D A;  2C35 B;  5E7N A;  1JWS D;  1D6E C;  1JOK A;  1DOK A;  2JA6 H;  1HQM C;  4UDU C;  3PIP A;  2UXB L;  5M5Y B;  1TWC B;  3C2P A;  4P3N A;  2AWO A;  1QZH A;  2AWN A;  3GTK B;  4IN3 A;  3HP3 A;  5LHY 1;  1IW7 C;  2SOB A;  3GTQ H;  1FNV A;  3OHX C;  2IW3 A;  1C9O A;  2MFI A;  4EO4 A;  4YIJ A;  1IL2 A;  2JA7 G;  1DZ1 A;  3A5Y A;  2A19 A;  4DF7 A;  1QE0 A;  2WV6 D;  1ET9 A;  4A3B B;  1D1I A;  2KHS A;  4HCS A;  1EQR A;  1UEA B;  4A3L G;  2HD3 A;  1M90 C;  1SNC A;  2DJF C;  3KDF A;  4WFN 3;  1YBY A;  3I3C A;  1PLF A;  2CJA A;  5E3I A;  3A7A B;  1H9J A;  1K8M A;  4KD3 A;  5CV6 A;  1YJW A;  2UUC Q;  4JI1 L;  1ET6 A;  4BBS B;  5CMD A;  5IP7 G;  3A55 A;  2I5L X;  1V1Q A;  2XVS A;  2N8N A;  5CV9 A;  4XTU A;  1HTP A;  4X64 Q;  1OO9 B;  5M3M G;  5K1X A;  1D5M C;  1I4R A;  1YJ9 A;  3TSS A;  1MBY A;  2DKG A;  4PZ7 A;  3VQV A;  4X3U A;  2R7Z B;  1LV9 A;  4JK1 C;  1WOC A;  1XPU A;  1IBK Q;  4OP0 A;  4C3I B;  2YU9 B;  2OXP A;  1SET A;  1TXY A;  3V8K A;  5LMN Q;  4KKS A;  3L1A A;  1XMQ L;  1YHB A;  1B53 A;  2YYZ A;  4M8A A;  5KEE A;  1VMP A;  4LFC Q;  4NXN Q;  4JYA L;  3G6E A;  1A3V A;  2A6E D;  4HVC A;  5FOB B;  4JI8 Q;  3SHL A;  1XMO L;  3Q24 A;  3M4P A;  4POF A;  1RD9 D;  3J80 i;  2ZZE A;  1I50 B;  1JC7 A;  2L9H A;  3NQT A;  3JAM c;  4OWT B;  3RKW A;  2GVB A;  3H94 A;  3HOX B;  1N33 L;  2RDH A;  4YRF A;  1PYB A;  4HIO A;  3SGI A;  2KEN A;  2AUK A;  3BYT B;  1PFB A;  3HKZ E;  2DVE A;  3G7L A;  4TVA B;  2Q7H A;  2NZO A;  5E4W C;  3IFT A;  3KLS X;  4H2S A;  2UUB Q;  4X6A H;  3T56 B;  3RAC A;  3ERR A;  5C3E H;  4ILW A;  2IWH A;  1QJO A;  3FRP B;  4BW9 A;  4YRE A;  4HWP A;  2B2U C;  1AN8 A;  1YIJ A;  1F2Y A;  1B9N A;  3NK9 A;  1KD1 C;  4N8X 1;  3M7G A;  1MJE A;  4L63 B;  4NMZ A;  4LFB Q;  4XU1 A;  2R7F A;  3MXN A;  1FR3 A;  2P5I A;  4HID A;  3A8K E;  3QG1 A;  1W66 A;  3V8J A;  1ENF A;  2A5H A;  2DY8 A;  1HA6 A;  1L0X B;  1B7Y A;  1DOL A;  1AEX A;  1QVG A;  4A3C G;  4DN4 M;  1UAP A;  1F77 A;  3ERO A;  3K59 A;  4A3F B;  4C3J B;  3DEO A;  4CH6 A;  1NTG A;  4A3C H;  1HJP A;  4P75 C;  1RDP D;  2PZU A;  1EIY B;  3W2D A;  4R9W A;  2HIV A;  1PH9 A;  1S5E D;  4I7A A;  1ILQ A;  4X62 Q;  2RF4 A;  2N3S A;  2MO0 A;  4NDX A;  1WCM B;  3Q8D A;  3CPW A;  4KR3 A;  2X6L A;  1MD2 D;  1TWA B;  2A68 D;  1HR0 L;  1B3A A;  1AZQ A;  5LL6 S;  4EQ5 A;  1JE5 A;  4DAP A;  4XTY A;  4TSS A;  5C44 H;  2DQ0 A;  2PMZ E;  2I07 B;  4DR5 Q;  3I73 A;  3PIO 3;  2ZCE A;  1AH9 A;  2P0L A;  3I4M B;  1QUQ B;  2UXC L;  1QNU A;  1B4O A;  1F9Q A;  4DR3 Q;  3H0G B;  4Q15 A;  1KQS A;  3D4R A;  1N9W A;  4A75 A;  4K0K Q;  1M4V A;  1H4T A;  2R93 B;  1SYD A;  4EGV A;  4YWL A;  3AEV A;  4X66 L;  2WAQ E;  1Y1W G;  1SMY D;  2KA7 A;  3H09 A;  3EBE A;  3OWE B;  2JEB I;  4RHR A;  2CH4 W;  3DLL A;  2E2I B;  2B63 G;  1Q81 C;  2BDN A;  2NVY H;  4JBJ A;  1N34 L;  5I6Y A;  3MEY A;  1EYA A;  2AQ3 B;  2HCC A;  2WKC A;  1VQ6 A;  4IUT A;  3LSS A;  2J4X A;  2PO4 A;  1RTN A;  5GAG C;  1IL8 A;  2KVM A;  4F8M A;  3HRK A;  5KND A;  1IKM A;  3K0Y A;  5IWA Q;  5GQO A;  2ZT9 C;  2K75 A;  2F0L A;  3SK5 A;  4DUZ Q;  3HOU G;  4RQE A;  1LTR D;  4YRR A;  1NSN S;  3QB3 A;  1X3E A;  3GTL H;  2DTO A;  4CKE A;  1E22 A;  4OIJ A;  1LAC A;  1GOZ A;  4OEL B;  2ODR D;  2PI2 A;  3OSO A;  4KY7 A;  3J81 i;  1EWC A;  3MQZ A;  3HOW H;  1TWF B;  4ZLT F;  3GTJ B;  1VQB A;  4R1J A;  1NY4 A;  5M5X B;  3HFZ A;  3WQZ A;  3I4L A;  5KRU A;  3J80 E;  4J6H A;  4TKO B;  2K5D A;  4LVM A;  3REX A;  2EY2 A;  4LWC A;  3TDQ A;  1X2H A;  4HSV A;  3EA6 A;  3DM1 A;  2UU9 Q;  1ATI A;  5JAV A;  3HOV G;  4YPF A;  2K03 A;  4ZKB B;  2JP1 A;  1DXM A;  1O7Y A;  5CBE E;  5M3M B;  2K52 A;  3ICA A;  2RHQ B;  4LF9 L;  3RLO A;  3MXG A;  4IOA A;  4RFB A;  2QHV A;  3AB9 A;  2OWO A;  1VQ4 A;  2F03 A;  2MNA A;  3IKL A;  4AYB E;  1R4P B;  2QEX A;  5M3F G;  1HNX L;  4YRP A;  4O2D A;  3MXP A;  2RHS A;  1VQJ A;  2F0T A;  4X5O A;  3OD1 A;  5IGB A;  3HOY H;  3GV6 A;  3KF8 B;  1WTR A;  1K3R A;  4CH5 A;  4TVY A;  1EYD A;  3WWV A;  3I91 A;  2PW7 A;  1VQL A;  3RKX A;  3VQY A;  1LTS D;  1I4Q A;  4DU9 A;  1PH5 A;  5JJL A;  5AJ3 L;  1BCP D;  3CRL C;  2YTY A;  1PH3 A;  4DK3 C;  2O5J C;  4BA1 I;  2RBM A;  2XIW A;  2EJM A;  5IY0 A;  4JBM A;  1PFM A;  3GP7 A;  4LF5 L;  2DU5 A;  4A3K H;  3BDO A;  3OTO L;  3A7U A;  2HQL A;  4POG A;  1TQO A;  1VQG A;  3K5M A;  4EQO A;  3HKS A;  1FGU A;  2F0J A;  1SE4 A;  3U58 A;  4K2K A;  1JB3 A;  1I4X A;  2JQO A;  4DR4 Q;  2LXJ A;  4GN3 B;  5EPK A;  1EFI D;  2L5T A;  2WB1 G;  1Y8N B;  2F4I A;  4A4I A;  3LWE A;  5IIF A;  1NJ5 A;  3D8G A;  4QY7 A;  3IAL A;  4JPB W;  4I7Z C;  3QWN A;  3S9W A;  1GGM A;  4JG2 A;  1Q82 C;  2F1M A;  1D2B A;  3PO2 H;  2XWJ B;  4K86 A;  2EYO A;  4GOP C;  1SYB A;  3BZK A;  2NVX B;  2XWB B;  3I90 A;  1X55 A;  2SNM A;  3IKM B;  3PZC A;  2K4K A;  4JI2 Q;  1RHP A;  3KLS A;  3KBX A;  2VW9 A;  2B8F A;  3NPP A;  4YRL A;  4U68 A;  1CSP A;  1ESF A;  4KHP L;  4R4I A;  1K8O A;  3HOZ G;  4GS3 A;  1SR3 A;  1STH A;  3KOJ A;  1HNW L;  4DUY L;  3AFP A;  1E7Z A;  2L4N A;  1IYU A;  3CC4 A;  1RL2 A;  2SNS A;  4QL5 A;  5JVG 3;  1W6J A;  3HOZ H;  1U0L A;  1VQC A;  4QUC A;  2V4D A;  3EQL C;  3STB C;  1E3P A;  4C1N K;  1FVI A;  1TS5 A;  4CKC A;  3TS2 A;  2HCI A;  1BCP B;  1NR4 A;  1S5D D;  2B2T C;  1UWV A;  1YNN D;  3H15 A;  4FF1 A;  3PUY A;  3I55 A;  4QIW B;  2EJF C;  3S2D H;  1PRT D;  1D1K A;  3BZD B;  4EQP A;  2KCT A;  5A35 A;  3J81 E;  4LF9 Q;  3E0J A;  3ULL A;  4JI4 Q;  1PYS A;  1Y1W B;  4OO1 H;  4DV7 L;  2DEQ A;  4DV5 L;  2B63 B;  1Q1B A;  5ELB A;  2PZT A;  1EVK A;  1HQR D;  2ZM6 L;  3NHH A;  5J3B A;  1X9N A;  1H95 A;  3AYH B;  2JA8 H;  3RR5 A;  5HUR A;  2F4V Q;  4P74 A;  1X3Q A;  1A0I A;  1GD7 A;  4F7X A;  5IYB H;  1E2V A;  3S24 A;  1WU7 A;  5ELD A;  2L11 A;  2ZTD A;  3TEH B;  4XTX A;  5C4J H;  4MZ9 A;  5I9P A;  4JI7 Q;  1PXU A;  3RLN A;  3VQX A;  4OON A;  4OL7 A;  1VQK A;  5TSS A;  3HFV A;  2BOS A;  4R4T A;  4GLV B;  4XU3 A;  4YRT A;  1ENC A;  1HTT A;  1AE3 A;  4H44 C;  5LMU Q;  3HOU B;  2I4L A;  1PH4 A;  12AS A;  2EYF A;  1EWH A;  4LUV A;  4GZY C;  1OTC A;  1HTL D;  3VDY A;  1FYC A;  4CHT B;  5IGC A;  3MC0 B;  3RD4 A;  1B3Q A;  1Q1E A;  1L0W A;  2H4O A;  3OW7 A;  3URY A;  5LL6 X;  1IXR A;  3I4N G;  2D9U A;  2D62 A;  1JJC A;  1DYQ A;  1UNS A;  1PH6 A;  1I94 Q;  1I6H H;  3VYT A;  4GNX A;  1JB7 A;  5C0X G;  1BNZ A;  5E3F A;  4F88 A;  2JA5 G;  2GVA A;  2K04 A;  3VYR A;  2MPM A;  1MJC A;  3TME A;  1XWE A;  4OX9 Q;  3V7R A;  1LYL A;  3HOV B;  1BIA A;  4B3S Q;  1CA6 A;  4J8Q A;  1PRT B;  1WTP A;  4B3T Q;  2JA5 H;  2QCP X;  3ND9 A;  4BWG B;  3L2P A;  2OTL A;  3J7A V;  1SYG A;  1EUJ A;  4IUP A;  4ZYS A;  3H91 A;  1I3Q H;  3SEB A;  2WKD A;  3HRZ C;  5C4Z A;  4DR7 L;  5M3F B;  1WQ7 A;  2XNA C;  3K80 C;  2ZNJ A;  1H9M A;  5C4X H;  4TVW A;  4UAI A;  4JBW A;  2FMC A;  3TN2 A;  2N78 A;  2OEO A;  3CCR A;  1Q8K A;  5CV8 A;  3S17 H;  4YRK A;  2AMC A;  3FPP A;  1EIF A;  3BZC A;  1D5Z C;  3R3O A;  4RKB A;  1WQW A;  1DCZ A;  2UXB Q;  3L2Z A;  4DQ2 A;  2NTS A;  1JJC B;  5K36 H;  3BFM A;  4XT3 B;  3BYY B;  4HJ8 A;  3FHW A;  3RN5 A;  1YNJ C;  5G3L F;  5KYI A;  3HS0 C;  1U4M A;  5FLM G;  3RZO H;  4KJO A;  4B3R L;  2PQE A;  3K7A B;  4FP5 D;  2NN6 G;  4BY1 G;  2HDM A;  3M9B A;  1ZYR C;  2K05 A;  1O7Z A;  4PMB A;  5ELE A;  4PV1 C;  3NTH A;  3LC0 A;  2ES2 A;  1E0B A;  1NNX A;  1PTO F;  4B3M L;  3TRZ A;  4KK7 A;  1CA5 A;  1DJR D;  3M3Y H;  5J1Z A;  4H2Y A;  1IBL L;  5JJK A;  4KQE A;  4HED A;  4JI1 Q;  2WB1 B;  1IYJ B;  5KYL A;  5KIX A;  4LF8 L;  1SRU A;  1BUV T;  3CD6 A;  1EU3 A;  2F0W A;  1EY5 A;  1VQN A;  2O4X A;  4UP9 A;  2CJB A;  4MNO A;  1WI5 A;  3L9A X;  2F0Q A;  4BS9 A;  3J7A F;  2ZXO A;  4IUQ A;  4YRQ A;  1GUO A;  3GDE A;  4LMQ D;  4YRO A;  4B9X A;  1N32 Q;  2EE1 A;  4CKB A;  5IOD A;  4TWA A;  1H9K A;  1USY C;  1G29 1;  4WJ4 A;  5AFW A;  4P75 A;  1AZP A;  3E9I A;  1Q12 A;  4A3G H;  1XMQ Q;  4LF7 L;  4P72 C;  2GN5 A;  3RNU A;  1A2T A;  3HOZ B;  2F0V A;  4UHV A;  1VQM A;  4WOR A;  3TP6 A;  1BDO A;  2NTT A;  1II3 A;  3Q22 A;  1XPR A;  4YRM A;  1UE5 A;  2UXD L;  1HFG A;  3T13 A;  5M5W B;  3KBG A;  4FXG C;  1VQP A;  4H2T A;  3UE0 A;  3GV3 A;  1X3F A;  2FXQ A;  4HMJ A;  1IBM L;  2AQ2 B;  1AE2 A;  2A8V A;  2D2C C;  4PMC A;  1YNX A;  3A8J E;  2Q5I A;  1VDZ A;  3K81 C;  4A76 A;  3KF6 B;  1Y69 U;  3R2I A;  1GUG A;  1STB A;  3NEM A;  3U50 C;  4BY7 G;  4WJ3 M;  2LFN A;  1TWH H;  4HIM A;  4CJ2 C;  2UUA L;  4YCW A;  4PZ6 A;  4JC0 A;  2D0O A;  1HCZ A;  1XX8 A;  4X65 L;  1YJN A;  1VQ8 A;  4NCX A;  3PIP 3;  2VQE L;  1NJI C;  4H2X B;  2J0T D;  5C4H A;  2ZT8 A;  4MTN A;  1CKN A;  1GUS A;  2IY5 A;  4RGT A;  1Y1V H;  3E9H A;  3QR8 A;  4V0B A;  1S3O A;  1ONL A;  3OMG A;  3TUP A;  4K88 A;  5T1I A;  1BF4 A;  4IJL A;  1F2M A;  4B08 A;  1YHQ A;  4CJ1 B;  2JA6 G;  5IE8 A;  1S5C D;  4N9P A;  3VR4 A;  4V19 0;  1A3T A;  4IPC A;  3AMU A;  2ZIN A;  4P73 C;  4HSP A;  4TQD A;  1HXD A;  1QNK A;  1Z47 A;  2E5L L;  4E6I A;  1L1O A;  3K57 A;  2GA4 B;  5C5L A;  4RG1 A;  4GKJ Q;  2Q8R E;  1XNR L;  1PTO C;  1NUC A;  2HQE A;  2JSO A;  2A8E A;  1B9M A;  4Q6G A;  1TR5 A;  3IKJ A;  2CFM A;  5C0X I;  5C53 B;  1CQF A;  1SNO A;  1I6H B;  2NVT B;  4XU0 A;  4YHH L;  2F3I A;  4JI3 Q;  3I4N B;  4A3J H;  4HWO A;  2DU7 A;  1XTC D;  2CQA A;  1HXY D;  2E10 A;  1EIH A;  3S1R B;  3TQY A;  2VUM H;  2CW0 D;  2JA5 B;  5FO8 B;  3RF1 A;  3T51 B;  1SES A;  4C1N I;  1AFP A;  4X66 Q;  5DNF A;  1SYC A;  3NBI A;  3DWQ A;  4CBV A;  2ZXF A;  1J5E L;  3R07 A;  3SK8 A;  1I3Q B;  4PHC A;  1SMX A;  4GNX C;  4IOC A;  2EJ9 A;  1J6Q A;  3P1H A;  3VYU A;  1U4P A;  2ZT7 A;  1YIT A;  1PDQ A;  5DM7 3;  1Z6H A;  2HNI A;  3OWF A;  1PFS A;  1EQV A;  3K7U C;  3S17 B;  5ELF A;  1CK1 A;  1D8L A;  1DOM A;  3IAY A;  4Y7N H;  4QQB X;  3ERQ A;  2RVL A;  3S15 B;  2Z6K C;  1K73 C;  1I6V C;  4ABN A;  4ODG A;  1T5E A;  1GO3 E;  1GJX A;  2J7Z A;  1C0A A;  1LTI D;  4H2W A;  1HPC A;  2NN6 I;  4N9T A;  4YCV A;  3U4Z A;  4CS4 A;  2Z8L A;  2KHI A;  3HTZ A;  2BE5 C;  2KCM A;  3W5O A;  4IO9 A;  3A5Z A;  3K0X A;  2DXT A;  4P3P A;  4ALP A;  3D6W A;  4R8N A;  2JK8 A;  2K6A A;  3KDF B;  4K5W A;  4BY1 B;  1DGS A;  3A74 A;  3E5S A;  3H6M A;  3MFG A;  1Z7M A;  1ZEQ X;  2RCN A;  3BVG A;  5C3E G;  3QOL A;  4P3O A;  4QUF A;  2ALY A;  2G5D A;  1MSH A;  3RGL A;  4XTV A;  4ZIB A;  3T1Y Q;  1SE2 A;  1ADY A;  1H4Q A;  4P2C B;  1A8V A;  1S40 A;  1W3S A;  2TMP A;  3F2U A;  1TS3 A;  2EY1 A;  3H3V I;  2VB2 X;  1C4Q A;  4K8I A;  1JJ2 A;  4R8I A;  1Y8P B;  4EQN A;  1LTB D;  1F9P A;  2VB3 X;  5FO9 B;  3HY0 A;  5GAE C;  1V8Q A;  3CF5 A;  2VQF L;  4GOP A;  1XYI A;  2KBN A;  2QIL A;  1F2L A;  1B8A A;  3C1F A;  4R4O A;  5CV4 A;  3STB D;  4YY3 L;  1F9R A;  2A6H C;  3GO5 A;  1C7Y A;  1G51 A;  1P16 A;  2DUD A;  4OLF A;  4JW0 A;  1NYQ A;  3M4O B;  5BN4 A;  2K5N A;  4O42 A;  5E4X A;  4JV5 Q;  1TU2 B;  4NW2 A;  1G2T A;  1K3B C;  4DAY A;  3IFD A;  3UI2 A;  2DZ9 A;  1KMM A;  1G5H A;  4FXD A;  3PQI A;  3MVV A;  1KXL A;  1PHJ A;  4UY8 C;  4BBR G;  3MAQ A;  1JJG A;  3UGQ A;  3K5O A;  1JMC A;  4C2M H;  4ME5 A;  3EFS A;  2ART A;  3QTC A;  2EWN A;  5AJ3 Q;  5M9O A;  1H9S A;  4BBR H;  2B2T A;  3JAM L;  3M85 A;  1R9T H;  1YEZ A;  5C44 G;  5EKL A;  3PGZ A;  5EPL A;  1GHK A;  4ZTU B;  2E8G A;  3WOF A;  1K8A C;  3I8Z A;  3HZX A;  3PUX A;  3OTO Q;  2EJF A;  4DR2 Q;  3GD7 A;  4FF4 A;  4BY7 B;  3DWA A;  4DV0 L;  2CQO A;  1N8R C;  2RDF A;  3UE1 A;  4OXP A;  3MXN B;  2KHJ A;  2ZXR A;  2KOL A;  1CQV A;  1MGS A;  4OGQ C;  3S1M B;  2ID0 A;  1QOH A;  3HKZ G;  4A3E G;  2F0D A;  4ZUI A;  5JJI A;  1KOG A;  1B7Y B;  1R4Q B;  4DV4 Q;  2BH2 A;  2B3G A;  5LMN W;  4BA2 I;  2M9V A;  3CC7 A;  3TRE A;  2NUC A;  4JI0 L;  2XTI A;  3R2T A;  2J3M A;  5FJ8 H;  5KGU A;  4C3H H;  3L3O C;  3J80 c;  4XYO A;  4A3E H;  1STN A;  4HMI A;  3N52 A;  1V1P A;  3S14 H;  4DXF A;  4FYD A;  2BDO A;  5IYD H;  1B70 A;  2OT2 A;  3GTO H;  3GTM H;  2JA6 B;  3S1N H;  3FPU B;  4PNY A;  1LLR D;  1LTA D;  3J81 j;  1PH8 A;  4G7H C;  4KHP Q;  4TRD A;  3CMA A;  1TWG H;  2UUC L;  3NSW A;  1CM9 A;  1VQE A;  3GTQ B;  4DNI A;  2HT1 A;  3HOW G;  1KNA A;  1WTQ A;  2MJ8 A;  4LF4 L;  1SRY A;  3MA2 B;  4X64 L;  4CDC C;  4UP8 A;  1RIP A;  2ZTC A;  3D4D A;  1HZB A;  2O5I C;  1L1O C;  4GN4 B;  5CV7 A;  4KLK A;  4MTK A;  1LM0 A;  4JOI C;  1HFN A;  2PPB C;  2F0P A;  2QGQ A;  3E3X A;  2KUM A;  3X3M A;  3S16 H;  4A93 H;  2F0G A;  1FGB D;  4WF2 A;  5KNN A;  1UUP A;  2NZH A;  2VNU D;  1DD2 A;  1SER A;  4CS3 A;  2B2Y A;  1O7I A;  1TY0 A;  3CCJ A;  3ZYY X;  1V1P B;  4YYE A;  3V8L A;  3FDT A;  1W2B A;  3SR1 A;  1QCB D;  1FL0 A;  1SNM A;  1YNJ D;  3D31 A;  5I2X A;  3ZJY C;  3BS1 A;  4NKL A;  4K5X A;  5IT9 c;  2XSC A;  1W6K A;  1VQI A;  2X69 A;  3ITP A;  3TP5 A;  1ZYR D;  1TVX A;  2WP8 J;  2Y0S E;  2WAQ G;  2F0U A;  3HOY G;  1EY0 A;  2JA9 A;  1PTO H;  1KLU D;  2RSO A;  4J1M A;  2EYH A;  5GAD C;  1U4R A;  3GTG H;  1BQQ T;  3TZD A;  4DNT B;  3EFX D;  2CHB D;  4RH6 A;  1NE3 A;  4A3I H;  1BO0 A;  2L0C A;  1HZA A;  3HXY A;  3HFZ B;  2F3W A;  3EFR A;  2WAC A;  4A3K G;  2H5X A;  4GLX A;  1DM0 B;  2NVQ H;  5C3E B;  2ENB A;  2F0I A;  3FKI H;  2OQ0 A;  4XEO A;  4F87 A;  2RCF A;  4DGZ A;  2KQ3 A;  1ILP A;  4DR6 L;  5IT9 E;  3E0E A;  4JI5 Q;  3V05 A;  3L7Z C;  3W1G A;  2PNR C;  3SXH A;  1KLG D;  3RKY A;  1SEB D;  3PMF A;  4H02 A;  1SFO H;  1MI2 A;  1LT5 D;  4K8J A;  1EZ6 A;  4YWM A;  2DDZ A;  1HUN A;  3P8T A;  1USY A;  2LKV A;  4LJZ C;  3PO2 G;  4JCV E;  3HXV A;  2RHS B;  2TSS A;  4G85 A;  4BXX H;  1PV4 A;  3FEW X;  3HXZ A;  4TQU S;  3S2H H;  4P72 A;  4APV A;  3J81 c;  5EGT A;  2ZTE A;  1CHQ D;  1N36 Q;  1K8G A;  2I5M X;  4ZKC B;  3G1Z A;  1BKB A;  1LT4 D;  3PO3 H;  1Q46 A;  4K0K L;  4CDF C;  4BBR B;  4AQY L;  1SYF A;  2A1A A;  2K14 A;  1YFS A;  4X3T A;  3CQZ H;  1PVO A;  2Q2T A;  5IGF A;  4IFD J;  3BG3 A;  1JIC A;  3DMU A;  1XNQ Q;  2NZ1 D;  2A6E C;  4AYB G;  5IGD A;  5DM6 3;  3M4Y A;  1PZJ D;  4ZCK A;  5C44 B;  3W3S A;  1B44 D;  2K32 A;  3ONA B;  2MHV A;  1BBU A;  2EOT A;  4DV1 Q;  5JEA H;  3I70 A;  1ESR A;  1NYR A;  2AKW A;  4HA8 A;  5D14 A;  2CKZ B;  3HG9 A;  2K28 A;  1PZI D;  4ME3 A;  3UDG A;  2ICE C;  2E2J H;  4B3M Q;  4OO1 G;  1LT6 D;  3KFU A;  2DJZ A;  3F2B A;  4H7B A;  2EIF A;  2E41 A;  4Q0F A;  4P71 C;  2NVY B;  5JOB A;  1ROD A;  1M1K C;  4PG3 A;  1BR9 A;  3HKZ B;  4A3E B;  3DXJ C;  2JA8 G;  1EY9 A;  3J7Y W;  4DK6 C;  4DUZ L;  4H2V A;  2F0H A;  1L2F A;  1JOO A;  4LNS A;  1PYW D;  1SRO A;  3SK6 A;  3RIR A;  3NTK A;  4A3D H;  5IYB G;  3S1N B;  1ASY A;  1IW7 D;  1RF2 D;  2EXD A;  3OW2 A;  1JR0 D;  3ER0 A;  5C5M A;  3P7J A;  4P73 A;  4DV3 Q;  3MXU A;  2WFW A;  2B2V C;  3T1H L;  1LUZ A;  4IPD A;  4ZQ3 A;  5I2Y A;  4E51 A;  4LF7 Q;  1GHJ A;  1SE3 A;  3LWU A;  4M1U B;  5I4D A;  3OIQ A;  2PME A;  3C46 A;  3GTL B;  3D6C A;  2E2H H;  3PSI A;  1O78 A;  2FFK B;  5CR3 A;  2FMM A;  4KHV A;  2AKW B;  3DM3 A;  3HOW B;  4TQF A;  1NJ8 A;  2E5A A;  2IL8 A;  1YVC A;  1K28 A;  3KK7 A;  1VQZ A;  1EEF D;  1IBM Q;  2FHT A;  4CDE C;  2SEB D;  2RQX A;  1PYS B;  1STE A;  3TP8 A;  5GRO A;  2I4N A;  4YDQ A;  5IYC H;  4YRN A;  2LY7 A;  4LUO A;  4KJN A;  1JOR A;  4WRD A;  3IL8 A;  4KI0 A;  2PNH A;  3RUZ A;  2ZGW A;  1ENA A;  3NTI A;  2ICI A;  1SJE D;  4QJF A;  4KKU A;  3AFQ A;  4X65 Q;  1YGB A;  2ARS A;  4OIK A;  1EL0 A;  2XRS D;  1VS0 A;  1K9M C;  2VQE Q;  1QVF A;  1SJH D;  1BCP F;  1CKO A;  1P8L A;  1PFN A;  1IYV A;  3A54 A;  5BR8 Q;  2PMZ B;  2BE5 D;  2IX3 A;  3GTP H;  1AP0 A;  2F0S A;  3VQW A;  1VQA A;  1UE6 A;  1X2G A;  2QDL A;  2B2Y C;  2OCE A;  1KC8 C;  2NS6 A;  2PW5 A;  2B29 A;  3F2C A;  4FF2 A;  2Z6K A;  4XTZ A;  5M5Y H;  5C52 B;  5C4X G;  1TWC H;  1HZC A;  2WAQ B;  4IZ8 A;  4DV2 Q;  2QHT A;  3HOY B;  3CMQ A;  5CC4 A;  3VR6 A;  1A15 A;  3GTG B;  1BBX C;  1GXD C;  4A3I B;  2F0O A;  4NXM Q;  4KY6 A;  1G8Z D;  4DAM A;  1ADJ A;  1FNU A;  4NP5 A;  1STY A;  5K36 G;  5EPJ A;  4JVZ A;  4DR4 L;  5EKK A;  3GQB A;  3W1B A;  1CFM A;  2NVQ B;  1KDA A;  3NXW A;  1Y14 B;  2Z4H A;  3G6J B;  4A3K B;  2RKS A;  3HEJ A;  4MN3 A;  4RWS C;  4FF3 A;  2ODR C;  4GNX B;  4GKK L;  5EAY A;  4YRG A;  4IJH A;  4XQQ A;  2Q7E A;  2F0N A;  1ASZ A;  3O13 A;  3QOJ A;  2K50 A;  4X3S A;  1VQO A;  1EY4 A;  4LFA L;  1K83 H;  1M8A A;  1VQH A;  4XIG S;  4A3M G;  1KAA A;  1KNE A;  2WIN B;  4CGY B;  1VQD A;  2XN9 C;  1RJT A;  2O2L D;  3T4A C;  2JN4 A;  2E65 A;  3CME A;  3D0F A;  2VY3 A;  1LT3 D;  2VL6 A;  3CHB D;  1UE1 A;  1H9R A;  4IAL A;  4G7Z C;  4XTC S;  4C3I H;  4A3M H;  2YU9 H;  3C1E A;  2F52 A;  3PCO A;  4L87 A;  1QVC A;  1BVS A;  1WLE A;  3VR3 A;  3S2H B;  3PO2 B;  3CW2 C;  3WDN A;  3NEL A;  1GVP A;  5ELC A;  1S5F D;  4HCE A;  3M7N A;  1V43 A;  3ULP A;  5JPN C;  1WVL A;  1E1T A;  2NB0 A;  2AMC B;  4A3G G;  2ZJR A;  4RCN A;  4K5V A;  1I50 H;  2D0P A;  2Q2U A;  3EVQ A;  4Y52 H;  3HOX H;  2EVB A;  3U9O A;  2R6G A;  3CAM A;  2AQ1 B;  4DV6 L;  1HZ9 A;  1GUN A;  4JI4 L;  2L15 A;  4NPS A;  4ULL A;  3DWP A;  2QHS A;  1HH2 P;  4AYB B;  1UE7 A;  4JYA Q;  1X01 A;  1XMO Q;  1KTK A;  4DXG A;  3T53 B;  5CV5 A;  4OO1 I;  4KD4 A;  2HUG A;  1BCP C;  2E2J B;  2MQH A;  2K33 A;  1N33 Q;  5FLX c;  3S2D B;  2MUY A;  3BVZ A;  4IPG A;  1NJ6 A;  3NBH A;  2BA0 A;  4JI7 L;  5EKI A;  3QO2 A;  3LX0 A;  2HDL A;  2OTJ A;  3UDF A;  4DFA A;  2JA8 B;  4O1N A;  4C3J H;  1RTO A;  4G4K A;  1SAP A;  4DPG A;  2VQF Q;  2C8M A;  1Y1V G;  2QHU A;  2N88 A;  1BOS A;  3MEF A;  4YY3 Q;  2CGH A;  1NNH A;  2PQA A;  4IUN A;  1KHI A;  5C4J B;  3HRI A;  1OXS C;  3BVM A;  1BIB A;  4CS2 A;  3I56 A;  1EU4 A;  3L4G A;  4L5T A;  1WTV A;  1TII D;  1WCM H;  1VF5 C;  4ZAI A;  2PMF A;  1I94 L;  2I4O A;  1TWA H;  3VBB A;  1HA5 A;  2VXW A;  4LAA A;  5A2Q L;  4RA8 A;  1WD1 A;  4DR1 L;  5JEA J;  4I65 A;  2VZA A;  3FMC A;  5FLX E;  4OX9 L;  3I4M H;  2K5H A;  4KN7 C;  2A74 C;  4JOI A;  4B3T L;  3F1Z A;  1V1O A;  4X3K A;  3UH0 A;  2ASB A;  2R93 H;  3OYY A;  1H4S A;  4YRJ A;  3JAM i;  3REU A;  1I4P A;  1WNL A;  4A3J G;  1T5X D;  3TBI B;  3FVQ A;  3A7A A;  1QE6 A;  3ICE A;  2B2W C;  1RKN A;  2QF7 A;  1HR0 Q;  2VUM G;  5KNB A;  3I4O A;  1KL9 A;  3VR5 A;  2C5C A;  3V7C A;  1CKN B;  2ZJQ A;  2UXC Q;  1J8I A;  2IY5 B;  3I72 A;  1QWY A;  1PRT C;  1NMF A;  2HHH L;  4K14 A;  1ZKO A;  2YTV A;  2Z0S A;  3G71 A;  3L4G B;  3F2D A;  2WII B;  1HUM A;  4JI0 Q;  1SDF A;  1G6P A;  2EL9 A;  1HNZ L;  3KLW A;  1N34 Q;  2E1H A;  1SE8 A;  1G2S A;  1EY7 A;  2RDG A;  3NP8 A;  5C4X B;  2ZT5 A;  1QB5 D;  1K0S A;  1L1O B;  2FIN B;  4LF6 L;  1SSO A;  2Q5H A;  4IUU A;  2F0E A;  4JI6 L;  2EAY A;  3A31 A;  1TWF H;  4CH4 A;  2JA7 H;  3GTJ H;  3UDI A;  4QCL A;  5HGQ A;  1FYF A;  5M5X H;  2A69 C;  4QF4 A;  2Z6B A;  3F8T A;  1NJ1 A;  2AHO B;  2DTI A;  4TVA A;  4A3L H;  2Q2H A;  1LTG D;  4IQZ A;  3RZO B;  1WTO A;  1A3U A;  2EJG C;  4LF4 Q;  3DEP A;  2MGS A;  1SNQ A;  4DK1 A;  1SN8 A;  1K83 B;  3E6Z X;  3IRB A;  5K1P A;  3BJU A;  4IFD G;  4RGO S;  5IP7 H;  1N32 L;  2JXM B;  1TS2 A;  2EYL A;  1E2Z A;  3MF2 A;  2B39 A;  5M3M H;  3KLR A;  3QJY A;  5NUC A;  4Q5V A;  4A3M B;  3M3Y B;  2BH8 A;  4ZRZ A;  4IFD H;  1FJG L;  4H2U A;  1GUT A;  4RDX A;  1NBW A;  3WOE A;  3CCU A;  3HY1 A;  5ELO A;  3UFG A;  4DK0 A;  1PH7 A;  2K5W A;  1OXU A;  1CZW A;  4CDD C;  1GUW A;  1WFQ A;  1EFW A;  3D3R A;  4QIW E;  5GAH C;  1ZXT A;  5C0X J;  1FD7 D;  5IP9 G;  1EIY A;  4A3G B;  1SYE A;  4HR7 B;  2E3C A;  5BN3 A;  2EQS A;  1CTM A;  2QEJ C;  2DGY A;  4ZUJ A;  3HGB A;  2KEC A;  5K5P A;  1J5W A;  3R8B A;  1EIG A;  1K0R A;  1O7L A;  1U4L A;  2N55 A;  5IP9 H;  1HNX Q;  1HR0 W;  3Q0A A;  3EJI A;  3A5Z B;  4KV6 A;  4C56 C;  3RZD H;  1A6X A;  2IHF A;  1VQ5 A;  4G57 A;  4K6D A;  3SK4 A;  4XYQ A;  1A63 A;  1B50 A;  2ZZF A;  4RAU C;  4S3S A;  1QUQ A;  1JWM D;  2ALY B;  1X54 A;  1IKL A;  3RUX A;  2ATW A;  4RHS A;  3P8V A;  5BN5 A;  2OF1 A;  1O80 A;  1STA A;  3FJP A;  1TWH B;  4K87 A;  2EDG A;  5I6W A;  4LF5 Q;  1KAW A;  3BU2 A;  5ELN A;  4P71 A;  1CUK A;  4LW1 A;  3CRK C;  4DR6 Q;  4KY5 A;  1JT8 A;  4PZ8 A;  4G7O C;  3JAM E;  4R4Q A;  3A32 A;  2R3Z A;  4GOP B;  1KMN A;  4RMF A;  4YWK A;  2NVX H;  11AS A;  3A56 A;  5T1G A;  1X65 A;  4GKJ L;  5FJ8 G;  1Z7N A;  1Y1V B;  4C3H G;  2LS0 1;  3CP0 A;  3PV0 A;  3N6R A;  1ICF B;  4KR2 A;  4PMW A;  2B2V A;  2DY7 A;  4DAY B;  4BWA A;  5IYD G;  5D3I B;  2BCO A;  1LAB A;  4JI3 L;  5C51 B;  2ZIO A;  2QKI C;  1OXV A;  4H0L C;  2JE6 I;  1HHV A;  1STG A;  3LGJ A;  4DA2 A;  1GKH A;  3MF1 A;  2HIX A;  3ND8 A;  1H9S B;  4AQY Q;  2ZIM A;  2ZT6 A;  1BXT A;  1MIU A;  1A62 A;  5COR A;  5L37 A;  2EY6 A;  5E1F A;  2F3V A;  1V9P A;  3SVM A;  5COY A;  2KJX A;  1HNW Q;  4DUY Q;  1Q86 C;  3KYH C;  5JVH 3;  1T9H A;  2LMC B;  1VMC A;  1Y1W H;  1VQF A;  4A3J B;  2Z4I A;  4L5R C;  3AU7 A;  4A93 G;  2E74 C;  2VUM B;  1MSG A;  1U9R A;  2EYJ A;  2B63 H;  5F5W A;  5DAU A;  2PZW A;  1PH1 A;  2ZZG A;  2JYO A;  1LTT D;  1EYG A;  4FO2 A;  1SNP A;  1IBK L;  2RHQ A;  3HXX A;  3SDZ A;  1EYC A;  2X6G A;  3G4S A;  3RLF A;  3PIO A;  5LMN L;  5HGT A;  3X3N A;  2F0K A;  4DNR B;  2Q8T A;  1SXT A;  4LVJ A;  1Q3L A;  2LXK A;  3L0O A;  4HWS A;  3UGT A;  3NE5 B;  4DV7 Q;  2E75 C;  3TEG A;  2KCC A;  4LFC L;  4NXN L;  2EYP A;  3U9S A;  5CYU A;  4DV5 Q;  3CXC A;  3Q6S A;  4JI8 L;  3VYS A;  1B70 B;  2DZC A;  1WJJ A;  2ZM6 Q;  1NR2 A;  4Y7N B;  3J80 L;  1CI3 M;  1TT2 A;  3KF8 A;  4IPH A;  3HOU H;  2JA7 B;  3A7R A;  3M4Q A;  2IX0 A;  2WB1 E;  3PUW A;  3SE0 A;  4HT4 A;  3T1H Q;  4HJ7 A;  4HTH A;  3RMH A;  2ZJP A;  5J39 A;  3T1Y L;  4AIM A;  2IJ0 A;  2UUB L;  2C9O A;  3OIP A;  1KDB A;  4QGU A;  4A3I G;  4IFD I;  3DHQ A;  5HY6 A;  4XXE A;  1WD0 A;  3HXU A;  4OWX B;  2K7V A;  4RGM A;  1TY2 A;  4LFB L;  2K5V A;  1HRJ A;  3FKI G;  4LVK A;  1YZ6 A;  3HOV H;  4HWT A;  1G6Z A;  4Z9C B;  2ZTG A;  2R92 G;  4JV5 L;  4FVM A;  3QO8 A;  1J9O A;  4LUZ A;  2I46 A;  1TS4 A;  3D4W A;  4YRC A;  2KEE A;  1I4H A;  1KAB A;  2P5Z X;  2QW7 A;  3P20 A;  4H13 C;  2CW0 C;  3MWY W;  3CCL A;  4UPA A;  4XDX A;  3K5L A;  2R92 H;  2Z1C A;  1EQQ A;  5M3F H;  4GN5 A;  4LVI A;  3H3V C;  1C8C A;  3QO5 A;  3MEH A;  4BXX G;  1VF7 A;  5IT9 L;  1B76 A;  1ICW A;  1CT1 D;  1OXX K;  4X62 L;  1XXG A;  1QZG A;  1EY6 A;  1S4Z A;  4DR2 L;  2CWP A;  1A2U A;  4XQN A;  3EN2 A;  3RZD B;  5EBC A;  3PO3 G;  1MHW C;  2QDB A;  2EPB A;  2NYZ D;  3R93 A;  4DR7 Q;  4DR5 L;  2RA4 A;  1NMG A;  1EWI A;  4C2M B;  5JJZ A;  2FJ2 A;  2DTH A;  1B1Z A;  5KNC A;  3K7A H;  3PF5 A;  1NJ2 A;  2EXZ A;  3B6Y A;  4DR3 L;  1KIX A;  2YV5 A;  4QB4 A;  1YHA A;  1R9T B;  4XU2 A;  4O0A A;  2EZV A;  4L8J A;  5D3D A;  4ZK9 B;  2Y0S G;  4DV4 L;  1Y8O B;  3OMC A;  4XT1 B;  2DNC A;  2CCZ A;  4WI1 A;  2E2D C;  5CGK A;  4GKK Q;  3W3A A;  5JEA G;  1YFT A;  2N49 A;  1B2T A;  4B3R Q;  2EYM A;  1G91 A;  1ML0 D;  4LFA Q;  4L5Q A;  5G3L D;  2L55 A;  5IGE A;  4G84 A;  1Q8I A;  3CC2 A;  3NQI A;  2G9D A;  5J22 A;  1QIL A;  1SLJ A;  3MFY A;  3HXW A;  2QA4 A;  1IBL Q;  5IWA L;  4OHJ A;  3VA5 A;  4R4C A;  1LO5 D;  1OXT A;  4C3H B;  4A3D G;  1PTO D;  2PYK A;  1RCV D;  3TEH A;  3G48 A;  1EOV A;  2B8G A;  2MP1 A;  4AH6 A;  4HJ9 A;  4LF8 Q;  3S14 B;  3PUV A;  4KKT A;  1Q90 A;  4KN4 C;  2J3L A;  3GTO B;  3GTM B;  3VA7 A;  3EIV A;  3J81 L;  3Q23 A;  2I4M A;  1F2Z A;  3A5U A;  4N8F A;  4GLA C;  2Q2I A;  1GM5 A;  5M5W H;  2OQK A;  4KHZ A;  1SND A;  1NAP A;  2DN8 A;  2VS1 A;  3LNN A;  1TWG B;  3DUZ A;  5EQ0 A;  2ZR2 A;  4UP7 A;  4DV6 Q;  2E64 A;  3V2T A;  5D65 A;  3KJP A;  1I5F A;  3MZ5 A;  5C3W A;  2YTX A;  4DAV A;  5H1S E;  2L1B A;  3NEN A;  2UU9 L;  5ISR A;  1LTL A;  3JC6 6;  4HJA A;  3TP7 A;  2F0M A;  1VCI A;  2B2W A;  5DLQ E;  1EY8 A;  2IX1 A;  2UXD Q;  2CIM A;  3S1Q H;  3S16 B;  2KCN A;  2CVR A;  4IUV A;  2XRQ D;  2V1C C;  5C3X A;  4A93 B;  4FNF A;  2JJQ A;  5IYC G;  2M2L A;  1Z9F A;  2IT1 A;  1CKM A;  2A68 C;  1PZK D;  1L0Y B;  1YB3 A;  4FXK C;  3V7S A;  1X3P A;  1XTD A;  2A69 D;  2UUA Q;  3UDX A;  1D7Q A;  2F0F A;  3LSQ A;  4YRS A;  4RKL A;  3K58 A;  5FO7 B;  1NCV A;  1KRT A;  1HC7 A;  3OOC A;  3CCS A;  4XTW A;  1SMY C;  4CH3 A;  2C7I A;  1KDC A;  2PCF B;  4RGN A;  5FK9 C;  2Z9H A;  3QIA A;  3AQQ A;  1PTO B;  1RIQ A;  2ZR3 A;  2ZXP A;  2Q8I B;  2DNE A; 
#chains in the Genus database with same CATH homology
 3J7A 5;  2JEA I;  1WPY A;  2NVT H;  3K8A A;  3QO7 A;  3GTK H;  4A3B G;  4JI5 L;  4YRI A;  3I4N H;  2EJG A;  4DR1 Q;  2E5L Q;  3S1R H;  4HJ5 A;  4A3B H;  4LVL A;  1XNR Q;  4BBS G;  3CCV A;  1XJV A;  3ERS X;  4BBS H;  3QNE A;  4LNQ A;  4YHH Q;  2R7D A;  1N36 L;  4TTV A;  2R7Z G;  1PH2 A;  4JI2 L;  2CJ9 A;  1WYD A;  2I0Q A;  2HHH Q;  3DSQ A;  2MO1 A;  1S72 A;  2R7Z H;  1XNQ L;  3S15 H;  1E1O A;  3RN2 A;  4L5S A;  1J5E Q;  3NET A;  1X56 A;  1HNZ Q;  2LSS A;  4YP0 A;  4HWR A;  4YCU A;  3A0J A;  4ZTZ B;  4DV1 L;  3HOX G;  4HIK A;  4LF6 Q;  4FDB A;  3CCQ A;  3CCE A;  5FLM H;  4JI6 Q;  4BY1 H;  1G5I A;  2DQ3 A;  1UEB A;  3KJO A;  1X3G A;  3KF6 A;  4RQF A;  2XGT A;  3PUZ A;  4DKA C;  3IG2 A;  4EX5 A;  1XPO A;  2F4V L;  4H2X A;  4DV3 L;  4JBK A;  3PCO B;  3H3V H;  3FP9 A;  1FJG Q;  3CCM A;  3U4V A;  4A3F G;  3PF4 A;  1CSQ A;  2DXU A;  3M4O H;  1MKH A;  3TS0 A;  1YI2 A;  4A3F H;  2FYK A;  5LMU L;  1VQ9 A;  1YFR A;  3I2Z A;  1QF6 A;  1KRS A;  1BBW A;  2G4C A;  1VQ7 A;  1WCM G;  2CWA A;  1U5K A;  1H4V B;  3ULJ A;  1PA6 A;  1X6O A;  3I4M G;  2ZNI A;  4XEM A;  3H0G G;  4BY7 H;  2BA1 A;  3J7Z C;  2R93 G;  4J15 A;  5BR8 L;  2ARU A;  4B3S L;  3H0G H;  3S1M H;  3NBH B;  1IZ6 A;  3CPF A;  3I7F A;  2PI2 E;  2I5H A;  2Q7G A;  4DV2 L;  4OWW B;  3RL6 A;  2IHE A;  1E24 A;  2E2I H;  3P8Y A;  1EVL A;  4DV0 Q;  4NXM L;  4NB3 A;  4P74 C;  1Q7Y C;  2PQA B;  2C35 B;  5E7N A;  2JA6 H;  3PIP A;  2UXB L;  4P3N A;  2AWO A;  1QZH A;  2AWN A;  3GTQ H;  1C9O A;  2MFI A;  4EO4 A;  2JA7 G;  1IL2 A;  3A5Y A;  2A19 A;  1QE0 A;  1EQR A;  4A3L G;  1M90 C;  3KDF A;  1YBY A;  2CJA A;  5E3I A;  2UUC Q;  1YJW A;  4JI1 L;  5IP7 G;  2I5L X;  1V1Q A;  4XTU A;  2N8N A;  4X64 Q;  5M3M G;  5K1X A;  1YJ9 A;  2DKG A;  4PZ7 A;  3VQV A;  1WOC A;  1XPU A;  1IBK Q;  4OP0 A;  1SET A;  1TXY A;  3V8K A;  5LMN Q;  3L1A A;  1XMQ L;  1YHB A;  2YYZ A;  4LFC Q;  4NXN Q;  4JYA L;  3G6E A;  4HVC A;  4JI8 Q;  1XMO L;  3M4P A;  4POF A;  3J80 i;  2ZZE A;  3JAM c;  4OWT B;  3RKW A;  2GVB A;  1N33 L;  4YRF A;  1PYB A;  4HIO A;  3SGI A;  2KEN A;  3HKZ E;  2DVE A;  4TVA B;  2Q7H A;  2NZO A;  4H2S A;  2UUB Q;  4X6A H;  3RAC A;  3ERR A;  5C3E H;  4BW9 A;  4YRE A;  4HWP A;  1YIJ A;  1KD1 C;  1MJE A;  4LFB Q;  4XU1 A;  2R7F A;  2P5I A;  4HID A;  1W66 A;  3V8J A;  1B7Y A;  1QVG A;  4A3C G;  4CH6 A;  1NTG A;  4A3C H;  1HJP A;  4P75 C;  1EIY B;  2HIV A;  1PH9 A;  4X62 Q;  2RF4 A;  2N3S A;  2MO0 A;  3Q8D A;  3CPW A;  4KR3 A;  1HR0 L;  4EQ5 A;  1JE5 A;  4XTY A;  5C44 H;  2DQ0 A;  2PMZ E;  4DR5 Q;  2ZCE A;  1AH9 A;  2P0L A;  1QUQ B;  2UXC L;  4DR3 Q;  4Q15 A;  1KQS A;  1N9W A;  4A75 A;  4K0K Q;  1H4T A;  3AEV A;  4YWL A;  4X66 L;  2WAQ E;  1Y1W G;  3EBE A;  2JEB I;  3DLL A;  2B63 G;  1Q81 C;  2NVY H;  4JBJ A;  1N34 L;  3MEY A;  1VQ6 A;  3LSS A;  5GAG C;  3HRK A;  5IWA Q;  5GQO A;  2K75 A;  4DUZ Q;  3HOU G;  4RQE A;  4YRR A;  1X3E A;  3GTL H;  2DTO A;  1E22 A;  2ODR D;  2PI2 A;  3J81 i;  3MQZ A;  3HOW H;  1VQB A;  4R1J A;  1NY4 A;  3HFZ A;  3WQZ A;  4LVM A;  3REX A;  4LWC A;  1X2H A;  2UU9 Q;  1ATI A;  3HOV G;  2K52 A;  3ICA A;  2RHQ B;  4LF9 L;  3RLO A;  4IOA A;  2QHV A;  2OWO A;  1VQ4 A;  2MNA A;  3IKL A;  4AYB E;  2QEX A;  5M3F G;  1HNX L;  4YRP A;  4O2D A;  2RHS A;  1VQJ A;  4X5O A;  3OD1 A;  3HOY H;  3KF8 B;  1K3R A;  4CH5 A;  4TVY A;  3WWV A;  1VQL A;  3RKX A;  3VQY A;  1PH5 A;  5JJL A;  5AJ3 L;  2YTY A;  1PH3 A;  4DK3 C;  4BA1 I;  5IY0 A;  4JBM A;  4LF5 L;  2DU5 A;  4A3K H;  3OTO L;  3A7U A;  2HQL A;  4POG A;  1VQG A;  3HKS A;  1FGU A;  3U58 A;  2JQO A;  4DR4 Q;  2LXJ A;  4GN3 B;  2WB1 G;  4A4I A;  1NJ5 A;  3IAL A;  4QY7 A;  1GGM A;  4JG2 A;  1Q82 C;  3PO2 H;  4K86 A;  4GOP C;  3BZK A;  1X55 A;  3IKM B;  3PZC A;  2K4K A;  4JI2 Q;  2VW9 A;  4YRL A;  1CSP A;  4KHP L;  4R4I A;  3HOZ G;  4GS3 A;  1SR3 A;  3KOJ A;  1HNW L;  4DUY L;  3AFP A;  1E7Z A;  3CC4 A;  1RL2 A;  4QL5 A;  3HOZ H;  1U0L A;  1VQC A;  3STB C;  1E3P A;  1FVI A;  3TS2 A;  1UWV A;  3H15 A;  3PUY A;  3I55 A;  3S2D H;  2KCT A;  3ULL A;  4JI4 Q;  1PYS A;  4DV7 L;  2DEQ A;  4DV5 L;  1Q1B A;  1EVK A;  2ZM6 L;  5J3B A;  1X9N A;  1H95 A;  3AYH B;  2JA8 H;  3RR5 A;  2F4V Q;  4P74 A;  1A0I A;  1GD7 A;  5IYB H;  3S24 A;  1WU7 A;  2ZTD A;  3TEH B;  4XTX A;  5C4J H;  4MZ9 A;  4JI7 Q;  3RLN A;  3VQX A;  4OON A;  1VQK A;  3HFV A;  4R4T A;  4GLV B;  4XU3 A;  4YRT A;  1HTT A;  1AE3 A;  5LMU Q;  2I4L A;  1PH4 A;  12AS A;  4LUV A;  1OTC A;  3VDY A;  1Q1E A;  1L0W A;  1IXR A;  3I4N G;  2D62 A;  1JJC A;  1PH6 A;  1I94 Q;  1I6H H;  4GNX A;  1JB7 A;  5C0X G;  2JA5 G;  2GVA A;  1MJC A;  3V7R A;  4OX9 Q;  1LYL A;  1BIA A;  4B3S Q;  4B3T Q;  2JA5 H;  3L2P A;  2OTL A;  1EUJ A;  1I3Q H;  4DR7 L;  1WQ7 A;  3K80 C;  2ZNJ A;  5C4X H;  4TVW A;  4JBW A;  2N78 A;  3CCR A;  1Q8K A;  3S17 H;  4YRK A;  2AMC A;  1EIF A;  3BZC A;  1WQW A;  2UXB Q;  3L2Z A;  4DQ2 A;  3BFM A;  1JJC B;  4HJ8 A;  3FHW A;  3RN5 A;  5FLM G;  3RZO H;  4B3R L;  4BY1 G;  2NN6 G;  3M9B A;  3LC0 A;  2ES2 A;  4B3M L;  3TRZ A;  3M3Y H;  4H2Y A;  1IBL L;  5JJK A;  4KQE A;  4JI1 Q;  1IYJ B;  4LF8 L;  1SRU A;  3CD6 A;  1VQN A;  2CJB A;  4UP9 A;  4MNO A;  1WI5 A;  4YRQ A;  3GDE A;  4YRO A;  1N32 Q;  4TWA A;  1USY C;  1G29 1;  4WJ4 A;  4P75 A;  3E9I A;  1Q12 A;  4A3G H;  1XMQ Q;  4LF7 L;  4P72 C;  2GN5 A;  3RNU A;  1VQM A;  1XPR A;  4YRM A;  1UE5 A;  2UXD L;  1VQP A;  4H2T A;  3UE0 A;  1X3F A;  2FXQ A;  1IBM L;  1AE2 A;  2A8V A;  1YNX A;  2Q5I A;  3K81 C;  4A76 A;  3KF6 B;  3U50 C;  3NEM A;  4BY7 G;  4WJ3 M;  1TWH H;  4HIM A;  2UUA L;  4YCW A;  4PZ6 A;  4JC0 A;  2D0O A;  4X65 L;  1YJN A;  1VQ8 A;  4NCX A;  2VQE L;  1NJI C;  4H2X B;  2ZT8 A;  4MTN A;  1CKN A;  2IY5 A;  1Y1V H;  3E9H A;  1S3O A;  3TUP A;  4K88 A;  4IJL A;  1YHQ A;  2JA6 G;  5IE8 A;  4YPF A;  2ZIN A;  4TQD A;  4IPC A;  4P73 C;  1HXD A;  1Z47 A;  2E5L L;  1L1O A;  4RG1 A;  4GKJ Q;  1XNR L;  2A8E A;  4Q6G A;  2CFM A;  5C0X I;  5C53 B;  4XU0 A;  4YHH L;  2F3I A;  4JI3 Q;  4A3J H;  4HWO A;  2DU7 A;  2E10 A;  3TQY A;  2VUM H;  3RF1 A;  1SES A;  4X66 Q;  2ZXF A;  1J5E L;  3R07 A;  4PHC A;  1SMX A;  4GNX C;  4IOC A;  2EJ9 A;  1J6Q A;  2ZT7 A;  1YIT A;  2HNI A;  1PFS A;  3K7U C;  1D8L A;  4Y7N H;  4QQB X;  2Z6K C;  1K73 C;  1GO3 E;  1C0A A;  4H2W A;  2NN6 I;  4YCV A;  3U4Z A;  4CS4 A;  2KHI A;  3HTZ A;  2KCM A;  3W5O A;  3A5Z A;  4IO9 A;  3K0X A;  2DXT A;  4P3P A;  4ALP A;  2JK8 A;  3KDF B;  1DGS A;  3A74 A;  1Z7M A;  2RCN A;  5C3E G;  4P3O A;  2ALY A;  3RGL A;  4ZIB A;  4XTV A;  3T1Y Q;  1ADY A;  1H4Q A;  1S40 A;  1A8V A;  1W3S A;  3H3V I;  1JJ2 A;  3HY0 A;  5GAE C;  3CF5 A;  2VQF L;  4GOP A;  2KBN A;  3STB D;  4R4O A;  1B8A A;  4YY3 L;  4LF9 Q;  3GO5 A;  1C7Y A;  1G51 A;  1P16 A;  2DUD A;  4OLF A;  1NYQ A;  2K5N A;  4JV5 Q;  2DZ9 A;  1KMM A;  1G5H A;  1KXL A;  4UY8 C;  1PHJ A;  4BBR G;  1JJG A;  3UGQ A;  1JMC A;  4C2M H;  3EFS A;  2ART A;  3QTC A;  2EWN A;  5AJ3 Q;  4BBR H;  3M85 A;  1R9T H;  1YEZ A;  5C44 G;  3PGZ A;  4ZTU B;  2E8G A;  1K8A C;  3PUX A;  2EJF A;  3OTO Q;  4DR2 Q;  3GD7 A;  4DV0 L;  2CQO A;  1N8R C;  3UE1 A;  4OXP A;  3MXN B;  2KHJ A;  2ID0 A;  3HKZ G;  4A3E G;  5JJI A;  1KOG A;  1B7Y B;  4DV4 Q;  2BH2 A;  2B3G A;  5LMN W;  4BA2 I;  3CC7 A;  3TRE A;  4JI0 L;  2XTI A;  2J3M A;  5FJ8 H;  4C3H H;  3J80 c;  4A3E H;  3S14 H;  5IYD H;  1B70 A;  3GTO H;  3GTM H;  3S1N H;  3J81 j;  1PH8 A;  4KHP Q;  3CMA A;  1TWG H;  2UUC L;  1VQE A;  4DNI A;  2HT1 A;  3HOW G;  1SRY A;  4LF4 L;  4X64 L;  4UP8 A;  1RIP A;  2ZTC A;  1HZB A;  1L1O C;  4GN4 B;  4KLK A;  1LM0 A;  4JOI C;  2QGQ A;  3S16 H;  4A93 H;  4WF2 A;  5KNN A;  2NZH A;  2VNU D;  1SER A;  4CS3 A;  1O7I A;  3CCJ A;  4YYE A;  3V8L A;  1W2B A;  1FL0 A;  3D31 A;  3ZJY C;  5IT9 c;  1VQI A;  2WP8 J;  2Y0S E;  2WAQ G;  3HOY G;  2JA9 A;  5GAD C;  3GTG H;  1NE3 A;  4A3I H;  1HZA A;  3HXY A;  3HFZ B;  3EFR A;  4A3K G;  2H5X A;  4GLX A;  2NVQ H;  3FKI H;  2OQ0 A;  4XEO A;  4DR6 L;  3E0E A;  4JI5 Q;  3L7Z C;  3W1G A;  3RKY A;  4H02 A;  1SFO H;  4YWM A;  2DDZ A;  3P8T A;  1USY A;  3PO2 G;  4JCV E;  3HXV A;  2RHS B;  4G85 A;  4BXX H;  1PV4 A;  3HXZ A;  4TQU S;  3S2H H;  4P72 A;  4APV A;  3J81 c;  2ZTE A;  1N36 Q;  1K8G A;  2I5M X;  3G1Z A;  1BKB A;  3PO3 H;  1Q46 A;  4K0K L;  4AQY L;  2A1A A;  2K14 A;  1YFS A;  3CQZ H;  1PVO A;  2Q2T A;  4IFD J;  1XNQ Q;  4AYB G;  3W3S A;  1BBU A;  4DV1 Q;  1NYR A;  2AKW A;  4HA8 A;  2CKZ B;  3UDG A;  4ME3 A;  2E2J H;  4B3M Q;  4OO1 G;  2DJZ A;  3KFU A;  3F2B A;  2EIF A;  2E41 A;  4P71 C;  1M1K C;  4PG3 A;  2JA8 G;  4DK6 C;  4DUZ L;  4H2V A;  1L2F A;  4LNS A;  1SRO A;  3RIR A;  4A3D H;  5IYB G;  1ASY A;  3OW2 A;  2EXD A;  3ER0 A;  4P73 A;  4DV3 Q;  2WFW A;  3T1H L;  1LUZ A;  4IPD A;  4E51 A;  4LF7 Q;  2PME A;  2E2H H;  3PSI A;  2AKW B;  3DM3 A;  4TQF A;  1NJ8 A;  2E5A A;  1YVC A;  1VQZ A;  1IBM Q;  1PYS B;  2I4N A;  5GRO A;  4YDQ A;  5IYC H;  4YRN A;  4LUO A;  4KI0 A;  2PNH A;  2ZGW A;  4QJF A;  3AFQ A;  4X65 Q;  1YGB A;  2ARS A;  1VS0 A;  1K9M C;  2VQE Q;  1QVF A;  1CKO A;  1P8L A;  5BR8 Q;  3GTP H;  3VQW A;  1VQA A;  1UE6 A;  1X2G A;  2OCE A;  1KC8 C;  2NS6 A;  2B29 A;  3F2C A;  2Z6K A;  4XTZ A;  5M5Y H;  5C52 B;  5C4X G;  1TWC H;  1HZC A;  4DV2 Q;  2QHT A;  3CMQ A;  4NXM Q;  4DAM A;  1ADJ A;  5K36 G;  4DR4 L;  3W1B A;  1Y14 B;  2ODR C;  4GNX B;  4GKK L;  5EAY A;  4YRG A;  4IJH A;  2Q7E A;  1ASZ A;  2K50 A;  1VQO A;  4LFA L;  1K83 H;  4XIG S;  1VQH A;  4A3M G;  1VQD A;  2E65 A;  3CME A;  3D0F A;  2VY3 A;  2VL6 A;  1UE1 A;  4XTC S;  4C3I H;  4A3M H;  2YU9 H;  4L87 A;  2F52 A;  3PCO A;  1QVC A;  1BVS A;  1WLE A;  3CW2 C;  3NEL A;  1GVP A;  3M7N A;  1V43 A;  3ULP A;  1E1T A;  2AMC B;  4A3G G;  2ZJR A;  1I50 H;  2D0P A;  2Q2U A;  4Y52 H;  3HOX H;  2R6G A;  3CAM A;  4DV6 L;  1HZ9 A;  4JI4 L;  2L15 A;  4NPS A;  2QHS A;  1HH2 P;  1UE7 A;  4JYA Q;  1X01 A;  1XMO Q;  4OO1 I;  2MQH A;  1N33 Q;  5FLX c;  4IPG A;  1NJ6 A;  2BA0 A;  4JI7 L;  2OTJ A;  3UDF A;  4C3J H;  4DPG A;  2VQF Q;  2C8M A;  1Y1V G;  2QHU A;  3MEF A;  4YY3 Q;  2CGH A;  1NNH A;  2PQA A;  1KHI A;  3HRI A;  1OXS C;  1BIB A;  4CS2 A;  3I56 A;  3L4G A;  4L5T A;  1WCM H;  2PMF A;  1I94 L;  2I4O A;  1TWA H;  3VBB A;  4DR1 L;  5JEA J;  2VZA A;  4OX9 L;  3I4M H;  2K5H A;  4JOI A;  4B3T L;  3F1Z A;  3UH0 A;  2ASB A;  2R93 H;  3OYY A;  1H4S A;  4YRJ A;  3JAM i;  3REU A;  1WNL A;  4A3J G;  3A7A A;  3ICE A;  2VUM G;  1HR0 Q;  3I4O A;  1KL9 A;  3V7C A;  1CKN B;  2ZJQ A;  2UXC Q;  2IY5 B;  1NMF A;  2HHH L;  2YTV A;  2Z0S A;  3G71 A;  3L4G B;  3F2D A;  4JI0 Q;  1G6P A;  2EL9 A;  1HNZ L;  3KLW A;  1N34 Q;  2E1H A;  1SE8 A;  2ZT5 A;  1L1O B;  4LF6 L;  2Q5H A;  3A31 A;  4JI6 L;  2EAY A;  1TWF H;  4CH4 A;  2JA7 H;  3GTJ H;  3UDI A;  5HGQ A;  1FYF A;  5M5X H;  1NJ1 A;  3F8T A;  2AHO B;  2DTI A;  4TVA A;  4A3L H;  2Q2H A;  4LF4 Q;  1SN8 A;  3IRB A;  5K1P A;  3BJU A;  4IFD G;  5IP7 H;  1N32 L;  3MF2 A;  5M3M H;  2BH8 A;  1FJG L;  4H2U A;  4RDX A;  1NBW A;  3CCU A;  3HY1 A;  5ELO A;  3UFG A;  1PH7 A;  1OXU A;  1WFQ A;  1EFW A;  4QIW E;  5GAH C;  5C0X J;  5IP9 G;  1EIY A;  2E3C A;  2EQS A;  2DGY A;  1J5W A;  5IP9 H;  1K0R A;  1HNX Q;  1HR0 W;  3A5Z B;  3RZD H;  2IHF A;  1VQ5 A;  2ZZF A;  1A63 A;  1QUQ A;  2ALY B;  1X54 A;  3RUX A;  2ATW A;  3P8V A;  3FJP A;  4K87 A;  4LF5 Q;  1KAW A;  3BU2 A;  5ELN A;  4P71 A;  1CUK A;  4LW1 A;  4DR6 Q;  1JT8 A;  4PZ8 A;  4R4Q A;  3A32 A;  4GOP B;  1KMN A;  4RMF A;  4YWK A;  2NVX H;  11AS A;  1X65 A;  4GKJ L;  5FJ8 G;  1Z7N A;  3CP0 A;  3PV0 A;  4KR2 A;  4PMW A;  4DAY B;  4BWA A;  5IYD G;  5C51 B;  4JI3 L;  2ZIO A;  1OXV A;  2JE6 I;  3LGJ A;  1GKH A;  3MF1 A;  2HIX A;  4AQY Q;  2ZIM A;  2ZT6 A;  1MIU A;  1A62 A;  1V9P A;  1HNW Q;  4DUY Q;  1Q86 C;  3KYH C;  1T9H A;  1Y1W H;  1VQF A;  4L5R C;  4A93 G;  2B63 H;  5F5W A;  1PH1 A;  2ZZG A;  1EYG A;  1IBK L;  2RHQ A;  3HXX A;  3G4S A;  3RLF A;  3PIO A;  5LMN L;  4LVJ A;  3L0O A;  2LXK A;  4HWS A;  3UGT A;  4DV7 Q;  3TEG A;  4LFC L;  4NXN L;  4DV5 Q;  3CXC A;  4JI8 L;  1B70 B;  2DZC A;  1WJJ A;  2ZM6 Q;  4IPH A;  3HOU H;  3A7R A;  3M4Q A;  2IX0 A;  2WB1 E;  3PUW A;  4HT4 A;  3T1H Q;  4HJ7 A;  2ZJP A;  3T1Y L;  4AIM A;  2UUB L;  4QGU A;  4A3I G;  4IFD I;  5HY6 A;  3HXU A;  4OWX B;  4LFB L;  2K5V A;  3FKI G;  4LVK A;  1YZ6 A;  3HOV H;  4HWT A;  2ZTG A;  2R92 G;  4JV5 L;  3QO8 A;  4LUZ A;  4YRC A;  3CCL A;  4UPA A;  2R92 H;  1EQQ A;  5M3F H;  4GN5 A;  4LVI A;  3QO5 A;  4BXX G;  1B76 A;  1OXX K;  4X62 L;  1QZG A;  4DR2 L;  2CWP A;  3EN2 A;  3PO3 G;  4DR7 Q;  4DR5 L;  1NMG A;  1EWI A;  2DTH A;  3K7A H;  3PF5 A;  1NJ2 A;  3B6Y A;  4DR3 L;  1KIX A;  2YV5 A;  1YHA A;  4XU2 A;  4O0A A;  2Y0S G;  4DV4 L;  2CCZ A;  4WI1 A;  4GKK Q;  5JEA G;  1YFT A;  2N49 A;  4B3R Q;  4LFA Q;  4L5Q A;  4G84 A;  3CC2 A;  1SLJ A;  3HXW A;  2QA4 A;  1IBL Q;  5IWA L;  4R4C A;  1OXT A;  4A3D G;  3TEH A;  3G48 A;  1EOV A;  4AH6 A;  4LF8 Q;  4HJ9 A;  3PUV A;  2J3L A;  3EIV A;  2I4M A;  3A5U A;  4GLA C;  2Q2I A;  1GM5 A;  5M5W H;  2OQK A;  4KHZ A;  2VS1 A;  2ZR2 A;  4UP7 A;  4DV6 Q;  2E64 A;  3KJP A;  1I5F A;  2YTX A;  5H1S E;  3NEN A;  2UU9 L;  1LTL A;  3JC6 6;  4HJA A;  1VCI A;  5DLQ E;  2IX1 A;  2UXD Q;  2CIM A;  3S1Q H;  2V1C C;  2JJQ A;  5IYC G;  1Z9F A;  2IT1 A;  1CKM A;  1YB3 A;  3V7S A;  1XTD A;  2UUA Q;  3UDX A;  1D7Q A;  3LSQ A;  4YRS A;  1KRT A;  1HC7 A;  3CCS A;  4XTW A;  4CH3 A;  2C7I A;  3AQQ A;  1RIQ A;  2ZR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...