3I7FA

Aspartyl trna synthetase from entamoeba histolytica
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
535
structure length
485
Chain Sequence
b'QLPPVVLLKTPELVSGENFKVMPMHQSQPCYKTGLKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKEFVQFCQKISAESICDITGIVKAVEKPIEKATQQDVEIHVTSIAVVSLAEYPLPMQIEDLTFPSSVFKKQEEDIAKVKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHLTEFEGLDIEMEIVENYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartyl-tRNA synthetase
publication title Crystal structure of the aspartyl-tRNA synthetase from Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Ligase
total genus 129
structure length 485
sequence length 535
chains with identical sequence B
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i7fA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3i7fA02
4EQ5A 4LF9Q 5C3EG 2DTIA 2H5XA 3KJOA 4NXNL 1VQJA 4DV6L 3T1HQ 2F4VL 1VQKA 3PZCA 1N9WA 4IPCA 4G84A 1FYFA 2AKWA 3IALA 2UXCL 4B3RQ 4DKAC 4YREA 5LMUL 1SFOH 3ICEA 3Q8DA 2EIFA 1JJCB 4JI1L 1E1OA 4JOIC 4P3PA 3HOUH 3RLOA 1K9MC 4Q6GA 3TQYA 1EWIA 2BH8A 4K0KL 2ZIMA 2GN5A 1NTGA 2N49A 2UXDL 1SMXA 4GOPB 3UFGA 2IHFA 4H2TA 4OXPA 2QHSA 3WWVA 4E51A 1KQSA 4CH3A 3PF5A 3I4MH 3HRKA 2ZIOA 4LF5Q 3CAMA 5IYBH 3HOZG 2IX1A 1GKHA 4A76A 2JA8G 3F1ZA 5C0XG 4JYAL 1GVPA 5BR8L 3S24A 4A3CG 4DR4L 1VQZA 2ZT5A 2NZOA 3HKZE 1WNLA 1Q81C 3T1YL 4DK6C 4IO9A 4OO1G 2ZTGA 1VQHA 3NELA 4GKKL 2IHEA 4UP9A 3VQYA 3HRIA 3A7AA 1N33Q 3U50C 4KLKA 2UUAQ 3EBEA 4GS3A 4CH4A 1IL2A 3PSIA 1PH3A 1H4SA 2KHJA 1VQDA 2CKZB 3DSQA 2AHOB 4LUZA 1Z7NA 4P72A 1PH9A 3S1NH 2R6GA 4HWSA 3IKLA 4HWOA 3PUVA 2XTIA 4JI8Q 2R93G 2GVBA 4X5OA 2CFMA 2ZT6A 4B3TQ 1Q46A 2VUMG 3TS0A 2PMFA 1EOVA 2PI2A 3KDFB 2JA6G 2ZJRA 1ASYA 1E3PA 4YPFA 2ARTA 2GVAA 4YDQA 1TWAH 2DQ3A 2OWOA 1A62A 5M3FH 3CCQA 1KIXA 3J81i 3CW2C 5J3BA 2RCNA 4GLAC 3CC2A 2YYZA 4IOCA 4BWAA 4YRPA 3KF8B 4DR1Q 4YYEA 3PIOA 1NJ1A 3J81c 3CQZH 4X6AH 2CGHA 1Q86C 2C8MA 4PG3A 4LFBL 5FLMH 4A3FG 4H2YA 1KOGA 2DVEA 4ZTZB 3IG2A 1VS0A 2CQOA 2VL6A 3RN5A 4DV1L 3V7SA 3ZJYC 1J5WA 2WB1G 2Z0SA 1XMOL 3F8TA 3F2CA 3E9IA 3CCEA 2WP8J 4LUVA 3RIRA 4ME3A 2ASBA 2DZ9A 4OONA 4GKKQ 3QTCA 2HT1A 1PYBA 3OD1A 3B6YA 1EIYA 1I3QH 4H2WA 2ALYA 1QZGA 3GTPH 2EAYA 4DUZL 1NJ2A 4HIKA 1OTCA 4LF8L 4IPDA 2B63G 2ZJPA 4HWTA 1ADJA 3CMEA 4BW9A 1B76A 3HOZH 3P8YA 4QGUA 2DQ0A 4XEMA 1VQ7A 4IJLA 1YJNA 2JA8H 3HOWH 4PZ6A 3GTOH 2UUCQ 4YWMA 3IRBA 4XTZA 3CCRA 3HFVA 1NY4A 2VQFQ 2AMCA 3MEYA 3REUA 4J15A 1Y1VG 3I4NG 1MJEA 4AQYL 3F2DA 4X66Q 2E10A 5E3IA 3PO3H 4A4IA 3KLWA 4DV5L 1SRYA 1QF6A 3J7ZC 2ZZGA 1WU7A 2R92H 3MEFA 4H2XB 4H02A 2UUBL 2E5AA 4DR5L 3I56A 2KHIA 3BJUA 3TEHB 2ZM6L 1NJIC 2HIVA 1FGUA 1V9PA 2DZCA 2HQLA 1EQQA 3S2HH 1MJCA 3PCOB 1IBML 2VUMH 1L1OB 3P8TA 1YVCA 2CIMA 2JA6H 1YITA 2DXUA 4XU0A 1J5EL 1E7ZA 3H3VH 3HKZG 4H2UA 1RIQA 3PF4A 4DV4Q 1TWCH 4HJAA 3V8JA 3IKMB 4P3NA 1XMQQ 1KMMA 1AE2A 4WI1A 4YRFA 5C44G 1PH7A 4YHHL 2CWAA 2Y0SE 5HY6A 3CCJA 4PZ8A 4QY7A 5LMNW 4XTVA 4OP0A 3QO8A 5K36G 3L2PA 4NB3A 4AH6A 2YV5A 4P73A 1S3OA 5C4JH 3M4OH 4A3MH 1G291 2ZT8A 1I94Q 4YRQA 3F2BA 4A3FH 3CCLA 4P74C 4LF9L 1IBLQ 1K0RA 3L4GB 1VQGA 1YHAA 1XNRQ 3S1QH 4IPHA 2XGTA 5C4XG 3T1HL 3J7A5 3A32A 5IT9c 4JV5Q 2CJBA 4LNQA 4P71A 1EUJA 4MTNA 12ASA 1PH8A 1WYDA 1B7YA 3AFQA 1I6HH 3TEGA 3UH0A 4IFDG 4B3SQ 4TQUS 1CUKA 3I4MG 1USYA 2K5VA 4B3RL 5IYBG 3HOVH 1X01A 4PZ7A 3A0JA 4GLVB 4GLXA 4YRCA 3L1AA 1BBUA 4C3IH 2BA1A 1E1TA 2IY5A 2MQHA 4GKJQ 3A5ZB 1BBWA 1X55A 2B63H 4OWXB 4JI6Q 4XIGS 1D7QA 4Y7NH 3FKIG 3M9BA 1IXRA 2N3SA 3GTGH 2K14A 3RZOH 4DPGA 4BY7H 1Z47A 3L2ZA 4AYBG 2VS1A 1M90C 1X2GA 3A5UA 2EJFA 1RIPA 2ARUA 4LF5L 4G85A 1QUQB 3CMQA 1SN8A 4XU2A 1HXDA 2E2IH 2ZXFA 4PMWA 1IYJB 1VQ8A 4YRRA 5E7NA 2RHQB 1YGBA 3UDGA 5AJ3Q 2ZZEA 5C51B 2IX0A 4TVWA 2ID0A 3OYYA 2ODRC 1VQAA 3G6EA 3ULLA 1PH4A 1XJVA 1N33L 1YI2A 2UUAL 5ELNA 2OTJA 1CKOA 4X62Q 5F5WA 1X3FA 3PUZA 3I55A 1NJ8A 5IWAQ 4JI8L 1SLJA 3RR5A 1IBKQ 1HNZQ 1C7YA 4DR2Q 5FLMG 4JG2A 1WI5A 1FJGQ 5C44H 3W5OA 4B3TL 3NBHB 4CS4A 2Q2IA 3LGJA 1Y1WH 4TWAA 4Q15A 1CKNB 3PUYA 3I4OA 4KHZA 1KMNA 4K87A 1UWVA 3E9HA 2PQAB 4KR2A 4POGA 2QHVA 1X3EA 4H2VA 3HXWA 5FJ8G 3GTQH 2VQEQ 4DV7Q 5C4XH 4P75C 3UE0A 4DR1L 1K83H 3S16H 3JAMi 4GOPC 4XU3A 3G1ZA 1P16A 5K1XA 4YRJA 2BA0A 3KF6A 4JI5Q 1EVLA 3QO5A 4A3JH 4A3IG 1W66A 1MIUA 2NVXH 4X64Q 3STBD 3JAMc 1HR0Q 1NYQA 4P3OA 1XNQQ 2I4NA 2Y0SG 3HOWG 1Q12A 2E5LQ 4P73C 4KHPQ 2E2HH 1PV4A 3L0OA 3FKIH 3TREA 4GNXA 3UDFA 3PO3G 3LC0A 2KCMA 3HXYA 2HIXA 2Z6KA 3ULPA 2MO1A 4YCWA 5JEAJ 1E22A 3LSSA 2A8VA 2R92G 1HC7A 4RQFA 4P71C 3EFSA 3I7FA 1WLEA 3KJPA 3HY1A 4FDBA 4QIWE 2RF4A 1YFSA 1PYSA 4UP7A 1USYC 1V43A 2UXBQ 2QHUA 1HNXQ 1GO3E 2N8NA 4LF6Q 5GROA 3HFZA 4P74A 2RHSA 2UUCL 5KNNA 3ERSX 3RGLA 1H95A 2VQFL 1A8VA 1B70B 4YROA 4TVAB 2DGYA 4OX9Q 4NPSA 4X66L 3CP0A 1SR3A 1LTLA 1JE5A 4DV3Q 3S15H 3MF1A 2DU7A 4L5RC 2G4CA 1CKMA 5IYDG 2VW9A 1K73C 3S2DH 4UY8C 5JJIA 2WAQE 2LXJA 1G5HA 1VQMA 1TWFH 4POFA 4YRLA 1BVSA 4A3MG 3VQWA 1AH9A 3CPWA 3K81C 4JI7Q 4XU1A 1Z7MA 5GAGC 4YRSA 3CCMA 2ZINA 4HWPA 1OXUA 3U58A 1W2BA 4RG1A 2NZHA 4KI0A 4MNOA 2Q7EA 1ADYA 1KRSA 2OCEA 4X65Q 1X9NA 4DV4L 2ARSA 3VBBA 3EFRA 4DR3Q 3UGTA 2JA7G 3W1BA 3FP9A 1XMQL 2I4OA 4A3GH 2F52A 5JJLA 4OLFA 5FJ8H 2PMEA 3DM3A 4XTYA 3HOVG 1EIFA 5HGQA 4BBSG 3K8AA 2CJ9A 1WOCA 1YHBA 3PIPA 1I94L 1D8LA 5IY0A 3AEVA 2JQOA 4LNSA 4A3IH 1YHQA 1QZHA 2OTLA 3RZDH 1IBLL 3G71A 2NVYH 4JI2Q 2NN6I 1XNRL 4BY7G 3BFMA 4R4TA 2AKWB 2K52A 1N34Q 4OO1I 3J80i 4JV5L 2DXTA 1X6OA 4AIMA 3CCSA 1N8RC 4HIDA 2I0QA 4B3SL 3TS2A 3I2ZA 3J80c 2DUDA 2KCTA 1B8AA 5DLQE 3S17H 3HTZA 3M3YH 1X56A 3V7CA 4GKJL 1H4TA 3BU2A 1RL2A 2PNHA 3ERRA 1BKBA 3SGIA 1NNHA 4JI6L 3CCUA 3V8LA 3HXXA 1NYRA 1TWHH 1JJCA 1VQ5A 4LF7Q 5LMNQ 1L1OC 2ZR2A 5M5YH 2I5MX 4OWTB 2JJQA 2PMZE 2UU9Q 3RUXA 1NBWA 3BZCA 1PH5A 2BH2A 2ZTEA 1KC8C 4GNXC 2E8GA 4P75A 2D62A 3K7AH 2K75A 2E65A 4GOPA 3M7NA 4BY1G 2Z6KC 3G4SA 3W3SA 1QVCA 1VCIA 3GTMH 5IYDH 3QNEA 4TQFA 1AE3A 1K3RA 4HA8A 1Q8KA 2Q2HA 4YCUA 1SESA 2F3IA 1OXSC 1PVOA 1KHIA 1HZBA 3A31A 3HXZA 4TQDA 3ICAA 5AJ3L 1Y1WG 1PHJA 2OQKA 2P5IA 1G6PA 1CSPA 2ZGWA 3L7ZC 1EQRA 4A3BH 4HJ9A 1HJPA 2QA4A 5C0XJ 3GTJH 4DQ2A 3VQXA 1SRUA 3MF2A 5M3MG 4X62L 1SETA 4A75A 2A1AA 3HXVA 3KYHC 4DV0Q 5IWAL 1HNZL 1IBKL 4R4QA 4DR2L 1FVIA 2JA7H 1C9OA 3HKSA 2HHHQ 4BA1I 4A3JG 2R7DA 1YEZA 5GAHC 1QVGA 1FJGL 4C2MH 3A7RA 5H1SE 1PA6A 2ZTDA 4EO4A 4BBSH 3PUWA 3W1GA 3CPFA 4YY3Q 2A19A 4RQEA 4QJFA 1GGMA 3KDFA 1UE1A 4A3EH 1I50H 4GN4B 1WCMG 4TTVA 1YFTA 2MO0A 4YWKA 4YWLA 1Q1EA 4LF4Q 1Q7YC 5ELOA 3A74A 3UE1A 3M85A 3AFPA 1O7IA 2VQEL 4DV7L 2DJZA 4K88A 1XPOA 1QVFA 3BZKA 4L5QA 3RL6A 4JCVE 1NJ5A 3M4PA 2JE6I 4JI5L 2HNIA 3PUXA 2K4KA 2I5LX 4DUYQ 4JBKA 3M4QA 4X64L 2I5HA 5GADC 5FLXc 3RF1A 1X65A 1HR0L 2ZNIA 4DV2Q 1VQPA 1XNQL 1N32Q 4YRIA 2E5LL 4KHPL 1VQOA 4XTUA 3GO5A 1HH2P 1EIYB 2ALYB 4YRNA 1NMGA 4CH5A 1VQ4A 5GAEC 2KBNA 4YRKA 4JI3Q 2MFIA 2ZNJA 2FXQA 2KENA 4LFAQ 5IYCH 2C35B 4CS2A 3RKXA 3R07A 4QQBX 4QL5A 1R9TH 3U4ZA 1JJGA 3UDXA 1DGSA 4BY1H 1TWGH 2AMCB 2UXBL 3D0FA 1Q82C 1HNXL 3RN2A 1KL9A 2R7FA 3K80C 1L0WA 4DR6Q 3HOXG 4LF6L 1C0AA 4K86A 4HIMA 4DAMA 4YP0A 3TUPA 1HZAA 3A7UA 4PHCA 4DK3C 1HNWL 4XTXA 4OX9L 2Q5HA 3D31A 2LXKA 3OW2A 5JJKA 3H15A 3FJPA 2K5HA 4DV3L 1ATIA 4IOAA 4HIOA 3CC7A 4A3DH 3CXCA 4DAYB 1Z9FA 5M3MH 5M5WH 2CJAA 1CSQA 2DTHA 4A3GG 3AQQA 2VY3A 3EIVA 2EXDA 1PH1A 4A93G 3V7RA 4KQEA 4JI0Q 1VQIA 4H2SA 4C3HH 4LFCQ 3PO2H 3LSQA 4IFDI 1G5IA 4DR7Q 1UE5A 3VQVA 4H2XA 4HJ7A 2DDZA 4JI7L 3MXNB 3TEHA 3NETA 5IP7H 2E1HA 2ZT7A 4MZ9A 4HWRA 4NXMQ 1BIBA 3PCOA 1M1KC 1L1OA 4B3MQ 4BA2I 3EN2A 4X65L 1H4QA 2YTYA 4BBRH 1WCMH 4EX5A 4GN3B 1YZ6A 4DR3L 2AWOA 1A63A 2JA5H 2K50A 4LWCA 2N78A 2NN6G 1PFSA 1GD7A 1X2HA 1NE3A 3H0GG 3OTOQ 4A3KG 1XPUA 1N36Q 4O2DA 1T9HA 2PI2E 3E0EA 4ZTUB 4A3LH 4R4CA 3DLLA 2CCZA 4NXNQ 4JI2L 2DTOA 4DV6Q 1HR0W 5IE8A 1B7YB 1A0IA 2F4VQ 2JK8A 1S40A 3L4GA 2EL9A 1N34L 4L5SA 4RMFA 1HNWQ 4WJ3M 5IP9G 4Y52H 2D0PA 2B29A 3UDIA 4BXXH 2UXCQ 1W3SA 2IY5B 1SE8A 1WFQA 1HZCA 1WPYA 1UE7A 1K8AC 3HOYH 2L15A 1KRTA 2Q7GA 5LMUQ 3VDYA 1LM0A 3NENA 3RNUA 1VQ6A 4YRGA 4HVCA 4R4OA 4JI1Q 2IT1A 4GN5A 2QEXA 4XTWA 2J3MA 4O0AA 1XPRA 1YB3A 5C3EH 5GQOA 4IPGA 4IFDJ 3A5ZA 3HOXH 4LF7L 5LMNL 4K0KQ 4A3BG 2UXDQ 4JI4L 3RACA 3CMAA 1YJWA 1Q1BA 2UU9L 2ZZFA 4DNIA 2K5NA 3PV0A 4YCVA 4WJ4A 4TVYA 3KOJA 2ZJQA 4RDXA 4JYAQ 4XEOA 1U5KA 3G48A 5BR8Q 4DR4Q 1H4VB 4AYBE 4A93H 1JB7A 1QUQA 1XTDA 3T1YQ 1VQ9A 5M5XH 1P8LA 2C7IA 1FL0A 2YU9H 1YFRA 4JC0A 2EWNA 4A3EG 2RHQA 4HJ5A 1JT8A 3CD6A 5C0XI 3U4VA 1GM5A 1YBYA 2Q2UA 3FHWA 4OWWB 3STBC 4ALPA 3NEMA 1X3GA 1KD1C 1LYLA 3CCVA 2WFWA 2R7ZG 4DV0L 2DEQA 1V1QA 4L5TA 2D0OA 1UE6A 1WQWA 2V1CC 1JMCA 1KXLA 2HHHL 3J81j 1PH2A 4A3CH 2Q7HA 4JBMA 2FYKA 4WF2A 3H0GH 2Q2TA 4A3KH 1J6QA 4YY3L 3JC66 5EAYA 2NVQH 1YJ9A 1Y14B 1NMFA 5C53B 2OQ0A 2I4LA 1VQBA 1CKNA 2QGQA 3KF6B 4LF4L 2E41A 4JI4Q 3H3VI 2PQAA 4NCXA 3KFUA 3CC4A 2P0LA 2JEAI 2E2JH 3S14H 2ODRD 5IYCG 2R93H 2CWPA 1VQCA 2ZR3A 1G51A 4LFBQ 5IP9H 2QHTA 2EQSA 4JOIA 4CS3A 3PGZA 3P8VA 4HJ8A 4DUYL 4DV1Q 2E3CA 5JEAG 1VQFA 4DV2L 3UGQA 1X54A 1N32L 1XMOQ 1EFWA 4GNXB 4ZIBA 4UP8A 2J3LA 2B3GA 3GD7A 2VZAA 3S1RH 2LSSA 2ZTCA 3QO7A 4P72C 4A3DG 4JI3L 1PYSB 2AWNA 4LFAL 1I5FA 4DUZQ 3S1MH 4YRTA 4LF8Q 1OXVA 2EJGA 1L2FA 1SROA 1ASZA 2Q5IA 3HFZB 4C3JH 1OXTA 2RHSB 1S72A 2NVTH 1OXXK 1U0LA 3HOUG 3PO2G 4YRMA 2VNUD 1E24A 3K7UC 1EYGA 4JBWA 4DR6L 2JA9A 1TXYA 5IP7G 3RKYA 1KAWA 1UEBA 2WAQG 4AQYQ 4IJHA 4DV5Q 2YTXA 1IZ6A 4CH6A 1B70A 1YNXA 4L87A 1EVKA 3V8KA 1WJJA 4TVAA 1SERA 4BBRG 4JBJA 1QE0A 2ES2A 2EJ9A 1JJ2A 2JA5G 3RLNA 3ULJA 3K0XA 3RLFA 1HZ9A 2UUBQ 2ZCEA 4DR5Q 4JI0L 2R7ZH 5C52B 1WQ7A 2ZM6Q 4LFCL 1VQLA 4LUOA 1YIJA 3GTLH 4DR7L 4LW1A 1VQNA 3TRZA 3HY0A 4R1JA 1IBMQ 2DU5A 2MNAA 4A3LG 2DKGA 3GDEA 4APVA 1J5EQ 3CF5A 4NXML 2JEBI 1MKHA 1Y1VH 2E64A 2YTVA 3GTKH 3REXA 4B3ML 3I4NH 2ATWA 11ASA 2I4MA 3HXUA 4UPAA 4R4IA 1LUZA 4YHHQ 4BXXG 2WB1E 3ER0A 3HOYG 5K1PA 3RKWA 1K8GA 3A5YA 1HTTA 3OTOL 3WQZA 1PH6A 3AYHB 1N36L 1NJ6A 1VQEA 4XTCS 4KR3A 1BIAA 5M3FG
chains in the Genus database with same CATH superfamily
1FYCA 5CR3A 3C2PA 4EQ5A 2EXZA 4Z9CB 1EU3A 4LF9Q 2B2VA 5C3EG 2DTIA 2H5XA 3KJOA 4NXNL 4I7ZC 1VQJA 2EJMA 1JOQA 3HRZC 4DV6L 3QJYA 3T1HQ 4N9TA 2F4VL 4NW2A 2K5QA 3D4DA 1VQKA 3SEBA 4JVZA 3PZCA 1N9WA 1BBXC 4IPCA 3NSWA 4G84A 1FYFA 2AKWA 1DOMA 3S15B 5D3IB 5IGFA 3IALA 1JCKB 2UXCL 4B3RQ 4DKAC 3KUPA 1CQFA 3NBIA 5JVG3 1A2UA 2SDFA 1PZID 5K36H 3S2DB 2Q8TA 4YREA 5LMUL 1SFOH 3ICEA 1ZEQX 3Q8DA 1UNSA 2B2YC 4K2LA 1MGSA 2EIFA 1JJCB 3HG9A 1DZ1A 2D2CC 4JI1L 1TWFB 4HCEA 1E1OA 5D14A 4JOIC 2KECA 2L12A 4P3PA 3HOUH 3RLOA 3BZDB 2WKDA 1K9MC 5JVH3 4Q6GA 3AB9A 1LV9A 4HCSA 4FF4A 3HOXB 3TQYA 1LT4D 1FR3A 1EWIA 1Q3LA 3TP6A 1PYWD 1E0BA 2BH8A 2F0HA 5BN3A 1AZPA 4K0KL 4RGMA 2GN5A 2ZIMA 2L55A 1NTGA 1PFBA 2N49A 2UXDL 1SMXA 4GOPB 3UFGA 2IHFA 4H2TA 1SNCA 4OXPA 1QB5D 5BN5A 2QHSA 1QILA 2KCCA 3WWVA 4NKLA 4E51A 1KQSA 4CH3A 5LL6S 4IFDH 1QWYA 3GV3A 3K6OA 2A6EC 3PF5A 3I4MH 3HRKA 4LVKA 2ZIOA 4LF5Q 3CAMA 5IYBH 3HOZG 2IX1A 1GKHA 4I65A 4A76A 4A3GB 2JA8G 3F1ZA 5C0XG 1EFID 2L1BA 4JYAL 2MP1A 1GVPA 5BR8L 1W6KA 3S24A 4A3CG 3RD4A 1F9PA 4DR4L 2F3WA 5CYUA 1VQZA 2ZT5A 2CHBD 3DUZA 2NZOA 3HKZE 4FXKC 5JOBA 1WNLA 2NTTA 1Q81C 1A15A 4BS9A 2NUCA 3T1YL 2YU9B 4DK6C 3OIQA 4RGNA 2PYKA 4IO9A 4OO1G 2ZTGA 1VQHA 5EPLA 1GHJA 3NELA 1A3VA 4GKKL 2IHEA 4UP9A 3VQYA 3HRIA 2CW0D 3A7AA 1N33Q 1CHPD 3U50C 2L0CA 4FVMA 1DOLA 4KLKA 3RZDB 2UUAQ 3EBEA 2O4XA 1IL8A 4GS3A 4CH4A 2NVYB 1IL2A 3OOCA 3PSIA 2L4NA 1ZXTA 1PH3A 2L9HA 1H4SA 5FKAC 2KHJA 1VQDA 2CKZB 4ZKCB 3DSQA 2AHOB 4LUZA 2B2WA 1EEFD 3SK6A 1Z7NA 1SE2A 2D9UA 4P72A 1K0SA 1J8IA 1PH9A 3D8GA 1F9SA 4CHTB 3S1NH 2R6GA 4HWSA 3IKLA 4HWOA 3PUVA 2XTIA 4JI8Q 3I70A 2GVBA 3VR4A 2R93G 3J7YW 4X5OA 1HRJA 1I6VC 2CFMA 1DYQA 4MTKA 2ZT6A 4B3TQ 1BQQT 4CKBA 1Q46A 2VUMG 2RQXA 1ILQA 3TS0A 2PMFA 1EOVA 2PI2A 3KDFB 2JA6G 3MFGA 5F2DA 3U9SA 2ZJRA 1ASYA 4A3KB 3S17B 3M3YB 1E3PA 4IUNA 1GUTA 4YPFA 2ARTA 3PIO3 1H9KA 3BVGA 2GVAA 3K59A 4YDQA 1TWAH 1NSNS 4XYQA 2DQ3A 2OWOA 3T13A 3A56A 1R4PB 2TMPA 3IL8A 1A62A 4ID6A 1SJHD 5M3FH 3NQIA 3CCQA 2SEBD 4HR7B 3J81i 1KIXA 1PRTC 3RMHA 3CW2C 1TWHB 3MWYW 5J3BA 2DNEA 2RCNA 4IUTA 3OIPA 5CC4A 4GLAC 3X3NA 2RVLA 3CC2A 2YYZA 3VR6A 4IOCA 4BWAA 3EA6A 4E6IA 4YRPA 4C1NI 3KF8B 5M5YB 4DR1Q 4YYEA 3PIOA 2WACA 1NJ1A 3J81c 2H4OA 4KTAA 3V96A 1JORA 3CQZH 3L9AX 4PMCA 1CZWA 4X6AH 2CGHA 1Q86C 3BVZA 2QILA 4BWGB 1D5ZC 2C8MA 4PG3A 4LFBL 3K7AB 5FLMH 4A3FG 2NYZD 4H2YA 4C3JG 1KOGA 2DVEA 3MXPA 1RODA 3IG2A 4ZTZB 1VS0A 3V05A 1WTRA 2QF7A 2CQOA 2Z4HA 2VL6A 3RN5A 3GTMB 1XYIA 4DV1L 2KHSA 2F0IA 4X3UA 3V7SA 3ZJYC 2WB1G 1J5WA 2Z0SA 3CHBD 1TY2A 4JW0A 2HDMA 1XMOL 3F8TA 1O7YA 3F2CA 3E9IA 3CCEA 2WP8J 4LUVA 3RIRA 1FNWA 4ME3A 3PIP3 2ASBA 1STNA 2DZ9A 4OONA 1QNKA 4GKKQ 3QTCA 2HT1A 1PYBA 3OD1A 4A3BB 5ELEA 2M9VA 3B6YA 2G9HD 2PZUA 1EIYA 3GTJB 5KNBA 1I3QH 4H2WA 1TKWB 2ALYA 1X3QA 1F9RA 2PO4A 1QZGA 4KD3A 3GTPH 5ELFA 3OMGA 1U4RA 4HSPA 2EAYA 4DUZL 2CH4A 1NJ2A 4TKOB 4HIKA 5KYLA 1OTCA 4LF8L 4ZQ3A 4IPDA 1SYGA 1Y8PB 2B63G 2ZJPA 4HWTA 3VR2A 1VMCA 3KBXA 3CMEA 1ADJA 4BW9A 1B76A 3HOZH 3M4YA 2JA7B 3P8YA 4QGUA 2B2TA 2DQ0A 1VQ7A 4XEMA 4IJLA 1YJNA 2JA8H 5C0XH 3HOWH 4PZ6A 4C2MB 3GTOH 2UUCQ 4YWMA 3IRBA 3I4LA 4XTZA 3CRKC 3CCRA 1ET9A 1Q90A 1GUOA 3HFVA 1NY4A 1SNMA 2VQFQ 2AMCA 3MEYA 3REUA 4J15A 1SYBA 1G2SA 2EYJA 1Y1VG 4YIJA 4L6TB 2DN8A 1SMYC 3I4NG 3NQTA 4AQYL 4A3EB 1MJEA 4K8JA 3F2DA 4X66Q 2E10A 5E3IA 3PO3H 1I50B 1XWEA 4A4IA 3KLWA 4DV5L 1RTNA 3SK5A 3F2UA 2K05A 1SRYA 1B3AA 1STYA 1QF6A 4RCOA 3TP7A 3J7ZC 2ZZGA 1WU7A 5CORA 2R92H 5A2QL 2QW7A 1BOSA 3MEFA 4H2XB 4H02A 3WOEA 1BCPC 2R7ZB 1CTMA 2UUBL 3NWSA 2WINB 4DR5L 2E5AA 4XYOA 3I56A 2KHIA 3BJUA 1CM9A 4TRDA 1EYDA 3TEHB 2ZM6L 4DAYA 2EZVA 1NJIC 4X3SA 2HIVA 1FGUA 4CDCC 2EYOA 1V9PA 4KY5A 2DZCA 1A3UA 1IHZA 2F0MA 2HQLA 1EQQA 3S2HH 1MJCA 1KDBA 2CQAA 3PCOB 5ISRA 3E5SA 3MXUA 2D5DA 1O80A 1IBML 2EYLA 1DXMA 2VUMH 1L1OB 3P8TA 1D6EC 1YVCA 2CIMA 2JA6H 1YITA 1A3TA 2DXUA 4XU0A 5COYA 3VR5A 5ELCA 1J5EL 3J81E 1E7ZA 5C5MA 3H3VH 4S3SA 1M4VA 4M8AA 2EYPA 2V4DA 3HKZG 4H2UA 1RIQA 3PF4A 1GUGA 4DV4Q 2A68D 1TWCH 2DJFC 4HJAA 5FOBB 3V8JA 3G6JB 1T5EA 3IKMB 4P3NA 1HFNA 1PTOC 2A8EA 1XMQQ 1KMMA 1AE2A 4WI1A 4YRFA 1STHA 2A6HC 5C44G 1PH7A 3R93A 1HFGA 4YHHL 2CWAA 5CV7A 2Y0SE 2B2WC 5HY6A 4DAVA 3P1HA 3CCJA 4PZ8A 4QY7A 5LMNW 4XTVA 4OP0A 3QO8A 5K36G 3L2PA 2BE5D 4NB3A 4AH6A 3D3RA 2YV5A 1CQVA 1S5CD 4P73A 1S3OA 5C4JH 3M4OH 4A3MH 1G291 2ZT8A 4IURA 1I94Q 1R9TB 4YRQA 1KTKA 2X6GA 4DFAA 1V8QA 3F2BA 4A3FH 3CCLA 2VXWA 3SDZA 4P74C 4BY1B 1TWGB 2HD3A 2LKVA 4LF9L 1IBLQ 1LTRD 1K0RA 1HCZA 2R61A 4Q0FA 3L4GB 1B1ZA 1VQGA 3IKJA 1YHAA 1XNRQ 2EY6A 4DAPA 5D3DA 3TSSA 3S1QH 4IPHA 1SSOA 1F2YA 2XGTA 5EPJA 5TSSA 3EFXD 5C4XG 5DEHA 3T1HL 3J7A5 1BXTA 1RHPA 5G3LF 3A32A 5IT9c 4JV5Q 1STBA 2CJBA 4LNQA 4LMQD 4P71A 1EUJA 1HHVA 1U9RA 4MTNA 4XT1B 4EGVA 1PH8A 12ASA 1WYDA 4QIWB 1B7YA 3AFQA 1I6HH 3A8JE 1H9JA 2DY8A 2Z6BA 2BDOA 3TEGA 3UH0A 4IFDG 3QWNA 4B3SQ 1BUVT 4U673 4TQUS 1CUKA 4EVOA 4FF2A 3I4MG 5DAUA 1JICA 1USYA 2K5VA 4B3RL 5IYBG 4A3DB 2Z9HA 4KD4A 3HOVH 2X69A 1X01A 5M5WB 4PZ7A 3A0JA 4GLVB 4GLXA 1U4MA 4YRCA 4H7BA 3L1AA 1BBUA 4C3IH 1JB3A 2BA1A 1E1TA 4EQOA 2IY5A 2MQHA 1TR5A 1LACA 1B9NA 4GKJQ 4C3HB 3A5ZB 2AQ3B 1BBWA 3TP5A 1CHQD 2WIIB 3Q0AA 2I46A 1X55A 5LHY1 3PO2B 2B63H 4K8IA 4OWXB 4JI6Q 1QJOA 4B08A 4XIGS 3DWAA 4Y7NH 1D7QA 3FKIG 3M9BA 4G7ZC 4FP5D 1IXRA 2N3SA 5IGGA 3GTGH 2K14A 3RZOH 1EY4A 3G7LA 4DPGA 4OHJA 4BY7H 4ILWA 1Z47A 3L2ZA 4G7OC 1XX8A 1FD7D 5EKIA 1Y69U 5NUCA 2AUJD 2WAQB 1PFNA 4AYBG 2HQEA 1LT6D 2VS1A 5E3FA 1KABA 4FO2A 1M90C 4UHVA 1X2GA 4G57A 1G8ZD 3VA5A 2OT2A 3A5UA 2EJFA 1RIPA 2ARUA 4BBRB 5I6WA 2PPBC 4LF5L 4G85A 2PW7A 3NP8A 2R3ZA 2FHTA 1QUQB 4I7AA 5IGBA 3HS0C 2JA5B 3CMQA 1SN8A 4XU2A 4KK7A 1HXDA 2E2IH 2E74C 2ZXFA 4PMWA 3N52A 1IYJB 2XIWA 1WTXA 1KNEA 1VQ8A 1EY0A 4YRRA 2EY2A 5E7NA 2RHQB 3M7GA 1YGBA 2OEOA 3UDGA 1ZYRC 5AJ3Q 2ZZEA 5C51B 1TT2A 3TMEA 2IX0A 4TVWA 2ID0A 2EY1A 3OYYA 5JPNC 2B2TC 1V1PA 2ODRC 5I2YA 1VQAA 5FLXL 3G6EA 1WD1A 3ULLA 1PH4A 1XJVA 1N33L 1C8CA 1FGBD 4ZRZA 1YI2A 2UUAL 3OW7A 5ELNA 5C5LA 2OTJA 1CKOA 4X62Q 1G91A 5F5WA 1I4RA 4ODGA 1X3FA 2SNMA 3PUZA 3BYTB 1WTPA 1PRTD 3OWEB 3I55A 1NJ8A 3URYA 1GUSA 5IWAQ 4U68A 3I8ZA 4JI8L 1SLJA 3RR5A 4DNRB 3SHLA 1IBKQ 1HNZQ 1C7YA 4DR2Q 4DK1A 4HAEA 1XXGA 5FLMG 4HEDA 4JG2A 1WI5A 1FJGQ 1K3BC 5C44H 3W5OA 4B3TL 1EWHA 3HOYB 1EY9A 3HGBA 2BDNA 1MD2D 3NBHB 5IT9E 4CS4A 1QG7A 2K28A 2Q2IA 3LGJA 1Y1WH 4C56C 1ZKOA 3IFDA 5M3FB 3T4AC 4TWAA 4Q15A 1O7ZA 5DM63 4LVLA 2NWGA 1CKNB 3PUYA 1KNAA 3I4OA 5C3EB 1Z7TA 4KHZA 2F0TA 3SK4A 1KMNA 4IALA 1UWVA 4TSSA 3W2DA 3E9HA 3GV6A 4K87A 1KAAA 2PQAB 4KKTA 4KR2A 3FDTA 4POGA 5HGTA 2QHVA 3P20A 1X3EA 4F8MA 4H2VA 3HXWA 3P7JA 5FJ8G 3GTQH 3ITPA 2VQEQ 4DV7Q 2H1EA 1SYDA 5C4XH 4P75C 3UE0A 4EQPA 4DR1L 1E2WA 1K83H 3S16H 1UAPA 3JAMi 4GOPC 1HA5A 4XU3A 1GOZA 1LLRD 3J7AV 3G1ZA 1P16A 2Q8IB 5K1XA 4YRJA 1I4GA 2BA0A 1AP0A 3KF6A 3K57A 2J4XA 4JI5Q 5EKKA 1HA6A 1EVLA 5A35A 1Z6HA 3QO5A 4A3JH 2XRSD 2LS01 3DEOA 1MIUA 4A3IG 1W66A 1EQTA 2ICIA 3D4RA 2RDHA 3R2IA 5J22A 3K5LA 2NVXH 2IW3A 1JE4A 3QO2A 4X64Q 1BF4A 2ZT9C 4XDXA 3STBD 3JAMc 2PCFB 1SNQA 1HR0Q 1NYQA 4P3OA 1XNQQ 2I4NA 2Y0SG 3HOWG 1Q12A 2E5LQ 1GJXA 3DEPA 4A93B 4P73C 3KLSX 4KHPQ 4F7XA 2E2HH 1RKNA 2PMZB 5M5XB 4K14A 1NR2A 1PV4A 1E2VA 2WV6D 2EYMA 4FF1A 3L0OA 3FKIH 3TREA 2L11A 2XWJB 2B39A 2RA4A 3J7AF 4GNXA 4CBVA 3V2TA 5E4XA 3UDFA 1C4QA 2J0TD 3PO3G 3LC0A 2KCMA 1ENAA 2HIXA 3HXYA 4ZK9B 2Z6KA 1EL0A 1ONLA 3ULPA 2MO1A 4YCWA 3NTKA 5CV8A 5JEAJ 3AU7A 4RCNA 2LY7A 1E22A 3LSSA 2KUMA 2MGSA 2A8VA 2R92G 1HC7A 4RQFA 2HUGA 4P71C 1EYAA 4RA8A 1IW7D 1RTOA 3WOFA 3EFSA 3DHQA 3I7FA 1WLEA 3KJPA 3HY1A 2OF1A 4FDBA 4QIWE 2IL8A 2RF4A 1YFSA 1PYSA 4UP7A 1USYC 1V43A 2UXBQ 1UEAB 2JA8B 2QHUA 1R4QB 1HNXQ 1GO3E 1DM0B 2N8NA 4LF6Q 5GROA 1SYFA 5C3XA 3I3CA 3HFZA 4P74A 2RHSA 4G4KA 2UUCL 1ILPA 5KNNA 4PNYA 4OEMB 1D1KA 1X3PA 3ERSX 3RGLA 1H95A 4CKEA 4IUUA 3H0GB 1O78A 4CJ1B 2VQFL 1A8VA 1Y8NB 1B70B 4YROA 2Z1CA 2HCIA 4IN3A 4TVAB 2DGYA 4OX9Q 4LVJA 2C9OA 3DWQA 2NVQB 2AQ2B 3C46A 1NNXA 2N55A 4NPSA 1HQMC 4X66L 3CP0A 1S5BD 1SR3A 1LTLA 1JE5A 1A2TA 4DV3Q 3S15H 3NXWA 3MF1A 2DU7A 4L5RC 2G4CA 2F0WA 5L37A 1CKMA 4RHRA 4XQNA 5IYDG 1BO0A 2VW9A 1K73C 3S2DH 1B50A 1BNZA 4UY8C 3QIAA 5JJIA 2WAQE 2LXJA 1H9SA 1I4XA 5ELBA 1D5MC 2F03A 1G5HA 1VQMA 2E2JB 3S14B 4J6HA 1TWFH 4POFA 2F0NA 1PTOD 2XVSA 3H3VC 2R93B 1PRTB 2EJFC 4YRLA 2KEDA 1BVSA 4A3MG 3MFYA 3VQWA 1AH9A 3CPWA 3K81C 4JI7Q 4XU1A 4FF3A 1YNJD 1IYVA 1Z7MA 2JA6B 3DWPA 4ME5A 5GAGC 2K03A 4YRSA 1JQYD 3CCMA 4CJ2C 1F2ZA 2ZINA 4HWPA 1OXUA 2F0SA 3U58A 5CGKA 1W2BA 2XRQD 4RG1A 2NZHA 2F0JA 4KI0A 1AEXA 4MNOA 2Q7EA 2EY5A 1ADYA 1KRSA 2OCEA 4X65Q 4K2KA 1TWCB 1PZJD 3TDQA 4L63B 3TZUA 1X9NA 4DV4L 1SNDA 1JR0D 1GXDC 1Q8IA 2ARSA 3S1RB 3HZXA 3VBBA 3HP3A 3EFRA 4DR3Q 3JAME 1YNNC 2JA7G 3UGTA 2ZXPA 3W1BA 1TQOA 3FP9A 1XMQL 2I4OA 5I2XA 4A3GH 2F52A 3J81L 5JJLA 4OLFA 2DJGC 5FJ8H 2PMEA 3DM3A 2JN4A 5DM73 5T1GA 1RDPD 3KLRA 3OMCA 4XTYA 3HOVG 4RFBA 1EIFA 5HGQA 4BBSG 3S1MB 4C3IG 1SDFA 4WRDA 1W6JA 2F0KA 3K8AA 5CMDA 2CJ9A 1WOCA 1YHBA 4V190 4C3JB 3WDNA 3PIPA 1I94L 2NVTB 1S4ZA 1D8LA 5IY0A 2JQOA 3AEVA 4LNSA 3VYRA 1TS3A 4A3IH 1YHQA 1QZHA 4WFN3 1EZ6A 2ICEC 4LJZC 2OTLA 3R8BA 2EDGA 5I6YA 3RZDH 1IBLL 4KKUA 2EE1A 4IZ8A 3G71A 2NVYH 4JI2Q 1F2LA 2NN6I 1AW7A 1XNRL 1CZGA 3I72A 4RHSA 4BY7G 1XTCD 3BFMA 1HQRD 4R4TA 2AKWB 2K52A 1N34Q 4OO1I 1IKLA 1CFMA 3AMUA 3J80i 1TU2B 4JV5L 2DXTA 4DK0A 2LFNA 1X6OA 4AIMA 2I07B 4RKLA 1SE4A 3OPOA 5IGEA 3CCSA 4HIDA 1N8RC 1PLFA 4ULLA 2I0QA 2NBFA 3SR1A 4B3SL 3TS2A 3I2ZA 2CH4W 1TS2A 2FFKB 4HTHA 1B4OA 2FINB 2CW0C 1B44D 3J80c 2LMCB 2DUDA 2KCTA 2K1BA 4CKCA 1B8AA 5DLQE 4RAUC 2K5WA 3S17H 3HTZA 3M3YH 1D1IA 1X56A 2WKCA 4RKBA 5EGTA 2VB3X 3V7CA 4GKJL 1H4TA 3BU2A 1RL2A 3E0JA 2PNHA 3ERRA 1BKBA 3SGIA 1NNHA 4JI6L 3I91A 5KEEA 3GTLB 4QUCA 2O2LD 1U4PA 1BR9A 1H9RA 3CCUA 4O1NA 3HXXA 2PZWA 1NYRA 3V8LA 1LTTD 1TWHH 1AFPA 1JJCA 5C6AA 1VQ5A 4LF7Q 5LMNQ 4R8IA 2F0EA 3C1EA 1BCPB 4N9PA 1L1OC 1JC7A 1OO9B 1ESFA 3RUZA 3MEHA 4DA2A 1SEBD 2ZR2A 5M5YH 1Y1VB 2I5MX 4OWTB 3GTKB 2JJQA 3MVVA 2PMZE 2QCPX 2UU9Q 3I4NB 3RUXA 1NBWA 3BZCA 5FK9C 1PH5A 2ZTEA 2BH2A 3FPUB 2K5DA 1KC8C 4GNXC 2E8GA 4P75A 2D62A 3K7AH 2K75A 2E65A 4GOPA 4ZUJA 1JWMD 1V1OA 3E6ZX 3M7NA 4BY1G 2Z6KC 3SK8A 3G4SA 3W3SA 1QVCA 1VCIA 4KHVA 4C1NK 3GTMH 5IYDH 3QNEA 4TQFA 2F0DA 2TSSA 1AE3A 1J9OA 1K3RA 4HA8A 1Q8KA 2Q2HA 2MUYA 4YCUA 1SESA 2F3IA 3A7AB 1OXSC 1PVOA 1KHIA 1VF5C 1HZBA 3A31A 3HXZA 3KLSA 1Y8OB 3NTIA 4TQDA 1L0XB 3N6RA 5AJ3L 3ICAA 2JSOA 1Y1WG 1PHJA 2X6LA 2OQKA 1PTOB 4K6DA 1NCVA 4IUPA 3LX0A 2P5IA 2CVRA 1G6PA 1CSPA 2ZGWA 3L7ZC 1EQRA 4UAIA 4A3BH 4HJ9A 1HTLD 3W3AA 4ABNA 1HJPA 2QA4A 2KA7A 5C0XJ 3GTJH 2F0OA 4DQ2A 1WTWA 3VQXA 1SRUA 3MF2A 1T5XD 4MN3A 4FXGC 5M3MG 4X62L 1SETA 1KLGD 4A75A 2ZXRA 3NWTA 1NR4A 2A5HA 2A1AA 3HXVA 3KYHC 3Q23A 4DV0Q 4C3HG 1TS4A 3K5MA 5IWAL 1HNZL 1IBKL 2KOLA 1ENCA 4R4QA 4DR2L 1FVIA 3LWUA 2JA7H 1C9OA 3HKSA 5JAVA 2HHHQ 4BA1I 4CGYB 2BOSA 2R7DA 4A3JG 1KDCA 1YEZA 2F0PA 5GAHC 4M1UB 1QVGA 1FJGL 4C2MH 4NDXA 1ICFB 3A7RA 5H1SE 1PA6A 2ZTDA 4EO4A 1MSGA 4QB4A 2C5CA 1SFOB 4BBSH 1TIID 3CU7A 4OGQC 1K28A 3PUWA 3W1GA 3CPFA 3SVMA 4YY3Q 2A6ED 2A19A 4RQEA 1TY0A 4QJFA 1GGMA 3KDFA 1SXTA 2QKIC 2K32A 1UE1A 4A3EH 3HOUB 1I50H 4GN4B 4DF7A 2F1MA 1WCMG 4TTVA 3J80E 1YFTA 1K8OA 1HPCA 5IODA 4K5WA 2MO0A 3QOJA 4YWKA 2RCFA 4YWLA 1Q1EA 5IT9L 4LF4Q 1Q7YC 5ELOA 3A74A 4FYDA 3UE1A 3M85A 3AFPA 1O7IA 2VQEL 4DV7L 2E2DC 2DJZA 4K88A 1XPOA 3R3OA 1QVFA 3BZKA 4L5QA 3RL6A 1EIGA 3ERQA 1K8MA 4JCVE 1IYUA 1NJ5A 3M4PA 2A69C 2JE6I 3KF8A 4JI5L 3I4MB 3PUXA 2HNIA 1DOKA 2K4KA 2I5LX 3BVMA 4DUYQ 4JBKA 3M4QA 4X64L 2I5HA 5GADC 4Q5VA 1MHWC 5CV5A 5FLXc 3RF1A 1X65A 1HR0L 2ZNIA 4H44C 4DV2Q 1VQPA 1XNQL 1N32Q 4YRIA 1PTOF 2E5LL 3QB3A 2GA4B 4LAAA 2KJXA 4H0LC 5J39A 1WVLA 3BDLA 4KHPL 4HMIA 2IWHA 2K33A 1VQOA 4XTUA 3GO5A 1HH2P 3Q24A 1EIYB 3FKIB 4PQXA 3GP7A 2ALYB 2A74C 4KN4C 5EBDA 4YRNA 1NMGA 4CH5A 2JXMB 5JJZA 4CDEC 1VQ4A 5GAEC 4EQNA 2KBNA 5JPMC 1STAA 4YRKA 3MHBA 4QCLA 2RSOA 2Z4IA 4JI3Q 4NMZA 3NE5B 2MFIA 4AYBB 2ZNJA 1BDOA 2FXQA 2KENA 4LFAQ 5IYCH 2C35B 4CS2A 3RKXA 3R07A 3S1NB 4QQBX 2F0QA 4QL5A 1R9TH 3H91A 3U4ZA 1JJGA 3NHHA 3FMCA 3UDXA 1DGSA 4BY1H 1TWGH 2DNCA 2A68C 2AMCB 2O5JC 1LTID 2UXBL 3D0FA 4J1MA 1Q82C 1HNXL 3RN2A 1KL9A 1RD9D 2R7FA 3K80C 1L0WA 5JEAH 3HOXG 2QDLA 3K5NA 4LF6L 4ZAIA 4DR6Q 1C0AA 4K86A 4HIMA 4DAMA 3NTHA 4YP0A 1KDAA 3TUPA 3BYYB 1HZAA 3A7UA 4PHCA 4N8FA 1EOTA 3MQZA 1X32A 4DK3C 1SNPA 1HNWL 4K5XA 1TWAB 2F0UA 4XTXA 2BE5C 3D6CA 2OXPA 4OX9L 2Q5HA 1CI3M 3D31A 2LXKA 3OW2A 5JJKA 3H15A 1SJED 4FNFA 3FJPA 2KQ3A 1PDQA 2K5HA 4KJOA 4DV3L 5EQ0A 4XT3B 3BDCA 1ATIA 4IOAA 4HIOA 2F0VA 3CC7A 4A3DH 3CXCA 4DAYB 1Z9FA 5M3MH 5M5WH 2CJAA 1CSQA 2DTHA 4A3GG 3AQQA 2VY3A 3I90A 1TS5A 3EIVA 4DU9A 1RJTA 2EXDA 1PH1A 2F3VA 4A93G 4KQEA 4JI0Q 3V7RA 1VQIA 2KCNA 4H2SA 3CQZB 4C3HH 2JP1A 4LFCQ 1ICWA 1YNND 1SE3A 4HSVA 3PO2H 2F0FA 3LSQA 2SNSA 4IFDI 1G5IA 4KJNA 4DR7Q 1UE5A 1UUPA 3VQVA 4H2XA 4R9WA 2F0LA 5HURA 4IUVA 4HJ7A 2PNRC 2DDZA 1LTAD 5KNCA 4LVMA 4JI7L 2AQ1B 2VB2X 3MXNB 5ELDA 1G6ZA 3S9WA 2M00A 3TEHA 3NETA 3CKIB 5IP7H 2E1HA 2O5IC 2ZT7A 1EY5A 4MZ9A 4HWRA 1EZ8A 4NXMQ 1BIBA 2FMMA 1STGA 1NUCA 4QUFA 3PCOA 3K58A 3LNNA 2A73B 1M1KC 3OHXC 5T1IA 5EJWA 1L1OA 2MPMA 4B3MQ 4BA2I 3VA7A 3EN2A 4X65L 3EJIA 3EROA 4KMUC 4XQJA 1H4QA 2RDFA 2YTYA 4BBRH 1WCMH 1GHKA 4EX5A 3PMFA 5D65A 4GN3B 1YZ6A 4DR3L 5FLXE 1CK1A 2AWOA 1A63A 3QOLA 1MI2A 4J8QA 4CDFC 2JA5H 5C4HA 3Q6SA 2K50A 1I3QB 4LWCA 1EYCA 3U9OA 2N78A 1WTVA 2EJGC 3VR3A 2NN6G 1PFSA 1GD7A 1NAPA 1X2HA 3T51B 1NE3A 3H0GG 3OTOQ 3GTPB 1SMYD 5KYIA 1EIHA 4A3KG 2HDLA 3ND8A 1XPUA 1N36Q 5EKLA 4O2DA 1T9HA 1RF2D 4A3IB 5G3LD 2PI2E 3JAML 2KVMA 3E0EA 1MBYA 4ZTUB 1M8AA 4A3LH 4R4CA 3HOZB 3L3OC 3DLLA 5IGDA 1E2ZA 2CCZA 1S5ED 4NXNQ 1SYCA 2Y0SB 3GTOB 3HOWB 1BCPD 3K0YA 4IQZA 4JI2L 2DTOA 5IOCA 1EEID 3BG3A 5IE8A 2SOBA 4DV6Q 1HR0W 1B7YB 1A0IA 3CRLC 2F4VQ 3EQLC 2JK8A 3VYSA 4LVIA 1S40A 2NZ1D 4WJWA 1SNOA 1N34L 2EL9A 3L4GA 3UI2A 1B3QA 4L5SA 4RMFA 1HNWQ 4WJ3M 2PQEA 2L5TA 4DXGA 2B8GA 5IP9G 4Y52H 3PO3B 2D0PA 2B29A 2ZXOA 3UDIA 3E3XA 4BXXH 2UXCQ 1W3SA 2IY5B 4KN7C 2EPBA 1SE8A 4JPBW 1WFQA 1HZCA 1WPYA 1UE7A 1K8AC 3HOYH 3GQBA 2L15A 1KRTA 2Q7GA 3MC0B 2R92B 3IFTA 4F88A 5LMUQ 1CA5A 3VDYA 1LM0A 2IX3A 2G5DA 3K5OA 3NENA 3RNUA 1VQ6A 4YRGA 4HVCA 2EVBA 4R4OA 5C3WA 1LT3D 5KNDA 4JI1Q 2IT1A 3T16A 4ZYSA 4GN5A 1QCBD 2QEXA 2J7ZA 2NTSA 4XTWA 2J3MA 4OIKA 4KY6A 1VDZA 4O0AA 4QMGA 3T56B 1XPRA 3S2HB 2DY7A 1JOOA 1YB3A 5C3EH 2A6HD 5GQOA 4HMJA 3Q22A 4IPGA 4IFDJ 1H9MA 1O7LA 3A5ZA 2VUMB 1I4HA 3QR8A 3HOXH 3NPPA 5LMNL 4LF7L 2FMCA 4K0KQ 4A3BG 2Z8LA 2RDGA 1AN8A 2UXDQ 1CT1D 4JI4L 3P75A 3MA2B 3RACA 3OWFA 3CMAA 1YJWA 1Q1BA 1B53A 1WTHA 3TZDA 2UU9L 2B2UA 2ZZFA 4DNIA 2K5NA 4LK1C 3PV0A 3C3LA 2P5ZX 3H6MA 4YCVA 4WJ4A 1LTGD 4OELB 5CV6A 4TVYA 1JWSD 3KOJA 3D4WA 3DM1A 2ZJQA 4RDXA 3SE0A 4JYAQ 4XEOA 1U5KA 3G48A 2N88A 2XN9C 5FO7B 5BR8Q 2KEEA 4DR4Q 1H4VB 4AYBE 3T53B 1V1PB 4A93H 5BN4A 3LWEA 1JB7A 1QUQA 3FPPA 1XTDA 3T1YQ 1LABA 5C4JB 1VQ9A 5M5XH 3H09A 3M4OB 4A3MB 1DONA 1P8LA 5I9PA 2C7IA 1FL0A 2B2VC 4MIUA 2YU9H 4H13C 1YFRA 4A3FB 4JC0A 3MXGA 4ZKBB 2EWNA 4A3EG 2RHQA 1S5DD 4HJ5A 1JT8A 5C4ZA 3CD6A 5C0XI 3U4VA 4PMBA 1C48A 1GM5A 1YBYA 2Q2UA 5IIFA 1F2MA 2WB1B 2E75C 5KGUA 3FHWA 4OWWB 3S1QB 3STBC 4ALPA 3NEMA 1X3GA 2XNAC 1KD1C 1LYLA 2M2LA 4X3KA 2WFWA 3CCVA 1SBBB 2R7ZG 5EBCA 4DV0L 3TP8A 2DEQA 1V1QA 5IGCA 4L5TA 2D0OA 1UE6A 1WQWA 3I73A 2V1CC 4F87A 2BCOA 1I6HB 1JMCA 2MJ8A 2QDBA 5I4DA 3ND9A 2K01A 1KXLA 2HHHL 2B8FA 3J81j 1PH2A 1LTBD 5LL6X 4A3CH 3HOVB 2Q7HA 4JBMA 2NN6H 5AFWA 4BBSB 2FYKA 4WF2A 1EY8A 1LT5D 4C3IB 1PRTF 3H0GH 4OL7A 1KLUD 2A69D 4KV6A 1J6QA 4DXFA 4A3KH 2Q2TA 4OO1H 3C1FA 4YY3L 3JC66 3BS1A 5EAYA 2B63B 3MTSA 3X3MA 2NVQH 2HCCA 3DXJC 1IW7C 2MHVA 1HXYD 3NBHA 4Y7NB 1DD2A 4OIJA 1ET6A 5KRUA 1YJ9A 1Y14B 3TBIB 3GTGB 3RZOB 1NMFA 5C53B 2OQ0A 3NK9A 2I4LA 4L8JA 2IPKD 4BY7B 1PZKD 3QG1A 2PW5A 1VQBA 1EY7A 1CKNA 2QGQA 3KF6B 4LF4L 1ZYRD 4JI4Q 2E41A 3H3VI 2PQAA 1QOHA 3KFUA 4NCXA 5I9OA 3CC4A 1MSHA 2P0LA 2JEAI 2E2JH 3A8IE 3S14H 2ODRD 5IYCG 2R93H 2CWPA 1VQCA 2ZR3A 1G51A 2B2YA 4LFBQ 5EPKA 5IP9H 5E4WC 2F0GA 3J80L 1HTPA 2QHTA 4ZCKA 3TN2A 2EQSA 4JOIA 4CS3A 3PGZA 1B2TA 1HUNA 3P8VA 4HJ8A 4KKSA 3KBGA 4DUYL 3ONAB 1EU4A 1EWCA 4DV1Q 2EOTA 3FEWX 4DGZA 2E2IB 2E3CA 3SXHA 1LO5D 5JEAG 1VQFA 4DV2L 3UGQA 3MXNA 5KIXA 1X54A 1STEA 4RH6A 1N32L 1XMOQ 1EFWA 4GNXB 4ZIBA 4UP8A 4QF4A 3FVQA 2JYOA 2J3LA 3DMUA 1II3A 4RGTA 1A6XA 2G9DA 1L0YB 2FJ2A 2B3GA 2AUKA 1ML0D 1GUWA 3GD7A 2VZAA 3S1RH 1JOKA 2LSSA 3ZYYX 1WD0A 4IUQA 1PFMA 4K6LA 5M9OA 1FNVA 1F9QA 2ZTCA 3QO7A 3VYUA 4P72C 5CV4A 1PXUA 1YNJC 4A3DG 4JI3L 4V0BA 1JWUD 1PYSB 2AWNA 1VMPA 4LFAL 3HKZB 1I5FA 4DUZQ 4N8X1 3S1MH 4YRTA 3NUCA 4LF8Q 1OXVA 2EJGA 1L2FA 2RSNA 1AZQA 5CBAE 1SROA 4RWSC 1QNUA 4CJ0B 1ASZA 2Q5IA 3HFZB 4FXDA 4C3JH 1OXTA 2RHSB 1S72A 2NVTH 1OXXK 1U0LA 3HOUG 3PO2G 2EYHA 3KK7A 2RBMA 4MHEA 2K7VA 4YRMA 2VNUD 2IJ0A 3D6WA 1E24A 5J1ZA 5C44B 3K7UC 1EYGA 4JBWA 1HUMA 4DR6L 2JA9A 1TXYA 1VF7A 5IP7G 1SYEA 2F4IA 1EQVA 2EYFA 2K6AA 5K5PA 3RKYA 1KAWA 5CBEE 4ZUIA 1UEBA 5A2QE 2NS6A 1Y1WB 4ZLTF 2WAQG 3MZ5A 4AQYQ 4B9WA 1B9MA 3EVQA 3BDOA 1BCPF 4IJHA 1GUNA 4DV5Q 2YTXA 1IZ6A 4CH6A 4K5VA 1YNXA 1B70A 4L87A 1EVKA 3V8KA 2XWBB 1WJJA 1H9SB 1RCVD 1SAPA 5CV9A 2RKSA 4TVAA 1SERA 4BBRG 1IKMA 3R2TA 1U4LA 4JBJA 1DCZA 5M3MB 1QE0A 4GZYC 2ES2A 2EJ9A 1JJ2A 3GTQB 2JA5G 3RLNA 3ULJA 4JK1C 3K0XA 3RLFA 1HZ9A 5C4XB 4DNTB 2UUBQ 2B2UC 3A55A 4UDUC 2ZCEA 4DR5Q 1K83B 3S16B 4JI0L 2R7ZH 5DNFA 5C52B 4NP5A 1WQ7A 2ZM6Q 4LFCL 1FNUA 1VQLA 1D2BA 3FRPB 1ESRA 4PV1C 1D5XC 4LUOA 1YIJA 3PQIA 1TVXA 3GTLH 4DR7L 4LW1A 4A3JB 1VQNA 3TRZA 3HY0A 4R1JA 1IBMQ 2DU5A 2MNAA 1LTSD 2NVXB 4CDDC 4HT4A 4A3LG 4O42A 1G2TA 4HN7A 2DKGA 3VYTA 2E76C 3GDEA 2K04A 4APVA 1WTOA 1CA6A 1J5EQ 4P2CB 3O13A 5FO9B 4RGOS 3CF5A 4X3TA 4NXML 1PMRA 2JEBI 1MKHA 1Y1VH 3A8KE 1I4QA 2E64A 2YTVA 2E2HB 3GTKH 3REXA 4B3ML 3I4NH 3HEJA 3OSOA 4G7HC 2ATWA 1S5FD 1F77A 1WCMB 4XXEA 5FO8B 11ASA 2I4MA 1EY6A 4B9XA 3HXUA 4UPAA 4DN4M 4R4IA 1LUZA 3MAQA 2NB0A 3A54A 1DJRD 4WORA 4XQQA 4YHHQ 4BXXG 2PZTA 2WB1E 3H94A 3ER0A 2Q8RE 3HOYG 3A7LA 5K1PA 3RKWA 1K8GA 4KY7A 3A5YA 1ENFA 2ENBA 2XSCA 1HTTA 3OTOL 3WQZA 1PH6A 3AYHB 2QEJC 1I4PA 1WTQA 1QE6A 1N36L 1NJ6A 4R8NA 5E1FA 1VQEA 4XTCS 4KR3A 3IAYA 1PTOH 1BIAA 5M3FG
chains in the Genus database with same CATH topology
4EQ5A 4LF9Q 5C3EG 2DTIA 2H5XA 3KJOA 4NXNL 1VQJA 4DV6L 3T1HQ 2F4VL 1VQKA 3PZCA 1N9WA 4IPCA 4G84A 1FYFA 2AKWA 3IALA 2UXCL 4B3RQ 4DKAC 4YREA 5LMUL 1SFOH 3ICEA 3Q8DA 2EIFA 1JJCB 4JI1L 1E1OA 4JOIC 4P3PA 3HOUH 3RLOA 1K9MC 4Q6GA 3TQYA 1EWIA 2BH8A 4K0KL 2ZIMA 2GN5A 1NTGA 2N49A 2UXDL 1SMXA 4GOPB 3UFGA 2IHFA 4H2TA 4OXPA 2QHSA 3WWVA 4E51A 1KQSA 4CH3A 3PF5A 3I4MH 3HRKA 4LVKA 2ZIOA 4LF5Q 3CAMA 5IYBH 3HOZG 2IX1A 1GKHA 4A76A 2JA8G 3F1ZA 5C0XG 4JYAL 1GVPA 5BR8L 3S24A 4A3CG 4DR4L 1VQZA 2ZT5A 2NZOA 3HKZE 1WNLA 1Q81C 3T1YL 4DK6C 4IO9A 4OO1G 2ZTGA 1VQHA 3NELA 4GKKL 2IHEA 4UP9A 3VQYA 3HRIA 3A7AA 1N33Q 3U50C 4KLKA 2UUAQ 3EBEA 4GS3A 4CH4A 1IL2A 3PSIA 1PH3A 1H4SA 2KHJA 1VQDA 2CKZB 3DSQA 2AHOB 4LUZA 1Z7NA 4P72A 1PH9A 3S1NH 2R6GA 4HWSA 3IKLA 4HWOA 3PUVA 2XTIA 4JI8Q 2R93G 2GVBA 4X5OA 2CFMA 2ZT6A 4B3TQ 1Q46A 2VUMG 3TS0A 2PMFA 1EOVA 2PI2A 3KDFB 2JA6G 2ZJRA 1ASYA 1E3PA 4YPFA 2ARTA 2GVAA 4YDQA 1TWAH 2DQ3A 2OWOA 1A62A 5M3FH 3CCQA 1KIXA 3J81i 3CW2C 5J3BA 2RCNA 4GLAC 3CC2A 2YYZA 4IOCA 4BWAA 4YRPA 3KF8B 4DR1Q 4YYEA 3PIOA 1NJ1A 3J81c 3CQZH 4X6AH 2CGHA 1Q86C 2C8MA 4PG3A 4LFBL 5FLMH 4A3FG 4H2YA 1KOGA 2DVEA 4ZTZB 3IG2A 1VS0A 2CQOA 2VL6A 3RN5A 4DV1L 3V7SA 3ZJYC 1J5WA 2WB1G 2Z0SA 1XMOL 3F8TA 3F2CA 3E9IA 3CCEA 2WP8J 4LUVA 3RIRA 4ME3A 2ASBA 2DZ9A 4OONA 4GKKQ 3QTCA 2HT1A 1PYBA 3OD1A 3B6YA 1EIYA 1I3QH 4H2WA 2ALYA 1QZGA 3GTPH 2EAYA 4DUZL 1NJ2A 4HIKA 1OTCA 4LF8L 4IPDA 2B63G 2ZJPA 4HWTA 1ADJA 3CMEA 4BW9A 1B76A 3HOZH 3P8YA 4QGUA 2DQ0A 4XEMA 1VQ7A 4IJLA 1YJNA 2JA8H 3HOWH 4PZ6A 3GTOH 2UUCQ 4YWMA 3IRBA 4XTZA 3CCRA 3HFVA 1NY4A 2VQFQ 2AMCA 3MEYA 3REUA 4J15A 1Y1VG 3I4NG 1MJEA 4AQYL 3F2DA 4X66Q 2E10A 5E3IA 3PO3H 4A4IA 3KLWA 4DV5L 1SRYA 1QF6A 3J7ZC 2ZZGA 1WU7A 2R92H 3MEFA 4H2XB 4H02A 2UUBL 2E5AA 4DR5L 3I56A 2KHIA 3BJUA 3TEHB 2ZM6L 1NJIC 2HIVA 1FGUA 1V9PA 2DZCA 2HQLA 1EQQA 3S2HH 1MJCA 3PCOB 1IBML 2VUMH 1L1OB 3P8TA 1YVCA 2CIMA 2JA6H 1YITA 2DXUA 4XU0A 1J5EL 1E7ZA 3H3VH 3HKZG 4H2UA 1RIQA 3PF4A 4DV4Q 1TWCH 4HJAA 3V8JA 3IKMB 4P3NA 2A8EA 1XMQQ 1KMMA 1AE2A 4WI1A 4YRFA 5C44G 1PH7A 4YHHL 2CWAA 2Y0SE 5HY6A 3CCJA 4PZ8A 4QY7A 5LMNW 4XTVA 4OP0A 3QO8A 5K36G 3L2PA 4NB3A 4AH6A 2YV5A 4P73A 1S3OA 5C4JH 3M4OH 4A3MH 1G291 2ZT8A 1I94Q 4YRQA 3F2BA 4A3FH 3CCLA 4P74C 4LF9L 1IBLQ 1K0RA 3L4GB 1VQGA 1YHAA 1XNRQ 3S1QH 4IPHA 2XGTA 5C4XG 3T1HL 3J7A5 3A32A 5IT9c 4JV5Q 2CJBA 4LNQA 4P71A 1EUJA 4MTNA 12ASA 1PH8A 1WYDA 1B7YA 3AFQA 1I6HH 3TEGA 3UH0A 4IFDG 4B3SQ 4TQUS 1CUKA 3I4MG 1USYA 2K5VA 4B3RL 5IYBG 3HOVH 1X01A 4PZ7A 3A0JA 4GLVB 4GLXA 4YRCA 3L1AA 1BBUA 4C3IH 2BA1A 1E1TA 2IY5A 2MQHA 4GKJQ 3A5ZB 1BBWA 1X55A 2B63H 4OWXB 4JI6Q 4XIGS 1D7QA 4Y7NH 3FKIG 3M9BA 1IXRA 2N3SA 3GTGH 2K14A 3RZOH 4DPGA 4BY7H 1Z47A 3L2ZA 4AYBG 2VS1A 1M90C 1X2GA 3A5UA 2EJFA 1RIPA 2ARUA 4LF5L 4G85A 1QUQB 3CMQA 1SN8A 4XU2A 1HXDA 2E2IH 2ZXFA 4PMWA 1IYJB 1VQ8A 4YRRA 5E7NA 2RHQB 1YGBA 3UDGA 5AJ3Q 2ZZEA 5C51B 2IX0A 4TVWA 2ID0A 3OYYA 2ODRC 1VQAA 3G6EA 3ULLA 1PH4A 1XJVA 1N33L 1YI2A 2UUAL 5ELNA 2OTJA 1CKOA 4X62Q 5F5WA 1X3FA 3PUZA 3I55A 1NJ8A 5IWAQ 4JI8L 1SLJA 3RR5A 1IBKQ 1HNZQ 1C7YA 4DR2Q 5FLMG 4JG2A 1WI5A 1FJGQ 5C44H 3W5OA 4B3TL 3NBHB 4CS4A 2Q2IA 3LGJA 1Y1WH 4TWAA 4Q15A 4LVLA 1CKNB 3PUYA 3I4OA 4KHZA 1KMNA 4K87A 1UWVA 3E9HA 2PQAB 4KR2A 4POGA 2QHVA 1X3EA 4H2VA 3HXWA 5FJ8G 3GTQH 2VQEQ 4DV7Q 5C4XH 4P75C 3UE0A 4DR1L 1K83H 3S16H 3JAMi 4GOPC 4XU3A 3G1ZA 1P16A 5K1XA 4YRJA 2BA0A 3KF6A 4JI5Q 1EVLA 3QO5A 4A3JH 4A3IG 1W66A 1MIUA 2NVXH 4X64Q 3STBD 3JAMc 1HR0Q 1NYQA 4P3OA 1XNQQ 2I4NA 2Y0SG 3HOWG 1Q12A 2E5LQ 4P73C 4KHPQ 2E2HH 1PV4A 3L0OA 3FKIH 3TREA 4GNXA 3UDFA 3PO3G 3LC0A 2KCMA 3HXYA 2HIXA 2Z6KA 3ULPA 2MO1A 4YCWA 5JEAJ 1E22A 3LSSA 2A8VA 2R92G 1HC7A 4RQFA 4P71C 3EFSA 3I7FA 1WLEA 3KJPA 3HY1A 4FDBA 4QIWE 2RF4A 1YFSA 1PYSA 4UP7A 1USYC 1V43A 2UXBQ 2QHUA 1HNXQ 1GO3E 2N8NA 4LF6Q 5GROA 3HFZA 4P74A 2RHSA 2UUCL 5KNNA 3ERSX 3RGLA 1H95A 2VQFL 1A8VA 1B70B 4YROA 4TVAB 2DGYA 4OX9Q 4LVJA 4NPSA 4X66L 3CP0A 1SR3A 1LTLA 1JE5A 4DV3Q 3S15H 3MF1A 2DU7A 4L5RC 2G4CA 1CKMA 5IYDG 2VW9A 1K73C 3S2DH 4UY8C 5JJIA 2WAQE 2LXJA 1G5HA 1VQMA 1TWFH 4POFA 4YRLA 1BVSA 4A3MG 3VQWA 1AH9A 3CPWA 3K81C 4JI7Q 4XU1A 1Z7MA 5GAGC 4YRSA 3CCMA 2ZINA 4HWPA 1OXUA 3U58A 1W2BA 4RG1A 2NZHA 4KI0A 4MNOA 2Q7EA 1ADYA 1KRSA 2OCEA 4X65Q 1X9NA 4DV4L 2ARSA 3VBBA 3EFRA 4DR3Q 3UGTA 2JA7G 3W1BA 3FP9A 1XMQL 2I4OA 4A3GH 2F52A 5JJLA 4OLFA 5FJ8H 2PMEA 3DM3A 4XTYA 3HOVG 1EIFA 5HGQA 4BBSG 3K8AA 2CJ9A 1WOCA 1YHBA 3PIPA 1I94L 1D8LA 5IY0A 3AEVA 2JQOA 4LNSA 4A3IH 1YHQA 1QZHA 2OTLA 3RZDH 1IBLL 3G71A 2NVYH 4JI2Q 2NN6I 1XNRL 4BY7G 3BFMA 4R4TA 2AKWB 2K52A 1N34Q 4OO1I 3J80i 4JV5L 2DXTA 1X6OA 4AIMA 3CCSA 1N8RC 4HIDA 2I0QA 4B3SL 3TS2A 3I2ZA 3J80c 2DUDA 2KCTA 1B8AA 5DLQE 3S17H 3HTZA 3M3YH 1X56A 3V7CA 4GKJL 1H4TA 3BU2A 1RL2A 2PNHA 3ERRA 1BKBA 3SGIA 1NNHA 4JI6L 3CCUA 3V8LA 3HXXA 1NYRA 1TWHH 1JJCA 1VQ5A 4LF7Q 5LMNQ 1L1OC 2ZR2A 5M5YH 2I5MX 4OWTB 2JJQA 2PMZE 2UU9Q 3RUXA 1NBWA 3BZCA 1PH5A 2BH2A 2ZTEA 1KC8C 4GNXC 2E8GA 4P75A 2D62A 3K7AH 2K75A 2E65A 4GOPA 3M7NA 4BY1G 2Z6KC 3G4SA 3W3SA 1QVCA 1VCIA 3GTMH 5IYDH 3QNEA 4TQFA 1AE3A 1K3RA 4HA8A 1Q8KA 2Q2HA 4YCUA 1SESA 2F3IA 1OXSC 1PVOA 1KHIA 1HZBA 3A31A 3HXZA 4TQDA 3ICAA 5AJ3L 1Y1WG 1PHJA 2OQKA 2P5IA 1G6PA 1CSPA 2ZGWA 3L7ZC 1EQRA 4A3BH 4HJ9A 1HJPA 2QA4A 5C0XJ 3GTJH 4DQ2A 3VQXA 1SRUA 3MF2A 5M3MG 4X62L 1SETA 4A75A 2A1AA 3HXVA 3KYHC 4DV0Q 5IWAL 1HNZL 1IBKL 4R4QA 4DR2L 1FVIA 2JA7H 1C9OA 3HKSA 2HHHQ 4BA1I 4A3JG 2R7DA 1YEZA 5GAHC 1QVGA 1FJGL 4C2MH 3A7RA 5H1SE 1PA6A 2ZTDA 4EO4A 4BBSH 3PUWA 3W1GA 3CPFA 4YY3Q 2A19A 4RQEA 4QJFA 1GGMA 3KDFA 1UE1A 4A3EH 1I50H 4GN4B 1WCMG 4TTVA 1YFTA 2MO0A 4YWKA 4YWLA 1Q1EA 4LF4Q 1Q7YC 5ELOA 3A74A 3UE1A 3M85A 3AFPA 1O7IA 2VQEL 4DV7L 2DJZA 4K88A 1XPOA 1QVFA 3BZKA 4L5QA 3RL6A 4JCVE 1NJ5A 3M4PA 2JE6I 4JI5L 2HNIA 3PUXA 2K4KA 2I5LX 4DUYQ 4JBKA 3M4QA 4X64L 2I5HA 5GADC 5FLXc 3RF1A 1X65A 1HR0L 2ZNIA 4DV2Q 1VQPA 1XNQL 1N32Q 4YRIA 2E5LL 4KHPL 1VQOA 4XTUA 3GO5A 1HH2P 1EIYB 2ALYB 4YRNA 1NMGA 4CH5A 1VQ4A 5GAEC 2KBNA 4YRKA 4JI3Q 2MFIA 2ZNJA 2FXQA 2KENA 4LFAQ 5IYCH 2C35B 4CS2A 3RKXA 3R07A 4QQBX 4QL5A 1R9TH 3U4ZA 1JJGA 3UDXA 1DGSA 4BY1H 1TWGH 2AMCB 2UXBL 3D0FA 1Q82C 1HNXL 3RN2A 1KL9A 2R7FA 3K80C 1L0WA 4DR6Q 3HOXG 4LF6L 1C0AA 4K86A 4HIMA 4DAMA 4YP0A 3TUPA 1HZAA 3A7UA 4PHCA 3MQZA 4DK3C 1HNWL 4XTXA 4OX9L 2Q5HA 3D31A 2LXKA 3OW2A 5JJKA 3H15A 3FJPA 2K5HA 4DV3L 1ATIA 4IOAA 4HIOA 3CC7A 4A3DH 3CXCA 4DAYB 1Z9FA 5M3MH 5M5WH 2CJAA 1CSQA 2DTHA 4A3GG 3AQQA 2VY3A 3EIVA 2EXDA 1PH1A 4A93G 3V7RA 4KQEA 4JI0Q 1VQIA 4H2SA 4C3HH 4LFCQ 3PO2H 3LSQA 4IFDI 1G5IA 4DR7Q 1UE5A 3VQVA 4H2XA 4HJ7A 2DDZA 4LVMA 4JI7L 3MXNB 3TEHA 3NETA 5IP7H 2E1HA 2ZT7A 4MZ9A 4HWRA 4NXMQ 1BIBA 3PCOA 1M1KC 1L1OA 4B3MQ 4BA2I 3EN2A 4X65L 1H4QA 2YTYA 4BBRH 1WCMH 4EX5A 4GN3B 1YZ6A 4DR3L 2AWOA 1A63A 2JA5H 2K50A 4LWCA 2N78A 2NN6G 1PFSA 1GD7A 1X2HA 1NE3A 3H0GG 3OTOQ 4A3KG 1XPUA 1N36Q 4O2DA 1T9HA 2PI2E 3E0EA 4ZTUB 4A3LH 4R4CA 3DLLA 2CCZA 4NXNQ 4JI2L 2DTOA 4DV6Q 1HR0W 5IE8A 1B7YB 1A0IA 2F4VQ 2JK8A 4LVIA 1S40A 3L4GA 2EL9A 1N34L 4L5SA 4RMFA 1HNWQ 4WJ3M 5IP9G 4Y52H 2D0PA 2B29A 3UDIA 4BXXH 2UXCQ 1W3SA 2IY5B 1SE8A 1WFQA 1HZCA 1WPYA 1UE7A 1K8AC 3HOYH 2L15A 1KRTA 2Q7GA 5LMUQ 3VDYA 1LM0A 3NENA 3RNUA 1VQ6A 4YRGA 4HVCA 4R4OA 4JI1Q 2IT1A 4GN5A 2QEXA 4XTWA 2J3MA 4O0AA 1XPRA 1YB3A 5C3EH 5GQOA 4IPGA 4IFDJ 3A5ZA 3HOXH 4LF7L 5LMNL 4K0KQ 4A3BG 2UXDQ 4JI4L 3RACA 3CMAA 1YJWA 1Q1BA 2UU9L 2ZZFA 4DNIA 2K5NA 3PV0A 4YCVA 4WJ4A 4TVYA 3KOJA 2ZJQA 4RDXA 4JYAQ 4XEOA 1U5KA 3G48A 5BR8Q 4DR4Q 1H4VB 4AYBE 4A93H 1JB7A 1QUQA 1XTDA 3T1YQ 1VQ9A 5M5XH 1P8LA 2C7IA 1FL0A 2YU9H 1YFRA 4JC0A 2EWNA 4A3EG 2RHQA 4HJ5A 1JT8A 3CD6A 5C0XI 3U4VA 1GM5A 1YBYA 2Q2UA 3FHWA 4OWWB 3STBC 4ALPA 3NEMA 1X3GA 1KD1C 1LYLA 3CCVA 2WFWA 2R7ZG 4DV0L 2DEQA 1V1QA 4L5TA 2D0OA 1UE6A 1WQWA 2V1CC 1JMCA 1KXLA 2HHHL 3J81j 1PH2A 4A3CH 2Q7HA 4JBMA 2FYKA 4WF2A 3H0GH 2Q2TA 4A3KH 1J6QA 4YY3L 3JC66 5EAYA 2NVQH 1YJ9A 1Y14B 1NMFA 5C53B 2OQ0A 2I4LA 1VQBA 1CKNA 2QGQA 3KF6B 4LF4L 2E41A 4JI4Q 3H3VI 2PQAA 4NCXA 3KFUA 3CC4A 2P0LA 2JEAI 2E2JH 3S14H 2ODRD 5IYCG 2R93H 2CWPA 1VQCA 2ZR3A 1G51A 4LFBQ 5IP9H 2QHTA 2EQSA 4JOIA 4CS3A 3PGZA 3P8VA 4HJ8A 4DUYL 4DV1Q 2E3CA 5JEAG 1VQFA 4DV2L 3UGQA 1X54A 1N32L 1XMOQ 1EFWA 4GNXB 4ZIBA 4UP8A 2J3LA 2B3GA 3GD7A 2VZAA 3S1RH 2LSSA 2ZTCA 3QO7A 4P72C 4A3DG 4JI3L 1PYSB 2AWNA 4LFAL 1I5FA 4DUZQ 3S1MH 4YRTA 4LF8Q 1OXVA 2EJGA 1L2FA 1SROA 1ASZA 2Q5IA 3HFZB 4C3JH 1OXTA 2RHSB 1S72A 2NVTH 1OXXK 1U0LA 3HOUG 3PO2G 4YRMA 2VNUD 1E24A 3K7UC 1EYGA 4JBWA 4DR6L 2JA9A 1TXYA 5IP7G 3RKYA 1KAWA 1UEBA 2NS6A 2WAQG 4AQYQ 4IJHA 4DV5Q 2YTXA 1IZ6A 4CH6A 1B70A 1YNXA 4L87A 1EVKA 3V8KA 1WJJA 4TVAA 1SERA 4BBRG 4JBJA 1QE0A 2ES2A 2EJ9A 1JJ2A 2JA5G 3RLNA 3ULJA 3K0XA 3RLFA 1HZ9A 2UUBQ 2ZCEA 4DR5Q 4JI0L 2R7ZH 5C52B 1WQ7A 2ZM6Q 4LFCL 1VQLA 4LUOA 1YIJA 3GTLH 4DR7L 4LW1A 1VQNA 3TRZA 3HY0A 4R1JA 1IBMQ 2DU5A 2MNAA 4HT4A 4A3LG 2DKGA 3GDEA 4APVA 1J5EQ 3CF5A 4NXML 2JEBI 1MKHA 1Y1VH 2E64A 2YTVA 3GTKH 3REXA 4B3ML 3I4NH 2ATWA 11ASA 2I4MA 3HXUA 4UPAA 4R4IA 1LUZA 4YHHQ 4BXXG 2WB1E 3ER0A 3HOYG 5K1PA 3RKWA 1K8GA 3A5YA 1HTTA 3OTOL 3WQZA 1PH6A 3AYHB 1N36L 1NJ6A 1VQEA 4XTCS 4KR3A 1BIAA 5M3FG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQ5 A;  4LF9 Q;  5C3E G;  2DTI A;  2H5X A;  3KJO A;  4NXN L;  1VQJ A;  4DV6 L;  3T1H Q;  2F4V L;  1VQK A;  3PZC A;  1N9W A;  4IPC A;  4G84 A;  1FYF A;  2AKW A;  3IAL A;  2UXC L;  4B3R Q;  4DKA C;  4YRE A;  5LMU L;  1SFO H;  3ICE A;  3Q8D A;  2EIF A;  1JJC B;  4JI1 L;  1E1O A;  4JOI C;  4P3P A;  3HOU H;  3RLO A;  1K9M C;  4Q6G A;  3TQY A;  1EWI A;  2BH8 A;  4K0K L;  2ZIM A;  2GN5 A;  1NTG A;  2N49 A;  2UXD L;  1SMX A;  4GOP B;  3UFG A;  2IHF A;  4H2T A;  4OXP A;  2QHS A;  3WWV A;  4E51 A;  1KQS A;  4CH3 A;  3PF5 A;  3I4M H;  3HRK A;  2ZIO A;  4LF5 Q;  3CAM A;  5IYB H;  3HOZ G;  2IX1 A;  1GKH A;  4A76 A;  2JA8 G;  3F1Z A;  5C0X G;  4JYA L;  1GVP A;  5BR8 L;  3S24 A;  4A3C G;  4DR4 L;  1VQZ A;  2ZT5 A;  2NZO A;  3HKZ E;  1WNL A;  1Q81 C;  3T1Y L;  4DK6 C;  4IO9 A;  4OO1 G;  2ZTG A;  1VQH A;  3NEL A;  4GKK L;  2IHE A;  4UP9 A;  3VQY A;  3HRI A;  3A7A A;  1N33 Q;  3U50 C;  4KLK A;  2UUA Q;  3EBE A;  4GS3 A;  4CH4 A;  1IL2 A;  3PSI A;  1PH3 A;  1H4S A;  2KHJ A;  1VQD A;  2CKZ B;  3DSQ A;  2AHO B;  4LUZ A;  1Z7N A;  4P72 A;  1PH9 A;  3S1N H;  2R6G A;  4HWS A;  3IKL A;  4HWO A;  3PUV A;  2XTI A;  4JI8 Q;  2R93 G;  2GVB A;  4X5O A;  2CFM A;  2ZT6 A;  4B3T Q;  1Q46 A;  2VUM G;  3TS0 A;  2PMF A;  1EOV A;  2PI2 A;  3KDF B;  2JA6 G;  2ZJR A;  1ASY A;  1E3P A;  4YPF A;  2ART A;  2GVA A;  4YDQ A;  1TWA H;  2DQ3 A;  2OWO A;  1A62 A;  5M3F H;  3CCQ A;  1KIX A;  3J81 i;  3CW2 C;  5J3B A;  2RCN A;  4GLA C;  3CC2 A;  2YYZ A;  4IOC A;  4BWA A;  4YRP A;  3KF8 B;  4DR1 Q;  4YYE A;  3PIO A;  1NJ1 A;  3J81 c;  3CQZ H;  4X6A H;  2CGH A;  1Q86 C;  2C8M A;  4PG3 A;  4LFB L;  5FLM H;  4A3F G;  4H2Y A;  1KOG A;  2DVE A;  4ZTZ B;  3IG2 A;  1VS0 A;  2CQO A;  2VL6 A;  3RN5 A;  4DV1 L;  3V7S A;  3ZJY C;  1J5W A;  2WB1 G;  2Z0S A;  1XMO L;  3F8T A;  3F2C A;  3E9I A;  3CCE A;  2WP8 J;  4LUV A;  3RIR A;  4ME3 A;  2ASB A;  2DZ9 A;  4OON A;  4GKK Q;  3QTC A;  2HT1 A;  1PYB A;  3OD1 A;  3B6Y A;  1EIY A;  1I3Q H;  4H2W A;  2ALY A;  1QZG A;  3GTP H;  2EAY A;  4DUZ L;  1NJ2 A;  4HIK A;  1OTC A;  4LF8 L;  4IPD A;  2B63 G;  2ZJP A;  4HWT A;  1ADJ A;  3CME A;  4BW9 A;  1B76 A;  3HOZ H;  3P8Y A;  4QGU A;  2DQ0 A;  4XEM A;  1VQ7 A;  4IJL A;  1YJN A;  2JA8 H;  3HOW H;  4PZ6 A;  3GTO H;  2UUC Q;  4YWM A;  3IRB A;  4XTZ A;  3CCR A;  3HFV A;  1NY4 A;  2VQF Q;  2AMC A;  3MEY A;  3REU A;  4J15 A;  1Y1V G;  3I4N G;  1MJE A;  4AQY L;  3F2D A;  4X66 Q;  2E10 A;  5E3I A;  3PO3 H;  4A4I A;  3KLW A;  4DV5 L;  1SRY A;  1QF6 A;  3J7Z C;  2ZZG A;  1WU7 A;  2R92 H;  3MEF A;  4H2X B;  4H02 A;  2UUB L;  2E5A A;  4DR5 L;  3I56 A;  2KHI A;  3BJU A;  3TEH B;  2ZM6 L;  1NJI C;  2HIV A;  1FGU A;  1V9P A;  2DZC A;  2HQL A;  1EQQ A;  3S2H H;  1MJC A;  3PCO B;  1IBM L;  2VUM H;  1L1O B;  3P8T A;  1YVC A;  2CIM A;  2JA6 H;  1YIT A;  2DXU A;  4XU0 A;  1J5E L;  1E7Z A;  3H3V H;  3HKZ G;  4H2U A;  1RIQ A;  3PF4 A;  4DV4 Q;  1TWC H;  4HJA A;  3V8J A;  3IKM B;  4P3N A;  1XMQ Q;  1KMM A;  1AE2 A;  4WI1 A;  4YRF A;  5C44 G;  1PH7 A;  4YHH L;  2CWA A;  2Y0S E;  5HY6 A;  3CCJ A;  4PZ8 A;  4QY7 A;  5LMN W;  4XTV A;  4OP0 A;  3QO8 A;  5K36 G;  3L2P A;  4NB3 A;  4AH6 A;  2YV5 A;  4P73 A;  1S3O A;  5C4J H;  3M4O H;  4A3M H;  1G29 1;  2ZT8 A;  1I94 Q;  4YRQ A;  3F2B A;  4A3F H;  3CCL A;  4P74 C;  4LF9 L;  1IBL Q;  1K0R A;  3L4G B;  1VQG A;  1YHA A;  1XNR Q;  3S1Q H;  4IPH A;  2XGT A;  5C4X G;  3T1H L;  3J7A 5;  3A32 A;  5IT9 c;  4JV5 Q;  2CJB A;  4LNQ A;  4P71 A;  1EUJ A;  4MTN A;  12AS A;  1PH8 A;  1WYD A;  1B7Y A;  3AFQ A;  1I6H H;  3TEG A;  3UH0 A;  4IFD G;  4B3S Q;  4TQU S;  1CUK A;  3I4M G;  1USY A;  2K5V A;  4B3R L;  5IYB G;  3HOV H;  1X01 A;  4PZ7 A;  3A0J A;  4GLV B;  4GLX A;  4YRC A;  3L1A A;  1BBU A;  4C3I H;  2BA1 A;  1E1T A;  2IY5 A;  2MQH A;  4GKJ Q;  3A5Z B;  1BBW A;  1X55 A;  2B63 H;  4OWX B;  4JI6 Q;  4XIG S;  1D7Q A;  4Y7N H;  3FKI G;  3M9B A;  1IXR A;  2N3S A;  3GTG H;  2K14 A;  3RZO H;  4DPG A;  4BY7 H;  1Z47 A;  3L2Z A;  4AYB G;  2VS1 A;  1M90 C;  1X2G A;  3A5U A;  2EJF A;  1RIP A;  2ARU A;  4LF5 L;  4G85 A;  1QUQ B;  3CMQ A;  1SN8 A;  4XU2 A;  1HXD A;  2E2I H;  2ZXF A;  4PMW A;  1IYJ B;  1VQ8 A;  4YRR A;  5E7N A;  2RHQ B;  1YGB A;  3UDG A;  5AJ3 Q;  2ZZE A;  5C51 B;  2IX0 A;  4TVW A;  2ID0 A;  3OYY A;  2ODR C;  1VQA A;  3G6E A;  3ULL A;  1PH4 A;  1XJV A;  1N33 L;  1YI2 A;  2UUA L;  5ELN A;  2OTJ A;  1CKO A;  4X62 Q;  5F5W A;  1X3F A;  3PUZ A;  3I55 A;  1NJ8 A;  5IWA Q;  4JI8 L;  1SLJ A;  3RR5 A;  1IBK Q;  1HNZ Q;  1C7Y A;  4DR2 Q;  5FLM G;  4JG2 A;  1WI5 A;  1FJG Q;  5C44 H;  3W5O A;  4B3T L;  3NBH B;  4CS4 A;  2Q2I A;  3LGJ A;  1Y1W H;  4TWA A;  4Q15 A;  1CKN B;  3PUY A;  3I4O A;  4KHZ A;  1KMN A;  4K87 A;  1UWV A;  3E9H A;  2PQA B;  4KR2 A;  4POG A;  2QHV A;  1X3E A;  4H2V A;  3HXW A;  5FJ8 G;  3GTQ H;  2VQE Q;  4DV7 Q;  5C4X H;  4P75 C;  3UE0 A;  4DR1 L;  1K83 H;  3S16 H;  3JAM i;  4GOP C;  4XU3 A;  3G1Z A;  1P16 A;  5K1X A;  4YRJ A;  2BA0 A;  3KF6 A;  4JI5 Q;  1EVL A;  3QO5 A;  4A3J H;  4A3I G;  1W66 A;  1MIU A;  2NVX H;  4X64 Q;  3STB D;  3JAM c;  1HR0 Q;  1NYQ A;  4P3O A;  1XNQ Q;  2I4N A;  2Y0S G;  3HOW G;  1Q12 A;  2E5L Q;  4P73 C;  4KHP Q;  2E2H H;  1PV4 A;  3L0O A;  3FKI H;  3TRE A;  4GNX A;  3UDF A;  3PO3 G;  3LC0 A;  2KCM A;  3HXY A;  2HIX A;  2Z6K A;  3ULP A;  2MO1 A;  4YCW A;  5JEA J;  1E22 A;  3LSS A;  2A8V A;  2R92 G;  1HC7 A;  4RQF A;  4P71 C;  3EFS A;  3I7F A;  1WLE A;  3KJP A;  3HY1 A;  4FDB A;  4QIW E;  2RF4 A;  1YFS A;  1PYS A;  4UP7 A;  1USY C;  1V43 A;  2UXB Q;  2QHU A;  1HNX Q;  1GO3 E;  2N8N A;  4LF6 Q;  5GRO A;  3HFZ A;  4P74 A;  2RHS A;  2UUC L;  5KNN A;  3ERS X;  3RGL A;  1H95 A;  2VQF L;  1A8V A;  1B70 B;  4YRO A;  4TVA B;  2DGY A;  4OX9 Q;  4NPS A;  4X66 L;  3CP0 A;  1SR3 A;  1LTL A;  1JE5 A;  4DV3 Q;  3S15 H;  3MF1 A;  2DU7 A;  4L5R C;  2G4C A;  1CKM A;  5IYD G;  2VW9 A;  1K73 C;  3S2D H;  4UY8 C;  5JJI A;  2WAQ E;  2LXJ A;  1G5H A;  1VQM A;  1TWF H;  4POF A;  4YRL A;  1BVS A;  4A3M G;  3VQW A;  1AH9 A;  3CPW A;  3K81 C;  4JI7 Q;  4XU1 A;  1Z7M A;  5GAG C;  4YRS A;  3CCM A;  2ZIN A;  4HWP A;  1OXU A;  3U58 A;  1W2B A;  4RG1 A;  2NZH A;  4KI0 A;  4MNO A;  2Q7E A;  1ADY A;  1KRS A;  2OCE A;  4X65 Q;  1X9N A;  4DV4 L;  2ARS A;  3VBB A;  3EFR A;  4DR3 Q;  3UGT A;  2JA7 G;  3W1B A;  3FP9 A;  1XMQ L;  2I4O A;  4A3G H;  2F52 A;  5JJL A;  4OLF A;  5FJ8 H;  2PME A;  3DM3 A;  4XTY A;  3HOV G;  1EIF A;  5HGQ A;  4BBS G;  3K8A A;  2CJ9 A;  1WOC A;  1YHB A;  3PIP A;  1I94 L;  1D8L A;  5IY0 A;  3AEV A;  2JQO A;  4LNS A;  4A3I H;  1YHQ A;  1QZH A;  2OTL A;  3RZD H;  1IBL L;  3G71 A;  2NVY H;  4JI2 Q;  2NN6 I;  1XNR L;  4BY7 G;  3BFM A;  4R4T A;  2AKW B;  2K52 A;  1N34 Q;  4OO1 I;  3J80 i;  4JV5 L;  2DXT A;  1X6O A;  4AIM A;  3CCS A;  1N8R C;  4HID A;  2I0Q A;  4B3S L;  3TS2 A;  3I2Z A;  3J80 c;  2DUD A;  2KCT A;  1B8A A;  5DLQ E;  3S17 H;  3HTZ A;  3M3Y H;  1X56 A;  3V7C A;  4GKJ L;  1H4T A;  3BU2 A;  1RL2 A;  2PNH A;  3ERR A;  1BKB A;  3SGI A;  1NNH A;  4JI6 L;  3CCU A;  3V8L A;  3HXX A;  1NYR A;  1TWH H;  1JJC A;  1VQ5 A;  4LF7 Q;  5LMN Q;  1L1O C;  2ZR2 A;  5M5Y H;  2I5M X;  4OWT B;  2JJQ A;  2PMZ E;  2UU9 Q;  3RUX A;  1NBW A;  3BZC A;  1PH5 A;  2BH2 A;  2ZTE A;  1KC8 C;  4GNX C;  2E8G A;  4P75 A;  2D62 A;  3K7A H;  2K75 A;  2E65 A;  4GOP A;  3M7N A;  4BY1 G;  2Z6K C;  3G4S A;  3W3S A;  1QVC A;  1VCI A;  3GTM H;  5IYD H;  3QNE A;  4TQF A;  1AE3 A;  1K3R A;  4HA8 A;  1Q8K A;  2Q2H A;  4YCU A;  1SES A;  2F3I A;  1OXS C;  1PVO A;  1KHI A;  1HZB A;  3A31 A;  3HXZ A;  4TQD A;  3ICA A;  5AJ3 L;  1Y1W G;  1PHJ A;  2OQK A;  2P5I A;  1G6P A;  1CSP A;  2ZGW A;  3L7Z C;  1EQR A;  4A3B H;  4HJ9 A;  1HJP A;  2QA4 A;  5C0X J;  3GTJ H;  4DQ2 A;  3VQX A;  1SRU A;  3MF2 A;  5M3M G;  4X62 L;  1SET A;  4A75 A;  2A1A A;  3HXV A;  3KYH C;  4DV0 Q;  5IWA L;  1HNZ L;  1IBK L;  4R4Q A;  4DR2 L;  1FVI A;  2JA7 H;  1C9O A;  3HKS A;  2HHH Q;  4BA1 I;  4A3J G;  2R7D A;  1YEZ A;  5GAH C;  1QVG A;  1FJG L;  4C2M H;  3A7R A;  5H1S E;  1PA6 A;  2ZTD A;  4EO4 A;  4BBS H;  3PUW A;  3W1G A;  3CPF A;  4YY3 Q;  2A19 A;  4RQE A;  4QJF A;  1GGM A;  3KDF A;  1UE1 A;  4A3E H;  1I50 H;  4GN4 B;  1WCM G;  4TTV A;  1YFT A;  2MO0 A;  4YWK A;  4YWL A;  1Q1E A;  4LF4 Q;  1Q7Y C;  5ELO A;  3A74 A;  3UE1 A;  3M85 A;  3AFP A;  1O7I A;  2VQE L;  4DV7 L;  2DJZ A;  4K88 A;  1XPO A;  1QVF A;  3BZK A;  4L5Q A;  3RL6 A;  4JCV E;  1NJ5 A;  3M4P A;  2JE6 I;  4JI5 L;  2HNI A;  3PUX A;  2K4K A;  2I5L X;  4DUY Q;  4JBK A;  3M4Q A;  4X64 L;  2I5H A;  5GAD C;  5FLX c;  3RF1 A;  1X65 A;  1HR0 L;  2ZNI A;  4DV2 Q;  1VQP A;  1XNQ L;  1N32 Q;  4YRI A;  2E5L L;  4KHP L;  1VQO A;  4XTU A;  3GO5 A;  1HH2 P;  1EIY B;  2ALY B;  4YRN A;  1NMG A;  4CH5 A;  1VQ4 A;  5GAE C;  2KBN A;  4YRK A;  4JI3 Q;  2MFI A;  2ZNJ A;  2FXQ A;  2KEN A;  4LFA Q;  5IYC H;  2C35 B;  4CS2 A;  3RKX A;  3R07 A;  4QQB X;  4QL5 A;  1R9T H;  3U4Z A;  1JJG A;  3UDX A;  1DGS A;  4BY1 H;  1TWG H;  2AMC B;  2UXB L;  3D0F A;  1Q82 C;  1HNX L;  3RN2 A;  1KL9 A;  2R7F A;  3K80 C;  1L0W A;  4DR6 Q;  3HOX G;  4LF6 L;  1C0A A;  4K86 A;  4HIM A;  4DAM A;  4YP0 A;  3TUP A;  1HZA A;  3A7U A;  4PHC A;  4DK3 C;  1HNW L;  4XTX A;  4OX9 L;  2Q5H A;  3D31 A;  2LXK A;  3OW2 A;  5JJK A;  3H15 A;  3FJP A;  2K5H A;  4DV3 L;  1ATI A;  4IOA A;  4HIO A;  3CC7 A;  4A3D H;  3CXC A;  4DAY B;  1Z9F A;  5M3M H;  5M5W H;  2CJA A;  1CSQ A;  2DTH A;  4A3G G;  3AQQ A;  2VY3 A;  3EIV A;  2EXD A;  1PH1 A;  4A93 G;  3V7R A;  4KQE A;  4JI0 Q;  1VQI A;  4H2S A;  4C3H H;  4LFC Q;  3PO2 H;  3LSQ A;  4IFD I;  1G5I A;  4DR7 Q;  1UE5 A;  3VQV A;  4H2X A;  4HJ7 A;  2DDZ A;  4JI7 L;  3MXN B;  3TEH A;  3NET A;  5IP7 H;  2E1H A;  2ZT7 A;  4MZ9 A;  4HWR A;  4NXM Q;  1BIB A;  3PCO A;  1M1K C;  1L1O A;  4B3M Q;  4BA2 I;  3EN2 A;  4X65 L;  1H4Q A;  2YTY A;  4BBR H;  1WCM H;  4EX5 A;  4GN3 B;  1YZ6 A;  4DR3 L;  2AWO A;  1A63 A;  2JA5 H;  2K50 A;  4LWC A;  2N78 A;  2NN6 G;  1PFS A;  1GD7 A;  1X2H A;  1NE3 A;  3H0G G;  3OTO Q;  4A3K G;  1XPU A;  1N36 Q;  4O2D A;  1T9H A;  2PI2 E;  3E0E A;  4ZTU B;  4A3L H;  4R4C A;  3DLL A;  2CCZ A;  4NXN Q;  4JI2 L;  2DTO A;  4DV6 Q;  1HR0 W;  5IE8 A;  1B7Y B;  1A0I A;  2F4V Q;  2JK8 A;  1S40 A;  3L4G A;  2EL9 A;  1N34 L;  4L5S A;  4RMF A;  1HNW Q;  4WJ3 M;  5IP9 G;  4Y52 H;  2D0P A;  2B29 A;  3UDI A;  4BXX H;  2UXC Q;  1W3S A;  2IY5 B;  1SE8 A;  1WFQ A;  1HZC A;  1WPY A;  1UE7 A;  1K8A C;  3HOY H;  2L15 A;  1KRT A;  2Q7G A;  5LMU Q;  3VDY A;  1LM0 A;  3NEN A;  3RNU A;  1VQ6 A;  4YRG A;  4HVC A;  4R4O A;  4JI1 Q;  2IT1 A;  4GN5 A;  2QEX A;  4XTW A;  2J3M A;  4O0A A;  1XPR A;  1YB3 A;  5C3E H;  5GQO A;  4IPG A;  4IFD J;  3A5Z A;  3HOX H;  4LF7 L;  5LMN L;  4K0K Q;  4A3B G;  2UXD Q;  4JI4 L;  3RAC A;  3CMA A;  1YJW A;  1Q1B A;  2UU9 L;  2ZZF A;  4DNI A;  2K5N A;  3PV0 A;  4YCV A;  4WJ4 A;  4TVY A;  3KOJ A;  2ZJQ A;  4RDX A;  4JYA Q;  4XEO A;  1U5K A;  3G48 A;  5BR8 Q;  4DR4 Q;  1H4V B;  4AYB E;  4A93 H;  1JB7 A;  1QUQ A;  1XTD A;  3T1Y Q;  1VQ9 A;  5M5X H;  1P8L A;  2C7I A;  1FL0 A;  2YU9 H;  1YFR A;  4JC0 A;  2EWN A;  4A3E G;  2RHQ A;  4HJ5 A;  1JT8 A;  3CD6 A;  5C0X I;  3U4V A;  1GM5 A;  1YBY A;  2Q2U A;  3FHW A;  4OWW B;  3STB C;  4ALP A;  3NEM A;  1X3G A;  1KD1 C;  1LYL A;  3CCV A;  2WFW A;  2R7Z G;  4DV0 L;  2DEQ A;  1V1Q A;  4L5T A;  2D0O A;  1UE6 A;  1WQW A;  2V1C C;  1JMC A;  1KXL A;  2HHH L;  3J81 j;  1PH2 A;  4A3C H;  2Q7H A;  4JBM A;  2FYK A;  4WF2 A;  3H0G H;  2Q2T A;  4A3K H;  1J6Q A;  4YY3 L;  3JC6 6;  5EAY A;  2NVQ H;  1YJ9 A;  1Y14 B;  1NMF A;  5C53 B;  2OQ0 A;  2I4L A;  1VQB A;  1CKN A;  2QGQ A;  3KF6 B;  4LF4 L;  2E41 A;  4JI4 Q;  3H3V I;  2PQA A;  4NCX A;  3KFU A;  3CC4 A;  2P0L A;  2JEA I;  2E2J H;  3S14 H;  2ODR D;  5IYC G;  2R93 H;  2CWP A;  1VQC A;  2ZR3 A;  1G51 A;  4LFB Q;  5IP9 H;  2QHT A;  2EQS A;  4JOI A;  4CS3 A;  3PGZ A;  3P8V A;  4HJ8 A;  4DUY L;  4DV1 Q;  2E3C A;  5JEA G;  1VQF A;  4DV2 L;  3UGQ A;  1X54 A;  1N32 L;  1XMO Q;  1EFW A;  4GNX B;  4ZIB A;  4UP8 A;  2J3L A;  2B3G A;  3GD7 A;  2VZA A;  3S1R H;  2LSS A;  2ZTC A;  3QO7 A;  4P72 C;  4A3D G;  4JI3 L;  1PYS B;  2AWN A;  4LFA L;  1I5F A;  4DUZ Q;  3S1M H;  4YRT A;  4LF8 Q;  1OXV A;  2EJG A;  1L2F A;  1SRO A;  1ASZ A;  2Q5I A;  3HFZ B;  4C3J H;  1OXT A;  2RHS B;  1S72 A;  2NVT H;  1OXX K;  1U0L A;  3HOU G;  3PO2 G;  4YRM A;  2VNU D;  1E24 A;  3K7U C;  1EYG A;  4JBW A;  4DR6 L;  2JA9 A;  1TXY A;  5IP7 G;  3RKY A;  1KAW A;  1UEB A;  2WAQ G;  4AQY Q;  4IJH A;  4DV5 Q;  2YTX A;  1IZ6 A;  4CH6 A;  1B70 A;  1YNX A;  4L87 A;  1EVK A;  3V8K A;  1WJJ A;  4TVA A;  1SER A;  4BBR G;  4JBJ A;  1QE0 A;  2ES2 A;  2EJ9 A;  1JJ2 A;  2JA5 G;  3RLN A;  3ULJ A;  3K0X A;  3RLF A;  1HZ9 A;  2UUB Q;  2ZCE A;  4DR5 Q;  4JI0 L;  2R7Z H;  5C52 B;  1WQ7 A;  2ZM6 Q;  4LFC L;  1VQL A;  4LUO A;  1YIJ A;  3GTL H;  4DR7 L;  4LW1 A;  1VQN A;  3TRZ A;  3HY0 A;  4R1J A;  1IBM Q;  2DU5 A;  2MNA A;  4A3L G;  2DKG A;  3GDE A;  4APV A;  1J5E Q;  3CF5 A;  4NXM L;  2JEB I;  1MKH A;  1Y1V H;  2E64 A;  2YTV A;  3GTK H;  3REX A;  4B3M L;  3I4N H;  2ATW A;  11AS A;  2I4M A;  3HXU A;  4UPA A;  4R4I A;  1LUZ A;  4YHH Q;  4BXX G;  2WB1 E;  3ER0 A;  3HOY G;  5K1P A;  3RKW A;  1K8G A;  3A5Y A;  1HTT A;  3OTO L;  3WQZ A;  1PH6 A;  3AYH B;  1N36 L;  1NJ6 A;  1VQE A;  4XTC S;  4KR3 A;  1BIA A;  5M3F G; 
#chains in the Genus database with same CATH topology
 1FYC A;  5CR3 A;  3C2P A;  4EQ5 A;  2EXZ A;  4Z9C B;  1EU3 A;  4LF9 Q;  2B2V A;  5C3E G;  2DTI A;  2H5X A;  3KJO A;  4NXN L;  4I7Z C;  1VQJ A;  2EJM A;  1JOQ A;  3HRZ C;  4DV6 L;  3QJY A;  3T1H Q;  4N9T A;  2F4V L;  4NW2 A;  2K5Q A;  3D4D A;  1VQK A;  3SEB A;  4JVZ A;  3PZC A;  1N9W A;  1BBX C;  4IPC A;  3NSW A;  4G84 A;  1FYF A;  2AKW A;  1DOM A;  3S15 B;  5D3I B;  5IGF A;  3IAL A;  1JCK B;  2UXC L;  4B3R Q;  4DKA C;  3KUP A;  1CQF A;  3NBI A;  5JVG 3;  1A2U A;  2SDF A;  1PZI D;  5K36 H;  3S2D B;  2Q8T A;  4YRE A;  5LMU L;  1SFO H;  3ICE A;  1ZEQ X;  3Q8D A;  1UNS A;  2B2Y C;  4K2L A;  1MGS A;  2EIF A;  1JJC B;  3HG9 A;  1DZ1 A;  2D2C C;  4JI1 L;  1TWF B;  4HCE A;  1E1O A;  5D14 A;  4JOI C;  2KEC A;  2L12 A;  4P3P A;  3HOU H;  3RLO A;  3BZD B;  2WKD A;  1K9M C;  5JVH 3;  4Q6G A;  3AB9 A;  1LV9 A;  4HCS A;  4FF4 A;  3HOX B;  3TQY A;  1LT4 D;  1FR3 A;  1EWI A;  1Q3L A;  3TP6 A;  1PYW D;  1E0B A;  2BH8 A;  2F0H A;  5BN3 A;  1AZP A;  4K0K L;  4RGM A;  2GN5 A;  2ZIM A;  2L55 A;  1NTG A;  1PFB A;  2N49 A;  2UXD L;  1SMX A;  4GOP B;  3UFG A;  2IHF A;  4H2T A;  1SNC A;  4OXP A;  1QB5 D;  5BN5 A;  2QHS A;  1QIL A;  2KCC A;  3WWV A;  4NKL A;  4E51 A;  1KQS A;  4CH3 A;  5LL6 S;  4IFD H;  1QWY A;  3GV3 A;  3K6O A;  2A6E C;  3PF5 A;  3I4M H;  3HRK A;  4LVK A;  2ZIO A;  4LF5 Q;  3CAM A;  5IYB H;  3HOZ G;  2IX1 A;  1GKH A;  4I65 A;  4A76 A;  4A3G B;  2JA8 G;  3F1Z A;  5C0X G;  1EFI D;  2L1B A;  4JYA L;  2MP1 A;  1GVP A;  5BR8 L;  1W6K A;  3S24 A;  4A3C G;  3RD4 A;  1F9P A;  4DR4 L;  2F3W A;  5CYU A;  1VQZ A;  2ZT5 A;  2CHB D;  3DUZ A;  2NZO A;  3HKZ E;  4FXK C;  5JOB A;  1WNL A;  2NTT A;  1Q81 C;  1A15 A;  4BS9 A;  2NUC A;  3T1Y L;  2YU9 B;  4DK6 C;  3OIQ A;  4RGN A;  2PYK A;  4IO9 A;  4OO1 G;  2ZTG A;  1VQH A;  5EPL A;  1GHJ A;  3NEL A;  1A3V A;  4GKK L;  2IHE A;  4UP9 A;  3VQY A;  3HRI A;  2CW0 D;  3A7A A;  1N33 Q;  1CHP D;  3U50 C;  2L0C A;  4FVM A;  1DOL A;  4KLK A;  3RZD B;  2UUA Q;  3EBE A;  2O4X A;  1IL8 A;  4GS3 A;  4CH4 A;  2NVY B;  1IL2 A;  3OOC A;  3PSI A;  2L4N A;  1ZXT A;  1PH3 A;  2L9H A;  1H4S A;  5FKA C;  2KHJ A;  1VQD A;  2CKZ B;  4ZKC B;  3DSQ A;  2AHO B;  4LUZ A;  2B2W A;  1EEF D;  3SK6 A;  1Z7N A;  1SE2 A;  2D9U A;  4P72 A;  1K0S A;  1J8I A;  1PH9 A;  3D8G A;  1F9S A;  4CHT B;  3S1N H;  2R6G A;  4HWS A;  3IKL A;  4HWO A;  3PUV A;  2XTI A;  4JI8 Q;  3I70 A;  2GVB A;  3VR4 A;  2R93 G;  3J7Y W;  4X5O A;  1HRJ A;  1I6V C;  2CFM A;  1DYQ A;  4MTK A;  2ZT6 A;  4B3T Q;  1BQQ T;  4CKB A;  1Q46 A;  2VUM G;  2RQX A;  1ILQ A;  3TS0 A;  2PMF A;  1EOV A;  2PI2 A;  3KDF B;  2JA6 G;  3MFG A;  5F2D A;  3U9S A;  2ZJR A;  1ASY A;  4A3K B;  3S17 B;  3M3Y B;  1E3P A;  4IUN A;  1GUT A;  4YPF A;  2ART A;  3PIO 3;  1H9K A;  3BVG A;  2GVA A;  3K59 A;  4YDQ A;  1TWA H;  1NSN S;  4XYQ A;  2DQ3 A;  2OWO A;  3T13 A;  3A56 A;  1R4P B;  2TMP A;  3IL8 A;  1A62 A;  4ID6 A;  1SJH D;  5M3F H;  3NQI A;  3CCQ A;  2SEB D;  4HR7 B;  3J81 i;  1KIX A;  1PRT C;  3RMH A;  3CW2 C;  1TWH B;  3MWY W;  5J3B A;  2DNE A;  2RCN A;  4IUT A;  3OIP A;  5CC4 A;  4GLA C;  3X3N A;  2RVL A;  3CC2 A;  2YYZ A;  3VR6 A;  4IOC A;  4BWA A;  3EA6 A;  4E6I A;  4YRP A;  4C1N I;  3KF8 B;  5M5Y B;  4DR1 Q;  4YYE A;  3PIO A;  2WAC A;  1NJ1 A;  3J81 c;  2H4O A;  4KTA A;  3V96 A;  1JOR A;  3CQZ H;  3L9A X;  4PMC A;  1CZW A;  4X6A H;  2CGH A;  1Q86 C;  3BVZ A;  2QIL A;  4BWG B;  1D5Z C;  2C8M A;  4PG3 A;  4LFB L;  3K7A B;  5FLM H;  4A3F G;  2NYZ D;  4H2Y A;  4C3J G;  1KOG A;  2DVE A;  3MXP A;  1ROD A;  3IG2 A;  4ZTZ B;  1VS0 A;  3V05 A;  1WTR A;  2QF7 A;  2CQO A;  2Z4H A;  2VL6 A;  3RN5 A;  3GTM B;  1XYI A;  4DV1 L;  2KHS A;  2F0I A;  4X3U A;  3V7S A;  3ZJY C;  2WB1 G;  1J5W A;  2Z0S A;  3CHB D;  1TY2 A;  4JW0 A;  2HDM A;  1XMO L;  3F8T A;  1O7Y A;  3F2C A;  3E9I A;  3CCE A;  2WP8 J;  4LUV A;  3RIR A;  1FNW A;  4ME3 A;  3PIP 3;  2ASB A;  1STN A;  2DZ9 A;  4OON A;  1QNK A;  4GKK Q;  3QTC A;  2HT1 A;  1PYB A;  3OD1 A;  4A3B B;  5ELE A;  2M9V A;  3B6Y A;  2G9H D;  2PZU A;  1EIY A;  3GTJ B;  5KNB A;  1I3Q H;  4H2W A;  1TKW B;  2ALY A;  1X3Q A;  1F9R A;  2PO4 A;  1QZG A;  4KD3 A;  3GTP H;  5ELF A;  3OMG A;  1U4R A;  4HSP A;  2EAY A;  4DUZ L;  2CH4 A;  1NJ2 A;  4TKO B;  4HIK A;  5KYL A;  1OTC A;  4LF8 L;  4ZQ3 A;  4IPD A;  1SYG A;  1Y8P B;  2B63 G;  2ZJP A;  4HWT A;  3VR2 A;  1VMC A;  3KBX A;  3CME A;  1ADJ A;  4BW9 A;  1B76 A;  3HOZ H;  3M4Y A;  2JA7 B;  3P8Y A;  4QGU A;  2B2T A;  2DQ0 A;  1VQ7 A;  4XEM A;  4IJL A;  1YJN A;  2JA8 H;  5C0X H;  3HOW H;  4PZ6 A;  4C2M B;  3GTO H;  2UUC Q;  4YWM A;  3IRB A;  3I4L A;  4XTZ A;  3CRK C;  3CCR A;  1ET9 A;  1Q90 A;  1GUO A;  3HFV A;  1NY4 A;  1SNM A;  2VQF Q;  2AMC A;  3MEY A;  3REU A;  4J15 A;  1SYB A;  1G2S A;  2EYJ A;  1Y1V G;  4YIJ A;  4L6T B;  2DN8 A;  1SMY C;  3I4N G;  3NQT A;  4AQY L;  4A3E B;  1MJE A;  4K8J A;  3F2D A;  4X66 Q;  2E10 A;  5E3I A;  3PO3 H;  1I50 B;  1XWE A;  4A4I A;  3KLW A;  4DV5 L;  1RTN A;  3SK5 A;  3F2U A;  2K05 A;  1SRY A;  1B3A A;  1STY A;  1QF6 A;  4RCO A;  3TP7 A;  3J7Z C;  2ZZG A;  1WU7 A;  5COR A;  2R92 H;  5A2Q L;  2QW7 A;  1BOS A;  3MEF A;  4H2X B;  4H02 A;  3WOE A;  1BCP C;  2R7Z B;  1CTM A;  2UUB L;  3NWS A;  2WIN B;  4DR5 L;  2E5A A;  4XYO A;  3I56 A;  2KHI A;  3BJU A;  1CM9 A;  4TRD A;  1EYD A;  3TEH B;  2ZM6 L;  4DAY A;  2EZV A;  1NJI C;  4X3S A;  2HIV A;  1FGU A;  4CDC C;  2EYO A;  1V9P A;  4KY5 A;  2DZC A;  1A3U A;  1IHZ A;  2F0M A;  2HQL A;  1EQQ A;  3S2H H;  1MJC A;  1KDB A;  2CQA A;  3PCO B;  5ISR A;  3E5S A;  3MXU A;  2D5D A;  1O80 A;  1IBM L;  2EYL A;  1DXM A;  2VUM H;  1L1O B;  3P8T A;  1D6E C;  1YVC A;  2CIM A;  2JA6 H;  1YIT A;  1A3T A;  2DXU A;  4XU0 A;  5COY A;  3VR5 A;  5ELC A;  1J5E L;  3J81 E;  1E7Z A;  5C5M A;  3H3V H;  4S3S A;  1M4V A;  4M8A A;  2EYP A;  2V4D A;  3HKZ G;  4H2U A;  1RIQ A;  3PF4 A;  1GUG A;  4DV4 Q;  2A68 D;  1TWC H;  2DJF C;  4HJA A;  5FOB B;  3V8J A;  3G6J B;  1T5E A;  3IKM B;  4P3N A;  1HFN A;  1PTO C;  2A8E A;  1XMQ Q;  1KMM A;  1AE2 A;  4WI1 A;  4YRF A;  1STH A;  2A6H C;  5C44 G;  1PH7 A;  3R93 A;  1HFG A;  4YHH L;  2CWA A;  5CV7 A;  2Y0S E;  2B2W C;  5HY6 A;  4DAV A;  3P1H A;  3CCJ A;  4PZ8 A;  4QY7 A;  5LMN W;  4XTV A;  4OP0 A;  3QO8 A;  5K36 G;  3L2P A;  2BE5 D;  4NB3 A;  4AH6 A;  3D3R A;  2YV5 A;  1CQV A;  1S5C D;  4P73 A;  1S3O A;  5C4J H;  3M4O H;  4A3M H;  1G29 1;  2ZT8 A;  4IUR A;  1I94 Q;  1R9T B;  4YRQ A;  1KTK A;  2X6G A;  4DFA A;  1V8Q A;  3F2B A;  4A3F H;  3CCL A;  2VXW A;  3SDZ A;  4P74 C;  4BY1 B;  1TWG B;  2HD3 A;  2LKV A;  4LF9 L;  1IBL Q;  1LTR D;  1K0R A;  1HCZ A;  2R61 A;  4Q0F A;  3L4G B;  1B1Z A;  1VQG A;  3IKJ A;  1YHA A;  1XNR Q;  2EY6 A;  4DAP A;  5D3D A;  3TSS A;  3S1Q H;  4IPH A;  1SSO A;  1F2Y A;  2XGT A;  5EPJ A;  5TSS A;  3EFX D;  5C4X G;  5DEH A;  3T1H L;  3J7A 5;  1BXT A;  1RHP A;  5G3L F;  3A32 A;  5IT9 c;  4JV5 Q;  1STB A;  2CJB A;  4LNQ A;  4LMQ D;  4P71 A;  1EUJ A;  1HHV A;  1U9R A;  4MTN A;  4XT1 B;  4EGV A;  1PH8 A;  12AS A;  1WYD A;  4QIW B;  1B7Y A;  3AFQ A;  1I6H H;  3A8J E;  1H9J A;  2DY8 A;  2Z6B A;  2BDO A;  3TEG A;  3UH0 A;  4IFD G;  3QWN A;  4B3S Q;  1BUV T;  4U67 3;  4TQU S;  1CUK A;  4EVO A;  4FF2 A;  3I4M G;  5DAU A;  1JIC A;  1USY A;  2K5V A;  4B3R L;  5IYB G;  4A3D B;  2Z9H A;  4KD4 A;  3HOV H;  2X69 A;  1X01 A;  5M5W B;  4PZ7 A;  3A0J A;  4GLV B;  4GLX A;  1U4M A;  4YRC A;  4H7B A;  3L1A A;  1BBU A;  4C3I H;  1JB3 A;  2BA1 A;  1E1T A;  4EQO A;  2IY5 A;  2MQH A;  1TR5 A;  1LAC A;  1B9N A;  4GKJ Q;  4C3H B;  3A5Z B;  2AQ3 B;  1BBW A;  3TP5 A;  1CHQ D;  2WII B;  3Q0A A;  2I46 A;  1X55 A;  5LHY 1;  3PO2 B;  2B63 H;  4K8I A;  4OWX B;  4JI6 Q;  1QJO A;  4B08 A;  4XIG S;  3DWA A;  4Y7N H;  1D7Q A;  3FKI G;  3M9B A;  4G7Z C;  4FP5 D;  1IXR A;  2N3S A;  5IGG A;  3GTG H;  2K14 A;  3RZO H;  1EY4 A;  3G7L A;  4DPG A;  4OHJ A;  4BY7 H;  4ILW A;  1Z47 A;  3L2Z A;  4G7O C;  1XX8 A;  1FD7 D;  5EKI A;  1Y69 U;  5NUC A;  2AUJ D;  2WAQ B;  1PFN A;  4AYB G;  2HQE A;  1LT6 D;  2VS1 A;  5E3F A;  1KAB A;  4FO2 A;  1M90 C;  4UHV A;  1X2G A;  4G57 A;  1G8Z D;  3VA5 A;  2OT2 A;  3A5U A;  2EJF A;  1RIP A;  2ARU A;  4BBR B;  5I6W A;  2PPB C;  4LF5 L;  4G85 A;  2PW7 A;  3NP8 A;  2R3Z A;  2FHT A;  1QUQ B;  4I7A A;  5IGB A;  3HS0 C;  2JA5 B;  3CMQ A;  1SN8 A;  4XU2 A;  4KK7 A;  1HXD A;  2E2I H;  2E74 C;  2ZXF A;  4PMW A;  3N52 A;  1IYJ B;  2XIW A;  1WTX A;  1KNE A;  1VQ8 A;  1EY0 A;  4YRR A;  2EY2 A;  5E7N A;  2RHQ B;  3M7G A;  1YGB A;  2OEO A;  3UDG A;  1ZYR C;  5AJ3 Q;  2ZZE A;  5C51 B;  1TT2 A;  3TME A;  2IX0 A;  4TVW A;  2ID0 A;  2EY1 A;  3OYY A;  5JPN C;  2B2T C;  1V1P A;  2ODR C;  5I2Y A;  1VQA A;  5FLX L;  3G6E A;  1WD1 A;  3ULL A;  1PH4 A;  1XJV A;  1N33 L;  1C8C A;  1FGB D;  4ZRZ A;  1YI2 A;  2UUA L;  3OW7 A;  5ELN A;  5C5L A;  2OTJ A;  1CKO A;  4X62 Q;  1G91 A;  5F5W A;  1I4R A;  4ODG A;  1X3F A;  2SNM A;  3PUZ A;  3BYT B;  1WTP A;  1PRT D;  3OWE B;  3I55 A;  1NJ8 A;  3URY A;  1GUS A;  5IWA Q;  4U68 A;  3I8Z A;  4JI8 L;  1SLJ A;  3RR5 A;  4DNR B;  3SHL A;  1IBK Q;  1HNZ Q;  1C7Y A;  4DR2 Q;  4DK1 A;  4HAE A;  1XXG A;  5FLM G;  4HED A;  4JG2 A;  1WI5 A;  1FJG Q;  1K3B C;  5C44 H;  3W5O A;  4B3T L;  1EWH A;  3HOY B;  1EY9 A;  3HGB A;  2BDN A;  1MD2 D;  3NBH B;  5IT9 E;  4CS4 A;  1QG7 A;  2K28 A;  2Q2I A;  3LGJ A;  1Y1W H;  4C56 C;  1ZKO A;  3IFD A;  5M3F B;  3T4A C;  4TWA A;  4Q15 A;  1O7Z A;  5DM6 3;  4LVL A;  2NWG A;  1CKN B;  3PUY A;  1KNA A;  3I4O A;  5C3E B;  1Z7T A;  4KHZ A;  2F0T A;  3SK4 A;  1KMN A;  4IAL A;  1UWV A;  4TSS A;  3W2D A;  3E9H A;  3GV6 A;  4K87 A;  1KAA A;  2PQA B;  4KKT A;  4KR2 A;  3FDT A;  4POG A;  5HGT A;  2QHV A;  3P20 A;  1X3E A;  4F8M A;  4H2V A;  3HXW A;  3P7J A;  5FJ8 G;  3GTQ H;  3ITP A;  2VQE Q;  4DV7 Q;  2H1E A;  1SYD A;  5C4X H;  4P75 C;  3UE0 A;  4EQP A;  4DR1 L;  1E2W A;  1K83 H;  3S16 H;  1UAP A;  3JAM i;  4GOP C;  1HA5 A;  4XU3 A;  1GOZ A;  1LLR D;  3J7A V;  3G1Z A;  1P16 A;  2Q8I B;  5K1X A;  4YRJ A;  1I4G A;  2BA0 A;  1AP0 A;  3KF6 A;  3K57 A;  2J4X A;  4JI5 Q;  5EKK A;  1HA6 A;  1EVL A;  5A35 A;  1Z6H A;  3QO5 A;  4A3J H;  2XRS D;  2LS0 1;  3DEO A;  1MIU A;  4A3I G;  1W66 A;  1EQT A;  2ICI A;  3D4R A;  2RDH A;  3R2I A;  5J22 A;  3K5L A;  2NVX H;  2IW3 A;  1JE4 A;  3QO2 A;  4X64 Q;  1BF4 A;  2ZT9 C;  4XDX A;  3STB D;  3JAM c;  2PCF B;  1SNQ A;  1HR0 Q;  1NYQ A;  4P3O A;  1XNQ Q;  2I4N A;  2Y0S G;  3HOW G;  1Q12 A;  2E5L Q;  1GJX A;  3DEP A;  4A93 B;  4P73 C;  3KLS X;  4KHP Q;  4F7X A;  2E2H H;  1RKN A;  2PMZ B;  5M5X B;  4K14 A;  1NR2 A;  1PV4 A;  1E2V A;  2WV6 D;  2EYM A;  4FF1 A;  3L0O A;  3FKI H;  3TRE A;  2L11 A;  2XWJ B;  2B39 A;  2RA4 A;  3J7A F;  4GNX A;  4CBV A;  3V2T A;  5E4X A;  3UDF A;  1C4Q A;  2J0T D;  3PO3 G;  3LC0 A;  2KCM A;  1ENA A;  2HIX A;  3HXY A;  4ZK9 B;  2Z6K A;  1EL0 A;  1ONL A;  3ULP A;  2MO1 A;  4YCW A;  3NTK A;  5CV8 A;  5JEA J;  3AU7 A;  4RCN A;  2LY7 A;  1E22 A;  3LSS A;  2KUM A;  2MGS A;  2A8V A;  2R92 G;  1HC7 A;  4RQF A;  2HUG A;  4P71 C;  1EYA A;  4RA8 A;  1IW7 D;  1RTO A;  3WOF A;  3EFS A;  3DHQ A;  3I7F A;  1WLE A;  3KJP A;  3HY1 A;  2OF1 A;  4FDB A;  4QIW E;  2IL8 A;  2RF4 A;  1YFS A;  1PYS A;  4UP7 A;  1USY C;  1V43 A;  2UXB Q;  1UEA B;  2JA8 B;  2QHU A;  1R4Q B;  1HNX Q;  1GO3 E;  1DM0 B;  2N8N A;  4LF6 Q;  5GRO A;  1SYF A;  5C3X A;  3I3C A;  3HFZ A;  4P74 A;  2RHS A;  4G4K A;  2UUC L;  1ILP A;  5KNN A;  4PNY A;  4OEM B;  1D1K A;  1X3P A;  3ERS X;  3RGL A;  1H95 A;  4CKE A;  4IUU A;  3H0G B;  1O78 A;  4CJ1 B;  2VQF L;  1A8V A;  1Y8N B;  1B70 B;  4YRO A;  2Z1C A;  2HCI A;  4IN3 A;  4TVA B;  2DGY A;  4OX9 Q;  4LVJ A;  2C9O A;  3DWQ A;  2NVQ B;  2AQ2 B;  3C46 A;  1NNX A;  2N55 A;  4NPS A;  1HQM C;  4X66 L;  3CP0 A;  1S5B D;  1SR3 A;  1LTL A;  1JE5 A;  1A2T A;  4DV3 Q;  3S15 H;  3NXW A;  3MF1 A;  2DU7 A;  4L5R C;  2G4C A;  2F0W A;  5L37 A;  1CKM A;  4RHR A;  4XQN A;  5IYD G;  1BO0 A;  2VW9 A;  1K73 C;  3S2D H;  1B50 A;  1BNZ A;  4UY8 C;  3QIA A;  5JJI A;  2WAQ E;  2LXJ A;  1H9S A;  1I4X A;  5ELB A;  1D5M C;  2F03 A;  1G5H A;  1VQM A;  2E2J B;  3S14 B;  4J6H A;  1TWF H;  4POF A;  2F0N A;  1PTO D;  2XVS A;  3H3V C;  2R93 B;  1PRT B;  2EJF C;  4YRL A;  2KED A;  1BVS A;  4A3M G;  3MFY A;  3VQW A;  1AH9 A;  3CPW A;  3K81 C;  4JI7 Q;  4XU1 A;  4FF3 A;  1YNJ D;  1IYV A;  1Z7M A;  2JA6 B;  3DWP A;  4ME5 A;  5GAG C;  2K03 A;  4YRS A;  1JQY D;  3CCM A;  4CJ2 C;  1F2Z A;  2ZIN A;  4HWP A;  1OXU A;  2F0S A;  3U58 A;  5CGK A;  1W2B A;  2XRQ D;  4RG1 A;  2NZH A;  2F0J A;  4KI0 A;  1AEX A;  4MNO A;  2Q7E A;  2EY5 A;  1ADY A;  1KRS A;  2OCE A;  4X65 Q;  4K2K A;  1TWC B;  1PZJ D;  3TDQ A;  4L63 B;  3TZU A;  1X9N A;  4DV4 L;  1SND A;  1JR0 D;  1GXD C;  1Q8I A;  2ARS A;  3S1R B;  3HZX A;  3VBB A;  3HP3 A;  3EFR A;  4DR3 Q;  3JAM E;  1YNN C;  2JA7 G;  3UGT A;  2ZXP A;  3W1B A;  1TQO A;  3FP9 A;  1XMQ L;  2I4O A;  5I2X A;  4A3G H;  2F52 A;  3J81 L;  5JJL A;  4OLF A;  2DJG C;  5FJ8 H;  2PME A;  3DM3 A;  2JN4 A;  5DM7 3;  5T1G A;  1RDP D;  3KLR A;  3OMC A;  4XTY A;  3HOV G;  4RFB A;  1EIF A;  5HGQ A;  4BBS G;  3S1M B;  4C3I G;  1SDF A;  4WRD A;  1W6J A;  2F0K A;  3K8A A;  5CMD A;  2CJ9 A;  1WOC A;  1YHB A;  4V19 0;  4C3J B;  3WDN A;  3PIP A;  1I94 L;  2NVT B;  1S4Z A;  1D8L A;  5IY0 A;  2JQO A;  3AEV A;  4LNS A;  3VYR A;  1TS3 A;  4A3I H;  1YHQ A;  1QZH A;  4WFN 3;  1EZ6 A;  2ICE C;  4LJZ C;  2OTL A;  3R8B A;  2EDG A;  5I6Y A;  3RZD H;  1IBL L;  4KKU A;  2EE1 A;  4IZ8 A;  3G71 A;  2NVY H;  4JI2 Q;  1F2L A;  2NN6 I;  1AW7 A;  1XNR L;  1CZG A;  3I72 A;  4RHS A;  4BY7 G;  1XTC D;  3BFM A;  1HQR D;  4R4T A;  2AKW B;  2K52 A;  1N34 Q;  4OO1 I;  1IKL A;  1CFM A;  3AMU A;  3J80 i;  1TU2 B;  4JV5 L;  2DXT A;  4DK0 A;  2LFN A;  1X6O A;  4AIM A;  2I07 B;  4RKL A;  1SE4 A;  3OPO A;  5IGE A;  3CCS A;  4HID A;  1N8R C;  1PLF A;  4ULL A;  2I0Q A;  2NBF A;  3SR1 A;  4B3S L;  3TS2 A;  3I2Z A;  2CH4 W;  1TS2 A;  2FFK B;  4HTH A;  1B4O A;  2FIN B;  2CW0 C;  1B44 D;  3J80 c;  2LMC B;  2DUD A;  2KCT A;  2K1B A;  4CKC A;  1B8A A;  5DLQ E;  4RAU C;  2K5W A;  3S17 H;  3HTZ A;  3M3Y H;  1D1I A;  1X56 A;  2WKC A;  4RKB A;  5EGT A;  2VB3 X;  3V7C A;  4GKJ L;  1H4T A;  3BU2 A;  1RL2 A;  3E0J A;  2PNH A;  3ERR A;  1BKB A;  3SGI A;  1NNH A;  4JI6 L;  3I91 A;  5KEE A;  3GTL B;  4QUC A;  2O2L D;  1U4P A;  1BR9 A;  1H9R A;  3CCU A;  4O1N A;  3HXX A;  2PZW A;  1NYR A;  3V8L A;  1LTT D;  1TWH H;  1AFP A;  1JJC A;  5C6A A;  1VQ5 A;  4LF7 Q;  5LMN Q;  4R8I A;  2F0E A;  3C1E A;  1BCP B;  4N9P A;  1L1O C;  1JC7 A;  1OO9 B;  1ESF A;  3RUZ A;  3MEH A;  4DA2 A;  1SEB D;  2ZR2 A;  5M5Y H;  1Y1V B;  2I5M X;  4OWT B;  3GTK B;  2JJQ A;  3MVV A;  2PMZ E;  2QCP X;  2UU9 Q;  3I4N B;  3RUX A;  1NBW A;  3BZC A;  5FK9 C;  1PH5 A;  2ZTE A;  2BH2 A;  3FPU B;  2K5D A;  1KC8 C;  4GNX C;  2E8G A;  4P75 A;  2D62 A;  3K7A H;  2K75 A;  2E65 A;  4GOP A;  4ZUJ A;  1JWM D;  1V1O A;  3E6Z X;  3M7N A;  4BY1 G;  2Z6K C;  3SK8 A;  3G4S A;  3W3S A;  1QVC A;  1VCI A;  4KHV A;  4C1N K;  3GTM H;  5IYD H;  3QNE A;  4TQF A;  2F0D A;  2TSS A;  1AE3 A;  1J9O A;  1K3R A;  4HA8 A;  1Q8K A;  2Q2H A;  2MUY A;  4YCU A;  1SES A;  2F3I A;  3A7A B;  1OXS C;  1PVO A;  1KHI A;  1VF5 C;  1HZB A;  3A31 A;  3HXZ A;  3KLS A;  1Y8O B;  3NTI A;  4TQD A;  1L0X B;  3N6R A;  5AJ3 L;  3ICA A;  2JSO A;  1Y1W G;  1PHJ A;  2X6L A;  2OQK A;  1PTO B;  4K6D A;  1NCV A;  4IUP A;  3LX0 A;  2P5I A;  2CVR A;  1G6P A;  1CSP A;  2ZGW A;  3L7Z C;  1EQR A;  4UAI A;  4A3B H;  4HJ9 A;  1HTL D;  3W3A A;  4ABN A;  1HJP A;  2QA4 A;  2KA7 A;  5C0X J;  3GTJ H;  2F0O A;  4DQ2 A;  1WTW A;  3VQX A;  1SRU A;  3MF2 A;  1T5X D;  4MN3 A;  4FXG C;  5M3M G;  4X62 L;  1SET A;  1KLG D;  4A75 A;  2ZXR A;  3NWT A;  1NR4 A;  2A5H A;  2A1A A;  3HXV A;  3KYH C;  3Q23 A;  4DV0 Q;  4C3H G;  1TS4 A;  3K5M A;  5IWA L;  1HNZ L;  1IBK L;  2KOL A;  1ENC A;  4R4Q A;  4DR2 L;  1FVI A;  3LWU A;  2JA7 H;  1C9O A;  3HKS A;  5JAV A;  2HHH Q;  4BA1 I;  4CGY B;  2BOS A;  2R7D A;  4A3J G;  1KDC A;  1YEZ A;  2F0P A;  5GAH C;  4M1U B;  1QVG A;  1FJG L;  4C2M H;  4NDX A;  1ICF B;  3A7R A;  5H1S E;  1PA6 A;  2ZTD A;  4EO4 A;  1MSG A;  4QB4 A;  2C5C A;  1SFO B;  4BBS H;  1TII D;  3CU7 A;  4OGQ C;  1K28 A;  3PUW A;  3W1G A;  3CPF A;  3SVM A;  4YY3 Q;  2A6E D;  2A19 A;  4RQE A;  1TY0 A;  4QJF A;  1GGM A;  3KDF A;  1SXT A;  2QKI C;  2K32 A;  1UE1 A;  4A3E H;  3HOU B;  1I50 H;  4GN4 B;  4DF7 A;  2F1M A;  1WCM G;  4TTV A;  3J80 E;  1YFT A;  1K8O A;  1HPC A;  5IOD A;  4K5W A;  2MO0 A;  3QOJ A;  4YWK A;  2RCF A;  4YWL A;  1Q1E A;  5IT9 L;  4LF4 Q;  1Q7Y C;  5ELO A;  3A74 A;  4FYD A;  3UE1 A;  3M85 A;  3AFP A;  1O7I A;  2VQE L;  4DV7 L;  2E2D C;  2DJZ A;  4K88 A;  1XPO A;  3R3O A;  1QVF A;  3BZK A;  4L5Q A;  3RL6 A;  1EIG A;  3ERQ A;  1K8M A;  4JCV E;  1IYU A;  1NJ5 A;  3M4P A;  2A69 C;  2JE6 I;  3KF8 A;  4JI5 L;  3I4M B;  3PUX A;  2HNI A;  1DOK A;  2K4K A;  2I5L X;  3BVM A;  4DUY Q;  4JBK A;  3M4Q A;  4X64 L;  2I5H A;  5GAD C;  4Q5V A;  1MHW C;  5CV5 A;  5FLX c;  3RF1 A;  1X65 A;  1HR0 L;  2ZNI A;  4H44 C;  4DV2 Q;  1VQP A;  1XNQ L;  1N32 Q;  4YRI A;  1PTO F;  2E5L L;  3QB3 A;  2GA4 B;  4LAA A;  2KJX A;  4H0L C;  5J39 A;  1WVL A;  3BDL A;  4KHP L;  4HMI A;  2IWH A;  2K33 A;  1VQO A;  4XTU A;  3GO5 A;  1HH2 P;  3Q24 A;  1EIY B;  3FKI B;  4PQX A;  3GP7 A;  2ALY B;  2A74 C;  4KN4 C;  5EBD A;  4YRN A;  1NMG A;  4CH5 A;  2JXM B;  5JJZ A;  4CDE C;  1VQ4 A;  5GAE C;  4EQN A;  2KBN A;  5JPM C;  1STA A;  4YRK A;  3MHB A;  4QCL A;  2RSO A;  2Z4I A;  4JI3 Q;  4NMZ A;  3NE5 B;  2MFI A;  4AYB B;  2ZNJ A;  1BDO A;  2FXQ A;  2KEN A;  4LFA Q;  5IYC H;  2C35 B;  4CS2 A;  3RKX A;  3R07 A;  3S1N B;  4QQB X;  2F0Q A;  4QL5 A;  1R9T H;  3H91 A;  3U4Z A;  1JJG A;  3NHH A;  3FMC A;  3UDX A;  1DGS A;  4BY1 H;  1TWG H;  2DNC A;  2A68 C;  2AMC B;  2O5J C;  1LTI D;  2UXB L;  3D0F A;  4J1M A;  1Q82 C;  1HNX L;  3RN2 A;  1KL9 A;  1RD9 D;  2R7F A;  3K80 C;  1L0W A;  5JEA H;  3HOX G;  2QDL A;  3K5N A;  4LF6 L;  4ZAI A;  4DR6 Q;  1C0A A;  4K86 A;  4HIM A;  4DAM A;  3NTH A;  4YP0 A;  1KDA A;  3TUP A;  3BYY B;  1HZA A;  3A7U A;  4PHC A;  4N8F A;  1EOT A;  3MQZ A;  1X32 A;  4DK3 C;  1SNP A;  1HNW L;  4K5X A;  1TWA B;  2F0U A;  4XTX A;  2BE5 C;  3D6C A;  2OXP A;  4OX9 L;  2Q5H A;  1CI3 M;  3D31 A;  2LXK A;  3OW2 A;  5JJK A;  3H15 A;  1SJE D;  4FNF A;  3FJP A;  2KQ3 A;  1PDQ A;  2K5H A;  4KJO A;  4DV3 L;  5EQ0 A;  4XT3 B;  3BDC A;  1ATI A;  4IOA A;  4HIO A;  2F0V A;  3CC7 A;  4A3D H;  3CXC A;  4DAY B;  1Z9F A;  5M3M H;  5M5W H;  2CJA A;  1CSQ A;  2DTH A;  4A3G G;  3AQQ A;  2VY3 A;  3I90 A;  1TS5 A;  3EIV A;  4DU9 A;  1RJT A;  2EXD A;  1PH1 A;  2F3V A;  4A93 G;  4KQE A;  4JI0 Q;  3V7R A;  1VQI A;  2KCN A;  4H2S A;  3CQZ B;  4C3H H;  2JP1 A;  4LFC Q;  1ICW A;  1YNN D;  1SE3 A;  4HSV A;  3PO2 H;  2F0F A;  3LSQ A;  2SNS A;  4IFD I;  1G5I A;  4KJN A;  4DR7 Q;  1UE5 A;  1UUP A;  3VQV A;  4H2X A;  4R9W A;  2F0L A;  5HUR A;  4IUV A;  4HJ7 A;  2PNR C;  2DDZ A;  1LTA D;  5KNC A;  4LVM A;  4JI7 L;  2AQ1 B;  2VB2 X;  3MXN B;  5ELD A;  1G6Z A;  3S9W A;  2M00 A;  3TEH A;  3NET A;  3CKI B;  5IP7 H;  2E1H A;  2O5I C;  2ZT7 A;  1EY5 A;  4MZ9 A;  4HWR A;  1EZ8 A;  4NXM Q;  1BIB A;  2FMM A;  1STG A;  1NUC A;  4QUF A;  3PCO A;  3K58 A;  3LNN A;  2A73 B;  1M1K C;  3OHX C;  5T1I A;  5EJW A;  1L1O A;  2MPM A;  4B3M Q;  4BA2 I;  3VA7 A;  3EN2 A;  4X65 L;  3EJI A;  3ERO A;  4KMU C;  4XQJ A;  1H4Q A;  2RDF A;  2YTY A;  4BBR H;  1WCM H;  1GHK A;  4EX5 A;  3PMF A;  5D65 A;  4GN3 B;  1YZ6 A;  4DR3 L;  5FLX E;  1CK1 A;  2AWO A;  1A63 A;  3QOL A;  1MI2 A;  4J8Q A;  4CDF C;  2JA5 H;  5C4H A;  3Q6S A;  2K50 A;  1I3Q B;  4LWC A;  1EYC A;  3U9O A;  2N78 A;  1WTV A;  2EJG C;  3VR3 A;  2NN6 G;  1PFS A;  1GD7 A;  1NAP A;  1X2H A;  3T51 B;  1NE3 A;  3H0G G;  3OTO Q;  3GTP B;  1SMY D;  5KYI A;  1EIH A;  4A3K G;  2HDL A;  3ND8 A;  1XPU A;  1N36 Q;  5EKL A;  4O2D A;  1T9H A;  1RF2 D;  4A3I B;  5G3L D;  2PI2 E;  3JAM L;  2KVM A;  3E0E A;  1MBY A;  4ZTU B;  1M8A A;  4A3L H;  4R4C A;  3HOZ B;  3L3O C;  3DLL A;  5IGD A;  1E2Z A;  2CCZ A;  1S5E D;  4NXN Q;  1SYC A;  2Y0S B;  3GTO B;  3HOW B;  1BCP D;  3K0Y A;  4IQZ A;  4JI2 L;  2DTO A;  5IOC A;  1EEI D;  3BG3 A;  5IE8 A;  2SOB A;  4DV6 Q;  1HR0 W;  1B7Y B;  1A0I A;  3CRL C;  2F4V Q;  3EQL C;  2JK8 A;  3VYS A;  4LVI A;  1S40 A;  2NZ1 D;  4WJW A;  1SNO A;  1N34 L;  2EL9 A;  3L4G A;  3UI2 A;  1B3Q A;  4L5S A;  4RMF A;  1HNW Q;  4WJ3 M;  2PQE A;  2L5T A;  4DXG A;  2B8G A;  5IP9 G;  4Y52 H;  3PO3 B;  2D0P A;  2B29 A;  2ZXO A;  3UDI A;  3E3X A;  4BXX H;  2UXC Q;  1W3S A;  2IY5 B;  4KN7 C;  2EPB A;  1SE8 A;  4JPB W;  1WFQ A;  1HZC A;  1WPY A;  1UE7 A;  1K8A C;  3HOY H;  3GQB A;  2L15 A;  1KRT A;  2Q7G A;  3MC0 B;  2R92 B;  3IFT A;  4F88 A;  5LMU Q;  1CA5 A;  3VDY A;  1LM0 A;  2IX3 A;  2G5D A;  3K5O A;  3NEN A;  3RNU A;  1VQ6 A;  4YRG A;  4HVC A;  2EVB A;  4R4O A;  5C3W A;  1LT3 D;  5KND A;  4JI1 Q;  2IT1 A;  3T16 A;  4ZYS A;  4GN5 A;  1QCB D;  2QEX A;  2J7Z A;  2NTS A;  4XTW A;  2J3M A;  4OIK A;  4KY6 A;  1VDZ A;  4O0A A;  4QMG A;  3T56 B;  1XPR A;  3S2H B;  2DY7 A;  1JOO A;  1YB3 A;  5C3E H;  2A6H D;  5GQO A;  4HMJ A;  3Q22 A;  4IPG A;  4IFD J;  1H9M A;  1O7L A;  3A5Z A;  2VUM B;  1I4H A;  3QR8 A;  3HOX H;  3NPP A;  5LMN L;  4LF7 L;  2FMC A;  4K0K Q;  4A3B G;  2Z8L A;  2RDG A;  1AN8 A;  2UXD Q;  1CT1 D;  4JI4 L;  3P75 A;  3MA2 B;  3RAC A;  3OWF A;  3CMA A;  1YJW A;  1Q1B A;  1B53 A;  1WTH A;  3TZD A;  2UU9 L;  2B2U A;  2ZZF A;  4DNI A;  2K5N A;  4LK1 C;  3PV0 A;  3C3L A;  2P5Z X;  3H6M A;  4YCV A;  4WJ4 A;  1LTG D;  4OEL B;  5CV6 A;  4TVY A;  1JWS D;  3KOJ A;  3D4W A;  3DM1 A;  2ZJQ A;  4RDX A;  3SE0 A;  4JYA Q;  4XEO A;  1U5K A;  3G48 A;  2N88 A;  2XN9 C;  5FO7 B;  5BR8 Q;  2KEE A;  4DR4 Q;  1H4V B;  4AYB E;  3T53 B;  1V1P B;  4A93 H;  5BN4 A;  3LWE A;  1JB7 A;  1QUQ A;  3FPP A;  1XTD A;  3T1Y Q;  1LAB A;  5C4J B;  1VQ9 A;  5M5X H;  3H09 A;  3M4O B;  4A3M B;  1DON A;  1P8L A;  5I9P A;  2C7I A;  1FL0 A;  2B2V C;  4MIU A;  2YU9 H;  4H13 C;  1YFR A;  4A3F B;  4JC0 A;  3MXG A;  4ZKB B;  2EWN A;  4A3E G;  2RHQ A;  1S5D D;  4HJ5 A;  1JT8 A;  5C4Z A;  3CD6 A;  5C0X I;  3U4V A;  4PMB A;  1C48 A;  1GM5 A;  1YBY A;  2Q2U A;  5IIF A;  1F2M A;  2WB1 B;  2E75 C;  5KGU A;  3FHW A;  4OWW B;  3S1Q B;  3STB C;  4ALP A;  3NEM A;  1X3G A;  2XNA C;  1KD1 C;  1LYL A;  2M2L A;  4X3K A;  2WFW A;  3CCV A;  1SBB B;  2R7Z G;  5EBC A;  4DV0 L;  3TP8 A;  2DEQ A;  1V1Q A;  5IGC A;  4L5T A;  2D0O A;  1UE6 A;  1WQW A;  3I73 A;  2V1C C;  4F87 A;  2BCO A;  1I6H B;  1JMC A;  2MJ8 A;  2QDB A;  5I4D A;  3ND9 A;  2K01 A;  1KXL A;  2HHH L;  2B8F A;  3J81 j;  1PH2 A;  1LTB D;  5LL6 X;  4A3C H;  3HOV B;  2Q7H A;  4JBM A;  2NN6 H;  5AFW A;  4BBS B;  2FYK A;  4WF2 A;  1EY8 A;  1LT5 D;  4C3I B;  1PRT F;  3H0G H;  4OL7 A;  1KLU D;  2A69 D;  4KV6 A;  1J6Q A;  4DXF A;  4A3K H;  2Q2T A;  4OO1 H;  3C1F A;  4YY3 L;  3JC6 6;  3BS1 A;  5EAY A;  2B63 B;  3MTS A;  3X3M A;  2NVQ H;  2HCC A;  3DXJ C;  1IW7 C;  2MHV A;  1HXY D;  3NBH A;  4Y7N B;  1DD2 A;  4OIJ A;  1ET6 A;  5KRU A;  1YJ9 A;  1Y14 B;  3TBI B;  3GTG B;  3RZO B;  1NMF A;  5C53 B;  2OQ0 A;  3NK9 A;  2I4L A;  4L8J A;  2IPK D;  4BY7 B;  1PZK D;  3QG1 A;  2PW5 A;  1VQB A;  1EY7 A;  1CKN A;  2QGQ A;  3KF6 B;  4LF4 L;  1ZYR D;  4JI4 Q;  2E41 A;  3H3V I;  2PQA A;  1QOH A;  3KFU A;  4NCX A;  5I9O A;  3CC4 A;  1MSH A;  2P0L A;  2JEA I;  2E2J H;  3A8I E;  3S14 H;  2ODR D;  5IYC G;  2R93 H;  2CWP A;  1VQC A;  2ZR3 A;  1G51 A;  2B2Y A;  4LFB Q;  5EPK A;  5IP9 H;  5E4W C;  2F0G A;  3J80 L;  1HTP A;  2QHT A;  4ZCK A;  3TN2 A;  2EQS A;  4JOI A;  4CS3 A;  3PGZ A;  1B2T A;  1HUN A;  3P8V A;  4HJ8 A;  4KKS A;  3KBG A;  4DUY L;  3ONA B;  1EU4 A;  1EWC A;  4DV1 Q;  2EOT A;  3FEW X;  4DGZ A;  2E2I B;  2E3C A;  3SXH A;  1LO5 D;  5JEA G;  1VQF A;  4DV2 L;  3UGQ A;  3MXN A;  5KIX A;  1X54 A;  1STE A;  4RH6 A;  1N32 L;  1XMO Q;  1EFW A;  4GNX B;  4ZIB A;  4UP8 A;  4QF4 A;  3FVQ A;  2JYO A;  2J3L A;  3DMU A;  1II3 A;  4RGT A;  1A6X A;  2G9D A;  1L0Y B;  2FJ2 A;  2B3G A;  2AUK A;  1ML0 D;  1GUW A;  3GD7 A;  2VZA A;  3S1R H;  1JOK A;  2LSS A;  3ZYY X;  1WD0 A;  4IUQ A;  1PFM A;  4K6L A;  5M9O A;  1FNV A;  1F9Q A;  2ZTC A;  3QO7 A;  3VYU A;  4P72 C;  5CV4 A;  1PXU A;  1YNJ C;  4A3D G;  4JI3 L;  4V0B A;  1JWU D;  1PYS B;  2AWN A;  1VMP A;  4LFA L;  3HKZ B;  1I5F A;  4DUZ Q;  4N8X 1;  3S1M H;  4YRT A;  3NUC A;  4LF8 Q;  1OXV A;  2EJG A;  1L2F A;  2RSN A;  1AZQ A;  5CBA E;  1SRO A;  4RWS C;  1QNU A;  4CJ0 B;  1ASZ A;  2Q5I A;  3HFZ B;  4FXD A;  4C3J H;  1OXT A;  2RHS B;  1S72 A;  2NVT H;  1OXX K;  1U0L A;  3HOU G;  3PO2 G;  2EYH A;  3KK7 A;  2RBM A;  4MHE A;  2K7V A;  4YRM A;  2VNU D;  2IJ0 A;  3D6W A;  1E24 A;  5J1Z A;  5C44 B;  3K7U C;  1EYG A;  4JBW A;  1HUM A;  4DR6 L;  2JA9 A;  1TXY A;  1VF7 A;  5IP7 G;  1SYE A;  2F4I A;  1EQV A;  2EYF A;  2K6A A;  5K5P A;  3RKY A;  1KAW A;  5CBE E;  4ZUI A;  1UEB A;  5A2Q E;  2NS6 A;  1Y1W B;  4ZLT F;  2WAQ G;  3MZ5 A;  4AQY Q;  4B9W A;  1B9M A;  3EVQ A;  3BDO A;  1BCP F;  4IJH A;  1GUN A;  4DV5 Q;  2YTX A;  1IZ6 A;  4CH6 A;  4K5V A;  1YNX A;  1B70 A;  4L87 A;  1EVK A;  3V8K A;  2XWB B;  1WJJ A;  1H9S B;  1RCV D;  1SAP A;  5CV9 A;  2RKS A;  4TVA A;  1SER A;  4BBR G;  1IKM A;  3R2T A;  1U4L A;  4JBJ A;  1DCZ A;  5M3M B;  1QE0 A;  4GZY C;  2ES2 A;  2EJ9 A;  1JJ2 A;  3GTQ B;  2JA5 G;  3RLN A;  3ULJ A;  4JK1 C;  3K0X A;  3RLF A;  1HZ9 A;  5C4X B;  4DNT B;  2UUB Q;  2B2U C;  3A55 A;  4UDU C;  2ZCE A;  4DR5 Q;  1K83 B;  3S16 B;  4JI0 L;  2R7Z H;  5DNF A;  5C52 B;  4NP5 A;  1WQ7 A;  2ZM6 Q;  4LFC L;  1FNU A;  1VQL A;  1D2B A;  3FRP B;  1ESR A;  4PV1 C;  1D5X C;  4LUO A;  1YIJ A;  3PQI A;  1TVX A;  3GTL H;  4DR7 L;  4LW1 A;  4A3J B;  1VQN A;  3TRZ A;  3HY0 A;  4R1J A;  1IBM Q;  2DU5 A;  2MNA A;  1LTS D;  2NVX B;  4CDD C;  4HT4 A;  4A3L G;  4O42 A;  1G2T A;  4HN7 A;  2DKG A;  3VYT A;  2E76 C;  3GDE A;  2K04 A;  4APV A;  1WTO A;  1CA6 A;  1J5E Q;  4P2C B;  3O13 A;  5FO9 B;  4RGO S;  3CF5 A;  4X3T A;  4NXM L;  1PMR A;  2JEB I;  1MKH A;  1Y1V H;  3A8K E;  1I4Q A;  2E64 A;  2YTV A;  2E2H B;  3GTK H;  3REX A;  4B3M L;  3I4N H;  3HEJ A;  3OSO A;  4G7H C;  2ATW A;  1S5F D;  1F77 A;  1WCM B;  4XXE A;  5FO8 B;  11AS A;  2I4M A;  1EY6 A;  4B9X A;  3HXU A;  4UPA A;  4DN4 M;  4R4I A;  1LUZ A;  3MAQ A;  2NB0 A;  3A54 A;  1DJR D;  4WOR A;  4XQQ A;  4YHH Q;  4BXX G;  2PZT A;  2WB1 E;  3H94 A;  3ER0 A;  2Q8R E;  3HOY G;  3A7L A;  5K1P A;  3RKW A;  1K8G A;  4KY7 A;  3A5Y A;  1ENF A;  2ENB A;  2XSC A;  1HTT A;  3OTO L;  3WQZ A;  1PH6 A;  3AYH B;  2QEJ C;  1I4P A;  1WTQ A;  1QE6 A;  1N36 L;  1NJ6 A;  4R8N A;  5E1F A;  1VQE A;  4XTC S;  4KR3 A;  3IAY A;  1PTO H;  1BIA A;  5M3F G; 
#chains in the Genus database with same CATH homology
 4EQ5 A;  4LF9 Q;  5C3E G;  2DTI A;  2H5X A;  3KJO A;  4NXN L;  1VQJ A;  4DV6 L;  3T1H Q;  2F4V L;  1VQK A;  3PZC A;  1N9W A;  4IPC A;  4G84 A;  1FYF A;  2AKW A;  3IAL A;  2UXC L;  4B3R Q;  4DKA C;  4YRE A;  5LMU L;  1SFO H;  3ICE A;  3Q8D A;  2EIF A;  1JJC B;  4JI1 L;  1E1O A;  4JOI C;  4P3P A;  3HOU H;  3RLO A;  1K9M C;  4Q6G A;  3TQY A;  1EWI A;  2BH8 A;  4K0K L;  2ZIM A;  2GN5 A;  1NTG A;  2N49 A;  2UXD L;  1SMX A;  4GOP B;  3UFG A;  2IHF A;  4H2T A;  4OXP A;  2QHS A;  3WWV A;  4E51 A;  1KQS A;  4CH3 A;  3PF5 A;  3I4M H;  3HRK A;  4LVK A;  2ZIO A;  4LF5 Q;  3CAM A;  5IYB H;  3HOZ G;  2IX1 A;  1GKH A;  4A76 A;  2JA8 G;  3F1Z A;  5C0X G;  4JYA L;  1GVP A;  5BR8 L;  3S24 A;  4A3C G;  4DR4 L;  1VQZ A;  2ZT5 A;  2NZO A;  3HKZ E;  1WNL A;  1Q81 C;  3T1Y L;  4DK6 C;  4IO9 A;  4OO1 G;  2ZTG A;  1VQH A;  3NEL A;  4GKK L;  2IHE A;  4UP9 A;  3VQY A;  3HRI A;  3A7A A;  1N33 Q;  3U50 C;  4KLK A;  2UUA Q;  3EBE A;  4GS3 A;  4CH4 A;  1IL2 A;  3PSI A;  1PH3 A;  1H4S A;  2KHJ A;  1VQD A;  2CKZ B;  3DSQ A;  2AHO B;  4LUZ A;  1Z7N A;  4P72 A;  1PH9 A;  3S1N H;  2R6G A;  4HWS A;  3IKL A;  4HWO A;  3PUV A;  2XTI A;  4JI8 Q;  2R93 G;  2GVB A;  4X5O A;  2CFM A;  2ZT6 A;  4B3T Q;  1Q46 A;  2VUM G;  3TS0 A;  2PMF A;  1EOV A;  2PI2 A;  3KDF B;  2JA6 G;  2ZJR A;  1ASY A;  1E3P A;  4YPF A;  2ART A;  2GVA A;  4YDQ A;  1TWA H;  2DQ3 A;  2OWO A;  1A62 A;  5M3F H;  3CCQ A;  1KIX A;  3J81 i;  3CW2 C;  5J3B A;  2RCN A;  4GLA C;  3CC2 A;  2YYZ A;  4IOC A;  4BWA A;  4YRP A;  3KF8 B;  4DR1 Q;  4YYE A;  3PIO A;  1NJ1 A;  3J81 c;  3CQZ H;  4X6A H;  2CGH A;  1Q86 C;  2C8M A;  4PG3 A;  4LFB L;  5FLM H;  4A3F G;  4H2Y A;  1KOG A;  2DVE A;  4ZTZ B;  3IG2 A;  1VS0 A;  2CQO A;  2VL6 A;  3RN5 A;  4DV1 L;  3V7S A;  3ZJY C;  1J5W A;  2WB1 G;  2Z0S A;  1XMO L;  3F8T A;  3F2C A;  3E9I A;  3CCE A;  2WP8 J;  4LUV A;  3RIR A;  4ME3 A;  2ASB A;  2DZ9 A;  4OON A;  4GKK Q;  3QTC A;  2HT1 A;  1PYB A;  3OD1 A;  3B6Y A;  1EIY A;  1I3Q H;  4H2W A;  2ALY A;  1QZG A;  3GTP H;  2EAY A;  4DUZ L;  1NJ2 A;  4HIK A;  1OTC A;  4LF8 L;  4IPD A;  2B63 G;  2ZJP A;  4HWT A;  1ADJ A;  3CME A;  4BW9 A;  1B76 A;  3HOZ H;  3P8Y A;  4QGU A;  2DQ0 A;  4XEM A;  1VQ7 A;  4IJL A;  1YJN A;  2JA8 H;  3HOW H;  4PZ6 A;  3GTO H;  2UUC Q;  4YWM A;  3IRB A;  4XTZ A;  3CCR A;  3HFV A;  1NY4 A;  2VQF Q;  2AMC A;  3MEY A;  3REU A;  4J15 A;  1Y1V G;  3I4N G;  1MJE A;  4AQY L;  3F2D A;  4X66 Q;  2E10 A;  5E3I A;  3PO3 H;  4A4I A;  3KLW A;  4DV5 L;  1SRY A;  1QF6 A;  3J7Z C;  2ZZG A;  1WU7 A;  2R92 H;  3MEF A;  4H2X B;  4H02 A;  2UUB L;  2E5A A;  4DR5 L;  3I56 A;  2KHI A;  3BJU A;  3TEH B;  2ZM6 L;  1NJI C;  2HIV A;  1FGU A;  1V9P A;  2DZC A;  2HQL A;  1EQQ A;  3S2H H;  1MJC A;  3PCO B;  1IBM L;  2VUM H;  1L1O B;  3P8T A;  1YVC A;  2CIM A;  2JA6 H;  1YIT A;  2DXU A;  4XU0 A;  1J5E L;  1E7Z A;  3H3V H;  3HKZ G;  4H2U A;  1RIQ A;  3PF4 A;  4DV4 Q;  1TWC H;  4HJA A;  3V8J A;  3IKM B;  4P3N A;  2A8E A;  1XMQ Q;  1KMM A;  1AE2 A;  4WI1 A;  4YRF A;  5C44 G;  1PH7 A;  4YHH L;  2CWA A;  2Y0S E;  5HY6 A;  3CCJ A;  4PZ8 A;  4QY7 A;  5LMN W;  4XTV A;  4OP0 A;  3QO8 A;  5K36 G;  3L2P A;  4NB3 A;  4AH6 A;  2YV5 A;  4P73 A;  1S3O A;  5C4J H;  3M4O H;  4A3M H;  1G29 1;  2ZT8 A;  1I94 Q;  4YRQ A;  3F2B A;  4A3F H;  3CCL A;  4P74 C;  4LF9 L;  1IBL Q;  1K0R A;  3L4G B;  1VQG A;  1YHA A;  1XNR Q;  3S1Q H;  4IPH A;  2XGT A;  5C4X G;  3T1H L;  3J7A 5;  3A32 A;  5IT9 c;  4JV5 Q;  2CJB A;  4LNQ A;  4P71 A;  1EUJ A;  4MTN A;  12AS A;  1PH8 A;  1WYD A;  1B7Y A;  3AFQ A;  1I6H H;  3TEG A;  3UH0 A;  4IFD G;  4B3S Q;  4TQU S;  1CUK A;  3I4M G;  1USY A;  2K5V A;  4B3R L;  5IYB G;  3HOV H;  1X01 A;  4PZ7 A;  3A0J A;  4GLV B;  4GLX A;  4YRC A;  3L1A A;  1BBU A;  4C3I H;  2BA1 A;  1E1T A;  2IY5 A;  2MQH A;  4GKJ Q;  3A5Z B;  1BBW A;  1X55 A;  2B63 H;  4OWX B;  4JI6 Q;  4XIG S;  1D7Q A;  4Y7N H;  3FKI G;  3M9B A;  1IXR A;  2N3S A;  3GTG H;  2K14 A;  3RZO H;  4DPG A;  4BY7 H;  1Z47 A;  3L2Z A;  4AYB G;  2VS1 A;  1M90 C;  1X2G A;  3A5U A;  2EJF A;  1RIP A;  2ARU A;  4LF5 L;  4G85 A;  1QUQ B;  3CMQ A;  1SN8 A;  4XU2 A;  1HXD A;  2E2I H;  2ZXF A;  4PMW A;  1IYJ B;  1VQ8 A;  4YRR A;  5E7N A;  2RHQ B;  1YGB A;  3UDG A;  5AJ3 Q;  2ZZE A;  5C51 B;  2IX0 A;  4TVW A;  2ID0 A;  3OYY A;  2ODR C;  1VQA A;  3G6E A;  3ULL A;  1PH4 A;  1XJV A;  1N33 L;  1YI2 A;  2UUA L;  5ELN A;  2OTJ A;  1CKO A;  4X62 Q;  5F5W A;  1X3F A;  3PUZ A;  3I55 A;  1NJ8 A;  5IWA Q;  4JI8 L;  1SLJ A;  3RR5 A;  1IBK Q;  1HNZ Q;  1C7Y A;  4DR2 Q;  5FLM G;  4JG2 A;  1WI5 A;  1FJG Q;  5C44 H;  3W5O A;  4B3T L;  3NBH B;  4CS4 A;  2Q2I A;  3LGJ A;  1Y1W H;  4TWA A;  4Q15 A;  4LVL A;  1CKN B;  3PUY A;  3I4O A;  4KHZ A;  1KMN A;  4K87 A;  1UWV A;  3E9H A;  2PQA B;  4KR2 A;  4POG A;  2QHV A;  1X3E A;  4H2V A;  3HXW A;  5FJ8 G;  3GTQ H;  2VQE Q;  4DV7 Q;  5C4X H;  4P75 C;  3UE0 A;  4DR1 L;  1K83 H;  3S16 H;  3JAM i;  4GOP C;  4XU3 A;  3G1Z A;  1P16 A;  5K1X A;  4YRJ A;  2BA0 A;  3KF6 A;  4JI5 Q;  1EVL A;  3QO5 A;  4A3J H;  4A3I G;  1W66 A;  1MIU A;  2NVX H;  4X64 Q;  3STB D;  3JAM c;  1HR0 Q;  1NYQ A;  4P3O A;  1XNQ Q;  2I4N A;  2Y0S G;  3HOW G;  1Q12 A;  2E5L Q;  4P73 C;  4KHP Q;  2E2H H;  1PV4 A;  3L0O A;  3FKI H;  3TRE A;  4GNX A;  3UDF A;  3PO3 G;  3LC0 A;  2KCM A;  3HXY A;  2HIX A;  2Z6K A;  3ULP A;  2MO1 A;  4YCW A;  5JEA J;  1E22 A;  3LSS A;  2A8V A;  2R92 G;  1HC7 A;  4RQF A;  4P71 C;  3EFS A;  3I7F A;  1WLE A;  3KJP A;  3HY1 A;  4FDB A;  4QIW E;  2RF4 A;  1YFS A;  1PYS A;  4UP7 A;  1USY C;  1V43 A;  2UXB Q;  2QHU A;  1HNX Q;  1GO3 E;  2N8N A;  4LF6 Q;  5GRO A;  3HFZ A;  4P74 A;  2RHS A;  2UUC L;  5KNN A;  3ERS X;  3RGL A;  1H95 A;  2VQF L;  1A8V A;  1B70 B;  4YRO A;  4TVA B;  2DGY A;  4OX9 Q;  4LVJ A;  4NPS A;  4X66 L;  3CP0 A;  1SR3 A;  1LTL A;  1JE5 A;  4DV3 Q;  3S15 H;  3MF1 A;  2DU7 A;  4L5R C;  2G4C A;  1CKM A;  5IYD G;  2VW9 A;  1K73 C;  3S2D H;  4UY8 C;  5JJI A;  2WAQ E;  2LXJ A;  1G5H A;  1VQM A;  1TWF H;  4POF A;  4YRL A;  1BVS A;  4A3M G;  3VQW A;  1AH9 A;  3CPW A;  3K81 C;  4JI7 Q;  4XU1 A;  1Z7M A;  5GAG C;  4YRS A;  3CCM A;  2ZIN A;  4HWP A;  1OXU A;  3U58 A;  1W2B A;  4RG1 A;  2NZH A;  4KI0 A;  4MNO A;  2Q7E A;  1ADY A;  1KRS A;  2OCE A;  4X65 Q;  1X9N A;  4DV4 L;  2ARS A;  3VBB A;  3EFR A;  4DR3 Q;  3UGT A;  2JA7 G;  3W1B A;  3FP9 A;  1XMQ L;  2I4O A;  4A3G H;  2F52 A;  5JJL A;  4OLF A;  5FJ8 H;  2PME A;  3DM3 A;  4XTY A;  3HOV G;  1EIF A;  5HGQ A;  4BBS G;  3K8A A;  2CJ9 A;  1WOC A;  1YHB A;  3PIP A;  1I94 L;  1D8L A;  5IY0 A;  3AEV A;  2JQO A;  4LNS A;  4A3I H;  1YHQ A;  1QZH A;  2OTL A;  3RZD H;  1IBL L;  3G71 A;  2NVY H;  4JI2 Q;  2NN6 I;  1XNR L;  4BY7 G;  3BFM A;  4R4T A;  2AKW B;  2K52 A;  1N34 Q;  4OO1 I;  3J80 i;  4JV5 L;  2DXT A;  1X6O A;  4AIM A;  3CCS A;  1N8R C;  4HID A;  2I0Q A;  4B3S L;  3TS2 A;  3I2Z A;  3J80 c;  2DUD A;  2KCT A;  1B8A A;  5DLQ E;  3S17 H;  3HTZ A;  3M3Y H;  1X56 A;  3V7C A;  4GKJ L;  1H4T A;  3BU2 A;  1RL2 A;  2PNH A;  3ERR A;  1BKB A;  3SGI A;  1NNH A;  4JI6 L;  3CCU A;  3V8L A;  3HXX A;  1NYR A;  1TWH H;  1JJC A;  1VQ5 A;  4LF7 Q;  5LMN Q;  1L1O C;  2ZR2 A;  5M5Y H;  2I5M X;  4OWT B;  2JJQ A;  2PMZ E;  2UU9 Q;  3RUX A;  1NBW A;  3BZC A;  1PH5 A;  2BH2 A;  2ZTE A;  1KC8 C;  4GNX C;  2E8G A;  4P75 A;  2D62 A;  3K7A H;  2K75 A;  2E65 A;  4GOP A;  3M7N A;  4BY1 G;  2Z6K C;  3G4S A;  3W3S A;  1QVC A;  1VCI A;  3GTM H;  5IYD H;  3QNE A;  4TQF A;  1AE3 A;  1K3R A;  4HA8 A;  1Q8K A;  2Q2H A;  4YCU A;  1SES A;  2F3I A;  1OXS C;  1PVO A;  1KHI A;  1HZB A;  3A31 A;  3HXZ A;  4TQD A;  3ICA A;  5AJ3 L;  1Y1W G;  1PHJ A;  2OQK A;  2P5I A;  1G6P A;  1CSP A;  2ZGW A;  3L7Z C;  1EQR A;  4A3B H;  4HJ9 A;  1HJP A;  2QA4 A;  5C0X J;  3GTJ H;  4DQ2 A;  3VQX A;  1SRU A;  3MF2 A;  5M3M G;  4X62 L;  1SET A;  4A75 A;  2A1A A;  3HXV A;  3KYH C;  4DV0 Q;  5IWA L;  1HNZ L;  1IBK L;  4R4Q A;  4DR2 L;  1FVI A;  2JA7 H;  1C9O A;  3HKS A;  2HHH Q;  4BA1 I;  4A3J G;  2R7D A;  1YEZ A;  5GAH C;  1QVG A;  1FJG L;  4C2M H;  3A7R A;  5H1S E;  1PA6 A;  2ZTD A;  4EO4 A;  4BBS H;  3PUW A;  3W1G A;  3CPF A;  4YY3 Q;  2A19 A;  4RQE A;  4QJF A;  1GGM A;  3KDF A;  1UE1 A;  4A3E H;  1I50 H;  4GN4 B;  1WCM G;  4TTV A;  1YFT A;  2MO0 A;  4YWK A;  4YWL A;  1Q1E A;  4LF4 Q;  1Q7Y C;  5ELO A;  3A74 A;  3UE1 A;  3M85 A;  3AFP A;  1O7I A;  2VQE L;  4DV7 L;  2DJZ A;  4K88 A;  1XPO A;  1QVF A;  3BZK A;  4L5Q A;  3RL6 A;  4JCV E;  1NJ5 A;  3M4P A;  2JE6 I;  4JI5 L;  2HNI A;  3PUX A;  2K4K A;  2I5L X;  4DUY Q;  4JBK A;  3M4Q A;  4X64 L;  2I5H A;  5GAD C;  5FLX c;  3RF1 A;  1X65 A;  1HR0 L;  2ZNI A;  4DV2 Q;  1VQP A;  1XNQ L;  1N32 Q;  4YRI A;  2E5L L;  4KHP L;  1VQO A;  4XTU A;  3GO5 A;  1HH2 P;  1EIY B;  2ALY B;  4YRN A;  1NMG A;  4CH5 A;  1VQ4 A;  5GAE C;  2KBN A;  4YRK A;  4JI3 Q;  2MFI A;  2ZNJ A;  2FXQ A;  2KEN A;  4LFA Q;  5IYC H;  2C35 B;  4CS2 A;  3RKX A;  3R07 A;  4QQB X;  4QL5 A;  1R9T H;  3U4Z A;  1JJG A;  3UDX A;  1DGS A;  4BY1 H;  1TWG H;  2AMC B;  2UXB L;  3D0F A;  1Q82 C;  1HNX L;  3RN2 A;  1KL9 A;  2R7F A;  3K80 C;  1L0W A;  4DR6 Q;  3HOX G;  4LF6 L;  1C0A A;  4K86 A;  4HIM A;  4DAM A;  4YP0 A;  3TUP A;  1HZA A;  3A7U A;  4PHC A;  3MQZ A;  4DK3 C;  1HNW L;  4XTX A;  4OX9 L;  2Q5H A;  3D31 A;  2LXK A;  3OW2 A;  5JJK A;  3H15 A;  3FJP A;  2K5H A;  4DV3 L;  1ATI A;  4IOA A;  4HIO A;  3CC7 A;  4A3D H;  3CXC A;  4DAY B;  1Z9F A;  5M3M H;  5M5W H;  2CJA A;  1CSQ A;  2DTH A;  4A3G G;  3AQQ A;  2VY3 A;  3EIV A;  2EXD A;  1PH1 A;  4A93 G;  3V7R A;  4KQE A;  4JI0 Q;  1VQI A;  4H2S A;  4C3H H;  4LFC Q;  3PO2 H;  3LSQ A;  4IFD I;  1G5I A;  4DR7 Q;  1UE5 A;  3VQV A;  4H2X A;  4HJ7 A;  2DDZ A;  4LVM A;  4JI7 L;  3MXN B;  3TEH A;  3NET A;  5IP7 H;  2E1H A;  2ZT7 A;  4MZ9 A;  4HWR A;  4NXM Q;  1BIB A;  3PCO A;  1M1K C;  1L1O A;  4B3M Q;  4BA2 I;  3EN2 A;  4X65 L;  1H4Q A;  2YTY A;  4BBR H;  1WCM H;  4EX5 A;  4GN3 B;  1YZ6 A;  4DR3 L;  2AWO A;  1A63 A;  2JA5 H;  2K50 A;  4LWC A;  2N78 A;  2NN6 G;  1PFS A;  1GD7 A;  1X2H A;  1NE3 A;  3H0G G;  3OTO Q;  4A3K G;  1XPU A;  1N36 Q;  4O2D A;  1T9H A;  2PI2 E;  3E0E A;  4ZTU B;  4A3L H;  4R4C A;  3DLL A;  2CCZ A;  4NXN Q;  4JI2 L;  2DTO A;  4DV6 Q;  1HR0 W;  5IE8 A;  1B7Y B;  1A0I A;  2F4V Q;  2JK8 A;  4LVI A;  1S40 A;  3L4G A;  2EL9 A;  1N34 L;  4L5S A;  4RMF A;  1HNW Q;  4WJ3 M;  5IP9 G;  4Y52 H;  2D0P A;  2B29 A;  3UDI A;  4BXX H;  2UXC Q;  1W3S A;  2IY5 B;  1SE8 A;  1WFQ A;  1HZC A;  1WPY A;  1UE7 A;  1K8A C;  3HOY H;  2L15 A;  1KRT A;  2Q7G A;  5LMU Q;  3VDY A;  1LM0 A;  3NEN A;  3RNU A;  1VQ6 A;  4YRG A;  4HVC A;  4R4O A;  4JI1 Q;  2IT1 A;  4GN5 A;  2QEX A;  4XTW A;  2J3M A;  4O0A A;  1XPR A;  1YB3 A;  5C3E H;  5GQO A;  4IPG A;  4IFD J;  3A5Z A;  3HOX H;  4LF7 L;  5LMN L;  4K0K Q;  4A3B G;  2UXD Q;  4JI4 L;  3RAC A;  3CMA A;  1YJW A;  1Q1B A;  2UU9 L;  2ZZF A;  4DNI A;  2K5N A;  3PV0 A;  4YCV A;  4WJ4 A;  4TVY A;  3KOJ A;  2ZJQ A;  4RDX A;  4JYA Q;  4XEO A;  1U5K A;  3G48 A;  5BR8 Q;  4DR4 Q;  1H4V B;  4AYB E;  4A93 H;  1JB7 A;  1QUQ A;  1XTD A;  3T1Y Q;  1VQ9 A;  5M5X H;  1P8L A;  2C7I A;  1FL0 A;  2YU9 H;  1YFR A;  4JC0 A;  2EWN A;  4A3E G;  2RHQ A;  4HJ5 A;  1JT8 A;  3CD6 A;  5C0X I;  3U4V A;  1GM5 A;  1YBY A;  2Q2U A;  3FHW A;  4OWW B;  3STB C;  4ALP A;  3NEM A;  1X3G A;  1KD1 C;  1LYL A;  3CCV A;  2WFW A;  2R7Z G;  4DV0 L;  2DEQ A;  1V1Q A;  4L5T A;  2D0O A;  1UE6 A;  1WQW A;  2V1C C;  1JMC A;  1KXL A;  2HHH L;  3J81 j;  1PH2 A;  4A3C H;  2Q7H A;  4JBM A;  2FYK A;  4WF2 A;  3H0G H;  2Q2T A;  4A3K H;  1J6Q A;  4YY3 L;  3JC6 6;  5EAY A;  2NVQ H;  1YJ9 A;  1Y14 B;  1NMF A;  5C53 B;  2OQ0 A;  2I4L A;  1VQB A;  1CKN A;  2QGQ A;  3KF6 B;  4LF4 L;  2E41 A;  4JI4 Q;  3H3V I;  2PQA A;  4NCX A;  3KFU A;  3CC4 A;  2P0L A;  2JEA I;  2E2J H;  3S14 H;  2ODR D;  5IYC G;  2R93 H;  2CWP A;  1VQC A;  2ZR3 A;  1G51 A;  4LFB Q;  5IP9 H;  2QHT A;  2EQS A;  4JOI A;  4CS3 A;  3PGZ A;  3P8V A;  4HJ8 A;  4DUY L;  4DV1 Q;  2E3C A;  5JEA G;  1VQF A;  4DV2 L;  3UGQ A;  1X54 A;  1N32 L;  1XMO Q;  1EFW A;  4GNX B;  4ZIB A;  4UP8 A;  2J3L A;  2B3G A;  3GD7 A;  2VZA A;  3S1R H;  2LSS A;  2ZTC A;  3QO7 A;  4P72 C;  4A3D G;  4JI3 L;  1PYS B;  2AWN A;  4LFA L;  1I5F A;  4DUZ Q;  3S1M H;  4YRT A;  4LF8 Q;  1OXV A;  2EJG A;  1L2F A;  1SRO A;  1ASZ A;  2Q5I A;  3HFZ B;  4C3J H;  1OXT A;  2RHS B;  1S72 A;  2NVT H;  1OXX K;  1U0L A;  3HOU G;  3PO2 G;  4YRM A;  2VNU D;  1E24 A;  3K7U C;  1EYG A;  4JBW A;  4DR6 L;  2JA9 A;  1TXY A;  5IP7 G;  3RKY A;  1KAW A;  1UEB A;  2NS6 A;  2WAQ G;  4AQY Q;  4IJH A;  4DV5 Q;  2YTX A;  1IZ6 A;  4CH6 A;  1B70 A;  1YNX A;  4L87 A;  1EVK A;  3V8K A;  1WJJ A;  4TVA A;  1SER A;  4BBR G;  4JBJ A;  1QE0 A;  2ES2 A;  2EJ9 A;  1JJ2 A;  2JA5 G;  3RLN A;  3ULJ A;  3K0X A;  3RLF A;  1HZ9 A;  2UUB Q;  2ZCE A;  4DR5 Q;  4JI0 L;  2R7Z H;  5C52 B;  1WQ7 A;  2ZM6 Q;  4LFC L;  1VQL A;  4LUO A;  1YIJ A;  3GTL H;  4DR7 L;  4LW1 A;  1VQN A;  3TRZ A;  3HY0 A;  4R1J A;  1IBM Q;  2DU5 A;  2MNA A;  4HT4 A;  4A3L G;  2DKG A;  3GDE A;  4APV A;  1J5E Q;  3CF5 A;  4NXM L;  2JEB I;  1MKH A;  1Y1V H;  2E64 A;  2YTV A;  3GTK H;  3REX A;  4B3M L;  3I4N H;  2ATW A;  11AS A;  2I4M A;  3HXU A;  4UPA A;  4R4I A;  1LUZ A;  4YHH Q;  4BXX G;  2WB1 E;  3ER0 A;  3HOY G;  5K1P A;  3RKW A;  1K8G A;  3A5Y A;  1HTT A;  3OTO L;  3WQZ A;  1PH6 A;  3AYH B;  1N36 L;  1NJ6 A;  1VQE A;  4XTC S;  4KR3 A;  1BIA A;  5M3F G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...