3I7FA

Aspartyl trna synthetase from entamoeba histolytica
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
535
structure length
485
Chain Sequence
QLPPVVLLKTPELVSGENFKVMPMHQSQPCYKTGLKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKEFVQFCQKISAESICDITGIVKAVEKPIEKATQQDVEIHVTSIAVVSLAEYPLPMQIEDLTFPSSVFKKQEEDIAKVKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHLTEFEGLDIEMEIVENYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the aspartyl-tRNA synthetase from Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Ligase
molecule keywords Aspartyl-tRNA synthetase
total genus 129
structure length 485
sequence length 535
chains with identical sequence B
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i7fA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3i7fA02
1XMQL 2DQ3A 2LXKA 5BR8Q 1VS0A 1WPYA 1EFWA 2WAQE 4XU2A 3PV0A 2IX1A 3RKWA 4GOPB 4GLAC 4JC0A 3PSIA 4JI7Q 1RIPA 2ODRD 1EIYB 3A7AA 4WI1A 3PO2H 3HXXA 3V7SA 3Q8DA 2RF4A 1EVLA 5IWAQ 2E65A 2ZT6A 2UXCL 4O2DA 4HJ9A 3PO3H 2IT1A 3BU2A 4X66Q 4LF9L 1YITA 1WU7A 3HOXG 4LNQA 2B63G 4NXNQ 1QE0A 3STBD 1XNRL 3VQXA 1Q1BA 2NZHA 2K14A 5GROA 3PUYA 3HOWG 4L5QA 3QNEA 2E5LQ 3LSQA 1AE2A 3V7CA 3UDXA 4BBSG 2K5NA 4YWKA 4H2TA 3KFUA 3CW2C 1WYDA 3CCUA 4A3BG 2F4VL 3J80i 1Q46A 4OX9Q 1E1TA 2Q2HA 4JI8Q 2PMEA 4TWAA 3L7ZC 4CS4A 5JJKA 1KRTA 3W3SA 4LUZA 3DSQA 4KLKA 5IY0A 1WQWA 5LMUQ 4LF5L 1QZHA 1XNRQ 2VZAA 2QHTA 5LMNL 1VQBA 4X62L 5EAYA 1QZGA 5M5WH 2JA8G 3S24A 1SERA 4XTZA 2HT1A 4NPSA 4UY8C 1VQEA 1R9TH 2HQLA 4XTYA 4YREA 2ZZGA 3HY1A 4ME3A 2E8GA 4DR1Q 1HH2P 4JYAQ 5IP9H 1I6HH 1G291 2CJAA 3PO2G 5K36G 4IPGA 3DM3A 1K3RA 4LF7Q 1KL9A 1SN8A 3A7UA 2ZJQA 1KC8C 2JA7H 2ZTCA 4GOPC 1GD7A 1XPOA 4L5RC 2I4LA 1X6OA 4IFDG 4QJFA 3H3VH 3AYHB 4HA8A 3M85A 4UP8A 4B3SL 2OTLA 3UDIA 1YVCA 4BY1G 4Y52H 4K87A 4GNXA 1UE5A 4A4IA 4TVYA 1CUKA 1H4QA 1KAWA 4GKJL 1RIQA 2R7ZH 3FJPA 1KIXA 1VQCA 1CKMA 2UXDL 2K5VA 3WWVA 1MIUA 4DV1Q 2J3MA 4A3LG 2PQAA 5JEAJ 4R4TA 5IYDH 3HXZA 1WJJA 5M5XH 4PZ7A 1HZ9A 3RN2A 3IRBA 1YJWA 5HY6A 3HOZG 5JJLA 1EYGA 2E5LL 2ZGWA 1L2FA 3A0JA 3J81j 4PZ6A 4JYAL 5JEAG 3K80C 2NVYH 2JA6H 4DR4L 2CCZA 2JA8H 3AFPA 3GTPH 1O7IA 2Q7EA 3HOYH 1TWGH 3NEMA 1PH5A 2NVXH 4LFAQ 4B3TL 3KJOA 5H1SE 5IP9G 5DLQE 3QTCA 2I5HA 4DV7Q 4AIMA 4JBMA 4XTXA 2E5AA 2R93G 3AEVA 3R07A 3TEHB 3GTKH 1JJCB 3I2ZA 4H2UA 3J81c 4YRQA 1HR0Q 1Y14B 1USYA 5C3EG 4JG2A 4C3JH 3HKZE 2Q2UA 4X65Q 1CKOA 2LXJA 1TWCH 1N32L 12ASA 3CC7A 5C53B 4IPCA 4DV4L 4TQUS 1X3GA 4HWOA 3T1YL 2DJZA 3FKIG 3FP9A 1VQHA 4A3GH 1BBWA 1H4SA 1NJ1A 1GO3E 4GN4B 4X62Q 1PH4A 4OP0A 1L1OA 1XJVA 1VCIA 1E7ZA 4YRSA 3KDFA 4GKKL 4TTVA 2RHQB 3G48A 4P75C 4JI6L 4JI7L 4HIOA 4R4OA 2E2JH 4DR7L 2MQHA 2I4NA 2XGTA 4LF4Q 3IG2A 2N49A 4B3ML 2R92H 3WQZA 4LF8L 2B3GA 3RNUA 4GNXB 2ALYA 2IHFA 4L5SA 3KDFB 4DUYL 3JC66 2ID0A 2K75A 2Q7HA 1EUJA 3S1RH 1J5EL 2CIMA 4K88A 4YCVA 3S1MH 1UE7A 3IKLA 1XTDA 2ZZEA 5FLXc 1C9OA 4ZTZB 2DGYA 1PH9A 1QVCA 3L4GB 5M3MG 3J7A5 3V8LA 3PCOA 1VQ9A 1SLJA 4QY7A 4LFAL 4P73A 1A62A 2ZT5A 3T1YQ 3HXVA 3J81i 3IKMB 3RN5A 4MTNA 5IYCH 1HNXL 1HJPA 4XTWA 4QGUA 2EAYA 2L15A 2BA0A 1FGUA 2QGQA 1UWVA 4G85A 4XTUA 4A3KH 3A5ZA 2ARSA 1ADYA 3HOZH 2JA7G 4B3SQ 4X6AH 4JI3L 1XNQQ 3HFZB 1CKNA 4DV2Q 2AHOB 1VQKA 2NN6I 4YRPA 1D7QA 1WNLA 3GTLH 2DQ0A 3M4PA 2ZR3A 3TEHA 4LF7L 1N36L 4K0KQ 1EIFA 5C44H 1Y1VH 3RZDH 3I56A 1N33Q 3CCSA 4B3MQ 2UUAQ 1N36Q 2C7IA 2JQOA 4TVAB 3I4NH 2IY5B 4AQYL 1N33L 1X56A 1KRSA 2PMZE 3MXNB 4DAYB 2C8MA 3CMEA 1IBML 3KLWA 4WJ4A 1VQ6A 2CGHA 1A8VA 3S17H 2EWNA 2IHEA 2P5IA 3CPFA 4P75A 1M1KC 3TEGA 4A3IH 4A3CH 2ZTGA 4IFDI 1IL2A 1L1OB 4P73C 3HTZA 2VQEL 4A3JH 4YWMA 4KR3A 1Q1EA 2ARTA 3HRIA 2UUCQ 3HOVH 1Q12A 4JI0Q 4YP0A 4MZ9A 2MO0A 4TVWA 3K8AA 1BVSA 1NTGA 2NN6G 1XMOQ 2JJQA 3M7NA 3ICAA 5LMUL 1HR0W 4AH6A 2DXTA 4BBRH 2PQAB 4OWWB 2F52A 4LF4L 3U4VA 4DR1L 3I4NG 2IY5A 4DNIA 4H2VA 1PHJA 4Q15A 4G84A 1E24A 1PH8A 4DV1L 4YRJA 4P74A 4C3HH 2NVQH 4LW1A 2ZXFA 1BKBA 3S2DH 1I50H 4KI0A 3L2PA 5IYDG 4UP7A 3TRZA 4DR6L 1XMOL 2E1HA 2DZ9A 2RHSB 4YRMA 3PZCA 2PNHA 4GKKQ 1KOGA 4L5TA 3ULJA 4IOCA 1G6PA 3UH0A 1W2BA 2YTXA 4LWCA 1KHIA 1NYQA 4JI5Q 3S16H 3PIPA 3CCQA 5C4JH 4A93H 1N34Q 1Z7NA 1KXLA 2EL9A 2VUMH 2J3LA 4TQDA 2FXQA 4A3MH 1VQ7A 4B3RL 3GTOH 4LFCL 2QA4A 2E10A 2Z0SA 3VDYA 4A3DG 4C2MH 5KNNA 2UUBL 4E51A 1BIAA 4P72C 5C52B 1NNHA 2AKWB 2EJGA 5IP7G 3HOXH 4P72A 4JI2Q 1Y1WH 1VQZA 4BY7H 1SETA 1RL2A 3A74A 1NJ2A 2QEXA 2QHUA 4K0KL 1IZ6A 3F8TA 3KF8B 4RQEA 2VQEQ 4AQYQ 3RF1A 1IXRA 3ULPA 3U50C 3CCEA 4HWPA 1X55A 1NJ6A 4TQFA 4YPFA 5GAHC 2UUCL 1Q82C 4FDBA 4HJ5A 4DR3Q 1ATIA 2CWAA 4BY1H 4A3LH 3K7UC 4H2XA 1K9MC 4DV3Q 5K1XA 1C0AA 4JBWA 4DKAC 4YRRA 1HZAA 2D0PA 1N34L 4BA2I 5GAGC 2AMCB 3I7FA 3HOVG 4IO9A 3BFMA 3M9BA 5IP7H 2KCMA 5E7NA 1YB3A 3K0XA 4AYBG 2WB1G 4JOIC 3MF1A 3NELA 3UFGA 1JJCA 4ZTUB 3W5OA 3TS2A 3HY0A 1YNXA 1VQIA 1GM5A 1PFSA 4JI4Q 1YHAA 3RIRA 2DU7A 3HXWA 3GTQH 4YY3Q 1IBKL 1XPRA 1ASZA 2UUBQ 2K4KA 3UE0A 2WFWA 2AKWA 4BBSH 2JA5G 2WP8J 5GQOA 4HWTA 1YHQA 2DEQA 4QL5A 2B63H 2F4VQ 1HNZL 4H2WA 1S72A 2FYKA 1YEZA 2E64A 5C0XG 2BA1A 2Z6KC 3RZOH 4P3PA 1VQMA 3CP0A 1YHBA 3L4GA 4YRTA 2PMFA 2N8NA 4POGA 1J5EQ 4R1JA 2ASBA 2HIVA 4HIMA 3D31A 1B70B 4LF6L 2ODRC 2NVTH 1NY4A 2BH2A 1HTTA 2MFIA 4GOPA 4JI3Q 1XPUA 2RCNA 1E1OA 1V43A 4CH4A 5C0XI 1G5IA 2A19A 4KHZA 1KMMA 2ES2A 3REUA 2ZNIA 3GO5A 3CPWA 5FJ8H 2VQFQ 4JOIA 1PH1A 3T1HL 5M5YH 1WQ7A 1OTCA 2DVEA 3K7AH 1H95A 1T9HA 4JI2L 1Z47A 2KENA 4YRGA 4OXPA 3TREA 4DR5Q 1FL0A 1UEBA 5AJ3L 3ERSX 3HRKA 3NENA 1G5HA 2VY3A 3FKIH 4DR2L 4GKJQ 3CCRA 1OXVA 3MEFA 2CFMA 5GAEC 1HZBA 2V1CC 1D8LA 2YTYA 1I3QH 2UXCQ 3KJPA 5GADC 3LSSA 1P16A 4DV5L 4P71A 1GKHA 4A3FH 1AH9A 1PYSB 1A0IA 1TWFH 3UE1A 4YWLA 4GN5A 3U58A 4IPDA 1E3PA 2MNAA 3RACA 3A7RA 5M3MH 1XNQL 1UE1A 5M3FH 1GGMA 3CCLA 1YI2A 2JA5H 1EOVA 2DUDA 2JE6I 1L1OC 3A5YA 4JI1Q 3A31A 2UUAL 2ZJRA 2ZT7A 3GTGH 1LUZA 3PUWA 2Y0SG 3ICEA 4EQ5A 1B70A 1VQJA 3AQQA 2KHJA 1NMFA 4BXXG 4DUZL 1FJGQ 2ZJPA 3ZJYC 4X5OA 1H4VB 3S1NH 4PMWA 4P74C 3I4OA 1H4TA 3H0GG 2VNUD 1Y1VG 1NE3A 5IWAL 4CH6A 5C4XH 2E3CA 3PF4A 3ULLA 5IYCG 4OONA 1Q8KA 2PI2A 2JEAI 4H02A 4JI1L 2VQFL 5IYBG 5ELNA 1P8LA 3GD7A 2OCEA 2AMCA 1USYC 2ZINA 5LMNQ 1PYBA 3PF5A 4LF9Q 2ZCEA 4LF5Q 1QUQA 1YZ6A 1PH7A 1Y1WG 1FYFA 1W3SA 1SR3A 2GN5A 2UXBL 4OO1I 1VQNA 4P3NA 1VQAA 3PGZA 3CF5A 4A3DH 1JB7A 3P8VA 3F1ZA 2N3SA 3I4MH 1PVOA 3JAMc 1B8AA 5M3FG 4LFBQ 2AWOA 4A3EH 3BJUA 4DV6Q 2Y0SE 1YFSA 1PH2A 3UGTA 1JMCA 3HKSA 2C35B 1X01A 2DU5A 3H15A 4B3RQ 3M4QA 2YYZA 1OXUA 4XTVA 1OXTA 4JI6Q 1S3OA 4YROA 3GTMH 2UXBQ 4CH5A 3GDEA 3TUPA 2ZT8A 4NXMQ 4DV2L 4GLVB 1NBWA 3KYHC 3REXA 1BIBA 1J6QA 4XU0A 1CSQA 1CKNB 1X3EA 4LF8Q 2EJ9A 5K1PA 3T1HQ 4J15A 3QO5A 1JE5A 2CJ9A 4A3KG 4LNSA 4O0AA 4OO1G 3BZKA 1YFTA 4NXNL 3I4MG 4R4IA 4POFA 1I94L 1PH6A 2P0LA 4X65L 1VQDA 3H3VI 4DR5L 1IBLQ 3QO7A 2AWNA 2G4CA 3HFVA 2ZNJA 4IJHA 4X64L 3QO8A 2UXDQ 4P3OA 4YRKA 3AFQA 3IALA 3CCMA 3V8JA 1JT8A 1K73C 2VS1A 3OW2A 5HGQA 1HZCA 2E2HH 2Q5HA 3MEYA 1V9PA 3OTOQ 1GVPA 3D0FA 2PI2E 3E9IA 5IT9c 1Q81C 4DR3L 1WCMH 4EX5A 1PA6A 3E0EA 3TS0A 1VQOA 4KHPL 4A76A 2R6GA 3J80c 3EBEA 2UU9L 1QVFA 3HXYA 4HJAA 2I4MA 3MF2A 4H2XB 2HIXA 1SRYA 2GVAA 1X2HA 4BWAA 1ADJA 1PYSA 3DLLA 2EIFA 3VQYA 4HJ7A 3KF6B 1X2GA 3PUVA 4A3JG 1DGSA 11ASA 3RR5A 4RMFA 2DTHA 4XU3A 3S1QH 3PO3G 4AYBE 4LFCQ 1X3FA 2KCTA 1SROA 1A63A 5FLMG 4BW9A 1B76A 1EIYA 2OQKA 1CSPA 1G51A 2GVBA 1MKHA 4HIDA 1EQQA 4R4CA 4A3EG 3L2ZA 2VL6A 1HNZQ 1HXDA 1QVGA 1FVIA 2N78A 3K81C 1SMXA 3F2CA 3NETA 1YJ9A 3U4ZA 3RLOA 1WOCA 4GLXA 3S14H 1K0RA 4DK3C 4XIGS 3KOJA 1MJCA 2CWPA 1VQ5A 3B6YA 4A93G 2YTVA 3HOUH 4H2YA 1OXSC 1WCMG 2WAQG 3G71A 4LF6Q 2Q5IA 3RLFA 2K52A 4LUOA 5IE8A 1TWHH 3OD1A 4HWSA 4YRCA 5E3IA 2DKGA 4EO4A 3VQWA 4APVA 3CD6A 1N9WA 2D0OA 1W66A 2ZM6Q 4L87A 4PG3A 3OTOL 2IX0A 3W1BA 1YJNA 2R92G 1VQPA 4R4QA 2OWOA 2UU9Q 1IBLL 3ER0A 1Z9FA 4A3BH 3RUXA 4NB3A 4GS3A 4ZIBA 1J5WA 1NYRA 1Q86C 4A3FG 1I5FA 5LMNW 2DTIA 4UPAA 3CC2A 3HKZG 3CCJA 2ZZFA 1JJ2A 4YRLA 4CS2A 4GN3B 4DV6L 4B3TQ 4XEOA 3P8YA 1HNXQ 2KHIA 3ERRA 4IPHA 3GTJH 4JI5L 2QHVA 1TXYA 1VQFA 4X66L 1VQ4A 3P8TA 4P71C 3S15H 1E22A 1YFRA 3FHWA 4XEMA 4JI4L 1XMQQ 1YGBA 2CKZB 3G1ZA 4DQ2A 1KMNA 4KHPQ 1OXXK 2R93H 3CCVA 3M4OH 3EFRA 2YV5A 4KR2A 3HOUG 4X64Q 3STBC 3RL6A 4XU1A 3V7RA 4JBJA 1S40A 2D62A 2ZIMA 4OX9L 4RG1A 4JCVE 4YRIA 4MNOA 4DV5Q 3LC0A 1AE3A 1IBMQ 4CH3A 4QQBX 1NJ8A 4RDXA 5FJ8G 3HXUA 2EQSA 4YY3L 4Y7NH 1ASYA 2I5MX 2YU9H 2LSSA 1LYLA 4OWXB 4DV0L 3HOYG 4BXXH 4A75A 3UDGA 4NXML 3LGJA 4YRFA 1VQGA 1WFQA 5J3BA 4BY7G 1EWIA 4HWRA 2VUMG 4GNXC 4A3IG 4HIKA 4A3CG 3UDFA 2I0QA 2E41A 1YIJA 1QF6A 3RLNA 4A3GG 1B7YA 5JJIA 3G4SA 2K5HA 5IYBH 4YYEA 4C3IH 2JEBI 1WI5A 4JI0L 1JJGA 2CQOA 3KF6A 2JK8A 3TQYA 2A1AA 1U0LA 4DV0Q 4YHHL 2Z6KA 3CMAA 3E9HA 2Q7GA 3L0OA 5C44G 2BH8A 1PV4A 4DK6C 3A5UA 3PUZA 4DR7Q 4DV4Q 2R7ZG 4HVCA 1SE8A 2MO1A 1Z7MA 4IOAA 2QHSA 4JI8L 4YCUA 1LTLA 1UE6A 2A8VA 3CAMA 3OYYA 1SFOH 1M90C 4K86A 1V1QA 5ELOA 2VW9A 4TVAA 1NJ5A 2KBNA 1QUQB 1VQLA 3CC4A 1YBYA 2NZOA 1TWAH 5C3EH 4LUVA 3RKXA 1HR0L 4QIWE 3HOWH 5F5WA 3UGQA 3NBHB 4XTCS 4CS3A 1IBKQ 4BBRG 3F2BA 2Q2IA 3JAMi 1NJIC 3F2DA 1N32Q 4H2SA 1KQSA 1EVKA 3EFSA 2ZTDA 3L1AA 2JA9A 1NMGA 4UP9A 4PHCA 3H0GH 2I5LX 4OWTB 5C4XG 4DUYQ 2I4OA 3W1GA 4WF2A 3V8KA 4Q6GA 2HNIA 4LFBL 1U5KA 1EQRA 4YCWA 4WJ3M 1SRUA 4JV5Q 4OLFA 4ALPA 2WB1E 5FLMH 4DV7L 1X65A 4BA1I 1B7YB 4A3MG 2Q2TA 3VBBA 2ATWA 4DR6Q 2E2IH 2RHQA 4IJLA 5AJ3Q 4DPGA 1X54A 2JA6G 2B29A 5C0XJ 3PCOB 4DR2Q 5BR8L 1VQ8A 2OQ0A 1K8AC 3M3YH 1IYJB 1BBUA 2HHHL 4HJ8A 1HNWL 2H5XA 2DXUA 1N8RC 4YHHQ 2ZTEA 3G6EA 4RQFA 2CJBA 2R7DA 3J7ZC 1MJEA 2DTOA 1HC7A 2ZIOA 3VQVA 4YRNA 1KD1C 3PUXA 1WLEA 2R7FA 4JV5L 1K83H 1X9NA 2DZCA 4DV3L 4NCXA 2ALYB 1C7YA 3CQZH 2EXDA 1K8GA 3I55A 3RGLA 3SGIA 1FJGL 4KQEA 4PZ8A 1PH3A 2RHSA 3EIVA 3S2HH 1L0WA 2HHHQ 1HNWQ 3CMQA 2OTJA 1I94Q 2ZR2A 4YDQA 2F3IA 3A5ZB 3EN2A 3BZCA 4JBKA 4IFDJ 4DR4Q 1SESA 3CXCA 2K50A 3RKYA 3HFZA 4DAMA 2ZM6L 5C51B 2XTIA 1Q7YC 3A32A 2ARUA 2EJFA 3PIOA 1LM0A 2DDZA 4DUZQ
chains in the Genus database with same CATH superfamily
2PW7A 1XMQL 3KBXA 2DQ3A 2EY1A 1B3QA 3GTOB 2LXKA 5BR8Q 3S1MB 1VS0A 1WPYA 1EFWA 2WAQE 4XU2A 3PV0A 2IX1A 1KTKA 4GOPB 3RKWA 4GLAC 4JC0A 4LVJA 3PSIA 3CRLC 4JI7Q 1RIPA 3A55A 2ODRD 1EIYB 3A7AA 1STNA 1CTMA 4WI1A 3PO2H 3HXXA 1GUNA 2B39A 1FYCA 4O42A 1DOMA 3V7SA 2C5CA 3Q8DA 2RF4A 2M2LA 1PZID 1EVLA 2O5JC 1A15A 5IWAQ 2E65A 2ZT6A 2UXCL 3SVMA 2BE5D 4O2DA 4ZUJA 4HJ9A 1ENCA 1TU2B 3MXPA 1RTOA 4C1NI 3PO3H 4N9PA 1CFMA 3MAQA 2IT1A 3BU2A 4FF4A 3NPPA 4X66Q 1Y8OB 1I6HB 1VMCA 4LF9L 1YITA 4CDDC 1WU7A 3HOXG 4H7BA 4EQPA 1PZKD 2RDGA 4LNQA 2B63G 4NXNQ 1QE0A 3STBD 1XNRL 3VQXA 1Q1BA 2NZHA 3D3RA 2K14A 1K3BC 5GROA 3S17B 5EKKA 3PUYA 3HOWG 2OXPA 3S1QB 1SYFA 3JAML 1STBA 4L5QA 3QNEA 2E5LQ 3LSQA 1AE2A 1H9RA 2E2DC 3V7CA 3UDXA 4BBSG 2K5NA 3W2DA 4YWKA 4H2TA 3KFUA 2AQ1B 3CW2C 1WYDA 2AUKA 3CCUA 2O4XA 3VYRA 4A3KB 3DXJC 2Z6BA 4A3BG 2F4VL 3J80i 1Q46A 5E1FA 4HAEA 1S5DD 4KK7A 4OX9Q 1E1TA 2Q2HA 2F3VA 4JI8Q 2PMEA 3D8GA 5EBCA 4TWAA 3L7ZC 4CS4A 5JJKA 1KRTA 4XQQA 3W3SA 4LUZA 3T53B 3DSQA 4KLKA 5IY0A 5ELCA 1EYCA 5A2QL 3K6OA 4ABNA 3V05A 3M4YA 2MUYA 3IKJA 4HCSA 1WQWA 5LMUQ 1SSOA 3KLRA 4LF5L 1QZHA 1XNRQ 4IFDH 2VZAA 2QHTA 5LMNL 2IPKD 1VQBA 4DXFA 4X62L 2B2TC 5ELBA 5EAYA 5D65A 1QZGA 5M5WH 5EPKA 5FLXE 2JA8G 3S24A 1SERA 4LVLA 3I73A 4XTZA 1ILPA 3H94A 2F0WA 2HT1A 2MPMA 3Q0AA 4NPSA 4UY8C 1VQEA 1R9TH 2HQLA 2M00A 1ZXTA 4XTYA 4YREA 2ZZGA 4TKOB 3HY1A 4ME3A 2E8GA 1JORA 4DR1Q 1HH2P 4JYAQ 5IP9H 1JWUD 1I6HH 1EYAA 1G291 1ZYRD 2CJAA 4A3JB 3PO2G 5K36G 4IPGA 3T13A 1GUSA 3DM3A 1ET6A 1K3RA 1KL9A 4LF7Q 3S2DB 1SN8A 4C3IG 3A7UA 2ZJQA 1JE4A 1KC8C 2BDNA 4V0BA 3KLSA 2JA7H 2ZTCA 2L12A 1F2MA 4GOPC 4FXDA 1GD7A 1XPOA 1SBBB 1U4RA 4L5RC 2I4LA 1X6OA 2IL8A 4IFDG 4QJFA 3H3VH 3AYHB 2Z4IA 1NSNS 2EXZA 4HA8A 3M85A 5T1IA 4UP8A 4B3SL 2OTLA 4C2MB 3UDIA 1YVCA 2H1EA 2B2YA 3C1FA 1VDZA 4FNFA 4BY1G 1RJTA 4Y52H 1U4PA 1XTCD 4K87A 4GNXA 1UE5A 2K32A 3HEJA 2K05A 4A4IA 1SNPA 2F0PA 2J0TD 4TVYA 1CUKA 3FRPB 1H4QA 5HURA 1KAWA 4GKJL 1RIQA 1SNOA 2R7ZH 2L9HA 3RZDB 3FJPA 3MC0B 2WAQB 1VQCA 1CKMA 1SNCA 2B2YC 1KIXA 2UXDL 1LTSD 2K5VA 1S5BD 1RD9D 3WWVA 3GV6A 1MIUA 4DV1Q 2J3MA 3MXUA 4A3LG 1WTQA 1EY9A 4K2KA 2NUCA 4J1MA 1ENFA 4N9TA 2F3WA 1ZKOA 2PQAA 5JEAJ 4R4TA 5IYDH 4FF2A 3HXZA 1WJJA 1BOSA 5M5XH 1X3PA 3M4OB 3FPPA 1HA5A 1SDFA 4PZ7A 4NKLA 1HZ9A 2WINB 3RN2A 3IRBA 1YJWA 5G3LF 5HY6A 5FKAC 5CGKA 3HOZG 5JJLA 2VB3X 1RKNA 1V1PA 1EYGA 2E5LL 2ZGWA 1L2FA 1LT5D 4G57A 1CHPD 3PIO3 1BUVT 3A0JA 3J81j 4PZ6A 4DA2A 1ICWA 4JYAL 5JEAG 2HCIA 1EU4A 3SXHA 3K80C 2NVYH 2JA6H 4DR4L 2BCOA 1MHWC 2CCZA 4EGVA 5C3XA 3FPUB 3AFPA 2JA8H 3GTPH 1JOQA 5E3FA 1O7IA 4NMZA 3HOYH 2Q7EA 1TWGH 3NEMA 1PH5A 5C4ZA 2NVXH 2F0IA 4LFAQ 3NTHA 4OIJA 3MFYA 4B3TL 2SEBD 5DAUA 1WTXA 3KJOA 5H1SE 2YU9B 1A6XA 5CMDA 5CBAE 1UAPA 5IP9G 4PNYA 5DLQE 1AZQA 1PLFA 3QTCA 4PMBA 2I5HA 1I4XA 3OMGA 4DV7Q 1MGSA 3QJYA 4AIMA 4JBMA 4XYQA 2Q8TA 5EKLA 4XTXA 2E5AA 2R93G 4PV1C 2KECA 4FXGC 3AEVA 3R07A 2WKDA 3TEHB 3GTKH 5HGTA 1JJCB 3I2ZA 1F9PA 4H2UA 3J81c 4YRQA 1HR0Q 1Y14B 1QWYA 1USYA 5C3EG 4JG2A 4C3JH 3HKZE 2CH4W 2Q2UA 4X65Q 1CT1D 5M5WB 5L37A 3T56B 1B9NA 1CKOA 1AP0A 3PO3B 2LXJA 1TWCH 2PW5A 1SE4A 3PO2B 2PCFB 1TS5A 2F1MA 1N32L 12ASA 2Z9HA 3NWTA 3CC7A 5C53B 4HMJA 4IPCA 3T16A 2A8EA 1BQQT 4DV4L 3C46A 4ZAIA 3MEHA 1L0YB 1ONLA 4TQUS 4K8JA 1I50B 2LS01 1SMYC 1BF4A 1X3GA 4HWOA 3KUPA 3T1YL 1EQVA 1V1PB 2DJZA 3FKIG 3FP9A 1VQHA 2QDLA 1I4RA 4F8MA 4A3GH 1BBWA 3I8ZA 1H4SA 1NJ1A 1GO3E 4GN4B 1CHQD 4X62Q 1PH4A 4OP0A 4BY1B 2CW0D 2EE1A 1L1OA 1XJVA 1VCIA 1E7ZA 4YRSA 3KDFA 3CRKC 4GKKL 4HSPA 2FHTA 4CKCA 4TTVA 1SYEA 2RHQB 1MSGA 3G48A 3SK4A 5JVH3 5DM73 4P75C 3HZXA 1ENAA 4ZK9B 1D1KA 1FNUA 1I3QB 4MTKA 4JI6L 4JI7L 4HIOA 1SXTA 4R4OA 2E2JH 4DR7L 2MQHA 2I4NA 3DEOA 2LY7A 1HTPA 2XGTA 4LF4Q 1EU3A 4KY7A 3IG2A 2N49A 4IN3A 4B3ML 2R92H 1O7ZA 2F0JA 3WQZA 4LF8L 2B3GA 2XWBB 3RNUA 4GNXB 2ALYA 4KTAA 2IHFA 1TKWB 3NWSA 4L5SA 1KLGD 1TWFB 2PO4A 5E4XA 3KDFB 2HQEA 3HS0C 4DUYL 3JC66 1JWSD 1LTBD 2ID0A 2K75A 2Q7HA 1WTVA 1EUJA 5D3DA 1Y1VB 3S1RH 1IKLA 3PQIA 1J5EL 2CIMA 4K88A 4YCVA 1V8QA 2OEOA 3S1MH 4I65A 1UE7A 1XTDA 3IKLA 2ZZEA 3A8JE 5FLXc 3DM1A 5FLXL 1ICFB 3K7AB 4N8X1 2K01A 5K36H 1C9OA 4ZTZB 2JYOA 1SAPA 4RGNA 1DXMA 5IGCA 2DGYA 4FP5D 1PH9A 1QVCA 2ZT9C 3L4GB 5M3MG 4RH6A 3J7A5 3V8LA 3PCOA 3BVGA 3BG3A 2L11A 1VQ9A 1SLJA 4QY7A 4LFAL 4P73A 1A62A 2ZT5A 3K57A 3T1YQ 1GHKA 1SEBD 4G7HC 3HXVA 3J81i 3IKMB 1FD7D 3RN5A 3HOYB 3OWEB 4MTNA 5IYCH 4G7OC 1HNXL 1EWHA 2FMCA 2LMCB 1DONA 1HJPA 4XTWA 4QGUA 1RF2D 3M3YB 3M7GA 2QKIC 2EAYA 2RVLA 2L15A 2BA0A 3H0GB 1FGUA 2QGQA 1UWVA 4G85A 4OEMB 4XTUA 2Z4HA 5FK9C 2A69C 5C4HA 4A3KH 3A5ZA 1PTOH 2A6ED 3VR5A 2ARSA 1ADYA 1EQTA 1U9RA 3HOZH 4IURA 1BR9A 2JA7G 2AUJD 4B3SQ 3H91A 4X6AH 3SK6A 4JI3L 5JVG3 3LWEA 1XNQQ 3HFZB 1CKNA 4DV2Q 2AHOB 3VYSA 2FJ2A 3QR8A 4KY6A 1VQKA 4Q0FA 2NN6I 5ELEA 4YRPA 1D7QA 1WNLA 4Y7NB 3ZYYX 3GTLH 2DQ0A 3M4PA 1B3AA 2EJFC 2ZR3A 3TEHA 4BBRB 5M3MB 1C48A 4C3JB 1NCVA 3BVZA 1GUOA 4LF7L 3K5MA 3CKIB 3E5SA 1N36L 2NVTB 1WCMB 4K0KQ 1IL8A 1EIFA 5C44H 1Y1VH 3RZDH 2R7ZB 3I56A 1N33Q 3MZ5A 3CCSA 3GP7A 5KYIA 4B3MQ 1F9RA 2UUAQ 1TQOA 1N36Q 2JQOA 2C7IA 4TVAB 1EZ8A 3I4NH 2IY5B 4AQYL 5C44B 1TS4A 1N33L 4FF3A 4HTHA 1X56A 3A56A 1KRSA 2Z1CA 2PMZE 2A6HC 3MXNB 4DAYB 3OOCA 3SHLA 5M5XB 3CMEA 2C8MA 3R8BA 1IBML 3KLWA 4WJ4A 2NN6H 1VQ6A 2QW7A 4CJ1B 2CGHA 2NVYB 1A8VA 3S17H 4LMQD 2EWNA 2IHEA 3IFDA 2P5IA 3CPFA 2XRSD 4P75A 3DWAA 4ZRZA 1M1KC 1D5MC 3TEGA 3D4WA 4A3IH 1D5ZC 4A3CH 1CA6A 2ZTGA 4IFDI 1EFID 2H4OA 1IL2A 1L1OB 3SEBA 4QB4A 4P73C 5M9OA 3HTZA 2K04A 3E0JA 1TY0A 1HXYD 1M4VA 2VQEL 3P75A 1GJXA 1DOKA 4A3JH 3KK7A 2EOTA 1B9MA 4YWMA 3MXNA 1FR3A 2E76C 1TWGB 5ISRA 5A35A 2SOBA 4KR3A 1IW7C 1Q1EA 1STYA 2ARTA 5CBEE 1W6JA 5BN4A 3HRIA 2UUCQ 2F0KA 2EVBA 3HOVH 1Q12A 5FO9B 3GTKB 4JI0Q 4YP0A 4MZ9A 2MO0A 3R93A 4TVWA 3AB9A 3K8AA 3Q22A 1BVSA 5IGFA 1NTGA 2NN6G 5EJWA 4CJ0B 1XMOQ 2JJQA 1I4PA 3M7NA 5BN3A 3ICAA 5LMUL 1C4QA 3MQZA 1HR0W 3A8IE 4AH6A 1JOOA 4DXGA 2LKVA 2DXTA 4BBRH 4B08A 2PQAB 4KD3A 4OWWB 2F52A 4LF4L 3U4VA 2F0OA 1A3TA 2XVSA 2ICIA 4DR1L 3I4NG 4R8NA 2IY5A 4CGYB 2G9HD 4DNIA 4H2VA 5I6YA 1PHJA 1LO5D 4Q15A 4G84A 4IUPA 1YNJD 2WV6D 4C3JG 5JJZA 1E24A 3TZUA 4DV1L 1PH8A 4EQOA 1PFBA 4YRJA 1NUCA 4P74A 4C3HH 2NVQH 3I4MB 1ET9A 2KEDA 4LW1A 1V1OA 5C3EB 2ZXFA 4R9WA 3HOUB 1BKBA 3S2DH 5IGGA 1I50H 4KI0A 3L2PA 5IYDG 4UP7A 1GUTA 3TRZA 2JA7B 2QCPX 2N55A 1EY4A 3BS1A 4OGQC 4CKEA 1XMOL 4DR6L 1BCPF 1O80A 1B53A 2E1HA 2DZ9A 1W6KA 3E3XA 2RHSB 4YRMA 3DWQA 2IX3A 2PNHA 3PZCA 4GKKQ 1KOGA 1JQYD 3VYUA 4L5TA 1AN8A 4H44C 3ULJA 2DNEA 3HOZB 4IQZA 4IOCA 1G6PA 2E2HB 3UH0A 1W2BA 2B8FA 2YTXA 4LWCA 3D4RA 3NQIA 4J8QA 1KHIA 3J7AF 4ZUIA 3G7LA 1NYQA 2B2WA 1ZYRC 4JI5Q 3S16H 3PIPA 3CCQA 5C4JH 4A93H 4DAPA 1N34Q 1BNZA 1Z7NA 1KABA 1KXLA 2EL9A 2VUMH 2F03A 2J3LA 4TQDA 2FXQA 4A3BB 4A3MH 3SK5A 1VQ7A 4B3RL 4ZYSA 3K5OA 3GTOH 4LFCL 2QA4A 2E10A 2Z0SA 3VDYA 4A3DG 3VR6A 4X3KA 1LTGD 4C2MH 5KNNA 1UNSA 2UUBL 3A8KE 4K2LA 4E51A 2KHSA 2KOLA 2JN4A 1BIAA 1LTID 3C1EA 4P72C 5C52B 4FO2A 1NNHA 2AKWB 2EJGA 5IP7G 2R3ZA 3HOXH 4P72A 4JI2Q 4KV6A 1Y1WH 1VQZA 2MGSA 4BY7H 1K8MA 3TP5A 3IFTA 2KEEA 1SETA 1RL2A 4ID6A 3A74A 3NP8A 2A6HD 3U9SA 1BCPB 4RGTA 1NJ2A 2QEXA 5KNCA 2QHUA 4K0KL 3WOEA 1LTTD 1IZ6A 1WTWA 3F8TA 3KF8B 5CR3A 4RQEA 2VQEQ 1KNEA 4AQYQ 3QO2A 3NE5B 3RF1A 2HUGA 1WTPA 1IXRA 3ULPA 3U50C 3CCEA 1X55A 4HWPA 1NJ6A 4TQFA 4YPFA 5GAHC 1CQVA 2UUCL 2HDLA 2K6AA 3HGBA 1Q82C 4FDBA 4HJ5A 4DR3Q 1ATIA 2DDZA 2CWAA 4BY1H 4A3LH 3K7UC 4H2XA 1UUPA 1K9MC 2E2JB 2L4NA 2N88A 3RZOB 1WVLA 4DV3Q 3GTLB 5K1XA 1HTLD 4RCOA 1C0AA 2DJGC 4JBWA 4DKAC 1PTOD 4NDXA 3BDCA 4XT1B 4YRRA 1QOHA 4HEDA 1HPCA 1HZAA 1STAA 2D0PA 1DJRD 2X6LA 5KEEA 1N34L 4BA2I 2TSSA 3I4NB 5GAGC 2AMCB 3I7FA 3HOVG 3QOJA 4IO9A 1TS3A 3BFMA 3M9BA 5IP7H 2F0VA 4RWSC 2KCMA 5E7NA 1YB3A 1WD1A 3K0XA 4AYBG 2WB1G 3TZDA 4JOIC 5IGBA 3MF1A 3NELA 3UFGA 1JJCA 4ZTUB 4QF4A 2B2UC 3W5OA 3TS2A 3HY0A 1YNXA 1VQIA 1GM5A 1PFSA 4JI4Q 1YHAA 3RIRA 2NBFA 2K33A 2DU7A 3HXWA 3GTQH 2F0MA 4YY3Q 4OO1H 5CV7A 1JR0D 1IBKL 1XPRA 1ASZA 2SDFA 2UUBQ 2K4KA 3UE0A 2ENBA 3GTPB 2EYOA 4KKTA 1TR5A 2WFWA 2AKWA 1QNKA 1E2VA 2EY6A 4KKSA 1NAPA 4BBSH 2ICEC 2CVRA 4DN4M 4DAYA 5I9PA 1XYIA 2JA5G 5KRUA 3TMEA 2RDHA 2D9UA 2LFNA 2WP8J 1LV9A 3NUCA 5GQOA 4CJ2C 1AFPA 1YHQA 1G6ZA 2A6EC 2DEQA 4HWTA 4QL5A 1QB5D 2B63H 2A69D 1STGA 2F4VQ 1HNZL 1F2YA 1E2ZA 2K7VA 4H2WA 1MD2D 4X3SA 1S72A 3EVQA 5CV6A 2FYKA 1YEZA 1EY5A 1I4HA 3HP3A 2E64A 5C0XG 2F0TA 2BA1A 2Z6KC 5EGTA 4A3DB 2X69A 2XWJB 4ZQ3A 2KCCA 5KNDA 3RZOH 1D2BA 2JP1A 1VQMA 4P3PA 4E6IA 2AQ3B 4WORA 3CP0A 4RKLA 3TSSA 1YHBA 3FEWX 3L4GA 4YRTA 4L6TB 4I7AA 1DD2A 2F0HA 2A68D 2PMFA 2BOSA 2N8NA 2EPBA 3ITPA 5C5LA 4POGA 1J5EQ 4R1JA 1QNUA 1VF5C 4UAIA 2ASBA 2HIVA 1GXDC 2AQ2B 4HIMA 4KY5A 3D31A 1B70B 1D1IA 4LF6L 2ODRC 2NVTH 1NY4A 2BH2A 1HTTA 2MFIA 4GOPA 3MA2B 4HR7B 4JI3Q 1XPUA 1IYVA 2RCNA 1E1OA 1V43A 3J7YW 2ZXRA 4CH4A 5C0XI 2NVQB 5JOBA 5I9OA 1ILQA 1WTOA 1G5IA 1CK1A 2A19A 4KHZA 1KMMA 4A3GB 2I07B 2ES2A 1EIHA 3REUA 2ZNIA 3GO5A 4G4KA 1B44D 3CPWA 5FJ8H 2VQFQ 2EDGA 2NWGA 2VUMB 1I4GA 4JOIA 1PH1A 2SNSA 3T1HL 1EY8A 1X3QA 4ODGA 3D4DA 5M5YH 1WQ7A 4QIWB 1OTCA 2DVEA 5I6WA 4AYBB 5A2QE 4RCNA 3D6WA 3K7AH 1H95A 5JPNC 2F0NA 1T9HA 4JI2L 2QDBA 1Z47A 2KENA 1KDBA 4K6DA 3OIPA 1Z7TA 4YRGA 4OXPA 2NZ1D 3TREA 3PIP3 4DR5Q 1FL0A 3FKIB 2EJMA 1UEBA 5AJ3L 2F0LA 3ERSX 5ELFA 3HRKA 2DJFC 3NENA 1G5HA 2KUMA 1TVXA 2VY3A 3FKIH 4DNRB 3TDQA 4DR2L 4GKJQ 3CCRA 2NVXB 2EY2A 4K8IA 1OXVA 3QOLA 3MEFA 1BO0A 2CFMA 4BWGB 5GAEC 3ERQA 5IOCA 1HZBA 2V1CC 2PPBC 4DAVA 1D8LA 2L5TA 5NUCA 1SJED 2XNAC 2YTYA 1I3QH 2UXCQ 4MHEA 3BDLA 3HOVB 3KJPA 5GADC 1JWMD 3LSSA 1P16A 5FOBB 1YNNC 1R4PB 4DV5L 2PNRC 4YIJA 2F4IA 3BVMA 5IGEA 4P71A 4L8JA 3OPOA 1F9SA 2EYLA 1GKHA 3T51B 5I2XA 1HCZA 1PYSB 4A3FH 1AH9A 4LVMA 1CZGA 1A0IA 1TWFH 3UE1A 4YWLA 1CZWA 4GN5A 3U58A 4IPDA 5G3LD 2K5QA 1E3PA 2MNAA 3OSOA 4RKBA 3Q24A 3A7RA 2PYKA 3RACA 5M3MH 1K28A 1KDCA 3SDZA 4N8FA 1XNQL 1UE1A 3MXGA 4WJWA 5M3FH 2IJ0A 1GGMA 1H9KA 3EJIA 1STHA 3CCLA 2F0QA 4HMIA 5M3FB 1YI2A 1J9OA 2JA5H 4O1NA 1EOVA 1Y8PB 2DUDA 2JE6I 1L1OC 3A5YA 1PTOB 5KNBA 5J1ZA 4JI1Q 3A31A 2UUAL 1A3VA 1B4OA 2ZJRA 2ZT7A 1JC7A 1SE2A 3GTGH 1LTAD 1GUWA 1LUZA 5CORA 3PUWA 1DOLA 2Y0SG 3ICEA 1GOZA 1QE6A 3DMUA 1T5EA 4EQ5A 1B70A 1VQJA 3AQQA 1O78A 2KHJA 1NMFA 4BXXG 4DUZL 1FJGQ 2ZJPA 3TP6A 3ZJYC 4X5OA 1H4VB 3S1NH 1A3UA 1O7YA 4PMWA 4P74C 3I4OA 1H4TA 3H0GG 3I3CA 1KNAA 3VA7A 2VNUD 4RAUC 1Y1VG 1NE3A 1XX8A 5IWAL 4FVMA 4FYDA 1S5FD 4CH6A 5C4XH 5CC4A 1TIID 4ZCKA 2P5ZX 2E3CA 1IHZA 3PF4A 2K03A 3ULLA 1I4QA 5IYCG 4OONA 3I91A 1Q8KA 2PI2A 3DHQA 2JEAI 4H02A 2EYFA 3N6RA 4JI1L 3LNNA 2VQFL 5IYBG 5ELNA 5KYLA 4DK0A 3TP7A 1P8LA 1K0SA 3GD7A 4LJZC 2OCEA 5IT9L 2L55A 2AMCA 1USYC 2ZINA 1AW7A 5LMNQ 1PYBA 1HQMC 3PF5A 4LF9Q 2ZCEA 4LF5Q 3AU7A 1QUQA 1YZ6A 1PH7A 1SNDA 3J80L 1Y1WG 1FYFA 3MHBA 1W3SA 1SR3A 1SNMA 2GN5A 2UXBL 4KJOA 1PTOC 4OO1I 1NR2A 2A5HA 1PDQA 1VQAA 1VQNA 3PGZA 2E75C 4XDXA 4P3NA 2JXMB 3CF5A 4A3DH 1JB7A 1JICA 3P8VA 3QIAA 5EPJA 3F1ZA 2N3SA 3I4MH 1CM9A 4JVZA 1PVOA 3JAMc 5JPMC 5T1GA 1B8AA 3GTGB 5M3FG 4A3IB 4LFBQ 2AWOA 1SYDA 4A3EH 4C56C 4K5XA 2RCFA 2DY7A 3BJUA 3OIQA 4DV6Q 2Y0SE 4JK1C 3OW7A 1YFSA 2KCNA 5EPLA 1PH2A 3FDTA 4RA8A 3CHBD 3UGTA 1JMCA 3HKSA 2C35B 3S1NB 2XRQD 1X01A 2DU5A 1SYCA 3H15A 3TN2A 4B3RQ 3ONAB 1TT2A 3M4QA 1JCKB 2DY8A 2YYZA 1OXUA 4XTVA 3U9OA 1E2WA 1OXTA 1QJOA 3A54A 4JI6Q 1S3OA 2I46A 4YROA 1PRTF 3MFGA 3GTMH 2UXBQ 4GZYC 4CH5A 3GDEA 1UEAB 2F0FA 1IKMA 2E74C 3TP8A 3TUPA 5JAVA 2ZT8A 3URYA 1HA6A 4NXMQ 4DV2L 2O2LD 4GLVB 1NBWA 3KYHC 5DM63 1TWHB 2V4DA 1FNVA 2EYMA 3REXA 3NHHA 4KJNA 1BIBA 1J6QA 4XU0A 3GTQB 1R9TB 1CSQA 1CKNB 1NNXA 1X3EA 4LF8Q 2EJ9A 2JA5B 1PMRA 1ML0D 2NB0A 1QILA 5K1PA 3K5LA 3T1HQ 5K5PA 4RHRA 4J15A 4XXEA 1DCZA 3D6CA 1JE5A 3QO5A 4K6LA 1QCBD 2CJ9A 2CHBD 4XYOA 1S5ED 3ND9A 3S15B 4A3KG 1SNQA 4LNSA 4O0AA 2CW0C 1IYUA 4OO1G 3BZKA 1YFTA 4NXNL 4C3HB 3I4MG 4R4IA 2B8GA 5D14A 3VR2A 4KD4A 1CQFA 4POFA 1I94L 3NBIA 1PH6A 2EZVA 2P0LA 1H9JA 4BBSB 4X65L 1LTRD 1VQDA 3VR4A 3H3VI 4HN7A 4ILWA 4OELB 4DR5L 1IBLQ 1OO9B 3QO7A 5FO7B 2F0EA 3RMHA 2AWNA 2G4CA 3HFVA 2ZNJA 4IJHA 4X64L 1L0XB 1PTOF 3QO8A 3RD4A 2UXDQ 2HCCA 4L63B 4P3OA 5F2DA 4YRKA 3AFQA 3IALA 4OIKA 3CCMA 1HUMA 5BN5A 3V8JA 1JT8A 1MI2A 1K73C 2IW3A 3JAME 1WTRA 2VS1A 3OW2A 5HGQA 2BDOA 4JPBW 1HZCA 2E2HH 2Q5HA 3MEYA 1B1ZA 1V9PA 1LACA 3OTOQ 1GVPA 2MHVA 3D0FA 2PI2E 4CDEC 3E9IA 5IT9c 4DGZA 2QEJC 1Q81C 4F87A 4DR3L 1WCMH 1EL0A 4EX5A 1PA6A 3E0EA 3I72A 1DYQA 1K83B 3TS0A 1C8CA 5IIFA 1VQOA 4FXKC 4A76A 2R6GA 3J80c 4KHPL 3EBEA 2UU9L 4UHVA 1QVFA 3HXYA 4HJAA 2I4MA 4WFN3 3MF2A 4H2XB 2HIXA 3OMCA 1SRYA 3L3OC 2O5IC 1FNWA 1PZJD 2GVAA 3N52A 4X3TA 2K28A 1X2HA 4BWAA 1ADJA 1PYSA 4U68A 2R93B 2XN9C 5M5YB 3DLLA 2EIFA 3A7LA 1LLRD 3VQYA 4HJ7A 1JOKA 3KF6B 3E6ZX 4ULLA 3HOXB 1X2GA 3PUVA 1JB3A 2K5DA 4CKBA 1VF7A 4A3JG 5JEAH 1DGSA 1D6EC 1U4MA 11ASA 3RR5A 4RMFA 1RODA 2DTHA 1BCPC 2K1BA 4XU3A 2WACA 3S1QH 1PRTB 2X6GA 4RFBA 3PO3G 1TY2A 3GQBA 4ZKCB 1MBYA 4AYBE 4LFCQ 3I70A 1X3FA 3EFXD 2KCTA 2NYZD 4MN3A 1A2UA 1LT4D 2A74C 1SROA 5CYUA 1A63A 5FLMG 2JA6B 1B76A 4BW9A 4CHTB 1EIYA 2IWHA 2OQKA 1CSPA 4FF1A 1G51A 2GVBA 5TSSA 1MKHA 4HIDA 1EQQA 5J22A 3WOFA 5I2YA 2Z8LA 3CU7A 1H9MA 3R3OA 4R4CA 3FVQA 1Q90A 1EYDA 5C3WA 3BYYB 4A3EG 3L2ZA 2VL6A 1HNZQ 1HXDA 1QVGA 1FVIA 3DUZA 2N78A 1XXGA 3K81C 1DZ1A 1SMXA 3F2CA 3NETA 3LX0A 1YJ9A 3U4ZA 4TRDA 4A3MB 3RLOA 1WOCA 3G6JB 2QILA 1PFMA 1RHPA 3KF8A 4GLXA 4RGOS 3V96A 3S14H 1K0RA 4KHVA 3T4AC 4DK3C 1O7LA 3R2IA 2TMPA 1ZEQX 1G91A 3MWYW 1I6VC 2D5DA 1PRTD 1AZPA 1LABA 4XIGS 3BYTB 3KOJA 1MJCA 2CWPA 1GHJA 1VQ5A 2RKSA 4DK1A 2Q8RE 3GTJB 5KIXA 1TWCB 3B6YA 4A93G 3IL8A 3Q6SA 2YTVA 1PYWD 3HOUH 4H2YA 4OHJA 4G7ZC 1OXSC 4RHSA 1WCMG 3HKZB 2WAQG 3G71A 4LF6Q 2Q5IA 4IZ8A 5C5MA 3RLFA 1II3A 2K52A 4LK1C 4LUOA 5IE8A 4C1NK 1LT6D 4KKUA 5KGUA 1TWHH 3OD1A 3V2TA 4HWSA 4YRCA 5E3IA 4NW2A 2DKGA 3EQLC 4EO4A 5AFWA 3DEPA 3VQWA 3BDOA 4APVA 2RSNA 3X3MA 4V190 3CD6A 2RSOA 1N9WA 1ESRA 2D0OA 1W66A 1B2TA 2ZM6Q 1PFNA 1IW7D 4L87A 2G5DA 4PG3A 4ZLTF 3C2PA 1HUNA 1Q8IA 5CV8A 3BZDB 3LWUA 3OTOL 5LHY1 1QG7A 2KVMA 2IX0A 3W1BA 4U673 4IUUA 2B2VA 1LT3D 1YJNA 2R92G 2E2IB 1FGBD 1VQPA 1H9SA 2RDFA 3C3LA 4R4QA 2OWOA 2UU9Q 1IBLL 2Y0SB 2OT2A 3ER0A 1TWAB 1Z9FA 4A3BH 3RUXA 2F0GA 1CA5A 4NB3A 4GS3A 3PMFA 4BS9A 3P1HA 4ZIBA 4PMCA 4KN7C 1J5WA 1NYRA 1Q86C 1SMYD 4A3FG 4QUFA 3GV3A 1I5FA 3S16B 1F77A 5LMNW 2DTIA 4UPAA 3CC2A 1Y69U 3HKZG 3CCJA 4M8AA 1S4ZA 1EZ6A 4MIUA 2G9DA 2L0CA 2ZZFA 2C9OA 1JJ2A 3L9AX 5C6AA 2PQEA 4K5WA 1BBXC 4YRLA 4CS2A 4BY7B 2PZUA 4GN3B 4DV6L 4B3TQ 4XEOA 3P8YA 4K14A 1HNXQ 2ZXPA 4IUTA 2KHIA 3J81E 3ERRA 1EEFD 2D2CC 4IPHA 3GTJH 4JI5L 1EY7A 2QHVA 1TXYA 1VQFA 4X66L 1EOTA 1VQ4A 3HOWB 2VB2X 4IUNA 4K5VA 4H13C 5CV9A 3P8TA 1X32A 3I4LA 4P71C 2F0UA 4OL7A 1NR4A 1E22A 3S15H 4LVIA 1YFRA 4EQNA 3FHWA 4XEMA 2EJGC 4JI4L 1XWEA 1XMQQ 1YGBA 1PXUA 4XQJA 1ESFA 2OF1A 2CKZB 3G1ZA 4DQ2A 3P7JA 1KMNA 4KHPQ 1AEXA 1S5CD 2F0DA 1HFGA 1OXXK 2R93H 3CCVA 3M4OH 4QCLA 3EFRA 2HD3A 2YV5A 4KR2A 3HOUG 4X64Q 5FO8B 2KA7A 3STBC 5C4XB 3RL6A 4XU1A 2A73B 4JBJA 3V7RA 1S40A 2D62A 1F2LA 2ZIMA 4A3EB 3X3NA 1HHVA 4OX9L 4RG1A 4X3UA 4JCVE 4YRIA 4MNOA 2MJ8A 4XT3B 5ELDA 1EWCA 2PMZB 3NSWA 3A7AB 3VYTA 4DV5Q 2Q8IB 2EYJA 3LC0A 1AE3A 3NTIA 2B2VC 4UDUC 3GTMB 5I4DA 1IBMQ 4CH3A 4QQBX 1NJ8A 5D3IB 4A93B 5FJ8G 4RDXA 4KN4C 1Z6HA 3HXUA 2EQSA 4YY3L 4Y7NH 1ASYA 2I5MX 2YU9H 5EQ0A 2LSSA 3K0YA 1RDPD 1LYLA 2SNMA 3QG1A 4OWXB 4DV0L 2EY5A 3HOYG 4BXXH 1STEA 4A75A 3UDGA 4NXML 4J6HA 3SR1A 3K5NA 4M1UB 5LL6S 3S2HB 3LGJA 1HQRD 1VMPA 4XQNA 2FINB 2RA4A 5DEHA 4YRFA 3F2UA 2GA4B 1KLUD 1VQGA 1D5XC 1WFQA 2J7ZA 5J3BA 2NTSA 4DFAA 5C0XH 4R8IA 2L1BA 4BY7G 3SE0A 1EWIA 2WIIB 4HWRA 2VUMG 4GNXC 2WKCA 4HIKA 4A3IG 4A3CG 5EBDA 4HCEA 3UDFA 2PZTA 5IT9E 3R2TA 1SJHD 3CQZB 3KBGA 3MTSA 4CBVA 2ZXOA 2I0QA 2E41A 1YIJA 1QF6A 3RLNA 4A3GG 1B7YA 5JJIA 5E4WC 3G4SA 2K5HA 3NTKA 5IYBH 4YYEA 4C3IH 2JEBI 1RCVD 1WI5A 1G2SA 5IGDA 3NQTA 4JI0L 1JJGA 2CQOA 3KF6A 4B9WA 2JK8A 4CDCC 3TQYA 2A1AA 3H09A 1U0LA 5CV5A 4CDFC 4DV0Q 3J7AV 4HT4A 3KLSX 4YHHL 2Z6KA 3CMAA 3E9HA 4F7XA 2Q7GA 2NS6A 3L0OA 2PZWA 5C44G 2BH8A 1PV4A 4DK6C 1Q3LA 4IUVA 3IAYA 3A5UA 2WB1B 3PUZA 4DU9A 3S14B 2RQXA 3S1RB 1EY6A 4H0LC 4DR7Q 4DV4Q 2CH4A 2R7ZG 4HVCA 1SE8A 2M9VA 2MO1A 1SFOB 2J4XA 2KJXA 1Z7MA 4IOAA 2QHSA 5DNFA 4JI8L 1WD0A 1EEID 1BCPD 4YCUA 1LTLA 1UE6A 3H6MA 2A8VA 3CAMA 4DF7A 3OYYA 1SFOH 1M90C 1HRJA 1V1QA 5ELOA 2VW9A 4K86A 4TVAA 3S9WA 1NJ5A 3OHXC 2KBNA 3I90A 1QUQB 3O13A 4P2CB 1VQLA 3CC4A 1YBYA 3WDNA 2NZOA 1TWAH 5C3EH 4LVKA 2HDMA 1EIGA 4LUVA 3RKXA 1TS2A 4IUQA 1HR0L 4QIWE 3HOWH 5F5WA 3UGQA 2DN8A 3NBHB 4XTCS 4CS3A 1IBKQ 2BE5C 4RGMA 4BBRG 2VXWA 4C3HG 4ME5A 1CI3M 3F2BA 1KDAA 2Q2IA 3QWNA 1EY0A 3JAMi 4JW0A 1NJIC 1YNND 2B2TA 3F2DA 1N32Q 4H2SA 3NXWA 1KQSA 1YNJC 5IODA 1K8OA 3EA6A 1DM0B 1EVKA 1B50A 3VR3A 3OWFA 3EFSA 2ZTDA 3L1AA 5J39A 2JA9A 1NMGA 4UP9A 2XSCA 1U4LA 4PHCA 4HSVA 3HG9A 3Q23A 3H0GH 2FFKB 5LL6X 1WTHA 2I5LX 4I7ZC 1R4QB 4OWTB 3SK8A 4DNTB 3QB3A 5C4XG 4DUYQ 2B63B 3W1GA 2I4OA 4WF2A 3V8KA 2NTTA 4Q6GA 2HNIA 4LFBL 1U5KA 3AMUA 1EQRA 4YCWA 4WJ3M 1M8AA 1SRUA 3K58A 4JV5Q 5CV4A 3FMCA 4OLFA 2B2WC 2MP1A 4ALPA 2WB1E 3J81L 5FLMH 4NP5A 2A68C 4LAAA 4DV7L 1X65A 4BA1I 1B7YB 4A3MG 2Q2TA 3VBBA 2ATWA 1Y8NB 2E2IH 4IJLA 5AJ3Q 4DR6Q 2RHQA 4DPGA 4QMGA 4TSSA 1X54A 2JA6G 2B29A 3RUZA 3P20A 5C0XJ 3PCOB 4KMUC 5BR8L 4DR2Q 1VQ8A 3EROA 2OQ0A 1K8AC 3M3YH 1IYJB 5C4JB 1SE3A 4QUCA 1A2TA 1H9SB 1PRTC 3UI2A 1BBUA 2HHHL 4WRDA 2JSOA 4HJ8A 1HNWL 2H5XA 2DXUA 1N8RC 2R92B 4YHHQ 2ZTEA 1BDOA 1Y1WB 2EYPA 3G6EA 4RQFA 2CJBA 2R7DA 3J7ZC 1MJEA 2DTOA 1HC7A 2ZIOA 3VQVA 3J80E 4YRNA 2FMMA 1F2ZA 1KD1C 3PUXA 4A3FB 1WLEA 4EVOA 3HRZC 1J8IA 2R7FA 3W3AA 4JV5L 4PQXA 2F0SA 1GUGA 1K83H 1HFNA 1X9NA 1E0BA 1BXTA 2DZCA 4DV3L 4NCXA 2ALYB 1C7YA 3CQZH 2K5WA 2EXDA 2DNCA 1K8GA 1KAAA 3I55A 3RGLA 4IALA 3SGIA 4B9XA 1FJGL 4KQEA 3NK9A 2EYHA 4PZ8A 1PH3A 2RHSA 2QF7A 3EIVA 5EKIA 3S2HH 1L0WA 2HHHQ 4ZKBB 1HNWQ 1I94Q 2OTJA 2ZR2A 3CMQA 1SYBA 4YDQA 2F3IA 3A5ZB 1F9QA 3EN2A 1SYGA 2XIWA 3BZCA 4JBKA 2JA8B 5COYA 4S3SA 4IFDJ 1RTNA 4DR4Q 1SESA 4Z9CB 3CXCA 2K50A 3RKYA 1G8ZD 3HFZA 2R61A 2B2UA 4DAMA 3ND8A 3VA5A 4F88A 2ZM6L 4Q5VA 1G2TA 1T5XD 2XTIA 5C51B 1Q7YC 3MVVA 3A32A 3H3VC 2ARUA 2EJFA 3PIOA 3NBHA 1MSHA 3K59A 2KQ3A 1LM0A 2CQAA 2RBMA 4C3IB 4DUZQ 3DWPA 3TBIB
chains in the Genus database with same CATH topology
1XMQL 2DQ3A 2LXKA 5BR8Q 1VS0A 1WPYA 1EFWA 2WAQE 4XU2A 3PV0A 2IX1A 3RKWA 4GOPB 4GLAC 4JC0A 4LVJA 3PSIA 4JI7Q 1RIPA 2ODRD 1EIYB 3A7AA 4WI1A 3PO2H 3HXXA 3V7SA 3Q8DA 2RF4A 1EVLA 5IWAQ 2E65A 2ZT6A 2UXCL 4O2DA 4HJ9A 3PO3H 2IT1A 3BU2A 4X66Q 4LF9L 1YITA 1WU7A 3HOXG 4LNQA 2B63G 4NXNQ 1QE0A 3STBD 1XNRL 3VQXA 1Q1BA 2NZHA 2K14A 5GROA 3PUYA 3HOWG 4L5QA 3QNEA 2E5LQ 3LSQA 1AE2A 3V7CA 3UDXA 4BBSG 2K5NA 4YWKA 4H2TA 3KFUA 3CW2C 1WYDA 3CCUA 4A3BG 2F4VL 3J80i 1Q46A 4OX9Q 1E1TA 2Q2HA 4JI8Q 2PMEA 4TWAA 3L7ZC 4CS4A 5JJKA 1KRTA 3W3SA 4LUZA 3DSQA 4KLKA 5IY0A 1WQWA 5LMUQ 4LF5L 1QZHA 1XNRQ 2VZAA 2QHTA 5LMNL 1VQBA 4X62L 5EAYA 1QZGA 5M5WH 2JA8G 3S24A 1SERA 4LVLA 4XTZA 2HT1A 4NPSA 4UY8C 1VQEA 1R9TH 2HQLA 4XTYA 4YREA 2ZZGA 3HY1A 4ME3A 2E8GA 4DR1Q 1HH2P 4JYAQ 5IP9H 1I6HH 1G291 2CJAA 3PO2G 5K36G 4IPGA 3DM3A 1K3RA 4LF7Q 1KL9A 1SN8A 3A7UA 2ZJQA 1KC8C 2JA7H 2ZTCA 4GOPC 1GD7A 1XPOA 4L5RC 2I4LA 1X6OA 4IFDG 4QJFA 3H3VH 3AYHB 4HA8A 3M85A 4UP8A 4B3SL 2OTLA 3UDIA 1YVCA 4BY1G 4Y52H 4K87A 4GNXA 1UE5A 4A4IA 4TVYA 1CUKA 1H4QA 1KAWA 4GKJL 1RIQA 2R7ZH 3FJPA 1KIXA 1VQCA 1CKMA 2UXDL 2K5VA 3WWVA 1MIUA 4DV1Q 2J3MA 4A3LG 2PQAA 5JEAJ 4R4TA 5IYDH 3HXZA 1WJJA 5M5XH 4PZ7A 1HZ9A 3RN2A 3IRBA 1YJWA 5HY6A 3HOZG 5JJLA 1EYGA 2E5LL 2ZGWA 1L2FA 3A0JA 3J81j 4PZ6A 4JYAL 5JEAG 3K80C 2NVYH 2JA6H 4DR4L 2CCZA 2JA8H 3AFPA 3GTPH 1O7IA 2Q7EA 3HOYH 1TWGH 3NEMA 1PH5A 2NVXH 4LFAQ 4B3TL 3KJOA 5H1SE 5IP9G 5DLQE 3QTCA 2I5HA 4DV7Q 4AIMA 4JBMA 4XTXA 2E5AA 2R93G 3AEVA 3R07A 3TEHB 3GTKH 1JJCB 3I2ZA 4H2UA 3J81c 4YRQA 1HR0Q 1Y14B 1USYA 5C3EG 4JG2A 4C3JH 3HKZE 2Q2UA 4X65Q 1CKOA 2LXJA 1TWCH 1N32L 12ASA 3CC7A 5C53B 4IPCA 2A8EA 4DV4L 4TQUS 1X3GA 4HWOA 3T1YL 2DJZA 3FKIG 3FP9A 1VQHA 4A3GH 1BBWA 1H4SA 1NJ1A 1GO3E 4GN4B 4X62Q 1PH4A 4OP0A 1L1OA 1XJVA 1VCIA 1E7ZA 4YRSA 3KDFA 4GKKL 4TTVA 2RHQB 3G48A 4P75C 4JI6L 4JI7L 4HIOA 4R4OA 2E2JH 4DR7L 2MQHA 2I4NA 2XGTA 4LF4Q 3IG2A 2N49A 4B3ML 2R92H 3WQZA 4LF8L 2B3GA 3RNUA 4GNXB 2ALYA 2IHFA 4L5SA 3KDFB 4DUYL 3JC66 2ID0A 2K75A 2Q7HA 1EUJA 3S1RH 1J5EL 2CIMA 4K88A 4YCVA 3S1MH 1UE7A 3IKLA 1XTDA 2ZZEA 5FLXc 1C9OA 4ZTZB 2DGYA 1PH9A 1QVCA 3L4GB 5M3MG 3J7A5 3V8LA 3PCOA 1VQ9A 1SLJA 4QY7A 4LFAL 4P73A 1A62A 2ZT5A 3T1YQ 3HXVA 3J81i 3IKMB 3RN5A 4MTNA 5IYCH 1HNXL 1HJPA 4XTWA 4QGUA 2EAYA 2L15A 2BA0A 1FGUA 2QGQA 1UWVA 4G85A 4XTUA 4A3KH 3A5ZA 2ARSA 1ADYA 3HOZH 2JA7G 4B3SQ 4X6AH 4JI3L 1XNQQ 3HFZB 1CKNA 4DV2Q 2AHOB 1VQKA 2NN6I 4YRPA 1D7QA 1WNLA 3GTLH 2DQ0A 3M4PA 2ZR3A 3TEHA 4LF7L 1N36L 4K0KQ 1EIFA 5C44H 1Y1VH 3RZDH 3I56A 1N33Q 3CCSA 4B3MQ 2UUAQ 1N36Q 2C7IA 2JQOA 4TVAB 3I4NH 2IY5B 4AQYL 1N33L 1X56A 1KRSA 2PMZE 3MXNB 4DAYB 2C8MA 3CMEA 1IBML 3KLWA 4WJ4A 1VQ6A 2CGHA 1A8VA 3S17H 2EWNA 2IHEA 2P5IA 3CPFA 4P75A 1M1KC 3TEGA 4A3IH 4A3CH 2ZTGA 4IFDI 1IL2A 1L1OB 4P73C 3HTZA 2VQEL 4A3JH 4YWMA 4KR3A 1Q1EA 2ARTA 3HRIA 2UUCQ 3HOVH 1Q12A 4JI0Q 4YP0A 4MZ9A 2MO0A 4TVWA 3K8AA 1BVSA 1NTGA 2NN6G 1XMOQ 2JJQA 3M7NA 3ICAA 5LMUL 3MQZA 1HR0W 4AH6A 2DXTA 4BBRH 2PQAB 4OWWB 2F52A 4LF4L 3U4VA 4DR1L 3I4NG 2IY5A 4DNIA 4H2VA 1PHJA 4Q15A 4G84A 1E24A 1PH8A 4DV1L 4YRJA 4P74A 4C3HH 2NVQH 4LW1A 2ZXFA 1BKBA 3S2DH 1I50H 4KI0A 3L2PA 5IYDG 4UP7A 3TRZA 4DR6L 1XMOL 2E1HA 2DZ9A 2RHSB 4YRMA 3PZCA 2PNHA 4GKKQ 1KOGA 4L5TA 3ULJA 4IOCA 1G6PA 3UH0A 1W2BA 2YTXA 4LWCA 1KHIA 1NYQA 4JI5Q 3S16H 3PIPA 3CCQA 5C4JH 4A93H 1N34Q 1Z7NA 1KXLA 2EL9A 2VUMH 2J3LA 4TQDA 2FXQA 4A3MH 1VQ7A 4B3RL 3GTOH 4LFCL 2QA4A 2E10A 2Z0SA 3VDYA 4A3DG 4C2MH 5KNNA 2UUBL 4E51A 1BIAA 4P72C 5C52B 1NNHA 2AKWB 2EJGA 5IP7G 3HOXH 4P72A 4JI2Q 1Y1WH 1VQZA 4BY7H 1SETA 1RL2A 3A74A 1NJ2A 2QEXA 2QHUA 4K0KL 1IZ6A 3F8TA 3KF8B 4RQEA 2VQEQ 4AQYQ 3RF1A 1IXRA 3ULPA 3U50C 3CCEA 4HWPA 1X55A 1NJ6A 4TQFA 4YPFA 5GAHC 2UUCL 1Q82C 4FDBA 4HJ5A 4DR3Q 1ATIA 2CWAA 4BY1H 4A3LH 3K7UC 4H2XA 1K9MC 4DV3Q 5K1XA 1C0AA 4JBWA 4DKAC 4YRRA 1HZAA 2D0PA 1N34L 4BA2I 5GAGC 2AMCB 3I7FA 3HOVG 4IO9A 3BFMA 3M9BA 5IP7H 2KCMA 5E7NA 1YB3A 3K0XA 4AYBG 2WB1G 4JOIC 3MF1A 3NELA 3UFGA 1JJCA 4ZTUB 3W5OA 3TS2A 3HY0A 1YNXA 1VQIA 1GM5A 1PFSA 4JI4Q 1YHAA 3RIRA 2DU7A 3HXWA 3GTQH 4YY3Q 1IBKL 1XPRA 1ASZA 2UUBQ 2K4KA 3UE0A 2WFWA 2AKWA 4BBSH 2JA5G 2WP8J 5GQOA 4HWTA 1YHQA 2DEQA 4QL5A 2B63H 2F4VQ 1HNZL 4H2WA 1S72A 2FYKA 1YEZA 2E64A 5C0XG 2BA1A 2Z6KC 3RZOH 4P3PA 1VQMA 3CP0A 1YHBA 3L4GA 4YRTA 2PMFA 2N8NA 4POGA 1J5EQ 4R1JA 2ASBA 2HIVA 4HIMA 3D31A 1B70B 4LF6L 2ODRC 2NVTH 1NY4A 2BH2A 1HTTA 2MFIA 4GOPA 4JI3Q 1XPUA 2RCNA 1E1OA 1V43A 4CH4A 5C0XI 1G5IA 2A19A 4KHZA 1KMMA 2ES2A 3REUA 2ZNIA 3GO5A 3CPWA 5FJ8H 2VQFQ 4JOIA 1PH1A 3T1HL 5M5YH 1WQ7A 1OTCA 2DVEA 3K7AH 1H95A 1T9HA 4JI2L 1Z47A 2KENA 4YRGA 4OXPA 3TREA 4DR5Q 1FL0A 1UEBA 5AJ3L 3ERSX 3HRKA 3NENA 1G5HA 2VY3A 3FKIH 4DR2L 4GKJQ 3CCRA 1OXVA 3MEFA 2CFMA 5GAEC 1HZBA 2V1CC 1D8LA 2YTYA 1I3QH 2UXCQ 3KJPA 5GADC 3LSSA 1P16A 4DV5L 4P71A 1GKHA 4A3FH 1AH9A 1PYSB 4LVMA 1A0IA 1TWFH 3UE1A 4YWLA 4GN5A 3U58A 4IPDA 1E3PA 2MNAA 3RACA 3A7RA 5M3MH 1XNQL 1UE1A 5M3FH 1GGMA 3CCLA 1YI2A 2JA5H 1EOVA 2DUDA 2JE6I 1L1OC 3A5YA 4JI1Q 3A31A 2UUAL 2ZJRA 2ZT7A 3GTGH 1LUZA 3PUWA 2Y0SG 3ICEA 4EQ5A 1B70A 1VQJA 3AQQA 2KHJA 1NMFA 4BXXG 4DUZL 1FJGQ 2ZJPA 3ZJYC 4X5OA 1H4VB 3S1NH 4PMWA 4P74C 3I4OA 1H4TA 3H0GG 2VNUD 1Y1VG 1NE3A 5IWAL 4CH6A 5C4XH 2E3CA 3PF4A 3ULLA 5IYCG 4OONA 1Q8KA 2PI2A 2JEAI 4H02A 4JI1L 2VQFL 5IYBG 5ELNA 1P8LA 3GD7A 2OCEA 2AMCA 1USYC 2ZINA 5LMNQ 1PYBA 3PF5A 4LF9Q 2ZCEA 4LF5Q 1QUQA 1YZ6A 1PH7A 1Y1WG 1FYFA 1W3SA 1SR3A 2GN5A 2UXBL 4OO1I 1VQNA 4P3NA 1VQAA 3PGZA 3CF5A 4A3DH 1JB7A 3P8VA 3F1ZA 2N3SA 3I4MH 1PVOA 3JAMc 1B8AA 5M3FG 4LFBQ 2AWOA 4A3EH 3BJUA 4DV6Q 2Y0SE 1YFSA 1PH2A 3UGTA 1JMCA 3HKSA 2C35B 1X01A 2DU5A 3H15A 4B3RQ 3M4QA 2YYZA 1OXUA 4XTVA 1OXTA 4JI6Q 1S3OA 4YROA 3GTMH 2UXBQ 4CH5A 3GDEA 3TUPA 2ZT8A 4NXMQ 4DV2L 4GLVB 1NBWA 3KYHC 3REXA 1BIBA 1J6QA 4XU0A 1CSQA 1CKNB 1X3EA 4LF8Q 2EJ9A 5K1PA 3T1HQ 4J15A 3QO5A 1JE5A 2CJ9A 4A3KG 4LNSA 4O0AA 4OO1G 3BZKA 1YFTA 4NXNL 3I4MG 4R4IA 4POFA 1I94L 1PH6A 2P0LA 4X65L 1VQDA 3H3VI 4DR5L 1IBLQ 3QO7A 2AWNA 2G4CA 3HFVA 2ZNJA 4IJHA 4X64L 3QO8A 2UXDQ 4P3OA 4YRKA 3AFQA 3IALA 3CCMA 3V8JA 1JT8A 1K73C 2VS1A 3OW2A 5HGQA 1HZCA 2E2HH 2Q5HA 3MEYA 1V9PA 3OTOQ 1GVPA 3D0FA 2PI2E 3E9IA 5IT9c 1Q81C 4DR3L 1WCMH 4EX5A 1PA6A 3E0EA 3TS0A 1VQOA 4KHPL 4A76A 2R6GA 3J80c 3EBEA 2UU9L 1QVFA 3HXYA 4HJAA 2I4MA 3MF2A 4H2XB 2HIXA 1SRYA 2GVAA 1X2HA 4BWAA 1ADJA 1PYSA 3DLLA 2EIFA 3VQYA 4HJ7A 3KF6B 1X2GA 3PUVA 4A3JG 1DGSA 11ASA 3RR5A 4RMFA 2DTHA 4XU3A 3S1QH 3PO3G 4AYBE 4LFCQ 1X3FA 2KCTA 1SROA 1A63A 5FLMG 4BW9A 1B76A 1EIYA 2OQKA 1CSPA 1G51A 2GVBA 1MKHA 4HIDA 1EQQA 4R4CA 4A3EG 3L2ZA 2VL6A 1HNZQ 1HXDA 1QVGA 1FVIA 2N78A 3K81C 1SMXA 3F2CA 3NETA 1YJ9A 3U4ZA 3RLOA 1WOCA 4GLXA 3S14H 1K0RA 4DK3C 4XIGS 3KOJA 1MJCA 2CWPA 1VQ5A 3B6YA 4A93G 2YTVA 3HOUH 4H2YA 1OXSC 1WCMG 2WAQG 3G71A 4LF6Q 2Q5IA 3RLFA 2K52A 4LUOA 5IE8A 1TWHH 3OD1A 4HWSA 4YRCA 5E3IA 2DKGA 4EO4A 3VQWA 4APVA 3CD6A 1N9WA 2D0OA 1W66A 2ZM6Q 4L87A 4PG3A 3OTOL 2IX0A 3W1BA 1YJNA 2R92G 1VQPA 4R4QA 2OWOA 2UU9Q 1IBLL 3ER0A 1Z9FA 4A3BH 3RUXA 4NB3A 4GS3A 4ZIBA 1J5WA 1NYRA 1Q86C 4A3FG 1I5FA 5LMNW 2DTIA 4UPAA 3CC2A 3HKZG 3CCJA 2ZZFA 1JJ2A 4YRLA 4CS2A 4GN3B 4DV6L 4B3TQ 4XEOA 3P8YA 1HNXQ 2KHIA 3ERRA 4IPHA 3GTJH 4JI5L 2QHVA 1TXYA 1VQFA 4X66L 1VQ4A 3P8TA 4P71C 3S15H 1E22A 4LVIA 1YFRA 3FHWA 4XEMA 4JI4L 1XMQQ 1YGBA 2CKZB 3G1ZA 4DQ2A 1KMNA 4KHPQ 1OXXK 2R93H 3CCVA 3M4OH 3EFRA 2YV5A 4KR2A 3HOUG 4X64Q 3STBC 3RL6A 4XU1A 3V7RA 4JBJA 1S40A 2D62A 2ZIMA 4OX9L 4RG1A 4JCVE 4YRIA 4MNOA 4DV5Q 3LC0A 1AE3A 1IBMQ 4CH3A 4QQBX 1NJ8A 4RDXA 5FJ8G 3HXUA 2EQSA 4YY3L 4Y7NH 1ASYA 2I5MX 2YU9H 2LSSA 1LYLA 4OWXB 4DV0L 3HOYG 4BXXH 4A75A 3UDGA 4NXML 3LGJA 4YRFA 1VQGA 1WFQA 5J3BA 4BY7G 1EWIA 4HWRA 2VUMG 4GNXC 4A3IG 4HIKA 4A3CG 3UDFA 2I0QA 2E41A 1YIJA 1QF6A 3RLNA 4A3GG 1B7YA 5JJIA 3G4SA 2K5HA 5IYBH 4YYEA 4C3IH 2JEBI 1WI5A 4JI0L 1JJGA 2CQOA 3KF6A 2JK8A 3TQYA 2A1AA 1U0LA 4DV0Q 4HT4A 4YHHL 2Z6KA 3CMAA 3E9HA 2Q7GA 2NS6A 3L0OA 5C44G 2BH8A 1PV4A 4DK6C 3A5UA 3PUZA 4DR7Q 4DV4Q 2R7ZG 4HVCA 1SE8A 2MO1A 1Z7MA 4IOAA 2QHSA 4JI8L 4YCUA 1LTLA 1UE6A 2A8VA 3CAMA 3OYYA 1SFOH 1M90C 4K86A 1V1QA 5ELOA 2VW9A 4TVAA 1NJ5A 2KBNA 1QUQB 1VQLA 3CC4A 1YBYA 2NZOA 1TWAH 5C3EH 4LVKA 4LUVA 3RKXA 1HR0L 4QIWE 3HOWH 5F5WA 3UGQA 3NBHB 4XTCS 4CS3A 1IBKQ 4BBRG 3F2BA 2Q2IA 3JAMi 1NJIC 3F2DA 1N32Q 4H2SA 1KQSA 1EVKA 3EFSA 2ZTDA 3L1AA 2JA9A 1NMGA 4UP9A 4PHCA 3H0GH 2I5LX 4OWTB 5C4XG 4DUYQ 2I4OA 3W1GA 4WF2A 3V8KA 4Q6GA 2HNIA 4LFBL 1U5KA 1EQRA 4YCWA 4WJ3M 1SRUA 4JV5Q 4OLFA 4ALPA 2WB1E 5FLMH 4DV7L 1X65A 4BA1I 1B7YB 4A3MG 2Q2TA 3VBBA 2ATWA 4DR6Q 2E2IH 2RHQA 4IJLA 5AJ3Q 4DPGA 1X54A 2JA6G 2B29A 5C0XJ 3PCOB 4DR2Q 5BR8L 1VQ8A 2OQ0A 1K8AC 3M3YH 1IYJB 1BBUA 2HHHL 4HJ8A 1HNWL 2H5XA 2DXUA 1N8RC 4YHHQ 2ZTEA 3G6EA 4RQFA 2CJBA 2R7DA 3J7ZC 1MJEA 2DTOA 1HC7A 2ZIOA 3VQVA 4YRNA 1KD1C 3PUXA 1WLEA 2R7FA 4JV5L 1K83H 1X9NA 2DZCA 4DV3L 4NCXA 2ALYB 1C7YA 3CQZH 2EXDA 1K8GA 3I55A 3RGLA 3SGIA 1FJGL 4KQEA 4PZ8A 1PH3A 2RHSA 3EIVA 3S2HH 1L0WA 2HHHQ 1HNWQ 3CMQA 2OTJA 1I94Q 2ZR2A 4YDQA 2F3IA 3A5ZB 3EN2A 3BZCA 4JBKA 4IFDJ 4DR4Q 1SESA 3CXCA 2K50A 3RKYA 3HFZA 4DAMA 2ZM6L 5C51B 2XTIA 1Q7YC 3A32A 2ARUA 2EJFA 3PIOA 1LM0A 2DDZA 4DUZQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ L;  2DQ3 A;  2LXK A;  5BR8 Q;  1VS0 A;  1WPY A;  1EFW A;  2WAQ E;  4XU2 A;  3PV0 A;  2IX1 A;  3RKW A;  4GOP B;  4GLA C;  4JC0 A;  3PSI A;  4JI7 Q;  1RIP A;  2ODR D;  1EIY B;  3A7A A;  4WI1 A;  3PO2 H;  3HXX A;  3V7S A;  3Q8D A;  2RF4 A;  1EVL A;  5IWA Q;  2E65 A;  2ZT6 A;  2UXC L;  4O2D A;  4HJ9 A;  3PO3 H;  2IT1 A;  3BU2 A;  4X66 Q;  4LF9 L;  1YIT A;  1WU7 A;  3HOX G;  4LNQ A;  2B63 G;  4NXN Q;  1QE0 A;  3STB D;  1XNR L;  3VQX A;  1Q1B A;  2NZH A;  2K14 A;  5GRO A;  3PUY A;  3HOW G;  4L5Q A;  3QNE A;  2E5L Q;  3LSQ A;  1AE2 A;  3V7C A;  3UDX A;  4BBS G;  2K5N A;  4YWK A;  4H2T A;  3KFU A;  3CW2 C;  1WYD A;  3CCU A;  4A3B G;  2F4V L;  3J80 i;  1Q46 A;  4OX9 Q;  1E1T A;  2Q2H A;  4JI8 Q;  2PME A;  4TWA A;  3L7Z C;  4CS4 A;  5JJK A;  1KRT A;  3W3S A;  4LUZ A;  3DSQ A;  4KLK A;  5IY0 A;  1WQW A;  5LMU Q;  4LF5 L;  1QZH A;  1XNR Q;  2VZA A;  2QHT A;  5LMN L;  1VQB A;  4X62 L;  5EAY A;  1QZG A;  5M5W H;  2JA8 G;  3S24 A;  1SER A;  4XTZ A;  2HT1 A;  4NPS A;  4UY8 C;  1VQE A;  1R9T H;  2HQL A;  4XTY A;  4YRE A;  2ZZG A;  3HY1 A;  4ME3 A;  2E8G A;  4DR1 Q;  1HH2 P;  4JYA Q;  5IP9 H;  1I6H H;  1G29 1;  2CJA A;  3PO2 G;  5K36 G;  4IPG A;  3DM3 A;  1K3R A;  4LF7 Q;  1KL9 A;  1SN8 A;  3A7U A;  2ZJQ A;  1KC8 C;  2JA7 H;  2ZTC A;  4GOP C;  1GD7 A;  1XPO A;  4L5R C;  2I4L A;  1X6O A;  4IFD G;  4QJF A;  3H3V H;  3AYH B;  4HA8 A;  3M85 A;  4UP8 A;  4B3S L;  2OTL A;  3UDI A;  1YVC A;  4BY1 G;  4Y52 H;  4K87 A;  4GNX A;  1UE5 A;  4A4I A;  4TVY A;  1CUK A;  1H4Q A;  1KAW A;  4GKJ L;  1RIQ A;  2R7Z H;  3FJP A;  1KIX A;  1VQC A;  1CKM A;  2UXD L;  2K5V A;  3WWV A;  1MIU A;  4DV1 Q;  2J3M A;  4A3L G;  2PQA A;  5JEA J;  4R4T A;  5IYD H;  3HXZ A;  1WJJ A;  5M5X H;  4PZ7 A;  1HZ9 A;  3RN2 A;  3IRB A;  1YJW A;  5HY6 A;  3HOZ G;  5JJL A;  1EYG A;  2E5L L;  2ZGW A;  1L2F A;  3A0J A;  3J81 j;  4PZ6 A;  4JYA L;  5JEA G;  3K80 C;  2NVY H;  2JA6 H;  4DR4 L;  2CCZ A;  2JA8 H;  3AFP A;  3GTP H;  1O7I A;  2Q7E A;  3HOY H;  1TWG H;  3NEM A;  1PH5 A;  2NVX H;  4LFA Q;  4B3T L;  3KJO A;  5H1S E;  5IP9 G;  5DLQ E;  3QTC A;  2I5H A;  4DV7 Q;  4AIM A;  4JBM A;  4XTX A;  2E5A A;  2R93 G;  3AEV A;  3R07 A;  3TEH B;  3GTK H;  1JJC B;  3I2Z A;  4H2U A;  3J81 c;  4YRQ A;  1HR0 Q;  1Y14 B;  1USY A;  5C3E G;  4JG2 A;  4C3J H;  3HKZ E;  2Q2U A;  4X65 Q;  1CKO A;  2LXJ A;  1TWC H;  1N32 L;  12AS A;  3CC7 A;  5C53 B;  4IPC A;  4DV4 L;  4TQU S;  1X3G A;  4HWO A;  3T1Y L;  2DJZ A;  3FKI G;  3FP9 A;  1VQH A;  4A3G H;  1BBW A;  1H4S A;  1NJ1 A;  1GO3 E;  4GN4 B;  4X62 Q;  1PH4 A;  4OP0 A;  1L1O A;  1XJV A;  1VCI A;  1E7Z A;  4YRS A;  3KDF A;  4GKK L;  4TTV A;  2RHQ B;  3G48 A;  4P75 C;  4JI6 L;  4JI7 L;  4HIO A;  4R4O A;  2E2J H;  4DR7 L;  2MQH A;  2I4N A;  2XGT A;  4LF4 Q;  3IG2 A;  2N49 A;  4B3M L;  2R92 H;  3WQZ A;  4LF8 L;  2B3G A;  3RNU A;  4GNX B;  2ALY A;  2IHF A;  4L5S A;  3KDF B;  4DUY L;  3JC6 6;  2ID0 A;  2K75 A;  2Q7H A;  1EUJ A;  3S1R H;  1J5E L;  2CIM A;  4K88 A;  4YCV A;  3S1M H;  1UE7 A;  3IKL A;  1XTD A;  2ZZE A;  5FLX c;  1C9O A;  4ZTZ B;  2DGY A;  1PH9 A;  1QVC A;  3L4G B;  5M3M G;  3J7A 5;  3V8L A;  3PCO A;  1VQ9 A;  1SLJ A;  4QY7 A;  4LFA L;  4P73 A;  1A62 A;  2ZT5 A;  3T1Y Q;  3HXV A;  3J81 i;  3IKM B;  3RN5 A;  4MTN A;  5IYC H;  1HNX L;  1HJP A;  4XTW A;  4QGU A;  2EAY A;  2L15 A;  2BA0 A;  1FGU A;  2QGQ A;  1UWV A;  4G85 A;  4XTU A;  4A3K H;  3A5Z A;  2ARS A;  1ADY A;  3HOZ H;  2JA7 G;  4B3S Q;  4X6A H;  4JI3 L;  1XNQ Q;  3HFZ B;  1CKN A;  4DV2 Q;  2AHO B;  1VQK A;  2NN6 I;  4YRP A;  1D7Q A;  1WNL A;  3GTL H;  2DQ0 A;  3M4P A;  2ZR3 A;  3TEH A;  4LF7 L;  1N36 L;  4K0K Q;  1EIF A;  5C44 H;  1Y1V H;  3RZD H;  3I56 A;  1N33 Q;  3CCS A;  4B3M Q;  2UUA Q;  1N36 Q;  2C7I A;  2JQO A;  4TVA B;  3I4N H;  2IY5 B;  4AQY L;  1N33 L;  1X56 A;  1KRS A;  2PMZ E;  3MXN B;  4DAY B;  2C8M A;  3CME A;  1IBM L;  3KLW A;  4WJ4 A;  1VQ6 A;  2CGH A;  1A8V A;  3S17 H;  2EWN A;  2IHE A;  2P5I A;  3CPF A;  4P75 A;  1M1K C;  3TEG A;  4A3I H;  4A3C H;  2ZTG A;  4IFD I;  1IL2 A;  1L1O B;  4P73 C;  3HTZ A;  2VQE L;  4A3J H;  4YWM A;  4KR3 A;  1Q1E A;  2ART A;  3HRI A;  2UUC Q;  3HOV H;  1Q12 A;  4JI0 Q;  4YP0 A;  4MZ9 A;  2MO0 A;  4TVW A;  3K8A A;  1BVS A;  1NTG A;  2NN6 G;  1XMO Q;  2JJQ A;  3M7N A;  3ICA A;  5LMU L;  1HR0 W;  4AH6 A;  2DXT A;  4BBR H;  2PQA B;  4OWW B;  2F52 A;  4LF4 L;  3U4V A;  4DR1 L;  3I4N G;  2IY5 A;  4DNI A;  4H2V A;  1PHJ A;  4Q15 A;  4G84 A;  1E24 A;  1PH8 A;  4DV1 L;  4YRJ A;  4P74 A;  4C3H H;  2NVQ H;  4LW1 A;  2ZXF A;  1BKB A;  3S2D H;  1I50 H;  4KI0 A;  3L2P A;  5IYD G;  4UP7 A;  3TRZ A;  4DR6 L;  1XMO L;  2E1H A;  2DZ9 A;  2RHS B;  4YRM A;  3PZC A;  2PNH A;  4GKK Q;  1KOG A;  4L5T A;  3ULJ A;  4IOC A;  1G6P A;  3UH0 A;  1W2B A;  2YTX A;  4LWC A;  1KHI A;  1NYQ A;  4JI5 Q;  3S16 H;  3PIP A;  3CCQ A;  5C4J H;  4A93 H;  1N34 Q;  1Z7N A;  1KXL A;  2EL9 A;  2VUM H;  2J3L A;  4TQD A;  2FXQ A;  4A3M H;  1VQ7 A;  4B3R L;  3GTO H;  4LFC L;  2QA4 A;  2E10 A;  2Z0S A;  3VDY A;  4A3D G;  4C2M H;  5KNN A;  2UUB L;  4E51 A;  1BIA A;  4P72 C;  5C52 B;  1NNH A;  2AKW B;  2EJG A;  5IP7 G;  3HOX H;  4P72 A;  4JI2 Q;  1Y1W H;  1VQZ A;  4BY7 H;  1SET A;  1RL2 A;  3A74 A;  1NJ2 A;  2QEX A;  2QHU A;  4K0K L;  1IZ6 A;  3F8T A;  3KF8 B;  4RQE A;  2VQE Q;  4AQY Q;  3RF1 A;  1IXR A;  3ULP A;  3U50 C;  3CCE A;  4HWP A;  1X55 A;  1NJ6 A;  4TQF A;  4YPF A;  5GAH C;  2UUC L;  1Q82 C;  4FDB A;  4HJ5 A;  4DR3 Q;  1ATI A;  2CWA A;  4BY1 H;  4A3L H;  3K7U C;  4H2X A;  1K9M C;  4DV3 Q;  5K1X A;  1C0A A;  4JBW A;  4DKA C;  4YRR A;  1HZA A;  2D0P A;  1N34 L;  4BA2 I;  5GAG C;  2AMC B;  3I7F A;  3HOV G;  4IO9 A;  3BFM A;  3M9B A;  5IP7 H;  2KCM A;  5E7N A;  1YB3 A;  3K0X A;  4AYB G;  2WB1 G;  4JOI C;  3MF1 A;  3NEL A;  3UFG A;  1JJC A;  4ZTU B;  3W5O A;  3TS2 A;  3HY0 A;  1YNX A;  1VQI A;  1GM5 A;  1PFS A;  4JI4 Q;  1YHA A;  3RIR A;  2DU7 A;  3HXW A;  3GTQ H;  4YY3 Q;  1IBK L;  1XPR A;  1ASZ A;  2UUB Q;  2K4K A;  3UE0 A;  2WFW A;  2AKW A;  4BBS H;  2JA5 G;  2WP8 J;  5GQO A;  4HWT A;  1YHQ A;  2DEQ A;  4QL5 A;  2B63 H;  2F4V Q;  1HNZ L;  4H2W A;  1S72 A;  2FYK A;  1YEZ A;  2E64 A;  5C0X G;  2BA1 A;  2Z6K C;  3RZO H;  4P3P A;  1VQM A;  3CP0 A;  1YHB A;  3L4G A;  4YRT A;  2PMF A;  2N8N A;  4POG A;  1J5E Q;  4R1J A;  2ASB A;  2HIV A;  4HIM A;  3D31 A;  1B70 B;  4LF6 L;  2ODR C;  2NVT H;  1NY4 A;  2BH2 A;  1HTT A;  2MFI A;  4GOP A;  4JI3 Q;  1XPU A;  2RCN A;  1E1O A;  1V43 A;  4CH4 A;  5C0X I;  1G5I A;  2A19 A;  4KHZ A;  1KMM A;  2ES2 A;  3REU A;  2ZNI A;  3GO5 A;  3CPW A;  5FJ8 H;  2VQF Q;  4JOI A;  1PH1 A;  3T1H L;  5M5Y H;  1WQ7 A;  1OTC A;  2DVE A;  3K7A H;  1H95 A;  1T9H A;  4JI2 L;  1Z47 A;  2KEN A;  4YRG A;  4OXP A;  3TRE A;  4DR5 Q;  1FL0 A;  1UEB A;  5AJ3 L;  3ERS X;  3HRK A;  3NEN A;  1G5H A;  2VY3 A;  3FKI H;  4DR2 L;  4GKJ Q;  3CCR A;  1OXV A;  3MEF A;  2CFM A;  5GAE C;  1HZB A;  2V1C C;  1D8L A;  2YTY A;  1I3Q H;  2UXC Q;  3KJP A;  5GAD C;  3LSS A;  1P16 A;  4DV5 L;  4P71 A;  1GKH A;  4A3F H;  1AH9 A;  1PYS B;  1A0I A;  1TWF H;  3UE1 A;  4YWL A;  4GN5 A;  3U58 A;  4IPD A;  1E3P A;  2MNA A;  3RAC A;  3A7R A;  5M3M H;  1XNQ L;  1UE1 A;  5M3F H;  1GGM A;  3CCL A;  1YI2 A;  2JA5 H;  1EOV A;  2DUD A;  2JE6 I;  1L1O C;  3A5Y A;  4JI1 Q;  3A31 A;  2UUA L;  2ZJR A;  2ZT7 A;  3GTG H;  1LUZ A;  3PUW A;  2Y0S G;  3ICE A;  4EQ5 A;  1B70 A;  1VQJ A;  3AQQ A;  2KHJ A;  1NMF A;  4BXX G;  4DUZ L;  1FJG Q;  2ZJP A;  3ZJY C;  4X5O A;  1H4V B;  3S1N H;  4PMW A;  4P74 C;  3I4O A;  1H4T A;  3H0G G;  2VNU D;  1Y1V G;  1NE3 A;  5IWA L;  4CH6 A;  5C4X H;  2E3C A;  3PF4 A;  3ULL A;  5IYC G;  4OON A;  1Q8K A;  2PI2 A;  2JEA I;  4H02 A;  4JI1 L;  2VQF L;  5IYB G;  5ELN A;  1P8L A;  3GD7 A;  2OCE A;  2AMC A;  1USY C;  2ZIN A;  5LMN Q;  1PYB A;  3PF5 A;  4LF9 Q;  2ZCE A;  4LF5 Q;  1QUQ A;  1YZ6 A;  1PH7 A;  1Y1W G;  1FYF A;  1W3S A;  1SR3 A;  2GN5 A;  2UXB L;  4OO1 I;  1VQN A;  4P3N A;  1VQA A;  3PGZ A;  3CF5 A;  4A3D H;  1JB7 A;  3P8V A;  3F1Z A;  2N3S A;  3I4M H;  1PVO A;  3JAM c;  1B8A A;  5M3F G;  4LFB Q;  2AWO A;  4A3E H;  3BJU A;  4DV6 Q;  2Y0S E;  1YFS A;  1PH2 A;  3UGT A;  1JMC A;  3HKS A;  2C35 B;  1X01 A;  2DU5 A;  3H15 A;  4B3R Q;  3M4Q A;  2YYZ A;  1OXU A;  4XTV A;  1OXT A;  4JI6 Q;  1S3O A;  4YRO A;  3GTM H;  2UXB Q;  4CH5 A;  3GDE A;  3TUP A;  2ZT8 A;  4NXM Q;  4DV2 L;  4GLV B;  1NBW A;  3KYH C;  3REX A;  1BIB A;  1J6Q A;  4XU0 A;  1CSQ A;  1CKN B;  1X3E A;  4LF8 Q;  2EJ9 A;  5K1P A;  3T1H Q;  4J15 A;  3QO5 A;  1JE5 A;  2CJ9 A;  4A3K G;  4LNS A;  4O0A A;  4OO1 G;  3BZK A;  1YFT A;  4NXN L;  3I4M G;  4R4I A;  4POF A;  1I94 L;  1PH6 A;  2P0L A;  4X65 L;  1VQD A;  3H3V I;  4DR5 L;  1IBL Q;  3QO7 A;  2AWN A;  2G4C A;  3HFV A;  2ZNJ A;  4IJH A;  4X64 L;  3QO8 A;  2UXD Q;  4P3O A;  4YRK A;  3AFQ A;  3IAL A;  3CCM A;  3V8J A;  1JT8 A;  1K73 C;  2VS1 A;  3OW2 A;  5HGQ A;  1HZC A;  2E2H H;  2Q5H A;  3MEY A;  1V9P A;  3OTO Q;  1GVP A;  3D0F A;  2PI2 E;  3E9I A;  5IT9 c;  1Q81 C;  4DR3 L;  1WCM H;  4EX5 A;  1PA6 A;  3E0E A;  3TS0 A;  1VQO A;  4KHP L;  4A76 A;  2R6G A;  3J80 c;  3EBE A;  2UU9 L;  1QVF A;  3HXY A;  4HJA A;  2I4M A;  3MF2 A;  4H2X B;  2HIX A;  1SRY A;  2GVA A;  1X2H A;  4BWA A;  1ADJ A;  1PYS A;  3DLL A;  2EIF A;  3VQY A;  4HJ7 A;  3KF6 B;  1X2G A;  3PUV A;  4A3J G;  1DGS A;  11AS A;  3RR5 A;  4RMF A;  2DTH A;  4XU3 A;  3S1Q H;  3PO3 G;  4AYB E;  4LFC Q;  1X3F A;  2KCT A;  1SRO A;  1A63 A;  5FLM G;  4BW9 A;  1B76 A;  1EIY A;  2OQK A;  1CSP A;  1G51 A;  2GVB A;  1MKH A;  4HID A;  1EQQ A;  4R4C A;  4A3E G;  3L2Z A;  2VL6 A;  1HNZ Q;  1HXD A;  1QVG A;  1FVI A;  2N78 A;  3K81 C;  1SMX A;  3F2C A;  3NET A;  1YJ9 A;  3U4Z A;  3RLO A;  1WOC A;  4GLX A;  3S14 H;  1K0R A;  4DK3 C;  4XIG S;  3KOJ A;  1MJC A;  2CWP A;  1VQ5 A;  3B6Y A;  4A93 G;  2YTV A;  3HOU H;  4H2Y A;  1OXS C;  1WCM G;  2WAQ G;  3G71 A;  4LF6 Q;  2Q5I A;  3RLF A;  2K52 A;  4LUO A;  5IE8 A;  1TWH H;  3OD1 A;  4HWS A;  4YRC A;  5E3I A;  2DKG A;  4EO4 A;  3VQW A;  4APV A;  3CD6 A;  1N9W A;  2D0O A;  1W66 A;  2ZM6 Q;  4L87 A;  4PG3 A;  3OTO L;  2IX0 A;  3W1B A;  1YJN A;  2R92 G;  1VQP A;  4R4Q A;  2OWO A;  2UU9 Q;  1IBL L;  3ER0 A;  1Z9F A;  4A3B H;  3RUX A;  4NB3 A;  4GS3 A;  4ZIB A;  1J5W A;  1NYR A;  1Q86 C;  4A3F G;  1I5F A;  5LMN W;  2DTI A;  4UPA A;  3CC2 A;  3HKZ G;  3CCJ A;  2ZZF A;  1JJ2 A;  4YRL A;  4CS2 A;  4GN3 B;  4DV6 L;  4B3T Q;  4XEO A;  3P8Y A;  1HNX Q;  2KHI A;  3ERR A;  4IPH A;  3GTJ H;  4JI5 L;  2QHV A;  1TXY A;  1VQF A;  4X66 L;  1VQ4 A;  3P8T A;  4P71 C;  3S15 H;  1E22 A;  1YFR A;  3FHW A;  4XEM A;  4JI4 L;  1XMQ Q;  1YGB A;  2CKZ B;  3G1Z A;  4DQ2 A;  1KMN A;  4KHP Q;  1OXX K;  2R93 H;  3CCV A;  3M4O H;  3EFR A;  2YV5 A;  4KR2 A;  3HOU G;  4X64 Q;  3STB C;  3RL6 A;  4XU1 A;  3V7R A;  4JBJ A;  1S40 A;  2D62 A;  2ZIM A;  4OX9 L;  4RG1 A;  4JCV E;  4YRI A;  4MNO A;  4DV5 Q;  3LC0 A;  1AE3 A;  1IBM Q;  4CH3 A;  4QQB X;  1NJ8 A;  4RDX A;  5FJ8 G;  3HXU A;  2EQS A;  4YY3 L;  4Y7N H;  1ASY A;  2I5M X;  2YU9 H;  2LSS A;  1LYL A;  4OWX B;  4DV0 L;  3HOY G;  4BXX H;  4A75 A;  3UDG A;  4NXM L;  3LGJ A;  4YRF A;  1VQG A;  1WFQ A;  5J3B A;  4BY7 G;  1EWI A;  4HWR A;  2VUM G;  4GNX C;  4A3I G;  4HIK A;  4A3C G;  3UDF A;  2I0Q A;  2E41 A;  1YIJ A;  1QF6 A;  3RLN A;  4A3G G;  1B7Y A;  5JJI A;  3G4S A;  2K5H A;  5IYB H;  4YYE A;  4C3I H;  2JEB I;  1WI5 A;  4JI0 L;  1JJG A;  2CQO A;  3KF6 A;  2JK8 A;  3TQY A;  2A1A A;  1U0L A;  4DV0 Q;  4YHH L;  2Z6K A;  3CMA A;  3E9H A;  2Q7G A;  3L0O A;  5C44 G;  2BH8 A;  1PV4 A;  4DK6 C;  3A5U A;  3PUZ A;  4DR7 Q;  4DV4 Q;  2R7Z G;  4HVC A;  1SE8 A;  2MO1 A;  1Z7M A;  4IOA A;  2QHS A;  4JI8 L;  4YCU A;  1LTL A;  1UE6 A;  2A8V A;  3CAM A;  3OYY A;  1SFO H;  1M90 C;  4K86 A;  1V1Q A;  5ELO A;  2VW9 A;  4TVA A;  1NJ5 A;  2KBN A;  1QUQ B;  1VQL A;  3CC4 A;  1YBY A;  2NZO A;  1TWA H;  5C3E H;  4LUV A;  3RKX A;  1HR0 L;  4QIW E;  3HOW H;  5F5W A;  3UGQ A;  3NBH B;  4XTC S;  4CS3 A;  1IBK Q;  4BBR G;  3F2B A;  2Q2I A;  3JAM i;  1NJI C;  3F2D A;  1N32 Q;  4H2S A;  1KQS A;  1EVK A;  3EFS A;  2ZTD A;  3L1A A;  2JA9 A;  1NMG A;  4UP9 A;  4PHC A;  3H0G H;  2I5L X;  4OWT B;  5C4X G;  4DUY Q;  2I4O A;  3W1G A;  4WF2 A;  3V8K A;  4Q6G A;  2HNI A;  4LFB L;  1U5K A;  1EQR A;  4YCW A;  4WJ3 M;  1SRU A;  4JV5 Q;  4OLF A;  4ALP A;  2WB1 E;  5FLM H;  4DV7 L;  1X65 A;  4BA1 I;  1B7Y B;  4A3M G;  2Q2T A;  3VBB A;  2ATW A;  4DR6 Q;  2E2I H;  2RHQ A;  4IJL A;  5AJ3 Q;  4DPG A;  1X54 A;  2JA6 G;  2B29 A;  5C0X J;  3PCO B;  4DR2 Q;  5BR8 L;  1VQ8 A;  2OQ0 A;  1K8A C;  3M3Y H;  1IYJ B;  1BBU A;  2HHH L;  4HJ8 A;  1HNW L;  2H5X A;  2DXU A;  1N8R C;  4YHH Q;  2ZTE A;  3G6E A;  4RQF A;  2CJB A;  2R7D A;  3J7Z C;  1MJE A;  2DTO A;  1HC7 A;  2ZIO A;  3VQV A;  4YRN A;  1KD1 C;  3PUX A;  1WLE A;  2R7F A;  4JV5 L;  1K83 H;  1X9N A;  2DZC A;  4DV3 L;  4NCX A;  2ALY B;  1C7Y A;  3CQZ H;  2EXD A;  1K8G A;  3I55 A;  3RGL A;  3SGI A;  1FJG L;  4KQE A;  4PZ8 A;  1PH3 A;  2RHS A;  3EIV A;  3S2H H;  1L0W A;  2HHH Q;  1HNW Q;  3CMQ A;  2OTJ A;  1I94 Q;  2ZR2 A;  4YDQ A;  2F3I A;  3A5Z B;  3EN2 A;  3BZC A;  4JBK A;  4IFD J;  4DR4 Q;  1SES A;  3CXC A;  2K50 A;  3RKY A;  3HFZ A;  4DAM A;  2ZM6 L;  5C51 B;  2XTI A;  1Q7Y C;  3A32 A;  2ARU A;  2EJF A;  3PIO A;  1LM0 A;  2DDZ A;  4DUZ Q; 
#chains in the Genus database with same CATH topology
 2PW7 A;  1XMQ L;  3KBX A;  2DQ3 A;  2EY1 A;  1B3Q A;  3GTO B;  2LXK A;  5BR8 Q;  3S1M B;  1VS0 A;  1WPY A;  1EFW A;  2WAQ E;  4XU2 A;  3PV0 A;  2IX1 A;  1KTK A;  4GOP B;  3RKW A;  4GLA C;  4JC0 A;  4LVJ A;  3PSI A;  3CRL C;  4JI7 Q;  1RIP A;  3A55 A;  2ODR D;  1EIY B;  3A7A A;  1STN A;  1CTM A;  4WI1 A;  3PO2 H;  3HXX A;  1GUN A;  2B39 A;  1FYC A;  4O42 A;  1DOM A;  3V7S A;  2C5C A;  3Q8D A;  2RF4 A;  2M2L A;  1PZI D;  1EVL A;  2O5J C;  1A15 A;  5IWA Q;  2E65 A;  2ZT6 A;  2UXC L;  3SVM A;  2BE5 D;  4O2D A;  4ZUJ A;  4HJ9 A;  1ENC A;  1TU2 B;  3MXP A;  1RTO A;  4C1N I;  3PO3 H;  4N9P A;  1CFM A;  3MAQ A;  2IT1 A;  3BU2 A;  4FF4 A;  3NPP A;  4X66 Q;  1Y8O B;  1I6H B;  1VMC A;  4LF9 L;  1YIT A;  4CDD C;  1WU7 A;  3HOX G;  4H7B A;  4EQP A;  1PZK D;  2RDG A;  4LNQ A;  2B63 G;  4NXN Q;  1QE0 A;  3STB D;  1XNR L;  3VQX A;  1Q1B A;  2NZH A;  3D3R A;  2K14 A;  1K3B C;  5GRO A;  3S17 B;  5EKK A;  3PUY A;  3HOW G;  2OXP A;  3S1Q B;  1SYF A;  3JAM L;  1STB A;  4L5Q A;  3QNE A;  2E5L Q;  3LSQ A;  1AE2 A;  1H9R A;  2E2D C;  3V7C A;  3UDX A;  4BBS G;  2K5N A;  3W2D A;  4YWK A;  4H2T A;  3KFU A;  2AQ1 B;  3CW2 C;  1WYD A;  2AUK A;  3CCU A;  2O4X A;  3VYR A;  4A3K B;  3DXJ C;  2Z6B A;  4A3B G;  2F4V L;  3J80 i;  1Q46 A;  5E1F A;  4HAE A;  1S5D D;  4KK7 A;  4OX9 Q;  1E1T A;  2Q2H A;  2F3V A;  4JI8 Q;  2PME A;  3D8G A;  5EBC A;  4TWA A;  3L7Z C;  4CS4 A;  5JJK A;  1KRT A;  4XQQ A;  3W3S A;  4LUZ A;  3T53 B;  3DSQ A;  4KLK A;  5IY0 A;  5ELC A;  1EYC A;  5A2Q L;  3K6O A;  4ABN A;  3V05 A;  3M4Y A;  2MUY A;  3IKJ A;  4HCS A;  1WQW A;  5LMU Q;  1SSO A;  3KLR A;  4LF5 L;  1QZH A;  1XNR Q;  4IFD H;  2VZA A;  2QHT A;  5LMN L;  2IPK D;  1VQB A;  4DXF A;  4X62 L;  2B2T C;  5ELB A;  5EAY A;  5D65 A;  1QZG A;  5M5W H;  5EPK A;  5FLX E;  2JA8 G;  3S24 A;  1SER A;  4LVL A;  3I73 A;  4XTZ A;  1ILP A;  3H94 A;  2F0W A;  2HT1 A;  2MPM A;  3Q0A A;  4NPS A;  4UY8 C;  1VQE A;  1R9T H;  2HQL A;  2M00 A;  1ZXT A;  4XTY A;  4YRE A;  2ZZG A;  4TKO B;  3HY1 A;  4ME3 A;  2E8G A;  1JOR A;  4DR1 Q;  1HH2 P;  4JYA Q;  5IP9 H;  1JWU D;  1I6H H;  1EYA A;  1G29 1;  1ZYR D;  2CJA A;  4A3J B;  3PO2 G;  5K36 G;  4IPG A;  3T13 A;  1GUS A;  3DM3 A;  1ET6 A;  1K3R A;  1KL9 A;  4LF7 Q;  3S2D B;  1SN8 A;  4C3I G;  3A7U A;  2ZJQ A;  1JE4 A;  1KC8 C;  2BDN A;  4V0B A;  3KLS A;  2JA7 H;  2ZTC A;  2L12 A;  1F2M A;  4GOP C;  4FXD A;  1GD7 A;  1XPO A;  1SBB B;  1U4R A;  4L5R C;  2I4L A;  1X6O A;  2IL8 A;  4IFD G;  4QJF A;  3H3V H;  3AYH B;  2Z4I A;  1NSN S;  2EXZ A;  4HA8 A;  3M85 A;  5T1I A;  4UP8 A;  4B3S L;  2OTL A;  4C2M B;  3UDI A;  1YVC A;  2H1E A;  2B2Y A;  3C1F A;  1VDZ A;  4FNF A;  4BY1 G;  1RJT A;  4Y52 H;  1U4P A;  1XTC D;  4K87 A;  4GNX A;  1UE5 A;  2K32 A;  3HEJ A;  2K05 A;  4A4I A;  1SNP A;  2F0P A;  2J0T D;  4TVY A;  1CUK A;  3FRP B;  1H4Q A;  5HUR A;  1KAW A;  4GKJ L;  1RIQ A;  1SNO A;  2R7Z H;  2L9H A;  3RZD B;  3FJP A;  3MC0 B;  2WAQ B;  1VQC A;  1CKM A;  1SNC A;  2B2Y C;  1KIX A;  2UXD L;  1LTS D;  2K5V A;  1S5B D;  1RD9 D;  3WWV A;  3GV6 A;  1MIU A;  4DV1 Q;  2J3M A;  3MXU A;  4A3L G;  1WTQ A;  1EY9 A;  4K2K A;  2NUC A;  4J1M A;  1ENF A;  4N9T A;  2F3W A;  1ZKO A;  2PQA A;  5JEA J;  4R4T A;  5IYD H;  4FF2 A;  3HXZ A;  1WJJ A;  1BOS A;  5M5X H;  1X3P A;  3M4O B;  3FPP A;  1HA5 A;  1SDF A;  4PZ7 A;  4NKL A;  1HZ9 A;  2WIN B;  3RN2 A;  3IRB A;  1YJW A;  5G3L F;  5HY6 A;  5FKA C;  5CGK A;  3HOZ G;  5JJL A;  2VB3 X;  1RKN A;  1V1P A;  1EYG A;  2E5L L;  2ZGW A;  1L2F A;  1LT5 D;  4G57 A;  1CHP D;  3PIO 3;  1BUV T;  3A0J A;  3J81 j;  4PZ6 A;  4DA2 A;  1ICW A;  4JYA L;  5JEA G;  2HCI A;  1EU4 A;  3SXH A;  3K80 C;  2NVY H;  2JA6 H;  4DR4 L;  2BCO A;  1MHW C;  2CCZ A;  4EGV A;  5C3X A;  3FPU B;  3AFP A;  2JA8 H;  3GTP H;  1JOQ A;  5E3F A;  1O7I A;  4NMZ A;  3HOY H;  2Q7E A;  1TWG H;  3NEM A;  1PH5 A;  5C4Z A;  2NVX H;  2F0I A;  4LFA Q;  3NTH A;  4OIJ A;  3MFY A;  4B3T L;  2SEB D;  5DAU A;  1WTX A;  3KJO A;  5H1S E;  2YU9 B;  1A6X A;  5CMD A;  5CBA E;  1UAP A;  5IP9 G;  4PNY A;  5DLQ E;  1AZQ A;  1PLF A;  3QTC A;  4PMB A;  2I5H A;  1I4X A;  3OMG A;  4DV7 Q;  1MGS A;  3QJY A;  4AIM A;  4JBM A;  4XYQ A;  2Q8T A;  5EKL A;  4XTX A;  2E5A A;  2R93 G;  4PV1 C;  2KEC A;  4FXG C;  3AEV A;  3R07 A;  2WKD A;  3TEH B;  3GTK H;  5HGT A;  1JJC B;  3I2Z A;  1F9P A;  4H2U A;  3J81 c;  4YRQ A;  1HR0 Q;  1Y14 B;  1QWY A;  1USY A;  5C3E G;  4JG2 A;  4C3J H;  3HKZ E;  2CH4 W;  2Q2U A;  4X65 Q;  1CT1 D;  5M5W B;  5L37 A;  3T56 B;  1B9N A;  1CKO A;  1AP0 A;  3PO3 B;  2LXJ A;  1TWC H;  2PW5 A;  1SE4 A;  3PO2 B;  2PCF B;  1TS5 A;  2F1M A;  1N32 L;  12AS A;  2Z9H A;  3NWT A;  3CC7 A;  5C53 B;  4HMJ A;  4IPC A;  3T16 A;  2A8E A;  1BQQ T;  4DV4 L;  3C46 A;  4ZAI A;  3MEH A;  1L0Y B;  1ONL A;  4TQU S;  4K8J A;  1I50 B;  2LS0 1;  1SMY C;  1BF4 A;  1X3G A;  4HWO A;  3KUP A;  3T1Y L;  1EQV A;  1V1P B;  2DJZ A;  3FKI G;  3FP9 A;  1VQH A;  2QDL A;  1I4R A;  4F8M A;  4A3G H;  1BBW A;  3I8Z A;  1H4S A;  1NJ1 A;  1GO3 E;  4GN4 B;  1CHQ D;  4X62 Q;  1PH4 A;  4OP0 A;  4BY1 B;  2CW0 D;  2EE1 A;  1L1O A;  1XJV A;  1VCI A;  1E7Z A;  4YRS A;  3KDF A;  3CRK C;  4GKK L;  4HSP A;  2FHT A;  4CKC A;  4TTV A;  1SYE A;  2RHQ B;  1MSG A;  3G48 A;  3SK4 A;  5JVH 3;  5DM7 3;  4P75 C;  3HZX A;  1ENA A;  4ZK9 B;  1D1K A;  1FNU A;  1I3Q B;  4MTK A;  4JI6 L;  4JI7 L;  4HIO A;  1SXT A;  4R4O A;  2E2J H;  4DR7 L;  2MQH A;  2I4N A;  3DEO A;  2LY7 A;  1HTP A;  2XGT A;  4LF4 Q;  1EU3 A;  4KY7 A;  3IG2 A;  2N49 A;  4IN3 A;  4B3M L;  2R92 H;  1O7Z A;  2F0J A;  3WQZ A;  4LF8 L;  2B3G A;  2XWB B;  3RNU A;  4GNX B;  2ALY A;  4KTA A;  2IHF A;  1TKW B;  3NWS A;  4L5S A;  1KLG D;  1TWF B;  2PO4 A;  5E4X A;  3KDF B;  2HQE A;  3HS0 C;  4DUY L;  3JC6 6;  1JWS D;  1LTB D;  2ID0 A;  2K75 A;  2Q7H A;  1WTV A;  1EUJ A;  5D3D A;  1Y1V B;  3S1R H;  1IKL A;  3PQI A;  1J5E L;  2CIM A;  4K88 A;  4YCV A;  1V8Q A;  2OEO A;  3S1M H;  4I65 A;  1UE7 A;  1XTD A;  3IKL A;  2ZZE A;  3A8J E;  5FLX c;  3DM1 A;  5FLX L;  1ICF B;  3K7A B;  4N8X 1;  2K01 A;  5K36 H;  1C9O A;  4ZTZ B;  2JYO A;  1SAP A;  4RGN A;  1DXM A;  5IGC A;  2DGY A;  4FP5 D;  1PH9 A;  1QVC A;  2ZT9 C;  3L4G B;  5M3M G;  4RH6 A;  3J7A 5;  3V8L A;  3PCO A;  3BVG A;  3BG3 A;  2L11 A;  1VQ9 A;  1SLJ A;  4QY7 A;  4LFA L;  4P73 A;  1A62 A;  2ZT5 A;  3K57 A;  3T1Y Q;  1GHK A;  1SEB D;  4G7H C;  3HXV A;  3J81 i;  3IKM B;  1FD7 D;  3RN5 A;  3HOY B;  3OWE B;  4MTN A;  5IYC H;  4G7O C;  1HNX L;  1EWH A;  2FMC A;  2LMC B;  1DON A;  1HJP A;  4XTW A;  4QGU A;  1RF2 D;  3M3Y B;  3M7G A;  2QKI C;  2EAY A;  2RVL A;  2L15 A;  2BA0 A;  3H0G B;  1FGU A;  2QGQ A;  1UWV A;  4G85 A;  4OEM B;  4XTU A;  2Z4H A;  5FK9 C;  2A69 C;  5C4H A;  4A3K H;  3A5Z A;  1PTO H;  2A6E D;  3VR5 A;  2ARS A;  1ADY A;  1EQT A;  1U9R A;  3HOZ H;  4IUR A;  1BR9 A;  2JA7 G;  2AUJ D;  4B3S Q;  3H91 A;  4X6A H;  3SK6 A;  4JI3 L;  5JVG 3;  3LWE A;  1XNQ Q;  3HFZ B;  1CKN A;  4DV2 Q;  2AHO B;  3VYS A;  2FJ2 A;  3QR8 A;  4KY6 A;  1VQK A;  4Q0F A;  2NN6 I;  5ELE A;  4YRP A;  1D7Q A;  1WNL A;  4Y7N B;  3ZYY X;  3GTL H;  2DQ0 A;  3M4P A;  1B3A A;  2EJF C;  2ZR3 A;  3TEH A;  4BBR B;  5M3M B;  1C48 A;  4C3J B;  1NCV A;  3BVZ A;  1GUO A;  4LF7 L;  3K5M A;  3CKI B;  3E5S A;  1N36 L;  2NVT B;  1WCM B;  4K0K Q;  1IL8 A;  1EIF A;  5C44 H;  1Y1V H;  3RZD H;  2R7Z B;  3I56 A;  1N33 Q;  3MZ5 A;  3CCS A;  3GP7 A;  5KYI A;  4B3M Q;  1F9R A;  2UUA Q;  1TQO A;  1N36 Q;  2JQO A;  2C7I A;  4TVA B;  1EZ8 A;  3I4N H;  2IY5 B;  4AQY L;  5C44 B;  1TS4 A;  1N33 L;  4FF3 A;  4HTH A;  1X56 A;  3A56 A;  1KRS A;  2Z1C A;  2PMZ E;  2A6H C;  3MXN B;  4DAY B;  3OOC A;  3SHL A;  5M5X B;  3CME A;  2C8M A;  3R8B A;  1IBM L;  3KLW A;  4WJ4 A;  2NN6 H;  1VQ6 A;  2QW7 A;  4CJ1 B;  2CGH A;  2NVY B;  1A8V A;  3S17 H;  4LMQ D;  2EWN A;  2IHE A;  3IFD A;  2P5I A;  3CPF A;  2XRS D;  4P75 A;  3DWA A;  4ZRZ A;  1M1K C;  1D5M C;  3TEG A;  3D4W A;  4A3I H;  1D5Z C;  4A3C H;  1CA6 A;  2ZTG A;  4IFD I;  1EFI D;  2H4O A;  1IL2 A;  1L1O B;  3SEB A;  4QB4 A;  4P73 C;  5M9O A;  3HTZ A;  2K04 A;  3E0J A;  1TY0 A;  1HXY D;  1M4V A;  2VQE L;  3P75 A;  1GJX A;  1DOK A;  4A3J H;  3KK7 A;  2EOT A;  1B9M A;  4YWM A;  3MXN A;  1FR3 A;  2E76 C;  1TWG B;  5ISR A;  5A35 A;  2SOB A;  4KR3 A;  1IW7 C;  1Q1E A;  1STY A;  2ART A;  5CBE E;  1W6J A;  5BN4 A;  3HRI A;  2UUC Q;  2F0K A;  2EVB A;  3HOV H;  1Q12 A;  5FO9 B;  3GTK B;  4JI0 Q;  4YP0 A;  4MZ9 A;  2MO0 A;  3R93 A;  4TVW A;  3AB9 A;  3K8A A;  3Q22 A;  1BVS A;  5IGF A;  1NTG A;  2NN6 G;  5EJW A;  4CJ0 B;  1XMO Q;  2JJQ A;  1I4P A;  3M7N A;  5BN3 A;  3ICA A;  5LMU L;  1C4Q A;  3MQZ A;  1HR0 W;  3A8I E;  4AH6 A;  1JOO A;  4DXG A;  2LKV A;  2DXT A;  4BBR H;  4B08 A;  2PQA B;  4KD3 A;  4OWW B;  2F52 A;  4LF4 L;  3U4V A;  2F0O A;  1A3T A;  2XVS A;  2ICI A;  4DR1 L;  3I4N G;  4R8N A;  2IY5 A;  4CGY B;  2G9H D;  4DNI A;  4H2V A;  5I6Y A;  1PHJ A;  1LO5 D;  4Q15 A;  4G84 A;  4IUP A;  1YNJ D;  2WV6 D;  4C3J G;  5JJZ A;  1E24 A;  3TZU A;  4DV1 L;  1PH8 A;  4EQO A;  1PFB A;  4YRJ A;  1NUC A;  4P74 A;  4C3H H;  2NVQ H;  3I4M B;  1ET9 A;  2KED A;  4LW1 A;  1V1O A;  5C3E B;  2ZXF A;  4R9W A;  3HOU B;  1BKB A;  3S2D H;  5IGG A;  1I50 H;  4KI0 A;  3L2P A;  5IYD G;  4UP7 A;  1GUT A;  3TRZ A;  2JA7 B;  2QCP X;  2N55 A;  1EY4 A;  3BS1 A;  4OGQ C;  4CKE A;  1XMO L;  4DR6 L;  1BCP F;  1O80 A;  1B53 A;  2E1H A;  2DZ9 A;  1W6K A;  3E3X A;  2RHS B;  4YRM A;  3DWQ A;  2IX3 A;  2PNH A;  3PZC A;  4GKK Q;  1KOG A;  1JQY D;  3VYU A;  4L5T A;  1AN8 A;  4H44 C;  3ULJ A;  2DNE A;  3HOZ B;  4IQZ A;  4IOC A;  1G6P A;  2E2H B;  3UH0 A;  1W2B A;  2B8F A;  2YTX A;  4LWC A;  3D4R A;  3NQI A;  4J8Q A;  1KHI A;  3J7A F;  4ZUI A;  3G7L A;  1NYQ A;  2B2W A;  1ZYR C;  4JI5 Q;  3S16 H;  3PIP A;  3CCQ A;  5C4J H;  4A93 H;  4DAP A;  1N34 Q;  1BNZ A;  1Z7N A;  1KAB A;  1KXL A;  2EL9 A;  2VUM H;  2F03 A;  2J3L A;  4TQD A;  2FXQ A;  4A3B B;  4A3M H;  3SK5 A;  1VQ7 A;  4B3R L;  4ZYS A;  3K5O A;  3GTO H;  4LFC L;  2QA4 A;  2E10 A;  2Z0S A;  3VDY A;  4A3D G;  3VR6 A;  4X3K A;  1LTG D;  4C2M H;  5KNN A;  1UNS A;  2UUB L;  3A8K E;  4K2L A;  4E51 A;  2KHS A;  2KOL A;  2JN4 A;  1BIA A;  1LTI D;  3C1E A;  4P72 C;  5C52 B;  4FO2 A;  1NNH A;  2AKW B;  2EJG A;  5IP7 G;  2R3Z A;  3HOX H;  4P72 A;  4JI2 Q;  4KV6 A;  1Y1W H;  1VQZ A;  2MGS A;  4BY7 H;  1K8M A;  3TP5 A;  3IFT A;  2KEE A;  1SET A;  1RL2 A;  4ID6 A;  3A74 A;  3NP8 A;  2A6H D;  3U9S A;  1BCP B;  4RGT A;  1NJ2 A;  2QEX A;  5KNC A;  2QHU A;  4K0K L;  3WOE A;  1LTT D;  1IZ6 A;  1WTW A;  3F8T A;  3KF8 B;  5CR3 A;  4RQE A;  2VQE Q;  1KNE A;  4AQY Q;  3QO2 A;  3NE5 B;  3RF1 A;  2HUG A;  1WTP A;  1IXR A;  3ULP A;  3U50 C;  3CCE A;  1X55 A;  4HWP A;  1NJ6 A;  4TQF A;  4YPF A;  5GAH C;  1CQV A;  2UUC L;  2HDL A;  2K6A A;  3HGB A;  1Q82 C;  4FDB A;  4HJ5 A;  4DR3 Q;  1ATI A;  2DDZ A;  2CWA A;  4BY1 H;  4A3L H;  3K7U C;  4H2X A;  1UUP A;  1K9M C;  2E2J B;  2L4N A;  2N88 A;  3RZO B;  1WVL A;  4DV3 Q;  3GTL B;  5K1X A;  1HTL D;  4RCO A;  1C0A A;  2DJG C;  4JBW A;  4DKA C;  1PTO D;  4NDX A;  3BDC A;  4XT1 B;  4YRR A;  1QOH A;  4HED A;  1HPC A;  1HZA A;  1STA A;  2D0P A;  1DJR D;  2X6L A;  5KEE A;  1N34 L;  4BA2 I;  2TSS A;  3I4N B;  5GAG C;  2AMC B;  3I7F A;  3HOV G;  3QOJ A;  4IO9 A;  1TS3 A;  3BFM A;  3M9B A;  5IP7 H;  2F0V A;  4RWS C;  2KCM A;  5E7N A;  1YB3 A;  1WD1 A;  3K0X A;  4AYB G;  2WB1 G;  3TZD A;  4JOI C;  5IGB A;  3MF1 A;  3NEL A;  3UFG A;  1JJC A;  4ZTU B;  4QF4 A;  2B2U C;  3W5O A;  3TS2 A;  3HY0 A;  1YNX A;  1VQI A;  1GM5 A;  1PFS A;  4JI4 Q;  1YHA A;  3RIR A;  2NBF A;  2K33 A;  2DU7 A;  3HXW A;  3GTQ H;  2F0M A;  4YY3 Q;  4OO1 H;  5CV7 A;  1JR0 D;  1IBK L;  1XPR A;  1ASZ A;  2SDF A;  2UUB Q;  2K4K A;  3UE0 A;  2ENB A;  3GTP B;  2EYO A;  4KKT A;  1TR5 A;  2WFW A;  2AKW A;  1QNK A;  1E2V A;  2EY6 A;  4KKS A;  1NAP A;  4BBS H;  2ICE C;  2CVR A;  4DN4 M;  4DAY A;  5I9P A;  1XYI A;  2JA5 G;  5KRU A;  3TME A;  2RDH A;  2D9U A;  2LFN A;  2WP8 J;  1LV9 A;  3NUC A;  5GQO A;  4CJ2 C;  1AFP A;  1YHQ A;  1G6Z A;  2A6E C;  2DEQ A;  4HWT A;  4QL5 A;  1QB5 D;  2B63 H;  2A69 D;  1STG A;  2F4V Q;  1HNZ L;  1F2Y A;  1E2Z A;  2K7V A;  4H2W A;  1MD2 D;  4X3S A;  1S72 A;  3EVQ A;  5CV6 A;  2FYK A;  1YEZ A;  1EY5 A;  1I4H A;  3HP3 A;  2E64 A;  5C0X G;  2F0T A;  2BA1 A;  2Z6K C;  5EGT A;  4A3D B;  2X69 A;  2XWJ B;  4ZQ3 A;  2KCC A;  5KND A;  3RZO H;  1D2B A;  2JP1 A;  1VQM A;  4P3P A;  4E6I A;  2AQ3 B;  4WOR A;  3CP0 A;  4RKL A;  3TSS A;  1YHB A;  3FEW X;  3L4G A;  4YRT A;  4L6T B;  4I7A A;  1DD2 A;  2F0H A;  2A68 D;  2PMF A;  2BOS A;  2N8N A;  2EPB A;  3ITP A;  5C5L A;  4POG A;  1J5E Q;  4R1J A;  1QNU A;  1VF5 C;  4UAI A;  2ASB A;  2HIV A;  1GXD C;  2AQ2 B;  4HIM A;  4KY5 A;  3D31 A;  1B70 B;  1D1I A;  4LF6 L;  2ODR C;  2NVT H;  1NY4 A;  2BH2 A;  1HTT A;  2MFI A;  4GOP A;  3MA2 B;  4HR7 B;  4JI3 Q;  1XPU A;  1IYV A;  2RCN A;  1E1O A;  1V43 A;  3J7Y W;  2ZXR A;  4CH4 A;  5C0X I;  2NVQ B;  5JOB A;  5I9O A;  1ILQ A;  1WTO A;  1G5I A;  1CK1 A;  2A19 A;  4KHZ A;  1KMM A;  4A3G B;  2I07 B;  2ES2 A;  1EIH A;  3REU A;  2ZNI A;  3GO5 A;  4G4K A;  1B44 D;  3CPW A;  5FJ8 H;  2VQF Q;  2EDG A;  2NWG A;  2VUM B;  1I4G A;  4JOI A;  1PH1 A;  2SNS A;  3T1H L;  1EY8 A;  1X3Q A;  4ODG A;  3D4D A;  5M5Y H;  1WQ7 A;  4QIW B;  1OTC A;  2DVE A;  5I6W A;  4AYB B;  5A2Q E;  4RCN A;  3D6W A;  3K7A H;  1H95 A;  5JPN C;  2F0N A;  1T9H A;  4JI2 L;  2QDB A;  1Z47 A;  2KEN A;  1KDB A;  4K6D A;  3OIP A;  1Z7T A;  4YRG A;  4OXP A;  2NZ1 D;  3TRE A;  3PIP 3;  4DR5 Q;  1FL0 A;  3FKI B;  2EJM A;  1UEB A;  5AJ3 L;  2F0L A;  3ERS X;  5ELF A;  3HRK A;  2DJF C;  3NEN A;  1G5H A;  2KUM A;  1TVX A;  2VY3 A;  3FKI H;  4DNR B;  3TDQ A;  4DR2 L;  4GKJ Q;  3CCR A;  2NVX B;  2EY2 A;  4K8I A;  1OXV A;  3QOL A;  3MEF A;  1BO0 A;  2CFM A;  4BWG B;  5GAE C;  3ERQ A;  5IOC A;  1HZB A;  2V1C C;  2PPB C;  4DAV A;  1D8L A;  2L5T A;  5NUC A;  1SJE D;  2XNA C;  2YTY A;  1I3Q H;  2UXC Q;  4MHE A;  3BDL A;  3HOV B;  3KJP A;  5GAD C;  1JWM D;  3LSS A;  1P16 A;  5FOB B;  1YNN C;  1R4P B;  4DV5 L;  2PNR C;  4YIJ A;  2F4I A;  3BVM A;  5IGE A;  4P71 A;  4L8J A;  3OPO A;  1F9S A;  2EYL A;  1GKH A;  3T51 B;  5I2X A;  1HCZ A;  1PYS B;  4A3F H;  1AH9 A;  4LVM A;  1CZG A;  1A0I A;  1TWF H;  3UE1 A;  4YWL A;  1CZW A;  4GN5 A;  3U58 A;  4IPD A;  5G3L D;  2K5Q A;  1E3P A;  2MNA A;  3OSO A;  4RKB A;  3Q24 A;  3A7R A;  2PYK A;  3RAC A;  5M3M H;  1K28 A;  1KDC A;  3SDZ A;  4N8F A;  1XNQ L;  1UE1 A;  3MXG A;  4WJW A;  5M3F H;  2IJ0 A;  1GGM A;  1H9K A;  3EJI A;  1STH A;  3CCL A;  2F0Q A;  4HMI A;  5M3F B;  1YI2 A;  1J9O A;  2JA5 H;  4O1N A;  1EOV A;  1Y8P B;  2DUD A;  2JE6 I;  1L1O C;  3A5Y A;  1PTO B;  5KNB A;  5J1Z A;  4JI1 Q;  3A31 A;  2UUA L;  1A3V A;  1B4O A;  2ZJR A;  2ZT7 A;  1JC7 A;  1SE2 A;  3GTG H;  1LTA D;  1GUW A;  1LUZ A;  5COR A;  3PUW A;  1DOL A;  2Y0S G;  3ICE A;  1GOZ A;  1QE6 A;  3DMU A;  1T5E A;  4EQ5 A;  1B70 A;  1VQJ A;  3AQQ A;  1O78 A;  2KHJ A;  1NMF A;  4BXX G;  4DUZ L;  1FJG Q;  2ZJP A;  3TP6 A;  3ZJY C;  4X5O A;  1H4V B;  3S1N H;  1A3U A;  1O7Y A;  4PMW A;  4P74 C;  3I4O A;  1H4T A;  3H0G G;  3I3C A;  1KNA A;  3VA7 A;  2VNU D;  4RAU C;  1Y1V G;  1NE3 A;  1XX8 A;  5IWA L;  4FVM A;  4FYD A;  1S5F D;  4CH6 A;  5C4X H;  5CC4 A;  1TII D;  4ZCK A;  2P5Z X;  2E3C A;  1IHZ A;  3PF4 A;  2K03 A;  3ULL A;  1I4Q A;  5IYC G;  4OON A;  3I91 A;  1Q8K A;  2PI2 A;  3DHQ A;  2JEA I;  4H02 A;  2EYF A;  3N6R A;  4JI1 L;  3LNN A;  2VQF L;  5IYB G;  5ELN A;  5KYL A;  4DK0 A;  3TP7 A;  1P8L A;  1K0S A;  3GD7 A;  4LJZ C;  2OCE A;  5IT9 L;  2L55 A;  2AMC A;  1USY C;  2ZIN A;  1AW7 A;  5LMN Q;  1PYB A;  1HQM C;  3PF5 A;  4LF9 Q;  2ZCE A;  4LF5 Q;  3AU7 A;  1QUQ A;  1YZ6 A;  1PH7 A;  1SND A;  3J80 L;  1Y1W G;  1FYF A;  3MHB A;  1W3S A;  1SR3 A;  1SNM A;  2GN5 A;  2UXB L;  4KJO A;  1PTO C;  4OO1 I;  1NR2 A;  2A5H A;  1PDQ A;  1VQA A;  1VQN A;  3PGZ A;  2E75 C;  4XDX A;  4P3N A;  2JXM B;  3CF5 A;  4A3D H;  1JB7 A;  1JIC A;  3P8V A;  3QIA A;  5EPJ A;  3F1Z A;  2N3S A;  3I4M H;  1CM9 A;  4JVZ A;  1PVO A;  3JAM c;  5JPM C;  5T1G A;  1B8A A;  3GTG B;  5M3F G;  4A3I B;  4LFB Q;  2AWO A;  1SYD A;  4A3E H;  4C56 C;  4K5X A;  2RCF A;  2DY7 A;  3BJU A;  3OIQ A;  4DV6 Q;  2Y0S E;  4JK1 C;  3OW7 A;  1YFS A;  2KCN A;  5EPL A;  1PH2 A;  3FDT A;  4RA8 A;  3CHB D;  3UGT A;  1JMC A;  3HKS A;  2C35 B;  3S1N B;  2XRQ D;  1X01 A;  2DU5 A;  1SYC A;  3H15 A;  3TN2 A;  4B3R Q;  3ONA B;  1TT2 A;  3M4Q A;  1JCK B;  2DY8 A;  2YYZ A;  1OXU A;  4XTV A;  3U9O A;  1E2W A;  1OXT A;  1QJO A;  3A54 A;  4JI6 Q;  1S3O A;  2I46 A;  4YRO A;  1PRT F;  3MFG A;  3GTM H;  2UXB Q;  4GZY C;  4CH5 A;  3GDE A;  1UEA B;  2F0F A;  1IKM A;  2E74 C;  3TP8 A;  3TUP A;  5JAV A;  2ZT8 A;  3URY A;  1HA6 A;  4NXM Q;  4DV2 L;  2O2L D;  4GLV B;  1NBW A;  3KYH C;  5DM6 3;  1TWH B;  2V4D A;  1FNV A;  2EYM A;  3REX A;  3NHH A;  4KJN A;  1BIB A;  1J6Q A;  4XU0 A;  3GTQ B;  1R9T B;  1CSQ A;  1CKN B;  1NNX A;  1X3E A;  4LF8 Q;  2EJ9 A;  2JA5 B;  1PMR A;  1ML0 D;  2NB0 A;  1QIL A;  5K1P A;  3K5L A;  3T1H Q;  5K5P A;  4RHR A;  4J15 A;  4XXE A;  1DCZ A;  3D6C A;  1JE5 A;  3QO5 A;  4K6L A;  1QCB D;  2CJ9 A;  2CHB D;  4XYO A;  1S5E D;  3ND9 A;  3S15 B;  4A3K G;  1SNQ A;  4LNS A;  4O0A A;  2CW0 C;  1IYU A;  4OO1 G;  3BZK A;  1YFT A;  4NXN L;  4C3H B;  3I4M G;  4R4I A;  2B8G A;  5D14 A;  3VR2 A;  4KD4 A;  1CQF A;  4POF A;  1I94 L;  3NBI A;  1PH6 A;  2EZV A;  2P0L A;  1H9J A;  4BBS B;  4X65 L;  1LTR D;  1VQD A;  3VR4 A;  3H3V I;  4HN7 A;  4ILW A;  4OEL B;  4DR5 L;  1IBL Q;  1OO9 B;  3QO7 A;  5FO7 B;  2F0E A;  3RMH A;  2AWN A;  2G4C A;  3HFV A;  2ZNJ A;  4IJH A;  4X64 L;  1L0X B;  1PTO F;  3QO8 A;  3RD4 A;  2UXD Q;  2HCC A;  4L63 B;  4P3O A;  5F2D A;  4YRK A;  3AFQ A;  3IAL A;  4OIK A;  3CCM A;  1HUM A;  5BN5 A;  3V8J A;  1JT8 A;  1MI2 A;  1K73 C;  2IW3 A;  3JAM E;  1WTR A;  2VS1 A;  3OW2 A;  5HGQ A;  2BDO A;  4JPB W;  1HZC A;  2E2H H;  2Q5H A;  3MEY A;  1B1Z A;  1V9P A;  1LAC A;  3OTO Q;  1GVP A;  2MHV A;  3D0F A;  2PI2 E;  4CDE C;  3E9I A;  5IT9 c;  4DGZ A;  2QEJ C;  1Q81 C;  4F87 A;  4DR3 L;  1WCM H;  1EL0 A;  4EX5 A;  1PA6 A;  3E0E A;  3I72 A;  1DYQ A;  1K83 B;  3TS0 A;  1C8C A;  5IIF A;  1VQO A;  4FXK C;  4A76 A;  2R6G A;  3J80 c;  4KHP L;  3EBE A;  2UU9 L;  4UHV A;  1QVF A;  3HXY A;  4HJA A;  2I4M A;  4WFN 3;  3MF2 A;  4H2X B;  2HIX A;  3OMC A;  1SRY A;  3L3O C;  2O5I C;  1FNW A;  1PZJ D;  2GVA A;  3N52 A;  4X3T A;  2K28 A;  1X2H A;  4BWA A;  1ADJ A;  1PYS A;  4U68 A;  2R93 B;  2XN9 C;  5M5Y B;  3DLL A;  2EIF A;  3A7L A;  1LLR D;  3VQY A;  4HJ7 A;  1JOK A;  3KF6 B;  3E6Z X;  4ULL A;  3HOX B;  1X2G A;  3PUV A;  1JB3 A;  2K5D A;  4CKB A;  1VF7 A;  4A3J G;  5JEA H;  1DGS A;  1D6E C;  1U4M A;  11AS A;  3RR5 A;  4RMF A;  1ROD A;  2DTH A;  1BCP C;  2K1B A;  4XU3 A;  2WAC A;  3S1Q H;  1PRT B;  2X6G A;  4RFB A;  3PO3 G;  1TY2 A;  3GQB A;  4ZKC B;  1MBY A;  4AYB E;  4LFC Q;  3I70 A;  1X3F A;  3EFX D;  2KCT A;  2NYZ D;  4MN3 A;  1A2U A;  1LT4 D;  2A74 C;  1SRO A;  5CYU A;  1A63 A;  5FLM G;  2JA6 B;  1B76 A;  4BW9 A;  4CHT B;  1EIY A;  2IWH A;  2OQK A;  1CSP A;  4FF1 A;  1G51 A;  2GVB A;  5TSS A;  1MKH A;  4HID A;  1EQQ A;  5J22 A;  3WOF A;  5I2Y A;  2Z8L A;  3CU7 A;  1H9M A;  3R3O A;  4R4C A;  3FVQ A;  1Q90 A;  1EYD A;  5C3W A;  3BYY B;  4A3E G;  3L2Z A;  2VL6 A;  1HNZ Q;  1HXD A;  1QVG A;  1FVI A;  3DUZ A;  2N78 A;  1XXG A;  3K81 C;  1DZ1 A;  1SMX A;  3F2C A;  3NET A;  3LX0 A;  1YJ9 A;  3U4Z A;  4TRD A;  4A3M B;  3RLO A;  1WOC A;  3G6J B;  2QIL A;  1PFM A;  1RHP A;  3KF8 A;  4GLX A;  4RGO S;  3V96 A;  3S14 H;  1K0R A;  4KHV A;  3T4A C;  4DK3 C;  1O7L A;  3R2I A;  2TMP A;  1ZEQ X;  1G91 A;  3MWY W;  1I6V C;  2D5D A;  1PRT D;  1AZP A;  1LAB A;  4XIG S;  3BYT B;  3KOJ A;  1MJC A;  2CWP A;  1GHJ A;  1VQ5 A;  2RKS A;  4DK1 A;  2Q8R E;  3GTJ B;  5KIX A;  1TWC B;  3B6Y A;  4A93 G;  3IL8 A;  3Q6S A;  2YTV A;  1PYW D;  3HOU H;  4H2Y A;  4OHJ A;  4G7Z C;  1OXS C;  4RHS A;  1WCM G;  3HKZ B;  2WAQ G;  3G71 A;  4LF6 Q;  2Q5I A;  4IZ8 A;  5C5M A;  3RLF A;  1II3 A;  2K52 A;  4LK1 C;  4LUO A;  5IE8 A;  4C1N K;  1LT6 D;  4KKU A;  5KGU A;  1TWH H;  3OD1 A;  3V2T A;  4HWS A;  4YRC A;  5E3I A;  4NW2 A;  2DKG A;  3EQL C;  4EO4 A;  5AFW A;  3DEP A;  3VQW A;  3BDO A;  4APV A;  2RSN A;  3X3M A;  4V19 0;  3CD6 A;  2RSO A;  1N9W A;  1ESR A;  2D0O A;  1W66 A;  1B2T A;  2ZM6 Q;  1PFN A;  1IW7 D;  4L87 A;  2G5D A;  4PG3 A;  4ZLT F;  3C2P A;  1HUN A;  1Q8I A;  5CV8 A;  3BZD B;  3LWU A;  3OTO L;  5LHY 1;  1QG7 A;  2KVM A;  2IX0 A;  3W1B A;  4U67 3;  4IUU A;  2B2V A;  1LT3 D;  1YJN A;  2R92 G;  2E2I B;  1FGB D;  1VQP A;  1H9S A;  2RDF A;  3C3L A;  4R4Q A;  2OWO A;  2UU9 Q;  1IBL L;  2Y0S B;  2OT2 A;  3ER0 A;  1TWA B;  1Z9F A;  4A3B H;  3RUX A;  2F0G A;  1CA5 A;  4NB3 A;  4GS3 A;  3PMF A;  4BS9 A;  3P1H A;  4ZIB A;  4PMC A;  4KN7 C;  1J5W A;  1NYR A;  1Q86 C;  1SMY D;  4A3F G;  4QUF A;  3GV3 A;  1I5F A;  3S16 B;  1F77 A;  5LMN W;  2DTI A;  4UPA A;  3CC2 A;  1Y69 U;  3HKZ G;  3CCJ A;  4M8A A;  1S4Z A;  1EZ6 A;  4MIU A;  2G9D A;  2L0C A;  2ZZF A;  2C9O A;  1JJ2 A;  3L9A X;  5C6A A;  2PQE A;  4K5W A;  1BBX C;  4YRL A;  4CS2 A;  4BY7 B;  2PZU A;  4GN3 B;  4DV6 L;  4B3T Q;  4XEO A;  3P8Y A;  4K14 A;  1HNX Q;  2ZXP A;  4IUT A;  2KHI A;  3J81 E;  3ERR A;  1EEF D;  2D2C C;  4IPH A;  3GTJ H;  4JI5 L;  1EY7 A;  2QHV A;  1TXY A;  1VQF A;  4X66 L;  1EOT A;  1VQ4 A;  3HOW B;  2VB2 X;  4IUN A;  4K5V A;  4H13 C;  5CV9 A;  3P8T A;  1X32 A;  3I4L A;  4P71 C;  2F0U A;  4OL7 A;  1NR4 A;  1E22 A;  3S15 H;  4LVI A;  1YFR A;  4EQN A;  3FHW A;  4XEM A;  2EJG C;  4JI4 L;  1XWE A;  1XMQ Q;  1YGB A;  1PXU A;  4XQJ A;  1ESF A;  2OF1 A;  2CKZ B;  3G1Z A;  4DQ2 A;  3P7J A;  1KMN A;  4KHP Q;  1AEX A;  1S5C D;  2F0D A;  1HFG A;  1OXX K;  2R93 H;  3CCV A;  3M4O H;  4QCL A;  3EFR A;  2HD3 A;  2YV5 A;  4KR2 A;  3HOU G;  4X64 Q;  5FO8 B;  2KA7 A;  3STB C;  5C4X B;  3RL6 A;  4XU1 A;  2A73 B;  4JBJ A;  3V7R A;  1S40 A;  2D62 A;  1F2L A;  2ZIM A;  4A3E B;  3X3N A;  1HHV A;  4OX9 L;  4RG1 A;  4X3U A;  4JCV E;  4YRI A;  4MNO A;  2MJ8 A;  4XT3 B;  5ELD A;  1EWC A;  2PMZ B;  3NSW A;  3A7A B;  3VYT A;  4DV5 Q;  2Q8I B;  2EYJ A;  3LC0 A;  1AE3 A;  3NTI A;  2B2V C;  4UDU C;  3GTM B;  5I4D A;  1IBM Q;  4CH3 A;  4QQB X;  1NJ8 A;  5D3I B;  4A93 B;  5FJ8 G;  4RDX A;  4KN4 C;  1Z6H A;  3HXU A;  2EQS A;  4YY3 L;  4Y7N H;  1ASY A;  2I5M X;  2YU9 H;  5EQ0 A;  2LSS A;  3K0Y A;  1RDP D;  1LYL A;  2SNM A;  3QG1 A;  4OWX B;  4DV0 L;  2EY5 A;  3HOY G;  4BXX H;  1STE A;  4A75 A;  3UDG A;  4NXM L;  4J6H A;  3SR1 A;  3K5N A;  4M1U B;  5LL6 S;  3S2H B;  3LGJ A;  1HQR D;  1VMP A;  4XQN A;  2FIN B;  2RA4 A;  5DEH A;  4YRF A;  3F2U A;  2GA4 B;  1KLU D;  1VQG A;  1D5X C;  1WFQ A;  2J7Z A;  5J3B A;  2NTS A;  4DFA A;  5C0X H;  4R8I A;  2L1B A;  4BY7 G;  3SE0 A;  1EWI A;  2WII B;  4HWR A;  2VUM G;  4GNX C;  2WKC A;  4HIK A;  4A3I G;  4A3C G;  5EBD A;  4HCE A;  3UDF A;  2PZT A;  5IT9 E;  3R2T A;  1SJH D;  3CQZ B;  3KBG A;  3MTS A;  4CBV A;  2ZXO A;  2I0Q A;  2E41 A;  1YIJ A;  1QF6 A;  3RLN A;  4A3G G;  1B7Y A;  5JJI A;  5E4W C;  3G4S A;  2K5H A;  3NTK A;  5IYB H;  4YYE A;  4C3I H;  2JEB I;  1RCV D;  1WI5 A;  1G2S A;  5IGD A;  3NQT A;  4JI0 L;  1JJG A;  2CQO A;  3KF6 A;  4B9W A;  2JK8 A;  4CDC C;  3TQY A;  2A1A A;  3H09 A;  1U0L A;  5CV5 A;  4CDF C;  4DV0 Q;  3J7A V;  4HT4 A;  3KLS X;  4YHH L;  2Z6K A;  3CMA A;  3E9H A;  4F7X A;  2Q7G A;  2NS6 A;  3L0O A;  2PZW A;  5C44 G;  2BH8 A;  1PV4 A;  4DK6 C;  1Q3L A;  4IUV A;  3IAY A;  3A5U A;  2WB1 B;  3PUZ A;  4DU9 A;  3S14 B;  2RQX A;  3S1R B;  1EY6 A;  4H0L C;  4DR7 Q;  4DV4 Q;  2CH4 A;  2R7Z G;  4HVC A;  1SE8 A;  2M9V A;  2MO1 A;  1SFO B;  2J4X A;  2KJX A;  1Z7M A;  4IOA A;  2QHS A;  5DNF A;  4JI8 L;  1WD0 A;  1EEI D;  1BCP D;  4YCU A;  1LTL A;  1UE6 A;  3H6M A;  2A8V A;  3CAM A;  4DF7 A;  3OYY A;  1SFO H;  1M90 C;  1HRJ A;  1V1Q A;  5ELO A;  2VW9 A;  4K86 A;  4TVA A;  3S9W A;  1NJ5 A;  3OHX C;  2KBN A;  3I90 A;  1QUQ B;  3O13 A;  4P2C B;  1VQL A;  3CC4 A;  1YBY A;  3WDN A;  2NZO A;  1TWA H;  5C3E H;  4LVK A;  2HDM A;  1EIG A;  4LUV A;  3RKX A;  1TS2 A;  4IUQ A;  1HR0 L;  4QIW E;  3HOW H;  5F5W A;  3UGQ A;  2DN8 A;  3NBH B;  4XTC S;  4CS3 A;  1IBK Q;  2BE5 C;  4RGM A;  4BBR G;  2VXW A;  4C3H G;  4ME5 A;  1CI3 M;  3F2B A;  1KDA A;  2Q2I A;  3QWN A;  1EY0 A;  3JAM i;  4JW0 A;  1NJI C;  1YNN D;  2B2T A;  3F2D A;  1N32 Q;  4H2S A;  3NXW A;  1KQS A;  1YNJ C;  5IOD A;  1K8O A;  3EA6 A;  1DM0 B;  1EVK A;  1B50 A;  3VR3 A;  3OWF A;  3EFS A;  2ZTD A;  3L1A A;  5J39 A;  2JA9 A;  1NMG A;  4UP9 A;  2XSC A;  1U4L A;  4PHC A;  4HSV A;  3HG9 A;  3Q23 A;  3H0G H;  2FFK B;  5LL6 X;  1WTH A;  2I5L X;  4I7Z C;  1R4Q B;  4OWT B;  3SK8 A;  4DNT B;  3QB3 A;  5C4X G;  4DUY Q;  2B63 B;  3W1G A;  2I4O A;  4WF2 A;  3V8K A;  2NTT A;  4Q6G A;  2HNI A;  4LFB L;  1U5K A;  3AMU A;  1EQR A;  4YCW A;  4WJ3 M;  1M8A A;  1SRU A;  3K58 A;  4JV5 Q;  5CV4 A;  3FMC A;  4OLF A;  2B2W C;  2MP1 A;  4ALP A;  2WB1 E;  3J81 L;  5FLM H;  4NP5 A;  2A68 C;  4LAA A;  4DV7 L;  1X65 A;  4BA1 I;  1B7Y B;  4A3M G;  2Q2T A;  3VBB A;  2ATW A;  1Y8N B;  2E2I H;  4IJL A;  5AJ3 Q;  4DR6 Q;  2RHQ A;  4DPG A;  4QMG A;  4TSS A;  1X54 A;  2JA6 G;  2B29 A;  3RUZ A;  3P20 A;  5C0X J;  3PCO B;  4KMU C;  5BR8 L;  4DR2 Q;  1VQ8 A;  3ERO A;  2OQ0 A;  1K8A C;  3M3Y H;  1IYJ B;  5C4J B;  1SE3 A;  4QUC A;  1A2T A;  1H9S B;  1PRT C;  3UI2 A;  1BBU A;  2HHH L;  4WRD A;  2JSO A;  4HJ8 A;  1HNW L;  2H5X A;  2DXU A;  1N8R C;  2R92 B;  4YHH Q;  2ZTE A;  1BDO A;  1Y1W B;  2EYP A;  3G6E A;  4RQF A;  2CJB A;  2R7D A;  3J7Z C;  1MJE A;  2DTO A;  1HC7 A;  2ZIO A;  3VQV A;  3J80 E;  4YRN A;  2FMM A;  1F2Z A;  1KD1 C;  3PUX A;  4A3F B;  1WLE A;  4EVO A;  3HRZ C;  1J8I A;  2R7F A;  3W3A A;  4JV5 L;  4PQX A;  2F0S A;  1GUG A;  1K83 H;  1HFN A;  1X9N A;  1E0B A;  1BXT A;  2DZC A;  4DV3 L;  4NCX A;  2ALY B;  1C7Y A;  3CQZ H;  2K5W A;  2EXD A;  2DNC A;  1K8G A;  1KAA A;  3I55 A;  3RGL A;  4IAL A;  3SGI A;  4B9X A;  1FJG L;  4KQE A;  3NK9 A;  2EYH A;  4PZ8 A;  1PH3 A;  2RHS A;  2QF7 A;  3EIV A;  5EKI A;  3S2H H;  1L0W A;  2HHH Q;  4ZKB B;  1HNW Q;  1I94 Q;  2OTJ A;  2ZR2 A;  3CMQ A;  1SYB A;  4YDQ A;  2F3I A;  3A5Z B;  1F9Q A;  3EN2 A;  1SYG A;  2XIW A;  3BZC A;  4JBK A;  2JA8 B;  5COY A;  4S3S A;  4IFD J;  1RTN A;  4DR4 Q;  1SES A;  4Z9C B;  3CXC A;  2K50 A;  3RKY A;  1G8Z D;  3HFZ A;  2R61 A;  2B2U A;  4DAM A;  3ND8 A;  3VA5 A;  4F88 A;  2ZM6 L;  4Q5V A;  1G2T A;  1T5X D;  2XTI A;  5C51 B;  1Q7Y C;  3MVV A;  3A32 A;  3H3V C;  2ARU A;  2EJF A;  3PIO A;  3NBH A;  1MSH A;  3K59 A;  2KQ3 A;  1LM0 A;  2CQA A;  2RBM A;  4C3I B;  4DUZ Q;  3DWP A;  3TBI B; 
#chains in the Genus database with same CATH homology
 1XMQ L;  2DQ3 A;  2LXK A;  5BR8 Q;  1VS0 A;  1WPY A;  1EFW A;  2WAQ E;  4XU2 A;  3PV0 A;  2IX1 A;  3RKW A;  4GOP B;  4GLA C;  4JC0 A;  4LVJ A;  3PSI A;  4JI7 Q;  1RIP A;  2ODR D;  1EIY B;  3A7A A;  4WI1 A;  3PO2 H;  3HXX A;  3V7S A;  3Q8D A;  2RF4 A;  1EVL A;  5IWA Q;  2E65 A;  2ZT6 A;  2UXC L;  4O2D A;  4HJ9 A;  3PO3 H;  2IT1 A;  3BU2 A;  4X66 Q;  4LF9 L;  1YIT A;  1WU7 A;  3HOX G;  4LNQ A;  2B63 G;  4NXN Q;  1QE0 A;  3STB D;  1XNR L;  3VQX A;  1Q1B A;  2NZH A;  2K14 A;  5GRO A;  3PUY A;  3HOW G;  4L5Q A;  3QNE A;  2E5L Q;  3LSQ A;  1AE2 A;  3V7C A;  3UDX A;  4BBS G;  2K5N A;  4YWK A;  4H2T A;  3KFU A;  3CW2 C;  1WYD A;  3CCU A;  4A3B G;  2F4V L;  3J80 i;  1Q46 A;  4OX9 Q;  1E1T A;  2Q2H A;  4JI8 Q;  2PME A;  4TWA A;  3L7Z C;  4CS4 A;  5JJK A;  1KRT A;  3W3S A;  4LUZ A;  3DSQ A;  4KLK A;  5IY0 A;  1WQW A;  5LMU Q;  4LF5 L;  1QZH A;  1XNR Q;  2VZA A;  2QHT A;  5LMN L;  1VQB A;  4X62 L;  5EAY A;  1QZG A;  5M5W H;  2JA8 G;  3S24 A;  1SER A;  4LVL A;  4XTZ A;  2HT1 A;  4NPS A;  4UY8 C;  1VQE A;  1R9T H;  2HQL A;  4XTY A;  4YRE A;  2ZZG A;  3HY1 A;  4ME3 A;  2E8G A;  4DR1 Q;  1HH2 P;  4JYA Q;  5IP9 H;  1I6H H;  1G29 1;  2CJA A;  3PO2 G;  5K36 G;  4IPG A;  3DM3 A;  1K3R A;  4LF7 Q;  1KL9 A;  1SN8 A;  3A7U A;  2ZJQ A;  1KC8 C;  2JA7 H;  2ZTC A;  4GOP C;  1GD7 A;  1XPO A;  4L5R C;  2I4L A;  1X6O A;  4IFD G;  4QJF A;  3H3V H;  3AYH B;  4HA8 A;  3M85 A;  4UP8 A;  4B3S L;  2OTL A;  3UDI A;  1YVC A;  4BY1 G;  4Y52 H;  4K87 A;  4GNX A;  1UE5 A;  4A4I A;  4TVY A;  1CUK A;  1H4Q A;  1KAW A;  4GKJ L;  1RIQ A;  2R7Z H;  3FJP A;  1KIX A;  1VQC A;  1CKM A;  2UXD L;  2K5V A;  3WWV A;  1MIU A;  4DV1 Q;  2J3M A;  4A3L G;  2PQA A;  5JEA J;  4R4T A;  5IYD H;  3HXZ A;  1WJJ A;  5M5X H;  4PZ7 A;  1HZ9 A;  3RN2 A;  3IRB A;  1YJW A;  5HY6 A;  3HOZ G;  5JJL A;  1EYG A;  2E5L L;  2ZGW A;  1L2F A;  3A0J A;  3J81 j;  4PZ6 A;  4JYA L;  5JEA G;  3K80 C;  2NVY H;  2JA6 H;  4DR4 L;  2CCZ A;  2JA8 H;  3AFP A;  3GTP H;  1O7I A;  2Q7E A;  3HOY H;  1TWG H;  3NEM A;  1PH5 A;  2NVX H;  4LFA Q;  4B3T L;  3KJO A;  5H1S E;  5IP9 G;  5DLQ E;  3QTC A;  2I5H A;  4DV7 Q;  4AIM A;  4JBM A;  4XTX A;  2E5A A;  2R93 G;  3AEV A;  3R07 A;  3TEH B;  3GTK H;  1JJC B;  3I2Z A;  4H2U A;  3J81 c;  4YRQ A;  1HR0 Q;  1Y14 B;  1USY A;  5C3E G;  4JG2 A;  4C3J H;  3HKZ E;  2Q2U A;  4X65 Q;  1CKO A;  2LXJ A;  1TWC H;  1N32 L;  12AS A;  3CC7 A;  5C53 B;  4IPC A;  2A8E A;  4DV4 L;  4TQU S;  1X3G A;  4HWO A;  3T1Y L;  2DJZ A;  3FKI G;  3FP9 A;  1VQH A;  4A3G H;  1BBW A;  1H4S A;  1NJ1 A;  1GO3 E;  4GN4 B;  4X62 Q;  1PH4 A;  4OP0 A;  1L1O A;  1XJV A;  1VCI A;  1E7Z A;  4YRS A;  3KDF A;  4GKK L;  4TTV A;  2RHQ B;  3G48 A;  4P75 C;  4JI6 L;  4JI7 L;  4HIO A;  4R4O A;  2E2J H;  4DR7 L;  2MQH A;  2I4N A;  2XGT A;  4LF4 Q;  3IG2 A;  2N49 A;  4B3M L;  2R92 H;  3WQZ A;  4LF8 L;  2B3G A;  3RNU A;  4GNX B;  2ALY A;  2IHF A;  4L5S A;  3KDF B;  4DUY L;  3JC6 6;  2ID0 A;  2K75 A;  2Q7H A;  1EUJ A;  3S1R H;  1J5E L;  2CIM A;  4K88 A;  4YCV A;  3S1M H;  1UE7 A;  3IKL A;  1XTD A;  2ZZE A;  5FLX c;  1C9O A;  4ZTZ B;  2DGY A;  1PH9 A;  1QVC A;  3L4G B;  5M3M G;  3J7A 5;  3V8L A;  3PCO A;  1VQ9 A;  1SLJ A;  4QY7 A;  4LFA L;  4P73 A;  1A62 A;  2ZT5 A;  3T1Y Q;  3HXV A;  3J81 i;  3IKM B;  3RN5 A;  4MTN A;  5IYC H;  1HNX L;  1HJP A;  4XTW A;  4QGU A;  2EAY A;  2L15 A;  2BA0 A;  1FGU A;  2QGQ A;  1UWV A;  4G85 A;  4XTU A;  4A3K H;  3A5Z A;  2ARS A;  1ADY A;  3HOZ H;  2JA7 G;  4B3S Q;  4X6A H;  4JI3 L;  1XNQ Q;  3HFZ B;  1CKN A;  4DV2 Q;  2AHO B;  1VQK A;  2NN6 I;  4YRP A;  1D7Q A;  1WNL A;  3GTL H;  2DQ0 A;  3M4P A;  2ZR3 A;  3TEH A;  4LF7 L;  1N36 L;  4K0K Q;  1EIF A;  5C44 H;  1Y1V H;  3RZD H;  3I56 A;  1N33 Q;  3CCS A;  4B3M Q;  2UUA Q;  1N36 Q;  2C7I A;  2JQO A;  4TVA B;  3I4N H;  2IY5 B;  4AQY L;  1N33 L;  1X56 A;  1KRS A;  2PMZ E;  3MXN B;  4DAY B;  2C8M A;  3CME A;  1IBM L;  3KLW A;  4WJ4 A;  1VQ6 A;  2CGH A;  1A8V A;  3S17 H;  2EWN A;  2IHE A;  2P5I A;  3CPF A;  4P75 A;  1M1K C;  3TEG A;  4A3I H;  4A3C H;  2ZTG A;  4IFD I;  1IL2 A;  1L1O B;  4P73 C;  3HTZ A;  2VQE L;  4A3J H;  4YWM A;  4KR3 A;  1Q1E A;  2ART A;  3HRI A;  2UUC Q;  3HOV H;  1Q12 A;  4JI0 Q;  4YP0 A;  4MZ9 A;  2MO0 A;  4TVW A;  3K8A A;  1BVS A;  1NTG A;  2NN6 G;  1XMO Q;  2JJQ A;  3M7N A;  3ICA A;  5LMU L;  3MQZ A;  1HR0 W;  4AH6 A;  2DXT A;  4BBR H;  2PQA B;  4OWW B;  2F52 A;  4LF4 L;  3U4V A;  4DR1 L;  3I4N G;  2IY5 A;  4DNI A;  4H2V A;  1PHJ A;  4Q15 A;  4G84 A;  1E24 A;  1PH8 A;  4DV1 L;  4YRJ A;  4P74 A;  4C3H H;  2NVQ H;  4LW1 A;  2ZXF A;  1BKB A;  3S2D H;  1I50 H;  4KI0 A;  3L2P A;  5IYD G;  4UP7 A;  3TRZ A;  4DR6 L;  1XMO L;  2E1H A;  2DZ9 A;  2RHS B;  4YRM A;  3PZC A;  2PNH A;  4GKK Q;  1KOG A;  4L5T A;  3ULJ A;  4IOC A;  1G6P A;  3UH0 A;  1W2B A;  2YTX A;  4LWC A;  1KHI A;  1NYQ A;  4JI5 Q;  3S16 H;  3PIP A;  3CCQ A;  5C4J H;  4A93 H;  1N34 Q;  1Z7N A;  1KXL A;  2EL9 A;  2VUM H;  2J3L A;  4TQD A;  2FXQ A;  4A3M H;  1VQ7 A;  4B3R L;  3GTO H;  4LFC L;  2QA4 A;  2E10 A;  2Z0S A;  3VDY A;  4A3D G;  4C2M H;  5KNN A;  2UUB L;  4E51 A;  1BIA A;  4P72 C;  5C52 B;  1NNH A;  2AKW B;  2EJG A;  5IP7 G;  3HOX H;  4P72 A;  4JI2 Q;  1Y1W H;  1VQZ A;  4BY7 H;  1SET A;  1RL2 A;  3A74 A;  1NJ2 A;  2QEX A;  2QHU A;  4K0K L;  1IZ6 A;  3F8T A;  3KF8 B;  4RQE A;  2VQE Q;  4AQY Q;  3RF1 A;  1IXR A;  3ULP A;  3U50 C;  3CCE A;  4HWP A;  1X55 A;  1NJ6 A;  4TQF A;  4YPF A;  5GAH C;  2UUC L;  1Q82 C;  4FDB A;  4HJ5 A;  4DR3 Q;  1ATI A;  2CWA A;  4BY1 H;  4A3L H;  3K7U C;  4H2X A;  1K9M C;  4DV3 Q;  5K1X A;  1C0A A;  4JBW A;  4DKA C;  4YRR A;  1HZA A;  2D0P A;  1N34 L;  4BA2 I;  5GAG C;  2AMC B;  3I7F A;  3HOV G;  4IO9 A;  3BFM A;  3M9B A;  5IP7 H;  2KCM A;  5E7N A;  1YB3 A;  3K0X A;  4AYB G;  2WB1 G;  4JOI C;  3MF1 A;  3NEL A;  3UFG A;  1JJC A;  4ZTU B;  3W5O A;  3TS2 A;  3HY0 A;  1YNX A;  1VQI A;  1GM5 A;  1PFS A;  4JI4 Q;  1YHA A;  3RIR A;  2DU7 A;  3HXW A;  3GTQ H;  4YY3 Q;  1IBK L;  1XPR A;  1ASZ A;  2UUB Q;  2K4K A;  3UE0 A;  2WFW A;  2AKW A;  4BBS H;  2JA5 G;  2WP8 J;  5GQO A;  4HWT A;  1YHQ A;  2DEQ A;  4QL5 A;  2B63 H;  2F4V Q;  1HNZ L;  4H2W A;  1S72 A;  2FYK A;  1YEZ A;  2E64 A;  5C0X G;  2BA1 A;  2Z6K C;  3RZO H;  4P3P A;  1VQM A;  3CP0 A;  1YHB A;  3L4G A;  4YRT A;  2PMF A;  2N8N A;  4POG A;  1J5E Q;  4R1J A;  2ASB A;  2HIV A;  4HIM A;  3D31 A;  1B70 B;  4LF6 L;  2ODR C;  2NVT H;  1NY4 A;  2BH2 A;  1HTT A;  2MFI A;  4GOP A;  4JI3 Q;  1XPU A;  2RCN A;  1E1O A;  1V43 A;  4CH4 A;  5C0X I;  1G5I A;  2A19 A;  4KHZ A;  1KMM A;  2ES2 A;  3REU A;  2ZNI A;  3GO5 A;  3CPW A;  5FJ8 H;  2VQF Q;  4JOI A;  1PH1 A;  3T1H L;  5M5Y H;  1WQ7 A;  1OTC A;  2DVE A;  3K7A H;  1H95 A;  1T9H A;  4JI2 L;  1Z47 A;  2KEN A;  4YRG A;  4OXP A;  3TRE A;  4DR5 Q;  1FL0 A;  1UEB A;  5AJ3 L;  3ERS X;  3HRK A;  3NEN A;  1G5H A;  2VY3 A;  3FKI H;  4DR2 L;  4GKJ Q;  3CCR A;  1OXV A;  3MEF A;  2CFM A;  5GAE C;  1HZB A;  2V1C C;  1D8L A;  2YTY A;  1I3Q H;  2UXC Q;  3KJP A;  5GAD C;  3LSS A;  1P16 A;  4DV5 L;  4P71 A;  1GKH A;  4A3F H;  1AH9 A;  1PYS B;  4LVM A;  1A0I A;  1TWF H;  3UE1 A;  4YWL A;  4GN5 A;  3U58 A;  4IPD A;  1E3P A;  2MNA A;  3RAC A;  3A7R A;  5M3M H;  1XNQ L;  1UE1 A;  5M3F H;  1GGM A;  3CCL A;  1YI2 A;  2JA5 H;  1EOV A;  2DUD A;  2JE6 I;  1L1O C;  3A5Y A;  4JI1 Q;  3A31 A;  2UUA L;  2ZJR A;  2ZT7 A;  3GTG H;  1LUZ A;  3PUW A;  2Y0S G;  3ICE A;  4EQ5 A;  1B70 A;  1VQJ A;  3AQQ A;  2KHJ A;  1NMF A;  4BXX G;  4DUZ L;  1FJG Q;  2ZJP A;  3ZJY C;  4X5O A;  1H4V B;  3S1N H;  4PMW A;  4P74 C;  3I4O A;  1H4T A;  3H0G G;  2VNU D;  1Y1V G;  1NE3 A;  5IWA L;  4CH6 A;  5C4X H;  2E3C A;  3PF4 A;  3ULL A;  5IYC G;  4OON A;  1Q8K A;  2PI2 A;  2JEA I;  4H02 A;  4JI1 L;  2VQF L;  5IYB G;  5ELN A;  1P8L A;  3GD7 A;  2OCE A;  2AMC A;  1USY C;  2ZIN A;  5LMN Q;  1PYB A;  3PF5 A;  4LF9 Q;  2ZCE A;  4LF5 Q;  1QUQ A;  1YZ6 A;  1PH7 A;  1Y1W G;  1FYF A;  1W3S A;  1SR3 A;  2GN5 A;  2UXB L;  4OO1 I;  1VQN A;  4P3N A;  1VQA A;  3PGZ A;  3CF5 A;  4A3D H;  1JB7 A;  3P8V A;  3F1Z A;  2N3S A;  3I4M H;  1PVO A;  3JAM c;  1B8A A;  5M3F G;  4LFB Q;  2AWO A;  4A3E H;  3BJU A;  4DV6 Q;  2Y0S E;  1YFS A;  1PH2 A;  3UGT A;  1JMC A;  3HKS A;  2C35 B;  1X01 A;  2DU5 A;  3H15 A;  4B3R Q;  3M4Q A;  2YYZ A;  1OXU A;  4XTV A;  1OXT A;  4JI6 Q;  1S3O A;  4YRO A;  3GTM H;  2UXB Q;  4CH5 A;  3GDE A;  3TUP A;  2ZT8 A;  4NXM Q;  4DV2 L;  4GLV B;  1NBW A;  3KYH C;  3REX A;  1BIB A;  1J6Q A;  4XU0 A;  1CSQ A;  1CKN B;  1X3E A;  4LF8 Q;  2EJ9 A;  5K1P A;  3T1H Q;  4J15 A;  3QO5 A;  1JE5 A;  2CJ9 A;  4A3K G;  4LNS A;  4O0A A;  4OO1 G;  3BZK A;  1YFT A;  4NXN L;  3I4M G;  4R4I A;  4POF A;  1I94 L;  1PH6 A;  2P0L A;  4X65 L;  1VQD A;  3H3V I;  4DR5 L;  1IBL Q;  3QO7 A;  2AWN A;  2G4C A;  3HFV A;  2ZNJ A;  4IJH A;  4X64 L;  3QO8 A;  2UXD Q;  4P3O A;  4YRK A;  3AFQ A;  3IAL A;  3CCM A;  3V8J A;  1JT8 A;  1K73 C;  2VS1 A;  3OW2 A;  5HGQ A;  1HZC A;  2E2H H;  2Q5H A;  3MEY A;  1V9P A;  3OTO Q;  1GVP A;  3D0F A;  2PI2 E;  3E9I A;  5IT9 c;  1Q81 C;  4DR3 L;  1WCM H;  4EX5 A;  1PA6 A;  3E0E A;  3TS0 A;  1VQO A;  4KHP L;  4A76 A;  2R6G A;  3J80 c;  3EBE A;  2UU9 L;  1QVF A;  3HXY A;  4HJA A;  2I4M A;  3MF2 A;  4H2X B;  2HIX A;  1SRY A;  2GVA A;  1X2H A;  4BWA A;  1ADJ A;  1PYS A;  3DLL A;  2EIF A;  3VQY A;  4HJ7 A;  3KF6 B;  1X2G A;  3PUV A;  4A3J G;  1DGS A;  11AS A;  3RR5 A;  4RMF A;  2DTH A;  4XU3 A;  3S1Q H;  3PO3 G;  4AYB E;  4LFC Q;  1X3F A;  2KCT A;  1SRO A;  1A63 A;  5FLM G;  4BW9 A;  1B76 A;  1EIY A;  2OQK A;  1CSP A;  1G51 A;  2GVB A;  1MKH A;  4HID A;  1EQQ A;  4R4C A;  4A3E G;  3L2Z A;  2VL6 A;  1HNZ Q;  1HXD A;  1QVG A;  1FVI A;  2N78 A;  3K81 C;  1SMX A;  3F2C A;  3NET A;  1YJ9 A;  3U4Z A;  3RLO A;  1WOC A;  4GLX A;  3S14 H;  1K0R A;  4DK3 C;  4XIG S;  3KOJ A;  1MJC A;  2CWP A;  1VQ5 A;  3B6Y A;  4A93 G;  2YTV A;  3HOU H;  4H2Y A;  1OXS C;  1WCM G;  2WAQ G;  3G71 A;  4LF6 Q;  2Q5I A;  3RLF A;  2K52 A;  4LUO A;  5IE8 A;  1TWH H;  3OD1 A;  4HWS A;  4YRC A;  5E3I A;  2DKG A;  4EO4 A;  3VQW A;  4APV A;  3CD6 A;  1N9W A;  2D0O A;  1W66 A;  2ZM6 Q;  4L87 A;  4PG3 A;  3OTO L;  2IX0 A;  3W1B A;  1YJN A;  2R92 G;  1VQP A;  4R4Q A;  2OWO A;  2UU9 Q;  1IBL L;  3ER0 A;  1Z9F A;  4A3B H;  3RUX A;  4NB3 A;  4GS3 A;  4ZIB A;  1J5W A;  1NYR A;  1Q86 C;  4A3F G;  1I5F A;  5LMN W;  2DTI A;  4UPA A;  3CC2 A;  3HKZ G;  3CCJ A;  2ZZF A;  1JJ2 A;  4YRL A;  4CS2 A;  4GN3 B;  4DV6 L;  4B3T Q;  4XEO A;  3P8Y A;  1HNX Q;  2KHI A;  3ERR A;  4IPH A;  3GTJ H;  4JI5 L;  2QHV A;  1TXY A;  1VQF A;  4X66 L;  1VQ4 A;  3P8T A;  4P71 C;  3S15 H;  1E22 A;  4LVI A;  1YFR A;  3FHW A;  4XEM A;  4JI4 L;  1XMQ Q;  1YGB A;  2CKZ B;  3G1Z A;  4DQ2 A;  1KMN A;  4KHP Q;  1OXX K;  2R93 H;  3CCV A;  3M4O H;  3EFR A;  2YV5 A;  4KR2 A;  3HOU G;  4X64 Q;  3STB C;  3RL6 A;  4XU1 A;  3V7R A;  4JBJ A;  1S40 A;  2D62 A;  2ZIM A;  4OX9 L;  4RG1 A;  4JCV E;  4YRI A;  4MNO A;  4DV5 Q;  3LC0 A;  1AE3 A;  1IBM Q;  4CH3 A;  4QQB X;  1NJ8 A;  4RDX A;  5FJ8 G;  3HXU A;  2EQS A;  4YY3 L;  4Y7N H;  1ASY A;  2I5M X;  2YU9 H;  2LSS A;  1LYL A;  4OWX B;  4DV0 L;  3HOY G;  4BXX H;  4A75 A;  3UDG A;  4NXM L;  3LGJ A;  4YRF A;  1VQG A;  1WFQ A;  5J3B A;  4BY7 G;  1EWI A;  4HWR A;  2VUM G;  4GNX C;  4A3I G;  4HIK A;  4A3C G;  3UDF A;  2I0Q A;  2E41 A;  1YIJ A;  1QF6 A;  3RLN A;  4A3G G;  1B7Y A;  5JJI A;  3G4S A;  2K5H A;  5IYB H;  4YYE A;  4C3I H;  2JEB I;  1WI5 A;  4JI0 L;  1JJG A;  2CQO A;  3KF6 A;  2JK8 A;  3TQY A;  2A1A A;  1U0L A;  4DV0 Q;  4HT4 A;  4YHH L;  2Z6K A;  3CMA A;  3E9H A;  2Q7G A;  2NS6 A;  3L0O A;  5C44 G;  2BH8 A;  1PV4 A;  4DK6 C;  3A5U A;  3PUZ A;  4DR7 Q;  4DV4 Q;  2R7Z G;  4HVC A;  1SE8 A;  2MO1 A;  1Z7M A;  4IOA A;  2QHS A;  4JI8 L;  4YCU A;  1LTL A;  1UE6 A;  2A8V A;  3CAM A;  3OYY A;  1SFO H;  1M90 C;  4K86 A;  1V1Q A;  5ELO A;  2VW9 A;  4TVA A;  1NJ5 A;  2KBN A;  1QUQ B;  1VQL A;  3CC4 A;  1YBY A;  2NZO A;  1TWA H;  5C3E H;  4LVK A;  4LUV A;  3RKX A;  1HR0 L;  4QIW E;  3HOW H;  5F5W A;  3UGQ A;  3NBH B;  4XTC S;  4CS3 A;  1IBK Q;  4BBR G;  3F2B A;  2Q2I A;  3JAM i;  1NJI C;  3F2D A;  1N32 Q;  4H2S A;  1KQS A;  1EVK A;  3EFS A;  2ZTD A;  3L1A A;  2JA9 A;  1NMG A;  4UP9 A;  4PHC A;  3H0G H;  2I5L X;  4OWT B;  5C4X G;  4DUY Q;  2I4O A;  3W1G A;  4WF2 A;  3V8K A;  4Q6G A;  2HNI A;  4LFB L;  1U5K A;  1EQR A;  4YCW A;  4WJ3 M;  1SRU A;  4JV5 Q;  4OLF A;  4ALP A;  2WB1 E;  5FLM H;  4DV7 L;  1X65 A;  4BA1 I;  1B7Y B;  4A3M G;  2Q2T A;  3VBB A;  2ATW A;  4DR6 Q;  2E2I H;  2RHQ A;  4IJL A;  5AJ3 Q;  4DPG A;  1X54 A;  2JA6 G;  2B29 A;  5C0X J;  3PCO B;  4DR2 Q;  5BR8 L;  1VQ8 A;  2OQ0 A;  1K8A C;  3M3Y H;  1IYJ B;  1BBU A;  2HHH L;  4HJ8 A;  1HNW L;  2H5X A;  2DXU A;  1N8R C;  4YHH Q;  2ZTE A;  3G6E A;  4RQF A;  2CJB A;  2R7D A;  3J7Z C;  1MJE A;  2DTO A;  1HC7 A;  2ZIO A;  3VQV A;  4YRN A;  1KD1 C;  3PUX A;  1WLE A;  2R7F A;  4JV5 L;  1K83 H;  1X9N A;  2DZC A;  4DV3 L;  4NCX A;  2ALY B;  1C7Y A;  3CQZ H;  2EXD A;  1K8G A;  3I55 A;  3RGL A;  3SGI A;  1FJG L;  4KQE A;  4PZ8 A;  1PH3 A;  2RHS A;  3EIV A;  3S2H H;  1L0W A;  2HHH Q;  1HNW Q;  3CMQ A;  2OTJ A;  1I94 Q;  2ZR2 A;  4YDQ A;  2F3I A;  3A5Z B;  3EN2 A;  3BZC A;  4JBK A;  4IFD J;  4DR4 Q;  1SES A;  3CXC A;  2K50 A;  3RKY A;  3HFZ A;  4DAM A;  2ZM6 L;  5C51 B;  2XTI A;  1Q7Y C;  3A32 A;  2ARU A;  2EJF A;  3PIO A;  1LM0 A;  2DDZ A;  4DUZ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...