3I7FA

Aspartyl trna synthetase from entamoeba histolytica
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
535
structure length
485
Chain Sequence
QLPPVVLLKTPELVSGENFKVMPMHQSQPCYKTGLKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKEFVQFCQKISAESICDITGIVKAVEKPIEKATQQDVEIHVTSIAVVSLAEYPLPMQIEDLTFPSSVFKKQEEDIAKVKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHLTEFEGLDIEMEIVENYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the aspartyl-tRNA synthetase from Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Ligase
molecule keywords Aspartyl-tRNA synthetase
total genus 129
structure length 485
sequence length 535
chains with identical sequence B
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i7fA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3i7fA02
2ZNIA 1HR0L 3PO3H 4XU3A 3UFGA 2K5NA 1HR0Q 2QHTA 4ZTUB 4JI6Q 1Q86C 4DR6Q 1BBWA 3CCSA 2C8MA 3HKZG 4YRLA 5IYBH 4LF7L 1VQHA 4XTUA 4K87A 2DZCA 1WLEA 1S72A 1IBLQ 4GN5A 4NPSA 1BVSA 1A0IA 4DV6Q 3MF2A 3UDIA 4HWTA 3PIOA 4LUOA 4LFBL 5HY6A 1HC7A 4DQ2A 4B3TL 5JJLA 2JEAI 1VQKA 3M4PA 3KJOA 2VZAA 4GKKL 4XEMA 4DK6C 2IX1A 4DR5L 1MJCA 5M5XH 1NJ1A 4AH6A 2EJGA 1PH4A 4A3CG 1VQ9A 2NVTH 3AEVA 2JA9A 5C3EH 2DXTA 2PI2E 3L0OA 2KBNA 3HXWA 5FLMG 3CF5A 4KHZA 1TXYA 4JV5L 3T1YL 4DK3C 2KCMA 2HHHL 4JI8Q 5E7NA 4LF4L 2JA6G 3HRKA 3P8TA 2DQ3A 2I4NA 3HXXA 4QGUA 3MF1A 2MO0A 3J80i 5LMUQ 2DTHA 5BR8L 3G1ZA 2PQAB 4LUVA 2LSSA 2I5MX 3H0GG 3HFZB 4JCVE 4GKJL 2G4CA 2CJ9A 4OX9L 3GTGH 1I94Q 1E1TA 3S1QH 3H3VI 1YIJA 4DR3Q 2A19A 2HQLA 1E3PA 4YRFA 2ODRC 1VQPA 4DR6L 1K8AC 1TWHH 1PH8A 1PVOA 3GTLH 3CCMA 2EXDA 3GTQH 3CCVA 3CPWA 4YWLA 3A0JA 3A7UA 1NTGA 2ZT7A 2Q2HA 1J6QA 3RN5A 1QUQA 1J5EQ 4CS4A 4GNXC 3E9IA 4P71C 2E5LL 1AE3A 2CJAA 4P74C 3S24A 1K83H 5J3BA 5C44G 3S1MH 1NJ6A 3K7UC 3S15H 4JI4L 2KCTA 2UUCL 1QE0A 3VDYA 4Q6GA 1B7YB 3I4NG 1TWGH 4LFCQ 5LMNL 1BBUA 3QNEA 2UXCL 4HJAA 4A3JG 2MO1A 1XNRL 3ZJYC 2UUAL 3A5ZB 2EIFA 1I3QH 4JV5Q 3NELA 1TWAH 1CKOA 3B6YA 3KDFA 3HRIA 4DV4L 3CAMA 4HJ5A 4C3HH 4APVA 2HT1A 1Y14B 4DV0L 1PH1A 4L5QA 5IYDG 4JYAL 2N49A 1Q1BA 1KRTA 1X9NA 4IOAA 1FYFA 4BY7H 1C7YA 1HH2P 1YEZA 4WJ3M 1JJGA 1K8GA 4DR3L 1NY4A 2Q5HA 3PUVA 3S2DH 4BY1H 1UE1A 1WU7A 4KHPQ 1BIAA 4P74A 1PHJA 4TVAB 4YWMA 2QEXA 1U5KA 4BXXH 4GKJQ 4LF6L 2ZGWA 3CXCA 4A3GH 4YWKA 3W1GA 1AH9A 2DTIA 2ZIOA 5C44H 1B70A 2DDZA 1YFTA 4JI7L 4OO1G 2BH2A 4YDQA 3S16H 1Q81C 1UE5A 4OWWB 4H02A 1PH5A 1HJPA 4DV7L 4KQEA 4LF5L 4OWTB 2CFMA 3L4GA 1JT8A 2OTJA 3T1HQ 2Z0SA 2ZIMA 4XTXA 1L1OB 1K73C 4YRRA 4YCWA 2HHHQ 4C3JH 1Y1WH 3HOXG 4BY7G 2ZXFA 2MFIA 4PZ6A 4A3EH 4R4QA 1SLJA 4LF5Q 1Q12A 3AFQA 4GS3A 3M85A 1XMQQ 3TEHA 4GLAC 3VBBA 2RHQA 2JA8G 3Q8DA 1KL9A 3F2CA 5JJKA 5AJ3Q 4BBRH 1W3SA 2UU9Q 1USYA 4RDXA 3I4MG 4HWSA 2QHSA 4YRGA 2C7IA 2ZNJA 3ICAA 3F2BA 1EOVA 2I5LX 4LF8L 3E9HA 3CW2C 4HIKA 1UEBA 3ULPA 5GADC 4GNXB 3V8JA 3I7FA 1VQEA 2CGHA 2VQEQ 1UE6A 5FLMH 4TWAA 4RQEA 2VQEL 4DV0Q 4XTVA 2I0QA 4YRSA 2DVEA 1SFOH 5M5WH 2ZT8A 4UP9A 3H15A 4P3PA 4AIMA 1YB3A 2ZJPA 3HOXH 3CQZH 4XTCS 2CWAA 1EIYB 4DV1Q 4A3IG 1CSPA 2NVYH 1MJEA 3HOVH 5BR8Q 3CC4A 2JA5H 4BA2I 2E2HH 3HOVG 1T9HA 1C0AA 1B7YA 2DEQA 1FJGQ 4R4TA 3PUWA 1KMNA 1GO3E 3FKIG 4JBJA 3REXA 1O7IA 2F4VL 1IYJB 2Z6KA 1VQJA 2B3GA 4L5RC 2OQ0A 4DR1Q 3CP0A 4DV5Q 2CJBA 4BXXG 2VS1A 1AE2A 4YREA 1JB7A 2ARSA 3HXVA 1Z7MA 4C2MH 4R4OA 3G71A 4A3BG 3J80c 5FLXc 2IY5A 3KOJA 4DV6L 2VNUD 3CD6A 2UUBQ 4DR5Q 3LGJA 2IHEA 1RIQA 2ZTGA 1I5FA 3BFMA 4BW9A 4B3TQ 1PH6A 1PYBA 3U50C 2YTYA 1NYRA 1IBKL 3DSQA 1ASYA 1VQCA 2YYZA 4TQUS 3A5YA 3M4QA 3PSIA 3RNUA 4LNSA 1YBYA 3CPFA 2B63H 4P73C 3MXNB 1FVIA 4G85A 4YRPA 4P3OA 4TVAA 1ASZA 5K36G 1G5IA 2ZZFA 3IKLA 3J7A5 3NBHB 1GGMA 2RF4A 4JI7Q 4JYAQ 4X62Q 3HXYA 3TS2A 1Z7NA 5H1SE 5JEAJ 3ULLA 3CC2A 4DUZL 2ZTDA 1I50H 3V8KA 3ERRA 3L1AA 4IOCA 5EAYA 1SRUA 4WJ4A 2ZT5A 4X5OA 2GVAA 4BA1I 2K4KA 2YTVA 3RKXA 1KD1C 3TRZA 2KENA 3CMAA 3MEFA 1XMOL 1NE3A 1I94L 2AMCA 4PG3A 2DXUA 2AKWB 2Q2UA 1CSQA 2I4LA 3A32A 1S3OA 2Q7HA 2UUCQ 2VL6A 4DPGA 2RHQB 3FP9A 1IBMQ 1JE5A 1PYSB 4NXMQ 4DR1L 2DGYA 1KC8C 3CC7A 4YHHQ 3PUYA 1XTDA 1Y1VH 4DAMA 2F52A 2J3LA 2LXKA 1D7QA 3IALA 4WI1A 4GN3B 4L5SA 4JI3L 3TQYA 1OXXK 1H95A 4NXML 3L7ZC 4XU1A 1RIPA 2HIXA 2DJZA 4OP0A 4E51A 4K0KQ 2JJQA 4MZ9A 4A3KG 4DUYQ 4IPHA 2DU7A 3QO5A 4X65L 3HOUH 4POGA 3IRBA 4LNQA 2VQFL 1X55A 4DV3Q 2K50A 1CUKA 4KI0A 4RMFA 1H4SA 3I4NH 1X56A 1QF6A 3HXUA 2JA7H 2QGQA 4YROA 1EQQA 4PMWA 1N8RC 3UGQA 1LUZA 4OO1I 4JI6L 4A3CH 4GOPB 3S17H 1PA6A 3HFZA 2D0PA 1KHIA 3FJPA 3K8AA 4GLVB 2ZM6L 3G4SA 4ZIBA 3I2ZA 4H2XA 3CCQA 1UE7A 2XGTA 3RKWA 3M9BA 4KR2A 4KR3A 4H2VA 1EIFA 1XNRQ 4DR2L 5IP9G 1SMXA 5FJ8H 1YJNA 1JJ2A 3ICEA 3RZOH 4GN4B 5GROA 1K0RA 1WPYA 3I55A 2YU9H 4XTWA 3WWVA 1ADYA 3KJPA 5LMNW 1NNHA 1VQZA 3UGTA 1XMOQ 2DU5A 1KRSA 1CKNB 2N3SA 4X64Q 2QA4A 1N33L 3QO8A 4GKKQ 4LFAL 2NVQH 1DGSA 3BJUA 4HWRA 1YNXA 3IG2A 1X3EA 4HIOA 2DKGA 4A93G 3PF5A 3I4OA 4JI4Q 1N33Q 3UDGA 2FYKA 1N34Q 1X65A 2ODRD 2PMEA 4XU2A 2CIMA 3PV0A 1EWIA 3NEMA 2R93G 1GVPA 4AQYQ 5C53B 4JBWA 2ZCEA 3GTOH 3RKYA 1YHBA 1OXSC 3HFVA 2ZINA 2E8GA 2V1CC 3NENA 2DZ9A 4GNXA 1FGUA 4L87A 5K1PA 1IL2A 1E1OA 4NXNQ 4HJ7A 4A3LG 4QIWE 3FKIH 1Q7YC 4DUZQ 2Q2IA 2UXDL 2R7FA 3KF8B 1XJVA 1NJ5A 4LF4Q 1E7ZA 4DV3L 1BKBA 4LF8Q 3A5ZA 1OXTA 3VQYA 1VCIA 5M3MH 1VQ5A 2PNHA 4XEOA 1Q82C 4IFDG 1HNXQ 1WQWA 3HOZG 3RL6A 2HIVA 4H2SA 3UH0A 4YRMA 1B76A 2ZT6A 3I56A 4A76A 3A5UA 3KDFB 4LUZA 4OX9Q 1MKHA 2YTXA 1SERA 4B3RQ 1E24A 4A3GG 1A62A 1WOCA 4LF9Q 5C4JH 4UPAA 2E5AA 2A1AA 2ZTCA 2E2JH 3RZDH 1TWFH 3HOYG 4YRQA 4A3LH 3HKSA 4XIGS 3P8VA 2ARTA 2ZJRA 1QVFA 2E64A 3ERSX 4R4CA 4IJHA 1VQ7A 1EIYA 4IPGA 1KQSA 4YRIA 3J7ZC 3IKMB 1EFWA 4DR7L 4TQFA 2XTIA 3WQZA 1K9MC 3KF6A 1FL0A 1X2HA 1HZ9A 4C3IH 1PH7A 2ALYB 3L2PA 4YRNA 1GKHA 4CH4A 1N36Q 1D8LA 2VQFQ 3EFSA 3UDXA 4YRKA 1PV4A 4Y52H 4LW1A 4H2YA 5F5WA 4JI5Q 1UWVA 1JJCA 2E5LQ 4K0KL 4PZ8A 2NN6I 1P8LA 1PH3A 2F3IA 1EVLA 5JEAG 4X62L 2QHUA 2LXJA 1NBWA 3J81i 4J15A 2ZTEA 4TVWA 2K75A 4B3ML 4X6AH 2ZR3A 4YYEA 4JI2L 1W2BA 1YFSA 4JI5L 1G291 1KOGA 3RF1A 3JC66 4YCVA 2Y0SG 4KHPL 2PI2A 2RHSB 1N36L 3S14H 4JOIA 5ELNA 2ZJQA 2AHOB 3OTOL 3VQWA 1KAWA 2A8VA 1WYDA 4A3IH 4TVYA 1VQAA 1WNLA 1KMMA 1HNWL 2AMCB 3OD1A 4K88A 1V43A 1MIUA 4DAYB 3HOWG 4CS3A 4A4IA 1EYGA 3HXZA 3RN2A 3HOUG 3STBD 1VQ4A 4IPCA 1VQFA 1ATIA 2DUDA 3DM3A 4JBMA 1WI5A 1IBLL 2ASBA 3S1NH 2F4VQ 5C4XH 1NJ8A 3ULJA 1HNZQ 3CMQA 3R07A 5C4XG 2P0LA 1IBML 3A74A 4MNOA 4A3FG 2IT1A 1YGBA 2Z6KC 4HIDA 4P72C 3A7RA 2D0OA 2JA6H 4A3BH 2K5HA 1L1OC 4HA8A 4IO9A 3M7NA 3PF4A 4UP7A 2NN6G 1YITA 4O0AA 4X66Q 2NZHA 1PH9A 5C0XJ 1NMGA 4CH6A 4X66L 1YJWA 3ER0A 4DV2L 1SR3A 2JQOA 3F2DA 5LMUL 1LTLA 4DV2Q 3D31A 2C35B 4R1JA 4YPFA 3GD7A 4GOPC 1Y1WG 3HTZA 4QL5A 4A75A 4CH3A 1NYQA 2J3MA 1GM5A 3L4GB 3PUXA 3U4ZA 5IP9H 1IXRA 4LFAQ 5IWAL 2P5IA 4AQYL 3EFRA 5FJ8G 3P8YA 2AWOA 3V7CA 2OQKA 3V7RA 2FXQA 2QHVA 1X3FA 4QQBX 4HVCA 1B70B 5IT9c 5IY0A 4XU0A 4UY8C 2Q5IA 1HNWQ 4EX5A 4YP0A 4WF2A 1PH2A 4RQFA 3CCRA 2E3CA 4O2DA 3DLLA 1M90C 1S40A 4B3SQ 1L1OA 3D0FA 3K81C 1J5WA 1JMCA 3H3VH 1Z47A 2ES2A 2PMFA 3RIRA 1IZ6A 2B63G 1K3RA 5C0XI 1L0WA 3W3SA 5LMNQ 1I6HH 1PYSA 4PZ7A 3HOYH 4DR4Q 3OTOQ 1OXUA 1FJGL 4YRTA 4AYBG 2VY3A 3GTPH 5C3EG 2MNAA 3UE0A 3OYYA 2JA8H 3HKZE 4OONA 1QVCA 4R4IA 3G6EA 2JEBI 3UE1A 1SRYA 3RACA 2Q2TA 4LFBQ 3PGZA 4P75A 1M1KC 3GTMH 5JJIA 3LSQA 2EJFA 1TWCH 2BA0A 2WB1E 4IFDI 3A7AA 1EUJA 4LF6Q 2AKWA 3S2HH 5GAGC 1HR0W 4X65Q 4EQ5A 1N32Q 2KHIA 1JJCB 3GTKH 4ZTZB 2PQAA 5M3MG 4JBKA 4A3MG 4TQDA 1YZ6A 3K7AH 4DR7Q 3REUA 2RHSA 2I4MA 4OWXB 1SN8A 2K5VA 4DUYL 4NCXA 4JG2A 1KIXA 3GO5A 4UP8A 4QY7A 3F8TA 1IBKQ 4GOPA 4IJLA 4JI8L 3VQXA 4A3MH 3HY0A 3S1RH 2R92G 2K52A 1B8AA 1Q8KA 3KYHC 3SGIA 4JI0L 4DNIA 1WJJA 2EQSA 1USYC 1A63A 4Y7NH 3JAMc 2EL9A 4H2UA 1LYLA 5HGQA 2E10A 4XTYA 3CCJA 3T1HL 1VQDA 5C0XG 4ALPA 4LWCA 1EQRA 4X64L 4A3KH 1X01A 2E41A 3U58A 5IYDH 3EIVA 2YV5A 1CKNA 4GLXA 4BWAA 1WCMH 3HOWH 4FDBA 1YI2A 2ZR2A 4H2TA 1Z9FA 5IYCH 3G48A 4BBSG 4B3MQ 3RLNA 4A3JH 4EO4A 1YJ9A 2CWPA 2UXBL 4Q15A 4DKAC 4AYBE 3AFPA 4NXNL 2GVBA 2CKZB 2D62A 1Y1VG 1SROA 1OTCA 12ASA 3PCOA 2L15A 1N32L 4YRCA 1X54A 3UDFA 3HOZH 4P3NA 4P75C 2UUBL 4DV5L 2UU9L 3U4VA 4HJ8A 1Q46A 1NJIC 2JA5G 1VQGA 3TUPA 5IE8A 4B3SL 1XPRA 5IYCG 2I5HA 4B3RL 4LFCL 2ZZEA 2PMZE 1X2GA 5GAHC 2Q7EA 5K1XA 1WCMG 3RUXA 5IP7G 3HY1A 2E1HA 3W5OA 4H2WA 1GD7A 4YCUA 1P16A 2JA7G 4QJFA 3CCLA 2JE6I 2WAQE 2OCEA 4HIMA 3V8LA 4DR2Q 4RG1A 3EBEA 1VQOA 3PIPA 3BU2A 1QUQB 2OTLA 4XTZA 1VS0A 2AWNA 1CKMA 1X6OA 3FHWA 1ADJA 1U0LA 2K14A 2BH8A 4BBRG 1G6PA 1N9WA 2R7ZH 3PO2H 1QVGA 2R6GA 1VQNA 4DV1L 1HZAA 2NZOA 1VQBA 1VQLA 2UXBQ 1W66A 4K86A 4P71A 3BZKA 1H4QA 4LF7Q 4YRJA 2HNIA 2CCZA 2MQHA 2N78A 4YY3Q 2ALYA 1OXVA 1YVCA 3E0EA 4JI3Q 1HZCA 2Y0SE 2I4OA 1V1QA 2R92H 2R7DA 3GDEA 4HWPA 4IPDA 3TEHB 3W1BA 1HNZL 3RLFA 3CCUA 1H4VB 1L2FA 5GQOA 11ASA 4ME3A 4DV4Q 2JK8A 3RGLA 5AJ3L 3VQVA 3PO2G 1QZGA 2WAQG 4G84A 5IYBG 3AQQA 3STBC 2UXCQ 3PO3G 2EJ9A 2WP8J 4JOIC 3JAMi 3RR5A 4OXPA 4TTVA 3T1YQ 1YHQA 2R93H 4CH5A 1R9TH 1SESA 1A8VA 5C51B 2VUMH 4PHCA 1HZBA 4MTNA 4JI0Q 2IX0A 2N8NA 2CQOA 3K80C 3LSSA 1J5EL 2BA1A 3RLOA 1G51A 3TS0A 1XPOA 5IWAQ 4KLKA 3PUZA 2ID0A 4A3FH 4POFA 2R7ZG 2UXDQ 2VW9A 1KXLA 2E65A 5GAEC 1BIBA 3V7SA 4A3DH 2IHFA 2DQ0A 2VUMG 3M3YH 3A31A 2ZZGA 2OWOA 2WFWA 3TREA 1XPUA 3I4MH 1PFSA 3PCOB 4A3EG 1V9PA 1NJ2A 3CCEA 4HJ9A 2NVXH 3F1ZA 2RCNA 3OW2A 1WFQA 3KLWA 1QZHA 5E3IA 1X3GA 3NETA 5C52B 3QTCA 1VQIA 2E2IH 5IP7H 3LC0A 4IFDJ 1N34L 2GN5A 3M4OH 4P73A 5M5YH 1G5HA 1EVKA 1NMFA 1LM0A 3J81c 4JI1L 1Q1EA 2WB1G 1H4TA 4H2XB 2EWNA 2IY5B 1XMQL 1SE8A 1VQMA 4CS2A 3CMEA 2ATWA 5KNNA 1XNQQ 3BZCA 4JC0A 1XNQL 4BBSH 3KFUA 1C9OA 3L2ZA 5DLQE 4BY1G 2ARUA 4DR4L 4P72A 4YHHL 4LF9L 3QO7A 4NB3A 1VQ8A 5ELOA 1VQ6A 4OLFA 2UUAQ 3K0XA 3PZCA 4YY3L 2H5XA 4A3DG 3KF6B 4JI1Q 3GTJH 3J81j 1HNXL 2B29A 1SETA 2Q7GA 3H0GH 4HWOA 3EN2A 2DTOA 1YHAA 1HXDA 4L5TA 1YFRA 5M3FH 1HTTA 4DV7Q 3AYHB 1E22A 1RL2A 5M3FG 2KHJA 3TEGA 2EAYA 3MEYA 1WQ7A 4JI2Q 2ZM6Q 4A93H
chains in the Genus database with same CATH superfamily
4L63B 2ZNIA 3OIQA 1MHWC 3NP8A 4Z9CB 1HR0L 2OT2A 4EQOA 3PO3H 2EYMA 4XU3A 1BO0A 3UFGA 2K5NA 1HR0Q 2QHTA 1AW7A 4JI6Q 4C3HG 1Q86C 4ZTUB 3K5LA 4DR6Q 1GUTA 1BBWA 3CCSA 2C8MA 3DHQA 4K6LA 3HKZG 4YRLA 2EYHA 5IYBH 4LF7L 1VQHA 4XTUA 4K87A 1TU2B 4Q5VA 2DZCA 1WLEA 5C5MA 5LHY1 3ONAB 1S72A 1IBLQ 1ONLA 1G91A 4GN5A 5ELFA 2F0MA 4NPSA 3T53B 5M9OA 1BVSA 1A0IA 2FINB 1SYDA 4DV6Q 3SVMA 3MF2A 2NUCA 3UDIA 1WTOA 1WTHA 1G2TA 2PO4A 4FXKC 5JJZA 4CJ0B 3PIOA 4HWTA 2ICEC 4LUOA 3OMCA 3OHXC 4LFBL 1CA6A 4HAEA 5HY6A 1HC7A 4DQ2A 3IFTA 1GUSA 4E6IA 4B3TL 1IYVA 5JJLA 2JEAI 1VQKA 3NQIA 3OOCA 3M4PA 5NUCA 3R8BA 2K6AA 3C2PA 3HEJA 3S14B 3KJOA 5EBCA 2VZAA 4GKKL 4XEMA 4DK6C 2IX1A 1SYGA 4DR5L 1MJCA 2KJXA 4KD3A 5M5XH 1MI2A 1YNNC 1NJ1A 4RGTA 4AH6A 2EJGA 1TY0A 1PH4A 1A15A 4A3CG 1VQ9A 4G7ZC 2NVTH 3AEVA 2JA9A 5C3EH 2DXTA 3J7YW 2PI2E 4K6DA 2HD3A 3L0OA 2KBNA 3HXWA 1GUGA 5FLMG 3CF5A 4KHZA 1TXYA 4JV5L 4KJNA 4G7HC 3T1YL 1J8IA 4DK3C 1ICFB 1ZXTA 2KCMA 2HHHL 1B1ZA 4JI8Q 5E7NA 4LF4L 2JA6G 3HRKA 3P8TA 2B39A 2DQ3A 1WVLA 2I4NA 3HXXA 4QGUA 1SNPA 1TIID 3MF1A 2EDGA 2MO0A 1NCVA 3J80i 5LMUQ 2DTHA 1IL8A 5BR8L 4LJZC 5KYLA 3G1ZA 2F03A 2PQAB 3QOLA 3PIO3 5EJWA 1KLUD 4LUVA 1RTOA 2LSSA 5CV5A 2I5MX 2K05A 3R2TA 3H0GG 3HFZB 1JQYD 4JCVE 4GKJL 2G4CA 3HOWB 4FO2A 2FHTA 2CJ9A 4OX9L 3GTGH 1I94Q 1E1TA 3S1QH 3H3VI 1YIJA 4DR3Q 2A19A 2HQLA 4C56C 4KN4C 3GTKB 3I72A 1QCBD 4TRDA 1DD2A 1E3PA 5I4DA 4YRFA 2ODRC 3QO2A 1VQPA 4L6TB 4ZCKA 5JPMC 4DR6L 3HRZC 1K8AC 1XYIA 1TWHH 1WCMB 4MN3A 2CQAA 2DY7A 4ZKCB 3VR3A 5DEHA 4MTKA 1PH8A 3HP3A 1VDZA 3GTLH 3J7AF 3L9AX 1PVOA 2XRQD 3CCMA 5FO7B 2EXDA 3GTQH 1F2YA 3CCVA 2CW0C 2O4XA 1RTNA 3CPWA 4YWLA 1W6KA 3A0JA 3A7UA 1NTGA 2F0TA 3DUZA 2Q2HA 2ZT7A 1J6QA 3RN5A 1QUQA 3CRKC 3N6RA 1J5EQ 1BCPF 1PMRA 4RAUC 2L5TA 4CS4A 4GNXC 1DM0B 3MXUA 3E9IA 4F87A 2F0NA 2E5LL 4P71C 1AE3A 2AQ2B 5E3FA 2CJAA 4P74C 2XN9C 4ZK9B 3S24A 3MHBA 1C4QA 3HZXA 1K83H 3GP7A 5J3BA 5CBAE 5C44G 2Q8IB 1DOLA 1BCPD 4C1NI 2B8GA 3TDQA 3S1MH 1NJ6A 1SE3A 4C3JB 3K7UC 4UAIA 3C1FA 4HT4A 5CV4A 5BN3A 3S15H 3K57A 2OF1A 3CHBD 4JI4L 2KCTA 3OIPA 2UUCL 4UHVA 2A69C 1QE0A 2X6GA 2M2LA 3VDYA 4Q6GA 1B7YB 1SNOA 3I4NG 4L8JA 1TWGH 4LFCQ 5LMNL 3MQZA 1BBUA 3QNEA 2UXCL 4HJAA 4A3JG 1KABA 2MO1A 1XNRL 3ZJYC 1RDPD 2UUAL 3A5ZB 1ILPA 2EIFA 4HR7B 1I3QH 4RFBA 4JV5Q 1Y8PB 1O78A 3NELA 4LVMA 1DCZA 1X32A 1TWAH 1CKOA 3B6YA 3KDFA 3HRIA 4DV4L 3T51B 5FK9C 2A6HD 3CAMA 4HJ5A 1JR0D 1STHA 4C3HH 4APVA 5EBDA 4LVJA 2RKSA 2KUMA 2HT1A 3R93A 1CA5A 1Y14B 4DV0L 1PH1A 3WOEA 3S2DB 4L5QA 5IYDG 3NXWA 3FEWX 4F7XA 4JYAL 2QDLA 3HOYB 2N49A 1Q1BA 2LKVA 1KRTA 3VR6A 1SDFA 1X9NA 4IOAA 4J8QA 4BY7H 1FYFA 1C7YA 1HH2P 1YEZA 1EOTA 4WJ3M 1SNMA 4DF7A 2F0VA 1CZGA 4KTAA 3H09A 1JJGA 2R3ZA 1K8GA 4DR3L 4A3GB 1NY4A 2Q5HA 3PUVA 2MGSA 3S2DH 2RDFA 5IGEA 3J81E 4BY1H 1UE1A 1WU7A 4KHPQ 1BIAA 2L55A 1K8MA 2K01A 4P74A 1PHJA 1SFOB 4TVAB 2ZT9C 3NWSA 4YWMA 2QEXA 1U5KA 4BXXH 2WACA 4RH6A 3NBHA 4GKJQ 4LF6L 3BDOA 1QE6A 3CXCA 3A8IE 4A3GH 2ZGWA 1D1IA 1NR4A 4YWKA 3W1GA 1GJXA 1AH9A 2DTIA 2ZIOA 5C44H 3I90A 1B70A 2DDZA 1YFTA 4JI7L 4OO1G 1RKNA 2BH2A 4YDQA 3S16H 1Q81C 2X6LA 5HURA 1UE5A 4I7ZC 1B50A 4OWWB 4H02A 1PH5A 4QIWB 4OIKA 4FVMA 3RUZA 1HJPA 4DV7L 4KQEA 1SYFA 4LF5L 4OWTB 2CFMA 3L4GA 3E3XA 1JT8A 4IUUA 1EU4A 2JSOA 2OTJA 1ZEQX 2FJ2A 3T1HQ 3AU7A 1JWSD 2EE1A 2Z0SA 1ZYRC 2SEBD 2ZIMA 4C1NK 4XTXA 4CBVA 1L1OB 1K73C 1ENFA 3J7AV 4YCWA 5I2XA 4YRRA 3VR5A 5ELDA 1F9PA 2HHHQ 1WD0A 2KCNA 4C3JH 1HPCA 1Y1WH 4PV1C 1QG7A 3HOXG 4A3MB 4BY7G 2ZXFA 2MFIA 4PZ6A 4A3EH 4R4QA 1F2ZA 3BVGA 3SHLA 1SLJA 4LF5Q 1KNAA 1PRTB 3DM1A 3SK8A 3AMUA 3DWPA 4IUVA 1C48A 2WV6D 1Q12A 3AFQA 4GS3A 5CV8A 3M85A 1K3BC 1XMQQ 1UAPA 3MZ5A 3TEHA 1CK1A 4GLAC 3VBBA 2B2TA 2RHQA 1YNJC 4IN3A 2JA8G 2MP1A 3P7JA 4DK0A 2B2VC 3Q8DA 1KL9A 3RMHA 3F2CA 5JJKA 5AJ3Q 1O7YA 4BBRH 3HGBA 3SK4A 1W3SA 4A93B 2EJFC 2UU9Q 1USYA 2EY5A 2JA8B 4RDXA 2MHVA 3I4MG 4AYBB 4HWSA 1RHPA 2QHSA 3S17B 4YRGA 2HUGA 3K59A 2C7IA 2ZNJA 3ICAA 4KKTA 1IYUA 3F2BA 1EOVA 2R93B 2I5LX 2F0WA 1CQFA 1LTSD 4LF8L 3E9HA 3CW2C 4HIKA 2VB3X 1UEBA 3ULPA 2F0UA 4XQJA 2B63B 4NW2A 1S5DD 5GADC 4GNXB 3V8JA 3I7FA 1VQEA 5EPLA 3HOXB 2CGHA 2VQEQ 2HCIA 1UE6A 5FLMH 4TWAA 4RQEA 2VQEL 1T5EA 4BS9A 4DV0Q 3SXHA 1SXTA 4XTVA 1FYCA 2I0QA 4YRSA 3MEHA 2DVEA 3F2UA 3NTKA 4DXFA 1SFOH 3V2TA 5M5WH 2MPMA 1STGA 3GTGB 3RZOB 3BYTB 1H9SB 2ZT8A 4UP9A 3H15A 4P3PA 3I91A 3IL8A 2TMPA 4AIMA 1YB3A 3Q24A 4H7BA 3U9OA 2ZJPA 3HOXH 4F8MA 3CQZH 1QB5D 2CWAA 4XTCS 4DV1Q 1EIYB 4A3IG 1CSPA 2NVYH 4DAYA 1MJEA 3K6OA 3M4YA 3HOVH 1FNVA 5BR8Q 3CC4A 2JA5H 4BA2I 2E2HH 3HOVG 3P1HA 1T9HA 5M5XB 1C0AA 2F0DA 1TQOA 1SE2A 1B7YA 1TS4A 3S16B 3PIP3 2DEQA 2R61A 2WIIB 4RWSC 1PRTF 1FJGQ 4R4TA 3PUWA 1KMNA 1GO3E 3FKIG 4JBJA 1PYWD 3REXA 5CGKA 2B2WA 4K2KA 1KAAA 1O7IA 4HTHA 2F4VL 3H3VC 3MAQA 1BQQT 4H0LC 5A2QE 3I4LA 3TZDA 1IYJB 2Z6KA 1VQJA 4K14A 2B3GA 2Z4IA 1PFNA 1RF2D 2Z8LA 4L5RC 1QWYA 2E2DC 4Y7NB 2OQ0A 3NSWA 4DR1Q 3CP0A 2PW5A 1Y1WB 4DV5Q 3BDLA 2CJBA 4BXXG 2VS1A 1V1OA 4CDDC 1AE2A 5ELBA 5FO9B 4HEDA 2Z4HA 4YREA 1JB7A 2IL8A 1EFID 2HCCA 3MTSA 2LY7A 4RA8A 2ARSA 3KBGA 2SDFA 3QOJA 3HXVA 4A3KB 4IUPA 1S5ED 1Z7MA 4C2MH 4R4OA 3G71A 4A3BG 3J80c 5FLXc 2IY5A 2WKCA 3KOJA 3S1MB 4LVIA 5IT9E 3EVQA 3GTOB 3D4WA 1SNQA 3LNNA 4DV6L 2VNUD 3CD6A 2UUBQ 4DR5Q 3LGJA 1DOKA 2IHEA 5KRUA 1RIQA 1VMCA 4U673 2ZTGA 1I5FA 3D3RA 3TP5A 3BFMA 4K8IA 1MSGA 4BW9A 4B3TQ 4DNRB 2PNRC 1PXUA 1WTVA 1PH6A 1CHPD 2A8EA 2NBFA 4QCLA 2QF7A 5L37A 3FVQA 5FOBB 1PYBA 3U50C 1LT4D 2YTYA 1NYRA 1IBKL 2L11A 1ASYA 3DSQA 1ILQA 1VQCA 2YYZA 1EEID 4IZ8A 4TQUS 1ENCA 1YNND 4A3JB 3M4QA 3A5YA 3ERQA 3J80E 1XTCD 3SEBA 2ZXOA 3PSIA 3RNUA 4LNSA 2K03A 1YBYA 3CPFA 2B63H 4P73C 2NVXB 5C4XB 3MXNB 3OW7A 5C6AA 1FVIA 3EJIA 3I4NB 4G85A 4YRPA 1F2LA 2F0FA 1GOZA 1SYBA 3G6JB 4LK1C 4P3OA 4TVAA 1HFNA 1ASZA 5K36G 3D4DA 5T1GA 1G5IA 2ZZFA 3IKLA 3J7A5 3NBHB 1GGMA 2RF4A 4JI7Q 1MSHA 3SR1A 4JYAQ 2P5ZX 4C3JG 4X62Q 3HXYA 1BCPC 5IGFA 3TS2A 1Z7NA 5H1SE 1JC7A 5JEAJ 3ULLA 3CC2A 4DUZL 3VYTA 3E6ZX 1TWCB 3DXJC 4ZYSA 5EPKA 2B2WC 2ZTDA 1I50H 3CQZB 2B2UA 5EQ0A 3V8KA 3ERRA 2PCFB 4ZAIA 3L1AA 2FFKB 4IOCA 1A3VA 4PMBA 2PMZB 2EZVA 1TT2A 5EAYA 1SRUA 2RBMA 4WJ4A 1JE4A 5C4JB 3C46A 2ZT5A 4X5OA 2GVAA 2HQEA 3CRLC 4BA1I 2K4KA 2YTVA 2EYJA 1DONA 3RKXA 1KD1C 3TRZA 3QR8A 2KENA 3CMAA 5JEAH 3MEFA 2G9HD 2SNMA 2Y0SB 4FNFA 2EY2A 1EU3A 1XMOL 1IW7D 1NE3A 1I94L 2JXMB 2AMCA 4PG3A 1Y69U 2DXUA 2AKWB 2DN8A 1F9RA 2Q2UA 1CSQA 2I4LA 3A32A 1S3OA 4OL7A 1J9OA 3T4AC 2Q7HA 4XYOA 2UUCQ 1WD1A 1QNUA 2VL6A 1QJOA 4DPGA 3D6CA 2RHQB 3FP9A 2A68D 1IBMQ 1JE5A 1PYSB 2L0CA 4NXMQ 4DR1L 3FRPB 1EQTA 2DGYA 1KC8C 1T5XD 3CC7A 4K5XA 3JAML 4YHHQ 1DOMA 3PUYA 3VYSA 1DZ1A 2XWJB 3S1NB 1I4HA 3S1RB 2EJMA 1XTDA 1H9KA 3H94A 4ME5A 1Y1VH 2A5HA 4DAMA 2F52A 2J3LA 2LXKA 3MC0B 1D7QA 3Q0AA 1PFMA 3IALA 4EGVA 1BCPB 4ILWA 1HUNA 4WI1A 1QOHA 4GN3B 4L5SA 4JI3L 1EIHA 1VMPA 3QJYA 3TQYA 2RDGA 1OXXK 1SNCA 3TMEA 4NXML 1H95A 3L7ZC 4XU1A 1RIPA 2EJGC 2MJ8A 2HIXA 1SNDA 1JORA 2CH4W 2DJZA 4OP0A 4E51A 4K0KQ 2JJQA 1HA6A 4MZ9A 4A3KG 4DUYQ 1IW7C 5COYA 5CMDA 4IPHA 1MD2D 2DU7A 1HFGA 5DNFA 3QO5A 4X65L 3ITPA 3HOUH 1D5MC 4POGA 3IRBA 4LNQA 1ICWA 2N55A 2VQFL 1LTBD 1X55A 4DV3Q 2B2TC 2PPBC 2K50A 1M8AA 1B2TA 4V0BA 1CUKA 4KI0A 4RMFA 1H4SA 3I4NH 1X56A 1QF6A 3HXUA 3M3YB 5IIFA 1H9SA 2JN4A 2JA7H 1JCKB 2QGQA 4ULLA 4YROA 1EQQA 2DJFC 4PMWA 1N8RC 3MFYA 3UGQA 1EYDA 1LUZA 1STEA 2FMMA 2L9HA 4MIUA 2BDOA 4OO1I 1AFPA 4JI6L 3SK5A 4A3CH 2CW0D 5C0XH 4GOPB 3S17H 1Q90A 1PA6A 2C5CA 3HFZA 2D0PA 2Z9HA 1KHIA 1V8QA 3K8AA 3FJPA 4GLVB 2F3VA 2ZM6L 3G4SA 4ZIBA 2EYFA 3LX0A 1TWGB 3I2ZA 4H2XA 3CCQA 5T1IA 2E2IB 1UE7A 2XGTA 1D1KA 4CGYB 4IFDH 3RKWA 1PZID 3M9BA 4KR2A 2D5DA 4IUTA 4KR3A 3FDTA 4H2VA 5D3DA 1EIFA 2XRSD 3K58A 1XNRQ 3QWNA 4DR2L 4JPBW 5IP9G 4FF1A 1SMXA 4HSVA 5FJ8H 1YJNA 1JJ2A 3VA7A 3ICEA 3RZOH 4YIJA 4GN4B 5GROA 1B9NA 1K0RA 4DNTB 1WPYA 3I55A 2YU9H 4XTWA 3WWVA 1DJRD 1F77A 5K36H 1ADYA 3IKJA 5I2YA 3KJPA 5LMNW 1EY6A 3OWEB 1NNHA 1VQZA 1ET6A 3UGTA 3HOZB 1XMOQ 1ZKOA 5IGDA 2DU5A 1KRSA 4K2LA 2EY6A 3HOVB 1CKNB 2N3SA 4X64Q 4RHRA 3X3NA 2QA4A 4WFN3 1N33L 3QO8A 3MFGA 4GKKQ 4LFAL 4IUQA 2F0EA 2NVQH 1PTOH 2PZTA 1DGSA 4PQXA 5LL6S 5JOBA 2E2JB 3BJUA 4HWRA 1YNXA 3IG2A 3KK7A 1X3EA 2NN6H 3CKIB 5JAVA 4HIOA 2DKGA 1CHQD 4QF4A 4A93G 3PF5A 4FP5D 3I4OA 4JI4Q 5C4HA 4Q0FA 1LT6D 1N33Q 3UDGA 5IGGA 2FYKA 1OO9B 1X65A 5G3LF 1N34Q 2ODRD 1GXDC 2PMEA 4XU2A 4WORA 3PV0A 2CIMA 1EWIA 1LABA 3NEMA 2ZXPA 1FGBD 2R93G 1LT3D 1GVPA 4AQYQ 5C53B 4JBWA 2ZCEA 3GTOH 2A6EC 1D6EC 2AUKA 1HQMC 4J6HA 3RKYA 3GQBA 1NR2A 1E2WA 1YHBA 3I4MB 1OXSC 1U4MA 4DK1A 3HFVA 4BY7B 2ZINA 3URYA 2E8GA 2V1CC 3NENA 2DZ9A 1LACA 4GNXA 1FGUA 1S5CD 4L87A 5K1PA 1WTXA 1IL2A 1F9QA 1E2ZA 1PZJD 5EGTA 1D5XC 4M8AA 1E1OA 4NXNQ 4HJ7A 2EYPA 4A3LG 4QIWE 3FKIH 1Q7YC 4DUZQ 1X3QA 2Q2IA 3KBXA 2UXDL 2R7FA 3KF8B 1XJVA 1NJ5A 4LF4Q 1E7ZA 4DV3L 1BKBA 4RGNA 4ZLTF 1JICA 4G4KA 2IJ0A 4CJ1B 1OXTA 4LF8Q 3A5ZA 1M4VA 1VCIA 5M3MH 3VQYA 1VQ5A 1TS3A 2PNHA 3FPUB 4XEOA 3TBIB 5G3LD 1Q82C 4IFDG 1PZKD 1HNXQ 2K7VA 1WQWA 3HOZG 3FPPA 1JB3A 4OO1H 3RL6A 2NVYB 2HIVA 4H2SA 3UH0A 4YRMA 1ZYRD 1B76A 2ZT6A 3I56A 4A76A 3GV3A 1LTID 3A5UA 2WINB 3TP6A 3KDFB 3NTIA 4LUZA 1SYCA 4OX9Q 1MKHA 1B3QA 2YTXA 1SERA 1E24A 4QMGA 4A3GG 4B3RQ 1JWUD 1A62A 1WOCA 4LF9Q 5C4JH 4UPAA 4QUFA 3DWAA 2E5AA 1ML0D 3ND8A 2A1AA 3L3OC 3EA6A 2ZTCA 4WRDA 1MGSA 2E2JH 4G7OC 3MXPA 1CZWA 3RZDH 4NP5A 1TWFH 2IW3A 3RD4A 2NVQB 3VR2A 3HOYG 5EKIA 4YRQA 3DMUA 4FXGC 2XIWA 4A3LH 4KY5A 3HKSA 4XIGS 3D4RA 3P8VA 1K28A 4I7AA 2ARTA 3S1QB 2ICIA 2ZJRA 1QVFA 2E64A 1O7ZA 3ERSX 4R4CA 4IJHA 1VQ7A 1EIYA 4IPGA 2J0TD 3HS0C 2F0JA 1KQSA 1LV9A 1XWEA 2ZXRA 4YRIA 2E76C 3J7ZC 3NTHA 2HDMA 5I6YA 3IKMB 2CVRA 1EFWA 4DR7L 4TQFA 3NK9A 4TKOB 2XTIA 4N8FA 2J7ZA 4NKLA 4N9PA 5EKKA 1K9MC 3WQZA 3KF6A 2M00A 1FL0A 1X2HA 1HZ9A 4IALA 1LTGD 4LMQD 3BDCA 1XXGA 1ESFA 4O42A 4C3IH 1PH7A 4EQNA 2ALYB 3L2PA 4YRNA 2DY8A 1GKHA 4CH4A 1N36Q 1EL0A 1D8LA 2VQFQ 3A55A 4HCEA 2BE5C 3H6MA 2F0LA 3EFSA 3UDXA 4YRKA 1EYAA 1PV4A 4Y52H 4LW1A 2DJGC 4H2YA 5F5WA 4JI5Q 1HQRD 3EROA 1UWVA 1JJCA 2E5LQ 4K0KL 4PZ8A 1CI3M 1SBBB 2NN6I 1P8LA 1PH3A 4GZYC 4CDFC 2F3IA 3BZDB 1G8ZD 3VA5A 5C3XA 1G6ZA 1EVLA 4CKBA 1EY4A 5JEAG 4X62L 4R9WA 2QHUA 1W6JA 1AZPA 5FO8B 2LXJA 1NBWA 2VXWA 3M7GA 3J81i 4J15A 3D6WA 4OIJA 2K04A 1R4PB 2KQ3A 2ZTEA 4TVWA 2K75A 3A7AB 3K5NA 4S3SA 4B3ML 4X6AH 2ZR3A 4YYEA 4JI2L 1BOSA 3CU7A 2F0KA 4ZKBB 1W2BA 1YFSA 4JI5L 1HHVA 1G291 3BG3A 2I46A 5LL6X 1I4RA 1KOGA 3RF1A 1K0SA 2K33A 5CV9A 2N88A 3JC66 4YCVA 1CQVA 2Y0SG 4KHPL 1BR9A 1FD7D 2PI2A 2RHSB 5E4WC 1N36L 3S14H 4JOIA 1EYCA 4FF3A 2PZUA 1I4QA 5ELNA 2ZJQA 2AHOB 3I8ZA 1STNA 3OTOL 1R9TB 1CT1D 4N9TA 3VQWA 1KAWA 2A8VA 1WYDA 4KY7A 4A3IH 1SAPA 1EEFD 4TVYA 1BUVT 1CTMA 1RD9D 1VQAA 3A8KE 1WNLA 3VYRA 1KMMA 1HNWL 2AMCB 2PQEA 2K5QA 3OD1A 4K88A 4KK7A 1V43A 3ND9A 1MIUA 4J1MA 2B2YC 2BOSA 3IAYA 4DAYB 2VB2X 3HOWG 4CS3A 4A4IA 2QEJC 5IGCA 5EKLA 1EYGA 3HXZA 3RN2A 2F0GA 5KIXA 3NWTA 3HOUG 4BBRB 3STBD 2O5JC 1VQ4A 4IPCA 1VQFA 1ATIA 2DUDA 3DM3A 1LTRD 4JBMA 5IOCA 1WI5A 1IBLL 1U9RA 2ASBA 3S1NH 2F4VQ 5C4XH 1NJ8A 2HDLA 2MUYA 3ULJA 1HNZQ 3CMQA 3EFXD 1SJED 3D8GA 5C4XG 3R07A 2P0LA 4N8X1 1IBML 3MA2B 3NPPA 3A74A 4MNOA 4A3FG 2IT1A 1YGBA 2Z6KC 4B9XA 1EQVA 4HIDA 4P72C 1I4PA 3A7RA 1PDQA 1EIGA 1V1PB 3A7LA 2D0OA 2JA6H 4A3BH 1A2UA 1NNXA 3PQIA 4XXEA 2K5HA 2JP1A 3H0GB 1FR3A 1U4LA 1L1OC 2NZ1D 4HA8A 5A35A 1EY7A 4IO9A 2K5WA 3SK6A 3PF4A 3M7NA 4UP7A 2NN6G 5CYUA 1Q8IA 3NUCA 5IODA 1WTPA 1EWCA 1YITA 4O0AA 4XT3B 4X66Q 2NZHA 1PH9A 5C0XJ 1NMGA 2JA6B 1CFMA 4A3BB 4CH6A 4RCOA 4X66L 1YJWA 3ER0A 4DV2L 3GTMB 5BN5A 1SR3A 2JQOA 3F2DA 3TN2A 5LMUL 2LFNA 4LVKA 1LTLA 4DV2Q 3D31A 2JA5B 2C35B 4R1JA 4KMUC 4YPFA 2KVMA 3GD7A 3W2DA 4GOPC 1Y1WG 2EYOA 1EY9A 3HTZA 3NQTA 4X3UA 4QL5A 4A75A 4CH3A 3UI2A 5DM73 1NYQA 2J3MA 2IWHA 1GM5A 3L4GB 3W3AA 2PZWA 3PUXA 3U4ZA 5IP9H 1IXRA 4NDXA 3FKIB 1V1PA 4LFAQ 4HSPA 1D2BA 5IWAL 2P5IA 3SE0A 4AQYL 2SOBA 2F0PA 3EFRA 5FJ8G 3P8YA 1Y8OB 1Y1VB 2AWOA 3V7CA 2A74C 2OQKA 3V7RA 3DEPA 2FXQA 2QHVA 1X3FA 4IQZA 2BDNA 4QQBX 4HVCA 1B70B 2PW7A 1AEXA 2B2UC 5IT9c 5I6WA 5IY0A 4A3IB 4XU0A 4UY8C 1EY0A 2Q5IA 1HNWQ 2L1BA 2RSOA 4CJ2C 4H44C 4EX5A 4YP0A 4WF2A 4NMZA 1PH2A 4RQFA 3CCRA 2E3CA 4O2DA 1GHJA 2XVSA 4C2MB 2KOLA 3DLLA 1K8OA 1M90C 1JOOA 1S40A 1AZQA 5FLXL 1TKWB 5ELEA 1PRTD 4KHVA 1QNKA 4B3SQ 1BF4A 4DXGA 1L1OA 3D0FA 3K81C 1J5WA 1JOKA 1JMCA 3H3VH 1Z47A 5CV7A 2CHBD 2DNEA 2L4NA 1LTAD 4QUCA 2ES2A 2PMFA 4C3HB 3RIRA 1IZ6A 2B63G 4IURA 1K3RA 5C0XI 5K5PA 1L0WA 3W3SA 1EWHA 5LMNQ 3E0JA 1I6HH 4PZ7A 1PYSA 3HOYH 4DR4Q 1KLGD 5JVG3 3OTOQ 1OXUA 2A6HC 1FJGL 2B8FA 4YRTA 4AYBG 2VY3A 3GTPH 5C3EG 2MNAA 3UE0A 3OYYA 2JA8H 3I73A 3HKZE 2KA7A 4OONA 5C4ZA 1QVCA 4HMJA 3BYYB 2OXPA 4R4IA 5J39A 3G6EA 1RCVD 4BY1B 2JEBI 3A54A 1A6XA 3BVZA 3T56B 3UE1A 1SRYA 1QILA 3RACA 2Q2TA 1SMYC 4LFBQ 2IX3A 3PGZA 4P75A 1M1KC 3GTMH 5JJIA 3LSQA 1SEBD 3A56A 2EJFA 4DAPA 1CM9A 4A3DB 1TWCH 2Q8TA 2BA0A 1H9MA 1DXMA 5KYIA 4KY6A 3K5OA 2WB1E 4IFDI 3A7AA 1EUJA 4LF6Q 2AKWA 3S2HH 2H1EA 5GAGC 1HR0W 4X65Q 4EQ5A 1N32Q 4M1UB 2KHIA 1JJCB 3GTKH 4ZTZB 2E74C 2PQAA 5M3MG 4JBKA 3QIAA 4A3MG 4TQDA 1FNUA 1YZ6A 5F2DA 4V190 3K7AH 4KKSA 4XT1B 4DR7Q 4RGOS 3REUA 2RHSA 3O13A 4JW0A 1NSNS 2I4MA 4OWXB 2NVTB 1SN8A 4R8IA 3DEOA 3S2HB 2K5VA 5DM63 4DUYL 3GTLB 2F3WA 4NCXA 4JG2A 1KIXA 3GO5A 4UP8A 4QY7A 3F8TA 2PYKA 1IBKQ 4GOPA 3VYUA 4IJLA 4JI8L 1KDBA 4HN7A 3VQXA 1H9RA 4DFAA 4A3MH 4OEMB 1SYEA 2B2VA 4A3EB 2WB1B 1EZ6A 3HY0A 3S1RH 5CBEE 2R92G 2K52A 5ISRA 1B8AA 1Q8KA 3KYHC 4DU9A 2EPBA 3SGIA 4JI0L 1PLFA 2VUMB 4DNIA 1WJJA 2M9VA 4K8JA 2RVLA 2EQSA 4B9WA 1USYC 1X3PA 1A63A 4Y7NH 2LMCB 4ZQ3A 3JAMc 2EL9A 4H2UA 4LAAA 4KN7C 1LYLA 5HGQA 3TSSA 3HG9A 3BVMA 2A73B 2E10A 4XTYA 1C8CA 1FNWA 3OSOA 3CCJA 3T1HL 1VQDA 4O1NA 1E0BA 3Q22A 4CKEA 5C0XG 4KV6A 4ALPA 3X3MA 4LWCA 1I6VC 1EQRA 4X64L 4A3KH 1X01A 1EY5A 2E41A 4DA2A 3U58A 5IYDH 3EIVA 1TWAB 5D65A 1SSOA 2YV5A 1SMYD 1CKNA 4DAVA 4GLXA 1LLRD 1VF7A 1GUOA 4BWAA 1TWHB 1WCMH 4ZRZA 3HOWH 3JAME 2F0QA 5E4XA 3E5SA 1KDAA 5TSSA 1IKLA 4FDBA 3V05A 1YI2A 2R7ZB 5FLXE 4EVOA 4C3IB 2ZR2A 4H2TA 2ENBA 1U4RA 1Z9FA 2A68C 2G5DA 4F88A 5IYCH 3KLSX 3G48A 2WAQB 3SDZA 3PO2B 4BBSG 2RQXA 1LT5D 3TP8A 4B3MQ 3RLNA 4A3JH 2QILA 2K32A 4EO4A 5C5LA 5AFWA 1YJ9A 2CWPA 2UXBL 4Q15A 4IUNA 2H4OA 1B44D 1EZ8A 4DKAC 4AYBE 3U9SA 4H13C 3AFPA 4NXNL 2GVBA 1HXYD 2CKZB 2D62A 1Y1VG 1TY2A 1SROA 1OTCA 12ASA 3S15B 3PCOA 3PO3B 2L15A 3S9WA 1N32L 2YU9B 1A2TA 3K7AB 4YRCA 3MXNA 3C1EA 1X54A 1WTRA 1I50B 3UDFA 3HOZH 2B2YA 4P3NA 4P75C 2UUBL 4DV5L 4CHTB 4KD4A 1HRJA 4RKLA 3BS1A 2UU9L 5C44B 3U4VA 4HJ8A 1Q46A 4RHSA 5KNBA 2AUJD 2BE5D 1UNSA 1NJIC 2JA5G 1AP0A 1VQGA 3VR4A 4RGMA 1HTLD 2O2LD 1STAA 3TUPA 2I07B 5KNDA 1ESRA 1STBA 5IE8A 2IPKD 3KLSA 2KHSA 3GTJB 3T16A 4B3SL 2C9OA 1XPRA 2D2CC 5IYCG 2I5HA 1HUMA 4B3RL 4LFCL 2ZZEA 2PMZE 3J80L 3DWQA 3WOFA 1X2GA 4U68A 4WJWA 5GAHC 2Q7EA 5K1XA 4JK1C 1WCMG 1AN8A 3RUXA 4MHEA 1I3QB 2F0SA 5IP7G 4RCNA 1L0XB 3HY1A 2XNAC 2RDHA 2E1HA 2EY1A 1HCZA 3R3OA 3W5OA 4H2WA 1BNZA 1GD7A 1LO5D 4YCUA 1P16A 2JA7G 3KLRA 1Z7TA 2EOTA 4OELB 3P20A 4DGZA 2F0OA 4BWGB 4QJFA 1G2SA 4ODGA 3CCLA 2JE6I 2WAQE 2OCEA 2SNSA 5J1ZA 4HIMA 2Z6BA 2NTTA 3V8LA 4DR2Q 4RG1A 3EBEA 4A3FB 3PIPA 4K5WA 1VQOA 3BU2A 1QUQB 4UDUC 2OTLA 1B4OA 1Z6HA 1B53A 4XTZA 2K5DA 1I4GA 5CR3A 1VS0A 2AQ3B 2AWNA 1TWFB 3MXGA 3OWFA 1CKMA 1X6OA 2NYZD 3FHWA 1ADJA 1H9JA 1U0LA 2K14A 2BH8A 2QW7A 2F0HA 4BBRG 3HOUB 1N9WA 4JVZA 1G6PA 5FKAC 2R7ZH 5E1FA 3PO2H 3QB3A 1QVGA 2R6GA 1F9SA 1VQNA 4DV1L 1HZAA 4X3KA 2NZOA 5I9PA 1VQBA 4XDXA 2X69A 5I9OA 1VQLA 2XWBB 2Z1CA 4FYDA 4CDEC 4PNYA 4FXDA 2UXBQ 3GTPB 1W66A 4K86A 4P71A 3BZKA 1XX8A 2L12A 2GA4B 2JA7B 5DAUA 1H4QA 4LF7Q 5KNCA 4YRJA 2HNIA 3GTQB 1A3TA 2CCZA 2MQHA 2N78A 5A2QL 3M4OB 3MWYW 2A6ED 4YY3Q 2ALYA 1OXVA 1PTOB 1YVCA 3OPOA 1TR5A 3E0EA 3H91A 4XQNA 4JI3Q 1PTOF 1HZCA 2CH4A 2Y0SE 2RCFA 1BXTA 2QCPX 4B08A 2I4OA 5M5WB 3LWEA 1V1QA 5JPNC 2R92H 2R7DA 3GDEA 4HWPA 4IPDA 1NAPA 1ENAA 4ZUIA 1EY8A 2BCOA 2E2HB 3TEHB 3W1BA 2NS6A 1HNZL 3RLFA 3CCUA 5IT9L 1H4VB 1L2FA 2D9UA 1LTTD 1PRTC 5GQOA 11ASA 1U4PA 3K5MA 4ME3A 4DV4Q 2JK8A 3RGLA 5AJ3L 1YNJD 3VQVA 4BBSB 3PO2G 4KJOA 1D5ZC 3KUPA 3NBIA 1QZGA 2WAQG 4G84A 4G57A 5IYBG 1VF5C 3AQQA 3STBC 1WTQA 4FF2A 3V96A 2UXCQ 1K83B 2NB0A 3I70A 1UUPA 4OGQC 4CDCC 3PO3G 1GUWA 2EJ9A 5D14A 1PTOC 2WP8J 4JOIC 3JAMi 1II3A 3HKZB 4OXPA 3RR5A 3TP7A 3T1YQ 4TTVA 1YHQA 2R93H 3IFDA 4CH5A 3C3LA 1R9TH 1KTKA 1UEAB 2LS01 1SESA 1A8VA 3NE5B 5HGTA 4TSSA 5C51B 1JOQA 2TSSA 2VUMH 4PHCA 3I3CA 4XYQA 1HZBA 2F4IA 4MTNA 1DYQA 2E75C 2IX0A 2N8NA 4JI0Q 2CQOA 3K80C 3LSSA 2A69D 1J5EL 2BA1A 3RLOA 1G51A 3TS0A 1XPOA 3NHHA 5IWAQ 1TVXA 4KLKA 5CC4A 3PUZA 5M3FB 2ID0A 2K28A 1RODA 4A3FH 3R2IA 4C3IG 4POFA 5EPJA 5CV6A 2R7ZG 2UXDQ 2VW9A 1KXLA 1BDOA 1I4XA 4ID6A 2E65A 5GAEC 1BIBA 3V7SA 4KKUA 4HCSA 4A3DH 2IHFA 2O5IC 2DQ0A 2JYOA 4X3SA 1WTWA 2VUMG 3M3YH 2FMCA 3A31A 2J4XA 1TS2A 2ZZGA 2OWOA 1ET9A 2WFWA 3TREA 3Q6SA 1XPUA 4CKCA 4ZUJA 3I4MH 3FMCA 2XSCA 4FF4A 1B3AA 1PFSA 3PCOB 1PTOD 4A3EG 3ZYYX 3PMFA 1V9PA 1NJ2A 3CCEA 2NWGA 4HJ9A 2NVXH 3F1ZA 1STYA 2RCNA 3OW2A 1WFQA 3KLWA 1QZHA 5E3IA 2F0IA 1X3GA 2EXZA 3KF8A 4PMCA 3NETA 2F1MA 5C52B 3QTCA 1VQIA 3A8JE 2E2IH 1IHZA 1MBYA 5IP7H 3LC0A 5CORA 1A3UA 1RJTA 1S5FD 3J81L 4IFDJ 1N34L 1KDCA 2EYLA 2GN5A 3M4OH 2DNCA 4P73A 5M5YH 1PFBA 1G5HA 2QKIC 1EVKA 1NMFA 1LM0A 3J81c 5D3IB 5M3MB 2R92B 4JI1L 1Q1EA 2WB1G 3Q23A 1H4TA 3OMGA 4H2XB 2EWNA 1R4QB 2IY5B 1XMQL 2KCCA 1HA5A 2OEOA 1SE8A 1VQMA 4CS2A 2RSNA 4LVLA 5C3WA 3CMEA 5BN4A 2ATWA 2G9DA 2KEEA 3AB9A 3WDNA 5KNNA 1XNQQ 3TZUA 3BZCA 4JC0A 5IGBA 1XNQL 5M5YB 4BBSH 3KFUA 1C9OA 4EQPA 2EVBA 1S4ZA 5JVH3 3K0YA 3L2ZA 5KEEA 3MVVA 5DLQE 4BY1G 2ARUA 4DR4L 4P72A 4YHHL 4LF9L 3QO7A 1SJHD 4NB3A 1E2VA 1VQ8A 5C3EB 5ELOA 1KNEA 3QG1A 4DN4M 1VQ6A 1HTPA 4OLFA 3G7LA 3P75A 2UUAQ 1IKMA 3N52A 4HMIA 1TS5A 3K0XA 2NTSA 3RZDB 3PZCA 4YY3L 2H5XA 2Q8RE 2V4DA 4OHJA 4A3DG 1Y8NB 4K5VA 1Q3LA 1L0YB 2KEDA 3KF6B 4QB4A 4JI1Q 3GTJH 3J81j 4R8NA 1HNXL 3T13A 2B29A 3EQLC 4ABNA 2KECA 1O7LA 3GV6A 4P2CB 2RA4A 2QDBA 4XQQA 1SETA 2Q7GA 4I65A 3H0GH 4HWOA 2WKDA 1SE4A 3EN2A 2DTOA 1YHAA 1HXDA 1O80A 4L5TA 1YFRA 5ELCA 5M3FH 1I6HB 1HTTA 5KGUA 5J22A 4DV7Q 3AYHB 2AQ1B 1E22A 1RL2A 3LWUA 4X3TA 5M3FG 2KHJA 3TEGA 1F2MA 2EAYA 1GUNA 4RKBA 3MEYA 1WQ7A 1GHKA 4JI2Q 1JWMD 1BBXC 2ZM6Q 1S5BD 4A93H 2K1BA 1B9MA 1NUCA
chains in the Genus database with same CATH topology
2ZNIA 1HR0L 3PO3H 4XU3A 3UFGA 2K5NA 1HR0Q 2QHTA 4ZTUB 4JI6Q 1Q86C 4DR6Q 1BBWA 3CCSA 2C8MA 3HKZG 4YRLA 5IYBH 4LF7L 1VQHA 4XTUA 4K87A 2DZCA 1WLEA 1S72A 1IBLQ 4GN5A 4NPSA 1BVSA 1A0IA 4DV6Q 3MF2A 3UDIA 4HWTA 3PIOA 4LUOA 4LFBL 5HY6A 1HC7A 4DQ2A 4B3TL 5JJLA 2JEAI 1VQKA 3M4PA 3KJOA 2VZAA 4GKKL 4XEMA 4DK6C 2IX1A 4DR5L 1MJCA 5M5XH 1NJ1A 4AH6A 2EJGA 1PH4A 4A3CG 1VQ9A 2NVTH 3AEVA 2JA9A 5C3EH 2DXTA 2PI2E 3L0OA 2KBNA 3HXWA 5FLMG 3CF5A 4KHZA 1TXYA 4JV5L 3T1YL 4DK3C 2KCMA 2HHHL 4JI8Q 5E7NA 4LF4L 2JA6G 3HRKA 3P8TA 2DQ3A 2I4NA 3HXXA 4QGUA 3MF1A 2MO0A 3J80i 5LMUQ 2DTHA 5BR8L 3G1ZA 2PQAB 4LUVA 2LSSA 2I5MX 3H0GG 3HFZB 4JCVE 4GKJL 2G4CA 2CJ9A 4OX9L 3GTGH 1I94Q 1E1TA 3S1QH 3H3VI 1YIJA 4DR3Q 2A19A 2HQLA 1E3PA 4YRFA 2ODRC 1VQPA 4DR6L 1K8AC 1TWHH 1PH8A 1PVOA 3GTLH 3CCMA 2EXDA 3GTQH 3CCVA 3CPWA 4YWLA 3A0JA 3A7UA 1NTGA 2ZT7A 2Q2HA 1J6QA 3RN5A 1QUQA 1J5EQ 4CS4A 4GNXC 3E9IA 4P71C 2E5LL 1AE3A 2CJAA 4P74C 3S24A 1K83H 5J3BA 5C44G 3S1MH 1NJ6A 3K7UC 4HT4A 3S15H 4JI4L 2KCTA 2UUCL 1QE0A 3VDYA 4Q6GA 1B7YB 3I4NG 1TWGH 4LFCQ 5LMNL 3MQZA 1BBUA 3QNEA 2UXCL 4HJAA 4A3JG 2MO1A 1XNRL 3ZJYC 2UUAL 3A5ZB 2EIFA 1I3QH 4JV5Q 3NELA 4LVMA 1TWAH 1CKOA 3B6YA 3KDFA 3HRIA 4DV4L 3CAMA 4HJ5A 4C3HH 4APVA 4LVJA 2HT1A 1Y14B 4DV0L 1PH1A 4L5QA 5IYDG 4JYAL 2N49A 1Q1BA 1KRTA 1X9NA 4IOAA 1FYFA 4BY7H 1C7YA 1HH2P 1YEZA 4WJ3M 1JJGA 1K8GA 4DR3L 1NY4A 2Q5HA 3PUVA 3S2DH 4BY1H 1UE1A 1WU7A 4KHPQ 1BIAA 4P74A 1PHJA 4TVAB 4YWMA 2QEXA 1U5KA 4BXXH 4GKJQ 4LF6L 2ZGWA 3CXCA 4A3GH 4YWKA 3W1GA 1AH9A 2DTIA 2ZIOA 5C44H 1B70A 2DDZA 1YFTA 4JI7L 4OO1G 2BH2A 4YDQA 3S16H 1Q81C 1UE5A 4OWWB 4H02A 1PH5A 1HJPA 4DV7L 4KQEA 4LF5L 4OWTB 2CFMA 3L4GA 1JT8A 2OTJA 3T1HQ 2Z0SA 2ZIMA 4XTXA 1L1OB 1K73C 4YRRA 4YCWA 2HHHQ 4C3JH 1Y1WH 3HOXG 4BY7G 2ZXFA 2MFIA 4PZ6A 4A3EH 4R4QA 1SLJA 4LF5Q 1Q12A 3AFQA 4GS3A 3M85A 1XMQQ 3TEHA 4GLAC 3VBBA 2RHQA 2JA8G 3Q8DA 1KL9A 3F2CA 5JJKA 5AJ3Q 4BBRH 1W3SA 2UU9Q 1USYA 4RDXA 3I4MG 4HWSA 2QHSA 4YRGA 2C7IA 2ZNJA 3ICAA 3F2BA 1EOVA 2I5LX 4LF8L 3E9HA 3CW2C 4HIKA 1UEBA 3ULPA 5GADC 4GNXB 3V8JA 3I7FA 1VQEA 2CGHA 2VQEQ 1UE6A 5FLMH 4TWAA 4RQEA 2VQEL 4DV0Q 4XTVA 2I0QA 4YRSA 2DVEA 1SFOH 5M5WH 2ZT8A 4UP9A 3H15A 4P3PA 4AIMA 1YB3A 2ZJPA 3HOXH 3CQZH 4XTCS 2CWAA 1EIYB 4DV1Q 4A3IG 1CSPA 2NVYH 1MJEA 3HOVH 5BR8Q 3CC4A 2JA5H 4BA2I 2E2HH 3HOVG 1T9HA 1C0AA 1B7YA 2DEQA 1FJGQ 4R4TA 3PUWA 1KMNA 1GO3E 3FKIG 4JBJA 3REXA 1O7IA 2F4VL 1IYJB 2Z6KA 1VQJA 2B3GA 4L5RC 2OQ0A 4DR1Q 3CP0A 4DV5Q 2CJBA 4BXXG 2VS1A 1AE2A 4YREA 1JB7A 2ARSA 3HXVA 1Z7MA 4C2MH 4R4OA 3G71A 4A3BG 3J80c 5FLXc 2IY5A 3KOJA 4LVIA 4DV6L 2VNUD 3CD6A 2UUBQ 4DR5Q 3LGJA 2IHEA 1RIQA 2ZTGA 1I5FA 3BFMA 4BW9A 4B3TQ 1PH6A 2A8EA 1PYBA 3U50C 2YTYA 1NYRA 1IBKL 3DSQA 1ASYA 1VQCA 2YYZA 4TQUS 3A5YA 3M4QA 3PSIA 3RNUA 4LNSA 1YBYA 3CPFA 2B63H 4P73C 3MXNB 1FVIA 4G85A 4YRPA 4P3OA 4TVAA 1ASZA 5K36G 1G5IA 2ZZFA 3IKLA 3J7A5 3NBHB 1GGMA 2RF4A 4JI7Q 4JYAQ 4X62Q 3HXYA 3TS2A 1Z7NA 5H1SE 5JEAJ 3ULLA 3CC2A 4DUZL 2ZTDA 1I50H 3V8KA 3ERRA 3L1AA 4IOCA 5EAYA 1SRUA 4WJ4A 2ZT5A 4X5OA 2GVAA 4BA1I 2K4KA 2YTVA 3RKXA 1KD1C 3TRZA 2KENA 3CMAA 3MEFA 1XMOL 1NE3A 1I94L 2AMCA 4PG3A 2DXUA 2AKWB 2Q2UA 1CSQA 2I4LA 3A32A 1S3OA 2Q7HA 2UUCQ 2VL6A 4DPGA 2RHQB 3FP9A 1IBMQ 1JE5A 1PYSB 4NXMQ 4DR1L 2DGYA 1KC8C 3CC7A 4YHHQ 3PUYA 1XTDA 1Y1VH 4DAMA 2F52A 2J3LA 2LXKA 1D7QA 3IALA 4WI1A 4GN3B 4L5SA 4JI3L 3TQYA 1OXXK 1H95A 4NXML 3L7ZC 4XU1A 1RIPA 2HIXA 2DJZA 4OP0A 4E51A 4K0KQ 2JJQA 4MZ9A 4A3KG 4DUYQ 4IPHA 2DU7A 3QO5A 4X65L 3HOUH 4POGA 3IRBA 4LNQA 2VQFL 1X55A 4DV3Q 2K50A 1CUKA 4KI0A 4RMFA 1H4SA 3I4NH 1X56A 1QF6A 3HXUA 2JA7H 2QGQA 4YROA 1EQQA 4PMWA 1N8RC 3UGQA 1LUZA 4OO1I 4JI6L 4A3CH 4GOPB 3S17H 1PA6A 3HFZA 2D0PA 1KHIA 3FJPA 3K8AA 4GLVB 2ZM6L 3G4SA 4ZIBA 3I2ZA 4H2XA 3CCQA 1UE7A 2XGTA 3RKWA 3M9BA 4KR2A 4KR3A 4H2VA 1EIFA 1XNRQ 4DR2L 5IP9G 1SMXA 5FJ8H 1YJNA 1JJ2A 3ICEA 3RZOH 4GN4B 5GROA 1K0RA 1WPYA 3I55A 2YU9H 4XTWA 3WWVA 1ADYA 3KJPA 5LMNW 1NNHA 1VQZA 3UGTA 1XMOQ 2DU5A 1KRSA 1CKNB 2N3SA 4X64Q 2QA4A 1N33L 3QO8A 4GKKQ 4LFAL 2NVQH 1DGSA 3BJUA 4HWRA 1YNXA 3IG2A 1X3EA 4HIOA 2DKGA 4A93G 3PF5A 3I4OA 4JI4Q 1N33Q 3UDGA 2FYKA 1N34Q 1X65A 2ODRD 2PMEA 4XU2A 2CIMA 3PV0A 1EWIA 3NEMA 2R93G 1GVPA 4AQYQ 5C53B 4JBWA 2ZCEA 3GTOH 3RKYA 1YHBA 1OXSC 3HFVA 2ZINA 2E8GA 2V1CC 3NENA 2DZ9A 4GNXA 1FGUA 4L87A 5K1PA 1IL2A 1E1OA 4NXNQ 4HJ7A 4A3LG 4QIWE 3FKIH 1Q7YC 4DUZQ 2Q2IA 2UXDL 2R7FA 3KF8B 1XJVA 1NJ5A 4LF4Q 1E7ZA 4DV3L 1BKBA 4LF8Q 3A5ZA 1OXTA 3VQYA 1VCIA 5M3MH 1VQ5A 2PNHA 4XEOA 1Q82C 4IFDG 1HNXQ 1WQWA 3HOZG 3RL6A 2HIVA 4H2SA 3UH0A 4YRMA 1B76A 2ZT6A 3I56A 4A76A 3A5UA 3KDFB 4LUZA 4OX9Q 1MKHA 2YTXA 1SERA 4B3RQ 1E24A 4A3GG 1A62A 1WOCA 4LF9Q 5C4JH 4UPAA 2E5AA 2A1AA 2ZTCA 2E2JH 3RZDH 1TWFH 3HOYG 4YRQA 4A3LH 3HKSA 4XIGS 3P8VA 2ARTA 2ZJRA 1QVFA 2E64A 3ERSX 4R4CA 4IJHA 1VQ7A 1EIYA 4IPGA 1KQSA 4YRIA 3J7ZC 3IKMB 1EFWA 4DR7L 4TQFA 2XTIA 3WQZA 1K9MC 3KF6A 1FL0A 1X2HA 1HZ9A 4C3IH 1PH7A 2ALYB 3L2PA 4YRNA 1GKHA 4CH4A 1N36Q 1D8LA 2VQFQ 3EFSA 3UDXA 4YRKA 1PV4A 4Y52H 4LW1A 4H2YA 5F5WA 4JI5Q 1UWVA 1JJCA 2E5LQ 4K0KL 4PZ8A 2NN6I 1P8LA 1PH3A 2F3IA 1EVLA 5JEAG 4X62L 2QHUA 2LXJA 1NBWA 3J81i 4J15A 2ZTEA 4TVWA 2K75A 4B3ML 4X6AH 2ZR3A 4YYEA 4JI2L 1W2BA 1YFSA 4JI5L 1G291 1KOGA 3RF1A 3JC66 4YCVA 2Y0SG 4KHPL 2PI2A 2RHSB 1N36L 3S14H 4JOIA 5ELNA 2ZJQA 2AHOB 3OTOL 3VQWA 1KAWA 2A8VA 1WYDA 4A3IH 4TVYA 1VQAA 1WNLA 1KMMA 1HNWL 2AMCB 3OD1A 4K88A 1V43A 1MIUA 4DAYB 3HOWG 4CS3A 4A4IA 1EYGA 3HXZA 3RN2A 3HOUG 3STBD 1VQ4A 4IPCA 1VQFA 1ATIA 2DUDA 3DM3A 4JBMA 1WI5A 1IBLL 2ASBA 3S1NH 2F4VQ 5C4XH 1NJ8A 3ULJA 1HNZQ 3CMQA 3R07A 5C4XG 2P0LA 1IBML 3A74A 4MNOA 4A3FG 2IT1A 1YGBA 2Z6KC 4HIDA 4P72C 3A7RA 2D0OA 2JA6H 4A3BH 2K5HA 1L1OC 4HA8A 4IO9A 3M7NA 3PF4A 4UP7A 2NN6G 1YITA 4O0AA 4X66Q 2NZHA 1PH9A 5C0XJ 1NMGA 4CH6A 4X66L 1YJWA 3ER0A 4DV2L 1SR3A 2JQOA 3F2DA 5LMUL 4LVKA 1LTLA 4DV2Q 3D31A 2C35B 4R1JA 4YPFA 3GD7A 4GOPC 1Y1WG 3HTZA 4QL5A 4A75A 4CH3A 1NYQA 2J3MA 1GM5A 3L4GB 3PUXA 3U4ZA 5IP9H 1IXRA 4LFAQ 5IWAL 2P5IA 4AQYL 3EFRA 5FJ8G 3P8YA 2AWOA 3V7CA 2OQKA 3V7RA 2FXQA 2QHVA 1X3FA 4QQBX 4HVCA 1B70B 5IT9c 5IY0A 4XU0A 4UY8C 2Q5IA 1HNWQ 4EX5A 4YP0A 4WF2A 1PH2A 4RQFA 3CCRA 2E3CA 4O2DA 3DLLA 1M90C 1S40A 4B3SQ 1L1OA 3D0FA 3K81C 1J5WA 1JMCA 3H3VH 1Z47A 2ES2A 2PMFA 3RIRA 1IZ6A 2B63G 1K3RA 5C0XI 1L0WA 3W3SA 5LMNQ 1I6HH 1PYSA 4PZ7A 3HOYH 4DR4Q 3OTOQ 1OXUA 1FJGL 4YRTA 4AYBG 2VY3A 3GTPH 5C3EG 2MNAA 3UE0A 3OYYA 2JA8H 3HKZE 4OONA 1QVCA 4R4IA 3G6EA 2JEBI 3UE1A 1SRYA 3RACA 2Q2TA 4LFBQ 3PGZA 4P75A 1M1KC 3GTMH 5JJIA 3LSQA 2EJFA 1TWCH 2BA0A 2WB1E 4IFDI 3A7AA 1EUJA 4LF6Q 2AKWA 3S2HH 5GAGC 1HR0W 4X65Q 4EQ5A 1N32Q 2KHIA 1JJCB 3GTKH 4ZTZB 2PQAA 5M3MG 4JBKA 4A3MG 4TQDA 1YZ6A 3K7AH 4DR7Q 3REUA 2RHSA 2I4MA 4OWXB 1SN8A 2K5VA 4DUYL 4NCXA 4JG2A 1KIXA 3GO5A 4UP8A 4QY7A 3F8TA 1IBKQ 4GOPA 4IJLA 4JI8L 3VQXA 4A3MH 3HY0A 3S1RH 2R92G 2K52A 1B8AA 1Q8KA 3KYHC 3SGIA 4JI0L 4DNIA 1WJJA 2EQSA 1USYC 1A63A 4Y7NH 3JAMc 2EL9A 4H2UA 1LYLA 5HGQA 2E10A 4XTYA 3CCJA 3T1HL 1VQDA 5C0XG 4ALPA 4LWCA 1EQRA 4X64L 4A3KH 1X01A 2E41A 3U58A 5IYDH 3EIVA 2YV5A 1CKNA 4GLXA 4BWAA 1WCMH 3HOWH 4FDBA 1YI2A 2ZR2A 4H2TA 1Z9FA 5IYCH 3G48A 4BBSG 4B3MQ 3RLNA 4A3JH 4EO4A 1YJ9A 2CWPA 2UXBL 4Q15A 4DKAC 4AYBE 3AFPA 4NXNL 2GVBA 2CKZB 2D62A 1Y1VG 1SROA 1OTCA 12ASA 3PCOA 2L15A 1N32L 4YRCA 1X54A 3UDFA 3HOZH 4P3NA 4P75C 2UUBL 4DV5L 2UU9L 3U4VA 4HJ8A 1Q46A 1NJIC 2JA5G 1VQGA 3TUPA 5IE8A 4B3SL 1XPRA 5IYCG 2I5HA 4B3RL 4LFCL 2ZZEA 2PMZE 1X2GA 5GAHC 2Q7EA 5K1XA 1WCMG 3RUXA 5IP7G 3HY1A 2E1HA 3W5OA 4H2WA 1GD7A 4YCUA 1P16A 2JA7G 4QJFA 3CCLA 2JE6I 2WAQE 2OCEA 4HIMA 3V8LA 4DR2Q 4RG1A 3EBEA 1VQOA 3PIPA 3BU2A 1QUQB 2OTLA 4XTZA 1VS0A 2AWNA 1CKMA 1X6OA 3FHWA 1ADJA 1U0LA 2K14A 2BH8A 4BBRG 1G6PA 1N9WA 2R7ZH 3PO2H 1QVGA 2R6GA 1VQNA 4DV1L 1HZAA 2NZOA 1VQBA 1VQLA 2UXBQ 1W66A 4K86A 4P71A 3BZKA 1H4QA 4LF7Q 4YRJA 2HNIA 2CCZA 2MQHA 2N78A 4YY3Q 2ALYA 1OXVA 1YVCA 3E0EA 4JI3Q 1HZCA 2Y0SE 2I4OA 1V1QA 2R92H 2R7DA 3GDEA 4HWPA 4IPDA 3TEHB 3W1BA 2NS6A 1HNZL 3RLFA 3CCUA 1H4VB 1L2FA 5GQOA 11ASA 4ME3A 4DV4Q 2JK8A 3RGLA 5AJ3L 3VQVA 3PO2G 1QZGA 2WAQG 4G84A 5IYBG 3AQQA 3STBC 2UXCQ 3PO3G 2EJ9A 2WP8J 4JOIC 3JAMi 3RR5A 4OXPA 4TTVA 3T1YQ 1YHQA 2R93H 4CH5A 1R9TH 1SESA 1A8VA 5C51B 2VUMH 4PHCA 1HZBA 4MTNA 4JI0Q 2IX0A 2N8NA 2CQOA 3K80C 3LSSA 1J5EL 2BA1A 3RLOA 1G51A 3TS0A 1XPOA 5IWAQ 4KLKA 3PUZA 2ID0A 4A3FH 4POFA 2R7ZG 2UXDQ 2VW9A 1KXLA 2E65A 5GAEC 1BIBA 3V7SA 4A3DH 2IHFA 2DQ0A 2VUMG 3M3YH 3A31A 2ZZGA 2OWOA 2WFWA 3TREA 1XPUA 3I4MH 1PFSA 3PCOB 4A3EG 1V9PA 1NJ2A 3CCEA 4HJ9A 2NVXH 3F1ZA 2RCNA 3OW2A 1WFQA 3KLWA 1QZHA 5E3IA 1X3GA 3NETA 5C52B 3QTCA 1VQIA 2E2IH 5IP7H 3LC0A 4IFDJ 1N34L 2GN5A 3M4OH 4P73A 5M5YH 1G5HA 1EVKA 1NMFA 1LM0A 3J81c 4JI1L 1Q1EA 2WB1G 1H4TA 4H2XB 2EWNA 2IY5B 1XMQL 1SE8A 1VQMA 4CS2A 4LVLA 3CMEA 2ATWA 5KNNA 1XNQQ 3BZCA 4JC0A 1XNQL 4BBSH 3KFUA 1C9OA 3L2ZA 5DLQE 4BY1G 2ARUA 4DR4L 4P72A 4YHHL 4LF9L 3QO7A 4NB3A 1VQ8A 5ELOA 1VQ6A 4OLFA 2UUAQ 3K0XA 3PZCA 4YY3L 2H5XA 4A3DG 3KF6B 4JI1Q 3GTJH 3J81j 1HNXL 2B29A 1SETA 2Q7GA 3H0GH 4HWOA 3EN2A 2DTOA 1YHAA 1HXDA 4L5TA 1YFRA 5M3FH 1HTTA 4DV7Q 3AYHB 1E22A 1RL2A 5M3FG 2KHJA 3TEGA 2EAYA 3MEYA 1WQ7A 4JI2Q 2ZM6Q 4A93H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNI A;  1HR0 L;  3PO3 H;  4XU3 A;  3UFG A;  2K5N A;  1HR0 Q;  2QHT A;  4ZTU B;  4JI6 Q;  1Q86 C;  4DR6 Q;  1BBW A;  3CCS A;  2C8M A;  3HKZ G;  4YRL A;  5IYB H;  4LF7 L;  1VQH A;  4XTU A;  4K87 A;  2DZC A;  1WLE A;  1S72 A;  1IBL Q;  4GN5 A;  4NPS A;  1BVS A;  1A0I A;  4DV6 Q;  3MF2 A;  3UDI A;  4HWT A;  3PIO A;  4LUO A;  4LFB L;  5HY6 A;  1HC7 A;  4DQ2 A;  4B3T L;  5JJL A;  2JEA I;  1VQK A;  3M4P A;  3KJO A;  2VZA A;  4GKK L;  4XEM A;  4DK6 C;  2IX1 A;  4DR5 L;  1MJC A;  5M5X H;  1NJ1 A;  4AH6 A;  2EJG A;  1PH4 A;  4A3C G;  1VQ9 A;  2NVT H;  3AEV A;  2JA9 A;  5C3E H;  2DXT A;  2PI2 E;  3L0O A;  2KBN A;  3HXW A;  5FLM G;  3CF5 A;  4KHZ A;  1TXY A;  4JV5 L;  3T1Y L;  4DK3 C;  2KCM A;  2HHH L;  4JI8 Q;  5E7N A;  4LF4 L;  2JA6 G;  3HRK A;  3P8T A;  2DQ3 A;  2I4N A;  3HXX A;  4QGU A;  3MF1 A;  2MO0 A;  3J80 i;  5LMU Q;  2DTH A;  5BR8 L;  3G1Z A;  2PQA B;  4LUV A;  2LSS A;  2I5M X;  3H0G G;  3HFZ B;  4JCV E;  4GKJ L;  2G4C A;  2CJ9 A;  4OX9 L;  3GTG H;  1I94 Q;  1E1T A;  3S1Q H;  3H3V I;  1YIJ A;  4DR3 Q;  2A19 A;  2HQL A;  1E3P A;  4YRF A;  2ODR C;  1VQP A;  4DR6 L;  1K8A C;  1TWH H;  1PH8 A;  1PVO A;  3GTL H;  3CCM A;  2EXD A;  3GTQ H;  3CCV A;  3CPW A;  4YWL A;  3A0J A;  3A7U A;  1NTG A;  2ZT7 A;  2Q2H A;  1J6Q A;  3RN5 A;  1QUQ A;  1J5E Q;  4CS4 A;  4GNX C;  3E9I A;  4P71 C;  2E5L L;  1AE3 A;  2CJA A;  4P74 C;  3S24 A;  1K83 H;  5J3B A;  5C44 G;  3S1M H;  1NJ6 A;  3K7U C;  3S15 H;  4JI4 L;  2KCT A;  2UUC L;  1QE0 A;  3VDY A;  4Q6G A;  1B7Y B;  3I4N G;  1TWG H;  4LFC Q;  5LMN L;  1BBU A;  3QNE A;  2UXC L;  4HJA A;  4A3J G;  2MO1 A;  1XNR L;  3ZJY C;  2UUA L;  3A5Z B;  2EIF A;  1I3Q H;  4JV5 Q;  3NEL A;  1TWA H;  1CKO A;  3B6Y A;  3KDF A;  3HRI A;  4DV4 L;  3CAM A;  4HJ5 A;  4C3H H;  4APV A;  2HT1 A;  1Y14 B;  4DV0 L;  1PH1 A;  4L5Q A;  5IYD G;  4JYA L;  2N49 A;  1Q1B A;  1KRT A;  1X9N A;  4IOA A;  1FYF A;  4BY7 H;  1C7Y A;  1HH2 P;  1YEZ A;  4WJ3 M;  1JJG A;  1K8G A;  4DR3 L;  1NY4 A;  2Q5H A;  3PUV A;  3S2D H;  4BY1 H;  1UE1 A;  1WU7 A;  4KHP Q;  1BIA A;  4P74 A;  1PHJ A;  4TVA B;  4YWM A;  2QEX A;  1U5K A;  4BXX H;  4GKJ Q;  4LF6 L;  2ZGW A;  3CXC A;  4A3G H;  4YWK A;  3W1G A;  1AH9 A;  2DTI A;  2ZIO A;  5C44 H;  1B70 A;  2DDZ A;  1YFT A;  4JI7 L;  4OO1 G;  2BH2 A;  4YDQ A;  3S16 H;  1Q81 C;  1UE5 A;  4OWW B;  4H02 A;  1PH5 A;  1HJP A;  4DV7 L;  4KQE A;  4LF5 L;  4OWT B;  2CFM A;  3L4G A;  1JT8 A;  2OTJ A;  3T1H Q;  2Z0S A;  2ZIM A;  4XTX A;  1L1O B;  1K73 C;  4YRR A;  4YCW A;  2HHH Q;  4C3J H;  1Y1W H;  3HOX G;  4BY7 G;  2ZXF A;  2MFI A;  4PZ6 A;  4A3E H;  4R4Q A;  1SLJ A;  4LF5 Q;  1Q12 A;  3AFQ A;  4GS3 A;  3M85 A;  1XMQ Q;  3TEH A;  4GLA C;  3VBB A;  2RHQ A;  2JA8 G;  3Q8D A;  1KL9 A;  3F2C A;  5JJK A;  5AJ3 Q;  4BBR H;  1W3S A;  2UU9 Q;  1USY A;  4RDX A;  3I4M G;  4HWS A;  2QHS A;  4YRG A;  2C7I A;  2ZNJ A;  3ICA A;  3F2B A;  1EOV A;  2I5L X;  4LF8 L;  3E9H A;  3CW2 C;  4HIK A;  1UEB A;  3ULP A;  5GAD C;  4GNX B;  3V8J A;  3I7F A;  1VQE A;  2CGH A;  2VQE Q;  1UE6 A;  5FLM H;  4TWA A;  4RQE A;  2VQE L;  4DV0 Q;  4XTV A;  2I0Q A;  4YRS A;  2DVE A;  1SFO H;  5M5W H;  2ZT8 A;  4UP9 A;  3H15 A;  4P3P A;  4AIM A;  1YB3 A;  2ZJP A;  3HOX H;  3CQZ H;  4XTC S;  2CWA A;  1EIY B;  4DV1 Q;  4A3I G;  1CSP A;  2NVY H;  1MJE A;  3HOV H;  5BR8 Q;  3CC4 A;  2JA5 H;  4BA2 I;  2E2H H;  3HOV G;  1T9H A;  1C0A A;  1B7Y A;  2DEQ A;  1FJG Q;  4R4T A;  3PUW A;  1KMN A;  1GO3 E;  3FKI G;  4JBJ A;  3REX A;  1O7I A;  2F4V L;  1IYJ B;  2Z6K A;  1VQJ A;  2B3G A;  4L5R C;  2OQ0 A;  4DR1 Q;  3CP0 A;  4DV5 Q;  2CJB A;  4BXX G;  2VS1 A;  1AE2 A;  4YRE A;  1JB7 A;  2ARS A;  3HXV A;  1Z7M A;  4C2M H;  4R4O A;  3G71 A;  4A3B G;  3J80 c;  5FLX c;  2IY5 A;  3KOJ A;  4DV6 L;  2VNU D;  3CD6 A;  2UUB Q;  4DR5 Q;  3LGJ A;  2IHE A;  1RIQ A;  2ZTG A;  1I5F A;  3BFM A;  4BW9 A;  4B3T Q;  1PH6 A;  1PYB A;  3U50 C;  2YTY A;  1NYR A;  1IBK L;  3DSQ A;  1ASY A;  1VQC A;  2YYZ A;  4TQU S;  3A5Y A;  3M4Q A;  3PSI A;  3RNU A;  4LNS A;  1YBY A;  3CPF A;  2B63 H;  4P73 C;  3MXN B;  1FVI A;  4G85 A;  4YRP A;  4P3O A;  4TVA A;  1ASZ A;  5K36 G;  1G5I A;  2ZZF A;  3IKL A;  3J7A 5;  3NBH B;  1GGM A;  2RF4 A;  4JI7 Q;  4JYA Q;  4X62 Q;  3HXY A;  3TS2 A;  1Z7N A;  5H1S E;  5JEA J;  3ULL A;  3CC2 A;  4DUZ L;  2ZTD A;  1I50 H;  3V8K A;  3ERR A;  3L1A A;  4IOC A;  5EAY A;  1SRU A;  4WJ4 A;  2ZT5 A;  4X5O A;  2GVA A;  4BA1 I;  2K4K A;  2YTV A;  3RKX A;  1KD1 C;  3TRZ A;  2KEN A;  3CMA A;  3MEF A;  1XMO L;  1NE3 A;  1I94 L;  2AMC A;  4PG3 A;  2DXU A;  2AKW B;  2Q2U A;  1CSQ A;  2I4L A;  3A32 A;  1S3O A;  2Q7H A;  2UUC Q;  2VL6 A;  4DPG A;  2RHQ B;  3FP9 A;  1IBM Q;  1JE5 A;  1PYS B;  4NXM Q;  4DR1 L;  2DGY A;  1KC8 C;  3CC7 A;  4YHH Q;  3PUY A;  1XTD A;  1Y1V H;  4DAM A;  2F52 A;  2J3L A;  2LXK A;  1D7Q A;  3IAL A;  4WI1 A;  4GN3 B;  4L5S A;  4JI3 L;  3TQY A;  1OXX K;  1H95 A;  4NXM L;  3L7Z C;  4XU1 A;  1RIP A;  2HIX A;  2DJZ A;  4OP0 A;  4E51 A;  4K0K Q;  2JJQ A;  4MZ9 A;  4A3K G;  4DUY Q;  4IPH A;  2DU7 A;  3QO5 A;  4X65 L;  3HOU H;  4POG A;  3IRB A;  4LNQ A;  2VQF L;  1X55 A;  4DV3 Q;  2K50 A;  1CUK A;  4KI0 A;  4RMF A;  1H4S A;  3I4N H;  1X56 A;  1QF6 A;  3HXU A;  2JA7 H;  2QGQ A;  4YRO A;  1EQQ A;  4PMW A;  1N8R C;  3UGQ A;  1LUZ A;  4OO1 I;  4JI6 L;  4A3C H;  4GOP B;  3S17 H;  1PA6 A;  3HFZ A;  2D0P A;  1KHI A;  3FJP A;  3K8A A;  4GLV B;  2ZM6 L;  3G4S A;  4ZIB A;  3I2Z A;  4H2X A;  3CCQ A;  1UE7 A;  2XGT A;  3RKW A;  3M9B A;  4KR2 A;  4KR3 A;  4H2V A;  1EIF A;  1XNR Q;  4DR2 L;  5IP9 G;  1SMX A;  5FJ8 H;  1YJN A;  1JJ2 A;  3ICE A;  3RZO H;  4GN4 B;  5GRO A;  1K0R A;  1WPY A;  3I55 A;  2YU9 H;  4XTW A;  3WWV A;  1ADY A;  3KJP A;  5LMN W;  1NNH A;  1VQZ A;  3UGT A;  1XMO Q;  2DU5 A;  1KRS A;  1CKN B;  2N3S A;  4X64 Q;  2QA4 A;  1N33 L;  3QO8 A;  4GKK Q;  4LFA L;  2NVQ H;  1DGS A;  3BJU A;  4HWR A;  1YNX A;  3IG2 A;  1X3E A;  4HIO A;  2DKG A;  4A93 G;  3PF5 A;  3I4O A;  4JI4 Q;  1N33 Q;  3UDG A;  2FYK A;  1N34 Q;  1X65 A;  2ODR D;  2PME A;  4XU2 A;  2CIM A;  3PV0 A;  1EWI A;  3NEM A;  2R93 G;  1GVP A;  4AQY Q;  5C53 B;  4JBW A;  2ZCE A;  3GTO H;  3RKY A;  1YHB A;  1OXS C;  3HFV A;  2ZIN A;  2E8G A;  2V1C C;  3NEN A;  2DZ9 A;  4GNX A;  1FGU A;  4L87 A;  5K1P A;  1IL2 A;  1E1O A;  4NXN Q;  4HJ7 A;  4A3L G;  4QIW E;  3FKI H;  1Q7Y C;  4DUZ Q;  2Q2I A;  2UXD L;  2R7F A;  3KF8 B;  1XJV A;  1NJ5 A;  4LF4 Q;  1E7Z A;  4DV3 L;  1BKB A;  4LF8 Q;  3A5Z A;  1OXT A;  3VQY A;  1VCI A;  5M3M H;  1VQ5 A;  2PNH A;  4XEO A;  1Q82 C;  4IFD G;  1HNX Q;  1WQW A;  3HOZ G;  3RL6 A;  2HIV A;  4H2S A;  3UH0 A;  4YRM A;  1B76 A;  2ZT6 A;  3I56 A;  4A76 A;  3A5U A;  3KDF B;  4LUZ A;  4OX9 Q;  1MKH A;  2YTX A;  1SER A;  4B3R Q;  1E24 A;  4A3G G;  1A62 A;  1WOC A;  4LF9 Q;  5C4J H;  4UPA A;  2E5A A;  2A1A A;  2ZTC A;  2E2J H;  3RZD H;  1TWF H;  3HOY G;  4YRQ A;  4A3L H;  3HKS A;  4XIG S;  3P8V A;  2ART A;  2ZJR A;  1QVF A;  2E64 A;  3ERS X;  4R4C A;  4IJH A;  1VQ7 A;  1EIY A;  4IPG A;  1KQS A;  4YRI A;  3J7Z C;  3IKM B;  1EFW A;  4DR7 L;  4TQF A;  2XTI A;  3WQZ A;  1K9M C;  3KF6 A;  1FL0 A;  1X2H A;  1HZ9 A;  4C3I H;  1PH7 A;  2ALY B;  3L2P A;  4YRN A;  1GKH A;  4CH4 A;  1N36 Q;  1D8L A;  2VQF Q;  3EFS A;  3UDX A;  4YRK A;  1PV4 A;  4Y52 H;  4LW1 A;  4H2Y A;  5F5W A;  4JI5 Q;  1UWV A;  1JJC A;  2E5L Q;  4K0K L;  4PZ8 A;  2NN6 I;  1P8L A;  1PH3 A;  2F3I A;  1EVL A;  5JEA G;  4X62 L;  2QHU A;  2LXJ A;  1NBW A;  3J81 i;  4J15 A;  2ZTE A;  4TVW A;  2K75 A;  4B3M L;  4X6A H;  2ZR3 A;  4YYE A;  4JI2 L;  1W2B A;  1YFS A;  4JI5 L;  1G29 1;  1KOG A;  3RF1 A;  3JC6 6;  4YCV A;  2Y0S G;  4KHP L;  2PI2 A;  2RHS B;  1N36 L;  3S14 H;  4JOI A;  5ELN A;  2ZJQ A;  2AHO B;  3OTO L;  3VQW A;  1KAW A;  2A8V A;  1WYD A;  4A3I H;  4TVY A;  1VQA A;  1WNL A;  1KMM A;  1HNW L;  2AMC B;  3OD1 A;  4K88 A;  1V43 A;  1MIU A;  4DAY B;  3HOW G;  4CS3 A;  4A4I A;  1EYG A;  3HXZ A;  3RN2 A;  3HOU G;  3STB D;  1VQ4 A;  4IPC A;  1VQF A;  1ATI A;  2DUD A;  3DM3 A;  4JBM A;  1WI5 A;  1IBL L;  2ASB A;  3S1N H;  2F4V Q;  5C4X H;  1NJ8 A;  3ULJ A;  1HNZ Q;  3CMQ A;  3R07 A;  5C4X G;  2P0L A;  1IBM L;  3A74 A;  4MNO A;  4A3F G;  2IT1 A;  1YGB A;  2Z6K C;  4HID A;  4P72 C;  3A7R A;  2D0O A;  2JA6 H;  4A3B H;  2K5H A;  1L1O C;  4HA8 A;  4IO9 A;  3M7N A;  3PF4 A;  4UP7 A;  2NN6 G;  1YIT A;  4O0A A;  4X66 Q;  2NZH A;  1PH9 A;  5C0X J;  1NMG A;  4CH6 A;  4X66 L;  1YJW A;  3ER0 A;  4DV2 L;  1SR3 A;  2JQO A;  3F2D A;  5LMU L;  1LTL A;  4DV2 Q;  3D31 A;  2C35 B;  4R1J A;  4YPF A;  3GD7 A;  4GOP C;  1Y1W G;  3HTZ A;  4QL5 A;  4A75 A;  4CH3 A;  1NYQ A;  2J3M A;  1GM5 A;  3L4G B;  3PUX A;  3U4Z A;  5IP9 H;  1IXR A;  4LFA Q;  5IWA L;  2P5I A;  4AQY L;  3EFR A;  5FJ8 G;  3P8Y A;  2AWO A;  3V7C A;  2OQK A;  3V7R A;  2FXQ A;  2QHV A;  1X3F A;  4QQB X;  4HVC A;  1B70 B;  5IT9 c;  5IY0 A;  4XU0 A;  4UY8 C;  2Q5I A;  1HNW Q;  4EX5 A;  4YP0 A;  4WF2 A;  1PH2 A;  4RQF A;  3CCR A;  2E3C A;  4O2D A;  3DLL A;  1M90 C;  1S40 A;  4B3S Q;  1L1O A;  3D0F A;  3K81 C;  1J5W A;  1JMC A;  3H3V H;  1Z47 A;  2ES2 A;  2PMF A;  3RIR A;  1IZ6 A;  2B63 G;  1K3R A;  5C0X I;  1L0W A;  3W3S A;  5LMN Q;  1I6H H;  1PYS A;  4PZ7 A;  3HOY H;  4DR4 Q;  3OTO Q;  1OXU A;  1FJG L;  4YRT A;  4AYB G;  2VY3 A;  3GTP H;  5C3E G;  2MNA A;  3UE0 A;  3OYY A;  2JA8 H;  3HKZ E;  4OON A;  1QVC A;  4R4I A;  3G6E A;  2JEB I;  3UE1 A;  1SRY A;  3RAC A;  2Q2T A;  4LFB Q;  3PGZ A;  4P75 A;  1M1K C;  3GTM H;  5JJI A;  3LSQ A;  2EJF A;  1TWC H;  2BA0 A;  2WB1 E;  4IFD I;  3A7A A;  1EUJ A;  4LF6 Q;  2AKW A;  3S2H H;  5GAG C;  1HR0 W;  4X65 Q;  4EQ5 A;  1N32 Q;  2KHI A;  1JJC B;  3GTK H;  4ZTZ B;  2PQA A;  5M3M G;  4JBK A;  4A3M G;  4TQD A;  1YZ6 A;  3K7A H;  4DR7 Q;  3REU A;  2RHS A;  2I4M A;  4OWX B;  1SN8 A;  2K5V A;  4DUY L;  4NCX A;  4JG2 A;  1KIX A;  3GO5 A;  4UP8 A;  4QY7 A;  3F8T A;  1IBK Q;  4GOP A;  4IJL A;  4JI8 L;  3VQX A;  4A3M H;  3HY0 A;  3S1R H;  2R92 G;  2K52 A;  1B8A A;  1Q8K A;  3KYH C;  3SGI A;  4JI0 L;  4DNI A;  1WJJ A;  2EQS A;  1USY C;  1A63 A;  4Y7N H;  3JAM c;  2EL9 A;  4H2U A;  1LYL A;  5HGQ A;  2E10 A;  4XTY A;  3CCJ A;  3T1H L;  1VQD A;  5C0X G;  4ALP A;  4LWC A;  1EQR A;  4X64 L;  4A3K H;  1X01 A;  2E41 A;  3U58 A;  5IYD H;  3EIV A;  2YV5 A;  1CKN A;  4GLX A;  4BWA A;  1WCM H;  3HOW H;  4FDB A;  1YI2 A;  2ZR2 A;  4H2T A;  1Z9F A;  5IYC H;  3G48 A;  4BBS G;  4B3M Q;  3RLN A;  4A3J H;  4EO4 A;  1YJ9 A;  2CWP A;  2UXB L;  4Q15 A;  4DKA C;  4AYB E;  3AFP A;  4NXN L;  2GVB A;  2CKZ B;  2D62 A;  1Y1V G;  1SRO A;  1OTC A;  12AS A;  3PCO A;  2L15 A;  1N32 L;  4YRC A;  1X54 A;  3UDF A;  3HOZ H;  4P3N A;  4P75 C;  2UUB L;  4DV5 L;  2UU9 L;  3U4V A;  4HJ8 A;  1Q46 A;  1NJI C;  2JA5 G;  1VQG A;  3TUP A;  5IE8 A;  4B3S L;  1XPR A;  5IYC G;  2I5H A;  4B3R L;  4LFC L;  2ZZE A;  2PMZ E;  1X2G A;  5GAH C;  2Q7E A;  5K1X A;  1WCM G;  3RUX A;  5IP7 G;  3HY1 A;  2E1H A;  3W5O A;  4H2W A;  1GD7 A;  4YCU A;  1P16 A;  2JA7 G;  4QJF A;  3CCL A;  2JE6 I;  2WAQ E;  2OCE A;  4HIM A;  3V8L A;  4DR2 Q;  4RG1 A;  3EBE A;  1VQO A;  3PIP A;  3BU2 A;  1QUQ B;  2OTL A;  4XTZ A;  1VS0 A;  2AWN A;  1CKM A;  1X6O A;  3FHW A;  1ADJ A;  1U0L A;  2K14 A;  2BH8 A;  4BBR G;  1G6P A;  1N9W A;  2R7Z H;  3PO2 H;  1QVG A;  2R6G A;  1VQN A;  4DV1 L;  1HZA A;  2NZO A;  1VQB A;  1VQL A;  2UXB Q;  1W66 A;  4K86 A;  4P71 A;  3BZK A;  1H4Q A;  4LF7 Q;  4YRJ A;  2HNI A;  2CCZ A;  2MQH A;  2N78 A;  4YY3 Q;  2ALY A;  1OXV A;  1YVC A;  3E0E A;  4JI3 Q;  1HZC A;  2Y0S E;  2I4O A;  1V1Q A;  2R92 H;  2R7D A;  3GDE A;  4HWP A;  4IPD A;  3TEH B;  3W1B A;  1HNZ L;  3RLF A;  3CCU A;  1H4V B;  1L2F A;  5GQO A;  11AS A;  4ME3 A;  4DV4 Q;  2JK8 A;  3RGL A;  5AJ3 L;  3VQV A;  3PO2 G;  1QZG A;  2WAQ G;  4G84 A;  5IYB G;  3AQQ A;  3STB C;  2UXC Q;  3PO3 G;  2EJ9 A;  2WP8 J;  4JOI C;  3JAM i;  3RR5 A;  4OXP A;  4TTV A;  3T1Y Q;  1YHQ A;  2R93 H;  4CH5 A;  1R9T H;  1SES A;  1A8V A;  5C51 B;  2VUM H;  4PHC A;  1HZB A;  4MTN A;  4JI0 Q;  2IX0 A;  2N8N A;  2CQO A;  3K80 C;  3LSS A;  1J5E L;  2BA1 A;  3RLO A;  1G51 A;  3TS0 A;  1XPO A;  5IWA Q;  4KLK A;  3PUZ A;  2ID0 A;  4A3F H;  4POF A;  2R7Z G;  2UXD Q;  2VW9 A;  1KXL A;  2E65 A;  5GAE C;  1BIB A;  3V7S A;  4A3D H;  2IHF A;  2DQ0 A;  2VUM G;  3M3Y H;  3A31 A;  2ZZG A;  2OWO A;  2WFW A;  3TRE A;  1XPU A;  3I4M H;  1PFS A;  3PCO B;  4A3E G;  1V9P A;  1NJ2 A;  3CCE A;  4HJ9 A;  2NVX H;  3F1Z A;  2RCN A;  3OW2 A;  1WFQ A;  3KLW A;  1QZH A;  5E3I A;  1X3G A;  3NET A;  5C52 B;  3QTC A;  1VQI A;  2E2I H;  5IP7 H;  3LC0 A;  4IFD J;  1N34 L;  2GN5 A;  3M4O H;  4P73 A;  5M5Y H;  1G5H A;  1EVK A;  1NMF A;  1LM0 A;  3J81 c;  4JI1 L;  1Q1E A;  2WB1 G;  1H4T A;  4H2X B;  2EWN A;  2IY5 B;  1XMQ L;  1SE8 A;  1VQM A;  4CS2 A;  3CME A;  2ATW A;  5KNN A;  1XNQ Q;  3BZC A;  4JC0 A;  1XNQ L;  4BBS H;  3KFU A;  1C9O A;  3L2Z A;  5DLQ E;  4BY1 G;  2ARU A;  4DR4 L;  4P72 A;  4YHH L;  4LF9 L;  3QO7 A;  4NB3 A;  1VQ8 A;  5ELO A;  1VQ6 A;  4OLF A;  2UUA Q;  3K0X A;  3PZC A;  4YY3 L;  2H5X A;  4A3D G;  3KF6 B;  4JI1 Q;  3GTJ H;  3J81 j;  1HNX L;  2B29 A;  1SET A;  2Q7G A;  3H0G H;  4HWO A;  3EN2 A;  2DTO A;  1YHA A;  1HXD A;  4L5T A;  1YFR A;  5M3F H;  1HTT A;  4DV7 Q;  3AYH B;  1E22 A;  1RL2 A;  5M3F G;  2KHJ A;  3TEG A;  2EAY A;  3MEY A;  1WQ7 A;  4JI2 Q;  2ZM6 Q;  4A93 H; 
#chains in the Genus database with same CATH topology
 4L63 B;  2ZNI A;  3OIQ A;  1MHW C;  3NP8 A;  4Z9C B;  1HR0 L;  2OT2 A;  4EQO A;  3PO3 H;  2EYM A;  4XU3 A;  1BO0 A;  3UFG A;  2K5N A;  1HR0 Q;  2QHT A;  1AW7 A;  4JI6 Q;  4C3H G;  1Q86 C;  4ZTU B;  3K5L A;  4DR6 Q;  1GUT A;  1BBW A;  3CCS A;  2C8M A;  3DHQ A;  4K6L A;  3HKZ G;  4YRL A;  2EYH A;  5IYB H;  4LF7 L;  1VQH A;  4XTU A;  4K87 A;  1TU2 B;  4Q5V A;  2DZC A;  1WLE A;  5C5M A;  5LHY 1;  3ONA B;  1S72 A;  1IBL Q;  1ONL A;  1G91 A;  4GN5 A;  5ELF A;  2F0M A;  4NPS A;  3T53 B;  5M9O A;  1BVS A;  1A0I A;  2FIN B;  1SYD A;  4DV6 Q;  3SVM A;  3MF2 A;  2NUC A;  3UDI A;  1WTO A;  1WTH A;  1G2T A;  2PO4 A;  4FXK C;  5JJZ A;  4CJ0 B;  3PIO A;  4HWT A;  2ICE C;  4LUO A;  3OMC A;  3OHX C;  4LFB L;  1CA6 A;  4HAE A;  5HY6 A;  1HC7 A;  4DQ2 A;  3IFT A;  1GUS A;  4E6I A;  4B3T L;  1IYV A;  5JJL A;  2JEA I;  1VQK A;  3NQI A;  3OOC A;  3M4P A;  5NUC A;  3R8B A;  2K6A A;  3C2P A;  3HEJ A;  3S14 B;  3KJO A;  5EBC A;  2VZA A;  4GKK L;  4XEM A;  4DK6 C;  2IX1 A;  1SYG A;  4DR5 L;  1MJC A;  2KJX A;  4KD3 A;  5M5X H;  1MI2 A;  1YNN C;  1NJ1 A;  4RGT A;  4AH6 A;  2EJG A;  1TY0 A;  1PH4 A;  1A15 A;  4A3C G;  1VQ9 A;  4G7Z C;  2NVT H;  3AEV A;  2JA9 A;  5C3E H;  2DXT A;  3J7Y W;  2PI2 E;  4K6D A;  2HD3 A;  3L0O A;  2KBN A;  3HXW A;  1GUG A;  5FLM G;  3CF5 A;  4KHZ A;  1TXY A;  4JV5 L;  4KJN A;  4G7H C;  3T1Y L;  1J8I A;  4DK3 C;  1ICF B;  1ZXT A;  2KCM A;  2HHH L;  1B1Z A;  4JI8 Q;  5E7N A;  4LF4 L;  2JA6 G;  3HRK A;  3P8T A;  2B39 A;  2DQ3 A;  1WVL A;  2I4N A;  3HXX A;  4QGU A;  1SNP A;  1TII D;  3MF1 A;  2EDG A;  2MO0 A;  1NCV A;  3J80 i;  5LMU Q;  2DTH A;  1IL8 A;  5BR8 L;  4LJZ C;  5KYL A;  3G1Z A;  2F03 A;  2PQA B;  3QOL A;  3PIO 3;  5EJW A;  1KLU D;  4LUV A;  1RTO A;  2LSS A;  5CV5 A;  2I5M X;  2K05 A;  3R2T A;  3H0G G;  3HFZ B;  1JQY D;  4JCV E;  4GKJ L;  2G4C A;  3HOW B;  4FO2 A;  2FHT A;  2CJ9 A;  4OX9 L;  3GTG H;  1I94 Q;  1E1T A;  3S1Q H;  3H3V I;  1YIJ A;  4DR3 Q;  2A19 A;  2HQL A;  4C56 C;  4KN4 C;  3GTK B;  3I72 A;  1QCB D;  4TRD A;  1DD2 A;  1E3P A;  5I4D A;  4YRF A;  2ODR C;  3QO2 A;  1VQP A;  4L6T B;  4ZCK A;  5JPM C;  4DR6 L;  3HRZ C;  1K8A C;  1XYI A;  1TWH H;  1WCM B;  4MN3 A;  2CQA A;  2DY7 A;  4ZKC B;  3VR3 A;  5DEH A;  4MTK A;  1PH8 A;  3HP3 A;  1VDZ A;  3GTL H;  3J7A F;  3L9A X;  1PVO A;  2XRQ D;  3CCM A;  5FO7 B;  2EXD A;  3GTQ H;  1F2Y A;  3CCV A;  2CW0 C;  2O4X A;  1RTN A;  3CPW A;  4YWL A;  1W6K A;  3A0J A;  3A7U A;  1NTG A;  2F0T A;  3DUZ A;  2Q2H A;  2ZT7 A;  1J6Q A;  3RN5 A;  1QUQ A;  3CRK C;  3N6R A;  1J5E Q;  1BCP F;  1PMR A;  4RAU C;  2L5T A;  4CS4 A;  4GNX C;  1DM0 B;  3MXU A;  3E9I A;  4F87 A;  2F0N A;  2E5L L;  4P71 C;  1AE3 A;  2AQ2 B;  5E3F A;  2CJA A;  4P74 C;  2XN9 C;  4ZK9 B;  3S24 A;  3MHB A;  1C4Q A;  3HZX A;  1K83 H;  3GP7 A;  5J3B A;  5CBA E;  5C44 G;  2Q8I B;  1DOL A;  1BCP D;  4C1N I;  2B8G A;  3TDQ A;  3S1M H;  1NJ6 A;  1SE3 A;  4C3J B;  3K7U C;  4UAI A;  3C1F A;  4HT4 A;  5CV4 A;  5BN3 A;  3S15 H;  3K57 A;  2OF1 A;  3CHB D;  4JI4 L;  2KCT A;  3OIP A;  2UUC L;  4UHV A;  2A69 C;  1QE0 A;  2X6G A;  2M2L A;  3VDY A;  4Q6G A;  1B7Y B;  1SNO A;  3I4N G;  4L8J A;  1TWG H;  4LFC Q;  5LMN L;  3MQZ A;  1BBU A;  3QNE A;  2UXC L;  4HJA A;  4A3J G;  1KAB A;  2MO1 A;  1XNR L;  3ZJY C;  1RDP D;  2UUA L;  3A5Z B;  1ILP A;  2EIF A;  4HR7 B;  1I3Q H;  4RFB A;  4JV5 Q;  1Y8P B;  1O78 A;  3NEL A;  4LVM A;  1DCZ A;  1X32 A;  1TWA H;  1CKO A;  3B6Y A;  3KDF A;  3HRI A;  4DV4 L;  3T51 B;  5FK9 C;  2A6H D;  3CAM A;  4HJ5 A;  1JR0 D;  1STH A;  4C3H H;  4APV A;  5EBD A;  4LVJ A;  2RKS A;  2KUM A;  2HT1 A;  3R93 A;  1CA5 A;  1Y14 B;  4DV0 L;  1PH1 A;  3WOE A;  3S2D B;  4L5Q A;  5IYD G;  3NXW A;  3FEW X;  4F7X A;  4JYA L;  2QDL A;  3HOY B;  2N49 A;  1Q1B A;  2LKV A;  1KRT A;  3VR6 A;  1SDF A;  1X9N A;  4IOA A;  4J8Q A;  4BY7 H;  1FYF A;  1C7Y A;  1HH2 P;  1YEZ A;  1EOT A;  4WJ3 M;  1SNM A;  4DF7 A;  2F0V A;  1CZG A;  4KTA A;  3H09 A;  1JJG A;  2R3Z A;  1K8G A;  4DR3 L;  4A3G B;  1NY4 A;  2Q5H A;  3PUV A;  2MGS A;  3S2D H;  2RDF A;  5IGE A;  3J81 E;  4BY1 H;  1UE1 A;  1WU7 A;  4KHP Q;  1BIA A;  2L55 A;  1K8M A;  2K01 A;  4P74 A;  1PHJ A;  1SFO B;  4TVA B;  2ZT9 C;  3NWS A;  4YWM A;  2QEX A;  1U5K A;  4BXX H;  2WAC A;  4RH6 A;  3NBH A;  4GKJ Q;  4LF6 L;  3BDO A;  1QE6 A;  3CXC A;  3A8I E;  4A3G H;  2ZGW A;  1D1I A;  1NR4 A;  4YWK A;  3W1G A;  1GJX A;  1AH9 A;  2DTI A;  2ZIO A;  5C44 H;  3I90 A;  1B70 A;  2DDZ A;  1YFT A;  4JI7 L;  4OO1 G;  1RKN A;  2BH2 A;  4YDQ A;  3S16 H;  1Q81 C;  2X6L A;  5HUR A;  1UE5 A;  4I7Z C;  1B50 A;  4OWW B;  4H02 A;  1PH5 A;  4QIW B;  4OIK A;  4FVM A;  3RUZ A;  1HJP A;  4DV7 L;  4KQE A;  1SYF A;  4LF5 L;  4OWT B;  2CFM A;  3L4G A;  3E3X A;  1JT8 A;  4IUU A;  1EU4 A;  2JSO A;  2OTJ A;  1ZEQ X;  2FJ2 A;  3T1H Q;  3AU7 A;  1JWS D;  2EE1 A;  2Z0S A;  1ZYR C;  2SEB D;  2ZIM A;  4C1N K;  4XTX A;  4CBV A;  1L1O B;  1K73 C;  1ENF A;  3J7A V;  4YCW A;  5I2X A;  4YRR A;  3VR5 A;  5ELD A;  1F9P A;  2HHH Q;  1WD0 A;  2KCN A;  4C3J H;  1HPC A;  1Y1W H;  4PV1 C;  1QG7 A;  3HOX G;  4A3M B;  4BY7 G;  2ZXF A;  2MFI A;  4PZ6 A;  4A3E H;  4R4Q A;  1F2Z A;  3BVG A;  3SHL A;  1SLJ A;  4LF5 Q;  1KNA A;  1PRT B;  3DM1 A;  3SK8 A;  3AMU A;  3DWP A;  4IUV A;  1C48 A;  2WV6 D;  1Q12 A;  3AFQ A;  4GS3 A;  5CV8 A;  3M85 A;  1K3B C;  1XMQ Q;  1UAP A;  3MZ5 A;  3TEH A;  1CK1 A;  4GLA C;  3VBB A;  2B2T A;  2RHQ A;  1YNJ C;  4IN3 A;  2JA8 G;  2MP1 A;  3P7J A;  4DK0 A;  2B2V C;  3Q8D A;  1KL9 A;  3RMH A;  3F2C A;  5JJK A;  5AJ3 Q;  1O7Y A;  4BBR H;  3HGB A;  3SK4 A;  1W3S A;  4A93 B;  2EJF C;  2UU9 Q;  1USY A;  2EY5 A;  2JA8 B;  4RDX A;  2MHV A;  3I4M G;  4AYB B;  4HWS A;  1RHP A;  2QHS A;  3S17 B;  4YRG A;  2HUG A;  3K59 A;  2C7I A;  2ZNJ A;  3ICA A;  4KKT A;  1IYU A;  3F2B A;  1EOV A;  2R93 B;  2I5L X;  2F0W A;  1CQF A;  1LTS D;  4LF8 L;  3E9H A;  3CW2 C;  4HIK A;  2VB3 X;  1UEB A;  3ULP A;  2F0U A;  4XQJ A;  2B63 B;  4NW2 A;  1S5D D;  5GAD C;  4GNX B;  3V8J A;  3I7F A;  1VQE A;  5EPL A;  3HOX B;  2CGH A;  2VQE Q;  2HCI A;  1UE6 A;  5FLM H;  4TWA A;  4RQE A;  2VQE L;  1T5E A;  4BS9 A;  4DV0 Q;  3SXH A;  1SXT A;  4XTV A;  1FYC A;  2I0Q A;  4YRS A;  3MEH A;  2DVE A;  3F2U A;  3NTK A;  4DXF A;  1SFO H;  3V2T A;  5M5W H;  2MPM A;  1STG A;  3GTG B;  3RZO B;  3BYT B;  1H9S B;  2ZT8 A;  4UP9 A;  3H15 A;  4P3P A;  3I91 A;  3IL8 A;  2TMP A;  4AIM A;  1YB3 A;  3Q24 A;  4H7B A;  3U9O A;  2ZJP A;  3HOX H;  4F8M A;  3CQZ H;  1QB5 D;  2CWA A;  4XTC S;  4DV1 Q;  1EIY B;  4A3I G;  1CSP A;  2NVY H;  4DAY A;  1MJE A;  3K6O A;  3M4Y A;  3HOV H;  1FNV A;  5BR8 Q;  3CC4 A;  2JA5 H;  4BA2 I;  2E2H H;  3HOV G;  3P1H A;  1T9H A;  5M5X B;  1C0A A;  2F0D A;  1TQO A;  1SE2 A;  1B7Y A;  1TS4 A;  3S16 B;  3PIP 3;  2DEQ A;  2R61 A;  2WII B;  4RWS C;  1PRT F;  1FJG Q;  4R4T A;  3PUW A;  1KMN A;  1GO3 E;  3FKI G;  4JBJ A;  1PYW D;  3REX A;  5CGK A;  2B2W A;  4K2K A;  1KAA A;  1O7I A;  4HTH A;  2F4V L;  3H3V C;  3MAQ A;  1BQQ T;  4H0L C;  5A2Q E;  3I4L A;  3TZD A;  1IYJ B;  2Z6K A;  1VQJ A;  4K14 A;  2B3G A;  2Z4I A;  1PFN A;  1RF2 D;  2Z8L A;  4L5R C;  1QWY A;  2E2D C;  4Y7N B;  2OQ0 A;  3NSW A;  4DR1 Q;  3CP0 A;  2PW5 A;  1Y1W B;  4DV5 Q;  3BDL A;  2CJB A;  4BXX G;  2VS1 A;  1V1O A;  4CDD C;  1AE2 A;  5ELB A;  5FO9 B;  4HED A;  2Z4H A;  4YRE A;  1JB7 A;  2IL8 A;  1EFI D;  2HCC A;  3MTS A;  2LY7 A;  4RA8 A;  2ARS A;  3KBG A;  2SDF A;  3QOJ A;  3HXV A;  4A3K B;  4IUP A;  1S5E D;  1Z7M A;  4C2M H;  4R4O A;  3G71 A;  4A3B G;  3J80 c;  5FLX c;  2IY5 A;  2WKC A;  3KOJ A;  3S1M B;  4LVI A;  5IT9 E;  3EVQ A;  3GTO B;  3D4W A;  1SNQ A;  3LNN A;  4DV6 L;  2VNU D;  3CD6 A;  2UUB Q;  4DR5 Q;  3LGJ A;  1DOK A;  2IHE A;  5KRU A;  1RIQ A;  1VMC A;  4U67 3;  2ZTG A;  1I5F A;  3D3R A;  3TP5 A;  3BFM A;  4K8I A;  1MSG A;  4BW9 A;  4B3T Q;  4DNR B;  2PNR C;  1PXU A;  1WTV A;  1PH6 A;  1CHP D;  2A8E A;  2NBF A;  4QCL A;  2QF7 A;  5L37 A;  3FVQ A;  5FOB B;  1PYB A;  3U50 C;  1LT4 D;  2YTY A;  1NYR A;  1IBK L;  2L11 A;  1ASY A;  3DSQ A;  1ILQ A;  1VQC A;  2YYZ A;  1EEI D;  4IZ8 A;  4TQU S;  1ENC A;  1YNN D;  4A3J B;  3M4Q A;  3A5Y A;  3ERQ A;  3J80 E;  1XTC D;  3SEB A;  2ZXO A;  3PSI A;  3RNU A;  4LNS A;  2K03 A;  1YBY A;  3CPF A;  2B63 H;  4P73 C;  2NVX B;  5C4X B;  3MXN B;  3OW7 A;  5C6A A;  1FVI A;  3EJI A;  3I4N B;  4G85 A;  4YRP A;  1F2L A;  2F0F A;  1GOZ A;  1SYB A;  3G6J B;  4LK1 C;  4P3O A;  4TVA A;  1HFN A;  1ASZ A;  5K36 G;  3D4D A;  5T1G A;  1G5I A;  2ZZF A;  3IKL A;  3J7A 5;  3NBH B;  1GGM A;  2RF4 A;  4JI7 Q;  1MSH A;  3SR1 A;  4JYA Q;  2P5Z X;  4C3J G;  4X62 Q;  3HXY A;  1BCP C;  5IGF A;  3TS2 A;  1Z7N A;  5H1S E;  1JC7 A;  5JEA J;  3ULL A;  3CC2 A;  4DUZ L;  3VYT A;  3E6Z X;  1TWC B;  3DXJ C;  4ZYS A;  5EPK A;  2B2W C;  2ZTD A;  1I50 H;  3CQZ B;  2B2U A;  5EQ0 A;  3V8K A;  3ERR A;  2PCF B;  4ZAI A;  3L1A A;  2FFK B;  4IOC A;  1A3V A;  4PMB A;  2PMZ B;  2EZV A;  1TT2 A;  5EAY A;  1SRU A;  2RBM A;  4WJ4 A;  1JE4 A;  5C4J B;  3C46 A;  2ZT5 A;  4X5O A;  2GVA A;  2HQE A;  3CRL C;  4BA1 I;  2K4K A;  2YTV A;  2EYJ A;  1DON A;  3RKX A;  1KD1 C;  3TRZ A;  3QR8 A;  2KEN A;  3CMA A;  5JEA H;  3MEF A;  2G9H D;  2SNM A;  2Y0S B;  4FNF A;  2EY2 A;  1EU3 A;  1XMO L;  1IW7 D;  1NE3 A;  1I94 L;  2JXM B;  2AMC A;  4PG3 A;  1Y69 U;  2DXU A;  2AKW B;  2DN8 A;  1F9R A;  2Q2U A;  1CSQ A;  2I4L A;  3A32 A;  1S3O A;  4OL7 A;  1J9O A;  3T4A C;  2Q7H A;  4XYO A;  2UUC Q;  1WD1 A;  1QNU A;  2VL6 A;  1QJO A;  4DPG A;  3D6C A;  2RHQ B;  3FP9 A;  2A68 D;  1IBM Q;  1JE5 A;  1PYS B;  2L0C A;  4NXM Q;  4DR1 L;  3FRP B;  1EQT A;  2DGY A;  1KC8 C;  1T5X D;  3CC7 A;  4K5X A;  3JAM L;  4YHH Q;  1DOM A;  3PUY A;  3VYS A;  1DZ1 A;  2XWJ B;  3S1N B;  1I4H A;  3S1R B;  2EJM A;  1XTD A;  1H9K A;  3H94 A;  4ME5 A;  1Y1V H;  2A5H A;  4DAM A;  2F52 A;  2J3L A;  2LXK A;  3MC0 B;  1D7Q A;  3Q0A A;  1PFM A;  3IAL A;  4EGV A;  1BCP B;  4ILW A;  1HUN A;  4WI1 A;  1QOH A;  4GN3 B;  4L5S A;  4JI3 L;  1EIH A;  1VMP A;  3QJY A;  3TQY A;  2RDG A;  1OXX K;  1SNC A;  3TME A;  4NXM L;  1H95 A;  3L7Z C;  4XU1 A;  1RIP A;  2EJG C;  2MJ8 A;  2HIX A;  1SND A;  1JOR A;  2CH4 W;  2DJZ A;  4OP0 A;  4E51 A;  4K0K Q;  2JJQ A;  1HA6 A;  4MZ9 A;  4A3K G;  4DUY Q;  1IW7 C;  5COY A;  5CMD A;  4IPH A;  1MD2 D;  2DU7 A;  1HFG A;  5DNF A;  3QO5 A;  4X65 L;  3ITP A;  3HOU H;  1D5M C;  4POG A;  3IRB A;  4LNQ A;  1ICW A;  2N55 A;  2VQF L;  1LTB D;  1X55 A;  4DV3 Q;  2B2T C;  2PPB C;  2K50 A;  1M8A A;  1B2T A;  4V0B A;  1CUK A;  4KI0 A;  4RMF A;  1H4S A;  3I4N H;  1X56 A;  1QF6 A;  3HXU A;  3M3Y B;  5IIF A;  1H9S A;  2JN4 A;  2JA7 H;  1JCK B;  2QGQ A;  4ULL A;  4YRO A;  1EQQ A;  2DJF C;  4PMW A;  1N8R C;  3MFY A;  3UGQ A;  1EYD A;  1LUZ A;  1STE A;  2FMM A;  2L9H A;  4MIU A;  2BDO A;  4OO1 I;  1AFP A;  4JI6 L;  3SK5 A;  4A3C H;  2CW0 D;  5C0X H;  4GOP B;  3S17 H;  1Q90 A;  1PA6 A;  2C5C A;  3HFZ A;  2D0P A;  2Z9H A;  1KHI A;  1V8Q A;  3K8A A;  3FJP A;  4GLV B;  2F3V A;  2ZM6 L;  3G4S A;  4ZIB A;  2EYF A;  3LX0 A;  1TWG B;  3I2Z A;  4H2X A;  3CCQ A;  5T1I A;  2E2I B;  1UE7 A;  2XGT A;  1D1K A;  4CGY B;  4IFD H;  3RKW A;  1PZI D;  3M9B A;  4KR2 A;  2D5D A;  4IUT A;  4KR3 A;  3FDT A;  4H2V A;  5D3D A;  1EIF A;  2XRS D;  3K58 A;  1XNR Q;  3QWN A;  4DR2 L;  4JPB W;  5IP9 G;  4FF1 A;  1SMX A;  4HSV A;  5FJ8 H;  1YJN A;  1JJ2 A;  3VA7 A;  3ICE A;  3RZO H;  4YIJ A;  4GN4 B;  5GRO A;  1B9N A;  1K0R A;  4DNT B;  1WPY A;  3I55 A;  2YU9 H;  4XTW A;  3WWV A;  1DJR D;  1F77 A;  5K36 H;  1ADY A;  3IKJ A;  5I2Y A;  3KJP A;  5LMN W;  1EY6 A;  3OWE B;  1NNH A;  1VQZ A;  1ET6 A;  3UGT A;  3HOZ B;  1XMO Q;  1ZKO A;  5IGD A;  2DU5 A;  1KRS A;  4K2L A;  2EY6 A;  3HOV B;  1CKN B;  2N3S A;  4X64 Q;  4RHR A;  3X3N A;  2QA4 A;  4WFN 3;  1N33 L;  3QO8 A;  3MFG A;  4GKK Q;  4LFA L;  4IUQ A;  2F0E A;  2NVQ H;  1PTO H;  2PZT A;  1DGS A;  4PQX A;  5LL6 S;  5JOB A;  2E2J B;  3BJU A;  4HWR A;  1YNX A;  3IG2 A;  3KK7 A;  1X3E A;  2NN6 H;  3CKI B;  5JAV A;  4HIO A;  2DKG A;  1CHQ D;  4QF4 A;  4A93 G;  3PF5 A;  4FP5 D;  3I4O A;  4JI4 Q;  5C4H A;  4Q0F A;  1LT6 D;  1N33 Q;  3UDG A;  5IGG A;  2FYK A;  1OO9 B;  1X65 A;  5G3L F;  1N34 Q;  2ODR D;  1GXD C;  2PME A;  4XU2 A;  4WOR A;  3PV0 A;  2CIM A;  1EWI A;  1LAB A;  3NEM A;  2ZXP A;  1FGB D;  2R93 G;  1LT3 D;  1GVP A;  4AQY Q;  5C53 B;  4JBW A;  2ZCE A;  3GTO H;  2A6E C;  1D6E C;  2AUK A;  1HQM C;  4J6H A;  3RKY A;  3GQB A;  1NR2 A;  1E2W A;  1YHB A;  3I4M B;  1OXS C;  1U4M A;  4DK1 A;  3HFV A;  4BY7 B;  2ZIN A;  3URY A;  2E8G A;  2V1C C;  3NEN A;  2DZ9 A;  1LAC A;  4GNX A;  1FGU A;  1S5C D;  4L87 A;  5K1P A;  1WTX A;  1IL2 A;  1F9Q A;  1E2Z A;  1PZJ D;  5EGT A;  1D5X C;  4M8A A;  1E1O A;  4NXN Q;  4HJ7 A;  2EYP A;  4A3L G;  4QIW E;  3FKI H;  1Q7Y C;  4DUZ Q;  1X3Q A;  2Q2I A;  3KBX A;  2UXD L;  2R7F A;  3KF8 B;  1XJV A;  1NJ5 A;  4LF4 Q;  1E7Z A;  4DV3 L;  1BKB A;  4RGN A;  4ZLT F;  1JIC A;  4G4K A;  2IJ0 A;  4CJ1 B;  1OXT A;  4LF8 Q;  3A5Z A;  1M4V A;  1VCI A;  5M3M H;  3VQY A;  1VQ5 A;  1TS3 A;  2PNH A;  3FPU B;  4XEO A;  3TBI B;  5G3L D;  1Q82 C;  4IFD G;  1PZK D;  1HNX Q;  2K7V A;  1WQW A;  3HOZ G;  3FPP A;  1JB3 A;  4OO1 H;  3RL6 A;  2NVY B;  2HIV A;  4H2S A;  3UH0 A;  4YRM A;  1ZYR D;  1B76 A;  2ZT6 A;  3I56 A;  4A76 A;  3GV3 A;  1LTI D;  3A5U A;  2WIN B;  3TP6 A;  3KDF B;  3NTI A;  4LUZ A;  1SYC A;  4OX9 Q;  1MKH A;  1B3Q A;  2YTX A;  1SER A;  1E24 A;  4QMG A;  4A3G G;  4B3R Q;  1JWU D;  1A62 A;  1WOC A;  4LF9 Q;  5C4J H;  4UPA A;  4QUF A;  3DWA A;  2E5A A;  1ML0 D;  3ND8 A;  2A1A A;  3L3O C;  3EA6 A;  2ZTC A;  4WRD A;  1MGS A;  2E2J H;  4G7O C;  3MXP A;  1CZW A;  3RZD H;  4NP5 A;  1TWF H;  2IW3 A;  3RD4 A;  2NVQ B;  3VR2 A;  3HOY G;  5EKI A;  4YRQ A;  3DMU A;  4FXG C;  2XIW A;  4A3L H;  4KY5 A;  3HKS A;  4XIG S;  3D4R A;  3P8V A;  1K28 A;  4I7A A;  2ART A;  3S1Q B;  2ICI A;  2ZJR A;  1QVF A;  2E64 A;  1O7Z A;  3ERS X;  4R4C A;  4IJH A;  1VQ7 A;  1EIY A;  4IPG A;  2J0T D;  3HS0 C;  2F0J A;  1KQS A;  1LV9 A;  1XWE A;  2ZXR A;  4YRI A;  2E76 C;  3J7Z C;  3NTH A;  2HDM A;  5I6Y A;  3IKM B;  2CVR A;  1EFW A;  4DR7 L;  4TQF A;  3NK9 A;  4TKO B;  2XTI A;  4N8F A;  2J7Z A;  4NKL A;  4N9P A;  5EKK A;  1K9M C;  3WQZ A;  3KF6 A;  2M00 A;  1FL0 A;  1X2H A;  1HZ9 A;  4IAL A;  1LTG D;  4LMQ D;  3BDC A;  1XXG A;  1ESF A;  4O42 A;  4C3I H;  1PH7 A;  4EQN A;  2ALY B;  3L2P A;  4YRN A;  2DY8 A;  1GKH A;  4CH4 A;  1N36 Q;  1EL0 A;  1D8L A;  2VQF Q;  3A55 A;  4HCE A;  2BE5 C;  3H6M A;  2F0L A;  3EFS A;  3UDX A;  4YRK A;  1EYA A;  1PV4 A;  4Y52 H;  4LW1 A;  2DJG C;  4H2Y A;  5F5W A;  4JI5 Q;  1HQR D;  3ERO A;  1UWV A;  1JJC A;  2E5L Q;  4K0K L;  4PZ8 A;  1CI3 M;  1SBB B;  2NN6 I;  1P8L A;  1PH3 A;  4GZY C;  4CDF C;  2F3I A;  3BZD B;  1G8Z D;  3VA5 A;  5C3X A;  1G6Z A;  1EVL A;  4CKB A;  1EY4 A;  5JEA G;  4X62 L;  4R9W A;  2QHU A;  1W6J A;  1AZP A;  5FO8 B;  2LXJ A;  1NBW A;  2VXW A;  3M7G A;  3J81 i;  4J15 A;  3D6W A;  4OIJ A;  2K04 A;  1R4P B;  2KQ3 A;  2ZTE A;  4TVW A;  2K75 A;  3A7A B;  3K5N A;  4S3S A;  4B3M L;  4X6A H;  2ZR3 A;  4YYE A;  4JI2 L;  1BOS A;  3CU7 A;  2F0K A;  4ZKB B;  1W2B A;  1YFS A;  4JI5 L;  1HHV A;  1G29 1;  3BG3 A;  2I46 A;  5LL6 X;  1I4R A;  1KOG A;  3RF1 A;  1K0S A;  2K33 A;  5CV9 A;  2N88 A;  3JC6 6;  4YCV A;  1CQV A;  2Y0S G;  4KHP L;  1BR9 A;  1FD7 D;  2PI2 A;  2RHS B;  5E4W C;  1N36 L;  3S14 H;  4JOI A;  1EYC A;  4FF3 A;  2PZU A;  1I4Q A;  5ELN A;  2ZJQ A;  2AHO B;  3I8Z A;  1STN A;  3OTO L;  1R9T B;  1CT1 D;  4N9T A;  3VQW A;  1KAW A;  2A8V A;  1WYD A;  4KY7 A;  4A3I H;  1SAP A;  1EEF D;  4TVY A;  1BUV T;  1CTM A;  1RD9 D;  1VQA A;  3A8K E;  1WNL A;  3VYR A;  1KMM A;  1HNW L;  2AMC B;  2PQE A;  2K5Q A;  3OD1 A;  4K88 A;  4KK7 A;  1V43 A;  3ND9 A;  1MIU A;  4J1M A;  2B2Y C;  2BOS A;  3IAY A;  4DAY B;  2VB2 X;  3HOW G;  4CS3 A;  4A4I A;  2QEJ C;  5IGC A;  5EKL A;  1EYG A;  3HXZ A;  3RN2 A;  2F0G A;  5KIX A;  3NWT A;  3HOU G;  4BBR B;  3STB D;  2O5J C;  1VQ4 A;  4IPC A;  1VQF A;  1ATI A;  2DUD A;  3DM3 A;  1LTR D;  4JBM A;  5IOC A;  1WI5 A;  1IBL L;  1U9R A;  2ASB A;  3S1N H;  2F4V Q;  5C4X H;  1NJ8 A;  2HDL A;  2MUY A;  3ULJ A;  1HNZ Q;  3CMQ A;  3EFX D;  1SJE D;  3D8G A;  5C4X G;  3R07 A;  2P0L A;  4N8X 1;  1IBM L;  3MA2 B;  3NPP A;  3A74 A;  4MNO A;  4A3F G;  2IT1 A;  1YGB A;  2Z6K C;  4B9X A;  1EQV A;  4HID A;  4P72 C;  1I4P A;  3A7R A;  1PDQ A;  1EIG A;  1V1P B;  3A7L A;  2D0O A;  2JA6 H;  4A3B H;  1A2U A;  1NNX A;  3PQI A;  4XXE A;  2K5H A;  2JP1 A;  3H0G B;  1FR3 A;  1U4L A;  1L1O C;  2NZ1 D;  4HA8 A;  5A35 A;  1EY7 A;  4IO9 A;  2K5W A;  3SK6 A;  3PF4 A;  3M7N A;  4UP7 A;  2NN6 G;  5CYU A;  1Q8I A;  3NUC A;  5IOD A;  1WTP A;  1EWC A;  1YIT A;  4O0A A;  4XT3 B;  4X66 Q;  2NZH A;  1PH9 A;  5C0X J;  1NMG A;  2JA6 B;  1CFM A;  4A3B B;  4CH6 A;  4RCO A;  4X66 L;  1YJW A;  3ER0 A;  4DV2 L;  3GTM B;  5BN5 A;  1SR3 A;  2JQO A;  3F2D A;  3TN2 A;  5LMU L;  2LFN A;  4LVK A;  1LTL A;  4DV2 Q;  3D31 A;  2JA5 B;  2C35 B;  4R1J A;  4KMU C;  4YPF A;  2KVM A;  3GD7 A;  3W2D A;  4GOP C;  1Y1W G;  2EYO A;  1EY9 A;  3HTZ A;  3NQT A;  4X3U A;  4QL5 A;  4A75 A;  4CH3 A;  3UI2 A;  5DM7 3;  1NYQ A;  2J3M A;  2IWH A;  1GM5 A;  3L4G B;  3W3A A;  2PZW A;  3PUX A;  3U4Z A;  5IP9 H;  1IXR A;  4NDX A;  3FKI B;  1V1P A;  4LFA Q;  4HSP A;  1D2B A;  5IWA L;  2P5I A;  3SE0 A;  4AQY L;  2SOB A;  2F0P A;  3EFR A;  5FJ8 G;  3P8Y A;  1Y8O B;  1Y1V B;  2AWO A;  3V7C A;  2A74 C;  2OQK A;  3V7R A;  3DEP A;  2FXQ A;  2QHV A;  1X3F A;  4IQZ A;  2BDN A;  4QQB X;  4HVC A;  1B70 B;  2PW7 A;  1AEX A;  2B2U C;  5IT9 c;  5I6W A;  5IY0 A;  4A3I B;  4XU0 A;  4UY8 C;  1EY0 A;  2Q5I A;  1HNW Q;  2L1B A;  2RSO A;  4CJ2 C;  4H44 C;  4EX5 A;  4YP0 A;  4WF2 A;  4NMZ A;  1PH2 A;  4RQF A;  3CCR A;  2E3C A;  4O2D A;  1GHJ A;  2XVS A;  4C2M B;  2KOL A;  3DLL A;  1K8O A;  1M90 C;  1JOO A;  1S40 A;  1AZQ A;  5FLX L;  1TKW B;  5ELE A;  1PRT D;  4KHV A;  1QNK A;  4B3S Q;  1BF4 A;  4DXG A;  1L1O A;  3D0F A;  3K81 C;  1J5W A;  1JOK A;  1JMC A;  3H3V H;  1Z47 A;  5CV7 A;  2CHB D;  2DNE A;  2L4N A;  1LTA D;  4QUC A;  2ES2 A;  2PMF A;  4C3H B;  3RIR A;  1IZ6 A;  2B63 G;  4IUR A;  1K3R A;  5C0X I;  5K5P A;  1L0W A;  3W3S A;  1EWH A;  5LMN Q;  3E0J A;  1I6H H;  4PZ7 A;  1PYS A;  3HOY H;  4DR4 Q;  1KLG D;  5JVG 3;  3OTO Q;  1OXU A;  2A6H C;  1FJG L;  2B8F A;  4YRT A;  4AYB G;  2VY3 A;  3GTP H;  5C3E G;  2MNA A;  3UE0 A;  3OYY A;  2JA8 H;  3I73 A;  3HKZ E;  2KA7 A;  4OON A;  5C4Z A;  1QVC A;  4HMJ A;  3BYY B;  2OXP A;  4R4I A;  5J39 A;  3G6E A;  1RCV D;  4BY1 B;  2JEB I;  3A54 A;  1A6X A;  3BVZ A;  3T56 B;  3UE1 A;  1SRY A;  1QIL A;  3RAC A;  2Q2T A;  1SMY C;  4LFB Q;  2IX3 A;  3PGZ A;  4P75 A;  1M1K C;  3GTM H;  5JJI A;  3LSQ A;  1SEB D;  3A56 A;  2EJF A;  4DAP A;  1CM9 A;  4A3D B;  1TWC H;  2Q8T A;  2BA0 A;  1H9M A;  1DXM A;  5KYI A;  4KY6 A;  3K5O A;  2WB1 E;  4IFD I;  3A7A A;  1EUJ A;  4LF6 Q;  2AKW A;  3S2H H;  2H1E A;  5GAG C;  1HR0 W;  4X65 Q;  4EQ5 A;  1N32 Q;  4M1U B;  2KHI A;  1JJC B;  3GTK H;  4ZTZ B;  2E74 C;  2PQA A;  5M3M G;  4JBK A;  3QIA A;  4A3M G;  4TQD A;  1FNU A;  1YZ6 A;  5F2D A;  4V19 0;  3K7A H;  4KKS A;  4XT1 B;  4DR7 Q;  4RGO S;  3REU A;  2RHS A;  3O13 A;  4JW0 A;  1NSN S;  2I4M A;  4OWX B;  2NVT B;  1SN8 A;  4R8I A;  3DEO A;  3S2H B;  2K5V A;  5DM6 3;  4DUY L;  3GTL B;  2F3W A;  4NCX A;  4JG2 A;  1KIX A;  3GO5 A;  4UP8 A;  4QY7 A;  3F8T A;  2PYK A;  1IBK Q;  4GOP A;  3VYU A;  4IJL A;  4JI8 L;  1KDB A;  4HN7 A;  3VQX A;  1H9R A;  4DFA A;  4A3M H;  4OEM B;  1SYE A;  2B2V A;  4A3E B;  2WB1 B;  1EZ6 A;  3HY0 A;  3S1R H;  5CBE E;  2R92 G;  2K52 A;  5ISR A;  1B8A A;  1Q8K A;  3KYH C;  4DU9 A;  2EPB A;  3SGI A;  4JI0 L;  1PLF A;  2VUM B;  4DNI A;  1WJJ A;  2M9V A;  4K8J A;  2RVL A;  2EQS A;  4B9W A;  1USY C;  1X3P A;  1A63 A;  4Y7N H;  2LMC B;  4ZQ3 A;  3JAM c;  2EL9 A;  4H2U A;  4LAA A;  4KN7 C;  1LYL A;  5HGQ A;  3TSS A;  3HG9 A;  3BVM A;  2A73 B;  2E10 A;  4XTY A;  1C8C A;  1FNW A;  3OSO A;  3CCJ A;  3T1H L;  1VQD A;  4O1N A;  1E0B A;  3Q22 A;  4CKE A;  5C0X G;  4KV6 A;  4ALP A;  3X3M A;  4LWC A;  1I6V C;  1EQR A;  4X64 L;  4A3K H;  1X01 A;  1EY5 A;  2E41 A;  4DA2 A;  3U58 A;  5IYD H;  3EIV A;  1TWA B;  5D65 A;  1SSO A;  2YV5 A;  1SMY D;  1CKN A;  4DAV A;  4GLX A;  1LLR D;  1VF7 A;  1GUO A;  4BWA A;  1TWH B;  1WCM H;  4ZRZ A;  3HOW H;  3JAM E;  2F0Q A;  5E4X A;  3E5S A;  1KDA A;  5TSS A;  1IKL A;  4FDB A;  3V05 A;  1YI2 A;  2R7Z B;  5FLX E;  4EVO A;  4C3I B;  2ZR2 A;  4H2T A;  2ENB A;  1U4R A;  1Z9F A;  2A68 C;  2G5D A;  4F88 A;  5IYC H;  3KLS X;  3G48 A;  2WAQ B;  3SDZ A;  3PO2 B;  4BBS G;  2RQX A;  1LT5 D;  3TP8 A;  4B3M Q;  3RLN A;  4A3J H;  2QIL A;  2K32 A;  4EO4 A;  5C5L A;  5AFW A;  1YJ9 A;  2CWP A;  2UXB L;  4Q15 A;  4IUN A;  2H4O A;  1B44 D;  1EZ8 A;  4DKA C;  4AYB E;  3U9S A;  4H13 C;  3AFP A;  4NXN L;  2GVB A;  1HXY D;  2CKZ B;  2D62 A;  1Y1V G;  1TY2 A;  1SRO A;  1OTC A;  12AS A;  3S15 B;  3PCO A;  3PO3 B;  2L15 A;  3S9W A;  1N32 L;  2YU9 B;  1A2T A;  3K7A B;  4YRC A;  3MXN A;  3C1E A;  1X54 A;  1WTR A;  1I50 B;  3UDF A;  3HOZ H;  2B2Y A;  4P3N A;  4P75 C;  2UUB L;  4DV5 L;  4CHT B;  4KD4 A;  1HRJ A;  4RKL A;  3BS1 A;  2UU9 L;  5C44 B;  3U4V A;  4HJ8 A;  1Q46 A;  4RHS A;  5KNB A;  2AUJ D;  2BE5 D;  1UNS A;  1NJI C;  2JA5 G;  1AP0 A;  1VQG A;  3VR4 A;  4RGM A;  1HTL D;  2O2L D;  1STA A;  3TUP A;  2I07 B;  5KND A;  1ESR A;  1STB A;  5IE8 A;  2IPK D;  3KLS A;  2KHS A;  3GTJ B;  3T16 A;  4B3S L;  2C9O A;  1XPR A;  2D2C C;  5IYC G;  2I5H A;  1HUM A;  4B3R L;  4LFC L;  2ZZE A;  2PMZ E;  3J80 L;  3DWQ A;  3WOF A;  1X2G A;  4U68 A;  4WJW A;  5GAH C;  2Q7E A;  5K1X A;  4JK1 C;  1WCM G;  1AN8 A;  3RUX A;  4MHE A;  1I3Q B;  2F0S A;  5IP7 G;  4RCN A;  1L0X B;  3HY1 A;  2XNA C;  2RDH A;  2E1H A;  2EY1 A;  1HCZ A;  3R3O A;  3W5O A;  4H2W A;  1BNZ A;  1GD7 A;  1LO5 D;  4YCU A;  1P16 A;  2JA7 G;  3KLR A;  1Z7T A;  2EOT A;  4OEL B;  3P20 A;  4DGZ A;  2F0O A;  4BWG B;  4QJF A;  1G2S A;  4ODG A;  3CCL A;  2JE6 I;  2WAQ E;  2OCE A;  2SNS A;  5J1Z A;  4HIM A;  2Z6B A;  2NTT A;  3V8L A;  4DR2 Q;  4RG1 A;  3EBE A;  4A3F B;  3PIP A;  4K5W A;  1VQO A;  3BU2 A;  1QUQ B;  4UDU C;  2OTL A;  1B4O A;  1Z6H A;  1B53 A;  4XTZ A;  2K5D A;  1I4G A;  5CR3 A;  1VS0 A;  2AQ3 B;  2AWN A;  1TWF B;  3MXG A;  3OWF A;  1CKM A;  1X6O A;  2NYZ D;  3FHW A;  1ADJ A;  1H9J A;  1U0L A;  2K14 A;  2BH8 A;  2QW7 A;  2F0H A;  4BBR G;  3HOU B;  1N9W A;  4JVZ A;  1G6P A;  5FKA C;  2R7Z H;  5E1F A;  3PO2 H;  3QB3 A;  1QVG A;  2R6G A;  1F9S A;  1VQN A;  4DV1 L;  1HZA A;  4X3K A;  2NZO A;  5I9P A;  1VQB A;  4XDX A;  2X69 A;  5I9O A;  1VQL A;  2XWB B;  2Z1C A;  4FYD A;  4CDE C;  4PNY A;  4FXD A;  2UXB Q;  3GTP B;  1W66 A;  4K86 A;  4P71 A;  3BZK A;  1XX8 A;  2L12 A;  2GA4 B;  2JA7 B;  5DAU A;  1H4Q A;  4LF7 Q;  5KNC A;  4YRJ A;  2HNI A;  3GTQ B;  1A3T A;  2CCZ A;  2MQH A;  2N78 A;  5A2Q L;  3M4O B;  3MWY W;  2A6E D;  4YY3 Q;  2ALY A;  1OXV A;  1PTO B;  1YVC A;  3OPO A;  1TR5 A;  3E0E A;  3H91 A;  4XQN A;  4JI3 Q;  1PTO F;  1HZC A;  2CH4 A;  2Y0S E;  2RCF A;  1BXT A;  2QCP X;  4B08 A;  2I4O A;  5M5W B;  3LWE A;  1V1Q A;  5JPN C;  2R92 H;  2R7D A;  3GDE A;  4HWP A;  4IPD A;  1NAP A;  1ENA A;  4ZUI A;  1EY8 A;  2BCO A;  2E2H B;  3TEH B;  3W1B A;  2NS6 A;  1HNZ L;  3RLF A;  3CCU A;  5IT9 L;  1H4V B;  1L2F A;  2D9U A;  1LTT D;  1PRT C;  5GQO A;  11AS A;  1U4P A;  3K5M A;  4ME3 A;  4DV4 Q;  2JK8 A;  3RGL A;  5AJ3 L;  1YNJ D;  3VQV A;  4BBS B;  3PO2 G;  4KJO A;  1D5Z C;  3KUP A;  3NBI A;  1QZG A;  2WAQ G;  4G84 A;  4G57 A;  5IYB G;  1VF5 C;  3AQQ A;  3STB C;  1WTQ A;  4FF2 A;  3V96 A;  2UXC Q;  1K83 B;  2NB0 A;  3I70 A;  1UUP A;  4OGQ C;  4CDC C;  3PO3 G;  1GUW A;  2EJ9 A;  5D14 A;  1PTO C;  2WP8 J;  4JOI C;  3JAM i;  1II3 A;  3HKZ B;  4OXP A;  3RR5 A;  3TP7 A;  3T1Y Q;  4TTV A;  1YHQ A;  2R93 H;  3IFD A;  4CH5 A;  3C3L A;  1R9T H;  1KTK A;  1UEA B;  2LS0 1;  1SES A;  1A8V A;  3NE5 B;  5HGT A;  4TSS A;  5C51 B;  1JOQ A;  2TSS A;  2VUM H;  4PHC A;  3I3C A;  4XYQ A;  1HZB A;  2F4I A;  4MTN A;  1DYQ A;  2E75 C;  2IX0 A;  2N8N A;  4JI0 Q;  2CQO A;  3K80 C;  3LSS A;  2A69 D;  1J5E L;  2BA1 A;  3RLO A;  1G51 A;  3TS0 A;  1XPO A;  3NHH A;  5IWA Q;  1TVX A;  4KLK A;  5CC4 A;  3PUZ A;  5M3F B;  2ID0 A;  2K28 A;  1ROD A;  4A3F H;  3R2I A;  4C3I G;  4POF A;  5EPJ A;  5CV6 A;  2R7Z G;  2UXD Q;  2VW9 A;  1KXL A;  1BDO A;  1I4X A;  4ID6 A;  2E65 A;  5GAE C;  1BIB A;  3V7S A;  4KKU A;  4HCS A;  4A3D H;  2IHF A;  2O5I C;  2DQ0 A;  2JYO A;  4X3S A;  1WTW A;  2VUM G;  3M3Y H;  2FMC A;  3A31 A;  2J4X A;  1TS2 A;  2ZZG A;  2OWO A;  1ET9 A;  2WFW A;  3TRE A;  3Q6S A;  1XPU A;  4CKC A;  4ZUJ A;  3I4M H;  3FMC A;  2XSC A;  4FF4 A;  1B3A A;  1PFS A;  3PCO B;  1PTO D;  4A3E G;  3ZYY X;  3PMF A;  1V9P A;  1NJ2 A;  3CCE A;  2NWG A;  4HJ9 A;  2NVX H;  3F1Z A;  1STY A;  2RCN A;  3OW2 A;  1WFQ A;  3KLW A;  1QZH A;  5E3I A;  2F0I A;  1X3G A;  2EXZ A;  3KF8 A;  4PMC A;  3NET A;  2F1M A;  5C52 B;  3QTC A;  1VQI A;  3A8J E;  2E2I H;  1IHZ A;  1MBY A;  5IP7 H;  3LC0 A;  5COR A;  1A3U A;  1RJT A;  1S5F D;  3J81 L;  4IFD J;  1N34 L;  1KDC A;  2EYL A;  2GN5 A;  3M4O H;  2DNC A;  4P73 A;  5M5Y H;  1PFB A;  1G5H A;  2QKI C;  1EVK A;  1NMF A;  1LM0 A;  3J81 c;  5D3I B;  5M3M B;  2R92 B;  4JI1 L;  1Q1E A;  2WB1 G;  3Q23 A;  1H4T A;  3OMG A;  4H2X B;  2EWN A;  1R4Q B;  2IY5 B;  1XMQ L;  2KCC A;  1HA5 A;  2OEO A;  1SE8 A;  1VQM A;  4CS2 A;  2RSN A;  4LVL A;  5C3W A;  3CME A;  5BN4 A;  2ATW A;  2G9D A;  2KEE A;  3AB9 A;  3WDN A;  5KNN A;  1XNQ Q;  3TZU A;  3BZC A;  4JC0 A;  5IGB A;  1XNQ L;  5M5Y B;  4BBS H;  3KFU A;  1C9O A;  4EQP A;  2EVB A;  1S4Z A;  5JVH 3;  3K0Y A;  3L2Z A;  5KEE A;  3MVV A;  5DLQ E;  4BY1 G;  2ARU A;  4DR4 L;  4P72 A;  4YHH L;  4LF9 L;  3QO7 A;  1SJH D;  4NB3 A;  1E2V A;  1VQ8 A;  5C3E B;  5ELO A;  1KNE A;  3QG1 A;  4DN4 M;  1VQ6 A;  1HTP A;  4OLF A;  3G7L A;  3P75 A;  2UUA Q;  1IKM A;  3N52 A;  4HMI A;  1TS5 A;  3K0X A;  2NTS A;  3RZD B;  3PZC A;  4YY3 L;  2H5X A;  2Q8R E;  2V4D A;  4OHJ A;  4A3D G;  1Y8N B;  4K5V A;  1Q3L A;  1L0Y B;  2KED A;  3KF6 B;  4QB4 A;  4JI1 Q;  3GTJ H;  3J81 j;  4R8N A;  1HNX L;  3T13 A;  2B29 A;  3EQL C;  4ABN A;  2KEC A;  1O7L A;  3GV6 A;  4P2C B;  2RA4 A;  2QDB A;  4XQQ A;  1SET A;  2Q7G A;  4I65 A;  3H0G H;  4HWO A;  2WKD A;  1SE4 A;  3EN2 A;  2DTO A;  1YHA A;  1HXD A;  1O80 A;  4L5T A;  1YFR A;  5ELC A;  5M3F H;  1I6H B;  1HTT A;  5KGU A;  5J22 A;  4DV7 Q;  3AYH B;  2AQ1 B;  1E22 A;  1RL2 A;  3LWU A;  4X3T A;  5M3F G;  2KHJ A;  3TEG A;  1F2M A;  2EAY A;  1GUN A;  4RKB A;  3MEY A;  1WQ7 A;  1GHK A;  4JI2 Q;  1JWM D;  1BBX C;  2ZM6 Q;  1S5B D;  4A93 H;  2K1B A;  1B9M A;  1NUC A; 
#chains in the Genus database with same CATH homology
 2ZNI A;  1HR0 L;  3PO3 H;  4XU3 A;  3UFG A;  2K5N A;  1HR0 Q;  2QHT A;  4ZTU B;  4JI6 Q;  1Q86 C;  4DR6 Q;  1BBW A;  3CCS A;  2C8M A;  3HKZ G;  4YRL A;  5IYB H;  4LF7 L;  1VQH A;  4XTU A;  4K87 A;  2DZC A;  1WLE A;  1S72 A;  1IBL Q;  4GN5 A;  4NPS A;  1BVS A;  1A0I A;  4DV6 Q;  3MF2 A;  3UDI A;  4HWT A;  3PIO A;  4LUO A;  4LFB L;  5HY6 A;  1HC7 A;  4DQ2 A;  4B3T L;  5JJL A;  2JEA I;  1VQK A;  3M4P A;  3KJO A;  2VZA A;  4GKK L;  4XEM A;  4DK6 C;  2IX1 A;  4DR5 L;  1MJC A;  5M5X H;  1NJ1 A;  4AH6 A;  2EJG A;  1PH4 A;  4A3C G;  1VQ9 A;  2NVT H;  3AEV A;  2JA9 A;  5C3E H;  2DXT A;  2PI2 E;  3L0O A;  2KBN A;  3HXW A;  5FLM G;  3CF5 A;  4KHZ A;  1TXY A;  4JV5 L;  3T1Y L;  4DK3 C;  2KCM A;  2HHH L;  4JI8 Q;  5E7N A;  4LF4 L;  2JA6 G;  3HRK A;  3P8T A;  2DQ3 A;  2I4N A;  3HXX A;  4QGU A;  3MF1 A;  2MO0 A;  3J80 i;  5LMU Q;  2DTH A;  5BR8 L;  3G1Z A;  2PQA B;  4LUV A;  2LSS A;  2I5M X;  3H0G G;  3HFZ B;  4JCV E;  4GKJ L;  2G4C A;  2CJ9 A;  4OX9 L;  3GTG H;  1I94 Q;  1E1T A;  3S1Q H;  3H3V I;  1YIJ A;  4DR3 Q;  2A19 A;  2HQL A;  1E3P A;  4YRF A;  2ODR C;  1VQP A;  4DR6 L;  1K8A C;  1TWH H;  1PH8 A;  1PVO A;  3GTL H;  3CCM A;  2EXD A;  3GTQ H;  3CCV A;  3CPW A;  4YWL A;  3A0J A;  3A7U A;  1NTG A;  2ZT7 A;  2Q2H A;  1J6Q A;  3RN5 A;  1QUQ A;  1J5E Q;  4CS4 A;  4GNX C;  3E9I A;  4P71 C;  2E5L L;  1AE3 A;  2CJA A;  4P74 C;  3S24 A;  1K83 H;  5J3B A;  5C44 G;  3S1M H;  1NJ6 A;  3K7U C;  4HT4 A;  3S15 H;  4JI4 L;  2KCT A;  2UUC L;  1QE0 A;  3VDY A;  4Q6G A;  1B7Y B;  3I4N G;  1TWG H;  4LFC Q;  5LMN L;  3MQZ A;  1BBU A;  3QNE A;  2UXC L;  4HJA A;  4A3J G;  2MO1 A;  1XNR L;  3ZJY C;  2UUA L;  3A5Z B;  2EIF A;  1I3Q H;  4JV5 Q;  3NEL A;  4LVM A;  1TWA H;  1CKO A;  3B6Y A;  3KDF A;  3HRI A;  4DV4 L;  3CAM A;  4HJ5 A;  4C3H H;  4APV A;  4LVJ A;  2HT1 A;  1Y14 B;  4DV0 L;  1PH1 A;  4L5Q A;  5IYD G;  4JYA L;  2N49 A;  1Q1B A;  1KRT A;  1X9N A;  4IOA A;  1FYF A;  4BY7 H;  1C7Y A;  1HH2 P;  1YEZ A;  4WJ3 M;  1JJG A;  1K8G A;  4DR3 L;  1NY4 A;  2Q5H A;  3PUV A;  3S2D H;  4BY1 H;  1UE1 A;  1WU7 A;  4KHP Q;  1BIA A;  4P74 A;  1PHJ A;  4TVA B;  4YWM A;  2QEX A;  1U5K A;  4BXX H;  4GKJ Q;  4LF6 L;  2ZGW A;  3CXC A;  4A3G H;  4YWK A;  3W1G A;  1AH9 A;  2DTI A;  2ZIO A;  5C44 H;  1B70 A;  2DDZ A;  1YFT A;  4JI7 L;  4OO1 G;  2BH2 A;  4YDQ A;  3S16 H;  1Q81 C;  1UE5 A;  4OWW B;  4H02 A;  1PH5 A;  1HJP A;  4DV7 L;  4KQE A;  4LF5 L;  4OWT B;  2CFM A;  3L4G A;  1JT8 A;  2OTJ A;  3T1H Q;  2Z0S A;  2ZIM A;  4XTX A;  1L1O B;  1K73 C;  4YRR A;  4YCW A;  2HHH Q;  4C3J H;  1Y1W H;  3HOX G;  4BY7 G;  2ZXF A;  2MFI A;  4PZ6 A;  4A3E H;  4R4Q A;  1SLJ A;  4LF5 Q;  1Q12 A;  3AFQ A;  4GS3 A;  3M85 A;  1XMQ Q;  3TEH A;  4GLA C;  3VBB A;  2RHQ A;  2JA8 G;  3Q8D A;  1KL9 A;  3F2C A;  5JJK A;  5AJ3 Q;  4BBR H;  1W3S A;  2UU9 Q;  1USY A;  4RDX A;  3I4M G;  4HWS A;  2QHS A;  4YRG A;  2C7I A;  2ZNJ A;  3ICA A;  3F2B A;  1EOV A;  2I5L X;  4LF8 L;  3E9H A;  3CW2 C;  4HIK A;  1UEB A;  3ULP A;  5GAD C;  4GNX B;  3V8J A;  3I7F A;  1VQE A;  2CGH A;  2VQE Q;  1UE6 A;  5FLM H;  4TWA A;  4RQE A;  2VQE L;  4DV0 Q;  4XTV A;  2I0Q A;  4YRS A;  2DVE A;  1SFO H;  5M5W H;  2ZT8 A;  4UP9 A;  3H15 A;  4P3P A;  4AIM A;  1YB3 A;  2ZJP A;  3HOX H;  3CQZ H;  4XTC S;  2CWA A;  1EIY B;  4DV1 Q;  4A3I G;  1CSP A;  2NVY H;  1MJE A;  3HOV H;  5BR8 Q;  3CC4 A;  2JA5 H;  4BA2 I;  2E2H H;  3HOV G;  1T9H A;  1C0A A;  1B7Y A;  2DEQ A;  1FJG Q;  4R4T A;  3PUW A;  1KMN A;  1GO3 E;  3FKI G;  4JBJ A;  3REX A;  1O7I A;  2F4V L;  1IYJ B;  2Z6K A;  1VQJ A;  2B3G A;  4L5R C;  2OQ0 A;  4DR1 Q;  3CP0 A;  4DV5 Q;  2CJB A;  4BXX G;  2VS1 A;  1AE2 A;  4YRE A;  1JB7 A;  2ARS A;  3HXV A;  1Z7M A;  4C2M H;  4R4O A;  3G71 A;  4A3B G;  3J80 c;  5FLX c;  2IY5 A;  3KOJ A;  4LVI A;  4DV6 L;  2VNU D;  3CD6 A;  2UUB Q;  4DR5 Q;  3LGJ A;  2IHE A;  1RIQ A;  2ZTG A;  1I5F A;  3BFM A;  4BW9 A;  4B3T Q;  1PH6 A;  2A8E A;  1PYB A;  3U50 C;  2YTY A;  1NYR A;  1IBK L;  3DSQ A;  1ASY A;  1VQC A;  2YYZ A;  4TQU S;  3A5Y A;  3M4Q A;  3PSI A;  3RNU A;  4LNS A;  1YBY A;  3CPF A;  2B63 H;  4P73 C;  3MXN B;  1FVI A;  4G85 A;  4YRP A;  4P3O A;  4TVA A;  1ASZ A;  5K36 G;  1G5I A;  2ZZF A;  3IKL A;  3J7A 5;  3NBH B;  1GGM A;  2RF4 A;  4JI7 Q;  4JYA Q;  4X62 Q;  3HXY A;  3TS2 A;  1Z7N A;  5H1S E;  5JEA J;  3ULL A;  3CC2 A;  4DUZ L;  2ZTD A;  1I50 H;  3V8K A;  3ERR A;  3L1A A;  4IOC A;  5EAY A;  1SRU A;  4WJ4 A;  2ZT5 A;  4X5O A;  2GVA A;  4BA1 I;  2K4K A;  2YTV A;  3RKX A;  1KD1 C;  3TRZ A;  2KEN A;  3CMA A;  3MEF A;  1XMO L;  1NE3 A;  1I94 L;  2AMC A;  4PG3 A;  2DXU A;  2AKW B;  2Q2U A;  1CSQ A;  2I4L A;  3A32 A;  1S3O A;  2Q7H A;  2UUC Q;  2VL6 A;  4DPG A;  2RHQ B;  3FP9 A;  1IBM Q;  1JE5 A;  1PYS B;  4NXM Q;  4DR1 L;  2DGY A;  1KC8 C;  3CC7 A;  4YHH Q;  3PUY A;  1XTD A;  1Y1V H;  4DAM A;  2F52 A;  2J3L A;  2LXK A;  1D7Q A;  3IAL A;  4WI1 A;  4GN3 B;  4L5S A;  4JI3 L;  3TQY A;  1OXX K;  1H95 A;  4NXM L;  3L7Z C;  4XU1 A;  1RIP A;  2HIX A;  2DJZ A;  4OP0 A;  4E51 A;  4K0K Q;  2JJQ A;  4MZ9 A;  4A3K G;  4DUY Q;  4IPH A;  2DU7 A;  3QO5 A;  4X65 L;  3HOU H;  4POG A;  3IRB A;  4LNQ A;  2VQF L;  1X55 A;  4DV3 Q;  2K50 A;  1CUK A;  4KI0 A;  4RMF A;  1H4S A;  3I4N H;  1X56 A;  1QF6 A;  3HXU A;  2JA7 H;  2QGQ A;  4YRO A;  1EQQ A;  4PMW A;  1N8R C;  3UGQ A;  1LUZ A;  4OO1 I;  4JI6 L;  4A3C H;  4GOP B;  3S17 H;  1PA6 A;  3HFZ A;  2D0P A;  1KHI A;  3FJP A;  3K8A A;  4GLV B;  2ZM6 L;  3G4S A;  4ZIB A;  3I2Z A;  4H2X A;  3CCQ A;  1UE7 A;  2XGT A;  3RKW A;  3M9B A;  4KR2 A;  4KR3 A;  4H2V A;  1EIF A;  1XNR Q;  4DR2 L;  5IP9 G;  1SMX A;  5FJ8 H;  1YJN A;  1JJ2 A;  3ICE A;  3RZO H;  4GN4 B;  5GRO A;  1K0R A;  1WPY A;  3I55 A;  2YU9 H;  4XTW A;  3WWV A;  1ADY A;  3KJP A;  5LMN W;  1NNH A;  1VQZ A;  3UGT A;  1XMO Q;  2DU5 A;  1KRS A;  1CKN B;  2N3S A;  4X64 Q;  2QA4 A;  1N33 L;  3QO8 A;  4GKK Q;  4LFA L;  2NVQ H;  1DGS A;  3BJU A;  4HWR A;  1YNX A;  3IG2 A;  1X3E A;  4HIO A;  2DKG A;  4A93 G;  3PF5 A;  3I4O A;  4JI4 Q;  1N33 Q;  3UDG A;  2FYK A;  1N34 Q;  1X65 A;  2ODR D;  2PME A;  4XU2 A;  2CIM A;  3PV0 A;  1EWI A;  3NEM A;  2R93 G;  1GVP A;  4AQY Q;  5C53 B;  4JBW A;  2ZCE A;  3GTO H;  3RKY A;  1YHB A;  1OXS C;  3HFV A;  2ZIN A;  2E8G A;  2V1C C;  3NEN A;  2DZ9 A;  4GNX A;  1FGU A;  4L87 A;  5K1P A;  1IL2 A;  1E1O A;  4NXN Q;  4HJ7 A;  4A3L G;  4QIW E;  3FKI H;  1Q7Y C;  4DUZ Q;  2Q2I A;  2UXD L;  2R7F A;  3KF8 B;  1XJV A;  1NJ5 A;  4LF4 Q;  1E7Z A;  4DV3 L;  1BKB A;  4LF8 Q;  3A5Z A;  1OXT A;  3VQY A;  1VCI A;  5M3M H;  1VQ5 A;  2PNH A;  4XEO A;  1Q82 C;  4IFD G;  1HNX Q;  1WQW A;  3HOZ G;  3RL6 A;  2HIV A;  4H2S A;  3UH0 A;  4YRM A;  1B76 A;  2ZT6 A;  3I56 A;  4A76 A;  3A5U A;  3KDF B;  4LUZ A;  4OX9 Q;  1MKH A;  2YTX A;  1SER A;  4B3R Q;  1E24 A;  4A3G G;  1A62 A;  1WOC A;  4LF9 Q;  5C4J H;  4UPA A;  2E5A A;  2A1A A;  2ZTC A;  2E2J H;  3RZD H;  1TWF H;  3HOY G;  4YRQ A;  4A3L H;  3HKS A;  4XIG S;  3P8V A;  2ART A;  2ZJR A;  1QVF A;  2E64 A;  3ERS X;  4R4C A;  4IJH A;  1VQ7 A;  1EIY A;  4IPG A;  1KQS A;  4YRI A;  3J7Z C;  3IKM B;  1EFW A;  4DR7 L;  4TQF A;  2XTI A;  3WQZ A;  1K9M C;  3KF6 A;  1FL0 A;  1X2H A;  1HZ9 A;  4C3I H;  1PH7 A;  2ALY B;  3L2P A;  4YRN A;  1GKH A;  4CH4 A;  1N36 Q;  1D8L A;  2VQF Q;  3EFS A;  3UDX A;  4YRK A;  1PV4 A;  4Y52 H;  4LW1 A;  4H2Y A;  5F5W A;  4JI5 Q;  1UWV A;  1JJC A;  2E5L Q;  4K0K L;  4PZ8 A;  2NN6 I;  1P8L A;  1PH3 A;  2F3I A;  1EVL A;  5JEA G;  4X62 L;  2QHU A;  2LXJ A;  1NBW A;  3J81 i;  4J15 A;  2ZTE A;  4TVW A;  2K75 A;  4B3M L;  4X6A H;  2ZR3 A;  4YYE A;  4JI2 L;  1W2B A;  1YFS A;  4JI5 L;  1G29 1;  1KOG A;  3RF1 A;  3JC6 6;  4YCV A;  2Y0S G;  4KHP L;  2PI2 A;  2RHS B;  1N36 L;  3S14 H;  4JOI A;  5ELN A;  2ZJQ A;  2AHO B;  3OTO L;  3VQW A;  1KAW A;  2A8V A;  1WYD A;  4A3I H;  4TVY A;  1VQA A;  1WNL A;  1KMM A;  1HNW L;  2AMC B;  3OD1 A;  4K88 A;  1V43 A;  1MIU A;  4DAY B;  3HOW G;  4CS3 A;  4A4I A;  1EYG A;  3HXZ A;  3RN2 A;  3HOU G;  3STB D;  1VQ4 A;  4IPC A;  1VQF A;  1ATI A;  2DUD A;  3DM3 A;  4JBM A;  1WI5 A;  1IBL L;  2ASB A;  3S1N H;  2F4V Q;  5C4X H;  1NJ8 A;  3ULJ A;  1HNZ Q;  3CMQ A;  3R07 A;  5C4X G;  2P0L A;  1IBM L;  3A74 A;  4MNO A;  4A3F G;  2IT1 A;  1YGB A;  2Z6K C;  4HID A;  4P72 C;  3A7R A;  2D0O A;  2JA6 H;  4A3B H;  2K5H A;  1L1O C;  4HA8 A;  4IO9 A;  3M7N A;  3PF4 A;  4UP7 A;  2NN6 G;  1YIT A;  4O0A A;  4X66 Q;  2NZH A;  1PH9 A;  5C0X J;  1NMG A;  4CH6 A;  4X66 L;  1YJW A;  3ER0 A;  4DV2 L;  1SR3 A;  2JQO A;  3F2D A;  5LMU L;  4LVK A;  1LTL A;  4DV2 Q;  3D31 A;  2C35 B;  4R1J A;  4YPF A;  3GD7 A;  4GOP C;  1Y1W G;  3HTZ A;  4QL5 A;  4A75 A;  4CH3 A;  1NYQ A;  2J3M A;  1GM5 A;  3L4G B;  3PUX A;  3U4Z A;  5IP9 H;  1IXR A;  4LFA Q;  5IWA L;  2P5I A;  4AQY L;  3EFR A;  5FJ8 G;  3P8Y A;  2AWO A;  3V7C A;  2OQK A;  3V7R A;  2FXQ A;  2QHV A;  1X3F A;  4QQB X;  4HVC A;  1B70 B;  5IT9 c;  5IY0 A;  4XU0 A;  4UY8 C;  2Q5I A;  1HNW Q;  4EX5 A;  4YP0 A;  4WF2 A;  1PH2 A;  4RQF A;  3CCR A;  2E3C A;  4O2D A;  3DLL A;  1M90 C;  1S40 A;  4B3S Q;  1L1O A;  3D0F A;  3K81 C;  1J5W A;  1JMC A;  3H3V H;  1Z47 A;  2ES2 A;  2PMF A;  3RIR A;  1IZ6 A;  2B63 G;  1K3R A;  5C0X I;  1L0W A;  3W3S A;  5LMN Q;  1I6H H;  1PYS A;  4PZ7 A;  3HOY H;  4DR4 Q;  3OTO Q;  1OXU A;  1FJG L;  4YRT A;  4AYB G;  2VY3 A;  3GTP H;  5C3E G;  2MNA A;  3UE0 A;  3OYY A;  2JA8 H;  3HKZ E;  4OON A;  1QVC A;  4R4I A;  3G6E A;  2JEB I;  3UE1 A;  1SRY A;  3RAC A;  2Q2T A;  4LFB Q;  3PGZ A;  4P75 A;  1M1K C;  3GTM H;  5JJI A;  3LSQ A;  2EJF A;  1TWC H;  2BA0 A;  2WB1 E;  4IFD I;  3A7A A;  1EUJ A;  4LF6 Q;  2AKW A;  3S2H H;  5GAG C;  1HR0 W;  4X65 Q;  4EQ5 A;  1N32 Q;  2KHI A;  1JJC B;  3GTK H;  4ZTZ B;  2PQA A;  5M3M G;  4JBK A;  4A3M G;  4TQD A;  1YZ6 A;  3K7A H;  4DR7 Q;  3REU A;  2RHS A;  2I4M A;  4OWX B;  1SN8 A;  2K5V A;  4DUY L;  4NCX A;  4JG2 A;  1KIX A;  3GO5 A;  4UP8 A;  4QY7 A;  3F8T A;  1IBK Q;  4GOP A;  4IJL A;  4JI8 L;  3VQX A;  4A3M H;  3HY0 A;  3S1R H;  2R92 G;  2K52 A;  1B8A A;  1Q8K A;  3KYH C;  3SGI A;  4JI0 L;  4DNI A;  1WJJ A;  2EQS A;  1USY C;  1A63 A;  4Y7N H;  3JAM c;  2EL9 A;  4H2U A;  1LYL A;  5HGQ A;  2E10 A;  4XTY A;  3CCJ A;  3T1H L;  1VQD A;  5C0X G;  4ALP A;  4LWC A;  1EQR A;  4X64 L;  4A3K H;  1X01 A;  2E41 A;  3U58 A;  5IYD H;  3EIV A;  2YV5 A;  1CKN A;  4GLX A;  4BWA A;  1WCM H;  3HOW H;  4FDB A;  1YI2 A;  2ZR2 A;  4H2T A;  1Z9F A;  5IYC H;  3G48 A;  4BBS G;  4B3M Q;  3RLN A;  4A3J H;  4EO4 A;  1YJ9 A;  2CWP A;  2UXB L;  4Q15 A;  4DKA C;  4AYB E;  3AFP A;  4NXN L;  2GVB A;  2CKZ B;  2D62 A;  1Y1V G;  1SRO A;  1OTC A;  12AS A;  3PCO A;  2L15 A;  1N32 L;  4YRC A;  1X54 A;  3UDF A;  3HOZ H;  4P3N A;  4P75 C;  2UUB L;  4DV5 L;  2UU9 L;  3U4V A;  4HJ8 A;  1Q46 A;  1NJI C;  2JA5 G;  1VQG A;  3TUP A;  5IE8 A;  4B3S L;  1XPR A;  5IYC G;  2I5H A;  4B3R L;  4LFC L;  2ZZE A;  2PMZ E;  1X2G A;  5GAH C;  2Q7E A;  5K1X A;  1WCM G;  3RUX A;  5IP7 G;  3HY1 A;  2E1H A;  3W5O A;  4H2W A;  1GD7 A;  4YCU A;  1P16 A;  2JA7 G;  4QJF A;  3CCL A;  2JE6 I;  2WAQ E;  2OCE A;  4HIM A;  3V8L A;  4DR2 Q;  4RG1 A;  3EBE A;  1VQO A;  3PIP A;  3BU2 A;  1QUQ B;  2OTL A;  4XTZ A;  1VS0 A;  2AWN A;  1CKM A;  1X6O A;  3FHW A;  1ADJ A;  1U0L A;  2K14 A;  2BH8 A;  4BBR G;  1G6P A;  1N9W A;  2R7Z H;  3PO2 H;  1QVG A;  2R6G A;  1VQN A;  4DV1 L;  1HZA A;  2NZO A;  1VQB A;  1VQL A;  2UXB Q;  1W66 A;  4K86 A;  4P71 A;  3BZK A;  1H4Q A;  4LF7 Q;  4YRJ A;  2HNI A;  2CCZ A;  2MQH A;  2N78 A;  4YY3 Q;  2ALY A;  1OXV A;  1YVC A;  3E0E A;  4JI3 Q;  1HZC A;  2Y0S E;  2I4O A;  1V1Q A;  2R92 H;  2R7D A;  3GDE A;  4HWP A;  4IPD A;  3TEH B;  3W1B A;  2NS6 A;  1HNZ L;  3RLF A;  3CCU A;  1H4V B;  1L2F A;  5GQO A;  11AS A;  4ME3 A;  4DV4 Q;  2JK8 A;  3RGL A;  5AJ3 L;  3VQV A;  3PO2 G;  1QZG A;  2WAQ G;  4G84 A;  5IYB G;  3AQQ A;  3STB C;  2UXC Q;  3PO3 G;  2EJ9 A;  2WP8 J;  4JOI C;  3JAM i;  3RR5 A;  4OXP A;  4TTV A;  3T1Y Q;  1YHQ A;  2R93 H;  4CH5 A;  1R9T H;  1SES A;  1A8V A;  5C51 B;  2VUM H;  4PHC A;  1HZB A;  4MTN A;  4JI0 Q;  2IX0 A;  2N8N A;  2CQO A;  3K80 C;  3LSS A;  1J5E L;  2BA1 A;  3RLO A;  1G51 A;  3TS0 A;  1XPO A;  5IWA Q;  4KLK A;  3PUZ A;  2ID0 A;  4A3F H;  4POF A;  2R7Z G;  2UXD Q;  2VW9 A;  1KXL A;  2E65 A;  5GAE C;  1BIB A;  3V7S A;  4A3D H;  2IHF A;  2DQ0 A;  2VUM G;  3M3Y H;  3A31 A;  2ZZG A;  2OWO A;  2WFW A;  3TRE A;  1XPU A;  3I4M H;  1PFS A;  3PCO B;  4A3E G;  1V9P A;  1NJ2 A;  3CCE A;  4HJ9 A;  2NVX H;  3F1Z A;  2RCN A;  3OW2 A;  1WFQ A;  3KLW A;  1QZH A;  5E3I A;  1X3G A;  3NET A;  5C52 B;  3QTC A;  1VQI A;  2E2I H;  5IP7 H;  3LC0 A;  4IFD J;  1N34 L;  2GN5 A;  3M4O H;  4P73 A;  5M5Y H;  1G5H A;  1EVK A;  1NMF A;  1LM0 A;  3J81 c;  4JI1 L;  1Q1E A;  2WB1 G;  1H4T A;  4H2X B;  2EWN A;  2IY5 B;  1XMQ L;  1SE8 A;  1VQM A;  4CS2 A;  4LVL A;  3CME A;  2ATW A;  5KNN A;  1XNQ Q;  3BZC A;  4JC0 A;  1XNQ L;  4BBS H;  3KFU A;  1C9O A;  3L2Z A;  5DLQ E;  4BY1 G;  2ARU A;  4DR4 L;  4P72 A;  4YHH L;  4LF9 L;  3QO7 A;  4NB3 A;  1VQ8 A;  5ELO A;  1VQ6 A;  4OLF A;  2UUA Q;  3K0X A;  3PZC A;  4YY3 L;  2H5X A;  4A3D G;  3KF6 B;  4JI1 Q;  3GTJ H;  3J81 j;  1HNX L;  2B29 A;  1SET A;  2Q7G A;  3H0G H;  4HWO A;  3EN2 A;  2DTO A;  1YHA A;  1HXD A;  4L5T A;  1YFR A;  5M3F H;  1HTT A;  4DV7 Q;  3AYH B;  1E22 A;  1RL2 A;  5M3F G;  2KHJ A;  3TEG A;  2EAY A;  3MEY A;  1WQ7 A;  4JI2 Q;  2ZM6 Q;  4A93 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...