2E10A

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutation r51a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
217
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGESPEGGLWLSIVLSPKKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Biotin Protein Ligase
total genus 66
structure length 217
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e10A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e10A01
2ZT5A 1E1TA 5C52B 1H4TA 2CJBA 5LJ5h 4YROA 5LJ5g 4F7UG 2Y90A 4J6XA 2DXUA 2ZXFA 4YDQA 4M78D 2P5IA 4M7AC 1JJCB 3IALA 4C8QF 2E65A 4RQFA 1YGBA 3JCMW 5GANh 2E1HA 2VC8A 1D3BA 1HK9A 3HFZB 4M75D 3TEGA 4DPGA 1G5HA 4PHCA 4ZTZB 1C0AA 4F7UA 2E10A 2Q7HA 1VQZA 1RIQA 4V2SA 4Q6GA 3BY7A 5LJ5d 4HWSA 3V7SA 3WQZA 4RCBA 4CH6A 2RB6A 2IY5B 1Z7NA 4J6WA 4OP0A 4H2SA 3A7UA 2QHSA 2DXTA 3FJPA 3HFZA 3PCOA 1B7YB 4N0AA 4RMFA 5GAN5 1NNHA 3A31A 2ZR2A 1EIYA 4C8QC 2P0LA 1EOVA 3QNEA 2PMFA 4J6YA 3HTZA 4M7DE 4OLFA 5GAN4 4YRJA 5GMKl 3QO3A 4XTUA 2JN0A 4C92B 1JJCA 3VQWA 4XQ3A 4XTWA 4EMKC 2QHTA 3LSSA 3QHSA 3HSBA 1KMMA 3JCMV 4YCWA 4P73C 4UP9A 4XTVA 4P71A 2ZT6A 3MF1A 1WNLA 3OD1A 4F7UB 4ZTUB 4YRRA 2XTIA 3INZA 3HXZA 4P3NA 1ADJA 2EJ9A 4C8QG 3L1AA 2Q7GA 4C92D 2ZIMA 5ELOA 3FIFA 4YRKA 1HTTA 4YRNA 3FB9A 2I4LA 2RM4A 1N9RA 2ZINA 4PJOB 4YRTA 3VBBA 3A7RA 3VQVA 2AMCA 5GAMd 1Z7MA 1W66A 1U1TA 4J15A 5GAN2 5GAOq 2EAYA 1X2HA 3VQYA 3TEHB 4BWAA 4M7DF 3MF2A 2EJFA 3G1ZA 3ICAA 4TVAA 4XTXA 4WF2A 5GAN7 2ZZFA 3RESA 3RERA 1WYDA 1WPYA 1I4K1 4YRFA 5F5WA 4TQDA 3E9IA 1X55A 1J5WA 2ZZGA 4RDXA 1YFTA 1E22A 2YLCA 3QSUA 1EFWA 4M7AA 2AKWB 3JB9H 1SERA 4M75G 2DJZA 3JB9D 5GMKh 3R07A 4QVCA 4M7AD 3JB9I 2ZT7A 4HWTA 4HT9A 2CJAA 1D3BB 3CMQA 3PGGA 3RKYA 5GANf 11ASA 4RCCA 5GAOm 4CS3A 4M77F 2AMCB 2Q5HA 2ZIOA 1TH7A 1LJOA 3V7RA 1BIBA 3NETA 3P8YA 4F7UE 1IL2A 2RA2A 3HFNA 3A32A 4K87A 2PMEA 3HFVA 5LJ3d 1EQRA 3JCMf 4PG3A 3JCMd 4TQFA 4EX5A 3EFRA 3M4PA 1WLEA 3RGLA 4C8QD 2VXEA 4BW9A 1EVLA 2HNIA 2DKGA 4TVWA 4YRIA 4H2YA 1PYSA 3BW1A 5GAMf 2RHQB 4WJ3M 2DVEA 1I81A 5GAN8 2RD1A 1EIYB 1ATIA 2FB7A 2EJGA 2DU7A 4M7AG 3HXXA 4YRLA 4KR3A 4E51A 3A5YA 1L0WA 4H2UA 1EVKA 5ELNA 1NJ8A 4CS2A 5LJ3h 2DTOA 4XU1A 4NL3A 5GANd 3JCMb 1X01A 1KMNA 4M7AE 3V8LA 3I7FA 4HWRA 4P72C 1HXDA 5GAN6 3DSQA 3SWNA 3QO5A 4XEOA 3UH0A 1H641 3REUA 4M78B 3NENA 2EL9A 4M77B 4NL2A 4JRIA 2ALYA 3JCMQ 3HXVA 2E5AA 2ZCEA 1NJ1A 4P74C 3TUPA 1E24A 4PJOC 1B76A 4YP0A 1WQ7A 1QF6A 3JCMJ 3IKLA 4TVYA 4JRKA 1M5Q1 4YCUA 2ZNIA 1WU7A 2C7IA 3HRIA 1G51A 2E64A 3V8JA 5GAOl 4HWPA 4XU0A 2Q7EA 2DU5A 5CAIA 4M77D 4TTVA 3P8TA 4M7DG 4EO4A 2CIMA 2ODRD 2ZTGA 3JB9J 4H2XA 3V8KA 5LJ5f 4M7DD 4EMKA 3IG2A 4C92F 4XEMA 3W3SA 2DZ9A 5GMKm 3SWNC 3M4QA 2CJ9A 4M7DA 4P3OA 3NELA 4HT8A 4M7AB 2AKWA 2ARTA 3BFMA 2ZNJA 5GAOn 1X56A 1GGMA 1NYRA 2ALYB 1N9WA 2ZR3A 1YFSA 3HXWA 4M78C 2QHUA 1KOGA 4M77C 1USYC 3M4GA 4EMKB 4Y91A 3RIRA 5DY9A 4P72A 1B70A 4H2TA 4TVAB 12ASA 4P3PA 2I2LA 1ASZA 4WI1A 1NJ6A 3EFSA 4M75F 4AH6A 3JCMP 4A53A 3JCMe 4C92C 1H4VB 3RACA 4JUVA 4NOYA 3JB9F 3ERRA 1YCYA 5LJ3j 4X9DA 4M7AF 1NYQA 4P73A 2Q5IA 1NJ5A 1I5LA 2C8MA 4P71C 5GMKe 4YPFA 4M77G 5GAMj 2J3MA 3HXUA 4M78G 4UP7A 4YRMA 4M77E 1BIAA 1HC7A 4M7DB 2ZZEA 4YCVA 3BJUA 3IKMB 1USYA 2DEQA 1JRIA 2YLBA 1BBUA 1SETA 3P8VA 4YRGA 3A7AA 3QTCA 2I4NA 1B34B 4XTZA 4G84A 4P74A 4X9CA 3HXYA 3QO8A 4M75E 4XU3A 5LJ5e 5C51B 3JCMc 4LNSA 1N9SA 2VXFA 3SWNB 1PYSB 5GMKi 4QVDA 5GMKj 4F7UF 5GAMe 4H2VA 4X5OA 5E3IA 3RKXA 1YB3A 3PCOB 4Q15A 1X54A 4JLIA 4HWOA 4YRQA 5GAOp 4PJOG 5KNNA 4KR2A 3KFUA 5GANj 4C8QE 1Y96A 2XGTA 2FYKA 2QTXA 4UP8A 3VQXA 1E1OA 4H2WA 3L2ZA 4YYEA 2DTHA 2ZT8A 2E3CA 5K1PA 2DQ0A 4CH4A 4M75A 4J5YA 1SRYA 5LJ5j 1BBWA 4P75A 4M75C 3RUXA 4YRCA 5GANg 3HFOA 3HY1A 4H2XB 1I8FA 4MMKA 4XTYA 5GAOr 5LJ3e 3VU3C 4PNOA 4O2DA 3GIBA 2EWNA 2IY5A 3PZCA 4K86A 4A54A 1X2GA 1KQ2A 4C92G 3HY0A 2ARSA 2G4CA 2DZCA 4HVCA 3JCMh 1B34A 2RHSA 4M78F 1JBMA 3HRKA 2I4OA 3LC0A 5GANe 3MEYA 1MGQA 3SB2A 4MMLA 4C92E 1FYFA 4CS4A 2I4MA 4M78E 4PJOE 5GAMg 4DQ2A 1Y96B 1NJ2A 1U1SA 3L4GA 4PJOA 4N0AC 3RKWA 4G85A 1KQ1A 4C8QA 4KQEA 4C92A 3BDUA 3JCMg 2E41A 5LJ3g 2RHQA 3AHUA 4H02A 3UGTA 2DQ3A 3JCMX 3REXA 4EMHA 2YHTA 4UPAA 1SESA 1H4QA 5LJ3f 3QUIA 2ZGWA 1LNXA 4M75B 3V7CA 4CH3A 3UFGA 5GAMh 1ADYA 4YRSA 4RQEA 4M7DC 1ASYA 3A5ZA 4YREA 1M8VA 4TWAA 2ODRC 4PJOF 4C8QB 5GAN3 4WJ4A 3LSQA 3NEMA 4ZIBA 3QO7A 5K1XA 4YRPA 1WQWA 3UGQA 1G5IA 3E9HA 2ARUA 4P75C 1H4SA 2RHSB 1B70B 2DTIA 3RL6A 2CGHA 4CH5A 1QE0A 1LYLA 5HGQA 3JB9G 2K57A 4HA8A 4EMGA 4XU2A 1LOJA 4M78A 4PJOD 4M77A 1YFRA 4L87A 3RF1A 3TEHA 4K88A 1B8AA 4NCXA 5C53B 2J3LA 5I21A 2QHVA 3A74A 3L4GB 1B7YA 2DDZA
chains in the Genus database with same CATH superfamily
1KG1A 1V29B 5AYFA 2K5LA 3RMQA 2BZ8A 2RJDA 3J7AF 1RAAB 1NM7A 2E70A 4F7UG 2Y90A 1G5VA 1WHGA 2W10A 4X34A 4RMOA 2PVDB 3CC2T 4IIMA 4YDQA 3VRZA 4C8QF 3CCLA 3EFOA 3UWNA 1YGBA 2DIQA 1VQNA 5GANh 3TEGA 1EX4A 3LGFA 2GFUA 2BUDA 1DJ7B 4IUUA 1ZUUA 1S72A 3CC7Q 1R8OB 5LJ5d 3E9GA 3V7SA 2EYWA 3WQZA 3M5AA 2FPDA 2O9VA 2K4YA 4J6WA 3EFOB 4LNPA 1JXOA 2QHSA 2K6DA 1B7YB 3CXCA 3QXEB 4QQDA 4J9BA 3OW2S 1VIEA 2V1RA 5GAN5 1NNHA 1YJ9T 3A31A 2BIVA 1M1GA 1B07A 2X51A 3IQLA 2LJ0A 2P0LA 2HAXA 1NE8A 1VQ6T 4LUEA 4J6YA 3HTZA 1I1JA 2JN0A 3QYHB 1VQOT 2QQAA 2Y4XA 3QHSA 3HSBA 1ARKA 4YCWA 2J6KA 4P73C 4FW1A 4E2FB 4OMFB 4UP9A 2EIFA 1K73U 2ZT6A 2J6FA 4RTUA 3MF1A 1VQ8T 2X3XD 2NLUA 1OU8A 1SHFA 1YWOA 3EG3A 1D1BA 2RI5A 3HXZA 2GTOA 1UEBA 3I5SA 2KXCA 5D6XA 4E47A 4C92D 2ZIMA 1TOVA 1KFZA 3FB9A 2I4LA 2RM4A 2C0OA 2CZ0B 2MOXA 5CVIA 3A8OB 2CDTA 1BI2A 1AZGB 5GAN2 1K9MU 4BWAA 1SSHA 3LWIA 2LQNA 3G1ZA 5HKCA 1ZSZA 5GAN7 4HKEA 3RESA 1WYDA 1WPYA 3E9IA 2ZZGA 1YFTA 3QIIA 3CPWA 2YLCA 3JB9H 1VQNT 1HD3A 5KYWA 3OS1A 3JB9D 2DM1A 3MO8A 1VQ8Q 2ZT7A 2J6OA 3EHRA 3JB9I 1GL5A 4HWTA 2FL7A 2V8JA 3G7ZA 2CJAA 1YN8A 2ZZDA 4AFZC 3CCQQ 3RKYA 4D8DA 5GANf 11ASA 4DEXA 2Q5HA 4MZPA 1NPPA 2QA4A 2VYTA 4J9EA 5KYYA 1YJNA 3CQTA 2EPDA 4PJMA 2FPEA 2P0KA 1G3SA 1VQOQ 4BE0A 1IL2A 2L5QA 4PLLA 3JCMf 3H9NA 3EFRA 3M4PA 3RGLA 3HPWA 1PRMC 4BW9A 5FROA 5IHNA 1XTDA 1EVLA 4II1A 2DL4A 1K0XA 2KYBA 3EH2A 3CMAT 3OSSC 2XK0A 1H3ZA 2VWFA 4WCIA 1ZSGA 5GAMf 2RHQB 2EQIA 4JJCA 2E5KA 2O4XA 3CCVA 4LVJA 2FB7A 4ORZA 2YUOA 1N8RR 1VYVA 1TTHB 2E4HA 2DU7A 4OMQA 4ZGJB 2XDBA 3NTIA 1KC8R 3CC7A 3A5YA 1PM3A 4CS2A 1EVKA 2DTOA 4FYVB 3V8LA 4HWRA 3CMAA 5GAN6 3SFMA 2DIGA 4XEOA 1W1FA 2M51A 3REUA 1XQHA 2XHCA 3NENA 4PKCC 4A4KA 3HXVA 2YXYA 2M16A 4P74C 5HY6A 3CCEQ 2YRDA 2DL5A 1UGPB 1M3AA 4XK8E 1UJYA 2KE9A 4JRKA 2NUTB 4ME7A 8AT1B 3CMAQ 2O88A 1CSKA 4DBQA 1NJIC 5J26A 3GP8A 3OQ5A 3RR6A 2D8HA 1ACMB 5GAOl 2GGRA 4E7JA 3A8HB 1G83A 3PIPA 4H2XA 1AEYA 3V8KA 4F14A 4M7DD 4XEMA 4RTZA 1C0MA 1OEBA 2DZ9A 2JTEA 2LCSA 3VS1A 4BI4A 3QG1A 1TU0B 4P3OA 3NELA 3QPHA 1NLPC 1ZA1B 4C0ZA 3BFMA 5I2SA 4ELYC 2ZNJA 5GAOn 1X56A 2MI6A 5C0MA 1UGSB 2YSQA 1KSWA 1NYRA 1N9WA 3I9QA 2G6FX 3M4GA 1XNIA 4EMKB 5D6YA 4BY6C 3RIRA 4D8KA 1JJ2P 3CCUA 4TVAB 5A0GA 3MEUA 2LT1A 3E2UA 4P3PA 3EFSA 4P5NA 3JCMP 4RG2A 1H4VB 3HRUA 1H3HA 5FRMA 3MP1A 4HCKA 1WXBA 4J9DA 2C8MA 4P71C 5A0LA 2COZA 5GMKe 2HQHA 2KY9A 5GAMj 1YITQ 1A0NB 5CKFA 4CC3A 3NFCA 3M0RA 4YRMA 1BIAA 2ZZEA 4ZNXA 4GBQA 1I07A 4ZTJA 3CC7T 2R58A 2BE9B 2RF0A 3IKMB 4B9XA 2KRMA 2HBPA 1VQOA 1RUWA 2DEQA 1BBUA 2AZVA 3QJYA 1B34B 2FO0A 3QJ6A 1QKWA 2EQMA 1YJ9Q 2V8KA 4RTWA 3G6EA 1KHCA 2F5TX 2IG0A 4XU3A 1R0CB 1U3OA 1SPKA 1OZ2A 4LVKA 2QGGA 4DOWA 3C94A 5GMKi 2RHZA 2FVUA 4H2VA 5E3IA 2MWOA 3VV0A 2EQJA 4YRQA 2D6FA 4PJOG 4LDXA 5KNNA 3FLGA 2CSQA 1S72T 2CUDA 3VQXA 3UT1A 2QXFA 4KUDK 3CXCS 4YYEA 1UECA 2O2OA 2DQ0A 2OTJQ 5KYWB 3CPFA 4M75C 2OAWA 5GANg 1FWZA 3KBGA 1Q82R 2DF6A 3HY1A 2YRCA 4H2XB 1VQ7T 3VU3C 2RHXA 1K8AC 3GIBA 2DX1A 1D09B 1QVGA 4HVWA 3A5ZB 4A54A 2C0TA 2ARSA 1AWWA 3L2RA 1B34A 2RHSA 3HRKA 2DERA 1RAEB 2OTLQ 3LC0A 5GANe 1ZLMA 3MEYA 2DYBA 3SB2A 3I55T 1VQPQ 2P0PA 1Q86R 4FT4A 2GNCA 4DOVA 3I5RA 4PJOE 4PFZA 5GAMg 4DQ2A 3OYKA 2OTJT 4N0AC 1VQ5T 1KQ1A 4C8QA 2RN8A 1AVZC 1U8RA 4JZ4A 2QA4T 1YHQT 4AFUC 3REXA 3MEWA 2E3HA 2K2MA 5I22A 2ESWA 2YHTA 4DBHA 2CSIA 3OYNA 3V7CA 2DK3A 3OYGA 2GQIA 4ELZC 4YRSA 4M7DC 1ASYA 1MV0B 2KDSA 4C8QB 1JB0E 1K9MR 2AT1B 4ZIBA 2HDAA 3UF4A 2F2WA 2KNBB 1YHQA 3E9HA 3AT1B 2SEMA 2XIDA 1Y7XA 1B70B 1SRMA 1QP3A 1QE0A 2C06A 3TCJA 1Q82U 5HGQA 2DL8A 3JB9G 1YIJQ 1I0CA 2F2XA 1OV3A 4PJOD 2HKQB 1RAIB 4M77A 5KYXB 3G71Q 1FX7A 2QHVA 3L4GB 2MYSA 5KYNA 2ZT5A 1E1TA 3TREA 1TG0A 2PZ1A 3E19A 4Z8AA 4JZ3A 3ZL7C 2DD5A 4LDUA 1EZZB 2DXUA 4M78D 3GF5A 1PNJA 1YJNT 1JJCB 3IALA 4N4HA 2E65A 4RQFA 3THKA 3PTAA 2E1HA 1G5HA 4PHCA 5CIUA 3KFVA 1C0AA 4RG8A 1X6GA 3BY7A 3SHWA 4HWSA 2X4JA 3HRSA 4RCBA 4CH6A 3PVLA 2OX7A 2QA4Q 3E9FA 4H2SA 3DB4A 3TU4K 3H41A 2QQBA 4N0AA 4ZGDB 3CC2Q 5CKBA 3X24B 1YNZA 1WDXA 3SD4A 2JTFA 1GRIA 2VKNA 3EG9A 4PK4A 2R5AA 1AWXA 5D6WA 2ZPEB 4C8QC 3CCRA 1QCOA 1X2QA 3OB9A 4M7DE 4OLFA 2JS2A 1W70A 4YRJA 2QI2A 4C92B 4QVZA 4XQ3A 4XTWA 4EMKC 2HCKA 3JCMV 2JS0A 4XTVA 1WNLA 5KCHA 2QG9B 3PMIA 2A3LA 2RPNA 3OS0A 4J9IA 1ADJA 2ZPHB 4B9WA 2EJ9A 4C8QG 4FL6A 1VQ4T 3FIFA 1ABQA 2O31A 1GFDA 1HTTA 3CCQA 1GBQA 2CZ1B 2FEIA 3ME9A 1N9RA 2ZINA 2JM9A 4PJOB 3VBBA 1ZUYA 5GAMd 1BBZA 1PG5B 2XI9A 2WSFE 1JEGA 4IUQA 5GAOq 2W0ZA 2EAYA 1M1FA 1M27C 1GBRA 3MF2A 4XTXA 1IHWA 2ZPBB 4A4FA 3FEOA 3X26B 4C5GA 3RERA 3CD6Q 4HVUA 4YRFA 1R0BG 3RBBB 2M0OA 1VQ4Q 1KD1C 3NTKA 1SERA 5FU7B 3OYYA 4FW2A 3PIOA 2MIOA 2JOYA 1VUBA 5GMKh 1MNDA 3R07A 4QVCA 1YCSB 3CCUQ 4J8OA 2FHDA 2ED0A 3UA7A 3L2WA 1VQ9T 2A28A 2VVKA 4RCCA 3REAB 4FYWB 2ZIOA 1BU1A 1TH7A 1PCXA 1LJOA 3M0QA 2P84A 3V7RA 2ATCB 1RL2A 4F7UE 4JS4A 2RA2A 2B8AA 3S6WA 5LJ3d 3HFVA 4EX5A 4PG3A 2EYXA 2CP3A 2VXEA 1Q7YU 3RMSA 4TVWA 2MMPA 1PYSA 1IRXA 2VV5A 3BW1A 2RHIA 2RQUA 3L42A 3OW2P 4ZN1A 3LGLA 3OSVA 2DVEA 3G71T 5GAN8 1EIYB 2EJGA 4OB0B 2EW3A 2G3RA 3FC3A 3OS2A 4YRLA 4KR3A 4E51A 2DXCA 3CCVT 1D0XA 4H2UA 2DO3A 1NJ8A 5LJ3h 4JRQA 1VQ6Q 2BE7D 2DNUA 4M7AE 1GFCA 2KR3A 4DEYA 3QO5A 1X75C 1Z9QA 1VQMT 2EL9A 2CS7A 2JUFA 4LE9A 4NL2A 3MKDA 2ZCEA 3TUPA 4QT7A 1QF6A 3JCMJ 3KXTA 3SDZA 3IKLA 2ZNIA 4JS5A 3OBWA 4O5VA 3I56T 4C0FA 2AKKA 3ZBDA 3C4SA 1U06A 2ZPFB 1RAFB 1BI0A 3GPLA 4HWPA 2KRSA 2Q7EA 1VYUA 3CBOA 1QP2A 3P8TA 3I55A 3HP9A 3I55Q 1VQPT 2ABLA 2CIMA 2ZTGA 5LJ5f 2QASA 1YIJT 1NPRA 3EG1A 3G6EQ 4F17A 4M7AB 2AKWA 2EYQA 2ARTA 1QVGP 1AZEA 3DLMA 3CCET 1RI0A 1P92A 1VQLQ 1V76A 1IHVA 2NUZA 4YTLA 3PE0A 1BKBA 2MPXC 4M78C 1UJ0A 1R77A 3H6ZA 1ZHIA 1VQ9Q 3G71A 3QWXX 4KGXB 5FU6C 8ATCB 3L2UA 5DY9A 4ANJA 12ASA 2QTVA 1RACB 2KI7A 5CQXA 4X1VA 1ASZA 2J06A 1UUEA 4AH6A 2WACA 2QQ9A 3JCMe 4N4GA 4C92C 3RACA 4JUVA 3JB9F 2D8JA 4M7AF 2NWMA 3ER0A 4P73A 3OMGA 1NJ5A 2XDDA 2M02A 4YPFA 3MQZA 2CH4A 2K3XA 1VQLA 3HXUA 2VUBA 2RHYA 2JNGA 3TEEA 3GNFB 2K3YA 1M9SA 4O6JA 1FMWA 1Q82C 1Q81C 2FZKB 4YCVA 1FYNA 3OYHA 2LQKA 1USYA 4OB1B 2M1HA 3MEVA 1WX6A 1JRIA 2YLBA 5L8RE 1SETA 2RJFA 4PLIA 3A7AA 3QTCA 2I4NA 4LVLA 2P0QA 3VS7A 4XTZA 3HXYA 1H92A 5C51B 4KUIA 1N8RU 3JCMc 1X6BA 1FMKA 1N9SA 2HKNA 3BE3A 2VXFA 1N27A 3MP6A 2AIRB 3OMCA 3CCST 1HJDA 1YWPA 2L89A 3GNGA 1M8MA 1X69A 5CKHA 1YB3A 2I0NA 1X54A 4HWOA 4CI0C 1BK2A 1Y96A 1SKUB 1SF9A 2NYSA 4D6WA 2QTXA 3TVTA 3MCAB 1D1AA 1WHJA 2LDMA 2A0FB 4H2WA 4BUGA 2HEQA 1D0YA 2ECZA 2PU9B 3CCEA 2ZT8A 1VQ4A 5K1PA 4CH4A 2H3JA 1JXMA 1M2OA 3M0SA 1Q7YC 2F1LA 5LJ5j 3M0TA 1BBWA 3RUXA 1G3WA 4YRCA 1YIJA 2EYYA 1VQ8A 2F2VA 3UDCA 3HFOA 5IXBA 1AT1B 5GAOr 2CP5A 2E6ZA 3CC4Q 4PNOA 3PVQA 1T3SA 1AWJA 3PZCA 3X25B 2EQKA 4K86A 4QW2A 2Z0WA 4KT0E 1GCPA 1OU9A 4A4EA 2DZCA 2QK0A 4M78F 1JBMA 4LXCA 3CCJA 2I4OA 1MGQA 3M57A 4OF1A 2L2PA 4C92E 5KE3A 4FSXA 1W2BA 3QWYA 4C5EA 1YJ9A 1AD5A 1U1SA 1G3YA 1VQMA 3EH1A 1TWBA 1E6HA 4C92A 4AMCA 5LJ3g 1K8AU 2M0YA 3VS0A 2KGTA 2GFAA 3FDRA 2DFUA 1VA7A 1Y0MA 1BCMA 2HMAA 2WSCE 1SESA 4UPAA 2CT4A 4FT2A 2ZGWA 1LNXA 5J3BA 2OTLT 4CH3A 3VYGA 1ADYA 1QQJA 4E7ZA 2KT8A 3A5ZA 4YREA 4TWAA 1WHKA 2ODRC 3CC4T 4PJOF 5GAN3 4WJ4A 3LSQA 3QO7A 2J7IA 5K1XA 4RUGA 1OYXA 2RQVA 4AFQC 1G5IA 2QDYB 1H4SA 2RHSB 3CCLT 2JMCA 1M1KR 2DTIA 2CGHA 1Q81R 1RLQC 4CH5A 1LYLA 3OW2A 4EMGA 3OS5A 3CC2A 4Z89A 2DBMA 1QKXA 4NS5A 3X28B 3RF1A 2K2VA 2KK4A 3VS5A 1UB4A 4HVVA 2J3LA 1ZSZB 3G4SA 1UGQB 2DE0X 5FLXE 1H4TA 2CJBA 5LJ5h 1KQSP 1PD0A 5IT9E 1VQKQ 1BI3A 3QDRB 1ABOA 2LCCA 5LJ5g 4YROA 5L23A 2HSPA 2CREA 4J6XA 1WA7A 2DYIA 5KYXA 1X6OA 4N4IA 4M7AC 3QZ5B 2DLPA 2IIMA 3EAEA 4HCZA 1RADB 4JLGA 1VQ7Q 2DL3A 4LUDA 1IREB 1K8AR 1HK9A 4DPGA 2MCNA 4Z02A 3NPFA 2C0IA 4ZTZB 1M1KC 3A8GB 4F7UA 2E10A 2X35A 2Q7HA 3A8LB 1RIQA 4Q6GA 3N5BB 2V26A 3URGA 1N5ZA 5IAYA 2RB6A 2DXBA 1Z7NA 4OP0A 1Y07A 3A7UA 3M59A 1KHIA 2DXTA 3VRYA 3PCOA 1PD1A 1M2VB 4E7KA 4RMFA 2FPFA 2YT6A 3OYFA 1WHLA 2CYZB 1BI1A 2EQUA 1QCFA 1RABB 2LC4A 1PHTA 3CMEA 4RTYA 3LYIA 4IIOA 2ZR2A 1EIYA 1EOVA 2XKOC 3QNEA 1M90R 2PMFA 2P4TA 1N8RC 1QVFS 5GAN4 2BKDN 1NEGA 3OYIA 5KYUB 2JT4A 2DILA 4XTUA 3ASKA 1JJCA 3VQWA 4E7SA 2EBPA 1Q86U 3PT9A 4AFSC 2QHTA 1KMMA 3EGXB 2FZCB 1PKSA 1MMAA 2XG8D 1LVKA 4F7UB 1VQLT 4F04B 4QQ6A 1NJIU 1SHGA 2XTIA 1M2VA 3L1AA 1XJWB 2Q7GA 5ELOA 4YRKA 2NS6A 3BDLA 2XICA 1OX9A 3M55A 3S3OA 1X43A 4YRTA 3A7RA 2LNVA 3VQVA 2AMCA 2KVQG 4FYYB 4L5GA 2L3RA 1Z7MA 1TUDA 1W66A 4A63B 3CCVQ 1X2HA 4M7DF 1PKTA 2ENMA 2EJFA 4TVAA 4PFPA 3FJ5A 3CCMQ 4LVIA 1RAHB 2HD0A 3ZFJA 4OGCA 1I4K1 1KC8U 4LDVA 1QVGS 1Y57A 3P8HA 1X55A 4C0GA 3QSUA 3VS6A 1EFWA 4M7AA 2AKWB 3VS2A 3CCRQ 2BZYA 2DJZA 2FG0A 2IVWA 2NUPA 4M7AD 3GOXA 3RNJA 2LX9A 5LL6S 4HT9A 4CC7A 1OQKA 1D3BB 3CCSQ 3CMQA 4DA4A 1O9SA 1IO6A 4BACA 3PGGA 1PWTA 4FYXB 5AT1B 2AMCB 2XMFA 2X3WD 3OYJA 1K73R 2HQXA 1RI9A 3FRNA 1BIBA 5IXFA 4J9HA 1KQSA 1KD1R 1CKBA 4TVRA 2KSSA 4LDWA 2RQRA 1NJIR 3A32A 3MEAA 1EQRA 2YUNA 1WLEA 5CO7A 4IURA 2O9SA 2EGAA 2LQWA 3HHTB 1VQKA 2HSEB 2K3BA 4YRIA 2RI3A 1IGUA 2XDPA 3MP8A 1NYGA 4WJ3M 1SEMA 1AOJA 3Q1JA 3OYAA 1I81A 1B3QA 4PJLA 1ATIA 2QEXT 2MK5A 1OX8A 2YDLA 2IPOB 3PMTA 4DBFA 2RK2A 3QBYA 4A4GA 3HXXA 4MDWA 2VB6A 3M0PA 2JXBA 3H8ZA 4OMMA 4FU6A 3CXCP 4NL3A 5GANd 3JCMb 2E3IA 1WJSA 2MF2A 2JVVA 1AWOA 1AHJB 3UH0A 2HL5C 4BI8B 1H641 3C95A 4M78B 3OY9A 4JRIA 3UATA 3JCMQ 1TUGB 2E5AA 3CBPA 5CKEA 1WJQA 1NJ1A 1VQ5Q 1E24A 1WQ7A 2K79A 1WHMA 4TVYA 1WI7A 1WU7A 1NEBA 4IKFA 4HT4A 4JDSA 3VUZA 1G51A 2E64A 4XU0A 2DU5A 4Y92A 5CAIA 2L3PA 4E7LA 4M77D 2L3QA 2KBTA 3I35A 2P4RA 1JU5C 1NLOC 4M7DG 1G8XA 3CCLQ 1VQ7A 4J7FA 3IG2A 1BYMA 5GMKm 1PRLC 3M4QA 1KK7A 4HT8A 2BTTA 2EGCA 4GLKA 2R57A 2YUQA 1YI2Q 4K11A 3TSWA 1GGMA 3A1PA 1VQMQ 3OYDA 5IHKA 3G4SQ 3HXWA 2X4WA 2OTLA 2QHUA 1KOGA 4M77C 1USYC 5GJVB 2D0QB 2EYZA 2JTMA 1G2BA 2QEXA 1OPKA 4OMPA 2I2LA 2DAQA 2KMTA 4M75F 3OBYA 3D7SB 1CKAA 4NOYA 3ERRA 2OTJA 3VYHB 2OI3A 4PJJA 3CCQT 3QZ9B 4MDXA 4C0DC 2GTJA 4VUBA 1NYQA 3CCMT 4JJNK 1MMGA 1I5LA 5CK9A 2LRQA 4M77G 2AZSA 4UP7A 4R55A 4RTXA 1X27A 3BJUA 1SSFA 5FRNA 4YRGA 3P8VA 2LCLA 2Y4YA 5IN1A 2SRCA 3CBMA 1WZOA 2RNAA 2K5FA 4P74A 4X9CA 3EHQA 4EIKA 1MNEA 1PSEA 2LZ6B 2KQWA 5LJ5e 1M90C 1VOMA 3LH0A 3CCSA 1PYSB 4QVDA 3PFSA 2EGEA 4CC4B 2L8DA 4A4HA 2DRMA 4J9FA 1VQKT 1QMCA 4Q15A 1MMNA 4FIBA 4JLIA 4Z88A 3X20B 4KR2A 2WSEE 3WVEB 4EDUA 2EFIA 2CUBA 5C6SA 1E1OA 1TS9A 1FMVA 2RJEA 3QKJA 1N6AA 3L2ZA 1YHQQ 1Q86C 2E3CA 2D9TA 4M75A 1JQQA 1VQ9A 4J5YA 4P75A 2RH2A 3L2VA 1WGSA 3JAME 1I8FA 3R6NA 4MMKA 4XTYA 2LNHB 3CEYA 3EGDA 2EWNA 4ZGEB 2VGMA 1X2GA 3CPWS 2G4CA 2CZ7B 4J83A 3JCMh 3I56A 2X4XA 2CP7A 4KRTA 1D1CA 3C12A 2LQ8A 3VKIA 4R0KA 4JJDA 1VQ6A 2ZPIB 4CS4A 2ZAEA 4QKUA 2I4MA 1M30A 4M78E 1IGQA 1Y96B 4KH0B 4B6MA 1NJ2A 5DM7R 4PJOA 1QVFA 1T3LA 1NZ9A 3M56A 5EC7A 3M53A 4KQEA 3BDUA 1Z9ZA 4HXJA 1Q81U 4H02A 1K1ZA 2DQ3A 3GBQA 2DRKA 4EMHA 5FW9A 2O4XB 3U23A 2GCXA 5CKDA 4Q5WA 2LT4A 4CRIA 4RQEA 3OYBA 5CCAA 4FM4B 3CPWP 5J39A 4E7HA 4WTOB 1MUZA 3S3MA 1K76A 3HKSA 4YRPA 1WQWA 2ARUA 4P75C 2LX7A 2E6NA 3CC4A 2FRWA 1SG5A 3HL8A 3RL6A 4BE1A 1VQPA 2QAZA 4LD9K 2KT1A 2DETA 2EKHA 3TSZA 2PTKA 5CR2A 4L87A 4KH1B 1OOTA 1B8AA 4NCXA 3ZEHA 5C53B 2LMJA 5I21A 1K73C 1OZ3A 3CCJT 5C52B 2KRNA 5I2MA 1MHNA 3T9NA 1Y71A 5CQYA 3H0HA 4JJBA 2ZXFA 3M58A 5FU6B 2P5IA 2HZYA 1RLPC 3JCMW 1YJWT 2VC8A 3EG0A 1D3BA 3HFZB 4M75D 1KJWA 4BB7A 4E7IA 1VQZA 3H0FA 3E1SA 4V2SA 3LW5E 3L2QA 5A2QE 3I56Q 2COYA 5HK3A 4BD3A 2IY5B 4XAXB 2CT3A 5IHIA 4AG2C 1F1BB 3FJPA 3HFZA 1RAGB 1ZSZC 1JO8A 3DKMA 2YWWA 1I5OB 3CCUT 2MAMA 2BZXA 1Q95G 2LTOA 2B86A 2E12A 1OI1A 4C0DB 1VIFA 1QWEA 2JMAA 5GMKl 2NUTA 1M3BA 3P8DA 3QO3A 1B7TA 2RQTA 1MMDA 3LSSA 5D7UA 1UHCA 2PNIA 2YRVA 1WYXA 1U5SA 2HQEA 3QYGB 4P71A 3OD1A 2PQWA 2CP6A 1PSFA 5KE2A 4BDYA 1OPLA 1QVPA 2ZCFB 3SEMA 4ZTUB 4YRRA 1BCOA 1WIEA 2RMOA 3INZA 4P3NA 1KC8C 4J9CA 5FWCA 3LH5A 4YRNA 5KYYB 4UC4A 2ROTA 1T0HA 2EKOA 4FSSA 2QDLA 1EIFA 2V8IA 4GY5A 2ED1A 4R56A 3MHXA 1U1TA 4J15A 1E6GA 1QLYA 1VQ5A 2M9UA 5ECAA 3VQYA 3TEHB 4C5HA 3S3NA 3VUBA 1QVFP 2QGFB 3ICAA 3OYLA 2F69A 3CMET 1G3TA 4WF2A 2ZZFA 4LDYA 2PUOB 1K9AA 4EPCA 5F5WA 4TQDA 1EFNA 3OYMA 1J5WA 2LP5A 4RDXA 2RJCA 1IZ6A 4LN2A 1E22A 4M75G 6AT1B 5I11A 2MWPA 3M4YA 4IUTA 1O75A 3ULRB 1YJWA 4BI3A 1IB8A 1W4SA 3HTRA 2PUKB 4CS3A 5GAOm 3P8BB 2K7AA 4M77F 3OA6A 5FU7C 1ZQ1A 3QDFA 2X4YA 2DBKA 3JSCA 3NETA 3J80E 3P8YA 3MJXA 2OAUA 3VJPA 3CCMA 3HFNA 1XOVA 4K87A 4HCBA 2PMEA 2KYMA 4TQFA 3JCMd 1JJ2A 4C8QD 2AKLA 2OJ2A 3CCRT 1W2BS 4M4ZA 1UG1A 2HNIA 2DKGA 4H2YA 1T0JA 2A37A 3WXMB 3UA6A 3O5ZA 2RD1A 1JJ2S 2FRYA 1GCQA 4AG1C 3LLRA 4RKUE 3A8MB 1NBEB 4M7AG 2QQRA 2ROLA 2LJ1A 2L0AA 1V1CA 3R6OA 4OMOA 3OYEA 1L0WA 5ELNA 4XU1A 4RTVA 3EGXA 1X01A 2V1QA 1GXIE 1KMNA 2H8HA 1ZA2B 3I7FA 1S1NA 1QWFA 4P72C 1HXDA 1YJNQ 3DSQA 3SWNA 1BB9A 1YJWQ 4QQGA 3G4ST 3M9QA 4M77B 5HCKA 1UTIA 2ALYA 1WXUA 3WVDB 4OMLA 2JM8A 2D1XA 5EG2A 4J7IA 2DL7A 4YP0A 3F70A 4PJOC 1B76A 4YCUA 1M5Q1 1QW1A 2C7IA 2LJ3A 3HRIA 4KGZB 4BDZA 1M4ZA 2GF7A 1M3CA 3V8JA 4OB3B 4JRPA 1PC0A 1YBYA 1LCKA 4L6V5 5DLOA 4TTVA 2R5MA 1Q7YR 4EO4A 4MZMA 2ODRD 3JB9J 4KBMB 3NMZC 4EMKA 4C92F 2DJQA 4ZN3A 5KH6A 3W3SA 2AHJB 3SWNC 3H0IA 1TXQA 3RDVA 1YITT 1WFWA 3TQ7P 3NGPA 4M7DA 2CJ9A 1ZX6A 3REBB 2VASA 1GCQC 3M54A 3G1JA 3CD6T 3PNWC 1HYOA 3EG2A 2ALYB 5GJWB 4CC2A 3LWHA 3CCJQ 4BE2A 1YFSA 2ZR3A 9ATCB 3M0UA 2ZPGB 3MPUB 4Y91A 3GLXA 2QEXQ 4P72A 2DD4A 1B70A 4H2TA 2H3EB 2DMOA 1NG2A 2FZGB 4WI1A 4E6RA 1UHFA 1K9MC 1X2KA 1NJ6A 2RK1A 1H8KA 4A53A 3EG9B 4DBRA 2JJ9A 1YCYA 1MV3A 2F5KA 5LJ3j 4X9DA 1ZUKA 4OB2B 1YI2T 2XU8A 4PFOA 4PJNA 2Q5IA 1UGVA 4ESRA 1C1AA 3NTHA 7AT1B 1LPLA 4OMNA 2A7YA 1S72Q 1KD1U 2J3MA 2CP2A 3VS4A 2KEAA 2L3SA 4M78G 4M77E 1HC7A 4M7DB 2PVGB 1VQNQ 4ATOA 3A98A 4AT1B 1UFFA 5IH2A 1UE9A 1WXTA 5A0DA 1YI2A 1K0SA 1WJRA 2DVJA 4G84A 3QO8A 4M75E 1W2BP 4J9GA 1NYFA 4LNSA 3UPUA 2NUPB 3J81E 2CP0A 3SWNB 4Y28E 2JZ2A 5GMKj 1M1KU 4F7UF 5GAMe 5KCOA 3OYCA 4X5OA 3RKXA 1D0ZA 3JRZA 3G6ET 3PCOB 4F16A 1TSFA 2PVOB 2KROA 5GAOp 2X9HA 4OGEA 3META 4L59A 5GANj 3KFUA 1WHHA 4C8QE 2XGTA 4C5IA 2E5QA 3HRTA 4ZTFA 3CD6A 2FYKA 4UP8A 4BY6B 2DTHA 1KIKA 3LX7A 2XD0A 2CKKA 1SRYA 1YITA 5KYUA 1KQSS 2HBWA 1YFNA 2O01E 5LJ3e 1YP5A 2RHUA 2J05A 4O2DA 2IY5A 3VS3A 5FWBA 1QCNA 2RI2A 1KQ2A 3DB3A 4C92G 3HY0A 2GQVA 4KGVB 4HVCA 2JW4A 1W6XA 4IUVA 1E7OA 4JPBW 4LD6A 3DLLA 2RQWA 1C6VX 1SRLA 4MMLA 3C0CA 1FYFA 1OULA 4IUPA 4PL6A 3CMEQ 1WLPB 3L4GA 1UDLA 1ZBJA 3RKWA 4G85A 4FCYA 1FXXA 3JCMg 2E41A 4KULA 1K4US 3NHNA 2DEUA 1TUCA 4HCCA 2LVMA 1J3TA 3AHUA 2RHQA 2VGNA 3UGTA 2A8EA 3JCMX 2A36A 2CH4W 2GBQA 2KXDA 2DPPB 3EGUA 3O8VA 1H4QA 5LJ3f 3QUIA 2A08A 4GLMA 4M75B 3UFGA 5GAMh 3JV3A 4MZTA 1M8VA 2RO0A 2DA9A 2YUPA 3NEMA 3EGDB 2K9GA 3UGQA 1ZBXA 2QYZA 3KUFA 2QQSA 2K57A 4HA8A 5HK0A 4XU2A 2HL3A 4M78A 1HSQA 1LOJA 2COWA 2EVRA 2AK5A 4LVMA 1YFRA 1IXDA 3TEHA 2CZ6B 4K88A 4RTTA 1M90U 1UGRB 2D0NA 2K5IA 3A74A 4OVAA 5M9OA 5DLQE 1B7YA 2DDZA 1VYTA 2KAFA
chains in the Genus database with same CATH topology
1KG1A 1V29B 5AYFA 2K5LA 3RMQA 2RJDA 3J7AF 2E70A 4F7UG 2Y90A 1G5VA 4X34A 4RMOA 2PVDB 3CC2T 4YDQA 4C8QF 3CCLA 3UWNA 1YGBA 2DIQA 1VQNA 5GANh 3TEGA 3LGFA 2GFUA 2BUDA 1DJ7B 4IUUA 1S72A 1R8OB 5LJ5d 3E9GA 3V7SA 3WQZA 3M5AA 2K4YA 4J6WA 2QHSA 1B7YB 3CXCA 3QXEB 4QQDA 3OW2S 1VIEA 5GAN5 1NNHA 1YJ9T 3A31A 2BIVA 1M1GA 2P0LA 2HAXA 1NE8A 1VQ6T 4J6YA 3HTZA 2JN0A 3QYHB 1VQOT 2QQAA 2Y4XA 3QHSA 3HSBA 4YCWA 4P73C 4UP9A 4OMFB 2EIFA 1K73U 2ZT6A 3MF1A 1VQ8T 2NLUA 2RI5A 3HXZA 1UEBA 5D6XA 4E47A 4C92D 2ZIMA 3FB9A 2I4LA 2RM4A 2CZ0B 5CVIA 3A8OB 1BI2A 5GAN2 1K9MU 4BWAA 3LWIA 3G1ZA 5HKCA 5GAN7 4HKEA 3RESA 1WYDA 1WPYA 3E9IA 2ZZGA 1YFTA 3QIIA 3CPWA 2YLCA 3JB9H 1VQNT 3OS1A 3JB9D 3MO8A 2ZT7A 3JB9I 4HWTA 2FL7A 2V8JA 3G7ZA 2CJAA 2ZZDA 3RKYA 5GANf 11ASA 2Q5HA 4MZPA 1NPPA 2QA4A 2VYTA 1YJNA 2P0KA 1G3SA 1IL2A 4BE0A 2L5QA 4PLLA 3JCMf 3EFRA 3M4PA 3RGLA 3HPWA 4BW9A 5FROA 1XTDA 1EVLA 4II1A 3CMAT 3OSSC 2XK0A 1H3ZA 5GAMf 2RHQB 2O4XA 3CCVA 4LVJA 2FB7A 2DU7A 4ZGJB 2XDBA 3NTIA 3CC7A 3A5YA 4CS2A 1EVKA 2DTOA 3V8LA 4HWRA 3CMAA 5GAN6 3SFMA 2DIGA 4XEOA 3REUA 1XQHA 2XHCA 3NENA 4PKCC 4A4KA 3HXVA 2M16A 4P74C 5HY6A 1UGPB 4XK8E 4ME7A 4JRKA 1NJIC 5J26A 3GP8A 3OQ5A 5GAOl 4E7JA 3A8HB 3PIPA 4H2XA 3V8KA 4M7DD 4XEMA 2DZ9A 4BI4A 3QG1A 4P3OA 3NELA 3QPHA 4C0ZA 3BFMA 5I2SA 4ELYC 2ZNJA 5GAOn 1X56A 2MI6A 5C0MA 1UGSB 1NYRA 1N9WA 3M4GA 1XNIA 4EMKB 5D6YA 4BY6C 3RIRA 3CCUA 4TVAB 5A0GA 3MEUA 2LT1A 4P3PA 3EFSA 4P5NA 3JCMP 4RG2A 1H4VB 3HRUA 5FRMA 3MP1A 2C8MA 4P71C 5A0LA 5GMKe 2KY9A 5GAMj 5CKFA 3NFCA 4YRMA 1BIAA 2ZZEA 4ZTJA 3CC7T 2R58A 3IKMB 4B9XA 2HBPA 1VQOA 2DEQA 1BBUA 3QJYA 1B34B 3QJ6A 2EQMA 2V8KA 3G6EA 1KHCA 2F5TX 2IG0A 4XU3A 1OZ2A 4LVKA 4DOWA 3C94A 5GMKi 2RHZA 2FVUA 4H2VA 5E3IA 2MWOA 3VV0A 2EQJA 4YRQA 2D6FA 4PJOG 4LDXA 5KNNA 3FLGA 1S72T 3VQXA 3UT1A 2QXFA 4KUDK 3CXCS 4YYEA 2DQ0A 3CPFA 4M75C 5GANg 1FWZA 3KBGA 3HY1A 4H2XB 1VQ7T 3VU3C 2RHXA 1K8AC 3GIBA 1QVGA 3A5ZB 4A54A 2ARSA 3L2RA 1B34A 2RHSA 3HRKA 3LC0A 3MEYA 5GANe 3SB2A 3I55T 2P0PA 4FT4A 4DOVA 4PJOE 5GAMg 4DQ2A 3OYKA 2OTJT 4N0AC 1VQ5T 1KQ1A 4C8QA 1U8RA 2QA4T 1YHQT 3REXA 3MEWA 2YHTA 3OYNA 3V7CA 2DK3A 3OYGA 4ELZC 4YRSA 4M7DC 1ASYA 2KDSA 4C8QB 1JB0E 4ZIBA 1YHQA 3E9HA 2XIDA 1Y7XA 1B70B 1QP3A 1QE0A 2C06A 3TCJA 1Q82U 5HGQA 3JB9G 4PJOD 4M77A 1FX7A 2QHVA 3L4GB 2ZT5A 1E1TA 3TREA 3E19A 2DD5A 4LDUA 2DXUA 4M78D 3GF5A 1YJNT 1JJCB 3IALA 4N4HA 2E65A 4RQFA 3PTAA 2E1HA 1G5HA 4PHCA 5CIUA 1C0AA 4RG8A 3BY7A 4HWSA 2X4JA 3HRSA 4RCBA 4CH6A 3E9FA 4H2SA 3DB4A 3TU4K 2QQBA 4N0AA 4ZGDB 5CKBA 3X24B 3SD4A 2JTFA 2R5AA 5D6WA 2ZPEB 4C8QC 3CCRA 3OB9A 4M7DE 4OLFA 4YRJA 2QI2A 4C92B 4QVZA 4XQ3A 4XTWA 4EMKC 3JCMV 4XTVA 1WNLA 5KCHA 3PMIA 2A3LA 3OS0A 1ADJA 2ZPHB 4B9WA 2EJ9A 4C8QG 4FL6A 1VQ4T 3FIFA 1HTTA 3CCQA 2CZ1B 3ME9A 1N9RA 2ZINA 4PJOB 3VBBA 5GAMd 2XI9A 2WSFE 4IUQA 5GAOq 2EAYA 1M1FA 3MF2A 4XTXA 2ZPBB 4A4FA 3FEOA 3X26B 4C5GA 3RERA 4YRFA 2M0OA 1KD1C 3NTKA 1SERA 5FU7B 3OYYA 3PIOA 2JOYA 1VUBA 5GMKh 3R07A 4QVCA 4J8OA 2FHDA 3L2WA 1VQ9T 4RCCA 2ZIOA 1TH7A 1LJOA 3V7RA 1RL2A 4F7UE 4JS4A 2RA2A 2B8AA 3S6WA 5LJ3d 3HFVA 4EX5A 4PG3A 2VXEA 1Q7YU 3RMSA 4TVWA 2MMPA 1PYSA 2VV5A 3BW1A 2RHIA 3L42A 4ZN1A 3LGLA 3OSVA 2DVEA 3G71T 5GAN8 1EIYB 2EJGA 4OB0B 2G3RA 3FC3A 3OS2A 4YRLA 4KR3A 4E51A 2DXCA 3CCVT 4H2UA 2DO3A 1NJ8A 5LJ3h 4JRQA 4M7AE 3QO5A 1X75C 1VQMT 2EL9A 2CS7A 2JUFA 4NL2A 2ZCEA 3TUPA 1QF6A 3JCMJ 3KXTA 3SDZA 3IKLA 2ZNIA 4JS5A 3OBWA 4O5VA 3I56T 4C0FA 3ZBDA 3C4SA 2ZPFB 1BI0A 3GPLA 4HWPA 2Q7EA 3CBOA 1QP2A 3P8TA 3I55A 3HP9A 1VQPT 2CIMA 2ZTGA 5LJ5f 1YIJT 1NPRA 4M7AB 2AKWA 2EYQA 2ARTA 3DLMA 3CCET 1RI0A 1P92A 4YTLA 1BKBA 4M78C 3H6ZA 1ZHIA 3G71A 5FU6C 3L2UA 5DY9A 12ASA 5CQXA 1ASZA 4AH6A 2WACA 2QQ9A 3JCMe 4N4GA 4C92C 3RACA 4JUVA 3JB9F 4M7AF 3ER0A 4P73A 3OMGA 1NJ5A 2XDDA 4YPFA 3MQZA 2K3XA 1VQLA 3HXUA 2VUBA 2RHYA 2JNGA 3TEEA 3GNFB 2K3YA 1M9SA 4O6JA 1Q82C 1Q81C 4YCVA 3OYHA 2LQKA 1USYA 4OB1B 2M1HA 3MEVA 1JRIA 2YLBA 5L8RE 1SETA 2RJFA 4PLIA 3A7AA 3QTCA 2I4NA 4LVLA 2P0QA 4XTZA 3HXYA 5C51B 4KUIA 1N8RU 3JCMc 1N9SA 2VXFA 1N27A 3MP6A 3OMCA 3CCST 2L89A 3GNGA 5CKHA 1YB3A 1X54A 4HWOA 4CI0C 1Y96A 4D6WA 2QTXA 3MCAB 2LDMA 4H2WA 4BUGA 2PU9B 3CCEA 2ZT8A 1VQ4A 5K1PA 4CH4A 2H3JA 1Q7YC 5LJ5j 1BBWA 3RUXA 1G3WA 4YRCA 1YIJA 1VQ8A 3UDCA 3HFOA 5GAOr 2E6ZA 4PNOA 3PZCA 3X25B 2EQKA 4K86A 4QW2A 4KT0E 4A4EA 2DZCA 4M78F 1JBMA 3CCJA 2I4OA 1MGQA 3M57A 4OF1A 4C92E 5KE3A 4FSXA 1W2BA 4C5EA 1YJ9A 1U1SA 1G3YA 1VQMA 4C92A 5LJ3g 1K8AU 2GFAA 3FDRA 2WSCE 1SESA 4UPAA 4FT2A 2ZGWA 1LNXA 5J3BA 2OTLT 4CH3A 3VYGA 1ADYA 3A5ZA 4YREA 4TWAA 2ODRC 3CC4T 4PJOF 5GAN3 4WJ4A 3LSQA 3QO7A 5K1XA 1OYXA 1G5IA 2QDYB 1H4SA 2RHSB 3CCLT 2DTIA 2CGHA 4CH5A 1LYLA 3OW2A 4EMGA 3OS5A 3CC2A 4NS5A 3X28B 3RF1A 2K2VA 2KK4A 1UB4A 2J3LA 3G4SA 1UGQB 5FLXE 1H4TA 2CJBA 5LJ5h 5IT9E 1BI3A 3QDRB 2LCCA 4YROA 5LJ5g 4J6XA 1X6OA 4N4IA 4M7AC 3QZ5B 3EAEA 4HCZA 4JLGA 1IREB 1HK9A 4DPGA 4Z02A 4ZTZB 1M1KC 3A8GB 4F7UA 2E10A 2X35A 2Q7HA 3A8LB 1RIQA 4Q6GA 3N5BB 3URGA 5IAYA 2RB6A 2DXBA 1Z7NA 4OP0A 1Y07A 3A7UA 3M59A 1KHIA 2DXTA 3PCOA 4E7KA 4RMFA 3OYFA 2CYZB 1BI1A 2EQUA 2LC4A 3CMEA 3LYIA 2ZR2A 1EIYA 1EOVA 2XKOC 3QNEA 2PMFA 2P4TA 1N8RC 1QVFS 5GAN4 2BKDN 3OYIA 4XTUA 3ASKA 1JJCA 3VQWA 1Q86U 3PT9A 2QHTA 1KMMA 2XG8D 4F7UB 1VQLT 4QQ6A 1NJIU 2XTIA 3L1AA 2Q7GA 5ELOA 4YRKA 2NS6A 3BDLA 2XICA 3M55A 3S3OA 4YRTA 3A7RA 2LNVA 3VQVA 2AMCA 2KVQG 4L5GA 2L3RA 1Z7MA 1W66A 1X2HA 4M7DF 2EJFA 4TVAA 4LVIA 2HD0A 3ZFJA 4OGCA 1I4K1 1KC8U 4LDVA 1QVGS 3P8HA 1X55A 4C0GA 3QSUA 1EFWA 4M7AA 2AKWB 2DJZA 2IVWA 4M7AD 3GOXA 2LX9A 5LL6S 4HT9A 1D3BB 3CMQA 4DA4A 1O9SA 4BACA 3PGGA 2AMCB 3OYJA 2HQXA 3FRNA 1BIBA 1KQSA 4TVRA 2KSSA 4LDWA 3A32A 3MEAA 1EQRA 1WLEA 5CO7A 4IURA 3HHTB 1VQKA 4YRIA 2RI3A 2XDPA 3MP8A 4WJ3M 3Q1JA 3OYAA 1I81A 1ATIA 2QEXT 3PMTA 2RK2A 3QBYA 4A4GA 3HXXA 4MDWA 3H8ZA 4FU6A 4NL3A 5GANd 3JCMb 1WJSA 2MF2A 2JVVA 1AHJB 3UH0A 4BI8B 1H641 3C95A 4M78B 3OY9A 4JRIA 3JCMQ 2E5AA 3CBPA 5CKEA 1WJQA 1NJ1A 1E24A 1WQ7A 4TVYA 1WU7A 4IKFA 4HT4A 4JDSA 3VUZA 1G51A 2E64A 4XU0A 2DU5A 4E7LA 5CAIA 4M77D 4M7DG 1VQ7A 4J7FA 3IG2A 1BYMA 5GMKm 3M4QA 4HT8A 4GLKA 2R57A 1GGMA 3OYDA 3HXWA 2X4WA 2OTLA 2QHUA 1KOGA 4M77C 1USYC 2D0QB 2JTMA 2QEXA 2I2LA 2DAQA 2KMTA 4M75F 3OBYA 4NOYA 3ERRA 2OTJA 3VYHB 3CCQT 3QZ9B 4MDXA 4C0DC 4VUBA 1NYQA 3CCMT 4JJNK 1I5LA 5CK9A 2LRQA 4M77G 4UP7A 4R55A 3BJUA 1SSFA 5FRNA 4YRGA 3P8VA 2LCLA 2Y4YA 5IN1A 3CBMA 2K5FA 4P74A 4X9CA 1PSEA 2KQWA 5LJ5e 1M90C 3LH0A 3CCSA 1PYSB 4QVDA 3PFSA 2L8DA 4A4HA 1VQKT 4Q15A 4FIBA 4JLIA 3X20B 4KR2A 2WSEE 3WVEB 4EDUA 2EFIA 5C6SA 1E1OA 2RJEA 3QKJA 1N6AA 3L2ZA 1Q86C 2E3CA 2D9TA 4M75A 1VQ9A 4J5YA 4P75A 2RH2A 3L2VA 1WGSA 3JAME 1I8FA 4MMKA 4XTYA 3CEYA 2EWNA 4ZGEB 2VGMA 1X2GA 3CPWS 2G4CA 2CZ7B 4J83A 3JCMh 3I56A 2X4XA 3C12A 2LQ8A 3VKIA 1VQ6A 2ZPIB 4CS4A 2I4MA 4M78E 1Y96B 1NJ2A 5DM7R 4PJOA 1QVFA 1NZ9A 3M56A 3M53A 4KQEA 3BDUA 1Q81U 4H02A 2DQ3A 4EMHA 2O4XB 2GCXA 5CKDA 4Q5WA 2LT4A 4CRIA 4RQEA 3OYBA 5CCAA 4FM4B 5J39A 4E7HA 3S3MA 4YRPA 3HKSA 1WQWA 2ARUA 4P75C 2E6NA 3CC4A 3HL8A 3RL6A 4BE1A 1VQPA 4LD9K 5CR2A 4L87A 1B8AA 4NCXA 3ZEHA 5C53B 5I21A 1K73C 1OZ3A 3CCJT 5C52B 5I2MA 1MHNA 3T9NA 1Y71A 5CQYA 2ZXFA 3M58A 5FU6B 2P5IA 3JCMW 1YJWT 2VC8A 1D3BA 3HFZB 4M75D 4BB7A 4E7IA 1VQZA 4V2SA 3E1SA 3LW5E 3L2QA 5A2QE 5HK3A 4BD3A 2IY5B 4XAXB 3FJPA 3HFZA 3DKMA 3CCUT 2MAMA 2LTOA 2E12A 1OI1A 4C0DB 1VIFA 5GMKl 3P8DA 3QO3A 3LSSA 2YRVA 2HQEA 3QYGB 4P71A 3OD1A 2PQWA 1PSFA 5KE2A 4BDYA 1QVPA 2ZCFB 4ZTUB 4YRRA 3INZA 4P3NA 1KC8C 4YRNA 4UC4A 2EKOA 1EIFA 2V8IA 4GY5A 4R56A 3MHXA 1U1TA 4J15A 1VQ5A 2M9UA 3VQYA 3TEHB 4C5HA 3S3NA 3VUBA 3ICAA 3OYLA 2F69A 3CMET 1G3TA 4WF2A 2ZZFA 4LDYA 2PUOB 4EPCA 5F5WA 4TQDA 3OYMA 1J5WA 4RDXA 2RJCA 1IZ6A 1E22A 4M75G 2MWPA 3M4YA 4IUTA 1O75A 1YJWA 4BI3A 1W4SA 2PUKB 4CS3A 5GAOm 3P8BB 4M77F 3OA6A 5FU7C 1ZQ1A 2X4YA 3NETA 3JSCA 3J80E 3P8YA 2OAUA 3VJPA 3CCMA 3HFNA 1XOVA 4K87A 4HCBA 2PMEA 4TQFA 3JCMd 1JJ2A 4C8QD 3CCRT 1W2BS 2HNIA 2DKGA 4H2YA 3WXMB 2RD1A 1JJ2S 3LLRA 4RKUE 3A8MB 4M7AG 2QQRA 3R6OA 3OYEA 1L0WA 5ELNA 4XU1A 1X01A 1GXIE 1KMNA 3I7FA 4P72C 1HXDA 3DSQA 3SWNA 4QQGA 3G4ST 3M9QA 4M77B 2ALYA 3WVDB 5EG2A 4J7IA 4YP0A 3F70A 4PJOC 1B76A 4YCUA 1M5Q1 1QW1A 2C7IA 3HRIA 4BDZA 1M4ZA 2GF7A 3V8JA 4OB3B 4JRPA 1YBYA 4TTVA 4L6V5 5DLOA 2R5MA 4EO4A 4MZMA 2ODRD 3JB9J 4KBMB 4EMKA 4C92F 4ZN3A 5KH6A 3W3SA 2AHJB 3SWNC 1YITT 2CJ9A 4M7DA 3M54A 3CD6T 3PNWC 2ALYB 3LWHA 4BE2A 1YFSA 2ZR3A 2ZPGB 4Y91A 3GLXA 4P72A 2DD4A 1B70A 4H2TA 4WI1A 1K9MC 1NJ6A 2RK1A 4A53A 1YCYA 2F5KA 5LJ3j 4X9DA 4OB2B 1YI2T 2XU8A 2Q5IA 3NTHA 2A7YA 1KD1U 2J3MA 4M78G 4M77E 1HC7A 4M7DB 2PVGB 4ATOA 5A0DA 1YI2A 1WJRA 4G84A 3QO8A 4M75E 4LNSA 3UPUA 3J81E 3SWNB 4Y28E 2JZ2A 5GMKj 1M1KU 4F7UF 5GAMe 5KCOA 3OYCA 4X5OA 3RKXA 3JRZA 3G6ET 3PCOB 2PVOB 5GAOp 4OGEA 3META 4L59A 5GANj 3KFUA 4C8QE 2XGTA 4C5IA 2E5QA 3HRTA 4ZTFA 3CD6A 2FYKA 4UP8A 4BY6B 2DTHA 3LX7A 2XD0A 2CKKA 1SRYA 1YITA 1KQSS 2O01E 5LJ3e 2RHUA 4O2DA 2IY5A 2RI2A 1KQ2A 3DB3A 4C92G 3HY0A 2GQVA 4HVCA 4IUVA 4LD6A 3DLLA 4MMLA 1FYFA 4IUPA 4PL6A 3L4GA 3RKWA 4G85A 1FXXA 3JCMg 2E41A 4KULA 4HCCA 2LVMA 2RHQA 3AHUA 3UGTA 2VGNA 2A8EA 3JCMX 2DPPB 3O8VA 1H4QA 5LJ3f 3QUIA 4M75B 3UFGA 5GAMh 4MZTA 1M8VA 2RO0A 3NEMA 3UGQA 1ZBXA 3KUFA 2QQSA 2K57A 4HA8A 5HK0A 4XU2A 1LOJA 4M78A 4LVMA 1YFRA 3TEHA 2CZ6B 4K88A 1M90U 1UGRB 2K5IA 3A74A 4OVAA 5M9OA 5DLQE 1B7YA 2DDZA 2KAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZT5 A;  1E1T A;  5C52 B;  1H4T A;  2CJB A;  5LJ5 h;  4YRO A;  5LJ5 g;  4F7U G;  2Y90 A;  4J6X A;  2DXU A;  2ZXF A;  4YDQ A;  4M78 D;  2P5I A;  4M7A C;  1JJC B;  3IAL A;  4C8Q F;  2E65 A;  4RQF A;  1YGB A;  3JCM W;  5GAN h;  2E1H A;  2VC8 A;  1D3B A;  1HK9 A;  3HFZ B;  4M75 D;  3TEG A;  4DPG A;  1G5H A;  4PHC A;  4ZTZ B;  1C0A A;  4F7U A;  2E10 A;  2Q7H A;  1VQZ A;  1RIQ A;  4V2S A;  4Q6G A;  3BY7 A;  5LJ5 d;  4HWS A;  3V7S A;  3WQZ A;  4RCB A;  4CH6 A;  2RB6 A;  2IY5 B;  1Z7N A;  4J6W A;  4OP0 A;  4H2S A;  3A7U A;  2QHS A;  2DXT A;  3FJP A;  3HFZ A;  3PCO A;  1B7Y B;  4N0A A;  4RMF A;  5GAN 5;  1NNH A;  3A31 A;  2ZR2 A;  1EIY A;  4C8Q C;  2P0L A;  1EOV A;  3QNE A;  2PMF A;  4J6Y A;  3HTZ A;  4M7D E;  4OLF A;  5GAN 4;  4YRJ A;  5GMK l;  3QO3 A;  4XTU A;  2JN0 A;  4C92 B;  1JJC A;  3VQW A;  4XQ3 A;  4XTW A;  4EMK C;  2QHT A;  3LSS A;  3QHS A;  3HSB A;  1KMM A;  3JCM V;  4YCW A;  4P73 C;  4UP9 A;  4XTV A;  4P71 A;  2ZT6 A;  3MF1 A;  1WNL A;  3OD1 A;  4F7U B;  4ZTU B;  4YRR A;  2XTI A;  3INZ A;  3HXZ A;  4P3N A;  1ADJ A;  2EJ9 A;  4C8Q G;  3L1A A;  2Q7G A;  4C92 D;  2ZIM A;  5ELO A;  3FIF A;  4YRK A;  1HTT A;  4YRN A;  3FB9 A;  2I4L A;  2RM4 A;  1N9R A;  2ZIN A;  4PJO B;  4YRT A;  3VBB A;  3A7R A;  3VQV A;  2AMC A;  5GAM d;  1Z7M A;  1W66 A;  1U1T A;  4J15 A;  5GAN 2;  5GAO q;  2EAY A;  1X2H A;  3VQY A;  3TEH B;  4BWA A;  4M7D F;  3MF2 A;  2EJF A;  3G1Z A;  3ICA A;  4TVA A;  4XTX A;  4WF2 A;  5GAN 7;  2ZZF A;  3RES A;  3RER A;  1WYD A;  1WPY A;  1I4K 1;  4YRF A;  5F5W A;  4TQD A;  3E9I A;  1X55 A;  1J5W A;  2ZZG A;  4RDX A;  1YFT A;  1E22 A;  2YLC A;  3QSU A;  1EFW A;  4M7A A;  2AKW B;  3JB9 H;  1SER A;  4M75 G;  2DJZ A;  3JB9 D;  5GMK h;  3R07 A;  4QVC A;  4M7A D;  3JB9 I;  2ZT7 A;  4HWT A;  4HT9 A;  2CJA A;  1D3B B;  3CMQ A;  3PGG A;  3RKY A;  5GAN f;  11AS A;  4RCC A;  5GAO m;  4CS3 A;  4M77 F;  2AMC B;  2Q5H A;  2ZIO A;  1TH7 A;  1LJO A;  3V7R A;  1BIB A;  3NET A;  3P8Y A;  4F7U E;  1IL2 A;  2RA2 A;  3HFN A;  3A32 A;  4K87 A;  2PME A;  3HFV A;  5LJ3 d;  1EQR A;  3JCM f;  4PG3 A;  3JCM d;  4TQF A;  4EX5 A;  3EFR A;  3M4P A;  1WLE A;  3RGL A;  4C8Q D;  2VXE A;  4BW9 A;  1EVL A;  2HNI A;  2DKG A;  4TVW A;  4YRI A;  4H2Y A;  1PYS A;  3BW1 A;  5GAM f;  2RHQ B;  4WJ3 M;  2DVE A;  1I81 A;  5GAN 8;  2RD1 A;  1EIY B;  1ATI A;  2FB7 A;  2EJG A;  2DU7 A;  4M7A G;  3HXX A;  4YRL A;  4KR3 A;  4E51 A;  3A5Y A;  1L0W A;  4H2U A;  1EVK A;  5ELN A;  1NJ8 A;  4CS2 A;  5LJ3 h;  2DTO A;  4XU1 A;  4NL3 A;  5GAN d;  3JCM b;  1X01 A;  1KMN A;  4M7A E;  3V8L A;  3I7F A;  4HWR A;  4P72 C;  1HXD A;  5GAN 6;  3DSQ A;  3SWN A;  3QO5 A;  4XEO A;  3UH0 A;  1H64 1;  3REU A;  4M78 B;  3NEN A;  2EL9 A;  4M77 B;  4NL2 A;  4JRI A;  2ALY A;  3JCM Q;  3HXV A;  2E5A A;  2ZCE A;  1NJ1 A;  4P74 C;  3TUP A;  1E24 A;  4PJO C;  1B76 A;  4YP0 A;  1WQ7 A;  1QF6 A;  3JCM J;  3IKL A;  4TVY A;  4JRK A;  1M5Q 1;  4YCU A;  2ZNI A;  1WU7 A;  2C7I A;  3HRI A;  1G51 A;  2E64 A;  3V8J A;  5GAO l;  4HWP A;  4XU0 A;  2Q7E A;  2DU5 A;  5CAI A;  4M77 D;  4TTV A;  3P8T A;  4M7D G;  4EO4 A;  2CIM A;  2ODR D;  2ZTG A;  3JB9 J;  4H2X A;  3V8K A;  5LJ5 f;  4M7D D;  4EMK A;  3IG2 A;  4C92 F;  4XEM A;  3W3S A;  2DZ9 A;  5GMK m;  3SWN C;  3M4Q A;  2CJ9 A;  4M7D A;  4P3O A;  3NEL A;  4HT8 A;  4M7A B;  2AKW A;  2ART A;  3BFM A;  2ZNJ A;  5GAO n;  1X56 A;  1GGM A;  1NYR A;  2ALY B;  1N9W A;  2ZR3 A;  1YFS A;  3HXW A;  4M78 C;  2QHU A;  1KOG A;  4M77 C;  1USY C;  3M4G A;  4EMK B;  4Y91 A;  3RIR A;  5DY9 A;  4P72 A;  1B70 A;  4H2T A;  4TVA B;  12AS A;  4P3P A;  2I2L A;  1ASZ A;  4WI1 A;  1NJ6 A;  3EFS A;  4M75 F;  4AH6 A;  3JCM P;  4A53 A;  3JCM e;  4C92 C;  1H4V B;  3RAC A;  4JUV A;  4NOY A;  3JB9 F;  3ERR A;  1YCY A;  5LJ3 j;  4X9D A;  4M7A F;  1NYQ A;  4P73 A;  2Q5I A;  1NJ5 A;  1I5L A;  2C8M A;  4P71 C;  5GMK e;  4YPF A;  4M77 G;  5GAM j;  2J3M A;  3HXU A;  4M78 G;  4UP7 A;  4YRM A;  4M77 E;  1BIA A;  1HC7 A;  4M7D B;  2ZZE A;  4YCV A;  3BJU A;  3IKM B;  1USY A;  2DEQ A;  1JRI A;  2YLB A;  1BBU A;  1SET A;  3P8V A;  4YRG A;  3A7A A;  3QTC A;  2I4N A;  1B34 B;  4XTZ A;  4G84 A;  4P74 A;  4X9C A;  3HXY A;  3QO8 A;  4M75 E;  4XU3 A;  5LJ5 e;  5C51 B;  3JCM c;  4LNS A;  1N9S A;  2VXF A;  3SWN B;  1PYS B;  5GMK i;  4QVD A;  5GMK j;  4F7U F;  5GAM e;  4H2V A;  4X5O A;  5E3I A;  3RKX A;  1YB3 A;  3PCO B;  4Q15 A;  1X54 A;  4JLI A;  4HWO A;  4YRQ A;  5GAO p;  4PJO G;  5KNN A;  4KR2 A;  3KFU A;  5GAN j;  4C8Q E;  1Y96 A;  2XGT A;  2FYK A;  2QTX A;  4UP8 A;  3VQX A;  1E1O A;  4H2W A;  3L2Z A;  4YYE A;  2DTH A;  2ZT8 A;  2E3C A;  5K1P A;  2DQ0 A;  4CH4 A;  4M75 A;  4J5Y A;  1SRY A;  5LJ5 j;  1BBW A;  4P75 A;  4M75 C;  3RUX A;  4YRC A;  5GAN g;  3HFO A;  3HY1 A;  4H2X B;  1I8F A;  4MMK A;  4XTY A;  5GAO r;  5LJ3 e;  3VU3 C;  4PNO A;  4O2D A;  3GIB A;  2EWN A;  2IY5 A;  3PZC A;  4K86 A;  4A54 A;  1X2G A;  1KQ2 A;  4C92 G;  3HY0 A;  2ARS A;  2G4C A;  2DZC A;  4HVC A;  3JCM h;  1B34 A;  2RHS A;  4M78 F;  1JBM A;  3HRK A;  2I4O A;  3LC0 A;  5GAN e;  3MEY A;  1MGQ A;  3SB2 A;  4MML A;  4C92 E;  1FYF A;  4CS4 A;  2I4M A;  4M78 E;  4PJO E;  5GAM g;  4DQ2 A;  1Y96 B;  1NJ2 A;  1U1S A;  3L4G A;  4PJO A;  4N0A C;  3RKW A;  4G85 A;  1KQ1 A;  4C8Q A;  4KQE A;  4C92 A;  3BDU A;  3JCM g;  2E41 A;  5LJ3 g;  2RHQ A;  3AHU A;  4H02 A;  3UGT A;  2DQ3 A;  3JCM X;  3REX A;  4EMH A;  2YHT A;  4UPA A;  1SES A;  1H4Q A;  5LJ3 f;  3QUI A;  2ZGW A;  1LNX A;  4M75 B;  3V7C A;  4CH3 A;  3UFG A;  5GAM h;  1ADY A;  4YRS A;  4RQE A;  4M7D C;  1ASY A;  3A5Z A;  4YRE A;  1M8V A;  4TWA A;  2ODR C;  4PJO F;  4C8Q B;  5GAN 3;  4WJ4 A;  3LSQ A;  3NEM A;  4ZIB A;  3QO7 A;  5K1X A;  4YRP A;  1WQW A;  3UGQ A;  1G5I A;  3E9H A;  2ARU A;  4P75 C;  1H4S A;  2RHS B;  1B70 B;  2DTI A;  3RL6 A;  2CGH A;  4CH5 A;  1QE0 A;  1LYL A;  5HGQ A;  3JB9 G;  2K57 A;  4HA8 A;  4EMG A;  4XU2 A;  1LOJ A;  4M78 A;  4PJO D;  4M77 A;  1YFR A;  4L87 A;  3RF1 A;  3TEH A;  4K88 A;  1B8A A;  4NCX A;  5C53 B;  2J3L A;  5I21 A;  2QHV A;  3A74 A;  3L4G B;  1B7Y A;  2DDZ A; 
#chains in the Genus database with same CATH topology
 1KG1 A;  1V29 B;  5AYF A;  2K5L A;  3RMQ A;  2BZ8 A;  2RJD A;  3J7A F;  1RAA B;  1NM7 A;  2E70 A;  4F7U G;  2Y90 A;  1G5V A;  1WHG A;  2W10 A;  4X34 A;  4RMO A;  2PVD B;  3CC2 T;  4IIM A;  4YDQ A;  3VRZ A;  4C8Q F;  3CCL A;  3EFO A;  3UWN A;  1YGB A;  2DIQ A;  1VQN A;  5GAN h;  3TEG A;  1EX4 A;  3LGF A;  2GFU A;  2BUD A;  1DJ7 B;  4IUU A;  1ZUU A;  1S72 A;  3CC7 Q;  1R8O B;  5LJ5 d;  3E9G A;  3V7S A;  2EYW A;  3WQZ A;  3M5A A;  2FPD A;  2O9V A;  2K4Y A;  4J6W A;  3EFO B;  4LNP A;  1JXO A;  2QHS A;  2K6D A;  1B7Y B;  3CXC A;  3QXE B;  4QQD A;  4J9B A;  3OW2 S;  1VIE A;  2V1R A;  5GAN 5;  1NNH A;  1YJ9 T;  3A31 A;  2BIV A;  1M1G A;  1B07 A;  2X51 A;  3IQL A;  2LJ0 A;  2P0L A;  2HAX A;  1NE8 A;  1VQ6 T;  4LUE A;  4J6Y A;  3HTZ A;  1I1J A;  2JN0 A;  3QYH B;  1VQO T;  2QQA A;  2Y4X A;  3QHS A;  3HSB A;  1ARK A;  4YCW A;  2J6K A;  4P73 C;  4FW1 A;  4E2F B;  4OMF B;  4UP9 A;  2EIF A;  1K73 U;  2ZT6 A;  2J6F A;  4RTU A;  3MF1 A;  1VQ8 T;  2X3X D;  2NLU A;  1OU8 A;  1SHF A;  1YWO A;  3EG3 A;  1D1B A;  2RI5 A;  3HXZ A;  2GTO A;  1UEB A;  3I5S A;  2KXC A;  5D6X A;  4E47 A;  4C92 D;  2ZIM A;  1TOV A;  1KFZ A;  3FB9 A;  2I4L A;  2RM4 A;  2C0O A;  2CZ0 B;  2MOX A;  5CVI A;  3A8O B;  2CDT A;  1BI2 A;  1AZG B;  5GAN 2;  1K9M U;  4BWA A;  1SSH A;  3LWI A;  2LQN A;  3G1Z A;  5HKC A;  1ZSZ A;  5GAN 7;  4HKE A;  3RES A;  1WYD A;  1WPY A;  3E9I A;  2ZZG A;  1YFT A;  3QII A;  3CPW A;  2YLC A;  3JB9 H;  1VQN T;  1HD3 A;  5KYW A;  3OS1 A;  3JB9 D;  2DM1 A;  3MO8 A;  1VQ8 Q;  2ZT7 A;  2J6O A;  3EHR A;  3JB9 I;  1GL5 A;  4HWT A;  2FL7 A;  2V8J A;  3G7Z A;  2CJA A;  1YN8 A;  2ZZD A;  4AFZ C;  3CCQ Q;  3RKY A;  4D8D A;  5GAN f;  11AS A;  4DEX A;  2Q5H A;  4MZP A;  1NPP A;  2QA4 A;  2VYT A;  4J9E A;  5KYY A;  1YJN A;  3CQT A;  2EPD A;  4PJM A;  2FPE A;  2P0K A;  1G3S A;  1VQO Q;  4BE0 A;  1IL2 A;  2L5Q A;  4PLL A;  3JCM f;  3H9N A;  3EFR A;  3M4P A;  3RGL A;  3HPW A;  1PRM C;  4BW9 A;  5FRO A;  5IHN A;  1XTD A;  1EVL A;  4II1 A;  2DL4 A;  1K0X A;  2KYB A;  3EH2 A;  3CMA T;  3OSS C;  2XK0 A;  1H3Z A;  2VWF A;  4WCI A;  1ZSG A;  5GAM f;  2RHQ B;  2EQI A;  4JJC A;  2E5K A;  2O4X A;  3CCV A;  4LVJ A;  2FB7 A;  4ORZ A;  2YUO A;  1N8R R;  1VYV A;  1TTH B;  2E4H A;  2DU7 A;  4OMQ A;  4ZGJ B;  2XDB A;  3NTI A;  1KC8 R;  3CC7 A;  3A5Y A;  1PM3 A;  4CS2 A;  1EVK A;  2DTO A;  4FYV B;  3V8L A;  4HWR A;  3CMA A;  5GAN 6;  3SFM A;  2DIG A;  4XEO A;  1W1F A;  2M51 A;  3REU A;  1XQH A;  2XHC A;  3NEN A;  4PKC C;  4A4K A;  3HXV A;  2YXY A;  2M16 A;  4P74 C;  5HY6 A;  3CCE Q;  2YRD A;  2DL5 A;  1UGP B;  1M3A A;  4XK8 E;  1UJY A;  2KE9 A;  4JRK A;  2NUT B;  4ME7 A;  8AT1 B;  3CMA Q;  2O88 A;  1CSK A;  4DBQ A;  1NJI C;  5J26 A;  3GP8 A;  3OQ5 A;  3RR6 A;  2D8H A;  1ACM B;  5GAO l;  2GGR A;  4E7J A;  3A8H B;  1G83 A;  3PIP A;  4H2X A;  1AEY A;  3V8K A;  4F14 A;  4M7D D;  4XEM A;  4RTZ A;  1C0M A;  1OEB A;  2DZ9 A;  2JTE A;  2LCS A;  3VS1 A;  4BI4 A;  3QG1 A;  1TU0 B;  4P3O A;  3NEL A;  3QPH A;  1NLP C;  1ZA1 B;  4C0Z A;  3BFM A;  5I2S A;  4ELY C;  2ZNJ A;  5GAO n;  1X56 A;  2MI6 A;  5C0M A;  1UGS B;  2YSQ A;  1KSW A;  1NYR A;  1N9W A;  3I9Q A;  2G6F X;  3M4G A;  1XNI A;  4EMK B;  5D6Y A;  4BY6 C;  3RIR A;  4D8K A;  1JJ2 P;  3CCU A;  4TVA B;  5A0G A;  3MEU A;  2LT1 A;  3E2U A;  4P3P A;  3EFS A;  4P5N A;  3JCM P;  4RG2 A;  1H4V B;  3HRU A;  1H3H A;  5FRM A;  3MP1 A;  4HCK A;  1WXB A;  4J9D A;  2C8M A;  4P71 C;  5A0L A;  2COZ A;  5GMK e;  2HQH A;  2KY9 A;  5GAM j;  1YIT Q;  1A0N B;  5CKF A;  4CC3 A;  3NFC A;  3M0R A;  4YRM A;  1BIA A;  2ZZE A;  4ZNX A;  4GBQ A;  1I07 A;  4ZTJ A;  3CC7 T;  2R58 A;  2BE9 B;  2RF0 A;  3IKM B;  4B9X A;  2KRM A;  2HBP A;  1VQO A;  1RUW A;  2DEQ A;  1BBU A;  2AZV A;  3QJY A;  1B34 B;  2FO0 A;  3QJ6 A;  1QKW A;  2EQM A;  1YJ9 Q;  2V8K A;  4RTW A;  3G6E A;  1KHC A;  2F5T X;  2IG0 A;  4XU3 A;  1R0C B;  1U3O A;  1SPK A;  1OZ2 A;  4LVK A;  2QGG A;  4DOW A;  3C94 A;  5GMK i;  2RHZ A;  2FVU A;  4H2V A;  5E3I A;  2MWO A;  3VV0 A;  2EQJ A;  4YRQ A;  2D6F A;  4PJO G;  4LDX A;  5KNN A;  3FLG A;  2CSQ A;  1S72 T;  2CUD A;  3VQX A;  3UT1 A;  2QXF A;  4KUD K;  3CXC S;  4YYE A;  1UEC A;  2O2O A;  2DQ0 A;  2OTJ Q;  5KYW B;  3CPF A;  4M75 C;  2OAW A;  5GAN g;  1FWZ A;  3KBG A;  1Q82 R;  2DF6 A;  3HY1 A;  2YRC A;  4H2X B;  1VQ7 T;  3VU3 C;  2RHX A;  1K8A C;  3GIB A;  2DX1 A;  1D09 B;  1QVG A;  4HVW A;  3A5Z B;  4A54 A;  2C0T A;  2ARS A;  1AWW A;  3L2R A;  1B34 A;  2RHS A;  3HRK A;  2DER A;  1RAE B;  2OTL Q;  3LC0 A;  5GAN e;  1ZLM A;  3MEY A;  2DYB A;  3SB2 A;  3I55 T;  1VQP Q;  2P0P A;  1Q86 R;  4FT4 A;  2GNC A;  4DOV A;  3I5R A;  4PJO E;  4PFZ A;  5GAM g;  4DQ2 A;  3OYK A;  2OTJ T;  4N0A C;  1VQ5 T;  1KQ1 A;  4C8Q A;  2RN8 A;  1AVZ C;  1U8R A;  4JZ4 A;  2QA4 T;  1YHQ T;  4AFU C;  3REX A;  3MEW A;  2E3H A;  2K2M A;  5I22 A;  2ESW A;  2YHT A;  4DBH A;  2CSI A;  3OYN A;  3V7C A;  2DK3 A;  3OYG A;  2GQI A;  4ELZ C;  4YRS A;  4M7D C;  1ASY A;  1MV0 B;  2KDS A;  4C8Q B;  1JB0 E;  1K9M R;  2AT1 B;  4ZIB A;  2HDA A;  3UF4 A;  2F2W A;  2KNB B;  1YHQ A;  3E9H A;  3AT1 B;  2SEM A;  2XID A;  1Y7X A;  1B70 B;  1SRM A;  1QP3 A;  1QE0 A;  2C06 A;  3TCJ A;  1Q82 U;  5HGQ A;  2DL8 A;  3JB9 G;  1YIJ Q;  1I0C A;  2F2X A;  1OV3 A;  4PJO D;  2HKQ B;  1RAI B;  4M77 A;  5KYX B;  3G71 Q;  1FX7 A;  2QHV A;  3L4G B;  2MYS A;  5KYN A;  2ZT5 A;  1E1T A;  3TRE A;  1TG0 A;  2PZ1 A;  3E19 A;  4Z8A A;  4JZ3 A;  3ZL7 C;  2DD5 A;  4LDU A;  1EZZ B;  2DXU A;  4M78 D;  3GF5 A;  1PNJ A;  1YJN T;  1JJC B;  3IAL A;  4N4H A;  2E65 A;  4RQF A;  3THK A;  3PTA A;  2E1H A;  1G5H A;  4PHC A;  5CIU A;  3KFV A;  1C0A A;  4RG8 A;  1X6G A;  3BY7 A;  3SHW A;  4HWS A;  2X4J A;  3HRS A;  4RCB A;  4CH6 A;  3PVL A;  2OX7 A;  2QA4 Q;  3E9F A;  4H2S A;  3DB4 A;  3TU4 K;  3H41 A;  2QQB A;  4N0A A;  4ZGD B;  3CC2 Q;  5CKB A;  3X24 B;  1YNZ A;  1WDX A;  3SD4 A;  2JTF A;  1GRI A;  2VKN A;  3EG9 A;  4PK4 A;  2R5A A;  1AWX A;  5D6W A;  2ZPE B;  4C8Q C;  3CCR A;  1QCO A;  1X2Q A;  3OB9 A;  4M7D E;  4OLF A;  2JS2 A;  1W70 A;  4YRJ A;  2QI2 A;  4C92 B;  4QVZ A;  4XQ3 A;  4XTW A;  4EMK C;  2HCK A;  3JCM V;  2JS0 A;  4XTV A;  1WNL A;  5KCH A;  2QG9 B;  3PMI A;  2A3L A;  2RPN A;  3OS0 A;  4J9I A;  1ADJ A;  2ZPH B;  4B9W A;  2EJ9 A;  4C8Q G;  4FL6 A;  1VQ4 T;  3FIF A;  1ABQ A;  2O31 A;  1GFD A;  1HTT A;  3CCQ A;  1GBQ A;  2CZ1 B;  2FEI A;  3ME9 A;  1N9R A;  2ZIN A;  2JM9 A;  4PJO B;  3VBB A;  1ZUY A;  5GAM d;  1BBZ A;  1PG5 B;  2XI9 A;  2WSF E;  1JEG A;  4IUQ A;  5GAO q;  2W0Z A;  2EAY A;  1M1F A;  1M27 C;  1GBR A;  3MF2 A;  4XTX A;  1IHW A;  2ZPB B;  4A4F A;  3FEO A;  3X26 B;  4C5G A;  3RER A;  3CD6 Q;  4HVU A;  4YRF A;  1R0B G;  3RBB B;  2M0O A;  1VQ4 Q;  1KD1 C;  3NTK A;  1SER A;  5FU7 B;  3OYY A;  4FW2 A;  3PIO A;  2MIO A;  2JOY A;  1VUB A;  5GMK h;  1MND A;  3R07 A;  4QVC A;  1YCS B;  3CCU Q;  4J8O A;  2FHD A;  2ED0 A;  3UA7 A;  3L2W A;  1VQ9 T;  2A28 A;  2VVK A;  4RCC A;  3REA B;  4FYW B;  2ZIO A;  1BU1 A;  1TH7 A;  1PCX A;  1LJO A;  3M0Q A;  2P84 A;  3V7R A;  2ATC B;  1RL2 A;  4F7U E;  4JS4 A;  2RA2 A;  2B8A A;  3S6W A;  5LJ3 d;  3HFV A;  4EX5 A;  4PG3 A;  2EYX A;  2CP3 A;  2VXE A;  1Q7Y U;  3RMS A;  4TVW A;  2MMP A;  1PYS A;  1IRX A;  2VV5 A;  3BW1 A;  2RHI A;  2RQU A;  3L42 A;  3OW2 P;  4ZN1 A;  3LGL A;  3OSV A;  2DVE A;  3G71 T;  5GAN 8;  1EIY B;  2EJG A;  4OB0 B;  2EW3 A;  2G3R A;  3FC3 A;  3OS2 A;  4YRL A;  4KR3 A;  4E51 A;  2DXC A;  3CCV T;  1D0X A;  4H2U A;  2DO3 A;  1NJ8 A;  5LJ3 h;  4JRQ A;  1VQ6 Q;  2BE7 D;  2DNU A;  4M7A E;  1GFC A;  2KR3 A;  4DEY A;  3QO5 A;  1X75 C;  1Z9Q A;  1VQM T;  2EL9 A;  2CS7 A;  2JUF A;  4LE9 A;  4NL2 A;  3MKD A;  2ZCE A;  3TUP A;  4QT7 A;  1QF6 A;  3JCM J;  3KXT A;  3SDZ A;  3IKL A;  2ZNI A;  4JS5 A;  3OBW A;  4O5V A;  3I56 T;  4C0F A;  2AKK A;  3ZBD A;  3C4S A;  1U06 A;  2ZPF B;  1RAF B;  1BI0 A;  3GPL A;  4HWP A;  2KRS A;  2Q7E A;  1VYU A;  3CBO A;  1QP2 A;  3P8T A;  3I55 A;  3HP9 A;  3I55 Q;  1VQP T;  2ABL A;  2CIM A;  2ZTG A;  5LJ5 f;  2QAS A;  1YIJ T;  1NPR A;  3EG1 A;  3G6E Q;  4F17 A;  4M7A B;  2AKW A;  2EYQ A;  2ART A;  1QVG P;  1AZE A;  3DLM A;  3CCE T;  1RI0 A;  1P92 A;  1VQL Q;  1V76 A;  1IHV A;  2NUZ A;  4YTL A;  3PE0 A;  1BKB A;  2MPX C;  4M78 C;  1UJ0 A;  1R77 A;  3H6Z A;  1ZHI A;  1VQ9 Q;  3G71 A;  3QWX X;  4KGX B;  5FU6 C;  8ATC B;  3L2U A;  5DY9 A;  4ANJ A;  12AS A;  2QTV A;  1RAC B;  2KI7 A;  5CQX A;  4X1V A;  1ASZ A;  2J06 A;  1UUE A;  4AH6 A;  2WAC A;  2QQ9 A;  3JCM e;  4N4G A;  4C92 C;  3RAC A;  4JUV A;  3JB9 F;  2D8J A;  4M7A F;  2NWM A;  3ER0 A;  4P73 A;  3OMG A;  1NJ5 A;  2XDD A;  2M02 A;  4YPF A;  3MQZ A;  2CH4 A;  2K3X A;  1VQL A;  3HXU A;  2VUB A;  2RHY A;  2JNG A;  3TEE A;  3GNF B;  2K3Y A;  1M9S A;  4O6J A;  1FMW A;  1Q82 C;  1Q81 C;  2FZK B;  4YCV A;  1FYN A;  3OYH A;  2LQK A;  1USY A;  4OB1 B;  2M1H A;  3MEV A;  1WX6 A;  1JRI A;  2YLB A;  5L8R E;  1SET A;  2RJF A;  4PLI A;  3A7A A;  3QTC A;  2I4N A;  4LVL A;  2P0Q A;  3VS7 A;  4XTZ A;  3HXY A;  1H92 A;  5C51 B;  4KUI A;  1N8R U;  3JCM c;  1X6B A;  1FMK A;  1N9S A;  2HKN A;  3BE3 A;  2VXF A;  1N27 A;  3MP6 A;  2AIR B;  3OMC A;  3CCS T;  1HJD A;  1YWP A;  2L89 A;  3GNG A;  1M8M A;  1X69 A;  5CKH A;  1YB3 A;  2I0N A;  1X54 A;  4HWO A;  4CI0 C;  1BK2 A;  1Y96 A;  1SKU B;  1SF9 A;  2NYS A;  4D6W A;  2QTX A;  3TVT A;  3MCA B;  1D1A A;  1WHJ A;  2LDM A;  2A0F B;  4H2W A;  4BUG A;  2HEQ A;  1D0Y A;  2ECZ A;  2PU9 B;  3CCE A;  2ZT8 A;  1VQ4 A;  5K1P A;  4CH4 A;  2H3J A;  1JXM A;  1M2O A;  3M0S A;  1Q7Y C;  2F1L A;  5LJ5 j;  3M0T A;  1BBW A;  3RUX A;  1G3W A;  4YRC A;  1YIJ A;  2EYY A;  1VQ8 A;  2F2V A;  3UDC A;  3HFO A;  5IXB A;  1AT1 B;  5GAO r;  2CP5 A;  2E6Z A;  3CC4 Q;  4PNO A;  3PVQ A;  1T3S A;  1AWJ A;  3PZC A;  3X25 B;  2EQK A;  4K86 A;  4QW2 A;  2Z0W A;  4KT0 E;  1GCP A;  1OU9 A;  4A4E A;  2DZC A;  2QK0 A;  4M78 F;  1JBM A;  4LXC A;  3CCJ A;  2I4O A;  1MGQ A;  3M57 A;  4OF1 A;  2L2P A;  4C92 E;  5KE3 A;  4FSX A;  1W2B A;  3QWY A;  4C5E A;  1YJ9 A;  1AD5 A;  1U1S A;  1G3Y A;  1VQM A;  3EH1 A;  1TWB A;  1E6H A;  4C92 A;  4AMC A;  5LJ3 g;  1K8A U;  2M0Y A;  3VS0 A;  2KGT A;  2GFA A;  3FDR A;  2DFU A;  1VA7 A;  1Y0M A;  1BCM A;  2HMA A;  2WSC E;  1SES A;  4UPA A;  2CT4 A;  4FT2 A;  2ZGW A;  1LNX A;  5J3B A;  2OTL T;  4CH3 A;  3VYG A;  1ADY A;  1QQJ A;  4E7Z A;  2KT8 A;  3A5Z A;  4YRE A;  4TWA A;  1WHK A;  2ODR C;  3CC4 T;  4PJO F;  5GAN 3;  4WJ4 A;  3LSQ A;  3QO7 A;  2J7I A;  5K1X A;  4RUG A;  1OYX A;  2RQV A;  4AFQ C;  1G5I A;  2QDY B;  1H4S A;  2RHS B;  3CCL T;  2JMC A;  1M1K R;  2DTI A;  2CGH A;  1Q81 R;  1RLQ C;  4CH5 A;  1LYL A;  3OW2 A;  4EMG A;  3OS5 A;  3CC2 A;  4Z89 A;  2DBM A;  1QKX A;  4NS5 A;  3X28 B;  3RF1 A;  2K2V A;  2KK4 A;  3VS5 A;  1UB4 A;  4HVV A;  2J3L A;  1ZSZ B;  3G4S A;  1UGQ B;  2DE0 X;  5FLX E;  1H4T A;  2CJB A;  5LJ5 h;  1KQS P;  1PD0 A;  5IT9 E;  1VQK Q;  1BI3 A;  3QDR B;  1ABO A;  2LCC A;  5LJ5 g;  4YRO A;  5L23 A;  2HSP A;  2CRE A;  4J6X A;  1WA7 A;  2DYI A;  5KYX A;  1X6O A;  4N4I A;  4M7A C;  3QZ5 B;  2DLP A;  2IIM A;  3EAE A;  4HCZ A;  1RAD B;  4JLG A;  1VQ7 Q;  2DL3 A;  4LUD A;  1IRE B;  1K8A R;  1HK9 A;  4DPG A;  2MCN A;  4Z02 A;  3NPF A;  2C0I A;  4ZTZ B;  1M1K C;  3A8G B;  4F7U A;  2E10 A;  2X35 A;  2Q7H A;  3A8L B;  1RIQ A;  4Q6G A;  3N5B B;  2V26 A;  3URG A;  1N5Z A;  5IAY A;  2RB6 A;  2DXB A;  1Z7N A;  4OP0 A;  1Y07 A;  3A7U A;  3M59 A;  1KHI A;  2DXT A;  3VRY A;  3PCO A;  1PD1 A;  1M2V B;  4E7K A;  4RMF A;  2FPF A;  2YT6 A;  3OYF A;  1WHL A;  2CYZ B;  1BI1 A;  2EQU A;  1QCF A;  1RAB B;  2LC4 A;  1PHT A;  3CME A;  4RTY A;  3LYI A;  4IIO A;  2ZR2 A;  1EIY A;  1EOV A;  2XKO C;  3QNE A;  1M90 R;  2PMF A;  2P4T A;  1N8R C;  1QVF S;  5GAN 4;  2BKD N;  1NEG A;  3OYI A;  5KYU B;  2JT4 A;  2DIL A;  4XTU A;  3ASK A;  1JJC A;  3VQW A;  4E7S A;  2EBP A;  1Q86 U;  3PT9 A;  4AFS C;  2QHT A;  1KMM A;  3EGX B;  2FZC B;  1PKS A;  1MMA A;  2XG8 D;  1LVK A;  4F7U B;  1VQL T;  4F04 B;  4QQ6 A;  1NJI U;  1SHG A;  2XTI A;  1M2V A;  3L1A A;  1XJW B;  2Q7G A;  5ELO A;  4YRK A;  2NS6 A;  3BDL A;  2XIC A;  1OX9 A;  3M55 A;  3S3O A;  1X43 A;  4YRT A;  3A7R A;  2LNV A;  3VQV A;  2AMC A;  2KVQ G;  4FYY B;  4L5G A;  2L3R A;  1Z7M A;  1TUD A;  1W66 A;  4A63 B;  3CCV Q;  1X2H A;  4M7D F;  1PKT A;  2ENM A;  2EJF A;  4TVA A;  4PFP A;  3FJ5 A;  3CCM Q;  4LVI A;  1RAH B;  2HD0 A;  3ZFJ A;  4OGC A;  1I4K 1;  1KC8 U;  4LDV A;  1QVG S;  1Y57 A;  3P8H A;  1X55 A;  4C0G A;  3QSU A;  3VS6 A;  1EFW A;  4M7A A;  2AKW B;  3VS2 A;  3CCR Q;  2BZY A;  2DJZ A;  2FG0 A;  2IVW A;  2NUP A;  4M7A D;  3GOX A;  3RNJ A;  2LX9 A;  5LL6 S;  4HT9 A;  4CC7 A;  1OQK A;  1D3B B;  3CCS Q;  3CMQ A;  4DA4 A;  1O9S A;  1IO6 A;  4BAC A;  3PGG A;  1PWT A;  4FYX B;  5AT1 B;  2AMC B;  2XMF A;  2X3W D;  3OYJ A;  1K73 R;  2HQX A;  1RI9 A;  3FRN A;  1BIB A;  5IXF A;  4J9H A;  1KQS A;  1KD1 R;  1CKB A;  4TVR A;  2KSS A;  4LDW A;  2RQR A;  1NJI R;  3A32 A;  3MEA A;  1EQR A;  2YUN A;  1WLE A;  5CO7 A;  4IUR A;  2O9S A;  2EGA A;  2LQW A;  3HHT B;  1VQK A;  2HSE B;  2K3B A;  4YRI A;  2RI3 A;  1IGU A;  2XDP A;  3MP8 A;  1NYG A;  4WJ3 M;  1SEM A;  1AOJ A;  3Q1J A;  3OYA A;  1I81 A;  1B3Q A;  4PJL A;  1ATI A;  2QEX T;  2MK5 A;  1OX8 A;  2YDL A;  2IPO B;  3PMT A;  4DBF A;  2RK2 A;  3QBY A;  4A4G A;  3HXX A;  4MDW A;  2VB6 A;  3M0P A;  2JXB A;  3H8Z A;  4OMM A;  4FU6 A;  3CXC P;  4NL3 A;  5GAN d;  3JCM b;  2E3I A;  1WJS A;  2MF2 A;  2JVV A;  1AWO A;  1AHJ B;  3UH0 A;  2HL5 C;  4BI8 B;  1H64 1;  3C95 A;  4M78 B;  3OY9 A;  4JRI A;  3UAT A;  3JCM Q;  1TUG B;  2E5A A;  3CBP A;  5CKE A;  1WJQ A;  1NJ1 A;  1VQ5 Q;  1E24 A;  1WQ7 A;  2K79 A;  1WHM A;  4TVY A;  1WI7 A;  1WU7 A;  1NEB A;  4IKF A;  4HT4 A;  4JDS A;  3VUZ A;  1G51 A;  2E64 A;  4XU0 A;  2DU5 A;  4Y92 A;  5CAI A;  2L3P A;  4E7L A;  4M77 D;  2L3Q A;  2KBT A;  3I35 A;  2P4R A;  1JU5 C;  1NLO C;  4M7D G;  1G8X A;  3CCL Q;  1VQ7 A;  4J7F A;  3IG2 A;  1BYM A;  5GMK m;  1PRL C;  3M4Q A;  1KK7 A;  4HT8 A;  2BTT A;  2EGC A;  4GLK A;  2R57 A;  2YUQ A;  1YI2 Q;  4K11 A;  3TSW A;  1GGM A;  3A1P A;  1VQM Q;  3OYD A;  5IHK A;  3G4S Q;  3HXW A;  2X4W A;  2OTL A;  2QHU A;  1KOG A;  4M77 C;  1USY C;  5GJV B;  2D0Q B;  2EYZ A;  2JTM A;  1G2B A;  2QEX A;  1OPK A;  4OMP A;  2I2L A;  2DAQ A;  2KMT A;  4M75 F;  3OBY A;  3D7S B;  1CKA A;  4NOY A;  3ERR A;  2OTJ A;  3VYH B;  2OI3 A;  4PJJ A;  3CCQ T;  3QZ9 B;  4MDX A;  4C0D C;  2GTJ A;  4VUB A;  1NYQ A;  3CCM T;  4JJN K;  1MMG A;  1I5L A;  5CK9 A;  2LRQ A;  4M77 G;  2AZS A;  4UP7 A;  4R55 A;  4RTX A;  1X27 A;  3BJU A;  1SSF A;  5FRN A;  4YRG A;  3P8V A;  2LCL A;  2Y4Y A;  5IN1 A;  2SRC A;  3CBM A;  1WZO A;  2RNA A;  2K5F A;  4P74 A;  4X9C A;  3EHQ A;  4EIK A;  1MNE A;  1PSE A;  2LZ6 B;  2KQW A;  5LJ5 e;  1M90 C;  1VOM A;  3LH0 A;  3CCS A;  1PYS B;  4QVD A;  3PFS A;  2EGE A;  4CC4 B;  2L8D A;  4A4H A;  2DRM A;  4J9F A;  1VQK T;  1QMC A;  4Q15 A;  1MMN A;  4FIB A;  4JLI A;  4Z88 A;  3X20 B;  4KR2 A;  2WSE E;  3WVE B;  4EDU A;  2EFI A;  2CUB A;  5C6S A;  1E1O A;  1TS9 A;  1FMV A;  2RJE A;  3QKJ A;  1N6A A;  3L2Z A;  1YHQ Q;  1Q86 C;  2E3C A;  2D9T A;  4M75 A;  1JQQ A;  1VQ9 A;  4J5Y A;  4P75 A;  2RH2 A;  3L2V A;  1WGS A;  3JAM E;  1I8F A;  3R6N A;  4MMK A;  4XTY A;  2LNH B;  3CEY A;  3EGD A;  2EWN A;  4ZGE B;  2VGM A;  1X2G A;  3CPW S;  2G4C A;  2CZ7 B;  4J83 A;  3JCM h;  3I56 A;  2X4X A;  2CP7 A;  4KRT A;  1D1C A;  3C12 A;  2LQ8 A;  3VKI A;  4R0K A;  4JJD A;  1VQ6 A;  2ZPI B;  4CS4 A;  2ZAE A;  4QKU A;  2I4M A;  1M30 A;  4M78 E;  1IGQ A;  1Y96 B;  4KH0 B;  4B6M A;  1NJ2 A;  5DM7 R;  4PJO A;  1QVF A;  1T3L A;  1NZ9 A;  3M56 A;  5EC7 A;  3M53 A;  4KQE A;  3BDU A;  1Z9Z A;  4HXJ A;  1Q81 U;  4H02 A;  1K1Z A;  2DQ3 A;  3GBQ A;  2DRK A;  4EMH A;  5FW9 A;  2O4X B;  3U23 A;  2GCX A;  5CKD A;  4Q5W A;  2LT4 A;  4CRI A;  4RQE A;  3OYB A;  5CCA A;  4FM4 B;  3CPW P;  5J39 A;  4E7H A;  4WTO B;  1MUZ A;  3S3M A;  1K76 A;  3HKS A;  4YRP A;  1WQW A;  2ARU A;  4P75 C;  2LX7 A;  2E6N A;  3CC4 A;  2FRW A;  1SG5 A;  3HL8 A;  3RL6 A;  4BE1 A;  1VQP A;  2QAZ A;  4LD9 K;  2KT1 A;  2DET A;  2EKH A;  3TSZ A;  2PTK A;  5CR2 A;  4L87 A;  4KH1 B;  1OOT A;  1B8A A;  4NCX A;  3ZEH A;  5C53 B;  2LMJ A;  5I21 A;  1K73 C;  1OZ3 A;  3CCJ T;  5C52 B;  2KRN A;  5I2M A;  1MHN A;  3T9N A;  1Y71 A;  5CQY A;  3H0H A;  4JJB A;  2ZXF A;  3M58 A;  5FU6 B;  2P5I A;  2HZY A;  1RLP C;  3JCM W;  1YJW T;  2VC8 A;  3EG0 A;  1D3B A;  3HFZ B;  4M75 D;  1KJW A;  4BB7 A;  4E7I A;  1VQZ A;  3H0F A;  3E1S A;  4V2S A;  3LW5 E;  3L2Q A;  5A2Q E;  3I56 Q;  2COY A;  5HK3 A;  4BD3 A;  2IY5 B;  4XAX B;  2CT3 A;  5IHI A;  4AG2 C;  1F1B B;  3FJP A;  3HFZ A;  1RAG B;  1ZSZ C;  1JO8 A;  3DKM A;  2YWW A;  1I5O B;  3CCU T;  2MAM A;  2BZX A;  1Q95 G;  2LTO A;  2B86 A;  2E12 A;  1OI1 A;  4C0D B;  1VIF A;  1QWE A;  2JMA A;  5GMK l;  2NUT A;  1M3B A;  3P8D A;  3QO3 A;  1B7T A;  2RQT A;  1MMD A;  3LSS A;  5D7U A;  1UHC A;  2PNI A;  2YRV A;  1WYX A;  1U5S A;  2HQE A;  3QYG B;  4P71 A;  3OD1 A;  2PQW A;  2CP6 A;  1PSF A;  5KE2 A;  4BDY A;  1OPL A;  1QVP A;  2ZCF B;  3SEM A;  4ZTU B;  4YRR A;  1BCO A;  1WIE A;  2RMO A;  3INZ A;  4P3N A;  1KC8 C;  4J9C A;  5FWC A;  3LH5 A;  4YRN A;  5KYY B;  4UC4 A;  2ROT A;  1T0H A;  2EKO A;  4FSS A;  2QDL A;  1EIF A;  2V8I A;  4GY5 A;  2ED1 A;  4R56 A;  3MHX A;  1U1T A;  4J15 A;  1E6G A;  1QLY A;  1VQ5 A;  2M9U A;  5ECA A;  3VQY A;  3TEH B;  4C5H A;  3S3N A;  3VUB A;  1QVF P;  2QGF B;  3ICA A;  3OYL A;  2F69 A;  3CME T;  1G3T A;  4WF2 A;  2ZZF A;  4LDY A;  2PUO B;  1K9A A;  4EPC A;  5F5W A;  4TQD A;  1EFN A;  3OYM A;  1J5W A;  2LP5 A;  4RDX A;  2RJC A;  1IZ6 A;  4LN2 A;  1E22 A;  4M75 G;  6AT1 B;  5I11 A;  2MWP A;  3M4Y A;  4IUT A;  1O75 A;  3ULR B;  1YJW A;  4BI3 A;  1IB8 A;  1W4S A;  3HTR A;  2PUK B;  4CS3 A;  5GAO m;  3P8B B;  2K7A A;  4M77 F;  3OA6 A;  5FU7 C;  1ZQ1 A;  3QDF A;  2X4Y A;  2DBK A;  3JSC A;  3NET A;  3J80 E;  3P8Y A;  3MJX A;  2OAU A;  3VJP A;  3CCM A;  3HFN A;  1XOV A;  4K87 A;  4HCB A;  2PME A;  2KYM A;  4TQF A;  3JCM d;  1JJ2 A;  4C8Q D;  2AKL A;  2OJ2 A;  3CCR T;  1W2B S;  4M4Z A;  1UG1 A;  2HNI A;  2DKG A;  4H2Y A;  1T0J A;  2A37 A;  3WXM B;  3UA6 A;  3O5Z A;  2RD1 A;  1JJ2 S;  2FRY A;  1GCQ A;  4AG1 C;  3LLR A;  4RKU E;  3A8M B;  1NBE B;  4M7A G;  2QQR A;  2ROL A;  2LJ1 A;  2L0A A;  1V1C A;  3R6O A;  4OMO A;  3OYE A;  1L0W A;  5ELN A;  4XU1 A;  4RTV A;  3EGX A;  1X01 A;  2V1Q A;  1GXI E;  1KMN A;  2H8H A;  1ZA2 B;  3I7F A;  1S1N A;  1QWF A;  4P72 C;  1HXD A;  1YJN Q;  3DSQ A;  3SWN A;  1BB9 A;  1YJW Q;  4QQG A;  3G4S T;  3M9Q A;  4M77 B;  5HCK A;  1UTI A;  2ALY A;  1WXU A;  3WVD B;  4OML A;  2JM8 A;  2D1X A;  5EG2 A;  4J7I A;  2DL7 A;  4YP0 A;  3F70 A;  4PJO C;  1B76 A;  4YCU A;  1M5Q 1;  1QW1 A;  2C7I A;  2LJ3 A;  3HRI A;  4KGZ B;  4BDZ A;  1M4Z A;  2GF7 A;  1M3C A;  3V8J A;  4OB3 B;  4JRP A;  1PC0 A;  1YBY A;  1LCK A;  4L6V 5;  5DLO A;  4TTV A;  2R5M A;  1Q7Y R;  4EO4 A;  4MZM A;  2ODR D;  3JB9 J;  4KBM B;  3NMZ C;  4EMK A;  4C92 F;  2DJQ A;  4ZN3 A;  5KH6 A;  3W3S A;  2AHJ B;  3SWN C;  3H0I A;  1TXQ A;  3RDV A;  1YIT T;  1WFW A;  3TQ7 P;  3NGP A;  4M7D A;  2CJ9 A;  1ZX6 A;  3REB B;  2VAS A;  1GCQ C;  3M54 A;  3G1J A;  3CD6 T;  3PNW C;  1HYO A;  3EG2 A;  2ALY B;  5GJW B;  4CC2 A;  3LWH A;  3CCJ Q;  4BE2 A;  1YFS A;  2ZR3 A;  9ATC B;  3M0U A;  2ZPG B;  3MPU B;  4Y91 A;  3GLX A;  2QEX Q;  4P72 A;  2DD4 A;  1B70 A;  4H2T A;  2H3E B;  2DMO A;  1NG2 A;  2FZG B;  4WI1 A;  4E6R A;  1UHF A;  1K9M C;  1X2K A;  1NJ6 A;  2RK1 A;  1H8K A;  4A53 A;  3EG9 B;  4DBR A;  2JJ9 A;  1YCY A;  1MV3 A;  2F5K A;  5LJ3 j;  4X9D A;  1ZUK A;  4OB2 B;  1YI2 T;  2XU8 A;  4PFO A;  4PJN A;  2Q5I A;  1UGV A;  4ESR A;  1C1A A;  3NTH A;  7AT1 B;  1LPL A;  4OMN A;  2A7Y A;  1S72 Q;  1KD1 U;  2J3M A;  2CP2 A;  3VS4 A;  2KEA A;  2L3S A;  4M78 G;  4M77 E;  1HC7 A;  4M7D B;  2PVG B;  1VQN Q;  4ATO A;  3A98 A;  4AT1 B;  1UFF A;  5IH2 A;  1UE9 A;  1WXT A;  5A0D A;  1YI2 A;  1K0S A;  1WJR A;  2DVJ A;  4G84 A;  3QO8 A;  4M75 E;  1W2B P;  4J9G A;  1NYF A;  4LNS A;  3UPU A;  2NUP B;  3J81 E;  2CP0 A;  3SWN B;  4Y28 E;  2JZ2 A;  5GMK j;  1M1K U;  4F7U F;  5GAM e;  5KCO A;  3OYC A;  4X5O A;  3RKX A;  1D0Z A;  3JRZ A;  3G6E T;  3PCO B;  4F16 A;  1TSF A;  2PVO B;  2KRO A;  5GAO p;  2X9H A;  4OGE A;  3MET A;  4L59 A;  5GAN j;  3KFU A;  1WHH A;  4C8Q E;  2XGT A;  4C5I A;  2E5Q A;  3HRT A;  4ZTF A;  3CD6 A;  2FYK A;  4UP8 A;  4BY6 B;  2DTH A;  1KIK A;  3LX7 A;  2XD0 A;  2CKK A;  1SRY A;  1YIT A;  5KYU A;  1KQS S;  2HBW A;  1YFN A;  2O01 E;  5LJ3 e;  1YP5 A;  2RHU A;  2J05 A;  4O2D A;  2IY5 A;  3VS3 A;  5FWB A;  1QCN A;  2RI2 A;  1KQ2 A;  3DB3 A;  4C92 G;  3HY0 A;  2GQV A;  4KGV B;  4HVC A;  2JW4 A;  1W6X A;  4IUV A;  1E7O A;  4JPB W;  4LD6 A;  3DLL A;  2RQW A;  1C6V X;  1SRL A;  4MML A;  3C0C A;  1FYF A;  1OUL A;  4IUP A;  4PL6 A;  3CME Q;  1WLP B;  3L4G A;  1UDL A;  1ZBJ A;  3RKW A;  4G85 A;  4FCY A;  1FXX A;  3JCM g;  2E41 A;  4KUL A;  1K4U S;  3NHN A;  2DEU A;  1TUC A;  4HCC A;  2LVM A;  1J3T A;  3AHU A;  2RHQ A;  2VGN A;  3UGT A;  2A8E A;  3JCM X;  2A36 A;  2CH4 W;  2GBQ A;  2KXD A;  2DPP B;  3EGU A;  3O8V A;  1H4Q A;  5LJ3 f;  3QUI A;  2A08 A;  4GLM A;  4M75 B;  3UFG A;  5GAM h;  3JV3 A;  4MZT A;  1M8V A;  2RO0 A;  2DA9 A;  2YUP A;  3NEM A;  3EGD B;  2K9G A;  3UGQ A;  1ZBX A;  2QYZ A;  3KUF A;  2QQS A;  2K57 A;  4HA8 A;  5HK0 A;  4XU2 A;  2HL3 A;  4M78 A;  1HSQ A;  1LOJ A;  2COW A;  2EVR A;  2AK5 A;  4LVM A;  1YFR A;  1IXD A;  3TEH A;  2CZ6 B;  4K88 A;  4RTT A;  1M90 U;  1UGR B;  2D0N A;  2K5I A;  3A74 A;  4OVA A;  5M9O A;  5DLQ E;  1B7Y A;  2DDZ A;  1VYT A;  2KAF A; 
#chains in the Genus database with same CATH homology
 1KG1 A;  1V29 B;  5AYF A;  2K5L A;  3RMQ A;  2RJD A;  3J7A F;  2E70 A;  4F7U G;  2Y90 A;  1G5V A;  4X34 A;  4RMO A;  2PVD B;  3CC2 T;  4YDQ A;  4C8Q F;  3CCL A;  3UWN A;  1YGB A;  2DIQ A;  1VQN A;  5GAN h;  3TEG A;  3LGF A;  2GFU A;  2BUD A;  1DJ7 B;  4IUU A;  1S72 A;  1R8O B;  5LJ5 d;  3E9G A;  3V7S A;  3WQZ A;  3M5A A;  2K4Y A;  4J6W A;  2QHS A;  1B7Y B;  3CXC A;  3QXE B;  4QQD A;  3OW2 S;  1VIE A;  5GAN 5;  1NNH A;  1YJ9 T;  3A31 A;  2BIV A;  1M1G A;  2P0L A;  2HAX A;  1NE8 A;  1VQ6 T;  4J6Y A;  3HTZ A;  2JN0 A;  3QYH B;  1VQO T;  2QQA A;  2Y4X A;  3QHS A;  3HSB A;  4YCW A;  4P73 C;  4UP9 A;  4OMF B;  2EIF A;  1K73 U;  2ZT6 A;  3MF1 A;  1VQ8 T;  2NLU A;  2RI5 A;  3HXZ A;  1UEB A;  5D6X A;  4E47 A;  4C92 D;  2ZIM A;  3FB9 A;  2I4L A;  2RM4 A;  2CZ0 B;  5CVI A;  3A8O B;  1BI2 A;  5GAN 2;  1K9M U;  4BWA A;  3LWI A;  3G1Z A;  5HKC A;  5GAN 7;  4HKE A;  3RES A;  1WYD A;  1WPY A;  3E9I A;  2ZZG A;  1YFT A;  3QII A;  3CPW A;  2YLC A;  3JB9 H;  1VQN T;  3OS1 A;  3JB9 D;  3MO8 A;  2ZT7 A;  3JB9 I;  4HWT A;  2FL7 A;  2V8J A;  3G7Z A;  2CJA A;  2ZZD A;  3RKY A;  5GAN f;  11AS A;  2Q5H A;  4MZP A;  1NPP A;  2QA4 A;  2VYT A;  1YJN A;  2P0K A;  1G3S A;  1IL2 A;  4BE0 A;  2L5Q A;  4PLL A;  3JCM f;  3EFR A;  3M4P A;  3RGL A;  3HPW A;  4BW9 A;  5FRO A;  1XTD A;  1EVL A;  4II1 A;  3CMA T;  3OSS C;  2XK0 A;  1H3Z A;  5GAM f;  2RHQ B;  2O4X A;  3CCV A;  4LVJ A;  2FB7 A;  2DU7 A;  4ZGJ B;  2XDB A;  3NTI A;  3CC7 A;  3A5Y A;  4CS2 A;  1EVK A;  2DTO A;  3V8L A;  4HWR A;  3CMA A;  5GAN 6;  3SFM A;  2DIG A;  4XEO A;  3REU A;  1XQH A;  2XHC A;  3NEN A;  4PKC C;  4A4K A;  3HXV A;  2M16 A;  4P74 C;  5HY6 A;  1UGP B;  4XK8 E;  4ME7 A;  4JRK A;  1NJI C;  5J26 A;  3GP8 A;  3OQ5 A;  5GAO l;  4E7J A;  3A8H B;  3PIP A;  4H2X A;  3V8K A;  4M7D D;  4XEM A;  2DZ9 A;  4BI4 A;  3QG1 A;  4P3O A;  3NEL A;  3QPH A;  4C0Z A;  3BFM A;  5I2S A;  4ELY C;  2ZNJ A;  5GAO n;  1X56 A;  2MI6 A;  5C0M A;  1UGS B;  1NYR A;  1N9W A;  3M4G A;  1XNI A;  4EMK B;  5D6Y A;  4BY6 C;  3RIR A;  3CCU A;  4TVA B;  5A0G A;  3MEU A;  2LT1 A;  4P3P A;  3EFS A;  4P5N A;  3JCM P;  4RG2 A;  1H4V B;  3HRU A;  5FRM A;  3MP1 A;  2C8M A;  4P71 C;  5A0L A;  5GMK e;  2KY9 A;  5GAM j;  5CKF A;  3NFC A;  4YRM A;  1BIA A;  2ZZE A;  4ZTJ A;  3CC7 T;  2R58 A;  3IKM B;  4B9X A;  2HBP A;  1VQO A;  2DEQ A;  1BBU A;  3QJY A;  1B34 B;  3QJ6 A;  2EQM A;  2V8K A;  3G6E A;  1KHC A;  2F5T X;  2IG0 A;  4XU3 A;  1OZ2 A;  4LVK A;  4DOW A;  3C94 A;  5GMK i;  2RHZ A;  2FVU A;  4H2V A;  5E3I A;  2MWO A;  3VV0 A;  2EQJ A;  4YRQ A;  2D6F A;  4PJO G;  4LDX A;  5KNN A;  3FLG A;  1S72 T;  3VQX A;  3UT1 A;  2QXF A;  4KUD K;  3CXC S;  4YYE A;  2DQ0 A;  3CPF A;  4M75 C;  5GAN g;  1FWZ A;  3KBG A;  3HY1 A;  4H2X B;  1VQ7 T;  3VU3 C;  2RHX A;  1K8A C;  3GIB A;  1QVG A;  3A5Z B;  4A54 A;  2ARS A;  3L2R A;  1B34 A;  2RHS A;  3HRK A;  3LC0 A;  3MEY A;  5GAN e;  3SB2 A;  3I55 T;  2P0P A;  4FT4 A;  4DOV A;  4PJO E;  5GAM g;  4DQ2 A;  3OYK A;  2OTJ T;  4N0A C;  1VQ5 T;  1KQ1 A;  4C8Q A;  1U8R A;  2QA4 T;  1YHQ T;  3REX A;  3MEW A;  2YHT A;  3OYN A;  3V7C A;  2DK3 A;  3OYG A;  4ELZ C;  4YRS A;  4M7D C;  1ASY A;  2KDS A;  4C8Q B;  1JB0 E;  4ZIB A;  1YHQ A;  3E9H A;  2XID A;  1Y7X A;  1B70 B;  1QP3 A;  1QE0 A;  2C06 A;  3TCJ A;  1Q82 U;  5HGQ A;  3JB9 G;  4PJO D;  4M77 A;  1FX7 A;  2QHV A;  3L4G B;  2ZT5 A;  1E1T A;  3TRE A;  3E19 A;  2DD5 A;  4LDU A;  2DXU A;  4M78 D;  3GF5 A;  1YJN T;  1JJC B;  3IAL A;  4N4H A;  2E65 A;  4RQF A;  3PTA A;  2E1H A;  1G5H A;  4PHC A;  5CIU A;  1C0A A;  4RG8 A;  3BY7 A;  4HWS A;  2X4J A;  3HRS A;  4RCB A;  4CH6 A;  3E9F A;  4H2S A;  3DB4 A;  3TU4 K;  2QQB A;  4N0A A;  4ZGD B;  5CKB A;  3X24 B;  3SD4 A;  2JTF A;  2R5A A;  5D6W A;  2ZPE B;  4C8Q C;  3CCR A;  3OB9 A;  4M7D E;  4OLF A;  4YRJ A;  2QI2 A;  4C92 B;  4QVZ A;  4XQ3 A;  4XTW A;  4EMK C;  3JCM V;  4XTV A;  1WNL A;  5KCH A;  3PMI A;  2A3L A;  3OS0 A;  1ADJ A;  2ZPH B;  4B9W A;  2EJ9 A;  4C8Q G;  4FL6 A;  1VQ4 T;  3FIF A;  1HTT A;  3CCQ A;  2CZ1 B;  3ME9 A;  1N9R A;  2ZIN A;  4PJO B;  3VBB A;  5GAM d;  2XI9 A;  2WSF E;  4IUQ A;  5GAO q;  2EAY A;  1M1F A;  3MF2 A;  4XTX A;  2ZPB B;  4A4F A;  3FEO A;  3X26 B;  4C5G A;  3RER A;  4YRF A;  2M0O A;  1KD1 C;  3NTK A;  1SER A;  5FU7 B;  3OYY A;  3PIO A;  2JOY A;  1VUB A;  5GMK h;  3R07 A;  4QVC A;  4J8O A;  2FHD A;  3L2W A;  1VQ9 T;  4RCC A;  2ZIO A;  1TH7 A;  1LJO A;  3V7R A;  1RL2 A;  4F7U E;  4JS4 A;  2RA2 A;  2B8A A;  3S6W A;  5LJ3 d;  3HFV A;  4EX5 A;  4PG3 A;  2VXE A;  1Q7Y U;  3RMS A;  4TVW A;  2MMP A;  1PYS A;  2VV5 A;  3BW1 A;  2RHI A;  3L42 A;  4ZN1 A;  3LGL A;  3OSV A;  2DVE A;  3G71 T;  5GAN 8;  1EIY B;  2EJG A;  4OB0 B;  2G3R A;  3FC3 A;  3OS2 A;  4YRL A;  4KR3 A;  4E51 A;  2DXC A;  3CCV T;  4H2U A;  2DO3 A;  1NJ8 A;  5LJ3 h;  4JRQ A;  4M7A E;  3QO5 A;  1X75 C;  1VQM T;  2EL9 A;  2CS7 A;  2JUF A;  4NL2 A;  2ZCE A;  3TUP A;  1QF6 A;  3JCM J;  3KXT A;  3SDZ A;  3IKL A;  2ZNI A;  4JS5 A;  3OBW A;  4O5V A;  3I56 T;  4C0F A;  3ZBD A;  3C4S A;  2ZPF B;  1BI0 A;  3GPL A;  4HWP A;  2Q7E A;  3CBO A;  1QP2 A;  3P8T A;  3I55 A;  3HP9 A;  1VQP T;  2CIM A;  2ZTG A;  5LJ5 f;  1YIJ T;  1NPR A;  4M7A B;  2AKW A;  2EYQ A;  2ART A;  3DLM A;  3CCE T;  1RI0 A;  1P92 A;  4YTL A;  1BKB A;  4M78 C;  3H6Z A;  1ZHI A;  3G71 A;  5FU6 C;  3L2U A;  5DY9 A;  12AS A;  5CQX A;  1ASZ A;  4AH6 A;  2WAC A;  2QQ9 A;  3JCM e;  4N4G A;  4C92 C;  3RAC A;  4JUV A;  3JB9 F;  4M7A F;  3ER0 A;  4P73 A;  3OMG A;  1NJ5 A;  2XDD A;  4YPF A;  3MQZ A;  2K3X A;  1VQL A;  3HXU A;  2VUB A;  2RHY A;  2JNG A;  3TEE A;  3GNF B;  2K3Y A;  1M9S A;  4O6J A;  1Q82 C;  1Q81 C;  4YCV A;  3OYH A;  2LQK A;  1USY A;  4OB1 B;  2M1H A;  3MEV A;  1JRI A;  2YLB A;  5L8R E;  1SET A;  2RJF A;  4PLI A;  3A7A A;  3QTC A;  2I4N A;  4LVL A;  2P0Q A;  4XTZ A;  3HXY A;  5C51 B;  4KUI A;  1N8R U;  3JCM c;  1N9S A;  2VXF A;  1N27 A;  3MP6 A;  3OMC A;  3CCS T;  2L89 A;  3GNG A;  5CKH A;  1YB3 A;  1X54 A;  4HWO A;  4CI0 C;  1Y96 A;  4D6W A;  2QTX A;  3MCA B;  2LDM A;  4H2W A;  4BUG A;  2PU9 B;  3CCE A;  2ZT8 A;  1VQ4 A;  5K1P A;  4CH4 A;  2H3J A;  1Q7Y C;  5LJ5 j;  1BBW A;  3RUX A;  1G3W A;  4YRC A;  1YIJ A;  1VQ8 A;  3UDC A;  3HFO A;  5GAO r;  2E6Z A;  4PNO A;  3PZC A;  3X25 B;  2EQK A;  4K86 A;  4QW2 A;  4KT0 E;  4A4E A;  2DZC A;  4M78 F;  1JBM A;  3CCJ A;  2I4O A;  1MGQ A;  3M57 A;  4OF1 A;  4C92 E;  5KE3 A;  4FSX A;  1W2B A;  4C5E A;  1YJ9 A;  1U1S A;  1G3Y A;  1VQM A;  4C92 A;  5LJ3 g;  1K8A U;  2GFA A;  3FDR A;  2WSC E;  1SES A;  4UPA A;  4FT2 A;  2ZGW A;  1LNX A;  5J3B A;  2OTL T;  4CH3 A;  3VYG A;  1ADY A;  3A5Z A;  4YRE A;  4TWA A;  2ODR C;  3CC4 T;  4PJO F;  5GAN 3;  4WJ4 A;  3LSQ A;  3QO7 A;  5K1X A;  1OYX A;  1G5I A;  2QDY B;  1H4S A;  2RHS B;  3CCL T;  2DTI A;  2CGH A;  4CH5 A;  1LYL A;  3OW2 A;  4EMG A;  3OS5 A;  3CC2 A;  4NS5 A;  3X28 B;  3RF1 A;  2K2V A;  2KK4 A;  1UB4 A;  2J3L A;  3G4S A;  1UGQ B;  5FLX E;  1H4T A;  2CJB A;  5LJ5 h;  5IT9 E;  1BI3 A;  3QDR B;  2LCC A;  4YRO A;  5LJ5 g;  4J6X A;  1X6O A;  4N4I A;  4M7A C;  3QZ5 B;  3EAE A;  4HCZ A;  4JLG A;  1IRE B;  1HK9 A;  4DPG A;  4Z02 A;  4ZTZ B;  1M1K C;  3A8G B;  4F7U A;  2E10 A;  2X35 A;  2Q7H A;  3A8L B;  1RIQ A;  4Q6G A;  3N5B B;  3URG A;  5IAY A;  2RB6 A;  2DXB A;  1Z7N A;  4OP0 A;  1Y07 A;  3A7U A;  3M59 A;  1KHI A;  2DXT A;  3PCO A;  4E7K A;  4RMF A;  3OYF A;  2CYZ B;  1BI1 A;  2EQU A;  2LC4 A;  3CME A;  3LYI A;  2ZR2 A;  1EIY A;  1EOV A;  2XKO C;  3QNE A;  2PMF A;  2P4T A;  1N8R C;  1QVF S;  5GAN 4;  2BKD N;  3OYI A;  4XTU A;  3ASK A;  1JJC A;  3VQW A;  1Q86 U;  3PT9 A;  2QHT A;  1KMM A;  2XG8 D;  4F7U B;  1VQL T;  4QQ6 A;  1NJI U;  2XTI A;  3L1A A;  2Q7G A;  5ELO A;  4YRK A;  2NS6 A;  3BDL A;  2XIC A;  3M55 A;  3S3O A;  4YRT A;  3A7R A;  2LNV A;  3VQV A;  2AMC A;  2KVQ G;  4L5G A;  2L3R A;  1Z7M A;  1W66 A;  1X2H A;  4M7D F;  2EJF A;  4TVA A;  4LVI A;  2HD0 A;  3ZFJ A;  4OGC A;  1I4K 1;  1KC8 U;  4LDV A;  1QVG S;  3P8H A;  1X55 A;  4C0G A;  3QSU A;  1EFW A;  4M7A A;  2AKW B;  2DJZ A;  2IVW A;  4M7A D;  3GOX A;  2LX9 A;  5LL6 S;  4HT9 A;  1D3B B;  3CMQ A;  4DA4 A;  1O9S A;  4BAC A;  3PGG A;  2AMC B;  3OYJ A;  2HQX A;  3FRN A;  1BIB A;  1KQS A;  4TVR A;  2KSS A;  4LDW A;  3A32 A;  3MEA A;  1EQR A;  1WLE A;  5CO7 A;  4IUR A;  3HHT B;  1VQK A;  4YRI A;  2RI3 A;  2XDP A;  3MP8 A;  4WJ3 M;  3Q1J A;  3OYA A;  1I81 A;  1ATI A;  2QEX T;  3PMT A;  2RK2 A;  3QBY A;  4A4G A;  3HXX A;  4MDW A;  3H8Z A;  4FU6 A;  4NL3 A;  5GAN d;  3JCM b;  1WJS A;  2MF2 A;  2JVV A;  1AHJ B;  3UH0 A;  4BI8 B;  1H64 1;  3C95 A;  4M78 B;  3OY9 A;  4JRI A;  3JCM Q;  2E5A A;  3CBP A;  5CKE A;  1WJQ A;  1NJ1 A;  1E24 A;  1WQ7 A;  4TVY A;  1WU7 A;  4IKF A;  4HT4 A;  4JDS A;  3VUZ A;  1G51 A;  2E64 A;  4XU0 A;  2DU5 A;  4E7L A;  5CAI A;  4M77 D;  4M7D G;  1VQ7 A;  4J7F A;  3IG2 A;  1BYM A;  5GMK m;  3M4Q A;  4HT8 A;  4GLK A;  2R57 A;  1GGM A;  3OYD A;  3HXW A;  2X4W A;  2OTL A;  2QHU A;  1KOG A;  4M77 C;  1USY C;  2D0Q B;  2JTM A;  2QEX A;  2I2L A;  2DAQ A;  2KMT A;  4M75 F;  3OBY A;  4NOY A;  3ERR A;  2OTJ A;  3VYH B;  3CCQ T;  3QZ9 B;  4MDX A;  4C0D C;  4VUB A;  1NYQ A;  3CCM T;  4JJN K;  1I5L A;  5CK9 A;  2LRQ A;  4M77 G;  4UP7 A;  4R55 A;  3BJU A;  1SSF A;  5FRN A;  4YRG A;  3P8V A;  2LCL A;  2Y4Y A;  5IN1 A;  3CBM A;  2K5F A;  4P74 A;  4X9C A;  1PSE A;  2KQW A;  5LJ5 e;  1M90 C;  3LH0 A;  3CCS A;  1PYS B;  4QVD A;  3PFS A;  2L8D A;  4A4H A;  1VQK T;  4Q15 A;  4FIB A;  4JLI A;  3X20 B;  4KR2 A;  2WSE E;  3WVE B;  4EDU A;  2EFI A;  5C6S A;  1E1O A;  2RJE A;  3QKJ A;  1N6A A;  3L2Z A;  1Q86 C;  2E3C A;  2D9T A;  4M75 A;  1VQ9 A;  4J5Y A;  4P75 A;  2RH2 A;  3L2V A;  1WGS A;  3JAM E;  1I8F A;  4MMK A;  4XTY A;  3CEY A;  2EWN A;  4ZGE B;  2VGM A;  1X2G A;  3CPW S;  2G4C A;  2CZ7 B;  4J83 A;  3JCM h;  3I56 A;  2X4X A;  3C12 A;  2LQ8 A;  3VKI A;  1VQ6 A;  2ZPI B;  4CS4 A;  2I4M A;  4M78 E;  1Y96 B;  1NJ2 A;  5DM7 R;  4PJO A;  1QVF A;  1NZ9 A;  3M56 A;  3M53 A;  4KQE A;  3BDU A;  1Q81 U;  4H02 A;  2DQ3 A;  4EMH A;  2O4X B;  2GCX A;  5CKD A;  4Q5W A;  2LT4 A;  4CRI A;  4RQE A;  3OYB A;  5CCA A;  4FM4 B;  5J39 A;  4E7H A;  3S3M A;  4YRP A;  3HKS A;  1WQW A;  2ARU A;  4P75 C;  2E6N A;  3CC4 A;  3HL8 A;  3RL6 A;  4BE1 A;  1VQP A;  4LD9 K;  5CR2 A;  4L87 A;  1B8A A;  4NCX A;  3ZEH A;  5C53 B;  5I21 A;  1K73 C;  1OZ3 A;  3CCJ T;  5C52 B;  5I2M A;  1MHN A;  3T9N A;  1Y71 A;  5CQY A;  2ZXF A;  3M58 A;  5FU6 B;  2P5I A;  3JCM W;  1YJW T;  2VC8 A;  1D3B A;  3HFZ B;  4M75 D;  4BB7 A;  4E7I A;  1VQZ A;  4V2S A;  3E1S A;  3LW5 E;  3L2Q A;  5A2Q E;  5HK3 A;  4BD3 A;  2IY5 B;  4XAX B;  3FJP A;  3HFZ A;  3DKM A;  3CCU T;  2MAM A;  2LTO A;  2E12 A;  1OI1 A;  4C0D B;  1VIF A;  5GMK l;  3P8D A;  3QO3 A;  3LSS A;  2YRV A;  2HQE A;  3QYG B;  4P71 A;  3OD1 A;  2PQW A;  1PSF A;  5KE2 A;  4BDY A;  1QVP A;  2ZCF B;  4ZTU B;  4YRR A;  3INZ A;  4P3N A;  1KC8 C;  4YRN A;  4UC4 A;  2EKO A;  1EIF A;  2V8I A;  4GY5 A;  4R56 A;  3MHX A;  1U1T A;  4J15 A;  1VQ5 A;  2M9U A;  3VQY A;  3TEH B;  4C5H A;  3S3N A;  3VUB A;  3ICA A;  3OYL A;  2F69 A;  3CME T;  1G3T A;  4WF2 A;  2ZZF A;  4LDY A;  2PUO B;  4EPC A;  5F5W A;  4TQD A;  3OYM A;  1J5W A;  4RDX A;  2RJC A;  1IZ6 A;  1E22 A;  4M75 G;  2MWP A;  3M4Y A;  4IUT A;  1O75 A;  1YJW A;  4BI3 A;  1W4S A;  2PUK B;  4CS3 A;  5GAO m;  3P8B B;  4M77 F;  3OA6 A;  5FU7 C;  1ZQ1 A;  2X4Y A;  3NET A;  3JSC A;  3J80 E;  3P8Y A;  2OAU A;  3VJP A;  3CCM A;  3HFN A;  1XOV A;  4K87 A;  4HCB A;  2PME A;  4TQF A;  3JCM d;  1JJ2 A;  4C8Q D;  3CCR T;  1W2B S;  2HNI A;  2DKG A;  4H2Y A;  3WXM B;  2RD1 A;  1JJ2 S;  3LLR A;  4RKU E;  3A8M B;  4M7A G;  2QQR A;  3R6O A;  3OYE A;  1L0W A;  5ELN A;  4XU1 A;  1X01 A;  1GXI E;  1KMN A;  3I7F A;  4P72 C;  1HXD A;  3DSQ A;  3SWN A;  4QQG A;  3G4S T;  3M9Q A;  4M77 B;  2ALY A;  3WVD B;  5EG2 A;  4J7I A;  4YP0 A;  3F70 A;  4PJO C;  1B76 A;  4YCU A;  1M5Q 1;  1QW1 A;  2C7I A;  3HRI A;  4BDZ A;  1M4Z A;  2GF7 A;  3V8J A;  4OB3 B;  4JRP A;  1YBY A;  4TTV A;  4L6V 5;  5DLO A;  2R5M A;  4EO4 A;  4MZM A;  2ODR D;  3JB9 J;  4KBM B;  4EMK A;  4C92 F;  4ZN3 A;  5KH6 A;  3W3S A;  2AHJ B;  3SWN C;  1YIT T;  2CJ9 A;  4M7D A;  3M54 A;  3CD6 T;  3PNW C;  2ALY B;  3LWH A;  4BE2 A;  1YFS A;  2ZR3 A;  2ZPG B;  4Y91 A;  3GLX A;  4P72 A;  2DD4 A;  1B70 A;  4H2T A;  4WI1 A;  1K9M C;  1NJ6 A;  2RK1 A;  4A53 A;  1YCY A;  2F5K A;  5LJ3 j;  4X9D A;  4OB2 B;  1YI2 T;  2XU8 A;  2Q5I A;  3NTH A;  2A7Y A;  1KD1 U;  2J3M A;  4M78 G;  4M77 E;  1HC7 A;  4M7D B;  2PVG B;  4ATO A;  5A0D A;  1YI2 A;  1WJR A;  4G84 A;  3QO8 A;  4M75 E;  4LNS A;  3UPU A;  3J81 E;  3SWN B;  4Y28 E;  2JZ2 A;  5GMK j;  1M1K U;  4F7U F;  5GAM e;  5KCO A;  3OYC A;  4X5O A;  3RKX A;  3JRZ A;  3G6E T;  3PCO B;  2PVO B;  5GAO p;  4OGE A;  3MET A;  4L59 A;  5GAN j;  3KFU A;  4C8Q E;  2XGT A;  4C5I A;  2E5Q A;  3HRT A;  4ZTF A;  3CD6 A;  2FYK A;  4UP8 A;  4BY6 B;  2DTH A;  3LX7 A;  2XD0 A;  2CKK A;  1SRY A;  1YIT A;  1KQS S;  2O01 E;  5LJ3 e;  2RHU A;  4O2D A;  2IY5 A;  2RI2 A;  1KQ2 A;  3DB3 A;  4C92 G;  3HY0 A;  2GQV A;  4HVC A;  4IUV A;  4LD6 A;  3DLL A;  4MML A;  1FYF A;  4IUP A;  4PL6 A;  3L4G A;  3RKW A;  4G85 A;  1FXX A;  3JCM g;  2E41 A;  4KUL A;  4HCC A;  2LVM A;  2RHQ A;  3AHU A;  3UGT A;  2VGN A;  2A8E A;  3JCM X;  2DPP B;  3O8V A;  1H4Q A;  5LJ3 f;  3QUI A;  4M75 B;  3UFG A;  5GAM h;  4MZT A;  1M8V A;  2RO0 A;  3NEM A;  3UGQ A;  1ZBX A;  3KUF A;  2QQS A;  2K57 A;  4HA8 A;  5HK0 A;  4XU2 A;  1LOJ A;  4M78 A;  4LVM A;  1YFR A;  3TEH A;  2CZ6 B;  4K88 A;  1M90 U;  1UGR B;  2K5I A;  3A74 A;  4OVA A;  5M9O A;  5DLQ E;  1B7Y A;  2DDZ A;  2KAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...