2E10A

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutation r51a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
217
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGESPEGGLWLSIVLSPKKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Biotin Protein Ligase
publication title Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
total genus 66
structure length 217
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e10A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e10A01
2E64A 3L4GA 1N9RA 4QVDA 4M77F 3JCMc 3PCOB 1M8VA 2ZT6A 3HXVA 3HY0A 1B8AA 2RA2A 3A74A 4L87A 4C8QA 1B7YA 3QNEA 3PZCA 2E5AA 3VQYA 1X55A 3DSQA 3BFMA 5E3IA 3W3SA 2JN0A 3RESA 4M7AE 2EAYA 4M7AC 5GMKe 1X01A 4M7DC 4CS2A 4PJOE 2ZIOA 5GMKl 4P3PA 4NOYA 5GMKh 2Y90A 4F7UF 5GAMe 4PJOC 5GAN4 4M75B 4HT8A 3A7RA 3M4QA 5GAMh 5LJ3f 1YFSA 3HXYA 3NELA 3QHSA 1M5Q1 1HK9A 3FIFA 2E1HA 4XTXA 5GANf 1Z7MA 1E22A 4M77A 3JB9I 1HXDA 2DZ9A 1KMNA 3V8LA 4PG3A 4Y91A 2DQ3A 1ADJA 4JUVA 4M78F 2VC8A 3G1ZA 5LJ5g 4CH5A 1D3BB 1NJ8A 2ZT8A 3JB9G 4HWRA 4XU0A 1EQRA 4G85A 4P75C 3TEGA 2RM4A 4P3NA 3MF1A 1U1TA 5LJ3e 3P8VA 4HVCA 2DTHA 3RUXA 2I4OA 4YREA 2ZTGA 2J3MA 2ZZFA 1ASZA 4EMHA 5GANe 2XTIA 4DPGA 2FB7A 1NJ5A 2CJBA 3L4GB 3JB9H 4M7AD 4F7UA 1USYA 4O2DA 4XTVA 1WYDA 4RCBA 4H2XA 4JLIA 3E9IA 4PJOD 4C92A 4HWOA 2ALYA 3VU3C 2C8MA 4C8QB 1B7YB 4NL2A 4XTZA 2ARUA 4EX5A 4P73C 4Q6GA 4YRSA 1EVKA 3AHUA 5GAOm 3HXZA 1EIYB 5K1XA 2AMCB 4YRIA 2DEQA 4Q15A 2IY5A 3P8TA 4M77G 4M78A 2ZNIA 4N0AC 2RHQA 3QSUA 3V7CA 5GAOl 3HFZA 1JBMA 1ADYA 2XGTA 5GANg 3EFSA 3JCMe 4YRQA 1L0WA 4H2TA 1WPYA 3HRKA 3JCMh 4YRLA 1SESA 2FYKA 5GAOn 4ZIBA 3VBBA 2E41A 4P72C 4TQDA 1JJCA 3IKLA 2RB6A 4M77B 2DJZA 1NJ2A 4M75E 1JRIA 1PYSB 4F7UG 3QUIA 3HXUA 4M75C 4X5OA 4G84A 1KQ1A 1WQWA 4E51A 4XTWA 5GAN5 2QHSA 2VXEA 1H4VB 2ZINA 4C92G 3TEHA 3UFGA 3VQWA 4YRPA 1ATIA 1I8FA 3JCMP 5GAN3 1TH7A 2E65A 5GAMj 4M78G 3EFRA 4EMKA 3V8KA 3OD1A 4F7UB 5C51B 3WQZA 1WNLA 3NENA 1MGQA 3LC0A 2I4LA 3A32A 3HY1A 4J6WA 5F5WA 4XTYA 1SETA 4C92B 3I7FA 4CH6A 2K57A 2ALYB 4KR2A 4H2UA 3HRIA 2Q5IA 2ODRC 1LOJA 5GMKm 3HFVA 3HFOA 4P71A 1W66A 5LJ5e 1I4K1 2VXFA 4M7DE 2IY5B 3V7RA 4JRKA 5LJ5h 5ELNA 4M7AA 3RGLA 4M78B 2DU5A 3CMQA 4RQEA 2RHQB 3QO5A 2AKWA 4WI1A 4M75D 4TVWA 4C8QE 3HFZB 4PJOA 4J6YA 4C8QC 4YRMA 1H4QA 4YRGA 4C92F 2I2LA 4OP0A 1G51A 4YROA 5K1PA 4TQFA 3VQXA 4P74C 4HWTA 1Y96A 4J5YA 2EJ9A 4XU1A 4UP8A 4RDXA 4TVAA 3PGGA 4RCCA 1H4SA 4MMLA 3RIRA 3A31A 3KFUA 5GAMd 3HTZA 2DXTA 2DQ0A 4YCUA 4P75A 4JRIA 2P5IA 2ZIMA 3TEHB 1KOGA 4YDQA 2DZCA 2ODRD 1H641 5LJ3h 4WF2A 4M77C 4X9CA 3QO7A 1B76A 5I21A 1ASYA 3V7SA 5GANh 3REXA 4M7AG 4M7DD 4EMKB 1E1OA 5GAOp 2CIMA 3A5ZA 1X54A 1G5IA 3JB9D 2ZCEA 4XTUA 1X2HA 2CJAA 4PJOG 1C0AA 1X56A 4C8QD 3ICAA 4A53A 3LSSA 1NYQA 3MF2A 4CS3A 4WJ3M 1KQ2A 1HTTA 5GAN6 3M4GA 2ARTA 3PCOA 1HC7A 1USYC 2C7IA 4H02A 4ZTZB 4J6XA 1J5WA 2ZR2A 2AKWB 3RERA 5HGQA 4C92C 1SERA 1KMMA 4YPFA 3JCMJ 1BIAA 1YGBA 4YRJA 3RKXA 4X9DA 4CH4A 4BWAA 3QTCA 2ZT5A 4WJ4A 1Y96B 3BJUA 3INZA 3SWNA 4M78C 4P72A 4TVAB 2DTOA 4HT9A 3JCMW 4M75A 4M7AF 1EOVA 4P3OA 4M7DF 4K86A 4H2VA 2Q7GA 3JCMd 4RMFA 4XEOA 3GIBA 5GAN8 2ZZGA 1IL2A 4PJOF 3FB9A 4TVYA 3FJPA 2ZNJA 3VQVA 4CS4A 5GAOr 1YFTA 5GMKj 3QO3A 1B70A 1LNXA 3RF1A 2J3LA 1G5HA 1NNHA 4YRKA 2Q5HA 1D3BA 3BW1A 2YLBA 5GMKi 4H2XB 3IKMB 2CJ9A 1LYLA 4H2WA 1N9SA 5C53B 3RL6A 2DVEA 2G4CA 4AH6A 1I81A 4YRTA 3A7UA 3JB9J 2ZZEA 3HFNA 3NEMA 4YRNA 3LSQA 2P0LA 4M78D 4EMKC 2Q7EA 4M7DA 2PMFA 11ASA 2RD1A 5GAMf 4V2SA 4MMKA 5LJ3j 4M75G 2CGHA 1B34A 3JCMQ 3A7AA 4KQEA 2RHSA 4BW9A 5GANj 4EO4A 1EIYA 3JCMV 4DQ2A 1N9WA 2AMCA 4P71C 4P74A 5LJ5d 1YB3A 3SWNB 1JJCB 4K87A 1BIBA 3RACA 2ZXFA 1H4TA 3P8YA 1EFWA 3HXXA 2I4NA 4YCVA 4YRFA 3HXWA 2E3CA 5C52B 4UP9A 1WLEA 2Q7HA 4YYEA 4H2SA 4M77E 4YRRA 5DY9A 1U1SA 4HA8A 1B70B 2E10A 4H2YA 1LJOA 1VQZA 2QHVA 4XU3A 3R07A 1PYSA 3BDUA 4J15A 1E24A 4M7DG 4NCXA 1GGMA 1WU7A 3TUPA 4QVCA 3JCMb 5ELOA 4M75F 1BBUA 4K88A 5LJ3d 4C8QG 3V8JA 3L2ZA 3QO8A 4LNSA 4HWPA 2DU7A 4P73A 4UP7A 2EWNA 5GAMg 4YP0A 5GANd 4XU2A 2EL9A 1FYFA 3A5YA 4F7UE 1SRYA 3UH0A 1EVLA 2QHUA 1RIQA 4N0AA 2ZR3A 2EJGA 4M7AB 1Z7NA 4UPAA 4M7DB 4PNOA 4C92E 2DDZA 3JCMf 3HSBA 4PJOB 1B34B 4NL3A 4TTVA 4RQFA 4A54A 2RHSB 5GAN7 4XEMA 4YRCA 1BBWA 12ASA 1X2GA 3REUA 4M78E 2DXUA 4KR3A 3IALA 1QF6A 2QTXA 4M77D 5LJ3g 1NYRA 3M4PA 3UGQA 1WQ7A 5CAIA 3RKYA 3E9HA 3NETA 2DTIA 1QE0A 3L1AA 5GAN2 1NJ6A 3RKWA 3JB9F 5LJ5j 4TWAA 4ZTUB 4C8QF 4XQ3A 2YHTA 1E1TA 2ARSA 3ERRA 4OLFA 4PHCA 2HNIA 1I5LA 3SWNC 2EJFA 1NJ1A 4YCWA 3UGTA 4CH3A 3BY7A 2I4MA 2DKGA 1YFRA 3JCMX 2ZGWA 4C92D 4EMGA 3SB2A 1YCYA 2YLCA 5GAOq 3IG2A 5LJ5f 2ZT7A 2QHTA 2PMEA 3JCMg 3MEYA 5KNNA 4HWSA
chains in the Genus database with same CATH superfamily
2L0AA 3WXMB 1X6GA 2YRCA 3ASKA 2X51A 3JCMc 2HBPA 2JTMA 1MV0B 3OYNA 1M1KC 1M9SA 2RA2A 3HRTA 3QNEA 2FZGB 4HVVA 5CKHA 1Q82U 2EYYA 1H3HA 1VQ4Q 2DM1A 1N8RC 3I55T 4MZMA 1G3TA 1PM3A 1ZUYA 2A7YA 2QXFA 5GMKe 1WYXA 3JRZA 4ANJA 1X2KA 2DA9A 2FRWA 4M75B 4QQDA 3HXYA 2R5AA 3NELA 5CIUA 1HK9A 3FIFA 3CMAA 1U06A 2E1HA 4K11A 5FRMA 4Y28E 1YITT 1KG1A 1SPKA 4GBQA 1G3SA 1BI2A 4M78F 4OB0B 1X75C 2DBMA 1NJ8A 1TXQA 4OMQA 1UHFA 1B7TA 4XU0A 1EQRA 3IQLA 2RM4A 1YI2Q 4P3NA 3MF1A 5LJ3e 3EFOB 3RUXA 4YREA 2RI3A 7AT1B 2XTIA 2FO0A 2JS2A 5KE2A 5FU6C 2FB7A 2BTTA 1D1AA 3JB9H 4JZ3A 4OF1A 4RTWA 1TUCA 2XDDA 3QYGB 2QQRA 4DA4A 1EFNA 3JV3A 4Z8AA 3REAB 4KGZB 2C8MA 1B7YB 4NL2A 2ARUA 2MF2A 3HXZA 5GAOm 1WIEA 1YJWQ 4E7KA 3M0QA 2L89A 2JTEA 5M9OA 2ZNIA 2RHQA 3QSUA 3E19A 2EYQA 2QDYB 2EQMA 2XGTA 1YJ9A 4HCBA 4R56A 2RPNA 4H2TA 1UEBA 1JXOA 3M0RA 3HRKA 4EIKA 3QIIA 1FMKA 3QJ6A 3VBBA 2DO3A 1Q86C 2WSFE 2E41A 2NUZA 3CCJT 2NUPB 4LUEA 2LJ0A 3CCVQ 2RQVA 2RHXA 4M75C 1KQ1A 1LPLA 2ENMA 2J06A 4E51A 4FW2A 1H4VB 3M9QA 2ZINA 5D6YA 4Z02A 2D1XA 2E3IA 2A0FB 4C0ZA 2ZZDA 2XMFA 1TH7A 1KD1U 3CCEQ 1C6VX 4M78G 3EFRA 4F7UB 3WQZA 1B3QA 1MGQA 3LC0A 4AFQC 1YJNT 1M3AA 3CC7T 4C92B 2GFUA 5J26A 4H2UA 3EG9A 2Q5IA 2ODRC 5GMKm 3CCUT 3HFVA 2HKQB 1W66A 1NPPA 2KVQG 1ZSZA 4M7DE 1UGSB 2IY5B 4JRKA 1RAIB 2MOXA 2L3SA 2O01E 4RQEA 2FVUA 2OX7A 4DEXA 2MK5A 4TVWA 2Y4XA 3CD6T 4J9HA 5KYWA 1RI0A 1H92A 4JJBA 1H4QA 4YRGA 1M2OA 2R57A 2I0NA 1Z9QA 5K1PA 4TQFA 2MIOA 2VWFA 1Y96A 1E6GA 4RDXA 1NLPC 1E6HA 3PGGA 1JQQA 1KHIA 1K9MU 1HJDA 3KFUA 2RJEA 2COZA 5GAMd 3C94A 2DXTA 2KYMA 4OB3B 1JB0E 2HSEB 1AOJA 2P5IA 3FC3A 3G71T 4YDQA 2DYIA 2P4RA 4WF2A 1SHFA 2GBQA 1GFCA 1YP5A 2O4XB 1ASYA 2DRMA 3V7SA 1SEMA 4M7DD 4J9EA 3A5ZA 2MWPA 1G83A 1VQPQ 2CIMA 3LW5E 1DJ7B 1UDLA 3P8DA 3E9GA 1WHHA 1XQHA 3CPFA 4CC3A 4PJOG 3S6WA 2K5IA 2PUOB 2V8JA 1QP2A 3LSSA 2E12A 4WJ3M 5IXFA 2QG9B 4ZN3A 4KGXB 1Q7YR 1KQSP 5GAN6 1K9MC 2ARTA 4CI0C 2LZ6B 3OYKA 2C7IA 1T0JA 1TOVA 3J80E 4J6XA 1VQ4A 3EGDB 3OYIA 3RERA 2FHDA 3A8MB 4C92C 2DNUA 2HCKA 2EPDA 3OYDA 1KMMA 4YPFA 3EH2A 2EGAA 1YGBA 4X9DA 4CH4A 1NG2A 1U5SA 4OMPA 2ZT5A 4WJ4A 5CQXA 2QA4T 3X28B 2RH2A 4TVAB 3CCQT 2VV5A 4MZTA 4FSSA 1CKBA 1NEGA 3QPHA 2JW4A 4M75A 1OI1A 4F16A 4H2VA 4A4HA 4XEOA 2KQWA 1OPKA 4BDYA 1W2BA 1B70A 1LNXA 2KE9A 2LRQA 1EZZB 3VYGA 1YI2A 3SDZA 1YHQT 2K6DA 2MMPA 3G6ET 3MKDA 3CC4Q 2X4WA 3BW1A 2F2WA 2YT6A 3IKMB 2CJ9A 2HSPA 4H2WA 2RI2A 5EG2A 3UA6A 2E5KA 2G4CA 1PRLC 2LNVA 2ZZEA 3NEMA 1QCOA 4OMOA 2AKKA 2L3PA 2DVJA 4M78D 3OYAA 2Q7EA 2PMFA 3TQ7P 2FG0A 2JXBA 3OMCA 5GAMf 4V2SA 11ASA 1YJWA 2CGHA 3DLLA 1VQLQ 1B34A 3JCMQ 4KQEA 3KUFA 2RHSA 2CZ6B 2LNHB 5GANj 5FU7B 2K4YA 5C0MA 3JCMV 2XIDA 4DQ2A 1N9WA 1BI0A 3TU4K 1YB3A 3SWNB 1Y07A 3PMIA 1OEBA 3RACA 3OQ5A 4KULA 1V1CA 3I5RA 4A4FA 2VB6A 3J81E 2ESWA 1T3LA 2BZYA 2KY9A 3MEVA 3CCVA 3HXWA 4YRFA 5C52B 4UP9A 3QYHB 1K1ZA 1GCQC 4ELYC 4MZPA 5IHNA 3E9FA 2NUPA 3PE0A 3EG0A 4JPBW 3THKA 1AD5A 5I2SA 4J15A 2OJ2A 4VUBA 4NCXA 1GGMA 1WU7A 1I07A 3A8HB 4JJDA 1PC0A 5ELOA 5KYNA 4M75F 2YSQA 4JRQA 4C8QG 3CCEA 3L2ZA 4HWPA 1X6OA 5GAMg 4YP0A 2KT1A 1SRYA 1EVLA 4GLKA 2QHUA 3CCSQ 2XKOC 4ZGDB 2ZR3A 6AT1B 2L5QA 2EQJA 1A0NB 3REBB 2BUDA 4PJOB 4C5IA 1PKTA 2RQRA 4XEMA 3EGUA 2HD0A 2DD5A 3RBBB 4FSXA 2RJFA 3CEYA 1Y7XA 3M4PA 3UGQA 1WXUA 5CAIA 3NETA 3FEOA 3FLGA 2DL7A 5CCAA 1TUGB 1IB8A 5FU7C 4TWAA 2RK2A 4ZTUB 2YHTA 4JS4A 1RABB 2BZ8A 4J9BA 1YIJT 2YDLA 1M90U 4OLFA 1I5LA 3M5AA 3SWNC 4DBFA 2QTVA 2KROA 3MPUB 1PRMC 4CH3A 3BY7A 5IT9E 1X43A 2ZGWA 4BDZA 1ZBJA 1XNIA 3F70A 4PLIA 1UGQB 3I56Q 1T3SA 1YCYA 1VQPA 5FROA 1T0HA 2K2MA 5KNNA 3OYFA 2BZXA 4HWSA 4BI3A 5IH2A 2DL5A 3S3NA 2E70A 3GNFB 3N5BB 2MWOA 2ZT6A 2KAFA 5D7UA 4ZTJA 1IRXA 5HY6A 2LDMA 4ESRA 3OS1A 2E5AA 2QDLA 2M9UA 2JN0A 3OA6A 4E7ZA 3NTHA 5D6WA 4BI8B 2A8EA 1QW1A 2EAYA 5CR2A 1NJIR 2AT1B 1G5VA 3CC2Q 4L59A 4LVJA 3MP8A 2CZ1B 1QKXA 5GMKl 1VQOT 2KR3A 2ZCFB 4F7UF 5GAN4 4PJOC 4HT8A 1HD3A 3A7RA 2DK3A 2EYZA 1N27A 2K5LA 1WHJA 5GAMh 3MP1A 4HCCA 1YFSA 2X4XA 1NYFA 3QDRB 3OYEA 2CP6A 4OGCA 1Q7YC 1IO6A 2RN8A 1Z7MA 1WXTA 2KXDA 3M56A 4BUGA 3CCLQ 4JZ4A 2VC8A 3BDLA 2JOYA 2ZT8A 2YUNA 1MMGA 2IIMA 4HT4A 5KYXB 2ROLA 4CC4B 3PMTA 3CC4A 3L2QA 2J3MA 2ZZFA 2QEXT 1ASZA 4DPGA 3C95A 1NJ5A 2CJBA 3L4GB 4O2DA 2P0PA 1WYDA 4RCBA 3WVEB 4II1A 2ZPIB 3NGPA 3E9IA 1VYVA 2DPPB 2FZKB 1OZ3A 2ALYA 1VQ8Q 3VU3C 4LD6A 3M0TA 4C8QB 4ZTFA 1O9SA 1X69A 4Q6GA 1EVKA 3AHUA 1EIYB 1VQ6T 2RMOA 2BKDN 4LDWA 1K8AR 2AMCB 4YRIA 4LXCA 3P8TA 2QASA 4M78A 4N0AC 4ATOA 3PVLA 5LL6S 3CCRT 1AWXA 3LLRA 4OVAA 3EFSA 3JCMe 4YRQA 4JDSA 2K3BA 1M2VA 1W6XA 2CP3A 2P4TA 1I1JA 3CPWA 4YRLA 4MDXA 2IPOB 4ZIBA 4EPCA 2L3QA 1QWEA 2KI7A 3IKLA 2RB6A 3EG1A 4M77B 5HK3A 1D0YA 4M75E 1G3YA 1M8MA 2KDSA 9ATCB 2O9VA 2OAWA 3VKIA 4F7UG 2LJ1A 4X5OA 4IKFA 2DIQA 1FMWA 5GAN5 2CT3A 3QG1A 4A4KA 4XK8E 4C92G 3TEHA 3UFGA 1WLPB 3I35A 1I8FA 1VQNQ 2HQXA 2B86A 2H3JA 3JCMP 4ELZC 2DMOA 3OBYA 3V8KA 1WXBA 1VQ7T 2NUTA 4PLLA 3CXCS 1NE8A 2NS6A 8ATCB 2DRKA 4QKUA 3H6ZA 4LD9K 5FRNA 3HY1A 3G1JA 3OS0A 3CPWP 3CCSA 1WA7A 4PJMA 1LOJA 4IIOA 5LJ5e 5CQYA 1I4K1 1QVFP 1UGRB 1BYMA 2EFIA 3G4ST 2OTLT 2HDAA 2KRNA 2KSSA 2WSCE 1VQKQ 4C0GA 2AKWA 3H8ZA 2VGMA 4M75D 4NS5A 1HYOA 2EQUA 3HFZB 4PJOA 4J6YA 4LVIA 1Y0MA 1UJYA 4C8QC 1JJ2A 1V29B 4E47A 4RTVA 1VQ9Q 2I2LA 2ZPGB 4OP0A 1G51A 1NPRA 3OSVA 1QWFA 2MCNA 5EC7A 4J7FA 4J5YA 1SSHA 1OULA 2SEMA 1H4SA 3MQZA 2CP5A 1ABQA 2OTJQ 3A98A 2WACA 4YCUA 4HCKA 5FW9A 1JO8A 4RTUA 2DD4A 2ZIMA 4TVRA 2DZCA 4B9XA 1MMNA 2ODRD 3PVQA 3L2VA 4AG2C 4M77C 4IUUA 1IHVA 3QO7A 1B76A 2QK0A 1Q86U 4RKUE 4M7AG 3I56A 2NLUA 4EMKB 5GAOp 2JJ9A 1BCOA 2FZCB 1X54A 2ZCEA 4XTUA 2EVRA 2QQAA 3O5ZA 1JJ2P 2QGGA 4OB1B 1AWJA 1RUWA 1S1NA 2HQHA 3GF5A 1NYQA 4CS3A 1IGUA 2GGRA 1OX8A 1HTTA 3OYJA 1NJIU 3CBOA 1USYC 4ZTZB 4Y92A 1J5WA 1ZBXA 2A3LA 2J6OA 3M59A 4JRPA 2JUFA 1FXXA 1M30A 5A0DA 4YRJA 4OB2B 3CC2A 5CKBA 4HVUA 1YITQ 5IAYA 1ACMB 2D6FA 2BE9B 4FCYA 1IHWA 1JEGA 1ZUUA 1I0CA 2DTOA 1WZOA 3MP6A 4HT9A 2ZPBB 3JCMW 1R0CB 1VQMT 2D0QB 2Q7GA 5CKFA 4OMLA 5GAN8 2ZZGA 4PFOA 4PJOF 1BI3A 2CSIA 3CCLA 2ZNJA 1N5ZA 2DXCA 4CS4A 1M1FA 1YFTA 5GMKj 3NTKA 1NJIC 2CP7A 2KYBA 2K9GA 4F04B 2HEQA 3OYHA 3VJPA 2Q5HA 1SSFA 2K7AA 2YLBA 5L8RE 4H2XB 3QKJA 2RHZA 4KGVB 5IXBA 5KYXA 1SRLA 1N9SA 1LYLA 2YUQA 2L8DA 5C53B 1S72T 3RL6A 1W4SA 2DVEA 4BD3A 1K73U 2E6ZA 1SG5A 3A7UA 1C0MA 3HFNA 3E2UA 2RQWA 1VQ8A 3Q1JA 4EMKC 5GJVB 4IUTA 3X20B 4MMKA 5LJ3j 1Q81R 2COWA 1CSKA 2AKLA 1NEBA 2D0NA 4ORZA 1EIYA 3CCJQ 2AMCA 4P71C 2CUBA 2GTJA 1KIKA 3EGXB 3D7SB 2LMJA 3CCMT 1BKBA 3X25B 1JJCB 4FU6A 3H0HA 4B9WA 2BE7D 1H4TA 3FRNA 2LT4A 1WHMA 1QLYA 2J05A 1G2BA 2O88A 2I4NA 1K73C 2Z0WA 1K8AC 4F14A 1AVZC 4GY5A 4HA8A 1AWWA 2GCXA 2PVGB 1LJOA 1VQZA 3OMGA 3VUZA 2PU9B 2QQBA 2HL5C 3GLXA 2V26A 2DLPA 1KC8R 3CC7Q 1VQNA 3CCUQ 5J39A 4K88A 4OGEA 1M3BA 1PG5B 2EQIA 4LNSA 3ZL7C 3NMZC 2DU7A 2DL4A 4CC2A 1TSFA 5GANd 1YWPA 2ECZA 1WJQA 4XU2A 3GPLA 1FYFA 4CRIA 3TREA 3CMEA 3S3OA 1GCPA 3MJXA 3CD6Q 2RJDA 3VS5A 4M7AB 4UPAA 4M7DB 4Z89A 4ME7A 2LQNA 3LH0A 3HSBA 1UGPB 2RHUA 3CC4T 4TTVA 1OYXA 3LGLA 3SD4A 5GAN7 1X27A 4A4GA 2YXYA 4FL6A 1VQKA 3OS5A 1X2GA 4M78E 2DXUA 1QF6A 4E7SA 1ZUKA 5LJ3g 1NYRA 5A0LA 1VQ9A 3RKYA 1D09B 1KQSS 3OYCA 2LJ3A 1G8XA 4ZNXA 5C6SA 1GXIE 1BBZA 4BACA 1NJ6A 2VVKA 2DX1A 4MDWA 3G71Q 3JB9F 2KRMA 2RNAA 4BB7A 1VQLT 1KHCA 2KT8A 4C8QF 4XQ3A 1E1TA 2PNIA 2LQ8A 3VS4A 2OTJA 2HNIA 1J3TA 1YN8A 2DF6A 4ZGEB 3UGTA 2I4MA 2O2OA 2DKGA 1YFRA 3JCMX 4E7HA 1YFNA 3H9NA 3PIPA 1MMDA 3EFOA 3MHXA 3IG2A 2P84A 3MEUA 3MEYA 4RG8A 4QVDA 3RMSA 3I55A 1P92A 4M77F 4BY6B 3NPFA 4PFPA 3A74A 2C0TA 1M3CA 1B7YA 3OYLA 3VS0A 1VQ5T 4F17A 1GBQA 5KYUB 1X55A 1BK2A 1W2BP 5HKCA 4E6RA 4RG2A 2HL3A 3VYHB 2YRDA 3CCQQ 3RESA 4KRTA 2JM8A 2XDPA 3TEEA 2PQWA 4M7AC 4M7DC 1RLPC 4PJOE 1YITA 4NOYA 5GMKh 2Y90A 3M4QA 3EHRA 5IN1A 1D1CA 1FMVA 1TUDA 1ABOA 2D8JA 3QHSA 4FM4B 2RK1A 5GANf 1YHQQ 2MI6A 3HRUA 1W2BS 2DZ9A 3G6EQ 2ABLA 2CZ7B 3V8LA 4PG3A 4AMCA 4Y91A 2DQ3A 1RAAB 1ADJA 2QYZA 3VRYA 4QQGA 3G1ZA 1FX7A 4CH5A 1D3BB 4QVZA 3JB9G 4BI4A 2CH4A 4HWRA 2KRSA 2CYZB 2V1QA 3CMAT 4IUPA 3P8VA 4HVCA 4C5HA 3OW2A 2ATCB 1D0ZA 2I4OA 4D6WA 4RTYA 5I22A 5CKDA 4DBRA 1WJSA 3O8VA 3UF4A 4F7UA 4O5VA 1E7OA 4XTVA 1Q81U 4H2XA 1WHGA 4JLIA 4PJOD 4C92A 4O6JA 4YTLA 4YRSA 4P73C 2LX7A 2RJCA 2RQUA 4Q15A 2IY5A 1D0XA 4M77G 2A28A 4IURA 4BY6C 3UWNA 3CCJA 5GAOl 1ZLMA 2MPXC 2EIFA 2ZPFB 1ADYA 5GANg 3DB4A 2KEAA 1JU5C 3DB3A 2FRYA 2X35A 5HCKA 1Q82R 1QVGA 4FT4A 3M4YA 3UA7A 2F5TX 1ARKA 2AZVA 4JJNK 4P72C 3OYMA 1JJCA 2DJZA 1YJ9T 1Q81C 2G3RA 3QUIA 4G84A 1KK7A 1OPLA 4XTWA 2VXEA 3VRZA 3HPWA 4JLGA 3VQWA 1H3ZA 1YJNA 1ATIA 4LNPA 2LP5A 3CC7A 2HZYA 1GBRA 1Q7YU 4LVKA 2O4XA 2E65A 3I9QA 5KE3A 3CCUA 3OB9A 2EKHA 2GF7A 3HRSA 1R8OB 3OD1A 1XTDA 4L5GA 1TWBA 5L23A 2I4LA 3GBQA 3A32A 4LDXA 3VS2A 1G3WA 4XTYA 1SETA 3I7FA 4CH6A 2K57A 4QW2A 3WVDB 3CD6A 3HRIA 4Q5WA 1VUBA 4L6V5 3V7RA 1KC8C 5ELNA 4M7AA 3RGLA 1GRIA 2RHQB 3EGDA 3QO5A 4WI1A 4C8QE 2V8KA 3EH1A 3LYIA 4YRMA 4C92F 1N6AA 1GCQA 5I2MA 3VQXA 3M0SA 4HWTA 3LGFA 3G71A 4TVAA 2JT4A 4RCCA 2LCLA 2XICA 1JXMA 1R77A 3RIRA 2CDTA 3KXTA 3A31A 5KYYB 2RF0A 2DQ0A 2K2VA 1ZQ1A 1Y71A 1F1BB 4JRIA 1RI9A 2XU8A 1BU1A 3DLMA 2FPFA 1C1AA 2HMAA 4DOVA 1WFWA 1TU0B 4J8OA 5I21A 5GANh 2XK0A 3M0UA 3C12A 1MNDA 2DEUA 1E1OA 4PL6A 3GOXA 3JB9D 1X2HA 2C0IA 4C8QD 3ICAA 2RQTA 4A53A 3MF2A 4R0KA 3EG3A 3LX7A 1PSFA 2H3EB 4PJLA 1UTIA 5HK0A 1KQ2A 2QQSA 3CXCA 1ZSZB 1VQOQ 1KD1R 1HSQA 1HC7A 4H02A 2QA4A 4QQ6A 5IHIA 2ZR2A 2C06A 3CCQA 3UDCA 1BIAA 1UGVA 5KYWB 2QI2A 3A8LB 1UG1A 3OY9A 1QVPA 3QTCA 1Y96B 3BJUA 1MHNA 4P72A 1QP3A 3SWNA 1VQ4T 5FLXE 4UC4A 4N4GA 4KH1B 4M7AF 3UPUA 4M7DF 2DBKA 1YHQA 1ZA1B 3HTRA 3JCMd 4RMFA 4RTZA 3SHWA 1IL2A 3G6EA 3J7AF 3EHQA 2QEXQ 4TVYA 1CKAA 1U3OA 1VOMA 3A1PA 3FJPA 3VQVA 5GAOr 3ER0A 2COYA 3QO3A 1KJWA 2X9HA 2VGNA 2J3LA 1XOVA 1UHCA 2DILA 1NNHA 4LDYA 3QWXX 1AZEA 4YRKA 1D3BA 2EBPA 3A5ZB 1YWOA 2JTFA 2OI3A 2K79A 2RHYA 4A4EA 1VQ6Q 4KUDK 3CMEQ 4DEYA 4AH6A 2XG8D 1YI2T 5FWBA 4D8DA 2J6FA 3JB9J 3QWYA 2W0ZA 4YRNA 3CCRQ 3LSQA 1MNEA 2P0LA 2CP0A 3RMQA 3M54A 2NWMA 4BW9A 2F69A 1ZX6A 1B07A 4EO4A 4KBMB 5CVIA 2V1RA 1O75A 2DE0X 2O9SA 4AFSC 5LJ5d 1XJWB 3CPWS 1ZSZC 3VS3A 2DETA 1YJWT 2CUDA 3JSCA 2F5KA 1QVFS 2ZXFA 3PT9A 2ED0A 3P8YA 5DLQE 3TSZA 3PIOA 4N4HA 1RL2A 3HXXA 3QZ5B 1K9AA 1LCKA 3HKSA 2VUBA 4HCZA 2E3CA 2M1HA 1WLEA 4YYEA 2YRVA 5DY9A 4IIMA 3EG2A 1B70B 2E10A 4H2YA 1VQ7Q 3VS7A 2KXCA 1K0SA 2QQ9A 4XU3A 3R07A 3BDUA 1EIFA 1E24A 4M7DG 3TUPA 3CCVT 3ZBDA 1UFFA 1Q82C 2CZ0B 3HP9A 5LJ3d 3I55Q 3QO8A 2X3XD 4E7JA 5GJWB 2XD0A 2K3XA 5J3BA 5DM7R 4UP7A 2EWNA 4J9DA 3G4SQ 2OTLQ 2EL9A 3A5YA 4F7UE 3UH0A 1Y57A 2EYWA 4N0AA 2EJGA 1Z7NA 2LTOA 2YUOA 1IZ6A 1TS9A 4C92E 3CCET 1AWOA 3JCMf 2HAXA 3L2RA 1B34B 4NL3A 4RQFA 4A54A 2RHSB 2W10A 4KT0E 4LVMA 2EKOA 1Z9ZA 2D9TA 1JJ2S 1BBWA 5KCOA 4KR3A 3IALA 2QTXA 1TTHB 2FL7A 1YIJA 4C5GA 2KMTA 4E2FB 2GQVA 1QE0A 1UB4A 4BE1A 3L1AA 1NYGA 2LCCA 1RACB 4IUVA 5LJ5j 3LWIA 2FEIA 3OYYA 2E6NA 4LN2A 1KFZA 5I11A 1SKUB 4CC7A 3M55A 2ARSA 3ERRA 1W70A 4PHCA 2D8HA 3A8OB 3LH5A 1NJ1A 5KYYA 3URGA 3QBYA 2ED1A 3RNJA 2CREA 5AYFA 4C92D 4EMGA 1RAFB 5CKEA 2IVWA 3UT1A 5GAOq 5LJ5f 2ZT7A 1K8AU 2QHTA 2PMEA 3M58A 3JCMg 2DERA 1WDXA 2A36A 2E64A 1GL5A 3L4GA 2MAMA 1N9RA 4LUDA 5AT1B 2CT4A 3PCOB 1M8VA 2EQKA 3HXVA 3CBPA 3KBGA 3HY0A 1UE9A 1B8AA 1VQPT 4FIBA 4L87A 2A08A 4C8QA 2X4YA 4J9FA 3TSWA 1VQOA 2PZ1A 5CK9A 3PZCA 3VQYA 4FYXB 1PCXA 4BE0A 3DSQA 3BFMA 5E3IA 3W3SA 3BE3A 2WSEE 2E5QA 2LVMA 2DFUA 4RMOA 4M7AE 1WI7A 2ROTA 2RHIA 1X01A 1VQMQ 4CS2A 3M0PA 3NFCA 2ZIOA 4P3PA 4LDVA 1VYTA 5GAMe 2Y4YA 3M57A 1X2QA 2EW3A 5LJ3f 2J7IA 2JS0A 4J9CA 1BB9A 1M5Q1 3ME9A 4LVLA 3G7ZA 2R5MA 1OZ2A 1KD1C 4XTXA 1ZSGA 4M77A 3JB9I 1HXDA 1KQSA 1KMNA 1SHGA 2QEXA 4JUVA 4GLMA 2CS7A 1YJNQ 3FDRA 5LJ5g 5IHKA 3ZEHA 1MMAA 2P0QA 1S72Q 3X26B 4G85A 4P75C 3TEGA 1IREB 4FW1A 1AT1B 1U1TA 2DTHA 1WJRA 2ZTGA 2ZAEA 4EMHA 5GANe 3TCJA 1M90R 2XHCA 4PFZA 3X24B 1VQ6A 2H8HA 4ZN1A 2C0OA 4M7AD 1USYA 2DL3A 4OMMA 4BE2A 2LCSA 2DJQA 2JM9A 4HWOA 3VS6A 3CCRA 2XI9A 4EX5A 4FYVB 4XTZA 2BIVA 2X4JA 5K1XA 3CCMQ 2DIGA 2DEQA 2NYSA 2R58A 3P8HA 1VA7A 4J9IA 3RR6A 2KGTA 3V7CA 1M4ZA 3HFZA 1JBMA 4RTTA 1SF9A 1OU8A 1L0WA 3PTAA 1WPYA 2JMCA 3JCMh 1SESA 2FYKA 2PVOB 5GAOn 2SRCA 2X3WD 1M1GA 3E1SA 3SEMA 1PNJA 4TQDA 1RAEB 4FYYB 1NJ2A 3OBWA 3R6NA 1JRIA 3L42A 1PYSB 3HXUA 1WQWA 4D8KA 3VS1A 2QHSA 1VQ7A 1UJ0A 2DXBA 4HVWA 2HBWA 1OOTA 4YRPA 3QDFA 1QMCA 1RADB 2F2VA 1Q95G 2AK5A 1NLOC 3OYGA 5GAN3 2KNBB 1I5OB 1U8RA 5GAMj 5ECAA 4EMKA 2DYBA 1YCSB 5C51B 1WNLA 1EX4A 3NENA 3G4SA 3UATA 2OTLA 2LC4A 1PHTA 4J6WA 5F5WA 3R6OA 2ALYB 4KR2A 3DKMA 1H8KA 3QXEB 2QA4Q 2F1LA 3HFOA 4KUIA 4P71A 2JMAA 4AG1C 2EGCA 3OSSC 2VXFA 4OMNA 1OX9A 4C0FA 5LJ5h 2EYXA 2DU5A 4M78B 3MEAA 3CMQA 3CCST 3ULRB 3H0IA 4E7LA 3PFSA 4LDUA 4XAXB 1M2VB 4YROA 2M51A 2IG0A 4P74C 1VIFA 2ZPHB 2EJ9A 4XU1A 4UP8A 2PUKB 1NZ9A 1AHJB 4WTOB 4MMLA 4AFZC 1PSEA 2HQEA 2PTKA 3HTZA 3GP8A 3QZ9B 2V8IA 4P75A 1VIEA 2O31A 1M1KR 4IUQA 3TEHB 1KOGA 4HKEA 4AFUC 3CQTA 4DBHA 1H641 5LJ3h 4FT2A 3OYBA 4X9CA 4QT7A 1N8RR 2KBTA 5DLOA 4RUGA 1PWTA 3REXA 2G6FX 4X34A 4R55A 2NUTB 1G5IA 2LQKA 4KH0B 1PD1A 3VV0A 1VQ5Q 2CJAA 1C0AA 2LQWA 1X56A 1NBEB 2VASA 3EAEA 4C5EA 2GQIA 2DAQA 1K76A 3I56T 2LT1A 3MEWA 4J9GA 3M4GA 1IXDA 3PCOA 2L3RA 1UUEA 1KSWA 2AKWB 5HGQA 1QCNA 2CP2A 1SERA 1AEYA 3JCMJ 1OV3A 1ZHIA 1ZA2B 1VQMA 3OW2P 3RKXA 3QJYA 1GFDA 4BWAA 4X1VA 3EGXA 3NTIA 2QAZA 2YUPA 3INZA 3RDVA 4M78C 1WHLA 2A37A 1KC8U 3CMAQ 1EOVA 4P3OA 4K86A 1RLQC 1YBYA 2M16A 3CC2T 3GIBA 1AZGB 4P5NA 1NM7A 4AT1B 1OQKA 3FB9A 3CBMA 3H0FA 1R0BG 3OW2S 1QKWA 1S72A 2FPDA 2GNCA 2M0OA 3C0CA 1K4US 3RF1A 1G5HA 1WX6A 1WGSA 1V76A 2JNGA 2PVDB 3NHNA 8AT1B 4OMFB 5GMKi 1RAGB 1M27C 3CCLT 2M02A 2CKKA 3A8GB 3TVTA 4C0DB 1LVKA 1QVGP 4LE9A 4JJCA 5KH6A 2JZ2A 1I81A 2KK4A 4YRTA 1TG0A 2RO0A 4B6MA 3L2WA 1Q86R 4M7DA 4FYWB 2YWWA 2E4HA 2RD1A 3CCMA 4M75G 1VYUA 4RTXA 3A7AA 4PK4A 3T9NA 3C4SA 1YIJQ 4PJNA 1M90C 1VQ8T 4P74A 1YJ9Q 1QVGS 4K87A 2FPEA 1BIBA 3JAME 1FWZA 1WHKA 5A2QE 4HXJA 1EFWA 3VUBA 2J6KA 4M4ZA 1MV3A 2L2PA 2M0YA 4DBQA 5FWCA 4YCVA 2AHJB 1BCMA 4PKCC 2Q7HA 1RAHB 2LX9A 5KCHA 4H2SA 4M77E 4YRRA 3META 1U1SA 1D1BA 2QHVA 2DL8A 2JVVA 1PYSA 4A63B 1OU9A 1QCFA 3H41A 3KFVA 4QVCA 2EGEA 2OAUA 4J83A 3JCMb 3OS2A 4Z88A 3U23A 1BBUA 2E3HA 1MUZA 3V8JA 4WCIA 2CH4W 3I5SA 2MYSA 4P73A 3EG9B 2VKNA 5CO7A 1VQNT 4PJJA 1RIQA 3AT1B 4PNOA 4J7IA 4C0DC 2DDZA 2B8AA 4DOWA 1PKSA 1X6BA 5KYUA 2RI5A 4YRCA 3HHTB 2K3YA 3CMET 1K73R 12ASA 3MCAB 3REUA 1VQLA 2K5FA 2VYTA 4ZGJB 4M77D 2AIRB 2ZPEB 3PNWC 3SFMA 3S3MA 1WQ7A 2AZSA 3E9HA 2GFAA 1BI1A 2DTIA 2P0KA 1K0XA 1IGQA 1QQJA 5GAN2 1VQKT 3RKWA 1M1KU 1UECA 1PD0A 3GNGA 3P8BB 3ZFJA 4E7IA 2HKNA 1W1FA 1VQ9T 1QVFA 5A0GA 2EJFA 1N8RU 1YNZA 3CXCP 1FYNA 2QGFB 4YCWA 5FU6B 4N4IA 2F2XA 3L2UA 1K9MR 2CSQA 2XDBA 5D6XA 2OTJT 4EDUA 3SB2A 2GTOA 3HL8A 2YLCA 3M53A 3LWHA 3FJ5A 1SRMA 3MO8A 1E22A 1VQ5A 4JS5A
chains in the Genus database with same CATH topology
3WXMB 3ASKA 3JCMc 2HBPA 2JTMA 3OYNA 1M1KC 1M9SA 2RA2A 3HRTA 3QNEA 5CKHA 1Q82U 1N8RC 3I55T 4MZMA 1G3TA 2A7YA 2QXFA 5GMKe 3JRZA 4M75B 4QQDA 3HXYA 2R5AA 3NELA 5CIUA 1HK9A 3FIFA 3CMAA 2E1HA 5FRMA 4Y28E 1YITT 1KG1A 1G3SA 1BI2A 4M78F 4OB0B 1X75C 1NJ8A 4XU0A 1EQRA 2RM4A 4P3NA 3MF1A 5LJ3e 3RUXA 4YREA 2RI3A 2XTIA 5KE2A 5FU6C 2FB7A 3JB9H 4OF1A 2XDDA 3QYGB 2QQRA 4DA4A 2C8MA 1B7YB 4NL2A 2ARUA 2MF2A 3HXZA 5GAOm 4E7KA 2L89A 5M9OA 2ZNIA 2RHQA 3QSUA 3E19A 2EYQA 2QDYB 2EQMA 2XGTA 1YJ9A 4HCBA 4R56A 4H2TA 1UEBA 3HRKA 3QIIA 3QJ6A 3VBBA 2DO3A 1Q86C 2WSFE 2E41A 3CCJT 2RHXA 4M75C 1KQ1A 4E51A 1H4VB 3M9QA 2ZINA 5D6YA 4Z02A 4C0ZA 2ZZDA 1TH7A 1KD1U 4M78G 3EFRA 4F7UB 3WQZA 1MGQA 3LC0A 1YJNT 3CC7T 4C92B 2GFUA 5J26A 4H2UA 2Q5IA 2ODRC 5GMKm 3CCUT 3HFVA 1W66A 1NPPA 2KVQG 4M7DE 1UGSB 2IY5B 4JRKA 2O01E 4RQEA 2FVUA 4TVWA 2Y4XA 3CD6T 1RI0A 1H4QA 4YRGA 2R57A 5K1PA 4TQFA 1Y96A 4RDXA 3PGGA 1KHIA 1K9MU 3KFUA 2RJEA 5GAMd 3C94A 2DXTA 4OB3B 1JB0E 2P5IA 3FC3A 3G71T 4YDQA 4WF2A 2O4XB 1ASYA 3V7SA 4M7DD 3A5ZA 2MWPA 2CIMA 3LW5E 1DJ7B 3P8DA 3E9GA 1XQHA 3CPFA 4PJOG 3S6WA 2K5IA 2PUOB 2V8JA 1QP2A 3LSSA 2E12A 4WJ3M 4ZN3A 5GAN6 1K9MC 2ARTA 4CI0C 3OYKA 2C7IA 3J80E 4J6XA 1VQ4A 3OYIA 3RERA 2FHDA 3A8MB 4C92C 3OYDA 1KMMA 4YPFA 1YGBA 4X9DA 4CH4A 2ZT5A 4WJ4A 5CQXA 2QA4T 3X28B 2RH2A 4TVAB 3CCQT 2VV5A 4MZTA 3QPHA 4M75A 1OI1A 4H2VA 4A4HA 4XEOA 2KQWA 4BDYA 1W2BA 1B70A 1LNXA 2LRQA 3VYGA 1YI2A 3SDZA 1YHQT 2MMPA 3G6ET 2X4WA 3BW1A 3IKMB 2CJ9A 4H2WA 2RI2A 5EG2A 2G4CA 2LNVA 2ZZEA 3NEMA 4M78D 3OYAA 2Q7EA 2PMFA 3OMCA 5GAMf 4V2SA 11ASA 1YJWA 2CGHA 3DLLA 1B34A 3JCMQ 4KQEA 3KUFA 2RHSA 2CZ6B 5GANj 5FU7B 2K4YA 5C0MA 3JCMV 2XIDA 4DQ2A 1N9WA 1BI0A 3TU4K 1YB3A 3SWNB 1Y07A 3PMIA 3RACA 3OQ5A 4KULA 4A4FA 3J81E 2KY9A 3MEVA 3CCVA 3HXWA 4YRFA 5C52B 4UP9A 3QYHB 4ELYC 4MZPA 3E9FA 5I2SA 4J15A 4VUBA 4NCXA 1GGMA 1WU7A 3A8HB 5ELOA 4M75F 4JRQA 4C8QG 3CCEA 3L2ZA 4HWPA 1X6OA 5GAMg 4YP0A 1SRYA 1EVLA 4GLKA 2QHUA 2XKOC 4ZGDB 2ZR3A 2L5QA 2EQJA 2BUDA 4PJOB 4C5IA 4XEMA 2HD0A 2DD5A 4FSXA 2RJFA 3CEYA 1Y7XA 3M4PA 3UGQA 5CAIA 3NETA 3FEOA 3FLGA 5CCAA 5FU7C 4TWAA 2RK2A 4ZTUB 2YHTA 4JS4A 1YIJT 1M90U 4OLFA 1I5LA 3M5AA 3SWNC 4CH3A 3BY7A 5IT9E 2ZGWA 4BDZA 1XNIA 3F70A 4PLIA 1UGQB 1YCYA 1VQPA 5FROA 5KNNA 3OYFA 4HWSA 4BI3A 3S3NA 2E70A 3GNFB 3N5BB 2MWOA 2ZT6A 2KAFA 4ZTJA 5HY6A 2LDMA 3OS1A 2E5AA 2M9UA 2JN0A 3OA6A 3NTHA 5D6WA 4BI8B 2A8EA 1QW1A 2EAYA 5CR2A 1G5VA 4L59A 4LVJA 3MP8A 2CZ1B 5GMKl 1VQOT 2ZCFB 4F7UF 5GAN4 4PJOC 4HT8A 3A7RA 2DK3A 1N27A 2K5LA 5GAMh 3MP1A 4HCCA 1YFSA 2X4XA 3QDRB 3OYEA 4OGCA 1Q7YC 1Z7MA 3M56A 4BUGA 2VC8A 3BDLA 2JOYA 2ZT8A 4HT4A 3PMTA 3CC4A 3L2QA 2J3MA 2ZZFA 2QEXT 1ASZA 4DPGA 3C95A 1NJ5A 2CJBA 3L4GB 4O2DA 2P0PA 1WYDA 4RCBA 3WVEB 4II1A 2ZPIB 3E9IA 2DPPB 1OZ3A 2ALYA 3VU3C 4LD6A 4C8QB 4ZTFA 1O9SA 4Q6GA 1EVKA 3AHUA 1EIYB 1VQ6T 2BKDN 4LDWA 2AMCB 4YRIA 3P8TA 4M78A 4N0AC 4ATOA 5LL6S 3CCRT 3LLRA 4OVAA 3EFSA 3JCMe 4YRQA 4JDSA 2P4TA 3CPWA 4YRLA 4MDXA 4ZIBA 4EPCA 3IKLA 2RB6A 4M77B 5HK3A 4M75E 1G3YA 2KDSA 3VKIA 4F7UG 4X5OA 4IKFA 2DIQA 5GAN5 3QG1A 4A4KA 4XK8E 4C92G 3TEHA 3UFGA 1I8FA 2HQXA 2H3JA 3JCMP 4ELZC 3OBYA 3V8KA 1VQ7T 4PLLA 3CXCS 1NE8A 2NS6A 3H6ZA 4LD9K 5FRNA 3HY1A 3OS0A 3CCSA 1LOJA 5LJ5e 5CQYA 1I4K1 1UGRB 1BYMA 2EFIA 3G4ST 2OTLT 2WSCE 2KSSA 4C0GA 2AKWA 3H8ZA 2VGMA 4M75D 4NS5A 2EQUA 3HFZB 4PJOA 4J6YA 4LVIA 4C8QC 1JJ2A 1V29B 4E47A 2I2LA 2ZPGB 4OP0A 1G51A 1NPRA 3OSVA 4J7FA 4J5YA 1H4SA 3MQZA 2WACA 4YCUA 2DD4A 2ZIMA 4TVRA 2DZCA 4B9XA 2ODRD 3L2VA 4M77C 4IUUA 3QO7A 1B76A 1Q86U 4RKUE 4M7AG 3I56A 2NLUA 4EMKB 5GAOp 1X54A 2ZCEA 4XTUA 2QQAA 4OB1B 3GF5A 1NYQA 4CS3A 1HTTA 3OYJA 1NJIU 3CBOA 1USYC 4ZTZB 1J5WA 1ZBXA 2A3LA 3M59A 4JRPA 2JUFA 1FXXA 5A0DA 4YRJA 4OB2B 3CC2A 5CKBA 5IAYA 2D6FA 2DTOA 3MP6A 4HT9A 2ZPBB 3JCMW 1VQMT 2D0QB 2Q7GA 5CKFA 5GAN8 2ZZGA 4PJOF 1BI3A 3CCLA 2ZNJA 2DXCA 4CS4A 1M1FA 1YFTA 5GMKj 3NTKA 1NJIC 3OYHA 3VJPA 2Q5HA 1SSFA 2YLBA 5L8RE 4H2XB 3QKJA 2RHZA 1LYLA 1N9SA 2L8DA 5C53B 1S72T 3RL6A 1W4SA 2DVEA 4BD3A 1K73U 2E6ZA 3A7UA 3HFNA 1VQ8A 3Q1JA 4EMKC 4IUTA 3X20B 4MMKA 5LJ3j 1EIYA 2AMCA 4P71C 3CCMT 1BKBA 3X25B 1JJCB 4FU6A 4B9WA 1H4TA 3FRNA 2LT4A 2I4NA 1K73C 1K8AC 4GY5A 4HA8A 2GCXA 2PVGB 1LJOA 1VQZA 3OMGA 3VUZA 2PU9B 2QQBA 3GLXA 1VQNA 5J39A 4K88A 4OGEA 4LNSA 2DU7A 5GANd 1WJQA 4XU2A 3GPLA 1FYFA 4CRIA 3TREA 3CMEA 3S3OA 2RJDA 4M7AB 4UPAA 4M7DB 4ME7A 3LH0A 3HSBA 1UGPB 2RHUA 3CC4T 4TTVA 1OYXA 3LGLA 3SD4A 5GAN7 4A4GA 4FL6A 1VQKA 3OS5A 1X2GA 4M78E 2DXUA 1QF6A 5LJ3g 1NYRA 5A0LA 1VQ9A 3RKYA 1KQSS 3OYCA 5C6SA 1GXIE 4BACA 1NJ6A 4MDWA 3JB9F 4BB7A 1VQLT 1KHCA 4C8QF 4XQ3A 1E1TA 2LQ8A 2OTJA 2HNIA 4ZGEB 3UGTA 2I4MA 2DKGA 1YFRA 3JCMX 4E7HA 3PIPA 3MHXA 3IG2A 3MEUA 3MEYA 4RG8A 4QVDA 3RMSA 3I55A 1P92A 4M77F 4BY6B 3A74A 1B7YA 3OYLA 1VQ5T 1X55A 5HKCA 4RG2A 3VYHB 3RESA 2XDPA 3TEEA 2PQWA 4M7AC 4M7DC 4PJOE 1YITA 4NOYA 5GMKh 2Y90A 3M4QA 5IN1A 3QHSA 4FM4B 2RK1A 5GANf 2MI6A 3HRUA 1W2BS 2DZ9A 2CZ7B 3V8LA 4PG3A 4Y91A 2DQ3A 1ADJA 4QQGA 3G1ZA 1FX7A 4CH5A 1D3BB 4QVZA 3JB9G 4BI4A 4HWRA 2CYZB 3CMAT 4IUPA 3P8VA 4HVCA 4C5HA 3OW2A 2I4OA 4D6WA 5CKDA 1WJSA 3O8VA 4F7UA 4O5VA 4XTVA 1Q81U 4H2XA 4JLIA 4PJOD 4C92A 4O6JA 4YTLA 4YRSA 4P73C 2RJCA 4Q15A 2IY5A 4M77G 4IURA 4BY6C 3UWNA 3CCJA 5GAOl 2ZPFB 2EIFA 1ADYA 5GANg 3DB4A 3DB3A 2X35A 1QVGA 4FT4A 3M4YA 2F5TX 4JJNK 4P72C 3OYMA 1JJCA 2DJZA 1YJ9T 1Q81C 2G3RA 3QUIA 4G84A 4XTWA 2VXEA 3HPWA 4JLGA 3VQWA 1H3ZA 1YJNA 1ATIA 3CC7A 1Q7YU 4LVKA 2O4XA 2E65A 5KE3A 3CCUA 3OB9A 2GF7A 3OD1A 3HRSA 1R8OB 1XTDA 4L5GA 2I4LA 3A32A 4LDXA 1G3WA 4XTYA 1SETA 3I7FA 4CH6A 2K57A 4QW2A 3WVDB 3CD6A 3HRIA 4Q5WA 1VUBA 4L6V5 3V7RA 1KC8C 5ELNA 4M7AA 3RGLA 2RHQB 3QO5A 4WI1A 4C8QE 2V8KA 3LYIA 4YRMA 4C92F 1N6AA 5I2MA 3VQXA 4HWTA 3LGFA 3G71A 4TVAA 4RCCA 2LCLA 2XICA 3RIRA 3KXTA 3A31A 2DQ0A 2K2VA 1ZQ1A 1Y71A 4JRIA 2XU8A 3DLMA 4DOVA 4J8OA 5I21A 5GANh 2XK0A 3C12A 1E1OA 4PL6A 3GOXA 3JB9D 1X2HA 4C8QD 3ICAA 4A53A 3MF2A 3LX7A 1PSFA 5HK0A 1KQ2A 2QQSA 3CXCA 1HC7A 4H02A 2QA4A 4QQ6A 2ZR2A 2C06A 3CCQA 3UDCA 1BIAA 2QI2A 3A8LB 3OY9A 1QVPA 3QTCA 1Y96B 3BJUA 1MHNA 4P72A 1QP3A 3SWNA 1VQ4T 5FLXE 4UC4A 4N4GA 4M7AF 3UPUA 4M7DF 1YHQA 3JCMd 4RMFA 1IL2A 3G6EA 3J7AF 4TVYA 3FJPA 3VQVA 5GAOr 3ER0A 3QO3A 2VGNA 2J3LA 1XOVA 1NNHA 4LDYA 4YRKA 1D3BA 3A5ZB 2JTFA 2RHYA 4A4EA 4KUDK 4AH6A 2XG8D 1YI2T 3JB9J 4YRNA 3LSQA 2P0LA 3RMQA 3M54A 4BW9A 2F69A 4EO4A 4KBMB 5CVIA 1O75A 5LJ5d 3CPWS 1YJWT 3JSCA 2F5KA 1QVFS 2ZXFA 3PT9A 3P8YA 5DLQE 3PIOA 4N4HA 1RL2A 3HXXA 3QZ5B 3HKSA 2VUBA 4HCZA 2E3CA 2M1HA 1WLEA 4YYEA 2YRVA 5DY9A 1B70B 2E10A 4H2YA 2QQ9A 4XU3A 3R07A 3BDUA 1EIFA 1E24A 4M7DG 3TUPA 3CCVT 3ZBDA 1Q82C 2CZ0B 3HP9A 5LJ3d 3QO8A 4E7JA 2XD0A 2K3XA 5J3BA 5DM7R 4UP7A 2EWNA 2EL9A 3A5YA 4F7UE 3UH0A 4N0AA 2EJGA 1Z7NA 2LTOA 4C92E 1IZ6A 3CCET 3JCMf 2HAXA 3L2RA 1B34B 4NL3A 4RQFA 4A54A 2RHSB 4KT0E 4LVMA 2EKOA 2D9TA 1JJ2S 1BBWA 5KCOA 4KR3A 3IALA 2QTXA 2FL7A 1YIJA 4C5GA 2KMTA 2GQVA 1QE0A 1UB4A 4BE1A 3L1AA 2LCCA 4IUVA 5LJ5j 3LWIA 3OYYA 2E6NA 3M55A 2ARSA 3ERRA 4PHCA 3A8OB 1NJ1A 3URGA 3QBYA 5AYFA 4C92D 4EMGA 5CKEA 2IVWA 3UT1A 5GAOq 5LJ5f 2ZT7A 1K8AU 2QHTA 2PMEA 3JCMg 3M58A 2E64A 3L4GA 2MAMA 1N9RA 3PCOB 1M8VA 2EQKA 3HXVA 3CBPA 3KBGA 3HY0A 1B8AA 1VQPT 4FIBA 4L87A 4C8QA 2X4YA 1VQOA 5CK9A 3PZCA 3VQYA 4BE0A 3DSQA 3BFMA 5E3IA 3W3SA 2WSEE 2E5QA 2LVMA 4RMOA 4M7AE 2RHIA 1X01A 4CS2A 3NFCA 2ZIOA 4P3PA 4LDVA 5GAMe 2Y4YA 3M57A 5LJ3f 1M5Q1 3ME9A 4LVLA 3G7ZA 2R5MA 1OZ2A 1KD1C 4XTXA 4M77A 3JB9I 1HXDA 1KQSA 1KMNA 2QEXA 4JUVA 2CS7A 3FDRA 5LJ5g 3ZEHA 2P0QA 4G85A 3X26B 4P75C 3TEGA 1IREB 1U1TA 2DTHA 1WJRA 2ZTGA 4EMHA 5GANe 3TCJA 2XHCA 3X24B 1VQ6A 4ZN1A 4M7AD 1USYA 4BE2A 4HWOA 3CCRA 2XI9A 4EX5A 4XTZA 2BIVA 2X4JA 5K1XA 2DIGA 2DEQA 2R58A 3P8HA 3V7CA 1M4ZA 3HFZA 1JBMA 1L0WA 3PTAA 1WPYA 3JCMh 1SESA 2FYKA 2PVOB 5GAOn 1M1GA 3E1SA 4TQDA 1NJ2A 3OBWA 1JRIA 3L42A 1PYSB 3HXUA 1WQWA 2QHSA 1VQ7A 2DXBA 4YRPA 3OYGA 5GAN3 1U8RA 5GAMj 4EMKA 5C51B 1WNLA 3NENA 3G4SA 2OTLA 2LC4A 4J6WA 5F5WA 3R6OA 2ALYB 4KR2A 3DKMA 3QXEB 3HFOA 4KUIA 4P71A 3OSSC 2VXFA 4C0FA 5LJ5h 2DU5A 4M78B 3MEAA 3CMQA 3CCST 4E7LA 3PFSA 4LDUA 4XAXB 4YROA 2IG0A 4P74C 1VIFA 2ZPHB 2EJ9A 4XU1A 4UP8A 2PUKB 1NZ9A 1AHJB 4MMLA 1PSEA 2HQEA 3HTZA 3GP8A 3QZ9B 2V8IA 4P75A 1VIEA 4IUQA 3TEHB 1KOGA 4HKEA 1H641 5LJ3h 4FT2A 3OYBA 4X9CA 5DLOA 3REXA 4X34A 4R55A 1G5IA 2LQKA 3VV0A 2CJAA 1C0AA 1X56A 3EAEA 4C5EA 2DAQA 3I56T 2LT1A 3MEWA 3M4GA 3PCOA 2L3RA 2AKWB 5HGQA 1SERA 3JCMJ 1ZHIA 1VQMA 3RKXA 3QJYA 4BWAA 3NTIA 3INZA 4M78C 1KC8U 1EOVA 4P3OA 4K86A 1YBYA 2M16A 3CC2T 3GIBA 4P5NA 3FB9A 3CBMA 3OW2S 1S72A 3RF1A 2M0OA 1G5HA 1WGSA 2JNGA 2PVDB 4OMFB 5GMKi 3CCLT 2CKKA 3A8GB 4C0DB 5KH6A 2JZ2A 1I81A 2KK4A 4YRTA 2RO0A 3L2WA 4M7DA 2RD1A 3CCMA 4M75G 3A7AA 3T9NA 3C4SA 1M90C 1VQ8T 4P74A 1QVGS 4K87A 1BIBA 3JAME 1FWZA 5A2QE 1EFWA 3VUBA 4YCVA 2AHJB 4PKCC 2Q7HA 2LX9A 5KCHA 4H2SA 4M77E 4YRRA 3META 1U1SA 2QHVA 2JVVA 1PYSA 4QVCA 2OAUA 4J83A 3JCMb 3OS2A 1BBUA 3V8JA 4P73A 5CO7A 1VQNT 1RIQA 4PNOA 4J7IA 4C0DC 2DDZA 2B8AA 4DOWA 2RI5A 4YRCA 3HHTB 2K3YA 3CMET 12ASA 3MCAB 3REUA 1VQLA 2K5FA 2VYTA 4ZGJB 4M77D 3SFMA 2ZPEB 3PNWC 3S3MA 1WQ7A 3E9HA 2GFAA 1BI1A 2DTIA 2P0KA 5GAN2 1VQKT 3RKWA 1M1KU 3GNGA 3P8BB 3ZFJA 4E7IA 1VQ9T 1QVFA 5A0GA 2EJFA 1N8RU 4YCWA 5FU6B 4N4IA 3L2UA 2XDBA 5D6XA 2OTJT 4EDUA 3SB2A 3HL8A 2YLCA 3M53A 3LWHA 3MO8A 1E22A 1VQ5A 4JS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E64 A;  3L4G A;  1N9R A;  4QVD A;  4M77 F;  3JCM c;  3PCO B;  1M8V A;  2ZT6 A;  3HXV A;  3HY0 A;  1B8A A;  2RA2 A;  3A74 A;  4L87 A;  4C8Q A;  1B7Y A;  3QNE A;  3PZC A;  2E5A A;  3VQY A;  1X55 A;  3DSQ A;  3BFM A;  5E3I A;  3W3S A;  2JN0 A;  3RES A;  4M7A E;  2EAY A;  4M7A C;  5GMK e;  1X01 A;  4M7D C;  4CS2 A;  4PJO E;  2ZIO A;  5GMK l;  4P3P A;  4NOY A;  5GMK h;  2Y90 A;  4F7U F;  5GAM e;  4PJO C;  5GAN 4;  4M75 B;  4HT8 A;  3A7R A;  3M4Q A;  5GAM h;  5LJ3 f;  1YFS A;  3HXY A;  3NEL A;  3QHS A;  1M5Q 1;  1HK9 A;  3FIF A;  2E1H A;  4XTX A;  5GAN f;  1Z7M A;  1E22 A;  4M77 A;  3JB9 I;  1HXD A;  2DZ9 A;  1KMN A;  3V8L A;  4PG3 A;  4Y91 A;  2DQ3 A;  1ADJ A;  4JUV A;  4M78 F;  2VC8 A;  3G1Z A;  5LJ5 g;  4CH5 A;  1D3B B;  1NJ8 A;  2ZT8 A;  3JB9 G;  4HWR A;  4XU0 A;  1EQR A;  4G85 A;  4P75 C;  3TEG A;  2RM4 A;  4P3N A;  3MF1 A;  1U1T A;  5LJ3 e;  3P8V A;  4HVC A;  2DTH A;  3RUX A;  2I4O A;  4YRE A;  2ZTG A;  2J3M A;  2ZZF A;  1ASZ A;  4EMH A;  5GAN e;  2XTI A;  4DPG A;  2FB7 A;  1NJ5 A;  2CJB A;  3L4G B;  3JB9 H;  4M7A D;  4F7U A;  1USY A;  4O2D A;  4XTV A;  1WYD A;  4RCB A;  4H2X A;  4JLI A;  3E9I A;  4PJO D;  4C92 A;  4HWO A;  2ALY A;  3VU3 C;  2C8M A;  4C8Q B;  1B7Y B;  4NL2 A;  4XTZ A;  2ARU A;  4EX5 A;  4P73 C;  4Q6G A;  4YRS A;  1EVK A;  3AHU A;  5GAO m;  3HXZ A;  1EIY B;  5K1X A;  2AMC B;  4YRI A;  2DEQ A;  4Q15 A;  2IY5 A;  3P8T A;  4M77 G;  4M78 A;  2ZNI A;  4N0A C;  2RHQ A;  3QSU A;  3V7C A;  5GAO l;  3HFZ A;  1JBM A;  1ADY A;  2XGT A;  5GAN g;  3EFS A;  3JCM e;  4YRQ A;  1L0W A;  4H2T A;  1WPY A;  3HRK A;  3JCM h;  4YRL A;  1SES A;  2FYK A;  5GAO n;  4ZIB A;  3VBB A;  2E41 A;  4P72 C;  4TQD A;  1JJC A;  3IKL A;  2RB6 A;  4M77 B;  2DJZ A;  1NJ2 A;  4M75 E;  1JRI A;  1PYS B;  4F7U G;  3QUI A;  3HXU A;  4M75 C;  4X5O A;  4G84 A;  1KQ1 A;  1WQW A;  4E51 A;  4XTW A;  5GAN 5;  2QHS A;  2VXE A;  1H4V B;  2ZIN A;  4C92 G;  3TEH A;  3UFG A;  3VQW A;  4YRP A;  1ATI A;  1I8F A;  3JCM P;  5GAN 3;  1TH7 A;  2E65 A;  5GAM j;  4M78 G;  3EFR A;  4EMK A;  3V8K A;  3OD1 A;  4F7U B;  5C51 B;  3WQZ A;  1WNL A;  3NEN A;  1MGQ A;  3LC0 A;  2I4L A;  3A32 A;  3HY1 A;  4J6W A;  5F5W A;  4XTY A;  1SET A;  4C92 B;  3I7F A;  4CH6 A;  2K57 A;  2ALY B;  4KR2 A;  4H2U A;  3HRI A;  2Q5I A;  2ODR C;  1LOJ A;  5GMK m;  3HFV A;  3HFO A;  4P71 A;  1W66 A;  5LJ5 e;  1I4K 1;  2VXF A;  4M7D E;  2IY5 B;  3V7R A;  4JRK A;  5LJ5 h;  5ELN A;  4M7A A;  3RGL A;  4M78 B;  2DU5 A;  3CMQ A;  4RQE A;  2RHQ B;  3QO5 A;  2AKW A;  4WI1 A;  4M75 D;  4TVW A;  4C8Q E;  3HFZ B;  4PJO A;  4J6Y A;  4C8Q C;  4YRM A;  1H4Q A;  4YRG A;  4C92 F;  2I2L A;  4OP0 A;  1G51 A;  4YRO A;  5K1P A;  4TQF A;  3VQX A;  4P74 C;  4HWT A;  1Y96 A;  4J5Y A;  2EJ9 A;  4XU1 A;  4UP8 A;  4RDX A;  4TVA A;  3PGG A;  4RCC A;  1H4S A;  4MML A;  3RIR A;  3A31 A;  3KFU A;  5GAM d;  3HTZ A;  2DXT A;  2DQ0 A;  4YCU A;  4P75 A;  4JRI A;  2P5I A;  2ZIM A;  3TEH B;  1KOG A;  4YDQ A;  2DZC A;  2ODR D;  1H64 1;  5LJ3 h;  4WF2 A;  4M77 C;  4X9C A;  3QO7 A;  1B76 A;  5I21 A;  1ASY A;  3V7S A;  5GAN h;  3REX A;  4M7A G;  4M7D D;  4EMK B;  1E1O A;  5GAO p;  2CIM A;  3A5Z A;  1X54 A;  1G5I A;  3JB9 D;  2ZCE A;  4XTU A;  1X2H A;  2CJA A;  4PJO G;  1C0A A;  1X56 A;  4C8Q D;  3ICA A;  4A53 A;  3LSS A;  1NYQ A;  3MF2 A;  4CS3 A;  4WJ3 M;  1KQ2 A;  1HTT A;  5GAN 6;  3M4G A;  2ART A;  3PCO A;  1HC7 A;  1USY C;  2C7I A;  4H02 A;  4ZTZ B;  4J6X A;  1J5W A;  2ZR2 A;  2AKW B;  3RER A;  5HGQ A;  4C92 C;  1SER A;  1KMM A;  4YPF A;  3JCM J;  1BIA A;  1YGB A;  4YRJ A;  3RKX A;  4X9D A;  4CH4 A;  4BWA A;  3QTC A;  2ZT5 A;  4WJ4 A;  1Y96 B;  3BJU A;  3INZ A;  3SWN A;  4M78 C;  4P72 A;  4TVA B;  2DTO A;  4HT9 A;  3JCM W;  4M75 A;  4M7A F;  1EOV A;  4P3O A;  4M7D F;  4K86 A;  4H2V A;  2Q7G A;  3JCM d;  4RMF A;  4XEO A;  3GIB A;  5GAN 8;  2ZZG A;  1IL2 A;  4PJO F;  3FB9 A;  4TVY A;  3FJP A;  2ZNJ A;  3VQV A;  4CS4 A;  5GAO r;  1YFT A;  5GMK j;  3QO3 A;  1B70 A;  1LNX A;  3RF1 A;  2J3L A;  1G5H A;  1NNH A;  4YRK A;  2Q5H A;  1D3B A;  3BW1 A;  2YLB A;  5GMK i;  4H2X B;  3IKM B;  2CJ9 A;  1LYL A;  4H2W A;  1N9S A;  5C53 B;  3RL6 A;  2DVE A;  2G4C A;  4AH6 A;  1I81 A;  4YRT A;  3A7U A;  3JB9 J;  2ZZE A;  3HFN A;  3NEM A;  4YRN A;  3LSQ A;  2P0L A;  4M78 D;  4EMK C;  2Q7E A;  4M7D A;  2PMF A;  11AS A;  2RD1 A;  5GAM f;  4V2S A;  4MMK A;  5LJ3 j;  4M75 G;  2CGH A;  1B34 A;  3JCM Q;  3A7A A;  4KQE A;  2RHS A;  4BW9 A;  5GAN j;  4EO4 A;  1EIY A;  3JCM V;  4DQ2 A;  1N9W A;  2AMC A;  4P71 C;  4P74 A;  5LJ5 d;  1YB3 A;  3SWN B;  1JJC B;  4K87 A;  1BIB A;  3RAC A;  2ZXF A;  1H4T A;  3P8Y A;  1EFW A;  3HXX A;  2I4N A;  4YCV A;  4YRF A;  3HXW A;  2E3C A;  5C52 B;  4UP9 A;  1WLE A;  2Q7H A;  4YYE A;  4H2S A;  4M77 E;  4YRR A;  5DY9 A;  1U1S A;  4HA8 A;  1B70 B;  2E10 A;  4H2Y A;  1LJO A;  1VQZ A;  2QHV A;  4XU3 A;  3R07 A;  1PYS A;  3BDU A;  4J15 A;  1E24 A;  4M7D G;  4NCX A;  1GGM A;  1WU7 A;  3TUP A;  4QVC A;  3JCM b;  5ELO A;  4M75 F;  1BBU A;  4K88 A;  5LJ3 d;  4C8Q G;  3V8J A;  3L2Z A;  3QO8 A;  4LNS A;  4HWP A;  2DU7 A;  4P73 A;  4UP7 A;  2EWN A;  5GAM g;  4YP0 A;  5GAN d;  4XU2 A;  2EL9 A;  1FYF A;  3A5Y A;  4F7U E;  1SRY A;  3UH0 A;  1EVL A;  2QHU A;  1RIQ A;  4N0A A;  2ZR3 A;  2EJG A;  4M7A B;  1Z7N A;  4UPA A;  4M7D B;  4PNO A;  4C92 E;  2DDZ A;  3JCM f;  3HSB A;  4PJO B;  1B34 B;  4NL3 A;  4TTV A;  4RQF A;  4A54 A;  2RHS B;  5GAN 7;  4XEM A;  4YRC A;  1BBW A;  12AS A;  1X2G A;  3REU A;  4M78 E;  2DXU A;  4KR3 A;  3IAL A;  1QF6 A;  2QTX A;  4M77 D;  5LJ3 g;  1NYR A;  3M4P A;  3UGQ A;  1WQ7 A;  5CAI A;  3RKY A;  3E9H A;  3NET A;  2DTI A;  1QE0 A;  3L1A A;  5GAN 2;  1NJ6 A;  3RKW A;  3JB9 F;  5LJ5 j;  4TWA A;  4ZTU B;  4C8Q F;  4XQ3 A;  2YHT A;  1E1T A;  2ARS A;  3ERR A;  4OLF A;  4PHC A;  2HNI A;  1I5L A;  3SWN C;  2EJF A;  1NJ1 A;  4YCW A;  3UGT A;  4CH3 A;  3BY7 A;  2I4M A;  2DKG A;  1YFR A;  3JCM X;  2ZGW A;  4C92 D;  4EMG A;  3SB2 A;  1YCY A;  2YLC A;  5GAO q;  3IG2 A;  5LJ5 f;  2ZT7 A;  2QHT A;  2PME A;  3JCM g;  3MEY A;  5KNN A;  4HWS A; 
#chains in the Genus database with same CATH topology
 2L0A A;  3WXM B;  1X6G A;  2YRC A;  3ASK A;  2X51 A;  3JCM c;  2HBP A;  2JTM A;  1MV0 B;  3OYN A;  1M1K C;  1M9S A;  2RA2 A;  3HRT A;  3QNE A;  2FZG B;  4HVV A;  5CKH A;  1Q82 U;  2EYY A;  1H3H A;  1VQ4 Q;  2DM1 A;  1N8R C;  3I55 T;  4MZM A;  1G3T A;  1PM3 A;  1ZUY A;  2A7Y A;  2QXF A;  5GMK e;  1WYX A;  3JRZ A;  4ANJ A;  1X2K A;  2DA9 A;  2FRW A;  4M75 B;  4QQD A;  3HXY A;  2R5A A;  3NEL A;  5CIU A;  1HK9 A;  3FIF A;  3CMA A;  1U06 A;  2E1H A;  4K11 A;  5FRM A;  4Y28 E;  1YIT T;  1KG1 A;  1SPK A;  4GBQ A;  1G3S A;  1BI2 A;  4M78 F;  4OB0 B;  1X75 C;  2DBM A;  1NJ8 A;  1TXQ A;  4OMQ A;  1UHF A;  1B7T A;  4XU0 A;  1EQR A;  3IQL A;  2RM4 A;  1YI2 Q;  4P3N A;  3MF1 A;  5LJ3 e;  3EFO B;  3RUX A;  4YRE A;  2RI3 A;  7AT1 B;  2XTI A;  2FO0 A;  2JS2 A;  5KE2 A;  5FU6 C;  2FB7 A;  2BTT A;  1D1A A;  3JB9 H;  4JZ3 A;  4OF1 A;  4RTW A;  1TUC A;  2XDD A;  3QYG B;  2QQR A;  4DA4 A;  1EFN A;  3JV3 A;  4Z8A A;  3REA B;  4KGZ B;  2C8M A;  1B7Y B;  4NL2 A;  2ARU A;  2MF2 A;  3HXZ A;  5GAO m;  1WIE A;  1YJW Q;  4E7K A;  3M0Q A;  2L89 A;  2JTE A;  5M9O A;  2ZNI A;  2RHQ A;  3QSU A;  3E19 A;  2EYQ A;  2QDY B;  2EQM A;  2XGT A;  1YJ9 A;  4HCB A;  4R56 A;  2RPN A;  4H2T A;  1UEB A;  1JXO A;  3M0R A;  3HRK A;  4EIK A;  3QII A;  1FMK A;  3QJ6 A;  3VBB A;  2DO3 A;  1Q86 C;  2WSF E;  2E41 A;  2NUZ A;  3CCJ T;  2NUP B;  4LUE A;  2LJ0 A;  3CCV Q;  2RQV A;  2RHX A;  4M75 C;  1KQ1 A;  1LPL A;  2ENM A;  2J06 A;  4E51 A;  4FW2 A;  1H4V B;  3M9Q A;  2ZIN A;  5D6Y A;  4Z02 A;  2D1X A;  2E3I A;  2A0F B;  4C0Z A;  2ZZD A;  2XMF A;  1TH7 A;  1KD1 U;  3CCE Q;  1C6V X;  4M78 G;  3EFR A;  4F7U B;  3WQZ A;  1B3Q A;  1MGQ A;  3LC0 A;  4AFQ C;  1YJN T;  1M3A A;  3CC7 T;  4C92 B;  2GFU A;  5J26 A;  4H2U A;  3EG9 A;  2Q5I A;  2ODR C;  5GMK m;  3CCU T;  3HFV A;  2HKQ B;  1W66 A;  1NPP A;  2KVQ G;  1ZSZ A;  4M7D E;  1UGS B;  2IY5 B;  4JRK A;  1RAI B;  2MOX A;  2L3S A;  2O01 E;  4RQE A;  2FVU A;  2OX7 A;  4DEX A;  2MK5 A;  4TVW A;  2Y4X A;  3CD6 T;  4J9H A;  5KYW A;  1RI0 A;  1H92 A;  4JJB A;  1H4Q A;  4YRG A;  1M2O A;  2R57 A;  2I0N A;  1Z9Q A;  5K1P A;  4TQF A;  2MIO A;  2VWF A;  1Y96 A;  1E6G A;  4RDX A;  1NLP C;  1E6H A;  3PGG A;  1JQQ A;  1KHI A;  1K9M U;  1HJD A;  3KFU A;  2RJE A;  2COZ A;  5GAM d;  3C94 A;  2DXT A;  2KYM A;  4OB3 B;  1JB0 E;  2HSE B;  1AOJ A;  2P5I A;  3FC3 A;  3G71 T;  4YDQ A;  2DYI A;  2P4R A;  4WF2 A;  1SHF A;  2GBQ A;  1GFC A;  1YP5 A;  2O4X B;  1ASY A;  2DRM A;  3V7S A;  1SEM A;  4M7D D;  4J9E A;  3A5Z A;  2MWP A;  1G83 A;  1VQP Q;  2CIM A;  3LW5 E;  1DJ7 B;  1UDL A;  3P8D A;  3E9G A;  1WHH A;  1XQH A;  3CPF A;  4CC3 A;  4PJO G;  3S6W A;  2K5I A;  2PUO B;  2V8J A;  1QP2 A;  3LSS A;  2E12 A;  4WJ3 M;  5IXF A;  2QG9 B;  4ZN3 A;  4KGX B;  1Q7Y R;  1KQS P;  5GAN 6;  1K9M C;  2ART A;  4CI0 C;  2LZ6 B;  3OYK A;  2C7I A;  1T0J A;  1TOV A;  3J80 E;  4J6X A;  1VQ4 A;  3EGD B;  3OYI A;  3RER A;  2FHD A;  3A8M B;  4C92 C;  2DNU A;  2HCK A;  2EPD A;  3OYD A;  1KMM A;  4YPF A;  3EH2 A;  2EGA A;  1YGB A;  4X9D A;  4CH4 A;  1NG2 A;  1U5S A;  4OMP A;  2ZT5 A;  4WJ4 A;  5CQX A;  2QA4 T;  3X28 B;  2RH2 A;  4TVA B;  3CCQ T;  2VV5 A;  4MZT A;  4FSS A;  1CKB A;  1NEG A;  3QPH A;  2JW4 A;  4M75 A;  1OI1 A;  4F16 A;  4H2V A;  4A4H A;  4XEO A;  2KQW A;  1OPK A;  4BDY A;  1W2B A;  1B70 A;  1LNX A;  2KE9 A;  2LRQ A;  1EZZ B;  3VYG A;  1YI2 A;  3SDZ A;  1YHQ T;  2K6D A;  2MMP A;  3G6E T;  3MKD A;  3CC4 Q;  2X4W A;  3BW1 A;  2F2W A;  2YT6 A;  3IKM B;  2CJ9 A;  2HSP A;  4H2W A;  2RI2 A;  5EG2 A;  3UA6 A;  2E5K A;  2G4C A;  1PRL C;  2LNV A;  2ZZE A;  3NEM A;  1QCO A;  4OMO A;  2AKK A;  2L3P A;  2DVJ A;  4M78 D;  3OYA A;  2Q7E A;  2PMF A;  3TQ7 P;  2FG0 A;  2JXB A;  3OMC A;  5GAM f;  4V2S A;  11AS A;  1YJW A;  2CGH A;  3DLL A;  1VQL Q;  1B34 A;  3JCM Q;  4KQE A;  3KUF A;  2RHS A;  2CZ6 B;  2LNH B;  5GAN j;  5FU7 B;  2K4Y A;  5C0M A;  3JCM V;  2XID A;  4DQ2 A;  1N9W A;  1BI0 A;  3TU4 K;  1YB3 A;  3SWN B;  1Y07 A;  3PMI A;  1OEB A;  3RAC A;  3OQ5 A;  4KUL A;  1V1C A;  3I5R A;  4A4F A;  2VB6 A;  3J81 E;  2ESW A;  1T3L A;  2BZY A;  2KY9 A;  3MEV A;  3CCV A;  3HXW A;  4YRF A;  5C52 B;  4UP9 A;  3QYH B;  1K1Z A;  1GCQ C;  4ELY C;  4MZP A;  5IHN A;  3E9F A;  2NUP A;  3PE0 A;  3EG0 A;  4JPB W;  3THK A;  1AD5 A;  5I2S A;  4J15 A;  2OJ2 A;  4VUB A;  4NCX A;  1GGM A;  1WU7 A;  1I07 A;  3A8H B;  4JJD A;  1PC0 A;  5ELO A;  5KYN A;  4M75 F;  2YSQ A;  4JRQ A;  4C8Q G;  3CCE A;  3L2Z A;  4HWP A;  1X6O A;  5GAM g;  4YP0 A;  2KT1 A;  1SRY A;  1EVL A;  4GLK A;  2QHU A;  3CCS Q;  2XKO C;  4ZGD B;  2ZR3 A;  6AT1 B;  2L5Q A;  2EQJ A;  1A0N B;  3REB B;  2BUD A;  4PJO B;  4C5I A;  1PKT A;  2RQR A;  4XEM A;  3EGU A;  2HD0 A;  2DD5 A;  3RBB B;  4FSX A;  2RJF A;  3CEY A;  1Y7X A;  3M4P A;  3UGQ A;  1WXU A;  5CAI A;  3NET A;  3FEO A;  3FLG A;  2DL7 A;  5CCA A;  1TUG B;  1IB8 A;  5FU7 C;  4TWA A;  2RK2 A;  4ZTU B;  2YHT A;  4JS4 A;  1RAB B;  2BZ8 A;  4J9B A;  1YIJ T;  2YDL A;  1M90 U;  4OLF A;  1I5L A;  3M5A A;  3SWN C;  4DBF A;  2QTV A;  2KRO A;  3MPU B;  1PRM C;  4CH3 A;  3BY7 A;  5IT9 E;  1X43 A;  2ZGW A;  4BDZ A;  1ZBJ A;  1XNI A;  3F70 A;  4PLI A;  1UGQ B;  3I56 Q;  1T3S A;  1YCY A;  1VQP A;  5FRO A;  1T0H A;  2K2M A;  5KNN A;  3OYF A;  2BZX A;  4HWS A;  4BI3 A;  5IH2 A;  2DL5 A;  3S3N A;  2E70 A;  3GNF B;  3N5B B;  2MWO A;  2ZT6 A;  2KAF A;  5D7U A;  4ZTJ A;  1IRX A;  5HY6 A;  2LDM A;  4ESR A;  3OS1 A;  2E5A A;  2QDL A;  2M9U A;  2JN0 A;  3OA6 A;  4E7Z A;  3NTH A;  5D6W A;  4BI8 B;  2A8E A;  1QW1 A;  2EAY A;  5CR2 A;  1NJI R;  2AT1 B;  1G5V A;  3CC2 Q;  4L59 A;  4LVJ A;  3MP8 A;  2CZ1 B;  1QKX A;  5GMK l;  1VQO T;  2KR3 A;  2ZCF B;  4F7U F;  5GAN 4;  4PJO C;  4HT8 A;  1HD3 A;  3A7R A;  2DK3 A;  2EYZ A;  1N27 A;  2K5L A;  1WHJ A;  5GAM h;  3MP1 A;  4HCC A;  1YFS A;  2X4X A;  1NYF A;  3QDR B;  3OYE A;  2CP6 A;  4OGC A;  1Q7Y C;  1IO6 A;  2RN8 A;  1Z7M A;  1WXT A;  2KXD A;  3M56 A;  4BUG A;  3CCL Q;  4JZ4 A;  2VC8 A;  3BDL A;  2JOY A;  2ZT8 A;  2YUN A;  1MMG A;  2IIM A;  4HT4 A;  5KYX B;  2ROL A;  4CC4 B;  3PMT A;  3CC4 A;  3L2Q A;  2J3M A;  2ZZF A;  2QEX T;  1ASZ A;  4DPG A;  3C95 A;  1NJ5 A;  2CJB A;  3L4G B;  4O2D A;  2P0P A;  1WYD A;  4RCB A;  3WVE B;  4II1 A;  2ZPI B;  3NGP A;  3E9I A;  1VYV A;  2DPP B;  2FZK B;  1OZ3 A;  2ALY A;  1VQ8 Q;  3VU3 C;  4LD6 A;  3M0T A;  4C8Q B;  4ZTF A;  1O9S A;  1X69 A;  4Q6G A;  1EVK A;  3AHU A;  1EIY B;  1VQ6 T;  2RMO A;  2BKD N;  4LDW A;  1K8A R;  2AMC B;  4YRI A;  4LXC A;  3P8T A;  2QAS A;  4M78 A;  4N0A C;  4ATO A;  3PVL A;  5LL6 S;  3CCR T;  1AWX A;  3LLR A;  4OVA A;  3EFS A;  3JCM e;  4YRQ A;  4JDS A;  2K3B A;  1M2V A;  1W6X A;  2CP3 A;  2P4T A;  1I1J A;  3CPW A;  4YRL A;  4MDX A;  2IPO B;  4ZIB A;  4EPC A;  2L3Q A;  1QWE A;  2KI7 A;  3IKL A;  2RB6 A;  3EG1 A;  4M77 B;  5HK3 A;  1D0Y A;  4M75 E;  1G3Y A;  1M8M A;  2KDS A;  9ATC B;  2O9V A;  2OAW A;  3VKI A;  4F7U G;  2LJ1 A;  4X5O A;  4IKF A;  2DIQ A;  1FMW A;  5GAN 5;  2CT3 A;  3QG1 A;  4A4K A;  4XK8 E;  4C92 G;  3TEH A;  3UFG A;  1WLP B;  3I35 A;  1I8F A;  1VQN Q;  2HQX A;  2B86 A;  2H3J A;  3JCM P;  4ELZ C;  2DMO A;  3OBY A;  3V8K A;  1WXB A;  1VQ7 T;  2NUT A;  4PLL A;  3CXC S;  1NE8 A;  2NS6 A;  8ATC B;  2DRK A;  4QKU A;  3H6Z A;  4LD9 K;  5FRN A;  3HY1 A;  3G1J A;  3OS0 A;  3CPW P;  3CCS A;  1WA7 A;  4PJM A;  1LOJ A;  4IIO A;  5LJ5 e;  5CQY A;  1I4K 1;  1QVF P;  1UGR B;  1BYM A;  2EFI A;  3G4S T;  2OTL T;  2HDA A;  2KRN A;  2KSS A;  2WSC E;  1VQK Q;  4C0G A;  2AKW A;  3H8Z A;  2VGM A;  4M75 D;  4NS5 A;  1HYO A;  2EQU A;  3HFZ B;  4PJO A;  4J6Y A;  4LVI A;  1Y0M A;  1UJY A;  4C8Q C;  1JJ2 A;  1V29 B;  4E47 A;  4RTV A;  1VQ9 Q;  2I2L A;  2ZPG B;  4OP0 A;  1G51 A;  1NPR A;  3OSV A;  1QWF A;  2MCN A;  5EC7 A;  4J7F A;  4J5Y A;  1SSH A;  1OUL A;  2SEM A;  1H4S A;  3MQZ A;  2CP5 A;  1ABQ A;  2OTJ Q;  3A98 A;  2WAC A;  4YCU A;  4HCK A;  5FW9 A;  1JO8 A;  4RTU A;  2DD4 A;  2ZIM A;  4TVR A;  2DZC A;  4B9X A;  1MMN A;  2ODR D;  3PVQ A;  3L2V A;  4AG2 C;  4M77 C;  4IUU A;  1IHV A;  3QO7 A;  1B76 A;  2QK0 A;  1Q86 U;  4RKU E;  4M7A G;  3I56 A;  2NLU A;  4EMK B;  5GAO p;  2JJ9 A;  1BCO A;  2FZC B;  1X54 A;  2ZCE A;  4XTU A;  2EVR A;  2QQA A;  3O5Z A;  1JJ2 P;  2QGG A;  4OB1 B;  1AWJ A;  1RUW A;  1S1N A;  2HQH A;  3GF5 A;  1NYQ A;  4CS3 A;  1IGU A;  2GGR A;  1OX8 A;  1HTT A;  3OYJ A;  1NJI U;  3CBO A;  1USY C;  4ZTZ B;  4Y92 A;  1J5W A;  1ZBX A;  2A3L A;  2J6O A;  3M59 A;  4JRP A;  2JUF A;  1FXX A;  1M30 A;  5A0D A;  4YRJ A;  4OB2 B;  3CC2 A;  5CKB A;  4HVU A;  1YIT Q;  5IAY A;  1ACM B;  2D6F A;  2BE9 B;  4FCY A;  1IHW A;  1JEG A;  1ZUU A;  1I0C A;  2DTO A;  1WZO A;  3MP6 A;  4HT9 A;  2ZPB B;  3JCM W;  1R0C B;  1VQM T;  2D0Q B;  2Q7G A;  5CKF A;  4OML A;  5GAN 8;  2ZZG A;  4PFO A;  4PJO F;  1BI3 A;  2CSI A;  3CCL A;  2ZNJ A;  1N5Z A;  2DXC A;  4CS4 A;  1M1F A;  1YFT A;  5GMK j;  3NTK A;  1NJI C;  2CP7 A;  2KYB A;  2K9G A;  4F04 B;  2HEQ A;  3OYH A;  3VJP A;  2Q5H A;  1SSF A;  2K7A A;  2YLB A;  5L8R E;  4H2X B;  3QKJ A;  2RHZ A;  4KGV B;  5IXB A;  5KYX A;  1SRL A;  1N9S A;  1LYL A;  2YUQ A;  2L8D A;  5C53 B;  1S72 T;  3RL6 A;  1W4S A;  2DVE A;  4BD3 A;  1K73 U;  2E6Z A;  1SG5 A;  3A7U A;  1C0M A;  3HFN A;  3E2U A;  2RQW A;  1VQ8 A;  3Q1J A;  4EMK C;  5GJV B;  4IUT A;  3X20 B;  4MMK A;  5LJ3 j;  1Q81 R;  2COW A;  1CSK A;  2AKL A;  1NEB A;  2D0N A;  4ORZ A;  1EIY A;  3CCJ Q;  2AMC A;  4P71 C;  2CUB A;  2GTJ A;  1KIK A;  3EGX B;  3D7S B;  2LMJ A;  3CCM T;  1BKB A;  3X25 B;  1JJC B;  4FU6 A;  3H0H A;  4B9W A;  2BE7 D;  1H4T A;  3FRN A;  2LT4 A;  1WHM A;  1QLY A;  2J05 A;  1G2B A;  2O88 A;  2I4N A;  1K73 C;  2Z0W A;  1K8A C;  4F14 A;  1AVZ C;  4GY5 A;  4HA8 A;  1AWW A;  2GCX A;  2PVG B;  1LJO A;  1VQZ A;  3OMG A;  3VUZ A;  2PU9 B;  2QQB A;  2HL5 C;  3GLX A;  2V26 A;  2DLP A;  1KC8 R;  3CC7 Q;  1VQN A;  3CCU Q;  5J39 A;  4K88 A;  4OGE A;  1M3B A;  1PG5 B;  2EQI A;  4LNS A;  3ZL7 C;  3NMZ C;  2DU7 A;  2DL4 A;  4CC2 A;  1TSF A;  5GAN d;  1YWP A;  2ECZ A;  1WJQ A;  4XU2 A;  3GPL A;  1FYF A;  4CRI A;  3TRE A;  3CME A;  3S3O A;  1GCP A;  3MJX A;  3CD6 Q;  2RJD A;  3VS5 A;  4M7A B;  4UPA A;  4M7D B;  4Z89 A;  4ME7 A;  2LQN A;  3LH0 A;  3HSB A;  1UGP B;  2RHU A;  3CC4 T;  4TTV A;  1OYX A;  3LGL A;  3SD4 A;  5GAN 7;  1X27 A;  4A4G A;  2YXY A;  4FL6 A;  1VQK A;  3OS5 A;  1X2G A;  4M78 E;  2DXU A;  1QF6 A;  4E7S A;  1ZUK A;  5LJ3 g;  1NYR A;  5A0L A;  1VQ9 A;  3RKY A;  1D09 B;  1KQS S;  3OYC A;  2LJ3 A;  1G8X A;  4ZNX A;  5C6S A;  1GXI E;  1BBZ A;  4BAC A;  1NJ6 A;  2VVK A;  2DX1 A;  4MDW A;  3G71 Q;  3JB9 F;  2KRM A;  2RNA A;  4BB7 A;  1VQL T;  1KHC A;  2KT8 A;  4C8Q F;  4XQ3 A;  1E1T A;  2PNI A;  2LQ8 A;  3VS4 A;  2OTJ A;  2HNI A;  1J3T A;  1YN8 A;  2DF6 A;  4ZGE B;  3UGT A;  2I4M A;  2O2O A;  2DKG A;  1YFR A;  3JCM X;  4E7H A;  1YFN A;  3H9N A;  3PIP A;  1MMD A;  3EFO A;  3MHX A;  3IG2 A;  2P84 A;  3MEU A;  3MEY A;  4RG8 A;  4QVD A;  3RMS A;  3I55 A;  1P92 A;  4M77 F;  4BY6 B;  3NPF A;  4PFP A;  3A74 A;  2C0T A;  1M3C A;  1B7Y A;  3OYL A;  3VS0 A;  1VQ5 T;  4F17 A;  1GBQ A;  5KYU B;  1X55 A;  1BK2 A;  1W2B P;  5HKC A;  4E6R A;  4RG2 A;  2HL3 A;  3VYH B;  2YRD A;  3CCQ Q;  3RES A;  4KRT A;  2JM8 A;  2XDP A;  3TEE A;  2PQW A;  4M7A C;  4M7D C;  1RLP C;  4PJO E;  1YIT A;  4NOY A;  5GMK h;  2Y90 A;  3M4Q A;  3EHR A;  5IN1 A;  1D1C A;  1FMV A;  1TUD A;  1ABO A;  2D8J A;  3QHS A;  4FM4 B;  2RK1 A;  5GAN f;  1YHQ Q;  2MI6 A;  3HRU A;  1W2B S;  2DZ9 A;  3G6E Q;  2ABL A;  2CZ7 B;  3V8L A;  4PG3 A;  4AMC A;  4Y91 A;  2DQ3 A;  1RAA B;  1ADJ A;  2QYZ A;  3VRY A;  4QQG A;  3G1Z A;  1FX7 A;  4CH5 A;  1D3B B;  4QVZ A;  3JB9 G;  4BI4 A;  2CH4 A;  4HWR A;  2KRS A;  2CYZ B;  2V1Q A;  3CMA T;  4IUP A;  3P8V A;  4HVC A;  4C5H A;  3OW2 A;  2ATC B;  1D0Z A;  2I4O A;  4D6W A;  4RTY A;  5I22 A;  5CKD A;  4DBR A;  1WJS A;  3O8V A;  3UF4 A;  4F7U A;  4O5V A;  1E7O A;  4XTV A;  1Q81 U;  4H2X A;  1WHG A;  4JLI A;  4PJO D;  4C92 A;  4O6J A;  4YTL A;  4YRS A;  4P73 C;  2LX7 A;  2RJC A;  2RQU A;  4Q15 A;  2IY5 A;  1D0X A;  4M77 G;  2A28 A;  4IUR A;  4BY6 C;  3UWN A;  3CCJ A;  5GAO l;  1ZLM A;  2MPX C;  2EIF A;  2ZPF B;  1ADY A;  5GAN g;  3DB4 A;  2KEA A;  1JU5 C;  3DB3 A;  2FRY A;  2X35 A;  5HCK A;  1Q82 R;  1QVG A;  4FT4 A;  3M4Y A;  3UA7 A;  2F5T X;  1ARK A;  2AZV A;  4JJN K;  4P72 C;  3OYM A;  1JJC A;  2DJZ A;  1YJ9 T;  1Q81 C;  2G3R A;  3QUI A;  4G84 A;  1KK7 A;  1OPL A;  4XTW A;  2VXE A;  3VRZ A;  3HPW A;  4JLG A;  3VQW A;  1H3Z A;  1YJN A;  1ATI A;  4LNP A;  2LP5 A;  3CC7 A;  2HZY A;  1GBR A;  1Q7Y U;  4LVK A;  2O4X A;  2E65 A;  3I9Q A;  5KE3 A;  3CCU A;  3OB9 A;  2EKH A;  2GF7 A;  3HRS A;  1R8O B;  3OD1 A;  1XTD A;  4L5G A;  1TWB A;  5L23 A;  2I4L A;  3GBQ A;  3A32 A;  4LDX A;  3VS2 A;  1G3W A;  4XTY A;  1SET A;  3I7F A;  4CH6 A;  2K57 A;  4QW2 A;  3WVD B;  3CD6 A;  3HRI A;  4Q5W A;  1VUB A;  4L6V 5;  3V7R A;  1KC8 C;  5ELN A;  4M7A A;  3RGL A;  1GRI A;  2RHQ B;  3EGD A;  3QO5 A;  4WI1 A;  4C8Q E;  2V8K A;  3EH1 A;  3LYI A;  4YRM A;  4C92 F;  1N6A A;  1GCQ A;  5I2M A;  3VQX A;  3M0S A;  4HWT A;  3LGF A;  3G71 A;  4TVA A;  2JT4 A;  4RCC A;  2LCL A;  2XIC A;  1JXM A;  1R77 A;  3RIR A;  2CDT A;  3KXT A;  3A31 A;  5KYY B;  2RF0 A;  2DQ0 A;  2K2V A;  1ZQ1 A;  1Y71 A;  1F1B B;  4JRI A;  1RI9 A;  2XU8 A;  1BU1 A;  3DLM A;  2FPF A;  1C1A A;  2HMA A;  4DOV A;  1WFW A;  1TU0 B;  4J8O A;  5I21 A;  5GAN h;  2XK0 A;  3M0U A;  3C12 A;  1MND A;  2DEU A;  1E1O A;  4PL6 A;  3GOX A;  3JB9 D;  1X2H A;  2C0I A;  4C8Q D;  3ICA A;  2RQT A;  4A53 A;  3MF2 A;  4R0K A;  3EG3 A;  3LX7 A;  1PSF A;  2H3E B;  4PJL A;  1UTI A;  5HK0 A;  1KQ2 A;  2QQS A;  3CXC A;  1ZSZ B;  1VQO Q;  1KD1 R;  1HSQ A;  1HC7 A;  4H02 A;  2QA4 A;  4QQ6 A;  5IHI A;  2ZR2 A;  2C06 A;  3CCQ A;  3UDC A;  1BIA A;  1UGV A;  5KYW B;  2QI2 A;  3A8L B;  1UG1 A;  3OY9 A;  1QVP A;  3QTC A;  1Y96 B;  3BJU A;  1MHN A;  4P72 A;  1QP3 A;  3SWN A;  1VQ4 T;  5FLX E;  4UC4 A;  4N4G A;  4KH1 B;  4M7A F;  3UPU A;  4M7D F;  2DBK A;  1YHQ A;  1ZA1 B;  3HTR A;  3JCM d;  4RMF A;  4RTZ A;  3SHW A;  1IL2 A;  3G6E A;  3J7A F;  3EHQ A;  2QEX Q;  4TVY A;  1CKA A;  1U3O A;  1VOM A;  3A1P A;  3FJP A;  3VQV A;  5GAO r;  3ER0 A;  2COY A;  3QO3 A;  1KJW A;  2X9H A;  2VGN A;  2J3L A;  1XOV A;  1UHC A;  2DIL A;  1NNH A;  4LDY A;  3QWX X;  1AZE A;  4YRK A;  1D3B A;  2EBP A;  3A5Z B;  1YWO A;  2JTF A;  2OI3 A;  2K79 A;  2RHY A;  4A4E A;  1VQ6 Q;  4KUD K;  3CME Q;  4DEY A;  4AH6 A;  2XG8 D;  1YI2 T;  5FWB A;  4D8D A;  2J6F A;  3JB9 J;  3QWY A;  2W0Z A;  4YRN A;  3CCR Q;  3LSQ A;  1MNE A;  2P0L A;  2CP0 A;  3RMQ A;  3M54 A;  2NWM A;  4BW9 A;  2F69 A;  1ZX6 A;  1B07 A;  4EO4 A;  4KBM B;  5CVI A;  2V1R A;  1O75 A;  2DE0 X;  2O9S A;  4AFS C;  5LJ5 d;  1XJW B;  3CPW S;  1ZSZ C;  3VS3 A;  2DET A;  1YJW T;  2CUD A;  3JSC A;  2F5K A;  1QVF S;  2ZXF A;  3PT9 A;  2ED0 A;  3P8Y A;  5DLQ E;  3TSZ A;  3PIO A;  4N4H A;  1RL2 A;  3HXX A;  3QZ5 B;  1K9A A;  1LCK A;  3HKS A;  2VUB A;  4HCZ A;  2E3C A;  2M1H A;  1WLE A;  4YYE A;  2YRV A;  5DY9 A;  4IIM A;  3EG2 A;  1B70 B;  2E10 A;  4H2Y A;  1VQ7 Q;  3VS7 A;  2KXC A;  1K0S A;  2QQ9 A;  4XU3 A;  3R07 A;  3BDU A;  1EIF A;  1E24 A;  4M7D G;  3TUP A;  3CCV T;  3ZBD A;  1UFF A;  1Q82 C;  2CZ0 B;  3HP9 A;  5LJ3 d;  3I55 Q;  3QO8 A;  2X3X D;  4E7J A;  5GJW B;  2XD0 A;  2K3X A;  5J3B A;  5DM7 R;  4UP7 A;  2EWN A;  4J9D A;  3G4S Q;  2OTL Q;  2EL9 A;  3A5Y A;  4F7U E;  3UH0 A;  1Y57 A;  2EYW A;  4N0A A;  2EJG A;  1Z7N A;  2LTO A;  2YUO A;  1IZ6 A;  1TS9 A;  4C92 E;  3CCE T;  1AWO A;  3JCM f;  2HAX A;  3L2R A;  1B34 B;  4NL3 A;  4RQF A;  4A54 A;  2RHS B;  2W10 A;  4KT0 E;  4LVM A;  2EKO A;  1Z9Z A;  2D9T A;  1JJ2 S;  1BBW A;  5KCO A;  4KR3 A;  3IAL A;  2QTX A;  1TTH B;  2FL7 A;  1YIJ A;  4C5G A;  2KMT A;  4E2F B;  2GQV A;  1QE0 A;  1UB4 A;  4BE1 A;  3L1A A;  1NYG A;  2LCC A;  1RAC B;  4IUV A;  5LJ5 j;  3LWI A;  2FEI A;  3OYY A;  2E6N A;  4LN2 A;  1KFZ A;  5I11 A;  1SKU B;  4CC7 A;  3M55 A;  2ARS A;  3ERR A;  1W70 A;  4PHC A;  2D8H A;  3A8O B;  3LH5 A;  1NJ1 A;  5KYY A;  3URG A;  3QBY A;  2ED1 A;  3RNJ A;  2CRE A;  5AYF A;  4C92 D;  4EMG A;  1RAF B;  5CKE A;  2IVW A;  3UT1 A;  5GAO q;  5LJ5 f;  2ZT7 A;  1K8A U;  2QHT A;  2PME A;  3M58 A;  3JCM g;  2DER A;  1WDX A;  2A36 A;  2E64 A;  1GL5 A;  3L4G A;  2MAM A;  1N9R A;  4LUD A;  5AT1 B;  2CT4 A;  3PCO B;  1M8V A;  2EQK A;  3HXV A;  3CBP A;  3KBG A;  3HY0 A;  1UE9 A;  1B8A A;  1VQP T;  4FIB A;  4L87 A;  2A08 A;  4C8Q A;  2X4Y A;  4J9F A;  3TSW A;  1VQO A;  2PZ1 A;  5CK9 A;  3PZC A;  3VQY A;  4FYX B;  1PCX A;  4BE0 A;  3DSQ A;  3BFM A;  5E3I A;  3W3S A;  3BE3 A;  2WSE E;  2E5Q A;  2LVM A;  2DFU A;  4RMO A;  4M7A E;  1WI7 A;  2ROT A;  2RHI A;  1X01 A;  1VQM Q;  4CS2 A;  3M0P A;  3NFC A;  2ZIO A;  4P3P A;  4LDV A;  1VYT A;  5GAM e;  2Y4Y A;  3M57 A;  1X2Q A;  2EW3 A;  5LJ3 f;  2J7I A;  2JS0 A;  4J9C A;  1BB9 A;  1M5Q 1;  3ME9 A;  4LVL A;  3G7Z A;  2R5M A;  1OZ2 A;  1KD1 C;  4XTX A;  1ZSG A;  4M77 A;  3JB9 I;  1HXD A;  1KQS A;  1KMN A;  1SHG A;  2QEX A;  4JUV A;  4GLM A;  2CS7 A;  1YJN Q;  3FDR A;  5LJ5 g;  5IHK A;  3ZEH A;  1MMA A;  2P0Q A;  1S72 Q;  3X26 B;  4G85 A;  4P75 C;  3TEG A;  1IRE B;  4FW1 A;  1AT1 B;  1U1T A;  2DTH A;  1WJR A;  2ZTG A;  2ZAE A;  4EMH A;  5GAN e;  3TCJ A;  1M90 R;  2XHC A;  4PFZ A;  3X24 B;  1VQ6 A;  2H8H A;  4ZN1 A;  2C0O A;  4M7A D;  1USY A;  2DL3 A;  4OMM A;  4BE2 A;  2LCS A;  2DJQ A;  2JM9 A;  4HWO A;  3VS6 A;  3CCR A;  2XI9 A;  4EX5 A;  4FYV B;  4XTZ A;  2BIV A;  2X4J A;  5K1X A;  3CCM Q;  2DIG A;  2DEQ A;  2NYS A;  2R58 A;  3P8H A;  1VA7 A;  4J9I A;  3RR6 A;  2KGT A;  3V7C A;  1M4Z A;  3HFZ A;  1JBM A;  4RTT A;  1SF9 A;  1OU8 A;  1L0W A;  3PTA A;  1WPY A;  2JMC A;  3JCM h;  1SES A;  2FYK A;  2PVO B;  5GAO n;  2SRC A;  2X3W D;  1M1G A;  3E1S A;  3SEM A;  1PNJ A;  4TQD A;  1RAE B;  4FYY B;  1NJ2 A;  3OBW A;  3R6N A;  1JRI A;  3L42 A;  1PYS B;  3HXU A;  1WQW A;  4D8K A;  3VS1 A;  2QHS A;  1VQ7 A;  1UJ0 A;  2DXB A;  4HVW A;  2HBW A;  1OOT A;  4YRP A;  3QDF A;  1QMC A;  1RAD B;  2F2V A;  1Q95 G;  2AK5 A;  1NLO C;  3OYG A;  5GAN 3;  2KNB B;  1I5O B;  1U8R A;  5GAM j;  5ECA A;  4EMK A;  2DYB A;  1YCS B;  5C51 B;  1WNL A;  1EX4 A;  3NEN A;  3G4S A;  3UAT A;  2OTL A;  2LC4 A;  1PHT A;  4J6W A;  5F5W A;  3R6O A;  2ALY B;  4KR2 A;  3DKM A;  1H8K A;  3QXE B;  2QA4 Q;  2F1L A;  3HFO A;  4KUI A;  4P71 A;  2JMA A;  4AG1 C;  2EGC A;  3OSS C;  2VXF A;  4OMN A;  1OX9 A;  4C0F A;  5LJ5 h;  2EYX A;  2DU5 A;  4M78 B;  3MEA A;  3CMQ A;  3CCS T;  3ULR B;  3H0I A;  4E7L A;  3PFS A;  4LDU A;  4XAX B;  1M2V B;  4YRO A;  2M51 A;  2IG0 A;  4P74 C;  1VIF A;  2ZPH B;  2EJ9 A;  4XU1 A;  4UP8 A;  2PUK B;  1NZ9 A;  1AHJ B;  4WTO B;  4MML A;  4AFZ C;  1PSE A;  2HQE A;  2PTK A;  3HTZ A;  3GP8 A;  3QZ9 B;  2V8I A;  4P75 A;  1VIE A;  2O31 A;  1M1K R;  4IUQ A;  3TEH B;  1KOG A;  4HKE A;  4AFU C;  3CQT A;  4DBH A;  1H64 1;  5LJ3 h;  4FT2 A;  3OYB A;  4X9C A;  4QT7 A;  1N8R R;  2KBT A;  5DLO A;  4RUG A;  1PWT A;  3REX A;  2G6F X;  4X34 A;  4R55 A;  2NUT B;  1G5I A;  2LQK A;  4KH0 B;  1PD1 A;  3VV0 A;  1VQ5 Q;  2CJA A;  1C0A A;  2LQW A;  1X56 A;  1NBE B;  2VAS A;  3EAE A;  4C5E A;  2GQI A;  2DAQ A;  1K76 A;  3I56 T;  2LT1 A;  3MEW A;  4J9G A;  3M4G A;  1IXD A;  3PCO A;  2L3R A;  1UUE A;  1KSW A;  2AKW B;  5HGQ A;  1QCN A;  2CP2 A;  1SER A;  1AEY A;  3JCM J;  1OV3 A;  1ZHI A;  1ZA2 B;  1VQM A;  3OW2 P;  3RKX A;  3QJY A;  1GFD A;  4BWA A;  4X1V A;  3EGX A;  3NTI A;  2QAZ A;  2YUP A;  3INZ A;  3RDV A;  4M78 C;  1WHL A;  2A37 A;  1KC8 U;  3CMA Q;  1EOV A;  4P3O A;  4K86 A;  1RLQ C;  1YBY A;  2M16 A;  3CC2 T;  3GIB A;  1AZG B;  4P5N A;  1NM7 A;  4AT1 B;  1OQK A;  3FB9 A;  3CBM A;  3H0F A;  1R0B G;  3OW2 S;  1QKW A;  1S72 A;  2FPD A;  2GNC A;  2M0O A;  3C0C A;  1K4U S;  3RF1 A;  1G5H A;  1WX6 A;  1WGS A;  1V76 A;  2JNG A;  2PVD B;  3NHN A;  8AT1 B;  4OMF B;  5GMK i;  1RAG B;  1M27 C;  3CCL T;  2M02 A;  2CKK A;  3A8G B;  3TVT A;  4C0D B;  1LVK A;  1QVG P;  4LE9 A;  4JJC A;  5KH6 A;  2JZ2 A;  1I81 A;  2KK4 A;  4YRT A;  1TG0 A;  2RO0 A;  4B6M A;  3L2W A;  1Q86 R;  4M7D A;  4FYW B;  2YWW A;  2E4H A;  2RD1 A;  3CCM A;  4M75 G;  1VYU A;  4RTX A;  3A7A A;  4PK4 A;  3T9N A;  3C4S A;  1YIJ Q;  4PJN A;  1M90 C;  1VQ8 T;  4P74 A;  1YJ9 Q;  1QVG S;  4K87 A;  2FPE A;  1BIB A;  3JAM E;  1FWZ A;  1WHK A;  5A2Q E;  4HXJ A;  1EFW A;  3VUB A;  2J6K A;  4M4Z A;  1MV3 A;  2L2P A;  2M0Y A;  4DBQ A;  5FWC A;  4YCV A;  2AHJ B;  1BCM A;  4PKC C;  2Q7H A;  1RAH B;  2LX9 A;  5KCH A;  4H2S A;  4M77 E;  4YRR A;  3MET A;  1U1S A;  1D1B A;  2QHV A;  2DL8 A;  2JVV A;  1PYS A;  4A63 B;  1OU9 A;  1QCF A;  3H41 A;  3KFV A;  4QVC A;  2EGE A;  2OAU A;  4J83 A;  3JCM b;  3OS2 A;  4Z88 A;  3U23 A;  1BBU A;  2E3H A;  1MUZ A;  3V8J A;  4WCI A;  2CH4 W;  3I5S A;  2MYS A;  4P73 A;  3EG9 B;  2VKN A;  5CO7 A;  1VQN T;  4PJJ A;  1RIQ A;  3AT1 B;  4PNO A;  4J7I A;  4C0D C;  2DDZ A;  2B8A A;  4DOW A;  1PKS A;  1X6B A;  5KYU A;  2RI5 A;  4YRC A;  3HHT B;  2K3Y A;  3CME T;  1K73 R;  12AS A;  3MCA B;  3REU A;  1VQL A;  2K5F A;  2VYT A;  4ZGJ B;  4M77 D;  2AIR B;  2ZPE B;  3PNW C;  3SFM A;  3S3M A;  1WQ7 A;  2AZS A;  3E9H A;  2GFA A;  1BI1 A;  2DTI A;  2P0K A;  1K0X A;  1IGQ A;  1QQJ A;  5GAN 2;  1VQK T;  3RKW A;  1M1K U;  1UEC A;  1PD0 A;  3GNG A;  3P8B B;  3ZFJ A;  4E7I A;  2HKN A;  1W1F A;  1VQ9 T;  1QVF A;  5A0G A;  2EJF A;  1N8R U;  1YNZ A;  3CXC P;  1FYN A;  2QGF B;  4YCW A;  5FU6 B;  4N4I A;  2F2X A;  3L2U A;  1K9M R;  2CSQ A;  2XDB A;  5D6X A;  2OTJ T;  4EDU A;  3SB2 A;  2GTO A;  3HL8 A;  2YLC A;  3M53 A;  3LWH A;  3FJ5 A;  1SRM A;  3MO8 A;  1E22 A;  1VQ5 A;  4JS5 A; 
#chains in the Genus database with same CATH homology
 3WXM B;  3ASK A;  3JCM c;  2HBP A;  2JTM A;  3OYN A;  1M1K C;  1M9S A;  2RA2 A;  3HRT A;  3QNE A;  5CKH A;  1Q82 U;  1N8R C;  3I55 T;  4MZM A;  1G3T A;  2A7Y A;  2QXF A;  5GMK e;  3JRZ A;  4M75 B;  4QQD A;  3HXY A;  2R5A A;  3NEL A;  5CIU A;  1HK9 A;  3FIF A;  3CMA A;  2E1H A;  5FRM A;  4Y28 E;  1YIT T;  1KG1 A;  1G3S A;  1BI2 A;  4M78 F;  4OB0 B;  1X75 C;  1NJ8 A;  4XU0 A;  1EQR A;  2RM4 A;  4P3N A;  3MF1 A;  5LJ3 e;  3RUX A;  4YRE A;  2RI3 A;  2XTI A;  5KE2 A;  5FU6 C;  2FB7 A;  3JB9 H;  4OF1 A;  2XDD A;  3QYG B;  2QQR A;  4DA4 A;  2C8M A;  1B7Y B;  4NL2 A;  2ARU A;  2MF2 A;  3HXZ A;  5GAO m;  4E7K A;  2L89 A;  5M9O A;  2ZNI A;  2RHQ A;  3QSU A;  3E19 A;  2EYQ A;  2QDY B;  2EQM A;  2XGT A;  1YJ9 A;  4HCB A;  4R56 A;  4H2T A;  1UEB A;  3HRK A;  3QII A;  3QJ6 A;  3VBB A;  2DO3 A;  1Q86 C;  2WSF E;  2E41 A;  3CCJ T;  2RHX A;  4M75 C;  1KQ1 A;  4E51 A;  1H4V B;  3M9Q A;  2ZIN A;  5D6Y A;  4Z02 A;  4C0Z A;  2ZZD A;  1TH7 A;  1KD1 U;  4M78 G;  3EFR A;  4F7U B;  3WQZ A;  1MGQ A;  3LC0 A;  1YJN T;  3CC7 T;  4C92 B;  2GFU A;  5J26 A;  4H2U A;  2Q5I A;  2ODR C;  5GMK m;  3CCU T;  3HFV A;  1W66 A;  1NPP A;  2KVQ G;  4M7D E;  1UGS B;  2IY5 B;  4JRK A;  2O01 E;  4RQE A;  2FVU A;  4TVW A;  2Y4X A;  3CD6 T;  1RI0 A;  1H4Q A;  4YRG A;  2R57 A;  5K1P A;  4TQF A;  1Y96 A;  4RDX A;  3PGG A;  1KHI A;  1K9M U;  3KFU A;  2RJE A;  5GAM d;  3C94 A;  2DXT A;  4OB3 B;  1JB0 E;  2P5I A;  3FC3 A;  3G71 T;  4YDQ A;  4WF2 A;  2O4X B;  1ASY A;  3V7S A;  4M7D D;  3A5Z A;  2MWP A;  2CIM A;  3LW5 E;  1DJ7 B;  3P8D A;  3E9G A;  1XQH A;  3CPF A;  4PJO G;  3S6W A;  2K5I A;  2PUO B;  2V8J A;  1QP2 A;  3LSS A;  2E12 A;  4WJ3 M;  4ZN3 A;  5GAN 6;  1K9M C;  2ART A;  4CI0 C;  3OYK A;  2C7I A;  3J80 E;  4J6X A;  1VQ4 A;  3OYI A;  3RER A;  2FHD A;  3A8M B;  4C92 C;  3OYD A;  1KMM A;  4YPF A;  1YGB A;  4X9D A;  4CH4 A;  2ZT5 A;  4WJ4 A;  5CQX A;  2QA4 T;  3X28 B;  2RH2 A;  4TVA B;  3CCQ T;  2VV5 A;  4MZT A;  3QPH A;  4M75 A;  1OI1 A;  4H2V A;  4A4H A;  4XEO A;  2KQW A;  4BDY A;  1W2B A;  1B70 A;  1LNX A;  2LRQ A;  3VYG A;  1YI2 A;  3SDZ A;  1YHQ T;  2MMP A;  3G6E T;  2X4W A;  3BW1 A;  3IKM B;  2CJ9 A;  4H2W A;  2RI2 A;  5EG2 A;  2G4C A;  2LNV A;  2ZZE A;  3NEM A;  4M78 D;  3OYA A;  2Q7E A;  2PMF A;  3OMC A;  5GAM f;  4V2S A;  11AS A;  1YJW A;  2CGH A;  3DLL A;  1B34 A;  3JCM Q;  4KQE A;  3KUF A;  2RHS A;  2CZ6 B;  5GAN j;  5FU7 B;  2K4Y A;  5C0M A;  3JCM V;  2XID A;  4DQ2 A;  1N9W A;  1BI0 A;  3TU4 K;  1YB3 A;  3SWN B;  1Y07 A;  3PMI A;  3RAC A;  3OQ5 A;  4KUL A;  4A4F A;  3J81 E;  2KY9 A;  3MEV A;  3CCV A;  3HXW A;  4YRF A;  5C52 B;  4UP9 A;  3QYH B;  4ELY C;  4MZP A;  3E9F A;  5I2S A;  4J15 A;  4VUB A;  4NCX A;  1GGM A;  1WU7 A;  3A8H B;  5ELO A;  4M75 F;  4JRQ A;  4C8Q G;  3CCE A;  3L2Z A;  4HWP A;  1X6O A;  5GAM g;  4YP0 A;  1SRY A;  1EVL A;  4GLK A;  2QHU A;  2XKO C;  4ZGD B;  2ZR3 A;  2L5Q A;  2EQJ A;  2BUD A;  4PJO B;  4C5I A;  4XEM A;  2HD0 A;  2DD5 A;  4FSX A;  2RJF A;  3CEY A;  1Y7X A;  3M4P A;  3UGQ A;  5CAI A;  3NET A;  3FEO A;  3FLG A;  5CCA A;  5FU7 C;  4TWA A;  2RK2 A;  4ZTU B;  2YHT A;  4JS4 A;  1YIJ T;  1M90 U;  4OLF A;  1I5L A;  3M5A A;  3SWN C;  4CH3 A;  3BY7 A;  5IT9 E;  2ZGW A;  4BDZ A;  1XNI A;  3F70 A;  4PLI A;  1UGQ B;  1YCY A;  1VQP A;  5FRO A;  5KNN A;  3OYF A;  4HWS A;  4BI3 A;  3S3N A;  2E70 A;  3GNF B;  3N5B B;  2MWO A;  2ZT6 A;  2KAF A;  4ZTJ A;  5HY6 A;  2LDM A;  3OS1 A;  2E5A A;  2M9U A;  2JN0 A;  3OA6 A;  3NTH A;  5D6W A;  4BI8 B;  2A8E A;  1QW1 A;  2EAY A;  5CR2 A;  1G5V A;  4L59 A;  4LVJ A;  3MP8 A;  2CZ1 B;  5GMK l;  1VQO T;  2ZCF B;  4F7U F;  5GAN 4;  4PJO C;  4HT8 A;  3A7R A;  2DK3 A;  1N27 A;  2K5L A;  5GAM h;  3MP1 A;  4HCC A;  1YFS A;  2X4X A;  3QDR B;  3OYE A;  4OGC A;  1Q7Y C;  1Z7M A;  3M56 A;  4BUG A;  2VC8 A;  3BDL A;  2JOY A;  2ZT8 A;  4HT4 A;  3PMT A;  3CC4 A;  3L2Q A;  2J3M A;  2ZZF A;  2QEX T;  1ASZ A;  4DPG A;  3C95 A;  1NJ5 A;  2CJB A;  3L4G B;  4O2D A;  2P0P A;  1WYD A;  4RCB A;  3WVE B;  4II1 A;  2ZPI B;  3E9I A;  2DPP B;  1OZ3 A;  2ALY A;  3VU3 C;  4LD6 A;  4C8Q B;  4ZTF A;  1O9S A;  4Q6G A;  1EVK A;  3AHU A;  1EIY B;  1VQ6 T;  2BKD N;  4LDW A;  2AMC B;  4YRI A;  3P8T A;  4M78 A;  4N0A C;  4ATO A;  5LL6 S;  3CCR T;  3LLR A;  4OVA A;  3EFS A;  3JCM e;  4YRQ A;  4JDS A;  2P4T A;  3CPW A;  4YRL A;  4MDX A;  4ZIB A;  4EPC A;  3IKL A;  2RB6 A;  4M77 B;  5HK3 A;  4M75 E;  1G3Y A;  2KDS A;  3VKI A;  4F7U G;  4X5O A;  4IKF A;  2DIQ A;  5GAN 5;  3QG1 A;  4A4K A;  4XK8 E;  4C92 G;  3TEH A;  3UFG A;  1I8F A;  2HQX A;  2H3J A;  3JCM P;  4ELZ C;  3OBY A;  3V8K A;  1VQ7 T;  4PLL A;  3CXC S;  1NE8 A;  2NS6 A;  3H6Z A;  4LD9 K;  5FRN A;  3HY1 A;  3OS0 A;  3CCS A;  1LOJ A;  5LJ5 e;  5CQY A;  1I4K 1;  1UGR B;  1BYM A;  2EFI A;  3G4S T;  2OTL T;  2WSC E;  2KSS A;  4C0G A;  2AKW A;  3H8Z A;  2VGM A;  4M75 D;  4NS5 A;  2EQU A;  3HFZ B;  4PJO A;  4J6Y A;  4LVI A;  4C8Q C;  1JJ2 A;  1V29 B;  4E47 A;  2I2L A;  2ZPG B;  4OP0 A;  1G51 A;  1NPR A;  3OSV A;  4J7F A;  4J5Y A;  1H4S A;  3MQZ A;  2WAC A;  4YCU A;  2DD4 A;  2ZIM A;  4TVR A;  2DZC A;  4B9X A;  2ODR D;  3L2V A;  4M77 C;  4IUU A;  3QO7 A;  1B76 A;  1Q86 U;  4RKU E;  4M7A G;  3I56 A;  2NLU A;  4EMK B;  5GAO p;  1X54 A;  2ZCE A;  4XTU A;  2QQA A;  4OB1 B;  3GF5 A;  1NYQ A;  4CS3 A;  1HTT A;  3OYJ A;  1NJI U;  3CBO A;  1USY C;  4ZTZ B;  1J5W A;  1ZBX A;  2A3L A;  3M59 A;  4JRP A;  2JUF A;  1FXX A;  5A0D A;  4YRJ A;  4OB2 B;  3CC2 A;  5CKB A;  5IAY A;  2D6F A;  2DTO A;  3MP6 A;  4HT9 A;  2ZPB B;  3JCM W;  1VQM T;  2D0Q B;  2Q7G A;  5CKF A;  5GAN 8;  2ZZG A;  4PJO F;  1BI3 A;  3CCL A;  2ZNJ A;  2DXC A;  4CS4 A;  1M1F A;  1YFT A;  5GMK j;  3NTK A;  1NJI C;  3OYH A;  3VJP A;  2Q5H A;  1SSF A;  2YLB A;  5L8R E;  4H2X B;  3QKJ A;  2RHZ A;  1LYL A;  1N9S A;  2L8D A;  5C53 B;  1S72 T;  3RL6 A;  1W4S A;  2DVE A;  4BD3 A;  1K73 U;  2E6Z A;  3A7U A;  3HFN A;  1VQ8 A;  3Q1J A;  4EMK C;  4IUT A;  3X20 B;  4MMK A;  5LJ3 j;  1EIY A;  2AMC A;  4P71 C;  3CCM T;  1BKB A;  3X25 B;  1JJC B;  4FU6 A;  4B9W A;  1H4T A;  3FRN A;  2LT4 A;  2I4N A;  1K73 C;  1K8A C;  4GY5 A;  4HA8 A;  2GCX A;  2PVG B;  1LJO A;  1VQZ A;  3OMG A;  3VUZ A;  2PU9 B;  2QQB A;  3GLX A;  1VQN A;  5J39 A;  4K88 A;  4OGE A;  4LNS A;  2DU7 A;  5GAN d;  1WJQ A;  4XU2 A;  3GPL A;  1FYF A;  4CRI A;  3TRE A;  3CME A;  3S3O A;  2RJD A;  4M7A B;  4UPA A;  4M7D B;  4ME7 A;  3LH0 A;  3HSB A;  1UGP B;  2RHU A;  3CC4 T;  4TTV A;  1OYX A;  3LGL A;  3SD4 A;  5GAN 7;  4A4G A;  4FL6 A;  1VQK A;  3OS5 A;  1X2G A;  4M78 E;  2DXU A;  1QF6 A;  5LJ3 g;  1NYR A;  5A0L A;  1VQ9 A;  3RKY A;  1KQS S;  3OYC A;  5C6S A;  1GXI E;  4BAC A;  1NJ6 A;  4MDW A;  3JB9 F;  4BB7 A;  1VQL T;  1KHC A;  4C8Q F;  4XQ3 A;  1E1T A;  2LQ8 A;  2OTJ A;  2HNI A;  4ZGE B;  3UGT A;  2I4M A;  2DKG A;  1YFR A;  3JCM X;  4E7H A;  3PIP A;  3MHX A;  3IG2 A;  3MEU A;  3MEY A;  4RG8 A;  4QVD A;  3RMS A;  3I55 A;  1P92 A;  4M77 F;  4BY6 B;  3A74 A;  1B7Y A;  3OYL A;  1VQ5 T;  1X55 A;  5HKC A;  4RG2 A;  3VYH B;  3RES A;  2XDP A;  3TEE A;  2PQW A;  4M7A C;  4M7D C;  4PJO E;  1YIT A;  4NOY A;  5GMK h;  2Y90 A;  3M4Q A;  5IN1 A;  3QHS A;  4FM4 B;  2RK1 A;  5GAN f;  2MI6 A;  3HRU A;  1W2B S;  2DZ9 A;  2CZ7 B;  3V8L A;  4PG3 A;  4Y91 A;  2DQ3 A;  1ADJ A;  4QQG A;  3G1Z A;  1FX7 A;  4CH5 A;  1D3B B;  4QVZ A;  3JB9 G;  4BI4 A;  4HWR A;  2CYZ B;  3CMA T;  4IUP A;  3P8V A;  4HVC A;  4C5H A;  3OW2 A;  2I4O A;  4D6W A;  5CKD A;  1WJS A;  3O8V A;  4F7U A;  4O5V A;  4XTV A;  1Q81 U;  4H2X A;  4JLI A;  4PJO D;  4C92 A;  4O6J A;  4YTL A;  4YRS A;  4P73 C;  2RJC A;  4Q15 A;  2IY5 A;  4M77 G;  4IUR A;  4BY6 C;  3UWN A;  3CCJ A;  5GAO l;  2ZPF B;  2EIF A;  1ADY A;  5GAN g;  3DB4 A;  3DB3 A;  2X35 A;  1QVG A;  4FT4 A;  3M4Y A;  2F5T X;  4JJN K;  4P72 C;  3OYM A;  1JJC A;  2DJZ A;  1YJ9 T;  1Q81 C;  2G3R A;  3QUI A;  4G84 A;  4XTW A;  2VXE A;  3HPW A;  4JLG A;  3VQW A;  1H3Z A;  1YJN A;  1ATI A;  3CC7 A;  1Q7Y U;  4LVK A;  2O4X A;  2E65 A;  5KE3 A;  3CCU A;  3OB9 A;  2GF7 A;  3OD1 A;  3HRS A;  1R8O B;  1XTD A;  4L5G A;  2I4L A;  3A32 A;  4LDX A;  1G3W A;  4XTY A;  1SET A;  3I7F A;  4CH6 A;  2K57 A;  4QW2 A;  3WVD B;  3CD6 A;  3HRI A;  4Q5W A;  1VUB A;  4L6V 5;  3V7R A;  1KC8 C;  5ELN A;  4M7A A;  3RGL A;  2RHQ B;  3QO5 A;  4WI1 A;  4C8Q E;  2V8K A;  3LYI A;  4YRM A;  4C92 F;  1N6A A;  5I2M A;  3VQX A;  4HWT A;  3LGF A;  3G71 A;  4TVA A;  4RCC A;  2LCL A;  2XIC A;  3RIR A;  3KXT A;  3A31 A;  2DQ0 A;  2K2V A;  1ZQ1 A;  1Y71 A;  4JRI A;  2XU8 A;  3DLM A;  4DOV A;  4J8O A;  5I21 A;  5GAN h;  2XK0 A;  3C12 A;  1E1O A;  4PL6 A;  3GOX A;  3JB9 D;  1X2H A;  4C8Q D;  3ICA A;  4A53 A;  3MF2 A;  3LX7 A;  1PSF A;  5HK0 A;  1KQ2 A;  2QQS A;  3CXC A;  1HC7 A;  4H02 A;  2QA4 A;  4QQ6 A;  2ZR2 A;  2C06 A;  3CCQ A;  3UDC A;  1BIA A;  2QI2 A;  3A8L B;  3OY9 A;  1QVP A;  3QTC A;  1Y96 B;  3BJU A;  1MHN A;  4P72 A;  1QP3 A;  3SWN A;  1VQ4 T;  5FLX E;  4UC4 A;  4N4G A;  4M7A F;  3UPU A;  4M7D F;  1YHQ A;  3JCM d;  4RMF A;  1IL2 A;  3G6E A;  3J7A F;  4TVY A;  3FJP A;  3VQV A;  5GAO r;  3ER0 A;  3QO3 A;  2VGN A;  2J3L A;  1XOV A;  1NNH A;  4LDY A;  4YRK A;  1D3B A;  3A5Z B;  2JTF A;  2RHY A;  4A4E A;  4KUD K;  4AH6 A;  2XG8 D;  1YI2 T;  3JB9 J;  4YRN A;  3LSQ A;  2P0L A;  3RMQ A;  3M54 A;  4BW9 A;  2F69 A;  4EO4 A;  4KBM B;  5CVI A;  1O75 A;  5LJ5 d;  3CPW S;  1YJW T;  3JSC A;  2F5K A;  1QVF S;  2ZXF A;  3PT9 A;  3P8Y A;  5DLQ E;  3PIO A;  4N4H A;  1RL2 A;  3HXX A;  3QZ5 B;  3HKS A;  2VUB A;  4HCZ A;  2E3C A;  2M1H A;  1WLE A;  4YYE A;  2YRV A;  5DY9 A;  1B70 B;  2E10 A;  4H2Y A;  2QQ9 A;  4XU3 A;  3R07 A;  3BDU A;  1EIF A;  1E24 A;  4M7D G;  3TUP A;  3CCV T;  3ZBD A;  1Q82 C;  2CZ0 B;  3HP9 A;  5LJ3 d;  3QO8 A;  4E7J A;  2XD0 A;  2K3X A;  5J3B A;  5DM7 R;  4UP7 A;  2EWN A;  2EL9 A;  3A5Y A;  4F7U E;  3UH0 A;  4N0A A;  2EJG A;  1Z7N A;  2LTO A;  4C92 E;  1IZ6 A;  3CCE T;  3JCM f;  2HAX A;  3L2R A;  1B34 B;  4NL3 A;  4RQF A;  4A54 A;  2RHS B;  4KT0 E;  4LVM A;  2EKO A;  2D9T A;  1JJ2 S;  1BBW A;  5KCO A;  4KR3 A;  3IAL A;  2QTX A;  2FL7 A;  1YIJ A;  4C5G A;  2KMT A;  2GQV A;  1QE0 A;  1UB4 A;  4BE1 A;  3L1A A;  2LCC A;  4IUV A;  5LJ5 j;  3LWI A;  3OYY A;  2E6N A;  3M55 A;  2ARS A;  3ERR A;  4PHC A;  3A8O B;  1NJ1 A;  3URG A;  3QBY A;  5AYF A;  4C92 D;  4EMG A;  5CKE A;  2IVW A;  3UT1 A;  5GAO q;  5LJ5 f;  2ZT7 A;  1K8A U;  2QHT A;  2PME A;  3JCM g;  3M58 A;  2E64 A;  3L4G A;  2MAM A;  1N9R A;  3PCO B;  1M8V A;  2EQK A;  3HXV A;  3CBP A;  3KBG A;  3HY0 A;  1B8A A;  1VQP T;  4FIB A;  4L87 A;  4C8Q A;  2X4Y A;  1VQO A;  5CK9 A;  3PZC A;  3VQY A;  4BE0 A;  3DSQ A;  3BFM A;  5E3I A;  3W3S A;  2WSE E;  2E5Q A;  2LVM A;  4RMO A;  4M7A E;  2RHI A;  1X01 A;  4CS2 A;  3NFC A;  2ZIO A;  4P3P A;  4LDV A;  5GAM e;  2Y4Y A;  3M57 A;  5LJ3 f;  1M5Q 1;  3ME9 A;  4LVL A;  3G7Z A;  2R5M A;  1OZ2 A;  1KD1 C;  4XTX A;  4M77 A;  3JB9 I;  1HXD A;  1KQS A;  1KMN A;  2QEX A;  4JUV A;  2CS7 A;  3FDR A;  5LJ5 g;  3ZEH A;  2P0Q A;  4G85 A;  3X26 B;  4P75 C;  3TEG A;  1IRE B;  1U1T A;  2DTH A;  1WJR A;  2ZTG A;  4EMH A;  5GAN e;  3TCJ A;  2XHC A;  3X24 B;  1VQ6 A;  4ZN1 A;  4M7A D;  1USY A;  4BE2 A;  4HWO A;  3CCR A;  2XI9 A;  4EX5 A;  4XTZ A;  2BIV A;  2X4J A;  5K1X A;  2DIG A;  2DEQ A;  2R58 A;  3P8H A;  3V7C A;  1M4Z A;  3HFZ A;  1JBM A;  1L0W A;  3PTA A;  1WPY A;  3JCM h;  1SES A;  2FYK A;  2PVO B;  5GAO n;  1M1G A;  3E1S A;  4TQD A;  1NJ2 A;  3OBW A;  1JRI A;  3L42 A;  1PYS B;  3HXU A;  1WQW A;  2QHS A;  1VQ7 A;  2DXB A;  4YRP A;  3OYG A;  5GAN 3;  1U8R A;  5GAM j;  4EMK A;  5C51 B;  1WNL A;  3NEN A;  3G4S A;  2OTL A;  2LC4 A;  4J6W A;  5F5W A;  3R6O A;  2ALY B;  4KR2 A;  3DKM A;  3QXE B;  3HFO A;  4KUI A;  4P71 A;  3OSS C;  2VXF A;  4C0F A;  5LJ5 h;  2DU5 A;  4M78 B;  3MEA A;  3CMQ A;  3CCS T;  4E7L A;  3PFS A;  4LDU A;  4XAX B;  4YRO A;  2IG0 A;  4P74 C;  1VIF A;  2ZPH B;  2EJ9 A;  4XU1 A;  4UP8 A;  2PUK B;  1NZ9 A;  1AHJ B;  4MML A;  1PSE A;  2HQE A;  3HTZ A;  3GP8 A;  3QZ9 B;  2V8I A;  4P75 A;  1VIE A;  4IUQ A;  3TEH B;  1KOG A;  4HKE A;  1H64 1;  5LJ3 h;  4FT2 A;  3OYB A;  4X9C A;  5DLO A;  3REX A;  4X34 A;  4R55 A;  1G5I A;  2LQK A;  3VV0 A;  2CJA A;  1C0A A;  1X56 A;  3EAE A;  4C5E A;  2DAQ A;  3I56 T;  2LT1 A;  3MEW A;  3M4G A;  3PCO A;  2L3R A;  2AKW B;  5HGQ A;  1SER A;  3JCM J;  1ZHI A;  1VQM A;  3RKX A;  3QJY A;  4BWA A;  3NTI A;  3INZ A;  4M78 C;  1KC8 U;  1EOV A;  4P3O A;  4K86 A;  1YBY A;  2M16 A;  3CC2 T;  3GIB A;  4P5N A;  3FB9 A;  3CBM A;  3OW2 S;  1S72 A;  3RF1 A;  2M0O A;  1G5H A;  1WGS A;  2JNG A;  2PVD B;  4OMF B;  5GMK i;  3CCL T;  2CKK A;  3A8G B;  4C0D B;  5KH6 A;  2JZ2 A;  1I81 A;  2KK4 A;  4YRT A;  2RO0 A;  3L2W A;  4M7D A;  2RD1 A;  3CCM A;  4M75 G;  3A7A A;  3T9N A;  3C4S A;  1M90 C;  1VQ8 T;  4P74 A;  1QVG S;  4K87 A;  1BIB A;  3JAM E;  1FWZ A;  5A2Q E;  1EFW A;  3VUB A;  4YCV A;  2AHJ B;  4PKC C;  2Q7H A;  2LX9 A;  5KCH A;  4H2S A;  4M77 E;  4YRR A;  3MET A;  1U1S A;  2QHV A;  2JVV A;  1PYS A;  4QVC A;  2OAU A;  4J83 A;  3JCM b;  3OS2 A;  1BBU A;  3V8J A;  4P73 A;  5CO7 A;  1VQN T;  1RIQ A;  4PNO A;  4J7I A;  4C0D C;  2DDZ A;  2B8A A;  4DOW A;  2RI5 A;  4YRC A;  3HHT B;  2K3Y A;  3CME T;  12AS A;  3MCA B;  3REU A;  1VQL A;  2K5F A;  2VYT A;  4ZGJ B;  4M77 D;  3SFM A;  2ZPE B;  3PNW C;  3S3M A;  1WQ7 A;  3E9H A;  2GFA A;  1BI1 A;  2DTI A;  2P0K A;  5GAN 2;  1VQK T;  3RKW A;  1M1K U;  3GNG A;  3P8B B;  3ZFJ A;  4E7I A;  1VQ9 T;  1QVF A;  5A0G A;  2EJF A;  1N8R U;  4YCW A;  5FU6 B;  4N4I A;  3L2U A;  2XDB A;  5D6X A;  2OTJ T;  4EDU A;  3SB2 A;  3HL8 A;  2YLC A;  3M53 A;  3LWH A;  3MO8 A;  1E22 A;  1VQ5 A;  4JS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...