2E10A

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutation r51a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
217
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGESPEGGLWLSIVLSPKKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin Protein Ligase
publication title Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 66
structure length 217
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e10A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e10A01
1HK9A 2DZCA 2E41A 1I8FA 4HVCA 3RESA 4NL2A 2YHTA 4TQDA 3RKYA 2DQ0A 3PCOA 3A74A 4C8QA 2C7IA 5GAOq 1NNHA 5GMKl 2C8MA 4TQFA 3CMQA 2E65A 4YRJA 1B70B 2Y90A 4C8QE 5GAOp 1SESA 4XU3A 1Z7NA 3L1AA 4M7AD 5LJ5d 4TVAB 5GANf 4M78C 3QO8A 1B8AA 3JCMX 4M75A 4EX5A 4TVWA 4UP8A 3MEYA 3TEHB 3VQVA 4P72A 3HRKA 1YFRA 4RCBA 4M75E 4XU2A 1LYLA 3SB2A 4C92B 3AHUA 2I4NA 5GMKe 2ZTGA 3P8VA 5GAN7 4YROA 4K88A 5GANe 5GAN6 5CAIA 2EL9A 3BDUA 3QUIA 2ODRC 4YRSA 4QVCA 4HA8A 4BW9A 1SETA 3UGTA 2DU7A 1MGQA 2Q5HA 3MF1A 2I4LA 1E22A 2ZT5A 4RDXA 4QVDA 4YRPA 4P73C 1EIYA 3A5YA 2AMCB 1H4QA 4CH4A 2ZR2A 1E1OA 4YDQA 1ASZA 3JCMg 4NL3A 2E3CA 3HFVA 2ZIMA 2AKWA 1YFTA 2J3LA 3SWNC 4M7AC 1NJ1A 3HFZA 2VXEA 4M78G 4X9CA 3BFMA 3JB9G 1N9WA 5GAOl 5C52B 1EOVA 2I4MA 4PHCA 4M75F 3BW1A 2CIMA 3M4GA 2ZNIA 5LJ3h 2RD1A 1HC7A 4RMFA 4XTXA 3A32A 4NCXA 1ADYA 5DY9A 3RKXA 5GMKj 3QHSA 2IY5B 3V7CA 4DQ2A 3WQZA 3JB9J 4P75C 3JB9H 2RHQB 4XTZA 5GANj 1U1TA 4H2SA 1B7YA 4M7AA 5KNNA 3RERA 3NETA 3HFNA 2RHSA 2ZZEA 4YCVA 4M7AE 4A54A 4M78D 4X9DA 3JB9D 3A31A 3NELA 3R07A 3LC0A 4A53A 1E24A 11ASA 4YCUA 4XTWA 3E9HA 2VXFA 2ZZFA 3JCMQ 4EMGA 1PYSB 1NJ2A 4JLIA 2CGHA 1H4SA 1NJ8A 2DJZA 1I81A 3HTZA 5E3IA 4M7AG 4M77B 1NJ6A 4P75A 4RQEA 4N0AC 3VU3C 5GMKi 2ZZGA 3PCOB 4M7DC 4XEMA 1IL2A 4C8QB 2RA2A 4XTUA 3BJUA 1SRYA 3UGQA 4E51A 4ZIBA 2ARUA 4HT8A 5GAN8 4H2XA 4YRFA 2EAYA 4MMLA 3I7FA 3KFUA 3JCMf 3A7RA 4M75B 5GMKh 3RGLA 2P5IA 1JJCA 5GANh 1KOGA 4XU0A 2ZCEA 3DSQA 4H2UA 1BBWA 3LSSA 4K86A 1GGMA 4KR3A 5GAMf 4EO4A 1EFWA 4YREA 4H2TA 1ASYA 3V8KA 2ZT7A 4N0AA 3JCMe 3RUXA 4Y91A 2QHVA 3L4GA 4P3OA 2ALYA 3NENA 4M7AF 4UP9A 4XEOA 1C0AA 1M8VA 1N9SA 1WQ7A 4F7UE 2EJ9A 4PJOG 5GAMe 4P71C 1EIYB 4YYEA 5GAOm 2Q7GA 4HWOA 1NYQA 5LJ3j 1JRIA 4H2WA 4G84A 3RL6A 3QNEA 3V7RA 3JCMc 4M7DG 2J3MA 1KMNA 4F7UG 4EMKB 4HT9A 2AKWB 3L2ZA 4M78A 3HSBA 4KR2A 4P3PA 3HFZB 1Z7MA 4M78E 3HXZA 5LJ5f 3BY7A 3W3SA 4TVAA 3JCMV 5GAN4 2K57A 2CJAA 4P71A 3RKWA 3NEMA 3PZCA 3TEHA 4PJOD 2CJBA 1W66A 4YP0A 1I5LA 2YLCA 4MMKA 4J6WA 1H641 2PMEA 3TEGA 2VC8A 5LJ5e 1X2HA 2ARTA 2E64A 4PNOA 1BIAA 5GAN2 1B76A 4M7DD 2ZT6A 1LOJA 3RIRA 5LJ3d 2ZIOA 4P73A 4HWSA 4M77D 4M7AB 3FJPA 1E1TA 4F7UF 4RCCA 2RHSB 3REUA 4RQFA 3M4PA 3FB9A 4C8QD 2FYKA 1WLEA 5GAMj 3P8YA 3UH0A 2YLBA 3IALA 2E5AA 4PG3A 3RF1A 3SWNA 5GAOr 4YCWA 1J5WA 3REXA 1KQ1A 2DXUA 2EWNA 5GANg 2DU5A 4TTVA 2ZT8A 4JUVA 3ICAA 3IKMB 4UPAA 3G1ZA 2I4OA 3HXXA 1EQRA 4M78F 3LSQA 3IKLA 2DKGA 3JB9F 3UFGA 4J5YA 4UP7A 3VBBA 4PJOC 4NOYA 4H2XB 1X01A 1ADJA 4K87A 4DPGA 1Y96A 4WF2A 3OD1A 1JJCB 1HXDA 3GIBA 4Q6GA 4C92D 1SERA 3JCMh 1TH7A 3M4QA 3RACA 3A7AA 5GAN3 2RM4A 3EFRA 5K1PA 2ZGWA 4M77C 5LJ5j 4JRKA 4C8QC 5GAMh 2DTIA 3L4GB 2XGTA 4O2DA 4YPFA 2ALYB 5GANd 5K1XA 3HFOA 2DXTA 4YRQA 4PJOA 2DVEA 2JN0A 4H2VA 3HXWA 3HY0A 2DTHA 4TVYA 4PJOE 1YB3A 3EFSA 1NYRA 1NJ5A 4P72C 1WNLA 1B34A 4WJ3M 4M7DA 4F7UA 2FB7A 3VQXA 4XU1A 3JCMJ 5F5WA 4HWRA 4M77A 3JCMP 4M7DE 4YRIA 3V8JA 3JCMb 1X55A 2QHTA 1LNXA 1WPYA 4M77E 4M78B 2DEQA 1D3BA 4Q15A 5C53B 1KQ2A 1JBMA 2E1HA 2QHSA 5LJ3g 1H4TA 4C92C 4H2YA 2I2LA 3HXUA 3HXVA 3HY1A 2ZNJA 3QSUA 1WQWA 5LJ5h 2PMFA 5C51B 4M77G 4P74C 4CS2A 4LNSA 2Q7EA 1BIBA 3QO3A 3A5ZA 4C8QG 1G5HA 1B70A 1YFSA 4YRNA 4EMKC 4ZTZB 2QHUA 4WI1A 4CH3A 2P0LA 1G5IA 4YRRA 2CJ9A 1YCYA 4M75G 1HTTA 4PJOF 3QO7A 1H4VB 2DQ3A 4C92A 4HWPA 4YRGA 4CH6A 2EJGA 1N9RA 3IG2A 4YRLA 4C92E 1USYC 2RB6A 4KQEA 4P74A 1B7YB 2QTXA 3SWNB 4V2SA 1EVLA 2G4CA 4M7DF 3HRIA 1RIQA 3A7UA 4YRMA 1U1SA 4WJ4A 4M77F 4EMKA 1YGBA 3JCMW 3QTCA 2DTOA 2AMCA 4X5OA 4C92G 1BBUA 4C8QF 5GAMg 1QF6A 5ELNA 2Q7HA 1G51A 4P3NA 4M75D 2ZR3A 4YRTA 1FYFA 4H02A 1Y96B 2XTIA 3QO5A 1I4K1 2Q5IA 4G85A 1USYA 2DZ9A 2ARSA 4CH5A 5GAOn 4OLFA 2HNIA 3FIFA 1X56A 3ERRA 5LJ3f 4XQ3A 5ELOA 3JB9I 4CS3A 3JCMd 1M5Q1 4HWTA 4OP0A 4ZTUB 3V8LA 1ATIA 4J15A 4XTYA 4PJOB 4YRCA 1WU7A 2ZINA 5GMKm 1KMMA 2EJFA 3VQYA 4C92F 1WYDA 3P8TA 2IY5A 3MF2A 5GAMd 5LJ3e 2RHQA 3VQWA 4XTVA 4J6XA 3E9IA 3V7SA 1X54A 4YRKA 5LJ5g 4AH6A 4J6YA 1B34B 1LJOA 5I21A 4M7DB 4F7UB 2ZXFA 4BWAA 1EVKA 5GAN5 3PGGA 4JRIA 3HXYA 2ODRD 4L87A 1L0WA 5HGQA 4CS4A 4TWAA 1VQZA 4M75C 1X2GA 2DDZA 1D3BB 3TUPA 4EMHA 2E10A 3INZA 12ASA 1PYSA 1QE0A
chains in the Genus database with same CATH superfamily
2DL5A 3G4SA 2LX9A 4R0KA 1G8XA 2DNUA 2YHTA 5D6XA 3G6ET 3RKYA 1O75A 2DQ0A 2JOYA 1PD0A 1OPLA 1WFWA 3EG0A 3M5AA 3OQ5A 3WVEB 5GAOq 1Q86U 2OTLQ 2C8MA 2KXDA 3A5ZB 4YRJA 1AZEA 3FLGA 1B70B 2HQXA 2BE7D 1RI0A 3SHWA 4CC2A 2GFAA 2HDAA 3QO8A 1B8AA 4UP8A 2ZCFB 1VQ8T 4R55A 1F1BB 2NUZA 3MP1A 1A0NB 4XU2A 1VQPT 2CZ0B 1KD1C 2YT6A 3SB2A 2H8HA 1B7TA 3P8VA 4ZGJB 3F70A 4C5EA 1GFCA 1AOJA 1WYXA 4K88A 1K0XA 1YHQQ 1QVFS 4YRSA 4HA8A 2DIGA 1E6HA 1UUEA 4DBHA 1SETA 3UGTA 1G3TA 2QEXA 2Q5HA 2I4LA 1YP5A 3S3MA 2ZT5A 4RDXA 2DBMA 3LH0A 3CPWA 3A5YA 2AMCB 1H4QA 4CH4A 4RTUA 2M51A 4LDWA 5A2QE 2FPEA 2GF7A 4NL3A 3HFVA 1SEMA 2K5FA 2JNGA 5DLOA 1YFTA 3VS0A 1KC8R 1N5ZA 3DKMA 2K3XA 2CH4A 3BFMA 4X9CA 4DOVA 1N9WA 2I4MA 2VV5A 3MHXA 3G6EA 2LQ8A 4A4FA 2RD1A 1K4US 2EQUA 2AKKA 1ADYA 3DLLA 1M90U 1D1AA 3QHSA 2VGMA 2IY5B 2A08A 3EGDB 3CMEQ 2VWFA 3H6ZA 3LH5A 3JB9J 3WQZA 3JB9H 3VS3A 1VQ8A 3JAME 4H2SA 1AVZC 1B7YA 3PVLA 1VQPA 1Y7XA 5IHNA 5FRMA 3EH1A 2RHSA 5FU7C 1D1BA 4M78D 3OYKA 2CT4A 3LC0A 4A53A 11ASA 3E9HA 2LCSA 3JCMQ 1XNIA 2M0YA 1X2KA 4JLIA 1NJ2A 1H4SA 3DB4A 2DJZA 3GF5A 2DL4A 4E7IA 4M77B 1NJ6A 3PMIA 2GNCA 4FT4A 3UPUA 2ZZGA 4M7DC 3CMAQ 1IL2A 4XTUA 3ULRB 2M02A 3A98A 5KYUA 4ZIBA 2DL3A 3GNGA 1WJRA 4MMLA 2L8DA 5IXBA 1OX9A 1OEBA 3A7RA 3EHRA 2MAMA 3RMQA 3CC7T 1MV0B 2P5IA 3CCST 4OB2B 1UGQB 1CKBA 1KOGA 3JSCA 4XU0A 2ZCEA 2GCXA 4BD3A 1Q7YC 1YFNA 1GGMA 5GAMf 4RTZA 1GL5A 4H2TA 1VOMA 1UDLA 1VQ7T 2MIOA 3C94A 3G4SQ 1ZLMA 4OGEA 4UP9A 5L8RE 4XEOA 1C0AA 1M8VA 1YI2T 1AWJA 3C4SA 1NJIC 2YUQA 1K9MR 1W1FA 4QT7A 1PSEA 1BI3A 4ESRA 3QJYA 1H3HA 4HWOA 3TCJA 5AYFA 1UHFA 3UA7A 4H2WA 1U8RA 3QNEA 4C5GA 1ZSZC 4F7UG 2YXYA 3PIOA 3CQTA 1P92A 4D6WA 4J9DA 2H3JA 1W2BS 2OI3A 4M78E 2ROLA 4FSSA 1RABB 3BY7A 3W3SA 2ZPHB 4TVAA 1M1KC 3NEMA 3OYFA 2QEXQ 2XU8A 2JMCA 1W66A 1KSWA 3TSWA 1QCOA 1S72A 2L3PA 1R0BG 2EKOA 2VB6A 4J6WA 1B3QA 5KYYA 1SKUB 1TUDA 2E64A 1BIAA 4L6V5 4J83A 3CCSA 3GPLA 1OQKA 2KRNA 1RLPC 4BACA 5HK0A 1N8RC 4OMLA 2RHSB 1VUBA 3M4PA 3BE3A 3FB9A 1VQ7A 4C8QD 1Q7YU 3M55A 4JPBW 1WLEA 4KH1B 2EPDA 3OBYA 2VYTA 4PL6A 2MPXC 3G6EQ 2K3BA 2RN8A 1YI2A 4DEXA 4YCWA 1X43A 2DXUA 4TTVA 3O5ZA 2L5QA 3ICAA 3LW5E 4UPAA 2I4OA 1EQRA 4M78F 2DKGA 3UFGA 4DOWA 4J5YA 1VQ8Q 5KYUB 3M59A 4NOYA 1RAFB 1M9SA 1VQPQ 2RHUA 4A4GA 3QJ6A 4DPGA 2IPOB 3CC2T 4BDYA 4OMQA 4OB3B 2AIRB 4F16A 4GLMA 3M4QA 1RAGB 1YJWT 3GBQA 3H9NA 4CRIA 2RM4A 5K1PA 2ZGWA 5LJ5j 3CD6T 1OPKA 1UG1A 1XJWB 1M1KU 2EKHA 4C8QC 7AT1B 5GAMh 2KDSA 4YPFA 5GANd 1KJWA 3HFOA 2DXTA 4PJOA 1QVGA 1KQSA 2CP5A 1ABOA 1NJ5A 2COYA 3OSSC 4F04B 1XQHA 3S6WA 1WNLA 1EX4A 3I5SA 4HVVA 4M7DA 4HWRA 1Y57A 3OS0A 1EIFA 4HVUA 1MMNA 1WDXA 4LE9A 1KFZA 3JCMb 3M0UA 3PTAA 1WPYA 3P8BB 1KQ2A 2DEUA 1SSHA 2CREA 2E1HA 1UE9A 2RJEA 3GOXA 2JVVA 1K8AC 1Q95G 2KYBA 3QSUA 2PMFA 2JS0A 2XDBA 4EPCA 4FW1A 3CXCS 1Q81C 1NM7A 1BIBA 3FDRA 5J3BA 1QVFP 1DJ7B 2I0NA 2IVWA 3WVDB 5KYYB 3C95A 3CC2A 1SG5A 2L3RA 2ZPGB 1BI1A 1G5IA 4YRRA 2CJ9A 4M75G 1IB8A 5L23A 2LRQA 3PT9A 2OX7A 3CD6A 2DQ3A 2FHDA 2E6NA 1VQ6T 2EJGA 4YRLA 4C0GA 2LQWA 2HL3A 1NG2A 1VQKA 2CS7A 2CYZB 1LCKA 2G4CA 3HRIA 2M9UA 2H3EB 5CO7A 5AT1B 1HSQA 3OYAA 1OI1A 4EMKA 1M1FA 3JCMW 4E47A 1S72Q 3OY9A 4X5OA 1BBUA 1FWZA 4C8QF 5C0MA 1SPKA 3OMCA 1QF6A 5ELNA 2ABLA 1G51A 1PKSA 2V8JA 2DD5A 2P4TA 2K5IA 2X35A 2F5TX 3SDZA 1NYFA 1T0JA 4ZGDB 1VQ7Q 2XG8D 2XTIA 2QASA 4AFZC 2LT1A 3HTRA 2DZ9A 4Y28E 4CH5A 2LCCA 1UGSB 2J6KA 2FZCB 3CCRT 1R77A 1T3LA 3HRSA 2E5QA 2FZGB 2AZVA 2MI6A 2RJFA 4JS5A 1YI2Q 3ERRA 3I5RA 2X9HA 3EG1A 3MEUA 1TXQA 3CC4Q 1YIJQ 2J6OA 3JCMd 1T3SA 1PNJA 3NTKA 4PJOB 4CC3A 2ZINA 4J7FA 2RI2A 3VQYA 3CCLT 2JM8A 3J81E 2DYBA 2YUNA 3V7SA 1X69A 5LJ5g 3H0IA 1TU0B 4J6YA 2WSFE 4M7DB 1FYNA 4AG2C 2O31A 1OZ2A 2ZXFA 4JS4A 2FO0A 2MCNA 1LVKA 5GAN5 3EH2A 1VQ6A 2EFIA 2VGNA 2Z0WA 3HXYA 1N8RR 4L87A 5HGQA 4CS4A 3R6NA 1VQZA 1C1AA 4PJNA 4QW2A 1C6VX 1XOVA 2CP3A 1V1CA 3RESA 5GJWB 1U5SA 4TQDA 1E6GA 1Q82R 1W70A 4WCIA 4FCYA 4C8QA 1GCPA 2ROTA 3OW2A 3VS5A 5GMKl 1NNHA 4LVJA 4JRPA 2HEQA 3PNWC 2QDYB 5HCKA 3X28B 1Z9QA 3M0SA 1I0CA 3JCMX 1NE8A 4TVWA 3TEHB 1AHJB 3VQVA 3HRKA 1YFRA 3ER0A 3CCRA 1LYLA 2OAUA 2JTFA 4A4HA 4CI0C 2EYWA 5GMKe 2ZTGA 4DEYA 2IG0A 1UJYA 5D7UA 5GANe 1YWOA 5CAIA 2EL9A 1BBZA 3QUIA 4QVCA 2KNBB 4BW9A 4JRQA 2PVDB 1MGQA 4A4KA 3CCLA 1W2BP 3QWXX 4B9WA 2LC4A 4N4HA 4BI4A 4J9BA 1ZUUA 2RHZA 4P73C 1EIYA 4AFQC 3GP8A 2X51A 4MZPA 3CC2Q 4JJDA 4A63B 3QZ9B 4OMNA 1G3YA 4OVAA 2QAZA 2C06A 3JCMg 1GXIE 3CD6Q 2KGTA 2LZ6B 4FYYB 2J3LA 3VRYA 1Q86C 2VXEA 1YNZA 3KUFA 2JS2A 2NYSA 1VQKQ 3VKIA 1ZUKA 1R0CB 2BZXA 4PHCA 1OYXA 1K8AR 4RMFA 1MHNA 2ATCB 2YWWA 2EQKA 2KY9A 2RH2A 3M9QA 4NCXA 4MDWA 3OA6A 3TQ7P 1Y0MA 3RKXA 2XKOC 4DQ2A 1Z9ZA 2O2OA 2GBQA 4VUBA 1JJ2S 3RMSA 4HXJA 5KNNA 2CUDA 3HFNA 2V1QA 2DD4A 2RNAA 4MZMA 1KC8U 4X9DA 4BE0A 3JB9D 3CCET 2DL7A 1VQ9T 2PQWA 3OB9A 3LWHA 4DBRA 2J05A 2VXFA 1PM3A 2HKNA 4ZTJA 4HKEA 2JW4A 1I81A 1FMVA 3H0HA 1X75C 4P75A 4RQEA 1K1ZA 4XEMA 4C8QB 3BJUA 3MP8A 1SRYA 2ZZDA 4HT8A 1WXBA 1HYOA 3KFUA 5IXFA 2X4YA 4OB0B 2KQWA 3RGLA 2RHIA 1UJ0A 4J9EA 3D7SB 1VQ6Q 2XIDA 4GBQA 3LX7A 1WLPB 2LJ0A 4QQGA 3DSQA 1M90C 4K86A 4EO4A 3X24B 2DRMA 1ASYA 4KBMB 2EQMA 3V8KA 2BUDA 3JCMe 2KBTA 2L2PA 4P3OA 1YN8A 4HCKA 4B6MA 2ALYA 1RLQC 5I2MA 1VIFA 2HMAA 1WQ7A 4F7UE 1EIYB 2YUPA 2M1HA 5LJ3j 2KT1A 2MK5A 1QKWA 1UECA 4G84A 4KT0E 1YJNT 3CXCP 4A4EA 4PFOA 3V7RA 3CCEA 2LJ1A 1VQ9A 1KMNA 1ZBXA 3CCRQ 1KHIA 3OYMA 4HT9A 3QXEB 3L2ZA 4P5NA 3QYGB 4JZ4A 1Z7MA 3QZ5B 4RKUE 2PU9B 1RAHB 3NGPA 1GRIA 1UTIA 4KGVB 3JCMV 4P71A 3RKWA 1M2OA 2OTJQ 2EQJA 3CCLQ 4PJOD 5A0LA 3IQLA 2FEIA 3CCQT 3A1PA 4MDXA 1ZQ1A 3L42A 2EIFA 4D8DA 2KYMA 4BI8B 4BUGA 2DXBA 2PMEA 2VC8A 5CKFA 1IHWA 1WHMA 2CDTA 4PNOA 5GAN2 1VQ5T 4M7DD 2A8EA 1VQNT 2PVGB 4ZTFA 5LJ3d 4P73A 2DETA 3FJPA 1K9AA 3VJPA 4F7UF 2P84A 1QWEA 3REUA 3A8OB 2E70A 3DLMA 4PJMA 5GAMj 4HCZA 1WHHA 2CUBA 2BE9B 1OV3A 3OSVA 3IALA 2E5AA 4PG3A 2K5LA 3LLRA 2O9VA 1VQMT 4JUVA 5I2SA 3IKMB 4BE2A 1AWOA 4HCCA 1QW1A 5HY6A 4MZTA 2K9GA 1M4ZA 3IKLA 3JB9F 1YJNA 4PJOC 3NFCA 1ADJA 5CKEA 2MF2A 2K4YA 5KCHA 1Y96A 2O01E 4J9FA 4LDUA 4JDSA 3GIBA 2A28A 1KHCA 1O9SA 1SERA 2YRCA 4FYWB 2B8AA 2FG0A 1UGPB 3OYJA 2F2VA 4Z02A 1Q86R 2HL5C 2PTKA 2RPNA 4QQ6A 4L59A 1PCXA 3UDCA 3CCQA 2BIVA 4WTOB 2ALYB 4YRQA 2FVUA 2AHJB 3E19A 4H2VA 1MNDA 3HY0A 2XICA 1VQ5A 1VYUA 1TWBA 1VQNA 4TVYA 4JLGA 4PJOE 1YB3A 1NYRA 4JJCA 4IKFA 3EG2A 4XK8E 2CT3A 4WJ3M 2RK2A 4F7UA 2FB7A 1SRLA 4XU1A 4BB7A 4M7DE 3OYHA 3V8JA 2GFUA 1LNXA 4LD6A 4KULA 2BTTA 4E7ZA 4KUIA 4Q15A 2LDMA 4FYVB 2K2VA 4UC4A 1PC0A 2MMPA 5EG2A 2QHSA 2D6FA 2MOXA 2EYYA 5LJ3g 1VQMA 4H2YA 2I2LA 6AT1B 3E9FA 5GJVB 5C6SA 2HBPA 4LNSA 3QO3A 5A0GA 1W6XA 3ZEHA 2B86A 1YFSA 4YRNA 4EMKC 2RJDA 4J9CA 1VQ9Q 2RO0A 1D1CA 3E1SA 1X6GA 4PJOF 1H4VB 5HKCA 3H41A 1M27C 4X34A 2DERA 4YRGA 2QQBA 4CH6A 1N6AA 3CBMA 1ZA2B 1FXXA 3CC7A 2YRVA 2RB6A 4AG1C 4KQEA 1B7YB 4E7LA 1EVLA 4M7DF 3PVQA 1YCSB 1RIQA 5CIUA 1U1SA 1RUWA 4WJ4A 1YGBA 2M16A 3VYGA 1IREB 1WXTA 2M0OA 2Y4XA 1KD1R 4K11A 1K76A 5GAMg 4E7HA 2P0PA 4RTYA 4P3NA 4YRTA 4YTLA 2XD0A 4H02A 3QKJA 1Y96B 1WHGA 1I4K1 1ZSGA 2QQRA 3VS4A 2Y4YA 1USYA 2DE0X 2NLUA 2X4XA 2ARSA 1IO6A 1JJ2P 3S3NA 2HNIA 1X56A 1I07A 4XQ3A 5CKDA 2HZYA 2EGCA 3JB9I 5CKHA 2BKDN 5KYNA 2LQNA 2QQ9A 4XTYA 4YRCA 5DM7R 1WU7A 1KMMA 4BY6B 3OS1A 2FPDA 2O9SA 2EYZA 2NS6A 3MF2A 5LJ3e 4AH6A 2CSQA 3A8HB 1GBQA 2D9TA 4F7UB 3G7ZA 2X4JA 4N4IA 1H92A 1QVFA 4IIMA 1ARKA 4ZN1A 1L0WA 2SEMA 1X2GA 4QKUA 1NLPC 5ECAA 2DDZA 4KH0B 1N27A 2E10A 3CCQQ 12ASA 1QE0A 1HK9A 2DZCA 4R56A 2AT1B 3NTHA 5J39A 2O4XA 4PKCC 1VQ5Q 1QP3A 5I11A 2LNVA 4ELZC 1VQNQ 3PCOA 2C7IA 2XHCA 1WXUA 2E65A 4XAXB 1MMAA 2Y90A 4C8QE 5GAOp 1SESA 4XU3A 1Z7NA 5LJ5d 4TVAB 5GANf 4EX5A 3M0TA 3J7AF 4M75A 4N4GA 1WZOA 4PFZA 4RCBA 1MNEA 3M0PA 1B07A 2I4NA 3CCJT 1FMKA 2YRDA 5GAN7 1K73C 1VQMQ 5KCOA 4LDVA 1YJWA 2DU7A 1PSFA 1X27A 2JZ2A 1Q82U 2RJCA 1E22A 3QDRB 4LD9K 1ABQA 1RAIB 4Q5WA 4Y92A 1RAAB 1SHGA 4RTVA 1X6OA 1Q7YR 2NUPA 3JV3A 2NWMA 4FYXB 4C0FA 2DA9A 4IUUA 3REBB 5KYXA 1ASZA 3HL8A 3EG3A 3OYLA 3ZL7C 5CQXA 3X20B 2KRMA 3SWNC 4FT2A 1FMWA 1NJIR 1NJ1A 3HFZA 4M78G 1UFFA 3CC7Q 2LMJA 3CCSQ 4IUPA 1NPRA 1AD5A 2EGAA 5CVIA 5C52B 1D09B 2KMTA 1YITT 1KIKA 3H0FA 2KE9A 1ZX6A 4LVKA 3BW1A 4B9XA 2JJ9A 1EFNA 1HC7A 4XTXA 3MP6A 2EYQA 3E2UA 4DA4A 2J7IA 4P75C 3M56A 1U1TA 4M7AA 3NETA 2HBWA 1M1KR 2LVMA 3CPWS 3CCJA 3CBOA 4A54A 1YHQT 1UHCA 4YCUA 3HPWA 1WA7A 1D0ZA 1K73U 2ZZFA 4EMGA 2CGHA 2A0FB 5E3IA 3FRNA 3VV0A 4M7AG 2O4XB 5GMKi 1QCNA 2PNIA 1OU8A 3PCOB 2L3QA 2RA2A 3MPUB 2DILA 4LUDA 1RI9A 3UGQA 4E51A 2DLPA 2HKQB 3N5BB 4YRFA 3I7FA 2K2MA 3H8ZA 1W2BA 3JCMf 1SF9A 2RI3A 5HK3A 4M75B 5GMKh 3ME9A 2JT4A 3RR6A 2FL7A 2RQRA 1U06A 3U23A 5GANh 4H2UA 1BBWA 4KR3A 4BI3A 1EFWA 1YITA 2V1RA 3S3OA 4YREA 2KT8A 3I56T 1AT1B 1AWWA 2PUOB 4KGZB 2ZT7A 4N0AA 3SD4A 3NENA 3ZBDA 2JM9A 1NPPA 2LJ3A 3NPFA 4PK4A 1JXMA 1N9SA 1KC8C 1MV3A 4J9HA 2EJ9A 1VYTA 4P71C 3VUZA 4LNPA 5GAOm 2NUPB 2DIQA 1TUGB 3JRZA 5FU6C 3RL6A 5KYXB 1YHQA 1WHJA 5M9OA 2J3MA 2RF0A 4EMKB 5CCAA 3VRZA 4KR2A 3EFOA 1JEGA 3HFZB 2QGFB 3OYIA 3VS2A 5GAN4 1YJWQ 3A8LB 2CJAA 3X26B 2DPPB 4YP0A 1K0SA 2ED0A 1I5LA 2QTVA 3RNJA 1NYGA 2EBPA 1QWFA 1H641 3C12A 2E3IA 3TEGA 5LJ5e 1X2HA 2ARTA 1B76A 1BYMA 2ZT6A 3RIRA 2CP7A 4E7JA 2ZIOA 4HWSA 4M7AB 1E1TA 4EIKA 4RQFA 2LT4A 3I56A 2FYKA 2NUTA 1Q81R 1RADB 1KG1A 1IRXA 3UH0A 2YLBA 4O5VA 5D6WA 3SWNA 3OYGA 3I9QA 1J5WA 3FC3A 2DU5A 3HXXA 1NEBA 3LSQA 2ZPBB 1GCQA 1QLYA 1QMCA 2F5KA 4UP7A 3VBBA 4OF1A 4BY6C 4IUVA 4K87A 3WXMB 1BCMA 1S1NA 1QCFA 3CCJQ 4WF2A 1ACMB 2VUBA 2RQUA 2DYIA 3JCMh 4FSXA 1TH7A 2CKKA 5I22A 5CR2A 4ANJA 1M30A 3I55T 4KGXB 1X2QA 2QXFA 5GAN3 2WSEE 2WACA 3CXCA 3HRUA 3R6OA 2X3XD 1QQJA 2J06A 4E6RA 3P8DA 1G5VA 3QIIA 2XGTA 4O2DA 3HRTA 2JTEA 4J8OA 1AEYA 2JN0A 1NEGA 1ZBJA 3EFSA 2J6FA 4P72C 2KK4A 1WIEA 2FRYA 4CC7A 2DAQA 2SRCA 1M3BA 3QYHB 2ZPEB 1JB0E 4M77A 3G71T 4II1A 3JCMP 4Z8AA 1AZGB 2ESWA 4EDUA 4F14A 1X55A 2QHTA 8AT1B 2OAWA 1YITQ 4OB1B 5IHKA 2DEQA 3EFOB 5C53B 2V8KA 1OX8A 5LL6S 1UGVA 3NHNA 5IN1A 5J26A 1H4TA 2QI2A 2RHYA 3EHQA 1XTDA 2A3LA 2ZNJA 1WQWA 1QKXA 4M77G 4CS2A 3CCVT 4JZ3A 5IT9E 1WHLA 2LP5A 3OYEA 1OZ3A 1UB4A 3O8VA 4WI1A 4RG8A 4HVWA 1Y71A 1QVGS 1Y07A 3I55A 4RMOA 2RQTA 3OS2A 1KQSS 1K9MU 1HTTA 1VQOT 2CZ6B 2D1XA 4FW2A 4IUQA 4C92A 2NUTB 2A36A 5FWBA 4HWPA 1U3OA 1N9RA 3PMTA 2CP0A 3M57A 1USYC 1YWPA 4P74A 3SWNB 2KI7A 4V2SA 3MQZA 3UF4A 2K6DA 2MWOA 2K3YA 2KRSA 2YSQA 1OULA 4D8KA 5CKBA 2OJ2A 4C92G 2LTOA 2GTJA 1NLOC 2R5MA 3P8HA 3G71A 3OMGA 4M75D 2QA4T 2E12A 1FYFA 2COZA 3OYCA 2GQVA 3QO5A 2Q5IA 3I56Q 4GLKA 3LGLA 2GGRA 1PG5B 2P4RA 5GAOn 9ATCB 3TU4K 3CPWP 5LJ3f 5ELOA 4CS3A 3CCVA 1ZA1B 1HJDA 2FPFA 4ZTUB 4OP0A 3V8LA 1ATIA 4J15A 2RQWA 1NBEB 1T0HA 1KD1U 5GMKm 2R58A 5IHIA 2GTOA 3TREA 2G3RA 5GAMd 3VQWA 1BKBA 2RHQA 4XTVA 2ECZA 2DBKA 1BB9A 5I21A 1VQOA 4C0ZA 1EVKA 1G83A 3PGGA 3CCUT 2DRKA 1TTHB 2ODRD 5KH6A 3UWNA 4TWAA 4M75C 2KROA 1YJ9T 3T9NA 2LX7A 1S72T 2KAFA 1PYSA 2HD0A 2E41A 3NTIA 1I8FA 2W0ZA 4HVCA 2ED1A 1AWXA 4NL2A 1J3TA 4J9GA 2BZ8A 3GLXA 1GFDA 4E2FB 2R5AA 3A74A 2JMAA 3M53A 2F2XA 2EQIA 2QA4A 4TQFA 3CMQA 2RK1A 2V26A 4KRTA 1W4SA 3X25B 3URGA 3L1AA 4M7AD 3PFSA 1ZUYA 4M78C 3VS6A 1WHKA 3MEYA 4HT4A 2JUFA 4P72A 4M75E 2VVKA 4J7IA 3RDVA 5FU6B 4LN2A 4C92B 1YIJT 3CC4T 3AHUA 2QQSA 3RBBB 1PHTA 3VS1A 4C0DC 2D8JA 4YROA 3VS7A 5GAN6 2L89A 3BDUA 3CCEQ 3META 2ODRC 2QG9B 3M0RA 1VQLT 4Z89A 5D6YA 2RI5A 3MF1A 1QP2A 4PJLA 1JJ2A 4PJJA 2KXCA 4NS5A 3THKA 2QQAA 4QVDA 4YRPA 2IIMA 1G2BA 3NMZC 1M90R 1G3SA 2ZR2A 3QPHA 3TVTA 1E1OA 3ZFJA 3CCUA 4YDQA 3I55Q 3M0QA 2E3CA 1BI0A 2ZIMA 3OW2S 2XMFA 2E4HA 2KVQG 2G6FX 5IAYA 1YJ9A 2AKWA 3OYNA 4M7AC 3JB9G 2ZPFB 5GAOl 1EOVA 3I35A 4PLLA 4LVLA 4M75F 2CIMA 4IIOA 3M4GA 2ZNIA 5LJ3h 1OOTA 3A32A 4AFUC 1D0XA 4E7KA 3REAB 5DY9A 3M58A 1BI2A 3A8GB 1IGQA 1HD3A 2E3HA 2HQEA 4DBFA 5GMKj 4BE1A 3V7CA 3G71Q 2CP6A 4AFSC 2RHQB 4XTZA 5GANj 4F17A 3CCMT 4TVRA 3RERA 2YUOA 2CSIA 1JXOA 3MJXA 2L3SA 2HQHA 1YIJA 2VASA 1G3WA 2F69A 1Q82C 3CC4A 2ZZEA 4M7AE 1NJIU 1WGSA 3A31A 2R57A 1YJNQ 1BU1A 2CZ7B 3NELA 3R07A 1E24A 4LVMA 2DJQA 2RMOA 4XTWA 1TS9A 1CKAA 1M3CA 1VQLA 5FROA 2K79A 2KSSA 3C0CA 1PYSB 1V29B 3CCVQ 1NJ8A 2HSEB 3HTZA 3LWIA 2E6ZA 2EW3A 5KE2A 1IXDA 8ATCB 1RL2A 3Q1JA 4N0AC 2E5KA 3VU3C 2DFUA 1H8KA 3L2UA 4ORZA 3LGFA 3TEEA 3L2QA 4O6JA 2ARUA 4H2XA 2XI9A 3PE0A 5GAN8 2EAYA 1CSKA 1VQOQ 1M2VA 3SFMA 1JQQA 2CZ1B 1JJCA 2ZPIB 1VQKT 1PRLC 2GQIA 2AK5A 2KEAA 4RG2A 2X3WD 3LSSA 4QVZA 3FJ5A 2F2WA 4Z88A 3M4YA 1WI7A 1IGUA 1R8OB 3RUXA 4Y91A 2QHVA 1MMDA 3L4GA 4M7AF 1N8RU 1SSFA 4AT1B 4PJOG 2QA4Q 4OMMA 5GAMe 4YYEA 2Q7GA 3CCMA 1NYQA 4C5HA 1BCOA 1JRIA 3L2WA 3BDLA 3QBYA 1TG0A 4OMFB 4M4ZA 2QK0A 3SEMA 1WJQA 3JCMc 4M7DG 4JJBA 2P0QA 2MYSA 1VIEA 1OU9A 2P0KA 2AKWB 3HSBA 4M78A 5FLXE 2D8HA 1IHVA 4P3PA 1TOVA 3VYHB 1QVGP 4LXCA 3QG1A 3EGXA 2KR3A 3HXZA 5LJ5f 2C0TA 1KQSP 3L2VA 4FU6A 4OMPA 2DXCA 3EG9A 2DF6A 2K57A 3KXTA 2MWPA 3PZCA 3PIPA 1QVPA 3TEHA 2CJBA 4E7SA 3UATA 1RACB 2YLCA 4RTWA 1VQ4T 3MKDA 1ZHIA 3L2RA 4MMKA 1LPLA 2DM1A 4PFPA 1ZSZA 2QDLA 4FL6A 3CCUQ 1LOJA 1M1GA 2YDLA 2OTLT 3ASKA 3CEYA 4M77D 1GCQC 1FX7A 4RCCA 3OYDA 2DMOA 1YJ9Q 4RTXA 2XDPA 3MCAB 3A8MB 2K7AA 2DL8A 3OYYA 3VUBA 3P8YA 2QYZA 4FIBA 2DVJA 3RF1A 1IZ6A 4QQDA 5GAOr 2L0AA 3REXA 1KQ1A 2EWNA 3FEOA 5GANg 4ZN3A 2ENMA 2ZT8A 3CPFA 2W10A 3G1ZA 4PLIA 1PWTA 3J80E 3E9GA 2JXBA 2AKLA 1E7OA 5FU7B 5IH2A 4H2XB 1X01A 3GNFB 1K8AU 5FW9A 1M2VB 3UA6A 3G1JA 4RTTA 3OD1A 1JJCB 2FRWA 1HXDA 4Q6GA 1EZZB 4C92D 3M54A 2A37A 5KYWA 1Q81U 4J9IA 3RACA 3A7AA 2OTJT 3EFRA 4M77C 4JJNK 1VQLQ 4ZGEB 4GY5A 2COWA 4JRKA 4FM4B 1VQ4A 2DTIA 3L4GB 2LCLA 2D0QB 3EAEA 5K1XA 1GBRA 1VA7A 2BZYA 4DBQA 2DVEA 3KFVA 3HXWA 3CBPA 2DTHA 1JO8A 2CP2A 5EC7A 3DB3A 3KBGA 2OTLA 4LDXA 2EYXA 3MO8A 2EGEA 1B34A 3OBWA 3MEVA 3VQXA 3JCMJ 5F5WA 3CMET 4YRIA 1TUCA 4BDZA 4LDYA 4M77E 4ATOA 4LUEA 4M78B 2RQVA 2XDDA 1D3BA 5FWCA 5CQYA 1JBMA 3EGXB 3OYBA 4ZNXA 3EG9B 4C92C 3HXUA 4LVIA 1JU5C 1MUZA 3HXVA 3HY1A 2PZ1A 5LJ5h 5C51B 4C0DB 1X6BA 3QDFA 4P74C 2Q7EA 2QGGA 3HP9A 2A7YA 3CCMQ 3AT1B 2DX1A 3A5ZA 4C8QG 1G5HA 1ZSZB 1B70A 4ZTZB 1VYVA 2LQKA 2DK3A 1H3ZA 5FRNA 2QHUA 4CH3A 4C5IA 3CMAT 1SHFA 2P0LA 2FZKB 4HCBA 5A0DA 2CH4W 1YCYA 3LYIA 2OTJA 1SRMA 1TSFA 3QO7A 1NZ9A 2VKNA 2D0NA 4AMCA 3IG2A 2F1LA 4C92E 2C0OA 3OW2P 2QTXA 4L5GA 3A7UA 4YRMA 1WJSA 4M77F 2LNHB 3G4ST 3QTCA 1RAEB 2DTOA 2AMCA 2RHXA 1C0MA 2Q7HA 3CMEA 2ZR3A 1K73R 2V8IA 1YBYA 3UT1A 1BK2A 3HHTB 4CC4B 3OS5A 4G85A 4IUTA 1I1JA 4IURA 4RUGA 5KE3A 5KYWB 1PKTA 3HKSA 1V76A 2C0IA 1UGRB 4OLFA 1I5OB 3FIFA 2O88A 1PD1A 5DLQE 2PVOB 1UEBA 4ELYC 3EGUA 2WSCE 2ZAEA 2HCKA 2X4WA 1M5Q1 2AZSA 4HWTA 1K9MC 1PRMC 2HSPA 4ME7A 2EJFA 3QWYA 3MEAA 4C92F 2QEXT 1M8MA 2DO3A 1WYDA 3P8TA 3CMAA 2IY5A 3EGDA 4J6XA 3E9IA 5CK9A 1X54A 4YRKA 2XK0A 4KUDK 3TSZA 2JTMA 1B34B 1LJOA 2PUKB 1KK7A 3MEWA 4BWAA 1WX6A 4JRIA 1M3AA 4OGCA 1D0YA 1D3BB 1MMGA 4EMHA 3TUPA 2EVRA 2HAXA 3INZA 1VQ4Q 4OMOA 4X1VA 4YCVA
chains in the Genus database with same CATH topology
3G4SA 2LX9A 2YHTA 5D6XA 3G6ET 3RKYA 1O75A 2DQ0A 2JOYA 3M5AA 3OQ5A 1Q86U 5GAOq 3WVEB 2C8MA 3A5ZB 4YRJA 3FLGA 1B70B 2HQXA 1RI0A 2GFAA 3QO8A 1B8AA 4UP8A 2ZCFB 1VQ8T 4R55A 3MP1A 4XU2A 1VQPT 2CZ0B 1KD1C 3SB2A 3P8VA 4ZGJB 3F70A 4C5EA 4K88A 1QVFS 4YRSA 4HA8A 2DIGA 1SETA 3UGTA 1G3TA 2QEXA 2Q5HA 2I4LA 3S3MA 2ZT5A 4RDXA 3LH0A 3CPWA 3A5YA 2AMCB 1H4QA 4CH4A 4LDWA 5A2QE 2GF7A 4NL3A 3HFVA 2K5FA 2JNGA 5DLOA 1YFTA 3DKMA 2K3XA 4X9CA 3BFMA 4DOVA 1N9WA 2I4MA 2VV5A 3MHXA 3G6EA 2LQ8A 4A4FA 2RD1A 2EQUA 1ADYA 3DLLA 1M90U 3QHSA 2VGMA 2IY5B 3WQZA 3H6ZA 3JB9J 3JB9H 1VQ8A 3JAME 4H2SA 1B7YA 1VQPA 1Y7XA 5FRMA 2RHSA 5FU7C 4M78D 3OYKA 3LC0A 4A53A 11ASA 3E9HA 3JCMQ 1XNIA 1NJ2A 4JLIA 1H4SA 3DB4A 2DJZA 3GF5A 4E7IA 4M77B 1NJ6A 3PMIA 4FT4A 3UPUA 2ZZGA 4M7DC 1IL2A 4XTUA 4ZIBA 3GNGA 1WJRA 4MMLA 2L8DA 3A7RA 2MAMA 3RMQA 3CC7T 2P5IA 3CCST 1UGQB 4OB2B 1KOGA 3JSCA 4XU0A 2ZCEA 2GCXA 4BD3A 1Q7YC 1GGMA 5GAMf 4H2TA 1VQ7T 3C94A 4OGEA 4UP9A 5L8RE 4XEOA 1C0AA 1M8VA 1YI2T 3C4SA 1NJIC 1PSEA 1BI3A 3QJYA 4HWOA 3TCJA 5AYFA 4H2WA 1U8RA 3QNEA 4C5GA 4F7UG 3PIOA 1P92A 4D6WA 2H3JA 1W2BS 4M78E 3BY7A 3W3SA 2ZPHB 4TVAA 1M1KC 3NEMA 3OYFA 2XU8A 1W66A 1S72A 2EKOA 4J6WA 2E64A 1BIAA 4L6V5 4J83A 3CCSA 3GPLA 4BACA 5HK0A 1N8RC 2RHSB 1VUBA 3M4PA 3FB9A 1VQ7A 4C8QD 1Q7YU 3M55A 1WLEA 3OBYA 2VYTA 4PL6A 1YI2A 4YCWA 2DXUA 4TTVA 2L5QA 3ICAA 3LW5E 4UPAA 2I4OA 1EQRA 4M78F 2DKGA 3UFGA 4DOWA 4J5YA 3M59A 4NOYA 1M9SA 2RHUA 4A4GA 3QJ6A 4DPGA 3CC2T 4BDYA 4OB3B 3M4QA 1YJWT 4CRIA 2RM4A 5K1PA 2ZGWA 5LJ5j 3CD6T 1M1KU 4C8QC 5GAMh 2KDSA 4YPFA 5GANd 3HFOA 2DXTA 4PJOA 1QVGA 1KQSA 1NJ5A 3OSSC 1XQHA 3S6WA 1WNLA 4M7DA 4HWRA 3OS0A 1EIFA 3JCMb 3PTAA 1WPYA 3P8BB 1KQ2A 2RJEA 2E1HA 3GOXA 2JVVA 1K8AC 3QSUA 2PMFA 2XDBA 4EPCA 3CXCS 1Q81C 1BIBA 3FDRA 5J3BA 1DJ7B 2IVWA 3WVDB 3C95A 3CC2A 2L3RA 2ZPGB 1BI1A 1G5IA 4YRRA 2CJ9A 4M75G 2LRQA 3PT9A 3CD6A 2DQ3A 2FHDA 2E6NA 1VQ6T 2EJGA 4YRLA 4C0GA 1VQKA 2CS7A 2CYZB 2G4CA 3HRIA 2M9UA 5CO7A 3OYAA 1OI1A 4EMKA 1M1FA 3JCMW 4E47A 3OY9A 4X5OA 1BBUA 1FWZA 4C8QF 5C0MA 3OMCA 1QF6A 5ELNA 1G51A 2V8JA 2DD5A 2P4TA 2K5IA 2X35A 2F5TX 3SDZA 4ZGDB 2XTIA 2XG8D 2LT1A 2DZ9A 4Y28E 4CH5A 2LCCA 1UGSB 3CCRT 3HRSA 2E5QA 2MI6A 4JS5A 2RJFA 3ERRA 3MEUA 3JCMd 4PJOB 3NTKA 2ZINA 4J7FA 2RI2A 3VQYA 3CCLT 3J81E 3V7SA 5LJ5g 2WSFE 4J6YA 4M7DB 2ZXFA 1OZ2A 4JS4A 5GAN5 1VQ6A 2EFIA 2VGNA 3HXYA 4L87A 5HGQA 4CS4A 1VQZA 4QW2A 1XOVA 3RESA 4TQDA 4C8QA 3OW2A 1NNHA 5GMKl 4LVJA 4JRPA 3PNWC 2QDYB 3X28B 3JCMX 1NE8A 4TVWA 3TEHB 1AHJB 3VQVA 3HRKA 1YFRA 3ER0A 3CCRA 1LYLA 2OAUA 2JTFA 4A4HA 4CI0C 5GMKe 2ZTGA 2IG0A 5GANe 5CAIA 2EL9A 3QUIA 4QVCA 4BW9A 4JRQA 2PVDB 1MGQA 4A4KA 3CCLA 4B9WA 2LC4A 4N4HA 4BI4A 2RHZA 4P73C 1EIYA 3GP8A 4MZPA 3QZ9B 1G3YA 4OVAA 2C06A 3JCMg 1GXIE 2J3LA 1Q86C 2VXEA 3KUFA 3VKIA 4PHCA 1OYXA 4RMFA 1MHNA 2EQKA 2KY9A 2RH2A 3M9QA 4NCXA 4MDWA 3OA6A 3RKXA 2XKOC 4DQ2A 4VUBA 1JJ2S 3RMSA 5KNNA 3HFNA 2DD4A 4MZMA 1KC8U 4X9DA 4BE0A 3JB9D 3CCET 1VQ9T 2PQWA 3OB9A 3LWHA 2VXFA 4ZTJA 4HKEA 1I81A 1X75C 4P75A 4RQEA 4XEMA 4C8QB 3BJUA 3MP8A 1SRYA 2ZZDA 4HT8A 3KFUA 2X4YA 4OB0B 2KQWA 3RGLA 2RHIA 2XIDA 3LX7A 4QQGA 3DSQA 1M90C 4K86A 4EO4A 3X24B 1ASYA 4KBMB 2EQMA 3V8KA 2BUDA 3JCMe 4P3OA 2ALYA 5I2MA 1VIFA 1WQ7A 4F7UE 1EIYB 2M1HA 5LJ3j 4G84A 4KT0E 1YJNT 4A4EA 3V7RA 3CCEA 1VQ9A 1KMNA 1ZBXA 1KHIA 3OYMA 4HT9A 3QXEB 3L2ZA 4P5NA 3QYGB 1Z7MA 3QZ5B 4RKUE 2PU9B 3JCMV 4P71A 3RKWA 2EQJA 4PJOD 5A0LA 3CCQT 4MDXA 1ZQ1A 3L42A 2EIFA 4BUGA 4BI8B 2DXBA 2PMEA 2VC8A 5CKFA 4PNOA 5GAN2 1VQ5T 4M7DD 2A8EA 1VQNT 2PVGB 4ZTFA 5LJ3d 4P73A 3FJPA 3VJPA 4F7UF 3REUA 3A8OB 2E70A 3DLMA 5GAMj 4HCZA 3OSVA 3IALA 2E5AA 4PG3A 2K5LA 3LLRA 1VQMT 4JUVA 5I2SA 3IKMB 4BE2A 4HCCA 1QW1A 5HY6A 4MZTA 1M4ZA 3IKLA 3JB9F 1YJNA 4PJOC 3NFCA 1ADJA 5CKEA 2MF2A 2K4YA 5KCHA 1Y96A 2O01E 4LDUA 4JDSA 3GIBA 1KHCA 1O9SA 1SERA 2B8AA 1UGPB 3OYJA 4Z02A 4QQ6A 4L59A 3UDCA 3CCQA 2BIVA 2ALYB 4YRQA 2FVUA 2AHJB 3E19A 4H2VA 3HY0A 2XICA 1VQ5A 4TVYA 1VQNA 4JLGA 4PJOE 1YB3A 1NYRA 4IKFA 4XK8E 4WJ3M 2RK2A 4F7UA 2FB7A 4XU1A 4BB7A 4M7DE 3OYHA 3V8JA 2GFUA 1LNXA 4LD6A 4KULA 4KUIA 4Q15A 2LDMA 2K2VA 4UC4A 2MMPA 5EG2A 2QHSA 2D6FA 1VQMA 5LJ3g 4H2YA 2I2LA 3E9FA 5C6SA 2HBPA 4LNSA 3QO3A 5A0GA 3ZEHA 1YFSA 4YRNA 4EMKC 2RJDA 2RO0A 3E1SA 4PJOF 1H4VB 5HKCA 4X34A 4YRGA 2QQBA 4CH6A 1N6AA 3CBMA 1FXXA 3CC7A 2YRVA 2RB6A 4KQEA 1B7YB 4E7LA 1EVLA 4M7DF 1RIQA 5CIUA 1U1SA 4WJ4A 1YGBA 2M16A 3VYGA 1IREB 2M0OA 2Y4XA 5GAMg 4E7HA 2P0PA 4P3NA 4YRTA 4YTLA 2XD0A 4H02A 3QKJA 1Y96B 1I4K1 2QQRA 2Y4YA 1USYA 2NLUA 2X4XA 2ARSA 3S3NA 2HNIA 1X56A 4XQ3A 5CKDA 3JB9I 5CKHA 2BKDN 2QQ9A 4XTYA 4YRCA 5DM7R 1WU7A 1KMMA 4BY6B 3OS1A 2NS6A 3MF2A 5LJ3e 4AH6A 3A8HB 2D9TA 4F7UB 3G7ZA 2X4JA 4N4IA 1QVFA 4ZN1A 1L0WA 1X2GA 2DDZA 1N27A 2E10A 12ASA 1QE0A 1HK9A 2DZCA 4R56A 3NTHA 5J39A 2O4XA 4PKCC 1QP3A 2LNVA 4ELZC 3PCOA 2C7IA 2XHCA 2E65A 4XAXB 2Y90A 4C8QE 5GAOp 1SESA 4XU3A 1Z7NA 5LJ5d 4TVAB 5GANf 4EX5A 3J7AF 4M75A 4N4GA 4RCBA 2I4NA 3CCJT 5GAN7 1K73C 5KCOA 4LDVA 1YJWA 2DU7A 1PSFA 2JZ2A 1Q82U 2RJCA 1E22A 3QDRB 4LD9K 4Q5WA 1X6OA 4C0FA 4IUUA 1ASZA 3HL8A 3OYLA 5CQXA 3X20B 3SWNC 4FT2A 1NJ1A 3HFZA 4M78G 4IUPA 1NPRA 5CVIA 5C52B 2KMTA 1YITT 4LVKA 3BW1A 4B9XA 1HC7A 4XTXA 3MP6A 2EYQA 4DA4A 4P75C 3M56A 1U1TA 4M7AA 3NETA 2LVMA 3CPWS 3CCJA 3CBOA 4A54A 1YHQT 4YCUA 3HPWA 1K73U 2ZZFA 4EMGA 2CGHA 5E3IA 3FRNA 3VV0A 4M7AG 2O4XB 5GMKi 3PCOB 2RA2A 3UGQA 4E51A 3N5BB 4YRFA 3I7FA 3H8ZA 1W2BA 3JCMf 2RI3A 5HK3A 4M75B 5GMKh 3ME9A 2FL7A 5GANh 4H2UA 1BBWA 4KR3A 4BI3A 1EFWA 1YITA 3S3OA 4YREA 3I56T 2PUOB 2ZT7A 4N0AA 3SD4A 3NENA 3ZBDA 1NPPA 1N9SA 1KC8C 2EJ9A 4P71C 3VUZA 5GAOm 2DIQA 3JRZA 5FU6C 3RL6A 1YHQA 5M9OA 2J3MA 4EMKB 5CCAA 4KR2A 3HFZB 3OYIA 5GAN4 3A8LB 2CJAA 3X26B 2DPPB 4YP0A 1I5LA 1H641 3C12A 3TEGA 5LJ5e 1X2HA 2ARTA 1B76A 2ZT6A 1BYMA 3RIRA 2ZIOA 4E7JA 4HWSA 4M7AB 1E1TA 4RQFA 2LT4A 3I56A 2FYKA 1KG1A 3UH0A 2YLBA 4O5VA 5D6WA 3SWNA 3OYGA 1J5WA 3FC3A 2DU5A 3HXXA 3LSQA 2ZPBB 2F5KA 4UP7A 3VBBA 4OF1A 4BY6C 4IUVA 4K87A 3WXMB 4WF2A 2VUBA 3JCMh 4FSXA 1TH7A 2CKKA 5CR2A 3I55T 2QXFA 5GAN3 2WSEE 2WACA 3CXCA 3HRUA 3R6OA 3P8DA 1G5VA 3QIIA 2XGTA 4O2DA 3HRTA 4J8OA 2JN0A 3EFSA 4P72C 2KK4A 2DAQA 3QYHB 2ZPEB 1JB0E 4M77A 3G71T 4II1A 3JCMP 4EDUA 1X55A 2QHTA 4OB1B 2DEQA 5C53B 2V8KA 5LL6S 5IN1A 5J26A 1H4TA 2QI2A 2RHYA 1XTDA 2A3LA 2ZNJA 1WQWA 4M77G 4CS2A 3CCVT 5IT9E 3OYEA 1OZ3A 1UB4A 3O8VA 4WI1A 4RG8A 1Y71A 1QVGS 1Y07A 3I55A 4RMOA 3OS2A 1KQSS 1K9MU 1HTTA 1VQOT 2CZ6B 4IUQA 4C92A 4HWPA 1N9RA 3PMTA 3M57A 1USYC 4P74A 3SWNB 4V2SA 3MQZA 2MWOA 2K3YA 5CKBA 4C92G 2LTOA 2R5MA 3P8HA 3G71A 3OMGA 4M75D 2QA4T 2E12A 1FYFA 3OYCA 2GQVA 3QO5A 2Q5IA 4GLKA 3LGLA 5GAOn 3TU4K 5LJ3f 5ELOA 4CS3A 3CCVA 4ZTUB 4OP0A 3V8LA 1ATIA 4J15A 1KD1U 5GMKm 2R58A 3TREA 2G3RA 5GAMd 3VQWA 1BKBA 2RHQA 4XTVA 5I21A 1VQOA 4C0ZA 1EVKA 3PGGA 3CCUT 2ODRD 5KH6A 3UWNA 4TWAA 4M75C 1YJ9T 3T9NA 1S72T 2KAFA 1PYSA 2HD0A 2E41A 3NTIA 1I8FA 4HVCA 4NL2A 3GLXA 2R5AA 3A74A 3M53A 2QA4A 4TQFA 3CMQA 2RK1A 1W4SA 3X25B 3URGA 3L1AA 4M7AD 3PFSA 4M78C 3MEYA 4HT4A 2JUFA 4P72A 4M75E 4J7IA 5FU6B 4C92B 1YIJT 3CC4T 3AHUA 2QQSA 4C0DC 4YROA 5GAN6 2L89A 3BDUA 2ODRC 3META 1VQLT 5D6YA 2RI5A 3MF1A 1QP2A 1JJ2A 4NS5A 2QQAA 4QVDA 4YRPA 1G3SA 2ZR2A 3QPHA 1E1OA 3ZFJA 3CCUA 4YDQA 2E3CA 1BI0A 2ZIMA 3OW2S 2KVQG 5IAYA 1YJ9A 2AKWA 3OYNA 4M7AC 3JB9G 2ZPFB 5GAOl 1EOVA 4PLLA 4LVLA 4M75F 2CIMA 3M4GA 2ZNIA 5LJ3h 3A32A 4E7KA 5DY9A 3M58A 1BI2A 3A8GB 5GMKj 2HQEA 4BE1A 3V7CA 2RHQB 4XTZA 5GANj 3CCMT 4TVRA 3RERA 1YIJA 3CC4A 1G3WA 2F69A 1Q82C 2ZZEA 4M7AE 1NJIU 1WGSA 3A31A 2R57A 3NELA 2CZ7B 3R07A 1E24A 4LVMA 4XTWA 1VQLA 5FROA 2KSSA 1PYSB 1V29B 1NJ8A 3HTZA 3LWIA 2E6ZA 5KE2A 1RL2A 3Q1JA 4N0AC 3VU3C 3L2UA 3LGFA 3TEEA 3L2QA 4O6JA 2ARUA 4H2XA 2XI9A 5GAN8 2EAYA 3SFMA 2CZ1B 1JJCA 2ZPIB 1VQKT 4RG2A 3LSSA 4QVZA 3M4YA 1R8OB 3RUXA 4Y91A 2QHVA 3L4GA 4M7AF 1N8RU 1SSFA 4PJOG 5GAMe 4YYEA 2Q7GA 3CCMA 1NYQA 4C5HA 1JRIA 3L2WA 3BDLA 3QBYA 4OMFB 1WJQA 3JCMc 4M7DG 2P0QA 1VIEA 2P0KA 2AKWB 3HSBA 4M78A 5FLXE 4P3PA 3VYHB 3QG1A 3HXZA 5LJ5f 3L2VA 4FU6A 2DXCA 2K57A 3KXTA 2MWPA 3PZCA 3PIPA 1QVPA 3TEHA 2CJBA 2YLCA 1VQ4T 1ZHIA 3L2RA 4MMKA 4FL6A 1LOJA 1M1GA 2OTLT 3ASKA 3CEYA 4M77D 1FX7A 4RCCA 3OYDA 2XDPA 3MCAB 3A8MB 3OYYA 3VUBA 3P8YA 4FIBA 3RF1A 1IZ6A 4QQDA 5GAOr 3REXA 1KQ1A 2EWNA 3FEOA 5GANg 4ZN3A 2ZT8A 3CPFA 3G1ZA 4PLIA 3J80E 3E9GA 5FU7B 4H2XB 1X01A 3GNFB 1K8AU 3OD1A 1JJCB 1HXDA 4Q6GA 4C92D 3M54A 1Q81U 3RACA 3A7AA 2OTJT 3EFRA 4JJNK 4M77C 4ZGEB 4GY5A 4JRKA 4FM4B 1VQ4A 2DTIA 3L4GB 2LCLA 2D0QB 3EAEA 5K1XA 2DVEA 3HXWA 3CBPA 2DTHA 3DB3A 3KBGA 2OTLA 4LDXA 3MO8A 1B34A 3OBWA 3MEVA 3VQXA 3JCMJ 5F5WA 3CMET 4YRIA 4BDZA 4LDYA 4M77E 4ATOA 4M78B 2XDDA 1D3BA 5CQYA 1JBMA 3OYBA 4C92C 4LVIA 3HXUA 3HXVA 3HY1A 5LJ5h 5C51B 4C0DB 4P74C 2Q7EA 3HP9A 2A7YA 3A5ZA 4C8QG 1G5HA 1B70A 4ZTZB 2LQKA 1H3ZA 2DK3A 5FRNA 2QHUA 4CH3A 4C5IA 3CMAT 2P0LA 4HCBA 5A0DA 1YCYA 3LYIA 2OTJA 3QO7A 1NZ9A 3IG2A 4C92E 2QTXA 4L5GA 3A7UA 4YRMA 1WJSA 4M77F 3G4ST 3QTCA 2DTOA 2AMCA 2RHXA 2Q7HA 3CMEA 2ZR3A 2V8IA 1YBYA 3UT1A 3HHTB 3OS5A 4G85A 4IUTA 4IURA 5KE3A 3HKSA 1UGRB 4OLFA 3FIFA 5DLQE 2PVOB 1UEBA 4ELYC 2WSCE 2X4WA 1M5Q1 4HWTA 1K9MC 4ME7A 2EJFA 3MEAA 4C92F 2QEXT 2DO3A 1WYDA 3P8TA 2IY5A 3CMAA 4J6XA 3E9IA 5CK9A 1X54A 4YRKA 2XK0A 4KUDK 2JTMA 1B34B 1LJOA 2PUKB 3MEWA 4BWAA 4JRIA 4OGCA 1D3BB 3TUPA 4EMHA 2HAXA 3INZA 4YCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HK9 A;  2DZC A;  2E41 A;  1I8F A;  4HVC A;  3RES A;  4NL2 A;  2YHT A;  4TQD A;  3RKY A;  2DQ0 A;  3PCO A;  3A74 A;  4C8Q A;  2C7I A;  5GAO q;  1NNH A;  5GMK l;  2C8M A;  4TQF A;  3CMQ A;  2E65 A;  4YRJ A;  1B70 B;  2Y90 A;  4C8Q E;  5GAO p;  1SES A;  4XU3 A;  1Z7N A;  3L1A A;  4M7A D;  5LJ5 d;  4TVA B;  5GAN f;  4M78 C;  3QO8 A;  1B8A A;  3JCM X;  4M75 A;  4EX5 A;  4TVW A;  4UP8 A;  3MEY A;  3TEH B;  3VQV A;  4P72 A;  3HRK A;  1YFR A;  4RCB A;  4M75 E;  4XU2 A;  1LYL A;  3SB2 A;  4C92 B;  3AHU A;  2I4N A;  5GMK e;  2ZTG A;  3P8V A;  5GAN 7;  4YRO A;  4K88 A;  5GAN e;  5GAN 6;  5CAI A;  2EL9 A;  3BDU A;  3QUI A;  2ODR C;  4YRS A;  4QVC A;  4HA8 A;  4BW9 A;  1SET A;  3UGT A;  2DU7 A;  1MGQ A;  2Q5H A;  3MF1 A;  2I4L A;  1E22 A;  2ZT5 A;  4RDX A;  4QVD A;  4YRP A;  4P73 C;  1EIY A;  3A5Y A;  2AMC B;  1H4Q A;  4CH4 A;  2ZR2 A;  1E1O A;  4YDQ A;  1ASZ A;  3JCM g;  4NL3 A;  2E3C A;  3HFV A;  2ZIM A;  2AKW A;  1YFT A;  2J3L A;  3SWN C;  4M7A C;  1NJ1 A;  3HFZ A;  2VXE A;  4M78 G;  4X9C A;  3BFM A;  3JB9 G;  1N9W A;  5GAO l;  5C52 B;  1EOV A;  2I4M A;  4PHC A;  4M75 F;  3BW1 A;  2CIM A;  3M4G A;  2ZNI A;  5LJ3 h;  2RD1 A;  1HC7 A;  4RMF A;  4XTX A;  3A32 A;  4NCX A;  1ADY A;  5DY9 A;  3RKX A;  5GMK j;  3QHS A;  2IY5 B;  3V7C A;  4DQ2 A;  3WQZ A;  3JB9 J;  4P75 C;  3JB9 H;  2RHQ B;  4XTZ A;  5GAN j;  1U1T A;  4H2S A;  1B7Y A;  4M7A A;  5KNN A;  3RER A;  3NET A;  3HFN A;  2RHS A;  2ZZE A;  4YCV A;  4M7A E;  4A54 A;  4M78 D;  4X9D A;  3JB9 D;  3A31 A;  3NEL A;  3R07 A;  3LC0 A;  4A53 A;  1E24 A;  11AS A;  4YCU A;  4XTW A;  3E9H A;  2VXF A;  2ZZF A;  3JCM Q;  4EMG A;  1PYS B;  1NJ2 A;  4JLI A;  2CGH A;  1H4S A;  1NJ8 A;  2DJZ A;  1I81 A;  3HTZ A;  5E3I A;  4M7A G;  4M77 B;  1NJ6 A;  4P75 A;  4RQE A;  4N0A C;  3VU3 C;  5GMK i;  2ZZG A;  3PCO B;  4M7D C;  4XEM A;  1IL2 A;  4C8Q B;  2RA2 A;  4XTU A;  3BJU A;  1SRY A;  3UGQ A;  4E51 A;  4ZIB A;  2ARU A;  4HT8 A;  5GAN 8;  4H2X A;  4YRF A;  2EAY A;  4MML A;  3I7F A;  3KFU A;  3JCM f;  3A7R A;  4M75 B;  5GMK h;  3RGL A;  2P5I A;  1JJC A;  5GAN h;  1KOG A;  4XU0 A;  2ZCE A;  3DSQ A;  4H2U A;  1BBW A;  3LSS A;  4K86 A;  1GGM A;  4KR3 A;  5GAM f;  4EO4 A;  1EFW A;  4YRE A;  4H2T A;  1ASY A;  3V8K A;  2ZT7 A;  4N0A A;  3JCM e;  3RUX A;  4Y91 A;  2QHV A;  3L4G A;  4P3O A;  2ALY A;  3NEN A;  4M7A F;  4UP9 A;  4XEO A;  1C0A A;  1M8V A;  1N9S A;  1WQ7 A;  4F7U E;  2EJ9 A;  4PJO G;  5GAM e;  4P71 C;  1EIY B;  4YYE A;  5GAO m;  2Q7G A;  4HWO A;  1NYQ A;  5LJ3 j;  1JRI A;  4H2W A;  4G84 A;  3RL6 A;  3QNE A;  3V7R A;  3JCM c;  4M7D G;  2J3M A;  1KMN A;  4F7U G;  4EMK B;  4HT9 A;  2AKW B;  3L2Z A;  4M78 A;  3HSB A;  4KR2 A;  4P3P A;  3HFZ B;  1Z7M A;  4M78 E;  3HXZ A;  5LJ5 f;  3BY7 A;  3W3S A;  4TVA A;  3JCM V;  5GAN 4;  2K57 A;  2CJA A;  4P71 A;  3RKW A;  3NEM A;  3PZC A;  3TEH A;  4PJO D;  2CJB A;  1W66 A;  4YP0 A;  1I5L A;  2YLC A;  4MMK A;  4J6W A;  1H64 1;  2PME A;  3TEG A;  2VC8 A;  5LJ5 e;  1X2H A;  2ART A;  2E64 A;  4PNO A;  1BIA A;  5GAN 2;  1B76 A;  4M7D D;  2ZT6 A;  1LOJ A;  3RIR A;  5LJ3 d;  2ZIO A;  4P73 A;  4HWS A;  4M77 D;  4M7A B;  3FJP A;  1E1T A;  4F7U F;  4RCC A;  2RHS B;  3REU A;  4RQF A;  3M4P A;  3FB9 A;  4C8Q D;  2FYK A;  1WLE A;  5GAM j;  3P8Y A;  3UH0 A;  2YLB A;  3IAL A;  2E5A A;  4PG3 A;  3RF1 A;  3SWN A;  5GAO r;  4YCW A;  1J5W A;  3REX A;  1KQ1 A;  2DXU A;  2EWN A;  5GAN g;  2DU5 A;  4TTV A;  2ZT8 A;  4JUV A;  3ICA A;  3IKM B;  4UPA A;  3G1Z A;  2I4O A;  3HXX A;  1EQR A;  4M78 F;  3LSQ A;  3IKL A;  2DKG A;  3JB9 F;  3UFG A;  4J5Y A;  4UP7 A;  3VBB A;  4PJO C;  4NOY A;  4H2X B;  1X01 A;  1ADJ A;  4K87 A;  4DPG A;  1Y96 A;  4WF2 A;  3OD1 A;  1JJC B;  1HXD A;  3GIB A;  4Q6G A;  4C92 D;  1SER A;  3JCM h;  1TH7 A;  3M4Q A;  3RAC A;  3A7A A;  5GAN 3;  2RM4 A;  3EFR A;  5K1P A;  2ZGW A;  4M77 C;  5LJ5 j;  4JRK A;  4C8Q C;  5GAM h;  2DTI A;  3L4G B;  2XGT A;  4O2D A;  4YPF A;  2ALY B;  5GAN d;  5K1X A;  3HFO A;  2DXT A;  4YRQ A;  4PJO A;  2DVE A;  2JN0 A;  4H2V A;  3HXW A;  3HY0 A;  2DTH A;  4TVY A;  4PJO E;  1YB3 A;  3EFS A;  1NYR A;  1NJ5 A;  4P72 C;  1WNL A;  1B34 A;  4WJ3 M;  4M7D A;  4F7U A;  2FB7 A;  3VQX A;  4XU1 A;  3JCM J;  5F5W A;  4HWR A;  4M77 A;  3JCM P;  4M7D E;  4YRI A;  3V8J A;  3JCM b;  1X55 A;  2QHT A;  1LNX A;  1WPY A;  4M77 E;  4M78 B;  2DEQ A;  1D3B A;  4Q15 A;  5C53 B;  1KQ2 A;  1JBM A;  2E1H A;  2QHS A;  5LJ3 g;  1H4T A;  4C92 C;  4H2Y A;  2I2L A;  3HXU A;  3HXV A;  3HY1 A;  2ZNJ A;  3QSU A;  1WQW A;  5LJ5 h;  2PMF A;  5C51 B;  4M77 G;  4P74 C;  4CS2 A;  4LNS A;  2Q7E A;  1BIB A;  3QO3 A;  3A5Z A;  4C8Q G;  1G5H A;  1B70 A;  1YFS A;  4YRN A;  4EMK C;  4ZTZ B;  2QHU A;  4WI1 A;  4CH3 A;  2P0L A;  1G5I A;  4YRR A;  2CJ9 A;  1YCY A;  4M75 G;  1HTT A;  4PJO F;  3QO7 A;  1H4V B;  2DQ3 A;  4C92 A;  4HWP A;  4YRG A;  4CH6 A;  2EJG A;  1N9R A;  3IG2 A;  4YRL A;  4C92 E;  1USY C;  2RB6 A;  4KQE A;  4P74 A;  1B7Y B;  2QTX A;  3SWN B;  4V2S A;  1EVL A;  2G4C A;  4M7D F;  3HRI A;  1RIQ A;  3A7U A;  4YRM A;  1U1S A;  4WJ4 A;  4M77 F;  4EMK A;  1YGB A;  3JCM W;  3QTC A;  2DTO A;  2AMC A;  4X5O A;  4C92 G;  1BBU A;  4C8Q F;  5GAM g;  1QF6 A;  5ELN A;  2Q7H A;  1G51 A;  4P3N A;  4M75 D;  2ZR3 A;  4YRT A;  1FYF A;  4H02 A;  1Y96 B;  2XTI A;  3QO5 A;  1I4K 1;  2Q5I A;  4G85 A;  1USY A;  2DZ9 A;  2ARS A;  4CH5 A;  5GAO n;  4OLF A;  2HNI A;  3FIF A;  1X56 A;  3ERR A;  5LJ3 f;  4XQ3 A;  5ELO A;  3JB9 I;  4CS3 A;  3JCM d;  1M5Q 1;  4HWT A;  4OP0 A;  4ZTU B;  3V8L A;  1ATI A;  4J15 A;  4XTY A;  4PJO B;  4YRC A;  1WU7 A;  2ZIN A;  5GMK m;  1KMM A;  2EJF A;  3VQY A;  4C92 F;  1WYD A;  3P8T A;  2IY5 A;  3MF2 A;  5GAM d;  5LJ3 e;  2RHQ A;  3VQW A;  4XTV A;  4J6X A;  3E9I A;  3V7S A;  1X54 A;  4YRK A;  5LJ5 g;  4AH6 A;  4J6Y A;  1B34 B;  1LJO A;  5I21 A;  4M7D B;  4F7U B;  2ZXF A;  4BWA A;  1EVK A;  5GAN 5;  3PGG A;  4JRI A;  3HXY A;  2ODR D;  4L87 A;  1L0W A;  5HGQ A;  4CS4 A;  4TWA A;  1VQZ A;  4M75 C;  1X2G A;  2DDZ A;  1D3B B;  3TUP A;  4EMH A;  2E10 A;  3INZ A;  12AS A;  1PYS A;  1QE0 A; 
#chains in the Genus database with same CATH topology
 2DL5 A;  3G4S A;  2LX9 A;  4R0K A;  1G8X A;  2DNU A;  2YHT A;  5D6X A;  3G6E T;  3RKY A;  1O75 A;  2DQ0 A;  2JOY A;  1PD0 A;  1OPL A;  1WFW A;  3EG0 A;  3M5A A;  3OQ5 A;  3WVE B;  5GAO q;  1Q86 U;  2OTL Q;  2C8M A;  2KXD A;  3A5Z B;  4YRJ A;  1AZE A;  3FLG A;  1B70 B;  2HQX A;  2BE7 D;  1RI0 A;  3SHW A;  4CC2 A;  2GFA A;  2HDA A;  3QO8 A;  1B8A A;  4UP8 A;  2ZCF B;  1VQ8 T;  4R55 A;  1F1B B;  2NUZ A;  3MP1 A;  1A0N B;  4XU2 A;  1VQP T;  2CZ0 B;  1KD1 C;  2YT6 A;  3SB2 A;  2H8H A;  1B7T A;  3P8V A;  4ZGJ B;  3F70 A;  4C5E A;  1GFC A;  1AOJ A;  1WYX A;  4K88 A;  1K0X A;  1YHQ Q;  1QVF S;  4YRS A;  4HA8 A;  2DIG A;  1E6H A;  1UUE A;  4DBH A;  1SET A;  3UGT A;  1G3T A;  2QEX A;  2Q5H A;  2I4L A;  1YP5 A;  3S3M A;  2ZT5 A;  4RDX A;  2DBM A;  3LH0 A;  3CPW A;  3A5Y A;  2AMC B;  1H4Q A;  4CH4 A;  4RTU A;  2M51 A;  4LDW A;  5A2Q E;  2FPE A;  2GF7 A;  4NL3 A;  3HFV A;  1SEM A;  2K5F A;  2JNG A;  5DLO A;  1YFT A;  3VS0 A;  1KC8 R;  1N5Z A;  3DKM A;  2K3X A;  2CH4 A;  3BFM A;  4X9C A;  4DOV A;  1N9W A;  2I4M A;  2VV5 A;  3MHX A;  3G6E A;  2LQ8 A;  4A4F A;  2RD1 A;  1K4U S;  2EQU A;  2AKK A;  1ADY A;  3DLL A;  1M90 U;  1D1A A;  3QHS A;  2VGM A;  2IY5 B;  2A08 A;  3EGD B;  3CME Q;  2VWF A;  3H6Z A;  3LH5 A;  3JB9 J;  3WQZ A;  3JB9 H;  3VS3 A;  1VQ8 A;  3JAM E;  4H2S A;  1AVZ C;  1B7Y A;  3PVL A;  1VQP A;  1Y7X A;  5IHN A;  5FRM A;  3EH1 A;  2RHS A;  5FU7 C;  1D1B A;  4M78 D;  3OYK A;  2CT4 A;  3LC0 A;  4A53 A;  11AS A;  3E9H A;  2LCS A;  3JCM Q;  1XNI A;  2M0Y A;  1X2K A;  4JLI A;  1NJ2 A;  1H4S A;  3DB4 A;  2DJZ A;  3GF5 A;  2DL4 A;  4E7I A;  4M77 B;  1NJ6 A;  3PMI A;  2GNC A;  4FT4 A;  3UPU A;  2ZZG A;  4M7D C;  3CMA Q;  1IL2 A;  4XTU A;  3ULR B;  2M02 A;  3A98 A;  5KYU A;  4ZIB A;  2DL3 A;  3GNG A;  1WJR A;  4MML A;  2L8D A;  5IXB A;  1OX9 A;  1OEB A;  3A7R A;  3EHR A;  2MAM A;  3RMQ A;  3CC7 T;  1MV0 B;  2P5I A;  3CCS T;  4OB2 B;  1UGQ B;  1CKB A;  1KOG A;  3JSC A;  4XU0 A;  2ZCE A;  2GCX A;  4BD3 A;  1Q7Y C;  1YFN A;  1GGM A;  5GAM f;  4RTZ A;  1GL5 A;  4H2T A;  1VOM A;  1UDL A;  1VQ7 T;  2MIO A;  3C94 A;  3G4S Q;  1ZLM A;  4OGE A;  4UP9 A;  5L8R E;  4XEO A;  1C0A A;  1M8V A;  1YI2 T;  1AWJ A;  3C4S A;  1NJI C;  2YUQ A;  1K9M R;  1W1F A;  4QT7 A;  1PSE A;  1BI3 A;  4ESR A;  3QJY A;  1H3H A;  4HWO A;  3TCJ A;  5AYF A;  1UHF A;  3UA7 A;  4H2W A;  1U8R A;  3QNE A;  4C5G A;  1ZSZ C;  4F7U G;  2YXY A;  3PIO A;  3CQT A;  1P92 A;  4D6W A;  4J9D A;  2H3J A;  1W2B S;  2OI3 A;  4M78 E;  2ROL A;  4FSS A;  1RAB B;  3BY7 A;  3W3S A;  2ZPH B;  4TVA A;  1M1K C;  3NEM A;  3OYF A;  2QEX Q;  2XU8 A;  2JMC A;  1W66 A;  1KSW A;  3TSW A;  1QCO A;  1S72 A;  2L3P A;  1R0B G;  2EKO A;  2VB6 A;  4J6W A;  1B3Q A;  5KYY A;  1SKU B;  1TUD A;  2E64 A;  1BIA A;  4L6V 5;  4J83 A;  3CCS A;  3GPL A;  1OQK A;  2KRN A;  1RLP C;  4BAC A;  5HK0 A;  1N8R C;  4OML A;  2RHS B;  1VUB A;  3M4P A;  3BE3 A;  3FB9 A;  1VQ7 A;  4C8Q D;  1Q7Y U;  3M55 A;  4JPB W;  1WLE A;  4KH1 B;  2EPD A;  3OBY A;  2VYT A;  4PL6 A;  2MPX C;  3G6E Q;  2K3B A;  2RN8 A;  1YI2 A;  4DEX A;  4YCW A;  1X43 A;  2DXU A;  4TTV A;  3O5Z A;  2L5Q A;  3ICA A;  3LW5 E;  4UPA A;  2I4O A;  1EQR A;  4M78 F;  2DKG A;  3UFG A;  4DOW A;  4J5Y A;  1VQ8 Q;  5KYU B;  3M59 A;  4NOY A;  1RAF B;  1M9S A;  1VQP Q;  2RHU A;  4A4G A;  3QJ6 A;  4DPG A;  2IPO B;  3CC2 T;  4BDY A;  4OMQ A;  4OB3 B;  2AIR B;  4F16 A;  4GLM A;  3M4Q A;  1RAG B;  1YJW T;  3GBQ A;  3H9N A;  4CRI A;  2RM4 A;  5K1P A;  2ZGW A;  5LJ5 j;  3CD6 T;  1OPK A;  1UG1 A;  1XJW B;  1M1K U;  2EKH A;  4C8Q C;  7AT1 B;  5GAM h;  2KDS A;  4YPF A;  5GAN d;  1KJW A;  3HFO A;  2DXT A;  4PJO A;  1QVG A;  1KQS A;  2CP5 A;  1ABO A;  1NJ5 A;  2COY A;  3OSS C;  4F04 B;  1XQH A;  3S6W A;  1WNL A;  1EX4 A;  3I5S A;  4HVV A;  4M7D A;  4HWR A;  1Y57 A;  3OS0 A;  1EIF A;  4HVU A;  1MMN A;  1WDX A;  4LE9 A;  1KFZ A;  3JCM b;  3M0U A;  3PTA A;  1WPY A;  3P8B B;  1KQ2 A;  2DEU A;  1SSH A;  2CRE A;  2E1H A;  1UE9 A;  2RJE A;  3GOX A;  2JVV A;  1K8A C;  1Q95 G;  2KYB A;  3QSU A;  2PMF A;  2JS0 A;  2XDB A;  4EPC A;  4FW1 A;  3CXC S;  1Q81 C;  1NM7 A;  1BIB A;  3FDR A;  5J3B A;  1QVF P;  1DJ7 B;  2I0N A;  2IVW A;  3WVD B;  5KYY B;  3C95 A;  3CC2 A;  1SG5 A;  2L3R A;  2ZPG B;  1BI1 A;  1G5I A;  4YRR A;  2CJ9 A;  4M75 G;  1IB8 A;  5L23 A;  2LRQ A;  3PT9 A;  2OX7 A;  3CD6 A;  2DQ3 A;  2FHD A;  2E6N A;  1VQ6 T;  2EJG A;  4YRL A;  4C0G A;  2LQW A;  2HL3 A;  1NG2 A;  1VQK A;  2CS7 A;  2CYZ B;  1LCK A;  2G4C A;  3HRI A;  2M9U A;  2H3E B;  5CO7 A;  5AT1 B;  1HSQ A;  3OYA A;  1OI1 A;  4EMK A;  1M1F A;  3JCM W;  4E47 A;  1S72 Q;  3OY9 A;  4X5O A;  1BBU A;  1FWZ A;  4C8Q F;  5C0M A;  1SPK A;  3OMC A;  1QF6 A;  5ELN A;  2ABL A;  1G51 A;  1PKS A;  2V8J A;  2DD5 A;  2P4T A;  2K5I A;  2X35 A;  2F5T X;  3SDZ A;  1NYF A;  1T0J A;  4ZGD B;  1VQ7 Q;  2XG8 D;  2XTI A;  2QAS A;  4AFZ C;  2LT1 A;  3HTR A;  2DZ9 A;  4Y28 E;  4CH5 A;  2LCC A;  1UGS B;  2J6K A;  2FZC B;  3CCR T;  1R77 A;  1T3L A;  3HRS A;  2E5Q A;  2FZG B;  2AZV A;  2MI6 A;  2RJF A;  4JS5 A;  1YI2 Q;  3ERR A;  3I5R A;  2X9H A;  3EG1 A;  3MEU A;  1TXQ A;  3CC4 Q;  1YIJ Q;  2J6O A;  3JCM d;  1T3S A;  1PNJ A;  3NTK A;  4PJO B;  4CC3 A;  2ZIN A;  4J7F A;  2RI2 A;  3VQY A;  3CCL T;  2JM8 A;  3J81 E;  2DYB A;  2YUN A;  3V7S A;  1X69 A;  5LJ5 g;  3H0I A;  1TU0 B;  4J6Y A;  2WSF E;  4M7D B;  1FYN A;  4AG2 C;  2O31 A;  1OZ2 A;  2ZXF A;  4JS4 A;  2FO0 A;  2MCN A;  1LVK A;  5GAN 5;  3EH2 A;  1VQ6 A;  2EFI A;  2VGN A;  2Z0W A;  3HXY A;  1N8R R;  4L87 A;  5HGQ A;  4CS4 A;  3R6N A;  1VQZ A;  1C1A A;  4PJN A;  4QW2 A;  1C6V X;  1XOV A;  2CP3 A;  1V1C A;  3RES A;  5GJW B;  1U5S A;  4TQD A;  1E6G A;  1Q82 R;  1W70 A;  4WCI A;  4FCY A;  4C8Q A;  1GCP A;  2ROT A;  3OW2 A;  3VS5 A;  5GMK l;  1NNH A;  4LVJ A;  4JRP A;  2HEQ A;  3PNW C;  2QDY B;  5HCK A;  3X28 B;  1Z9Q A;  3M0S A;  1I0C A;  3JCM X;  1NE8 A;  4TVW A;  3TEH B;  1AHJ B;  3VQV A;  3HRK A;  1YFR A;  3ER0 A;  3CCR A;  1LYL A;  2OAU A;  2JTF A;  4A4H A;  4CI0 C;  2EYW A;  5GMK e;  2ZTG A;  4DEY A;  2IG0 A;  1UJY A;  5D7U A;  5GAN e;  1YWO A;  5CAI A;  2EL9 A;  1BBZ A;  3QUI A;  4QVC A;  2KNB B;  4BW9 A;  4JRQ A;  2PVD B;  1MGQ A;  4A4K A;  3CCL A;  1W2B P;  3QWX X;  4B9W A;  2LC4 A;  4N4H A;  4BI4 A;  4J9B A;  1ZUU A;  2RHZ A;  4P73 C;  1EIY A;  4AFQ C;  3GP8 A;  2X51 A;  4MZP A;  3CC2 Q;  4JJD A;  4A63 B;  3QZ9 B;  4OMN A;  1G3Y A;  4OVA A;  2QAZ A;  2C06 A;  3JCM g;  1GXI E;  3CD6 Q;  2KGT A;  2LZ6 B;  4FYY B;  2J3L A;  3VRY A;  1Q86 C;  2VXE A;  1YNZ A;  3KUF A;  2JS2 A;  2NYS A;  1VQK Q;  3VKI A;  1ZUK A;  1R0C B;  2BZX A;  4PHC A;  1OYX A;  1K8A R;  4RMF A;  1MHN A;  2ATC B;  2YWW A;  2EQK A;  2KY9 A;  2RH2 A;  3M9Q A;  4NCX A;  4MDW A;  3OA6 A;  3TQ7 P;  1Y0M A;  3RKX A;  2XKO C;  4DQ2 A;  1Z9Z A;  2O2O A;  2GBQ A;  4VUB A;  1JJ2 S;  3RMS A;  4HXJ A;  5KNN A;  2CUD A;  3HFN A;  2V1Q A;  2DD4 A;  2RNA A;  4MZM A;  1KC8 U;  4X9D A;  4BE0 A;  3JB9 D;  3CCE T;  2DL7 A;  1VQ9 T;  2PQW A;  3OB9 A;  3LWH A;  4DBR A;  2J05 A;  2VXF A;  1PM3 A;  2HKN A;  4ZTJ A;  4HKE A;  2JW4 A;  1I81 A;  1FMV A;  3H0H A;  1X75 C;  4P75 A;  4RQE A;  1K1Z A;  4XEM A;  4C8Q B;  3BJU A;  3MP8 A;  1SRY A;  2ZZD A;  4HT8 A;  1WXB A;  1HYO A;  3KFU A;  5IXF A;  2X4Y A;  4OB0 B;  2KQW A;  3RGL A;  2RHI A;  1UJ0 A;  4J9E A;  3D7S B;  1VQ6 Q;  2XID A;  4GBQ A;  3LX7 A;  1WLP B;  2LJ0 A;  4QQG A;  3DSQ A;  1M90 C;  4K86 A;  4EO4 A;  3X24 B;  2DRM A;  1ASY A;  4KBM B;  2EQM A;  3V8K A;  2BUD A;  3JCM e;  2KBT A;  2L2P A;  4P3O A;  1YN8 A;  4HCK A;  4B6M A;  2ALY A;  1RLQ C;  5I2M A;  1VIF A;  2HMA A;  1WQ7 A;  4F7U E;  1EIY B;  2YUP A;  2M1H A;  5LJ3 j;  2KT1 A;  2MK5 A;  1QKW A;  1UEC A;  4G84 A;  4KT0 E;  1YJN T;  3CXC P;  4A4E A;  4PFO A;  3V7R A;  3CCE A;  2LJ1 A;  1VQ9 A;  1KMN A;  1ZBX A;  3CCR Q;  1KHI A;  3OYM A;  4HT9 A;  3QXE B;  3L2Z A;  4P5N A;  3QYG B;  4JZ4 A;  1Z7M A;  3QZ5 B;  4RKU E;  2PU9 B;  1RAH B;  3NGP A;  1GRI A;  1UTI A;  4KGV B;  3JCM V;  4P71 A;  3RKW A;  1M2O A;  2OTJ Q;  2EQJ A;  3CCL Q;  4PJO D;  5A0L A;  3IQL A;  2FEI A;  3CCQ T;  3A1P A;  4MDX A;  1ZQ1 A;  3L42 A;  2EIF A;  4D8D A;  2KYM A;  4BI8 B;  4BUG A;  2DXB A;  2PME A;  2VC8 A;  5CKF A;  1IHW A;  1WHM A;  2CDT A;  4PNO A;  5GAN 2;  1VQ5 T;  4M7D D;  2A8E A;  1VQN T;  2PVG B;  4ZTF A;  5LJ3 d;  4P73 A;  2DET A;  3FJP A;  1K9A A;  3VJP A;  4F7U F;  2P84 A;  1QWE A;  3REU A;  3A8O B;  2E70 A;  3DLM A;  4PJM A;  5GAM j;  4HCZ A;  1WHH A;  2CUB A;  2BE9 B;  1OV3 A;  3OSV A;  3IAL A;  2E5A A;  4PG3 A;  2K5L A;  3LLR A;  2O9V A;  1VQM T;  4JUV A;  5I2S A;  3IKM B;  4BE2 A;  1AWO A;  4HCC A;  1QW1 A;  5HY6 A;  4MZT A;  2K9G A;  1M4Z A;  3IKL A;  3JB9 F;  1YJN A;  4PJO C;  3NFC A;  1ADJ A;  5CKE A;  2MF2 A;  2K4Y A;  5KCH A;  1Y96 A;  2O01 E;  4J9F A;  4LDU A;  4JDS A;  3GIB A;  2A28 A;  1KHC A;  1O9S A;  1SER A;  2YRC A;  4FYW B;  2B8A A;  2FG0 A;  1UGP B;  3OYJ A;  2F2V A;  4Z02 A;  1Q86 R;  2HL5 C;  2PTK A;  2RPN A;  4QQ6 A;  4L59 A;  1PCX A;  3UDC A;  3CCQ A;  2BIV A;  4WTO B;  2ALY B;  4YRQ A;  2FVU A;  2AHJ B;  3E19 A;  4H2V A;  1MND A;  3HY0 A;  2XIC A;  1VQ5 A;  1VYU A;  1TWB A;  1VQN A;  4TVY A;  4JLG A;  4PJO E;  1YB3 A;  1NYR A;  4JJC A;  4IKF A;  3EG2 A;  4XK8 E;  2CT3 A;  4WJ3 M;  2RK2 A;  4F7U A;  2FB7 A;  1SRL A;  4XU1 A;  4BB7 A;  4M7D E;  3OYH A;  3V8J A;  2GFU A;  1LNX A;  4LD6 A;  4KUL A;  2BTT A;  4E7Z A;  4KUI A;  4Q15 A;  2LDM A;  4FYV B;  2K2V A;  4UC4 A;  1PC0 A;  2MMP A;  5EG2 A;  2QHS A;  2D6F A;  2MOX A;  2EYY A;  5LJ3 g;  1VQM A;  4H2Y A;  2I2L A;  6AT1 B;  3E9F A;  5GJV B;  5C6S A;  2HBP A;  4LNS A;  3QO3 A;  5A0G A;  1W6X A;  3ZEH A;  2B86 A;  1YFS A;  4YRN A;  4EMK C;  2RJD A;  4J9C A;  1VQ9 Q;  2RO0 A;  1D1C A;  3E1S A;  1X6G A;  4PJO F;  1H4V B;  5HKC A;  3H41 A;  1M27 C;  4X34 A;  2DER A;  4YRG A;  2QQB A;  4CH6 A;  1N6A A;  3CBM A;  1ZA2 B;  1FXX A;  3CC7 A;  2YRV A;  2RB6 A;  4AG1 C;  4KQE A;  1B7Y B;  4E7L A;  1EVL A;  4M7D F;  3PVQ A;  1YCS B;  1RIQ A;  5CIU A;  1U1S A;  1RUW A;  4WJ4 A;  1YGB A;  2M16 A;  3VYG A;  1IRE B;  1WXT A;  2M0O A;  2Y4X A;  1KD1 R;  4K11 A;  1K76 A;  5GAM g;  4E7H A;  2P0P A;  4RTY A;  4P3N A;  4YRT A;  4YTL A;  2XD0 A;  4H02 A;  3QKJ A;  1Y96 B;  1WHG A;  1I4K 1;  1ZSG A;  2QQR A;  3VS4 A;  2Y4Y A;  1USY A;  2DE0 X;  2NLU A;  2X4X A;  2ARS A;  1IO6 A;  1JJ2 P;  3S3N A;  2HNI A;  1X56 A;  1I07 A;  4XQ3 A;  5CKD A;  2HZY A;  2EGC A;  3JB9 I;  5CKH A;  2BKD N;  5KYN A;  2LQN A;  2QQ9 A;  4XTY A;  4YRC A;  5DM7 R;  1WU7 A;  1KMM A;  4BY6 B;  3OS1 A;  2FPD A;  2O9S A;  2EYZ A;  2NS6 A;  3MF2 A;  5LJ3 e;  4AH6 A;  2CSQ A;  3A8H B;  1GBQ A;  2D9T A;  4F7U B;  3G7Z A;  2X4J A;  4N4I A;  1H92 A;  1QVF A;  4IIM A;  1ARK A;  4ZN1 A;  1L0W A;  2SEM A;  1X2G A;  4QKU A;  1NLP C;  5ECA A;  2DDZ A;  4KH0 B;  1N27 A;  2E10 A;  3CCQ Q;  12AS A;  1QE0 A;  1HK9 A;  2DZC A;  4R56 A;  2AT1 B;  3NTH A;  5J39 A;  2O4X A;  4PKC C;  1VQ5 Q;  1QP3 A;  5I11 A;  2LNV A;  4ELZ C;  1VQN Q;  3PCO A;  2C7I A;  2XHC A;  1WXU A;  2E65 A;  4XAX B;  1MMA A;  2Y90 A;  4C8Q E;  5GAO p;  1SES A;  4XU3 A;  1Z7N A;  5LJ5 d;  4TVA B;  5GAN f;  4EX5 A;  3M0T A;  3J7A F;  4M75 A;  4N4G A;  1WZO A;  4PFZ A;  4RCB A;  1MNE A;  3M0P A;  1B07 A;  2I4N A;  3CCJ T;  1FMK A;  2YRD A;  5GAN 7;  1K73 C;  1VQM Q;  5KCO A;  4LDV A;  1YJW A;  2DU7 A;  1PSF A;  1X27 A;  2JZ2 A;  1Q82 U;  2RJC A;  1E22 A;  3QDR B;  4LD9 K;  1ABQ A;  1RAI B;  4Q5W A;  4Y92 A;  1RAA B;  1SHG A;  4RTV A;  1X6O A;  1Q7Y R;  2NUP A;  3JV3 A;  2NWM A;  4FYX B;  4C0F A;  2DA9 A;  4IUU A;  3REB B;  5KYX A;  1ASZ A;  3HL8 A;  3EG3 A;  3OYL A;  3ZL7 C;  5CQX A;  3X20 B;  2KRM A;  3SWN C;  4FT2 A;  1FMW A;  1NJI R;  1NJ1 A;  3HFZ A;  4M78 G;  1UFF A;  3CC7 Q;  2LMJ A;  3CCS Q;  4IUP A;  1NPR A;  1AD5 A;  2EGA A;  5CVI A;  5C52 B;  1D09 B;  2KMT A;  1YIT T;  1KIK A;  3H0F A;  2KE9 A;  1ZX6 A;  4LVK A;  3BW1 A;  4B9X A;  2JJ9 A;  1EFN A;  1HC7 A;  4XTX A;  3MP6 A;  2EYQ A;  3E2U A;  4DA4 A;  2J7I A;  4P75 C;  3M56 A;  1U1T A;  4M7A A;  3NET A;  2HBW A;  1M1K R;  2LVM A;  3CPW S;  3CCJ A;  3CBO A;  4A54 A;  1YHQ T;  1UHC A;  4YCU A;  3HPW A;  1WA7 A;  1D0Z A;  1K73 U;  2ZZF A;  4EMG A;  2CGH A;  2A0F B;  5E3I A;  3FRN A;  3VV0 A;  4M7A G;  2O4X B;  5GMK i;  1QCN A;  2PNI A;  1OU8 A;  3PCO B;  2L3Q A;  2RA2 A;  3MPU B;  2DIL A;  4LUD A;  1RI9 A;  3UGQ A;  4E51 A;  2DLP A;  2HKQ B;  3N5B B;  4YRF A;  3I7F A;  2K2M A;  3H8Z A;  1W2B A;  3JCM f;  1SF9 A;  2RI3 A;  5HK3 A;  4M75 B;  5GMK h;  3ME9 A;  2JT4 A;  3RR6 A;  2FL7 A;  2RQR A;  1U06 A;  3U23 A;  5GAN h;  4H2U A;  1BBW A;  4KR3 A;  4BI3 A;  1EFW A;  1YIT A;  2V1R A;  3S3O A;  4YRE A;  2KT8 A;  3I56 T;  1AT1 B;  1AWW A;  2PUO B;  4KGZ B;  2ZT7 A;  4N0A A;  3SD4 A;  3NEN A;  3ZBD A;  2JM9 A;  1NPP A;  2LJ3 A;  3NPF A;  4PK4 A;  1JXM A;  1N9S A;  1KC8 C;  1MV3 A;  4J9H A;  2EJ9 A;  1VYT A;  4P71 C;  3VUZ A;  4LNP A;  5GAO m;  2NUP B;  2DIQ A;  1TUG B;  3JRZ A;  5FU6 C;  3RL6 A;  5KYX B;  1YHQ A;  1WHJ A;  5M9O A;  2J3M A;  2RF0 A;  4EMK B;  5CCA A;  3VRZ A;  4KR2 A;  3EFO A;  1JEG A;  3HFZ B;  2QGF B;  3OYI A;  3VS2 A;  5GAN 4;  1YJW Q;  3A8L B;  2CJA A;  3X26 B;  2DPP B;  4YP0 A;  1K0S A;  2ED0 A;  1I5L A;  2QTV A;  3RNJ A;  1NYG A;  2EBP A;  1QWF A;  1H64 1;  3C12 A;  2E3I A;  3TEG A;  5LJ5 e;  1X2H A;  2ART A;  1B76 A;  1BYM A;  2ZT6 A;  3RIR A;  2CP7 A;  4E7J A;  2ZIO A;  4HWS A;  4M7A B;  1E1T A;  4EIK A;  4RQF A;  2LT4 A;  3I56 A;  2FYK A;  2NUT A;  1Q81 R;  1RAD B;  1KG1 A;  1IRX A;  3UH0 A;  2YLB A;  4O5V A;  5D6W A;  3SWN A;  3OYG A;  3I9Q A;  1J5W A;  3FC3 A;  2DU5 A;  3HXX A;  1NEB A;  3LSQ A;  2ZPB B;  1GCQ A;  1QLY A;  1QMC A;  2F5K A;  4UP7 A;  3VBB A;  4OF1 A;  4BY6 C;  4IUV A;  4K87 A;  3WXM B;  1BCM A;  1S1N A;  1QCF A;  3CCJ Q;  4WF2 A;  1ACM B;  2VUB A;  2RQU A;  2DYI A;  3JCM h;  4FSX A;  1TH7 A;  2CKK A;  5I22 A;  5CR2 A;  4ANJ A;  1M30 A;  3I55 T;  4KGX B;  1X2Q A;  2QXF A;  5GAN 3;  2WSE E;  2WAC A;  3CXC A;  3HRU A;  3R6O A;  2X3X D;  1QQJ A;  2J06 A;  4E6R A;  3P8D A;  1G5V A;  3QII A;  2XGT A;  4O2D A;  3HRT A;  2JTE A;  4J8O A;  1AEY A;  2JN0 A;  1NEG A;  1ZBJ A;  3EFS A;  2J6F A;  4P72 C;  2KK4 A;  1WIE A;  2FRY A;  4CC7 A;  2DAQ A;  2SRC A;  1M3B A;  3QYH B;  2ZPE B;  1JB0 E;  4M77 A;  3G71 T;  4II1 A;  3JCM P;  4Z8A A;  1AZG B;  2ESW A;  4EDU A;  4F14 A;  1X55 A;  2QHT A;  8AT1 B;  2OAW A;  1YIT Q;  4OB1 B;  5IHK A;  2DEQ A;  3EFO B;  5C53 B;  2V8K A;  1OX8 A;  5LL6 S;  1UGV A;  3NHN A;  5IN1 A;  5J26 A;  1H4T A;  2QI2 A;  2RHY A;  3EHQ A;  1XTD A;  2A3L A;  2ZNJ A;  1WQW A;  1QKX A;  4M77 G;  4CS2 A;  3CCV T;  4JZ3 A;  5IT9 E;  1WHL A;  2LP5 A;  3OYE A;  1OZ3 A;  1UB4 A;  3O8V A;  4WI1 A;  4RG8 A;  4HVW A;  1Y71 A;  1QVG S;  1Y07 A;  3I55 A;  4RMO A;  2RQT A;  3OS2 A;  1KQS S;  1K9M U;  1HTT A;  1VQO T;  2CZ6 B;  2D1X A;  4FW2 A;  4IUQ A;  4C92 A;  2NUT B;  2A36 A;  5FWB A;  4HWP A;  1U3O A;  1N9R A;  3PMT A;  2CP0 A;  3M57 A;  1USY C;  1YWP A;  4P74 A;  3SWN B;  2KI7 A;  4V2S A;  3MQZ A;  3UF4 A;  2K6D A;  2MWO A;  2K3Y A;  2KRS A;  2YSQ A;  1OUL A;  4D8K A;  5CKB A;  2OJ2 A;  4C92 G;  2LTO A;  2GTJ A;  1NLO C;  2R5M A;  3P8H A;  3G71 A;  3OMG A;  4M75 D;  2QA4 T;  2E12 A;  1FYF A;  2COZ A;  3OYC A;  2GQV A;  3QO5 A;  2Q5I A;  3I56 Q;  4GLK A;  3LGL A;  2GGR A;  1PG5 B;  2P4R A;  5GAO n;  9ATC B;  3TU4 K;  3CPW P;  5LJ3 f;  5ELO A;  4CS3 A;  3CCV A;  1ZA1 B;  1HJD A;  2FPF A;  4ZTU B;  4OP0 A;  3V8L A;  1ATI A;  4J15 A;  2RQW A;  1NBE B;  1T0H A;  1KD1 U;  5GMK m;  2R58 A;  5IHI A;  2GTO A;  3TRE A;  2G3R A;  5GAM d;  3VQW A;  1BKB A;  2RHQ A;  4XTV A;  2ECZ A;  2DBK A;  1BB9 A;  5I21 A;  1VQO A;  4C0Z A;  1EVK A;  1G83 A;  3PGG A;  3CCU T;  2DRK A;  1TTH B;  2ODR D;  5KH6 A;  3UWN A;  4TWA A;  4M75 C;  2KRO A;  1YJ9 T;  3T9N A;  2LX7 A;  1S72 T;  2KAF A;  1PYS A;  2HD0 A;  2E41 A;  3NTI A;  1I8F A;  2W0Z A;  4HVC A;  2ED1 A;  1AWX A;  4NL2 A;  1J3T A;  4J9G A;  2BZ8 A;  3GLX A;  1GFD A;  4E2F B;  2R5A A;  3A74 A;  2JMA A;  3M53 A;  2F2X A;  2EQI A;  2QA4 A;  4TQF A;  3CMQ A;  2RK1 A;  2V26 A;  4KRT A;  1W4S A;  3X25 B;  3URG A;  3L1A A;  4M7A D;  3PFS A;  1ZUY A;  4M78 C;  3VS6 A;  1WHK A;  3MEY A;  4HT4 A;  2JUF A;  4P72 A;  4M75 E;  2VVK A;  4J7I A;  3RDV A;  5FU6 B;  4LN2 A;  4C92 B;  1YIJ T;  3CC4 T;  3AHU A;  2QQS A;  3RBB B;  1PHT A;  3VS1 A;  4C0D C;  2D8J A;  4YRO A;  3VS7 A;  5GAN 6;  2L89 A;  3BDU A;  3CCE Q;  3MET A;  2ODR C;  2QG9 B;  3M0R A;  1VQL T;  4Z89 A;  5D6Y A;  2RI5 A;  3MF1 A;  1QP2 A;  4PJL A;  1JJ2 A;  4PJJ A;  2KXC A;  4NS5 A;  3THK A;  2QQA A;  4QVD A;  4YRP A;  2IIM A;  1G2B A;  3NMZ C;  1M90 R;  1G3S A;  2ZR2 A;  3QPH A;  3TVT A;  1E1O A;  3ZFJ A;  3CCU A;  4YDQ A;  3I55 Q;  3M0Q A;  2E3C A;  1BI0 A;  2ZIM A;  3OW2 S;  2XMF A;  2E4H A;  2KVQ G;  2G6F X;  5IAY A;  1YJ9 A;  2AKW A;  3OYN A;  4M7A C;  3JB9 G;  2ZPF B;  5GAO l;  1EOV A;  3I35 A;  4PLL A;  4LVL A;  4M75 F;  2CIM A;  4IIO A;  3M4G A;  2ZNI A;  5LJ3 h;  1OOT A;  3A32 A;  4AFU C;  1D0X A;  4E7K A;  3REA B;  5DY9 A;  3M58 A;  1BI2 A;  3A8G B;  1IGQ A;  1HD3 A;  2E3H A;  2HQE A;  4DBF A;  5GMK j;  4BE1 A;  3V7C A;  3G71 Q;  2CP6 A;  4AFS C;  2RHQ B;  4XTZ A;  5GAN j;  4F17 A;  3CCM T;  4TVR A;  3RER A;  2YUO A;  2CSI A;  1JXO A;  3MJX A;  2L3S A;  2HQH A;  1YIJ A;  2VAS A;  1G3W A;  2F69 A;  1Q82 C;  3CC4 A;  2ZZE A;  4M7A E;  1NJI U;  1WGS A;  3A31 A;  2R57 A;  1YJN Q;  1BU1 A;  2CZ7 B;  3NEL A;  3R07 A;  1E24 A;  4LVM A;  2DJQ A;  2RMO A;  4XTW A;  1TS9 A;  1CKA A;  1M3C A;  1VQL A;  5FRO A;  2K79 A;  2KSS A;  3C0C A;  1PYS B;  1V29 B;  3CCV Q;  1NJ8 A;  2HSE B;  3HTZ A;  3LWI A;  2E6Z A;  2EW3 A;  5KE2 A;  1IXD A;  8ATC B;  1RL2 A;  3Q1J A;  4N0A C;  2E5K A;  3VU3 C;  2DFU A;  1H8K A;  3L2U A;  4ORZ A;  3LGF A;  3TEE A;  3L2Q A;  4O6J A;  2ARU A;  4H2X A;  2XI9 A;  3PE0 A;  5GAN 8;  2EAY A;  1CSK A;  1VQO Q;  1M2V A;  3SFM A;  1JQQ A;  2CZ1 B;  1JJC A;  2ZPI B;  1VQK T;  1PRL C;  2GQI A;  2AK5 A;  2KEA A;  4RG2 A;  2X3W D;  3LSS A;  4QVZ A;  3FJ5 A;  2F2W A;  4Z88 A;  3M4Y A;  1WI7 A;  1IGU A;  1R8O B;  3RUX A;  4Y91 A;  2QHV A;  1MMD A;  3L4G A;  4M7A F;  1N8R U;  1SSF A;  4AT1 B;  4PJO G;  2QA4 Q;  4OMM A;  5GAM e;  4YYE A;  2Q7G A;  3CCM A;  1NYQ A;  4C5H A;  1BCO A;  1JRI A;  3L2W A;  3BDL A;  3QBY A;  1TG0 A;  4OMF B;  4M4Z A;  2QK0 A;  3SEM A;  1WJQ A;  3JCM c;  4M7D G;  4JJB A;  2P0Q A;  2MYS A;  1VIE A;  1OU9 A;  2P0K A;  2AKW B;  3HSB A;  4M78 A;  5FLX E;  2D8H A;  1IHV A;  4P3P A;  1TOV A;  3VYH B;  1QVG P;  4LXC A;  3QG1 A;  3EGX A;  2KR3 A;  3HXZ A;  5LJ5 f;  2C0T A;  1KQS P;  3L2V A;  4FU6 A;  4OMP A;  2DXC A;  3EG9 A;  2DF6 A;  2K57 A;  3KXT A;  2MWP A;  3PZC A;  3PIP A;  1QVP A;  3TEH A;  2CJB A;  4E7S A;  3UAT A;  1RAC B;  2YLC A;  4RTW A;  1VQ4 T;  3MKD A;  1ZHI A;  3L2R A;  4MMK A;  1LPL A;  2DM1 A;  4PFP A;  1ZSZ A;  2QDL A;  4FL6 A;  3CCU Q;  1LOJ A;  1M1G A;  2YDL A;  2OTL T;  3ASK A;  3CEY A;  4M77 D;  1GCQ C;  1FX7 A;  4RCC A;  3OYD A;  2DMO A;  1YJ9 Q;  4RTX A;  2XDP A;  3MCA B;  3A8M B;  2K7A A;  2DL8 A;  3OYY A;  3VUB A;  3P8Y A;  2QYZ A;  4FIB A;  2DVJ A;  3RF1 A;  1IZ6 A;  4QQD A;  5GAO r;  2L0A A;  3REX A;  1KQ1 A;  2EWN A;  3FEO A;  5GAN g;  4ZN3 A;  2ENM A;  2ZT8 A;  3CPF A;  2W10 A;  3G1Z A;  4PLI A;  1PWT A;  3J80 E;  3E9G A;  2JXB A;  2AKL A;  1E7O A;  5FU7 B;  5IH2 A;  4H2X B;  1X01 A;  3GNF B;  1K8A U;  5FW9 A;  1M2V B;  3UA6 A;  3G1J A;  4RTT A;  3OD1 A;  1JJC B;  2FRW A;  1HXD A;  4Q6G A;  1EZZ B;  4C92 D;  3M54 A;  2A37 A;  5KYW A;  1Q81 U;  4J9I A;  3RAC A;  3A7A A;  2OTJ T;  3EFR A;  4M77 C;  4JJN K;  1VQL Q;  4ZGE B;  4GY5 A;  2COW A;  4JRK A;  4FM4 B;  1VQ4 A;  2DTI A;  3L4G B;  2LCL A;  2D0Q B;  3EAE A;  5K1X A;  1GBR A;  1VA7 A;  2BZY A;  4DBQ A;  2DVE A;  3KFV A;  3HXW A;  3CBP A;  2DTH A;  1JO8 A;  2CP2 A;  5EC7 A;  3DB3 A;  3KBG A;  2OTL A;  4LDX A;  2EYX A;  3MO8 A;  2EGE A;  1B34 A;  3OBW A;  3MEV A;  3VQX A;  3JCM J;  5F5W A;  3CME T;  4YRI A;  1TUC A;  4BDZ A;  4LDY A;  4M77 E;  4ATO A;  4LUE A;  4M78 B;  2RQV A;  2XDD A;  1D3B A;  5FWC A;  5CQY A;  1JBM A;  3EGX B;  3OYB A;  4ZNX A;  3EG9 B;  4C92 C;  3HXU A;  4LVI A;  1JU5 C;  1MUZ A;  3HXV A;  3HY1 A;  2PZ1 A;  5LJ5 h;  5C51 B;  4C0D B;  1X6B A;  3QDF A;  4P74 C;  2Q7E A;  2QGG A;  3HP9 A;  2A7Y A;  3CCM Q;  3AT1 B;  2DX1 A;  3A5Z A;  4C8Q G;  1G5H A;  1ZSZ B;  1B70 A;  4ZTZ B;  1VYV A;  2LQK A;  2DK3 A;  1H3Z A;  5FRN A;  2QHU A;  4CH3 A;  4C5I A;  3CMA T;  1SHF A;  2P0L A;  2FZK B;  4HCB A;  5A0D A;  2CH4 W;  1YCY A;  3LYI A;  2OTJ A;  1SRM A;  1TSF A;  3QO7 A;  1NZ9 A;  2VKN A;  2D0N A;  4AMC A;  3IG2 A;  2F1L A;  4C92 E;  2C0O A;  3OW2 P;  2QTX A;  4L5G A;  3A7U A;  4YRM A;  1WJS A;  4M77 F;  2LNH B;  3G4S T;  3QTC A;  1RAE B;  2DTO A;  2AMC A;  2RHX A;  1C0M A;  2Q7H A;  3CME A;  2ZR3 A;  1K73 R;  2V8I A;  1YBY A;  3UT1 A;  1BK2 A;  3HHT B;  4CC4 B;  3OS5 A;  4G85 A;  4IUT A;  1I1J A;  4IUR A;  4RUG A;  5KE3 A;  5KYW B;  1PKT A;  3HKS A;  1V76 A;  2C0I A;  1UGR B;  4OLF A;  1I5O B;  3FIF A;  2O88 A;  1PD1 A;  5DLQ E;  2PVO B;  1UEB A;  4ELY C;  3EGU A;  2WSC E;  2ZAE A;  2HCK A;  2X4W A;  1M5Q 1;  2AZS A;  4HWT A;  1K9M C;  1PRM C;  2HSP A;  4ME7 A;  2EJF A;  3QWY A;  3MEA A;  4C92 F;  2QEX T;  1M8M A;  2DO3 A;  1WYD A;  3P8T A;  3CMA A;  2IY5 A;  3EGD A;  4J6X A;  3E9I A;  5CK9 A;  1X54 A;  4YRK A;  2XK0 A;  4KUD K;  3TSZ A;  2JTM A;  1B34 B;  1LJO A;  2PUK B;  1KK7 A;  3MEW A;  4BWA A;  1WX6 A;  4JRI A;  1M3A A;  4OGC A;  1D0Y A;  1D3B B;  1MMG A;  4EMH A;  3TUP A;  2EVR A;  2HAX A;  3INZ A;  1VQ4 Q;  4OMO A;  4X1V A;  4YCV A; 
#chains in the Genus database with same CATH homology
 3G4S A;  2LX9 A;  2YHT A;  5D6X A;  3G6E T;  3RKY A;  1O75 A;  2DQ0 A;  2JOY A;  3M5A A;  3OQ5 A;  1Q86 U;  5GAO q;  3WVE B;  2C8M A;  3A5Z B;  4YRJ A;  3FLG A;  1B70 B;  2HQX A;  1RI0 A;  2GFA A;  3QO8 A;  1B8A A;  4UP8 A;  2ZCF B;  1VQ8 T;  4R55 A;  3MP1 A;  4XU2 A;  1VQP T;  2CZ0 B;  1KD1 C;  3SB2 A;  3P8V A;  4ZGJ B;  3F70 A;  4C5E A;  4K88 A;  1QVF S;  4YRS A;  4HA8 A;  2DIG A;  1SET A;  3UGT A;  1G3T A;  2QEX A;  2Q5H A;  2I4L A;  3S3M A;  2ZT5 A;  4RDX A;  3LH0 A;  3CPW A;  3A5Y A;  2AMC B;  1H4Q A;  4CH4 A;  4LDW A;  5A2Q E;  2GF7 A;  4NL3 A;  3HFV A;  2K5F A;  2JNG A;  5DLO A;  1YFT A;  3DKM A;  2K3X A;  4X9C A;  3BFM A;  4DOV A;  1N9W A;  2I4M A;  2VV5 A;  3MHX A;  3G6E A;  2LQ8 A;  4A4F A;  2RD1 A;  2EQU A;  1ADY A;  3DLL A;  1M90 U;  3QHS A;  2VGM A;  2IY5 B;  3WQZ A;  3H6Z A;  3JB9 J;  3JB9 H;  1VQ8 A;  3JAM E;  4H2S A;  1B7Y A;  1VQP A;  1Y7X A;  5FRM A;  2RHS A;  5FU7 C;  4M78 D;  3OYK A;  3LC0 A;  4A53 A;  11AS A;  3E9H A;  3JCM Q;  1XNI A;  1NJ2 A;  4JLI A;  1H4S A;  3DB4 A;  2DJZ A;  3GF5 A;  4E7I A;  4M77 B;  1NJ6 A;  3PMI A;  4FT4 A;  3UPU A;  2ZZG A;  4M7D C;  1IL2 A;  4XTU A;  4ZIB A;  3GNG A;  1WJR A;  4MML A;  2L8D A;  3A7R A;  2MAM A;  3RMQ A;  3CC7 T;  2P5I A;  3CCS T;  1UGQ B;  4OB2 B;  1KOG A;  3JSC A;  4XU0 A;  2ZCE A;  2GCX A;  4BD3 A;  1Q7Y C;  1GGM A;  5GAM f;  4H2T A;  1VQ7 T;  3C94 A;  4OGE A;  4UP9 A;  5L8R E;  4XEO A;  1C0A A;  1M8V A;  1YI2 T;  3C4S A;  1NJI C;  1PSE A;  1BI3 A;  3QJY A;  4HWO A;  3TCJ A;  5AYF A;  4H2W A;  1U8R A;  3QNE A;  4C5G A;  4F7U G;  3PIO A;  1P92 A;  4D6W A;  2H3J A;  1W2B S;  4M78 E;  3BY7 A;  3W3S A;  2ZPH B;  4TVA A;  1M1K C;  3NEM A;  3OYF A;  2XU8 A;  1W66 A;  1S72 A;  2EKO A;  4J6W A;  2E64 A;  1BIA A;  4L6V 5;  4J83 A;  3CCS A;  3GPL A;  4BAC A;  5HK0 A;  1N8R C;  2RHS B;  1VUB A;  3M4P A;  3FB9 A;  1VQ7 A;  4C8Q D;  1Q7Y U;  3M55 A;  1WLE A;  3OBY A;  2VYT A;  4PL6 A;  1YI2 A;  4YCW A;  2DXU A;  4TTV A;  2L5Q A;  3ICA A;  3LW5 E;  4UPA A;  2I4O A;  1EQR A;  4M78 F;  2DKG A;  3UFG A;  4DOW A;  4J5Y A;  3M59 A;  4NOY A;  1M9S A;  2RHU A;  4A4G A;  3QJ6 A;  4DPG A;  3CC2 T;  4BDY A;  4OB3 B;  3M4Q A;  1YJW T;  4CRI A;  2RM4 A;  5K1P A;  2ZGW A;  5LJ5 j;  3CD6 T;  1M1K U;  4C8Q C;  5GAM h;  2KDS A;  4YPF A;  5GAN d;  3HFO A;  2DXT A;  4PJO A;  1QVG A;  1KQS A;  1NJ5 A;  3OSS C;  1XQH A;  3S6W A;  1WNL A;  4M7D A;  4HWR A;  3OS0 A;  1EIF A;  3JCM b;  3PTA A;  1WPY A;  3P8B B;  1KQ2 A;  2RJE A;  2E1H A;  3GOX A;  2JVV A;  1K8A C;  3QSU A;  2PMF A;  2XDB A;  4EPC A;  3CXC S;  1Q81 C;  1BIB A;  3FDR A;  5J3B A;  1DJ7 B;  2IVW A;  3WVD B;  3C95 A;  3CC2 A;  2L3R A;  2ZPG B;  1BI1 A;  1G5I A;  4YRR A;  2CJ9 A;  4M75 G;  2LRQ A;  3PT9 A;  3CD6 A;  2DQ3 A;  2FHD A;  2E6N A;  1VQ6 T;  2EJG A;  4YRL A;  4C0G A;  1VQK A;  2CS7 A;  2CYZ B;  2G4C A;  3HRI A;  2M9U A;  5CO7 A;  3OYA A;  1OI1 A;  4EMK A;  1M1F A;  3JCM W;  4E47 A;  3OY9 A;  4X5O A;  1BBU A;  1FWZ A;  4C8Q F;  5C0M A;  3OMC A;  1QF6 A;  5ELN A;  1G51 A;  2V8J A;  2DD5 A;  2P4T A;  2K5I A;  2X35 A;  2F5T X;  3SDZ A;  4ZGD B;  2XTI A;  2XG8 D;  2LT1 A;  2DZ9 A;  4Y28 E;  4CH5 A;  2LCC A;  1UGS B;  3CCR T;  3HRS A;  2E5Q A;  2MI6 A;  4JS5 A;  2RJF A;  3ERR A;  3MEU A;  3JCM d;  4PJO B;  3NTK A;  2ZIN A;  4J7F A;  2RI2 A;  3VQY A;  3CCL T;  3J81 E;  3V7S A;  5LJ5 g;  2WSF E;  4J6Y A;  4M7D B;  2ZXF A;  1OZ2 A;  4JS4 A;  5GAN 5;  1VQ6 A;  2EFI A;  2VGN A;  3HXY A;  4L87 A;  5HGQ A;  4CS4 A;  1VQZ A;  4QW2 A;  1XOV A;  3RES A;  4TQD A;  4C8Q A;  3OW2 A;  1NNH A;  5GMK l;  4LVJ A;  4JRP A;  3PNW C;  2QDY B;  3X28 B;  3JCM X;  1NE8 A;  4TVW A;  3TEH B;  1AHJ B;  3VQV A;  3HRK A;  1YFR A;  3ER0 A;  3CCR A;  1LYL A;  2OAU A;  2JTF A;  4A4H A;  4CI0 C;  5GMK e;  2ZTG A;  2IG0 A;  5GAN e;  5CAI A;  2EL9 A;  3QUI A;  4QVC A;  4BW9 A;  4JRQ A;  2PVD B;  1MGQ A;  4A4K A;  3CCL A;  4B9W A;  2LC4 A;  4N4H A;  4BI4 A;  2RHZ A;  4P73 C;  1EIY A;  3GP8 A;  4MZP A;  3QZ9 B;  1G3Y A;  4OVA A;  2C06 A;  3JCM g;  1GXI E;  2J3L A;  1Q86 C;  2VXE A;  3KUF A;  3VKI A;  4PHC A;  1OYX A;  4RMF A;  1MHN A;  2EQK A;  2KY9 A;  2RH2 A;  3M9Q A;  4NCX A;  4MDW A;  3OA6 A;  3RKX A;  2XKO C;  4DQ2 A;  4VUB A;  1JJ2 S;  3RMS A;  5KNN A;  3HFN A;  2DD4 A;  4MZM A;  1KC8 U;  4X9D A;  4BE0 A;  3JB9 D;  3CCE T;  1VQ9 T;  2PQW A;  3OB9 A;  3LWH A;  2VXF A;  4ZTJ A;  4HKE A;  1I81 A;  1X75 C;  4P75 A;  4RQE A;  4XEM A;  4C8Q B;  3BJU A;  3MP8 A;  1SRY A;  2ZZD A;  4HT8 A;  3KFU A;  2X4Y A;  4OB0 B;  2KQW A;  3RGL A;  2RHI A;  2XID A;  3LX7 A;  4QQG A;  3DSQ A;  1M90 C;  4K86 A;  4EO4 A;  3X24 B;  1ASY A;  4KBM B;  2EQM A;  3V8K A;  2BUD A;  3JCM e;  4P3O A;  2ALY A;  5I2M A;  1VIF A;  1WQ7 A;  4F7U E;  1EIY B;  2M1H A;  5LJ3 j;  4G84 A;  4KT0 E;  1YJN T;  4A4E A;  3V7R A;  3CCE A;  1VQ9 A;  1KMN A;  1ZBX A;  1KHI A;  3OYM A;  4HT9 A;  3QXE B;  3L2Z A;  4P5N A;  3QYG B;  1Z7M A;  3QZ5 B;  4RKU E;  2PU9 B;  3JCM V;  4P71 A;  3RKW A;  2EQJ A;  4PJO D;  5A0L A;  3CCQ T;  4MDX A;  1ZQ1 A;  3L42 A;  2EIF A;  4BUG A;  4BI8 B;  2DXB A;  2PME A;  2VC8 A;  5CKF A;  4PNO A;  5GAN 2;  1VQ5 T;  4M7D D;  2A8E A;  1VQN T;  2PVG B;  4ZTF A;  5LJ3 d;  4P73 A;  3FJP A;  3VJP A;  4F7U F;  3REU A;  3A8O B;  2E70 A;  3DLM A;  5GAM j;  4HCZ A;  3OSV A;  3IAL A;  2E5A A;  4PG3 A;  2K5L A;  3LLR A;  1VQM T;  4JUV A;  5I2S A;  3IKM B;  4BE2 A;  4HCC A;  1QW1 A;  5HY6 A;  4MZT A;  1M4Z A;  3IKL A;  3JB9 F;  1YJN A;  4PJO C;  3NFC A;  1ADJ A;  5CKE A;  2MF2 A;  2K4Y A;  5KCH A;  1Y96 A;  2O01 E;  4LDU A;  4JDS A;  3GIB A;  1KHC A;  1O9S A;  1SER A;  2B8A A;  1UGP B;  3OYJ A;  4Z02 A;  4QQ6 A;  4L59 A;  3UDC A;  3CCQ A;  2BIV A;  2ALY B;  4YRQ A;  2FVU A;  2AHJ B;  3E19 A;  4H2V A;  3HY0 A;  2XIC A;  1VQ5 A;  4TVY A;  1VQN A;  4JLG A;  4PJO E;  1YB3 A;  1NYR A;  4IKF A;  4XK8 E;  4WJ3 M;  2RK2 A;  4F7U A;  2FB7 A;  4XU1 A;  4BB7 A;  4M7D E;  3OYH A;  3V8J A;  2GFU A;  1LNX A;  4LD6 A;  4KUL A;  4KUI A;  4Q15 A;  2LDM A;  2K2V A;  4UC4 A;  2MMP A;  5EG2 A;  2QHS A;  2D6F A;  1VQM A;  5LJ3 g;  4H2Y A;  2I2L A;  3E9F A;  5C6S A;  2HBP A;  4LNS A;  3QO3 A;  5A0G A;  3ZEH A;  1YFS A;  4YRN A;  4EMK C;  2RJD A;  2RO0 A;  3E1S A;  4PJO F;  1H4V B;  5HKC A;  4X34 A;  4YRG A;  2QQB A;  4CH6 A;  1N6A A;  3CBM A;  1FXX A;  3CC7 A;  2YRV A;  2RB6 A;  4KQE A;  1B7Y B;  4E7L A;  1EVL A;  4M7D F;  1RIQ A;  5CIU A;  1U1S A;  4WJ4 A;  1YGB A;  2M16 A;  3VYG A;  1IRE B;  2M0O A;  2Y4X A;  5GAM g;  4E7H A;  2P0P A;  4P3N A;  4YRT A;  4YTL A;  2XD0 A;  4H02 A;  3QKJ A;  1Y96 B;  1I4K 1;  2QQR A;  2Y4Y A;  1USY A;  2NLU A;  2X4X A;  2ARS A;  3S3N A;  2HNI A;  1X56 A;  4XQ3 A;  5CKD A;  3JB9 I;  5CKH A;  2BKD N;  2QQ9 A;  4XTY A;  4YRC A;  5DM7 R;  1WU7 A;  1KMM A;  4BY6 B;  3OS1 A;  2NS6 A;  3MF2 A;  5LJ3 e;  4AH6 A;  3A8H B;  2D9T A;  4F7U B;  3G7Z A;  2X4J A;  4N4I A;  1QVF A;  4ZN1 A;  1L0W A;  1X2G A;  2DDZ A;  1N27 A;  2E10 A;  12AS A;  1QE0 A;  1HK9 A;  2DZC A;  4R56 A;  3NTH A;  5J39 A;  2O4X A;  4PKC C;  1QP3 A;  2LNV A;  4ELZ C;  3PCO A;  2C7I A;  2XHC A;  2E65 A;  4XAX B;  2Y90 A;  4C8Q E;  5GAO p;  1SES A;  4XU3 A;  1Z7N A;  5LJ5 d;  4TVA B;  5GAN f;  4EX5 A;  3J7A F;  4M75 A;  4N4G A;  4RCB A;  2I4N A;  3CCJ T;  5GAN 7;  1K73 C;  5KCO A;  4LDV A;  1YJW A;  2DU7 A;  1PSF A;  2JZ2 A;  1Q82 U;  2RJC A;  1E22 A;  3QDR B;  4LD9 K;  4Q5W A;  1X6O A;  4C0F A;  4IUU A;  1ASZ A;  3HL8 A;  3OYL A;  5CQX A;  3X20 B;  3SWN C;  4FT2 A;  1NJ1 A;  3HFZ A;  4M78 G;  4IUP A;  1NPR A;  5CVI A;  5C52 B;  2KMT A;  1YIT T;  4LVK A;  3BW1 A;  4B9X A;  1HC7 A;  4XTX A;  3MP6 A;  2EYQ A;  4DA4 A;  4P75 C;  3M56 A;  1U1T A;  4M7A A;  3NET A;  2LVM A;  3CPW S;  3CCJ A;  3CBO A;  4A54 A;  1YHQ T;  4YCU A;  3HPW A;  1K73 U;  2ZZF A;  4EMG A;  2CGH A;  5E3I A;  3FRN A;  3VV0 A;  4M7A G;  2O4X B;  5GMK i;  3PCO B;  2RA2 A;  3UGQ A;  4E51 A;  3N5B B;  4YRF A;  3I7F A;  3H8Z A;  1W2B A;  3JCM f;  2RI3 A;  5HK3 A;  4M75 B;  5GMK h;  3ME9 A;  2FL7 A;  5GAN h;  4H2U A;  1BBW A;  4KR3 A;  4BI3 A;  1EFW A;  1YIT A;  3S3O A;  4YRE A;  3I56 T;  2PUO B;  2ZT7 A;  4N0A A;  3SD4 A;  3NEN A;  3ZBD A;  1NPP A;  1N9S A;  1KC8 C;  2EJ9 A;  4P71 C;  3VUZ A;  5GAO m;  2DIQ A;  3JRZ A;  5FU6 C;  3RL6 A;  1YHQ A;  5M9O A;  2J3M A;  4EMK B;  5CCA A;  4KR2 A;  3HFZ B;  3OYI A;  5GAN 4;  3A8L B;  2CJA A;  3X26 B;  2DPP B;  4YP0 A;  1I5L A;  1H64 1;  3C12 A;  3TEG A;  5LJ5 e;  1X2H A;  2ART A;  1B76 A;  2ZT6 A;  1BYM A;  3RIR A;  2ZIO A;  4E7J A;  4HWS A;  4M7A B;  1E1T A;  4RQF A;  2LT4 A;  3I56 A;  2FYK A;  1KG1 A;  3UH0 A;  2YLB A;  4O5V A;  5D6W A;  3SWN A;  3OYG A;  1J5W A;  3FC3 A;  2DU5 A;  3HXX A;  3LSQ A;  2ZPB B;  2F5K A;  4UP7 A;  3VBB A;  4OF1 A;  4BY6 C;  4IUV A;  4K87 A;  3WXM B;  4WF2 A;  2VUB A;  3JCM h;  4FSX A;  1TH7 A;  2CKK A;  5CR2 A;  3I55 T;  2QXF A;  5GAN 3;  2WSE E;  2WAC A;  3CXC A;  3HRU A;  3R6O A;  3P8D A;  1G5V A;  3QII A;  2XGT A;  4O2D A;  3HRT A;  4J8O A;  2JN0 A;  3EFS A;  4P72 C;  2KK4 A;  2DAQ A;  3QYH B;  2ZPE B;  1JB0 E;  4M77 A;  3G71 T;  4II1 A;  3JCM P;  4EDU A;  1X55 A;  2QHT A;  4OB1 B;  2DEQ A;  5C53 B;  2V8K A;  5LL6 S;  5IN1 A;  5J26 A;  1H4T A;  2QI2 A;  2RHY A;  1XTD A;  2A3L A;  2ZNJ A;  1WQW A;  4M77 G;  4CS2 A;  3CCV T;  5IT9 E;  3OYE A;  1OZ3 A;  1UB4 A;  3O8V A;  4WI1 A;  4RG8 A;  1Y71 A;  1QVG S;  1Y07 A;  3I55 A;  4RMO A;  3OS2 A;  1KQS S;  1K9M U;  1HTT A;  1VQO T;  2CZ6 B;  4IUQ A;  4C92 A;  4HWP A;  1N9R A;  3PMT A;  3M57 A;  1USY C;  4P74 A;  3SWN B;  4V2S A;  3MQZ A;  2MWO A;  2K3Y A;  5CKB A;  4C92 G;  2LTO A;  2R5M A;  3P8H A;  3G71 A;  3OMG A;  4M75 D;  2QA4 T;  2E12 A;  1FYF A;  3OYC A;  2GQV A;  3QO5 A;  2Q5I A;  4GLK A;  3LGL A;  5GAO n;  3TU4 K;  5LJ3 f;  5ELO A;  4CS3 A;  3CCV A;  4ZTU B;  4OP0 A;  3V8L A;  1ATI A;  4J15 A;  1KD1 U;  5GMK m;  2R58 A;  3TRE A;  2G3R A;  5GAM d;  3VQW A;  1BKB A;  2RHQ A;  4XTV A;  5I21 A;  1VQO A;  4C0Z A;  1EVK A;  3PGG A;  3CCU T;  2ODR D;  5KH6 A;  3UWN A;  4TWA A;  4M75 C;  1YJ9 T;  3T9N A;  1S72 T;  2KAF A;  1PYS A;  2HD0 A;  2E41 A;  3NTI A;  1I8F A;  4HVC A;  4NL2 A;  3GLX A;  2R5A A;  3A74 A;  3M53 A;  2QA4 A;  4TQF A;  3CMQ A;  2RK1 A;  1W4S A;  3X25 B;  3URG A;  3L1A A;  4M7A D;  3PFS A;  4M78 C;  3MEY A;  4HT4 A;  2JUF A;  4P72 A;  4M75 E;  4J7I A;  5FU6 B;  4C92 B;  1YIJ T;  3CC4 T;  3AHU A;  2QQS A;  4C0D C;  4YRO A;  5GAN 6;  2L89 A;  3BDU A;  2ODR C;  3MET A;  1VQL T;  5D6Y A;  2RI5 A;  3MF1 A;  1QP2 A;  1JJ2 A;  4NS5 A;  2QQA A;  4QVD A;  4YRP A;  1G3S A;  2ZR2 A;  3QPH A;  1E1O A;  3ZFJ A;  3CCU A;  4YDQ A;  2E3C A;  1BI0 A;  2ZIM A;  3OW2 S;  2KVQ G;  5IAY A;  1YJ9 A;  2AKW A;  3OYN A;  4M7A C;  3JB9 G;  2ZPF B;  5GAO l;  1EOV A;  4PLL A;  4LVL A;  4M75 F;  2CIM A;  3M4G A;  2ZNI A;  5LJ3 h;  3A32 A;  4E7K A;  5DY9 A;  3M58 A;  1BI2 A;  3A8G B;  5GMK j;  2HQE A;  4BE1 A;  3V7C A;  2RHQ B;  4XTZ A;  5GAN j;  3CCM T;  4TVR A;  3RER A;  1YIJ A;  3CC4 A;  1G3W A;  2F69 A;  1Q82 C;  2ZZE A;  4M7A E;  1NJI U;  1WGS A;  3A31 A;  2R57 A;  3NEL A;  2CZ7 B;  3R07 A;  1E24 A;  4LVM A;  4XTW A;  1VQL A;  5FRO A;  2KSS A;  1PYS B;  1V29 B;  1NJ8 A;  3HTZ A;  3LWI A;  2E6Z A;  5KE2 A;  1RL2 A;  3Q1J A;  4N0A C;  3VU3 C;  3L2U A;  3LGF A;  3TEE A;  3L2Q A;  4O6J A;  2ARU A;  4H2X A;  2XI9 A;  5GAN 8;  2EAY A;  3SFM A;  2CZ1 B;  1JJC A;  2ZPI B;  1VQK T;  4RG2 A;  3LSS A;  4QVZ A;  3M4Y A;  1R8O B;  3RUX A;  4Y91 A;  2QHV A;  3L4G A;  4M7A F;  1N8R U;  1SSF A;  4PJO G;  5GAM e;  4YYE A;  2Q7G A;  3CCM A;  1NYQ A;  4C5H A;  1JRI A;  3L2W A;  3BDL A;  3QBY A;  4OMF B;  1WJQ A;  3JCM c;  4M7D G;  2P0Q A;  1VIE A;  2P0K A;  2AKW B;  3HSB A;  4M78 A;  5FLX E;  4P3P A;  3VYH B;  3QG1 A;  3HXZ A;  5LJ5 f;  3L2V A;  4FU6 A;  2DXC A;  2K57 A;  3KXT A;  2MWP A;  3PZC A;  3PIP A;  1QVP A;  3TEH A;  2CJB A;  2YLC A;  1VQ4 T;  1ZHI A;  3L2R A;  4MMK A;  4FL6 A;  1LOJ A;  1M1G A;  2OTL T;  3ASK A;  3CEY A;  4M77 D;  1FX7 A;  4RCC A;  3OYD A;  2XDP A;  3MCA B;  3A8M B;  3OYY A;  3VUB A;  3P8Y A;  4FIB A;  3RF1 A;  1IZ6 A;  4QQD A;  5GAO r;  3REX A;  1KQ1 A;  2EWN A;  3FEO A;  5GAN g;  4ZN3 A;  2ZT8 A;  3CPF A;  3G1Z A;  4PLI A;  3J80 E;  3E9G A;  5FU7 B;  4H2X B;  1X01 A;  3GNF B;  1K8A U;  3OD1 A;  1JJC B;  1HXD A;  4Q6G A;  4C92 D;  3M54 A;  1Q81 U;  3RAC A;  3A7A A;  2OTJ T;  3EFR A;  4JJN K;  4M77 C;  4ZGE B;  4GY5 A;  4JRK A;  4FM4 B;  1VQ4 A;  2DTI A;  3L4G B;  2LCL A;  2D0Q B;  3EAE A;  5K1X A;  2DVE A;  3HXW A;  3CBP A;  2DTH A;  3DB3 A;  3KBG A;  2OTL A;  4LDX A;  3MO8 A;  1B34 A;  3OBW A;  3MEV A;  3VQX A;  3JCM J;  5F5W A;  3CME T;  4YRI A;  4BDZ A;  4LDY A;  4M77 E;  4ATO A;  4M78 B;  2XDD A;  1D3B A;  5CQY A;  1JBM A;  3OYB A;  4C92 C;  4LVI A;  3HXU A;  3HXV A;  3HY1 A;  5LJ5 h;  5C51 B;  4C0D B;  4P74 C;  2Q7E A;  3HP9 A;  2A7Y A;  3A5Z A;  4C8Q G;  1G5H A;  1B70 A;  4ZTZ B;  2LQK A;  1H3Z A;  2DK3 A;  5FRN A;  2QHU A;  4CH3 A;  4C5I A;  3CMA T;  2P0L A;  4HCB A;  5A0D A;  1YCY A;  3LYI A;  2OTJ A;  3QO7 A;  1NZ9 A;  3IG2 A;  4C92 E;  2QTX A;  4L5G A;  3A7U A;  4YRM A;  1WJS A;  4M77 F;  3G4S T;  3QTC A;  2DTO A;  2AMC A;  2RHX A;  2Q7H A;  3CME A;  2ZR3 A;  2V8I A;  1YBY A;  3UT1 A;  3HHT B;  3OS5 A;  4G85 A;  4IUT A;  4IUR A;  5KE3 A;  3HKS A;  1UGR B;  4OLF A;  3FIF A;  5DLQ E;  2PVO B;  1UEB A;  4ELY C;  2WSC E;  2X4W A;  1M5Q 1;  4HWT A;  1K9M C;  4ME7 A;  2EJF A;  3MEA A;  4C92 F;  2QEX T;  2DO3 A;  1WYD A;  3P8T A;  2IY5 A;  3CMA A;  4J6X A;  3E9I A;  5CK9 A;  1X54 A;  4YRK A;  2XK0 A;  4KUD K;  2JTM A;  1B34 B;  1LJO A;  2PUK B;  3MEW A;  4BWA A;  4JRI A;  4OGC A;  1D3B B;  3TUP A;  4EMH A;  2HAX A;  3INZ A;  4YCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...