2E10A

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutation r51a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
217
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGESPEGGLWLSIVLSPKKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin Protein Ligase
molecule tags Ligase
source organism Pyrococcus horikoshii
publication title Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
total genus 66
structure length 217
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e10A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e10A01
1H4TA 1ASZA 3TUPA 4C92F 2G4CA 3HRKA 4H2SA 2QHTA 4H2WA 4PHCA 1MGQA 4PJOE 1FYFA 2AMCB 2DDZA 5LJ5e 4YRLA 3JB9J 4YRPA 5ELNA 3IALA 4J6XA 1N9SA 4J5YA 4UPAA 4A53A 4F7UE 4P72A 3QO8A 4P75C 2DZCA 4M75A 5KNNA 3A7UA 2K57A 4OP0A 2ALYB 1NYRA 4YROA 4EMKC 4EMGA 3LSQA 3VQXA 1B7YA 4PJOG 2QHSA 2HNIA 1B76A 1ADYA 2P5IA 3VQYA 3MEYA 5GAMf 4M7DG 4H02A 2ZZFA 1WU7A 4WJ4A 4J6WA 1RIQA 3PZCA 2DTIA 2FB7A 5LJ3d 5GAN7 1QE0A 4P72C 5GAMe 1WQ7A 3CMQA 4P75A 1D3BB 3P8TA 3HRIA 3EFRA 4WJ3M 3WQZA 4XTWA 3RIRA 4EMKB 2ZR3A 4EX5A 2DXUA 5LJ3h 2ZT7A 4TVAB 4N0AA 2DVEA 4C8QG 2QHUA 4M78E 4M7AA 4TTVA 4M77G 2ODRD 4LNSA 4F7UG 4CH5A 2EWNA 1EFWA 4XU3A 1G5HA 2DTHA 4F7UF 5GAOr 2CJ9A 2RHSB 4UP9A 1YB3A 4YRKA 4HWSA 3JCMh 1E1OA 1J5WA 4P74A 4RQEA 2YLBA 2RA2A 2ZINA 4C8QF 2EAYA 3L4GB 4C8QC 3JCMX 12ASA 1USYC 3TEGA 4BWAA 2EL9A 4UP7A 1W66A 2AKWB 4WF2A 4HWPA 5GANf 2RHQA 4YP0A 1B34B 4M78C 4YYEA 3HFZB 4WI1A 1NJ5A 4TVYA 2ZT8A 1KQ1A 3A5YA 4TQFA 3JB9H 2ZZGA 3M4PA 4M7AF 1KMNA 2PMFA 2ZZEA 5LJ5j 5E3IA 4HT9A 1JRIA 3QNEA 5LJ3f 4M77A 3TEHB 1WYDA 3FB9A 4KR3A 1M5Q1 3AHUA 1LYLA 1U1TA 5LJ3g 3GIBA 2RHSA 5GMKj 4C92B 3JCMW 2CJAA 4TQDA 1ATIA 1BIAA 2E64A 1EOVA 4K88A 3RF1A 4RCBA 3V7RA 4YRIA 4XU0A 5ELOA 2I4OA 3V7CA 3PCOB 3MF1A 5GAN6 1IL2A 4M7AB 4EMHA 4C92G 2QTXA 3SWNC 1I8FA 3UGTA 1N9RA 1LJOA 4QVCA 3IG2A 5GAMj 4PJOD 4YRGA 3A32A 3JCMe 3V7SA 2CGHA 1WPYA 4XTYA 2E65A 2YHTA 4M75D 2E5AA 4X9CA 3A7RA 5K1PA 1H641 3QO3A 2Q7EA 2AKWA 2EJGA 4HWRA 2E41A 2Q7GA 4M7DE 1TH7A 3EFSA 1KQ2A 3QO7A 5HGQA 3A31A 3I7FA 4XTUA 4L87A 1KMMA 1NYQA 3QSUA 3JB9G 1NJ8A 3IKMB 4P3PA 4CH6A 3HXYA 2DU5A 5GAOp 4JRIA 1L0WA 3V8JA 4M7AC 1G5IA 4ZIBA 2VXEA 1JJCB 1YFRA 4M75G 3L2ZA 4C8QE 4OLFA 4C92A 3JCMg 4JUVA 1Y96A 4YPFA 2I4LA 4HVCA 4P74C 1H4SA 1B70B 4P73C 4M78D 3QTCA 3JB9I 3PCOA 5GAN8 2ZT6A 4H2UA 2IY5B 1YCYA 3HTZA 4M75E 3VQVA 2JN0A 1B70A 4YRMA 1Y96B 4YRSA 5LJ5g 1X2GA 3M4GA 1BBUA 1Z7MA 2I4NA 4YRFA 5LJ5h 3HFOA 4C92C 4M78G 4XEOA 3BJUA 1HXDA 3JCMP 4UP8A 4C8QA 2Q5HA 4MMLA 2PMEA 1B34A 3V8KA 2Y90A 2DTOA 1X54A 3KFUA 1GGMA 4KQEA 3NELA 1EQRA 4H2YA 2ZXFA 1LNXA 2CJBA 4O2DA 5GANh 4C8QD 3SB2A 1NJ1A 3JB9D 3HY0A 4Q15A 4EMKA 1NNHA 5GAMg 3ICAA 3LC0A 4Q6GA 3TEHA 3HXXA 3MF2A 4TWAA 4NL3A 4N0AC 4H2XA 3JCMQ 3VQWA 1PYSB 2J3MA 2DXTA 2XTIA 3P8VA 5GAMd 3BY7A 3RGLA 1U1SA 1B7YB 4YRCA 4YRRA 5GAOn 4P71A 1C0AA 1HTTA 3NETA 5GAN4 1WNLA 2DZ9A 1X56A 5GAOm 4RCCA 4M7AD 4G84A 3RERA 1NJ6A 1LOJA 4NL2A 3L1AA 4CH3A 1SERA 3JCMV 2E3CA 2ARTA 1USYA 1N9WA 2QHVA 2XGTA 3HXUA 4H2VA 1ASYA 4M77D 3RACA 2ALYA 4M78F 3RL6A 3V8LA 5DY9A 2DJZA 3E9HA 4XEMA 5LJ5d 4CS2A 1JJCA 3INZA 2VC8A 3G1ZA 3VBBA 4KR2A 3RKYA 3RESA 4HWTA 1E1TA 4M7DD 2IY5A 3HXVA 4RDXA 4BW9A 2ZCEA 4RMFA 3UH0A 4M75C 4M75F 3RKXA 4G85A 4PG3A 3W3SA 4XTXA 4HT8A 3JCMc 2RHQB 5GANg 3QO5A 1WLEA 2C8MA 4H2XB 4CS4A 4PNOA 4ZTZB 2E1HA 4H2TA 3JB9F 4C92D 2DQ0A 3HFZA 3M4QA 2CIMA 3HFVA 1I81A 4TVWA 2ZNIA 1Z7NA 1YFSA 1HC7A 1EIYB 4YCWA 1SRYA 4M75B 4M78B 1KOGA 2ARSA 4TVAA 4X9DA 1BBWA 4PJOB 4M77B 1X2HA 5K1XA 1HK9A 3FJPA 4YRTA 3QUIA 3BW1A 3A7AA 4NCXA 5CAIA 3P8YA 4CS3A 5C52B 2ZT5A 5GMKh 4CH4A 2YLCA 3IKLA 5GMKe 3HFNA 3RUXA 5I21A 5GMKl 4V2SA 3NENA 4QVDA 5LJ3e 2DKGA 3UGQA 2ZIOA 2RB6A 5GMKm 5LJ5f 1YFTA 4ZTUB 4M7DA 2P0LA 5GAMh 2I4MA 2ZIMA 5GANj 2EJFA 4J15A 3ERRA 1I4K1 1SESA 1YGBA 3E9IA 3RKWA 4XQ3A 3UFGA 4YREA 2AMCA 1X01A 4YRQA 2EJ9A 3DSQA 4F7UB 3BDUA 1SETA 4JLIA 5GAOq 3HY1A 3LSSA 1EVKA 2ODRC 4C8QB 4M7AG 3PGGA 4M7DC 4P73A 3REUA 3JCMd 4HA8A 4F7UA 3L4GA 3OD1A 1H4QA 3VU3C 2Q5IA 1H4VB 2E10A 1EVLA 4EO4A 3SWNA 4M7AE 1M8VA 1G51A 2FYKA 5F5WA 3REXA 4Y91A 4X5OA 4M7DB 5GMKi 2RD1A 4YRJA 4JRKA 4HWOA 1QF6A 4M77E 3SWNB 1X55A 4XTVA 2ARUA 4YDQA 1VQZA 1NJ2A 1E22A 5GANd 1PYSA 4J6YA 1ADJA 11ASA 3A74A 5C53B 2ZTGA 1I5LA 3JCMb 5GAN2 4AH6A 4PJOC 4DQ2A 4P3NA 2I2LA 4M77F 2ZNJA 4YRNA 3FIFA 1E24A 2J3LA 1EIYA 3JCMJ 4NOYA 4XTZA 4P3OA 3R07A 2DEQA 5GAN3 4P71C 1JBMA 5GAOl 4DPGA 4XU2A 1B8AA 4E51A 3NEMA 3A5ZA 1BIBA 2RM4A 5LJ3j 4PJOA 4K86A 5C51B 1D3BA 2DQ3A 1WQWA 4C92E 3HSBA 4YCVA 4M7DF 4A54A 4XU1A 3JCMf 4MMKA 3HXZA 5GAN5 4PJOF 5GANe 4K87A 3QHSA 2ZR2A 4M78A 4M77C 4RQFA 2ZGWA 3HXWA 2C7IA 2VXFA 2Q7HA 2DU7A 3BFMA 4YCUA
chains in the Genus database with same CATH superfamily
3JSCA 1H4TA 4HKEA 1PC0A 1FMVA 1YITQ 2QTVA 2EQUA 4AFZC 2QA4T 4YRLA 1D1BA 5FU7C 2XG8D 3H0HA 3A8GB 1N9SA 4UPAA 4LN2A 4OB0B 4A53A 2FPDA 2NWMA 2EQKA 1OI1A 3O8VA 4AG2C 2FVUA 3M0TA 4P75C 2CZ0B 3CCEA 1VQ7A 1VIEA 4OP0A 1NYRA 5A0GA 4RG8A 4EMKC 3PIOA 3VQXA 2HL3A 3CCST 1AWOA 2WSCE 4DBFA 1K0XA 1B76A 1ADYA 4E47A 1WXTA 3VQYA 2H8HA 5KYWA 1LCKA 3OYYA 4M7DG 2ZZFA 5KCOA 1WU7A 1UJYA 1OU9A 3CMQA 1YJ9A 4TVRA 1FMKA 3G7ZA 2FZCB 4BD3A 3WQZA 1YITT 2OTJA 1RAHB 1OV3A 4M78E 2BKDN 1NYFA 4TTVA 4RTWA 4LNSA 3D7SB 4PJNA 3OYAA 4WTOB 2EWNA 4CH5A 3UA6A 5J3BA 1T3LA 3HPWA 4HCZA 1VQ5Q 4F7UF 4RUGA 2A7YA 2ZPGB 4IUUA 1K8AC 1E1OA 2QAZA 4R55A 1K9MU 1TS9A 3OBYA 1K76A 2YLBA 2ZINA 4RKUE 2EAYA 4E7SA 1USYC 4BWAA 1W66A 3FLGA 4WF2A 1YI2A 2HBWA 4YYEA 2COZA 1YFNA 1QCOA 1VQ4A 1VQ9T 2E5KA 1ZSZA 2ZT8A 1KQ1A 4GLMA 4LUEA 4TQFA 1QWEA 3L2UA 1PRLC 3GOXA 3J7AF 2LCCA 1W2BA 1MMAA 1JRIA 2DJQA 5LJ3f 3P8HA 3A8OB 4KR3A 2LJ0A 2QEXA 1U1TA 3PE0A 5LJ3g 3M0RA 4FM4B 4TQDA 1HJDA 1QP3A 4RCBA 1OX8A 1VQKT 1K9MR 2E3IA 5KYUB 1KD1R 1GCPA 1K4US 3SWNC 4ANJA 3UGTA 1LJOA 4QVCA 4RG2A 2BZYA 2LTOA 5L23A 3CCJQ 4PJOD 4LNPA 3C4SA 1YJWA 2CDTA 1NZ9A 3M53A 2CGHA 5DLQE 5CVIA 1YJNT 4FL6A 4LVJA 2DFUA 2E5AA 1K9MC 3A8MB 5I2SA 2L3RA 4JLGA 3M55A 4QKUA 1X6GA 1JJ2A 2AKWA 4FSSA 3I35A 2GNCA 4MDWA 1WXBA 2RPNA 1JO8A 1RL2A 3EFSA 2D0NA 1JQQA 3QO7A 1UGSB 4BY6C 1Y07A 5IT9E 1VIFA 4E7LA 1KMMA 4B9XA 4CH6A 4C5HA 3F70A 2RJDA 3EGUA 4M7AC 1G5IA 3VS6A 3OS0A 1Q81R 2AHJB 1GCQA 4C8QE 2V8IA 4BE2A 3JCMg 2ED0A 4JUVA 2QQBA 4LUDA 3X28B 2MI6A 1H4SA 4N4IA 4P73C 3QTCA 3MEAA 3PCOA 3GBQA 2ZT6A 2SEMA 4LVLA 3CCVA 2F2VA 3EG1A 3HTRA 3VS1A 3OYEA 1VQNQ 2GGRA 1B70A 1KC8U 3VS5A 1TSFA 1EZZB 4OGCA 1Y96B 4YRSA 3WVDB 4HVWA 3OYJA 1VQ4T 3G6EA 1BBUA 3ZFJA 4LDYA 2I4NA 4K11A 3QDFA 3EGXA 1MMDA 2MIOA 2KYBA 1XTDA 1NJIC 2K6DA 1HXDA 2B8AA 2EGCA 3JCMP 1BBZA 2EQJA 1YJNQ 3CXCA 1YHQQ 1RABB 2HCKA 3V8KA 4LD9K 2RO0A 5KH6A 1RLPC 2KQWA 2K5FA 2AK5A 2GCXA 3OYNA 4KQEA 4ZGJB 3QKJA 1EQRA 1D09B 3KFVA 2D9TA 5LL6S 1QVFS 2DNUA 3ICAA 2LP5A 2A8EA 4QT7A 4BE1A 4N0AC 3NTKA 3BE3A 5IAYA 3VQWA 3MEWA 1RAAB 2DXTA 5GAMd 1U1SA 2OTLT 2K5LA 2KY9A 1NEBA 1WNLA 2DZ9A 2R58A 1IHWA 5GAOm 2HKNA 4RCCA 1IGUA 3I55Q 2EIFA 4Z8AA 4ATOA 1NJ6A 2LC4A 4F14A 2RQWA 3PVLA 4C0ZA 3MP1A 1ZLMA 2QI2A 2QHVA 1ZBXA 2XGTA 3VS7A 3RACA 2V8KA 3JV3A 4M78F 3RL6A 2CREA 5FU7B 5LJ5d 4IUVA 4CS2A 1Y57A 3OYIA 2VC8A 3VBBA 5CKEA 1NBEB 2DF6A 1RI0A 3RESA 2DXBA 3QIIA 4QW2A 1OX9A 3MO8A 4HWTA 3CD6A 1GBRA 5IHNA 4M75C 4MDXA 2SRCA 4M75F 4LXCA 2JNGA 2IIMA 4HT8A 2G6FX 1VQNT 2DL7A 1KC8C 1CSKA 4XK8E 2E1HA 1B7TA 2PTKA 3JB9F 4Y28E 2PVDB 3VS0A 3UDCA 1Z7NA 1X43A 1EIYB 3OYHA 1SRYA 1G5VA 4M78B 4JPBW 4ESRA 2QGGA 1BKBA 2ARSA 3EHQA 1Q7YU 1VQ9A 1KC8R 1NM7A 1V1CA 2RI2A 1SPKA 4X9DA 5KYXB 4PJOB 5K1XA 2LQWA 2RHXA 4YRTA 1WHMA 4B6MA 5CAIA 3P8YA 5GMKh 1TWBA 1MNEA 5I21A 1M30A 3UGQA 2YSQA 4QVDA 2FRYA 3CCLQ 5GMKm 1VA7A 3LGLA 2MF2A 5GAMh 5FU6B 5ECAA 4J83A 1I1JA 5HCKA 1I4K1 3L2WA 3RKWA 1YP5A 1NLOC 2RK1A 4HXJA 3G71Q 2AMCA 4YREA 4YRQA 2EJ9A 4O6JA 3UATA 4F7UB 2RNAA 3CCQT 5IHIA 1SETA 3R6OA 3N5BB 3UPUA 4E7KA 2ZPEB 4CC2A 1N27A 1PD1A 4C8QB 2F1LA 3PGGA 1W4SA 2V8JA 4HA8A 1SHGA 4F7UA 2A08A 3M59A 3L4GA 1H4VB 2JTFA 1BI2A 1QVPA 1M3BA 4EO4A 3A8HB 1VQ7Q 4JJBA 4LDVA 2LQKA 9ATCB 5F5WA 2DYIA 3G71A 1AZGB 3NHNA 2QDLA 4HCCA 2M51A 2AIRB 2EVRA 4JRKA 1SHFA 2DBMA 4N4GA 3SWNB 1HSQA 4XTVA 1XNIA 1VQZA 4J9DA 1U3OA 1WX6A 3S3OA 1NJ2A 1PYSA 4M4ZA 1JJ2P 4J6YA 2X4WA 3A74A 1S72A 5C53B 2CP7A 2CT3A 1I5LA 3JCMb 3QJYA 3CCET 1AOJA 4DQ2A 1SEMA 4P3NA 3OS5A 4M77F 3ZBDA 1KIKA 4YRNA 1TUCA 1QQJA 2JW4A 3VUZA 3PMTA 3TCJA 3MPUB 4E7ZA 1P92A 4RTVA 4ELZC 2YUOA 1G2BA 5GJVB 1B8AA 2KT1A 3A5ZA 1BIBA 2RM4A 5C51B 1D3BA 3UA7A 1IGQA 2JT4A 1GL5A 3CCVQ 4Q5WA 4KGXB 3JCMf 3CC4T 4MMKA 4JJDA 2F5TX 2L3QA 3HL8A 2BZXA 2VXFA 2Q7HA 4EDUA 2G4CA 4H2SA 2QHTA 4PHCA 2PVGB 4PJOE 2NLUA 1FYFA 3GNGA 1JXOA 4KULA 4YRPA 3IALA 2AKKA 4J5YA 1M90C 4PFZA 3EFOB 4ZNXA 3QO8A 2O31A 4M75A 5KNNA 2JJ9A 2ALYB 3H41A 3LSQA 1YWOA 3EG2A 2PZ1A 3UWNA 2HAXA 5EG2A 1RAIB 3MEYA 1NJIU 4UC4A 2Y4YA 4DOVA 5IN1A 2MAMA 4WJ4A 1OPKA 2QGFB 4J6WA 2DTIA 2EGEA 2JXBA 5LJ3d 2ZPHB 2CH4W 4P72C 3J80E 3EG9B 2EPDA 3CCQQ 5J39A 3A5ZB 2CUDA 4XTWA 3LX7A 3RIRA 4A4KA 2KRMA 5LJ3h 1VOMA 4FSXA 1O9SA 2KAFA 2A36A 2CKKA 4M77G 2ODRD 2QK0A 4F7UG 2QEXQ 1KK7A 3PIPA 2JS2A 1PSFA 4D8KA 2CJ9A 4UP9A 2QASA 1J3TA 3DLLA 1YB3A 3CMAT 4RQEA 2KXCA 1UECA 4A4FA 3UT1A 1N8RU 4C8QF 2MPXC 4C8QC 1KQSA 3PNWC 2XDBA 1T0HA 1ZX6A 2JS0A 2JMAA 1W2BP 4A63B 1FWZA 4HWPA 5GANf 4YP0A 5D6WA 2NYSA 1VQOA 3HFZB 4WI1A 3H8ZA 2D6FA 3MHXA 4E7JA 2ED1A 2BIVA 2DILA 4C0GA 2M0YA 5AYFA 3PT9A 1MV0B 2RQVA 5D7UA 1LVKA 3LWIA 4M7AF 2JOYA 2MCNA 5E3IA 4HT9A 1RAGB 3CCRT 3TEHB 3CPWP 1M5Q1 1BI3A 4JZ4A 3GIBA 3PVQA 5GMKj 3JCMW 4BY6B 1EOVA 2E12A 3H0IA 1VQPT 4LDUA 1VQLQ 2IG0A 4J7FA 3PCOB 4OB3B 1IL2A 4E7IA 4M7AB 4EMHA 4PL6A 5I22A 4C92G 2QTXA 1SG5A 3G6ET 1TU0B 3CEYA 1SRMA 2KR3A 4AFQC 4BUGA 3JCMe 3A32A 4RTUA 2RQUA 2YWWA 3OYDA 3CCVT 4F04B 2YHTA 3CCJT 2GFAA 1KD1C 2X3WD 2CYZB 1YJWQ 3I55T 1UGPB 5FLXE 3QO3A 2M02A 2M16A 1M90U 2RH2A 2E41A 5CCAA 4J9CA 1M1KU 1FX7A 1M4ZA 2EGAA 3I7FA 4FYWB 4R0KA 2CZ7B 4XTUA 4F17A 2DRKA 3HXYA 2DU5A 2KVQG 1L0WA 1VQ6A 2J05A 4ZIBA 4M75G 4DBHA 2DX1A 1W2BS 2L3PA 4PJJA 3CD6T 1UFFA 2J6KA 5D6XA 1VQ8A 2I4LA 1SRLA 1OYXA 4ORZA 4M78D 1YCYA 4M75E 1R8OB 3P8BB 1VQ9Q 2KRNA 1XOVA 1Q81C 3VJPA 2Y4XA 1KHIA 1K73R 5LJ5g 1X2GA 3M4GA 1Q86U 3EHRA 5LJ5h 2J7IA 2HL5C 3C94A 1PKSA 4LDWA 1GXIE 3CBOA 4XEOA 2DE0X 3H9NA 4UP8A 4MMLA 1M2VA 1UG1A 1X54A 1WDXA 2BUDA 3KFUA 1GGMA 1WZOA 1GRIA 1AWJA 4H2YA 2CP0A 1VQ5A 2OJ2A 4KUDK 4O2DA 1S72Q 3S3NA 1TTHB 3SB2A 3PTAA 3JB9D 1NJ1A 1VQPA 1G3WA 1YWPA 3ER0A 4ZGDB 5GAMg 4BB7A 1BYMA 4NL3A 4H2XA 3G1JA 2HSPA 3JCMQ 2XTIA 4AFUC 2CP5A 1B7YB 1WA7A 4DBQA 5GAOn 2DK3A 2VKNA 3TVTA 3CCRA 2HDAA 4OB2B 1HTTA 1ABOA 1C0AA 1K8AU 2QQRA 3C95A 2LX9A 1VQ8T 3M5AA 3VYGA 5FWCA 1UUEA 2MWOA 2BE9B 4YTLA 1IHVA 1YIJQ 3L2QA 4AMCA 3JCMV 4H2VA 1TG0A 2QQ9A 2ALYA 3M4YA 3EAEA 4XEMA 1GCQC 2PUOB 4KUIA 2KXDA 3ME9A 1M3CA 1JJCA 1H3HA 3G1ZA 4KR2A 3RKYA 1C6VX 1YITA 2Z0WA 2DO3A 4RDXA 3M58A 1O75A 2O2OA 3RKXA 4PG3A 4J9HA 3M9QA 1T3SA 2NUTA 2DL4A 2XK0A 2RHQB 3QO5A 1WLEA 2LNVA 1CKAA 5FROA 4PNOA 2VYTA 4ZTZB 3GLXA 2R5MA 4IIOA 4C92D 2DQ0A 2RI3A 1X27A 2LQ8A 3VUBA 3HFVA 1AEYA 1WFWA 3E9GA 1VQMT 3WXMB 2XHCA 3X25B 1BU1A 3M54A 1M3AA 1YFSA 8AT1B 2FRWA 4CC3A 4DA4A 4JJCA 3GP8A 2EYYA 1E6GA 1HK9A 3FJPA 2JM9A 2CSIA 4NCXA 3A7AA 1PCXA 5C52B 2ZT5A 2COWA 2I0NA 4CH4A 3IKLA 1WHJA 3NTIA 4V2SA 2DL8A 1WHKA 2CSQA 2J6FA 4ZTUB 2QEXT 1NLPC 2YUQA 2I4MA 2P0QA 2C0OA 1HD3A 2K5IA 1BI0A 1SESA 1E6HA 3E9IA 1BI1A 2W10A 3HRTA 3VS4A 2PUKB 1VQ5T 2HBPA 1PHTA 4BDYA 2FO0A 3QPHA 4JLIA 2GTJA 5GAOq 3H0FA 1ACMB 1NPPA 2J6OA 2LCSA 4P73A 3REUA 5AT1B 5FRMA 1H8KA 2FZGB 3CCJA 2OTLA 1OPLA 3HP9A 1WJSA 1IZ6A 2QXFA 2CT4A 4DEYA 1HYOA 4FU6A 4HWOA 1F1BB 3VRZA 4BDZA 2XIDA 4PJMA 5L8RE 4YDQA 2P0KA 1E22A 2ROLA 2HMAA 2X9HA 1WJRA 11ASA 5CIUA 3QYHB 4MZTA 2QQAA 2ZTGA 1YNZA 4BI3A 5GAN2 5C6SA 2GBQA 4F16A 1D1AA 2I2LA 3LYIA 1Q82C 3G4SA 2ATCB 2ROTA 2XU8A 1UHFA 1E24A 1EIYA 4LVMA 4PFPA 4JJNK 4NOYA 3OQ5A 4XTZA 2A0FB 3CMAA 4P3OA 4D6WA 3KXTA 3MP8A 1NE8A 1S72T 2C0TA 4DPGA 2RMOA 2YUPA 3TSZA 1IB8A 4K86A 2K79A 2CS7A 1U06A 2DQ3A 4C92E 1MHNA 3E2UA 3A98A 3G4SQ 2VWFA 3SD4A 5CKDA 1AWWA 2YRCA 4E6RA 1D1CA 4M78A 3WVEB 5CR2A 2EKHA 1M90R 3M0SA 2RHIA 5A0LA 5KYNA 5FRNA 4C92F 3HRKA 4ME7A 4RTTA 1I5OB 3MCAB 1MGQA 2XICA 2AMCB 1JB0E 1RACB 2DDZA 5LJ5e 3OYMA 2M0OA 3JB9J 5ELNA 4J6XA 1Z9QA 1D0XA 1Q95G 4P72A 5J26A 2DZCA 4X1VA 2FHDA 4JRPA 3A7UA 1X75C 2OTJT 1B7YA 1QLYA 4PJOG 4CC7A 2HNIA 2YDLA 2P5IA 1IRXA 1PD0A 5GAMf 3TQ7P 2D1XA 4C5IA 1QVGS 4H02A 5CQXA 1RIQA 2R5AA 3PZCA 2FB7A 1KG1A 4ZTFA 5GAMe 1XJWB 4P75A 1D3BB 1SF9A 2RJEA 3DLMA 3P8TA 3HRIA 3EFRA 1X6BA 2EYQA 4WJ3M 8ATCB 3OS2A 4EMKB 2ZR3A 1OZ3A 1R77A 1R0BG 2DVEA 1MNDA 3EG3A 4C8QG 1Q7YR 1ZSGA 4C5GA 4J9FA 1B3QA 2NUPA 1WGSA 2LT4A 1M1GA 4Z02A 2AZVA 3SEMA 4XU3A 4DOWA 3CCEQ 1G5HA 4J9GA 1AD5A 5EC7A 4ZN3A 3MEUA 4YRKA 2KNBB 3JCMh 1J5WA 1NG2A 2CP6A 2GQIA 2XI9A 2PNIA 2IVWA 2ESWA 2L2PA 1N8RC 2X51A 4LE9A 3TEGA 4KH0B 2DEUA 1VQKA 2LMJA 2EL9A 4UP7A 2AKWB 1G3TA 2RHQA 4M78C 3L2VA 1YI2Q 3SDZA 1NEGA 4FW1A 2F5KA 2VV5A 1ZA2B 3JB9H 4J9BA 5I2MA 3CCLT 2ZZGA 1M2OA 3CXCP 1X2QA 2ZZEA 3CC7Q 5LJ5j 3QNEA 3CC7T 2WSFE 1WYDA 3FB9A 2HZYA 5D6YA 3RR6A 2FG0A 2RHSA 3ASKA 4C92B 1YJWT 4K88A 1BIAA 2E64A 2LT1A 5ELOA 1G3YA 2I4OA 3V7CA 3E19A 1YI2T 3MF1A 4PFOA 1ZQ1A 2VVKA 5IXFA 3MEVA 1I8FA 3X26B 2MK5A 1N9RA 3QBYA 2QDYB 5GAMj 1ARKA 3SFMA 2K7AA 3A8LB 1KHCA 3V7SA 4KBMB 1U5SA 1G3SA 4M75D 1I07A 4RTZA 1IXDA 4C0DC 5K1PA 1H92A 2DIQA 1RAEB 1EIFA 3DB4A 3M0PA 5KYYB 4HWRA 2HEQA 2Q7GA 4M7DE 3A31A 3QZ9B 4L87A 3EH1A 2ECZA 4P3PA 4CC4B 2K2VA 3VS3A 3OY9A 4C0FA 2DYBA 3OW2S 2HD0A 2JTMA 2VXEA 3I55A 1JJCB 1YFRA 4NS5A 4QVZA 4D8DA 4GBQA 4OLFA 2NUZA 4OMMA 4IURA 2A37A 4FYVB 1Y96A 4YPFA 3LW5E 4HVCA 4Z88A 3T9NA 1WHLA 3JB9I 5GAN8 4H2UA 2IY5B 1VQLA 2JN0A 3VQVA 1TUDA 2L89A 1Q86C 2E5QA 4N4HA 3CC2T 4MZPA 4QQGA 3URGA 1ZUKA 3NFCA 3L2RA 4YRFA 1WXUA 4C92C 1M2VB 1D0YA 2L0AA 1QVGA 2F2WA 4Y92A 5GJWB 1UGQB 4C8QA 2Q5HA 1B34A 3OYFA 2E4HA 3CPFA 2Y90A 2IPOB 2QYZA 2B86A 3NELA 4ELYC 2M1HA 4Z89A 2ZXFA 3AT1B 1LNXA 5GANh 2YXYA 1QWFA 1M8MA 4Q15A 2X4YA 3HHTB 4JS5A 1IO6A 3I56A 5HK3A 3LC0A 4Q6GA 1NJIR 3NTHA 1VQKQ 3HXXA 2CZ6B 3MF2A 4TWAA 3ULRB 5KE2A 2J3MA 2PU9B 4BI4A 1VQOT 3P8VA 1SSFA 3BY7A 4FIBA 3OMCA 4P71A 2X4XA 4FYYB 3NETA 1UDLA 5GAN4 1Q7YC 2DETA 2KMTA 1UE9A 4L5GA 1YIJT 4G84A 3RERA 1MUZA 1WHGA 1VQ6Q 2HKQB 1RLQC 1LOJA 3TREA 4HT4A 3L1AA 3CBMA 1SERA 3HXUA 2ZZDA 1USYA 1N9WA 2KRSA 1YCSB 4M77D 4CI0C 2W0ZA 3IQLA 1KSWA 1FMWA 1WYXA 3E9HA 4JS4A 1EX4A 1KQSS 5FWBA 1N8RR 4R56A 3EGXB 3OYKA 2JMCA 1OOTA 3MP6A 2EBPA 4DBRA 4ZGEB 1YHQT 1FXXA 2MMPA 4AT1B 3NPFA 1T0JA 1E1TA 3CC4A 3CMET 2K3YA 3REAB 3UH0A 3W3SA 3MJXA 4XTXA 2DERA 3JCMc 3M56A 3CPWS 4H2XB 1PM3A 1VQLT 3OW2P 4CS4A 1BB9A 2O9VA 2RK2A 3U23A 4H2TA 3L42A 4AFSC 1AWXA 3HRUA 1SSHA 2CIMA 2GF7A 4GY5A 5KYUA 1I81A 2ZNIA 4A4EA 2DLPA 2FPEA 1HC7A 2LJ3A 4M75B 3LH5A 3S3MA 2V1QA 3QG1A 1VQNA 4TVAA 4RMOA 1W6XA 2LNHB 4FCYA 1VQ6T 1BBWA 2WSEE 3ZL7C 1X2HA 2R57A 5HK0A 3QUIA 2DXCA 3BW1A 2KT8A 2ZAEA 3CPWA 2KI7A 3REBB 2BTTA 2P0PA 2YLCA 2RN8A 5GMKe 3HFNA 5GMKl 3NENA 4L59A 4OMQA 1UHCA 6AT1B 4OVAA 1VQOQ 4ZN1A 2ENMA 2RB6A 5LJ5f 1UGVA 1M1FA 2P0LA 1QCFA 3S6WA 2ZIMA 5IXBA 3CMAQ 1VUBA 4IUQA 4J15A 3ERRA 4XQ3A 1VQMQ 3UFGA 3DSQA 3BDUA 3HY1A 4XAXB 3LSSA 3PFSA 1KQSP 2ODRC 4M7AG 4M7DC 3JCMd 3OB9A 5DLOA 1YBYA 2YRDA 2WACA 1H4QA 3VU3C 3EG9A 1C1AA 3EGDA 1OU8A 2EYZA 3CCSQ 3J81E 3SWNA 4M7AE 1QKXA 3CCQA 2FYKA 3OYBA 3REXA 2KDSA 1G83A 3CXCS 4M7DB 5GMKi 4YRJA 2OTLQ 3EGDB 3RNJA 4DEXA 4J8OA 1QF6A 2F2XA 2JZ2A 3FRNA 1K73U 1X55A 5KYXA 2CUBA 2JUFA 3CQTA 4FT2A 1ADJA 4LD6A 3QZ5B 1WIEA 1PG5B 2GQVA 3EG0A 2RHYA 1PSEA 2ABLA 2BE7D 4OF1A 3QWYA 3LH0A 4E7HA 2ZNJA 3FIFA 2J3LA 1ZA1B 2DRMA 3JCMJ 1TUGB 2DEQA 5GAN3 4JZ3A 4P71C 1JBMA 4BE0A 1RUWA 5GAOl 4E2FB 1W1FA 4FYXB 3X24B 5IH2A 4OB1B 4L6V5 1W70A 4HVVA 4AG1C 3HXZA 5GAN5 3LWHA 4K87A 1BCOA 1OZ2A 4M77C 2ZGWA 2ZPFB 4PLLA 2PVOB 2C7IA 4KGZB 3M0QA 3TSWA 3BFMA 4YCUA 4FT4A 2L3SA 1ASZA 3TUPA 2A3LA 1LPLA 3FDRA 4EPCA 4H2WA 3OMGA 3I5RA 1AVZC 3RBBB 2VUBA 4KH1B 4KGVB 2JVVA 4F7UE 2K57A 4YROA 2RF0A 4EMGA 3VV0A 4HCBA 2YRVA 2QHSA 1VYUA 5FW9A 2AKLA 3TEEA 5CK9A 3TU4K 5M9OA 3GPLA 2JTEA 4MZMA 1G8XA 4IIMA 5GAN7 1KD1U 1QE0A 1WQ7A 1AHJB 4J7IA 1S1NA 2EYXA 1QMCA 7AT1B 1WHHA 2LVMA 2DD5A 5I11A 2DXUA 4EX5A 2ZT7A 2K4YA 4TVAB 4N0AA 1NYGA 2QHUA 3QWXX 4M7AA 3PMIA 4ZTJA 3E9FA 1TXQA 2OAUA 5KCHA 1EFWA 2XKOC 2DTHA 5GAOr 1UEBA 2VGMA 2RHSB 1IREB 4HWSA 4A4GA 2DA9A 4VUBA 4P74A 1VYVA 2RA2A 1VYTA 5IHKA 3GNFB 3L4GB 3JCMX 1FYNA 1V29B 12ASA 4P5NA 1B34B 2E3HA 3CC2Q 1CKBA 1ABQA 1C0MA 1NJ5A 1K8AR 1MMNA 4TVYA 1N5ZA 1Y7XA 2OX7A 3A5YA 3VRYA 2HQXA 1ZSZB 3CCUQ 3M4PA 1Y71A 2A28A 5CKBA 2K2MA 1KMNA 1VQ8Q 2PMFA 2RQTA 3HKSA 4M77A 4JRQA 3RDVA 3X20B 3AHUA 1LYLA 3R6NA 2KSSA 2CJAA 2ZCFB 1ATIA 3RF1A 2EW3A 3V7RA 2O88A 4YRIA 4XU0A 2O01E 3O5ZA 5GAN6 3C12A 2P84A 4C0DB 2MOXA 1QP2A 2EFIA 1VQ7T 2BZ8A 1H3ZA 1WLPB 4FW2A 1A0NB 1SKUB 3IG2A 2PQWA 5A2QE 4YRGA 2LZ6B 1RI9A 1YIJA 1WPYA 5CQYA 3BDLA 2E65A 4XTYA 4X9CA 2O4XA 3A7RA 2COYA 2JM8A 2NS6A 1Z9ZA 1H641 3OSVA 4IUTA 2X4JA 2Q7EA 3G71T 2FEIA 2EJGA 1QCNA 4B9WA 3OYCA 1K0SA 1TH7A 1KQ2A 2X35A 4GLKA 1RADB 5KYWB 5HGQA 1JU5C 3C0CA 2M9UA 5KE3A 1NYQA 3QSUA 1MMGA 3JB9G 3A1PA 1NJ8A 3IKMB 3JRZA 3THKA 5GAOp 1GBQA 4OGEA 5HY6A 4JRIA 3VKIA 3V8JA 5DM7R 4PLIA 1Q86R 3L2ZA 3NGPA 4C92A 3CMEA 3OW2A 4P74C 1B70B 2QA4Q 2C06A 1U8RA 1YJNA 3HTZA 4IUPA 3G4ST 2H3JA 2GFUA 3QYGB 4YRMA 2YUNA 3FEOA 5C0MA 1Z7MA 3G6EQ 1GFCA 2CP2A 2MWPA 3HFOA 2K9GA 4M78G 1X69A 2EYWA 3BJUA 2HSEB 2V26A 4OMOA 1X6OA 2PMEA 2DAQA 4EIKA 5CKFA 2DTOA 1YHQA 1GFDA 1PKTA 3MQZA 1BCMA 2E6NA 2K3BA 3UF4A 4LDXA 2CJBA 3DKMA 1M1KC 1UTIA 4C8QD 3HY0A 3CC4Q 4LVIA 3LGFA 4EMKA 1QW1A 1NNHA 2KEAA 1X2KA 3TEHA 2EKOA 3OSSC 3M0UA 2ZPBB 2NUPB 1PYSB 1BK2A 1ZUYA 3RGLA 1AZEA 4YRCA 4YRRA 2RHUA 4PJLA 4BI8B 1MV3A 2KE9A 2KYMA 1M1KR 3CCSA 4QQ6A 1X56A 4M7AD 3I56T 1UJ0A 2KROA 1TOVA 2VASA 2DIGA 3Q1JA 4NL2A 2L8DA 2LCLA 3E1SA 4HCKA 4RTXA 4CH3A 2E3CA 2ARTA 2DBKA 2LDMA 1ASYA 4IKFA 3V8LA 5DY9A 2V1RA 2DJZA 2DL5A 5CKHA 4CRIA 1VQMA 1PWTA 1JXMA 2VB6A 3INZA 2O9SA 3DB3A 3NMZC 1OEBA 1EFNA 3QDRB 2RHZA 3QJ6A 2RJCA 4M7DD 2IY5A 3HXVA 2DD4A 3EFOA 3CBPA 4BW9A 2ZCEA 2DVJA 4RMFA 4O5VA 4RTYA 4G85A 4KT0E 3KUFA 5GANg 1N6AA 1QVFA 2C8MA 2KK4A 1WI7A 3HFZA 2FL7A 5CO7A 3M4QA 1K9AA 2P4TA 1Q82U 3VYHB 1VQ4Q 4TVWA 3H6ZA 2LRQA 4WCIA 3OYGA 2D8JA 1Y0MA 2XD0A 3I5SA 4YCWA 2DM1A 2DPPB 1QVGP 1R0CB 1KOGA 1AT1B 2D8HA 2F69A 3ZEHA 3META 3OA6A 3CCUA 2QA4A 4M77B 2VGNA 3QXEB 4CS3A 1M9SA 2AZSA 3OBWA 1Q81U 1PRMC 3RUXA 3EH2A 3CCMT 1KJWA 5LJ3e 2DKGA 2MYSA 1XQHA 4J9EA 2ZIOA 4KRTA 4OMLA 3JAME 3P8DA 1D0ZA 2CH4A 2C0IA 2OI3A 1YFTA 3OS1A 4M7DA 2FPFA 2HQEA 2HQHA 2DMOA 5GANj 1JJ2S 2EJFA 1OQKA 3MKDA 2LQNA 1OULA 2EQMA 1ZUUA 2QQSA 4C5EA 1RAFB 1YN8A 2P4RA 1YGBA 1UB4A 1QVFP 1X01A 2H3EB 2XMFA 3I9QA 2OAWA 3CMEQ 3CD6Q 1ZSZC 1EVKA 1ZBJA 1B07A 2NUTB 5FU6C 3LLRA 4OMFB 2KGTA 4OMNA 5KYYA 2L5QA 4QQDA 4HVUA 2GTOA 4OMPA 1JEGA 1I0CA 2CZ1B 3OD1A 2Q5IA 2J06A 3GF5A 2E10A 1WJQA 2OTJQ 1EVLA 3HRSA 1YJ9Q 1M8VA 1G51A 3CCRQ 2KBTA 4Y91A 1V76A 2YT6A 4JDSA 4X5OA 4PK4A 2O4XB 2RD1A 1YJ9T 1K73C 2QG9B 2AT1B 3CCUT 1E7OA 2XDPA 4M77E 1NPRA 2ARUA 2LJ1A 3I56Q 5GANd 2X3XD 3CCLA 2CP3A 3FJ5A 4PKCC 4AH6A 4PJOC 2ZPIB 2RI5A 3CC7A 3KBGA 2LX7A 3M57A 2FZKB 2E70A 3RMSA 1DJ7B 3VS2A 2DL3A 2D0QB 4BACA 3R07A 3RMQA 4LVKA 2RJFA 1M27C 1VQPQ 1ZHIA 1UGRB 4XU2A 3SHWA 4A4HA 3CC2A 4E51A 3NEMA 2E6ZA 5LJ3j 4X34A 3FC3A 4PJOA 1WQWA 3HSBA 4YCVA 4II1A 3CCMQ 4M7DF 1Q82R 1PNJA 4A54A 1KFZA 4XU1A 5HKCA 2G3RA 3OYLA 2K3XA 2RQRA 4PJOF 5GANe 1QKWA 3QHSA 3CCMA 2ZR2A 4J9IA 5A0DA 2XDDA 4RQFA 1K1ZA 2EQIA 3HXWA 2DU7A
chains in the Genus database with same CATH topology
3JSCA 1H4TA 4HKEA 2EQUA 2QA4T 4YRLA 5FU7C 2XG8D 3A8GB 1N9SA 4UPAA 4OB0B 4A53A 2EQKA 1OI1A 3O8VA 2FVUA 4P75C 2CZ0B 3CCEA 1VQ7A 1VIEA 4OP0A 1NYRA 5A0GA 4RG8A 4EMKC 3PIOA 3VQXA 3CCST 2WSCE 1B76A 1ADYA 4E47A 3VQYA 3OYYA 4M7DG 2ZZFA 5KCOA 1WU7A 3CMQA 1YJ9A 4TVRA 3G7ZA 4BD3A 3WQZA 1YITT 2OTJA 4M78E 2BKDN 4TTVA 4LNSA 3OYAA 4CH5A 2EWNA 5J3BA 3HPWA 4HCZA 4F7UF 2A7YA 2ZPGB 4IUUA 1K8AC 1E1OA 4R55A 1K9MU 3OBYA 2YLBA 2ZINA 4RKUE 2EAYA 1USYC 4BWAA 1W66A 3FLGA 4WF2A 1YI2A 4YYEA 1VQ4A 1VQ9T 2ZT8A 1KQ1A 4TQFA 3L2UA 3GOXA 3J7AF 2LCCA 1W2BA 1JRIA 5LJ3f 3P8HA 3A8OB 4KR3A 2QEXA 1U1TA 5LJ3g 4FM4B 4TQDA 1QP3A 4RCBA 1VQKT 3SWNC 3UGTA 1LJOA 4QVCA 4RG2A 2LTOA 4PJOD 3C4SA 1YJWA 1NZ9A 3M53A 2CGHA 5DLQE 5CVIA 1YJNT 4FL6A 4LVJA 2E5AA 1K9MC 3A8MB 5I2SA 2L3RA 4JLGA 3M55A 1JJ2A 2AKWA 4MDWA 1RL2A 3EFSA 3QO7A 1UGSB 4BY6C 1Y07A 5IT9E 1VIFA 4E7LA 1KMMA 4B9XA 4CH6A 4C5HA 3F70A 2RJDA 4M7AC 1G5IA 3OS0A 2AHJB 4C8QE 2V8IA 4BE2A 3JCMg 4JUVA 2QQBA 3X28B 2MI6A 1H4SA 4N4IA 4P73C 3QTCA 3MEAA 3PCOA 2ZT6A 4LVLA 3CCVA 3OYEA 1B70A 1KC8U 4OGCA 1Y96B 4YRSA 3WVDB 3OYJA 1VQ4T 3G6EA 1BBUA 3ZFJA 4LDYA 2I4NA 1XTDA 1NJIC 1HXDA 2B8AA 3JCMP 2EQJA 3CXCA 3V8KA 4LD9K 2RO0A 5KH6A 2KQWA 2K5FA 2GCXA 3OYNA 4KQEA 4ZGJB 3QKJA 1EQRA 2D9TA 5LL6S 1QVFS 3ICAA 2A8EA 4BE1A 4N0AC 3NTKA 5IAYA 3VQWA 3MEWA 2DXTA 5GAMd 1U1SA 2OTLT 2K5LA 2KY9A 1WNLA 2DZ9A 2R58A 5GAOm 4RCCA 2EIFA 4ATOA 1NJ6A 2LC4A 4C0ZA 3MP1A 2QI2A 2QHVA 1ZBXA 2XGTA 3RACA 2V8KA 4M78F 3RL6A 5FU7B 5LJ5d 4IUVA 4CS2A 3OYIA 2VC8A 3VBBA 5CKEA 1RI0A 3RESA 2DXBA 3QIIA 4QW2A 3MO8A 4HWTA 3CD6A 4M75C 4MDXA 4M75F 2JNGA 4HT8A 1VQNT 1KC8C 4XK8E 2E1HA 3JB9F 4Y28E 2PVDB 3UDCA 1Z7NA 1EIYB 3OYHA 1SRYA 1G5VA 4M78B 1BKBA 2ARSA 1Q7YU 1VQ9A 2RI2A 4X9DA 4PJOB 5K1XA 2RHXA 4YRTA 5CAIA 3P8YA 5GMKh 5I21A 3UGQA 4QVDA 5GMKm 3LGLA 2MF2A 5GAMh 5FU6B 4J83A 1I4K1 3L2WA 3RKWA 2RK1A 4YREA 2AMCA 4YRQA 2EJ9A 4O6JA 4F7UB 3CCQT 1SETA 3R6OA 3N5BB 3UPUA 4E7KA 2ZPEB 1N27A 4C8QB 3PGGA 1W4SA 2V8JA 4HA8A 4F7UA 3M59A 3L4GA 1H4VB 2JTFA 1BI2A 1QVPA 4EO4A 3A8HB 4LDVA 2LQKA 5F5WA 3G71A 4HCCA 4JRKA 4N4GA 3SWNB 4XTVA 1XNIA 1VQZA 3S3OA 1NJ2A 1PYSA 4J6YA 2X4WA 3A74A 1S72A 5C53B 1I5LA 3JCMb 3QJYA 3CCET 4DQ2A 4P3NA 3OS5A 4M77F 3ZBDA 4YRNA 3VUZA 3PMTA 3TCJA 1P92A 4ELZC 1B8AA 3A5ZA 1BIBA 2RM4A 5C51B 1D3BA 4Q5WA 3JCMf 3CC4T 4MMKA 2F5TX 3HL8A 2VXFA 2Q7HA 4EDUA 2G4CA 4H2SA 2QHTA 4PHCA 2PVGB 4PJOE 2NLUA 1FYFA 3GNGA 4KULA 4YRPA 3IALA 4J5YA 1M90C 3QO8A 4M75A 5KNNA 2ALYB 3LSQA 3UWNA 2HAXA 5EG2A 3MEYA 1NJIU 4UC4A 2Y4YA 4DOVA 5IN1A 2MAMA 4WJ4A 4J6WA 2DTIA 5LJ3d 2ZPHB 4P72C 3J80E 5J39A 3A5ZB 4XTWA 3LX7A 3RIRA 4A4KA 5LJ3h 4FSXA 1O9SA 2KAFA 2CKKA 4M77G 2ODRD 4F7UG 3PIPA 1PSFA 2CJ9A 4UP9A 1YB3A 3DLLA 3CMAT 4RQEA 4A4FA 3UT1A 1N8RU 4C8QF 4C8QC 1KQSA 3PNWC 2XDBA 1FWZA 4HWPA 5GANf 4YP0A 5D6WA 1VQOA 3HFZB 4WI1A 3H8ZA 2D6FA 3MHXA 4E7JA 2BIVA 4C0GA 5AYFA 3PT9A 3LWIA 4M7AF 2JOYA 5E3IA 4HT9A 3CCRT 3TEHB 1BI3A 1M5Q1 3GIBA 5GMKj 3JCMW 4BY6B 1EOVA 2E12A 1VQPT 4LDUA 2IG0A 4J7FA 3PCOB 4OB3B 1IL2A 4E7IA 4M7AB 4EMHA 4PL6A 4C92G 2QTXA 3G6ET 3CEYA 3A32A 4BUGA 3JCMe 3OYDA 3CCVT 1KD1C 2YHTA 3CCJT 2GFAA 2CYZB 3I55T 1UGPB 5FLXE 3QO3A 2M16A 1M90U 2RH2A 2E41A 5CCAA 1M1KU 1FX7A 1M4ZA 3I7FA 2CZ7B 4XTUA 3HXYA 2DU5A 2KVQG 1L0WA 1VQ6A 4ZIBA 4M75G 1W2BS 3CD6T 5D6XA 1VQ8A 2I4LA 1OYXA 4M78D 1YCYA 4M75E 1R8OB 3P8BB 1XOVA 1Q81C 3VJPA 2Y4XA 1KHIA 5LJ5g 1X2GA 3M4GA 1Q86U 5LJ5h 3C94A 4LDWA 1GXIE 3CBOA 4XEOA 4UP8A 4MMLA 1X54A 2BUDA 3KFUA 1GGMA 4H2YA 1VQ5A 4KUDK 4O2DA 3S3NA 3SB2A 3PTAA 3JB9D 1NJ1A 1VQPA 1G3WA 3ER0A 4ZGDB 5GAMg 4BB7A 1BYMA 4NL3A 4H2XA 3JCMQ 2XTIA 1B7YB 5GAOn 2DK3A 3CCRA 1C0AA 4OB2B 1HTTA 1K8AU 2QQRA 3C95A 2LX9A 1VQ8T 3M5AA 3VYGA 2MWOA 4YTLA 3L2QA 4H2VA 3JCMV 2QQ9A 2ALYA 3M4YA 3EAEA 4XEMA 2PUOB 4KUIA 3ME9A 1JJCA 3G1ZA 4KR2A 3RKYA 1YITA 2DO3A 4RDXA 3M58A 1O75A 3RKXA 4PG3A 3M9QA 2XK0A 2RHQB 3QO5A 1WLEA 2LNVA 5FROA 4PNOA 2VYTA 4ZTZB 3GLXA 2R5MA 4C92D 2DQ0A 2RI3A 2LQ8A 3VUBA 3HFVA 3E9GA 1VQMT 3WXMB 2XHCA 3X25B 3M54A 1YFSA 4DA4A 3GP8A 1HK9A 3FJPA 4NCXA 3A7AA 5C52B 2ZT5A 4CH4A 3IKLA 3NTIA 4V2SA 4ZTUB 2QEXT 2I4MA 2P0QA 2K5IA 1BI0A 1SESA 3E9IA 1BI1A 3HRTA 2PUKB 1VQ5T 2HBPA 4BDYA 3QPHA 4JLIA 5GAOq 1NPPA 4P73A 3REUA 5FRMA 3CCJA 2OTLA 3HP9A 1WJSA 1IZ6A 2QXFA 4FU6A 4HWOA 4BDZA 2XIDA 5L8RE 4YDQA 2P0KA 1E22A 1WJRA 11ASA 3QYHB 4MZTA 5CIUA 2QQAA 2ZTGA 4BI3A 5GAN2 5C6SA 3LYIA 2I2LA 1Q82C 3G4SA 2XU8A 1E24A 1EIYA 4LVMA 4JJNK 4NOYA 3OQ5A 4XTZA 4P3OA 3CMAA 4D6WA 3KXTA 3MP8A 1NE8A 1S72T 4DPGA 4K86A 2CS7A 2DQ3A 4C92E 1MHNA 3SD4A 5CKDA 4M78A 3WVEB 5CR2A 2RHIA 5A0LA 5FRNA 4C92F 3HRKA 4ME7A 3MCAB 1MGQA 2XICA 2AMCB 1JB0E 2DDZA 5LJ5e 3OYMA 2M0OA 3JB9J 5ELNA 4J6XA 4P72A 5J26A 2DZCA 2FHDA 4JRPA 3A7UA 1X75C 2OTJT 1B7YA 4PJOG 2HNIA 2P5IA 5GAMf 4C5IA 1QVGS 4H02A 5CQXA 1RIQA 2R5AA 3PZCA 2FB7A 1KG1A 4ZTFA 5GAMe 4P75A 1D3BB 2RJEA 3DLMA 3P8TA 3HRIA 3EFRA 2EYQA 4WJ3M 3OS2A 4EMKB 2ZR3A 1OZ3A 2DVEA 4C8QG 4C5GA 1WGSA 2LT4A 1M1GA 4Z02A 4XU3A 4DOWA 1G5HA 4ZN3A 3MEUA 4YRKA 3JCMh 1J5WA 2XI9A 2IVWA 1N8RC 3TEGA 1VQKA 2EL9A 4UP7A 2AKWB 1G3TA 2RHQA 4M78C 3L2VA 3SDZA 2F5KA 2VV5A 3JB9H 5I2MA 3CCLT 2ZZGA 2ZZEA 5LJ5j 3QNEA 3CC7T 2WSFE 1WYDA 3FB9A 5D6YA 2RHSA 3ASKA 4C92B 1YJWT 4K88A 1BIAA 2E64A 2LT1A 5ELOA 1G3YA 2I4OA 3V7CA 3E19A 1YI2T 3MF1A 1ZQ1A 3MEVA 1I8FA 3X26B 1N9RA 3QBYA 2QDYB 5GAMj 3SFMA 3A8LB 1KHCA 3V7SA 4KBMB 1G3SA 4M75D 4C0DC 5K1PA 2DIQA 1EIFA 3DB4A 4HWRA 2Q7GA 4M7DE 3A31A 3QZ9B 4L87A 4P3PA 2K2VA 3OY9A 4C0FA 3OW2S 2HD0A 2JTMA 2VXEA 3I55A 1JJCB 1YFRA 4NS5A 4QVZA 4OLFA 4IURA 1Y96A 4YPFA 3LW5E 4HVCA 3T9NA 3JB9I 5GAN8 4H2UA 2IY5B 1VQLA 2JN0A 3VQVA 2L89A 1Q86C 2E5QA 4N4HA 3CC2T 4MZPA 4QQGA 3URGA 3NFCA 3L2RA 4YRFA 4C92C 1QVGA 1UGQB 4C8QA 2Q5HA 1B34A 3OYFA 3CPFA 2Y90A 3NELA 4ELYC 2M1HA 2ZXFA 1LNXA 5GANh 4Q15A 2X4YA 3HHTB 4JS5A 3I56A 5HK3A 3LC0A 4Q6GA 3NTHA 3HXXA 2CZ6B 3MF2A 4TWAA 5KE2A 2J3MA 2PU9B 4BI4A 1VQOT 3P8VA 1SSFA 3BY7A 4FIBA 3OMCA 4P71A 2X4XA 3NETA 5GAN4 1Q7YC 2KMTA 4L5GA 1YIJT 4G84A 3RERA 1LOJA 3TREA 4HT4A 3L1AA 3CBMA 1SERA 3HXUA 2ZZDA 1USYA 1N9WA 4M77D 4CI0C 3E9HA 4JS4A 1KQSS 4R56A 3OYKA 3MP6A 4ZGEB 1YHQT 1FXXA 2MMPA 1E1TA 3CC4A 3CMET 2K3YA 3UH0A 3W3SA 4XTXA 3JCMc 3M56A 3CPWS 4H2XB 1VQLT 4CS4A 2RK2A 4H2TA 3L42A 3HRUA 2CIMA 2GF7A 4GY5A 1I81A 2ZNIA 4A4EA 1HC7A 4M75B 3S3MA 3QG1A 1VQNA 4TVAA 4RMOA 1VQ6T 1BBWA 2WSEE 1X2HA 2R57A 5HK0A 3QUIA 2DXCA 3BW1A 3CPWA 2P0PA 2YLCA 5GMKe 3HFNA 5GMKl 3NENA 4L59A 4OVAA 4ZN1A 2RB6A 5LJ5f 1M1FA 2P0LA 3S6WA 2ZIMA 1VUBA 4IUQA 4J15A 3ERRA 4XQ3A 3UFGA 3DSQA 3BDUA 3HY1A 4XAXB 3LSSA 3PFSA 2ODRC 4M7AG 4M7DC 3JCMd 3OB9A 5DLOA 1YBYA 2WACA 1H4QA 3VU3C 3J81E 3SWNA 4M7AE 3CCQA 2FYKA 3OYBA 3REXA 2KDSA 3CXCS 4M7DB 5GMKi 4YRJA 4J8OA 1QF6A 2JZ2A 3FRNA 1K73U 1X55A 2JUFA 4FT2A 1ADJA 4LD6A 3QZ5B 2GQVA 2RHYA 1PSEA 4OF1A 3LH0A 4E7HA 2ZNJA 3FIFA 2J3LA 3JCMJ 2DEQA 5GAN3 4P71C 1JBMA 4BE0A 5GAOl 3X24B 4OB1B 4L6V5 3HXZA 5GAN5 3LWHA 4K87A 1OZ2A 4M77C 2ZGWA 2ZPFB 4PLLA 2PVOB 2C7IA 3BFMA 4YCUA 4FT4A 1ASZA 3TUPA 2A3LA 3FDRA 4EPCA 4H2WA 3OMGA 2VUBA 2JVVA 4F7UE 2K57A 4YROA 4EMGA 3VV0A 4HCBA 2YRVA 2QHSA 3TEEA 5CK9A 3TU4K 5M9OA 3GPLA 4MZMA 5GAN7 1KD1U 1QE0A 1WQ7A 1AHJB 4J7IA 2LVMA 2DD5A 4EX5A 2DXUA 2ZT7A 2K4YA 4TVAB 4N0AA 2QHUA 4M7AA 3PMIA 4ZTJA 3E9FA 2OAUA 5KCHA 1EFWA 2XKOC 2DTHA 5GAOr 1UEBA 2VGMA 2RHSB 1IREB 4HWSA 4A4GA 4VUBA 4P74A 2RA2A 3GNFB 3L4GB 3JCMX 1V29B 12ASA 4P5NA 1B34B 1NJ5A 4TVYA 1Y7XA 3A5YA 2HQXA 3M4PA 1Y71A 5CKBA 1KMNA 2PMFA 3HKSA 4M77A 4JRQA 3X20B 3AHUA 1LYLA 2KSSA 2CJAA 2ZCFB 1ATIA 3RF1A 3V7RA 4YRIA 4XU0A 2O01E 5GAN6 3C12A 4C0DB 1QP2A 2EFIA 1VQ7T 1H3ZA 3IG2A 2PQWA 5A2QE 4YRGA 1YIJA 1WPYA 5CQYA 3BDLA 2E65A 4XTYA 4X9CA 2O4XA 3A7RA 2NS6A 1H641 3OSVA 4IUTA 2X4JA 2Q7EA 3G71T 2EJGA 4B9WA 3OYCA 1TH7A 1KQ2A 2X35A 4GLKA 5HGQA 2M9UA 5KE3A 1NYQA 3QSUA 3JB9G 1NJ8A 3IKMB 3JRZA 5GAOp 4OGEA 5HY6A 4JRIA 3VKIA 3V8JA 5DM7R 4PLIA 3L2ZA 4C92A 3CMEA 3OW2A 4P74C 1B70B 2C06A 1U8RA 1YJNA 3HTZA 4IUPA 3G4ST 2H3JA 2GFUA 3QYGB 4YRMA 3FEOA 5C0MA 1Z7MA 2MWPA 3HFOA 4M78G 3BJUA 1X6OA 2PMEA 2DAQA 5CKFA 2DTOA 1YHQA 3MQZA 2E6NA 4LDXA 2CJBA 3DKMA 1M1KC 4C8QD 3HY0A 4LVIA 3LGFA 4EMKA 1QW1A 1NNHA 3TEHA 2EKOA 3OSSC 2ZPBB 1PYSB 3RGLA 4YRCA 4YRRA 2RHUA 4BI8B 3CCSA 4QQ6A 1X56A 4M7AD 3I56T 2DIGA 3Q1JA 4NL2A 2L8DA 2LCLA 3E1SA 4CH3A 2E3CA 2ARTA 2LDMA 1ASYA 4IKFA 3V8LA 5DY9A 2DJZA 5CKHA 4CRIA 1VQMA 3INZA 3DB3A 3QDRB 2RHZA 3QJ6A 2RJCA 4M7DD 2IY5A 3HXVA 2DD4A 3CBPA 4BW9A 2ZCEA 4RMFA 4O5VA 4G85A 4KT0E 3KUFA 5GANg 1N6AA 1QVFA 2C8MA 2KK4A 3HFZA 2FL7A 5CO7A 3M4QA 2P4TA 1Q82U 3VYHB 4TVWA 3H6ZA 2LRQA 3OYGA 2XD0A 4YCWA 2DPPB 1KOGA 2F69A 3ZEHA 3META 3OA6A 3CCUA 2QA4A 4M77B 2VGNA 3QXEB 4CS3A 1M9SA 3OBWA 1Q81U 3RUXA 3CCMT 5LJ3e 2DKGA 1XQHA 2ZIOA 3JAME 3P8DA 1YFTA 3OS1A 4M7DA 2HQEA 5GANj 1JJ2S 2EJFA 2EQMA 2QQSA 4C5EA 1YGBA 1UB4A 1X01A 1EVKA 3LLRA 4OMFB 5FU6C 2L5QA 4QQDA 2CZ1B 3OD1A 2Q5IA 2E10A 3GF5A 1WJQA 1EVLA 3HRSA 1M8VA 1G51A 4Y91A 4X5OA 4JDSA 2O4XB 2RD1A 1YJ9T 1K73C 3CCUT 2XDPA 4M77E 1NPRA 2ARUA 5GANd 3CCLA 4PKCC 4AH6A 4PJOC 2ZPIB 2RI5A 3CC7A 3KBGA 3M57A 2E70A 3RMSA 1DJ7B 2D0QB 4BACA 3R07A 3RMQA 4LVKA 2RJFA 1ZHIA 1UGRB 4XU2A 3CC2A 4A4HA 4E51A 3NEMA 2E6ZA 5LJ3j 4X34A 3FC3A 4PJOA 1WQWA 3HSBA 4YCVA 4II1A 4M7DF 4A54A 4XU1A 5HKCA 2G3RA 3OYLA 2K3XA 4PJOF 5GANe 3QHSA 3CCMA 2ZR2A 5A0DA 2XDDA 4RQFA 3HXWA 2DU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H4T A;  1ASZ A;  3TUP A;  4C92 F;  2G4C A;  3HRK A;  4H2S A;  2QHT A;  4H2W A;  4PHC A;  1MGQ A;  4PJO E;  1FYF A;  2AMC B;  2DDZ A;  5LJ5 e;  4YRL A;  3JB9 J;  4YRP A;  5ELN A;  3IAL A;  4J6X A;  1N9S A;  4J5Y A;  4UPA A;  4A53 A;  4F7U E;  4P72 A;  3QO8 A;  4P75 C;  2DZC A;  4M75 A;  5KNN A;  3A7U A;  2K57 A;  4OP0 A;  2ALY B;  1NYR A;  4YRO A;  4EMK C;  4EMG A;  3LSQ A;  3VQX A;  1B7Y A;  4PJO G;  2QHS A;  2HNI A;  1B76 A;  1ADY A;  2P5I A;  3VQY A;  3MEY A;  5GAM f;  4M7D G;  4H02 A;  2ZZF A;  1WU7 A;  4WJ4 A;  4J6W A;  1RIQ A;  3PZC A;  2DTI A;  2FB7 A;  5LJ3 d;  5GAN 7;  1QE0 A;  4P72 C;  5GAM e;  1WQ7 A;  3CMQ A;  4P75 A;  1D3B B;  3P8T A;  3HRI A;  3EFR A;  4WJ3 M;  3WQZ A;  4XTW A;  3RIR A;  4EMK B;  2ZR3 A;  4EX5 A;  2DXU A;  5LJ3 h;  2ZT7 A;  4TVA B;  4N0A A;  2DVE A;  4C8Q G;  2QHU A;  4M78 E;  4M7A A;  4TTV A;  4M77 G;  2ODR D;  4LNS A;  4F7U G;  4CH5 A;  2EWN A;  1EFW A;  4XU3 A;  1G5H A;  2DTH A;  4F7U F;  5GAO r;  2CJ9 A;  2RHS B;  4UP9 A;  1YB3 A;  4YRK A;  4HWS A;  3JCM h;  1E1O A;  1J5W A;  4P74 A;  4RQE A;  2YLB A;  2RA2 A;  2ZIN A;  4C8Q F;  2EAY A;  3L4G B;  4C8Q C;  3JCM X;  12AS A;  1USY C;  3TEG A;  4BWA A;  2EL9 A;  4UP7 A;  1W66 A;  2AKW B;  4WF2 A;  4HWP A;  5GAN f;  2RHQ A;  4YP0 A;  1B34 B;  4M78 C;  4YYE A;  3HFZ B;  4WI1 A;  1NJ5 A;  4TVY A;  2ZT8 A;  1KQ1 A;  3A5Y A;  4TQF A;  3JB9 H;  2ZZG A;  3M4P A;  4M7A F;  1KMN A;  2PMF A;  2ZZE A;  5LJ5 j;  5E3I A;  4HT9 A;  1JRI A;  3QNE A;  5LJ3 f;  4M77 A;  3TEH B;  1WYD A;  3FB9 A;  4KR3 A;  1M5Q 1;  3AHU A;  1LYL A;  1U1T A;  5LJ3 g;  3GIB A;  2RHS A;  5GMK j;  4C92 B;  3JCM W;  2CJA A;  4TQD A;  1ATI A;  1BIA A;  2E64 A;  1EOV A;  4K88 A;  3RF1 A;  4RCB A;  3V7R A;  4YRI A;  4XU0 A;  5ELO A;  2I4O A;  3V7C A;  3PCO B;  3MF1 A;  5GAN 6;  1IL2 A;  4M7A B;  4EMH A;  4C92 G;  2QTX A;  3SWN C;  1I8F A;  3UGT A;  1N9R A;  1LJO A;  4QVC A;  3IG2 A;  5GAM j;  4PJO D;  4YRG A;  3A32 A;  3JCM e;  3V7S A;  2CGH A;  1WPY A;  4XTY A;  2E65 A;  2YHT A;  4M75 D;  2E5A A;  4X9C A;  3A7R A;  5K1P A;  1H64 1;  3QO3 A;  2Q7E A;  2AKW A;  2EJG A;  4HWR A;  2E41 A;  2Q7G A;  4M7D E;  1TH7 A;  3EFS A;  1KQ2 A;  3QO7 A;  5HGQ A;  3A31 A;  3I7F A;  4XTU A;  4L87 A;  1KMM A;  1NYQ A;  3QSU A;  3JB9 G;  1NJ8 A;  3IKM B;  4P3P A;  4CH6 A;  3HXY A;  2DU5 A;  5GAO p;  4JRI A;  1L0W A;  3V8J A;  4M7A C;  1G5I A;  4ZIB A;  2VXE A;  1JJC B;  1YFR A;  4M75 G;  3L2Z A;  4C8Q E;  4OLF A;  4C92 A;  3JCM g;  4JUV A;  1Y96 A;  4YPF A;  2I4L A;  4HVC A;  4P74 C;  1H4S A;  1B70 B;  4P73 C;  4M78 D;  3QTC A;  3JB9 I;  3PCO A;  5GAN 8;  2ZT6 A;  4H2U A;  2IY5 B;  1YCY A;  3HTZ A;  4M75 E;  3VQV A;  2JN0 A;  1B70 A;  4YRM A;  1Y96 B;  4YRS A;  5LJ5 g;  1X2G A;  3M4G A;  1BBU A;  1Z7M A;  2I4N A;  4YRF A;  5LJ5 h;  3HFO A;  4C92 C;  4M78 G;  4XEO A;  3BJU A;  1HXD A;  3JCM P;  4UP8 A;  4C8Q A;  2Q5H A;  4MML A;  2PME A;  1B34 A;  3V8K A;  2Y90 A;  2DTO A;  1X54 A;  3KFU A;  1GGM A;  4KQE A;  3NEL A;  1EQR A;  4H2Y A;  2ZXF A;  1LNX A;  2CJB A;  4O2D A;  5GAN h;  4C8Q D;  3SB2 A;  1NJ1 A;  3JB9 D;  3HY0 A;  4Q15 A;  4EMK A;  1NNH A;  5GAM g;  3ICA A;  3LC0 A;  4Q6G A;  3TEH A;  3HXX A;  3MF2 A;  4TWA A;  4NL3 A;  4N0A C;  4H2X A;  3JCM Q;  3VQW A;  1PYS B;  2J3M A;  2DXT A;  2XTI A;  3P8V A;  5GAM d;  3BY7 A;  3RGL A;  1U1S A;  1B7Y B;  4YRC A;  4YRR A;  5GAO n;  4P71 A;  1C0A A;  1HTT A;  3NET A;  5GAN 4;  1WNL A;  2DZ9 A;  1X56 A;  5GAO m;  4RCC A;  4M7A D;  4G84 A;  3RER A;  1NJ6 A;  1LOJ A;  4NL2 A;  3L1A A;  4CH3 A;  1SER A;  3JCM V;  2E3C A;  2ART A;  1USY A;  1N9W A;  2QHV A;  2XGT A;  3HXU A;  4H2V A;  1ASY A;  4M77 D;  3RAC A;  2ALY A;  4M78 F;  3RL6 A;  3V8L A;  5DY9 A;  2DJZ A;  3E9H A;  4XEM A;  5LJ5 d;  4CS2 A;  1JJC A;  3INZ A;  2VC8 A;  3G1Z A;  3VBB A;  4KR2 A;  3RKY A;  3RES A;  4HWT A;  1E1T A;  4M7D D;  2IY5 A;  3HXV A;  4RDX A;  4BW9 A;  2ZCE A;  4RMF A;  3UH0 A;  4M75 C;  4M75 F;  3RKX A;  4G85 A;  4PG3 A;  3W3S A;  4XTX A;  4HT8 A;  3JCM c;  2RHQ B;  5GAN g;  3QO5 A;  1WLE A;  2C8M A;  4H2X B;  4CS4 A;  4PNO A;  4ZTZ B;  2E1H A;  4H2T A;  3JB9 F;  4C92 D;  2DQ0 A;  3HFZ A;  3M4Q A;  2CIM A;  3HFV A;  1I81 A;  4TVW A;  2ZNI A;  1Z7N A;  1YFS A;  1HC7 A;  1EIY B;  4YCW A;  1SRY A;  4M75 B;  4M78 B;  1KOG A;  2ARS A;  4TVA A;  4X9D A;  1BBW A;  4PJO B;  4M77 B;  1X2H A;  5K1X A;  1HK9 A;  3FJP A;  4YRT A;  3QUI A;  3BW1 A;  3A7A A;  4NCX A;  5CAI A;  3P8Y A;  4CS3 A;  5C52 B;  2ZT5 A;  5GMK h;  4CH4 A;  2YLC A;  3IKL A;  5GMK e;  3HFN A;  3RUX A;  5I21 A;  5GMK l;  4V2S A;  3NEN A;  4QVD A;  5LJ3 e;  2DKG A;  3UGQ A;  2ZIO A;  2RB6 A;  5GMK m;  5LJ5 f;  1YFT A;  4ZTU B;  4M7D A;  2P0L A;  5GAM h;  2I4M A;  2ZIM A;  5GAN j;  2EJF A;  4J15 A;  3ERR A;  1I4K 1;  1SES A;  1YGB A;  3E9I A;  3RKW A;  4XQ3 A;  3UFG A;  4YRE A;  2AMC A;  1X01 A;  4YRQ A;  2EJ9 A;  3DSQ A;  4F7U B;  3BDU A;  1SET A;  4JLI A;  5GAO q;  3HY1 A;  3LSS A;  1EVK A;  2ODR C;  4C8Q B;  4M7A G;  3PGG A;  4M7D C;  4P73 A;  3REU A;  3JCM d;  4HA8 A;  4F7U A;  3L4G A;  3OD1 A;  1H4Q A;  3VU3 C;  2Q5I A;  1H4V B;  2E10 A;  1EVL A;  4EO4 A;  3SWN A;  4M7A E;  1M8V A;  1G51 A;  2FYK A;  5F5W A;  3REX A;  4Y91 A;  4X5O A;  4M7D B;  5GMK i;  2RD1 A;  4YRJ A;  4JRK A;  4HWO A;  1QF6 A;  4M77 E;  3SWN B;  1X55 A;  4XTV A;  2ARU A;  4YDQ A;  1VQZ A;  1NJ2 A;  1E22 A;  5GAN d;  1PYS A;  4J6Y A;  1ADJ A;  11AS A;  3A74 A;  5C53 B;  2ZTG A;  1I5L A;  3JCM b;  5GAN 2;  4AH6 A;  4PJO C;  4DQ2 A;  4P3N A;  2I2L A;  4M77 F;  2ZNJ A;  4YRN A;  3FIF A;  1E24 A;  2J3L A;  1EIY A;  3JCM J;  4NOY A;  4XTZ A;  4P3O A;  3R07 A;  2DEQ A;  5GAN 3;  4P71 C;  1JBM A;  5GAO l;  4DPG A;  4XU2 A;  1B8A A;  4E51 A;  3NEM A;  3A5Z A;  1BIB A;  2RM4 A;  5LJ3 j;  4PJO A;  4K86 A;  5C51 B;  1D3B A;  2DQ3 A;  1WQW A;  4C92 E;  3HSB A;  4YCV A;  4M7D F;  4A54 A;  4XU1 A;  3JCM f;  4MMK A;  3HXZ A;  5GAN 5;  4PJO F;  5GAN e;  4K87 A;  3QHS A;  2ZR2 A;  4M78 A;  4M77 C;  4RQF A;  2ZGW A;  3HXW A;  2C7I A;  2VXF A;  2Q7H A;  2DU7 A;  3BFM A;  4YCU A; 
#chains in the Genus database with same CATH topology
 3JSC A;  1H4T A;  4HKE A;  1PC0 A;  1FMV A;  1YIT Q;  2QTV A;  2EQU A;  4AFZ C;  2QA4 T;  4YRL A;  1D1B A;  5FU7 C;  2XG8 D;  3H0H A;  3A8G B;  1N9S A;  4UPA A;  4LN2 A;  4OB0 B;  4A53 A;  2FPD A;  2NWM A;  2EQK A;  1OI1 A;  3O8V A;  4AG2 C;  2FVU A;  3M0T A;  4P75 C;  2CZ0 B;  3CCE A;  1VQ7 A;  1VIE A;  4OP0 A;  1NYR A;  5A0G A;  4RG8 A;  4EMK C;  3PIO A;  3VQX A;  2HL3 A;  3CCS T;  1AWO A;  2WSC E;  4DBF A;  1K0X A;  1B76 A;  1ADY A;  4E47 A;  1WXT A;  3VQY A;  2H8H A;  5KYW A;  1LCK A;  3OYY A;  4M7D G;  2ZZF A;  5KCO A;  1WU7 A;  1UJY A;  1OU9 A;  3CMQ A;  1YJ9 A;  4TVR A;  1FMK A;  3G7Z A;  2FZC B;  4BD3 A;  3WQZ A;  1YIT T;  2OTJ A;  1RAH B;  1OV3 A;  4M78 E;  2BKD N;  1NYF A;  4TTV A;  4RTW A;  4LNS A;  3D7S B;  4PJN A;  3OYA A;  4WTO B;  2EWN A;  4CH5 A;  3UA6 A;  5J3B A;  1T3L A;  3HPW A;  4HCZ A;  1VQ5 Q;  4F7U F;  4RUG A;  2A7Y A;  2ZPG B;  4IUU A;  1K8A C;  1E1O A;  2QAZ A;  4R55 A;  1K9M U;  1TS9 A;  3OBY A;  1K76 A;  2YLB A;  2ZIN A;  4RKU E;  2EAY A;  4E7S A;  1USY C;  4BWA A;  1W66 A;  3FLG A;  4WF2 A;  1YI2 A;  2HBW A;  4YYE A;  2COZ A;  1YFN A;  1QCO A;  1VQ4 A;  1VQ9 T;  2E5K A;  1ZSZ A;  2ZT8 A;  1KQ1 A;  4GLM A;  4LUE A;  4TQF A;  1QWE A;  3L2U A;  1PRL C;  3GOX A;  3J7A F;  2LCC A;  1W2B A;  1MMA A;  1JRI A;  2DJQ A;  5LJ3 f;  3P8H A;  3A8O B;  4KR3 A;  2LJ0 A;  2QEX A;  1U1T A;  3PE0 A;  5LJ3 g;  3M0R A;  4FM4 B;  4TQD A;  1HJD A;  1QP3 A;  4RCB A;  1OX8 A;  1VQK T;  1K9M R;  2E3I A;  5KYU B;  1KD1 R;  1GCP A;  1K4U S;  3SWN C;  4ANJ A;  3UGT A;  1LJO A;  4QVC A;  4RG2 A;  2BZY A;  2LTO A;  5L23 A;  3CCJ Q;  4PJO D;  4LNP A;  3C4S A;  1YJW A;  2CDT A;  1NZ9 A;  3M53 A;  2CGH A;  5DLQ E;  5CVI A;  1YJN T;  4FL6 A;  4LVJ A;  2DFU A;  2E5A A;  1K9M C;  3A8M B;  5I2S A;  2L3R A;  4JLG A;  3M55 A;  4QKU A;  1X6G A;  1JJ2 A;  2AKW A;  4FSS A;  3I35 A;  2GNC A;  4MDW A;  1WXB A;  2RPN A;  1JO8 A;  1RL2 A;  3EFS A;  2D0N A;  1JQQ A;  3QO7 A;  1UGS B;  4BY6 C;  1Y07 A;  5IT9 E;  1VIF A;  4E7L A;  1KMM A;  4B9X A;  4CH6 A;  4C5H A;  3F70 A;  2RJD A;  3EGU A;  4M7A C;  1G5I A;  3VS6 A;  3OS0 A;  1Q81 R;  2AHJ B;  1GCQ A;  4C8Q E;  2V8I A;  4BE2 A;  3JCM g;  2ED0 A;  4JUV A;  2QQB A;  4LUD A;  3X28 B;  2MI6 A;  1H4S A;  4N4I A;  4P73 C;  3QTC A;  3MEA A;  3PCO A;  3GBQ A;  2ZT6 A;  2SEM A;  4LVL A;  3CCV A;  2F2V A;  3EG1 A;  3HTR A;  3VS1 A;  3OYE A;  1VQN Q;  2GGR A;  1B70 A;  1KC8 U;  3VS5 A;  1TSF A;  1EZZ B;  4OGC A;  1Y96 B;  4YRS A;  3WVD B;  4HVW A;  3OYJ A;  1VQ4 T;  3G6E A;  1BBU A;  3ZFJ A;  4LDY A;  2I4N A;  4K11 A;  3QDF A;  3EGX A;  1MMD A;  2MIO A;  2KYB A;  1XTD A;  1NJI C;  2K6D A;  1HXD A;  2B8A A;  2EGC A;  3JCM P;  1BBZ A;  2EQJ A;  1YJN Q;  3CXC A;  1YHQ Q;  1RAB B;  2HCK A;  3V8K A;  4LD9 K;  2RO0 A;  5KH6 A;  1RLP C;  2KQW A;  2K5F A;  2AK5 A;  2GCX A;  3OYN A;  4KQE A;  4ZGJ B;  3QKJ A;  1EQR A;  1D09 B;  3KFV A;  2D9T A;  5LL6 S;  1QVF S;  2DNU A;  3ICA A;  2LP5 A;  2A8E A;  4QT7 A;  4BE1 A;  4N0A C;  3NTK A;  3BE3 A;  5IAY A;  3VQW A;  3MEW A;  1RAA B;  2DXT A;  5GAM d;  1U1S A;  2OTL T;  2K5L A;  2KY9 A;  1NEB A;  1WNL A;  2DZ9 A;  2R58 A;  1IHW A;  5GAO m;  2HKN A;  4RCC A;  1IGU A;  3I55 Q;  2EIF A;  4Z8A A;  4ATO A;  1NJ6 A;  2LC4 A;  4F14 A;  2RQW A;  3PVL A;  4C0Z A;  3MP1 A;  1ZLM A;  2QI2 A;  2QHV A;  1ZBX A;  2XGT A;  3VS7 A;  3RAC A;  2V8K A;  3JV3 A;  4M78 F;  3RL6 A;  2CRE A;  5FU7 B;  5LJ5 d;  4IUV A;  4CS2 A;  1Y57 A;  3OYI A;  2VC8 A;  3VBB A;  5CKE A;  1NBE B;  2DF6 A;  1RI0 A;  3RES A;  2DXB A;  3QII A;  4QW2 A;  1OX9 A;  3MO8 A;  4HWT A;  3CD6 A;  1GBR A;  5IHN A;  4M75 C;  4MDX A;  2SRC A;  4M75 F;  4LXC A;  2JNG A;  2IIM A;  4HT8 A;  2G6F X;  1VQN T;  2DL7 A;  1KC8 C;  1CSK A;  4XK8 E;  2E1H A;  1B7T A;  2PTK A;  3JB9 F;  4Y28 E;  2PVD B;  3VS0 A;  3UDC A;  1Z7N A;  1X43 A;  1EIY B;  3OYH A;  1SRY A;  1G5V A;  4M78 B;  4JPB W;  4ESR A;  2QGG A;  1BKB A;  2ARS A;  3EHQ A;  1Q7Y U;  1VQ9 A;  1KC8 R;  1NM7 A;  1V1C A;  2RI2 A;  1SPK A;  4X9D A;  5KYX B;  4PJO B;  5K1X A;  2LQW A;  2RHX A;  4YRT A;  1WHM A;  4B6M A;  5CAI A;  3P8Y A;  5GMK h;  1TWB A;  1MNE A;  5I21 A;  1M30 A;  3UGQ A;  2YSQ A;  4QVD A;  2FRY A;  3CCL Q;  5GMK m;  1VA7 A;  3LGL A;  2MF2 A;  5GAM h;  5FU6 B;  5ECA A;  4J83 A;  1I1J A;  5HCK A;  1I4K 1;  3L2W A;  3RKW A;  1YP5 A;  1NLO C;  2RK1 A;  4HXJ A;  3G71 Q;  2AMC A;  4YRE A;  4YRQ A;  2EJ9 A;  4O6J A;  3UAT A;  4F7U B;  2RNA A;  3CCQ T;  5IHI A;  1SET A;  3R6O A;  3N5B B;  3UPU A;  4E7K A;  2ZPE B;  4CC2 A;  1N27 A;  1PD1 A;  4C8Q B;  2F1L A;  3PGG A;  1W4S A;  2V8J A;  4HA8 A;  1SHG A;  4F7U A;  2A08 A;  3M59 A;  3L4G A;  1H4V B;  2JTF A;  1BI2 A;  1QVP A;  1M3B A;  4EO4 A;  3A8H B;  1VQ7 Q;  4JJB A;  4LDV A;  2LQK A;  9ATC B;  5F5W A;  2DYI A;  3G71 A;  1AZG B;  3NHN A;  2QDL A;  4HCC A;  2M51 A;  2AIR B;  2EVR A;  4JRK A;  1SHF A;  2DBM A;  4N4G A;  3SWN B;  1HSQ A;  4XTV A;  1XNI A;  1VQZ A;  4J9D A;  1U3O A;  1WX6 A;  3S3O A;  1NJ2 A;  1PYS A;  4M4Z A;  1JJ2 P;  4J6Y A;  2X4W A;  3A74 A;  1S72 A;  5C53 B;  2CP7 A;  2CT3 A;  1I5L A;  3JCM b;  3QJY A;  3CCE T;  1AOJ A;  4DQ2 A;  1SEM A;  4P3N A;  3OS5 A;  4M77 F;  3ZBD A;  1KIK A;  4YRN A;  1TUC A;  1QQJ A;  2JW4 A;  3VUZ A;  3PMT A;  3TCJ A;  3MPU B;  4E7Z A;  1P92 A;  4RTV A;  4ELZ C;  2YUO A;  1G2B A;  5GJV B;  1B8A A;  2KT1 A;  3A5Z A;  1BIB A;  2RM4 A;  5C51 B;  1D3B A;  3UA7 A;  1IGQ A;  2JT4 A;  1GL5 A;  3CCV Q;  4Q5W A;  4KGX B;  3JCM f;  3CC4 T;  4MMK A;  4JJD A;  2F5T X;  2L3Q A;  3HL8 A;  2BZX A;  2VXF A;  2Q7H A;  4EDU A;  2G4C A;  4H2S A;  2QHT A;  4PHC A;  2PVG B;  4PJO E;  2NLU A;  1FYF A;  3GNG A;  1JXO A;  4KUL A;  4YRP A;  3IAL A;  2AKK A;  4J5Y A;  1M90 C;  4PFZ A;  3EFO B;  4ZNX A;  3QO8 A;  2O31 A;  4M75 A;  5KNN A;  2JJ9 A;  2ALY B;  3H41 A;  3LSQ A;  1YWO A;  3EG2 A;  2PZ1 A;  3UWN A;  2HAX A;  5EG2 A;  1RAI B;  3MEY A;  1NJI U;  4UC4 A;  2Y4Y A;  4DOV A;  5IN1 A;  2MAM A;  4WJ4 A;  1OPK A;  2QGF B;  4J6W A;  2DTI A;  2EGE A;  2JXB A;  5LJ3 d;  2ZPH B;  2CH4 W;  4P72 C;  3J80 E;  3EG9 B;  2EPD A;  3CCQ Q;  5J39 A;  3A5Z B;  2CUD A;  4XTW A;  3LX7 A;  3RIR A;  4A4K A;  2KRM A;  5LJ3 h;  1VOM A;  4FSX A;  1O9S A;  2KAF A;  2A36 A;  2CKK A;  4M77 G;  2ODR D;  2QK0 A;  4F7U G;  2QEX Q;  1KK7 A;  3PIP A;  2JS2 A;  1PSF A;  4D8K A;  2CJ9 A;  4UP9 A;  2QAS A;  1J3T A;  3DLL A;  1YB3 A;  3CMA T;  4RQE A;  2KXC A;  1UEC A;  4A4F A;  3UT1 A;  1N8R U;  4C8Q F;  2MPX C;  4C8Q C;  1KQS A;  3PNW C;  2XDB A;  1T0H A;  1ZX6 A;  2JS0 A;  2JMA A;  1W2B P;  4A63 B;  1FWZ A;  4HWP A;  5GAN f;  4YP0 A;  5D6W A;  2NYS A;  1VQO A;  3HFZ B;  4WI1 A;  3H8Z A;  2D6F A;  3MHX A;  4E7J A;  2ED1 A;  2BIV A;  2DIL A;  4C0G A;  2M0Y A;  5AYF A;  3PT9 A;  1MV0 B;  2RQV A;  5D7U A;  1LVK A;  3LWI A;  4M7A F;  2JOY A;  2MCN A;  5E3I A;  4HT9 A;  1RAG B;  3CCR T;  3TEH B;  3CPW P;  1M5Q 1;  1BI3 A;  4JZ4 A;  3GIB A;  3PVQ A;  5GMK j;  3JCM W;  4BY6 B;  1EOV A;  2E12 A;  3H0I A;  1VQP T;  4LDU A;  1VQL Q;  2IG0 A;  4J7F A;  3PCO B;  4OB3 B;  1IL2 A;  4E7I A;  4M7A B;  4EMH A;  4PL6 A;  5I22 A;  4C92 G;  2QTX A;  1SG5 A;  3G6E T;  1TU0 B;  3CEY A;  1SRM A;  2KR3 A;  4AFQ C;  4BUG A;  3JCM e;  3A32 A;  4RTU A;  2RQU A;  2YWW A;  3OYD A;  3CCV T;  4F04 B;  2YHT A;  3CCJ T;  2GFA A;  1KD1 C;  2X3W D;  2CYZ B;  1YJW Q;  3I55 T;  1UGP B;  5FLX E;  3QO3 A;  2M02 A;  2M16 A;  1M90 U;  2RH2 A;  2E41 A;  5CCA A;  4J9C A;  1M1K U;  1FX7 A;  1M4Z A;  2EGA A;  3I7F A;  4FYW B;  4R0K A;  2CZ7 B;  4XTU A;  4F17 A;  2DRK A;  3HXY A;  2DU5 A;  2KVQ G;  1L0W A;  1VQ6 A;  2J05 A;  4ZIB A;  4M75 G;  4DBH A;  2DX1 A;  1W2B S;  2L3P A;  4PJJ A;  3CD6 T;  1UFF A;  2J6K A;  5D6X A;  1VQ8 A;  2I4L A;  1SRL A;  1OYX A;  4ORZ A;  4M78 D;  1YCY A;  4M75 E;  1R8O B;  3P8B B;  1VQ9 Q;  2KRN A;  1XOV A;  1Q81 C;  3VJP A;  2Y4X A;  1KHI A;  1K73 R;  5LJ5 g;  1X2G A;  3M4G A;  1Q86 U;  3EHR A;  5LJ5 h;  2J7I A;  2HL5 C;  3C94 A;  1PKS A;  4LDW A;  1GXI E;  3CBO A;  4XEO A;  2DE0 X;  3H9N A;  4UP8 A;  4MML A;  1M2V A;  1UG1 A;  1X54 A;  1WDX A;  2BUD A;  3KFU A;  1GGM A;  1WZO A;  1GRI A;  1AWJ A;  4H2Y A;  2CP0 A;  1VQ5 A;  2OJ2 A;  4KUD K;  4O2D A;  1S72 Q;  3S3N A;  1TTH B;  3SB2 A;  3PTA A;  3JB9 D;  1NJ1 A;  1VQP A;  1G3W A;  1YWP A;  3ER0 A;  4ZGD B;  5GAM g;  4BB7 A;  1BYM A;  4NL3 A;  4H2X A;  3G1J A;  2HSP A;  3JCM Q;  2XTI A;  4AFU C;  2CP5 A;  1B7Y B;  1WA7 A;  4DBQ A;  5GAO n;  2DK3 A;  2VKN A;  3TVT A;  3CCR A;  2HDA A;  4OB2 B;  1HTT A;  1ABO A;  1C0A A;  1K8A U;  2QQR A;  3C95 A;  2LX9 A;  1VQ8 T;  3M5A A;  3VYG A;  5FWC A;  1UUE A;  2MWO A;  2BE9 B;  4YTL A;  1IHV A;  1YIJ Q;  3L2Q A;  4AMC A;  3JCM V;  4H2V A;  1TG0 A;  2QQ9 A;  2ALY A;  3M4Y A;  3EAE A;  4XEM A;  1GCQ C;  2PUO B;  4KUI A;  2KXD A;  3ME9 A;  1M3C A;  1JJC A;  1H3H A;  3G1Z A;  4KR2 A;  3RKY A;  1C6V X;  1YIT A;  2Z0W A;  2DO3 A;  4RDX A;  3M58 A;  1O75 A;  2O2O A;  3RKX A;  4PG3 A;  4J9H A;  3M9Q A;  1T3S A;  2NUT A;  2DL4 A;  2XK0 A;  2RHQ B;  3QO5 A;  1WLE A;  2LNV A;  1CKA A;  5FRO A;  4PNO A;  2VYT A;  4ZTZ B;  3GLX A;  2R5M A;  4IIO A;  4C92 D;  2DQ0 A;  2RI3 A;  1X27 A;  2LQ8 A;  3VUB A;  3HFV A;  1AEY A;  1WFW A;  3E9G A;  1VQM T;  3WXM B;  2XHC A;  3X25 B;  1BU1 A;  3M54 A;  1M3A A;  1YFS A;  8AT1 B;  2FRW A;  4CC3 A;  4DA4 A;  4JJC A;  3GP8 A;  2EYY A;  1E6G A;  1HK9 A;  3FJP A;  2JM9 A;  2CSI A;  4NCX A;  3A7A A;  1PCX A;  5C52 B;  2ZT5 A;  2COW A;  2I0N A;  4CH4 A;  3IKL A;  1WHJ A;  3NTI A;  4V2S A;  2DL8 A;  1WHK A;  2CSQ A;  2J6F A;  4ZTU B;  2QEX T;  1NLP C;  2YUQ A;  2I4M A;  2P0Q A;  2C0O A;  1HD3 A;  2K5I A;  1BI0 A;  1SES A;  1E6H A;  3E9I A;  1BI1 A;  2W10 A;  3HRT A;  3VS4 A;  2PUK B;  1VQ5 T;  2HBP A;  1PHT A;  4BDY A;  2FO0 A;  3QPH A;  4JLI A;  2GTJ A;  5GAO q;  3H0F A;  1ACM B;  1NPP A;  2J6O A;  2LCS A;  4P73 A;  3REU A;  5AT1 B;  5FRM A;  1H8K A;  2FZG B;  3CCJ A;  2OTL A;  1OPL A;  3HP9 A;  1WJS A;  1IZ6 A;  2QXF A;  2CT4 A;  4DEY A;  1HYO A;  4FU6 A;  4HWO A;  1F1B B;  3VRZ A;  4BDZ A;  2XID A;  4PJM A;  5L8R E;  4YDQ A;  2P0K A;  1E22 A;  2ROL A;  2HMA A;  2X9H A;  1WJR A;  11AS A;  5CIU A;  3QYH B;  4MZT A;  2QQA A;  2ZTG A;  1YNZ A;  4BI3 A;  5GAN 2;  5C6S A;  2GBQ A;  4F16 A;  1D1A A;  2I2L A;  3LYI A;  1Q82 C;  3G4S A;  2ATC B;  2ROT A;  2XU8 A;  1UHF A;  1E24 A;  1EIY A;  4LVM A;  4PFP A;  4JJN K;  4NOY A;  3OQ5 A;  4XTZ A;  2A0F B;  3CMA A;  4P3O A;  4D6W A;  3KXT A;  3MP8 A;  1NE8 A;  1S72 T;  2C0T A;  4DPG A;  2RMO A;  2YUP A;  3TSZ A;  1IB8 A;  4K86 A;  2K79 A;  2CS7 A;  1U06 A;  2DQ3 A;  4C92 E;  1MHN A;  3E2U A;  3A98 A;  3G4S Q;  2VWF A;  3SD4 A;  5CKD A;  1AWW A;  2YRC A;  4E6R A;  1D1C A;  4M78 A;  3WVE B;  5CR2 A;  2EKH A;  1M90 R;  3M0S A;  2RHI A;  5A0L A;  5KYN A;  5FRN A;  4C92 F;  3HRK A;  4ME7 A;  4RTT A;  1I5O B;  3MCA B;  1MGQ A;  2XIC A;  2AMC B;  1JB0 E;  1RAC B;  2DDZ A;  5LJ5 e;  3OYM A;  2M0O A;  3JB9 J;  5ELN A;  4J6X A;  1Z9Q A;  1D0X A;  1Q95 G;  4P72 A;  5J26 A;  2DZC A;  4X1V A;  2FHD A;  4JRP A;  3A7U A;  1X75 C;  2OTJ T;  1B7Y A;  1QLY A;  4PJO G;  4CC7 A;  2HNI A;  2YDL A;  2P5I A;  1IRX A;  1PD0 A;  5GAM f;  3TQ7 P;  2D1X A;  4C5I A;  1QVG S;  4H02 A;  5CQX A;  1RIQ A;  2R5A A;  3PZC A;  2FB7 A;  1KG1 A;  4ZTF A;  5GAM e;  1XJW B;  4P75 A;  1D3B B;  1SF9 A;  2RJE A;  3DLM A;  3P8T A;  3HRI A;  3EFR A;  1X6B A;  2EYQ A;  4WJ3 M;  8ATC B;  3OS2 A;  4EMK B;  2ZR3 A;  1OZ3 A;  1R77 A;  1R0B G;  2DVE A;  1MND A;  3EG3 A;  4C8Q G;  1Q7Y R;  1ZSG A;  4C5G A;  4J9F A;  1B3Q A;  2NUP A;  1WGS A;  2LT4 A;  1M1G A;  4Z02 A;  2AZV A;  3SEM A;  4XU3 A;  4DOW A;  3CCE Q;  1G5H A;  4J9G A;  1AD5 A;  5EC7 A;  4ZN3 A;  3MEU A;  4YRK A;  2KNB B;  3JCM h;  1J5W A;  1NG2 A;  2CP6 A;  2GQI A;  2XI9 A;  2PNI A;  2IVW A;  2ESW A;  2L2P A;  1N8R C;  2X51 A;  4LE9 A;  3TEG A;  4KH0 B;  2DEU A;  1VQK A;  2LMJ A;  2EL9 A;  4UP7 A;  2AKW B;  1G3T A;  2RHQ A;  4M78 C;  3L2V A;  1YI2 Q;  3SDZ A;  1NEG A;  4FW1 A;  2F5K A;  2VV5 A;  1ZA2 B;  3JB9 H;  4J9B A;  5I2M A;  3CCL T;  2ZZG A;  1M2O A;  3CXC P;  1X2Q A;  2ZZE A;  3CC7 Q;  5LJ5 j;  3QNE A;  3CC7 T;  2WSF E;  1WYD A;  3FB9 A;  2HZY A;  5D6Y A;  3RR6 A;  2FG0 A;  2RHS A;  3ASK A;  4C92 B;  1YJW T;  4K88 A;  1BIA A;  2E64 A;  2LT1 A;  5ELO A;  1G3Y A;  2I4O A;  3V7C A;  3E19 A;  1YI2 T;  3MF1 A;  4PFO A;  1ZQ1 A;  2VVK A;  5IXF A;  3MEV A;  1I8F A;  3X26 B;  2MK5 A;  1N9R A;  3QBY A;  2QDY B;  5GAM j;  1ARK A;  3SFM A;  2K7A A;  3A8L B;  1KHC A;  3V7S A;  4KBM B;  1U5S A;  1G3S A;  4M75 D;  1I07 A;  4RTZ A;  1IXD A;  4C0D C;  5K1P A;  1H92 A;  2DIQ A;  1RAE B;  1EIF A;  3DB4 A;  3M0P A;  5KYY B;  4HWR A;  2HEQ A;  2Q7G A;  4M7D E;  3A31 A;  3QZ9 B;  4L87 A;  3EH1 A;  2ECZ A;  4P3P A;  4CC4 B;  2K2V A;  3VS3 A;  3OY9 A;  4C0F A;  2DYB A;  3OW2 S;  2HD0 A;  2JTM A;  2VXE A;  3I55 A;  1JJC B;  1YFR A;  4NS5 A;  4QVZ A;  4D8D A;  4GBQ A;  4OLF A;  2NUZ A;  4OMM A;  4IUR A;  2A37 A;  4FYV B;  1Y96 A;  4YPF A;  3LW5 E;  4HVC A;  4Z88 A;  3T9N A;  1WHL A;  3JB9 I;  5GAN 8;  4H2U A;  2IY5 B;  1VQL A;  2JN0 A;  3VQV A;  1TUD A;  2L89 A;  1Q86 C;  2E5Q A;  4N4H A;  3CC2 T;  4MZP A;  4QQG A;  3URG A;  1ZUK A;  3NFC A;  3L2R A;  4YRF A;  1WXU A;  4C92 C;  1M2V B;  1D0Y A;  2L0A A;  1QVG A;  2F2W A;  4Y92 A;  5GJW B;  1UGQ B;  4C8Q A;  2Q5H A;  1B34 A;  3OYF A;  2E4H A;  3CPF A;  2Y90 A;  2IPO B;  2QYZ A;  2B86 A;  3NEL A;  4ELY C;  2M1H A;  4Z89 A;  2ZXF A;  3AT1 B;  1LNX A;  5GAN h;  2YXY A;  1QWF A;  1M8M A;  4Q15 A;  2X4Y A;  3HHT B;  4JS5 A;  1IO6 A;  3I56 A;  5HK3 A;  3LC0 A;  4Q6G A;  1NJI R;  3NTH A;  1VQK Q;  3HXX A;  2CZ6 B;  3MF2 A;  4TWA A;  3ULR B;  5KE2 A;  2J3M A;  2PU9 B;  4BI4 A;  1VQO T;  3P8V A;  1SSF A;  3BY7 A;  4FIB A;  3OMC A;  4P71 A;  2X4X A;  4FYY B;  3NET A;  1UDL A;  5GAN 4;  1Q7Y C;  2DET A;  2KMT A;  1UE9 A;  4L5G A;  1YIJ T;  4G84 A;  3RER A;  1MUZ A;  1WHG A;  1VQ6 Q;  2HKQ B;  1RLQ C;  1LOJ A;  3TRE A;  4HT4 A;  3L1A A;  3CBM A;  1SER A;  3HXU A;  2ZZD A;  1USY A;  1N9W A;  2KRS A;  1YCS B;  4M77 D;  4CI0 C;  2W0Z A;  3IQL A;  1KSW A;  1FMW A;  1WYX A;  3E9H A;  4JS4 A;  1EX4 A;  1KQS S;  5FWB A;  1N8R R;  4R56 A;  3EGX B;  3OYK A;  2JMC A;  1OOT A;  3MP6 A;  2EBP A;  4DBR A;  4ZGE B;  1YHQ T;  1FXX A;  2MMP A;  4AT1 B;  3NPF A;  1T0J A;  1E1T A;  3CC4 A;  3CME T;  2K3Y A;  3REA B;  3UH0 A;  3W3S A;  3MJX A;  4XTX A;  2DER A;  3JCM c;  3M56 A;  3CPW S;  4H2X B;  1PM3 A;  1VQL T;  3OW2 P;  4CS4 A;  1BB9 A;  2O9V A;  2RK2 A;  3U23 A;  4H2T A;  3L42 A;  4AFS C;  1AWX A;  3HRU A;  1SSH A;  2CIM A;  2GF7 A;  4GY5 A;  5KYU A;  1I81 A;  2ZNI A;  4A4E A;  2DLP A;  2FPE A;  1HC7 A;  2LJ3 A;  4M75 B;  3LH5 A;  3S3M A;  2V1Q A;  3QG1 A;  1VQN A;  4TVA A;  4RMO A;  1W6X A;  2LNH B;  4FCY A;  1VQ6 T;  1BBW A;  2WSE E;  3ZL7 C;  1X2H A;  2R57 A;  5HK0 A;  3QUI A;  2DXC A;  3BW1 A;  2KT8 A;  2ZAE A;  3CPW A;  2KI7 A;  3REB B;  2BTT A;  2P0P A;  2YLC A;  2RN8 A;  5GMK e;  3HFN A;  5GMK l;  3NEN A;  4L59 A;  4OMQ A;  1UHC A;  6AT1 B;  4OVA A;  1VQO Q;  4ZN1 A;  2ENM A;  2RB6 A;  5LJ5 f;  1UGV A;  1M1F A;  2P0L A;  1QCF A;  3S6W A;  2ZIM A;  5IXB A;  3CMA Q;  1VUB A;  4IUQ A;  4J15 A;  3ERR A;  4XQ3 A;  1VQM Q;  3UFG A;  3DSQ A;  3BDU A;  3HY1 A;  4XAX B;  3LSS A;  3PFS A;  1KQS P;  2ODR C;  4M7A G;  4M7D C;  3JCM d;  3OB9 A;  5DLO A;  1YBY A;  2YRD A;  2WAC A;  1H4Q A;  3VU3 C;  3EG9 A;  1C1A A;  3EGD A;  1OU8 A;  2EYZ A;  3CCS Q;  3J81 E;  3SWN A;  4M7A E;  1QKX A;  3CCQ A;  2FYK A;  3OYB A;  3REX A;  2KDS A;  1G83 A;  3CXC S;  4M7D B;  5GMK i;  4YRJ A;  2OTL Q;  3EGD B;  3RNJ A;  4DEX A;  4J8O A;  1QF6 A;  2F2X A;  2JZ2 A;  3FRN A;  1K73 U;  1X55 A;  5KYX A;  2CUB A;  2JUF A;  3CQT A;  4FT2 A;  1ADJ A;  4LD6 A;  3QZ5 B;  1WIE A;  1PG5 B;  2GQV A;  3EG0 A;  2RHY A;  1PSE A;  2ABL A;  2BE7 D;  4OF1 A;  3QWY A;  3LH0 A;  4E7H A;  2ZNJ A;  3FIF A;  2J3L A;  1ZA1 B;  2DRM A;  3JCM J;  1TUG B;  2DEQ A;  5GAN 3;  4JZ3 A;  4P71 C;  1JBM A;  4BE0 A;  1RUW A;  5GAO l;  4E2F B;  1W1F A;  4FYX B;  3X24 B;  5IH2 A;  4OB1 B;  4L6V 5;  1W70 A;  4HVV A;  4AG1 C;  3HXZ A;  5GAN 5;  3LWH A;  4K87 A;  1BCO A;  1OZ2 A;  4M77 C;  2ZGW A;  2ZPF B;  4PLL A;  2PVO B;  2C7I A;  4KGZ B;  3M0Q A;  3TSW A;  3BFM A;  4YCU A;  4FT4 A;  2L3S A;  1ASZ A;  3TUP A;  2A3L A;  1LPL A;  3FDR A;  4EPC A;  4H2W A;  3OMG A;  3I5R A;  1AVZ C;  3RBB B;  2VUB A;  4KH1 B;  4KGV B;  2JVV A;  4F7U E;  2K57 A;  4YRO A;  2RF0 A;  4EMG A;  3VV0 A;  4HCB A;  2YRV A;  2QHS A;  1VYU A;  5FW9 A;  2AKL A;  3TEE A;  5CK9 A;  3TU4 K;  5M9O A;  3GPL A;  2JTE A;  4MZM A;  1G8X A;  4IIM A;  5GAN 7;  1KD1 U;  1QE0 A;  1WQ7 A;  1AHJ B;  4J7I A;  1S1N A;  2EYX A;  1QMC A;  7AT1 B;  1WHH A;  2LVM A;  2DD5 A;  5I11 A;  2DXU A;  4EX5 A;  2ZT7 A;  2K4Y A;  4TVA B;  4N0A A;  1NYG A;  2QHU A;  3QWX X;  4M7A A;  3PMI A;  4ZTJ A;  3E9F A;  1TXQ A;  2OAU A;  5KCH A;  1EFW A;  2XKO C;  2DTH A;  5GAO r;  1UEB A;  2VGM A;  2RHS B;  1IRE B;  4HWS A;  4A4G A;  2DA9 A;  4VUB A;  4P74 A;  1VYV A;  2RA2 A;  1VYT A;  5IHK A;  3GNF B;  3L4G B;  3JCM X;  1FYN A;  1V29 B;  12AS A;  4P5N A;  1B34 B;  2E3H A;  3CC2 Q;  1CKB A;  1ABQ A;  1C0M A;  1NJ5 A;  1K8A R;  1MMN A;  4TVY A;  1N5Z A;  1Y7X A;  2OX7 A;  3A5Y A;  3VRY A;  2HQX A;  1ZSZ B;  3CCU Q;  3M4P A;  1Y71 A;  2A28 A;  5CKB A;  2K2M A;  1KMN A;  1VQ8 Q;  2PMF A;  2RQT A;  3HKS A;  4M77 A;  4JRQ A;  3RDV A;  3X20 B;  3AHU A;  1LYL A;  3R6N A;  2KSS A;  2CJA A;  2ZCF B;  1ATI A;  3RF1 A;  2EW3 A;  3V7R A;  2O88 A;  4YRI A;  4XU0 A;  2O01 E;  3O5Z A;  5GAN 6;  3C12 A;  2P84 A;  4C0D B;  2MOX A;  1QP2 A;  2EFI A;  1VQ7 T;  2BZ8 A;  1H3Z A;  1WLP B;  4FW2 A;  1A0N B;  1SKU B;  3IG2 A;  2PQW A;  5A2Q E;  4YRG A;  2LZ6 B;  1RI9 A;  1YIJ A;  1WPY A;  5CQY A;  3BDL A;  2E65 A;  4XTY A;  4X9C A;  2O4X A;  3A7R A;  2COY A;  2JM8 A;  2NS6 A;  1Z9Z A;  1H64 1;  3OSV A;  4IUT A;  2X4J A;  2Q7E A;  3G71 T;  2FEI A;  2EJG A;  1QCN A;  4B9W A;  3OYC A;  1K0S A;  1TH7 A;  1KQ2 A;  2X35 A;  4GLK A;  1RAD B;  5KYW B;  5HGQ A;  1JU5 C;  3C0C A;  2M9U A;  5KE3 A;  1NYQ A;  3QSU A;  1MMG A;  3JB9 G;  3A1P A;  1NJ8 A;  3IKM B;  3JRZ A;  3THK A;  5GAO p;  1GBQ A;  4OGE A;  5HY6 A;  4JRI A;  3VKI A;  3V8J A;  5DM7 R;  4PLI A;  1Q86 R;  3L2Z A;  3NGP A;  4C92 A;  3CME A;  3OW2 A;  4P74 C;  1B70 B;  2QA4 Q;  2C06 A;  1U8R A;  1YJN A;  3HTZ A;  4IUP A;  3G4S T;  2H3J A;  2GFU A;  3QYG B;  4YRM A;  2YUN A;  3FEO A;  5C0M A;  1Z7M A;  3G6E Q;  1GFC A;  2CP2 A;  2MWP A;  3HFO A;  2K9G A;  4M78 G;  1X69 A;  2EYW A;  3BJU A;  2HSE B;  2V26 A;  4OMO A;  1X6O A;  2PME A;  2DAQ A;  4EIK A;  5CKF A;  2DTO A;  1YHQ A;  1GFD A;  1PKT A;  3MQZ A;  1BCM A;  2E6N A;  2K3B A;  3UF4 A;  4LDX A;  2CJB A;  3DKM A;  1M1K C;  1UTI A;  4C8Q D;  3HY0 A;  3CC4 Q;  4LVI A;  3LGF A;  4EMK A;  1QW1 A;  1NNH A;  2KEA A;  1X2K A;  3TEH A;  2EKO A;  3OSS C;  3M0U A;  2ZPB B;  2NUP B;  1PYS B;  1BK2 A;  1ZUY A;  3RGL A;  1AZE A;  4YRC A;  4YRR A;  2RHU A;  4PJL A;  4BI8 B;  1MV3 A;  2KE9 A;  2KYM A;  1M1K R;  3CCS A;  4QQ6 A;  1X56 A;  4M7A D;  3I56 T;  1UJ0 A;  2KRO A;  1TOV A;  2VAS A;  2DIG A;  3Q1J A;  4NL2 A;  2L8D A;  2LCL A;  3E1S A;  4HCK A;  4RTX A;  4CH3 A;  2E3C A;  2ART A;  2DBK A;  2LDM A;  1ASY A;  4IKF A;  3V8L A;  5DY9 A;  2V1R A;  2DJZ A;  2DL5 A;  5CKH A;  4CRI A;  1VQM A;  1PWT A;  1JXM A;  2VB6 A;  3INZ A;  2O9S A;  3DB3 A;  3NMZ C;  1OEB A;  1EFN A;  3QDR B;  2RHZ A;  3QJ6 A;  2RJC A;  4M7D D;  2IY5 A;  3HXV A;  2DD4 A;  3EFO A;  3CBP A;  4BW9 A;  2ZCE A;  2DVJ A;  4RMF A;  4O5V A;  4RTY A;  4G85 A;  4KT0 E;  3KUF A;  5GAN g;  1N6A A;  1QVF A;  2C8M A;  2KK4 A;  1WI7 A;  3HFZ A;  2FL7 A;  5CO7 A;  3M4Q A;  1K9A A;  2P4T A;  1Q82 U;  3VYH B;  1VQ4 Q;  4TVW A;  3H6Z A;  2LRQ A;  4WCI A;  3OYG A;  2D8J A;  1Y0M A;  2XD0 A;  3I5S A;  4YCW A;  2DM1 A;  2DPP B;  1QVG P;  1R0C B;  1KOG A;  1AT1 B;  2D8H A;  2F69 A;  3ZEH A;  3MET A;  3OA6 A;  3CCU A;  2QA4 A;  4M77 B;  2VGN A;  3QXE B;  4CS3 A;  1M9S A;  2AZS A;  3OBW A;  1Q81 U;  1PRM C;  3RUX A;  3EH2 A;  3CCM T;  1KJW A;  5LJ3 e;  2DKG A;  2MYS A;  1XQH A;  4J9E A;  2ZIO A;  4KRT A;  4OML A;  3JAM E;  3P8D A;  1D0Z A;  2CH4 A;  2C0I A;  2OI3 A;  1YFT A;  3OS1 A;  4M7D A;  2FPF A;  2HQE A;  2HQH A;  2DMO A;  5GAN j;  1JJ2 S;  2EJF A;  1OQK A;  3MKD A;  2LQN A;  1OUL A;  2EQM A;  1ZUU A;  2QQS A;  4C5E A;  1RAF B;  1YN8 A;  2P4R A;  1YGB A;  1UB4 A;  1QVF P;  1X01 A;  2H3E B;  2XMF A;  3I9Q A;  2OAW A;  3CME Q;  3CD6 Q;  1ZSZ C;  1EVK A;  1ZBJ A;  1B07 A;  2NUT B;  5FU6 C;  3LLR A;  4OMF B;  2KGT A;  4OMN A;  5KYY A;  2L5Q A;  4QQD A;  4HVU A;  2GTO A;  4OMP A;  1JEG A;  1I0C A;  2CZ1 B;  3OD1 A;  2Q5I A;  2J06 A;  3GF5 A;  2E10 A;  1WJQ A;  2OTJ Q;  1EVL A;  3HRS A;  1YJ9 Q;  1M8V A;  1G51 A;  3CCR Q;  2KBT A;  4Y91 A;  1V76 A;  2YT6 A;  4JDS A;  4X5O A;  4PK4 A;  2O4X B;  2RD1 A;  1YJ9 T;  1K73 C;  2QG9 B;  2AT1 B;  3CCU T;  1E7O A;  2XDP A;  4M77 E;  1NPR A;  2ARU A;  2LJ1 A;  3I56 Q;  5GAN d;  2X3X D;  3CCL A;  2CP3 A;  3FJ5 A;  4PKC C;  4AH6 A;  4PJO C;  2ZPI B;  2RI5 A;  3CC7 A;  3KBG A;  2LX7 A;  3M57 A;  2FZK B;  2E70 A;  3RMS A;  1DJ7 B;  3VS2 A;  2DL3 A;  2D0Q B;  4BAC A;  3R07 A;  3RMQ A;  4LVK A;  2RJF A;  1M27 C;  1VQP Q;  1ZHI A;  1UGR B;  4XU2 A;  3SHW A;  4A4H A;  3CC2 A;  4E51 A;  3NEM A;  2E6Z A;  5LJ3 j;  4X34 A;  3FC3 A;  4PJO A;  1WQW A;  3HSB A;  4YCV A;  4II1 A;  3CCM Q;  4M7D F;  1Q82 R;  1PNJ A;  4A54 A;  1KFZ A;  4XU1 A;  5HKC A;  2G3R A;  3OYL A;  2K3X A;  2RQR A;  4PJO F;  5GAN e;  1QKW A;  3QHS A;  3CCM A;  2ZR2 A;  4J9I A;  5A0D A;  2XDD A;  4RQF A;  1K1Z A;  2EQI A;  3HXW A;  2DU7 A; 
#chains in the Genus database with same CATH homology
 3JSC A;  1H4T A;  4HKE A;  2EQU A;  2QA4 T;  4YRL A;  5FU7 C;  2XG8 D;  3A8G B;  1N9S A;  4UPA A;  4OB0 B;  4A53 A;  2EQK A;  1OI1 A;  3O8V A;  2FVU A;  4P75 C;  2CZ0 B;  3CCE A;  1VQ7 A;  1VIE A;  4OP0 A;  1NYR A;  5A0G A;  4RG8 A;  4EMK C;  3PIO A;  3VQX A;  3CCS T;  2WSC E;  1B76 A;  1ADY A;  4E47 A;  3VQY A;  3OYY A;  4M7D G;  2ZZF A;  5KCO A;  1WU7 A;  3CMQ A;  1YJ9 A;  4TVR A;  3G7Z A;  4BD3 A;  3WQZ A;  1YIT T;  2OTJ A;  4M78 E;  2BKD N;  4TTV A;  4LNS A;  3OYA A;  4CH5 A;  2EWN A;  5J3B A;  3HPW A;  4HCZ A;  4F7U F;  2A7Y A;  2ZPG B;  4IUU A;  1K8A C;  1E1O A;  4R55 A;  1K9M U;  3OBY A;  2YLB A;  2ZIN A;  4RKU E;  2EAY A;  1USY C;  4BWA A;  1W66 A;  3FLG A;  4WF2 A;  1YI2 A;  4YYE A;  1VQ4 A;  1VQ9 T;  2ZT8 A;  1KQ1 A;  4TQF A;  3L2U A;  3GOX A;  3J7A F;  2LCC A;  1W2B A;  1JRI A;  5LJ3 f;  3P8H A;  3A8O B;  4KR3 A;  2QEX A;  1U1T A;  5LJ3 g;  4FM4 B;  4TQD A;  1QP3 A;  4RCB A;  1VQK T;  3SWN C;  3UGT A;  1LJO A;  4QVC A;  4RG2 A;  2LTO A;  4PJO D;  3C4S A;  1YJW A;  1NZ9 A;  3M53 A;  2CGH A;  5DLQ E;  5CVI A;  1YJN T;  4FL6 A;  4LVJ A;  2E5A A;  1K9M C;  3A8M B;  5I2S A;  2L3R A;  4JLG A;  3M55 A;  1JJ2 A;  2AKW A;  4MDW A;  1RL2 A;  3EFS A;  3QO7 A;  1UGS B;  4BY6 C;  1Y07 A;  5IT9 E;  1VIF A;  4E7L A;  1KMM A;  4B9X A;  4CH6 A;  4C5H A;  3F70 A;  2RJD A;  4M7A C;  1G5I A;  3OS0 A;  2AHJ B;  4C8Q E;  2V8I A;  4BE2 A;  3JCM g;  4JUV A;  2QQB A;  3X28 B;  2MI6 A;  1H4S A;  4N4I A;  4P73 C;  3QTC A;  3MEA A;  3PCO A;  2ZT6 A;  4LVL A;  3CCV A;  3OYE A;  1B70 A;  1KC8 U;  4OGC A;  1Y96 B;  4YRS A;  3WVD B;  3OYJ A;  1VQ4 T;  3G6E A;  1BBU A;  3ZFJ A;  4LDY A;  2I4N A;  1XTD A;  1NJI C;  1HXD A;  2B8A A;  3JCM P;  2EQJ A;  3CXC A;  3V8K A;  4LD9 K;  2RO0 A;  5KH6 A;  2KQW A;  2K5F A;  2GCX A;  3OYN A;  4KQE A;  4ZGJ B;  3QKJ A;  1EQR A;  2D9T A;  5LL6 S;  1QVF S;  3ICA A;  2A8E A;  4BE1 A;  4N0A C;  3NTK A;  5IAY A;  3VQW A;  3MEW A;  2DXT A;  5GAM d;  1U1S A;  2OTL T;  2K5L A;  2KY9 A;  1WNL A;  2DZ9 A;  2R58 A;  5GAO m;  4RCC A;  2EIF A;  4ATO A;  1NJ6 A;  2LC4 A;  4C0Z A;  3MP1 A;  2QI2 A;  2QHV A;  1ZBX A;  2XGT A;  3RAC A;  2V8K A;  4M78 F;  3RL6 A;  5FU7 B;  5LJ5 d;  4IUV A;  4CS2 A;  3OYI A;  2VC8 A;  3VBB A;  5CKE A;  1RI0 A;  3RES A;  2DXB A;  3QII A;  4QW2 A;  3MO8 A;  4HWT A;  3CD6 A;  4M75 C;  4MDX A;  4M75 F;  2JNG A;  4HT8 A;  1VQN T;  1KC8 C;  4XK8 E;  2E1H A;  3JB9 F;  4Y28 E;  2PVD B;  3UDC A;  1Z7N A;  1EIY B;  3OYH A;  1SRY A;  1G5V A;  4M78 B;  1BKB A;  2ARS A;  1Q7Y U;  1VQ9 A;  2RI2 A;  4X9D A;  4PJO B;  5K1X A;  2RHX A;  4YRT A;  5CAI A;  3P8Y A;  5GMK h;  5I21 A;  3UGQ A;  4QVD A;  5GMK m;  3LGL A;  2MF2 A;  5GAM h;  5FU6 B;  4J83 A;  1I4K 1;  3L2W A;  3RKW A;  2RK1 A;  4YRE A;  2AMC A;  4YRQ A;  2EJ9 A;  4O6J A;  4F7U B;  3CCQ T;  1SET A;  3R6O A;  3N5B B;  3UPU A;  4E7K A;  2ZPE B;  1N27 A;  4C8Q B;  3PGG A;  1W4S A;  2V8J A;  4HA8 A;  4F7U A;  3M59 A;  3L4G A;  1H4V B;  2JTF A;  1BI2 A;  1QVP A;  4EO4 A;  3A8H B;  4LDV A;  2LQK A;  5F5W A;  3G71 A;  4HCC A;  4JRK A;  4N4G A;  3SWN B;  4XTV A;  1XNI A;  1VQZ A;  3S3O A;  1NJ2 A;  1PYS A;  4J6Y A;  2X4W A;  3A74 A;  1S72 A;  5C53 B;  1I5L A;  3JCM b;  3QJY A;  3CCE T;  4DQ2 A;  4P3N A;  3OS5 A;  4M77 F;  3ZBD A;  4YRN A;  3VUZ A;  3PMT A;  3TCJ A;  1P92 A;  4ELZ C;  1B8A A;  3A5Z A;  1BIB A;  2RM4 A;  5C51 B;  1D3B A;  4Q5W A;  3JCM f;  3CC4 T;  4MMK A;  2F5T X;  3HL8 A;  2VXF A;  2Q7H A;  4EDU A;  2G4C A;  4H2S A;  2QHT A;  4PHC A;  2PVG B;  4PJO E;  2NLU A;  1FYF A;  3GNG A;  4KUL A;  4YRP A;  3IAL A;  4J5Y A;  1M90 C;  3QO8 A;  4M75 A;  5KNN A;  2ALY B;  3LSQ A;  3UWN A;  2HAX A;  5EG2 A;  3MEY A;  1NJI U;  4UC4 A;  2Y4Y A;  4DOV A;  5IN1 A;  2MAM A;  4WJ4 A;  4J6W A;  2DTI A;  5LJ3 d;  2ZPH B;  4P72 C;  3J80 E;  5J39 A;  3A5Z B;  4XTW A;  3LX7 A;  3RIR A;  4A4K A;  5LJ3 h;  4FSX A;  1O9S A;  2KAF A;  2CKK A;  4M77 G;  2ODR D;  4F7U G;  3PIP A;  1PSF A;  2CJ9 A;  4UP9 A;  1YB3 A;  3DLL A;  3CMA T;  4RQE A;  4A4F A;  3UT1 A;  1N8R U;  4C8Q F;  4C8Q C;  1KQS A;  3PNW C;  2XDB A;  1FWZ A;  4HWP A;  5GAN f;  4YP0 A;  5D6W A;  1VQO A;  3HFZ B;  4WI1 A;  3H8Z A;  2D6F A;  3MHX A;  4E7J A;  2BIV A;  4C0G A;  5AYF A;  3PT9 A;  3LWI A;  4M7A F;  2JOY A;  5E3I A;  4HT9 A;  3CCR T;  3TEH B;  1BI3 A;  1M5Q 1;  3GIB A;  5GMK j;  3JCM W;  4BY6 B;  1EOV A;  2E12 A;  1VQP T;  4LDU A;  2IG0 A;  4J7F A;  3PCO B;  4OB3 B;  1IL2 A;  4E7I A;  4M7A B;  4EMH A;  4PL6 A;  4C92 G;  2QTX A;  3G6E T;  3CEY A;  3A32 A;  4BUG A;  3JCM e;  3OYD A;  3CCV T;  1KD1 C;  2YHT A;  3CCJ T;  2GFA A;  2CYZ B;  3I55 T;  1UGP B;  5FLX E;  3QO3 A;  2M16 A;  1M90 U;  2RH2 A;  2E41 A;  5CCA A;  1M1K U;  1FX7 A;  1M4Z A;  3I7F A;  2CZ7 B;  4XTU A;  3HXY A;  2DU5 A;  2KVQ G;  1L0W A;  1VQ6 A;  4ZIB A;  4M75 G;  1W2B S;  3CD6 T;  5D6X A;  1VQ8 A;  2I4L A;  1OYX A;  4M78 D;  1YCY A;  4M75 E;  1R8O B;  3P8B B;  1XOV A;  1Q81 C;  3VJP A;  2Y4X A;  1KHI A;  5LJ5 g;  1X2G A;  3M4G A;  1Q86 U;  5LJ5 h;  3C94 A;  4LDW A;  1GXI E;  3CBO A;  4XEO A;  4UP8 A;  4MML A;  1X54 A;  2BUD A;  3KFU A;  1GGM A;  4H2Y A;  1VQ5 A;  4KUD K;  4O2D A;  3S3N A;  3SB2 A;  3PTA A;  3JB9 D;  1NJ1 A;  1VQP A;  1G3W A;  3ER0 A;  4ZGD B;  5GAM g;  4BB7 A;  1BYM A;  4NL3 A;  4H2X A;  3JCM Q;  2XTI A;  1B7Y B;  5GAO n;  2DK3 A;  3CCR A;  1C0A A;  4OB2 B;  1HTT A;  1K8A U;  2QQR A;  3C95 A;  2LX9 A;  1VQ8 T;  3M5A A;  3VYG A;  2MWO A;  4YTL A;  3L2Q A;  4H2V A;  3JCM V;  2QQ9 A;  2ALY A;  3M4Y A;  3EAE A;  4XEM A;  2PUO B;  4KUI A;  3ME9 A;  1JJC A;  3G1Z A;  4KR2 A;  3RKY A;  1YIT A;  2DO3 A;  4RDX A;  3M58 A;  1O75 A;  3RKX A;  4PG3 A;  3M9Q A;  2XK0 A;  2RHQ B;  3QO5 A;  1WLE A;  2LNV A;  5FRO A;  4PNO A;  2VYT A;  4ZTZ B;  3GLX A;  2R5M A;  4C92 D;  2DQ0 A;  2RI3 A;  2LQ8 A;  3VUB A;  3HFV A;  3E9G A;  1VQM T;  3WXM B;  2XHC A;  3X25 B;  3M54 A;  1YFS A;  4DA4 A;  3GP8 A;  1HK9 A;  3FJP A;  4NCX A;  3A7A A;  5C52 B;  2ZT5 A;  4CH4 A;  3IKL A;  3NTI A;  4V2S A;  4ZTU B;  2QEX T;  2I4M A;  2P0Q A;  2K5I A;  1BI0 A;  1SES A;  3E9I A;  1BI1 A;  3HRT A;  2PUK B;  1VQ5 T;  2HBP A;  4BDY A;  3QPH A;  4JLI A;  5GAO q;  1NPP A;  4P73 A;  3REU A;  5FRM A;  3CCJ A;  2OTL A;  3HP9 A;  1WJS A;  1IZ6 A;  2QXF A;  4FU6 A;  4HWO A;  4BDZ A;  2XID A;  5L8R E;  4YDQ A;  2P0K A;  1E22 A;  1WJR A;  11AS A;  3QYH B;  4MZT A;  5CIU A;  2QQA A;  2ZTG A;  4BI3 A;  5GAN 2;  5C6S A;  3LYI A;  2I2L A;  1Q82 C;  3G4S A;  2XU8 A;  1E24 A;  1EIY A;  4LVM A;  4JJN K;  4NOY A;  3OQ5 A;  4XTZ A;  4P3O A;  3CMA A;  4D6W A;  3KXT A;  3MP8 A;  1NE8 A;  1S72 T;  4DPG A;  4K86 A;  2CS7 A;  2DQ3 A;  4C92 E;  1MHN A;  3SD4 A;  5CKD A;  4M78 A;  3WVE B;  5CR2 A;  2RHI A;  5A0L A;  5FRN A;  4C92 F;  3HRK A;  4ME7 A;  3MCA B;  1MGQ A;  2XIC A;  2AMC B;  1JB0 E;  2DDZ A;  5LJ5 e;  3OYM A;  2M0O A;  3JB9 J;  5ELN A;  4J6X A;  4P72 A;  5J26 A;  2DZC A;  2FHD A;  4JRP A;  3A7U A;  1X75 C;  2OTJ T;  1B7Y A;  4PJO G;  2HNI A;  2P5I A;  5GAM f;  4C5I A;  1QVG S;  4H02 A;  5CQX A;  1RIQ A;  2R5A A;  3PZC A;  2FB7 A;  1KG1 A;  4ZTF A;  5GAM e;  4P75 A;  1D3B B;  2RJE A;  3DLM A;  3P8T A;  3HRI A;  3EFR A;  2EYQ A;  4WJ3 M;  3OS2 A;  4EMK B;  2ZR3 A;  1OZ3 A;  2DVE A;  4C8Q G;  4C5G A;  1WGS A;  2LT4 A;  1M1G A;  4Z02 A;  4XU3 A;  4DOW A;  1G5H A;  4ZN3 A;  3MEU A;  4YRK A;  3JCM h;  1J5W A;  2XI9 A;  2IVW A;  1N8R C;  3TEG A;  1VQK A;  2EL9 A;  4UP7 A;  2AKW B;  1G3T A;  2RHQ A;  4M78 C;  3L2V A;  3SDZ A;  2F5K A;  2VV5 A;  3JB9 H;  5I2M A;  3CCL T;  2ZZG A;  2ZZE A;  5LJ5 j;  3QNE A;  3CC7 T;  2WSF E;  1WYD A;  3FB9 A;  5D6Y A;  2RHS A;  3ASK A;  4C92 B;  1YJW T;  4K88 A;  1BIA A;  2E64 A;  2LT1 A;  5ELO A;  1G3Y A;  2I4O A;  3V7C A;  3E19 A;  1YI2 T;  3MF1 A;  1ZQ1 A;  3MEV A;  1I8F A;  3X26 B;  1N9R A;  3QBY A;  2QDY B;  5GAM j;  3SFM A;  3A8L B;  1KHC A;  3V7S A;  4KBM B;  1G3S A;  4M75 D;  4C0D C;  5K1P A;  2DIQ A;  1EIF A;  3DB4 A;  4HWR A;  2Q7G A;  4M7D E;  3A31 A;  3QZ9 B;  4L87 A;  4P3P A;  2K2V A;  3OY9 A;  4C0F A;  3OW2 S;  2HD0 A;  2JTM A;  2VXE A;  3I55 A;  1JJC B;  1YFR A;  4NS5 A;  4QVZ A;  4OLF A;  4IUR A;  1Y96 A;  4YPF A;  3LW5 E;  4HVC A;  3T9N A;  3JB9 I;  5GAN 8;  4H2U A;  2IY5 B;  1VQL A;  2JN0 A;  3VQV A;  2L89 A;  1Q86 C;  2E5Q A;  4N4H A;  3CC2 T;  4MZP A;  4QQG A;  3URG A;  3NFC A;  3L2R A;  4YRF A;  4C92 C;  1QVG A;  1UGQ B;  4C8Q A;  2Q5H A;  1B34 A;  3OYF A;  3CPF A;  2Y90 A;  3NEL A;  4ELY C;  2M1H A;  2ZXF A;  1LNX A;  5GAN h;  4Q15 A;  2X4Y A;  3HHT B;  4JS5 A;  3I56 A;  5HK3 A;  3LC0 A;  4Q6G A;  3NTH A;  3HXX A;  2CZ6 B;  3MF2 A;  4TWA A;  5KE2 A;  2J3M A;  2PU9 B;  4BI4 A;  1VQO T;  3P8V A;  1SSF A;  3BY7 A;  4FIB A;  3OMC A;  4P71 A;  2X4X A;  3NET A;  5GAN 4;  1Q7Y C;  2KMT A;  4L5G A;  1YIJ T;  4G84 A;  3RER A;  1LOJ A;  3TRE A;  4HT4 A;  3L1A A;  3CBM A;  1SER A;  3HXU A;  2ZZD A;  1USY A;  1N9W A;  4M77 D;  4CI0 C;  3E9H A;  4JS4 A;  1KQS S;  4R56 A;  3OYK A;  3MP6 A;  4ZGE B;  1YHQ T;  1FXX A;  2MMP A;  1E1T A;  3CC4 A;  3CME T;  2K3Y A;  3UH0 A;  3W3S A;  4XTX A;  3JCM c;  3M56 A;  3CPW S;  4H2X B;  1VQL T;  4CS4 A;  2RK2 A;  4H2T A;  3L42 A;  3HRU A;  2CIM A;  2GF7 A;  4GY5 A;  1I81 A;  2ZNI A;  4A4E A;  1HC7 A;  4M75 B;  3S3M A;  3QG1 A;  1VQN A;  4TVA A;  4RMO A;  1VQ6 T;  1BBW A;  2WSE E;  1X2H A;  2R57 A;  5HK0 A;  3QUI A;  2DXC A;  3BW1 A;  3CPW A;  2P0P A;  2YLC A;  5GMK e;  3HFN A;  5GMK l;  3NEN A;  4L59 A;  4OVA A;  4ZN1 A;  2RB6 A;  5LJ5 f;  1M1F A;  2P0L A;  3S6W A;  2ZIM A;  1VUB A;  4IUQ A;  4J15 A;  3ERR A;  4XQ3 A;  3UFG A;  3DSQ A;  3BDU A;  3HY1 A;  4XAX B;  3LSS A;  3PFS A;  2ODR C;  4M7A G;  4M7D C;  3JCM d;  3OB9 A;  5DLO A;  1YBY A;  2WAC A;  1H4Q A;  3VU3 C;  3J81 E;  3SWN A;  4M7A E;  3CCQ A;  2FYK A;  3OYB A;  3REX A;  2KDS A;  3CXC S;  4M7D B;  5GMK i;  4YRJ A;  4J8O A;  1QF6 A;  2JZ2 A;  3FRN A;  1K73 U;  1X55 A;  2JUF A;  4FT2 A;  1ADJ A;  4LD6 A;  3QZ5 B;  2GQV A;  2RHY A;  1PSE A;  4OF1 A;  3LH0 A;  4E7H A;  2ZNJ A;  3FIF A;  2J3L A;  3JCM J;  2DEQ A;  5GAN 3;  4P71 C;  1JBM A;  4BE0 A;  5GAO l;  3X24 B;  4OB1 B;  4L6V 5;  3HXZ A;  5GAN 5;  3LWH A;  4K87 A;  1OZ2 A;  4M77 C;  2ZGW A;  2ZPF B;  4PLL A;  2PVO B;  2C7I A;  3BFM A;  4YCU A;  4FT4 A;  1ASZ A;  3TUP A;  2A3L A;  3FDR A;  4EPC A;  4H2W A;  3OMG A;  2VUB A;  2JVV A;  4F7U E;  2K57 A;  4YRO A;  4EMG A;  3VV0 A;  4HCB A;  2YRV A;  2QHS A;  3TEE A;  5CK9 A;  3TU4 K;  5M9O A;  3GPL A;  4MZM A;  5GAN 7;  1KD1 U;  1QE0 A;  1WQ7 A;  1AHJ B;  4J7I A;  2LVM A;  2DD5 A;  4EX5 A;  2DXU A;  2ZT7 A;  2K4Y A;  4TVA B;  4N0A A;  2QHU A;  4M7A A;  3PMI A;  4ZTJ A;  3E9F A;  2OAU A;  5KCH A;  1EFW A;  2XKO C;  2DTH A;  5GAO r;  1UEB A;  2VGM A;  2RHS B;  1IRE B;  4HWS A;  4A4G A;  4VUB A;  4P74 A;  2RA2 A;  3GNF B;  3L4G B;  3JCM X;  1V29 B;  12AS A;  4P5N A;  1B34 B;  1NJ5 A;  4TVY A;  1Y7X A;  3A5Y A;  2HQX A;  3M4P A;  1Y71 A;  5CKB A;  1KMN A;  2PMF A;  3HKS A;  4M77 A;  4JRQ A;  3X20 B;  3AHU A;  1LYL A;  2KSS A;  2CJA A;  2ZCF B;  1ATI A;  3RF1 A;  3V7R A;  4YRI A;  4XU0 A;  2O01 E;  5GAN 6;  3C12 A;  4C0D B;  1QP2 A;  2EFI A;  1VQ7 T;  1H3Z A;  3IG2 A;  2PQW A;  5A2Q E;  4YRG A;  1YIJ A;  1WPY A;  5CQY A;  3BDL A;  2E65 A;  4XTY A;  4X9C A;  2O4X A;  3A7R A;  2NS6 A;  1H64 1;  3OSV A;  4IUT A;  2X4J A;  2Q7E A;  3G71 T;  2EJG A;  4B9W A;  3OYC A;  1TH7 A;  1KQ2 A;  2X35 A;  4GLK A;  5HGQ A;  2M9U A;  5KE3 A;  1NYQ A;  3QSU A;  3JB9 G;  1NJ8 A;  3IKM B;  3JRZ A;  5GAO p;  4OGE A;  5HY6 A;  4JRI A;  3VKI A;  3V8J A;  5DM7 R;  4PLI A;  3L2Z A;  4C92 A;  3CME A;  3OW2 A;  4P74 C;  1B70 B;  2C06 A;  1U8R A;  1YJN A;  3HTZ A;  4IUP A;  3G4S T;  2H3J A;  2GFU A;  3QYG B;  4YRM A;  3FEO A;  5C0M A;  1Z7M A;  2MWP A;  3HFO A;  4M78 G;  3BJU A;  1X6O A;  2PME A;  2DAQ A;  5CKF A;  2DTO A;  1YHQ A;  3MQZ A;  2E6N A;  4LDX A;  2CJB A;  3DKM A;  1M1K C;  4C8Q D;  3HY0 A;  4LVI A;  3LGF A;  4EMK A;  1QW1 A;  1NNH A;  3TEH A;  2EKO A;  3OSS C;  2ZPB B;  1PYS B;  3RGL A;  4YRC A;  4YRR A;  2RHU A;  4BI8 B;  3CCS A;  4QQ6 A;  1X56 A;  4M7A D;  3I56 T;  2DIG A;  3Q1J A;  4NL2 A;  2L8D A;  2LCL A;  3E1S A;  4CH3 A;  2E3C A;  2ART A;  2LDM A;  1ASY A;  4IKF A;  3V8L A;  5DY9 A;  2DJZ A;  5CKH A;  4CRI A;  1VQM A;  3INZ A;  3DB3 A;  3QDR B;  2RHZ A;  3QJ6 A;  2RJC A;  4M7D D;  2IY5 A;  3HXV A;  2DD4 A;  3CBP A;  4BW9 A;  2ZCE A;  4RMF A;  4O5V A;  4G85 A;  4KT0 E;  3KUF A;  5GAN g;  1N6A A;  1QVF A;  2C8M A;  2KK4 A;  3HFZ A;  2FL7 A;  5CO7 A;  3M4Q A;  2P4T A;  1Q82 U;  3VYH B;  4TVW A;  3H6Z A;  2LRQ A;  3OYG A;  2XD0 A;  4YCW A;  2DPP B;  1KOG A;  2F69 A;  3ZEH A;  3MET A;  3OA6 A;  3CCU A;  2QA4 A;  4M77 B;  2VGN A;  3QXE B;  4CS3 A;  1M9S A;  3OBW A;  1Q81 U;  3RUX A;  3CCM T;  5LJ3 e;  2DKG A;  1XQH A;  2ZIO A;  3JAM E;  3P8D A;  1YFT A;  3OS1 A;  4M7D A;  2HQE A;  5GAN j;  1JJ2 S;  2EJF A;  2EQM A;  2QQS A;  4C5E A;  1YGB A;  1UB4 A;  1X01 A;  1EVK A;  3LLR A;  4OMF B;  5FU6 C;  2L5Q A;  4QQD A;  2CZ1 B;  3OD1 A;  2Q5I A;  2E10 A;  3GF5 A;  1WJQ A;  1EVL A;  3HRS A;  1M8V A;  1G51 A;  4Y91 A;  4X5O A;  4JDS A;  2O4X B;  2RD1 A;  1YJ9 T;  1K73 C;  3CCU T;  2XDP A;  4M77 E;  1NPR A;  2ARU A;  5GAN d;  3CCL A;  4PKC C;  4AH6 A;  4PJO C;  2ZPI B;  2RI5 A;  3CC7 A;  3KBG A;  3M57 A;  2E70 A;  3RMS A;  1DJ7 B;  2D0Q B;  4BAC A;  3R07 A;  3RMQ A;  4LVK A;  2RJF A;  1ZHI A;  1UGR B;  4XU2 A;  3CC2 A;  4A4H A;  4E51 A;  3NEM A;  2E6Z A;  5LJ3 j;  4X34 A;  3FC3 A;  4PJO A;  1WQW A;  3HSB A;  4YCV A;  4II1 A;  4M7D F;  4A54 A;  4XU1 A;  5HKC A;  2G3R A;  3OYL A;  2K3X A;  4PJO F;  5GAN e;  3QHS A;  3CCM A;  2ZR2 A;  5A0D A;  2XDD A;  4RQF A;  3HXW A;  2DU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...