2E10A

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutation r51a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
217
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGESPEGGLWLSIVLSPKKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Biotin Protein Ligase
total genus 66
structure length 217
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e10A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e10A01
3RF1A 4DPGA 4J6XA 4M77B 4YRIA 4F7UA 2CGHA 3G1ZA 4P75A 5GAN3 3EFRA 5ELNA 5CAIA 2ZINA 2ZZFA 4MMLA 3TEGA 4XQ3A 1FYFA 2ZGWA 4H2XB 3ERRA 3P8TA 4YREA 4C92B 3RKXA 1YCYA 4PJOF 2RA2A 4M7DF 1X56A 3NELA 2RB6A 4P72A 2IY5B 4ZTZB 3HRIA 3QO5A 4EX5A 3SWNB 3A7UA 3UGQA 5C53B 1KQ1A 2DJZA 3JB9H 2DZ9A 4C92F 4M77D 3M4GA 1I8FA 1NJ6A 4L87A 1I5LA 2ODRC 2FB7A 4P3OA 1YGBA 3RERA 1X01A 2YHTA 1YFRA 2ZIOA 2EL9A 3JCMJ 1L0WA 1HK9A 3RKWA 3P8VA 3JB9D 1U1SA 5GAOm 4A53A 4AH6A 4HVCA 3V7SA 4C8QE 3INZA 4C8QA 3RIRA 2DTHA 2AMCB 5LJ3j 3A5YA 4MMKA 3PGGA 2DVEA 4PNOA 1X2HA 1WNLA 4H2VA 3RGLA 4YRJA 5LJ3h 4XU2A 2ALYB 2ZZEA 2VXEA 5C52B 3REUA 1NJ8A 4ZIBA 1USYA 4C92D 1KMMA 3HXYA 3V8JA 4YRCA 2RHQA 1Y96A 3PCOB 1LJOA 2DTIA 4RQFA 2E5AA 4YDQA 4P73A 5GAMg 1KMNA 3SWNA 2C7IA 4M75D 1D3BA 1H4QA 1LNXA 11ASA 3NETA 3HTZA 5GAMj 4M78D 1JBMA 5GAN6 1WLEA 2AKWA 4OLFA 4XU3A 2Y90A 1B70B 4M75B 4TQDA 4K87A 1SRYA 4M78C 4F7UE 5LJ5g 4M7AG 1EOVA 3GIBA 1B70A 5GAN2 2E3CA 4HWPA 5GMKl 4YPFA 4YRNA 4M78E 4H2YA 4PJOG 2ZNJA 3HFZA 1PYSB 2DDZA 2I2LA 5LJ5h 1E24A 1HXDA 1SERA 2EJGA 3JCMf 2ZIMA 1G5IA 4H2XA 4F7UF 1ADJA 4JRIA 4J5YA 2RD1A 4JRKA 5GAOn 4HT8A 2PMEA 3DSQA 3HFNA 4X9CA 5ELOA 4WI1A 1HTTA 4M7DB 4WJ4A 1BBUA 4M75G 1B8AA 5LJ3f 2I4NA 4M7DA 4P3PA 2ZR2A 3A5ZA 4M7AB 3UGTA 2QHTA 4M75F 2XTIA 3QO8A 3HXUA 1I4K1 3JB9J 4XTUA 4CS3A 4YCUA 3V8KA 2ZT7A 4DQ2A 2I4LA 4M77E 2DQ3A 1B7YB 2QHVA 4F7UB 2PMFA 4CH3A 2ARUA 4RMFA 2C8MA 2QHSA 5C51B 3HY0A 3JB9F 1SETA 2QHUA 3FJPA 4TVAB 5LJ5d 1NJ1A 3HFVA 1VQZA 4H2SA 4YRLA 1LOJA 2RM4A 3LC0A 4X5OA 1G5HA 2ZTGA 5GMKh 2AMCA 3RACA 2DU7A 4YRQA 4H2UA 2Q5HA 4H2WA 4C8QF 5GAMf 4M77F 3SWNC 2Q7HA 4YRRA 3QUIA 4E51A 3JCMc 2ODRD 2CJBA 3A7AA 1N9SA 3JCMX 1HC7A 4M77G 1NJ2A 4JUVA 1NYRA 3VU3C 3HXVA 3QO7A 4YRFA 4M75E 2HNIA 5GAN5 4PJOA 2I4MA 5K1XA 4H02A 5GAOq 5GANe 1E1OA 4M77A 3HY1A 3L4GA 2DTOA 4PJOD 4P75C 3RKYA 4C92G 2IY5A 1ASZA 2E1HA 5GAMe 4YRPA 4C92E 4EMKA 4PJOC 4N0AC 3HSBA 4J6WA 4C92A 1EVLA 2DEQA 4YP0A 3QNEA 3JCMQ 5LJ3d 3VQYA 4YRSA 4M78G 3A31A 4PHCA 4NL2A 1JJCA 4M78F 2ZT5A 5GMKi 4M7DE 1EIYB 1GGMA 2ZNIA 4CS2A 1H641 5K1PA 2P0LA 3JCMe 5GAOp 3PZCA 3TEHB 3M4QA 3BW1A 5GANf 2E65A 1KOGA 2QTXA 3JB9I 4EMKC 1E1TA 4C8QC 1QE0A 4XEOA 1W66A 2Q5IA 1B7YA 1WPYA 1WU7A 2EWNA 1Z7NA 2RHSB 4G85A 3IALA 1G51A 3A74A 3QSUA 4HA8A 3RUXA 4NL3A 4TQFA 12ASA 3NEMA 4HWRA 1B76A 3VQVA 4YRGA 5GMKm 1N9RA 4EO4A 1H4SA 3JCMP 1USYC 4PG3A 1WYDA 4P74C 1LYLA 2FYKA 4HWOA 4UP7A 3OD1A 4XTVA 5GANg 3PCOA 3V7CA 1X2GA 4LNSA 5GMKj 3A32A 4M78B 2Q7EA 1C0AA 4QVDA 4YCWA 4RQEA 2P5IA 3HRKA 4UP8A 1B34B 4K86A 3W3SA 4M77C 2G4CA 3HXZA 1IL2A 3VQWA 4X9DA 1B34A 2EAYA 2DQ0A 2K57A 3RL6A 3KFUA 3QTCA 3UFGA 5GAOl 3E9HA 1RIQA 3MF1A 4G84A 5GANd 3IKMB 2E41A 1NJ5A 4QVCA 1X54A 4OP0A 1PYSA 1ASYA 4YCVA 4EMKB 4M7DC 3JCMb 3CMQA 3WQZA 4F7UG 4M7AE 1BIBA 3AHUA 4KQEA 3BDUA 4C8QB 3HFZB 4TVWA 2ZT8A 3IG2A 3TEHA 4M7AC 1ADYA 5KNNA 1X55A 4KR2A 2ZCEA 3HXXA 4P3NA 1EIYA 5GANj 4EMGA 4P74A 4V2SA 2ARTA 2YLBA 4XTZA 3HXWA 2EJFA 4P72C 2CIMA 2CJ9A 3MEYA 1YFTA 1ATIA 3LSQA 4PJOE 2DXUA 4J6YA 4YROA 5LJ5j 3EFSA 3LSSA 3P8YA 1NNHA 2RHQB 1M8VA 4YRTA 3JB9G 5GAMh 1Z7MA 3QO3A 2ALYA 3BJUA 2DZCA 4M7AA 1D3BB 1WQ7A 1QF6A 2VC8A 4P73C 4KR3A 4M7DD 4WJ3M 1YFSA 3HFOA 3MF2A 2AKWB 4YYEA 4XU1A 4CH5A 4M75A 3JCMV 4HT9A 2DXTA 4NOYA 4M7DG 3E9IA 4XTYA 4P71C 4C8QG 3L4GB 3I7FA 2ARSA 5E3IA 2J3LA 5F5WA 4UPAA 5LJ3g 4CH4A 4K88A 5GAOr 3JCMh 4RDXA 4CS4A 4A54A 3VQXA 5LJ5e 5HGQA 3L2ZA 3A7RA 5DY9A 3RESA 5GAN4 1H4TA 4P71A 3V7RA 3JCMd 1U1TA 1M5Q1 4PJOB 4TWAA 3NENA 4C8QD 3UH0A 4Y91A 5GMKe 2EJ9A 1Y96B 4Q6GA 4CH6A 3SB2A 3V8LA 3M4PA 1KQ2A 2J3MA 1YB3A 4M7AF 2DU5A 2ZT6A 5LJ3e 2DKGA 4XTWA 1H4VB 4XEMA 2E64A 3REXA 1I81A 4M75C 4XU0A 5GAMd 4C92C 4ZTUB 4Q15A 4M7AD 2ZXFA 3JCMg 1JRIA 1EVKA 1BIAA 2YLCA 4J15A 4XTXA 1J5WA 2Q7GA 3ICAA 3TUPA 4TTVA 4YRKA 2I4OA 4BW9A 5LJ5f 1NYQA 2E10A 1SESA 5GAN7 4H2TA 4YRMA 3BY7A 4HWTA 1EFWA 4JLIA 1WQWA 3FIFA 3L1AA 1EQRA 2VXFA 4BWAA 1JJCB 1N9WA 3BFMA 4WF2A 1TH7A 4EMHA 3FB9A 3IKLA 3R07A 4RCCA 2JN0A 4RCBA 4O2DA 1MGQA 3VBBA 4M78A 2CJAA 5GAN8 3JCMW 2RHSA 5I21A 4TVYA 1BBWA 2XGTA 4UP9A 4NCXA 4TVAA 2ZR3A 4N0AA 4HWSA 2ZZGA 1E22A 3QHSA 5GANh
chains in the Genus database with same CATH superfamily
2VUBA 2XG8D 1OOTA 3RF1A 4J6XA 4M77B 4BI8B 4YRIA 2CGHA 5IHKA 3G1ZA 4P75A 3OYCA 2AT1B 1M3AA 2YRCA 4X1VA 2ZINA 1X27A 2HQHA 3RKXA 5CQYA 2FPFA 4M7DF 2PU9B 1D1CA 1UGVA 1ZSZA 2CP3A 2QTVA 4D8KA 1Q7YC 2XHCA 4BUGA 3QWXX 4TVRA 1M90U 2DJZA 3JB9H 2DZ9A 4C92F 3M4GA 1BB9A 1PM3A 4L87A 3NHNA 4N4HA 2MWPA 2EYQA 1Q81U 4LVIA 4KGVB 2JW4A 3N5BB 2YHTA 4QQGA 3OSVA 1M2OA 1R0BG 2ZIOA 5KYYA 2RK2A 7AT1B 2L3QA 1BKBA 1UEBA 5GAOm 2K3XA 3OYEA 1NEGA 1IGUA 1VQ4T 2AMCB 1Q86C 2F69A 3OYYA 5IXBA 1X2HA 1WNLA 5LL6S 1MMNA 5FU7B 2PVDB 5CKBA 3MEUA 3CCSQ 4PJLA 2FRYA 1KC8R 2MYSA 5LJ3h 2ALYB 2M1HA 2ZZEA 2VXEA 5EG2A 2C0TA 2A36A 1YHQQ 1PWTA 1NJ8A 4LDUA 1UG1A 2JNGA 5FRNA 1RLQC 1X43A 4GY5A 2L0AA 3PCOB 4Z02A 4AMCA 5IN1A 2ED1A 5GAMg 2C7IA 1YJWT 2V1QA 4Z89A 3EH1A 1M3CA 3NETA 2ABLA 3PMIA 3HTZA 9ATCB 2KK4A 1TXQA 2LJ3A 2YRVA 3OYKA 2KAFA 3OS1A 3A1PA 3EG9B 4AFZC 4M75B 1B70B 4TQDA 1VYTA 1WHLA 2LX9A 3FEOA 3CD6T 2E3CA 4J9FA 5I11A 2DPPB 4YPFA 3OS5A 2ZNJA 3CCQA 2EYYA 2I2LA 2W10A 2GBQA 2I0NA 3CPWP 2COWA 2KDSA 2MK5A 4F7UF 1G5VA 2PUOB 4JJCA 4JRIA 1YJ9A 2VKNA 4J5YA 5GAOn 3DSQA 2OI3A 3VRZA 4OB3B 3HRSA 4D6WA 4LUDA 3CCQQ 3CD6Q 2CP0A 1B8AA 3MEVA 2XDBA 4M7AB 2XU8A 2V8KA 3UGTA 2QHTA 4LVJA 1M1KU 4RG2A 4E7LA 3EGUA 1TG0A 1YITQ 5IT9E 1TUCA 2JMCA 2HKNA 2AHJB 4DQ2A 1WXBA 3OW2P 2PMFA 4CH3A 2CH4W 4BI4A 2KT8A 2QEXQ 2EQIA 1BCOA 4ZNXA 3VUZA 1SETA 2RHIA 3FJPA 5C0MA 1XTDA 3UATA 3FLGA 4ZGJB 3QG1A 1G5HA 2OAWA 1YJNA 5GMKh 2AMCA 3H8ZA 1R0CB 1UGRB 3OB9A 3OYJA 2HL5C 3QJYA 2LCCA 3EGDA 1RAHB 2Q7HA 4YRRA 4E51A 5GJVB 2ODRD 3A7AA 1N9SA 3JCMX 4KBMB 1NLPC 1SPKA 2EQUA 2X4JA 4H02A 1A0NB 4XK8E 1E1OA 3CCRT 1GCQC 2LZ6B 4P75C 4R55A 1OX9A 4C92G 1ASZA 1VIFA 4EMKA 4FYWB 4PJOC 3HSBA 4J6WA 4C92A 4IIOA 2X3XD 2AZSA 1AWXA 1GBRA 1I07A 1WHJA 4YP0A 3QNEA 3VQYA 2DJQA 1MUZA 2FEIA 2RHUA 1K9MR 5KYUA 4JJNK 1W4SA 1EIYB 1H641 5HKCA 1SKUB 2MCNA 1OV3A 1QVFP 3PZCA 2K3YA 3M4QA 2DYBA 3CCUQ 3VS6A 3BW1A 2FZCB 2R57A 4IUPA 5CIUA 2EYWA 3G71Q 4ELYC 1E1TA 1CKBA 3OA6A 1W2BA 2D0NA 1RI9A 1M30A 4FW1A 1WPYA 1IREB 3KFVA 1Z7NA 2L5QA 1G51A 3A74A 1PSFA 4C5IA 4QQ6A 3QSUA 3VQVA 1B76A 2CZ0B 1H4SA 1USYC 5CVIA 3I9QA 4PG3A 2CZ1B 3NMZC 3VS0A 2PZ1A 3F70A 1X75C 4MZTA 3I5SA 3HRUA 3PCOA 1X2GA 5CR2A 2OJ2A 5GMKj 3MP8A 1NJIC 2BE9B 3QZ5B 1V76A 3ZBDA 4J9DA 3EG3A 1B34B 4FT4A 3OYBA 3CMAA 4J9BA 1ZBXA 2DXBA 5I2MA 3CC4T 3UFGA 3E9HA 1X54A 3FC3A 1K0SA 4F7UG 1ZLMA 5ECAA 1OPKA 2PUKB 1KK7A 3HFZB 1X2QA 3TEHA 1ADYA 1JU5C 2RQWA 5KNNA 2EGCA 4KR2A 2ZCEA 1ABOA 4DOVA 3HXXA 4P3NA 4CC4B 1VQ6A 1RAAB 1NM7A 4KRTA 4OB1B 1AWOA 2EKOA 1ZSGA 4V2SA 1Z9QA 2CREA 1VQKQ 2YLBA 4XTZA 1RI0A 4RTWA 3CCEA 2EJFA 2EKHA 1BCMA 2CSQA 2QGGA 1NBEB 1ATIA 2NLUA 1FX7A 4DBHA 2EVRA 2A0FB 3TREA 1SF9A 1ZUYA 1KG1A 2RHQB 2VYTA 4ZGEB 1WI7A 1M90R 1TUGB 1LVKA 3QO3A 4F04B 5I22A 4A4KA 3BJUA 2DZCA 2JUFA 1KC8C 1QF6A 1ACMB 3RMQA 1BI3A 4KR3A 1T0HA 4WJ3M 3MF2A 1M2VA 2L2PA 5KE3A 1PKTA 4M7DG 3CCUA 1QVFS 3J81E 3PVQA 5CCAA 3C95A 3LGFA 1VQ4Q 4CS4A 5J3BA 5HGQA 1JXOA 1H4TA 4RUGA 1U1TA 3ZFJA 2X9HA 2O9VA 2DYIA 3HTRA 1QKWA 4ORZA 4PFOA 4C8QD 1MV3A 3CXCP 5KYUB 1OI1A 3V8LA 1VQMT 4LXCA 1KQ2A 3M4PA 1U5SA 3G1JA 1VQ4A 4JRPA 4M7AF 2HMAA 3I55Q 3PT9A 1ZUUA 1KC8U 2P4TA 5CKDA 5FLXE 2GGRA 1I0CA 2KMTA 4PFZA 3VS3A 4XU0A 5L8RE 1N27A 2HDAA 4E7IA 1PG5B 4C92C 4ZTUB 4M7AD 3G6EA 5KYYB 1TS9A 1UTIA 2K6DA 2Q7GA 1MMGA 2CP2A 4TTVA 4E2FB 4YRKA 4JJDA 3EHRA 2I4OA 2E6ZA 4BW9A 5IHNA 4JZ4A 1VQ8T 3MKDA 1Y7XA 4C0ZA 4YRMA 2O4XA 2LCSA 3G6EQ 1GRIA 2KEAA 2X3WD 2NUPB 2VXFA 1JJCB 2XMFA 2DERA 2VB6A 3LX7A 1MGQA 1FWZA 2CJAA 3OYGA 3G4SA 4LDYA 2RHSA 3CMAT 1UDLA 1BBWA 2AZVA 3QZ9B 5D6WA 2LX7A 1VQ6Q 1VQLT 2L3PA 1Q7YU 3LLRA 4HWSA 3QHSA 2PVOB 3UWNA 3CCEQ 2VASA 4Q5WA 1YBYA 5HY6A 3AT1B 5GAN3 1D0ZA 4M4ZA 1YWOA 3EFRA 1K9MC 1MNEA 4EIKA 2QEXA 3OSSC 1FYFA 1NJIU 4YREA 2KYMA 1G2BA 1Q7YR 2LVMA 1PRMC 1QP3A 2RB6A 2IY5B 2LQKA 1AVZC 3QO5A 4C0DC 1M1FA 1OZ2A 2FG0A 3SWNB 3MQZA 3UGQA 1O9SA 3MO8A 2ESWA 2BTTA 4PJNA 4J83A 1KQ1A 4JS5A 1MMAA 3M0RA 2CUDA 1NJ6A 2DLPA 2E3IA 1YITT 3CC4Q 2LQNA 2K5IA 2DFUA 2COYA 3E1SA 4OGEA 4AG2C 2CKKA 2OAUA 3DLMA 1WYXA 1HK9A 3LH5A 3RKWA 2GCXA 1U1SA 3G7ZA 2JT4A 4J9HA 4AH6A 4HVCA 3V7SA 2NS6A 4HCKA 4ATOA 1BK2A 3I35A 3HPWA 4MMKA 3BDLA 3PGGA 1KIKA 4HVVA 3DLLA 4MDXA 3PNWC 2BUDA 1U06A 1VQLA 4J7IA 2RHZA 3RGLA 2D1XA 1VQNT 1M1KC 5C52B 4PK4A 4ZTJA 4ELZC 1G3WA 2K4YA 2RJFA 4DBRA 3M59A 2OTLA 1F1BB 3WXMB 2QDLA 3HXYA 3V8JA 4YRCA 1P92A 1H92A 5IH2A 3A8OB 2DTIA 3RDVA 2E5AA 4RQFA 4YDQA 2DILA 2QXFA 3I56A 3CBOA 3ZEHA 3I5RA 1D3BA 4KT0E 2A8EA 1ZUKA 2OTLQ 1QVPA 3C0CA 4BDYA 5GAMj 4M78D 5CKEA 4AT1B 1JBMA 2AKWA 4MZPA 3VS2A 2C0OA 4CC2A 3CMEQ 2VGNA 1SRYA 4M7AG 1B70A 2FHDA 2RK1A 4J9IA 4HWPA 4YRNA 2RI3A 1WX6A 4M78E 4PJOG 1YN8A 1Q81C 4J9EA 1E24A 1HXDA 2DK3A 8AT1B 1SERA 5KYNA 2EJGA 2C06A 5A0LA 1M9SA 1N5ZA 2KRSA 3OMGA 1ADJA 1UUEA 3CMAQ 2RD1A 4JRKA 1PCXA 3EG1A 5ELOA 2K3BA 3ASKA 4M7DB 2GF7A 5CKFA 1BBZA 4E7HA 1YJWA 2I4NA 1OX8A 4P3PA 3A5ZA 1Q95G 2KVQG 1WHMA 1UECA 2XTIA 2YUOA 3VRYA 2LC4A 1I4K1 1GXIE 3CPWS 4HT4A 3GPLA 2K79A 4M77E 1AOJA 2SRCA 1MNDA 2C8MA 1W1FA 1NLOC 1JO8A 3X25B 2QHUA 1PKSA 3QIIA 5LJ5d 1VQZA 4FIBA 1GL5A 1QKXA 4X5OA 2RM4A 2D9TA 1UB4A 2H3JA 2D8HA 4H2UA 2Q5HA 3NGPA 1KFZA 2ZPGB 5GAMf 1YIJT 1PHTA 4C0FA 2M9UA 4RTVA 3CCLT 1S72A 2LQWA 2XD0A 3QO7A 1RLPC 2EGEA 4YRFA 2EYXA 2DF6A 4M75E 2HNIA 5GAN5 5K1XA 2J6OA 5FW9A 1LPLA 2QI2A 1VQ7T 1VQNA 2EQJA 2QAZA 2QDYB 3HY1A 1TU0B 2L8DA 1PNJA 2D8JA 4B6MA 3UA6A 2MPXC 1KD1C 1AWJA 2E1HA 1G3TA 3HL8A 3REBB 1RAIB 1EX4A 2CZ6B 4N0AC 3M54A 2RO0A 2DEQA 3M53A 3REAB 3JCMQ 1M8MA 1VQNQ 3A31A 2LCLA 2O88A 2JM8A 4L59A 2LDMA 5CQXA 4NL2A 5KYWA 1SHFA 2Y4YA 2ZT5A 3TEEA 2KYBA 1G83A 4FSSA 3QYHB 5K1PA 1M1GA 2P0LA 1JXMA 3H9NA 2ZPFB 2J6KA 1YITA 1Q86R 5GANf 3JB9I 4EMKC 3VS7A 5CKHA 1QLYA 1V1CA 3CC2Q 4C8QC 3CCRA 2BZ8A 1J3TA 2QK0A 1WU7A 3E9GA 4PL6A 1S72T 4HA8A 3CBPA 3RUXA 2V8IA 3KUFA 4IKFA 4AFUC 5FWBA 1EZZB 1K8AC 1H8KA 1LYLA 1CKAA 2E5QA 2FYKA 4HWOA 2VGMA 1VA7A 1YJWQ 3C94A 3A8HB 4JLGA 3OY9A 3PTAA 3E2UA 3V7CA 5A2QE 5IXFA 2DX1A 3LGLA 4M78B 1EFNA 1OZ3A 2AKKA 2DXCA 3QKJA 2LT4A 4RQEA 3NTKA 2DMOA 3ME9A 2YDLA 4UP8A 3C12A 3FJ5A 3W3SA 4M77C 2G4CA 4RTTA 2RJDA 2JMAA 4X9DA 1B34A 3VQWA 4E7JA 1SHGA 1G8XA 3KFUA 2BZYA 4BD3A 4HCZA 3CCST 1RIQA 2HCKA 4G84A 5GANd 1NJ5A 1ASYA 1GCPA 2FPDA 3OYHA 3CMQA 3A5ZB 3WQZA 4M7AE 2HD0A 1BIBA 3MEAA 4EDUA 2O2OA 2KBTA 2QQSA 2ZAEA 1NEBA 4M7AC 2MIOA 1X55A 3UA7A 3JRZA 1JQQA 5A0DA 1QCFA 4EMGA 2ZPHB 4QKUA 3HXWA 3G4ST 3ULRB 4BY6C 1YIJA 2CJ9A 1VQLQ 3LSQA 4PJOE 5M9OA 2DXUA 2LT1A 5KYXB 2DNUA 5LJ5j 2J06A 1NNHA 1IXDA 4A4EA 1C0MA 1D0YA 4BE0A 4YRTA 2VWFA 5GAMh 3J80E 4HCCA 4MZMA 1FMVA 4FYVB 1X2KA 1VQ9A 4Z88A 2E70A 4O6JA 3VYHB 1UE9A 2AIRB 1YFSA 4YYEA 1UJYA 5DLOA 4M75A 1TUDA 3E9IA 4XTYA 1DJ7B 2V26A 3I7FA 5F5WA 1U3OA 2J3LA 4UPAA 2MMPA 2JTEA 1GFCA 3EFOB 3JCMh 2CUBA 3VQXA 1RAEB 3CCRQ 4J9GA 2RQUA 4N4GA 3VKIA 3V7RA 1M5Q1 4N4IA 3M5AA 1MV0B 1Y96B 3CEYA 2M0OA 3SB2A 3OW2A 2J3MA 3P8DA 3X26B 1M27C 1OQKA 2DKGA 2RHYA 3S3MA 4XTWA 3A8LB 1H4VB 2CP6A 4XEMA 2E64A 1I81A 4M75C 4KH0B 3H0IA 1VQ5Q 2E6NA 4RG8A 1RABB 3CCMT 1W2BS 2HAXA 1TOVA 3E19A 3CCLA 3EAEA 4Q15A 2XI9A 4LD9K 2EYZA 1JRIA 4IUUA 1I1JA 3ICAA 3NTIA 1VQMA 3VS1A 2M51A 1SRLA 3LYIA 5LJ5f 1NYFA 2E10A 4GBQA 4PLIA 2JOYA 1YHQT 3ZL7C 1IZ6A 3BY7A 4KGXB 4EPCA 1OU8A 4ZN3A 4HWTA 1GCQA 4WTOB 2O31A 4C0GA 1BYMA 4EMHA 4J9CA 1YI2A 3UT1A 3OYNA 4M78A 1PRLC 2QA4T 1UFFA 2JXBA 3C4SA 1PC0A 1T3LA 2IG0A 2KY9A 4P5NA 2OTLT 2P0KA 4NCXA 4Y28E 5EC7A 3L2RA 1VQ6T 2DL8A 1RUWA 2EGAA 2X4XA 1S72Q 1ABQA 1JJ2A 1WJSA 3MCAB 5FU7C 3PE0A 5CAIA 3RBBB 2E4HA 4MMLA 4XQ3A 1NYGA 1KHIA 1ZHIA 2V1RA 4C92B 4FYYB 1YCYA 4X34A 4PJOF 3G71T 2M16A 2RA2A 1AZEA 3CC4A 1K0XA 3SDZA 2C0IA 4ZTZB 3HRIA 1VYVA 3S3OA 2DVJA 3A7UA 4E7ZA 3EGXB 2RJEA 2JZ2A 2A28A 2DE0X 3J7AF 2F2VA 4M77D 1BU1A 3OYDA 1I8FA 2DBMA 2B8AA 3TSZA 2D6FA 5CO7A 1VOMA 2COZA 3MHXA 2ROTA 3RERA 4ZGDB 2CDTA 4A4HA 1D1AA 3BE3A 2FVUA 3JCMJ 4AG1C 2QEXT 1WJRA 2FZGB 1WHGA 3INZA 3M9QA 4C8QA 2NYSA 3RIRA 4PJMA 1NJIR 5LJ3j 1D1BA 2P84A 2DVEA 1YJNT 4PNOA 5FWCA 4Y92A 3G4SQ 3M0PA 2JVVA 2LJ1A 4H2VA 3GNGA 4YRJA 2HSPA 2HSEB 3QPHA 4RTXA 3PVLA 2MOXA 4ZIBA 1USYA 1M1KR 1WXUA 3CMEA 3OYFA 1KMMA 5DM7R 1KQSS 2F5KA 1K8AR 2BE7D 1TTHB 1Y96A 1XNIA 2CT3A 5KE2A 2KROA 1IHWA 4A4FA 3OYIA 1VQ9T 4P73A 3WVDB 1KMNA 3M57A 1U8RA 4FU6A 1H4QA 11ASA 3MJXA 4OB0B 3QBYA 2E12A 3MP6A 4OLFA 4F7UE 2YWWA 5GAN2 4LVKA 4R56A 5GMKl 4C5GA 1X6OA 4H2YA 1WA7A 1PYSB 2DDZA 5LJ5h 2LNVA 2YUNA 1G5IA 2KE9A 2XDPA 3M56A 3TVTA 2MWOA 1NE8A 3VV0A 4K11A 5J26A 4AFSC 3M4YA 2A37A 3HFNA 1YWPA 3CPWA 2RJCA 4WI1A 1OPLA 1BBUA 4M75G 1QW1A 3CCVQ 4M7DA 2ZR2A 3OS0A 2XDDA 4QQDA 1E6GA 3PFSA 4M75F 3QO8A 3HXUA 2JTFA 2W0ZA 4BE1A 1K9AA 4XTUA 4CS3A 3E9FA 4YCUA 3V8KA 2ZT7A 2EPDA 2QHVA 2DIGA 3CCVA 2NUPA 4OMNA 2ECZA 2ARUA 4RMFA 2QHSA 3OBYA 2M02A 1D09B 3UF4A 3R6NA 2KI7A 4JDSA 2DO3A 3EH2A 4YRLA 4BB7A 1LOJA 2OX7A 3QYGB 2ZTGA 1PD1A 5IHIA 3SEMA 3I56Q 4YRQA 1WHKA 4C8QF 4M77F 2IIMA 3SWNC 2VVKA 4DA4A 3OYLA 2CJBA 1HC7A 2DAQA 4M77G 3Q1JA 2XIDA 1NYRA 3VU3C 3HXVA 3WVEB 2LMJA 5A0GA 3L2QA 4FW2A 4PJOA 2I4MA 4JJBA 5GANe 2H8HA 1KD1R 1K73R 4M77A 5D6YA 3L4GA 2DTOA 4PJOD 5AYFA 2IY5A 2EW3A 2QG9B 4YRPA 4L5GA 4C92E 2IVWA 2MI6A 1EVLA 3X28B 4M78G 3L2VA 2BZXA 2FRWA 4PHCA 1YFNA 1KD1U 3H0HA 4GLMA 2GTOA 1JJCA 2LP5A 2EIFA 4M78F 2FO0A 4M7DE 5IAYA 2ATCB 1ZA1B 3D7SB 2CYZB 2D0QB 5I2SA 4C5EA 4J8OA 5GAOp 3TEHB 3OS2A 1Q82C 1SEMA 2QTXA 2HQEA 1VQ5A 1KQSA 3CXCS 4FYXB 1QE0A 2ROLA 3CCLQ 1W66A 3QXEB 8ATCB 1B7YA 1K73C 2YSQA 1RADB 1PD0A 3LW5E 3IALA 1K4US 2WSFE 4E7SA 4NL3A 3KBGA 12ASA 3NEMA 2KNBB 4YRGA 5GMKm 1N9RA 4EO4A 3JCMP 2L89A 4BE2A 1V29B 2JS2A 2QYZA 4KGZB 4XTVA 2OTJA 5GANg 2X51A 2DEUA 4YTLA 4LNSA 1OULA 4BACA 3EFOA 2BIVA 4YCWA 2P5IA 1WDXA 2ZPEB 4OMPA 3CCVT 1KQSP 1UHFA 3VS5A 2MF2A 3IQLA 2LNHB 3HXZA 1IL2A 1K9MU 3GP8A 2EQKA 5KCOA 5J39A 1HJDA 3ER0A 2RQVA 3MF1A 3IKMB 4QVCA 4KH1B 2YUPA 1RL2A 1PYSA 1NG2A 1WZOA 3RR6A 4M7DC 2K5FA 1C1AA 2LTOA 3TCJA 3AHUA 4KQEA 3LWHA 2EQMA 3PMTA 4CC7A 1VYUA 4TVWA 1VIEA 1WIEA 3A98A 2DM1A 2XK0A 2EBPA 2ZZDA 2EFIA 3META 1VQ7A 3SHWA 4PFPA 1IO6A 2RMOA 5GANj 2JS0A 2ARTA 4NS5A 4RMOA 2DRMA 4LUEA 2CIMA 1YFTA 1UGPB 2NUZA 2DL5A 4ZN1A 1W70A 3QDFA 2WSCE 2A08A 2ZCFB 2ZPIB 3OMCA 4LE9A 3PIPA 2J7IA 3GBQA 5HK3A 1Z7MA 2AK5A 4M7AA 1D3BB 4P73C 2QGFB 2QQBA 4M7DD 2CS7A 2AKWB 4DBFA 4XU1A 4HT9A 2DXTA 3QDRB 4NOYA 4BI3A 3CMET 4P71C 4C8QG 5CK9A 3L4GB 4LVLA 1IB8A 1QVGS 1KSWA 2RH2A 5LJ3g 4CH4A 1BI0A 3OW2S 5GAOr 3LH0A 5LJ5e 3L2ZA 4HCBA 3A7RA 4P71A 3MPUB 1YJNQ 4PJOB 4TWAA 1QCOA 3NENA 2LQ8A 1QVFA 3A8MB 1VQKT 3UH0A 5GMKe 2M0YA 2AKLA 4J7FA 1YCSB 3KXTA 2JM9A 2GTJA 1YB3A 4LVMA 2DU5A 2DD4A 2ZT6A 3NTHA 5LJ3e 4IUTA 2RHXA 2PQWA 2P0QA 3REXA 3M0TA 2K9GA 3CXCA 1R8OB 2LJ0A 4DBQA 3EHQA 1K1ZA 1KJWA 1EVKA 1BIAA 4GLKA 4XTXA 3OBWA 1JJ2P 1YI2Q 2A3LA 4C0DB 4HXJA 4RTYA 4OF1A 1EIFA 1YIJQ 4ZTFA 1NYQA 3MP1A 1SESA 1I5OB 3S6WA 1UGSB 4JLIA 1XQHA 2P0PA 3CC7A 3L1AA 1AD5A 3FIFA 4A63B 1EQRA 2GQIA 1ZBJA 4BWAA 1X69A 4WF2A 1TH7A 2A7YA 3FB9A 2E5KA 2CZ7B 4RCCA 1VQ9Q 4O2DA 4RCBA 3CCUT 1QP2A 2L3SA 1Y57A 4OMLA 1Q82U 5GAN8 4JZ3A 1XOVA 2WACA 5I21A 4UP9A 4TVAA 2ZR3A 3CC7Q 4N0AA 1AWWA 2ZZGA 3EGDB 2R5MA 4DPGA 3EG2A 1YNZA 2DL7A 2K2MA 4F7UA 2JJ9A 1VQ5T 2O01E 3FDRA 4HKEA 1CSKA 1NPRA 1Q82R 5ELNA 3CPFA 4ANJA 2ZZFA 5D7UA 5KH6A 3TEGA 2ZGWA 4H2XB 3ERRA 3P8TA 2V8JA 4AFQC 1ZSZB 2XICA 1X56A 3NELA 4FL6A 4P72A 1WLPB 2O9SA 2PNIA 3GNFB 4EX5A 1B7TA 1AT1B 3FRNA 4OB2B 5C53B 4E6RA 2CH4A 2RPNA 1HYOA 2NUTB 1VQOQ 1VQPQ 4MDWA 2QQ9A 3S3NA 1GFDA 1I5LA 2ODRC 2G6FX 2FB7A 2CP5A 2GNCA 3TU4K 4P3OA 1WXTA 1ZX6A 4FCYA 1YGBA 4IURA 3H0FA 3M55A 2F2WA 1X01A 2OTJT 1YFRA 2FL7A 2O4XB 1WFWA 1D0XA 2EL9A 3GF5A 2KRNA 2FPEA 2HEQA 1L0WA 3X24B 2QQAA 3P8VA 1VQOA 3JB9D 3UDCA 4A53A 1QMCA 4C8QE 4QVZA 2RF0A 3M0UA 4RTZA 1VQPT 2DTHA 2R5AA 3H41A 3A5YA 4LN2A 2XKOC 5HK0A 1C6VX 2B86A 4PLLA 3OYAA 2HBPA 1SG5A 3U23A 1T0JA 5C6SA 4XU2A 1T3SA 3OQ5A 1NZ9A 1OEBA 3REUA 3L2WA 1VQ8Q 4OMOA 1QCNA 4FM4B 3NPFA 1HD3A 4C92D 1IHVA 4A4GA 2RHQA 1WGSA 3DB4A 1LJOA 3O8VA 5FU6C 4F14A 1FXXA 1VQ8A 2HQXA 2X4YA 3SWNA 3CCJQ 4M75D 1LNXA 1WJQA 3HP9A 2QQRA 3LWIA 5GAN6 1WLEA 2Y90A 4XU3A 2K7AA 4K87A 2KQWA 4M78C 5LJ5g 1EOVA 3GIBA 3CCJA 2KRMA 4OMQA 2J05A 4L6V5 3HFZA 3CCJT 3JCMf 2ZIMA 3SD4A 4H2XA 2Y4XA 4KUIA 4HT8A 2PMEA 1M3BA 4X9CA 1K8AU 1SSFA 3I55A 1HTTA 3I55T 1G3YA 4WJ4A 4JS4A 5LJ3f 1UHCA 3TSWA 2K5LA 2E3HA 2QASA 2P4RA 1QQJA 3DKMA 2DBKA 4HVUA 3JB9J 4FT2A 1AHJB 1GBQA 1B3QA 2R58A 1JJ2S 2I4LA 1RAGB 2DQ3A 4JPBW 1B7YB 4F7UB 4FSXA 4BY6B 3CD6A 5C51B 3HY0A 1SSHA 1E7OA 4CI0C 3JB9F 3HKSA 4TVAB 1Q81R 3HFVA 1G3SA 1NJ1A 1H3HA 4IUVA 3URGA 4H2SA 3LC0A 3PIOA 3RACA 3EG0A 4HVWA 1S1NA 2DU7A 1VQPA 2HZYA 4H2WA 3A8GB 3QUIA 2X35A 4D8DA 1UGQB 1IRXA 3JCMc 4R0KA 4DOWA 3CCMA 1NJ2A 4JUVA 1H3ZA 2ED0A 3P8BB 5GAOq 2RQTA 1RAFB 2PTKA 3VJPA 5DLQE 2DA9A 3RKYA 1LCKA 1XJWB 1Z9ZA 2YRDA 3SFMA 5GAMe 2NUTA 4E7KA 2YT6A 2FZKB 3I56T 3JV3A 1VQMQ 2BKDN 2SEMA 1OYXA 3RMSA 5LJ3d 4YRSA 1X6BA 3MEWA 1JB0E 1QWFA 2H3EB 3THKA 1AZGB 3CCQT 4PKCC 3VYGA 5L23A 5GMKi 3CCSA 1GGMA 2ZNIA 4LDXA 4CS2A 4OMMA 3X20B 3JCMe 2GFUA 4CRIA 1Y0MA 3QJ6A 2E65A 3GOXA 1KOGA 4KUDK 3H6ZA 3DB3A 4XEOA 2DIQA 1BI1A 2Q5IA 3O5ZA 4IUQA 2KXDA 1K73U 2EWNA 5KCHA 2WSEE 2RHSB 4G85A 4CC3A 1WHHA 2RQRA 4TQFA 2F5TX 4HWRA 5FU6B 6AT1B 4RTUA 4LDVA 1WYDA 1IGQA 3G71A 2F2XA 4P74C 2JTMA 4UC4A 1Y71A 4UP7A 1QVGP 3OD1A 1RACB 4Z8AA 1YHQA 3EGXA 1B07A 4OGCA 5FRMA 3A32A 5FROA 2Q7EA 1C0AA 2DL3A 2F1LA 4QVDA 4ME7A 2IPOB 4QW2A 3HRKA 1ZQ1A 4K86A 1K76A 1YJ9Q 4B9WA 2EAYA 2DQ0A 2K57A 3RL6A 3OYMA 3QTCA 2KGTA 1FMKA 1YI2T 5GAOl 1FMWA 2E41A 3L42A 2GFAA 2DETA 4OP0A 4F16A 1Q86U 4YCVA 4EMKB 3JCMb 3M0QA 3CC7T 3BDUA 1NPPA 4C8QB 2ZT8A 1ARKA 3IG2A 3NFCA 1E6HA 1PSEA 1YJ9T 5HCKA 1EIYA 4ESRA 4WCIA 4P74A 1FYNA 2PVGB 2HKQB 4O5VA 1Y07A 3M58A 1TSFA 4JRQA 4P72C 2KXCA 3MEYA 3R6OA 4J6YA 1JEGA 4LNPA 4YROA 3L2UA 3EFSA 3LSSA 4PJJA 1M90C 3P8YA 4OMFB 2DRKA 1KHCA 1M8VA 5GJWB 4LDWA 3CCMQ 4LD6A 3JB9G 1QVGA 2ENMA 3UPUA 1VQKA 2ALYA 1W6XA 1O75A 1WQ7A 2VC8A 1AEYA 2K2VA 1M2VB 1UJ0A 2OTJQ 3HHTB 3CC2T 3HFOA 4CH5A 3JCMV 2HL3A 4RKUE 2RN8A 3VUBA 2QA4A 4B9XA 5AT1B 2ARSA 5E3IA 1YP5A 4IIMA 4VUBA 3CCET 4K88A 2LRQA 4RDXA 1BI2A 4F17A 4A54A 4DEYA 1M4ZA 2X4WA 4QT7A 2VV5A 1N8RC 5DY9A 3RESA 4C5HA 5GAN4 3JCMd 4BDZA 2YUQA 3RNJA 2Z0WA 2QA4Q 4E47A 3EG9A 1MHNA 4Y91A 2EJ9A 2KR3A 4Q6GA 4CH6A 1W2BP 3JSCA 2J6FA 1HSQA 3G6ET 1SRMA 2CP7A 3TQ7P 2DD5A 3HRTA 3CBMA 1VQOT 1VQ7Q 2RI2A 5GAMd 1MMDA 2ZXFA 1ZSZC 3JCMg 3QWYA 3JAME 1VUBA 2YLCA 1N6AA 4J15A 5KYXA 3P8HA 1QWEA 1J5WA 3TUPA 3GLXA 1X6GA 1OU9A 2YXYA 2NWMA 2RNAA 4DEXA 2MAMA 5GAN7 3M0SA 4H2TA 2CT4A 1TWBA 1N8RR 1EFWA 4II1A 1WQWA 3CQTA 2RI5A 4OVAA 1ZA2B 2HBWA 3VS4A 5KYWB 2ZPBB 1N9WA 3BFMA 3IKLA 3R07A 3T9NA 2KSSA 2JN0A 2GQVA 4KULA 3VBBA 3JCMW 4XAXB 1R77A 2CSIA 2L3RA 4TVYA 2XGTA 2DL4A 1N8RU 3CC2A 2KT1A 5D6XA 2G3RA 1E22A 5GANh
chains in the Genus database with same CATH topology
2VUBA 2XG8D 3RF1A 4J6XA 4M77B 4BI8B 4YRIA 2CGHA 3G1ZA 4P75A 3OYCA 2ZINA 3RKXA 5CQYA 4M7DF 2PU9B 1Q7YC 2XHCA 4BUGA 4TVRA 1M90U 2DJZA 3JB9H 2DZ9A 4C92F 3M4GA 4L87A 4N4HA 2MWPA 2EYQA 1Q81U 4LVIA 3N5BB 2YHTA 3OSVA 4QQGA 2ZIOA 2RK2A 1BKBA 1UEBA 5GAOm 2K3XA 3OYEA 1VQ4T 2AMCB 1Q86C 2F69A 3OYYA 1X2HA 1WNLA 5LL6S 5FU7B 2PVDB 5CKBA 3MEUA 5LJ3h 2ALYB 2M1HA 2ZZEA 2VXEA 5EG2A 1NJ8A 4LDUA 2JNGA 5FRNA 4GY5A 3PCOB 4Z02A 5IN1A 5GAMg 2C7IA 1YJWT 3NETA 3PMIA 3HTZA 2KK4A 2YRVA 3OYKA 2KAFA 3OS1A 1B70B 4M75B 4TQDA 2LX9A 3FEOA 3CD6T 2E3CA 2DPPB 4YPFA 3OS5A 2ZNJA 3CCQA 2I2LA 2KDSA 4F7UF 1G5VA 2PUOB 4JRIA 1YJ9A 4J5YA 5GAOn 3DSQA 4OB3B 3HRSA 4D6WA 1B8AA 3MEVA 2XDBA 4M7AB 2XU8A 2V8KA 3UGTA 2QHTA 4LVJA 1M1KU 4RG2A 4E7LA 5IT9E 2AHJB 4DQ2A 2PMFA 4CH3A 4BI4A 3VUZA 1SETA 2RHIA 3FJPA 5C0MA 1XTDA 3FLGA 4ZGJB 3QG1A 1G5HA 1YJNA 5GMKh 2AMCA 3H8ZA 1UGRB 3OB9A 3OYJA 3QJYA 2LCCA 2Q7HA 4YRRA 4E51A 2ODRD 3A7AA 1N9SA 3JCMX 4KBMB 2EQUA 2X4JA 4H02A 4XK8E 1E1OA 3CCRT 4P75C 4R55A 4C92G 1ASZA 1VIFA 4EMKA 4PJOC 3HSBA 4J6WA 4C92A 4YP0A 3QNEA 3VQYA 2RHUA 4JJNK 1W4SA 1EIYB 1H641 5HKCA 3PZCA 2K3YA 3M4QA 3BW1A 2R57A 4IUPA 5CIUA 4ELYC 1E1TA 3OA6A 1W2BA 1WPYA 1IREB 1Z7NA 2L5QA 1G51A 3A74A 1PSFA 4C5IA 4QQ6A 3QSUA 3VQVA 1B76A 2CZ0B 1H4SA 1USYC 5CVIA 4PG3A 2CZ1B 3F70A 1X75C 4MZTA 3HRUA 3PCOA 1X2GA 5CR2A 5GMKj 3MP8A 1NJIC 3QZ5B 3ZBDA 1B34B 4FT4A 3OYBA 3CMAA 1ZBXA 2DXBA 5I2MA 3CC4T 3UFGA 3E9HA 1X54A 3FC3A 4F7UG 2PUKB 3HFZB 3TEHA 1ADYA 5KNNA 4KR2A 2ZCEA 4DOVA 3HXXA 4P3NA 1VQ6A 4OB1B 2EKOA 4V2SA 2YLBA 4XTZA 1RI0A 3CCEA 2EJFA 1ATIA 2NLUA 1FX7A 3TREA 1KG1A 2RHQB 2VYTA 4ZGEB 3QO3A 4A4KA 3BJUA 2DZCA 2JUFA 1KC8C 1QF6A 3RMQA 1BI3A 4KR3A 4WJ3M 3MF2A 5KE3A 4M7DG 3CCUA 1QVFS 3J81E 5CCAA 3C95A 3LGFA 4CS4A 5J3BA 5HGQA 1H4TA 1U1TA 3ZFJA 4C8QD 1VQMT 1OI1A 3V8LA 3M4PA 1KQ2A 1VQ4A 4JRPA 4M7AF 3PT9A 1KC8U 2P4TA 5CKDA 5FLXE 2KMTA 4XU0A 5L8RE 1N27A 4E7IA 4C92C 4ZTUB 4M7AD 3G6EA 2Q7GA 4TTVA 4YRKA 2I4OA 2E6ZA 4BW9A 1VQ8T 1Y7XA 4C0ZA 4YRMA 2O4XA 2VXFA 1JJCB 3LX7A 1MGQA 1FWZA 2CJAA 3OYGA 3G4SA 4LDYA 2RHSA 3CMAT 1BBWA 3QZ9B 5D6WA 1VQLT 1Q7YU 4HWSA 3LLRA 3QHSA 2PVOB 3UWNA 4Q5WA 1YBYA 5HY6A 5GAN3 3EFRA 1K9MC 2QEXA 3OSSC 1FYFA 1NJIU 4YREA 2LVMA 1QP3A 2RB6A 2IY5B 2LQKA 3QO5A 4C0DC 1M1FA 1OZ2A 3SWNB 3MQZA 3UGQA 1O9SA 3MO8A 4J83A 1KQ1A 4JS5A 1NJ6A 1YITT 2K5IA 3E1SA 4OGEA 2CKKA 2OAUA 3DLMA 1HK9A 3RKWA 2GCXA 1U1SA 3G7ZA 4AH6A 4HVCA 3V7SA 2NS6A 4ATOA 3HPWA 4MMKA 3BDLA 3PGGA 3DLLA 4MDXA 3PNWC 2BUDA 1VQLA 4J7IA 2RHZA 3RGLA 1VQNT 1M1KC 5C52B 4ZTJA 4ELZC 1G3WA 2K4YA 2RJFA 3M59A 2OTLA 3WXMB 3HXYA 3V8JA 4YRCA 1P92A 3A8OB 2DTIA 4RQFA 2E5AA 4YDQA 2QXFA 3I56A 3CBOA 3ZEHA 1D3BA 4KT0E 2A8EA 1QVPA 4BDYA 5GAMj 4M78D 5CKEA 1JBMA 2AKWA 4MZPA 2VGNA 1SRYA 4M7AG 1B70A 2FHDA 2RK1A 4HWPA 4YRNA 2RI3A 4M78E 4PJOG 1Q81C 1E24A 1HXDA 2DK3A 1SERA 2EJGA 2C06A 5A0LA 1M9SA 3OMGA 1ADJA 2RD1A 4JRKA 5ELOA 3ASKA 4M7DB 2GF7A 5CKFA 4E7HA 1YJWA 2I4NA 4P3PA 3A5ZA 2KVQG 2XTIA 2LC4A 1I4K1 1GXIE 3CPWS 4HT4A 3GPLA 4M77E 2C8MA 3X25B 2QHUA 3QIIA 5LJ5d 1VQZA 4FIBA 4X5OA 2RM4A 2D9TA 1UB4A 2H3JA 4H2UA 2Q5HA 2ZPGB 5GAMf 1YIJT 4C0FA 2M9UA 3CCLT 1S72A 2XD0A 3QO7A 4YRFA 4M75E 2HNIA 5GAN5 5K1XA 1VQ7T 2QI2A 1VQNA 2EQJA 2QDYB 3HY1A 2L8DA 1KD1C 2E1HA 1G3TA 3HL8A 2CZ6B 4N0AC 3M54A 2RO0A 2DEQA 3M53A 3JCMQ 3A31A 2LCLA 4L59A 2LDMA 5CQXA 4NL2A 2Y4YA 2ZT5A 3TEEA 3QYHB 5K1PA 1M1GA 2P0LA 2ZPFB 1YITA 5GANf 3JB9I 4EMKC 5CKHA 4C8QC 3CCRA 1WU7A 3E9GA 4PL6A 1S72T 4HA8A 3CBPA 3RUXA 2V8IA 3KUFA 4IKFA 1K8AC 1LYLA 2E5QA 2FYKA 4HWOA 2VGMA 3C94A 3A8HB 4JLGA 3OY9A 3PTAA 3V7CA 5A2QE 3LGLA 4M78B 2DXCA 1OZ3A 3QKJA 2LT4A 4RQEA 3NTKA 3ME9A 4UP8A 3C12A 3W3SA 4M77C 2G4CA 2RJDA 3VQWA 4X9DA 1B34A 4E7JA 3KFUA 4BD3A 4HCZA 3CCST 1RIQA 4G84A 5GANd 1NJ5A 1ASYA 3OYHA 3CMQA 3A5ZB 3WQZA 4M7AE 2HD0A 1BIBA 3MEAA 4EDUA 2QQSA 4M7AC 1X55A 3JRZA 5A0DA 4EMGA 2ZPHB 3HXWA 3G4ST 4BY6C 1YIJA 2CJ9A 3LSQA 4PJOE 5M9OA 2LT1A 2DXUA 5LJ5j 1NNHA 4A4EA 4BE0A 4YRTA 5GAMh 3J80E 4HCCA 4MZMA 1VQ9A 2E70A 4O6JA 3VYHB 1YFSA 4YYEA 5DLOA 4M75A 3E9IA 4XTYA 1DJ7B 3I7FA 5F5WA 2J3LA 4UPAA 2MMPA 3JCMh 3VQXA 4N4GA 3VKIA 3V7RA 1M5Q1 4N4IA 3M5AA 1Y96B 3CEYA 2M0OA 3SB2A 3OW2A 2J3MA 3P8DA 3X26B 3S3MA 2DKGA 2RHYA 4XTWA 3A8LB 1H4VB 4XEMA 2E64A 1I81A 4M75C 2E6NA 4RG8A 3CCMT 1W2BS 2HAXA 3E19A 3CCLA 3EAEA 4Q15A 2XI9A 4LD9K 1JRIA 4IUUA 3ICAA 3NTIA 1VQMA 3LYIA 5LJ5f 2E10A 4PLIA 2JOYA 1YHQT 1IZ6A 3BY7A 4EPCA 4ZN3A 4HWTA 4C0GA 1BYMA 4EMHA 1YI2A 3UT1A 3OYNA 4M78A 2QA4T 3C4SA 2IG0A 4P5NA 2KY9A 2OTLT 2P0KA 4NCXA 4Y28E 3L2RA 1VQ6T 2X4XA 1JJ2A 1WJSA 3MCAB 5FU7C 5CAIA 4MMLA 4XQ3A 1KHIA 1ZHIA 4C92B 1YCYA 4X34A 4PJOF 3G71T 2M16A 2RA2A 3CC4A 3SDZA 4ZTZB 3HRIA 3S3OA 3A7UA 2RJEA 2JZ2A 3J7AF 4M77D 3OYDA 1I8FA 2B8AA 2D6FA 5CO7A 3MHXA 3RERA 4ZGDB 4A4HA 2FVUA 3JCMJ 2QEXT 1WJRA 3INZA 3M9QA 4C8QA 3RIRA 5LJ3j 2DVEA 1YJNT 4PNOA 2JVVA 4H2VA 3GNGA 4YRJA 3QPHA 4ZIBA 1USYA 3CMEA 3OYFA 1KMMA 5DM7R 1KQSS 2F5KA 1Y96A 1XNIA 5KE2A 4A4FA 3OYIA 1VQ9T 4P73A 3WVDB 1KMNA 3M57A 1U8RA 4FU6A 1H4QA 11ASA 4OB0B 3QBYA 2E12A 3MP6A 4OLFA 4F7UE 5GAN2 4LVKA 4R56A 5GMKl 4C5GA 1X6OA 4H2YA 1PYSB 2DDZA 5LJ5h 2LNVA 1G5IA 2XDPA 3M56A 2MWOA 1NE8A 3VV0A 5J26A 3M4YA 3HFNA 3CPWA 2RJCA 4WI1A 1BBUA 4M75G 1QW1A 4M7DA 2ZR2A 3OS0A 2XDDA 4QQDA 3PFSA 4M75F 3QO8A 3HXUA 2JTFA 4BE1A 4XTUA 4CS3A 3E9FA 4YCUA 3V8KA 2ZT7A 2QHVA 2DIGA 3CCVA 2ARUA 4RMFA 2QHSA 3OBYA 4JDSA 2DO3A 4YRLA 4BB7A 1LOJA 3QYGB 2ZTGA 4YRQA 4C8QF 4M77F 3SWNC 4DA4A 3OYLA 2CJBA 1HC7A 2DAQA 4M77G 3Q1JA 2XIDA 1NYRA 3VU3C 3HXVA 3WVEB 3L2QA 5A0GA 4PJOA 2I4MA 5GANe 4M77A 5D6YA 3L4GA 2DTOA 4PJOD 5AYFA 2IY5A 4YRPA 4L5GA 4C92E 2IVWA 2MI6A 1EVLA 3X28B 4M78G 3L2VA 4PHCA 1KD1U 1JJCA 2EIFA 4M78F 4M7DE 5IAYA 2CYZB 2D0QB 5I2SA 4C5EA 4J8OA 5GAOp 3TEHB 3OS2A 1Q82C 2QTXA 2HQEA 1VQ5A 1KQSA 3CXCS 1QE0A 1W66A 3QXEB 1B7YA 1K73C 3LW5E 3IALA 2WSFE 4NL3A 3KBGA 12ASA 3NEMA 4YRGA 5GMKm 1N9RA 4EO4A 3JCMP 2L89A 4BE2A 1V29B 4XTVA 2OTJA 5GANg 4YTLA 4LNSA 4BACA 2BIVA 4YCWA 2P5IA 3CCVT 2ZPEB 2MF2A 3HXZA 1IL2A 1K9MU 3GP8A 2EQKA 5KCOA 5J39A 3ER0A 3MF1A 3IKMB 4QVCA 1RL2A 1PYSA 4M7DC 2K5FA 2LTOA 3TCJA 3AHUA 4KQEA 3LWHA 2EQMA 3PMTA 4TVWA 1VIEA 2XK0A 2ZZDA 2EFIA 3META 1VQ7A 5GANj 2ARTA 4NS5A 4RMOA 2CIMA 1YFTA 1UGPB 4ZN1A 2WSCE 2ZCFB 2ZPIB 3OMCA 3PIPA 5HK3A 1Z7MA 4M7AA 1D3BB 4P73C 2QQBA 4M7DD 2CS7A 2AKWB 4XU1A 4HT9A 2DXTA 3QDRB 4NOYA 4BI3A 3CMET 4P71C 4C8QG 5CK9A 3L4GB 4LVLA 1QVGS 2RH2A 5LJ3g 4CH4A 1BI0A 3OW2S 5GAOr 3LH0A 5LJ5e 3L2ZA 4HCBA 3A7RA 4P71A 4PJOB 4TWAA 3NENA 2LQ8A 1QVFA 3A8MB 1VQKT 3UH0A 5GMKe 4J7FA 3KXTA 1YB3A 5GANh 4LVMA 2DU5A 2DD4A 2ZT6A 3NTHA 5LJ3e 4IUTA 2RHXA 2PQWA 2P0QA 3REXA 3CXCA 1R8OB 1EVKA 1BIAA 4GLKA 4XTXA 3OBWA 2A3LA 4C0DB 4OF1A 1EIFA 4ZTFA 1NYQA 3MP1A 1SESA 3S6WA 1UGSB 4JLIA 1XQHA 2P0PA 3CC7A 3FIFA 3L1AA 1EQRA 4BWAA 4WF2A 1TH7A 2A7YA 3FB9A 2CZ7B 4RCCA 4O2DA 4RCBA 3CCUT 1QP2A 1Q82U 5GAN8 1XOVA 4UP9A 2WACA 5I21A 4TVAA 2ZR3A 4N0AA 2ZZGA 2R5MA 4DPGA 4F7UA 1VQ5T 2O01E 3FDRA 4HKEA 1NPRA 5ELNA 3CPFA 2ZZFA 5KH6A 3TEGA 2ZGWA 4H2XB 3ERRA 3P8TA 2V8JA 2XICA 1X56A 3NELA 4FL6A 4P72A 3GNFB 4EX5A 3FRNA 4OB2B 5C53B 4MDWA 2QQ9A 3S3NA 1I5LA 2ODRC 2FB7A 3TU4K 4P3OA 1YGBA 3M55A 4IURA 2OTJT 1X01A 1YFRA 2FL7A 2O4XB 2EL9A 3GF5A 1L0WA 3X24B 2QQAA 3P8VA 1VQOA 3JB9D 3UDCA 4A53A 4C8QE 4QVZA 1VQPT 2DTHA 2R5AA 3A5YA 2XKOC 5HK0A 4PLLA 3OYAA 2HBPA 5C6SA 4XU2A 3OQ5A 1NZ9A 3REUA 3L2WA 4FM4B 4C92D 4A4GA 2RHQA 1WGSA 3DB4A 1LJOA 3O8VA 5FU6C 1FXXA 1VQ8A 2HQXA 2X4YA 3SWNA 4M75D 1LNXA 1WJQA 3HP9A 2QQRA 3LWIA 5GAN6 1WLEA 2Y90A 4XU3A 4K87A 2KQWA 4M78C 5LJ5g 1EOVA 3GIBA 3CCJA 4L6V5 3HFZA 3CCJT 3JCMf 2ZIMA 3SD4A 4H2XA 2Y4XA 4KUIA 4HT8A 2PMEA 4X9CA 1K8AU 1SSFA 3I55A 1HTTA 3I55T 1G3YA 4WJ4A 4JS4A 5LJ3f 2K5LA 3DKMA 3JB9J 4FT2A 1AHJB 2R58A 1JJ2S 2I4LA 2DQ3A 1B7YB 4F7UB 4FSXA 4BY6B 3CD6A 5C51B 3HY0A 4CI0C 3JB9F 3HKSA 4TVAB 3HFVA 1G3SA 1NJ1A 4IUVA 3URGA 4H2SA 3LC0A 3PIOA 3RACA 2DU7A 1VQPA 4H2WA 3A8GB 3QUIA 2X35A 1UGQB 3JCMc 4DOWA 3CCMA 1NJ2A 4JUVA 1H3ZA 3P8BB 5GAOq 3VJPA 5DLQE 3RKYA 3SFMA 5GAMe 4E7KA 3I56T 2BKDN 1OYXA 3RMSA 5LJ3d 4YRSA 3MEWA 1JB0E 3CCQT 4PKCC 3VYGA 5GMKi 3CCSA 1GGMA 2ZNIA 4LDXA 4CS2A 3X20B 3JCMe 2GFUA 4CRIA 3QJ6A 2E65A 3GOXA 1KOGA 4KUDK 3H6ZA 3DB3A 4XEOA 2DIQA 1BI1A 2Q5IA 4IUQA 1K73U 2EWNA 5KCHA 2WSEE 2RHSB 4G85A 4TQFA 2F5TX 4HWRA 5FU6B 4LDVA 1WYDA 3G71A 4P74C 2JTMA 4UC4A 1Y71A 4UP7A 3OD1A 1YHQA 4OGCA 5FRMA 5FROA 2Q7EA 1C0AA 4QVDA 4ME7A 4QW2A 3HRKA 1ZQ1A 4K86A 4B9WA 2EAYA 2DQ0A 2K57A 3RL6A 3OYMA 3QTCA 1YI2T 5GAOl 2E41A 3L42A 2GFAA 4OP0A 1Q86U 4YCVA 4EMKB 3JCMb 3CC7T 3BDUA 1NPPA 4C8QB 2ZT8A 3IG2A 3NFCA 1PSEA 1YJ9T 1EIYA 4P74A 2PVGB 4O5VA 1Y07A 3M58A 4JRQA 4P72C 3MEYA 3R6OA 4J6YA 4YROA 3L2UA 3EFSA 3LSSA 1M90C 3P8YA 4OMFB 1KHCA 1M8VA 4LDWA 4LD6A 3JB9G 1QVGA 3UPUA 2ALYA 1VQKA 1O75A 1WQ7A 2VC8A 2K2VA 3HHTB 3CC2T 3HFOA 4CH5A 3JCMV 4RKUE 3VUBA 2QA4A 4B9XA 2ARSA 5E3IA 4VUBA 3CCET 4K88A 2LRQA 4RDXA 1BI2A 4A54A 1M4ZA 2X4WA 2VV5A 1N8RC 5DY9A 3RESA 4C5HA 5GAN4 3JCMd 4BDZA 4E47A 1MHNA 4Y91A 2EJ9A 4Q6GA 4CH6A 3JSCA 3G6ET 2DD5A 3HRTA 3CBMA 1VQOT 2RI2A 5GAMd 2ZXFA 3JCMg 3JAME 1VUBA 2YLCA 1N6AA 4J15A 3P8HA 1J5WA 3TUPA 3GLXA 2MAMA 5GAN7 4H2TA 1EFWA 1WQWA 4II1A 2RI5A 4OVAA 2ZPBB 1N9WA 3BFMA 3IKLA 3R07A 3T9NA 2KSSA 2JN0A 2GQVA 4KULA 3VBBA 3JCMW 4XAXB 2L3RA 4TVYA 2XGTA 1N8RU 3CC2A 5D6XA 2G3RA 1E22A 3A32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RF1 A;  4DPG A;  4J6X A;  4M77 B;  4YRI A;  4F7U A;  2CGH A;  3G1Z A;  4P75 A;  5GAN 3;  3EFR A;  5ELN A;  5CAI A;  2ZIN A;  2ZZF A;  4MML A;  3TEG A;  4XQ3 A;  1FYF A;  2ZGW A;  4H2X B;  3ERR A;  3P8T A;  4YRE A;  4C92 B;  3RKX A;  1YCY A;  4PJO F;  2RA2 A;  4M7D F;  1X56 A;  3NEL A;  2RB6 A;  4P72 A;  2IY5 B;  4ZTZ B;  3HRI A;  3QO5 A;  4EX5 A;  3SWN B;  3A7U A;  3UGQ A;  5C53 B;  1KQ1 A;  2DJZ A;  3JB9 H;  2DZ9 A;  4C92 F;  4M77 D;  3M4G A;  1I8F A;  1NJ6 A;  4L87 A;  1I5L A;  2ODR C;  2FB7 A;  4P3O A;  1YGB A;  3RER A;  1X01 A;  2YHT A;  1YFR A;  2ZIO A;  2EL9 A;  3JCM J;  1L0W A;  1HK9 A;  3RKW A;  3P8V A;  3JB9 D;  1U1S A;  5GAO m;  4A53 A;  4AH6 A;  4HVC A;  3V7S A;  4C8Q E;  3INZ A;  4C8Q A;  3RIR A;  2DTH A;  2AMC B;  5LJ3 j;  3A5Y A;  4MMK A;  3PGG A;  2DVE A;  4PNO A;  1X2H A;  1WNL A;  4H2V A;  3RGL A;  4YRJ A;  5LJ3 h;  4XU2 A;  2ALY B;  2ZZE A;  2VXE A;  5C52 B;  3REU A;  1NJ8 A;  4ZIB A;  1USY A;  4C92 D;  1KMM A;  3HXY A;  3V8J A;  4YRC A;  2RHQ A;  1Y96 A;  3PCO B;  1LJO A;  2DTI A;  4RQF A;  2E5A A;  4YDQ A;  4P73 A;  5GAM g;  1KMN A;  3SWN A;  2C7I A;  4M75 D;  1D3B A;  1H4Q A;  1LNX A;  11AS A;  3NET A;  3HTZ A;  5GAM j;  4M78 D;  1JBM A;  5GAN 6;  1WLE A;  2AKW A;  4OLF A;  4XU3 A;  2Y90 A;  1B70 B;  4M75 B;  4TQD A;  4K87 A;  1SRY A;  4M78 C;  4F7U E;  5LJ5 g;  4M7A G;  1EOV A;  3GIB A;  1B70 A;  5GAN 2;  2E3C A;  4HWP A;  5GMK l;  4YPF A;  4YRN A;  4M78 E;  4H2Y A;  4PJO G;  2ZNJ A;  3HFZ A;  1PYS B;  2DDZ A;  2I2L A;  5LJ5 h;  1E24 A;  1HXD A;  1SER A;  2EJG A;  3JCM f;  2ZIM A;  1G5I A;  4H2X A;  4F7U F;  1ADJ A;  4JRI A;  4J5Y A;  2RD1 A;  4JRK A;  5GAO n;  4HT8 A;  2PME A;  3DSQ A;  3HFN A;  4X9C A;  5ELO A;  4WI1 A;  1HTT A;  4M7D B;  4WJ4 A;  1BBU A;  4M75 G;  1B8A A;  5LJ3 f;  2I4N A;  4M7D A;  4P3P A;  2ZR2 A;  3A5Z A;  4M7A B;  3UGT A;  2QHT A;  4M75 F;  2XTI A;  3QO8 A;  3HXU A;  1I4K 1;  3JB9 J;  4XTU A;  4CS3 A;  4YCU A;  3V8K A;  2ZT7 A;  4DQ2 A;  2I4L A;  4M77 E;  2DQ3 A;  1B7Y B;  2QHV A;  4F7U B;  2PMF A;  4CH3 A;  2ARU A;  4RMF A;  2C8M A;  2QHS A;  5C51 B;  3HY0 A;  3JB9 F;  1SET A;  2QHU A;  3FJP A;  4TVA B;  5LJ5 d;  1NJ1 A;  3HFV A;  1VQZ A;  4H2S A;  4YRL A;  1LOJ A;  2RM4 A;  3LC0 A;  4X5O A;  1G5H A;  2ZTG A;  5GMK h;  2AMC A;  3RAC A;  2DU7 A;  4YRQ A;  4H2U A;  2Q5H A;  4H2W A;  4C8Q F;  5GAM f;  4M77 F;  3SWN C;  2Q7H A;  4YRR A;  3QUI A;  4E51 A;  3JCM c;  2ODR D;  2CJB A;  3A7A A;  1N9S A;  3JCM X;  1HC7 A;  4M77 G;  1NJ2 A;  4JUV A;  1NYR A;  3VU3 C;  3HXV A;  3QO7 A;  4YRF A;  4M75 E;  2HNI A;  5GAN 5;  4PJO A;  2I4M A;  5K1X A;  4H02 A;  5GAO q;  5GAN e;  1E1O A;  4M77 A;  3HY1 A;  3L4G A;  2DTO A;  4PJO D;  4P75 C;  3RKY A;  4C92 G;  2IY5 A;  1ASZ A;  2E1H A;  5GAM e;  4YRP A;  4C92 E;  4EMK A;  4PJO C;  4N0A C;  3HSB A;  4J6W A;  4C92 A;  1EVL A;  2DEQ A;  4YP0 A;  3QNE A;  3JCM Q;  5LJ3 d;  3VQY A;  4YRS A;  4M78 G;  3A31 A;  4PHC A;  4NL2 A;  1JJC A;  4M78 F;  2ZT5 A;  5GMK i;  4M7D E;  1EIY B;  1GGM A;  2ZNI A;  4CS2 A;  1H64 1;  5K1P A;  2P0L A;  3JCM e;  5GAO p;  3PZC A;  3TEH B;  3M4Q A;  3BW1 A;  5GAN f;  2E65 A;  1KOG A;  2QTX A;  3JB9 I;  4EMK C;  1E1T A;  4C8Q C;  1QE0 A;  4XEO A;  1W66 A;  2Q5I A;  1B7Y A;  1WPY A;  1WU7 A;  2EWN A;  1Z7N A;  2RHS B;  4G85 A;  3IAL A;  1G51 A;  3A74 A;  3QSU A;  4HA8 A;  3RUX A;  4NL3 A;  4TQF A;  12AS A;  3NEM A;  4HWR A;  1B76 A;  3VQV A;  4YRG A;  5GMK m;  1N9R A;  4EO4 A;  1H4S A;  3JCM P;  1USY C;  4PG3 A;  1WYD A;  4P74 C;  1LYL A;  2FYK A;  4HWO A;  4UP7 A;  3OD1 A;  4XTV A;  5GAN g;  3PCO A;  3V7C A;  1X2G A;  4LNS A;  5GMK j;  3A32 A;  4M78 B;  2Q7E A;  1C0A A;  4QVD A;  4YCW A;  4RQE A;  2P5I A;  3HRK A;  4UP8 A;  1B34 B;  4K86 A;  3W3S A;  4M77 C;  2G4C A;  3HXZ A;  1IL2 A;  3VQW A;  4X9D A;  1B34 A;  2EAY A;  2DQ0 A;  2K57 A;  3RL6 A;  3KFU A;  3QTC A;  3UFG A;  5GAO l;  3E9H A;  1RIQ A;  3MF1 A;  4G84 A;  5GAN d;  3IKM B;  2E41 A;  1NJ5 A;  4QVC A;  1X54 A;  4OP0 A;  1PYS A;  1ASY A;  4YCV A;  4EMK B;  4M7D C;  3JCM b;  3CMQ A;  3WQZ A;  4F7U G;  4M7A E;  1BIB A;  3AHU A;  4KQE A;  3BDU A;  4C8Q B;  3HFZ B;  4TVW A;  2ZT8 A;  3IG2 A;  3TEH A;  4M7A C;  1ADY A;  5KNN A;  1X55 A;  4KR2 A;  2ZCE A;  3HXX A;  4P3N A;  1EIY A;  5GAN j;  4EMG A;  4P74 A;  4V2S A;  2ART A;  2YLB A;  4XTZ A;  3HXW A;  2EJF A;  4P72 C;  2CIM A;  2CJ9 A;  3MEY A;  1YFT A;  1ATI A;  3LSQ A;  4PJO E;  2DXU A;  4J6Y A;  4YRO A;  5LJ5 j;  3EFS A;  3LSS A;  3P8Y A;  1NNH A;  2RHQ B;  1M8V A;  4YRT A;  3JB9 G;  5GAM h;  1Z7M A;  3QO3 A;  2ALY A;  3BJU A;  2DZC A;  4M7A A;  1D3B B;  1WQ7 A;  1QF6 A;  2VC8 A;  4P73 C;  4KR3 A;  4M7D D;  4WJ3 M;  1YFS A;  3HFO A;  3MF2 A;  2AKW B;  4YYE A;  4XU1 A;  4CH5 A;  4M75 A;  3JCM V;  4HT9 A;  2DXT A;  4NOY A;  4M7D G;  3E9I A;  4XTY A;  4P71 C;  4C8Q G;  3L4G B;  3I7F A;  2ARS A;  5E3I A;  2J3L A;  5F5W A;  4UPA A;  5LJ3 g;  4CH4 A;  4K88 A;  5GAO r;  3JCM h;  4RDX A;  4CS4 A;  4A54 A;  3VQX A;  5LJ5 e;  5HGQ A;  3L2Z A;  3A7R A;  5DY9 A;  3RES A;  5GAN 4;  1H4T A;  4P71 A;  3V7R A;  3JCM d;  1U1T A;  1M5Q 1;  4PJO B;  4TWA A;  3NEN A;  4C8Q D;  3UH0 A;  4Y91 A;  5GMK e;  2EJ9 A;  1Y96 B;  4Q6G A;  4CH6 A;  3SB2 A;  3V8L A;  3M4P A;  1KQ2 A;  2J3M A;  1YB3 A;  4M7A F;  2DU5 A;  2ZT6 A;  5LJ3 e;  2DKG A;  4XTW A;  1H4V B;  4XEM A;  2E64 A;  3REX A;  1I81 A;  4M75 C;  4XU0 A;  5GAM d;  4C92 C;  4ZTU B;  4Q15 A;  4M7A D;  2ZXF A;  3JCM g;  1JRI A;  1EVK A;  1BIA A;  2YLC A;  4J15 A;  4XTX A;  1J5W A;  2Q7G A;  3ICA A;  3TUP A;  4TTV A;  4YRK A;  2I4O A;  4BW9 A;  5LJ5 f;  1NYQ A;  2E10 A;  1SES A;  5GAN 7;  4H2T A;  4YRM A;  3BY7 A;  4HWT A;  1EFW A;  4JLI A;  1WQW A;  3FIF A;  3L1A A;  1EQR A;  2VXF A;  4BWA A;  1JJC B;  1N9W A;  3BFM A;  4WF2 A;  1TH7 A;  4EMH A;  3FB9 A;  3IKL A;  3R07 A;  4RCC A;  2JN0 A;  4RCB A;  4O2D A;  1MGQ A;  3VBB A;  4M78 A;  2CJA A;  5GAN 8;  3JCM W;  2RHS A;  5I21 A;  4TVY A;  1BBW A;  2XGT A;  4UP9 A;  4NCX A;  4TVA A;  2ZR3 A;  4N0A A;  4HWS A;  2ZZG A;  1E22 A;  3QHS A;  5GAN h; 
#chains in the Genus database with same CATH topology
 2VUB A;  2XG8 D;  1OOT A;  3RF1 A;  4J6X A;  4M77 B;  4BI8 B;  4YRI A;  2CGH A;  5IHK A;  3G1Z A;  4P75 A;  3OYC A;  2AT1 B;  1M3A A;  2YRC A;  4X1V A;  2ZIN A;  1X27 A;  2HQH A;  3RKX A;  5CQY A;  2FPF A;  4M7D F;  2PU9 B;  1D1C A;  1UGV A;  1ZSZ A;  2CP3 A;  2QTV A;  4D8K A;  1Q7Y C;  2XHC A;  4BUG A;  3QWX X;  4TVR A;  1M90 U;  2DJZ A;  3JB9 H;  2DZ9 A;  4C92 F;  3M4G A;  1BB9 A;  1PM3 A;  4L87 A;  3NHN A;  4N4H A;  2MWP A;  2EYQ A;  1Q81 U;  4LVI A;  4KGV B;  2JW4 A;  3N5B B;  2YHT A;  4QQG A;  3OSV A;  1M2O A;  1R0B G;  2ZIO A;  5KYY A;  2RK2 A;  7AT1 B;  2L3Q A;  1BKB A;  1UEB A;  5GAO m;  2K3X A;  3OYE A;  1NEG A;  1IGU A;  1VQ4 T;  2AMC B;  1Q86 C;  2F69 A;  3OYY A;  5IXB A;  1X2H A;  1WNL A;  5LL6 S;  1MMN A;  5FU7 B;  2PVD B;  5CKB A;  3MEU A;  3CCS Q;  4PJL A;  2FRY A;  1KC8 R;  2MYS A;  5LJ3 h;  2ALY B;  2M1H A;  2ZZE A;  2VXE A;  5EG2 A;  2C0T A;  2A36 A;  1YHQ Q;  1PWT A;  1NJ8 A;  4LDU A;  1UG1 A;  2JNG A;  5FRN A;  1RLQ C;  1X43 A;  4GY5 A;  2L0A A;  3PCO B;  4Z02 A;  4AMC A;  5IN1 A;  2ED1 A;  5GAM g;  2C7I A;  1YJW T;  2V1Q A;  4Z89 A;  3EH1 A;  1M3C A;  3NET A;  2ABL A;  3PMI A;  3HTZ A;  9ATC B;  2KK4 A;  1TXQ A;  2LJ3 A;  2YRV A;  3OYK A;  2KAF A;  3OS1 A;  3A1P A;  3EG9 B;  4AFZ C;  4M75 B;  1B70 B;  4TQD A;  1VYT A;  1WHL A;  2LX9 A;  3FEO A;  3CD6 T;  2E3C A;  4J9F A;  5I11 A;  2DPP B;  4YPF A;  3OS5 A;  2ZNJ A;  3CCQ A;  2EYY A;  2I2L A;  2W10 A;  2GBQ A;  2I0N A;  3CPW P;  2COW A;  2KDS A;  2MK5 A;  4F7U F;  1G5V A;  2PUO B;  4JJC A;  4JRI A;  1YJ9 A;  2VKN A;  4J5Y A;  5GAO n;  3DSQ A;  2OI3 A;  3VRZ A;  4OB3 B;  3HRS A;  4D6W A;  4LUD A;  3CCQ Q;  3CD6 Q;  2CP0 A;  1B8A A;  3MEV A;  2XDB A;  4M7A B;  2XU8 A;  2V8K A;  3UGT A;  2QHT A;  4LVJ A;  1M1K U;  4RG2 A;  4E7L A;  3EGU A;  1TG0 A;  1YIT Q;  5IT9 E;  1TUC A;  2JMC A;  2HKN A;  2AHJ B;  4DQ2 A;  1WXB A;  3OW2 P;  2PMF A;  4CH3 A;  2CH4 W;  4BI4 A;  2KT8 A;  2QEX Q;  2EQI A;  1BCO A;  4ZNX A;  3VUZ A;  1SET A;  2RHI A;  3FJP A;  5C0M A;  1XTD A;  3UAT A;  3FLG A;  4ZGJ B;  3QG1 A;  1G5H A;  2OAW A;  1YJN A;  5GMK h;  2AMC A;  3H8Z A;  1R0C B;  1UGR B;  3OB9 A;  3OYJ A;  2HL5 C;  3QJY A;  2LCC A;  3EGD A;  1RAH B;  2Q7H A;  4YRR A;  4E51 A;  5GJV B;  2ODR D;  3A7A A;  1N9S A;  3JCM X;  4KBM B;  1NLP C;  1SPK A;  2EQU A;  2X4J A;  4H02 A;  1A0N B;  4XK8 E;  1E1O A;  3CCR T;  1GCQ C;  2LZ6 B;  4P75 C;  4R55 A;  1OX9 A;  4C92 G;  1ASZ A;  1VIF A;  4EMK A;  4FYW B;  4PJO C;  3HSB A;  4J6W A;  4C92 A;  4IIO A;  2X3X D;  2AZS A;  1AWX A;  1GBR A;  1I07 A;  1WHJ A;  4YP0 A;  3QNE A;  3VQY A;  2DJQ A;  1MUZ A;  2FEI A;  2RHU A;  1K9M R;  5KYU A;  4JJN K;  1W4S A;  1EIY B;  1H64 1;  5HKC A;  1SKU B;  2MCN A;  1OV3 A;  1QVF P;  3PZC A;  2K3Y A;  3M4Q A;  2DYB A;  3CCU Q;  3VS6 A;  3BW1 A;  2FZC B;  2R57 A;  4IUP A;  5CIU A;  2EYW A;  3G71 Q;  4ELY C;  1E1T A;  1CKB A;  3OA6 A;  1W2B A;  2D0N A;  1RI9 A;  1M30 A;  4FW1 A;  1WPY A;  1IRE B;  3KFV A;  1Z7N A;  2L5Q A;  1G51 A;  3A74 A;  1PSF A;  4C5I A;  4QQ6 A;  3QSU A;  3VQV A;  1B76 A;  2CZ0 B;  1H4S A;  1USY C;  5CVI A;  3I9Q A;  4PG3 A;  2CZ1 B;  3NMZ C;  3VS0 A;  2PZ1 A;  3F70 A;  1X75 C;  4MZT A;  3I5S A;  3HRU A;  3PCO A;  1X2G A;  5CR2 A;  2OJ2 A;  5GMK j;  3MP8 A;  1NJI C;  2BE9 B;  3QZ5 B;  1V76 A;  3ZBD A;  4J9D A;  3EG3 A;  1B34 B;  4FT4 A;  3OYB A;  3CMA A;  4J9B A;  1ZBX A;  2DXB A;  5I2M A;  3CC4 T;  3UFG A;  3E9H A;  1X54 A;  3FC3 A;  1K0S A;  4F7U G;  1ZLM A;  5ECA A;  1OPK A;  2PUK B;  1KK7 A;  3HFZ B;  1X2Q A;  3TEH A;  1ADY A;  1JU5 C;  2RQW A;  5KNN A;  2EGC A;  4KR2 A;  2ZCE A;  1ABO A;  4DOV A;  3HXX A;  4P3N A;  4CC4 B;  1VQ6 A;  1RAA B;  1NM7 A;  4KRT A;  4OB1 B;  1AWO A;  2EKO A;  1ZSG A;  4V2S A;  1Z9Q A;  2CRE A;  1VQK Q;  2YLB A;  4XTZ A;  1RI0 A;  4RTW A;  3CCE A;  2EJF A;  2EKH A;  1BCM A;  2CSQ A;  2QGG A;  1NBE B;  1ATI A;  2NLU A;  1FX7 A;  4DBH A;  2EVR A;  2A0F B;  3TRE A;  1SF9 A;  1ZUY A;  1KG1 A;  2RHQ B;  2VYT A;  4ZGE B;  1WI7 A;  1M90 R;  1TUG B;  1LVK A;  3QO3 A;  4F04 B;  5I22 A;  4A4K A;  3BJU A;  2DZC A;  2JUF A;  1KC8 C;  1QF6 A;  1ACM B;  3RMQ A;  1BI3 A;  4KR3 A;  1T0H A;  4WJ3 M;  3MF2 A;  1M2V A;  2L2P A;  5KE3 A;  1PKT A;  4M7D G;  3CCU A;  1QVF S;  3J81 E;  3PVQ A;  5CCA A;  3C95 A;  3LGF A;  1VQ4 Q;  4CS4 A;  5J3B A;  5HGQ A;  1JXO A;  1H4T A;  4RUG A;  1U1T A;  3ZFJ A;  2X9H A;  2O9V A;  2DYI A;  3HTR A;  1QKW A;  4ORZ A;  4PFO A;  4C8Q D;  1MV3 A;  3CXC P;  5KYU B;  1OI1 A;  3V8L A;  1VQM T;  4LXC A;  1KQ2 A;  3M4P A;  1U5S A;  3G1J A;  1VQ4 A;  4JRP A;  4M7A F;  2HMA A;  3I55 Q;  3PT9 A;  1ZUU A;  1KC8 U;  2P4T A;  5CKD A;  5FLX E;  2GGR A;  1I0C A;  2KMT A;  4PFZ A;  3VS3 A;  4XU0 A;  5L8R E;  1N27 A;  2HDA A;  4E7I A;  1PG5 B;  4C92 C;  4ZTU B;  4M7A D;  3G6E A;  5KYY B;  1TS9 A;  1UTI A;  2K6D A;  2Q7G A;  1MMG A;  2CP2 A;  4TTV A;  4E2F B;  4YRK A;  4JJD A;  3EHR A;  2I4O A;  2E6Z A;  4BW9 A;  5IHN A;  4JZ4 A;  1VQ8 T;  3MKD A;  1Y7X A;  4C0Z A;  4YRM A;  2O4X A;  2LCS A;  3G6E Q;  1GRI A;  2KEA A;  2X3W D;  2NUP B;  2VXF A;  1JJC B;  2XMF A;  2DER A;  2VB6 A;  3LX7 A;  1MGQ A;  1FWZ A;  2CJA A;  3OYG A;  3G4S A;  4LDY A;  2RHS A;  3CMA T;  1UDL A;  1BBW A;  2AZV A;  3QZ9 B;  5D6W A;  2LX7 A;  1VQ6 Q;  1VQL T;  2L3P A;  1Q7Y U;  3LLR A;  4HWS A;  3QHS A;  2PVO B;  3UWN A;  3CCE Q;  2VAS A;  4Q5W A;  1YBY A;  5HY6 A;  3AT1 B;  5GAN 3;  1D0Z A;  4M4Z A;  1YWO A;  3EFR A;  1K9M C;  1MNE A;  4EIK A;  2QEX A;  3OSS C;  1FYF A;  1NJI U;  4YRE A;  2KYM A;  1G2B A;  1Q7Y R;  2LVM A;  1PRM C;  1QP3 A;  2RB6 A;  2IY5 B;  2LQK A;  1AVZ C;  3QO5 A;  4C0D C;  1M1F A;  1OZ2 A;  2FG0 A;  3SWN B;  3MQZ A;  3UGQ A;  1O9S A;  3MO8 A;  2ESW A;  2BTT A;  4PJN A;  4J83 A;  1KQ1 A;  4JS5 A;  1MMA A;  3M0R A;  2CUD A;  1NJ6 A;  2DLP A;  2E3I A;  1YIT T;  3CC4 Q;  2LQN A;  2K5I A;  2DFU A;  2COY A;  3E1S A;  4OGE A;  4AG2 C;  2CKK A;  2OAU A;  3DLM A;  1WYX A;  1HK9 A;  3LH5 A;  3RKW A;  2GCX A;  1U1S A;  3G7Z A;  2JT4 A;  4J9H A;  4AH6 A;  4HVC A;  3V7S A;  2NS6 A;  4HCK A;  4ATO A;  1BK2 A;  3I35 A;  3HPW A;  4MMK A;  3BDL A;  3PGG A;  1KIK A;  4HVV A;  3DLL A;  4MDX A;  3PNW C;  2BUD A;  1U06 A;  1VQL A;  4J7I A;  2RHZ A;  3RGL A;  2D1X A;  1VQN T;  1M1K C;  5C52 B;  4PK4 A;  4ZTJ A;  4ELZ C;  1G3W A;  2K4Y A;  2RJF A;  4DBR A;  3M59 A;  2OTL A;  1F1B B;  3WXM B;  2QDL A;  3HXY A;  3V8J A;  4YRC A;  1P92 A;  1H92 A;  5IH2 A;  3A8O B;  2DTI A;  3RDV A;  2E5A A;  4RQF A;  4YDQ A;  2DIL A;  2QXF A;  3I56 A;  3CBO A;  3ZEH A;  3I5R A;  1D3B A;  4KT0 E;  2A8E A;  1ZUK A;  2OTL Q;  1QVP A;  3C0C A;  4BDY A;  5GAM j;  4M78 D;  5CKE A;  4AT1 B;  1JBM A;  2AKW A;  4MZP A;  3VS2 A;  2C0O A;  4CC2 A;  3CME Q;  2VGN A;  1SRY A;  4M7A G;  1B70 A;  2FHD A;  2RK1 A;  4J9I A;  4HWP A;  4YRN A;  2RI3 A;  1WX6 A;  4M78 E;  4PJO G;  1YN8 A;  1Q81 C;  4J9E A;  1E24 A;  1HXD A;  2DK3 A;  8AT1 B;  1SER A;  5KYN A;  2EJG A;  2C06 A;  5A0L A;  1M9S A;  1N5Z A;  2KRS A;  3OMG A;  1ADJ A;  1UUE A;  3CMA Q;  2RD1 A;  4JRK A;  1PCX A;  3EG1 A;  5ELO A;  2K3B A;  3ASK A;  4M7D B;  2GF7 A;  5CKF A;  1BBZ A;  4E7H A;  1YJW A;  2I4N A;  1OX8 A;  4P3P A;  3A5Z A;  1Q95 G;  2KVQ G;  1WHM A;  1UEC A;  2XTI A;  2YUO A;  3VRY A;  2LC4 A;  1I4K 1;  1GXI E;  3CPW S;  4HT4 A;  3GPL A;  2K79 A;  4M77 E;  1AOJ A;  2SRC A;  1MND A;  2C8M A;  1W1F A;  1NLO C;  1JO8 A;  3X25 B;  2QHU A;  1PKS A;  3QII A;  5LJ5 d;  1VQZ A;  4FIB A;  1GL5 A;  1QKX A;  4X5O A;  2RM4 A;  2D9T A;  1UB4 A;  2H3J A;  2D8H A;  4H2U A;  2Q5H A;  3NGP A;  1KFZ A;  2ZPG B;  5GAM f;  1YIJ T;  1PHT A;  4C0F A;  2M9U A;  4RTV A;  3CCL T;  1S72 A;  2LQW A;  2XD0 A;  3QO7 A;  1RLP C;  2EGE A;  4YRF A;  2EYX A;  2DF6 A;  4M75 E;  2HNI A;  5GAN 5;  5K1X A;  2J6O A;  5FW9 A;  1LPL A;  2QI2 A;  1VQ7 T;  1VQN A;  2EQJ A;  2QAZ A;  2QDY B;  3HY1 A;  1TU0 B;  2L8D A;  1PNJ A;  2D8J A;  4B6M A;  3UA6 A;  2MPX C;  1KD1 C;  1AWJ A;  2E1H A;  1G3T A;  3HL8 A;  3REB B;  1RAI B;  1EX4 A;  2CZ6 B;  4N0A C;  3M54 A;  2RO0 A;  2DEQ A;  3M53 A;  3REA B;  3JCM Q;  1M8M A;  1VQN Q;  3A31 A;  2LCL A;  2O88 A;  2JM8 A;  4L59 A;  2LDM A;  5CQX A;  4NL2 A;  5KYW A;  1SHF A;  2Y4Y A;  2ZT5 A;  3TEE A;  2KYB A;  1G83 A;  4FSS A;  3QYH B;  5K1P A;  1M1G A;  2P0L A;  1JXM A;  3H9N A;  2ZPF B;  2J6K A;  1YIT A;  1Q86 R;  5GAN f;  3JB9 I;  4EMK C;  3VS7 A;  5CKH A;  1QLY A;  1V1C A;  3CC2 Q;  4C8Q C;  3CCR A;  2BZ8 A;  1J3T A;  2QK0 A;  1WU7 A;  3E9G A;  4PL6 A;  1S72 T;  4HA8 A;  3CBP A;  3RUX A;  2V8I A;  3KUF A;  4IKF A;  4AFU C;  5FWB A;  1EZZ B;  1K8A C;  1H8K A;  1LYL A;  1CKA A;  2E5Q A;  2FYK A;  4HWO A;  2VGM A;  1VA7 A;  1YJW Q;  3C94 A;  3A8H B;  4JLG A;  3OY9 A;  3PTA A;  3E2U A;  3V7C A;  5A2Q E;  5IXF A;  2DX1 A;  3LGL A;  4M78 B;  1EFN A;  1OZ3 A;  2AKK A;  2DXC A;  3QKJ A;  2LT4 A;  4RQE A;  3NTK A;  2DMO A;  3ME9 A;  2YDL A;  4UP8 A;  3C12 A;  3FJ5 A;  3W3S A;  4M77 C;  2G4C A;  4RTT A;  2RJD A;  2JMA A;  4X9D A;  1B34 A;  3VQW A;  4E7J A;  1SHG A;  1G8X A;  3KFU A;  2BZY A;  4BD3 A;  4HCZ A;  3CCS T;  1RIQ A;  2HCK A;  4G84 A;  5GAN d;  1NJ5 A;  1ASY A;  1GCP A;  2FPD A;  3OYH A;  3CMQ A;  3A5Z B;  3WQZ A;  4M7A E;  2HD0 A;  1BIB A;  3MEA A;  4EDU A;  2O2O A;  2KBT A;  2QQS A;  2ZAE A;  1NEB A;  4M7A C;  2MIO A;  1X55 A;  3UA7 A;  3JRZ A;  1JQQ A;  5A0D A;  1QCF A;  4EMG A;  2ZPH B;  4QKU A;  3HXW A;  3G4S T;  3ULR B;  4BY6 C;  1YIJ A;  2CJ9 A;  1VQL Q;  3LSQ A;  4PJO E;  5M9O A;  2DXU A;  2LT1 A;  5KYX B;  2DNU A;  5LJ5 j;  2J06 A;  1NNH A;  1IXD A;  4A4E A;  1C0M A;  1D0Y A;  4BE0 A;  4YRT A;  2VWF A;  5GAM h;  3J80 E;  4HCC A;  4MZM A;  1FMV A;  4FYV B;  1X2K A;  1VQ9 A;  4Z88 A;  2E70 A;  4O6J A;  3VYH B;  1UE9 A;  2AIR B;  1YFS A;  4YYE A;  1UJY A;  5DLO A;  4M75 A;  1TUD A;  3E9I A;  4XTY A;  1DJ7 B;  2V26 A;  3I7F A;  5F5W A;  1U3O A;  2J3L A;  4UPA A;  2MMP A;  2JTE A;  1GFC A;  3EFO B;  3JCM h;  2CUB A;  3VQX A;  1RAE B;  3CCR Q;  4J9G A;  2RQU A;  4N4G A;  3VKI A;  3V7R A;  1M5Q 1;  4N4I A;  3M5A A;  1MV0 B;  1Y96 B;  3CEY A;  2M0O A;  3SB2 A;  3OW2 A;  2J3M A;  3P8D A;  3X26 B;  1M27 C;  1OQK A;  2DKG A;  2RHY A;  3S3M A;  4XTW A;  3A8L B;  1H4V B;  2CP6 A;  4XEM A;  2E64 A;  1I81 A;  4M75 C;  4KH0 B;  3H0I A;  1VQ5 Q;  2E6N A;  4RG8 A;  1RAB B;  3CCM T;  1W2B S;  2HAX A;  1TOV A;  3E19 A;  3CCL A;  3EAE A;  4Q15 A;  2XI9 A;  4LD9 K;  2EYZ A;  1JRI A;  4IUU A;  1I1J A;  3ICA A;  3NTI A;  1VQM A;  3VS1 A;  2M51 A;  1SRL A;  3LYI A;  5LJ5 f;  1NYF A;  2E10 A;  4GBQ A;  4PLI A;  2JOY A;  1YHQ T;  3ZL7 C;  1IZ6 A;  3BY7 A;  4KGX B;  4EPC A;  1OU8 A;  4ZN3 A;  4HWT A;  1GCQ A;  4WTO B;  2O31 A;  4C0G A;  1BYM A;  4EMH A;  4J9C A;  1YI2 A;  3UT1 A;  3OYN A;  4M78 A;  1PRL C;  2QA4 T;  1UFF A;  2JXB A;  3C4S A;  1PC0 A;  1T3L A;  2IG0 A;  2KY9 A;  4P5N A;  2OTL T;  2P0K A;  4NCX A;  4Y28 E;  5EC7 A;  3L2R A;  1VQ6 T;  2DL8 A;  1RUW A;  2EGA A;  2X4X A;  1S72 Q;  1ABQ A;  1JJ2 A;  1WJS A;  3MCA B;  5FU7 C;  3PE0 A;  5CAI A;  3RBB B;  2E4H A;  4MML A;  4XQ3 A;  1NYG A;  1KHI A;  1ZHI A;  2V1R A;  4C92 B;  4FYY B;  1YCY A;  4X34 A;  4PJO F;  3G71 T;  2M16 A;  2RA2 A;  1AZE A;  3CC4 A;  1K0X A;  3SDZ A;  2C0I A;  4ZTZ B;  3HRI A;  1VYV A;  3S3O A;  2DVJ A;  3A7U A;  4E7Z A;  3EGX B;  2RJE A;  2JZ2 A;  2A28 A;  2DE0 X;  3J7A F;  2F2V A;  4M77 D;  1BU1 A;  3OYD A;  1I8F A;  2DBM A;  2B8A A;  3TSZ A;  2D6F A;  5CO7 A;  1VOM A;  2COZ A;  3MHX A;  2ROT A;  3RER A;  4ZGD B;  2CDT A;  4A4H A;  1D1A A;  3BE3 A;  2FVU A;  3JCM J;  4AG1 C;  2QEX T;  1WJR A;  2FZG B;  1WHG A;  3INZ A;  3M9Q A;  4C8Q A;  2NYS A;  3RIR A;  4PJM A;  1NJI R;  5LJ3 j;  1D1B A;  2P84 A;  2DVE A;  1YJN T;  4PNO A;  5FWC A;  4Y92 A;  3G4S Q;  3M0P A;  2JVV A;  2LJ1 A;  4H2V A;  3GNG A;  4YRJ A;  2HSP A;  2HSE B;  3QPH A;  4RTX A;  3PVL A;  2MOX A;  4ZIB A;  1USY A;  1M1K R;  1WXU A;  3CME A;  3OYF A;  1KMM A;  5DM7 R;  1KQS S;  2F5K A;  1K8A R;  2BE7 D;  1TTH B;  1Y96 A;  1XNI A;  2CT3 A;  5KE2 A;  2KRO A;  1IHW A;  4A4F A;  3OYI A;  1VQ9 T;  4P73 A;  3WVD B;  1KMN A;  3M57 A;  1U8R A;  4FU6 A;  1H4Q A;  11AS A;  3MJX A;  4OB0 B;  3QBY A;  2E12 A;  3MP6 A;  4OLF A;  4F7U E;  2YWW A;  5GAN 2;  4LVK A;  4R56 A;  5GMK l;  4C5G A;  1X6O A;  4H2Y A;  1WA7 A;  1PYS B;  2DDZ A;  5LJ5 h;  2LNV A;  2YUN A;  1G5I A;  2KE9 A;  2XDP A;  3M56 A;  3TVT A;  2MWO A;  1NE8 A;  3VV0 A;  4K11 A;  5J26 A;  4AFS C;  3M4Y A;  2A37 A;  3HFN A;  1YWP A;  3CPW A;  2RJC A;  4WI1 A;  1OPL A;  1BBU A;  4M75 G;  1QW1 A;  3CCV Q;  4M7D A;  2ZR2 A;  3OS0 A;  2XDD A;  4QQD A;  1E6G A;  3PFS A;  4M75 F;  3QO8 A;  3HXU A;  2JTF A;  2W0Z A;  4BE1 A;  1K9A A;  4XTU A;  4CS3 A;  3E9F A;  4YCU A;  3V8K A;  2ZT7 A;  2EPD A;  2QHV A;  2DIG A;  3CCV A;  2NUP A;  4OMN A;  2ECZ A;  2ARU A;  4RMF A;  2QHS A;  3OBY A;  2M02 A;  1D09 B;  3UF4 A;  3R6N A;  2KI7 A;  4JDS A;  2DO3 A;  3EH2 A;  4YRL A;  4BB7 A;  1LOJ A;  2OX7 A;  3QYG B;  2ZTG A;  1PD1 A;  5IHI A;  3SEM A;  3I56 Q;  4YRQ A;  1WHK A;  4C8Q F;  4M77 F;  2IIM A;  3SWN C;  2VVK A;  4DA4 A;  3OYL A;  2CJB A;  1HC7 A;  2DAQ A;  4M77 G;  3Q1J A;  2XID A;  1NYR A;  3VU3 C;  3HXV A;  3WVE B;  2LMJ A;  5A0G A;  3L2Q A;  4FW2 A;  4PJO A;  2I4M A;  4JJB A;  5GAN e;  2H8H A;  1KD1 R;  1K73 R;  4M77 A;  5D6Y A;  3L4G A;  2DTO A;  4PJO D;  5AYF A;  2IY5 A;  2EW3 A;  2QG9 B;  4YRP A;  4L5G A;  4C92 E;  2IVW A;  2MI6 A;  1EVL A;  3X28 B;  4M78 G;  3L2V A;  2BZX A;  2FRW A;  4PHC A;  1YFN A;  1KD1 U;  3H0H A;  4GLM A;  2GTO A;  1JJC A;  2LP5 A;  2EIF A;  4M78 F;  2FO0 A;  4M7D E;  5IAY A;  2ATC B;  1ZA1 B;  3D7S B;  2CYZ B;  2D0Q B;  5I2S A;  4C5E A;  4J8O A;  5GAO p;  3TEH B;  3OS2 A;  1Q82 C;  1SEM A;  2QTX A;  2HQE A;  1VQ5 A;  1KQS A;  3CXC S;  4FYX B;  1QE0 A;  2ROL A;  3CCL Q;  1W66 A;  3QXE B;  8ATC B;  1B7Y A;  1K73 C;  2YSQ A;  1RAD B;  1PD0 A;  3LW5 E;  3IAL A;  1K4U S;  2WSF E;  4E7S A;  4NL3 A;  3KBG A;  12AS A;  3NEM A;  2KNB B;  4YRG A;  5GMK m;  1N9R A;  4EO4 A;  3JCM P;  2L89 A;  4BE2 A;  1V29 B;  2JS2 A;  2QYZ A;  4KGZ B;  4XTV A;  2OTJ A;  5GAN g;  2X51 A;  2DEU A;  4YTL A;  4LNS A;  1OUL A;  4BAC A;  3EFO A;  2BIV A;  4YCW A;  2P5I A;  1WDX A;  2ZPE B;  4OMP A;  3CCV T;  1KQS P;  1UHF A;  3VS5 A;  2MF2 A;  3IQL A;  2LNH B;  3HXZ A;  1IL2 A;  1K9M U;  3GP8 A;  2EQK A;  5KCO A;  5J39 A;  1HJD A;  3ER0 A;  2RQV A;  3MF1 A;  3IKM B;  4QVC A;  4KH1 B;  2YUP A;  1RL2 A;  1PYS A;  1NG2 A;  1WZO A;  3RR6 A;  4M7D C;  2K5F A;  1C1A A;  2LTO A;  3TCJ A;  3AHU A;  4KQE A;  3LWH A;  2EQM A;  3PMT A;  4CC7 A;  1VYU A;  4TVW A;  1VIE A;  1WIE A;  3A98 A;  2DM1 A;  2XK0 A;  2EBP A;  2ZZD A;  2EFI A;  3MET A;  1VQ7 A;  3SHW A;  4PFP A;  1IO6 A;  2RMO A;  5GAN j;  2JS0 A;  2ART A;  4NS5 A;  4RMO A;  2DRM A;  4LUE A;  2CIM A;  1YFT A;  1UGP B;  2NUZ A;  2DL5 A;  4ZN1 A;  1W70 A;  3QDF A;  2WSC E;  2A08 A;  2ZCF B;  2ZPI B;  3OMC A;  4LE9 A;  3PIP A;  2J7I A;  3GBQ A;  5HK3 A;  1Z7M A;  2AK5 A;  4M7A A;  1D3B B;  4P73 C;  2QGF B;  2QQB A;  4M7D D;  2CS7 A;  2AKW B;  4DBF A;  4XU1 A;  4HT9 A;  2DXT A;  3QDR B;  4NOY A;  4BI3 A;  3CME T;  4P71 C;  4C8Q G;  5CK9 A;  3L4G B;  4LVL A;  1IB8 A;  1QVG S;  1KSW A;  2RH2 A;  5LJ3 g;  4CH4 A;  1BI0 A;  3OW2 S;  5GAO r;  3LH0 A;  5LJ5 e;  3L2Z A;  4HCB A;  3A7R A;  4P71 A;  3MPU B;  1YJN Q;  4PJO B;  4TWA A;  1QCO A;  3NEN A;  2LQ8 A;  1QVF A;  3A8M B;  1VQK T;  3UH0 A;  5GMK e;  2M0Y A;  2AKL A;  4J7F A;  1YCS B;  3KXT A;  2JM9 A;  2GTJ A;  1YB3 A;  4LVM A;  2DU5 A;  2DD4 A;  2ZT6 A;  3NTH A;  5LJ3 e;  4IUT A;  2RHX A;  2PQW A;  2P0Q A;  3REX A;  3M0T A;  2K9G A;  3CXC A;  1R8O B;  2LJ0 A;  4DBQ A;  3EHQ A;  1K1Z A;  1KJW A;  1EVK A;  1BIA A;  4GLK A;  4XTX A;  3OBW A;  1JJ2 P;  1YI2 Q;  2A3L A;  4C0D B;  4HXJ A;  4RTY A;  4OF1 A;  1EIF A;  1YIJ Q;  4ZTF A;  1NYQ A;  3MP1 A;  1SES A;  1I5O B;  3S6W A;  1UGS B;  4JLI A;  1XQH A;  2P0P A;  3CC7 A;  3L1A A;  1AD5 A;  3FIF A;  4A63 B;  1EQR A;  2GQI A;  1ZBJ A;  4BWA A;  1X69 A;  4WF2 A;  1TH7 A;  2A7Y A;  3FB9 A;  2E5K A;  2CZ7 B;  4RCC A;  1VQ9 Q;  4O2D A;  4RCB A;  3CCU T;  1QP2 A;  2L3S A;  1Y57 A;  4OML A;  1Q82 U;  5GAN 8;  4JZ3 A;  1XOV A;  2WAC A;  5I21 A;  4UP9 A;  4TVA A;  2ZR3 A;  3CC7 Q;  4N0A A;  1AWW A;  2ZZG A;  3EGD B;  2R5M A;  4DPG A;  3EG2 A;  1YNZ A;  2DL7 A;  2K2M A;  4F7U A;  2JJ9 A;  1VQ5 T;  2O01 E;  3FDR A;  4HKE A;  1CSK A;  1NPR A;  1Q82 R;  5ELN A;  3CPF A;  4ANJ A;  2ZZF A;  5D7U A;  5KH6 A;  3TEG A;  2ZGW A;  4H2X B;  3ERR A;  3P8T A;  2V8J A;  4AFQ C;  1ZSZ B;  2XIC A;  1X56 A;  3NEL A;  4FL6 A;  4P72 A;  1WLP B;  2O9S A;  2PNI A;  3GNF B;  4EX5 A;  1B7T A;  1AT1 B;  3FRN A;  4OB2 B;  5C53 B;  4E6R A;  2CH4 A;  2RPN A;  1HYO A;  2NUT B;  1VQO Q;  1VQP Q;  4MDW A;  2QQ9 A;  3S3N A;  1GFD A;  1I5L A;  2ODR C;  2G6F X;  2FB7 A;  2CP5 A;  2GNC A;  3TU4 K;  4P3O A;  1WXT A;  1ZX6 A;  4FCY A;  1YGB A;  4IUR A;  3H0F A;  3M55 A;  2F2W A;  1X01 A;  2OTJ T;  1YFR A;  2FL7 A;  2O4X B;  1WFW A;  1D0X A;  2EL9 A;  3GF5 A;  2KRN A;  2FPE A;  2HEQ A;  1L0W A;  3X24 B;  2QQA A;  3P8V A;  1VQO A;  3JB9 D;  3UDC A;  4A53 A;  1QMC A;  4C8Q E;  4QVZ A;  2RF0 A;  3M0U A;  4RTZ A;  1VQP T;  2DTH A;  2R5A A;  3H41 A;  3A5Y A;  4LN2 A;  2XKO C;  5HK0 A;  1C6V X;  2B86 A;  4PLL A;  3OYA A;  2HBP A;  1SG5 A;  3U23 A;  1T0J A;  5C6S A;  4XU2 A;  1T3S A;  3OQ5 A;  1NZ9 A;  1OEB A;  3REU A;  3L2W A;  1VQ8 Q;  4OMO A;  1QCN A;  4FM4 B;  3NPF A;  1HD3 A;  4C92 D;  1IHV A;  4A4G A;  2RHQ A;  1WGS A;  3DB4 A;  1LJO A;  3O8V A;  5FU6 C;  4F14 A;  1FXX A;  1VQ8 A;  2HQX A;  2X4Y A;  3SWN A;  3CCJ Q;  4M75 D;  1LNX A;  1WJQ A;  3HP9 A;  2QQR A;  3LWI A;  5GAN 6;  1WLE A;  2Y90 A;  4XU3 A;  2K7A A;  4K87 A;  2KQW A;  4M78 C;  5LJ5 g;  1EOV A;  3GIB A;  3CCJ A;  2KRM A;  4OMQ A;  2J05 A;  4L6V 5;  3HFZ A;  3CCJ T;  3JCM f;  2ZIM A;  3SD4 A;  4H2X A;  2Y4X A;  4KUI A;  4HT8 A;  2PME A;  1M3B A;  4X9C A;  1K8A U;  1SSF A;  3I55 A;  1HTT A;  3I55 T;  1G3Y A;  4WJ4 A;  4JS4 A;  5LJ3 f;  1UHC A;  3TSW A;  2K5L A;  2E3H A;  2QAS A;  2P4R A;  1QQJ A;  3DKM A;  2DBK A;  4HVU A;  3JB9 J;  4FT2 A;  1AHJ B;  1GBQ A;  1B3Q A;  2R58 A;  1JJ2 S;  2I4L A;  1RAG B;  2DQ3 A;  4JPB W;  1B7Y B;  4F7U B;  4FSX A;  4BY6 B;  3CD6 A;  5C51 B;  3HY0 A;  1SSH A;  1E7O A;  4CI0 C;  3JB9 F;  3HKS A;  4TVA B;  1Q81 R;  3HFV A;  1G3S A;  1NJ1 A;  1H3H A;  4IUV A;  3URG A;  4H2S A;  3LC0 A;  3PIO A;  3RAC A;  3EG0 A;  4HVW A;  1S1N A;  2DU7 A;  1VQP A;  2HZY A;  4H2W A;  3A8G B;  3QUI A;  2X35 A;  4D8D A;  1UGQ B;  1IRX A;  3JCM c;  4R0K A;  4DOW A;  3CCM A;  1NJ2 A;  4JUV A;  1H3Z A;  2ED0 A;  3P8B B;  5GAO q;  2RQT A;  1RAF B;  2PTK A;  3VJP A;  5DLQ E;  2DA9 A;  3RKY A;  1LCK A;  1XJW B;  1Z9Z A;  2YRD A;  3SFM A;  5GAM e;  2NUT A;  4E7K A;  2YT6 A;  2FZK B;  3I56 T;  3JV3 A;  1VQM Q;  2BKD N;  2SEM A;  1OYX A;  3RMS A;  5LJ3 d;  4YRS A;  1X6B A;  3MEW A;  1JB0 E;  1QWF A;  2H3E B;  3THK A;  1AZG B;  3CCQ T;  4PKC C;  3VYG A;  5L23 A;  5GMK i;  3CCS A;  1GGM A;  2ZNI A;  4LDX A;  4CS2 A;  4OMM A;  3X20 B;  3JCM e;  2GFU A;  4CRI A;  1Y0M A;  3QJ6 A;  2E65 A;  3GOX A;  1KOG A;  4KUD K;  3H6Z A;  3DB3 A;  4XEO A;  2DIQ A;  1BI1 A;  2Q5I A;  3O5Z A;  4IUQ A;  2KXD A;  1K73 U;  2EWN A;  5KCH A;  2WSE E;  2RHS B;  4G85 A;  4CC3 A;  1WHH A;  2RQR A;  4TQF A;  2F5T X;  4HWR A;  5FU6 B;  6AT1 B;  4RTU A;  4LDV A;  1WYD A;  1IGQ A;  3G71 A;  2F2X A;  4P74 C;  2JTM A;  4UC4 A;  1Y71 A;  4UP7 A;  1QVG P;  3OD1 A;  1RAC B;  4Z8A A;  1YHQ A;  3EGX A;  1B07 A;  4OGC A;  5FRM A;  3A32 A;  5FRO A;  2Q7E A;  1C0A A;  2DL3 A;  2F1L A;  4QVD A;  4ME7 A;  2IPO B;  4QW2 A;  3HRK A;  1ZQ1 A;  4K86 A;  1K76 A;  1YJ9 Q;  4B9W A;  2EAY A;  2DQ0 A;  2K57 A;  3RL6 A;  3OYM A;  3QTC A;  2KGT A;  1FMK A;  1YI2 T;  5GAO l;  1FMW A;  2E41 A;  3L42 A;  2GFA A;  2DET A;  4OP0 A;  4F16 A;  1Q86 U;  4YCV A;  4EMK B;  3JCM b;  3M0Q A;  3CC7 T;  3BDU A;  1NPP A;  4C8Q B;  2ZT8 A;  1ARK A;  3IG2 A;  3NFC A;  1E6H A;  1PSE A;  1YJ9 T;  5HCK A;  1EIY A;  4ESR A;  4WCI A;  4P74 A;  1FYN A;  2PVG B;  2HKQ B;  4O5V A;  1Y07 A;  3M58 A;  1TSF A;  4JRQ A;  4P72 C;  2KXC A;  3MEY A;  3R6O A;  4J6Y A;  1JEG A;  4LNP A;  4YRO A;  3L2U A;  3EFS A;  3LSS A;  4PJJ A;  1M90 C;  3P8Y A;  4OMF B;  2DRK A;  1KHC A;  1M8V A;  5GJW B;  4LDW A;  3CCM Q;  4LD6 A;  3JB9 G;  1QVG A;  2ENM A;  3UPU A;  1VQK A;  2ALY A;  1W6X A;  1O75 A;  1WQ7 A;  2VC8 A;  1AEY A;  2K2V A;  1M2V B;  1UJ0 A;  2OTJ Q;  3HHT B;  3CC2 T;  3HFO A;  4CH5 A;  3JCM V;  2HL3 A;  4RKU E;  2RN8 A;  3VUB A;  2QA4 A;  4B9X A;  5AT1 B;  2ARS A;  5E3I A;  1YP5 A;  4IIM A;  4VUB A;  3CCE T;  4K88 A;  2LRQ A;  4RDX A;  1BI2 A;  4F17 A;  4A54 A;  4DEY A;  1M4Z A;  2X4W A;  4QT7 A;  2VV5 A;  1N8R C;  5DY9 A;  3RES A;  4C5H A;  5GAN 4;  3JCM d;  4BDZ A;  2YUQ A;  3RNJ A;  2Z0W A;  2QA4 Q;  4E47 A;  3EG9 A;  1MHN A;  4Y91 A;  2EJ9 A;  2KR3 A;  4Q6G A;  4CH6 A;  1W2B P;  3JSC A;  2J6F A;  1HSQ A;  3G6E T;  1SRM A;  2CP7 A;  3TQ7 P;  2DD5 A;  3HRT A;  3CBM A;  1VQO T;  1VQ7 Q;  2RI2 A;  5GAM d;  1MMD A;  2ZXF A;  1ZSZ C;  3JCM g;  3QWY A;  3JAM E;  1VUB A;  2YLC A;  1N6A A;  4J15 A;  5KYX A;  3P8H A;  1QWE A;  1J5W A;  3TUP A;  3GLX A;  1X6G A;  1OU9 A;  2YXY A;  2NWM A;  2RNA A;  4DEX A;  2MAM A;  5GAN 7;  3M0S A;  4H2T A;  2CT4 A;  1TWB A;  1N8R R;  1EFW A;  4II1 A;  1WQW A;  3CQT A;  2RI5 A;  4OVA A;  1ZA2 B;  2HBW A;  3VS4 A;  5KYW B;  2ZPB B;  1N9W A;  3BFM A;  3IKL A;  3R07 A;  3T9N A;  2KSS A;  2JN0 A;  2GQV A;  4KUL A;  3VBB A;  3JCM W;  4XAX B;  1R77 A;  2CSI A;  2L3R A;  4TVY A;  2XGT A;  2DL4 A;  1N8R U;  3CC2 A;  2KT1 A;  5D6X A;  2G3R A;  1E22 A;  5GAN h; 
#chains in the Genus database with same CATH homology
 2VUB A;  2XG8 D;  3RF1 A;  4J6X A;  4M77 B;  4BI8 B;  4YRI A;  2CGH A;  3G1Z A;  4P75 A;  3OYC A;  2ZIN A;  3RKX A;  5CQY A;  4M7D F;  2PU9 B;  1Q7Y C;  2XHC A;  4BUG A;  4TVR A;  1M90 U;  2DJZ A;  3JB9 H;  2DZ9 A;  4C92 F;  3M4G A;  4L87 A;  4N4H A;  2MWP A;  2EYQ A;  1Q81 U;  4LVI A;  3N5B B;  2YHT A;  3OSV A;  4QQG A;  2ZIO A;  2RK2 A;  1BKB A;  1UEB A;  5GAO m;  2K3X A;  3OYE A;  1VQ4 T;  2AMC B;  1Q86 C;  2F69 A;  3OYY A;  1X2H A;  1WNL A;  5LL6 S;  5FU7 B;  2PVD B;  5CKB A;  3MEU A;  5LJ3 h;  2ALY B;  2M1H A;  2ZZE A;  2VXE A;  5EG2 A;  1NJ8 A;  4LDU A;  2JNG A;  5FRN A;  4GY5 A;  3PCO B;  4Z02 A;  5IN1 A;  5GAM g;  2C7I A;  1YJW T;  3NET A;  3PMI A;  3HTZ A;  2KK4 A;  2YRV A;  3OYK A;  2KAF A;  3OS1 A;  1B70 B;  4M75 B;  4TQD A;  2LX9 A;  3FEO A;  3CD6 T;  2E3C A;  2DPP B;  4YPF A;  3OS5 A;  2ZNJ A;  3CCQ A;  2I2L A;  2KDS A;  4F7U F;  1G5V A;  2PUO B;  4JRI A;  1YJ9 A;  4J5Y A;  5GAO n;  3DSQ A;  4OB3 B;  3HRS A;  4D6W A;  1B8A A;  3MEV A;  2XDB A;  4M7A B;  2XU8 A;  2V8K A;  3UGT A;  2QHT A;  4LVJ A;  1M1K U;  4RG2 A;  4E7L A;  5IT9 E;  2AHJ B;  4DQ2 A;  2PMF A;  4CH3 A;  4BI4 A;  3VUZ A;  1SET A;  2RHI A;  3FJP A;  5C0M A;  1XTD A;  3FLG A;  4ZGJ B;  3QG1 A;  1G5H A;  1YJN A;  5GMK h;  2AMC A;  3H8Z A;  1UGR B;  3OB9 A;  3OYJ A;  3QJY A;  2LCC A;  2Q7H A;  4YRR A;  4E51 A;  2ODR D;  3A7A A;  1N9S A;  3JCM X;  4KBM B;  2EQU A;  2X4J A;  4H02 A;  4XK8 E;  1E1O A;  3CCR T;  4P75 C;  4R55 A;  4C92 G;  1ASZ A;  1VIF A;  4EMK A;  4PJO C;  3HSB A;  4J6W A;  4C92 A;  4YP0 A;  3QNE A;  3VQY A;  2RHU A;  4JJN K;  1W4S A;  1EIY B;  1H64 1;  5HKC A;  3PZC A;  2K3Y A;  3M4Q A;  3BW1 A;  2R57 A;  4IUP A;  5CIU A;  4ELY C;  1E1T A;  3OA6 A;  1W2B A;  1WPY A;  1IRE B;  1Z7N A;  2L5Q A;  1G51 A;  3A74 A;  1PSF A;  4C5I A;  4QQ6 A;  3QSU A;  3VQV A;  1B76 A;  2CZ0 B;  1H4S A;  1USY C;  5CVI A;  4PG3 A;  2CZ1 B;  3F70 A;  1X75 C;  4MZT A;  3HRU A;  3PCO A;  1X2G A;  5CR2 A;  5GMK j;  3MP8 A;  1NJI C;  3QZ5 B;  3ZBD A;  1B34 B;  4FT4 A;  3OYB A;  3CMA A;  1ZBX A;  2DXB A;  5I2M A;  3CC4 T;  3UFG A;  3E9H A;  1X54 A;  3FC3 A;  4F7U G;  2PUK B;  3HFZ B;  3TEH A;  1ADY A;  5KNN A;  4KR2 A;  2ZCE A;  4DOV A;  3HXX A;  4P3N A;  1VQ6 A;  4OB1 B;  2EKO A;  4V2S A;  2YLB A;  4XTZ A;  1RI0 A;  3CCE A;  2EJF A;  1ATI A;  2NLU A;  1FX7 A;  3TRE A;  1KG1 A;  2RHQ B;  2VYT A;  4ZGE B;  3QO3 A;  4A4K A;  3BJU A;  2DZC A;  2JUF A;  1KC8 C;  1QF6 A;  3RMQ A;  1BI3 A;  4KR3 A;  4WJ3 M;  3MF2 A;  5KE3 A;  4M7D G;  3CCU A;  1QVF S;  3J81 E;  5CCA A;  3C95 A;  3LGF A;  4CS4 A;  5J3B A;  5HGQ A;  1H4T A;  1U1T A;  3ZFJ A;  4C8Q D;  1VQM T;  1OI1 A;  3V8L A;  3M4P A;  1KQ2 A;  1VQ4 A;  4JRP A;  4M7A F;  3PT9 A;  1KC8 U;  2P4T A;  5CKD A;  5FLX E;  2KMT A;  4XU0 A;  5L8R E;  1N27 A;  4E7I A;  4C92 C;  4ZTU B;  4M7A D;  3G6E A;  2Q7G A;  4TTV A;  4YRK A;  2I4O A;  2E6Z A;  4BW9 A;  1VQ8 T;  1Y7X A;  4C0Z A;  4YRM A;  2O4X A;  2VXF A;  1JJC B;  3LX7 A;  1MGQ A;  1FWZ A;  2CJA A;  3OYG A;  3G4S A;  4LDY A;  2RHS A;  3CMA T;  1BBW A;  3QZ9 B;  5D6W A;  1VQL T;  1Q7Y U;  4HWS A;  3LLR A;  3QHS A;  2PVO B;  3UWN A;  4Q5W A;  1YBY A;  5HY6 A;  5GAN 3;  3EFR A;  1K9M C;  2QEX A;  3OSS C;  1FYF A;  1NJI U;  4YRE A;  2LVM A;  1QP3 A;  2RB6 A;  2IY5 B;  2LQK A;  3QO5 A;  4C0D C;  1M1F A;  1OZ2 A;  3SWN B;  3MQZ A;  3UGQ A;  1O9S A;  3MO8 A;  4J83 A;  1KQ1 A;  4JS5 A;  1NJ6 A;  1YIT T;  2K5I A;  3E1S A;  4OGE A;  2CKK A;  2OAU A;  3DLM A;  1HK9 A;  3RKW A;  2GCX A;  1U1S A;  3G7Z A;  4AH6 A;  4HVC A;  3V7S A;  2NS6 A;  4ATO A;  3HPW A;  4MMK A;  3BDL A;  3PGG A;  3DLL A;  4MDX A;  3PNW C;  2BUD A;  1VQL A;  4J7I A;  2RHZ A;  3RGL A;  1VQN T;  1M1K C;  5C52 B;  4ZTJ A;  4ELZ C;  1G3W A;  2K4Y A;  2RJF A;  3M59 A;  2OTL A;  3WXM B;  3HXY A;  3V8J A;  4YRC A;  1P92 A;  3A8O B;  2DTI A;  4RQF A;  2E5A A;  4YDQ A;  2QXF A;  3I56 A;  3CBO A;  3ZEH A;  1D3B A;  4KT0 E;  2A8E A;  1QVP A;  4BDY A;  5GAM j;  4M78 D;  5CKE A;  1JBM A;  2AKW A;  4MZP A;  2VGN A;  1SRY A;  4M7A G;  1B70 A;  2FHD A;  2RK1 A;  4HWP A;  4YRN A;  2RI3 A;  4M78 E;  4PJO G;  1Q81 C;  1E24 A;  1HXD A;  2DK3 A;  1SER A;  2EJG A;  2C06 A;  5A0L A;  1M9S A;  3OMG A;  1ADJ A;  2RD1 A;  4JRK A;  5ELO A;  3ASK A;  4M7D B;  2GF7 A;  5CKF A;  4E7H A;  1YJW A;  2I4N A;  4P3P A;  3A5Z A;  2KVQ G;  2XTI A;  2LC4 A;  1I4K 1;  1GXI E;  3CPW S;  4HT4 A;  3GPL A;  4M77 E;  2C8M A;  3X25 B;  2QHU A;  3QII A;  5LJ5 d;  1VQZ A;  4FIB A;  4X5O A;  2RM4 A;  2D9T A;  1UB4 A;  2H3J A;  4H2U A;  2Q5H A;  2ZPG B;  5GAM f;  1YIJ T;  4C0F A;  2M9U A;  3CCL T;  1S72 A;  2XD0 A;  3QO7 A;  4YRF A;  4M75 E;  2HNI A;  5GAN 5;  5K1X A;  1VQ7 T;  2QI2 A;  1VQN A;  2EQJ A;  2QDY B;  3HY1 A;  2L8D A;  1KD1 C;  2E1H A;  1G3T A;  3HL8 A;  2CZ6 B;  4N0A C;  3M54 A;  2RO0 A;  2DEQ A;  3M53 A;  3JCM Q;  3A31 A;  2LCL A;  4L59 A;  2LDM A;  5CQX A;  4NL2 A;  2Y4Y A;  2ZT5 A;  3TEE A;  3QYH B;  5K1P A;  1M1G A;  2P0L A;  2ZPF B;  1YIT A;  5GAN f;  3JB9 I;  4EMK C;  5CKH A;  4C8Q C;  3CCR A;  1WU7 A;  3E9G A;  4PL6 A;  1S72 T;  4HA8 A;  3CBP A;  3RUX A;  2V8I A;  3KUF A;  4IKF A;  1K8A C;  1LYL A;  2E5Q A;  2FYK A;  4HWO A;  2VGM A;  3C94 A;  3A8H B;  4JLG A;  3OY9 A;  3PTA A;  3V7C A;  5A2Q E;  3LGL A;  4M78 B;  2DXC A;  1OZ3 A;  3QKJ A;  2LT4 A;  4RQE A;  3NTK A;  3ME9 A;  4UP8 A;  3C12 A;  3W3S A;  4M77 C;  2G4C A;  2RJD A;  3VQW A;  4X9D A;  1B34 A;  4E7J A;  3KFU A;  4BD3 A;  4HCZ A;  3CCS T;  1RIQ A;  4G84 A;  5GAN d;  1NJ5 A;  1ASY A;  3OYH A;  3CMQ A;  3A5Z B;  3WQZ A;  4M7A E;  2HD0 A;  1BIB A;  3MEA A;  4EDU A;  2QQS A;  4M7A C;  1X55 A;  3JRZ A;  5A0D A;  4EMG A;  2ZPH B;  3HXW A;  3G4S T;  4BY6 C;  1YIJ A;  2CJ9 A;  3LSQ A;  4PJO E;  5M9O A;  2LT1 A;  2DXU A;  5LJ5 j;  1NNH A;  4A4E A;  4BE0 A;  4YRT A;  5GAM h;  3J80 E;  4HCC A;  4MZM A;  1VQ9 A;  2E70 A;  4O6J A;  3VYH B;  1YFS A;  4YYE A;  5DLO A;  4M75 A;  3E9I A;  4XTY A;  1DJ7 B;  3I7F A;  5F5W A;  2J3L A;  4UPA A;  2MMP A;  3JCM h;  3VQX A;  4N4G A;  3VKI A;  3V7R A;  1M5Q 1;  4N4I A;  3M5A A;  1Y96 B;  3CEY A;  2M0O A;  3SB2 A;  3OW2 A;  2J3M A;  3P8D A;  3X26 B;  3S3M A;  2DKG A;  2RHY A;  4XTW A;  3A8L B;  1H4V B;  4XEM A;  2E64 A;  1I81 A;  4M75 C;  2E6N A;  4RG8 A;  3CCM T;  1W2B S;  2HAX A;  3E19 A;  3CCL A;  3EAE A;  4Q15 A;  2XI9 A;  4LD9 K;  1JRI A;  4IUU A;  3ICA A;  3NTI A;  1VQM A;  3LYI A;  5LJ5 f;  2E10 A;  4PLI A;  2JOY A;  1YHQ T;  1IZ6 A;  3BY7 A;  4EPC A;  4ZN3 A;  4HWT A;  4C0G A;  1BYM A;  4EMH A;  1YI2 A;  3UT1 A;  3OYN A;  4M78 A;  2QA4 T;  3C4S A;  2IG0 A;  4P5N A;  2KY9 A;  2OTL T;  2P0K A;  4NCX A;  4Y28 E;  3L2R A;  1VQ6 T;  2X4X A;  1JJ2 A;  1WJS A;  3MCA B;  5FU7 C;  5CAI A;  4MML A;  4XQ3 A;  1KHI A;  1ZHI A;  4C92 B;  1YCY A;  4X34 A;  4PJO F;  3G71 T;  2M16 A;  2RA2 A;  3CC4 A;  3SDZ A;  4ZTZ B;  3HRI A;  3S3O A;  3A7U A;  2RJE A;  2JZ2 A;  3J7A F;  4M77 D;  3OYD A;  1I8F A;  2B8A A;  2D6F A;  5CO7 A;  3MHX A;  3RER A;  4ZGD B;  4A4H A;  2FVU A;  3JCM J;  2QEX T;  1WJR A;  3INZ A;  3M9Q A;  4C8Q A;  3RIR A;  5LJ3 j;  2DVE A;  1YJN T;  4PNO A;  2JVV A;  4H2V A;  3GNG A;  4YRJ A;  3QPH A;  4ZIB A;  1USY A;  3CME A;  3OYF A;  1KMM A;  5DM7 R;  1KQS S;  2F5K A;  1Y96 A;  1XNI A;  5KE2 A;  4A4F A;  3OYI A;  1VQ9 T;  4P73 A;  3WVD B;  1KMN A;  3M57 A;  1U8R A;  4FU6 A;  1H4Q A;  11AS A;  4OB0 B;  3QBY A;  2E12 A;  3MP6 A;  4OLF A;  4F7U E;  5GAN 2;  4LVK A;  4R56 A;  5GMK l;  4C5G A;  1X6O A;  4H2Y A;  1PYS B;  2DDZ A;  5LJ5 h;  2LNV A;  1G5I A;  2XDP A;  3M56 A;  2MWO A;  1NE8 A;  3VV0 A;  5J26 A;  3M4Y A;  3HFN A;  3CPW A;  2RJC A;  4WI1 A;  1BBU A;  4M75 G;  1QW1 A;  4M7D A;  2ZR2 A;  3OS0 A;  2XDD A;  4QQD A;  3PFS A;  4M75 F;  3QO8 A;  3HXU A;  2JTF A;  4BE1 A;  4XTU A;  4CS3 A;  3E9F A;  4YCU A;  3V8K A;  2ZT7 A;  2QHV A;  2DIG A;  3CCV A;  2ARU A;  4RMF A;  2QHS A;  3OBY A;  4JDS A;  2DO3 A;  4YRL A;  4BB7 A;  1LOJ A;  3QYG B;  2ZTG A;  4YRQ A;  4C8Q F;  4M77 F;  3SWN C;  4DA4 A;  3OYL A;  2CJB A;  1HC7 A;  2DAQ A;  4M77 G;  3Q1J A;  2XID A;  1NYR A;  3VU3 C;  3HXV A;  3WVE B;  3L2Q A;  5A0G A;  4PJO A;  2I4M A;  5GAN e;  4M77 A;  5D6Y A;  3L4G A;  2DTO A;  4PJO D;  5AYF A;  2IY5 A;  4YRP A;  4L5G A;  4C92 E;  2IVW A;  2MI6 A;  1EVL A;  3X28 B;  4M78 G;  3L2V A;  4PHC A;  1KD1 U;  1JJC A;  2EIF A;  4M78 F;  4M7D E;  5IAY A;  2CYZ B;  2D0Q B;  5I2S A;  4C5E A;  4J8O A;  5GAO p;  3TEH B;  3OS2 A;  1Q82 C;  2QTX A;  2HQE A;  1VQ5 A;  1KQS A;  3CXC S;  1QE0 A;  1W66 A;  3QXE B;  1B7Y A;  1K73 C;  3LW5 E;  3IAL A;  2WSF E;  4NL3 A;  3KBG A;  12AS A;  3NEM A;  4YRG A;  5GMK m;  1N9R A;  4EO4 A;  3JCM P;  2L89 A;  4BE2 A;  1V29 B;  4XTV A;  2OTJ A;  5GAN g;  4YTL A;  4LNS A;  4BAC A;  2BIV A;  4YCW A;  2P5I A;  3CCV T;  2ZPE B;  2MF2 A;  3HXZ A;  1IL2 A;  1K9M U;  3GP8 A;  2EQK A;  5KCO A;  5J39 A;  3ER0 A;  3MF1 A;  3IKM B;  4QVC A;  1RL2 A;  1PYS A;  4M7D C;  2K5F A;  2LTO A;  3TCJ A;  3AHU A;  4KQE A;  3LWH A;  2EQM A;  3PMT A;  4TVW A;  1VIE A;  2XK0 A;  2ZZD A;  2EFI A;  3MET A;  1VQ7 A;  5GAN j;  2ART A;  4NS5 A;  4RMO A;  2CIM A;  1YFT A;  1UGP B;  4ZN1 A;  2WSC E;  2ZCF B;  2ZPI B;  3OMC A;  3PIP A;  5HK3 A;  1Z7M A;  4M7A A;  1D3B B;  4P73 C;  2QQB A;  4M7D D;  2CS7 A;  2AKW B;  4XU1 A;  4HT9 A;  2DXT A;  3QDR B;  4NOY A;  4BI3 A;  3CME T;  4P71 C;  4C8Q G;  5CK9 A;  3L4G B;  4LVL A;  1QVG S;  2RH2 A;  5LJ3 g;  4CH4 A;  1BI0 A;  3OW2 S;  5GAO r;  3LH0 A;  5LJ5 e;  3L2Z A;  4HCB A;  3A7R A;  4P71 A;  4PJO B;  4TWA A;  3NEN A;  2LQ8 A;  1QVF A;  3A8M B;  1VQK T;  3UH0 A;  5GMK e;  4J7F A;  3KXT A;  1YB3 A;  5GAN h;  4LVM A;  2DU5 A;  2DD4 A;  2ZT6 A;  3NTH A;  5LJ3 e;  4IUT A;  2RHX A;  2PQW A;  2P0Q A;  3REX A;  3CXC A;  1R8O B;  1EVK A;  1BIA A;  4GLK A;  4XTX A;  3OBW A;  2A3L A;  4C0D B;  4OF1 A;  1EIF A;  4ZTF A;  1NYQ A;  3MP1 A;  1SES A;  3S6W A;  1UGS B;  4JLI A;  1XQH A;  2P0P A;  3CC7 A;  3FIF A;  3L1A A;  1EQR A;  4BWA A;  4WF2 A;  1TH7 A;  2A7Y A;  3FB9 A;  2CZ7 B;  4RCC A;  4O2D A;  4RCB A;  3CCU T;  1QP2 A;  1Q82 U;  5GAN 8;  1XOV A;  4UP9 A;  2WAC A;  5I21 A;  4TVA A;  2ZR3 A;  4N0A A;  2ZZG A;  2R5M A;  4DPG A;  4F7U A;  1VQ5 T;  2O01 E;  3FDR A;  4HKE A;  1NPR A;  5ELN A;  3CPF A;  2ZZF A;  5KH6 A;  3TEG A;  2ZGW A;  4H2X B;  3ERR A;  3P8T A;  2V8J A;  2XIC A;  1X56 A;  3NEL A;  4FL6 A;  4P72 A;  3GNF B;  4EX5 A;  3FRN A;  4OB2 B;  5C53 B;  4MDW A;  2QQ9 A;  3S3N A;  1I5L A;  2ODR C;  2FB7 A;  3TU4 K;  4P3O A;  1YGB A;  3M55 A;  4IUR A;  2OTJ T;  1X01 A;  1YFR A;  2FL7 A;  2O4X B;  2EL9 A;  3GF5 A;  1L0W A;  3X24 B;  2QQA A;  3P8V A;  1VQO A;  3JB9 D;  3UDC A;  4A53 A;  4C8Q E;  4QVZ A;  1VQP T;  2DTH A;  2R5A A;  3A5Y A;  2XKO C;  5HK0 A;  4PLL A;  3OYA A;  2HBP A;  5C6S A;  4XU2 A;  3OQ5 A;  1NZ9 A;  3REU A;  3L2W A;  4FM4 B;  4C92 D;  4A4G A;  2RHQ A;  1WGS A;  3DB4 A;  1LJO A;  3O8V A;  5FU6 C;  1FXX A;  1VQ8 A;  2HQX A;  2X4Y A;  3SWN A;  4M75 D;  1LNX A;  1WJQ A;  3HP9 A;  2QQR A;  3LWI A;  5GAN 6;  1WLE A;  2Y90 A;  4XU3 A;  4K87 A;  2KQW A;  4M78 C;  5LJ5 g;  1EOV A;  3GIB A;  3CCJ A;  4L6V 5;  3HFZ A;  3CCJ T;  3JCM f;  2ZIM A;  3SD4 A;  4H2X A;  2Y4X A;  4KUI A;  4HT8 A;  2PME A;  4X9C A;  1K8A U;  1SSF A;  3I55 A;  1HTT A;  3I55 T;  1G3Y A;  4WJ4 A;  4JS4 A;  5LJ3 f;  2K5L A;  3DKM A;  3JB9 J;  4FT2 A;  1AHJ B;  2R58 A;  1JJ2 S;  2I4L A;  2DQ3 A;  1B7Y B;  4F7U B;  4FSX A;  4BY6 B;  3CD6 A;  5C51 B;  3HY0 A;  4CI0 C;  3JB9 F;  3HKS A;  4TVA B;  3HFV A;  1G3S A;  1NJ1 A;  4IUV A;  3URG A;  4H2S A;  3LC0 A;  3PIO A;  3RAC A;  2DU7 A;  1VQP A;  4H2W A;  3A8G B;  3QUI A;  2X35 A;  1UGQ B;  3JCM c;  4DOW A;  3CCM A;  1NJ2 A;  4JUV A;  1H3Z A;  3P8B B;  5GAO q;  3VJP A;  5DLQ E;  3RKY A;  3SFM A;  5GAM e;  4E7K A;  3I56 T;  2BKD N;  1OYX A;  3RMS A;  5LJ3 d;  4YRS A;  3MEW A;  1JB0 E;  3CCQ T;  4PKC C;  3VYG A;  5GMK i;  3CCS A;  1GGM A;  2ZNI A;  4LDX A;  4CS2 A;  3X20 B;  3JCM e;  2GFU A;  4CRI A;  3QJ6 A;  2E65 A;  3GOX A;  1KOG A;  4KUD K;  3H6Z A;  3DB3 A;  4XEO A;  2DIQ A;  1BI1 A;  2Q5I A;  4IUQ A;  1K73 U;  2EWN A;  5KCH A;  2WSE E;  2RHS B;  4G85 A;  4TQF A;  2F5T X;  4HWR A;  5FU6 B;  4LDV A;  1WYD A;  3G71 A;  4P74 C;  2JTM A;  4UC4 A;  1Y71 A;  4UP7 A;  3OD1 A;  1YHQ A;  4OGC A;  5FRM A;  5FRO A;  2Q7E A;  1C0A A;  4QVD A;  4ME7 A;  4QW2 A;  3HRK A;  1ZQ1 A;  4K86 A;  4B9W A;  2EAY A;  2DQ0 A;  2K57 A;  3RL6 A;  3OYM A;  3QTC A;  1YI2 T;  5GAO l;  2E41 A;  3L42 A;  2GFA A;  4OP0 A;  1Q86 U;  4YCV A;  4EMK B;  3JCM b;  3CC7 T;  3BDU A;  1NPP A;  4C8Q B;  2ZT8 A;  3IG2 A;  3NFC A;  1PSE A;  1YJ9 T;  1EIY A;  4P74 A;  2PVG B;  4O5V A;  1Y07 A;  3M58 A;  4JRQ A;  4P72 C;  3MEY A;  3R6O A;  4J6Y A;  4YRO A;  3L2U A;  3EFS A;  3LSS A;  1M90 C;  3P8Y A;  4OMF B;  1KHC A;  1M8V A;  4LDW A;  4LD6 A;  3JB9 G;  1QVG A;  3UPU A;  2ALY A;  1VQK A;  1O75 A;  1WQ7 A;  2VC8 A;  2K2V A;  3HHT B;  3CC2 T;  3HFO A;  4CH5 A;  3JCM V;  4RKU E;  3VUB A;  2QA4 A;  4B9X A;  2ARS A;  5E3I A;  4VUB A;  3CCE T;  4K88 A;  2LRQ A;  4RDX A;  1BI2 A;  4A54 A;  1M4Z A;  2X4W A;  2VV5 A;  1N8R C;  5DY9 A;  3RES A;  4C5H A;  5GAN 4;  3JCM d;  4BDZ A;  4E47 A;  1MHN A;  4Y91 A;  2EJ9 A;  4Q6G A;  4CH6 A;  3JSC A;  3G6E T;  2DD5 A;  3HRT A;  3CBM A;  1VQO T;  2RI2 A;  5GAM d;  2ZXF A;  3JCM g;  3JAM E;  1VUB A;  2YLC A;  1N6A A;  4J15 A;  3P8H A;  1J5W A;  3TUP A;  3GLX A;  2MAM A;  5GAN 7;  4H2T A;  1EFW A;  1WQW A;  4II1 A;  2RI5 A;  4OVA A;  2ZPB B;  1N9W A;  3BFM A;  3IKL A;  3R07 A;  3T9N A;  2KSS A;  2JN0 A;  2GQV A;  4KUL A;  3VBB A;  3JCM W;  4XAX B;  2L3R A;  4TVY A;  2XGT A;  1N8R U;  3CC2 A;  5D6X A;  2G3R A;  1E22 A;  3A32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...