2E10A

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutation r51a
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
217
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGESPEGGLWLSIVLSPKKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin Protein Ligase
publication title Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 66
structure length 217
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e10A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e10A01
4HA8A 3REXA 3QTCA 4CH4A 5GAMg 4M78F 5C53B 4HWSA 5GAN6 4RMFA 11ASA 1KQ2A 4EMKB 1X55A 1D3BB 4J5YA 4A53A 3JB9G 4C8QC 4C8QE 4XU2A 3UFGA 1H641 1B76A 1JJCB 3EFSA 4C8QG 2CGHA 4CH6A 4YROA 4YYEA 1Z7MA 4M7AF 3EFRA 2QHVA 3VU3C 5ELNA 1WYDA 1WU7A 4BWAA 4YCVA 1X2GA 2EJFA 2E64A 2ODRD 4LNSA 4YRIA 3A32A 3JCMP 4M7DF 4XTVA 3DSQA 4XU3A 4RDXA 2ZR2A 3HXUA 4UP8A 3IG2A 5GAMd 1BBUA 1YFRA 4H2SA 2VXEA 3V7CA 4K88A 3MEYA 4XTWA 3JCMe 3FB9A 1ADJA 4Q15A 2ZZFA 5KNNA 3REUA 4WJ3M 4TQDA 2I4LA 3HFZA 4EO4A 3BY7A 3QSUA 4G85A 4PJOB 3NELA 3V7RA 2Q5HA 4CS3A 3LSQA 4XTXA 4YRLA 1PYSA 4UPAA 4TVWA 2ZIOA 4M77C 4M77E 1HC7A 1I4K1 3BJUA 4XTZA 4C92A 4M77G 3V7SA 2ZIMA 3NEMA 3V8LA 3BDUA 3V8KA 3HFZB 1G5HA 2RHQA 4TWAA 3LC0A 3QO8A 5LJ5j 5K1PA 5LJ3e 1NYRA 3JB9I 3HFOA 5GAN4 2ZT5A 3SB2A 1PYSB 2C7IA 2ZT8A 4YRSA 3HFVA 3L1AA 4K86A 4C92B 2VC8A 1BIBA 1N9SA 2RHQB 2EWNA 3HXVA 4WI1A 5E3IA 4WJ4A 5GAOp 2AMCA 3VBBA 3UGTA 4O2DA 2HNIA 3ICAA 4M78D 3RESA 3BFMA 3JB9F 1YGBA 1HK9A 3KFUA 4F7UG 5GMKi 4YCUA 4C8QF 3JCMf 3RKYA 1YFSA 1MGQA 2CJAA 4YRTA 4M75A 4P73C 4HT8A 4UP9A 2AMCB 4KR3A 2Q5IA 4M7AD 3UH0A 4MMLA 3AHUA 1B70B 5GAMj 3L4GA 3SWNA 1J5WA 3A7UA 3RACA 1Y96A 1D3BA 4MMKA 3IALA 2ZXFA 3HRIA 4P71A 2E3CA 3A5ZA 1NJ5A 4JRKA 5C52B 1QF6A 4M7DD 1SERA 3CMQA 4M75C 3JB9J 4M75E 1H4SA 2RB6A 5DY9A 1YCYA 1B7YA 3QO7A 4H2XB 5LJ3f 3JCMV 3L4GB 4Q6GA 3SWNB 3IKMB 1Y96B 3SWNC 1NJ2A 4PHCA 2YLCA 2PMEA 5HGQA 5C51B 4EMKC 1QE0A 4TTVA 3MF2A 5GANe 3JCMc 2ZINA 4YRNA 5LJ5f 2I4NA 3OD1A 4NL3A 1B7YB 3TEGA 4HT9A 1G51A 1TH7A 1NJ1A 4N0AA 1JRIA 1HTTA 4M77F 3TUPA 4YPFA 4X9DA 5F5WA 4YCWA 1E22A 5GMKj 4J6XA 3IKLA 4CH5A 4HWPA 2DTOA 1LOJA 2XGTA 2RD1A 4P3NA 4XTYA 2QHSA 4PJOA 3HTZA 4TVYA 4M78A 1KMMA 1LJOA 5GMKe 4KR2A 2E1HA 2XTIA 4RCBA 2AKWA 4X5OA 4YRGA 3JCMJ 3HXZA 3QO5A 2I4MA 2RA2A 2DXUA 2J3MA 4TQFA 4M7AA 2DEQA 4ZTUB 1ASYA 2RM4A 4PJOC 4M78B 4PJOE 4F7UF 2YLBA 3JB9D 3TEHA 4K87A 1EVLA 2AKWB 3JCMh 4C8QD 2DU5A 5GAOn 4YRJA 4H2TA 4CS2A 2J3LA 5GANf 4M7DA 3INZA 4M7AB 4YP0A 2CJBA 1I5LA 5K1XA 2Q7HA 3RKXA 4EMHA 4H2YA 3HXXA 4H02A 2ARTA 3RGLA 3TEHB 3PCOA 2E5AA 5LJ5e 3A31A 4C92C 4WF2A 4C92E 1NJ6A 4M7DB 3MF1A 2DU7A 3L2ZA 5ELOA 1SESA 2ZT7A 2ARSA 3A7RA 1I8FA 3QUIA 4C92G 4JRIA 5LJ3h 2DDZA 4HVCA 2EJ9A 1EFWA 3FIFA 1B70A 2EAYA 2FYKA 2I4OA 5LJ3g 3PCOB 1NYQA 3HY0A 2DTHA 4G84A 4JLIA 3JCMW 1USYA 4YRMA 2RHSB 1W66A 3JCMd 3A74A 1KQ1A 1ASZA 4P75A 4H2XA 4F7UB 1BBWA 1EVKA 3VQVA 5GAN8 1I81A 4M77D 3I7FA 3P8VA 4V2SA 4P3PA 5GAOm 1YB3A 1U1SA 3HFNA 2PMFA 4YRCA 4NCXA 3QNEA 2ODRC 3HXWA 4XEOA 2ZGWA 4RCCA 4X9CA 4H2VA 5GAMe 2ZNIA 4J15A 4M75G 2C8MA 1H4QA 4XTUA 2Q7EA 3RKWA 4RQFA 4P72A 5LJ3d 2EJGA 4PG3A 4C8QA 2IY5A 3RUXA 1G5IA 4DQ2A 5GAOr 1SRYA 4P71C 2JN0A 2DVEA 3JCMQ 4KQEA 1M5Q1 5GMKm 5GAOl 1EOVA 4OLFA 1X2HA 3A7AA 2DQ0A 1EQRA 2E41A 4HWRA 4DPGA 3W3SA 3RIRA 4NL2A 4XEMA 4L87A 4TVAB 2ZCEA 2ALYA 4H2UA 4C8QB 2DZ9A 2IY5B 4P72C 4UP7A 4YRQA 5GANh 2ZZGA 4E51A 3JCMX 3R07A 4J6WA 3M4PA 1HXDA 1YFTA 5GANg 1WNLA 1VQZA 3LSSA 1KMNA 4EX5A 4JUVA 5GMKl 2ALYB 1KOGA 4N0AC 3E9HA 2CJ9A 1Z7NA 4BW9A 4XQ3A 5CAIA 1GGMA 4YDQA 4C92F 4P74A 3PGGA 4M75D 3HRKA 4EMGA 1ATIA 5GAMf 1IL2A 2EL9A 4M78C 4M77A 4M78E 5GMKh 4YRFA 4PJOG 1NJ8A 1H4TA 1WQWA 3VQYA 3ERRA 4OP0A 1B8AA 4M78G 2Y90A 3RL6A 1B34A 3V8JA 5I21A 4HWTA 3QO3A 2P0LA 4QVDA 2DQ3A 3VQWA 12ASA 3JCMg 4P74C 4P3OA 4CS4A 2DJZA 2ZTGA 5GANd 4M7AC 4M7AE 2G4CA 2CIMA 1SETA 4M77B 4YREA 1C0AA 1H4VB 4ZTZB 4A54A 4M7AG 1X56A 5LJ3j 4RQEA 1E24A 2ZZEA 3HSBA 3UGQA 4NOYA 1B34B 1WLEA 2QTXA 3M4QA 1U1TA 5GAOq 4YRPA 2ARUA 2RHSA 2ZNJA 2ZR3A 3A5YA 4M75F 4M7DC 4M7DE 4YRRA 2K57A 1LYLA 4H2WA 5GAN2 1EIYA 1N9WA 1WPYA 1LNXA 4F7UA 4M7DG 1RIQA 2E10A 2FB7A 2YHTA 3QHSA 2DXTA 2DKGA 5LJ5h 3M4GA 2I2LA 5GAN3 3P8YA 4P73A 3WQZA 1M8VA 3E9IA 4ZIBA 1X54A 1EIYB 5LJ5g 4AH6A 4PJOD 3JB9H 5GAN5 4J6YA 3NETA 4XU0A 4F7UE 3NENA 1NNHA 1L0WA 3HY1A 2ZT6A 4YRKA 3RERA 2DTIA 2DZCA 4CH3A 2QHUA 4HWOA 3HXYA 4PNOA 1E1TA 1BIAA 2QHTA 1USYC 3BW1A 5GAN7 1N9RA 1X01A 2P5IA 3P8TA 4P75C 1ADYA 3RF1A 1E1OA 3G1ZA 1WQ7A 2E65A 3VQXA 4TVAA 4EMKA 4QVCA 1JBMA 3JCMb 3PZCA 4C92D 2Q7GA 1JJCA 4M75B 2VXFA 5GAMh 3GIBA 3FJPA 4Y91A 1FYFA 4XU1A 5GANj 5LJ5d 4PJOF
chains in the Genus database with same CATH superfamily
1LCKA 4FU6A 3OBYA 2X4YA 2FZGB 4CH4A 2PZ1A 4A4HA 3OA6A 2HKQB 2J06A 1KQ2A 3OB9A 1OI1A 3OYIA 4J5YA 2LCLA 4A53A 4C8QE 2F5KA 3LLRA 3E9GA 2X9HA 3MP6A 5A2QE 2CSQA 2LDMA 3OYLA 1K0XA 1Z7MA 2KK4A 4A4KA 1S72Q 2KYBA 1WU7A 3CCUA 1WYDA 4YCVA 2EJFA 2KI7A 3CPFA 1WXUA 3DB4A 2AK5A 4YRIA 3EH2A 3A32A 2COZA 2W0ZA 4M7DF 5KYXA 2BE9B 2A3LA 2KE9A 3PTAA 5HY6A 4RDXA 1OQKA 4FL6A 1K8AR 2L3QA 3CCMA 3CC2Q 1EX4A 1RAHB 3MKDA 4K88A 1AZGB 3CCRQ 4XTWA 3CCEA 3FB9A 4HVUA 3CD6T 2ZZFA 3CCVQ 1NM7A 3REUA 1TTHB 3HFZA 5IXBA 2DX1A 2BZXA 2CP5A 2DF6A 2M16A 2DL3A 1VQLA 4BB7A 4XTXA 1FMKA 1Q7YC 2JMAA 4UPAA 2K7AA 4TVWA 1V1CA 2O4XB 1BK2A 1PNJA 3JAME 1NJIU 2K3BA 3V7SA 1AOJA 2FPFA 2X3WD 1VQMQ 1G5HA 2RHQA 2FHDA 3LC0A 4TWAA 5LJ5j 1OYXA 2DIGA 4BY6C 3OS5A 3SB2A 1VQOA 4K86A 4C92B 2LJ3A 2DD4A 1GXIE 1N9SA 2H3EB 1G3YA 3VJPA 4WI1A 4WJ4A 3H41A 4C0GA 3L2VA 2RF0A 4O2DA 2IG0A 3ICAA 3VKIA 1D0YA 3OYDA 3M59A 4PFPA 1Q7YR 3M9QA 5GMKi 1TU0B 4B9XA 4KULA 2QEXQ 1G2BA 4WCIA 1MGQA 3J81E 2EIFA 4RMOA 2YXYA 2HL3A 2AMCB 2KT8A 4MMLA 2JTEA 4C5EA 1BCOA 1VQNQ 2PVDB 3M58A 2L2PA 3O5ZA 3L4GA 1RLPC 2GTJA 1X2QA 3OYKA 3I5SA 4A4FA 5HK0A 1YHQA 5FU7B 1ZUYA 4P71A 5C6SA 5FROA 4M7DD 1WYXA 4M75C 4AMCA 3JB9J 3CCET 1B7YA 1C0MA 3QO7A 3SWNB 4ELYC 1PCXA 3LWHA 1UB4A 2PMEA 4ZN3A 4PHCA 2YLCA 2MAMA 2KRMA 1IXDA 2XMFA 4TTVA 4BI8B 1R8OB 1C6VX 2D1XA 3JCMc 1K73U 1ZSZB 2O31A 5CKEA 3WXMB 4D8KA 1VQ8A 2QQ9A 2CDTA 3TEGA 2RN8A 3PT9A 1VYVA 1NJ1A 2JM8A 2P0PA 1UECA 1HTTA 1K8AU 5KYUB 2QK0A 4YPFA 1U8RA 3NPFA 3EHRA 5F5WA 5GMKj 4J6XA 1YN8A 2EYZA 2DXCA 1LOJA 1VQOT 4DBRA 1GRIA 4PJOA 1G5VA 1Q81U 3CBPA 3HTZA 1T3SA 2GNCA 4TVYA 2L3SA 2M0OA 4MZTA 1LJOA 2CH4A 3M54A 2E1HA 2HD0A 4HKEA 4HCCA 2OAUA 2AKWA 4BD3A 2O01E 4B6MA 3HXZA 3QO5A 2HEQA 4FYWB 4ZTUB 3I56T 1ASYA 1JJ2A 2A0FB 2M51A 1SRMA 2QA4T 3TCJA 1MHNA 4K87A 4Z02A 1YIJQ 2MI6A 1S72A 5CKHA 1UFFA 4H2TA 3SEMA 2PVOB 3EG0A 4M7DA 5I2SA 1BKBA 2XI9A 2K9GA 3GF5A 3CMEA 5KYNA 4EMHA 2NUZA 3OYCA 2DL8A 2HSEB 3MEWA 3VRZA 2FEIA 3HXXA 3RGLA 1M9SA 2E6ZA 2CS7A 4ZGDB 2AZSA 4C92C 4WF2A 3CCRA 1VQ5A 1NJ6A 1QP2A 2MIOA 3J7AF 2HBPA 3CCVA 3QUIA 4C92G 1YNZA 2DDZA 2EJ9A 2LQ8A 3HL8A 2HAXA 2ZPIB 2GFUA 4CC2A 1G3SA 2I4OA 2HKNA 5L23A 1VQ8T 1NYQA 2YUPA 2HMAA 1UEBA 1IRXA 3JCMW 3QWYA 3A74A 5KYYA 1ASZA 1OU9A 4JZ3A 2HSPA 1EVKA 2L89A 2DYBA 4Y28E 1AD5A 2PMFA 3X24B 3QNEA 2QGGA 2ODRC 3HXWA 3VV0A 3ZBDA 2ZGWA 5FU7C 1GCQC 3G1JA 4FM4B 1YJ9Q 4J15A 1ZBJA 3FDRA 3QDRB 2A8EA 1EZZB 2M0YA 4J83A 1PHTA 3RKWA 4FT4A 1TUCA 1QVFP 2EJGA 2DBKA 3CCSA 3FJ5A 1WI7A 2E12A 4E7KA 3R6OA 4DQ2A 3JCMQ 4KQEA 2E3IA 2FPDA 5GAOl 1ZSZC 4OLFA 3RBBB 2E41A 3OYGA 4DPGA 1WHHA 2ZCEA 2ALYA 4H2UA 4EPCA 4OGCA 2AT1B 3HRUA 2EFIA 1N6AA 3EGXA 2NLUA 1KQSA 1D09B 3JCMX 2ZZDA 3R07A 1VQPQ 3DKMA 5FWCA 3CC2T 3M55A 3CCRT 1OX8A 7AT1B 5KYWA 2XG8D 3CCVT 1KOGA 4DBFA 1Z7NA 2JUFA 2GQVA 3QXEB 1P92A 2ZPEB 4J9DA 3HRKA 3KUFA 4J9GA 1F1BB 2EYXA 1ATIA 1X6BA 1MMAA 4BDZA 5KE3A 1OOTA 1RAAB 1WQWA 1VQMT 1SEMA 4OP0A 1W2BS 1WHKA 3RL6A 1YITT 4QQGA 1VIEA 3QPHA 4AG1C 1AHJB 4BE2A 2DPPB 1RACB 4KGZB 3H9NA 3VQWA 3JRZA 4P3OA 4CS4A 2RJCA 4KBMB 1QP3A 1YWOA 2G4CA 2EYWA 2Y4YA 2CIMA 1IB8A 4M77B 4YREA 1H4VB 4FSSA 4A54A 4LUEA 1PM3A 2LT4A 3UT1A 3M4QA 2V1RA 3C0CA 2AIRB 4YRPA 2RHSA 2ZR3A 3HKSA 2LRQA 1AVZC 3EG9A 4M7DE 4HVVA 5IN1A 2CP7A 5GAN2 4KRTA 1LNXA 2X4XA 2VGNA 2FZKB 3CXCP 4AG2C 2QEXT 4XK8E 3QHSA 1SHGA 2KEAA 1PD0A 1VQ4Q 4KGXB 2E5KA 2DKGA 5LJ5h 1OZ3A 4RUGA 1YIJA 4KUIA 1VQNT 5IH2A 1M8VA 4ATOA 3E9IA 3PE0A 1AWJA 4WTOB 1EIYB 2CP3A 2K4YA 1JXOA 4Q5WA 2ROTA 1K76A 4XU0A 5FU6B 2ZT6A 2XU8A 2B8AA 1KD1C 2DZCA 4CH3A 3GNGA 2JVVA 2DE0X 4D8DA 2BKDN 2OTLA 1AT1B 3BW1A 1T3LA 5GAN7 1D1BA 4TVAA 2K79A 3JCMb 2ZCFB 4XU1A 2WACA 3LGLA 4QVZA 1ZBXA 2LQKA 1KHCA 3PMIA 1SRLA 1WZOA 4HWSA 1VQKA 11ASA 4EMKB 4FIBA 2P4TA 1QVFS 3CC7Q 3JB9G 2KAFA 3A8LB 3VS5A 1MMNA 1M90C 1H641 1K9MU 1B76A 1M1FA 1JJCB 2DYIA 2XDBA 4IUVA 4CH6A 2RQVA 5CIUA 4YYEA 1YJ9A 5CR2A 4M7AF 5ELNA 1WJQA 4AFZC 2L8DA 3OY9A 2QQSA 1X2GA 2ED0A 4E6RA 1X43A 2KXDA 2DLPA 5IHIA 4LUDA 4E2FB 2HBWA 1M3CA 5KH6A 4FSXA 3WVEB 1MV3A 4XU3A 1YIJT 2JTFA 3HXUA 1VYTA 3CCJA 3V7CA 1GCPA 4JS4A 1ZUKA 3MEYA 5I2MA 4E7JA 4Q15A 4LDVA 5KNNA 3Q1JA 3PVLA 3QSUA 1JJ2P 4PJOB 3NELA 2Q5HA 4CS3A 1U06A 3NTKA 4GBQA 1VQ7Q 3CCLQ 4YRLA 2ZIOA 1TSFA 4M77C 1HC7A 4BACA 2F2WA 2QA4Q 3H0FA 4XTZA 3BJUA 1G8XA 4M77G 4RTUA 2XHCA 1G3TA 2K5FA 3V8KA 3L2WA 1UGQB 5D7UA 4A4EA 4BY6B 3QO8A 2W10A 2O9SA 4LD6A 1RI0A 3HFOA 5GAN4 4RTTA 1PYSB 4LVLA 2MWOA 2JW4A 1NJIR 4PL6A 2D8JA 1RAEB 2ZT8A 3SHWA 3L1AA 4PJLA 3PMTA 1BIBA 5HK3A 3CPWA 3QYGB 2CREA 1H3HA 3VS3A 2F1LA 2CH4W 3UWNA 5GAOp 3LH0A 3I55Q 3VBBA 2RH2A 4D6WA 2A28A 4J9HA 2A36A 3CXCS 1YGBA 1N8RU 3VRYA 2DJQA 4F7UG 2EVRA 3CQTA 5FU6C 3CBOA 4YCUA 3I35A 4PJNA 1B07A 4AFSC 3RKYA 4X1VA 1PKTA 2CJAA 4P73C 1RUWA 3UA7A 4HT8A 4KR3A 1WHMA 4M7AD 1SSFA 1VOMA 3X25B 4PJMA 2BIVA 1HD3A 4LVIA 2GCXA 1WFWA 3A7UA 3RACA 1D3BA 2RMOA 2RI3A 1Z9ZA 3HRIA 2VGMA 2G3RA 3J80E 1QF6A 1KD1U 4PKCC 4F17A 1SERA 3CMQA 4OGEA 2RNAA 2RB6A 5DY9A 5A0DA 4TVRA 3JCMV 1Q82U 1HSQA 3IKMB 1Y96B 3QJYA 3SFMA 2FZCB 1NJ2A 1VQPT 1M30A 4EMKC 1QE0A 3MF2A 4OB1B 3MEAA 1R77A 1Q81C 2QAZA 2RHZA 3A5ZB 4YRNA 2AZVA 2I4NA 1NZ9A 1WIEA 5L8RE 1TH7A 4F04B 1YFNA 2VUBA 2YUOA 1VQ6Q 3TUPA 4X9DA 2IIMA 2KXCA 2LMJA 2IVWA 1NLOC 2NUPB 1K73R 1E22A 3I5RA 4YCWA 3EGDB 4CH5A 1KK7A 2DTOA 1D1AA 1VIFA 3OYAA 1BI0A 3ASKA 1M90U 2WSCE 3DLMA 5I11A 1Q86C 2X51A 1W70A 1Z9QA 2HQHA 2D0NA 1BYMA 2Z0WA 2F69A 2RPNA 2XDPA 9ATCB 3CC7A 3JCMJ 1Q81R 3OSVA 4M7AA 2RM4A 4PJOC 4M78B 4E7HA 4Z8AA 1GBQA 1EVLA 4P5NA 1PKSA 3OMGA 3VS4A 2DU5A 5GAOn 4E7LA 4YRJA 2KROA 3FLGA 3I9QA 2JM9A 1Y0MA 1WHJA 2L3RA 1YBYA 3INZA 3VS2A 1YITQ 2FL7A 1SG5A 1QWEA 2CJBA 2DO3A 1JJ2S 1VQ4T 2RQRA 3ZEHA 2LC4A 2ARTA 3TEHB 2XDDA 3MP8A 2FO0A 3E9FA 2E5AA 4MDWA 2QQRA 5EC7A 3MF1A 2DU7A 3L2ZA 3EG1A 1SESA 2ZT7A 3OYYA 4OMPA 2PVGB 4JRIA 4HVCA 1O75A 1UE9A 3FIFA 2DM1A 1B70A 4CRIA 1SHFA 4Y92A 2FYKA 2AHJB 1VQ7A 3CCLA 3PCOB 3I56A 3TSZA 2QA4A 1JO8A 4AFQC 4YRMA 2SEMA 2RHSB 2ZPFB 4O5VA 3EG9B 2K2MA 3PIOA 1AZEA 4H2XA 3MEUA 1QKXA 4FW2A 3E1SA 5GAN8 1I81A 3QYHB 4V2SA 5HKCA 1YB3A 1U1SA 1ABQA 4YRCA 1X6OA 2DRMA 2YRCA 4H2VA 3X26B 1O9SA 2QG9B 1AWOA 2ZNIA 2EQUA 2P0QA 1FYNA 1UJYA 3QKJA 3G71Q 3P8BB 4M75G 3I55A 3CC7T 3QG1A 2KSSA 1B7TA 1EFNA 1QW1A 3NGPA 2NYSA 4PG3A 2IY5A 4JJDA 4J9EA 3KFVA 1G5IA 4C5GA 5GAOr 2JN0A 3OMCA 5KCOA 1E7OA 2E3HA 2EQKA 3ME9A 5CVIA 1M2VA 1ACMB 3HTRA 2CZ6B 4TVAB 1Y57A 4C8QB 3VS6A 3RNJA 4UP7A 4YRQA 3G4SQ 4EDUA 2X4WA 4E47A 4J6WA 5IHKA 3H0IA 3CMAQ 2X4JA 3DLLA 1W2BP 4DOWA 4N0AC 4VUBA 3MHXA 2CJ9A 4XQ3A 2GTOA 1GGMA 1UG1A 1YJNQ 4YDQA 4RKUE 4C92F 1KQSS 3PGGA 1G3WA 1VQ7T 4M75D 1H8KA 2HCKA 3CCLT 4EMGA 1KFZA 1IGQA 2EGEA 2MCNA 4LD9K 3OW2P 2EL9A 4M78C 4AFUC 4YRFA 3CCQQ 1QCNA 3VQYA 4E7SA 1Q86U 4M78G 4IIOA 5CO7A 2KMTA 3EFOB 3V8JA 3QO3A 2CKKA 2J6KA 4ZNXA 1OPLA 5AYFA 2BZYA 2BZ8A 4M7AE 2HL5C 2KY9A 2MK5A 2XD0A 3BDLA 4F14A 3FRNA 1E24A 2LX7A 3CC2A 3I55T 1B34B 1KSWA 1WHGA 5GAOq 2L5QA 2ARUA 2ZNJA 5D6YA 3QBYA 2LTOA 2DL4A 3A8MB 2K57A 1WXBA 2V8JA 4H2WA 1NPPA 1RIQA 2B86A 3EAEA 2YHTA 2YRVA 2EQJA 4LVMA 1XJWB 2DXTA 1QCFA 8ATCB 4RTXA 4LN2A 2VASA 3M4GA 2I2LA 5GAN3 3X28B 3THKA 1E6HA 2XICA 4CC3A 1VQMA 2JOYA 3A1PA 3VS0A 3OYEA 3EGUA 1T0JA 2J6FA 1YITA 3N5BB 3MJXA 2LT1A 1S1NA 4F7UE 4GLKA 1NNHA 1L0WA 3HY1A 2CT4A 4F16A 1BB9A 2DTIA 3FEOA 2NUTB 3PVQA 2K5IA 4DA4A 3UF4A 2RK2A 2F5TX 1E1TA 2QHTA 1YI2T 2XIDA 1USYC 4R55A 1N9RA 1X01A 1JB0E 4P75C 4IUPA 2C0TA 1E1OA 3P8DA 1BI3A 2E65A 1K9MC 3TSWA 4E7ZA 1JBMA 4C92D 1LVKA 1FMVA 1OULA 3SD4A 2RQWA 5DLOA 2QEXA 2RHYA 2XK0A 1VQ6T 3O8VA 4J7IA 5AT1B 5M9OA 2RJEA 2MYSA 3QTCA 1VQNA 1H3ZA 2X3XD 5GAN6 1X55A 2BTTA 1D3BB 3UA6A 4JLGA 4C8QC 1M27C 4XU2A 3UFGA 2FPEA 2YWWA 3EFSA 4FT2A 4C8QG 3QWXX 4YROA 2V1QA 2QQBA 2JTMA 3HRTA 2MPXC 3EFRA 5CKDA 2FRWA 2QHVA 3VU3C 4BWAA 1UTIA 3S3MA 1K9MR 5GJWB 3OYBA 2ODRD 1UDLA 4ORZA 4Z89A 1I1JA 4XTVA 4N4IA 2ZR2A 4JJNK 1I07A 1X75C 1A0NB 1QQJA 4C5IA 8AT1B 3OQ5A 1YFRA 4H2SA 2O4XA 2CUBA 4LDUA 3VYGA 3JCMe 2YSQA 1ADJA 5FWBA 4TQDA 3G4SA 3BY7A 5KYXB 3OYFA 1NEBA 3V7RA 3LSQA 4FYXB 2DMOA 1AEYA 4HVWA 2CZ0B 1JEGA 1UHCA 3OW2S 3CMAA 3S3NA 2GBQA 2LZ6B 4K11A 3ZL7C 4DBQA 4ZGEB 3RMQA 1QKWA 4C92A 3PIPA 1TUDA 1TUGB 2ZIMA 4FW1A 3URGA 3NEMA 4KH0B 3V8LA 1B3QA 1YJNA 3HFZB 2DERA 1N8RC 5LJ3e 3JB9I 3H8ZA 2ZT5A 2WSEE 3MO8A 2ENMA 2C7IA 4FYVB 3LW5E 5CQXA 3HFVA 4ELZC 4JZ4A 2P4RA 3MCAB 1PG5B 5ECAA 2RHQB 2AMCA 2DK3A 2OX7A 3GLXA 3HP9A 1WHLA 1PRLC 1VQ9Q 3C12A 4LE9A 3RESA 1ZSGA 3JB9F 3F70A 3KFUA 2YT6A 3G71T 2R58A 4LVJA 1X2KA 4UP9A 1Q82C 4C0ZA 5CQYA 1PC0A 2JMCA 1KC8U 1N8RR 3LX7A 1B70B 3M0TA 3SWNA 1J5WA 2WSFE 5IAYA 4RTVA 3IALA 2GFAA 2E3CA 5FRMA 1NJ5A 1M1KC 5C52B 2C0OA 2DFUA 1ZSZA 2YUQA 4M75E 3OS0A 1ZA1B 1TXQA 4LXCA 1RAFB 3L2RA 2D6FA 4H2XB 3L4GB 4Q6GA 3G4ST 2JJ9A 3CCUQ 2EYQA 3EG3A 4J9IA 5KE2A 3M57A 5KYUA 4ZTJA 1KD1R 1PWTA 5GANe 2K3YA 2JS0A 3CMAT 3TU4K 5FW9A 2BE7D 3OD1A 2V8KA 1B7YB 1Q82R 1G51A 4KGVB 4II1A 4B9WA 5DM7R 1UGPB 2DVJA 3CCMQ 5GJVB 1TG0A 1YJNT 1JRIA 4M77F 1ZHIA 1RL2A 3IKLA 2KRSA 4R0KA 2LCCA 1M1KR 3CCQT 3UPUA 2QHSA 2KDSA 1VQLQ 4HCZA 3PNWC 2E5QA 1M2VB 2EGCA 5GMKe 2R57A 4KR2A 2RK1A 2RHUA 3C4SA 4RCBA 1RADB 1ARKA 4L59A 2FG0A 1H92A 2RI2A 4X5OA 4YRGA 2CZ7B 1D0ZA 1M90R 2I4MA 3M5AA 2DXBA 2RA2A 4LNPA 1I5OB 4IKFA 1RI9A 3S3OA 1VQPA 2DEQA 4F7UF 3JB9D 4OF1A 2KRNA 4PLIA 3LWIA 2AKWB 3IQLA 2LP5A 1IHVA 1UGRB 3OYJA 2LJ1A 2CP6A 2MMPA 2J3LA 3QZ5B 4YP0A 1KHIA 3LH5A 2QYZA 1I5LA 2Q7HA 1WLPB 3RKXA 1OPKA 2EW3A 4H02A 1QWFA 4ANJA 2QTVA 1QVGA 1N27A 3GOXA 3C95A 4KH1B 2ZAEA 1RABB 4PFZA 4C92E 4M7DB 4ME7A 2OAWA 2A08A 1EFWA 1QCOA 1FX7A 2IPOB 1M2OA 2EAYA 2EKOA 2A37A 5LJ3g 1YHQQ 4IUUA 1OX9A 1R0BG 2DTHA 3HY0A 3NFCA 2SRCA 4G84A 2VYTA 3L42A 1RLQC 1NYFA 1PRMC 3U23A 3JCMd 4JRPA 2FVUA 4QT7A 1E6GA 5J3BA 4M77D 3VQVA 4P3PA 1T0HA 5LJ5d 3HFNA 2P0KA 4NCXA 1VQ4A 2O88A 4XEOA 2Y4XA 4X9CA 2D9TA 5GAMe 2ECZA 1SKUB 2QDYB 2VKNA 1MMDA 5KYYB 1GFDA 5FLXE 2CUDA 4J7FA 2C8MA 1YI2Q 4OMQA 2Q7EA 1VQ9A 2V8IA 4RQFA 4P72A 2DILA 5LJ3d 2QASA 1QVFA 2DAQA 2OTJQ 1SRYA 4P71C 2K5LA 2DVEA 5GMKm 1BU1A 1VA7A 3UATA 1EOVA 3LYIA 3CC4Q 1M1KU 1EQRA 2DQ0A 4HWRA 3W3SA 3RIRA 4XEMA 3S6WA 2PQWA 1WA7A 3E2UA 3VUBA 1W6XA 1KQSP 1ZA2B 4BUGA 2J05A 2RQTA 2QQAA 2ESWA 1XQHA 3M4PA 1HXDA 4N4GA 1YFTA 1TS9A 5GANg 1WNLA 4BI3A 1KMNA 3C94A 2YDLA 1BI1A 2DETA 1PSEA 4EX5A 4JUVA 2ALYB 3E9HA 3GPLA 2X35A 1Y07A 1NYGA 2LJ0A 3VYHB 3FC3A 4BW9A 3EGXB 4P74A 1MMGA 2DBMA 3CMEQ 1I0CA 4MZMA 3NMZC 3G7ZA 4C0DC 5KYWB 4M77A 4KT0E 4PJOG 1NJ8A 4IURA 1H4TA 4OVAA 3ERRA 4GY5A 1B8AA 2Y90A 4JDSA 2MWPA 1VQ5Q 1V29B 4HWTA 2P0LA 4CI0C 2RHIA 12ASA 2QI2A 1SPKA 5GANd 2ZTGA 3M0UA 2E4HA 1WXTA 1Q86R 1C0AA 1CSKA 2J6OA 4ZTZB 4PJJA 1HYOA 5I22A 5LJ3j 2E70A 4NOYA 2QTXA 2EQIA 3ULRB 5EG2A 2L3PA 1VQ9T 5IHNA 3A5YA 4M75F 4M7DC 4YRRA 1EIYA 3M56A 1N9WA 1RAIB 1WPYA 4F7UA 1U5SA 4M7DG 5D6XA 2E10A 1YWPA 2FB7A 3CXCA 1UUEA 2E6NA 2ZPBB 4M4ZA 4P73A 3WQZA 2OI3A 5A0GA 4OMOA 4ZIBA 3KXTA 2K6DA 4PJOD 5GAN5 1ZX6A 3NETA 4R56A 2EGAA 2KQWA 2KBTA 2EQMA 3CCSQ 3RERA 1GL5A 3P8HA 3GBQA 2O9VA 4HXJA 3HRSA 3HXYA 4BDYA 2R5MA 4PNOA 1UJ0A 1Y71A 2HZYA 3CCUT 1ZQ1A 1K4US 2HDAA 2P5IA 1ABOA 1ADYA 3RF1A 4OB3B 1FXXA 3G1ZA 1WGSA 4QW2A 4EMKA 4QVCA 4UC4A 3PZCA 6AT1B 1KIKA 4MDXA 1EIFA 3AT1B 1XTDA 2LNVA 1JJCA 1QVPA 2KVQG 2VXFA 1K0SA 1NBEB 3CCMT 3GIBA 3FJPA 4DEXA 4Y91A 1FYFA 5GANj 4HA8A 1TOVA 3REXA 5GAMg 4M78F 5C53B 4RMFA 2RJDA 3GP8A 2VWFA 1K1ZA 1U3OA 1VQLT 2LVMA 3A8GB 4OB2B 2CGHA 3EG2A 2NWMA 2G6FX 3H6ZA 2KR3A 2RO0A 1UGVA 1YI2A 2ATCB 2E64A 4RTYA 2ED1A 3M0SA 4LNSA 4X34A 4QQ6A 3JCMP 2OTJA 1WJRA 1OZ2A 3DSQA 4E7IA 2NS6A 4FCYA 2PUKB 2PNIA 4UP8A 3IG2A 3G6EQ 3CC4A 5GAMd 1SSHA 1BBUA 2M1HA 2VXEA 1VQ6A 2CYZB 3UDCA 4NS5A 3NTIA 4WJ3M 3X20B 4PK4A 4KUDK 1OV3A 2I4LA 4EO4A 4G85A 2DRKA 1FWZA 2GGRA 2CP2A 2D0QB 1PD1A 4O6JA 1YJWQ 1PYSA 2PTKA 4M77E 1I4K1 2CSIA 4HT4A 3GNFB 1AWWA 2YRDA 3M4YA 1MNDA 3BDUA 2O2OA 4GLMA 4BI4A 4JS5A 5K1PA 1DJ7B 2H3JA 1NYRA 3EHQA 1OEBA 5CCAA 1YHQT 3VS1A 1Q95G 1Y7XA 2D8HA 4DEYA 1QVGP 4OMNA 2LNHB 4J9CA 4YRSA 1Q7YU 4OMMA 2VC8A 3CPWP 1KC8C 2K2VA 2OTLQ 2AKLA 2EWNA 3HXVA 5E3IA 2GF7A 5A0LA 4OB0B 3UGTA 3A8OB 2HNIA 4M78D 3REBB 3BFMA 3OYMA 4DBHA 1HK9A 3REAB 2V26A 3LGFA 3MQZA 4C8QF 4ZTFA 2M02A 3JCMf 1YFSA 3BE3A 4YRTA 4M75A 3VS7A 2Q5IA 3OYHA 3UH0A 3AHUA 1KG1A 5GAMj 1VQKQ 4PFOA 2OTJT 1BBZA 1Y96A 4MMKA 3NTHA 2ZXFA 3CC4T 3A5ZA 4JRKA 3E19A 1KC8R 4JPBW 3EH1A 1H4SA 3HPWA 2BUDA 1YCYA 4A4GA 2C06A 3KBGA 3QJ6A 5LJ3f 3META 4OMLA 2CP0A 1GFCA 2OJ2A 1M8MA 3SWNC 5C51B 5HGQA 1X69A 1LPLA 5CK9A 2NUPA 3EGDA 2ZINA 4MZPA 5LJ5f 1MNEA 2L0AA 4HCBA 2F2XA 4NL3A 1S72T 3QDFA 4Z88A 4HT9A 3CCJQ 3G71A 4N0AA 4A63B 1GBRA 3CMET 1X6GA 3M0PA 1RAGB 2JS2A 4CC4B 4HWPA 2XGTA 2RD1A 4P3NA 4XTYA 1JU5C 5IT9E 1OU8A 4YTLA 4M78A 1VQ5T 1KMMA 1QLYA 1X27A 5D6WA 4RTWA 2XTIA 2EYYA 1JQQA 1TWBA 2DNUA 3RR6A 2DXUA 2J3MA 2KNBB 4ZGJB 3CEYA 4RG2A 5DLQE 2YUNA 4TQFA 4PJOE 5CKFA 2YLBA 2P84A 3TEHA 3JCMh 4C8QD 1NEGA 4CS2A 5GANf 3OSSC 2F2VA 4M7AB 1WX6A 3CD6Q 2EKHA 1M3AA 5HCKA 5K1XA 4H2YA 5FRNA 2LQWA 1KJWA 2JXBA 3G6EA 3CCQA 4RTZA 5J39A 3PCOA 5LJ5e 3A31A 3RMSA 4LDXA 5ELOA 2FRYA 2ARSA 3A7RA 1I8FA 1WDXA 3TREA 5LJ3h 3CCST 2KYMA 3A98A 3TEEA 2LCSA 1JXMA 4J9FA 1C1AA 2KGTA 2DL7A 1YJWA 1QVGS 1BCMA 1GCQA 1XOVA 3CPWS 4IUQA 2DIQA 4HCKA 4JLIA 1USYA 2I0NA 1QMCA 4N4HA 2QDLA 5KCHA 1W66A 1KQ1A 1NLPC 2ZPHB 2COYA 4P75A 2JZ2A 5C0MA 2COWA 4F7UB 1BBWA 1J3TA 3SDZA 3RDVA 3I7FA 4C0FA 3P8VA 3DB3A 5GAOm 1M4ZA 1G83A 2DA9A 3R6NA 4BE0A 1VUBA 4J9BA 4RCCA 3OBWA 1AWXA 3TVTA 1H4QA 4XTUA 2EBPA 4C8QA 3RUXA 4ESRA 3MEVA 2M9UA 2RJFA 1BI2A 1M5Q1 3OS2A 3TQ7P 3MP1A 1X2HA 3A7AA 4LDWA 4NL2A 4L87A 3CCEQ 1MV0B 2DZ9A 2IY5B 3D7SB 1ZLMA 4P72C 4J8OA 5GANh 3T9NA 3MPUB 2ZZGA 1IGUA 1NE8A 4E51A 3G6ET 2RI5A 1VQZA 3LSSA 3L2UA 2PUOB 2QXFA 5GMKl 1NPRA 5CKBA 2JNGA 1V76A 1W2BA 3EFOA 5CAIA 2GQIA 2J7IA 4DOVA 2JT4A 1HJDA 1XNIA 3QZ9B 1YJWT 5GAMf 4C0DB 2HQXA 1IL2A 1VQOQ 1W1FA 1NJIC 4IUTA 4M78E 5GMKh 2DD5A 3VUZA 3OW2A 4OMFB 1MUZA 2R5AA 1B34A 5I21A 2DL5A 1IREB 1CKAA 1WJSA 2KT1A 4RG8A 4QVDA 2DQ3A 1IO6A 4CC7A 3M53A 3JCMg 4P74C 2DJZA 1W4SA 4M7AC 2ZPGB 2CT3A 1SETA 3ZFJA 4M7AG 2OTLT 1ZUUA 1X56A 5LL6S 3I56Q 4RQEA 1UHFA 2ZZEA 3HSBA 3UGQA 2HQEA 1WLEA 2EPDA 1FMWA 1U1TA 1VYUA 2K3XA 3QIIA 3WVDB 1NG2A 2AKKA 3M0RA 1YCSB 2VV5A 4PLLA 1D1CA 2ABLA 1LYLA 2CZ1B 4L6V5 3NHNA 1IHWA 4LVKA 4JJBA 3L2QA 2LX9A 3OS1A 1N5ZA 2DEUA 2RHXA 4AT1B 5IXFA 2NUTA 1D0XA 3A8HB 4EIKA 3P8YA 1M1GA 3PFSA 1IZ6A 1VQKT 3CBMA 1X54A 2XKOC 4IIMA 5LJ5g 4AH6A 1M3BA 1YP5A 3JB9H 2A7YA 4ZN1A 2RQUA 3CD6A 4J6YA 2VB6A 3JV3A 3NENA 3H0HA 1PSFA 5J26A 4YRKA 1SF9A 2VVKA 4XAXB 1R0CB 1YJ9T 2QHUA 4HWOA 4JJCA 2LQNA 3OYNA 1BIAA 1VQ8Q 1CKBA 4L5GA 2C0IA 3ER0A 1K9AA 3P8TA 3M0QA 1WQ7A 3JSCA 3VQXA 4JRQA 2ROLA 4QQDA 4QKUA 1K73C 2MOXA 2H8HA 4FYYB 2Q7GA 2PU9B 4BE1A 4C5HA 3HHTB 3CCJT 4M75B 1UGSB 2MF2A 5GAMh 4LDYA 2QGFB 1K8AC 4PJOF
chains in the Genus database with same CATH topology
4FU6A 3OBYA 2X4YA 4CH4A 4A4HA 3OA6A 1KQ2A 3OB9A 1OI1A 3OYIA 4J5YA 2LCLA 4A53A 4C8QE 2F5KA 3LLRA 3E9GA 3MP6A 5A2QE 2LDMA 3OYLA 1Z7MA 2KK4A 4A4KA 1WYDA 1WU7A 3CCUA 4YCVA 2EJFA 3CPFA 3DB4A 4YRIA 3A32A 4M7DF 2A3LA 3PTAA 5HY6A 4RDXA 4FL6A 3CCMA 4K88A 4XTWA 3CCEA 3FB9A 3CD6T 2ZZFA 3REUA 3HFZA 2M16A 1VQLA 4BB7A 4XTXA 1Q7YC 4UPAA 4TVWA 2O4XB 3JAME 1NJIU 3V7SA 1G5HA 2RHQA 2FHDA 3LC0A 4TWAA 5LJ5j 1OYXA 2DIGA 4BY6C 3OS5A 3SB2A 1VQOA 4K86A 4C92B 2DD4A 1GXIE 1N9SA 3VJPA 1G3YA 4WI1A 4WJ4A 4C0GA 3L2VA 4O2DA 2IG0A 3ICAA 3VKIA 3OYDA 3M59A 3M9QA 5GMKi 4B9XA 4KULA 1MGQA 3J81E 2EIFA 4RMOA 2AMCB 4MMLA 4C5EA 2PVDB 3M58A 3L4GA 3OYKA 4A4FA 5HK0A 1YHQA 5FU7B 4P71A 5C6SA 5FROA 4M7DD 4M75C 3JB9J 3CCET 1B7YA 3QO7A 3SWNB 4ELYC 3LWHA 1UB4A 2PMEA 4ZN3A 4PHCA 2YLCA 2MAMA 4TTVA 4BI8B 1R8OB 3JCMc 1K73U 5CKEA 3WXMB 1VQ8A 2QQ9A 3TEGA 3PT9A 1NJ1A 2P0PA 1HTTA 1K8AU 4YPFA 1U8RA 5F5WA 5GMKj 4J6XA 2DXCA 1LOJA 1VQOT 4PJOA 1G5VA 1Q81U 3CBPA 3HTZA 4TVYA 2M0OA 4MZTA 1LJOA 3M54A 2E1HA 2HD0A 4HKEA 4HCCA 2OAUA 2AKWA 4BD3A 2O01E 3HXZA 3QO5A 4ZTUB 3I56T 1ASYA 1JJ2A 2QA4T 3TCJA 1MHNA 4K87A 4Z02A 2MI6A 1S72A 5CKHA 4H2TA 2PVOB 4LDYA 4M7DA 5I2SA 1BKBA 2XI9A 3GF5A 3CMEA 4EMHA 3OYCA 3HXXA 3MEWA 3RGLA 1M9SA 2E6ZA 2CS7A 4ZGDB 4C92C 4WF2A 3CCRA 1VQ5A 1NJ6A 1QP2A 3J7AF 2HBPA 3CCVA 3QUIA 4C92G 2DDZA 2EJ9A 2LQ8A 3HL8A 2HAXA 2ZPIB 2GFUA 1G3SA 2I4OA 1VQ8T 1NYQA 1UEBA 3JCMW 3A74A 1ASZA 1EVKA 2L89A 4Y28E 2PMFA 3X24B 3QNEA 2ODRC 3HXWA 3VV0A 3ZBDA 2ZGWA 5FU7C 4FM4B 4J15A 3FDRA 3QDRB 2A8EA 4J83A 3RKWA 4FT4A 2EJGA 3CCSA 2E12A 4E7KA 3R6OA 4DQ2A 3JCMQ 4KQEA 5GAOl 4OLFA 2E41A 3OYGA 4DPGA 2ZCEA 2ALYA 4H2UA 4EPCA 4OGCA 3HRUA 2EFIA 1N6AA 2NLUA 1KQSA 3JCMX 2ZZDA 3R07A 3DKMA 3CC2T 3M55A 3CCRT 2XG8D 3CCVT 1KOGA 1Z7NA 2JUFA 2GQVA 3QXEB 1P92A 2ZPEB 3HRKA 3KUFA 1ATIA 4BDZA 5KE3A 1WQWA 1VQMT 4OP0A 1W2BS 3RL6A 1YITT 4QQGA 1VIEA 3QPHA 1AHJB 4BE2A 2DPPB 3VQWA 3JRZA 4P3OA 4CS4A 2RJCA 4KBMB 1QP3A 2G4CA 2Y4YA 2CIMA 4M77B 4YREA 1H4VB 4A54A 2LT4A 3UT1A 3M4QA 4YRPA 2RHSA 2ZR3A 3HKSA 2LRQA 4M7DE 5IN1A 5GAN2 1LNXA 2X4XA 2VGNA 2QEXT 4XK8E 3QHSA 2DKGA 5LJ5h 1OZ3A 1YIJA 4KUIA 1VQNT 1M8VA 4ATOA 3E9IA 1EIYB 2K4YA 4Q5WA 4XU0A 5FU6B 2ZT6A 2XU8A 2B8AA 1KD1C 2DZCA 4CH3A 3GNGA 2JVVA 2BKDN 2OTLA 3BW1A 5GAN7 4TVAA 3JCMb 2ZCFB 4XU1A 2WACA 3LGLA 4QVZA 1ZBXA 2LQKA 1KHCA 3PMIA 4HWSA 1VQKA 11ASA 4EMKB 4FIBA 2P4TA 1QVFS 3JB9G 2KAFA 3A8LB 1M90C 1H641 1K9MU 1B76A 1M1FA 1JJCB 2XDBA 4IUVA 4CH6A 5CIUA 4YYEA 1YJ9A 5CR2A 4M7AF 5ELNA 1WJQA 3OY9A 2L8DA 2QQSA 1X2GA 5KH6A 4FSXA 3WVEB 4XU3A 1YIJT 2JTFA 3HXUA 3CCJA 3V7CA 4JS4A 3MEYA 5I2MA 4E7JA 4Q15A 4LDVA 5KNNA 3Q1JA 3QSUA 4PJOB 3NELA 2Q5HA 4CS3A 3NTKA 4YRLA 2ZIOA 4M77C 1HC7A 4BACA 3BJUA 4XTZA 4M77G 2XHCA 1G3TA 2K5FA 3V8KA 3L2WA 1UGQB 4BY6B 4A4EA 3QO8A 4LD6A 1RI0A 3HFOA 5GAN4 1PYSB 4LVLA 2MWOA 4PL6A 2ZT8A 3L1AA 3PMTA 1BIBA 5HK3A 3CPWA 3QYGB 3UWNA 5GAOp 3LH0A 3VBBA 2RH2A 4D6WA 3CXCS 1YGBA 1N8RU 4F7UG 5FU6C 3CBOA 4YCUA 3RKYA 2CJAA 4P73C 4HT8A 4KR3A 4M7AD 1SSFA 3X25B 2BIVA 4LVIA 2GCXA 3A7UA 3RACA 1D3BA 2RI3A 3HRIA 2VGMA 2G3RA 3J80E 1QF6A 1KD1U 4PKCC 1SERA 3CMQA 4OGEA 2RB6A 5DY9A 5A0DA 4TVRA 3JCMV 1Q82U 3IKMB 1Y96B 3QJYA 3SFMA 1NJ2A 1VQPT 4EMKC 1QE0A 3MF2A 3MEAA 4OB1B 1Q81C 2RHZA 3A5ZB 4YRNA 2I4NA 1NZ9A 5L8RE 1TH7A 2VUBA 3TUPA 4X9DA 4YCWA 2IVWA 1E22A 4CH5A 2DTOA 1VIFA 3OYAA 1BI0A 3ASKA 1M90U 2WSCE 3DLMA 1Q86C 1BYMA 2F69A 2XDPA 3CC7A 3JCMJ 3OSVA 4M7AA 2RM4A 4PJOC 4M78B 4E7HA 1EVLA 4P5NA 3OMGA 2DU5A 5GAOn 4E7LA 4YRJA 3FLGA 2L3RA 1YBYA 3INZA 2FL7A 2CJBA 2DO3A 1JJ2S 1VQ4T 3ZEHA 2LC4A 2ARTA 3TEHB 2XDDA 3MP8A 3E9FA 2E5AA 4MDWA 2QQRA 3MF1A 2DU7A 3L2ZA 1SESA 2ZT7A 3OYYA 2PVGB 4JRIA 4HVCA 1O75A 3FIFA 1B70A 4CRIA 2FYKA 2AHJB 1VQ7A 3CCLA 3PCOB 3I56A 2QA4A 4YRMA 2RHSB 2ZPFB 4O5VA 3PIOA 4H2XA 3MEUA 3E1SA 5GAN8 1I81A 3QYHB 4V2SA 5HKCA 1YB3A 1U1SA 4YRCA 1X6OA 4H2VA 3X26B 1O9SA 2ZNIA 2EQUA 2P0QA 3QKJA 3P8BB 4M75G 3I55A 3CC7T 3QG1A 2KSSA 1QW1A 4PG3A 2IY5A 1G5IA 4C5GA 5GAOr 2JN0A 3OMCA 5KCOA 2EQKA 3ME9A 5CVIA 2CZ6B 4TVAB 4C8QB 4UP7A 4YRQA 4EDUA 2X4WA 4E47A 4J6WA 2X4JA 3DLLA 4DOWA 4N0AC 4VUBA 3MHXA 2CJ9A 4XQ3A 1GGMA 4YDQA 4RKUE 4C92F 1KQSS 3PGGA 1G3WA 1VQ7T 4M75D 3CCLT 4EMGA 4LD9K 2EL9A 4M78C 4YRFA 3VQYA 1Q86U 4M78G 5CO7A 2KMTA 3V8JA 3QO3A 2CKKA 5AYFA 4M7AE 2KY9A 2XD0A 3BDLA 3FRNA 1E24A 3CC2A 3I55T 1B34B 5GAOq 2L5QA 2ARUA 2ZNJA 5D6YA 3QBYA 2LTOA 3A8MB 2K57A 2V8JA 4H2WA 1NPPA 1RIQA 3EAEA 2YHTA 2YRVA 2EQJA 4LVMA 2DXTA 3M4GA 2I2LA 5GAN3 3X28B 2XICA 1VQMA 2JOYA 3OYEA 1YITA 3N5BB 2LT1A 4F7UE 4GLKA 1NNHA 1L0WA 3HY1A 2DTIA 3FEOA 2K5IA 4DA4A 2RK2A 2F5TX 1E1TA 2QHTA 1YI2T 2XIDA 1USYC 4R55A 1N9RA 1X01A 1JB0E 4P75C 4IUPA 1E1OA 3P8DA 1BI3A 2E65A 1K9MC 1JBMA 4C92D 3SD4A 5DLOA 2QEXA 2RHYA 2XK0A 1VQ6T 3O8VA 4J7IA 5M9OA 2RJEA 3QTCA 1VQNA 1H3ZA 5GAN6 1X55A 1D3BB 4JLGA 4C8QC 4XU2A 3UFGA 3EFSA 4FT2A 4C8QG 4YROA 2QQBA 2JTMA 3HRTA 3EFRA 5CKDA 2QHVA 3VU3C 4BWAA 3S3MA 3OYBA 2ODRD 4XTVA 4N4IA 2ZR2A 4JJNK 1X75C 4C5IA 3OQ5A 1YFRA 4H2SA 2O4XA 4LDUA 3VYGA 3JCMe 1ADJA 4TQDA 3G4SA 3BY7A 3OYFA 3V7RA 3LSQA 2CZ0B 3OW2S 3CMAA 3S3NA 4ZGEB 3RMQA 4C92A 3PIPA 2ZIMA 3NEMA 3URGA 3V8LA 3HFZB 1YJNA 1N8RC 5LJ3e 3JB9I 3H8ZA 2ZT5A 2WSEE 3MO8A 2C7IA 3LW5E 5CQXA 3HFVA 4ELZC 3MCAB 2RHQB 2AMCA 2DK3A 3GLXA 3HP9A 3C12A 3RESA 3JB9F 3F70A 3KFUA 3G71T 2R58A 4LVJA 4UP9A 1Q82C 4C0ZA 5CQYA 1KC8U 3LX7A 1B70B 3SWNA 1J5WA 2WSFE 5IAYA 3IALA 2GFAA 2E3CA 5FRMA 1NJ5A 1M1KC 5C52B 4M75E 3OS0A 3L2RA 2D6FA 4H2XB 3L4GB 4Q6GA 3G4ST 2EYQA 5KE2A 3M57A 4ZTJA 5GANe 2K3YA 3CMAT 3TU4K 3OD1A 2V8KA 1B7YB 1G51A 5DM7R 4II1A 4B9WA 1UGPB 1YJNT 1JRIA 4M77F 1ZHIA 1RL2A 3IKLA 2LCCA 3CCQT 3UPUA 2QHSA 2KDSA 4HCZA 3PNWC 2E5QA 5GMKe 2R57A 4KR2A 2RK1A 2RHUA 3C4SA 4RCBA 4L59A 2RI2A 4X5OA 4YRGA 2CZ7B 2I4MA 3M5AA 2DXBA 2RA2A 4IKFA 3S3OA 1VQPA 2DEQA 4F7UF 3JB9D 4OF1A 4PLIA 3LWIA 2AKWB 1UGRB 3OYJA 2MMPA 2J3LA 3QZ5B 4YP0A 1KHIA 1I5LA 2Q7HA 3RKXA 4H02A 1QVGA 1N27A 3GOXA 3C95A 4C92E 4M7DB 4ME7A 1EFWA 1FX7A 2EAYA 2EKOA 5LJ3g 4IUUA 3HY0A 2DTHA 3NFCA 4G84A 2VYTA 3L42A 3JCMd 4JRPA 2FVUA 5J3BA 3VQVA 4M77D 4P3PA 3HFNA 2P0KA 4NCXA 1VQ4A 4XEOA 2Y4XA 4X9CA 2D9TA 5GAMe 2QDYB 5FLXE 4J7FA 2C8MA 2Q7EA 1VQ9A 2V8IA 4RQFA 4P72A 5LJ3d 1QVFA 2DAQA 1SRYA 4P71C 2K5LA 2DVEA 5GMKm 1EOVA 3LYIA 1M1KU 1EQRA 2DQ0A 4HWRA 3W3SA 3RIRA 4XEMA 3S6WA 2PQWA 3VUBA 4BUGA 2QQAA 1XQHA 3M4PA 1HXDA 4N4GA 1YFTA 5GANg 1WNLA 4BI3A 1KMNA 3C94A 1BI1A 1PSEA 4EX5A 4JUVA 2ALYB 3E9HA 3GPLA 2X35A 1Y07A 3VYHB 3FC3A 4BW9A 4P74A 4MZMA 3G7ZA 4C0DC 4M77A 4KT0E 4PJOG 1NJ8A 4IURA 1H4TA 4OVAA 3ERRA 4GY5A 1B8AA 2Y90A 4JDSA 2MWPA 1V29B 4HWTA 2P0LA 4CI0C 2RHIA 12ASA 2QI2A 2ZTGA 5GANd 1C0AA 4ZTZB 5LJ3j 2E70A 4NOYA 2QTXA 5EG2A 1VQ9T 3A5YA 4M75F 4M7DC 4YRRA 1EIYA 3M56A 1N9WA 1WPYA 4F7UA 4M7DG 5D6XA 2E10A 2FB7A 3CXCA 2E6NA 2ZPBB 4P73A 3WQZA 5A0GA 4ZIBA 3KXTA 4PJOD 5GAN5 3NETA 4R56A 2KQWA 2EQMA 3RERA 3P8HA 3HRSA 3HXYA 4BDYA 2R5MA 4PNOA 1Y71A 3CCUT 1ZQ1A 2P5IA 1ADYA 3RF1A 4OB3B 1FXXA 3G1ZA 1WGSA 4QW2A 4EMKA 4QVCA 4UC4A 3PZCA 4MDXA 1EIFA 1XTDA 1JJCA 2LNVA 1QVPA 2KVQG 2VXFA 3CCMT 3GIBA 3FJPA 4Y91A 1FYFA 5GANj 4HA8A 3REXA 5GAMg 4M78F 5C53B 4RMFA 2RJDA 3GP8A 1VQLT 2LVMA 3A8GB 4OB2B 2CGHA 3H6ZA 2RO0A 1YI2A 2E64A 4LNSA 4X34A 4QQ6A 3JCMP 2OTJA 1WJRA 1OZ2A 3DSQA 4E7IA 2NS6A 2PUKB 4UP8A 3IG2A 3CC4A 5GAMd 1BBUA 2M1HA 2VXEA 1VQ6A 2CYZB 3UDCA 4NS5A 3NTIA 4WJ3M 3X20B 4KUDK 2I4LA 4EO4A 4G85A 1FWZA 2D0QB 4O6JA 1PYSA 4M77E 1I4K1 4HT4A 3GNFB 3M4YA 3BDUA 4BI4A 4JS5A 5K1PA 1DJ7B 2H3JA 1NYRA 1YHQT 5CCAA 1Y7XA 4YRSA 1Q7YU 2VC8A 1KC8C 2K2VA 2EWNA 3HXVA 5E3IA 2GF7A 5A0LA 4OB0B 3UGTA 3A8OB 2HNIA 4M78D 3BFMA 3OYMA 1HK9A 3LGFA 3MQZA 4C8QF 4ZTFA 3JCMf 1YFSA 4YRTA 4M75A 2Q5IA 3OYHA 3UH0A 3AHUA 1KG1A 5GAMj 2OTJT 1Y96A 4MMKA 3NTHA 2ZXFA 3CC4T 3A5ZA 4JRKA 3E19A 1H4SA 3HPWA 2BUDA 1YCYA 4A4GA 2C06A 3KBGA 3QJ6A 5LJ3f 3META 3SWNC 5C51B 5HGQA 5CK9A 2ZINA 4MZPA 5LJ5f 4HCBA 4NL3A 1S72T 4HT9A 3G71A 4N0AA 3CMET 4HWPA 2XGTA 2RD1A 4P3NA 4XTYA 5IT9E 4YTLA 4M78A 1VQ5T 1KMMA 5D6WA 2XTIA 2DXUA 2J3MA 4ZGJB 3CEYA 4RG2A 5DLQE 4TQFA 4PJOE 5CKFA 2YLBA 3TEHA 3JCMh 4C8QD 4CS2A 5GANf 3OSSC 4M7AB 5K1XA 4H2YA 5FRNA 3G6EA 3CCQA 5J39A 3PCOA 5LJ5e 3A31A 3RMSA 4LDXA 5ELOA 2ARSA 3A7RA 1I8FA 3TREA 5LJ3h 3CCST 3TEEA 1YJWA 1QVGS 1XOVA 3CPWS 4IUQA 2DIQA 4JLIA 1USYA 1W66A 4N4HA 5KCHA 1KQ1A 2ZPHB 4P75A 2JZ2A 5C0MA 4F7UB 1BBWA 3SDZA 3P8VA 3I7FA 4C0FA 3DB3A 5GAOm 1M4ZA 4BE0A 1VUBA 4RCCA 3OBWA 1H4QA 4XTUA 4C8QA 3RUXA 3MEVA 2M9UA 2RJFA 1BI2A 1M5Q1 3OS2A 3MP1A 1X2HA 3A7AA 4LDWA 4NL2A 4L87A 2DZ9A 2IY5B 4P72C 4J8OA 5GANh 3T9NA 2ZZGA 1NE8A 4E51A 3G6ET 2RI5A 1VQZA 3LSSA 3L2UA 2PUOB 2QXFA 5GMKl 1NPRA 5CKBA 2JNGA 1W2BA 5CAIA 4DOVA 1XNIA 3QZ9B 1YJWT 5GAMf 4C0DB 2HQXA 1IL2A 1NJIC 4IUTA 4M78E 5GMKh 2DD5A 3VUZA 3OW2A 4OMFB 2R5AA 1B34A 5I21A 1IREB 1WJSA 4RG8A 4QVDA 2DQ3A 3M53A 3JCMg 4P74C 2DJZA 1W4SA 4M7AC 2ZPGB 1SETA 3ZFJA 4M7AG 2OTLT 1X56A 5LL6S 4RQEA 2ZZEA 3HSBA 3UGQA 2HQEA 1WLEA 1U1TA 2K3XA 3QIIA 3WVDB 2VV5A 4PLLA 1LYLA 2CZ1B 4L6V5 4LVKA 3L2QA 2LX9A 3OS1A 2RHXA 3A8HB 3P8YA 1M1GA 3PFSA 1IZ6A 1VQKT 3CBMA 1X54A 2XKOC 5LJ5g 4AH6A 3JB9H 2A7YA 4ZN1A 3CD6A 4J6YA 3NENA 1PSFA 5J26A 4YRKA 4XAXB 1YJ9T 2QHUA 4HWOA 3OYNA 1BIAA 4L5GA 3ER0A 3P8TA 1WQ7A 3JSCA 3VQXA 4JRQA 4QQDA 1K73C 2Q7GA 2PU9B 4BE1A 4C5HA 3HHTB 3CCJT 4M75B 1UGSB 2MF2A 5GAMh 5LJ5d 1K8AC 4PJOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HA8 A;  3REX A;  3QTC A;  4CH4 A;  5GAM g;  4M78 F;  5C53 B;  4HWS A;  5GAN 6;  4RMF A;  11AS A;  1KQ2 A;  4EMK B;  1X55 A;  1D3B B;  4J5Y A;  4A53 A;  3JB9 G;  4C8Q C;  4C8Q E;  4XU2 A;  3UFG A;  1H64 1;  1B76 A;  1JJC B;  3EFS A;  4C8Q G;  2CGH A;  4CH6 A;  4YRO A;  4YYE A;  1Z7M A;  4M7A F;  3EFR A;  2QHV A;  3VU3 C;  5ELN A;  1WYD A;  1WU7 A;  4BWA A;  4YCV A;  1X2G A;  2EJF A;  2E64 A;  2ODR D;  4LNS A;  4YRI A;  3A32 A;  3JCM P;  4M7D F;  4XTV A;  3DSQ A;  4XU3 A;  4RDX A;  2ZR2 A;  3HXU A;  4UP8 A;  3IG2 A;  5GAM d;  1BBU A;  1YFR A;  4H2S A;  2VXE A;  3V7C A;  4K88 A;  3MEY A;  4XTW A;  3JCM e;  3FB9 A;  1ADJ A;  4Q15 A;  2ZZF A;  5KNN A;  3REU A;  4WJ3 M;  4TQD A;  2I4L A;  3HFZ A;  4EO4 A;  3BY7 A;  3QSU A;  4G85 A;  4PJO B;  3NEL A;  3V7R A;  2Q5H A;  4CS3 A;  3LSQ A;  4XTX A;  4YRL A;  1PYS A;  4UPA A;  4TVW A;  2ZIO A;  4M77 C;  4M77 E;  1HC7 A;  1I4K 1;  3BJU A;  4XTZ A;  4C92 A;  4M77 G;  3V7S A;  2ZIM A;  3NEM A;  3V8L A;  3BDU A;  3V8K A;  3HFZ B;  1G5H A;  2RHQ A;  4TWA A;  3LC0 A;  3QO8 A;  5LJ5 j;  5K1P A;  5LJ3 e;  1NYR A;  3JB9 I;  3HFO A;  5GAN 4;  2ZT5 A;  3SB2 A;  1PYS B;  2C7I A;  2ZT8 A;  4YRS A;  3HFV A;  3L1A A;  4K86 A;  4C92 B;  2VC8 A;  1BIB A;  1N9S A;  2RHQ B;  2EWN A;  3HXV A;  4WI1 A;  5E3I A;  4WJ4 A;  5GAO p;  2AMC A;  3VBB A;  3UGT A;  4O2D A;  2HNI A;  3ICA A;  4M78 D;  3RES A;  3BFM A;  3JB9 F;  1YGB A;  1HK9 A;  3KFU A;  4F7U G;  5GMK i;  4YCU A;  4C8Q F;  3JCM f;  3RKY A;  1YFS A;  1MGQ A;  2CJA A;  4YRT A;  4M75 A;  4P73 C;  4HT8 A;  4UP9 A;  2AMC B;  4KR3 A;  2Q5I A;  4M7A D;  3UH0 A;  4MML A;  3AHU A;  1B70 B;  5GAM j;  3L4G A;  3SWN A;  1J5W A;  3A7U A;  3RAC A;  1Y96 A;  1D3B A;  4MMK A;  3IAL A;  2ZXF A;  3HRI A;  4P71 A;  2E3C A;  3A5Z A;  1NJ5 A;  4JRK A;  5C52 B;  1QF6 A;  4M7D D;  1SER A;  3CMQ A;  4M75 C;  3JB9 J;  4M75 E;  1H4S A;  2RB6 A;  5DY9 A;  1YCY A;  1B7Y A;  3QO7 A;  4H2X B;  5LJ3 f;  3JCM V;  3L4G B;  4Q6G A;  3SWN B;  3IKM B;  1Y96 B;  3SWN C;  1NJ2 A;  4PHC A;  2YLC A;  2PME A;  5HGQ A;  5C51 B;  4EMK C;  1QE0 A;  4TTV A;  3MF2 A;  5GAN e;  3JCM c;  2ZIN A;  4YRN A;  5LJ5 f;  2I4N A;  3OD1 A;  4NL3 A;  1B7Y B;  3TEG A;  4HT9 A;  1G51 A;  1TH7 A;  1NJ1 A;  4N0A A;  1JRI A;  1HTT A;  4M77 F;  3TUP A;  4YPF A;  4X9D A;  5F5W A;  4YCW A;  1E22 A;  5GMK j;  4J6X A;  3IKL A;  4CH5 A;  4HWP A;  2DTO A;  1LOJ A;  2XGT A;  2RD1 A;  4P3N A;  4XTY A;  2QHS A;  4PJO A;  3HTZ A;  4TVY A;  4M78 A;  1KMM A;  1LJO A;  5GMK e;  4KR2 A;  2E1H A;  2XTI A;  4RCB A;  2AKW A;  4X5O A;  4YRG A;  3JCM J;  3HXZ A;  3QO5 A;  2I4M A;  2RA2 A;  2DXU A;  2J3M A;  4TQF A;  4M7A A;  2DEQ A;  4ZTU B;  1ASY A;  2RM4 A;  4PJO C;  4M78 B;  4PJO E;  4F7U F;  2YLB A;  3JB9 D;  3TEH A;  4K87 A;  1EVL A;  2AKW B;  3JCM h;  4C8Q D;  2DU5 A;  5GAO n;  4YRJ A;  4H2T A;  4CS2 A;  2J3L A;  5GAN f;  4M7D A;  3INZ A;  4M7A B;  4YP0 A;  2CJB A;  1I5L A;  5K1X A;  2Q7H A;  3RKX A;  4EMH A;  4H2Y A;  3HXX A;  4H02 A;  2ART A;  3RGL A;  3TEH B;  3PCO A;  2E5A A;  5LJ5 e;  3A31 A;  4C92 C;  4WF2 A;  4C92 E;  1NJ6 A;  4M7D B;  3MF1 A;  2DU7 A;  3L2Z A;  5ELO A;  1SES A;  2ZT7 A;  2ARS A;  3A7R A;  1I8F A;  3QUI A;  4C92 G;  4JRI A;  5LJ3 h;  2DDZ A;  4HVC A;  2EJ9 A;  1EFW A;  3FIF A;  1B70 A;  2EAY A;  2FYK A;  2I4O A;  5LJ3 g;  3PCO B;  1NYQ A;  3HY0 A;  2DTH A;  4G84 A;  4JLI A;  3JCM W;  1USY A;  4YRM A;  2RHS B;  1W66 A;  3JCM d;  3A74 A;  1KQ1 A;  1ASZ A;  4P75 A;  4H2X A;  4F7U B;  1BBW A;  1EVK A;  3VQV A;  5GAN 8;  1I81 A;  4M77 D;  3I7F A;  3P8V A;  4V2S A;  4P3P A;  5GAO m;  1YB3 A;  1U1S A;  3HFN A;  2PMF A;  4YRC A;  4NCX A;  3QNE A;  2ODR C;  3HXW A;  4XEO A;  2ZGW A;  4RCC A;  4X9C A;  4H2V A;  5GAM e;  2ZNI A;  4J15 A;  4M75 G;  2C8M A;  1H4Q A;  4XTU A;  2Q7E A;  3RKW A;  4RQF A;  4P72 A;  5LJ3 d;  2EJG A;  4PG3 A;  4C8Q A;  2IY5 A;  3RUX A;  1G5I A;  4DQ2 A;  5GAO r;  1SRY A;  4P71 C;  2JN0 A;  2DVE A;  3JCM Q;  4KQE A;  1M5Q 1;  5GMK m;  5GAO l;  1EOV A;  4OLF A;  1X2H A;  3A7A A;  2DQ0 A;  1EQR A;  2E41 A;  4HWR A;  4DPG A;  3W3S A;  3RIR A;  4NL2 A;  4XEM A;  4L87 A;  4TVA B;  2ZCE A;  2ALY A;  4H2U A;  4C8Q B;  2DZ9 A;  2IY5 B;  4P72 C;  4UP7 A;  4YRQ A;  5GAN h;  2ZZG A;  4E51 A;  3JCM X;  3R07 A;  4J6W A;  3M4P A;  1HXD A;  1YFT A;  5GAN g;  1WNL A;  1VQZ A;  3LSS A;  1KMN A;  4EX5 A;  4JUV A;  5GMK l;  2ALY B;  1KOG A;  4N0A C;  3E9H A;  2CJ9 A;  1Z7N A;  4BW9 A;  4XQ3 A;  5CAI A;  1GGM A;  4YDQ A;  4C92 F;  4P74 A;  3PGG A;  4M75 D;  3HRK A;  4EMG A;  1ATI A;  5GAM f;  1IL2 A;  2EL9 A;  4M78 C;  4M77 A;  4M78 E;  5GMK h;  4YRF A;  4PJO G;  1NJ8 A;  1H4T A;  1WQW A;  3VQY A;  3ERR A;  4OP0 A;  1B8A A;  4M78 G;  2Y90 A;  3RL6 A;  1B34 A;  3V8J A;  5I21 A;  4HWT A;  3QO3 A;  2P0L A;  4QVD A;  2DQ3 A;  3VQW A;  12AS A;  3JCM g;  4P74 C;  4P3O A;  4CS4 A;  2DJZ A;  2ZTG A;  5GAN d;  4M7A C;  4M7A E;  2G4C A;  2CIM A;  1SET A;  4M77 B;  4YRE A;  1C0A A;  1H4V B;  4ZTZ B;  4A54 A;  4M7A G;  1X56 A;  5LJ3 j;  4RQE A;  1E24 A;  2ZZE A;  3HSB A;  3UGQ A;  4NOY A;  1B34 B;  1WLE A;  2QTX A;  3M4Q A;  1U1T A;  5GAO q;  4YRP A;  2ARU A;  2RHS A;  2ZNJ A;  2ZR3 A;  3A5Y A;  4M75 F;  4M7D C;  4M7D E;  4YRR A;  2K57 A;  1LYL A;  4H2W A;  5GAN 2;  1EIY A;  1N9W A;  1WPY A;  1LNX A;  4F7U A;  4M7D G;  1RIQ A;  2E10 A;  2FB7 A;  2YHT A;  3QHS A;  2DXT A;  2DKG A;  5LJ5 h;  3M4G A;  2I2L A;  5GAN 3;  3P8Y A;  4P73 A;  3WQZ A;  1M8V A;  3E9I A;  4ZIB A;  1X54 A;  1EIY B;  5LJ5 g;  4AH6 A;  4PJO D;  3JB9 H;  5GAN 5;  4J6Y A;  3NET A;  4XU0 A;  4F7U E;  3NEN A;  1NNH A;  1L0W A;  3HY1 A;  2ZT6 A;  4YRK A;  3RER A;  2DTI A;  2DZC A;  4CH3 A;  2QHU A;  4HWO A;  3HXY A;  4PNO A;  1E1T A;  1BIA A;  2QHT A;  1USY C;  3BW1 A;  5GAN 7;  1N9R A;  1X01 A;  2P5I A;  3P8T A;  4P75 C;  1ADY A;  3RF1 A;  1E1O A;  3G1Z A;  1WQ7 A;  2E65 A;  3VQX A;  4TVA A;  4EMK A;  4QVC A;  1JBM A;  3JCM b;  3PZC A;  4C92 D;  2Q7G A;  1JJC A;  4M75 B;  2VXF A;  5GAM h;  3GIB A;  3FJP A;  4Y91 A;  1FYF A;  4XU1 A;  5GAN j;  5LJ5 d;  4PJO F; 
#chains in the Genus database with same CATH topology
 1LCK A;  4FU6 A;  3OBY A;  2X4Y A;  2FZG B;  4CH4 A;  2PZ1 A;  4A4H A;  3OA6 A;  2HKQ B;  2J06 A;  1KQ2 A;  3OB9 A;  1OI1 A;  3OYI A;  4J5Y A;  2LCL A;  4A53 A;  4C8Q E;  2F5K A;  3LLR A;  3E9G A;  2X9H A;  3MP6 A;  5A2Q E;  2CSQ A;  2LDM A;  3OYL A;  1K0X A;  1Z7M A;  2KK4 A;  4A4K A;  1S72 Q;  2KYB A;  1WU7 A;  3CCU A;  1WYD A;  4YCV A;  2EJF A;  2KI7 A;  3CPF A;  1WXU A;  3DB4 A;  2AK5 A;  4YRI A;  3EH2 A;  3A32 A;  2COZ A;  2W0Z A;  4M7D F;  5KYX A;  2BE9 B;  2A3L A;  2KE9 A;  3PTA A;  5HY6 A;  4RDX A;  1OQK A;  4FL6 A;  1K8A R;  2L3Q A;  3CCM A;  3CC2 Q;  1EX4 A;  1RAH B;  3MKD A;  4K88 A;  1AZG B;  3CCR Q;  4XTW A;  3CCE A;  3FB9 A;  4HVU A;  3CD6 T;  2ZZF A;  3CCV Q;  1NM7 A;  3REU A;  1TTH B;  3HFZ A;  5IXB A;  2DX1 A;  2BZX A;  2CP5 A;  2DF6 A;  2M16 A;  2DL3 A;  1VQL A;  4BB7 A;  4XTX A;  1FMK A;  1Q7Y C;  2JMA A;  4UPA A;  2K7A A;  4TVW A;  1V1C A;  2O4X B;  1BK2 A;  1PNJ A;  3JAM E;  1NJI U;  2K3B A;  3V7S A;  1AOJ A;  2FPF A;  2X3W D;  1VQM Q;  1G5H A;  2RHQ A;  2FHD A;  3LC0 A;  4TWA A;  5LJ5 j;  1OYX A;  2DIG A;  4BY6 C;  3OS5 A;  3SB2 A;  1VQO A;  4K86 A;  4C92 B;  2LJ3 A;  2DD4 A;  1GXI E;  1N9S A;  2H3E B;  1G3Y A;  3VJP A;  4WI1 A;  4WJ4 A;  3H41 A;  4C0G A;  3L2V A;  2RF0 A;  4O2D A;  2IG0 A;  3ICA A;  3VKI A;  1D0Y A;  3OYD A;  3M59 A;  4PFP A;  1Q7Y R;  3M9Q A;  5GMK i;  1TU0 B;  4B9X A;  4KUL A;  2QEX Q;  1G2B A;  4WCI A;  1MGQ A;  3J81 E;  2EIF A;  4RMO A;  2YXY A;  2HL3 A;  2AMC B;  2KT8 A;  4MML A;  2JTE A;  4C5E A;  1BCO A;  1VQN Q;  2PVD B;  3M58 A;  2L2P A;  3O5Z A;  3L4G A;  1RLP C;  2GTJ A;  1X2Q A;  3OYK A;  3I5S A;  4A4F A;  5HK0 A;  1YHQ A;  5FU7 B;  1ZUY A;  4P71 A;  5C6S A;  5FRO A;  4M7D D;  1WYX A;  4M75 C;  4AMC A;  3JB9 J;  3CCE T;  1B7Y A;  1C0M A;  3QO7 A;  3SWN B;  4ELY C;  1PCX A;  3LWH A;  1UB4 A;  2PME A;  4ZN3 A;  4PHC A;  2YLC A;  2MAM A;  2KRM A;  1IXD A;  2XMF A;  4TTV A;  4BI8 B;  1R8O B;  1C6V X;  2D1X A;  3JCM c;  1K73 U;  1ZSZ B;  2O31 A;  5CKE A;  3WXM B;  4D8K A;  1VQ8 A;  2QQ9 A;  2CDT A;  3TEG A;  2RN8 A;  3PT9 A;  1VYV A;  1NJ1 A;  2JM8 A;  2P0P A;  1UEC A;  1HTT A;  1K8A U;  5KYU B;  2QK0 A;  4YPF A;  1U8R A;  3NPF A;  3EHR A;  5F5W A;  5GMK j;  4J6X A;  1YN8 A;  2EYZ A;  2DXC A;  1LOJ A;  1VQO T;  4DBR A;  1GRI A;  4PJO A;  1G5V A;  1Q81 U;  3CBP A;  3HTZ A;  1T3S A;  2GNC A;  4TVY A;  2L3S A;  2M0O A;  4MZT A;  1LJO A;  2CH4 A;  3M54 A;  2E1H A;  2HD0 A;  4HKE A;  4HCC A;  2OAU A;  2AKW A;  4BD3 A;  2O01 E;  4B6M A;  3HXZ A;  3QO5 A;  2HEQ A;  4FYW B;  4ZTU B;  3I56 T;  1ASY A;  1JJ2 A;  2A0F B;  2M51 A;  1SRM A;  2QA4 T;  3TCJ A;  1MHN A;  4K87 A;  4Z02 A;  1YIJ Q;  2MI6 A;  1S72 A;  5CKH A;  1UFF A;  4H2T A;  3SEM A;  2PVO B;  3EG0 A;  4M7D A;  5I2S A;  1BKB A;  2XI9 A;  2K9G A;  3GF5 A;  3CME A;  5KYN A;  4EMH A;  2NUZ A;  3OYC A;  2DL8 A;  2HSE B;  3MEW A;  3VRZ A;  2FEI A;  3HXX A;  3RGL A;  1M9S A;  2E6Z A;  2CS7 A;  4ZGD B;  2AZS A;  4C92 C;  4WF2 A;  3CCR A;  1VQ5 A;  1NJ6 A;  1QP2 A;  2MIO A;  3J7A F;  2HBP A;  3CCV A;  3QUI A;  4C92 G;  1YNZ A;  2DDZ A;  2EJ9 A;  2LQ8 A;  3HL8 A;  2HAX A;  2ZPI B;  2GFU A;  4CC2 A;  1G3S A;  2I4O A;  2HKN A;  5L23 A;  1VQ8 T;  1NYQ A;  2YUP A;  2HMA A;  1UEB A;  1IRX A;  3JCM W;  3QWY A;  3A74 A;  5KYY A;  1ASZ A;  1OU9 A;  4JZ3 A;  2HSP A;  1EVK A;  2L89 A;  2DYB A;  4Y28 E;  1AD5 A;  2PMF A;  3X24 B;  3QNE A;  2QGG A;  2ODR C;  3HXW A;  3VV0 A;  3ZBD A;  2ZGW A;  5FU7 C;  1GCQ C;  3G1J A;  4FM4 B;  1YJ9 Q;  4J15 A;  1ZBJ A;  3FDR A;  3QDR B;  2A8E A;  1EZZ B;  2M0Y A;  4J83 A;  1PHT A;  3RKW A;  4FT4 A;  1TUC A;  1QVF P;  2EJG A;  2DBK A;  3CCS A;  3FJ5 A;  1WI7 A;  2E12 A;  4E7K A;  3R6O A;  4DQ2 A;  3JCM Q;  4KQE A;  2E3I A;  2FPD A;  5GAO l;  1ZSZ C;  4OLF A;  3RBB B;  2E41 A;  3OYG A;  4DPG A;  1WHH A;  2ZCE A;  2ALY A;  4H2U A;  4EPC A;  4OGC A;  2AT1 B;  3HRU A;  2EFI A;  1N6A A;  3EGX A;  2NLU A;  1KQS A;  1D09 B;  3JCM X;  2ZZD A;  3R07 A;  1VQP Q;  3DKM A;  5FWC A;  3CC2 T;  3M55 A;  3CCR T;  1OX8 A;  7AT1 B;  5KYW A;  2XG8 D;  3CCV T;  1KOG A;  4DBF A;  1Z7N A;  2JUF A;  2GQV A;  3QXE B;  1P92 A;  2ZPE B;  4J9D A;  3HRK A;  3KUF A;  4J9G A;  1F1B B;  2EYX A;  1ATI A;  1X6B A;  1MMA A;  4BDZ A;  5KE3 A;  1OOT A;  1RAA B;  1WQW A;  1VQM T;  1SEM A;  4OP0 A;  1W2B S;  1WHK A;  3RL6 A;  1YIT T;  4QQG A;  1VIE A;  3QPH A;  4AG1 C;  1AHJ B;  4BE2 A;  2DPP B;  1RAC B;  4KGZ B;  3H9N A;  3VQW A;  3JRZ A;  4P3O A;  4CS4 A;  2RJC A;  4KBM B;  1QP3 A;  1YWO A;  2G4C A;  2EYW A;  2Y4Y A;  2CIM A;  1IB8 A;  4M77 B;  4YRE A;  1H4V B;  4FSS A;  4A54 A;  4LUE A;  1PM3 A;  2LT4 A;  3UT1 A;  3M4Q A;  2V1R A;  3C0C A;  2AIR B;  4YRP A;  2RHS A;  2ZR3 A;  3HKS A;  2LRQ A;  1AVZ C;  3EG9 A;  4M7D E;  4HVV A;  5IN1 A;  2CP7 A;  5GAN 2;  4KRT A;  1LNX A;  2X4X A;  2VGN A;  2FZK B;  3CXC P;  4AG2 C;  2QEX T;  4XK8 E;  3QHS A;  1SHG A;  2KEA A;  1PD0 A;  1VQ4 Q;  4KGX B;  2E5K A;  2DKG A;  5LJ5 h;  1OZ3 A;  4RUG A;  1YIJ A;  4KUI A;  1VQN T;  5IH2 A;  1M8V A;  4ATO A;  3E9I A;  3PE0 A;  1AWJ A;  4WTO B;  1EIY B;  2CP3 A;  2K4Y A;  1JXO A;  4Q5W A;  2ROT A;  1K76 A;  4XU0 A;  5FU6 B;  2ZT6 A;  2XU8 A;  2B8A A;  1KD1 C;  2DZC A;  4CH3 A;  3GNG A;  2JVV A;  2DE0 X;  4D8D A;  2BKD N;  2OTL A;  1AT1 B;  3BW1 A;  1T3L A;  5GAN 7;  1D1B A;  4TVA A;  2K79 A;  3JCM b;  2ZCF B;  4XU1 A;  2WAC A;  3LGL A;  4QVZ A;  1ZBX A;  2LQK A;  1KHC A;  3PMI A;  1SRL A;  1WZO A;  4HWS A;  1VQK A;  11AS A;  4EMK B;  4FIB A;  2P4T A;  1QVF S;  3CC7 Q;  3JB9 G;  2KAF A;  3A8L B;  3VS5 A;  1MMN A;  1M90 C;  1H64 1;  1K9M U;  1B76 A;  1M1F A;  1JJC B;  2DYI A;  2XDB A;  4IUV A;  4CH6 A;  2RQV A;  5CIU A;  4YYE A;  1YJ9 A;  5CR2 A;  4M7A F;  5ELN A;  1WJQ A;  4AFZ C;  2L8D A;  3OY9 A;  2QQS A;  1X2G A;  2ED0 A;  4E6R A;  1X43 A;  2KXD A;  2DLP A;  5IHI A;  4LUD A;  4E2F B;  2HBW A;  1M3C A;  5KH6 A;  4FSX A;  3WVE B;  1MV3 A;  4XU3 A;  1YIJ T;  2JTF A;  3HXU A;  1VYT A;  3CCJ A;  3V7C A;  1GCP A;  4JS4 A;  1ZUK A;  3MEY A;  5I2M A;  4E7J A;  4Q15 A;  4LDV A;  5KNN A;  3Q1J A;  3PVL A;  3QSU A;  1JJ2 P;  4PJO B;  3NEL A;  2Q5H A;  4CS3 A;  1U06 A;  3NTK A;  4GBQ A;  1VQ7 Q;  3CCL Q;  4YRL A;  2ZIO A;  1TSF A;  4M77 C;  1HC7 A;  4BAC A;  2F2W A;  2QA4 Q;  3H0F A;  4XTZ A;  3BJU A;  1G8X A;  4M77 G;  4RTU A;  2XHC A;  1G3T A;  2K5F A;  3V8K A;  3L2W A;  1UGQ B;  5D7U A;  4A4E A;  4BY6 B;  3QO8 A;  2W10 A;  2O9S A;  4LD6 A;  1RI0 A;  3HFO A;  5GAN 4;  4RTT A;  1PYS B;  4LVL A;  2MWO A;  2JW4 A;  1NJI R;  4PL6 A;  2D8J A;  1RAE B;  2ZT8 A;  3SHW A;  3L1A A;  4PJL A;  3PMT A;  1BIB A;  5HK3 A;  3CPW A;  3QYG B;  2CRE A;  1H3H A;  3VS3 A;  2F1L A;  2CH4 W;  3UWN A;  5GAO p;  3LH0 A;  3I55 Q;  3VBB A;  2RH2 A;  4D6W A;  2A28 A;  4J9H A;  2A36 A;  3CXC S;  1YGB A;  1N8R U;  3VRY A;  2DJQ A;  4F7U G;  2EVR A;  3CQT A;  5FU6 C;  3CBO A;  4YCU A;  3I35 A;  4PJN A;  1B07 A;  4AFS C;  3RKY A;  4X1V A;  1PKT A;  2CJA A;  4P73 C;  1RUW A;  3UA7 A;  4HT8 A;  4KR3 A;  1WHM A;  4M7A D;  1SSF A;  1VOM A;  3X25 B;  4PJM A;  2BIV A;  1HD3 A;  4LVI A;  2GCX A;  1WFW A;  3A7U A;  3RAC A;  1D3B A;  2RMO A;  2RI3 A;  1Z9Z A;  3HRI A;  2VGM A;  2G3R A;  3J80 E;  1QF6 A;  1KD1 U;  4PKC C;  4F17 A;  1SER A;  3CMQ A;  4OGE A;  2RNA A;  2RB6 A;  5DY9 A;  5A0D A;  4TVR A;  3JCM V;  1Q82 U;  1HSQ A;  3IKM B;  1Y96 B;  3QJY A;  3SFM A;  2FZC B;  1NJ2 A;  1VQP T;  1M30 A;  4EMK C;  1QE0 A;  3MF2 A;  4OB1 B;  3MEA A;  1R77 A;  1Q81 C;  2QAZ A;  2RHZ A;  3A5Z B;  4YRN A;  2AZV A;  2I4N A;  1NZ9 A;  1WIE A;  5L8R E;  1TH7 A;  4F04 B;  1YFN A;  2VUB A;  2YUO A;  1VQ6 Q;  3TUP A;  4X9D A;  2IIM A;  2KXC A;  2LMJ A;  2IVW A;  1NLO C;  2NUP B;  1K73 R;  1E22 A;  3I5R A;  4YCW A;  3EGD B;  4CH5 A;  1KK7 A;  2DTO A;  1D1A A;  1VIF A;  3OYA A;  1BI0 A;  3ASK A;  1M90 U;  2WSC E;  3DLM A;  5I11 A;  1Q86 C;  2X51 A;  1W70 A;  1Z9Q A;  2HQH A;  2D0N A;  1BYM A;  2Z0W A;  2F69 A;  2RPN A;  2XDP A;  9ATC B;  3CC7 A;  3JCM J;  1Q81 R;  3OSV A;  4M7A A;  2RM4 A;  4PJO C;  4M78 B;  4E7H A;  4Z8A A;  1GBQ A;  1EVL A;  4P5N A;  1PKS A;  3OMG A;  3VS4 A;  2DU5 A;  5GAO n;  4E7L A;  4YRJ A;  2KRO A;  3FLG A;  3I9Q A;  2JM9 A;  1Y0M A;  1WHJ A;  2L3R A;  1YBY A;  3INZ A;  3VS2 A;  1YIT Q;  2FL7 A;  1SG5 A;  1QWE A;  2CJB A;  2DO3 A;  1JJ2 S;  1VQ4 T;  2RQR A;  3ZEH A;  2LC4 A;  2ART A;  3TEH B;  2XDD A;  3MP8 A;  2FO0 A;  3E9F A;  2E5A A;  4MDW A;  2QQR A;  5EC7 A;  3MF1 A;  2DU7 A;  3L2Z A;  3EG1 A;  1SES A;  2ZT7 A;  3OYY A;  4OMP A;  2PVG B;  4JRI A;  4HVC A;  1O75 A;  1UE9 A;  3FIF A;  2DM1 A;  1B70 A;  4CRI A;  1SHF A;  4Y92 A;  2FYK A;  2AHJ B;  1VQ7 A;  3CCL A;  3PCO B;  3I56 A;  3TSZ A;  2QA4 A;  1JO8 A;  4AFQ C;  4YRM A;  2SEM A;  2RHS B;  2ZPF B;  4O5V A;  3EG9 B;  2K2M A;  3PIO A;  1AZE A;  4H2X A;  3MEU A;  1QKX A;  4FW2 A;  3E1S A;  5GAN 8;  1I81 A;  3QYH B;  4V2S A;  5HKC A;  1YB3 A;  1U1S A;  1ABQ A;  4YRC A;  1X6O A;  2DRM A;  2YRC A;  4H2V A;  3X26 B;  1O9S A;  2QG9 B;  1AWO A;  2ZNI A;  2EQU A;  2P0Q A;  1FYN A;  1UJY A;  3QKJ A;  3G71 Q;  3P8B B;  4M75 G;  3I55 A;  3CC7 T;  3QG1 A;  2KSS A;  1B7T A;  1EFN A;  1QW1 A;  3NGP A;  2NYS A;  4PG3 A;  2IY5 A;  4JJD A;  4J9E A;  3KFV A;  1G5I A;  4C5G A;  5GAO r;  2JN0 A;  3OMC A;  5KCO A;  1E7O A;  2E3H A;  2EQK A;  3ME9 A;  5CVI A;  1M2V A;  1ACM B;  3HTR A;  2CZ6 B;  4TVA B;  1Y57 A;  4C8Q B;  3VS6 A;  3RNJ A;  4UP7 A;  4YRQ A;  3G4S Q;  4EDU A;  2X4W A;  4E47 A;  4J6W A;  5IHK A;  3H0I A;  3CMA Q;  2X4J A;  3DLL A;  1W2B P;  4DOW A;  4N0A C;  4VUB A;  3MHX A;  2CJ9 A;  4XQ3 A;  2GTO A;  1GGM A;  1UG1 A;  1YJN Q;  4YDQ A;  4RKU E;  4C92 F;  1KQS S;  3PGG A;  1G3W A;  1VQ7 T;  4M75 D;  1H8K A;  2HCK A;  3CCL T;  4EMG A;  1KFZ A;  1IGQ A;  2EGE A;  2MCN A;  4LD9 K;  3OW2 P;  2EL9 A;  4M78 C;  4AFU C;  4YRF A;  3CCQ Q;  1QCN A;  3VQY A;  4E7S A;  1Q86 U;  4M78 G;  4IIO A;  5CO7 A;  2KMT A;  3EFO B;  3V8J A;  3QO3 A;  2CKK A;  2J6K A;  4ZNX A;  1OPL A;  5AYF A;  2BZY A;  2BZ8 A;  4M7A E;  2HL5 C;  2KY9 A;  2MK5 A;  2XD0 A;  3BDL A;  4F14 A;  3FRN A;  1E24 A;  2LX7 A;  3CC2 A;  3I55 T;  1B34 B;  1KSW A;  1WHG A;  5GAO q;  2L5Q A;  2ARU A;  2ZNJ A;  5D6Y A;  3QBY A;  2LTO A;  2DL4 A;  3A8M B;  2K57 A;  1WXB A;  2V8J A;  4H2W A;  1NPP A;  1RIQ A;  2B86 A;  3EAE A;  2YHT A;  2YRV A;  2EQJ A;  4LVM A;  1XJW B;  2DXT A;  1QCF A;  8ATC B;  4RTX A;  4LN2 A;  2VAS A;  3M4G A;  2I2L A;  5GAN 3;  3X28 B;  3THK A;  1E6H A;  2XIC A;  4CC3 A;  1VQM A;  2JOY A;  3A1P A;  3VS0 A;  3OYE A;  3EGU A;  1T0J A;  2J6F A;  1YIT A;  3N5B B;  3MJX A;  2LT1 A;  1S1N A;  4F7U E;  4GLK A;  1NNH A;  1L0W A;  3HY1 A;  2CT4 A;  4F16 A;  1BB9 A;  2DTI A;  3FEO A;  2NUT B;  3PVQ A;  2K5I A;  4DA4 A;  3UF4 A;  2RK2 A;  2F5T X;  1E1T A;  2QHT A;  1YI2 T;  2XID A;  1USY C;  4R55 A;  1N9R A;  1X01 A;  1JB0 E;  4P75 C;  4IUP A;  2C0T A;  1E1O A;  3P8D A;  1BI3 A;  2E65 A;  1K9M C;  3TSW A;  4E7Z A;  1JBM A;  4C92 D;  1LVK A;  1FMV A;  1OUL A;  3SD4 A;  2RQW A;  5DLO A;  2QEX A;  2RHY A;  2XK0 A;  1VQ6 T;  3O8V A;  4J7I A;  5AT1 B;  5M9O A;  2RJE A;  2MYS A;  3QTC A;  1VQN A;  1H3Z A;  2X3X D;  5GAN 6;  1X55 A;  2BTT A;  1D3B B;  3UA6 A;  4JLG A;  4C8Q C;  1M27 C;  4XU2 A;  3UFG A;  2FPE A;  2YWW A;  3EFS A;  4FT2 A;  4C8Q G;  3QWX X;  4YRO A;  2V1Q A;  2QQB A;  2JTM A;  3HRT A;  2MPX C;  3EFR A;  5CKD A;  2FRW A;  2QHV A;  3VU3 C;  4BWA A;  1UTI A;  3S3M A;  1K9M R;  5GJW B;  3OYB A;  2ODR D;  1UDL A;  4ORZ A;  4Z89 A;  1I1J A;  4XTV A;  4N4I A;  2ZR2 A;  4JJN K;  1I07 A;  1X75 C;  1A0N B;  1QQJ A;  4C5I A;  8AT1 B;  3OQ5 A;  1YFR A;  4H2S A;  2O4X A;  2CUB A;  4LDU A;  3VYG A;  3JCM e;  2YSQ A;  1ADJ A;  5FWB A;  4TQD A;  3G4S A;  3BY7 A;  5KYX B;  3OYF A;  1NEB A;  3V7R A;  3LSQ A;  4FYX B;  2DMO A;  1AEY A;  4HVW A;  2CZ0 B;  1JEG A;  1UHC A;  3OW2 S;  3CMA A;  3S3N A;  2GBQ A;  2LZ6 B;  4K11 A;  3ZL7 C;  4DBQ A;  4ZGE B;  3RMQ A;  1QKW A;  4C92 A;  3PIP A;  1TUD A;  1TUG B;  2ZIM A;  4FW1 A;  3URG A;  3NEM A;  4KH0 B;  3V8L A;  1B3Q A;  1YJN A;  3HFZ B;  2DER A;  1N8R C;  5LJ3 e;  3JB9 I;  3H8Z A;  2ZT5 A;  2WSE E;  3MO8 A;  2ENM A;  2C7I A;  4FYV B;  3LW5 E;  5CQX A;  3HFV A;  4ELZ C;  4JZ4 A;  2P4R A;  3MCA B;  1PG5 B;  5ECA A;  2RHQ B;  2AMC A;  2DK3 A;  2OX7 A;  3GLX A;  3HP9 A;  1WHL A;  1PRL C;  1VQ9 Q;  3C12 A;  4LE9 A;  3RES A;  1ZSG A;  3JB9 F;  3F70 A;  3KFU A;  2YT6 A;  3G71 T;  2R58 A;  4LVJ A;  1X2K A;  4UP9 A;  1Q82 C;  4C0Z A;  5CQY A;  1PC0 A;  2JMC A;  1KC8 U;  1N8R R;  3LX7 A;  1B70 B;  3M0T A;  3SWN A;  1J5W A;  2WSF E;  5IAY A;  4RTV A;  3IAL A;  2GFA A;  2E3C A;  5FRM A;  1NJ5 A;  1M1K C;  5C52 B;  2C0O A;  2DFU A;  1ZSZ A;  2YUQ A;  4M75 E;  3OS0 A;  1ZA1 B;  1TXQ A;  4LXC A;  1RAF B;  3L2R A;  2D6F A;  4H2X B;  3L4G B;  4Q6G A;  3G4S T;  2JJ9 A;  3CCU Q;  2EYQ A;  3EG3 A;  4J9I A;  5KE2 A;  3M57 A;  5KYU A;  4ZTJ A;  1KD1 R;  1PWT A;  5GAN e;  2K3Y A;  2JS0 A;  3CMA T;  3TU4 K;  5FW9 A;  2BE7 D;  3OD1 A;  2V8K A;  1B7Y B;  1Q82 R;  1G51 A;  4KGV B;  4II1 A;  4B9W A;  5DM7 R;  1UGP B;  2DVJ A;  3CCM Q;  5GJV B;  1TG0 A;  1YJN T;  1JRI A;  4M77 F;  1ZHI A;  1RL2 A;  3IKL A;  2KRS A;  4R0K A;  2LCC A;  1M1K R;  3CCQ T;  3UPU A;  2QHS A;  2KDS A;  1VQL Q;  4HCZ A;  3PNW C;  2E5Q A;  1M2V B;  2EGC A;  5GMK e;  2R57 A;  4KR2 A;  2RK1 A;  2RHU A;  3C4S A;  4RCB A;  1RAD B;  1ARK A;  4L59 A;  2FG0 A;  1H92 A;  2RI2 A;  4X5O A;  4YRG A;  2CZ7 B;  1D0Z A;  1M90 R;  2I4M A;  3M5A A;  2DXB A;  2RA2 A;  4LNP A;  1I5O B;  4IKF A;  1RI9 A;  3S3O A;  1VQP A;  2DEQ A;  4F7U F;  3JB9 D;  4OF1 A;  2KRN A;  4PLI A;  3LWI A;  2AKW B;  3IQL A;  2LP5 A;  1IHV A;  1UGR B;  3OYJ A;  2LJ1 A;  2CP6 A;  2MMP A;  2J3L A;  3QZ5 B;  4YP0 A;  1KHI A;  3LH5 A;  2QYZ A;  1I5L A;  2Q7H A;  1WLP B;  3RKX A;  1OPK A;  2EW3 A;  4H02 A;  1QWF A;  4ANJ A;  2QTV A;  1QVG A;  1N27 A;  3GOX A;  3C95 A;  4KH1 B;  2ZAE A;  1RAB B;  4PFZ A;  4C92 E;  4M7D B;  4ME7 A;  2OAW A;  2A08 A;  1EFW A;  1QCO A;  1FX7 A;  2IPO B;  1M2O A;  2EAY A;  2EKO A;  2A37 A;  5LJ3 g;  1YHQ Q;  4IUU A;  1OX9 A;  1R0B G;  2DTH A;  3HY0 A;  3NFC A;  2SRC A;  4G84 A;  2VYT A;  3L42 A;  1RLQ C;  1NYF A;  1PRM C;  3U23 A;  3JCM d;  4JRP A;  2FVU A;  4QT7 A;  1E6G A;  5J3B A;  4M77 D;  3VQV A;  4P3P A;  1T0H A;  5LJ5 d;  3HFN A;  2P0K A;  4NCX A;  1VQ4 A;  2O88 A;  4XEO A;  2Y4X A;  4X9C A;  2D9T A;  5GAM e;  2ECZ A;  1SKU B;  2QDY B;  2VKN A;  1MMD A;  5KYY B;  1GFD A;  5FLX E;  2CUD A;  4J7F A;  2C8M A;  1YI2 Q;  4OMQ A;  2Q7E A;  1VQ9 A;  2V8I A;  4RQF A;  4P72 A;  2DIL A;  5LJ3 d;  2QAS A;  1QVF A;  2DAQ A;  2OTJ Q;  1SRY A;  4P71 C;  2K5L A;  2DVE A;  5GMK m;  1BU1 A;  1VA7 A;  3UAT A;  1EOV A;  3LYI A;  3CC4 Q;  1M1K U;  1EQR A;  2DQ0 A;  4HWR A;  3W3S A;  3RIR A;  4XEM A;  3S6W A;  2PQW A;  1WA7 A;  3E2U A;  3VUB A;  1W6X A;  1KQS P;  1ZA2 B;  4BUG A;  2J05 A;  2RQT A;  2QQA A;  2ESW A;  1XQH A;  3M4P A;  1HXD A;  4N4G A;  1YFT A;  1TS9 A;  5GAN g;  1WNL A;  4BI3 A;  1KMN A;  3C94 A;  2YDL A;  1BI1 A;  2DET A;  1PSE A;  4EX5 A;  4JUV A;  2ALY B;  3E9H A;  3GPL A;  2X35 A;  1Y07 A;  1NYG A;  2LJ0 A;  3VYH B;  3FC3 A;  4BW9 A;  3EGX B;  4P74 A;  1MMG A;  2DBM A;  3CME Q;  1I0C A;  4MZM A;  3NMZ C;  3G7Z A;  4C0D C;  5KYW B;  4M77 A;  4KT0 E;  4PJO G;  1NJ8 A;  4IUR A;  1H4T A;  4OVA A;  3ERR A;  4GY5 A;  1B8A A;  2Y90 A;  4JDS A;  2MWP A;  1VQ5 Q;  1V29 B;  4HWT A;  2P0L A;  4CI0 C;  2RHI A;  12AS A;  2QI2 A;  1SPK A;  5GAN d;  2ZTG A;  3M0U A;  2E4H A;  1WXT A;  1Q86 R;  1C0A A;  1CSK A;  2J6O A;  4ZTZ B;  4PJJ A;  1HYO A;  5I22 A;  5LJ3 j;  2E70 A;  4NOY A;  2QTX A;  2EQI A;  3ULR B;  5EG2 A;  2L3P A;  1VQ9 T;  5IHN A;  3A5Y A;  4M75 F;  4M7D C;  4YRR A;  1EIY A;  3M56 A;  1N9W A;  1RAI B;  1WPY A;  4F7U A;  1U5S A;  4M7D G;  5D6X A;  2E10 A;  1YWP A;  2FB7 A;  3CXC A;  1UUE A;  2E6N A;  2ZPB B;  4M4Z A;  4P73 A;  3WQZ A;  2OI3 A;  5A0G A;  4OMO A;  4ZIB A;  3KXT A;  2K6D A;  4PJO D;  5GAN 5;  1ZX6 A;  3NET A;  4R56 A;  2EGA A;  2KQW A;  2KBT A;  2EQM A;  3CCS Q;  3RER A;  1GL5 A;  3P8H A;  3GBQ A;  2O9V A;  4HXJ A;  3HRS A;  3HXY A;  4BDY A;  2R5M A;  4PNO A;  1UJ0 A;  1Y71 A;  2HZY A;  3CCU T;  1ZQ1 A;  1K4U S;  2HDA A;  2P5I A;  1ABO A;  1ADY A;  3RF1 A;  4OB3 B;  1FXX A;  3G1Z A;  1WGS A;  4QW2 A;  4EMK A;  4QVC A;  4UC4 A;  3PZC A;  6AT1 B;  1KIK A;  4MDX A;  1EIF A;  3AT1 B;  1XTD A;  2LNV A;  1JJC A;  1QVP A;  2KVQ G;  2VXF A;  1K0S A;  1NBE B;  3CCM T;  3GIB A;  3FJP A;  4DEX A;  4Y91 A;  1FYF A;  5GAN j;  4HA8 A;  1TOV A;  3REX A;  5GAM g;  4M78 F;  5C53 B;  4RMF A;  2RJD A;  3GP8 A;  2VWF A;  1K1Z A;  1U3O A;  1VQL T;  2LVM A;  3A8G B;  4OB2 B;  2CGH A;  3EG2 A;  2NWM A;  2G6F X;  3H6Z A;  2KR3 A;  2RO0 A;  1UGV A;  1YI2 A;  2ATC B;  2E64 A;  4RTY A;  2ED1 A;  3M0S A;  4LNS A;  4X34 A;  4QQ6 A;  3JCM P;  2OTJ A;  1WJR A;  1OZ2 A;  3DSQ A;  4E7I A;  2NS6 A;  4FCY A;  2PUK B;  2PNI A;  4UP8 A;  3IG2 A;  3G6E Q;  3CC4 A;  5GAM d;  1SSH A;  1BBU A;  2M1H A;  2VXE A;  1VQ6 A;  2CYZ B;  3UDC A;  4NS5 A;  3NTI A;  4WJ3 M;  3X20 B;  4PK4 A;  4KUD K;  1OV3 A;  2I4L A;  4EO4 A;  4G85 A;  2DRK A;  1FWZ A;  2GGR A;  2CP2 A;  2D0Q B;  1PD1 A;  4O6J A;  1YJW Q;  1PYS A;  2PTK A;  4M77 E;  1I4K 1;  2CSI A;  4HT4 A;  3GNF B;  1AWW A;  2YRD A;  3M4Y A;  1MND A;  3BDU A;  2O2O A;  4GLM A;  4BI4 A;  4JS5 A;  5K1P A;  1DJ7 B;  2H3J A;  1NYR A;  3EHQ A;  1OEB A;  5CCA A;  1YHQ T;  3VS1 A;  1Q95 G;  1Y7X A;  2D8H A;  4DEY A;  1QVG P;  4OMN A;  2LNH B;  4J9C A;  4YRS A;  1Q7Y U;  4OMM A;  2VC8 A;  3CPW P;  1KC8 C;  2K2V A;  2OTL Q;  2AKL A;  2EWN A;  3HXV A;  5E3I A;  2GF7 A;  5A0L A;  4OB0 B;  3UGT A;  3A8O B;  2HNI A;  4M78 D;  3REB B;  3BFM A;  3OYM A;  4DBH A;  1HK9 A;  3REA B;  2V26 A;  3LGF A;  3MQZ A;  4C8Q F;  4ZTF A;  2M02 A;  3JCM f;  1YFS A;  3BE3 A;  4YRT A;  4M75 A;  3VS7 A;  2Q5I A;  3OYH A;  3UH0 A;  3AHU A;  1KG1 A;  5GAM j;  1VQK Q;  4PFO A;  2OTJ T;  1BBZ A;  1Y96 A;  4MMK A;  3NTH A;  2ZXF A;  3CC4 T;  3A5Z A;  4JRK A;  3E19 A;  1KC8 R;  4JPB W;  3EH1 A;  1H4S A;  3HPW A;  2BUD A;  1YCY A;  4A4G A;  2C06 A;  3KBG A;  3QJ6 A;  5LJ3 f;  3MET A;  4OML A;  2CP0 A;  1GFC A;  2OJ2 A;  1M8M A;  3SWN C;  5C51 B;  5HGQ A;  1X69 A;  1LPL A;  5CK9 A;  2NUP A;  3EGD A;  2ZIN A;  4MZP A;  5LJ5 f;  1MNE A;  2L0A A;  4HCB A;  2F2X A;  4NL3 A;  1S72 T;  3QDF A;  4Z88 A;  4HT9 A;  3CCJ Q;  3G71 A;  4N0A A;  4A63 B;  1GBR A;  3CME T;  1X6G A;  3M0P A;  1RAG B;  2JS2 A;  4CC4 B;  4HWP A;  2XGT A;  2RD1 A;  4P3N A;  4XTY A;  1JU5 C;  5IT9 E;  1OU8 A;  4YTL A;  4M78 A;  1VQ5 T;  1KMM A;  1QLY A;  1X27 A;  5D6W A;  4RTW A;  2XTI A;  2EYY A;  1JQQ A;  1TWB A;  2DNU A;  3RR6 A;  2DXU A;  2J3M A;  2KNB B;  4ZGJ B;  3CEY A;  4RG2 A;  5DLQ E;  2YUN A;  4TQF A;  4PJO E;  5CKF A;  2YLB A;  2P84 A;  3TEH A;  3JCM h;  4C8Q D;  1NEG A;  4CS2 A;  5GAN f;  3OSS C;  2F2V A;  4M7A B;  1WX6 A;  3CD6 Q;  2EKH A;  1M3A A;  5HCK A;  5K1X A;  4H2Y A;  5FRN A;  2LQW A;  1KJW A;  2JXB A;  3G6E A;  3CCQ A;  4RTZ A;  5J39 A;  3PCO A;  5LJ5 e;  3A31 A;  3RMS A;  4LDX A;  5ELO A;  2FRY A;  2ARS A;  3A7R A;  1I8F A;  1WDX A;  3TRE A;  5LJ3 h;  3CCS T;  2KYM A;  3A98 A;  3TEE A;  2LCS A;  1JXM A;  4J9F A;  1C1A A;  2KGT A;  2DL7 A;  1YJW A;  1QVG S;  1BCM A;  1GCQ A;  1XOV A;  3CPW S;  4IUQ A;  2DIQ A;  4HCK A;  4JLI A;  1USY A;  2I0N A;  1QMC A;  4N4H A;  2QDL A;  5KCH A;  1W66 A;  1KQ1 A;  1NLP C;  2ZPH B;  2COY A;  4P75 A;  2JZ2 A;  5C0M A;  2COW A;  4F7U B;  1BBW A;  1J3T A;  3SDZ A;  3RDV A;  3I7F A;  4C0F A;  3P8V A;  3DB3 A;  5GAO m;  1M4Z A;  1G83 A;  2DA9 A;  3R6N A;  4BE0 A;  1VUB A;  4J9B A;  4RCC A;  3OBW A;  1AWX A;  3TVT A;  1H4Q A;  4XTU A;  2EBP A;  4C8Q A;  3RUX A;  4ESR A;  3MEV A;  2M9U A;  2RJF A;  1BI2 A;  1M5Q 1;  3OS2 A;  3TQ7 P;  3MP1 A;  1X2H A;  3A7A A;  4LDW A;  4NL2 A;  4L87 A;  3CCE Q;  1MV0 B;  2DZ9 A;  2IY5 B;  3D7S B;  1ZLM A;  4P72 C;  4J8O A;  5GAN h;  3T9N A;  3MPU B;  2ZZG A;  1IGU A;  1NE8 A;  4E51 A;  3G6E T;  2RI5 A;  1VQZ A;  3LSS A;  3L2U A;  2PUO B;  2QXF A;  5GMK l;  1NPR A;  5CKB A;  2JNG A;  1V76 A;  1W2B A;  3EFO A;  5CAI A;  2GQI A;  2J7I A;  4DOV A;  2JT4 A;  1HJD A;  1XNI A;  3QZ9 B;  1YJW T;  5GAM f;  4C0D B;  2HQX A;  1IL2 A;  1VQO Q;  1W1F A;  1NJI C;  4IUT A;  4M78 E;  5GMK h;  2DD5 A;  3VUZ A;  3OW2 A;  4OMF B;  1MUZ A;  2R5A A;  1B34 A;  5I21 A;  2DL5 A;  1IRE B;  1CKA A;  1WJS A;  2KT1 A;  4RG8 A;  4QVD A;  2DQ3 A;  1IO6 A;  4CC7 A;  3M53 A;  3JCM g;  4P74 C;  2DJZ A;  1W4S A;  4M7A C;  2ZPG B;  2CT3 A;  1SET A;  3ZFJ A;  4M7A G;  2OTL T;  1ZUU A;  1X56 A;  5LL6 S;  3I56 Q;  4RQE A;  1UHF A;  2ZZE A;  3HSB A;  3UGQ A;  2HQE A;  1WLE A;  2EPD A;  1FMW A;  1U1T A;  1VYU A;  2K3X A;  3QII A;  3WVD B;  1NG2 A;  2AKK A;  3M0R A;  1YCS B;  2VV5 A;  4PLL A;  1D1C A;  2ABL A;  1LYL A;  2CZ1 B;  4L6V 5;  3NHN A;  1IHW A;  4LVK A;  4JJB A;  3L2Q A;  2LX9 A;  3OS1 A;  1N5Z A;  2DEU A;  2RHX A;  4AT1 B;  5IXF A;  2NUT A;  1D0X A;  3A8H B;  4EIK A;  3P8Y A;  1M1G A;  3PFS A;  1IZ6 A;  1VQK T;  3CBM A;  1X54 A;  2XKO C;  4IIM A;  5LJ5 g;  4AH6 A;  1M3B A;  1YP5 A;  3JB9 H;  2A7Y A;  4ZN1 A;  2RQU A;  3CD6 A;  4J6Y A;  2VB6 A;  3JV3 A;  3NEN A;  3H0H A;  1PSF A;  5J26 A;  4YRK A;  1SF9 A;  2VVK A;  4XAX B;  1R0C B;  1YJ9 T;  2QHU A;  4HWO A;  4JJC A;  2LQN A;  3OYN A;  1BIA A;  1VQ8 Q;  1CKB A;  4L5G A;  2C0I A;  3ER0 A;  1K9A A;  3P8T A;  3M0Q A;  1WQ7 A;  3JSC A;  3VQX A;  4JRQ A;  2ROL A;  4QQD A;  4QKU A;  1K73 C;  2MOX A;  2H8H A;  4FYY B;  2Q7G A;  2PU9 B;  4BE1 A;  4C5H A;  3HHT B;  3CCJ T;  4M75 B;  1UGS B;  2MF2 A;  5GAM h;  4LDY A;  2QGF B;  1K8A C;  4PJO F; 
#chains in the Genus database with same CATH homology
 4FU6 A;  3OBY A;  2X4Y A;  4CH4 A;  4A4H A;  3OA6 A;  1KQ2 A;  3OB9 A;  1OI1 A;  3OYI A;  4J5Y A;  2LCL A;  4A53 A;  4C8Q E;  2F5K A;  3LLR A;  3E9G A;  3MP6 A;  5A2Q E;  2LDM A;  3OYL A;  1Z7M A;  2KK4 A;  4A4K A;  1WYD A;  1WU7 A;  3CCU A;  4YCV A;  2EJF A;  3CPF A;  3DB4 A;  4YRI A;  3A32 A;  4M7D F;  2A3L A;  3PTA A;  5HY6 A;  4RDX A;  4FL6 A;  3CCM A;  4K88 A;  4XTW A;  3CCE A;  3FB9 A;  3CD6 T;  2ZZF A;  3REU A;  3HFZ A;  2M16 A;  1VQL A;  4BB7 A;  4XTX A;  1Q7Y C;  4UPA A;  4TVW A;  2O4X B;  3JAM E;  1NJI U;  3V7S A;  1G5H A;  2RHQ A;  2FHD A;  3LC0 A;  4TWA A;  5LJ5 j;  1OYX A;  2DIG A;  4BY6 C;  3OS5 A;  3SB2 A;  1VQO A;  4K86 A;  4C92 B;  2DD4 A;  1GXI E;  1N9S A;  3VJP A;  1G3Y A;  4WI1 A;  4WJ4 A;  4C0G A;  3L2V A;  4O2D A;  2IG0 A;  3ICA A;  3VKI A;  3OYD A;  3M59 A;  3M9Q A;  5GMK i;  4B9X A;  4KUL A;  1MGQ A;  3J81 E;  2EIF A;  4RMO A;  2AMC B;  4MML A;  4C5E A;  2PVD B;  3M58 A;  3L4G A;  3OYK A;  4A4F A;  5HK0 A;  1YHQ A;  5FU7 B;  4P71 A;  5C6S A;  5FRO A;  4M7D D;  4M75 C;  3JB9 J;  3CCE T;  1B7Y A;  3QO7 A;  3SWN B;  4ELY C;  3LWH A;  1UB4 A;  2PME A;  4ZN3 A;  4PHC A;  2YLC A;  2MAM A;  4TTV A;  4BI8 B;  1R8O B;  3JCM c;  1K73 U;  5CKE A;  3WXM B;  1VQ8 A;  2QQ9 A;  3TEG A;  3PT9 A;  1NJ1 A;  2P0P A;  1HTT A;  1K8A U;  4YPF A;  1U8R A;  5F5W A;  5GMK j;  4J6X A;  2DXC A;  1LOJ A;  1VQO T;  4PJO A;  1G5V A;  1Q81 U;  3CBP A;  3HTZ A;  4TVY A;  2M0O A;  4MZT A;  1LJO A;  3M54 A;  2E1H A;  2HD0 A;  4HKE A;  4HCC A;  2OAU A;  2AKW A;  4BD3 A;  2O01 E;  3HXZ A;  3QO5 A;  4ZTU B;  3I56 T;  1ASY A;  1JJ2 A;  2QA4 T;  3TCJ A;  1MHN A;  4K87 A;  4Z02 A;  2MI6 A;  1S72 A;  5CKH A;  4H2T A;  2PVO B;  4LDY A;  4M7D A;  5I2S A;  1BKB A;  2XI9 A;  3GF5 A;  3CME A;  4EMH A;  3OYC A;  3HXX A;  3MEW A;  3RGL A;  1M9S A;  2E6Z A;  2CS7 A;  4ZGD B;  4C92 C;  4WF2 A;  3CCR A;  1VQ5 A;  1NJ6 A;  1QP2 A;  3J7A F;  2HBP A;  3CCV A;  3QUI A;  4C92 G;  2DDZ A;  2EJ9 A;  2LQ8 A;  3HL8 A;  2HAX A;  2ZPI B;  2GFU A;  1G3S A;  2I4O A;  1VQ8 T;  1NYQ A;  1UEB A;  3JCM W;  3A74 A;  1ASZ A;  1EVK A;  2L89 A;  4Y28 E;  2PMF A;  3X24 B;  3QNE A;  2ODR C;  3HXW A;  3VV0 A;  3ZBD A;  2ZGW A;  5FU7 C;  4FM4 B;  4J15 A;  3FDR A;  3QDR B;  2A8E A;  4J83 A;  3RKW A;  4FT4 A;  2EJG A;  3CCS A;  2E12 A;  4E7K A;  3R6O A;  4DQ2 A;  3JCM Q;  4KQE A;  5GAO l;  4OLF A;  2E41 A;  3OYG A;  4DPG A;  2ZCE A;  2ALY A;  4H2U A;  4EPC A;  4OGC A;  3HRU A;  2EFI A;  1N6A A;  2NLU A;  1KQS A;  3JCM X;  2ZZD A;  3R07 A;  3DKM A;  3CC2 T;  3M55 A;  3CCR T;  2XG8 D;  3CCV T;  1KOG A;  1Z7N A;  2JUF A;  2GQV A;  3QXE B;  1P92 A;  2ZPE B;  3HRK A;  3KUF A;  1ATI A;  4BDZ A;  5KE3 A;  1WQW A;  1VQM T;  4OP0 A;  1W2B S;  3RL6 A;  1YIT T;  4QQG A;  1VIE A;  3QPH A;  1AHJ B;  4BE2 A;  2DPP B;  3VQW A;  3JRZ A;  4P3O A;  4CS4 A;  2RJC A;  4KBM B;  1QP3 A;  2G4C A;  2Y4Y A;  2CIM A;  4M77 B;  4YRE A;  1H4V B;  4A54 A;  2LT4 A;  3UT1 A;  3M4Q A;  4YRP A;  2RHS A;  2ZR3 A;  3HKS A;  2LRQ A;  4M7D E;  5IN1 A;  5GAN 2;  1LNX A;  2X4X A;  2VGN A;  2QEX T;  4XK8 E;  3QHS A;  2DKG A;  5LJ5 h;  1OZ3 A;  1YIJ A;  4KUI A;  1VQN T;  1M8V A;  4ATO A;  3E9I A;  1EIY B;  2K4Y A;  4Q5W A;  4XU0 A;  5FU6 B;  2ZT6 A;  2XU8 A;  2B8A A;  1KD1 C;  2DZC A;  4CH3 A;  3GNG A;  2JVV A;  2BKD N;  2OTL A;  3BW1 A;  5GAN 7;  4TVA A;  3JCM b;  2ZCF B;  4XU1 A;  2WAC A;  3LGL A;  4QVZ A;  1ZBX A;  2LQK A;  1KHC A;  3PMI A;  4HWS A;  1VQK A;  11AS A;  4EMK B;  4FIB A;  2P4T A;  1QVF S;  3JB9 G;  2KAF A;  3A8L B;  1M90 C;  1H64 1;  1K9M U;  1B76 A;  1M1F A;  1JJC B;  2XDB A;  4IUV A;  4CH6 A;  5CIU A;  4YYE A;  1YJ9 A;  5CR2 A;  4M7A F;  5ELN A;  1WJQ A;  3OY9 A;  2L8D A;  2QQS A;  1X2G A;  5KH6 A;  4FSX A;  3WVE B;  4XU3 A;  1YIJ T;  2JTF A;  3HXU A;  3CCJ A;  3V7C A;  4JS4 A;  3MEY A;  5I2M A;  4E7J A;  4Q15 A;  4LDV A;  5KNN A;  3Q1J A;  3QSU A;  4PJO B;  3NEL A;  2Q5H A;  4CS3 A;  3NTK A;  4YRL A;  2ZIO A;  4M77 C;  1HC7 A;  4BAC A;  3BJU A;  4XTZ A;  4M77 G;  2XHC A;  1G3T A;  2K5F A;  3V8K A;  3L2W A;  1UGQ B;  4BY6 B;  4A4E A;  3QO8 A;  4LD6 A;  1RI0 A;  3HFO A;  5GAN 4;  1PYS B;  4LVL A;  2MWO A;  4PL6 A;  2ZT8 A;  3L1A A;  3PMT A;  1BIB A;  5HK3 A;  3CPW A;  3QYG B;  3UWN A;  5GAO p;  3LH0 A;  3VBB A;  2RH2 A;  4D6W A;  3CXC S;  1YGB A;  1N8R U;  4F7U G;  5FU6 C;  3CBO A;  4YCU A;  3RKY A;  2CJA A;  4P73 C;  4HT8 A;  4KR3 A;  4M7A D;  1SSF A;  3X25 B;  2BIV A;  4LVI A;  2GCX A;  3A7U A;  3RAC A;  1D3B A;  2RI3 A;  3HRI A;  2VGM A;  2G3R A;  3J80 E;  1QF6 A;  1KD1 U;  4PKC C;  1SER A;  3CMQ A;  4OGE A;  2RB6 A;  5DY9 A;  5A0D A;  4TVR A;  3JCM V;  1Q82 U;  3IKM B;  1Y96 B;  3QJY A;  3SFM A;  1NJ2 A;  1VQP T;  4EMK C;  1QE0 A;  3MF2 A;  3MEA A;  4OB1 B;  1Q81 C;  2RHZ A;  3A5Z B;  4YRN A;  2I4N A;  1NZ9 A;  5L8R E;  1TH7 A;  2VUB A;  3TUP A;  4X9D A;  4YCW A;  2IVW A;  1E22 A;  4CH5 A;  2DTO A;  1VIF A;  3OYA A;  1BI0 A;  3ASK A;  1M90 U;  2WSC E;  3DLM A;  1Q86 C;  1BYM A;  2F69 A;  2XDP A;  3CC7 A;  3JCM J;  3OSV A;  4M7A A;  2RM4 A;  4PJO C;  4M78 B;  4E7H A;  1EVL A;  4P5N A;  3OMG A;  2DU5 A;  5GAO n;  4E7L A;  4YRJ A;  3FLG A;  2L3R A;  1YBY A;  3INZ A;  2FL7 A;  2CJB A;  2DO3 A;  1JJ2 S;  1VQ4 T;  3ZEH A;  2LC4 A;  2ART A;  3TEH B;  2XDD A;  3MP8 A;  3E9F A;  2E5A A;  4MDW A;  2QQR A;  3MF1 A;  2DU7 A;  3L2Z A;  1SES A;  2ZT7 A;  3OYY A;  2PVG B;  4JRI A;  4HVC A;  1O75 A;  3FIF A;  1B70 A;  4CRI A;  2FYK A;  2AHJ B;  1VQ7 A;  3CCL A;  3PCO B;  3I56 A;  2QA4 A;  4YRM A;  2RHS B;  2ZPF B;  4O5V A;  3PIO A;  4H2X A;  3MEU A;  3E1S A;  5GAN 8;  1I81 A;  3QYH B;  4V2S A;  5HKC A;  1YB3 A;  1U1S A;  4YRC A;  1X6O A;  4H2V A;  3X26 B;  1O9S A;  2ZNI A;  2EQU A;  2P0Q A;  3QKJ A;  3P8B B;  4M75 G;  3I55 A;  3CC7 T;  3QG1 A;  2KSS A;  1QW1 A;  4PG3 A;  2IY5 A;  1G5I A;  4C5G A;  5GAO r;  2JN0 A;  3OMC A;  5KCO A;  2EQK A;  3ME9 A;  5CVI A;  2CZ6 B;  4TVA B;  4C8Q B;  4UP7 A;  4YRQ A;  4EDU A;  2X4W A;  4E47 A;  4J6W A;  2X4J A;  3DLL A;  4DOW A;  4N0A C;  4VUB A;  3MHX A;  2CJ9 A;  4XQ3 A;  1GGM A;  4YDQ A;  4RKU E;  4C92 F;  1KQS S;  3PGG A;  1G3W A;  1VQ7 T;  4M75 D;  3CCL T;  4EMG A;  4LD9 K;  2EL9 A;  4M78 C;  4YRF A;  3VQY A;  1Q86 U;  4M78 G;  5CO7 A;  2KMT A;  3V8J A;  3QO3 A;  2CKK A;  5AYF A;  4M7A E;  2KY9 A;  2XD0 A;  3BDL A;  3FRN A;  1E24 A;  3CC2 A;  3I55 T;  1B34 B;  5GAO q;  2L5Q A;  2ARU A;  2ZNJ A;  5D6Y A;  3QBY A;  2LTO A;  3A8M B;  2K57 A;  2V8J A;  4H2W A;  1NPP A;  1RIQ A;  3EAE A;  2YHT A;  2YRV A;  2EQJ A;  4LVM A;  2DXT A;  3M4G A;  2I2L A;  5GAN 3;  3X28 B;  2XIC A;  1VQM A;  2JOY A;  3OYE A;  1YIT A;  3N5B B;  2LT1 A;  4F7U E;  4GLK A;  1NNH A;  1L0W A;  3HY1 A;  2DTI A;  3FEO A;  2K5I A;  4DA4 A;  2RK2 A;  2F5T X;  1E1T A;  2QHT A;  1YI2 T;  2XID A;  1USY C;  4R55 A;  1N9R A;  1X01 A;  1JB0 E;  4P75 C;  4IUP A;  1E1O A;  3P8D A;  1BI3 A;  2E65 A;  1K9M C;  1JBM A;  4C92 D;  3SD4 A;  5DLO A;  2QEX A;  2RHY A;  2XK0 A;  1VQ6 T;  3O8V A;  4J7I A;  5M9O A;  2RJE A;  3QTC A;  1VQN A;  1H3Z A;  5GAN 6;  1X55 A;  1D3B B;  4JLG A;  4C8Q C;  4XU2 A;  3UFG A;  3EFS A;  4FT2 A;  4C8Q G;  4YRO A;  2QQB A;  2JTM A;  3HRT A;  3EFR A;  5CKD A;  2QHV A;  3VU3 C;  4BWA A;  3S3M A;  3OYB A;  2ODR D;  4XTV A;  4N4I A;  2ZR2 A;  4JJN K;  1X75 C;  4C5I A;  3OQ5 A;  1YFR A;  4H2S A;  2O4X A;  4LDU A;  3VYG A;  3JCM e;  1ADJ A;  4TQD A;  3G4S A;  3BY7 A;  3OYF A;  3V7R A;  3LSQ A;  2CZ0 B;  3OW2 S;  3CMA A;  3S3N A;  4ZGE B;  3RMQ A;  4C92 A;  3PIP A;  2ZIM A;  3NEM A;  3URG A;  3V8L A;  3HFZ B;  1YJN A;  1N8R C;  5LJ3 e;  3JB9 I;  3H8Z A;  2ZT5 A;  2WSE E;  3MO8 A;  2C7I A;  3LW5 E;  5CQX A;  3HFV A;  4ELZ C;  3MCA B;  2RHQ B;  2AMC A;  2DK3 A;  3GLX A;  3HP9 A;  3C12 A;  3RES A;  3JB9 F;  3F70 A;  3KFU A;  3G71 T;  2R58 A;  4LVJ A;  4UP9 A;  1Q82 C;  4C0Z A;  5CQY A;  1KC8 U;  3LX7 A;  1B70 B;  3SWN A;  1J5W A;  2WSF E;  5IAY A;  3IAL A;  2GFA A;  2E3C A;  5FRM A;  1NJ5 A;  1M1K C;  5C52 B;  4M75 E;  3OS0 A;  3L2R A;  2D6F A;  4H2X B;  3L4G B;  4Q6G A;  3G4S T;  2EYQ A;  5KE2 A;  3M57 A;  4ZTJ A;  5GAN e;  2K3Y A;  3CMA T;  3TU4 K;  3OD1 A;  2V8K A;  1B7Y B;  1G51 A;  5DM7 R;  4II1 A;  4B9W A;  1UGP B;  1YJN T;  1JRI A;  4M77 F;  1ZHI A;  1RL2 A;  3IKL A;  2LCC A;  3CCQ T;  3UPU A;  2QHS A;  2KDS A;  4HCZ A;  3PNW C;  2E5Q A;  5GMK e;  2R57 A;  4KR2 A;  2RK1 A;  2RHU A;  3C4S A;  4RCB A;  4L59 A;  2RI2 A;  4X5O A;  4YRG A;  2CZ7 B;  2I4M A;  3M5A A;  2DXB A;  2RA2 A;  4IKF A;  3S3O A;  1VQP A;  2DEQ A;  4F7U F;  3JB9 D;  4OF1 A;  4PLI A;  3LWI A;  2AKW B;  1UGR B;  3OYJ A;  2MMP A;  2J3L A;  3QZ5 B;  4YP0 A;  1KHI A;  1I5L A;  2Q7H A;  3RKX A;  4H02 A;  1QVG A;  1N27 A;  3GOX A;  3C95 A;  4C92 E;  4M7D B;  4ME7 A;  1EFW A;  1FX7 A;  2EAY A;  2EKO A;  5LJ3 g;  4IUU A;  3HY0 A;  2DTH A;  3NFC A;  4G84 A;  2VYT A;  3L42 A;  3JCM d;  4JRP A;  2FVU A;  5J3B A;  3VQV A;  4M77 D;  4P3P A;  3HFN A;  2P0K A;  4NCX A;  1VQ4 A;  4XEO A;  2Y4X A;  4X9C A;  2D9T A;  5GAM e;  2QDY B;  5FLX E;  4J7F A;  2C8M A;  2Q7E A;  1VQ9 A;  2V8I A;  4RQF A;  4P72 A;  5LJ3 d;  1QVF A;  2DAQ A;  1SRY A;  4P71 C;  2K5L A;  2DVE A;  5GMK m;  1EOV A;  3LYI A;  1M1K U;  1EQR A;  2DQ0 A;  4HWR A;  3W3S A;  3RIR A;  4XEM A;  3S6W A;  2PQW A;  3VUB A;  4BUG A;  2QQA A;  1XQH A;  3M4P A;  1HXD A;  4N4G A;  1YFT A;  5GAN g;  1WNL A;  4BI3 A;  1KMN A;  3C94 A;  1BI1 A;  1PSE A;  4EX5 A;  4JUV A;  2ALY B;  3E9H A;  3GPL A;  2X35 A;  1Y07 A;  3VYH B;  3FC3 A;  4BW9 A;  4P74 A;  4MZM A;  3G7Z A;  4C0D C;  4M77 A;  4KT0 E;  4PJO G;  1NJ8 A;  4IUR A;  1H4T A;  4OVA A;  3ERR A;  4GY5 A;  1B8A A;  2Y90 A;  4JDS A;  2MWP A;  1V29 B;  4HWT A;  2P0L A;  4CI0 C;  2RHI A;  12AS A;  2QI2 A;  2ZTG A;  5GAN d;  1C0A A;  4ZTZ B;  5LJ3 j;  2E70 A;  4NOY A;  2QTX A;  5EG2 A;  1VQ9 T;  3A5Y A;  4M75 F;  4M7D C;  4YRR A;  1EIY A;  3M56 A;  1N9W A;  1WPY A;  4F7U A;  4M7D G;  5D6X A;  2E10 A;  2FB7 A;  3CXC A;  2E6N A;  2ZPB B;  4P73 A;  3WQZ A;  5A0G A;  4ZIB A;  3KXT A;  4PJO D;  5GAN 5;  3NET A;  4R56 A;  2KQW A;  2EQM A;  3RER A;  3P8H A;  3HRS A;  3HXY A;  4BDY A;  2R5M A;  4PNO A;  1Y71 A;  3CCU T;  1ZQ1 A;  2P5I A;  1ADY A;  3RF1 A;  4OB3 B;  1FXX A;  3G1Z A;  1WGS A;  4QW2 A;  4EMK A;  4QVC A;  4UC4 A;  3PZC A;  4MDX A;  1EIF A;  1XTD A;  1JJC A;  2LNV A;  1QVP A;  2KVQ G;  2VXF A;  3CCM T;  3GIB A;  3FJP A;  4Y91 A;  1FYF A;  5GAN j;  4HA8 A;  3REX A;  5GAM g;  4M78 F;  5C53 B;  4RMF A;  2RJD A;  3GP8 A;  1VQL T;  2LVM A;  3A8G B;  4OB2 B;  2CGH A;  3H6Z A;  2RO0 A;  1YI2 A;  2E64 A;  4LNS A;  4X34 A;  4QQ6 A;  3JCM P;  2OTJ A;  1WJR A;  1OZ2 A;  3DSQ A;  4E7I A;  2NS6 A;  2PUK B;  4UP8 A;  3IG2 A;  3CC4 A;  5GAM d;  1BBU A;  2M1H A;  2VXE A;  1VQ6 A;  2CYZ B;  3UDC A;  4NS5 A;  3NTI A;  4WJ3 M;  3X20 B;  4KUD K;  2I4L A;  4EO4 A;  4G85 A;  1FWZ A;  2D0Q B;  4O6J A;  1PYS A;  4M77 E;  1I4K 1;  4HT4 A;  3GNF B;  3M4Y A;  3BDU A;  4BI4 A;  4JS5 A;  5K1P A;  1DJ7 B;  2H3J A;  1NYR A;  1YHQ T;  5CCA A;  1Y7X A;  4YRS A;  1Q7Y U;  2VC8 A;  1KC8 C;  2K2V A;  2EWN A;  3HXV A;  5E3I A;  2GF7 A;  5A0L A;  4OB0 B;  3UGT A;  3A8O B;  2HNI A;  4M78 D;  3BFM A;  3OYM A;  1HK9 A;  3LGF A;  3MQZ A;  4C8Q F;  4ZTF A;  3JCM f;  1YFS A;  4YRT A;  4M75 A;  2Q5I A;  3OYH A;  3UH0 A;  3AHU A;  1KG1 A;  5GAM j;  2OTJ T;  1Y96 A;  4MMK A;  3NTH A;  2ZXF A;  3CC4 T;  3A5Z A;  4JRK A;  3E19 A;  1H4S A;  3HPW A;  2BUD A;  1YCY A;  4A4G A;  2C06 A;  3KBG A;  3QJ6 A;  5LJ3 f;  3MET A;  3SWN C;  5C51 B;  5HGQ A;  5CK9 A;  2ZIN A;  4MZP A;  5LJ5 f;  4HCB A;  4NL3 A;  1S72 T;  4HT9 A;  3G71 A;  4N0A A;  3CME T;  4HWP A;  2XGT A;  2RD1 A;  4P3N A;  4XTY A;  5IT9 E;  4YTL A;  4M78 A;  1VQ5 T;  1KMM A;  5D6W A;  2XTI A;  2DXU A;  2J3M A;  4ZGJ B;  3CEY A;  4RG2 A;  5DLQ E;  4TQF A;  4PJO E;  5CKF A;  2YLB A;  3TEH A;  3JCM h;  4C8Q D;  4CS2 A;  5GAN f;  3OSS C;  4M7A B;  5K1X A;  4H2Y A;  5FRN A;  3G6E A;  3CCQ A;  5J39 A;  3PCO A;  5LJ5 e;  3A31 A;  3RMS A;  4LDX A;  5ELO A;  2ARS A;  3A7R A;  1I8F A;  3TRE A;  5LJ3 h;  3CCS T;  3TEE A;  1YJW A;  1QVG S;  1XOV A;  3CPW S;  4IUQ A;  2DIQ A;  4JLI A;  1USY A;  1W66 A;  4N4H A;  5KCH A;  1KQ1 A;  2ZPH B;  4P75 A;  2JZ2 A;  5C0M A;  4F7U B;  1BBW A;  3SDZ A;  3P8V A;  3I7F A;  4C0F A;  3DB3 A;  5GAO m;  1M4Z A;  4BE0 A;  1VUB A;  4RCC A;  3OBW A;  1H4Q A;  4XTU A;  4C8Q A;  3RUX A;  3MEV A;  2M9U A;  2RJF A;  1BI2 A;  1M5Q 1;  3OS2 A;  3MP1 A;  1X2H A;  3A7A A;  4LDW A;  4NL2 A;  4L87 A;  2DZ9 A;  2IY5 B;  4P72 C;  4J8O A;  5GAN h;  3T9N A;  2ZZG A;  1NE8 A;  4E51 A;  3G6E T;  2RI5 A;  1VQZ A;  3LSS A;  3L2U A;  2PUO B;  2QXF A;  5GMK l;  1NPR A;  5CKB A;  2JNG A;  1W2B A;  5CAI A;  4DOV A;  1XNI A;  3QZ9 B;  1YJW T;  5GAM f;  4C0D B;  2HQX A;  1IL2 A;  1NJI C;  4IUT A;  4M78 E;  5GMK h;  2DD5 A;  3VUZ A;  3OW2 A;  4OMF B;  2R5A A;  1B34 A;  5I21 A;  1IRE B;  1WJS A;  4RG8 A;  4QVD A;  2DQ3 A;  3M53 A;  3JCM g;  4P74 C;  2DJZ A;  1W4S A;  4M7A C;  2ZPG B;  1SET A;  3ZFJ A;  4M7A G;  2OTL T;  1X56 A;  5LL6 S;  4RQE A;  2ZZE A;  3HSB A;  3UGQ A;  2HQE A;  1WLE A;  1U1T A;  2K3X A;  3QII A;  3WVD B;  2VV5 A;  4PLL A;  1LYL A;  2CZ1 B;  4L6V 5;  4LVK A;  3L2Q A;  2LX9 A;  3OS1 A;  2RHX A;  3A8H B;  3P8Y A;  1M1G A;  3PFS A;  1IZ6 A;  1VQK T;  3CBM A;  1X54 A;  2XKO C;  5LJ5 g;  4AH6 A;  3JB9 H;  2A7Y A;  4ZN1 A;  3CD6 A;  4J6Y A;  3NEN A;  1PSF A;  5J26 A;  4YRK A;  4XAX B;  1YJ9 T;  2QHU A;  4HWO A;  3OYN A;  1BIA A;  4L5G A;  3ER0 A;  3P8T A;  1WQ7 A;  3JSC A;  3VQX A;  4JRQ A;  4QQD A;  1K73 C;  2Q7G A;  2PU9 B;  4BE1 A;  4C5H A;  3HHT B;  3CCJ T;  4M75 B;  1UGS B;  2MF2 A;  5GAM h;  5LJ5 d;  1K8A C;  4PJO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...