2QHTA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
b'MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase
molecule tags Transferase
source organism Thermus thermophilus
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
total genus 66
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhtA01
2ZR2A 4P73A 3OD1A 3V7RA 2DQ3A 3V8KA 2ZT7A 1L0WA 1WYDA 5C53B 2AKWA 4TTVA 3TUPA 4P75A 2DJZA 2CGHA 1G5IA 4TQFA 1EOVA 4HWSA 1X2HA 2ZZGA 1BBUA 1SERA 1ATIA 2ZT8A 12ASA 4H2YA 4G85A 4XTVA 3E9HA 1WNLA 3HY1A 3P8TA 1RIQA 4UPAA 4G84A 4AH6A 4TVWA 1IL2A 3UGTA 3W3SA 1Z7MA 5K1PA 4HWPA 1KMMA 4YRPA 1NNHA 3BFMA 4P74C 2C7IA 2IY5B 3TEHB 3FJPA 1GGMA 1NJ5A 3UH0A 2ZR3A 3L1AA 3REUA 4H02A 1SESA 5KNNA 2I4OA 4YYEA 2E64A 4EX5A 3PZCA 3A31A 4YRCA 4H2VA 2EJGA 5K1XA 4WJ4A 4K88A 4P72C 2RHQA 4YRNA 3RL6A 4DQ2A 1X55A 4HWRA 2FYKA 1B70A 2EAYA 1W66A 1YB3A 2DTOA 3NENA 3QO5A 2AMCA 2CIMA 4WI1A 3I7FA 2E65A 3IKMB 1B7YB 1J5WA 2QHUA 4YRFA 2DU5A 11ASA 1E22A 3HXZA 2DTIA 4YRTA 2DQ0A 2RHSA 2DKGA 1WU7A 1E1TA 2QHSA 2HNIA 1E24A 3HXXA 1NJ2A 4O2DA 3HRIA 4CH3A 2DU7A 3UGQA 1FYFA 4KR2A 2J3MA 1USYC 2DEQA 2ZZFA 3TEHA 4YRMA 2P5IA 2I4NA 1C0AA 2ZIOA 1BIAA 4YRRA 3V8JA 4P71A 4H2XB 4RMFA 3V8LA 1SRYA 4YRSA 4YCUA 4YDQA 3LSQA 3EFSA 1VQZA 3HXYA 2DZCA 4CH5A 1X56A 2CJBA 4YCWA 4XTYA 4CS4A 1HC7A 3QO8A 3A5ZA 3HXVA 3QO7A 1G51A 2ZNJA 1G5HA 1EFWA 4EO4A 3L4GA 3QTCA 2EL9A 1H4SA 2XGTA 3VQWA 4TQDA 2AMCB 1WLEA 2ZNIA 4HWOA 1N9WA 4P3PA 3VQVA 4BWAA 1USYA 3CMQA 4H2UA 2ZZEA 3A7RA 4CS2A 4KQEA 4P3OA 2AKWB 2ZTGA 1YFSA 4OP0A 1HTTA 1JJCB 3A32A 4ZTUB 3RIRA 1KMNA 1YFTA 4BW9A 4P75C 2Q7GA 1X2GA 1PYSB 3IKLA 2Q5HA 1X54A 2DVEA 1WQ7A 3A5YA 2CJAA 3LSSA 1Z7NA 3DSQA 4UP7A 2DZ9A 4H2XA 3IG2A 2ZGWA 3HXUA 4KR3A 1YGBA 3PCOA 4Q15A 2ZT6A 1NJ8A 4TVAB 3WQZA 4RQEA 1EIYB 4YPFA 1NYRA 4Q6GA 2P0LA 4P74A 4CH4A 4YRLA 2ZIMA 2ZXFA 3UFGA 3P8VA 3HY0A 4UP9A 4XEMA 1LYLA 4K87A 4XU3A 5E3IA 2E1HA 3HRKA 4XTZA 4XU1A 2ZINA 4YRJA 4E51A 2ALYA 4HA8A 1WPYA 4YCVA 3RKYA 4LNSA 1B70B 4P73C 1SETA 4TVYA 1H4VB 4OLFA 4CS3A 2XTIA 2DXUA 1NYQA 3MEYA 3P8YA 4XU2A 3HTZA 4YRIA 2ZCEA 4RQFA 4HWTA 3M4QA 2ARUA 3NETA 4K86A 1B76A 5ELOA 4XEOA 3RKXA 1EVKA 2C8MA 2EJFA 1NJ1A 2ARSA 2ODRD 2RHSB 3A74A 2PMFA 2IY5A 2QHVA 1ADJA 2CJ9A 1QE0A 4YP0A 1X01A 4TVAA 4WF2A 1EIYA 4P72A 2E5AA 2I4LA 1H4TA 2RHQB 2DDZA 2I4MA 2DTHA 4UP8A 4XU0A 2E3CA 2PMEA 2Q7EA 3R07A 1B8AA 4J15A 2ARTA 2ODRC 4XTXA 5C51B 2E41A 2Q7HA 3HFZB 4H2SA 4X5OA 3EFRA 5HGQA 3L2ZA 3HFVA 5F5WA 4H2TA 3KFUA 3RGLA 1EVLA 4YRKA 4ZIBA 3NELA 4RDXA 1WQWA 5C52B 1B7YA 2ZT5A 3RACA 2J3LA 3V7CA 1BIBA 1ADYA 4DPGA 3NEMA 3RF1A 2G4CA 4ZTZB 1BBWA 3A7AA 3ERRA 1E1OA 3G1ZA 3VQYA 4PG3A 1EQRA 4P71C 1ASYA 4YRGA 4HVCA 1QF6A 4XTUA 3E9IA 4WJ3M 3V7SA 3MF2A 1JJCA 3REXA 2EWNA 2DXTA 1KOGA 3MF1A 3A7UA 1ASZA 4PHCA 1PYSA 3M4PA 4YRQA 1YFRA 2E10A 3HXWA 2QHTA 2ALYB 3RKWA 4P3NA 3IALA 4YROA 4NCXA 3TEGA 4XTWA 1HXDA 3PCOB 4YREA 3ICAA 4H2WA 3L4GB 1H4QA 3VBBA 5ELNA 3LC0A 2EJ9A 4TWAA 3HFZA 3QNEA 3BJUA 2Q5IA 4L87A 4CH6A 3VQXA 3RUXA 1NJ6A
chains in the Genus database with same CATH superfamily
2ZR2A 4P73A 3OD1A 3V7RA 2DQ3A 3V8KA 2ZT7A 1L0WA 1WYDA 5C53B 2AKWA 4TTVA 3TUPA 4P75A 2DJZA 2A8EA 2CGHA 1G5IA 4TQFA 1EOVA 4HWSA 1X2HA 2ZZGA 1BBUA 1SERA 1ATIA 2ZT8A 12ASA 4H2YA 4G85A 4XTVA 3E9HA 1WNLA 3HY1A 3P8TA 1RIQA 4UPAA 4G84A 4AH6A 4TVWA 1IL2A 3UGTA 3W3SA 1Z7MA 5K1PA 4HWPA 1KMMA 4YRPA 4LVIA 1NNHA 3BFMA 4P74C 2C7IA 4HT4A 2IY5B 3TEHB 3FJPA 1GGMA 1NJ5A 3UH0A 2ZR3A 3L1AA 3REUA 4H02A 1SESA 5KNNA 2I4OA 4YYEA 2E64A 4EX5A 3PZCA 3A31A 4YRCA 4H2VA 2EJGA 5K1XA 4WJ4A 4K88A 4P72C 2RHQA 4YRNA 3RL6A 4DQ2A 1X55A 4HWRA 2FYKA 1B70A 2EAYA 1W66A 1YB3A 2DTOA 3NENA 4LVKA 3QO5A 2AMCA 2CIMA 4WI1A 3I7FA 2E65A 3IKMB 1B7YB 1J5WA 2QHUA 4YRFA 2DU5A 11ASA 1E22A 3HXZA 2DTIA 4YRTA 2DQ0A 2RHSA 2DKGA 1WU7A 1E1TA 2QHSA 2HNIA 1E24A 3HXXA 1NJ2A 4O2DA 3HRIA 4CH3A 2DU7A 3UGQA 1FYFA 4KR2A 2J3MA 1USYC 2DEQA 2ZZFA 3TEHA 4YRMA 2P5IA 2I4NA 1C0AA 2ZIOA 1BIAA 4YRRA 3V8JA 4P71A 4H2XB 4RMFA 3V8LA 1SRYA 4YRSA 4YCUA 4YDQA 3LSQA 3EFSA 1VQZA 3HXYA 2DZCA 4CH5A 1X56A 2CJBA 4YCWA 4XTYA 4CS4A 1HC7A 3QO8A 3A5ZA 3HXVA 3QO7A 1G51A 2ZNJA 1G5HA 1EFWA 4EO4A 3L4GA 3QTCA 2EL9A 1H4SA 2XGTA 3VQWA 4TQDA 2AMCB 1WLEA 2ZNIA 4HWOA 1N9WA 4P3PA 3VQVA 4BWAA 1USYA 3CMQA 4H2UA 2ZZEA 3A7RA 4CS2A 4KQEA 4P3OA 2AKWB 2ZTGA 1YFSA 4OP0A 1HTTA 1JJCB 3A32A 4ZTUB 3RIRA 1KMNA 1YFTA 4BW9A 4P75C 2Q7GA 1X2GA 1PYSB 3IKLA 2Q5HA 1X54A 2DVEA 1WQ7A 3A5YA 2CJAA 3LSSA 1Z7NA 3DSQA 4UP7A 2DZ9A 4H2XA 3IG2A 2ZGWA 3HXUA 4KR3A 1YGBA 3PCOA 4Q15A 2ZT6A 1NJ8A 4TVAB 3WQZA 4RQEA 1EIYB 4YPFA 1NYRA 4Q6GA 2P0LA 4P74A 4CH4A 4YRLA 2ZIMA 2ZXFA 3UFGA 3P8VA 3HY0A 4UP9A 4XEMA 1LYLA 4K87A 4XU3A 5E3IA 2E1HA 3HRKA 4XTZA 4XU1A 2ZINA 4YRJA 4E51A 2ALYA 4HA8A 1WPYA 4LVMA 4YCVA 3RKYA 4LNSA 1B70B 4P73C 1SETA 4TVYA 1H4VB 4OLFA 4CS3A 2XTIA 2DXUA 1NYQA 3MEYA 3P8YA 4XU2A 3HTZA 4YRIA 2ZCEA 4RQFA 4HWTA 3M4QA 2ARUA 3NETA 4K86A 1B76A 5ELOA 4XEOA 3RKXA 1EVKA 2C8MA 2EJFA 1NJ1A 2ARSA 2ODRD 2RHSB 3A74A 2PMFA 2IY5A 2QHVA 1ADJA 2CJ9A 1QE0A 4YP0A 1X01A 4TVAA 4WF2A 1EIYA 4P72A 2E5AA 2I4LA 1H4TA 2RHQB 2DDZA 2I4MA 2DTHA 4UP8A 4XU0A 2E3CA 4LVJA 2PMEA 2Q7EA 3R07A 1B8AA 4J15A 2ARTA 2ODRC 4XTXA 5C51B 2E41A 2Q7HA 3HFZB 4H2SA 4X5OA 3EFRA 5HGQA 3L2ZA 3HFVA 5F5WA 4H2TA 3KFUA 3RGLA 1EVLA 4YRKA 3MQZA 4ZIBA 3NELA 4RDXA 1WQWA 5C52B 1B7YA 2ZT5A 3RACA 2J3LA 3V7CA 1BIBA 1ADYA 4DPGA 3NEMA 3RF1A 2G4CA 4ZTZB 4LVLA 1BBWA 3A7AA 3ERRA 1E1OA 3G1ZA 3VQYA 4PG3A 1EQRA 4P71C 1ASYA 4YRGA 4HVCA 1QF6A 4XTUA 3E9IA 4WJ3M 3V7SA 3MF2A 1JJCA 3REXA 2EWNA 2DXTA 1KOGA 3MF1A 3A7UA 1ASZA 4PHCA 1PYSA 3M4PA 4YRQA 1YFRA 2E10A 3HXWA 2QHTA 2ALYB 3RKWA 4P3NA 3IALA 4YROA 4NCXA 3TEGA 4XTWA 1HXDA 3PCOB 4YREA 3ICAA 4H2WA 3L4GB 1H4QA 3VBBA 5ELNA 3LC0A 2EJ9A 4TWAA 3HFZA 3QNEA 3BJUA 2Q5IA 4L87A 4CH6A 3VQXA 3RUXA 1NJ6A 2NS6A
chains in the Genus database with same CATH topology
2ZR2A 4P73A 3OD1A 3V7RA 2DQ3A 3V8KA 2ZT7A 1L0WA 1WYDA 5C53B 2AKWA 4TTVA 3TUPA 4P75A 2DJZA 2A8EA 2CGHA 1G5IA 4TQFA 1EOVA 4HWSA 1X2HA 2ZZGA 1BBUA 1SERA 1ATIA 2ZT8A 12ASA 4H2YA 4G85A 4XTVA 3E9HA 1WNLA 3HY1A 3P8TA 1RIQA 4UPAA 4G84A 4AH6A 4TVWA 1IL2A 3UGTA 3W3SA 1Z7MA 5K1PA 4HWPA 1KMMA 4YRPA 4LVIA 1NNHA 3BFMA 4P74C 2C7IA 4HT4A 2IY5B 3TEHB 3FJPA 1GGMA 1NJ5A 3UH0A 2ZR3A 3L1AA 3REUA 4H02A 1SESA 5KNNA 2I4OA 4YYEA 2E64A 4EX5A 3PZCA 3A31A 4YRCA 4H2VA 2EJGA 5K1XA 4WJ4A 4K88A 4P72C 2RHQA 4YRNA 3RL6A 4DQ2A 1X55A 4HWRA 2FYKA 1B70A 2EAYA 1W66A 1YB3A 2DTOA 3NENA 4LVKA 3QO5A 2AMCA 2CIMA 4WI1A 3I7FA 2E65A 3IKMB 1B7YB 1J5WA 2QHUA 4YRFA 2DU5A 11ASA 1E22A 3HXZA 2DTIA 4YRTA 2DQ0A 2RHSA 2DKGA 1WU7A 1E1TA 2QHSA 2HNIA 1E24A 3HXXA 1NJ2A 4O2DA 3HRIA 4CH3A 2DU7A 3UGQA 1FYFA 4KR2A 2J3MA 1USYC 2DEQA 2ZZFA 3TEHA 4YRMA 2P5IA 2I4NA 1C0AA 2ZIOA 1BIAA 4YRRA 3V8JA 4P71A 4H2XB 4RMFA 3V8LA 1SRYA 4YRSA 4YCUA 4YDQA 3LSQA 3EFSA 1VQZA 3HXYA 2DZCA 4CH5A 1X56A 2CJBA 4YCWA 4XTYA 4CS4A 1HC7A 3QO8A 3A5ZA 3HXVA 3QO7A 1G51A 2ZNJA 1G5HA 1EFWA 4EO4A 3L4GA 3QTCA 2EL9A 1H4SA 2XGTA 3VQWA 4TQDA 2AMCB 1WLEA 2ZNIA 4HWOA 1N9WA 4P3PA 3VQVA 4BWAA 1USYA 3CMQA 4H2UA 2ZZEA 3A7RA 4CS2A 4KQEA 4P3OA 2AKWB 2ZTGA 1YFSA 4OP0A 1HTTA 1JJCB 3A32A 4ZTUB 3RIRA 1KMNA 1YFTA 4BW9A 4P75C 2Q7GA 1X2GA 1PYSB 3IKLA 2Q5HA 1X54A 2DVEA 1WQ7A 3A5YA 2CJAA 3LSSA 1Z7NA 3DSQA 4UP7A 2DZ9A 4H2XA 3IG2A 2ZGWA 3HXUA 4KR3A 1YGBA 3PCOA 4Q15A 2ZT6A 1NJ8A 4TVAB 3WQZA 4RQEA 1EIYB 4YPFA 1NYRA 4Q6GA 2P0LA 4P74A 4CH4A 4YRLA 2ZIMA 2ZXFA 3UFGA 3P8VA 3HY0A 4UP9A 4XEMA 1LYLA 4K87A 4XU3A 5E3IA 2E1HA 3HRKA 4XTZA 4XU1A 2ZINA 4YRJA 4E51A 2ALYA 4HA8A 1WPYA 4LVMA 4YCVA 3RKYA 4LNSA 1B70B 4P73C 1SETA 4TVYA 1H4VB 4OLFA 4CS3A 2XTIA 2DXUA 1NYQA 3MEYA 3P8YA 4XU2A 3HTZA 4YRIA 2ZCEA 4RQFA 4HWTA 3M4QA 2ARUA 3NETA 4K86A 1B76A 5ELOA 4XEOA 3RKXA 1EVKA 2C8MA 2EJFA 1NJ1A 2ARSA 2ODRD 2RHSB 3A74A 2PMFA 2IY5A 2QHVA 1ADJA 2CJ9A 1QE0A 4YP0A 1X01A 4TVAA 4WF2A 1EIYA 4P72A 2E5AA 2I4LA 1H4TA 2RHQB 2DDZA 2I4MA 2DTHA 4UP8A 4XU0A 2E3CA 4LVJA 2PMEA 2Q7EA 3R07A 1B8AA 4J15A 2ARTA 2ODRC 4XTXA 5C51B 2E41A 2Q7HA 3HFZB 4H2SA 4X5OA 3EFRA 5HGQA 3L2ZA 3HFVA 5F5WA 4H2TA 3KFUA 3RGLA 1EVLA 4YRKA 3MQZA 4ZIBA 3NELA 4RDXA 1WQWA 5C52B 1B7YA 2ZT5A 3RACA 2J3LA 3V7CA 1BIBA 1ADYA 4DPGA 3NEMA 3RF1A 2G4CA 4ZTZB 4LVLA 1BBWA 3A7AA 3ERRA 1E1OA 3G1ZA 3VQYA 4PG3A 1EQRA 4P71C 1ASYA 4YRGA 4HVCA 1QF6A 4XTUA 3E9IA 4WJ3M 3V7SA 3MF2A 1JJCA 3REXA 2EWNA 2DXTA 1KOGA 3MF1A 3A7UA 1ASZA 4PHCA 1PYSA 3M4PA 4YRQA 1YFRA 2E10A 3HXWA 2QHTA 2ALYB 3RKWA 4P3NA 3IALA 4YROA 4NCXA 3TEGA 4XTWA 1HXDA 3PCOB 4YREA 3ICAA 4H2WA 3L4GB 1H4QA 3VBBA 5ELNA 3LC0A 2EJ9A 4TWAA 3HFZA 3QNEA 3BJUA 2Q5IA 4L87A 4CH6A 3VQXA 3RUXA 1NJ6A 2NS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR2 A;  4P73 A;  3OD1 A;  3V7R A;  2DQ3 A;  3V8K A;  2ZT7 A;  1L0W A;  1WYD A;  5C53 B;  2AKW A;  4TTV A;  3TUP A;  4P75 A;  2DJZ A;  2CGH A;  1G5I A;  4TQF A;  1EOV A;  4HWS A;  1X2H A;  2ZZG A;  1BBU A;  1SER A;  1ATI A;  2ZT8 A;  12AS A;  4H2Y A;  4G85 A;  4XTV A;  3E9H A;  1WNL A;  3HY1 A;  3P8T A;  1RIQ A;  4UPA A;  4G84 A;  4AH6 A;  4TVW A;  1IL2 A;  3UGT A;  3W3S A;  1Z7M A;  5K1P A;  4HWP A;  1KMM A;  4YRP A;  1NNH A;  3BFM A;  4P74 C;  2C7I A;  2IY5 B;  3TEH B;  3FJP A;  1GGM A;  1NJ5 A;  3UH0 A;  2ZR3 A;  3L1A A;  3REU A;  4H02 A;  1SES A;  5KNN A;  2I4O A;  4YYE A;  2E64 A;  4EX5 A;  3PZC A;  3A31 A;  4YRC A;  4H2V A;  2EJG A;  5K1X A;  4WJ4 A;  4K88 A;  4P72 C;  2RHQ A;  4YRN A;  3RL6 A;  4DQ2 A;  1X55 A;  4HWR A;  2FYK A;  1B70 A;  2EAY A;  1W66 A;  1YB3 A;  2DTO A;  3NEN A;  3QO5 A;  2AMC A;  2CIM A;  4WI1 A;  3I7F A;  2E65 A;  3IKM B;  1B7Y B;  1J5W A;  2QHU A;  4YRF A;  2DU5 A;  11AS A;  1E22 A;  3HXZ A;  2DTI A;  4YRT A;  2DQ0 A;  2RHS A;  2DKG A;  1WU7 A;  1E1T A;  2QHS A;  2HNI A;  1E24 A;  3HXX A;  1NJ2 A;  4O2D A;  3HRI A;  4CH3 A;  2DU7 A;  3UGQ A;  1FYF A;  4KR2 A;  2J3M A;  1USY C;  2DEQ A;  2ZZF A;  3TEH A;  4YRM A;  2P5I A;  2I4N A;  1C0A A;  2ZIO A;  1BIA A;  4YRR A;  3V8J A;  4P71 A;  4H2X B;  4RMF A;  3V8L A;  1SRY A;  4YRS A;  4YCU A;  4YDQ A;  3LSQ A;  3EFS A;  1VQZ A;  3HXY A;  2DZC A;  4CH5 A;  1X56 A;  2CJB A;  4YCW A;  4XTY A;  4CS4 A;  1HC7 A;  3QO8 A;  3A5Z A;  3HXV A;  3QO7 A;  1G51 A;  2ZNJ A;  1G5H A;  1EFW A;  4EO4 A;  3L4G A;  3QTC A;  2EL9 A;  1H4S A;  2XGT A;  3VQW A;  4TQD A;  2AMC B;  1WLE A;  2ZNI A;  4HWO A;  1N9W A;  4P3P A;  3VQV A;  4BWA A;  1USY A;  3CMQ A;  4H2U A;  2ZZE A;  3A7R A;  4CS2 A;  4KQE A;  4P3O A;  2AKW B;  2ZTG A;  1YFS A;  4OP0 A;  1HTT A;  1JJC B;  3A32 A;  4ZTU B;  3RIR A;  1KMN A;  1YFT A;  4BW9 A;  4P75 C;  2Q7G A;  1X2G A;  1PYS B;  3IKL A;  2Q5H A;  1X54 A;  2DVE A;  1WQ7 A;  3A5Y A;  2CJA A;  3LSS A;  1Z7N A;  3DSQ A;  4UP7 A;  2DZ9 A;  4H2X A;  3IG2 A;  2ZGW A;  3HXU A;  4KR3 A;  1YGB A;  3PCO A;  4Q15 A;  2ZT6 A;  1NJ8 A;  4TVA B;  3WQZ A;  4RQE A;  1EIY B;  4YPF A;  1NYR A;  4Q6G A;  2P0L A;  4P74 A;  4CH4 A;  4YRL A;  2ZIM A;  2ZXF A;  3UFG A;  3P8V A;  3HY0 A;  4UP9 A;  4XEM A;  1LYL A;  4K87 A;  4XU3 A;  5E3I A;  2E1H A;  3HRK A;  4XTZ A;  4XU1 A;  2ZIN A;  4YRJ A;  4E51 A;  2ALY A;  4HA8 A;  1WPY A;  4YCV A;  3RKY A;  4LNS A;  1B70 B;  4P73 C;  1SET A;  4TVY A;  1H4V B;  4OLF A;  4CS3 A;  2XTI A;  2DXU A;  1NYQ A;  3MEY A;  3P8Y A;  4XU2 A;  3HTZ A;  4YRI A;  2ZCE A;  4RQF A;  4HWT A;  3M4Q A;  2ARU A;  3NET A;  4K86 A;  1B76 A;  5ELO A;  4XEO A;  3RKX A;  1EVK A;  2C8M A;  2EJF A;  1NJ1 A;  2ARS A;  2ODR D;  2RHS B;  3A74 A;  2PMF A;  2IY5 A;  2QHV A;  1ADJ A;  2CJ9 A;  1QE0 A;  4YP0 A;  1X01 A;  4TVA A;  4WF2 A;  1EIY A;  4P72 A;  2E5A A;  2I4L A;  1H4T A;  2RHQ B;  2DDZ A;  2I4M A;  2DTH A;  4UP8 A;  4XU0 A;  2E3C A;  2PME A;  2Q7E A;  3R07 A;  1B8A A;  4J15 A;  2ART A;  2ODR C;  4XTX A;  5C51 B;  2E41 A;  2Q7H A;  3HFZ B;  4H2S A;  4X5O A;  3EFR A;  5HGQ A;  3L2Z A;  3HFV A;  5F5W A;  4H2T A;  3KFU A;  3RGL A;  1EVL A;  4YRK A;  4ZIB A;  3NEL A;  4RDX A;  1WQW A;  5C52 B;  1B7Y A;  2ZT5 A;  3RAC A;  2J3L A;  3V7C A;  1BIB A;  1ADY A;  4DPG A;  3NEM A;  3RF1 A;  2G4C A;  4ZTZ B;  1BBW A;  3A7A A;  3ERR A;  1E1O A;  3G1Z A;  3VQY A;  4PG3 A;  1EQR A;  4P71 C;  1ASY A;  4YRG A;  4HVC A;  1QF6 A;  4XTU A;  3E9I A;  4WJ3 M;  3V7S A;  3MF2 A;  1JJC A;  3REX A;  2EWN A;  2DXT A;  1KOG A;  3MF1 A;  3A7U A;  1ASZ A;  4PHC A;  1PYS A;  3M4P A;  4YRQ A;  1YFR A;  2E10 A;  3HXW A;  2QHT A;  2ALY B;  3RKW A;  4P3N A;  3IAL A;  4YRO A;  4NCX A;  3TEG A;  4XTW A;  1HXD A;  3PCO B;  4YRE A;  3ICA A;  4H2W A;  3L4G B;  1H4Q A;  3VBB A;  5ELN A;  3LC0 A;  2EJ9 A;  4TWA A;  3HFZ A;  3QNE A;  3BJU A;  2Q5I A;  4L87 A;  4CH6 A;  3VQX A;  3RUX A;  1NJ6 A; 
#chains in the Genus database with same CATH topology
 2ZR2 A;  4P73 A;  3OD1 A;  3V7R A;  2DQ3 A;  3V8K A;  2ZT7 A;  1L0W A;  1WYD A;  5C53 B;  2AKW A;  4TTV A;  3TUP A;  4P75 A;  2DJZ A;  2A8E A;  2CGH A;  1G5I A;  4TQF A;  1EOV A;  4HWS A;  1X2H A;  2ZZG A;  1BBU A;  1SER A;  1ATI A;  2ZT8 A;  12AS A;  4H2Y A;  4G85 A;  4XTV A;  3E9H A;  1WNL A;  3HY1 A;  3P8T A;  1RIQ A;  4UPA A;  4G84 A;  4AH6 A;  4TVW A;  1IL2 A;  3UGT A;  3W3S A;  1Z7M A;  5K1P A;  4HWP A;  1KMM A;  4YRP A;  4LVI A;  1NNH A;  3BFM A;  4P74 C;  2C7I A;  4HT4 A;  2IY5 B;  3TEH B;  3FJP A;  1GGM A;  1NJ5 A;  3UH0 A;  2ZR3 A;  3L1A A;  3REU A;  4H02 A;  1SES A;  5KNN A;  2I4O A;  4YYE A;  2E64 A;  4EX5 A;  3PZC A;  3A31 A;  4YRC A;  4H2V A;  2EJG A;  5K1X A;  4WJ4 A;  4K88 A;  4P72 C;  2RHQ A;  4YRN A;  3RL6 A;  4DQ2 A;  1X55 A;  4HWR A;  2FYK A;  1B70 A;  2EAY A;  1W66 A;  1YB3 A;  2DTO A;  3NEN A;  4LVK A;  3QO5 A;  2AMC A;  2CIM A;  4WI1 A;  3I7F A;  2E65 A;  3IKM B;  1B7Y B;  1J5W A;  2QHU A;  4YRF A;  2DU5 A;  11AS A;  1E22 A;  3HXZ A;  2DTI A;  4YRT A;  2DQ0 A;  2RHS A;  2DKG A;  1WU7 A;  1E1T A;  2QHS A;  2HNI A;  1E24 A;  3HXX A;  1NJ2 A;  4O2D A;  3HRI A;  4CH3 A;  2DU7 A;  3UGQ A;  1FYF A;  4KR2 A;  2J3M A;  1USY C;  2DEQ A;  2ZZF A;  3TEH A;  4YRM A;  2P5I A;  2I4N A;  1C0A A;  2ZIO A;  1BIA A;  4YRR A;  3V8J A;  4P71 A;  4H2X B;  4RMF A;  3V8L A;  1SRY A;  4YRS A;  4YCU A;  4YDQ A;  3LSQ A;  3EFS A;  1VQZ A;  3HXY A;  2DZC A;  4CH5 A;  1X56 A;  2CJB A;  4YCW A;  4XTY A;  4CS4 A;  1HC7 A;  3QO8 A;  3A5Z A;  3HXV A;  3QO7 A;  1G51 A;  2ZNJ A;  1G5H A;  1EFW A;  4EO4 A;  3L4G A;  3QTC A;  2EL9 A;  1H4S A;  2XGT A;  3VQW A;  4TQD A;  2AMC B;  1WLE A;  2ZNI A;  4HWO A;  1N9W A;  4P3P A;  3VQV A;  4BWA A;  1USY A;  3CMQ A;  4H2U A;  2ZZE A;  3A7R A;  4CS2 A;  4KQE A;  4P3O A;  2AKW B;  2ZTG A;  1YFS A;  4OP0 A;  1HTT A;  1JJC B;  3A32 A;  4ZTU B;  3RIR A;  1KMN A;  1YFT A;  4BW9 A;  4P75 C;  2Q7G A;  1X2G A;  1PYS B;  3IKL A;  2Q5H A;  1X54 A;  2DVE A;  1WQ7 A;  3A5Y A;  2CJA A;  3LSS A;  1Z7N A;  3DSQ A;  4UP7 A;  2DZ9 A;  4H2X A;  3IG2 A;  2ZGW A;  3HXU A;  4KR3 A;  1YGB A;  3PCO A;  4Q15 A;  2ZT6 A;  1NJ8 A;  4TVA B;  3WQZ A;  4RQE A;  1EIY B;  4YPF A;  1NYR A;  4Q6G A;  2P0L A;  4P74 A;  4CH4 A;  4YRL A;  2ZIM A;  2ZXF A;  3UFG A;  3P8V A;  3HY0 A;  4UP9 A;  4XEM A;  1LYL A;  4K87 A;  4XU3 A;  5E3I A;  2E1H A;  3HRK A;  4XTZ A;  4XU1 A;  2ZIN A;  4YRJ A;  4E51 A;  2ALY A;  4HA8 A;  1WPY A;  4LVM A;  4YCV A;  3RKY A;  4LNS A;  1B70 B;  4P73 C;  1SET A;  4TVY A;  1H4V B;  4OLF A;  4CS3 A;  2XTI A;  2DXU A;  1NYQ A;  3MEY A;  3P8Y A;  4XU2 A;  3HTZ A;  4YRI A;  2ZCE A;  4RQF A;  4HWT A;  3M4Q A;  2ARU A;  3NET A;  4K86 A;  1B76 A;  5ELO A;  4XEO A;  3RKX A;  1EVK A;  2C8M A;  2EJF A;  1NJ1 A;  2ARS A;  2ODR D;  2RHS B;  3A74 A;  2PMF A;  2IY5 A;  2QHV A;  1ADJ A;  2CJ9 A;  1QE0 A;  4YP0 A;  1X01 A;  4TVA A;  4WF2 A;  1EIY A;  4P72 A;  2E5A A;  2I4L A;  1H4T A;  2RHQ B;  2DDZ A;  2I4M A;  2DTH A;  4UP8 A;  4XU0 A;  2E3C A;  4LVJ A;  2PME A;  2Q7E A;  3R07 A;  1B8A A;  4J15 A;  2ART A;  2ODR C;  4XTX A;  5C51 B;  2E41 A;  2Q7H A;  3HFZ B;  4H2S A;  4X5O A;  3EFR A;  5HGQ A;  3L2Z A;  3HFV A;  5F5W A;  4H2T A;  3KFU A;  3RGL A;  1EVL A;  4YRK A;  3MQZ A;  4ZIB A;  3NEL A;  4RDX A;  1WQW A;  5C52 B;  1B7Y A;  2ZT5 A;  3RAC A;  2J3L A;  3V7C A;  1BIB A;  1ADY A;  4DPG A;  3NEM A;  3RF1 A;  2G4C A;  4ZTZ B;  4LVL A;  1BBW A;  3A7A A;  3ERR A;  1E1O A;  3G1Z A;  3VQY A;  4PG3 A;  1EQR A;  4P71 C;  1ASY A;  4YRG A;  4HVC A;  1QF6 A;  4XTU A;  3E9I A;  4WJ3 M;  3V7S A;  3MF2 A;  1JJC A;  3REX A;  2EWN A;  2DXT A;  1KOG A;  3MF1 A;  3A7U A;  1ASZ A;  4PHC A;  1PYS A;  3M4P A;  4YRQ A;  1YFR A;  2E10 A;  3HXW A;  2QHT A;  2ALY B;  3RKW A;  4P3N A;  3IAL A;  4YRO A;  4NCX A;  3TEG A;  4XTW A;  1HXD A;  3PCO B;  4YRE A;  3ICA A;  4H2W A;  3L4G B;  1H4Q A;  3VBB A;  5ELN A;  3LC0 A;  2EJ9 A;  4TWA A;  3HFZ A;  3QNE A;  3BJU A;  2Q5I A;  4L87 A;  4CH6 A;  3VQX A;  3RUX A;  1NJ6 A;  2NS6 A; 
#chains in the Genus database with same CATH homology
 2ZR2 A;  4P73 A;  3OD1 A;  3V7R A;  2DQ3 A;  3V8K A;  2ZT7 A;  1L0W A;  1WYD A;  5C53 B;  2AKW A;  4TTV A;  3TUP A;  4P75 A;  2DJZ A;  2A8E A;  2CGH A;  1G5I A;  4TQF A;  1EOV A;  4HWS A;  1X2H A;  2ZZG A;  1BBU A;  1SER A;  1ATI A;  2ZT8 A;  12AS A;  4H2Y A;  4G85 A;  4XTV A;  3E9H A;  1WNL A;  3HY1 A;  3P8T A;  1RIQ A;  4UPA A;  4G84 A;  4AH6 A;  4TVW A;  1IL2 A;  3UGT A;  3W3S A;  1Z7M A;  5K1P A;  4HWP A;  1KMM A;  4YRP A;  4LVI A;  1NNH A;  3BFM A;  4P74 C;  2C7I A;  4HT4 A;  2IY5 B;  3TEH B;  3FJP A;  1GGM A;  1NJ5 A;  3UH0 A;  2ZR3 A;  3L1A A;  3REU A;  4H02 A;  1SES A;  5KNN A;  2I4O A;  4YYE A;  2E64 A;  4EX5 A;  3PZC A;  3A31 A;  4YRC A;  4H2V A;  2EJG A;  5K1X A;  4WJ4 A;  4K88 A;  4P72 C;  2RHQ A;  4YRN A;  3RL6 A;  4DQ2 A;  1X55 A;  4HWR A;  2FYK A;  1B70 A;  2EAY A;  1W66 A;  1YB3 A;  2DTO A;  3NEN A;  4LVK A;  3QO5 A;  2AMC A;  2CIM A;  4WI1 A;  3I7F A;  2E65 A;  3IKM B;  1B7Y B;  1J5W A;  2QHU A;  4YRF A;  2DU5 A;  11AS A;  1E22 A;  3HXZ A;  2DTI A;  4YRT A;  2DQ0 A;  2RHS A;  2DKG A;  1WU7 A;  1E1T A;  2QHS A;  2HNI A;  1E24 A;  3HXX A;  1NJ2 A;  4O2D A;  3HRI A;  4CH3 A;  2DU7 A;  3UGQ A;  1FYF A;  4KR2 A;  2J3M A;  1USY C;  2DEQ A;  2ZZF A;  3TEH A;  4YRM A;  2P5I A;  2I4N A;  1C0A A;  2ZIO A;  1BIA A;  4YRR A;  3V8J A;  4P71 A;  4H2X B;  4RMF A;  3V8L A;  1SRY A;  4YRS A;  4YCU A;  4YDQ A;  3LSQ A;  3EFS A;  1VQZ A;  3HXY A;  2DZC A;  4CH5 A;  1X56 A;  2CJB A;  4YCW A;  4XTY A;  4CS4 A;  1HC7 A;  3QO8 A;  3A5Z A;  3HXV A;  3QO7 A;  1G51 A;  2ZNJ A;  1G5H A;  1EFW A;  4EO4 A;  3L4G A;  3QTC A;  2EL9 A;  1H4S A;  2XGT A;  3VQW A;  4TQD A;  2AMC B;  1WLE A;  2ZNI A;  4HWO A;  1N9W A;  4P3P A;  3VQV A;  4BWA A;  1USY A;  3CMQ A;  4H2U A;  2ZZE A;  3A7R A;  4CS2 A;  4KQE A;  4P3O A;  2AKW B;  2ZTG A;  1YFS A;  4OP0 A;  1HTT A;  1JJC B;  3A32 A;  4ZTU B;  3RIR A;  1KMN A;  1YFT A;  4BW9 A;  4P75 C;  2Q7G A;  1X2G A;  1PYS B;  3IKL A;  2Q5H A;  1X54 A;  2DVE A;  1WQ7 A;  3A5Y A;  2CJA A;  3LSS A;  1Z7N A;  3DSQ A;  4UP7 A;  2DZ9 A;  4H2X A;  3IG2 A;  2ZGW A;  3HXU A;  4KR3 A;  1YGB A;  3PCO A;  4Q15 A;  2ZT6 A;  1NJ8 A;  4TVA B;  3WQZ A;  4RQE A;  1EIY B;  4YPF A;  1NYR A;  4Q6G A;  2P0L A;  4P74 A;  4CH4 A;  4YRL A;  2ZIM A;  2ZXF A;  3UFG A;  3P8V A;  3HY0 A;  4UP9 A;  4XEM A;  1LYL A;  4K87 A;  4XU3 A;  5E3I A;  2E1H A;  3HRK A;  4XTZ A;  4XU1 A;  2ZIN A;  4YRJ A;  4E51 A;  2ALY A;  4HA8 A;  1WPY A;  4LVM A;  4YCV A;  3RKY A;  4LNS A;  1B70 B;  4P73 C;  1SET A;  4TVY A;  1H4V B;  4OLF A;  4CS3 A;  2XTI A;  2DXU A;  1NYQ A;  3MEY A;  3P8Y A;  4XU2 A;  3HTZ A;  4YRI A;  2ZCE A;  4RQF A;  4HWT A;  3M4Q A;  2ARU A;  3NET A;  4K86 A;  1B76 A;  5ELO A;  4XEO A;  3RKX A;  1EVK A;  2C8M A;  2EJF A;  1NJ1 A;  2ARS A;  2ODR D;  2RHS B;  3A74 A;  2PMF A;  2IY5 A;  2QHV A;  1ADJ A;  2CJ9 A;  1QE0 A;  4YP0 A;  1X01 A;  4TVA A;  4WF2 A;  1EIY A;  4P72 A;  2E5A A;  2I4L A;  1H4T A;  2RHQ B;  2DDZ A;  2I4M A;  2DTH A;  4UP8 A;  4XU0 A;  2E3C A;  4LVJ A;  2PME A;  2Q7E A;  3R07 A;  1B8A A;  4J15 A;  2ART A;  2ODR C;  4XTX A;  5C51 B;  2E41 A;  2Q7H A;  3HFZ B;  4H2S A;  4X5O A;  3EFR A;  5HGQ A;  3L2Z A;  3HFV A;  5F5W A;  4H2T A;  3KFU A;  3RGL A;  1EVL A;  4YRK A;  3MQZ A;  4ZIB A;  3NEL A;  4RDX A;  1WQW A;  5C52 B;  1B7Y A;  2ZT5 A;  3RAC A;  2J3L A;  3V7C A;  1BIB A;  1ADY A;  4DPG A;  3NEM A;  3RF1 A;  2G4C A;  4ZTZ B;  4LVL A;  1BBW A;  3A7A A;  3ERR A;  1E1O A;  3G1Z A;  3VQY A;  4PG3 A;  1EQR A;  4P71 C;  1ASY A;  4YRG A;  4HVC A;  1QF6 A;  4XTU A;  3E9I A;  4WJ3 M;  3V7S A;  3MF2 A;  1JJC A;  3REX A;  2EWN A;  2DXT A;  1KOG A;  3MF1 A;  3A7U A;  1ASZ A;  4PHC A;  1PYS A;  3M4P A;  4YRQ A;  1YFR A;  2E10 A;  3HXW A;  2QHT A;  2ALY B;  3RKW A;  4P3N A;  3IAL A;  4YRO A;  4NCX A;  3TEG A;  4XTW A;  1HXD A;  3PCO B;  4YRE A;  3ICA A;  4H2W A;  3L4G B;  1H4Q A;  3VBB A;  5ELN A;  3LC0 A;  2EJ9 A;  4TWA A;  3HFZ A;  3QNE A;  3BJU A;  2Q5I A;  4L87 A;  4CH6 A;  3VQX A;  3RUX A;  1NJ6 A;  2NS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...