2QHTA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
b'MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 66
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhtA01
3NELA 1B70B 11ASA 2DU5A 2E3CA 3QO7A 2XTIA 3QNEA 2EJFA 1X54A 1BIBA 4L87A 3E9HA 4YROA 2ZGWA 4CS2A 4P3OA 2ZCEA 3PZCA 1X2HA 3REXA 1USYC 2ZT6A 3HTZA 2ZT7A 2QHUA 4WJ3M 1NJ8A 4HWPA 3BJUA 2ZR3A 3LSSA 1N9WA 2E65A 2ZZGA 1KOGA 5F5WA 2Q5HA 4P72C 1NJ6A 3CMQA 4H2UA 2EWNA 4XU0A 2EL9A 1JJCB 1LYLA 2ARUA 2DVEA 3ERRA 1IL2A 3UFGA 3TEHB 4Q6GA 4YRGA 1PYSB 3P8YA 2ZZFA 3VBBA 1HC7A 1WPYA 3NENA 4AH6A 2CIMA 1YGBA 3HFZB 1NYQA 2FYKA 4H2XA 3WQZA 1BBWA 1Z7NA 4TTVA 2AKWA 3L4GB 5K1PA 3MF2A 4P73A 2DTIA 3R07A 4K88A 3HXUA 4UP9A 1WLEA 1WQ7A 4P75A 4OLFA 2ZR2A 1B8AA 4H2SA 1FYFA 3NEMA 2DKGA 2CJAA 4ZIBA 1EQRA 4YYEA 4YRTA 4RDXA 3A7RA 3A5YA 1NJ5A 3HY0A 1EIYA 3LSQA 3VQYA 3A7AA 3HXVA 2PMEA 1Z7MA 1SETA 2ARTA 4ZTZB 2Q5IA 2RHQA 4P71A 4HWSA 4H02A 2G4CA 3PCOA 4RMFA 1H4SA 1WNLA 1SERA 3V7SA 2ALYA 3A74A 2P0LA 1HTTA 1E22A 2ODRC 4NCXA 4P73C 3FJPA 3NETA 2RHSA 1ASYA 4XTVA 2ZINA 3IKMB 2ZNIA 1B70A 5C53B 5K1XA 4P75C 2DQ3A 2XGTA 2Q7EA 3UGQA 1ADJA 4BW9A 2QHSA 5ELNA 1RIQA 4H2WA 4XTWA 2EAYA 1VQZA 2DU7A 2DJZA 2ODRD 4XU3A 2AMCB 3VQWA 2ZIMA 4YRNA 2CJ9A 3HY1A 4YP0A 3ICAA 3V8JA 3QO8A 3V7RA 1KMNA 4XTZA 1NYRA 2IY5B 4UP8A 3OD1A 2EJ9A 4TVAB 1KMMA 1NJ1A 1YB3A 3V8LA 4WJ4A 1EOVA 4XTXA 4H2YA 3HXWA 4P71C 3G1ZA 1JJCA 3E9IA 3IG2A 2DXUA 4XU1A 1YFRA 4P3NA 3TEHA 1J5WA 3HXZA 3L1AA 3TEGA 1PYSA 5KNNA 3RACA 3RF1A 3IALA 4YRQA 4EO4A 4YRPA 4PHCA 1B7YB 3RL6A 2DEQA 4P74A 3HFZA 4KR2A 1H4TA 1QE0A 2J3MA 3L4GA 4YPFA 1NJ2A 2E41A 3UGTA 4YRJA 4CH6A 2P5IA 3RKYA 1W66A 1GGMA 2E1HA 4UPAA 1SESA 3RUXA 1WQWA 3IKLA 1WU7A 3VQVA 4YRKA 2I4LA 1X56A 2E64A 4XEOA 1G51A 4YRLA 4ZTUB 4TVYA 5HGQA 1QF6A 2ZT5A 3W3SA 1EVKA 3QTCA 1EFWA 3A31A 4RQFA 3P8VA 2E5AA 2PMFA 3A7UA 2EJGA 3HRIA 3RGLA 1YFTA 5E3IA 5C52B 3DSQA 2DTHA 3QO5A 4KQEA 4HA8A 3UH0A 1ADYA 2DZ9A 4H2VA 2QHTA 1H4VB 3L2ZA 2C8MA 4TVWA 4P74C 1EVLA 2DTOA 4XTUA 3RKWA 4YRSA 3MEYA 2Q7GA 3M4PA 2QHVA 4K86A 1E24A 2DQ0A 3HFVA 3BFMA 2C7IA 4Q15A 1ASZA 1B76A 4XEMA 2ZXFA 1E1TA 1ATIA 1SRYA 4DQ2A 4E51A 4G85A 1H4QA 2ZT8A 2HNIA 3HXXA 3LC0A 4XTYA 3KFUA 1C0AA 1E1OA 4CH3A 5ELOA 3EFSA 1YFSA 3A32A 3A5ZA 4DPGA 4TWAA 4XU2A 2J3LA 4O2DA 4HWRA 4YCVA 2AMCA 2DDZA 1NNHA 4H2XB 1WYDA 2AKWB 2CJBA 1L0WA 2IY5A 2DZCA 1BIAA 1X01A 4YRIA 2Q7HA 4TVAA 3RKXA 4UP7A 4WF2A 4CS3A 1HXDA 4J15A 4CH4A 3VQXA 1X55A 2ZNJA 2E10A 4HVCA 2ZTGA 4YREA 4BWAA 4YCWA 4TQFA 4EX5A 4OP0A 4LNSA 1BBUA 4K87A 4X5OA 3RIRA 4YDQA 1USYA 1EIYB 1B7YA 4PG3A 2I4OA 4RQEA 2ZIOA 5C51B 3M4QA 3V8KA 2I4MA 1G5HA 1X2GA 4G84A 4P3PA 3HXYA 2RHQB 4P72A 4YRMA 2I4NA 3REUA 12ASA 2ZZEA 4YRFA 3PCOB 3P8TA 4WI1A 4TQDA 4YRRA 4KR3A 4YCUA 4CS4A 4HWTA 4YRCA 4CH5A 1G5IA 2CGHA 3V7CA 3TUPA 2ARSA 3I7FA 2ALYB 3HRKA 4H2TA 3EFRA 2DXTA 3MF1A 2RHSB 4HWOA
chains in the Genus database with same CATH superfamily
3NELA 1B70B 11ASA 2DU5A 2E3CA 3QO7A 2XTIA 3QNEA 2EJFA 1X54A 1BIBA 4L87A 3E9HA 4YROA 2ZGWA 4CS2A 4P3OA 2ZCEA 3PZCA 1X2HA 3REXA 1USYC 2ZT6A 3HTZA 2ZT7A 2QHUA 4WJ3M 1NJ8A 4HWPA 3BJUA 2ZR3A 3LSSA 1N9WA 2E65A 2ZZGA 1KOGA 5F5WA 2Q5HA 4P72C 1NJ6A 3CMQA 4H2UA 2EWNA 4XU0A 2EL9A 1JJCB 2A8EA 1LYLA 2ARUA 2DVEA 3ERRA 1IL2A 3UFGA 3TEHB 4Q6GA 4YRGA 1PYSB 3P8YA 2ZZFA 3VBBA 1HC7A 1WPYA 3NENA 4AH6A 2CIMA 1YGBA 3HFZB 1NYQA 2FYKA 2NS6A 4H2XA 3WQZA 1BBWA 1Z7NA 4TTVA 2AKWA 3L4GB 5K1PA 3MF2A 4P73A 2DTIA 3R07A 4K88A 3HXUA 4UP9A 1WLEA 1WQ7A 4P75A 4OLFA 2ZR2A 1B8AA 4H2SA 1FYFA 3NEMA 2DKGA 2CJAA 4ZIBA 1EQRA 4YYEA 4YRTA 4RDXA 3A7RA 3A5YA 4LVLA 1NJ5A 3HY0A 1EIYA 3LSQA 3VQYA 3A7AA 3HXVA 2PMEA 1Z7MA 1SETA 2ARTA 4ZTZB 2Q5IA 2RHQA 4P71A 4HWSA 4H02A 2G4CA 3PCOA 4RMFA 1H4SA 1WNLA 1SERA 3V7SA 2ALYA 3A74A 2P0LA 1HTTA 1E22A 2ODRC 4NCXA 4P73C 3FJPA 3NETA 2RHSA 1ASYA 4XTVA 2ZINA 3IKMB 2ZNIA 1B70A 5C53B 5K1XA 4P75C 4LVKA 2DQ3A 2XGTA 2Q7EA 3UGQA 1ADJA 4BW9A 2QHSA 5ELNA 1RIQA 4H2WA 4XTWA 2EAYA 1VQZA 2DU7A 2DJZA 2ODRD 4XU3A 2AMCB 3VQWA 2ZIMA 4YRNA 2CJ9A 3HY1A 4YP0A 3ICAA 3V8JA 3QO8A 3V7RA 1KMNA 4XTZA 4LVMA 1NYRA 2IY5B 4UP8A 3OD1A 2EJ9A 4TVAB 1KMMA 1NJ1A 1YB3A 3V8LA 4WJ4A 1EOVA 4XTXA 4H2YA 3HXWA 4P71C 3G1ZA 1JJCA 3E9IA 3IG2A 2DXUA 4XU1A 1YFRA 4P3NA 3TEHA 1J5WA 3HXZA 3L1AA 3TEGA 1PYSA 5KNNA 3RACA 3RF1A 3IALA 4YRQA 4EO4A 4YRPA 4PHCA 1B7YB 3RL6A 2DEQA 4P74A 3HFZA 4KR2A 1H4TA 1QE0A 2J3MA 3L4GA 4YPFA 1NJ2A 2E41A 3UGTA 4YRJA 4CH6A 2P5IA 3RKYA 1W66A 1GGMA 2E1HA 4UPAA 1SESA 3RUXA 1WQWA 3IKLA 1WU7A 3VQVA 4YRKA 2I4LA 1X56A 2E64A 4XEOA 1G51A 4YRLA 4ZTUB 4TVYA 5HGQA 1QF6A 2ZT5A 4HT4A 3W3SA 1EVKA 3MQZA 3QTCA 1EFWA 3A31A 4RQFA 3P8VA 2E5AA 2PMFA 3A7UA 2EJGA 3HRIA 3RGLA 1YFTA 5E3IA 5C52B 3DSQA 2DTHA 4LVIA 3QO5A 4KQEA 4HA8A 3UH0A 1ADYA 2DZ9A 4H2VA 2QHTA 1H4VB 3L2ZA 2C8MA 4TVWA 4P74C 1EVLA 2DTOA 4XTUA 3RKWA 4YRSA 3MEYA 2Q7GA 3M4PA 2QHVA 4K86A 1E24A 2DQ0A 3HFVA 3BFMA 2C7IA 4Q15A 1ASZA 1B76A 4XEMA 2ZXFA 1E1TA 1ATIA 1SRYA 4DQ2A 4E51A 4G85A 1H4QA 2ZT8A 2HNIA 3HXXA 3LC0A 4XTYA 3KFUA 1C0AA 1E1OA 4CH3A 5ELOA 3EFSA 1YFSA 3A32A 3A5ZA 4DPGA 4TWAA 4XU2A 2J3LA 4O2DA 4HWRA 4YCVA 2AMCA 2DDZA 1NNHA 4H2XB 1WYDA 2AKWB 2CJBA 1L0WA 2IY5A 2DZCA 1BIAA 1X01A 4YRIA 2Q7HA 4TVAA 3RKXA 4UP7A 4LVJA 4WF2A 4CS3A 1HXDA 4J15A 4CH4A 3VQXA 1X55A 2ZNJA 2E10A 4HVCA 2ZTGA 4YREA 4BWAA 4YCWA 4TQFA 4EX5A 4OP0A 4LNSA 1BBUA 4K87A 4X5OA 3RIRA 4YDQA 1USYA 1EIYB 1B7YA 4PG3A 2I4OA 4RQEA 2ZIOA 5C51B 3M4QA 3V8KA 2I4MA 1G5HA 1X2GA 4G84A 4P3PA 3HXYA 2RHQB 4P72A 4YRMA 2I4NA 3REUA 12ASA 2ZZEA 4YRFA 3PCOB 3P8TA 4WI1A 4TQDA 4YRRA 4KR3A 4YCUA 4CS4A 4HWTA 4YRCA 4CH5A 1G5IA 2CGHA 3V7CA 3TUPA 2ARSA 3I7FA 2ALYB 3HRKA 4H2TA 3EFRA 2DXTA 3MF1A 2RHSB 4HWOA
chains in the Genus database with same CATH topology
3NELA 1B70B 11ASA 2DU5A 2E3CA 3QO7A 2XTIA 3QNEA 2EJFA 1X54A 1BIBA 4L87A 3E9HA 4YROA 2ZGWA 4CS2A 4P3OA 2ZCEA 3PZCA 1X2HA 3REXA 1USYC 2ZT6A 3HTZA 2ZT7A 2QHUA 4WJ3M 1NJ8A 4HWPA 3BJUA 2ZR3A 3LSSA 1N9WA 2E65A 2ZZGA 1KOGA 5F5WA 2Q5HA 4P72C 1NJ6A 3CMQA 4H2UA 2EWNA 4XU0A 2EL9A 1JJCB 2A8EA 1LYLA 2ARUA 2DVEA 3ERRA 1IL2A 3UFGA 3TEHB 4Q6GA 4YRGA 1PYSB 3P8YA 2ZZFA 3VBBA 1HC7A 1WPYA 3NENA 4AH6A 2CIMA 1YGBA 3HFZB 1NYQA 2FYKA 2NS6A 4H2XA 3WQZA 1BBWA 1Z7NA 4TTVA 2AKWA 3L4GB 5K1PA 3MF2A 4P73A 2DTIA 3R07A 4K88A 3HXUA 4UP9A 1WLEA 1WQ7A 4P75A 4OLFA 2ZR2A 1B8AA 4H2SA 1FYFA 3NEMA 2DKGA 2CJAA 4ZIBA 1EQRA 4YYEA 4YRTA 4RDXA 3A7RA 3A5YA 4LVLA 1NJ5A 3HY0A 1EIYA 3LSQA 3VQYA 3A7AA 3HXVA 2PMEA 1Z7MA 1SETA 2ARTA 4ZTZB 2Q5IA 2RHQA 4P71A 4HWSA 4H02A 2G4CA 3PCOA 4RMFA 1H4SA 1WNLA 1SERA 3V7SA 2ALYA 3A74A 2P0LA 1HTTA 1E22A 2ODRC 4NCXA 4P73C 3FJPA 3NETA 2RHSA 1ASYA 4XTVA 2ZINA 3IKMB 2ZNIA 1B70A 5C53B 5K1XA 4P75C 4LVKA 2DQ3A 2XGTA 2Q7EA 3UGQA 1ADJA 4BW9A 2QHSA 5ELNA 1RIQA 4H2WA 4XTWA 2EAYA 1VQZA 2DU7A 2DJZA 2ODRD 4XU3A 2AMCB 3VQWA 2ZIMA 4YRNA 2CJ9A 3HY1A 4YP0A 3ICAA 3V8JA 3QO8A 3V7RA 1KMNA 4XTZA 4LVMA 1NYRA 2IY5B 4UP8A 3OD1A 2EJ9A 4TVAB 1KMMA 1NJ1A 1YB3A 3V8LA 4WJ4A 1EOVA 4XTXA 4H2YA 3HXWA 4P71C 3G1ZA 1JJCA 3E9IA 3IG2A 2DXUA 4XU1A 1YFRA 4P3NA 3TEHA 1J5WA 3HXZA 3L1AA 3TEGA 1PYSA 5KNNA 3RACA 3RF1A 3IALA 4YRQA 4EO4A 4YRPA 4PHCA 1B7YB 3RL6A 2DEQA 4P74A 3HFZA 4KR2A 1H4TA 1QE0A 2J3MA 3L4GA 4YPFA 1NJ2A 2E41A 3UGTA 4YRJA 4CH6A 2P5IA 3RKYA 1W66A 1GGMA 2E1HA 4UPAA 1SESA 3RUXA 1WQWA 3IKLA 1WU7A 3VQVA 4YRKA 2I4LA 1X56A 2E64A 4XEOA 1G51A 4YRLA 4ZTUB 4TVYA 5HGQA 1QF6A 2ZT5A 4HT4A 3W3SA 1EVKA 3MQZA 3QTCA 1EFWA 3A31A 4RQFA 3P8VA 2E5AA 2PMFA 3A7UA 2EJGA 3HRIA 3RGLA 1YFTA 5E3IA 5C52B 3DSQA 2DTHA 4LVIA 3QO5A 4KQEA 4HA8A 3UH0A 1ADYA 2DZ9A 4H2VA 2QHTA 1H4VB 3L2ZA 2C8MA 4TVWA 4P74C 1EVLA 2DTOA 4XTUA 3RKWA 4YRSA 3MEYA 2Q7GA 3M4PA 2QHVA 4K86A 1E24A 2DQ0A 3HFVA 3BFMA 2C7IA 4Q15A 1ASZA 1B76A 4XEMA 2ZXFA 1E1TA 1ATIA 1SRYA 4DQ2A 4E51A 4G85A 1H4QA 2ZT8A 2HNIA 3HXXA 3LC0A 4XTYA 3KFUA 1C0AA 1E1OA 4CH3A 5ELOA 3EFSA 1YFSA 3A32A 3A5ZA 4DPGA 4TWAA 4XU2A 2J3LA 4O2DA 4HWRA 4YCVA 2AMCA 2DDZA 1NNHA 4H2XB 1WYDA 2AKWB 2CJBA 1L0WA 2IY5A 2DZCA 1BIAA 1X01A 4YRIA 2Q7HA 4TVAA 3RKXA 4UP7A 4LVJA 4WF2A 4CS3A 1HXDA 4J15A 4CH4A 3VQXA 1X55A 2ZNJA 2E10A 4HVCA 2ZTGA 4YREA 4BWAA 4YCWA 4TQFA 4EX5A 4OP0A 4LNSA 1BBUA 4K87A 4X5OA 3RIRA 4YDQA 1USYA 1EIYB 1B7YA 4PG3A 2I4OA 4RQEA 2ZIOA 5C51B 3M4QA 3V8KA 2I4MA 1G5HA 1X2GA 4G84A 4P3PA 3HXYA 2RHQB 4P72A 4YRMA 2I4NA 3REUA 12ASA 2ZZEA 4YRFA 3PCOB 3P8TA 4WI1A 4TQDA 4YRRA 4KR3A 4YCUA 4CS4A 4HWTA 4YRCA 4CH5A 1G5IA 2CGHA 3V7CA 3TUPA 2ARSA 3I7FA 2ALYB 3HRKA 4H2TA 3EFRA 2DXTA 3MF1A 2RHSB 4HWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEL A;  1B70 B;  11AS A;  2DU5 A;  2E3C A;  3QO7 A;  2XTI A;  3QNE A;  2EJF A;  1X54 A;  1BIB A;  4L87 A;  3E9H A;  4YRO A;  2ZGW A;  4CS2 A;  4P3O A;  2ZCE A;  3PZC A;  1X2H A;  3REX A;  1USY C;  2ZT6 A;  3HTZ A;  2ZT7 A;  2QHU A;  4WJ3 M;  1NJ8 A;  4HWP A;  3BJU A;  2ZR3 A;  3LSS A;  1N9W A;  2E65 A;  2ZZG A;  1KOG A;  5F5W A;  2Q5H A;  4P72 C;  1NJ6 A;  3CMQ A;  4H2U A;  2EWN A;  4XU0 A;  2EL9 A;  1JJC B;  1LYL A;  2ARU A;  2DVE A;  3ERR A;  1IL2 A;  3UFG A;  3TEH B;  4Q6G A;  4YRG A;  1PYS B;  3P8Y A;  2ZZF A;  3VBB A;  1HC7 A;  1WPY A;  3NEN A;  4AH6 A;  2CIM A;  1YGB A;  3HFZ B;  1NYQ A;  2FYK A;  4H2X A;  3WQZ A;  1BBW A;  1Z7N A;  4TTV A;  2AKW A;  3L4G B;  5K1P A;  3MF2 A;  4P73 A;  2DTI A;  3R07 A;  4K88 A;  3HXU A;  4UP9 A;  1WLE A;  1WQ7 A;  4P75 A;  4OLF A;  2ZR2 A;  1B8A A;  4H2S A;  1FYF A;  3NEM A;  2DKG A;  2CJA A;  4ZIB A;  1EQR A;  4YYE A;  4YRT A;  4RDX A;  3A7R A;  3A5Y A;  1NJ5 A;  3HY0 A;  1EIY A;  3LSQ A;  3VQY A;  3A7A A;  3HXV A;  2PME A;  1Z7M A;  1SET A;  2ART A;  4ZTZ B;  2Q5I A;  2RHQ A;  4P71 A;  4HWS A;  4H02 A;  2G4C A;  3PCO A;  4RMF A;  1H4S A;  1WNL A;  1SER A;  3V7S A;  2ALY A;  3A74 A;  2P0L A;  1HTT A;  1E22 A;  2ODR C;  4NCX A;  4P73 C;  3FJP A;  3NET A;  2RHS A;  1ASY A;  4XTV A;  2ZIN A;  3IKM B;  2ZNI A;  1B70 A;  5C53 B;  5K1X A;  4P75 C;  2DQ3 A;  2XGT A;  2Q7E A;  3UGQ A;  1ADJ A;  4BW9 A;  2QHS A;  5ELN A;  1RIQ A;  4H2W A;  4XTW A;  2EAY A;  1VQZ A;  2DU7 A;  2DJZ A;  2ODR D;  4XU3 A;  2AMC B;  3VQW A;  2ZIM A;  4YRN A;  2CJ9 A;  3HY1 A;  4YP0 A;  3ICA A;  3V8J A;  3QO8 A;  3V7R A;  1KMN A;  4XTZ A;  1NYR A;  2IY5 B;  4UP8 A;  3OD1 A;  2EJ9 A;  4TVA B;  1KMM A;  1NJ1 A;  1YB3 A;  3V8L A;  4WJ4 A;  1EOV A;  4XTX A;  4H2Y A;  3HXW A;  4P71 C;  3G1Z A;  1JJC A;  3E9I A;  3IG2 A;  2DXU A;  4XU1 A;  1YFR A;  4P3N A;  3TEH A;  1J5W A;  3HXZ A;  3L1A A;  3TEG A;  1PYS A;  5KNN A;  3RAC A;  3RF1 A;  3IAL A;  4YRQ A;  4EO4 A;  4YRP A;  4PHC A;  1B7Y B;  3RL6 A;  2DEQ A;  4P74 A;  3HFZ A;  4KR2 A;  1H4T A;  1QE0 A;  2J3M A;  3L4G A;  4YPF A;  1NJ2 A;  2E41 A;  3UGT A;  4YRJ A;  4CH6 A;  2P5I A;  3RKY A;  1W66 A;  1GGM A;  2E1H A;  4UPA A;  1SES A;  3RUX A;  1WQW A;  3IKL A;  1WU7 A;  3VQV A;  4YRK A;  2I4L A;  1X56 A;  2E64 A;  4XEO A;  1G51 A;  4YRL A;  4ZTU B;  4TVY A;  5HGQ A;  1QF6 A;  2ZT5 A;  3W3S A;  1EVK A;  3QTC A;  1EFW A;  3A31 A;  4RQF A;  3P8V A;  2E5A A;  2PMF A;  3A7U A;  2EJG A;  3HRI A;  3RGL A;  1YFT A;  5E3I A;  5C52 B;  3DSQ A;  2DTH A;  3QO5 A;  4KQE A;  4HA8 A;  3UH0 A;  1ADY A;  2DZ9 A;  4H2V A;  2QHT A;  1H4V B;  3L2Z A;  2C8M A;  4TVW A;  4P74 C;  1EVL A;  2DTO A;  4XTU A;  3RKW A;  4YRS A;  3MEY A;  2Q7G A;  3M4P A;  2QHV A;  4K86 A;  1E24 A;  2DQ0 A;  3HFV A;  3BFM A;  2C7I A;  4Q15 A;  1ASZ A;  1B76 A;  4XEM A;  2ZXF A;  1E1T A;  1ATI A;  1SRY A;  4DQ2 A;  4E51 A;  4G85 A;  1H4Q A;  2ZT8 A;  2HNI A;  3HXX A;  3LC0 A;  4XTY A;  3KFU A;  1C0A A;  1E1O A;  4CH3 A;  5ELO A;  3EFS A;  1YFS A;  3A32 A;  3A5Z A;  4DPG A;  4TWA A;  4XU2 A;  2J3L A;  4O2D A;  4HWR A;  4YCV A;  2AMC A;  2DDZ A;  1NNH A;  4H2X B;  1WYD A;  2AKW B;  2CJB A;  1L0W A;  2IY5 A;  2DZC A;  1BIA A;  1X01 A;  4YRI A;  2Q7H A;  4TVA A;  3RKX A;  4UP7 A;  4WF2 A;  4CS3 A;  1HXD A;  4J15 A;  4CH4 A;  3VQX A;  1X55 A;  2ZNJ A;  2E10 A;  4HVC A;  2ZTG A;  4YRE A;  4BWA A;  4YCW A;  4TQF A;  4EX5 A;  4OP0 A;  4LNS A;  1BBU A;  4K87 A;  4X5O A;  3RIR A;  4YDQ A;  1USY A;  1EIY B;  1B7Y A;  4PG3 A;  2I4O A;  4RQE A;  2ZIO A;  5C51 B;  3M4Q A;  3V8K A;  2I4M A;  1G5H A;  1X2G A;  4G84 A;  4P3P A;  3HXY A;  2RHQ B;  4P72 A;  4YRM A;  2I4N A;  3REU A;  12AS A;  2ZZE A;  4YRF A;  3PCO B;  3P8T A;  4WI1 A;  4TQD A;  4YRR A;  4KR3 A;  4YCU A;  4CS4 A;  4HWT A;  4YRC A;  4CH5 A;  1G5I A;  2CGH A;  3V7C A;  3TUP A;  2ARS A;  3I7F A;  2ALY B;  3HRK A;  4H2T A;  3EFR A;  2DXT A;  3MF1 A;  2RHS B;  4HWO A; 
#chains in the Genus database with same CATH topology
 3NEL A;  1B70 B;  11AS A;  2DU5 A;  2E3C A;  3QO7 A;  2XTI A;  3QNE A;  2EJF A;  1X54 A;  1BIB A;  4L87 A;  3E9H A;  4YRO A;  2ZGW A;  4CS2 A;  4P3O A;  2ZCE A;  3PZC A;  1X2H A;  3REX A;  1USY C;  2ZT6 A;  3HTZ A;  2ZT7 A;  2QHU A;  4WJ3 M;  1NJ8 A;  4HWP A;  3BJU A;  2ZR3 A;  3LSS A;  1N9W A;  2E65 A;  2ZZG A;  1KOG A;  5F5W A;  2Q5H A;  4P72 C;  1NJ6 A;  3CMQ A;  4H2U A;  2EWN A;  4XU0 A;  2EL9 A;  1JJC B;  2A8E A;  1LYL A;  2ARU A;  2DVE A;  3ERR A;  1IL2 A;  3UFG A;  3TEH B;  4Q6G A;  4YRG A;  1PYS B;  3P8Y A;  2ZZF A;  3VBB A;  1HC7 A;  1WPY A;  3NEN A;  4AH6 A;  2CIM A;  1YGB A;  3HFZ B;  1NYQ A;  2FYK A;  2NS6 A;  4H2X A;  3WQZ A;  1BBW A;  1Z7N A;  4TTV A;  2AKW A;  3L4G B;  5K1P A;  3MF2 A;  4P73 A;  2DTI A;  3R07 A;  4K88 A;  3HXU A;  4UP9 A;  1WLE A;  1WQ7 A;  4P75 A;  4OLF A;  2ZR2 A;  1B8A A;  4H2S A;  1FYF A;  3NEM A;  2DKG A;  2CJA A;  4ZIB A;  1EQR A;  4YYE A;  4YRT A;  4RDX A;  3A7R A;  3A5Y A;  4LVL A;  1NJ5 A;  3HY0 A;  1EIY A;  3LSQ A;  3VQY A;  3A7A A;  3HXV A;  2PME A;  1Z7M A;  1SET A;  2ART A;  4ZTZ B;  2Q5I A;  2RHQ A;  4P71 A;  4HWS A;  4H02 A;  2G4C A;  3PCO A;  4RMF A;  1H4S A;  1WNL A;  1SER A;  3V7S A;  2ALY A;  3A74 A;  2P0L A;  1HTT A;  1E22 A;  2ODR C;  4NCX A;  4P73 C;  3FJP A;  3NET A;  2RHS A;  1ASY A;  4XTV A;  2ZIN A;  3IKM B;  2ZNI A;  1B70 A;  5C53 B;  5K1X A;  4P75 C;  4LVK A;  2DQ3 A;  2XGT A;  2Q7E A;  3UGQ A;  1ADJ A;  4BW9 A;  2QHS A;  5ELN A;  1RIQ A;  4H2W A;  4XTW A;  2EAY A;  1VQZ A;  2DU7 A;  2DJZ A;  2ODR D;  4XU3 A;  2AMC B;  3VQW A;  2ZIM A;  4YRN A;  2CJ9 A;  3HY1 A;  4YP0 A;  3ICA A;  3V8J A;  3QO8 A;  3V7R A;  1KMN A;  4XTZ A;  4LVM A;  1NYR A;  2IY5 B;  4UP8 A;  3OD1 A;  2EJ9 A;  4TVA B;  1KMM A;  1NJ1 A;  1YB3 A;  3V8L A;  4WJ4 A;  1EOV A;  4XTX A;  4H2Y A;  3HXW A;  4P71 C;  3G1Z A;  1JJC A;  3E9I A;  3IG2 A;  2DXU A;  4XU1 A;  1YFR A;  4P3N A;  3TEH A;  1J5W A;  3HXZ A;  3L1A A;  3TEG A;  1PYS A;  5KNN A;  3RAC A;  3RF1 A;  3IAL A;  4YRQ A;  4EO4 A;  4YRP A;  4PHC A;  1B7Y B;  3RL6 A;  2DEQ A;  4P74 A;  3HFZ A;  4KR2 A;  1H4T A;  1QE0 A;  2J3M A;  3L4G A;  4YPF A;  1NJ2 A;  2E41 A;  3UGT A;  4YRJ A;  4CH6 A;  2P5I A;  3RKY A;  1W66 A;  1GGM A;  2E1H A;  4UPA A;  1SES A;  3RUX A;  1WQW A;  3IKL A;  1WU7 A;  3VQV A;  4YRK A;  2I4L A;  1X56 A;  2E64 A;  4XEO A;  1G51 A;  4YRL A;  4ZTU B;  4TVY A;  5HGQ A;  1QF6 A;  2ZT5 A;  4HT4 A;  3W3S A;  1EVK A;  3MQZ A;  3QTC A;  1EFW A;  3A31 A;  4RQF A;  3P8V A;  2E5A A;  2PMF A;  3A7U A;  2EJG A;  3HRI A;  3RGL A;  1YFT A;  5E3I A;  5C52 B;  3DSQ A;  2DTH A;  4LVI A;  3QO5 A;  4KQE A;  4HA8 A;  3UH0 A;  1ADY A;  2DZ9 A;  4H2V A;  2QHT A;  1H4V B;  3L2Z A;  2C8M A;  4TVW A;  4P74 C;  1EVL A;  2DTO A;  4XTU A;  3RKW A;  4YRS A;  3MEY A;  2Q7G A;  3M4P A;  2QHV A;  4K86 A;  1E24 A;  2DQ0 A;  3HFV A;  3BFM A;  2C7I A;  4Q15 A;  1ASZ A;  1B76 A;  4XEM A;  2ZXF A;  1E1T A;  1ATI A;  1SRY A;  4DQ2 A;  4E51 A;  4G85 A;  1H4Q A;  2ZT8 A;  2HNI A;  3HXX A;  3LC0 A;  4XTY A;  3KFU A;  1C0A A;  1E1O A;  4CH3 A;  5ELO A;  3EFS A;  1YFS A;  3A32 A;  3A5Z A;  4DPG A;  4TWA A;  4XU2 A;  2J3L A;  4O2D A;  4HWR A;  4YCV A;  2AMC A;  2DDZ A;  1NNH A;  4H2X B;  1WYD A;  2AKW B;  2CJB A;  1L0W A;  2IY5 A;  2DZC A;  1BIA A;  1X01 A;  4YRI A;  2Q7H A;  4TVA A;  3RKX A;  4UP7 A;  4LVJ A;  4WF2 A;  4CS3 A;  1HXD A;  4J15 A;  4CH4 A;  3VQX A;  1X55 A;  2ZNJ A;  2E10 A;  4HVC A;  2ZTG A;  4YRE A;  4BWA A;  4YCW A;  4TQF A;  4EX5 A;  4OP0 A;  4LNS A;  1BBU A;  4K87 A;  4X5O A;  3RIR A;  4YDQ A;  1USY A;  1EIY B;  1B7Y A;  4PG3 A;  2I4O A;  4RQE A;  2ZIO A;  5C51 B;  3M4Q A;  3V8K A;  2I4M A;  1G5H A;  1X2G A;  4G84 A;  4P3P A;  3HXY A;  2RHQ B;  4P72 A;  4YRM A;  2I4N A;  3REU A;  12AS A;  2ZZE A;  4YRF A;  3PCO B;  3P8T A;  4WI1 A;  4TQD A;  4YRR A;  4KR3 A;  4YCU A;  4CS4 A;  4HWT A;  4YRC A;  4CH5 A;  1G5I A;  2CGH A;  3V7C A;  3TUP A;  2ARS A;  3I7F A;  2ALY B;  3HRK A;  4H2T A;  3EFR A;  2DXT A;  3MF1 A;  2RHS B;  4HWO A; 
#chains in the Genus database with same CATH homology
 3NEL A;  1B70 B;  11AS A;  2DU5 A;  2E3C A;  3QO7 A;  2XTI A;  3QNE A;  2EJF A;  1X54 A;  1BIB A;  4L87 A;  3E9H A;  4YRO A;  2ZGW A;  4CS2 A;  4P3O A;  2ZCE A;  3PZC A;  1X2H A;  3REX A;  1USY C;  2ZT6 A;  3HTZ A;  2ZT7 A;  2QHU A;  4WJ3 M;  1NJ8 A;  4HWP A;  3BJU A;  2ZR3 A;  3LSS A;  1N9W A;  2E65 A;  2ZZG A;  1KOG A;  5F5W A;  2Q5H A;  4P72 C;  1NJ6 A;  3CMQ A;  4H2U A;  2EWN A;  4XU0 A;  2EL9 A;  1JJC B;  2A8E A;  1LYL A;  2ARU A;  2DVE A;  3ERR A;  1IL2 A;  3UFG A;  3TEH B;  4Q6G A;  4YRG A;  1PYS B;  3P8Y A;  2ZZF A;  3VBB A;  1HC7 A;  1WPY A;  3NEN A;  4AH6 A;  2CIM A;  1YGB A;  3HFZ B;  1NYQ A;  2FYK A;  2NS6 A;  4H2X A;  3WQZ A;  1BBW A;  1Z7N A;  4TTV A;  2AKW A;  3L4G B;  5K1P A;  3MF2 A;  4P73 A;  2DTI A;  3R07 A;  4K88 A;  3HXU A;  4UP9 A;  1WLE A;  1WQ7 A;  4P75 A;  4OLF A;  2ZR2 A;  1B8A A;  4H2S A;  1FYF A;  3NEM A;  2DKG A;  2CJA A;  4ZIB A;  1EQR A;  4YYE A;  4YRT A;  4RDX A;  3A7R A;  3A5Y A;  4LVL A;  1NJ5 A;  3HY0 A;  1EIY A;  3LSQ A;  3VQY A;  3A7A A;  3HXV A;  2PME A;  1Z7M A;  1SET A;  2ART A;  4ZTZ B;  2Q5I A;  2RHQ A;  4P71 A;  4HWS A;  4H02 A;  2G4C A;  3PCO A;  4RMF A;  1H4S A;  1WNL A;  1SER A;  3V7S A;  2ALY A;  3A74 A;  2P0L A;  1HTT A;  1E22 A;  2ODR C;  4NCX A;  4P73 C;  3FJP A;  3NET A;  2RHS A;  1ASY A;  4XTV A;  2ZIN A;  3IKM B;  2ZNI A;  1B70 A;  5C53 B;  5K1X A;  4P75 C;  4LVK A;  2DQ3 A;  2XGT A;  2Q7E A;  3UGQ A;  1ADJ A;  4BW9 A;  2QHS A;  5ELN A;  1RIQ A;  4H2W A;  4XTW A;  2EAY A;  1VQZ A;  2DU7 A;  2DJZ A;  2ODR D;  4XU3 A;  2AMC B;  3VQW A;  2ZIM A;  4YRN A;  2CJ9 A;  3HY1 A;  4YP0 A;  3ICA A;  3V8J A;  3QO8 A;  3V7R A;  1KMN A;  4XTZ A;  4LVM A;  1NYR A;  2IY5 B;  4UP8 A;  3OD1 A;  2EJ9 A;  4TVA B;  1KMM A;  1NJ1 A;  1YB3 A;  3V8L A;  4WJ4 A;  1EOV A;  4XTX A;  4H2Y A;  3HXW A;  4P71 C;  3G1Z A;  1JJC A;  3E9I A;  3IG2 A;  2DXU A;  4XU1 A;  1YFR A;  4P3N A;  3TEH A;  1J5W A;  3HXZ A;  3L1A A;  3TEG A;  1PYS A;  5KNN A;  3RAC A;  3RF1 A;  3IAL A;  4YRQ A;  4EO4 A;  4YRP A;  4PHC A;  1B7Y B;  3RL6 A;  2DEQ A;  4P74 A;  3HFZ A;  4KR2 A;  1H4T A;  1QE0 A;  2J3M A;  3L4G A;  4YPF A;  1NJ2 A;  2E41 A;  3UGT A;  4YRJ A;  4CH6 A;  2P5I A;  3RKY A;  1W66 A;  1GGM A;  2E1H A;  4UPA A;  1SES A;  3RUX A;  1WQW A;  3IKL A;  1WU7 A;  3VQV A;  4YRK A;  2I4L A;  1X56 A;  2E64 A;  4XEO A;  1G51 A;  4YRL A;  4ZTU B;  4TVY A;  5HGQ A;  1QF6 A;  2ZT5 A;  4HT4 A;  3W3S A;  1EVK A;  3MQZ A;  3QTC A;  1EFW A;  3A31 A;  4RQF A;  3P8V A;  2E5A A;  2PMF A;  3A7U A;  2EJG A;  3HRI A;  3RGL A;  1YFT A;  5E3I A;  5C52 B;  3DSQ A;  2DTH A;  4LVI A;  3QO5 A;  4KQE A;  4HA8 A;  3UH0 A;  1ADY A;  2DZ9 A;  4H2V A;  2QHT A;  1H4V B;  3L2Z A;  2C8M A;  4TVW A;  4P74 C;  1EVL A;  2DTO A;  4XTU A;  3RKW A;  4YRS A;  3MEY A;  2Q7G A;  3M4P A;  2QHV A;  4K86 A;  1E24 A;  2DQ0 A;  3HFV A;  3BFM A;  2C7I A;  4Q15 A;  1ASZ A;  1B76 A;  4XEM A;  2ZXF A;  1E1T A;  1ATI A;  1SRY A;  4DQ2 A;  4E51 A;  4G85 A;  1H4Q A;  2ZT8 A;  2HNI A;  3HXX A;  3LC0 A;  4XTY A;  3KFU A;  1C0A A;  1E1O A;  4CH3 A;  5ELO A;  3EFS A;  1YFS A;  3A32 A;  3A5Z A;  4DPG A;  4TWA A;  4XU2 A;  2J3L A;  4O2D A;  4HWR A;  4YCV A;  2AMC A;  2DDZ A;  1NNH A;  4H2X B;  1WYD A;  2AKW B;  2CJB A;  1L0W A;  2IY5 A;  2DZC A;  1BIA A;  1X01 A;  4YRI A;  2Q7H A;  4TVA A;  3RKX A;  4UP7 A;  4LVJ A;  4WF2 A;  4CS3 A;  1HXD A;  4J15 A;  4CH4 A;  3VQX A;  1X55 A;  2ZNJ A;  2E10 A;  4HVC A;  2ZTG A;  4YRE A;  4BWA A;  4YCW A;  4TQF A;  4EX5 A;  4OP0 A;  4LNS A;  1BBU A;  4K87 A;  4X5O A;  3RIR A;  4YDQ A;  1USY A;  1EIY B;  1B7Y A;  4PG3 A;  2I4O A;  4RQE A;  2ZIO A;  5C51 B;  3M4Q A;  3V8K A;  2I4M A;  1G5H A;  1X2G A;  4G84 A;  4P3P A;  3HXY A;  2RHQ B;  4P72 A;  4YRM A;  2I4N A;  3REU A;  12AS A;  2ZZE A;  4YRF A;  3PCO B;  3P8T A;  4WI1 A;  4TQD A;  4YRR A;  4KR3 A;  4YCU A;  4CS4 A;  4HWT A;  4YRC A;  4CH5 A;  1G5I A;  2CGH A;  3V7C A;  3TUP A;  2ARS A;  3I7F A;  2ALY B;  3HRK A;  4H2T A;  3EFR A;  2DXT A;  3MF1 A;  2RHS B;  4HWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...