2QHTA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Lipoyltransferase
total genus 66
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhtA01
1G51A 3UH0A 5C53B 1KMNA 4YCUA 4K88A 4YP0A 4YRCA 4H2XB 4KR2A 4TTVA 3V8LA 4UP8A 2DDZA 3A7UA 2XTIA 4P3NA 4YRPA 1EQRA 4YRKA 4Q15A 2ARUA 3TEGA 3A32A 3IKLA 1H4QA 4H2TA 2G4CA 4P75C 1Z7MA 2DU5A 2ZT6A 1NYRA 3DSQA 4WJ4A 3HFZA 3NENA 4XTUA 2EWNA 3V7SA 1WNLA 3V7CA 4P3OA 3HXXA 4TVAB 4YCVA 4EO4A 1HTTA 2AKWA 2RHQA 2FYKA 4OP0A 3QO5A 4H2UA 1BBWA 1QF6A 1BBUA 1NNHA 3HFVA 5HGQA 1YFSA 3L4GA 3RACA 2ZTGA 2DEQA 3QO7A 3WQZA 1X54A 3LSSA 4TQDA 4K87A 2EAYA 2EJ9A 4H2WA 4O2DA 2E41A 5K1XA 3L1AA 3HRIA 1PYSA 2E10A 3TEHA 4RDXA 4ZTUB 1FYFA 3V8KA 1NJ1A 4YRIA 4YRGA 4CH4A 2AMCB 3A5YA 2ODRD 3HXYA 4YRLA 1JJCB 3PCOB 1ADYA 3RKWA 2QHTA 2DQ3A 1NJ8A 4P72C 4P73A 3I7FA 4HA8A 1BIBA 3IALA 4PHCA 3QNEA 2I4OA 4XTVA 5K1PA 2IY5B 5E3IA 4KR3A 2AMCA 1E1TA 4XU2A 3QTCA 2I4NA 2ZT8A 4H2YA 4LNSA 2ODRC 3M4PA 5ELNA 4XU1A 1SERA 1E22A 4CS2A 1SRYA 2P0LA 3IKMB 4P71C 4NCXA 2DXTA 2ALYB 3HXZA 4WI1A 4XEOA 1NJ2A 1W66A 2I4MA 4RQEA 4P75A 3VQVA 3BJUA 2ZIMA 4HWRA 4XEMA 1E1OA 1G5HA 2QHVA 1H4SA 3P8TA 2E3CA 1RIQA 1HC7A 3CMQA 3W3SA 3LC0A 2ZR2A 4BWAA 4AH6A 3PCOA 4YREA 3HXVA 5ELOA 1YB3A 1WLEA 3E9HA 3VQYA 1NJ6A 1N9WA 2DTHA 2ZR3A 2DJZA 2PMEA 4Q6GA 1B70B 4YDQA 4H2VA 4RQFA 3E9IA 1WQ7A 2DXUA 4TWAA 2CJ9A 1B8AA 1X55A 1WQWA 2E64A 2ZT5A 3HY1A 1H4VB 2ZNIA 3VQXA 1WPYA 4WF2A 3UGTA 2CIMA 2ZCEA 1KOGA 1NJ5A 2ARTA 1EVLA 1Z7NA 1B7YB 2Q7HA 1X56A 3OD1A 3NETA 4XU3A 3HXWA 3VQWA 1HXDA 4TVAA 2Q7GA 4YRFA 4YRTA 2PMFA 2J3LA 4TVYA 4P73C 4TQFA 4P71A 4G85A 2E65A 4CH5A 3REUA 4YROA 2DZ9A 4XTXA 2Q5IA 3RIRA 1X01A 4YRMA 2DVEA 2RHSB 3P8VA 4HWSA 1L0WA 5F5WA 4CH3A 4X5OA 3TEHB 1KMMA 3EFSA 2RHSA 4K86A 4L87A 1VQZA 1QE0A 2CJBA 2QHUA 4YCWA 3VBBA 4BW9A 2DTIA 2CJAA 11ASA 2HNIA 2ZT7A 3HRKA 4ZIBA 12ASA 4OLFA 4HVCA 2I4LA 1SESA 1YFRA 2C7IA 2EL9A 2ZXFA 3PZCA 4UP9A 4PG3A 1WU7A 4YRJA 3V7RA 4WJ3M 3EFRA 4G84A 4HWTA 1C0AA 4DQ2A 2E1HA 2ZZGA 4YPFA 3L2ZA 4YRSA 3LSQA 4CH6A 1IL2A 1E24A 2Q5HA 4E51A 4H02A 4CS3A 2J3MA 3V8JA 3RL6A 1B70A 4XTYA 1EFWA 5C52B 4HWOA 4UP7A 2EJFA 3HY0A 3A5ZA 3R07A 1GGMA 3TUPA 3UFGA 5KNNA 2XGTA 1ADJA 3A7AA 3QO8A 4H2XA 1YGBA 2DKGA 1EOVA 2ZZFA 1ASZA 1SETA 4HWPA 2DZCA 2ZINA 4YRRA 3P8YA 3KFUA 3RGLA 1WYDA 3RF1A 4H2SA 1ATIA 1USYC 3RUXA 4P74A 3NELA 3HFZB 2ZIOA 3MF2A 3BFMA 2E5AA 4YYEA 1PYSB 1B76A 1NYQA 3MF1A 3ERRA 1EIYA 1X2HA 1EVKA 4UPAA 2DQ0A 2EJGA 5C51B 2ALYA 1LYLA 2Q7EA 1EIYB 3L4GB 2IY5A 3RKYA 4XU0A 2DU7A 3ICAA 4XTWA 3REXA 3A74A 4P3PA 4J15A 2P5IA 3IG2A 1J5WA 3HXUA 2RHQB 1B7YA 4XTZA 2C8MA 2ZGWA 3MEYA 4YRNA 4P74C 2CGHA 4YRQA 4RMFA 4EX5A 1USYA 1ASYA 1JJCA 4TVWA 3NEMA 4DPGA 1YFTA 4P72A 1G5IA 2ZZEA 2ARSA 2DTOA 3M4QA 3A31A 4ZTZB 1X2GA 1H4TA 4KQEA 4CS4A 1BIAA 2QHSA 2ZNJA 3FJPA 2AKWB 3A7RA 3HTZA 3UGQA 3RKXA 3G1ZA
chains in the Genus database with same CATH superfamily
1G51A 3UH0A 5C53B 1KMNA 4LVLA 4YCUA 4K88A 4YP0A 4YRCA 4H2XB 4KR2A 4TTVA 3V8LA 4UP8A 2DDZA 3A7UA 2XTIA 4P3NA 4YRPA 1EQRA 4YRKA 4Q15A 2ARUA 3TEGA 3A32A 3IKLA 1H4QA 4H2TA 2G4CA 4P75C 1Z7MA 2DU5A 2ZT6A 1NYRA 4HT4A 3DSQA 4WJ4A 3HFZA 3NENA 4XTUA 2EWNA 3V7SA 1WNLA 3V7CA 4P3OA 3HXXA 4TVAB 4YCVA 4EO4A 1HTTA 2AKWA 2RHQA 2FYKA 4OP0A 3QO5A 4H2UA 1BBWA 1QF6A 1BBUA 1NNHA 3HFVA 5HGQA 1YFSA 3L4GA 3RACA 2ZTGA 2DEQA 3QO7A 3WQZA 1X54A 3LSSA 4TQDA 3MQZA 4K87A 2EAYA 2EJ9A 4H2WA 4O2DA 2E41A 5K1XA 3L1AA 3HRIA 1PYSA 2E10A 3TEHA 4RDXA 4ZTUB 1FYFA 3V8KA 1NJ1A 4YRIA 4YRGA 4CH4A 2AMCB 3A5YA 2ODRD 3HXYA 4YRLA 1JJCB 3PCOB 1ADYA 3RKWA 2QHTA 2DQ3A 1NJ8A 4P72C 4P73A 3I7FA 4HA8A 1BIBA 3IALA 4PHCA 3QNEA 2I4OA 4XTVA 5K1PA 2IY5B 5E3IA 4KR3A 2AMCA 1E1TA 4XU2A 3QTCA 2I4NA 2ZT8A 4H2YA 4LNSA 2ODRC 3M4PA 5ELNA 4XU1A 1SERA 1E22A 4CS2A 1SRYA 2P0LA 3IKMB 4P71C 4NCXA 2DXTA 2ALYB 3HXZA 4WI1A 4XEOA 1NJ2A 1W66A 2I4MA 4RQEA 2NS6A 4P75A 3VQVA 3BJUA 2ZIMA 4HWRA 4XEMA 1E1OA 1G5HA 2QHVA 1H4SA 3P8TA 2E3CA 1RIQA 1HC7A 3CMQA 3W3SA 3LC0A 2ZR2A 4BWAA 4AH6A 3PCOA 4YREA 3HXVA 5ELOA 1YB3A 1WLEA 3E9HA 3VQYA 1NJ6A 1N9WA 2DTHA 2ZR3A 2DJZA 2PMEA 4Q6GA 1B70B 4YDQA 4H2VA 4RQFA 3E9IA 1WQ7A 2DXUA 4TWAA 2CJ9A 1B8AA 1X55A 1WQWA 2E64A 2ZT5A 3HY1A 1H4VB 2ZNIA 3VQXA 1WPYA 4WF2A 3UGTA 2CIMA 2ZCEA 1KOGA 1NJ5A 2ARTA 1EVLA 1Z7NA 1B7YB 2Q7HA 1X56A 3OD1A 3NETA 4XU3A 3HXWA 3VQWA 1HXDA 4TVAA 2Q7GA 4YRFA 4YRTA 2PMFA 2J3LA 4TVYA 4P73C 4TQFA 4P71A 4G85A 2E65A 4CH5A 3REUA 4YROA 2DZ9A 4XTXA 2Q5IA 3RIRA 1X01A 4YRMA 2DVEA 2RHSB 3P8VA 4LVKA 4HWSA 1L0WA 5F5WA 4CH3A 4X5OA 3TEHB 1KMMA 3EFSA 2RHSA 4K86A 4L87A 1VQZA 1QE0A 2CJBA 2QHUA 4YCWA 3VBBA 2A8EA 4BW9A 2DTIA 2CJAA 11ASA 2HNIA 2ZT7A 3HRKA 4ZIBA 12ASA 4OLFA 4HVCA 2I4LA 1SESA 1YFRA 2C7IA 2EL9A 2ZXFA 3PZCA 4UP9A 4PG3A 1WU7A 4YRJA 3V7RA 4WJ3M 3EFRA 4G84A 4HWTA 1C0AA 4DQ2A 2E1HA 2ZZGA 4YPFA 3L2ZA 4YRSA 3LSQA 4CH6A 1IL2A 1E24A 2Q5HA 4E51A 4H02A 4LVMA 4CS3A 2J3MA 3V8JA 3RL6A 1B70A 4XTYA 1EFWA 5C52B 4HWOA 4UP7A 2EJFA 3HY0A 3A5ZA 4LVIA 3R07A 1GGMA 3TUPA 3UFGA 5KNNA 2XGTA 1ADJA 3A7AA 3QO8A 4H2XA 1YGBA 2DKGA 1EOVA 2ZZFA 1ASZA 1SETA 4HWPA 2DZCA 2ZINA 4YRRA 3P8YA 3KFUA 3RGLA 1WYDA 3RF1A 4H2SA 1ATIA 1USYC 3RUXA 4P74A 3NELA 3HFZB 2ZIOA 3MF2A 3BFMA 2E5AA 4YYEA 1PYSB 1B76A 1NYQA 3MF1A 3ERRA 1EIYA 1X2HA 1EVKA 4UPAA 2DQ0A 2EJGA 5C51B 2ALYA 1LYLA 2Q7EA 1EIYB 3L4GB 2IY5A 3RKYA 4XU0A 2DU7A 3ICAA 4XTWA 3REXA 3A74A 4P3PA 4J15A 2P5IA 3IG2A 1J5WA 3HXUA 2RHQB 1B7YA 4XTZA 2C8MA 2ZGWA 3MEYA 4YRNA 4P74C 2CGHA 4YRQA 4RMFA 4EX5A 1USYA 1ASYA 1JJCA 4TVWA 4LVJA 3NEMA 4DPGA 1YFTA 4P72A 1G5IA 2ZZEA 2ARSA 2DTOA 3M4QA 3A31A 4ZTZB 1X2GA 1H4TA 4KQEA 4CS4A 1BIAA 2QHSA 2ZNJA 3FJPA 2AKWB 3A7RA 3HTZA 3UGQA 3RKXA 3G1ZA
chains in the Genus database with same CATH topology
1G51A 3UH0A 5C53B 1KMNA 4LVLA 4YCUA 4K88A 4YP0A 4YRCA 4H2XB 4KR2A 4TTVA 3V8LA 4UP8A 2DDZA 3A7UA 2XTIA 4P3NA 4YRPA 1EQRA 4YRKA 4Q15A 2ARUA 3TEGA 3A32A 3IKLA 1H4QA 4H2TA 2G4CA 4P75C 1Z7MA 2DU5A 2ZT6A 1NYRA 4HT4A 3DSQA 4WJ4A 3HFZA 3NENA 4XTUA 2EWNA 3V7SA 1WNLA 3V7CA 4P3OA 3HXXA 4TVAB 4YCVA 4EO4A 1HTTA 2AKWA 2RHQA 2FYKA 4OP0A 3QO5A 4H2UA 1BBWA 1QF6A 1BBUA 1NNHA 3HFVA 5HGQA 1YFSA 3L4GA 3RACA 2ZTGA 2DEQA 3QO7A 3WQZA 1X54A 3LSSA 4TQDA 3MQZA 4K87A 2EAYA 2EJ9A 4H2WA 4O2DA 2E41A 5K1XA 3L1AA 3HRIA 1PYSA 2E10A 3TEHA 4RDXA 4ZTUB 1FYFA 3V8KA 1NJ1A 4YRIA 4YRGA 4CH4A 2AMCB 3A5YA 2ODRD 3HXYA 4YRLA 1JJCB 3PCOB 1ADYA 3RKWA 2QHTA 2DQ3A 1NJ8A 4P72C 4P73A 3I7FA 4HA8A 1BIBA 3IALA 4PHCA 3QNEA 2I4OA 4XTVA 5K1PA 2IY5B 5E3IA 4KR3A 2AMCA 1E1TA 4XU2A 3QTCA 2I4NA 2ZT8A 4H2YA 4LNSA 2ODRC 3M4PA 5ELNA 4XU1A 1SERA 1E22A 4CS2A 1SRYA 2P0LA 3IKMB 4P71C 4NCXA 2DXTA 2ALYB 3HXZA 4WI1A 4XEOA 1NJ2A 1W66A 2I4MA 4RQEA 2NS6A 4P75A 3VQVA 3BJUA 2ZIMA 4HWRA 4XEMA 1E1OA 1G5HA 2QHVA 1H4SA 3P8TA 2E3CA 1RIQA 1HC7A 3CMQA 3W3SA 3LC0A 2ZR2A 4BWAA 4AH6A 3PCOA 4YREA 3HXVA 5ELOA 1YB3A 1WLEA 3E9HA 3VQYA 1NJ6A 1N9WA 2DTHA 2ZR3A 2DJZA 2PMEA 4Q6GA 1B70B 4YDQA 4H2VA 4RQFA 3E9IA 1WQ7A 2DXUA 4TWAA 2CJ9A 1B8AA 1X55A 1WQWA 2E64A 2ZT5A 3HY1A 1H4VB 2ZNIA 3VQXA 1WPYA 4WF2A 3UGTA 2CIMA 2ZCEA 1KOGA 1NJ5A 2ARTA 1EVLA 1Z7NA 1B7YB 2Q7HA 1X56A 3OD1A 3NETA 4XU3A 3HXWA 3VQWA 1HXDA 4TVAA 2Q7GA 4YRFA 4YRTA 2PMFA 2J3LA 4TVYA 4P73C 4TQFA 4P71A 4G85A 2E65A 4CH5A 3REUA 4YROA 2DZ9A 4XTXA 2Q5IA 3RIRA 1X01A 4YRMA 2DVEA 2RHSB 3P8VA 4LVKA 4HWSA 1L0WA 5F5WA 4CH3A 4X5OA 3TEHB 1KMMA 3EFSA 2RHSA 4K86A 4L87A 1VQZA 1QE0A 2CJBA 2QHUA 4YCWA 3VBBA 2A8EA 4BW9A 2DTIA 2CJAA 11ASA 2HNIA 2ZT7A 3HRKA 4ZIBA 12ASA 4OLFA 4HVCA 2I4LA 1SESA 1YFRA 2C7IA 2EL9A 2ZXFA 3PZCA 4UP9A 4PG3A 1WU7A 4YRJA 3V7RA 4WJ3M 3EFRA 4G84A 4HWTA 1C0AA 4DQ2A 2E1HA 2ZZGA 4YPFA 3L2ZA 4YRSA 3LSQA 4CH6A 1IL2A 1E24A 2Q5HA 4E51A 4H02A 4LVMA 4CS3A 2J3MA 3V8JA 3RL6A 1B70A 4XTYA 1EFWA 5C52B 4HWOA 4UP7A 2EJFA 3HY0A 3A5ZA 4LVIA 3R07A 1GGMA 3TUPA 3UFGA 5KNNA 2XGTA 1ADJA 3A7AA 3QO8A 4H2XA 1YGBA 2DKGA 1EOVA 2ZZFA 1ASZA 1SETA 4HWPA 2DZCA 2ZINA 4YRRA 3P8YA 3KFUA 3RGLA 1WYDA 3RF1A 4H2SA 1ATIA 1USYC 3RUXA 4P74A 3NELA 3HFZB 2ZIOA 3MF2A 3BFMA 2E5AA 4YYEA 1PYSB 1B76A 1NYQA 3MF1A 3ERRA 1EIYA 1X2HA 1EVKA 4UPAA 2DQ0A 2EJGA 5C51B 2ALYA 1LYLA 2Q7EA 1EIYB 3L4GB 2IY5A 3RKYA 4XU0A 2DU7A 3ICAA 4XTWA 3REXA 3A74A 4P3PA 4J15A 2P5IA 3IG2A 1J5WA 3HXUA 2RHQB 1B7YA 4XTZA 2C8MA 2ZGWA 3MEYA 4YRNA 4P74C 2CGHA 4YRQA 4RMFA 4EX5A 1USYA 1ASYA 1JJCA 4TVWA 4LVJA 3NEMA 4DPGA 1YFTA 4P72A 1G5IA 2ZZEA 2ARSA 2DTOA 3M4QA 3A31A 4ZTZB 1X2GA 1H4TA 4KQEA 4CS4A 1BIAA 2QHSA 2ZNJA 3FJPA 2AKWB 3A7RA 3HTZA 3UGQA 3RKXA 3G1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G51 A;  3UH0 A;  5C53 B;  1KMN A;  4YCU A;  4K88 A;  4YP0 A;  4YRC A;  4H2X B;  4KR2 A;  4TTV A;  3V8L A;  4UP8 A;  2DDZ A;  3A7U A;  2XTI A;  4P3N A;  4YRP A;  1EQR A;  4YRK A;  4Q15 A;  2ARU A;  3TEG A;  3A32 A;  3IKL A;  1H4Q A;  4H2T A;  2G4C A;  4P75 C;  1Z7M A;  2DU5 A;  2ZT6 A;  1NYR A;  3DSQ A;  4WJ4 A;  3HFZ A;  3NEN A;  4XTU A;  2EWN A;  3V7S A;  1WNL A;  3V7C A;  4P3O A;  3HXX A;  4TVA B;  4YCV A;  4EO4 A;  1HTT A;  2AKW A;  2RHQ A;  2FYK A;  4OP0 A;  3QO5 A;  4H2U A;  1BBW A;  1QF6 A;  1BBU A;  1NNH A;  3HFV A;  5HGQ A;  1YFS A;  3L4G A;  3RAC A;  2ZTG A;  2DEQ A;  3QO7 A;  3WQZ A;  1X54 A;  3LSS A;  4TQD A;  4K87 A;  2EAY A;  2EJ9 A;  4H2W A;  4O2D A;  2E41 A;  5K1X A;  3L1A A;  3HRI A;  1PYS A;  2E10 A;  3TEH A;  4RDX A;  4ZTU B;  1FYF A;  3V8K A;  1NJ1 A;  4YRI A;  4YRG A;  4CH4 A;  2AMC B;  3A5Y A;  2ODR D;  3HXY A;  4YRL A;  1JJC B;  3PCO B;  1ADY A;  3RKW A;  2QHT A;  2DQ3 A;  1NJ8 A;  4P72 C;  4P73 A;  3I7F A;  4HA8 A;  1BIB A;  3IAL A;  4PHC A;  3QNE A;  2I4O A;  4XTV A;  5K1P A;  2IY5 B;  5E3I A;  4KR3 A;  2AMC A;  1E1T A;  4XU2 A;  3QTC A;  2I4N A;  2ZT8 A;  4H2Y A;  4LNS A;  2ODR C;  3M4P A;  5ELN A;  4XU1 A;  1SER A;  1E22 A;  4CS2 A;  1SRY A;  2P0L A;  3IKM B;  4P71 C;  4NCX A;  2DXT A;  2ALY B;  3HXZ A;  4WI1 A;  4XEO A;  1NJ2 A;  1W66 A;  2I4M A;  4RQE A;  4P75 A;  3VQV A;  3BJU A;  2ZIM A;  4HWR A;  4XEM A;  1E1O A;  1G5H A;  2QHV A;  1H4S A;  3P8T A;  2E3C A;  1RIQ A;  1HC7 A;  3CMQ A;  3W3S A;  3LC0 A;  2ZR2 A;  4BWA A;  4AH6 A;  3PCO A;  4YRE A;  3HXV A;  5ELO A;  1YB3 A;  1WLE A;  3E9H A;  3VQY A;  1NJ6 A;  1N9W A;  2DTH A;  2ZR3 A;  2DJZ A;  2PME A;  4Q6G A;  1B70 B;  4YDQ A;  4H2V A;  4RQF A;  3E9I A;  1WQ7 A;  2DXU A;  4TWA A;  2CJ9 A;  1B8A A;  1X55 A;  1WQW A;  2E64 A;  2ZT5 A;  3HY1 A;  1H4V B;  2ZNI A;  3VQX A;  1WPY A;  4WF2 A;  3UGT A;  2CIM A;  2ZCE A;  1KOG A;  1NJ5 A;  2ART A;  1EVL A;  1Z7N A;  1B7Y B;  2Q7H A;  1X56 A;  3OD1 A;  3NET A;  4XU3 A;  3HXW A;  3VQW A;  1HXD A;  4TVA A;  2Q7G A;  4YRF A;  4YRT A;  2PMF A;  2J3L A;  4TVY A;  4P73 C;  4TQF A;  4P71 A;  4G85 A;  2E65 A;  4CH5 A;  3REU A;  4YRO A;  2DZ9 A;  4XTX A;  2Q5I A;  3RIR A;  1X01 A;  4YRM A;  2DVE A;  2RHS B;  3P8V A;  4HWS A;  1L0W A;  5F5W A;  4CH3 A;  4X5O A;  3TEH B;  1KMM A;  3EFS A;  2RHS A;  4K86 A;  4L87 A;  1VQZ A;  1QE0 A;  2CJB A;  2QHU A;  4YCW A;  3VBB A;  4BW9 A;  2DTI A;  2CJA A;  11AS A;  2HNI A;  2ZT7 A;  3HRK A;  4ZIB A;  12AS A;  4OLF A;  4HVC A;  2I4L A;  1SES A;  1YFR A;  2C7I A;  2EL9 A;  2ZXF A;  3PZC A;  4UP9 A;  4PG3 A;  1WU7 A;  4YRJ A;  3V7R A;  4WJ3 M;  3EFR A;  4G84 A;  4HWT A;  1C0A A;  4DQ2 A;  2E1H A;  2ZZG A;  4YPF A;  3L2Z A;  4YRS A;  3LSQ A;  4CH6 A;  1IL2 A;  1E24 A;  2Q5H A;  4E51 A;  4H02 A;  4CS3 A;  2J3M A;  3V8J A;  3RL6 A;  1B70 A;  4XTY A;  1EFW A;  5C52 B;  4HWO A;  4UP7 A;  2EJF A;  3HY0 A;  3A5Z A;  3R07 A;  1GGM A;  3TUP A;  3UFG A;  5KNN A;  2XGT A;  1ADJ A;  3A7A A;  3QO8 A;  4H2X A;  1YGB A;  2DKG A;  1EOV A;  2ZZF A;  1ASZ A;  1SET A;  4HWP A;  2DZC A;  2ZIN A;  4YRR A;  3P8Y A;  3KFU A;  3RGL A;  1WYD A;  3RF1 A;  4H2S A;  1ATI A;  1USY C;  3RUX A;  4P74 A;  3NEL A;  3HFZ B;  2ZIO A;  3MF2 A;  3BFM A;  2E5A A;  4YYE A;  1PYS B;  1B76 A;  1NYQ A;  3MF1 A;  3ERR A;  1EIY A;  1X2H A;  1EVK A;  4UPA A;  2DQ0 A;  2EJG A;  5C51 B;  2ALY A;  1LYL A;  2Q7E A;  1EIY B;  3L4G B;  2IY5 A;  3RKY A;  4XU0 A;  2DU7 A;  3ICA A;  4XTW A;  3REX A;  3A74 A;  4P3P A;  4J15 A;  2P5I A;  3IG2 A;  1J5W A;  3HXU A;  2RHQ B;  1B7Y A;  4XTZ A;  2C8M A;  2ZGW A;  3MEY A;  4YRN A;  4P74 C;  2CGH A;  4YRQ A;  4RMF A;  4EX5 A;  1USY A;  1ASY A;  1JJC A;  4TVW A;  3NEM A;  4DPG A;  1YFT A;  4P72 A;  1G5I A;  2ZZE A;  2ARS A;  2DTO A;  3M4Q A;  3A31 A;  4ZTZ B;  1X2G A;  1H4T A;  4KQE A;  4CS4 A;  1BIA A;  2QHS A;  2ZNJ A;  3FJP A;  2AKW B;  3A7R A;  3HTZ A;  3UGQ A;  3RKX A;  3G1Z A; 
#chains in the Genus database with same CATH topology
 1G51 A;  3UH0 A;  5C53 B;  1KMN A;  4LVL A;  4YCU A;  4K88 A;  4YP0 A;  4YRC A;  4H2X B;  4KR2 A;  4TTV A;  3V8L A;  4UP8 A;  2DDZ A;  3A7U A;  2XTI A;  4P3N A;  4YRP A;  1EQR A;  4YRK A;  4Q15 A;  2ARU A;  3TEG A;  3A32 A;  3IKL A;  1H4Q A;  4H2T A;  2G4C A;  4P75 C;  1Z7M A;  2DU5 A;  2ZT6 A;  1NYR A;  4HT4 A;  3DSQ A;  4WJ4 A;  3HFZ A;  3NEN A;  4XTU A;  2EWN A;  3V7S A;  1WNL A;  3V7C A;  4P3O A;  3HXX A;  4TVA B;  4YCV A;  4EO4 A;  1HTT A;  2AKW A;  2RHQ A;  2FYK A;  4OP0 A;  3QO5 A;  4H2U A;  1BBW A;  1QF6 A;  1BBU A;  1NNH A;  3HFV A;  5HGQ A;  1YFS A;  3L4G A;  3RAC A;  2ZTG A;  2DEQ A;  3QO7 A;  3WQZ A;  1X54 A;  3LSS A;  4TQD A;  3MQZ A;  4K87 A;  2EAY A;  2EJ9 A;  4H2W A;  4O2D A;  2E41 A;  5K1X A;  3L1A A;  3HRI A;  1PYS A;  2E10 A;  3TEH A;  4RDX A;  4ZTU B;  1FYF A;  3V8K A;  1NJ1 A;  4YRI A;  4YRG A;  4CH4 A;  2AMC B;  3A5Y A;  2ODR D;  3HXY A;  4YRL A;  1JJC B;  3PCO B;  1ADY A;  3RKW A;  2QHT A;  2DQ3 A;  1NJ8 A;  4P72 C;  4P73 A;  3I7F A;  4HA8 A;  1BIB A;  3IAL A;  4PHC A;  3QNE A;  2I4O A;  4XTV A;  5K1P A;  2IY5 B;  5E3I A;  4KR3 A;  2AMC A;  1E1T A;  4XU2 A;  3QTC A;  2I4N A;  2ZT8 A;  4H2Y A;  4LNS A;  2ODR C;  3M4P A;  5ELN A;  4XU1 A;  1SER A;  1E22 A;  4CS2 A;  1SRY A;  2P0L A;  3IKM B;  4P71 C;  4NCX A;  2DXT A;  2ALY B;  3HXZ A;  4WI1 A;  4XEO A;  1NJ2 A;  1W66 A;  2I4M A;  4RQE A;  2NS6 A;  4P75 A;  3VQV A;  3BJU A;  2ZIM A;  4HWR A;  4XEM A;  1E1O A;  1G5H A;  2QHV A;  1H4S A;  3P8T A;  2E3C A;  1RIQ A;  1HC7 A;  3CMQ A;  3W3S A;  3LC0 A;  2ZR2 A;  4BWA A;  4AH6 A;  3PCO A;  4YRE A;  3HXV A;  5ELO A;  1YB3 A;  1WLE A;  3E9H A;  3VQY A;  1NJ6 A;  1N9W A;  2DTH A;  2ZR3 A;  2DJZ A;  2PME A;  4Q6G A;  1B70 B;  4YDQ A;  4H2V A;  4RQF A;  3E9I A;  1WQ7 A;  2DXU A;  4TWA A;  2CJ9 A;  1B8A A;  1X55 A;  1WQW A;  2E64 A;  2ZT5 A;  3HY1 A;  1H4V B;  2ZNI A;  3VQX A;  1WPY A;  4WF2 A;  3UGT A;  2CIM A;  2ZCE A;  1KOG A;  1NJ5 A;  2ART A;  1EVL A;  1Z7N A;  1B7Y B;  2Q7H A;  1X56 A;  3OD1 A;  3NET A;  4XU3 A;  3HXW A;  3VQW A;  1HXD A;  4TVA A;  2Q7G A;  4YRF A;  4YRT A;  2PMF A;  2J3L A;  4TVY A;  4P73 C;  4TQF A;  4P71 A;  4G85 A;  2E65 A;  4CH5 A;  3REU A;  4YRO A;  2DZ9 A;  4XTX A;  2Q5I A;  3RIR A;  1X01 A;  4YRM A;  2DVE A;  2RHS B;  3P8V A;  4LVK A;  4HWS A;  1L0W A;  5F5W A;  4CH3 A;  4X5O A;  3TEH B;  1KMM A;  3EFS A;  2RHS A;  4K86 A;  4L87 A;  1VQZ A;  1QE0 A;  2CJB A;  2QHU A;  4YCW A;  3VBB A;  2A8E A;  4BW9 A;  2DTI A;  2CJA A;  11AS A;  2HNI A;  2ZT7 A;  3HRK A;  4ZIB A;  12AS A;  4OLF A;  4HVC A;  2I4L A;  1SES A;  1YFR A;  2C7I A;  2EL9 A;  2ZXF A;  3PZC A;  4UP9 A;  4PG3 A;  1WU7 A;  4YRJ A;  3V7R A;  4WJ3 M;  3EFR A;  4G84 A;  4HWT A;  1C0A A;  4DQ2 A;  2E1H A;  2ZZG A;  4YPF A;  3L2Z A;  4YRS A;  3LSQ A;  4CH6 A;  1IL2 A;  1E24 A;  2Q5H A;  4E51 A;  4H02 A;  4LVM A;  4CS3 A;  2J3M A;  3V8J A;  3RL6 A;  1B70 A;  4XTY A;  1EFW A;  5C52 B;  4HWO A;  4UP7 A;  2EJF A;  3HY0 A;  3A5Z A;  4LVI A;  3R07 A;  1GGM A;  3TUP A;  3UFG A;  5KNN A;  2XGT A;  1ADJ A;  3A7A A;  3QO8 A;  4H2X A;  1YGB A;  2DKG A;  1EOV A;  2ZZF A;  1ASZ A;  1SET A;  4HWP A;  2DZC A;  2ZIN A;  4YRR A;  3P8Y A;  3KFU A;  3RGL A;  1WYD A;  3RF1 A;  4H2S A;  1ATI A;  1USY C;  3RUX A;  4P74 A;  3NEL A;  3HFZ B;  2ZIO A;  3MF2 A;  3BFM A;  2E5A A;  4YYE A;  1PYS B;  1B76 A;  1NYQ A;  3MF1 A;  3ERR A;  1EIY A;  1X2H A;  1EVK A;  4UPA A;  2DQ0 A;  2EJG A;  5C51 B;  2ALY A;  1LYL A;  2Q7E A;  1EIY B;  3L4G B;  2IY5 A;  3RKY A;  4XU0 A;  2DU7 A;  3ICA A;  4XTW A;  3REX A;  3A74 A;  4P3P A;  4J15 A;  2P5I A;  3IG2 A;  1J5W A;  3HXU A;  2RHQ B;  1B7Y A;  4XTZ A;  2C8M A;  2ZGW A;  3MEY A;  4YRN A;  4P74 C;  2CGH A;  4YRQ A;  4RMF A;  4EX5 A;  1USY A;  1ASY A;  1JJC A;  4TVW A;  4LVJ A;  3NEM A;  4DPG A;  1YFT A;  4P72 A;  1G5I A;  2ZZE A;  2ARS A;  2DTO A;  3M4Q A;  3A31 A;  4ZTZ B;  1X2G A;  1H4T A;  4KQE A;  4CS4 A;  1BIA A;  2QHS A;  2ZNJ A;  3FJP A;  2AKW B;  3A7R A;  3HTZ A;  3UGQ A;  3RKX A;  3G1Z A; 
#chains in the Genus database with same CATH homology
 1G51 A;  3UH0 A;  5C53 B;  1KMN A;  4LVL A;  4YCU A;  4K88 A;  4YP0 A;  4YRC A;  4H2X B;  4KR2 A;  4TTV A;  3V8L A;  4UP8 A;  2DDZ A;  3A7U A;  2XTI A;  4P3N A;  4YRP A;  1EQR A;  4YRK A;  4Q15 A;  2ARU A;  3TEG A;  3A32 A;  3IKL A;  1H4Q A;  4H2T A;  2G4C A;  4P75 C;  1Z7M A;  2DU5 A;  2ZT6 A;  1NYR A;  4HT4 A;  3DSQ A;  4WJ4 A;  3HFZ A;  3NEN A;  4XTU A;  2EWN A;  3V7S A;  1WNL A;  3V7C A;  4P3O A;  3HXX A;  4TVA B;  4YCV A;  4EO4 A;  1HTT A;  2AKW A;  2RHQ A;  2FYK A;  4OP0 A;  3QO5 A;  4H2U A;  1BBW A;  1QF6 A;  1BBU A;  1NNH A;  3HFV A;  5HGQ A;  1YFS A;  3L4G A;  3RAC A;  2ZTG A;  2DEQ A;  3QO7 A;  3WQZ A;  1X54 A;  3LSS A;  4TQD A;  3MQZ A;  4K87 A;  2EAY A;  2EJ9 A;  4H2W A;  4O2D A;  2E41 A;  5K1X A;  3L1A A;  3HRI A;  1PYS A;  2E10 A;  3TEH A;  4RDX A;  4ZTU B;  1FYF A;  3V8K A;  1NJ1 A;  4YRI A;  4YRG A;  4CH4 A;  2AMC B;  3A5Y A;  2ODR D;  3HXY A;  4YRL A;  1JJC B;  3PCO B;  1ADY A;  3RKW A;  2QHT A;  2DQ3 A;  1NJ8 A;  4P72 C;  4P73 A;  3I7F A;  4HA8 A;  1BIB A;  3IAL A;  4PHC A;  3QNE A;  2I4O A;  4XTV A;  5K1P A;  2IY5 B;  5E3I A;  4KR3 A;  2AMC A;  1E1T A;  4XU2 A;  3QTC A;  2I4N A;  2ZT8 A;  4H2Y A;  4LNS A;  2ODR C;  3M4P A;  5ELN A;  4XU1 A;  1SER A;  1E22 A;  4CS2 A;  1SRY A;  2P0L A;  3IKM B;  4P71 C;  4NCX A;  2DXT A;  2ALY B;  3HXZ A;  4WI1 A;  4XEO A;  1NJ2 A;  1W66 A;  2I4M A;  4RQE A;  2NS6 A;  4P75 A;  3VQV A;  3BJU A;  2ZIM A;  4HWR A;  4XEM A;  1E1O A;  1G5H A;  2QHV A;  1H4S A;  3P8T A;  2E3C A;  1RIQ A;  1HC7 A;  3CMQ A;  3W3S A;  3LC0 A;  2ZR2 A;  4BWA A;  4AH6 A;  3PCO A;  4YRE A;  3HXV A;  5ELO A;  1YB3 A;  1WLE A;  3E9H A;  3VQY A;  1NJ6 A;  1N9W A;  2DTH A;  2ZR3 A;  2DJZ A;  2PME A;  4Q6G A;  1B70 B;  4YDQ A;  4H2V A;  4RQF A;  3E9I A;  1WQ7 A;  2DXU A;  4TWA A;  2CJ9 A;  1B8A A;  1X55 A;  1WQW A;  2E64 A;  2ZT5 A;  3HY1 A;  1H4V B;  2ZNI A;  3VQX A;  1WPY A;  4WF2 A;  3UGT A;  2CIM A;  2ZCE A;  1KOG A;  1NJ5 A;  2ART A;  1EVL A;  1Z7N A;  1B7Y B;  2Q7H A;  1X56 A;  3OD1 A;  3NET A;  4XU3 A;  3HXW A;  3VQW A;  1HXD A;  4TVA A;  2Q7G A;  4YRF A;  4YRT A;  2PMF A;  2J3L A;  4TVY A;  4P73 C;  4TQF A;  4P71 A;  4G85 A;  2E65 A;  4CH5 A;  3REU A;  4YRO A;  2DZ9 A;  4XTX A;  2Q5I A;  3RIR A;  1X01 A;  4YRM A;  2DVE A;  2RHS B;  3P8V A;  4LVK A;  4HWS A;  1L0W A;  5F5W A;  4CH3 A;  4X5O A;  3TEH B;  1KMM A;  3EFS A;  2RHS A;  4K86 A;  4L87 A;  1VQZ A;  1QE0 A;  2CJB A;  2QHU A;  4YCW A;  3VBB A;  2A8E A;  4BW9 A;  2DTI A;  2CJA A;  11AS A;  2HNI A;  2ZT7 A;  3HRK A;  4ZIB A;  12AS A;  4OLF A;  4HVC A;  2I4L A;  1SES A;  1YFR A;  2C7I A;  2EL9 A;  2ZXF A;  3PZC A;  4UP9 A;  4PG3 A;  1WU7 A;  4YRJ A;  3V7R A;  4WJ3 M;  3EFR A;  4G84 A;  4HWT A;  1C0A A;  4DQ2 A;  2E1H A;  2ZZG A;  4YPF A;  3L2Z A;  4YRS A;  3LSQ A;  4CH6 A;  1IL2 A;  1E24 A;  2Q5H A;  4E51 A;  4H02 A;  4LVM A;  4CS3 A;  2J3M A;  3V8J A;  3RL6 A;  1B70 A;  4XTY A;  1EFW A;  5C52 B;  4HWO A;  4UP7 A;  2EJF A;  3HY0 A;  3A5Z A;  4LVI A;  3R07 A;  1GGM A;  3TUP A;  3UFG A;  5KNN A;  2XGT A;  1ADJ A;  3A7A A;  3QO8 A;  4H2X A;  1YGB A;  2DKG A;  1EOV A;  2ZZF A;  1ASZ A;  1SET A;  4HWP A;  2DZC A;  2ZIN A;  4YRR A;  3P8Y A;  3KFU A;  3RGL A;  1WYD A;  3RF1 A;  4H2S A;  1ATI A;  1USY C;  3RUX A;  4P74 A;  3NEL A;  3HFZ B;  2ZIO A;  3MF2 A;  3BFM A;  2E5A A;  4YYE A;  1PYS B;  1B76 A;  1NYQ A;  3MF1 A;  3ERR A;  1EIY A;  1X2H A;  1EVK A;  4UPA A;  2DQ0 A;  2EJG A;  5C51 B;  2ALY A;  1LYL A;  2Q7E A;  1EIY B;  3L4G B;  2IY5 A;  3RKY A;  4XU0 A;  2DU7 A;  3ICA A;  4XTW A;  3REX A;  3A74 A;  4P3P A;  4J15 A;  2P5I A;  3IG2 A;  1J5W A;  3HXU A;  2RHQ B;  1B7Y A;  4XTZ A;  2C8M A;  2ZGW A;  3MEY A;  4YRN A;  4P74 C;  2CGH A;  4YRQ A;  4RMF A;  4EX5 A;  1USY A;  1ASY A;  1JJC A;  4TVW A;  4LVJ A;  3NEM A;  4DPG A;  1YFT A;  4P72 A;  1G5I A;  2ZZE A;  2ARS A;  2DTO A;  3M4Q A;  3A31 A;  4ZTZ B;  1X2G A;  1H4T A;  4KQE A;  4CS4 A;  1BIA A;  2QHS A;  2ZNJ A;  3FJP A;  2AKW B;  3A7R A;  3HTZ A;  3UGQ A;  3RKX A;  3G1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...