2QHTA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Lipoyltransferase
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
total genus 66
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhtA01
3VQWA 2ARSA 4WF2A 2ZR2A 4P3OA 4XU2A 3I7FA 2CIMA 5C53B 1EOVA 1WNLA 1WLEA 3HY1A 4XU0A 4YREA 3RACA 1JJCB 2QHSA 2ZNJA 1WYDA 5E3IA 3HXWA 2ZINA 2CJBA 1YFRA 2Q5HA 2EJGA 1VQZA 4XU1A 4XEOA 1ASYA 12ASA 2ZXFA 3V8JA 2P0LA 4G85A 4TWAA 2ZZFA 1KMNA 2ZIMA 4YRLA 4RQEA 1EIYA 2ZT6A 2E10A 4KR2A 1YB3A 1GGMA 1YFSA 3M4QA 4J15A 2Q5IA 4CS4A 4HWPA 2QHVA 4H2VA 4WJ4A 2DZCA 2ALYA 3RGLA 4XEMA 3RL6A 3TEHB 4P74A 3E9IA 4X5OA 3FJPA 4TTVA 4YRMA 2RHSA 1USYA 3ICAA 2QHTA 3VBBA 4YRRA 3L4GB 3MF1A 4HWOA 3HFZA 1BIAA 3QO5A 2Q7GA 3PCOB 3V8KA 1EQRA 4P72A 3E9HA 2G4CA 3HTZA 3HFVA 3EFRA 2ODRD 5HGQA 3VQYA 3MF2A 2ZIOA 2ZR3A 1YGBA 1PYSB 3OD1A 1EVLA 1JJCA 3MEYA 1NNHA 1ADJA 1SESA 4P73A 1SERA 4H2SA 1ATIA 1SRYA 4YROA 1B76A 4H2XB 2E41A 2ARUA 1E24A 3TUPA 5C52B 4BW9A 1G5HA 1QF6A 3CMQA 4HWRA 3IKMB 1NJ6A 4P75C 2DU7A 3RUXA 3G1ZA 1H4QA 4YRKA 3REXA 3DSQA 1E1OA 4XTXA 4P72C 3RIRA 2ODRC 1B70A 3TEHA 4YP0A 3V7CA 4KQEA 4YRFA 2EL9A 1NJ5A 2RHQB 2DDZA 4P73C 1YFTA 2CJAA 2J3LA 1J5WA 3PCOA 3QNEA 4KR3A 3RKXA 1HC7A 3HXYA 3L2ZA 4YRCA 2DZ9A 3HXVA 3R07A 1EVKA 1EFWA 2CGHA 2DTIA 2XTIA 2I4MA 3IALA 3V7RA 1B7YB 2AKWB 4HWSA 4TQFA 4TVYA 2I4OA 1PYSA 4HA8A 5F5WA 4YRIA 3QTCA 3A7AA 3RKYA 1WU7A 4PG3A 1LYLA 3A32A 2ZGWA 3A74A 4P75A 3PZCA 3HXUA 2DXTA 1H4VB 3M4PA 3LC0A 4AH6A 1C0AA 3BJUA 1L0WA 2C8MA 1N9WA 2DQ0A 2ZZGA 2ZT5A 4YCUA 1NJ1A 1G5IA 2IY5B 4ZTUB 4P71A 3VQXA 1NJ2A 4P3PA 3TEGA 4LNSA 5K1PA 3HXZA 3UGTA 3VQVA 2ZT7A 3UH0A 1SETA 2EWNA 1NJ8A 3EFSA 1X55A 1Z7MA 5ELOA 1B8AA 2ARTA 4DQ2A 1QE0A 1ADYA 2DTHA 3NELA 4L87A 4DPGA 3REUA 4O2DA 4H02A 4YCVA 4CS2A 3V8LA 4YRSA 1E1TA 2E65A 4YRQA 2ALYB 2DQ3A 2EAYA 3BFMA 4H2WA 2ZNIA 1BBWA 4G84A 3HRKA 4CH3A 1FYFA 3A5ZA 2J3MA 4WJ3M 4XTVA 1X2HA 2PMEA 4XU3A 2P5IA 1Z7NA 4P71C 1NYRA 2AKWA 1BBUA 1HXDA 4XTWA 3LSQA 1H4SA 2ZCEA 2EJ9A 1WQ7A 3HXXA 1HTTA 1RIQA 4HWTA 4CS3A 2DXUA 3L4GA 2AMCB 3UGQA 4HVCA 4BWAA 3L1AA 4UP8A 5C51B 3RKWA 2Q7HA 3P8VA 4TVAB 2IY5A 4XTZA 1W66A 4H2UA 2C7IA 3V7SA 1KOGA 4K87A 4ZIBA 1WQWA 2ZTGA 2DTOA 1H4TA 4H2TA 2ZZEA 1KMMA 4K86A 3RF1A 4YRNA 1X56A 3IG2A 4H2XA 1NYQA 4UPAA 11ASA 5K1XA 3WQZA 1ASZA 1X2GA 3P8YA 3A7UA 3NEMA 5KNNA 2CJ9A 3NENA 1B70B 2XGTA 1G51A 3NETA 3ERRA 2ZT8A 4H2YA 4XTYA 2DU5A 4CH6A 4YRPA 4UP7A 1X54A 2EJFA 1BIBA 4OP0A 4WI1A 4UP9A 4RQFA 4E51A 4Q6GA 4Q15A 3W3SA 4RMFA 1EIYB 2Q7EA 4CH4A 2E1HA 4CH5A 2PMFA 3IKLA 1IL2A 4TQDA 3LSSA 4EX5A 2RHQA 2DEQA 1X01A 2FYKA 4NCXA 4RDXA 1E22A 4YPFA 2AMCA 3KFUA 2DJZA 3A5YA 3P8TA 4PHCA 4YDQA 4K88A 2DVEA 4TVWA 3HY0A 2QHUA 3A7RA 4YCWA 4YRJA 5ELNA 4YYEA 4TVAA 4YRGA 2E3CA 3QO8A 4ZTZB 2RHSB 4P74C 4P3NA 2E64A 3UFGA 2DKGA 2E5AA 3HRIA 3QO7A 1B7YA 4EO4A 1USYC 4XTUA 3HFZB 2HNIA 4YRTA 3A31A 2I4LA 2I4NA 4OLFA 1WPYA
chains in the Genus database with same CATH superfamily
3VQWA 2ARSA 4WF2A 2ZR2A 4P3OA 4XU2A 3I7FA 2CIMA 5C53B 1EOVA 1WNLA 1WLEA 3HY1A 4XU0A 4YREA 3RACA 1JJCB 2QHSA 2ZNJA 1WYDA 5E3IA 3HXWA 2ZINA 2CJBA 1YFRA 2Q5HA 2EJGA 1VQZA 4XU1A 4XEOA 1ASYA 12ASA 2ZXFA 3V8JA 2P0LA 4G85A 4TWAA 2ZZFA 1KMNA 2ZIMA 4YRLA 4RQEA 1EIYA 2ZT6A 2E10A 4KR2A 1YB3A 1GGMA 1YFSA 3M4QA 4J15A 2Q5IA 4CS4A 4HWPA 2QHVA 4H2VA 4WJ4A 2DZCA 2ALYA 3RGLA 4XEMA 3RL6A 3TEHB 4P74A 3E9IA 4X5OA 3FJPA 4TTVA 4YRMA 2RHSA 1USYA 3ICAA 2QHTA 3VBBA 4YRRA 3L4GB 3MF1A 4HWOA 3HFZA 2A8EA 1BIAA 3QO5A 2Q7GA 3PCOB 3V8KA 1EQRA 4P72A 3E9HA 2G4CA 3HTZA 3HFVA 3EFRA 2ODRD 5HGQA 3VQYA 3MF2A 2ZIOA 2ZR3A 4HT4A 1YGBA 1PYSB 3OD1A 1EVLA 1JJCA 3MEYA 1NNHA 1ADJA 1SESA 4P73A 1SERA 4H2SA 1ATIA 1SRYA 4YROA 1B76A 4H2XB 2E41A 2ARUA 1E24A 3TUPA 5C52B 4BW9A 1G5HA 1QF6A 3CMQA 4HWRA 3IKMB 1NJ6A 4P75C 2DU7A 3RUXA 3G1ZA 1H4QA 4YRKA 3REXA 3DSQA 1E1OA 4XTXA 4P72C 3RIRA 2ODRC 1B70A 3TEHA 4YP0A 3V7CA 4KQEA 4YRFA 2EL9A 1NJ5A 2RHQB 2DDZA 4P73C 1YFTA 2CJAA 2J3LA 1J5WA 4LVIA 3PCOA 3QNEA 4KR3A 3RKXA 1HC7A 3HXYA 3L2ZA 4YRCA 2DZ9A 3HXVA 3R07A 1EVKA 1EFWA 2CGHA 2DTIA 2XTIA 2I4MA 3IALA 3V7RA 1B7YB 2AKWB 4HWSA 4TQFA 4TVYA 2I4OA 1PYSA 4HA8A 5F5WA 4LVMA 4YRIA 3QTCA 3A7AA 3RKYA 1WU7A 4PG3A 1LYLA 3A32A 2ZGWA 3A74A 4P75A 3PZCA 3HXUA 2DXTA 1H4VB 3M4PA 3LC0A 4AH6A 1C0AA 3BJUA 1L0WA 2C8MA 1N9WA 2DQ0A 2ZZGA 2ZT5A 4YCUA 1NJ1A 1G5IA 2IY5B 4ZTUB 4P71A 3VQXA 1NJ2A 4P3PA 3TEGA 4LNSA 5K1PA 3HXZA 3UGTA 3VQVA 2ZT7A 3UH0A 1SETA 2EWNA 1NJ8A 3EFSA 4LVJA 1X55A 1Z7MA 5ELOA 1B8AA 2ARTA 4DQ2A 1QE0A 1ADYA 2DTHA 3NELA 4L87A 4DPGA 3REUA 4O2DA 4H02A 4YCVA 4CS2A 3V8LA 4YRSA 1E1TA 2E65A 4YRQA 2ALYB 2DQ3A 2EAYA 3BFMA 4H2WA 2ZNIA 1BBWA 4G84A 3HRKA 4CH3A 1FYFA 3A5ZA 2J3MA 4WJ3M 4XTVA 1X2HA 2PMEA 4XU3A 2P5IA 1Z7NA 4P71C 1NYRA 2AKWA 1BBUA 1HXDA 4XTWA 3LSQA 1H4SA 2ZCEA 2EJ9A 1WQ7A 3HXXA 1HTTA 1RIQA 4HWTA 4CS3A 2DXUA 3L4GA 2AMCB 3UGQA 4HVCA 4BWAA 3L1AA 4UP8A 5C51B 3RKWA 2Q7HA 3P8VA 4TVAB 2IY5A 4XTZA 1W66A 4H2UA 2C7IA 3V7SA 1KOGA 4K87A 4ZIBA 1WQWA 2ZTGA 2DTOA 1H4TA 4H2TA 3MQZA 2ZZEA 1KMMA 4K86A 3RF1A 4YRNA 1X56A 3IG2A 4H2XA 1NYQA 4UPAA 11ASA 5K1XA 3WQZA 1ASZA 1X2GA 3P8YA 3A7UA 3NEMA 5KNNA 2CJ9A 3NENA 1B70B 2XGTA 4LVLA 1G51A 3NETA 3ERRA 2ZT8A 4H2YA 4XTYA 2DU5A 4CH6A 4YRPA 4UP7A 1X54A 2EJFA 1BIBA 4OP0A 4WI1A 4UP9A 4RQFA 4E51A 4Q6GA 4Q15A 3W3SA 4RMFA 1EIYB 2Q7EA 4CH4A 2E1HA 4CH5A 2PMFA 3IKLA 1IL2A 4TQDA 3LSSA 4EX5A 2RHQA 2DEQA 1X01A 2FYKA 4NCXA 4RDXA 1E22A 4YPFA 2AMCA 3KFUA 2DJZA 3A5YA 3P8TA 4PHCA 4YDQA 4K88A 2DVEA 4TVWA 3HY0A 2QHUA 3A7RA 4YCWA 4YRJA 5ELNA 4YYEA 4TVAA 4YRGA 2E3CA 3QO8A 4ZTZB 2RHSB 4P74C 4P3NA 2E64A 3UFGA 2DKGA 2E5AA 3HRIA 3QO7A 1B7YA 4EO4A 2NS6A 1USYC 4XTUA 3HFZB 2HNIA 4YRTA 4LVKA 3A31A 2I4LA 2I4NA 4OLFA 1WPYA
chains in the Genus database with same CATH topology
3VQWA 2ARSA 4WF2A 2ZR2A 4P3OA 4XU2A 3I7FA 2CIMA 5C53B 1EOVA 1WNLA 1WLEA 3HY1A 4XU0A 4YREA 3RACA 1JJCB 2QHSA 2ZNJA 1WYDA 5E3IA 3HXWA 2ZINA 2CJBA 1YFRA 2Q5HA 2EJGA 1VQZA 4XU1A 4XEOA 1ASYA 12ASA 2ZXFA 3V8JA 2P0LA 4G85A 4TWAA 2ZZFA 1KMNA 2ZIMA 4YRLA 4RQEA 1EIYA 2ZT6A 2E10A 4KR2A 1YB3A 1GGMA 1YFSA 3M4QA 4J15A 2Q5IA 4CS4A 4HWPA 2QHVA 4H2VA 4WJ4A 2DZCA 2ALYA 3RGLA 4XEMA 3RL6A 3TEHB 4P74A 3E9IA 4X5OA 3FJPA 4TTVA 4YRMA 2RHSA 1USYA 3ICAA 2QHTA 3VBBA 4YRRA 3L4GB 3MF1A 4HWOA 3HFZA 2A8EA 1BIAA 3QO5A 2Q7GA 3PCOB 3V8KA 1EQRA 4P72A 3E9HA 2G4CA 3HTZA 3HFVA 3EFRA 2ODRD 5HGQA 3VQYA 3MF2A 2ZIOA 2ZR3A 4HT4A 1YGBA 1PYSB 3OD1A 1EVLA 1JJCA 3MEYA 1NNHA 1ADJA 1SESA 4P73A 1SERA 4H2SA 1ATIA 1SRYA 4YROA 1B76A 4H2XB 2E41A 2ARUA 1E24A 3TUPA 5C52B 4BW9A 1G5HA 1QF6A 3CMQA 4HWRA 3IKMB 1NJ6A 4P75C 2DU7A 3RUXA 3G1ZA 1H4QA 4YRKA 3REXA 3DSQA 1E1OA 4XTXA 4P72C 3RIRA 2ODRC 1B70A 3TEHA 4YP0A 3V7CA 4KQEA 4YRFA 2EL9A 1NJ5A 2RHQB 2DDZA 4P73C 1YFTA 2CJAA 2J3LA 1J5WA 4LVIA 3PCOA 3QNEA 4KR3A 3RKXA 1HC7A 3HXYA 3L2ZA 4YRCA 2DZ9A 3HXVA 3R07A 1EVKA 1EFWA 2CGHA 2DTIA 2XTIA 2I4MA 3IALA 3V7RA 1B7YB 2AKWB 4HWSA 4TQFA 4TVYA 2I4OA 1PYSA 4HA8A 5F5WA 4LVMA 4YRIA 3QTCA 3A7AA 3RKYA 1WU7A 4PG3A 1LYLA 3A32A 2ZGWA 3A74A 4P75A 3PZCA 3HXUA 2DXTA 1H4VB 3M4PA 3LC0A 4AH6A 1C0AA 3BJUA 1L0WA 2C8MA 1N9WA 2DQ0A 2ZZGA 2ZT5A 4YCUA 1NJ1A 1G5IA 2IY5B 4ZTUB 4P71A 3VQXA 1NJ2A 4P3PA 3TEGA 4LNSA 5K1PA 3HXZA 3UGTA 3VQVA 2ZT7A 3UH0A 1SETA 2EWNA 1NJ8A 3EFSA 4LVJA 1X55A 1Z7MA 5ELOA 1B8AA 2ARTA 4DQ2A 1QE0A 1ADYA 2DTHA 3NELA 4L87A 4DPGA 3REUA 4O2DA 4H02A 4YCVA 4CS2A 3V8LA 4YRSA 1E1TA 2E65A 4YRQA 2ALYB 2DQ3A 2EAYA 3BFMA 4H2WA 2ZNIA 1BBWA 4G84A 3HRKA 4CH3A 1FYFA 3A5ZA 2J3MA 4WJ3M 4XTVA 1X2HA 2PMEA 4XU3A 2P5IA 1Z7NA 4P71C 1NYRA 2AKWA 1BBUA 1HXDA 4XTWA 3LSQA 1H4SA 2ZCEA 2EJ9A 1WQ7A 3HXXA 1HTTA 1RIQA 4HWTA 4CS3A 2DXUA 3L4GA 2AMCB 3UGQA 4HVCA 4BWAA 3L1AA 4UP8A 5C51B 3RKWA 2Q7HA 3P8VA 4TVAB 2IY5A 4XTZA 1W66A 4H2UA 2C7IA 3V7SA 1KOGA 4K87A 4ZIBA 1WQWA 2ZTGA 2DTOA 1H4TA 4H2TA 3MQZA 2ZZEA 1KMMA 4K86A 3RF1A 4YRNA 1X56A 3IG2A 4H2XA 1NYQA 4UPAA 11ASA 5K1XA 3WQZA 1ASZA 1X2GA 3P8YA 3A7UA 3NEMA 5KNNA 2CJ9A 3NENA 1B70B 2XGTA 4LVLA 1G51A 3NETA 3ERRA 2ZT8A 4H2YA 4XTYA 2DU5A 4CH6A 4YRPA 4UP7A 1X54A 2EJFA 1BIBA 4OP0A 4WI1A 4UP9A 4RQFA 4E51A 4Q6GA 4Q15A 3W3SA 4RMFA 1EIYB 2Q7EA 4CH4A 2E1HA 4CH5A 2PMFA 3IKLA 1IL2A 4TQDA 3LSSA 4EX5A 2RHQA 2DEQA 1X01A 2FYKA 4NCXA 4RDXA 1E22A 4YPFA 2AMCA 3KFUA 2DJZA 3A5YA 3P8TA 4PHCA 4YDQA 4K88A 2DVEA 4TVWA 3HY0A 2QHUA 3A7RA 4YCWA 4YRJA 5ELNA 4YYEA 4TVAA 4YRGA 2E3CA 3QO8A 4ZTZB 2RHSB 4P74C 4P3NA 2E64A 3UFGA 2DKGA 2E5AA 3HRIA 3QO7A 1B7YA 4EO4A 2NS6A 1USYC 4XTUA 3HFZB 2HNIA 4YRTA 4LVKA 3A31A 2I4LA 2I4NA 4OLFA 1WPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQW A;  2ARS A;  4WF2 A;  2ZR2 A;  4P3O A;  4XU2 A;  3I7F A;  2CIM A;  5C53 B;  1EOV A;  1WNL A;  1WLE A;  3HY1 A;  4XU0 A;  4YRE A;  3RAC A;  1JJC B;  2QHS A;  2ZNJ A;  1WYD A;  5E3I A;  3HXW A;  2ZIN A;  2CJB A;  1YFR A;  2Q5H A;  2EJG A;  1VQZ A;  4XU1 A;  4XEO A;  1ASY A;  12AS A;  2ZXF A;  3V8J A;  2P0L A;  4G85 A;  4TWA A;  2ZZF A;  1KMN A;  2ZIM A;  4YRL A;  4RQE A;  1EIY A;  2ZT6 A;  2E10 A;  4KR2 A;  1YB3 A;  1GGM A;  1YFS A;  3M4Q A;  4J15 A;  2Q5I A;  4CS4 A;  4HWP A;  2QHV A;  4H2V A;  4WJ4 A;  2DZC A;  2ALY A;  3RGL A;  4XEM A;  3RL6 A;  3TEH B;  4P74 A;  3E9I A;  4X5O A;  3FJP A;  4TTV A;  4YRM A;  2RHS A;  1USY A;  3ICA A;  2QHT A;  3VBB A;  4YRR A;  3L4G B;  3MF1 A;  4HWO A;  3HFZ A;  1BIA A;  3QO5 A;  2Q7G A;  3PCO B;  3V8K A;  1EQR A;  4P72 A;  3E9H A;  2G4C A;  3HTZ A;  3HFV A;  3EFR A;  2ODR D;  5HGQ A;  3VQY A;  3MF2 A;  2ZIO A;  2ZR3 A;  1YGB A;  1PYS B;  3OD1 A;  1EVL A;  1JJC A;  3MEY A;  1NNH A;  1ADJ A;  1SES A;  4P73 A;  1SER A;  4H2S A;  1ATI A;  1SRY A;  4YRO A;  1B76 A;  4H2X B;  2E41 A;  2ARU A;  1E24 A;  3TUP A;  5C52 B;  4BW9 A;  1G5H A;  1QF6 A;  3CMQ A;  4HWR A;  3IKM B;  1NJ6 A;  4P75 C;  2DU7 A;  3RUX A;  3G1Z A;  1H4Q A;  4YRK A;  3REX A;  3DSQ A;  1E1O A;  4XTX A;  4P72 C;  3RIR A;  2ODR C;  1B70 A;  3TEH A;  4YP0 A;  3V7C A;  4KQE A;  4YRF A;  2EL9 A;  1NJ5 A;  2RHQ B;  2DDZ A;  4P73 C;  1YFT A;  2CJA A;  2J3L A;  1J5W A;  3PCO A;  3QNE A;  4KR3 A;  3RKX A;  1HC7 A;  3HXY A;  3L2Z A;  4YRC A;  2DZ9 A;  3HXV A;  3R07 A;  1EVK A;  1EFW A;  2CGH A;  2DTI A;  2XTI A;  2I4M A;  3IAL A;  3V7R A;  1B7Y B;  2AKW B;  4HWS A;  4TQF A;  4TVY A;  2I4O A;  1PYS A;  4HA8 A;  5F5W A;  4YRI A;  3QTC A;  3A7A A;  3RKY A;  1WU7 A;  4PG3 A;  1LYL A;  3A32 A;  2ZGW A;  3A74 A;  4P75 A;  3PZC A;  3HXU A;  2DXT A;  1H4V B;  3M4P A;  3LC0 A;  4AH6 A;  1C0A A;  3BJU A;  1L0W A;  2C8M A;  1N9W A;  2DQ0 A;  2ZZG A;  2ZT5 A;  4YCU A;  1NJ1 A;  1G5I A;  2IY5 B;  4ZTU B;  4P71 A;  3VQX A;  1NJ2 A;  4P3P A;  3TEG A;  4LNS A;  5K1P A;  3HXZ A;  3UGT A;  3VQV A;  2ZT7 A;  3UH0 A;  1SET A;  2EWN A;  1NJ8 A;  3EFS A;  1X55 A;  1Z7M A;  5ELO A;  1B8A A;  2ART A;  4DQ2 A;  1QE0 A;  1ADY A;  2DTH A;  3NEL A;  4L87 A;  4DPG A;  3REU A;  4O2D A;  4H02 A;  4YCV A;  4CS2 A;  3V8L A;  4YRS A;  1E1T A;  2E65 A;  4YRQ A;  2ALY B;  2DQ3 A;  2EAY A;  3BFM A;  4H2W A;  2ZNI A;  1BBW A;  4G84 A;  3HRK A;  4CH3 A;  1FYF A;  3A5Z A;  2J3M A;  4WJ3 M;  4XTV A;  1X2H A;  2PME A;  4XU3 A;  2P5I A;  1Z7N A;  4P71 C;  1NYR A;  2AKW A;  1BBU A;  1HXD A;  4XTW A;  3LSQ A;  1H4S A;  2ZCE A;  2EJ9 A;  1WQ7 A;  3HXX A;  1HTT A;  1RIQ A;  4HWT A;  4CS3 A;  2DXU A;  3L4G A;  2AMC B;  3UGQ A;  4HVC A;  4BWA A;  3L1A A;  4UP8 A;  5C51 B;  3RKW A;  2Q7H A;  3P8V A;  4TVA B;  2IY5 A;  4XTZ A;  1W66 A;  4H2U A;  2C7I A;  3V7S A;  1KOG A;  4K87 A;  4ZIB A;  1WQW A;  2ZTG A;  2DTO A;  1H4T A;  4H2T A;  2ZZE A;  1KMM A;  4K86 A;  3RF1 A;  4YRN A;  1X56 A;  3IG2 A;  4H2X A;  1NYQ A;  4UPA A;  11AS A;  5K1X A;  3WQZ A;  1ASZ A;  1X2G A;  3P8Y A;  3A7U A;  3NEM A;  5KNN A;  2CJ9 A;  3NEN A;  1B70 B;  2XGT A;  1G51 A;  3NET A;  3ERR A;  2ZT8 A;  4H2Y A;  4XTY A;  2DU5 A;  4CH6 A;  4YRP A;  4UP7 A;  1X54 A;  2EJF A;  1BIB A;  4OP0 A;  4WI1 A;  4UP9 A;  4RQF A;  4E51 A;  4Q6G A;  4Q15 A;  3W3S A;  4RMF A;  1EIY B;  2Q7E A;  4CH4 A;  2E1H A;  4CH5 A;  2PMF A;  3IKL A;  1IL2 A;  4TQD A;  3LSS A;  4EX5 A;  2RHQ A;  2DEQ A;  1X01 A;  2FYK A;  4NCX A;  4RDX A;  1E22 A;  4YPF A;  2AMC A;  3KFU A;  2DJZ A;  3A5Y A;  3P8T A;  4PHC A;  4YDQ A;  4K88 A;  2DVE A;  4TVW A;  3HY0 A;  2QHU A;  3A7R A;  4YCW A;  4YRJ A;  5ELN A;  4YYE A;  4TVA A;  4YRG A;  2E3C A;  3QO8 A;  4ZTZ B;  2RHS B;  4P74 C;  4P3N A;  2E64 A;  3UFG A;  2DKG A;  2E5A A;  3HRI A;  3QO7 A;  1B7Y A;  4EO4 A;  1USY C;  4XTU A;  3HFZ B;  2HNI A;  4YRT A;  3A31 A;  2I4L A;  2I4N A;  4OLF A;  1WPY A; 
#chains in the Genus database with same CATH topology
 3VQW A;  2ARS A;  4WF2 A;  2ZR2 A;  4P3O A;  4XU2 A;  3I7F A;  2CIM A;  5C53 B;  1EOV A;  1WNL A;  1WLE A;  3HY1 A;  4XU0 A;  4YRE A;  3RAC A;  1JJC B;  2QHS A;  2ZNJ A;  1WYD A;  5E3I A;  3HXW A;  2ZIN A;  2CJB A;  1YFR A;  2Q5H A;  2EJG A;  1VQZ A;  4XU1 A;  4XEO A;  1ASY A;  12AS A;  2ZXF A;  3V8J A;  2P0L A;  4G85 A;  4TWA A;  2ZZF A;  1KMN A;  2ZIM A;  4YRL A;  4RQE A;  1EIY A;  2ZT6 A;  2E10 A;  4KR2 A;  1YB3 A;  1GGM A;  1YFS A;  3M4Q A;  4J15 A;  2Q5I A;  4CS4 A;  4HWP A;  2QHV A;  4H2V A;  4WJ4 A;  2DZC A;  2ALY A;  3RGL A;  4XEM A;  3RL6 A;  3TEH B;  4P74 A;  3E9I A;  4X5O A;  3FJP A;  4TTV A;  4YRM A;  2RHS A;  1USY A;  3ICA A;  2QHT A;  3VBB A;  4YRR A;  3L4G B;  3MF1 A;  4HWO A;  3HFZ A;  2A8E A;  1BIA A;  3QO5 A;  2Q7G A;  3PCO B;  3V8K A;  1EQR A;  4P72 A;  3E9H A;  2G4C A;  3HTZ A;  3HFV A;  3EFR A;  2ODR D;  5HGQ A;  3VQY A;  3MF2 A;  2ZIO A;  2ZR3 A;  4HT4 A;  1YGB A;  1PYS B;  3OD1 A;  1EVL A;  1JJC A;  3MEY A;  1NNH A;  1ADJ A;  1SES A;  4P73 A;  1SER A;  4H2S A;  1ATI A;  1SRY A;  4YRO A;  1B76 A;  4H2X B;  2E41 A;  2ARU A;  1E24 A;  3TUP A;  5C52 B;  4BW9 A;  1G5H A;  1QF6 A;  3CMQ A;  4HWR A;  3IKM B;  1NJ6 A;  4P75 C;  2DU7 A;  3RUX A;  3G1Z A;  1H4Q A;  4YRK A;  3REX A;  3DSQ A;  1E1O A;  4XTX A;  4P72 C;  3RIR A;  2ODR C;  1B70 A;  3TEH A;  4YP0 A;  3V7C A;  4KQE A;  4YRF A;  2EL9 A;  1NJ5 A;  2RHQ B;  2DDZ A;  4P73 C;  1YFT A;  2CJA A;  2J3L A;  1J5W A;  4LVI A;  3PCO A;  3QNE A;  4KR3 A;  3RKX A;  1HC7 A;  3HXY A;  3L2Z A;  4YRC A;  2DZ9 A;  3HXV A;  3R07 A;  1EVK A;  1EFW A;  2CGH A;  2DTI A;  2XTI A;  2I4M A;  3IAL A;  3V7R A;  1B7Y B;  2AKW B;  4HWS A;  4TQF A;  4TVY A;  2I4O A;  1PYS A;  4HA8 A;  5F5W A;  4LVM A;  4YRI A;  3QTC A;  3A7A A;  3RKY A;  1WU7 A;  4PG3 A;  1LYL A;  3A32 A;  2ZGW A;  3A74 A;  4P75 A;  3PZC A;  3HXU A;  2DXT A;  1H4V B;  3M4P A;  3LC0 A;  4AH6 A;  1C0A A;  3BJU A;  1L0W A;  2C8M A;  1N9W A;  2DQ0 A;  2ZZG A;  2ZT5 A;  4YCU A;  1NJ1 A;  1G5I A;  2IY5 B;  4ZTU B;  4P71 A;  3VQX A;  1NJ2 A;  4P3P A;  3TEG A;  4LNS A;  5K1P A;  3HXZ A;  3UGT A;  3VQV A;  2ZT7 A;  3UH0 A;  1SET A;  2EWN A;  1NJ8 A;  3EFS A;  4LVJ A;  1X55 A;  1Z7M A;  5ELO A;  1B8A A;  2ART A;  4DQ2 A;  1QE0 A;  1ADY A;  2DTH A;  3NEL A;  4L87 A;  4DPG A;  3REU A;  4O2D A;  4H02 A;  4YCV A;  4CS2 A;  3V8L A;  4YRS A;  1E1T A;  2E65 A;  4YRQ A;  2ALY B;  2DQ3 A;  2EAY A;  3BFM A;  4H2W A;  2ZNI A;  1BBW A;  4G84 A;  3HRK A;  4CH3 A;  1FYF A;  3A5Z A;  2J3M A;  4WJ3 M;  4XTV A;  1X2H A;  2PME A;  4XU3 A;  2P5I A;  1Z7N A;  4P71 C;  1NYR A;  2AKW A;  1BBU A;  1HXD A;  4XTW A;  3LSQ A;  1H4S A;  2ZCE A;  2EJ9 A;  1WQ7 A;  3HXX A;  1HTT A;  1RIQ A;  4HWT A;  4CS3 A;  2DXU A;  3L4G A;  2AMC B;  3UGQ A;  4HVC A;  4BWA A;  3L1A A;  4UP8 A;  5C51 B;  3RKW A;  2Q7H A;  3P8V A;  4TVA B;  2IY5 A;  4XTZ A;  1W66 A;  4H2U A;  2C7I A;  3V7S A;  1KOG A;  4K87 A;  4ZIB A;  1WQW A;  2ZTG A;  2DTO A;  1H4T A;  4H2T A;  3MQZ A;  2ZZE A;  1KMM A;  4K86 A;  3RF1 A;  4YRN A;  1X56 A;  3IG2 A;  4H2X A;  1NYQ A;  4UPA A;  11AS A;  5K1X A;  3WQZ A;  1ASZ A;  1X2G A;  3P8Y A;  3A7U A;  3NEM A;  5KNN A;  2CJ9 A;  3NEN A;  1B70 B;  2XGT A;  4LVL A;  1G51 A;  3NET A;  3ERR A;  2ZT8 A;  4H2Y A;  4XTY A;  2DU5 A;  4CH6 A;  4YRP A;  4UP7 A;  1X54 A;  2EJF A;  1BIB A;  4OP0 A;  4WI1 A;  4UP9 A;  4RQF A;  4E51 A;  4Q6G A;  4Q15 A;  3W3S A;  4RMF A;  1EIY B;  2Q7E A;  4CH4 A;  2E1H A;  4CH5 A;  2PMF A;  3IKL A;  1IL2 A;  4TQD A;  3LSS A;  4EX5 A;  2RHQ A;  2DEQ A;  1X01 A;  2FYK A;  4NCX A;  4RDX A;  1E22 A;  4YPF A;  2AMC A;  3KFU A;  2DJZ A;  3A5Y A;  3P8T A;  4PHC A;  4YDQ A;  4K88 A;  2DVE A;  4TVW A;  3HY0 A;  2QHU A;  3A7R A;  4YCW A;  4YRJ A;  5ELN A;  4YYE A;  4TVA A;  4YRG A;  2E3C A;  3QO8 A;  4ZTZ B;  2RHS B;  4P74 C;  4P3N A;  2E64 A;  3UFG A;  2DKG A;  2E5A A;  3HRI A;  3QO7 A;  1B7Y A;  4EO4 A;  2NS6 A;  1USY C;  4XTU A;  3HFZ B;  2HNI A;  4YRT A;  4LVK A;  3A31 A;  2I4L A;  2I4N A;  4OLF A;  1WPY A; 
#chains in the Genus database with same CATH homology
 3VQW A;  2ARS A;  4WF2 A;  2ZR2 A;  4P3O A;  4XU2 A;  3I7F A;  2CIM A;  5C53 B;  1EOV A;  1WNL A;  1WLE A;  3HY1 A;  4XU0 A;  4YRE A;  3RAC A;  1JJC B;  2QHS A;  2ZNJ A;  1WYD A;  5E3I A;  3HXW A;  2ZIN A;  2CJB A;  1YFR A;  2Q5H A;  2EJG A;  1VQZ A;  4XU1 A;  4XEO A;  1ASY A;  12AS A;  2ZXF A;  3V8J A;  2P0L A;  4G85 A;  4TWA A;  2ZZF A;  1KMN A;  2ZIM A;  4YRL A;  4RQE A;  1EIY A;  2ZT6 A;  2E10 A;  4KR2 A;  1YB3 A;  1GGM A;  1YFS A;  3M4Q A;  4J15 A;  2Q5I A;  4CS4 A;  4HWP A;  2QHV A;  4H2V A;  4WJ4 A;  2DZC A;  2ALY A;  3RGL A;  4XEM A;  3RL6 A;  3TEH B;  4P74 A;  3E9I A;  4X5O A;  3FJP A;  4TTV A;  4YRM A;  2RHS A;  1USY A;  3ICA A;  2QHT A;  3VBB A;  4YRR A;  3L4G B;  3MF1 A;  4HWO A;  3HFZ A;  2A8E A;  1BIA A;  3QO5 A;  2Q7G A;  3PCO B;  3V8K A;  1EQR A;  4P72 A;  3E9H A;  2G4C A;  3HTZ A;  3HFV A;  3EFR A;  2ODR D;  5HGQ A;  3VQY A;  3MF2 A;  2ZIO A;  2ZR3 A;  4HT4 A;  1YGB A;  1PYS B;  3OD1 A;  1EVL A;  1JJC A;  3MEY A;  1NNH A;  1ADJ A;  1SES A;  4P73 A;  1SER A;  4H2S A;  1ATI A;  1SRY A;  4YRO A;  1B76 A;  4H2X B;  2E41 A;  2ARU A;  1E24 A;  3TUP A;  5C52 B;  4BW9 A;  1G5H A;  1QF6 A;  3CMQ A;  4HWR A;  3IKM B;  1NJ6 A;  4P75 C;  2DU7 A;  3RUX A;  3G1Z A;  1H4Q A;  4YRK A;  3REX A;  3DSQ A;  1E1O A;  4XTX A;  4P72 C;  3RIR A;  2ODR C;  1B70 A;  3TEH A;  4YP0 A;  3V7C A;  4KQE A;  4YRF A;  2EL9 A;  1NJ5 A;  2RHQ B;  2DDZ A;  4P73 C;  1YFT A;  2CJA A;  2J3L A;  1J5W A;  4LVI A;  3PCO A;  3QNE A;  4KR3 A;  3RKX A;  1HC7 A;  3HXY A;  3L2Z A;  4YRC A;  2DZ9 A;  3HXV A;  3R07 A;  1EVK A;  1EFW A;  2CGH A;  2DTI A;  2XTI A;  2I4M A;  3IAL A;  3V7R A;  1B7Y B;  2AKW B;  4HWS A;  4TQF A;  4TVY A;  2I4O A;  1PYS A;  4HA8 A;  5F5W A;  4LVM A;  4YRI A;  3QTC A;  3A7A A;  3RKY A;  1WU7 A;  4PG3 A;  1LYL A;  3A32 A;  2ZGW A;  3A74 A;  4P75 A;  3PZC A;  3HXU A;  2DXT A;  1H4V B;  3M4P A;  3LC0 A;  4AH6 A;  1C0A A;  3BJU A;  1L0W A;  2C8M A;  1N9W A;  2DQ0 A;  2ZZG A;  2ZT5 A;  4YCU A;  1NJ1 A;  1G5I A;  2IY5 B;  4ZTU B;  4P71 A;  3VQX A;  1NJ2 A;  4P3P A;  3TEG A;  4LNS A;  5K1P A;  3HXZ A;  3UGT A;  3VQV A;  2ZT7 A;  3UH0 A;  1SET A;  2EWN A;  1NJ8 A;  3EFS A;  4LVJ A;  1X55 A;  1Z7M A;  5ELO A;  1B8A A;  2ART A;  4DQ2 A;  1QE0 A;  1ADY A;  2DTH A;  3NEL A;  4L87 A;  4DPG A;  3REU A;  4O2D A;  4H02 A;  4YCV A;  4CS2 A;  3V8L A;  4YRS A;  1E1T A;  2E65 A;  4YRQ A;  2ALY B;  2DQ3 A;  2EAY A;  3BFM A;  4H2W A;  2ZNI A;  1BBW A;  4G84 A;  3HRK A;  4CH3 A;  1FYF A;  3A5Z A;  2J3M A;  4WJ3 M;  4XTV A;  1X2H A;  2PME A;  4XU3 A;  2P5I A;  1Z7N A;  4P71 C;  1NYR A;  2AKW A;  1BBU A;  1HXD A;  4XTW A;  3LSQ A;  1H4S A;  2ZCE A;  2EJ9 A;  1WQ7 A;  3HXX A;  1HTT A;  1RIQ A;  4HWT A;  4CS3 A;  2DXU A;  3L4G A;  2AMC B;  3UGQ A;  4HVC A;  4BWA A;  3L1A A;  4UP8 A;  5C51 B;  3RKW A;  2Q7H A;  3P8V A;  4TVA B;  2IY5 A;  4XTZ A;  1W66 A;  4H2U A;  2C7I A;  3V7S A;  1KOG A;  4K87 A;  4ZIB A;  1WQW A;  2ZTG A;  2DTO A;  1H4T A;  4H2T A;  3MQZ A;  2ZZE A;  1KMM A;  4K86 A;  3RF1 A;  4YRN A;  1X56 A;  3IG2 A;  4H2X A;  1NYQ A;  4UPA A;  11AS A;  5K1X A;  3WQZ A;  1ASZ A;  1X2G A;  3P8Y A;  3A7U A;  3NEM A;  5KNN A;  2CJ9 A;  3NEN A;  1B70 B;  2XGT A;  4LVL A;  1G51 A;  3NET A;  3ERR A;  2ZT8 A;  4H2Y A;  4XTY A;  2DU5 A;  4CH6 A;  4YRP A;  4UP7 A;  1X54 A;  2EJF A;  1BIB A;  4OP0 A;  4WI1 A;  4UP9 A;  4RQF A;  4E51 A;  4Q6G A;  4Q15 A;  3W3S A;  4RMF A;  1EIY B;  2Q7E A;  4CH4 A;  2E1H A;  4CH5 A;  2PMF A;  3IKL A;  1IL2 A;  4TQD A;  3LSS A;  4EX5 A;  2RHQ A;  2DEQ A;  1X01 A;  2FYK A;  4NCX A;  4RDX A;  1E22 A;  4YPF A;  2AMC A;  3KFU A;  2DJZ A;  3A5Y A;  3P8T A;  4PHC A;  4YDQ A;  4K88 A;  2DVE A;  4TVW A;  3HY0 A;  2QHU A;  3A7R A;  4YCW A;  4YRJ A;  5ELN A;  4YYE A;  4TVA A;  4YRG A;  2E3C A;  3QO8 A;  4ZTZ B;  2RHS B;  4P74 C;  4P3N A;  2E64 A;  3UFG A;  2DKG A;  2E5A A;  3HRI A;  3QO7 A;  1B7Y A;  4EO4 A;  2NS6 A;  1USY C;  4XTU A;  3HFZ B;  2HNI A;  4YRT A;  4LVK A;  3A31 A;  2I4L A;  2I4N A;  4OLF A;  1WPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...