2QHTA

Structural basis of octanoic acid recognition by lipoate-protein ligase b
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase
publication title Structural basis of octanoic acid recognition by lipoate-protein ligase B
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 66
structure length 210
sequence length 210
ec nomenclature ec 2.3.1.181: Lipoyl(octanoyl) transferase.
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2qhtA01
1KMMA 3OD1A 4HWSA 1BBWA 3A5ZA 1H4SA 4WI1A 1NYRA 2AKWA 1SESA 2DXTA 2Q5HA 4TTVA 1BBUA 1HXDA 3UH0A 4XTYA 4Q6GA 1JJCB 4XTUA 2RHSA 4P74A 2EAYA 4XTWA 4CH3A 3V7RA 3RKWA 2ZINA 1G5HA 2ZZFA 4AH6A 3HXZA 1EIYA 4UP8A 5HGQA 2C8MA 4TVWA 2IY5B 2ZIMA 3TEGA 2E1HA 3MF1A 4TQFA 3HXWA 2ALYB 4H02A 2AMCA 2DXUA 4K86A 4HWTA 2CGHA 1KMNA 4ZIBA 2EWNA 11ASA 3EFRA 3G1ZA 4ZTUB 3R07A 3L1AA 1BIBA 3FJPA 4YPFA 1YFTA 4HVCA 4P3OA 1FYFA 1W66A 3PZCA 3UFGA 2FYKA 1B8AA 3IKLA 4YRRA 5F5WA 1YFSA 3V7SA 1NJ1A 2ZGWA 4YRSA 1ADYA 4P75C 2I4OA 1N9WA 3NETA 4YRTA 4OLFA 2G4CA 2DTHA 1EVKA 4YCWA 1G51A 2I4LA 3V8LA 4CH5A 3ERRA 2CJBA 4YYEA 5C53B 4WJ4A 1SRYA 4CH6A 3V8KA 4Q15A 1X2HA 2Q7HA 1YGBA 4YRJA 4J15A 4TVAA 3BFMA 4YCVA 2QHUA 3HY0A 3VQXA 2DQ0A 1L0WA 3BJUA 12ASA 4EO4A 3A7AA 4P73C 3LSQA 4HWOA 3W3SA 4YREA 1E1TA 4YP0A 1NJ8A 3A7UA 2XTIA 3E9HA 3QNEA 4P72C 5ELNA 2ZR3A 2RHQB 4XEMA 1EIYB 2E5AA 3HXXA 2QHVA 3PCOA 4P75A 1RIQA 2P5IA 2CIMA 1EOVA 4RQFA 4TVYA 4BWAA 3HXUA 1YB3A 4KQEA 3HXYA 2XGTA 3M4PA 2DQ3A 1QF6A 1USYC 1WQ7A 4CH4A 4CS3A 4UP7A 3NENA 4OP0A 3HFZA 2EL9A 1X01A 3L2ZA 2DTIA 3NELA 2ZR2A 3L4GB 2Q7GA 3V8JA 2ZT6A 4XEOA 3V7CA 4YRGA 1B7YB 3A5YA 4BW9A 2PMFA 1X56A 4YRMA 3REUA 2ZZGA 1B70B 4P73A 4ZTZB 1NJ6A 1G5IA 2QHTA 1H4VB 1YFRA 4RDXA 3VQVA 2J3LA 4P3PA 2ZNIA 2EJGA 1JJCA 2PMEA 2I4NA 4G85A 1H4QA 4CS2A 4YRNA 3P8TA 4P72A 1X2GA 1SETA 4WJ3M 3QTCA 3RUXA 2C7IA 1E24A 4EX5A 1ADJA 1E22A 4P3NA 1HTTA 2IY5A 4H2TA 1USYA 2DVEA 3RKXA 2ALYA 4XTZA 2E3CA 2E10A 1EFWA 3EFSA 4NCXA 1J5WA 4H2XA 5KNNA 3LSSA 3TEHA 3A7RA 4RMFA 1PYSA 2E64A 4P71C 4E51A 2ODRD 4PHCA 3MF2A 3RGLA 3RKYA 4RQEA 4TQDA 1NYQA 1X54A 4K88A 4LNSA 2CJAA 1EVLA 2ZXFA 4HWPA 2AKWB 4KR2A 4YRIA 3PCOB 3NEMA 2EJ9A 4XU0A 5K1PA 3VQYA 1Z7MA 4CS4A 4XU3A 3HXVA 3ICAA 2RHSB 2Q5IA 3HTZA 3RF1A 2ZTGA 3HFVA 3M4QA 5ELOA 2ARTA 2ZNJA 3A74A 4YRPA 3HFZB 1NJ2A 4XU1A 1WQWA 1KOGA 1WYDA 2AMCB 2ARSA 4XTXA 4DQ2A 1WPYA 4YCUA 4P71A 4YRFA 2DU7A 2EJFA 2DKGA 3P8YA 1Z7NA 1C0AA 2ZCEA 4H2WA 2P0LA 2Q7EA 3HRIA 1ATIA 3IALA 4PG3A 2DZ9A 3QO7A 2ZZEA 1SERA 2RHQA 1WNLA 1B76A 4WF2A 4L87A 5C52B 3DSQA 2ARUA 2I4MA 3QO5A 3P8VA 4UPAA 4DPGA 3UGTA 1EQRA 4H2YA 2DJZA 4H2XB 1NJ5A 3TEHB 1PYSB 2QHSA 3RL6A 2ZT5A 3RIRA 4O2DA 3HY1A 4H2SA 4XTVA 3UGQA 3L4GA 3VQWA 2ZIOA 4HWRA 4YRLA 4TVAB 3WQZA 1WU7A 1B7YA 1QE0A 2CJ9A 1IL2A 5E3IA 2DU5A 1NNHA 4UP9A 2E41A 3HRKA 4H2UA 4TWAA 1B70A 4X5OA 4YRQA 3KFUA 3REXA 4YROA 2ODRC 3RACA 4YRCA 3MEYA 4P74C 4YDQA 4K87A 1GGMA 5K1XA 3IG2A 3TUPA 4XU2A 1H4TA 3I7FA 1HC7A 4G84A 1ASZA 1VQZA 1X55A 3IKMB 1WLEA 1ASYA 2E65A 2J3MA 2DZCA 5C51B 2DTOA 3VBBA 2ZT7A 3A31A 4KR3A 3E9IA 2HNIA 2DDZA 4H2VA 3CMQA 3QO8A 1LYLA 3A32A 2ZT8A 3LC0A 4HA8A 2DEQA 1E1OA 1BIAA 4YRKA
chains in the Genus database with same CATH superfamily
1KMMA 3OD1A 4HT4A 4HWSA 1BBWA 3A5ZA 1H4SA 4WI1A 1NYRA 2AKWA 1SESA 2DXTA 2Q5HA 4TTVA 1BBUA 1HXDA 3UH0A 4XTYA 4Q6GA 1JJCB 4XTUA 2RHSA 4P74A 2EAYA 4XTWA 4CH3A 3V7RA 3RKWA 2ZINA 1G5HA 2ZZFA 4AH6A 3HXZA 1EIYA 4UP8A 5HGQA 2C8MA 4TVWA 2IY5B 2ZIMA 3TEGA 2E1HA 3MF1A 4TQFA 3HXWA 2ALYB 4H02A 2AMCA 2DXUA 4K86A 4HWTA 2CGHA 1KMNA 4ZIBA 2EWNA 11ASA 3EFRA 3G1ZA 4ZTUB 3R07A 3L1AA 1BIBA 3FJPA 4YPFA 1YFTA 4HVCA 4P3OA 1FYFA 1W66A 3PZCA 3UFGA 2FYKA 1B8AA 3IKLA 4YRRA 5F5WA 1YFSA 3V7SA 1NJ1A 2ZGWA 4YRSA 3MQZA 1ADYA 4P75C 2I4OA 1N9WA 3NETA 4YRTA 4OLFA 2G4CA 2DTHA 1EVKA 4YCWA 1G51A 2I4LA 3V8LA 4CH5A 3ERRA 2CJBA 4YYEA 5C53B 4WJ4A 1SRYA 4CH6A 4LVKA 3V8KA 4Q15A 1X2HA 2Q7HA 1YGBA 4YRJA 4J15A 4TVAA 3BFMA 4YCVA 2QHUA 3HY0A 3VQXA 2DQ0A 1L0WA 3BJUA 12ASA 4EO4A 3A7AA 4P73C 3LSQA 4HWOA 3W3SA 4YREA 1E1TA 4YP0A 1NJ8A 3A7UA 2XTIA 3E9HA 3QNEA 4P72C 5ELNA 2ZR3A 2RHQB 4XEMA 1EIYB 2E5AA 3HXXA 2QHVA 3PCOA 4P75A 1RIQA 2P5IA 2CIMA 1EOVA 4RQFA 4TVYA 4LVJA 4BWAA 3HXUA 1YB3A 4KQEA 3HXYA 2XGTA 3M4PA 2DQ3A 1QF6A 1USYC 1WQ7A 4CH4A 4CS3A 4UP7A 3NENA 4OP0A 3HFZA 2EL9A 1X01A 3L2ZA 2DTIA 3NELA 2ZR2A 3L4GB 2Q7GA 3V8JA 2ZT6A 4XEOA 3V7CA 4YRGA 1B7YB 3A5YA 4BW9A 2PMFA 1X56A 4YRMA 3REUA 2ZZGA 1B70B 4P73A 4ZTZB 1NJ6A 1G5IA 2QHTA 1H4VB 1YFRA 4RDXA 3VQVA 2J3LA 4P3PA 2ZNIA 2EJGA 1JJCA 2PMEA 2I4NA 4G85A 1H4QA 4CS2A 4YRNA 3P8TA 4P72A 1X2GA 1SETA 4WJ3M 3QTCA 3RUXA 2C7IA 1E24A 4EX5A 1ADJA 1E22A 4P3NA 1HTTA 2IY5A 4H2TA 1USYA 2DVEA 3RKXA 2ALYA 4XTZA 2E3CA 2E10A 1EFWA 3EFSA 4NCXA 1J5WA 4H2XA 5KNNA 3LSSA 3TEHA 3A7RA 4RMFA 1PYSA 2E64A 4P71C 4E51A 2ODRD 4PHCA 3MF2A 3RGLA 3RKYA 4RQEA 4TQDA 1NYQA 1X54A 4K88A 4LNSA 2CJAA 1EVLA 2ZXFA 4HWPA 2AKWB 4KR2A 4YRIA 3PCOB 3NEMA 4LVLA 2EJ9A 4XU0A 5K1PA 3VQYA 1Z7MA 4CS4A 4XU3A 3HXVA 3ICAA 2RHSB 2Q5IA 3HTZA 3RF1A 2ZTGA 3HFVA 3M4QA 5ELOA 2ARTA 2ZNJA 3A74A 4YRPA 3HFZB 1NJ2A 4XU1A 1WQWA 1KOGA 1WYDA 2AMCB 2ARSA 4XTXA 4DQ2A 1WPYA 4YCUA 4P71A 4YRFA 2DU7A 2EJFA 2DKGA 3P8YA 1Z7NA 1C0AA 2ZCEA 4H2WA 2P0LA 2Q7EA 3HRIA 1ATIA 3IALA 4PG3A 2DZ9A 3QO7A 2ZZEA 1SERA 2RHQA 1WNLA 1B76A 4WF2A 2A8EA 4L87A 5C52B 3DSQA 2ARUA 2I4MA 3QO5A 3P8VA 4UPAA 4DPGA 3UGTA 1EQRA 4H2YA 4LVMA 2DJZA 4H2XB 1NJ5A 3TEHB 1PYSB 2QHSA 3RL6A 2ZT5A 3RIRA 4O2DA 3HY1A 4H2SA 4XTVA 3UGQA 3L4GA 3VQWA 2ZIOA 4HWRA 4YRLA 4LVIA 4TVAB 3WQZA 1WU7A 1B7YA 1QE0A 2CJ9A 1IL2A 5E3IA 2DU5A 1NNHA 4UP9A 2E41A 3HRKA 4H2UA 4TWAA 1B70A 4X5OA 4YRQA 3KFUA 3REXA 4YROA 2ODRC 3RACA 4YRCA 3MEYA 4P74C 4YDQA 4K87A 1GGMA 5K1XA 3IG2A 3TUPA 4XU2A 1H4TA 3I7FA 1HC7A 4G84A 1ASZA 1VQZA 1X55A 3IKMB 1WLEA 1ASYA 2E65A 2J3MA 2DZCA 5C51B 2DTOA 3VBBA 2ZT7A 3A31A 4KR3A 3E9IA 2HNIA 2DDZA 4H2VA 2NS6A 3CMQA 3QO8A 1LYLA 3A32A 2ZT8A 3LC0A 4HA8A 2DEQA 1E1OA 1BIAA 4YRKA
chains in the Genus database with same CATH topology
1KMMA 3OD1A 4HT4A 4HWSA 1BBWA 3A5ZA 1H4SA 4WI1A 1NYRA 2AKWA 1SESA 2DXTA 2Q5HA 4TTVA 1BBUA 1HXDA 3UH0A 4XTYA 4Q6GA 1JJCB 4XTUA 2RHSA 4P74A 2EAYA 4XTWA 4CH3A 3V7RA 3RKWA 2ZINA 1G5HA 2ZZFA 4AH6A 3HXZA 1EIYA 4UP8A 5HGQA 2C8MA 4TVWA 2IY5B 2ZIMA 3TEGA 2E1HA 3MF1A 4TQFA 3HXWA 2ALYB 4H02A 2AMCA 2DXUA 4K86A 4HWTA 2CGHA 1KMNA 4ZIBA 2EWNA 11ASA 3EFRA 3G1ZA 4ZTUB 3R07A 3L1AA 1BIBA 3FJPA 4YPFA 1YFTA 4HVCA 4P3OA 1FYFA 1W66A 3PZCA 3UFGA 2FYKA 1B8AA 3IKLA 4YRRA 5F5WA 1YFSA 3V7SA 1NJ1A 2ZGWA 4YRSA 3MQZA 1ADYA 4P75C 2I4OA 1N9WA 3NETA 4YRTA 4OLFA 2G4CA 2DTHA 1EVKA 4YCWA 1G51A 2I4LA 3V8LA 4CH5A 3ERRA 2CJBA 4YYEA 5C53B 4WJ4A 1SRYA 4CH6A 4LVKA 3V8KA 4Q15A 1X2HA 2Q7HA 1YGBA 4YRJA 4J15A 4TVAA 3BFMA 4YCVA 2QHUA 3HY0A 3VQXA 2DQ0A 1L0WA 3BJUA 12ASA 4EO4A 3A7AA 4P73C 3LSQA 4HWOA 3W3SA 4YREA 1E1TA 4YP0A 1NJ8A 3A7UA 2XTIA 3E9HA 3QNEA 4P72C 5ELNA 2ZR3A 2RHQB 4XEMA 1EIYB 2E5AA 3HXXA 2QHVA 3PCOA 4P75A 1RIQA 2P5IA 2CIMA 1EOVA 4RQFA 4TVYA 4LVJA 4BWAA 3HXUA 1YB3A 4KQEA 3HXYA 2XGTA 3M4PA 2DQ3A 1QF6A 1USYC 1WQ7A 4CH4A 4CS3A 4UP7A 3NENA 4OP0A 3HFZA 2EL9A 1X01A 3L2ZA 2DTIA 3NELA 2ZR2A 3L4GB 2Q7GA 3V8JA 2ZT6A 4XEOA 3V7CA 4YRGA 1B7YB 3A5YA 4BW9A 2PMFA 1X56A 4YRMA 3REUA 2ZZGA 1B70B 4P73A 4ZTZB 1NJ6A 1G5IA 2QHTA 1H4VB 1YFRA 4RDXA 3VQVA 2J3LA 4P3PA 2ZNIA 2EJGA 1JJCA 2PMEA 2I4NA 4G85A 1H4QA 4CS2A 4YRNA 3P8TA 4P72A 1X2GA 1SETA 4WJ3M 3QTCA 3RUXA 2C7IA 1E24A 4EX5A 1ADJA 1E22A 4P3NA 1HTTA 2IY5A 4H2TA 1USYA 2DVEA 3RKXA 2ALYA 4XTZA 2E3CA 2E10A 1EFWA 3EFSA 4NCXA 1J5WA 4H2XA 5KNNA 3LSSA 3TEHA 3A7RA 4RMFA 1PYSA 2E64A 4P71C 4E51A 2ODRD 4PHCA 3MF2A 3RGLA 3RKYA 4RQEA 4TQDA 1NYQA 1X54A 4K88A 4LNSA 2CJAA 1EVLA 2ZXFA 4HWPA 2AKWB 4KR2A 4YRIA 3PCOB 3NEMA 4LVLA 2EJ9A 4XU0A 5K1PA 3VQYA 1Z7MA 4CS4A 4XU3A 3HXVA 3ICAA 2RHSB 2Q5IA 3HTZA 3RF1A 2ZTGA 3HFVA 3M4QA 5ELOA 2ARTA 2ZNJA 3A74A 4YRPA 3HFZB 1NJ2A 4XU1A 1WQWA 1KOGA 1WYDA 2AMCB 2ARSA 4XTXA 4DQ2A 1WPYA 4YCUA 4P71A 4YRFA 2DU7A 2EJFA 2DKGA 3P8YA 1Z7NA 1C0AA 2ZCEA 4H2WA 2P0LA 2Q7EA 3HRIA 1ATIA 3IALA 4PG3A 2DZ9A 3QO7A 2ZZEA 1SERA 2RHQA 1WNLA 1B76A 4WF2A 2A8EA 4L87A 5C52B 3DSQA 2ARUA 2I4MA 3QO5A 3P8VA 4UPAA 4DPGA 3UGTA 1EQRA 4H2YA 4LVMA 2DJZA 4H2XB 1NJ5A 3TEHB 1PYSB 2QHSA 3RL6A 2ZT5A 3RIRA 4O2DA 3HY1A 4H2SA 4XTVA 3UGQA 3L4GA 3VQWA 2ZIOA 4HWRA 4YRLA 4LVIA 4TVAB 3WQZA 1WU7A 1B7YA 1QE0A 2CJ9A 1IL2A 5E3IA 2DU5A 1NNHA 4UP9A 2E41A 3HRKA 4H2UA 4TWAA 1B70A 4X5OA 4YRQA 3KFUA 3REXA 4YROA 2ODRC 3RACA 4YRCA 3MEYA 4P74C 4YDQA 4K87A 1GGMA 5K1XA 3IG2A 3TUPA 4XU2A 1H4TA 3I7FA 1HC7A 4G84A 1ASZA 1VQZA 1X55A 3IKMB 1WLEA 1ASYA 2E65A 2J3MA 2DZCA 5C51B 2DTOA 3VBBA 2ZT7A 3A31A 4KR3A 3E9IA 2HNIA 2DDZA 4H2VA 2NS6A 3CMQA 3QO8A 1LYLA 3A32A 2ZT8A 3LC0A 4HA8A 2DEQA 1E1OA 1BIAA 4YRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KMM A;  3OD1 A;  4HWS A;  1BBW A;  3A5Z A;  1H4S A;  4WI1 A;  1NYR A;  2AKW A;  1SES A;  2DXT A;  2Q5H A;  4TTV A;  1BBU A;  1HXD A;  3UH0 A;  4XTY A;  4Q6G A;  1JJC B;  4XTU A;  2RHS A;  4P74 A;  2EAY A;  4XTW A;  4CH3 A;  3V7R A;  3RKW A;  2ZIN A;  1G5H A;  2ZZF A;  4AH6 A;  3HXZ A;  1EIY A;  4UP8 A;  5HGQ A;  2C8M A;  4TVW A;  2IY5 B;  2ZIM A;  3TEG A;  2E1H A;  3MF1 A;  4TQF A;  3HXW A;  2ALY B;  4H02 A;  2AMC A;  2DXU A;  4K86 A;  4HWT A;  2CGH A;  1KMN A;  4ZIB A;  2EWN A;  11AS A;  3EFR A;  3G1Z A;  4ZTU B;  3R07 A;  3L1A A;  1BIB A;  3FJP A;  4YPF A;  1YFT A;  4HVC A;  4P3O A;  1FYF A;  1W66 A;  3PZC A;  3UFG A;  2FYK A;  1B8A A;  3IKL A;  4YRR A;  5F5W A;  1YFS A;  3V7S A;  1NJ1 A;  2ZGW A;  4YRS A;  1ADY A;  4P75 C;  2I4O A;  1N9W A;  3NET A;  4YRT A;  4OLF A;  2G4C A;  2DTH A;  1EVK A;  4YCW A;  1G51 A;  2I4L A;  3V8L A;  4CH5 A;  3ERR A;  2CJB A;  4YYE A;  5C53 B;  4WJ4 A;  1SRY A;  4CH6 A;  3V8K A;  4Q15 A;  1X2H A;  2Q7H A;  1YGB A;  4YRJ A;  4J15 A;  4TVA A;  3BFM A;  4YCV A;  2QHU A;  3HY0 A;  3VQX A;  2DQ0 A;  1L0W A;  3BJU A;  12AS A;  4EO4 A;  3A7A A;  4P73 C;  3LSQ A;  4HWO A;  3W3S A;  4YRE A;  1E1T A;  4YP0 A;  1NJ8 A;  3A7U A;  2XTI A;  3E9H A;  3QNE A;  4P72 C;  5ELN A;  2ZR3 A;  2RHQ B;  4XEM A;  1EIY B;  2E5A A;  3HXX A;  2QHV A;  3PCO A;  4P75 A;  1RIQ A;  2P5I A;  2CIM A;  1EOV A;  4RQF A;  4TVY A;  4BWA A;  3HXU A;  1YB3 A;  4KQE A;  3HXY A;  2XGT A;  3M4P A;  2DQ3 A;  1QF6 A;  1USY C;  1WQ7 A;  4CH4 A;  4CS3 A;  4UP7 A;  3NEN A;  4OP0 A;  3HFZ A;  2EL9 A;  1X01 A;  3L2Z A;  2DTI A;  3NEL A;  2ZR2 A;  3L4G B;  2Q7G A;  3V8J A;  2ZT6 A;  4XEO A;  3V7C A;  4YRG A;  1B7Y B;  3A5Y A;  4BW9 A;  2PMF A;  1X56 A;  4YRM A;  3REU A;  2ZZG A;  1B70 B;  4P73 A;  4ZTZ B;  1NJ6 A;  1G5I A;  2QHT A;  1H4V B;  1YFR A;  4RDX A;  3VQV A;  2J3L A;  4P3P A;  2ZNI A;  2EJG A;  1JJC A;  2PME A;  2I4N A;  4G85 A;  1H4Q A;  4CS2 A;  4YRN A;  3P8T A;  4P72 A;  1X2G A;  1SET A;  4WJ3 M;  3QTC A;  3RUX A;  2C7I A;  1E24 A;  4EX5 A;  1ADJ A;  1E22 A;  4P3N A;  1HTT A;  2IY5 A;  4H2T A;  1USY A;  2DVE A;  3RKX A;  2ALY A;  4XTZ A;  2E3C A;  2E10 A;  1EFW A;  3EFS A;  4NCX A;  1J5W A;  4H2X A;  5KNN A;  3LSS A;  3TEH A;  3A7R A;  4RMF A;  1PYS A;  2E64 A;  4P71 C;  4E51 A;  2ODR D;  4PHC A;  3MF2 A;  3RGL A;  3RKY A;  4RQE A;  4TQD A;  1NYQ A;  1X54 A;  4K88 A;  4LNS A;  2CJA A;  1EVL A;  2ZXF A;  4HWP A;  2AKW B;  4KR2 A;  4YRI A;  3PCO B;  3NEM A;  2EJ9 A;  4XU0 A;  5K1P A;  3VQY A;  1Z7M A;  4CS4 A;  4XU3 A;  3HXV A;  3ICA A;  2RHS B;  2Q5I A;  3HTZ A;  3RF1 A;  2ZTG A;  3HFV A;  3M4Q A;  5ELO A;  2ART A;  2ZNJ A;  3A74 A;  4YRP A;  3HFZ B;  1NJ2 A;  4XU1 A;  1WQW A;  1KOG A;  1WYD A;  2AMC B;  2ARS A;  4XTX A;  4DQ2 A;  1WPY A;  4YCU A;  4P71 A;  4YRF A;  2DU7 A;  2EJF A;  2DKG A;  3P8Y A;  1Z7N A;  1C0A A;  2ZCE A;  4H2W A;  2P0L A;  2Q7E A;  3HRI A;  1ATI A;  3IAL A;  4PG3 A;  2DZ9 A;  3QO7 A;  2ZZE A;  1SER A;  2RHQ A;  1WNL A;  1B76 A;  4WF2 A;  4L87 A;  5C52 B;  3DSQ A;  2ARU A;  2I4M A;  3QO5 A;  3P8V A;  4UPA A;  4DPG A;  3UGT A;  1EQR A;  4H2Y A;  2DJZ A;  4H2X B;  1NJ5 A;  3TEH B;  1PYS B;  2QHS A;  3RL6 A;  2ZT5 A;  3RIR A;  4O2D A;  3HY1 A;  4H2S A;  4XTV A;  3UGQ A;  3L4G A;  3VQW A;  2ZIO A;  4HWR A;  4YRL A;  4TVA B;  3WQZ A;  1WU7 A;  1B7Y A;  1QE0 A;  2CJ9 A;  1IL2 A;  5E3I A;  2DU5 A;  1NNH A;  4UP9 A;  2E41 A;  3HRK A;  4H2U A;  4TWA A;  1B70 A;  4X5O A;  4YRQ A;  3KFU A;  3REX A;  4YRO A;  2ODR C;  3RAC A;  4YRC A;  3MEY A;  4P74 C;  4YDQ A;  4K87 A;  1GGM A;  5K1X A;  3IG2 A;  3TUP A;  4XU2 A;  1H4T A;  3I7F A;  1HC7 A;  4G84 A;  1ASZ A;  1VQZ A;  1X55 A;  3IKM B;  1WLE A;  1ASY A;  2E65 A;  2J3M A;  2DZC A;  5C51 B;  2DTO A;  3VBB A;  2ZT7 A;  3A31 A;  4KR3 A;  3E9I A;  2HNI A;  2DDZ A;  4H2V A;  3CMQ A;  3QO8 A;  1LYL A;  3A32 A;  2ZT8 A;  3LC0 A;  4HA8 A;  2DEQ A;  1E1O A;  1BIA A;  4YRK A; 
#chains in the Genus database with same CATH topology
 1KMM A;  3OD1 A;  4HT4 A;  4HWS A;  1BBW A;  3A5Z A;  1H4S A;  4WI1 A;  1NYR A;  2AKW A;  1SES A;  2DXT A;  2Q5H A;  4TTV A;  1BBU A;  1HXD A;  3UH0 A;  4XTY A;  4Q6G A;  1JJC B;  4XTU A;  2RHS A;  4P74 A;  2EAY A;  4XTW A;  4CH3 A;  3V7R A;  3RKW A;  2ZIN A;  1G5H A;  2ZZF A;  4AH6 A;  3HXZ A;  1EIY A;  4UP8 A;  5HGQ A;  2C8M A;  4TVW A;  2IY5 B;  2ZIM A;  3TEG A;  2E1H A;  3MF1 A;  4TQF A;  3HXW A;  2ALY B;  4H02 A;  2AMC A;  2DXU A;  4K86 A;  4HWT A;  2CGH A;  1KMN A;  4ZIB A;  2EWN A;  11AS A;  3EFR A;  3G1Z A;  4ZTU B;  3R07 A;  3L1A A;  1BIB A;  3FJP A;  4YPF A;  1YFT A;  4HVC A;  4P3O A;  1FYF A;  1W66 A;  3PZC A;  3UFG A;  2FYK A;  1B8A A;  3IKL A;  4YRR A;  5F5W A;  1YFS A;  3V7S A;  1NJ1 A;  2ZGW A;  4YRS A;  3MQZ A;  1ADY A;  4P75 C;  2I4O A;  1N9W A;  3NET A;  4YRT A;  4OLF A;  2G4C A;  2DTH A;  1EVK A;  4YCW A;  1G51 A;  2I4L A;  3V8L A;  4CH5 A;  3ERR A;  2CJB A;  4YYE A;  5C53 B;  4WJ4 A;  1SRY A;  4CH6 A;  4LVK A;  3V8K A;  4Q15 A;  1X2H A;  2Q7H A;  1YGB A;  4YRJ A;  4J15 A;  4TVA A;  3BFM A;  4YCV A;  2QHU A;  3HY0 A;  3VQX A;  2DQ0 A;  1L0W A;  3BJU A;  12AS A;  4EO4 A;  3A7A A;  4P73 C;  3LSQ A;  4HWO A;  3W3S A;  4YRE A;  1E1T A;  4YP0 A;  1NJ8 A;  3A7U A;  2XTI A;  3E9H A;  3QNE A;  4P72 C;  5ELN A;  2ZR3 A;  2RHQ B;  4XEM A;  1EIY B;  2E5A A;  3HXX A;  2QHV A;  3PCO A;  4P75 A;  1RIQ A;  2P5I A;  2CIM A;  1EOV A;  4RQF A;  4TVY A;  4LVJ A;  4BWA A;  3HXU A;  1YB3 A;  4KQE A;  3HXY A;  2XGT A;  3M4P A;  2DQ3 A;  1QF6 A;  1USY C;  1WQ7 A;  4CH4 A;  4CS3 A;  4UP7 A;  3NEN A;  4OP0 A;  3HFZ A;  2EL9 A;  1X01 A;  3L2Z A;  2DTI A;  3NEL A;  2ZR2 A;  3L4G B;  2Q7G A;  3V8J A;  2ZT6 A;  4XEO A;  3V7C A;  4YRG A;  1B7Y B;  3A5Y A;  4BW9 A;  2PMF A;  1X56 A;  4YRM A;  3REU A;  2ZZG A;  1B70 B;  4P73 A;  4ZTZ B;  1NJ6 A;  1G5I A;  2QHT A;  1H4V B;  1YFR A;  4RDX A;  3VQV A;  2J3L A;  4P3P A;  2ZNI A;  2EJG A;  1JJC A;  2PME A;  2I4N A;  4G85 A;  1H4Q A;  4CS2 A;  4YRN A;  3P8T A;  4P72 A;  1X2G A;  1SET A;  4WJ3 M;  3QTC A;  3RUX A;  2C7I A;  1E24 A;  4EX5 A;  1ADJ A;  1E22 A;  4P3N A;  1HTT A;  2IY5 A;  4H2T A;  1USY A;  2DVE A;  3RKX A;  2ALY A;  4XTZ A;  2E3C A;  2E10 A;  1EFW A;  3EFS A;  4NCX A;  1J5W A;  4H2X A;  5KNN A;  3LSS A;  3TEH A;  3A7R A;  4RMF A;  1PYS A;  2E64 A;  4P71 C;  4E51 A;  2ODR D;  4PHC A;  3MF2 A;  3RGL A;  3RKY A;  4RQE A;  4TQD A;  1NYQ A;  1X54 A;  4K88 A;  4LNS A;  2CJA A;  1EVL A;  2ZXF A;  4HWP A;  2AKW B;  4KR2 A;  4YRI A;  3PCO B;  3NEM A;  4LVL A;  2EJ9 A;  4XU0 A;  5K1P A;  3VQY A;  1Z7M A;  4CS4 A;  4XU3 A;  3HXV A;  3ICA A;  2RHS B;  2Q5I A;  3HTZ A;  3RF1 A;  2ZTG A;  3HFV A;  3M4Q A;  5ELO A;  2ART A;  2ZNJ A;  3A74 A;  4YRP A;  3HFZ B;  1NJ2 A;  4XU1 A;  1WQW A;  1KOG A;  1WYD A;  2AMC B;  2ARS A;  4XTX A;  4DQ2 A;  1WPY A;  4YCU A;  4P71 A;  4YRF A;  2DU7 A;  2EJF A;  2DKG A;  3P8Y A;  1Z7N A;  1C0A A;  2ZCE A;  4H2W A;  2P0L A;  2Q7E A;  3HRI A;  1ATI A;  3IAL A;  4PG3 A;  2DZ9 A;  3QO7 A;  2ZZE A;  1SER A;  2RHQ A;  1WNL A;  1B76 A;  4WF2 A;  2A8E A;  4L87 A;  5C52 B;  3DSQ A;  2ARU A;  2I4M A;  3QO5 A;  3P8V A;  4UPA A;  4DPG A;  3UGT A;  1EQR A;  4H2Y A;  4LVM A;  2DJZ A;  4H2X B;  1NJ5 A;  3TEH B;  1PYS B;  2QHS A;  3RL6 A;  2ZT5 A;  3RIR A;  4O2D A;  3HY1 A;  4H2S A;  4XTV A;  3UGQ A;  3L4G A;  3VQW A;  2ZIO A;  4HWR A;  4YRL A;  4LVI A;  4TVA B;  3WQZ A;  1WU7 A;  1B7Y A;  1QE0 A;  2CJ9 A;  1IL2 A;  5E3I A;  2DU5 A;  1NNH A;  4UP9 A;  2E41 A;  3HRK A;  4H2U A;  4TWA A;  1B70 A;  4X5O A;  4YRQ A;  3KFU A;  3REX A;  4YRO A;  2ODR C;  3RAC A;  4YRC A;  3MEY A;  4P74 C;  4YDQ A;  4K87 A;  1GGM A;  5K1X A;  3IG2 A;  3TUP A;  4XU2 A;  1H4T A;  3I7F A;  1HC7 A;  4G84 A;  1ASZ A;  1VQZ A;  1X55 A;  3IKM B;  1WLE A;  1ASY A;  2E65 A;  2J3M A;  2DZC A;  5C51 B;  2DTO A;  3VBB A;  2ZT7 A;  3A31 A;  4KR3 A;  3E9I A;  2HNI A;  2DDZ A;  4H2V A;  2NS6 A;  3CMQ A;  3QO8 A;  1LYL A;  3A32 A;  2ZT8 A;  3LC0 A;  4HA8 A;  2DEQ A;  1E1O A;  1BIA A;  4YRK A; 
#chains in the Genus database with same CATH homology
 1KMM A;  3OD1 A;  4HT4 A;  4HWS A;  1BBW A;  3A5Z A;  1H4S A;  4WI1 A;  1NYR A;  2AKW A;  1SES A;  2DXT A;  2Q5H A;  4TTV A;  1BBU A;  1HXD A;  3UH0 A;  4XTY A;  4Q6G A;  1JJC B;  4XTU A;  2RHS A;  4P74 A;  2EAY A;  4XTW A;  4CH3 A;  3V7R A;  3RKW A;  2ZIN A;  1G5H A;  2ZZF A;  4AH6 A;  3HXZ A;  1EIY A;  4UP8 A;  5HGQ A;  2C8M A;  4TVW A;  2IY5 B;  2ZIM A;  3TEG A;  2E1H A;  3MF1 A;  4TQF A;  3HXW A;  2ALY B;  4H02 A;  2AMC A;  2DXU A;  4K86 A;  4HWT A;  2CGH A;  1KMN A;  4ZIB A;  2EWN A;  11AS A;  3EFR A;  3G1Z A;  4ZTU B;  3R07 A;  3L1A A;  1BIB A;  3FJP A;  4YPF A;  1YFT A;  4HVC A;  4P3O A;  1FYF A;  1W66 A;  3PZC A;  3UFG A;  2FYK A;  1B8A A;  3IKL A;  4YRR A;  5F5W A;  1YFS A;  3V7S A;  1NJ1 A;  2ZGW A;  4YRS A;  3MQZ A;  1ADY A;  4P75 C;  2I4O A;  1N9W A;  3NET A;  4YRT A;  4OLF A;  2G4C A;  2DTH A;  1EVK A;  4YCW A;  1G51 A;  2I4L A;  3V8L A;  4CH5 A;  3ERR A;  2CJB A;  4YYE A;  5C53 B;  4WJ4 A;  1SRY A;  4CH6 A;  4LVK A;  3V8K A;  4Q15 A;  1X2H A;  2Q7H A;  1YGB A;  4YRJ A;  4J15 A;  4TVA A;  3BFM A;  4YCV A;  2QHU A;  3HY0 A;  3VQX A;  2DQ0 A;  1L0W A;  3BJU A;  12AS A;  4EO4 A;  3A7A A;  4P73 C;  3LSQ A;  4HWO A;  3W3S A;  4YRE A;  1E1T A;  4YP0 A;  1NJ8 A;  3A7U A;  2XTI A;  3E9H A;  3QNE A;  4P72 C;  5ELN A;  2ZR3 A;  2RHQ B;  4XEM A;  1EIY B;  2E5A A;  3HXX A;  2QHV A;  3PCO A;  4P75 A;  1RIQ A;  2P5I A;  2CIM A;  1EOV A;  4RQF A;  4TVY A;  4LVJ A;  4BWA A;  3HXU A;  1YB3 A;  4KQE A;  3HXY A;  2XGT A;  3M4P A;  2DQ3 A;  1QF6 A;  1USY C;  1WQ7 A;  4CH4 A;  4CS3 A;  4UP7 A;  3NEN A;  4OP0 A;  3HFZ A;  2EL9 A;  1X01 A;  3L2Z A;  2DTI A;  3NEL A;  2ZR2 A;  3L4G B;  2Q7G A;  3V8J A;  2ZT6 A;  4XEO A;  3V7C A;  4YRG A;  1B7Y B;  3A5Y A;  4BW9 A;  2PMF A;  1X56 A;  4YRM A;  3REU A;  2ZZG A;  1B70 B;  4P73 A;  4ZTZ B;  1NJ6 A;  1G5I A;  2QHT A;  1H4V B;  1YFR A;  4RDX A;  3VQV A;  2J3L A;  4P3P A;  2ZNI A;  2EJG A;  1JJC A;  2PME A;  2I4N A;  4G85 A;  1H4Q A;  4CS2 A;  4YRN A;  3P8T A;  4P72 A;  1X2G A;  1SET A;  4WJ3 M;  3QTC A;  3RUX A;  2C7I A;  1E24 A;  4EX5 A;  1ADJ A;  1E22 A;  4P3N A;  1HTT A;  2IY5 A;  4H2T A;  1USY A;  2DVE A;  3RKX A;  2ALY A;  4XTZ A;  2E3C A;  2E10 A;  1EFW A;  3EFS A;  4NCX A;  1J5W A;  4H2X A;  5KNN A;  3LSS A;  3TEH A;  3A7R A;  4RMF A;  1PYS A;  2E64 A;  4P71 C;  4E51 A;  2ODR D;  4PHC A;  3MF2 A;  3RGL A;  3RKY A;  4RQE A;  4TQD A;  1NYQ A;  1X54 A;  4K88 A;  4LNS A;  2CJA A;  1EVL A;  2ZXF A;  4HWP A;  2AKW B;  4KR2 A;  4YRI A;  3PCO B;  3NEM A;  4LVL A;  2EJ9 A;  4XU0 A;  5K1P A;  3VQY A;  1Z7M A;  4CS4 A;  4XU3 A;  3HXV A;  3ICA A;  2RHS B;  2Q5I A;  3HTZ A;  3RF1 A;  2ZTG A;  3HFV A;  3M4Q A;  5ELO A;  2ART A;  2ZNJ A;  3A74 A;  4YRP A;  3HFZ B;  1NJ2 A;  4XU1 A;  1WQW A;  1KOG A;  1WYD A;  2AMC B;  2ARS A;  4XTX A;  4DQ2 A;  1WPY A;  4YCU A;  4P71 A;  4YRF A;  2DU7 A;  2EJF A;  2DKG A;  3P8Y A;  1Z7N A;  1C0A A;  2ZCE A;  4H2W A;  2P0L A;  2Q7E A;  3HRI A;  1ATI A;  3IAL A;  4PG3 A;  2DZ9 A;  3QO7 A;  2ZZE A;  1SER A;  2RHQ A;  1WNL A;  1B76 A;  4WF2 A;  2A8E A;  4L87 A;  5C52 B;  3DSQ A;  2ARU A;  2I4M A;  3QO5 A;  3P8V A;  4UPA A;  4DPG A;  3UGT A;  1EQR A;  4H2Y A;  4LVM A;  2DJZ A;  4H2X B;  1NJ5 A;  3TEH B;  1PYS B;  2QHS A;  3RL6 A;  2ZT5 A;  3RIR A;  4O2D A;  3HY1 A;  4H2S A;  4XTV A;  3UGQ A;  3L4G A;  3VQW A;  2ZIO A;  4HWR A;  4YRL A;  4LVI A;  4TVA B;  3WQZ A;  1WU7 A;  1B7Y A;  1QE0 A;  2CJ9 A;  1IL2 A;  5E3I A;  2DU5 A;  1NNH A;  4UP9 A;  2E41 A;  3HRK A;  4H2U A;  4TWA A;  1B70 A;  4X5O A;  4YRQ A;  3KFU A;  3REX A;  4YRO A;  2ODR C;  3RAC A;  4YRC A;  3MEY A;  4P74 C;  4YDQ A;  4K87 A;  1GGM A;  5K1X A;  3IG2 A;  3TUP A;  4XU2 A;  1H4T A;  3I7F A;  1HC7 A;  4G84 A;  1ASZ A;  1VQZ A;  1X55 A;  3IKM B;  1WLE A;  1ASY A;  2E65 A;  2J3M A;  2DZC A;  5C51 B;  2DTO A;  3VBB A;  2ZT7 A;  3A31 A;  4KR3 A;  3E9I A;  2HNI A;  2DDZ A;  4H2V A;  2NS6 A;  3CMQ A;  3QO8 A;  1LYL A;  3A32 A;  2ZT8 A;  3LC0 A;  4HA8 A;  2DEQ A;  1E1O A;  1BIA A;  4YRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...