2DKGA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, pyrophosphate and mg(2+)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
total genus 71
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dkgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dkgA01
2E10A 4EMKA 4O2DA 4M7DE 4YRSA 4YDQA 4XTZA 4YRKA 1X2HA 5GAN7 2EJGA 3P8TA 5I21A 3SWNB 2HNIA 4YRRA 1SETA 3RKXA 1HTTA 2DU5A 11ASA 3INZA 2JN0A 2IY5B 4PJOE 4M7AC 3A74A 5ELNA 1N9WA 4M77C 4F7UG 3QO8A 4KR2A 2RD1A 1WQWA 2Q7HA 2VXFA 2I4MA 1D3BA 5LJ5e 5GMKj 5GAOl 4MMKA 1E22A 2ZT7A 5GMKl 1NJ6A 4CS4A 4X9DA 1JBMA 2YLCA 4CS2A 4G84A 1SERA 2QHUA 3CMQA 1YFTA 4C92A 4M75G 1JJCA 2DQ0A 3IG2A 3LSQA 4N0AC 4TQDA 1X54A 3QHSA 3VQVA 4M7DC 3JCMh 5GAN3 1LNXA 1EFWA 1W66A 3ERRA 4H2TA 3TEHA 1LOJA 2ZINA 3HXYA 4UP8A 3V7CA 3LC0A 2CJ9A 2AMCA 4F7UE 2DEQA 4PJOB 2I2LA 4C92D 4YRCA 4V2SA 4M78G 2ALYA 1H4VB 2J3LA 1B8AA 4X5OA 4M7AA 5ELOA 1B7YA 4M77A 4EMHA 4QVCA 5LJ5h 3REUA 1TH7A 3TEGA 1LJOA 3BJUA 4Q6GA 4YCUA 3RL6A 2Q7EA 4P74C 1H641 1KQ2A 2Q7GA 4HT8A 4TWAA 5K1XA 1EVKA 2I4OA 2EWNA 5GAN4 2AKWB 4M7AD 2ZTGA 3IKLA 3MF2A 4BW9A 4RDXA 5GAOm 5GAMf 4N0AA 3REXA 3BY7A 3UFGA 3PZCA 4M7DA 5GAOr 1HXDA 3R07A 1NNHA 4PG3A 5F5WA 2DZ9A 2RB6A 4P3PA 1I4K1 1WQ7A 1B34A 4C92F 5GMKi 5GAOn 2ODRC 4RQEA 4PJOA 1BBUA 4EX5A 4C8QB 2E3CA 3JCMd 3VQXA 4RCBA 3M4QA 4M7DD 1WYDA 1GGMA 1NYQA 1FYFA 1RIQA 4M75B 2ZGWA 4YCVA 3BDUA 3RUXA 2ZCEA 3NENA 4P74A 3JCMW 5E3IA 3SB2A 1E24A 5GANe 4NCXA 5GAMg 2QHSA 4M7AF 3HXXA 2EJFA 4M77F 4YRIA 1Y96A 3HFZA 5LJ5d 2RHSA 4RMFA 3JCMe 4HWRA 3VQYA 2QHVA 4M78B 4NL3A 3SWNC 5LJ3e 4TTVA 2EL9A 5LJ5j 3BFMA 3A5ZA 1Z7NA 4K86A 1KMMA 3JB9I 1YB3A 2RHQB 4F7UA 2ARSA 2ZNIA 4RQFA 1EQRA 3BW1A 3L4GB 2YLBA 1EIYA 3A7UA 2K57A 1U1TA 3JCMX 1ATIA 4UP9A 4M7DF 4YROA 1E1OA 2E41A 4RCCA 4HWSA 3ICAA 3KFUA 4WJ4A 4YRNA 4C8QG 3W3SA 2ZZEA 3HTZA 4TVWA 2I4LA 3JCMc 1B70B 3RKYA 1M5Q1 5GANh 5GAOq 1I81A 4PJOF 2ZT5A 4XU2A 1NJ1A 2ODRD 3EFSA 3E9HA 2DJZA 2ZT6A 4HWPA 3JCMb 2ARUA 2ZIMA 4P3NA 2DU7A 3HFOA 1H4QA 4CS3A 2DZCA 5LJ3h 3QNEA 1H4SA 4G85A 4A53A 3HXVA 1I5LA 4YPFA 3RGLA 5DY9A 3SWNA 4AH6A 2DXUA 2ZXFA 4PJOC 2ZNJA 1KOGA 1KQ1A 3PCOB 2IY5A 2CJBA 4C8QE 4XEMA 3QTCA 4C92G 1USYC 2EJ9A 1G5IA 2VXEA 2CJAA 4TVAB 2EAYA 4M75E 4ZIBA 1X01A 1IL2A 4F7UF 3IKMB 3QO7A 1Z7MA 3HXWA 2DXTA 4K87A 4MMLA 4NL2A 2DQ3A 3JCMJ 3A32A 4M77D 3JCMQ 4CH6A 3HY0A 1NJ8A 1LYLA 3HRIA 2DVEA 5GMKm 2I4NA 4UPAA 4XTVA 1PYSB 4YRQA 4M78E 3V8JA 3JCMf 5GAOp 2XTIA 5GANd 4XU1A 3RKWA 3GIBA 3JCMV 3A7AA 3HXUA 4TQFA 1ASYA 3DSQA 2DTIA 4YRFA 4EMKB 3JB9D 1SESA 5C52B 2ZR2A 5GANj 4C8QC 4XQ3A 5GMKh 2ZIOA 2CIMA 3V7SA 4H2XB 4P71C 5LJ3d 4H02A 1WU7A 1USYA 3NEMA 4M75C 1YFRA 3P8YA 1VQZA 3RIRA 1BIAA 3L1AA 3FIFA 4JLIA 5LJ5f 1ADYA 3MF1A 2E1HA 2PMFA 2YHTA 5LJ3j 2E65A 4XTUA 4DQ2A 4PJOD 1EVLA 4YRJA 1X2GA 4PNOA 4XU0A 2AKWA 1BIBA 4P73A 4YRTA 1D3BB 3VQWA 3JCMg 1E1TA 4YRMA 2ARTA 3IALA 4H2SA 5CAIA 1YFSA 3P8VA 4M78C 2P5IA 4P75A 4J5YA 1N9SA 3LSSA 4YRPA 2DTHA 3UGTA 4C92B 1X56A 1JJCB 1WNLA 3V8KA 1HK9A 2Q5HA 3JB9F 3VU3C 4HVCA 4H2VA 2C8MA 3VBBA 3HRKA 4KR3A 3RESA 3TEHB 4C8QA 3V7RA 2AMCB 5LJ5g 4H2XA 4P71A 3RERA 4UP7A 4WI1A 2Y90A 4M75A 2XGTA 3NELA 4YYEA 4HA8A 3JB9H 4E51A 4EMGA 1I8FA 4YP0A 3G1ZA 2ALYB 3WQZA 1G5HA 4M7AB 4K88A 2P0LA 1B7YB 3I7FA 4M77B 1ADJA 3UGQA 4L87A 2DKGA 4C8QD 3M4PA 1G51A 4TVYA 3UH0A 4YRLA 4CH5A 4M75D 3HXZA 4XU3A 5C53B 4XEOA 4M78A 4KQEA 1NJ5A 4H2UA 4J15A 2PMEA 2RM4A 4QVDA 3A31A 5GAMh 1L0WA 3E9IA 2RHQA 5GAN8 5C51B 4JRKA 3JB9J 2QHTA 4ZTZB 2E64A 3L4GA 3FB9A 3HSBA 4M7DB 3M4GA 3PGGA 4P3OA 3FJPA 5GMKe 4P72C 1C0AA 5KNNA 1NYRA 5GAN2 2ZZFA 1B34B 4XTWA 4XTYA 4M78D 2DDZA 3HFNA 3HY1A 3MEYA 5K1PA 1B70A 1HC7A 4H2YA 1QF6A 4Y91A 1X55A 4WF2A 4P73C 4JUVA 1EOVA 5GANf 4CH4A 4OP0A 4C8QF 2FYKA 4BWAA 1B76A 2RA2A 4HT9A 4HWTA 2ZR3A 4P75C 4M7AG 1WPYA 3EFRA 3V8LA 4M75F 3JCMP 12ASA 4M77G 4PHCA 4J6YA 1M8VA 1JRIA 1U1SA 4NOYA 5LJ3f 1YCYA 4C92E 4EO4A 1Y96B 3AHUA 3RF1A 4EMKC 3HFZB 4YRGA 3QSUA 2RHSB 4OLFA 4X9CA 1BBWA 1ASZA 4YCWA 3L2ZA 2CGHA 1NJ2A 3OD1A 4DPGA 4CH3A 3PCOA 3JB9G 3QO5A 4P72A 4M78F 4TVAA 4F7UB 1KMNA 4HWOA 4M7DG 3QO3A 2ZT8A 5GAMd 5GAN6 1QE0A 4LNSA 1N9RA 2C7IA 1EIYB 4H2WA 5GANg 4M7AE 2VC8A 2ZZGA 4A54A 4M77E 2J3MA 5GAMj 4YREA 4ZTUB 3HFVA 4J6WA 5GAN5 1H4TA 3QUIA 1SRYA 4PJOG 5HGQA 1WLEA 2G4CA 2FB7A 3A7RA 2QTXA 4Q15A 4WJ3M 3A5YA 5LJ3g 4XTXA 1PYSA 3NETA 4C92C 4JRIA 2DTOA 1YGBA 5GAMe 3RACA 1J5WA 3TUPA 2Q5IA 4J6XA 2E5AA 1MGQA
chains in the Genus database with same CATH superfamily
1D0YA 4YRSA 1YI2A 4XTZA 4YRKA 1U3OA 1N8RU 3MEVA 2O4XA 4L6V5 5I21A 2L2PA 4YRRA 1IHVA 1G2BA 3E9GA 1HTTA 2EKHA 1FMVA 1VQ4Q 3CC7A 2L5QA 1Y7XA 4DBFA 3QO8A 4KR2A 3M56A 3EFOB 1WQWA 2OI3A 1AEYA 2K2VA 3PMIA 2VXFA 2KR3A 1D3BA 1YHQQ 3ZL7C 2O88A 4A4HA 1VYUA 4MMKA 3ME9A 5J3BA 1E22A 2DJQA 5GMKl 4X9DA 1JBMA 3CXCP 2M16A 3WXMB 1YIJA 2M02A 3Q1JA 4M75G 1OZ3A 4E2FB 3IG2A 3LSQA 2PU9B 3JCMh 3OYAA 5GAN3 1LNXA 3VYGA 1IGQA 2Y4YA 1EFWA 2KRSA 4H2TA 4QW2A 2LQNA 2ZINA 4LVJA 3V7CA 2CJ9A 4F7UE 1BI3A 3TREA 1YJ9A 1PNJA 2ZAEA 5D6XA 1G3SA 5CK9A 4PJOB 2QASA 4HCZA 4V2SA 3G4ST 1MMNA 2AZSA 3GNFB 1H4VB 2RJEA 4X5OA 4F04B 3LW5E 1YJNT 3TVTA 3CXCA 3TEGA 2ZPGB 4HCKA 1KK7A 2LMJA 3LWHA 1IHWA 2JTMA 2Q7GA 1AWWA 2HQXA 4TWAA 4PKCC 2MMPA 2RQVA 2HEQA 2I4OA 2ZTGA 3MF2A 1RI0A 1Y57A 1ABQA 1PKSA 3REXA 4A4GA 2A08A 5GAOr 4OMFB 3A5ZB 5A2QE 1NNHA 2DZ9A 4P3PA 4CC3A 3FRNA 1J3TA 4FSXA 2OTLQ 4C92F 5GAOn 4GLMA 4J9GA 3KUFA 1OX9A 1BBUA 2BIVA 5J39A 2E3CA 2JJ9A 2WSFE 4X1VA 1NYQA 2C0TA 3DB3A 3CC2Q 4J9DA 4YCVA 1OEBA 3A8GB 3BDUA 3RUXA 4B9XA 1T3SA 2ZCEA 1YI2T 2YUOA 5E3IA 1SHGA 1E24A 2KEAA 4NCXA 3CPWS 3HXXA 4DEXA 3QKJA 3GLXA 3QZ5B 4C0ZA 3HFZA 5LJ5d 3VS7A 4RMFA 1UB4A 3CMEA 3JCMe 3OYGA 2YUNA 2QHVA 2ABLA 4ELZC 3SWNC 2A3LA 2YT6A 2NWMA 1Z7NA 1KMMA 3JB9I 2EBPA 2RHQB 4J9CA 4F7UA 1VQOA 2ZNIA 4RQFA 2X9HA 2DIGA 3A7UA 3X20B 2XI9A 2DA9A 4M7DF 2CZ1B 2KROA 2GNCA 4DA4A 4AFQC 1NJIU 1YIJT 2K3YA 2E41A 1HSQA 3HTRA 4HWSA 2J6FA 4DOWA 3KFUA 4WJ4A 3EGXA 4Z8AA 1Q81R 1K8AC 4C8QG 1M5Q1 2LNVA 3QWYA 4PJNA 2L3RA 2ZT5A 2ODRD 1SF9A 3VS4A 2PNIA 1K73U 3JCMb 2ARUA 1YJ9T 2KQWA 4JLGA 4P3NA 2Z0WA 1VQPT 3HFOA 4RG8A 4CS3A 4FIBA 2KMTA 5HKCA 4Y28E 4DEYA 4ME7A 3I55Q 1WHMA 1I5LA 2OAUA 3EG9A 3SWNA 2ZXFA 4CI0C 4J9FA 3CBPA 1X2QA 4HKEA 5C0MA 3REAB 2MF2A 1WXBA 1NE8A 2JTFA 2FPEA 4C92G 1VUBA 2HBPA 4TVAB 2VWFA 3RMSA 3ZEHA 4Z89A 1EFNA 2D1XA 2DBKA 1T0HA 2XK0A 2QK0A 4KRTA 2VB6A 4A4EA 3A32A 4KH1B 3JCMQ 3MJXA 2J6KA 4LE9A 1LYLA 1RLQC 1FWZA 4FU6A 1KC8C 5FLXE 5GAOp 2XTIA 4XU1A 3JCMV 1ZBJA 1MMAA 3DSQA 2VKNA 3NHNA 2QI2A 2E6ZA 1PRLC 4EIKA 2QGFB 1OPKA 2ED0A 5GMKh 1KIKA 1W4SA 3E9FA 2L89A 3OSVA 4H2XB 2O4XB 5LJ3d 4H02A 1WU7A 1YFRA 3P8YA 1VQZA 3RIRA 2FG0A 4BI3A 4NS5A 3MF1A 4FM4B 4OMMA 2PMFA 1VQLA 1YJWQ 3D7SB 2HSEB 4YRJA 1M90C 1KD1U 3M5AA 2RF0A 1KQSA 3CCEA 1TUCA 2E12A 2IIMA 3EGDA 1D3BB 5DM7R 3OS5A 2R58A 3P8BB 4UC4A 1VQOT 3JCMg 1G3WA 1X6BA 1E1TA 3IALA 1OU8A 2QXFA 3CCMA 2YXYA 4J5YA 1O75A 2CS7A 4FYWB 1JU5C 4EPCA 3JAME 3QXEB 1SRMA 2C8MA 2Y4XA 3HRKA 3VS2A 1VIEA 2X4JA 3V7RA 4JRQA 2LNHB 4RG2A 2RPNA 2H8HA 5CVIA 1WXTA 2RJFA 2O9VA 2D6FA 3RERA 4YYEA 4E51A 3OYCA 1YBYA 4YP0A 1QQJA 2BKDN 1WFWA 2J05A 2JS2A 2M9UA 1ZSZC 1VQ8A 2P0LA 3HPWA 3PE0A 4L87A 2DKGA 2P0PA 1WHHA 4C8QD 2CP6A 3NTKA 2DVJA 3R6OA 3HXZA 4XU3A 1NPRA 1ZA2B 1NJ5A 2PMEA 2RM4A 4QQ6A 1I5OB 4JJDA 2XIDA 3E9IA 4PJMA 3I56T 1JB0E 4ZTZB 3CCUQ 1EZZB 1WHJA 2IG0A 5C6SA 4P3OA 3A8MB 3FJPA 5GMKe 4P72C 4B9WA 4PJJA 2DILA 5KNNA 2MAMA 1ZBXA 4XTWA 4M78D 2DDZA 3O5ZA 3GOXA 1K8AU 1X6OA 1MHNA 2DYIA 1WDXA 1TWBA 3OW2P 1HC7A 3KBGA 4LDXA 1X55A 1ZSZA 1VQNA 1PKTA 1EOVA 2V8JA 1KG1A 4QT7A 4CC2A 1E6GA 1SG5A 4HWTA 2NUPB 4M7AG 3EFRA 4M77G 4P5NA 1QP3A 3OB9A 2YSQA 3CCSA 1YCYA 5IHIA 5EC7A 5HY6A 3AHUA 4EMKC 3HFZB 4YRGA 4RTTA 3L2ZA 2CGHA 1M2VA 3LLRA 4LD9K 1N8RC 3QO5A 3MPUB 1I0CA 3OW2A 3PVLA 4P72A 1Q86R 2RQRA 4JDSA 2R5AA 4F7UB 4RMOA 1YNZA 1KMNA 3VS1A 2KXDA 1UGQB 3GPLA 2BZYA 2P4RA 2DERA 1Z9ZA 1Q7YR 2VVKA 2CH4W 2J3MA 3OSSC 2DEUA 3JRZA 4OVAA 4ZTUB 4AT1B 2ENMA 1YJWT 1H4TA 1SRYA 4PJOG 3EGXB 3I35A 4LD6A 2NS6A 2FB7A 1OX8A 4L5GA 4ATOA 1K0SA 4XTXA 5CKDA 1AWOA 4YTLA 3M0QA 3ASKA 2CZ7B 2Q5IA 2L3PA 2E5AA 1MGQA 1SETA 4JS4A 4O5VA 4GLKA 4EMKA 1VQKQ 4O2DA 4YDQA 3NPFA 2YRVA 1ZUUA 2ROTA 2RHZA 3P8TA 4OB3B 3EG9B 5D6WA 3SWNB 2HNIA 2F1LA 2JNGA 3RMQA 2GQVA 3LH5A 3GF5A 1C0MA 2DD5A 1IRXA 2EVRA 3MCAB 4RUGA 1Q82R 2EPDA 2RD1A 1PC0A 2FZGB 2ED1A 3J7AF 2I4MA 1YITA 1HJDA 2MYSA 2K3XA 3MKDA 4L59A 1YP5A 2YLCA 1SERA 3LGFA 4G84A 1Q7YU 4X34A 4N0AC 1X54A 2MIOA 3G1JA 3VQVA 4BE0A 1RAHB 4C5EA 2PZ1A 2L3SA 1QW1A 1GFCA 2CZ0B 2F69A 1W66A 4PLLA 5IAYA 1QLYA 4AFZC 1LOJA 2QGGA 5IHKA 3G4SQ 1VQNT 3HXYA 3LC0A 4E6RA 1HD3A 2DEQA 4HCBA 1AZGB 1BCOA 2F5TX 4YRCA 2EQKA 3SD4A 3GNGA 1VQ9Q 1SSHA 4J9BA 1JQQA 2AZVA 2KDSA 4MZPA 1E7OA 4D8KA 1B7YA 2RQUA 4QVCA 3CCST 3C94A 5CCAA 1B3QA 2YRCA 1TH7A 2KYMA 5FWBA 3RL6A 2KBTA 2Q7EA 2LZ6B 1H641 1KQ2A 2COYA 1G3TA 4OMQA 3CCQT 5K1XA 2FO0A 1EVKA 1QVFA 4DBHA 2EWNA 4Z88A 4JRPA 3EGDB 4M7AD 3IKLA 4BW9A 2CUDA 3M58A 3MEAA 1BI1A 4N0AA 3OS2A 3PZCA 3X26B 1VIFA 3H9NA 4Q5WA 3CMAA 2LTOA 3EG1A 5F5WA 2RB6A 2VV5A 1I4K1 2IPOB 1KJWA 2A37A 5D7UA 2GFAA 3P8DA 2X3WD 2ODRC 2K5LA 1M1FA 2AIRB 4RQEA 4EX5A 1R0CB 2LRQA 4IUPA 3JCMd 1NJIC 1MV3A 3CCLT 3M0UA 3QJYA 6AT1B 1YI2Q 1RIQA 2J7IA 4JS5A 3TU4K 4IUTA 4LDVA 1JO8A 3JCMW 1X69A 3SB2A 1QMCA 5GANe 2X4XA 1VQMA 3G6EA 1SKUB 2EFIA 2ZZDA 5CQYA 1K73C 3X28B 1Y96A 1AD5A 1M9SA 4J8OA 1VQ5T 2LDMA 5L8RE 1ZA1B 2MOXA 2E5KA 1VQKT 3BFMA 4GBQA 4XAXB 4BACA 1NBEB 1YIJQ 1YITT 2YUQA 1EIYA 1U1TA 3QYGB 2L0AA 1H8KA 2F5KA 1YFNA 4KBMB 4YRNA 2GBQA 1M8MA 2ZZEA 2JOYA 1WHKA 5GAOq 1RLPC 2V8KA 3BE3A 1AWJA 1I81A 1ZSZB 3MP8A 3VJPA 1YJ9Q 1WHLA 2CSIA 1VQPQ 2X4YA 4ORZA 2DJZA 1H92A 2DXCA 4LVKA 4HWPA 3LWIA 2E70A 2SEMA 2QQRA 2DU7A 3CPFA 2K6DA 2DZCA 3OYYA 1O9SA 1K76A 3CEYA 3U23A 4ZN1A 1VQ4A 2DXUA 2EYXA 2ZNJA 1KOGA 1SEMA 1M2VB 4C8QE 2CUBA 4AFSC 4XEMA 2EJ9A 2CJAA 1VQ9T 5CKBA 1R8OB 2O9SA 4BE2A 3OYFA 4ZIBA 2EGEA 4J7FA 2J06A 1KHIA 3CQTA 2OAWA 4F7UF 3IKMB 1KHCA 3HXWA 4C0GA 1G5VA 1KD1C 4ZNXA 3FLGA 2DQ3A 3CPWP 2LCLA 5KCHA 2KVQG 3MHXA 4CH6A 3R6NA 4LDUA 2DVEA 2CP7A 5GMKm 4MDWA 4ELYC 4YRQA 1FMWA 4M78E 2KE9A 2CYZB 5IHNA 1VQ7T 5DLQE 4TQFA 2DTIA 2MCNA 4EMKB 3JB9D 3MQZA 3MO8A 4C8QC 1BKBA 1FXXA 2CH4A 3G6ET 4FT4A 3CMEQ 5FRNA 4RTUA 2OTJA 2O2OA 1ADYA 4HVUA 3O8VA 1RADB 1TG0A 2P4TA 1TXQA 1VQOQ 4D6WA 4TVRA 1XTDA 4PNOA 2F2VA 3QG1A 4XU0A 1ZX6A 2AKWA 1BIBA 2KNBB 1G83A 3J81E 2ZCFB 3OYLA 2KAFA 4YRMA 4H2SA 3CC7T 4M78C 4QQDA 1FMKA 3OYNA 4AG1C 2X51A 2RHYA 1X56A 4C5IA 2K5IA 2QQ9A 1HK9A 1DJ7B 4E7ZA 4IIMA 4N4HA 5CR2A 1BU1A 1WXUA 2G3RA 3RESA 2D0NA 4C8QA 4PK4A 3VS0A 4JPBW 1QCFA 3HHTB 2NUZA 4F14A 4WI1A 3SDZA 1S72A 2XGTA 3NELA 2DRKA 1I8FA 2QYZA 3G1ZA 2MWOA 4A4KA 2DRMA 1QKWA 1B7YB 3CBMA 4BY6C 1NPPA 2LP5A 4C0FA 1XOVA 1V29B 1G51A 4TVYA 2HKQB 3UH0A 2DFUA 1M1KR 1QVPA 5CQXA 1AOJA 2LCCA 3E19A 4CH5A 1VQ6A 4M75D 3I56Q 5C53B 4M78A 4KQEA 3QDRB 4QVDA 1V76A 2WSEE 5C51B 5HK0A 2DL5A 2MWPA 4HCCA 2CP0A 2O31A 1WLPB 2ZPFB 3M4GA 3PGGA 2XKOC 3CCVA 3DB4A 5GAN2 5CKFA 5CIUA 1PHTA 3HY1A 3HFNA 2A0FB 2XHCA 5IT9E 3MEYA 2XMFA 5IXBA 1B70A 1PG5B 4Y91A 3NGPA 4D8DA 5GANf 4OP0A 2FYKA 4BWAA 1WA7A 2RA2A 1TS9A 1K9MR 1WPYA 2V1RA 4ZGDB 2RJCA 1Q81U 3JCMP 1SSFA 4J6YA 2J6OA 1K0XA 2QEXA 2QA4A 2JXBA 1M8VA 2DPPB 5FROA 1WIEA 4ZGJB 3VS5A 1N6AA 4EO4A 1Y96B 5CKEA 3RF1A 4K11A 1UUEA 1QCOA 3A1PA 4OLFA 3I5SA 4X9CA 1BBWA 1W2BS 2HAXA 1NJ2A 3GP8A 2RHIA 3OD1A 2DL3A 3CCEQ 4ZTFA 5CKHA 1UE9A 3EAEA 2QQBA 4CC7A 1M1KU 2FEIA 1VYTA 3CCMQ 1UGVA 1SRLA 4M7DG 2LQ8A 2ZT8A 5GAN6 3CMET 1EIYB 2DO3A 2YUPA 2CT3A 3KFVA 1WJSA 3G7ZA 2FRYA 4M7AE 1ZHIA 2JMCA 4A54A 4M77E 1QVGS 2DXBA 1RAAB 3HFVA 4ESRA 3QUIA 2R5MA 3A7RA 4WJ3M 2YRDA 3J80E 2FZCB 1WJRA 1AHJB 1Q7YC 3NETA 2LJ0A 4BI8B 3M0SA 3PNWC 4JRIA 2KYBA 3RACA 2NUTA 1J5WA 3CC4A 3H6ZA 2E10A 2D9TA 1K9MU 1ZUYA 2CREA 2JUFA 4BI4A 1KQSS 2EJGA 2EGAA 3JV3A 1UJ0A 2DU5A 2PVDB 3NMZC 5DLOA 1IGUA 2EYQA 11ASA 3HRUA 2AHJB 1OULA 4PJOE 3META 2DNUA 1R0BG 4M7AC 3A74A 5ELNA 1TUGB 4ZN3A 1VQ6T 4M77C 1M30A 2Q7HA 1YN8A 3CCJA 4IUUA 2RHUA 5LJ5e 3E2UA 3EH2A 5GMKj 5GAOl 3LH0A 4CRIA 1VOMA 2ZT7A 1PCXA 1UGRB 1NJ6A 1Q82C 1ZLMA 1LCKA 2DQ0A 4BD3A 2A28A 1VQNQ 4O6JA 2MPXC 3TEEA 2G6FX 3OMGA 2C0OA 4LXCA 4OB2B 2DE0X 4QKUA 2AMCA 2EQUA 3QIIA 1BK2A 5IH2A 4HXJA 1N27A 1T3LA 4C92D 2VUBA 3CCSQ 2QAZA 2ALYA 2ESWA 2J3LA 1B8AA 4M7AA 5ELOA 2QA4T 1M2OA 1CKAA 4M77A 4ZGEB 2I0NA 4EMHA 2PVOB 4Y92A 1FX7A 3CCQQ 2V26A 5FRMA 3RDVA 4YCUA 3BDLA 1UFFA 1C1AA 2D0QB 2QQSA 3OS0A 2JVVA 2B86A 1K4US 1WHGA 5GAN4 2AKWB 4ANJA 2X4WA 4RDXA 5GAOm 5GAMf 5KYXA 1X2KA 1VQLT 4LNPA 2JT4A 3BY7A 3F70A 4OMOA 3QBYA 1RAIB 1JJ2S 3R07A 1QCNA 4E47A 2COZA 5EG2A 3CCET 4FW1A 2JMAA 2BTTA 3EHRA 3CCRA 2WSCE 1B34A 2KRMA 3UA6A 4PFOA 3M0PA 3CCLQ 2DMOA 5GMKi 3CD6A 3CCMT 4PJOA 4JJBA 4C8QB 1E6HA 1M90R 4RCBA 2RK2A 3M4QA 4M7DD 1WYDA 1GGMA 3RR6A 2DIQA 1FYFA 3L2UA 5A0LA 2HQEA 2ZGWA 3CC4T 1B7TA 3QZ9B 1D0ZA 1IXDA 2LCSA 1Y07A 1I1JA 2DLPA 3NENA 2F2WA 2RMOA 4E7JA 1A0NB 2W0ZA 1VQ5Q 1BCMA 2HL5C 2EJFA 1G8XA 4LN2A 4LUDA 2RHSA 1ABOA 1VQ8T 3PFSA 4M78B 3HRSA 4NL3A 1R77A 1YITQ 5LJ3e 2GCXA 4TTVA 3A8OB 3A5ZA 1MMDA 4K86A 2A7YA 4KUIA 1YB3A 3CCJT 2ARSA 1K9AA 3UPUA 2K57A 3HP9A 2JZ2A 2GGRA 5I2MA 1KSWA 4YROA 4RCCA 1Q86U 5KYYA 2GTJA 4RTZA 2RQTA 3VS6A 4TVWA 2I4LA 3JCMc 1B70B 3RKYA 1QKXA 5GANh 4RTWA 3EFSA 4JZ3A 4BY6B 2LJ1A 1MUZA 2ZIMA 2O01E 4FT2A 1H4QA 1NEGA 3H0FA 5IXFA 4G85A 4B6MA 3HXVA 2HL3A 3DKMA 4C0DC 2RNAA 3NTIA 2JS0A 4AFUC 1JEGA 2M51A 2IY5A 2LC4A 2CJBA 3VUZA 1N5ZA 3QTCA 1USYC 1G5IA 5FU6C 5KYNA 2RN8A 4M75E 3CMAQ 2BUDA 2ATCB 1IL2A 3QO7A 3L2QA 5FW9A 1Z7MA 2KRNA 1Y0MA 4BB7A 3OYKA 2HCKA 4K87A 4NL2A 2XDPA 1Q82U 2PUKB 4M77D 2ZPHB 3HY0A 1BBZA 1VA7A 3HRIA 1VQ7Q 3FJ5A 4XTVA 1N8RR 3V8JA 1ZSGA 3RKWA 3QJ6A 1YJNA 3HXUA 1TTHB 2NUTB 1AVZC 4WCIA 4YRFA 1SESA 4F16A 3G6EQ 2V1QA 5C52B 5GANj 4XQ3A 3JSCA 3LGLA 1QVFS 2CIMA 2LT4A 4PLIA 2CP5A 1USYA 3NEMA 4M75C 1JXOA 4GY5A 2F2XA 4F17A 5LJ5f 1AT1B 1SPKA 2YHTA 1OPLA 2E65A 1MNDA 3M57A 4VUBA 4DQ2A 3OY9A 4PJOD 1EVLA 4MZTA 3CC7Q 3VYHB 2B8AA 1NZ9A 2BE9B 2KSSA 4P73A 3QYHB 4YRTA 1UDLA 1V1CA 2LVMA 3REBB 4IURA 4XK8E 4P75A 3C12A 3RBBB 2RQWA 3LSSA 3OYEA 1M1GA 2DTHA 3WVEB 2HD0A 3SEMA 3C95A 3V8KA 4FYYB 4FL6A 4OMPA 1JXMA 2Q5HA 3VU3C 2X35A 3HL8A 2CP2A 3G71A 4HVCA 2L8DA 1NYFA 3EHQA 1TSFA 4KR3A 2YDLA 2GQIA 4E7LA 8AT1B 2AMCB 2A36A 3VKIA 4H2XA 3OYJA 4UP7A 4KGZB 3P8HA 2LJ3A 4M75A 4J83A 3S6WA 4EMGA 2RI5A 2JM9A 5KE3A 2ALYB 3VRYA 1G5HA 4M7AB 4M77B 4N4GA 1ADJA 3UGQA 1Y71A 2EW3A 5CO7A 3M4PA 3QDFA 3OYHA 4R55A 4JZ4A 3OA6A 1Q81C 3PVQA 3EGUA 4YRLA 2MK5A 3ZBDA 1UTIA 1S1NA 4OF1A 5GJVB 4H2UA 4J15A 3H8ZA 3UDCA 1OQKA 5GAMh 1BI2A 1YCSB 2HKNA 5LL6S 3OQ5A 1OV3A 5GAN8 5KYXB 4JRKA 4RTYA 3JB9J 4KT0E 2QHTA 2E64A 3L4GA 1M1KC 1XNIA 1TOVA 3M9QA 2BE7D 3X25B 1C0AA 1NLOC 1YHQA 1B34B 2DX1A 3MEUA 3UATA 4C5HA 4J7IA 4R0KA 1VQPA 2DL7A 1IB8A 5K1PA 1QF6A 3CMAT 1GL5A 3A8HB 2M0OA 5KYWA 4JUVA 4CH4A 4C8QF 1PSEA 3FDRA 4PFPA 4HT9A 1B76A 2VGNA 2XDDA 2QG9B 1QWFA 2DAQA 5KE2A 2E5QA 3V8LA 2AT1B 4PHCA 1X75C 3CXCS 2OTJQ 1U1SA 4NOYA 2XD0A 1NLPC 5LJ3f 4WTOB 4C92E 2D8JA 3MEWA 1K1ZA 1K9MC 5GJWB 3QSUA 2RHSB 4YCWA 1B07A 2EIFA 2EGCA 3PCOA 1RUWA 1VQMT 1WX6A 1NJIR 5A0DA 4M78F 3LX7A 4HWOA 4QQGA 3CPWA 4LDYA 1ZQ1A 3OYIA 1BI0A 1QE0A 4LNSA 1N9RA 4IKFA 2C7IA 5GANg 4IUVA 4OB1B 5KYUA 2E3HA 2ZZGA 3T9NA 3THKA 1VYVA 5GAMj 1K73R 4J6WA 5GAN5 3NTHA 2LT1A 5KYYB 2PTKA 5HGQA 1WLEA 2ROLA 5FU7C 3G71T 2G4CA 4Q15A 3VUBA 2FRWA 3A5YA 1M3BA 2NUPA 1CKBA 2IVWA 1PYSA 1S72Q 2OTLA 2AKLA 4C92C 5I11A 1M3CA 2DTOA 1YGBA 5GAMe 2E6NA 2P0KA 3TUPA 4J6XA 1GCQC 5HK3A 4M7DE 1X2HA 4IIOA 3CC2A 5GAN7 4LUEA 1CSKA 1OI1A 1D09B 2PUOB 3L2VA 1VQ6Q 3RKXA 2LQKA 2JM8A 3INZA 2JN0A 2IY5B 3RNJA 1N9WA 1ACMB 3QWXX 4F7UG 2X3XD 5FWCA 1VQ4T 3CCVQ 1UECA 4R56A 1WI7A 3CBOA 3EG3A 2DK3A 2D8HA 1QP2A 4CS4A 4CS2A 1NM7A 1OU9A 2QHUA 3CMQA 2COWA 1YHQT 2DETA 1YFTA 4C92A 1PD0A 2E4HA 1JJCA 3N5BB 2VASA 4TQDA 2XDBA 2MI6A 3QHSA 4M7DC 4BDZA 1W2BP 1GCQA 3M55A 4KUDK 1X43A 3ERRA 3TEHA 1Z9QA 3H0HA 4UP8A 4ZTJA 4C0DB 4OGEA 1BYMA 3M53A 4QVZA 3UF4A 2QEXQ 2QA4Q 2I2LA 3KXTA 1X27A 2ZPEB 3PIPA 4M78G 2RO0A 1KD1R 2K7AA 1X6GA 1QVGP 5FU6B 5LJ5h 1BB9A 4OMNA 3OBYA 3REUA 2FHDA 3VV0A 5L23A 1LJOA 3BJUA 4Q6GA 3I56A 3I55A 4P74C 4HVWA 1GXIE 1GCPA 3GBQA 1KFZA 4HT8A 1W2BA 1VQLQ 1W1FA 3MP6A 2GFUA 2NLUA 3TSWA 2OTJT 2FPFA 1NG2A 2K5FA 4DBRA 3UFGA 4M7DA 4KULA 3PTAA 1HXDA 4FCYA 3M0RA 4PG3A 1KQSP 2RHXA 1WQ7A 2RH2A 3M54A 1ZUKA 1QVGA 1UGPB 1UEBA 4KGXB 1HYOA 4JJNK 2A8EA 3CC4Q 2JTEA 2OTLT 3VQXA 4II1A 5AYFA 2V8IA 4JJCA 1PSFA 1Q86C 2CZ6B 2DD4A 2CP3A 4M75B 7AT1B 3PIOA 4A4FA 3L2RA 1D0XA 2HSPA 3DLMA 4P74A 2JW4A 3CC2T 4J9EA 1WGSA 4DBQA 1VQ8Q 5GAMg 2QHSA 4M7AF 1IREB 1GFDA 4M77F 1S72T 4YRIA 2KK4A 2BZXA 2P0QA 3CCJQ 4HWRA 3VQYA 3L2WA 3TQ7P 1RABB 2EL9A 5LJ5j 2XU8A 2NYSA 3LYIA 1YJWA 1K8AR 2EQMA 3E1SA 3H41A 1AZEA 1U5SA 3EH1A 1EQRA 3BW1A 3L4GB 2YLBA 2QDYB 3JCMX 2KT8A 1ATIA 4UP9A 2C0IA 1EIFA 3A8LB 1E1OA 2VYTA 3SFMA 3AT1B 3M59A 3ICAA 4LVMA 3X24B 3W3SA 4E7KA 3HTZA 2CKKA 3CCVT 4BE1A 3TSZA 1TU0B 3S3NA 4PJOF 5KYWB 3DLLA 3L42A 4XU2A 3UT1A 1NJ1A 1IO6A 4FYVB 3E9HA 4E7HA 4E7IA 1WJQA 3OS1A 2ZT6A 1RAFB 4CC4B 1RAEB 3C0CA 1MNEA 1PD1A 4MZMA 2EYWA 5I2SA 1UHCA 4KH0B 3FEOA 3C4SA 3OBWA 5LJ3h 1UGSB 3QNEA 1XQHA 1H4SA 4A53A 2HBWA 1JJ2P 2M0YA 4YPFA 3RGLA 5DY9A 1GBRA 4AH6A 4BDYA 2RJDA 4PJOC 2KGTA 4HT4A 1KQ1A 2HMAA 3I55T 4FSSA 3PCOB 5KH6A 2OJ2A 2QEXT 2M1HA 2DL8A 4LVIA 5ECAA 1M3AA 3M4YA 2VXEA 4E7SA 1RACB 3EFOA 4PFZA 2EAYA 8ATCB 1D1BA 3HKSA 2HDAA 1X01A 2DL4A 2XG8D 1U8RA 3CCRQ 1KC8R 2DXTA 2KY9A 5KYUB 1F1BB 4MMLA 3CD6Q 3I9QA 3EG2A 3CCUA 1H3ZA 3JCMJ 3TCJA 1JJ2A 1OZ2A 2K3BA 1NJ8A 2HQHA 2I4NA 4UPAA 2W10A 1PYSB 4RTVA 3JCMf 2SRCA 2PVGB 1IZ6A 5GANd 3GIBA 3A7AA 1ASYA 2EQIA 1LVKA 1UJYA 2DBMA 2CDTA 2ZR2A 4Z02A 1LPLA 2ZPIB 2ZIOA 1TUDA 3CCQA 3V7SA 3S3OA 1RL2A 2AK5A 4P71C 3OYDA 3S3MA 2L3QA 2WACA 3PT9A 1BIAA 2RI2A 1I07A 3L1AA 3FIFA 4JLIA 4LVLA 2E1HA 3OW2S 5LJ3j 2ZPBB 1WZOA 4XTUA 3I5RA 4OMLA 4AMCA 1OYXA 3M0TA 1X2GA 4M4ZA 3PMTA 1OOTA 3VQWA 1T0JA 5FU7B 2ARTA 5CAIA 2DYBA 1YFSA 3P8VA 2P5IA 5IN1A 1AWXA 1W6XA 1UG1A 2PQWA 1N9SA 1Q95G 4YRPA 1GRIA 3UA7A 1KC8U 3UGTA 4C92B 2YWWA 3CCLA 1JJCB 1WNLA 4FYXB 1PRMC 2KT1A 1W70A 3JB9F 2FZKB 3MP1A 3SHWA 2EQJA 4H2VA 1YWOA 4LDWA 1RAGB 3VBBA 1MV0B 3TEHB 3UWNA 5LJ5g 2HZYA 5AT1B 4P71A 1NYGA 2Y90A 1NEBA 4HA8A 3JB9H 4OGCA 3WQZA 5KCOA 1VQ5A 4K88A 4KGVB 2AKKA 3I7FA 3VRZA 1WYXA 2QTVA 1M90U 1VQKA 5J26A 5HCKA 4PL6A 2KI7A 2P84A 2E3IA 1PWTA 2KXCA 4N4IA 4XEOA 3A31A 1SHFA 2H3EB 3FC3A 1L0WA 2RHQA 2EKOA 4A63B 2CT4A 4RKUE 3H0IA 4DOVA 3ULRB 3FB9A 3HSBA 4M7DB 5A0GA 3ZFJA 4J9IA 1QVFP 1ARKA 1NYRA 2ZZFA 3CCUT 4XTYA 1RI9A 1YWPA 3A98A 4AG2C 1YJNQ 1D1CA 3IQLA 2OX7A 3OMCA 4H2YA 5D6YA 2LX9A 4WF2A 4P73C 1C6VX 3HRTA 3CCRT 4C5GA 4IUQA 2VGMA 3CD6T 1P92A 2ZR3A 4P75C 5I22A 3G4SA 4M75F 12ASA 2C06A 3EG0A 1JRIA 2RK1A 2GTOA 2XICA 5M9OA 1VQ9A 1G3YA 2GF7A 3QPHA 3VS3A 1VQMQ 1QWEA 1ASZA 1XJWB 4DPGA 4CH3A 2FVUA 2CSQA 9ATCB 3NFCA 2RI3A 3JB9G 1M27C 2H3JA 2K79A 4TVAA 3ER0A 1FYNA 2DM1A 3QO3A 5GAMd 2DF6A 4MDXA 1U06A 4J9HA 4H2WA 4EDUA 1M4ZA 2EYZA 4HVVA 4BUGA 3G71Q 2VC8A 4PJLA 3OYMA 1PM3A 2FL7A 2K4YA 2LX7A 4YREA 1VQ7A 1EX4A 4OB0B 2K9GA 1MMGA 2QTXA 2R57A 3URGA 1D1AA 2LQWA 2ECZA 5LJ3g 3WVDB 4RTXA 1UHFA 4FW2A 2FPDA 1GBQA 1H3HA 2EYYA 3OYBA 2QQAA 2QDLA 2K2MA 2BZ8A
chains in the Genus database with same CATH topology
4YRSA 1YI2A 4XTZA 4YRKA 1N8RU 3MEVA 2O4XA 4L6V5 5I21A 4YRRA 3E9GA 1HTTA 3CC7A 2L5QA 1Y7XA 3QO8A 4KR2A 3M56A 1WQWA 2K2VA 3PMIA 2VXFA 1D3BA 4A4HA 4MMKA 3ME9A 5J3BA 1E22A 5GMKl 4X9DA 1JBMA 2M16A 3WXMB 1YIJA 3Q1JA 4M75G 1OZ3A 3IG2A 3LSQA 2PU9B 3JCMh 3OYAA 5GAN3 1LNXA 3VYGA 1EFWA 2Y4YA 4H2TA 4QW2A 2ZINA 4LVJA 3V7CA 2CJ9A 4F7UE 1BI3A 3TREA 1YJ9A 5D6XA 1G3SA 5CK9A 4PJOB 4HCZA 4V2SA 3G4ST 3GNFB 1H4VB 2RJEA 4X5OA 3LW5E 1YJNT 3CXCA 3TEGA 2ZPGB 3LWHA 2JTMA 2Q7GA 2HQXA 4TWAA 4PKCC 2MMPA 2I4OA 2ZTGA 3MF2A 1RI0A 3REXA 4A4GA 5GAOr 4OMFB 3A5ZB 5A2QE 1NNHA 2DZ9A 4P3PA 3FRNA 4FSXA 4C92F 5GAOn 3KUFA 1BBUA 2BIVA 5J39A 2E3CA 2WSFE 1NYQA 3DB3A 4YCVA 3A8GB 3BDUA 3RUXA 4B9XA 2ZCEA 1YI2T 5E3IA 1E24A 4NCXA 3CPWS 3HXXA 3QKJA 3GLXA 3QZ5B 4C0ZA 3HFZA 5LJ5d 4RMFA 1UB4A 3CMEA 3JCMe 3OYGA 2QHVA 4ELZC 3SWNC 2A3LA 1Z7NA 1KMMA 2RHQB 3JB9I 4F7UA 1VQOA 2ZNIA 4RQFA 2DIGA 3A7UA 3X20B 2XI9A 4M7DF 2CZ1B 4DA4A 1NJIU 1YIJT 2K3YA 2E41A 4HWSA 4DOWA 3KFUA 4WJ4A 1K8AC 4C8QG 1M5Q1 2LNVA 2L3RA 2ZT5A 2ODRD 1K73U 3JCMb 2ARUA 1YJ9T 2KQWA 4JLGA 4P3NA 1VQPT 3HFOA 4RG8A 4CS3A 4FIBA 2KMTA 5HKCA 4Y28E 4ME7A 1I5LA 2OAUA 3SWNA 2ZXFA 4CI0C 3CBPA 4HKEA 5C0MA 2MF2A 1NE8A 2JTFA 4C92G 1VUBA 2HBPA 4TVAB 3RMSA 3ZEHA 2XK0A 4A4EA 3A32A 3JCMQ 1LYLA 1FWZA 4FU6A 1KC8C 5FLXE 5GAOp 2XTIA 4XU1A 3JCMV 3DSQA 2QI2A 2E6ZA 5GMKh 1W4SA 3E9FA 2L89A 3OSVA 4H2XB 2O4XB 5LJ3d 4H02A 1WU7A 1YFRA 3P8YA 1VQZA 3RIRA 4BI3A 4NS5A 3MF1A 4FM4B 2PMFA 1VQLA 4YRJA 1M90C 1KD1U 3M5AA 1KQSA 3CCEA 2E12A 1D3BB 5DM7R 3OS5A 2R58A 3P8BB 4UC4A 1VQOT 3JCMg 1G3WA 1E1TA 3IALA 2QXFA 3CCMA 4J5YA 1O75A 2CS7A 4EPCA 3JAME 3QXEB 2C8MA 2Y4XA 3HRKA 1VIEA 2X4JA 3V7RA 4JRQA 4RG2A 5CVIA 2RJFA 2D6FA 3RERA 4YYEA 4E51A 3OYCA 1YBYA 4YP0A 2M9UA 2BKDN 1VQ8A 2P0LA 3HPWA 4L87A 2DKGA 2P0PA 4C8QD 3NTKA 3R6OA 3HXZA 4XU3A 1NPRA 1NJ5A 2PMEA 2RM4A 4QQ6A 2XIDA 3E9IA 3I56T 1JB0E 4ZTZB 2IG0A 5C6SA 4P3OA 3A8MB 3FJPA 5GMKe 4P72C 4B9WA 5KNNA 2MAMA 1ZBXA 4XTWA 4M78D 2DDZA 3GOXA 1K8AU 1X6OA 1MHNA 1HC7A 3KBGA 4LDXA 1X55A 1VQNA 1EOVA 2V8JA 1KG1A 4M7AG 3EFRA 4M77G 4P5NA 1QP3A 3OB9A 3CCSA 1YCYA 5HY6A 3AHUA 4EMKC 3HFZB 4YRGA 3L2ZA 2CGHA 3LLRA 4LD9K 1N8RC 3QO5A 3OW2A 4P72A 4JDSA 2R5AA 4F7UB 4RMOA 1KMNA 1UGQB 3GPLA 2J3MA 3OSSC 3JRZA 4OVAA 4ZTUB 1YJWT 1H4TA 1SRYA 4PJOG 4LD6A 2NS6A 2FB7A 4L5GA 4ATOA 4XTXA 5CKDA 4YTLA 3ASKA 2CZ7B 2Q5IA 2E5AA 1SETA 1MGQA 4JS4A 4O5VA 4GLKA 4EMKA 4O2DA 4YDQA 2YRVA 2RHZA 3P8TA 4OB3B 5D6WA 3SWNB 2HNIA 2JNGA 3RMQA 2GQVA 3GF5A 2DD5A 3MCAB 2RD1A 2I4MA 3J7AF 1YITA 2K3XA 4L59A 2YLCA 1SERA 3LGFA 4G84A 1Q7YU 4X34A 4N0AC 1X54A 3VQVA 4BE0A 4C5EA 1QW1A 2CZ0B 2F69A 1W66A 4PLLA 5IAYA 1LOJA 1VQNT 3HXYA 3LC0A 2DEQA 4HCBA 2F5TX 4YRCA 2EQKA 3SD4A 3GNGA 2KDSA 4MZPA 1B7YA 4QVCA 3CCST 3C94A 5CCAA 1TH7A 3RL6A 2Q7EA 1H641 1KQ2A 1G3TA 3CCQT 5K1XA 1EVKA 1QVFA 2EWNA 4JRPA 4M7AD 3IKLA 4BW9A 3M58A 3MEAA 1BI1A 4N0AA 3OS2A 3PZCA 3X26B 1VIFA 4Q5WA 3CMAA 2LTOA 5F5WA 2RB6A 2VV5A 1I4K1 2GFAA 3P8DA 2ODRC 2K5LA 1M1FA 4RQEA 4EX5A 2LRQA 4IUPA 3JCMd 1NJIC 3CCLT 3QJYA 1RIQA 4JS5A 3TU4K 4IUTA 4LDVA 3JCMW 3SB2A 5GANe 1VQMA 2X4XA 3G6EA 5CQYA 2EFIA 2ZZDA 1K73C 3X28B 1Y96A 1M9SA 4J8OA 1VQ5T 2LDMA 5L8RE 1VQKT 3BFMA 4XAXB 4BACA 1YITT 1EIYA 1U1TA 3QYGB 2F5KA 4KBMB 4YRNA 2ZZEA 2JOYA 5GAOq 2V8KA 3MP8A 1I81A 3VJPA 2X4YA 2DJZA 2DXCA 4LVKA 4HWPA 3LWIA 2E70A 2QQRA 2DU7A 3CPFA 2DZCA 3OYYA 1O9SA 3CEYA 4ZN1A 1VQ4A 2DXUA 2ZNJA 1KOGA 4C8QE 4XEMA 2EJ9A 2CJAA 1VQ9T 5CKBA 1R8OB 4BE2A 3OYFA 4ZIBA 4J7FA 1KHIA 4F7UF 3IKMB 1KHCA 3HXWA 4C0GA 1G5VA 1KD1C 3FLGA 2DQ3A 2LCLA 5KCHA 2KVQG 3MHXA 4CH6A 4LDUA 2DVEA 5GMKm 4MDWA 4ELYC 4YRQA 4M78E 2CYZB 1VQ7T 5DLQE 4TQFA 2DTIA 4EMKB 3JB9D 3MQZA 3MO8A 4C8QC 1BKBA 1FXXA 3G6ET 4FT4A 5FRNA 2OTJA 1ADYA 3O8VA 2P4TA 4D6WA 4TVRA 1XTDA 4PNOA 3QG1A 4XU0A 2AKWA 1BIBA 3J81E 2ZCFB 3OYLA 2KAFA 4YRMA 4H2SA 3CC7T 4M78C 4QQDA 3OYNA 2RHYA 1X56A 4C5IA 2K5IA 2QQ9A 1HK9A 1DJ7B 4N4HA 5CR2A 2G3RA 3RESA 4C8QA 3HHTB 4WI1A 3SDZA 1S72A 2XGTA 3NELA 1I8FA 3G1ZA 2MWOA 4A4KA 1B7YB 3CBMA 4BY6C 1NPPA 4C0FA 1XOVA 1V29B 1G51A 4TVYA 3UH0A 1QVPA 5CQXA 2LCCA 3E19A 4CH5A 1VQ6A 4M75D 5C53B 4M78A 4KQEA 3QDRB 4QVDA 2WSEE 5C51B 5HK0A 2MWPA 4HCCA 2ZPFB 3M4GA 3PGGA 2XKOC 3CCVA 3DB4A 5GAN2 5CKFA 5CIUA 3HY1A 3HFNA 2XHCA 5IT9E 3MEYA 1B70A 4Y91A 5GANf 4OP0A 2FYKA 4BWAA 2RA2A 1WPYA 4ZGDB 2RJCA 1Q81U 3JCMP 1SSFA 4J6YA 2QEXA 2QA4A 1M8VA 2DPPB 5FROA 4ZGJB 1N6AA 4EO4A 1Y96B 5CKEA 3RF1A 4OLFA 4X9CA 1BBWA 1W2BS 2HAXA 1NJ2A 3GP8A 2RHIA 3OD1A 4ZTFA 5CKHA 3EAEA 2QQBA 1M1KU 4M7DG 2LQ8A 2ZT8A 5GAN6 3CMET 1EIYB 2DO3A 1WJSA 3G7ZA 4M7AE 1ZHIA 4A54A 4M77E 1QVGS 2DXBA 3HFVA 3QUIA 2R5MA 3A7RA 4WJ3M 3J80E 1WJRA 1AHJB 1Q7YC 3NETA 4BI8B 3PNWC 4JRIA 3RACA 1J5WA 3CC4A 3H6ZA 2E10A 2D9TA 1K9MU 2JUFA 4BI4A 1KQSS 2EJGA 2DU5A 2PVDB 5DLOA 2EYQA 11ASA 3HRUA 2AHJB 4PJOE 3META 4M7AC 3A74A 5ELNA 4ZN3A 1VQ6T 4M77C 2Q7HA 3CCJA 4IUUA 2RHUA 5LJ5e 5GMKj 5GAOl 3LH0A 4CRIA 2ZT7A 1UGRB 1NJ6A 1Q82C 2DQ0A 4BD3A 4O6JA 3TEEA 3OMGA 4OB2B 2AMCA 2EQUA 3QIIA 1N27A 4C92D 2VUBA 2ALYA 2J3LA 1B8AA 4M7AA 5ELOA 2QA4T 4M77A 4ZGEB 4EMHA 2PVOB 1FX7A 5FRMA 4YCUA 3BDLA 2D0QB 2QQSA 3OS0A 2JVVA 5GAN4 2AKWB 4RDXA 2X4WA 5GAOm 5GAMf 1VQLT 3BY7A 3F70A 3QBYA 1JJ2S 3R07A 4E47A 5EG2A 3CCET 3CCRA 2WSCE 1B34A 5GMKi 3CD6A 3CCMT 4PJOA 4C8QB 4RCBA 2RK2A 3M4QA 4M7DD 1WYDA 1GGMA 2DIQA 1FYFA 3L2UA 5A0LA 2HQEA 2ZGWA 3CC4T 3QZ9B 1Y07A 3NENA 4E7JA 2EJFA 2RHSA 1VQ8T 3PFSA 4M78B 3HRSA 4NL3A 5LJ3e 2GCXA 4TTVA 3A8OB 3A5ZA 4K86A 2A7YA 4KUIA 1YB3A 3CCJT 2ARSA 3UPUA 2K57A 3HP9A 2JZ2A 5I2MA 4YROA 4RCCA 1Q86U 4TVWA 2I4LA 3JCMc 1B70B 3RKYA 5GANh 3EFSA 4BY6B 2ZIMA 2O01E 4FT2A 1H4QA 4G85A 3HXVA 3DKMA 4C0DC 3NTIA 2IY5A 2LC4A 2CJBA 3VUZA 3QTCA 1USYC 1G5IA 5FU6C 4M75E 2BUDA 1IL2A 3QO7A 3L2QA 1Z7MA 4BB7A 3OYKA 4K87A 4NL2A 2XDPA 1Q82U 2PUKB 4M77D 2ZPHB 3HY0A 3HRIA 4XTVA 3V8JA 3RKWA 3QJ6A 1YJNA 3HXUA 4YRFA 1SESA 5C52B 5GANj 4XQ3A 3JSCA 3LGLA 1QVFS 2CIMA 2LT4A 4PLIA 1USYA 3NEMA 4M75C 4GY5A 5LJ5f 2YHTA 2E65A 3M57A 4VUBA 4DQ2A 3OY9A 4PJOD 1EVLA 4MZTA 3VYHB 2B8AA 1NZ9A 2KSSA 4P73A 3QYHB 4YRTA 2LVMA 4IURA 4XK8E 4P75A 3C12A 3LSSA 3OYEA 1M1GA 2DTHA 3WVEB 2HD0A 3C95A 3V8KA 4FL6A 2Q5HA 3VU3C 2X35A 3HL8A 3G71A 4HVCA 2L8DA 4KR3A 4E7LA 2AMCB 3VKIA 4H2XA 3OYJA 4UP7A 3P8HA 4M75A 4J83A 3S6WA 4EMGA 2RI5A 5KE3A 2ALYB 1G5HA 4M7AB 4M77B 4N4GA 1ADJA 3UGQA 1Y71A 5CO7A 3M4PA 3OYHA 4R55A 3OA6A 1Q81C 4YRLA 3ZBDA 4OF1A 4H2UA 4J15A 3H8ZA 3UDCA 5GAMh 1BI2A 5LL6S 3OQ5A 5GAN8 4JRKA 3JB9J 4KT0E 2QHTA 2E64A 3L4GA 1M1KC 1XNIA 3M9QA 3X25B 1C0AA 1YHQA 1B34B 3MEUA 4C5HA 4J7IA 1VQPA 5K1PA 1QF6A 3CMAT 3A8HB 2M0OA 4JUVA 4CH4A 4C8QF 1PSEA 3FDRA 1B76A 4HT9A 2VGNA 2XDDA 2DAQA 5KE2A 2E5QA 3V8LA 4PHCA 1X75C 3CXCS 1U1SA 4NOYA 2XD0A 5LJ3f 4C92E 3MEWA 1K9MC 3QSUA 2RHSB 4YCWA 2EIFA 3PCOA 1VQMT 5A0DA 4M78F 3LX7A 4HWOA 4QQGA 3CPWA 4LDYA 1ZQ1A 3OYIA 1BI0A 1QE0A 4LNSA 1N9RA 4IKFA 2C7IA 5GANg 4IUVA 4OB1B 2ZZGA 3T9NA 5GAMj 4J6WA 5GAN5 3NTHA 2LT1A 5HGQA 1WLEA 5FU7C 2G4CA 3G71T 4Q15A 3VUBA 3A5YA 2IVWA 1PYSA 2OTLA 4C92C 2DTOA 1YGBA 5GAMe 2E6NA 2P0KA 3TUPA 4J6XA 5HK3A 4M7DE 1X2HA 3CC2A 5GAN7 1OI1A 3L2VA 2PUOB 3RKXA 2LQKA 3INZA 2JN0A 2IY5B 1N9WA 4F7UG 1VQ4T 4R56A 3CBOA 2DK3A 1QP2A 4CS4A 4CS2A 2QHUA 3CMQA 1YHQT 1YFTA 4C92A 1JJCA 3N5BB 4TQDA 2XDBA 2MI6A 3QHSA 4M7DC 4BDZA 3M55A 4KUDK 3ERRA 3TEHA 4UP8A 4ZTJA 4C0DB 4OGEA 1BYMA 3M53A 4QVZA 2I2LA 3KXTA 2ZPEB 3PIPA 4M78G 2RO0A 5FU6B 5LJ5h 3OBYA 3REUA 2FHDA 3VV0A 1LJOA 3BJUA 4Q6GA 3I56A 3I55A 4P74C 1GXIE 4HT8A 1W2BA 3MP6A 2GFUA 2NLUA 2OTJT 2K5FA 3UFGA 4M7DA 4KULA 3PTAA 1HXDA 4PG3A 2RHXA 1WQ7A 2RH2A 3M54A 1QVGA 1UGPB 1UEBA 4JJNK 2A8EA 2OTLT 3VQXA 4II1A 5AYFA 2V8IA 1Q86C 1PSFA 2CZ6B 2DD4A 4M75B 3PIOA 4A4FA 3L2RA 3DLMA 4P74A 3CC2T 1WGSA 5GAMg 2QHSA 4M7AF 1IREB 4M77F 1S72T 4YRIA 2KK4A 2P0QA 4HWRA 3VQYA 3L2WA 2EL9A 5LJ5j 2XU8A 3LYIA 1YJWA 2EQMA 3E1SA 1EQRA 3BW1A 3L4GB 2YLBA 2QDYB 3JCMX 1ATIA 4UP9A 1EIFA 3A8LB 1E1OA 2VYTA 3SFMA 3M59A 3ICAA 4LVMA 3X24B 3W3SA 4E7KA 3HTZA 2CKKA 3CCVT 4BE1A 3S3NA 4PJOF 3DLLA 3L42A 4XU2A 3UT1A 1NJ1A 3E9HA 4E7HA 4E7IA 1WJQA 3OS1A 2ZT6A 4MZMA 5I2SA 3FEOA 3C4SA 3OBWA 5LJ3h 1UGSB 3QNEA 1XQHA 1H4SA 4A53A 4YPFA 3RGLA 5DY9A 4AH6A 4BDYA 2RJDA 4PJOC 4HT4A 1KQ1A 3I55T 3PCOB 5KH6A 2QEXT 2M1HA 4LVIA 3M4YA 2VXEA 2EAYA 3HKSA 1X01A 2XG8D 1U8RA 2DXTA 2KY9A 4MMLA 3CCUA 1H3ZA 3JCMJ 3TCJA 1JJ2A 1OZ2A 1NJ8A 2I4NA 4UPAA 1PYSB 3JCMf 2PVGB 1IZ6A 5GANd 3GIBA 3A7AA 1ASYA 2ZR2A 4Z02A 2ZPIB 2ZIOA 3CCQA 3V7SA 3S3OA 1RL2A 4P71C 3OYDA 3S3MA 2WACA 3PT9A 1BIAA 2RI2A 3L1AA 3FIFA 4JLIA 4LVLA 2E1HA 3OW2S 5LJ3j 2ZPBB 4XTUA 1OYXA 1X2GA 3PMTA 3VQWA 5FU7B 2ARTA 5CAIA 1YFSA 3P8VA 2P5IA 5IN1A 2PQWA 1N9SA 4YRPA 1KC8U 3UGTA 4C92B 3CCLA 1JJCB 1WNLA 3JB9F 3MP1A 4H2VA 2EQJA 4LDWA 3VBBA 3TEHB 3UWNA 5LJ5g 4P71A 2Y90A 4HA8A 3JB9H 4OGCA 3WQZA 5KCOA 1VQ5A 4K88A 3I7FA 1VQKA 1M90U 5J26A 4PL6A 4N4IA 4XEOA 3A31A 3FC3A 1L0WA 2RHQA 2EKOA 4RKUE 4DOVA 3FB9A 3HSBA 4M7DB 5A0GA 3ZFJA 1NYRA 2ZZFA 3CCUT 4XTYA 3OMCA 4H2YA 5D6YA 2LX9A 4WF2A 4P73C 3HRTA 3CCRT 4C5GA 4IUQA 2VGMA 3CD6T 1P92A 2ZR3A 4P75C 3G4SA 4M75F 12ASA 2C06A 1JRIA 2RK1A 2XICA 5M9OA 1VQ9A 1G3YA 2GF7A 3QPHA 1ASZA 4DPGA 4CH3A 2FVUA 3NFCA 2RI3A 3JB9G 2H3JA 4TVAA 3ER0A 3QO3A 5GAMd 4MDXA 4H2WA 4EDUA 1M4ZA 4BUGA 2VC8A 3OYMA 2FL7A 2K4YA 4YREA 1VQ7A 4OB0B 2QTXA 2R57A 3URGA 5LJ3g 3WVDB 3OYBA 2QQAA 4HWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E10 A;  4EMK A;  4O2D A;  4M7D E;  4YRS A;  4YDQ A;  4XTZ A;  4YRK A;  1X2H A;  5GAN 7;  2EJG A;  3P8T A;  5I21 A;  3SWN B;  2HNI A;  4YRR A;  1SET A;  3RKX A;  1HTT A;  2DU5 A;  11AS A;  3INZ A;  2JN0 A;  2IY5 B;  4PJO E;  4M7A C;  3A74 A;  5ELN A;  1N9W A;  4M77 C;  4F7U G;  3QO8 A;  4KR2 A;  2RD1 A;  1WQW A;  2Q7H A;  2VXF A;  2I4M A;  1D3B A;  5LJ5 e;  5GMK j;  5GAO l;  4MMK A;  1E22 A;  2ZT7 A;  5GMK l;  1NJ6 A;  4CS4 A;  4X9D A;  1JBM A;  2YLC A;  4CS2 A;  4G84 A;  1SER A;  2QHU A;  3CMQ A;  1YFT A;  4C92 A;  4M75 G;  1JJC A;  2DQ0 A;  3IG2 A;  3LSQ A;  4N0A C;  4TQD A;  1X54 A;  3QHS A;  3VQV A;  4M7D C;  3JCM h;  5GAN 3;  1LNX A;  1EFW A;  1W66 A;  3ERR A;  4H2T A;  3TEH A;  1LOJ A;  2ZIN A;  3HXY A;  4UP8 A;  3V7C A;  3LC0 A;  2CJ9 A;  2AMC A;  4F7U E;  2DEQ A;  4PJO B;  2I2L A;  4C92 D;  4YRC A;  4V2S A;  4M78 G;  2ALY A;  1H4V B;  2J3L A;  1B8A A;  4X5O A;  4M7A A;  5ELO A;  1B7Y A;  4M77 A;  4EMH A;  4QVC A;  5LJ5 h;  3REU A;  1TH7 A;  3TEG A;  1LJO A;  3BJU A;  4Q6G A;  4YCU A;  3RL6 A;  2Q7E A;  4P74 C;  1H64 1;  1KQ2 A;  2Q7G A;  4HT8 A;  4TWA A;  5K1X A;  1EVK A;  2I4O A;  2EWN A;  5GAN 4;  2AKW B;  4M7A D;  2ZTG A;  3IKL A;  3MF2 A;  4BW9 A;  4RDX A;  5GAO m;  5GAM f;  4N0A A;  3REX A;  3BY7 A;  3UFG A;  3PZC A;  4M7D A;  5GAO r;  1HXD A;  3R07 A;  1NNH A;  4PG3 A;  5F5W A;  2DZ9 A;  2RB6 A;  4P3P A;  1I4K 1;  1WQ7 A;  1B34 A;  4C92 F;  5GMK i;  5GAO n;  2ODR C;  4RQE A;  4PJO A;  1BBU A;  4EX5 A;  4C8Q B;  2E3C A;  3JCM d;  3VQX A;  4RCB A;  3M4Q A;  4M7D D;  1WYD A;  1GGM A;  1NYQ A;  1FYF A;  1RIQ A;  4M75 B;  2ZGW A;  4YCV A;  3BDU A;  3RUX A;  2ZCE A;  3NEN A;  4P74 A;  3JCM W;  5E3I A;  3SB2 A;  1E24 A;  5GAN e;  4NCX A;  5GAM g;  2QHS A;  4M7A F;  3HXX A;  2EJF A;  4M77 F;  4YRI A;  1Y96 A;  3HFZ A;  5LJ5 d;  2RHS A;  4RMF A;  3JCM e;  4HWR A;  3VQY A;  2QHV A;  4M78 B;  4NL3 A;  3SWN C;  5LJ3 e;  4TTV A;  2EL9 A;  5LJ5 j;  3BFM A;  3A5Z A;  1Z7N A;  4K86 A;  1KMM A;  3JB9 I;  1YB3 A;  2RHQ B;  4F7U A;  2ARS A;  2ZNI A;  4RQF A;  1EQR A;  3BW1 A;  3L4G B;  2YLB A;  1EIY A;  3A7U A;  2K57 A;  1U1T A;  3JCM X;  1ATI A;  4UP9 A;  4M7D F;  4YRO A;  1E1O A;  2E41 A;  4RCC A;  4HWS A;  3ICA A;  3KFU A;  4WJ4 A;  4YRN A;  4C8Q G;  3W3S A;  2ZZE A;  3HTZ A;  4TVW A;  2I4L A;  3JCM c;  1B70 B;  3RKY A;  1M5Q 1;  5GAN h;  5GAO q;  1I81 A;  4PJO F;  2ZT5 A;  4XU2 A;  1NJ1 A;  2ODR D;  3EFS A;  3E9H A;  2DJZ A;  2ZT6 A;  4HWP A;  3JCM b;  2ARU A;  2ZIM A;  4P3N A;  2DU7 A;  3HFO A;  1H4Q A;  4CS3 A;  2DZC A;  5LJ3 h;  3QNE A;  1H4S A;  4G85 A;  4A53 A;  3HXV A;  1I5L A;  4YPF A;  3RGL A;  5DY9 A;  3SWN A;  4AH6 A;  2DXU A;  2ZXF A;  4PJO C;  2ZNJ A;  1KOG A;  1KQ1 A;  3PCO B;  2IY5 A;  2CJB A;  4C8Q E;  4XEM A;  3QTC A;  4C92 G;  1USY C;  2EJ9 A;  1G5I A;  2VXE A;  2CJA A;  4TVA B;  2EAY A;  4M75 E;  4ZIB A;  1X01 A;  1IL2 A;  4F7U F;  3IKM B;  3QO7 A;  1Z7M A;  3HXW A;  2DXT A;  4K87 A;  4MML A;  4NL2 A;  2DQ3 A;  3JCM J;  3A32 A;  4M77 D;  3JCM Q;  4CH6 A;  3HY0 A;  1NJ8 A;  1LYL A;  3HRI A;  2DVE A;  5GMK m;  2I4N A;  4UPA A;  4XTV A;  1PYS B;  4YRQ A;  4M78 E;  3V8J A;  3JCM f;  5GAO p;  2XTI A;  5GAN d;  4XU1 A;  3RKW A;  3GIB A;  3JCM V;  3A7A A;  3HXU A;  4TQF A;  1ASY A;  3DSQ A;  2DTI A;  4YRF A;  4EMK B;  3JB9 D;  1SES A;  5C52 B;  2ZR2 A;  5GAN j;  4C8Q C;  4XQ3 A;  5GMK h;  2ZIO A;  2CIM A;  3V7S A;  4H2X B;  4P71 C;  5LJ3 d;  4H02 A;  1WU7 A;  1USY A;  3NEM A;  4M75 C;  1YFR A;  3P8Y A;  1VQZ A;  3RIR A;  1BIA A;  3L1A A;  3FIF A;  4JLI A;  5LJ5 f;  1ADY A;  3MF1 A;  2E1H A;  2PMF A;  2YHT A;  5LJ3 j;  2E65 A;  4XTU A;  4DQ2 A;  4PJO D;  1EVL A;  4YRJ A;  1X2G A;  4PNO A;  4XU0 A;  2AKW A;  1BIB A;  4P73 A;  4YRT A;  1D3B B;  3VQW A;  3JCM g;  1E1T A;  4YRM A;  2ART A;  3IAL A;  4H2S A;  5CAI A;  1YFS A;  3P8V A;  4M78 C;  2P5I A;  4P75 A;  4J5Y A;  1N9S A;  3LSS A;  4YRP A;  2DTH A;  3UGT A;  4C92 B;  1X56 A;  1JJC B;  1WNL A;  3V8K A;  1HK9 A;  2Q5H A;  3JB9 F;  3VU3 C;  4HVC A;  4H2V A;  2C8M A;  3VBB A;  3HRK A;  4KR3 A;  3RES A;  3TEH B;  4C8Q A;  3V7R A;  2AMC B;  5LJ5 g;  4H2X A;  4P71 A;  3RER A;  4UP7 A;  4WI1 A;  2Y90 A;  4M75 A;  2XGT A;  3NEL A;  4YYE A;  4HA8 A;  3JB9 H;  4E51 A;  4EMG A;  1I8F A;  4YP0 A;  3G1Z A;  2ALY B;  3WQZ A;  1G5H A;  4M7A B;  4K88 A;  2P0L A;  1B7Y B;  3I7F A;  4M77 B;  1ADJ A;  3UGQ A;  4L87 A;  2DKG A;  4C8Q D;  3M4P A;  1G51 A;  4TVY A;  3UH0 A;  4YRL A;  4CH5 A;  4M75 D;  3HXZ A;  4XU3 A;  5C53 B;  4XEO A;  4M78 A;  4KQE A;  1NJ5 A;  4H2U A;  4J15 A;  2PME A;  2RM4 A;  4QVD A;  3A31 A;  5GAM h;  1L0W A;  3E9I A;  2RHQ A;  5GAN 8;  5C51 B;  4JRK A;  3JB9 J;  2QHT A;  4ZTZ B;  2E64 A;  3L4G A;  3FB9 A;  3HSB A;  4M7D B;  3M4G A;  3PGG A;  4P3O A;  3FJP A;  5GMK e;  4P72 C;  1C0A A;  5KNN A;  1NYR A;  5GAN 2;  2ZZF A;  1B34 B;  4XTW A;  4XTY A;  4M78 D;  2DDZ A;  3HFN A;  3HY1 A;  3MEY A;  5K1P A;  1B70 A;  1HC7 A;  4H2Y A;  1QF6 A;  4Y91 A;  1X55 A;  4WF2 A;  4P73 C;  4JUV A;  1EOV A;  5GAN f;  4CH4 A;  4OP0 A;  4C8Q F;  2FYK A;  4BWA A;  1B76 A;  2RA2 A;  4HT9 A;  4HWT A;  2ZR3 A;  4P75 C;  4M7A G;  1WPY A;  3EFR A;  3V8L A;  4M75 F;  3JCM P;  12AS A;  4M77 G;  4PHC A;  4J6Y A;  1M8V A;  1JRI A;  1U1S A;  4NOY A;  5LJ3 f;  1YCY A;  4C92 E;  4EO4 A;  1Y96 B;  3AHU A;  3RF1 A;  4EMK C;  3HFZ B;  4YRG A;  3QSU A;  2RHS B;  4OLF A;  4X9C A;  1BBW A;  1ASZ A;  4YCW A;  3L2Z A;  2CGH A;  1NJ2 A;  3OD1 A;  4DPG A;  4CH3 A;  3PCO A;  3JB9 G;  3QO5 A;  4P72 A;  4M78 F;  4TVA A;  4F7U B;  1KMN A;  4HWO A;  4M7D G;  3QO3 A;  2ZT8 A;  5GAM d;  5GAN 6;  1QE0 A;  4LNS A;  1N9R A;  2C7I A;  1EIY B;  4H2W A;  5GAN g;  4M7A E;  2VC8 A;  2ZZG A;  4A54 A;  4M77 E;  2J3M A;  5GAM j;  4YRE A;  4ZTU B;  3HFV A;  4J6W A;  5GAN 5;  1H4T A;  3QUI A;  1SRY A;  4PJO G;  5HGQ A;  1WLE A;  2G4C A;  2FB7 A;  3A7R A;  2QTX A;  4Q15 A;  4WJ3 M;  3A5Y A;  5LJ3 g;  4XTX A;  1PYS A;  3NET A;  4C92 C;  4JRI A;  2DTO A;  1YGB A;  5GAM e;  3RAC A;  1J5W A;  3TUP A;  2Q5I A;  4J6X A;  2E5A A;  1MGQ A; 
#chains in the Genus database with same CATH topology
 1D0Y A;  4YRS A;  1YI2 A;  4XTZ A;  4YRK A;  1U3O A;  1N8R U;  3MEV A;  2O4X A;  4L6V 5;  5I21 A;  2L2P A;  4YRR A;  1IHV A;  1G2B A;  3E9G A;  1HTT A;  2EKH A;  1FMV A;  1VQ4 Q;  3CC7 A;  2L5Q A;  1Y7X A;  4DBF A;  3QO8 A;  4KR2 A;  3M56 A;  3EFO B;  1WQW A;  2OI3 A;  1AEY A;  2K2V A;  3PMI A;  2VXF A;  2KR3 A;  1D3B A;  1YHQ Q;  3ZL7 C;  2O88 A;  4A4H A;  1VYU A;  4MMK A;  3ME9 A;  5J3B A;  1E22 A;  2DJQ A;  5GMK l;  4X9D A;  1JBM A;  3CXC P;  2M16 A;  3WXM B;  1YIJ A;  2M02 A;  3Q1J A;  4M75 G;  1OZ3 A;  4E2F B;  3IG2 A;  3LSQ A;  2PU9 B;  3JCM h;  3OYA A;  5GAN 3;  1LNX A;  3VYG A;  1IGQ A;  2Y4Y A;  1EFW A;  2KRS A;  4H2T A;  4QW2 A;  2LQN A;  2ZIN A;  4LVJ A;  3V7C A;  2CJ9 A;  4F7U E;  1BI3 A;  3TRE A;  1YJ9 A;  1PNJ A;  2ZAE A;  5D6X A;  1G3S A;  5CK9 A;  4PJO B;  2QAS A;  4HCZ A;  4V2S A;  3G4S T;  1MMN A;  2AZS A;  3GNF B;  1H4V B;  2RJE A;  4X5O A;  4F04 B;  3LW5 E;  1YJN T;  3TVT A;  3CXC A;  3TEG A;  2ZPG B;  4HCK A;  1KK7 A;  2LMJ A;  3LWH A;  1IHW A;  2JTM A;  2Q7G A;  1AWW A;  2HQX A;  4TWA A;  4PKC C;  2MMP A;  2RQV A;  2HEQ A;  2I4O A;  2ZTG A;  3MF2 A;  1RI0 A;  1Y57 A;  1ABQ A;  1PKS A;  3REX A;  4A4G A;  2A08 A;  5GAO r;  4OMF B;  3A5Z B;  5A2Q E;  1NNH A;  2DZ9 A;  4P3P A;  4CC3 A;  3FRN A;  1J3T A;  4FSX A;  2OTL Q;  4C92 F;  5GAO n;  4GLM A;  4J9G A;  3KUF A;  1OX9 A;  1BBU A;  2BIV A;  5J39 A;  2E3C A;  2JJ9 A;  2WSF E;  4X1V A;  1NYQ A;  2C0T A;  3DB3 A;  3CC2 Q;  4J9D A;  4YCV A;  1OEB A;  3A8G B;  3BDU A;  3RUX A;  4B9X A;  1T3S A;  2ZCE A;  1YI2 T;  2YUO A;  5E3I A;  1SHG A;  1E24 A;  2KEA A;  4NCX A;  3CPW S;  3HXX A;  4DEX A;  3QKJ A;  3GLX A;  3QZ5 B;  4C0Z A;  3HFZ A;  5LJ5 d;  3VS7 A;  4RMF A;  1UB4 A;  3CME A;  3JCM e;  3OYG A;  2YUN A;  2QHV A;  2ABL A;  4ELZ C;  3SWN C;  2A3L A;  2YT6 A;  2NWM A;  1Z7N A;  1KMM A;  3JB9 I;  2EBP A;  2RHQ B;  4J9C A;  4F7U A;  1VQO A;  2ZNI A;  4RQF A;  2X9H A;  2DIG A;  3A7U A;  3X20 B;  2XI9 A;  2DA9 A;  4M7D F;  2CZ1 B;  2KRO A;  2GNC A;  4DA4 A;  4AFQ C;  1NJI U;  1YIJ T;  2K3Y A;  2E41 A;  1HSQ A;  3HTR A;  4HWS A;  2J6F A;  4DOW A;  3KFU A;  4WJ4 A;  3EGX A;  4Z8A A;  1Q81 R;  1K8A C;  4C8Q G;  1M5Q 1;  2LNV A;  3QWY A;  4PJN A;  2L3R A;  2ZT5 A;  2ODR D;  1SF9 A;  3VS4 A;  2PNI A;  1K73 U;  3JCM b;  2ARU A;  1YJ9 T;  2KQW A;  4JLG A;  4P3N A;  2Z0W A;  1VQP T;  3HFO A;  4RG8 A;  4CS3 A;  4FIB A;  2KMT A;  5HKC A;  4Y28 E;  4DEY A;  4ME7 A;  3I55 Q;  1WHM A;  1I5L A;  2OAU A;  3EG9 A;  3SWN A;  2ZXF A;  4CI0 C;  4J9F A;  3CBP A;  1X2Q A;  4HKE A;  5C0M A;  3REA B;  2MF2 A;  1WXB A;  1NE8 A;  2JTF A;  2FPE A;  4C92 G;  1VUB A;  2HBP A;  4TVA B;  2VWF A;  3RMS A;  3ZEH A;  4Z89 A;  1EFN A;  2D1X A;  2DBK A;  1T0H A;  2XK0 A;  2QK0 A;  4KRT A;  2VB6 A;  4A4E A;  3A32 A;  4KH1 B;  3JCM Q;  3MJX A;  2J6K A;  4LE9 A;  1LYL A;  1RLQ C;  1FWZ A;  4FU6 A;  1KC8 C;  5FLX E;  5GAO p;  2XTI A;  4XU1 A;  3JCM V;  1ZBJ A;  1MMA A;  3DSQ A;  2VKN A;  3NHN A;  2QI2 A;  2E6Z A;  1PRL C;  4EIK A;  2QGF B;  1OPK A;  2ED0 A;  5GMK h;  1KIK A;  1W4S A;  3E9F A;  2L89 A;  3OSV A;  4H2X B;  2O4X B;  5LJ3 d;  4H02 A;  1WU7 A;  1YFR A;  3P8Y A;  1VQZ A;  3RIR A;  2FG0 A;  4BI3 A;  4NS5 A;  3MF1 A;  4FM4 B;  4OMM A;  2PMF A;  1VQL A;  1YJW Q;  3D7S B;  2HSE B;  4YRJ A;  1M90 C;  1KD1 U;  3M5A A;  2RF0 A;  1KQS A;  3CCE A;  1TUC A;  2E12 A;  2IIM A;  3EGD A;  1D3B B;  5DM7 R;  3OS5 A;  2R58 A;  3P8B B;  4UC4 A;  1VQO T;  3JCM g;  1G3W A;  1X6B A;  1E1T A;  3IAL A;  1OU8 A;  2QXF A;  3CCM A;  2YXY A;  4J5Y A;  1O75 A;  2CS7 A;  4FYW B;  1JU5 C;  4EPC A;  3JAM E;  3QXE B;  1SRM A;  2C8M A;  2Y4X A;  3HRK A;  3VS2 A;  1VIE A;  2X4J A;  3V7R A;  4JRQ A;  2LNH B;  4RG2 A;  2RPN A;  2H8H A;  5CVI A;  1WXT A;  2RJF A;  2O9V A;  2D6F A;  3RER A;  4YYE A;  4E51 A;  3OYC A;  1YBY A;  4YP0 A;  1QQJ A;  2BKD N;  1WFW A;  2J05 A;  2JS2 A;  2M9U A;  1ZSZ C;  1VQ8 A;  2P0L A;  3HPW A;  3PE0 A;  4L87 A;  2DKG A;  2P0P A;  1WHH A;  4C8Q D;  2CP6 A;  3NTK A;  2DVJ A;  3R6O A;  3HXZ A;  4XU3 A;  1NPR A;  1ZA2 B;  1NJ5 A;  2PME A;  2RM4 A;  4QQ6 A;  1I5O B;  4JJD A;  2XID A;  3E9I A;  4PJM A;  3I56 T;  1JB0 E;  4ZTZ B;  3CCU Q;  1EZZ B;  1WHJ A;  2IG0 A;  5C6S A;  4P3O A;  3A8M B;  3FJP A;  5GMK e;  4P72 C;  4B9W A;  4PJJ A;  2DIL A;  5KNN A;  2MAM A;  1ZBX A;  4XTW A;  4M78 D;  2DDZ A;  3O5Z A;  3GOX A;  1K8A U;  1X6O A;  1MHN A;  2DYI A;  1WDX A;  1TWB A;  3OW2 P;  1HC7 A;  3KBG A;  4LDX A;  1X55 A;  1ZSZ A;  1VQN A;  1PKT A;  1EOV A;  2V8J A;  1KG1 A;  4QT7 A;  4CC2 A;  1E6G A;  1SG5 A;  4HWT A;  2NUP B;  4M7A G;  3EFR A;  4M77 G;  4P5N A;  1QP3 A;  3OB9 A;  2YSQ A;  3CCS A;  1YCY A;  5IHI A;  5EC7 A;  5HY6 A;  3AHU A;  4EMK C;  3HFZ B;  4YRG A;  4RTT A;  3L2Z A;  2CGH A;  1M2V A;  3LLR A;  4LD9 K;  1N8R C;  3QO5 A;  3MPU B;  1I0C A;  3OW2 A;  3PVL A;  4P72 A;  1Q86 R;  2RQR A;  4JDS A;  2R5A A;  4F7U B;  4RMO A;  1YNZ A;  1KMN A;  3VS1 A;  2KXD A;  1UGQ B;  3GPL A;  2BZY A;  2P4R A;  2DER A;  1Z9Z A;  1Q7Y R;  2VVK A;  2CH4 W;  2J3M A;  3OSS C;  2DEU A;  3JRZ A;  4OVA A;  4ZTU B;  4AT1 B;  2ENM A;  1YJW T;  1H4T A;  1SRY A;  4PJO G;  3EGX B;  3I35 A;  4LD6 A;  2NS6 A;  2FB7 A;  1OX8 A;  4L5G A;  4ATO A;  1K0S A;  4XTX A;  5CKD A;  1AWO A;  4YTL A;  3M0Q A;  3ASK A;  2CZ7 B;  2Q5I A;  2L3P A;  2E5A A;  1MGQ A;  1SET A;  4JS4 A;  4O5V A;  4GLK A;  4EMK A;  1VQK Q;  4O2D A;  4YDQ A;  3NPF A;  2YRV A;  1ZUU A;  2ROT A;  2RHZ A;  3P8T A;  4OB3 B;  3EG9 B;  5D6W A;  3SWN B;  2HNI A;  2F1L A;  2JNG A;  3RMQ A;  2GQV A;  3LH5 A;  3GF5 A;  1C0M A;  2DD5 A;  1IRX A;  2EVR A;  3MCA B;  4RUG A;  1Q82 R;  2EPD A;  2RD1 A;  1PC0 A;  2FZG B;  2ED1 A;  3J7A F;  2I4M A;  1YIT A;  1HJD A;  2MYS A;  2K3X A;  3MKD A;  4L59 A;  1YP5 A;  2YLC A;  1SER A;  3LGF A;  4G84 A;  1Q7Y U;  4X34 A;  4N0A C;  1X54 A;  2MIO A;  3G1J A;  3VQV A;  4BE0 A;  1RAH B;  4C5E A;  2PZ1 A;  2L3S A;  1QW1 A;  1GFC A;  2CZ0 B;  2F69 A;  1W66 A;  4PLL A;  5IAY A;  1QLY A;  4AFZ C;  1LOJ A;  2QGG A;  5IHK A;  3G4S Q;  1VQN T;  3HXY A;  3LC0 A;  4E6R A;  1HD3 A;  2DEQ A;  4HCB A;  1AZG B;  1BCO A;  2F5T X;  4YRC A;  2EQK A;  3SD4 A;  3GNG A;  1VQ9 Q;  1SSH A;  4J9B A;  1JQQ A;  2AZV A;  2KDS A;  4MZP A;  1E7O A;  4D8K A;  1B7Y A;  2RQU A;  4QVC A;  3CCS T;  3C94 A;  5CCA A;  1B3Q A;  2YRC A;  1TH7 A;  2KYM A;  5FWB A;  3RL6 A;  2KBT A;  2Q7E A;  2LZ6 B;  1H64 1;  1KQ2 A;  2COY A;  1G3T A;  4OMQ A;  3CCQ T;  5K1X A;  2FO0 A;  1EVK A;  1QVF A;  4DBH A;  2EWN A;  4Z88 A;  4JRP A;  3EGD B;  4M7A D;  3IKL A;  4BW9 A;  2CUD A;  3M58 A;  3MEA A;  1BI1 A;  4N0A A;  3OS2 A;  3PZC A;  3X26 B;  1VIF A;  3H9N A;  4Q5W A;  3CMA A;  2LTO A;  3EG1 A;  5F5W A;  2RB6 A;  2VV5 A;  1I4K 1;  2IPO B;  1KJW A;  2A37 A;  5D7U A;  2GFA A;  3P8D A;  2X3W D;  2ODR C;  2K5L A;  1M1F A;  2AIR B;  4RQE A;  4EX5 A;  1R0C B;  2LRQ A;  4IUP A;  3JCM d;  1NJI C;  1MV3 A;  3CCL T;  3M0U A;  3QJY A;  6AT1 B;  1YI2 Q;  1RIQ A;  2J7I A;  4JS5 A;  3TU4 K;  4IUT A;  4LDV A;  1JO8 A;  3JCM W;  1X69 A;  3SB2 A;  1QMC A;  5GAN e;  2X4X A;  1VQM A;  3G6E A;  1SKU B;  2EFI A;  2ZZD A;  5CQY A;  1K73 C;  3X28 B;  1Y96 A;  1AD5 A;  1M9S A;  4J8O A;  1VQ5 T;  2LDM A;  5L8R E;  1ZA1 B;  2MOX A;  2E5K A;  1VQK T;  3BFM A;  4GBQ A;  4XAX B;  4BAC A;  1NBE B;  1YIJ Q;  1YIT T;  2YUQ A;  1EIY A;  1U1T A;  3QYG B;  2L0A A;  1H8K A;  2F5K A;  1YFN A;  4KBM B;  4YRN A;  2GBQ A;  1M8M A;  2ZZE A;  2JOY A;  1WHK A;  5GAO q;  1RLP C;  2V8K A;  3BE3 A;  1AWJ A;  1I81 A;  1ZSZ B;  3MP8 A;  3VJP A;  1YJ9 Q;  1WHL A;  2CSI A;  1VQP Q;  2X4Y A;  4ORZ A;  2DJZ A;  1H92 A;  2DXC A;  4LVK A;  4HWP A;  3LWI A;  2E70 A;  2SEM A;  2QQR A;  2DU7 A;  3CPF A;  2K6D A;  2DZC A;  3OYY A;  1O9S A;  1K76 A;  3CEY A;  3U23 A;  4ZN1 A;  1VQ4 A;  2DXU A;  2EYX A;  2ZNJ A;  1KOG A;  1SEM A;  1M2V B;  4C8Q E;  2CUB A;  4AFS C;  4XEM A;  2EJ9 A;  2CJA A;  1VQ9 T;  5CKB A;  1R8O B;  2O9S A;  4BE2 A;  3OYF A;  4ZIB A;  2EGE A;  4J7F A;  2J06 A;  1KHI A;  3CQT A;  2OAW A;  4F7U F;  3IKM B;  1KHC A;  3HXW A;  4C0G A;  1G5V A;  1KD1 C;  4ZNX A;  3FLG A;  2DQ3 A;  3CPW P;  2LCL A;  5KCH A;  2KVQ G;  3MHX A;  4CH6 A;  3R6N A;  4LDU A;  2DVE A;  2CP7 A;  5GMK m;  4MDW A;  4ELY C;  4YRQ A;  1FMW A;  4M78 E;  2KE9 A;  2CYZ B;  5IHN A;  1VQ7 T;  5DLQ E;  4TQF A;  2DTI A;  2MCN A;  4EMK B;  3JB9 D;  3MQZ A;  3MO8 A;  4C8Q C;  1BKB A;  1FXX A;  2CH4 A;  3G6E T;  4FT4 A;  3CME Q;  5FRN A;  4RTU A;  2OTJ A;  2O2O A;  1ADY A;  4HVU A;  3O8V A;  1RAD B;  1TG0 A;  2P4T A;  1TXQ A;  1VQO Q;  4D6W A;  4TVR A;  1XTD A;  4PNO A;  2F2V A;  3QG1 A;  4XU0 A;  1ZX6 A;  2AKW A;  1BIB A;  2KNB B;  1G83 A;  3J81 E;  2ZCF B;  3OYL A;  2KAF A;  4YRM A;  4H2S A;  3CC7 T;  4M78 C;  4QQD A;  1FMK A;  3OYN A;  4AG1 C;  2X51 A;  2RHY A;  1X56 A;  4C5I A;  2K5I A;  2QQ9 A;  1HK9 A;  1DJ7 B;  4E7Z A;  4IIM A;  4N4H A;  5CR2 A;  1BU1 A;  1WXU A;  2G3R A;  3RES A;  2D0N A;  4C8Q A;  4PK4 A;  3VS0 A;  4JPB W;  1QCF A;  3HHT B;  2NUZ A;  4F14 A;  4WI1 A;  3SDZ A;  1S72 A;  2XGT A;  3NEL A;  2DRK A;  1I8F A;  2QYZ A;  3G1Z A;  2MWO A;  4A4K A;  2DRM A;  1QKW A;  1B7Y B;  3CBM A;  4BY6 C;  1NPP A;  2LP5 A;  4C0F A;  1XOV A;  1V29 B;  1G51 A;  4TVY A;  2HKQ B;  3UH0 A;  2DFU A;  1M1K R;  1QVP A;  5CQX A;  1AOJ A;  2LCC A;  3E19 A;  4CH5 A;  1VQ6 A;  4M75 D;  3I56 Q;  5C53 B;  4M78 A;  4KQE A;  3QDR B;  4QVD A;  1V76 A;  2WSE E;  5C51 B;  5HK0 A;  2DL5 A;  2MWP A;  4HCC A;  2CP0 A;  2O31 A;  1WLP B;  2ZPF B;  3M4G A;  3PGG A;  2XKO C;  3CCV A;  3DB4 A;  5GAN 2;  5CKF A;  5CIU A;  1PHT A;  3HY1 A;  3HFN A;  2A0F B;  2XHC A;  5IT9 E;  3MEY A;  2XMF A;  5IXB A;  1B70 A;  1PG5 B;  4Y91 A;  3NGP A;  4D8D A;  5GAN f;  4OP0 A;  2FYK A;  4BWA A;  1WA7 A;  2RA2 A;  1TS9 A;  1K9M R;  1WPY A;  2V1R A;  4ZGD B;  2RJC A;  1Q81 U;  3JCM P;  1SSF A;  4J6Y A;  2J6O A;  1K0X A;  2QEX A;  2QA4 A;  2JXB A;  1M8V A;  2DPP B;  5FRO A;  1WIE A;  4ZGJ B;  3VS5 A;  1N6A A;  4EO4 A;  1Y96 B;  5CKE A;  3RF1 A;  4K11 A;  1UUE A;  1QCO A;  3A1P A;  4OLF A;  3I5S A;  4X9C A;  1BBW A;  1W2B S;  2HAX A;  1NJ2 A;  3GP8 A;  2RHI A;  3OD1 A;  2DL3 A;  3CCE Q;  4ZTF A;  5CKH A;  1UE9 A;  3EAE A;  2QQB A;  4CC7 A;  1M1K U;  2FEI A;  1VYT A;  3CCM Q;  1UGV A;  1SRL A;  4M7D G;  2LQ8 A;  2ZT8 A;  5GAN 6;  3CME T;  1EIY B;  2DO3 A;  2YUP A;  2CT3 A;  3KFV A;  1WJS A;  3G7Z A;  2FRY A;  4M7A E;  1ZHI A;  2JMC A;  4A54 A;  4M77 E;  1QVG S;  2DXB A;  1RAA B;  3HFV A;  4ESR A;  3QUI A;  2R5M A;  3A7R A;  4WJ3 M;  2YRD A;  3J80 E;  2FZC B;  1WJR A;  1AHJ B;  1Q7Y C;  3NET A;  2LJ0 A;  4BI8 B;  3M0S A;  3PNW C;  4JRI A;  2KYB A;  3RAC A;  2NUT A;  1J5W A;  3CC4 A;  3H6Z A;  2E10 A;  2D9T A;  1K9M U;  1ZUY A;  2CRE A;  2JUF A;  4BI4 A;  1KQS S;  2EJG A;  2EGA A;  3JV3 A;  1UJ0 A;  2DU5 A;  2PVD B;  3NMZ C;  5DLO A;  1IGU A;  2EYQ A;  11AS A;  3HRU A;  2AHJ B;  1OUL A;  4PJO E;  3MET A;  2DNU A;  1R0B G;  4M7A C;  3A74 A;  5ELN A;  1TUG B;  4ZN3 A;  1VQ6 T;  4M77 C;  1M30 A;  2Q7H A;  1YN8 A;  3CCJ A;  4IUU A;  2RHU A;  5LJ5 e;  3E2U A;  3EH2 A;  5GMK j;  5GAO l;  3LH0 A;  4CRI A;  1VOM A;  2ZT7 A;  1PCX A;  1UGR B;  1NJ6 A;  1Q82 C;  1ZLM A;  1LCK A;  2DQ0 A;  4BD3 A;  2A28 A;  1VQN Q;  4O6J A;  2MPX C;  3TEE A;  2G6F X;  3OMG A;  2C0O A;  4LXC A;  4OB2 B;  2DE0 X;  4QKU A;  2AMC A;  2EQU A;  3QII A;  1BK2 A;  5IH2 A;  4HXJ A;  1N27 A;  1T3L A;  4C92 D;  2VUB A;  3CCS Q;  2QAZ A;  2ALY A;  2ESW A;  2J3L A;  1B8A A;  4M7A A;  5ELO A;  2QA4 T;  1M2O A;  1CKA A;  4M77 A;  4ZGE B;  2I0N A;  4EMH A;  2PVO B;  4Y92 A;  1FX7 A;  3CCQ Q;  2V26 A;  5FRM A;  3RDV A;  4YCU A;  3BDL A;  1UFF A;  1C1A A;  2D0Q B;  2QQS A;  3OS0 A;  2JVV A;  2B86 A;  1K4U S;  1WHG A;  5GAN 4;  2AKW B;  4ANJ A;  2X4W A;  4RDX A;  5GAO m;  5GAM f;  5KYX A;  1X2K A;  1VQL T;  4LNP A;  2JT4 A;  3BY7 A;  3F70 A;  4OMO A;  3QBY A;  1RAI B;  1JJ2 S;  3R07 A;  1QCN A;  4E47 A;  2COZ A;  5EG2 A;  3CCE T;  4FW1 A;  2JMA A;  2BTT A;  3EHR A;  3CCR A;  2WSC E;  1B34 A;  2KRM A;  3UA6 A;  4PFO A;  3M0P A;  3CCL Q;  2DMO A;  5GMK i;  3CD6 A;  3CCM T;  4PJO A;  4JJB A;  4C8Q B;  1E6H A;  1M90 R;  4RCB A;  2RK2 A;  3M4Q A;  4M7D D;  1WYD A;  1GGM A;  3RR6 A;  2DIQ A;  1FYF A;  3L2U A;  5A0L A;  2HQE A;  2ZGW A;  3CC4 T;  1B7T A;  3QZ9 B;  1D0Z A;  1IXD A;  2LCS A;  1Y07 A;  1I1J A;  2DLP A;  3NEN A;  2F2W A;  2RMO A;  4E7J A;  1A0N B;  2W0Z A;  1VQ5 Q;  1BCM A;  2HL5 C;  2EJF A;  1G8X A;  4LN2 A;  4LUD A;  2RHS A;  1ABO A;  1VQ8 T;  3PFS A;  4M78 B;  3HRS A;  4NL3 A;  1R77 A;  1YIT Q;  5LJ3 e;  2GCX A;  4TTV A;  3A8O B;  3A5Z A;  1MMD A;  4K86 A;  2A7Y A;  4KUI A;  1YB3 A;  3CCJ T;  2ARS A;  1K9A A;  3UPU A;  2K57 A;  3HP9 A;  2JZ2 A;  2GGR A;  5I2M A;  1KSW A;  4YRO A;  4RCC A;  1Q86 U;  5KYY A;  2GTJ A;  4RTZ A;  2RQT A;  3VS6 A;  4TVW A;  2I4L A;  3JCM c;  1B70 B;  3RKY A;  1QKX A;  5GAN h;  4RTW A;  3EFS A;  4JZ3 A;  4BY6 B;  2LJ1 A;  1MUZ A;  2ZIM A;  2O01 E;  4FT2 A;  1H4Q A;  1NEG A;  3H0F A;  5IXF A;  4G85 A;  4B6M A;  3HXV A;  2HL3 A;  3DKM A;  4C0D C;  2RNA A;  3NTI A;  2JS0 A;  4AFU C;  1JEG A;  2M51 A;  2IY5 A;  2LC4 A;  2CJB A;  3VUZ A;  1N5Z A;  3QTC A;  1USY C;  1G5I A;  5FU6 C;  5KYN A;  2RN8 A;  4M75 E;  3CMA Q;  2BUD A;  2ATC B;  1IL2 A;  3QO7 A;  3L2Q A;  5FW9 A;  1Z7M A;  2KRN A;  1Y0M A;  4BB7 A;  3OYK A;  2HCK A;  4K87 A;  4NL2 A;  2XDP A;  1Q82 U;  2PUK B;  4M77 D;  2ZPH B;  3HY0 A;  1BBZ A;  1VA7 A;  3HRI A;  1VQ7 Q;  3FJ5 A;  4XTV A;  1N8R R;  3V8J A;  1ZSG A;  3RKW A;  3QJ6 A;  1YJN A;  3HXU A;  1TTH B;  2NUT B;  1AVZ C;  4WCI A;  4YRF A;  1SES A;  4F16 A;  3G6E Q;  2V1Q A;  5C52 B;  5GAN j;  4XQ3 A;  3JSC A;  3LGL A;  1QVF S;  2CIM A;  2LT4 A;  4PLI A;  2CP5 A;  1USY A;  3NEM A;  4M75 C;  1JXO A;  4GY5 A;  2F2X A;  4F17 A;  5LJ5 f;  1AT1 B;  1SPK A;  2YHT A;  1OPL A;  2E65 A;  1MND A;  3M57 A;  4VUB A;  4DQ2 A;  3OY9 A;  4PJO D;  1EVL A;  4MZT A;  3CC7 Q;  3VYH B;  2B8A A;  1NZ9 A;  2BE9 B;  2KSS A;  4P73 A;  3QYH B;  4YRT A;  1UDL A;  1V1C A;  2LVM A;  3REB B;  4IUR A;  4XK8 E;  4P75 A;  3C12 A;  3RBB B;  2RQW A;  3LSS A;  3OYE A;  1M1G A;  2DTH A;  3WVE B;  2HD0 A;  3SEM A;  3C95 A;  3V8K A;  4FYY B;  4FL6 A;  4OMP A;  1JXM A;  2Q5H A;  3VU3 C;  2X35 A;  3HL8 A;  2CP2 A;  3G71 A;  4HVC A;  2L8D A;  1NYF A;  3EHQ A;  1TSF A;  4KR3 A;  2YDL A;  2GQI A;  4E7L A;  8AT1 B;  2AMC B;  2A36 A;  3VKI A;  4H2X A;  3OYJ A;  4UP7 A;  4KGZ B;  3P8H A;  2LJ3 A;  4M75 A;  4J83 A;  3S6W A;  4EMG A;  2RI5 A;  2JM9 A;  5KE3 A;  2ALY B;  3VRY A;  1G5H A;  4M7A B;  4M77 B;  4N4G A;  1ADJ A;  3UGQ A;  1Y71 A;  2EW3 A;  5CO7 A;  3M4P A;  3QDF A;  3OYH A;  4R55 A;  4JZ4 A;  3OA6 A;  1Q81 C;  3PVQ A;  3EGU A;  4YRL A;  2MK5 A;  3ZBD A;  1UTI A;  1S1N A;  4OF1 A;  5GJV B;  4H2U A;  4J15 A;  3H8Z A;  3UDC A;  1OQK A;  5GAM h;  1BI2 A;  1YCS B;  2HKN A;  5LL6 S;  3OQ5 A;  1OV3 A;  5GAN 8;  5KYX B;  4JRK A;  4RTY A;  3JB9 J;  4KT0 E;  2QHT A;  2E64 A;  3L4G A;  1M1K C;  1XNI A;  1TOV A;  3M9Q A;  2BE7 D;  3X25 B;  1C0A A;  1NLO C;  1YHQ A;  1B34 B;  2DX1 A;  3MEU A;  3UAT A;  4C5H A;  4J7I A;  4R0K A;  1VQP A;  2DL7 A;  1IB8 A;  5K1P A;  1QF6 A;  3CMA T;  1GL5 A;  3A8H B;  2M0O A;  5KYW A;  4JUV A;  4CH4 A;  4C8Q F;  1PSE A;  3FDR A;  4PFP A;  4HT9 A;  1B76 A;  2VGN A;  2XDD A;  2QG9 B;  1QWF A;  2DAQ A;  5KE2 A;  2E5Q A;  3V8L A;  2AT1 B;  4PHC A;  1X75 C;  3CXC S;  2OTJ Q;  1U1S A;  4NOY A;  2XD0 A;  1NLP C;  5LJ3 f;  4WTO B;  4C92 E;  2D8J A;  3MEW A;  1K1Z A;  1K9M C;  5GJW B;  3QSU A;  2RHS B;  4YCW A;  1B07 A;  2EIF A;  2EGC A;  3PCO A;  1RUW A;  1VQM T;  1WX6 A;  1NJI R;  5A0D A;  4M78 F;  3LX7 A;  4HWO A;  4QQG A;  3CPW A;  4LDY A;  1ZQ1 A;  3OYI A;  1BI0 A;  1QE0 A;  4LNS A;  1N9R A;  4IKF A;  2C7I A;  5GAN g;  4IUV A;  4OB1 B;  5KYU A;  2E3H A;  2ZZG A;  3T9N A;  3THK A;  1VYV A;  5GAM j;  1K73 R;  4J6W A;  5GAN 5;  3NTH A;  2LT1 A;  5KYY B;  2PTK A;  5HGQ A;  1WLE A;  2ROL A;  5FU7 C;  3G71 T;  2G4C A;  4Q15 A;  3VUB A;  2FRW A;  3A5Y A;  1M3B A;  2NUP A;  1CKB A;  2IVW A;  1PYS A;  1S72 Q;  2OTL A;  2AKL A;  4C92 C;  5I11 A;  1M3C A;  2DTO A;  1YGB A;  5GAM e;  2E6N A;  2P0K A;  3TUP A;  4J6X A;  1GCQ C;  5HK3 A;  4M7D E;  1X2H A;  4IIO A;  3CC2 A;  5GAN 7;  4LUE A;  1CSK A;  1OI1 A;  1D09 B;  2PUO B;  3L2V A;  1VQ6 Q;  3RKX A;  2LQK A;  2JM8 A;  3INZ A;  2JN0 A;  2IY5 B;  3RNJ A;  1N9W A;  1ACM B;  3QWX X;  4F7U G;  2X3X D;  5FWC A;  1VQ4 T;  3CCV Q;  1UEC A;  4R56 A;  1WI7 A;  3CBO A;  3EG3 A;  2DK3 A;  2D8H A;  1QP2 A;  4CS4 A;  4CS2 A;  1NM7 A;  1OU9 A;  2QHU A;  3CMQ A;  2COW A;  1YHQ T;  2DET A;  1YFT A;  4C92 A;  1PD0 A;  2E4H A;  1JJC A;  3N5B B;  2VAS A;  4TQD A;  2XDB A;  2MI6 A;  3QHS A;  4M7D C;  4BDZ A;  1W2B P;  1GCQ A;  3M55 A;  4KUD K;  1X43 A;  3ERR A;  3TEH A;  1Z9Q A;  3H0H A;  4UP8 A;  4ZTJ A;  4C0D B;  4OGE A;  1BYM A;  3M53 A;  4QVZ A;  3UF4 A;  2QEX Q;  2QA4 Q;  2I2L A;  3KXT A;  1X27 A;  2ZPE B;  3PIP A;  4M78 G;  2RO0 A;  1KD1 R;  2K7A A;  1X6G A;  1QVG P;  5FU6 B;  5LJ5 h;  1BB9 A;  4OMN A;  3OBY A;  3REU A;  2FHD A;  3VV0 A;  5L23 A;  1LJO A;  3BJU A;  4Q6G A;  3I56 A;  3I55 A;  4P74 C;  4HVW A;  1GXI E;  1GCP A;  3GBQ A;  1KFZ A;  4HT8 A;  1W2B A;  1VQL Q;  1W1F A;  3MP6 A;  2GFU A;  2NLU A;  3TSW A;  2OTJ T;  2FPF A;  1NG2 A;  2K5F A;  4DBR A;  3UFG A;  4M7D A;  4KUL A;  3PTA A;  1HXD A;  4FCY A;  3M0R A;  4PG3 A;  1KQS P;  2RHX A;  1WQ7 A;  2RH2 A;  3M54 A;  1ZUK A;  1QVG A;  1UGP B;  1UEB A;  4KGX B;  1HYO A;  4JJN K;  2A8E A;  3CC4 Q;  2JTE A;  2OTL T;  3VQX A;  4II1 A;  5AYF A;  2V8I A;  4JJC A;  1PSF A;  1Q86 C;  2CZ6 B;  2DD4 A;  2CP3 A;  4M75 B;  7AT1 B;  3PIO A;  4A4F A;  3L2R A;  1D0X A;  2HSP A;  3DLM A;  4P74 A;  2JW4 A;  3CC2 T;  4J9E A;  1WGS A;  4DBQ A;  1VQ8 Q;  5GAM g;  2QHS A;  4M7A F;  1IRE B;  1GFD A;  4M77 F;  1S72 T;  4YRI A;  2KK4 A;  2BZX A;  2P0Q A;  3CCJ Q;  4HWR A;  3VQY A;  3L2W A;  3TQ7 P;  1RAB B;  2EL9 A;  5LJ5 j;  2XU8 A;  2NYS A;  3LYI A;  1YJW A;  1K8A R;  2EQM A;  3E1S A;  3H41 A;  1AZE A;  1U5S A;  3EH1 A;  1EQR A;  3BW1 A;  3L4G B;  2YLB A;  2QDY B;  3JCM X;  2KT8 A;  1ATI A;  4UP9 A;  2C0I A;  1EIF A;  3A8L B;  1E1O A;  2VYT A;  3SFM A;  3AT1 B;  3M59 A;  3ICA A;  4LVM A;  3X24 B;  3W3S A;  4E7K A;  3HTZ A;  2CKK A;  3CCV T;  4BE1 A;  3TSZ A;  1TU0 B;  3S3N A;  4PJO F;  5KYW B;  3DLL A;  3L42 A;  4XU2 A;  3UT1 A;  1NJ1 A;  1IO6 A;  4FYV B;  3E9H A;  4E7H A;  4E7I A;  1WJQ A;  3OS1 A;  2ZT6 A;  1RAF B;  4CC4 B;  1RAE B;  3C0C A;  1MNE A;  1PD1 A;  4MZM A;  2EYW A;  5I2S A;  1UHC A;  4KH0 B;  3FEO A;  3C4S A;  3OBW A;  5LJ3 h;  1UGS B;  3QNE A;  1XQH A;  1H4S A;  4A53 A;  2HBW A;  1JJ2 P;  2M0Y A;  4YPF A;  3RGL A;  5DY9 A;  1GBR A;  4AH6 A;  4BDY A;  2RJD A;  4PJO C;  2KGT A;  4HT4 A;  1KQ1 A;  2HMA A;  3I55 T;  4FSS A;  3PCO B;  5KH6 A;  2OJ2 A;  2QEX T;  2M1H A;  2DL8 A;  4LVI A;  5ECA A;  1M3A A;  3M4Y A;  2VXE A;  4E7S A;  1RAC B;  3EFO A;  4PFZ A;  2EAY A;  8ATC B;  1D1B A;  3HKS A;  2HDA A;  1X01 A;  2DL4 A;  2XG8 D;  1U8R A;  3CCR Q;  1KC8 R;  2DXT A;  2KY9 A;  5KYU B;  1F1B B;  4MML A;  3CD6 Q;  3I9Q A;  3EG2 A;  3CCU A;  1H3Z A;  3JCM J;  3TCJ A;  1JJ2 A;  1OZ2 A;  2K3B A;  1NJ8 A;  2HQH A;  2I4N A;  4UPA A;  2W10 A;  1PYS B;  4RTV A;  3JCM f;  2SRC A;  2PVG B;  1IZ6 A;  5GAN d;  3GIB A;  3A7A A;  1ASY A;  2EQI A;  1LVK A;  1UJY A;  2DBM A;  2CDT A;  2ZR2 A;  4Z02 A;  1LPL A;  2ZPI B;  2ZIO A;  1TUD A;  3CCQ A;  3V7S A;  3S3O A;  1RL2 A;  2AK5 A;  4P71 C;  3OYD A;  3S3M A;  2L3Q A;  2WAC A;  3PT9 A;  1BIA A;  2RI2 A;  1I07 A;  3L1A A;  3FIF A;  4JLI A;  4LVL A;  2E1H A;  3OW2 S;  5LJ3 j;  2ZPB B;  1WZO A;  4XTU A;  3I5R A;  4OML A;  4AMC A;  1OYX A;  3M0T A;  1X2G A;  4M4Z A;  3PMT A;  1OOT A;  3VQW A;  1T0J A;  5FU7 B;  2ART A;  5CAI A;  2DYB A;  1YFS A;  3P8V A;  2P5I A;  5IN1 A;  1AWX A;  1W6X A;  1UG1 A;  2PQW A;  1N9S A;  1Q95 G;  4YRP A;  1GRI A;  3UA7 A;  1KC8 U;  3UGT A;  4C92 B;  2YWW A;  3CCL A;  1JJC B;  1WNL A;  4FYX B;  1PRM C;  2KT1 A;  1W70 A;  3JB9 F;  2FZK B;  3MP1 A;  3SHW A;  2EQJ A;  4H2V A;  1YWO A;  4LDW A;  1RAG B;  3VBB A;  1MV0 B;  3TEH B;  3UWN A;  5LJ5 g;  2HZY A;  5AT1 B;  4P71 A;  1NYG A;  2Y90 A;  1NEB A;  4HA8 A;  3JB9 H;  4OGC A;  3WQZ A;  5KCO A;  1VQ5 A;  4K88 A;  4KGV B;  2AKK A;  3I7F A;  3VRZ A;  1WYX A;  2QTV A;  1M90 U;  1VQK A;  5J26 A;  5HCK A;  4PL6 A;  2KI7 A;  2P84 A;  2E3I A;  1PWT A;  2KXC A;  4N4I A;  4XEO A;  3A31 A;  1SHF A;  2H3E B;  3FC3 A;  1L0W A;  2RHQ A;  2EKO A;  4A63 B;  2CT4 A;  4RKU E;  3H0I A;  4DOV A;  3ULR B;  3FB9 A;  3HSB A;  4M7D B;  5A0G A;  3ZFJ A;  4J9I A;  1QVF P;  1ARK A;  1NYR A;  2ZZF A;  3CCU T;  4XTY A;  1RI9 A;  1YWP A;  3A98 A;  4AG2 C;  1YJN Q;  1D1C A;  3IQL A;  2OX7 A;  3OMC A;  4H2Y A;  5D6Y A;  2LX9 A;  4WF2 A;  4P73 C;  1C6V X;  3HRT A;  3CCR T;  4C5G A;  4IUQ A;  2VGM A;  3CD6 T;  1P92 A;  2ZR3 A;  4P75 C;  5I22 A;  3G4S A;  4M75 F;  12AS A;  2C06 A;  3EG0 A;  1JRI A;  2RK1 A;  2GTO A;  2XIC A;  5M9O A;  1VQ9 A;  1G3Y A;  2GF7 A;  3QPH A;  3VS3 A;  1VQM Q;  1QWE A;  1ASZ A;  1XJW B;  4DPG A;  4CH3 A;  2FVU A;  2CSQ A;  9ATC B;  3NFC A;  2RI3 A;  3JB9 G;  1M27 C;  2H3J A;  2K79 A;  4TVA A;  3ER0 A;  1FYN A;  2DM1 A;  3QO3 A;  5GAM d;  2DF6 A;  4MDX A;  1U06 A;  4J9H A;  4H2W A;  4EDU A;  1M4Z A;  2EYZ A;  4HVV A;  4BUG A;  3G71 Q;  2VC8 A;  4PJL A;  3OYM A;  1PM3 A;  2FL7 A;  2K4Y A;  2LX7 A;  4YRE A;  1VQ7 A;  1EX4 A;  4OB0 B;  2K9G A;  1MMG A;  2QTX A;  2R57 A;  3URG A;  1D1A A;  2LQW A;  2ECZ A;  5LJ3 g;  3WVD B;  4RTX A;  1UHF A;  4FW2 A;  2FPD A;  1GBQ A;  1H3H A;  2EYY A;  3OYB A;  2QQA A;  2QDL A;  2K2M A;  2BZ8 A; 
#chains in the Genus database with same CATH homology
 4YRS A;  1YI2 A;  4XTZ A;  4YRK A;  1N8R U;  3MEV A;  2O4X A;  4L6V 5;  5I21 A;  4YRR A;  3E9G A;  1HTT A;  3CC7 A;  2L5Q A;  1Y7X A;  3QO8 A;  4KR2 A;  3M56 A;  1WQW A;  2K2V A;  3PMI A;  2VXF A;  1D3B A;  4A4H A;  4MMK A;  3ME9 A;  5J3B A;  1E22 A;  5GMK l;  4X9D A;  1JBM A;  2M16 A;  3WXM B;  1YIJ A;  3Q1J A;  4M75 G;  1OZ3 A;  3IG2 A;  3LSQ A;  2PU9 B;  3JCM h;  3OYA A;  5GAN 3;  1LNX A;  3VYG A;  1EFW A;  2Y4Y A;  4H2T A;  4QW2 A;  2ZIN A;  4LVJ A;  3V7C A;  2CJ9 A;  4F7U E;  1BI3 A;  3TRE A;  1YJ9 A;  5D6X A;  1G3S A;  5CK9 A;  4PJO B;  4HCZ A;  4V2S A;  3G4S T;  3GNF B;  1H4V B;  2RJE A;  4X5O A;  3LW5 E;  1YJN T;  3CXC A;  3TEG A;  2ZPG B;  3LWH A;  2JTM A;  2Q7G A;  2HQX A;  4TWA A;  4PKC C;  2MMP A;  2I4O A;  2ZTG A;  3MF2 A;  1RI0 A;  3REX A;  4A4G A;  5GAO r;  4OMF B;  3A5Z B;  5A2Q E;  1NNH A;  2DZ9 A;  4P3P A;  3FRN A;  4FSX A;  4C92 F;  5GAO n;  3KUF A;  1BBU A;  2BIV A;  5J39 A;  2E3C A;  2WSF E;  1NYQ A;  3DB3 A;  4YCV A;  3A8G B;  3BDU A;  3RUX A;  4B9X A;  2ZCE A;  1YI2 T;  5E3I A;  1E24 A;  4NCX A;  3CPW S;  3HXX A;  3QKJ A;  3GLX A;  3QZ5 B;  4C0Z A;  3HFZ A;  5LJ5 d;  4RMF A;  1UB4 A;  3CME A;  3JCM e;  3OYG A;  2QHV A;  4ELZ C;  3SWN C;  2A3L A;  1Z7N A;  1KMM A;  2RHQ B;  3JB9 I;  4F7U A;  1VQO A;  2ZNI A;  4RQF A;  2DIG A;  3A7U A;  3X20 B;  2XI9 A;  4M7D F;  2CZ1 B;  4DA4 A;  1NJI U;  1YIJ T;  2K3Y A;  2E41 A;  4HWS A;  4DOW A;  3KFU A;  4WJ4 A;  1K8A C;  4C8Q G;  1M5Q 1;  2LNV A;  2L3R A;  2ZT5 A;  2ODR D;  1K73 U;  3JCM b;  2ARU A;  1YJ9 T;  2KQW A;  4JLG A;  4P3N A;  1VQP T;  3HFO A;  4RG8 A;  4CS3 A;  4FIB A;  2KMT A;  5HKC A;  4Y28 E;  4ME7 A;  1I5L A;  2OAU A;  3SWN A;  2ZXF A;  4CI0 C;  3CBP A;  4HKE A;  5C0M A;  2MF2 A;  1NE8 A;  2JTF A;  4C92 G;  1VUB A;  2HBP A;  4TVA B;  3RMS A;  3ZEH A;  2XK0 A;  4A4E A;  3A32 A;  3JCM Q;  1LYL A;  1FWZ A;  4FU6 A;  1KC8 C;  5FLX E;  5GAO p;  2XTI A;  4XU1 A;  3JCM V;  3DSQ A;  2QI2 A;  2E6Z A;  5GMK h;  1W4S A;  3E9F A;  2L89 A;  3OSV A;  4H2X B;  2O4X B;  5LJ3 d;  4H02 A;  1WU7 A;  1YFR A;  3P8Y A;  1VQZ A;  3RIR A;  4BI3 A;  4NS5 A;  3MF1 A;  4FM4 B;  2PMF A;  1VQL A;  4YRJ A;  1M90 C;  1KD1 U;  3M5A A;  1KQS A;  3CCE A;  2E12 A;  1D3B B;  5DM7 R;  3OS5 A;  2R58 A;  3P8B B;  4UC4 A;  1VQO T;  3JCM g;  1G3W A;  1E1T A;  3IAL A;  2QXF A;  3CCM A;  4J5Y A;  1O75 A;  2CS7 A;  4EPC A;  3JAM E;  3QXE B;  2C8M A;  2Y4X A;  3HRK A;  1VIE A;  2X4J A;  3V7R A;  4JRQ A;  4RG2 A;  5CVI A;  2RJF A;  2D6F A;  3RER A;  4YYE A;  4E51 A;  3OYC A;  1YBY A;  4YP0 A;  2M9U A;  2BKD N;  1VQ8 A;  2P0L A;  3HPW A;  4L87 A;  2DKG A;  2P0P A;  4C8Q D;  3NTK A;  3R6O A;  3HXZ A;  4XU3 A;  1NPR A;  1NJ5 A;  2PME A;  2RM4 A;  4QQ6 A;  2XID A;  3E9I A;  3I56 T;  1JB0 E;  4ZTZ B;  2IG0 A;  5C6S A;  4P3O A;  3A8M B;  3FJP A;  5GMK e;  4P72 C;  4B9W A;  5KNN A;  2MAM A;  1ZBX A;  4XTW A;  4M78 D;  2DDZ A;  3GOX A;  1K8A U;  1X6O A;  1MHN A;  1HC7 A;  3KBG A;  4LDX A;  1X55 A;  1VQN A;  1EOV A;  2V8J A;  1KG1 A;  4M7A G;  3EFR A;  4M77 G;  4P5N A;  1QP3 A;  3OB9 A;  3CCS A;  1YCY A;  5HY6 A;  3AHU A;  4EMK C;  3HFZ B;  4YRG A;  3L2Z A;  2CGH A;  3LLR A;  4LD9 K;  1N8R C;  3QO5 A;  3OW2 A;  4P72 A;  4JDS A;  2R5A A;  4F7U B;  4RMO A;  1KMN A;  1UGQ B;  3GPL A;  2J3M A;  3OSS C;  3JRZ A;  4OVA A;  4ZTU B;  1YJW T;  1H4T A;  1SRY A;  4PJO G;  4LD6 A;  2NS6 A;  2FB7 A;  4L5G A;  4ATO A;  4XTX A;  5CKD A;  4YTL A;  3ASK A;  2CZ7 B;  2Q5I A;  2E5A A;  1SET A;  1MGQ A;  4JS4 A;  4O5V A;  4GLK A;  4EMK A;  4O2D A;  4YDQ A;  2YRV A;  2RHZ A;  3P8T A;  4OB3 B;  5D6W A;  3SWN B;  2HNI A;  2JNG A;  3RMQ A;  2GQV A;  3GF5 A;  2DD5 A;  3MCA B;  2RD1 A;  2I4M A;  3J7A F;  1YIT A;  2K3X A;  4L59 A;  2YLC A;  1SER A;  3LGF A;  4G84 A;  1Q7Y U;  4X34 A;  4N0A C;  1X54 A;  3VQV A;  4BE0 A;  4C5E A;  1QW1 A;  2CZ0 B;  2F69 A;  1W66 A;  4PLL A;  5IAY A;  1LOJ A;  1VQN T;  3HXY A;  3LC0 A;  2DEQ A;  4HCB A;  2F5T X;  4YRC A;  2EQK A;  3SD4 A;  3GNG A;  2KDS A;  4MZP A;  1B7Y A;  4QVC A;  3CCS T;  3C94 A;  5CCA A;  1TH7 A;  3RL6 A;  2Q7E A;  1H64 1;  1KQ2 A;  1G3T A;  3CCQ T;  5K1X A;  1EVK A;  1QVF A;  2EWN A;  4JRP A;  4M7A D;  3IKL A;  4BW9 A;  3M58 A;  3MEA A;  1BI1 A;  4N0A A;  3OS2 A;  3PZC A;  3X26 B;  1VIF A;  4Q5W A;  3CMA A;  2LTO A;  5F5W A;  2RB6 A;  2VV5 A;  1I4K 1;  2GFA A;  3P8D A;  2ODR C;  2K5L A;  1M1F A;  4RQE A;  4EX5 A;  2LRQ A;  4IUP A;  3JCM d;  1NJI C;  3CCL T;  3QJY A;  1RIQ A;  4JS5 A;  3TU4 K;  4IUT A;  4LDV A;  3JCM W;  3SB2 A;  5GAN e;  1VQM A;  2X4X A;  3G6E A;  5CQY A;  2EFI A;  2ZZD A;  1K73 C;  3X28 B;  1Y96 A;  1M9S A;  4J8O A;  1VQ5 T;  2LDM A;  5L8R E;  1VQK T;  3BFM A;  4XAX B;  4BAC A;  1YIT T;  1EIY A;  1U1T A;  3QYG B;  2F5K A;  4KBM B;  4YRN A;  2ZZE A;  2JOY A;  5GAO q;  2V8K A;  3MP8 A;  1I81 A;  3VJP A;  2X4Y A;  2DJZ A;  2DXC A;  4LVK A;  4HWP A;  3LWI A;  2E70 A;  2QQR A;  2DU7 A;  3CPF A;  2DZC A;  3OYY A;  1O9S A;  3CEY A;  4ZN1 A;  1VQ4 A;  2DXU A;  2ZNJ A;  1KOG A;  4C8Q E;  4XEM A;  2EJ9 A;  2CJA A;  1VQ9 T;  5CKB A;  1R8O B;  4BE2 A;  3OYF A;  4ZIB A;  4J7F A;  1KHI A;  4F7U F;  3IKM B;  1KHC A;  3HXW A;  4C0G A;  1G5V A;  1KD1 C;  3FLG A;  2DQ3 A;  2LCL A;  5KCH A;  2KVQ G;  3MHX A;  4CH6 A;  4LDU A;  2DVE A;  5GMK m;  4MDW A;  4ELY C;  4YRQ A;  4M78 E;  2CYZ B;  1VQ7 T;  5DLQ E;  4TQF A;  2DTI A;  4EMK B;  3JB9 D;  3MQZ A;  3MO8 A;  4C8Q C;  1BKB A;  1FXX A;  3G6E T;  4FT4 A;  5FRN A;  2OTJ A;  1ADY A;  3O8V A;  2P4T A;  4D6W A;  4TVR A;  1XTD A;  4PNO A;  3QG1 A;  4XU0 A;  2AKW A;  1BIB A;  3J81 E;  2ZCF B;  3OYL A;  2KAF A;  4YRM A;  4H2S A;  3CC7 T;  4M78 C;  4QQD A;  3OYN A;  2RHY A;  1X56 A;  4C5I A;  2K5I A;  2QQ9 A;  1HK9 A;  1DJ7 B;  4N4H A;  5CR2 A;  2G3R A;  3RES A;  4C8Q A;  3HHT B;  4WI1 A;  3SDZ A;  1S72 A;  2XGT A;  3NEL A;  1I8F A;  3G1Z A;  2MWO A;  4A4K A;  1B7Y B;  3CBM A;  4BY6 C;  1NPP A;  4C0F A;  1XOV A;  1V29 B;  1G51 A;  4TVY A;  3UH0 A;  1QVP A;  5CQX A;  2LCC A;  3E19 A;  4CH5 A;  1VQ6 A;  4M75 D;  5C53 B;  4M78 A;  4KQE A;  3QDR B;  4QVD A;  2WSE E;  5C51 B;  5HK0 A;  2MWP A;  4HCC A;  2ZPF B;  3M4G A;  3PGG A;  2XKO C;  3CCV A;  3DB4 A;  5GAN 2;  5CKF A;  5CIU A;  3HY1 A;  3HFN A;  2XHC A;  5IT9 E;  3MEY A;  1B70 A;  4Y91 A;  5GAN f;  4OP0 A;  2FYK A;  4BWA A;  2RA2 A;  1WPY A;  4ZGD B;  2RJC A;  1Q81 U;  3JCM P;  1SSF A;  4J6Y A;  2QEX A;  2QA4 A;  1M8V A;  2DPP B;  5FRO A;  4ZGJ B;  1N6A A;  4EO4 A;  1Y96 B;  5CKE A;  3RF1 A;  4OLF A;  4X9C A;  1BBW A;  1W2B S;  2HAX A;  1NJ2 A;  3GP8 A;  2RHI A;  3OD1 A;  4ZTF A;  5CKH A;  3EAE A;  2QQB A;  1M1K U;  4M7D G;  2LQ8 A;  2ZT8 A;  5GAN 6;  3CME T;  1EIY B;  2DO3 A;  1WJS A;  3G7Z A;  4M7A E;  1ZHI A;  4A54 A;  4M77 E;  1QVG S;  2DXB A;  3HFV A;  3QUI A;  2R5M A;  3A7R A;  4WJ3 M;  3J80 E;  1WJR A;  1AHJ B;  1Q7Y C;  3NET A;  4BI8 B;  3PNW C;  4JRI A;  3RAC A;  1J5W A;  3CC4 A;  3H6Z A;  2E10 A;  2D9T A;  1K9M U;  2JUF A;  4BI4 A;  1KQS S;  2EJG A;  2DU5 A;  2PVD B;  5DLO A;  2EYQ A;  11AS A;  3HRU A;  2AHJ B;  4PJO E;  3MET A;  4M7A C;  3A74 A;  5ELN A;  4ZN3 A;  1VQ6 T;  4M77 C;  2Q7H A;  3CCJ A;  4IUU A;  2RHU A;  5LJ5 e;  5GMK j;  5GAO l;  3LH0 A;  4CRI A;  2ZT7 A;  1UGR B;  1NJ6 A;  1Q82 C;  2DQ0 A;  4BD3 A;  4O6J A;  3TEE A;  3OMG A;  4OB2 B;  2AMC A;  2EQU A;  3QII A;  1N27 A;  4C92 D;  2VUB A;  2ALY A;  2J3L A;  1B8A A;  4M7A A;  5ELO A;  2QA4 T;  4M77 A;  4ZGE B;  4EMH A;  2PVO B;  1FX7 A;  5FRM A;  4YCU A;  3BDL A;  2D0Q B;  2QQS A;  3OS0 A;  2JVV A;  5GAN 4;  2AKW B;  4RDX A;  2X4W A;  5GAO m;  5GAM f;  1VQL T;  3BY7 A;  3F70 A;  3QBY A;  1JJ2 S;  3R07 A;  4E47 A;  5EG2 A;  3CCE T;  3CCR A;  2WSC E;  1B34 A;  5GMK i;  3CD6 A;  3CCM T;  4PJO A;  4C8Q B;  4RCB A;  2RK2 A;  3M4Q A;  4M7D D;  1WYD A;  1GGM A;  2DIQ A;  1FYF A;  3L2U A;  5A0L A;  2HQE A;  2ZGW A;  3CC4 T;  3QZ9 B;  1Y07 A;  3NEN A;  4E7J A;  2EJF A;  2RHS A;  1VQ8 T;  3PFS A;  4M78 B;  3HRS A;  4NL3 A;  5LJ3 e;  2GCX A;  4TTV A;  3A8O B;  3A5Z A;  4K86 A;  2A7Y A;  4KUI A;  1YB3 A;  3CCJ T;  2ARS A;  3UPU A;  2K57 A;  3HP9 A;  2JZ2 A;  5I2M A;  4YRO A;  4RCC A;  1Q86 U;  4TVW A;  2I4L A;  3JCM c;  1B70 B;  3RKY A;  5GAN h;  3EFS A;  4BY6 B;  2ZIM A;  2O01 E;  4FT2 A;  1H4Q A;  4G85 A;  3HXV A;  3DKM A;  4C0D C;  3NTI A;  2IY5 A;  2LC4 A;  2CJB A;  3VUZ A;  3QTC A;  1USY C;  1G5I A;  5FU6 C;  4M75 E;  2BUD A;  1IL2 A;  3QO7 A;  3L2Q A;  1Z7M A;  4BB7 A;  3OYK A;  4K87 A;  4NL2 A;  2XDP A;  1Q82 U;  2PUK B;  4M77 D;  2ZPH B;  3HY0 A;  3HRI A;  4XTV A;  3V8J A;  3RKW A;  3QJ6 A;  1YJN A;  3HXU A;  4YRF A;  1SES A;  5C52 B;  5GAN j;  4XQ3 A;  3JSC A;  3LGL A;  1QVF S;  2CIM A;  2LT4 A;  4PLI A;  1USY A;  3NEM A;  4M75 C;  4GY5 A;  5LJ5 f;  2YHT A;  2E65 A;  3M57 A;  4VUB A;  4DQ2 A;  3OY9 A;  4PJO D;  1EVL A;  4MZT A;  3VYH B;  2B8A A;  1NZ9 A;  2KSS A;  4P73 A;  3QYH B;  4YRT A;  2LVM A;  4IUR A;  4XK8 E;  4P75 A;  3C12 A;  3LSS A;  3OYE A;  1M1G A;  2DTH A;  3WVE B;  2HD0 A;  3C95 A;  3V8K A;  4FL6 A;  2Q5H A;  3VU3 C;  2X35 A;  3HL8 A;  3G71 A;  4HVC A;  2L8D A;  4KR3 A;  4E7L A;  2AMC B;  3VKI A;  4H2X A;  3OYJ A;  4UP7 A;  3P8H A;  4M75 A;  4J83 A;  3S6W A;  4EMG A;  2RI5 A;  5KE3 A;  2ALY B;  1G5H A;  4M7A B;  4M77 B;  4N4G A;  1ADJ A;  3UGQ A;  1Y71 A;  5CO7 A;  3M4P A;  3OYH A;  4R55 A;  3OA6 A;  1Q81 C;  4YRL A;  3ZBD A;  4OF1 A;  4H2U A;  4J15 A;  3H8Z A;  3UDC A;  5GAM h;  1BI2 A;  5LL6 S;  3OQ5 A;  5GAN 8;  4JRK A;  3JB9 J;  4KT0 E;  2QHT A;  2E64 A;  3L4G A;  1M1K C;  1XNI A;  3M9Q A;  3X25 B;  1C0A A;  1YHQ A;  1B34 B;  3MEU A;  4C5H A;  4J7I A;  1VQP A;  5K1P A;  1QF6 A;  3CMA T;  3A8H B;  2M0O A;  4JUV A;  4CH4 A;  4C8Q F;  1PSE A;  3FDR A;  1B76 A;  4HT9 A;  2VGN A;  2XDD A;  2DAQ A;  5KE2 A;  2E5Q A;  3V8L A;  4PHC A;  1X75 C;  3CXC S;  1U1S A;  4NOY A;  2XD0 A;  5LJ3 f;  4C92 E;  3MEW A;  1K9M C;  3QSU A;  2RHS B;  4YCW A;  2EIF A;  3PCO A;  1VQM T;  5A0D A;  4M78 F;  3LX7 A;  4HWO A;  4QQG A;  3CPW A;  4LDY A;  1ZQ1 A;  3OYI A;  1BI0 A;  1QE0 A;  4LNS A;  1N9R A;  4IKF A;  2C7I A;  5GAN g;  4IUV A;  4OB1 B;  2ZZG A;  3T9N A;  5GAM j;  4J6W A;  5GAN 5;  3NTH A;  2LT1 A;  5HGQ A;  1WLE A;  5FU7 C;  2G4C A;  3G71 T;  4Q15 A;  3VUB A;  3A5Y A;  2IVW A;  1PYS A;  2OTL A;  4C92 C;  2DTO A;  1YGB A;  5GAM e;  2E6N A;  2P0K A;  3TUP A;  4J6X A;  5HK3 A;  4M7D E;  1X2H A;  3CC2 A;  5GAN 7;  1OI1 A;  3L2V A;  2PUO B;  3RKX A;  2LQK A;  3INZ A;  2JN0 A;  2IY5 B;  1N9W A;  4F7U G;  1VQ4 T;  4R56 A;  3CBO A;  2DK3 A;  1QP2 A;  4CS4 A;  4CS2 A;  2QHU A;  3CMQ A;  1YHQ T;  1YFT A;  4C92 A;  1JJC A;  3N5B B;  4TQD A;  2XDB A;  2MI6 A;  3QHS A;  4M7D C;  4BDZ A;  3M55 A;  4KUD K;  3ERR A;  3TEH A;  4UP8 A;  4ZTJ A;  4C0D B;  4OGE A;  1BYM A;  3M53 A;  4QVZ A;  2I2L A;  3KXT A;  2ZPE B;  3PIP A;  4M78 G;  2RO0 A;  5FU6 B;  5LJ5 h;  3OBY A;  3REU A;  2FHD A;  3VV0 A;  1LJO A;  3BJU A;  4Q6G A;  3I56 A;  3I55 A;  4P74 C;  1GXI E;  4HT8 A;  1W2B A;  3MP6 A;  2GFU A;  2NLU A;  2OTJ T;  2K5F A;  3UFG A;  4M7D A;  4KUL A;  3PTA A;  1HXD A;  4PG3 A;  2RHX A;  1WQ7 A;  2RH2 A;  3M54 A;  1QVG A;  1UGP B;  1UEB A;  4JJN K;  2A8E A;  2OTL T;  3VQX A;  4II1 A;  5AYF A;  2V8I A;  1Q86 C;  1PSF A;  2CZ6 B;  2DD4 A;  4M75 B;  3PIO A;  4A4F A;  3L2R A;  3DLM A;  4P74 A;  3CC2 T;  1WGS A;  5GAM g;  2QHS A;  4M7A F;  1IRE B;  4M77 F;  1S72 T;  4YRI A;  2KK4 A;  2P0Q A;  4HWR A;  3VQY A;  3L2W A;  2EL9 A;  5LJ5 j;  2XU8 A;  3LYI A;  1YJW A;  2EQM A;  3E1S A;  1EQR A;  3BW1 A;  3L4G B;  2YLB A;  2QDY B;  3JCM X;  1ATI A;  4UP9 A;  1EIF A;  3A8L B;  1E1O A;  2VYT A;  3SFM A;  3M59 A;  3ICA A;  4LVM A;  3X24 B;  3W3S A;  4E7K A;  3HTZ A;  2CKK A;  3CCV T;  4BE1 A;  3S3N A;  4PJO F;  3DLL A;  3L42 A;  4XU2 A;  3UT1 A;  1NJ1 A;  3E9H A;  4E7H A;  4E7I A;  1WJQ A;  3OS1 A;  2ZT6 A;  4MZM A;  5I2S A;  3FEO A;  3C4S A;  3OBW A;  5LJ3 h;  1UGS B;  3QNE A;  1XQH A;  1H4S A;  4A53 A;  4YPF A;  3RGL A;  5DY9 A;  4AH6 A;  4BDY A;  2RJD A;  4PJO C;  4HT4 A;  1KQ1 A;  3I55 T;  3PCO B;  5KH6 A;  2QEX T;  2M1H A;  4LVI A;  3M4Y A;  2VXE A;  2EAY A;  3HKS A;  1X01 A;  2XG8 D;  1U8R A;  2DXT A;  2KY9 A;  4MML A;  3CCU A;  1H3Z A;  3JCM J;  3TCJ A;  1JJ2 A;  1OZ2 A;  1NJ8 A;  2I4N A;  4UPA A;  1PYS B;  3JCM f;  2PVG B;  1IZ6 A;  5GAN d;  3GIB A;  3A7A A;  1ASY A;  2ZR2 A;  4Z02 A;  2ZPI B;  2ZIO A;  3CCQ A;  3V7S A;  3S3O A;  1RL2 A;  4P71 C;  3OYD A;  3S3M A;  2WAC A;  3PT9 A;  1BIA A;  2RI2 A;  3L1A A;  3FIF A;  4JLI A;  4LVL A;  2E1H A;  3OW2 S;  5LJ3 j;  2ZPB B;  4XTU A;  1OYX A;  1X2G A;  3PMT A;  3VQW A;  5FU7 B;  2ART A;  5CAI A;  1YFS A;  3P8V A;  2P5I A;  5IN1 A;  2PQW A;  1N9S A;  4YRP A;  1KC8 U;  3UGT A;  4C92 B;  3CCL A;  1JJC B;  1WNL A;  3JB9 F;  3MP1 A;  4H2V A;  2EQJ A;  4LDW A;  3VBB A;  3TEH B;  3UWN A;  5LJ5 g;  4P71 A;  2Y90 A;  4HA8 A;  3JB9 H;  4OGC A;  3WQZ A;  5KCO A;  1VQ5 A;  4K88 A;  3I7F A;  1VQK A;  1M90 U;  5J26 A;  4PL6 A;  4N4I A;  4XEO A;  3A31 A;  3FC3 A;  1L0W A;  2RHQ A;  2EKO A;  4RKU E;  4DOV A;  3FB9 A;  3HSB A;  4M7D B;  5A0G A;  3ZFJ A;  1NYR A;  2ZZF A;  3CCU T;  4XTY A;  3OMC A;  4H2Y A;  5D6Y A;  2LX9 A;  4WF2 A;  4P73 C;  3HRT A;  3CCR T;  4C5G A;  4IUQ A;  2VGM A;  3CD6 T;  1P92 A;  2ZR3 A;  4P75 C;  3G4S A;  4M75 F;  12AS A;  2C06 A;  1JRI A;  2RK1 A;  2XIC A;  5M9O A;  1VQ9 A;  1G3Y A;  2GF7 A;  3QPH A;  1ASZ A;  4DPG A;  4CH3 A;  2FVU A;  3NFC A;  2RI3 A;  3JB9 G;  2H3J A;  4TVA A;  3ER0 A;  3QO3 A;  5GAM d;  4MDX A;  4H2W A;  4EDU A;  1M4Z A;  4BUG A;  2VC8 A;  3OYM A;  2FL7 A;  2K4Y A;  4YRE A;  1VQ7 A;  4OB0 B;  2QTX A;  2R57 A;  3URG A;  5LJ3 g;  3WVD B;  3OYB A;  2QQA A;  4HWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...