2DKGA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, pyrophosphate and mg(2+)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
total genus 71
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dkgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dkgA01
1TH7A 4J6XA 3P8VA 11ASA 4YRSA 3BFMA 2E10A 3JCMf 1HC7A 3PZCA 3QO5A 2IY5B 4C92E 3JCMP 2DU5A 4N0AA 3PCOA 3RESA 3MF1A 3SWNB 3UH0A 2YLCA 3A32A 4YRRA 5DY9A 3V8LA 4M78E 3JCMc 1E1OA 4UP9A 4M7AF 2ZIOA 4X9DA 3A7RA 2VXEA 3NEMA 4RMFA 4YRQA 1YCYA 2QHSA 5LJ3e 4P71C 1WU7A 4TVAA 1C0AA 5GAN8 1ASYA 4H2VA 2E65A 2ZZEA 4M75E 1HTTA 4P75A 1H4SA 2I4LA 2G4CA 4P72C 3QUIA 3JCMh 5GAN3 3RKWA 4DPGA 4YYEA 1G5IA 2DTIA 3HFNA 4M75A 2Y90A 3V7SA 3RKYA 3INZA 1Y96A 5GANd 2AMCB 2AKWA 1H4QA 3NENA 4F7UG 4C8QF 2EJFA 3M4GA 3RERA 3FB9A 5HGQA 1B76A 1USYC 4RCCA 3A7AA 4X5OA 4TTVA 3IKMB 4M77C 4M7AD 4E51A 2CJAA 1KMMA 4YRPA 4EO4A 1ADYA 3MF2A 4PNOA 4Q15A 4P73A 4RCBA 5LJ3h 5GAOr 1JRIA 3PCOB 2ZCEA 4YRGA 2XTIA 2CJ9A 4EX5A 2ZR2A 2YHTA 1ADJA 2ODRC 3V7RA 5GAN6 4PJOE 3VQYA 2JN0A 1WQWA 2E5AA 1SERA 1NJ6A 3JCMX 4P74C 3UGTA 4MMKA 3RIRA 4RQFA 4XU1A 4M7AG 4YDQA 4M77B 2ARUA 5K1PA 1JJCB 12ASA 4M7DC 1X2GA 3HXVA 3HY0A 3HXYA 2DZCA 3QSUA 5E3IA 4PJOF 5LJ3d 5C53B 4H2YA 3L4GA 2DQ3A 4M77E 3NETA 5LJ5h 3JB9H 1QE0A 5GAOq 4H2WA 3MEYA 4K87A 2CGHA 4HWRA 4PG3A 4XTVA 2ARSA 3UFGA 4TVAB 4YRJA 4C8QD 4XEOA 1I5LA 1PYSA 3NELA 1B7YA 4HVCA 1NJ8A 2Q7GA 3W3SA 4PJOC 4P74A 1N9WA 3ICAA 4M77D 4BWAA 4TQDA 5GANj 1M5Q1 1BIAA 4C8QG 1YB3A 5CAIA 3HFZA 3EFRA 4YRMA 1E22A 1LYLA 1BBWA 3REUA 2XGTA 4YRCA 2Q7EA 5GANh 1YFSA 4YPFA 4AH6A 4CS3A 5I21A 5GAN7 2DU7A 3V8JA 1KQ1A 1L0WA 4N0AC 1X55A 2QHVA 1N9RA 4PJOG 4X9CA 5GAMh 4H2XB 2E41A 4YREA 4G84A 2DQ0A 4XTXA 4HWTA 4CS2A 3HSBA 3HXWA 2DXUA 2I4OA 4CS4A 3BJUA 1NYRA 4KQEA 3QHSA 1KOGA 3VBBA 3VQWA 3JCMJ 5GAMf 3V7CA 4QVDA 4TVYA 1H4TA 1YFRA 4M7AB 5C52B 1M8VA 4M77G 1G5HA 4PJOA 2FYKA 4F7UB 4TQFA 5LJ3j 1KMNA 4MMLA 4P3PA 1YFTA 2C7IA 2YLBA 4XU2A 3JB9F 4ZIBA 5GAOl 1LOJA 2Q5IA 4K88A 3RF1A 2Q5HA 4M78B 5ELOA 2ZZGA 5LJ5g 5GAN2 1WQ7A 4XQ3A 2DZ9A 1EOVA 2DXTA 4M75F 1MGQA 4XTUA 2K57A 4XU3A 4C92B 3RGLA 4ZTUB 2PMFA 4HWSA 5F5WA 3JCMg 4Y91A 5GMKh 3A74A 3BDUA 3PGGA 2I4MA 3FJPA 2ZNJA 5K1XA 2DTOA 4YRNA 1X2HA 2QTXA 2AKWB 4A53A 3G1ZA 4EMHA 1B34A 4M7DG 1U1TA 1KQ2A 4C8QB 4M7DE 1ATIA 1VQZA 1B7YB 3VU3C 4Q6GA 4M75B 1EFWA 3HY1A 1B34B 4M78D 1X56A 3CMQA 5GANe 3RL6A 2ZT8A 3TEHB 4YRFA 2P5IA 1D3BA 4HT9A 3HFVA 4HWPA 1X54A 4PJOB 3ERRA 3REXA 2RA2A 4PJOD 3A5ZA 1H641 4H2TA 4YP0A 4NOYA 3R07A 4OP0A 3IALA 2ALYA 4C8QC 5GMKi 4M75D 1N9SA 4O2DA 2ZXFA 4CH4A 4EMGA 4YCVA 1B70A 3E9IA 4RDXA 4H2SA 4NCXA 3I7FA 1JBMA 1EQRA 2Q7HA 4EMKA 2PMEA 5GANf 3JB9I 1EVLA 1JJCA 2I2LA 1PYSB 1B70B 2VXFA 1YGBA 1HK9A 3A7UA 2E1HA 1NNHA 2DKGA 3JB9J 3VQXA 3M4QA 3HFZB 2EJ9A 3QO3A 4JLIA 4M7DD 4XU0A 3JCMV 3VQVA 2RHQA 4M78G 4YCUA 5C51B 3L2ZA 4H02A 4K86A 2ZNIA 4RQEA 1Z7MA 5LJ5j 4C92G 2ODRD 2RM4A 4M78A 1D3BB 1BIBA 4L87A 2DEQA 2VC8A 1Z7NA 2DTHA 3HFOA 3HRIA 1WNLA 1Y96B 2E64A 2DDZA 3JCMQ 1G51A 3HXZA 4KR2A 4YRIA 4HWOA 5GAN5 4M7AC 2ZT7A 4M7DB 1NJ5A 3WQZA 5GAOm 4ZTZB 5ELNA 3QNEA 3BY7A 4KR3A 4LNSA 4XTYA 1LNXA 1BBUA 4C92C 3L1AA 5GAMe 3HTZA 5GAMj 4F7UF 4M7DA 2J3LA 4C92D 3QO7A 2EL9A 1X01A 3IG2A 2ALYB 4J6YA 2HNIA 4UP7A 2ZTGA 5KNNA 2FB7A 4XEMA 4M78F 5LJ3f 3FIFA 1EVKA 2I4NA 3LC0A 4HA8A 3JCMd 3AHUA 3RACA 4G85A 4C92F 3LSQA 4M7DF 3A31A 1QF6A 5LJ5d 4DQ2A 4M75C 4J15A 3HXXA 3A5YA 3JCMb 4M7AA 4P73C 4P72A 4P3OA 4F7UA 3DSQA 4M7AE 2RHSB 3KFUA 4V2SA 1E24A 2DJZA 3LSSA 3QTCA 1FYFA 1NYQA 3L4GB 4OLFA 4UP8A 4M75G 4EMKB 1B8AA 2ZGWA 2ARTA 1GGMA 2ZR3A 2ZT6A 2RHSA 4H2UA 4WI1A 1EIYA 5GMKe 1HXDA 4J6WA 5GMKj 4P71A 3OD1A 1IL2A 5LJ3g 4YROA 1NJ1A 2C8MA 4EMKC 4CH3A 1NJ2A 4CH6A 5GAN4 3JB9D 4JRKA 1EIYB 1SESA 4NL3A 3SWNA 3P8YA 1SETA 1I8FA 2ZIMA 1E1TA 4C8QE 3RUXA 3E9HA 3RKXA 2P0LA 3TEGA 4CH5A 4TWAA 3IKLA 3JB9G 3SB2A 5GAOp 4C92A 3QO8A 5GMKl 4UPAA 4P75C 3JCMW 5GMKm 3P8TA 2ZINA 1H4VB 2RB6A 4J5YA 4F7UE 5LJ5e 1SRYA 3HRKA 1WPYA 4M77A 4BW9A 4TVWA 1J5WA 3EFSA 4WF2A 3JCMe 3UGQA 3BW1A 2EJGA 1USYA 4PHCA 5GAMd 4YCWA 1I81A 2ZZFA 4M78C 4C8QA 4YRTA 2QHTA 2DVEA 4P3NA 4WJ4A 4JUVA 2RD1A 5GAMg 2J3MA 4JRIA 4XTZA 4WJ3M 4NL2A 4QVCA 2QHUA 4H2XA 1LJOA 3M4PA 4YRKA 5GAOn 2EWNA 3SWNC 2EAYA 4XTWA 2RHQB 1WYDA 1W66A 3TEHA 2CIMA 3GIBA 1RIQA 2ZT5A 4A54A 5GANg 2E3CA 3V8KA 2CJBA 4M77F 3HXUA 4HT8A 2IY5A 2AMCA 5LJ5f 1I4K1 1ASZA 3TUPA 1WLEA 1U1SA 4YRLA
chains in the Genus database with same CATH superfamily
5C6SA 1UHCA 2CH4W 1N27A 1YI2Q 11ASA 1VQ6A 1QWFA 1HC7A 3PZCA 1QKXA 2IY5B 3VRYA 1Y7XA 2K5IA 1EX4A 2MI6A 4KGVB 2F2WA 3CCMT 1YFNA 1R77A 3SWNB 3LGFA 1M3AA 1YP5A 4UP9A 1Q7YU 1YITA 4L5GA 1HD3A 4RMFA 4YRQA 3EFOA 3G4SA 3EHRA 4BY6C 5FU7B 3TQ7P 2JW4A 5KYXB 1UDLA 1WU7A 2DIQA 3MEWA 2CP5A 2JTFA 3EGDA 1ASYA 2DMOA 1VQLQ 1QP3A 2CH4A 1TU0B 4M75E 3WVEB 1H4SA 2Y4YA 3QZ9B 4P72C 4ZGDB 2XDPA 5GAN3 2K3YA 4C5IA 1G5IA 2ABLA 1SKUB 4R56A 1LCKA 2OI3A 3CMEA 1C6VX 2YRCA 5GANd 2AKWA 4GY5A 4LVMA 3R6NA 3H0IA 2KT1A 4JJBA 3RERA 3FB9A 4FSSA 1U06A 1AWWA 1USYC 3DLMA 4X5OA 1YIJA 2ENMA 1QCOA 2L3PA 2RQRA 1JU5C 1XOVA 3PTAA 5HK3A 1ADYA 4PNOA 5CIUA 3BDLA 2EQKA 4JJDA 3H41A 1H8KA 1YWPA 1AT1B 2ZCEA 4A4KA 4AFZC 2XTIA 1VQKQ 2WSEE 2XICA 1ADJA 2RNAA 1PRLC 3V7RA 4OF1A 4PJOE 1ZA1B 3VQYA 1M3BA 2A37A 1WQWA 3OS5A 1SERA 5HK0A 2DF6A 2K5FA 3JCMX 2KY9A 5I2SA 4XU1A 4M7AG 1M1GA 4DOVA 2EQMA 3EAEA 3DKMA 2ARUA 1JJCB 2BIVA 12ASA 4M7DC 1X2GA 3HXVA 2KXDA 2NUPA 1YJWA 1ARKA 3HXYA 2RN8A 3CCJT 3EG0A 2DZCA 2IIMA 3QWXX 4FYVB 2LX7A 5LJ3d 4PLIA 3NTIA 1U5SA 5C53B 2RHIA 3CC2Q 2DQ3A 4M77E 4CC3A 3OQ5A 2X4JA 2ROLA 2CYZB 3VYGA 1VQMT 3THKA 1FWZA 4HWRA 3MP8A 5IHKA 4KH1B 1PYSA 1VIFA 1BB9A 1N9WA 4PFPA 5GANj 2M9UA 5CAIA 3VS4A 3C0CA 1E22A 3CMAQ 1ABQA 4IUPA 1LYLA 2XGTA 4YRCA 3MP1A 5GANh 4AH6A 3M0PA 3OYLA 5I21A 3RR6A 4OB0B 2YUPA 2DU7A 1VQ7T 1KQ1A 2QHVA 4AMCA 1N9RA 2CREA 2MCNA 2F2VA 2FHDA 3UF4A 3QXEB 2CP3A 3PIOA 3RBBB 2D1XA 5FRMA 3HSBA 1GFDA 3NMZC 1VQPQ 1NYRA 1RUWA 3J81E 1KC8C 2FZGB 1KOGA 1X6OA 2KMTA 4J9FA 2ED0A 1ZUKA 3V7CA 1H4TA 3P8DA 4M7AB 5C52B 3PMIA 4CC4B 4TQFA 3NTHA 5LJ3j 1YJWQ 4MMLA 4L59A 4AFUC 4ZIBA 4D8KA 2RQVA 1LOJA 3G6ET 1TUCA 2Q5HA 1SSFA 1W2BP 5ELOA 2ZZGA 2IVWA 4MZTA 1BI2A 1EOVA 1VQ4Q 1XTDA 2LT4A 4OMQA 4BD3A 2PMFA 4HWSA 4Y91A 1LPLA 3BDUA 2VGMA 2I4MA 1UGSB 1K8AR 2RQWA 2QK0A 1W4SA 2DE0X 2LCSA 3MPUB 1GFCA 5HCKA 4M7DE 1ATIA 1VQZA 1WJQA 1OULA 4M75B 1B34B 3CCJA 2LQNA 3CMQA 3RL6A 1Z9ZA 4BUGA 5IHIA 5I11A 1GL5A 3ME9A 4GLKA 1FMWA 2M1HA 4HCCA 4HT9A 2CUDA 3ZBDA 1X54A 2R5AA 1VQ8A 3ERRA 3I55A 3REXA 2EYXA 1WYXA 2GTJA 2EIFA 3CD6Q 1PHTA 4DBQA 2RJFA 4M75D 1UB4A 2K9GA 3EGUA 4IIMA 2ZPIB 1SPKA 1YJNA 3I7FA 1W6XA 2D0QB 2Q7HA 2VASA 3X26B 1G3TA 4A4HA 2PMEA 3VUZA 1Q82R 2LTOA 1VQKA 2QEXT 4LUDA 3OSVA 3C95A 1VQ5Q 2VXFA 2E1HA 1TSFA 1UECA 2HCKA 2F69A 1M9SA 4RTTA 1UJ0A 1E6GA 3UT1A 1DJ7B 1WHGA 1WFWA 2RJEA 1QVFP 4LVJA 1QVFS 2QA4A 3C12A 2V1QA 1PG5B 3CMET 4ME7A 1OPLA 3OMCA 2EKOA 2JXBA 2DVJA 3GF5A 3X24B 4L87A 2DEQA 2VC8A 3T9NA 3MHXA 5KCHA 1B7TA 4MDXA 1TUGB 2DL5A 3HXZA 2HMAA 2YUOA 3OW2P 5AT1B 4HWOA 4Z89A 4FM4B 1M8MA 3WQZA 3M57A 4UC4A 4XTYA 3PIPA 1QCFA 3RMSA 3OYJA 1MNEA 2VB6A 4A4GA 4KBMB 3LYIA 3CPWA 1VQ4T 4C92D 3QO7A 2EL9A 2ZZDA 1X01A 1OV3A 1UGRB 1OU8A 2QQAA 1VQ7A 1G83A 2ZTGA 4XEMA 4OB3B 5IT9E 3JCMd 2FZKB 2QQ9A 4VUBA 5LJ5d 4DQ2A 4AFSC 2EVRA 4J15A 1YJNQ 3HXXA 2AZSA 3A5YA 1SEMA 1K1ZA 3JCMb 2RPNA 1X2QA 3ASKA 5HKCA 4P72A 4BY6B 1WHHA 4F7UA 2X4YA 1XNIA 2J6FA 2YRDA 1E24A 3FLGA 1JEGA 4OGCA 1FYFA 1BK2A 2LCLA 1B8AA 2A0FB 2RHSA 2YDLA 2AKLA 4AG1C 5LJ3g 1NJ1A 2C8MA 2H3EB 4BDYA 4BB7A 3JB9D 4JRKA 1EIYB 3E9GA 4Y92A 2RI5A 3SWNA 3P8YA 2PVDB 1I8FA 2X51A 5CVIA 3S3OA 3LH5A 2ZAEA 2P0LA 1ZBJA 4EPCA 3CC7A 2HEQA 2J6KA 3CCLT 4CH5A 3IKLA 1Q86R 1SRMA 4C92A 3QO8A 1YJNT 5GMKl 2RHUA 4UPAA 2EYWA 2L5QA 2QASA 4BI4A 1AWOA 5D6WA 2ZINA 2MPXC 3ZL7C 4F7UE 1OZ3A 1RI0A 3LW5E 2BZYA 2K3XA 2QI2A 1G3WA 1C0MA 1J5WA 2M0OA 6AT1B 4WF2A 2O2OA 3CBOA 2NYSA 1JQQA 1ZA2B 2O9VA 2EJGA 2L3QA 1D09B 4BE2A 2DBKA 3LWIA 4C8QA 4YRTA 3OW2A 2DVEA 3LX7A 4WJ4A 1K4US 1KC8U 1R8OB 3M4PA 1NJIC 4YRKA 3FJ5A 1IHVA 3SWNC 2COYA 2EWNA 2VWFA 1QCNA 3NGPA 4XTWA 4LDYA 3TEHA 1KD1C 2CIMA 3LH0A 1RIQA 1O75A 2ZT5A 2XDBA 5GANg 2GBQA 3I55Q 1JXOA 3MEAA 3CCVQ 2IY5A 5ECAA 3OYBA 4YRLA 4J6XA 2E10A 2EGCA 1VQMQ 1WZOA 3GOXA 4ESRA 2PVGB 2LJ3A 4FL6A 4RTYA 2HSEB 4PL6A 2E70A 2XMFA 1YI2A 1VQNT 1VQ6Q 4X9DA 1D0XA 5FU7C 1WXTA 2DM1A 1D1AA 3CC4A 1YCYA 1VQ5T 2XHCA 2QHSA 4LNPA 1W2BA 2EBPA 2CZ0B 4TVAA 1C0AA 5GAN8 1CSKA 2NUPB 2E65A 2LMJA 2ZZEA 4A4EA 2ZPGB 3TU4K 1HTTA 2GF7A 2I4LA 2LQ8A 4E7JA 3QJ6A 2G4CA 2NUTB 3E19A 3JCMh 3RKWA 1NBEB 2E6ZA 1PD1A 4M75A 3OYNA 5IXBA 1PKTA 2LJ1A 2VV5A 4X34A 3V7SA 3OS1A 3RKYA 1PWTA 3INZA 1Y96A 2HL5C 2RQUA 2M51A 1J3TA 1X27A 4XAXB 3NENA 2RJDA 1KQSP 1VYUA 4F7UG 4C8QF 5AYFA 5FWCA 1VQLT 3M4GA 3MO8A 2KT8A 5HGQA 3OYGA 3PFSA 3VS0A 4FYXB 3A8GB 2YWWA 1YJ9Q 5CKHA 5IHNA 3EGXB 4M77C 3X20B 5CR2A 3A8MB 4M7AD 4OMNA 9ATCB 1VUBA 4YRPA 1UHFA 1I5OB 3VS7A 3CCMQ 3MEUA 1JRIA 3JRZA 2AZVA 2JOYA 4YRGA 2CJ9A 2DL4A 1SF9A 3L2VA 4AT1B 2DXBA 4CC2A 4M4ZA 2JN0A 1ZX6A 3NPFA 4XK8E 3CCST 4P74C 2E6NA 2P84A 4RQFA 4M77B 1S1NA 3OYFA 2V8KA 3M0SA 4EIKA 2MF2A 2LJ0A 2ZPBB 4FIBA 3OYCA 3QSUA 3DB3A 2EKHA 1VQOQ 2AT1B 2PQWA 3OYHA 5IAYA 2OTLA 4E7HA 1QE0A 1MMAA 2CKKA 1EZZB 5CQXA 4FU6A 3TCJA 3MEYA 1R0BG 4H2WA 2RQTA 3HHTB 1TTHB 3A1PA 1VQNA 2EQUA 2ARSA 3CC2A 4TVAB 3DB4A 2DL3A 3OMGA 1I5LA 2WSCE 2Q7GA 4ZTJA 2RHYA 4LDXA 4DBHA 1N8RU 4M77D 3CCQT 1KD1R 1M5Q1 1BIAA 1YB3A 1OI1A 4DEYA 3EFRA 1K9MC 1JJ2P 2YXYA 3REUA 1BBWA 3J7AF 2Q7EA 1YFSA 1QVGA 4LXCA 3CC4T 4JRPA 1Q7YR 1YHQQ 4KH0B 2BZXA 3CMAT 2H8HA 2QGGA 5CKEA 3M4YA 1S72Q 1K0SA 1ACMB 2X3XD 3I9QA 4YREA 1ZSZA 1WJSA 4TVRA 4XTXA 4CS2A 2I4OA 2LDMA 4CS4A 1OX8A 1Q81R 1KJWA 4MDWA 3VBBA 2E5KA 3VQWA 1RAHB 2ROTA 4QVDA 1YFRA 3QKJA 1N8RR 1ZBXA 4M77G 1G5HA 4ZTFA 2FYKA 5C0MA 1K9MR 2C7IA 2FEIA 4XU2A 3JB9F 1M27C 2Q5IA 3RF1A 3NTKA 2G3RA 2XI9A 1S72T 1WHKA 1RAEB 3P8HA 3PT9A 1UUEA 4XQ3A 3VS5A 4XTUA 1YWOA 1VQ6T 4C92B 3RGLA 2E4HA 2BKDN 5F5WA 3A74A 1AZGB 3I5SA 5FRNA 2Z0WA 3L42A 4QQGA 3FJPA 2ZNJA 2QGFB 2DTOA 2KDSA 4YRNA 1X2HA 2QTXA 3M0UA 3G1ZA 1X2KA 3CCRA 4BE0A 2PU9B 2QG9B 4C5GA 1B34A 4M7DG 4C8QB 5DLQE 4OB2B 3G71T 3VU3C 2V8JA 2R5MA 4O6JA 2X4WA 3HY1A 5KYYB 5GANe 2AKKA 3JSCA 2LQKA 2ZT8A 3TEHB 4Z88A 2IPOB 2DD4A 2P5IA 2ATCB 4O5VA 3CCQA 4HWPA 3HFVA 1Y07A 4PJOB 1FMVA 4GBQA 2HSPA 2RA2A 3HTRA 1ZHIA 3A5ZA 3LGLA 3M53A 4YP0A 3IALA 5GMKi 1N9SA 4O2DA 1RLQC 2JMCA 5IH2A 4LVKA 4EMGA 4YCVA 1ZSZC 2O31A 4H2SA 1JBMA 1K73C 1QP2A 3JB9I 1PD0A 2RI3A 1JJCA 1PYSB 1B70B 3MJXA 2I0NA 1WHLA 3M5AA 4N4IA 1OYXA 1HK9A 3HPWA 4IKFA 3S6WA 2DKGA 5FW9A 2DETA 3VQXA 4HCBA 1GCQC 3G6EA 4M78G 1GBRA 5C51B 2FVUA 2OX7A 1QW1A 1Z7MA 5LJ5j 3QPHA 4C92G 1D3BB 3VJPA 1QVPA 1YBYA 1ABOA 2DD5A 3HRIA 2SEMA 1V1CA 1WNLA 2DIGA 1GCQA 1G51A 2CT3A 4YRIA 2CP0A 3D7SB 4ZGEB 4LDVA 4M7AC 1UE9A 2ZT7A 5GAOm 4KR3A 1M1KU 4LNSA 1NPRA 1P92A 3VKIA 1M30A 2GGRA 5FROA 1I1JA 4GLMA 1Y0MA 1VQPA 2QQRA 2LZ6B 4IUQA 1RADB 1M2OA 4MZMA 3CMAA 2HNIA 4UP7A 2A7YA 2FB7A 4M78F 3FIFA 3LLRA 3VS2A 4FW1A 3LC0A 3AHUA 3RACA 3DLLA 1M3CA 1LVKA 3MP6A 2LQWA 4M7DF 3A31A 2XIDA 4B6MA 4KUDK 2EPDA 2HQEA 4HVWA 2YUQA 3CCEA 3CC2T 1YIJQ 3HP9A 4P3OA 1YN8A 2RHSB 3LSSA 1KHCA 2GNCA 1W2BS 3L4GB 1RLPC 4OLFA 4UP8A 4M75G 1MMDA 2BTTA 5KH6A 1GGMA 5J39A 4P5NA 1EIYA 1HXDA 2JS2A 2CP6A 2LX9A 1WIEA 3OD1A 2DERA 4P71A 1T3LA 3G1JA 2F5KA 4YROA 4EMKC 1UFFA 4LE9A 1NJ2A 1E7OA 3H0HA 4RMOA 1SESA 4NL3A 3O8VA 4LD9K 1N5ZA 1SETA 2QEXA 4LUEA 4E7KA 2LVMA 3CCUT 3JB9G 3KFVA 3SB2A 5GAOp 4LVLA 4ZNXA 1VQ4A 3G7ZA 4E7ZA 3P8TA 1KG1A 1X69A 1K73U 1F1BB 1IGQA 3P8BB 4ELYC 4TVWA 3EFSA 5KYUA 2C0OA 2KE9A 3UGQA 1USYA 3QG1A 4PHCA 2EQIA 3OA6A 5GAMd 2P4RA 2BE7D 1I0CA 1NM7A 2ZZFA 2O4XB 3FEOA 4J9CA 1WHMA 3OS2A 2QHTA 4P3NA 5I22A 4JUVA 2DAQA 2RD1A 5GAMg 2JUFA 2QDLA 4JRIA 2J3MA 2OJ2A 3IQLA 2RMOA 2QHUA 1LJOA 1RAAB 4J9BA 5GAOn 1MHNA 1WYDA 1W66A 1GXIE 4F04B 2E3CA 2D9TA 3QZ5B 1VQ8Q 4IUVA 4PJMA 3CCVT 4CRIA 1ASZA 3TUPA 5FWBA 3P8VA 1OPKA 3QO5A 2MWOA 2SRCA 3VS1A 3RESA 4JS5A 3MF1A 2XK0A 1VIEA 5DY9A 4M78E 1V76A 2CP2A 1E1OA 4M7AF 2YRVA 3A7RA 2VXEA 1RABB 2CSIA 2W10A 2BE9B 3NHNA 1B3QA 3CPFA 1KC8R 3G6EQ 4P71C 3VS6A 2MYSA 3EFOB 2DLPA 3CQTA 5HY6A 5KYXA 1BKBA 2JNGA 5L23A 2O01E 2HD0A 3I56Q 2NS6A 4DPGA 4IUUA 4YYEA 2KGTA 1TS9A 4MZPA 1B07A 3HFNA 4AFQC 2DYIA 2XG8D 4FT4A 1M4ZA 1TOVA 2F2XA 2IG0A 2XKOC 2JS0A 4AG2C 1VQ9T 2AMCB 1Q86U 4D6WA 2X9HA 2EJFA 3KUFA 4B9XA 1ZSGA 3M56A 2L89A 2K4YA 1B76A 1TWBA 3CMEQ 3PVLA 4RCCA 3A7AA 1WXBA 3EHQA 3A5ZB 3HRSA 1QVGS 4RTVA 1K8AU 4JJCA 2CJAA 1KMMA 1BBZA 5A0LA 2OTJA 3QBYA 5CO7A 3MF2A 4RCBA 4BI3A 2LNHB 1AZEA 2YSQA 2ZR2A 2YHTA 3E2UA 5GAN6 2RH2A 3GNGA 1NJ6A 4ELZC 4F17A 3RIRA 4BE1A 3MQZA 3QDFA 3I5RA 3CD6A 2O9SA 2Y4XA 1Q86C 3GBQA 1SRLA 1W1FA 2RHZA 1KK7A 5K1PA 5KYUB 1Y57A 3FRNA 2QYZA 3X28B 5CCAA 4E7SA 2DO3A 5E3IA 4H2YA 2QDYB 3L4GA 1IHWA 3GLXA 3PVQA 1K73R 5LJ5h 3JB9H 2KVQG 5GAOq 3WXMB 4K87A 4OMLA 4DOWA 3OB9A 1RAIB 4XTVA 1VQOA 3UFGA 4PKCC 3NELA 4HVCA 1NJIR 3ZEHA 3W3SA 4P74A 2FZCB 2VUBA 2BUDA 2G6FX 3F70A 4FYYB 1MUZA 1WDXA 3QJYA 4C0ZA 1NYGA 2DNUA 4YPFA 3O5ZA 3N5BB 3CCVA 1FYNA 3EG3A 5GJWB 1OQKA 1ZSZB 1AEYA 1TUDA 4X9CA 3CXCS 1VA7A 2E41A 3OYKA 4IURA 1BU1A 2DQ0A 4G84A 4HWTA 5KYWB 1TG0A 1RI9A 3HXWA 3EGXA 2DXUA 3E1SA 4QQ6A 8ATCB 3BJUA 4KQEA 3QHSA 3HRUA 1IREB 5J26A 3AT1B 2CSQA 4Q5WA 3G4SQ 2DL7A 4RTWA 2KYBA 4JLGA 4HKEA 3JCMJ 5GAMf 4HT4A 4OB1B 5KCOA 2A36A 4TVYA 1NEGA 1V29B 1PSEA 1UGVA 1XJWB 2HKQB 4JJNK 1M8VA 1M1FA 4HCKA 4F7UB 1D0YA 4LVIA 3RDVA 3RMQA 3I56T 4P3PA 5CKDA 1YFTA 3VYHB 2CZ7B 2KEAA 4J9GA 2KBTA 3NFCA 5A2QE 1A0NB 1D1BA 2GQIA 5GAN2 1NYFA 1VQ8T 2OTJT 2DXTA 3URGA 1MGQA 1G2BA 2HQXA 1QVGP 1H3ZA 2CZ6B 3PGGA 4E2FB 4RG8A 4WCIA 5K1XA 4F14A 3JV3A 2DA9A 2PNIA 2AKWB 2KYMA 4A53A 3M54A 1M1KR 1YJ9A 2X4XA 5KYYA 3CXCA 2DILA 1BI1A 2JM9A 1KQ2A 2O4XA 2QAZA 2CP7A 1VQ9A 2K5LA 4ZN3A 2OTLT 1KD1U 1U3OA 5A0DA 3ER0A 1EFWA 1N8RC 3TSWA 3CCRQ 1PRMC 1D3BA 3HKSA 2PUOB 2DX1A 3BE3A 5IN1A 4OMMA 4PJJA 2NUZA 1G3SA 5A0GA 4CI0C 3J80E 2AHJB 3A98A 1T0JA 4EDUA 3G71A 2GQVA 1AHJB 1QKWA 1PC0A 2V8IA 3CCJQ 2COWA 1H641 1UEBA 2ED1A 4H2TA 4NOYA 4OP0A 1QWEA 2V1RA 1WX6A 1G5VA 5D7UA 2ZXFA 4CH4A 1B70A 2K6DA 4JS4A 4NCXA 1EQRA 2I2LA 1MMGA 3KBGA 3OYIA 2CDTA 2JZ2A 3S3MA 1M1KC 3CCUQ 1NNHA 1IZ6A 1GCPA 2ZCFB 4N4HA 4FCYA 3QO3A 4JLIA 1MMNA 2P4TA 4M7DD 2RHQA 4ATOA 3CBPA 3L2ZA 1VOMA 2DRMA 2LP5A 8AT1B 1OEBA 4H02A 4BACA 4K86A 2ZNIA 2ODRD 2QEXQ 1BIBA 2A28A 5D6YA 1MNDA 3HFOA 1QLYA 1Y96B 2E64A 1WXUA 2HBPA 2F5TX 4IIOA 3TVTA 2X35A 3JCMQ 4KR2A 2NUTA 4JRQA 5GAN5 1VQKT 1VQ9Q 1S72A 1NJ5A 2W0ZA 2D8JA 4ZTZB 5ELNA 3QNEA 2L3RA 4JDSA 4C92C 1AVZC 5GAMj 3TREA 1Q81C 4M7DA 2J3LA 2JMAA 4J6YA 4C5HA 3EGDB 2VGNA 3H0FA 5KNNA 2ESWA 4HVUA 1CKBA 2HQHA 1Q81U 1AWJA 2JTMA 2ZPFB 2KNBB 4C92F 1YJWT 3SFMA 3LSQA 2DL8A 2YT6A 1QF6A 2RJCA 1GBQA 3M0TA 2K2VA 3UWNA 1VQOT 4J9DA 3R6OA 1ZUYA 3CCLQ 4M7AA 3PNWC 2FG0A 3VRZA 3SHWA 3KFUA 1X6GA 3CCRT 2MK5A 4V2SA 1UTIA 3SDZA 4L6V5 4HCZA 3EH2A 4PFOA 1AD5A 4RKUE 3X25B 4N4GA 1YI2T 5D6XA 3CCMA 2ZT6A 2ARTA 5IXFA 2ZR3A 3CCET 1HJDA 4WI1A 5GMKe 5CKFA 5GMKj 3C4SA 1IL2A 3CCSQ 3M59A 4C0DC 1T0HA 4F16A 2RF0A 2EGEA 2R58A 4PFZA 2BZ8A 2JVVA 4LD6A 2ZIMA 1E1TA 4JZ4A 3A8OB 3E9HA 3H6ZA 4OMFB 3TEGA 4E47A 2P0PA 4DA4A 1NJIU 2HZYA 3QIIA 3EG9A 3JCMW 2LT1A 1VQPT 2RB6A 5LJ5e 3HRKA 4Z8AA 1M2VA 1VYVA 1NEBA 3UATA 3EH1A 3REAB 5DLOA 3JCMe 4RTUA 3CPWS 2RK1A 4YCWA 1SG5A 1I81A 2J6OA 4M78C 1Q95G 2A3LA 2XDDA 4XTZA 1R0CB 5KYNA 3U23A 2A8EA 1CKAA 3OYAA 4BI8B 2RHQB 3ULRB 1SSHA 2FPDA 1VQMA 3GIBA 2PZ1A 4FW2A 4A54A 2RO0A 2DRKA 3EG1A 3V8KA 1BYMA 4J7IA 3G71Q 3HXUA 1IB8A 1PKSA 2GTOA 2AIRB 5LJ5f 2AMCA 3L2WA 4WTOB 1I4K1 4LDWA 2X3WD 3CXCP 1WLEA 1U1SA 1TH7A 2RHXA 2FPEA 4K11A 4YRSA 3BFMA 1YITQ 3JCMf 2B86A 1KSWA 2EYYA 1VYTA 4C92E 1FX7A 3JCMP 2DU5A 4N0AA 3CC4Q 5DM7R 3PCOA 4II1A 1IGUA 3META 3UH0A 2YLCA 3A32A 4YRRA 3REBB 3V8LA 2HDAA 2EGAA 3JCMc 2ZIOA 3M0QA 3H8ZA 2DJQA 3NEMA 3ZFJA 2NLUA 1YITT 4KRTA 2K3BA 3MKDA 1O9SA 2KRMA 5LJ3e 1Z9QA 1NLPC 4H2VA 3CBMA 5I2MA 2KK4A 4P75A 5FU6B 2E3IA 2KRNA 1YNZA 3QUIA 2DEUA 1FMKA 4OMPA 2DTIA 1HYOA 1U8RA 2L2PA 2Y90A 1WJRA 3M58A 1WLPB 1WI7A 5L8RE 2CS7A 2FO0A 2DYBA 2MWPA 1WHJA 5CK9A 1H4QA 2OAUA 3VS3A 1SHFA 2E12A 1M2VB 1YCSB 1NZ9A 4DBFA 4E7IA 2H3JA 2J06A 1D1CA 3CCEQ 4TTVA 3IKMB 1OU9A 4DBRA 4E51A 1X75C 1C1AA 1W70A 4EO4A 1RAFB 3EG2A 4P73A 3WVDB 3Q1JA 5LJ3h 4Q15A 5GAOr 3MEVA 4KGZB 3PCOB 3OBYA 1JJ2A 2DK3A 2LNVA 2V26A 4EX5A 2XU8A 4Z02A 3UDCA 4PJLA 2ODRC 4QT7A 4KULA 2QA4T 4ANJA 4PK4A 4BDZA 2E5AA 2DPPB 2GCXA 3UGTA 4MMKA 2YUNA 1JO8A 5CQYA 1H3HA 4YDQA 7AT1B 2WSFE 3M9QA 4R55A 2P0QA 3M0RA 3HY0A 4J83A 1ZUUA 4PJOF 4A63B 3OYYA 3NETA 5EG2A 3CCSA 1VQ5A 4B9WA 1G8XA 1GRIA 1Q82U 2CGHA 4PLLA 2L8DA 2OAWA 4C0DB 4PG3A 4NS5A 3VUBA 2KAFA 4YRJA 2VVKA 4C8QD 4XEOA 1B7YA 4E7LA 3TSZA 1EIFA 1UG1A 1NJ8A 4D8DA 4PJOC 3ICAA 4BWAA 4TQDA 4C8QG 2K2MA 5FLXE 3HFZA 1OZ2A 2F1LA 3EG9B 3L2QA 2C06A 4YRMA 1VQ7Q 3OW2S 1RAGB 4J7FA 2M0YA 4OGEA 3OYDA 3M55A 4CS3A 2KR3A 4ORZA 5GAN7 3V8JA 1NLOC 5CKBA 1L0WA 4N0AC 1RACB 1X55A 4PJOG 2JJ9A 5KYWA 1K76A 1AWXA 5GAMh 3OYMA 5KE3A 4H2XB 4QKUA 3MCAB 2A08A 3OSSC 4HVVA 1Y71A 4Y28E 4JZ3A 4RTZA 2NWMA 1UJYA 5LL6S 3CD6T 2EYZA 4C5EA 1NPPA 2RI2A 2EYQA 2LCCA 4PJOA 1NG2A 1KMNA 1XQHA 2M16A 1UGQB 2YLBA 5GAOl 2M02A 3FDRA 4K88A 2PTKA 4M78B 4ZN1A 1EFNA 5LJ5g 1Q7YC 1WQ7A 2DZ9A 4LN2A 4M75F 3L2RA 2K57A 4JPBW 4XU3A 2HBWA 4C0FA 4ZTUB 2QTVA 2PUKB 3JCMg 5GMKh 1RL2A 1K0XA 1UGPB 4RTXA 2KRSA 4C0GA 3S3NA 4OMOA 2AK5A 4DEXA 1T3SA 4FT2A 2ECZA 1KQSS 3HL8A 4EMHA 1U1TA 4KUIA 1FXXA 1QMCA 3CC7Q 3CCQQ 2DFUA 2C0TA 1B7YB 3I55T 2OTJQ 2VKNA 2L3SA 2ZPHB 3OS0A 4Q6GA 1IO6A 1ZQ1A 4M78D 1X56A 2C0IA 1N6AA 4YRFA 3RNJA 4PJNA 4FSXA 1IXDA 2KI7A 4PJOD 2EW3A 2GFUA 1K9AA 3R07A 2ALYA 2E5QA 4C8QC 3QWYA 3H9NA 3GNFB 3CEYA 2MAMA 5FU6C 3E9IA 4RDXA 1BI3A 3CPWP 4EMKA 2HL3A 5GANf 3KXTA 1EVLA 1MV0B 1M90C 1YGBA 1BCOA 3A7UA 3OY9A 2QA4Q 3JB9J 2PVOB 3M4QA 3HFZB 2EJ9A 2D6FA 4XU0A 2J7IA 3E9FA 3JCMV 3VQVA 2DXCA 2E3HA 3G4ST 4YCUA 3UA6A 2QQBA 1YJ9T 4RUGA 2EFIA 2QXFA 1X6BA 2DBMA 3QDRB 4OVAA 1OX9A 4QW2A 4RQEA 2HAXA 2RM4A 2R57A 4M78A 1K9MU 2JT4A 4IUTA 1Z7NA 2FRYA 2DTHA 3I35A 1PSFA 3QYHB 1JJ2S 3HRTA 4HXJA 3A8HB 1YHQA 1WA7A 2DDZA 3FC3A 2VYTA 4M7DB 2QQSA 4QVZA 5GJVB 3BY7A 1Q82C 1LNXA 5KE2A 1BBUA 3L1AA 5GAMe 2EQJA 1JB0E 3HTZA 1SHGA 4KGXB 4F7UF 3I56A 4J9IA 4R0KA 3PMTA 2ALYB 2L0AA 3IG2A 4ZGJB 2CT4A 1D0ZA 1NE8A 1PNJA 2GFAA 4A4FA 5LJ3f 3SD4A 1EVKA 2I4NA 2B8AA 4HA8A 2LC4A 4G85A 2K7AA 4J9EA 1IRXA 2CZ1B 1PM3A 4E6RA 4M75C 3TEEA 1AOJA 2D8HA 4KT0E 4QQDA 1QVFA 2MIOA 3PE0A 4P73C 1PCXA 4J9HA 2P0KA 3DSQA 4M7AE 2DJZA 1KIKA 1TXQA 1G3YA 3QTCA 2ZPEB 1NYQA 4EMKB 3OYEA 2ZGWA 4H2UA 1K8AC 3CC7T 4LDUA 1H92A 5M9OA 3CCLA 4J6WA 2OTLQ 4CH3A 4CH6A 5GAN4 5EC7A 3GP8A 2FL7A 3UA7A 1VQNQ 1YIJT 2COZA 4RG2A 4X1VA 1OOTA 1WGSA 4C8QE 2D0NA 3RUXA 2FRWA 3RKXA 2JM8A 2KROA 2CUBA 3UPUA 1VQLA 4TWAA 2FPFA 3L2UA 1M90U 4J8OA 2K79A 4P75C 1BI0A 2J05A 5GMKm 4CC7A 2KQWA 1H4VB 4J5YA 1SRYA 1MV3A 1WPYA 4M77A 3VV0A 1QQJA 4BW9A 3QYGB 3BW1A 3C94A 1X43A 3A8LB 1KFZA 1YHQT 2O88A 2LRQA 4WJ3M 3GPLA 2MMPA 4NL2A 4QVCA 1M90R 4H2XA 1I07A 2KXCA 3JAME 3SEMA 1JXMA 2EAYA 1E6HA 1BCMA 2XD0A 1HSQA 2WACA 4YTLA 1ZLMA 4FYWB 3OBWA 2JTEA 3CCUA 2KSSA 4M77F 2CJBA 2RK2A 3LWHA 1KHIA 2HKNA 4HT8A 1KQSA 5J3BA 2MOXA
chains in the Genus database with same CATH topology
5C6SA 1N27A 11ASA 1VQ6A 1HC7A 3PZCA 2IY5B 1Y7XA 2K5IA 2MI6A 3CCMT 3SWNB 3LGFA 4UP9A 1Q7YU 1YITA 4L5GA 4RMFA 4YRQA 3G4SA 4BY6C 5FU7B 1WU7A 2DIQA 3MEWA 2JTFA 1ASYA 1QP3A 4M75E 3WVEB 1H4SA 2Y4YA 3QZ9B 4P72C 4ZGDB 2XDPA 5GAN3 2K3YA 4C5IA 1G5IA 4R56A 3CMEA 5GANd 2AKWA 4GY5A 4LVMA 3RERA 3FB9A 1USYC 3DLMA 4X5OA 1YIJA 1XOVA 3PTAA 5HK3A 1ADYA 4PNOA 5CIUA 3BDLA 2EQKA 2ZCEA 4A4KA 2XTIA 2WSEE 2XICA 1ADJA 3V7RA 4PJOE 4OF1A 3VQYA 1WQWA 3OS5A 1SERA 5HK0A 2K5FA 3JCMX 2KY9A 5I2SA 4XU1A 4M7AG 1M1GA 4DOVA 2EQMA 3EAEA 3DKMA 2ARUA 1JJCB 2BIVA 12ASA 4M7DC 1X2GA 3HXVA 1YJWA 3HXYA 3CCJT 2DZCA 5LJ3d 4PLIA 3NTIA 5C53B 2RHIA 2DQ3A 4M77E 3OQ5A 2X4JA 2CYZB 3VYGA 1VQMT 1FWZA 4HWRA 3MP8A 1PYSA 1VIFA 1N9WA 5GANj 2M9UA 5CAIA 1E22A 4IUPA 1LYLA 2XGTA 4YRCA 3MP1A 5GANh 4AH6A 3OYLA 5I21A 4OB0B 2DU7A 1VQ7T 1KQ1A 2QHVA 1N9RA 2FHDA 3QXEB 3PIOA 5FRMA 3HSBA 1NYRA 3J81E 1KC8C 1KOGA 1X6OA 2KMTA 3V7CA 1H4TA 3P8DA 4M7AB 5C52B 3PMIA 4TQFA 3NTHA 5LJ3j 4MMLA 4L59A 4ZIBA 1LOJA 3G6ET 2Q5HA 1SSFA 5ELOA 2ZZGA 2IVWA 4MZTA 1BI2A 1EOVA 1XTDA 2LT4A 2PMFA 4BD3A 4HWSA 4Y91A 3BDUA 2VGMA 2I4MA 1UGSB 1W4SA 4M7DE 1ATIA 1VQZA 1WJQA 4M75B 1B34B 3CCJA 3CMQA 3RL6A 4BUGA 3ME9A 4GLKA 2M1HA 4HCCA 4HT9A 3ZBDA 1X54A 2R5AA 1VQ8A 3ERRA 3I55A 3REXA 2EIFA 2RJFA 4M75D 1UB4A 2ZPIB 1YJNA 3I7FA 2D0QB 2Q7HA 3X26B 1G3TA 4A4HA 2PMEA 3VUZA 2LTOA 1VQKA 2QEXT 3OSVA 3C95A 2VXFA 2E1HA 2F69A 1M9SA 3UT1A 1DJ7B 2RJEA 4LVJA 1QVFS 2QA4A 3C12A 3CMET 4ME7A 3OMCA 2EKOA 3X24B 4L87A 3GF5A 2DEQA 2VC8A 3T9NA 3MHXA 5KCHA 4MDXA 3HXZA 4HWOA 4FM4B 3WQZA 3M57A 4UC4A 4XTYA 3PIPA 3RMSA 3OYJA 4A4GA 4KBMB 3LYIA 3CPWA 1VQ4T 4C92D 3QO7A 2EL9A 2ZZDA 1X01A 1UGRB 2QQAA 1VQ7A 2ZTGA 4XEMA 4OB3B 5IT9E 3JCMd 2QQ9A 4VUBA 5LJ5d 4DQ2A 4J15A 3HXXA 3A5YA 3JCMb 3ASKA 5HKCA 4P72A 4BY6B 4F7UA 2X4YA 1XNIA 1E24A 3FLGA 4OGCA 1FYFA 2LCLA 1B8AA 2RHSA 5LJ3g 1NJ1A 2C8MA 4BDYA 4BB7A 3JB9D 4JRKA 1EIYB 3E9GA 2RI5A 3SWNA 3P8YA 2PVDB 1I8FA 5CVIA 3S3OA 2P0LA 4EPCA 3CC7A 3CCLT 4CH5A 3IKLA 4C92A 3QO8A 1YJNT 4UPAA 5GMKl 2RHUA 2L5QA 4BI4A 5D6WA 2ZINA 4F7UE 1OZ3A 1RI0A 3LW5E 2K3XA 2QI2A 1G3WA 1J5WA 2M0OA 4WF2A 3CBOA 2EJGA 4BE2A 3LWIA 4C8QA 4YRTA 3OW2A 2DVEA 3LX7A 4WJ4A 1KC8U 1R8OB 3M4PA 1NJIC 4YRKA 2EWNA 4XTWA 3SWNC 4LDYA 3TEHA 1KD1C 2CIMA 3LH0A 1RIQA 1O75A 2ZT5A 2XDBA 5GANg 3MEAA 2IY5A 3OYBA 4YRLA 4J6XA 2E10A 3GOXA 2PVGB 4FL6A 4PL6A 2E70A 1YI2A 1VQNT 4X9DA 5FU7C 3CC4A 1YCYA 1VQ5T 2XHCA 2QHSA 1W2BA 2CZ0B 4TVAA 1C0AA 5GAN8 2E65A 2ZZEA 4A4EA 2ZPGB 3TU4K 1HTTA 2GF7A 2I4LA 2LQ8A 4E7JA 3QJ6A 2G4CA 3E19A 3JCMh 3RKWA 2E6ZA 4M75A 3OYNA 3OS1A 2VV5A 4X34A 3V7SA 3RKYA 3INZA 1Y96A 4XAXB 3NENA 2RJDA 4F7UG 4C8QF 5AYFA 1VQLT 3M4GA 3MO8A 5HGQA 3OYGA 3PFSA 3A8GB 5CKHA 5CR2A 4M77C 3X20B 3A8MB 4M7AD 1VUBA 4YRPA 3MEUA 1JRIA 3JRZA 2JOYA 4YRGA 2CJ9A 3L2VA 2DXBA 2JN0A 4XK8E 3CCST 4P74C 2E6NA 4RQFA 4M77B 3OYFA 2V8KA 2MF2A 2ZPBB 4FIBA 3OYCA 3QSUA 3DB3A 2PQWA 3OYHA 5IAYA 2OTLA 1QE0A 4E7HA 2CKKA 5CQXA 4FU6A 3TCJA 3MEYA 4H2WA 3HHTB 1VQNA 2EQUA 2ARSA 3CC2A 4TVAB 3DB4A 3OMGA 1I5LA 2WSCE 2Q7GA 4ZTJA 2RHYA 4LDXA 1N8RU 4M77D 3CCQT 1M5Q1 1BIAA 1YB3A 1OI1A 3EFRA 1K9MC 3REUA 1BBWA 3J7AF 2Q7EA 1YFSA 1QVGA 3CC4T 4JRPA 3CMAT 5CKEA 3M4YA 4YREA 1WJSA 4TVRA 4XTXA 4CS2A 2I4OA 2LDMA 4CS4A 4MDWA 3VBBA 3VQWA 4QVDA 1YFRA 3QKJA 1ZBXA 4M77G 1G5HA 4ZTFA 2FYKA 5C0MA 2C7IA 4XU2A 3JB9F 2Q5IA 3RF1A 3NTKA 2G3RA 2XI9A 1S72T 3PT9A 3P8HA 4XQ3A 4XTUA 1VQ6T 4C92B 3RGLA 2BKDN 5F5WA 3A74A 5FRNA 3L42A 4QQGA 3FJPA 2ZNJA 2DTOA 2KDSA 4YRNA 1X2HA 2QTXA 3G1ZA 3CCRA 4BE0A 2PU9B 4C5GA 1B34A 4M7DG 4C8QB 5DLQE 4OB2B 3G71T 3VU3C 2V8JA 2R5MA 4O6JA 2X4WA 3HY1A 5GANe 3JSCA 2LQKA 2ZT8A 3TEHB 2DD4A 2P5IA 4O5VA 3CCQA 4HWPA 3HFVA 1Y07A 4PJOB 2RA2A 3A5ZA 1ZHIA 3LGLA 3M53A 4YP0A 3IALA 5GMKi 1N9SA 4O2DA 4LVKA 4EMGA 4YCVA 4H2SA 1JBMA 1K73C 1QP2A 3JB9I 2RI3A 1JJCA 1PYSB 1B70B 3M5AA 4N4IA 1OYXA 1HK9A 3HPWA 4IKFA 3S6WA 2DKGA 3VQXA 4HCBA 3G6EA 4M78G 5C51B 2FVUA 1QW1A 1Z7MA 5LJ5j 3QPHA 4C92G 1D3BB 3VJPA 1QVPA 1YBYA 2DD5A 3HRIA 1WNLA 2DIGA 1G51A 4YRIA 4M7AC 4ZGEB 2ZT7A 4LDVA 5GAOm 4KR3A 1M1KU 4LNSA 1NPRA 1P92A 3VKIA 5FROA 1VQPA 2QQRA 4IUQA 3CMAA 4MZMA 2HNIA 4UP7A 2A7YA 2FB7A 4M78F 3FIFA 3LLRA 3LC0A 3AHUA 3RACA 3DLLA 3MP6A 4M7DF 3A31A 2XIDA 4KUDK 2HQEA 3CCEA 3CC2T 3HP9A 4P3OA 2RHSB 3LSSA 1KHCA 1W2BS 3L4GB 4UP8A 4OLFA 4M75G 5KH6A 1GGMA 5J39A 4P5NA 1EIYA 1HXDA 4P71A 2LX9A 3OD1A 4YROA 2F5KA 4EMKC 1NJ2A 4RMOA 1SESA 4NL3A 3O8VA 4LD9K 1SETA 2QEXA 4E7KA 2LVMA 3CCUT 3JB9G 3SB2A 5GAOp 4LVLA 1VQ4A 3G7ZA 3P8TA 1KG1A 1K73U 3P8BB 4ELYC 4TVWA 3EFSA 3UGQA 1USYA 3QG1A 4PHCA 3OA6A 5GAMd 2ZZFA 2O4XB 3FEOA 3OS2A 2QHTA 4P3NA 4JUVA 2DAQA 2RD1A 5GAMg 2JUFA 4JRIA 2J3MA 2QHUA 1LJOA 5GAOn 1MHNA 1WYDA 1W66A 1GXIE 2E3CA 2D9TA 3QZ5B 4IUVA 3CCVT 4CRIA 1ASZA 3TUPA 3P8VA 3QO5A 2MWOA 4JS5A 3RESA 3MF1A 2XK0A 1VIEA 5DY9A 4M78E 1E1OA 4M7AF 2YRVA 3A7RA 2VXEA 3CPFA 4P71C 5HY6A 1BKBA 2JNGA 2O01E 2HD0A 2NS6A 4DPGA 4IUUA 4YYEA 4MZPA 3HFNA 2XG8D 4FT4A 1M4ZA 2IG0A 2XKOC 1VQ9T 2AMCB 1Q86U 4D6WA 2EJFA 3KUFA 4B9XA 3M56A 2L89A 2K4YA 1B76A 4RCCA 3A7AA 3A5ZB 3HRSA 1QVGS 1K8AU 2CJAA 1KMMA 5A0LA 2OTJA 3QBYA 5CO7A 3MF2A 4RCBA 4BI3A 2ZR2A 2YHTA 5GAN6 2RH2A 3GNGA 1NJ6A 4ELZC 4BE1A 3RIRA 3MQZA 3CD6A 2Y4XA 1Q86C 2RHZA 5K1PA 3FRNA 3X28B 5CCAA 2DO3A 5E3IA 4H2YA 2QDYB 3L4GA 3GLXA 5LJ5h 3JB9H 2KVQG 5GAOq 3WXMB 4K87A 4DOWA 3OB9A 4XTVA 1VQOA 3UFGA 4PKCC 3NELA 4HVCA 3ZEHA 3W3SA 4P74A 2VUBA 2BUDA 3F70A 3QJYA 4C0ZA 4YPFA 3N5BB 3CCVA 4X9CA 3CXCS 2E41A 3OYKA 4IURA 4G84A 2DQ0A 4HWTA 3HXWA 4QQ6A 2DXUA 3E1SA 3BJUA 4KQEA 3QHSA 3HRUA 1IREB 5J26A 4Q5WA 4JLGA 4HKEA 3JCMJ 5GAMf 4HT4A 4OB1B 5KCOA 4TVYA 1V29B 1PSEA 4JJNK 1M8VA 1M1FA 4F7UB 4LVIA 3RMQA 3I56T 4P3PA 5CKDA 1YFTA 3VYHB 2CZ7B 3NFCA 5A2QE 1VQ8T 5GAN2 2OTJT 2DXTA 3URGA 1MGQA 2HQXA 1H3ZA 2CZ6B 3PGGA 4RG8A 5K1XA 2AKWB 4A53A 3M54A 1YJ9A 2X4XA 3CXCA 1BI1A 1KQ2A 2O4XA 1VQ9A 2OTLT 2K5LA 4ZN3A 1KD1U 5A0DA 3ER0A 1EFWA 1N8RC 1D3BA 3HKSA 2PUOB 5IN1A 5A0GA 4CI0C 1G3SA 3J80E 2AHJB 4EDUA 3G71A 2GQVA 1AHJB 2V8IA 1H641 1UEBA 4H2TA 4NOYA 4OP0A 1G5VA 2ZXFA 4CH4A 1B70A 4JS4A 4NCXA 1EQRA 2I2LA 3KBGA 3OYIA 2JZ2A 3S3MA 1M1KC 1NNHA 1IZ6A 2ZCFB 4N4HA 3QO3A 4JLIA 2P4TA 4M7DD 2RHQA 4ATOA 3CBPA 3L2ZA 4H02A 4BACA 4K86A 2ZNIA 2ODRD 1BIBA 5D6YA 3HFOA 1Y96B 2E64A 2HBPA 2F5TX 3JCMQ 2X35A 4KR2A 4JRQA 5GAN5 1VQKT 1S72A 1NJ5A 4ZTZB 5ELNA 3QNEA 2L3RA 4JDSA 4C92C 5GAMj 3TREA 1Q81C 4M7DA 2J3LA 4J6YA 4C5HA 2VGNA 5KNNA 1Q81U 2JTMA 2ZPFB 4C92F 1YJWT 3SFMA 3LSQA 1QF6A 2RJCA 2K2VA 3UWNA 1VQOT 3R6OA 4M7AA 3PNWC 3KFUA 3CCRT 4V2SA 3SDZA 4L6V5 4HCZA 4RKUE 3X25B 4N4GA 1YI2T 5D6XA 3CCMA 2ZT6A 2ARTA 2ZR3A 3CCET 4WI1A 5GMKe 5CKFA 5GMKj 3C4SA 1IL2A 3M59A 4C0DC 2R58A 2JVVA 4LD6A 2ZIMA 1E1TA 3E9HA 3A8OB 3H6ZA 4OMFB 3TEGA 4E47A 2P0PA 4DA4A 1NJIU 3QIIA 3JCMW 2LT1A 1VQPT 2RB6A 5LJ5e 3HRKA 5DLOA 3JCMe 3CPWS 2RK1A 4YCWA 1I81A 4M78C 2A3LA 2XDDA 4XTZA 2A8EA 3OYAA 4BI8B 2RHQB 1VQMA 3GIBA 4A54A 2RO0A 1BYMA 3V8KA 4J7IA 3HXUA 2AMCA 5LJ5f 3L2WA 1I4K1 4LDWA 1WLEA 1U1SA 1TH7A 2RHXA 4YRSA 3BFMA 3JCMf 4C92E 1FX7A 3JCMP 2DU5A 4N0AA 5DM7R 3PCOA 4II1A 3META 3UH0A 2YLCA 3A32A 4YRRA 3V8LA 3JCMc 2ZIOA 3H8ZA 3NEMA 3ZFJA 2NLUA 1YITT 1O9SA 5LJ3e 4H2VA 3CBMA 5I2MA 2KK4A 4P75A 5FU6B 3QUIA 2DTIA 1U8RA 2Y90A 1WJRA 3M58A 5L8RE 2CS7A 2MWPA 5CK9A 1H4QA 2OAUA 2E12A 1NZ9A 4E7IA 2H3JA 4TTVA 3IKMB 4E51A 1X75C 4EO4A 4Q15A 4P73A 3WVDB 3Q1JA 5LJ3h 5GAOr 3MEVA 3PCOB 3OBYA 1JJ2A 2DK3A 2LNVA 4EX5A 2XU8A 4Z02A 3UDCA 2ODRC 4KULA 2QA4T 4BDZA 2E5AA 2DPPB 2GCXA 3UGTA 4MMKA 5CQYA 4YDQA 2WSFE 3M9QA 4R55A 2P0QA 3HY0A 4J83A 4PJOF 3OYYA 3NETA 5EG2A 3CCSA 1VQ5A 4B9WA 1Q82U 2CGHA 4PLLA 2L8DA 4C0DB 4PG3A 4NS5A 3VUBA 2KAFA 4YRJA 4C8QD 4XEOA 1B7YA 4E7LA 1EIFA 1NJ8A 4PJOC 3ICAA 4BWAA 4TQDA 4C8QG 5FLXE 3HFZA 1OZ2A 3L2QA 2C06A 4YRMA 3OW2S 4J7FA 4OGEA 3OYDA 3M55A 4CS3A 5GAN7 3V8JA 5CKBA 1L0WA 4N0AC 1X55A 4PJOG 5GAMh 3OYMA 5KE3A 4H2XB 3MCAB 3OSSC 1Y71A 4Y28E 5LL6S 3CD6T 4C5EA 1NPPA 2RI2A 2EYQA 2LCCA 4PJOA 1KMNA 1XQHA 2M16A 1UGQB 2YLBA 5GAOl 3FDRA 4K88A 4M78B 4ZN1A 5LJ5g 1Q7YC 1WQ7A 2DZ9A 4M75F 3L2RA 2K57A 4XU3A 4C0FA 4ZTUB 2PUKB 3JCMg 5GMKh 1RL2A 1UGPB 4C0GA 3S3NA 4FT2A 1KQSS 3HL8A 4EMHA 1U1TA 4KUIA 1FXXA 1B7YB 3I55T 2ZPHB 3OS0A 4Q6GA 1ZQ1A 4M78D 1X56A 1N6AA 4YRFA 4FSXA 4PJOD 2GFUA 3R07A 2ALYA 2E5QA 4C8QC 3GNFB 3CEYA 2MAMA 5FU6C 3E9IA 4RDXA 1BI3A 4EMKA 5GANf 3KXTA 1EVLA 1M90C 1YGBA 3A7UA 3OY9A 3JB9J 2PVOB 3M4QA 3HFZB 2EJ9A 2D6FA 4XU0A 3E9FA 3JCMV 3VQVA 2DXCA 3G4ST 4YCUA 2QQBA 1YJ9T 2EFIA 2QXFA 3QDRB 4OVAA 4QW2A 4RQEA 2HAXA 2RM4A 2R57A 4M78A 1K9MU 4IUTA 1Z7NA 2DTHA 1PSFA 3QYHB 1JJ2S 3HRTA 1YHQA 3A8HB 2DDZA 3FC3A 2VYTA 4M7DB 2QQSA 4QVZA 3BY7A 1Q82C 1LNXA 5KE2A 1BBUA 3L1AA 5GAMe 2EQJA 1JB0E 3HTZA 4F7UF 3I56A 3PMTA 3IG2A 2ALYB 4ZGJB 1NE8A 2GFAA 4A4FA 5LJ3f 3SD4A 1EVKA 2I4NA 2B8AA 4HA8A 2LC4A 4G85A 2CZ1B 4M75C 3TEEA 4KT0E 4QQDA 1QVFA 4P73C 2P0KA 3DSQA 4M7AE 2DJZA 1G3YA 3QTCA 2ZPEB 1NYQA 4EMKB 3OYEA 2ZGWA 4H2UA 1K8AC 3CC7T 4LDUA 5M9OA 3CCLA 4J6WA 4CH3A 4CH6A 5GAN4 3GP8A 2FL7A 1YIJT 4RG2A 1WGSA 4C8QE 3RUXA 3RKXA 3UPUA 1VQLA 4TWAA 3L2UA 1M90U 4J8OA 4P75C 1BI0A 5GMKm 2KQWA 1H4VB 4J5YA 1SRYA 1WPYA 4M77A 3VV0A 4BW9A 3QYGB 3BW1A 3C94A 3A8LB 1YHQT 2LRQA 4WJ3M 3GPLA 2MMPA 4NL2A 4QVCA 4H2XA 3JAME 2EAYA 2XD0A 2WACA 4YTLA 3CCUA 3OBWA 2CJBA 2KSSA 4M77F 2RK2A 3LWHA 1KHIA 4HT8A 1KQSA 5J3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TH7 A;  4J6X A;  3P8V A;  11AS A;  4YRS A;  3BFM A;  2E10 A;  3JCM f;  1HC7 A;  3PZC A;  3QO5 A;  2IY5 B;  4C92 E;  3JCM P;  2DU5 A;  4N0A A;  3PCO A;  3RES A;  3MF1 A;  3SWN B;  3UH0 A;  2YLC A;  3A32 A;  4YRR A;  5DY9 A;  3V8L A;  4M78 E;  3JCM c;  1E1O A;  4UP9 A;  4M7A F;  2ZIO A;  4X9D A;  3A7R A;  2VXE A;  3NEM A;  4RMF A;  4YRQ A;  1YCY A;  2QHS A;  5LJ3 e;  4P71 C;  1WU7 A;  4TVA A;  1C0A A;  5GAN 8;  1ASY A;  4H2V A;  2E65 A;  2ZZE A;  4M75 E;  1HTT A;  4P75 A;  1H4S A;  2I4L A;  2G4C A;  4P72 C;  3QUI A;  3JCM h;  5GAN 3;  3RKW A;  4DPG A;  4YYE A;  1G5I A;  2DTI A;  3HFN A;  4M75 A;  2Y90 A;  3V7S A;  3RKY A;  3INZ A;  1Y96 A;  5GAN d;  2AMC B;  2AKW A;  1H4Q A;  3NEN A;  4F7U G;  4C8Q F;  2EJF A;  3M4G A;  3RER A;  3FB9 A;  5HGQ A;  1B76 A;  1USY C;  4RCC A;  3A7A A;  4X5O A;  4TTV A;  3IKM B;  4M77 C;  4M7A D;  4E51 A;  2CJA A;  1KMM A;  4YRP A;  4EO4 A;  1ADY A;  3MF2 A;  4PNO A;  4Q15 A;  4P73 A;  4RCB A;  5LJ3 h;  5GAO r;  1JRI A;  3PCO B;  2ZCE A;  4YRG A;  2XTI A;  2CJ9 A;  4EX5 A;  2ZR2 A;  2YHT A;  1ADJ A;  2ODR C;  3V7R A;  5GAN 6;  4PJO E;  3VQY A;  2JN0 A;  1WQW A;  2E5A A;  1SER A;  1NJ6 A;  3JCM X;  4P74 C;  3UGT A;  4MMK A;  3RIR A;  4RQF A;  4XU1 A;  4M7A G;  4YDQ A;  4M77 B;  2ARU A;  5K1P A;  1JJC B;  12AS A;  4M7D C;  1X2G A;  3HXV A;  3HY0 A;  3HXY A;  2DZC A;  3QSU A;  5E3I A;  4PJO F;  5LJ3 d;  5C53 B;  4H2Y A;  3L4G A;  2DQ3 A;  4M77 E;  3NET A;  5LJ5 h;  3JB9 H;  1QE0 A;  5GAO q;  4H2W A;  3MEY A;  4K87 A;  2CGH A;  4HWR A;  4PG3 A;  4XTV A;  2ARS A;  3UFG A;  4TVA B;  4YRJ A;  4C8Q D;  4XEO A;  1I5L A;  1PYS A;  3NEL A;  1B7Y A;  4HVC A;  1NJ8 A;  2Q7G A;  3W3S A;  4PJO C;  4P74 A;  1N9W A;  3ICA A;  4M77 D;  4BWA A;  4TQD A;  5GAN j;  1M5Q 1;  1BIA A;  4C8Q G;  1YB3 A;  5CAI A;  3HFZ A;  3EFR A;  4YRM A;  1E22 A;  1LYL A;  1BBW A;  3REU A;  2XGT A;  4YRC A;  2Q7E A;  5GAN h;  1YFS A;  4YPF A;  4AH6 A;  4CS3 A;  5I21 A;  5GAN 7;  2DU7 A;  3V8J A;  1KQ1 A;  1L0W A;  4N0A C;  1X55 A;  2QHV A;  1N9R A;  4PJO G;  4X9C A;  5GAM h;  4H2X B;  2E41 A;  4YRE A;  4G84 A;  2DQ0 A;  4XTX A;  4HWT A;  4CS2 A;  3HSB A;  3HXW A;  2DXU A;  2I4O A;  4CS4 A;  3BJU A;  1NYR A;  4KQE A;  3QHS A;  1KOG A;  3VBB A;  3VQW A;  3JCM J;  5GAM f;  3V7C A;  4QVD A;  4TVY A;  1H4T A;  1YFR A;  4M7A B;  5C52 B;  1M8V A;  4M77 G;  1G5H A;  4PJO A;  2FYK A;  4F7U B;  4TQF A;  5LJ3 j;  1KMN A;  4MML A;  4P3P A;  1YFT A;  2C7I A;  2YLB A;  4XU2 A;  3JB9 F;  4ZIB A;  5GAO l;  1LOJ A;  2Q5I A;  4K88 A;  3RF1 A;  2Q5H A;  4M78 B;  5ELO A;  2ZZG A;  5LJ5 g;  5GAN 2;  1WQ7 A;  4XQ3 A;  2DZ9 A;  1EOV A;  2DXT A;  4M75 F;  1MGQ A;  4XTU A;  2K57 A;  4XU3 A;  4C92 B;  3RGL A;  4ZTU B;  2PMF A;  4HWS A;  5F5W A;  3JCM g;  4Y91 A;  5GMK h;  3A74 A;  3BDU A;  3PGG A;  2I4M A;  3FJP A;  2ZNJ A;  5K1X A;  2DTO A;  4YRN A;  1X2H A;  2QTX A;  2AKW B;  4A53 A;  3G1Z A;  4EMH A;  1B34 A;  4M7D G;  1U1T A;  1KQ2 A;  4C8Q B;  4M7D E;  1ATI A;  1VQZ A;  1B7Y B;  3VU3 C;  4Q6G A;  4M75 B;  1EFW A;  3HY1 A;  1B34 B;  4M78 D;  1X56 A;  3CMQ A;  5GAN e;  3RL6 A;  2ZT8 A;  3TEH B;  4YRF A;  2P5I A;  1D3B A;  4HT9 A;  3HFV A;  4HWP A;  1X54 A;  4PJO B;  3ERR A;  3REX A;  2RA2 A;  4PJO D;  3A5Z A;  1H64 1;  4H2T A;  4YP0 A;  4NOY A;  3R07 A;  4OP0 A;  3IAL A;  2ALY A;  4C8Q C;  5GMK i;  4M75 D;  1N9S A;  4O2D A;  2ZXF A;  4CH4 A;  4EMG A;  4YCV A;  1B70 A;  3E9I A;  4RDX A;  4H2S A;  4NCX A;  3I7F A;  1JBM A;  1EQR A;  2Q7H A;  4EMK A;  2PME A;  5GAN f;  3JB9 I;  1EVL A;  1JJC A;  2I2L A;  1PYS B;  1B70 B;  2VXF A;  1YGB A;  1HK9 A;  3A7U A;  2E1H A;  1NNH A;  2DKG A;  3JB9 J;  3VQX A;  3M4Q A;  3HFZ B;  2EJ9 A;  3QO3 A;  4JLI A;  4M7D D;  4XU0 A;  3JCM V;  3VQV A;  2RHQ A;  4M78 G;  4YCU A;  5C51 B;  3L2Z A;  4H02 A;  4K86 A;  2ZNI A;  4RQE A;  1Z7M A;  5LJ5 j;  4C92 G;  2ODR D;  2RM4 A;  4M78 A;  1D3B B;  1BIB A;  4L87 A;  2DEQ A;  2VC8 A;  1Z7N A;  2DTH A;  3HFO A;  3HRI A;  1WNL A;  1Y96 B;  2E64 A;  2DDZ A;  3JCM Q;  1G51 A;  3HXZ A;  4KR2 A;  4YRI A;  4HWO A;  5GAN 5;  4M7A C;  2ZT7 A;  4M7D B;  1NJ5 A;  3WQZ A;  5GAO m;  4ZTZ B;  5ELN A;  3QNE A;  3BY7 A;  4KR3 A;  4LNS A;  4XTY A;  1LNX A;  1BBU A;  4C92 C;  3L1A A;  5GAM e;  3HTZ A;  5GAM j;  4F7U F;  4M7D A;  2J3L A;  4C92 D;  3QO7 A;  2EL9 A;  1X01 A;  3IG2 A;  2ALY B;  4J6Y A;  2HNI A;  4UP7 A;  2ZTG A;  5KNN A;  2FB7 A;  4XEM A;  4M78 F;  5LJ3 f;  3FIF A;  1EVK A;  2I4N A;  3LC0 A;  4HA8 A;  3JCM d;  3AHU A;  3RAC A;  4G85 A;  4C92 F;  3LSQ A;  4M7D F;  3A31 A;  1QF6 A;  5LJ5 d;  4DQ2 A;  4M75 C;  4J15 A;  3HXX A;  3A5Y A;  3JCM b;  4M7A A;  4P73 C;  4P72 A;  4P3O A;  4F7U A;  3DSQ A;  4M7A E;  2RHS B;  3KFU A;  4V2S A;  1E24 A;  2DJZ A;  3LSS A;  3QTC A;  1FYF A;  1NYQ A;  3L4G B;  4OLF A;  4UP8 A;  4M75 G;  4EMK B;  1B8A A;  2ZGW A;  2ART A;  1GGM A;  2ZR3 A;  2ZT6 A;  2RHS A;  4H2U A;  4WI1 A;  1EIY A;  5GMK e;  1HXD A;  4J6W A;  5GMK j;  4P71 A;  3OD1 A;  1IL2 A;  5LJ3 g;  4YRO A;  1NJ1 A;  2C8M A;  4EMK C;  4CH3 A;  1NJ2 A;  4CH6 A;  5GAN 4;  3JB9 D;  4JRK A;  1EIY B;  1SES A;  4NL3 A;  3SWN A;  3P8Y A;  1SET A;  1I8F A;  2ZIM A;  1E1T A;  4C8Q E;  3RUX A;  3E9H A;  3RKX A;  2P0L A;  3TEG A;  4CH5 A;  4TWA A;  3IKL A;  3JB9 G;  3SB2 A;  5GAO p;  4C92 A;  3QO8 A;  5GMK l;  4UPA A;  4P75 C;  3JCM W;  5GMK m;  3P8T A;  2ZIN A;  1H4V B;  2RB6 A;  4J5Y A;  4F7U E;  5LJ5 e;  1SRY A;  3HRK A;  1WPY A;  4M77 A;  4BW9 A;  4TVW A;  1J5W A;  3EFS A;  4WF2 A;  3JCM e;  3UGQ A;  3BW1 A;  2EJG A;  1USY A;  4PHC A;  5GAM d;  4YCW A;  1I81 A;  2ZZF A;  4M78 C;  4C8Q A;  4YRT A;  2QHT A;  2DVE A;  4P3N A;  4WJ4 A;  4JUV A;  2RD1 A;  5GAM g;  2J3M A;  4JRI A;  4XTZ A;  4WJ3 M;  4NL2 A;  4QVC A;  2QHU A;  4H2X A;  1LJO A;  3M4P A;  4YRK A;  5GAO n;  2EWN A;  3SWN C;  2EAY A;  4XTW A;  2RHQ B;  1WYD A;  1W66 A;  3TEH A;  2CIM A;  3GIB A;  1RIQ A;  2ZT5 A;  4A54 A;  5GAN g;  2E3C A;  3V8K A;  2CJB A;  4M77 F;  3HXU A;  4HT8 A;  2IY5 A;  2AMC A;  5LJ5 f;  1I4K 1;  1ASZ A;  3TUP A;  1WLE A;  1U1S A;  4YRL A; 
#chains in the Genus database with same CATH topology
 5C6S A;  1UHC A;  2CH4 W;  1N27 A;  1YI2 Q;  11AS A;  1VQ6 A;  1QWF A;  1HC7 A;  3PZC A;  1QKX A;  2IY5 B;  3VRY A;  1Y7X A;  2K5I A;  1EX4 A;  2MI6 A;  4KGV B;  2F2W A;  3CCM T;  1YFN A;  1R77 A;  3SWN B;  3LGF A;  1M3A A;  1YP5 A;  4UP9 A;  1Q7Y U;  1YIT A;  4L5G A;  1HD3 A;  4RMF A;  4YRQ A;  3EFO A;  3G4S A;  3EHR A;  4BY6 C;  5FU7 B;  3TQ7 P;  2JW4 A;  5KYX B;  1UDL A;  1WU7 A;  2DIQ A;  3MEW A;  2CP5 A;  2JTF A;  3EGD A;  1ASY A;  2DMO A;  1VQL Q;  1QP3 A;  2CH4 A;  1TU0 B;  4M75 E;  3WVE B;  1H4S A;  2Y4Y A;  3QZ9 B;  4P72 C;  4ZGD B;  2XDP A;  5GAN 3;  2K3Y A;  4C5I A;  1G5I A;  2ABL A;  1SKU B;  4R56 A;  1LCK A;  2OI3 A;  3CME A;  1C6V X;  2YRC A;  5GAN d;  2AKW A;  4GY5 A;  4LVM A;  3R6N A;  3H0I A;  2KT1 A;  4JJB A;  3RER A;  3FB9 A;  4FSS A;  1U06 A;  1AWW A;  1USY C;  3DLM A;  4X5O A;  1YIJ A;  2ENM A;  1QCO A;  2L3P A;  2RQR A;  1JU5 C;  1XOV A;  3PTA A;  5HK3 A;  1ADY A;  4PNO A;  5CIU A;  3BDL A;  2EQK A;  4JJD A;  3H41 A;  1H8K A;  1YWP A;  1AT1 B;  2ZCE A;  4A4K A;  4AFZ C;  2XTI A;  1VQK Q;  2WSE E;  2XIC A;  1ADJ A;  2RNA A;  1PRL C;  3V7R A;  4OF1 A;  4PJO E;  1ZA1 B;  3VQY A;  1M3B A;  2A37 A;  1WQW A;  3OS5 A;  1SER A;  5HK0 A;  2DF6 A;  2K5F A;  3JCM X;  2KY9 A;  5I2S A;  4XU1 A;  4M7A G;  1M1G A;  4DOV A;  2EQM A;  3EAE A;  3DKM A;  2ARU A;  1JJC B;  2BIV A;  12AS A;  4M7D C;  1X2G A;  3HXV A;  2KXD A;  2NUP A;  1YJW A;  1ARK A;  3HXY A;  2RN8 A;  3CCJ T;  3EG0 A;  2DZC A;  2IIM A;  3QWX X;  4FYV B;  2LX7 A;  5LJ3 d;  4PLI A;  3NTI A;  1U5S A;  5C53 B;  2RHI A;  3CC2 Q;  2DQ3 A;  4M77 E;  4CC3 A;  3OQ5 A;  2X4J A;  2ROL A;  2CYZ B;  3VYG A;  1VQM T;  3THK A;  1FWZ A;  4HWR A;  3MP8 A;  5IHK A;  4KH1 B;  1PYS A;  1VIF A;  1BB9 A;  1N9W A;  4PFP A;  5GAN j;  2M9U A;  5CAI A;  3VS4 A;  3C0C A;  1E22 A;  3CMA Q;  1ABQ A;  4IUP A;  1LYL A;  2XGT A;  4YRC A;  3MP1 A;  5GAN h;  4AH6 A;  3M0P A;  3OYL A;  5I21 A;  3RR6 A;  4OB0 B;  2YUP A;  2DU7 A;  1VQ7 T;  1KQ1 A;  2QHV A;  4AMC A;  1N9R A;  2CRE A;  2MCN A;  2F2V A;  2FHD A;  3UF4 A;  3QXE B;  2CP3 A;  3PIO A;  3RBB B;  2D1X A;  5FRM A;  3HSB A;  1GFD A;  3NMZ C;  1VQP Q;  1NYR A;  1RUW A;  3J81 E;  1KC8 C;  2FZG B;  1KOG A;  1X6O A;  2KMT A;  4J9F A;  2ED0 A;  1ZUK A;  3V7C A;  1H4T A;  3P8D A;  4M7A B;  5C52 B;  3PMI A;  4CC4 B;  4TQF A;  3NTH A;  5LJ3 j;  1YJW Q;  4MML A;  4L59 A;  4AFU C;  4ZIB A;  4D8K A;  2RQV A;  1LOJ A;  3G6E T;  1TUC A;  2Q5H A;  1SSF A;  1W2B P;  5ELO A;  2ZZG A;  2IVW A;  4MZT A;  1BI2 A;  1EOV A;  1VQ4 Q;  1XTD A;  2LT4 A;  4OMQ A;  4BD3 A;  2PMF A;  4HWS A;  4Y91 A;  1LPL A;  3BDU A;  2VGM A;  2I4M A;  1UGS B;  1K8A R;  2RQW A;  2QK0 A;  1W4S A;  2DE0 X;  2LCS A;  3MPU B;  1GFC A;  5HCK A;  4M7D E;  1ATI A;  1VQZ A;  1WJQ A;  1OUL A;  4M75 B;  1B34 B;  3CCJ A;  2LQN A;  3CMQ A;  3RL6 A;  1Z9Z A;  4BUG A;  5IHI A;  5I11 A;  1GL5 A;  3ME9 A;  4GLK A;  1FMW A;  2M1H A;  4HCC A;  4HT9 A;  2CUD A;  3ZBD A;  1X54 A;  2R5A A;  1VQ8 A;  3ERR A;  3I55 A;  3REX A;  2EYX A;  1WYX A;  2GTJ A;  2EIF A;  3CD6 Q;  1PHT A;  4DBQ A;  2RJF A;  4M75 D;  1UB4 A;  2K9G A;  3EGU A;  4IIM A;  2ZPI B;  1SPK A;  1YJN A;  3I7F A;  1W6X A;  2D0Q B;  2Q7H A;  2VAS A;  3X26 B;  1G3T A;  4A4H A;  2PME A;  3VUZ A;  1Q82 R;  2LTO A;  1VQK A;  2QEX T;  4LUD A;  3OSV A;  3C95 A;  1VQ5 Q;  2VXF A;  2E1H A;  1TSF A;  1UEC A;  2HCK A;  2F69 A;  1M9S A;  4RTT A;  1UJ0 A;  1E6G A;  3UT1 A;  1DJ7 B;  1WHG A;  1WFW A;  2RJE A;  1QVF P;  4LVJ A;  1QVF S;  2QA4 A;  3C12 A;  2V1Q A;  1PG5 B;  3CME T;  4ME7 A;  1OPL A;  3OMC A;  2EKO A;  2JXB A;  2DVJ A;  3GF5 A;  3X24 B;  4L87 A;  2DEQ A;  2VC8 A;  3T9N A;  3MHX A;  5KCH A;  1B7T A;  4MDX A;  1TUG B;  2DL5 A;  3HXZ A;  2HMA A;  2YUO A;  3OW2 P;  5AT1 B;  4HWO A;  4Z89 A;  4FM4 B;  1M8M A;  3WQZ A;  3M57 A;  4UC4 A;  4XTY A;  3PIP A;  1QCF A;  3RMS A;  3OYJ A;  1MNE A;  2VB6 A;  4A4G A;  4KBM B;  3LYI A;  3CPW A;  1VQ4 T;  4C92 D;  3QO7 A;  2EL9 A;  2ZZD A;  1X01 A;  1OV3 A;  1UGR B;  1OU8 A;  2QQA A;  1VQ7 A;  1G83 A;  2ZTG A;  4XEM A;  4OB3 B;  5IT9 E;  3JCM d;  2FZK B;  2QQ9 A;  4VUB A;  5LJ5 d;  4DQ2 A;  4AFS C;  2EVR A;  4J15 A;  1YJN Q;  3HXX A;  2AZS A;  3A5Y A;  1SEM A;  1K1Z A;  3JCM b;  2RPN A;  1X2Q A;  3ASK A;  5HKC A;  4P72 A;  4BY6 B;  1WHH A;  4F7U A;  2X4Y A;  1XNI A;  2J6F A;  2YRD A;  1E24 A;  3FLG A;  1JEG A;  4OGC A;  1FYF A;  1BK2 A;  2LCL A;  1B8A A;  2A0F B;  2RHS A;  2YDL A;  2AKL A;  4AG1 C;  5LJ3 g;  1NJ1 A;  2C8M A;  2H3E B;  4BDY A;  4BB7 A;  3JB9 D;  4JRK A;  1EIY B;  3E9G A;  4Y92 A;  2RI5 A;  3SWN A;  3P8Y A;  2PVD B;  1I8F A;  2X51 A;  5CVI A;  3S3O A;  3LH5 A;  2ZAE A;  2P0L A;  1ZBJ A;  4EPC A;  3CC7 A;  2HEQ A;  2J6K A;  3CCL T;  4CH5 A;  3IKL A;  1Q86 R;  1SRM A;  4C92 A;  3QO8 A;  1YJN T;  5GMK l;  2RHU A;  4UPA A;  2EYW A;  2L5Q A;  2QAS A;  4BI4 A;  1AWO A;  5D6W A;  2ZIN A;  2MPX C;  3ZL7 C;  4F7U E;  1OZ3 A;  1RI0 A;  3LW5 E;  2BZY A;  2K3X A;  2QI2 A;  1G3W A;  1C0M A;  1J5W A;  2M0O A;  6AT1 B;  4WF2 A;  2O2O A;  3CBO A;  2NYS A;  1JQQ A;  1ZA2 B;  2O9V A;  2EJG A;  2L3Q A;  1D09 B;  4BE2 A;  2DBK A;  3LWI A;  4C8Q A;  4YRT A;  3OW2 A;  2DVE A;  3LX7 A;  4WJ4 A;  1K4U S;  1KC8 U;  1R8O B;  3M4P A;  1NJI C;  4YRK A;  3FJ5 A;  1IHV A;  3SWN C;  2COY A;  2EWN A;  2VWF A;  1QCN A;  3NGP A;  4XTW A;  4LDY A;  3TEH A;  1KD1 C;  2CIM A;  3LH0 A;  1RIQ A;  1O75 A;  2ZT5 A;  2XDB A;  5GAN g;  2GBQ A;  3I55 Q;  1JXO A;  3MEA A;  3CCV Q;  2IY5 A;  5ECA A;  3OYB A;  4YRL A;  4J6X A;  2E10 A;  2EGC A;  1VQM Q;  1WZO A;  3GOX A;  4ESR A;  2PVG B;  2LJ3 A;  4FL6 A;  4RTY A;  2HSE B;  4PL6 A;  2E70 A;  2XMF A;  1YI2 A;  1VQN T;  1VQ6 Q;  4X9D A;  1D0X A;  5FU7 C;  1WXT A;  2DM1 A;  1D1A A;  3CC4 A;  1YCY A;  1VQ5 T;  2XHC A;  2QHS A;  4LNP A;  1W2B A;  2EBP A;  2CZ0 B;  4TVA A;  1C0A A;  5GAN 8;  1CSK A;  2NUP B;  2E65 A;  2LMJ A;  2ZZE A;  4A4E A;  2ZPG B;  3TU4 K;  1HTT A;  2GF7 A;  2I4L A;  2LQ8 A;  4E7J A;  3QJ6 A;  2G4C A;  2NUT B;  3E19 A;  3JCM h;  3RKW A;  1NBE B;  2E6Z A;  1PD1 A;  4M75 A;  3OYN A;  5IXB A;  1PKT A;  2LJ1 A;  2VV5 A;  4X34 A;  3V7S A;  3OS1 A;  3RKY A;  1PWT A;  3INZ A;  1Y96 A;  2HL5 C;  2RQU A;  2M51 A;  1J3T A;  1X27 A;  4XAX B;  3NEN A;  2RJD A;  1KQS P;  1VYU A;  4F7U G;  4C8Q F;  5AYF A;  5FWC A;  1VQL T;  3M4G A;  3MO8 A;  2KT8 A;  5HGQ A;  3OYG A;  3PFS A;  3VS0 A;  4FYX B;  3A8G B;  2YWW A;  1YJ9 Q;  5CKH A;  5IHN A;  3EGX B;  4M77 C;  3X20 B;  5CR2 A;  3A8M B;  4M7A D;  4OMN A;  9ATC B;  1VUB A;  4YRP A;  1UHF A;  1I5O B;  3VS7 A;  3CCM Q;  3MEU A;  1JRI A;  3JRZ A;  2AZV A;  2JOY A;  4YRG A;  2CJ9 A;  2DL4 A;  1SF9 A;  3L2V A;  4AT1 B;  2DXB A;  4CC2 A;  4M4Z A;  2JN0 A;  1ZX6 A;  3NPF A;  4XK8 E;  3CCS T;  4P74 C;  2E6N A;  2P84 A;  4RQF A;  4M77 B;  1S1N A;  3OYF A;  2V8K A;  3M0S A;  4EIK A;  2MF2 A;  2LJ0 A;  2ZPB B;  4FIB A;  3OYC A;  3QSU A;  3DB3 A;  2EKH A;  1VQO Q;  2AT1 B;  2PQW A;  3OYH A;  5IAY A;  2OTL A;  4E7H A;  1QE0 A;  1MMA A;  2CKK A;  1EZZ B;  5CQX A;  4FU6 A;  3TCJ A;  3MEY A;  1R0B G;  4H2W A;  2RQT A;  3HHT B;  1TTH B;  3A1P A;  1VQN A;  2EQU A;  2ARS A;  3CC2 A;  4TVA B;  3DB4 A;  2DL3 A;  3OMG A;  1I5L A;  2WSC E;  2Q7G A;  4ZTJ A;  2RHY A;  4LDX A;  4DBH A;  1N8R U;  4M77 D;  3CCQ T;  1KD1 R;  1M5Q 1;  1BIA A;  1YB3 A;  1OI1 A;  4DEY A;  3EFR A;  1K9M C;  1JJ2 P;  2YXY A;  3REU A;  1BBW A;  3J7A F;  2Q7E A;  1YFS A;  1QVG A;  4LXC A;  3CC4 T;  4JRP A;  1Q7Y R;  1YHQ Q;  4KH0 B;  2BZX A;  3CMA T;  2H8H A;  2QGG A;  5CKE A;  3M4Y A;  1S72 Q;  1K0S A;  1ACM B;  2X3X D;  3I9Q A;  4YRE A;  1ZSZ A;  1WJS A;  4TVR A;  4XTX A;  4CS2 A;  2I4O A;  2LDM A;  4CS4 A;  1OX8 A;  1Q81 R;  1KJW A;  4MDW A;  3VBB A;  2E5K A;  3VQW A;  1RAH B;  2ROT A;  4QVD A;  1YFR A;  3QKJ A;  1N8R R;  1ZBX A;  4M77 G;  1G5H A;  4ZTF A;  2FYK A;  5C0M A;  1K9M R;  2C7I A;  2FEI A;  4XU2 A;  3JB9 F;  1M27 C;  2Q5I A;  3RF1 A;  3NTK A;  2G3R A;  2XI9 A;  1S72 T;  1WHK A;  1RAE B;  3P8H A;  3PT9 A;  1UUE A;  4XQ3 A;  3VS5 A;  4XTU A;  1YWO A;  1VQ6 T;  4C92 B;  3RGL A;  2E4H A;  2BKD N;  5F5W A;  3A74 A;  1AZG B;  3I5S A;  5FRN A;  2Z0W A;  3L42 A;  4QQG A;  3FJP A;  2ZNJ A;  2QGF B;  2DTO A;  2KDS A;  4YRN A;  1X2H A;  2QTX A;  3M0U A;  3G1Z A;  1X2K A;  3CCR A;  4BE0 A;  2PU9 B;  2QG9 B;  4C5G A;  1B34 A;  4M7D G;  4C8Q B;  5DLQ E;  4OB2 B;  3G71 T;  3VU3 C;  2V8J A;  2R5M A;  4O6J A;  2X4W A;  3HY1 A;  5KYY B;  5GAN e;  2AKK A;  3JSC A;  2LQK A;  2ZT8 A;  3TEH B;  4Z88 A;  2IPO B;  2DD4 A;  2P5I A;  2ATC B;  4O5V A;  3CCQ A;  4HWP A;  3HFV A;  1Y07 A;  4PJO B;  1FMV A;  4GBQ A;  2HSP A;  2RA2 A;  3HTR A;  1ZHI A;  3A5Z A;  3LGL A;  3M53 A;  4YP0 A;  3IAL A;  5GMK i;  1N9S A;  4O2D A;  1RLQ C;  2JMC A;  5IH2 A;  4LVK A;  4EMG A;  4YCV A;  1ZSZ C;  2O31 A;  4H2S A;  1JBM A;  1K73 C;  1QP2 A;  3JB9 I;  1PD0 A;  2RI3 A;  1JJC A;  1PYS B;  1B70 B;  3MJX A;  2I0N A;  1WHL A;  3M5A A;  4N4I A;  1OYX A;  1HK9 A;  3HPW A;  4IKF A;  3S6W A;  2DKG A;  5FW9 A;  2DET A;  3VQX A;  4HCB A;  1GCQ C;  3G6E A;  4M78 G;  1GBR A;  5C51 B;  2FVU A;  2OX7 A;  1QW1 A;  1Z7M A;  5LJ5 j;  3QPH A;  4C92 G;  1D3B B;  3VJP A;  1QVP A;  1YBY A;  1ABO A;  2DD5 A;  3HRI A;  2SEM A;  1V1C A;  1WNL A;  2DIG A;  1GCQ A;  1G51 A;  2CT3 A;  4YRI A;  2CP0 A;  3D7S B;  4ZGE B;  4LDV A;  4M7A C;  1UE9 A;  2ZT7 A;  5GAO m;  4KR3 A;  1M1K U;  4LNS A;  1NPR A;  1P92 A;  3VKI A;  1M30 A;  2GGR A;  5FRO A;  1I1J A;  4GLM A;  1Y0M A;  1VQP A;  2QQR A;  2LZ6 B;  4IUQ A;  1RAD B;  1M2O A;  4MZM A;  3CMA A;  2HNI A;  4UP7 A;  2A7Y A;  2FB7 A;  4M78 F;  3FIF A;  3LLR A;  3VS2 A;  4FW1 A;  3LC0 A;  3AHU A;  3RAC A;  3DLL A;  1M3C A;  1LVK A;  3MP6 A;  2LQW A;  4M7D F;  3A31 A;  2XID A;  4B6M A;  4KUD K;  2EPD A;  2HQE A;  4HVW A;  2YUQ A;  3CCE A;  3CC2 T;  1YIJ Q;  3HP9 A;  4P3O A;  1YN8 A;  2RHS B;  3LSS A;  1KHC A;  2GNC A;  1W2B S;  3L4G B;  1RLP C;  4OLF A;  4UP8 A;  4M75 G;  1MMD A;  2BTT A;  5KH6 A;  1GGM A;  5J39 A;  4P5N A;  1EIY A;  1HXD A;  2JS2 A;  2CP6 A;  2LX9 A;  1WIE A;  3OD1 A;  2DER A;  4P71 A;  1T3L A;  3G1J A;  2F5K A;  4YRO A;  4EMK C;  1UFF A;  4LE9 A;  1NJ2 A;  1E7O A;  3H0H A;  4RMO A;  1SES A;  4NL3 A;  3O8V A;  4LD9 K;  1N5Z A;  1SET A;  2QEX A;  4LUE A;  4E7K A;  2LVM A;  3CCU T;  3JB9 G;  3KFV A;  3SB2 A;  5GAO p;  4LVL A;  4ZNX A;  1VQ4 A;  3G7Z A;  4E7Z A;  3P8T A;  1KG1 A;  1X69 A;  1K73 U;  1F1B B;  1IGQ A;  3P8B B;  4ELY C;  4TVW A;  3EFS A;  5KYU A;  2C0O A;  2KE9 A;  3UGQ A;  1USY A;  3QG1 A;  4PHC A;  2EQI A;  3OA6 A;  5GAM d;  2P4R A;  2BE7 D;  1I0C A;  1NM7 A;  2ZZF A;  2O4X B;  3FEO A;  4J9C A;  1WHM A;  3OS2 A;  2QHT A;  4P3N A;  5I22 A;  4JUV A;  2DAQ A;  2RD1 A;  5GAM g;  2JUF A;  2QDL A;  4JRI A;  2J3M A;  2OJ2 A;  3IQL A;  2RMO A;  2QHU A;  1LJO A;  1RAA B;  4J9B A;  5GAO n;  1MHN A;  1WYD A;  1W66 A;  1GXI E;  4F04 B;  2E3C A;  2D9T A;  3QZ5 B;  1VQ8 Q;  4IUV A;  4PJM A;  3CCV T;  4CRI A;  1ASZ A;  3TUP A;  5FWB A;  3P8V A;  1OPK A;  3QO5 A;  2MWO A;  2SRC A;  3VS1 A;  3RES A;  4JS5 A;  3MF1 A;  2XK0 A;  1VIE A;  5DY9 A;  4M78 E;  1V76 A;  2CP2 A;  1E1O A;  4M7A F;  2YRV A;  3A7R A;  2VXE A;  1RAB B;  2CSI A;  2W10 A;  2BE9 B;  3NHN A;  1B3Q A;  3CPF A;  1KC8 R;  3G6E Q;  4P71 C;  3VS6 A;  2MYS A;  3EFO B;  2DLP A;  3CQT A;  5HY6 A;  5KYX A;  1BKB A;  2JNG A;  5L23 A;  2O01 E;  2HD0 A;  3I56 Q;  2NS6 A;  4DPG A;  4IUU A;  4YYE A;  2KGT A;  1TS9 A;  4MZP A;  1B07 A;  3HFN A;  4AFQ C;  2DYI A;  2XG8 D;  4FT4 A;  1M4Z A;  1TOV A;  2F2X A;  2IG0 A;  2XKO C;  2JS0 A;  4AG2 C;  1VQ9 T;  2AMC B;  1Q86 U;  4D6W A;  2X9H A;  2EJF A;  3KUF A;  4B9X A;  1ZSG A;  3M56 A;  2L89 A;  2K4Y A;  1B76 A;  1TWB A;  3CME Q;  3PVL A;  4RCC A;  3A7A A;  1WXB A;  3EHQ A;  3A5Z B;  3HRS A;  1QVG S;  4RTV A;  1K8A U;  4JJC A;  2CJA A;  1KMM A;  1BBZ A;  5A0L A;  2OTJ A;  3QBY A;  5CO7 A;  3MF2 A;  4RCB A;  4BI3 A;  2LNH B;  1AZE A;  2YSQ A;  2ZR2 A;  2YHT A;  3E2U A;  5GAN 6;  2RH2 A;  3GNG A;  1NJ6 A;  4ELZ C;  4F17 A;  3RIR A;  4BE1 A;  3MQZ A;  3QDF A;  3I5R A;  3CD6 A;  2O9S A;  2Y4X A;  1Q86 C;  3GBQ A;  1SRL A;  1W1F A;  2RHZ A;  1KK7 A;  5K1P A;  5KYU B;  1Y57 A;  3FRN A;  2QYZ A;  3X28 B;  5CCA A;  4E7S A;  2DO3 A;  5E3I A;  4H2Y A;  2QDY B;  3L4G A;  1IHW A;  3GLX A;  3PVQ A;  1K73 R;  5LJ5 h;  3JB9 H;  2KVQ G;  5GAO q;  3WXM B;  4K87 A;  4OML A;  4DOW A;  3OB9 A;  1RAI B;  4XTV A;  1VQO A;  3UFG A;  4PKC C;  3NEL A;  4HVC A;  1NJI R;  3ZEH A;  3W3S A;  4P74 A;  2FZC B;  2VUB A;  2BUD A;  2G6F X;  3F70 A;  4FYY B;  1MUZ A;  1WDX A;  3QJY A;  4C0Z A;  1NYG A;  2DNU A;  4YPF A;  3O5Z A;  3N5B B;  3CCV A;  1FYN A;  3EG3 A;  5GJW B;  1OQK A;  1ZSZ B;  1AEY A;  1TUD A;  4X9C A;  3CXC S;  1VA7 A;  2E41 A;  3OYK A;  4IUR A;  1BU1 A;  2DQ0 A;  4G84 A;  4HWT A;  5KYW B;  1TG0 A;  1RI9 A;  3HXW A;  3EGX A;  2DXU A;  3E1S A;  4QQ6 A;  8ATC B;  3BJU A;  4KQE A;  3QHS A;  3HRU A;  1IRE B;  5J26 A;  3AT1 B;  2CSQ A;  4Q5W A;  3G4S Q;  2DL7 A;  4RTW A;  2KYB A;  4JLG A;  4HKE A;  3JCM J;  5GAM f;  4HT4 A;  4OB1 B;  5KCO A;  2A36 A;  4TVY A;  1NEG A;  1V29 B;  1PSE A;  1UGV A;  1XJW B;  2HKQ B;  4JJN K;  1M8V A;  1M1F A;  4HCK A;  4F7U B;  1D0Y A;  4LVI A;  3RDV A;  3RMQ A;  3I56 T;  4P3P A;  5CKD A;  1YFT A;  3VYH B;  2CZ7 B;  2KEA A;  4J9G A;  2KBT A;  3NFC A;  5A2Q E;  1A0N B;  1D1B A;  2GQI A;  5GAN 2;  1NYF A;  1VQ8 T;  2OTJ T;  2DXT A;  3URG A;  1MGQ A;  1G2B A;  2HQX A;  1QVG P;  1H3Z A;  2CZ6 B;  3PGG A;  4E2F B;  4RG8 A;  4WCI A;  5K1X A;  4F14 A;  3JV3 A;  2DA9 A;  2PNI A;  2AKW B;  2KYM A;  4A53 A;  3M54 A;  1M1K R;  1YJ9 A;  2X4X A;  5KYY A;  3CXC A;  2DIL A;  1BI1 A;  2JM9 A;  1KQ2 A;  2O4X A;  2QAZ A;  2CP7 A;  1VQ9 A;  2K5L A;  4ZN3 A;  2OTL T;  1KD1 U;  1U3O A;  5A0D A;  3ER0 A;  1EFW A;  1N8R C;  3TSW A;  3CCR Q;  1PRM C;  1D3B A;  3HKS A;  2PUO B;  2DX1 A;  3BE3 A;  5IN1 A;  4OMM A;  4PJJ A;  2NUZ A;  1G3S A;  5A0G A;  4CI0 C;  3J80 E;  2AHJ B;  3A98 A;  1T0J A;  4EDU A;  3G71 A;  2GQV A;  1AHJ B;  1QKW A;  1PC0 A;  2V8I A;  3CCJ Q;  2COW A;  1H64 1;  1UEB A;  2ED1 A;  4H2T A;  4NOY A;  4OP0 A;  1QWE A;  2V1R A;  1WX6 A;  1G5V A;  5D7U A;  2ZXF A;  4CH4 A;  1B70 A;  2K6D A;  4JS4 A;  4NCX A;  1EQR A;  2I2L A;  1MMG A;  3KBG A;  3OYI A;  2CDT A;  2JZ2 A;  3S3M A;  1M1K C;  3CCU Q;  1NNH A;  1IZ6 A;  1GCP A;  2ZCF B;  4N4H A;  4FCY A;  3QO3 A;  4JLI A;  1MMN A;  2P4T A;  4M7D D;  2RHQ A;  4ATO A;  3CBP A;  3L2Z A;  1VOM A;  2DRM A;  2LP5 A;  8AT1 B;  1OEB A;  4H02 A;  4BAC A;  4K86 A;  2ZNI A;  2ODR D;  2QEX Q;  1BIB A;  2A28 A;  5D6Y A;  1MND A;  3HFO A;  1QLY A;  1Y96 B;  2E64 A;  1WXU A;  2HBP A;  2F5T X;  4IIO A;  3TVT A;  2X35 A;  3JCM Q;  4KR2 A;  2NUT A;  4JRQ A;  5GAN 5;  1VQK T;  1VQ9 Q;  1S72 A;  1NJ5 A;  2W0Z A;  2D8J A;  4ZTZ B;  5ELN A;  3QNE A;  2L3R A;  4JDS A;  4C92 C;  1AVZ C;  5GAM j;  3TRE A;  1Q81 C;  4M7D A;  2J3L A;  2JMA A;  4J6Y A;  4C5H A;  3EGD B;  2VGN A;  3H0F A;  5KNN A;  2ESW A;  4HVU A;  1CKB A;  2HQH A;  1Q81 U;  1AWJ A;  2JTM A;  2ZPF B;  2KNB B;  4C92 F;  1YJW T;  3SFM A;  3LSQ A;  2DL8 A;  2YT6 A;  1QF6 A;  2RJC A;  1GBQ A;  3M0T A;  2K2V A;  3UWN A;  1VQO T;  4J9D A;  3R6O A;  1ZUY A;  3CCL Q;  4M7A A;  3PNW C;  2FG0 A;  3VRZ A;  3SHW A;  3KFU A;  1X6G A;  3CCR T;  2MK5 A;  4V2S A;  1UTI A;  3SDZ A;  4L6V 5;  4HCZ A;  3EH2 A;  4PFO A;  1AD5 A;  4RKU E;  3X25 B;  4N4G A;  1YI2 T;  5D6X A;  3CCM A;  2ZT6 A;  2ART A;  5IXF A;  2ZR3 A;  3CCE T;  1HJD A;  4WI1 A;  5GMK e;  5CKF A;  5GMK j;  3C4S A;  1IL2 A;  3CCS Q;  3M59 A;  4C0D C;  1T0H A;  4F16 A;  2RF0 A;  2EGE A;  2R58 A;  4PFZ A;  2BZ8 A;  2JVV A;  4LD6 A;  2ZIM A;  1E1T A;  4JZ4 A;  3A8O B;  3E9H A;  3H6Z A;  4OMF B;  3TEG A;  4E47 A;  2P0P A;  4DA4 A;  1NJI U;  2HZY A;  3QII A;  3EG9 A;  3JCM W;  2LT1 A;  1VQP T;  2RB6 A;  5LJ5 e;  3HRK A;  4Z8A A;  1M2V A;  1VYV A;  1NEB A;  3UAT A;  3EH1 A;  3REA B;  5DLO A;  3JCM e;  4RTU A;  3CPW S;  2RK1 A;  4YCW A;  1SG5 A;  1I81 A;  2J6O A;  4M78 C;  1Q95 G;  2A3L A;  2XDD A;  4XTZ A;  1R0C B;  5KYN A;  3U23 A;  2A8E A;  1CKA A;  3OYA A;  4BI8 B;  2RHQ B;  3ULR B;  1SSH A;  2FPD A;  1VQM A;  3GIB A;  2PZ1 A;  4FW2 A;  4A54 A;  2RO0 A;  2DRK A;  3EG1 A;  3V8K A;  1BYM A;  4J7I A;  3G71 Q;  3HXU A;  1IB8 A;  1PKS A;  2GTO A;  2AIR B;  5LJ5 f;  2AMC A;  3L2W A;  4WTO B;  1I4K 1;  4LDW A;  2X3W D;  3CXC P;  1WLE A;  1U1S A;  1TH7 A;  2RHX A;  2FPE A;  4K11 A;  4YRS A;  3BFM A;  1YIT Q;  3JCM f;  2B86 A;  1KSW A;  2EYY A;  1VYT A;  4C92 E;  1FX7 A;  3JCM P;  2DU5 A;  4N0A A;  3CC4 Q;  5DM7 R;  3PCO A;  4II1 A;  1IGU A;  3MET A;  3UH0 A;  2YLC A;  3A32 A;  4YRR A;  3REB B;  3V8L A;  2HDA A;  2EGA A;  3JCM c;  2ZIO A;  3M0Q A;  3H8Z A;  2DJQ A;  3NEM A;  3ZFJ A;  2NLU A;  1YIT T;  4KRT A;  2K3B A;  3MKD A;  1O9S A;  2KRM A;  5LJ3 e;  1Z9Q A;  1NLP C;  4H2V A;  3CBM A;  5I2M A;  2KK4 A;  4P75 A;  5FU6 B;  2E3I A;  2KRN A;  1YNZ A;  3QUI A;  2DEU A;  1FMK A;  4OMP A;  2DTI A;  1HYO A;  1U8R A;  2L2P A;  2Y90 A;  1WJR A;  3M58 A;  1WLP B;  1WI7 A;  5L8R E;  2CS7 A;  2FO0 A;  2DYB A;  2MWP A;  1WHJ A;  5CK9 A;  1H4Q A;  2OAU A;  3VS3 A;  1SHF A;  2E12 A;  1M2V B;  1YCS B;  1NZ9 A;  4DBF A;  4E7I A;  2H3J A;  2J06 A;  1D1C A;  3CCE Q;  4TTV A;  3IKM B;  1OU9 A;  4DBR A;  4E51 A;  1X75 C;  1C1A A;  1W70 A;  4EO4 A;  1RAF B;  3EG2 A;  4P73 A;  3WVD B;  3Q1J A;  5LJ3 h;  4Q15 A;  5GAO r;  3MEV A;  4KGZ B;  3PCO B;  3OBY A;  1JJ2 A;  2DK3 A;  2LNV A;  2V26 A;  4EX5 A;  2XU8 A;  4Z02 A;  3UDC A;  4PJL A;  2ODR C;  4QT7 A;  4KUL A;  2QA4 T;  4ANJ A;  4PK4 A;  4BDZ A;  2E5A A;  2DPP B;  2GCX A;  3UGT A;  4MMK A;  2YUN A;  1JO8 A;  5CQY A;  1H3H A;  4YDQ A;  7AT1 B;  2WSF E;  3M9Q A;  4R55 A;  2P0Q A;  3M0R A;  3HY0 A;  4J83 A;  1ZUU A;  4PJO F;  4A63 B;  3OYY A;  3NET A;  5EG2 A;  3CCS A;  1VQ5 A;  4B9W A;  1G8X A;  1GRI A;  1Q82 U;  2CGH A;  4PLL A;  2L8D A;  2OAW A;  4C0D B;  4PG3 A;  4NS5 A;  3VUB A;  2KAF A;  4YRJ A;  2VVK A;  4C8Q D;  4XEO A;  1B7Y A;  4E7L A;  3TSZ A;  1EIF A;  1UG1 A;  1NJ8 A;  4D8D A;  4PJO C;  3ICA A;  4BWA A;  4TQD A;  4C8Q G;  2K2M A;  5FLX E;  3HFZ A;  1OZ2 A;  2F1L A;  3EG9 B;  3L2Q A;  2C06 A;  4YRM A;  1VQ7 Q;  3OW2 S;  1RAG B;  4J7F A;  2M0Y A;  4OGE A;  3OYD A;  3M55 A;  4CS3 A;  2KR3 A;  4ORZ A;  5GAN 7;  3V8J A;  1NLO C;  5CKB A;  1L0W A;  4N0A C;  1RAC B;  1X55 A;  4PJO G;  2JJ9 A;  5KYW A;  1K76 A;  1AWX A;  5GAM h;  3OYM A;  5KE3 A;  4H2X B;  4QKU A;  3MCA B;  2A08 A;  3OSS C;  4HVV A;  1Y71 A;  4Y28 E;  4JZ3 A;  4RTZ A;  2NWM A;  1UJY A;  5LL6 S;  3CD6 T;  2EYZ A;  4C5E A;  1NPP A;  2RI2 A;  2EYQ A;  2LCC A;  4PJO A;  1NG2 A;  1KMN A;  1XQH A;  2M16 A;  1UGQ B;  2YLB A;  5GAO l;  2M02 A;  3FDR A;  4K88 A;  2PTK A;  4M78 B;  4ZN1 A;  1EFN A;  5LJ5 g;  1Q7Y C;  1WQ7 A;  2DZ9 A;  4LN2 A;  4M75 F;  3L2R A;  2K57 A;  4JPB W;  4XU3 A;  2HBW A;  4C0F A;  4ZTU B;  2QTV A;  2PUK B;  3JCM g;  5GMK h;  1RL2 A;  1K0X A;  1UGP B;  4RTX A;  2KRS A;  4C0G A;  3S3N A;  4OMO A;  2AK5 A;  4DEX A;  1T3S A;  4FT2 A;  2ECZ A;  1KQS S;  3HL8 A;  4EMH A;  1U1T A;  4KUI A;  1FXX A;  1QMC A;  3CC7 Q;  3CCQ Q;  2DFU A;  2C0T A;  1B7Y B;  3I55 T;  2OTJ Q;  2VKN A;  2L3S A;  2ZPH B;  3OS0 A;  4Q6G A;  1IO6 A;  1ZQ1 A;  4M78 D;  1X56 A;  2C0I A;  1N6A A;  4YRF A;  3RNJ A;  4PJN A;  4FSX A;  1IXD A;  2KI7 A;  4PJO D;  2EW3 A;  2GFU A;  1K9A A;  3R07 A;  2ALY A;  2E5Q A;  4C8Q C;  3QWY A;  3H9N A;  3GNF B;  3CEY A;  2MAM A;  5FU6 C;  3E9I A;  4RDX A;  1BI3 A;  3CPW P;  4EMK A;  2HL3 A;  5GAN f;  3KXT A;  1EVL A;  1MV0 B;  1M90 C;  1YGB A;  1BCO A;  3A7U A;  3OY9 A;  2QA4 Q;  3JB9 J;  2PVO B;  3M4Q A;  3HFZ B;  2EJ9 A;  2D6F A;  4XU0 A;  2J7I A;  3E9F A;  3JCM V;  3VQV A;  2DXC A;  2E3H A;  3G4S T;  4YCU A;  3UA6 A;  2QQB A;  1YJ9 T;  4RUG A;  2EFI A;  2QXF A;  1X6B A;  2DBM A;  3QDR B;  4OVA A;  1OX9 A;  4QW2 A;  4RQE A;  2HAX A;  2RM4 A;  2R57 A;  4M78 A;  1K9M U;  2JT4 A;  4IUT A;  1Z7N A;  2FRY A;  2DTH A;  3I35 A;  1PSF A;  3QYH B;  1JJ2 S;  3HRT A;  4HXJ A;  3A8H B;  1YHQ A;  1WA7 A;  2DDZ A;  3FC3 A;  2VYT A;  4M7D B;  2QQS A;  4QVZ A;  5GJV B;  3BY7 A;  1Q82 C;  1LNX A;  5KE2 A;  1BBU A;  3L1A A;  5GAM e;  2EQJ A;  1JB0 E;  3HTZ A;  1SHG A;  4KGX B;  4F7U F;  3I56 A;  4J9I A;  4R0K A;  3PMT A;  2ALY B;  2L0A A;  3IG2 A;  4ZGJ B;  2CT4 A;  1D0Z A;  1NE8 A;  1PNJ A;  2GFA A;  4A4F A;  5LJ3 f;  3SD4 A;  1EVK A;  2I4N A;  2B8A A;  4HA8 A;  2LC4 A;  4G85 A;  2K7A A;  4J9E A;  1IRX A;  2CZ1 B;  1PM3 A;  4E6R A;  4M75 C;  3TEE A;  1AOJ A;  2D8H A;  4KT0 E;  4QQD A;  1QVF A;  2MIO A;  3PE0 A;  4P73 C;  1PCX A;  4J9H A;  2P0K A;  3DSQ A;  4M7A E;  2DJZ A;  1KIK A;  1TXQ A;  1G3Y A;  3QTC A;  2ZPE B;  1NYQ A;  4EMK B;  3OYE A;  2ZGW A;  4H2U A;  1K8A C;  3CC7 T;  4LDU A;  1H92 A;  5M9O A;  3CCL A;  4J6W A;  2OTL Q;  4CH3 A;  4CH6 A;  5GAN 4;  5EC7 A;  3GP8 A;  2FL7 A;  3UA7 A;  1VQN Q;  1YIJ T;  2COZ A;  4RG2 A;  4X1V A;  1OOT A;  1WGS A;  4C8Q E;  2D0N A;  3RUX A;  2FRW A;  3RKX A;  2JM8 A;  2KRO A;  2CUB A;  3UPU A;  1VQL A;  4TWA A;  2FPF A;  3L2U A;  1M90 U;  4J8O A;  2K79 A;  4P75 C;  1BI0 A;  2J05 A;  5GMK m;  4CC7 A;  2KQW A;  1H4V B;  4J5Y A;  1SRY A;  1MV3 A;  1WPY A;  4M77 A;  3VV0 A;  1QQJ A;  4BW9 A;  3QYG B;  3BW1 A;  3C94 A;  1X43 A;  3A8L B;  1KFZ A;  1YHQ T;  2O88 A;  2LRQ A;  4WJ3 M;  3GPL A;  2MMP A;  4NL2 A;  4QVC A;  1M90 R;  4H2X A;  1I07 A;  2KXC A;  3JAM E;  3SEM A;  1JXM A;  2EAY A;  1E6H A;  1BCM A;  2XD0 A;  1HSQ A;  2WAC A;  4YTL A;  1ZLM A;  4FYW B;  3OBW A;  2JTE A;  3CCU A;  2KSS A;  4M77 F;  2CJB A;  2RK2 A;  3LWH A;  1KHI A;  2HKN A;  4HT8 A;  1KQS A;  5J3B A;  2MOX A; 
#chains in the Genus database with same CATH homology
 5C6S A;  1N27 A;  11AS A;  1VQ6 A;  1HC7 A;  3PZC A;  2IY5 B;  1Y7X A;  2K5I A;  2MI6 A;  3CCM T;  3SWN B;  3LGF A;  4UP9 A;  1Q7Y U;  1YIT A;  4L5G A;  4RMF A;  4YRQ A;  3G4S A;  4BY6 C;  5FU7 B;  1WU7 A;  2DIQ A;  3MEW A;  2JTF A;  1ASY A;  1QP3 A;  4M75 E;  3WVE B;  1H4S A;  2Y4Y A;  3QZ9 B;  4P72 C;  4ZGD B;  2XDP A;  5GAN 3;  2K3Y A;  4C5I A;  1G5I A;  4R56 A;  3CME A;  5GAN d;  2AKW A;  4GY5 A;  4LVM A;  3RER A;  3FB9 A;  1USY C;  3DLM A;  4X5O A;  1YIJ A;  1XOV A;  3PTA A;  5HK3 A;  1ADY A;  4PNO A;  5CIU A;  3BDL A;  2EQK A;  2ZCE A;  4A4K A;  2XTI A;  2WSE E;  2XIC A;  1ADJ A;  3V7R A;  4PJO E;  4OF1 A;  3VQY A;  1WQW A;  3OS5 A;  1SER A;  5HK0 A;  2K5F A;  3JCM X;  2KY9 A;  5I2S A;  4XU1 A;  4M7A G;  1M1G A;  4DOV A;  2EQM A;  3EAE A;  3DKM A;  2ARU A;  1JJC B;  2BIV A;  12AS A;  4M7D C;  1X2G A;  3HXV A;  1YJW A;  3HXY A;  3CCJ T;  2DZC A;  5LJ3 d;  4PLI A;  3NTI A;  5C53 B;  2RHI A;  2DQ3 A;  4M77 E;  3OQ5 A;  2X4J A;  2CYZ B;  3VYG A;  1VQM T;  1FWZ A;  4HWR A;  3MP8 A;  1PYS A;  1VIF A;  1N9W A;  5GAN j;  2M9U A;  5CAI A;  1E22 A;  4IUP A;  1LYL A;  2XGT A;  4YRC A;  3MP1 A;  5GAN h;  4AH6 A;  3OYL A;  5I21 A;  4OB0 B;  2DU7 A;  1VQ7 T;  1KQ1 A;  2QHV A;  1N9R A;  2FHD A;  3QXE B;  3PIO A;  5FRM A;  3HSB A;  1NYR A;  3J81 E;  1KC8 C;  1KOG A;  1X6O A;  2KMT A;  3V7C A;  1H4T A;  3P8D A;  4M7A B;  5C52 B;  3PMI A;  4TQF A;  3NTH A;  5LJ3 j;  4MML A;  4L59 A;  4ZIB A;  1LOJ A;  3G6E T;  2Q5H A;  1SSF A;  5ELO A;  2ZZG A;  2IVW A;  4MZT A;  1BI2 A;  1EOV A;  1XTD A;  2LT4 A;  2PMF A;  4BD3 A;  4HWS A;  4Y91 A;  3BDU A;  2VGM A;  2I4M A;  1UGS B;  1W4S A;  4M7D E;  1ATI A;  1VQZ A;  1WJQ A;  4M75 B;  1B34 B;  3CCJ A;  3CMQ A;  3RL6 A;  4BUG A;  3ME9 A;  4GLK A;  2M1H A;  4HCC A;  4HT9 A;  3ZBD A;  1X54 A;  2R5A A;  1VQ8 A;  3ERR A;  3I55 A;  3REX A;  2EIF A;  2RJF A;  4M75 D;  1UB4 A;  2ZPI B;  1YJN A;  3I7F A;  2D0Q B;  2Q7H A;  3X26 B;  1G3T A;  4A4H A;  2PME A;  3VUZ A;  2LTO A;  1VQK A;  2QEX T;  3OSV A;  3C95 A;  2VXF A;  2E1H A;  2F69 A;  1M9S A;  3UT1 A;  1DJ7 B;  2RJE A;  4LVJ A;  1QVF S;  2QA4 A;  3C12 A;  3CME T;  4ME7 A;  3OMC A;  2EKO A;  3X24 B;  4L87 A;  3GF5 A;  2DEQ A;  2VC8 A;  3T9N A;  3MHX A;  5KCH A;  4MDX A;  3HXZ A;  4HWO A;  4FM4 B;  3WQZ A;  3M57 A;  4UC4 A;  4XTY A;  3PIP A;  3RMS A;  3OYJ A;  4A4G A;  4KBM B;  3LYI A;  3CPW A;  1VQ4 T;  4C92 D;  3QO7 A;  2EL9 A;  2ZZD A;  1X01 A;  1UGR B;  2QQA A;  1VQ7 A;  2ZTG A;  4XEM A;  4OB3 B;  5IT9 E;  3JCM d;  2QQ9 A;  4VUB A;  5LJ5 d;  4DQ2 A;  4J15 A;  3HXX A;  3A5Y A;  3JCM b;  3ASK A;  5HKC A;  4P72 A;  4BY6 B;  4F7U A;  2X4Y A;  1XNI A;  1E24 A;  3FLG A;  4OGC A;  1FYF A;  2LCL A;  1B8A A;  2RHS A;  5LJ3 g;  1NJ1 A;  2C8M A;  4BDY A;  4BB7 A;  3JB9 D;  4JRK A;  1EIY B;  3E9G A;  2RI5 A;  3SWN A;  3P8Y A;  2PVD B;  1I8F A;  5CVI A;  3S3O A;  2P0L A;  4EPC A;  3CC7 A;  3CCL T;  4CH5 A;  3IKL A;  4C92 A;  3QO8 A;  1YJN T;  4UPA A;  5GMK l;  2RHU A;  2L5Q A;  4BI4 A;  5D6W A;  2ZIN A;  4F7U E;  1OZ3 A;  1RI0 A;  3LW5 E;  2K3X A;  2QI2 A;  1G3W A;  1J5W A;  2M0O A;  4WF2 A;  3CBO A;  2EJG A;  4BE2 A;  3LWI A;  4C8Q A;  4YRT A;  3OW2 A;  2DVE A;  3LX7 A;  4WJ4 A;  1KC8 U;  1R8O B;  3M4P A;  1NJI C;  4YRK A;  2EWN A;  4XTW A;  3SWN C;  4LDY A;  3TEH A;  1KD1 C;  2CIM A;  3LH0 A;  1RIQ A;  1O75 A;  2ZT5 A;  2XDB A;  5GAN g;  3MEA A;  2IY5 A;  3OYB A;  4YRL A;  4J6X A;  2E10 A;  3GOX A;  2PVG B;  4FL6 A;  4PL6 A;  2E70 A;  1YI2 A;  1VQN T;  4X9D A;  5FU7 C;  3CC4 A;  1YCY A;  1VQ5 T;  2XHC A;  2QHS A;  1W2B A;  2CZ0 B;  4TVA A;  1C0A A;  5GAN 8;  2E65 A;  2ZZE A;  4A4E A;  2ZPG B;  3TU4 K;  1HTT A;  2GF7 A;  2I4L A;  2LQ8 A;  4E7J A;  3QJ6 A;  2G4C A;  3E19 A;  3JCM h;  3RKW A;  2E6Z A;  4M75 A;  3OYN A;  3OS1 A;  2VV5 A;  4X34 A;  3V7S A;  3RKY A;  3INZ A;  1Y96 A;  4XAX B;  3NEN A;  2RJD A;  4F7U G;  4C8Q F;  5AYF A;  1VQL T;  3M4G A;  3MO8 A;  5HGQ A;  3OYG A;  3PFS A;  3A8G B;  5CKH A;  5CR2 A;  4M77 C;  3X20 B;  3A8M B;  4M7A D;  1VUB A;  4YRP A;  3MEU A;  1JRI A;  3JRZ A;  2JOY A;  4YRG A;  2CJ9 A;  3L2V A;  2DXB A;  2JN0 A;  4XK8 E;  3CCS T;  4P74 C;  2E6N A;  4RQF A;  4M77 B;  3OYF A;  2V8K A;  2MF2 A;  2ZPB B;  4FIB A;  3OYC A;  3QSU A;  3DB3 A;  2PQW A;  3OYH A;  5IAY A;  2OTL A;  1QE0 A;  4E7H A;  2CKK A;  5CQX A;  4FU6 A;  3TCJ A;  3MEY A;  4H2W A;  3HHT B;  1VQN A;  2EQU A;  2ARS A;  3CC2 A;  4TVA B;  3DB4 A;  3OMG A;  1I5L A;  2WSC E;  2Q7G A;  4ZTJ A;  2RHY A;  4LDX A;  1N8R U;  4M77 D;  3CCQ T;  1M5Q 1;  1BIA A;  1YB3 A;  1OI1 A;  3EFR A;  1K9M C;  3REU A;  1BBW A;  3J7A F;  2Q7E A;  1YFS A;  1QVG A;  3CC4 T;  4JRP A;  3CMA T;  5CKE A;  3M4Y A;  4YRE A;  1WJS A;  4TVR A;  4XTX A;  4CS2 A;  2I4O A;  2LDM A;  4CS4 A;  4MDW A;  3VBB A;  3VQW A;  4QVD A;  1YFR A;  3QKJ A;  1ZBX A;  4M77 G;  1G5H A;  4ZTF A;  2FYK A;  5C0M A;  2C7I A;  4XU2 A;  3JB9 F;  2Q5I A;  3RF1 A;  3NTK A;  2G3R A;  2XI9 A;  1S72 T;  3PT9 A;  3P8H A;  4XQ3 A;  4XTU A;  1VQ6 T;  4C92 B;  3RGL A;  2BKD N;  5F5W A;  3A74 A;  5FRN A;  3L42 A;  4QQG A;  3FJP A;  2ZNJ A;  2DTO A;  2KDS A;  4YRN A;  1X2H A;  2QTX A;  3G1Z A;  3CCR A;  4BE0 A;  2PU9 B;  4C5G A;  1B34 A;  4M7D G;  4C8Q B;  5DLQ E;  4OB2 B;  3G71 T;  3VU3 C;  2V8J A;  2R5M A;  4O6J A;  2X4W A;  3HY1 A;  5GAN e;  3JSC A;  2LQK A;  2ZT8 A;  3TEH B;  2DD4 A;  2P5I A;  4O5V A;  3CCQ A;  4HWP A;  3HFV A;  1Y07 A;  4PJO B;  2RA2 A;  3A5Z A;  1ZHI A;  3LGL A;  3M53 A;  4YP0 A;  3IAL A;  5GMK i;  1N9S A;  4O2D A;  4LVK A;  4EMG A;  4YCV A;  4H2S A;  1JBM A;  1K73 C;  1QP2 A;  3JB9 I;  2RI3 A;  1JJC A;  1PYS B;  1B70 B;  3M5A A;  4N4I A;  1OYX A;  1HK9 A;  3HPW A;  4IKF A;  3S6W A;  2DKG A;  3VQX A;  4HCB A;  3G6E A;  4M78 G;  5C51 B;  2FVU A;  1QW1 A;  1Z7M A;  5LJ5 j;  3QPH A;  4C92 G;  1D3B B;  3VJP A;  1QVP A;  1YBY A;  2DD5 A;  3HRI A;  1WNL A;  2DIG A;  1G51 A;  4YRI A;  4M7A C;  4ZGE B;  2ZT7 A;  4LDV A;  5GAO m;  4KR3 A;  1M1K U;  4LNS A;  1NPR A;  1P92 A;  3VKI A;  5FRO A;  1VQP A;  2QQR A;  4IUQ A;  3CMA A;  4MZM A;  2HNI A;  4UP7 A;  2A7Y A;  2FB7 A;  4M78 F;  3FIF A;  3LLR A;  3LC0 A;  3AHU A;  3RAC A;  3DLL A;  3MP6 A;  4M7D F;  3A31 A;  2XID A;  4KUD K;  2HQE A;  3CCE A;  3CC2 T;  3HP9 A;  4P3O A;  2RHS B;  3LSS A;  1KHC A;  1W2B S;  3L4G B;  4UP8 A;  4OLF A;  4M75 G;  5KH6 A;  1GGM A;  5J39 A;  4P5N A;  1EIY A;  1HXD A;  4P71 A;  2LX9 A;  3OD1 A;  4YRO A;  2F5K A;  4EMK C;  1NJ2 A;  4RMO A;  1SES A;  4NL3 A;  3O8V A;  4LD9 K;  1SET A;  2QEX A;  4E7K A;  2LVM A;  3CCU T;  3JB9 G;  3SB2 A;  5GAO p;  4LVL A;  1VQ4 A;  3G7Z A;  3P8T A;  1KG1 A;  1K73 U;  3P8B B;  4ELY C;  4TVW A;  3EFS A;  3UGQ A;  1USY A;  3QG1 A;  4PHC A;  3OA6 A;  5GAM d;  2ZZF A;  2O4X B;  3FEO A;  3OS2 A;  2QHT A;  4P3N A;  4JUV A;  2DAQ A;  2RD1 A;  5GAM g;  2JUF A;  4JRI A;  2J3M A;  2QHU A;  1LJO A;  5GAO n;  1MHN A;  1WYD A;  1W66 A;  1GXI E;  2E3C A;  2D9T A;  3QZ5 B;  4IUV A;  3CCV T;  4CRI A;  1ASZ A;  3TUP A;  3P8V A;  3QO5 A;  2MWO A;  4JS5 A;  3RES A;  3MF1 A;  2XK0 A;  1VIE A;  5DY9 A;  4M78 E;  1E1O A;  4M7A F;  2YRV A;  3A7R A;  2VXE A;  3CPF A;  4P71 C;  5HY6 A;  1BKB A;  2JNG A;  2O01 E;  2HD0 A;  2NS6 A;  4DPG A;  4IUU A;  4YYE A;  4MZP A;  3HFN A;  2XG8 D;  4FT4 A;  1M4Z A;  2IG0 A;  2XKO C;  1VQ9 T;  2AMC B;  1Q86 U;  4D6W A;  2EJF A;  3KUF A;  4B9X A;  3M56 A;  2L89 A;  2K4Y A;  1B76 A;  4RCC A;  3A7A A;  3A5Z B;  3HRS A;  1QVG S;  1K8A U;  2CJA A;  1KMM A;  5A0L A;  2OTJ A;  3QBY A;  5CO7 A;  3MF2 A;  4RCB A;  4BI3 A;  2ZR2 A;  2YHT A;  5GAN 6;  2RH2 A;  3GNG A;  1NJ6 A;  4ELZ C;  4BE1 A;  3RIR A;  3MQZ A;  3CD6 A;  2Y4X A;  1Q86 C;  2RHZ A;  5K1P A;  3FRN A;  3X28 B;  5CCA A;  2DO3 A;  5E3I A;  4H2Y A;  2QDY B;  3L4G A;  3GLX A;  5LJ5 h;  3JB9 H;  2KVQ G;  5GAO q;  3WXM B;  4K87 A;  4DOW A;  3OB9 A;  4XTV A;  1VQO A;  3UFG A;  4PKC C;  3NEL A;  4HVC A;  3ZEH A;  3W3S A;  4P74 A;  2VUB A;  2BUD A;  3F70 A;  3QJY A;  4C0Z A;  4YPF A;  3N5B B;  3CCV A;  4X9C A;  3CXC S;  2E41 A;  3OYK A;  4IUR A;  4G84 A;  2DQ0 A;  4HWT A;  3HXW A;  4QQ6 A;  2DXU A;  3E1S A;  3BJU A;  4KQE A;  3QHS A;  3HRU A;  1IRE B;  5J26 A;  4Q5W A;  4JLG A;  4HKE A;  3JCM J;  5GAM f;  4HT4 A;  4OB1 B;  5KCO A;  4TVY A;  1V29 B;  1PSE A;  4JJN K;  1M8V A;  1M1F A;  4F7U B;  4LVI A;  3RMQ A;  3I56 T;  4P3P A;  5CKD A;  1YFT A;  3VYH B;  2CZ7 B;  3NFC A;  5A2Q E;  1VQ8 T;  5GAN 2;  2OTJ T;  2DXT A;  3URG A;  1MGQ A;  2HQX A;  1H3Z A;  2CZ6 B;  3PGG A;  4RG8 A;  5K1X A;  2AKW B;  4A53 A;  3M54 A;  1YJ9 A;  2X4X A;  3CXC A;  1BI1 A;  1KQ2 A;  2O4X A;  1VQ9 A;  2OTL T;  2K5L A;  4ZN3 A;  1KD1 U;  5A0D A;  3ER0 A;  1EFW A;  1N8R C;  1D3B A;  3HKS A;  2PUO B;  5IN1 A;  5A0G A;  4CI0 C;  1G3S A;  3J80 E;  2AHJ B;  4EDU A;  3G71 A;  2GQV A;  1AHJ B;  2V8I A;  1H64 1;  1UEB A;  4H2T A;  4NOY A;  4OP0 A;  1G5V A;  2ZXF A;  4CH4 A;  1B70 A;  4JS4 A;  4NCX A;  1EQR A;  2I2L A;  3KBG A;  3OYI A;  2JZ2 A;  3S3M A;  1M1K C;  1NNH A;  1IZ6 A;  2ZCF B;  4N4H A;  3QO3 A;  4JLI A;  2P4T A;  4M7D D;  2RHQ A;  4ATO A;  3CBP A;  3L2Z A;  4H02 A;  4BAC A;  4K86 A;  2ZNI A;  2ODR D;  1BIB A;  5D6Y A;  3HFO A;  1Y96 B;  2E64 A;  2HBP A;  2F5T X;  3JCM Q;  2X35 A;  4KR2 A;  4JRQ A;  5GAN 5;  1VQK T;  1S72 A;  1NJ5 A;  4ZTZ B;  5ELN A;  3QNE A;  2L3R A;  4JDS A;  4C92 C;  5GAM j;  3TRE A;  1Q81 C;  4M7D A;  2J3L A;  4J6Y A;  4C5H A;  2VGN A;  5KNN A;  1Q81 U;  2JTM A;  2ZPF B;  4C92 F;  1YJW T;  3SFM A;  3LSQ A;  1QF6 A;  2RJC A;  2K2V A;  3UWN A;  1VQO T;  3R6O A;  4M7A A;  3PNW C;  3KFU A;  3CCR T;  4V2S A;  3SDZ A;  4L6V 5;  4HCZ A;  4RKU E;  3X25 B;  4N4G A;  1YI2 T;  5D6X A;  3CCM A;  2ZT6 A;  2ART A;  2ZR3 A;  3CCE T;  4WI1 A;  5GMK e;  5CKF A;  5GMK j;  3C4S A;  1IL2 A;  3M59 A;  4C0D C;  2R58 A;  2JVV A;  4LD6 A;  2ZIM A;  1E1T A;  3E9H A;  3A8O B;  3H6Z A;  4OMF B;  3TEG A;  4E47 A;  2P0P A;  4DA4 A;  1NJI U;  3QII A;  3JCM W;  2LT1 A;  1VQP T;  2RB6 A;  5LJ5 e;  3HRK A;  5DLO A;  3JCM e;  3CPW S;  2RK1 A;  4YCW A;  1I81 A;  4M78 C;  2A3L A;  2XDD A;  4XTZ A;  2A8E A;  3OYA A;  4BI8 B;  2RHQ B;  1VQM A;  3GIB A;  4A54 A;  2RO0 A;  1BYM A;  3V8K A;  4J7I A;  3HXU A;  2AMC A;  5LJ5 f;  3L2W A;  1I4K 1;  4LDW A;  1WLE A;  1U1S A;  1TH7 A;  2RHX A;  4YRS A;  3BFM A;  3JCM f;  4C92 E;  1FX7 A;  3JCM P;  2DU5 A;  4N0A A;  5DM7 R;  3PCO A;  4II1 A;  3MET A;  3UH0 A;  2YLC A;  3A32 A;  4YRR A;  3V8L A;  3JCM c;  2ZIO A;  3H8Z A;  3NEM A;  3ZFJ A;  2NLU A;  1YIT T;  1O9S A;  5LJ3 e;  4H2V A;  3CBM A;  5I2M A;  2KK4 A;  4P75 A;  5FU6 B;  3QUI A;  2DTI A;  1U8R A;  2Y90 A;  1WJR A;  3M58 A;  5L8R E;  2CS7 A;  2MWP A;  5CK9 A;  1H4Q A;  2OAU A;  2E12 A;  1NZ9 A;  4E7I A;  2H3J A;  4TTV A;  3IKM B;  4E51 A;  1X75 C;  4EO4 A;  4Q15 A;  4P73 A;  3WVD B;  3Q1J A;  5LJ3 h;  5GAO r;  3MEV A;  3PCO B;  3OBY A;  1JJ2 A;  2DK3 A;  2LNV A;  4EX5 A;  2XU8 A;  4Z02 A;  3UDC A;  2ODR C;  4KUL A;  2QA4 T;  4BDZ A;  2E5A A;  2DPP B;  2GCX A;  3UGT A;  4MMK A;  5CQY A;  4YDQ A;  2WSF E;  3M9Q A;  4R55 A;  2P0Q A;  3HY0 A;  4J83 A;  4PJO F;  3OYY A;  3NET A;  5EG2 A;  3CCS A;  1VQ5 A;  4B9W A;  1Q82 U;  2CGH A;  4PLL A;  2L8D A;  4C0D B;  4PG3 A;  4NS5 A;  3VUB A;  2KAF A;  4YRJ A;  4C8Q D;  4XEO A;  1B7Y A;  4E7L A;  1EIF A;  1NJ8 A;  4PJO C;  3ICA A;  4BWA A;  4TQD A;  4C8Q G;  5FLX E;  3HFZ A;  1OZ2 A;  3L2Q A;  2C06 A;  4YRM A;  3OW2 S;  4J7F A;  4OGE A;  3OYD A;  3M55 A;  4CS3 A;  5GAN 7;  3V8J A;  5CKB A;  1L0W A;  4N0A C;  1X55 A;  4PJO G;  5GAM h;  3OYM A;  5KE3 A;  4H2X B;  3MCA B;  3OSS C;  1Y71 A;  4Y28 E;  5LL6 S;  3CD6 T;  4C5E A;  1NPP A;  2RI2 A;  2EYQ A;  2LCC A;  4PJO A;  1KMN A;  1XQH A;  2M16 A;  1UGQ B;  2YLB A;  5GAO l;  3FDR A;  4K88 A;  4M78 B;  4ZN1 A;  5LJ5 g;  1Q7Y C;  1WQ7 A;  2DZ9 A;  4M75 F;  3L2R A;  2K57 A;  4XU3 A;  4C0F A;  4ZTU B;  2PUK B;  3JCM g;  5GMK h;  1RL2 A;  1UGP B;  4C0G A;  3S3N A;  4FT2 A;  1KQS S;  3HL8 A;  4EMH A;  1U1T A;  4KUI A;  1FXX A;  1B7Y B;  3I55 T;  2ZPH B;  3OS0 A;  4Q6G A;  1ZQ1 A;  4M78 D;  1X56 A;  1N6A A;  4YRF A;  4FSX A;  4PJO D;  2GFU A;  3R07 A;  2ALY A;  2E5Q A;  4C8Q C;  3GNF B;  3CEY A;  2MAM A;  5FU6 C;  3E9I A;  4RDX A;  1BI3 A;  4EMK A;  5GAN f;  3KXT A;  1EVL A;  1M90 C;  1YGB A;  3A7U A;  3OY9 A;  3JB9 J;  2PVO B;  3M4Q A;  3HFZ B;  2EJ9 A;  2D6F A;  4XU0 A;  3E9F A;  3JCM V;  3VQV A;  2DXC A;  3G4S T;  4YCU A;  2QQB A;  1YJ9 T;  2EFI A;  2QXF A;  3QDR B;  4OVA A;  4QW2 A;  4RQE A;  2HAX A;  2RM4 A;  2R57 A;  4M78 A;  1K9M U;  4IUT A;  1Z7N A;  2DTH A;  1PSF A;  3QYH B;  1JJ2 S;  3HRT A;  1YHQ A;  3A8H B;  2DDZ A;  3FC3 A;  2VYT A;  4M7D B;  2QQS A;  4QVZ A;  3BY7 A;  1Q82 C;  1LNX A;  5KE2 A;  1BBU A;  3L1A A;  5GAM e;  2EQJ A;  1JB0 E;  3HTZ A;  4F7U F;  3I56 A;  3PMT A;  3IG2 A;  2ALY B;  4ZGJ B;  1NE8 A;  2GFA A;  4A4F A;  5LJ3 f;  3SD4 A;  1EVK A;  2I4N A;  2B8A A;  4HA8 A;  2LC4 A;  4G85 A;  2CZ1 B;  4M75 C;  3TEE A;  4KT0 E;  4QQD A;  1QVF A;  4P73 C;  2P0K A;  3DSQ A;  4M7A E;  2DJZ A;  1G3Y A;  3QTC A;  2ZPE B;  1NYQ A;  4EMK B;  3OYE A;  2ZGW A;  4H2U A;  1K8A C;  3CC7 T;  4LDU A;  5M9O A;  3CCL A;  4J6W A;  4CH3 A;  4CH6 A;  5GAN 4;  3GP8 A;  2FL7 A;  1YIJ T;  4RG2 A;  1WGS A;  4C8Q E;  3RUX A;  3RKX A;  3UPU A;  1VQL A;  4TWA A;  3L2U A;  1M90 U;  4J8O A;  4P75 C;  1BI0 A;  5GMK m;  2KQW A;  1H4V B;  4J5Y A;  1SRY A;  1WPY A;  4M77 A;  3VV0 A;  4BW9 A;  3QYG B;  3BW1 A;  3C94 A;  3A8L B;  1YHQ T;  2LRQ A;  4WJ3 M;  3GPL A;  2MMP A;  4NL2 A;  4QVC A;  4H2X A;  3JAM E;  2EAY A;  2XD0 A;  2WAC A;  4YTL A;  3CCU A;  3OBW A;  2CJB A;  2KSS A;  4M77 F;  2RK2 A;  3LWH A;  1KHI A;  4HT8 A;  1KQS A;  5J3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...