2DKGA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, pyrophosphate and mg(2+)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 71
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dkgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dkgA01
4LNSA 4H2SA 1LOJA 1M8VA 2RHQB 3L2ZA 3JB9G 3HFZB 3GIBA 1IL2A 1D3BA 4YROA 1U1SA 2ZINA 1L0WA 4H2XA 2YHTA 1WQWA 4TQDA 4JRIA 4YP0A 2ALYA 4P3OA 4H02A 1J5WA 1X55A 4P71A 3A31A 4F7UA 2ZZEA 1WNLA 4M7DG 4RDXA 4XTYA 4L87A 4HWRA 4H2YA 5GAOp 1JJCA 1H641 1USYA 2DQ3A 5HGQA 4JLIA 4MMKA 4XEMA 4PJOB 3HRKA 11ASA 3TEHB 3NENA 4HT9A 1B7YA 5GAMj 5LJ3g 2Y90A 5F5WA 4YREA 1YCYA 3RL6A 5C51B 2ZCEA 2QHTA 2RHSB 1I4K1 1X54A 4EMKB 3HY1A 3JCMf 5LJ5f 3IG2A 4M75G 5GAMd 3QO8A 2ZXFA 1NJ6A 4EMHA 4EMKC 3QSUA 3R07A 4TQFA 2FB7A 5LJ3h 4M75E 4M7DC 4C8QG 5GANe 3JCMP 1G5HA 2AMCA 4QVCA 4H2UA 1EIYA 3SB2A 1I81A 3HSBA 2AKWA 2DU7A 4AH6A 4JRKA 3HFNA 4C8QE 2ZZFA 3E9IA 5GAN7 3JCMX 1BBUA 3HXUA 1EQRA 3VQXA 3FIFA 3JCMc 2E64A 1EFWA 3OD1A 3RESA 2C7IA 2QHSA 1YFTA 3JCMg 1G51A 1YGBA 3IALA 3MF2A 2K57A 3ICAA 4M77G 1B70A 4Q15A 4YRJA 3NEMA 1SESA 4C8QB 4M75C 1WLEA 2ZNJA 1NYQA 2ODRC 4M77E 5GAMe 2DXUA 2XTIA 1LJOA 4C92D 4C8QC 5GMKh 3IKLA 1WPYA 5LJ3j 3JCMh 3A5YA 4YYEA 5LJ5h 4X9CA 3TUPA 2EWNA 4HVCA 3RUXA 3P8VA 1NJ5A 4O2DA 2IY5B 2RB6A 5GANh 5GAN3 4TVAA 1ASYA 4M78G 4YRSA 1ADYA 1BIBA 2E41A 3E9HA 3UGQA 1PYSA 5GAN5 4YDQA 3V8KA 5DY9A 5GAN8 5LJ3d 2E5AA 1NJ1A 1X2GA 4P73A 4M77C 5GAOr 3FJPA 1Z7MA 5ELNA 4KR3A 4M7DD 1N9WA 2XGTA 3JCMW 4YRKA 2ARUA 4UPAA 4P72A 4P74C 3RKWA 3LC0A 1KQ1A 5GMKj 2I4LA 4G85A 5GAOl 3A7AA 5GMKi 4HWPA 5LJ5j 3G1ZA 3PZCA 1SRYA 3EFRA 4M78C 4C92F 4QVDA 1NJ8A 2Q7HA 3PGGA 5E3IA 1U1TA 4ZIBA 1H4SA 4PJOG 4K88A 3RACA 3L4GB 4K86A 4X9DA 2ZT7A 1YFRA 5LJ3e 3NELA 3JCMd 4PJOE 5LJ5d 4RMFA 3RKXA 4HWTA 3QUIA 4X5OA 1BIAA 2EAYA 5GANd 2G4CA 3M4QA 4KR2A 3UH0A 3MEYA 1D3BB 1B34A 5GMKm 4OLFA 4C92A 4H2XB 4HWOA 4M7AD 5C52B 2ALYB 5GAOm 4A54A 3JCMQ 5I21A 4M7DF 2DVEA 2JN0A 4BW9A 4F7UB 3QTCA 3I7FA 1NNHA 2DXTA 4G84A 1B34B 2ZT8A 4XTWA 3CMQA 4PJOC 5ELOA 4J6YA 1JJCB 4TWAA 1SETA 4P71C 2QTXA 2YLCA 5GAN6 4EO4A 2DU5A 1B7YB 4J15A 1W66A 5GMKe 3JCMe 1ATIA 1EVLA 3JCMV 5LJ5e 4RQFA 2VXEA 2CJ9A 2EL9A 4M7DA 4M75F 3VBBA 4P75A 4RQEA 4N0AC 2CGHA 3M4PA 1Y96A 4DPGA 3QHSA 4M78D 5KNNA 4EMGA 1E24A 4KQEA 2AMCB 1EIYB 4XTXA 1JRIA 2AKWB 5CAIA 4M7AF 3BFMA 4BWAA 3HXWA 3BJUA 12ASA 2ZNIA 3PCOA 4M75A 5GAN2 2RM4A 2E1HA 4XEOA 4PG3A 4WJ4A 1HK9A 3SWNA 4YRLA 2PMFA 4ZTUB 1N9RA 2VXFA 2ZGWA 1B70B 3L1AA 1X56A 3QNEA 4NL3A 2ZIOA 3HXXA 1X01A 4M7AA 4YRIA 1E22A 3BDUA 3V7SA 2Q5IA 3V7CA 4XTUA 2Q7EA 2E10A 2DZ9A 1N9SA 3JB9D 2ZIMA 4DQ2A 4YCUA 2DJZA 3VU3C 4M78F 1FYFA 4M7AB 1H4QA 4TVAB 2QHUA 3HTZA 3RF1A 1PYSB 3A7UA 3V8JA 1I5LA 3IKMB 2ZT6A 2HNIA 3VQYA 2EJFA 1VQZA 1H4TA 4YRNA 2CJAA 4P74A 2P0LA 5GMKl 3HFVA 3MF1A 3JCMJ 4UP9A 2DDZA 2FYKA 1RIQA 2ZR2A 4ZTZB 4YRFA 5GAMg 4M78A 2P5IA 4YCWA 3QO3A 1YB3A 4RCCA 4F7UG 4P3PA 4J6XA 3DSQA 4J6WA 2ZTGA 4XTVA 4M75D 4C92G 4PJOF 4TTVA 4F7UE 2ODRD 2CJBA 2DTIA 3M4GA 1EOVA 2RHQA 3JB9F 3HFZA 4YCVA 1KOGA 4C8QD 4CH3A 4EX5A 3V7RA 4WF2A 4C92E 3A74A 1B8AA 1X2HA 3UGTA 3TEGA 1KMMA 2PMEA 1ADJA 4TVWA 2DEQA 4PNOA 2E65A 1WQ7A 4YRQA 4CH5A 4V2SA 4Y91A 1GGMA 1QE0A 1HC7A 4C92B 4PJOA 3TEHA 1NYRA 1YFSA 4M77D 3QO7A 3LSQA 4C92C 2ZR3A 2DTHA 4XU1A 1H4VB 2RA2A 1USYC 3VQVA 3KFUA 2RHSA 3HFOA 4M7DE 4EMKA 2ARSA 4HA8A 1HXDA 3RIRA 2J3MA 3ERRA 1EVKA 2Q7GA 4E51A 4JUVA 4N0AA 1B76A 2I4OA 3NETA 4YRCA 2EJ9A 4XTZA 4H2VA 4C8QF 2YLBA 1HTTA 3FB9A 3HRIA 4YRRA 2I2LA 4M7DB 4CS2A 3WQZA 4A53A 4YRTA 1JBMA 4YRGA 3JB9H 1WU7A 5GAOq 2DZCA 5GANf 4XU2A 2DKGA 5GAN4 3AHUA 3P8YA 1Y96B 3LSSA 4WI1A 5C53B 4YRPA 4XU3A 4P75C 3UFGA 3BY7A 4P3NA 1C0AA 1Z7NA 3HXYA 2E3CA 4M7AG 2EJGA 4M77F 2QHVA 4H2TA 4C8QA 1M5Q1 1G5IA 4CH6A 2DQ0A 4M7AE 3PCOB 4M75B 4H2WA 4WJ3M 2Q5HA 5LJ5g 3SWNB 1E1OA 2RD1A 4PJOD 4MMLA 3RKYA 5GAMf 4CS3A 3BW1A 5GANg 4HWSA 3HXVA 3HXZA 5K1XA 1WYDA 3A5ZA 3W3SA 4NCXA 3SWNC 2IY5A 4TVYA 3P8TA 4HT8A 4XU0A 1E1TA 4M77A 1LNXA 2DTOA 4K87A 4J5YA 1BBWA 3VQWA 4M7AC 4YRMA 3A32A 4UP7A 4Q6GA 3V8LA 4M77B 3JB9I 2C8MA 2ZT5A 4M78E 3HY0A 4YPFA 4P73C 1ASZA 2I4MA 4CS4A 3QO5A 1TH7A 1SERA 3REXA 3JB9J 3A7RA 1QF6A 2ARTA 3JCMb 3REUA 4P72C 3RERA 2ZZGA 3INZA 4PHCA 1NJ2A 5GAOn 2J3LA 4M78B 5K1PA 4CH4A 4F7UF 5GAMh 4OP0A 3L4GA 1KQ2A 2VC8A 3RGLA 1I8FA 2I4NA 4RCBA 2CIMA 1KMNA 4XQ3A 4NOYA 1MGQA 5GANj 4NL2A 3EFSA 1LYLA 4UP8A 5LJ3f
chains in the Genus database with same CATH superfamily
1VQ6A 3L2ZA 3CD6Q 1D3BA 3L2VA 4YROA 3I56T 3I5RA 2ZINA 2YRDA 2YHTA 2ED0A 4LVKA 4JRIA 2RQWA 4YP0A 1RAGB 3L2QA 4CC3A 4P71A 3LH0A 3HRTA 3QYHB 4M7DG 2PUOB 4XTYA 1M1GA 4RDXA 3ZBDA 2C0IA 1VQPQ 4C0DC 1USYA 2M0OA 2ZPGB 4MMKA 4XEMA 4PJOB 1B7YA 2EVRA 3VKIA 3C94A 4RTUA 3A8OB 4MDXA 2ZCEA 2E4HA 3VYHB 1JB0E 2CT4A 2JUFA 3JCMf 1JO8A 2GQVA 5LJ5f 2XHCA 3OYFA 4M75G 2B8AA 1O75A 3QO8A 2ZXFA 2F2VA 1ZHIA 1VQ8Q 2W10A 4EMKC 3QBYA 2GGRA 5LJ3h 5GANe 3JCMP 4QVCA 2KRNA 4H2UA 3SB2A 2DU7A 3PVQA 2P0QA 3CCLQ 2O9VA 3CMAT 4AH6A 2RN8A 4Z8AA 3HFNA 2ZPBB 1QLYA 3HXUA 1EQRA 5CKHA 3JCMc 2QDYB 1VYTA 1Y71A 1OEBA 3CCVQ 3CCQA 2K57A 3ICAA 4ORZA 1PSEA 2NWMA 3H6ZA 4Q15A 3CBMA 5M9OA 3CC2A 1XJWB 2MI6A 1NYQA 5KYUB 4JZ4A 2GCXA 1M3AA 2DL4A 2DXUA 1NPRA 4C8QC 2DXCA 2KQWA 5LJ3j 2X9HA 3OS2A 4BI4A 4YYEA 1SRMA 4AFSC 4HVCA 3P8VA 2IY5B 2RNAA 2RB6A 5GAN3 3EH1A 1N6AA 2LJ0A 1BIBA 2O4XA 3E9HA 3OYKA 4OB3B 2SEMA 5GAN5 1GRIA 2EYQA 4E7HA 2E5AA 4ESRA 1OZ2A 4RTTA 2X51A 3CPWS 4M77C 4A63B 3JRZA 2K3XA 4PFPA 2IG0A 4HCKA 1FX7A 2XGTA 3JCMW 1TWBA 2K2VA 4P74C 3RKWA 4BD3A 4WCIA 4FSSA 3OYLA 3GF5A 1BI2A 1PRMC 1TUDA 2G6FX 4FYWB 5GAOl 2LQ8A 2L3RA 2DEUA 2CP3A 2AK5A 4B9WA 1IGQA 1W4SA 4PJOG 2EQJA 1QVFS 1U06A 3RACA 3NELA 2VKNA 3JCMd 2FZKB 3AT1B 5LJ5d 2DJQA 1X69A 1E7OA 1GBRA 4P5NA 3QUIA 4X5OA 2OTLT 2KEAA 1Q82R 1VQNQ 1B34A 1QP3A 2ECZA 5C0MA 2RI3A 1VQPA 1XNIA 1KC8C 4H2XB 5FW9A 2V1RA 4M7AD 4F04B 2KDSA 2B86A 3JCMQ 4M7DF 1IREB 5I2SA 3R6OA 1X43A 3ZL7C 2ZT8A 1VQ9A 4LD9K 1VQ6T 1SETA 4P71C 2QTXA 1RI0A 5FWBA 2JXBA 5GAN6 2X4JA 3QIIA 3OB9A 3TEEA 2DU5A 2COYA 1QVFP 5GMKe 2LZ6B 3JCMe 1EVLA 2KMTA 1Q7YC 3OYJA 1NJIC 5LJ5e 1E6HA 4M7DA 1M8MA 2KBTA 1MMGA 3H0FA 4M75F 3VBBA 4GLMA 4P75A 1I0CA 1D1CA 4OGCA 3G4SQ 2CGHA 4XK8E 4L59A 4LVIA 4M78D 4OGEA 3QJ6A 1RADB 2GTJA 1TOVA 4KULA 1YFNA 1E24A 3MEVA 2AMCB 2KROA 3CCVA 5IH2A 3VS6A 1R8OB 1PCXA 2K5IA 2ZNIA 3O8VA 4DA4A 4M75A 1ZUKA 2RM4A 5GAN2 1W2BS 4XEOA 4PG3A 1KC8U 4ZTUB 3GPLA 4FT2A 2FO0A 1X01A 3EGXA 1R0BG 2I0NA 2OTJA 2MK5A 1VUBA 3V7CA 2JVVA 2EYXA 3ER0A 3MP1A 5KE2A 2QDLA 3CCQT 2O31A 1OV3A 2F2XA 3CCUQ 3OYDA 1Q7YU 1NJIU 3VS5A 3CC2T 5FRMA 3A7UA 4J9GA 1FYNA 1VQKT 1K0SA 5FU6B 2VVKA 1I5LA 5KYNA 2HNIA 3VQYA 1VQZA 1S72A 2K5LA 1ZQ1A 5KCHA 3LWHA 5KH6A 2FL7A 5GMKl 2A28A 1KQSS 3HFVA 5DLQE 3JCMJ 2FRYA 2P84A 1W1FA 3MP6A 2Y4YA 4YRFA 1R77A 2BZXA 2QG9B 4BE2A 4GBQA 3I56Q 2K3BA 3WXMB 4E7IA 2EBPA 3QO3A 2LCSA 4P3PA 4J6XA 3DSQA 2RJCA 1QKWA 1TXQA 5KYYA 2AKLA 3I9QA 4PJOF 3VYGA 4E2FB 2CJBA 2IIMA 2PNIA 2CP5A 4C8QD 4EX5A 3UDCA 3NPFA 3A74A 1PD1A 1LCKA 4CC7A 1T3SA 1V1CA 3UGTA 1KJWA 1AWXA 4M4ZA 3CC7Q 1ADJA 2E65A 2M16A 2QTVA 4Y91A 1GGMA 2K5FA 3OW2P 1QE0A 4C92B 4PJOA 2F2WA 2M9UA 3CD6T 1YFSA 4L6V5 1YN8A 3KFVA 3PVLA 4M77D 3E19A 3M0RA 3CXCP 3LSQA 3LYIA 2YDLA 1H4VB 2RA2A 3KXTA 3HFOA 3QG1A 2ARSA 1UE9A 3MPUB 1VYUA 2YSQA 1EVKA 2LT4A 4PJMA 1VQPT 4J8OA 3OYNA 2K2MA 1WXBA 2CZ6B 2K3YA 4JUVA 3SEMA 1Z9ZA 3OYAA 3NETA 2A08A 1WHJA 3FB9A 3M58A 1K9AA 4CS2A 3WQZA 4IUVA 2DZCA 1AHJB 2DERA 1QMCA 4F17A 3E2UA 3P8YA 3PNWC 2M51A 4WI1A 2HQHA 4P75C 1VQ8T 1RAFB 3UWNA 1Z7NA 1WHGA 2ZAEA 3BDLA 2CUDA 4J9DA 1QWFA 3H8ZA 2FPFA 3OA6A 4CH6A 2DQ0A 4M7AE 5ECAA 2LVMA 5KYUA 4H2WA 3M59A 5LJ5g 3SWNB 3UATA 1PG5B 2D8HA 3RKYA 4II1A 3CCVT 3BW1A 3PIPA 4N4HA 3CCUA 1WYDA 2IY5A 3OQ5A 4XU0A 1CKBA 1H92A 4D6WA 1LNXA 1M2OA 2EQKA 3RNJA 1PNJA 4PK4A 2C0OA 1TUGB 2M02A 4YRMA 3A32A 2GNCA 3FC3A 1UJ0A 3V8LA 4EPCA 2C8MA 4M78E 2OTJT 4YPFA 1UECA 2RHZA 4P73C 2LQKA 1ASZA 1U8RA 3MHXA 4IURA 2VASA 3QO5A 1WFWA 2GQIA 1TH7A 1KG1A 1SERA 5C6SA 1GFDA 3A7RA 2W0ZA 2OTLQ 3REUA 1VQ4Q 1Q7YR 1NJIR 2CZ0B 5GAOn 2NYSA 1V29B 5HCKA 1K76A 3NFCA 4OP0A 1S72T 1I8FA 1PSFA 4RCBA 1PWTA 1KMNA 1G3WA 3CC7A 5GANj 4L5GA 2CP2A 1G3SA 2COZA 3PTAA 1M8VA 2A8EA 1VQ6Q 2KR3A 2RHQB 3JB9G 3SHWA 1U1SA 3C12A 4OMNA 1TU0B 4H2XA 1WQWA 4H02A 2PVDB 2MAMA 4QW2A 2O88A 2RPNA 4L87A 3UF4A 5KCOA 4Z88A 2DD5A 1H641 1YJWA 11ASA 4J83A 3TEHB 4OB2B 1ZBXA 5LJ3g 2Y90A 1WXUA 4YREA 3I35A 3A8HB 2EGEA 1I4K1 3Q1JA 2RHSB 4AG1C 2OI3A 4LUEA 1O9SA 3IG2A 4AFZC 3ASKA 1ZSZB 1SPKA 3C95A 2ABLA 1Y07A 1JJ2P 2AMCA 3HSBA 3TVTA 2L2PA 2EQMA 3H41A 4C8QE 2ZZFA 1QP2A 3HTRA 3JCMX 1Q86C 2DK3A 1BBUA 3FIFA 1QCNA 4DBRA 1FMVA 1IHWA 3X20B 4QQ6A 4GLKA 2QHSA 1JXOA 2MMPA 1YGBA 3CCSQ 2XKOC 2DYIA 1T0JA 3J7AF 3OYYA 4YRJA 1JXMA 1WLEA 3CC2Q 2K7AA 4A4HA 4M77E 1BK2A 4BY6C 2XTIA 4RTYA 5GMKh 3IKLA 4BI8B 3JCMh 4DBHA 9ATCB 5LJ5h 4X9CA 2VV5A 3CEYA 2EWNA 3EGUA 3MQZA 1NJ5A 4PL6A 4YRSA 2KRSA 1C6VX 2DIQA 3V8KA 2IVWA 1WHKA 2FRWA 1X2GA 3REBB 1D0XA 1BYMA 3CCUT 2DMOA 4KR3A 4M7DD 4K11A 4YRKA 1VQ4A 2ARUA 1Q86U 2GFUA 3QXEB 3CC4A 5CQYA 1KQ1A 5GMKj 3F70A 3X28B 3CXCA 4KGVB 5LJ5j 1V76A 4C92F 4M78C 5E3IA 3VV0A 2FHDA 1YFRA 2DL7A 1ZSGA 5IXFA 4FU6A 1NBEB 3GNFB 2KYBA 3QDRB 2COWA 2F1LA 4FYXB 2RQUA 1VIEA 5GANd 1YJNQ 1OU8A 4KR2A 1WZOA 3MEYA 4B9XA 3H0IA 2QK0A 4QQDA 4C92A 4HWOA 1X6OA 3URGA 1FMWA 3M0PA 2MOXA 5I21A 2JTFA 2JN0A 3QTCA 2QI2A 3HHTB 2DXTA 3CC7T 1ABQA 4AFQC 1VQ9Q 5ELOA 4FCYA 1JJCB 2GBQA 2CH4A 1G2BA 4C5GA 2YLCA 4KBMB 4EO4A 1MNDA 1N5ZA 4X1VA 1BKBA 2CREA 3EG3A 2CKKA 3HL8A 4HXJA 1YI2A 1UGPB 1YHQQ 4C0FA 2KVQG 4PFOA 4RQEA 5IHKA 3CCMA 1YJWT 1BBZA 5GJVB 3M4PA 2HDAA 1I5OB 3VJPA 2A0FB 2QYZA 1WA7A 4XTXA 5IAYA 2AKWB 3BFMA 3CCSA 3BJUA 1EIFA 4FIBA 4AG2C 4LUDA 2DNUA 2LDMA 1H3HA 4JLGA 3SWNA 4YRLA 1WHLA 3G71Q 1OX8A 1R0CB 4BDZA 1N9RA 2P4TA 2ZGWA 1RUWA 4KH0B 1GXIE 4NL3A 1M3BA 3QKJA 4FSXA 5IXBA 3VRYA 4YRIA 3BDUA 3V7SA 2Q5IA 2OTJQ 4Z02A 2NUZA 2RJEA 4HVWA 2QA4A 2PTKA 3HPWA 1WJQA 5I2MA 4YCUA 2DJZA 2VUBA 3VU3C 5A0GA 1OYXA 1FYFA 1WX6A 4M7AB 3OBWA 1H4QA 4TVAB 2QHUA 3HTZA 1VIFA 4LVJA 1PYSB 3CQTA 2J06A 5DLOA 2EKHA 3IKMB 2FG0A 2EJFA 2LQWA 4OB0B 1S72Q 3TCJA 2P0LA 2L89A 4RG2A 2VWFA 1IRXA 3CCRA 4C5EA 1MNEA 1SRLA 3DB4A 4XAXB 3BE3A 1D1AA 4ZTZB 2BE7D 2DYBA 5I11A 2JZ2A 4RMOA 2DILA 1YB3A 4E7ZA 1F1BB 3OS5A 3SD4A 1JQQA 4IIOA 2Y4XA 1E6GA 2X4YA 1GCQC 1YWOA 4J6WA 2QXFA 2QEXA 1IGUA 2PVGB 1PD0A 2GFAA 4TTVA 4F7UE 2O9SA 3M4GA 1TSFA 2RI2A 2RHQA 3EH2A 1YJNA 1VQ4T 2E3HA 4LVLA 1VQMA 1JEGA 1B8AA 1X27A 1Q86R 1Y7XA 1JJ2A 2PMEA 4QKUA 1WQ7A 2CP0A 4YRQA 1RL2A 2LQNA 4RTVA 3HP9A 4IKFA 4C5IA 4RG8A 3TEHA 4C0DB 1AT1B 4TVRA 2JNGA 4C92C 1OOTA 2DTHA 4XU1A 1USYC 2NLUA 3KFUA 2RHSA 4M7DE 2YUOA 4YTLA 2XDDA 2ZPIB 4HA8A 1YHQA 2D1XA 2J3MA 3ERRA 1TTHB 1X2QA 2Q7GA 2G3RA 4E51A 2K9GA 2RHIA 4N0AA 1ZA2B 1ZSZA 2C0TA 2I4OA 1I07A 1AWOA 4H2VA 1XTDA 2FPEA 1WI7A 1Q81C 1H8KA 4KGXB 3JB9H 1WU7A 5GAOq 1QQJA 4GY5A 2DKGA 3H0HA 5GAN4 3AHUA 1VA7A 3EHQA 4HKEA 1AEYA 2VB6A 3UFGA 4P3NA 2O01E 2YXYA 2BIVA 1QVGP 3PMTA 4OMMA 4M7AG 3G71A 1AVZC 3A8MB 2QHVA 3MKDA 3TSZA 4ZGEB 3CCMT 2DBMA 1WHMA 1K9MC 3CPFA 8AT1B 1FMKA 3J80E 3CMEA 5CO7A 2Q5HA 3META 2L3SA 3I55T 2XIDA 1E1OA 4OMQA 1YCSB 5GAMf 3CBPA 1BI1A 5GANg 3HXVA 3HXZA 2E12A 3CCST 4LDXA 3W3SA 3HRUA 4FL6A 3SWNC 4TVYA 3P8TA 2DIGA 1KIKA 2VYTA 2DL8A 4F16A 1NLOC 1N8RC 2PU9B 1ACMB 4K87A 1QCFA 3JV3A 2EW3A 4QQGA 1M4ZA 1BBWA 2H8HA 1KHIA 3P8HA 5IT9E 4M77B 1RLPC 3OYIA 1NZ9A 2X3WD 3S3OA 2EQUA 3OY9A 3OW2S 3CCJA 3SDZA 1VQOA 4PFZA 1Y57A 2QA4T 5AYFA 2YRVA 3CXCS 2ZPHB 3REXA 3L42A 1OZ3A 3JCMb 2KXDA 2V26A 1NJ2A 5K1PA 2RK2A 3MEWA 4AMCA 5CKBA 4LDUA 1K9MU 1KQ2A 2BKDN 4O5VA 3VUZA 3RGLA 2AZVA 1NYGA 2JMAA 2E70A 4XQ3A 4DBQA 4C0ZA 1XQHA 1B07A 4UP8A 3JSCA 1M1KC 4H2SA 1LOJA 2HQXA 3CBOA 3HFZB 3P8DA 3UPUA 1K73C 1ZUUA 1UTIA 3R6NA 1N8RU 5LL6S 2ZZEA 1WNLA 2BTTA 3DKMA 2WACA 2JTMA 2DVJA 4H2YA 5GAOp 1JJCA 2DQ3A 5HGQA 2JM9A 1QKXA 3VS0A 1YJNT 1YJWQ 5CIUA 1PC0A 2RJFA 1VQMT 3NENA 3ZFJA 1GCPA 4KGZB 3P8BB 5F5WA 1OULA 1SHGA 2JW4A 3MO8A 5J3BA 1YCYA 5C51B 1NG2A 1X54A 3HY1A 3DLLA 3QDFA 1BCOA 2R5MA 2YWWA 3HKSA 3NTHA 1VQ9T 4FT4A 4DEXA 5GAMd 4JPBW 1NJ6A 1OPLA 4EMHA 3QSUA 3OS1A 1MUZA 4M7DC 3M5AA 2EFIA 4C8QG 3PT9A 1G5HA 1I81A 1KSWA 2AKWA 2RJDA 1M27C 1ZSZC 1YHQT 1C0MA 1RLQC 4JRQA 4MZTA 3E9IA 2CSIA 1M1KU 3VQXA 4DOWA 1NLPC 3OD1A 1EFWA 2PZ1A 1K73U 3JCMg 2RHUA 2CT3A 1S1NA 2FEIA 4M77G 5HK3A 2K6DA 2D0QB 3NEMA 4M75C 5FU7C 3L2WA 3X25B 1YBYA 4FW1A 2JTEA 4IIMA 2ODRC 5GAMe 2RQVA 4DOVA 1IHVA 2J6OA 4C92D 2DL5A 3WVDB 1IZ6A 2MYSA 1WPYA 4LDWA 3A5YA 5CQXA 4MZPA 2QQBA 3TUPA 3G71T 3RUXA 2BZYA 3GLXA 3NGPA 1KC8R 4O2DA 4TVAA 5GANh 2XDBA 1ADYA 3UGQA 1PYSA 2V8KA 2ROLA 4YDQA 5GAN8 4HCZA 1OQKA 1NJ1A 1MMAA 5DM7R 4ELYC 1SF9A 3FJPA 2QQ9A 4ME7A 1WXTA 2DA9A 1N9WA 1QWEA 2QASA 3CPWA 4JS5A 4P72A 2D0NA 2E5KA 4LD6A 3LC0A 2LX7A 1Z9QA 4A4GA 3CC4Q 4KH1B 3NTKA 3I55A 1FWZA 5EG2A 4FW2A 5GMKi 2CH4W 3G1ZA 3PZCA 2JJ9A 2Q7HA 3PGGA 2A7YA 2J6FA 5FROA 3G1JA 3CCJT 3IQLA 3L4GB 4K86A 3LH5A 4X9DA 1EZZB 1SKUB 4JRPA 3RBBB 3EG1A 4FYYB 3UT1A 5A2QE 1UJYA 4HWTA 1JJ2S 2EAYA 3MEAA 2G4CA 2DAQA 2L3QA 5HKCA 5GMKm 4BB7A 1ZA1B 5C52B 2ALYB 4DBFA 1GFCA 4A54A 2DVEA 4F7UB 1HD3A 2CYZB 4RTXA 3I7FA 2ZPFB 1QVGA 1B34B 1ZLMA 3A98A 4XTWA 3CMQA 4PJOC 2RO0A 4TWAA 1SSHA 1M2VB 3A8LB 3RR6A 1RAIB 1W66A 2MIOA 1ATIA 2HKQB 3JCMV 4RQFA 2XU8A 3M56A 1N8RR 1YI2Q 2VXEA 4A4FA 2CJ9A 2HBWA 1NEGA 5D6XA 3CCMQ 4HCBA 4WTOB 2KSSA 1IO6A 4DPGA 4JJNK 5KNNA 3M55A 2O2OA 4EMGA 2KI7A 4KQEA 1UG1A 1EIYB 5CAIA 3SFMA 2A36A 4BWAA 4JDSA 4R0KA 4ZGJB 3CCEA 1QCOA 4ZN1A 4DEYA 2V8IA 1PM3A 4WJ4A 3G6EQ 3GOXA 1HK9A 2JS0A 3EHRA 1K4US 1IXDA 4UC4A 1FXXA 1B3QA 3FEOA 3MEUA 2RF0A 3PIOA 1B70B 3L1AA 1MV3A 2ZIOA 4Y92A 1VQ5A 5CK9A 3L2UA 2MPXC 5CVIA 1A0NB 1E22A 2HBPA 1NEBA 1M1KR 2Q7EA 4D8KA 1WLPB 2E10A 2DZ9A 2QA4Q 4DQ2A 1M9SA 2MF2A 1K73R 1KD1C 1VOMA 3V8JA 1AWWA 1RAEB 2ZT6A 1H4TA 2HAXA 4P74A 1YITA 4J9CA 4IUTA 4IUUA 2CP6A 3FRNA 3MF1A 4UP9A 3CCRQ 2DDZA 1RIQA 4QT7A 4E47A 5GAMg 2R5AA 2AKKA 2P5IA 2AIRB 2E3IA 4HT4A 1UB4A 4J9BA 4F7UG 4KUDK 5CR2A 2LJ3A 4XTVA 4M75D 2YT6A 4PLIA 2QEXQ 5D6WA 2ODRD 1NM7A 4LXCA 2HZYA 3JB9F 3HFZA 1KOGA 1YWPA 2QQSA 3V7RA 4C92E 7AT1B 1VQMQ 4AFUC 5KYYB 1X2HA 2V8JA 1D0YA 3TEGA 1KMMA 2NUTB 3I5SA 3ZEHA 4TVWA 2EPDA 1OU9A 2CP7A 3X24B 4CH5A 4V2SA 1SG5A 1XOVA 1KD1U 4R56A 3TQ7P 1HSQA 2GTOA 2KRMA 1HC7A 1M3CA 4LDYA 4LNPA 1NYRA 1Y0MA 4JJBA 3MP8A 2DL3A 2ZR3A 2A3LA 4BUGA 3S3NA 1OPKA 1HXDA 2X3XD 3RIRA 3MCAB 2OJ2A 1TG0A 1WJRA 1H3ZA 2LMJA 3JAME 2EJ9A 4XTZA 5IHIA 1HTTA 2YLBA 1ZUYA 4YRRA 5FWCA 4YRTA 1EX4A 1JBMA 1VQLA 5CKFA 4YRGA 4XU2A 2LNVA 1Y96B 3LSSA 5C53B 3QJYA 4YRPA 4XU3A 1C0AA 2RH2A 3HXYA 1BI3A 4PJJA 4R55A 3G6EA 3N5BB 2DPPB 2KT8A 4H2TA 8ATCB 3THKA 1M5Q1 1G5IA 3A8GB 2EYWA 2HQEA 3PCOB 4C5HA 3CMEQ 1VQ7Q 5I22A 4BY6B 2EKOA 2RD1A 3L2RA 4MMLA 4PJOD 4CS3A 5K1XA 4OMFB 2XICA 4JS4A 3LW5E 1VQKA 4NCXA 1AD5A 1ZBJA 3CCET 1GL5A 1E1TA 3GBQA 1DJ7B 4ZTJA 2DTOA 2X35A 3E1SA 2YUQA 3S3MA 1AZGB 3GNGA 2P0KA 4Q6GA 4LE9A 1VQ5T 4OMPA 5FU6C 3TU4K 4Z89A 3HY0A 1UFFA 3MJXA 4HVVA 4BACA 3CCJQ 1VQOQ 1LPLA 3ME9A 3LWIA 4CS4A 2ZCFB 1UHCA 1KK7A 2DRKA 2HL3A 2ARTA 2L0AA 3RERA 2ZZGA 3GP8A 1M1FA 4M78B 2CZ1B 2OAWA 3VUBA 4F7UF 5AT1B 5GAMh 3L4GA 2GF7A 2QGFB 2VC8A 4ZGDB 5HK0A 2BZ8A 1X6BA 2E6ZA 2I4NA 2J05A 1YITT 2FZGB 2YRCA 3CC4T 2CIMA 1W70A 4NOYA 3X26B 2ROTA 5A0DA 3EFSA 5D6YA 2A37A 5LJ3f 2P4RA 2H3EB 1IB8A 1SSFA 4LNSA 1Q95G 3CD6A 2HMAA 3M0TA 3GIBA 1IL2A 2J6KA 3TREA 2F69A 3M4YA 1L0WA 4RUGA 4A4KA 3OSVA 4TQDA 3OMGA 2ALYA 1JU5C 2CDTA 2RQRA 3CPWP 4P3OA 1J5WA 1X55A 1PRLC 3A31A 4F7UA 1BI0A 3EGDB 2CSQA 1CKAA 4MDWA 3OYEA 3M0UA 4OVAA 1QVGS 1U5SA 4HWRA 4N4GA 2Z0WA 3E9FA 4JLIA 2EGCA 3HRKA 1M2VA 4HT9A 1G8XA 2KNBB 5GAMj 2CUBA 2EGAA 1UHFA 1M90C 2ZPEB 2L5QA 3RL6A 4E7LA 2QHTA 4EMKB 4Y28E 2XD0A 3TSWA 1YIJQ 4LVMA 2LP5A 1KD1R 3EAEA 1UGSB 1VQ8A 3QZ9B 3VS7A 3R07A 4ZTFA 3A1PA 4TQFA 2FB7A 3QZ5B 4OMOA 1N27A 2DO3A 4M75E 4JJCA 1EIYA 5KYWB 2PUKB 3CCLA 2JT4A 1YI2T 4JRKA 1BB9A 3DLMA 5GAN7 2DFUA 1MV0B 2E64A 2NUPB 2RMOA 2FVUA 1UGQB 1SEMA 3RESA 2C7IA 3VS3A 1YFTA 4J9IA 1G51A 3MF2A 3IALA 2D8JA 1VQ7A 2HCKA 1B70A 3O5ZA 1PHTA 1VQLT 4C8QB 1SESA 3EFOB 2E6NA 2ENMA 2ZNJA 2QGGA 2LTOA 4KRTA 4HCCA 1LJOA 2JOYA 3M0SA 2D9TA 4E7JA 5KYXB 2MWPA 2DXBA 2SRCA 3OBYA 3G6ET 1M90U 3M54A 3A5ZB 1J3TA 2HSPA 1ASYA 2LT1A 4M78G 1GBQA 4J7FA 2E41A 1SHFA 5DY9A 5LJ3d 1Q81U 3G7ZA 4JJDA 4P73A 2RK1A 5GAOr 6AT1B 5D7UA 4ANJA 1Z7MA 5EC7A 1NPPA 3LGLA 2YUNA 5ELNA 4NS5A 2AT1B 1HJDA 1W6XA 4UPAA 1W2BP 3OSSC 3J81E 3PMIA 2P0PA 2MCNA 3C4SA 1YJ9Q 1UDLA 1AZEA 1AWJA 2KT1A 3I55Q 2IPOB 4LN2A 2I4LA 4G85A 2QQAA 3A7AA 1MMDA 3M9QA 1RAAB 2QAZA 4HWPA 3D7SB 1SRYA 2X4WA 2KGTA 2XG8D 3EFRA 2EQIA 4QVDA 1NJ8A 1U1TA 4ZIBA 5L23A 4X34A 1H4SA 3CCRT 3OYGA 4J9HA 4K88A 5FLXE 3RMQA 4JZ3A 2ZT7A 5LJ3e 4PJOE 5HY6A 1WJSA 2NUTA 3VRZA 1NYFA 2EYYA 3VS2A 3EG9B 3NMZC 3RKXA 4RMFA 4EDUA 1BIAA 2ESWA 2KK4A 1RACB 3M4QA 3UH0A 2QEXT 1VQNA 4KT0E 1D3BB 4F14A 2DRMA 4OLFA 2PQWA 1MMNA 5FRNA 2LCCA 2KY9A 2YUPA 5GAOm 1WIEA 1KQSP 4BW9A 3OYMA 2LC4A 1NNHA 4G84A 2L8DA 1X6GA 4J6YA 2EYZA 2DX1A 4BE0A 4BDYA 3FDRA 1B7YB 4J15A 1YP5A 3LX7A 1YIJA 2LRQA 3T9NA 2F5TX 3OS0A 2RI5A 3CMAQ 4ATOA 4MZMA 2M1HA 1AOJA 2RHYA 5CKDA 2EL9A 1WDXA 5IN1A 1WYXA 4O6JA 3QWXX 4N0AC 3G4SA 1K8AC 3NTIA 2JS2A 2VGNA 1Y96A 3QHSA 1RAHB 2DF6A 3PE0A 1EFNA 5J39A 1OI1A 1P92A 2WSFE 4B6MA 1JRIA 2DBKA 4M7AF 2AZSA 2DE0X 5A0LA 1T3LA 4C0GA 3HXWA 1G3YA 1NE8A 3S6WA 3LLRA 1K1ZA 12ASA 2LCLA 3CCEQ 2NS6A 3PCOA 4ZNXA 1G83A 5IHNA 4LDVA 2ATCB 2E1HA 3LGFA 4QVZA 2PMFA 2D6FA 2VXFA 3PFSA 3CCLT 3REAB 1X56A 3QNEA 2OAUA 1KFZA 2DM1A 1B7TA 3HXXA 1VQ5Q 1PKSA 2OX7A 4M7AA 2BE9B 4XTUA 4E6RA 1CSKA 2ZZDA 2KXCA 3VS4A 2F5KA 3CMET 1N9SA 3JB9D 2ZIMA 4OF1A 2FZCB 3M57A 1VQ7T 1G3TA 3E9GA 4M78F 1D09B 2KE9A 3QWYA 2K79A 2L3PA 2O4XB 3RF1A 1LVKA 4CI0C 4BI3A 5L8RE 2M0YA 2K4YA 1K8AU 4YRNA 2CJAA 2DLPA 1YITQ 1YJ9A 2HL5C 3KBGA 4PKCC 5J26A 1WHHA 1C1AA 1QVPA 2FYKA 1M90R 2ZR2A 4M78A 1OX9A 3I56A 2PVOB 1QW1A 4YCWA 2CS7A 4RCCA 1M30A 1VQOT 1ARKA 2QQRA 1T0HA 1Q81R 2ZTGA 3QYGB 4IUQA 4C92G 1X2KA 2HKNA 2LJ1A 4J9FA 4RTZA 3RDVA 3OYHA 1QVFA 4A4EA 2DTIA 1EOVA 4YCVA 3DB3A 3H9NA 3HRSA 1WGSA 4CH3A 4WF2A 4PJLA 1ZX6A 3UA6A 4IUPA 2HEQA 4FM4B 3EGDA 2DEQA 4PJNA 4PNOA 4Q5WA 1K9MR 5CCAA 1YNZA 2KYMA 2XDPA 3VS1A 2AHJB 3EG0A 1VYVA 4E7KA 1D0ZA 1RABB 3QO7A 1UEBA 2XMFA 2J7IA 4RTWA 3VQVA 3M53A 2EIFA 4EMKA 3CMAA 1MHNA 5KE3A 1VQNT 4OB1B 3C0CA 1UUEA 1HYOA 5CKEA 1B76A 4RKUE 2WSCE 4ELZC 4YRCA 4BE1A 1KHCA 4C8QF 3OYBA 3HRIA 5KYWA 2I2LA 4M7DB 4A53A 4AT1B 5GJWB 2DETA 3FLGA 1VQLQ 5GANf 3WVEB 4PLLA 2C06A 2X4XA 1YIJT 2NUPA 2HSEB 4EIKA 2RQTA 3BY7A 1Q82C 2VGMA 2E3CA 4HVUA 2E5QA 1TS9A 2HD0A 2EJGA 4M77F 2V1QA 2JMCA 4C8QA 4CRIA 3EFOA 1RI9A 1BCMA 3G4ST 4M75B 3OYCA 5FU7B 1W2BA 4WJ3M 3CCQQ 2XI9A 2BUDA 5KYXA 2R57A 4HWSA 2ED1A 3ULRB 3A5ZA 3NHNA 3U23A 1VQKQ 3EGXB 2LX9A 4HT8A 1BU1A 4M77A 2R58A 3QPHA 2FPDA 1G5VA 2MWOA 1ABOA 4J5YA 2XK0A 3VQWA 4M7AC 1UGVA 3EG2A 4CC2A 4UP7A 4E7SA 4KUIA 3RMSA 1TUCA 1X75C 4D8DA 3JB9I 2DD4A 1D1BA 2ZT5A 2KAFA 3OMCA 3UA7A 2RHXA 1I1JA 1U3OA 4N4IA 2I4MA 1KQSA 2JM8A 3FJ5A 2H3JA 3JB9J 1Q82U 1GCQA 1UGRB 4ZN3A 3OW2A 2OTLA 4VUBA 1QF6A 3M0QA 4P72C 1PKTA 3KUFA 3INZA 4PHCA 2J3LA 4J7IA 4J9EA 4CH4A 2LNHB 1K0XA 4FYVB 4CC4B 1K8AR 1YJ9T 3EG9A 4OMLA 1MGQA 2WSEE 2CZ7B 4NL2A 1LYLA
chains in the Genus database with same CATH topology
1VQ6A 3L2ZA 1D3BA 3L2VA 4YROA 3I56T 2ZINA 2YHTA 4LVKA 4JRIA 4YP0A 3L2QA 4P71A 3LH0A 3HRTA 3QYHB 4M7DG 2PUOB 4XTYA 1M1GA 4RDXA 3ZBDA 4C0DC 1USYA 2M0OA 2ZPGB 4MMKA 4XEMA 4PJOB 1B7YA 3VKIA 3C94A 3A8OB 4MDXA 2ZCEA 3VYHB 1JB0E 2JUFA 3JCMf 2GQVA 5LJ5f 2XHCA 3OYFA 4M75G 2B8AA 1O75A 3QO8A 2ZXFA 1ZHIA 4EMKC 3QBYA 5LJ3h 5GANe 3JCMP 4QVCA 4H2UA 3SB2A 2DU7A 2P0QA 3CMAT 4AH6A 3HFNA 2ZPBB 3HXUA 1EQRA 5CKHA 3JCMc 2QDYB 1Y71A 3CCQA 2K57A 3ICAA 1PSEA 3H6ZA 4Q15A 3CBMA 5M9OA 3CC2A 2MI6A 1NYQA 2GCXA 2DXUA 1NPRA 4C8QC 2DXCA 2KQWA 5LJ3j 3OS2A 4BI4A 4YYEA 4HVCA 3P8VA 2IY5B 2RB6A 5GAN3 1N6AA 1BIBA 2O4XA 3E9HA 3OYKA 4OB3B 5GAN5 2EYQA 4E7HA 2E5AA 1OZ2A 3CPWS 4M77C 3JRZA 2K3XA 2IG0A 2XGTA 1FX7A 3JCMW 2K2VA 4P74C 3RKWA 4BD3A 3OYLA 3GF5A 1BI2A 5GAOl 2LQ8A 2L3RA 4B9WA 1W4SA 4PJOG 2EQJA 1QVFS 3RACA 3NELA 3JCMd 5LJ5d 4P5NA 3QUIA 4X5OA 2OTLT 1B34A 1QP3A 5C0MA 2RI3A 1VQPA 1XNIA 1KC8C 4H2XB 4M7AD 2KDSA 3JCMQ 4M7DF 1IREB 5I2SA 3R6OA 2ZT8A 1VQ9A 4LD9K 1VQ6T 1SETA 4P71C 2QTXA 1RI0A 5GAN6 2X4JA 3QIIA 3OB9A 3TEEA 2DU5A 5GMKe 3JCMe 1EVLA 2KMTA 1Q7YC 3OYJA 1NJIC 5LJ5e 4M7DA 4M75F 3VBBA 4P75A 4OGCA 2CGHA 4XK8E 4L59A 4LVIA 4M78D 4OGEA 3QJ6A 4KULA 1E24A 3MEVA 2AMCB 3CCVA 1R8OB 2K5IA 2ZNIA 3O8VA 4DA4A 4M75A 2RM4A 5GAN2 1W2BS 4XEOA 4PG3A 1KC8U 4ZTUB 3GPLA 4FT2A 1X01A 2OTJA 1VUBA 3V7CA 2JVVA 3ER0A 3MP1A 5KE2A 3CCQT 3OYDA 1Q7YU 1NJIU 3CC2T 5FRMA 3A7UA 1VQKT 5FU6B 1I5LA 2HNIA 3VQYA 1VQZA 1S72A 2K5LA 1ZQ1A 5KCHA 3LWHA 5KH6A 2FL7A 5GMKl 1KQSS 3HFVA 5DLQE 3JCMJ 3MP6A 2Y4YA 4YRFA 4BE2A 4E7IA 3WXMB 3QO3A 4P3PA 4J6XA 3DSQA 2RJCA 4PJOF 3VYGA 2CJBA 4C8QD 4EX5A 3UDCA 3A74A 3UGTA 1ADJA 2E65A 2M16A 4Y91A 1GGMA 2K5FA 1QE0A 4C92B 4PJOA 2M9UA 3CD6T 1YFSA 4L6V5 4M77D 3E19A 3LSQA 3LYIA 1H4VB 2RA2A 3KXTA 3HFOA 2ARSA 3QG1A 1EVKA 2LT4A 1VQPT 4J8OA 3OYNA 2K3YA 2CZ6B 4JUVA 3OYAA 3NETA 3FB9A 3M58A 4CS2A 3WQZA 4IUVA 2DZCA 1AHJB 3P8YA 3PNWC 4WI1A 4P75C 1VQ8T 3UWNA 1Z7NA 3BDLA 3H8ZA 3OA6A 4CH6A 2DQ0A 4M7AE 2LVMA 4H2WA 3M59A 5LJ5g 3SWNB 3RKYA 4II1A 3CCVT 3BW1A 3PIPA 4N4HA 3CCUA 1WYDA 2IY5A 3OQ5A 4XU0A 4D6WA 1LNXA 2EQKA 4YRMA 3A32A 3FC3A 3V8LA 4EPCA 2C8MA 4M78E 2OTJT 4YPFA 2RHZA 4P73C 2LQKA 1ASZA 1U8RA 3MHXA 4IURA 3QO5A 1TH7A 1KG1A 1SERA 5C6SA 3A7RA 3REUA 2CZ0B 5GAOn 1V29B 3NFCA 4OP0A 1S72T 1I8FA 1PSFA 4RCBA 1KMNA 1G3WA 3CC7A 5GANj 4L5GA 1G3SA 3PTAA 1M8VA 2A8EA 2RHQB 3JB9G 1U1SA 3C12A 4H2XA 1WQWA 4H02A 2PVDB 2MAMA 4QW2A 4L87A 5KCOA 2DD5A 1H641 1YJWA 11ASA 4J83A 3TEHB 4OB2B 1ZBXA 5LJ3g 2Y90A 4YREA 3A8HB 2RHSB 1I4K1 3Q1JA 1O9SA 3IG2A 3ASKA 3C95A 1Y07A 2AMCA 3HSBA 2EQMA 4C8QE 2ZZFA 1QP2A 3JCMX 1Q86C 2DK3A 1BBUA 3FIFA 3X20B 4QQ6A 4GLKA 2QHSA 2MMPA 1YGBA 2XKOC 3J7AF 3OYYA 4YRJA 1WLEA 4A4HA 4M77E 4BY6C 2XTIA 5GMKh 3IKLA 4BI8B 3JCMh 5LJ5h 4X9CA 2VV5A 3CEYA 2EWNA 3MQZA 1NJ5A 4PL6A 4YRSA 2DIQA 3V8KA 2IVWA 1X2GA 1BYMA 3CCUT 4KR3A 4M7DD 4YRKA 1VQ4A 2ARUA 1Q86U 2GFUA 3QXEB 3CC4A 5CQYA 1KQ1A 5GMKj 3F70A 3X28B 3CXCA 5LJ5j 4C92F 4M78C 5E3IA 3VV0A 2FHDA 1YFRA 4FU6A 3GNFB 3QDRB 1VIEA 5GANd 4KR2A 3MEYA 4B9XA 4QQDA 4C92A 4HWOA 1X6OA 3URGA 5I21A 2JTFA 2JN0A 3QTCA 2QI2A 3HHTB 2DXTA 3CC7T 5ELOA 1JJCB 4C5GA 2YLCA 4KBMB 4EO4A 1BKBA 2CKKA 3HL8A 1YI2A 1UGPB 4C0FA 2KVQG 4RQEA 3CCMA 1YJWT 3M4PA 3VJPA 4XTXA 5IAYA 2AKWB 3BFMA 3CCSA 3BJUA 1EIFA 4FIBA 2LDMA 4JLGA 3SWNA 4YRLA 4BDZA 1N9RA 2P4TA 2ZGWA 1GXIE 4NL3A 3QKJA 4FSXA 4YRIA 3BDUA 3V7SA 2Q5IA 4Z02A 2RJEA 2QA4A 3HPWA 1WJQA 5I2MA 4YCUA 2DJZA 2VUBA 3VU3C 5A0GA 1OYXA 1FYFA 4M7AB 1H4QA 3OBWA 4TVAB 2QHUA 3HTZA 1VIFA 4LVJA 1PYSB 5DLOA 3IKMB 2EJFA 4OB0B 3TCJA 2P0LA 2L89A 4RG2A 3CCRA 4C5EA 3DB4A 4XAXB 4ZTZB 2JZ2A 4RMOA 1YB3A 3OS5A 3SD4A 2Y4XA 2X4YA 4J6WA 2QXFA 2QEXA 2PVGB 2GFAA 4TTVA 4F7UE 3M4GA 2RI2A 2RHQA 1YJNA 1VQ4T 4LVLA 1VQMA 1B8AA 1Y7XA 1JJ2A 2PMEA 1WQ7A 4YRQA 1RL2A 3HP9A 4IKFA 4C5IA 4RG8A 3TEHA 4C0DB 4TVRA 2JNGA 4C92C 2DTHA 4XU1A 1USYC 2NLUA 3KFUA 2RHSA 4M7DE 2XDDA 4YTLA 2ZPIB 4HA8A 1YHQA 2J3MA 3ERRA 2Q7GA 2G3RA 4E51A 2RHIA 4N0AA 2I4OA 4H2VA 1XTDA 1Q81C 3JB9H 1WU7A 5GAOq 4GY5A 2DKGA 5GAN4 3AHUA 4HKEA 3UFGA 4P3NA 2O01E 2BIVA 3PMTA 4M7AG 3G71A 3A8MB 2QHVA 4ZGEB 3CCMT 1K9MC 3CPFA 3J80E 3CMEA 5CO7A 2Q5HA 3META 1E1OA 2XIDA 5GAMf 3CBPA 1BI1A 5GANg 3HXVA 3HXZA 2E12A 3CCST 4LDXA 3W3SA 3HRUA 4FL6A 3SWNC 4TVYA 3P8TA 2DIGA 2VYTA 1N8RC 2PU9B 4K87A 4QQGA 1M4ZA 1BBWA 1KHIA 3P8HA 5IT9E 4M77B 3OYIA 1NZ9A 3S3OA 2EQUA 3OY9A 3OW2S 3CCJA 3SDZA 1VQOA 2QA4T 5AYFA 2YRVA 3CXCS 2ZPHB 3REXA 3L42A 1OZ3A 3JCMb 1NJ2A 5K1PA 2RK2A 3MEWA 1KQ2A 5CKBA 4LDUA 1K9MU 2BKDN 4O5VA 3VUZA 3RGLA 2E70A 4XQ3A 4C0ZA 1XQHA 4UP8A 3JSCA 1M1KC 4H2SA 1LOJA 2HQXA 3CBOA 3HFZB 3P8DA 3UPUA 1K73C 1N8RU 5LL6S 2ZZEA 1WNLA 3DKMA 2WACA 2JTMA 4H2YA 5GAOp 1JJCA 2DQ3A 5HGQA 1YJNT 5CIUA 1VQMT 2RJFA 3NENA 3ZFJA 5F5WA 3P8BB 3MO8A 5J3BA 1YCYA 5C51B 1X54A 3HY1A 3DLLA 2R5MA 3HKSA 3NTHA 1VQ9T 4FT4A 5GAMd 1NJ6A 4EMHA 3QSUA 3OS1A 4M7DC 3M5AA 2EFIA 4C8QG 3PT9A 1G5HA 1I81A 2AKWA 2RJDA 1YHQT 4JRQA 4MZTA 3E9IA 1M1KU 3VQXA 4DOWA 1EFWA 3OD1A 1K73U 3JCMg 2RHUA 4M77G 5HK3A 2D0QB 3NEMA 4M75C 5FU7C 3L2WA 3X25B 1YBYA 2ODRC 5GAMe 4DOVA 4C92D 3WVDB 1IZ6A 1WPYA 4LDWA 3A5YA 5CQXA 4MZPA 2QQBA 3TUPA 3G71T 3RUXA 3GLXA 4O2DA 4TVAA 5GANh 2XDBA 1ADYA 3UGQA 1PYSA 2V8KA 4YDQA 5GAN8 4HCZA 1NJ1A 5DM7R 4ELYC 3FJPA 2QQ9A 4ME7A 1N9WA 3CPWA 4JS5A 4P72A 4LD6A 3LC0A 4A4GA 3NTKA 3I55A 1FWZA 5EG2A 5GMKi 3G1ZA 3PZCA 2Q7HA 3PGGA 2A7YA 5FROA 3CCJT 3L4GB 4K86A 4X9DA 4JRPA 3UT1A 5A2QE 4HWTA 1JJ2S 2EAYA 3MEAA 2G4CA 2DAQA 5HKCA 5GMKm 4BB7A 5C52B 2ALYB 4A54A 2DVEA 4F7UB 2CYZB 3I7FA 2ZPFB 1QVGA 1B34B 4XTWA 3CMQA 4PJOC 2RO0A 4TWAA 3A8LB 1W66A 1ATIA 3JCMV 4RQFA 2XU8A 3M56A 2VXEA 4A4FA 2CJ9A 5D6XA 4HCBA 2KSSA 4DPGA 4JJNK 5KNNA 3M55A 4EMGA 4KQEA 1EIYB 5CAIA 3SFMA 4BWAA 4JDSA 4ZGJB 3CCEA 4ZN1A 2V8IA 4WJ4A 3GOXA 1HK9A 4UC4A 1FXXA 3FEOA 3MEUA 3PIOA 1B70B 3L1AA 2ZIOA 1VQ5A 5CK9A 3L2UA 5CVIA 1E22A 2HBPA 2Q7EA 2E10A 2DZ9A 4DQ2A 1M9SA 2MF2A 1KD1C 3V8JA 2ZT6A 1H4TA 2HAXA 4P74A 1YITA 4IUTA 4IUUA 3FRNA 3MF1A 4UP9A 2DDZA 1RIQA 4E47A 5GAMg 2R5AA 2P5IA 4HT4A 1UB4A 4F7UG 4KUDK 5CR2A 4XTVA 4M75D 4PLIA 5D6WA 2ODRD 3JB9F 3HFZA 1KOGA 2QQSA 3V7RA 4C92E 1X2HA 2V8JA 3TEGA 1KMMA 3ZEHA 4TVWA 3X24B 4CH5A 4V2SA 1XOVA 1KD1U 4R56A 1HC7A 4LDYA 1NYRA 3MP8A 2ZR3A 2A3LA 4BUGA 3S3NA 1HXDA 3RIRA 3MCAB 1WJRA 1H3ZA 3JAME 2EJ9A 4XTZA 1HTTA 2YLBA 4YRRA 4YRTA 1JBMA 1VQLA 5CKFA 4YRGA 4XU2A 2LNVA 1Y96B 3LSSA 5C53B 3QJYA 4YRPA 4XU3A 1C0AA 2RH2A 3HXYA 1BI3A 4R55A 3G6EA 3N5BB 2DPPB 4H2TA 1M5Q1 1G5IA 3A8GB 2HQEA 3PCOB 4C5HA 4BY6B 2EKOA 2RD1A 3L2RA 4MMLA 4PJOD 4CS3A 5K1XA 4OMFB 2XICA 4JS4A 3LW5E 1VQKA 4NCXA 3CCET 1E1TA 1DJ7B 4ZTJA 2DTOA 2X35A 3E1SA 3S3MA 3GNGA 2P0KA 4Q6GA 1VQ5T 5FU6C 3TU4K 3HY0A 4BACA 3ME9A 3LWIA 4CS4A 2ZCFB 2ARTA 3RERA 2ZZGA 3GP8A 1M1FA 4M78B 2CZ1B 3VUBA 4F7UF 5GAMh 3L4GA 2GF7A 4ZGDB 2VC8A 5HK0A 2E6ZA 2I4NA 1YITT 2CIMA 3CC4T 4NOYA 3X26B 5A0DA 5D6YA 3EFSA 5LJ3f 1SSFA 4LNSA 3CD6A 3GIBA 1IL2A 3TREA 2F69A 3M4YA 1L0WA 4A4KA 3OSVA 4TQDA 3OMGA 2ALYA 4P3OA 1J5WA 1X55A 3A31A 4F7UA 1BI0A 3OYEA 4MDWA 4OVAA 1QVGS 4HWRA 4N4GA 3E9FA 4JLIA 3HRKA 4HT9A 5GAMj 1M90C 2ZPEB 2L5QA 3RL6A 4E7LA 2QHTA 4EMKB 4Y28E 2XD0A 4LVMA 3EAEA 1UGSB 1VQ8A 3QZ9B 3R07A 4ZTFA 4TQFA 2FB7A 3QZ5B 1N27A 2DO3A 4M75E 1EIYA 2PUKB 3CCLA 1YI2T 4JRKA 3DLMA 5GAN7 2E64A 2FVUA 1UGQB 3RESA 2C7IA 1YFTA 1G51A 3MF2A 3IALA 1VQ7A 1B70A 1VQLT 4C8QB 1SESA 2E6NA 2ZNJA 2LTOA 4HCCA 1LJOA 2JOYA 2D9TA 4E7JA 2MWPA 2DXBA 3OBYA 3G6ET 1M90U 3M54A 3A5ZB 1ASYA 2LT1A 4M78G 4J7FA 2E41A 5DY9A 5LJ3d 1Q81U 3G7ZA 4P73A 2RK1A 5GAOr 1Z7MA 1NPPA 3LGLA 5ELNA 4NS5A 4UPAA 3OSSC 3J81E 3PMIA 2P0PA 3C4SA 2I4LA 4G85A 2QQAA 3A7AA 3M9QA 4HWPA 1SRYA 2X4WA 2XG8D 3EFRA 4QVDA 1NJ8A 1U1TA 4ZIBA 1H4SA 4X34A 3CCRT 3OYGA 4K88A 5FLXE 3RMQA 2ZT7A 5LJ3e 4PJOE 5HY6A 1WJSA 4RMFA 3RKXA 4EDUA 1BIAA 2KK4A 3M4QA 3UH0A 2QEXT 1VQNA 4KT0E 1D3BB 4OLFA 2PQWA 5FRNA 2LCCA 2KY9A 5GAOm 4BW9A 3OYMA 2LC4A 1NNHA 4G84A 2L8DA 4J6YA 4BE0A 4BDYA 3FDRA 1B7YB 4J15A 3LX7A 1YIJA 2LRQA 3T9NA 2F5TX 3OS0A 2RI5A 4ATOA 4MZMA 2M1HA 2RHYA 5CKDA 2EL9A 5IN1A 4O6JA 4N0AC 3G4SA 1K8AC 3NTIA 2VGNA 1Y96A 3QHSA 5J39A 1OI1A 1P92A 2WSFE 1JRIA 4M7AF 5A0LA 4C0GA 3HXWA 1G3YA 1NE8A 3S6WA 3LLRA 12ASA 2LCLA 2NS6A 3PCOA 4LDVA 2E1HA 3LGFA 4QVZA 2PMFA 2D6FA 2VXFA 3PFSA 3CCLT 1X56A 3QNEA 2OAUA 3HXXA 4M7AA 4XTUA 2ZZDA 2F5KA 3CMET 1N9SA 2ZIMA 3JB9D 4OF1A 3M57A 1VQ7T 1G3TA 3E9GA 4M78F 3RF1A 2O4XB 4CI0C 4BI3A 5L8RE 2K4YA 1K8AU 4YRNA 2CJAA 1YJ9A 3KBGA 4PKCC 5J26A 1QVPA 2FYKA 2ZR2A 4M78A 3I56A 2PVOB 1QW1A 4YCWA 2CS7A 4RCCA 1VQOT 2QQRA 2ZTGA 3QYGB 4IUQA 4C92G 3OYHA 1QVFA 4A4EA 2DTIA 1EOVA 4YCVA 3DB3A 3HRSA 4CH3A 1WGSA 4WF2A 4IUPA 4FM4B 2DEQA 4PNOA 4Q5WA 5CCAA 2XDPA 2AHJB 4E7KA 3QO7A 1UEBA 3VQVA 3M53A 2EIFA 4EMKA 3CMAA 1MHNA 5KE3A 1VQNT 4OB1B 5CKEA 1B76A 4RKUE 2WSCE 4ELZC 4YRCA 4BE1A 1KHCA 4C8QF 3OYBA 3HRIA 2I2LA 4M7DB 4A53A 3FLGA 5GANf 3WVEB 4PLLA 2C06A 2X4XA 1YIJT 3BY7A 1Q82C 2VGMA 2E3CA 2E5QA 2HD0A 2EJGA 4M77F 4C8QA 4CRIA 3G4ST 4M75B 3OYCA 5FU7B 1W2BA 4WJ3M 2XI9A 2BUDA 2R57A 4HWSA 3A5ZA 2LX9A 4HT8A 4M77A 2R58A 3QPHA 1G5VA 2MWOA 4J5YA 2XK0A 3VQWA 4M7AC 4UP7A 4KUIA 3RMSA 1X75C 3JB9I 2DD4A 2ZT5A 2KAFA 3OMCA 2RHXA 4N4IA 2I4MA 1KQSA 2H3JA 3JB9J 1Q82U 1UGRB 4ZN3A 3OW2A 2OTLA 1QF6A 4VUBA 4P72C 3KUFA 3INZA 4PHCA 2J3LA 4J7IA 4CH4A 1YJ9T 1MGQA 2WSEE 2CZ7B 3I55T 4NL2A 1LYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNS A;  4H2S A;  1LOJ A;  1M8V A;  2RHQ B;  3L2Z A;  3JB9 G;  3HFZ B;  3GIB A;  1IL2 A;  1D3B A;  4YRO A;  1U1S A;  2ZIN A;  1L0W A;  4H2X A;  2YHT A;  1WQW A;  4TQD A;  4JRI A;  4YP0 A;  2ALY A;  4P3O A;  4H02 A;  1J5W A;  1X55 A;  4P71 A;  3A31 A;  4F7U A;  2ZZE A;  1WNL A;  4M7D G;  4RDX A;  4XTY A;  4L87 A;  4HWR A;  4H2Y A;  5GAO p;  1JJC A;  1H64 1;  1USY A;  2DQ3 A;  5HGQ A;  4JLI A;  4MMK A;  4XEM A;  4PJO B;  3HRK A;  11AS A;  3TEH B;  3NEN A;  4HT9 A;  1B7Y A;  5GAM j;  5LJ3 g;  2Y90 A;  5F5W A;  4YRE A;  1YCY A;  3RL6 A;  5C51 B;  2ZCE A;  2QHT A;  2RHS B;  1I4K 1;  1X54 A;  4EMK B;  3HY1 A;  3JCM f;  5LJ5 f;  3IG2 A;  4M75 G;  5GAM d;  3QO8 A;  2ZXF A;  1NJ6 A;  4EMH A;  4EMK C;  3QSU A;  3R07 A;  4TQF A;  2FB7 A;  5LJ3 h;  4M75 E;  4M7D C;  4C8Q G;  5GAN e;  3JCM P;  1G5H A;  2AMC A;  4QVC A;  4H2U A;  1EIY A;  3SB2 A;  1I81 A;  3HSB A;  2AKW A;  2DU7 A;  4AH6 A;  4JRK A;  3HFN A;  4C8Q E;  2ZZF A;  3E9I A;  5GAN 7;  3JCM X;  1BBU A;  3HXU A;  1EQR A;  3VQX A;  3FIF A;  3JCM c;  2E64 A;  1EFW A;  3OD1 A;  3RES A;  2C7I A;  2QHS A;  1YFT A;  3JCM g;  1G51 A;  1YGB A;  3IAL A;  3MF2 A;  2K57 A;  3ICA A;  4M77 G;  1B70 A;  4Q15 A;  4YRJ A;  3NEM A;  1SES A;  4C8Q B;  4M75 C;  1WLE A;  2ZNJ A;  1NYQ A;  2ODR C;  4M77 E;  5GAM e;  2DXU A;  2XTI A;  1LJO A;  4C92 D;  4C8Q C;  5GMK h;  3IKL A;  1WPY A;  5LJ3 j;  3JCM h;  3A5Y A;  4YYE A;  5LJ5 h;  4X9C A;  3TUP A;  2EWN A;  4HVC A;  3RUX A;  3P8V A;  1NJ5 A;  4O2D A;  2IY5 B;  2RB6 A;  5GAN h;  5GAN 3;  4TVA A;  1ASY A;  4M78 G;  4YRS A;  1ADY A;  1BIB A;  2E41 A;  3E9H A;  3UGQ A;  1PYS A;  5GAN 5;  4YDQ A;  3V8K A;  5DY9 A;  5GAN 8;  5LJ3 d;  2E5A A;  1NJ1 A;  1X2G A;  4P73 A;  4M77 C;  5GAO r;  3FJP A;  1Z7M A;  5ELN A;  4KR3 A;  4M7D D;  1N9W A;  2XGT A;  3JCM W;  4YRK A;  2ARU A;  4UPA A;  4P72 A;  4P74 C;  3RKW A;  3LC0 A;  1KQ1 A;  5GMK j;  2I4L A;  4G85 A;  5GAO l;  3A7A A;  5GMK i;  4HWP A;  5LJ5 j;  3G1Z A;  3PZC A;  1SRY A;  3EFR A;  4M78 C;  4C92 F;  4QVD A;  1NJ8 A;  2Q7H A;  3PGG A;  5E3I A;  1U1T A;  4ZIB A;  1H4S A;  4PJO G;  4K88 A;  3RAC A;  3L4G B;  4K86 A;  4X9D A;  2ZT7 A;  1YFR A;  5LJ3 e;  3NEL A;  3JCM d;  4PJO E;  5LJ5 d;  4RMF A;  3RKX A;  4HWT A;  3QUI A;  4X5O A;  1BIA A;  2EAY A;  5GAN d;  2G4C A;  3M4Q A;  4KR2 A;  3UH0 A;  3MEY A;  1D3B B;  1B34 A;  5GMK m;  4OLF A;  4C92 A;  4H2X B;  4HWO A;  4M7A D;  5C52 B;  2ALY B;  5GAO m;  4A54 A;  3JCM Q;  5I21 A;  4M7D F;  2DVE A;  2JN0 A;  4BW9 A;  4F7U B;  3QTC A;  3I7F A;  1NNH A;  2DXT A;  4G84 A;  1B34 B;  2ZT8 A;  4XTW A;  3CMQ A;  4PJO C;  5ELO A;  4J6Y A;  1JJC B;  4TWA A;  1SET A;  4P71 C;  2QTX A;  2YLC A;  5GAN 6;  4EO4 A;  2DU5 A;  1B7Y B;  4J15 A;  1W66 A;  5GMK e;  3JCM e;  1ATI A;  1EVL A;  3JCM V;  5LJ5 e;  4RQF A;  2VXE A;  2CJ9 A;  2EL9 A;  4M7D A;  4M75 F;  3VBB A;  4P75 A;  4RQE A;  4N0A C;  2CGH A;  3M4P A;  1Y96 A;  4DPG A;  3QHS A;  4M78 D;  5KNN A;  4EMG A;  1E24 A;  4KQE A;  2AMC B;  1EIY B;  4XTX A;  1JRI A;  2AKW B;  5CAI A;  4M7A F;  3BFM A;  4BWA A;  3HXW A;  3BJU A;  12AS A;  2ZNI A;  3PCO A;  4M75 A;  5GAN 2;  2RM4 A;  2E1H A;  4XEO A;  4PG3 A;  4WJ4 A;  1HK9 A;  3SWN A;  4YRL A;  2PMF A;  4ZTU B;  1N9R A;  2VXF A;  2ZGW A;  1B70 B;  3L1A A;  1X56 A;  3QNE A;  4NL3 A;  2ZIO A;  3HXX A;  1X01 A;  4M7A A;  4YRI A;  1E22 A;  3BDU A;  3V7S A;  2Q5I A;  3V7C A;  4XTU A;  2Q7E A;  2E10 A;  2DZ9 A;  1N9S A;  3JB9 D;  2ZIM A;  4DQ2 A;  4YCU A;  2DJZ A;  3VU3 C;  4M78 F;  1FYF A;  4M7A B;  1H4Q A;  4TVA B;  2QHU A;  3HTZ A;  3RF1 A;  1PYS B;  3A7U A;  3V8J A;  1I5L A;  3IKM B;  2ZT6 A;  2HNI A;  3VQY A;  2EJF A;  1VQZ A;  1H4T A;  4YRN A;  2CJA A;  4P74 A;  2P0L A;  5GMK l;  3HFV A;  3MF1 A;  3JCM J;  4UP9 A;  2DDZ A;  2FYK A;  1RIQ A;  2ZR2 A;  4ZTZ B;  4YRF A;  5GAM g;  4M78 A;  2P5I A;  4YCW A;  3QO3 A;  1YB3 A;  4RCC A;  4F7U G;  4P3P A;  4J6X A;  3DSQ A;  4J6W A;  2ZTG A;  4XTV A;  4M75 D;  4C92 G;  4PJO F;  4TTV A;  4F7U E;  2ODR D;  2CJB A;  2DTI A;  3M4G A;  1EOV A;  2RHQ A;  3JB9 F;  3HFZ A;  4YCV A;  1KOG A;  4C8Q D;  4CH3 A;  4EX5 A;  3V7R A;  4WF2 A;  4C92 E;  3A74 A;  1B8A A;  1X2H A;  3UGT A;  3TEG A;  1KMM A;  2PME A;  1ADJ A;  4TVW A;  2DEQ A;  4PNO A;  2E65 A;  1WQ7 A;  4YRQ A;  4CH5 A;  4V2S A;  4Y91 A;  1GGM A;  1QE0 A;  1HC7 A;  4C92 B;  4PJO A;  3TEH A;  1NYR A;  1YFS A;  4M77 D;  3QO7 A;  3LSQ A;  4C92 C;  2ZR3 A;  2DTH A;  4XU1 A;  1H4V B;  2RA2 A;  1USY C;  3VQV A;  3KFU A;  2RHS A;  3HFO A;  4M7D E;  4EMK A;  2ARS A;  4HA8 A;  1HXD A;  3RIR A;  2J3M A;  3ERR A;  1EVK A;  2Q7G A;  4E51 A;  4JUV A;  4N0A A;  1B76 A;  2I4O A;  3NET A;  4YRC A;  2EJ9 A;  4XTZ A;  4H2V A;  4C8Q F;  2YLB A;  1HTT A;  3FB9 A;  3HRI A;  4YRR A;  2I2L A;  4M7D B;  4CS2 A;  3WQZ A;  4A53 A;  4YRT A;  1JBM A;  4YRG A;  3JB9 H;  1WU7 A;  5GAO q;  2DZC A;  5GAN f;  4XU2 A;  2DKG A;  5GAN 4;  3AHU A;  3P8Y A;  1Y96 B;  3LSS A;  4WI1 A;  5C53 B;  4YRP A;  4XU3 A;  4P75 C;  3UFG A;  3BY7 A;  4P3N A;  1C0A A;  1Z7N A;  3HXY A;  2E3C A;  4M7A G;  2EJG A;  4M77 F;  2QHV A;  4H2T A;  4C8Q A;  1M5Q 1;  1G5I A;  4CH6 A;  2DQ0 A;  4M7A E;  3PCO B;  4M75 B;  4H2W A;  4WJ3 M;  2Q5H A;  5LJ5 g;  3SWN B;  1E1O A;  2RD1 A;  4PJO D;  4MML A;  3RKY A;  5GAM f;  4CS3 A;  3BW1 A;  5GAN g;  4HWS A;  3HXV A;  3HXZ A;  5K1X A;  1WYD A;  3A5Z A;  3W3S A;  4NCX A;  3SWN C;  2IY5 A;  4TVY A;  3P8T A;  4HT8 A;  4XU0 A;  1E1T A;  4M77 A;  1LNX A;  2DTO A;  4K87 A;  4J5Y A;  1BBW A;  3VQW A;  4M7A C;  4YRM A;  3A32 A;  4UP7 A;  4Q6G A;  3V8L A;  4M77 B;  3JB9 I;  2C8M A;  2ZT5 A;  4M78 E;  3HY0 A;  4YPF A;  4P73 C;  1ASZ A;  2I4M A;  4CS4 A;  3QO5 A;  1TH7 A;  1SER A;  3REX A;  3JB9 J;  3A7R A;  1QF6 A;  2ART A;  3JCM b;  3REU A;  4P72 C;  3RER A;  2ZZG A;  3INZ A;  4PHC A;  1NJ2 A;  5GAO n;  2J3L A;  4M78 B;  5K1P A;  4CH4 A;  4F7U F;  5GAM h;  4OP0 A;  3L4G A;  1KQ2 A;  2VC8 A;  3RGL A;  1I8F A;  2I4N A;  4RCB A;  2CIM A;  1KMN A;  4XQ3 A;  4NOY A;  1MGQ A;  5GAN j;  4NL2 A;  3EFS A;  1LYL A;  4UP8 A;  5LJ3 f; 
#chains in the Genus database with same CATH topology
 1VQ6 A;  3L2Z A;  3CD6 Q;  1D3B A;  3L2V A;  4YRO A;  3I56 T;  3I5R A;  2ZIN A;  2YRD A;  2YHT A;  2ED0 A;  4LVK A;  4JRI A;  2RQW A;  4YP0 A;  1RAG B;  3L2Q A;  4CC3 A;  4P71 A;  3LH0 A;  3HRT A;  3QYH B;  4M7D G;  2PUO B;  4XTY A;  1M1G A;  4RDX A;  3ZBD A;  2C0I A;  1VQP Q;  4C0D C;  1USY A;  2M0O A;  2ZPG B;  4MMK A;  4XEM A;  4PJO B;  1B7Y A;  2EVR A;  3VKI A;  3C94 A;  4RTU A;  3A8O B;  4MDX A;  2ZCE A;  2E4H A;  3VYH B;  1JB0 E;  2CT4 A;  2JUF A;  3JCM f;  1JO8 A;  2GQV A;  5LJ5 f;  2XHC A;  3OYF A;  4M75 G;  2B8A A;  1O75 A;  3QO8 A;  2ZXF A;  2F2V A;  1ZHI A;  1VQ8 Q;  2W10 A;  4EMK C;  3QBY A;  2GGR A;  5LJ3 h;  5GAN e;  3JCM P;  4QVC A;  2KRN A;  4H2U A;  3SB2 A;  2DU7 A;  3PVQ A;  2P0Q A;  3CCL Q;  2O9V A;  3CMA T;  4AH6 A;  2RN8 A;  4Z8A A;  3HFN A;  2ZPB B;  1QLY A;  3HXU A;  1EQR A;  5CKH A;  3JCM c;  2QDY B;  1VYT A;  1Y71 A;  1OEB A;  3CCV Q;  3CCQ A;  2K57 A;  3ICA A;  4ORZ A;  1PSE A;  2NWM A;  3H6Z A;  4Q15 A;  3CBM A;  5M9O A;  3CC2 A;  1XJW B;  2MI6 A;  1NYQ A;  5KYU B;  4JZ4 A;  2GCX A;  1M3A A;  2DL4 A;  2DXU A;  1NPR A;  4C8Q C;  2DXC A;  2KQW A;  5LJ3 j;  2X9H A;  3OS2 A;  4BI4 A;  4YYE A;  1SRM A;  4AFS C;  4HVC A;  3P8V A;  2IY5 B;  2RNA A;  2RB6 A;  5GAN 3;  3EH1 A;  1N6A A;  2LJ0 A;  1BIB A;  2O4X A;  3E9H A;  3OYK A;  4OB3 B;  2SEM A;  5GAN 5;  1GRI A;  2EYQ A;  4E7H A;  2E5A A;  4ESR A;  1OZ2 A;  4RTT A;  2X51 A;  3CPW S;  4M77 C;  4A63 B;  3JRZ A;  2K3X A;  4PFP A;  2IG0 A;  4HCK A;  1FX7 A;  2XGT A;  3JCM W;  1TWB A;  2K2V A;  4P74 C;  3RKW A;  4BD3 A;  4WCI A;  4FSS A;  3OYL A;  3GF5 A;  1BI2 A;  1PRM C;  1TUD A;  2G6F X;  4FYW B;  5GAO l;  2LQ8 A;  2L3R A;  2DEU A;  2CP3 A;  2AK5 A;  4B9W A;  1IGQ A;  1W4S A;  4PJO G;  2EQJ A;  1QVF S;  1U06 A;  3RAC A;  3NEL A;  2VKN A;  3JCM d;  2FZK B;  3AT1 B;  5LJ5 d;  2DJQ A;  1X69 A;  1E7O A;  1GBR A;  4P5N A;  3QUI A;  4X5O A;  2OTL T;  2KEA A;  1Q82 R;  1VQN Q;  1B34 A;  1QP3 A;  2ECZ A;  5C0M A;  2RI3 A;  1VQP A;  1XNI A;  1KC8 C;  4H2X B;  5FW9 A;  2V1R A;  4M7A D;  4F04 B;  2KDS A;  2B86 A;  3JCM Q;  4M7D F;  1IRE B;  5I2S A;  3R6O A;  1X43 A;  3ZL7 C;  2ZT8 A;  1VQ9 A;  4LD9 K;  1VQ6 T;  1SET A;  4P71 C;  2QTX A;  1RI0 A;  5FWB A;  2JXB A;  5GAN 6;  2X4J A;  3QII A;  3OB9 A;  3TEE A;  2DU5 A;  2COY A;  1QVF P;  5GMK e;  2LZ6 B;  3JCM e;  1EVL A;  2KMT A;  1Q7Y C;  3OYJ A;  1NJI C;  5LJ5 e;  1E6H A;  4M7D A;  1M8M A;  2KBT A;  1MMG A;  3H0F A;  4M75 F;  3VBB A;  4GLM A;  4P75 A;  1I0C A;  1D1C A;  4OGC A;  3G4S Q;  2CGH A;  4XK8 E;  4L59 A;  4LVI A;  4M78 D;  4OGE A;  3QJ6 A;  1RAD B;  2GTJ A;  1TOV A;  4KUL A;  1YFN A;  1E24 A;  3MEV A;  2AMC B;  2KRO A;  3CCV A;  5IH2 A;  3VS6 A;  1R8O B;  1PCX A;  2K5I A;  2ZNI A;  3O8V A;  4DA4 A;  4M75 A;  1ZUK A;  2RM4 A;  5GAN 2;  1W2B S;  4XEO A;  4PG3 A;  1KC8 U;  4ZTU B;  3GPL A;  4FT2 A;  2FO0 A;  1X01 A;  3EGX A;  1R0B G;  2I0N A;  2OTJ A;  2MK5 A;  1VUB A;  3V7C A;  2JVV A;  2EYX A;  3ER0 A;  3MP1 A;  5KE2 A;  2QDL A;  3CCQ T;  2O31 A;  1OV3 A;  2F2X A;  3CCU Q;  3OYD A;  1Q7Y U;  1NJI U;  3VS5 A;  3CC2 T;  5FRM A;  3A7U A;  4J9G A;  1FYN A;  1VQK T;  1K0S A;  5FU6 B;  2VVK A;  1I5L A;  5KYN A;  2HNI A;  3VQY A;  1VQZ A;  1S72 A;  2K5L A;  1ZQ1 A;  5KCH A;  3LWH A;  5KH6 A;  2FL7 A;  5GMK l;  2A28 A;  1KQS S;  3HFV A;  5DLQ E;  3JCM J;  2FRY A;  2P84 A;  1W1F A;  3MP6 A;  2Y4Y A;  4YRF A;  1R77 A;  2BZX A;  2QG9 B;  4BE2 A;  4GBQ A;  3I56 Q;  2K3B A;  3WXM B;  4E7I A;  2EBP A;  3QO3 A;  2LCS A;  4P3P A;  4J6X A;  3DSQ A;  2RJC A;  1QKW A;  1TXQ A;  5KYY A;  2AKL A;  3I9Q A;  4PJO F;  3VYG A;  4E2F B;  2CJB A;  2IIM A;  2PNI A;  2CP5 A;  4C8Q D;  4EX5 A;  3UDC A;  3NPF A;  3A74 A;  1PD1 A;  1LCK A;  4CC7 A;  1T3S A;  1V1C A;  3UGT A;  1KJW A;  1AWX A;  4M4Z A;  3CC7 Q;  1ADJ A;  2E65 A;  2M16 A;  2QTV A;  4Y91 A;  1GGM A;  2K5F A;  3OW2 P;  1QE0 A;  4C92 B;  4PJO A;  2F2W A;  2M9U A;  3CD6 T;  1YFS A;  4L6V 5;  1YN8 A;  3KFV A;  3PVL A;  4M77 D;  3E19 A;  3M0R A;  3CXC P;  3LSQ A;  3LYI A;  2YDL A;  1H4V B;  2RA2 A;  3KXT A;  3HFO A;  3QG1 A;  2ARS A;  1UE9 A;  3MPU B;  1VYU A;  2YSQ A;  1EVK A;  2LT4 A;  4PJM A;  1VQP T;  4J8O A;  3OYN A;  2K2M A;  1WXB A;  2CZ6 B;  2K3Y A;  4JUV A;  3SEM A;  1Z9Z A;  3OYA A;  3NET A;  2A08 A;  1WHJ A;  3FB9 A;  3M58 A;  1K9A A;  4CS2 A;  3WQZ A;  4IUV A;  2DZC A;  1AHJ B;  2DER A;  1QMC A;  4F17 A;  3E2U A;  3P8Y A;  3PNW C;  2M51 A;  4WI1 A;  2HQH A;  4P75 C;  1VQ8 T;  1RAF B;  3UWN A;  1Z7N A;  1WHG A;  2ZAE A;  3BDL A;  2CUD A;  4J9D A;  1QWF A;  3H8Z A;  2FPF A;  3OA6 A;  4CH6 A;  2DQ0 A;  4M7A E;  5ECA A;  2LVM A;  5KYU A;  4H2W A;  3M59 A;  5LJ5 g;  3SWN B;  3UAT A;  1PG5 B;  2D8H A;  3RKY A;  4II1 A;  3CCV T;  3BW1 A;  3PIP A;  4N4H A;  3CCU A;  1WYD A;  2IY5 A;  3OQ5 A;  4XU0 A;  1CKB A;  1H92 A;  4D6W A;  1LNX A;  1M2O A;  2EQK A;  3RNJ A;  1PNJ A;  4PK4 A;  2C0O A;  1TUG B;  2M02 A;  4YRM A;  3A32 A;  2GNC A;  3FC3 A;  1UJ0 A;  3V8L A;  4EPC A;  2C8M A;  4M78 E;  2OTJ T;  4YPF A;  1UEC A;  2RHZ A;  4P73 C;  2LQK A;  1ASZ A;  1U8R A;  3MHX A;  4IUR A;  2VAS A;  3QO5 A;  1WFW A;  2GQI A;  1TH7 A;  1KG1 A;  1SER A;  5C6S A;  1GFD A;  3A7R A;  2W0Z A;  2OTL Q;  3REU A;  1VQ4 Q;  1Q7Y R;  1NJI R;  2CZ0 B;  5GAO n;  2NYS A;  1V29 B;  5HCK A;  1K76 A;  3NFC A;  4OP0 A;  1S72 T;  1I8F A;  1PSF A;  4RCB A;  1PWT A;  1KMN A;  1G3W A;  3CC7 A;  5GAN j;  4L5G A;  2CP2 A;  1G3S A;  2COZ A;  3PTA A;  1M8V A;  2A8E A;  1VQ6 Q;  2KR3 A;  2RHQ B;  3JB9 G;  3SHW A;  1U1S A;  3C12 A;  4OMN A;  1TU0 B;  4H2X A;  1WQW A;  4H02 A;  2PVD B;  2MAM A;  4QW2 A;  2O88 A;  2RPN A;  4L87 A;  3UF4 A;  5KCO A;  4Z88 A;  2DD5 A;  1H64 1;  1YJW A;  11AS A;  4J83 A;  3TEH B;  4OB2 B;  1ZBX A;  5LJ3 g;  2Y90 A;  1WXU A;  4YRE A;  3I35 A;  3A8H B;  2EGE A;  1I4K 1;  3Q1J A;  2RHS B;  4AG1 C;  2OI3 A;  4LUE A;  1O9S A;  3IG2 A;  4AFZ C;  3ASK A;  1ZSZ B;  1SPK A;  3C95 A;  2ABL A;  1Y07 A;  1JJ2 P;  2AMC A;  3HSB A;  3TVT A;  2L2P A;  2EQM A;  3H41 A;  4C8Q E;  2ZZF A;  1QP2 A;  3HTR A;  3JCM X;  1Q86 C;  2DK3 A;  1BBU A;  3FIF A;  1QCN A;  4DBR A;  1FMV A;  1IHW A;  3X20 B;  4QQ6 A;  4GLK A;  2QHS A;  1JXO A;  2MMP A;  1YGB A;  3CCS Q;  2XKO C;  2DYI A;  1T0J A;  3J7A F;  3OYY A;  4YRJ A;  1JXM A;  1WLE A;  3CC2 Q;  2K7A A;  4A4H A;  4M77 E;  1BK2 A;  4BY6 C;  2XTI A;  4RTY A;  5GMK h;  3IKL A;  4BI8 B;  3JCM h;  4DBH A;  9ATC B;  5LJ5 h;  4X9C A;  2VV5 A;  3CEY A;  2EWN A;  3EGU A;  3MQZ A;  1NJ5 A;  4PL6 A;  4YRS A;  2KRS A;  1C6V X;  2DIQ A;  3V8K A;  2IVW A;  1WHK A;  2FRW A;  1X2G A;  3REB B;  1D0X A;  1BYM A;  3CCU T;  2DMO A;  4KR3 A;  4M7D D;  4K11 A;  4YRK A;  1VQ4 A;  2ARU A;  1Q86 U;  2GFU A;  3QXE B;  3CC4 A;  5CQY A;  1KQ1 A;  5GMK j;  3F70 A;  3X28 B;  3CXC A;  4KGV B;  5LJ5 j;  1V76 A;  4C92 F;  4M78 C;  5E3I A;  3VV0 A;  2FHD A;  1YFR A;  2DL7 A;  1ZSG A;  5IXF A;  4FU6 A;  1NBE B;  3GNF B;  2KYB A;  3QDR B;  2COW A;  2F1L A;  4FYX B;  2RQU A;  1VIE A;  5GAN d;  1YJN Q;  1OU8 A;  4KR2 A;  1WZO A;  3MEY A;  4B9X A;  3H0I A;  2QK0 A;  4QQD A;  4C92 A;  4HWO A;  1X6O A;  3URG A;  1FMW A;  3M0P A;  2MOX A;  5I21 A;  2JTF A;  2JN0 A;  3QTC A;  2QI2 A;  3HHT B;  2DXT A;  3CC7 T;  1ABQ A;  4AFQ C;  1VQ9 Q;  5ELO A;  4FCY A;  1JJC B;  2GBQ A;  2CH4 A;  1G2B A;  4C5G A;  2YLC A;  4KBM B;  4EO4 A;  1MND A;  1N5Z A;  4X1V A;  1BKB A;  2CRE A;  3EG3 A;  2CKK A;  3HL8 A;  4HXJ A;  1YI2 A;  1UGP B;  1YHQ Q;  4C0F A;  2KVQ G;  4PFO A;  4RQE A;  5IHK A;  3CCM A;  1YJW T;  1BBZ A;  5GJV B;  3M4P A;  2HDA A;  1I5O B;  3VJP A;  2A0F B;  2QYZ A;  1WA7 A;  4XTX A;  5IAY A;  2AKW B;  3BFM A;  3CCS A;  3BJU A;  1EIF A;  4FIB A;  4AG2 C;  4LUD A;  2DNU A;  2LDM A;  1H3H A;  4JLG A;  3SWN A;  4YRL A;  1WHL A;  3G71 Q;  1OX8 A;  1R0C B;  4BDZ A;  1N9R A;  2P4T A;  2ZGW A;  1RUW A;  4KH0 B;  1GXI E;  4NL3 A;  1M3B A;  3QKJ A;  4FSX A;  5IXB A;  3VRY A;  4YRI A;  3BDU A;  3V7S A;  2Q5I A;  2OTJ Q;  4Z02 A;  2NUZ A;  2RJE A;  4HVW A;  2QA4 A;  2PTK A;  3HPW A;  1WJQ A;  5I2M A;  4YCU A;  2DJZ A;  2VUB A;  3VU3 C;  5A0G A;  1OYX A;  1FYF A;  1WX6 A;  4M7A B;  3OBW A;  1H4Q A;  4TVA B;  2QHU A;  3HTZ A;  1VIF A;  4LVJ A;  1PYS B;  3CQT A;  2J06 A;  5DLO A;  2EKH A;  3IKM B;  2FG0 A;  2EJF A;  2LQW A;  4OB0 B;  1S72 Q;  3TCJ A;  2P0L A;  2L89 A;  4RG2 A;  2VWF A;  1IRX A;  3CCR A;  4C5E A;  1MNE A;  1SRL A;  3DB4 A;  4XAX B;  3BE3 A;  1D1A A;  4ZTZ B;  2BE7 D;  2DYB A;  5I11 A;  2JZ2 A;  4RMO A;  2DIL A;  1YB3 A;  4E7Z A;  1F1B B;  3OS5 A;  3SD4 A;  1JQQ A;  4IIO A;  2Y4X A;  1E6G A;  2X4Y A;  1GCQ C;  1YWO A;  4J6W A;  2QXF A;  2QEX A;  1IGU A;  2PVG B;  1PD0 A;  2GFA A;  4TTV A;  4F7U E;  2O9S A;  3M4G A;  1TSF A;  2RI2 A;  2RHQ A;  3EH2 A;  1YJN A;  1VQ4 T;  2E3H A;  4LVL A;  1VQM A;  1JEG A;  1B8A A;  1X27 A;  1Q86 R;  1Y7X A;  1JJ2 A;  2PME A;  4QKU A;  1WQ7 A;  2CP0 A;  4YRQ A;  1RL2 A;  2LQN A;  4RTV A;  3HP9 A;  4IKF A;  4C5I A;  4RG8 A;  3TEH A;  4C0D B;  1AT1 B;  4TVR A;  2JNG A;  4C92 C;  1OOT A;  2DTH A;  4XU1 A;  1USY C;  2NLU A;  3KFU A;  2RHS A;  4M7D E;  2YUO A;  4YTL A;  2XDD A;  2ZPI B;  4HA8 A;  1YHQ A;  2D1X A;  2J3M A;  3ERR A;  1TTH B;  1X2Q A;  2Q7G A;  2G3R A;  4E51 A;  2K9G A;  2RHI A;  4N0A A;  1ZA2 B;  1ZSZ A;  2C0T A;  2I4O A;  1I07 A;  1AWO A;  4H2V A;  1XTD A;  2FPE A;  1WI7 A;  1Q81 C;  1H8K A;  4KGX B;  3JB9 H;  1WU7 A;  5GAO q;  1QQJ A;  4GY5 A;  2DKG A;  3H0H A;  5GAN 4;  3AHU A;  1VA7 A;  3EHQ A;  4HKE A;  1AEY A;  2VB6 A;  3UFG A;  4P3N A;  2O01 E;  2YXY A;  2BIV A;  1QVG P;  3PMT A;  4OMM A;  4M7A G;  3G71 A;  1AVZ C;  3A8M B;  2QHV A;  3MKD A;  3TSZ A;  4ZGE B;  3CCM T;  2DBM A;  1WHM A;  1K9M C;  3CPF A;  8AT1 B;  1FMK A;  3J80 E;  3CME A;  5CO7 A;  2Q5H A;  3MET A;  2L3S A;  3I55 T;  2XID A;  1E1O A;  4OMQ A;  1YCS B;  5GAM f;  3CBP A;  1BI1 A;  5GAN g;  3HXV A;  3HXZ A;  2E12 A;  3CCS T;  4LDX A;  3W3S A;  3HRU A;  4FL6 A;  3SWN C;  4TVY A;  3P8T A;  2DIG A;  1KIK A;  2VYT A;  2DL8 A;  4F16 A;  1NLO C;  1N8R C;  2PU9 B;  1ACM B;  4K87 A;  1QCF A;  3JV3 A;  2EW3 A;  4QQG A;  1M4Z A;  1BBW A;  2H8H A;  1KHI A;  3P8H A;  5IT9 E;  4M77 B;  1RLP C;  3OYI A;  1NZ9 A;  2X3W D;  3S3O A;  2EQU A;  3OY9 A;  3OW2 S;  3CCJ A;  3SDZ A;  1VQO A;  4PFZ A;  1Y57 A;  2QA4 T;  5AYF A;  2YRV A;  3CXC S;  2ZPH B;  3REX A;  3L42 A;  1OZ3 A;  3JCM b;  2KXD A;  2V26 A;  1NJ2 A;  5K1P A;  2RK2 A;  3MEW A;  4AMC A;  5CKB A;  4LDU A;  1K9M U;  1KQ2 A;  2BKD N;  4O5V A;  3VUZ A;  3RGL A;  2AZV A;  1NYG A;  2JMA A;  2E70 A;  4XQ3 A;  4DBQ A;  4C0Z A;  1XQH A;  1B07 A;  4UP8 A;  3JSC A;  1M1K C;  4H2S A;  1LOJ A;  2HQX A;  3CBO A;  3HFZ B;  3P8D A;  3UPU A;  1K73 C;  1ZUU A;  1UTI A;  3R6N A;  1N8R U;  5LL6 S;  2ZZE A;  1WNL A;  2BTT A;  3DKM A;  2WAC A;  2JTM A;  2DVJ A;  4H2Y A;  5GAO p;  1JJC A;  2DQ3 A;  5HGQ A;  2JM9 A;  1QKX A;  3VS0 A;  1YJN T;  1YJW Q;  5CIU A;  1PC0 A;  2RJF A;  1VQM T;  3NEN A;  3ZFJ A;  1GCP A;  4KGZ B;  3P8B B;  5F5W A;  1OUL A;  1SHG A;  2JW4 A;  3MO8 A;  5J3B A;  1YCY A;  5C51 B;  1NG2 A;  1X54 A;  3HY1 A;  3DLL A;  3QDF A;  1BCO A;  2R5M A;  2YWW A;  3HKS A;  3NTH A;  1VQ9 T;  4FT4 A;  4DEX A;  5GAM d;  4JPB W;  1NJ6 A;  1OPL A;  4EMH A;  3QSU A;  3OS1 A;  1MUZ A;  4M7D C;  3M5A A;  2EFI A;  4C8Q G;  3PT9 A;  1G5H A;  1I81 A;  1KSW A;  2AKW A;  2RJD A;  1M27 C;  1ZSZ C;  1YHQ T;  1C0M A;  1RLQ C;  4JRQ A;  4MZT A;  3E9I A;  2CSI A;  1M1K U;  3VQX A;  4DOW A;  1NLP C;  3OD1 A;  1EFW A;  2PZ1 A;  1K73 U;  3JCM g;  2RHU A;  2CT3 A;  1S1N A;  2FEI A;  4M77 G;  5HK3 A;  2K6D A;  2D0Q B;  3NEM A;  4M75 C;  5FU7 C;  3L2W A;  3X25 B;  1YBY A;  4FW1 A;  2JTE A;  4IIM A;  2ODR C;  5GAM e;  2RQV A;  4DOV A;  1IHV A;  2J6O A;  4C92 D;  2DL5 A;  3WVD B;  1IZ6 A;  2MYS A;  1WPY A;  4LDW A;  3A5Y A;  5CQX A;  4MZP A;  2QQB A;  3TUP A;  3G71 T;  3RUX A;  2BZY A;  3GLX A;  3NGP A;  1KC8 R;  4O2D A;  4TVA A;  5GAN h;  2XDB A;  1ADY A;  3UGQ A;  1PYS A;  2V8K A;  2ROL A;  4YDQ A;  5GAN 8;  4HCZ A;  1OQK A;  1NJ1 A;  1MMA A;  5DM7 R;  4ELY C;  1SF9 A;  3FJP A;  2QQ9 A;  4ME7 A;  1WXT A;  2DA9 A;  1N9W A;  1QWE A;  2QAS A;  3CPW A;  4JS5 A;  4P72 A;  2D0N A;  2E5K A;  4LD6 A;  3LC0 A;  2LX7 A;  1Z9Q A;  4A4G A;  3CC4 Q;  4KH1 B;  3NTK A;  3I55 A;  1FWZ A;  5EG2 A;  4FW2 A;  5GMK i;  2CH4 W;  3G1Z A;  3PZC A;  2JJ9 A;  2Q7H A;  3PGG A;  2A7Y A;  2J6F A;  5FRO A;  3G1J A;  3CCJ T;  3IQL A;  3L4G B;  4K86 A;  3LH5 A;  4X9D A;  1EZZ B;  1SKU B;  4JRP A;  3RBB B;  3EG1 A;  4FYY B;  3UT1 A;  5A2Q E;  1UJY A;  4HWT A;  1JJ2 S;  2EAY A;  3MEA A;  2G4C A;  2DAQ A;  2L3Q A;  5HKC A;  5GMK m;  4BB7 A;  1ZA1 B;  5C52 B;  2ALY B;  4DBF A;  1GFC A;  4A54 A;  2DVE A;  4F7U B;  1HD3 A;  2CYZ B;  4RTX A;  3I7F A;  2ZPF B;  1QVG A;  1B34 B;  1ZLM A;  3A98 A;  4XTW A;  3CMQ A;  4PJO C;  2RO0 A;  4TWA A;  1SSH A;  1M2V B;  3A8L B;  3RR6 A;  1RAI B;  1W66 A;  2MIO A;  1ATI A;  2HKQ B;  3JCM V;  4RQF A;  2XU8 A;  3M56 A;  1N8R R;  1YI2 Q;  2VXE A;  4A4F A;  2CJ9 A;  2HBW A;  1NEG A;  5D6X A;  3CCM Q;  4HCB A;  4WTO B;  2KSS A;  1IO6 A;  4DPG A;  4JJN K;  5KNN A;  3M55 A;  2O2O A;  4EMG A;  2KI7 A;  4KQE A;  1UG1 A;  1EIY B;  5CAI A;  3SFM A;  2A36 A;  4BWA A;  4JDS A;  4R0K A;  4ZGJ B;  3CCE A;  1QCO A;  4ZN1 A;  4DEY A;  2V8I A;  1PM3 A;  4WJ4 A;  3G6E Q;  3GOX A;  1HK9 A;  2JS0 A;  3EHR A;  1K4U S;  1IXD A;  4UC4 A;  1FXX A;  1B3Q A;  3FEO A;  3MEU A;  2RF0 A;  3PIO A;  1B70 B;  3L1A A;  1MV3 A;  2ZIO A;  4Y92 A;  1VQ5 A;  5CK9 A;  3L2U A;  2MPX C;  5CVI A;  1A0N B;  1E22 A;  2HBP A;  1NEB A;  1M1K R;  2Q7E A;  4D8K A;  1WLP B;  2E10 A;  2DZ9 A;  2QA4 Q;  4DQ2 A;  1M9S A;  2MF2 A;  1K73 R;  1KD1 C;  1VOM A;  3V8J A;  1AWW A;  1RAE B;  2ZT6 A;  1H4T A;  2HAX A;  4P74 A;  1YIT A;  4J9C A;  4IUT A;  4IUU A;  2CP6 A;  3FRN A;  3MF1 A;  4UP9 A;  3CCR Q;  2DDZ A;  1RIQ A;  4QT7 A;  4E47 A;  5GAM g;  2R5A A;  2AKK A;  2P5I A;  2AIR B;  2E3I A;  4HT4 A;  1UB4 A;  4J9B A;  4F7U G;  4KUD K;  5CR2 A;  2LJ3 A;  4XTV A;  4M75 D;  2YT6 A;  4PLI A;  2QEX Q;  5D6W A;  2ODR D;  1NM7 A;  4LXC A;  2HZY A;  3JB9 F;  3HFZ A;  1KOG A;  1YWP A;  2QQS A;  3V7R A;  4C92 E;  7AT1 B;  1VQM Q;  4AFU C;  5KYY B;  1X2H A;  2V8J A;  1D0Y A;  3TEG A;  1KMM A;  2NUT B;  3I5S A;  3ZEH A;  4TVW A;  2EPD A;  1OU9 A;  2CP7 A;  3X24 B;  4CH5 A;  4V2S A;  1SG5 A;  1XOV A;  1KD1 U;  4R56 A;  3TQ7 P;  1HSQ A;  2GTO A;  2KRM A;  1HC7 A;  1M3C A;  4LDY A;  4LNP A;  1NYR A;  1Y0M A;  4JJB A;  3MP8 A;  2DL3 A;  2ZR3 A;  2A3L A;  4BUG A;  3S3N A;  1OPK A;  1HXD A;  2X3X D;  3RIR A;  3MCA B;  2OJ2 A;  1TG0 A;  1WJR A;  1H3Z A;  2LMJ A;  3JAM E;  2EJ9 A;  4XTZ A;  5IHI A;  1HTT A;  2YLB A;  1ZUY A;  4YRR A;  5FWC A;  4YRT A;  1EX4 A;  1JBM A;  1VQL A;  5CKF A;  4YRG A;  4XU2 A;  2LNV A;  1Y96 B;  3LSS A;  5C53 B;  3QJY A;  4YRP A;  4XU3 A;  1C0A A;  2RH2 A;  3HXY A;  1BI3 A;  4PJJ A;  4R55 A;  3G6E A;  3N5B B;  2DPP B;  2KT8 A;  4H2T A;  8ATC B;  3THK A;  1M5Q 1;  1G5I A;  3A8G B;  2EYW A;  2HQE A;  3PCO B;  4C5H A;  3CME Q;  1VQ7 Q;  5I22 A;  4BY6 B;  2EKO A;  2RD1 A;  3L2R A;  4MML A;  4PJO D;  4CS3 A;  5K1X A;  4OMF B;  2XIC A;  4JS4 A;  3LW5 E;  1VQK A;  4NCX A;  1AD5 A;  1ZBJ A;  3CCE T;  1GL5 A;  1E1T A;  3GBQ A;  1DJ7 B;  4ZTJ A;  2DTO A;  2X35 A;  3E1S A;  2YUQ A;  3S3M A;  1AZG B;  3GNG A;  2P0K A;  4Q6G A;  4LE9 A;  1VQ5 T;  4OMP A;  5FU6 C;  3TU4 K;  4Z89 A;  3HY0 A;  1UFF A;  3MJX A;  4HVV A;  4BAC A;  3CCJ Q;  1VQO Q;  1LPL A;  3ME9 A;  3LWI A;  4CS4 A;  2ZCF B;  1UHC A;  1KK7 A;  2DRK A;  2HL3 A;  2ART A;  2L0A A;  3RER A;  2ZZG A;  3GP8 A;  1M1F A;  4M78 B;  2CZ1 B;  2OAW A;  3VUB A;  4F7U F;  5AT1 B;  5GAM h;  3L4G A;  2GF7 A;  2QGF B;  2VC8 A;  4ZGD B;  5HK0 A;  2BZ8 A;  1X6B A;  2E6Z A;  2I4N A;  2J05 A;  1YIT T;  2FZG B;  2YRC A;  3CC4 T;  2CIM A;  1W70 A;  4NOY A;  3X26 B;  2ROT A;  5A0D A;  3EFS A;  5D6Y A;  2A37 A;  5LJ3 f;  2P4R A;  2H3E B;  1IB8 A;  1SSF A;  4LNS A;  1Q95 G;  3CD6 A;  2HMA A;  3M0T A;  3GIB A;  1IL2 A;  2J6K A;  3TRE A;  2F69 A;  3M4Y A;  1L0W A;  4RUG A;  4A4K A;  3OSV A;  4TQD A;  3OMG A;  2ALY A;  1JU5 C;  2CDT A;  2RQR A;  3CPW P;  4P3O A;  1J5W A;  1X55 A;  1PRL C;  3A31 A;  4F7U A;  1BI0 A;  3EGD B;  2CSQ A;  1CKA A;  4MDW A;  3OYE A;  3M0U A;  4OVA A;  1QVG S;  1U5S A;  4HWR A;  4N4G A;  2Z0W A;  3E9F A;  4JLI A;  2EGC A;  3HRK A;  1M2V A;  4HT9 A;  1G8X A;  2KNB B;  5GAM j;  2CUB A;  2EGA A;  1UHF A;  1M90 C;  2ZPE B;  2L5Q A;  3RL6 A;  4E7L A;  2QHT A;  4EMK B;  4Y28 E;  2XD0 A;  3TSW A;  1YIJ Q;  4LVM A;  2LP5 A;  1KD1 R;  3EAE A;  1UGS B;  1VQ8 A;  3QZ9 B;  3VS7 A;  3R07 A;  4ZTF A;  3A1P A;  4TQF A;  2FB7 A;  3QZ5 B;  4OMO A;  1N27 A;  2DO3 A;  4M75 E;  4JJC A;  1EIY A;  5KYW B;  2PUK B;  3CCL A;  2JT4 A;  1YI2 T;  4JRK A;  1BB9 A;  3DLM A;  5GAN 7;  2DFU A;  1MV0 B;  2E64 A;  2NUP B;  2RMO A;  2FVU A;  1UGQ B;  1SEM A;  3RES A;  2C7I A;  3VS3 A;  1YFT A;  4J9I A;  1G51 A;  3MF2 A;  3IAL A;  2D8J A;  1VQ7 A;  2HCK A;  1B70 A;  3O5Z A;  1PHT A;  1VQL T;  4C8Q B;  1SES A;  3EFO B;  2E6N A;  2ENM A;  2ZNJ A;  2QGG A;  2LTO A;  4KRT A;  4HCC A;  1LJO A;  2JOY A;  3M0S A;  2D9T A;  4E7J A;  5KYX B;  2MWP A;  2DXB A;  2SRC A;  3OBY A;  3G6E T;  1M90 U;  3M54 A;  3A5Z B;  1J3T A;  2HSP A;  1ASY A;  2LT1 A;  4M78 G;  1GBQ A;  4J7F A;  2E41 A;  1SHF A;  5DY9 A;  5LJ3 d;  1Q81 U;  3G7Z A;  4JJD A;  4P73 A;  2RK1 A;  5GAO r;  6AT1 B;  5D7U A;  4ANJ A;  1Z7M A;  5EC7 A;  1NPP A;  3LGL A;  2YUN A;  5ELN A;  4NS5 A;  2AT1 B;  1HJD A;  1W6X A;  4UPA A;  1W2B P;  3OSS C;  3J81 E;  3PMI A;  2P0P A;  2MCN A;  3C4S A;  1YJ9 Q;  1UDL A;  1AZE A;  1AWJ A;  2KT1 A;  3I55 Q;  2IPO B;  4LN2 A;  2I4L A;  4G85 A;  2QQA A;  3A7A A;  1MMD A;  3M9Q A;  1RAA B;  2QAZ A;  4HWP A;  3D7S B;  1SRY A;  2X4W A;  2KGT A;  2XG8 D;  3EFR A;  2EQI A;  4QVD A;  1NJ8 A;  1U1T A;  4ZIB A;  5L23 A;  4X34 A;  1H4S A;  3CCR T;  3OYG A;  4J9H A;  4K88 A;  5FLX E;  3RMQ A;  4JZ3 A;  2ZT7 A;  5LJ3 e;  4PJO E;  5HY6 A;  1WJS A;  2NUT A;  3VRZ A;  1NYF A;  2EYY A;  3VS2 A;  3EG9 B;  3NMZ C;  3RKX A;  4RMF A;  4EDU A;  1BIA A;  2ESW A;  2KK4 A;  1RAC B;  3M4Q A;  3UH0 A;  2QEX T;  1VQN A;  4KT0 E;  1D3B B;  4F14 A;  2DRM A;  4OLF A;  2PQW A;  1MMN A;  5FRN A;  2LCC A;  2KY9 A;  2YUP A;  5GAO m;  1WIE A;  1KQS P;  4BW9 A;  3OYM A;  2LC4 A;  1NNH A;  4G84 A;  2L8D A;  1X6G A;  4J6Y A;  2EYZ A;  2DX1 A;  4BE0 A;  4BDY A;  3FDR A;  1B7Y B;  4J15 A;  1YP5 A;  3LX7 A;  1YIJ A;  2LRQ A;  3T9N A;  2F5T X;  3OS0 A;  2RI5 A;  3CMA Q;  4ATO A;  4MZM A;  2M1H A;  1AOJ A;  2RHY A;  5CKD A;  2EL9 A;  1WDX A;  5IN1 A;  1WYX A;  4O6J A;  3QWX X;  4N0A C;  3G4S A;  1K8A C;  3NTI A;  2JS2 A;  2VGN A;  1Y96 A;  3QHS A;  1RAH B;  2DF6 A;  3PE0 A;  1EFN A;  5J39 A;  1OI1 A;  1P92 A;  2WSF E;  4B6M A;  1JRI A;  2DBK A;  4M7A F;  2AZS A;  2DE0 X;  5A0L A;  1T3L A;  4C0G A;  3HXW A;  1G3Y A;  1NE8 A;  3S6W A;  3LLR A;  1K1Z A;  12AS A;  2LCL A;  3CCE Q;  2NS6 A;  3PCO A;  4ZNX A;  1G83 A;  5IHN A;  4LDV A;  2ATC B;  2E1H A;  3LGF A;  4QVZ A;  2PMF A;  2D6F A;  2VXF A;  3PFS A;  3CCL T;  3REA B;  1X56 A;  3QNE A;  2OAU A;  1KFZ A;  2DM1 A;  1B7T A;  3HXX A;  1VQ5 Q;  1PKS A;  2OX7 A;  4M7A A;  2BE9 B;  4XTU A;  4E6R A;  1CSK A;  2ZZD A;  2KXC A;  3VS4 A;  2F5K A;  3CME T;  1N9S A;  3JB9 D;  2ZIM A;  4OF1 A;  2FZC B;  3M57 A;  1VQ7 T;  1G3T A;  3E9G A;  4M78 F;  1D09 B;  2KE9 A;  3QWY A;  2K79 A;  2L3P A;  2O4X B;  3RF1 A;  1LVK A;  4CI0 C;  4BI3 A;  5L8R E;  2M0Y A;  2K4Y A;  1K8A U;  4YRN A;  2CJA A;  2DLP A;  1YIT Q;  1YJ9 A;  2HL5 C;  3KBG A;  4PKC C;  5J26 A;  1WHH A;  1C1A A;  1QVP A;  2FYK A;  1M90 R;  2ZR2 A;  4M78 A;  1OX9 A;  3I56 A;  2PVO B;  1QW1 A;  4YCW A;  2CS7 A;  4RCC A;  1M30 A;  1VQO T;  1ARK A;  2QQR A;  1T0H A;  1Q81 R;  2ZTG A;  3QYG B;  4IUQ A;  4C92 G;  1X2K A;  2HKN A;  2LJ1 A;  4J9F A;  4RTZ A;  3RDV A;  3OYH A;  1QVF A;  4A4E A;  2DTI A;  1EOV A;  4YCV A;  3DB3 A;  3H9N A;  3HRS A;  1WGS A;  4CH3 A;  4WF2 A;  4PJL A;  1ZX6 A;  3UA6 A;  4IUP A;  2HEQ A;  4FM4 B;  3EGD A;  2DEQ A;  4PJN A;  4PNO A;  4Q5W A;  1K9M R;  5CCA A;  1YNZ A;  2KYM A;  2XDP A;  3VS1 A;  2AHJ B;  3EG0 A;  1VYV A;  4E7K A;  1D0Z A;  1RAB B;  3QO7 A;  1UEB A;  2XMF A;  2J7I A;  4RTW A;  3VQV A;  3M53 A;  2EIF A;  4EMK A;  3CMA A;  1MHN A;  5KE3 A;  1VQN T;  4OB1 B;  3C0C A;  1UUE A;  1HYO A;  5CKE A;  1B76 A;  4RKU E;  2WSC E;  4ELZ C;  4YRC A;  4BE1 A;  1KHC A;  4C8Q F;  3OYB A;  3HRI A;  5KYW A;  2I2L A;  4M7D B;  4A53 A;  4AT1 B;  5GJW B;  2DET A;  3FLG A;  1VQL Q;  5GAN f;  3WVE B;  4PLL A;  2C06 A;  2X4X A;  1YIJ T;  2NUP A;  2HSE B;  4EIK A;  2RQT A;  3BY7 A;  1Q82 C;  2VGM A;  2E3C A;  4HVU A;  2E5Q A;  1TS9 A;  2HD0 A;  2EJG A;  4M77 F;  2V1Q A;  2JMC A;  4C8Q A;  4CRI A;  3EFO A;  1RI9 A;  1BCM A;  3G4S T;  4M75 B;  3OYC A;  5FU7 B;  1W2B A;  4WJ3 M;  3CCQ Q;  2XI9 A;  2BUD A;  5KYX A;  2R57 A;  4HWS A;  2ED1 A;  3ULR B;  3A5Z A;  3NHN A;  3U23 A;  1VQK Q;  3EGX B;  2LX9 A;  4HT8 A;  1BU1 A;  4M77 A;  2R58 A;  3QPH A;  2FPD A;  1G5V A;  2MWO A;  1ABO A;  4J5Y A;  2XK0 A;  3VQW A;  4M7A C;  1UGV A;  3EG2 A;  4CC2 A;  4UP7 A;  4E7S A;  4KUI A;  3RMS A;  1TUC A;  1X75 C;  4D8D A;  3JB9 I;  2DD4 A;  1D1B A;  2ZT5 A;  2KAF A;  3OMC A;  3UA7 A;  2RHX A;  1I1J A;  1U3O A;  4N4I A;  2I4M A;  1KQS A;  2JM8 A;  3FJ5 A;  2H3J A;  3JB9 J;  1Q82 U;  1GCQ A;  1UGR B;  4ZN3 A;  3OW2 A;  2OTL A;  4VUB A;  1QF6 A;  3M0Q A;  4P72 C;  1PKT A;  3KUF A;  3INZ A;  4PHC A;  2J3L A;  4J7I A;  4J9E A;  4CH4 A;  2LNH B;  1K0X A;  4FYV B;  4CC4 B;  1K8A R;  1YJ9 T;  3EG9 A;  4OML A;  1MGQ A;  2WSE E;  2CZ7 B;  4NL2 A;  1LYL A; 
#chains in the Genus database with same CATH homology
 1VQ6 A;  3L2Z A;  1D3B A;  3L2V A;  4YRO A;  3I56 T;  2ZIN A;  2YHT A;  4LVK A;  4JRI A;  4YP0 A;  3L2Q A;  4P71 A;  3LH0 A;  3HRT A;  3QYH B;  4M7D G;  2PUO B;  4XTY A;  1M1G A;  4RDX A;  3ZBD A;  4C0D C;  1USY A;  2M0O A;  2ZPG B;  4MMK A;  4XEM A;  4PJO B;  1B7Y A;  3VKI A;  3C94 A;  3A8O B;  4MDX A;  2ZCE A;  3VYH B;  1JB0 E;  2JUF A;  3JCM f;  2GQV A;  5LJ5 f;  2XHC A;  3OYF A;  4M75 G;  2B8A A;  1O75 A;  3QO8 A;  2ZXF A;  1ZHI A;  4EMK C;  3QBY A;  5LJ3 h;  5GAN e;  3JCM P;  4QVC A;  4H2U A;  3SB2 A;  2DU7 A;  2P0Q A;  3CMA T;  4AH6 A;  3HFN A;  2ZPB B;  3HXU A;  1EQR A;  5CKH A;  3JCM c;  2QDY B;  1Y71 A;  3CCQ A;  2K57 A;  3ICA A;  1PSE A;  3H6Z A;  4Q15 A;  3CBM A;  5M9O A;  3CC2 A;  2MI6 A;  1NYQ A;  2GCX A;  2DXU A;  1NPR A;  4C8Q C;  2DXC A;  2KQW A;  5LJ3 j;  3OS2 A;  4BI4 A;  4YYE A;  4HVC A;  3P8V A;  2IY5 B;  2RB6 A;  5GAN 3;  1N6A A;  1BIB A;  2O4X A;  3E9H A;  3OYK A;  4OB3 B;  5GAN 5;  2EYQ A;  4E7H A;  2E5A A;  1OZ2 A;  3CPW S;  4M77 C;  3JRZ A;  2K3X A;  2IG0 A;  2XGT A;  1FX7 A;  3JCM W;  2K2V A;  4P74 C;  3RKW A;  4BD3 A;  3OYL A;  3GF5 A;  1BI2 A;  5GAO l;  2LQ8 A;  2L3R A;  4B9W A;  1W4S A;  4PJO G;  2EQJ A;  1QVF S;  3RAC A;  3NEL A;  3JCM d;  5LJ5 d;  4P5N A;  3QUI A;  4X5O A;  2OTL T;  1B34 A;  1QP3 A;  5C0M A;  2RI3 A;  1VQP A;  1XNI A;  1KC8 C;  4H2X B;  4M7A D;  2KDS A;  3JCM Q;  4M7D F;  1IRE B;  5I2S A;  3R6O A;  2ZT8 A;  1VQ9 A;  4LD9 K;  1VQ6 T;  1SET A;  4P71 C;  2QTX A;  1RI0 A;  5GAN 6;  2X4J A;  3QII A;  3OB9 A;  3TEE A;  2DU5 A;  5GMK e;  3JCM e;  1EVL A;  2KMT A;  1Q7Y C;  3OYJ A;  1NJI C;  5LJ5 e;  4M7D A;  4M75 F;  3VBB A;  4P75 A;  4OGC A;  2CGH A;  4XK8 E;  4L59 A;  4LVI A;  4M78 D;  4OGE A;  3QJ6 A;  4KUL A;  1E24 A;  3MEV A;  2AMC B;  3CCV A;  1R8O B;  2K5I A;  2ZNI A;  3O8V A;  4DA4 A;  4M75 A;  2RM4 A;  5GAN 2;  1W2B S;  4XEO A;  4PG3 A;  1KC8 U;  4ZTU B;  3GPL A;  4FT2 A;  1X01 A;  2OTJ A;  1VUB A;  3V7C A;  2JVV A;  3ER0 A;  3MP1 A;  5KE2 A;  3CCQ T;  3OYD A;  1Q7Y U;  1NJI U;  3CC2 T;  5FRM A;  3A7U A;  1VQK T;  5FU6 B;  1I5L A;  2HNI A;  3VQY A;  1VQZ A;  1S72 A;  2K5L A;  1ZQ1 A;  5KCH A;  3LWH A;  5KH6 A;  2FL7 A;  5GMK l;  1KQS S;  3HFV A;  5DLQ E;  3JCM J;  3MP6 A;  2Y4Y A;  4YRF A;  4BE2 A;  4E7I A;  3WXM B;  3QO3 A;  4P3P A;  4J6X A;  3DSQ A;  2RJC A;  4PJO F;  3VYG A;  2CJB A;  4C8Q D;  4EX5 A;  3UDC A;  3A74 A;  3UGT A;  1ADJ A;  2E65 A;  2M16 A;  4Y91 A;  1GGM A;  2K5F A;  1QE0 A;  4C92 B;  4PJO A;  2M9U A;  3CD6 T;  1YFS A;  4L6V 5;  4M77 D;  3E19 A;  3LSQ A;  3LYI A;  1H4V B;  2RA2 A;  3KXT A;  3HFO A;  2ARS A;  3QG1 A;  1EVK A;  2LT4 A;  1VQP T;  4J8O A;  3OYN A;  2K3Y A;  2CZ6 B;  4JUV A;  3OYA A;  3NET A;  3FB9 A;  3M58 A;  4CS2 A;  3WQZ A;  4IUV A;  2DZC A;  1AHJ B;  3P8Y A;  3PNW C;  4WI1 A;  4P75 C;  1VQ8 T;  3UWN A;  1Z7N A;  3BDL A;  3H8Z A;  3OA6 A;  4CH6 A;  2DQ0 A;  4M7A E;  2LVM A;  4H2W A;  3M59 A;  5LJ5 g;  3SWN B;  3RKY A;  4II1 A;  3CCV T;  3BW1 A;  3PIP A;  4N4H A;  3CCU A;  1WYD A;  2IY5 A;  3OQ5 A;  4XU0 A;  4D6W A;  1LNX A;  2EQK A;  4YRM A;  3A32 A;  3FC3 A;  3V8L A;  4EPC A;  2C8M A;  4M78 E;  2OTJ T;  4YPF A;  2RHZ A;  4P73 C;  2LQK A;  1ASZ A;  1U8R A;  3MHX A;  4IUR A;  3QO5 A;  1TH7 A;  1KG1 A;  1SER A;  5C6S A;  3A7R A;  3REU A;  2CZ0 B;  5GAO n;  1V29 B;  3NFC A;  4OP0 A;  1S72 T;  1I8F A;  1PSF A;  4RCB A;  1KMN A;  1G3W A;  3CC7 A;  5GAN j;  4L5G A;  1G3S A;  3PTA A;  1M8V A;  2A8E A;  2RHQ B;  3JB9 G;  1U1S A;  3C12 A;  4H2X A;  1WQW A;  4H02 A;  2PVD B;  2MAM A;  4QW2 A;  4L87 A;  5KCO A;  2DD5 A;  1H64 1;  1YJW A;  11AS A;  4J83 A;  3TEH B;  4OB2 B;  1ZBX A;  5LJ3 g;  2Y90 A;  4YRE A;  3A8H B;  2RHS B;  1I4K 1;  3Q1J A;  1O9S A;  3IG2 A;  3ASK A;  3C95 A;  1Y07 A;  2AMC A;  3HSB A;  2EQM A;  4C8Q E;  2ZZF A;  1QP2 A;  3JCM X;  1Q86 C;  2DK3 A;  1BBU A;  3FIF A;  3X20 B;  4QQ6 A;  4GLK A;  2QHS A;  2MMP A;  1YGB A;  2XKO C;  3J7A F;  3OYY A;  4YRJ A;  1WLE A;  4A4H A;  4M77 E;  4BY6 C;  2XTI A;  5GMK h;  3IKL A;  4BI8 B;  3JCM h;  5LJ5 h;  4X9C A;  2VV5 A;  3CEY A;  2EWN A;  3MQZ A;  1NJ5 A;  4PL6 A;  4YRS A;  2DIQ A;  3V8K A;  2IVW A;  1X2G A;  1BYM A;  3CCU T;  4KR3 A;  4M7D D;  4YRK A;  1VQ4 A;  2ARU A;  1Q86 U;  2GFU A;  3QXE B;  3CC4 A;  5CQY A;  1KQ1 A;  5GMK j;  3F70 A;  3X28 B;  3CXC A;  5LJ5 j;  4C92 F;  4M78 C;  5E3I A;  3VV0 A;  2FHD A;  1YFR A;  4FU6 A;  3GNF B;  3QDR B;  1VIE A;  5GAN d;  4KR2 A;  3MEY A;  4B9X A;  4QQD A;  4C92 A;  4HWO A;  1X6O A;  3URG A;  5I21 A;  2JTF A;  2JN0 A;  3QTC A;  2QI2 A;  3HHT B;  2DXT A;  3CC7 T;  5ELO A;  1JJC B;  4C5G A;  2YLC A;  4KBM B;  4EO4 A;  1BKB A;  2CKK A;  3HL8 A;  1YI2 A;  1UGP B;  4C0F A;  2KVQ G;  4RQE A;  3CCM A;  1YJW T;  3M4P A;  3VJP A;  4XTX A;  5IAY A;  2AKW B;  3BFM A;  3CCS A;  3BJU A;  1EIF A;  4FIB A;  2LDM A;  4JLG A;  3SWN A;  4YRL A;  4BDZ A;  1N9R A;  2P4T A;  2ZGW A;  1GXI E;  4NL3 A;  3QKJ A;  4FSX A;  4YRI A;  3BDU A;  3V7S A;  2Q5I A;  4Z02 A;  2RJE A;  2QA4 A;  3HPW A;  1WJQ A;  5I2M A;  4YCU A;  2DJZ A;  2VUB A;  3VU3 C;  5A0G A;  1OYX A;  1FYF A;  4M7A B;  1H4Q A;  3OBW A;  4TVA B;  2QHU A;  3HTZ A;  1VIF A;  4LVJ A;  1PYS B;  5DLO A;  3IKM B;  2EJF A;  4OB0 B;  3TCJ A;  2P0L A;  2L89 A;  4RG2 A;  3CCR A;  4C5E A;  3DB4 A;  4XAX B;  4ZTZ B;  2JZ2 A;  4RMO A;  1YB3 A;  3OS5 A;  3SD4 A;  2Y4X A;  2X4Y A;  4J6W A;  2QXF A;  2QEX A;  2PVG B;  2GFA A;  4TTV A;  4F7U E;  3M4G A;  2RI2 A;  2RHQ A;  1YJN A;  1VQ4 T;  4LVL A;  1VQM A;  1B8A A;  1Y7X A;  1JJ2 A;  2PME A;  1WQ7 A;  4YRQ A;  1RL2 A;  3HP9 A;  4IKF A;  4C5I A;  4RG8 A;  3TEH A;  4C0D B;  4TVR A;  2JNG A;  4C92 C;  2DTH A;  4XU1 A;  1USY C;  2NLU A;  3KFU A;  2RHS A;  4M7D E;  2XDD A;  4YTL A;  2ZPI B;  4HA8 A;  1YHQ A;  2J3M A;  3ERR A;  2Q7G A;  2G3R A;  4E51 A;  2RHI A;  4N0A A;  2I4O A;  4H2V A;  1XTD A;  1Q81 C;  3JB9 H;  1WU7 A;  5GAO q;  4GY5 A;  2DKG A;  5GAN 4;  3AHU A;  4HKE A;  3UFG A;  4P3N A;  2O01 E;  2BIV A;  3PMT A;  4M7A G;  3G71 A;  3A8M B;  2QHV A;  4ZGE B;  3CCM T;  1K9M C;  3CPF A;  3J80 E;  3CME A;  5CO7 A;  2Q5H A;  3MET A;  1E1O A;  2XID A;  5GAM f;  3CBP A;  1BI1 A;  5GAN g;  3HXV A;  3HXZ A;  2E12 A;  3CCS T;  4LDX A;  3W3S A;  3HRU A;  4FL6 A;  3SWN C;  4TVY A;  3P8T A;  2DIG A;  2VYT A;  1N8R C;  2PU9 B;  4K87 A;  4QQG A;  1M4Z A;  1BBW A;  1KHI A;  3P8H A;  5IT9 E;  4M77 B;  3OYI A;  1NZ9 A;  3S3O A;  2EQU A;  3OY9 A;  3OW2 S;  3CCJ A;  3SDZ A;  1VQO A;  2QA4 T;  5AYF A;  2YRV A;  3CXC S;  2ZPH B;  3REX A;  3L42 A;  1OZ3 A;  3JCM b;  1NJ2 A;  5K1P A;  2RK2 A;  3MEW A;  1KQ2 A;  5CKB A;  4LDU A;  1K9M U;  2BKD N;  4O5V A;  3VUZ A;  3RGL A;  2E70 A;  4XQ3 A;  4C0Z A;  1XQH A;  4UP8 A;  3JSC A;  1M1K C;  4H2S A;  1LOJ A;  2HQX A;  3CBO A;  3HFZ B;  3P8D A;  3UPU A;  1K73 C;  1N8R U;  5LL6 S;  2ZZE A;  1WNL A;  3DKM A;  2WAC A;  2JTM A;  4H2Y A;  5GAO p;  1JJC A;  2DQ3 A;  5HGQ A;  1YJN T;  5CIU A;  1VQM T;  2RJF A;  3NEN A;  3ZFJ A;  5F5W A;  3P8B B;  3MO8 A;  5J3B A;  1YCY A;  5C51 B;  1X54 A;  3HY1 A;  3DLL A;  2R5M A;  3HKS A;  3NTH A;  1VQ9 T;  4FT4 A;  5GAM d;  1NJ6 A;  4EMH A;  3QSU A;  3OS1 A;  4M7D C;  3M5A A;  2EFI A;  4C8Q G;  3PT9 A;  1G5H A;  1I81 A;  2AKW A;  2RJD A;  1YHQ T;  4JRQ A;  4MZT A;  3E9I A;  1M1K U;  3VQX A;  4DOW A;  1EFW A;  3OD1 A;  1K73 U;  3JCM g;  2RHU A;  4M77 G;  5HK3 A;  2D0Q B;  3NEM A;  4M75 C;  5FU7 C;  3L2W A;  3X25 B;  1YBY A;  2ODR C;  5GAM e;  4DOV A;  4C92 D;  3WVD B;  1IZ6 A;  1WPY A;  4LDW A;  3A5Y A;  5CQX A;  4MZP A;  2QQB A;  3TUP A;  3G71 T;  3RUX A;  3GLX A;  4O2D A;  4TVA A;  5GAN h;  2XDB A;  1ADY A;  3UGQ A;  1PYS A;  2V8K A;  4YDQ A;  5GAN 8;  4HCZ A;  1NJ1 A;  5DM7 R;  4ELY C;  3FJP A;  2QQ9 A;  4ME7 A;  1N9W A;  3CPW A;  4JS5 A;  4P72 A;  4LD6 A;  3LC0 A;  4A4G A;  3NTK A;  3I55 A;  1FWZ A;  5EG2 A;  5GMK i;  3G1Z A;  3PZC A;  2Q7H A;  3PGG A;  2A7Y A;  5FRO A;  3CCJ T;  3L4G B;  4K86 A;  4X9D A;  4JRP A;  3UT1 A;  5A2Q E;  4HWT A;  1JJ2 S;  2EAY A;  3MEA A;  2G4C A;  2DAQ A;  5HKC A;  5GMK m;  4BB7 A;  5C52 B;  2ALY B;  4A54 A;  2DVE A;  4F7U B;  2CYZ B;  3I7F A;  2ZPF B;  1QVG A;  1B34 B;  4XTW A;  3CMQ A;  4PJO C;  2RO0 A;  4TWA A;  3A8L B;  1W66 A;  1ATI A;  3JCM V;  4RQF A;  2XU8 A;  3M56 A;  2VXE A;  4A4F A;  2CJ9 A;  5D6X A;  4HCB A;  2KSS A;  4DPG A;  4JJN K;  5KNN A;  3M55 A;  4EMG A;  4KQE A;  1EIY B;  5CAI A;  3SFM A;  4BWA A;  4JDS A;  4ZGJ B;  3CCE A;  4ZN1 A;  2V8I A;  4WJ4 A;  3GOX A;  1HK9 A;  4UC4 A;  1FXX A;  3FEO A;  3MEU A;  3PIO A;  1B70 B;  3L1A A;  2ZIO A;  1VQ5 A;  5CK9 A;  3L2U A;  5CVI A;  1E22 A;  2HBP A;  2Q7E A;  2E10 A;  2DZ9 A;  4DQ2 A;  1M9S A;  2MF2 A;  1KD1 C;  3V8J A;  2ZT6 A;  1H4T A;  2HAX A;  4P74 A;  1YIT A;  4IUT A;  4IUU A;  3FRN A;  3MF1 A;  4UP9 A;  2DDZ A;  1RIQ A;  4E47 A;  5GAM g;  2R5A A;  2P5I A;  4HT4 A;  1UB4 A;  4F7U G;  4KUD K;  5CR2 A;  4XTV A;  4M75 D;  4PLI A;  5D6W A;  2ODR D;  3JB9 F;  3HFZ A;  1KOG A;  2QQS A;  3V7R A;  4C92 E;  1X2H A;  2V8J A;  3TEG A;  1KMM A;  3ZEH A;  4TVW A;  3X24 B;  4CH5 A;  4V2S A;  1XOV A;  1KD1 U;  4R56 A;  1HC7 A;  4LDY A;  1NYR A;  3MP8 A;  2ZR3 A;  2A3L A;  4BUG A;  3S3N A;  1HXD A;  3RIR A;  3MCA B;  1WJR A;  1H3Z A;  3JAM E;  2EJ9 A;  4XTZ A;  1HTT A;  2YLB A;  4YRR A;  4YRT A;  1JBM A;  1VQL A;  5CKF A;  4YRG A;  4XU2 A;  2LNV A;  1Y96 B;  3LSS A;  5C53 B;  3QJY A;  4YRP A;  4XU3 A;  1C0A A;  2RH2 A;  3HXY A;  1BI3 A;  4R55 A;  3G6E A;  3N5B B;  2DPP B;  4H2T A;  1M5Q 1;  1G5I A;  3A8G B;  2HQE A;  3PCO B;  4C5H A;  4BY6 B;  2EKO A;  2RD1 A;  3L2R A;  4MML A;  4PJO D;  4CS3 A;  5K1X A;  4OMF B;  2XIC A;  4JS4 A;  3LW5 E;  1VQK A;  4NCX A;  3CCE T;  1E1T A;  1DJ7 B;  4ZTJ A;  2DTO A;  2X35 A;  3E1S A;  3S3M A;  3GNG A;  2P0K A;  4Q6G A;  1VQ5 T;  5FU6 C;  3TU4 K;  3HY0 A;  4BAC A;  3ME9 A;  3LWI A;  4CS4 A;  2ZCF B;  2ART A;  3RER A;  2ZZG A;  3GP8 A;  1M1F A;  4M78 B;  2CZ1 B;  3VUB A;  4F7U F;  5GAM h;  3L4G A;  2GF7 A;  4ZGD B;  2VC8 A;  5HK0 A;  2E6Z A;  2I4N A;  1YIT T;  2CIM A;  3CC4 T;  4NOY A;  3X26 B;  5A0D A;  5D6Y A;  3EFS A;  5LJ3 f;  1SSF A;  4LNS A;  3CD6 A;  3GIB A;  1IL2 A;  3TRE A;  2F69 A;  3M4Y A;  1L0W A;  4A4K A;  3OSV A;  4TQD A;  3OMG A;  2ALY A;  4P3O A;  1J5W A;  1X55 A;  3A31 A;  4F7U A;  1BI0 A;  3OYE A;  4MDW A;  4OVA A;  1QVG S;  4HWR A;  4N4G A;  3E9F A;  4JLI A;  3HRK A;  4HT9 A;  5GAM j;  1M90 C;  2ZPE B;  2L5Q A;  3RL6 A;  4E7L A;  2QHT A;  4EMK B;  4Y28 E;  2XD0 A;  4LVM A;  3EAE A;  1UGS B;  1VQ8 A;  3QZ9 B;  3R07 A;  4ZTF A;  4TQF A;  2FB7 A;  3QZ5 B;  1N27 A;  2DO3 A;  4M75 E;  1EIY A;  2PUK B;  3CCL A;  1YI2 T;  4JRK A;  3DLM A;  5GAN 7;  2E64 A;  2FVU A;  1UGQ B;  3RES A;  2C7I A;  1YFT A;  1G51 A;  3MF2 A;  3IAL A;  1VQ7 A;  1B70 A;  1VQL T;  4C8Q B;  1SES A;  2E6N A;  2ZNJ A;  2LTO A;  4HCC A;  1LJO A;  2JOY A;  2D9T A;  4E7J A;  2MWP A;  2DXB A;  3OBY A;  3G6E T;  1M90 U;  3M54 A;  3A5Z B;  1ASY A;  2LT1 A;  4M78 G;  4J7F A;  2E41 A;  5DY9 A;  5LJ3 d;  1Q81 U;  3G7Z A;  4P73 A;  2RK1 A;  5GAO r;  1Z7M A;  1NPP A;  3LGL A;  5ELN A;  4NS5 A;  4UPA A;  3OSS C;  3J81 E;  3PMI A;  2P0P A;  3C4S A;  2I4L A;  4G85 A;  2QQA A;  3A7A A;  3M9Q A;  4HWP A;  1SRY A;  2X4W A;  2XG8 D;  3EFR A;  4QVD A;  1NJ8 A;  1U1T A;  4ZIB A;  1H4S A;  4X34 A;  3CCR T;  3OYG A;  4K88 A;  5FLX E;  3RMQ A;  2ZT7 A;  5LJ3 e;  4PJO E;  5HY6 A;  1WJS A;  4RMF A;  3RKX A;  4EDU A;  1BIA A;  2KK4 A;  3M4Q A;  3UH0 A;  2QEX T;  1VQN A;  4KT0 E;  1D3B B;  4OLF A;  2PQW A;  5FRN A;  2LCC A;  2KY9 A;  5GAO m;  4BW9 A;  3OYM A;  2LC4 A;  1NNH A;  4G84 A;  2L8D A;  4J6Y A;  4BE0 A;  4BDY A;  3FDR A;  1B7Y B;  4J15 A;  3LX7 A;  1YIJ A;  2LRQ A;  3T9N A;  2F5T X;  3OS0 A;  2RI5 A;  4ATO A;  4MZM A;  2M1H A;  2RHY A;  5CKD A;  2EL9 A;  5IN1 A;  4O6J A;  4N0A C;  3G4S A;  1K8A C;  3NTI A;  2VGN A;  1Y96 A;  3QHS A;  5J39 A;  1OI1 A;  1P92 A;  2WSF E;  1JRI A;  4M7A F;  5A0L A;  4C0G A;  3HXW A;  1G3Y A;  1NE8 A;  3S6W A;  3LLR A;  12AS A;  2LCL A;  2NS6 A;  3PCO A;  4LDV A;  2E1H A;  3LGF A;  4QVZ A;  2PMF A;  2D6F A;  2VXF A;  3PFS A;  3CCL T;  1X56 A;  3QNE A;  2OAU A;  3HXX A;  4M7A A;  4XTU A;  2ZZD A;  2F5K A;  3CME T;  1N9S A;  2ZIM A;  3JB9 D;  4OF1 A;  3M57 A;  1VQ7 T;  1G3T A;  3E9G A;  4M78 F;  3RF1 A;  2O4X B;  4CI0 C;  4BI3 A;  5L8R E;  2K4Y A;  1K8A U;  4YRN A;  2CJA A;  1YJ9 A;  3KBG A;  4PKC C;  5J26 A;  1QVP A;  2FYK A;  2ZR2 A;  4M78 A;  3I56 A;  2PVO B;  1QW1 A;  4YCW A;  2CS7 A;  4RCC A;  1VQO T;  2QQR A;  2ZTG A;  3QYG B;  4IUQ A;  4C92 G;  3OYH A;  1QVF A;  4A4E A;  2DTI A;  1EOV A;  4YCV A;  3DB3 A;  3HRS A;  4CH3 A;  1WGS A;  4WF2 A;  4IUP A;  4FM4 B;  2DEQ A;  4PNO A;  4Q5W A;  5CCA A;  2XDP A;  2AHJ B;  4E7K A;  3QO7 A;  1UEB A;  3VQV A;  3M53 A;  2EIF A;  4EMK A;  3CMA A;  1MHN A;  5KE3 A;  1VQN T;  4OB1 B;  5CKE A;  1B76 A;  4RKU E;  2WSC E;  4ELZ C;  4YRC A;  4BE1 A;  1KHC A;  4C8Q F;  3OYB A;  3HRI A;  2I2L A;  4M7D B;  4A53 A;  3FLG A;  5GAN f;  3WVE B;  4PLL A;  2C06 A;  2X4X A;  1YIJ T;  3BY7 A;  1Q82 C;  2VGM A;  2E3C A;  2E5Q A;  2HD0 A;  2EJG A;  4M77 F;  4C8Q A;  4CRI A;  3G4S T;  4M75 B;  3OYC A;  5FU7 B;  1W2B A;  4WJ3 M;  2XI9 A;  2BUD A;  2R57 A;  4HWS A;  3A5Z A;  2LX9 A;  4HT8 A;  4M77 A;  2R58 A;  3QPH A;  1G5V A;  2MWO A;  4J5Y A;  2XK0 A;  3VQW A;  4M7A C;  4UP7 A;  4KUI A;  3RMS A;  1X75 C;  3JB9 I;  2DD4 A;  2ZT5 A;  2KAF A;  3OMC A;  2RHX A;  4N4I A;  2I4M A;  1KQS A;  2H3J A;  3JB9 J;  1Q82 U;  1UGR B;  4ZN3 A;  3OW2 A;  2OTL A;  1QF6 A;  4VUB A;  4P72 C;  3KUF A;  3INZ A;  4PHC A;  2J3L A;  4J7I A;  4CH4 A;  1YJ9 T;  1MGQ A;  2WSE E;  2CZ7 B;  3I55 T;  4NL2 A;  1LYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...