2DKGA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, pyrophosphate and mg(2+)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
235
structure length
235
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 71
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dkgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dkgA01
2G4CA 4M7DD 5K1XA 1EOVA 1Z7NA 2Q7GA 4KR2A 3JCMQ 3NELA 4C92G 3UFGA 3QO3A 4CH6A 2RD1A 4QVDA 1G51A 1LOJA 1NJ5A 4M75G 3RF1A 1WNLA 3RKYA 1QE0A 3M4QA 1NJ1A 1X56A 2C8MA 2ZCEA 5GANf 4HT9A 2QHVA 2DTHA 5GAMe 5HGQA 3HXUA 1I8FA 4M7AG 2E64A 1M5Q1 4M78G 3M4PA 4YRJA 2ODRC 2ALYA 4PJOC 5LJ5h 1EVKA 5GAOm 1B34B 1YCYA 2ARSA 4P71A 4MMLA 1I4K1 2DQ3A 3L4GA 3UGQA 2FYKA 5GANd 2DKGA 2E1HA 1EVLA 4C92B 5LJ5g 4YREA 4YRRA 3HXVA 4M7DF 2ZT6A 5LJ5j 4XQ3A 2ARTA 3VBBA 1KQ1A 4M75B 3JCMV 5GAN5 1WYDA 3L2ZA 2ZXFA 5GMKh 4J5YA 3IG2A 5ELNA 1KOGA 1LJOA 3SWNB 3NENA 4N0AC 4YRPA 4CS4A 1HXDA 1LNXA 1B7YA 2ZT5A 2JN0A 4YPFA 3PCOA 4PJOG 4M7AB 4YRKA 3ERRA 1HTTA 3TUPA 4RQEA 4YRSA 4C92D 3JB9I 1PYSB 4OLFA 5GANe 4TVYA 4DQ2A 2ZZFA 3A74A 4M75D 4PNOA 3RERA 5I21A 3E9IA 4XTXA 4A53A 4JUVA 2AMCB 3V8KA 5GMKl 2PMEA 3JB9J 5GAMh 4M77C 4M7AD 2CJBA 4M78D 4XTUA 3QO5A 4YROA 3M4GA 4WF2A 4X9DA 3HFOA 3E9HA 3IKMB 3PZCA 1B70A 2ZIMA 3FJPA 1YB3A 3JB9G 2ZNIA 3IALA 3LSSA 4PJOB 4K88A 3JCMP 4PG3A 3MF1A 4F7UA 4O2DA 1X01A 4UP7A 1IL2A 4J6WA 4EMKA 2EJGA 3QTCA 1H4QA 1EIYA 2VXFA 4M77G 4K87A 4C92F 1WQ7A 1Z7MA 4XTWA 1X55A 4G84A 1BBWA 2XGTA 3I7FA 1H4VB 4M75F 5ELOA 4PJOD 3RUXA 3JCMJ 2ZINA 4Q6GA 2I4NA 2P5IA 4RMFA 1N9SA 1ADYA 1NYQA 4EMHA 4P75C 2QHTA 4C8QC 4M7AF 4M78F 4XU0A 5E3IA 1YGBA 3TEHB 1I5LA 4H2XB 3AHUA 4CS3A 5CAIA 4NCXA 2DTIA 2DXUA 1GGMA 3HSBA 4YRGA 3VQYA 2RHSB 3HFVA 1SRYA 4UP8A 1X2GA 2RHQB 4M77B 2CGHA 2RA2A 3W3SA 3LC0A 4F7UE 3BJUA 4M7DA 2RM4A 2Q7EA 1H4TA 2YHTA 3JB9D 4C8QG 1D3BB 3REXA 4P72C 2ZIOA 4H2UA 4XU3A 5LJ3f 2Q7HA 4PJOF 1SERA 4HT8A 2ZT7A 4YRCA 4M77D 3UH0A 4EMGA 2DQ0A 2J3LA 1NJ6A 4P3PA 3VQVA 4WI1A 2ZZEA 4HVCA 1HK9A 2IY5B 3ICAA 4L87A 4P3OA 1N9WA 4J6XA 5LJ3d 3BY7A 4TQFA 4P73C 4RDXA 3RIRA 4P74C 1JBMA 3V8JA 4C8QB 3HTZA 4YP0A 4P3NA 3LSQA 3V7RA 3JCMh 2ZTGA 3WQZA 2E41A 4M7DE 12ASA 3JB9F 2DU5A 4XU1A 4KQEA 1G5IA 3EFRA 3JCMg 4TWAA 2EAYA 2DTOA 1KQ2A 3L1AA 3MEYA 2AKWA 3A5ZA 1USYA 4TVAB 5C51B 1VQZA 3UGTA 5GMKj 3HXXA 4M77F 5LJ3e 4C8QD 4BW9A 4C92A 4F7UG 2QTXA 3RESA 3INZA 2DVEA 4M75A 2PMFA 11ASA 2E65A 3JCMb 1RIQA 3SWNA 3DSQA 1Y96B 4YYEA 2ZGWA 1YFRA 3NEMA 3EFSA 2ZT8A 3G1ZA 3QUIA 4M7AA 4XU2A 3BFMA 4M78A 2DZCA 2XTIA 5GAMg 5GAOl 3A7UA 4ZTUB 2DDZA 5GAMj 1LYLA 4RQFA 1ADJA 5GAN8 4AH6A 1ASYA 5DY9A 2DZ9A 5LJ5f 4H2WA 2AMCA 4K86A 3TEGA 4F7UB 3A31A 3JB9H 1NJ2A 1E1TA 4H2YA 4ZTZB 1J5WA 1C0AA 4C8QF 2I4LA 4C92E 2Q5IA 1JRIA 2ODRD 4CS2A 4ZIBA 3RKXA 4PJOA 2ZZGA 3P8VA 2P0LA 5LJ5d 4OP0A 4XTYA 2ZR3A 4HWSA 4P71C 2FB7A 1MGQA 4XTZA 3HFZB 1TH7A 4UP9A 4E51A 5GANh 3V8LA 2QHUA 4M78E 1N9RA 2J3MA 1FYFA 4NOYA 5GANg 4YCVA 4Q15A 4WJ4A 5GANj 4N0AA 1H641 1B8AA 1X2HA 1YFSA 5GAN7 3V7SA 1JJCB 3A32A 5LJ5e 3BDUA 1BBUA 1KMNA 3HRKA 4UPAA 2VXEA 3BW1A 3A5YA 4YRQA 3TEHA 1U1TA 4KR3A 3A7RA 4HWRA 5GMKi 2RHQA 4M77A 1E22A 2ARUA 4F7UF 5GAOr 4BWAA 2I2LA 4TVWA 3R07A 1H4SA 4V2SA 1D3BA 2ZNJA 4XTVA 4YCWA 5F5WA 2EJFA 4JRKA 2ALYB 2Y90A 5C52B 3KFUA 4YRFA 4CH5A 1EFWA 2EJ9A 3QNEA 1YFTA 3PGGA 4J6YA 3L4GB 4EMKC 4X5OA 2EL9A 3JCMX 1SESA 3HXYA 3VU3C 4QVCA 2DEQA 1U1SA 3HY0A 2IY5A 2VC8A 5GMKm 3CMQA 4CH3A 2I4MA 1NJ8A 4JLIA 2E5AA 1B76A 3A7AA 1B34A 5GAN6 1B7YB 4G85A 3PCOB 2AKWB 2E3CA 4P75A 5GAOq 4C8QA 1G5HA 4M77E 2I4OA 1SETA 2HNIA 3HFNA 4CH4A 3HXZA 5GAN3 5C53B 1L0WA 5GAN2 1NNHA 4H2VA 4XEMA 4DPGA 4HA8A 4HWPA 4TVAA 4YDQA 1X54A 1QF6A 4M78B 1KMMA 4RCCA 4M7DC 1BIBA 1PYSA 3FB9A 1B70B 4XEOA 4PHCA 4P72A 3MF2A 2CIMA 1Y96A 3V7CA 3SB2A 3RKWA 3OD1A 3FIFA 3GIBA 3QSUA 4EMKB 2RB6A 3VQXA 3JCMf 1EIYB 3QO7A 3NETA 4J15A 4YRMA 4MMKA 1WQWA 3QHSA 3HY1A 4C8QE 1HC7A 4NL2A 4YCUA 4M7DG 2EWNA 4HWTA 1ATIA 1M8VA 3JCMc 1W66A 4M75E 2QHSA 4TQDA 2Q5HA 5LJ3h 4P73A 3P8YA 4YRNA 4P74A 4NL3A 2CJ9A 4YRIA 4M7AE 2ZR2A 3JCMd 3HXWA 5LJ3g 2K57A 2DJZA 3JCMW 1NYRA 3REUA 5LJ3j 2E10A 4Y91A 1WU7A 1BIAA 5K1PA 1WPYA 3RACA 5GAMf 2DXTA 5GAOn 4LNSA 4WJ3M 4A54A 1USYC 3HRIA 3IKLA 3HFZA 4YRTA 2YLBA 4EX5A 4M7DB 2DU7A 4H02A 5KNNA 5GAOp 1E24A 4C92C 1E1OA 4EO4A 4H2XA 3JCMe 3VQWA 4M75C 4TTVA 3P8TA 2CJAA 1ASZA 4JRIA 4H2TA 2C7IA 1I81A 3SWNC 4YRLA 2RHSA 5GMKe 4H2SA 5GAN4 4PJOE 2YLCA 5GAMd 4HWOA 3RGLA 4RCBA 1JJCA 3QO8A 1EQRA 4X9CA 1WLEA 4M7AC 3RL6A 4M78C
chains in the Genus database with same CATH superfamily
3MEVA 2HDAA 1EOVA 1H8KA 2AZSA 4KR2A 3NELA 1WHHA 3CBOA 4ZN3A 2NUPA 1WHGA 2HKQB 3VS1A 2ESWA 2RD1A 3EGXA 1SSHA 3KXTA 4E7KA 2RQWA 3LH5A 2C8MA 2X3XD 3MCAB 5GAMe 3HXUA 1ARKA 1I8FA 1RUWA 3TREA 4ME7A 2XDPA 1KQSA 3WVEB 3R6NA 4BE0A 2ODRC 1B3QA 1NJIU 1YJNT 2ALYA 4PJOC 2DK3A 2LT4A 5KYUA 5LJ5h 2C06A 1X2KA 3OYDA 3A5ZB 4P71A 4MMLA 5A0GA 5GANd 2JS0A 2E1HA 1EVLA 5A2QE 4PFOA 2EQIA 3P8BB 5GAN5 2DF6A 1WYDA 1UGQB 5GMKh 2JMCA 3FC3A 3SWNB 1HXDA 1VYUA 4JZ3A 2XMFA 1D09B 1LNXA 3OYAA 2YUPA 5FLXE 2KEAA 1BI1A 1WYXA 2KXCA 4NS5A 2PUKB 3CPWS 2AKLA 1W2BS 5GANe 1WA7A 1LCKA 4DQ2A 1S72Q 3A74A 4M75D 1N27A 3THKA 2JS2A 3CD6Q 3OMGA 4XTXA 2YRCA 4A53A 2HQXA 1Q82R 2AMCB 1AWXA 3CCUA 4HCBA 3PIOA 1VQ5Q 4M7AD 2LQKA 1VA7A 2A0FB 5CKDA 1PCXA 4WF2A 3SFMA 3PZCA 2HL5C 2ZIMA 3CBPA 4KGZB 2JM8A 1SHGA 4PJOB 4HCKA 1GFDA 1GCPA 3MF1A 2DIGA 4RTUA 1EFNA 1X01A 3OSVA 1H4QA 2KYBA 3QYHB 2VXFA 4OMOA 4K87A 1BI0A 4C92F 1Z7MA 1FMKA 1X55A 1HSQA 2KRSA 2YSQA 2LDMA 1OX8A 1H4VB 2E5QA 2LMJA 2COZA 4M4ZA 2ZINA 2HD0A 2F2VA 2I4NA 3GNGA 1N9SA 1VQ9Q 1YITQ 2L3SA 3HPWA 2Y4YA 4C8QC 4M78F 2M0OA 4LD9K 2JMAA 4AG1C 3OB9A 2DFUA 3NGPA 3CCRA 2A37A 1BCOA 2L3RA 1T3SA 3M59A 5GJVB 4OGCA 3VQYA 1SRYA 3OA6A 3RR6A 3G6EQ 2RJFA 4F7UE 3BJUA 2BZXA 2RM4A 1I5OB 7AT1B 1H4TA 1BBZA 1XOVA 4B9WA 3AT1B 3UA7A 1D3BB 3UT1A 4BUGA 4P72C 3QPHA 2AKKA 4XU3A 2EGEA 5DLOA 3CCJQ 3JSCA 1MMGA 4OB1B 3UH0A 4KUIA 2KAFA 5HK3A 2MOXA 4EMGA 4IURA 4HT4A 4BY6C 3MO8A 4KUDK 3I56A 2QQAA 3E2UA 4E7LA 5D7UA 1YI2Q 2L89A 2ZZEA 4HVCA 2YUQA 1IRXA 3ICAA 2RHZA 3H0IA 4OMFB 4XK8E 1VYTA 1U8RA 4P3OA 4J6XA 1ZSZC 2GBQA 2X35A 1AWOA 3HP9A 8ATCB 1NJIC 4C8QB 3HTZA 1XJWB 1VQ4T 1K76A 3QWYA 2DA9A 2E4HA 3M55A 1R8OB 3JB9F 2X4WA 4KQEA 1PSFA 2DTOA 2DM1A 2ED1A 4FSXA 1KQ2A 5IXFA 1RACB 2R58A 3CPFA 2AKWA 5C51B 4TVAB 1VQZA 1PRMC 4M77F 3H0HA 3RESA 2F1LA 1NG2A 1TG0A 2OAWA 2HL3A 5CIUA 4JJCA 1Y57A 4M75A 2PUOB 2MYSA 4Z8AA 1NLOC 1YJWQ 1YFRA 1KC8R 1Z9ZA 2OTLQ 1YWPA 1SKUB 4M7AA 2KYMA 2RHYA 4BY6B 1IB8A 2EBPA 4RTZA 2NUTB 5GAOl 3M53A 1ADJA 5GAN8 1ASYA 4J9EA 5LJ5f 5CQYA 1YFNA 3TEGA 5DLQE 2OTJT 3PFSA 3JB9H 1N6AA 4GBQA 1J5WA 1AWWA 4XAXB 2K2VA 4DOVA 3CCQA 3EFOA 4CS2A 2H8HA 3KBGA 2QEXA 3QDFA 3OMCA 4OP0A 4XTYA 4HCZA 2FPFA 1UJ0A 2B86A 3VUZA 5GANh 1IHWA 2KRMA 2BTTA 3H9NA 3V8LA 4E51A 1K8AC 2E6ZA 4MDXA 2EQJA 4YCVA 3CC7T 3M58A 2LTOA 3OS1A 4BDYA 4WJ4A 3BE3A 2CZ6B 2VKNA 2QI2A 2R5AA 1JJCB 1UGPB 2X4YA 3BDUA 3HRKA 2VVKA 4MDWA 1BI2A 2VXEA 2LJ1A 4HCCA 4YRQA 3I5RA 1U1TA 2BZ8A 2C0IA 4KBMB 5I22A 2ROLA 3QBYA 3HRTA 2KNBB 1YNZA 4HWRA 3M56A 2HSEB 3M5AA 5IN1A 2ARUA 1O75A 1QVGS 4VUBA 2K3BA 2ZNJA 1ZBJA 1G83A 2OJ2A 3VRZA 4YCWA 2DL4A 2Y90A 1RI0A 1EFWA 2EJ9A 5IHNA 2R5MA 3PGGA 3PNWC 1RAHB 3L4GB 3UA6A 2RQVA 2EL9A 2PU9B 1U1SA 2EFIA 2IY5A 2VC8A 4ELZC 1QVFP 3TU4K 2E5AA 3OYEA 2RQRA 4G85A 2AKWB 1PNJA 2MMPA 3CCUQ 3X28B 3WVDB 1CKBA 4E7IA 4C5EA 3HFNA 2KT8A 3HTRA 4H2VA 4XEMA 4DPGA 4HA8A 1ZA2B 4BI4A 3VUBA 1P92A 4A4EA 1WJRA 1BI3A 4M7DC 1PC0A 1ZHIA 1PYSA 1R0CB 2WSCE 3IQLA 1QVGA 4PHCA 3PVLA 4BI8B 1DJ7B 2GTOA 2KBTA 5FRNA 2V1QA 1M2OA 3M9QA 1XNIA 1AWJA 3OYKA 1TSFA 2HBPA 3QSUA 1K9MU 4BD3A 3GLXA 1OU9A 4J9FA 2LJ3A 4YRMA 4MMKA 3HY1A 4C8QE 1NJIR 2X4XA 4HWTA 3EFOB 2EYXA 2A7YA 2QHSA 1U3OA 1OX9A 3CCRQ 1X6BA 2O9SA 4N4GA 5FRMA 4YRIA 2K79A 3HXWA 3A8OB 3H41A 1VQ8T 2DJZA 1NYRA 3REUA 1V29B 2QK0A 4F17A 2DXCA 2KGTA 2P4TA 3G7ZA 4RUGA 5GAMf 1UUEA 4PFPA 4WJ3M 2HKNA 3HRIA 3IKLA 4YRTA 4M7DB 2DU7A 1KIKA 3NHNA 5GAOp 1TUCA 2DL8A 1E24A 1UHCA 3PE0A 4LN2A 5CQXA 4OB2B 4EO4A 4EDUA 2DXBA 2K2MA 3VQWA 3F70A 3VYGA 3I56Q 4TTVA 3L2RA 2CJAA 2C7IA 3EG3A 1QW1A 1Y71A 3GPLA 4H2SA 5GMKe 2P0KA 1M1KU 1VQ7A 2K5FA 1WLEA 3RL6A 2BUDA 4DEYA 2X9HA 1QVPA 2G4CA 4ORZA 2D0QB 2ED0A 4OB0B 4N4IA 2BZYA 2Q7GA 3JCMQ 1JEGA 4D8KA 3UFGA 3QO3A 4EIKA 4CH6A 5CVIA 1LOJA 1NJ5A 4M75G 3RF1A 1NEBA 1UGSB 3RMQA 2JM9A 3M4QA 1KJWA 3L2QA 3HKSA 5GANf 1VQNT 1QKWA 2FL7A 1RAEB 4M7AG 2L8DA 2EW3A 4A4KA 4DOWA 4YRJA 4LDVA 3FEOA 1PD1A 2CYZB 3HL8A 3VS7A 2D6FA 3JAME 4AFQC 3OS2A 4J9CA 1VOMA 1NYGA 2VV5A 1TUGB 5LJ5j 4PLIA 1ZUUA 3PT9A 1X2QA 2A3LA 2CS7A 1M2VA 4J5YA 1SF9A 2PQWA 1KOGA 2EKOA 2J05A 2ZT5A 4YPFA 2JN0A 1K4US 3PCOA 3D7SB 3OBWA 1HTTA 1H3HA 3TUPA 3H0FA 4C92D 3JB9I 1PYSB 4OLFA 4TVYA 2EQUA 2ZZFA 5DM7R 5L8RE 4PNOA 4GY5A 3VS0A 4J9BA 3E9IA 3CCQQ 1C0MA 4JUVA 3ULRB 2EQKA 2QEXQ 3OYYA 3NTHA 3JB9J 2PMEA 4FL6A 1QKXA 5C6SA 3CCVT 1I07A 1WXTA 4M78D 3E9GA 2NUZA 3WXMB 1YHQA 3M4GA 4X9DA 3CCET 5CO7A 3E9HA 2YWWA 1B70A 4IUQA 3OBYA 1K9MC 1VQKA 4MZTA 2PVGB 4QT7A 4K88A 4ZN1A 1KG1A 4UP7A 1IL2A 4J6WA 2EYZA 2VGMA 4PJNA 2Z0WA 4LDUA 2CSQA 1X69A 2AIRB 3FDRA 4OMPA 4HVVA 3OYJA 2NS6A 5IXBA 4XTWA 3M0UA 3OQ5A 2XGTA 3I7FA 5ELOA 3OY9A 3QYGB 3JCMJ 2OAUA 3CCMA 2RK1A 2QDYB 3L2VA 2RI2A 3GNFB 4PKCC 3I55T 2P5IA 3CXCA 4EMHA 2QHTA 3CMET 1UFFA 3G4SA 1SRLA 1AZEA 4GLMA 1I5LA 2DETA 2QAZA 4ESRA 1YIJA 3SDZA 3AHUA 5FU6C 4CS3A 1SHFA 2DTIA 2RI5A 2IG0A 2CZ7B 3EG9A 1K1ZA 2IIMA 3CCEA 1VQMT 2ECZA 1JJ2A 3QZ9B 2Q7EA 1VQOT 3EGDB 1M1KC 3LGFA 2LT1A 3JB9D 1FX7A 1ZSGA 1G5VA 4H2UA 2XHCA 3ME9A 2D8HA 2Q7HA 4PJOF 1PM3A 1G8XA 2ZT7A 1VQLT 2EPDA 5I2MA 4YRCA 1VQPT 4M77D 4O6JA 1GCQC 4JS4A 2DQ0A 1K0SA 1UGRB 2SRCA 2F5KA 1NJ6A 3I55A 1PD0A 3NPFA 4LVMA 2L2PA 3X24B 3CMEA 1UJYA 5LJ3d 2RJCA 2ZAEA 3C95A 4P73C 2QYZA 4RDXA 1I1JA 3V8JA 4CC4B 3LSQA 4KGVB 4P3NA 1KSWA 1IGQA 5GJWB 2ZTGA 4M7DE 2CP5A 3VRYA 2SEMA 5FU6B 1PRLC 2QQSA 2DU5A 1OQKA 4TWAA 3JCMg 5FWCA 1VQOA 2D1XA 3MEYA 1USYA 3HXXA 5LJ3e 3S3NA 4R0KA 2L5QA 2QTXA 1NPRA 3INZA 4KRTA 3QKJA 4OMQA 4AT1B 4C92A 4F7UG 1EZZB 1VQPA 2GQVA 3I35A 3JCMb 4OMLA 2NLUA 3QG1A 4OVAA 4YYEA 2LNVA 2ZGWA 3NEMA 2MWPA 3EFSA 3G1ZA 2CP6A 3BFMA 4M78A 1YJNA 3M0TA 2DDZA 4OB3B 3JRZA 5GAMj 2IPOB 1LYLA 4TVRA 4RQFA 4II1A 2O4XB 2DL3A 2VB6A 3META 3G71T 5DY9A 2DZ9A 1E6GA 3QJYA 2DBMA 3CC2T 2COYA 2JTMA 8AT1B 3EGUA 4CC2A 1KQSP 3J81E 4ZTZB 2XKOC 3H6ZA 3SD4A 4C8QF 2I4LA 2D9TA 2ZCFB 2BIVA 4IUVA 2PNIA 5KYXB 2XDDA 3P8VA 2M02A 1K8AU 2ATCB 4P71C 4KH0B 4QVZA 3HFZB 1VQ7Q 2QHUA 4J7IA 1Y07A 2BE7D 4FYXB 3CPWA 2CP3A 4NOYA 1W2BA 1X43A 2CH4W 3OYBA 2XG8D 2QQBA 4Q15A 3UATA 5GANj 4RTVA 4N0AA 2R57A 3S3MA 1YFSA 1WGSA 4QKUA 3V7SA 2VYTA 1WFWA 1LPLA 1TU0B 3E1SA 2COWA 1KMNA 3A98A 1BU1A 2QXFA 3G71A 3BW1A 3TEHA 4FSSA 3MPUB 1YP5A 2NUPB 4KR3A 2CZ0B 4UC4A 1MMAA 2GGRA 3EGXB 1K9MR 4LVJA 2RHQA 4M77A 2G3RA 1AHJB 1SRMA 1AD5A 5GAOr 4B9XA 1M27C 1ZLMA 4KT0E 3BDLA 1NZ9A 3QXEB 4PJMA 4J7FA 2JZ2A 2EJFA 2ALYB 1QQJA 2HSPA 5C52B 5KYUB 3QNEA 1WHKA 3CCST 3X25B 4X5OA 1ABOA 1NPPA 1B07A 2WSFE 1UECA 1WHMA 2GFAA 5GMKm 1M9SA 4CH3A 1RAAB 1NJ8A 4C0FA 3VS6A 3CMAT 1B76A 3A7AA 2GFUA 1K73U 4P75A 1QLYA 1G5HA 3CC4T 3N5BB 3C0CA 2I4OA 3S3OA 4MZPA 2L0AA 1EIFA 2ZPIB 4LD6A 1YHQQ 5C53B 1M1KR 2F2XA 1C1AA 1VQKQ 1QVFS 3QWXX 2A08A 4M78B 4RG8A 4RCCA 1BIBA 1GFCA 3X20B 4LDYA 3FB9A 1YJ9T 2RNAA 3HHTB 1ZUKA 2A36A 1VQ4A 3LLRA 1Y96A 2P4RA 3FJ5A 3MHXA 3VS5A 1U5SA 1UGVA 3FIFA 2DMOA 3CCMQ 2FPDA 2RJEA 3QO7A 2H3JA 1WQWA 3QHSA 4MZMA 1VQ6T 5CR2A 2CDTA 5KH6A 2EWNA 4AFUC 2QA4T 3G4SQ 4F04B 4ZNXA 4FIBA 1YIJQ 4TQDA 5LJ3h 2DLPA 1BKBA 4C5GA 1UHFA 4YRNA 4P74A 3CCEQ 3EAEA 3QDRB 1WIEA 3MP6A 2EGAA 1ZQ1A 2MK5A 2K9GA 1M3CA 2K57A 5KCOA 2YT6A 1UDLA 2E10A 3P8DA 2FO0A 2K3XA 1WU7A 4AFZC 1BIAA 5KYYA 2XIDA 2DXTA 3SHWA 4A54A 1AEYA 2NWMA 4WCIA 2XU8A 2ZPHB 4FW2A 5KNNA 1XQHA 4IIMA 1E1OA 2OTJA 3PTAA 4M75C 5AYFA 4D6WA 4JRIA 3VYHB 3I55Q 1N8RC 3OYCA 3VS3A 3CQTA 4PJOE 1NYFA 4HWOA 4RCBA 3CMEQ 3QO8A 1PKTA 4X9CA 4M7AC 4DBRA 3OYMA 2FG0A 3NTIA 2A28A 5K1XA 1RAIB 1KFZA 1Y7XA 2ABLA 3QZ5B 2I0NA 4C92G 4D8DA 1ZA1B 5D6WA 4GLKA 3C12A 1G51A 1WJSA 5FROA 3RKYA 1VQOQ 1Q7YC 4E7HA 1Q86C 2ZCEA 1UB4A 2FPEA 5EC7A 3CC7A 1Q82U 2DTHA 2J6OA 2QHVA 2RK2A 2MIOA 5HGQA 1X75C 5KE2A 1M5Q1 4M78G 3NTKA 2RMOA 1VQPQ 1EVKA 3DB4A 2ARSA 2DQ3A 1I4K1 4IIOA 3UGQA 2QTVA 1JO8A 3TQ7P 5LJ5g 2VWFA 4YREA 4M7DF 4BE1A 1YJNQ 1K73C 4J9DA 2ARTA 3VBBA 1KQ1A 1OPLA 2H3EB 4PJJA 2CH4A 4M75B 3IG2A 5ELNA 5C0MA 3NENA 1S72T 4CS4A 1N5ZA 1B7YA 3CD6T 3PMIA 4M7AB 2XDBA 3UF4A 3ERRA 4KULA 3ZBDA 2RHUA 4RQEA 2CSIA 2HQHA 1VQ5T 1IGUA 2D0NA 1E7OA 1V76A 2AHJB 2QGFB 1OPKA 4OGEA 3V8KA 4ZGEB 2HMAA 3TCJA 1IXDA 4RMOA 3L42A 3J7AF 2V1RA 1VUBA 2LRQA 3QO5A 1ACMB 4YROA 2W0ZA 2KY9A 3JB9G 2ZNIA 1FXXA 3IALA 3LSSA 2FZKB 3MQZA 3EHQA 2BKDN 4F7UA 4O2DA 2RQUA 4EMKA 2YXYA 2XICA 3QTCA 1EIYA 1T0JA 4M77G 1VQ9T 1YITT 2KR3A 2EIFA 5CCAA 3G71Q 3A8MB 3EH1A 4BI3A 1HYOA 2J06A 1NBEB 1MMNA 2DIQA 3M0PA 3M0SA 2YRDA 2YUOA 1FYNA 3OYIA 4PJOD 3M54A 3SEMA 2HCKA 4AMCA 4RMFA 2KRNA 2K4YA 2M9UA 2G6FX 3G6ET 5E3IA 1GL5A 5ECAA 1H92A 4QQGA 5J3BA 5CAIA 2P0PA 4NCXA 2DBKA 2PZ1A 2CP2A 5J39A 1GGMA 5IHKA 4YRGA 1W70A 4UP8A 4LUDA 1X2GA 2LZ6B 3DB3A 3W3SA 3CCJT 2QGGA 3ZFJA 2AK5A 4FCYA 2KMTA 3OW2S 4J8OA 1YI2T 4DEXA 4X1VA 2JT4A 5HY6A 4OMNA 1VQ8A 5LJ3f 3VV0A 4HT8A 2ZPGB 1KHIA 1M8MA 1AT1B 1QP2A 3OYLA 4DBFA 2BE9B 3URGA 4P3PA 1OULA 1UEBA 2KSSA 4QQ6A 4WI1A 1HK9A 1Q82C 1M90U 2IY5B 1K8AR 1UE9A 1N9WA 3HRSA 3RIRA 5I2SA 2C0OA 4JDSA 1JBMA 1MV3A 4YP0A 2HZYA 4K11A 1RLPC 2DAQA 5D6XA 3VS2A 1M1GA 1RAFB 1B7TA 1WJQA 1G5IA 2EAYA 4YTLA 1IHVA 4E7ZA 5IHIA 2CZ1B 2ROTA 3ZEHA 1VQ4Q 3A5ZA 4RKUE 5GMKj 2OTLT 4C8QD 1Q81U 3X26B 2HQEA 1YBYA 3C4SA 3QIIA 2DVEA 3DLMA 3OYNA 1VQNA 1RIQA 3OW2A 3SWNA 2QASA 2DD5A 2ZT8A 3UWNA 5KCHA 1YWOA 1PHTA 4XU2A 2DZCA 5CK9A 2DRMA 2J7IA 1I0CA 1T0HA 5GAMg 3A7UA 1MNEA 3I9QA 1GBRA 2GNCA 3M4YA 4FYVB 4AH6A 2QQ9A 4ZTJA 2AMCA 1AZGB 4F7UB 3A31A 1NJ2A 1WXUA 1O9SA 4H2YA 2DPPB 1C0AA 4E47A 4Y28E 1VIEA 3ZL7C 3PIPA 2Q5IA 1JRIA 4ZIBA 5FU7C 2CREA 2OI3A 4RTYA 4PJOA 4JPBW 2OTJQ 2P0LA 1NLPC 2ZR3A 3NFCA 1K0XA 2X51A 1MGQA 3P8HA 4XTZA 1BCMA 1X6GA 1NEGA 1TOVA 1G3TA 3PMTA 3MKDA 5GANg 3CCVA 1B8AA 1H641 2LCCA 2RH2A 1X2HA 2XK0A 3LGLA 2V26A 3UPUA 4ELYC 1BBUA 2WACA 1PSEA 2FRYA 4UPAA 1RL2A 3RDVA 3CC7Q 5HKCA 3DLLA 4R55A 1NM7A 4JZ4A 2ZPFB 2RF0A 4JJDA 3FLGA 2DL7A 1E22A 2WSEE 4DBHA 1KK7A 2E3IA 4BDZA 1M4ZA 3L2UA 1K9AA 4J9IA 1D3BA 4XTVA 5FU7B 1KC8C 5F5WA 2K5LA 3KFUA 4CH5A 2X3WD 2LVMA 1M90C 1YFTA 3UDCA 2JNGA 4A4GA 5HK0A 1PWTA 1SG5A 2JTFA 3VU3C 4PK4A 3CCUT 1VQMA 3VS4A 1WXBA 1M2VB 3CXCP 2FVUA 2Y4XA 3Q1JA 3KUFA 3CCLT 4AG2C 2O2OA 1B34A 2CP7A 5GAN6 2L3QA 4LE9A 3PCOB 4OF1A 2E3CA 4C8QA 1SETA 4ZGDB 1VQLA 2HNIA 3M0QA 2E12A 3OYHA 1L0WA 1Q81C 1JJ2P 5GAN2 3FRNA 1SSFA 4WTOB 4HWPA 3MP8A 4TVAA 1QWEA 4YDQA 1X54A 1QF6A 3NMZC 1MUZA 2E3HA 4JRQA 1CKAA 4A4FA 4BW9A 1JB0E 1B70B 4XEOA 4LVKA 4P72A 4LVIA 3A8LB 4BE2A 5IAYA 3V7CA 1M30A 1RI9A 1SEMA 1F1BB 3RKWA 3OS5A 1AOJA 4C0DC 2FHDA 3CCRT 1KD1U 2LJ0A 1H3ZA 2NUTA 3CCLA 2OX7A 3EG2A 2LX7A 4YCUA 5FW9A 2DRKA 2F5TX 2P84A 2KVQG 1W66A 3TEEA 2PVDB 2FZGB 1ZSZA 4ZTFA 1Q95G 4FW1A 3P8YA 2CT4A 4NL3A 1TWBA 2CJ9A 1D0XA 1M3AA 2ZR2A 3JCMd 1NE8A 4CC3A 1HJDA 3T9NA 5LJ3j 3E9FA 1X6OA 4DBQA 4X34A 2DYBA 1R77A 5K1PA 1IZ6A 4RG2A 3RACA 3I5SA 3I56T 3EG9B 2K5IA 4LNSA 1VQ8Q 1USYC 2YLBA 4EX5A 4E7SA 4R56A 2FRWA 1N8RU 4C92C 3CC2A 2PVOB 2EQMA 1MMDA 2W10A 4H2XA 2C0TA 3JCMe 2VASA 2LX9A 5KYNA 1ASZA 4FM4B 1TUDA 2AZVA 5IH2A 2KT1A 4H2TA 1I81A 2RHSA 2RHIA 2GTJA 2F2WA 5GAN4 1OOTA 2YLCA 3RGLA 1JJCA 4C5IA 4C0DB 1EQRA 4M78C 5CKEA 2V8JA 4M7DD 3REAB 1Z7NA 4PL6A 3GBQA 2DL5A 1Q7YU 1Q86U 1FMWA 2DNUA 4ANJA 4QVDA 1QP3A 3H8ZA 4DA4A 1WNLA 2FZCB 2MCNA 1QE0A 2A8EA 4ZGJB 2KXDA 1NJ1A 1X56A 1RABB 2E70A 4RTXA 4HT9A 2YRVA 2DJQA 2E5KA 3GP8A 2AT1B 2E64A 9ATCB 3M4PA 1WHJA 3GF5A 3MJXA 2RO0A 6AT1B 2MAMA 3KFVA 1VQNQ 5GAOm 1B34B 1OU8A 1YCYA 3L4GA 1C6VX 1W4SA 2FYKA 3CPWP 2DKGA 1W2BP 4C92B 2MWOA 2CP0A 4OMMA 2O31A 3HXVA 4YRRA 2ZT6A 4XQ3A 4EPCA 3JCMV 4Y92A 3L2ZA 2ZXFA 1LJOA 1RADB 1JXMA 2DILA 4N0AC 4YRPA 5L23A 1Y0MA 1HD3A 1MV0B 1QCFA 4L59A 4PJOG 3CCQT 1GRIA 3TVTA 5CKHA 3MEWA 4YRKA 2QEXT 3EHRA 3RMSA 4YRSA 2EYWA 1A0NB 4B6MA 3RNJA 3CCSA 1JQQA 2J6KA 3RERA 1OZ3A 5I21A 2JUFA 2M1HA 1KHCA 1YCSB 1FMVA 5GMKl 1W6XA 3E19A 5GAMh 4M77C 2CJBA 4XTUA 4P5NA 1M90R 1ZBXA 4Z02A 3CMAA 3R6OA 3HFOA 3IKMB 1D0ZA 2DD4A 3FJPA 1YB3A 1KD1C 3CC4A 2RQTA 3JCMP 5A0LA 4PG3A 4LVLA 3CCVQ 1ZSZB 4Z89A 2EJGA 4LXCA 2RPNA 4QQDA 4J9HA 1WQ7A 5CKBA 4G84A 4IKFA 1BBWA 2JXBA 4F14A 4QW2A 4M75F 3RUXA 4HXJA 4Q6GA 1YJ9A 2DX1A 1Q81R 2LCLA 1ADYA 1NYQA 2MI6A 1QVFA 4P75C 4M7AF 4XU0A 4JJBA 1YGBA 3TEHB 3O8VA 3TSZA 4H2XB 1WZOA 4PLLA 1IO6A 2DXUA 3G1JA 3HSBA 1VQ6A 2KE9A 2RHSB 3HFVA 5KE3A 2RHQB 1PG5B 4M77B 2CGHA 4JLGA 2RA2A 4RTTA 2QA4A 1OZ2A 3LC0A 1CSKA 4M7DA 4F16A 2YHTA 1IREB 4N4HA 5I11A 4C8QG 2ZPEB 3CBMA 2VGNA 3REXA 2ZIOA 2EKHA 1VQMQ 2L3PA 2LCSA 1PKSA 1SERA 4FYWB 3EG1A 2J3LA 3ASKA 3REBB 1WX6A 3VQVA 1G2BA 2XI9A 4E2FB 4L87A 4C0ZA 1VQLQ 1VIFA 1GXIE 1M3BA 4CRIA 2K3YA 2QG9B 3BY7A 4TQFA 3MEUA 2KDSA 4P74C 3OYFA 5HCKA 2KK4A 4IUPA 2CT3A 3V7RA 3JCMh 4CC7A 3WQZA 2E41A 1SPKA 2GF7A 4FT4A 12ASA 1U06A 4JJNK 4XU1A 4JRPA 3EFRA 1WHLA 2QDLA 5FWBA 2ZPBB 2M0YA 3L1AA 4A63B 2RHXA 3UGTA 2QQRA 1J3TA 2KQWA 2LQWA 3QJ6A 2PMFA 11ASA 2E65A 3CCLQ 2NYSA 1G3WA 3DSQA 1Y96B 2JTEA 2ZZDA 2JOYA 3GOXA 3QUIA 1QCOA 1V1CA 2YDLA 2V8IA 4E7JA 2XTIA 4ZTUB 4BACA 2DO3A 1FWZA 3LWHA 4H2WA 1BK2A 4K86A 3OYGA 5KYWA 2LC4A 1EX4A 1E1TA 1QCNA 2J6FA 3OSSC 1D1CA 1GBQA 1TS9A 1VYVA 1S72A 4IUUA 4LUEA 3CD6A 4C92E 1VQ7T 2ODRD 3CC2Q 2EYYA 3RKXA 4J9GA 5KYYB 2ZZGA 1G3YA 1VQ5A 5LJ5d 3M57A 2RN8A 4PFZA 2O88A 4HWSA 1WDXA 2FB7A 1ZX6A 4AFSC 1TH7A 4UP9A 3LYIA 3M0RA 1WI7A 4M78E 5M9OA 1N9RA 2J3MA 2LQNA 1FYFA 5EG2A 3L2WA 1MNDA 4L6V5 5J26A 3U23A 2CKKA 4LDWA 5GAN7 1R0BG 3A32A 1OI1A 3PVQA 1QVGP 5LJ5e 2HAXA 2EYQA 1D1BA 2M51A 1YN8A 4PJLA 3A5YA 2EGCA 2P0QA 2VUBA 2LNHB 1RLQC 3TSWA 3A7RA 2V8KA 3LW5E 1VQ9A 1YITA 5D6YA 5GMKi 1KD1R 1E6HA 2JW4A 2O9VA 2XD0A 1KC8U 4F7UF 4BWAA 1WLPB 2I2LA 3EGDA 3A8GB 4TVWA 3R07A 1H4SA 3S6WA 2DEUA 4V2SA 2IVWA 5AT1B 1ABQA 4JRKA 4J83A 3HRUA 3RBBB 3G6EA 4YRFA 2E6NA 4E6RA 2FEIA 1LVKA 4J6YA 4EMKC 3LWIA 1Z9QA 3JCMX 1MHNA 2MPXC 1SESA 3HXYA 4QVCA 2CUBA 1X27A 2O01E 2DEQA 1T3LA 3HY0A 3CMQA 3EH2A 3CCJA 2I4MA 2K7AA 5IT9E 2B8AA 3CCSQ 4JLIA 2GQIA 1YHQT 2YUNA 1B7YB 1YJWT 1G3SA 1N8RR 3A1PA 5GAOq 1YI2A 1VQKT 1XTDA 3O5ZA 4M77E 2KI7A 1TTHB 2HEQA 3CEYA 2CUDA 1UG1A 2PTKA 3JV3A 4CH4A 3HXZA 2RJDA 5GAN3 3CMAQ 4A4HA 1NNHA 2RI3A 4IUTA 3CXCS 4L5GA 3CC4Q 5CKFA 5LL6S 1W1FA 3VJPA 4LNPA 1KMMA 4BB7A 1Q7YR 1Q86R 3VKIA 3CCMT 2DERA 3DKMA 2LQ8A 2MF2A 2KROA 3MF2A 2CIMA 1JXOA 1OV3A 3ER0A 4Q5WA 1JJ2S 3SB2A 3G4ST 3EG0A 4C0GA 2LP5A 5KYWB 3GIBA 1BYMA 2M16A 1YIJT 4EMKB 2RB6A 3OD1A 1GCQA 1OYXA 3VQXA 3JCMf 1EIYB 1YJ9Q 3MP1A 4HKEA 3NETA 4O5VA 4J15A 1M1FA 1JU5C 4HVWA 1HC7A 2ENMA 2JJ9A 4KH1B 4NL2A 1YJWA 4M7DG 1ATIA 2O4XA 1M8VA 2OTLA 3JCMc 4RTWA 4JS5A 4M75E 1K73R 2Q5HA 2X4JA 4P73A 3OS0A 5A0DA 1BB9A 1VQ6Q 2K6DA 4M7AE 2HBWA 1KQSS 1QWFA 5LJ3g 1D0YA 2QA4Q 3JCMW 1RAGB 4ATOA 1ZUYA 1QMCA 4FYYB 4KGXB 4FT2A 2DE0X 4Y91A 4Z88A 1UTIA 3LX7A 4C5HA 1WPYA 1OEBA 5KYXA 5GAOn 2DVJA 2DYIA 3HFZA 2GCXA 4H02A 3MEAA 3OW2P 2F69A 1D1AA 1AVZC 4CI0C 2EVRA 4LDXA 2JVVA 3C94A 3P8TA 3J80E 3SWNC 4YRLA 4HVUA 1TXQA 5GAMd 4FU6A 3A8HB 2D8JA 1S1NA 3LH0A
chains in the Genus database with same CATH topology
3MEVA 1EOVA 4KR2A 3NELA 3CBOA 4ZN3A 2RD1A 3KXTA 4E7KA 2C8MA 3MCAB 5GAMe 3HXUA 1I8FA 3TREA 4ME7A 2XDPA 1KQSA 3WVEB 4BE0A 2ODRC 1NJIU 1YJNT 2ALYA 4PJOC 2DK3A 2LT4A 5LJ5h 2C06A 3OYDA 3A5ZB 4P71A 4MMLA 5A0GA 5GANd 2E1HA 1EVLA 5A2QE 3P8BB 5GAN5 1WYDA 1UGQB 5GMKh 3FC3A 3SWNB 1HXDA 1LNXA 3OYAA 5FLXE 1BI1A 4NS5A 2PUKB 3CPWS 1W2BS 5GANe 4DQ2A 3A74A 4M75D 1N27A 3OMGA 4XTXA 4A53A 2HQXA 2AMCB 3CCUA 4HCBA 3PIOA 4M7AD 2LQKA 5CKDA 4WF2A 3SFMA 3PZCA 2ZIMA 3CBPA 4PJOB 3MF1A 2DIGA 3OSVA 1X01A 1H4QA 3QYHB 2VXFA 4K87A 1BI0A 4C92F 1Z7MA 1X55A 2LDMA 1H4VB 2E5QA 2ZINA 2HD0A 2I4NA 3GNGA 1N9SA 3HPWA 2Y4YA 4C8QC 4M78F 2M0OA 4LD9K 3OB9A 3CCRA 2L3RA 3M59A 3VQYA 4OGCA 1SRYA 3OA6A 2RJFA 4F7UE 3BJUA 2RM4A 1H4TA 1XOVA 4B9WA 1D3BB 3UT1A 4BUGA 4P72C 3QPHA 4XU3A 5DLOA 3JSCA 4OB1B 3UH0A 4KUIA 2KAFA 5HK3A 4EMGA 4IURA 4HT4A 4BY6C 3MO8A 4KUDK 3I56A 2QQAA 4E7LA 2L89A 2ZZEA 4HVCA 3ICAA 2RHZA 4OMFB 4XK8E 1U8RA 4P3OA 4J6XA 2X35A 3HP9A 1NJIC 4C8QB 3HTZA 1VQ4T 3M55A 3JB9F 1R8OB 2X4WA 4KQEA 1PSFA 2DTOA 4FSXA 1KQ2A 2R58A 3CPFA 2AKWA 5C51B 4TVAB 1VQZA 4M77F 3RESA 5CIUA 4M75A 2PUOB 1YFRA 4M7AA 2RHYA 4BY6B 5GAOl 3M53A 1ADJA 5GAN8 1ASYA 5LJ5f 5CQYA 3TEGA 5DLQE 2OTJT 3PFSA 3JB9H 1N6AA 1J5WA 4XAXB 2K2VA 4DOVA 3CCQA 4CS2A 3KBGA 2QEXA 3OMCA 4OP0A 4XTYA 4HCZA 3VUZA 5GANh 4E51A 3V8LA 1K8AC 2E6ZA 4MDXA 2EQJA 4YCVA 3CC7T 3M58A 2LTOA 3OS1A 4BDYA 4WJ4A 2CZ6B 2QI2A 2R5AA 1JJCB 1UGPB 2X4YA 3BDUA 3HRKA 4MDWA 1BI2A 2VXEA 4HCCA 4YRQA 1U1TA 4KBMB 3QBYA 3HRTA 4HWRA 3M56A 3M5AA 5IN1A 2ARUA 1O75A 1QVGS 4VUBA 2ZNJA 4YCWA 2Y90A 1RI0A 1EFWA 2EJ9A 2R5MA 3PGGA 3PNWC 3L4GB 2EL9A 2PU9B 1U1SA 2EFIA 2IY5A 2VC8A 4ELZC 3TU4K 2E5AA 3OYEA 4G85A 2AKWB 2MMPA 3X28B 3WVDB 4E7IA 4C5EA 3HFNA 4H2VA 4XEMA 4DPGA 4HA8A 4BI4A 3VUBA 1P92A 4A4EA 1WJRA 1BI3A 4M7DC 1ZHIA 1PYSA 2WSCE 1QVGA 4PHCA 4BI8B 1DJ7B 5FRNA 3M9QA 1XNIA 3OYKA 2HBPA 3QSUA 1K9MU 4BD3A 3GLXA 4YRMA 4MMKA 3HY1A 4C8QE 2X4XA 4HWTA 2A7YA 2QHSA 4N4GA 5FRMA 4YRIA 3HXWA 3A8OB 1VQ8T 2DJZA 1NYRA 3REUA 1V29B 2DXCA 2P4TA 3G7ZA 5GAMf 4WJ3M 3HRIA 3IKLA 4YRTA 4M7DB 2DU7A 5GAOp 1E24A 5CQXA 4OB2B 4EO4A 4EDUA 2DXBA 3VQWA 3F70A 3VYGA 4TTVA 3L2RA 2CJAA 2C7IA 1QW1A 1Y71A 3GPLA 4H2SA 5GMKe 2P0KA 1M1KU 1VQ7A 2K5FA 1WLEA 3RL6A 2BUDA 1QVPA 2G4CA 2D0QB 4OB0B 4N4IA 2Q7GA 3JCMQ 3UFGA 3QO3A 4CH6A 5CVIA 1LOJA 1NJ5A 4M75G 3RF1A 1UGSB 3RMQA 3M4QA 3L2QA 3HKSA 5GANf 1VQNT 2FL7A 4M7AG 2L8DA 4A4KA 4DOWA 4YRJA 4LDVA 3FEOA 2CYZB 3HL8A 2D6FA 3JAME 3OS2A 2VV5A 5LJ5j 4PLIA 3PT9A 2A3LA 2CS7A 4J5YA 2PQWA 1KOGA 2EKOA 2ZT5A 4YPFA 2JN0A 3PCOA 3OBWA 1HTTA 3TUPA 4C92D 3JB9I 1PYSB 4OLFA 4TVYA 2EQUA 2ZZFA 5DM7R 5L8RE 4PNOA 4GY5A 3E9IA 4JUVA 2EQKA 3OYYA 3NTHA 3JB9J 2PMEA 4FL6A 5C6SA 3CCVT 4M78D 3E9GA 3WXMB 1YHQA 3M4GA 4X9DA 3CCET 5CO7A 3E9HA 1B70A 4IUQA 3OBYA 1K9MC 1VQKA 4MZTA 2PVGB 4K88A 4ZN1A 1KG1A 4UP7A 1IL2A 4J6WA 2VGMA 4LDUA 3FDRA 3OYJA 2NS6A 4XTWA 3OQ5A 2XGTA 3I7FA 5ELOA 3OY9A 3QYGB 3JCMJ 2OAUA 3CCMA 2RK1A 2QDYB 3L2VA 2RI2A 3GNFB 4PKCC 3I55T 2P5IA 3CXCA 4EMHA 2QHTA 3CMET 3G4SA 1I5LA 1YIJA 3AHUA 3SDZA 5FU6C 4CS3A 2DTIA 2RI5A 2IG0A 2CZ7B 3CCEA 1VQMT 1JJ2A 3QZ9B 2Q7EA 1VQOT 1M1KC 3LGFA 2LT1A 3JB9D 1FX7A 1G5VA 4H2UA 2XHCA 3ME9A 2Q7HA 4PJOF 2ZT7A 1VQLT 5I2MA 4YRCA 1VQPT 4M77D 4O6JA 2DQ0A 4JS4A 1UGRB 2F5KA 1NJ6A 3I55A 4LVMA 3X24B 3CMEA 5LJ3d 2RJCA 3C95A 4P73C 4RDXA 3V8JA 4P3NA 3LSQA 2ZTGA 4M7DE 5FU6B 2QQSA 2DU5A 4TWAA 3JCMg 1VQOA 3MEYA 1USYA 3HXXA 5LJ3e 3S3NA 4C92A 4F7UG 2L5QA 2QTXA 1NPRA 3INZA 3QKJA 4BW9A 1VQPA 2GQVA 3JCMb 2NLUA 3QG1A 4OVAA 4YYEA 2LNVA 2ZGWA 3NEMA 2MWPA 3EFSA 3G1ZA 3BFMA 4M78A 1YJNA 2DDZA 4OB3B 3JRZA 5GAMj 1LYLA 4RQFA 4TVRA 4II1A 2O4XB 3META 3G71T 5DY9A 2DZ9A 3QJYA 3CC2T 2JTMA 3J81E 4ZTZB 2XKOC 3H6ZA 3SD4A 4C8QF 2I4LA 2D9TA 2ZCFB 2BIVA 4IUVA 3P8VA 2XDDA 1K8AU 4P71C 4QVZA 3HFZB 2QHUA 4J7IA 1Y07A 3CPWA 4NOYA 1W2BA 3OYBA 2XG8D 2QQBA 4Q15A 5GANj 4N0AA 2R57A 3S3MA 1YFSA 1WGSA 3V7SA 2VYTA 3E1SA 1KMNA 2QXFA 3G71A 3BW1A 3TEHA 4KR3A 2CZ0B 4UC4A 4LVJA 2RHQA 4M77A 2G3RA 1AHJB 5GAOr 4B9XA 4KT0E 3BDLA 1NZ9A 3QXEB 4J7FA 2JZ2A 2EJFA 2ALYB 5C52B 3QNEA 3CCST 3X25B 4X5OA 1NPPA 2WSFE 2GFAA 5GMKm 1M9SA 4CH3A 1NJ8A 4C0FA 3CMAT 1B76A 3A7AA 2GFUA 1K73U 4P75A 1G5HA 3CC4T 3N5BB 2I4OA 3S3OA 4MZPA 1EIFA 2ZPIB 4LD6A 5C53B 1QVFS 4M78B 4RG8A 4RCCA 1BIBA 3X20B 4LDYA 3FB9A 1YJ9T 3HHTB 1VQ4A 3LLRA 1Y96A 3MHXA 3FIFA 2RJEA 3QO7A 2H3JA 1WQWA 3QHSA 4MZMA 1VQ6T 5CR2A 5KH6A 2EWNA 2QA4T 4FIBA 4TQDA 5LJ3h 4C5GA 1BKBA 4YRNA 4P74A 3EAEA 3QDRB 3MP6A 1ZQ1A 2K57A 5KCOA 2E10A 3P8DA 2K3XA 1WU7A 1BIAA 2XIDA 2DXTA 4A54A 2XU8A 2ZPHB 5KNNA 1XQHA 1E1OA 2OTJA 3PTAA 4M75C 5AYFA 4D6WA 4JRIA 3VYHB 1N8RC 3OYCA 4PJOE 4HWOA 4RCBA 3QO8A 4X9CA 4M7AC 3OYMA 3NTIA 5K1XA 1Y7XA 3QZ5B 4C92G 5D6WA 4GLKA 3C12A 1G51A 1WJSA 5FROA 3RKYA 1Q7YC 4E7HA 1Q86C 2ZCEA 1UB4A 3CC7A 1Q82U 2QHVA 2DTHA 2RK2A 5HGQA 1X75C 5KE2A 1M5Q1 4M78G 3NTKA 1EVKA 3DB4A 2ARSA 2DQ3A 1I4K1 3UGQA 5LJ5g 4YREA 4M7DF 4BE1A 1K73C 2ARTA 3VBBA 1KQ1A 4M75B 3IG2A 5ELNA 5C0MA 3NENA 1S72T 4CS4A 1B7YA 3CD6T 3PMIA 4M7AB 2XDBA 3ERRA 4KULA 3ZBDA 2RHUA 4RQEA 1VQ5T 2AHJB 4OGEA 3V8KA 4ZGEB 3TCJA 4RMOA 3L42A 3J7AF 1VUBA 2LRQA 3QO5A 4YROA 2KY9A 3JB9G 2ZNIA 1FXXA 3IALA 3LSSA 3MQZA 2BKDN 4F7UA 4O2DA 4EMKA 2XICA 3QTCA 1EIYA 4M77G 1VQ9T 1YITT 2EIFA 5CCAA 3A8MB 4BI3A 2DIQA 3OYIA 4PJOD 3M54A 4RMFA 2K4YA 2M9UA 3G6ET 5E3IA 4QQGA 5J3BA 5CAIA 2P0PA 4NCXA 5J39A 1GGMA 4YRGA 4UP8A 1X2GA 3DB3A 3W3SA 3CCJT 3ZFJA 2KMTA 3OW2S 4J8OA 1YI2T 5HY6A 1VQ8A 5LJ3f 3VV0A 4HT8A 2ZPGB 1KHIA 1QP2A 3OYLA 3URGA 4P3PA 1UEBA 2KSSA 4QQ6A 4WI1A 1HK9A 1Q82C 1M90U 2IY5B 1N9WA 3HRSA 3RIRA 5I2SA 4JDSA 1JBMA 4YP0A 2DAQA 5D6XA 1M1GA 1WJQA 1G5IA 2EAYA 4YTLA 2CZ1B 3ZEHA 3A5ZA 4RKUE 5GMKj 2OTLT 4C8QD 1Q81U 3X26B 2HQEA 1YBYA 3C4SA 3QIIA 2DVEA 3DLMA 3OYNA 1VQNA 1RIQA 3OW2A 3SWNA 2DD5A 2ZT8A 3UWNA 5KCHA 4XU2A 2DZCA 5CK9A 5GAMg 3A7UA 3M4YA 4AH6A 2QQ9A 4ZTJA 2AMCA 4F7UB 3A31A 1NJ2A 4H2YA 1O9SA 2DPPB 1C0AA 4E47A 4Y28E 1VIEA 3PIPA 2Q5IA 1JRIA 4ZIBA 5FU7C 4PJOA 2P0LA 2ZR3A 3NFCA 1MGQA 3P8HA 4XTZA 1G3TA 3PMTA 5GANg 3CCVA 1X2HA 1H641 2LCCA 2RH2A 1B8AA 2XK0A 3LGLA 3UPUA 4ELYC 1BBUA 2WACA 1PSEA 4UPAA 1RL2A 5HKCA 3DLLA 4R55A 2ZPFB 3FLGA 1E22A 2WSEE 4BDZA 1M4ZA 3L2UA 1D3BA 4XTVA 5FU7B 1KC8C 5F5WA 2K5LA 3KFUA 4CH5A 2LVMA 1M90C 1YFTA 3UDCA 2JNGA 4A4GA 5HK0A 2JTFA 3VU3C 3CCUT 1VQMA 2FVUA 2Y4XA 3Q1JA 3KUFA 3CCLT 1B34A 5GAN6 3PCOB 4OF1A 2E3CA 4C8QA 1SETA 4ZGDB 1VQLA 2HNIA 2E12A 3OYHA 1L0WA 1Q81C 5GAN2 3FRNA 1SSFA 4HWPA 3MP8A 4TVAA 4YDQA 1X54A 1QF6A 4JRQA 4A4FA 1JB0E 1B70B 4XEOA 4LVKA 4P72A 4LVIA 3A8LB 4BE2A 5IAYA 3V7CA 3RKWA 3OS5A 4C0DC 2FHDA 3CCRT 1KD1U 1H3ZA 3CCLA 4YCUA 2F5TX 2KVQG 1W66A 3TEEA 2PVDB 4ZTFA 3P8YA 4NL3A 2CJ9A 2ZR2A 3JCMd 1NE8A 3T9NA 5LJ3j 3E9FA 1X6OA 4X34A 5K1PA 1IZ6A 4RG2A 3RACA 3I56T 2K5IA 4LNSA 1USYC 2YLBA 4EX5A 4R56A 1N8RU 4C92C 3CC2A 2PVOB 2EQMA 4H2XA 3JCMe 2LX9A 1ASZA 4FM4B 4H2TA 1I81A 2RHSA 2RHIA 5GAN4 2YLCA 3RGLA 1JJCA 4C5IA 4C0DB 1EQRA 4M78C 5CKEA 2V8JA 4M7DD 1Z7NA 4PL6A 1Q7YU 1Q86U 4QVDA 1QP3A 3H8ZA 4DA4A 1WNLA 1QE0A 2A8EA 4ZGJB 1NJ1A 1X56A 2E70A 4HT9A 2YRVA 3GP8A 2E64A 3M4PA 3GF5A 2RO0A 2MAMA 5GAOm 1B34B 1YCYA 3L4GA 1W4SA 2FYKA 2DKGA 4C92B 2MWOA 4YRRA 3HXVA 2ZT6A 4XQ3A 4EPCA 3JCMV 2ZXFA 3L2ZA 1LJOA 4N0AC 4YRPA 4L59A 4PJOG 3CCQT 5CKHA 3MEWA 4YRKA 2QEXT 3RMSA 4YRSA 3CCSA 3RERA 1OZ3A 5I21A 2JUFA 2M1HA 1KHCA 5GMKl 3E19A 5GAMh 4M77C 2CJBA 4XTUA 4P5NA 1ZBXA 4Z02A 3CMAA 3R6OA 3HFOA 3IKMB 2DD4A 3FJPA 1YB3A 1KD1C 3CC4A 3JCMP 5A0LA 4PG3A 4LVLA 2EJGA 4QQDA 1WQ7A 5CKBA 4G84A 4IKFA 1BBWA 4QW2A 4M75F 3RUXA 4Q6GA 1YJ9A 2LCLA 1ADYA 1NYQA 2MI6A 1QVFA 4P75C 4M7AF 4XU0A 1YGBA 3TEHB 3O8VA 4H2XB 4PLLA 2DXUA 3HSBA 1VQ6A 2RHSB 3HFVA 5KE3A 2RHQB 4M77B 2CGHA 4JLGA 2RA2A 2QA4A 1OZ2A 3LC0A 4M7DA 2YHTA 1IREB 4N4HA 4C8QG 2ZPEB 3CBMA 2VGNA 3REXA 2ZIOA 1SERA 2J3LA 3ASKA 3VQVA 2XI9A 4L87A 4C0ZA 1VIFA 1GXIE 4CRIA 2K3YA 3BY7A 4TQFA 3MEUA 2KDSA 4P74C 3OYFA 2KK4A 4IUPA 3V7RA 3JCMh 3WQZA 2E41A 2GF7A 4FT4A 12ASA 4JJNK 4XU1A 4JRPA 3EFRA 2ZPBB 3L1AA 2RHXA 3UGTA 2QQRA 2KQWA 3QJ6A 2PMFA 11ASA 2E65A 1G3WA 3DSQA 1Y96B 2ZZDA 2JOYA 3GOXA 3QUIA 2V8IA 4E7JA 2XTIA 4ZTUB 4BACA 2DO3A 1FWZA 3LWHA 4H2WA 4K86A 3OYGA 2LC4A 1E1TA 3OSSC 1S72A 4IUUA 3CD6A 4C92E 1VQ7T 2ODRD 3RKXA 2ZZGA 1G3YA 1VQ5A 5LJ5d 3M57A 4HWSA 2FB7A 1TH7A 4UP9A 3LYIA 4M78E 5M9OA 1N9RA 2J3MA 1FYFA 5EG2A 3L2WA 4L6V5 5J26A 2CKKA 4LDWA 5GAN7 3A32A 1OI1A 5LJ5e 2HAXA 2EYQA 3A5YA 2P0QA 2VUBA 3A7RA 2V8KA 3LW5E 1VQ9A 1YITA 5D6YA 5GMKi 2XD0A 1KC8U 4F7UF 4BWAA 2I2LA 4TVWA 3A8GB 3R07A 1H4SA 3S6WA 4V2SA 2IVWA 4JRKA 4J83A 3HRUA 3G6EA 4YRFA 2E6NA 4J6YA 4EMKC 3LWIA 3JCMX 1MHNA 1SESA 3HXYA 4QVCA 2O01E 2DEQA 3HY0A 3CMQA 3CCJA 2I4MA 5IT9E 2B8AA 4JLIA 1YHQT 1B7YB 1YJWT 1G3SA 5GAOq 1YI2A 1VQKT 1XTDA 4M77E 3CEYA 4CH4A 3HXZA 2RJDA 5GAN3 4A4HA 1NNHA 2RI3A 4IUTA 3CXCS 4L5GA 5CKFA 5LL6S 3VJPA 1KMMA 4BB7A 3VKIA 3CCMT 3DKMA 2LQ8A 2MF2A 3MF2A 2CIMA 4Q5WA 3ER0A 1JJ2S 3SB2A 3G4ST 4C0GA 3OD1A 1BYMA 3GIBA 2M16A 1YIJT 4EMKB 2RB6A 1OYXA 3VQXA 3JCMf 1EIYB 3MP1A 4HKEA 3NETA 4O5VA 4J15A 1M1FA 1HC7A 4NL2A 4M7DG 1YJWA 1ATIA 2O4XA 1M8VA 2OTLA 3JCMc 4JS5A 4M75E 2Q5HA 2X4JA 4P73A 3OS0A 5A0DA 4M7AE 1KQSS 5LJ3g 3JCMW 4ATOA 4FT2A 4Y91A 4C5HA 3LX7A 1WPYA 5GAOn 3HFZA 2GCXA 4H02A 3MEAA 2F69A 4CI0C 4LDXA 2JVVA 3C94A 3P8TA 3J80E 3SWNC 4YRLA 5GAMd 4FU6A 3A8HB 3LH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G4C A;  4M7D D;  5K1X A;  1EOV A;  1Z7N A;  2Q7G A;  4KR2 A;  3JCM Q;  3NEL A;  4C92 G;  3UFG A;  3QO3 A;  4CH6 A;  2RD1 A;  4QVD A;  1G51 A;  1LOJ A;  1NJ5 A;  4M75 G;  3RF1 A;  1WNL A;  3RKY A;  1QE0 A;  3M4Q A;  1NJ1 A;  1X56 A;  2C8M A;  2ZCE A;  5GAN f;  4HT9 A;  2QHV A;  2DTH A;  5GAM e;  5HGQ A;  3HXU A;  1I8F A;  4M7A G;  2E64 A;  1M5Q 1;  4M78 G;  3M4P A;  4YRJ A;  2ODR C;  2ALY A;  4PJO C;  5LJ5 h;  1EVK A;  5GAO m;  1B34 B;  1YCY A;  2ARS A;  4P71 A;  4MML A;  1I4K 1;  2DQ3 A;  3L4G A;  3UGQ A;  2FYK A;  5GAN d;  2DKG A;  2E1H A;  1EVL A;  4C92 B;  5LJ5 g;  4YRE A;  4YRR A;  3HXV A;  4M7D F;  2ZT6 A;  5LJ5 j;  4XQ3 A;  2ART A;  3VBB A;  1KQ1 A;  4M75 B;  3JCM V;  5GAN 5;  1WYD A;  3L2Z A;  2ZXF A;  5GMK h;  4J5Y A;  3IG2 A;  5ELN A;  1KOG A;  1LJO A;  3SWN B;  3NEN A;  4N0A C;  4YRP A;  4CS4 A;  1HXD A;  1LNX A;  1B7Y A;  2ZT5 A;  2JN0 A;  4YPF A;  3PCO A;  4PJO G;  4M7A B;  4YRK A;  3ERR A;  1HTT A;  3TUP A;  4RQE A;  4YRS A;  4C92 D;  3JB9 I;  1PYS B;  4OLF A;  5GAN e;  4TVY A;  4DQ2 A;  2ZZF A;  3A74 A;  4M75 D;  4PNO A;  3RER A;  5I21 A;  3E9I A;  4XTX A;  4A53 A;  4JUV A;  2AMC B;  3V8K A;  5GMK l;  2PME A;  3JB9 J;  5GAM h;  4M77 C;  4M7A D;  2CJB A;  4M78 D;  4XTU A;  3QO5 A;  4YRO A;  3M4G A;  4WF2 A;  4X9D A;  3HFO A;  3E9H A;  3IKM B;  3PZC A;  1B70 A;  2ZIM A;  3FJP A;  1YB3 A;  3JB9 G;  2ZNI A;  3IAL A;  3LSS A;  4PJO B;  4K88 A;  3JCM P;  4PG3 A;  3MF1 A;  4F7U A;  4O2D A;  1X01 A;  4UP7 A;  1IL2 A;  4J6W A;  4EMK A;  2EJG A;  3QTC A;  1H4Q A;  1EIY A;  2VXF A;  4M77 G;  4K87 A;  4C92 F;  1WQ7 A;  1Z7M A;  4XTW A;  1X55 A;  4G84 A;  1BBW A;  2XGT A;  3I7F A;  1H4V B;  4M75 F;  5ELO A;  4PJO D;  3RUX A;  3JCM J;  2ZIN A;  4Q6G A;  2I4N A;  2P5I A;  4RMF A;  1N9S A;  1ADY A;  1NYQ A;  4EMH A;  4P75 C;  2QHT A;  4C8Q C;  4M7A F;  4M78 F;  4XU0 A;  5E3I A;  1YGB A;  3TEH B;  1I5L A;  4H2X B;  3AHU A;  4CS3 A;  5CAI A;  4NCX A;  2DTI A;  2DXU A;  1GGM A;  3HSB A;  4YRG A;  3VQY A;  2RHS B;  3HFV A;  1SRY A;  4UP8 A;  1X2G A;  2RHQ B;  4M77 B;  2CGH A;  2RA2 A;  3W3S A;  3LC0 A;  4F7U E;  3BJU A;  4M7D A;  2RM4 A;  2Q7E A;  1H4T A;  2YHT A;  3JB9 D;  4C8Q G;  1D3B B;  3REX A;  4P72 C;  2ZIO A;  4H2U A;  4XU3 A;  5LJ3 f;  2Q7H A;  4PJO F;  1SER A;  4HT8 A;  2ZT7 A;  4YRC A;  4M77 D;  3UH0 A;  4EMG A;  2DQ0 A;  2J3L A;  1NJ6 A;  4P3P A;  3VQV A;  4WI1 A;  2ZZE A;  4HVC A;  1HK9 A;  2IY5 B;  3ICA A;  4L87 A;  4P3O A;  1N9W A;  4J6X A;  5LJ3 d;  3BY7 A;  4TQF A;  4P73 C;  4RDX A;  3RIR A;  4P74 C;  1JBM A;  3V8J A;  4C8Q B;  3HTZ A;  4YP0 A;  4P3N A;  3LSQ A;  3V7R A;  3JCM h;  2ZTG A;  3WQZ A;  2E41 A;  4M7D E;  12AS A;  3JB9 F;  2DU5 A;  4XU1 A;  4KQE A;  1G5I A;  3EFR A;  3JCM g;  4TWA A;  2EAY A;  2DTO A;  1KQ2 A;  3L1A A;  3MEY A;  2AKW A;  3A5Z A;  1USY A;  4TVA B;  5C51 B;  1VQZ A;  3UGT A;  5GMK j;  3HXX A;  4M77 F;  5LJ3 e;  4C8Q D;  4BW9 A;  4C92 A;  4F7U G;  2QTX A;  3RES A;  3INZ A;  2DVE A;  4M75 A;  2PMF A;  11AS A;  2E65 A;  3JCM b;  1RIQ A;  3SWN A;  3DSQ A;  1Y96 B;  4YYE A;  2ZGW A;  1YFR A;  3NEM A;  3EFS A;  2ZT8 A;  3G1Z A;  3QUI A;  4M7A A;  4XU2 A;  3BFM A;  4M78 A;  2DZC A;  2XTI A;  5GAM g;  5GAO l;  3A7U A;  4ZTU B;  2DDZ A;  5GAM j;  1LYL A;  4RQF A;  1ADJ A;  5GAN 8;  4AH6 A;  1ASY A;  5DY9 A;  2DZ9 A;  5LJ5 f;  4H2W A;  2AMC A;  4K86 A;  3TEG A;  4F7U B;  3A31 A;  3JB9 H;  1NJ2 A;  1E1T A;  4H2Y A;  4ZTZ B;  1J5W A;  1C0A A;  4C8Q F;  2I4L A;  4C92 E;  2Q5I A;  1JRI A;  2ODR D;  4CS2 A;  4ZIB A;  3RKX A;  4PJO A;  2ZZG A;  3P8V A;  2P0L A;  5LJ5 d;  4OP0 A;  4XTY A;  2ZR3 A;  4HWS A;  4P71 C;  2FB7 A;  1MGQ A;  4XTZ A;  3HFZ B;  1TH7 A;  4UP9 A;  4E51 A;  5GAN h;  3V8L A;  2QHU A;  4M78 E;  1N9R A;  2J3M A;  1FYF A;  4NOY A;  5GAN g;  4YCV A;  4Q15 A;  4WJ4 A;  5GAN j;  4N0A A;  1H64 1;  1B8A A;  1X2H A;  1YFS A;  5GAN 7;  3V7S A;  1JJC B;  3A32 A;  5LJ5 e;  3BDU A;  1BBU A;  1KMN A;  3HRK A;  4UPA A;  2VXE A;  3BW1 A;  3A5Y A;  4YRQ A;  3TEH A;  1U1T A;  4KR3 A;  3A7R A;  4HWR A;  5GMK i;  2RHQ A;  4M77 A;  1E22 A;  2ARU A;  4F7U F;  5GAO r;  4BWA A;  2I2L A;  4TVW A;  3R07 A;  1H4S A;  4V2S A;  1D3B A;  2ZNJ A;  4XTV A;  4YCW A;  5F5W A;  2EJF A;  4JRK A;  2ALY B;  2Y90 A;  5C52 B;  3KFU A;  4YRF A;  4CH5 A;  1EFW A;  2EJ9 A;  3QNE A;  1YFT A;  3PGG A;  4J6Y A;  3L4G B;  4EMK C;  4X5O A;  2EL9 A;  3JCM X;  1SES A;  3HXY A;  3VU3 C;  4QVC A;  2DEQ A;  1U1S A;  3HY0 A;  2IY5 A;  2VC8 A;  5GMK m;  3CMQ A;  4CH3 A;  2I4M A;  1NJ8 A;  4JLI A;  2E5A A;  1B76 A;  3A7A A;  1B34 A;  5GAN 6;  1B7Y B;  4G85 A;  3PCO B;  2AKW B;  2E3C A;  4P75 A;  5GAO q;  4C8Q A;  1G5H A;  4M77 E;  2I4O A;  1SET A;  2HNI A;  3HFN A;  4CH4 A;  3HXZ A;  5GAN 3;  5C53 B;  1L0W A;  5GAN 2;  1NNH A;  4H2V A;  4XEM A;  4DPG A;  4HA8 A;  4HWP A;  4TVA A;  4YDQ A;  1X54 A;  1QF6 A;  4M78 B;  1KMM A;  4RCC A;  4M7D C;  1BIB A;  1PYS A;  3FB9 A;  1B70 B;  4XEO A;  4PHC A;  4P72 A;  3MF2 A;  2CIM A;  1Y96 A;  3V7C A;  3SB2 A;  3RKW A;  3OD1 A;  3FIF A;  3GIB A;  3QSU A;  4EMK B;  2RB6 A;  3VQX A;  3JCM f;  1EIY B;  3QO7 A;  3NET A;  4J15 A;  4YRM A;  4MMK A;  1WQW A;  3QHS A;  3HY1 A;  4C8Q E;  1HC7 A;  4NL2 A;  4YCU A;  4M7D G;  2EWN A;  4HWT A;  1ATI A;  1M8V A;  3JCM c;  1W66 A;  4M75 E;  2QHS A;  4TQD A;  2Q5H A;  5LJ3 h;  4P73 A;  3P8Y A;  4YRN A;  4P74 A;  4NL3 A;  2CJ9 A;  4YRI A;  4M7A E;  2ZR2 A;  3JCM d;  3HXW A;  5LJ3 g;  2K57 A;  2DJZ A;  3JCM W;  1NYR A;  3REU A;  5LJ3 j;  2E10 A;  4Y91 A;  1WU7 A;  1BIA A;  5K1P A;  1WPY A;  3RAC A;  5GAM f;  2DXT A;  5GAO n;  4LNS A;  4WJ3 M;  4A54 A;  1USY C;  3HRI A;  3IKL A;  3HFZ A;  4YRT A;  2YLB A;  4EX5 A;  4M7D B;  2DU7 A;  4H02 A;  5KNN A;  5GAO p;  1E24 A;  4C92 C;  1E1O A;  4EO4 A;  4H2X A;  3JCM e;  3VQW A;  4M75 C;  4TTV A;  3P8T A;  2CJA A;  1ASZ A;  4JRI A;  4H2T A;  2C7I A;  1I81 A;  3SWN C;  4YRL A;  2RHS A;  5GMK e;  4H2S A;  5GAN 4;  4PJO E;  2YLC A;  5GAM d;  4HWO A;  3RGL A;  4RCB A;  1JJC A;  3QO8 A;  1EQR A;  4X9C A;  1WLE A;  4M7A C;  3RL6 A;  4M78 C; 
#chains in the Genus database with same CATH topology
 3MEV A;  2HDA A;  1EOV A;  1H8K A;  2AZS A;  4KR2 A;  3NEL A;  1WHH A;  3CBO A;  4ZN3 A;  2NUP A;  1WHG A;  2HKQ B;  3VS1 A;  2ESW A;  2RD1 A;  3EGX A;  1SSH A;  3KXT A;  4E7K A;  2RQW A;  3LH5 A;  2C8M A;  2X3X D;  3MCA B;  5GAM e;  3HXU A;  1ARK A;  1I8F A;  1RUW A;  3TRE A;  4ME7 A;  2XDP A;  1KQS A;  3WVE B;  3R6N A;  4BE0 A;  2ODR C;  1B3Q A;  1NJI U;  1YJN T;  2ALY A;  4PJO C;  2DK3 A;  2LT4 A;  5KYU A;  5LJ5 h;  2C06 A;  1X2K A;  3OYD A;  3A5Z B;  4P71 A;  4MML A;  5A0G A;  5GAN d;  2JS0 A;  2E1H A;  1EVL A;  5A2Q E;  4PFO A;  2EQI A;  3P8B B;  5GAN 5;  2DF6 A;  1WYD A;  1UGQ B;  5GMK h;  2JMC A;  3FC3 A;  3SWN B;  1HXD A;  1VYU A;  4JZ3 A;  2XMF A;  1D09 B;  1LNX A;  3OYA A;  2YUP A;  5FLX E;  2KEA A;  1BI1 A;  1WYX A;  2KXC A;  4NS5 A;  2PUK B;  3CPW S;  2AKL A;  1W2B S;  5GAN e;  1WA7 A;  1LCK A;  4DQ2 A;  1S72 Q;  3A74 A;  4M75 D;  1N27 A;  3THK A;  2JS2 A;  3CD6 Q;  3OMG A;  4XTX A;  2YRC A;  4A53 A;  2HQX A;  1Q82 R;  2AMC B;  1AWX A;  3CCU A;  4HCB A;  3PIO A;  1VQ5 Q;  4M7A D;  2LQK A;  1VA7 A;  2A0F B;  5CKD A;  1PCX A;  4WF2 A;  3SFM A;  3PZC A;  2HL5 C;  2ZIM A;  3CBP A;  4KGZ B;  2JM8 A;  1SHG A;  4PJO B;  4HCK A;  1GFD A;  1GCP A;  3MF1 A;  2DIG A;  4RTU A;  1EFN A;  1X01 A;  3OSV A;  1H4Q A;  2KYB A;  3QYH B;  2VXF A;  4OMO A;  4K87 A;  1BI0 A;  4C92 F;  1Z7M A;  1FMK A;  1X55 A;  1HSQ A;  2KRS A;  2YSQ A;  2LDM A;  1OX8 A;  1H4V B;  2E5Q A;  2LMJ A;  2COZ A;  4M4Z A;  2ZIN A;  2HD0 A;  2F2V A;  2I4N A;  3GNG A;  1N9S A;  1VQ9 Q;  1YIT Q;  2L3S A;  3HPW A;  2Y4Y A;  4C8Q C;  4M78 F;  2M0O A;  4LD9 K;  2JMA A;  4AG1 C;  3OB9 A;  2DFU A;  3NGP A;  3CCR A;  2A37 A;  1BCO A;  2L3R A;  1T3S A;  3M59 A;  5GJV B;  4OGC A;  3VQY A;  1SRY A;  3OA6 A;  3RR6 A;  3G6E Q;  2RJF A;  4F7U E;  3BJU A;  2BZX A;  2RM4 A;  1I5O B;  7AT1 B;  1H4T A;  1BBZ A;  1XOV A;  4B9W A;  3AT1 B;  3UA7 A;  1D3B B;  3UT1 A;  4BUG A;  4P72 C;  3QPH A;  2AKK A;  4XU3 A;  2EGE A;  5DLO A;  3CCJ Q;  3JSC A;  1MMG A;  4OB1 B;  3UH0 A;  4KUI A;  2KAF A;  5HK3 A;  2MOX A;  4EMG A;  4IUR A;  4HT4 A;  4BY6 C;  3MO8 A;  4KUD K;  3I56 A;  2QQA A;  3E2U A;  4E7L A;  5D7U A;  1YI2 Q;  2L89 A;  2ZZE A;  4HVC A;  2YUQ A;  1IRX A;  3ICA A;  2RHZ A;  3H0I A;  4OMF B;  4XK8 E;  1VYT A;  1U8R A;  4P3O A;  4J6X A;  1ZSZ C;  2GBQ A;  2X35 A;  1AWO A;  3HP9 A;  8ATC B;  1NJI C;  4C8Q B;  3HTZ A;  1XJW B;  1VQ4 T;  1K76 A;  3QWY A;  2DA9 A;  2E4H A;  3M55 A;  1R8O B;  3JB9 F;  2X4W A;  4KQE A;  1PSF A;  2DTO A;  2DM1 A;  2ED1 A;  4FSX A;  1KQ2 A;  5IXF A;  1RAC B;  2R58 A;  3CPF A;  2AKW A;  5C51 B;  4TVA B;  1VQZ A;  1PRM C;  4M77 F;  3H0H A;  3RES A;  2F1L A;  1NG2 A;  1TG0 A;  2OAW A;  2HL3 A;  5CIU A;  4JJC A;  1Y57 A;  4M75 A;  2PUO B;  2MYS A;  4Z8A A;  1NLO C;  1YJW Q;  1YFR A;  1KC8 R;  1Z9Z A;  2OTL Q;  1YWP A;  1SKU B;  4M7A A;  2KYM A;  2RHY A;  4BY6 B;  1IB8 A;  2EBP A;  4RTZ A;  2NUT B;  5GAO l;  3M53 A;  1ADJ A;  5GAN 8;  1ASY A;  4J9E A;  5LJ5 f;  5CQY A;  1YFN A;  3TEG A;  5DLQ E;  2OTJ T;  3PFS A;  3JB9 H;  1N6A A;  4GBQ A;  1J5W A;  1AWW A;  4XAX B;  2K2V A;  4DOV A;  3CCQ A;  3EFO A;  4CS2 A;  2H8H A;  3KBG A;  2QEX A;  3QDF A;  3OMC A;  4OP0 A;  4XTY A;  4HCZ A;  2FPF A;  1UJ0 A;  2B86 A;  3VUZ A;  5GAN h;  1IHW A;  2KRM A;  2BTT A;  3H9N A;  3V8L A;  4E51 A;  1K8A C;  2E6Z A;  4MDX A;  2EQJ A;  4YCV A;  3CC7 T;  3M58 A;  2LTO A;  3OS1 A;  4BDY A;  4WJ4 A;  3BE3 A;  2CZ6 B;  2VKN A;  2QI2 A;  2R5A A;  1JJC B;  1UGP B;  2X4Y A;  3BDU A;  3HRK A;  2VVK A;  4MDW A;  1BI2 A;  2VXE A;  2LJ1 A;  4HCC A;  4YRQ A;  3I5R A;  1U1T A;  2BZ8 A;  2C0I A;  4KBM B;  5I22 A;  2ROL A;  3QBY A;  3HRT A;  2KNB B;  1YNZ A;  4HWR A;  3M56 A;  2HSE B;  3M5A A;  5IN1 A;  2ARU A;  1O75 A;  1QVG S;  4VUB A;  2K3B A;  2ZNJ A;  1ZBJ A;  1G83 A;  2OJ2 A;  3VRZ A;  4YCW A;  2DL4 A;  2Y90 A;  1RI0 A;  1EFW A;  2EJ9 A;  5IHN A;  2R5M A;  3PGG A;  3PNW C;  1RAH B;  3L4G B;  3UA6 A;  2RQV A;  2EL9 A;  2PU9 B;  1U1S A;  2EFI A;  2IY5 A;  2VC8 A;  4ELZ C;  1QVF P;  3TU4 K;  2E5A A;  3OYE A;  2RQR A;  4G85 A;  2AKW B;  1PNJ A;  2MMP A;  3CCU Q;  3X28 B;  3WVD B;  1CKB A;  4E7I A;  4C5E A;  3HFN A;  2KT8 A;  3HTR A;  4H2V A;  4XEM A;  4DPG A;  4HA8 A;  1ZA2 B;  4BI4 A;  3VUB A;  1P92 A;  4A4E A;  1WJR A;  1BI3 A;  4M7D C;  1PC0 A;  1ZHI A;  1PYS A;  1R0C B;  2WSC E;  3IQL A;  1QVG A;  4PHC A;  3PVL A;  4BI8 B;  1DJ7 B;  2GTO A;  2KBT A;  5FRN A;  2V1Q A;  1M2O A;  3M9Q A;  1XNI A;  1AWJ A;  3OYK A;  1TSF A;  2HBP A;  3QSU A;  1K9M U;  4BD3 A;  3GLX A;  1OU9 A;  4J9F A;  2LJ3 A;  4YRM A;  4MMK A;  3HY1 A;  4C8Q E;  1NJI R;  2X4X A;  4HWT A;  3EFO B;  2EYX A;  2A7Y A;  2QHS A;  1U3O A;  1OX9 A;  3CCR Q;  1X6B A;  2O9S A;  4N4G A;  5FRM A;  4YRI A;  2K79 A;  3HXW A;  3A8O B;  3H41 A;  1VQ8 T;  2DJZ A;  1NYR A;  3REU A;  1V29 B;  2QK0 A;  4F17 A;  2DXC A;  2KGT A;  2P4T A;  3G7Z A;  4RUG A;  5GAM f;  1UUE A;  4PFP A;  4WJ3 M;  2HKN A;  3HRI A;  3IKL A;  4YRT A;  4M7D B;  2DU7 A;  1KIK A;  3NHN A;  5GAO p;  1TUC A;  2DL8 A;  1E24 A;  1UHC A;  3PE0 A;  4LN2 A;  5CQX A;  4OB2 B;  4EO4 A;  4EDU A;  2DXB A;  2K2M A;  3VQW A;  3F70 A;  3VYG A;  3I56 Q;  4TTV A;  3L2R A;  2CJA A;  2C7I A;  3EG3 A;  1QW1 A;  1Y71 A;  3GPL A;  4H2S A;  5GMK e;  2P0K A;  1M1K U;  1VQ7 A;  2K5F A;  1WLE A;  3RL6 A;  2BUD A;  4DEY A;  2X9H A;  1QVP A;  2G4C A;  4ORZ A;  2D0Q B;  2ED0 A;  4OB0 B;  4N4I A;  2BZY A;  2Q7G A;  3JCM Q;  1JEG A;  4D8K A;  3UFG A;  3QO3 A;  4EIK A;  4CH6 A;  5CVI A;  1LOJ A;  1NJ5 A;  4M75 G;  3RF1 A;  1NEB A;  1UGS B;  3RMQ A;  2JM9 A;  3M4Q A;  1KJW A;  3L2Q A;  3HKS A;  5GAN f;  1VQN T;  1QKW A;  2FL7 A;  1RAE B;  4M7A G;  2L8D A;  2EW3 A;  4A4K A;  4DOW A;  4YRJ A;  4LDV A;  3FEO A;  1PD1 A;  2CYZ B;  3HL8 A;  3VS7 A;  2D6F A;  3JAM E;  4AFQ C;  3OS2 A;  4J9C A;  1VOM A;  1NYG A;  2VV5 A;  1TUG B;  5LJ5 j;  4PLI A;  1ZUU A;  3PT9 A;  1X2Q A;  2A3L A;  2CS7 A;  1M2V A;  4J5Y A;  1SF9 A;  2PQW A;  1KOG A;  2EKO A;  2J05 A;  2ZT5 A;  4YPF A;  2JN0 A;  1K4U S;  3PCO A;  3D7S B;  3OBW A;  1HTT A;  1H3H A;  3TUP A;  3H0F A;  4C92 D;  3JB9 I;  1PYS B;  4OLF A;  4TVY A;  2EQU A;  2ZZF A;  5DM7 R;  5L8R E;  4PNO A;  4GY5 A;  3VS0 A;  4J9B A;  3E9I A;  3CCQ Q;  1C0M A;  4JUV A;  3ULR B;  2EQK A;  2QEX Q;  3OYY A;  3NTH A;  3JB9 J;  2PME A;  4FL6 A;  1QKX A;  5C6S A;  3CCV T;  1I07 A;  1WXT A;  4M78 D;  3E9G A;  2NUZ A;  3WXM B;  1YHQ A;  3M4G A;  4X9D A;  3CCE T;  5CO7 A;  3E9H A;  2YWW A;  1B70 A;  4IUQ A;  3OBY A;  1K9M C;  1VQK A;  4MZT A;  2PVG B;  4QT7 A;  4K88 A;  4ZN1 A;  1KG1 A;  4UP7 A;  1IL2 A;  4J6W A;  2EYZ A;  2VGM A;  4PJN A;  2Z0W A;  4LDU A;  2CSQ A;  1X69 A;  2AIR B;  3FDR A;  4OMP A;  4HVV A;  3OYJ A;  2NS6 A;  5IXB A;  4XTW A;  3M0U A;  3OQ5 A;  2XGT A;  3I7F A;  5ELO A;  3OY9 A;  3QYG B;  3JCM J;  2OAU A;  3CCM A;  2RK1 A;  2QDY B;  3L2V A;  2RI2 A;  3GNF B;  4PKC C;  3I55 T;  2P5I A;  3CXC A;  4EMH A;  2QHT A;  3CME T;  1UFF A;  3G4S A;  1SRL A;  1AZE A;  4GLM A;  1I5L A;  2DET A;  2QAZ A;  4ESR A;  1YIJ A;  3SDZ A;  3AHU A;  5FU6 C;  4CS3 A;  1SHF A;  2DTI A;  2RI5 A;  2IG0 A;  2CZ7 B;  3EG9 A;  1K1Z A;  2IIM A;  3CCE A;  1VQM T;  2ECZ A;  1JJ2 A;  3QZ9 B;  2Q7E A;  1VQO T;  3EGD B;  1M1K C;  3LGF A;  2LT1 A;  3JB9 D;  1FX7 A;  1ZSG A;  1G5V A;  4H2U A;  2XHC A;  3ME9 A;  2D8H A;  2Q7H A;  4PJO F;  1PM3 A;  1G8X A;  2ZT7 A;  1VQL T;  2EPD A;  5I2M A;  4YRC A;  1VQP T;  4M77 D;  4O6J A;  1GCQ C;  4JS4 A;  2DQ0 A;  1K0S A;  1UGR B;  2SRC A;  2F5K A;  1NJ6 A;  3I55 A;  1PD0 A;  3NPF A;  4LVM A;  2L2P A;  3X24 B;  3CME A;  1UJY A;  5LJ3 d;  2RJC A;  2ZAE A;  3C95 A;  4P73 C;  2QYZ A;  4RDX A;  1I1J A;  3V8J A;  4CC4 B;  3LSQ A;  4KGV B;  4P3N A;  1KSW A;  1IGQ A;  5GJW B;  2ZTG A;  4M7D E;  2CP5 A;  3VRY A;  2SEM A;  5FU6 B;  1PRL C;  2QQS A;  2DU5 A;  1OQK A;  4TWA A;  3JCM g;  5FWC A;  1VQO A;  2D1X A;  3MEY A;  1USY A;  3HXX A;  5LJ3 e;  3S3N A;  4R0K A;  2L5Q A;  2QTX A;  1NPR A;  3INZ A;  4KRT A;  3QKJ A;  4OMQ A;  4AT1 B;  4C92 A;  4F7U G;  1EZZ B;  1VQP A;  2GQV A;  3I35 A;  3JCM b;  4OML A;  2NLU A;  3QG1 A;  4OVA A;  4YYE A;  2LNV A;  2ZGW A;  3NEM A;  2MWP A;  3EFS A;  3G1Z A;  2CP6 A;  3BFM A;  4M78 A;  1YJN A;  3M0T A;  2DDZ A;  4OB3 B;  3JRZ A;  5GAM j;  2IPO B;  1LYL A;  4TVR A;  4RQF A;  4II1 A;  2O4X B;  2DL3 A;  2VB6 A;  3MET A;  3G71 T;  5DY9 A;  2DZ9 A;  1E6G A;  3QJY A;  2DBM A;  3CC2 T;  2COY A;  2JTM A;  8AT1 B;  3EGU A;  4CC2 A;  1KQS P;  3J81 E;  4ZTZ B;  2XKO C;  3H6Z A;  3SD4 A;  4C8Q F;  2I4L A;  2D9T A;  2ZCF B;  2BIV A;  4IUV A;  2PNI A;  5KYX B;  2XDD A;  3P8V A;  2M02 A;  1K8A U;  2ATC B;  4P71 C;  4KH0 B;  4QVZ A;  3HFZ B;  1VQ7 Q;  2QHU A;  4J7I A;  1Y07 A;  2BE7 D;  4FYX B;  3CPW A;  2CP3 A;  4NOY A;  1W2B A;  1X43 A;  2CH4 W;  3OYB A;  2XG8 D;  2QQB A;  4Q15 A;  3UAT A;  5GAN j;  4RTV A;  4N0A A;  2R57 A;  3S3M A;  1YFS A;  1WGS A;  4QKU A;  3V7S A;  2VYT A;  1WFW A;  1LPL A;  1TU0 B;  3E1S A;  2COW A;  1KMN A;  3A98 A;  1BU1 A;  2QXF A;  3G71 A;  3BW1 A;  3TEH A;  4FSS A;  3MPU B;  1YP5 A;  2NUP B;  4KR3 A;  2CZ0 B;  4UC4 A;  1MMA A;  2GGR A;  3EGX B;  1K9M R;  4LVJ A;  2RHQ A;  4M77 A;  2G3R A;  1AHJ B;  1SRM A;  1AD5 A;  5GAO r;  4B9X A;  1M27 C;  1ZLM A;  4KT0 E;  3BDL A;  1NZ9 A;  3QXE B;  4PJM A;  4J7F A;  2JZ2 A;  2EJF A;  2ALY B;  1QQJ A;  2HSP A;  5C52 B;  5KYU B;  3QNE A;  1WHK A;  3CCS T;  3X25 B;  4X5O A;  1ABO A;  1NPP A;  1B07 A;  2WSF E;  1UEC A;  1WHM A;  2GFA A;  5GMK m;  1M9S A;  4CH3 A;  1RAA B;  1NJ8 A;  4C0F A;  3VS6 A;  3CMA T;  1B76 A;  3A7A A;  2GFU A;  1K73 U;  4P75 A;  1QLY A;  1G5H A;  3CC4 T;  3N5B B;  3C0C A;  2I4O A;  3S3O A;  4MZP A;  2L0A A;  1EIF A;  2ZPI B;  4LD6 A;  1YHQ Q;  5C53 B;  1M1K R;  2F2X A;  1C1A A;  1VQK Q;  1QVF S;  3QWX X;  2A08 A;  4M78 B;  4RG8 A;  4RCC A;  1BIB A;  1GFC A;  3X20 B;  4LDY A;  3FB9 A;  1YJ9 T;  2RNA A;  3HHT B;  1ZUK A;  2A36 A;  1VQ4 A;  3LLR A;  1Y96 A;  2P4R A;  3FJ5 A;  3MHX A;  3VS5 A;  1U5S A;  1UGV A;  3FIF A;  2DMO A;  3CCM Q;  2FPD A;  2RJE A;  3QO7 A;  2H3J A;  1WQW A;  3QHS A;  4MZM A;  1VQ6 T;  5CR2 A;  2CDT A;  5KH6 A;  2EWN A;  4AFU C;  2QA4 T;  3G4S Q;  4F04 B;  4ZNX A;  4FIB A;  1YIJ Q;  4TQD A;  5LJ3 h;  2DLP A;  1BKB A;  4C5G A;  1UHF A;  4YRN A;  4P74 A;  3CCE Q;  3EAE A;  3QDR B;  1WIE A;  3MP6 A;  2EGA A;  1ZQ1 A;  2MK5 A;  2K9G A;  1M3C A;  2K57 A;  5KCO A;  2YT6 A;  1UDL A;  2E10 A;  3P8D A;  2FO0 A;  2K3X A;  1WU7 A;  4AFZ C;  1BIA A;  5KYY A;  2XID A;  2DXT A;  3SHW A;  4A54 A;  1AEY A;  2NWM A;  4WCI A;  2XU8 A;  2ZPH B;  4FW2 A;  5KNN A;  1XQH A;  4IIM A;  1E1O A;  2OTJ A;  3PTA A;  4M75 C;  5AYF A;  4D6W A;  4JRI A;  3VYH B;  3I55 Q;  1N8R C;  3OYC A;  3VS3 A;  3CQT A;  4PJO E;  1NYF A;  4HWO A;  4RCB A;  3CME Q;  3QO8 A;  1PKT A;  4X9C A;  4M7A C;  4DBR A;  3OYM A;  2FG0 A;  3NTI A;  2A28 A;  5K1X A;  1RAI B;  1KFZ A;  1Y7X A;  2ABL A;  3QZ5 B;  2I0N A;  4C92 G;  4D8D A;  1ZA1 B;  5D6W A;  4GLK A;  3C12 A;  1G51 A;  1WJS A;  5FRO A;  3RKY A;  1VQO Q;  1Q7Y C;  4E7H A;  1Q86 C;  2ZCE A;  1UB4 A;  2FPE A;  5EC7 A;  3CC7 A;  1Q82 U;  2DTH A;  2J6O A;  2QHV A;  2RK2 A;  2MIO A;  5HGQ A;  1X75 C;  5KE2 A;  1M5Q 1;  4M78 G;  3NTK A;  2RMO A;  1VQP Q;  1EVK A;  3DB4 A;  2ARS A;  2DQ3 A;  1I4K 1;  4IIO A;  3UGQ A;  2QTV A;  1JO8 A;  3TQ7 P;  5LJ5 g;  2VWF A;  4YRE A;  4M7D F;  4BE1 A;  1YJN Q;  1K73 C;  4J9D A;  2ART A;  3VBB A;  1KQ1 A;  1OPL A;  2H3E B;  4PJJ A;  2CH4 A;  4M75 B;  3IG2 A;  5ELN A;  5C0M A;  3NEN A;  1S72 T;  4CS4 A;  1N5Z A;  1B7Y A;  3CD6 T;  3PMI A;  4M7A B;  2XDB A;  3UF4 A;  3ERR A;  4KUL A;  3ZBD A;  2RHU A;  4RQE A;  2CSI A;  2HQH A;  1VQ5 T;  1IGU A;  2D0N A;  1E7O A;  1V76 A;  2AHJ B;  2QGF B;  1OPK A;  4OGE A;  3V8K A;  4ZGE B;  2HMA A;  3TCJ A;  1IXD A;  4RMO A;  3L42 A;  3J7A F;  2V1R A;  1VUB A;  2LRQ A;  3QO5 A;  1ACM B;  4YRO A;  2W0Z A;  2KY9 A;  3JB9 G;  2ZNI A;  1FXX A;  3IAL A;  3LSS A;  2FZK B;  3MQZ A;  3EHQ A;  2BKD N;  4F7U A;  4O2D A;  2RQU A;  4EMK A;  2YXY A;  2XIC A;  3QTC A;  1EIY A;  1T0J A;  4M77 G;  1VQ9 T;  1YIT T;  2KR3 A;  2EIF A;  5CCA A;  3G71 Q;  3A8M B;  3EH1 A;  4BI3 A;  1HYO A;  2J06 A;  1NBE B;  1MMN A;  2DIQ A;  3M0P A;  3M0S A;  2YRD A;  2YUO A;  1FYN A;  3OYI A;  4PJO D;  3M54 A;  3SEM A;  2HCK A;  4AMC A;  4RMF A;  2KRN A;  2K4Y A;  2M9U A;  2G6F X;  3G6E T;  5E3I A;  1GL5 A;  5ECA A;  1H92 A;  4QQG A;  5J3B A;  5CAI A;  2P0P A;  4NCX A;  2DBK A;  2PZ1 A;  2CP2 A;  5J39 A;  1GGM A;  5IHK A;  4YRG A;  1W70 A;  4UP8 A;  4LUD A;  1X2G A;  2LZ6 B;  3DB3 A;  3W3S A;  3CCJ T;  2QGG A;  3ZFJ A;  2AK5 A;  4FCY A;  2KMT A;  3OW2 S;  4J8O A;  1YI2 T;  4DEX A;  4X1V A;  2JT4 A;  5HY6 A;  4OMN A;  1VQ8 A;  5LJ3 f;  3VV0 A;  4HT8 A;  2ZPG B;  1KHI A;  1M8M A;  1AT1 B;  1QP2 A;  3OYL A;  4DBF A;  2BE9 B;  3URG A;  4P3P A;  1OUL A;  1UEB A;  2KSS A;  4QQ6 A;  4WI1 A;  1HK9 A;  1Q82 C;  1M90 U;  2IY5 B;  1K8A R;  1UE9 A;  1N9W A;  3HRS A;  3RIR A;  5I2S A;  2C0O A;  4JDS A;  1JBM A;  1MV3 A;  4YP0 A;  2HZY A;  4K11 A;  1RLP C;  2DAQ A;  5D6X A;  3VS2 A;  1M1G A;  1RAF B;  1B7T A;  1WJQ A;  1G5I A;  2EAY A;  4YTL A;  1IHV A;  4E7Z A;  5IHI A;  2CZ1 B;  2ROT A;  3ZEH A;  1VQ4 Q;  3A5Z A;  4RKU E;  5GMK j;  2OTL T;  4C8Q D;  1Q81 U;  3X26 B;  2HQE A;  1YBY A;  3C4S A;  3QII A;  2DVE A;  3DLM A;  3OYN A;  1VQN A;  1RIQ A;  3OW2 A;  3SWN A;  2QAS A;  2DD5 A;  2ZT8 A;  3UWN A;  5KCH A;  1YWO A;  1PHT A;  4XU2 A;  2DZC A;  5CK9 A;  2DRM A;  2J7I A;  1I0C A;  1T0H A;  5GAM g;  3A7U A;  1MNE A;  3I9Q A;  1GBR A;  2GNC A;  3M4Y A;  4FYV B;  4AH6 A;  2QQ9 A;  4ZTJ A;  2AMC A;  1AZG B;  4F7U B;  3A31 A;  1NJ2 A;  1WXU A;  1O9S A;  4H2Y A;  2DPP B;  1C0A A;  4E47 A;  4Y28 E;  1VIE A;  3ZL7 C;  3PIP A;  2Q5I A;  1JRI A;  4ZIB A;  5FU7 C;  2CRE A;  2OI3 A;  4RTY A;  4PJO A;  4JPB W;  2OTJ Q;  2P0L A;  1NLP C;  2ZR3 A;  3NFC A;  1K0X A;  2X51 A;  1MGQ A;  3P8H A;  4XTZ A;  1BCM A;  1X6G A;  1NEG A;  1TOV A;  1G3T A;  3PMT A;  3MKD A;  5GAN g;  3CCV A;  1B8A A;  1H64 1;  2LCC A;  2RH2 A;  1X2H A;  2XK0 A;  3LGL A;  2V26 A;  3UPU A;  4ELY C;  1BBU A;  2WAC A;  1PSE A;  2FRY A;  4UPA A;  1RL2 A;  3RDV A;  3CC7 Q;  5HKC A;  3DLL A;  4R55 A;  1NM7 A;  4JZ4 A;  2ZPF B;  2RF0 A;  4JJD A;  3FLG A;  2DL7 A;  1E22 A;  2WSE E;  4DBH A;  1KK7 A;  2E3I A;  4BDZ A;  1M4Z A;  3L2U A;  1K9A A;  4J9I A;  1D3B A;  4XTV A;  5FU7 B;  1KC8 C;  5F5W A;  2K5L A;  3KFU A;  4CH5 A;  2X3W D;  2LVM A;  1M90 C;  1YFT A;  3UDC A;  2JNG A;  4A4G A;  5HK0 A;  1PWT A;  1SG5 A;  2JTF A;  3VU3 C;  4PK4 A;  3CCU T;  1VQM A;  3VS4 A;  1WXB A;  1M2V B;  3CXC P;  2FVU A;  2Y4X A;  3Q1J A;  3KUF A;  3CCL T;  4AG2 C;  2O2O A;  1B34 A;  2CP7 A;  5GAN 6;  2L3Q A;  4LE9 A;  3PCO B;  4OF1 A;  2E3C A;  4C8Q A;  1SET A;  4ZGD B;  1VQL A;  2HNI A;  3M0Q A;  2E12 A;  3OYH A;  1L0W A;  1Q81 C;  1JJ2 P;  5GAN 2;  3FRN A;  1SSF A;  4WTO B;  4HWP A;  3MP8 A;  4TVA A;  1QWE A;  4YDQ A;  1X54 A;  1QF6 A;  3NMZ C;  1MUZ A;  2E3H A;  4JRQ A;  1CKA A;  4A4F A;  4BW9 A;  1JB0 E;  1B70 B;  4XEO A;  4LVK A;  4P72 A;  4LVI A;  3A8L B;  4BE2 A;  5IAY A;  3V7C A;  1M30 A;  1RI9 A;  1SEM A;  1F1B B;  3RKW A;  3OS5 A;  1AOJ A;  4C0D C;  2FHD A;  3CCR T;  1KD1 U;  2LJ0 A;  1H3Z A;  2NUT A;  3CCL A;  2OX7 A;  3EG2 A;  2LX7 A;  4YCU A;  5FW9 A;  2DRK A;  2F5T X;  2P84 A;  2KVQ G;  1W66 A;  3TEE A;  2PVD B;  2FZG B;  1ZSZ A;  4ZTF A;  1Q95 G;  4FW1 A;  3P8Y A;  2CT4 A;  4NL3 A;  1TWB A;  2CJ9 A;  1D0X A;  1M3A A;  2ZR2 A;  3JCM d;  1NE8 A;  4CC3 A;  1HJD A;  3T9N A;  5LJ3 j;  3E9F A;  1X6O A;  4DBQ A;  4X34 A;  2DYB A;  1R77 A;  5K1P A;  1IZ6 A;  4RG2 A;  3RAC A;  3I5S A;  3I56 T;  3EG9 B;  2K5I A;  4LNS A;  1VQ8 Q;  1USY C;  2YLB A;  4EX5 A;  4E7S A;  4R56 A;  2FRW A;  1N8R U;  4C92 C;  3CC2 A;  2PVO B;  2EQM A;  1MMD A;  2W10 A;  4H2X A;  2C0T A;  3JCM e;  2VAS A;  2LX9 A;  5KYN A;  1ASZ A;  4FM4 B;  1TUD A;  2AZV A;  5IH2 A;  2KT1 A;  4H2T A;  1I81 A;  2RHS A;  2RHI A;  2GTJ A;  2F2W A;  5GAN 4;  1OOT A;  2YLC A;  3RGL A;  1JJC A;  4C5I A;  4C0D B;  1EQR A;  4M78 C;  5CKE A;  2V8J A;  4M7D D;  3REA B;  1Z7N A;  4PL6 A;  3GBQ A;  2DL5 A;  1Q7Y U;  1Q86 U;  1FMW A;  2DNU A;  4ANJ A;  4QVD A;  1QP3 A;  3H8Z A;  4DA4 A;  1WNL A;  2FZC B;  2MCN A;  1QE0 A;  2A8E A;  4ZGJ B;  2KXD A;  1NJ1 A;  1X56 A;  1RAB B;  2E70 A;  4RTX A;  4HT9 A;  2YRV A;  2DJQ A;  2E5K A;  3GP8 A;  2AT1 B;  2E64 A;  9ATC B;  3M4P A;  1WHJ A;  3GF5 A;  3MJX A;  2RO0 A;  6AT1 B;  2MAM A;  3KFV A;  1VQN Q;  5GAO m;  1B34 B;  1OU8 A;  1YCY A;  3L4G A;  1C6V X;  1W4S A;  2FYK A;  3CPW P;  2DKG A;  1W2B P;  4C92 B;  2MWO A;  2CP0 A;  4OMM A;  2O31 A;  3HXV A;  4YRR A;  2ZT6 A;  4XQ3 A;  4EPC A;  3JCM V;  4Y92 A;  3L2Z A;  2ZXF A;  1LJO A;  1RAD B;  1JXM A;  2DIL A;  4N0A C;  4YRP A;  5L23 A;  1Y0M A;  1HD3 A;  1MV0 B;  1QCF A;  4L59 A;  4PJO G;  3CCQ T;  1GRI A;  3TVT A;  5CKH A;  3MEW A;  4YRK A;  2QEX T;  3EHR A;  3RMS A;  4YRS A;  2EYW A;  1A0N B;  4B6M A;  3RNJ A;  3CCS A;  1JQQ A;  2J6K A;  3RER A;  1OZ3 A;  5I21 A;  2JUF A;  2M1H A;  1KHC A;  1YCS B;  1FMV A;  5GMK l;  1W6X A;  3E19 A;  5GAM h;  4M77 C;  2CJB A;  4XTU A;  4P5N A;  1M90 R;  1ZBX A;  4Z02 A;  3CMA A;  3R6O A;  3HFO A;  3IKM B;  1D0Z A;  2DD4 A;  3FJP A;  1YB3 A;  1KD1 C;  3CC4 A;  2RQT A;  3JCM P;  5A0L A;  4PG3 A;  4LVL A;  3CCV Q;  1ZSZ B;  4Z89 A;  2EJG A;  4LXC A;  2RPN A;  4QQD A;  4J9H A;  1WQ7 A;  5CKB A;  4G84 A;  4IKF A;  1BBW A;  2JXB A;  4F14 A;  4QW2 A;  4M75 F;  3RUX A;  4HXJ A;  4Q6G A;  1YJ9 A;  2DX1 A;  1Q81 R;  2LCL A;  1ADY A;  1NYQ A;  2MI6 A;  1QVF A;  4P75 C;  4M7A F;  4XU0 A;  4JJB A;  1YGB A;  3TEH B;  3O8V A;  3TSZ A;  4H2X B;  1WZO A;  4PLL A;  1IO6 A;  2DXU A;  3G1J A;  3HSB A;  1VQ6 A;  2KE9 A;  2RHS B;  3HFV A;  5KE3 A;  2RHQ B;  1PG5 B;  4M77 B;  2CGH A;  4JLG A;  2RA2 A;  4RTT A;  2QA4 A;  1OZ2 A;  3LC0 A;  1CSK A;  4M7D A;  4F16 A;  2YHT A;  1IRE B;  4N4H A;  5I11 A;  4C8Q G;  2ZPE B;  3CBM A;  2VGN A;  3REX A;  2ZIO A;  2EKH A;  1VQM Q;  2L3P A;  2LCS A;  1PKS A;  1SER A;  4FYW B;  3EG1 A;  2J3L A;  3ASK A;  3REB B;  1WX6 A;  3VQV A;  1G2B A;  2XI9 A;  4E2F B;  4L87 A;  4C0Z A;  1VQL Q;  1VIF A;  1GXI E;  1M3B A;  4CRI A;  2K3Y A;  2QG9 B;  3BY7 A;  4TQF A;  3MEU A;  2KDS A;  4P74 C;  3OYF A;  5HCK A;  2KK4 A;  4IUP A;  2CT3 A;  3V7R A;  3JCM h;  4CC7 A;  3WQZ A;  2E41 A;  1SPK A;  2GF7 A;  4FT4 A;  12AS A;  1U06 A;  4JJN K;  4XU1 A;  4JRP A;  3EFR A;  1WHL A;  2QDL A;  5FWB A;  2ZPB B;  2M0Y A;  3L1A A;  4A63 B;  2RHX A;  3UGT A;  2QQR A;  1J3T A;  2KQW A;  2LQW A;  3QJ6 A;  2PMF A;  11AS A;  2E65 A;  3CCL Q;  2NYS A;  1G3W A;  3DSQ A;  1Y96 B;  2JTE A;  2ZZD A;  2JOY A;  3GOX A;  3QUI A;  1QCO A;  1V1C A;  2YDL A;  2V8I A;  4E7J A;  2XTI A;  4ZTU B;  4BAC A;  2DO3 A;  1FWZ A;  3LWH A;  4H2W A;  1BK2 A;  4K86 A;  3OYG A;  5KYW A;  2LC4 A;  1EX4 A;  1E1T A;  1QCN A;  2J6F A;  3OSS C;  1D1C A;  1GBQ A;  1TS9 A;  1VYV A;  1S72 A;  4IUU A;  4LUE A;  3CD6 A;  4C92 E;  1VQ7 T;  2ODR D;  3CC2 Q;  2EYY A;  3RKX A;  4J9G A;  5KYY B;  2ZZG A;  1G3Y A;  1VQ5 A;  5LJ5 d;  3M57 A;  2RN8 A;  4PFZ A;  2O88 A;  4HWS A;  1WDX A;  2FB7 A;  1ZX6 A;  4AFS C;  1TH7 A;  4UP9 A;  3LYI A;  3M0R A;  1WI7 A;  4M78 E;  5M9O A;  1N9R A;  2J3M A;  2LQN A;  1FYF A;  5EG2 A;  3L2W A;  1MND A;  4L6V 5;  5J26 A;  3U23 A;  2CKK A;  4LDW A;  5GAN 7;  1R0B G;  3A32 A;  1OI1 A;  3PVQ A;  1QVG P;  5LJ5 e;  2HAX A;  2EYQ A;  1D1B A;  2M51 A;  1YN8 A;  4PJL A;  3A5Y A;  2EGC A;  2P0Q A;  2VUB A;  2LNH B;  1RLQ C;  3TSW A;  3A7R A;  2V8K A;  3LW5 E;  1VQ9 A;  1YIT A;  5D6Y A;  5GMK i;  1KD1 R;  1E6H A;  2JW4 A;  2O9V A;  2XD0 A;  1KC8 U;  4F7U F;  4BWA A;  1WLP B;  2I2L A;  3EGD A;  3A8G B;  4TVW A;  3R07 A;  1H4S A;  3S6W A;  2DEU A;  4V2S A;  2IVW A;  5AT1 B;  1ABQ A;  4JRK A;  4J83 A;  3HRU A;  3RBB B;  3G6E A;  4YRF A;  2E6N A;  4E6R A;  2FEI A;  1LVK A;  4J6Y A;  4EMK C;  3LWI A;  1Z9Q A;  3JCM X;  1MHN A;  2MPX C;  1SES A;  3HXY A;  4QVC A;  2CUB A;  1X27 A;  2O01 E;  2DEQ A;  1T3L A;  3HY0 A;  3CMQ A;  3EH2 A;  3CCJ A;  2I4M A;  2K7A A;  5IT9 E;  2B8A A;  3CCS Q;  4JLI A;  2GQI A;  1YHQ T;  2YUN A;  1B7Y B;  1YJW T;  1G3S A;  1N8R R;  3A1P A;  5GAO q;  1YI2 A;  1VQK T;  1XTD A;  3O5Z A;  4M77 E;  2KI7 A;  1TTH B;  2HEQ A;  3CEY A;  2CUD A;  1UG1 A;  2PTK A;  3JV3 A;  4CH4 A;  3HXZ A;  2RJD A;  5GAN 3;  3CMA Q;  4A4H A;  1NNH A;  2RI3 A;  4IUT A;  3CXC S;  4L5G A;  3CC4 Q;  5CKF A;  5LL6 S;  1W1F A;  3VJP A;  4LNP A;  1KMM A;  4BB7 A;  1Q7Y R;  1Q86 R;  3VKI A;  3CCM T;  2DER A;  3DKM A;  2LQ8 A;  2MF2 A;  2KRO A;  3MF2 A;  2CIM A;  1JXO A;  1OV3 A;  3ER0 A;  4Q5W A;  1JJ2 S;  3SB2 A;  3G4S T;  3EG0 A;  4C0G A;  2LP5 A;  5KYW B;  3GIB A;  1BYM A;  2M16 A;  1YIJ T;  4EMK B;  2RB6 A;  3OD1 A;  1GCQ A;  1OYX A;  3VQX A;  3JCM f;  1EIY B;  1YJ9 Q;  3MP1 A;  4HKE A;  3NET A;  4O5V A;  4J15 A;  1M1F A;  1JU5 C;  4HVW A;  1HC7 A;  2ENM A;  2JJ9 A;  4KH1 B;  4NL2 A;  1YJW A;  4M7D G;  1ATI A;  2O4X A;  1M8V A;  2OTL A;  3JCM c;  4RTW A;  4JS5 A;  4M75 E;  1K73 R;  2Q5H A;  2X4J A;  4P73 A;  3OS0 A;  5A0D A;  1BB9 A;  1VQ6 Q;  2K6D A;  4M7A E;  2HBW A;  1KQS S;  1QWF A;  5LJ3 g;  1D0Y A;  2QA4 Q;  3JCM W;  1RAG B;  4ATO A;  1ZUY A;  1QMC A;  4FYY B;  4KGX B;  4FT2 A;  2DE0 X;  4Y91 A;  4Z88 A;  1UTI A;  3LX7 A;  4C5H A;  1WPY A;  1OEB A;  5KYX A;  5GAO n;  2DVJ A;  2DYI A;  3HFZ A;  2GCX A;  4H02 A;  3MEA A;  3OW2 P;  2F69 A;  1D1A A;  1AVZ C;  4CI0 C;  2EVR A;  4LDX A;  2JVV A;  3C94 A;  3P8T A;  3J80 E;  3SWN C;  4YRL A;  4HVU A;  1TXQ A;  5GAM d;  4FU6 A;  3A8H B;  2D8J A;  1S1N A;  3LH0 A; 
#chains in the Genus database with same CATH homology
 3MEV A;  1EOV A;  4KR2 A;  3NEL A;  3CBO A;  4ZN3 A;  2RD1 A;  3KXT A;  4E7K A;  2C8M A;  3MCA B;  5GAM e;  3HXU A;  1I8F A;  3TRE A;  4ME7 A;  2XDP A;  1KQS A;  3WVE B;  4BE0 A;  2ODR C;  1NJI U;  1YJN T;  2ALY A;  4PJO C;  2DK3 A;  2LT4 A;  5LJ5 h;  2C06 A;  3OYD A;  3A5Z B;  4P71 A;  4MML A;  5A0G A;  5GAN d;  2E1H A;  1EVL A;  5A2Q E;  3P8B B;  5GAN 5;  1WYD A;  1UGQ B;  5GMK h;  3FC3 A;  3SWN B;  1HXD A;  1LNX A;  3OYA A;  5FLX E;  1BI1 A;  4NS5 A;  2PUK B;  3CPW S;  1W2B S;  5GAN e;  4DQ2 A;  3A74 A;  4M75 D;  1N27 A;  3OMG A;  4XTX A;  4A53 A;  2HQX A;  2AMC B;  3CCU A;  4HCB A;  3PIO A;  4M7A D;  2LQK A;  5CKD A;  4WF2 A;  3SFM A;  3PZC A;  2ZIM A;  3CBP A;  4PJO B;  3MF1 A;  2DIG A;  3OSV A;  1X01 A;  1H4Q A;  3QYH B;  2VXF A;  4K87 A;  1BI0 A;  4C92 F;  1Z7M A;  1X55 A;  2LDM A;  1H4V B;  2E5Q A;  2ZIN A;  2HD0 A;  2I4N A;  3GNG A;  1N9S A;  3HPW A;  2Y4Y A;  4C8Q C;  4M78 F;  2M0O A;  4LD9 K;  3OB9 A;  3CCR A;  2L3R A;  3M59 A;  3VQY A;  4OGC A;  1SRY A;  3OA6 A;  2RJF A;  4F7U E;  3BJU A;  2RM4 A;  1H4T A;  1XOV A;  4B9W A;  1D3B B;  3UT1 A;  4BUG A;  4P72 C;  3QPH A;  4XU3 A;  5DLO A;  3JSC A;  4OB1 B;  3UH0 A;  4KUI A;  2KAF A;  5HK3 A;  4EMG A;  4IUR A;  4HT4 A;  4BY6 C;  3MO8 A;  4KUD K;  3I56 A;  2QQA A;  4E7L A;  2L89 A;  2ZZE A;  4HVC A;  3ICA A;  2RHZ A;  4OMF B;  4XK8 E;  1U8R A;  4P3O A;  4J6X A;  2X35 A;  3HP9 A;  1NJI C;  4C8Q B;  3HTZ A;  1VQ4 T;  3M55 A;  3JB9 F;  1R8O B;  2X4W A;  4KQE A;  1PSF A;  2DTO A;  4FSX A;  1KQ2 A;  2R58 A;  3CPF A;  2AKW A;  5C51 B;  4TVA B;  1VQZ A;  4M77 F;  3RES A;  5CIU A;  4M75 A;  2PUO B;  1YFR A;  4M7A A;  2RHY A;  4BY6 B;  5GAO l;  3M53 A;  1ADJ A;  5GAN 8;  1ASY A;  5LJ5 f;  5CQY A;  3TEG A;  5DLQ E;  2OTJ T;  3PFS A;  3JB9 H;  1N6A A;  1J5W A;  4XAX B;  2K2V A;  4DOV A;  3CCQ A;  4CS2 A;  3KBG A;  2QEX A;  3OMC A;  4OP0 A;  4XTY A;  4HCZ A;  3VUZ A;  5GAN h;  4E51 A;  3V8L A;  1K8A C;  2E6Z A;  4MDX A;  2EQJ A;  4YCV A;  3CC7 T;  3M58 A;  2LTO A;  3OS1 A;  4BDY A;  4WJ4 A;  2CZ6 B;  2QI2 A;  2R5A A;  1JJC B;  1UGP B;  2X4Y A;  3BDU A;  3HRK A;  4MDW A;  1BI2 A;  2VXE A;  4HCC A;  4YRQ A;  1U1T A;  4KBM B;  3QBY A;  3HRT A;  4HWR A;  3M56 A;  3M5A A;  5IN1 A;  2ARU A;  1O75 A;  1QVG S;  4VUB A;  2ZNJ A;  4YCW A;  2Y90 A;  1RI0 A;  1EFW A;  2EJ9 A;  2R5M A;  3PGG A;  3PNW C;  3L4G B;  2EL9 A;  2PU9 B;  1U1S A;  2EFI A;  2IY5 A;  2VC8 A;  4ELZ C;  3TU4 K;  2E5A A;  3OYE A;  4G85 A;  2AKW B;  2MMP A;  3X28 B;  3WVD B;  4E7I A;  4C5E A;  3HFN A;  4H2V A;  4XEM A;  4DPG A;  4HA8 A;  4BI4 A;  3VUB A;  1P92 A;  4A4E A;  1WJR A;  1BI3 A;  4M7D C;  1ZHI A;  1PYS A;  2WSC E;  1QVG A;  4PHC A;  4BI8 B;  1DJ7 B;  5FRN A;  3M9Q A;  1XNI A;  3OYK A;  2HBP A;  3QSU A;  1K9M U;  4BD3 A;  3GLX A;  4YRM A;  4MMK A;  3HY1 A;  4C8Q E;  2X4X A;  4HWT A;  2A7Y A;  2QHS A;  4N4G A;  5FRM A;  4YRI A;  3HXW A;  3A8O B;  1VQ8 T;  2DJZ A;  1NYR A;  3REU A;  1V29 B;  2DXC A;  2P4T A;  3G7Z A;  5GAM f;  4WJ3 M;  3HRI A;  3IKL A;  4YRT A;  4M7D B;  2DU7 A;  5GAO p;  1E24 A;  5CQX A;  4OB2 B;  4EO4 A;  4EDU A;  2DXB A;  3VQW A;  3F70 A;  3VYG A;  4TTV A;  3L2R A;  2CJA A;  2C7I A;  1QW1 A;  1Y71 A;  3GPL A;  4H2S A;  5GMK e;  2P0K A;  1M1K U;  1VQ7 A;  2K5F A;  1WLE A;  3RL6 A;  2BUD A;  1QVP A;  2G4C A;  2D0Q B;  4OB0 B;  4N4I A;  2Q7G A;  3JCM Q;  3UFG A;  3QO3 A;  4CH6 A;  5CVI A;  1LOJ A;  1NJ5 A;  4M75 G;  3RF1 A;  1UGS B;  3RMQ A;  3M4Q A;  3L2Q A;  3HKS A;  5GAN f;  1VQN T;  2FL7 A;  4M7A G;  2L8D A;  4A4K A;  4DOW A;  4YRJ A;  4LDV A;  3FEO A;  2CYZ B;  3HL8 A;  2D6F A;  3JAM E;  3OS2 A;  2VV5 A;  5LJ5 j;  4PLI A;  3PT9 A;  2A3L A;  2CS7 A;  4J5Y A;  2PQW A;  1KOG A;  2EKO A;  2ZT5 A;  4YPF A;  2JN0 A;  3PCO A;  3OBW A;  1HTT A;  3TUP A;  4C92 D;  3JB9 I;  1PYS B;  4OLF A;  4TVY A;  2EQU A;  2ZZF A;  5DM7 R;  5L8R E;  4PNO A;  4GY5 A;  3E9I A;  4JUV A;  2EQK A;  3OYY A;  3NTH A;  3JB9 J;  2PME A;  4FL6 A;  5C6S A;  3CCV T;  4M78 D;  3E9G A;  3WXM B;  1YHQ A;  3M4G A;  4X9D A;  3CCE T;  5CO7 A;  3E9H A;  1B70 A;  4IUQ A;  3OBY A;  1K9M C;  1VQK A;  4MZT A;  2PVG B;  4K88 A;  4ZN1 A;  1KG1 A;  4UP7 A;  1IL2 A;  4J6W A;  2VGM A;  4LDU A;  3FDR A;  3OYJ A;  2NS6 A;  4XTW A;  3OQ5 A;  2XGT A;  3I7F A;  5ELO A;  3OY9 A;  3QYG B;  3JCM J;  2OAU A;  3CCM A;  2RK1 A;  2QDY B;  3L2V A;  2RI2 A;  3GNF B;  4PKC C;  3I55 T;  2P5I A;  3CXC A;  4EMH A;  2QHT A;  3CME T;  3G4S A;  1I5L A;  1YIJ A;  3AHU A;  3SDZ A;  5FU6 C;  4CS3 A;  2DTI A;  2RI5 A;  2IG0 A;  2CZ7 B;  3CCE A;  1VQM T;  1JJ2 A;  3QZ9 B;  2Q7E A;  1VQO T;  1M1K C;  3LGF A;  2LT1 A;  3JB9 D;  1FX7 A;  1G5V A;  4H2U A;  2XHC A;  3ME9 A;  2Q7H A;  4PJO F;  2ZT7 A;  1VQL T;  5I2M A;  4YRC A;  1VQP T;  4M77 D;  4O6J A;  2DQ0 A;  4JS4 A;  1UGR B;  2F5K A;  1NJ6 A;  3I55 A;  4LVM A;  3X24 B;  3CME A;  5LJ3 d;  2RJC A;  3C95 A;  4P73 C;  4RDX A;  3V8J A;  4P3N A;  3LSQ A;  2ZTG A;  4M7D E;  5FU6 B;  2QQS A;  2DU5 A;  4TWA A;  3JCM g;  1VQO A;  3MEY A;  1USY A;  3HXX A;  5LJ3 e;  3S3N A;  4C92 A;  4F7U G;  2L5Q A;  2QTX A;  1NPR A;  3INZ A;  3QKJ A;  4BW9 A;  1VQP A;  2GQV A;  3JCM b;  2NLU A;  3QG1 A;  4OVA A;  4YYE A;  2LNV A;  2ZGW A;  3NEM A;  2MWP A;  3EFS A;  3G1Z A;  3BFM A;  4M78 A;  1YJN A;  2DDZ A;  4OB3 B;  3JRZ A;  5GAM j;  1LYL A;  4RQF A;  4TVR A;  4II1 A;  2O4X B;  3MET A;  3G71 T;  5DY9 A;  2DZ9 A;  3QJY A;  3CC2 T;  2JTM A;  3J81 E;  4ZTZ B;  2XKO C;  3H6Z A;  3SD4 A;  4C8Q F;  2I4L A;  2D9T A;  2ZCF B;  2BIV A;  4IUV A;  3P8V A;  2XDD A;  1K8A U;  4P71 C;  4QVZ A;  3HFZ B;  2QHU A;  4J7I A;  1Y07 A;  3CPW A;  4NOY A;  1W2B A;  3OYB A;  2XG8 D;  2QQB A;  4Q15 A;  5GAN j;  4N0A A;  2R57 A;  3S3M A;  1YFS A;  1WGS A;  3V7S A;  2VYT A;  3E1S A;  1KMN A;  2QXF A;  3G71 A;  3BW1 A;  3TEH A;  4KR3 A;  2CZ0 B;  4UC4 A;  4LVJ A;  2RHQ A;  4M77 A;  2G3R A;  1AHJ B;  5GAO r;  4B9X A;  4KT0 E;  3BDL A;  1NZ9 A;  3QXE B;  4J7F A;  2JZ2 A;  2EJF A;  2ALY B;  5C52 B;  3QNE A;  3CCS T;  3X25 B;  4X5O A;  1NPP A;  2WSF E;  2GFA A;  5GMK m;  1M9S A;  4CH3 A;  1NJ8 A;  4C0F A;  3CMA T;  1B76 A;  3A7A A;  2GFU A;  1K73 U;  4P75 A;  1G5H A;  3CC4 T;  3N5B B;  2I4O A;  3S3O A;  4MZP A;  1EIF A;  2ZPI B;  4LD6 A;  5C53 B;  1QVF S;  4M78 B;  4RG8 A;  4RCC A;  1BIB A;  3X20 B;  4LDY A;  3FB9 A;  1YJ9 T;  3HHT B;  1VQ4 A;  3LLR A;  1Y96 A;  3MHX A;  3FIF A;  2RJE A;  3QO7 A;  2H3J A;  1WQW A;  3QHS A;  4MZM A;  1VQ6 T;  5CR2 A;  5KH6 A;  2EWN A;  2QA4 T;  4FIB A;  4TQD A;  5LJ3 h;  4C5G A;  1BKB A;  4YRN A;  4P74 A;  3EAE A;  3QDR B;  3MP6 A;  1ZQ1 A;  2K57 A;  5KCO A;  2E10 A;  3P8D A;  2K3X A;  1WU7 A;  1BIA A;  2XID A;  2DXT A;  4A54 A;  2XU8 A;  2ZPH B;  5KNN A;  1XQH A;  1E1O A;  2OTJ A;  3PTA A;  4M75 C;  5AYF A;  4D6W A;  4JRI A;  3VYH B;  1N8R C;  3OYC A;  4PJO E;  4HWO A;  4RCB A;  3QO8 A;  4X9C A;  4M7A C;  3OYM A;  3NTI A;  5K1X A;  1Y7X A;  3QZ5 B;  4C92 G;  5D6W A;  4GLK A;  3C12 A;  1G51 A;  1WJS A;  5FRO A;  3RKY A;  1Q7Y C;  4E7H A;  1Q86 C;  2ZCE A;  1UB4 A;  3CC7 A;  1Q82 U;  2QHV A;  2DTH A;  2RK2 A;  5HGQ A;  1X75 C;  5KE2 A;  1M5Q 1;  4M78 G;  3NTK A;  1EVK A;  3DB4 A;  2ARS A;  2DQ3 A;  1I4K 1;  3UGQ A;  5LJ5 g;  4YRE A;  4M7D F;  4BE1 A;  1K73 C;  2ART A;  3VBB A;  1KQ1 A;  4M75 B;  3IG2 A;  5ELN A;  5C0M A;  3NEN A;  1S72 T;  4CS4 A;  1B7Y A;  3CD6 T;  3PMI A;  4M7A B;  2XDB A;  3ERR A;  4KUL A;  3ZBD A;  2RHU A;  4RQE A;  1VQ5 T;  2AHJ B;  4OGE A;  3V8K A;  4ZGE B;  3TCJ A;  4RMO A;  3L42 A;  3J7A F;  1VUB A;  2LRQ A;  3QO5 A;  4YRO A;  2KY9 A;  3JB9 G;  2ZNI A;  1FXX A;  3IAL A;  3LSS A;  3MQZ A;  2BKD N;  4F7U A;  4O2D A;  4EMK A;  2XIC A;  3QTC A;  1EIY A;  4M77 G;  1VQ9 T;  1YIT T;  2EIF A;  5CCA A;  3A8M B;  4BI3 A;  2DIQ A;  3OYI A;  4PJO D;  3M54 A;  4RMF A;  2K4Y A;  2M9U A;  3G6E T;  5E3I A;  4QQG A;  5J3B A;  5CAI A;  2P0P A;  4NCX A;  5J39 A;  1GGM A;  4YRG A;  4UP8 A;  1X2G A;  3DB3 A;  3W3S A;  3CCJ T;  3ZFJ A;  2KMT A;  3OW2 S;  4J8O A;  1YI2 T;  5HY6 A;  1VQ8 A;  5LJ3 f;  3VV0 A;  4HT8 A;  2ZPG B;  1KHI A;  1QP2 A;  3OYL A;  3URG A;  4P3P A;  1UEB A;  2KSS A;  4QQ6 A;  4WI1 A;  1HK9 A;  1Q82 C;  1M90 U;  2IY5 B;  1N9W A;  3HRS A;  3RIR A;  5I2S A;  4JDS A;  1JBM A;  4YP0 A;  2DAQ A;  5D6X A;  1M1G A;  1WJQ A;  1G5I A;  2EAY A;  4YTL A;  2CZ1 B;  3ZEH A;  3A5Z A;  4RKU E;  5GMK j;  2OTL T;  4C8Q D;  1Q81 U;  3X26 B;  2HQE A;  1YBY A;  3C4S A;  3QII A;  2DVE A;  3DLM A;  3OYN A;  1VQN A;  1RIQ A;  3OW2 A;  3SWN A;  2DD5 A;  2ZT8 A;  3UWN A;  5KCH A;  4XU2 A;  2DZC A;  5CK9 A;  5GAM g;  3A7U A;  3M4Y A;  4AH6 A;  2QQ9 A;  4ZTJ A;  2AMC A;  4F7U B;  3A31 A;  1NJ2 A;  4H2Y A;  1O9S A;  2DPP B;  1C0A A;  4E47 A;  4Y28 E;  1VIE A;  3PIP A;  2Q5I A;  1JRI A;  4ZIB A;  5FU7 C;  4PJO A;  2P0L A;  2ZR3 A;  3NFC A;  1MGQ A;  3P8H A;  4XTZ A;  1G3T A;  3PMT A;  5GAN g;  3CCV A;  1X2H A;  1H64 1;  2LCC A;  2RH2 A;  1B8A A;  2XK0 A;  3LGL A;  3UPU A;  4ELY C;  1BBU A;  2WAC A;  1PSE A;  4UPA A;  1RL2 A;  5HKC A;  3DLL A;  4R55 A;  2ZPF B;  3FLG A;  1E22 A;  2WSE E;  4BDZ A;  1M4Z A;  3L2U A;  1D3B A;  4XTV A;  5FU7 B;  1KC8 C;  5F5W A;  2K5L A;  3KFU A;  4CH5 A;  2LVM A;  1M90 C;  1YFT A;  3UDC A;  2JNG A;  4A4G A;  5HK0 A;  2JTF A;  3VU3 C;  3CCU T;  1VQM A;  2FVU A;  2Y4X A;  3Q1J A;  3KUF A;  3CCL T;  1B34 A;  5GAN 6;  3PCO B;  4OF1 A;  2E3C A;  4C8Q A;  1SET A;  4ZGD B;  1VQL A;  2HNI A;  2E12 A;  3OYH A;  1L0W A;  1Q81 C;  5GAN 2;  3FRN A;  1SSF A;  4HWP A;  3MP8 A;  4TVA A;  4YDQ A;  1X54 A;  1QF6 A;  4JRQ A;  4A4F A;  1JB0 E;  1B70 B;  4XEO A;  4LVK A;  4P72 A;  4LVI A;  3A8L B;  4BE2 A;  5IAY A;  3V7C A;  3RKW A;  3OS5 A;  4C0D C;  2FHD A;  3CCR T;  1KD1 U;  1H3Z A;  3CCL A;  4YCU A;  2F5T X;  2KVQ G;  1W66 A;  3TEE A;  2PVD B;  4ZTF A;  3P8Y A;  4NL3 A;  2CJ9 A;  2ZR2 A;  3JCM d;  1NE8 A;  3T9N A;  5LJ3 j;  3E9F A;  1X6O A;  4X34 A;  5K1P A;  1IZ6 A;  4RG2 A;  3RAC A;  3I56 T;  2K5I A;  4LNS A;  1USY C;  2YLB A;  4EX5 A;  4R56 A;  1N8R U;  4C92 C;  3CC2 A;  2PVO B;  2EQM A;  4H2X A;  3JCM e;  2LX9 A;  1ASZ A;  4FM4 B;  4H2T A;  1I81 A;  2RHS A;  2RHI A;  5GAN 4;  2YLC A;  3RGL A;  1JJC A;  4C5I A;  4C0D B;  1EQR A;  4M78 C;  5CKE A;  2V8J A;  4M7D D;  1Z7N A;  4PL6 A;  1Q7Y U;  1Q86 U;  4QVD A;  1QP3 A;  3H8Z A;  4DA4 A;  1WNL A;  1QE0 A;  2A8E A;  4ZGJ B;  1NJ1 A;  1X56 A;  2E70 A;  4HT9 A;  2YRV A;  3GP8 A;  2E64 A;  3M4P A;  3GF5 A;  2RO0 A;  2MAM A;  5GAO m;  1B34 B;  1YCY A;  3L4G A;  1W4S A;  2FYK A;  2DKG A;  4C92 B;  2MWO A;  4YRR A;  3HXV A;  2ZT6 A;  4XQ3 A;  4EPC A;  3JCM V;  2ZXF A;  3L2Z A;  1LJO A;  4N0A C;  4YRP A;  4L59 A;  4PJO G;  3CCQ T;  5CKH A;  3MEW A;  4YRK A;  2QEX T;  3RMS A;  4YRS A;  3CCS A;  3RER A;  1OZ3 A;  5I21 A;  2JUF A;  2M1H A;  1KHC A;  5GMK l;  3E19 A;  5GAM h;  4M77 C;  2CJB A;  4XTU A;  4P5N A;  1ZBX A;  4Z02 A;  3CMA A;  3R6O A;  3HFO A;  3IKM B;  2DD4 A;  3FJP A;  1YB3 A;  1KD1 C;  3CC4 A;  3JCM P;  5A0L A;  4PG3 A;  4LVL A;  2EJG A;  4QQD A;  1WQ7 A;  5CKB A;  4G84 A;  4IKF A;  1BBW A;  4QW2 A;  4M75 F;  3RUX A;  4Q6G A;  1YJ9 A;  2LCL A;  1ADY A;  1NYQ A;  2MI6 A;  1QVF A;  4P75 C;  4M7A F;  4XU0 A;  1YGB A;  3TEH B;  3O8V A;  4H2X B;  4PLL A;  2DXU A;  3HSB A;  1VQ6 A;  2RHS B;  3HFV A;  5KE3 A;  2RHQ B;  4M77 B;  2CGH A;  4JLG A;  2RA2 A;  2QA4 A;  1OZ2 A;  3LC0 A;  4M7D A;  2YHT A;  1IRE B;  4N4H A;  4C8Q G;  2ZPE B;  3CBM A;  2VGN A;  3REX A;  2ZIO A;  1SER A;  2J3L A;  3ASK A;  3VQV A;  2XI9 A;  4L87 A;  4C0Z A;  1VIF A;  1GXI E;  4CRI A;  2K3Y A;  3BY7 A;  4TQF A;  3MEU A;  2KDS A;  4P74 C;  3OYF A;  2KK4 A;  4IUP A;  3V7R A;  3JCM h;  3WQZ A;  2E41 A;  2GF7 A;  4FT4 A;  12AS A;  4JJN K;  4XU1 A;  4JRP A;  3EFR A;  2ZPB B;  3L1A A;  2RHX A;  3UGT A;  2QQR A;  2KQW A;  3QJ6 A;  2PMF A;  11AS A;  2E65 A;  1G3W A;  3DSQ A;  1Y96 B;  2ZZD A;  2JOY A;  3GOX A;  3QUI A;  2V8I A;  4E7J A;  2XTI A;  4ZTU B;  4BAC A;  2DO3 A;  1FWZ A;  3LWH A;  4H2W A;  4K86 A;  3OYG A;  2LC4 A;  1E1T A;  3OSS C;  1S72 A;  4IUU A;  3CD6 A;  4C92 E;  1VQ7 T;  2ODR D;  3RKX A;  2ZZG A;  1G3Y A;  1VQ5 A;  5LJ5 d;  3M57 A;  4HWS A;  2FB7 A;  1TH7 A;  4UP9 A;  3LYI A;  4M78 E;  5M9O A;  1N9R A;  2J3M A;  1FYF A;  5EG2 A;  3L2W A;  4L6V 5;  5J26 A;  2CKK A;  4LDW A;  5GAN 7;  3A32 A;  1OI1 A;  5LJ5 e;  2HAX A;  2EYQ A;  3A5Y A;  2P0Q A;  2VUB A;  3A7R A;  2V8K A;  3LW5 E;  1VQ9 A;  1YIT A;  5D6Y A;  5GMK i;  2XD0 A;  1KC8 U;  4F7U F;  4BWA A;  2I2L A;  4TVW A;  3A8G B;  3R07 A;  1H4S A;  3S6W A;  4V2S A;  2IVW A;  4JRK A;  4J83 A;  3HRU A;  3G6E A;  4YRF A;  2E6N A;  4J6Y A;  4EMK C;  3LWI A;  3JCM X;  1MHN A;  1SES A;  3HXY A;  4QVC A;  2O01 E;  2DEQ A;  3HY0 A;  3CMQ A;  3CCJ A;  2I4M A;  5IT9 E;  2B8A A;  4JLI A;  1YHQ T;  1B7Y B;  1YJW T;  1G3S A;  5GAO q;  1YI2 A;  1VQK T;  1XTD A;  4M77 E;  3CEY A;  4CH4 A;  3HXZ A;  2RJD A;  5GAN 3;  4A4H A;  1NNH A;  2RI3 A;  4IUT A;  3CXC S;  4L5G A;  5CKF A;  5LL6 S;  3VJP A;  1KMM A;  4BB7 A;  3VKI A;  3CCM T;  3DKM A;  2LQ8 A;  2MF2 A;  3MF2 A;  2CIM A;  4Q5W A;  3ER0 A;  1JJ2 S;  3SB2 A;  3G4S T;  4C0G A;  3OD1 A;  1BYM A;  3GIB A;  2M16 A;  1YIJ T;  4EMK B;  2RB6 A;  1OYX A;  3VQX A;  3JCM f;  1EIY B;  3MP1 A;  4HKE A;  3NET A;  4O5V A;  4J15 A;  1M1F A;  1HC7 A;  4NL2 A;  4M7D G;  1YJW A;  1ATI A;  2O4X A;  1M8V A;  2OTL A;  3JCM c;  4JS5 A;  4M75 E;  2Q5H A;  2X4J A;  4P73 A;  3OS0 A;  5A0D A;  4M7A E;  1KQS S;  5LJ3 g;  3JCM W;  4ATO A;  4FT2 A;  4Y91 A;  4C5H A;  3LX7 A;  1WPY A;  5GAO n;  3HFZ A;  2GCX A;  4H02 A;  3MEA A;  2F69 A;  4CI0 C;  4LDX A;  2JVV A;  3C94 A;  3P8T A;  3J80 E;  3SWN C;  4YRL A;  5GAM d;  4FU6 A;  3A8H B;  3LH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...