3V7CA

Cystal structure of sabpl in complex with inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 103
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7cA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7cA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7cA02
3J7AO 4H2TA 2FA5A 2CGHA 4P74C 1IAWA 4K88A 3E5QA 4F7UA 1MDMA 2UXNA 2M8EA 3R0JA 3L2CA 3O6BB 4HDVA 3MCZA 1PYSA 1MJ9A 4LB6B 5E20A 3KCCA 1YTYA 2DU9A 4AWXB 3ICAA 4HYEA 1SFEA 2ZIOA 2ETHA 3RKXA 4NL2A 4P71C 2GZWA 1U1TA 1JXSA 1ASYA 1EOVA 1FYLA 4HW0A 5GAMd 4KR2A 3QP6A 5HS8A 2H09A 3V7RA 5F6FA 2D2WA 4Q5SF 5HLHA 4J6WA 3HFZA 4HX4A 4C8QC 4NHJA 1FBUA 4LLLA 1U78A 1G4DA 1YW8A 1DDNA 2W25A 3BJUA 2MA3A 3INZA 2HR3A 1NJ5A 3LA7A 3WTUC 2CGPA 4TVAA 5DD4A 2X4HA 1BI0A 3I71A 3HOSA 1U5TA 3J81K 2XKOA 5CVIA 4L9JA 4RGUA 2BYVE 2FNAA 5DUIA 2RHSA 2WC2A 1BN5A 1O3RA 1NHAA 4ZTZB 1E17A 2ZT5A 2MLGA 3HRMA 3P7NA 1EVKA 5DY9A 3IL2A 1L0OC 5FLXK 1H4TA 1AOYA 4BHBA 3P9CA 3FM5A 2XUBA 3F8CA 1MJBA 1X54A 5FD5A 3NEUA 3E3VA 5D4SA 1U8RA 3JCMe 4KQEA 2KKOA 5BPDA 3JB9F 1LJ9A 3LQQA 1H9GA 4A0ZA 3L4GB 1R36A 4X5OA 4YPFA 3PQJA 2A3SA 4C92A 5C51B 4UP8A 2G7HA 1HSTA 1SD4A 1ATIA 1XCVA 4YROA 5ERIA 1KQ9A 3LAPA 1FX7A 2P0LA 3RJPA 1WI9A 4JRKA 5A2QZ 4G6QA 4CICA 1EH8A 2Z99A 4KNYA 3UGQA 3CUQA 1G51A 5DUKA 1EVLA 1ZRFA 4IVNA 1B76A 4TTVA 3F6VA 1D5VA 1T2KA 4LNSA 4XSZF 5HDGA 3NEMA 1LDKB 4M73A 5ED4A 1FBSA 4EMKB 1JRIA 5DDGA 2CYYA 4V2SA 1R5GA 4IJAA 5EEGA 2HFHA 3CO6C 4O5VA 4U7BA 1G5IA 3OV8A 2V1XA 3C18A 5JFRA 1Z91A 3QHSA 4J15A 5HDNA 3F21A 2PMHA 4UUVA 1GVJA 3F3XA 2D45A 3HY0A 5ICFA 4KA4A 2PMFA 4JK1X 1UHMA 4JBAA 1KU9A 1S3JA 4YRQA 3QU6A 4P73C 5JR3A 4P5OA 4U0WA 1IF1A 1NJ6A 4A6DA 1KMMA 4MTDA 4J6YA 1HKTA 5D6FA 2IA1A 1B59A 4CS3A 4M71A 3ZMTA 2L3DA 1B70B 3KZZA 4NL3A 4F7UB 1MDMB 5H6QA 2EJFA 3OOPA 4P3PA 1FP1D 1E1OA 1SD5A 3GFJA 4LK0F 4OOIA 4XTXA 4KFCA 1Z05A 2DXTA 3VOEA 1U1SA 4HT9A 5GAN2 1EQRA 1UCRA 4PJOE 4WJ4A 2PFBA 3VQWA 5LJ3h 4CH3A 4O3MA 3WGHA 2VBYA 1ULYA 5CAIA 2X0LA 4XEOA 3K69A 1G6NA 3GVAA 4WJ3M 4U88A 4LLGF 3GF2A 1PDNC 1DPUA 1B1BA 4YRGA 4G85A 3JB9H 4LGWA 1WKMA 3MF1A 4PG3A 3RF1A 5GANg 2ZKZA 2JN0A 2ZCEA 4CH4A 5HDKA 3D5LA 4PCQA 4GGGA 5EEHA 4PJOA 4M7AD 4CH6A 2QHUA 2YLBA 2ZXJA 1E22A 3A7UA 1TNTA 2KIUA 4M7DE 1QQIA 5FFXA 2W85A 4FHTA 4WX9A 3QO7A 4M9SA 4MHGA 2QUFA 3V7SA 4L0YB 1ADYA 3C7JA 1D3BA 1P92A 1WQWA 3SWNA 5E8IA 4MGRA 3QO5A 5E1WA 3JCMh 3WODF 3GXOA 2BEOA 4HOBA 4ZYHA 1AWCA 1Z1DA 4QLCU 2ODRC 2V1UA 1T38A 1SRYA 5GAOl 3DV8A 2YU3A 4PJOF 5HLGA 1LB2A 4EVIA 2VBXA 3BROA 1R1UA 1S6LA 2IA0A 2VN2A 3D0SA 2PLYA 3EDPA 3R4KA 1BI2A 2E64A 3OD1A 4A5MA 1Y0UA 3Q5FA 2VBWA 5LJ3j 1JGSA 2H6CA 4M7DA 1XDUA 5JVTA 3E6MA 5L3EA 3JCMX 2AKWB 5GMKh 1KQ2A 4M77B 2ALYB 1XGSA 5CVUA 3M8FA 3HRUA 1QZZA 2V6CA 3BP8A 2E7XA 3LA2A 4P75A 1XCBA 2XROA 1W4MA 5LJ5d 3LQRA 2EK5A 1LOJA 3P8TA 4H2XA 1EV7A 2B0LA 4P55A 3RYPA 3U2RA 4KYWA 1NJ2A 4I7HA 4M7DF 5E18F 3I59B 1IXSB 1EH7A 5L3BA 2BV6A 5GAN4 3BWGA 1GGMA 2LSOA 2FMLA 4AIHA 4ENMA 3EFRA 3RPQA 2EFQA 1OPCA 3IRQA 1JJCA 1V3FA 4LD5A 4B8XA 4M72A 4F7ZA 2PMEA 1R1TA 3BW1A 3A74A 2DTHA 3EYIA 3PQKA 4KMUX 4PNOA 5HGQA 1I1SA 2M1BA 3FMQA 3K9TA 4OU0A 4M77D 3JCMP 3G73A 4TVYA 2EFWA 2E41A 3V7CA 3ERED 2STTA 4PHCA 3JCMb 4KDPA 2ZR3A 4HLXA 4YIFA 1G3YA 4M78E 2ZTGA 3MQ0A 1BIAA 2R7DA 5L3GA 2YX4A 2EWNA 4Z2YA 1BBUA 3SHFA 1IXRC 3H92A 3M9AA 4MNUA 3HTUA 5GMKj 4M9ZA 4HV6A 3RDIA 3P9IA 2VE9A 2KIMA 4YCVA 2QHTA 2BE5F 3FB9A 3A7AA 4ETSA 2IP2A 5GANf 4EO4A 4Y91A 3JAMK 1R5HA 1ON1A 4RDXA 2EFPA 5CLSA 1HTTA 3WG9A 1YFHA 4I98B 4AH6A 3KZYA 5GAOr 4G94A 4UHTA 2YPRA 2ELHA 3NETA 2Q7GA 4C8QB 4DPGA 2JPBA 3CTAA 1F4KA 4BH9A 4AIJA 4M78A 3GLXA 1FYMA 2PEXA 4L87A 3GEZA 1FWZA 2HTJA 3MF2A 2ZGWA 5I21A 4LG0A 3E5UA 3VQXA 2DPUA 3BDUA 1IUYA 2CIMA 2DVEA 2YSRA 3JTGA 1USYA 5GAN5 1F1ZA 2R3SA 4O6JA 1U5TC 5D8KB 4L5IA 3J81Z 5FFZA 1H9TA 2AXLA 3TKYA 4RCBA 4M78F 2L02A 1CF7B 4OIQF 4H2YA 3HRTA 3IALA 1QE0A 4A12A 1Z9CA 3V4GA 3HXWA 2ZMEB 4EJVA 2ZBKA 1R00A 5KK1A 2HEOA 1B7YA 5LHGA 4PGGA 4C8QD 1KA8A 1KQ1A 3RYRA 5FLXZ 5IT3A 2E3CA 4B09A 4YRKA 1ZAOA 3BDDA 1VTNC 1WLEA 1ZGJA 3IHUA 5C52B 4OLFA 2ADUA 2M5WA 3U9GA 1ZN2A 5GAOn 1YW7A 3UFGA 1SFXA 1MKMA 3KLNA 4EV0A 1KU7A 3N97A 1J75A 4RB2C 2O3FA 4PGHA 1ZLKA 1ONVA 3RKYA 1TQMA 3IRRA 5K5RA 1P6RA 2GWRA 2YR2A 3GWZA 4C92C 3BJ6A 3F8MA 1GXQA 3QPHA 2ARSA 1TW3A 1ZARA 2KJCA 3IKMB 4M75G 1G3WA 5LHHA 3N4MA 4H2SA 1C0AA 4ESFA 1I4K1 3CUQC 3I53A 2RHQB 3KE2A 2O8XA 3T8RA 2ZIMA 5D5UB 4YIIA 3I5UA 1S8NA 4HDUA 3HXYA 4ZH4F 2GXGA 1UHWA 5L3CA 4H0EA 1G3SA 2NNYA 2DJZA 1IN8A 1G3TA 4M7AE 3FIFA 4I0BA 3NENA 2CG4A 2E65A 3QNEA 5GANe 1OYWA 4YRIA 4I2OA 1P2FA 2ZZGA 4PJOG 1R23A 3RGLA 1H641 1YYVA 1KU3A 4PDKA 2LF8A 4LK1F 2M45A 3FX3A 3L1AA 4L5JA 1SMYF 2I4MA 4HVCA 2Z3YA 4Q47A 2EAYA 1FLIA 2JTVA 2HQRA 4G7HF 2P5VA 3QAHA 5DCMB 1T6SA 2GA1A 5LEJA 2Y75A 1N9RA 3HFVA 1MZBA 4IPAA 3VQVA 3HXZA 2VOPA 5H6RA 4KN7X 3KFUA 1Z6RA 3F8BA 3TO7A 3VEPA 1BI3A 4YRPA 2MC3A 3FXUA 4EJTA 4RGRA 2ZXFA 3VFZA 4EGYA 4M7DG 3I7FA 3V8LA 4DNCA 3ERRA 2HQNA 1Z7MA 2FB7A 4M7AF 3DKWA 1L0WA 1S29A 3FMRA 2G4CA 2P7VB 2ZNYA 2JRTA 1DPRA 2I4LA 1KOGA 5LRSA 1H4SA 3TOAA 3KP2A 2VC8A 4J6XA 1QGPA 4FT8A 2RN7A 2HDCA 2IVMA 1OMIA 3CLOA 4ASNA 3HUGA 2GXBA 2XAJA 3P9KA 4UP9A 1SAXA 5CJ9A 3GYHX 2A6EF 3WU1B 1SFUA 3QPTA 2HYGD 4PJOC 1KQ8A 4EGZA 1W5SA 5DCFA 3M4GA 1YGBA 4EMHA 2DK8A 4TWAA 2QHSA 11ASA 3JCMV 1XGOA 1KYZA 1WNLA 3WTYC 1K78A 3SWNC 1U6GA 4GYGA 1LNWA 1WRJA 4RB1A 4IRHA 1STZA 2QLZA 1EIYB 2J5OA 4WXCA 1J59A 3S2WA 2ISZA 2VC0A 3PCOA 1MD0A 2Z33A 3ML6A 1REPC 1A04A 3W3SA 4MQ9F 1SESA 2P5LC 2IY5A 2ZNJA 4XTZA 3WTTC 2L4MA 3MZYA 4ZZDA 2PJPA 2PI0A 4CS2A 2XAHA 1XDSA 4YRMA 3KP4A 3E5XA 1IW7F 5TJJA 3NELA 2F5FA 3BFMA 1W7PB 3FXRA 1YQAA 4N0AA 1LVAA 3GUDA 2TDXA 2A68F 1LNXA 4JUVA 1B6AA 3L9FA 3QTCA 2ODRD 2VONA 1FYKA 5LJ3d 4P75C 5BS6A 1QO0D 2C6YA 4G7ZF 3JCMc 5AONA 5GANh 4FX0A 4M78G 3O2PE 1FSEA 1FYFA 2OD5A 5GAOm 4ESBA 2P7CB 2RM4A 3TEHB 2EFNA 3BY7A 3H3UA 4OIPF 2HTSA 1H4VB 2K4JA 4JQFA 1S7OA 2F2EA 5J8FA 4M75E 1IN7A 1Z7UA 2ZT8A 1NYQA 3E6DA 1TQIA 4O2DA 1LDDA 1YS6A 4WWCA 2C8MA 1KGSA 2ACJA 1MGQA 2H94A 3CMQA 4RAZA 4D0PA 1J5WA 2HYFA 4P3NA 5DEQA 4EX5A 1YIOA 4U0YA 4TVWA 5GAMg 5IT9K 2CFXA 3JCMd 1PYSB 2DU5A 1K7AA 2WV0A 4WXHA 2EJ9A 3U1DA 1BOAA 2AS5F 4M75A 2DZCA 2GA2A 2L01A 3QO8A 3WTXC 1XB4A 3IKLA 5J6XA 2DAOA 3ECHA 3SXYA 5K1PA 1WYDA 5LBQA 2PN6A 3QRFF 2E5AA 3FZVA 2RV8A 5GAN6 3HHGA 1YG2A 5GAN3 2COMA 4BNCA 3RACA 3JAMZ 4MMLA 4G8XA 2MD5A 4R1HA 2GQQA 1KMNA 1R22A 2FXAA 3A31A 2CWEA 4M75F 5GANj 2CJBA 3HFZB 1LEAA 5AIQA 4YFNF 2O03A 1WQ7A 1HSJA 1JBMA 1WSUA 3WGGA 4AIKA 5HS9A 4M78C 3A32A 3HXXA 5FB2A 4HZFA 2ZR2A 1OKRA 1RIOH 4TVAB 4I02A 1R1VA 1U5TB 1HXDA 3EFSA 3HFNA 2Q0OA 1PUEE 1XSXA 3PZCA 2QVOA 4XTVA 1TTYA 3QUIA 5K1XA 2QYOA 1USYC 5J8CA 2RHSB 1B34A 2VXZA 4YP0A 3DXJF 2VXFA 3JB9J 2EA4A 2VOOA 2ZT7A 2M87A 2PBIA 5D4RA 3E6CC 4WI1A 2QTXA 3RKWA 1IXCA 1I27A 5GAN8 2FBIA 4ENNA 3BZ6A 1PP8F 4HQMA 2RVCA 5C53B 4LJZF 4MTEA 2YHTA 3H3ZA 2DW4A 2RQPA 4WF2A 2F5CA 1IL2A 1ON2A 3UH0A 3HIFA 4BXUA 5ICGA 3ABTA 2CSOA 2Z9OA 1K78B 2K02A 1FSHA 1TLHB 3KP3A 5GMKl 3JCMW 3VU3C 2J3LA 3KP5A 3BOQA 2OU2A 3DPTA 4M7AG 3LSSA 4YRSA 3MZHA 1H4QA 4A53A 4C92B 2RDPA 3ROUA 4MEXF 3FM3A 1X55A 5F5WA 2HKOA 2JT1A 3JB9D 2DTRA 4E51A 2I2LA 2NNNA 2ISYA 2H27A 2IPQX 3KP6A 2E10A 1HKSA 3HFOA 4ZIBA 3CUQB 4H02A 1DP7P 4CS4A 4OIOF 1RIQA 1Y96A 1UFMA 2A07F 3NRVA 3K2ZA 2Y90A 2QBYA 2V9VA 3R60A 5L3DA 3FHZA 2NAZA 2EB7A 3J80K 1QPMA 3W6KB 3HYIA 2OZUA 4OMZA 1X01A 5GAMf 4UPAA 2K86A 2HZTA 2Q7EA 3L09A 3VB2A 2DPDA 4BWAA 3WTZA 5D5VB 3LC0A 5JI6A 4C92D 1BBWA 3DFGA 4BAYA 3ABUA 2E1CA 2DFIA 1N9SA 4OP0A 4IF4A 4P96A 1B9NA 2FE3A 3RI4A 3PFIA 4LMYA 3K0LA 4U0VA 1VQZA 1TQPA 3ISPA 2PG4A 3IWFA 4HBLA 4I01A 3E97A 2XAFA 4RQFA 2V79A 4YRNA 1FOKA 4IHTA 3R07A 3DPLC 2KJBA 1V4RA 2IRFG 1G5HA 3LSTA 4XLNF 2KRFA 4YFKF 1I8FA 2RA2A 2NS0A 2XASA 3LA3A 4UV9A 5ICEA 5H20A 3JSOA 3RPUA 1QZYA 5ELOA 3K1NA 1J2XA 3HHHA 2XAQA 4L9NA 4HWOA 5KVRA 4DQ2A 2ARUA 4M77G 4BW9A 4KMFA 1HW1A 1BC7C 3EYYA 4XTUA 3JCMJ 2MH2A 1MGTA 1XMKA 2FOKA 1NJ8A 3DF8A 4TQDA 3WU0A 4UV8A 2I4NA 1SD6A 4RQEA 1WQ2A 2XHKA 3IWZA 2EJGA 4S04A 4HWRA 1KYWA 3TO9A 5E17F 3F72A 3F8NA 4Y15A 2FEZA 3ZMVA 3BPXA 3KP7A 4TQFA 2ZINA 1X2GA 3HSEA 2RD1A 2EFOA 2FU4A 2P6TA 2ZNZA 1YLFA 2FF4A 1J5YA 2DEQA 4YRCA 2STWA 1F5TA 4PJOB 4G9YA 1I81A 4R8HA 1BIBA 2A69F 4XU0A 4LFUA 4ON0A 4EJUA 3F8FA 2P5KA 4OMYA 4MMKA 2ZJ2A 1XSDA 2XRNA 2OA4A 2K4BA 4GXOA 1D3BB 3SWNB 1B8AA 1O7FA 1RZ4A 4ZTUB 3L4GA 3UGTA 1R58A 3T0YA 1SD7A 4KR3A 3L2ZA 4K87A 5JHUA 2JSCA 4XU2A 3GFIA 2FRHA 1P4AA 1YFRA 3FF5A 5LJ5g 1PP7U 5LHIA 4K86A 3QOPA 2ESNA 2UWMA 5AIPA 5CYVA 5GAMe 1D8JA 2Q7HA 5GMKi 3WTWC 4YG2F 2L54A 4A2UA 2ZT6A 3GW2A 5GAN7 2QHVA 3TEGA 3DEUA 4M7DB 4PJOD 3FWEA 2DLLA 3IKTA 3DQVC 4KIBA 1YW9A 4UXNA 4KIFA 2FSWA 4ZYDA 4YCUA 1R7JA 2F5EA 4EMKA 1RI7A 2FBHA 5F1RA 1OYIA 6PAXA 1USTA 1ZH5A 2RNJA 3QU3A 3GZ5A 4N0AC 4F7UE 1BJAA 4Q6GA 5CVRA 3F6OA 5K5QA 4H2XB 2K27A 3AAFA 3HRSA 3Q9SA 2QENA 4IRGA 3SZPA 1J7KA 2DQRA 2QQ9A 3CUOA 3EQLF 3F23A 12ASA 1BM9A 4WK8F 4EMGA 1XGMA 5E1ZB 4XTYA 1XD7A 3TO6A 2UXXA 3SQNA 1B9MA 1JJCB 3KETA 2PMUA 2L4AA 4YRTA 2V1DA 2MH9A 3JSPA 4XBFA 1YS7A 1JHFA 2P8TA 4EMSA 3A7RA 1B70A 3HY1A 2XAGA 2BBYA 1IRFA 3E9HA 2Y0MA 1FZPB 2QQAA 5ELNA 1U3EM 1SERA 1USSA 5BOXA 2K7LA 4M7AA 3F22A 1TNSA 4BQAA 4ESJA 5D8LB 2HOEA 1E24A 5TRDA 5BQTA 3M4QA 4E70A 4UVBA 5IT9Z 4WXDA 3KFWX 3K1PA 1WU7A 4UVAA 1J0RA 4F7UF 4RGXA 3TDUC 4MQVA 3REOA 4M75C 1HBXG 2JZYA 4G6DA 2ZZFA 4OIRF 3A5ZA 1KQ0A 3JW4A 2HGCA 2ZZEA 4BHPA 3L7WA 2DXUA 3B73A 3SB2A 2DO7A 4Q48A 1IN4A 3TUPA 4RMFA 3L00A 3QO3A 2P5IA 1EFWA 5LJ3e 2EV6A 5ILUA 1LEBA 4M74A 4Q15A 4RB3C 3BPVA 1O3TA 4M78B 3REXA 3TGNA 4LB5A 2Y48A 2P4WA 3V8KA 2DQLA 4RGSA 4TV7A 4QVDA 3ZMUA 3HRIA 4KUMA 2E1HA 1NJ1A 4YRLA 4UVCA 2DQ3A 4LG0B 4L0ZB 1B4AA 1LJOA 1O3SA 3JTHA 4M77E 1ZGAA 2D1VA 3QP5A 5ILSA 4YDQA 5GANd 3WGIA 4M6XA 3EETA 2O61A 5LJ5f 2LNBA 1QNTA 4C92E 1ZG5A 3GFMA 4HAMA 3SFZA 4CH5A 1W66A 4XLPF 3TOBA 1YO5C 3ULQB 2AMCA 2CJAA 4Y17A 3MWMA 1N9WA 4NQWA 1B7YB 4EJOA 1DUXC 5GAMh 2FQ3A 4FX4A 1WWXA 4GYIA 1FP2A 4M78D 2AKWA 4I0AA 4QWQA 1X56A 4M77A 2ALYA 1I1GA 3CDHA 3K1MA 2HS5A 4M7DC 2DKGA 4L18B 4HT8A 3CJNA 2A5YB 5E1XA 5CVVA 4YCWA 1F9NA 4GO1A 3I59A 4HWPA 2Z5UA 1P4XA 3I4PA 1FY7A 4AVPA 2YX7A 5BMZA 4YFXF 5CVJA 4ENKA 5GMKe 4M77F 2XKPA 3T8TA 4S05A 1D8KA 3NQOA 5LLQA 4P72A 3VBBA 3B02A 4EM2A 4RCCA 2HNIA 4OINF 1LYLA 2FYKA 3RESA 5HOOA 4C92F 5HLIA 3HXVA 1O7LA 4PZJA 3HTSB 1WPYA 1HQCA 1T98A 5LGNA 2HWVA 2DTIA 2OQGA 1D3YA 4HWTA 4P74A 2K57A 4K2EA 1Z7NA 3P8YA 1QF6A 5FO5A 4ZYEA 3J80Z 1W7PD 5K1YA 4NCXA 4KIGA 3MEXA 3V8JA 3GIBA 4CHUA 1T0FA 1FNNA 2DQ0A 4C8QE 2HKXA 1XMAA 5L3FA 4Y13A 5GMKm 3ZP5A 3JB9I 4KT5C 5GAMj 3HTZA 4HF1A 1XN7A 2M30A 4P71A 3TQNA 3ZQ7A 2P6SA 1T39A 2F5DA 4HX8A 3RIRA 4G84A 1SETA 2DU7A 2W84A 3IKVA 2GIVA 2VC1A 1RUOA 1ODDA 2KIFA 2MLKA 5LGTA 3GX4X 3AHUA 2Q5IA 3DP7A 2QQBA 2E7WA 5ICCA 2YLCA 1TH7A 4M7AB 4L9TA 3ZMDA 4C8QA 2RGVA 2OQRA 3ELKA 3LWFA 4YRFA 2DI3A 5ILVA 5LJ5e 2EV5A 2I4OA 1BI1A 4HA8A 4L9VA 4A6EA 4N9HA 2XV4S 4HLYA 3EUHA 2J5PA 4H2WA 3COAC 3WQZA 3BJOA 3LAJA 2A6HF 1ZREA 4LLNA 1YFSA 2VT3A 1SMTA 1XGNA 3Q9VA 2XIGA 3M8EA 4C8QF 2DTOA 2VXEA 4AD9A 3JCMQ 3HRKA 1ZG3A 1CF7A 3W6JB 2Q8KA 2ZMEA 4H2VA 3ZN1A 2IW5A 3KLOA 2RC4A 1KU2A 3R0AA 5LEKA 2O6GE 3A5YA 1TBXA 2DK5A 2PQ8A 2FNPA 2NRAC 4RS8A 2UZKA 1JE8A 2EA2A 2BGCA 2LKPA 5LGUA 1BBYA 1LDJA 5BPIA 2CW0F 2IJLA 1IRGA 4GCVA 2W24A 1QBJA 1E1TA 1ZYRF 2FBKA 3HSFA 5HVQC 1GXPA 1RUNA 4EM0B 2O0YA 5DV5A 2W57A 4P3OA 4RAYA 4HV5A 4F7UG 3WTVC 1I5ZA 2E1NA 2VT2A 4HQEA 3I54A 3E9IA 5D6EA 2LF7A 3T1BA 4ENJA 3TDZC 4CDGA 4G7OF 2DT5A 4HF2A 2AMCB 3PCOB 1NNHA 1NYRA 1FT9A 5A2QK 3HXUA 3ZPLA 4IXAA 2ZO4A 1M5Q1 5LJ3g 4CXFA 1E2XA 2J3MA 3RL6A 5F64A 2IY5B 4A54A 2DDZA 4UNOA 2Q5HA 4N9IA 2RKHA 3I64A 3HSBA 3C1DA 4JLIA 1IN6A 4EJWA 2RHQA 3IC7A 5GAOp 2G9WA 1L3LA 1M8VA 2DZ9A 3HOTA 1OR7A 2OAZA 2IA2A 2DBBA 3WTSC 1CGPA 2ZCWA 4WCGA 2Q2EA 1MJAA 4XEMA 3FMSA 5FD6A 1RNLA 3BJAA 4EMKC 1HK9A 3RTRA 2ESHA 1ZLJA 1ZRCA 5FGMA 2WTEA 3WE2A 2EL9A 1ZHFA 5D5WB 1C0WA 3FJPA 4J5YA 1P4WA 4P73A 3LSQA 3ZMZA 3M7GA 3JCMg 2CO5A 1HKQA 2OBPA 1HW5A 1GHCA 2MBFA 1S7AA 5DCMA 1FBQA 2FMYA 3ZN0A 3JB9G 4Q4ZF 5E3IA 2EJRA 2GAUA 2H6BA 3RERA 3R6SA 3E6BA 2VODA 4A0YA 1IZ1A 3ZMSA 2NYXA 4M7AC 3G1ZA 4XTWA 5DYMA 3GFLA 5LJ5h 2ZNIA 4IHSA 4EQQA 4P9FA 4YYEA 4X9DA 4M6YA 3M4PA 4NB5A 4YRJA 1FC3A 3HSRA 4M75B 2CJ9A 4HWSA 4EM1A 3WE3A 2EV0A 1H0MA 3SZTA 3RUXA 3VODA 1I5LA 1HW2A 4HX7A 4C92G 3M1EA 1O3QA 2XGTA 1XSVA 5K5OA 4CYDA 2XTIA 1K79A 2LDUA 4N0BA 4KN4X 2VE8A 2A61A 3GO5A 2VBZA 4CGZA 3ECOA 1FPQA 5KNNA 1TW2A 2XGXA 3REUA 4U7DA 1X3UA 2JPCA 4BHCA 3LFKA 1Z6TA 2ARTA 1ZG1A 1OYYA 3BY6A 4M75D 3PGGA 4NOYA 1IN5A 4H2UA 5E8GA 4CO8A 4UP7A 1EIYA 2D1HA 1LQ1A 2CQKA 2QM3A 5LJ3f 3P8VA 5D5XB 1B34B 2C7IA 4BYYA 1X2HA 3I58A 3O3KA 4P9UA 2RB6A 4JRIA 2XVCA 1YFTA 2ZFWA 1W5TA 1YB3A 4IRIA 5LJ5j 4KICA 3KEOA 1I6XA 1Q1HA 1YCYA 4QVCA 4XSXF 1HC7A 4YRRA 3I0TA 4RB0A 4I09A 4A0XA 3CO7C 1W7PA 4ZZLA 1JHHA 3T5XA 3G3ZA 3MFKA 3MAJA 1BC8C 4M77C 3VQYA 4R79A 2G7UA 4MEYF 1ZRDA 2OZ6A 4ZYGA 5DD8A 4C8QG 4HF0A 3QSUA 1J9IA 3FXQA 1UB9A 4CZZA 3TEHA 3JCMf 1ADJA 1ASZA 1O57A 4X9CA 2R7FA 3R61A 1EH6A 5GAOq 3DSQA 5LRRA 2QWWA 4M9XA 4XRFA 2IT0A 3MEYA 4A5NA 4XQ3A 3IG2A 4P72C 3KEQA 5HS7A 1Y96B 1U2WA 4XU3A 4XU1A 1K6OA 2QZ8A 4YREA 2WWYA 2QBYB 3GZ6A 4M7DD 3C3WA
chains in the Genus database with same CATH superfamily
4DJAA 4P74C 1IAWA 3E5QA 3QPLA 3MP6A 4F7UA 4LVLA 2UXNA 2M8EA 3OSSC 1T8IA 3R0JA 2DL3A 2AKLA 1DGRM 4M6VA 1PYSA 4LB6B 3BDLA 2QA4I 1YTYA 2DU9A 4AWXB 5IY5H 2EIFA 3ICAA 1SFOJ 2AHQA 3L2UA 1U1TA 4XLFA 1JXSA 2L2PA 1ASYA 1QWEA 5CKHA 4BEHA 4LDUA 1FYLA 1Q1VA 3QP6A 5HS8A 2E4HA 2RHIA 3W2WA 3BR6A 4J6WA 3HFZA 4HX4A 4NHJA 1SKUB 1AD5A 2KQWA 1YW8A 1DDNA 2DILA 5FKOA 3CBPA 3VS1A 3WVEB 4CA0A 3BJUA 5H2FC 3WTUC 3PIPF 2RHXA 2F2VA 5CVIA 1VQ9T 2BYVE 2V8JA 1WHGA 2FNAA 3OYJA 2F69A 2RHSA 1YX5A 5A2QE 2CV1A 1E17A 4DZJA 2ZMEC 3IL2A 3CCUQ 2KIQA 2BXYA 5IN1A 2VPLA 2XUBA 2JA2A 1VQPA 4BQOA 2VKVA 5FD5A 1FOYA 2KNBB 2AQEA 2AK5A 3JCMe 2ECBA 4KQEA 2KKOA 4ESRA 1LJ9A 1AZEA 1UUEA 2R7WA 3L4GB 1R36A 2HKNA 1ZLMA 1P9QC 3PQJA 4DIQA 3VS7A 1PHTA 3VDXA 1YE9A 2G7HA 3K10A 4UUTA 5DM6F 5ERIA 3QYEA 1KQ9A 1WI9A 4JRKA 5A2QZ 4G6QA 3QJYA 2RJCA 3CMEQ 3UGQA 3CUQA 3PMIA 1ZRFA 4IVNA 4TTVA 2NYSA 4C2MJ 1S5LC 1JRIA 5DDGA 1SEUA 2IXSA 4CC4B 2CQXA 3NMZC 3OV8A 3CMAA 1OX8A 2PMHA 4DOZA 3K7AJ 1RAFB 1NG6A 4NS5A 2PMFA 4BBRJ 2A7YA 1UHMA 4JBAA 1WJ5A 2JA6J 1S3JA 4YRQA 2HSPA 3G6EQ 5D6FA 2IA1A 1AT1B 3SDBA 3LWHA 3KZZA 1FP1D 4LD6A 5C3EJ 4KFCA 5E3MA 1U1SA 4HT9A 4IX7A 5GAN2 3L2RA 1VOMA 4PJOE 2COBA 2PFBA 2MI6A 1ULYA 4JPBW 2DETA 2X0LA 3HOXJ 4PLLA 3K69A 2E5KA 1G6NA 3GVAA 4HXJA 2WSFE 3CC4T 1B1BA 4IUVA 5M3FJ 2DA9A 3MF1A 3NPFA 3S1RJ 2HQHA 1XS9A 5HDKA 3EHQA 4PCQA 3JCUC 3LFUA 1YJWI 2CUEA 2W85A 4FHTA 5CQYA 4C5EA 1K73R 3V7SA 4KT6A 4L0YB 3CCQI 5AYFA 2RJDA 3JCMh 3GBQA 4BU2A 2BEOA 1AWCA 2ODRC 1OI1A 2BZ8A 5K7HA 2YU3A 5HLGA 1LB2A 3BROA 3CC2Q 2IA0A 3D0SA 3VJPA 2BZYA 3K4MA 3R4KA 3OW2S 2MD0A 2M7BA 1V76A 4A3MJ 5L3EA 2AKWB 1XGSA 5CVUA 2X1EA 2V6CA 2E7XA 3PNWC 1XTAA 5LJ5d 4DYQA 4ZN3A 4H2XA 1VQ8A 3DBLB 4M7DF 5E18F 3I59B 1IXSB 1YJWT 2E3IA 5L3BA 5GAN4 2FD5A 4ENMA 3CCQT 3BG5A 3IRQA 4AFUC 2PMEA 1R1TA 2DTHA 3PM1A 3PQKA 1ZK8A 5HGQA 1AKHA 4XLHA 1A6IA 3FMQA 3K9TA 2FPDA 3D1NI 2IS4A 2LOOA 4C5GA 1R6RA 2STTA 1OPLA 3BG7A 2HBPA 1VIEA 2HL5C 3G71Q 2R7DA 2NVUB 2V6EA 4Z2YA 3M9AA 1X4PA 2DDBA 3FHNA 1FIAA 3KYDB 3RDIA 5HLTA 1VQ4Q 3GTJJ 2OTLT 2HKQB 3FB9A 2BUDA 3CCSA 4EO4A 1ON1A 4RDXA 2EFPA 1YWOA 1HTTA 4Z02A 1YFHA 4ZDPA 4GDFA 3FEOA 3GTQJ 2R7SA 5D6XA 2W48A 4AIJA 3GEZA 3VYGA 1NJIU 2DCEA 2HTJA 3CJQB 5I21A 2CSQA 1W6XA 1JO8A 3BDUA 2CIMA 2H8HA 5GAN5 2R3SA 3IUOA 5IAYA 2AXLA 2EINH 3ZQQA 4H2YA 2P0KA 1IRZA 1QE0A 4EJVA 2L2OA 1R00A 2X6XA 1KA8A 2SRCA 3BDDA 3IHUA 4OLFA 4ZGDB 3E9GA 2NLUA 1TTHB 3UFGA 2R5MA 4A63B 4C0DB 1ZLKA 2LQNA 2J06A 2CUBA 2DMPA 3BJ6A 2GIZA 3RSNA 2KJCA 3IKMB 2YS9A 1IUFA 3IAM2 3ERMA 4C30A 2CUFA 2XC7A 5LHHA 2NS7A 3CUQC 5CR2A 2AIRB 3KE2A 1RL2A 3T8RA 2AQFA 2VQLA 1VQKT 2GXGA 1UHWA 5L3CA 5EEAA 4A3GJ 4XRMA 2NNYA 4Z8AA 1G3TA 3QYFA 2RI2A 2E65A 2VQCA 3BR0A 3HOYJ 1WX6A 5J3BA 2RHUA 2O4XB 3GZNB 3H8ZA 4BGDA 3GNFB 2KDOA 1MNMC 1F1BB 2I4MA 2Z3YA 1ZSGA 2E70A 4Q47A 5KYUA 2JTVA 4J8OA 2P5VA 4J83A 2OTJI 1KIKA 3LSHA 1G2BA 2A5WA 2E60A 3PIPA 2LRQA 1KHCA 2RJFA 4MDXA 4IPAA 3HXZA 3KFUA 3VYHB 2HOSA 3G1JA 4DZPA 2RHYA 5E3OA 1Y0NA 3V8LA 4V19K 3H3VK 1OX9A 2JOYA 1Z7MA 1KOGA 1DPRA 2YUSA 3TOAA 3KP2A 2VC8A 2NS8A 2KPMA 4XMYA 2HDCA 5J39A 2QGFB 2EBIA 1OMIA 3P9KA 1TC3C 2EYYA 3WU1B 2I5UA 2HYGD 4PJLA 1M1KR 2QTVA 4XLAA 3M4GA 1FMWA 4EMHA 4TWAA 2QHSA 11ASA 1YRNB 2UV1A 1XGOA 1XG1A 1DU0A 1KYZA 3WTYC 1K78A 3KX2A 1BCMA 4II1A 3EFOA 1I0CA 4RB1A 4IRHA 2KGTA 1AVZC 2VV5A 3K70C 2J5OA 4WXCA 1VQMA 3OW2A 3WHBA 1A04A 1EX4A 1A6QA 1K9MC 2P5LC 1BA5A 1NM7A 1VYUA 1T33A 4XTZA 2PI0A 4CS2A 5EG0B 1VQPQ 1B8IB 4FW2A 2F5FA 2V26A 3A03A 2KDSA 4JUVA 1B6AA 3L9FA 3HJEA 1S1NA 2VONA 5LJ3d 4W1UA 5HKCA 3OOUA 3A2KA 2PUOB 2CH0A 4C5IA 1GVDA 4G7ZF 2C6YA 3CP8A 3FXOA 1FYFA 2OD5A 2O7OA 4UB8C 4ESBA 3TEHB 3H3UA 4J9DA 4IOCF 4M75E 1NYQA 1TQIA 2YWWA 2IPOB 2H1LA 1G2HA 4MZPA 3MEVA 3L2QA 4JJBA 1C0MA 4LITA 2E35A 4BE1A 2CP5A 3CMAQ 2KZGA 4U0YA 2JJ9A 3G7ZA 3CCLA 2DU5A 4B44A 2W0ZA 1S72T 2R5YB 3QZ5B 1DU6A 4WXHA 4W97A 4Y52J 4A93J 2DZCA 4A3KJ 3QO8A 3Q0WA 2COYA 4MFEA 2DAOA 2CU7A 3JRZA 2PN6A 2V8KA 3HHGA 1YG2A 2N8GA 5KCOA 4BNCA 1NH3A 2G6FX 3KBGA 2ZB9A 1R22A 2FXAA 3TP3A 3GMEA 1LEAA 1HSJA 4UC4A 4CCLA 1T3LA 3VPRA 2ZR2A 3NWTA 2HVRA 2W10A 4QTRA 1U5TB 2Q0OA 3HKSA 3QUIA 3NHNA 5CKEA 3GCMA 2CREA 1B34A 4CCJA 2FPEA 5J1UA 2PBIA 5EC7A 1OV3A 1N8RU 1IXCA 3NWSA 1DP3A 1PP8F 1D0ZA 4LJZF 3A8MB 2RQPA 1X4OA 3HIFA 2FZCB 3BLYA 1FSHA 2CUDA 4BY6C 5GMKl 3I9QA 3I3LA 4UUSA 3DPTA 2VJ4A 4AG1C 4M7AG 3LSSA 3CPWA 3A8LB 4A3DJ 1WHMA 2FEIA 4XN0A 4MEXF 5F5WA 2I2LA 4AU7A 1PUFB 3CMMA 3QPSA 4ABZA 2E10A 1HKSA 1YJNA 4ZIBA 1DP7P 4CS4A 3A01A 1Y96A 2VQHA 2XB0X 4EEFG 4J19A 1JKPC 2NAZA 1NLOC 2OZUA 2MMPA 2FL7A 2NUPB 2K86A 1Q81R 1RRJA 2WAEA 3BR5A 2VUBA 1YITA 2HZTA 1VQ8Q 2Q7EA 1AWOA 3EGDA 2LT1A 3ZQIA 3LC0A 1BBWA 4C92D 1Q86R 2DFIA 1QZEA 3MPUB 1A5JA 3K0LA 4HSTA 1X27A 4RM3A 2PG4A 1K8AR 1IV6A 2XAFA 1FOKA 2M2EA 5KYNA 1V4RA 2IRFG 1G5HA 2Y4XA 5KE3A 3UF4A 2KRFA 4YFKF 1G8XA 4UV9A 3IQLA 1HLVA 1UG2A 2LP0A 3K1NA 3S2HJ 4JJNK 4L9NA 4HWOA 1MGTA 1A35A 1NJ8A 3DF8A 1TUDA 3HP9A 1K73C 3CC7I 1SD6A 2EJGA 1U9OA 1VQLI 3ZMVA 3HL8A 4TQFA 4C2TA 3F9KA 3ABKH 2JZ2A 5KH6A 2RD1A 4RTXA 1YLFA 1JKQC 2STWA 1I81A 4R8HA 4EJUA 2VGMA 4OMYA 2KMTA 2DT6A 1XSDA 5J4VA 1RZ4A 5EG2A 2DMUA 2E36A 4XKWA 1SD7A 2QSGX 3L2ZA 2VJJA 5JHUA 1K83J 3GFIA 2FRHA 1S9HA 1P4AA 3ZR8X 5CIUA 3UDCA 2K9LA 2UWMA 1D8JA 2ECCA 4J9GA 3DLLA 3TEGA 2W00A 1JXOA 2DAQA 3FWEA 1Z7LA 1YW9A 1XC5A 2FSWA 4ZYDA 1R7JA 5F1RA 1OYIA 1VI0A 4LDYA 5HNHA 2RNJA 2FOWA 4F7UE 1VQNI 4Q6GA 1GBQA 3F6OA 2JXBA 2K27A 3AAFA 3HRSA 3Q9SA 1RETA 4I6ZA 3C2BA 3CUOA 4J9IA 4FU6A 4QW2A 1VNDA 3QG1A 2JUGA 2CUZA 5E1ZB 2MWPA 3TO6A 3FBNB 2VUMJ 3CF5F 2DEUA 3KETA 2ZXWH 4YRTA 2R5ZB 4QQDA 4GFBA 3A7RA 1B70A 2BBYA 1IRFA 1MH4A 2QQAA 1Z9ZA 3LSRA 2GTJA 1U3EM 5BOXA 2JTEA 2QEXT 3JRIA 3CCMI 1PC0A 2PNIA 1UB4A 2DYIA 1PRMC 4UVBA 3KFWX 4OMOA 1VQOA 4RGXA 1MBFA 1OCRH 3REOA 2COZA 1I3AA 2VKDA 4BHPA 3B73A 2DO7A 1Y71A 1QVUA 4RMFA 1VQ5Q 1EFWA 2O2OA 4M74A 3BPVA 4M78B 3REXA 3TGNA 4LB5A 2Y48A 2WB1A 4TV7A 4QVDA 1FOWA 4IQJA 1GDTA 5JLXA 1ZGAA 3DKXA 1TWHJ 2RI3A 5GANd 3PNTA 5LJ5f 5F27A 1MH3A 2GQIA 3GFMA 3CCYA 5KHDA 1OYXA 3QXEB 4GRIA 1YO5C 2CJAA 1YIJT 2HOAA 1N9WA 4XAXB 4NQWA 3EH2A 3DKYA 1KD1C 2QI2A 4GYIA 2R58A 4M77A 3AFHA 2LY9A 4LDWA 2HS5A 4M7DC 2HVQA 1NYFA 5CVVA 5E1XA 3FBIB 1YJ9I 4GO1A 3E0JB 5KAIC 1VQMQ 1FY7A 3Q0VA 4YFXF 3K4NA 5CVJA 5GMKe 2MYSA 2XKPA 1KQSP 3T8TA 3HTRA 3QYBA 3CCUI 3B02A 3SHWA 3RESA 5HOOA 3LH5A 3NFCA 4PZJA 1HQCA 1T98A 3JAME 1PWTA 2D1XA 1X43A 1SC7A 4FW1A 5FO5A 3J80Z 3MKZA 1W7PD 5K1YA 4JLGA 4KIGA 2Z1DA 3CDIA 4CHUA 1T0FA 4J9HA 1QVGA 5BNGA 5KCHA 1FMKA 1TT0A 1M30A 3X20B 3D5RC 4ELZC 1ETXA 5B3SH 3HTZA 2LDMA 3TQNA 1VYTA 3CQTA 2X1CA 5CQGA 1SETA 1X69A 2GIVA 3ZQFA 4I76A 2MLKA 5LGTA 3AHUA 1NPRA 2LKSA 2P84A 4C8QA 1UTIA 5TISC 5CKFA 4ZTJA 4YRFA 1MUZA 5ILVA 2DA4A 2L5QA 2DA6A 1PVEA 4N4GA 3URGA 3CCLQ 3EUHA 3H9QA 2J5PA 4XL9A 5I22A 5J1RA 3WQZA 3LAJA 3J7AY 3OBYA 1YFSA 1SMTA 1MBEA 1XGNA 4D8DA 2EYXA 3M8EA 2JS0A 2XPVA 1ZG3A 1CF7A 3G6EI 3M0RA 3ZN1A 2V1NA 4BQQA 3A5YA 2EKHA 4L5EA 3O5ZA 4A4GA 2PQ8A 2XAUA 2IGNA 2FNPA 2K5FA 5TGTA 2GTOA 3CMET 2DA5A 1WH7A 1LDJA 5BPIA 4FM4B 3ZQHA 3OL4A 4LIUA 4RMNA 1I5ZA 3E9IA 1Y7XA 1R0BG 1X58A 2DT7B 2AMCB 2O01E 3PCOB 1RPWA 2ZJPF 2ZO4A 3OMYA 4IL6C 4N9IA 3C1DA 2RHQA 3IC7A 3LLRA 4JJCA 1X2QA 3HOTA 1J09A 2A28A 3WTSC 3C4SA 1RNLA 2H8RA 1WLPB 3BJAA 1WGXA 5FU7B 1RABB 1K9MU 1IRXA 1ZLJA 5FGMA 2KZVA 3WE2A 2X4JA 3M0UA 3GTMJ 1YCSB 2KLOA 2LNHB 3CCVA 1UHSA 2EZIA 1TUGB 2ME6A 3LSQA 2LT4A 3IAS2 1D1BA 2CO5A 3VKIA 1YJNQ 3CD6T 1HW5A 1GHCA 2MBFA 1PKSA 3VS0A 5C0MA 4Q4ZF 2I0NA 1Z3XA 1ZUKA 3E6BA 2VODA 4A4HA 3M0PA 5IHNA 1YITQ 1IZ1A 3ZMSA 2QDYB 3AG1H 2E1MB 1VQ6I 2ZNIA 3M9QA 4IHSA 3U1KA 4X9DA 3E19A 2ECZA 1HDPA 2CJ9A 4HWSA 3GTGJ 3PT9A 1H0MA 1HW2A 2Y0SN 1O3QA 2XGTA 4OMFB 2KE9A 3AKZA 3CC2T 2VE8A 1HYOA 1OFCX 1BR1A 5DS9A 2VBZA 2HQ5A 3R6OA 3HDDA 1TW2A 1YI2T 1JU5C 1WI3A 4AUXA 3LFKA 1Z6TA 2ARTA 2WSCE 3BY6A 1B07A 3H5RA 4LUEA 3EH1A 2MF2A 5E8GA 4CO8A 4L59A 1WXTA 5LJ3f 2EBPA 4J01A 3SDZA 2MOXA 3S3NA 3DKMA 4IRIA 3KEOA 4WCIA 1WHLA 2DYSH 4XSXF 2ME0A 4YRRA 3I0TA 4I09A 4A0XA 3IP4B 1OZ2A 4M77C 2WACA 2DFFA 1Q82R 3TW7A 2G7UA 3FXKA 4MEYF 2J05A 2OZ6A 4C8QG 4HF0A 4PFZA 5IT9E 1Q81C 1ASZA 4X9CA 3G71T 3DSQA 1Q86C 3OR1C 4LIVA 1VQ4T 4XU3A 1XJWB 1K6OA 2QZ8A 4YREA 1GFCA 3C3WA 2F48A 4E6KG 3EG0A 3J7AO 4H2TA 2FA5A 4OMQA 4K88A 2P4RA 2L9SA 1RAIB 1B72B 4HDVA 1GRIA 3J7ZI 5A0DA 5HNFA 1MJ9A 1T0FC 2CJJA 3KCCA 4MDWA 3JRFA 2XGEA 3RKXA 4JP0A 2GZWA 1KSWA 3SFIA 2GFAA 1EOVA 1RAEB 1QVFS 4HW0A 2M9HA 3PIOF 5GAMd 4KR2A 3PO2J 1S72A 5F6FA 5GJVB 2BIVA 1CQTA 4C8QC 4LLLA 4MO7A 5IXBA 2C0IA 2MA3A 1LFPA 1OISA 4XOTA 3LA7A 3KIOA 2H1KA 3EUHC 4IIOA 1VQOQ 3GTOJ 3CCEI 1RUWA 1OLTA 2EQUA 1O3RA 3P7NA 1EVKA 1L0OC 2K3XA 4BHBA 3P9CA 2OCEA 1VQ7T 3RPUD 3OMCA 3NEUA 1HD3A 1K73U 3E3VA 5D4SA 1UGPB 3HBLA 5KAFC 2JMAA 4PSXA 3H9NA 1VYVA 3RBBB 3FRNA 4A0ZA 4D5FA 3K6GA 3S8PA 1SD4A 2HZDA 4IHWA 2CUJA 3LAPA 1FX7A 3RJPA 4CICA 2XGCA 1JQQA 1G51A 2XU8A 3R6NA 1M1GA 3F6VA 1D5VA 1T2KA 1LE8B 3A8OB 4A3EJ 5HDGA 1PRLC 4EMKB 1UE9A 2YUOA 2X9HA 1M2VB 1R4MB 4IJAA 2X4WA 5EEGA 4QT7A 4VUBA 3CO6C 4HNTA 1G5IA 2V1XA 3C18A 5JFRA 2O9LA 1Z91A 4D9JA 1I1JA 5C4XJ 3QHSA 2K5IA 2PU9B 3F3XA 2YRVA 1KQSS 4AM3A 1TWFJ 1KU9A 1IF1A 3OYAA 1HKTA 1B59A 3ZMTA 2Y2ZA 1VQPI 2L3DA 1MDMB 2EJFA 2KEAA 1E1OA 3W2AA 3SDGA 1Z05A 2DXTA 2H3JA 3VOEA 2LMJA 4RTUA 4E7KA 1UCRA 1SRLA 4O3MA 2VBYA 2BW3B 3SEZA 4XEOA 4FETA 3P8BB 1WXBA 4LLGF 3GF2A 5K7ZA 1BOBA 4G85A 4ZC3A 1XMXA 4LGWA 4N4OB 4JOMA 2QGGA 3G4SI 2JN0A 2ZCEA 4CH4A 3M07A 3I55I 4JZ3A 4PJOA 4LVIA 3DBHB 2Y4YA 4M7AD 4CH6A 2QHUA 3VRYA 1PNJA 3A7UA 3CMAI 2KIUA 3LOCA 4M7DE 1QQIA 1VQPT 4WX9A 4MHGA 4C5HA 4Y3OA 1YHQA 4MGRA 3GXOA 4HOBA 3OYFA 3AL0B 5GAOl 1JGGA 3FXMA 5LD2C 3JRBA 2E64A 2YRDA 5IHKA 2BVMA 3EUAA 4A5MA 1Y0UA 4E7SA 2M0OA 1IO6A 4LVKA 1JGSA 5F0CA 1XDUA 4FL6A 5JVTA 3E6MA 2D9TA 2KT1A 1K6YA 1E6HA 1KQ2A 2YUNA 1PYVA 1QU3A 3HRUA 4E7LA 1TP4A 4P75A 3GF5A 2XROA 3LQRA 1DQUA 1EV7A 3NGPA 3U2RA 1UAAA 4KYWA 3GBGA 3KEYA 3CMAT 1EH7A 2PTKA 2M4KA 1KD1U 2LMDA 4AIHA 3EFRA 4ZN1A 3RPQA 2A3LA 9ATCB 3C95A 3BW1A 2LX7A 4DGWB 3EYIA 4YTLA 1I1SA 3S14J 3U23A 4AG2C 2AZVA 3G73A 2JMWA 3C2GA 3H36A 1G3YA 2HZYA 1X19A 5L3GA 3CCVQ 2YX4A 1Y8RB 3CDLA 1BBUA 2QYZA 4HV6A 1QWFA 3P9IA 2VE9A 1QVFA 2QHTA 5KYXA 5GJWB 3HPGA 5GANf 1DJ7B 3JAMK 3LSMA 5CLSA 4IHVA 1FYNA 4I98B 2K3BA 4DBRA 4UHTA 1EZZB 4Z89A 5EYRA 3LW5E 3I5SA 3CCRI 2D8JA 3NETA 2Q7GA 4DPGA 3OY9A 4BH9A 3GLXA 1FYMA 2PEXA 4L87A 2BE7D 1ZUYA 3O8GA 3ZXSA 1FWZA 1WVRA 3PFYA 3EGXB 2DPUA 1OU8A 4BJ6C 4DA4A 1IUYA 2YSRA 3JTGA 5D8KB 4O6JA 1MHNA 5FFZA 1LCKA 4M78F 4OIQF 1M1EB 3MKYB 2FHDA 1V54H 2K9NA 2E19A 2ZMEB 2QA4A 5KK1A 3UKGA 2DOAA 1B7YA 2ABLA 4B9WA 1M1KU 4YRKA 1VTNC 5C52B 2M5WA 3U9GA 1ZN2A 3SEMA 5DM7F 5E3NA 2YSQA 4EV0A 1N25A 1C6VX 1ONVA 3RKYA 2DX1A 1P6RA 1VQ8T 5B1BH 3F8MA 1TW3A 1QKXA 1JT0A 4HCZA 3N4MA 4Y28E 1ZBXA 3TSZA 4J9EA 3FDRA 5D5UB 4YIIA 3I5UA 1IJWC 3HXYA 1YP5A 2HXOA 3TSWA 2DJZA 2X6WA 2ZPEB 3FIFA 3A98A 2VPRA 2CG4A 1OCPA 1QP3A 2ELKA 1BR2A 1P2FA 4PJOG 1QVPA 3RGLA 1YYVA 1KU3A 1X2MA 1QA6A 1WJQA 1GFDA 4IKFA 2YXYA 3FKIJ 4L5JA 2LCSA 1IHWA 4G7HF 4PKCC 4XRSA 1NTCA 1RESA 4KUDK 4EATA 3CCST 5LEJA 1N9RA 3HFVA 3VUZA 4ZGEB 2ZJQF 1C1AA 3BTCA 2L9VA 1PKTA 2BY2A 3TO7A 3F8BA 2OC6A 3FXUA 4RGRA 4CI0C 3VFZA 2FB7A 2DFEA 1S29A 3FMRA 1MW7A 2ZNYA 2JRTA 2LCLA 9ANTA 4J6XA 4FT8A 2WV1A 4A4KA 2Y9ZA 2K3FA 4Z6YA 1S72Q 3HUGA 1VFCA 2GXBA 1HC8A 2VVKA 3GYHX 1Z67A 2PMZA 1SFUA 1W2BP 1T0JA 4PJOC 1KQ8A 1W5SA 5DCFA 4XK8E 3W3CA 3JCMV 4OMMA 1K4SA 2IBDA 2R7XA 1X75C 1QQJA 4GYGA 3DEWA 2ZXHA 2QLZA 4PK4A 1J59A 1Q82C 2XSJC 3W3SA 1SESA 3RNJA 4IUUA 3DB4A 2ZNJA 2KISA 3WTTC 1VQ5I 2L4MA 3MZYA 4ZZDA 1PUFA 2XAHA 2VB6A 3E5XA 4PUSA 1W7PB 3ESWB 1YQAA 4LN2A 2RMOA 2WY8Q 5AT1B 4E7ZA 4XNFA 5FKLA 4J7FA 5KYYB 4P75C 2VQGA 4BS9A 2E2JJ 2NUPA 4ITVA 5J26A 1QO0D 2EYWA 3JCMc 5AONA 2CQNA 4G12A 1FSEA 2P7CB 3LYIA 2EFNA 3BY7A 4OIPF 2HTSA 3GPLA 2GF7A 4O2DA 1LDDA 4WWCA 2CT3A 4FT2A 2X9DA 2L9NA 1Q81U 3OMGA 2HYFA 4P3NA 2DJQA 2K6DA 2DOFA 3DTIA 5IT9K 1Q86U 1PYSB 4KH1B 3CD6A 2WV0A 1VQMI 4M75A 2GA2A 2L01A 3RCOA 2M1HA 3IKLA 5J6XA 5K1PA 2DYBA 4CYCA 1WYDA 3LH0A 2E5AA 2RV8A 4BEHB 3ASNH 2MD5A 3VS5A 2AKKA 2CJBA 3LSJA 3HFZB 4YFNF 1WQ7A 3N5BB 3WXMB 3MVPA 3HXXA 2VYTA 2NOGA 2EZLA 2ZPGB 3CPFA 1RIOH 2KYBA 4UY8I 1HXDA 3TREA 3CXCP 3L42A 3PZCA 1TTYA 5K1XA 4XLCA 1A31A 3I56T 2DLPA 5J8CA 2RHSB 1ZA1B 3DXJF 2VXFA 3JB9J 1VQMT 1ENHA 1YI2A 2M87A 5D4RA 3RZDJ 3WHCA 4WI1A 1I27A 2OJ2A 5GAN8 2FBIA 1BU1A 4K11A 2YHTA 2P4TA 1IL2A 3UH0A 4BXUA 5ICGA 2K2MA 3CCLI 2QSHX 2Z9OA 2EKOA 5HCKA 1YHQQ 3KP3A 3JCMW 4XRSG 3MZHA 5FRNA 3UA6A 1H4QA 3OYMA 1OJLA 2GOMA 4E51A 4KGZB 3OYLA 2ISYA 2NOJB 2IPQX 3KP6A 2H27A 3CCJT 3CUQB 4HNVA 3NRVA 3K2ZA 2QBYA 4JDSA 3R60A 2V1RA 2K4YA 2DA2A 3HYIA 4OMZA 5B5EC 1N75A 5GAMf 1F43A 4XOPA 3PNYA 3VB2A 3WTZA 5JI6A 4A4FA 2A08A 2DFHA 4PFOA 3CCLT 3RI4A 4M3EA 4E2FB 3J81E 4Y92A 3JV3A 1TQPA 3ISPA 2K9GA 2D6FA 2OAUA 2ZFUA 2NS6A 3VSLA 4HBLA 4RQFA 2XDDA 2KJBA 3LSTA 5FLXE 3CZ6A 3A0HC 2I8DA 1TOVA 5IHIA 5ELOA 2DRKA 5FW9A 2XAQA 5HY6A 2P81A 4B47A 1OEBA 4DQ2A 2ARUA 3EYYA 2DODA 3HPWA 2I4NA 2XHKA 1EKEA 4QSHA 5E17F 3F8NA 2FEZA 3BPXA 3OYCA 3LGLA 5EZHA 1WIEA 4RUGA 2FU4A 2P6TA 1W4SA 2TCTA 4MMKA 1W36D 2OTJA 4XK4A 2XRNA 3I4MJ 2K4BA 4GXOA 1O7FA 4ZTUB 3DTEA 4HVWA 4XU2A 5LJ5g 1VQ7A 2QA4Q 3VS2A 1X1AA 1YNZA 3QOPA 2ESNA 5AIPA 2COWA 2ZC2A 4YIRX 5CYVA 3S2DJ 4YG2F 2ZT6A 3DEUA 2DLLA 3IKTA 2CQQA 1YJNT 3CJRB 2F5EA 2CKKA 2HVSA 2FBHA 6PAXA 1USTA 1ZH5A 1IC8A 4OVAA 3QU3A 3GZ5A 1BJAA 2GBYA 1K9AA 2R7OA 2HOTA 2M0CA 4H2XB 1GLNA 3SZPA 2DD4A 2DQRA 2X6YA 5CKBA 1YITT 2QQRA 1JJ2P 2HBWA 4WK8F 4EMGA 1MBKA 5GTIC 1XGMA 4J9FA 1QMCA 3M3YJ 2PMUA 2L4AA 1IG7A 3H9JA 2MH9A 1YS7A 1IXDA 3TQ7P 2P8TA 4EMSA 3ABMH 2DERA 2CS3A 2HPMA 1AKHB 1VQ9I 1E6GA 2IGMA 5ELNA 3EG3A 3MEAA 3EG9A 3PUBA 5TRDA 1IV8A 3G1OA 1MMAA 2BHYA 1WU7A 1OCOH 4UVAA 5IH2A 4MQVA 5EDNA 2CMPA 4M75C 3X28B 1HBXG 4F17A 1WJDA 2ZZFA 1UGSB 3A5ZA 3JW4A 2ZZEA 3L7WA 1UGVA 1GCPA 3SB2A 4Q48A 1IN4A 3TUPA 1YFNA 1LKXA 3L00A 4FASD 2EV6A 2E1OA 5GAGJ 4DW6A 2P4WA 3GLLA 3TEEA 3V8KA 2CS7A 2VWFA 3HRIA 3ZMUA 4RM2A 4U87A 4KUMA 2E1HA 2DE0X 4UVCA 1LJOA 4C3HJ 1O3SA 4E7IA 2LZ6B 2AZSA 4YDQA 1SFKA 1FMVA 2VL8A 3GTLJ 2JRMA 1FJLA 1V1CA 2XK0A 2RREA 2DMOA 4MIMA 4RLQA 3Q0UA 1W66A 4XLPF 3TOBA 3ULQB 2AMCA 3HGGA 4YEJA 4BL0B 1W2BS 1WWXA 2BY0A 4M78D 4I0AA 4QWQA 2H8WA 2JMCA 4KUIA 2ALYA 1ETWA 4BY6B 4HNUA 2PJRA 3FIWA 3OSFA 3QWLA 4R56A 1DGWY 3FJ5A 2HCKA 1NG7A 3DBRB 2DVJA 1RC9A 2CZ0B 2CT4A 4BI8B 1MV3A 3VUBA 1RAGB 4OINF 1LYLA 2FYKA 4C92F 1O7LA 5LGNA 1RKTA 2DTIA 3A1PA 4HEA2 3CC4I 1U3OA 4IUPA 1QF6A 1SVOA 4ZYEA 4NCXA 3MEXA 2DXBA 3V8JA 5JLWA 2FRYA 3OYYA 5IOYA 1FNNA 3OYHA 4Y13A 5EF6A 1WHUA 5IOZA 1IO2A 4HF1A 3LX7A 2M30A 1T39A 2P6SA 2LTOA 3LNQA 4RTYA 1ACMB 2EQJA 4HX8A 5F0HA 3BR3A 4G84A 2Z0WA 1VQOT 3IKVA 2VC1A 4IUQA 4C3JJ 5KYUB 3GX4X 2Q5IA 1OCTC 3DP7A 2E7WA 4M7AB 1TH7A 5GPCA 3ZMDA 3ZQLA 2CP3A 2LREA 3ELKA 3LWFA 5LJ5e 2I4OA 1BI1A 3S15J 4A6EA 2DMTA 2PQWA 2XV4S 1MSEC 4HLYA 1FOXA 3CD6Q 4H2WA 3COAC 2DD5A 1F36A 1ZREA 2RNAA 3Q9VA 1BW6A 4AD9A 3JCMQ 1WI7A 2BKDN 2RQVA 3UT1A 2XGDA 4C0FA 3R0AA 1KU2A 2LG4A 2Z16A 1TBXA 2DK5A 1Y39A 2EIMH 8ATCB 2E34A 3BG6A 4RS8A 2FJ1A 1JE8A 3QKJA 2LKPA 1BBYA 1U9NA 2CW0F 2HEQA 2W24A 4OMLA 1E1TA 1ZYRF 3HSFA 2ZSIB 5HVQC 1RUNA 5DV5A 4F7UG 5E79C 3S1NJ 2VT2A 3MEUA 2GM4A 2CSIA 1Y0MA 3EFOB 1I6HJ 4ENJA 1U0JA 2P0WA 3OSVA 2L7MP 1FT9A 4M3FA 2M02A 3HXUA 3ZPLA 1M5Q1 5LJ3g 5I11A 1E2XA 1YI2Q 2J3MA 4A54A 3TEDA 2RNGA 2RKHA 3I64A 2ZZDA 3H0FA 4EJWA 2DZ9A 1OR7A 2OAZA 2LVSA 2DBBA 2Q2EA 2F5VA 4XEMA 3I9V2 2CZ7B 2OTLI 2DBMA 1Z3YA 2X85A 1Q82U 2ATCB 2KROA 2FRWA 1D1CA 2CV0A 2LJ1A 5FU6C 2KRHA 1YOVB 4PLIA 1C0WA 3FJPA 5CQXA 1MV0B 2UUZA 2CQ7A 3OSGA 1HKQA 4DOWA 2OBPA 5B66C 2WAQN 5DCMA 3HXLA 1FBQA 3OYDA 3GP8A 5E3IA 2H6BA 1MBJA 4OB2B 1PD1A 4A0YA 2XF7A 2NYXA 3G1ZA 2P0PA 5DYMA 1N5ZA 2P0QA 5LJ5h 4CC7A 4KISA 4EQQA 2IGKA 4YYEA 4A3CJ 3RQIA 4NB5A 3AT1B 4LOCA 3LWIA 2YU9J 4EM1A 1VQNA 3WE3A 3SZTA 1ZBJA 3SYTA 2K3PA 3VODA 2V7FA 4E6RA 1XSVA 4MLOA 5GAHJ 5K5OA 1OCCH 1K79A 2LDUA 3H9GA 2JA5J 3EGUA 4OF1A 2CW7A 2O9SA 2VGNA 5KNNA 1ZTRA 2IS2A 4XIDA 3M55A 3REUA 2XPWA 1X3UA 4BHCA 4PJJA 4KULA 3H0GJ 1ZG1A 1OYYA 4P5NA 4P1WA 3NTHA 3PGGA 1RR7A 2J7IA 1VQKI 1H8KA 3CCMA 4H2UA 4UP7A 1EIYA 1BR4A 2CQKA 3A02A 3P8VA 3VWBA 5D5XB 1B34B 3I58A 4B4CA 2RB6A 2LQWA 2KXCA 3IH2A 1W5TA 1YB3A 5LJ5j 4KICA 3EUKL 4NC6A 3CO7C 2JS2A 4X1VA 2QDLA 2OTJQ 4RAGA 2F4OB 3X26B 3DTKA 2HXIA 3REBB 1BC8C 3VQYA 4R79A 3AG2H 1OZ3A 3T9NA 3E1SA 4UUSB 4ZYGA 1KD1R 3QSUA 1VQ7Q 3HOVJ 3FXQA 1UB9A 4CZZA 1O57A 4JZ4A 5GAOq 2B63J 3CCVT 2QWWA 4BDYA 2X4XA 3HKZN 2MK5A 3IG2A 3A01B 1IHVA 3A4CA 1Y96B 2RQUA 1NK2P 5CKDA 2CGHA 3H0DA 4YRVA 1MDMA 4ME7A 3L2CA 3O6BB 3C0CA 3MCZA 1JJ2S 4CRIA 1A36A 4XLEA 3JRHA 3FK7A 4HYEA 1SFEA 2JVGA 2ZIOA 1X6OA 3S6WA 4L5GA 4FQGA 1YJ9A 1ZKGA 1U5SA 2RK2A 3ER0A 2X3WD 1H8AC 2F2XA 4X1EA 3C12A 2H09A 4ELYC 2HQEA 2KRCA 4HG2A 4Q5SF 3OS0A 5HLHA 4F16A 1FBUA 1X6GA 3O8HA 2QG9B 4FYXB 3HM5A 3ME9A 3S3OA 2K9QA 2RH2A 2HR3A 1NJ5A 2CGPA 1IDYA 4TVAA 1UMQA 3I71A 2CZ6B 3KUFA 3J81K 2XKOA 2MSYA 3HEFA 2WC2A 5KNLA 1BN5A 2M16A 1NHAA 4ZTZB 2ZT5A 2MLGA 3HG9A 3FKJA 1QPIA 5FLXK 3FM5A 4KGVB 1MJBA 4FSXA 3M0TA 5FKNA 5FWBA 2DRMA 1U8RA 4AYBN 3I56A 4D8KA 2O88A 2M3AA 3DU6A 1TWAJ 1MMNA 4X5OA 4YPFA 2A3SA 4C92A 3C94A 5C51B 4UP8A 3QWXX 2QSFX 4E7HA 1EH8A 4N4IA 1S72I 1EVLA 1B76A 1TUCA 4LNSA 3N05A 3G6EA 4XSZF 5ED4A 4BBSJ 3QODA 5KYWA 1ZR4A 2CYYA 1OR7C 4V2SA 2HFHA 2IS6A 4EDUA 4C0ZA 2VKEA 4J15A 3PE0A 4UUVA 3CCJA 1QW1A 2R7TA 1GVJA 3HY0A 3PMTA 4KA4A 4JK1X 4HPQA 5JR3A 4U0WA 3DB3A 4FE7A 4A6DA 1NJ6A 1APLC 1T3SA 1KMMA 4MTDA 2QASA 1B70B 3OOPA 4P3PA 1WJEA 3QQAA 3GFJA 4OOIA 4XTXA 3A1YA 1EQRA 2IEKA 3VQWA 5LJ3h 3WGHA 2O8KA 1E3OC 3M53A 1BYMA 4WJ3M 4FTHA 1OULA 1PDNC 1M90C 5IP7J 4YRGA 1WKMA 2E2IJ 3RF1A 5GANg 2HU9A 4RG8A 3JRGA 2RJEA 3D5LA 1RACB 4GGGA 2R93J 3OW2P 3BR1A 1RKWA 2DIGA 2ZXJA 3QO7A 4M9SA 2QUFA 1ERDA 1ADYA 1D09B 1D3BA 3SWNA 2ROTA 3QO5A 5F1JA 3WODF 5M5YJ 1Z1DA 2DNUA 1T38A 2KAFA 1SRYA 2CP2A 2L8DA 3DV8A 4EVIA 1R1UA 1S6LA 2R7UA 1VQ6A 3EDPA 1QHGA 3RKQA 3OD1A 1D0YA 3Q5FA 4NQWB 5LJ3j 4M7DA 1OQYA 1WYXA 5IP9J 2M0MA 1BB9A 4M77B 3M8FA 1QZZA 2DIQA 2BXZA 3BP8A 1LFBA 1LOJA 1BK2A 3P8TA 2XF6A 2EYZA 2KT0A 2B0LA 4P55A 3RYPA 1EIFA 2YT6A 3CBOA 4I7HA 4IUTA 1EFNA 3BWGA 1GGMA 2FMLA 1AWWA 1JJCA 1V3FA 4B8XA 4M72A 4F7ZA 4XKVA 2VKHA 3PUFA 3O8VA 3A74A 4KMUX 2NXNB 4PNOA 2M1BA 1GV2A 2QF7A 3OS2A 2ZPBB 3MN2A 2EFWA 1FXXA 2E41A 4CC3A 4PHCA 3MP8A 4KDPA 5IP6A 2V1QA 4D1QA 3S17J 3S1MJ 2EH3A 2CW8A 3VYSB 4M78E 3MQ0A 1WZ2A 3B6CA 2ZSHB 3H92A 4MNUA 3HTUA 2MCNA 3ZL7C 1RADB 4KJZA 1BL0A 2DJIA 2KIMA 3A7AA 3G1LA 3RMQA 1R5HA 2JT4A 4AH6A 1KC8R 3IH3A 2YPRA 4C8QB 4KGXB 3CTAA 1F4KA 2ED0A 2X4YA 4M3BA 2JJ7A 3RMSA 2HI3A 2XDPA 4LG0A 3E5UA 3DWLE 2A05A 3CCSQ 3PSFA 1IGNA 2DVEA 1VQNQ 1USYA 1F1ZA 2E5NA 1RR8C 1H9TA 1YHQT 2XKOC 4LDVA 2HD0A 3TKYA 4RCBA 2L02A 1CF7B 3HRTA 3IALA 4A12A 2VXDA 3CPWP 5LHGA 4PGGA 4BXFA 2HNHA 2C0OA 3A8HB 3PL8A 3RYRA 3G1MA 1WLEA 1ZGJA 2CRGA 1HJDA 3JR9A 4ZDLA 1YW7A 3EPZA 1SFXA 3J7AF 3N97A 3ZCOA 3CCMQ 2O3FA 3BQZA 4PJNA 5KYYA 1TQMA 2XDBA 2V9KA 2AHJB 5IYCJ 5K5RA 2QEXI 2GWRA 3GWZA 4C92C 2YUPA 2ROLA 3DLMA 2A36A 2DBKA 1OU9A 4OB0B 2B8AA 1G3WA 3M57A 3CCEA 1MMDA 4ESFA 1I4K1 2RHQB 1UJYA 6AT1B 2O8XA 3OYNA 2IAIA 1S8NA 4HRIA 4ZH4F 5FKKA 1G3SA 4II2A 4I0BA 3NENA 3QNEA 5GANe 4AIDA 4I2OA 2XICA 2ZZGA 4AMCA 4RTWA 1R23A 3F0CA 1H641 2RHZA 4PDKA 2LF8A 2EZHA 2QAZA 2M45A 2F4IA 2L89A 3FX3A 3L1AA 2DL8A 4HVCA 5DTDA 2KRMA 4BE0A 2EAYA 1FLIA 2DDAA 2HQRA 3MQZA 1LPLA 1MZBA 2LNVA 1Z6RA 3M58A 4YRPA 1YIJI 4EJTA 4EGYA 1X3WB 4M7DG 4E7JA 3I7FA 2F2WA 4DNCA 3VSKA 3ZEHA 2HSEB 2HQNA 4M7AF 3DKWA 1N8RC 1YJ9Q 4OAZA 4X34A 4BB7A 2G4CA 5EGOB 2P7VB 4RBOA 5LRSA 3PTAA 2CP6A 3H6ZA 2IVMA 4ANJA 3CLOA 4ASNA 2QA4T 4RKUE 2XAJA 5CJ9A 1K1ZA 3HL2A 2XD0A 4ZYAA 3BG3A 1WHKA 1YGBA 4PJMA 2DK8A 2DO3A 4RTZA 3SWNC 1U6GA 1Q7YR 3TL4X 1WRJA 1KONA 1STZA 2VC0A 1MD0A 2Z33A 1REPC 2M51A 2L7FP 2WBMA 4MQ9F 2R0QC 2IY5A 2PJPA 2JW4A 4YRMA 1R49A 1IW7F 5TJJA 2LYCA 3NELA 3BFMA 2VASA 3KYCB 2HQAA 3I56Q 1LVAA 4BUGA 2LY2A 3GUDA 2TDXA 1LNXA 1R71A 3G4SA 5F08A 2E3HA 2ODRD 1M3CA 3I55A 2KQRA 5BS6A 2K40A 4FCYA 2E6NA 1XNIA 2LQ8A 5GANh 3TP0A 2Y9YA 2ZPHB 3TMOA 2C06A 2K4JA 4JQFA 1S7OA 3PSIA 5J8FA 1IN7A 2X3XD 2ZT8A 2BY1A 3E6DA 2C8MA 2Y69H 7AT1B 3QIIA 1MGQA 1WDXA 2H94A 4RAZA 1J5WA 1NK3P 4BY1J 1BKBA 2KRNA 4D5CA 2OPTA 5GAMg 2MG4A 5J3LA 1KZHA 2VIXA 3JCMd 3CCJQ 3OB9A 1PSEA 2EJ9A 4N4NB 3U1DA 1BOAA 3WTXC 1V5EA 2KP6A 3CMEI 3K2AA 1XB4A 2EPFA 3AG4H 2DXIA 3SXYA 5HK0A 1M8MA 5LBQA 3ABLH 3FZVA 3W6VA 5GAN3 2COMA 4GBQA 4KH0B 3RACA 4LDXA 3JAMZ 4MMLA 4G8XA 1KMNA 2LBFA 3A31A 2CWEA 5GANj 3ONQA 2JA8J 2GNCA 1T0HA 2TRTA 3WGGA 4AIKA 3A32A 2KVQG 5FB2A 5I2MA 3UA7A 1OKRA 4BKXA 4I02A 4NDLA 3L2VA 2X35A 3HFNA 1N78A 1PUEE 2QVOA 4XTVA 2JA7J 4Y4RA 2QYOA 1RI9A 1USYC 1XX5A 2VXZA 4YP0A 2HL3A 5IXFA 1SHGA 2VOOA 3E6CC 3GTPJ 1IREB 3RKWA 1Z0XA 2RVCA 5HODA 2DW4A 3BG9A 2F5CA 1ON2A 3ABTA 4I99C 3CD6I 3CCRA 3VYRB 3BQYA 4YRSA 3H5NA 2B9SA 4A53A 1GL5A 4XQFA 1VQ6Q 2ICWG 2HKOA 2JT1A 2DTRA 1QVGP 2NNNA 2RAEA 1RIQA 4R55A 1UFMA 2A07F 2Y90A 1M9SA 2EB7A 1QPMA 3W6KB 2LC4A 4UPAA 2HAXA 3UNGC 3RQ4A 4AC0A 3VS3A 4XR6A 3EG1A 3CC2I 5D5VB 2FQ4A 3DFGA 4BAYA 2E1CA 2FZKB 3ZBDA 1LVKA 3PFIA 4LMYA 1RAHB 2EQMA 1VQZA 1YI2I 2EQRA 1I39A 4I01A 3ZQCA 3LMMA 4YRNA 3DPLC 1I8FA 2RA2A 3LA3A 5ICEA 3JSOA 3RPUA 4IO9F 1NEBA 1J2XA 4DYRA 5KVRA 2O31A 4M77G 4KMFA 1HW1A 4DEYA 1BC7C 4XTUA 3L1PA 2MH2A 2GCXA 1XMKA 4TQDA 3WU0A 1U8BA 1WQ2A 3IWZA 1W0UA 4S04A 4HWRA 2DMNA 3F72A 3LGFA 2DOEA 3KP7A 4CUGA 3PVLA 2YRCA 1X2GA 5FROA 3HSEA 4V2GA 2EFOA 2RQQA 1FTTA 2ZNZA 3MJXA 4B3AA 1J5YA 1X2KA 2XPUA 4YRCA 1F5TA 4PJOB 4G9YA 4XU0A 4LFUA 1H88C 3F8FA 3G71I 1N27A 1WH5A 1M90U 2I10A 1M1FA 2BY3A 1B8AA 2PMZN 5GPAA 3L4GA 3OIOA 3UGTA 1VQ4I 1R58A 2LLKA 1QP2A 1UGRB 1QRYA 2JSCA 3BZKA 3FF5A 2PVDB 1PP7U 5LHIA 1MNDA 4JS4A 2DK3A 3KFVA 5GAMe 1NYGA 3CPWS 3WTWC 4II3A 2L54A 5GAN7 2QXFA 1TSFA 4UXNA 4DBQA 4YCUA 1RI7A 3ZGKA 1MIJA 2OAWA 1ZSZB 5CVRA 5K5QA 5KCMA 3K70D 2GGRA 4IRGA 3DLLF 2QQ9A 4F91B 2AXTC 1SSFA 3F23A 2WY7Q 4Y33A 4XTYA 3ZOBA 4A3IJ 3SQNA 1JJ8C 1WPKA 3CCEQ 1W1FA 2RPNA 3JSPA 4XBFA 2HMAA 4D7MA 3HY1A 1JJ6C 2XAGA 3E9HA 5I2SA 1N6AA 4JX6A 1SERA 1USSA 4LE9A 2K7LA 4M7AA 1TNSA 2F5KA 1VQ5A 1KC8C 4XKBA 4ESJA 5D8LB 4XICA 1E24A 1HOMA 5BQTA 3META 3ASOH 4E70A 4RAFA 5IT9Z 5CQEA 2YUQA 3K1PA 1VQ7I 1J0RA 2G3RA 1VA7A 4Y7NJ 2JZYA 1M3AA 4OIRF 5KYXB 4BACA 3FDYA 2KT8A 3P8DA 2PVGB 3BTLA 2P5IA 1TS9A 4Q15A 2M8GX 2X1DA 4BQNA 2FUG2 2DQLA 5FWCA 1T56A 2IS1A 4BDZA 1G59A 4YRLA 2M4GA 1B4AA 1D5YA 1JEGA 4AT1B 2OTJT 3QP5A 2LK2A 4M6XA 3EETA 1PD0A 2DN0A 4C92E 1ZG5A 2HQXA 4Y17A 2JM8A 4ATOA 3M4OJ 1B7YB 4EJOA 2DM1A 5GAMh 2O9VA 4FX4A 1ETOA 4CCMA 2AKWA 1X56A 3CDHA 2MW8A 2JM9A 4HT8A 4CC2A 1S7EA 4XKCA 3I59A 4HWPA 2Z5UA 1P4XA 2R4GA 4AVPA 1E3HA 5BMZA 3DLAA 1GUUA 4F04B 4M77F 2EIJH 4S0HB 4S05A 3NQOA 2V9PA 5LLQA 4RCCA 3HTSB 3OYIA 2MIOA 2HWVA 5D6WA 2OQGA 2K57A 4K2EA 1Z7NA 1Y1VJ 2O5RA 4AFSC 3G4SQ 3I55Q 2R7VA 2JNGA 2RO0A 1I5OB 1WHJA 5L3FA 5GMKm 4KITB 4LG3A 2KRSA 1MBGA 5GAMj 1ARKA 4P71A 2E6ZA 1XTDA 1WJBA 2F5DA 3RIRA 3OQ5A 2DU7A 2W84A 4A3FJ 4X0GA 2QQBA 5ICCA 4L9TA 2HDDA 4QQ6A 2RGVA 1KFZA 2OQRA 2DI3A 4HA8A 1NE8A 4QPOA 3MCAB 3BJOA 2A6HF 2VT3A 4PFPA 3WU2C 4C8QF 5LFAA 2DTOA 2VXEA 1R0CB 3FC3A 3HRKA 2Y30A 3W6JB 3HC7A 4H2VA 1Q7YC 3DEEA 2IW5A 3S93A 4NBQA 5LEKA 3VS6A 3FLGA 4ZTFA 3HUGB 1WJFA 2HPIA 3C2HA 2EA2A 5LGUA 1IRGA 4GCVA 1QBJA 3PVQA 4F3QA 3M59A 4RA2A 4EM0B 4P3OA 4RAYA 4HV5A 5FLVA 3WTVC 3RZOJ 1R77A 4HQEA 2KBTA 1Z9QA 2LF7A 4OB3B 3T1BA 4FSSA 2RF0A 3OIQA 1KJWA 1NNHA 1NYRA 5A2QK 1ZGWA 4A3JJ 1WHHA 1UG0A 4CXFA 1YWPA 3RL6A 2ZPIB 4F52A 2DDZA 2Q5HA 2WADA 2R7RA 4JLIA 5GAOp 2G9WA 3E9FA 1M8VA 2DTZA 2LCCA 4WCGA 1MJAA 3FMSA 5FD6A 3IH4A 3NARA 1SG5A 3CCRQ 2HDAA 3FXLA 3HPHA 2WTEA 2EL9A 4IIMA 1B7TA 5D5WB 1HSQA 2O4XA 1QVGS 4J5YA 2R92J 4P73A 3G2BA 3ZMZA 3M7GA 1GXIE 1I50J 1S7AA 2K5CA 4BE2A 4BI4A 2FMYA 3JB9G 1JUPA 4BXXJ 4F93B 2GAUA 5B1AH 2EW3A 3KZIC 2ZAEA 4M7AC 1EJ9A 4XTWA 3CEYA 3MO8A 3QZ9B 3M4PA 4YRJA 1V5GA 4M75B 8AT1B 4NC8A 2XRLA 3RUXA 3GOXA 2XI9A 4JX5A 3QOEA 1I5LA 4CYCB 1AOJA 1QLYA 4CYDA 4N0BA 4XONA 4KN4X 4E4HA 4PSWA 4NC7A 1VQ8I 2A61A 3GO5A 5FJ8J 3HGYA 4CGZA 3ECOA 1FPQA 2XGXA 4E47A 1YRNA 2JPCA 1VQ9A 2OF7A 3LSGA 2IIMA 1IN5A 2K5LA 1ZQ3P 4BUPA 1WJRA 1SRMA 2D1HA 2QM3A 2F5TX 4BYYA 4QQGA 4P9UA 4JRIA 1YFTA 3CQZJ 2ZFWA 5M3MJ 1YCYA 5EG0A 2K85A 1B8IA 1V5FA 1HC7A 3VYTB 3E7LA 1UEBA 3CC7T 4LXCA 3CP2A 1VQLT 4OMPA 4M3DA 3CCSI 1ZRDA 5DD8A 4PJ0C 4ZNXA 2ID6A 1ABQA 2DYRH 3TEHA 3JCMf 1ADJA 1AU7A 2R7FA 4OAYA 2WAQA 3A0BC 4M9XA 4XRFA 2IT0A 4A5NA 1WJSA 1U2WA 2M34A 3CLQA 2WWYA 2QBYB 3GZ6A 4M7DD 1ABOA 2RI5A 1QVFP 5F04A 3BT9A 1X1BA 1KQSA 3PIOA 2R5YA 5E20A 2JVVA 1GBRA 2ETHA 4NL2A 4P71C 1CKAA 1IGQA 4OGEA 1VQNT 3QDFA 1FTZA 4B48A 3V7RA 2D2WA 1WJCA 3M0SA 1U78A 1G4DA 2G0EA 2W25A 1VZ0A 1TWGJ 3INZA 1J3TA 1ZUUA 5DD4A 2KY9A 3CESA 3CC4A 2X4HA 1BI0A 3HOSA 1U5TA 5GTHC 4L9JA 4RGUA 1I07A 5DUIA 3K4CA 4RLFA 3H0HA 3CCMT 4FYYB 3HRMA 1MMSA 3AG3H 5DY9A 2FX0A 1H4TA 1W0TA 1AOYA 5GADJ 3F8CA 2RK1A 4FE4A 1X54A 1LPQA 2J6OA 1ETKA 4NUBA 1UZCA 4JRQA 3ASKA 3J80E 5BPDA 3JB9F 3LQQA 1H9GA 1R4NB 1JTXA 3HB9A 1RI0A 1UG1A 5DM7R 4C0DC 3OYKA 3OA6A 1HSTA 1ATIA 4YROA 1XCVA 3H5AA 2LJ3A 2E12A 1TZLA 3HKZA 5DLOA 2P0LA 4DYCA 1JB0E 2Z99A 4KNYA 1Z21A 3WVDB 5DUKA 1POGA 3A8GB 2AT1B 1WFXA 2SEMA 3NEMA 1LDKB 4M73A 1FBSA 3RR6A 3QBYA 1R5GA 4BJ5C 2FO0A 4O5VA 2C0TA 4U7BA 1YJWA 2NUTB 5HDNA 3F21A 5FU6B 3REAB 3CCQA 1O4XA 3QJ6A 2D45A 1QCOA 5ICFA 5JHFA 4FYWB 3QU6A 4P73C 4P5OA 5C4JJ 4J6YA 1YJ9T 4CS3A 4M71A 5KE2A 5M9OA 1R8OB 1X1DA 4NL3A 4F7UB 3CJTB 5H6QA 3SFMA 3DCFA 1SD5A 4LK0F 3I56I 2K7AA 3EG9B 4OMNA 2IGOA 4D7NA 4WJ4A 4YELA 3CCUT 2KL4A 4CH3A 2B86A 1ZQ1A 5CAIA 3D5SC 2OTLA 5EZGA 3MD2A 4U88A 4LD9K 1M1KC 1DPUA 1SVLA 3BE3A 3A5ZB 3JB9H 2BTTA 3QWYA 1JUMA 2NVQJ 1H89C 1KC8U 4PG3A 2ZKZA 2H3EB 2CP0A 2OCCH 5EEHA 3KXTA 4B9XA 2K9MA 4AYBA 2YLBA 2GFUA 1E22A 2PZ1A 3ZRGA 1TNTA 5FFXA 2E5ZA 3CCJI 3C7JA 1P92A 2R7QA 1WQWA 3WG7H 5E8IA 5E1WA 4QVZA 4ZYHA 1TU0B 4QLCU 2EQIA 2V1UA 2CH4A 1QVTA 3P5JA 4PJOF 5IPAA 2XHCA 2VBXA 2QQSA 2GOXB 2VN2A 2PLYA 2D0NA 4HVUA 1XPXA 1BI2A 4IHYA 2VBWA 2LC2A 2H6CA 4NNJA 3JCMX 5GMKh 1JUSA 2VI6A 1X6BA 2ALYB 4ZJZA 2E5QA 2PJRB 4B43A 1K0XA 3LA2A 3G6ET 1XCBA 1W4MA 2EK5A 4AFQC 2FG0A 3LSIA 3VRZA 3K4KA 1NJ2A 1QKWA 1Q95G 2BV6A 1E0EA 2LSOA 3OWTA 2EFQA 5CK9A 2LKXA 1OPCA 5L8RE 4LD5A 2JTMA 2R5ZA 1SANA 1VQKA 2JTFA 1BCOA 1HDDC 4JYKA 1ZHIA 4MZMA 2KXDA 2EYQA 2XB5A 2JSPA 1LFUP 4OU0A 4M77D 1UDLA 2CH4W 2MGQA 2XIDA 1UJ8A 3JCMP 4TVYA 3V7CA 3ERED 3JCMb 3K4JA 2ZR3A 1X1PA 4HLXA 4YIFA 2ZTGA 1BIAA 4M4ZA 2EWNA 2CDTA 3SHFA 1IXRC 2ED1A 3J7YJ 5GMKj 4M9ZA 4YCVA 2BE5F 4C3IJ 1UFFA 4ETSA 2IP2A 5EGOA 4Y91A 3Q3SA 3WG9A 4L6V5 3KZYA 5GAOr 2OX7A 2BZTA 4G94A 2F6CA 2ELHA 1NLPC 3TCJA 3DPUA 2JPBA 4M78A 3H0IA 4OGCA 5IYBJ 1K0SA 4KBMB 2MWOA 4HKEA 4BD3A 3MF2A 2ZGWA 1WFWA 5C44J 3VQXA 1Y57A 3BCAA 3VV0A 3I35A 1FIPA 3ZQGA 1YJNI 2RQRA 1WCMJ 3J81Z 1U5TC 4L5IA 1P7JA 1Z9CA 3V4GA 3HXWA 2ZBKA 2LFBA 3VS4A 1VQ6T 2BZXA 2HEOA 1YITI 4C8QD 2DL7A 1KQ1A 5FLXZ 5IT3A 2E3CA 2X48A 3HOWJ 4B09A 3BTJA 1ZAOA 3GNGA 4IQ4A 3TVTA 2ADUA 4RDUA 3OBWA 1VQ9Q 5GAOn 1Q7YU 1MKMA 3KLNA 1KU7A 1J75A 4RB2C 4PGHA 1YX3A 3HOUJ 3IRRA 1T08B 4OWRB 2YR2A 1GXQA 3QPHA 4LUDA 2ARSA 4G6TB 5C6SA 1ZARA 1CKBA 4M75G 2R7ZJ 4H2SA 2XMFA 1C0AA 3P8HA 3I53A 3S16J 4CZCA 1K4TA 3M1CA 1ORKA 2ZIMA 4HDUA 3H1CA 1X3ZB 4RMOA 2Q2EB 4H0EA