3V7CA

Cystal structure of sabpl in complex with inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
322
structure length
322
Chain Sequence
b'SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
total genus 103
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7cA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7cA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7cA02
3I54A 2EV6A 4OP0A 3VOEA 3T5XA 4P75C 1BI1A 4M7DD 4LB6B 3MAJA 2PMFA 2EK5A 2LF7A 5L3DA 3Q9SA 1VTNC 4M75C 1W5SA 3WTYC 3JCMV 4YPFA 4P9FA 4M78C 3P9CA 4HAMA 1MJBA 3RTRA 2IJLA 3V8LA 4PG3A 3KEQA 4E51A 1TNSA 2DXUA 2QVOA 1CF7B 4M77D 1RNLA 4XEOA 5ELNA 2GA1A 3KFUA 4J6WA 4WXCA 3WE2A 4AWXB 3HXWA 3UH0A 3HTUA 1NYQA 5GAMg 1H4QA 1AWCA 5C51B 4OMYA 2ZINA 2O3FA 1W7PD 2R3SA 3NEMA 3BY7A 3A74A 4CZZA 4PDKA 3F22A 3Q9VA 5BOXA 1HC7A 2Q2EA 3U2RA 4P71A 1LB2A 3S2WA 3COAC 5J8CA 4RGUA 2Q7EA 3DFGA 2HKXA 5GAOn 5ILSA 4P3OA 1U1SA 4HX8A 4KICA 4TVWA 3M8FA 2PJPA 4PJOC 5BS6A 2JT1A 4M78E 3EDPA 4XRFA 1DP7P 4B09A 1TW3A 4RGSA 1IN5A 1WQ2A 2HS5A 3CDHA 2DTIA 4P3NA 2ISYA 4XLNF 2O6GE 1WQWA 3QPTA 1QE0A 5CVUA 1X56A 2I4NA 1LEAA 3DP7A 4CH5A 4M7DA 3F8MA 1EH8A 3HSFA 4L9JA 3ZP5A 2F2EA 4HX7A 5LJ3e 3JCMW 2RV8A 2MH9A 3WTTC 4HWSA 5ICCA 2RN7A 1ON1A 2R7FA 4IRGA 2JPBA 4DQ2A 1R5HA 2BGCA 3FHZA 2RB6A 4MEYF 4TWAA 1I5ZA 5D4SA 4UUVA 3VB2A 3ZMSA 2DTOA 5K5OA 3VQVA 4HYEA 4FX0A 3JB9H 2GXBA 4F7UA 3BZ6A 3QO8A 1KQ2A 4UP8A 1TH7A 3E9IA 1HK9A 3D5LA 4EV0A 4RB0A 4A5MA 1Z05A 4J6XA 4YCWA 3HSRA 1IZ1A 2Z9OA 1QF6A 3TKYA 4YRSA 2M5WA 1HTTA 4QLCU 2OD5A 4S04A 2M30A 5LJ5h 5CVIA 1Z7MA 3JCMQ 2ZTGA 3T1BA 4M75D 1R5GA 5CVVA 5GAN6 3RGLA 4M78D 1HW2A 1U1TA 4RB1A 4P73A 5DV5A 3LSQA 3IALA 5GAN3 1UFMA 1ZREA 3FB9A 4WXDA 4QVCA 1H9GA 3GWZA 3M4GA 5LHIA 2DK5A 3RKWA 2VBYA 4XTWA 2D1VA 3TO9A 1JGSA 5BMZA 5DUKA 5K5RA 1P4AA 5HDGA 3D0SA 4H0EA 1K78A 3MEYA 3FIFA 3HFOA 3RF1A 2MH2A 2ZIOA 1XD7A 1YB3A 2VONA 3GIBA 1HW1A 4LB5A 1HKTA 3EUHA 4EGZA 2G4CA 2DO7A 2A5YB 3I58A 3M1EA 4YRRA 2DFIA 1FBQA 3JTHA 2HZTA 2K27A 1YIOA 4M74A 1BOAA 4K2EA 4WCGA 1ATIA 2VOOA 4YRGA 2C7IA 3WTXC 4UVAA 3NRVA 2W85A 1D3BA 3C1DA 1T0FA 4X9DA 4YFNF 2XHKA 3GFJA 5D4RA 3M4QA 4PGHA 4PJOD 3R4KA 2ZZFA 4YREA 4N0AA 1LDKB 4XSXF 4ZYGA 1B7YB 3PCOA 2Y0MA 1B9NA 4XEMA 2EA4A 3QU3A 1JE8A 1FY7A 4YCUA 2VC0A 2K86A 2VC1A 2B0LA 4M7DG 2RDPA 1BBWA 1KU9A 1EVLA 4XTXA 3LA3A 3QU6A 3CO7C 2GA2A 4HDUA 3F3XA 4RCCA 1ULYA 2XIGA 3H3UA 4AH6A 4HV5A 2Q7HA 3GFLA 4I09A 4M78A 4K87A 1S6LA 5GMKm 6PAXA 4M77G 1B4AA 3IWFA 4TVAB 3G3ZA 4B8XA 3MF2A 4G84A 3HUGA 2DU7A 4IJAA 4KIGA 1R36A 1WPYA 1O3SA 2CIMA 4ZIBA 5CAIA 1FP1D 4HQMA 4EMKC 3SWNA 1YW9A 1LDDA 4KUMA 1KGSA 2XAQA 3HFNA 2AMCA 2WC2A 4HWTA 2OZ6A 4WX9A 1PP8F 3FXRA 1EIYA 3LSTA 4JRIA 4M77F 2LDUA 4C8QB 4A2UA 5ERIA 1WQ7A 3U1DA 2DU9A 4Y13A 1ZH5A 3VQXA 2F5FA 3JCMg 4I2OA 2X0LA 4JQFA 4M71A 4L0YB 4EJUA 4AIHA 4PZJA 3CMQA 3V7CA 3HTSB 4M7AF 1WRJA 2W57A 5LRRA 4PGGA 4RB2C 4C92C 3L7WA 4A12A 5GAN8 2NS0A 1EOVA 3EYYA 2QENA 4GYGA 4ENNA 1J7KA 5H6RA 4YRTA 2DPDA 2L02A 2P5KA 3K1NA 4BH9A 3G73A 5E3IA 3QP5A 3RUXA 3O6BB 4KN4X 3QNEA 5BPIA 2I4LA 2CJAA 5D8LB 1TW2A 5JVTA 1XDSA 4YRQA 2EWNA 1YS6A 3B02A 1FZPB 1YG2A 2Z5UA 3WG9A 3P8YA 3GX4X 5LEKA 1JHFA 2Z3YA 3HXVA 3QO7A 5L3BA 1ADYA 3GF2A 3DQVC 5HLHA 2L3DA 3EQLF 4KMUX 4U7DA 1FSEA 1REPC 3SWNB 2EJ9A 5AIQA 5H6QA 1E17A 1ONVA 3HXUA 3F6OA 5D6FA 1BI3A 3HY1A 1QBJA 2YX4A 1LEBA 3DF8A 1Z1DA 2YX7A 3RPUA 1SD6A 4YRCA 2J3MA 3QHSA 1T6SA 2VBXA 4BXUA 2DT5A 1Y96B 3NENA 3U9GA 4HT8A 1MJAA 1Z9CA 4C92E 3WTWC 5AIPA 4WWCA 2CQKA 2V1XA 5GAOq 1XSXA 4GO1A 3MFKA 4HVCA 4L5JA 5LLQA 2BYVE 2Y75A 3TEGA 4P3PA 2STWA 1WWXA 4CS2A 3EFRA 4H2XA 1O7FA 4MEXF 4M75G 2HFHA 5GAN5 1IW7F 4ENMA 4V2SA 4H2YA 4CYDA 4YFXF 2DDZA 4RAZA 1YFSA 4M7AC 2ZJ2A 3IKTA 2KKOA 3FM5A 1MD0A 1BM9A 2YHTA 2A07F 2ACJA 3RDIA 4A6EA 2FE3A 2Y48A 3M8EA 2DQRA 3IHUA 1IXCA 2O0YA 4M75F 1YS7A 4P74C 3OD1A 2J5OA 4BHBA 1XGMA 2YLBA 2K57A 1YCYA 3E3VA 2E7WA 2EFNA 3TDZC 4A53A 1M8VA 3HHHA 5HOOA 1EV7A 1QZZA 1G4DA 2I4MA 5L3FA 4HQEA 4C92D 1Z7UA 3CUQC 4YROA 4M77E 2XVCA 4PJOG 1YW7A 4HT9A 1FWZA 5FD5A 4O5VA 2ARUA 3HXZA 1JJCB 4A0ZA 5HDKA 1C0WA 5L3EA 4M7AE 2UXXA 1EH6A 1NJ6A 3FX3A 1XGOA 2Q0OA 3BJ6A 4CS4A 3WU1B 1JBMA 3GYHX 3BOQA 1NJ8A 4Q6GA 2XRNA 3QUIA 1IRFA 2IRFG 4PJOF 3IRRA 4G9YA 2VODA 4HWRA 2OU2A 2JPCA 3JB9D 1Z6RA 1QZYA 3LFKA 1LYLA 1O3TA 4WJ4A 4EVIA 1FBSA 5D8KB 5LJ3f 1VQZA 2F5EA 3RERA 1D8KA 1MGTA 5LGUA 2ODRC 2VXEA 1ZAOA 2PMUA 4BHPA 1RZ4A 1BJAA 1JRIA 4KFCA 3HSEA 3TOAA 3TEHB 3L00A 1ZLJA 1B34A 2QLZA 2ESNA 2A69F 2E7XA 2MLGA 3HHGA 3E5QA 3HFZA 5BPDA 2WWYA 4BW9A 5JI6A 1HSTA 4KR3A 3VODA 5DUIA 3CO6C 5LJ3j 1P92A 2RD1A 4O6JA 4A0YA 5JR3A 4P55A 4KYWA 2VXFA 2M1BA 3HRUA 2A68F 4LLNA 3R6SA 3PQJA 2AKWB 2EJGA 4UPAA 2V1UA 4M7AD 2K4BA 2K02A 3W3SA 1FPQA 1MJ9A 5E1WA 5J6XA 5F1RA 1PP7U 4NCXA 2IP2A 3FF5A 5GMKe 1NYRA 5C53B 2FSWA 4U0VA 4XTYA 2HTJA 4HF2A 4MQ9F 1ZARA 2ZMEA 3FZVA 3MF1A 2Z99A 1GVJA 2XAFA 1STZA 2RNJA 5DCMA 1S3JA 2FMYA 3NEUA 3E6MA 1KQ9A 11ASA 3IL2A 1X01A 2L54A 4M72A 4G85A 3ISPA 2DKGA 3TGNA 2GXGA 4ASNA 2UZKA 2EJFA 3P9IA 4NL2A 1WYDA 4Q15A 1PUEE 3BJUA 3V8JA 4M75E 1T98A 2E41A 2ELHA 1MDMA 2FBIA 4UVBA 2VXZA 3GFMA 2BBYA 2OQGA 5FO5A 4WXHA 2ETHA 3JCMP 3F23A 1FT9A 1USSA 3KZYA 1YYVA 1H0MA 1D3YA 3R07A 4L87A 2QYOA 1SFXA 5LJ3d 3R60A 2XTIA 3BDDA 5DY9A 3E6CC 4WJ3M 2H6CA 1RUNA 3DKWA 4U88A 1F1ZA 2MC3A 3QTCA 3WGHA 2Q5HA 1KQ8A 4DPGA 2W24A 1R1UA 5HGQA 4LJZF 1ZN2A 5K1YA 3H92A 3RPQA 1SERA 3BWGA 4NOYA 2VT2A 3K1MA 4M77A 3BJAA 5ELOA 4U0YA 1HW5A 1BN5A 3ECOA 3ZMDA 5GANd 4L9NA 4N9IA 5F64A 2I4OA 5ILVA 2WV0A 3BY6A 3RYPA 4CH4A 4KIFA 1XN7A 2DZCA 3HTZA 4M7AA 2PBIA 1IN8A 4CGZA 5LHHA 5L3CA 3I64A 4BHCA 1WKMA 4PJOE 4EGYA 3SFZA 2RHSA 2DPUA 1W7PA 3VU3C 2ODRD 3GZ5A 3GEZA 5H20A 3JTGA 3FJPA 3ABUA 1Q1HA 3SZPA 5KVRA 3R0AA 2QM3A 2YR2A 5GANe 4PCQA 4AD9A 1FBUA 1IXRC 4P74A 5K5QA 2HGCA 4ESFA 3QRFF 4TQFA 3JSOA 2P5LC 5CLSA 1R22A 4Q5SF 2XAHA 5GAOl 4S05A 3VQWA 4M7DB 3I4PA 4RAYA 1R00A 5GMKi 4EM1A 2XAGA 2RC4A 3W6JB 2E64A 2EFWA 1P6RA 3IRQA 1FLIA 4ESJA 3IKVA 4ON0A 1U5TA 4C92G 2KJBA 1FSHA 4OLFA 1Y0UA 3O3KA 4R1HA 3P9KA 3C18A 3CUQA 3I71A 4JBAA 2O8XA 1G6NA 3ULQB 4Q48A 1T38A 2ZNZA 2PEXA 2Q8KA 1E1TA 1NJ5A 5HS8A 2FEZA 4BQAA 4F7UB 5IT9Z 5D5VB 4G6QA 2QBYA 1MKMA 1G3SA 5LJ5g 3KP4A 2LF8A 5FFXA 12ASA 1O3RA 1KYZA 1T2KA 4JUVA 4LD5A 3RKXA 4C92F 5GAOp 4XTVA 2JZYA 2F5CA 3KFWX 1MGQA 3DXJF 2D1HA 1ZRDA 2ZZGA 1NNHA 4M6YA 1H9TA 3M4PA 2LSOA 1A04A 2DZ9A 2C6YA 2NNYA 3JB9G 3BPVA 5HLGA 1B9MA 2H6BA 2P7CB 1B8AA 1LQ1A 4IRHA 4XSZF 3GVAA 4G8XA 4P72C 2OQRA 4A6DA 2E65A 1LDJA 3R61A 2GAUA 2BEOA 3I59A 4EJOA 2ZCWA 2FBHA 2VC8A 4P75A 2GZWA 1S7OA 2A61A 5D5UB 4CH3A 1H4TA 2PI0A 4TTVA 3WGGA 3PZCA 2IW5A 3NELA 1K78B 5HDNA 2RKHA 4M75A 5E8IA 3JB9F 2EFQA 2HKOA 3KCCA 1XSVA 2ALYA 2P0LA 4YIIA 4IPAA 4G7ZF 1L3LA 4Y91A 4OIOF 3QSUA 4UP9A 3FXUA 4JK1X 1BC7C 3RL6A 2RQPA 3KZZA 1JXSA 3J80Z 1J59A 3WODF 1ADJA 3GO5A 1H4SA 5E8GA 1XGSA 2VOPA 4HA8A 4J6YA 5L3GA 1D3BB 4M7AG 4UVCA 3UFGA 4ZZDA 3BDUA 5LJ3h 4TVYA 3ZN0A 2KIUA 1IAWA 3WGIA 3E6BA 4RGXA 1SD7A 4ESBA 5ED4A 4AVPA 3PCOB 3KLNA 4FT8A 3HOSA 3EFSA 3HRKA 2XUBA 1UHMA 2D45A 1XSDA 4LG0A 1J75A 3QO3A 4XU3A 2ZNYA 1I1GA 4GYIA 5ICEA 5ICGA 3K0LA 4K86A 4YRJA 3E5UA 1TBXA 1ZHFA 2PG4A 3INZA 4LLGF 5GANh 3CUOA 3L4GA 3F8BA 2FNPA 4GGGA 3ZMVA 1YFHA 4PJOA 2DJZA 2ZBKA 5DYMA 1J9IA 2Y90A 4M78B 3QP6A 4YRMA 1L0OC 4MNUA 3LWFA 4XTUA 1F5TA 5GAMd 4KR2A 2EJRA 4Z2YA 5I21A 2PN6A 5EEHA 5LHGA 1U3EM 4N9HA 2EV5A 5E1XA 3ZPLA 2QHTA 1GGMA 1G5HA 4UP7A 3WU0A 2KIMA 1C0AA 5GAMe 3HYIA 3UGTA 2AMCB 2E1NA 4ETSA 2RHQA 4IHSA 4P71C 1D5VA 1GXQA 3K9TA 5ILUA 4P5OA 1N9SA 2DBBA 1EIYB 1IN4A 3M9AA 4UXNA 4R79A 4OINF 3VBBA 1N9WA 1O57A 1Z6TA 4BYYA 2X4HA 5IT9K 1KMMA 5E1ZB 1OR7A 2EFOA 5D5XB 3LSSA 3SB2A 3JAMK 3IKMB 4FHTA 1LOJA 2PLYA 3WQZA 1RIOH 2XGTA 1X2HA 1XGNA 3F72A 1S7AA 3FXQA 2ADUA 1I4K1 3BFMA 4I01A 3FMSA 2V1DA 2FMLA 1G3YA 4RS8A 3FWEA 3MCZA 2ZR3A 3JSPA 1RI7A 4LLLA 3I7FA 3KETA 4M9XA 2YLCA 1FYLA 1EQRA 1SD4A 3WTSC 4MQVA 4MTEA 2DK8A 3J81Z 1Z7NA 4P9UA 1ZRCA 2P8TA 3ELKA 4M9SA 3SQNA 3FMQA 4NQWA 5E17F 1BBYA 2RHQB 4Y17A 1DUXC 3PQKA 4HLYA 2O03A 3ERED 2A6HF 4RCBA 3ML6A 5TJJA 4KQEA 4X9CA 3L2ZA 4IRIA 4C8QF 3N97A 2LKPA 2Q7GA 4TQDA 1YO5C 2M8EA 3LAPA 3JCMc 5CVRA 2RM4A 2YPRA 3J80K 2ARTA 5CJ9A 1YFTA 2DLLA 4KIBA 5DEQA 5HS7A 4HDVA 3JB9J 2P6SA 4YRKA 3N4MA 4E70A 1W66A 4YYEA 2L4MA 3ZQ7A 2P6TA 1SRYA 5KNNA 3SHFA 4MGRA 4WI1A 4H2XB 1V3FA 1I6XA 2MLKA 4YRNA 3GFIA 3MWMA 1UB9A 4P73C 2UXNA 2HR3A 3H3ZA 2MD5A 5LGTA 2HNIA 2IT0A 2ISZA 1K6OA 1NJ2A 4P72A 1QPMA 2RVCA 2UWMA 1RIQA 3O2PE 4OIRF 3RESA 5GMKj 1U78A 3MZYA 2EFPA 3P7NA 4H2WA 2XKPA 2CGHA 2GIVA 3JW4A 1J5YA 4UHTA 1TQMA 1CF7A 3JCMb 1BBUA 2OZUA 4KT5C 4KMFA 4A54A 5JHUA 2COMA 1U6GA 3REUA 3HRTA 3TDUC 5E20A 3G1ZA 1LJOA 5DCFA 2ZGWA 2V6CA 1XB4A 3F6VA 5IT3A 4H02A 5K1PA 2M87A 2MA3A 1J5WA 4XLPF 3RKYA 2HEOA 5LJ5e 3T8TA 2HWVA 2QQAA 2DTHA 4G7OF 1KQ0A 5GMKl 2A6EF 5GAMh 2P5IA 1HKSA 3HXYA 4RGRA 4UV8A 4EMKA 3JCMJ 1ASZA 2ZT7A 3LC0A 1B70A 4BWAA 2JSCA 1LNXA 1IUYA 1FX7A 4WF2A 2QTXA 4C8QC 2EL9A 1ZLKA 4RDXA 4RQEA 4L9TA 3BROA 1OPCA 3VEPA 1LVAA 3IWZA 4L18B 1SMYF 5LRSA 1XMKA 4EMHA 1XCVA 1XCBA 1DPUA 4M6XA 2CYYA 1KOGA 3KE2A 4EQQA 3EYIA 4J5YA 2JRTA 2ZZEA 3RI4A 5GANf 4C92A 4BNCA 1W5TA 1HXDA 2VN2A 4Y15A 5F5WA 3A7UA 1H4VB 1J2XA 3A7AA 1YTYA 2G7UA 2VBZA 1ODDA 3LAJA 2V9VA 2ZCEA 3B73A 1ASYA 2QZ8A 4CH6A 3KP6A 2FOKA 3DEUA 3J81K 4PHCA 3OOPA 5GAN4 5GANj 2DQLA 1B1BA 3SWNC 5CVJA 4MMKA 1GXPA 4K88A 1UHWA 1W4MA 3HSBA 2WTEA 3KP5A 4EM2A 4EMKB 3CLOA 1B70B 2D2WA 4C8QE 2ZT6A 1B34B 4I02A 3FMRA 3JCMd 3KP2A 3LA2A 1F4KA 3HFZB 1E2XA 1ZG5A 1IRGA 2AXLA 5LGNA 5E18F 3DPTA 3JCMX 3L1AA 4MTDA 1OYYA 1B6AA 1SD5A 2CW0F 1P4XA 4OU0A 5CYVA 3T0YA 1X2GA 5FLXK 1YLFA 2ZNJA 1G3WA 3ABTA 2DEQA 3JCMe 4C92B 4YP0A 3L09A 5J8FA 3RYRA 1BIAA 3P8VA 4WK8F 1SFUA 2ARSA 3R0JA 1I81A 4GXOA 4XU2A 1TTYA 2W84A 1KMNA 2QHUA 2GQQA 2MBFA 4ZYHA 2ZMEB 1OKRA 4OMZA 3WE3A 1P4WA 5DCMB 2ZIMA 1IF1A 3HIFA 4XBFA 3L9FA 4A0XA 1KYWA 1G51A 2P4WA 4IF4A 3PFIA 4HBLA 4CS3A 1XMAA 3KLOA 3E5XA 3A7RA 1MDMB 1X55A 4CDGA 2FBKA 1E24A 1OYIA 3KP3A 3MEXA 3A5YA 4UNOA 4LK0F 1FYKA 4M9ZA 3WTZA 4BAYA 1QNTA 4R8HA 4KNYA 2DQ3A 2DI3A 2K7LA 2L4AA 4EM0B 2CJBA 2EB7A 3MQ0A 2JN0A 4YIFA 3DSQA 2CGPA 4XU0A 4C8QD 1J0RA 2QWWA 3F21A 1IL2A 1T39A 1YQAA 4FX4A 1K7AA 3IC7A 3QO5A 1USTA 3GLXA 3A31A 3IG2A 4CICA 3K2ZA 3E9HA 1WLEA 4U0WA 2FRHA 4O2DA 2O61A 4HLXA 1KU7A 2ZR2A 2BV6A 1SAXA 5DDGA 2CWEA 2HQRA 2L01A 4HOBA 4M77B 1B7YA 1G3TA 2XV4S 2VE9A 1SESA 1JHHA 3CTAA 2QHVA 3I53A 3ZN1A 5FGMA 3L2CA 4M7AB 2DVEA 4LGWA 3BJOA 4ZH4F 4ENKA 3JAMZ 2DXTA 2NRAC 2RHSB 1W7PB 5F6FA 4NL3A 1YGBA 3RJPA 4RQFA 3VFZA 2VBWA 2H09A 1FYFA 5AONA 4XQ3A 1X54A 5GMKh 4I0BA 3HRSA 5GAOr 2NAZA 2ZXJA 1ON2A 4Q47A 1U8RA 4HW0A 4TVAA 4G6DA 1DPRA 4TV7A 2H94A 3NETA 2HOEA 3LQQA 2DQ0A 4U7BA 1KA8A 5GAMf 2J3LA 1I1SA 4P96A 3ZMZA 4YRPA 3E6DA 4O3MA 1SMTA 4I7HA 2CJ9A 2IVMA 4ZZLA 4YDQA 1U5TB 4KDPA 2IA0A 2C8MA 3ERRA 1UCRA 3CUQB 5EEGA 4L5IA 4F7ZA 2W25A 4N0BA 1G5IA 4C8QA 1HQCA 1QQIA 4EJVA 4H2TA 1E1OA 2J5PA 2FQ3A 2KIFA 2P7VB 3GXOA 2CG4A 3I0TA 5GAMj 2H27A 4LMYA 4EJWA 2QBYB 1TLHB 1S8NA 2ZKZA 1EFWA 5ICFA 1RUOA 5GAN2 1I5LA 3KEOA 1I27A 3Q5FA 3JCMh 2IY5A 4MMLA 4IHTA 3HY0A 4L0ZB 5LEJA 2HYFA 2XGXA 4H2VA 1USYC 3HRMA 4NB5A 1HBXG 4EJTA 4LNSA 2NNNA 2DAOA 4I0AA 2RA2A 2NYXA 3T8RA 2K4JA 4HWOA 3BP8A 4ZTUB 1BC8C 4Q4ZF 4H2SA 4HX4A 2PQ8A 2ZFWA 4AIKA 4M7DF 2OA4A 4KA4A 2DTRA 2JTVA 1AOYA 4F7UG 4ZYDA 2VE8A 4EO4A 4G7HF 4HWPA 1CGPA 1BI2A 4EMGA 3I59B 2HYGD 1U2WA 2YU3A 3K1PA 2G9WA 1D8JA 2DU5A 3HFVA 2HDCA 1B76A 2ZO4A 2EAYA 1H641 2Q5IA 2LNBA 5D6EA 3P8TA 1ZGAA 2KJCA 4M75B 1KU2A 1K79A 4CHUA 3UGQA 1OYWA 2EA2A 2IPQX 2ALYB 2ZXFA 2GWRA 1HSJA 4XTZA 1Y96A 4F7UF 2AS5F 2FU4A 2DW4A 1R1TA 2ZT5A 2TDXA 1L0WA 1YW8A 4DNCA 2IY5B 5LJ3g 5A2QZ 1WNLA 4YG2F 1EVKA 2PFBA 3RIRA 4YFKF 3QPHA 4YRFA 1PYSA 5GAN7 3REXA 1TNTA 1IXSB 1TQPA 3GZ6A 1NJ1A 3ROUA 2HQNA 1I8FA 3E97A 2RGVA 1KQ1A 4CO8A 1MZBA 3TO7A 1X3UA 4ZTZB 2PMEA 1BI0A 1WU7A 4I98B 4H2UA 2HTSA 5HLIA 3WTUC 4LG0B 4CXFA 5GANg 3SXYA 3PGGA 2A3SA 4QWQA 1FYMA 4A5NA 2QHSA 5BQTA 1S29A 1SFEA 2I2LA 3L4GB 4PJOB 3ZMTA 2QUFA 1WSUA 1BIBA 4MHGA 5KK1A 5C52B 3K69A 1O7LA 4HF1A 3A32A 1P2FA 4ENJA 3SZTA 1PDNC 2E1HA 3JB9I 4C8QG 4GCVA 4M7DC 4LFUA 5LJ5f 1FOKA 3MZHA 3TUPA 5DD8A 1HKQA 3AHUA 3V7RA 2P5VA 4PNOA 3FM3A 3M7GA 3J7AO 1FNNA 3I5UA 1LNWA 1PYSB 4EX5A 4YCVA 1F9NA 2CFXA 3ICAA 3TQNA 2BE5F 4M77C 3ECHA 1ZYRF 3A5ZA 4M78G 2G7HA 1GHCA 2XAJA 5DD4A 5JFRA 3C7JA 4RB3C 4G94A 2VT3A 2V79A 2STTA 1QO0D 1R7JA 1O3QA 4EMSA 1JJCA 5HS9A 3LQRA 4M73A 5LJ5j 2M45A 3TOBA 1YFRA 5LBQA 4QVDA 1WI9A 1NHAA 4IXAA 1V4RA 3AAFA 2FNAA 2KRFA 4AIJA 4HF0A 2FA5A 3TO6A 2PMHA 3OV8A 5GAOm 2FXAA 3C3WA 5FLXZ 4NHJA 4HV6A 4D0PA 2Z33A 1M5Q1 3BW1A 3QOPA 2E3CA 1FC3A 2IA2A 4YRLA 3HRIA 4RMFA 2E10A 4M78F 2ZT8A 1R1VA 3DPLC 2ESHA 4M7DE 3LA7A 1DDNA 1TQIA 3VQYA 4OOIA 3KP7A 3WTVC 5TRDA 4X5OA 1EH7A 2XKOA 2FF4A 5FFZA 2OAZA 3RACA 5FB2A 1Z91A 3HXXA 1ZRFA 3CJNA 4JRKA 3DV8A 1U5TC 4UV9A 3W6KB 4OIQF 3NQOA 1FP2A 3F8FA 1ZG1A 1OMIA 1IN6A 4HZFA 3IKLA 2CSOA 1SETA 3TEHA 2QQ9A 2ZNIA 5D5WB 3F8CA 3ZMUA 1XDUA 3REOA 3F8NA 4KN7X 2CO5A 4ZYEA 4F7UE 3GUDA 2EV0A 5LJ5d 2IA1A 3QAHA 1LJ9A 4YRIA 3JCMf 5FD6A 5A2QK 1IN7A 3EETA 2E5AA 3V8KA 2YSRA 4J15A 2AKWA 4IVNA 1ZG3A 1KU3A 1E22A 3GW2A 1R58A 1N9RA 1R23A 2XASA 4XU1A 2QQBA 2FB7A 5K1XA 1QGPA 1ZGJA 1B59A 1USYA 3HOTA 4L9VA 2OBPA 2XROA 2FYKA 3V7SA 3BPXA 4LK1F 4OIPF 4N0AC 2E1CA 3V4GA 4JLIA 2R7DA 5HVQC 2F5DA
chains in the Genus database with same CATH superfamily
2E5QA 1ACMB 3OB9A 4BBRJ 1SANA 3LYIA 2VKVA 3O8VA 3MAJA 1PSFA 1B07A 2EK5A 2LF7A 3MKLA 2ZPEB 3JCMV 2DN0A 2K5FA 4R0KA 3KYDB 1GT0C 3LL7A 4BUGA 2GQVA 1TNSA 2X1DA 4XEOA 4AWXB 2X4JA 4FIBA 3U21A 1NYQA 1H4QA 3TVTA 4LVMA 2B8AA 5A0DA 4NDLA 3S15J 2ZINA 1BR1A 2R3SA 4CZZA 2FG0A 2Q2EA 2R7OA 4II1A 3DFGA 4P3OA 4BDYA 2O5RA 4KICA 5DTDA 1JQQA 1JTYA 2CH0A 2L8DA 2KRHA 2RHYA 3EDPA 3H0DA 1LUJB 1WQ2A 3CDHA 4P3NA 2QXFA 2O6GE 4D7MA 5CVUA 1VQNI 2I4NA 1WJQA 4M7DA 3EHRA 4EDUA 3HSFA 3ZP5A 2F2EA 4HX7A 3H6ZA 2CSIA 5LJ3e 2CRGA 3WTTC 3G4SI 3FRNA 2RB6A 2VQHA 2VJJA 3VB2A 3OYNA 2DTOA 4HYEA 4FX0A 4L5GA 3QO8A 4UP8A 2WY8Q 2W4SA 1RI9A 4A5MA 3M5AA 3HSRA 1QF6A 4LVJA 4YRSA 2OD5A 4S04A 2M30A 5LJ5h 2XF6A 1WJ5A 4IURA 2LR8A 5CVVA 4B48A 3TW6A 1JKRC 5GAN6 3VSKA 4M78D 1WHHA 3C0CA 3LSQA 3N05A 2QKMB 3OYAA 3HB9A 5C4JJ 2LRQA 1VNDA 1O9SA 1JGSA 3MEYA 5HDGA 1KFZA 1GFCA 5IPAA 3RF1A 2MH2A 5IXBA 1SF9A 1XD7A 1LE8B 2VONA 5FU6B 1HW1A 2DFHA 1U0JA 1PC0A 4BEHB 2HZTA 2COZA 2K27A 5GTHC 1ATIA 1KC8R 2VOOA 1I3QJ 3NRVA 1D3BA 4FE7A 1T0FA 2BZXA 3GFJA 2DX1A 4PJOD 1Y0NA 4PFPA 4N0AA 1B7YB 2Y0MA 1FOWA 3QU3A 1PD1A 1X2MA 1FY7A 4YCUA 1LFUP 2IXSA 4M7DG 2RDPA 4XTXA 4GRIA 3QU6A 3H3UA 3LW5E 1AOJA 2EZKA 2I8DA 2KY9A 3C2HA 4PLLA 1JB0E 6PAXA 3RQ4A 4M77G 3IWFA 3MF2A 2QYZA 2PVDB 1TWFJ 4KUDK 1RI0A 2CW7A 1R36A 3SWNA 1NM7A 2M16A 1KGSA 2OZ6A 4WX9A 3JSCA 2LDUA 3M1CA 1ZHIA 1ZH5A 4PFZA 3VQXA 3JCMg 4I2OA 3ER0A 3OQ5A 4EJUA 4PZJA 2DYBA 3AL0B 5LRRA 5EGOA 3CPWS 2LC4A 1ITYA 4A12A 1SVOA 2NS0A 1EOVA 3FJ5A 3FXOA 3H0IA 1D0XA 4ENNA 3O6BB 5BPIA 3CCSA 1D0ZA 2EWNA 3X26B 3P8YA 3GX4X 4E2FB 3LOCA 3ZQCA 3DQVC 2GOXB 4W1UA 3EQLF 3TREA 2RAEA 1RL2A 3HOUJ 3I9V2 5AIQA 1E17A 3F6OA 3HY1A 3QJYA 2YX4A 3CCUI 2F4IA 3G2BA 3OMCA 5KE3A 2YX7A 3RPUA 3RZDJ 2MPXC 2L0KA 1X1DA 1T6SA 2P81A 1NYGA 3QG1A 4C92E 3MEWA 5CKBA 3M4YA 4L5JA 2BYVE 1A5JA 4RMOA 5FROA 1TTHB 3PNYA 5GAN5 1IW7F 3JRFA 4C5HA 2HQ5A 1SHGA 4CH7A 3FM5A 3O8HA 1B8IA 1BM9A 2H3JA 1VQ5I 2ACJA 2FE3A 1ZELA 5CPRB 2O0YA 4M75F 4P74C 1XGMA 2H1LA 2KDOA 2RNGA 1VQPI 4A53A 5IY5H 4AMCA 1M8VA 1QMCA 1OV3A 1EV7A 4JRQA 4YROA 5J3LA 1MH4A 2MABA 1FWZA 3OSFA 5FD5A 2ME0A 4VUBA 2RN8A 4F93B 5B3SH 3FX3A 1XGOA 4CI0C 3BJ6A 2X6YA 4CS4A 3WU1B 3I3LA 3I55I 3BOQA 2GOMA 1YITQ 1NJ8A 1IRFA 2IRFG 1ZA1B 3CCMQ 2OU2A 2JVGA 3JB9D 5CK9A 1HF0A 1SFKA 3JRDA 2F5EA 1D8KA 3L2QA 2JVVA 1K8AR 3HKSA 2GBYA 2WBMA 3VRZA 5EZHA 3L00A 1ZLJA 2ESNA 1MBKA 4BW9A 5JI6A 1YX3A 3VODA 2RQTA 4D5CA 3B6AA 4O6JA 2HDWA 2M1BA 3VS0A 2A68F 2DFEA 2AKWB 1W2BS 3PFSA 2DEUA 4M7AD 2K02A 2MOXA 5J1UA 5E1WA 3HJEA 4B3XA 1VYTA 4FU6A 1EJ9A 2BW3B 1POGA 4HVWA 4NCXA 2IBDA 5GMKe 1NYRA 3BTJA 2F2WA 2HTJA 3PSFA 4MQ9F 4DGWB 1QCNA 3MF1A 2Z99A 4RTZA 2ZC2A 3HG9A 5DCMA 1KONA 1DGRM 4FETA 3GTKJ 2DKGA 2GGRA 3TGNA 1FOYA 3P9IA 2ED0A 3KEYA 3BJUA 4M75E 2EYQA 1T98A 2E41A 2ELHA 2M0MA 2OCEA 5HK0A 2NLUA 5IHKA 2BXYA 3F23A 3EH1A 3M0RA 4LUDA 3KZYA 2V7FA 3PT9A 4KH1B 1H0MA 3R07A 2ZCFB 3H0HA 3R60A 2CREA 4FT4A 5DY9A 1K4TA 3QPSA 2MC3A 3HBLA 3QTCA 4A3GJ 3OS5A 2OTLI 3BR2A 2GFAA 1WXBA 2VJIA 2VKNA 1R0CB 3K6GA 1X2QA 2Q2EB 3K1MA 5ELOA 3FXJA 3ZMDA 1OR7C 2VLAA 1GBQA 4L9NA 3BY6A 3RYPA 1XN7A 3OSVA 3MVPA 4BHCA 5KAIC 1QVUA 2EGCA 3SFZA 2DPUA 1W7PA 3NAUA 3SZPA 2AXTC 2HGCA 2JA2A 3JSOA 2ROTA 1R22A 4BXFA 5GAOl 4S05A 4M7DB 3SEQA 3M59A 1MNMC 2E64A 2RC4A 2LKSA 1M3AA 4UB8C 3IKVA 2QQSA 4J7FA 4C92G 2KJBA 3C18A 4XLFA 4JBAA 3A4CA 1GCQC 2VGNA 1N8RR 2PEXA 2E60A 1E1TA 3ZOBA 4GLKA 5D5VB 1KQSS 2NUZA 2LF8A 2D9TA 2VQLA 1K73U 3VYRB 2PNIA 1UG0A 1ZRDA 2ZZGA 4M6YA 3M4PA 3KFVA 3PL8A 4DBHA 3BPVA 2YU9J 1B9MA 2H6BA 1B8AA 4QQDA 1R71A 4IRHA 3GVAA 4G8XA 2ECBA 1YITT 3KZIC 4A6DA 4ESRA 2DA5A 3R61A 2M51A 2BEOA 4DBFA 1Q81U 3CCMT 2A61A 5D5UB 2MG4A 4TTVA 3WGGA 4OAZA 1ZX6A 1LFPA 2KRNA 4M75A 2HKOA 3LSGA 3TSZA 3G6EI 3CCQA 1VQ7Q 1ZBXA 4OIOF 4AFQC 1QVTA 1BC7C 2IG0A 1QWEA 3QIIA 2RQPA 3J80Z 2NUTA 3A02A 1RLPC 2KISA 1XGSA 3VYGA 4EPCA 1D3BB 2XMFA 1RC9A 1M1EB 5LJ3h 2OUMA 2VKDA 1IAWA 3A0BC 2ZAEA 4XN0A 4PLIA 1EFNA 2M4GA 4RGXA 4ELZC 3C2BA 2DD5A 3HOSA 3MP1A 3W6VA 4ZGEB 1UHMA 2RHUA 4LG0A 1J75A 2ZNYA 2CZ6B 2HQEA 5ICGA 3K0LA 4K86A 1ZHFA 2SEMA 3INZA 3CC4A 2Y4YA 3VS1A 3I56A 3CDLA 2Y90A 2E4HA 3QP6A 1L0OC 2HOTA 3GTPJ 4XTUA 4KR2A 2EJRA 4IOCF 5I21A 4L5EA 1U3EM 3CCSQ 2LYCA 3CCEA 2EILH 3DU6A 5E1XA 3M4OJ 4OB1B 3WU0A 3HYIA 4HSRA 5A0GA 1S72I 4ETSA 2RHQA 4P71C 3K9TA 2LY9A 1O57A 2ECZA 1Z6TA 5GAGJ 2SRCA 2EFOA 5D5XB 3JAMK 3OMYA 3A8OB 1LOJA 2PLYA 4B6MA 2FVUA 5EGOB 1RIOH 1T0JA 1X2HA 1FTZA 5CKFA 3F72A 1KC8C 4PFOA 2D8HA 2DMTA 3FMSA 2V1DA 1BCMA 2L7KA 4LLLA 5E79C 3I7FA 2NUPB 2X51A 1FYLA 1EQRA 1SD4A 3WTSC 1X1BA 4MQVA 3J81Z 1Z7NA 4CYCA 1ZRCA 3ELKA 4NQWA 3BR3A 3A8HB 1RACB 2K6DA 2H1KA 1TWBA 1DUXC 2A6HF 4UB6C 5FU6C 4A3FJ 2DETA 4IRIA 4TQDA 2Y2ZA 2HXOA 1CQTA 4RDUA 2LQWA 2P6SA 1KG1A 1D0YA 1SRYA 5KNNA 1VQ8A 3BTIA 4KULA 1WJRA 2MLKA 3MWMA 2VYTA 2UXNA 2E36A 1QCFA 4C5IA 2K9GA 3H3ZA 4A3EJ 5F08A 2HNIA 2IT0A 4P72A 1QPMA 2RVCA 1W36C 5HODA 4JZ4A 4E4HA 1K6YA 1B8IB 1NLPC 5IYBJ 1U78A 3MZYA 1UGSB 1OOTA 5FKKA 4B9WA 1YIJI 3UKGA 2X85A 3H41A 4LUEA 3KPHA 1BBUA 4Y33A 1U6GA 4PJLA 2RI5A 5E20A 3G1ZA 1TUCA 1YNZA 2V6CA 1J5WA 4XLPF 1Q82R 2HWVA 5D6YA 2A6EF 3HXYA 2CFOA 5CO7A 4RGRA 3JCMJ 1VQ7T 2ZT7A 1LNXA 2M02A 4WF2A 2QTXA 4BD3A 2EL9A 4RDXA 2K3FA 3BROA 2DJIA 4F14A 3IWZA 4H4KC 5LRSA 5J40A 3AL0C 1ETVA 2D0QB 3BDLA 1XCVA 1OFCX 1DPUA 4M6XA 3ZGKA 2CYYA 2ZZEA 5GANf 1HXDA 4Y15A 1J2XA 1YTYA 1UMQA 2H8RA 1UE9A 1OX9A 2ZCEA 3ABKH 2QZ8A 3KP6A 3WG7H 2VUMJ 1IV6A 4PHCA 3E9GA 1B1BA 4E7KA 5CVJA 4K88A 4EMKB 3TMOA 3EFOA 3DCFA 2ZT6A 3LA2A 1IRGA 3CCST 5LGNA 5E3LA 2QA4A 3L1AA 4ZGJB 3T0YA 2AQEA 1YLFA 3UR3C 4C3IJ 2EPFA 4C92B 3L2VA 2WACA 1M30A 3A1YA 3P8VA 2V1RA 2I0NA 4XNFA 1ZGWA 2ARSA 2L9RA 2W84A 2MBFA 3OL3A 2XDBA 4OMZA 5DCMB 3NTKA 4XICA 2JJ9A 1G51A 2P4WA 2MK5A 4IF4A 2WB1A 1DGWY 4Z89A 4BXXJ 2FBKA 2O88A 1FYKA 4QVZA 2ID6A 4KNYA 2DI3A 2V26A 2L4AA 2CJBA 4A3CJ 2EB7A 2JN0A 4IL6C 4N4HA 4C8QD 5ECAA 2HNHA 5IN1A 2XF5A 4MFEA 4RG8A 5L23A 2XPUA 4F16A 3IG2A 2BKDN 5EF6A 1W4SA 4O2DA 2EKHA 4HLXA 1K8AC 4PKCC 3CCLA 5LD2C 3LSPA 4BI3A 2ENMA 2FZKB 2CWEA 1UHFA 3LH0A 1ZUYA 2L01A 2FPEA 3HM5A 2OJ2A 1AU7A 2DM1A 1QVGP 3OYJA 1G2HA 1TZLA 3F0CA 1JHHA 3I53A 3EG1A 3BJOA 1A0NB 3Q0VA 3JAMZ 1VQKI 1W7PB 3HGGA 1SAUA 1QHHD 4RQFA 1YJ9I 4J9DA 1M8MA 4XQ3A 4EIKA 3R6OA 5GMKh 2NAZA 1N6AA 1ON2A 1MMNA 1DPRA 2H94A 2RHZA 3OW2S 2K85A 3NETA 2QAZA 3LQQA 2DQ0A 1JJ2P 1KA8A 5GAMf 3E6DA 4I7HA 2CJ9A 3GOXA 4KDPA 3OA6A 2IA0A 2RREA 3ERRA 2K2MA 2W25A 1QQIA 4EJVA 2CP2A 2EZIA 3HXLA 2FQ3A 3GXOA 2CG4A 3LSJA 1AHJB 4EJWA 3BG7A 5ICFA 5GAN2 3JCMh 2JMAA 3CCQQ 1Q95G 4L0ZB 5IAYA 3OYIA 2RJFA 3DPUA 4QPQA 1HBXG 2LY2A 5IHNA 2RA2A 3DBRB 2PJRA 2KRSA 2OA4A 4F7UG 4ZYDA 4G7HF 2YU3A 4XM3A 2G9WA 1GLNA 1D8JA 2DU5A 2D1XA 3H9QA 1H641 2Q5IA 3P8TA 4BE1A 3HL2A 4X6AJ 3UWNA 1VQMI 1KU2A 4M75B 1C0MA 3UGQA 2ZXFA 3M57A 3CC4Q 4XTZA 1OPKA 3OMGA 3I56Q 2ZT5A 2TDXA 3OS0A 2NUTB 3D1NI 5FLXE 2IY5B 2XF7A 2ESWA 3RIRA 5EYRA 4YFKF 1M4ZA 1YRNB 2OAWA 3CCEQ 1OZ3A 1P7JA 4D6WA 2ZMEC 1I8FA 4XL9A 2ZPHB 3VKIA 4CO8A 1MZBA 4BE2A 1N8RC 3PFYA 3RCOA 5HLIA 2FO0A 1PYVA 4LG0B 3OYBA 2X1CA 5JLWA 4QWQA 1FJLA 4Z8AA 2QHSA 4CCOA 2QEXA 2BZYA 2VJ5A 4Y3OA 3H9JA 2M0YA 2ELKA 1WSUA 1XQHA 3H5AA 5KK1A 1YHQA 2CUJA 2O9SA 3SZTA 2EIKH 4M7DC 2JNGA 2Y9ZA 1FOKA 2OTJI 3MZHA 2GTOA 1F36A 5DD8A 3V7RA 2P5VA 1XNIA 4M3FA 1FNNA 3I5UA 1LNWA 3L2RA 3TQNA 4M77C 5J3BA 2BZTA 3S1RJ 4A3JJ 2G7HA 4B3AA 5JFRA 2STTA 4EMSA 1JJCA 3C2GA 1SPKA 4XMYA 4B43A 3WHCA 2M34A 4HNVA 3PJRA 1N27A 1SVMA 1WVRA 1NHAA 4IXAA 2DFUA 3OV8A 5GAOm 2XGDA 3GP8A 1D09B 2RQVA 1M5Q1 4FQGA 2E3CA 1X6GA 2LMDA 3J7ZI 2E10A 1X6OA 4M78F 2F4MB 4LDVA 1VQ8Q 3WTVC 4X5OA 1ACIA 5FFZA 2OAZA 3HXXA 4JRKA 4CYCB 1U5TC 4OIQF 1K1ZA 3VS7A 4NQWB 1OMIA 1IN6A 2ZNIA 3F8CA 1PCXA 2JUFA 4KN7X 2L3RA 2EV0A 2ZPIB 1VQ9I 2CW8A 4E7HA 1UJ0A 1NE8A 2COBA 2ZSHB 1XX5A 3ZXSA 1R58A 2Y9YA 1T0FC 2FL7A 2XASA 4BQNA 2QQBA 2FB7A 1VYVA 3OBYA 4L9VA 1H8AC 2E71A 1IGUA 2X1EA 4OMLA 4N0AC 2K9SA 4JLIA 2JM9A 2F5DA 3I54A 3CCQT 2W82A 4FE4A 3S93A 2F4OB 4BQQA 3VOEA 2CYZB 3EG2A 3T5XA 4JJNK 2JTMA 4ZNXA 4LB6B 3Q9SA 2XD0A 1W5SA 4BB7A 2F69A 5F27A 4A4EA 3RTRA 1SRLA 3V8LA 2LP0A 3KEQA 4PG3A 3KFUA 4J9EA 4J6WA 5KYNA 3HTUA 2YRCA 4D1QA 2Y30A 4OMYA 2R7WA 1T3LA 2O3FA 3VSLA 1W7PD 1WJAA 3CC4T 3BY7A 2EYXA 3F22A 2V8JA 3Q9VA 3I56T 5BOXA 1HC7A 1Z7LA 1BJZA 1LB2A 3S2WA 2EVRA 2O4XA 5KCHA 1XG1A 2HQHA 5GAEJ 2LTOA 5ILSA 3X20B 1U1SA 3BR0A 4BJTA 2QA4Q 4HX8A 2DK3A 5CIUA 1U8BA 3CCET 2PJPA 2JT1A 4M78E 2EGEA 3HGYA 4XRFA 1JUPA 4RGSA 5F0HA 2RQRA 1QLYA 1IN5A 1AA7A 3ERMA 1X19A 1WQWA 1G8XA 1X56A 1LEAA 2A36A 1W6XA 1IO6A 4J19A 2PTKA 1ZA2B 2GFUA 3JCMW 1M2VA 2OI3A 2L7ZA 2MH9A 4HWSA 1XTDA 1VFCA 2RN7A 1ON1A 2JPBA 4MZTA 1R5HA 2BGCA 1ARKA 4MEYF 4TWAA 3X25B 2DERA 1ETOA 1D1CA 5K5OA 3VQVA 4X1VA 1OCOH 3JB9H 3E9IA 1Z05A 4J6XA 4YCWA 1IZ1A 2Z9OA 4FASD 1WJCA 3THKA 2DOEA 3S1NJ 1FTTA 1Z7MA 1Q82C 2CU7A 2ZTGA 3T1BA 1I1JA 4M75D 3HZJA 2Q1ZB 1VQ9A 4RB1A 1R5ID 3CCLQ 2V1QA 2AHJB 5GTIC 1UFMA 1ZREA 3FB9A 5LHIA 3RKWA 1U5SA 2DVJA 1RR8C 1HJDA 2W00A 1VQ8T 5K5RA 3PIPF 1A6QA 4H0EA 2LD5A 1K78A 5KAFC 3FIFA 2LCCA 1YB3A 2K3PA 1BW5A 2ICWG 3I58A 2NVXJ 2DFIA 1UHCA 2OAUA 5FRMA 2DMNA 2W85A 2YUSA 1BL0A 2CS7A 4ME7A 4S0HB 2COYA 1MH3A 4YFNF 2XHKA 3CC7A 5D4RA 2QG9B 2QF7A 2ZZFA 5HCKA 1LDKB 4ZYGA 3PCOA 3K4LA 1B9NA 4D7NA 4XK4A 4Y28E 3CCVI 1QW1A 2VC0A 5HNFA 2JTEA 2VC1A 2B0LA 2A8EA 3VYTB 3QYBA 5IOZA 4I6ZA 4HDUA 4DYQA 4AH6A 4JDSA 1K73R 4JYKA 4M78A 4K87A 1S6LA 2CH4W 3U1KA 1Y39A 4B8XA 4G84A 2O31A 3PNWC 4KIGA 3HOYJ 5CAIA 1TL8A 4EMKC 1LDDA 4KUMA 2VXDA 3UA7A 4CCMA 3HFNA 5E3MA 4AYBA 5GAHJ 1Q81R 2D0NA 8AT1B 2MF2A 4AC0A 3RKQA 2DXBA 3PMTA 5ERIA 1MNEA 2F5FA 2X0LA 4C2MJ 4JQFA 4M7AF 1WRJA 4PGGA 4RB2C 2ED1A 4C92C 1X4PA 5HKCA 5GAN8 3L1PA 2RK1A 2DO3A 3MJXA 1PNJA 4GYGA 1J7KA 4YRTA 3K1NA 1VIEA 2MI6A 3CZ6A 3QP5A 4AU7A 3K10A 3RUXA 2E19A 3VUBA 3QNEA 5D8LB 4YRQA 2PJRB 2QA4T 1YS6A 2BUDA 2Z5UA 2Z3YA 4IUUA 4FSSA 2EYYA 4U7DA 3C94A 1VQOI 2EJ9A 2P0WA 3OOUA 3KYCB 1ENHA 1Z1DA 1X1AA 3BLYA 2JA6J 1SD6A 1RR7A 2J3MA 4B1RA 2QEXQ 4PSXA 2F48A 2BOLA 1Q1VA 1Z9CA 4OMMA 1WI3A 1YHQQ 2DE0X 2CQKA 2JTFA 2V1XA 5M5YJ 3CXCA 2Y75A 2M9HA 4KGXB 1DU0A 3ZL7C 1WZ2A 3OS1A 4H2XA 1O7FA 2OPTA 4A93J 2HFHA 3EG3A 4JP0A 4V2SA 1X27A 4F92B 1HCRA 5HLTA 2IGKA 4RAZA 3IKTA 2KKOA 2B7EA 2A07F 5EJCA 2M0OA 1SFOJ 1JXMA 2KYBA 1IXCA 1ZSZA 3CCLT 3VS2A 1TG0A 3BG9A 4BHBA 5KYWB 1R6RA 2YLBA 3QYFA 1YCYA 4LDXA 3E3VA 1ZR4A 3D7SB 2R92J 1HC8A 5FKLA 1HDDC 1CKAA 1QZZA 4IHYA 4HCCA 3IP4B 1MBEA 2XVCA 3DBHB 4PJOG 4O5VA 2WSEE 2BY3A 1SKUB 1JJCB 3ZBDA 5L3EA 2CUBA 4M7AE 1WJBA 2H8HA 2E6NA 2P0KA 1VQ6A 3OYFA 2DD4A 2EIMH 3EUAA 1GRIA 2HKQB 1DQUA 3MCAB 3RDVA 1NBEB 4XK8E 1J3TA 4G9YA 2VODA 4RKUE 3LFKA 1QVFP 1UECA 5CQEA 2RF0A 1VQZA 5LGUA 1XOVA 2VXEA 1XC5A 2EH3A 2PMUA 4BHPA 1RZ4A 1BJAA 1JRIA 3HSEA 3TOAA 3PIPA 2E7XA 3HFZA 3CMYA 4LITA 1MUZA 2DTZA 1BR2A 2DF6A 3CO6C 4A0YA 3CCJI 2VXFA 2A0FB 3K70D 4RTVA 4LLNA 2IGMA 4F17A 3QYHB 2K2VA 3CEYA 3LSRA 2MC4A 4E7JA 1WCMJ 5F1RA 1N75A 2KRMA 4OB0B 4C0DC 1D5YA 1TXQA 3FZVA 1T0HA 3VRYA 1GVJA 1S3JA 3E6MA 2DBKA 1KQ9A 2L54A 3ISPA 3S1QJ 3UNGC 2V8KA 3HOZJ 3EGDA 2FBIA 4UVBA 2V4JC 3M3YJ 4J83A 2BBYA 3JCMP 2YRDA 2DRMA 3UF4A 1USSA 2L2OA 1VQ4Q 2QYOA 2R7RA 3PVQA 1S5LC 4U88A 2YUNA 2NYSA 3QJ6A 1E3HA 2Q5HA 2M7BA 2DT7B 1KQ8A 2QEXT 2W24A 5HGQA 4LJZF 2XC7A 3X24B 5K1YA 4LD6A 3G71A 1SERA 1AT1B 1YHQT 3BWGA 2VT2A 2CQXA 3BJAA 2CUDA 4CC4B 2CJJA 4U0YA 1HW5A 5ILVA 2WV0A 4XKCA 4M7AA 3CCRA 4OMOA 2VJ4A 2LLKA 3BG5A 2ODRD 2HBPA 3GZ5A 5H20A 1YE9A 3FJPA 1Q1HA 5KVRA 2RPNA 2YR2A 5GANe 1E3PA 4E7LA 4PCQA 5KYUB 1IXRC 3SEMA 4DIQA 4ESFA 2LNHB 2P5LC 5CLSA 1NPRA 1N78A 1ZQ3P 2NVUB 3A8LB 3I4PA 2EFWA 1P6RA 3IRQA 1FLIA 4IKFA 4ESJA 4AYBN 2DDBA 1Y0UA 4R1HA 3ASOH 3CUQA 4MZPA 3PM1A 1G6NA 4Q48A 1T38A 1MBGA 1NJ5A 5M3FJ 3K7AJ 4BQAA 3QBYA 5IT9Z 2DPPB 1RPWA 2GCXA 4G6QA 2QBYA 3KP4A 4KGVB 5FFXA 2FQ4A 1T2KA 5CKTA 4ZDLA 3RKXA 3ZCOA 4A69C 2QSGX 4OAYA 1A04A 3CPFA 1JUSA 2KI7A 3JB9G 2P7CB 1LQ1A 3F9KA 3CC7Q 4XSZF 1G59A 4P72C 2OQRA 2PMZN 1LDJA 2ZXWH 4RM2A 1QVPA 1QP2A 2VC8A 2JM8A 2F5TX 3PZCA 1K78B 5HDNA 2HOAA 5F04A 1G2BA 2EFQA 2MMPA 2WV1A 2VUBA 4QSHA 4BGDA 2JS0A 1RKTA 1XJWB 4JX5A 4Y91A 3QSUA 3FXUA 3IH3A 1WH7A 1J59A 2ZSIB 5E8GA 2VOPA 5GP9A 4M7AG 1Y1WJ 3UFGA 1SVLA 3A1PA 3SDBA 1X6BA 2XGCA 3E6BA 2KIQA 2V6EA 1ERDA 4KGZB 1P9QC 4AVPA 3PCOB 5IP6A 2XUBA 2B9SA 1XSDA 2NS7A 4XU3A 2XSDC 2VKEA 3E5UA 1NJIU 2PG4A 4LLGF 3CBOA 3REBB 3CUOA 4GGGA 3A8MB 2DJZA 5DYMA 1GL5A 1J9IA 1VQLI 4M78B 3GTOJ 4YRMA 1YI2A 1F5TA 4Z2YA 5KCOA 2K9MA 3NARA 1TWCJ 3CQTA 1PD0A 5EEHA 3CMAA 3H3VK 5LHGA 5I2MA 1VQ4T 4HSTA 3WXMB 3ZPLA 4CA0A 4UP7A 5GAMe 4IHSA 3LMMA 3M9AA 4UXNA 4R79A 4OINF 4JLGA 1KMMA 2X4HA 3MP6A 3CD6A 5E1ZB 3LSSA 3SB2A 4FYYB 3IKMB 2LZ6B 2VB6A 5EDNA 2ADUA 1X3WB 3M07A 4I01A 1G3YA 1YJWA 2CP0A 4X1EA 3MCZA 2ZR3A 2TRTA 3J7YJ 1HA8A 3C12A 3KETA 5IP7J 2X4WA 2YLCA 2IIMA 3HOXJ 3SQNA 1O75A 1ABQA 4Y17A 2KQWA 3PQKA 4IHVA 4F04B 1MNDA 4BJ5C 1DP3A 3ML6A 5TJJA 4KQEA 4X9CA 3L2ZA 4C8QF 3N97A 1YO5C 1K73C 3LAPA 4YELA 2DDAA 5CVRA 2ARTA 2DLLA 1MV0B 3JB9J 3MN2A 3N4MA 2XPVA 4E70A 1YJNA 4BI8B 4YYEA 3RSNA 3H0FA 3CC2I 2MIOA 4MZMA 4MGRA 1VYUA 4H2XB 1I6XA 1V3FA 4A3IJ 1UB9A 4P73C 2L2PA 1Q81C 1TWHJ 3ASKA 1K6OA 3FKIJ 2HOSA 4GBQA 2UWMA 1C6VX 2LJ0A 4H2WA 3MKZA 3CC7T 1ZSZB 1FMKA 2AQFA 3EUHC 3MMYB 1J5YA 1VQ6Q 4UHTA 1TWGJ 2DJQA 4R55A 5IYDJ 2X3XD 3Q1JA 3JCMb 2OZUA 1OCPA 4N4OB 3MEVA 2COMA 3REUA 2V9KA 1XB4A 3F6VA 1IDZA 2DL5A 5FKOA 2JRMA 3RBBB 2HEOA 4G7OF 1UUEA 5GMKl 4UV8A 1N77A 4FISA 2KK4A 2QK0A 3LC0A 4MLOA 1B70A 2JSCA 2F5VA 3EH2A 3CMEA 2RI2A 1LVAA 1WI7A 4I76A 1SMYF 1PWTA 1XMKA 1R0BG 2H8WA 4EQQA 2JRTA 3A98A 2VN2A 1APLC 1H4VB 1WHUA 3A7AA 1TS9A 1AWWA 1ODDA 1EA3A 2O7OA 4A3BJ 2DRKA 4B44A 4DBRA 2RJCA 2XB0X 2R4GA 3H9GA 3EG9B 1V29B 1GXPA 2DIGA 2WTEA 2ZPFB 2JK3A 3CLOA 4C8QE 2KR3A 3DBLB 4L6V5 2GIZA 4C0FA 2EW3A 3HFZB 3A01A 2CP5A 4M3BA 1A36A 1UFFA 2FHDA 5IT9E 9ATCB 4MTDA 1B6AA 1P4XA 2PQWA 4OU0A 1MSEC 1G3WA 1JI8A 4YP0A 4IQ4A 5J8FA 3RYRA 1BIAA 1WGSA 3R0JA 4GXOA 3J7AF 3PIOF 3EPZA 4OGCA 4DEXA 4G6TB 1OKRA 1LCKA 4RLFA 2X6WA 1IF1A 3G71Q 3SZGA 3HPGA 3HIFA 4XBFA 4XN3A 1VF9A 2EQMA 2LT1A 3EGDB 3KLOA 4A63B 1X55A 2HL5C 1E24A 3A5YA 4UNOA 3DKYA 3NMZC 4M9ZA 3WTZA 1QNTA 2DQ3A 4XORA 3CCRQ 3AG2H 3MQ0A 1JUMA 3DSQA 1J0RA 3IQLA 3F21A 1YQAA 4FX4A 3QO5A 3ZR8X 2RNAA 2X6OA 3E9HA 1WLEA 4AIDA 4U0WA 3I5RA 2ATCB 3CCYA 2HQRA 1JJ8C 4CCLA 1AD5A 2OV7A 1KHIA 3OSSC 2W48A 1PG5B 2XV4S 4KISA 1WHLA 1QKXA 2VE9A 4CCKA 1A35A 2LOOA 1SESA 2QHVA 4M7AB 1TP4A 3N5BB 1Y57A 2CDTA 4LGWA 2E34A 4BL0B 4ABZA 4NL3A 1YGBA 3OYLA 3VFZA 3BZKA 2DT6A 3V42A 2J05A 1X54A 3HRSA 5GAOr 4UUSA 2ZXJA 1Y1VJ 1U8RA 3KXTA 4TV7A 1OCZH 2HVRA 2A7YA 1TU0B 2EZLA 4P96A 3FDYA 1VQ6T 2YS9A 4O3MA 4LG3A 2IVMA 2ZJQF 4V19K 5HNHA 4OMQA 2C8MA 1OU9A 3CUQB 5EEGA 4L5IA 4N0BA 2KNBB 2W7NA 4C8QA 1HQCA 3H36A 2RMOA 2EQUA 5F1JA 1A31A 2KIFA 2P7VB 3I0TA 1W0UA 4LMYA 2QBYB 1EFWA 1RUOA 4Y7NJ 3Q5FA 3HP9A 4J8OA 1MW7A 5FW9A 4H2VA 4M3EA 3M56A 3SDZA 3AG3H 5IH2A 2DAOA 2RQWA 3T8RA 4HWOA 2LTPA 5FKNA 1RLQC 1HDPA 4HX4A 1TUGB 2ZFWA 2DTRA 2JTVA 4EO4A 1CGPA 3RMSA 2K9QA 3ASNH 3K1PA 4NNJA 3CPWP 3HL8A 3GNFB 1B76A 2LNBA 5D6EA 1K79A 3OYGA 2UV1A 1VQNA 4J9IA 1Y96A 2XICA 2DW4A 1FYNA 3FEOA 1AWJA 2HSPA 4DNCA 5A2QZ 1WNLA 3BR1A 1YI2Q 2PFBA 3G4SA 4YRFA 3CMAQ 4AG2C 1H89C 3DU5A 2XAUA 1TQPA 3QWYA 3GZ6A 3M0QA 4LDUA 3FXKA 4PK4A 2RGVA 1KQ1A 3M58A 3TO7A 3BQYA 1WZOA 4I98B 3X2QH 5J4YA 1EF4A 3CJQB 3CD6Q 2KRCA 3G1JA 2ELJA 4OB2B 5FWBA 1S29A 1SFEA 1SC7A 2KAFA 2QUFA 4BDZA 3S8PA 3TL4X 3G71T 2F5KA 3L42A 1O7LA 4HF1A 3A32A 1P2FA 1M2OA 4AG1C 3JB9I 3K4BA 4C8QG 4GCVA 3CQZJ 1YJWQ 1UDLA 2HDAA 3TUPA 1HKQA 3AHUA 2DYIA 2R5AA 3CCRT 3M7GA 3J7AO 1PYSB 1SRMA 4YCVA 2CFXA 3ICAA 1ETXA 3CJRB 5DD4A 5D6WA 1R7JA 5LJ5j 4KRTA 2MWPA 2QSHX 4M4ZA 1WI9A 1V5GA 1X4OA 3E7LA 4BY6B 1MBFA 2FNAA 4AIJA 3OBWA 2FA5A 3C3WA 5IYCJ 3HKZA 4D0PA 2Z33A 3GTMJ 2DJNA 1ETYA 4LOCA 1YJNQ 2ZT8A 3OIQA 1R1VA 4RLQA 3PIOA 1DDNA 1TQIA 1ZLMA 2K3XA 3VQYA 3RACA 1Z91A 3OY9A 4V2FA 2DA1A 3QQAA 3DV8A 4UV9A 3W6KB 1UB4A 3X28B 4KJZA 4MDWA 1H88C 3GUDA 3QAHA 2EINH 4YRIA 3JCMf 5FD6A 2YSRA 1M27C 2FRWA 4J15A 2NOJB 1YOVB 3GW2A 5LFAA 2EQKA 3KYLA 5H2FC 1QGPA 1NEBA 1MMDA 3DEWA 1USYA 2OBPA 3HHTB 4OIPF 2R7DA 3GTQJ 2QGGA 2EV6A 5L8RE 2DMPA 2LCLA 2DA9A 1TOVA 2LDMA 4P75C 3CMEQ 2PMFA 1W2BP 1VTNC 4NC6A 1ZSGA 2E1MC 3OWTA 2E5NA 2XB5A 3CF5F 4X34A 4P9FA 4M78C 3P9CA 4HAMA 1MJBA 2IJLA 3OR1C 3P5JA 5HK3A 4E51A 2DXUA 1RNLA 4A4FA 2GA1A 4FT2A 4WXCA 3HXWA 3TEDA 3UH0A 1AWCA 5C51B 1RADB 3CCUA 2L7FP 1JO8A 3OIOA 3S17J 2D6FA 2WADA 4P71A 1YI2T 5J8CA 4JJBA 4RGUA 2Q7EA 2HKXA 2PVGB 2M1HA 4XONA 5GAOn 3CMAT 3EGUA 3M8FA 2QCOA 4PJOC 5BS6A 2L5QA 1UGRB 4B09A 1TW3A 5FKMA 2ECCA 1WXTA 4YIRX 3QYEA 2HS5A 2Z16A 3BZCA 2AZVA 2DTIA 3OYEA 3VS5A 3D5RC 1ZUUA 3TCJA 4A4GA 3AFHA 3CD6T 3QPTA 3F8MA 4C9YA 1EH8A 1VQ5A 1TT5B 2RHIA 5JLXA 5KHDA 2RV8A 5ICCA 1WFXA 2KP6A 2R7FA 4IRGA 5EZGA 3OS2A 3H5RA 2XK0A 1YJWT 3A01B 1VQPA 3BZ6A 4C3HJ 1KQ2A 2R7UA 2E12A 1TH7A 1HK9A 2MD0A 4RB0A 4EV0A 1D1AA 4QTRA 3TKYA 2A6TA 4F91B 1Y8RB 1NZ9A 2W1OA 2V8IA 3GF5A 2FD5A 2J6KA 1R5GA 4DZPA 1OJLA 3IUOA 4N4GA 3RGLA 2DILA 5DV5A 2RQUA 1T33A 5GAN3 3I55A 1O4XA 4WXDA 1H9GA 3GWZA 4RTXA 3M4GA 2DK5A 1YJNT 1KQSP 1U06A 2VBYA 1UTIA 5DS9A 1V54H 2D1VA 3TO9A 1ZSZC 5DUKA 2BHYA 1P4AA 3D0SA 2FRYA 1NG2A 4WTOB 3FIWA 4NC8A 2E1OA 3GIBA 1HKTA 2RO0A 4EGZA 5D7UA 1ORKA 2A5YB 3VYUB 1FBQA 1YWPA 4M74A 4WCGA 4EEFG 4YRGA 3WTXC 2XDVA 3C1DA 4B9XA 4X9DA 3FISA 4XKWA 1OYXA 1K9AA 3M4QA 2L89A 4PGHA 3UATA 2ZPBB 3R4KA 4YEJA 1ETQA 1VOMA 3R6NA 9ANTA 2K86A 2G0EA 2EQIA 1KU9A 1BBWA 1EVLA 3LA3A 3NWTA 3CO7C 1R4NB 2A37A 1QVGA 2XIGA 3H1CA 2CQ7A 2Q7HA 1XS9A 4BU2A 5GMKm 4UUSB 1B4AA 3CMET 3VS4A 3HUGA 2HI3A 3WHBA 1T95A 4FCYA 5B1AH 1Q86U 4ZC3A 1RKWA 1YITI 1OU8A 2CUFA 1O3SA 2CIMA 4ZIBA 2XAQA 3CCMI 2AMCA 4E6RA 2J6FA 3GBGA 4KITB 1NPPA 1JJ2A 4M77F 1ETWA 1GV2A 2EBIA 1WQ7A 4C8QB 3U1DA 1NTCA 3LGFA 3Q3SA 1R8OB 4M71A 4L0YB 3ZQIA 3HC7A 4AIHA 1Z9QA 2OTLA 1VQNQ 4HG2A 2EQRA 3HKZN 3L7WA 2X35A 5I22A 2QGUA 2QENA 3CXCS 4K11A 2L02A 2P5KA 3G73A 2XIDA 2DA4A 3FK7A 3S32A 4F55A 2IVWA 3G4SQ 4J9CA 2LJ3A 1JHFA 3GF2A 5HLHA 1FSEA 1REPC 2R7XA 3SWNB 3W3CA 5H6QA 1EX4A 1ONVA 4E7ZA 3M0TA 1LEBA 3S14J 3S3MA 1K9MU 4MFDA 1U9NA 5GJWB 4XIDA 3QHSA 1NJIR 2K5CA 5KCMA 4BXUA 2LQNA 2LCSA 1UEBA 3RQIA 1Y96B 3NENA 3U9GA 3GPLA 3WTWC 1E6HA 4ORZA 3TP0A 2R93J 5GAOq 1XSXA 3LSKA 4GO1A 3MFKA 4HVCA 5LLQA 3TEGA 4P3PA 1WWXA 2OJED 3DWLE 4CS2A 3EFRA 2CZ0B 4M75G 5TISC 1GUUA 4ENMA 4CYDA 4JPBW 2DDZA 1V1CA 2DXIA 4M7AC 3LWHA 1I6HJ 2CUEA 1MD0A 2YHTA 1SG5A 4AUXA 2K79A 4A6EA 2Y48A 2BE7D 1JU5C 4LIVA 2KL4A 2PX9A 2BY1A 3OD1A 4ZN1A 2J5OA 2KBTA 2L3PA 2AK5A 2KEAA 4A4HA 4IIMA 2E7WA 2Y31A 1SEUA 2EFNA 3TDZC 2QKLB 3PUBA 2I4MA 5L3FA 3IAS2 4HQEA 4J9HA 1Z7UA 3CUQC 4M77E 1K4US 2WY7Q 3G1OA 1YW7A 2E2IJ 1GCPA 3G6EA 2XGEA 1G83A 2ARUA 1I5OB 3HXZA 2E2JJ 1D1BA 1C0WA 2GF7A 2UXXA 4XOTA 2Q0OA 1JBMA 1KD1U 2JS2A 2H3EB 3MEAA 4Q6GA 3IRRA 1HYOA 1PHTA 4ZGDB 1QZYA 1LYLA 1O3TA 4WJ4A 5D8KB 3K4NA 3O8GA 1ZAOA 4KFCA 3BE3A 2CSQA 1OCTC 1B34A 2QLZA 3HHGA 3E5QA 1I39A 1QA6A 2JW4A 4KR3A 5IHIA 4E6KG 5LJ3j 1GVDA 5JR3A 4KYWA 3HRUA 3URGA 3R6SA 3PQJA 2JSPA 1U9OA 1OQYA 3QOEA 1S72A 4BKXA 1FPQA 1MJ9A 2WSCE 4C5GA 1OLTA 2W0ZA 1X3ZB 1PP7U 2DIQA 4PUSA 1VIFA 3CCUQ 5C53B 2EYWA 5HY6A 1VQ7I 4XTYA 1VQNT 2LMJA 1ZARA 2ZMEA 2BZ8A 2XAFA 1Y07A 1STZA 4XLCA 3NEUA 3IL2A 4G85A 4M3GA 2PZ1A 1WYDA 2GXGA 4ASNA 4NL2A 4Q15A 1IB8A 3V8JA 3G4ST 1MDMA 1M90U 2VXZA 2K9NA 5FO5A 4WXHA 2I5UA 4J7IA 1BYMA 2CT4A 1YYVA 2KPMA 1SFXA 2XTIA 2K5LA 3GNGA 2H6CA 1RUNA 2HEQA 2TCTA 1F1ZA 2L0AA 4D8KA 3WGHA 5DM7F 4DPGA 3HPWA 1R1UA 3NFCA 1VQ5Q 3I4MJ 2HYJA 1LFBA 4OF1A 2X9HA 4RMNA 1ZK8A 2ID3A 1RAHB 3GLLA 4M77A 4HNUA 1Q7YU 1BN5A 3ONQA 5GANd 4N9IA 3CCSI 4BY6C 1Z21A 1VQPQ 3BTCA 5LL6S 2PBIA 1IN8A 4CGZA 5LHHA 3BTLA 2HSEB 1WKMA 4EGYA 2RHSA 3VU3C 3ABUA 2XDPA 4XKBA 3UPUA 4PJMA 1FBUA 3J80E 1IGQA 3QRFF 4TQFA 2XG8D 4DA4A 2CZ7B 1R00A 5EG0A 4C5EA 2FZGB 4EM1A 2XAGA 3W6JB 2X48A 1CSKA 2BIVA 3DLAA 4AVZA 1YIJA 2L9NA 4ON0A 3E19A 3I55Q 1U5TA 1FSHA 4OLFA 3PSIA 3P9KA 3I71A 2O8XA 3BG3A 3ULQB 2KFDA 3RNJA 4XLAA 3DLLF 3HDDA 2NWMA 1X1PA 5HS8A 2R7SA 2FEZA 3ZFJA 5A0LA 2FZCB 3D5SC 2IGOA 3OW2P 1O3RA 1KYZA 4JUVA 3NHNA 4C92F 2M4KA 3VWBA 2D1HA 1NNHA 1H9TA 4DBQA 2VQCA 2LSOA 2WSFE 2L9SA 2VGMA 2XKOC 4MDXA 3META 4NC7A 4L59A 1IG7A 3I59A 4EJOA 1PRLC 2FBHA 1H4TA 4HEA2 4CUGA 1C1AA 2IW5A 3NELA 1UGPB 2RKHA 2QTVA 5E8IA 2BHZA 1Z3YA 1K0XA 1VQ7A 1KK7A 1IZ6A 1KHCA 2VWFA 4G7ZF 5K7HA 4JK1X 3KZZA 3WODF 3MPUB 1ADJA 3GO5A 2DOFA 2WAQA 2FOWA 3MQZA 3C95A 1B72A 4UVCA 2ZXHA 4ZZDA 4HKEA 3PO3J 4TVYA 3ZN0A 1ZQ1A 2KIUA 2D5VA 4A4KA 2KT0A 3EGXA 1K4SA 1M1KU 3WGIA 1SD7A 4ESBA 3J81E 3KLNA 3I4NJ 4FT8A 5E3OA 2E35A 3HRKA 2RJDA 2IGNA 2JJ7A 5ICEA 3CCUT 1NYFA 4YRJA 3QZ5B 1RAGB 5GJVB 2OTLQ 3L4GA 2FNPA 3ZMVA 2MWOA 1UGQB 3HOVJ 2JQ7A 2ZBKA 4IO9F 5CR2A 3NPFA 5CKDA 4ZYAA 4MNUA 1YX5A 5GAMd 2Y69H 3EUKL 3HUGB 3G7ZA 3NGPA 5DLQE 2G6FX 2NUPA 1PKSA 1KSWA 3CMMA 4BI4A 1QQJA 4N9HA 1A6IA 4Z88A 3S3OA 1GGMA 1SHFA 4J9GA 2KIMA 2KGTA 1C0AA 3OSGA 3UGTA 2AMCB 1FXXA 2E1NA 2CP6A 1QP3A 1D5VA 2JUGA 3OIPA 1N9SA 2DBBA 2WAFA 5KYXA 4FTHA 1AEYA 1K61A 3DB3A 4XQFA 1NH3A 3IAM2 4FHTA 3QKJA 1VQ5T 5DM6F 5IP9J 2XGTA 2L3SA 1S7AA 3FXQA 5EG2A 1R49A 4Y92A 1AKHA 2PUKB 2FMLA 5KNLA 4AFSC 2C0TA 3JRZA 1RI7A 1VQPT 1PM3A 4M9XA 1W1WE 5CKHA 1VQKA 2DK8A 4MTEA 2P8TA 2R0QC 4M9SA 2O9LA 1MMGA 1RETA 1RAIB 1YJ9A 2LC2A 3LSMA 1BBYA 2RHQB 3ZQQA 4ZTFA 4OVAA 2O03A 3ERED 4RCBA 2KZVA 2Q7GA 2M8EA 3JCMc 3MKYB 2RM4A 2YPRA 4IHXA 3J80K 3JREA 5CJ9A 4KIBA 3I55T 2HMAA 4QIWN 1FEXA 1Z77A 1RAEB 3TSWA 2FUG2 5CQYA 3DTIA 4ELYC 4ZDPA 2DFFA 4YRNA 1Z9ZA 1IGNA 2HR3A 1M1FA 5C6SA 1K83J 2MD5A 4LIUA 4DYCA 2ME6A 2ISZA 2LVSA 4HT4A 1HOMA 3G6EQ 2MCNA 1MIJA 3RMQA 1RIQA 4OIRF 5GMKj 4YTLA 4ZJZA 1EIFA 2LNVA 2EFPA 3P7NA 2E70A 2CGHA 3PNTA 3M8JA 1NLOC 2RK2A 2GIVA 2EPDA 5GPCA 2CKKA 2KMTA 4IIOA 4N4NB 1SEMA 1CF7A 3VDXA 5JHUA 2LK2A 3HRTA 2XSJC 5DCFA 2ZGWA 5K1PA 4H02A 4RTTA 4CCNA 2M87A 3G1LA 1UAAA 3VYSB 1KQ0A 1VQMA 3I5SA 1HKSA 4TVRA 3TEEA 4EMKA 1ASZA 4LVKA 2KQRA 4C2TA 1IUYA 1FX7A 4C8QC 1ZLKA 3MO8A 4J9BA 4L9TA 1B7TA 3DLLA 2K5IA 1NJIC 2HVQA 2YRVA 3OYMA 4EMHA 1WJFA 1WHKA 4HVUA 4II2A 3KE2A 3EYIA 4GFBA 4J5YA 3RI4A 2P84A 3MD2A 4C92A 2HXIA 2IS2A 2DXCA 5I11A 1S72Q 2VBZA 3LAJA 3B73A 3PVLA 2DA3A 4CH6A 4MIMA 2N8GA 2FOKA 3FBIB 2ZFUA 3J81K 2DODA 3OOPA 2OTLT 4FL6A 3CCQI 2DQLA 3SWNC 1AWOA 1LPLA 4MMKA 1H3HA 1W4MA 5J39A 4EM2A 1QVFA 2YXYA 1B34B 1WLPB 3FMRA 3VS3A 1F4KA 1ZG5A 2AXLA 5E18F 3DPTA 2OTJA 1OYYA 2CW0F 3JAME 4XRMA 1X2GA 5FLXK 3JCMe 2PUOB 3L09A 2DL3A 1W36D 2WA0A 1UG1A 3TP3A 4LVLA 5J1RA 2VV5A 1I81A 3CC4I 1TTYA 4LVIA 3I56I 4BE0A 2GQQA 4ZYHA 2ZMEB 4B4CA 3WE3A 2ZIMA 1IHVA 4DYRA 3LNQA 1CKBA 1WFWA 3L9FA 3A2KA 1KYWA 4HBLA 2QGFB 4CS3A 2W10A 2BE9B 2FEIA 3E5XA 3A7RA 1MDMB 4CDGA 3EFOB 1UJ8A 1OYIA 5M3MJ 3CCEI 5FLVA 1S7EA 4DJAA 1IUFA 2K7LA 3M0SA 4EM0B 4YIFA 2WAQN 2JMCA 3REAB 1OPLA 2QWWA 2C0IA 5J1YA 3IC7A 1USTA 3GLXA 4KH0B 4CICA 1BCOA 2FRHA 2O2OA 1X2NA 2O61A 2YT6A 2VL8A 2LX7A 2Z1DA 1SAXA 1JKQC 5FWCA 5DDGA 1YIJQ 3M0UA 4BY1J 4HOBA 4JZ3A 4M77B 1G3TA 2VPLA 3CLQA 4XRSA 5FGMA 3K4JA 4ENKA 2RHSB 2NRAC 5F6FA 3RJPA 4N4IA 2VBWA 2NS6A 4GDFA 1FYFA 3G6ET 1OULA 4I0BA 4TVAA 1EZZB 2HOEA 5EG0B 4DOWA 4P1WA 1JJ6C 2QQ8A 1U3OA 3ZMZA 1IC8A 1Z67A 4YDQA 1U5TB 1OQKA 2IEKA 3F70A 1UCRA 3A8GB 1VQ8I 4F7ZA 1TSFA 2ZZDA 4QQGA 1X43A 1G5IA 6AT1B 3DKXA 2J5PA 3LWIA 2KMUA 1TLHB 2ZKZA 1I5LA 1I27A 2IY5A 2CS3A 5LEJA 2HYFA 1USYC 4RAFA 1YRNA 4NB5A 4FYVB 4EJTA 4LNSA 2NNNA 1KIKA 4OB3B 4PJ0C 3WVEB 3C4SA 3BP8A 2A28A 4ZTUB 2LX9A 4Q4ZF 4H2SA 2XRLA 2QQRA 4AIKA 2AO9A 3A0HC 4D8DA 4HWPA 3A03A 3I59B 2HYGD 4HNTA 1PUFA 1U2WA 4OMNA 1S72T 3DTKA 4GY5A 2ZO4A 2EAYA 2CH4A 1BBZA 2XDDA 4F3QA 2EA2A 4XAXB 4Y52J 2K4YA 2BY0A 1HSJA 4F7UF 2AS5F 1RUWA 2FU4A 4AFZC 4FM4B 1T56A 1L0WA 2HL3A 4YG2F 2J6OA 1MHNA 4XRSG 1B72B 5KH6A 3QPHA 2HQXA 4WCIA 3Q0UA 3GZNB 1MMSA 1Q86R 2CUZA 2KLOA 1TNTA 1IXSB 3EGXB 4AFUC 1NJ1A 3QDRB 2HQNA 2LQ8A 3LX7A 4FW2A 1IV8A 4AT1B 1R4MB 2KT8A 1X3UA 4ZTZB 4C0ZA 2PMEA 1WU7A 2K3BA 2PMZA 4H2UA 4CXFA 5GANg 3PNVA 1V76A 3PGGA 5BQTA 1MBHA 2JT4A 4RTYA 3L4GB 1MMAA 4MHGA 5C52B 2M0CA 3K69A 4ENJA 1F1BB 2E1HA 2L7MP 4LFUA 5LJ5f 2QA4I 4RG2A 1OCRH 2KSSA 2LH9A 2ZJPF 4EX5A 5K7ZA 1VQKQ 2ZJRF 2IPOB 2K3YA 5KYXB 3A5ZA 4M78G 1GHCA 3C7JA 4G94A 1YJ9Q 5AYFA 2V79A 2K9LA 3LQRA 1AHDP 1K9MR 3TOBA 2DNUA 1YFRA 4QVDA 3AKZA 1M9SA 3AAFA 1IREB 3EAEA 2LVMA 4HF0A 3TO6A 4KBMB 1YIJT 2FXAA 5FLXZ 4NHJA 1FC3A 1HD3A 4BACA 1AKHB 3HRIA 4RMFA 2QI2A 5CQXA 2ESHA 3LA7A 5C4XJ 3CCVA 3KP7A 3WU2C 5FB2A 1KJWA 4NS5A 4ITVA 1ZRFA 3CJNA 1ZKGA 2PVOB 3NQOA 1ZG1A 4J01A 3IKLA 1SETA 1HSQA 3K2AA 3TEHA 2QQ9A 5D5WB 4RBOA 1JKOC 2YWWA 4F7UE 3CCLI 3E2UA 5LJ5d 1W5CC 2IA1A 2HQAA 4ZN3A 1IN7A 1T08B 2E5AA 3SJMA 1N9RA 2DL4A 3S2DJ 4XU1A 5K1XA 4ANJA 1ZGJA 1B59A 3HOTA 3H0GJ 3MEUA 3V7SA 4LK1F 3AG1H 2E1CA 1VQMQ 2CV2A 5HVQC 4FW1A 4OP0A 3GTGJ 2E5ZA 2BXZA 4XLEA 3HEFA 4KUIA 1BI1A 3DKMA 4M7DD 2IS1A 4C0GA 5L3DA 4M75C 3WTYC 4YPFA 1KD1R 1FIPA 2RHXA 1BK2A 1BKBA 3GTLJ 2QVOA 1CF7B 4M77D 4IQJA 5ELNA 2FPFA 3WE2A 1VQOA 2E3HA 3SD4A 2Z0WA 4GLMA 5I2SA 5GAMg 5DM7R 3SFMA 2RI3A 3NEMA 2LT4A 3A74A 4PJNA 3VS6A 4PDKA 2CT3A 3U2RA 3COAC 1JT6A 3BC8A 1JXOA 2OTJQ 4TVWA 4D5FA 1DP7P 3FLGA 1V5FA 3FK6A 1UZCA 2ISYA 5B1BH 4XLNF 1TUDA 1QE0A 4RAGA 4CH5A 3DP7A 4L9JA 2LBFA 2F2VA 4J00A 3K4CA 5D6XA 3TBIA 3FHNA 2YUQA 4E7IA 3U23A 2HU9A 4DQ2A 3FHZA 3GTJJ 3MP8A 2UUZA 1I5ZA 2O4XB 2O01E 1XTAA 5D4SA 4UUVA 1M90R 3ZMSA 1TC3C 4QKUA 2GXBA 4F7UA 3O5ZA 3IH2A 3OYHA 3D5LA 2CMPA 4D9JA 1E0EA 1VQKT 4A3DJ 1BA5A 2M5WA 1HTTA 4QLCU 4QT7A 3S3NA 1GFDA 3JRHA 1YJ9T 5CVIA 3JR9A 3JCMQ 2EBPA 2FJ1A 2QEXI 3SEZA 4E47A 1HW2A 1U1TA 4P73A 1YHQI 3IALA 4AM3A 4A3MJ 2EIFA 1M3BA 1VQ9Q 4QVCA 1Q7YR 2EQJA 1M2VB 4ZDOA 2F2XA 4XTWA 3E1SA 1WJSA 5IXFA 1H8KA 5BMZA 1BU1A 2E6ZA 2XU8A 1NEGA 1FMWA 3HFOA 2ZIOA 1QVGS 2M7AA 2BTTA 4LB5A 2HD0A 3EUHA 3Q0WA 2G4CA 2DO7A 3M1EA 4YRRA 3JTHA 1S1NA 1YIOA 2KXDA 1BOAA 4K2EA 2R5YA 4PL6A 2C7IA 1I3AA 4UVAA 1K76A 1K0SA 3E0JB 2LKXA 3DTEA 5J4VA 2VVKA 2HPMA 3PE0A 1E7OA 3CCJA 1X1CA 4OMPA 4YREA 5BNGA 4XSXF 2DL8A 4BUPA 1JJ2S 4XEMA 2EA4A 1YN8A 1JE8A 3RR6A 1Y71A 4LE9A 2GA2A 1VQMT 3F3XA 4RCCA 1ULYA 3KIOA 3SDGA 4HV5A 3L2UA 3GFLA 4I09A 3RPUD 4XLHA 4TVAB 3FKJA 3G3ZA 2DU7A 4IJAA 1WHJA 2I10A 3H5NA 5EC7A 2EIJH 2M3AA 2C06A 1WPYA 2MAMA 5J26A 1FP1D 4HQMA 1YW9A 1KZHA 2GQIA 2OX7A 2WC2A 4HWTA 1PP8F 3FXRA 1EIYA 3I35A 3LSTA 4JRIA 1ZR2A 3UA6A 4A2UA 2DU9A 4ATOA 4Y13A 2IS6A 3OR2C 1SSFA 1QPIA 2IS4A 3CMQA 3V7CA 3HTSB 2W57A 2R7TA 1QWFA 4XKVA 3H9NA 4JS5A 1W1FA 2KT1A 2EGAA 4CC2A 2WAEA 3EYYA 3ESWB 5H6RA 3QZ9B 1RESA 2DPDA 4BH9A 1WJEA 5AT1B 5E3IA 1SSHA 1WGXA 4KN4X 4XR6A 2I4LA 2CJAA 1TW2A 5JVTA 2Y0SA 1XDSA 3FXLA 3B02A 2OTJT 3HOWJ 1FZPB 1YG2A 4JX6A 4C0DB 3OYCA 3WG9A 5LEKA 1M1GA 1M1KR 3HXVA 3QO7A 5L3BA 1ADYA 4MO7A 1QU3A 2L3DA 2COWA 4KMUX 3CBMA 1PUFB 3P8DA 2OC6A 3HXUA 5D6FA 1X2KA 1BI3A 1QBJA 2KZGA 3DF8A 2NVQJ 5JHFA 2RJEA 4YRCA 3LSHA 1X69A 2VBXA 2DT5A 1J09A 5KYWA 4HT8A 1MJAA 3CPWA 4JRPA 2QDYB 5AIPA 2HKNA 1N5ZA 4WWCA 2OCCH 4NBQA 4RM3A 2L3QA 4HCZA 5CQGA 2STWA 1VQ4I 4YRVA 1MV3A 4MEXF 2JWTA 2KYMA 1H92A 5CKEA 3K70C 4H2YA 4YFXF 2R5ZA 1YFSA 4J9FA 1IXDA 1MSFC 2ZJ2A 3ZRGA 4BQOA 4CCJA 3RDIA 5J47A 1NG7A 3M8EA 2DQRA 1UJYA 3IHUA 2P0QA 3PTAA 5C0MA 1YS7A 2R7VA 1VQ9T 1ZBJA 2K57A 2VPRA 2X3WD 1WHMA 2FPDA 3HHHA 5HOOA 3CCVQ 3G1MA 1G4DA 4JS4A 4C92D 2B86A 3VV0A 4BS9A 4HT9A 2NXNB 5C3EJ 4HXJA 3A5ZB 4Y4RA 4LXCA 4A0ZA 5HDKA 1EH6A 1NJ6A 1NG6A 3GYHX