3V7CA

Cystal structure of sabpl in complex with inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
total genus 103
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7cA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7cA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7cA02
2IT0A 3I64A 4YYEA 2JRTA 1XD7A 4UPAA 4PJOB 1N9WA 4WWCA 2HEOA 1FY7A 3GLXA 4FX4A 4LK0F 3B73A 3KLNA 4M9XA 5CLSA 2AKWB 4XTZA 3N97A 4QVCA 2Z33A 2YHTA 2XVCA 3K2ZA 5GAN5 5LJ3f 2L02A 12ASA 4YFNF 1K7AA 3ERRA 5LJ5g 4WXCA 3E6MA 5DD8A 4UP9A 1KU7A 4LLLA 2E5AA 4QWQA 2EFOA 4OMZA 4RB1A 1SD7A 5JHUA 1B8AA 3L4GB 1YIOA 5E1ZB 2QQBA 1WQ2A 1YFTA 4ENKA 4NHJA 2MD5A 4YIIA 3Q9SA 5F5WA 3EYIA 1P6RA 4H2YA 4WJ4A 2FYKA 2IPQX 3WTZA 2I4MA 1HK9A 1DPRA 4L87A 1KQ9A 3I54A 1X2HA 2LSOA 2XTIA 3Q9VA 3HHGA 1NNHA 3TQNA 1LJOA 1BIBA 2LNBA 1EVLA 1SRYA 4HWRA 2F5FA 5F64A 3A74A 3WTSC 1RUNA 4ENJA 5HOOA 3HFVA 2ZMEA 4M6XA 3UGTA 2Q2EA 1X54A 5CVVA 1V4RA 3VQVA 3FZVA 3AAFA 4A5NA 5GAN4 4M7AC 3VQYA 3LAPA 2JT1A 3H3ZA 5LJ3h 2ARTA 4PHCA 2EWNA 4P73A 1NHAA 1NJ1A 4J5YA 2DJZA 1AOYA 2C7IA 4WCGA 1J2XA 4HW0A 2PG4A 3WTVC 4XEMA 2F5CA 2JZYA 1R7JA 1ADYA 1MZBA 3RTRA 4OIPF 2RQPA 1EH7A 2A69F 3LC0A 3MF1A 3EFSA 5KVRA 3KP7A 2RHQB 5AIQA 4EGYA 1P4XA 1F9NA 1BJAA 3JCMd 1BBWA 4WI1A 1WYDA 4A5MA 4ZYHA 4XBFA 1XGNA 1OPCA 2GIVA 4RGUA 3R07A 2UXNA 4KIGA 4LG0B 4P71A 1LDDA 3RERA 4U0VA 4ETSA 4A53A 2RA2A 1R22A 3JB9G 3V4GA 2V1UA 2CJ9A 1EH6A 2RKHA 1TQMA 1PP7U 2VOOA 4CH5A 2M30A 3W6JB 1Y0UA 3TDUC 1DDNA 5D6FA 4S05A 4MNUA 5GANj 1F1ZA 5HGQA 1P4WA 1JJCB 2EV5A 3GVAA 1O57A 4P9UA 3V8KA 3O6BB 4BXUA 1IUYA 3ZN1A 1UHMA 1ZARA 2I4LA 4EMSA 4CH4A 5C52B 3TOBA 1XN7A 3WTWC 2D2WA 1YCYA 2BYVE 4EJWA 1ZAOA 2XV4S 2ALYB 1H4QA 2HWVA 4WXDA 4JK1X 6PAXA 4XU3A 3JCMh 4YRRA 2MA3A 1QF6A 3ZMVA 1LOJA 1E24A 2O3FA 3QU3A 1QZZA 1U1SA 4CICA 4XLPF 3T5XA 4RB3C 4M71A 2W84A 1XSVA 5ELNA 2I4NA 2DDZA 3K1MA 3CJNA 2RNJA 3DP7A 5GAOm 2D45A 3HFZB 3T0YA 4CS4A 2OQRA 4LLGF 1FYKA 5ILVA 1Z9CA 1IRGA 4OMYA 1U5TB 2VC0A 2VC8A 2EV6A 1KMNA 4NB5A 4WJ3M 1JJCA 4E70A 3SXYA 4O3MA 1R00A 3HSEA 3KZZA 3DQVC 5LGTA 1Y96B 1G3TA 1IZ1A 5GAMe 1IF1A 3RESA 4JLIA 1WRJA 1R36A 3JCMJ 1XDUA 2COMA 4RCBA 4TWAA 5JR3A 4EX5A 2ZT6A 4HDUA 1D3BA 1R1TA 5IT9Z 1QE0A 4TVYA 2H6CA 3LSSA 4A6DA 1I8FA 1Z6RA 3CMQA 4U0WA 2E10A 5GAN8 5GANg 3L09A 5LLQA 4ZTZB 1W5SA 1SD5A 4M74A 3L2CA 1XGSA 2DPUA 4DQ2A 1IL2A 4N9IA 2YLBA 3ZMDA 2HS5A 1HSJA 1P2FA 1BBUA 4JUVA 2IJLA 1BI0A 2IVMA 5JFRA 2XGTA 1HQCA 4ZYDA 3CDHA 5H20A 1QPMA 3F72A 2DU7A 1UCRA 4N0AC 3JCMe 4UVCA 2XGXA 5FFXA 2HDCA 3NEMA 4EQQA 3EYYA 1HW5A 5HS8A 3RKXA 4F7UF 4YRMA 4YCVA 3JCMg 5LEJA 3AHUA 2ZT5A 3SB2A 1C0WA 4RB0A 3LA3A 11ASA 4RB2C 2ZTGA 4YCWA 1T38A 3DSQA 1G4DA 2XHKA 1UB9A 4P3OA 3M4QA 2ZCWA 2IA0A 1Y96A 1IW7F 4R8HA 1TNTA 1AWCA 2Y90A 4ZZLA 1BIAA 2FRHA 4H2TA 4BHCA 2LF7A 3V7RA 3QTCA 2DK8A 4L0ZB 4KR2A 2HNIA 4KNYA 4HV6A 1Z7NA 3WQZA 5F6FA 2IY5A 1E2XA 3QRFF 1IN4A 2RC4A 4RGSA 3GW2A 3HFZA 3HHHA 2VXEA 3K1PA 3HOTA 1SMYF 4LD5A 4B8XA 4M75A 1J59A 2M8EA 1KU2A 5FLXK 2ZNIA 1PP8F 4G94A 2A6EF 4LFUA 4C8QE 4AIJA 4KA4A 1UHWA 4GXOA 5K5RA 4PZJA 1G5IA 3GWZA 1Z7MA 3F21A 2QHUA 1BBYA 4XTWA 4MEYF 4LB5A 3QO3A 3MFKA 2DU5A 4C92B 5L3BA 5AIPA 3JCMQ 4L5IA 4L5JA 5FLXZ 4MQVA 1QNTA 4UNOA 1B4AA 2E65A 1G3YA 4IF4A 4P75A 4PJOA 4V2SA 3ZQ7A 2QHSA 3WGGA 4CGZA 1ZGAA 3FMQA 3J80K 4J6WA 5BPIA 1SD6A 1R1UA 1LNXA 3ZMZA 5DEQA 5BPDA 1B9MA 1G6NA 1XB4A 3UFGA 3I71A 3WU0A 2DPDA 1Z7UA 5HDGA 4F7UE 5E17F 2DQRA 1HKSA 4M7DA 3KLOA 2O8XA 2WC2A 1B70A 4LK1F 1KU9A 4MHGA 1T39A 1WSUA 3VU3C 1SMTA 2EL9A 4MMLA 3J80Z 4C8QC 3I5UA 4M78F 5HDNA 2ZR2A 3DKWA 5J8FA 2HQRA 4TVAB 2CSOA 1USYA 3EUHA 4K2EA 5LJ5d 3IKLA 4K88A 1R58A 4YFKF 2OA4A 5HDKA 4KIBA 2X4HA 2H09A 2HTSA 5C51B 2H6BA 4C92D 1MGQA 3BWGA 3WODF 4M75E 4MMKA 3A31A 2FE3A 4M73A 3KETA 2PN6A 1KOGA 5FD6A 4C92F 1WLEA 3E9HA 5HLGA 3WG9A 2PMEA 3JB9J 3F8FA 2IY5B 1DUXC 4EO4A 1KA8A 2HGCA 4YFXF 1UFMA 2HFHA 4XEOA 3E3VA 3GFJA 2I4OA 5LBQA 1YQAA 2NS0A 5DD4A 3SWNC 3HTZA 5ILUA 3FM5A 3E9IA 5K1PA 2ZZGA 4KICA 1IRFA 2HQNA 4M7AD 4IJAA 3UH0A 4EGZA 1D8JA 4C92E 4CS2A 3DXJF 5DV5A 2PQ8A 1YGBA 2HR3A 4PJOG 4YP0A 5GANf 4M7AB 3HRIA 2TDXA 2PJPA 4F7UA 4EJUA 5LHIA 5FFZA 4A6EA 1T6SA 2UZKA 2XASA 2ZZEA 4L18B 5LRSA 2JPBA 1D8KA 4J6XA 2J3MA 3HFNA 3QP5A 3P9KA 1FSHA 5AONA 2R7FA 3WGIA 5A2QZ 4GO1A 1SESA 3QPTA 3GUDA 3M8FA 3M4GA 2GQQA 1WPYA 2VBXA 4A0ZA 4H0EA 1WU7A 3U1DA 3T8RA 4TQDA 5H6QA 2A5YB 2JN0A 2DI3A 2P4WA 3MF2A 3DFGA 3TO9A 2ODRD 1SAXA 4M77E 5A2QK 4YRJA 1ZG5A 2H94A 3HOSA 3CUQB 3M7GA 5GMKi 4HWPA 3BPVA 1QZYA 1FYMA 3VOEA 3BW1A 1KYWA 4G6QA 2VBWA 3H3UA 3T1BA 5GAOp 5L3DA 3G73A 4PJOD 5D5WB 2ZNJA 4UXNA 3JTHA 1BOAA 1H4VB 4DPGA 5GAN6 4I01A 5FO5A 2CWEA 4EMKB 2M87A 4M72A 2G7HA 3GZ5A 1KQ8A 3GFMA 1MDMB 4C8QA 3UGQA 3JB9I 3MCZA 1EVKA 4NQWA 4D0PA 4L9VA 3ECOA 2I2LA 1USYC 2DTRA 1IN8A 2EJGA 1MJBA 5CJ9A 4X9DA 2J5OA 2K02A 2XKOA 4YRKA 2XAHA 3VFZA 4XTXA 4WF2A 3A5ZA 4IXAA 2E1HA 3RF1A 2FB7A 1E22A 3D0SA 4M75D 2EV0A 4Q47A 1CF7B 3JCMf 3V8LA 3L9FA 1CF7A 1ZN2A 3E97A 4C8QG 4WK8F 4PJOF 3RJPA 5LGUA 3QO5A 2ISZA 3JSPA 4IPAA 3ICAA 4MTDA 3EDPA 4YRQA 2FSWA 2BEOA 3E5XA 2Q7EA 2FMLA 4Q48A 2IW5A 2ESHA 1EFWA 4B09A 2HTJA 4HLYA 4U88A 5D5UB 2A07F 4I09A 4NOYA 2OQGA 4KFCA 3RPUA 5EEHA 2FEZA 2IP2A 2DU9A 2DXTA 1H9GA 2XKPA 1WI9A 5CVIA 4XU2A 2A61A 4M6YA 3L7WA 2V1XA 2Y48A 3R0JA 4CYDA 5LJ5h 2QTXA 2MBFA 1RIOH 1FBUA 1MGTA 1X2GA 3RYPA 4AVPA 3U2RA 1V3FA 3EETA 2Q7GA 4Q6GA 5GANd 2L54A 3CO6C 2VXZA 1USSA 2PBIA 4H2XA 5GAN2 2WTEA 1FBSA 3HY1A 4O5VA 2AMCA 4AD9A 3IKVA 4FHTA 2O6GE 3TEGA 5FB2A 3M9AA 3VODA 3JCMV 3MAJA 3DPLC 4PDKA 2ALYA 1U2WA 3IC7A 4M78C 4F7ZA 2AMCB 3E5UA 1GHCA 5LGNA 2W24A 3IALA 3LFKA 1FC3A 2ARSA 2HYGD 1FPQA 2ESNA 2NYXA 1OYWA 2CG4A 1ZH5A 1O7FA 1YFHA 2GXBA 2ACJA 3I59B 2GWRA 1TLHB 3TKYA 4EJTA 4KMUX 2VXFA 3IG2A 2QBYA 4C92C 3JB9D 2VOPA 4M78D 4YIFA 2ZNYA 5E1WA 5J6XA 4XU1A 2BGCA 4EMGA 3HFOA 1WWXA 5D4RA 3FM3A 1B1BA 1MKMA 3LSTA 2MH2A 3HSFA 3WTXC 2QYOA 3C1DA 3MEXA 3U9GA 4C8QD 1ASYA 4ESFA 3HXUA 2VE8A 5BOXA 1YS6A 1H9TA 3E6CC 2EFPA 3O2PE 1ASZA 4G6DA 1O3RA 2FMYA 5CVUA 3HTSB 3VQWA 2FOKA 4PCQA 2J5PA 1ZRCA 1F5TA 3KP5A 2P8TA 2Y0MA 4H2XB 5D8KB 2HYFA 2IA2A 2XRNA 4E51A 3A5YA 3TO6A 1MJ9A 1FSEA 4HAMA 3HIFA 2XROA 4GYIA 2EFWA 4RQEA 3O3KA 4I98B 2FQ3A 1X56A 1YFRA 3HRTA 1G51A 5CVJA 2DAOA 4BHBA 4M7DG 1ODDA 1VTNC 2ZMEB 2C6YA 1LDJA 1MDMA 2EJFA 4YG2F 3GXOA 1FZPB 5GMKe 1S3JA 4QVDA 5JVTA 3TUPA 4PJOE 5K1XA 4KUMA 2DK5A 2ZXJA 2Q5IA 3P9IA 3DEUA 2VC1A 4ENNA 1I81A 4AWXB 2K57A 3NENA 1IN7A 1W7PB 2RM4A 3JCMP 3P7NA 2DTIA 3REOA 1N9RA 1QBJA 1TW2A 4RGRA 3HSBA 5ICCA 4J6YA 2QUFA 2PEXA 3BOQA 2AS5F 4U7DA 3J81Z 1I1GA 2FA5A 2EJ9A 4JRKA 2V79A 2Z5UA 1SD4A 4TVAA 1LJ9A 5LJ3e 4HA8A 1O3SA 2Z3YA 4P72C 3GO5A 5DCFA 2E7WA 3MEYA 3KP3A 2QWWA 4PNOA 2ZZFA 2VT2A 2XUBA 2W57A 2ZIMA 5LRRA 1NJ5A 1VQZA 4EMKC 3JAMK 4M78A 1HKQA 4P74C 1QO0D 1JHFA 1I5LA 4ON0A 4EMKA 5GAOl 3W6KB 5C53B 3F22A 3JCMc 3H92A 4IRIA 3B02A 5LJ3g 1YLFA 1R5HA 3TDZC 1LVAA 3P8TA 1B59A 3KCCA 1RI7A 3N4MA 3D5LA 4BH9A 2IRFG 1FLIA 4M7AE 1NJ2A 4H2UA 2E1NA 4R79A 3IRQA 1JHHA 4HYEA 3BDDA 3RPQA 4XU0A 2EA4A 1YW9A 4NCXA 4C92A 3CUQA 4BQAA 1T98A 3ML6A 1KYZA 2F5DA 3BJOA 1D5VA 2YPRA 2P7CB 2OD5A 4GYGA 3K0LA 4UUVA 1S6LA 3A7RA 3RI4A 2EAYA 4YRFA 2XAJA 3I7FA 2YX7A 2AKWA 4ZTUB 5KK1A 4XSXF 2M5WA 3BJUA 4N0BA 3R0AA 4RQFA 1FNNA 2QHTA 2VODA 4UHTA 2FU4A 4KYWA 5ICGA 4G9YA 1OMIA 5GAOr 1YO5C 2PFBA 4CHUA 4CH3A 3IKMB 1XSDA 4R1HA 2P5LC 1ZG3A 4RGXA 5D5VB 4A0XA 4BYYA 3KP6A 3WGHA 3GIBA 5GAMj 3TO7A 2P7VB 5LJ5e 4H2SA 2GXGA 2EB7A 3QHSA 1B34A 3BROA 3ZN0A 3KFUA 5GAMf 1D3BB 5JI6A 1W4MA 2ZXFA 1FYLA 5IT3A 5E20A 3BDUA 2XAGA 1ZG1A 3BJ6A 1SFUA 3C3WA 3F6VA 1J7KA 4P9FA 4I2OA 2D1HA 1J5YA 2HKXA 4TTVA 2VBYA 2O0YA 2KIUA 5E8IA 2P5IA 2ZJ2A 1D3YA 4AIKA 1PYSB 1JE8A 2YX4A 4XSZF 4RMFA 1NYRA 3F8BA 4NL2A 3LQRA 1E17A 4TQFA 2M45A 3RUXA 1OYYA 4A2UA 3K9TA 2MLKA 2FBIA 1WQ7A 1HXDA 3RKWA 3HXVA 4P72A 1B76A 3W3SA 3M8EA 1J9IA 4Z2YA 4OU0A 3QAHA 2E64A 3QNEA 4C8QB 3F8CA 2F2EA 3BY6A 4CS3A 2DZ9A 2QENA 3FXQA 4FT8A 4IRHA 2ISYA 5GANe 1KQ1A 2LF8A 2QBYB 4KN7X 3WTUC 1ZYRF 2LKPA 4M7DE 4P3PA 5E1XA 1K78B 4ZYEA 1IN6A 1FBQA 3V8JA 4JRIA 4X5OA 1B7YB 4YRIA 1MD0A 4A0YA 5BQTA 1ON2A 1U6GA 3FHZA 1W7PD 1L0OC 3E6BA 2JSCA 3LA7A 3ULQB 1X55A 4HT9A 3FXUA 1B7YA 5GAMg 4M78B 3LWFA 4M7AG 2MC3A 3DF8A 3HRKA 1OR7A 4P5OA 4CO8A 3EQLF 4QLCU 4HV5A 2H27A 2DO7A 2DQ3A 1WQWA 2ETHA 1Z1DA 2QQAA 5DUIA 1LNWA 4M77B 3WTTC 3ERED 1HW2A 4M7DC 3C18A 4A54A 3CUOA 1ZLKA 4N9HA 1YG2A 1W66A 4EVIA 4HWSA 3BJAA 1YTYA 1J75A 4BAYA 5GMKm 3BP8A 1I6XA 4YRCA 3HY0A 4BW9A 2UWMA 4M75G 1H4SA 3CO7C 2A3SA 4U0YA 1W5TA 3JTGA 4EJOA 4XTYA 4M7AA 5L3EA 2L3DA 3LQQA 1SETA 3TGNA 1YW8A 2V1DA 1KU3A 1DP7P 4EM0B 4RDXA 3MZHA 3QSUA 2JTVA 4IHSA 5L3FA 1ZHFA 4YREA 1G5HA 1WKMA 2EK5A 2ZBKA 1ATIA 3HXYA 1FYFA 5LJ3j 3HXWA 5ILSA 5GAMd 3L00A 1ZLJA 4YRTA 1MJAA 4EV0A 5ED4A 4U7BA 3MWMA 4RAZA 4HF0A 3HRSA 1FP1D 1XGOA 4WX9A 3GX4X 2G9WA 3SZPA 1KQ2A 4P71C 2NRAC 5LEKA 4ENMA 3JCMW 4HQEA 2KIFA 4GCVA 4I7HA 2DTHA 3JB9H 2KRFA 1ADJA 3RACA 3CTAA 4X9CA 5GAOn 4DNCA 3K1NA 1I4K1 4OIRF 2ZNZA 1KMMA 4P73C 2R7DA 4HWTA 4EM1A 1E1OA 4PGHA 1T2KA 1GXPA 1HW1A 1QQIA 1EV7A 3P9CA 2Q8KA 5L3GA 3F23A 3E6DA 2K7LA 2M1BA 1ULYA 1I1SA 1R23A 2GA2A 4L9NA 3KZYA 5CAIA 2GAUA 1JRIA 2CIMA 4Q5SF 1OKRA 4XRFA 1ZGJA 3QU6A 2DW4A 2QM3A 2CJBA 4Y17A 1SFXA 4XQ3A 1H4TA 2RGVA 3LAJA 3L2ZA 2P0LA 1BI2A 3PCOB 1TQPA 4M77D 1YYVA 4AIHA 4Q15A 1O3QA 1FT9A 2OU2A 4RS8A 1U5TC 2W85A 4XTUA 3RYRA 1XMAA 5GMKl 1YW7A 3HTUA 3PFIA 3NETA 2VBZA 2P5VA 2CGPA 1U5TA 4IRGA 2Q5HA 4HBLA 1EIYB 3BFMA 1X01A 1XCBA 2DLLA 3OV8A 1RUOA 2OZ6A 4YPFA 5HS9A 1CGPA 3ZPLA 3PZCA 3A7AA 3DV8A 1U3EM 1EQRA 1SFEA 4KDPA 1GVJA 3DPTA 4RCCA 4Y15A 4YRPA 2ZCEA 2ZR3A 5DYMA 4ESJA 1X3UA 5BMZA 2CYYA 1SERA 1PDNC 3FF5A 4LJZF 5GAN7 4HF2A 3ELKA 1JBMA 2EFNA 5EEGA 3TEHA 4TV7A 4LLNA 1OYIA 2OZUA 3R4KA 2CJAA 4XLNF 1H0MA 1TW3A 4YROA 5E3IA 4ESBA 4CZZA 4Y13A 1L3LA 4OIOF 1LDKB 3JW4A 3SHFA 1YFSA 1BN5A 1TQIA 4OINF 4HLXA 1ZRDA 1YB3A 4H02A 3J81K 2UXXA 2RN7A 4I0AA 5IT9K 4K86A 1IXSB 2ZKZA 5K5OA 3F8MA 3ZMTA 3F3XA 3HRUA 4RAYA 5CYVA 3JCMX 3OD1A 2AXLA 1KGSA 4HX7A 5DUKA 3QP6A 1C0AA 5HLHA 3FIFA 4M78G 3SWNA 2PMHA 4N0AA 4LB6B 2Q7HA 2MH9A 3R61A 1GGMA 2PMFA 5D6EA 4M9SA 2J3LA 4UP8A 2NAZA 4EJVA 2BV6A 5ELOA 5F1RA 4A12A 5LHHA 2G4CA 2DXUA 1XCVA 2RVCA 1T0FA 2MLGA 5TJJA 4IVNA 1REPC 3KEOA 4GGGA 4M77G 4UP7A 5DCMB 3IL2A 2W25A 4C92G 2K4BA 1IAWA 2CO5A 3REUA 4M7AF 3I4PA 4G84A 1IN5A 2LDUA 3I58A 3KE2A 3JSOA 4M7DD 5LJ5j 3HXZA 1NYQA 2EFQA 3I0TA 1B70B 2E3CA 4F7UG 3RKYA 3P8YA 3BPXA 5BS6A 1U8RA 2L4AA 3NELA 2DKGA 3QPHA 2O61A 4XTVA 2KIMA 2PI0A 5ICFA 1BC7C 2YLCA 2ZIOA 2CQKA 4KN4X 5LJ3d 1RIQA 2ZT8A 3BY7A 2YR2A 2HKOA 2OAZA 3ECHA 5HVQC 2Q0OA 5KNNA 2RDPA 4BNCA 4UVBA 1DPUA 3VBBA 5DDGA 3IWZA 4S04A 5H6RA 4YRSA 2B0LA 4M75F 3RIRA 1KQ0A 2GZWA 2KJCA 2A68F 4I0BA 3OOPA 4P75C 4LG0A 2QVOA 3G3ZA 3NRVA 4HOBA 2WV0A 4UV9A 2HOEA 2DTOA 4G85A 1IXCA 4MGRA 1TH7A 3L1AA 4OIQF 4UV8A 4TVWA 4ZZDA 1FWZA 4PG3A 3HXXA 2ELHA 3ZMUA 1TTYA 3FX3A 4YRLA 4HT8A 4ZYGA 2BBYA 1WNLA 3KP2A 2V6CA 5DCMA 2HZTA 1XDSA 4OLFA 2FF4A 1K6OA 2YSRA 2STTA 3SZTA 2ZT7A 1EOVA 2ARUA 1RZ4A 3WE2A 3QUIA 4CXFA 1BI3A 1EH8A 3S2WA 5GAMh 3GFIA 2KKOA 1FOKA 4P96A 4MTEA 3A32A 3WU1B 2KJBA 1J0RA 3Q5FA 3ABUA 3P8VA 5K1YA 2ZINA 4Q4ZF 4P55A 3EFRA 1S8NA 1K78A 2PLYA 2X0LA 2ZFWA 5HS7A 1R5GA 3R6SA 4HWOA 5GANh 4L9TA 2Y75A 4OP0A 1Q1HA 2RHSA 1ONVA 4ASNA 1ZREA 1O3TA 3QO7A 1B34B 2CFXA 3LA2A 1I27A 2XAQA 3KP4A 4G7ZF 3PQJA 1HC7A 1F4KA 2GA1A 3ZP5A 1O7LA 5TRDA 2G7UA 4EM2A 5DY9A 4LMYA 1LYLA 3M1EA 2DVEA 3JCMb 2K27A 1BM9A 5ICEA 4KMFA 2DEQA 3HYIA 3G1ZA 2FBKA 2QQ9A 1FP2A 3CLOA 4G7HF 4MQ9F 2EJRA 3NQOA 3TEHB 4M77A 1S7OA 4M78E 3FMRA 4P74A 2CW0F 2FNPA 1PYSA 3GEZA 4AH6A 4M77C 3GYHX 5GMKj 4IHTA 2BE5F 2RHSB 1L0WA 5E8GA 1XSXA 2VN2A 2R3SA 2VONA 1Z05A 2QLZA 3FWEA 4M7DB 3I53A 1Z6TA 3ISPA 4Y91A 3CUQC 2E1CA 1N9SA 4H2VA 3K69A 3J7AO 2QZ8A 5I21A 4HQMA 2XAFA 3KEQA 4CDGA 2RD1A 3FXRA 4H2WA 3WTYC 1EIYA 3TOAA 3VQXA 1TBXA 1XMKA 4YDQA 5K5QA 3VEPA 4UVAA 4NL3A 3IWFA 3ROUA 3COAC 2DBBA 3HUGA 1NJ6A 2L4MA 5HLIA 1JXSA 5GMKh 3L4GA 2ZO4A 1STZA 3NEUA 3RGLA 4ZIBA 2RV8A 4HZFA 2PMUA 2V9VA 3V7CA 2STWA 4I02A 1E1TA 4O6JA 3FJPA 1M8VA 4P3NA 3WE3A 2P6SA 4JBAA 5GAN3 3JB9F 4HVCA 5LHGA 3FB9A 4YRGA 2K4JA 3GF2A 2NNNA 1PUEE 4L0YB 4EMHA 4YCUA 2ZGWA 2Z9OA 4KR3A 1I5ZA 3BZ6A 3RDIA 2O03A 1QGPA 4M75B 1HSTA 2FXAA 1A04A 2P5KA 4L9JA 3RL6A 1S7AA 3REXA 2DFIA 4M9ZA 2DZCA 1YS7A 5E18F 4PGGA 1Z91A 1LEBA 1G3SA 5FGMA 2CGHA 1LEAA 1HKTA 1USTA 3PQKA 3QO8A 1LB2A 1LQ1A 1HBXG 3R60A 4M7DF 1NJ8A 1W7PA 3MZYA 3GFLA 2NNYA 4LGWA 2FBHA 4CH6A 2DQ0A 3FMSA 3A7UA 5FD5A 3HRMA 3C7JA 3SWNB 1B6AA 4F7UB 3PCOA 3F6OA 4PJOC 1RNLA 4HX8A 1S29A 3SQNA 2Z99A 3PGGA 3ABTA 4ZH4F 4KIFA 4YRNA 3MQ0A 4M77F 4G7OF 1M5Q1 1BC8C 2VT3A 1U1TA 5GAOq 4K87A 4JQFA 2K86A 2L01A 3V7SA 2A6HF 3ZMSA 2ODRC 4BHPA 3E5QA 2WWYA 2OBPA 2F5EA 1IXRC 2DT5A 5J8CA 3SFZA 2RHQA 3VB2A 2RB6A 5LJ5f 4BWAA 5D8LB 2IA1A 5ERIA 2C8MA 5CVRA 3F8NA 4HX4A 2E7XA 2FNAA 3IHUA 4WXHA 3KFWX 5L3CA 4HF1A 1TNSA 3LSQA 2E41A 4C8QF 2XIGA 2EA2A 4FX0A 4M75C 4LNSA 3HSRA 3QOPA 4MEXF 1G3WA 2VE9A 1P4AA 2ADUA 4HDVA 2P6TA 2JPCA 2YU3A 3M4PA 1U78A 4O2DA 3JAMZ 2DQLA 5D5XB 1XGMA 3IKTA 2QHVA 1K79A 1GXQA 1BI1A 1JGSA 1FX7A 1P92A 2D1VA 4G8XA 1J5WA 4KT5C 3T8TA 1H641 1B9NA 3I59A 4J15A 3GZ6A 1R1VA 1HTTA 1ON1A 5D4SA 3INZA 4KQEA 3IRRA 1ZRFA 4OOIA
chains in the Genus database with same CATH superfamily
2QKMB 3FC3A 2IT0A 3I64A 3VYSB 3CJQB 4YYEA 1D1AA 1NTCA 1V54H 1WGSA 1AZGB 2JRTA 4ZN1A 2EZHA 1BOBA 2CW7A 1XD7A 3HKZN 2HZYA 2KR3A 2KYMA 4LUEA 1RR8C 4PUSA 1MSFC 4PJOB 4UPAA 4DJAA 1QZEA 2OTLA 1N9WA 2JK3A 4WWCA 1FY7A 1YIJI 2HEOA 1QVFP 3GLXA 2XIDA 1WH7A 4FX4A 4LK0F 3DU6A 3B73A 3KLNA 4M9XA 4XLAA 1SHGA 2XGCA 5CLSA 1YJWQ 2AKWB 3A0BC 4XTZA 3S1RJ 2ELJA 2K3FA 3CCJA 3HPGA 3CDLA 2ZB9A 2CUZA 3N97A 3JRHA 4QVCA 1LVKA 2NS7A 2H8WA 2Z33A 2YHTA 2XVCA 1QRYA 3G71A 3K2ZA 2O31A 5GAN5 5D7UA 3OBYA 1KIKA 5LJ3f 4B3AA 2L02A 2OTLI 1PKSA 2CKKA 4PKCC 4YFNF 3GNGA 12ASA 1K7AA 1H3ZA 2W00A 1VQOT 3ERRA 5LJ5g 5IN1A 2IGKA 4WXCA 1YJNT 3E6MA 2L7KA 4D9JA 5DD8A 4FYYB 2LVSA 1VQ4A 4UP9A 2IXSA 2ECBA 4LLLA 1KU7A 1K83J 1ZGWA 1X6GA 2E5AA 4QWQA 4MDXA 2EFOA 4OMZA 4RB1A 3F70A 1SD7A 5JHUA 1B8AA 3L4GB 1YIOA 4XKBA 5E1ZB 2QQBA 1G83A 1OZ3A 1C0AA 1M90R 1WQ2A 3BCBA 2EIMH 4ENKA 1YFTA 1J3TA 4NHJA 2MD5A 4YIIA 3Q9SA 4E7IA 2ZJPF 5F5WA 3EYIA 1YJNQ 1P6RA 1E3OC 4H2YA 5IP9J 3I55Q 3CMEQ 2FX0A 2IPQX 3WTZA 2FYKA 3CC7Q 3PO3J 4WJ4A 3M56A 2LK2A 1VQ5A 2I4MA 1FMKA 1HK9A 1DPRA 4L87A 3QWYA 3BR1A 1DU6A 4DEXA 1KQ9A 3I54A 1X2HA 2LSOA 1Z9ZA 1FTTA 2EFIA 3Q9VA 2XTIA 3HHGA 2HNHA 4DIQA 1ZA1B 3CCLA 3ZR8X 1NNHA 3TQNA 2J6FA 3HG9A 1LE8B 1LJOA 1BIBA 2LNBA 4ZTFA 1EVLA 1SRYA 4HWRA 2PJRA 2F5FA 1RAEB 5F64A 4D7NA 1Z7LA 3WTSC 4QPOA 3TMOA 4ENJA 5HOOA 1RUNA 2EQMA 3OYAA 1UGPB 2ZMEA 2RJCA 2VJ5A 5AYFA 4I6ZA 3HFVA 1A6IA 4M6XA 3UGTA 3K2AA 1TU0B 2Q2EA 5F1JA 2LMDA 3QODA 2HPMA 4IOAF 5CVVA 1V4RA 2EZKA 1HD3A 3FZVA 1X54A 3VQVA 2ZMEC 2BY3A 4A5NA 3AAFA 3BE3A 3R6NA 1K0XA 5GAN4 2E5NA 4CUGA 1C6VX 4M7AC 4H2UA 4BACA 3VQYA 5FROA 1YHQA 3LAPA 2JT1A 3H3ZA 2D0NA 2E1OA 4F55A 1AWXA 2KT8A 2EWNA 3FHNA 3I5RA 4JZ3A 5LJ3h 1AWWA 4P73A 1PNJA 2E4HA 1B8IB 3MCAB 1NHAA 2MABA 1PC0A 1NJ1A 4J5YA 2DJZA 4C5HA 1AOYA 2C7IA 2QQ8A 4WCGA 2KIQA 4LVMA 1J2XA 1WXBA 1T3LA 1UEBA 4HW0A 1TC3C 2PG4A 3WTVC 1TSFA 3JRFA 4XEMA 4LDXA 1BJZA 2F5CA 2JZYA 1R7JA 1ADYA 3EHQA 1MZBA 4OB3B 3JRBA 3MKZA 1YNZA 4DBRA 3RTRA 3A8OB 4OIPF 4CH7A 5CQEA 3PUFA 2RQPA 2A3LA 2NUPB 4F91B 1EH7A 4RTZA 2A69F 2YDLA 1VF9A 3LC0A 2A08A 3EFSA 1UE9A 5KVRA 2XC7A 3QIIA 5EGOA 1GDTA 3JV3A 3KP7A 2RHQB 5AIQA 4EGYA 3QYBA 2H3EB 1P4XA 2JVVA 2JM8A 3AFHA 2CV1A 1BU1A 3A8MB 2LJ3A 1F9NA 1BJAA 5KYUB 4Q5WA 3JCMd 1VQMA 2KT0A 1BBWA 4WI1A 1ETXA 2M0MA 2LBFB 5K7FA 1WZ2A 2BZ8A 3VS3A 5KCMA 3CEYA 1WYDA 4A5MA 4ZYHA 5DM6F 4RMOA 1RESA 1M90U 2KFDA 2V26A 1XGNA 4XBFA 1OPCA 2L8DA 5FLVA 2GQVA 2VL8A 2HSPA 2GIVA 4RGUA 2QKLB 3FKJA 2UXNA 4KIGA 4LG0B 2AHQA 1YHQI 4KISA 1LDDA 2SRCA 3RERA 4U0VA 2CH0A 3G4SQ 4ETSA 3CMAT 4A53A 2LDMA 2RA2A 1R22A 4IQJA 2LQ8A 4BI3A 3OOUA 4MDWA 3JB9G 4IIOA 1FOYA 1P7IA 3V4GA 3UDCA 2V1UA 1GFCA 3UPUA 2CJ9A 4BJ6C 2LFBA 3VYHB 1EH6A 2RKHA 1TQMA 1SAUA 2LC2A 4S0HB 4CCMA 1PP7U 2VOOA 1AHJB 4RBOA 2PUKB 2M30A 2L3SA 3W6JB 4CH5A 3I56A 2E70A 4CSWA 2HBPA 1D0ZA 1Y0UA 3CCEA 3OYDA 4AFUC 1YN8A 4E47A 3TDUC 3DKXA 1DDNA 3LSMA 5D6FA 1QQJA 2CT3A 2QYZA 4BE0A 2RJFA 3E19A 3ME9A 1XQHA 4BL0B 5C4XJ 1NH3A 3BC8A 4FYXB 4S05A 4MNUA 4MZPA 5GANj 4B43A 3ER0A 4P71A 2V1NA 1F1ZA 3LSIA 5HGQA 1P4WA 3BQZA 1JJCB 3GVAA 2EV5A 1O57A 3S93A 3VS4A 4P9UA 2DFUA 3V8KA 3O6BB 3VS2A 4BXUA 1IUYA 1N75A 3U1KA 1V1CA 3ZN1A 2A7YA 1UHMA 2DFEA 4A4FA 1ZARA 2I4LA 4EMSA 4CH4A 5C52B 3HOUJ 1YI2T 3TOBA 2DK3A 3BQYA 1XN7A 2C06A 3JRCA 3WTWC 2VJJA 3OWTA 5GAEJ 3CD6I 2D2WA 2EZIA 2BYVE 4EJWA 1ZAOA 2XV4S 2E60A 3PIOF 1YCYA 3X28B 4KR2A 4RM2A 2ALYB 1H4QA 2HWVA 1VFCA 2YRVA 4ESRA 3RR6A 4WXDA 2XGEA 4JK1X 4RAFA 6PAXA 3H5NA 3OS5A 4RTYA 3DEWA 1ENHA 1I5OB 2OX7A 4XU3A 5FU7C 2EIKH 4BI4A 5FLXE 2XI9A 3JCMh 1KJWA 1QVTA 3QYEA 1N5ZA 2XHCA 4YRRA 2M4KA 2MA3A 1NYGA 4Y33A 3S2DJ 1YE9A 1NZ9A 1QF6A 3ZMVA 4MZTA 4N4NB 1LOJA 4D8KA 1E24A 3HP9A 1OCOH 2O3FA 3QU3A 1QZZA 1ZKGA 1QW1A 1U1SA 1RPWA 4JZ4A 4P5NA 5L23A 1KD1U 4CI0C 3CC4T 1B72B 4CICA 3ABMH 4EDUA 3CCVT 4XLPF 1BR1A 3T5XA 1PWTA 4RB3C 2K3YA 1BA5A 4M71A 1T33A 4MLOA 2W84A 3IH2A 1XSVA 1IRZA 2DL3A 2I4NA 5ELNA 3CC7T 3K1MA 3CJNA 2DDZA 2RNJA 2FPFA 3DP7A 5GAOm 2D45A 4ANJA 2GTJA 3HFZB 1VYVA 1JKOC 1VQ7T 2O88A 3T0YA 4M3BA 3RMQA 4CS4A 3A8GB 2OQRA 4LLGF 2K5CA 3FISA 5ILVA 3BTJA 1FYKA 1V76A 5GTIC 2R7WA 1Z9CA 1IRGA 1X2NA 2DJNA 1U5TB 4OMYA 4IQ4A 1BW5A 1JKQC 2KZVA 2VC0A 5CPRB 3NMZC 4C0FA 2VC8A 2Y4YA 3DBHB 2FG0A 2EV6A 2LVMA 4ITVA 3A8LB 3G7ZA 4NB5A 1X2KA 1KMNA 2QEXI 4WJ3M 5B3SH 3ZCOA 1JJCA 4E70A 3JSCA 3SXYA 4O3MA 1R00A 3HSEA 3G71Q 1R9TJ 2O8KA 1JTXA 3KZZA 3HXLA 4LXCA 4BXFA 1WHJA 3DQVC 2KDOA 5LGTA 3X24B 1Y96B 1G3TA 1IZ1A 1TUCA 3OW2P 5GAMe 4BE1A 1QA6A 2EYYA 3JRDA 1XPXA 1IF1A 3VWBA 1RUWA 3A1PA 4J7FA 4JLIA 3RESA 1WRJA 4XTVA 1R36A 4XK8E 2BY1A 4G12A 1CKBA 4N4OB 4II1A 3ZBDA 3JCMJ 4J9DA 1A6QA 1XDUA 2COMA 2DBMA 4RCBA 3PO2J 4TWAA 5JLXA 5JR3A 2NVTJ 2Z0WA 4LD6A 4EX5A 1W2BA 1AOJA 2IG0A 1I0CA 3G71I 2JTEA 2X4JA 4HDUA 3EUKL 1R1TA 1TWFJ 1D3BA 3G1MA 3LL7A 2ZT6A 2DT6A 2LMJA 3NPFA 5IT9Z 2F48A 3H36A 1QE0A 4TVYA 1YJ9A 5KYNA 2ZC2A 2H6CA 3LSSA 4A6DA 1I8FA 1Z6RA 2LR8A 2RNAA 3CMQA 2L5QA 4YIRX 4U0WA 1FOXA 4MFDA 5IXBA 4CRIA 1VQPI 2DYRH 2E10A 3KXTA 2LQNA 2XD0A 5GAN8 3FDYA 5GANg 3L09A 5LLQA 1VQMI 4ZTZB 1W5SA 3H41A 1SD5A 4M74A 1K76A 3L2CA 2FO0A 3AKZA 1SFKA 1XGSA 2DPUA 2X3XD 4DQ2A 1IL2A 4N9IA 2YLBA 3ZMDA 5GAGJ 2DL8A 2HS5A 3NTIA 1HSJA 2QSFX 3OA6A 1P2FA 2Y69H 1BBUA 3I5SA 2BY2A 3CLQA 1YJ9I 4JUVA 2IJLA 3LH0A 1BI0A 3HBLA 2RMOA 4RG8A 4EPCA 3RZDJ 2Y31A 3GTOJ 2IVMA 5JFRA 3NAUA 4NUBA 2XGTA 1HQCA 4ZYDA 2CFOA 1BW6A 3CDHA 4BJTA 1U3OA 5H20A 1MBHA 1QPMA 3F72A 4KT6A 1IHVA 1SPKA 1UHCA 4JJBA 2DU7A 2GIZA 3HB9A 1MHNA 1UCRA 2QK0A 4N0AC 3JCMe 4I76A 3BLYA 4UVCA 1JO8A 2XGXA 4HVUA 5FFXA 1YITI 2VQGA 2HDCA 3S1NJ 4EQQA 3EYYA 2AZSA 4C5GA 3NEMA 1HW5A 5HS8A 3RKXA 2LY9A 4F7UF 3JRAA 3HOXJ 4XKVA 2XPWA 5GJVB 4YRMA 2D8HA 2PVDB 1ZBXA 2EYXA 4FT2A 4IIMA 5LEJA 3JCMg 3AHUA 1FMVA 3SB2A 3CPWP 3J7AF 1C0WA 2L2PA 2ZT5A 3W2WA 4RB0A 3LA3A 11ASA 4RB2C 1QHGA 4XOTA 4BQOA 3KUFA 2KHMA 2HL3A 2ZTGA 4YCWA 1D09B 4BBRJ 1T38A 3DSQA 3M0TA 1X75C 1YWPA 1G4DA 2D6FA 1KSWA 1GLNA 2XHKA 3SDBA 5M3FJ 2FHDA 1UB9A 5M5YJ 1EF4A 1W2BS 3M4QA 4P3OA 2ZCWA 1HYOA 2IA0A 1Y96A 2D9TA 2L2OA 2EQIA 2WAQA 3H0HA 1IW7F 4R8HA 1TNTA 3KEYA 3P8HA 2AQFA 2L0KA 1AWCA 4LG3A 4ZZLA 2Y90A 1D1CA 3LSJA 3R07A 1BIAA 2FRHA 2W10A 4H2TA 1OCTC 3MF1A 4BHCA 1WFXA 2LF7A 3V7RA 4UUSA 3OS1A 1IDZA 2DK8A 1MMGA 4F14A 4L0ZB 2DILA 3ZXSA 4DYRA 2HNIA 4KNYA 4HV6A 2LQKA 3GTKJ 2LYCA 1Z7NA 2GBYA 3WQZA 5F6FA 1OFCX 2IY5A 4BQQA 1E2XA 4II2A 2CUEA 1R0BG 1N25A 3EH2A 3WVDB 4DYQA 3G4SA 2IGOA 3QRFF 2A37A 3HHTB 3MHXA 2XB5A 5B66C 3RNJA 1IV8A 2OPTA 4HPQA 2HOTA 1IN4A 4JX6A 1QVPA 3VJPA 2NUZA 4Z02A 2JA5J 1QKXA 2ESWA 2RC4A 4BUPA 1YIJT 4RGSA 3GW2A 1GT0C 2X4YA 3HFZA 3HHHA 1T08B 3K1PA 5EEAA 1MBFA 3HOTA 1SMYF 4LD5A 4B8XA 1U06A 1J59A 3EG0A 2M8EA 4M75A 3OD1A 1KU2A 3IH3A 5HLTA 5FLXK 2YU9J 1GL5A 1PP8F 2ZNIA 2GOMA 4G94A 2ENMA 3U21A 2A6EF 4DA4A 3CCEQ 2DETA 2J06A 4LFUA 4C8QE 1XC5A 4XLHA 4AIJA 1V29B 2PX9A 5J47A 4KA4A 5HY6A 2R5MA 4M7AE 4P73C 1UHWA 2A6TA 4GXOA 2KRNA 2M1HA 5I11A 5K5RA 3I3LA 1UZCA 4PZJA 3GWZA 4X6AJ 2EQUA 1G5IA 1Z7MA 2FEIA 2CZ6B 3MZ8A 1YIJA 3F21A 4BKXA 1WVRA 1JGGA 4KUIA 2QHUA 1BBYA 4XTWA 4MEYF 2NXNB 1ZSZA 4LB5A 3JCMb 2KY9A 3QO3A 3MFKA 2HQAA 2K9QA 4D6WA 5KE2A 2VQLA 3C2GA 5L3BA 2RQRA 4C92B 2DU5A 1JU5C 5AIPA 1HA8A 3JCMQ 1YCSB 1ZSZC 4L5IA 2X3WD 1KC8C 1G2BA 4L5JA 1MH4A 2HPIA 5FLXZ 2CZ0B 4MQVA 1VUBA 1QNTA 3HPHA 2EGCA 4UNOA 3FXJA 3OYNA 1B4AA 1FOWA 3GTQJ 4J00A 2DVJA 2E65A 1G3YA 4IF4A 4RA2A 2M0YA 4OMPA 1VQNI 4FISA 3SWNA 4PJOA 2JUCA 3ZQ7A 4V2SA 1VQOI 4XNFA 1Y07A 2QHSA 4DOZA 2E2IJ 3ABKH 2BE7D 3WGGA 4B47A 2F5KA 2BW3B 4GRIA 4CGZA 2J6OA 4RTVA 1ZGAA 3FMQA 3J80K 1X1BA 2R5ZA 2EBIA 4J6WA 4XR6A 4XONA 5BPIA 1SD6A 3HL8A 4RDUA 2DPPB 4LIUA 1R1UA 3W6VA 3TBIA 5HNFA 3HOZJ 3ZMZA 1LNXA 2E12A 3ZOBA 5KE3A 5DEQA 5BPDA 1B9MA 2CSIA 1G6NA 1XB4A 3ASNH 4F93B 1FIAA 1NG2A 3MEAA 4FIBA 4O2DA 3UFGA 3I71A 3WU0A 2DPDA 3NTKA 3QWXX 1Z7UA 5HDGA 4F7UE 5E17F 2DQRA 3EGXA 1XNIA 1HKSA 4M7DA 1ETWA 3KLOA 2O8XA 3QPLA 3UR3C 2WC2A 1LFPA 2X1DA 3CCQI 1W36D 1B70A 4CYCB 2JS0A 5I2MA 4LK1F 2Y0SN 3RCOA 1KU9A 4MHGA 1T39A 1WSUA 2K79A 4PK4A 3URGA 3VU3C 2QSHX 1SMTA 4WCIA 2EL9A 4L6V5 4UB6C 4IHVA 3A03A 3OL4A 3J80Z 1W70A 2X4WA 2JTMA 4MMLA 1NG6A 3I5UA 4M78F 4C8QC 5HDNA 2ZR2A 2XDDA 1ERDA 3DKWA 3PIPF 1T8IA 5J8FA 2HQRA 1Y8RB 3OSFA 2QTVA 2ROTA 4TVAB 2CSOA 2VQHA 2D1XA 1USYA 1T0JA 4XRMA 3EUHA 4K2EA 2XDPA 5AT1B 2A36A 5LJ5d 3IKLA 4K88A 1R58A 4YFKF 2AZVA 2OA4A 1UJYA 1TS9A 3REBB 1YIJQ 1ITYA 1FTZA 5HDKA 4KIBA 4M3GA 2DE0X 3EUHC 2X4HA 1ORKA 2EPDA 1OJLA 5KYWA 3JAME 2V9PA 4Z89A 2LY2A 2H09A 2HTSA 1OV3A 3M0PA 1WA7A 4FQGA 5C51B 2H6BA 4C92D 2R7VA 1E6GA 3J7ZI 1MGQA 1T3SA 3BWGA 4BD3A 3WODF 1BB9A 4M75E 4MMKA 1WZOA 3A31A 2FE3A 4M73A 2HKQB 3KETA 3QOEA 1JJ6C 4OB1B 2PN6A 2R7UA 2BTTA 4J9HA 3GP8A 4J9IA 1KOGA 5FD6A 1VQ8T 4C92F 1WLEA 3E9HA 5HLGA 3WG9A 3GTMJ 4KH0B 2PMEA 3JB9J 3F8FA 2IY5B 2OCCH 4DBQA 1DUXC 3TW6A 4EO4A 1KA8A 4W97A 4C0DB 2HGCA 3M9QA 3IH4A 4YFXF 3S32A 4YELA 4AFZC 1UFMA 2HFHA 4XEOA 3OW2A 2HOAA 3E3VA 3GFJA 3M1CA 9ANTA 2J05A 4FTHA 1PCXA 3VSKA 2I4OA 5LBQA 1ZK8A 3ABLH 1Q95G 1YQAA 2F2WA 3CD6A 4A3MJ 2NS0A 1U8BA 1VYUA 5DD4A 2JM9A 5C3EJ 2RI3A 3BTCA 2ZCFB 1MBJA 1X4PA 3OYKA 3SWNC 3VS0A 3M8JA 4AG1C 3DLLA 3HTZA 4B1RA 5ILUA 3FM5A 3OIPA 3MD2A 3I55T 3CMET 3E9IA 5K1PA 1VQ5I 2C0OA 1AU7A 2ZZGA 2E1MC 4KICA 4AT1B 2JJ7A 2PUOB 4LDWA 2O7OA 2PJRB 3ZQFA 1IRFA 2HQNA 3H8ZA 4M7AD 4HSRA 4AC0A 4IJAA 1K73U 3UH0A 1XMXA 4EGZA 1D8JA 2QA4A 3MEUA 2Y4XA 3FLGA 4ELYC 1K8AU 1U5SA 4C92E 4CS2A 4V19K 3DXJF 5DV5A 2PQ8A 3IUOA 3QYGB 4YTLA 4DBFA 1U9NA 1YGBA 3B6AA 1QP3A 4C3IJ 2V8KA 2HR3A 4PJOG 4YP0A 5GANf 3OMCA 2J7IA 1GV5A 3I56I 4M7AB 1VQLQ 3HRIA 3UA6A 2XF6A 2IEKA 2TDXA 1TUGB 2PJPA 4F7UA 4FE7A 2Y30A 3VUZA 1WJFA 2JUGA 1X1CA 5FKMA 1NG7A 4EJUA 3ZGKA 1WJDA 2VPRA 2BHYA 2JVHA 5FFZA 5LHIA 5FRNA 1NEBA 3CCSI 3TQ7P 5IPAA 1ETYA 1R5ID 4A6EA 2GBQA 1T6SA 1TWGJ 2UZKA 2RI5A 5FU7B 2XASA 2K5LA 2ZZEA 4IURA 3K70D 4L18B 5LRSA 4HVVA 2JPBA 2LNVA 1D8KA 4J6XA 2J3MA 2FZKB 2RK2A 2VKEA 3A0HC 3QYFA 4ZDLA 1UG0A 3HFNA 3X20B 1OEBA 1GXIE 3QP5A 3P9KA 1FSHA 1X2QA 5AONA 2GCXA 4JJDA 2CQNA 2R7FA 3BR6A 3OIQA 3WGIA 1K4TA 5EDNA 1MSEC 1MNEA 5A2QZ 1E7OA 2X35A 2YWWA 3CXCP 3TL4X 4GO1A 1RI0A 1SESA 5EG0A 4YCVA 1HDPA 4GY5A 1Y8QB 3MN2A 4TVAA 4LNPA 3QPTA 3EUAA 4A3CJ 1DGRM 2DOEA 2R4GA 3A4CA 3GUDA 4A69C 2IVWA 4JS4A 3BG6A 1VQNA 3M8FA 5J4YA 2A05A 2VASA 2GQQA 3M4GA 1WPYA 3NGPA 3PFSA 2VBXA 1MNDA 4A0ZA 4H0EA 1WU7A 2F4MB 2JQ7A 2B63J 1GCQC 2LKXA 3WHCA 2C0IA 3U1DA 3T8RA 2RQUA 3EGDB 4TQDA 3CBMA 5H6QA 2VKNA 2A5YB 2JN0A 2EILH 3H0FA 4A93J 2DI3A 2P4WA 3MF2A 3DFGA 3TO9A 3H9GA 3OR1C 1OISA 1SAXA 1C1AA 3O8VA 4M77E 2ODRD 2R5YB 3MKLA 5A2QK 4YRJA 2KPMA 1ZG5A 2RHXA 3MKDA 2QA4Q 2H94A 2F5VA 1RACB 1ZLMA 3HOSA 2NYSA 4M4ZA 2ZXIA 3CUQB 4XLEA 4PFPA 4OAYA 3M7GA 5CQXA 1KD1C 5GMKi 1MNMC 4PLLA 4XORA 4HWPA 3CCQT 2X48A 2KL4A 3BPVA 4E7LA 3PSIA 1R77A 1YFNA 1EA3A 1QZYA 1RL2A 1FYMA 3VOEA 3BW1A 1KYWA 4G6QA 1BR2A 2VBWA 3H3UA 1W0TA 1ZQ1A 3T1BA 2DRMA 2K6DA 5L3DA 3FRNA 5FKNA 3G73A 5GAOp 2OCEA 2EGAA 4PJOD 5D5WB 2B9SA 4UXNA 3I4NJ 3JTHA 1AKHB 1S72T 2ZNJA 2FVUA 3KX2A 4A3KJ 1BOAA 2RNGA 2MIOA 1RLPC 2COBA 2CH4W 1H4VB 3PL8A 4DPGA 5HODA 2CH4A 5GAN6 3QJYA 4I01A 5FO5A 3DBLB 5EZGA 2QGGA 2CWEA 4EMKB 2M87A 4M72A 5FU6B 1JUMA 2G7HA 3GZ5A 1KQ8A 3LWHA 3GFMA 1J09A 2I8DA 2Z1DA 3L2VA 1AVZC 2AT1B 1MDMB 1VQKT 2K9SA 4C8QA 3UGQA 4R0KA 1WH5A 2ROLA 3JB9I 3MCZA 3S6WA 4NQWA 4BDYA 1NPRA 1EVKA 2ME0A 3KYDB 4D0PA 4L9VA 4CA0A 4YRVA 3OYFA 2QA4I 2BVLA 2DD5A 3OYMA 4ORZA 3ECOA 2I2LA 2BKDN 2DTRA 1USYC 1IN8A 1WPKA 3SEZA 3H9QA 2EJGA 3CQZJ 1MJBA 5CJ9A 4J9CA 3E9FA 4X9DA 1QPIA 3HPWA 2PTKA 1R4MB 2HXIA 3VS6A 5DM7F 2J5OA 2K02A 2XKOA 4YRKA 2HQXA 2XAHA 3VFZA 2V4JC 1T56A 2LJ1A 3JR9A 2YUNA 3O8HA 4WF2A 3C95A 2RHUA 1AD5A 4XTXA 3ZQLA 3CPFA 3EH1A 4ZN3A 3A5ZA 7AT1B 4N4HA 2JA6J 1VQLT 4IXAA 2E1HA 2HOSA 3RF1A 2VJIA 2FB7A 3D0SA 4OMOA 1E22A 4M75D 2EV0A 4Q47A 5J1UA 1JJ8C 2GOXB 1MMSA 4ZDOA 5E3MA 1NLOC 2FOWA 1CF7B 3JCMf 3V8LA 4E7KA 5B5EC 3L9FA 2WB1A 1OULA 4ZGEB 1CF7A 1ZN2A 2E19A 3E97A 2IPOB 2LTOA 4C8QG 5KNLA 4WK8F 3FEOA 3SDZA 2OTJQ 2QGUA 4PJOF 3RJPA 5LGUA 4A3DJ 2ISZA 4PJ0C 3DTKA 3JSPA 2AKLA 3QO5A 5IYCJ 4IPAA 3MO8A 4BXXJ 3ICAA 4MTDA 1VQLI 3I55I 3EDPA 3CMEI 3OMYA 3K7AJ 2TCTA 2NVXJ 3P8DA 4YRQA 4RMNA 1K1ZA 2FSWA 4CC3A 2BEOA 3E5XA 3OYEA 2E2HJ 5IOZA 2Q7EA 2FMLA 2CUDA 2GTOA 5GTHC 3CCLT 4Q48A 2IW5A 2ESHA 1EFWA 4B09A 2HTJA 4HLYA 4U88A 5D5UB 1JKPC 1YOVB 4I09A 2A07F 2CRGA 2K9GA 2OQGA 2DIQA 4NOYA 4KFCA 4PJMA 3RPUA 2IIMA 4J8OA 3EAEA 1ZQ3P 5EEHA 2FEZA 2IP2A 2DU9A 2LKSA 1H9GA 2L9VA 2DXTA 4LD9K 3VS7A 4E7SA 2XKPA 2XSDC 1WI9A 5CVIA 4X0GA 4X1VA 2A61A 4XU2A 4EEFG 2XF7A 4I99C 2LH9A 4E6KG 3AG2H 3GTPJ 4HSTA 2DT7B 4M6YA 2MMPA 4VUBA 5EF6A 4BY6B 4C0DC 4OMMA 4MIMA 3L7WA 3RDVA 2MWOA 5JHFA 2V1XA 2Y48A 3R0JA 4CYDA 5LJ5h 2QTXA 4CYCA 1KZHA 1MH3A 2MBFA 1VQ7Q 1RIOH 2ZPFB 4PHCA 4XIDA 1FBUA 1MGTA 1SSHA 3TVTA 1X2GA 2AHJB 5CCAA 2XB0X 1JJ2S 3RYPA 1Y7XA 2JZ2A 4AVPA 3U2RA 1V3FA 4ZTJA 3EETA 3EG2A 1M90C 4LOCA 2Q7GA 4Q6GA 3T9NA 3ZQGA 4IUPA 1OYXA 3UNGC 5GANd 2PMZN 4IOCF 2NUTA 2L54A 3UATA 2W82A 4BB7A 2JA2A 5HKCA 3CO6C 1K9MU 2VXZA 1USSA 2PBIA 4QTRA 5GAN2 2WTEA 4H2XA 4LVLA 2RQWA 3F9KA 1UG1A 5GPAA 1RADB 2MSYA 1JT0A 5LD2C 1FBSA 2ECCA 2FL7A 3HY1A 1SVOA 4O5VA 2OUMA 4AD9A 3J7YJ 5C44J 1R71A 2AMCA 1W6XA 1QVGA 3IKVA 4FHTA 3M55A 4AVZA 3CCVI 3CC4I 2O6GE 1FEXA 5J39A 1JJ2P 3TEGA 4UB8C 5FB2A 1KHIA 3M9AA 3VODA 1IZ6A 1FJLA 3JCMV 3MAJA 4D5CA 1NLPC 4R55A 5FWCA 3CCJQ 3DPLC 4PDKA 2R5AA 2YXYA 3K4MA 2ALYA 1M1KC 1U2WA 3IC7A 4WTOB 5EC7A 2JS2A 4F7ZA 4M78C 1GCQA 2JRMA 1WHKA 2AMCB 2WV1A 3E5UA 1GHCA 5EG0B 3PT9A 1ETKA 1WJQA 2DXCA 3VPRA 5LGNA 1LCKA 2DA5A 1Y57A 2W24A 5D6XA 3IALA 4HVWA 1X69A 2IS4A 3LFKA 3I9QA 1SEMA 3PVLA 5CO7A 3S15J 1VQMT 1FC3A 1QVFS 2ARSA 2HYGD 3CCQQ 1FPQA 2ESNA 1QVGP 2NYXA 2VUBA 2O01E 3L2QA 1HSQA 1OYWA 2CG4A 5E3NA 1O7FA 5F08A 3H0DA 1ZH5A 4BUGA 4JYKA 3CCMA 2X9DA 1Z77A 2M34A 2PMZA 1YFHA 1UGSB 2M02A 2GXBA 2QI2A 3CCYA 2ACJA 4HCKA 5IXFA 2DL4A 3GNFB 2GXAA 3I59B 3HZJA 2OI3A 3KIOA 1I1JA 2O4XA 2O4XB 2RHZA 2K85A 2GWRA 3AG3H 3HKZA 1TLHB 3TKYA 4KMUX 1V55H 4EJTA 2VXFA 3IG2A 2R0QC 2QBYA 4C92C 3JB9D 3QG1A 2CV2A 4NC7A 3RQ4A 2VOPA 4M78D 1WHGA 4YIFA 2ZNYA 2DMUA 5E1WA 5IHNA 3EGDA 2DEUA 2IGNA 5J6XA 1MBGA 2E3HA 4XU1A 1KQSA 2L0AA 2BGCA 1EX4A 2YRCA 2KRCA 4IUUA 4EMGA 3PMTA 3HFOA 2KRHA 4LVIA 1WWXA 5D4RA 1NK3P 2WY7Q 3FM3A 2E35A 1B1BA 1MKMA 3FBIB 3K6GA 3CESA 3LSTA 2MH2A 4J9FA 3HSFA 2KYBA 3WTXC 2GM4A 1BYMA 3WU2C 3CCUA 3GOXA 2QYOA 4P1WA 1H88C 4IHWA 1U9OA 2BOLA 3C94A 3C1DA 3MEXA 3U9GA 4C8QD 1ASYA 4ESFA 3HXUA 2VE8A 1Q81U 4BJ5C 5BOXA 1YS6A 1SRMA 5KYYB 4FYVB 4BE2A 1H9TA 3MMYB 4IO9F 1IGQA 1M3BA 2JJ9A 2P0QA 3E6CC 2EFPA 3O2PE 3EHRA 3G1JA 2MPXC 1ASZA 3ASOH 4G6DA 3OBWA 1O3RA 2GQIA 2FMYA 5CVUA 1ZHIA 5GAHJ 3HTSB 3VQWA 1ACIA 2FOKA 2PZ1A 3G71T 4PCQA 2J5PA 1UTIA 2WAQN 1K6YA 1ZRCA 1F5TA 2NVYJ 2DM1A 3KP5A 2P8TA 5CKDA 5KAFC 2HVSA 2Y0MA 4H2XB 5D8KB 1FMWA 2HYFA 2IA2A 2X9HA 2XRNA 4QQDA 4E51A 3A5YA 1X1DA 3TO6A 2EQJA 1MJ9A 2BXZA 3HM5A 4V2FA 5LFAA 1HCRA 2HVRA 1FSEA 3OYHA 3GTGJ 4A3LJ 1VQPT 4HAMA 5FW9A 3HIFA 2LX9A 2XROA 5F0HA 2L9NA 4GYIA 4EATA 2EFWA 5KYXA 4RQEA 3O3KA 4I98B 1VQMQ 2FQ3A 1X56A 2Y9ZA 4N4IA 1IGUA 1YFRA 2K2MA 2V1QA 3SFIA 3HRTA 1VQOA 2VXEA 4AYBN 1G51A 5CVJA 4GFBA 2DAOA 2R92J 3NHNA 3BR0A 5CQYA 4BHBA 4M7DG 1ODDA 4MZMA 4CCNA 2O2OA 1VQ6I 1RAFB 1VTNC 3CJRB 4X1EA 2YS9A 2YUQA 5DTDA 3M07A 2ZMEB 3O8GA 4PSWA 3ZRGA 5CIUA 4X34A 3D5RC 3BTIA 2EH3A 1LDJA 4PJLA 2C6YA 3VKIA 1MDMA 3BZKA 4NDLA 1VQ4I 2EJFA 1SEUA 2ATCB 4YG2F 3GXOA 1H8KA 5KCHA 1B07A 4Z8AA 3DCFA 2W48A 1X1AA 2KK4A 4F52A 2M2EA 1FZPB 1ZUUA 3QZ9B 2KISA 1M1FA 1YX5A 1S3JA 5GMKe 3HGGA 1A0NB 3E9GA 4QVDA 1JI8A 5JVTA 4C3HJ 1VA7A 2QDLA 3OQ5A 3TUPA 2L9RA 3CF2A 2L7FP 1QLYA 2AIRB 2BUDA 4PJOE 5K1XA 1AKHA 3LSHA 4KUMA 3UWNA 4A4HA 3I56T 2DK5A 1GUUA 1S5LC 2ZXJA 2XKOC 3P9IA 3DEUA 2CP6A 2Q5IA 3OSVA 2KAFA 1CSKA 1YJWA 3FXKA 4BU2A 2VC1A 3LSGA 1ZTRA 1ZUYA 1MMAA 5GP9A 2CV0A 4ENNA 3LSPA 4CZCA 2JA8J 2P4TA 4E7JA 1PUFB 3N5BB 4DBHA 4NC8A 3PNYA 1I81A 4AWXB 2K57A 4D8DA 3NENA 3GBQA 1IN7A 1W7PB 2NS8A 3HEFA 3TP3A 1X27A 1WHUA 2RM4A 3U23A 3JCMP 3P7NA 2DTIA 3REOA 4OWRB 1N9RA 1QBJA 2R5ZB 4CC4B 1TW2A 4ZDPA 1HJDA 4IEJA 4RGRA 2XMFA 5IHKA 3HSBA 1M1KU 5ICCA 3D7SB 4J6YA 2QUFA 4M6VA 1VQ4Q 1IUFA 2PEXA 3BOQA 3DBRB 5DS9A 2AS5F 4U7DA 3J81Z 3CCRQ 2KRSA 2DERA 1AZEA 1RI9A 1I1GA 3SD4A 2FA5A 5TISC 2EJ9A 2J6KA 2V79A 2Z5UA 1SD4A 1LFUP 2BE9B 4JRKA 4L59A 1JKRC 4RTTA 1LJ9A 5LJ3e 2BVMA 4HA8A 1O3SA 3A5ZB 2Z3YA 2FD5A 2M9UA 1VQ7A 2CP3A 4P72C 3MPUB 3BTLA 2N8GA 3GO5A 5DCFA 1DP3A 2E7WA 2MWPA 3GLLA 3KP3A 5KYYA 3MEYA 2QWWA 3SDGA 3DKYA 4PNOA 2ZZFA 2VT2A 3DU5A 1FIPA 2XUBA 2JSPA 2RQQA 1ABOA 4C2MJ 2W57A 3DWLE 3L2RA 1B3QA 1LFBA 1PSEA 2ZIMA 2Q1ZB 5LRRA 1NJ5A 2KRMA 1VQZA 4EMKC 3JAMK 2DFHA 4M78A 2DA3A 1HKQA 4P74C 1E0EA 1QO0D 1JHFA 1I5LA 4ON0A 2XPVA 4DOVA 4EMKA 5GAOl 2F2XA 3I35A 3W6KB 3OYLA 2NVQJ 3TSZA 1RAIB 3DLLF 2DN0A 5B1AH 5C53B 1X3ZB 2JUFA 3F22A 1HLVA 2EZLA 1ZSGA 3JCMc 4XQFA 4Y4RA 3H92A 5IT9E 4C2TA 4IRIA 3B02A 5LJ3g 1YLFA 2BW3A 1R5HA 4TVRA 3TDZC 1LVAA 2PVOB 3NFCA 1YBYA 3P8TA 2FUG2 3UKGA 1B59A 1YHQQ 1B7TA 2NOGA 3KCCA 1RI7A 3N4MA 3D5LA 4BH9A 2IRFG 1JUSA 1FLIA 1QCOA 1WI7A 1XTDA 2E1NA 4R79A 3IRQA 2RK1A 3M0SA 1NJ2A 2LJ0A 4UUSB 4N4GA 3CXCA 3LNQA 1JHHA 4HYEA 2DAQA 2DYBA 3L2WA 2DA9A 4HCCA 1K4US 3BDDA 3RPQA 4XU0A 1F36A 2EA4A 4D1QA 1YW9A 2OAWA 1NJIC 4C92A 4NCXA 3CUQA 4BQAA 1T98A 1UDLA 3ML6A 2F4OB 1JXOA 1KYZA 3THKA 2F5DA 3PUBA 3BJOA 1TP4A 1D5VA 2K4YA 3CJTB 2YPRA 4JOMA 3LSRA 2OD5A 4GYGA 2VQCA 2P7CB 1KHCA 3K0LA 4UUVA 3CMAI 1S6LA 2XPUA 2H8RA 3RI4A 1AHDP 1PD1A 2KVQG 4AMCA 3S17J 3CCMT 2KP6A 2EAYA 4YRFA 1GBQA 2XAJA 3QXEB 2DLPA 3HC7A 2DA2A 3G6EI 1APLC 1FYNA 3B6CA 2VPLA 2X6OA 3CDIA 2K9NA 1Y71A 2HD0A 3I7FA 2YX7A 1MBKA 1HDDC 4ZGDB 2H1KA 2AKWA 4ZTUB 4FSSA 1UUEA 3VV0A 5KK1A 4XSXF 4A4KA 4A3GJ 3LSKA 1YI2A 2M5WA 1N6AA 3FXMA 2LP0A 3IAS2 4N0BA 4U87A 2XG8D 3R0AA 5EJCA 3BJUA 4RQFA 1NE8A 1FNNA 4BI8B 2QHTA 2XU8A 2VODA 1POGA 4J9GA 2E71A 4UHTA 3TREA 2FU4A 1ETQA 1WJSA 3LYIA 4KYWA 5F27A 4Z88A 2X1CA 4PSXA 2RHYA 5ICGA 4ZC3A 2LBFA 4G9YA 1KFZA 1OMIA 1RRJA 4XKCA 1VQ7I 4GLMA 5GAOr 1R8OB 3CCJT 2H1LA 1YO5C 3CCST 2M8GX 2PFBA 1Y0NA 1WDXA 4CHUA 5FKOA 3CCUQ 1Q82C 3E1SA 4B9WA 3LWIA 3IKMB 2R7RA 2WACA 3PNWC 4CH3A 1XSDA 4R1HA 4GLKA 2O9LA 2I5UA 2ZXHA 2P5LC 4GDFA 1ZG3A 4RGXA 3MKWB 5D5VB 4UUTA 4C2UA 2F69A 2UV1A 3NTHA 1V5GA 4OMFB 1VQ4T 4A0XA 1Q82U 2ED0A 2LLKA 2XK0A 2VKHA 3Q0VA 1ACMB 2HBWA 4BYYA 3KP6A 4OVAA 3WGHA 3GIBA 3CC2T 5GAMj 3TO7A 1XS9A 2P7VB 2NOJB 5LJ5e 2GXGA 4H2SA 2EB7A 3QHSA 4XN3A 1B34A 4HEA2 2KQWA 3BROA 1JEGA 3ZQHA 2EYWA 3ZN0A 4A63B 3KFUA 2GFUA 5GAMf 1D3BB 5JI6A 4A3FJ 4KH1B 2KZGA 1IRXA 1OLTA 1UAAA 1OU9A 1I3AA 1W4MA 3Q1JA 3TSWA 2ZXFA 3VSLA 1RAAB 5I22A 1FYLA 1YHQT 2QF7A 5E20A 5IT3A 3BDUA 2XAGA 2UUZA 1ZG1A 2COYA 3BJ6A 1M4ZA 1EKEA 4IHXA 1OX8A 2KBTA 1QVGS 1KQSP 1SFUA 3QTCA 2VUMJ 3C3WA 1YP5A 3UA7A 1M2VA 3EGXB 4QVZA 1VQ8Q 2GLOA 1XG1A 3F6VA 1J7KA 4EIKA 5CKTA 2OTJI 4P9FA 2DBKA 2DX1A 4LVJA 5KYUA 4I2OA 2D1HA 4HRIA 1J5YA 5EG2A 3BG5A 2HKXA 1HC8A 1UGQB 3EG3A 1W5CC 4C0GA 4TTVA 2LNHB 2VBYA 4FCYA 5CKFA 2O0YA 5EGOB 1PKTA 2KIUA 1MV3A 5E8IA 1VQ5Q 2P5IA 3KFVA 1PD0A 2ZJ2A 1R0CB 2ZSHB 4E4HA 1GVDA 1D3YA 4XK4A 4AIKA 1PYSB 1JE8A 2YX4A 2QAZA 4LITA 4XSZF 4PFOA 4RMFA 2VXDA 1WHHA 1NYRA 2M0CA 3F8BA 4NL2A 2OC6A 4QT7A 1RKWA 3LQRA 1YJNI 2WSFE 4BS9A 3M5AA 1TWAJ 3QBYA 2CP0A 3V42A 1LPLA 4OB0B 1E17A 3OW2S 4TQFA 2V8JA 2M45A 5J3LA 4RUGA 3HKSA 3RUXA 1OYYA 4A2UA 1VQ9T 3K9TA 1B8IA 2IS2A 5HK3A 2MLKA 4CCOA 2QASA 2DMOA 2KI7A 2FBIA 4D5FA 1VNDA 2JMWA 3LX7A 2ZAEA 1WQ7A 3CCSQ 3RQIA 3VYGA 3J80E 1HXDA 4G6TB 3RKWA 3Q3SA 2MGQA 2CS7A 4B6MA 3HXVA 1B76A 2CYZB 3M8EA 4P72A 3W3SA 3FDRA 1J9IA 1TG0A 4BDZA 4MFEA 2L9SA 4ME7A 4OGEA 4Z2YA 1NK2P 4OU0A 3QAHA 2JA7J 2E64A 2K40A 3MP8A 2LC4A 2MI6A 4C8QB 2HQHA 3QNEA 3F8CA 1I07A 3CCUI 3BR2A 2JMCA 2F2EA 3BY6A 2DNUA 1NBEB 4QKUA 4CS3A 1RR7A 1G8XA 2QENA 2VB6A 3FXQA 4FT8A 2DZ9A 2QXFA 3E2UA 3GPLA 2X4XA 4IUQA 1IGNA 4IRHA 4OF1A 2ISYA 3S16J 3C12A 1UMQA 3X2QH 2RO0A 1N8RU 2VGMA 1QMCA 5GANe 3TEEA 1Z3YA 3CCRA 2XF5A 2V9KA 1WGXA 1IV6A 4HCBA 1KQ1A 2QCOA 2FRWA 2LF8A 5J40A 4E7ZA 4KN7X 3WTUC 1ZYRF 2LKPA 2QBYB 4M7DE 4P3PA 3FBNB 2ZSIB 5E1XA 1K78B 4ZYEA 2ABLA 1IN6A 1FBQA 3E0JB 3V8JA 1Y1WJ 3DLMA 4JRIA 5M5WJ 1NYFA 1B7YB 4X5OA 2RREA 4YRIA 1P7JA 5D6YA 1MD0A 4A0YA 3N05A 5BQTA 5J1YA 4ZYAA 2K7AA 2K5FA 1ON2A 3ZL7C 1U6GA 2GFAA 3FHZA 1W7PD 2CUFA 6AT1B 1L0OC 1OQYA 3E6BA 2JSCA 2WB1N 3LA7A 2PVGB 3G6EQ 3ULQB 3M3YJ 1TXQA 4BBSJ 1X55A 3L42A 3S2HJ 4Y92A 2P0PA 1AWJA 4HT9A 3FXUA 1B7YA 2IGMA 5GAMg 4M78B 3LWFA 3KZIC 2KLOA 4M7AG 2DYIA 2XICA 2MC3A 3EG9B 1YJ9T 2E5KA 2EQKA 4ATOA 3DF8A 2QQSA 3M53A 1V5EA 1VYTA 3HRKA 1OR7A 2CQQA 2DCEA 4P5OA 2OTLQ 4CO8A 2E1MB 3EQLF 3OYBA 4QLCU 4XRSG 2E34A 4HV5A 2H27A 2DO7A 3MQZA 3M0UA 1X3WB 2KNBB 2KEAA 3CCSA 3VUBA 2DQ3A 1WQWA 1T0HA 3DEEA 2HQEA 1K8AR 2ED1A 3CXCS 3TU4K 3H0GJ 1UHFA 3K70C 2XRLA 2Y9YA 3GZNB 3G4SI 2E6ZA 2ZPBB 3S3NA 3K4JA 1YITQ 2ETHA 1Z1DA 3A8HB 4L5EA 1VQ6Q 2QQAA 2WADA 2QEXA 5DUIA 1LNWA 4M77B 1KC8U 1OPLA 3WTTC 3ERED 1HW2A 1VZ0A 3DB3A 4F04B 4LN2A 4M7DC 1Q7YR 3TEDA 5HCKA 3C18A 4A54A 3CUOA 4YEJA 1ZLKA 1EZZB 5K7HA 3S3MA 2HMAA 2LT1A 2HQ5A 4N9HA 1A36A 1YG2A 4XICA 4DW6A 5JVGF 1MUZA 1NPPA 5CKEA 4EVIA 1W66A 4F92B 4IZZA 1RAGB 4HWSA 5CQGA 2AO9A 2OF7A 4XMYA 4IHYA 3BJAA 1YTYA 1J75A 4BAYA 4E6RA 5GMKm 1PUFA 3BP8A 1I6XA 4YRCA 4QW2A 3HY0A 4BW9A 2UWMA 4M75G 2FQ4A 1H4SA 3CO7C 2ID6A 1UFFA 1N8RC 2A3SA 1OCCH 2M3AA 1D0XA 2DYSH 3PNTA 3GTLJ 3QJ6A 4U0YA 1W5TA 3JTGA 3FIWA 1T0FC 4EJOA 3KYCB 2JNGA 5L3EA 4XTYA 2L3DA 4M7AA 4OGCA 3LQQA 1SETA 3I55A 3CMEA 4DZPA 3QKJA 3TGNA 4XAXB 1YW8A 4M3EA 2V1DA 5IP6A 3QDRB 1KQSS 1H8AC 1N27A 2EYZA 2FZCB 1KU3A 2M4GA 3G6EA 1DP7P 2KMTA 1SC7A 4EM0B 2WSEE 4RDXA 3MZHA 3CD6T 4FETA 1UGRB 2F1LA 3CCLQ 3CZ6A 3E7LA 3WG7H 3DKMA 5E3LA 4J7IA 3C2BA 3QSUA 2JTVA 4IHSA 1UJ8A 4JX5A 5L3FA 1ZHFA 4YREA 1G5HA 1WKMA 2B86A 2EK5A 2ZBKA 1QCFA 1ATIA 3HXYA 1FYFA 1W4SA 5LJ3j 3HXWA 1I39A 3SEQA 4LDVA 5M9OA 5ILSA 2R57A 3MEWA 1M8VA 1SHFA 5GAMd 1MW7A 4L5GA 3L00A 3AL0C 1C0MA 1OU8A 2L3RA 1ZLJA 4HT4A 3CPWS 3PFYA 4YRTA 4PJJA 1MJAA 4JJCA 1IJWC 4EV0A 3SYTA 5ED4A 4DGWB 4U7BA 4GBQA 2EIJH 2M16A 2LOOA 3LLRA 2NS6A 3MWMA 4RAZA 4HF0A 1VQ6A 2KQRA 3HRSA 4LVKA 1FP1D 1XGOA 4JLGA 3IP4B 4WX9A 5HK0A 4R56A 1ETVA 2EKOA 2DOAA 2QEXQ 3GX4X 1F43A 2DXBA 2ZZDA 3CCVA 3CC4A 2G9WA 3SZPA 4LIVA 1KQ2A 2HXOA 5J4VA 4C9YA 2EVRA 2NRAC 5LEKA 1WJRA 4P71C 5JLWA 4ENMA 4HQEA 1K4SA 1BL0A 2KIFA 3JCMW 4HCZA 4GCVA 1G59A 4I7HA 1QCNA 3DB4A 2O5RA 3K10A 2DTHA 1QP2A 5CKHA 1QHHD 1RKTA 1ABQA 2KRFA 3JB9H 1ADJA 2HEQA 1O9SA 3RACA 3CTAA 4X9CA 5ECAA 3IV5A 5GAOn 4DNCA 1A31A 3EFOA 3LGLA 2W7NA 1M1KR 3K1NA 1I4K1 3BR5A 4OIRF 1ZSZB 2F4IA 2L7ZA 2ZNZA 1CQTA 2R7DA 2QGFB 4KT0E 3ZQIA 1VQ8A 1KMMA 4HWTA 4EM1A 3P5JA 1E1OA 4PGHA 1PSFA 3CCUT 3C4SA 1HW1A 1QQIA 2Q8KA 1EV7A 3P9CA 1T2KA 1DQUA 1GXPA 5L3GA 2V1RA 1WI3A 2H3JA 4FU6A 5IYDJ 1YJWI 1M8MA 3F23A 3E6DA 2EPFA 2D8JA 2K7LA 1ZA2B 2M1BA 3M57A 1ULYA 2MCNA 3SHWA 4A4EA 4ELZC 2MFZA 1SVLA 3CMAA 1I1SA 1R23A 1OCZH 2GA2A 4L9NA 3KZYA 5CAIA 5I2SA 2M0OA 2GAUA 4W1UA 1JRIA 2ZPEB 2HKNA 3LW5E 3OB9A 4C0ZA 2DA4A 4KITB 3MKYB 1UHSA 1OKRA 4XRFA 4Q5SF 1ZGJA 2ZFUA 3QU6A 2R7XA 2D5VA 2DW4A 1JUPA 2QM3A 4II3A 4Y17A 2CJBA 1SFXA 4XQ3A 1H4TA 2RGVA 1WIEA 3LAJA 3L2ZA 3OIOA 2P0LA 1BI2A 3PCOB 2W4SA 1TQPA 3CCET 3A01A 4M77D 4NNJA 1YYVA 3RBBB 5M3MJ 4IUVA 4QPQA 4AIHA 1IG7A 4Q15A 2KE9A 1Z3XA 1O3QA 2VKVA 1VQPA 1RC9A 3KPHA 2KXCA 1WXUA 1FT9A 3K4KA 2CS3A 3SFMA 2HVQA 2DTZA 4PLIA 2OU2A 1UG2A 2V8IA 2BZTA 5DM7R 2NVUB 1QWEA 4RS8A 1U5TC 2W0ZA 2W85A 4XTUA 3RYRA 1G2HA 3Q0WA 2R58A 3FXLA 4FW1A 1XMAA 5GMKl 3META 2DDBA 3CC4Q 1YW7A 3HTUA 3PFIA 3MJXA 4J83A 3CCVQ 3NETA 4KUDK 2VBZA 2P5VA 2CGPA 1U5TA 4IRGA 1NJ6A 2Q5HA 3CCJI 4HBLA 4HKEA 3CCRI 2XGDA 2DA1A 1Q82R 3SZGA 3BFMA 1EIYB 1X01A 1XCBA 2DLLA 2DMNA 3OV8A 3CCMI 3SJMA 1RUOA 3ULRB 2P81A 2OZ6A 1IXDA 2WY8Q 1XTAA 3UF4A 2CUBA 4YPFA 4HXJA 5HS9A 1Q81R 1A5JA 2RI2A 1CGPA 3ZPLA 3PZCA 3HOVJ 3A7AA 3DV8A 4Y28E 5FKKA 1U3EM 1SFEA 1M3AA 1EQRA 3OYIA 2Y0SA 2EKHA 2RHIA 3K4CA 4ZJZA 3LGFA 3OYGA 4KDPA 2KXDA 1GVJA 3CCRT 1ZBJA 3DPTA 1V5FA 5F0FA 3C0CA 4UC4A 3QDFA 3FK6A 3H9NA 3OR2C 1KONA 4RCCA 4Y15A 4YRPA 3M58A 3PSFA 3M4OJ 4AG2C 2ZCEA 2ZR3A 2LT4A 3G4ST 5DYMA 5DLOA 3CMAQ 1Q86R 4ESJA 1OX9A 3ONQA 3HL2A 2R7SA 1X3UA 8ATCB 2O9SA 4AFQC 4QSHA 3VS1A 3H6ZA 3AL0B 5BMZA 2NUTB 2CP5A 3CC2Q 3RSNA 2CYYA 3Q0UA 2PQWA 1I3QJ 3S1MJ 2HI3A 2EW3A 1TWBA 1SERA 3FJ5A 1D1BA 1PDNC 3FF5A 4LJZF 5GAN7 2LQWA 2P4RA 4HF2A 3ELKA 3G1LA 3HUGB 4BEHB 2RAEA 1JBMA 1OPKA 2EFNA 5EEGA 5IP7J 1XOVA 3TEHA 1Q1VA 4J01A 3SEMA 4DEYA 4TV7A 4LLNA 1N78A 1SG5A 2FZGB 1OYIA 2ME6A 2R7QA 3AG1H 2OZUA 3R4KA 1NJIR 2XAUA 2CJAA 5IOYA 3CMMA 4FSXA 4XLNF 1DU0A 1H0MA 5A0DA 1TW3A 1YRNB 2H8HA 4IUTA 1VQPQ 1WHMA 3W2VA 1LPQA 4YROA 2KMUA 5E3IA 1KK7A 2G6FX 4ESBA 1DJ7B 2DA6A 4CZZA 4AU7A 1YITA 4Y13A 1L3LA 2LP5A 3CBPA 4OIOF 1LDKB 5K7ZA 2G0EA 3OY9A 1X4OA 1DGWY 2LY1A 1BR4A 3JW4A 3SHFA 2LRQA 1MMNA 2MK5A 5GADJ 2RN8A 2VVKA 1YFSA 1BN5A 1SFOJ 1ZR4A 2EIFA 1TQIA 4OINF 4HLXA 2HYJA 3K4BA 3S14J 1ARKA 1ZRDA 1M2OA 3JRGA 3NARA 1YB3A 4H02A 3C2HA 2F2VA 1D0YA 5CKBA 3J81K 2UXXA 2RN7A 1S1NA 2P0KA 2ECZA 4KGVB 4I0AA 5KCOA 2K3BA 5IT9K 4K86A 3MVPA 3RZOJ 1BKBA 1QKWA 3CQTA 3UT1A 1IXSB 2Z2SB 3AG4H 2ZKZA 5K5OA 4DOWA 3F8MA 3ZMTA 3F3XA 1BCOA 3HRUA 2OTLT 4RAYA 1W1FA 2YSQA 5CYVA 2RF0A 5J26A 2AXLA 2KDSA 4ZGJB 3AT1B 3MP6A 3JCMX 1YJ9Q 1KGSA 4HX7A 4XN0A 4OB2B 1Q7YC 5DUKA 4ABZA 2DMTA 3QP6A 3HOYJ 5HLHA 2MAMA 3FIFA 2P0WA 2PMHA 4M78G 4AUXA 1TUDA 2VV5A 2VGNA 4LB6B 4N0AA 1K9MR 2Q7HA 3J7AY 2MH9A 3R61A 2GGRA 2QG9B 3CBOA 1GGMA 3GCMA 5A0GA 2PMFA 5D6EA 4M9SA 2J3LA 4UP8A 3CC2A 2F5TX 2NAZA 2Y2ZA 4EJVA 1OOTA 5KYXB 1KG1A 2BV6A 1OQKA 5ELOA 5F1RA 4C5EA 1IDYA 4A12A 5LHHA 2NUPA 2VWFA 2G4CA 2JT4A 2DXUA 2L89A 1IO6A 1XCVA 2RVCA 2WBMA 3GMEA 3PE0A 1T0FA 1VQ9I 2G3RA 2MLGA 3OYCA 4IX7A 5KYWB 2YUOA 5TJJA 4IVNA 1REPC 4C5IA 3PIOA 3KEOA 2JW4A 3WXMB 2MC4A 4GGGA 4M77G 3GBGA 4UP7A 4KULA 4NQWB 2CP2A 2MF2A 5DCMB 3IL2A 3M0QA 3DTEA 3P8BB 2W25A 1E6HA 4XLCA 4C92G 2K4BA 1IAWA 1WLPB 2CO5A 4QQGA 2ARTA 4A3IJ 3REUA 1EFNA 1RAHB 4M7AF 1H92A 3I4PA 4A4GA 4G84A 4PFZA 1IN5A 2LDUA 1PHTA 3I58A 3KE2A 3JSOA 4FL6A 4FYWB 1PYVA 4CC7A 5LJ5j 4M7DD 4XM3A 3HXZA 3OYYA 3BCAA 1NYQA 2EFQA 2R7ZJ 4FW2A 3FKIJ 3I0TA 2D0QB 1FXXA 4F7UG 1B70B 2E3CA 3RKYA 3P8YA 3BG3A 3BPXA 4F17A 5A2QE 3CCQA 5BS6A 5HNHA 1VQKI 1W2BP 1UELB 3H9JA 1U8RA 1MV0B 2K3PA 3OL3A 1QWFA 2L4AA 4FE4A 1KC8R 3NELA 4F16A 4IKFA 2DKGA 2QA4T 3QPHA 2O61A 1K0SA 2CSQA 2NWMA 2O9VA 2WSCE 2KIMA 5BNGA 5ICFA 1BC7C 2PI0A 2YLCA 3OSSC 4RG2A 1PVEA 2ZIOA 2A5WA 2CQKA 5M5XJ 1IHWA 1I6HJ 5GJWB 3O5ZA 3M54A 1GRIA 4KN4X 5LJ3d 4NS5A 5FWBA 1RIQA 2FRYA 2EYQA 2ZT8A 1Q7YU 3BY7A 1A35A 2YR2A 2K9LA 5EYRA 2HKOA 5FRMA 2R5YA 1Y56A 2CU7A 1VQ8I 2OAZA 3ECHA 5TGTA 3A01B 1ZR2A 3RPUD 1WXTA 4J9EA 1ETOA 5HVQC 2Q0OA 4OMNA 5KNNA 5F0CA 2E3IA 2DOFA 2KSSA 2RDPA 1WCMJ 1MMDA 4XOPA 4BNCA 4UVBA 1DPUA 2ICWG 1WYXA 2FPEA 5DDGA 3VBBA 2DODA 3IWZA 1TZLA 4S04A 3CC2I 5H6RA 4YRSA 2B0LA 4M75F 2EBPA 3IQLA 5C6SA 3RIRA 1KQ0A 1T95A 2TRTA 1JTYA 3VYTB 2GZWA 1S72I 4Y7NJ 4RTUA 2KJCA 4AFSC 2A28A 2A68F 1UB4A 5CK9A 3I4MJ 4I0BA 5J3BA 3OOPA 1UJ0A 3CCLI 4P75C 3D5SC 4LG0A 4KGZB 1P9QC 2QVOA 3G3ZA 3NRVA 4HOBA 3EPZA 3LH5A 2WV0A 1VQKQ 4UV9A 2HOEA 2CW8A 2DTOA 2JOYA 4G85A 1GV2A 1IXCA 4MGRA 1K73C 1D5YA 3H5AA 5IYBJ 1TH7A 3L1AA 4OIQF 4UV8A 4M3FA 1K9AA 4ZZDA 3REAB 1VQLA 1FWZA 2CIMA 4TVWA 1PJRA 3EGUA 1R4NB