3V7CA

Cystal structure of sabpl in complex with inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
total genus 103
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7cA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7cA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7cA02
4XSXF 4M9ZA 5ICGA 4HT9A 1SERA 1N9RA 1I5ZA 2M8EA 2DTRA 3C3WA 2GIVA 1SRYA 3HHHA 3HRUA 3IHUA 2JPBA 2Z99A 3MZHA 3NEUA 5FLXZ 2Z9OA 3GO5A 1D3YA 3ISPA 4C8QF 3R6SA 5BPIA 2EJRA 5D8KB 2XIGA 1WQ2A 1L0WA 3QUIA 4ZTZB 3UH0A 4M77B 5GAOr 1W5SA 1R1VA 2Q5HA 2KJBA 4RGSA 2Z33A 3KP3A 3HOTA 4P3NA 3D5LA 1G4DA 4UXNA 3I7FA 4TQDA 4RDXA 5E1XA 2JRTA 1LEAA 4I01A 4RAZA 5D5UB 4IJAA 2FSWA 2ESHA 2JT1A 4BQAA 2EJ9A 5L3DA 3RJPA 4P96A 1ADYA 4S04A 4LJZF 4M7AA 4DNCA 3VOEA 3ZMDA 1BC7C 3R60A 2CFXA 4LB6B 3E9IA 4M7AC 1LYLA 4DPGA 4P75A 4WWCA 3EFRA 1OMIA 3RF1A 2F5FA 2M45A 1PYSB 1EVKA 1Z6TA 1QF6A 1KU7A 3FX3A 4H2XB 4P75C 4ZIBA 5HDKA 5FFZA 3ZP5A 3HY0A 5D6EA 4WJ3M 2P4WA 4XTVA 3LA3A 4YIFA 1MGTA 3I59B 3ECHA 3TQNA 4M9XA 1D3BB 5GAMj 1RUOA 5LJ3j 2WWYA 1P4WA 4GXOA 4ETSA 4HV6A 4NOYA 2ZXFA 1FY7A 4HF1A 3LFKA 4PJOG 5ILSA 2E7WA 1NJ2A 3A5YA 3CDHA 3RTRA 4DQ2A 3M4QA 5DD4A 3J81Z 2HGCA 3C18A 2DTHA 3SQNA 1Z05A 4L9JA 2FA5A 2HKOA 1C0AA 4QVDA 2NS0A 4WXHA 5E8IA 3L4GA 1FYKA 5F5WA 4RCBA 1HKQA 2J3MA 3UGQA 2QLZA 4LLGF 2BGCA 3JCMW 4KR3A 4WF2A 2YPRA 2LNBA 4M75F 4NB5A 1KQ0A 4LB5A 1BIAA 1R58A 3ERED 2HYGD 3GX4X 2E41A 3HTSB 2FEZA 2KIFA 4XSZF 2XAFA 4M77G 2FU4A 1HSJA 1ZG1A 2J5OA 4G85A 1R5GA 1HSTA 3F3XA 3F72A 4U0VA 3CO7C 3JCMQ 1U1SA 1T6SA 3JTGA 1U8RA 3NENA 4CO8A 3P9CA 2XRNA 5L3EA 2YLCA 2GXBA 1NHAA 3JB9F 1LB2A 3ZQ7A 1F4KA 2IVMA 2O0YA 4IRIA 4M78B 5JR3A 2VXZA 3K69A 3CMQA 1Z7NA 3KFUA 4IPAA 2QHVA 1ZG3A 1G51A 3G73A 2COMA 4Q5SF 5GAOp 2RVCA 2A68F 3ROUA 2P7VB 1ZGJA 2PG4A 1P4XA 2CIMA 5LJ5g 1ZRDA 1XSVA 1YW8A 3REXA 2ALYA 1P6RA 1HTTA 2K4BA 5LHHA 1SD7A 4YYEA 4MHGA 3DXJF 4RCCA 4C92B 1D5VA 2QUFA 1SFEA 4TVAA 2ISYA 4KIFA 4Q47A 2IRFG 4HWPA 2BYVE 4YRPA 3QU3A 3E6CC 3A7AA 1KU9A 4LK0F 3TOBA 2EV6A 2UXXA 1YLFA 4KYWA 4H02A 2BBYA 5LJ5d 5LJ5e 3A7RA 4EGYA 4J5YA 2DQ3A 3V8JA 1XSXA 2IY5B 4U7DA 4PJOA 4F7UE 2OZ6A 1CGPA 1USSA 2VOOA 4PJOC 4CS4A 3GW2A 2QWWA 2ZR3A 5F1RA 1MZBA 4S05A 4C8QD 4Q15A 4KR2A 2XAQA 1I1GA 1D8KA 2G7HA 3DV8A 2GXGA 3SWNB 5GANf 4A0ZA 4R79A 3R4KA 1ADJA 3HXYA 3JTHA 2GA1A 3V7CA 4I98B 5J6XA 1ZRFA 1GHCA 3F6VA 4HWTA 3F8FA 3R0JA 3C7JA 1O3TA 3K2ZA 4J15A 3ZN0A 4ZYEA 4L0YB 1M8VA 1ZAOA 1B70A 1LVAA 2E10A 4PNOA 2A61A 4M77A 4M77C 2QHTA 4TTVA 3ZPLA 3ABTA 2VBYA 2ZNIA 2RNJA 2AS5F 4H2YA 2PMFA 2CGHA 3LA2A 2NAZA 1XGNA 1KA8A 2DT5A 2F5CA 1YB3A 1BN5A 3KP6A 4YRIA 3EYYA 4JBAA 4EJTA 2ODRD 1U78A 5AIPA 2GWRA 2EV5A 2F5EA 2D1VA 3BY6A 5BPDA 3MF1A 5DD8A 1IUYA 3MEYA 1B34B 2CW0F 1ONVA 1FBSA 1LJOA 4XEMA 3E6MA 1J5YA 4LMYA 4G9YA 4JK1X 5GMKe 1IRGA 4ZH4F 4HWSA 3JB9I 1B76A 1B6AA 4C92G 1O3SA 3WGIA 3AHUA 5D4RA 3CO6C 2C6YA 3I59A 4BHBA 2MH9A 4GGGA 5GAN6 5DCMB 2DQ0A 5GAN2 5GAN8 1EH8A 3HXWA 3JCMV 3WTZA 4PCQA 2HOEA 4AWXB 4BHPA 2XHKA 2MLGA 2CGPA 4R1HA 4M75D 1NJ5A 4KNYA 2E64A 2ARUA 4RAYA 4M6YA 3REOA 2BV6A 3IC7A 1H641 2RGVA 2EFOA 3GZ5A 4BNCA 2H6CA 2D45A 4OU0A 1DP7P 1E1TA 3LSQA 4LLNA 5FB2A 4OINF 1BI1A 3C1DA 4FX0A 4ZZLA 2DO7A 1R00A 2I2LA 3JB9D 1RI7A 1PDNC 2DXTA 3PZCA 5K1PA 2OU2A 2ZNYA 5FO5A 5LBQA 4HDVA 3HTZA 5LGTA 1FPQA 2MA3A 1LDKB 4RB2C 1BI3A 3ZN1A 1QZZA 3DEUA 2RM4A 4MGRA 4ESFA 5ELNA 1F9NA 2ZMEA 2DDZA 3DPLC 2ZT8A 1FSHA 3HYIA 2EA2A 3E3VA 3J7AO 1I27A 3T0YA 1HK9A 3BROA 2I4NA 3GFJA 4UVBA 1FLIA 3TEHA 3FJPA 5H6RA 3HFZB 5DV5A 1S6LA 5K5QA 4AH6A 3M7GA 1HBXG 2W25A 3TO7A 4MEXF 3VQXA 4EM0B 3HRIA 2EK5A 3MQ0A 3IG2A 3P8YA 4C92A 1YFHA 4UV9A 3TDZC 1SD6A 5E3IA 4C92C 5HDGA 2VONA 4M7AE 1BI0A 1R22A 1XCVA 3IKMB 4UPAA 1S7OA 2IA1A 2VODA 1O7FA 1WWXA 2EFQA 2IY5A 4WXDA 3RI4A 2ZT5A 2L4MA 5GANh 2JZYA 3JW4A 2DBBA 3RKWA 1LDDA 5LJ5f 3L4GB 1HXDA 3GFLA 1V4RA 3K9TA 1VTNC 5BQTA 5DY9A 1L3LA 4GCVA 2XASA 4ENNA 1JRIA 2OAZA 2DI3A 3L2CA 3L09A 1YS6A 3VB2A 3RYRA 4WJ4A 1RIOH 4P5OA 4M7DB 2HQRA 3VU3C 4Y17A 4H2UA 3W3SA 2P5VA 3E97A 2VE8A 1Z1DA 1IRFA 5GAMg 4EX5A 1W7PB 2Y90A 5LJ3g 3RPUA 1BI2A 2XAHA 1XMAA 3REUA 4ZTUB 4XRFA 2XUBA 3FXQA 1XCBA 4M74A 4JUVA 2KIMA 2G7UA 4NQWA 3QSUA 1XGSA 2ZINA 2A07F 2ZO4A 2E1HA 2OQGA 2XKOA 2R3SA 4HX7A 4AIHA 5ILUA 2Z5UA 1EH7A 3KFWX 3WGHA 1N9WA 3WU1B 2ALYB 1YIOA 3BP8A 2FBHA 5D5XB 3IL2A 3F8NA 5BMZA 3HIFA 4UP9A 3QO3A 1RUNA 3G3ZA 1B34A 3P9KA 4XBFA 2DU9A 1MJBA 1IL2A 3Q9SA 3BOQA 2MC3A 3A32A 4P3OA 1K79A 4A2UA 1QNTA 4UUVA 3ICAA 4RMFA 1MJ9A 3M1EA 3JCMg 2MD5A 2PMUA 2DW4A 2WV0A 1ZN2A 4K2EA 3KE2A 2HTJA 1QE0A 5DCMA 2EB7A 4O6JA 2RC4A 3ZMZA 4HX4A 2AMCA 2BEOA 5GAOn 2E5AA 4AIKA 2G9WA 3GEZA 5I21A 5E1WA 1SD4A 3JB9H 5E1ZB 3LAJA 3BFMA 4M78F 4EO4A 2Y48A 3RL6A 1FWZA 3HXUA 5LGUA 2ZNJA 2IT0A 2IP2A 3HOSA 4KT5C 5A2QZ 3U2RA 2DZCA 2VBWA 4F7UF 1LNWA 2V1UA 4PJOE 1H4QA 2DU7A 1YFSA 4E51A 1K78B 1AWCA 4LNSA 1U3EM 4M6XA 5FGMA 4TV7A 3RPQA 1B70B 4M7DG 4H2TA 3GVAA 2FNAA 1OYWA 1W4MA 5E18F 3P9IA 1EQRA 5ICEA 2RHQB 4D0PA 3SHFA 2VC1A 1M5Q1 1FYLA 2FMLA 4I02A 4V2SA 2VC0A 1G3WA 2O6GE 3FXRA 3LQQA 1X54A 3WTYC 4RB3C 4XEOA 3KLOA 3N4MA 4YRKA 4AD9A 4PZJA 3BJAA 1KU3A 4LGWA 4M77E 2FB7A 2ADUA 3P7NA 1YTYA 2YLBA 4BYYA 4O3MA 1WSUA 2ZJ2A 1X55A 3KCCA 4YCWA 2QTXA 3HFZA 1EH6A 1WYDA 4A12A 4CICA 3V8KA 4BW9A 4WK8F 2QBYB 1W66A 4A6EA 4FHTA 2MH2A 1TQMA 4YDQA 3TEGA 1YW7A 3GWZA 3RYPA 5ED4A 4ZZDA 1ZARA 3P8VA 2CSOA 4P9FA 1HQCA 3HFOA 4XTYA 3L7WA 4JQFA 1XSDA 3W6JB 3JSPA 3O2PE 5J8CA 1STZA 2O8XA 1YS7A 3WTSC 11ASA 4QWQA 3EDPA 2DK5A 2CO5A 5D5WB 4L9NA 1FYFA 4WI1A 1SAXA 5HLGA 2ARTA 1X2HA 4BXUA 2CG4A 3V4GA 1J7KA 1XDUA 5KVRA 4YRRA 5LLQA 1B8AA 1SETA 3HFVA 3KP7A 4G7HF 3W6KB 4HWOA 4M7DA 2HFHA 1FNNA 3I53A 4M7DC 2HYFA 4CS3A 3GFIA 5GANj 3Q5FA 3QO8A 4A6DA 2R7DA 1S7AA 2LF8A 1W7PA 3MAJA 2HS5A 2ZMEB 3KP4A 2E1CA 3NEMA 5K1XA 1EIYB 1SD5A 4EMHA 2L54A 1LEBA 1BBWA 2YSRA 1HW5A 3F8CA 3TEHB 2GA2A 3IKLA 3HXZA 4NHJA 4ASNA 5IT9Z 1QZYA 3GYHX 2XKPA 5BOXA 3JAMK 1GXPA 2TDXA 2Q7EA 3TKYA 1XGMA 4OMZA 4C8QB 4YRTA 3LAPA 4UNOA 1HKSA 1SFUA 3FF5A 5JHUA 5ICFA 1QBJA 4M78E 1KMNA 5D5VB 3F23A 1N9SA 1X3UA 2DU5A 2PBIA 4OIQF 4E70A 4HQEA 3KEQA 2UWMA 3QO7A 4H2WA 4YREA 4IHSA 2XGXA 4M78D 4H0EA 3RESA 1SMTA 3ABUA 3FMQA 4NCXA 2VT2A 4B8XA 3RDIA 4IVNA 4GO1A 3O6BB 1JXSA 2EL9A 1ZLJA 1W5TA 2XAJA 5FFXA 3JCMb 2A5YB 1F1ZA 4C92E 2AXLA 5L3BA 1KMMA 1R7JA 4M7AF 2B0LA 2RB6A 3OD1A 4HLYA 5CYVA 1G3TA 3QPHA 4OOIA 1IF1A 2ZZEA 2ZT6A 3FM3A 4YRMA 3WODF 3BW1A 1XN7A 2PEXA 4CDGA 4G6QA 3M9AA 3JCMP 4EJVA 4CH6A 1USTA 3M4PA 1K78A 1Z7UA 3L00A 5AIQA 2XV4S 1P92A 1GGMA 1I81A 3WTXC 1U1TA 3F22A 4RGXA 3NRVA 4B09A 1WI9A 2HTSA 1B4AA 2JPCA 2EJFA 3L9FA 2RHQA 1I6XA 1P4AA 1YG2A 2VE9A 2Q2EA 4LK1F 5DYMA 4IRHA 5C52B 5D8LB 4P71A 3WE3A 2V9VA 4M9SA 1U2WA 2CJ9A 2E3CA 4P71C 3HXXA 3HSEA 4X5OA 4KN4X 2V79A 4YRCA 3K0LA 3ECOA 2HQNA 4XQ3A 1TQPA 2DQLA 3F6OA 3VQYA 1FYMA 3FB9A 1BOAA 5TJJA 4ENKA 1R1UA 2CQKA 1TW2A 2K4JA 4QVCA 1ASYA 4NL3A 1B7YB 5D4SA 4XLPF 2I4MA 3DPTA 3COAC 2LDUA 3LWFA 3E6DA 5E20A 4G8XA 1XDSA 1O7LA 4M75B 4C8QG 2DLLA 3WG9A 3MEXA 2KKOA 3PQJA 4KIBA 3O3KA 3DQVC 1Z7MA 2QBYA 1R23A 4ZYHA 1J59A 2QQ9A 2ZT7A 1JJCA 3FWEA 2PMHA 1S8NA 4RGRA 3VBBA 4N9HA 4L87A 5GAN7 2AMCB 4HW0A 4OP0A 1REPC 1OYYA 5ICCA 1IXRC 1ULYA 1JHFA 1FSEA 3HHGA 1ZYRF 2WTEA 2X4HA 4MNUA 2GAUA 2HKXA 2I4OA 2L02A 1PP8F 4JRKA 6PAXA 4WX9A 2K27A 1FOKA 1HKTA 3FMSA 1IAWA 3I0TA 1JHHA 5FD5A 4EVIA 3JCMX 4ZYGA 4EJOA 4HDUA 2EJGA 2H09A 4A54A 3A5ZA 2O3FA 5TRDA 1LJ9A 1R36A 4HV5A 4YRFA 3HRSA 2XROA 2ZKZA 5LJ5j 4CHUA 1IW7F 4L9TA 3BDDA 3QPTA 1QO0D 1ZLKA 2LSOA 3BDUA 2LF7A 4M73A 2I4LA 1T0FA 4LLLA 2IPQX 2H94A 4KA4A 1KQ2A 3B02A 3E5XA 3KP2A 3ZMSA 3IRRA 2V1XA 4JRIA 4YRGA 4L0ZB 5CLSA 5E17F 1ZREA 1CF7A 2KJCA 4PJOF 4YPFA 2J3LA 1EIYA 4K86A 1YQAA 1DDNA 1ZG5A 1FP2A 1J75A 3LSTA 4Z2YA 3ZMTA 4EM1A 2P8TA 2LKPA 3INZA 1XMKA 3IWZA 3GF2A 5CAIA 4G6DA 2NNYA 4WXCA 2HR3A 3BJ6A 4ESBA 2G4CA 4YCUA 2PN6A 5AONA 2A3SA 3EUHA 3FZVA 4HT8A 3RUXA 4C8QA 2A6EF 1YW9A 4J6YA 2M5WA 2DPDA 3J80Z 2O61A 4M75G 4C8QC 3HY1A 2C8MA 2E7XA 5KNNA 3HRTA 4M77F 3Q9VA 4Q6GA 5IT3A 2Q8KA 4X9DA 2P0LA 4L9VA 2QM3A 2QENA 3CJNA 3T5XA 4M7AD 2ZCWA 3DKWA 3QP6A 2ISZA 4I2OA 5CVIA 1QQIA 3GZ6A 5L3CA 3FHZA 3JB9G 5LEJA 4L18B 4HA8A 1JBMA 3PCOB 1TTYA 1O3QA 3KETA 2ARSA 2L3DA 1EOVA 4XLNF 3EETA 5LRRA 2OBPA 3TDUC 1QGPA 4KQEA 1YFTA 3SZPA 4IHTA 4KMUX 5GMKj 2P6TA 4MQ9F 3DFGA 3G1ZA 2QQBA 3VFZA 1FC3A 2D1HA 4CYDA 3HSBA 3ERRA 4HWRA 2X0LA 3S2WA 2VT3A 3A31A 1HC7A 5LHIA 2ODRC 4YCVA 3DP7A 4TVYA 2FMYA 4UP7A 4GYGA 3P8TA 3VODA 3LSSA 1G3SA 1HW2A 4I09A 5C53B 2VXEA 5JVTA 1E22A 2ZTGA 1GVJA 1NYRA 3L2ZA 4NL2A 3CLOA 4YFKF 2VXFA 5LGNA 3ZMUA 1R1TA 4LG0B 5GAMd 5GAMe 5LJ3d 5LJ3e 4M7DE 5HVQC 1H4SA 1YGBA 1KQ8A 3JCMJ 1V3FA 5D6FA 5K1YA 2XTIA 3TUPA 5GMKi 3IALA 4EGZA 1L0OC 1TLHB 4TQFA 4M7AG 1B7YA 1ON2A 2W57A 1FP1D 3IRQA 2HWVA 3SFZA 4M75A 4ZYDA 1KQ9A 4OIOF 1WQWA 1IN5A 2YR2A 1J5WA 2P7CB 2ZZFA 4M75C 3HRMA 5GANg 4P9UA 4G7OF 4EMKB 3I54A 4Y91A 3K1MA 2HDCA 1E17A 3RGLA 2YX7A 3NELA 1BC8C 2DPUA 4G84A 2H6BA 3GXOA 5GMKl 1G5HA 4CH4A 4U0WA 4OMYA 3JCMd 4K88A 3JCMe 4RQFA 1B9MA 4YFXF 4M71A 1KOGA 2HEOA 4XTXA 2RDPA 4XTUA 2P5KA 1SFXA 1KQ1A 3RKYA 2Q7GA 3QAHA 4ON0A 4O5VA 4K87A 3QRFF 2FRHA 4EQQA 4XU3A 2DJZA 1NJ6A 5L3GA 3QOPA 2DZ9A 5FLXK 5DCFA 3TOAA 4Q4ZF 2FBKA 1YYVA 1TBXA 5EEHA 2DK8A 5A2QK 2P5IA 4PJOD 3WU0A 4C92F 3I58A 4UVCA 4RQEA 2H27A 2YX4A 1BBUA 4A5MA 4EM2A 1ATIA 2JSCA 2ZBKA 1FX7A 1C0WA 3VQWA 4UV8A 4PHCA 4OLFA 3MFKA 3JCMc 2ZNZA 3VEPA 1X56A 3BZ6A 3BJUA 2ACJA 1IN8A 2EFWA 2CJBA 1DPRA 2RQPA 4ENJA 3MF2A 2ZIOA 5LRSA 4OIRF 1TQIA 3I4PA 4QLCU 2W85A 1RNLA 2KIUA 3HSRA 3H92A 2VOPA 4TVWA 4M77D 2Y75A 1KGSA 3I71A 2PLYA 1JJCB 2Z3YA 3V7RA 4MEYF 5K5OA 3PQKA 2EAYA 1EFWA 4WCGA 1MD0A 2P6SA 1YO5C 3QHSA 2VBXA 1O3RA 3KLNA 3CTAA 2UZKA 5DDGA 3WTVC 2PMEA 2FQ3A 4KMFA 3F8MA 1D8JA 2Y0MA 4CH5A 3KZYA 5LJ5h 2OZUA 3E5UA 3TO6A 1IN7A 1WRJA 3FXUA 4I0BA 5ILVA 2NNNA 3QP5A 3V7SA 3PGGA 1YCYA 2FF4A 1GXQA 1UHWA 1SESA 2QQAA 3PCOA 4ESJA 5F64A 2IA2A 3J81K 2ESNA 2DVEA 3SB2A 2W84A 2L01A 3U9GA 1QPMA 4HLXA 4GYIA 2DEQA 1U5TB 2MLKA 3M8FA 1G3YA 4YRLA 2JTVA 3BJOA 4FT8A 3EYIA 1NJ8A 4N0AA 3MWMA 4TWAA 2ZFWA 3L1AA 4N0AC 4IRGA 1KYWA 1AOYA 2MBFA 1FBQA 1LDJA 1WKMA 5GAN3 4EV0A 4HZFA 1MJAA 4HF0A 1RIQA 1T39A 2Q7HA 5GAOl 5HS8A 5GMKm 2FBIA 4J6XA 5GAN4 3BY7A 2PFBA 1CF7B 1KU2A 1USYA 2OD5A 3BPVA 4G94A 1LOJA 1BM9A 2CYYA 3AAFA 2AKWB 1USYC 1ZHFA 3WGGA 4OIPF 2BE5F 4LG0A 1MDMB 4PG3A 5DUKA 3GIBA 4HOBA 3E9HA 2ZGWA 2EWNA 4M72A 3KZZA 3I5UA 3IWFA 4A0YA 3RACA 2ETHA 3M8EA 3SXYA 2RN7A 5C51B 1UHMA 3WTWC 4O2DA 1I5LA 3JAMZ 1Y0UA 5IT9K 5GAMf 2STWA 2D2WA 5LJ3f 3FIFA 5H20A 1B9NA 4F7UB 4HVCA 2A69F 2QHSA 3R07A 4KN7X 3NQOA 5GMKh 4XTZA 1H4VB 2QHUA 4MTDA 3CUQB 4XTWA 4AIJA 3OOPA 4EMKA 1EVLA 1UCRA 4EMKC 2M1BA 4KICA 3UFGA 5HDNA 3DF8A 1R5HA 2QVOA 5FD6A 1X01A 1XB4A 3D0SA 3JSOA 4IF4A 2EA4A 4C8QE 4L5IA 2P5LC 4RB0A 4HF2A 3V8LA 2K7LA 2M30A 2PI0A 5JI6A 4AVPA 2Q5IA 3HRKA 1WQ7A 3E6BA 3B73A 3T8TA 3H3ZA 4C92D 1NYQA 2DTOA 2ZXJA 2DAOA 2E65A 3OV8A 3JCMf 2IW5A 1IXSB 2GZWA 3F8BA 2RHSB 2DTIA 5DEQA 3ZMVA 4IXAA 2FXAA 3GLXA 4YRQA 4CZZA 3QTCA 2EV0A 2K86A 2ZZGA 3HFNA 1X2GA 1XGOA 2QZ8A 1T98A 1MGQA 3CUOA 5HS9A 2VC8A 2A6HF 4Y15A 12ASA 4L5JA 1K6OA 2W24A 2NYXA 4RS8A 3FMRA 3A74A 3RKXA 1O57A 5F6FA 1SMYF 2RV8A 3GFMA 5HLHA 2FOKA 3NETA 1OYIA 3WE2A 1BBYA 4HX8A 2F2EA 1FBUA 4HAMA 2L4AA 4KUMA 4M78G 1OR7A 4P72A 2DQRA 3ULQB 1EV7A 1H0MA 4P72C 1YFRA 2E1NA 2XGTA 3R0AA 1OKRA 5GAOm 1FZPB 1HW1A 4F7UG 2XAGA 4I7HA 2PJPA 5GAOq 2VBZA 5CJ9A 4UVAA 4XU2A 1PYSA 4M7DF 4H2XA 2ZCEA 1ODDA 1Y96B 2FE3A 2RKHA 4A0XA 3QO5A 1E2XA 5KK1A 4RB1A 4P74A 4EJUA 3MCZA 1B59A 2K02A 4P74C 5HGQA 1PP7U 3HTUA 5H6QA 5ELOA 1D3BA 2F5DA 1WU7A 3M4GA 2DXUA 5EEGA 1IN6A 4KIGA 2V1DA 5BS6A 4M75E 1WLEA 3ML6A 5GANe 2C7IA 4YROA 3LQRA 2ELHA 1IXCA 4J6WA 4MTEA 1A04A 4PDKA 1ZRCA 4I0AA 1U5TA 4N9IA 3LC0A 3T1BA 1DPUA 1U5TC 5CVVA 2VN2A 4CS2A 2HZTA 3K1NA 1T38A 1PUEE 1RZ4A 4HQMA 4R8HA 2QYOA 3VQVA 1E1OA 5DUIA 2ZR2A 1LQ1A 4EMSA 3IKVA 5K5RA 2O03A 3GUDA 5J8FA 1WNLA 3E5QA 3FM5A 2M87A 1XD7A 2IJLA 4YG2F 4JLIA 2AKWA 1JGSA 4BHCA 3UGTA 4CXFA 1ZH5A 3SZTA 2JN0A 3H3UA 2R7FA 5HOOA 1J2XA 4FX4A 1MDMA 3RERA 4U0YA 5GAMh 1H4TA 2FNPA 1IZ1A 5LJ3h 4YRJA 2IA0A 4M7AB 4LFUA 1TNSA 4M78A 2K57A 3HXVA 2HNIA 2CWEA 3IKTA 5HLIA 4M78C 1BIBA 3U1DA 5CVJA 1I4K1 1G5IA 5HS7A 2ZIMA 4F7UA 1I8FA 1G6NA 1E24A 1UB9A 1MKMA 1Q1HA 1U6GA 1H9GA 1IN4A 3QNEA 3J80K 3CUQA 3CUQC 3PFIA 2V6CA 3I64A 1Z91A 4YRSA 2Q0OA 1J9IA 5ERIA 1KYZA 4KFCA 4P55A 4LD5A 1NNHA 3BPXA 4P73A 1Z6RA 1OPCA 4BAYA 2EFNA 4XU0A 4MQVA 4H2SA 4P73C 4YP0A 3JB9J 1S29A 4A5NA 3JCMh 1ON1A 4UHTA 4PGHA 2FYKA 1J0RA 4CGZA 1I1SA 4HBLA 3TGNA 4HYEA 1BJAA 4H2VA 4MMKA 1ZGAA 3QU6A 2RA2A 3SWNA 1ASZA 2PQ8A 2GQQA 2UXNA 4YFNF 1WPYA 2RHSA 2OQRA 1K7AA 3SWNC 4U7BA 3T8RA 5L3FA 5E8GA 4BH9A 3LA7A 4MMLA 2J5PA 2NRAC 2OA4A 3HSFA 1TNTA 4Q48A 4XU1A 2XVCA 5CVUA 5GAN5 1P2FA 2CJAA 3BWGA 4CH3A 4EMGA 1B1BA 3DSQA 5LEKA 4N0BA 4BWAA 2YU3A 4P3PA 1TH7A 4F7ZA 1TW3A 1T2KA 4A53A 2KRFA 5CVRA 3ELKA 4Y13A 2DFIA 4X9CA 2YHTA 3K1PA 2DKGA 1S3JA 4M7DD 4ENMA 2WC2A 3RIRA 3KP5A 4G7ZF 1UFMA 1NJ1A 3TO9A 3HUGA 4PGGA 4YRNA 2RD1A 3MZYA 4UP8A 4YIIA 3WTTC 3WTUC 2EFPA 1W7PD 2STTA 3KEOA 1LNXA 3EQLF 4TVAB 4EJWA 4KDPA 4RGUA 1VQZA 3EFSA 5JFRA 3A7UA 1Y96A 3WQZA 1Z9CA 3N97A 3F21A 5LHGA 1JE8A 4PJOB 1H9TA 4U88A 5GANd 3R61A 1DUXC 1FT9A 1F5TA
chains in the Genus database with same CATH superfamily
1JXMA 1SERA 2DMPA 1I5ZA 1N9RA 2M8EA 1SSHA 3REAB 3CCMA 2NXNB 3IHUA 2LYCA 4IIMA 2BE9B 2LMJA 3NEUA 2MYSA 1R0BG 4C8QF 3OYKA 2XIGA 3ZQCA 4Y3OA 5FRMA 1JUPA 2Q5HA 1R1VA 2KJBA 4BEHA 2ZB9A 2JZ2A 3I7FA 5F0CA 3UF4A 1JKQC 3P8HA 4GFBA 4IJAA 1LKXA 5L3DA 1ADYA 5L8RE 2JMWA 4M7AA 4DNCA 3VOEA 3ZMDA 3R60A 3E9IA 4KJZA 4P75A 4D7MA 2M45A 1VQ7T 4H2XB 5HDKA 5FFZA 2CU7A 3VRYA 1BCMA 4D8DA 4BACA 3CCUQ 1RI0A 4RTXA 4OB3B 3OBYA 2JOYA 2IEKA 1DGRM 3WHCA 3GZNB 1MBKA 2OCEA 1RUOA 4GXOA 4ETSA 4NOYA 2C0IA 2TRTA 2K2MA 4RUGA 3LFKA 5ILSA 3QWXX 3DWLE 1NJ2A 1HA8A 3J7YJ 2DYBA 1E6GA 2HGCA 3SQNA 1Z05A 2HKOA 4DBHA 2O01E 4ZDPA 2QYZA 2W48A 1PD0A 3JCMW 4WF2A 1M30A 2YPRA 3OR2C 1R58A 1IC8A 2QSHX 4LDVA 2FEZA 2R7WA 1ZG1A 2YS9A 5JLWA 1HSTA 1VQ9T 4A4GA 3CO7C 1T6SA 2YLCA 2AHQA 1SVLA 2DXCA 1VQKA 3EHQA 5CO7A 3RNJA 4E7IA 5EDNA 2VXZA 3HG9A 3RMSA 2GLOA 2COZA 1W2BP 4DEYA 1ERDA 2A68F 1Q82C 1RAAB 2QCOA 4XOTA 2ESWA 2VUMJ 1XSVA 3OYIA 1Z0XA 2HVSA 4HWPA 1ZBXA 1HDDC 1PM3A 2EV6A 4XNFA 1YLFA 4H02A 2E2JJ 2NVXJ 2RJDA 2DFFA 1VQLT 4LVMA 2IY5B 4PJOA 3K70C 4RLFA 1X1PA 1USSA 2VOOA 4CS4A 3GW2A 1IGNA 1YJNA 4S05A 3LGFA 1N25A 3CBPA 1I1GA 2DILA 2GXGA 3RQ4A 5GANf 4R79A 2GA1A 5EGOA 1JI8A 3EG3A 1ZRFA 4DOZA 2JA7J 1MMNA 3C7JA 4J15A 2JMCA 3DTKA 2H3EB 4PNOA 2JM8A 2QHTA 2PJRB 4TTVA 3OSSC 1PJRA 4GY5A 4NQWB 3X20B 1QVPA 2KQRA 3DBLB 1A0NB 1PG5B 1XGNA 1VQ6T 3CMAQ 2F5CA 1YB3A 4ELZC 4YRIA 4JBAA 4EJTA 2GWRA 2D1VA 3MF1A 1K0SA 2JK3A 3S8PA 4LG3A 4AFUC 2CW0F 1FBSA 2DFUA 4IX7A 2GBYA 4OAZA 4RA2A 3TQ7P 2C6YA 3I59A 3RZDJ 3A0BC 2MH9A 1TG0A 2JW4A 2VKNA 2DQ0A 1I3AA 1N6AA 1K8AR 3HXWA 3JCMV 1WX6A 4J7IA 4CYCA 3BR6A 4AWXB 2MWPA 1VQ4A 2EPDA 2XHKA 2KRNA 2CZ0B 2MLGA 4M75D 1SG5A 4A4FA 2LTPA 4RAYA 2BV6A 2EFOA 2IS6A 3SJMA 3GZ5A 2H6CA 5FB2A 2VYTA 4FX0A 2DO7A 2ME6A 3JRAA 4BEHB 1UG2A 1Q1VA 4HSRA 5KAIC 4ZJZA 2OU2A 2ZNYA 5FO5A 4L5GA 5LBQA 4HDVA 2X9HA 2CV1A 2MA3A 1JKPC 3LSKA 1DP3A 5ELNA 2ZMEA 4JYKA 4DBRA 2HOTA 2ZT8A 1QKXA 3FISA 3HYIA 1Z3YA 2EA2A 1A31A 2LDMA 3UPUA 3BROA 1UECA 5HY6A 5KE2A 2HKNA 3FJPA 5K5QA 4AH6A 4BJ5C 2W25A 1C0MA 2RJFA 2DYRH 3HRIA 3MQ0A 3IG2A 3P8YA 3FJ5A 3M57A 1QVTA 1YFHA 2DF6A 1SD6A 2M2EA 4M7AE 4UPAA 1S7OA 3I55I 1VQ8A 4F14A 2VODA 1O75A 2LH9A 2EFQA 2LR8A 2JA6J 3M9QA 2JZYA 3JW4A 2DBBA 2LVMA 3K9TA 5BQTA 5HK3A 4XAXB 4OMFB 1ACMB 2BHYA 2DI3A 3WVEB 3E7LA 4IURA 2NWMA 1RIOH 4P5OA 3G2BA 2YWWA 5CKEA 1YX3A 2DMOA 3VU3C 1UELB 4JZ4A 3IP4B 2P5VA 3S14J 4KH1B 5GAMg 2QEXT 3RPUA 4D9JA 4XRFA 2XUBA 4M74A 1XCBA 2WSEE 5KYYA 2XKOA 2R3SA 3C2GA 2E70A 5E3LA 4XKCA 2Z5UA 3OW2A 3KFWX 3WGHA 4AFSC 1GFDA 4I76A 2MF2A 1Q81R 5D5XB 4XK8E 3O5ZA 4UP9A 2RQTA 4XBFA 2DU9A 1MJBA 2HL5C 3JR9A 1JUSA 2MC3A 4RMFA 1MJ9A 2M0CA 2PMUA 1NYFA 4BB7A 2WV1A 4A3MJ 3A2KA 2HTJA 1QE0A 5DCMA 2EB7A 2RC4A 4IUUA 4HX4A 3AG2H 4AG1C 2E5AA 4QQGA 3JB9H 3BFMA 2J06A 2R4GA 5LGUA 2ZNJA 2EILH 3K6GA 2IP2A 3HOSA 5A2QZ 2DZCA 4F7UF 4PJOE 1LNWA 2V1UA 4XLFA 1K78B 1YOVB 3K4KA 4TV7A 3UT1A 2ED0A 4H2TA 2FNAA 5FRNA 3P9IA 1BW6A 3IH3A 1JT6A 3DLLF 2KLOA 3SHFA 2LG4A 3LNQA 1M5Q1 1X1DA 4QPOA 1FYLA 1UAAA 3OS0A 3RQIA 2DA3A 1R71A 2O6GE 1VI0A 3AKZA 2DRKA 4OMOA 3QODA 2FB7A 3HKZA 4BYYA 2YUNA 3KCCA 3BCAA 2J6FA 2L9NA 4YCWA 3HFZA 1WYDA 2VPRA 2K5LA 1ARKA 5M9OA 5CKTA 2RF0A 3HP9A 1QVFS 1NJIC 2DMNA 4BI8B 1VF9A 2MH2A 4BDZA 5LL6S 3PJRA 2EQIA 2M7AA 4YEJA 1UHSA 3JSCA 2QDYB 4ZZDA 1MNMC 3P8VA 2CSOA 1HQCA 4CYCB 3HFOA 1H3ZA 1VQMQ 3HKZN 1JTXA 5J8CA 1STZA 2O8XA 2X1DA 3HOUJ 3OS5A 3VDXA 4XOPA 4QWQA 3X24B 1EA3A 1MMDA 2CO5A 2KDZA 4L9NA 3M07A 1FYFA 1TWBA 1M9SA 2K9SA 3OA6A 3JAME 2BTTA 2DT7B 2O4XA 5KVRA 2WSFE 3OMYA 1OEBA 1WJCA 3X2QH 4G7HF 4HWOA 4LVIA 2KQWA 4ZN3A 4GBQA 3CCRA 4E4HA 4MDWA 3OW2P 3GFIA 2DXIA 2K7AA 1S7AA 2LF8A 3VYUB 1FIPA 2ZMEB 3S1QJ 1WJAA 2K79A 9ANTA 1SD5A 4EMHA 2L54A 1M3BA 1HJDA 2GA2A 4NHJA 5IT9Z 2EIJH 3RSNA 1OOTA 2QA4I 1YITT 2TDXA 2PNIA 3KYDB 3TKYA 1EKEA 2RMOA 4ESRA 4YRTA 1R6RA 2DA2A 2IS1A 3H0FA 1SFUA 1AWXA 4ORZA 2ZPIB 4HT4A 1Q86C 1PVEA 2E34A 4OIQF 4E70A 1I1JA 3S2DJ 4H2WA 5A0DA 4NC6A 4CCKA 2XGXA 4IQJA 4H0EA 3H8ZA 2BY0A 3G71A 4NCXA 5EEAA 3CCSA 1JXSA 4LVKA 1ZLJA 5FFXA 1F1ZA 1AZGB 1R7JA 3OD1A 4HLYA 4BUPA 2DTZA 1YIJI 2ZZEA 2L0KA 3FM3A 5IHIA 2X4JA 5F27A 3C12A 2PEXA 4EJVA 3VYHB 1Z7UA 3L00A 5AIQA 2QSFX 2XV4S 1I81A 4J9IA 3NPFA 3CPWA 2A5WA 4B09A 4KGVB 3H35A 4FW2A 2JPCA 1U3OA 3L9FA 1YG2A 1V29B 1B72A 2L7ZA 1F36A 5KYUB 1NH3A 4P71C 3HXXA 3QQAA 1TZLA 1M90U 2WY8Q 2V79A 2V7FA 2DQLA 3IH2A 3F6OA 2JT4A 3VQYA 2LQWA 4ENKA 2CQKA 2ENMA 3GPLA 2EIMH 3LMMA 2B9SA 2JVVA 4NL3A 5C0MA 1VQKT 3OYJA 2PZ1A 1WJSA 5KNLA 3K4MA 3LWFA 4G8XA 2OV7A 4KIBA 3O3KA 3DQVC 1Z7MA 3GNFB 1OCPA 1BKBA 1JJCA 2PMHA 1S8NA 2EZHA 4AVZA 3M58A 1SHGA 4L87A 1WHLA 3A01A 2CP6A 3VJPA 3P5JA 3G4SQ 1D0ZA 1XC5A 5CQXA 3HHGA 1EIFA 3CCYA 2WTEA 5D6XA 1VYUA 1Q7YR 2I4OA 1ZBJA 3PO3J 1FOKA 4E47A 3FMSA 1IAWA 3EHRA 2DCEA 2LBFB 4EJOA 1SC7A 2EJGA 2H09A 2KXDA 2O3FA 3MEWA 1YJNT 3F9KA 4YRFA 5KYXA 3HRSA 2ZKZA 3DBRB 5LJ5j 1IW7F 4BY6C 1QO0D 1A36A 2IPQX 1JO8A 4KA4A 1BYMA 3CDIA 3D7SB 5CLSA 2K9QA 1CF7A 3BLYA 2ZMEC 5TISC 4K86A 1ZG5A 1FP2A 2LK2A 2BKDN 1YHQT 2VQHA 5HKCA 2P8TA 4MDXA 1LE8A 2V1QA 5CAIA 4XLHA 1QZEA 2F48A 2LQKA 3MKZA 1E3PA 4HT8A 4C8QA 2FRWA 2DPDA 2QGFB 3HY1A 2K9GA 5KNNA 4M77F 2LY9A 2YUQA 4Q6GA 2AK5A 2M4GA 3CJNA 2ZC2A 5D7UA 2ZCWA 3DKWA 4I2OA 1MIJA 1VQOI 3KBGA 5LEJA 3PCOB 1TTYA 3FBIB 3CPWP 2DD4A 1YJWI 5LRRA 1QGPA 4KMUX 5GMKj 1ZUUA 1FC3A 1VQ4T 3HSBA 4HWRA 1E6HA 2IIMA 3I4MJ 3A31A 4FT2A 2BOLA 2KAFA 4TVYA 2VXEA 2ZTGA 1NPRA 4YFKF 3ZMUA 3EAEA 3PT9A 5LJ3d 5LJ3e 1YE9A 5HVQC 5FW9A 2F6CA 1QP2A 1K9MR 3W2AA 5D6FA 3TUPA 5F04A 5I22A 5GMKi 2HXOA 2ROTA 1ON2A 3PMIA 2DL4A 1XQHA 1WQWA 1X58A 2L9SA 2ZZFA 1HF0A 5GANg 4G7OF 3KUFA 3JRIA 3ZL7C 2F4OB 3NELA 1BC8C 2DPUA 4RDUA 2R5MA 2M7BA 2A05A 2GTOA 2X85A 4RQFA 1U9OA 2B86A 4M71A 4XTXA 3FIWA 3QJYA 4XTUA 1DQUA 1E7OA 3G6EQ 1RETA 4QIWN 4ON0A 2KVQG 3OYNA 3QRFF 2F1LA 5L3GA 3QOPA 3GBQA 3Q0VA 1PSFA 4FT4A 4RTYA 5FLXK 2Y31A 2CREA 4Q4ZF 3K70D 5A2QK 5DM6F 5IHKA 2R5YA 3RBBB 1B72B 2IVWA 4RQEA 2H27A 4A5MA 2CT3A 4XIDA 2XD0A 3VUBA 3VQWA 4RBOA 1W0TA 1JTYA 4OLFA 4PUSA 3JCMc 4D8KA 3PL8A 4ITVA 4C3JJ 1D0YA 1IN8A 2IGMA 3HM5A 2EFWA 1BA5A 2CJBA 2RQPA 3VYRB 3MF2A 2ZIOA 1IB8A 5LRSA 2E6ZA 4OIRF 1TQIA 2MD0A 1YWPA 5DM7R 1KONA 2HQAA 2K3PA 3H92A 1ZSGA 4BGDA 2VOPA 2I8DA 3I71A 2NS8A 1N75A 1JJCB 3OSFA 2JUFA 1MD0A 3H0GJ 2VBXA 3CTAA 1FEXA 2FQ3A 2OZUA 2BVMA 1N77A 1M27C 5FLVA 1IN7A 5ILVA 2LC4A 2NNNA 1V76A 3QP5A 1IRZA 1VUBA 1GXQA 5F64A 3BG5A 3I55A 2L01A 3EFOA 1VQ9Q 3A98A 4HLXA 2OTLI 2RAEA 2D6FA 4YRLA 2LJ3A 4ATOA 3FDRA 4N0AA 3MWMA 3L1AA 2KHMA 3W2VA 2MBFA 4HF0A 4Z89A 3ER0A 2Q7HA 4KGZB 5GMKm 4HKEA 3BQYA 2PFBA 1CF7B 1USYA 3KYLA 2CYYA 3HOVJ 2AKWB 7AT1B 3QBYA 1ETOA 4UB8C 3VS2A 4LG0A 4PG3A 5DUKA 4F92B 1LE8B 1WJDA 3KZZA 3IWFA 1Q95G 3M8EA 3SXYA 1VQLQ 3WTWC 2IS4A 2HD0A 1Y0UA 5IT9K 2D2WA 1ZQ3P 5LJ3f 5H20A 1B9NA 3RCOA 4KN7X 3NQOA 4MTDA 1POGA 1EVLA 4PK4A 3EG9A 3CLQA 5M5XJ 3TW6A 1TSFA 3S15J 2KYBA 3UA6A 1X01A 3JSOA 4IF4A 4C8QE 4L5IA 2P5LC 2R58A 1I0CA 4UB6C 3E9GA 3K4JA 1WQ7A 3B73A 3G1OA 1NYQA 1VA7A 1RKTA 2A36A 3VWBA 1WHUA 1GVDA 3CCJT 3PTAA 3VKIA 2V1NA 3ZMVA 1R9TJ 2RQRA 3BZCA 2GFAA 1T98A 2JUCA 1MGQA 3CUOA 3M0QA 1Z21A 2VC8A 1RPWA 4ZTJA 1X1BA 5F6FA 2XG8D 3CCRT 2YRCA 1SMYF 4B43A 3I56T 3NETA 4AC0A 3D1NI 1IDYA 2YU9J 1WH7A 4KUMA 3L2WA 1OR7A 4M78G 3CCUI 2QF7A 1RRJA 1LVKA 4WTOB 1VQPT 4II2A 4XU2A 2ZCEA 1GCQC 3C0CA 2RKHA 4A0XA 3QO5A 4RB1A 4A3DJ 3MP1A 1PC0A 5CIUA 1KD1R 2F5DA 1WU7A 2R5AA 1I50J 2R92J 3A8OB 4B48A 1WLEA 3ML6A 1M4ZA 4YROA 1PD1A 4A4EA 2HZDA 1MMGA 3DU6A 2MSYA 1U5TA 3HOYJ 4OMPA 3G71T 2P84A 2X6OA 5CVVA 2WB1A 2VN2A 2HZTA 2L0AA 4MIMA 5HK0A 1PUEE 1E1OA 5DUIA 1S9HA 5K5RA 1U0JA 3GUDA 3E19A 3J80E 4IHYA 1UTIA 4BY7J 4BI4A 3OYEA 3GCMA 1OX9A 2FG0A 1JGSA 4CXFA 3SZTA 2VQCA 4GLKA 4FX4A 1MDMA 1H3HA 4YRJA 2Y2ZA 2WB1N 4AUXA 3A4CA 4M78C 5CVJA 3P8DA 5HS7A 2CP7A 4F7UA 1G6NA 1M8MA 1E24A 1RAIB 1YJ9I 1H9GA 2QGGA 2QA4A 3DLLA 4M3FA 2XC7A 1Z91A 4YRSA 2E71A 2B8AA 4KFCA 3BPXA 4RM2A 1OPCA 1TUGB 1KJWA 4P73C 2QEXQ 4F04B 4E7SA 2FYKA 3HPHA 4CGZA 1I1SA 1QRYA 4HBLA 3MEVA 3MO8A 3CBOA 1MNEA 2ZXIA 1ZGAA 1ASZA 4OVAA 4FQGA 3TSZA 1EF4A 3SWNC 4DYRA 1V1CA 5GPCA 2QKMB 5L3FA 4A3IJ 4MMLA 1YIJA 1TNTA 2LP0A 4XU1A 2XVCA 1TWFJ 2CJAA 4EMGA 2XICA 3CMAI 1MBGA 1TH7A 4E7JA 3K1PA 2RHIA 4C5EA 3KP5A 4G7ZF 1UJ0A 4IOCF 3OYFA 1QP3A 4Z88A 3HGGA 3KEOA 4TVAB 3PMTA 4EJWA 4RGUA 4XL9A 1VQZA 4UY8I 3GTLJ 1Y96A 3WQZA 1Z9CA 3LL7A 3AFHA 3NGPA 2HSPA 3ZQHA 3N97A 1F1BB 2V26A 1JE8A 3PVQA 3R61A 2FVUA 3OYGA 5ICGA 3QWYA 4XLEA 3TREA 1GL5A 1JQQA 1TS9A 3TW7A 3HRUA 4Y4RA 4C3HJ 1LFBA 1VQNI 2JPBA 2Z99A 1U5SA 4XQFA 2ZAEA 4Y28E 4XLCA 5IH2A 3CCEA 4CC4B 4PJJA 1D3YA 1AHDP 3R6SA 5BPIA 2DFEA 1X1AA 5GAOr 3CMYA 2Z33A 3HOTA 3C4SA 4LVJA 2R93J 2K85A 4BJTA 1RAFB 2JRTA 1UGRB 5D5UB 5CCAA 2BVLA 2FSWA 2JT1A 2EJ9A 2FHDA 2HMAA 1VQ5Q 4C2TA 4DPGA 2Y0SA 3EFRA 1OMIA 1EVKA 1Z6TA 2BW3A 1M2OA 4PJ0C 4WJ3M 3LYIA 5HODA 3ME9A 4YIFA 3CJQB 1MV0B 1MGTA 1WPKA 3FXOA 1MH4A 2X1CA 1ZTRA 4A3CJ 1MBJA 2FQ4A 1WIEA 4LITA 2ZXFA 4HCKA 2AZSA 2R7RA 2E7WA 2P81A 1Q81U 3A5YA 3CDHA 5IP6A 1ORKA 3J81Z 5FKMA 3C18A 2DTHA 4L9JA 1YBYA 2QG9B 3A8LB 1C0AA 2KIQA 4QVDA 2FD5A 2P0QA 5E8IA 1VQOA 2MPXC 3M56A 3ASNH 3QDRB 3UGQA 2QLZA 4HNVA 4JJCA 2DBKA 5M3MJ 1YJWA 4M75F 1OJLA 1KQ0A 4LB5A 4LUEA 3VV0A 4LIUA 2W00A 2H8RA 2DOEA 2E41A 3HTSB 2P0WA 4XSZF 1YITQ 2CSIA 2YUSA 2XAFA 2FU4A 4G85A 1R5GA 3F3XA 2V4JC 4U0VA 2HZYA 3JCMQ 3JTGA 4CO8A 1NHAA 3ZQ7A 2Q1ZB 2IVMA 1VIFA 2M1HA 5CPRB 2HAXA 5JR3A 4D7NA 2ZFUA 1Z7NA 3K7AJ 1I39A 2L8DA 1G51A 3L2RA 4Q5SF 3ROUA 2P7VB 1ZGJA 1P4XA 5LJ5g 1T95A 2DDAA 2K5FA 1HTTA 5LHHA 3DB4A 4MHGA 4C92B 3CC4T 2BYVE 1LFPA 2BUDA 4LK0F 4KYWA 2BBYA 4BY1J 4J5YA 2E2HJ 1XSXA 1BR1A 4F7UE 2HVQA 1OFCX 2LY2A 5J47A 2VLAA 1M3AA 3VYGA 2O31A 2ZR3A 5F1RA 5KH6A 1D8KA 1WFXA 1WZOA 4X34A 4A0ZA 1UFFA 3JTHA 3V7CA 2HOSA 1WXTA 1RADB 2LOOA 4HWTA 4JX6A 1WXBA 3F8FA 4JOMA 3H6ZA 4FSSA 3I55T 3K2ZA 3ZN0A 4OAYA 2AKLA 2GQVA 3QYEA 2A61A 4M77A 1VQKQ 3JREA 4W1UA 4XMYA 1UGPB 2VBYA 3OS2A 4IL6C 1M90C 2ZNIA 4FSXA 1RAHB 4BQOA 3LA2A 2DMUA 2DT5A 4KH0B 2R7OA 3EYYA 4RTVA 1U78A 2F5EA 4N4NB 4ME7A 3OYMA 1FXXA 3G1MA 3RPUD 2PUKB 4J9FA 1IUYA 2DFHA 1BBZA 1LJOA 2LT4A 4XEMA 3E6MA 3LH0A 4B4CA 4G9YA 3PIOF 4JK1X 4ZH4F 2NVTJ 4C92G 1O3SA 2COYA 4JX4A 3CO6C 2HEQA 4BHBA 8ATCB 1VQMI 2D0NA 3M0RA 2EGCA 4GGGA 3OOUA 3JRHA 1YJNQ 3CCVI 4QPQA 5GAN2 2DN0A 1D1CA 4DIQA 5GAN8 2XF5A 4IUVA 1ETKA 2F5TX 4BHPA 3BQZA 3CC7T 2CGPA 4R1HA 3KIOA 3OSGA 2R7SA 4M6YA 4BS9A 1WCMJ 2RJCA 1DP7P 4E7KA 1YNZA 1YHQQ 3LSQA 4YTLA 4ZZLA 2PMZA 3MMYB 1OV3A 2OTLA 4FYWB 2MK5A 3PZCA 2VB6A 4B47A 2AQEA 1KK7A 4KUIA 5IN1A 1FPQA 2V8IA 5J26A 4BDYA 3HXLA 5FKLA 3ZN1A 1BI3A 3DEUA 1OZ2A 2RM4A 5DM7F 1F9NA 2ED1A 1I5OB 2B63J 2CP0A 1NG2A 3J7AO 4QVZA 1HK9A 4PSWA 3OYBA 2OCCH 4J8OA 3GFJA 2PMZN 3M7GA 1XG1A 1T33A 4XR6A 1RACB 1E0EA 2EK5A 2L89A 4N4OB 2R57A 5E3IA 4C92C 1R4NB 2VONA 1BI0A 2EBPA 1VQ4Q 3PFSA 1FTTA 3RKQA 2JM9A 2WSCE 4FE4A 2M02A 2KRCA 1Y8QB 1Z7LA 4A4KA 2VUBA 2DE0X 4FU6A 3E0JB 2NVQJ 3RKWA 1IZ6A 4OGEA 4X1EA 1JUMA 2QGUA 3VSLA 1V4RA 1NE8A 2CUFA 1ZSZB 3CC2T 3VRZA 1L3LA 2XASA 4ENNA 1JRIA 2OAZA 2Z2SB 3L2CA 2BY3A 3RYRA 4M7DB 2AXTC 2HQRA 1AWWA 4H2UA 1IRFA 1MV3A 1IUFA 1W7PB 2Y90A 5LJ3g 1XMAA 1NJIR 3O8VA 1Q7YU 2JJ7A 1XGSA 3QOEA 1JEGA 1BOBA 2V9KA 4AIHA 5ILUA 1YIOA 2FBHA 5BMZA 1A5JA 4BQQA 3QO3A 1B34A 2ID6A 1IL2A 4B9WA 4P3OA 3G4SI 1QNTA 1JJ8C 4UUVA 3ICAA 3CCUA 4K2EA 5GJVB 1IHWA 3TU4K 3GTJJ 4O6JA 5KHDA 2QA4T 2LRQA 2K3FA 5GAOn 2YXYA 1R0CB 4C2MJ 3LAJA 3HOWJ 2L2OA 2FL7A 4E7ZA 3DEEA 3CMET 2L7KA 2LKSA 5KYWA 4M7DG 1MBFA 5E18F 4V19K 1S72A 2RHQB 2Q2EB 4I02A 4V2SA 3KXTA 1Q86R 3PSFA 5IYCJ 3N4MA 2A3LA 1AVZC 4LGWA 3L42A 4A3GJ 4M77E 2YLBA 1X55A 3M1CA 2QTXA 1IGUA 4CICA 1TC3C 1RLQC 1QPIA 5K7FA 2QBYB 2DD5A 4J9CA 1W66A 4C5GA 3CCLT 1TQMA 4YDQA 3TEGA 3RYPA 1Z9ZA 3VS1A 1QHGA 4J9GA 2QXFA 1BR2A 1M2VA 1YJ9A 1AU7A 2P0PA 3HJEA 3O2PE 4RLQA 4LDYA 2CSQA 3WTSC 11ASA 5FKOA 2VKVA 3G1JA 1N8RU 3URGA 1SAXA 5HLGA 3ZQIA 4BXUA 2CG4A 2K6DA 1B7TA 1N78A 1J7KA 4BE0A 1QQJA 5LLQA 1ZSZC 3WG7H 1GBQA 1ETVA 4JP0A 2JWTA 3KP7A 3W6KB 4MZPA 4M7DC 1G59A 4CS3A 2X6XA 1A6IA 4F52A 3CCET 2HS5A 3QXEB 3KP4A 2XB0X 3I35A 3OL3A 4BU2A 2QDLA 1MMAA 1EIYB 2X4YA 2XDDA 1BBWA 4A3EJ 3CMAA 3LSJA 5BOXA 3JAMK 5EZGA 4DGWB 5IOYA 3M5AA 1HKSA 3QZ9B 5JHUA 4M78E 4J9DA 5GAGJ 5KE3A 1LFUP 1X3UA 2DU5A 2E35A 4AIDA 2UWMA 4YREA 3BG9A 3CCJQ 2MC4A 4M78D 4QTRA 4B8XA 1LPQA 4IVNA 3G6EI 3O6BB 1RKWA 3OBWA 3JCMb 3VS0A 2VJJA 1GFCA 2Y9ZA 2HDWA 1SAUA 1T56A 2HU9A 1FMKA 2XSDC 5CYVA 4PKCC 3QPHA 2RQVA 4OOIA 3CCRQ 3FRNA 2ZT6A 3I56Q 5GTHC 3NWTA 3M8JA 3H0IA 1USTA 3L2VA 1P92A 3WTXC 1U1TA 1VQNA 3NRVA 1WI9A 1VQOT 5J4VA 1B4AA 1AD5A 4FW1A 1K4TA 1P4AA 2VE9A 4IRHA 3V42A 1HDPA 3WE3A 2X3WD 1V5GA 1VQPQ 1YJWT 4Y7NJ 3HSEA 4KN4X 3ZOBA 2VVKA 2ZSHB 2J7IA 3ECOA 4XQ3A 1TQPA 4KBMB 4ZGEB 3FB9A 1BOAA 1VZ0A 5TJJA 1NEBA 2K4JA 1A6QA 4QVCA 1ASYA 1B7YB 5D4SA 3COAC 3S3MA 2LDUA 5FROA 2CH4W 3WG9A 3MEXA 2KKOA 4EEFG 4ZYHA 1JT0A 3IH4A 2ZT7A 4RGRA 4N9HA 2QQ8A 5GAN7 3F70A 1ACIA 4HW0A 1REPC 1OYYA 5EG0A 3SDZA 1IXRC 2ECCA 1ULYA 1JHFA 2ELKA 5KYNA 1RI9A 1VQ9I 1ZYRF 3LFUA 3QG1A 3GTKJ 3JRGA 4Z6YA 2X4HA 5I2MA 3PUBA 2HKXA 2N8GA 6PAXA 3MKLA 5F0HA 1HKTA 4ZDLA 3I0TA 5FD5A 5IHNA 4ZYGA 4HDUA 1R36A 4HV5A 5IYBJ 3BR3A 3WXMB 2EW3A 1ZLKA 3LGLA 4M73A 2I4LA 5JVGF 4NC7A 1KQ2A 3KP2A 1UHFA 1T0FC 3IRRA 2A28A 4L0ZB 3SD4A 1UGSB 4JZ3A 1ZREA 2A0FB 1OULA 4V2FA 3OYLA 2J3LA 1APLC 1VQLI 4EM1A 1XS9A 2LKPA 1XMKA 2NLUA 4G6DA 2NNYA 4WXCA 4YCUA 2PN6A 3EUHA 2G6FX 4W97A 3J80Z 5D6YA 4EATA 2KRHA 3Q9VA 1UHCA 5IP7J 4UUSB 5EJCA 2QM3A 2EKHA 2QENA 3LSPA 2ATCB 3QP6A 5CVIA 3GZ6A 3JB9G 3MVPA 4L18B 5IOZA 1JBMA 3UR3C 3KETA 3NAUA 2L3DA 2VQLA 3EETA 3TDUC 2QQSA 3O8GA 1G2BA 4IHTA 1S7EA 3DFGA 3G1ZA 4A3KJ 3VFZA 2D1HA 3ERRA 2GOXB 1Z3XA 3S2WA 3S93A 3DLAA 2VT3A 1HC7A 2E36A 1WHMA 4PFZA 3N5BB 3P8TA 5KCHA 1YWOA 1G3SA 3LOCA 4I09A 2LQNA 2VI6A 3EUKL 1E22A 3M59A 4ZN1A 3CLOA 2AKKA 2OTLT 5LGNA 1R1TA 1X2KA 1H4SA 2PVGB 4L5EA 4HPQA 1H92A 2LMDA 1KQ8A 2DA7A 1KC8R 3JCMJ 2L7FP 2VJIA 1T3LA 2IXSA 2EIFA 3IALA 4EGZA 1L0OC 1TOVA 2DA4A 4IHXA 1FP1D 3CJRB 3SFZA 4M75A 1KQ9A 1UG0A 1IN5A 4C5IA 1J5WA 2P7CB 5IAYA 4EMKB 2K3BA 4Y91A 1RL2A 1E17A 1IRXA 4NDLA 4BKXA 1FTZA 2HNHA 2H6BA 3GXOA 5GMKl 2AT1B 3KX2A 1G5HA 1BR4A 3MJXA 4ELYC 3JCMd 3JCMe 1B9MA 1VQMA 2F2VA 3CCVA 4PL6A 2D8JA 2Q7GA 3QAHA 1XTAA 3H0HA 2HPIA 1IV6A 3CD6T 5C6SA 1T3SA 5DCFA 3TOAA 2FBKA 1TBXA 5EEHA 4CH7A 2DK8A 2P5IA 3OL4A 2FJ1A 1BBUA 3FDYA 2JSCA 4FYXB 1C0WA 4PHCA 1NLOC 1K4US 4DZJA 3MFKA 3Q1JA 3CJTB 1OLTA 1X56A 1RR7A 3FKJA 4YELA 1GCPA 3LSIA 3BJUA 2ACJA 2RQUA 1JKRC 1DPRA 4ENJA 1SFOJ 2E3HA 2K2VA 5E3OA 4JJBA 3H1CA 4KULA 3HSRA 4TVWA 3IQLA 1KGSA 1TT0A 4HCZA 2Z3YA 4MEYF 1EFWA 4WCGA 2P6SA 3QHSA 1WGXA 1O3RA 2EFIA 2M0MA 2UZKA 3F8MA 5EYRA 2RI3A 3G1LA 3DU5A 3TO6A 2QEXI 4MFDA 4PLIA 2EIKH 3V7SA 1Q81C 4OF1A 2FF4A 1KHCA 3PNYA 4HG2A 1ETXA 3CCUT 3SB2A 4D5CA 3U9GA 2LREA 2XAUA 1QPMA 4J9BA 2DEQA 2MLKA 3M8FA 2JTVA 3EYIA 1PHTA 1NJ8A 4JJNK 1ZA2B 4HVWA 1ABQA 4TWAA 2ZFWA 4C3IJ 1WKMA 4NBQA 1WHJA 3PIOA 5HS8A 2FBIA 5FJ8J 3BY7A 2KMTA 2CT4A 3BPVA 4G94A 2EYXA 5J1YA 3CC4Q 3FEOA 2BE5F 2Y4YA 1S72T 3E9HA 2JRMA 2ZGWA 2EWNA 3CCQT 2ZXWH 4LDXA 1FOWA 1UHMA 2VIXA 3K4NA 1I5LA 2STWA 4HVCA 2A69F 4BBSJ 4IEJA 2DERA 3SHWA 4IOAF 2QHUA 2DDBA 2H1LA 1XPXA 3CUQB 1U06A 2XRLA 4XTWA 4AIJA 5B66C 1UCRA 4EMKC 3UFGA 3X26B 4I6ZA 2DETA 3DF8A 3I55Q 2E2IJ 1G83A 1O9SA 3D0SA 2EA4A 2E5KA 1I3QJ 1BU1A 4RB0A 4HF2A 2I5UA 1WDXA 2J6OA 2M30A 4CUGA 5FKKA 4LN2A 1YJ9T 4C92D 1RUWA 3J7AY 2DTOA 2DAOA 3JCMf 3TCJA 4KUDK 1IXSB 3ZQQA 2GZWA 4B3AA 2RHSB 1K76A 5DEQA 1Y7XA 3GLXA 3HPGA 1W70A 2GQIA 2ZZGA 3HFNA 3A8MB 3OYDA 1WJBA 4CC7A 5HS9A 2EH3A 2A6HF 1K6OA 4JS5A 4RS8A 3FMRA 1PSEA 1O57A 3GFMA 2RV8A 2FOKA 1VQ5I 2RO0A 3WE2A 1ZUYA 1GDTA 5K7HA 2F2EA 2NUTA 4P72A 1EV7A 1FZPB 1HW1A 2QK0A 2VBZA 3CC7Q 2TCTA 4UVAA 1PYSA 2AIRB 3UKGA 2DM1A 2FE3A 3QYBA 2V6EA 4QSHA 1O4XA 5GAEJ 3HOZJ 4P74A 4EJUA 4CCOA 2CQXA 2CUDA 2K02A 1YI2Q 2RQWA 5ELOA 1EZZB 5CKFA 2DXUA 5EF6A 5EEGA 2EBIA 3H5RA 4KIGA 5BS6A 4M75E 2C7IA 2WAFA 4UUTA 1KSWA 4FYYB 4J6WA 3H9GA 1A04A 4MTEA 1QLYA 3AG3H 2XF6A 1FIAA 4CS2A 4XICA 1ZR4A 1T38A 3WU2C 4LDWA 1YITI 4R8HA 2QYOA 2V1RA 4QT7A 3TMOA 4A3BJ 3A1PA 2RNAA 2DRMA 3B6AA 1FJLA 5J8FA 2QI2A 2IJLA 2AZVA 1AHJB 4BHCA 3UGTA 4B6MA 1VQNT 5HOOA 1OCZH 1J2XA 4U0YA 5GAMh 2O5RA 4M7AB 4LFUA 2HNIA 3FK7A 5HLIA 1BIBA 1EX4A 1Y8RB 1G5IA 3E1SA 3QYGB 4MZTA 1UB9A 1W1FA 2JS0A 3CC2Q 1M3CA 2M4KA 3J80K 5FU7B 4XRSA 3CUQC 2V6CA 5C44J 3H5NA 3E9FA 1J9IA 1KQSP 1Z6RA 2MOXA 1UUEA 3GOXA 1K6YA 3H41A 1MSEC 1S29A 2KDSA 4UHTA 2PVDB 4PGHA 3SEMA 3G6EA 4QQDA 5DS9A 4H2VA 2RA2A 2UXNA 1WPYA 1Y71A 2OQRA 1VQKI 1ZGWA 1N5ZA 1Y39A 3T8RA 2J5PA 2OA4A 3HSFA 2J05A 1K73U 2MFZA 5GAN5 3BWGA 4CH3A 4N0BA 2YU3A 2HSEB 1UJYA 1OI1A 4E7LA 1T2KA 2KSSA 2CH0A 2KRFA 3HTRA 4MFEA 1QCOA 2YHTA 2UV1A 2DKGA 4M7DD 3RIRA 4ABZA 1SRMA 1NJ1A 2F5VA 2ROLA 2R5ZA 4YRNA 2RD1A 2QA4Q 1MUZA 4X1VA 4YIIA 2EFPA 1W7PD 3WTUC 5KAFC 5C4JJ 1LNXA 3THKA 1YJNI 5JFRA 3LWIA 3HL2A 3CMEQ 2VKHA 4PJOB 1H9TA 2CDTA 1FT9A 1F5TA 4XSXF 5IXFA 2FRYA 2JXBA 3C3WA 4L6V5 1SRYA 3GNGA 2ZPEB 3MZHA 1YHQI 3DB3A 1VQ9A 5GTIC 4PJNA 3HL8A 5EGOB 4II1A 1BK2A 2YUOA 5FLXZ 3I4NJ 3JRDA 3ISPA 3SEQA 2EJRA 4ZTZB 4F3QA 1OQYA 1HOMA 2GTJA 4LNPA 1CQTA 3KP3A 3M0UA 4UXNA 1LEAA 1YP5A 3CCLQ 4RAZA 2LLKA 2CUJA 5F08A 3UWNA 2NUTB 3RJPA 4S04A 4LJZF 2E6NA 1X27A 1BC7C 2CFXA 4M7AC 1LYLA 3RF1A 1PYSB 1QCNA 1QF6A 1KU7A 4P75C 4OMNA 4ZIBA 3HY0A 3DTIA 2CV2A 3QKJA 3I9QA 2EYWA 5D6EA 2M3AA 2P4WA 1NJIU 2FPEA 1VQ4I 3M0SA 3I59B 3LW5E 5GADJ 3ECHA 3TQNA 3EGUA 5GAMj 2DL8A 1P4WA 5FU7C 4HV6A 4HF1A 2BXZA 4PJOG 1B8IA 4G12A 3JRZA 3RTRA 4DQ2A 5DD4A 1N8RC 2I0NA 3CCEQ 1M90R 2D8HA 5C4XJ 2NS0A 1KIKA 4C9YA 1HKQA 2J3MA 2EQJA 1VQMT 2BE7D 4KR3A 2XPUA 5HNHA 3KPHA 4NB5A 3CCVT 1BIAA 1BB9A 4ZNXA 3ABKH 2HYGD 4D5FA 2KE9A 2KIFA 3CCMT 4DW6A 3CXCP 1U8RA 3NENA 1NG6A 2XRNA 2GXBA 4OB1B 1LB2A 4CCNA 2LCLA 2QAZA 2DL5A 4IRIA 4EIKA 3MHXA 3K69A 3CMQA 3KFUA 4A4HA 4IPAA 3M53A 2QHVA 2EKOA 1ZG3A 2OF7A 3G73A 5GAOp 2RVCA 5GPAA 4Y33A 1M1FA 1AZEA 2PG4A 1BW5A 1ZRDA 1YW8A 1K9AA 2ALYA 1E3OC 2K4BA 5GP9A 1AOJA 3DXJF 1SFEA 1Q86U 2ISYA 4Q47A 2IRFG 2KGTA 2ZJPF 4GLMA 3QU3A 2BXYA 2IBDA 3E6CC 3A7AA 3CEYA 3MP6A 1VOMA 3TOBA 2UXXA 5LJ5d 5LJ5e 4EGYA 4IO9F 2OZ6A 3BTJA 2IS2A 1CGPA 4PJOC 5J3BA 3BR2A 1S5LC 4BQNA 3QJ6A 1MZBA 4Q15A 4KR2A 3DV8A 2G7HA 1YJWQ 2CZ6B 2F4MB 3H36A 1IG7A 2QTVA 2L5QA 4I98B 5J6XA 2CJJA 1GHCA 3ZFJA 3VPRA 4IZZA 4D6WA 1U8BA 3R0JA 1W5CC 4L0YB 1M8VA 4PJLA 1B70A 2E10A 1W1WE 2X35A 4BE2A 4HCCA 2CYZB 3ZPLA 3ABTA 3VUZA 1ITYA 2RNJA 2AS5F 5KYYB 2PMFA 3BC8A 1KA8A 3FXMA 2R5ZB 2Y9YA 1BN5A 3KP6A 4AT1B 5AIPA 3BY6A 3MQZA 3SDGA 4OMMA 2KZGA 1MH3A 2NVYJ 2XIDA 1ONVA 1J5YA 4LMYA 2L3QA 5GMKe 1IRGA 4HWSA 2VGMA 3AL0B 3AHUA 5D4RA 2DEUA 2L9RA 3M55A 1UMQA 2G0EA 4RTWA 2K3XA 4C0ZA 1M1KR 1V5EA 5DCMB 1WHGA 3BG6A 1SKUB 1EH8A 4R0KA 5LD2C 2PQWA 4PCQA 3VS7A 2HQ5A 4CCLA 1QVGP 1NJ5A 4KNYA 2QEXA 3REOA 1H641 2RGVA 4XN3A 4BNCA 3A02A 2P4TA 4LLNA 1XNIA 4OINF 1BI1A 3C1DA 1R00A 1QWFA 3JB9D 1RI7A 3CMMA 1NZ9A 2HXIA 2DXTA 5K1PA 2FPFA 4LUDA 1GUUA 3HTZA 5LGTA 2K5CA 5F0FA 2DDZA 3DPLC 3OQ5A 2KBTA 3OYAA 3E3VA 2X1EA 2GGRA 4AFZC 1SVOA 3OMGA 2VWFA 5H6RA 3HFZB 5DV5A 1S6LA 3TO7A 5HLTA 4MEXF 3SYTA 3VQXA 4F93B 2KPMA 4UV9A 4DOWA 3HC7A 3HBLA 3CCJI 1UEBA 3TVTA 5HDGA 2BIVA 1R22A 3IKMB 1XCVA 2F69A 1WWXA 2IY5A 3RI4A 2FUG2 2X4WA 2ZT5A 1SHFA 5GANh 3PO2J 1LDDA 3CCRI 5LJ5f 1CKBA 3I56I 2KRMA 2AHJB 2OJED 2OTLQ 4QQ6A 4GCVA 2O4XB 1WFWA 4WJ4A 2CP2A 5BNGA 1JJ2S 3W3SA 2VE8A 1Z1DA 1VQPI 4JLGA 3M54A 2HL3A 1BI2A 3UATA 2XAHA 4FISA 1GBRA 3FBNB 1SVMA 3CDLA 4JUVA 2RI2A 4NQWA 3QSUA 1B07A 2A07F 3LLRA 2C06A 2XKOC 2DA1A 2RN8A 3WU1B 2ALYB 3K4BA 3BP8A 2OTJI 4AU7A 1ZX6A 1VQ5A 3IUOA 4QW2A 3P9KA 1W0UA 1NTCA 2MAMA 3M0PA 1UJ8A 3BOQA 2R7XA 2CZ7B 1SF9A 4FM4B 1X3ZB 3CD6Q 3AL0C 3JCMg 2DW4A 1ZK8A 2LFBA 3KE2A 1X3WB 1PKTA 2FOWA 3ZMZA 3NFCA 5M5WJ 2AMCA 1AWOA 2JA2A 2G9WA 3GEZA 5I21A 2CW7A 5L23A 5E1ZB 2E5NA 3VS4A 2L3RA 4M78F 2MWOA 4EO4A 2Y48A 3GF5A 3RL6A 1FWZA 3HXUA 1VQ8T 2CQ7A 3HOXJ 1PNJA 3U2RA 1H4QA 2DU7A 1YFSA 4E51A 1X6GA 1U3EM 4M6XA 2V9PA 5FGMA 3RDVA 1B70B 3MKDA 1QA6A 1OYWA 1W4MA 2JA8J 1EQRA 1AT1B 5ICEA 3G6ET 4JRQA 4RTTA 2K9NA 4D0PA 1YITA 2C0TA 2VC0A 1VQ7Q 1VFCA 4BE1A 3LQQA 1X54A 3WTYC 4RB3C 4XEOA 4YRKA 4AD9A 4PZJA 2O2OA 3ASKA 1KU3A 2ADUA 1YTYA 4O3MA 2LRDA 2ZJ2A 4U87A 4NC8A 5E3NA 1EH6A 2X4XA 4A12A 1TP4A 3V8KA 1J09A 2JN6A 4RAFA 4LOCA 4FHTA 2LX9A 3GWZA 3A01B 1NPPA 2Y30A 4DBFA 5ED4A 1ZARA 4P9FA 4XTYA 3L7WA 5C3EJ 1KC8U 2Z1DA 5CK9A 3H9NA 3EG0A 3W6JB 2F2XA 3JSPA 4F55A 5IP9J 1YS7A 3PM1A 2R0QC 3EDPA 2EZLA 5D5WB 3FC3A 4WI1A 2W82A 3FLGA 3D5RC 4M3DA 3V4GA 1GV2A 1V55H 1XDUA 2HBWA 1S72Q 1SETA 3HFVA 5KYXB 3CCQQ 2HFHA 2DO3A 5GANj 3MP8A 3Q5FA 3OIQA 1IGQA 2FZGB 3QO8A 2R7DA 3MAJA 2E1CA 2XGCA 1P9QC 3NEMA 2KP6A 5K1XA 4AG2C 4PFOA 2KROA 1LEBA 2YSRA 1OCRH 1VNDA 3IKLA 1Z77A 1GXPA 3CF5F 2VV5A 4C8QB 1HYOA 5B3SH 4RAGA 1WJEA 3FF5A 2PX9A 5ICFA 1QBJA 1YJ9Q 1KMNA 2KMUA 3F23A 1SSFA 1BL0A 1R8OB 4HQEA 2FX0A 3KEQA 3QO7A 2H3JA 5ECAA 4BBRJ 4IHSA 2VT2A 1B3QA 3BE3A 4GO1A 2EL9A 1W5TA 2XAJA 2AXLA 4JS4A 5L3BA 1KMMA 3GTMJ 2B0LA 4HXJA 4GDFA 2HOAA 3QYFA 5J4YA 1WA7A 4YRMA 2KT0A 4CDGA 4G6QA 3M9AA 3ZRGA 3JCMP 3U23A 3M4PA 1K78A 4MZMA 1VQ6Q 3F22A 1Y1VJ 1YHQA 4KGXB 5CKHA 2HTSA 3LSGA 4E6KG 2EJFA 2FPDA 1I6XA 4PJMA 4P71A 2V9VA 4M9SA 2YUPA 1U2WA 3CBMA 2LTOA 2HQNA 2CRGA 3E2UA 1TW2A 1H88C 4XLPF 4DA4A 2I4MA 3DPTA 2CKKA 2OPTA 3E6DA 2R7UA 4C8QG 2YSQA 2HPMA 1WJ5A 4KISA 2QQ9A 3FWEA 2NOJB 1TXQA 4Y52J 2AMCB 3M4OJ 2MMPA 4OP0A 4JDSA 2DIQA 1FSEA 2LC2A 2RQQA 1X2MA 2D9TA 2BHZA 4HVVA 2GAUA 4JRKA 1AEYA 1VQNQ 3PVLA 4EVIA 1NK2P 4F16A 1G2HA 4A54A 5TRDA 4LD9K 3CCST 4ANJA 1QHHD 2R5YB 4CHUA 4L9TA 3BDDA 3ULRB 1Y0MA 4LLLA 2NUPA 2H94A 2Z16A 3B02A 3E5XA 3ZMSA 3CC4I 4FASD 4JRIA 2CV0A 1DDNA 1J75A 1XOVA 2EQKA 3ZMTA 3NTHA 3CP2A 2E5ZA 2DA9A 3INZA 3IWZA 3BTIA 2FO0A 3TBIA 2HR3A 5FWCA 2XSJC 3RUXA 1YW9A 4J6YA 2M5WA 4C8QC 2C8MA 2E7XA 2VQGA 2RK1A 3HRTA 5IY5H 3UNGC 5IT3A 4H4KC 4M7AD 4AFQC 2HBPA 2RHXA 2ISZA 5L3CA 1IHVA 1VYVA 5GAHJ 4HA8A 4BI3A 3EFOB 1EOVA 2RPNA 4XLNF 1J3TA 2OBPA 3BTLA 2MI6A 1FOXA 4MQ9F 2OJ2A 2QQBA 4CYDA 3F0CA 2IGOA 1SFKA 2X0LA 2ZSIB 4C0DB 5LHIA 2ODRC 3S3OA 3DP7A 2FMYA 1K73C 1VYTA 4UP7A 1Z67A 4J9HA 1K8AU 1HW2A 2HQXA 5C53B 4WCIA 2QKLB 2HDDA 5KYUA 3L2ZA 3D5SC 3TP3A 1K0XA 4LG0B 3PIPF 1YGBA 3FXJA 2KXCA 3MEUA 3QWLA 5K1YA 2XTIA 2A6TA 3CC7I 4LVLA 3OR1C 3IRQA 1ZHIA 2HWVA 3EH1A 1YI2I 3L1PA 2FZCB 3EG9B 3K1MA 2HDCA 2ZZDA 3KYCB 3AG1H 2HQEA 3RGLA 2RI5A 4U0WA 1WHKA 1GRIA 1UZCA 3WHBA 2HEOA 3BTCA 1I6HJ 1KQ1A 1SFXA 5FKNA 3RKYA 2M0YA 4K87A 2XPVA 4O5VA 4XU3A 4FYVB 2M8GX 2DJZA 2LCCA 1NJ6A 2XDVA 2LBFA 2UUZA 1YYVA 2VJ5A 2ME0A 4YIRX 4PJOD 3WU0A 4C92F 4R55A 3I58A 3VS6A 1Q82R 5F1JA 2F2WA 1ATIA 1GLNA 3BR1A 2ZBKA 1FX7A 2BY2A 5DLQE 4UV8A 1R77A 4FIBA 1QU3A 3U1KA 2K3YA 5EC7A 2ZNZA 3VEPA 3BG7A 2WACA 3J81E 4XORA 2K4YA 1TT5B 4QLCU 3I4PA 3I3LA 1DGWY 2RHUA 3H9QA 2Y75A 3L2QA 2JQ7A 3CC2I 2F5KA 2JUGA 2RH2A 2EAYA 4XKBA 3C95A 3NWSA 2LCSA 3J7ZI 3KLNA 3CQZJ 1D8JA 1UGQB 1VQ5T 4CH5A 3KZYA 5LJ5h 4PFPA 1CSKA 4Y92A 3FXUA 3G7ZA 3CCVQ 3CCJA 1UHWA 3CCMQ 1SESA 2QQAA 2NS6A 2M0OA 3PCOA 4ESJA 2IA2A 2ESNA 2XK0A 2FZKB 2DVEA 2ZPHB 5E3MA 4GYIA 3ONQA 1U5TB 1OU9A 4FT8A 3BJOA 4BY6B 2LJ0A 5E79C 4AYBA 4N0AC 3M4YA 4IRGA 1AOYA 5GAN3 4XLAA 4EV0A 3I56A 4ZC3A 4HZFA 2AQFA 1MJAA 3GMEA 2NUPB 4BXFA 3OSVA 1RIQA 1T39A 2R7QA 2OC6A 2KZVA 2GIZA 4J6XA 2KEAA 4C0DC 1KU2A 4RM3A 3ABMH 2OD5A 1BM9A 2CUZA 1USYC 1ZHFA 3WGGA 4OIPF 1E3HA 3META 1VQPA 1MDMB 1DJ7B 2EINH 4CC2A 2ECBA 4AYBN 4M72A 3FXLA 1TWAJ 4A0YA 9ATCB 5C51B 1TTHB 2RNGA 4O2DA 3JAMZ 4F7UB 2QHSA 5CKDA 5GMKh 2SRCA 2WA0A 3CMEI 1QVUA 4G6TB 4A69C 2OTJA 2ECZA 5FLMJ 2M1BA 2IAIA 1R5HA 5FD6A 2CP3A 1DU6A 5KCMA 1SRLA 5JI6A 4AVPA 1WJRA 3JRFA 4L59A 2HYJA 3E6BA 3H3ZA 2E65A 3T9NA 3OV8A 3MKWB 1HD3A 2DPPB 4IXAA 2FXAA 4X6AJ 4CZZA 2EV0A 2MCNA 1X2GA 4JPBW 3ASOH 1SPKA 2EQMA 3CCLI 4Y15A 12ASA 4L5JA 2VPLA 2W24A 2NYXA 3BDLA 1T0JA 5HLHA 5IYDJ 1OYIA 2DK3A 2CUEA 1TWCJ 1FBUA 2XGDA 3ULQB 3LWHA 2NYSA 1OR7C 3C2BA 1H0MA 2O9LA 2XGTA 3R0AA 1KQSS 1OKRA 5GAOm 1M1GA 3S1RJ 4F7UG 4I7HA 4BJ6C 2PJPA 5GAOq 2MW8A 3VS3A 4M7DF 3P8BB 3ZQGA 1GCQA 2L3SA 2O9VA 1ODDA 1Y96B 1WLPB 3EG2A 4DZPA 5CR2A 1E2XA 5KK1A 4MO7A 1B59A 2DOAA 2PUOB 1ZELA 1PP7U 5H6QA 3PE0A 1D3BA 4Z8AA 1G5VA 3CCEI 2XB5A 3M4GA 2MABA 1IN6A 2DA6A 2COWA 1KZHA 4FL6A 2ELHA 1IXCA 4RTZA 3KZIC 4I0AA 3FK6A 1C6VX 4N9IA 5J40A 1U5TC 4A3FJ 3LSRA 1RZ4A 4EMSA 4NS5A 2O03A 3HB9A 5B1BH 4XM3A 1WNLA 3E5QA 1Y0NA 2OI3A 3FM5A 2CZ1B 2M87A 2JTEA 4HCBA 2VXDA 4OB0B 4JLIA 2AKWA 3H3UA 3CESA 2R7FA 4B9XA 4XK4A 4CCJA 1H4TA 1IZ1A 5LJ3h 2IA0A 2CW8A 2X48A 1TNSA 3PNWC 4M78A 2K57A 2CWEA 1I4K1 2BW3B 2EZIA 1Y1WJ 2VJ4A 1MKMA 3S3NA 4M3BA 4HNUA 1PWTA 3QNEA 1IV8A 2KR3A 1JJ2A 2CFOA 3PFIA 2XDBA 2Q0OA 5ERIA 4P55A 4P73A 4XU0A 4H2SA 1OU8A 3PNVA 4YP0A 4FCYA 3S17J 3JB9J 4A5NA 2DT6A 4I99C 4IUQA 4RG2A 1ON1A 1MMSA 4RMOA 1X2QA 1V5FA 4HYEA 1BJAA 3QU6A 3SWNA 2XGEA 2PQ8A 2GQQA 4YFNF 1RAGB 2DLPA 1M1KU 1X4PA 2DXBA 5E8GA 1X1CA 2NRAC 4Q48A 2PVOB 2DYSH 3A8HB 1B1BA 4OGCA 3W6VA 1LCKA 1OCOH 1GXIE 1ETYA 4Y13A 2DFIA 4X9CA 1AKHA 2K9MA 4ENMA 1X6BA 1ZKGA 3OWTA 3HUGA 1N8RR 5CQEA 1X6OA 3MZYA 3NARA 2ZPBB 3WTTC 2JNGA 2M16A 2NS7A 2E5QA 4C0GA 4KDPA 3EFSA 4Q5WA 1VQ8Q 3A7UA 2FEIA 1NBEB 4JJDA 5B5EC 3PNTA 1WH5A 2HQHA 1DUXC 1ETWA 4M9ZA 3PUFA 4HT9A 3K10A 5IXBA 3M3YJ 2DAQA 2DTRA 2GIVA 4FETA 3HHHA 3VYTB 3QPSA 1D5YA 3CXCS 3SZGA 4FTHA 1TL8A 2Z9OA 3GO5A 5D8KB 1WQ2A 2A8EA 1ZA1B 4ZTFA 1G8XA 1L0WA 3QUIA 3UH0A 4M77B 1RLPC 1W5SA 3IAS2 1RABB 4RGSA 2DIGA 2LD5A 4P3NA 3D5LA 5A0GA 1G4DA 4TQDA 4RDXA 5E1XA 4I01A 3CC4A 4BQAA 2ESHA 1JJ2P 1YIJT 4P96A 2C0OA 1ETQA 4LXCA 4LB6B 4WWCA 2F5FA 4A3LJ 3FX3A 2GM4A 3ZP5A 4XTVA 3LA3A 5B1AH 2IGKA 1H8KA 1RR8C 2Y4XA 4II3A 2MGQA 4M9XA 1D3BB 1IO2A 2COBA 4B44A 5LJ3j 2WWYA 4AMCA 1KC8C 3AT1B 1FY7A 2E4HA 1K9MU 4IUPA 2DJQA 4LE9A 3M4QA 3CZ6A 4PSXA 2FA5A 2M9UA 4WXHA 5AT1B 3L4GA 1FYKA 5F5WA 3M0TA 4RCBA 3CF2A 4LLGF 5FU6B 2BGCA 1KG1A 2LNBA 2O9SA 3ERED 1TWGJ 4A93J 3H9JA 4DJAA 3GX4X 4S0HB 4M77G 1HSJA 2J5OA 2VKDA 3F72A 4HNTA 4N4IA 2DYIA 1U1SA 2OAWA 3P9CA 5K7ZA 5L3EA 3JB9F 1F4KA 3N05A 2O0YA 4M78B 3EG1A 3C94A 1GT0C 2D0QB 1F43A 4JX5A 4QKUA 2COMA 2JTFA 3TP0A 3ABLH 2XHCA 2CIMA 3REXA 1P6RA 1SD7A 3CD6I 4YYEA 1K1ZA 4RCCA 1D5VA 2YDLA 2QUFA 2ICWG 2NOGA 4TVAA 4KIFA 3GP8A 4IIOA 2Y69H 4YRPA 3CC7A 1QVGS 2DODA 1KU9A 2E12A 1TUCA 2EPFA 3A7RA 4N4HA 3OIPA 2DQ3A 3V8JA 4U7DA 4J9EA 1YI2A 2E1OA 2QWWA 2KK4A 3GTOJ 1QWEA 4C8QD 2ZPGB 2E60A 2XAQA 4UC4A 3SWNB 2ZCFB 5CKBA 2D1XA 3RR6A 2DNUA 4HRIA 3R4KA 2EVRA 1ADJA 3HXYA 2XDPA 2R7ZJ 3F6VA 3BCBA 5J1UA 3S1NJ 1O3TA 4HVUA 4ZYEA 1W4SA 2WY7Q 2X3XD 1ZAOA 1LVAA 1VQ7I 4IKFA 4RKUE 4M77C 3HDDA 5AYFA 1MNDA 1AKHB 4H2YA 2CGHA 2NAZA 1Z9QA 4V2GA 3HUGB 3IAM2 2ODRD 2EV5A 4F17A 5BPDA 5DD8A 5M3FJ 2OAUA 3NTKA 3MEYA 1HC8A 1B34B 2DL7A 4CI0C 2OUMA 1X19A 4A3JJ 2KI7A 1EJ9A 3JB9I 1B76A 1B6AA 3WGIA 2F4IA 3CC2A 1JKOC 3G71Q 5GAN6 5HNFA 3CCSQ 3WTZA 3S6WA 2HOEA 1KFZA 1OX8A 3PIPA 2OTJT 1P7IA 3ZQLA 3SDBA 2X6WA 1S72I 2E64A 2ARUA 5J3LA 2JVHA 4A63B 3GTPJ 1WYXA 1R5ID 3IC7A 1NEGA 3CCQI 1XTDA 1FMVA 2D45A 4OU0A 1E1TA 3CP8A 5KYWB 1IDZA 5FU6C 2I2LA 2BY1A 4E7HA 1PDNC 3QPLA 2KNBB 1LDKB 1C1AA 4RB2C 1WJQA 1QZZA 5GJWB 4MGRA 4ESFA 1PRMC 2IGNA 1D1AA 1OYXA 1FSHA 1I27A 3T0YA 2SEMA 2I4NA 5J1RA 4UVBA 1HSQA 1FLIA 3TEHA 1T08B 3A1YA 3OMCA 1HBXG 4J7FA 2O7OA 3EGDA 4XKVA 4EM0B 1T0HA 2RK2A 4C92A 3DEWA 2EYYA 3TDZC 2IA1A 2DA5A 2KISA 1M2VB