3V7CA

Cystal structure of sabpl in complex with inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
total genus 103
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7cA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7cA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7cA02
4P3NA 4HF1A 4XTVA 5DCFA 3RPQA 1LOJA 4UVCA 3WGHA 3A32A 1R1VA 2DZCA 4CH3A 1UHMA 2J5PA 4WF2A 3ROUA 4UVBA 1ASYA 4KIBA 2FSWA 3AHUA 1IUYA 5C53B 1HQCA 2FE3A 3JCMV 1OPCA 1CF7A 4XSXF 4U0YA 1J59A 3NETA 3HIFA 3G73A 1DP7P 1SD5A 1I1GA 2E64A 3OD1A 1BIBA 4AIJA 1IN4A 3JCMc 5HLIA 1C0WA 1YB3A 2V1XA 3RERA 2HYGD 1TBXA 2QQBA 2C6YA 2FB7A 5L3CA 5D5VB 2MC3A 5LEKA 3D0SA 2XTIA 3L4GA 2CFXA 4KN4X 1QBJA 2OA4A 2M8EA 1O57A 5LJ5g 3JCMd 4QWQA 2HKOA 3HHHA 3KFWX 1K7AA 1LQ1A 1DPUA 4TVYA 2ZNIA 4LG0B 3J81Z 4MGRA 4MEXF 1MDMB 3R07A 4Z2YA 3HXWA 5HS9A 4OINF 1I6XA 3FB9A 2A68F 2CG4A 5LLQA 1ZRFA 5F6FA 1CGPA 4N9IA 3IRQA 2DO7A 2XASA 4AIHA 3LFKA 1PYSB 1O7LA 4PZJA 3EFSA 2W84A 4H2XB 3L00A 3HRMA 3FF5A 3NRVA 1F4KA 2JTVA 3WU0A 4HWTA 5GANd 4KN7X 1BC8C 3HRTA 1AWCA 2OD5A 5GAN2 3MZYA 3WTWC 2AMCB 2P6TA 4LB5A 1XD7A 4FT8A 2ZFWA 3C18A 3JCMP 3NQOA 4M9SA 1YG2A 3M8EA 3RKYA 1V3FA 3OV8A 2VE9A 1X54A 4C8QB 2FF4A 4YP0A 3JCMJ 2DW4A 4UNOA 1H4VB 1KU9A 2H27A 4JBAA 5F5WA 5D6FA 4UP7A 3ZMTA 4AVPA 3RL6A 4YRQA 4ESJA 2M87A 1QZZA 4HZFA 3P8VA 4XU2A 1KQ8A 3QHSA 2QYOA 3ZP5A 1MGQA 2KIMA 3HSFA 4EO4A 2CJ9A 2BV6A 3E6MA 4P72A 5GAMd 1TQIA 1H9GA 4PJOF 2O6GE 3FMSA 3QTCA 2VN2A 3RUXA 1AOYA 1HK9A 3ECHA 2MH2A 1W7PD 4TQDA 1IXRC 1MDMA 1B34B 3U2RA 3FXQA 1WSUA 4BYYA 5KK1A 4PJOA 2R3SA 1WQ7A 2QBYB 4XTYA 4J5YA 4I09A 2QTXA 2XAQA 3F8CA 3K0LA 4LGWA 2RM4A 2XAGA 1FSEA 1G5IA 4GYGA 4S05A 2NNYA 1XB4A 5FLXZ 4KIFA 3KFUA 1YYVA 1W5SA 4C92F 2O3FA 1T6SA 4H0EA 2O61A 3A74A 4HF0A 1T39A 2LNBA 2DTHA 1W5TA 2YR2A 1KQ1A 1P4WA 3P8YA 1FYFA 5E1WA 1ZG5A 2YX7A 4MMKA 3DP7A 1G4DA 5GMKh 3HXYA 1IN5A 5FFXA 4X9DA 3RJPA 1HW2A 2ZR3A 1Z91A 4Q4ZF 2R7FA 5E1XA 1J9IA 2HGCA 4V2SA 2D45A 4L5JA 2D1VA 3IG2A 2W57A 4NL2A 5CYVA 2RA2A 2ETHA 3DQVC 4M77D 4M75F 2E1NA 2V9VA 3IHUA 4M78F 1R23A 1USYA 1H0MA 4EMHA 3FZVA 3K1PA 4RB2C 3A5YA 5GAOm 3GYHX 3BPXA 1NYRA 3EYIA 5GAN6 5GANj 1ZG1A 4M72A 1X2HA 4Q47A 1Z6RA 2E1HA 4TVWA 3G3ZA 2JT1A 4H2UA 4M75A 2EJ9A 1KMNA 3BJUA 5LJ5h 4OLFA 1EFWA 1LYLA 3HY0A 1STZA 2YHTA 4G6DA 1YQAA 3T8RA 4HDUA 4ZIBA 4A0ZA 3RPUA 4I98B 2ZT8A 3RKWA 1I4K1 5HDKA 1ZLJA 2H6CA 1JRIA 1HW1A 5ILSA 3NELA 3F8FA 2H6BA 4Y17A 2QHVA 4A5MA 1FY7A 3TO6A 1IZ1A 5GAMj 4M7DD 4ON0A 3ZMZA 1ODDA 2Q7EA 1SAXA 1IXSB 1B9NA 3B73A 2Q7HA 1YW7A 1ZGAA 3H3UA 1WQ2A 5K5RA 4K87A 5DY9A 4XSZF 3KP4A 1XGNA 3DFGA 1BOAA 2K57A 4MQVA 4ENMA 1EQRA 3JB9I 4WCGA 3RGLA 5ICEA 2IRFG 4LLNA 5GAOl 4BHPA 3IKMB 4M6XA 2J5OA 4L9TA 1MJ9A 4FX4A 1ZH5A 4Q15A 3EUHA 2Q2EA 4OIPF 2JRTA 5GAN5 2L54A 3I59A 1I81A 4WX9A 1G3YA 4MMLA 5FD5A 5K5OA 4XTXA 3GIBA 1G3SA 3KZYA 4TQFA 3VQWA 4DNCA 1EV7A 3P9IA 4ETSA 4BNCA 3SZTA 4HWPA 1USSA 3RESA 1KA8A 1KQ0A 5HDGA 1ON2A 3IKVA 2A07F 1OR7A 2EJRA 4CYDA 1NJ2A 2EWNA 5TJJA 4EMKA 3K69A 4C92C 4N0BA 3J7AO 3CDHA 4AH6A 2EAYA 3M4QA 3RYPA 1FYKA 5J8FA 4N0AC 2K4BA 3KLOA 4I0AA 1ON1A 5L3DA 4YREA 1YLFA 2ISZA 4XLNF 4A2UA 1QGPA 2EFQA 3JCMb 4I01A 5LHGA 4P9UA 3SHFA 2ZT7A 2IA0A 4HF2A 1USYC 5K1PA 4RDXA 1G51A 2RGVA 4TTVA 3BOQA 4UXNA 4AWXB 2Z9OA 1K6OA 3A5ZA 4L87A 5GAN7 4JK1X 1QPMA 3E5QA 3HRIA 4X9CA 1EH8A 3HHGA 5FGMA 3V4GA 2VODA 4M78C 3ABTA 4F7UF 1QF6A 1LDDA 4ZYEA 2DQRA 1W4MA 4LLLA 3M4PA 5AIPA 5GMKm 3KE2A 4J6XA 4HWSA 4FHTA 3L9FA 5ILUA 3WE2A 4EJOA 4C8QD 1N9SA 3HOTA 3QU3A 1FBQA 1A04A 2HQNA 3IKLA 3QO7A 2K02A 3BWGA 2W25A 2ADUA 4OIQF 2COMA 1J7KA 1KU2A 3J81K 2I4LA 3I4PA 2P6SA 3T5XA 4X5OA 3D5LA 1JGSA 1XN7A 2AXLA 1YFHA 4E51A 4QLCU 3T1BA 3JB9H 1USTA 2EFPA 1Y96B 2CIMA 4PJOE 5BMZA 3ZN0A 2OZUA 3KETA 4CS4A 2PQ8A 2YLCA 5I21A 4BXUA 2AKWB 2L4MA 2XIGA 1O3QA 4WJ3M 4PGGA 3QP6A 4O3MA 3JCMg 4B8XA 2F5DA 3PQJA 2BGCA 3VOEA 1DDNA 2VC8A 4M74A 2V6CA 2UXXA 2XHKA 2XKPA 4Q48A 2A6EF 4ESFA 2ZKZA 1ZYRF 2P5IA 1MJAA 3CMQA 2ZCEA 3HSRA 1X55A 1BI0A 4R8HA 5DCMB 2RVCA 3MFKA 4C92E 2IY5B 2ZT6A 4U7DA 2XROA 5GMKl 3QU6A 4EVIA 1ZLKA 2ZZGA 3FX3A 3R6SA 1ADYA 5GANg 4KICA 3JW4A 4OIRF 4YRPA 3LA7A 1BJAA 4YRTA 2OZ6A 2CW0F 5ICCA 3U1DA 4EMKC 3DF8A 3E9IA 3F6OA 4P75C 3FIFA 4M9ZA 3SQNA 2WTEA 3M9AA 5E17F 4WXDA 2ODRD 3QOPA 1SFUA 1B4AA 1NNHA 4I7HA 2DAOA 3R0JA 2RDPA 2MLKA 1IL2A 4P3PA 1Y96A 4M7DB 4L9NA 1QNTA 2ZNZA 3TQNA 4M75E 4M78E 4M77F 4YRGA 3QNEA 2CQKA 5A2QZ 2OAZA 4HV5A 5FLXK 2FA5A 4RQEA 2AKWA 2F5FA 3RIRA 1ZRCA 5GAMg 3COAC 4M77A 1R36A 2PLYA 2A6HF 5ICFA 3SWNC 3K9TA 2OU2A 5D5UB 3CUQC 3FXRA 1TH7A 3SXYA 2L01A 4BHBA 1DUXC 5EEHA 1TNTA 4ASNA 3L2CA 3P9KA 4Q6GA 1BIAA 1XSDA 2OQGA 5H6RA 2ACJA 5DCMA 2IY5A 2OQRA 1JJCA 3QSUA 3ICAA 2WWYA 2A5YB 3BZ6A 4PHCA 1EVLA 4ZTZB 4M7AG 4JRIA 1FWZA 1SFXA 1YW8A 3CTAA 4IRGA 3H3ZA 3JB9J 1B9MA 1U3EM 2GWRA 2K27A 4AD9A 4M78G 1IN7A 3MCZA 2RHQA 1J5WA 4U0VA 2IT0A 5GMKe 3QO3A 1PUEE 4HVCA 4MEYF 4P5OA 1B59A 5LGUA 4R1HA 4YRKA 2FMYA 2XKOA 2XUBA 4K86A 1GGMA 4M7DA 1B8AA 1WKMA 4UUVA 2VXFA 1XDUA 3GFMA 2EJGA 2NNNA 3O2PE 4P73A 1KYZA 3DKWA 3FHZA 4UVAA 2VBXA 1JE8A 1X01A 2UWMA 1I27A 1U6GA 4PDKA 4I02A 3ERED 2A69F 1V4RA 2EFOA 4XEMA 5LJ3h 5CLSA 2GA2A 1HKSA 5GAN8 2VC1A 4XTWA 3VQXA 2EK5A 2QWWA 2NRAC 2G7UA 4XU0A 4OOIA 4TWAA 1MD0A 5L3GA 4WWCA 2DQ0A 2HFHA 4CGZA 3JCMh 1U5TB 4NL3A 5KVRA 2L3DA 2FXAA 2IVMA 3WTXC 3P7NA 2DTIA 4YRRA 3HXXA 2KJBA 4P71A 2YPRA 1C0AA 2KIUA 3RF1A 5DD8A 2PN6A 3W6KB 1FSHA 4G84A 4YG2F 3WTSC 1S8NA 5D5XB 3BROA 1R5HA 3REUA 1VTNC 4EM1A 3BW1A 1MGTA 5FD6A 2RB6A 4P3OA 2LF7A 2LF8A 4NHJA 1S3JA 4TV7A 5GANh 1M8VA 4IRHA 2IP2A 4KYWA 2QVOA 1E1OA 3TEGA 1L0OC 1S7AA 5ILVA 1KU3A 4MQ9F 4HX8A 3M8FA 3VU3C 2Y90A 3A7AA 4YPFA 1KYWA 2FNAA 1RIQA 2ZR2A 3VEPA 4UP8A 3C7JA 4PG3A 3I5UA 4LG0A 3L09A 4F7UE 3WTVC 3QO5A 5FFZA 3ECOA 5GAOq 3R60A 1T0FA 3HTUA 4UPAA 3MQ0A 1PYSA 4KT5C 4H2XA 4M7AB 4C8QF 4H2TA 3SZPA 1XSVA 3K2ZA 1U5TA 2AMCA 3WGIA 1NHAA 4M78B 3DXJF 3WTZA 3F8MA 3JAMK 4HBLA 3AAFA 4HQEA 4EMGA 1Z1DA 2GAUA 2B0LA 4KMUX 2CYYA 4LFUA 4C8QA 3JB9G 4YRSA 1SETA 5FO5A 3GEZA 5CVUA 5CJ9A 3EETA 4U0WA 2DU5A 1YCYA 2E1CA 3HFOA 4HDVA 3LSTA 3WTYC 1MJBA 2E3CA 5J8CA 1Q1HA 4XBFA 2DXUA 1FOKA 4F7UG 1N9WA 5ICGA 2QLZA 3MF2A 2GXGA 2IA2A 4HAMA 1FX7A 3BY7A 1GHCA 3TDUC 4IPAA 2G7HA 1ULYA 5E3IA 4LD5A 3L2ZA 1YGBA 3CLOA 2HQRA 2V79A 5JI6A 2JPBA 2HNIA 2G9WA 4EX5A 2RQPA 3GF2A 4RGRA 3U9GA 1IAWA 4OMZA 3UFGA 4J6YA 1B34A 4GYIA 1BC7C 3Q9SA 1ZARA 1U8RA 4KUMA 2QBYA 5F1RA 2ZT5A 2CWEA 2FRHA 1LDJA 3T8TA 3ABUA 1IF1A 4LNSA 3WODF 2DTRA 2ZGWA 1Y0UA 2QHTA 5LJ5f 2H09A 4QVCA 2DK8A 4EQQA 4N9HA 2KKOA 3WE3A 2I4OA 1S7OA 3HXUA 4DPGA 1U1TA 1YFTA 1TQMA 3GW2A 3V8LA 1R1UA 3HFZB 3INZA 4HX7A 4CDGA 2H94A 4CS2A 1IW7F 1U1SA 1RZ4A 4M77E 2CO5A 2VOPA 1LNXA 4ZZDA 4A6DA 5D8LB 5LHIA 1SESA 3PCOB 1IRFA 4P72C 4KNYA 2VONA 4L9VA 1H4QA 4UHTA 1U2WA 4Y13A 4HT8A 3I0TA 1BI1A 2Z99A 2HEOA 1ZRDA 2RNJA 4RB1A 2JPCA 2DDZA 3WTUC 4PJOC 4M73A 1ZN2A 4RCCA 1RIOH 2EV0A 3FMQA 2DQLA 4HT9A 5GMKj 5K5QA 2ELHA 5HVQC 2M45A 1QZYA 1X3UA 1EOVA 2YLBA 4L18B 3V7RA 4ZTUB 3ZMSA 4R79A 1PP8F 4WXCA 11ASA 1HC7A 2Y48A 3IWZA 3PQKA 4CZZA 3BJAA 1F1ZA 1H9TA 1QQIA 3CUQB 4HWOA 1SERA 4YFXF 5CVVA 1RUOA 1J2XA 2E5AA 4EM2A 3SB2A 2Z5UA 1B76A 3E6DA 1JXSA 4KA4A 1B7YB 1FP1D 3HFZA 1J0RA 4H2YA 1DPRA 2ZCWA 5HLGA 5J6XA 5HS7A 2QHSA 2DPUA 3VODA 4MHGA 3IL2A 4LB6B 1RUNA 5K1XA 4RGXA 5C52B 4NB5A 3W6JB 3TGNA 5LJ5j 3BJOA 2M5WA 3RTRA 3E9HA 3S2WA 1IN6A 3KZZA 2J3LA 5DYMA 3FM5A 2F5CA 2E65A 3F21A 5IT9Z 1B1BA 4HLXA 2L4AA 4OP0A 4U88A 3IWFA 1BI2A 4K2EA 2ESNA 5LRSA 4M75C 4P74A 4A6EA 5F64A 3F72A 1ATIA 4S04A 1Z9CA 2ALYB 4YFNF 2FBKA 3LAJA 3HY1A 3DV8A 3QPTA 4J6WA 1LDKB 1KOGA 2F2EA 2HZTA 3RKXA 4G85A 1WU7A 3LQRA 1NJ1A 2DLLA 3OOPA 2IA1A 2X0LA 2TDXA 4ZYDA 3I53A 5ED4A 1D8JA 4AIKA 1SMTA 3LQQA 1T38A 1REPC 4A12A 1UB9A 3NENA 2O8XA 3P9CA 3E6CC 4B09A 3UGTA 2MBFA 4LK1F 2AS5F 3CO6C 4LJZF 2DQ3A 4I0BA 2ODRC 2FNPA 4EGZA 1S29A 1WLEA 3EYYA 3QO8A 4MTDA 4CO8A 3MZHA 2BYVE 3WTTC 3I64A 3VB2A 2HDCA 1P4XA 4OMYA 2IJLA 3O6BB 4ENJA 1WRJA 2QUFA 5EEGA 3HSEA 3SFZA 3ZMVA 1FNNA 2HR3A 3BPVA 3QRFF 1HKTA 3HFVA 3TEHB 5D5WB 2LSOA 2LDUA 4XU1A 2KJCA 2PI0A 5LJ3e 4JRKA 2ZIOA 5LRRA 4C8QE 3KCCA 4ZYHA 4M7AD 1XSXA 3I54A 4BH9A 1I8FA 2CGPA 4L0ZB 4ZYGA 2HYFA 3V8KA 3JTHA 2ZNJA 2ESHA 2QQ9A 2E41A 4M78D 2QHUA 3TO9A 5DD4A 2E7XA 1R00A 3MEXA 2MLGA 2MH9A 4NCXA 4A0XA 4PCQA 4PJOG 1XMKA 4G6QA 5CVRA 4KQEA 2XV4S 5L3EA 4O2DA 2HOEA 1S6LA 1FYMA 4GXOA 3FWEA 2JN0A 2PJPA 1RNLA 1OYWA 3KP7A 3EQLF 1SD4A 2HTSA 2YSRA 4FX0A 2GQQA 3C1DA 5DUIA 1T98A 3IC7A 3BP8A 4GO1A 3LC0A 3MAJA 3J80Z 2R7DA 4CXFA 4G7ZF 4EM0B 3PZCA 3LSSA 4UV9A 3TDZC 3GO5A 2PFBA 3O3KA 4O6JA 4YYEA 5JVTA 4YCWA 4C92G 2STTA 3I7FA 2ZNYA 1M5Q1 3F23A 1SRYA 4XTUA 2KRFA 1WPYA 2DT5A 3QP5A 3TEHA 1LJ9A 1HSJA 2GXBA 2J3MA 5BQTA 1H641 2DI3A 2LKPA 1LEBA 1QE0A 3HRSA 3JCMW 3RYRA 3ZQ7A 5HOOA 4UP9A 1E22A 1R7JA 4YROA 4OU0A 2L02A 1BN5A 5JHUA 5GAN3 1F9NA 4NQWA 2ZBKA 5GAOr 1SMYF 3GZ5A 2XGTA 3QUIA 2WC2A 2FEZA 4HW0A 2VXEA 3KP5A 5E8IA 3E97A 4M75G 3H92A 3JSOA 2EA4A 1NJ6A 4M7DF 4YRLA 2VBWA 1XGOA 4CS3A 2CJBA 2ZZEA 1N9RA 4E70A 1R22A 4WJ4A 4IHSA 1T2KA 2DEQA 4A54A 2EB7A 1I5LA 1B6AA 2ZXFA 2XAHA 2ISYA 1E2XA 2PEXA 1MZBA 5LJ3d 2PG4A 2DVEA 3LWFA 5AIQA 4F7ZA 4KMFA 2Z3YA 5D4SA 3T0YA 1YO5C 4H2SA 2P0LA 3NEUA 3FMRA 2XAFA 2D2WA 1UHWA 3TOBA 1OYYA 3GZ6A 1KMMA 3LAPA 3RI4A 5E8GA 4L5IA 1YFSA 3VBBA 2FMLA 1GXQA 2ARSA 5GAOn 3N4MA 4Y15A 5K1YA 4JQFA 4KR3A 3P8TA 5LJ5e 4YIFA 5LJ3f 4H2VA 4EJVA 2Q0OA 1ZHFA 2QZ8A 4O5VA 1HW5A 3IKTA 3JB9D 4ZH4F 2GZWA 4PJOB 5LEJA 2DK5A 2MA3A 2QENA 3K1NA 3DEUA 2NS0A 1OMIA 1IN8A 1HXDA 1OKRA 3JCMf 2ARTA 2Y0MA 4KFCA 3GFLA 3NEMA 4CH5A 1G6NA 2P8TA 3EFRA 3E5UA 1G3TA 4CICA 2VBYA 1LJOA 4RQFA 4UV8A 5JFRA 5BS6A 3R4KA 2K86A 1WQWA 1D3YA 2DZ9A 4GGGA 4HX4A 2ZINA 1NJ8A 2QQAA 1TTYA 4ENNA 3WQZA 3GWZA 1H4TA 4WXHA 4C92B 1FC3A 2MD5A 1JBMA 5GANf 3L1AA 1W66A 4RAZA 1PP7U 4EGYA 1BI3A 4YIIA 1D8KA 5KNNA 3UH0A 5TRDA 1VQZA 4M77C 4YCUA 2STWA 1NYQA 1EH7A 2G4CA 5JR3A 1O7FA 4M6YA 3F8BA 2Q7GA 4M9XA 3WGGA 3HTSB 1UCRA 3E3VA 4RB3C 2I4MA 4IHTA 3MEYA 4RCBA 4H2WA 1XCBA 1ASZA 4P9FA 2P5LC 4IXAA 1P6RA 3LA2A 1SFEA 3ZPLA 1E17A 1WWXA 4L9JA 5FB2A 1KGSA 3HTZA 5GAMh 4KDPA 1FT9A 5DUKA 2W85A 3Q9VA 5C51B 3VQYA 4M75B 4H02A 5HGQA 3F6VA 3W3SA 2JSCA 5CAIA 4YRMA 2VOOA 3TO7A 5GAMf 1U78A 2F5EA 1TW2A 3RDIA 5AONA 1Z7NA 4MTEA 4P55A 4BW9A 5LGTA 1HKQA 1ADJA 3HUGA 2CSOA 1X56A 2Z33A 5IT9K 4JUVA 4HQMA 1FP2A 4RMFA 2YX4A 5LJ3j 5ELNA 3ELKA 2CJAA 5BPDA 4RS8A 4XRFA 3GX4X 4M7DC 3R61A 3HYIA 5D4RA 1Z7UA 2DJZA 2ZZFA 2VBZA 3TUPA 2DU9A 1ONVA 4C92A 4P73C 2P7VB 2C7IA 3IALA 1Z05A 4LK0F 5LJ5d 3B02A 4N0AA 2A3SA 4M7AF 5LHHA 1RI7A 1Z6TA 2BE5F 5GAN4 5HLHA 2K4JA 4HA8A 1IXCA 3EDPA 3HOSA 4BQAA 1Z7MA 4G8XA 1HBXG 5H6QA 2UZKA 1L3LA 3G1ZA 2O03A 4M7AA 4TVAB 1PDNC 4CHUA 1TNSA 1XDSA 2FOKA 3BJ6A 4IRIA 5D6EA 2RC4A 4P71C 1FBUA 5E1ZB 2Q5HA 1TLHB 2WV0A 4M78A 2VE8A 3I59B 1LVAA 4NOYA 3N97A 4G9YA 1YTYA 2M1BA 1R5GA 2FQ3A 1O3TA 4WK8F 4XEOA 2CGHA 4YCVA 2E10A 1G5HA 2XVCA 4ESBA 3A31A 1B70B 3C3WA 1X2GA 1OYIA 2IW5A 4EMKB 3UGQA 2FBIA 3FJPA 5L3BA 3KEOA 4IJAA 3BFMA 3WU1B 2HTJA 2P5KA 2DTOA 5LBQA 1FLIA 2O0YA 3VFZA 1R1TA 3R0AA 5DEQA 1IRGA 4DQ2A 2XRNA 2JZYA 2QM3A 4HYEA 4A0YA 1BBYA 1SD6A 1L0WA 4G7OF 2EA2A 2EV5A 3LA3A 2Q5IA 4K88A 3Q5FA 3GLXA 4U7BA 3FM3A 4HV6A 2NYXA 2E7WA 2I4NA 2PBIA 3REOA 1GXPA 5HDNA 1BM9A 1U5TC 1E24A 4TVAA 1LEAA 3SWNB 1YS7A 4MNUA 2DPDA 2VT3A 3ZMDA 3J80K 4M77G 3K1MA 4M7DE 4IF4A 4Y91A 5A2QK 4C8QC 4ENKA 2ZMEB 2RHSB 4YRCA 5ERIA 4IVNA 2FBHA 3HXZA 5ELOA 2Q8KA 4HOBA 4EV0A 4CH6A 3JSPA 4EJUA 2VC0A 4F7UB 3ZMUA 5GMKi 3HRKA 2ZJ2A 2X4HA 5DDGA 4I2OA 1B70A 4LMYA 2V1DA 4JLIA 2HWVA 1E1TA 3PCOA 4BAYA 3KEQA 4P75A 3A7UA 3CJNA 4OIOF 4RGSA 1ZAOA 3WG9A 1J5YA 1GVJA 4PGHA 2Y75A 5L3FA 5DV5A 3KP2A 1D3BB 1MKMA 3ISPA 3JAMZ 1F5TA 1FYLA 2ZTGA 1XMAA 3M7GA 4M7DG 1YIOA 3E5XA 3PGGA 1YFRA 2PMFA 3ERRA 1WNLA 5H20A 3FXUA 2RV8A 1I5ZA 4Q5SF 3JB9F 3JCMQ 4PJOD 1J75A 4M7AC 1ZG3A 3I71A 4PNOA 6PAXA 2PMHA 1W7PB 3BDUA 4XLPF 5BPIA 2XAJA 1SD7A 3HRUA 1K78B 2DKGA 3SWNA 3ML6A 1LNWA 3KLNA 1EVKA 3DPTA 5CVJA 3CUQA 3GFIA 2EJFA 3MF1A 4YRJA 2YU3A 4M71A 1K79A 4KR2A 1WI9A 1QO0D 3HXVA 2PMUA 1ZGJA 2M30A 5BOXA 2GIVA 12ASA 2ZMEA 2RHSA 2DFIA 3GFJA 3QPHA 4G7HF 1BBWA 3ULQB 1B7YA 4D0PA 1ZREA 2PMEA 2RD1A 1WYDA 1G3WA 4HLYA 1HTTA 1EIYB 4EMSA 4F7UA 4C92D 1O3RA 1KU7A 2UXNA 4BHCA 2FU4A 4HWRA 4J15A 1P2FA 3CUOA 2EFNA 4P96A 2ZO4A 4RAYA 3IRRA 4YRFA 3RACA 5LGNA 1YS6A 4CH4A 3L7WA 2EFWA 3GUDA 3MWMA 5LJ3g 1BBUA 5D8KB 1YW9A 2XGXA 5GAOp 1HSTA 2C8MA 3JCMX 1EH6A 1LB2A 2HS5A 3I58A 1D3BA 4YRNA 3DPLC 4RGUA 1D5VA 3M4GA 3LSQA 3KP3A 1FBSA 1P4AA 4XQ3A 2ZXJA 1H4SA 3ZN1A 2DBBA 2ALYA 2FYKA 4M77B 5CVIA 4EJWA 2KIFA 4A5NA 4M75D 4WI1A 4YRIA 2NAZA 4A53A 3JCMe 1W7PA 2GA1A 4G94A 2ZIMA 4QVDA 2I2LA 4YDQA 2V1UA 4ZZLA 1K78A 3REXA 4EJTA 1XGMA 2P4WA 3F8NA 1JJCB 3F3XA 2P7CB 2VXZA 3TKYA 2K7LA 3GVAA 1TW3A 4BWAA 3TOAA 1O3SA 5E20A 3DSQA 5IT3A 1R58A 2DU7A 1EIYA 4XTZA 5HS8A 5GANe 3GXOA 3PFIA 1FPQA 1CF7B 2RHQB 1KQ9A 3V7SA 2VT2A 2HKXA 2OBPA 4XU3A 4C8QG 2IPQX 3KP6A 3M1EA 5E18F 4L0YB 2P5VA 1TQPA 1XGSA 4M7AE 3A7RA 1KQ2A 1P92A 4KIGA 3VQVA 3L4GB 1UFMA 3HFNA 2RKHA 3HSBA 1I1SA 2EL9A 4P74C 3CO7C 2DXTA 2BBYA 2W24A 1JHFA 4RB0A 4LLGF 4GCVA 1FZPB 3BY6A 1NJ5A 1XCVA 3E6BA 2RN7A 4YFKF 2EV6A 1JHHA 3V7CA 3V8JA 5GAMe 2A61A 3QAHA 3F22A 2D1HA 2BEOA 3JTGA 3BDDA 2ARUA
chains in the Genus database with same CATH superfamily
4HF1A 3I3LA 2WADA 3RZOJ 1SFKA 3J80E 3HPWA 2J5PA 5CO7A 1OV3A 2JJ7A 3EGDB 4F14A 2FE3A 1OPCA 1VQOQ 2DMQA 2ATCB 1DP7P 2LTOA 1SD5A 1I1GA 3OD1A 3JCMc 4AIJA 1VQ9A 1OOTA 2VGMA 3RERA 2HYGD 2QQBA 3PUBA 4J83A 2JA8J 2C6YA 2FB7A 4FASD 1ZQ3P 3D0SA 2D6FA 4KN4X 2M0YA 5LJ5g 4QWQA 5CKBA 1VQPA 3V42A 4TVYA 1WI7A 3CCMT 3J81Z 3R07A 4Z2YA 4OINF 2O9SA 1M90C 2A68F 1YJNT 5LLQA 4N9IA 1PYSB 1O7LA 4PZJA 3HRMA 1M2VB 3CC7Q 3PUFA 2KNBB 2QEXI 1AWCA 1K9AA 2OD5A 3TW7A 5GAN2 2P6TA 4C0DC 3JCMP 3K4KA 3S1RJ 4FE7A 4E6KG 3Q1JA 3EGDA 1BJZA 2R7ZJ 2M4GA 1DGRM 5F5WA 1YN8A 3SDGA 2XPUA 3ZMTA 2YUOA 2QKMB 4M3GA 2C0OA 4BUPA 4XU2A 1ACMB 3QHSA 3JSCA 3HSFA 3FLGA 2CJ9A 4EO4A 3E6MA 4P72A 3G71Q 4PJOF 3QTCA 1VIFA 3CCSQ 2MH2A 1W7PD 2FZCB 3FDRA 4C5EA 1IXRC 1YIJQ 1B34B 3U2RA 3FXQA 1WSUA 2R3SA 2QBYB 2QTXA 2XAGA 4S05A 2NNYA 1M8MA 2Y4YA 2E5QA 2O3FA 4HF0A 2DTHA 1AWWA 4HCCA 1VQ5Q 2PZ1A 5GMKh 2XF6A 4AFQC 2E5NA 3CMYA 1G2BA 3RJPA 2NLUA 4Q4ZF 3M0QA 3MVPA 2KZGA 2DMOA 3LSMA 2L9SA 2W57A 2RQVA 3EG9B 5CYVA 4LIVA 2M16A 4M75F 3IHUA 3DLLA 3DU6A 3ZQFA 1R23A 2AZSA 1H0MA 2OTJQ 4PSWA 1EIFA 3GYHX 5GAN6 4M72A 1X2HA 4Q47A 1Q7YC 4TVWA 4LVKA 4H2UA 1WJFA 1N25A 1QWFA 3T9NA 5KE2A 1OQKA 4DYRA 3G4SQ 3S32A 4G6DA 1JJ2S 4IZZA 2RJFA 3RKWA 5HDKA 1ZLJA 2Z16A 2DXBA 4D8DA 5KAIC 1JRIA 2VLAA 1HW1A 3NELA 4XKWA 4NUBA 4Y17A 5KE3A 1V1CA 2NVTJ 3CCUT 1W0UA 5GAMj 2JS2A 1KONA 1GCPA 1QWEA 1SAXA 4Z02A 4UB6C 1ZGAA 2HVRA 1IGQA 4V2FA 3KP4A 1UZCA 1VQ6T 1T56A 4OB1B 2IIMA 2F2XA 3JB9I 1WHLA 2IRFG 1OJLA 2MW8A 4FX4A 2DRKA 3IAS2 2JMCA 1M2OA 1JJ2A 3GPLA 4TQFA 3P9IA 3A8OB 1GT0C 4HWPA 3RESA 4LNPA 1ACIA 2X3XD 2EYQA 1ZA2B 1TUGB 3PIOF 3J7AO 4AH6A 1VQKT 3EUAA 3QPLA 4A93J 1FYKA 2K4BA 1V5FA 2QASA 4OAZA 1HCRA 1TUCA 2HKQB 4A2UA 1ETVA 2EFQA 3JCMb 4I01A 2ZT7A 4TTVA 3A01B 4UC4A 1NJIR 3F0CA 3E5QA 2LFBA 2L3SA 2JTMA 5EG2A 3V4GA 3HHGA 4ZGEB 3ABTA 1QF6A 2M8GX 4XKBA 1VQ9T 1W4MA 3KE2A 4J6XA 4HWSA 3OW2S 2DYBA 1QRYA 1FIPA 1FBQA 1Y1WJ 2RHIA 1VQPT 2HQNA 4OGCA 1RADB 3I56A 3BWGA 2ADUA 1I3QJ 2I4LA 1B3QA 3T5XA 3D5LA 3CCRT 3A02A 1V76A 4A4HA 5BMZA 5I2MA 1Z9QA 2EZLA 3M59A 5I21A 1LPLA 4PGGA 2D8JA 3ABKH 1XMXA 3JCMg 4B8XA 3PL8A 3PQJA 3VOEA 1DDNA 2VKVA 2V6CA 2XHKA 2E70A 4Q48A 3BTJA 1VIEA 1XOVA 2ZCEA 1YI2A 2RVCA 4U7DA 2XROA 1JJ2P 2EGCA 3R6SA 1ADYA 1C1AA 5GANg 3OYAA 3DF8A 4IHXA 2JOYA 1TC3C 3SQNA 2WTEA 1P7IA 3I9V2 4AYBA 2FPFA 2DAOA 2FZKB 3CMET 5J39A 3L1PA 3M0SA 4XK4A 2CQKA 4HV5A 3SFIA 5EDNA 4RQEA 1SHGA 2RAEA 1UG1A 2DN0A 2F5FA 1ZRCA 3OS5A 3ABMH 1PHTA 2XAUA 3SWNC 5D5UB 4FYXB 1TH7A 4BHBA 1DUXC 5EEHA 3C12A 1TNTA 4Q6GA 3FJ5A 2OQGA 5H6RA 2OQRA 1JJCA 1HLVA 2R5AA 1VQNA 2WWYA 1EVLA 1FWZA 3PIPA 1AOJA 3CTAA 2QYZA 1UJ8A 3X24B 4M78G 3S1QJ 4U0VA 5CKFA 4LD9K 1RACB 4P5OA 4RLFA 1K9MR 5LGUA 3CC4T 4FW2A 4K86A 1MMGA 1WKMA 4QQDA 4A69C 3O2PE 2K7AA 3BLYA 2ESWA 3HM5A 2E5ZA 2EFOA 4Z89A 4ZGJB 5CLSA 1HKSA 5GAN8 4XTWA 1ZKGA 4BY1J 2VB6A 2NRAC 1R8OB 3PSFA 4OOIA 3VPRA 2HPMA 2HFHA 4MZTA 5KVRA 2L3QA 2LZ6B 3OW2P 3HP9A 3WTXC 4W97A 4J00A 4YRRA 3LSHA 1W4SA 3OYYA 4XONA 3AG2H 3W6KB 1LCKA 2XGDA 1PM3A 4A3LJ 4YG2F 3WTSC 2ENMA 1R5HA 3REUA 4PJMA 1VTNC 4EM1A 1MGTA 5FD6A 3HB9A 2DXIA 2KSSA 2LF8A 2NUTB 4TV7A 1M8VA 5ECAA 2BY1A 1MBEA 4IRHA 5E3NA 3LH5A 4II3A 3CCEA 2KRHA 3L2VA 4MQ9F 4HX8A 1X1DA 3PVQA 3A7AA 1QZEA 2AKKA 2FNAA 2OCCH 2ZR2A 3VEPA 4LN2A 4UP8A 3C7JA 9ANTA 3L09A 3WTVC 3ECOA 5GAOq 1NG2A 1VOMA 2W7NA 1FOWA 1X4PA 4UPAA 3ZQHA 2IGMA 1JU5C 5FU7B 2QA4I 4RTWA 3VS4A 4KT5C 4H2XA 1BL0A 4H2TA 1XSVA 1ZSZB 1MNMC 2ZC2A 4G6TB 1K73R 4PK4A 2AMCA 1YJNI 1ZHIA 3MJXA 1NHAA 2KL4A 5B1AH 2BOLA 3E2UA 4HQEA 1JUPA 1Z1DA 4KMUX 4LFUA 4E7SA 3GTGJ 1GVDA 2DA1A 5I11A 1ZBJA 2L9RA 3DLLF 5J8CA 3S3OA 5J26A 2CH4W 3X25B 4XBFA 1X58A 1RR8C 4F7UG 5ICGA 2QLZA 3KXTA 1KK7A 4HAMA 2KYBA 1TG0A 1ULYA 4NBQA 3FEOA 1K61A 3CESA 2HQRA 2V79A 3OY9A 5JI6A 2G9WA 4Y33A 2RQPA 3GF2A 4RGRA 3U9GA 3I56T 3NTIA 5FLXE 4GYIA 4XLHA 4KUMA 2LQKA 1CKAA 5F1RA 1NEBA 2CWEA 2NS7A 2AZVA 3T8TA 3ABUA 1IF1A 3MEUA 2ZGWA 1Y0UA 1F36A 1MSFC 2H09A 1X3ZB 4QVCA 2DK8A 2EYXA 3PM1A 2HQEA 1P9QC 5CKDA 3HXUA 1U1TA 2HVQA 3HFZB 1PC0A 1OCTC 3KYCB 4NS5A 2WA0A 5CQEA 1PUFB 2W10A 4QPQA 1Q86R 3FK7A 2NUZA 2HDDA 1OPLA 1YI2T 2IG0A 5LHIA 4BY7J 3PCOB 3FXJA 2IVWA 1ZBXA 4BY6B 4UHTA 4HT8A 1BI1A 2HEOA 2EGAA 4RB1A 2DT7B 2JPCA 4A3BJ 4PJOC 1ZN2A 3OMYA 2RI2A 1RIOH 1TT5B 4DW6A 5K5QA 1W70A 2ZXWH 4ZTUB 4IIMA 2Y2ZA 4R79A 1PP8F 3SEZA 2K9MA 2ZJPF 2CT3A 2Y48A 1M1KR 1F1ZA 1QQIA 3CUQB 3CCQA 4BKXA 3OSGA 3CXCS 1J2XA 1B76A 4DOZA 2R5ZB 3HFZA 4H2YA 2CQNA 5HS7A 2QHSA 3VODA 1YE9A 2ZJQF 3C95A 2V6EA 5GTIC 5K1XA 4RGXA 5LJ5j 3BJOA 2HCKA 1IGUA 2JMWA 3HL8A 4PFZA 3BDLA 1FMWA 3CCUI 3KZZA 2XK0A 4WCIA 2VQLA 5DYMA 5IT9Z 1JTXA 4U88A 3IWFA 2RF0A 1Y0NA 2D5VA 2ESNA 1ABQA 5LRSA 4M75C 1M30A 4A6EA 1Z9CA 4I76A 1VQ6I 2FBKA 3LAJA 3DU5A 1W36D 2DYIA 3HY1A 3QPTA 1WU7A 3CCLA 2JMAA 5CKEA 2G0EA 3J7AY 2IS4A 2VJ5A 4ZYDA 5ED4A 1T38A 4AG1C 4A12A 4E4HA 2R5ZA 1UB9A 2HU9A 3CDLA 1UDLA 5K7HA 2CP5A 1UB4A 1UFFA 4LJZF 2DQ3A 4C2TA 2FNPA 1UHSA 1YJ9T 1WLEA 3TMOA 3EGXB 2PMZA 3LFUA 2IJLA 2ZSIB 1WRJA 1VQKI 5EEGA 3M54A 1YITQ 2W82A 3QRFF 2LSOA 3RKQA 1YHQI 4ITVA 2LLKA 4BH9A 4AVZA 2E41A 3HKSA 1M3CA 5DD4A 2E7XA 4NQWB 1R00A 2JM9A 2QSGX 4RDUA 2FZGB 4NCXA 1FJLA 4PCQA 2XV4S 2HOEA 3FWEA 1ZUUA 2PJPA 2FPDA 3PFSA 2LQWA 3LGFA 1TWGJ 2YSRA 1NJIU 3C1DA 3BR1A 3IC7A 1AHDP 4GO1A 1VQPI 3C0CA 5J3LA 3PZCA 3TDZC 4C92G 3CCRI 3I7FA 1I3AA 1M5Q1 3F23A 3QJYA 2J3MA 2AKLA 1X1PA 5FW9A 1SFOJ 4E7JA 3OA6A 2EBIA 2Y0SA 1H641 2EIJH 2DA5A 3RYRA 1UTIA 1FMVA 1E22A 2KXDA 4AT1B 2F5TX 1BN5A 4E7ZA 4NQWA 4OAYA 1WLPB 2WACA 4HW0A 1J3TA 4IUUA 3CXCP 2KK4A 4YRLA 2VBWA 3BG7A 1XGOA 2CJBA 4J9FA 2GIZA 3S8PA 4KH0B 2ZZEA 2F6CA 2R7RA 4JX6A 5GAGJ 4RAGA 4IHSA 2DEQA 2WB1N 1JXOA 2BIVA 1I5LA 1B6AA 2JRMA 3LMMA 2ISYA 1Q82R 2JVVA 5C6SA 1ZUKA 5LJ3d 4X1EA 3CLQA 3KBGA 3LWFA 2JUCA 5AIQA 3A1PA 3IP4B 2Z3YA 3CMEI 1XX5A 3RZDJ 1YO5C 3FMRA 3TOBA 1E0EA 2YDLA 5BNGA 4L5IA 3VBBA 1YIJT 2R5MA 4Y15A 5K1YA 3AT1B 3P8TA 1R4MB 3REAB 3BTCA 1MBJA 1DQUA 3DKXA 5DLQE 2Q0OA 1ZHFA 2XHCA 2DK5A 2MA3A 1QCFA 2QEXQ 1IN8A 1HXDA 4XNFA 1UJYA 3S2DJ 4RAFA 1NYGA 4BJ5C 3NEMA 4CH5A 3E5UA 2VBYA 2X9DA 4M4ZA 1OFCX 2K86A 1D3YA 2VIXA 2EYZA 2K85A 3GWZA 1H4TA 3KYDB 3L42A 2MD5A 1PP7U 4A4EA 2QTVA 3CEYA 1Z3YA 5TRDA 1VQZA 3CC4I 2KDOA 2STWA 1EH7A 5JR3A 1TZLA 4RCBA 1TWFJ 1P6RA 3LA2A 3ZPLA 3CC2A 4EDUA 1E17A 1MUZA 1K9MU 1PCXA 2DTZA 1X2QA 2WAQN 3SEQA 1A31A 1X27A 1H3ZA 3QYEA 5GAMh 4B44A 1FT9A 2XF7A 1X2KA 4H02A 3F6VA 3W3SA 2JSCA 5GAMf 3CMAA 2LNVA 3PE0A 1K8AR 2PU9B 1WJQA 3HUGA 4IUTA 1WHJA 4JUVA 1FP2A 3A8HB 4GDFA 5J40A 2H1LA 2XKOC 2HI3A 1KFZA 2DJZA 2RHYA 2VBZA 3TUPA 4P73C 2C7IA 1BCOA 3IALA 3CCLT 1GLNA 5LJ5d 3B02A 4N0AA 5CPRB 3QWLA 1Z6TA 2BE5F 5GAN4 1VQ7Q 3FC3A 3AG4H 1HBXG 3TU4K 4UUSA 1FTTA 2UZKA 2JUGA 5IPAA 1YWPA 1TWBA 4TVAB 1PDNC 2RC4A 3NTHA 1TLHB 1YNZA 3LSPA 4M78A 3I59B 1LVAA 3UT1A 2MIOA 4G9YA 1R5GA 2LY2A 2VKNA 1R71A 2CGHA 2FO0A 4YCVA 3S16J 2E10A 2XVCA 4C3IJ 1X2GA 1QW1A 2AIRB 3ERMA 4EMKB 4YEJA 1MNEA 3KEOA 2DODA 3WU1B 1YX3A 1M3AA 2EIFA 3H1CA 3R0AA 3CCYA 3OL4A 1K73U 5GAEJ 3GTOJ 4A0YA 4G7OF 5I2SA 2QI2A 2EV5A 1X69A 3MKZA 3GLXA 4U7BA 1MH4A 1GCQA 4CH7A 4MO7A 3FHNA 5HDNA 2RQUA 1ZELA 4TVAA 3ZMDA 1ETWA 2BE9B 2B86A 4Y91A 3CD6A 4I99C 2ZMEB 2RHSB 4YRCA 5ERIA 2CUDA 4DBFA 4IX7A 3JSPA 2VC0A 4F7UB 4BL0B 2RJEA 2VJIA 2R7WA 5JLWA 3MD2A 2V1DA 4HNUA 2HWVA 3I35A 1WXBA 4BD3A 3BTIA 3A7UA 3CJNA 3WG9A 3KPHA 4RTUA 3AFHA 1YI2I 2O88A 2EBPA 5FKNA 2ZPEB 1YIOA 3CZ6A 3E5XA 1IC8A 2BE7D 5A0LA 5IHKA 3PO2J 3QQAA 4PNOA 1Q86U 4HSTA 1SD7A 2WAFA 5H2FC 1VQMA 2YU3A 4M71A 1K79A 4KR2A 2ZMEA 3D7SB 4L6V5 2RHSA 2Y31A 1X43A 2XU8A 2QK0A 4D0PA 2E2IJ 1WYDA 1G3WA 4F7UA 2GBYA 1O3RA 1KU7A 2RI5A 1BOBA 4BHCA 4E7IA 3G2BA 3M9QA 3ASNH 3IRRA 3RACA 5LGNA 4CH4A 3L7WA 3EPZA 3MWMA 4JZ4A 1M1KU 4GLMA 5GJWB 2XGXA 5GAOp 3JCMX 2HS5A 2JSPA 1D5VA 3LYIA 3M4GA 4JRPA 3LSQA 3KP3A 1M1EB 4XQ3A 1P4AA 1M4ZA 3CMMA 1QKXA 4CYCB 4M77B 1M1FA 2ZIMA 4QVDA 1VQ4A 4ZZLA 2PTKA 2LCSA 2M34A 3REXA 3P8DA 4ZN1A 3FBNB 2W00A 4ME7A 2ICWG 3OYMA 1N8RR 1TW3A 2IPOB 3TOAA 3META 4E7KA 5IT3A 1R58A 1C0MA 2GM4A 2MYSA 3GXOA 2CP0A 2LTPA 2VT2A 2X6YA 2HKXA 1JQQA 2LBFA 3M1EA 2YRDA 2P5VA 1IREB 3A7RA 1KQ2A 3ZXSA 1P92A 3VQVA 3CMAT 3GNFB 3L4GB 1YJ9I 1NEGA 1I1SA 3CO7C 2DXTA 1JHFA 1LE8B 1XCVA 3E6BA 1AWXA 2RN7A 4YFKF 2EV6A 2P4TA 2X6OA 2A61A 3F22A 4A3DJ 2BEOA 3BDDA 1C6VX 4P3NA 4XTVA 2VV5A 1Z67A 2O01E 4D6WA 1O75A 3NMZC 2CS7A 4WF2A 3ROUA 3MEWA 2R7VA 3WG7H 1MMSA 1HQCA 3JCMV 4DEYA 4XSXF 5EJCA 1ORKA 2LDMA 3NETA 1UGSB 1BIBA 1IN4A 2YRVA 1YB3A 2V1XA 1QCNA 2VPLA 4LOCA 5D5VB 2MC3A 5LEKA 1HD3A 3FXOA 5FKLA 1M27C 3KFVA 3L4GA 5GPCA 2A28A 4A3EJ 2OA4A 1O57A 3QYFA 3JCMd 2K9QA 3HHHA 3OB9A 2OTLA 1LE8A 2ZNIA 4MGRA 5FROA 2GQIA 2E35A 5HS9A 3QXEB 1SVOA 1QVGS 2DO7A 2XASA 2B8AA 3SYTA 3VUZA 3EFSA 2W84A 4EPCA 3L00A 1BCMA 1F4KA 2JTVA 1UGRB 1G83A 5GANd 1BC8C 5FLMJ 4RTTA 3WTWC 3VS7A 4FT8A 1A36A 3C18A 2ME0A 4M9SA 3M8EA 2VE9A 4C8QB 4X6AJ 2JA2A 4DYQA 4YP0A 3JCMJ 2DW4A 1H4VB 4QIWN 4JBAA 4YIRX 2F2VA 3RSNA 5D6FA 4AVPA 4N4NB 2DF6A 1ZX6A 3U23A 2QYOA 2EKHA 3DBRB 2BV6A 3OYNA 3QYHB 3RMSA 1TQIA 3BTLA 3FMSA 2IGKA 3RUXA 1HK9A 2R7TA 5KCOA 3VKIA 1K0XA 4F04B 2BXYA 3OIOA 1QVGA 2ZPFB 4C3HJ 5KK1A 3HBLA 3CCMQ 1WQ7A 2KY9A 2L0KA 3K0LA 1YIJI 4LGWA 2KBTA 1Q82U 2RM4A 2IXSA 2DL7A 1G5IA 1R5ID 3WHCA 1YJNQ 1XB4A 3JR9A 2ZFUA 3W6VA 3OYBA 1W5SA 4H0EA 2O61A 2HQHA 1T39A 1W5TA 5EZHA 4C5IA 1G4DA 3HHTB 2CU7A 1JEGA 2OAUA 4AIDA 4X9DA 3TREA 2DCEA 2E12A 4II1A 1KHCA 1J9IA 2HGCA 5DTDA 1VQMT 2G3RA 4FYYB 1IUFA 4AC0A 2CSQA 4F52A 4M3EA 2D1VA 5B5EC 1PKSA 1PNJA 3BZKA 2RA2A 2ETHA 3VJPA 3DQVC 4M77D 2V9VA 4M78F 4HT4A 1USYA 1KQSP 3M56A 4ZDLA 3K1PA 5KYXB 2X9HA 5GAOm 3EYIA 3S3NA 1TL8A 3A8MB 2GOMA 2Q2EB 3G3ZA 3QDRB 4KGXB 2EJ9A 1KMNA 5LJ5h 1LYLA 3T8RA 4HDUA 1DU0A 1Y71A 2I5UA 4A3JJ 2NS8A 3RPUA 4I98B 4HPQA 4HKEA 4AUXA 2H6CA 1TWCJ 2R92J 3F8FA 5IHNA 3TO6A 2FRWA 4M7DD 3ZMZA 3B73A 3H0IA 3H3UA 1VQ5A 1WQ2A 5K5RA 3M1CA 5DY9A 4BACA 1YCSB 1K8AU 4Y52J 2VGNA 1BOAA 2K57A 3CCLI 1EQRA 3M0TA 4WCGA 2XSJC 4LLNA 5FU6C 3IKMB 1W36C 1MJ9A 4Q15A 1X75C 3EUHA 2UUZA 4RTVA 2Q2EA 3A0HC 3TL4X 5K5OA 2OTJA 4OWRB 5KCMA 2HSPA 3KZYA 2GCXA 3VQWA 1EV7A 4ETSA 3SZTA 2QXFA 2VVKA 1ON2A 2A07F 5F1JA 2EJRA 4LVLA 4RTXA 3K69A 4C92C 2K3BA 4G12A 1K1ZA 3M4QA 2HYJA 4JDSA 5J8FA 3HG9A 1VZ0A 4YREA 4OF1A 3GMEA 2ISZA 2EPFA 1QGPA 1PSFA 4HF2A 2O4XA 1USYC 4NNJA 3VRYA 1G51A 1WXUA 3ZFJA 4UXNA 4AWXB 3U21A 1ZSZC 2A5WA 1VQ6Q 1U9NA 1MHNA 1EH8A 4X9CA 5FGMA 4F7UF 2DQRA 4J01A 1H3HA 1M90R 1RESA 2OAWA 3L9FA 4JYKA 3WE2A 2A7YA 4C8QD 1N9SA 3H9JA 3QU3A 4II2A 1RR7A 3QO7A 2DJIA 2K02A 2W25A 3SZGA 2P6SA 2BHYA 4E51A 3T1BA 1USTA 1Y96B 2MWPA 3C94A 4FTHA 3GZNB 3ZN0A 3KETA 4ATOA 4KJZA 3ABLH 2K9GA 2F5DA 3OYJA 2E5KA 5A0DA 2VC8A 3WXMB 4CCOA 3DB3A 2XKPA 3EUHC 4F92B 2ZKZA 2P5IA 4AFZC 2YWWA 2EYWA 4BI8B 1QCOA 4C92E 1EZZB 3K4BA 3QYBA 1VQ9Q 8ATCB 4KICA 4OIRF 4YRPA 3LA7A 2KPMA 4KGZB 1Z9ZA 3U1DA 2XRLA 4A4FA 3S14J 3FIFA 1VQPQ 4BY6C 4KISA 2ODRD 2H8RA 1NK2P 2RDPA 1LKXA 2G6FX 4ZJZA 1FXXA 1Y96A 4D7MA 4M77F 1IGNA 3CCRQ 2KZVA 1JGGA 2OAZA 2DMUA 3PNWC 2FA5A 1OU8A 3RIRA 4UUTA 5GAMg 4CRIA 1DJ7B 1G2HA 2L7KA 3K9TA 2OU2A 3CJQB 3CUQC 3FXRA 3PNYA 3QKJA 3L2CA 3E1SA 3LSIA 4X34A 3QSUA 2A5YB 1Q7YR 3BZ6A 4ZTZB 1GV2A 1YW8A 3K4LA 2OC6A 3JB9J 1B9MA 1U3EM 3UA7A 2GWRA 3MCZA 2RHQA 1IZ6A 1PUEE 2ZPGB 3M0RA 1DP3A 2PNIA 1RLQC 2MAMA 3X2QH 1GGMA 4UUVA 1XDUA 1Q81R 3CMEQ 3CCJA 1N8RU 1TTHB 3FHZA 1X01A 2F5VA 2UWMA 3G6EA 3FDYA 3ERED 4XEMA 2BW3B 3SHWA 1G8XA 2QWWA 4FE4A 4D5FA 3LNQA 2DDAA 2DQ0A 4RMNA 3JCMh 1KSWA 2L3DA 2FXAA 3CPFA 1E3OC 1R0BG 3S15J 2KJBA 4P71A 3RF1A 2E1OA 2ELKA 3KZIC 4P1WA 1S8NA 5D5XB 3BROA 4B43A 1FOYA 2M02A 2LF7A 1S3JA 5GANh 2FHDA 4KYWA 3OYLA 3TEGA 1S7AA 5F27A 3J81E 3QIIA 1LVKA 2DLPA 4XK8E 3M8FA 2D9TA 2QQRA 4B9XA 3CC4Q 2Y90A 4YPFA 4BE2A 4LG0A 2DA4A 1WJRA 1T0FA 2DA7A 2BW3A 3MQ0A 1LPQA 3K2AA 2DAQA 3DBLB 3OYCA 4M7AB 4C8QF 3VYTB 1U3OA 3MEVA 3SDBA 4PJ0C 4FSSA 1IHVA 5GJVB 1M1GA 1Y39A 5IHIA 4EMGA 2B0LA 4BE0A 3JB9G 2LH9A 4QSHA 5M3FJ 1W2BS 5CVUA 5CJ9A 3EETA 1YCYA 4HDVA 1MJBA 1Q1HA 3VYUB 1FOKA 2TCTA 3MF2A 3VS0A 2IA2A 3JRCA 4IPAA 2MPXC 2G7HA 4LD5A 4N4GA 2D0QB 1T33A 2LRDA 3CLOA 5IYDJ 4Y4RA 5KYWB 2JPBA 3RQIA 1IAWA 4OMZA 4J6YA 1ZARA 2DXCA 4I6ZA 4LUEA 3G1MA 4R56A 3QBYA 2W48A 1LDJA 2R7UA 5HY6A 1VA7A 2EH3A 2DERA 2DJNA 4A4GA 4HXJA 4CA0A 2HVSA 3ESWB 1K9MC 4N9HA 2KKOA 3WE3A 2I4OA 1QVUA 3V8LA 1R1UA 1AWOA 4HX7A 5C3EJ 1WHKA 4CDGA 2R93J 1I50J 4CS2A 1IW7F 1GBQA 2CO5A 2VOPA 1JTYA 4OB0B 3CBMA 4ZGDB 3LWHA 4KNYA 1SEMA 2VONA 3JRBA 2XDPA 1U2WA 3I0TA 3G1OA 1MMDA 3QZ9B 2DOFA 2RNJA 3M0PA 1VQMI 2DDZA 5KYNA 4C5HA 2EV0A 3FMQA 4X1VA 1O4XA 5HKCA 2FG0A 2ELHA 2M45A 1QZYA 1UE9A 2KRMA 3I56Q 3ZBDA 2YLBA 1R49A 3K7AJ 3ZMSA 5EEAA 1S1NA 4CZZA 1H9TA 1BW6A 3H9GA 5CVVA 3M4OJ 4N4OB 4EATA 3E6DA 1JXSA 2NS6A 1B7YB 1FP1D 3MKLA 4RMOA 4AYBN 5IH2A 4J7FA 2ZCWA 5HLGA 2RREA 5J6XA 5HNHA 2COWA 3H3VK 1B72A 4IO9F 3W6JB 3TGNA 1Z21A 1P7JA 2M5WA 3S2WA 4DBRA 1YI2Q 2DX1A 3RCOA 1VQLA 2DM1A 3QYGB 5M5WJ 2E65A 3F21A 1BI2A 4K2EA 1K73C 2ZB9A 2VUMJ 2X85A 2ALYB 3NWSA 4F93B 1LDKB 1KOGA 2HZTA 4XL9A 2LOOA 1YJWA 1NJ1A 2WSFE 5GTHC 2X0LA 3CCJT 1D8JA 4AIKA 2QKLB 3LLRA 4CCJA 3G6ET 3NENA 4C0DB 1W2BP 2O8XA 3JAME 3P9CA 3E6CC 4B09A 3DB4A 2MBFA 5D6WA 3JRZA 4ZN3A 1ERDA 4D9JA 3QO8A 3MZHA 2BYVE 3J7AF 3VB2A 3D5RC 1EA3A 4B9WA 2M7BA 2CFOA 3ZMVA 1B8IA 1FNNA 5IOYA 1QP3A 1VQNQ 5E3MA 2JA6J 2IGNA 2LDUA 4XU1A 2KJCA 5LJ3e 1JJ8C 4JRKA 2ZIOA 3KCCA 2ZPIB 1BYMA 4M7AD 1T3LA 3GCMA 2CGPA 4ZYGA 2HYFA 3JTHA 2QQ9A 4XAXB 4ELYC 3S1MJ 3MEXA 2MH9A 1U8BA 4A0XA 1VQ8A 4PJOG 1XMKA 1FYMA 4GXOA 4XM3A 3BG3A 4BQQA 5F0CA 3KP7A 2DYRH 2MGQA 3UWNA 4FU6A 3BP8A 3JRDA 3MAJA 2A6TA 1RKTA 5J47A 4F17A 4EM0B 3OBWA 4UV9A 3GTJJ 2L9VA 1M90U 5JVTA 2CQXA 3D5SC 1AT1B 1YJ9Q 4C3JJ 5KNLA 1SRYA 1WPYA 2DT5A 4NC6A 3MP8A 2QDYB 2RN8A 5J1RA 4KITB 1ABOA 5D7UA 1M1KC 5BQTA 2CS3A 3ZQ7A 2LMJA 1YITA 4UP9A 4YROA 1HDPA 5A0GA 5GAN3 1F9NA 5GAOr 2ZBKA 1NZ9A 1N75A 2WC2A 2VXEA 1VYTA 3E97A 4M75G 3JSOA 4DZJA 2MWOA 1HSQA 4HCBA 4D1QA 4FSXA 2CUJA 3H35A 4GY5A 3QOEA 1GFDA 1WXTA 1N9RA 2CZ0B 1SVMA 1APLC 4WJ4A 1T2KA 4A63B 1D0XA 2ZXFA 2XAHA 5FKMA 1KHIA 2PEXA 1MZBA 1X1BA 1SVLA 2VJ4A 2J7IA 4H2SA 2P0LA 1KMMA 3LAPA 5HNFA 3RI4A 1YFSA 1SHFA 5GAOn 3OYHA 5LJ5e 5LJ3f 4E7LA 4H2VA 2LC2A 2HNHA 3H0HA 3AG1H 4ZH4F 1KC8C 5LEJA 3K1NA 2A37A 3DEUA 1OMIA 1SF9A 3CCVT 2EKOA 3GFLA 1G3TA 4CICA 4UV8A 1WQWA 4LIUA 1NJ8A 2V8KA 4ENNA 2D0NA 2OJED 3L1AA 2JNGA 4EGYA 1OLTA 5DLOA 3PNVA 4A3KJ 1V55H 1Q7YU 1BI3A 3I55T 1D8KA 5LD2C 3SJMA 2IS1A 4M77C 4XORA 1NYQA 1O7FA 4M6YA 3WGGA 2LQ8A 3E3VA 4RB3C 3MEYA 3HPGA 4H2WA 1XCBA 4YRVA 4IXAA 4QKUA 1X6BA 2K2MA 4L9JA 1KGSA 3HTZA 4C0GA 5DUKA 4CCKA 3Q9VA 3VQYA 3IV5A 2VOOA 3TO7A 1U78A 1A35A 1Q81U 1TW2A 3RDIA 5AONA 1VQLT 1Z7NA 4MTEA 5LGTA 1HKQA 2CSOA 1X56A 3AL0B 1U06A 3ZGKA 1D1CA 1E3HA 2FQ4A 2QEXA 1HOMA 2CJAA 5BPDA 3K4NA 3GX4X 4M7DC 3HYIA 1TWHJ 1QVFP 4XRMA 1QU3A 1SRMA 1ONVA 1FMKA 2BZ8A 3FISA 4J19A 2TRTA 4A3FJ 1WFXA 4LK0F 2EINH 4M7AF 3BQZA 5HLHA 1NPRA 2E3IA 5HK3A 2JWTA 2FPEA 5H6QA 1VQ7I 3QPSA 1YX5A 2FX0A 1TNSA 3A2KA 1X2MA 5D6EA 5E1ZB 5F0HA 2WV0A 2K5CA 4NOYA 2EPDA 2ZPHB 3N97A 1PVEA 4DOVA 2KHMA 4ESBA 1XNIA 1U9OA 2EQKA 2FD5A 2FBIA 3FJPA 4KULA 2PMZN 1ETOA 2E3HA 1AA7A 3NTKA 2P5KA 4LDYA 1FLIA 3VFZA 3IH4A 3BR0A 3BZCA 1VQ8T 2KMUA 4RUGA 3BCAA 1RLPC 2QM3A 2OCEA 1L0WA 3CCLQ 1RPWA 4K88A 2LRQA 2LVMA 3FM3A 4HCKA 1U5TC 2O9LA 3SWNB 1YS7A 4MNUA 2DPDA 3URGA 2VT3A 3J80K 1WJEA 3E9GA 3K1MA 4M7DE 4IF4A 4C8QC 4ENKA 3OBYA 3L2QA 2BY3A 2FBHA 1SEUA 2Q8KA 4HOBA 4FETA 3GTMJ 4EJUA 3UDCA 5FWBA 1SKUB 1RI9A 2AK5A 3RNJA 2RPNA 2VUBA 4LMYA 4JLIA 4BAYA 2J06A 2HQXA 5DM6F 4BXXJ 3MQZA 2M9HA 1GVJA 2KIQA 4PGHA 3MN2A 2Y75A 1AD5A 2X1EA 5L3FA 3JAMZ 2H8WA 1FYLA 1KG1A 2CMPA 1XMAA 2K5LA 2Y0SN 4PKCC 4FISA 3ERRA 1WNLA 2L3PA 1CQTA 3H0DA 1J75A 1ZG3A 2HZDA 4XLPF 4A3IJ 2E71A 2QSFX 4DJAA 3CDIA 3SWNA 1EVKA 2EJFA 1H88C 1QO0D 3HXVA 2M30A 3FKIJ 2LK2A 2DFIA 1BBWA 3ULQB 1HTTA 2Y4XA 4KRTA 4CCNA 4KGVB 4N4IA 2UXNA 5IT9E 2FU4A 5KYYA 1P2FA 2JM8A 4P96A 4KH1B 3TEDA 2EFWA 5J1UA 3M4YA 1BBUA 5D8KB 1YW9A 1UMQA 3W2VA 2C8MA 1EH6A 3I58A 2JW4A 2CUZA 4RGUA 5HCKA 2H3JA 2ZXJA 2FYKA 3H5NA 4EJWA 2KIFA 4WI1A 4A53A 2A0FB 3JCMe 2P0PA 3HEFA 3U1KA 4EJTA 3OW2A 2ZXIA 3F8NA 1KIKA 1JJCB 2P7CB 2VXZA 2SEMA 2MCNA 3GVAA 4C2MJ 2PVOB 2E34A 4Y3OA 1ETKA 4XTZA 5GANe 3FIWA 3CCJI 1FPQA 2GQVA 2OBPA 4JX5A 4XU3A 2Y69H 2LYCA 1AU7A 5E18F 1V5GA 3TW6A 3CP2A 4XQFA 5M3MJ 4IHVA 2LREA 3HSBA 4P74C 2MK5A 2X51A 2DPPB 1WJDA 9ATCB 1E3PA 4BU2A 1NE8A 3V7CA 2D1HA 2VI6A 1RRJA 3LSKA 1KD1C 2ARUA 5DCFA 3RPQA 1LOJA 4UVCA 2DZCA 3DKYA 1D1BA 1ASYA 4CC2A 5A2QE 2LR8A 2FSWA 2RQRA 4M3FA 2HXIA 3S3MA 4JZ3A 1J59A 4Z6YA 2R58A 4BBSJ 4EEFG 3CC2Q 2RQTA 2LX7A 3FBIB 3ER0A 2IEKA 5L3CA 4ZDOA 3ZL7C 1WHUA 3Q3SA 1IO6A 2HKOA 3CMAQ 1K7AA 4Y7NJ 4LVIA 5KAFC 4LXCA 1LQ1A 2JK3A 4MEXF 3HXWA 2K2VA 5C4JJ 5F6FA 1V5EA 3A0BC 4AIHA 2LJ0A 1W6XA 3UKGA 4H2XB 3NRVA 4JRQA 1GFCA 1JXMA 3WU0A 5FKOA 4KN7X 3PJRA 5IP7J 1FYNA 1BB9A 2AMCB 1Y7XA 3RKYA 1V3FA 3O5ZA 2FF4A 3LH0A 3TP3A 2DO3A 4UNOA 4J9EA 2LP5A 4UP7A 5M9OA 4YRQA 4ESJA 2M87A 1QZZA 4HZFA 1KQ8A 3ZP5A 1MGQA 2KIMA 2LCCA 2R57A 5GAMd 2O6GE 2HOAA 3ECHA 1JI8A 2HOTA 2M7AA 4TQDA 1W5CC 2V1QA 2O2OA 1T0JA 5KYUA 4PJOA 3KIOA 2O31A 4XTYA 4J5YA 2L5QA 2CZ6B 1FSEA 2MC4A 4XKCA 3X26B 4RKUE 3CCMI 4ZTFA 1YRNB 4DZPA 2JVHA 1YYVA 1T6SA 1DGWY 3A74A 5FRNA 1P4WA 3K70D 3P8YA 2EZKA 3CCVI 1HDDC 3DP7A 5IN1A 1OCZH 1MV3A 3TSWA 2JUFA 2LMDA 3HXYA 1IN5A 5FFXA 1D1AA 2KQWA 2BZYA 5GP9A 2ZR3A 1Z91A 1XTDA 1NBEB 2R7FA 1MBHA 1JT0A 5M5YJ 2EZHA 4AMCA 3VS6A 1A6IA 2D45A 4J8OA 3IG2A 4NL2A 2H3EB 2JT4A 2XDDA 3H5RA 4NDLA 1TXQA 3I55I 3FZVA 1VYUA 4RB2C 3A5YA 4CCMA 1NYRA 1ZG1A 5TGTA 2E1HA 2JT1A 4M75A 3BJUA 3HY0A 1STZA 2YHTA 3JV3A 1QQJA 4ZIBA 3P8HA 1YRNA 3GP8A 1SANA 2QA4A 5IP9J 2H6BA 2QHVA 1I0CA 4A5MA 1FY7A 1MBGA 1AVZC 1XTAA 1YJNA 3DWLE 4ANJA 3GTKJ 1PJRA 1M9SA 2CYZB 1IXDA 3HJEA 1IXSB 1B9NA 2XICA 5IYCJ 3K4CA 2DL3A 4GBQA 3MHXA 4WTOB 3DPUA 4XSZF 2KT1A 1VQMQ 1XGNA 4ENMA 2K9NA 2F5KA 4XN0A 5ICEA 4IUVA 2KYMA 5GAOl 2EQIA 4M6XA 1ZH5A 2V1RA 3H0FA 3DTIA 2DL4A 2M0MA 3SFMA 1JJ6C 5GAN5 2L54A 1I81A 1G3YA 3ASOH 3RDVA 3GOXA 1G3SA 3LOCA 5HLTA 1D0YA 1MBKA 1H8AC 3R6OA 1USSA 2OF7A 1KA8A 3IKVA 1OR7A 4E47A 1NJ2A 4CYDA 2EWNA 2VPRA 3A8GB 4MZPA 2E2JJ 3CDHA 2MG4A 4BJ6C 2I8DA 3RYPA 2J6KA 3KLOA 3PIOA 5L3DA 1VQNT 3MMYB 4P9UA 3SHFA 3H8ZA 3M8JA 2IA0A 5K1PA 4RDXA 2OI3A 1VQ8I 1K6OA 2X48A 3A5ZA 3Q0VA 5GAN7 3HRIA 2R0QC 2VODA 3ZQQA 2XG8D 1BKBA 2C06A 3SD4A 4LLLA 5GMKm 5IXBA 4UB8C 5IYBJ 3CXCA 4FT2A 4YTLA 4CSWA 1A04A 5LL6S 4C0FA 3MCAB 4EIKA 4RG2A 2COMA 1J7KA 5DM7R 3HKZA 4X5OA 1JGSA 2AXLA 1YFHA 1OZ2A 4QLCU 2EFPA 2A36A 4PJOE 2IBDA 2CW7A 2CT4A 2PQ8A 2YLCA 2Y9YA 2CP3A 1FOXA 2AQEA 3CF5F 3QP6A 4BDYA 2BGCA 2Y30A 2NVXJ 3FXLA 3CCUA 2A6EF 1ZTRA 2L7ZA 3UA6A 1ZYRF 1MJAA 3HSRA 4JX4A 1BI0A 4R8HA 5DCMB 3MFKA 2IY5B 2MFZA 2KVQG 2KQRA 3QU6A 4EVIA 4GFBA 3CCET 2O8KA 3FX3A 2F2WA 1JKPC 4AU7A 1VQ6A 1OR7C 1IV8A 4YRTA 2OZ6A 5AYFA 1VQ9I 2JQ7A 3E9IA 3F6OA 2PUKB 4P75C 1JKQC 3J7ZI 2ECZA 4M9ZA 3M9AA 3D1NI 5E17F 4WXDA 1IDYA 3QOPA 1SFUA 1NNHA 4I7HA 2CREA 3AG3H 2MLKA 1IL2A 2CH0A 4L9NA 3HGYA 3TQNA 3EUKL 2CSIA 4M75E 2K6DA 3QNEA 1K6YA 5A2QZ 3ASKA 3OWTA 5FLXK 2CV1A 3X20B 3ONQA 3EG2A 1POGA 2WV1A 2X1CA 2HQAA 2CP7A 2PLYA 2A6HF 5ICFA 1VQKA 2CUFA 1EKEA 1S7EA 4IIOA 3PIPF 4ASNA 3P9KA 1BIAA 1XSDA 2PQWA 2HDWA 1Y56A 5DCMA 2IY5A 1PYVA 1YHQA 4FM4B 2GOXB 3ICAA 4PHCA 4JRIA 3TP0A 5J4VA 2MF2A 1IN7A 2DT6A 3X28B 3PMIA 4C30A 5GMKe 3QO3A 4HVCA 4MEYF 4ORZA 3I5RA 4R1HA 2HAXA 1N27A 2FMYA 2XKOA 3DBHB 1B8AA 2VXFA 3GFMA 3FK6A 3EH2A 4BS9A 2QA4T 4P73A 1ZGWA 2X6WA 3TSZA 1U6GA 3VS1A 4I02A 2A69F 6AT1B 1RAGB 2MMPA 4OB3B 3CCRA 2VC1A 2EK5A 1ZR4A 4XU0A 3H5AA 2VXDA 4TWAA 4IUQA 5L3GA 2W1OA 2YT6A 4CGZA 1HC8A 2DTIA 3HXXA 2YPRA 2KIUA 3DEEA 2PN6A 3HTRA 3M3YJ 2CZ1B 3HUGB 1I5OB 1OCRH 2KRCA 2D1XA 3BW1A 2RB6A 4P3OA 2IP2A 2QVOA 4B48A 1IB8A 1KU3A 1YOVB 1NPPA 2P81A 2QCOA 3VU3C 1XS9A 2M3AA 2CH4A 2NOGA 2AO9A 3CCQT 3PO3J 4PG3A 4KUIA 4HG2A 3QO5A 1KJWA 2B9SA 2NVUB 3HTUA 3OIQA 1K76A 1PYSA 3CMEA 4UUSB 4MDWA 1M2VA 2A8EA 3SZPA 2ELJA 3K2ZA 2E2HJ 2GBQA 2JVGA 4M78B 2V1NA 4IOCF 3F8MA 3AAFA 2KAFA 2GAUA 2DOAA 4YRSA 4D5CA 1I1JA 1SETA 3OIPA 2RHXA 2RMOA 2DU5A 2E1CA 1A5JA 1G5VA 1UG2A 3ZCOA 1N9WA 1ETYA 3BY7A 3I5SA 4JJBA 1GHCA 1HA8A 4W1UA 4KT6A 1BK2A 4E6RA 2CZ7B 5JVGF 3C2BA 3JRFA 2HL3A 2YUNA 1WI3A 2I10A 3A03A 1H89C 2HNIA 3UFGA 3JRIA 1B34A 1QMCA 4V19K 3M58A 2QBYA 3CC4A 2ZT5A 2FRHA 1SC7A 3JRGA 4IOAF 4LNSA 3WODF 3AKZA 2LY1A 4BB7A 4JJNK 3GBGA 2RH2A 4EQQA 3IAM2 1R6RA 2NYSA 2CQQA 1S7OA 4CI0C 5AT1B 1TQMA 4PJLA 1YP5A 4OVAA 2Z0WA 2RHUA 2M9UA 1Q81C 1RZ4A 4Y28E 1QHHD 1LNXA 1S72A 4ZZDA 4A6DA 2ECBA 5D8LB 1EFNA 2E4HA 4JJDA 1IRFA 4P72C 3PTAA 4BE1A 2AXTC 2MD0A 5E3OA 2IS2A 1WDXA 3EG9A 1H4QA 2Z99A 1MBFA 1ZRDA 2XB0X 5F0FA 4HCZA 3WTUC 1ZLMA 4M73A 1XQHA 4J9BA 4ZC3A 2GFUA 4JOMA 4RCCA 4HRIA 2DQLA 4HT9A 2M4KA 2C0IA 1X3UA 2WSEE 1EOVA 3E9FA 2HDAA 4MDXA 3S93A 3I56I 4R55A 3PQKA 2HMAA 4HWOA 1SERA 4YFXF 3A1YA 1D09B 2O7OA 4EM2A 3SB2A 2Z5UA 1OCPA 1RKWA 4KA4A 1UUEA 1Z0XA 3NARA 3OYIA 3N5BB 3RMQA 1J0RA 3LSRA 1ARKA 2PX9A 4LB6B 5C52B 4CCLA 4XOTA 1YHQT 3RTRA 4MIMA 2QGUA 1IN6A 2J3LA 4RG8A 4BQNA 1LUJB 2COZA 4LDUA 1B1BA 2L4AA 3N05A 3QWXX 1GRIA 4OP0A 5F64A 3BG6A 5B3SH 1ATIA 4PJNA 1W1FA 3DV8A 3C4SA 2F2EA 3RKXA 4G85A 3AL0C 2DLLA 1N6AA 2TDXA 2ED0A 5D6XA 2XDVA 3LQQA 2YUQA 1REPC 2MSYA 1NTCA 2L2OA 1X1AA 4DIQA 4LK1F 2E1MB 4M3DA 3CO6C 4I0BA 5K7FA 1S29A 2DDBA 2LBFB 1Y8RB 4BDZA 3WTTC 3I64A 2A3LA 2X4WA 4OMYA 3LX7A 4RBOA 2EGEA 2GTJA 2QUFA 1ZSGA 3SFZA 3BPVA 5K7ZA 2YSQA 3A01A 4XRSG 2RNGA 2Q1ZB 1VF9A 5LRRA 2QQ8A 1VQNI 4ZYHA 2M1HA 1T0HA 1XSXA 2HBPA 1ZR2A 4L0ZB 3V8KA 2DE0X 4M78D 2VKEA 4XOPA 3TO9A 4HEA2 2MLGA 2AQFA 5CVRA 5L3EA 4O2DA 2JN0A 1RNLA 2FOWA 3CCJQ 4NC7A 3EQLF 5JLXA 4FX0A 5DUIA 1T98A 3G6EQ 4LVJA 4ELZC 3CC2T 4PLLA 2R7DA 3J80Z 4CXFA 4G7ZF 4JLGA 2R4GA 3LSSA 2DFFA 3GO5A 2PFBA 1WJ5A 2KP6A 2KE9A 3SDZA 2L3RA 4YYEA 4YCWA 2JA5J 2STTA 3OS1A 2SRCA 4XTUA 1HSJA 1Q95G 2F4OB 5F04A 3NAUA 1I6HJ 3ZR8X 2CP6A 2E60A 1KQSS 1YBYA 4IEJA 2LKPA 1LEBA 1Y0MA 1QE0A 3HRSA 2V9PA 2VKDA 3RR6A 1NH3A 4OU0A 1N5ZA 2L02A 5JHUA 3OYFA 3CP8A 1SMYF 3GZ5A 2K5FA 2XGTA 2YS9A 3KP5A 5E8IA 3DEWA 3H92A 2EA4A 1NJ6A 2JS0A 3PFYA 3HOXJ 1O9SA 3CCEI 4J9HA 4E2FB 3MP1A 1R22A 4MZMA 1MSEC 4RA2A 1QA6A 4DOWA 3W2AA 2KDSA 3S6WA 5GPAA 2PG4A 4F7ZA 5E3LA 4KMFA 3T0YA 2D2WA 1UHWA 3GZ6A 1OYYA 2DA2A 1KQSA 5E8GA 2LT4A 4JJCA 1ITYA 2FMLA 1GXQA 2F1LA 3O8HA 4IKFA 4KR3A 1WPKA 3BR5A 1YJ9A 1S72T 4O5VA 1HW5A 3IKTA 4OMMA 2DA6A 2J05A 2GZWA 5FU6B 1IRZA 2QENA 2NUPB 3KEYA 4FW1A 2KRSA 2ARTA 1I39A 1OULA 2RI3A 2XPWA 5EF6A 4KFCA 3K70C 3LSJA 1G6NA 2P8TA 3EFRA 3ZQIA 1LJOA 2ZZDA 4RQFA 3R4KA 2HQ5A 4QQGA 4HX4A 2LVSA 5CKHA 1TTYA 4C92B 2RQQA 3OYGA 5I22A 3EG0A 3CD6T 2G4CA 3F8BA 4ZDPA 3HTSB 1VQOA 1UCRA 2I4MA 4IHTA 1F43A 1ASZA 4P9FA 2DL8A 2XGCA 1LFBA 5FB2A 2EIKH 2LCLA 2QGFB 2FEIA 4RM2A 2W85A 5C51B 4DA4A 2K3XA 4BEHB 2NUPA 5CAIA 1A0NB 5FWCA 2F5EA 4BW9A 4P55A 3HZJA 2R7OA 1SAUA 3CCVQ 3MO8A 4RMFA 5LJ3j 4MFEA 3ELKA 2NUTA 4RS8A 4C9YA 3CC7A 2DBMA 2ZZFA 2HBWA 1NG6A 2DU9A 3HL2A 4C92A 2P7VB 3ZQGA 4FCYA 2K3FA 4FYVB 2A3SA 2CJJA 1RI7A 1IHWA 3I55Q 1IXCA 3HOSA 1VFCA 4BQAA 1Z7MA 3BE3A 2CW8A 2X3WD 2F69A 2KDZA 2GTOA 3CCQI 1RAAB 3G1ZA 2O03A 4Z88A 1XDSA 1ZSZA 2FOKA 3BJ6A 2DFHA 4OMQA 1FBUA 2QDLA 4L5GA 3G71A 2XD0A 4OB2B 4HNTA 2VE8A 4BEHA 3CCSA 3KYLA 3BR6A 3UNGC 4WK8F 3HOYJ 1YIJA 1OYXA 3DTKA 1B07A 1VQLQ 3TEEA 1B70B 1QLYA 4F16A 3C3WA 1OYIA 2IW5A 3UGQA 3QODA 5L3BA 4IJAA 3BFMA 2HTJA 5LBQA 2DA3A 3PNTA 1JKRC 1R1TA 5B1BH 1VQ4T 4DQ2A 2XRNA 4OMLA 1YJWQ 2YUPA 2EA2A 2Q5IA 2O4XB 3Q5FA 4XICA 2BKDN 3THKA 4HV6A 4LG3A 2NYXA 2E7WA 4XMYA 3IQLA 2I4NA 2PBIA 3REOA 1GXPA 1LEAA 4M77G 1CKBA 2CRGA 1MIJA 1Z7LA 3M57A 1W0TA 5IXFA 3VWBA 4KUDK 4B3XA 2YXYA 4J9DA 5ELOA 1XG1A 4CH6A 1RUWA 5GMKi 3HRKA 1PUFA 2X4HA 1B70A 5E79C 3B6AA 4XLAA 2QG9B 3G4SA 3PCOA 3KEQA 2EW3A 4LUDA 2P0WA 1ZAOA 3QZ5B 2XF5A 1J5YA 3H6ZA 3KP2A 3H9NA 1D3BB 1MKMA 3TVTA 2ZTGA 3M7GA 4M7DG 1VQ8Q 1TT0A 1OZ3A 2PMFA 1YFRA 3HXLA 3FXUA 3EH1A 2RV8A 2R5YB 5FU7C 1LFPA 3JCMQ 1ZQ1A 3I71A 6PAXA 2PMHA 2F4MB 3K4JA 5BPIA 2XAJA 3HRUA 1K78B 3ML6A 2HD0A 5CVJA 3CUQA 3GFIA 4YRJA 4BQOA 2PMUA 1KC8R 2V4JC 3QPHA 4G7HF 2P84A 2PMEA 4HLYA 1EIYB 4EMSA 1F1BB 1RAFB 4C92D 2OTLT 1VYVA 2RK1A 5EYRA 3OSVA 3BC8A 3CUOA 2EFNA 4Z8AA 1T8IA 3NGPA 2GF7A 4IHWA 4ZYAA 1D3BA 3VS5A 2R5YA 2LJ1A 2RK2A 3B6CA 3HOUJ 5CVIA 4A5NA 2JJ9A 1UGVA 2NAZA 3MP6A 2GA1A 4G94A 1WJBA 4YDQA 1K78A 3LWIA 5DM7F 3RPUD 2XDBA 1UHFA 1XGMA 5J1YA 1KZHA 3TKYA 2K7LA 3QDFA 3PMTA 3VYHB 4LVMA 1O3SA 5E20A 1VQOT 1R4NB 3BCBA 1GV5A 1Y1VJ 3BQYA 1EIYA 3CF2A 3VS3A 1CF7B 2RHQB 3V7SA 4F55A 2W0ZA 3EGXA 4C8QG 2IPQX 3KP6A 3O8VA 3KX2A 2KROA 4X0GA 1XGSA 4F91B 1WJCA 2YU9J 4KIGA 1HF0A 3UR3C 3JCUC 1UFMA 3HFNA 3GTQJ 4AM3A 2RKHA 4K11A 1VNDA 2EL9A 4IUPA 3NWTA 2W24A 1ZUYA 4LLGF 4GCVA 3JRAA 1FZPB 3BY6A 1IJWC 1WHMA 1DU6A 2LKSA 1UAAA 3V8JA 5GAMe 3CC7T 2DK3A 3QAHA 2CV2A 5CQXA 2BTTA 2QAZA 1MNDA 2ZSHB 3WGHA 3A32A 1R1VA 4CH3A 1UHMA 1G59A 1AEYA 4UVBA 3BR2A 4KIBA 3AHUA 1IUYA 5C53B 1CF7A 4U0YA 4ZNXA 1OISA 3HIFA 3G73A 2DYSH 5L8RE 4HVWA 2GLOA 2E64A 3G71T 5HLIA 1C0WA 1JKOC 1TBXA 4B4CA 3CC2I 3CCST 4GLKA 2XTIA 2CFXA 3S1NJ 1QBJA 2M8EA 5CR2A 1NJIC 3K6GA 1U5SA 3KFWX 1DPUA 2P4RA 2OPTA 3IUOA 1FTZA 4LG0B 1MDMB 1JT6A 3CMAI 1I6XA 2WAEA 3FB9A 2X35A 3EGUA 2CG4A 1ZRFA 1CGPA 3IRQA 3LFKA 2VASA 1D5YA 3FF5A 2R7XA 4HWTA 3EHQA 3HRTA 3NFCA 1TSFA 4JS5A 1VQ5T 3MZYA 4LB5A 1XD7A 2ZFWA 3OSFA 2F48A 4LE9A 3NQOA 1YG2A 3GF5A 3OV8A 1X54A 4FL6A 2P0KA 3M07A 4DEXA 1KU9A 2H27A 2L0AA 4PL6A 3RL6A 2XB5A 3IH2A 3P8VA 4XRSA 2IGOA 1UEBA 4J9GA 2OTJT 2CQ7A 4XLFA 1H9GA 3ZQLA 3E7LA 3I9QA 2VN2A 1AOYA 3VYGA 1MDMA 2XGEA 2ROTA 3G4ST 1BR4A 4BYYA 3TCJA 4I09A 2XAQA 3F8CA 4LD6A 2KFDA 4GYGA 5FLXZ 4KIFA 1S72I 4B47A 3KFUA 1QPIA 4C92F 4PLIA 4OGEA 2LNBA 2YR2A 1KQ1A 5HODA 4XLEA 1MV0B 1FYFA 5E1WA 5TISC 1ZG5A 2YX7A 4MMKA 1GUUA 3CQTA 3LW5E 3QG1A 1HW2A 2K40A 5E1XA 3TQ7P 4V2SA 1NLOC 4L5JA 2HEQA 2H8HA 4BI4A 3DLMA 2E1NA 2DL5A 4EMHA 3CD6I 1IO2A 2LG4A 3BPXA 3HOZJ 5GANj 2W4SA 3H41A 2K9LA 2M0OA 1Z6RA 1EFWA 4OLFA 1WA7A 1PKTA 2K9SA 1ENHA 1YQAA 4BGDA 4A0ZA 4IHYA 2ZT8A 1JO8A 1I4K1 3QWYA 2C0TA 4AFSC 5ILSA 2V8IA 5EG0B 2CV0A 2CP2A 4B3AA 1W2BA 2ZJRF 4BJTA 4DBHA 3HGGA 2Z2SB 4A3CJ 4OMFB 2DA9A 1IZ1A 1X2NA 4ON0A 4DBQA 4L5EA 2DBKA 1ODDA 2Q7EA 1UELB 1B72B 3LGLA 2B63J 3WVEB 2AHJB 2Q7HA 1OEBA 2ME6A 1YW7A 5IY5H 4K87A 4ESRA 5C4XJ 1S5LC 3DFGA 4MQVA 2MI6A 2DFEA 3RGLA 3GLLA 2KMTA 4BHPA 2K3PA 5C44J 2J5OA 4L9TA 4OIPF 2JRTA 3I59A 4WX9A 4MMLA 5FD5A 4XTXA 3GIBA 3A98A 4B6MA 4DNCA 4BNCA 1KD1R 1R77A 2XMFA 1GXIE 1KQ0A 5HDGA 3CBOA 1TS9A 1EF4A 5EG0A 5TJJA 3S17J 4EMKA 3MZ8A 4N0BA 2YUSA 2XPVA 2EAYA 1UJ0A 2QGGA 1RAIB 4N0AC 4PJJA 4N4HA 3O8GA 2UV1A 4I0AA 1BW5A 2EQJA 1ON1A 1GBRA 1YLFA 4XLNF 1UECA 5LHGA 1B8IB 2RJDA 2X1DA 1VQ4I 4MLOA 2RGVA 1Y6IA 1GL5A 3BOQA 4B1RA 3OQ5A 2Z9OA 3ZQCA 2CUEA 3BR3A 4L87A 4JK1X 1QPMA 2HL5C 1NYFA 4M78C 4BUGA 1LDDA 4ZYEA 3M4PA 5AIPA 4FHTA 5ILUA 4EJOA 4RM3A 3HOTA 3QJ6A 3IKLA 5DS9A 1FIAA 1RABB 4OIQF 1KU2A 4TVRA 3J81K 3I4PA 1XN7A 2ZPBB 3JB9H 2FJ1A 3E19A 2X6XA 2CIMA 2ROLA 2OZUA 3UATA 4CS4A 4BXUA 2KR3A 5CIUA 3OR2C 2AKWB 3H0GJ 2WY7Q 2L4MA 2XIGA 1O3QA 5FJ8J 3KUFA 4WJ3M 4DGWB 2ECCA 1GCQC 4O3MA 4CC3A 2NOJB 4M6VA 2N8GA 4M74A 5GAHJ 2UXXA 4ESFA 1ZA1B 3CMQA 1X55A 2QSHX 2K79A 3DTEA 4C2UA 2DFUA 2X4JA 2ZT6A 5CQYA 5GMKl 2IS6A 3JREA 1ZLKA 2ZZGA 1SSFA 1RC9A 2VQHA 3JW4A 4QW2A 5EC7A 5KHDA 1BJAA 2CW0F 5ICCA 1Q86C 3MKYB