3V7CA

Cystal structure of sabpl in complex with inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
total genus 103
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7cA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7cA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7cA02
1B9MA 1WI9A 2ACJA 2Y48A 3HFZA 1QZZA 3GEZA 4WJ4A 3LAPA 5LJ5g 2XUBA 2VE9A 2Z99A 3K0LA 3M7GA 4P75A 4H2WA 1ZRCA 2HQRA 4UVBA 4IJAA 5A2QZ 2EA4A 2A3SA 2YLBA 1ZRDA 1TQIA 3PFIA 4F7UG 3UGTA 4M75B 3CDHA 4HX4A 5GAOr 4CZZA 4A54A 2A61A 3BOQA 5D4RA 2XASA 4A0ZA 1JRIA 1D8KA 1RIOH 1MJAA 1FBQA 4IVNA 2DVEA 2OU2A 3JB9F 4ZYHA 3CMQA 3QPTA 5CVVA 3BY7A 1ULYA 2D2WA 4XEMA 2H27A 4C92C 3HUGA 2E41A 4I0BA 4HWRA 2QENA 1Z1DA 2KJBA 3ML6A 1KU3A 2VBWA 4RS8A 2PMFA 4KR2A 2RDPA 2ZNZA 4HYEA 1ZAOA 5GMKl 1B7YB 1FBSA 2X4HA 4L0YB 3T5XA 3V8KA 2M30A 4JRIA 2CFXA 1PDNC 2ZGWA 3ZMUA 4K87A 3GZ5A 5DDGA 2ESHA 2FE3A 2Z5UA 4M78C 1YTYA 1O3RA 4G6DA 4HQMA 4ON0A 4M7DE 4L9NA 1YS6A 2CGHA 1K7AA 3I59B 3IHUA 1X2GA 2FMLA 2HTJA 1HKSA 1YW9A 5L3BA 1USTA 4OU0A 5H6QA 4S05A 4DNCA 1EIYB 1DPUA 4MEYF 2I2LA 4L9JA 2FEZA 4A53A 1WYDA 2VODA 3NENA 4G94A 4LK1F 3JCMJ 4N0AA 2HGCA 2ZR2A 2MH9A 2XKPA 4LLGF 4H2TA 4B8XA 3G1ZA 3DF8A 3VQVA 5GAMd 3LSSA 3Q5FA 5LEKA 4G7OF 3J81Z 5F5WA 2ZNIA 5CAIA 1IN5A 2DZ9A 4M6XA 4P73C 4EQQA 5ICGA 3RKWA 3LQQA 3PQKA 5K1XA 4Y15A 2CQKA 3T0YA 4CO8A 1KU9A 4M7DA 1USSA 4C8QA 1YO5C 5LJ5h 2W25A 4M72A 4CYDA 3BW1A 4YRJA 2O61A 4TQFA 4ESBA 2P0LA 2DTIA 1U1TA 4FHTA 2ZCEA 2GWRA 3FB9A 5GAN7 1XGNA 2W57A 4HWSA 2RGVA 4M7DD 3WQZA 3RERA 2ZO4A 4M75C 4XU3A 5JI6A 3QO5A 5CLSA 1WKMA 3A7UA 5BPIA 4P3PA 5LJ3j 1YQAA 2FNAA 3EYYA 5ICFA 2I4NA 1AWCA 4YRNA 1NYQA 2M5WA 3N4MA 4YIIA 3TQNA 4E70A 3LA7A 1IN4A 4KN7X 2P5VA 4LG0B 2DQ0A 1I8FA 4GCVA 3I7FA 2ARSA 1F4KA 3ISPA 4C92A 2QVOA 5LJ5e 4BHPA 3WE2A 2IY5B 4M75E 2BBYA 2RHSA 3DKWA 1ATIA 1OYYA 4TVWA 3JAMZ 4PJOA 1Q1HA 4XBFA 3NEMA 1ASYA 1B70B 1Y96B 1KMMA 1P4XA 2ZR3A 1G6NA 3KP7A 4YFKF 3JSPA 3E9IA 3GYHX 2XAJA 1I4K1 4LG0A 3CUQB 3QP5A 1YW7A 4WK8F 1HKTA 4BWAA 3V7RA 3HSEA 4AD9A 2QLZA 4C92B 3KZZA 1KOGA 3BZ6A 3F3XA 2RHSB 1TW2A 3IL2A 4OMYA 1IRGA 2GXGA 5JVTA 5HS7A 3GO5A 3DFGA 1P6RA 4UV9A 5LRRA 1E1OA 1B70A 1N9SA 5LEJA 4M7AA 4RCCA 1EVLA 3D0SA 3HXVA 5IT9Z 3E97A 3I0TA 2OA4A 2QBYA 3ZMSA 2VBZA 2K4JA 3F8NA 2J3LA 1T98A 1X55A 1S3JA 1VTNC 1R36A 4M7DC 2CJBA 1BBWA 1SMTA 2ZBKA 1QZYA 2RC4A 4HBLA 4HDUA 2HFHA 2EFOA 1H4QA 5IT3A 3T8RA 3I5UA 2GXBA 1FT9A 1ZHFA 2RM4A 2PBIA 1XGSA 2A5YB 2B0LA 3FMQA 4KN4X 3T8TA 4OIOF 4YRPA 4YRIA 4MMKA 4LB5A 1XSVA 2O8XA 1LEAA 2IA0A 5K1YA 4H0EA 4I98B 1MKMA 5GAMg 3GXOA 3V4GA 4EMKC 4L9VA 2DTHA 2EFQA 4TTVA 1U5TA 3VBBA 5LHGA 4RQEA 1P4AA 4DPGA 2XGTA 2FQ3A 2JTVA 1K78A 4HV6A 4ASNA 2GA1A 1I1GA 4C8QC 5D4SA 2LSOA 1BOAA 5LJ3e 3IG2A 3TO6A 5GAMf 3QPHA 2EJRA 3ZMDA 3MEXA 3Q9VA 5HLHA 2OAZA 2BYVE 4L9TA 4ZTUB 3ZN0A 1I6XA 2J5PA 4I0AA 3W6KB 1MDMB 4P55A 3KCCA 1RNLA 2L54A 5KNNA 1L0WA 2DKGA 2Q0OA 4U0VA 3E5QA 4DQ2A 2C7IA 3JTGA 3H92A 2EJGA 4L18B 1K79A 1B76A 2FB7A 5GANh 2HTSA 5FFZA 1YB3A 1HC7A 2MC3A 1KYWA 3VFZA 2K02A 3J80Z 1TQPA 1H0MA 4S04A 1LOJA 2F5FA 4LD5A 5FD6A 1EVKA 4HLXA 2GIVA 2MA3A 3A32A 4F7UE 3CLOA 4U7BA 2A69F 1IN8A 3WE3A 3GZ6A 3L1AA 4EMSA 4P73A 2V6CA 2PMHA 4CH4A 1N9WA 4C8QD 3I58A 1R58A 2CO5A 2YX4A 3GW2A 1B34B 2VXFA 2FRHA 1H9TA 2RNJA 4UP9A 2MH2A 1YCYA 3HRKA 5F6FA 5ED4A 4PG3A 3S2WA 2HWVA 1O3SA 2Y90A 3MZHA 4YPFA 1T2KA 2O3FA 3JCMf 1Z6TA 4YRCA 3I59A 1WSUA 1LVAA 3DSQA 4IHTA 4EJTA 3HSBA 5ICCA 1EIYA 2IP2A 4HX7A 4L5IA 1P92A 5BPDA 2UWMA 4RAZA 4FX0A 1GGMA 5L3FA 2MBFA 2D1HA 4TVYA 4WXCA 2VBXA 2AXLA 3NEUA 4CH3A 4O3MA 4M77D 2K27A 4RGUA 2YX7A 2W85A 4HW0A 1K6OA 2G7UA 1LJ9A 1U5TB 1NHAA 5KVRA 4G7ZF 11ASA 3TOBA 2DDZA 12ASA 4OIQF 1ONVA 4XLPF 1HW2A 4M78B 3MEYA 2ZZFA 2VXZA 3HHGA 2E5AA 3E6DA 4EJVA 3F21A 3F23A 1C0AA 3ERED 1BM9A 4BAYA 2RHQA 1ZLJA 4Q15A 3QNEA 4CS4A 1KQ8A 4XSZF 3HFVA 4P3OA 2W24A 4M77A 4IXAA 3MZYA 1HSJA 1BI2A 4TVAB 2V9VA 5HLGA 3HSRA 3MFKA 3F6VA 3F72A 1EQRA 3L4GB 5HS8A 3OV8A 4CHUA 4PJOG 5GAN3 2I4MA 2ZT6A 4BHBA 2E1NA 1RZ4A 3JCMc 1J75A 1WLEA 1BBUA 3MF1A 2VN2A 3WTSC 2NNNA 2QHUA 2IT0A 1SFEA 1ZRFA 5K1PA 2VOPA 4FT8A 4BHCA 3O3KA 1B4AA 1O3TA 1XMAA 1R1VA 5CVJA 3K69A 5GAN2 3JW4A 4HLYA 4NOYA 1XCBA 4LJZF 3NELA 2QZ8A 3ROUA 2Y75A 3FM5A 4K86A 4F7UF 3J81K 4P3NA 5K5QA 4KMUX 5A2QK 2FBKA 3P8TA 1JGSA 3LWFA 4MTEA 5HDNA 1ADJA 1SMYF 4A5NA 1YFTA 3FWEA 2G9WA 2ZT8A 5DD8A 4EJOA 2HOEA 3TDUC 2L3DA 3LSTA 3DPLC 2XAGA 4HQEA 4MEXF 4OINF 4LB6B 1J5WA 2JSCA 3PGGA 5E8GA 3NRVA 3MCZA 3IWFA 3GFJA 4A5MA 1FC3A 5GAMj 3HXZA 5FD5A 1JE8A 1W7PB 5D5UB 3EYIA 4XTYA 5H6RA 1KU2A 4HOBA 1KQ9A 4LGWA 4M7AC 4HF0A 3KFWX 5GAOn 3HRSA 4MMLA 2K7LA 1IUYA 5HDGA 1FX7A 3ICAA 2MD5A 3QP6A 1OR7A 1UB9A 1ZG3A 2XAFA 2DQRA 2EL9A 1REPC 3ECOA 2F2EA 3WGIA 3RJPA 3JCMe 1U2WA 3L9FA 5DCMB 3HTSB 4M73A 2H94A 3IKVA 3WTWC 3A7RA 4O2DA 1S7OA 3A31A 1O57A 3U1DA 4H2SA 2IRFG 2M8EA 1KYZA 5FLXZ 1E2XA 3HRUA 2A68F 3QUIA 1JHHA 5LJ3d 5GANg 4Y17A 1NJ8A 2F5DA 2E10A 1S29A 3WG9A 5FLXK 4F7UB 5LJ5d 4BXUA 3JCMW 3TO7A 2V1XA 3ECHA 1J59A 1SRYA 1HQCA 1O7FA 2DLLA 2OQRA 2IW5A 1IXRC 2Z33A 4XQ3A 2QWWA 2X0LA 4YRGA 4IHSA 3OOPA 1QE0A 1EH6A 2G4CA 3E6MA 2OZ6A 1G3WA 2L4AA 2PEXA 1BIAA 3KLNA 4I01A 5GAN5 1G5IA 3HY0A 2PMEA 1OKRA 3K9TA 3ERRA 1KQ1A 4I09A 5GAOm 2VONA 3PQJA 5H20A 3HXWA 5LJ3f 5CYVA 3E6BA 3HIFA 2ZMEB 4RAYA 2H6CA 4IRIA 1MDMA 4ENKA 3JCMb 1CF7A 4Y91A 1BIBA 3RIRA 2ADUA 3E5UA 1I5LA 3HRIA 3HY1A 4XTVA 5DUKA 3ZMTA 4M7AD 2HNIA 2P6SA 3OD1A 5ERIA 3JCMh 3JB9I 3E5XA 2O0YA 1HK9A 4C92G 4CH5A 1B7YA 1YFSA 4GGGA 3RDIA 2IVMA 1RIQA 3R61A 3FXUA 1EH8A 3EFSA 3JAMK 3L2CA 3K1PA 3ZP5A 4C8QE 3M4PA 1YGBA 3D5LA 2ALYA 1XGMA 4KUMA 1Z7NA 2GA2A 3JB9G 2CJ9A 4YP0A 3RKXA 4PDKA 3KEOA 1XB4A 4UHTA 3ELKA 3LC0A 2RV8A 3BWGA 4YRTA 4CXFA 5GANf 1IW7F 1S6LA 3L09A 1T6SA 3VU3C 3PCOA 1D3BB 4F7UA 2EWNA 1QBJA 1QNTA 2YLCA 3MAJA 1B1BA 5L3EA 2DQLA 4LLNA 1FY7A 4NL3A 2EAYA 4ZZLA 2NNYA 3JCMP 3SB2A 2DO7A 4N0BA 5DYMA 4R8HA 2FU4A 3GFMA 4P72C 1FOKA 4V2SA 3LSQA 4P5OA 2DI3A 5LRSA 1LDJA 4TV7A 5CJ9A 3R4KA 3BROA 3HOTA 2ZNJA 2DW4A 2YHTA 3COAC 2K57A 1UHMA 4AIHA 4OP0A 3HRMA 2DFIA 4XU0A 4RQFA 3KEQA 2FSWA 4A6DA 4IPAA 2PN6A 4MTDA 3N97A 2AMCA 2LF8A 5BMZA 4J6XA 4M7DG 1A04A 2V1DA 4M77G 2KIMA 5F1RA 3VQYA 3FIFA 3V8JA 4GYGA 1GXPA 3LAJA 1Z91A 1W4MA 2DBBA 1BC7C 3HXYA 2STWA 3K1MA 1UFMA 4YG2F 4KA4A 4M75G 3RUXA 4EM1A 1YYVA 4N0AC 2L02A 4UVAA 4GO1A 2KIUA 2DK5A 1JJCA 3I4PA 1KGSA 1DDNA 1YIOA 1FLIA 3INZA 5CVRA 3TEHA 1PP8F 3NQOA 4C8QF 2TDXA 1TTYA 2HEOA 1DPRA 2ZCWA 2ARUA 1F9NA 3VODA 4M9XA 1MJ9A 5CVIA 1BI3A 4R79A 3WTYC 4AH6A 5GAOp 4BW9A 2UZKA 2RA2A 2GZWA 2ZJ2A 3LFKA 3M8EA 2PQ8A 4L5JA 4UNOA 4P9UA 2UXNA 5J8FA 1H641 2O6GE 1N9RA 4XU1A 1TLHB 4ENMA 2EJ9A 5D5VB 4MHGA 3V7SA 3JCMQ 4M9ZA 1YS7A 3WGHA 3JCMd 2P6TA 4Q6GA 4H02A 5GAN6 3J80K 1D3BA 3L7WA 2VBYA 4AIKA 3GUDA 2XHKA 2IJLA 4P74C 2Q2EA 4M7AF 4KQEA 4QLCU 2Q8KA 1EFWA 4EJUA 2FF4A 1XDUA 1L0OC 4GYIA 2BE5F 5LGNA 3KETA 1IRFA 1YFRA 2DU7A 2A6HF 1Y0UA 4EX5A 2E65A 2QBYB 2NRAC 4N9HA 4J15A 1BI1A 2FA5A 3RTRA 1KQ0A 2VC1A 3R0JA 4OLFA 2RB6A 3QOPA 5L3CA 2HS5A 3VB2A 1WNLA 3QO3A 2FYKA 1HBXG 4WWCA 2XRNA 3ZPLA 4AWXB 4HF2A 3RPQA 4CS3A 4U0WA 1T38A 4M7AE 5BQTA 4ZYEA 4C92F 1UHWA 1WU7A 1X2HA 2ZIMA 3REUA 1XGOA 3RL6A 4HF1A 3RESA 3TEGA 4KYWA 1R1UA 2LDUA 3JCMV 2RHQB 2WV0A 5C51B 4M7DF 4M9SA 2ZT7A 1J5YA 3CTAA 1U5TC 2YSRA 5BOXA 4QVCA 4PJOC 1HW1A 2ZXJA 4YREA 2DZCA 2Q5HA 1L3LA 1U1SA 4IRHA 3DQVC 1BJAA 5E1WA 5E20A 5ILUA 3FXRA 3I64A 1P2FA 1AOYA 2HYFA 2ELHA 2EV6A 2QQAA 1PYSA 3FMSA 4KFCA 2HYGD 2ZMEA 1RUOA 3HOSA 3RACA 1E24A 5DCFA 1NJ1A 5E1XA 5E8IA 1HSTA 5LHHA 1HKQA 3I71A 2ISZA 5ILVA 1VQZA 2WTEA 3IRQA 3P8YA 2KIFA 4TQDA 4PJOB 4I02A 3WU0A 2D1VA 1FBUA 3M4GA 2W84A 4M77B 2ISYA 2IA2A 1XCVA 3GFLA 1JXSA 1ZN2A 4QVDA 2ZKZA 1R22A 4YCWA 3SFZA 4YFNF 1QPMA 4EVIA 4YROA 1SAXA 1FSHA 4HAMA 4J6YA 1O7LA 4KICA 2E1CA 1G5HA 2EK5A 2L4MA 2VT3A 4LMYA 2QHVA 1B8AA 4U0YA 3IWZA 3Q9SA 2PFBA 4JQFA 4CH6A 2E7WA 1E1TA 3PZCA 4UP8A 1RI7A 3RF1A 3KP5A 3KP2A 5HVQC 2VT2A 4JLIA 1JBMA 1F1ZA 4YCUA 1S8NA 3V8LA 5HS9A 4EMKA 4RGXA 3RKYA 2Y0MA 2F5EA 3F22A 2P7CB 1MJBA 3TUPA 4UV8A 4K2EA 5GMKm 1G3TA 3GVAA 4M75D 3K1NA 4ZZDA 4M78F 1H4SA 2QQ9A 2XIGA 3I54A 2ETHA 4YRFA 4K88A 1J0RA 1FNNA 4U7DA 3SZTA 3F8FA 2JZYA 3VQXA 3IKMB 2K4BA 4CICA 4KNYA 4EM0B 5HDKA 3RYPA 4O6JA 1YFHA 4WF2A 4ZH4F 4MGRA 4LNSA 5GAN8 2H6BA 1W5SA 1X3UA 3A5ZA 5LGTA 5EEGA 4WJ3M 1V3FA 1XDSA 3JCMg 4AIJA 2EA2A 4MNUA 1R5GA 1B34A 1PYSB 1XMKA 4YRLA 4M74A 4M6YA 2OD5A 2Q5IA 3KFUA 5DV5A 3TKYA 2FOKA 1KA8A 4XTUA 3QHSA 2Z9OA 2M45A 4YIFA 4A12A 1Z7UA 2KRFA 2DPUA 4YFXF 1RUNA 2HKOA 2P4WA 2NAZA 2MLGA 1EV7A 3JB9J 4LK0F 1W66A 4A0YA 1ADYA 1LQ1A 4XU2A 1QO0D 3W6JB 2JN0A 1U6GA 1OMIA 3HXXA 3M8FA 1IZ1A 4G7HF 1FYKA 1FP2A 1ODDA 1F5TA 4KR3A 2PMUA 4NQWA 5LGUA 1B59A 2PG4A 2YPRA 1GXQA 3BPVA 4CS2A 2DAOA 3G3ZA 4A6EA 4ZYDA 1V4RA 2RVCA 1STZA 1KQ2A 2DEQA 1ON2A 1O3QA 3P9KA 3I53A 4EMHA 1CGPA 3P9IA 1R7JA 2LF7A 2CJAA 3TOAA 4IF4A 1EH7A 2HR3A 1D8JA 3EETA 1W7PA 4OIPF 5CVUA 2H09A 1NYRA 4NCXA 2RN7A 2OQGA 3GFIA 4M78D 1Z6RA 4L87A 4UVCA 2VE8A 5C52B 2WC2A 2QTXA 4NHJA 4JUVA 5DD4A 2RKHA 5J8CA 4M7AG 5KK1A 1MGTA 3P7NA 2ALYB 1I81A 1SERA 3TGNA 2M1BA 2LKPA 3E3VA 3L00A 1SFUA 1I5ZA 2QHTA 4P9FA 3GF2A 1GHCA 2DTRA 4M77C 1T39A 1U8RA 3LA3A 3F6OA 5GANj 3L2ZA 1YW8A 2BGCA 5DCMA 3KP3A 4X9CA 4Q48A 3QAHA 4WXHA 1BI0A 1G51A 4Q5SF 1FYFA 4E51A 3EDPA 5GAOl 3WTUC 3WGGA 5TRDA 1LDKB 1TNSA 1SD5A 3EFRA 2V1UA 2E3CA 3FHZA 1PP7U 2IA1A 3M9AA 5GMKe 3J7AO 3R6SA 1FPQA 4EGZA 1LNXA 2JT1A 1G4DA 5GAN4 1HXDA 3BDDA 4G8XA 4KIFA 3C3WA 1H4TA 1NJ5A 1I1SA 3BY6A 4X5OA 4XTXA 3BDUA 4LLLA 4PCQA 3HTUA 1SD7A 2K86A 4M75F 1OYIA 2COMA 4TVAA 3B02A 3BJOA 1ZG5A 3P9CA 2F5CA 2QYOA 2Q7HA 3L4GA 2QM3A 4ENJA 2FBHA 2DJZA 3VOEA 5JHUA 4RCBA 4NL2A 2AS5F 4F7ZA 3O2PE 2VOOA 2JPBA 3PCOB 2STTA 2EJFA 3G73A 4C92D 3IKLA 1WQWA 3REOA 2PLYA 3F8MA 4J5YA 2ZFWA 4PJOD 3FM3A 2ZTGA 3SWNB 4BH9A 1CF7B 1D5VA 2QHSA 3HFZB 5LBQA 5FGMA 2I4LA 4WCGA 2EB7A 4M78G 5HGQA 3KZYA 3WTVC 3JB9H 4A0XA 4PHCA 4ETSA 1K78B 5E3IA 2XKOA 2KJCA 3E6CC 4M75A 2O03A 5ICEA 4I7HA 1TQMA 3LQRA 5J6XA 2AMCB 1FWZA 4XEOA 2QQBA 3R0AA 5D6FA 5LLQA 3E9HA 1XN7A 4U88A 3VQWA 1MD0A 5K5RA 2ZXFA 3C1DA 4KIGA 4NB5A 2XVCA 3GLXA 2DU5A 3BJUA 3SWNA 3F8BA 2QUFA 1LB2A 4KDPA 2E1HA 2R7DA 1HW5A 3HYIA 2E64A 4EV0A 4CDGA 1SETA 1MGQA 4XTWA 5DUIA 5GANd 5L3GA 2ZT5A 4GXOA 1JJCB 1X56A 2BV6A 2ODRD 5E17F 2FBIA 2A6EF 1Z9CA 3UH0A 3U9GA 3QO7A 2MLKA 2P7VB 1LDDA 2M87A 4EGYA 1ZGAA 5LJ5f 1TNTA 3BFMA 1WWXA 2VC8A 4M7DB 1LNWA 3DEUA 4BNCA 2LNBA 5D6EA 4FX4A 1WQ7A 3H3ZA 2WWYA 5AIPA 4P72A 4YRMA 2ZZGA 1R1TA 3O6BB 4ZIBA 4AVPA 3M4QA 3F8CA 1ZLKA 5JFRA 2CGPA 5C53B 5JR3A 3MF2A 3HTZA 4D0PA 4HT8A 3WTXC 1XSXA 2RQPA 2GQQA 4M7AB 4P96A 3GX4X 3DP7A 2J3MA 2GAUA 5D5XB 4YRSA 3DXJF 1QQIA 4YYEA 1IN7A 3LA2A 3CUOA 3JCMX 3A74A 3IRRA 2XAQA 1H4VB 2FXAA 2XROA 3QO8A 3WODF 4HZFA 4WI1A 3QSUA 5HOOA 3P8VA 3EUHA 4HT9A 1ZYRF 4C8QB 2AKWB 5L3DA 1R5HA 5D8KB 4L0ZB 1QGPA 2XGXA 4PGGA 4EO4A 1MZBA 5ELNA 2P5IA 2ARTA 4G9YA 3RI4A 3TEHB 2RD1A 2A07F 4Z2YA 2I4OA 1ON1A 2DXUA 3C7JA 3R60A 3FJPA 1ZG1A 4H2XB 5FB2A 1M5Q1 4YRQA 1SFXA 4RB0A 5GMKj 3UFGA 4EM2A 4LFUA 4P74A 1J2XA 3AAFA 2Q7EA 5LJ3h 3CUQA 2EV0A 1UCRA 4XSXF 3QTCA 1FYMA 2HZTA 3CO6C 3JB9D 1ZGJA 1SD4A 4JBAA 4KIBA 5HLIA 5FFXA 4ZYGA 2OBPA 1M8VA 3SHFA 3REXA 4RDXA 3U2RA 1B9NA 1OPCA 4OIRF 1J9IA 1USYA 1YLFA 2ZIOA 4YDQA 1SESA 1R00A 3HRTA 4H2VA 4XTZA 2IY5A 4BYYA 3T1BA 3JSOA 2XAHA 2CYYA 3CO7C 1BN5A 2ZNYA 3RPUA 3EQLF 3QU3A 3ZQ7A 5GMKh 3CJNA 3IALA 2Z3YA 3A7AA 5GMKi 2L01A 3BPXA 4OMZA 4H2YA 1X54A 1YG2A 1TBXA 1GVJA 4JRKA 3SQNA 3BJAA 3ULQB 4HA8A 4M77F 2EV5A 4KMFA 3HSFA 3ZMZA 4R1HA 6PAXA 3DV8A 2G7HA 5EEHA 2EFNA 2CSOA 1ZH5A 1R23A 2DK8A 4ESFA 2NYXA 5GAOq 3FXQA 1U3EM 3MQ0A 4P75C 1DUXC 4P71C 1EOVA 4HWOA 2YR2A 4EMKB 2DT5A 4WXDA 2C8MA 1LYLA 3IC7A 2YU3A 4CGZA 1J7KA 1BBYA 3QRFF 1TW3A 4N9IA 3WTZA 5IT9K 4C8QG 4PGHA 2EFWA 1WRJA 1QF6A 4EMGA 2BEOA 4XRFA 2AKWA 2Q7GA 3R07A 1C0WA 2UXXA 3FF5A 3RYRA 3A5YA 2DXTA 2C6YA 2IPQX 4ZTZB 1OYWA 1W5TA 4MQVA 4YCVA 4RGSA 4ENNA 1PUEE 2E7XA 4KT5C 4UPAA 4WX9A 1IXSB 1LEBA 1XSDA 2CIMA 2CWEA 1NNHA 2KKOA 4PZJA 2FNPA 5AIQA 3HFOA 3FZVA 1W7PD 3RGLA 2HDCA 2J5OA 5LJ3g 4OOIA 2JPCA 3NETA 1FZPB 4M78A 1FP1D 4HWPA 1B6AA 3IKTA 2HKXA 4X9DA 4RB1A 4YRRA 4M77E 2XTIA 1KMNA 4PJOF 3C18A 4G84A 4YRKA 3GWZA 2P5KA 3KE2A 3KLOA 3ZN1A 3K2ZA 4M78E 2DQ3A 1BC8C 1FYLA 5E1ZB 1E17A 1P4WA 4PNOA 2ODRC 3TO9A 3SWNC 1USYC 3WU1B 1T0FA 2VXEA 4RMFA 4I2OA 2DPDA 1IL2A 3V7CA 3SXYA 1E22A 3VEPA 3AHUA 2PJPA 1ZARA 3QU6A 4C92E 3BP8A 3SZPA 5F64A 5DEQA 2DTOA 4HDVA 4HVCA 4BQAA 5D5WB 5ILSA 4O5VA 2NS0A 5GAMh 2V79A 4JK1X 4J6WA 1LJOA 1G3SA 4EJWA 3HXUA 4TWAA 1Y96A 2ZINA 1ASZA 1IF1A 3TDZC 1NJ2A 3ABTA 4MQ9F 5AONA 4HWTA 5LJ5j 2FMYA 3W3SA 1X01A 1TH7A 2R7FA 3DPTA 2JRTA 5K5OA 1D3YA 2CG4A 4RB3C 5FO5A 1NJ6A 3KP6A 1I27A 4IRGA 3FX3A 2P5LC 5BS6A 5TJJA 3ZMVA 4Q4ZF 1IN6A 4HV5A 1KU7A 2DU9A 1Z7MA 4UXNA 1SD6A 1XD7A 4B09A 1JHFA 2CW0F 3GIBA 3CUQC 2R3SA 4XLNF 4P71A 5E18F 2D45A 4PJOE 3FMRA 4A2UA 1IXCA 3HHHA 1Z05A 3BJ6A 1S7AA 3ABUA 3JTHA 4UUVA 4Q47A 4G6QA 2VC0A 1WQ2A 4UP7A 1DP7P 3H3UA 4QWQA 1IAWA 4HX8A 1ZREA 3WTTC 2OZUA 4Y13A 4H2UA 3UGQA 1H9GA 3MWMA 3HFNA 3KP4A 4ESJA 1WPYA 3B73A 5D8LB 2ESNA 4RGRA 5LHIA 5I21A 3M1EA 1FSEA 2HQNA 5GAMe 2PI0A 4M71A 5GANe 1G3YA 1HTTA 4RB2C 2P8TA 4H2XA 2ZZEA 2EFPA 5DY9A 5ELOA 1U78A 2XV4S 4G85A
chains in the Genus database with same CATH superfamily
1B9MA 1M2VA 1X4OA 3HOVJ 2LVMA 3TEDA 1WI9A 2ACJA 4A4GA 2Y48A 3HFZA 1QZZA 3GEZA 4ZDLA 3GTPJ 3NTKA 3LAPA 1BR4A 3ULRB 4L5GA 1OZ2A 3CF2A 5LJ5g 2XUBA 2KT1A 2VE9A 2LBFA 4RM3A 1UTIA 1Z77A 1WJAA 2Z99A 3K0LA 3M7GA 4P75A 4H2WA 1ZRCA 2HQRA 4KUIA 4UVBA 4FSSA 4IJAA 5J47A 5A2QZ 1OV3A 1Y1VJ 2EA4A 2A3SA 2YLBA 1ZRDA 4C5EA 2ZPFB 4FW2A 1TQIA 2E35A 2A0FB 3M58A 2CQ7A 3PFIA 1ZSGA 1BK2A 4M75B 4A4EA 4F7UG 3UGTA 3CDHA 4HX4A 5GAOr 5C44J 4CZZA 5HCKA 1WHUA 3QPLA 4A54A 1SVLA 2A61A 4B48A 1TG0A 3BOQA 5D4RA 3H9JA 3JR9A 1QQJA 2XASA 2X48A 4A0ZA 2JA7J 2E1MC 1JRIA 1D8KA 2IVWA 3MHXA 1RIOH 1MJAA 3VWBA 1QCOA 1FBQA 2EQJA 2DPPB 2YUQA 2DL8A 1WYXA 4IVNA 1YJ9T 1VQ5T 2DVEA 2X4XA 1YE9A 2OU2A 3LGFA 3G4ST 4ZYHA 3JB9F 2HYJA 3S2DJ 3S32A 1T0HA 4F52A 3CMQA 2Y4YA 1B7TA 1FXXA 3QPTA 3NWSA 4IOAF 4DOZA 4BU2A 3ZEHA 2HZDA 1LVKA 5CVVA 3L2QA 1Y8RB 1ULYA 1UHFA 2WACA 3BY7A 3HTRA 2D2WA 4ABZA 4J9BA 3CXCA 1ZX6A 1YIJT 5FW9A 2H27A 4XEMA 3GP8A 2A5WA 4C92C 4Z6YA 1M4ZA 3RBBB 3HUGA 3KEYA 1PM3A 3RDVA 2E41A 4I0BA 1QCFA 4HWRA 4RUGA 2QENA 1Z1DA 2KJBA 3ML6A 1KU3A 2VBWA 4RS8A 5KHDA 2PMFA 4LVMA 2M0MA 4KR2A 2RDPA 2ZNZA 4HYEA 1ZAOA 1X19A 3Q3SA 4HNTA 3ZQCA 5GMKl 3PIPA 1B7YB 1FBSA 4VUBA 2R5MA 2X4HA 4L0YB 3T5XA 3V8KA 2M30A 4JRIA 2CFXA 1NK2P 1PDNC 2KDOA 3ZMUA 2ZGWA 4K87A 2RHXA 3GZ5A 1OX9A 5DDGA 3H0DA 3CLQA 4KITB 1Y07A 1W0UA 2ESHA 2PJRA 2ZXIA 2FE3A 1HCRA 2Z5UA 2OTJQ 4M78C 1K4SA 2M3AA 1KK7A 1YTYA 1O3RA 2CT3A 4G6DA 3BCAA 4HQMA 4NC7A 4JJCA 4ON0A 4M7DE 2COZA 2KROA 4L9NA 1YS6A 2CUJA 2CGHA 2PNIA 2JRMA 1K7AA 2ZC2A 2D0QB 2HMAA 4JX4A 1PJRA 4QQGA 3THKA 1X3ZB 3I59B 1FEXA 3C95A 3IHUA 2QKMB 2IGOA 1MV3A 1RACB 2JM9A 1SF9A 1X2GA 5J39A 1ZK8A 2FMLA 2HTJA 1EIFA 1IO2A 1HKSA 1YW9A 5L3BA 3H0FA 4A3IJ 1USTA 2A6TA 3KPHA 2L3PA 1VQ6I 4OU0A 5H6QA 4S05A 2KL4A 4DNCA 1EIYB 4YEJA 1DPUA 4MEYF 2I2LA 4L9JA 2NVYJ 2XF7A 3H9QA 2FEZA 4A53A 1GRIA 2VODA 2WSFE 2E3HA 1WYDA 3NENA 4G94A 4XLCA 5CKBA 4LK1F 5CPRB 1KQSS 1C1AA 5BNGA 3JCMJ 4N0AA 1HF0A 3QYFA 2HGCA 2CRGA 2W10A 2ZR2A 2MH9A 2XKPA 4LLGF 1KC8U 1OCOH 3IH3A 4OVAA 4RG2A 3CCEQ 4H2TA 4B8XA 1GFCA 3G1ZA 3DF8A 3VQVA 4RM2A 3TVTA 4C2MJ 5GAMd 4YRPA 3LSSA 2LC2A 3K70C 3VS7A 2HNHA 4DBHA 1YJWT 3Q5FA 1ETXA 5LEKA 2EQKA 2VXDA 2BY2A 4G7OF 2HSEB 4C2TA 3J81Z 2NS6A 5F5WA 4CCLA 4MMKA 2ZNIA 5CAIA 1IN5A 2DZ9A 4Y28E 4M6XA 4P73C 2IAIA 2PZ1A 9ATCB 4EQQA 3FEOA 3C0CA 1YJNI 3S16J 3DLLA 3CJTB 5ICGA 3OMGA 4HRIA 1YRNB 3OYBA 2EH3A 3RKWA 2KT8A 2PVGB 3LH0A 3LQQA 3PQKA 4IUTA 1GVDA 1RC9A 5K1XA 3MEWA 4Y15A 1Z3XA 2DN0A 2JZ2A 2CQKA 3T0YA 4CO8A 2O31A 2NUPA 5D6YA 1J3TA 12ASA 1KU9A 2KMTA 2K5LA 4M7DA 2KLOA 1USSA 4C8QA 1TU0B 1YO5C 1ZTRA 5LJ5h 2W25A 5KYNA 4M72A 4CYDA 4AM3A 3BW1A 4BI3A 4YRJA 1EX4A 2O61A 4TQFA 4ESBA 2P0LA 4A3KJ 1EF4A 1Q86R 4DYCA 2DTIA 1U1TA 1JKQC 3DTKA 2CFOA 2EQIA 2XGEA 4FHTA 1T95A 2ZCEA 2GWRA 1X1PA 1SANA 1TUCA 3FB9A 2LH9A 5GAN7 1Q82C 2RNGA 5K7HA 1XGNA 2W57A 3KYDB 2Z0WA 2RGVA 2DA2A 4CYCA 4M78G 1YN8A 4M7DD 4HWSA 3WQZA 3RERA 2W82A 3HOZJ 2ZO4A 4M75C 4PL6A 4XU3A 2XSJC 3X24B 4F17A 5JI6A 2W0ZA 1WHHA 5CLSA 1WKMA 2DD4A 3A7UA 2K9LA 3CP8A 2E5ZA 3QO5A 5BPIA 4XLEA 3M4YA 3CCUI 2M0YA 4P3PA 1QW1A 5LJ3j 1YQAA 2FNAA 3EYYA 3MKDA 1BR2A 4IZZA 5ICFA 1ZKGA 3O8VA 2OTLT 4IQ4A 2I4NA 3C2HA 4XN3A 2R7RA 2WB1N 1H8AC 1AWCA 4YRNA 5KCOA 1NYQA 2M5WA 1KC8C 2IEKA 3N4MA 2BIVA 4YIIA 2M16A 3TQNA 4E70A 4E7LA 1NYGA 3LA7A 2RQTA 4LNSA 1IN4A 2Y0SN 4CCOA 4KN7X 2P5VA 3TU4K 4ANJA 4LG0B 1YP5A 1I8FA 2DQ0A 1YIJQ 4GCVA 2OCEA 3CMET 3I7FA 4QVZA 1M8MA 2X6OA 3CC4Q 4I99C 2ARSA 2DXBA 2PUOB 1W0TA 2V9KA 3M8JA 2O9SA 3HL8A 1F4KA 2BZ8A 2E6ZA 3G4SQ 3L2UA 3ISPA 4C92A 2QVOA 2R7VA 5LJ5e 1JJ2S 4J01A 4BHPA 3WE2A 4IUUA 4G6TB 3NMZC 2IY5B 1G8XA 3DPUA 4M75E 2R7ZJ 1P7IA 2BBYA 2CMPA 2VJIA 3TBIA 2M7AA 3DKWA 2HL3A 1ATIA 2RHSA 2PJRB 5L8RE 1OYYA 3W2VA 4TVWA 2JUCA 1TOVA 3JAMZ 1TT5B 1XTAA 1Q1VA 3QZ9B 1Q1HA 5F08A 4XBFA 3VYGA 3G71T 4CZCA 1AWOA 2XF5A 1K76A 2MCNA 5J1YA 2O8KA 4AFZC 1EJ9A 4IUVA 3NEMA 4BGDA 1ASYA 1Q86C 2H1LA 3EHQA 3CPFA 1B70B 4BJ6C 3TW6A 3H9GA 1NG2A 4MZPA 1Y96B 3S3MA 1KMMA 4A3DJ 1P4XA 3JRZA 2ZR3A 1OCPA 2VIXA 1R4NB 1G6NA 2NS8A 1NZ9A 5L23A 2CUEA 1TS9A 3KP7A 4YFKF 2HDAA 3G2BA 3JSPA 1YITT 4N4GA 3E9IA 3GYHX 2X1CA 2XAJA 4LG0A 1I4K1 2EVRA 3CUQB 3QP5A 1YW7A 4WK8F 1HKTA 3TQ7P 5IT9E 1X2NA 1H89C 4BWAA 3V7RA 4E6RA 3HSEA 1POGA 3K4CA 3S2HJ 4AD9A 1P7JA 1G2BA 2QLZA 3LMMA 1LCKA 4C92B 3KZZA 1VQNA 2E70A 4PJMA 2E4HA 1KOGA 4JJDA 5E3NA 3OYFA 3GNGA 3BZ6A 4XM3A 3F3XA 2RI2A 1TW2A 3HM5A 4C0FA 5DM7R 2RHSB 1JO8A 4Y7NJ 3IL2A 2JA5J 4OMYA 1TTHB 2QKLB 1WJEA 1W5CC 1UDLA 1RLPC 5KH6A 4HSTA 1IRGA 3PTAA 2GXGA 2DE0X 5JVTA 5HS7A 1YCSB 5KYXA 2CP5A 4LDWA 3K4NA 1IRZA 4QIWN 3GO5A 3WVDB 3S8PA 2CSQA 3DFGA 1P6RA 1UZCA 2DYBA 4RG8A 2VQGA 4UV9A 5LRRA 1AWXA 2DO3A 2RQRA 2V1RA 2M8GX 4DBFA 1B70A 1N9SA 5LEJA 1T56A 4M7AA 1GCQA 1I6HJ 4RCCA 3TCJA 2CUZA 3D5SC 3KYCB 3E1SA 1RAAB 3O8HA 1EVLA 5A0LA 3D0SA 3DLLF 3OBWA 3VUBA 4N4IA 3HXVA 2MK5A 3ESWB 4RTUA 3JRDA 3UATA 2EYXA 5IT9Z 1XQHA 4DIQA 2IXSA 2DOFA 2OA4A 3E97A 3I0TA 2R93J 2QBYA 3ZMSA 1MMDA 3MP8A 2VBZA 2WADA 2K4JA 2VUBA 2KY9A 1Z9QA 3F8NA 2J3LA 4LUEA 2X4YA 1T98A 2DFHA 3DEWA 4J7FA 1X55A 3FBIB 1ABOA 1S3JA 1VTNC 1PUFB 1R36A 3RSNA 1WJRA 4M7DC 1QVFS 2CJBA 1BBWA 2A05A 3CD6I 2CUBA 1QHGA 1SKUB 1SMTA 2ZBKA 3K4BA 2ME6A 5KYXB 1QZYA 2RC4A 4HBLA 4HDUA 2RQWA 4D1QA 3DB3A 2OTLA 1SEUA 2E5QA 1M1EB 2HFHA 4RTZA 2EFOA 3GTGJ 2QSFX 1D1CA 2FO0A 2HVQA 1H4QA 5IT3A 3T8RA 3I5UA 5M3FJ 1FT9A 1ZHFA 4NUBA 2PBIA 1XGSA 4FE4A 2GXBA 1FTZA 1X75C 2GF7A 2A5YB 2B0LA 3FMQA 3QWLA 4KN4X 3T8TA 1E3PA 2DA4A 2I5UA 1ETOA 1MW7A 4BUPA 1XC5A 1XSVA 2O8XA 5GAHJ 4LB5A 1K1ZA 1LEAA 2IA0A 3P8DA 4OGEA 4A4HA 5K1YA 4H0EA 4IKFA 4I98B 2QYZA 4OMMA 5FU6C 1MKMA 5GAMg 3GXOA 3V4GA 4JZ3A 1IDZA 4EMKC 4L9VA 2DTHA 1YITQ 1R9TJ 2EFQA 4RTXA 5HNHA 4TTVA 4LVLA 2V1QA 1U5TA 2EIMH 3VBBA 4ATOA 2QDLA 5LHGA 4RQEA 1SG5A 1P4AA 2QQSA 1U06A 4DPGA 3JRHA 2XGTA 2WBMA 2FQ3A 4FQGA 2RHIA 2X6YA 1SVMA 1F43A 3ER0A 2JTVA 1K78A 1TSFA 4HV6A 2DTZA 4ASNA 4RTYA 2GA1A 1M1KC 1I1GA 4E4HA 1JXOA 3CMEQ 5H2FC 5FKLA 1UECA 2HD0A 4C8QC 3R6OA 5D4SA 2LSOA 1BOAA 2WV1A 5LJ3e 3IG2A 2EKHA 3TO6A 5GAMf 3QPHA 5IP9J 1ZQ3P 2EJRA 3ZMDA 2KVQG 3ZQIA 2DK3A 3CCUT 3MEXA 3Q9VA 5J1UA 2OAZA 5HLHA 2BYVE 4L9TA 4ZTUB 3ZN0A 4II1A 1I6XA 3HKZN 1U9NA 2EZHA 3LL7A 2J5PA 2H3JA 2R7SA 1OCZH 3OYLA 4GBQA 4I0AA 3W6KB 1MDMB 1X3WB 4P55A 2BY0A 3KCCA 1VQMT 1WDXA 3X28B 1RNLA 1HC8A 3C4SA 4AFQC 2L54A 5KNNA 1L0WA 2COBA 2Q0OA 4BACA 3OOUA 2XPUA 4U0VA 4DYQA 1PYVA 2HQ5A 3E5QA 3GMEA 4DQ2A 2CYZB 3G1MA 3H92A 5TISC 3JTGA 4L18B 2EJGA 1VIEA 2LCLA 4B9XA 2O2OA 1K79A 1B76A 2BXYA 3CD6A 2FB7A 5GANh 6AT1B 2HTSA 5FFZA 1QU3A 2C06A 1YB3A 2LMDA 3AG1H 1I39A 1T3SA 4B47A 2GFUA 2MC3A 1HC7A 3C2GA 4M3FA 1KYWA 2JUGA 2K02A 3VFZA 1TQPA 3J80Z 2LX9A 4XOTA 1H0MA 1MNDA 3BZCA 4S04A 2XSDC 1D09B 1LOJA 2F5FA 3BTJA 4FIBA 4HSRA 2CDTA 1FJLA 4BE0A 4LD5A 5FD6A 1UJ8A 3NAUA 3SDBA 4HLXA 3VSLA 3OSVA 4HCKA 2CQQA 1VQKQ 1EVKA 2GIVA 2VASA 5FU7B 2MA3A 2L8DA 1AU7A 4A93J 3A32A 1FYNA 2DXCA 3CLOA 4F7UE 4U7BA 1WZOA 2A69F 5IHIA 3CCEA 1VQ4T 1IN8A 3WE3A 3GZ6A 2I8DA 4EMSA 3L1AA 1K9MR 2DBMA 1ZSZC 4RAFA 4P73A 2V6CA 3A5ZB 2PMHA 5KYYB 4CH4A 1N9WA 3CCSI 3ASNH 4C8QD 4MZMA 3TEEA 3OA6A 1VQKA 2PMZA 4RMNA 3A8MB 3I58A 1R58A 2CO5A 2YX4A 3GW2A 4UUSB 1YJWI 1B34B 2FRHA 4F91B 2DX1A 2VXFA 4BY1J 3CCJI 1H9TA 2K9NA 3GOXA 4TVAA 2RNJA 1AKHB 4UP9A 2MH2A 4PFOA 1YCYA 1MSEC 3SFMA 3HRKA 2L7FP 3BR2A 1WJDA 1B8IB 1RKWA 5F6FA 5ED4A 3VYUB 2NVQJ 5IXBA 3QBYA 4PG3A 3S2WA 3CDLA 2HWVA 1O3SA 2Y90A 3GNFB 3WVEB 3MZHA 2DMOA 4DA4A 4YPFA 3SJMA 5E79C 1T2KA 2FPFA 3H9NA 2O3FA 3JCMf 1PCXA 1Y6IA 1H3HA 1Z6TA 4YRCA 3I59A 2HQXA 1WSUA 3E9FA 5J26A 3M0SA 2L9VA 1Y71A 2ZZDA 1LVAA 3ZQQA 1IC8A 4IHTA 3DSQA 4KGXB 4N4OB 4EJTA 1RPWA 3HSBA 3LSHA 2O9LA 5ICCA 4DOWA 1OZ3A 5M9OA 1EIYA 2IP2A 2JK3A 4HX7A 4L5IA 1ZSZB 3A8HB 1E6HA 1P92A 3G6EI 2LDMA 2YWWA 5BPDA 1GV5A 2UWMA 4LVIA 3BR5A 2DA5A 2CV1A 1FOWA 1Y0NA 4ZTFA 2DL7A 1FOYA 4NNJA 2RN8A 4RAZA 2XPWA 3OWTA 4FX0A 4M6VA 4AU7A 3LSPA 1U9OA 5L3FA 4C0ZA 1GGMA 2MBFA 3AKZA 2D1HA 4TVYA 4IO9F 4WXCA 2VBXA 2AXLA 3NEUA 2V8IA 3PUFA 5D6WA 5J3BA 1AKHA 2QA4Q 1N8RC 5IOYA 4CH3A 4O3MA 4ZGJB 3GCMA 2X4JA 2K27A 3E2UA 4RGUA 2YX7A 2W85A 4HW0A 1K6OA 2E1OA 2XGDA 3M9QA 1QVGP 1WGXA 1LJ9A 2G7UA 3W3CA 2R5YB 1U5TB 2J6OA 1NHAA 5KVRA 1YI2A 4G7ZF 11ASA 3H0GJ 3TOBA 2NXNB 2L9RA 3CCRA 2DDZA 1IV8A 4J19A 2EKOA 3H0HA 3G4SA 4OIQF 1VQLQ 1ONVA 3DEEA 3FDYA 4XLPF 1HW2A 3QDFA 2K9QA 2VXZA 1JJ6C 3HHGA 4FYXB 4M78B 4XLHA 1OISA 4OMFB 3VV0A 4AMCA 3E6DA 4EJVA 1MNEA 3F21A 3F23A 5CQXA 2OV7A 2KMUA 3PIOA 3ERED 1BM9A 4BAYA 2HVRA 2HQHA 2QAZA 1ZLJA 2RHQA 1YIJA 4Q15A 3QNEA 4CS4A 4OAYA 2CZ7B 1A31A 1KQ8A 4XSZF 2LQWA 2DXIA 2VJ4A 3HFVA 1HYOA 4P3OA 4FISA 2W24A 4M77A 3PSFA 4IXAA 1WHJA 3VYTB 2W48A 1WHGA 3MZYA 5C0MA 4LOCA 1HSJA 4ESRA 2LVSA 2VJ5A 1BI2A 1UJ0A 4TVAB 4RDUA 1X27A 3TP3A 4LD9K 2V9VA 5HLGA 2Y69H 3HSRA 5FLXE 3MFKA 3F6VA 3F72A 2K7AA 1KD1U 3HPGA 1LE8B 2KK4A 3HEFA 5HS8A 1MUZA 3OBYA 3J7AF 3OV8A 2DEUA 1RAEB 1TT0A 1NH3A 4CHUA 2F48A 3QG1A 2P81A 4PJOG 5GAN3 2I4MA 3QXEB 2ZT6A 3HGGA 4BHBA 2E1NA 1NLPC 1RZ4A 3JCMc 4CRIA 3FKIJ 1J75A 2CZ0B 2DT6A 1BBUA 3ME9A 1WLEA 2QA4I 2VN2A 5IXFA 2JQ7A 1WZ2A 3WTSC 2NNNA 2QHUA 2HOAA 2JWTA 1AHJB 2IT0A 3MF1A 1AZEA 2FZCB 2LLKA 1YJ9I 1NJIR 1SFEA 4PJ0C 1VQ7A 1MV0B 1ZRFA 3SDZA 4XRSA 4FU6A 4OGCA 5K1PA 2VOPA 2X85A 2FX0A 4FT8A 3FIWA 4BHCA 2RQVA 3O3KA 1B4AA 2ELKA 1O3TA 1BL0A 4E7SA 1XMAA 3CCLA 2TCTA 1R1VA 5CVJA 1OFCX 3K69A 2HOTA 5GAN2 2JTMA 3JW4A 4HLYA 2K9SA 1XCBA 1VOMA 4NOYA 5KE3A 2EILH 4LJZF 3NELA 2L2PA 2QZ8A 3ROUA 2H8WA 1WH7A 1B72A 2Y75A 3CESA 3FM5A 1OQKA 3RNJA 2FL7A 4K86A 1MMAA 2EINH 4F7UF 3J81K 4P3NA 5K5QA 4KMUX 4BL0B 1YWOA 5A2QK 2FBKA 1GCQC 3FRNA 1JGSA 3LWFA 4MTEA 3CPWA 3P8TA 2XDBA 2PMZN 5HDNA 1MMNA 1ADJA 1A35A 1SMYF 4A5NA 1WXTA 4RA2A 3OSFA 1N6AA 3FWEA 2IIMA 2LC4A 1YFTA 2EIKH 4P5NA 1VQOI 2G9WA 3E0JB 1ABQA 2ZT8A 2NOJB 5DD8A 4EJOA 4M4ZA 2HOEA 2QGUA 3TDUC 2L3DA 2E12A 3LSTA 2KYMA 3TREA 3DPLC 2XAGA 4HQEA 3DTEA 4MEXF 1MBFA 4OINF 3IAM2 4LB6B 4C3HJ 4FSXA 1VQ5A 1J5WA 2JSCA 3HOUJ 2K9GA 3PGGA 5E8GA 4NBQA 3NRVA 3MCZA 3IWFA 3GFJA 4PJLA 4A5MA 1FC3A 5GAMj 3HXZA 5CKFA 1IDYA 1ZBXA 5FD5A 1DP3A 2DA3A 1X4PA 1JE8A 2VJJA 1W7PB 2M0CA 2X6WA 3E19A 3JV3A 5EC7A 5D5UB 3EYIA 4XTYA 2KHMA 3META 4FT2A 4RAGA 3CCYA 5H6RA 1KU2A 4HOBA 4JPBW 1KQ9A 4C5GA 4LGWA 1LKXA 2SEMA 4D7MA 3OYNA 2OJED 3S14J 1T0JA 4HF0A 3KFWX 3MKYB 4M7AC 1T0FC 5GAOn 3HRSA 4MMLA 2SRCA 3PNYA 2KR3A 2OAWA 2K7LA 2R5ZA 5J3LA 2K3FA 1D5YA 4HG2A 1VQPT 2OTJA 3BC8A 3DKXA 1IUYA 2A36A 4YELA 4JZ4A 5HDGA 1FX7A 1SHGA 4LD6A 2KRNA 4F16A 2JTFA 3HXLA 3ICAA 2MD5A 1GDTA 3QP6A 2LMJA 3TSZA 4CC3A 1OR7A 3M53A 4UUTA 2KXDA 2O01E 2KNBB 1KD1C 1UB9A 4F55A 2LCSA 1ZG3A 4ZGDB 2XAFA 2DQRA 4HT4A 4XLFA 2C0TA 2EL9A 1REPC 2MFZA 4PUSA 2Z2SB 4KGVB 3ECOA 3QYGB 1IREB 1WI3A 2F2EA 4YTLA 3WGIA 3RJPA 1UJYA 3JCMe 1U2WA 3CC4I 1W2BS 3L9FA 5DCMB 3HTSB 4J7IA 2NVUB 1JB0E 1FMVA 4M73A 1IHWA 2H94A 3IKVA 2L7KA 3WTWC 3I9QA 3A7RA 2DODA 2KPMA 5DLQE 3LGLA 1K73R 4O2DA 2ZXHA 1S7OA 3A31A 1O57A 4Y33A 1WHLA 3U1DA 3CBMA 4H2SA 2IRFG 2M8EA 1QVFA 1KYZA 5FLXZ 2WAQN 1M3CA 5KE2A 4WCIA 1E2XA 2HQEA 3HRUA 2A68F 3QUIA 4ITVA 3U21A 5C6SA 2HVSA 1QP3A 1JHHA 1W6XA 3MEAA 2O7OA 4BEHA 3QJ6A 5LJ3d 1UFFA 1JKRC 5GANg 4R0KA 3G71A 4Y17A 1NJ8A 2F5DA 1R0BG 4IX7A 2E10A 1VYUA 1S29A 2G6FX 1NK3P 1FMWA 4K11A 3WG9A 2V6EA 1ITYA 5FLXK 2CT4A 1N8RU 1OCTC 4F7UB 1TUGB 3BR3A 1EA3A 1ACIA 4BXUA 5LJ5d 3JCMW 3TO7A 2OI3A 2V1XA 3ECHA 1J59A 1MIJA 1HQCA 3PE0A 1SRYA 3BLYA 3DBRB 2GNCA 1O7FA 4S0HB 1WI7A 3CCQT 3GLLA 2G0EA 3CXCP 1GFDA 2DLLA 2OQRA 1N75A 3G1OA 2IW5A 1IXRC 1BBZA 5C4XJ 2WY7Q 2F4MB 1OU9A 2KE9A 2O4XA 2Z33A 2VGNA 1Z0XA 2QWWA 2X0LA 1UGVA 4XQ3A 4YRGA 2X6XA 3QYBA 4IHSA 1K4TA 3OOPA 4FYVB 4BDZA 1QE0A 1EH6A 3A02A 3E6MA 3X2QH 1IJWC 2EYQA 2VPLA 2G4CA 2OZ6A 1G3WA 1X1BA 2F2VA 4EATA 4J8OA 2QEXT 2L89A 1NG6A 2I0NA 1QKWA 2KBTA 2L4AA 4A4FA 3M0TA 2PEXA 4HVWA 1BYMA 1GL5A 1BIAA 3KLNA 4I01A 4BE2A 1H8KA 3CD6T 2QGFB 4IHXA 4LN2A 3LSGA 1YBYA 2BW3A 2VQHA 5GAN5 1G5IA 3HY0A 4B3XA 4J00A 2L3RA 1UGRB 5HKCA 2DKGA 1OKRA 2PMEA 1JUSA 3K9TA 1R77A 1VA7A 1YWPA 3FDRA 2E6NA 3ERRA 1KQ1A 4I09A 2DJIA 4D5CA 4BE1A 5GAOm 2BKDN 3BR0A 1VFCA 2VONA 3K4KA 3PQJA 2AQFA 5H20A 1OEBA 1YFNA 1VQ4I 2VVKA 3HXWA 3LH5A 3OS0A 2IS4A 2L7MP 5LJ3f 1E0EA 4BI4A 5CYVA 1MNMC 3E6BA 4XNFA 3HIFA 4BXXJ 2ZMEB 1Q7YC 1XOVA 4RAYA 1VQ9I 3EFOB 3FC3A 3DU6A 2L7ZA 3OYGA 2H6CA 2XI9A 2XU8A 2KYBA 3L1PA 1W2BP 1HD3A 4IRIA 1MDMA 4ENKA 2MI6A 3PSIA 3JCMb 2I10A 5K7FA 4QPOA 1VQ7I 1VQMQ 4JYKA 1QKXA 1AD5A 2NS7A 2MGQA 3M0PA 3ASKA 5HK0A 1CF7A 1BR1A 3PM1A 4Y91A 1BIBA 3C12A 1E3HA 3RIRA 1YRNA 3NPFA 2ADUA 3E5UA 1I5LA 4M7DG 3HRIA 3HY1A 1W1WE 4XTVA 4NS5A 4C3JJ 4F04B 4CA0A 3PIOF 5DUKA 5FWCA 3ZMTA 2DIQA 3CF5F 1CKAA 1VQPA 2JSPA 2R7TA 1JQQA 3HOXJ 2HNIA 4M7AD 1XG1A 1W70A 2P6SA 3FHNA 3M1CA 1XS9A 1EZZB 3OD1A 5ERIA 3JCMh 1ZELA 3JB9I 3E5XA 4FETA 1KG1A 2O0YA 3IP4B 3A8OB 1HK9A 4C92G 2GTJA 3M59A 1AOJA 3H5RA 4CH5A 1B7YA 2CJJA 1YFSA 3B6CA 3KXTA 2LR8A 4GGGA 1D1AA 3RDIA 2IVMA 2P4RA 3A2KA 3QJYA 4HCCA 1RIQA 1WVRA 3R61A 3JRCA 4JOMA 4PJOA 3I4NJ 2W1OA 3FXUA 1CKBA 3WU2C 2Y30A 1EH8A 4X6AJ 3EFSA 2K3BA 2ZJPF 2DFFA 5CQGA 4Z02A 5IYDJ 1KFZA 3JAMK 1JXMA 2OJ2A 3L2CA 2YU9J 2JVHA 3K1PA 3ZP5A 4C8QE 3M4PA 1M2VB 1YGBA 2B63J 1Q81R 1TUDA 2JNGA 3D5LA 2B9SA 1ADYA 3CCRI 1UGSB 1WJSA 1XGMA 4KUMA 1Z7NA 2ALYA 1HA8A 2GA2A 2KQRA 2HXOA 1M1FA 4B9WA 2PUKB 4PSWA 1KZHA 1KONA 3JB9G 2CJ9A 4A63B 2XG8D 1OPKA 3BZKA 3I5RA 4YP0A 3RKXA 3I56T 3OB9A 4PDKA 4ZN1A 1YOVB 3KEOA 3CCVA 1XB4A 4UHTA 3ELKA 2Y0SA 2AZSA 3DLMA 2BVLA 4C5IA 3PFSA 3LC0A 4KUDK 2RQQA 1C6VX 2RV8A 3HC7A 3BWGA 2WB1A 1HDPA 1BCOA 1WLPB 3VKIA 4AFUC 2B7EA 3ZOBA 4QPQA 3CC7T 4YRTA 2DMPA 4CXFA 2DA7A 3EUHC 2V8KA 4X34A 5GANf 1IW7F 5JHFA 1X2QA 5M5WJ 4E2FB 1S6LA 1MH3A 2QCOA 4XRMA 1WJBA 3BQYA 3L09A 1T6SA 2WSCE 3VU3C 3PCOA 1JT6A 1D3BB 4F7UA 2EWNA 1QBJA 1QNTA 2HKNA 1RAGB 1UUEA 2DJQA 2V7FA 2YLCA 3MAJA 4EIKA 1BJZA 4IEJA 3I55I 2IS1A 2H1KA 2KT0A 1U3OA 1WJCA 1B1BA 5L3EA 1YX5A 2DQLA 4LLNA 1FY7A 3GTLJ 3GTJJ 2VV5A 3J81E 4NL3A 5IHNA 4BS9A 3RMSA 2K5IA 3ZGKA 1MBHA 2YDLA 1BW6A 5M3MJ 2EAYA 2IS6A 3A98A 4LVJA 2OF7A 4ZZLA 2NNYA 3JCMP 3SB2A 2DO7A 2NOGA 4N0BA 5DYMA 4R8HA 4AYBA 2FU4A 3GFMA 4P72C 4XKCA 5EJCA 1FOKA 4V2SA 3VUZA 1S72I 4P5OA 5HLTA 2DI3A 3CMAI 2D5VA 2DAQA 5FU7C 3LSQA 5LRSA 1LDJA 3SZGA 4TV7A 4BY6B 4XORA 3G6ET 5CJ9A 3R4KA 2VI6A 3CMEA 2C0OA 1ZUUA 3S17J 3LSKA 2KISA 1IG7A 2NUPB 3BROA 1BKBA 3HOTA 3QWXX 2ZNJA 5EZGA 1VQKI 3MPUB 4JS4A 2DW4A 2YHTA 5I2MA 3J7YJ 3COAC 4RKUE 2NUZA 3CQZJ 3OYKA 2DYIA 1BA5A 2CP7A 2K57A 1M90C 1IUFA 1UHMA 1ZA1B 4AIHA 2JVVA 4OP0A 1VQ8A 3HRMA 2DFIA 3HZJA 5CQEA 2F4IA 4XU0A 2OTLQ 4RLQA 3KEQA 1TWFJ 4U87A 1AVZC 2MAMA 2FSWA 2DCEA 4A6DA 4IPAA 3ZCOA 4BDYA 2PN6A 1GLNA 1LFBA 4MTDA 3N97A 1AWJA 4BBSJ 2K5FA 3HP9A 4X1VA 2AMCA 5FROA 3OYIA 3S93A 3PT9A 2LF8A 4HNUA 3ABKH 5BMZA 4J6XA 1YJWQ 1VI0A 5EG0A 2JUFA 1A04A 3MVPA 1RLQC 3MJXA 3CCJQ 2V1DA 4M77G 2KIMA 3A8GB 1VQ8Q 3HDDA 1IZ6A 5F1RA 2DIGA 2IGKA 2LQNA 3RQ4A 1LE8A 1WCMJ 2RREA 2D0NA 2RQUA 3ABMH 3FIFA 4L6V5 2NUTA 3S6WA 4DEXA 3VS0A 1V5EA 3V8JA 1RKTA 2ECCA 4GYGA 2X3XD 1ETYA 4ZDOA 2VB6A 2E19A 1GXPA 4HVVA 4KRTA 4NC6A 4CC7A 4OAZA 3CCMQ 3M5AA 3LAJA 1Z91A 1UG2A 1W4MA 2DBBA 1BC7C 2DMUA 1PKTA 5D7UA 5FU6B 1GT0C 3ERMA 2LBFB 3HXYA 2STWA 2BZXA 3K1MA 1UFMA 1YITI 4YG2F 4KA4A 4M75G 1S72Q 3RUXA 4EM1A 3RPUD 5E3OA 1YYVA 5J4YA 2M1HA 4N0AC 2L02A 2VQLA 4UVAA 5I2SA 4GO1A 3P5JA 5F1JA 2KIUA 3CP2A 2DK5A 1JJCA 3R6NA 2DNUA 5CO7A 5KYUA 3CPWP 2FRYA 1VNDA 3I4PA 2QDYB 3DB4A 2DL4A 2QXFA 1KGSA 1DDNA 2C7IA 1YIOA 1FLIA 3INZA 5CVRA 4BD3A 3TEHA 2AQEA 3BG3A 1PP8F 1BCMA 3NQOA 2EQMA 4C8QF 2GBYA 4QT7A 1I3AA 2JVGA 3G71I 1UGPB 2K3XA 2TDXA 4UB6C 4M3DA 2ZCFB 1TTYA 2HEOA 1LUJB 3ZRGA 1DPRA 5JVGF 4I76A 2ZCWA 2XB0X 3GTOJ 2AK5A 2ARUA 3K4MA 2V8JA 3W2AA 2CS7A 1F9NA 2Q2EB 2K4YA 3VODA 4M9XA 2M7BA 1OI1A 4KJZA 1MJ9A 5CVIA 4DJAA 1BI3A 3ABLH 4R79A 2E60A 3WTYC 2HDDA 5JLWA 1Y0MA 3BT9A 3KUFA 5GAOp 1OULA 4AH6A 4BW9A 2UZKA 2RA2A 2V1NA 2GZWA 2ZJ2A 3LFKA 5EG2A 3CMMA 4M3EA 2K2MA 3M8EA 1VQLI 2PQ8A 3GBQA 2BVMA 2WA0A 4L5JA 4UNOA 3HUGB 1N5ZA 4BJTA 4QKUA 4P9UA 1Q86U 2YS9A 3URGA 3CCMI 2UXNA 2LT1A 5J8FA 3OS1A 4AIDA 2EZIA 1H641 2O6GE 1YI2T 1I1JA 1N9RA 4XU1A 1V76A 3TW7A 2O9VA 3LX7A 1TLHB 4ENMA 3BQZA 5D5VB 4X1EA 2GXAA 2EJ9A 1JUMA 4MHGA 3GTKJ 1PD0A 8ATCB 3V7SA 3JCMQ 4M9ZA 2D1XA 3OQ5A 1YS7A 3WGHA 3JCMd 3NFCA 2P6TA 2BZTA 4Q6GA 1E7OA 4H02A 1GCPA 5GAN6 3J80K 1D3BA 2KEAA 2QEXA 2DA9A 3PL8A 1MHNA 3H6ZA 2X51A 3L7WA 8AT1B 2VBYA 1W36D 2LKSA 3GUDA 4AIKA 1JUPA 2ED1A 1KQSP 3EUKL 5F27A 1OR7C 2XHKA 2R0QC 2IJLA 4P74C 4XQFA 2Q2EA 4A3EJ 4M7AF 4KQEA 4QLCU 3G71Q 4A3LJ 3S1MJ 4KGZB 2EBIA 3MP1A 3OS5A 1T8IA 4XAXB 2Q8KA 2CH4A 1EFWA 3K10A 3QYEA 3QZ5B 2WAEA 1EKEA 3OL3A 2RMOA 3VYRB 2QF7A 4EJUA 4J9FA 3SEMA 2FF4A 1A6QA 1OCRH 1L0OC 1XDUA 2Y9YA 2LJ3A 3ZQGA 3I5SA 4GYIA 3REAB 2BE5F 2O5RA 3Q0VA 2HI3A 3H1CA 5LGNA 3KETA 3CC7I 1IRFA 4A3MJ 3CCVI 1YFRA 2DU7A 2A6HF 1Y0UA 2KP6A 5FKKA 4YRVA 2H8HA 4EX5A 2E65A 4A3FJ 1HLVA 5D6XA 2VLAA 2BTTA 2QBYB 2NRAC 2ED0A 1WJQA 1EFNA 4N9HA 2JJ9A 2CZ1B 2BY3A 1VZ0A 2M9HA 3SDGA 2P84A 3HOYJ 3MCAB 2CU7A 3VYHB 4J15A 1BI1A 2FA5A 2W7NA 3RTRA 1KQ0A 2VC1A 3R0JA 4WJ4A 4YIRX 4II2A 2E36A 2RB6A 4OLFA 3QOPA 2CQXA 4PK4A 3W2WA 4W1UA 1ZLMA 2LJ1A 2M51A 1JTYA 5L3CA 1UELB 2HS5A 3VB2A 1VYTA 1WNLA 1LPLA 3QO3A 4HXJA 2Q5HA 3G6EQ 2FYKA 4LDXA 1HBXG 3S1QJ 4WWCA 2XRNA 3ZPLA 2BHZA 4AWXB 4HF2A 3K2AA 1SEMA 1NE8A 2CSIA 2R7OA 3RPQA 4XOPA 2PTKA 4QTRA 2MYSA 4CS3A 4OWRB 4U0WA 4CSWA 3DWLE 5LFAA 1T38A 5BQTA 2DBKA 4AG1C 4HKEA 4M7AE 1EQRA 5TGTA 5GADJ 1ERDA 2LT4A 3MO8A 1NPRA 4ZYEA 2ECZA 1PRLC 4C92F 3ZBDA 3EAEA 1UHWA 3D5RC 4KT6A 4LE9A 1WU7A 1WX6A 1X2HA 2LX7A 2ZIMA 1BB9A 3REUA 1XGOA 3RL6A 4HF1A 1DU6A 4N4HA 1B8IA 3RESA 4EPCA 3TEGA 4KYWA 1R1UA 2LDUA 4E7IA 5GTIC 3JCMV 2WV0A 4I6ZA 2RHQB 5C51B 4M7DF 4M9SA 2OPTA 3QPSA 2ZT7A 1J5YA 3CTAA 1U5TC 2YSRA 2PQWA 2L0KA 2QK0A 4ZGEB 3J80E 5BOXA 4QVCA 4PJOC 3EG9B 1HW1A 2ZXJA 2E2HJ 1IB8A 1DQUA 4YREA 3KYLA 5IYCJ 4A3JJ 1IGQA 3CCVT 2DZCA 3TL4X 2CP3A 2NVTJ 2L3SA 1IRXA 4FE7A 2E1MB 1L3LA 2LNHB 4ME7A 2NVXJ 4MO7A 1A5JA 3K4LA 2K79A 1U1SA 4IRHA 4MDWA 3CCST 2FD5A 2E5NA 1BJAA 3DQVC 5E1WA 5FJ8J 1ETQA 3PJRA 2C0IA 1ZUKA 1QVFP 5E20A 4GDFA 5ILUA 3EGXB 3FXRA 1RRJA 1NYFA 3EHRA 3I64A 1P2FA 2R7QA 1MBJA 3ONQA 2HYFA 1G59A 3GTMJ 1AOYA 2XIDA 4A4KA 1M90R 2ELHA 2EV6A 1PC0A 2ABLA 2OUMA 2QQAA 4JP0A 4ELYC 3FMSA 4KFCA 2K9MA 2HYGD 3DCFA 2KQWA 2ZMEA 3QIIA 4KBMB 2QI2A 1RUOA 3ZL7C 4PFZA 3HOSA 3LWHA 3RACA 1E24A 5DCFA 2KRMA 1NJ1A 3FBNB 5IP7J 1OPLA 2BE9B 2HPIA 1E6GA 2MWOA 1MBGA 5E1XA 5E8IA 1HSTA 2JOYA 1M30A 3FK6A 4Z89A 1BOBA 3VS3A 3L4GB 5LHHA 1HKQA 3Q0WA 1IGNA 1QWFA 3BE3A 2XRLA 3I71A 4IUPA 5CKDA 2ISZA 5ILVA 1VQZA 1VQ5I 3EG9A 3GF5A 2VL8A 1FIPA 4AC0A 1PUFA 2WTEA 3IRQA 2Z1DA 4JDSA 3ZFJA 2KFDA 1QVUA 3ASOH 3P8YA 2KIFA 2VKDA 4XR6A 2VKNA 1PD1A 4TQDA 4PFPA 4PJOB 4I02A 3WU0A 3JRGA 2CP6A 2D1VA 1FBUA 5B3SH 2MMPA 3UPUA 1ETVA 3M4GA 2W84A 4M77B 2ISYA 3UR3C 1QLYA 2VWFA 2IA2A 1VQLT 2HXIA 1XCVA 3GFLA 1JXSA 1ZN2A 4QVDA 1Q7YU 2ZKZA 5A0GA 2Y2ZA 1R22A 3CJRB 2DOAA 2XKOC 1GXIE 1JJ2P 4YCWA 2DDBA 2FOWA 2X9HA 3SFZA 3KBGA 2FRWA 1QP2A 1NBEB 4YFNF 4J9HA 4GLMA 2CREA 5EZHA 4PJNA 4ELZC 1QPMA 4EVIA 4A3CJ 3EUAA 3MEUA 2LG4A 1SAXA 4FYWB 4JJNK 1VQOQ 1FSHA 2FVUA 4HAMA 2LQKA 3QODA 3MEVA 1K61A 1ZHIA 4J6YA 3QYHB 4MFEA 1TC3C 1O7LA 4XLAA 5EYRA 3BR1A 3CCQA 1M90U 4MFDA 4KICA 2CH4W 1Q95G 2VKHA 2E1CA 3EGUA 1G5HA 2EK5A 2LTPA 3DKYA 3CC4A 2L4MA 3OMCA 2VT3A 3REBB 3IH4A 3BG6A 4LMYA 3OYDA 5LD2C 2QHVA 1B8AA 2KAFA 2ZZFA 4U0YA 1ACMB 1YJWA 1VQ6Q 3IWZA 3OL4A 4Y52J 3Q9SA 4LNPA 3U23A 2W4SA 5KNLA 2PFBA 4C2UA 4JQFA 1ETWA 2FPDA 2DA6A 4OMLA 1VQ5Q 4CH6A 2E7WA 1E1TA 5KAFC 3PZCA 2XAUA 4UP8A 3HHTB 1X1DA 2AT1B 1RI7A 2OC6A 1JI8A 4RTTA 3KP5A 3KP2A 5EGOA 3RF1A 1U0JA 1FOXA 1X6OA 5HVQC 3CCEI 2VT2A 4JLIA 1JBMA 1F1ZA 2GFAA 1S8NA 2FUG2 5HS9A 3V8LA 4YCUA 4EMKA 4RGXA 3RKYA 2Y0MA 1M3AA 2F5EA 3MD2A 4AT1B 3GTQJ 3F22A 4CUGA 2P7CB 1VQPI 2EYYA 1Z9ZA 2L0AA 3CQTA 1MJBA 3TUPA 4UV8A 4K2EA 5GMKm 1G3TA 2K6DA 1RR8C 3J7AY 1TWGJ 3GVAA 4C0GA 2JXBA 2X1DA 4RQFA 4M75D 2ROLA 4FM4B 5GJVB 1YJNQ 3K1NA 1GBRA 4ZZDA 4FL6A 2GGRA 4M78F 3OW2S 3VSKA 3LSRA 3CMYA 4UY8I 4IL6C 1H4SA 1WXBA 2QQ9A 3CCSA 2XIGA 3I54A 2ETHA 3JRFA 3UWNA 4K88A 4YRFA 1VQ9A 1J0RA 1FNNA 4W97A 3FJ5A 4U7DA 3L2RA 3SZTA 4RTVA 2HEQA 1TL8A 1SFOJ 2RNAA 1VQKT 2X35A 1X6BA 3A0BC 2JZYA 3F8FA 3VQXA 3VS2A 1S9HA 3IKMB 2J05A 2K4BA 1YITA 4CICA 1VIFA 4KNYA 4EM0B 2EIFA 5HDKA 3RYPA 4O6JA 1YFHA 4WF2A 2E71A 4MGRA 4ZH4F 2LYCA 5GPAA 4BEHB 3OS2A 4FTHA 1QCNA 3HPWA 3NTIA 2H6BA 4KH1B 2VKVA 5GAN8 1W5SA 1X3UA 1W1FA 2AHQA 3A5ZA 5LGTA 5KYYA 5EEGA 3UT1A 3I56Q 1V3FA 1XDSA 4WJ3M 4B1RA 1ZUYA 3JCMg 4AIJA 2EA2A 2FZGB 4MNUA 1R5GA 1B34A 2LFBA 2CV2A 2YUPA 1PYSB 1XMKA 3WHCA 4XIDA 2ELJA 4XK8E 1FMKA 4Z8AA 4YRLA 2FPEA 4M74A 2FHDA 3JAME 5KCMA 4E7HA 4M6YA 2OD5A 1H88C 4DBQA 2Q5IA 3KFUA 5DV5A 1Y56A 1T08B 2DA1A 3TKYA 2O4XB 2FOKA 1KA8A 4XTUA 2J6FA 3QHSA 4AFSC 1Q82U 2Z9OA 5CKTA 1IO6A 2M45A 1ZR2A 4V2GA 4YIFA 3OYHA 1Z7UA 4A12A 2KRFA 2QSGX 3PNWC 3CCUQ 5HODA 1TWHJ 2DPUA 4YFXF 1RUNA 2HKOA 3M0QA 2P4WA 1K83J 2K3PA 2NAZA 1RL2A 1JT0A 2IPOB 2YRCA 3NARA 2PVOB 2MLGA 3OIPA 1EV7A 4DW6A 2XK0A 3JB9J 2HOSA 1VQ6A 1K8AC 3MKZA 4LK0F 4LXCA 2KXCA 5IN1A 3AG4H 4A0YA 4WTOB 5KYUB 1LQ1A 2ZB9A 3AFHA 1PSFA 3CD6Q 2MC4A 2CW8A 2R92J 4XU2A 1I3QJ 1QO0D 2DJNA 3W6JB 1TP4A 5IOZA 4IIMA 2JN0A 3PMIA 4J9GA 1U6GA 1OMIA 2YUNA 3CC2I 3AG2H 1QWEA 1TWBA 2ATCB 3M8FA 3I55Q 1AA7A 2A3LA 4JJBA 3CC7A 3HXXA 1IZ1A 3VYSB 4G7HF 3S3NA 1YHQI 1FYKA 2DMNA 1FP2A 1ODDA 3FXLA 4XK4A 5GTHC 1LPQA 1F5TA 4KR3A 2AO9A 2PMUA 2XD0A 4NQWA 5LL6S 5LGUA 2EPFA 1B59A 2PG4A 3HB9A 2RO0A 2YPRA 2EBPA 2R5YA 4OF1A 2FQ4A 4B4CA 1GXQA 4CYCB 4Z88A 3WG7H 2W00A 1H92A 3BPVA 5KAIC 4CS2A 2DAOA 3G3ZA 4A6EA 4ZYDA 1V4RA 2HKQB 5B1BH 2RVCA 1STZA 3TEHB 1KQ2A 3M54A 5FKNA 2DEQA 4ZJZA 1ON2A 3AL0C 1O3QA 3P9KA 3I53A 4ZDPA 5GPCA 2ECBA 1CGPA 4EMHA 3P9IA 4CCJA 2X3WD 3JSCA 5CR2A 1R7JA 2CQNA 2JMAA 4IIOA 2LF7A 5KCHA 2CJAA 4GRIA 1V55H 3TOAA 3KFVA 1QZEA 5EDNA 4IF4A 2HBPA 2OTLI 1DJ7B 1EH7A 3H8ZA 2HR3A 1W4SA 1D8JA 3EETA 1W7PA 4OIPF 2G3RA 5CVUA 3CCQQ 4OB0B 1ZA2B 2H09A 1D0ZA 2MW8A 3JRAA 4CCNA 1NYRA 4NCXA 4IHWA 2RN7A 2OQGA 2WSEE 2BW3B 1UHSA 3GFIA 4M78D 1Z6RA 3L2WA 1WHKA 2YRDA 4L87A 4UUSA 4UVCA 2ROTA 4UC4A 2VE8A 1VQ7T 3CC2Q 1X6GA 5AT1B 5C52B 4XKVA 2WC2A 2QTXA 4NHJA 2R5ZB 5DD4A 4JUVA 5M5XJ 3JREA 3MKWB 1R8OB 2RKHA 1U8BA 2QGGA 1NTCA 1R4MB 3G1JA 5J8CA 4M7AG 5KK1A 4A69C 2V9PA 1MGTA 3P7NA 2ALYB 2ZXWH 1I81A 1SERA 4M77D 1K6YA 3TGNA 2M1BA 2LKPA 3E3VA 3U1KA 4JS5A 2LOOA 3L00A 1SFUA 1I5ZA 2QHTA 2L5QA 1K73U 2GIZA 4P9FA 2F1LA 4L59A 1JJ8C 3EGDA 3GF2A 1GHCA 2DTRA 1SRLA 2AZVA 1T39A 1U8RA 2YSQA 1KSWA 3LA3A 3F6OA 5IP6A 2GLOA 4M77C 2V26A 1MH4A 4N4NB 2KGTA 3L2ZA 3OW2A 5GANj 1YW8A 2BGCA 3MZ8A 1Y8QB 5FRNA 4J9DA 5DCMA 3KP3A 4X9CA 4Q48A 3QAHA 4WXHA 1BI0A 2VGMA 2XHCA 2KRHA 3PVLA 1KQSA 1G51A 1K73C 4Q5SF 1NPPA 1FYFA 3K70D 2CW7A 5M5YJ 3E9GA 3VS6A 1C0AA 3HPHA 2K40A 4BQQA 3Q0UA 1KHCA 3LYIA 3EDPA 2P0KA 3M0UA 3CCJA 5GAOl 4E51A 2X1EA 3WTUC 1G83A 2CS3A 2A7YA 2DYSH 3WGGA 3CCSQ 1A36A 4DYRA 2Y9ZA 1RAIB 5TRDA 1LDKB 1TNSA 4MDXA 1SD5A 1V1CA 2RI5A 3NWTA 2LD5A 1AZGB 3EFRA 5J40A 2V1UA 3FHZA 2E3CA 1KC8R 1PP7U 2IA1A 3M9AA 3G1LA 5FLVA 5GMKe 3J7AO 3R6SA 1G5VA 1FPQA 3LSIA 4PLLA 1VQ4A 1KD1R 3CCET 4EGZA 2EIJH 2XB5A 2WY8Q 1LNXA 2GQVA 3K4JA 3HOWJ 2DMTA 2JT1A 3OIQA 1G4DA 2E2JJ 1YJ9A 5GAN4 1HXDA 3M3YJ 3BDDA 4XMYA 1UG0A 1S1NA 4G8XA 4JRPA 4KIFA 3C3WA 5GP9A 1Q82R 1XMXA 3QOEA 2NUTB 1I1SA 1K9MC 1H4TA 1NJ5A 3BY6A 3SYTA 4HCZA 3CZ6A 4E6KG 4XTXA 2BY1A 3BDUA 4X5OA 4ZN3A 1MBKA 4LLLA 1M9SA 4KH0B 3L42A 4B44A 4PCQA 4B6MA 3UNGC 2ZFUA 1APLC 3QDRB 3VS4A 1NG7A 3HTUA 1SD7A 1X1AA 2K86A 4M75F 1OYIA 2COMA 2EQRA 3BJOA 3B02A 1TZLA 4PSXA 5B5EC 3OSGA 1ZG5A 2FZKB 2M9UA 1SSHA 3P9CA 2F6CA 3OIOA 2F5CA 2YUSA 2QYOA 1RADB 2ICWG 1ZGWA 3CMEI 3SD4A 2Q7HA 3CC2A 3L4GA 2QM3A 4ENJA 4LDUA 3KIOA 1QPIA 2FBHA 2DJZA 3VOEA 5JHUA 1B07A 4RCBA 4NL2A 2AS5F 2F2WA 1ZBJA 3CCLQ 4F7ZA 5E3MA 3I55T 3O2PE 2QASA 2VOOA 2JPBA 3PCOB 2STTA 2JA6J 5C4JJ 2DF6A 1Y1WJ 3F0CA 3CMAT 2EJFA 5CCAA 5I11A 5DLOA 4L5EA 3FXJA 4J9IA 2OX7A 2QEXQ 1F1BB 4LDYA 3G73A 3EFOA 2ZPIB 3BTIA 1M27C 2J06A 5E3LA 1JU5C 4QQDA 4C92D 3IKLA 1WQWA 1VQLA 3W6VA 3OMYA 3REOA 3CC7Q 2PLYA 1V54H 3F8MA 1IV6A 3UF4A 4XKWA 2EPDA 2HBWA 4J5YA 2ZFWA 4PJOD 4LIUA 3FM3A 2ZTGA 3SWNB 4BH9A 1FTTA 2YXYA 1CF7B 3BG5A 1D5VA 1X58A 5K7ZA 1IGUA 4BBRJ 2IG0A 4D7NA 1GV2A 2QHSA 3HFZB 5LBQA 1R0CB 2EYZA 2HCKA 2DETA 3OYJA 3A03A 2MOXA 5FGMA 2LP0A 1SC7A 1B72B 2LNVA 3CCRT 2I4LA 4XONA 2LREA 2EB7A 3CJQB 4WCGA 3ZQLA 3AL0B 3KZYA 3WTVC 1PG5B 2EFIA 2RH2A 3JB9H 4A0XA 1SFKA 1UB4A 4F93B 2RHUA 1DGRM 4ETSA 1K78B 2XF6A 4PHCA 5E3IA 5GJWB 2XKOA 1D1BA 2ZAEA 2F4OB 2KJCA 1AT1B 3E6CC 2VQCA 1OJLA 3A8LB 4M75A 4BQOA 4DZJA 2E2IJ 4FT4A 4ZNXA 3OY9A 4LDVA 2YUOA 1W66A 2GBQA 2O03A 1PSEA 5ICEA 4XRSG 4E47A 3D7SB 2L9NA 1UHCA 3VS5A 4I7HA 1TQMA 2GCXA 3LQRA 2V4JC 5IYBJ 2HL5C 5J6XA 1E3OC 2LRQA 4D8KA 1FWZA 2AMCB 4XEOA 2QQBA 1SSFA 3R0AA 5D6FA 5LLQA 1VQNT 3E9HA 1XN7A 2KIQA 5CK9A 4U88A 2ENMA 3NTHA 3VQWA 1PWTA 1YJ9Q 2DRKA 1MD0A 1GUUA 5K5RA 3WHBA 2ZXFA 3C1DA 4KIGA 4NB5A 2XVCA 3GLXA 1JEGA 1R49A 2DU5A 4A3GJ 3SWNA 3G6EA 3F8BA 3BJUA 4QSHA 2IGNA 3HL2A 2QUFA 3IAS2 2VKEA 1XNIA 1LB2A 4KDPA 2CP0A 2A37A 2E1HA 2EQUA 2R7DA 4F3QA 3N05A 1HW5A 1OLTA 2ID6A 3HYIA 3A1YA 4CH7A 2BUDA 2E64A 4EV0A 4FYYB 2XGCA 2KI7A 3CC4T 2OCCH 4CDGA 3X26B 3CBOA 1RAHB 1MGQA 2OAUA 2RJFA 4XTWA 4BB7A 3X25B 1SETA 5FRMA 3CEYA 5DUIA 2X4WA 1VQ8T 4IHYA 2NLUA 3PUBA 1HJDA 5GANd 5L3GA 4BJ5C 1K8AR 2ZT5A 4GXOA 1WPKA 3JRIA 1JJCB 1X56A 1Y57A 2BV6A 2A28A 2BOLA 1VQ6T 4JLGA 2ODRD 5E17F 2FBIA 2MSYA 2A6EF 1Z9CA 3CCLT 1MBEA 3VJPA 3DU5A 4GY5A 1JJ2A 3UH0A 3U9GA 2Y4XA 1O4XA 3QO7A 3M4OJ 2HZYA 4BXFA 2MLKA 1R71A 1BU1A 1AHDP 1NM7A 1S72T 2P7VB 1LDDA 2M87A 4EGYA 2QQ8A 5GAEJ 4FASD 1XX5A 1ZGAA 3AG3H 5J4VA 5IAYA 5LJ5f 3VQYA 1TNTA 2RK1A 3BFMA 1WWXA 5KYWA 3H0IA 2M4KA 1K4US 1ZR4A 2VC8A 1I5OB 2JS0A 3MMYB 2RJEA 1A6IA 4M7DB 1LNWA 3DEUA 3TMOA 4BNCA 4BI8B 2LNBA 5D6EA 4FX4A 1CQTA 3NHNA 3BTLA 4Y92A 1RESA 2JMWA 1KIKA 4DZPA 1WQ7A 4PLIA 2H8RA 1OCCH 1RABB 3H3ZA 2WWYA 3O5ZA 5AIPA 3DTIA 4P72A 3I55A 2GM4A 3RR6A 4YRMA 4NC8A 2MWPA 4AUXA 1R1TA 1PYSA 2ZZGA 2MF2A 3O6BB 4CC2A 3O8GA 4ZIBA 3M0RA 4OIOF 4AVPA 3M4QA 2HAXA 3F8CA 2XICA 4LUDA 2XC7A 1ZLKA 2DVJA 4D6WA 2LRDA 5JFRA 2JN6A 3EG2A 1K9AA 2CGPA 1U5SA 5C53B 5JR3A 4J9EA 3MF2A 3X20B 2DFEA 4M3BA 1ETKA 3HTZA 1SHFA 3GBGA 4D0PA 1HSQA 3WTXC 3HG9A 1XSXA 3N5BB 2DL5A 4R55A 4HT8A 2RQPA 3MQZA 1F36A 1HDDC 3LLRA 1NJIU 2GQQA 4M7AB 4P96A 5HY6A 3GX4X 5KYWB 3I56A 3FISA 3DP7A 2J3MA 2ZJRF 4X0GA 2GAUA 3K6GA 5D5XB 1RAFB 2F5KA 2F5VA 4YRSA 2M34A 2ME0A 3OYCA 4H4KC 1UGQB 3DXJF 3E7LA 1QQIA 2E34A 1IN7A 2XDDA 4YYEA 4DGWB 3LA2A 1I50J 3CUOA 3FKJA 2M02A 4J83A 2KDSA 3JCMX 3A74A 3IRRA 2XAQA 1H4VB 2KZGA 3BDLA 1W2BA 2CZ6B 2JMCA 2FXAA 1Q7YR 2XROA 3L2VA 3WODF 4HZFA 3QO8A 4WI1A 2XDPA 3QSUA 1QHHD 4UB8C 5F0CA 4JX6A 5HOOA 2E5AA 1NLOC 4RMOA 3P8VA 1VYVA 3C94A 3EUHA 4DOVA 1VQMA 1WIEA 3H41A 1D0XA 3H36A 1ZYRF 4C8QB 4V19K 4HT9A 2AKWB 5L3DA 5F04A 1OU8A 2DILA 2YT6A 1R5HA 2M0OA 4IUQA 2MPXC 3WXMB 5D8KB 2QSHX 4L0ZB 3TSWA 3VPRA 1QGPA 2HSPA 2XGXA 4PGGA 2FJ1A 1MZBA 3EPZA 2P5IA 5ELNA 3SFIA 4EO4A 5HGQA 2ARTA 4G9YA 4BUGA 3RI4A 1T33A 1LFPA 4DBRA 2LTOA 2RD1A 2A07F 1T3LA 1JKPC 2EGEA 4II3A 4Z2YA 1J09A 4BY6C 2AIRB 2I4OA 1ON1A 2DXUA 2QTVA 3C7JA 1S5LC 1V5FA 3FK7A 3R60A 3FJPA 4OMPA 1ZG1A 3GPLA 2L2OA 1Y39A 3S3OA 1VQPQ 2CH0A 1WGSA 3M57A 4H2XB 2JT4A 4KT0E