3V8KA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with biotin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
total genus 93
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8kA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8kA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8kA02
2TDXA 4E70A 1FY7A 4A54A 4RAZA 5F5WA 2OZUA 2E1HA 1RNLA 4K86A 1ZRDA 2IVMA 2OD5A 2V9VA 1IXRC 4U7BA 1SESA 2QM3A 3FHZA 2NNYA 1DPUA 3QNEA 2K02A 1BIBA 3K1PA 4TV7A 3HXWA 4P72C 4EMSA 3T1BA 2Q5IA 2I4NA 2PBIA 2XIGA 1L3LA 2CFXA 2YU3A 1R1VA 5DEQA 3RPQA 3F8NA 4M77E 5DDGA 3QO7A 3NETA 2ZT7A 1G51A 1JHHA 2ETHA 1HW5A 4M72A 5IT3A 4RAYA 1B7YA 2XVCA 4L9JA 4WJ4A 5GMKj 5E3IA 3E5QA 4M77A 3VOEA 3MZHA 4Y13A 5F6FA 3M7GA 2YX7A 2Y90A 2ALYB 1NJ8A 1EVKA 3U1DA 3GIBA 1USSA 2FBIA 4UV8A 2XGXA 4H2SA 1J5WA 1WQ7A 3B73A 3HSEA 2O3FA 2A68F 2VC1A 4HT9A 4PJOC 5IT9K 3CMQA 1S29A 2AMCB 1EH6A 3GO5A 1LDDA 1REPC 2ZMEB 3WGHA 4M7DE 2DKGA 5DV5A 2ZNIA 2MLKA 2DZ9A 1TTYA 5E8IA 1OPCA 1J0RA 4PDKA 3JW4A 5GAMh 3F6VA 4YRMA 1EIYB 1O3RA 2Q7GA 3RKYA 2DU5A 2ESNA 4RCCA 4M7DA 3ZN1A 1SERA 1FNNA 3VFZA 4XU2A 3UGTA 1B76A 2ZR3A 3I53A 2QHSA 4RS8A 4HQMA 4IRGA 5IT9Z 4EMKB 4EVIA 3RTRA 3TDZC 3DV8A 2Q2EA 1SFXA 5K5OA 3E6MA 4B8XA 4RDXA 1IN4A 2XASA 3HHHA 1XDSA 3WGGA 2QHTA 3J7AO 3JB9I 3GEZA 2CG4A 4XQ3A 4G9YA 2KIMA 2VE9A 4P96A 4M6YA 2AMCA 4BWAA 5LJ3g 4KMFA 2XV4S 2H27A 3GXOA 5H6QA 4N0AC 5DCMA 1IN6A 2R7DA 2ZNZA 2E41A 3QO3A 3JB9J 1XD7A 5GANg 1MDMB 1D5VA 2ZIOA 2UXNA 4BNCA 4YCWA 4MNUA 4XLPF 2ZGWA 4M78B 3JCMc 4H2WA 2XHKA 2CGHA 3FMQA 3WTUC 1QF6A 1ONVA 2F5DA 4EMKA 3MFKA 3SQNA 4P73C 4HWOA 1JGSA 1KOGA 3KP2A 5EEHA 3QSUA 1EH8A 4I0BA 4XEOA 1D8KA 3M4PA 1EH7A 5LJ3j 4UXNA 4X9CA 2MD5A 4NHJA 1GVJA 4HV6A 1H9GA 3M9AA 5ERIA 4Q6GA 5GANj 2WWYA 2I4MA 4M78G 1FP2A 3DPLC 4LG0B 3RERA 1D8JA 3LA2A 1XDUA 2V1XA 5EEGA 5J8CA 4CXFA 1L0WA 1Y96A 2OBPA 4JQFA 1MDMA 2E7XA 4HF2A 4ZZDA 1O3QA 3CO7C 3Q9SA 3L2CA 4CS2A 2O61A 4G94A 2E5AA 5ICCA 5LBQA 4RB3C 1LDJA 4Q5SF 4KYWA 3K69A 3L09A 3A5YA 1B9MA 1LJ9A 1UHWA 4C8QB 3C18A 2XKPA 5E1WA 3CUQC 1X54A 3JSOA 4YIFA 4U0YA 5L3GA 3SZTA 4PJOF 4M77D 1IAWA 4GGGA 3JCMf 1ZG5A 1HSTA 4A53A 4OP0A 2HDCA 3LA7A 4M75B 4HX7A 4OMYA 1GHCA 4UVCA 2UWMA 3MEYA 2PMEA 3GX4X 2ZZEA 1FZPB 3MEXA 1IRGA 1GXPA 3VEPA 4R79A 1B34A 4PGGA 3LC0A 3L2ZA 4QLCU 3OV8A 4I02A 3ZMVA 1T6SA 4C8QG 3FWEA 3MCZA 4HWTA 5LJ3f 3RESA 3I59A 3TDUC 1ZH5A 2A5YB 2E64A 3ISPA 4G84A 4OMZA 5LRRA 3QPTA 2VONA 2HWVA 1WYDA 5GANf 4HBLA 4KFCA 3KP3A 5DD4A 5FGMA 4H2YA 2F5CA 4M7DD 4M6XA 2DJZA 2DQ3A 4M75G 2I2LA 1NYQA 2RGVA 3KLNA 2DAOA 4S05A 3V7RA 4K87A 3HSFA 2PI0A 4WI1A 3QU6A 2PG4A 5AIPA 2DPDA 3HSRA 1P4WA 4LFUA 1LOJA 1C0WA 5D4SA 4RMFA 1LDKB 5FD5A 1AOYA 5GAMg 3H3UA 1XSXA 3M4QA 3DPTA 4J6XA 4J15A 4RCBA 1KQ8A 1USYA 1NJ6A 3SWNA 4YCVA 2P5IA 4A0ZA 1GXQA 1USYC 1U5TB 2ZCWA 2YPRA 1XSVA 3JCMb 5A2QK 4YDQA 3EYYA 5F1RA 2D1HA 3WTTC 3AAFA 2VC8A 4HF1A 3DSQA 5FFZA 4BHBA 3O2PE 3I5UA 3PFIA 1MKMA 1KQ9A 2JT1A 3SXYA 4LD5A 4ETSA 3F23A 1DPRA 2RN7A 2RQPA 4L0ZB 1W7PD 4IXAA 5D8LB 3FMSA 3P7NA 1RIOH 1XCVA 4M74A 5GAN3 1ZHFA 4M71A 1ZRCA 3HFOA 1KU7A 3BDDA 1F1ZA 2P5LC 3QUIA 2M5WA 5JVTA 1ASYA 1KQ2A 1H0MA 1R5HA 3INZA 5GAMj 4H2XA 5A2QZ 1JBMA 5LJ5h 4LNSA 2BE5F 2DBBA 4EX5A 3VB2A 1SD5A 2O6GE 4PNOA 1HSJA 1DUXC 4ZYHA 4MHGA 4XBFA 3JB9H 4H2TA 2J5OA 3RYPA 2LNBA 3F3XA 4XRFA 1HKTA 3HRMA 1QPMA 1G5IA 5K1XA 3T5XA 3WTWC 3JCMX 1YQAA 3BOQA 5D4RA 2KIFA 4EJTA 1X2GA 2ESHA 3NQOA 2P4WA 4ZTZB 4A5NA 5HS8A 2RKHA 2COMA 2QHVA 5GAN5 4O3MA 1TNTA 3FMRA 1G3SA 2BV6A 4CDGA 4N9HA 1W5TA 2Y75A 1R00A 3P9KA 4P74C 2Q7EA 1FOKA 3G73A 3L9FA 1V4RA 2Q0OA 1N9RA 1WPYA 1Z05A 3BY6A 2DXUA 1WI9A 3HFVA 4P9FA 4C92C 3TEHA 3GFMA 1R1TA 4RGUA 4RB2C 4ZTUB 3EQLF 1NJ1A 3P8YA 4NCXA 1XGOA 4YRTA 1I1GA 3E9IA 4ZH4F 3JAMK 3F21A 4F7UB 4HWSA 4AIJA 5K5RA 3I7FA 2Z99A 3HTZA 1Y0UA 3TGNA 3HTSB 1S7AA 3W6KB 4BXUA 1XCBA 4YRIA 2JRTA 3ERED 5TJJA 4YRKA 4RB1A 5GAMf 3BPVA 1T39A 3IKMB 1XGMA 1FP1D 4KR3A 3E6DA 3RPUA 3JCMh 1HC7A 3IHUA 2HS5A 1PP7U 3BJUA 5GAN2 3Q9VA 1X2HA 4P71C 2EV0A 4M7AG 2XAFA 3UFGA 2DVEA 2ZFWA 1DDNA 3CDHA 3IWFA 2LSOA 4YRCA 1R36A 3WODF 4G7OF 4F7UG 3HFNA 1PDNC 1K78B 3PQJA 1JXSA 2P5VA 1ZG1A 4O2DA 2H6BA 2OAZA 1IRFA 4M73A 1IN5A 2P6TA 1JE8A 4EJUA 4EM0B 3C3WA 1G5HA 3E5XA 3JTGA 3HFZA 1Z91A 5TRDA 2DK5A 3GZ5A 2DDZA 3NEUA 4IPAA 4OLFA 3A31A 1Z6TA 3HOTA 1O7LA 2QTXA 2BYVE 5CVVA 5ELNA 3FXUA 3NRVA 1SD4A 2DZCA 1HW1A 1O7FA 4M9XA 4UV9A 4WK8F 4YRQA 3DFGA 5CVIA 5LGUA 1T38A 4G7ZF 2ZCEA 4BHPA 2FE3A 1SD6A 3DXJF 4IRHA 2ODRC 1S8NA 5DUIA 4RGSA 3ICAA 1IW7F 1RZ4A 3ECHA 3UGQA 4OINF 4QVDA 4Y17A 1F5TA 1B7YB 3HRKA 4PHCA 1I5ZA 4HDVA 4FX4A 1I27A 4HAMA 4Q15A 2PEXA 3PGGA 4M77B 3HRTA 2VT3A 2RDPA 5LLQA 3FXQA 2IA2A 1IF1A 4XTYA 3L7WA 4YRLA 3BPXA 3K0LA 2A61A 3I54A 3EYIA 5CAIA 4P72A 2HNIA 4OIQF 2F2EA 3I0TA 3V4GA 4P3NA 1H4QA 2NRAC 4YFXF 3ZN0A 4BH9A 4BHCA 4CHUA 3A5ZA 5LJ5g 4EV0A 2GWRA 2VBWA 3E3VA 2VXFA 1YW8A 5LHHA 4M77G 4C92F 2FBHA 3ELKA 2ZJ2A 2D45A 3B02A 2ISYA 2VE8A 4CICA 4M7DB 4B09A 4PGHA 1XB4A 2QQAA 1FC3A 4XEMA 4KNYA 1X01A 4PJOE 4KIBA 2PMHA 4IHTA 4YFNF 1ZAOA 2PMFA 4HYEA 1YW7A 2XAJA 4LK1F 1SAXA 1I4K1 2YR2A 1UCRA 1K79A 1QZYA 1BC8C 4XTUA 4NOYA 3TKYA 1QGPA 4Q48A 4PJOA 4MGRA 4HWPA 3N4MA 3TQNA 5LJ5j 3GLXA 5D8KB 4TVYA 2IA0A 1UB9A 4M7DG 4HOBA 5DCMB 1O57A 2O8XA 3L1AA 2C6YA 1EFWA 2FMYA 2YLBA 1LJOA 2Z3YA 1U78A 5ILVA 3K2ZA 3HY0A 3DEUA 3CUOA 2ZBKA 2EA4A 4P5OA 4GYGA 2MLGA 3BJ6A 2O03A 4A5MA 2X0LA 4U0VA 3KETA 5CVUA 4H2VA 3VBBA 2IT0A 4J6YA 2H09A 2VXZA 3JCMg 4AIHA 3KEOA 5CVRA 3TO6A 3WGIA 2CQKA 3RI4A 1LB2A 3KCCA 3BJAA 3J80K 2V79A 5ICGA 3OOPA 3F22A 3FJPA 2RB6A 4WXCA 3JB9G 3QO5A 3COAC 3V8LA 1Q1HA 1PP8F 2L54A 1NNHA 4KA4A 5FD6A 4A12A 4XU3A 4N0AA 3U2RA 4P3PA 3V8JA 1J7KA 4UVBA 2K27A 1UHMA 3IC7A 5K1YA 3KZZA 4AD9A 1CF7A 4IHSA 1D3YA 5C52B 3KP6A 3JTHA 1Y96B 5H6RA 2CSOA 1HXDA 1MJBA 1W7PA 2P7VB 3QOPA 2AS5F 1V3FA 3CTAA 1EV7A 2P0LA 3J80Z 1WLEA 5LJ5f 1YFTA 3ZMTA 1OMIA 1BOAA 4P73A 1Z7UA 4ZYDA 1FYFA 3NEMA 1B70A 3ZP5A 2VOPA 3P8VA 2STWA 4L18B 1B9NA 3I71A 2HR3A 2EV5A 5D5WB 5GAN8 3SHFA 1FBSA 4I98B 1ZGJA 1RIQA 2MC3A 4UVAA 4JK1X 4HT8A 3E6CC 2O0YA 1F4KA 3FF5A 3AHUA 4YRJA 2IY5A 2CJAA 3RACA 1I5LA 4KIFA 1M8VA 2PFBA 3EETA 1R22A 2Q8KA 3WU0A 3KLOA 3QAHA 1WU7A 3VQWA 2K7LA 1B34B 3H3ZA 2JPBA 4XTVA 2AKWA 5GAOp 4EMHA 5E8GA 4A0YA 3E97A 3IKTA 4JBAA 2M87A 3I59B 5CYVA 1BI2A 2HTJA 2HQRA 2VBZA 3QHSA 5AIQA 2DU7A 4R1HA 4H02A 3F6OA 4D0PA 5L3BA 1WWXA 2C7IA 3CUQA 1FBUA 4WXHA 4IF4A 3V8KA 5D5XB 1U1TA 4L9VA 4XTZA 1YS6A 4XU1A 5DYMA 2YX4A 2GXGA 3TO7A 5GMKe 2MA3A 1RUNA 4JUVA 4M78C 5HLGA 2ZT8A 2CO5A 2K4BA 3WTVC 3R4KA 1E24A 1OR7A 2YSRA 3LA3A 5LGNA 1G6NA 1WRJA 4PJOD 3FX3A 3SWNB 2IW5A 3RL6A 4KUMA 4CO8A 4XTWA 4H2UA 1FLIA 4CZZA 1BBWA 4HV5A 4YIIA 5HS7A 2EV6A 2WC2A 1XSDA 2L02A 4I01A 4G6DA 5GMKi 1R58A 4HF0A 3TUPA 3PCOA 3WTSC 5K1PA 2HOEA 3QU3A 3K1NA 3FM5A 3P9CA 3P9IA 3KFWX 3JCMJ 1KU2A 2ISZA 4TQDA 1P2FA 2KRFA 5E17F 2IPQX 5BQTA 4ESJA 5DD8A 3HTUA 5DY9A 2LF8A 2XKOA 4H2XB 1S6LA 2FSWA 3H92A 2VC0A 3WQZA 1MZBA 4Z2YA 3GWZA 5CJ9A 2K86A 4L9NA 2DLLA 2RHQA 1FPQA 5GAOn 1YIOA 5D6EA 4DQ2A 4CGZA 2PJPA 4UP7A 2EA2A 2A3SA 4TVWA 2XRNA 1MGQA 4U88A 2VXEA 4Y15A 3FZVA 4G7HF 1Z7MA 3ML6A 2VOOA 4YG2F 3HYIA 4MEXF 2HTSA 1ON2A 2ZO4A 5GAOl 4PG3A 2OQGA 1Z6RA 2DW4A 4M75C 2LF7A 4JLIA 2J3LA 3FB9A 2F5FA 1Z9CA 4LB6B 1WSUA 4UP8A 1XN7A 4PCQA 1YFHA 3RJPA 1GGMA 5GAOr 4ESBA 1SETA 3TEHB 3HRIA 1J5YA 3CO6C 2RHSA 1JJCA 1W4MA 1FWZA 2G7UA 4AH6A 1JHFA 1G3WA 2I4OA 2VBXA 4HA8A 2UXXA 2DQRA 1J59A 1P4AA 1YGBA 4BQAA 1L0OC 4HVCA 3I64A 4L5IA 2JSCA 2J3MA 1YFRA 3I4PA 2OU2A 2HFHA 4N0BA 3DQVC 4X5OA 5LJ3e 1USTA 2CJBA 1H9TA 2DQ0A 4C92E 2QZ8A 5GANe 4I09A 4PZJA 1OYIA 5C51B 4QVCA 5AONA 3VQVA 4P74A 1STZA 3F8CA 1KQ0A 2GA1A 4J6WA 5BPDA 1U5TC 3JCMQ 4RQFA 3W3SA 1X55A 5DUKA 4M78F 4C92A 4OOIA 1MJ9A 4CH3A 4LB5A 3R60A 4N9IA 1K7AA 2HGCA 1YG2A 5LJ3d 1KQ1A 5KVRA 1YW9A 1U8RA 5L3EA 3IWZA 1ZRFA 2B0LA 2QUFA 1QQIA 1W66A 2FQ3A 5GANd 3HFZB 3REOA 2KJCA 2Q7HA 4J5YA 2OZ6A 2RV8A 3BW1A 4H0EA 1OKRA 2A6HF 3BROA 3IG2A 3DF8A 5E1ZB 3REXA 3KFUA 1TQPA 4FHTA 2XAQA 4P71A 2RA2A 1A04A 1ZN2A 2WTEA 1R5GA 1W5SA 1P92A 4I0AA 2ARTA 5HDGA 2EAYA 1Z1DA 2PN6A 3JAMZ 3E9HA 2VN2A 4LK0F 4ZYEA 2EJGA 1I81A 2KIUA 5HGQA 3DP7A 1ZYRF 1X3UA 2XGTA 3S2WA 1EVLA 1BI1A 4C8QF 2CW0F 4CH5A 1IUYA 4M7AE 3T0YA 1J75A 2ACJA 5GMKl 4YRFA 3L4GA 4CH6A 2FMLA 2NYXA 3PQKA 2A07F 4WF2A 5L3CA 3A7AA 1F9NA 2L3DA 3M8EA 4IJAA 1E17A 2GIVA 2QBYA 3JCMP 4LJZF 4GCVA 4M75F 1U6GA 4M7AC 1YTYA 2CIMA 1TW2A 1U2WA 4JRKA 2CJ9A 5BMZA 4ENJA 1TNSA 1LEBA 1TQIA 4M9ZA 1ZGAA 4K88A 1TW3A 5CVJA 2EL9A 3ERRA 2HYGD 3F72A 3K9TA 3IALA 1QE0A 1UFMA 2Z9OA 2QQ9A 3HSBA 1BJAA 1FBQA 4HX8A 3C7JA 1M5Q1 2A6EF 2DI3A 4XU0A 2J5PA 1CGPA 2EJ9A 1YYVA 4IRIA 3LAPA 3VQYA 1H4SA 3RYRA 2DQLA 5C53B 2F5EA 3VODA 1IZ1A 4EM1A 2EFWA 4NB5A 2CWEA 3IL2A 2ADUA 4WWCA 1VTNC 1G4DA 2RM4A 1TBXA 2NNNA 4PJOB 4UHTA 1J9IA 2E65A 4P75C 2G7HA 5K5QA 3GFLA 5FO5A 5ILSA 5E20A 4A0XA 1P4XA 3ZMUA 2FNAA 4RGRA 3TO9A 3GFIA 1S3JA 5BPIA 4EM2A 4P55A 4ZZLA 4GYIA 1BN5A 5GAN6 5GAMd 3EUHA 2EFOA 3IRQA 2IJLA 4HDUA 1NJ5A 5HDNA 4PJOG 1WQWA 1HQCA 1LEAA 4C92D 4R8HA 3BY7A 4YREA 2DTRA 4KMUX 1HKQA 4MTEA 1KA8A 2QYOA 2VODA 2MBFA 2ZT6A 3HXXA 4XSXF 2YLCA 3Q5FA 5KK1A 1YO5C 3HY1A 1KYZA 2P7CB 5LEKA 4U7DA 1YCYA 3ROUA 5JI6A 3E5UA 4NL3A 1NJ2A 1MD0A 3TOBA 1BBUA 4EQQA 1IXCA 4M77C 2E7WA 4X9DA 1CF7B 4MMKA 1SD7A 2ZZFA 4CS3A 2RVCA 3UH0A 3WE2A 2KJBA 4KIGA 2BBYA 3A74A 4MTDA 4EMGA 2ZKZA 1U1SA 2V6CA 1W7PB 5E1XA 1O3TA 4HX4A 4A6DA 1E1TA 4HW0A 2YHTA 3HXVA 1SMTA 1E22A 2ELHA 3WTZA 4KN7X 4G6QA 4I7HA 1B70B 3PZCA 3MZYA 5HLIA 1QBJA 4CS4A 5HLHA 1XGSA 1ZLKA 3CJNA 1H641 4M7AF 4CYDA 3LQRA 2RD1A 4XLNF 2EB7A 4M7DC 2RNJA 5ICEA 5FLXK 4L87A 4YROA 3R61A 3W6JB 4F7UF 4BW9A 3QP5A 4Y91A 4O5VA 2IY5B 1EQRA 1HW2A 2P6SA 4ENMA 4S04A 2GA2A 2XAGA 4M7AD 2ALYA 1I6XA 4LGWA 3IRRA 2GXBA 4ZYGA 1JRIA 5GAOm 4YCUA 2E3CA 1B4AA 4P3OA 2AKWB 1S7OA 3GVAA 1I1SA 3QP6A 3QO8A 4HWRA 4KQEA 2P8TA 4XTXA 4GXOA 3FXRA 2ODRD 1T98A 4RB0A 4P9UA 2MH9A 2ZMEA 5FLXZ 5HVQC 4WCGA 3P8TA 1XGNA 1X56A 2Q5HA 1LVAA 4Q47A 4A6EA 1WKMA 2WV0A 3CUQB 5LRSA 1EIYA 2FEZA 4OIOF 4MQVA 2HYFA 4LLLA 4NQWA 4EGZA 2G4CA 1OYWA 1ODDA 4O6JA 1YFSA 1ZG3A 1Z7NA 3T8RA 1FSEA 3FIFA 4TTVA 3BZ6A 3U9GA 3QPHA 2A69F 2NS0A 2KKOA 1DP7P 2BEOA 2ARUA 4E51A 2R3SA 4EMKC 3LSTA 4TWAA 5L3DA 3WTXC 2DEQA 2W84A 1YS7A 4QWQA 4L9TA 2CGPA 3TEGA 4EJVA 2FBKA 4LMYA 1QZZA 3F8FA 5FB2A 2L4AA 5I21A 3R6SA 2DU9A 1B1BA 3PCOB 1ASZA 2FF4A 3GF2A 4FT8A 5LGTA 4IVNA 5HDKA 4ESFA 4KICA 3QTCA 4M78E 2HKXA 1HTTA 2FOKA 4YPFA 5LHGA 2HEOA 4MQ9F 2D1VA 4HLYA 2C8MA 3BWGA 3TOAA 1FYLA 2W57A 4L5JA 4OIRF 4M78A 4NL2A 3R0AA 4BYYA 2XROA 3WU1B 3O6BB 4YRNA 4TVAB 2DTIA 3T8TA 3HIFA 3FM3A 4M77F 3RGLA 4DNCA 2LDUA 3ABTA 3BJOA 3OD1A 2R7FA 2GZWA 1SFUA 2RHQB 3MQ0A 4MMLA 4V2SA 3MAJA 3SB2A 2ZZGA 1PYSB 2G9WA 4WX9A 1FYMA 1T2KA 1OYYA 5GAOq 1E2XA 4M9SA 1BM9A 5FFXA 5LJ5e 1MJAA 1G3TA 5BS6A 3HXUA 1IN7A 3RUXA 1QNTA 2ZXJA 1BIAA 5HOOA 4ZIBA 1T0FA 4LG0A 2IP2A 3KEQA 1G3YA 1BI3A 5JHUA 4UP9A 1KU3A 3GW2A 2DPUA 1K6OA 3C1DA 1NHAA 3WE3A 3WG9A 3JCMV 2K4JA 4TQFA 4M7DF 1ATIA 4C8QE 4G85A 4ENNA 5GMKm 3VQXA 2HKOA 1N9SA 4TVAA 2UZKA 2QVOA 5F64A 2EFPA 2RHSB 3ECOA 1JJCB 3K1MA 2IRFG 5LJ5d 4JRIA 1ZLJA 3ZMZA 4C8QA 2DFIA 1B59A 3GZ6A 5ED4A 6PAXA 2OQRA 5J8FA 4M75E 2MH2A 2VT2A 4C8QC 1PYSA 3RDIA 3A7UA 2FRHA 4WXDA 3BP8A 2FYKA 3EDPA 1E1OA 4U0WA 1O3SA 3LSQA 1KYWA 2EWNA 4LLNA 4M75A 2ZTGA 4MEYF 2FB7A 2X4HA 2ZT5A 2L01A 2JPCA 3ZPLA 11ASA 1EOVA 2JN0A 1LYLA 3JB9F 2BGCA 3HOSA 3SWNC 1AWCA 3EFRA 2K57A 1BBYA 3ZMSA 3SFZA 2PLYA 4ASNA 4YFKF 2DTHA 4L0YB 1HBXG 1ULYA 1FSHA 4F7ZA 4C92B 1TH7A 3GFJA 5GMKh 3JB9D 1YLFA 3LSSA 1R23A 5CLSA 4EGYA 3BDUA 5J6XA 3JCMe 5H20A 3KP4A 5E18F 1MGTA 3HXYA 4YRGA 2HQNA 2EFNA 1BI0A 4OU0A 3ULQB 2ZR2A 3RKXA 2ARSA 1LNWA 1H4TA 4AVPA 5LHIA 1SRYA 2JTVA 2Z33A 2L4MA 1U3EM 2M45A 3N97A 4EJWA 3RKWA 3NENA 3WTYC 5D5VB 1KMNA 4C92G 1SMYF 1KGSA 1ADJA 2PQ8A 2FXAA 4G8XA 4UUVA 3JCMd 4DPGA 1J2XA 1D3BB 4UNOA 2XTIA 1U5TA 4YRSA 4YYEA 5ELOA 2QENA 1NYRA 4LLGF 3J81K 4ON0A 3MWMA 3LWFA 1H4VB 3O3KA 2FNPA 1RUOA 1LNXA 3KP5A 3MF2A 2H6CA 1B6AA 3DKWA 4FX0A 3MF1A 3HXZA 2DTOA 1BC7C 5GAN7 3F8BA 3R0JA 4M78D 3L4GB 1FX7A 1RI7A 1N9WA 5L3FA 3EFSA 2OA4A 1IN8A 3M1EA 3LAJA 3A7RA 1I8FA 1HKSA 2DO7A 2EK5A 2E1NA 4CH4A 1XMKA 5D5UB 3J81Z 1R1UA 3KP7A 4M7AB 3HUGA 4RGXA 2QBYB 3JSPA 3ZMDA 3ZQ7A 4EJOA 3HHGA 3M8FA 4HLXA 3BFMA 4EO4A 2QQBA 2E1CA 5JR3A 3ABUA 3D5LA 2D2WA 4UPAA 1D3BA 2STTA 4KN4X 2XAHA 5BOXA 4RQEA 3SZPA 4HQEA 2DT5A 4GO1A 2W24A 3G3ZA 4K2EA 2E10A 2VBYA 4WJ3M 5LEJA 2QLZA 4I2OA 3KZYA 1KU9A 1ON1A 3F8MA 2XUBA 2ZIMA 2M1BA 2CYYA 2GQQA 2V1UA 2FU4A 2M30A 2PMUA 4KR2A 4AIKA 1IXSB 3REUA 3I58A 1WQ2A 3RF1A 4KT5C 1SFEA 2ZNYA 3LFKA 4F7UE 1ZARA 4AWXB 5LJ3h 3JCMW 2DK8A 2V1DA 5GAN4 3E6BA 3GUDA 2EJFA 4C8QD 1YB3A 12ASA 3V7SA 3CLOA 4M7AA 3HRUA 3M4GA 1R7JA 2EJRA 1KMMA 1B8AA 1VQZA 5GANh 5ILUA 5DCFA 4F7UA 2QWWA 3IKLA 3HRSA 2NAZA 5D6FA 1FYKA 1PUEE 2ZXFA 3IKVA 1P6RA 3L00A 3NELA 4M75D 4YRPA 2DXTA 3A32A 1HK9A 2RC4A 2FA5A 2IA1A 4ENKA 2LKPA 4KDPA 2HZTA 2ZINA 5ICFA 4YRRA 4HZFA 4A2UA 3VU3C 2ZNJA 2W25A 1IL2A 3RIRA 2JZYA 3QRFF 1QO0D 2H94A 4BAYA 3R07A 2W85A 2GAUA 4Q4ZF 2M8EA 1K78A 3V7CA 1TLHB 2Z5UA 3GYHX 2AXLA 1LQ1A 1TQMA 5KNNA 3G1ZA 2P5KA 1ADYA 2EFQA 5GAMe 3LQQA 4XSZF 2QHUA 5HS9A 4YP0A 1ZREA 4P75A 1FT9A 1XMAA 2Y0MA 2I4LA 2Y48A 3KE2A 4OIPF 3D0SA 5JFRA 1C0AA 1WNLA
chains in the Genus database with same CATH superfamily
2TDXA 4A54A 4B43A 2E1HA 1RNLA 3RQ4A 1ZRDA 1OULA 3I5RA 2CZ0B 3TVTA 1I39A 2QQRA 3FBIB 3OR1C 2JNGA 3HG9A 2CFXA 1R1VA 5DEQA 4DYCA 2PUOB 1JHHA 2ETHA 3I4NJ 5IT3A 5IH2A 4RAGA 4M77A 4PKCC 3MZHA 2F2WA 1AWXA 3JAME 4LE9A 4Y13A 2E5QA 1X27A 5KE2A 5CKFA 4IQ4A 2X6XA 4FW1A 1T0JA 4B47A 3HSEA 2O3FA 2A68F 2MGQA 3GCMA 2V6EA 2K5LA 1EH6A 3GO5A 1LDDA 3CCLQ 4M7DE 2JJ7A 3VS3A 2JTFA 5HK3A 2WACA 5E8IA 1OPCA 2R7SA 3CD6Q 4PDKA 4YRMA 2R7TA 2ECCA 2Q7GA 1H3HA 1SERA 4II1A 1T95A 2DYIA 4EMKB 3G71A 4EVIA 2BZTA 1SFXA 1WHKA 3E6MA 4RDXA 3PIPA 1XNIA 2RJCA 1XDSA 3C2GA 2QHTA 3RMQA 1VQMA 2KIMA 4P96A 2AMCA 4HG2A 2XV4S 2DVJA 5DCMA 2EZKA 2ZNZA 5HLTA 3W2VA 3JCUC 4HPQA 5J26A 4BNCA 4YCWA 3LSJA 4XLPF 4M78B 3CXCS 3JCMc 1MMGA 2BIVA 4XRMA 3WTUC 1Z9ZA 3MFKA 2KDZA 2DA2A 2B86A 1N27A 2RHUA 4XEOA 4NDLA 5LJ3j 4UXNA 2MD5A 4NHJA 3KPHA 4Z88A 3CC2I 3SFMA 1FP2A 3DPLC 3LA2A 2V1XA 5J8CA 1VQ8Q 1MDMA 4ZZDA 2IS6A 3CO7C 2RI2A 2QQ8A 4CS2A 2CZ1B 2QYZA 3O8VA 1LJ9A 3CPWS 1X54A 3JSOA 1TU0B 5L3GA 4PJOF 4HSTA 3MCAB 1VQ9T 1IAWA 2W7NA 5HK0A 2ZZEA 1FZPB 1IRGA 1E7OA 4PGGA 3LC0A 1HCRA 2MOXA 3ZMVA 2RPNA 3BT9A 1QVUA 2L3QA 1GCQA 5FLVA 4HWTA 3I59A 1G2HA 4BJTA 3REBB 1LE8A 1ZH5A 1VIEA 3ISPA 3QPTA 1WX6A 1WYDA 5GANf 4KFCA 2O5RA 5FGMA 2FRYA 4H2YA 4XIDA 1QKXA 5KYUA 1TT0A 3HOWJ 2HSEB 3V7RA 1T56A 2LJ0A 4WI1A 3QU6A 2OTLI 2TCTA 2DPDA 2V1QA 1LOJA 2XB5A 4RMFA 3NWTA 2L89A 3H3UA 2VKEA 2MF2A 2DAQA 1HDDC 4RCBA 1KQ8A 2OTLA 1USYA 4UB8C 4YCVA 3A8OB 1GXQA 1UJYA 5A2QK 3EYYA 4HF1A 2QAZA 2MWPA 3I5UA 1BB9A 1M9SA 4PL6A 2XMFA 3FMSA 3HC7A 1G5VA 3A01A 2E5ZA 5KAFC 1OCCH 1Q81C 3F0CA 5CKBA 5GAN3 4M71A 1ZRCA 1KU7A 3QUIA 3OS1A 3M58A 4LVIA 1H0MA 1R5HA 2ED1A 3INZA 2CP6A 2KGTA 5GAMj 3CQZJ 5A2QZ 1RKTA 1SD5A 3HEFA 2BVLA 2O6GE 4CC7A 4ZYHA 4A3LJ 1ZA1B 2F5VA 5JLXA 2DA4A 1QPMA 5M5WJ 4Y28E 2F5TX 3WTWC 2IPOB 3ABLH 5D4RA 2P4WA 2Y0SA 4BEHA 5HS8A 1C6VX 1VQOT 1G3SA 2BV6A 4JP0A 1GFCA 4N9HA 1R00A 3VRZA 2K6DA 1TWHJ 1FOKA 3L9FA 2Q0OA 1WPYA 3BY6A 1WI9A 4C92C 2KAFA 2PUKB 3TEHA 1HD3A 3GFMA 1R1TA 4RGUA 3I5SA 1JJ8C 1M3AA 2L5QA 4NCXA 4DYRA 3E9IA 2L2PA 2A05A 2V8IA 4HXJA 4N4GA 3M07A 4ZYAA 2HDAA 4F3QA 1SHGA 3ERED 4YRKA 1T39A 2HVQA 3IKMB 4C5HA 2MFZA 3E6DA 3QXEB 2BUDA 1E6GA 4PSXA 4JX4A 3BJUA 3H9GA 3PT9A 4M7AG 4YRVA 3SDGA 4II3A 3G4SI 2DJQA 3WODF 4AM3A 4F7UG 4Z6YA 1ZA2B 2DMQA 4O2DA 2X48A 3EG0A 4F93B 3TCJA 4E2FB 4EJUA 3AG3H 3C3WA 4AT1B 4LVKA 1ZK8A 3E5XA 3CC4I 4F92B 3HFZA 2DK5A 2BW3B 3GZ5A 2DDZA 4OLFA 3A31A 4KISA 1MUZA 1EJ9A 3JREA 3CC4A 3HGYA 4WTOB 1ZSGA 4B3AA 1LCKA 5H2FC 1HW1A 3M0QA 4ZGDB 4FETA 4YRQA 1OJLA 1T38A 4G7ZF 2V1RA 2ZCEA 2JMWA 4IRHA 4B1RA 3K4CA 1RZ4A 3UGQA 1Q7YR 4OINF 3OSFA 1B7YB 2NWMA 4FTHA 4PHCA 4HDVA 1NK3P 1ETWA 4OMQA 4HAMA 4Q15A 2PEXA 1X3ZB 3HRTA 1U3OA 3ZR8X 1WJ5A 3H0GJ 2O01E 5IXFA 3DBLB 4HCZA 2IA2A 2CV2A 1IF1A 2A61A 5KCHA 4FYYB 1VOMA 3M9QA 5CQGA 4P3NA 3V4GA 5K7FA 4BH9A 3A5ZA 5LJ5g 3MPUB 2VBWA 5CQYA 2VXFA 4FIBA 5I2SA 2ZJ2A 1R4NB 3KYDB 3B02A 1XB4A 2HBPA 4KNYA 4PJOE 4KIBA 1ZAOA 1BKBA 1YW7A 4KH1B 2H3JA 1WJAA 4KGXB 4NOYA 4UB6C 2B9SA 3TKYA 1QGPA 4Q48A 3GMEA 4M3GA 3GLXA 3HTRA 1JKOC 1ZGWA 4M7DG 1BJZA 2G6FX 3CCYA 4LIUA 3X20B 3VYUB 2XDPA 2XHCA 3VS4A 1U78A 5ILVA 1VQ5Q 3G71T 1Z9QA 4GYGA 2MLGA 1SEUA 2X1CA 3VBBA 3OS2A 3JCMg 1V1CA 3KEOA 5CVRA 2CUBA 1V54H 1VQMT 2H1KA 1LB2A 3KCCA 1LKXA 3FJPA 2RB6A 3QQAA 1EIFA 4N0AA 1MH4A 1CF7A 1N6AA 2XGCA 5KYWB 5CIUA 2ZXHA 2QEXQ 3KP6A 1Y96B 1MJBA 2P84A 2HPIA 4L5GA 1BU1A 3A8MB 1D1AA 2RAEA 2IEKA 3ZMTA 1BOAA 2X4JA 4RAFA 2KY9A 2VOPA 2HR3A 2EV5A 1AHDP 2IGOA 2PVGB 1MV0B 1FBSA 4EATA 5KE3A 1RAHB 3E6CC 3LH0A 4KIFA 5A0GA 1K9MR 1R22A 1MBEA 2CP7A 3WU0A 3ZOBA 4D8KA 1WU7A 3C0CA 3VQWA 2K7LA 3H3ZA 3J7AY 1W2BP 5E8GA 4LOCA 3E97A 2M87A 2DL3A 9ATCB 2VBZA 2GNCA 4ZN1A 2DMOA 1Y71A 2K9NA 3F6OA 2P0QA 4D0PA 2C7IA 1FBUA 3V8KA 1FYNA 4DOVA 2E34A 4LITA 1WJFA 5DYMA 2LP5A 5GMKe 1RUNA 4JUVA 2X9DA 2KFDA 2CO5A 3WTVC 1OR7A 2YSRA 3LA3A 3BCBA 2LD5A 2EQUA 3FX3A 2Y2ZA 1HJDA 4CO8A 4XTWA 4H2UA 1FLIA 1BBWA 5IP9J 1JJ2A 2YSQA 4I01A 3EG3A 2DOAA 3H5RA 3PCOA 5K1PA 2HOEA 2K9LA 3CCVI 5J39A 1VYVA 2EGEA 3JCMJ 3OIOA 2ISZA 2SEMA 5E17F 2IPQX 2PMZN 1OCRH 3HTUA 1N77A 2DM1A 3CCVA 2OTLT 4H2XB 4J7FA 1S6LA 4HRIA 3EH2A 4QKUA 3H92A 3WQZA 1MZBA 2NUPA 2QKLB 2ZCFB 5D6EA 4ESRA 1BBZA 1MGQA 2VWFA 2G3RA 4G7HF 2VOOA 4YG2F 1XOVA 3LGLA 4MEXF 1ETXA 2OQGA 2DW4A 2GFAA 2LF7A 1Z7LA 4JLIA 1O4XA 1Z9CA 1WSUA 4PCQA 4ZGJB 2V8KA 2ESWA 3RJPA 4RM2A 1GGMA 4EDUA 1SETA 2M0MA 2FX0A 2DNUA 3TL4X 1JJCA 4AH6A 3PNTA 1G3WA 4RA2A 1RACB 1J59A 3QDFA 1P4AA 4XMYA 2GTJA 2KSSA 4L5IA 4BUPA 1YFRA 1WGSA 3I4PA 4N0BA 2HFHA 4X5OA 4I99C 4UC4A 3UNGC 1W2BS 2QGFB 3GF5A 2W00A 3E9FA 2GTOA 3OYEA 3A02A 1EF4A 4JYKA 1UEBA 1YWPA 1YG2A 1YW9A 4J9EA 3CMMA 1VQLA 3CCSI 1W66A 2RI3A 3REOA 4NC7A 3CCET 2FEIA 1YWOA 2DMTA 1WJDA 4B44A 3BW1A 2RQVA 2L2OA 4C9YA 3DF8A 3CCSA 2DD5A 3KFUA 4FHTA 2KVQG 3MZ8A 1YITQ 1YI2I 1KZHA 4I0AA 2E1MB 5IYDJ 3LX7A 3E9HA 2VN2A 3UPUA 1YIJT 4LK0F 1I81A 1MIJA 5HGQA 1YJNQ 2VI6A 1X3UA 2XGTA 1BI1A 4DEXA 4CH5A 1IUYA 3HOZJ 4LVLA 2BOLA 3FHNA 3L4GA 4CH6A 3CC4T 3FDRA 2L3DA 3M8EA 3GTOJ 1Y1WJ 3V42A 2QBYA 3JCMP 2MD0A 4LJZF 4GCVA 4M75F 4PSWA 3PSFA 4JRKA 1OEBA 5BMZA 1Y0NA 1TQIA 1TW3A 5CVJA 3IALA 5LD2C 1QE0A 1N25A 1UFMA 2H8HA 3HSBA 1WVRA 5A2QE 2ZSIB 1I5OB 1CKBA 4RTVA 4XU0A 1CGPA 4IOCF 2DYBA 1K0SA 2JA7J 2HL3A 1YRNB 1K73R 1MBFA 2VUBA 1AWWA 1VQOQ 4KH0B 3ZQLA 4UHTA 3F9KA 1E6HA 2WY7Q 3WU2C 3OYIA 5ILSA 3KZIC 1Q95G 3H36A 3CMEQ 2YWWA 1S3JA 2DFFA 3OQ5A 2E35A 1SSFA 2H1LA 5GAN6 3M59A 3EUHA 2EFOA 2RQQA 2IJLA 4PJOG 2BY2A 1M3BA 1E3HA 2DTRA 1VFCA 3LSRA 1HLVA 1KA8A 2QYOA 3HOVJ 1ITYA 3Q5FA 1LPLA 3S8PA 2HD0A 5LEKA 1IO6A 5TISC 5EG2A 3E5UA 1NJ2A 1MD0A 2AQEA 3TOBA 2F5KA 4EQQA 2EIFA 2KK4A 3UH0A 4NC8A 1YJWI 3S1RJ 4KGVB 1NG7A 4XNFA 5E1XA 4HX4A 3MP6A 1E1TA 3HXVA 1SMTA 3ZGKA 1YJWA 3C12A 1WGXA 4RTYA 2F2XA 1B70B 3HP9A 2EKOA 1ZLKA 2J7IA 5B5EC 3CJNA 4OMPA 1H641 4CYDA 3LQRA 4M3EA 4FASD 5ICEA 4CYCB 4YROA 4AYBA 3W6JB 2UV1A 1SVOA 2LH9A 1WCMJ 1HW2A 3H35A 4A3EJ 1JRIA 5K7HA 5GAOm 4YCUA 5EGOA 4E7ZA 1I1SA 2JK3A 3RZDJ 1Q82C 3QP6A 1DQUA 2JA5J 4OMLA 4KQEA 1OCZH 2P8TA 2KP6A 4RB0A 3I56A 3M1CA 1OZ2A 4CCOA 1BCOA 4LXCA 3BE3A 3C2BA 3WVDB 1WKMA 2WV0A 1LVKA 3CEYA 2G4CA 2CQXA 3VPRA 4DA4A 2GXAA 3FIFA 2ECZA 3S6WA 2K5CA 1DP7P 2NS8A 2NVQJ 3LSTA 4L9TA 5LFAA 2CGPA 4EJVA 1GUUA 1WHMA 3M53A 3D1NI 2L7ZA 1JJ6C 3HPWA 2L4AA 5I21A 2L0AA 1B1BA 1ASZA 5JVGF 4OMFB 5FWCA 3NHNA 2FF4A 2HKXA 4K11A 4A93J 1W36D 1M1FA 2OCEA 4MQ9F 1MMAA 4J9DA 3BWGA 3TOAA 1BL0A 3DEWA 3OYJA 1FYLA 2W57A 1AD5A 4M78A 5C0MA 3WU1B 2DTIA 4A4GA 4M77F 2AHJB 3OYLA 5B1AH 2GZWA 1Q7YC 4MMLA 4V2SA 3LSHA 1F1BB 1OYYA 2KMUA 4IUQA 2L9SA 1M90U 4M9SA 3OSVA 5IT9E 2O4XA 2X6OA 2ZXJA 5HOOA 2RJEA 4ZTJA 4FQGA 1IRZA 1G3YA 3CCVT 1T0FC 1K6OA 2DX1A 4XN3A 4G85A 4J7IA 4ENNA 3B6CA 5I11A 4TVAA 2E4HA 3KXTA 3I9QA 3PMIA 4B48A 2P0PA 1B59A 3PIPF 3E2UA 5CQXA 4M75E 2VT2A 3OYGA 3NAUA 3RDIA 2FRHA 5KCMA 2MW8A 2PVOB 2BZ8A 2RJDA 3MEVA 1YBYA 3S1NJ 2ZTGA 4MEYF 4LDYA 8ATCB 3ZPLA 1LYLA 3SWNC 1AWCA 2K57A 2PX9A 3ZMSA 4EPCA 1IO2A 3SFZA 1HBXG 1ULYA 4A3JJ 1BR4A 4C92B 4QQDA 3JB9D 1YLFA 1BW6A 5CLSA 5IXBA 3DU6A 1MGTA 4YRGA 5A0LA 1RABB 2EFNA 3WG7H 2ZR2A 3NWSA 2VUMJ 5LHIA 3DBRB 5IAYA 3WXMB 4DYQA 2JTVA 2Z33A 3QWYA 4ELZC 4E47A 1U3EM 4M3DA 3RKWA 4HVWA 1SMYF 2XF6A 2MAMA 1H89C 1WXUA 4DPGA 2YRVA 2XTIA 1NYRA 1XS9A 4ON0A 2DETA 2DYSH 3MWMA 1VQLT 3MF2A 4FX0A 3MF1A 3MP8A 1ETYA 4FT4A 1MNDA 1OI1A 5DS9A 3CCST 3EFSA 2I0NA 1Y1VJ 3M1EA 1SKUB 1YCSB 3FBNB 2BY1A 3AT1B 3WVEB 2E1NA 4CH4A 2HKQB 3JSPA 3ZMDA 3D7SB 2HBWA 2QQBA 2XK0A 3ABUA 1D3BA 2STTA 2CV1A 4RQEA 2OTLQ 4A3BJ 4E7JA 4HQEA 2E10A 2VBYA 1RC9A 2M4GA 1QP2A 4BQQA 4DZPA 2X3XD 4GDFA 4BXFA 3OYFA 4KBMB 1W6XA 2M30A 1WQ2A 2ZNYA 3FXMA 3GUDA 4OB0B 2EJFA 3OMGA 12ASA 3V7SA 1MMDA 2VGNA 5ILUA 4CC3A 2QWWA 4FE7A 1PUEE 2QA4I 3IKVA 3NTIA 4D5FA 2XGEA 2FA5A 2L9NA 2HVRA 4ENKA 2HZTA 3GBGA 2ZINA 5ICFA 2J6FA 4ZN3A 2ZPHB 1IL2A 3ERMA 2KEAA 3QRFF 2EBPA 1WH5A 4BAYA 3EPZA 3V7CA 1VQ7I 5KNNA 2P5KA 2MI6A 3OBYA 1X1BA 1QWEA 4XSZF 3MEWA 5HS9A 3VYRB 1ZREA 2ZPBB 1KD1R 4C3HJ 1FT9A 1XMAA 4DBHA 2I4LA 3UA6A 2BW3A 2KT0A 4DZJA 1V29B 1FY7A 4RAZA 2GF7A 2QQSA 2AKKA 4U7BA 1SESA 2QM3A 4YEJA 3FHZA 2NNYA 2DOFA 3K1PA 4TV7A 2RO0A 3HXWA 4P72C 2Q5IA 3SFIA 3DTIA 1M3CA 1XJWB 1L3LA 2YU3A 3RPQA 4CRIA 1MH3A 4M77E 5DDGA 3TEDA 2CH4A 2B63J 4M72A 1B7YA 5E3IA 3L2VA 2OAUA 3E5QA 3G4SQ 2KRMA 2CT3A 2W4SA 4FE4A 4QW2A 2Y90A 2HZYA 1PSFA 1USSA 2FBIA 2V9PA 4H2SA 4UY8I 3K4JA 3A8LB 2VC1A 2EGAA 4HT9A 4A63B 5B3SH 3CMQA 3CC4Q 2AMCB 2JA6J 2XSDC 3S17J 4S0HB 2DKGA 3ZCOA 4FU6A 1SRLA 1VI0A 3ZRGA 3BG7A 3HDDA 3JW4A 1EIYB 3OIPA 1O3RA 3RKYA 3IV5A 3VV0A 1RLPC 2EZLA 1JJ2S 3UGTA 2Q1ZB 3PL8A 2ZR3A 2CUFA 2QHSA 4HQMA 3OBWA 3A0BC 5K5OA 1LFBA 2JWTA 2FPFA 4RUGA 3I56T 5J40A 2CMPA 2EQRA 3J7AO 3JB9I 2CG4A 2K40A 3VUBA 1ABOA 1OZ3A 4BWAA 4KMFA 3GXOA 2R7DA 3LNQA 4FT2A 1VQ6I 2R57A 2GCXA 1MDMB 4PJMA 3BTCA 3FMQA 3ASKA 4Y7NJ 5IN1A 2Y9YA 2F5DA 3K4NA 1FIAA 1X1CA 2I5UA 2KI7A 4HWOA 2VASA 1KOGA 5EEHA 4Y52J 4JPBW 2LP0A 3MJXA 2RMOA 1H9GA 1FMWA 2R7QA 1K1ZA 3I55I 3THKA 5GANj 2I4MA 3RERA 1D8JA 1NPRA 5KYWA 1R9TJ 1XDUA 2J6KA 3LW5E 4CXFA 1L0WA 1Y96A 2OBPA 1O3QA 2RHIA 2E5AA 5ICCA 4Q5SF 2LTPA 3DKYA 3K69A 3A5YA 5KYUB 1Q7YU 4C8QB 2COYA 5E1WA 2K4YA 5E3OA 5CO7A 4XAXB 4BQOA 2D5VA 4GGGA 1K73C 1ZG5A 1HSTA 3LA7A 1M1KU 4BL0B 4HX7A 1GHCA 1IGNA 3QDRB 4UVCA 2PMEA 3GX4X 3MEXA 2JVVA 3LSMA 3OMCA 1I3AA 3DBHB 2O9VA 4QLCU 3PNWC 1X2KA 2E64A 2CUEA 4OMZA 2VONA 3URGA 1JUSA 3KP3A 3A01B 1GBQA 3SZGA 2AZSA 4MLOA 4M7DD 4M75G 2DAOA 1ETOA 2KZGA 1SFKA 2P0KA 3HSRA 3UATA 4LFUA 2L7KA 2XKOC 2KMTA 2FHDA 5FD5A 5HCKA 4J6XA 4J15A 1OPKA 3L2WA 1USYC 2K3PA 5I22A 2ZCWA 2YPRA 4G6TB 2LK2A 3C2HA 1MKMA 4LD5A 3QYBA 4ETSA 2RQPA 2HXIA 4NC6A 2AQFA 1RIOH 2ZJRF 1XCVA 1G59A 3K7AJ 4H2XA 5LJ5h 3VB2A 1SVLA 5B66C 1ZSZA 1DUXC 3M8JA 4N4HA 4XBFA 3JB9H 2KXCA 3M0RA 2LNBA 1VQ4I 1I50J 3HRMA 1G5IA 2LYCA 3JCMX 1YQAA 3BOQA 4J9HA 1X2GA 3NQOA 2A37A 2FD5A 1GFDA 2LTOA 2COMA 1B07A 5GAN5 4O3MA 1TNTA 3FMRA 2WAQA 1X69A 2ZJPF 4CDGA 4IUUA 1W5TA 2X4XA 2Y75A 4BY6C 5FLMJ 4P74C 3DTKA 3AL0C 2HPMA 3ULRB 2PVDB 1N9RA 1VIFA 2IGKA 3EQLF 1NJ1A 3CCVQ 3WHBA 1RLQC 1NEBA 2R7VA 8AT1B 3JAMK 4HWSA 4XKBA 3I7FA 2Z99A 1PHTA 1Y0UA 1S7AA 1UHFA 1XCBA 2JRTA 3ASNH 4ZJZA 1K9MU 1FP1D 4KT6A 4KR3A 1V5GA 3JCMh 4J8OA 3IHUA 1PP7U 3VYTB 2XAFA 3UFGA 4JX5A 5J1YA 3DKMA 3CDHA 2LSOA 3EG1A 3HFNA 2LX7A 1JXSA 1MBGA 4J9GA 2H6BA 4A3DJ 2OAZA 1IRFA 2LT1A 1GVDA 2A5WA 4EM0B 3CCJI 4N4OB 2IIMA 3CCLT 1WFXA 3HM5A 2FVUA 5B1BH 2KQWA 1W4SA 2CU7A 4PFPA 3CCJA 2HOAA 3CD6T 2HQEA 5CVVA 2WAEA 5ELNA 3RMSA 2DXCA 4R0KA 2CP0A 3DFGA 3A5ZB 5CVIA 1YFNA 5LGUA 1FTTA 3OSSC 1VQ5A 3S3NA 2FE3A 1SD6A 1Y8RB 1S8NA 4RGSA 3ICAA 3ECHA 4PJJA 3EUKL 3F70A 2CH0A 2E6ZA 4QVDA 4Y17A 3HHTB 3HRKA 1H92A 2RDPA 3FXQA 3SD4A 5M5XJ 2DOEA 3L7WA 2PNIA 3BPXA 1PD0A 2ID6A 1RL2A 2M3AA 2JRMA 2F2EA 3I0TA 1H4QA 3CCSQ 4YTLA 2JVGA 2NRAC 3ZN0A 2QEXA 4CHUA 4EV0A 3JRDA 1LFUP 2YT6A 3E3VA 1W0TA 2VXDA 1YW8A 5LHHA 4M77G 2FBHA 3E7LA 3EHRA 2XDBA 2ISYA 3OW2A 2VE8A 4CICA 1ZQ3P 4PGHA 1W36C 1CKAA 1YI2Q 3VYGA 2OCCH 2CYZB 1K4TA 2CSQA 1FJLA 4HCKA 1BR1A 3JRAA 2XAJA 1YRNA 1I4K1 1SAXA 2YR2A 5GTIC 1VQ8T 2K9GA 3TQNA 3U1KA 1PYVA 2IA0A 1Z3YA 2XI9A 1S72I 2O8XA 3L1AA 3LL7A 2FMYA 3RPUD 2YLBA 1PC0A 1LJOA 2RHXA 2Z3YA 1WZOA 3CUOA 1S72A 3JRGA 1WA7A 4A5MA 3QKJA 5FU6B 3NTKA 4BB7A 3CMAI 1GV5A 4H2VA 3E0JB 2LJ1A 3WGIA 3BJAA 3LOCA 1AVZC 2BE7D 2F2VA 3CMAA 3COAC 1WXTA 1NNHA 4CCKA 4A12A 1UGVA 3V8JA 1UGQB 2GBYA 4AD9A 4KITB 3P8DA 2X6WA 1D3YA 2DL8A 5H6RA 1RI0A 2EFIA 2CSOA 3I4MJ 4XLCA 2AS5F 1V3FA 2V7FA 2P0LA 2MK5A 1WLEA 4DGWB 5LJ5f 1OMIA 4XLHA 2ZMEC 1Z7UA 3OMYA 1FYFA 4V19K 1B70A 1AWJA 3P8VA 4GBQA 4X1VA 4J9IA 2IGMA 1NLPC 3C95A 2VL8A 2DDBA 4HT8A 2O0YA 1IB8A 4CYCA 4E7HA 3FF5A 4YRJA 4RTUA 1WHLA 2CJAA 1ZELA 3GPLA 1M8VA 5FKOA 1JKQC 3HXLA 2JPBA 4JBAA 4FYXB 2H3EB 3EG9B 5CYVA 4BD3A 5DM6F 3PUBA 4GLKA 1ARKA 1YJWQ 2JMCA 5L3BA 2GFUA 2O8KA 1U06A 1DGWY 3EG2A 4F52A 4L9VA 1YS6A 2JTMA 1KIKA 2F6CA 2QG9B 2DEUA 3TP0A 2CT4A 5HLGA 1KONA 1K73U 4BJ5C 2WSCE 1G6NA 3L2UA 3VS2A 4PJOD 3SWNB 3RL6A 4KUMA 4CZZA 1APLC 3ABMH 2WC2A 1QVFP 1YJ9I 4IUVA 3NFCA 1YHQI 2LKSA 5DM7R 2XPWA 3P9IA 3BG6A 1KU2A 1P2FA 1X2NA 2KRFA 1IRXA 5BQTA 5ECAA 5DY9A 2LF8A 3CPFA 1KC8R 5E3MA 5F04A 2GLOA 5FLXE 3CC7I 4L9NA 4BU2A 2DLLA 1FPQA 4DQ2A 2EA2A 2A3SA 2XPVA 2XRNA 1QVGP 2M4KA 3CC7A 3ML6A 2K9SA 1X1PA 1TSFA 1U0JA 1Z6RA 3EGXB 2DILA 3BQYA 4A3KJ 2HMAA 1YJNA 5GAOr 3HPHA 1TWBA 3NTHA 5EDNA 2KXDA 1JHFA 2RN8A 3QJ6A 2I4OA 2K5IA 4HA8A 2UXXA 9ANTA 3G1MA 1T33A 3K4KA 2JSCA 3BR5A 3DQVC 4RDUA 5LJ3e 3G1OA 1USTA 1HOMA 2VV5A 1H9TA 4IHWA 4YIRX 2NYSA 5CPRB 3FXLA 1A35A 3ZL7C 2QZ8A 3F8CA 2GA1A 3PIOA 4AIDA 5BPDA 3A4CA 3JCMQ 1RPWA 1QCNA 1X55A 2V4JC 4C92A 4M78F 2IS2A 1RR7A 3VS5A 4BDZA 5LJ3d 5KVRA 1JT6A 1U8RA 5L3EA 1ZRFA 1PM3A 2Y0SN 2B0LA 4J00A 4QPQA 1WIEA 4IZZA 1DJ7B 2KJCA 4KUDK 4J5YA 1ETQA 1TL8A 4MO7A 3IG2A 4A3MJ 2VKDA 3CCMI 4C0DC 3JRCA 3AKZA 5DLOA 1W5SA 1P92A 3HB9A 1K4US 5EF6A 4IIOA 3U21A 4XOTA 4D1QA 1D1CA 3CCMA 2CV0A 1N8RC 4FYWB 4DOWA 1EVLA 1MHNA 4M7AE 2ACJA 5HKCA 4YRFA 1S5LC 2FPEA 2NVYJ 3CCJT 2LY2A 1Z67A 2NYXA 3PQKA 2A07F 4WF2A 5L3CA 3K4BA 1E17A 2O88A 1Y6IA 1LPQA 3DLLA 1R77A 2RNAA 1RR8C 4M7AC 1VQ5T 2MABA 3H1CA 1TW2A 3HJEA 2CJ9A 4ENJA 1VQPI 3CCRI 3C4SA 4M9ZA 2ZFUA 5J4VA 2HYGD 4AG2C 4ZDPA 5J4YA 2QQ9A 1V76A 2LLKA 4HX8A 1A36A 5FKKA 1M5Q1 3HKSA 4R56A 1SPKA 1VQPA 3CCRA 1EX4A 3UR3C 3QG1A 4P1WA 3S2DJ 1YYVA 4IRIA 3QODA 2NXNB 3RYRA 1A0NB 2F5EA 3VODA 2JJ9A 1LUJB 4XR6A 3KX2A 5M5YJ 3ZEHA 2NS6A 1TXQA 4RTTA 1G4DA 2XF5A 2QEXT 3J7ZI 1BK2A 2E65A 4P75C 4C5GA 1A6IA 2VJIA 1MV3A 4KUIA 4A0XA 2KYMA 4C5EA 4RGRA 3TO9A 1IUFA 3LSPA 3GFIA 1Y7XA 4OF1A 2E6NA 4EM2A 1QVPA 5GAMd 2NS7A 1JUPA 2M1HA 4HDUA 1B7TA 3BTLA 1WQWA 1HQCA 2IS1A 3VS6A 2IGNA 4YREA 4KMUX 4MTEA 1QVFA 1IC8A 2ED0A 3TBIA 1GCPA 2VPLA 3CPWP 1BCMA 5IYCJ 4U7DA 1UAAA 4NL3A 2LX9A 2MPXC 4BDYA 2JA2A 4X9DA 1S72T 4MMKA 4CS3A 2KJBA 3OYMA 5EGOB 2BBYA 5E3NA 1MBJA 2ZKZA 1U1SA 2V6CA 1W7PB 2JA8J 3OYHA 2HQXA 2CUJA 1RUWA 2QA4Q 4IUPA 2RJFA 1JUMA 4RTWA 4I7HA 3MZYA 4CS4A 4DOZA 1XGSA 2KISA 3OR2C 2QSGX 1OCTC 4XLNF 2E3IA 2EB7A 4M7DC 1PD1A 1OQKA 1WJRA 4Y91A 2RQWA 1K6YA 4ENMA 1VQ7Q 3PVLA 1I6XA 4LGWA 3EH1A 3IRRA 4ZYGA 3HPGA 2E3CA 1NJIR 4P3OA 2K7AA 2AKWB 3GVAA 2ME0A 2CW8A 4IIMA 1UMQA 3CDLA 2DERA 3N5BB 4GXOA 3FXRA 2ODRD 4QSHA 4P9UA 1QQJA 5HVQC 3M57A 1Z77A 4EIKA 1LVAA 4A6EA 3GTLJ 1SHFA 1EIYA 4CCJA 3OYNA 3IAM2 3CMYA 1KQSA 2YUQA 2CP2A 1ODDA 4O6JA 3CLQA 4TTVA 1W1FA 1MBKA 4Y92A 4HNVA 4E51A 2BHZA 4EMKC 2KNBB 1YS7A 2FBKA 1IJWC 3PE0A 2L8DA 2ZAEA 1QP3A 4XOPA 1QZZA 5DLQE 4E6KG 1XTAA 2O4XB 5IOYA 1NPPA 2CDTA 3DEEA 3VRYA 1X2MA 3QTCA 4M78E 5LHGA 2XF7A 1P7JA 1V5EA 5GAGJ 3CC2A 2D1VA 2C8MA 1TWAJ 2IG0A 4L5JA 2AK5A 4OIRF 4NL2A 3R0AA 4BYYA 5FKMA 4TVAB 3HIFA 2DL7A 2OV7A 1WJBA 1RAGB 5EJCA 2RHQB 3MQ0A 3MAJA 1WFWA 4M3FA 2G9WA 2RK2A 2VYTA 1T2KA 1KD1U 1B3QA 2JUCA 2LNHB 3M5AA 1D0YA 5E79C 1E2XA 1UGPB 2IXSA 1G3TA 1MBHA 2HU9A 1BIAA 4IHVA 1X6BA 2KPMA 3FKIJ 3Q0UA 4UP9A 1BI3A 1NHAA 3WE3A 4AC0A 3JCMV 1ORKA 2M0OA 4B9WA 2BXYA 3UA7A 2CRGA 2WA0A 5GMKm 3VQXA 2UZKA 2QVOA 5F64A 3GTKJ 3IQLA 3K1MA 1ZLJA 2BY3A 5L8RE 4C8QA 1VQ6Q 2MH2A 2HQHA 1PYSA 3A7UA 5J3BA 1YITT 2OTJI 4HCBA 3BP8A 4A4FA 3BR2A 1VUBA 2X4WA 3CXCA 4U0WA 2YUOA 1O3SA 1BR2A 1KYWA 4IQJA 3RQIA 2AIRB 3H41A 2FB7A 1YJNT 3JB9F 3HOSA 3AL0B 4ASNA 1FSHA 4F7ZA 3GFJA 5GMKh 3I55Q 4EGYA 2GIZA 4BKXA 2VKHA 2HL5C 1A31A 1UFFA 3HXYA 2HQNA 2HXOA 4CC2A 1BI0A 3ULQB 1LNWA 1RKWA 4AVPA 2EIKH 1UHSA 2L7MP 1FOWA 5D6WA 2M45A 3N97A 2JW4A 3BQZA 3WTYC 1K8AR 3BG9A 2C06A 2FXAA 4G8XA 1J2XA 1D3BB 4YRSA 4YYEA 2QENA 3CJQB 1AKHB 1TUDA 3OYBA 3S3OA 3HKZN 4F16A 4NS5A 1H4VB 3O3KA 2FNPA 3KP5A 4XRSA 1B6AA 3DKWA 1KJWA 3TMOA 2DTOA 5KYXB 1AU7A 4GY5A 4KULA 4LD6A 3LAJA 5CK9A 2ENMA 2DO7A 3CMET 2LQ8A 3OW2S 3HHGA 3M8FA 3S1QJ 3BFMA 3G6EI 1Q82R 2Z2SB 5JR3A 2QDYB 2D2WA 1ZR2A 2XAHA 2H8RA 2DT5A 2W24A 2HQ5A 3G3ZA 4K2EA 1Q86C 3G6EA 4BE0A 4UUTA 4J9BA 3F8MA 2XUBA 3R6NA 2GQQA 2ELKA 2V1UA 2FU4A 4LVMA 1IXSB 1WHUA 3LFKA 1ZARA 3E1SA 4X6AJ 3JCMW 2DK8A 5GAN4 3CF2A 5GAEJ 3HRUA 3G4SA 3M4GA 1R7JA 2EJRA 1B8AA 1X6OA 3IKLA 3HRSA 3K4MA 3CCUI 1WYXA 2KYBA 4M75D 3L2RA 4RMOA 4LN2A 1BW5A 4LIVA 4PJ0C 2Z16A 4OMNA 4HZFA 4A2UA 1VQ4Q 2JZYA 1PWTA 2ZPEB 4KGZB 3R07A 1KG1A 1TP4A 3GYHX 2VLAA 3DCFA 4DEYA 1X1AA 3LQQA 2E36A 4YP0A 3LWIA 2WB1A 2K3XA 2ELJA 3VS0A 1KC8C 1DU6A 2LY9A 4E70A 2OZUA 2EQKA 3L42A 2EZIA 2Y30A 2HOSA 4K86A 3VJPA 2IVMA 2OD5A 2V9VA 2F4MB 1S7EA 3AG2H 3HOYJ 1DPUA 1G8XA 3QNEA 3QZ5B 1BIBA 4EMSA 3T1BA 2PBIA 2JS0A 1ZTRA 2XIGA 3F8NA 2ZT7A 2M9HA 1M2OA 3QPSA 1C0MA 3NARA 5FRMA 1UJ0A 3SHWA 2MWOA 4RBOA 5F6FA 3M7GA 1EVKA 2LY1A 2K79A 3FISA 3U1DA 3GIBA 1PCXA 1J5WA 1WQ7A 1GXIE 3B73A 2QK0A 4L59A 4PJOC 5IT9K 4NUBA 1F36A 3CCJQ 1S29A 2CS7A 4L6V5 1REPC 2ZMEB 3WGHA 5DV5A 4BGDA 2ZNIA 1YN8A 2MLKA 2NOJB 2LJ3A 3F6VA 2LBFA 4ANJA 1IG7A 4NQWB 2DU5A 2ESNA 2IS4A 5EC7A 3VS1A 1FNNA 3VFZA 1OV3A 4XU2A 2O9LA 2CZ7B 2FZCB 4RS8A 4IRGA 5IT9Z 1WJSA 1E0EA 1ZKGA 3TDZC 4C3IJ 3DV8A 1YNZA 2XD0A 1U8BA 4MZPA 3WGGA 4G9YA 2VE9A 1DP3A 5LJ3g 2H27A 3NPFA 3H5NA 3RCOA 2DN0A 4AYBN 2BVMA 3QO3A 5EZGA 1XD7A 3UF4A 1D5VA 2UXNA 4XM3A 2F69A 5KNLA 4P73C 2AXTC 2M8GX 3CF5F 5HY6A 2E3HA 1JTYA 3JR9A 5CKHA 3M4PA 3VS7A 1EH7A 5C3EJ 4X9CA 1OX9A 3M9AA 5ERIA 4Q6GA 3CC2T 1S9HA 2WWYA 3JRHA 2M51A 4M78G 3O8HA 4LG0B 3O5ZA 1JU5C 2CQ7A 4HF2A 2HVSA 4BS9A 2EIMH 2LVSA 2DA6A 2ME6A 1S72Q 2O61A 4G94A 5LBQA 4NNJA 4RB3C 3TSWA 5HNFA 4KYWA 4OGEA 2QGUA 4OB3B 3L09A 4D7NA 1B9MA 2EINH 1PJRA 3C18A 2XKPA 2CJJA 3CUQC 4XKCA 3G1JA 4YIFA 4U0YA 4M77D 1F43A 3LWHA 1IZ6A 1VQ9I 3CMAQ 2CH4W 2WSEE 4OP0A 2HDCA 2L7FP 3FEOA 1EA3A 1GXPA 4MZTA 3VEPA 4R79A 1VQ9A 3FXKA 3OV8A 4I02A 1T6SA 2HZDA 3RESA 3TDUC 3EG9A 1HF0A 3I35A 4G84A 3OS5A 4IHYA 2HWVA 2WAFA 5DD4A 2CUDA 4M6XA 2DL5A 2DIGA 4E7IA 2PG4A 5AIPA 3BR3A 2G0EA 3J80E 2XICA 3VUZA 4DJAA 1KHIA 3C94A 5GAMg 1XSXA 1ZSZB 3DPTA 3SWNA 3UDCA 2JSPA 2P5IA 4RLQA 4A0ZA 3FDYA 1XSVA 4YDQA 2VC8A 1UG2A 5FFZA 3O2PE 3ASOH 3PFIA 5JHFA 4R55A 2JT1A 3HZJA 3SXYA 2O2OA 4CCMA 3F23A 1DPRA 4AU7A 1W7PD 2LVMA 5KH6A 3P7NA 1XX5A 1Q81U 3A1YA 1ZHFA 3HFOA 4PFZA 2E5NA 2BTTA 2M5WA 3S16J 1TOVA 4LVJA 1I3QJ 1O75A 3H9QA 1HSQA 1PRMC 1JBMA 3H0IA 1ZUYA 2DBBA 3HUGB 4EX5A 4A3IJ 3P5JA 2EYZA 4MHGA 4C0DB 4H2TA 4PLIA 3PNYA 2J5OA 3RYPA 4QPOA 3F3XA 5FKLA 2XPUA 4BY7J 1AEYA 4EJTA 2DRMA 2ESHA 2AHQA 4ZTZB 4A5NA 3EGXA 4N4IA 2QHVA 1NJIC 3PO3J 2ZXIA 2DYRH 2DK3A 2X1DA 3K70D 2NVUB 2HQAA 1V4RA 2EH3A 1Z05A 1YJ9Q 1NEGA 3CP8A 4P9FA 2VJ5A 1YHQQ 4RB2C 4ZTUB 1D0ZA 2EYQA 2DMUA 1XGOA 4YRTA 1I1GA 4ZH4F 3F21A 4F7UB 2DD4A 4C0GA 1OCOH 3HTZA 3LH5A 1UECA 2ID3A 2C0OA 3HTSB 3A1PA 4BXUA 4LNPA 5TJJA 4RB1A 3PSIA 3CC7Q 4JJDA 3HOUJ 4HNTA 1XGMA 1X2QA 1HC7A 2VQCA 1NTCA 4ME7A 2HS5A 4IURA 1IREB 3Q9VA 4P71C 4MFEA 2ZFWA 1DDNA 3IWFA 4A3CJ 3G4ST 4G7OF 3PQJA 2P5VA 2AKLA 2M02A 1YI2A 5D7UA 2YXYA 5DTDA 3KUFA 4N4NB 2OX7A 2MMPA 2P6TA 1JE8A 4FM4B 4X0GA 2TRTA 5TRDA 1UE9A 3NEUA 1Z6TA 4GLMA 4OWRB 1RI9A 2BYVE 3NRVA 1M2VB 2X6YA 1O7FA 4M9XA 3M0TA 4WK8F 1RAAB 2OPTA 2GQIA 4D7MA 3TSZA 2ODRC 5DUIA 1V5FA 1IW7F 4D9JA 1H3ZA 1UELB 2DA7A 5K7ZA 1F5TA 1I5ZA 4FX4A 4AFSC 1CSKA 2W1OA 4XN0A 1W2BA 3DPUA 5LLQA 1OCPA 1KC8U 4IOAF 3S15J 2UUZA 2K3BA 4XTYA 4YRLA 3MKYB 3K0LA 1NK2P 3S1MJ 1WPKA 1KQSS 5IOZA 4MZMA 1WXBA 4P72A 1QZEA 1XQHA 5A0DA 1BOBA 3PIOF 4BHCA 1Z0XA 3E9GA 4E7SA 2GWRA 4BY1J 4C92F 2COWA 3I9V2 2RK1A 3MP1A 4ZDLA 4M7DB 4B09A 2KDOA 4A69C 3CCMQ 4XEMA 1X01A 5HODA 2PMHA 3SDZA 1DU0A 4ZGEB 4Z02A 2Q2EB 4OMMA 2KZVA 1BC8C 2LMDA 3MVPA 4HWPA 2JUGA 4RKUE 5LJ5j 3KBGA 4TVYA 3PUFA 1UB9A 3QYHB 4HOBA 4JS4A 4H4KC 2VQHA 2CFOA 4OVAA 1K8AC 2Y4XA 3G71I 3H3VK 3HY0A 2ZBKA 4P5OA 4Q5WA 2EILH 2E60A 4DW6A 4PFOA 1VQPQ 3CCRQ 2QSHX 3KETA 5CVUA 3GLLA 3OS0A 5F0HA 4J6YA 3OYDA 3KIOA 1VQMI 2BZXA 2CQKA 4MDXA 3RI4A 3OYCA 3DLLF 2V79A 3OOPA 3F22A 3JB9G 1T8IA 3V8LA 2E71A 1Q1HA 5M9OA 1PP8F 4KA4A 5FD6A 4XU3A 3U2RA 2E12A 3MHXA 1UHMA 3S3MA 3IC7A 3KZZA 3ZQGA 3G1LA 4IKFA 4IHSA 2DBMA 2RI5A 5DM7F 4RTXA 1HXDA 3GTJJ 1W7PA 4RM3A 2P7VB 3QOPA 1SVMA 3CTAA 3CZ6A 1QKWA 1YFTA 3RKQA 1T3SA 2YUNA 4ZYDA 2EYWA 2A28A 2CREA 4XICA 2DA5A 3K10A 1IHWA 2STWA 2NUZA 3I71A 1QU3A 3H9JA 1VZ0A 3SHFA 4I98B 1ZGJA 1RIQA 1TT5B 2MC3A 3PJRA 4UVAA 1F4KA 3AHUA 1E3OC 1I5LA 2L0KA 2PFBA 3EETA 2Q8KA 3KLOA 3QAHA 2Y9ZA 2X3WD 3OB9A 1B34B 1IV8A 4LDWA 2AKWA 5GAOp 2GGRA 3NMZC 2PU9B 4A0YA 2K3YA 5J1UA 1SSHA 1BI2A 2HQRA 3QHSA 1M27C 2R92J 4R1HA 2LQWA 2WBMA 2K2VA 2LKXA 2DFUA 3PFYA 2R7OA 1U1TA 4XTZA 4XU1A 3OA6A 2ZPIB 3KYCB 2MA3A 2JZ2A 2ZT8A 2VPRA 4AFQC 3MEAA 5LGNA 2OAWA 2E19A 1IV6A 2ABLA 3CBOA 4E6RA 5GAHJ 5HS7A 2EV6A 1XSDA 5GMKi 2B7EA 3TUPA 3HL2A 4ATOA 2BKDN 4Z8AA 3KFWX 1VQNI 3OIQA 2M0YA 3SEQA 3GTQJ 2XKOA 1TC3C 1VQNA 2K9MA 2VC0A 1D0XA 2VB6A 5CJ9A 3A8GB 3G7ZA 5CQEA 2RHQA 3K6GA 4BI8B 2E70A 5GAOn 1YIOA 1OLTA 2PJPA 4UP7A 4JJBA 2E1OA 4Y15A 3FZVA 1Z7MA 3ZQHA 1UG1A 2JTEA 2HTSA 4PJNA 1ON2A 3SDBA 5GAOl 4PG3A 5EG0B 4RLFA 4M75C 5FWBA 2J3LA 3FB9A 2F5FA 4E7KA 4UP8A 4J9CA 1XN7A 1YFHA 1XTDA 3CC2Q 3HRIA 4IUTA 1W4MA 3OYAA 4MDWA 2G7UA 1X75C 1SRMA 1JEGA 2ECBA 2WSFE 2DQRA 1YGBA 5FU7C 1UJ8A 1MNMC 1L0OC 3I64A 1WI7A 2E5KA 5F08A 1A5JA 1K9AA 3S14J 2R0QC 3UWNA 2XB0X 2YS9A 2DQ0A 1P9QC 1QLYA 4C92E 2P4RA 1NJIU 5GANe 4PZJA 1OYIA 5C51B 3VQVA 4P74A 3M55A 4J6WA 3DKXA 1U5TC 3QBYA 5DUKA 4CH3A 3R60A 1K7AA 5GTHC 3IWZA 4C2UA 1ACIA 2QUFA 2EQMA 5GANd 1ABQA 3OYKA 3CCEI 4LUEA 2WAQN 2Q7HA 3FXOA 2RV8A 4H0EA 4JRQA 2A6HF 4F04B 3REXA 1TQPA 3EGDB 3CCEA 4A4HA 1X43A 2OTJQ 2WTEA 1YI2T 2IVWA 1AKHA 3BZCA 4J83A 2PN6A 2R5ZA 1YIJI 1OYXA 4DBQA 2EQJA 2DDAA 2A08A 2R58A 3DP7A 5KYXA 3S2WA 1YIJA 4C8QF 1OFCX 2QXFA 1J75A 1JJ2P 4XLFA 1ZX6A 3OL4A 2FMLA 5AT1B 3O8GA 3W2WA 2QCOA 2GIVA 1U6GA 4Y33A 4MFDA 1I6HJ 1NZ9A 3SYTA 1TNSA 1LEBA 3K9TA 2WADA 1FBQA 1WH7A 1GBRA 1GT0C 1QPIA 2QA4A 2EJ9A 2LOOA 3LAPA 2ROLA 1H8AC 3VQYA 2CW7A 7AT1B 2DQLA 1QRYA 1IZ1A 2EFWA 2LDMA 1EZZB 3FXJA 2DE0X 3Q1JA 4WWCA 1M1KR 2LC4A 1T08B 4LD9K 1TBXA 2KQRA 4PJOB 1J9IA 1VQ7A 3GFLA 3CQTA 4PLLA 5FO5A 1K61A 1P4XA 3ZMUA 1VQKI 3S2HJ 3J81E 5BPIA 3TQ7P 1ENHA 3HL8A 4ZZLA 4GYIA 1BN5A 3G6EQ 1PVEA 2QDLA 2OF7A 2DL4A 2CP3A 4YELA 2FL7A 5HDNA 1VQKA 1LEAA 1A6QA 3BY7A 1HKQA 2XAUA 3SEZA 3LYIA 2MBFA 3HXXA 3HBLA 3I3LA 2L9VA 2P7CB 3J7YJ 4TVRA 1IXDA 2R5YB 1X3WB 1OU8A 4JJNK 4C30A 3SEMA 1IXCA 2I8DA 2O31A 5CR2A 4M77C 2E7WA 3FKJA 1SD7A 3CESA 2RVCA 3WE2A 4KIGA 3BR1A 2ROTA 1K8AU 1YJWT 2K85A 2E2HJ 1O3TA 3JRFA 4JOMA 2P4TA 1B72B 4HW0A 3BTJA 1JT0A 1E22A 2ELHA 4KN7X 3CCUQ 1SAUA 4G6QA 3PZCA 1NLOC 1NM7A 3M3YJ 1H8KA 1QBJA 1X4PA 2ZXWH 4HNUA 2RD1A 3MKLA 2XDVA 2RNJA 5FLXK 1FOYA 2CQNA 1Z21A 4BW9A 2XC7A 2IY5B 3J7AF 2J05A 2P6SA 3EUAA 2GA2A 4M7AD 4AVZA 1JKRC 2GXBA 3ZQCA 1Y8QB 1Q82U 2KR3A 4HWRA 4XTXA 4F14A 1T98A 2ZMEA 1I1JA 5IHNA 5FLXZ 4WCGA 3P8TA 1XGNA 1X56A 4BE2A 2D6FA 3MKWB 4OB1B 4JS5A 3CUQB 5LRSA 2FEZA 5JLWA 2HYFA 4LLLA 4NQWA 2HCKA 3FK7A 4PJLA 3ONQA 1Z7NA 1FSEA 4IO9F 1VQ6A 3QPHA 2A69F 2L3RA 3AG1H 1YOVB 2R3SA 5L3DA 2DEQA 1W5CC 5J47A 3TEGA 4BBRJ 4LMYA 2AO9A 2YU9J 1QCOA 5FB2A 2VGMA 1U9OA 2DFEA 2A7YA 3GF2A 4AFUC 5LGTA 4IVNA 4ESFA 4KICA 2FOKA 2QI2A 1N8RR 3P8BB 1UUEA 3ZXSA 1X19A 4HLYA 4CH7A 3I55A 2RHYA 3K70C 2XROA 3O6BB 3T8TA 3FM3A 3RGLA 4DNCA 1VYTA 3BJOA 1QHGA 2R7FA 1SFUA 5C4XJ 1OU9A 3MQZA 1PYSB 1FYMA 4B3XA 1NE8A 4P5NA 5GAOq 1M90C 1HYOA 2JOYA 1MJAA 1Y56A 3JV3A 1IN7A 2ZPGB 3RUXA 4ORZA 3CBMA 4LG0A 2HDWA 3KEQA 3MMYB 5JHUA 2Y4YA 4C0ZA 3GW2A 3AG4H 3C1DA 1VQNT 1UGSB 3WG9A 2LNVA 4TQFA 3R6OA 4C8QE 2K9QA 3VDXA 3CP2A 1GCQC 2KT1A 1N9SA 2XG8D 3HOXJ 3M56A 2RHSB 2IRFG 5J1RA 2KRNA 3KYLA 3GZ6A 6PAXA 2OQRA 4C8QC 2W0ZA 5GJVB 3RSNA 2CSIA 2FYKA 1E1OA 4HSRA 4RG2A 3LSIA 5GPCA 1CQTA 3IAS2 5FKNA 3LSQA 2QF7A 2X4HA 3EGUA 2NVTJ 2JPCA 3RNJA 2BGCA 3M4OJ 2DTHA 4L0YB 2EPDA 4LDUA 2NUTB 2F4IA 3LSSA 1R23A 3VSKA 1O9SA 4WCIA 1TTHB 3KP4A 3HKZA 3OYYA 2QSFX 3RKXA 4J9FA 2ARSA 2BHYA 2LC2A 2L4MA 4D6WA 4EJWA 2OC6A 5D5VB 1KMNA 4C92G 1PG5B 4FW2A 2DJIA 3VWBA 3BZKA 5ELOA 2P0WA 4LLGF 1VQ9Q 3UKGA 1VQLI 4HCCA 2L9RA 4QQ6A 2DFHA 3LWFA 2ZPFB 3META 3H0FA 1RUOA 4MIMA 1M4ZA 1LNXA 4AG1C 2CQQA 1VQ4A 2H6CA 3JSCA 1JXMA 2HNHA 2QGGA 3PO2J 3F8BA 4M78D 1FX7A 5L3FA 4KRTA 2OA4A 1R49A 5CKTA 1PUFB 1XMKA 4UUSB 1QVTA 4ZDOA 1ZBXA 2ZSHB 3HUGA 2VKNA 2KBTA 4EJOA 4HLXA 5EYRA 3D5LA 1SANA 4UPAA 4KN4X 1X6GA 5BOXA 4GO1A 3H0HA 3GNFB 4WJ3M 1RAFB 5I2MA 3IP4B 3MEUA 2HYJA 2JN6A 1FTZA 3ZBDA 1ON1A 1U5SA 2M1BA 4U87A 4KR2A 3REUA 4CCLA 2D0QB 3RF1A 4KT5C 2MYSA 3IH2A 1P7IA 4AWXB 3CCQI 5LJ3h 3E6BA 3CLOA 4M7AA 2HSPA 3H6ZA 1JO8A 1JI8A 1VQZA 1G2BA 1NG6A 4F7UA 3CCQA 2CS3A 3DLMA 2NAZA 5D6FA 3L00A 2QA4T 3WHCA 4B9XA 3MO8A 2DXTA 1HK9A 1C1AA 2RC4A 1VYUA 2IA1A 2LKPA 2M0CA 1OX8A 1K76A 2FZGB 4YRRA 2X1EA 5M3MJ 4W1UA 1NG2A 2W25A 2HDDA 1QO0D 2H94A 2E2IJ 1TLHB 2Z5UA 2A3LA 1LQ1A 3GTGJ 3G1ZA 1VQ7T 3ABKH 1ADYA 2W82A 2FOWA 4LUDA 4P75A 2M7AA 3K2AA 3KE2A 5JFRA 1RADB 1MMNA 1HA8A 2EBIA 2LT4A 3QPLA 2KROA 5F5WA 2M7BA 1VQKT 1MSFC 1IXRC 1PKSA 1ZUKA 2K02A 1M2VA 1MSEC 4JLGA 2I4NA 2EYXA 1PRLC 3A8HB 2DT7B 1YX3A 3QO7A 2LBFB 3NETA 1G51A 2PJRB 1G83A 1TUGB 1HW5A 2KHMA 4RAYA 4BACA 2XVCA 4L9JA 4WJ4A 1GLNA 5GMKj 3W3CA 4JX6A 5IPAA 1HC8A 4CC4B 3VOEA 4LG3A 2R7UA 2Y31A 2YX7A 1MNEA 4LDXA 2ALYB 4HKEA 1NJ8A 1ZR4A 4UV8A 2XGXA 1H88C 4AUXA 4IX7A 2MSYA 1LFPA 1XC5A 4BXXJ 4A3FJ 2X35A 2EYYA 2DZ9A 4HEA2 1TTYA 1J0RA 3CJTB 5GAMh 2FZKB 4RCCA 4M7DA 3ZN1A 1B76A 2LG4A 3I53A 3OOUA 1KK7A 3RTRA 2Q2EA 1W0UA 4E7LA 4B8XA 2BE9B 1IN4A 2XASA 3I56I 3SJMA 3PVQA 2DA9A 3HHHA 3QJYA 1R0BG 5C6SA 3GEZA 4XQ3A 3X28B 4ZTFA 5GPAA 4M6YA 2LZ6B 5H6QA 4N0AC 2DPPB 1IN6A 5EZHA 1QWFA 2E41A 1AT1B 5EEAA 3JB9J 5GANg 4QQGA 1VQ6T 1B8IB 2SRCA 3FRNA 2ZIOA 4MNUA 2ZGWA 1D09B 4H2WA 1ETKA 2XHKA 2CGHA 5FU6C 1QF6A 4FCYA 1ONVA 4EMKA 3SQNA 1JGSA 3PTAA 2PTKA 3KP2A 4ABZA 4AMCA 3QSUA 1EH8A 4I0BA 2DF6A 2LQNA 3A98A 1D8KA 4FSSA 1TWCJ 3FLGA 1GVJA 4HV6A 1MW7A 4ZNXA 1Q86R 2I10A 2ZZDA 1XPXA 3I55T 5L23A 3TW6A 5KYNA 5EEGA 3GOXA 4JQFA 2E7XA 3Q9SA 3ZQQA 3L2CA 4OAYA 4XLEA 1LDJA 2FO0A 1I0CA 3P8HA 1UHWA 3G71Q 1NH3A 1K83J 1R4MB 3SZTA 4QT7A 3M4YA 2ZB9A 3JCMf 2CUZA 4A53A 4M75B 3U23A 1M1KC 4OMYA 3QYGB 2PMZA 1VQMQ 3TP3A 1FMKA 1OR7C 2UWMA 3MEYA 3OWTA 1B34A 3EFOB 3L2ZA 4C8QG 5CCAA 3FWEA 3MCZA 5LJ3f 2M16A 2A5YB 5LRRA 4JJCA 4HBLA 5FJ8J 1JXOA 2F5CA 5FU7B 2DJZA 2DQ3A 2I2LA 1YJ9A 1NYQA 2RGVA 3KLNA 4S05A 3CBPA 4K87A 3HSFA 2PI0A 1YHQA 2RF0A 4B6MA 1P4WA 1C0WA 2X4YA 1V55H 5D4SA 2R5MA 1LDKB 1AA7A 1AOYA 3M4QA 1NJ6A 1ZLMA 1U5TB 1N78A 3JCMb 5F1RA 2D1HA 3WTTC 3AAFA 3DSQA 4BHBA 2XDDA 1KQ9A 1GL5A 2RN7A 4L0ZB 4IXAA 1QW1A 5D8LB 4M74A 4JZ4A 3BDDA 1F1ZA 2P5LC 5JVTA 1ASYA 1KQ2A 4KT0E 4LNSA 2BE5F 2YRCA 2HEQA 3H0DA 1YE9A 2JT4A 4PNOA 1HSJA 4QTRA 1UZCA 2IBDA 2X51A 4XRSG 3KFVA 4XRFA 4ELYC 1HKTA 1VQ4T 4GRIA 5K1XA 1GDTA 3T5XA 3PMTA 2KIFA 5EG0A 2DA3A 2RKHA 2YRDA 3P9KA 1OISA 2Q7EA 3N05A 1GRIA 2EVRA 3G73A 1UDLA 1Y57A 2DXUA 3HFVA 1IDYA 2JS2A 4BJ6C 2QASA 3P8YA 1VQNQ 2H8WA 4AIJA 5K5RA 1K4SA 3TGNA 3W6KB 4YRIA 2O7OA 3ME9A 5GAMf 3BPVA 3AFHA 1K9MC 3RPUA 5FROA 2KRHA 2BXZA 4IEJA 5GAN2 1X2HA 2EV0A 3GP8A 2R5AA 2DVEA 3IH4A 4YRCA 2COZA 1R36A 3D5SC 1M8MA 3FJ5A 1PDNC 1K78B 2EPFA 1ZG1A 3GTPJ 2EKHA 1WHGA 3CCQT 4M73A 1IN5A 2F48A 1WZ2A 4W97A 1S1NA 1G5HA 4DBFA 4BQNA 3JTGA 3CCLI 2XIDA 1Z91A 1WDXA 5KYYB 3MKZA 2V1NA 4IPAA 3G2BA 2P81A 5GP9A 2NLUA 3HOTA 3DU5A 1O7LA 2D8HA 3M0UA 3CD6I 2KE9A 2VVKA 2QTXA 3CCLA 3EGDA 3FXUA 1SD4A 2DZCA 4UV9A 1SEMA 3CD6A 4IHXA 1D5YA 4BHPA 4E4HA 3DXJF 4FL6A 1SF9A 2DXBA 4F55A 2WV1A 1I27A 3PGGA 1QCFA 1KFZA 4M77B 3GBQA 2VT3A 2MC4A 1PSEA 4XL9A 5KHDA 3QYFA 4CZCA 4OGCA 4CCNA