3V8KA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with biotin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 93
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8kA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8kA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8kA02
4H2SA 1YFHA 2VXEA 1YFSA 4YFNF 4YRTA 1HW5A 4LG0B 2FNAA 3R4KA 4M7AB 4F7UE 2OU2A 4I7HA 2VT3A 2RV8A 5D5XB 2XAGA 2NRAC 5JFRA 5KK1A 4A0XA 1YS7A 2M45A 3C18A 2C8MA 5DCMA 3N97A 4RAYA 3GFIA 2AKWB 1RZ4A 1JHFA 1MDMB 5LHGA 1WQWA 2JT1A 1HW2A 5GANh 4OOIA 2ZXJA 4M7DD 2Q7EA 3FM3A 4KR3A 5LGTA 1ASYA 2LF8A 2YHTA 2NNNA 4YRRA 3CUQC 2ZZGA 3P9KA 4CH3A 3A7AA 4EMKC 2GZWA 1UHMA 5GMKi 3JCMW 3SB2A 5GAOm 1TQPA 2O03A 5CVVA 4AVPA 4QVDA 2MLGA 2LF7A 4KUMA 2DXUA 5GAMj 4KN4X 4HLXA 2DEQA 3QTCA 3TKYA 4EJVA 1G4DA 1ZN2A 1LEAA 3QAHA 4F7UF 3ZMVA 1M5Q1 1YW8A 4M77D 3E6MA 3E6CC 2ZNZA 1R1UA 1NNHA 4RB3C 3ERRA 4JQFA 2WV0A 2VBWA 4ZIBA 2GAUA 2YX7A 3QUIA 2XRNA 2Z99A 5LRSA 1WKMA 2HQNA 3WU0A 3I7FA 3WTVC 1H4QA 1AWCA 3TO7A 4OU0A 1P6RA 2ZBKA 3SQNA 1C0WA 3SWNA 3JAMZ 1XDSA 1U6GA 2ZT5A 3A5YA 4YG2F 5GAN7 3L09A 4PG3A 2RHSB 3E6BA 5L3CA 1YGBA 1H9GA 4NB5A 4HOBA 4K2EA 4XQ3A 5L3BA 4XEMA 5C52B 4O2DA 4U88A 1LDDA 4H2VA 3DXJF 4LK1F 1FC3A 5DD4A 2VT2A 4BQAA 1YS6A 2XASA 4MNUA 3P8TA 3OD1A 2Z9OA 5ICEA 3QP6A 1UCRA 4YIFA 4JRIA 3LFKA 4EQQA 4IHSA 1QGPA 2ZTGA 2E3CA 4EMGA 3HOSA 4M77A 2HS5A 4IHTA 4LLNA 4H02A 5ILSA 4HQMA 5CJ9A 3CDHA 3E9IA 1ZAOA 5HS7A 4RGSA 1BIBA 3SXYA 2ARTA 1XGNA 4D0PA 5GAOp 2HKOA 5GAMg 3QPHA 1KQ2A 3G3ZA 5DEQA 3RPQA 4E51A 1L0OC 4M7DB 4JUVA 1FSHA 1QZZA 3C7JA 3M4GA 4HWRA 2E7XA 5IT9K 2IA2A 3F72A 1U5TB 2ZR3A 4TV7A 4C92B 3WTSC 1UFMA 4Q4ZF 5D4RA 2XVCA 1KYWA 3UH0A 4PCQA 1LVAA 2CW0F 1IN6A 2BE5F 2CG4A 2FNPA 1J5WA 1F9NA 4BNCA 4DPGA 1OPCA 4ON0A 5FB2A 2G7HA 4M77B 1SD4A 4P71A 3MQ0A 5FD5A 3FXRA 3DEUA 2Q7HA 3I53A 2KIUA 4XRFA 3RIRA 4Z2YA 4EJWA 2Y48A 2PBIA 4YRGA 2LSOA 2IA0A 2Q5HA 4P55A 2UXXA 5IT3A 5E20A 1O7FA 4HX7A 5FGMA 5GMKj 4TVYA 4KN7X 3W3SA 2LNBA 3FMQA 3L9FA 4M6YA 1RIOH 2ZNYA 2D45A 2F5DA 1FX7A 5ICCA 1J59A 1ZGAA 1VTNC 1X3UA 4A6EA 2VONA 3VQYA 3E6DA 1T0FA 3HFZA 1BI1A 3JCMJ 1R22A 3FXUA 4V2SA 3HYIA 2RDPA 2OQRA 2FYKA 2OZ6A 4EMHA 2CFXA 2DQ0A 3RL6A 2CJBA 1TTYA 2QTXA 1V3FA 5EEHA 2J5OA 5GAMd 1R5HA 1FOKA 1NHAA 2ZJ2A 4JBAA 4LB5A 4IRGA 1OYYA 1X54A 3DSQA 4EO4A 3I54A 5D5VB 1JGSA 2PG4A 3CUQA 3LA3A 4HA8A 2I4OA 4LLGF 4WXHA 4MTDA 3RERA 3ICAA 2P4WA 3TEHA 4J6XA 3WTWC 3GW2A 1LDKB 3ELKA 3RJPA 4H2XB 2FSWA 3QO7A 4C8QC 1P4WA 4CH6A 2I4NA 3ECOA 3VQWA 3HTUA 2OD5A 1REPC 3RF1A 3NETA 2DTRA 4LGWA 1KQ0A 2QWWA 3HFOA 3PQJA 3RKXA 3HFZB 3REUA 1H4VB 1D3BA 4HF2A 4JK1X 4L0YB 2R7DA 3U1DA 4YFKF 4EJTA 2E10A 1YB3A 3FMRA 2MC3A 2F5FA 5HGQA 1I5LA 5E3IA 4KA4A 4M72A 4LD5A 5LJ5j 1BI0A 1SRYA 2P7VB 4YFXF 4G6QA 2J5PA 3WE2A 3VBBA 4LLLA 2Q0OA 2I4LA 1MZBA 1GXQA 4G94A 3KP7A 2EJFA 2I2LA 3P8VA 1K79A 3D0SA 3M7GA 4YPFA 2VOPA 1N9RA 1EIYB 3JTGA 3LQQA 3IALA 2X0LA 1ZYRF 3U9GA 4HX8A 4NQWA 1V4RA 1Z6TA 1N9SA 12ASA 2CIMA 4XTUA 3G1ZA 2A3SA 5EEGA 3JB9J 1NYRA 3LSSA 4LMYA 2QM3A 2GQQA 3G73A 2A69F 4F7UB 2XUBA 3O2PE 1F4KA 3ABUA 3Q5FA 2BYVE 1ZG5A 2FBKA 5GAN4 4PZJA 4HWSA 3KP5A 3MZYA 4A53A 4ESJA 1HW1A 1KMNA 2A07F 4I0BA 5FO5A 3VOEA 4YROA 4IVNA 2JPBA 4RGUA 3H3ZA 4YYEA 2DLLA 2YLCA 3VU3C 5E1ZB 3GZ6A 1J5YA 1KU3A 1FBSA 4TVAA 4YRNA 1QBJA 1R7JA 3QNEA 1WI9A 3BDUA 2V1UA 2HGCA 4YRJA 4I98B 4RCCA 1O3TA 4UP8A 5K1XA 3CO7C 2EB7A 3I59A 5D6FA 1F5TA 1KYZA 3PGGA 3LSTA 3N4MA 1FBQA 1ZG3A 3M8FA 4L18B 2XAJA 3BJ6A 3EQLF 2QZ8A 4NL2A 2M5WA 3ZMZA 2EV0A 3BP8A 3K69A 4CHUA 4HBLA 3TDZC 3C3WA 1OYWA 5GANf 1SAXA 2PI0A 1O3QA 5LJ5g 5D5WB 4P72C 3JCMh 1E24A 3IKMB 3HXZA 1O3RA 4OLFA 4DNCA 1VQZA 4OIQF 2G7UA 1U8RA 1IW7F 4M73A 1E2XA 3RKYA 2EAYA 1YFRA 4EM2A 4PDKA 1S8NA 1ZARA 2OZUA 4IPAA 3V8LA 4M78C 1J0RA 1OYIA 2GXGA 4UXNA 4YRQA 2W25A 1B70A 4YRSA 3QOPA 4UV8A 1IN7A 5KNNA 3DF8A 1KQ9A 2XKPA 3ZPLA 1CF7B 2L4MA 5E17F 5GANj 2ZFWA 2RC4A 1XGMA 4RAZA 2X4HA 3JSPA 2FE3A 2ALYB 1K78B 2EJGA 2AXLA 4EGYA 3BPVA 3HRKA 1IN8A 2GA1A 1X2HA 3V8JA 1FP1D 2BGCA 1S7OA 3UGQA 5DUKA 3L1AA 3GZ5A 4HVCA 3K0LA 3JB9G 3CMQA 2EFQA 1MJAA 3QSUA 1Y96A 2IY5A 1YLFA 3HXWA 4EV0A 4G7ZF 5L3FA 1B7YA 1STZA 1J7KA 3GFJA 3IG2A 5C53B 3Q9SA 3K9TA 1LJOA 3I4PA 2NNYA 4OIOF 4J15A 1H0MA 1OMIA 4WI1A 2DQLA 5A2QZ 3KP2A 2PMEA 1SMTA 3E97A 1L0WA 1R1VA 3FB9A 4OP0A 2M30A 2O3FA 3VODA 4ZZLA 1G6NA 2B0LA 4PGHA 4WJ3M 1FBUA 5LJ5d 3RDIA 3FM5A 4ESFA 1W66A 3KZZA 5H6QA 3R6SA 3J80Z 1T38A 1BIAA 4G7HF 5HDKA 1DPUA 2Q7GA 4KICA 2VN2A 1Z7MA 3LAPA 3F23A 2YPRA 3WTTC 1P4AA 5GAN2 3PCOB 4KIFA 4ETSA 4L9NA 4PJOC 3R07A 3VB2A 4NHJA 4WJ4A 5HDNA 1USTA 4H2YA 3RGLA 3DPLC 2ZZEA 4ZH4F 1EOVA 1ZH5A 4Y17A 2P5VA 5GANg 1W5SA 2FXAA 4Q5SF 2ZR2A 3E5UA 1ADJA 1O7LA 4XLNF 4K88A 4ZTZB 5GAN5 2UWMA 1YTYA 1B8AA 1IF1A 3ZP5A 4P9UA 2H94A 4E70A 5GAMf 1YQAA 3WU1B 2DXTA 4FX4A 3HSRA 3V7RA 4ZYGA 1YIOA 3KLNA 2CSOA 1QQIA 1SD7A 2F2EA 5LGNA 3U2RA 3AAFA 2DK5A 2QENA 3H92A 4A2UA 1I1SA 2W84A 1UHWA 3QU6A 3KETA 3E5QA 4RGXA 1Z91A 4M75G 2HTSA 4XU1A 5E18F 4AIJA 4M9SA 3WODF 4EGZA 2C6YA 3EFSA 2DAOA 2ODRD 1USSA 4L87A 5GAMe 1B59A 1HXDA 2O61A 1YYVA 5LRRA 4A0YA 3ERED 2PQ8A 1PP8F 1WNLA 1O57A 2KIFA 4LFUA 3HTZA 3REOA 3SHFA 1I27A 3R60A 4BWAA 4K86A 1WQ2A 2ESHA 4MHGA 5DCMB 5JI6A 3ML6A 2F5CA 2EFNA 1DUXC 1XSVA 5FFXA 4UHTA 5HOOA 3JTHA 4XSXF 2XAHA 1H9TA 5BQTA 2KIMA 1RUNA 3JB9F 2DU7A 4CS3A 1R36A 4P72A 3VEPA 2ELHA 2E1HA 2VC1A 4YRLA 2GA2A 3L7WA 3R0AA 2DU9A 3HRUA 2PMHA 5GANd 4CGZA 1XDUA 4YRKA 1IXSB 4M78A 3M1EA 2MD5A 3ECHA 4C8QG 1Z6RA 2IW5A 5L3DA 5GAOr 5LHIA 5JR3A 2EFWA 2ARSA 4L5IA 2DPUA 4F7ZA 1FNNA 1HBXG 1ADYA 2P7CB 4M7AG 1FYFA 2ZIOA 3ZMDA 4J6WA 4G8XA 3F8BA 4DQ2A 1YG2A 5D6EA 1RIQA 3QO3A 3EDPA 3KP4A 4YRCA 4A12A 4EJUA 4CO8A 3SWNB 3JAMK 2DVEA 2DTIA 3I58A 1FYKA 4NOYA 4U0YA 4BXUA 1LNWA 4L5JA 1B76A 3E3VA 2FBIA 1XMKA 5J8FA 3MZHA 4XEOA 4M9ZA 3M4QA 4P96A 3TQNA 3HRTA 1G51A 2NYXA 4M71A 4EX5A 3L2ZA 1D3YA 4RB1A 3TUPA 1L3LA 4UVCA 11ASA 2P5IA 4HW0A 2IRFG 3BJUA 1BC8C 4UP9A 2IP2A 4U7BA 1P2FA 4RQFA 2K57A 2ISYA 3K1NA 1TH7A 2L01A 1HSJA 1TLHB 3F22A 5LJ3f 2AS5F 2EWNA 2ZNIA 2FBHA 1H4TA 2D1VA 4HV6A 2KRFA 3QO8A 2ETHA 1DPRA 4NCXA 1F1ZA 1R5GA 4RB2C 4M75C 3RUXA 4TTVA 1KU7A 2JN0A 2Q8KA 1FP2A 1Z7NA 1WPYA 1M8VA 3O6BB 3HXYA 4RDXA 3I64A 5E8IA 5GMKe 3QRFF 4FHTA 5K5RA 2AMCA 1EVLA 2RQPA 2OQGA 4MEXF 1LNXA 3TEGA 1H4SA 2MBFA 3J81Z 5F6FA 5DYMA 2VE8A 2E1NA 2V1DA 2QQ9A 2ZT6A 1T39A 2Y75A 1B9MA 1WWXA 2EJ9A 1YCYA 1G5HA 1IZ1A 4KMFA 5LJ3j 2LKPA 3E5XA 3FZVA 1ZGJA 3LA2A 3NEUA 3P8YA 5H6RA 1SD5A 1QO0D 3JB9D 2KJBA 4GYGA 3ZMTA 2ZMEA 3FXQA 5L3EA 3F6VA 1QPMA 3HRIA 5LLQA 1TNTA 2DQ3A 3KCCA 2W57A 2XIGA 3A74A 5ELOA 1W7PD 2MA3A 1FLIA 4ENJA 1TQIA 1X56A 1U1TA 2VC8A 3A7UA 1IXCA 4HWPA 5LJ5f 4M78G 4EMKA 1KU2A 2PEXA 3IRQA 3BOQA 4YRFA 2K27A 1B4AA 1ATIA 2RNJA 5GAN6 1G3SA 4C8QF 2VXZA 3GWZA 3PQKA 2EA2A 4R1HA 3EYIA 4MQVA 3E9HA 3I0TA 2L3DA 2GWRA 2RVCA 4M7AC 1EVKA 4XU3A 4C92G 2VBXA 3INZA 2E1CA 1J2XA 1HKQA 3WTUC 2JTVA 1RI7A 4EMSA 2J3MA 4Q47A 2DO7A 4ENKA 3NENA 3OV8A 3WGHA 5AIPA 3A7RA 2E5AA 1BJAA 1DP7P 2FQ3A 2DKGA 1X01A 5LJ5e 1SFUA 5FD6A 2XAFA 1K7AA 5GMKl 5K5QA 4GGGA 3P9CA 4H0EA 1KU9A 2E65A 4M9XA 5LGUA 1D8JA 3OOPA 2YLBA 1AOYA 3BZ6A 5KVRA 1BC7C 3CUQB 3MCZA 2HR3A 4O5VA 4YRPA 1W7PA 5D5UB 3TEHB 1IUYA 2R3SA 4HQEA 5J6XA 1SESA 1WYDA 5LJ3g 2MLKA 2YR2A 3DPTA 5E8GA 2D2WA 2HQRA 2UXNA 5LHHA 4CYDA 4X9DA 4B8XA 1P92A 3RPUA 3ZMUA 3CTAA 3WGIA 2Z33A 3QPTA 4KIBA 2XROA 1IXRC 3HOTA 4A6DA 2F5EA 3J7AO 3ZQ7A 1U1SA 1E22A 5FLXK 4P9FA 1ZRDA 2TDXA 1D3BB 3GXOA 2RM4A 4M75D 1G5IA 1X55A 2ZT8A 4ASNA 2ZCWA 3WQZA 2MH9A 1ZG1A 4ZZDA 1Z05A 2BEOA 1SETA 4PJOG 1O3SA 4KFCA 5BPDA 1ZHFA 4MMLA 5AONA 1E1TA 1USYC 3QP5A 1ZRFA 2DK8A 4I2OA 2M87A 4M78E 3GX4X 2M8EA 1JJCA 5HS8A 2LDUA 4WCGA 1W7PB 1IL2A 4BAYA 2O0YA 3L4GA 1X2GA 4FX0A 3HRMA 2HWVA 5HLGA 3IHUA 5C51B 4UV9A 4I02A 1WLEA 1G3WA 3W6JB 5ICGA 4Y91A 3CJNA 3COAC 1WQ7A 1I81A 2K7LA 3BW1A 5FFZA 4XU0A 1UB9A 1FSEA 4BHPA 4LJZF 3BDDA 2Z3YA 2K4BA 3TGNA 3B02A 2HYFA 3P9IA 3JCMQ 1EH8A 4KR2A 1R58A 1I1GA 4LB6B 2DZ9A 2WTEA 6PAXA 2EK5A 2XAQA 3RTRA 4M78F 4M75A 1YFTA 2OAZA 2CO5A 3F3XA 4C8QD 5CVIA 4XLPF 3P7NA 4TVAB 2P8TA 2RKHA 1TW3A 5LJ3d 1B1BA 3JCMc 1WSUA 4Y15A 3T1BA 3JB9H 5GAOn 1EH7A 4M7DC 1SMYF 1GGMA 4TQDA 1B34A 4YREA 3GO5A 4M7AD 3I59B 5GANe 3CLOA 1U5TC 5DD8A 3UFGA 3MWMA 4C92C 2E7WA 3Q9VA 4QLCU 4P74C 1XGOA 3HIFA 5DY9A 2PMFA 4ENMA 2ZCEA 4YCVA 4FT8A 2FRHA 2FB7A 2DBBA 2QHTA 2QQAA 4F7UG 2XTIA 3TO9A 2Y0MA 1D5VA 5JHUA 4M77C 1LJ9A 4CH4A 4G9YA 4ESBA 3KE2A 2PMUA 3V4GA 3W6KB 3FHZA 4CS4A 3SFZA 3JCMd 3H3UA 2CGHA 5GAOq 4EVIA 2RHQA 2HYGD 1EFWA 4OMYA 2DU5A 1B70B 4CH5A 2XHKA 4P73C 1XN7A 4KYWA 2ARUA 1IAWA 1PUEE 4N0AC 4R8HA 4C8QA 2JRTA 3C1DA 4BHCA 2DZCA 1K6OA 3DKWA 4R79A 4RMFA 4U7DA 2IA1A 4I0AA 4O3MA 4HT8A 4P3PA 4CXFA 2XKOA 4LG0A 4M7AA 1ZREA 1BBUA 2DDZA 1MGTA 4IRHA 1JE8A 3GEZA 1S7AA 3GF2A 1T6SA 3RYRA 1JXSA 2VBZA 4XTYA 2ZIMA 1BBWA 3NELA 1I4K1 5GMKm 1Q1HA 2AKWA 5E1WA 3ZN0A 1Y96B 2IY5B 3F8NA 4K87A 4PJOF 5ICFA 2HFHA 1MDMA 3MEYA 4MTEA 3M9AA 3T8RA 3JCMP 2GIVA 3JSOA 1U3EM 3KZYA 2ZKZA 3VQXA 5BPIA 1B7YB 1FYLA 1NYQA 3HHHA 4UPAA 1NJ2A 3KEOA 4N9IA 4HF0A 1BI3A 5A2QK 1ON1A 1TW2A 1JBMA 1R00A 4RS8A 2H6CA 3MFKA 4MEYF 3HSBA 2QHSA 2QQBA 4L9JA 3AHUA 2FA5A 1E1OA 2Q5IA 1SERA 1GXPA 2QHUA 4YDQA 1S29A 5DV5A 2VBYA 2XV4S 1J9IA 4A5NA 3J80K 2COMA 2K86A 2HEOA 3IRRA 3WTZA 2ACJA 3EUHA 1P4XA 3B73A 4Y13A 4M78D 2P6TA 5CVRA 5TRDA 3HSFA 3K2ZA 5ILUA 2XGXA 4MQ9F 2HZTA 4N9HA 5CAIA 5CYVA 3HXVA 1USYA 2EJRA 4J6YA 3M8EA 3HSEA 5GAN3 2WWYA 2RHSA 2V6CA 2YX4A 5F5WA 1G3TA 4C92D 1EH6A 2RD1A 2V1XA 2YSRA 5K5OA 2VOOA 1QZYA 2VODA 3KLOA 4G7OF 4M6XA 3NEMA 1ZLJA 1LQ1A 1ONVA 3SZTA 5JVTA 1RNLA 2ESNA 2P0LA 2DFIA 2I4MA 4GYIA 2UZKA 2E64A 3IKTA 4L9VA 3RESA 2EFOA 3QU3A 1BI2A 4RB0A 3ROUA 5D8KB 5DCFA 1XB4A 1KA8A 4XBFA 4HAMA 2IT0A 2H27A 1ON2A 4BHBA 1JHHA 3V7CA 2CJAA 2EV5A 5HLHA 3F21A 2QLZA 4OINF 3FF5A 3FWEA 2L02A 2A61A 1YW9A 4ZTUB 4QWQA 3DP7A 4XTWA 1BOAA 3QO5A 3FMSA 4HLYA 4KMUX 3T5XA 4UNOA 2RB6A 1LOJA 1PYSA 1U78A 4M7DA 3LQRA 1NJ5A 3K1MA 2RGVA 3KP6A 2P5LC 1H641 3JCMb 5IT9Z 1U5TA 2XGTA 3GYHX 5AIQA 2QBYA 4C92A 1FYMA 2O8XA 4HF1A 2VE9A 4HDVA 4P3NA 2PJPA 4P74A 3ZMSA 3IWZA 4PJOD 5TJJA 3BY6A 3V7SA 1D8KA 4P75C 2QVOA 3DV8A 2ISZA 4CICA 2PLYA 5I21A 4RCBA 4AH6A 1MD0A 3F6OA 4M75E 2DQRA 2G4CA 3A5ZA 1LDJA 4Q15A 3HY0A 3HTSB 3EFRA 3ABTA 4ENNA 5BOXA 2FOKA 4M78B 3M4PA 4RQEA 5CLSA 4KNYA 4P73A 4PHCA 5DUIA 4WXCA 3IKLA 4Q48A 5CVJA 1YW7A 3LWFA 3TDUC 3TOAA 1Y0UA 1PYSB 1IN4A 4BYYA 4ZYDA 4N0AA 3RI4A 4HDUA 2VXFA 2Z5UA 3CO6C 2KKOA 2WC2A 4IRIA 1I5ZA 3T0YA 1XCVA 1MKMA 2DTOA 2QBYB 3JW4A 1FT9A 2DW4A 4L0ZB 3IWFA 3T8TA 1S6LA 1S3JA 4WX9A 3A31A 4EM0B 2ZXFA 5D8LB 4S05A 4HX4A 1TQMA 4M75F 4YP0A 3KFUA 5GAMh 3GIBA 4JRKA 2CYYA 5ERIA 4PJOA 4KT5C 2DT5A 2NAZA 2DPDA 3HFVA 1BBYA 1BN5A 1XSXA 1QF6A 5K1PA 4C8QE 3F8FA 1I6XA 1XSDA 3QHSA 3MF1A 3F8CA 3R0JA 1SFEA 4PNOA 3JCMV 3LC0A 2RN7A 3MF2A 2DJZA 1KQ8A 3JB9I 5LJ3e 4H2XA 3JCMf 4M7AE 4BW9A 2M1BA 3BJOA 4UUVA 1HKSA 3SZPA 4ZYHA 4AWXB 1CGPA 2ZGWA 4X9CA 3D5LA 4U0VA 4XTVA 1YO5C 2DTHA 1FY7A 1TNSA 4LK0F 2W24A 2GXBA 3WTYC 3BJAA 1ULYA 1FWZA 1Z7UA 4IXAA 3RKWA 4XTXA 4B09A 2E41A 1NJ6A 1EV7A 2FEZA 4PJOB 1FZPB 3BWGA 2K4JA 3LAJA 2VC0A 5HDGA 2STWA 3HXUA 4GXOA 2ZZFA 2AMCB 2STTA 4M7DG 3JCMe 3J81K 2CJ9A 1GHCA 2HKXA 3KFWX 5CVUA 1LEBA 1ODDA 3HY1A 1EIYA 4YIIA 4IJAA 2FU4A 4M7AF 2L54A 1B6AA 4A54A 3PFIA 3VFZA 4CDGA 3IC7A 1SD6A 4GCVA 1IN5A 1XGSA 1T2KA 3K1PA 2IVMA 2ZMEB 2KJCA 4U0WA 3KEQA 4F7UA 4AIHA 1BM9A 2J3LA 2IJLA 5ILVA 4HT9A 1MJBA 4M77G 2Y90A 4RGRA 3JCMX 3CUOA 3MAJA 4GO1A 4OMZA 4S04A 2HNIA 2A6EF 5FLXZ 1MJ9A 3NRVA 1IRFA 5ED4A 2ZNJA 3L00A 2W85A 3WG9A 1Z9CA 4HWOA 1OKRA 4EMKB 5L3GA 2IPQX 2G9WA 2QUFA 3DFGA 2QHVA 4YCUA 4M74A 4UP7A 5LEJA 5ELNA 1KQ1A 4H2WA 4N0BA 4H2TA 3BPXA 2EV6A 2FMLA 3GVAA 3TOBA 5LEKA 2R7FA 1GVJA 2ZO4A 4XTZA 2NS0A 4IF4A 2OBPA 2ADUA 4XU2A 3ZN1A 4PGGA 4TQFA 2D1HA 5F64A 2CWEA 5GMKh 1OR7A 1U2WA 3S2WA 2ZT7A 3UGTA 4X5OA 4TWAA 2HDCA 4P75A 4I01A 3F8MA 1HTTA 1ASZA 3VQVA 1KMMA 3BROA 4KIGA 1PP7U 3JCMg 4H2UA 2A5YB 3HXXA 5E1XA 2QYOA 2A6HF 5LJ3h 4AD9A 1HSTA 1LB2A 4CS2A 4M7DE 1A04A 2OA4A 4P5OA 2Q2EA 4EM1A 1ZLKA 3LA7A 2PFBA 2JZYA 4OIRF 3BY7A 3GLXA 1QE0A 5GAOl 4C92E 3EETA 2RA2A 1SFXA 5BS6A 5LBQA 1CF7A 1ZRCA 4YRIA 2H09A 2CQKA 1JRIA 1T98A 2ALYA 4Q6GA 4A0ZA 1K78A 3HRSA 1Z1DA 3GFMA 5K1YA 4NL3A 1W5TA 2V79A 4MMKA 4M77E 4TVWA 2EA4A 5H20A 1TBXA 4KQEA 4WWCA 2EL9A 1HKTA 4J5YA 3RACA 3SWNC 3I5UA 1N9WA 4HWTA 2HOEA 1XMAA 4WF2A 3FIFA 1RUOA 3R61A 1J75A 1JJCB 4M7DF 3MEXA 4YCWA 1EQRA 3V8KA 3BFMA 3L4GB 3HFNA 5J8CA 1W4MA 3REXA 4C92F 3FX3A 4HZFA 3HHGA 1NJ8A 5LJ5h 3ULQB 2BV6A 1B9NA 2H6BA 3PZCA 3O3KA 2ZINA 2JSCA 1FPQA 2ODRC 1WRJA 2V9VA 4G85A 4OIPF 2MH2A 4M77F 1XD7A 5HVQC 4ZYEA 2O6GE 3IKVA 1HC7A 2BBYA 4HV5A 4PJOE 1WU7A 3DQVC 4M75B 2PN6A 3A32A 3PCOA 1R1TA 2FF4A 2CGPA 1I8FA 3FJPA 5GAN8 4WK8F 3RYPA 1NJ1A 5BMZA 4P3OA 4L9TA 3IL2A 1B34B 1G3YA 3WE3A 4KDPA 2EFPA 1IRGA 2C7IA 1C0AA 4EJOA 3WTXC 4QVCA 5F1RA 3ISPA 1QNTA 5D4SA 4HYEA 4UVAA 4G6DA 2JPCA 4MGRA 4BH9A 1R23A 4XSZF 5HS9A 2YU3A 3NQOA 4JLIA 1PDNC 3LSQA 4WXDA 2P6SA 1DDNA 2FMYA 1E17A 1XCBA 2K02A 4UVBA 3WGGA 2L4AA 3L2CA 3HUGA 4A5MA 4P71C 1LYLA 2HTJA 4LNSA 4YRMA 3GFLA 1KGSA 4I09A 4G84A 4CZZA 2RHQB 3EYYA 5HLIA 1KOGA 2DI3A 2P5KA 1HQCA 3GUDA 3I71A 3KP3A 3TO6A 1HK9A 4C8QB 4AIKA 1MGQA 4O6JA 2A68F 5DDGA
chains in the Genus database with same CATH superfamily
4H2SA 2VXEA 1YFSA 2WAQN 2OU2A 4LIVA 2V4JC 4I7HA 2VT3A 3LSIA 5D5XB 2FL7A 2ELJA 5KK1A 4A0XA 4D8KA 2C8MA 3CF2A 5DCMA 4RAYA 1D0XA 3UT1A 1RZ4A 1V5GA 2QYZA 1WQWA 1HW2A 3CESA 4OOIA 4M7DD 2KRMA 3J7AF 2FHDA 2LF8A 3CUQC 1Z0XA 1PYVA 3CCJT 5J4VA 1TQPA 5FU6B 3ONQA 5GAMj 4KN4X 2KR3A 5EG0A 1VA7A 3QTCA 4EJVA 1QU3A 4J83A 4IHXA 3ZMVA 1M5Q1 5IXFA 4RB3C 3ABKH 3CC4I 1VQPA 2GAUA 2YX7A 2XRNA 5LRSA 1WKMA 2HQNA 5D6WA 1JXMA 4LVLA 1Q7YC 8ATCB 1P6RA 5KAIC 1SF9A 1YJWI 1XDSA 4B1RA 2QSFX 4XQ3A 4I76A 3B6CA 1VQ5Q 4BE1A 2K5FA 2F4MB 1G83A 4M3DA 1C1AA 3DXJF 1YS6A 3UA7A 2ICWG 2Z9OA 5ICEA 3QP6A 1UCRA 1RAEB 4IHSA 4RTTA 2E3CA 3HOSA 2YSQA 2M0MA 3L2WA 4IUUA 2CUFA 1JT6A 3ZXSA 1FTZA 3E0JB 1KHCA 1WHKA 5JLWA 2HL3A 1TWHJ 4XLAA 4F93B 2HKOA 5GAMg 4ZGJB 3G3ZA 3RPQA 4JUVA 2FRWA 1FSHA 2RMOA 3F72A 5HLTA 2LY2A 4C92B 1WJDA 5D4RA 1NYFA 2CW0F 4QIWN 4DPGA 2NOGA 1SSFA 1YITA 4IL6C 2K3BA 2G7HA 4M77B 1SD4A 1WPKA 2E3IA 3PVLA 3RKQA 2KIUA 3RIRA 4Z2YA 3RQ4A 3CMET 3L2UA 4FSXA 3OA6A 2Q5HA 4N4GA 5IYBJ 3T9NA 3H35A 2K5CA 4KN7X 2LNBA 1RIOH 1M90U 2ZNYA 3H41A 1BCOA 5KH6A 5KYNA 3A8HB 7AT1B 1YHQQ 3G2BA 4A6EA 2VONA 3VQYA 3UA6A 5CKDA 1R22A 4EATA 1Q81U 1MMNA 3BLYA 4EMHA 3OOUA 2JUGA 2CFXA 3HGYA 2DQ0A 4CCNA 2CJBA 2YS9A 5GAMd 4JBAA 4LB5A 4IRGA 2SRCA 1YJNQ 3DSQA 4EO4A 3I54A 1W70A 2EKHA 3HTRA 1UJYA 1B7TA 3TEHA 3OYGA 3VQWA 2W0ZA 2CH4A 2KEAA 1M4ZA 4UB6C 3RKXA 1D3BA 4HF2A 3G1MA 2R7DA 3U1DA 1VQNT 2LY9A 3FMRA 1NK2P 2AK5A 3BDLA 4IQ4A 5HGQA 1K9AA 1Z21A 2MSYA 1R77A 1GCQC 5K7FA 3JR9A 1GXQA 3P8VA 3CCRA 5F04A 1N9RA 4MZPA 2KY9A 4XONA 4HX8A 4NQWA 3EPZA 2LMJA 1A6QA 2A3SA 2A69F 2V7FA 3Q5FA 5GAN4 2A08A 3EH1A 4BE0A 1UJ8A 3NTIA 1KQSS 1XQHA 1KMNA 2FX0A 5FO5A 3VOEA 4C5EA 1W36D 4IVNA 5FWCA 4C30A 2PNIA 1VQ5I 2YLCA 4A3FJ 3FC3A 1UG0A 1RAAB 1KU3A 1ENHA 1FBSA 1QBJA 1JKOC 3VKIA 3I9V2 3QNEA 2XGEA 2V1UA 4PSWA 4UP8A 5D6FA 3LSTA 2B86A 3M8FA 1Z67A 1IB8A 4NL2A 2M5WA 3L2VA 4CHUA 4EIKA 3E2UA 1SAXA 3D1NI 3HXZA 4DNCA 1VQZA 1M90C 1NPRA 1QZEA 1U8RA 1K4US 4BQNA 1EFNA 4M3EA 2EAYA 1VQ6T 2AHQA 1ZARA 2L3QA 3V8LA 4W1UA 3BC8A 4M78C 1J0RA 3GTQJ 2W25A 1B70A 4YRSA 1W1WE 2DMTA 2Q2EB 2FVUA 4LOCA 1KQ9A 3CDIA 2CZ6B 1U0JA 4RAZA 2X4HA 4M3BA 2FE3A 2DDAA 2F4IA 3WG7H 2EJGA 4BY6B 1IN8A 1X2HA 2E1OA 3NGPA 5J1RA 3CMQA 1MMGA 1U06A 2PVOB 2JA6J 2XI9A 4DEXA 3S32A 2HQXA 2DETA 1STZA 2JVGA 4H4KC 3GFJA 5C53B 3K9TA 3UPUA 2EZLA 4OIOF 1R6RA 3TU4K 4E7ZA 1R71A 4XOTA 3JRFA 5EZHA 4CCMA 2OV7A 3RDIA 1NJIU 3GTMJ 3R6SA 1T0JA 3J80Z 1T38A 5C0MA 1YJNI 2DMUA 2VJ5A 1DPUA 4KICA 3WTTC 1WYXA 4KIFA 4NHJA 4H2YA 3RR6A 2ZPBB 1QVGP 3OYHA 4CC2A 3E5UA 1O7LA 5GAN5 1YTYA 1IF1A 3ZP5A 3W2AA 4OB2B 3RBBB 1OFCX 2DXTA 3FDYA 1YIOA 3DU6A 2W84A 2LX7A 1UMQA 5GTHC 2HTSA 4XU1A 3CQZJ 4UUTA 1X1AA 4M9SA 1QPIA 2BVLA 1UGPB 4KUDK 2LKXA 2RJEA 1Q95G 2CP5A 5C3EJ 1WNLA 3DBLB 4RKUE 4LFUA 3CXCA 1K8AR 1S72A 1WGXA 5KYUB 2ESHA 4MHGA 5DM7F 3ML6A 3QBYA 1XSVA 4IHYA 1U8BA 5BQTA 2GOMA 2VIXA 3JB9F 2PUKB 2DU7A 2LQWA 3EGDA 4CS3A 5I22A 3VEPA 1JUSA 4F04B 2ELHA 1QCNA 3L7WA 3R0AA 2PMHA 5FROA 4XLHA 1BB9A 2DERA 1W2BA 3ECHA 5GAOr 4PJNA 5JR3A 3S16J 2EFWA 2ARSA 4L5IA 2NVXJ 4F7ZA 1FNNA 2F69A 1HBXG 3QYGB 2X48A 3K70C 2P7CB 3HL2A 2DT6A 4M7AG 3CCQA 2JQ7A 4M6VA 3ZMDA 1WXBA 3K4NA 4HNTA 3I56I 2K5LA 3EDPA 2QDYB 3HL8A 1T08B 2OTLT 1VQLT 3SWNB 1X4PA 2DVEA 1T3SA 2EYWA 3UDCA 1NJIC 3CC2T 3MZHA 4M9ZA 4P96A 2Y30A 2IPOB 3BT9A 2XB0X 4EX5A 3ER0A 2LVSA 4RB1A 2P81A 3TUPA 3WVEB 1HDPA 1I07A 1TWCJ 1AWWA 2L01A 1AHDP 2YT6A 2FBHA 4CCJA 1ABQA 2KRFA 1DPRA 1F43A 1JKQC 1Z7NA 1WPYA 4RDXA 2E5KA 1UEBA 2M0CA 3QRFF 5K5RA 5D7UA 1VUBA 2BZYA 1H4SA 2MBFA 2V1DA 2QQ9A 2ZT6A 1T39A 1WH5A 2EQKA 2PTKA 1B9MA 2EJ9A 1IZ6A 1ZBXA 4XQFA 4JX5A 2KDZA 2XF5A 2OTJI 4DBHA 1YIJI 3FXQA 4ZGDB 1EIFA 3F6VA 2PJRA 3KCCA 1X2MA 2GBYA 1RACB 4HXJA 3K2AA 4J9DA 5K7HA 3A7UA 1OYXA 5LJ5f 4M78G 3AFHA 3IUOA 1ZK8A 2O5RA 4YRFA 2YWWA 4Y3OA 2P0WA 5HNFA 2EH3A 2ECBA 4R56A 3H6ZA 3GWZA 3PQKA 4R1HA 1M2VB 1QCFA 1EKEA 2XKOC 1EVKA 1ZUYA 2BZXA 4DGWB 3WTUC 4G12A 2JTVA 1RI7A 3CCVT 4EMSA 2IG0A 4Q47A 2X3XD 1OI1A 5AIPA 4KITB 2FQ3A 1SFUA 5FD6A 2E5QA 3DWLE 3QYHB 1KU9A 2E65A 3PL8A 3CDLA 4M9XA 2HVQA 5KVRA 1H8KA 4NS5A 2R3SA 3JRHA 3DPTA 5E8GA 2D2WA 2HQRA 5IP6A 4Q5WA 2VJIA 3ZMUA 4AYBA 1D0ZA 3CTAA 5M3FJ 3QPTA 4KIBA 5IOYA 1IXRC 2F5EA 3EUHC 1RESA 2CQNA 3GXOA 2RM4A 3SDZA 4M75D 1X55A 4ASNA 4OWRB 1K9MU 2DA3A 1SETA 1E1TA 3HJEA 2CP7A 3QP5A 1ZRFA 1W1FA 2FZKB 2M8EA 3CMMA 3H9NA 4OAZA 5HS8A 4NC7A 3LOCA 2JS0A 1W7PB 4QT7A 2O0YA 1X2GA 4RTWA 2FRYA 5HLGA 4I02A 3RMQA 3ASOH 2QGFB 4Y91A 4UUSB 1V29B 4D5CA 3SD4A 1QW1A 5FFZA 3UNGC 1YE9A 1FSEA 4BHPA 3DPUA 3TGNA 2K4BA 1TWFJ 1VQ7T 3E7LA 3BR2A 3P9IA 3JCMQ 2MI6A 4FCYA 1EH8A 2L3RA 1WA7A 5IP7J 1R58A 1I1GA 4LB6B 2DIQA 1IGNA 2DZ9A 1Z3XA 6PAXA 1B72B 4M75A 4UB8C 1YFTA 2OAZA 2CO5A 1N27A 2RKHA 3C94A 1WSUA 2MC4A 1EH7A 3I59B 2VI6A 1EF4A 2VWFA 3JRBA 2Y2ZA 3DBRB 1T95A 4BJ5C 5DY9A 4YCVA 1OOTA 4FT8A 2DBBA 1QWEA 1D5VA 1AZGB 2NWMA 1UGSB 3PSIA 1X2KA 3FHZA 1T0HA 2ZFUA 3QG1A 3G71Q 1WHHA 3EFOB 3DTEA 2DU5A 4NC6A 4CH5A 2ARUA 2VVKA 3JV3A 4R8HA 4BHCA 3C1DA 2DZCA 4BACA 3DB3A 3DKWA 4XICA 4R79A 2LFBA 2P4TA 1FEXA 1VQMI 3M53A 4CXFA 5KCHA 2CUJA 3TEDA 2DDZA 4IRHA 1S7AA 1X27A 3MKZA 4K87A 3BG5A 5ICFA 2LNHB 3M9AA 3JCMP 2GIVA 3KZYA 1YOVB 5BPIA 1Q7YR 3ZOBA 4LN2A 1PD0A 5IYCJ 4PJ0C 3DCFA 4KUIA 4HKEA 1IHVA 1OPKA 2K40A 4ESRA 2A6TA 4RS8A 4Z88A 3MFKA 2QHSA 3LNQA 1E7OA 1ZR4A 1SERA 2JM9A 3C0CA 2JA8J 1NPPA 4QPOA 4C0ZA 1S29A 2XV4S 1OULA 3J80K 3PMIA 3HP9A 3M3YJ 2LRQA 1SRMA 5CVRA 5TRDA 3GNGA 1G5VA 3HSFA 1X4OA 4LDWA 2XGXA 4MQ9F 2DVJA 3HXVA 1USYA 2HBPA 3HSEA 1UG1A 1NK3P 5GAN3 2VXDA 1E0EA 1QLYA 4C92D 3CCJQ 5IPAA 4IHWA 2VOOA 3CCLI 4M6XA 3ZQHA 4VUBA 4Z02A 4ABZA 1V5FA 4L9VA 5K7ZA 4ZTFA 4HVWA 3DLLF 5DCFA 3VS1A 4HAMA 3MEAA 4Y52J 3EG0A 4LDXA 3V7CA 3CCUQ 1VIEA 3F21A 4BQQA 3FWEA 4GBQA 2WY7Q 4QWQA 4LVMA 4XTWA 2XDDA 4HLYA 5KE3A 4UNOA 1PYSA 3CJRB 1NJ5A 1X2NA 1I39A 5IT9Z 2QTVA 2RJCA 3TREA 2QBYA 4C92A 2O8XA 2VE9A 2ME0A 4HDVA 2WADA 2PJPA 2NVQJ 1Y7XA 3IWZA 3QPLA 4BEHB 3THKA 4CICA 2PLYA 5I21A 4M75E 2G4CA 1ZQ1A 3TP0A 3C4SA 3BR1A 2H1KA 2WAQA 4KNYA 5EJCA 5E3LA 4Q48A 4IUTA 3LWFA 2KQRA 2F5TX 4BYYA 4N0AA 3RI4A 2LCCA 2Z5UA 2QQRA 4FT4A 1I5ZA 1XCVA 4BKXA 3ZR8X 3JW4A 5D6YA 4L0ZB 4C5HA 1NEGA 4FIBA 1WHLA 1RR8C 3OSFA 1TQMA 4YP0A 5ERIA 2R92J 2XGCA 1IHWA 2DT5A 4FYYB 1YI2A 2VKVA 3HFVA 1QF6A 3TMOA 1K76A 3M8JA 3F8FA 1IC8A 4Z6YA 5GJWB 3F8CA 4PNOA 1Y56A 3LC0A 2RN7A 2ZPFB 3MF2A 2DJZA 4AFSC 3JB9I 1U3OA 4E7IA 2E1MB 1HKSA 1RRJA 4RTUA 4U0VA 1PRMC 4XTVA 2DTHA 1FY7A 2W24A 3KYLA 3G4ST 4A3KJ 4ZNXA 1ULYA 4Z8AA 2JA2A 4XTXA 4B09A 2VUMJ 2E41A 5IHNA 3DEEA 4V2FA 3OSGA 2WB1N 2VC0A 1VYVA 2STWA 4C0DB 2STTA 4KH1B 3QWYA 3JCMe 1GHCA 1S72T 5CVUA 3TW7A 5J1UA 1SPKA 4YIIA 4M7AF 2FU4A 5M5WJ 3PFIA 4XIDA 2A8EA 2A37A 1TUDA 2YU9J 1RUWA 4R55A 2DD5A 3BG6A 4S04A 5FLXZ 1IRFA 2W10A 4YTLA 2W85A 1VQNQ 1M90R 2R58A 2ID6A 2VKEA 2CV1A 2IPQX 3QOEA 1UHFA 5F0FA 1JEGA 4ORZA 2DODA 2NLUA 1SRLA 3ZQFA 2L7ZA 4XKBA 1E3HA 1KQ1A 3HOYJ 5B66C 3BPXA 2EV6A 1Y0NA 3DB4A 4JZ4A 2EYXA 3GVAA 3TOBA 1Q81R 3QYBA 4JYKA 1GVJA 3CCEQ 4OB0B 2CRGA 2O8KA 2ADUA 3VS2A 3CCUI 2DL8A 2ZT7A 4TWAA 4P75A 2QEXQ 3DTKA 3F8MA 3VUZA 1RADB 1XG1A 4KIGA 1PP7U 3JCMg 5E1XA 1VZ0A 5LJ3h 4AD9A 4GFBA 1UELB 4CS2A 1CKAA 2KL4A 2M4KA 2DJNA 2C0OA 2OA4A 2Q2EA 1YJWT 2Z1DA 3BY7A 3GLXA 5GAOl 4C92E 3QJYA 4YELA 3E19A 1IO6A 4BDZA 4Q6GA 1Z1DA 4JJNK 1UECA 1U9NA 1W5TA 4M77E 2YUSA 2VASA 2R7QA 2EL9A 1N9WA 4HWTA 2HOEA 4II3A 2RHUA 1BU1A 4WF2A 2J6OA 1ZQ3P 1XMXA 1RUOA 1J75A 1VQ6Q 1PKSA 1JJCB 4M7DF 1U9OA 1EQRA 4S0HB 2QK0A 1O4XA 3FX3A 2R5YB 3S3OA 4C0FA 2BV6A 3PZCA 3O3KA 1UHSA 4J8OA 4BGDA 2ODRC 3CD6A 3BE3A 3HXLA 1AWOA 1IRXA 4OIPF 2MH2A 2O88A 4BE2A 5HVQC 3CEYA 3M57A 4HV5A 1G59A 4RM2A 2VKNA 2AT1B 4FM4B 5DTDA 2VKDA 2XPUA 4AVZA 2JJ9A 2CGPA 2D8HA 5M5XJ 3HGGA 1M30A 4XRSG 1NJ1A 2HQEA 5BMZA 5AYFA 3QDFA 4L9TA 1MV3A 3WE3A 4BY1J 4XR6A 2CT3A 2ID3A 4MGRA 1OZ3A 3VYGA 5HS9A 5LD2C 4JLIA 3OW2A 3LSQA 2R57A 2FMYA 1E17A 3IP4B 1XNIA 2KDOA 2L4AA 3I4NJ 5M3MJ 4ZC3A 3GFLA 1T56A 1JI8A 1TS9A 3X24B 2I10A 1S5LC 1HK9A 3IH3A 1MGQA 4O6JA 2FQ4A 3CLQA 3Q0UA 4YFNF 2FNAA 2RPNA 4M7AB 4K11A 1OV3A 2DA5A 2M45A 5KYUA 3N97A 1YP5A 3WU2C 4CCKA 5TISC 2RREA 2Z16A 1MDMB 5LHGA 2JT1A 1YWPA 3M0QA 1JJ6C 2DM1A 4KR3A 2YHTA 1Y0MA 2NNNA 1OU9A 4CH3A 2EYQA 3A7AA 3JCMW 3CCEI 1MBFA 3M9QA 2O03A 4AVPA 3C2HA 4QVDA 2WSEE 2YXYA 4QQDA 1PUFB 4KT6A 1M1EB 1NJIR 2DEQA 3TKYA 3QAHA 1YW8A 3SFMA 2QEXI 2ZNZA 1R1UA 3ERRA 2R0QC 2VBWA 3QWLA 2V8IA 2Z99A 2X6WA 4QQ6A 1TL8A 2M0OA 3A8OB 4RTXA 2C0TA 1H4QA 1RLPC 1KD1C 1PJRA 3SWNA 3JAMZ 2CV0A 1U6GA 3A5YA 3K7AJ 3W3CA 3L09A 4PG3A 4NB5A 4XORA 5L3BA 2E60A 3BR6A 1LDDA 1FC3A 2RQTA 5EG0B 1VQKQ 4LVKA 4BXXJ 2O9VA 2EIKH 4PL6A 1QGPA 4EMGA 3S17J 4LLNA 4H02A 1V76A 5CJ9A 3E9IA 2D9TA 3CCLA 3BZKA 3RCOA 5HS7A 2OTLQ 4JZ3A 1VQLQ 5A0LA 3S1QJ 1BR4A 4AMCA 4M7DB 2LC2A 1QZZA 5I2SA 3KBGA 2X4JA 3CC2Q 4HWRA 5IT9K 3QWXX 2XMFA 2NUTB 1UFMA 2XVCA 1KYWA 1LVAA 1IN6A 3FBNB 2HOSA 2CG4A 1OPCA 2RN8A 3VS3A 1BKBA 1TG0A 1VQOQ 4ON0A 5FB2A 5FD5A 2K2MA 5FU7C 3FXRA 2Q7HA 4HPQA 1OCZH 2MABA 4XRFA 1M9SA 2Y48A 2RNAA 1X58A 2ZPIB 4HX7A 4TVYA 3QYFA 1MBJA 3W3SA 5IHIA 5F0HA 2BVMA 1FX7A 3HBLA 1J59A 1M2VA 2XF7A 1ZGAA 3C2GA 2XSJC 3CCSA 1X3UA 3HFZA 4II2A 3SYTA 1CSKA 3E9FA 3I5SA 4DOWA 1R5HA 1JJ2S 1YJNT 1OYYA 1JJ8C 5D5VB 1JGSA 4V2GA 4ZYAA 4WXHA 5GAGJ 3WTWC 3GW2A 2AZVA 4MFEA 3TBIA 3TSZA 4H2XB 1W0TA 4C8QC 1REPC 1VQPQ 1LPQA 2GF7A 2DA1A 3NETA 4CA0A 4L6V5 4EPCA 1WJQA 1KQ0A 2QWWA 3HFOA 3PQJA 1BA5A 3REUA 1H4VB 1UJ0A 1PNJA 2ED0A 3RNJA 4YFKF 1TSFA 2MC3A 2NS7A 2F5FA 2J6KA 2QA4I 1I5LA 1BI0A 3MP6A 2P7VB 2X1CA 3I55A 2KBTA 4G6QA 3CCMA 2L9VA 3MEVA 3WE2A 4LLLA 1K4TA 2Q0OA 2F5KA 2I2LA 1K79A 1MW7A 3M7GA 1WIEA 4YPFA 2M3AA 2JTMA 3LQQA 4XLCA 3PNWC 2CZ1B 2BHYA 4XTUA 1RLQC 3LSSA 4LMYA 3PVQA 4UUSA 2XUBA 2LJ3A 1TP4A 2AO9A 3ABUA 1ZG5A 4B4CA 4J9FA 3C2BA 4ESJA 5CR2A 2JPBA 3H3ZA 1YWOA 2QSGX 3TEEA 3HPHA 5L23A 2VYTA 2ZXIA 3VS7A 1XJWB 4AFZC 2X9HA 1VQKI 5F08A 4BI8B 2GM4A 4YRJA 4I98B 3ZEHA 1O3TA 4B9XA 1SHFA 3I59A 1F5TA 2XAJA 4BS9A 3EQLF 4OB3B 2DNUA 3K69A 4HBLA 4ZTJA 1WDXA 3C3WA 2BW3B 3VS6A 2OTLI 3OS5A 1IO2A 3OYMA 1X43A 3IKMB 4JDSA 4OLFA 1RR7A 4EM2A 1S8NA 4AFQC 3I56T 1WX6A 2HYJA 5KYWB 3EFOA 3DKXA 5IYDJ 1WHJA 2G0EA 1GV5A 3DF8A 2R5MA 2XKPA 5E17F 3AG4H 4C9YA 1ITYA 1XGMA 3JSPA 1VQOI 1NBEB 2ALYB 1K78B 5FLVA 1K9MR 2AXLA 3HRKA 2GA1A 1H88C 2LZ6B 3UGQA 3GZ5A 3IH2A 4HVCA 2SEMA 3H9JA 2NS6A 2X4XA 4FYXB 3O8GA 1J7KA 2K2VA 1LJOA 1WXTA 2MYSA 2LYCA 3L2QA 3MKWB 2OJ2A 5A2QZ 1MUZA 2PMEA 1SMTA 3HC7A 4HVUA 2IVWA 3Q0VA 1FOXA 3VODA 4ZZLA 1G6NA 4PGHA 4ESFA 4QQGA 2AKLA 4DBRA 1NZ9A 2LDMA 2Q7GA 2IGOA 2OTJT 3LAPA 3F23A 2EKOA 1YIJT 3S2HJ 3PCOB 4PJOC 3VB2A 4WJ4A 3PO2J 3CCRQ 2DL7A 1VQPI 2P5VA 1W5SA 2FXAA 4Q5SF 3HOXJ 1ADJA 4FETA 3ZQQA 2NYSA 2UWMA 3QYEA 4P9UA 5BNGA 5GAMf 1YHQA 1RETA 3WU1B 5HK0A 3PM1A 3TCJA 2OUMA 2CSOA 1OCCH 5LGNA 5LL6S 3KX2A 2QENA 3ZGKA 3H92A 1GDTA 2P0QA 1UHWA 2RAEA 3AT1B 3CMAA 3QZ5B 3WODF 4EGZA 4YEJA 3EFSA 4L87A 1B59A 2O61A 4A0YA 3ERED 5F0CA 1O57A 3V42A 4HEA2 1HJDA 3REOA 4DYQA 1Q86U 3R60A 4BWAA 1QP3A 1N77A 4IO9F 1WQ2A 1Y07A 2EFNA 4PFZA 4XSXF 2KIMA 4BEHA 1OU8A 1R36A 4P72A 2F6CA 3KZIC 2R7TA 2P0PA 5B3SH 2CZ0B 5E3MA 2MD5A 2K79A 4C8QG 1YITI 3LGLA 2R4GA 5LHIA 3QZ9B 2CSIA 2L7MP 2LJ0A 1X1CA 2DPUA 1ADYA 4OGEA 3H0DA 3RQIA 4V19K 1FYFA 2ZIOA 4U87A 2JNGA 3F8BA 4DQ2A 1RIQA 3D7SB 1BK2A 4YRCA 1H3HA 5FRNA 1Y6IA 4YIRX 3JAMK 2TRTA 8AT1B 1KC8U 3I58A 1FYKA 4U0YA 4BXUA 1B76A 3HKZA 5J8FA 4XEOA 1E6HA 2EGAA 1KQSA 2DA7A 2M16A 2W7NA 11ASA 1K8AC 2EZHA 2ROTA 2JMAA 3HKSA 5TGTA 2DIGA 2K57A 1TH7A 5C44J 2ZNIA 1PD1A 4QPQA 3QO8A 2ECCA 3I5RA 4NCXA 1F1ZA 4M75C 1Q82U 2FZGB 1YJ9A 1GLNA 1KU7A 1RKTA 1FP2A 1QP2A 3K4JA 3AL0B 3O6BB 2CREA 5GMKe 4BJ6C 2PUOB 3RDVA 1LNXA 3TEGA 1VQ8A 4RMNA 3G6EA 2VE8A 3BG9A 2Y75A 4E7KA 1G5HA 1N5ZA 1IZ1A 4KMFA 3LA2A 3NEUA 5H6RA 1NH3A 1SD5A 1XOVA 3CPWS 4CSWA 4LG3A 1DQUA 1VQMT 3HRIA 3GMEA 2W57A 3JRDA 3CCRI 2A36A 2ZPGB 2MA3A 1TQIA 1IXCA 1AWXA 1YX5A 4M3FA 1B4AA 1ATIA 2RNJA 4F92B 1FTTA 3RPUD 2KVQG 1ETOA 3MN2A 1PKTA 3EYIA 3S8PA 3AKZA 1S72Q 3M07A 5DM6F 3QXEB 4KT0E 2GWRA 2RVCA 3WHCA 4DBQA 1TWBA 2VBXA 2HPMA 2E1CA 1HKQA 2J3MA 3NENA 4NC8A 3A7RA 3PMTA 2E5AA 2XPVA 1X01A 3KYDB 5LJ5e 3OSSC 2L7FP 3DTIA 2XAFA 1K7AA 5GMKl 4H0EA 4GGGA 2L2OA 5IH2A 3OOPA 2HQ5A 4E6RA 3BZ6A 3MCZA 2HR3A 2K3FA 3CZ6A 1RAFB 2YR2A 2UXNA 5LHHA 2V9PA 3SJMA 3ASNH 4B8XA 3RPUA 3Q3SA 5FWBA 3CCLT 1KC8C 5JVGF 1U1SA 1E22A 2DAQA 2BHZA 2NXNB 1XC5A 2RQRA 2ZCWA 2MH9A 3HHTB 1ZG1A 4ZZDA 1Z05A 3H1CA 4PJOG 1USYC 2DK8A 4Y92A 5CKHA 3GX4X 4WCIA 2E5ZA 5CQYA 1JJCA 2LDUA 2KISA 4BAYA 3C12A 4FX0A 3HRMA 2HWVA 4JS4A 1OZ2A 2R5YA 5C51B 4UV9A 4CYCB 1WLEA 4KISA 3CJNA 3COAC 2PVGB 3BW1A 3LSMA 4XU0A 2J06A 2Z3YA 2QXFA 2MPXC 2HDWA 2DF6A 3OBYA 2LCLA 3FBIB 4CRIA 1R4NB 2ZPEB 3OL3A 2AIRB 2O7OA 3EGXB 1OQYA 1GVDA 1IRZA 1OX9A 4XLPF 3P7NA 4TVAB 1TW3A 1B1BA 4Y33A 3OYKA 2X4YA 4DYRA 3GO5A 4M7AD 5GANe 3CLOA 2XPWA 1W2BP 4KBMB 2EIJH 4C92C 2E7WA 3Q9VA 1WI3A 2L3SA 4QLCU 1XGOA 3HIFA 4A93J 2ZCEA 2FRHA 2FB7A 3I35A 5DLQE 2QQAA 4F7UG 2XTIA 2Y0MA 5F27A 2KP6A 5HY6A 4M77C 4CH4A 4G9YA 2PMUA 4PFPA 4CS4A 3H3UA 5GAOq 5J26A 4EVIA 4C3JJ 4FQGA 4KGVB 5LFAA 4JLGA 2LQ8A 2XHKA 5JHFA 2FZCB 2YRDA 1X3ZB 5EGOB 4KYWA 4N0AC 2JRTA 1R0BG 5HKCA 2HD0A 2IA1A 4HT8A 3PNYA 4P3PA 5J47A 3OYBA 4M7AA 1BBUA 1MGTA 1T6SA 3RYRA 2HU9A 4XTYA 1BBWA 1I4K1 5J39A 1K1ZA 1Q1HA 1Y96B 2IY5B 3NTHA 1MDMA 3MEUA 2QF7A 3JSOA 1U3EM 1B7YB 1D1BA 2RHZA 1FYLA 1S72I 1NYQA 4UPAA 1NJ2A 4N9IA 4HF0A 5A2QK 1PUFA 2LQKA 5E79C 2RQUA 3BZCA 1K0XA 2HMAA 1R00A 2CSQA 2H6CA 2QQBA 4IKFA 3AHUA 3H3VK 1E1OA 1QQJA 4YDQA 2HEOA 2K86A 2ZSIB 1WJRA 4RTYA 1JU5C 1P4XA 3B73A 4Y13A 4M78D 5GP9A 1MMDA 4L5GA 2LTPA 3K2ZA 2CW8A 4FT2A 3MQZA 3LSGA 4J6YA 2QQSA 3GTLJ 3CCQI 2WWYA 2V6CA 1ZSZB 1OCOH 2RD1A 2ZJQF 2V1XA 2YSRA 3KLOA 3S1MJ 1ONVA 1U5SA 5JVTA 1RNLA 2P0LA 3GTKJ 1K6YA 2YRVA 4XK4A 2UZKA 2E64A 2K85A 1B3QA 1FMKA 2MD0A 1VI0A 4RB0A 1T8IA 5D8KB 2QKMB 1Y1WJ 4GY5A 2MFZA 2IT0A 4OAYA 1ON2A 4AG2C 1JHHA 3RMSA 3CCUT 2KXCA 3VPRA 4OINF 3FF5A 4IOAF 2L02A 4ZTUB 4GRIA 5FKOA 1NLOC 4QKUA 3FMSA 4AM3A 4KMUX 3T5XA 1LOJA 2JN6A 3J80E 4M7DA 4D8DA 3KP6A 9ANTA 2WA0A 3GYHX 9ATCB 2NUTA 2EQIA 3LSJA 2HOTA 2ZXWH 4FW1A 2LNVA 4JJDA 1Z9ZA 4P74A 3ZMSA 3OR2C 2JVVA 3BY6A 4P75C 1D8KA 2QVOA 3HB9A 3TSWA 1WJAA 2ISZA 2ABLA 1MD0A 1PVEA 2EFIA 3G1LA 4CUGA 3HY0A 3EFRA 3ABTA 3IAM2 5BOXA 2FOKA 2LY1A 3FKJA 2M51A 5HNHA 1X6OA 2FD5A 3IKLA 3TOAA 1PYSB 1IN4A 2F5VA 2JMWA 4HDUA 3LSHA 4BY6C 2QBYB 1I50J 1FT9A 1EX4A 2DW4A 3IWFA 2Z2SB 2HVSA 2LH9A 3EG3A 2ZXFA 4HX4A 3KFUA 5IXBA 2R93J 4JRKA 1MBGA 2NAZA 2DPDA 2DD4A 3M0UA 1XSXA 1WJCA 5K1PA 1XSDA 1O75A 3MF1A 3R0JA 1SFEA 3CBMA 2KZGA 4H2XA 5LJ3e 4L5EA 4M7AE 4BW9A 2M1BA 2VV5A 2DE0X 4UUVA 2L9NA 4C2UA 3NWSA 3H36A 1TNSA 2CP6A 3BJAA 1FWZA 2FEIA 3G71A 2K4JA 5HDGA 3HXUA 2PX9A 1DU0A 3GCMA 4II1A 3NARA 4XKWA 1LEBA 3HY1A 4IJAA 4J9CA 4HRIA 1LE8B 2H8RA 3VFZA 4CDGA 4J00A 3DLMA 4A3MJ 3IC7A 2P4RA 1IN5A 4ELYC 3K1PA 2DOEA 3KEQA 5M9OA 1BM9A 2J3LA 4HT9A 5ILVA 1MJBA 4M77G 3CC7A 2RQVA 1MMSA 3NRVA 5ED4A 3L00A 1JTYA 1Z9CA 4HWOA 2G9WA 3H0IA 3NFCA 2QASA 2QUFA 5E3OA 4M74A 5LEJA 5CQEA 4IUVA 4H2WA 1S7EA 4BQOA 2R7OA 2FMLA 1P7IA 4OMFB 2W00A 4L59A 2R7FA 3CCET 2ZO4A 1XS9A 4XTZA 4IF4A 5KCMA 2D8JA 4TQFA 2D1HA 3QPSA 2BW3A 1TC3C 3CJQB 4Y7NJ 2QEXT 3K10A 3VQVA 1KMMA 2A5YB 3HXXA 2BY0A 2QYOA 2R7RA 1WZOA 1MIJA 5KYWA 3GLLA 2R7SA 4M7DE 1QVFS 1SFOJ 1A04A 3CCJA 3H9QA 2GTJA 1M3BA 1TUGB 3EETA 1SFXA 4N4OB 5BS6A 1N25A 3HOWJ 2CH0A 1NG2A 2KQWA 2ALYA 2NVYJ 1K78A 1QVGS 3HRSA 1M1GA 3KUFA 4Y28E 2V79A 4TVWA 2VB6A 3H0FA 2H8WA 2QGUA 3RACA 1YI2Q 2JRMA 3SWNC 1RAHB 1M27C 1VOMA 1XMAA 5GADJ 3MEXA 4YCWA 3I56Q 2DL5A 3BFMA 3HFNA 1W4MA 3REXA 2HAXA 1Q81C 4IUQA 3ULQB 1G2BA 5CCAA 1H8AC 2EYYA 2ZINA 4F55A 4E7LA 1AKHB 4F16A 2V9VA 2KK4A 2RHIA 3GP8A 4G85A 3VYTB 1BYMA 3HG9A 5KHDA 1R49A 1NG6A 5E3NA 1K73U 1JUMA 4D7MA 2VUBA 5FJ8J 1WU7A 3DQVC 2K3PA 3I9QA 2CJJA 4JPBW 2H3EB 2MAMA 3PCOA 3SHWA 5B5EC 3MMYB 4WK8F 3RYPA 3VYHB 4J9EA 1B34B 2CDTA 1YCSB 3WTXC 4QVCA 2O31A 3ISPA 5D4SA 4UVAA 1IDYA 2EVRA 3NQOA 2P6SA 1DDNA 3FISA 3LFUA 4AU7A 2HQHA 1X69A 5KYXB 4PLLA 1QVFP 3FXLA 5I2MA 2OTJQ 1HQCA 3X2QH 2O01E 4BI4A 1YIJQ 2I8DA 3KP3A 3CMEA 2XRLA 2L0KA 5CQXA 1ETWA 4C8QB 4XK8E 2LREA 3SEQA 4XLEA 1ZSGA 4KRTA 4DJAA 4YRTA 3R4KA 3REAB 2HL5C 2RV8A 2JW4A 1YS7A 2KZVA 3C18A 2VQHA 2EPFA 2V8KA 2ZMEC 3BR0A 2BIVA 1YFNA 4XLFA 2KT8A 2FUG2 4RTZA 4YRRA 2ZZGA 1GFCA 2DOAA 2PU9B 5FKNA 2QA4T 4XRMA 4EMKC 2GZWA 3SB2A 5GAOm 4ZDLA 5CVVA 4OMOA 1UTIA 4KUMA 5CIUA 2DXUA 5HCKA 4HLXA 1G4DA 1ZN2A 4F7UF 5C4JJ 1NNHA 2KRSA 4JQFA 2WV0A 3A1PA 1X19A 3QUIA 2DCEA 4CI0C 3H0GJ 3S15J 5A0DA 1AWCA 1QHGA 4OU0A 1C0WA 2FPDA 2RI2A 3HOUJ 3M0TA 5GAN7 4XN3A 5L3CA 1YGBA 1H9GA 2GNCA 2DXCA 3S3NA 4XEMA 5C52B 2BE9B 1K73C 5IHKA 4U88A 1WJSA 4H2VA 2L89A 2Y4YA 3CD6Q 1VQKT 4BQAA 1N75A 3VYRB 2B9SA 1AEYA 3OD1A 1YI2I 4YIFA 2E36A 3LFKA 1WCMJ 2HS5A 2P84A 1QWFA 2C06A 2I5UA 4HQMA 3CDHA 1ZUUA 1QCOA 4P5NA 1ZAOA 1XGNA 1BR2A 4D0PA 2HZDA 3QPHA 4KULA 1Q86R 5DEQA 3C7JA 3M4GA 1U5TB 2ZR3A 4BD3A 3WTSC 5HK3A 2AQEA 2KLOA 1LPLA 4PCQA 4J9GA 2BE5F 1J5WA 1F9NA 4XOPA 1VQOT 1B07A 3HPWA 4ZN3A 2DX1A 3A5ZB 4P71A 4UC4A 5GJVB 3MQ0A 3DEUA 3I53A 2QG9B 1VQ4I 1ZX6A 1QVTA 2LSOA 2IXSA 3AG1H 4P55A 2UXXA 2XF6A 5E20A 1YNZA 4M6YA 2LLKA 2YUOA 2F5DA 4A3LJ 2E6ZA 4C5IA 3RZDJ 2EINH 2R5ZB 3X28B 1KSWA 1VTNC 3E6DA 1T0FA 4XMYA 1SG5A 1FYNA 3DU5A 3A8GB 1IXDA 3R6NA 2RDPA 1KC8R 2OQRA 4IOCF 2JUFA 2OZ6A 2D1XA 1VQMQ 1TTYA 2QTXA 1V3FA 5EEHA 2J5OA 3B6AA 2AHJB 2L9SA 3HOZJ 3P8BB 1ABOA 1X54A 1D1CA 4XKCA 4B9WA 3K4CA 3LL7A 3LA3A 4HA8A 2I4OA 2WACA 3RERA 3ICAA 2P4WA 3SDBA 1GT0C 2HPIA 1ORKA 2FSWA 3QO7A 4CH6A 2I4NA 3ECOA 1VQPT 3RF1A 3F0CA 1NLPC 1Q82R 3VYSB 3HFZB 3GTJJ 1JT0A 4E4HA 3I4MJ 4JK1X 2HCKA 4KGXB 5E3IA 2DMQA 4KA4A 5KNLA 3ZQLA 3OB9A 1T33A 4M72A 4IEJA 1SRYA 3NTKA 4YFXF 2J5PA 2XICA 1JB0E 2L8DA 2I4LA 1MZBA 4BDYA 4G94A 3VDXA 2VOPA 1A0NB 4IX7A 2ZXHA 1X1DA 3IALA 2X0LA 2PZ1A 2LT1A 3U9GA 3QDRB 2FG0A 3PTAA 1Z6TA 3W2VA 4CYCA 1N9SA 2HKNA 5EEGA 3EH2A 1NYRA 3G73A 4YRVA 4F7UB 3O2PE 4LE9A 2FBKA 3GTPJ 4PZJA 3EUAA 4HWSA 3CCLQ 3KP5A 2DJIA 1IV6A 1AOJA 4FU6A 4RGUA 2DLLA 4LD9K 1PHTA 3VU3C 5E1ZB 1LFBA 3EGXA 4AUXA 3GZ6A 3CD6I 4TVAA 1WHGA 1R7JA 1IJWC 2HGCA 5GTIC 4AIDA 4RCCA 5K1XA 2KRNA 1KYZA 2RHXA 1ZG3A 1GUUA 2E6NA 2QZ8A 1RI0A 3L2RA 3K6GA 3ZMZA 3BP8A 1YITT 2KT0A 4A69C 2GLOA 1RC9A 1OYWA 5GANf 4MO7A 5D5WB 5CO7A 2R7XA 2EYZA 4P72C 3JCMh 1E24A 1OCPA 1O3RA 2O4XB 2G7UA 4M73A 1E2XA 3DEWA 1YFRA 1PSFA 2IAIA 2GOXB 1MBHA 1OYIA 2GXGA 2EPDA 2DA4A 2NOJB 4E7SA 2YDLA 5EGOA 4UV8A 2JUCA 2L4MA 3CCSQ 3VS5A 2ZFWA 2RC4A 5FLXE 2VPRA 2RO0A 2E2IJ 2E5NA 4EGYA 4PJMA 3A0HC 1SKUB 2LCSA 3U21A 1FP1D 2BGCA 3L1AA 4JP0A 2F4OB 3JB9G 2EFQA 3SFIA 1Y96A 2IY5A 2L9RA 1YLFA 5CPRB 2X1EA 4EV0A 5EC7A 4G7ZF 5L3FA 1B7YA 2RH2A 1KZHA 1VQLA 4WTOB 3IG2A 3Q9SA 2KYBA 1FIPA 4AT1B 3I4PA 4J15A 3F9KA 1LVKA 4B48A 1BW5A 3VSLA 3CC2A 2VGMA 1GBRA 4D6WA 3E97A 2NUPB 1R1VA 3CC7T 2E1MC 2HI3A 2M30A 1OISA 4WJ3M 2B0LA 1FBUA 1BW6A 1W66A 1OJLA 3E9GA 1TXQA 2RF0A 1PCXA 3JRIA 4G7HF 2HZYA 3I55Q 3CCMQ 2YPRA 1P4AA 5GAN2 4ETSA 4L9NA 3C95A 3R07A 4QVZA 4FL6A 3G1JA 3RSNA 5HDNA 3UATA 3CCRT 3DPLC 1NE8A 2KIQA 1GFDA 1ZH5A 2PMZN 3S6WA 2QI2A 1ZSZA 1VYTA 5KYYB 2M9HA 4XLNF 4K88A 4R0KA 4ZTZB 2VQGA 1Y8QB 1NYGA 2H94A 1OCRH 1K9MC 2HKQB 1SEUA 3MP8A 1ZELA 3HSRA 3V7RA 2LMDA 3MZ8A 3HUGB 4ZYGA 3KLNA 1QQIA 2F2EA 2LT4A 3AAFA 4A2UA 2RQWA 3QU6A 3PFYA 3KETA 1N8RU 1Z91A 1R9TJ 1I5OB 4AIJA 1ZGWA 2M9UA 4BBRJ 2DILA 2C6YA 4W97A 3OMCA 2V8JA 2DAOA 1AA7A 2ODRD 1USSA 3OWTA 5GAMe 4OMPA 2B7EA 1YYVA 1PP8F 1D1AA 3HTZA 1R4MB 1TWGJ 5JI6A 4LDUA 1JJ2A 2F5CA 1DUXC 4OMMA 5FFXA 4UHTA 4N4IA 2IS1A 2XAHA 1H9TA 3VJPA 2YUPA 3CCVA 4LIUA 4KGZB 3KFVA 3PIPF 1N78A 3HRUA 3FK7A 4MLOA 3BTIA 2LP0A 3VRZA 1Z6RA 1R8OB 1VQ9A 4MZTA 4JOMA 1YN8A 3QODA 3P8HA 1WI7A 4J6WA 5D6EA 3KP4A 4EJUA 1YBYA 3J7AY 3FXMA 2XDBA 2M02A 1Y71A 1RAIB 3CCSI 3ZQIA 1LNWA 2LP5A 4L5JA 2CP2A 1XMKA 5EF6A 2EW3A 2GFUA 3M4QA 3S1NJ 2P0KA 2WV1A 3JREA 2MK5A 1D3YA 1L3LA 4UVCA 2P5IA 1WJ5A 4G6TB 1BR1A 2IRFG 1LFPA 3BJUA 1BC8C 2M8GX 4UP9A 4U7BA 4RQFA 2ISYA 2MWOA 1HSJA 1TLHB 4IIMA 5LJ3f 2AS5F 2EWNA 2DLPA 2IBDA 1H4TA 2E35A 4HV6A 4CC4B 1VQ7A 4DOVA 3ZRGA 2Y0SN 3RUXA 2DL4A 4TTVA 2JN0A 2Q8KA 4E47A 1M8VA 5H2FC 2DYRH 4RUGA 2RQPA 2OQGA 3MKYB 5F6FA 5DYMA 2E1NA 4FE4A 3K4LA 1YCYA 2LKPA 3FZVA 1LE8A 1N8RC 3P8YA 4B6MA 3JAME 2OC6A 3I55I 4GYGA 1FMWA 3CCMI 3OMYA 3ZMTA 5L3EA 3FEOA 2E12A 4RAFA 1QPMA 5LLQA 2KGTA 1TNTA 2DQ3A 1IV8A 2XIGA 3A74A 1YX3A 2V6EA 2HSPA 3CMAQ 3VYUB 1UGQB 1FLIA 2CZ7B 1X56A 1U1TA 2VC8A 1PG5B 1KU2A 3IRQA 3PIOF 2K27A 4ZGEB 1G3SA 4MQVA 5C4XJ 3E9HA 2L3DA 4M7AC 1VQ4A 1J2XA 2OJED 1OEBA 3ZL7C 2ZPHB 3MEWA 2XHCA 1M2OA 2KMTA 1BJAA 1DP7P 3OYDA 3JRGA 4ELZC 5K5QA 3P9CA 1V1CA 5LGUA 1D8JA 1BC7C 3CUQB 4O5VA 2AQFA 5D5UB 4JX4A 5J6XA 1HYOA 3N05A 2KE9A 1SESA 1WYDA 2MLKA 3HPGA 2A05A 2F2WA 1X1BA 3CCQT 4CYDA 1QVPA 2CYZB 2Z33A 2OAWA 3HOTA 4P9FA 2TDXA 3FXJA 3Q1JA 4A3DJ 2BEOA 3MPUB 1MBKA 1O3SA 4KFCA 3J81E 5BPDA 4C2MJ 1ZHFA 2F48A 1K4SA 4WCGA 3M0RA 1I6HJ 2LVMA 3BTCA 1G3WA 3W6JB 1WQ7A 3M58A 2K7LA 1UB9A 1AKHA 4LJZF 3BDDA 1ZHIA 3TQ7P 3B02A 2GIZA 3ASKA 1PRLC 4KR2A 2OX7A 1YJ9Q 2X6XA 1UAAA 2WTEA 2EK5A 2XAQA 4M78F 3F3XA 3BTJA 4C8QD 2P8TA 1VQ8Q 2XK0A 3G6EQ 3OL4A 3JCMc 4X34A 4Y15A 4J19A 3JB9H 4M7DC 1SMYF 3OIQA 3GBGA 4AC0A 1B34A 4YREA 2A5WA 5DD8A 5IY5H 1TU0B 3MWMA 2QAZA 3MP1A 1VYUA 3WXMB 4P74C 2CUZA 3EAEA 1WHMA 2PMFA 4ENMA 2CUDA 2DBKA 5JHUA 1SAUA 2TCTA 2Y9YA 4ESBA 2GFAA 3QJ6A 3V4GA 1Q1VA 3SFZA 3JCMd 5KYXA 1EFWA 3A02A 4XL9A 4AFUC 1YHQI 1KONA 3VSKA 2EZKA 1XN7A 3SEZA 1W4SA 1PUEE 4C8QA 5CKBA 2KAFA 1KQSP 4RMFA 4I0AA 3QIIA 3F70A 2XSDC 3CMAI 1JE8A 3GEZA 1Y1VJ 1JXSA 2ZIMA 3PJRA 4HCCA 3NELA 3CF5F 2KYMA 5GMKm 2HSEB 3JRZA 3ZN0A 5DM7R 2KXDA 2HFHA 3NHNA 2DT7B 2ZKZA 3LSPA 5EEAA 2KRHA 4JX6A 3FXOA 3HHHA 4E7JA 4RG8A 1BI3A 2DA6A 3LWHA 1TW2A 1HOMA 1JBMA 3EG2A 2L0AA 4MEYF 1K73R 2FA5A 2HBWA 1GXPA 1MBEA 2QHUA 2VBYA 2DA9A 1SVOA 2K5IA 4A5NA 2COMA 3IRRA 1MSEC 2P6TA 4ATOA 4FSSA 3CMYA 2HOAA 3G4SA 2HZTA 4N9HA 5CYVA 1Y8RB 2ZCFB 1JO8A 4BUPA 3CPWA 5F5WA 1G3TA 2LK2A 1SANA 5J40A 2QA4Q 5K5OA 2VODA 1QZYA 1R0CB 4G7OF 3NEMA 1ZLJA 1M1KU 2IIMA 5GPCA 2DFIA 2I4MA 4GYIA 2X85A 3UF4A 5FRMA 3RESA 1QKXA 2EFOA 1P9QC 3QU3A 3M5AA 1H89C 2XD0A 1KA8A 2JVHA 2H27A 5A2QE 2CJAA 2EV5A 2QLZA 1YRNB 2A61A 1YW9A 4D1QA 5FW9A 3DP7A 1BOAA 3QO5A 2JTFA 2RB6A 1U78A 1ETXA 4B43A 3LQRA 1KK7A 2RJFA 2P5LC 1H641 3H5NA 3JCMb 1GXIE 3M0SA 3CPFA 3LWIA 1U5TA 2JMCA 3CQTA 1FYMA 2DJQA 2E19A 1FOWA 1YJ9I 2ROLA 1XPXA 4X1EA 1UG2A 4PJOD 5TJJA 3V7SA 3CBOA 3DV8A 3X20B 1VQ8I 3G6EI 4RCBA 4AH6A 5C6SA 3F6OA 1C0MA 5ECAA 3A5ZA 3S1RJ 4Q15A 1IGUA 3CC4A 4ENNA 3HM5A 4M78B 3PO3J 1UB4A 4RQEA 4P73A 5DUIA 2OCCH 5CVJA 1I0CA 3KYCB 4ZYDA 4NUBA 3N5BB 3NMZC 1YJWA 4J9HA 2KKOA 5AT1B 4HCBA 2R5ZA 1GCPA 2DTOA 4XN0A 2WSCE 1I3QJ 3LW5E 3T8TA 3A31A 4F3QA 5D8LB 4S05A 3A8MB 4JRQA 3GIBA 2CYYA 1QVUA 4A3BJ 4PJOA 4KT5C 4LXCA 2DFUA 1KIKA 1BBYA 1BN5A 4ZJZA 2V26A 2DYIA 3MO8A 2VPLA 4C8QE 1WJEA 1W36C 1I6XA 3QHSA 4BU2A 1Z7LA 3M59A 1KQ8A 4A63B 2DBMA 2RQQA 1UFFA 1WJBA 1R5ID 3SZPA 4ZYHA 3HDDA 3D5SC 1SVMA 2N8GA 4X9CA 1X3WB 3D5LA 1YO5C 3EUKL 4FE7A 3JRCA 2GXBA 1Z7UA 3RKWA 4I99C 1M1KC 1NJ6A 2FEZA 3BWGA 4PKCC 3LX7A 3JRAA 3G7ZA 2ZZFA 3TL4X 2V1QA 2AMCB 2LR8A 4M7DG 3VV0A 3KFWX 4J7IA 3K4KA 4IHVA 2HNHA 2H1LA 1ODDA 3LLRA 2NVUB 2L54A 1B6AA 4A54A 1DP3A 1SD6A 1XGSA 1T2KA 5HODA 2IVMA 2ZMEB 2KJCA 4U0WA 3ZQGA 1UGVA 2A0FB 4FYWB 4F7UA 4AIHA 4D9JA 3H5RA 2BKDN 2Y90A 2EIFA 3CUOA 3MAJA 4GO1A 1RPWA 4OMZA 4OF1A 1VF9A 2HNIA 1K0SA 1MJ9A 3H0HA 4DZPA 3WG9A 2EGEA 2W82A 2UV1A 4EMKB 1VQ9T 2CU7A 3M0PA 2QHVA 4A3GJ 1A6IA 4YCUA 1B8IA 1H92A 3ABLH 4N0BA 4H2TA 4X6AJ 4F52A 5LEKA 5FKKA 2EGCA 3PT9A 4BY7J 2OBPA 2BXZA 3BQZA 2CWEA 5GMKh 1OR7A 1U2WA 5GAHJ 3UGTA 4X5OA 2VLAA 2HDCA 3U1KA 2O4XA 4HNUA 1ASZA 1WZ2A 1ZA2B 4H2UA 2OCEA 2A6HF 4PSXA 1GRIA 1QKWA 2DEUA 3ZBDA 4P5OA 3LA7A 4MFDA 3VWBA 2J6FA 4B44A 5EG2A 1QE0A 2WSFE 5LBQA 4PK4A 2H09A 2CQKA 1JRIA 1T98A 4A0ZA 2R7UA 2ZJPF 3EG9B 4NL3A 4RG2A 2F1LA 1YITQ 1TBXA 3BTLA 1YI2T 3L1PA 3EG1A 3I5UA 1CQTA 4B47A 2DL3A 4JJCA 2VGNA 3ZQCA 3Q0WA 3W6VA 2W4SA 3IQLA 1JGGA 3FJ5A 3L4GB 2LJ1A 5M5YJ 2Y4XA 5J8CA 3HHGA 5LJ5h 1VQ5A 2KROA 2OI3A 2NUPA 2R7ZJ 1Z77A 2LC4A 2JSCA 3AG2H 4IURA 1RKWA 1WRJA 3OYEA 4TVRA 2YRCA 1VFCA 1XD7A 5L8RE 4PJOE 3EGUA 1M1FA 1DGRM 3SDGA 2PN6A 1R1TA 2FF4A 3AL0C 3PSFA 3FJPA 3E1SA 3ULRB 1JKRC 4GDFA 4P3OA 3IL2A 1VQ4T 1G3YA 4KDPA 2EFPA 4NBQA 1X6BA 5KYYA 1C0AA 4EJOA 5F1RA 1QNTA 4HYEA 2JPCA 4BXFA 4BH9A 1R23A 4FASD 4XSZF 2LQNA 3H8ZA 3CC7Q 2K02A 3OQ5A 4UVBA 3WGGA 3L2CA 3HUGA 4A5MA 4P71C 1LYLA 3GNFB 4LNSA 4C0GA 1BCMA 4I09A 2L2PA 4CZZA 2RHQB 2M7AA 3EYYA 3MKLA 5HLIA 4HNVA 1KOGA 2DI3A 1V5EA 4GLKA 3GUDA 2LOOA 2IGNA 3PNTA 1ETQA 4AIKA 2A68F 4P1WA 3HKZN 2XB5A 4C2TA 5DDGA 2H8HA 4J9BA 1YFHA 3K4BA 1HW5A 5CKTA 4LG0B 1WLPB 1T0FC 1WXUA 4F7UE 2XAGA 2NRAC 5JFRA 3HOVJ 3EHRA 5FKMA 3GFIA 2BUDA 2AKWB 2BY1A 2X6YA 2HXOA 1JHFA 2DYBA 4J9IA 5GANh 3EHQA 2ZXJA 2Q7EA 3FM3A 5LGTA 4QTRA 1ASYA 3P9KA 5CKFA 1UHMA 5GMKi 1YJNA 3OBWA 2K3YA 2MLGA 2LF7A 2M1HA 2C0IA 1ETVA 4HCZA 2DTZA 4A4EA 1LEAA 2ZB9A 4M77D 5DLOA 3E6MA 3E6CC 2RNGA 2JWTA 2O2OA 2BZTA 2IGKA 4ZIBA 1WGSA 4FISA 1NEBA 2QGGA 5I11A 3A1YA 1P7JA 3WU0A 3I7FA 1HD3A 3WTVC 2CS7A 2R7VA 3TO7A 3SQNA 2ZBKA 2ZT5A 4YG2F 2RHSB 3E6BA 4A3CJ 4HOBA 4K2EA 4FTHA 2BY2A 4O2DA 1DGWY 3GOXA 2MF2A 4BB7A 3CD6T 4LK1F 3GBQA 5DD4A 2L3PA 2VT2A 2XASA 4MNUA 3P8TA 1RL2A 4JRIA 1N8RR 3K4MA 4XNFA 4EQQA 5EZGA 2B8AA 1XX5A 2ZTGA 4M77A 3CCYA 4IHTA 2UUZA 5ILSA 3MD2A 2PMZA 2V1RA 5J3BA 3REBB 4RGSA 4BL0B 1BIBA 3OSVA 3SXYA 2ARTA 5A0GA 2CQ7A 3LH5A 5GAOp 3PUFA 5FKLA 1KQ2A 4E51A 1Y57A 3LYIA 1L0OC 2Y31A 2E7XA 3KXTA 2IA2A 2LRDA 4TV7A 2JXBA 1KFZA 3HZJA 3TVTA 4Q4ZF 3UH0A 3VRYA 3G71I 1G8XA 3WVDB 2FNPA 3S3MA 4BNCA 1EA3A 1WFWA 1QVFA 3PUBA 1FIAA 3X25B 2COYA 1FXXA 4HT4A 5IN1A 2Y9ZA 1PWTA 5GPAA 1MV0B 2KRCA 1AT1B 4EJWA 4QW2A 4YRGA 2PBIA 3CMEQ 2IA0A 2LBFB 5IT3A 1QVGA 1O7FA 5FGMA 3I56A 5GMKj 3FMQA 2CW7A 3L9FA 2AKKA 5IAYA 3CC7I 4OMNA 4A4GA 2D45A 5ICCA 4ZN1A 1EZZB 2DN0A 1BI1A 3JCMJ 4FYVB 3FXUA 4V2SA 3HYIA 1OCTC 2FYKA 2CQQA 2A28A 3RL6A 3CXCS 4E6KG 4OMQA 2X6OA 2K9MA 3I3LA 2CP0A 1FOKA 2WAEA 1NHAA 2ZJ2A 2QKLB 2PG4A 3CUQA 1Q86C 4LLGF 3JCUC 4MTDA 4J6XA 2JSPA 1LDKB 3ELKA 3RJPA 2X35A 1IUFA 2E70A 2MOXA 1P4WA 2YUQA 3HTUA 2OD5A 2L5QA 3A98A 3OYIA 3OYCA 2DTRA 4LGWA 4RA2A 4CC3A 1W2BS 4L0YB 2E10A 1YB3A 4EJTA 2DMNA 3CCJI 3OYAA 4A4FA 4LD5A 4NDLA 5LJ5j 4LDVA 4GLMA 3TP3A 2RI3A 2OTJA 1YIJA 4D7NA 3VBBA 3PIPA 1PC0A 1IG7A 2F2XA 2BY3A 1ZSZC 3KP7A 2EJFA 3D0SA 3BG3A 2XDVA 1EIYB 3JTGA 1BJZA 5FU6C 1ZYRF 1V4RA 12ASA 2CIMA 3RZOJ 3G1ZA 3JB9J 2QM3A 1WJFA 2GQQA 3CCQQ 2Y0SA 1F4KA 2BYVE 1OLTA 5J4YA 3CC4T 3MZYA 4A53A 1HW1A 2COBA 2A07F 4I0BA 2ESWA 4YROA 4YYEA 3WHBA 3FLGA 2JJ7A 3CP8A 1J5YA 3CP2A 4YRNA 2FPFA 1WI9A 3BDUA 2RJDA 3CO7C 2EB7A 3PGGA 4MIMA 4D5FA 3N4MA 1FBQA 3S14J 4A3IJ 4L18B 2MMPA 3BJ6A 3JSCA 2MWPA 2K9QA 2EV0A 1Q82C 2VKHA 5KCOA 3TDZC 3CXCP 2PI0A 1O3QA 2EBIA 5LJ5g 2KDSA 4OIQF 4MDXA 2WB1A 1IW7F 3RKYA 2JT4A 3CBPA 4PDKA 5EDNA 2OZUA 4IPAA 3OS2A 1AHJB 4UXNA 4YRQA 1TWAJ 2AXTC 1GV2A 3QOPA 3AG3H 1KD1U 3FXKA 1IN7A 5KNNA 3M1CA 2DYSH 2R5AA 3CCST 3ZPLA 1CF7B 2H3JA 5GANj 4PFOA 1W0UA 2MIOA 1HA8A 5EYRA 2KSSA 3BPVA 1FMVA 4JS5A 1A5JA 3BCBA 1UGRB 2BE7D 3V8JA 4Y4RA 1S7OA 3CMEI 5DUKA 4LD6A 1ZKGA 3K0LA 2M34A 2ELKA 1MJAA 1ZA1B 4QSHA 3A01B 3QSUA 3HXWA 2QDLA 2JOYA 2GXAA 2KFDA 2J7IA 1FJLA 3OMGA 2NNYA 3X26B 4JRPA 4UY8I 1H0MA