3V8KA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with biotin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
total genus 93
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8kA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8kA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8kA02
2ZCEA 4LGWA 2XKOA 3LC0A 4UP7A 1SFXA 5K1YA 2DFIA 1QBJA 2J3MA 4AVPA 2AXLA 2XASA 2K57A 4HX4A 1YW8A 1ZLJA 5ILUA 3ERRA 2IJLA 2RB6A 1T38A 4M7DB 2PFBA 5GAOn 3CDHA 2FQ3A 5BOXA 3C7JA 5K1XA 4M9SA 4M77C 4L9NA 3L2ZA 5HS7A 1R1UA 3WGIA 4HF1A 3V7CA 3QO7A 4RQFA 3KP6A 1X01A 2JRTA 4XSXF 4M75D 3SQNA 5GAN4 4EQQA 4LB6B 1QQIA 4R79A 1I81A 1WNLA 2R7DA 3I7FA 5AONA 2E1HA 1R7JA 3JCMX 4P75C 3CUQB 2ARSA 3WTTC 1H4VB 3TEGA 3MF1A 2XROA 5GAOp 2WTEA 4IRHA 1F1ZA 2RHSA 1OYYA 1O3TA 3N97A 2V9VA 2ZNZA 4XSZF 4FX0A 2I2LA 4RGRA 1FSEA 3VODA 3TUPA 1ATIA 2GAUA 2VOPA 3JSOA 2Y0MA 1FYFA 3V4GA 3HFZA 3HFVA 3RI4A 3K1PA 1BN5A 2QENA 5BPDA 4Z2YA 5DCMA 1TW3A 3WTXC 3FZVA 4M7AA 4N0AC 1TW2A 1R1VA 1E17A 3E6MA 5LJ5d 3EYIA 3QHSA 2ZT6A 3EUHA 4I02A 4KQEA 4Q4ZF 2W85A 4CHUA 4HDUA 3NQOA 5DDGA 5GAOl 2AMCB 1DUXC 5GANj 3KLOA 1EH6A 1SMYF 4MQVA 5FD6A 1CF7B 2L3DA 2CFXA 3PCOB 5LJ3h 4M78A 3L09A 4UHTA 4BXUA 4M7DC 5C51B 3J80Z 5FB2A 1G51A 3SZPA 1Y96A 4GYGA 5GAN8 2XUBA 2DQ3A 2OQGA 5ED4A 1TH7A 2ZR3A 1YS7A 2RDPA 3H3UA 3MF2A 1SERA 4P3PA 2DXTA 4HLYA 1QF6A 3QOPA 2P5LC 2KRFA 5A2QK 1BI0A 3LA3A 5GANf 1RNLA 4JQFA 4L0YB 2K4JA 2LKPA 4WWCA 4CYDA 2XAGA 4OLFA 4C8QA 1BIAA 3DFGA 1LJ9A 5GAMj 2GQQA 3GFMA 4BHPA 5LJ3e 2JN0A 3P8TA 4X9DA 2UZKA 4JUVA 1G3YA 3ISPA 5D4RA 4YFNF 3BFMA 1KMMA 3R0JA 3DP7A 1P92A 2WWYA 3COAC 4LG0B 4EGZA 4QVDA 2O8XA 2DQRA 1P4XA 5ICGA 4J5YA 4EJVA 4YRNA 4YCVA 2VOOA 3BJUA 4I7HA 1PP7U 2M30A 3ZN1A 4M7DD 4UNOA 1SRYA 4RGUA 3TEHA 3F6OA 5CVUA 3WTUC 3EFRA 2LSOA 2Q5IA 3ZMZA 3CUQA 4U88A 3AAFA 2Z9OA 1EV7A 2JZYA 5LLQA 1BI1A 2BE5F 5LRRA 4M7AE 4OIQF 4M71A 3ML6A 4EMKB 2L4MA 3REOA 5LHGA 1FPQA 1J2XA 1D3BA 3JCMb 5GAMh 4MEYF 3ZN0A 1XCVA 2FB7A 4MQ9F 5D5VB 1Z7MA 1YB3A 3REUA 1P4AA 4M77B 1UFMA 3ZMVA 1ZG1A 1MD0A 3WE2A 2DDZA 2GXBA 4XRFA 1HC7A 2J5PA 2EFQA 3DEUA 2OBPA 4CO8A 2LDUA 3JTGA 3TKYA 3I64A 4G94A 2DI3A 4CH5A 5DUKA 1LNXA 2F5DA 5LJ5g 1NYRA 5FO5A 4PJOA 2HZTA 4LJZF 3RL6A 4RB0A 4PGHA 5E1WA 2G7HA 1S3JA 3JCMe 2EJFA 4ZYDA 5CVVA 1FP1D 2CQKA 5LHHA 2ZT8A 1PYSA 4M9ZA 2DEQA 3MFKA 4JRKA 2ZJ2A 2K27A 3I5UA 2IPQX 4KR2A 4M78B 2LF7A 1RUNA 2RKHA 4G8XA 3MCZA 3NRVA 4FX4A 2FBKA 2BGCA 1IF1A 4BYYA 3BJ6A 1I27A 5BMZA 3KZYA 1YYVA 3VFZA 3BP8A 4AD9A 3EQLF 5CVRA 1T39A 4GO1A 3V8JA 1R1TA 3RTRA 1IUYA 1LDDA 4HWPA 4EM1A 1IN6A 5HLHA 1EH7A 2V1DA 4P55A 4P9FA 4TWAA 3HRSA 2YX7A 1B1BA 3L1AA 4CZZA 5E18F 1FOKA 3IWFA 2J5OA 1KQ0A 3GWZA 2O0YA 2QQBA 4HOBA 2VODA 2IVMA 1YO5C 1MJBA 4ZZDA 3LA7A 3SHFA 4KMUX 2ZT7A 4WXCA 3ULQB 2PMHA 4C92E 3U1DA 1CGPA 4A53A 3ZP5A 1WI9A 3J80K 5ICFA 4M9XA 2D1HA 3J81K 1Y0UA 3KP3A 1L0OC 2VT3A 3PQJA 5CYVA 4FHTA 4K86A 4H2SA 1B70B 1GHCA 3BWGA 2O61A 1F5TA 4PJOC 1B34A 5GAOq 2DTIA 2MLGA 2M5WA 3BY6A 1LYLA 3GZ6A 4LFUA 2HS5A 3WGGA 2A6EF 2P5VA 1S6LA 4NL3A 4TVAA 4G84A 2I4MA 1QE0A 1FP2A 2RN7A 3RKWA 4YCWA 4K87A 1H641 2QVOA 5E8GA 2PG4A 2HR3A 5GAMd 4G6QA 2IA0A 5L3GA 5H6RA 3HXXA 2X4HA 2XAHA 2W25A 2DBBA 4M73A 3I53A 2MLKA 4HZFA 4UVAA 3PGGA 3WU1B 1OYWA 1YGBA 1Z1DA 3JCMg 2CW0F 3QU6A 4EVIA 1LVAA 3KZZA 4HWOA 4UV8A 3FIFA 3N4MA 3F72A 2PLYA 2MBFA 3GW2A 1Z05A 2EB7A 2QUFA 3KCCA 3IKTA 2FNAA 1GVJA 4M74A 5HS9A 4GGGA 2QQAA 2M8EA 1K78B 1ZYRF 2Q5HA 4PG3A 4WJ3M 1WQWA 5CJ9A 1I5ZA 1AWCA 4U0VA 3B73A 4G85A 2I4NA 5DD4A 5ELOA 4UVCA 2STTA 4G7ZF 2KIFA 1BJAA 4M7AF 2RHQA 4HV6A 2ZMEA 2ALYB 4NHJA 1STZA 1ZLKA 5GMKl 2RNJA 4M75B 1Z6TA 3D0SA 4MHGA 2QHUA 4P72C 1P6RA 4IHSA 2Q7EA 4LK0F 4CICA 4A5MA 3WQZA 2QQ9A 3C18A 2E7XA 4CXFA 1SFUA 3HFZB 5KNNA 4G9YA 2E64A 3HRIA 1HKQA 4WJ4A 3QO8A 3QNEA 3F6VA 1UB9A 4I2OA 3TEHB 3RPQA 2K86A 5LEJA 3GYHX 1TQPA 1WYDA 4A6EA 3QTCA 3T8TA 2QHVA 2M45A 1IXSB 2OAZA 1XSXA 3LQQA 3BJAA 4CH3A 2F5FA 3V8LA 3JCMd 3W6JB 4QWQA 3L00A 1G6NA 1O3RA 3RESA 4PHCA 1ON1A 2QYOA 5D5XB 2YU3A 3T5XA 1E1OA 1FLIA 1HBXG 4IHTA 3TQNA 1QZZA 5LJ5h 4NQWA 3BROA 1PDNC 3DV8A 1X3UA 3SXYA 2C7IA 3J81Z 1YQAA 3HXZA 4Y13A 2CJBA 1SAXA 3H3ZA 3JAMK 2ZKZA 5D4SA 1ZHFA 2MA3A 2Q8KA 4OIOF 5D5WB 1D8KA 3ZQ7A 4XLNF 3FHZA 3DXJF 3JTHA 4BHCA 4D0PA 3DKWA 3P9CA 5GANe 2NYXA 5C52B 4ZZLA 1EH8A 1MJ9A 3ECHA 4F7UG 1KQ8A 4ZIBA 4BNCA 5LJ5e 5HVQC 1NJ2A 5L3BA 4E51A 3F21A 1TNTA 1HKTA 2XAFA 4F7UA 3QP6A 1E22A 4OIPF 4HLXA 2AMCA 3V7SA 3VQVA 4XU1A 1D5VA 5HDNA 4Q15A 1UHMA 2ZZFA 4ESJA 4ZYGA 1GGMA 1REPC 4M6YA 3KP2A 3QO5A 2VONA 4XU3A 4LB5A 3VOEA 4YCUA 2CSOA 4A6DA 3F8FA 5LJ3j 4O2DA 4K2EA 5F1RA 3RYRA 3U2RA 2ZR2A 1JHHA 5LJ5j 4HT8A 2RVCA 1DDNA 4M6XA 3CTAA 4V2SA 3RF1A 2A3SA 4O6JA 1I6XA 1EIYA 4M77F 4C92G 2EFOA 4M7AG 2LF8A 4XTYA 1FT9A 3BW1A 1G5IA 3UGTA 2RA2A 1R58A 5LHIA 4JK1X 1ON2A 2VXZA 3FB9A 2OA4A 2Z3YA 4PJOF 1FYMA 2CYYA 2ISYA 1ZREA 2TDXA 1H4QA 2CJ9A 3BDUA 4I09A 4OMYA 1X54A 1J0RA 5K5RA 3JSPA 3A7RA 4N9HA 3UFGA 1A04A 1MJAA 2MC3A 3VEPA 2COMA 4M72A 5LJ3g 4Q48A 3V7RA 2IA2A 3EYYA 3DPTA 4TVWA 3I59B 1KA8A 1Z6RA 1S8NA 2Z99A 4BAYA 1ZG3A 5HGQA 3GX4X 2P0LA 3HY1A 4HAMA 3RGLA 5CVIA 3V8KA 3GFJA 1IAWA 2EA2A 3JCMc 1OKRA 5GAOr 3G73A 4HV5A 1WKMA 4NCXA 1WRJA 2GA2A 3GLXA 5ICEA 3CUOA 4P9UA 4B09A 1WQ2A 2PN6A 3E6DA 2FMLA 5DD8A 4L5JA 2DZCA 4RB3C 3DQVC 4M7DF 4YYEA 2CIMA 3TO6A 4XEOA 4M75G 1R5HA 3U9GA 2P7VB 1PP8F 4YRGA 2DU5A 4F7UE 4UVBA 2A68F 4KN7X 4EJWA 1LEAA 4M77A 1RUOA 3ZMTA 3HXUA 1X55A 4KICA 4UP8A 5E1ZB 4TV7A 1BIBA 2Y75A 2VC8A 4A0XA 4IPAA 2GZWA 3W3SA 2EFNA 2DKGA 1ADYA 4KDPA 4H02A 4EMHA 1S7OA 4XTWA 2DK8A 1KU2A 5FD5A 3KFUA 3F3XA 3UH0A 2JT1A 4KFCA 4EMKA 1U5TA 4CS2A 1T2KA 3GEZA 1W7PD 3R61A 1XMKA 3PQKA 1O57A 1H9GA 1QO0D 1KU9A 3P8YA 4HQEA 1U1TA 1HW1A 4L0ZB 3M8FA 4MNUA 1FYLA 1IN4A 3HOTA 1I8FA 3O3KA 3KFWX 1UHWA 1M5Q1 4M75E 4CS4A 1U8RA 4M75F 4A2UA 1K6OA 1RZ4A 2YLBA 3R07A 2V1UA 1ZH5A 3BZ6A 5F6FA 4ZYHA 4WCGA 5L3DA 3FWEA 4BW9A 1B9MA 4M78F 4YRKA 3KP7A 4LK1F 3SFZA 1N9SA 1B8AA 5JVTA 1ZRFA 2V1XA 4MTDA 4QVCA 2DLLA 1TBXA 2EJGA 2UWMA 3WU0A 4KMFA 1B9NA 3KE2A 4Y17A 2XRNA 3ABTA 1W7PA 3PCOA 2ZNJA 2XVCA 4H2WA 2FEZA 4XLPF 5BPIA 2EFWA 3HTZA 3E6BA 2F2EA 2ZT5A 4EJUA 5TRDA 4L9JA 4YRLA 4L5IA 4HDVA 1X2HA 2AKWA 2DTOA 1XB4A 2FE3A 1NYQA 2DVEA 3HRKA 3SWNC 4A5NA 1DPRA 5FGMA 3RPUA 2ZNIA 4MGRA 1TTYA 2ZFWA 3L4GB 3JCMh 2HGCA 4TQFA 4OP0A 4GCVA 4XTZA 5K5QA 1Z7UA 5H6QA 2VBYA 3JAMZ 3GO5A 3TO7A 3BY7A 1J9IA 5TJJA 2EJ9A 2RV8A 3K69A 4RQEA 2IA1A 3JCMJ 1G3TA 3HYIA 4M77G 4C92F 2IRFG 3J7AO 1U5TB 2XGXA 3EDPA 3HOSA 1L0WA 2RGVA 3PFIA 2HEOA 4C8QC 5GANd 5AIPA 1HQCA 4XU2A 5DCFA 5GAMg 3E5XA 4ON0A 4GXOA 3IKMB 1QNTA 3QU3A 1ZARA 1OMIA 4C92B 2ARTA 2IY5B 2OD5A 1FZPB 2EAYA 1B76A 1JXSA 4PDKA 3ICAA 2GIVA 4AIHA 4DQ2A 4WX9A 3D5LA 3IRRA 1Z9CA 1T6SA 5HLGA 1FY7A 3EFSA 4HVCA 3FF5A 4UUVA 1LB2A 2DW4A 3IALA 1W5TA 1GXPA 1E1TA 4RGSA 2HWVA 3RKYA 5C53B 3FM5A 1SESA 3IWZA 1TQMA 1FBSA 3HRUA 3VQWA 4HWTA 5KK1A 3QO3A 1R5GA 1OPCA 2HKXA 1QZYA 3OV8A 5JFRA 1T98A 2E7WA 1WU7A 4WK8F 2K7LA 4NOYA 2RHQB 3QUIA 1GXQA 4C8QD 1J5YA 1YW9A 2F5EA 3KETA 4M78E 2P5KA 1HK9A 1XMAA 3QAHA 4CGZA 3RUXA 4I0BA 4F7UF 1PYSB 3HTSB 3IG2A 2DK5A 1LDKB 2DTRA 4ZTZB 4ENJA 5LEKA 2VT2A 3JCMQ 1B7YA 2FMYA 2VBZA 1R36A 3RJPA 1LQ1A 4CH6A 2PBIA 2YPRA 1ULYA 3NEMA 2K4BA 1F4KA 2OU2A 5CLSA 5GAN2 3VQYA 3M4PA 2QHSA 3LAPA 4ASNA 2FNPA 5J8CA 4PJOD 2VBWA 4EJTA 3SB2A 4A12A 2P7CB 2BV6A 2PMUA 3M4GA 4J6WA 2VXFA 2O6GE 1SMTA 3IHUA 5DUIA 1B59A 1D3BB 5FFZA 4MEXF 3HSBA 3FXQA 1YG2A 4EM2A 5ILVA 1HSJA 2O03A 3PZCA 4O5VA 3WODF 3ERED 3HSEA 2YHTA 2FOKA 2YR2A 3INZA 4M7AB 3MWMA 2FU4A 4Q6GA 4CS3A 4AWXB 2EL9A 5H20A 3EETA 1USTA 4H2UA 3VB2A 4M78D 2FF4A 1R00A 1HKSA 2QWWA 2W57A 11ASA 4PJOG 4ESBA 4LNSA 2NNNA 4JBAA 5GANh 1I1SA 2DT5A 4A0YA 3WTYC 2ZZGA 5AIQA 1KQ2A 1FX7A 2B0LA 4KYWA 2FBIA 2ZIOA 3MEYA 3B02A 5LJ3f 3HXVA 3DPLC 3L9FA 4DNCA 1ZGJA 4PCQA 2STWA 2O3FA 3M1EA 3T8RA 3HUGA 2DO7A 5L3FA 3WTSC 1K78A 1G3SA 3LQRA 2NS0A 2MD5A 1KU7A 3FX3A 3RACA 1NJ6A 5D6FA 1SETA 1O7FA 4WXDA 4F7UB 2ODRD 2ZMEB 2DU7A 3R4KA 3HXWA 4L9TA 4PNOA 2G4CA 1IXCA 2QHTA 4KNYA 3QPHA 1VQZA 3TOAA 3HFNA 1JJCA 3JCMV 2PI0A 4P73C 4XEMA 4M75A 4J6XA 1IN8A 1HSTA 2ZXJA 2PMEA 2M87A 4EJOA 1R22A 2EWNA 4M7DA 1FWZA 5ELNA 4P5OA 1EVKA 1IRFA 3WTVC 2IP2A 3M7GA 2X0LA 4ENNA 4R8HA 1XGMA 1J75A 2ZGWA 3CLOA 5JI6A 3BOQA 3MZHA 4ZYEA 1XGOA 4YRPA 4ZTUB 2J3LA 5DYMA 5L3CA 1N9WA 1F9NA 1EQRA 1NNHA 2YSRA 3E5UA 3F8NA 4G6DA 2L54A 3A7UA 2IW5A 4UXNA 3K0LA 2ZTGA 1LOJA 2VC0A 1WQ7A 3CO7C 1CF7A 4C8QE 2KJBA 3CJNA 4RDXA 2DU9A 3QRFF 2ZBKA 5J6XA 1RI7A 3P9KA 3JCMf 1BBYA 4EO4A 1FC3A 3QP5A 4R1HA 2EV6A 4A0ZA 2AS5F 1BBWA 4KN4X 2KJCA 1EFWA 2QBYA 1EIYB 4BHBA 1IL2A 4M78G 2H09A 2P4WA 1ZAOA 1YFSA 4O3MA 3O6BB 1JE8A 1BC8C 2DJZA 4H2XB 1RIOH 4P72A 3GF2A 4PGGA 2L02A 5IT9Z 3JB9F 3MZYA 4HX8A 2VN2A 5GANg 4C92A 2EV5A 4H2YA 3JB9G 3MQ0A 4YRCA 2VBXA 5GMKi 4TVYA 2FXAA 2H27A 3OOPA 3ZMUA 2RC4A 5DEQA 2V6CA 1BOAA 2XAQA 2RM4A 3FM3A 4YRSA 1IN7A 2IY5A 1KQ1A 4TTVA 2UXXA 4UP9A 3F8BA 4IVNA 4HQMA 3KLNA 1Z91A 4LLGF 4RAZA 3IC7A 3LAJA 2JSCA 4P74A 4P71C 4H2TA 3GZ5A 2PQ8A 1OR7A 2ZINA 1X2GA 4IRIA 5K1PA 1HW2A 5JR3A 4N0BA 1H9TA 3A5ZA 1MGQA 3L7WA 3NETA 4HX7A 1MZBA 1BI3A 5BQTA 4C8QB 2H94A 1IRGA 4AIJA 4Q5SF 3LFKA 5CAIA 4IRGA 3DSQA 4YROA 4M7DE 3LSQA 3I0TA 2NRAC 1I4K1 1MKMA 1JHFA 5LGTA 2EV0A 5DY9A 5ICCA 1IW7F 5A2QZ 1UCRA 4ESFA 4YFKF 3F22A 5GMKm 1XDSA 3I4PA 4YIFA 4XU0A 1AOYA 2HOEA 4UV9A 1WLEA 3WTZA 2QZ8A 2D2WA 4J15A 5BS6A 5D5UB 2ESNA 4P73A 4EV0A 1H4SA 2JPBA 2FSWA 3WE3A 3FXUA 2OZUA 3ZPLA 5HLIA 1QGPA 1XGNA 2DXUA 3P7NA 2DPDA 2NNYA 3M8EA 2E1NA 3T0YA 3M4QA 3ROUA 3I54A 3LSTA 3WGHA 2A61A 4EX5A 2HTSA 4L9VA 1NJ1A 2Z33A 3BPVA 2BEOA 12ASA 3HSRA 4RCBA 4XBFA 1LJOA 3H92A 1KYWA 1K7AA 4BWAA 2XHKA 3I59A 3K1NA 3A74A 1HTTA 4HWSA 4RGXA 5E20A 1C0WA 1B34B 1USYC 3G3ZA 1O7LA 1SD4A 3KEOA 4I0AA 5J8FA 3BJOA 5FFXA 1LNWA 1MDMA 1USSA 3A5YA 5E17F 4OU0A 4YRJA 1O3QA 1I1GA 1U6GA 3W6KB 1WSUA 3A32A 5LJ5f 5F5WA 1J5WA 4P71A 1SD5A 2FRHA 3HHHA 3P9IA 4ENKA 3BDDA 1KQ9A 1SD7A 5KVRA 3AHUA 3VQXA 3CO6C 4LD5A 1D3YA 3R6SA 2HYFA 2R7FA 1ODDA 2OQRA 2PEXA 4Q47A 2K02A 2KIUA 4HT9A 1H0MA 3SZTA 2Y48A 1SD6A 1KYZA 2I4OA 2E3CA 1G5HA 4RB2C 1C0AA 5GAN5 3Q9VA 4Y15A 1JRIA 1U78A 4K88A 3JB9D 4IJAA 4B8XA 4M7AC 1JJCB 2BBYA 4RB1A 3HRMA 4WXHA 2EA4A 2WC2A 4OMZA 1TNSA 2DQLA 4UPAA 2Q7HA 5ERIA 3IKLA 1U3EM 2F5CA 5LGNA 3SWNB 2XTIA 5E8IA 3KP4A 3VU3C 3RKXA 4S05A 2MH9A 2OZ6A 4JLIA 2Q2EA 5GAN6 5EEHA 3GFLA 5EEGA 1G3WA 2G9WA 3OD1A 4KUMA 3ELKA 4PJOB 3HFOA 3MAJA 1R23A 1JGSA 4ZH4F 3C3WA 2E10A 4YP0A 3JB9H 2FBHA 2ZCWA 4C8QG 3CMQA 1T0FA 3TDUC 1I5LA 4AIKA 3O2PE 2Q0OA 2JPCA 3TGNA 2H6BA 2HNIA 2KIMA 1E2XA 5JHUA 4CH4A 1P2FA 2DTHA 2IT0A 2AKWB 1ADJA 1PUEE 2ZNYA 4MTEA 1ASYA 4YIIA 4PZJA 3A31A 2RHSB 1YCYA 1D8JA 4M7AD 2ALYA 2QM3A 3E6CC 1XSVA 2H6CA 3IKVA 4IXAA 4YREA 4U0YA 3RYPA 3RERA 4N0AA 1V4RA 2P8TA 4YRIA 1XD7A 2FA5A 1USYA 1FYKA 3HRTA 4EMGA 1YS6A 3E9HA 5ILSA 2EK5A 2YX4A 4RCCA 4U7BA 1B4AA 5FLXK 2E65A 3GUDA 3Q5FA 1QPMA 3Q9SA 4XTVA 4KR3A 4HA8A 2FYKA 3JB9J 2DAOA 3TOBA 4G7HF 1M8VA 1YFHA 1IZ1A 1Z7NA 1P4WA 5IT9K 2Q7GA 4HWRA 1KU3A 2RQPA 3HTUA 5LGUA 1FNNA 5LRSA 2XIGA 2PMFA 4I01A 5L3EA 3LA2A 3GIBA 1J59A 4XTUA 2VXEA 3BPXA 2QTXA 4NB5A 2L01A 2ZO4A 5D6EA 4P3NA 4X5OA 1OYIA 1YIOA 1WWXA 1E24A 2P5IA 1IN5A 2LNBA 5GMKe 3WG9A 4U0WA 1BBUA 2D1VA 2VE9A 3VBBA 4DPGA 1G4DA 4JRIA 2ISZA 2CGPA 3FMSA 3E97A 2RD1A 1U5TC 4PJOE 5FLXZ 3LWFA 5F64A 3E9IA 3L4GA 4HBLA 4YPFA 4G7OF 3F23A 1K79A 4H0EA 2GA1A 4FT8A 1FSHA 5GAMf 2ARUA 4ETSA 4IF4A 1Q1HA 4ENMA 4YFXF 3G1ZA 3DF8A 5GAN3 1XGSA 3E5QA 4BQAA 3A7AA 4LLLA 4N9IA 5E3IA 1KMNA 1XCBA 1BI2A 4EMKC 2KKOA 4AH6A 2CO5A 4L87A 2ZXFA 2V79A 4M77E 1XDUA 1W7PB 3P8VA 3GVAA 3CUQC 3T1BA 2GXGA 1B70A 2XGTA 3HY0A 1Y96B 3R0AA 3ZMSA 4LG0A 3FJPA 2CWEA 3M9AA 5CVJA 4L18B 2DQ0A 3ABUA 4HYEA 2CG4A 1MGTA 5IT3A 1ZG5A 4I98B 2HKOA 4H2XA 4P74C 1YFRA 3FMRA 2A07F 4YRFA 1V3FA 3FXRA 4CDGA 4KIBA 3IRQA 1MDMB 3KP5A 1EVLA 1SFEA 2VC1A 3RDIA 4WI1A 3HXYA 2E1CA 1HW5A 4S04A 3NELA 4F7ZA 4YDQA 1ASZA 5K5OA 2W24A 1NJ8A 1ZRCA 1BM9A 1DP7P 3JCMW 2E5AA 1KOGA 2DZ9A 4YRTA 3I58A 3K2ZA 2ACJA 4YG2F 2DPUA 2BYVE 3RIRA 3HIFA 4HF2A 5HDKA 1H4TA 1ZN2A 2HDCA 2EJRA 3R60A 1O3SA 5E1XA 1DPUA 3JB9I 4MMKA 1KGSA 2P6SA 1J7KA 1S29A 2A5YB 4M7DG 3WTWC 3IL2A 4RS8A 1N9RA 2ADUA 4GYIA 1S7AA 5GAN7 3TDZC 5GAOm 4P96A 4M78C 5I21A 2ESHA 4C8QF 2CGHA 2M1BA 2C8MA 1RIQA 1X56A 2GWRA 4OOIA 1XN7A 2ELHA 4C92C 2C6YA 4HF0A 1YW7A 5LBQA 5D8KB 3LSSA 4EGYA 4H2VA 4U7DA 2A6HF 2W84A 2P6TA 3UGQA 4TQDA 3NENA 1B7YB 4P75A 3QPTA 2XAJA 4A54A 3ECOA 2G7UA 2L4AA 4NL2A 3SWNA 5GMKj 1NJ5A 4QLCU 4TVAB 4XQ3A 3L2CA 2HTJA 1W5SA 2ODRC 2HFHA 4OIRF 2R3SA 2JTVA 6PAXA 3K1MA 1B6AA 2MH2A 4EM0B 4KIFA 1FBQA 1YLFA 1W66A 3F8MA 2ZZEA 2I4LA 4HW0A 4P3OA 4Y91A 2WV0A 3C1DA 3HSFA 2HYGD 2E41A 3HHGA 4WF2A 1EOVA 2HQRA 4J6YA 2ZIMA 4KIGA 2Z5UA 4OINF 1TQIA 2CJAA 2VE8A 3QSUA 1NHAA 4BH9A 3S2WA 2PJPA 5DCMB 5GAMe 1IXRC 3JW4A 1W4MA 2YLCA 3I71A 5GMKh 3REXA 1L3LA 2HQNA 2UXNA 4LLNA 5HOOA 4C92D 2EFPA 4YRRA 3KEQA 4M77D 1LEBA 3ZMDA 4LMYA 3F8CA 2Y90A 1VTNC 1BC7C 1HXDA 1ZGAA 5DV5A 4KA4A 4X9CA 4RAYA 1ONVA 1XSDA 4YRQA 4M75C 5HDGA 4EMSA 1FBUA 1TLHB 3NEUA 4KT5C 3FMQA 3K9TA 1U2WA 1WPYA 5LJ3d 4YRMA 2QBYB 1JBMA 1YTYA 4MMLA 2D45A 2QLZA 4XTXA 2A69F 5D8LB 3GFIA 1LDJA 5HS8A 3MEXA 1YFTA 1ZRDA 4RMFA 2XKPA 3TO9A 2NAZA 3JCMP 2XV4S 4E70A 1U1SA 2ETHA 3E3VA 3GXOA
chains in the Genus database with same CATH superfamily
4B4CA 2ZCEA 1G2HA 4UB8C 3UDCA 4LGWA 2XKOA 2LQ8A 4S0HB 3LC0A 1RETA 1B8IA 1SFXA 1OCCH 2OCCH 5K1YA 4P73A 4UP7A 2DFIA 1QBJA 4FCYA 2J3MA 2L9SA 1AWJA 4AVPA 3TW7A 1PUFA 2HQHA 4OMQA 3G4SA 2ENMA 1R5ID 2AXLA 4NQWB 2XASA 2CKKA 2K57A 2ZSHB 4HX4A 2XSDC 1YW8A 4LE9A 2LD5A 1ZLJA 5ILUA 3LSJA 1YITI 3PO2J 3ERRA 2IJLA 2RB6A 2DO3A 1T38A 1VQMQ 4M7DB 2PFBA 4ZNXA 1SSHA 1PJRA 3MEUA 5GAOn 3CDHA 2FQ3A 5BOXA 3C7JA 4G6TB 1GV5A 3K4LA 4M9SA 4M77C 2HVRA 1PG5B 3VJPA 4L9NA 3L2ZA 4DOVA 5FKLA 5HS7A 2RO0A 1R1UA 3WGIA 5HK0A 3TU4K 4HF1A 2R7QA 3V7CA 1WJQA 3CCLQ 3CJTB 2CV1A 1LCKA 1SPKA 1RL2A 5J1UA 3VYHB 3QO7A 4RQFA 1FEXA 3KP6A 2JVGA 4KT0E 3HG9A 1X01A 2JRTA 1KQSP 1T95A 4XSXF 2DL3A 2PVGB 4M75D 3SQNA 1GCQC 4V19K 3GTMJ 4EQQA 4LB6B 2KDZA 2XDPA 3ZL7C 5GAN4 1QQIA 2IGMA 4R79A 3AL0C 2DEUA 1I81A 1WNLA 2R7DA 2EZKA 3I7FA 5AONA 4UUTA 3FISA 1ABQA 2E1HA 2R7XA 3G71Q 1R7JA 3DU6A 4BI3A 3ZQCA 2F4MB 3JCMX 2LR8A 5IT9E 4P75C 1FMVA 3CUQB 2L89A 3J7AF 3H0GJ 2A5WA 2ARSA 3WTTC 2J06A 1H4VB 3TEGA 3MF1A 2X6XA 2XROA 2GQVA 3EGDB 5GAOp 2LREA 2M0CA 2WTEA 4IRHA 5F0HA 2CH4A 1F1ZA 2FZCB 4J7IA 2RHSA 2CUJA 3CMEI 1OYYA 1O3TA 1VQMA 1XC5A 3N97A 2GGRA 1K73C 1XQHA 2RQWA 1IXDA 2K4YA 5J26A 4LDXA 2V9VA 2ZNZA 2X1DA 4XSZF 1YI2I 4A3LJ 2ELKA 4FX0A 4XLCA 4DA4A 5KE3A 2I2LA 4RGRA 2E35A 1VFCA 1ETYA 2RHUA 1FSEA 3VODA 3OYLA 1RAFB 1WDXA 3CCLA 3VUBA 3TUPA 1R77A 3NAUA 1ATIA 4BEHA 2GAUA 2C0OA 3CXCP 2VOPA 3JSOA 2L5QA 2Y0MA 5B5EC 1FYFA 3V4GA 3HFZA 3HFVA 4A3KJ 3RI4A 2L8DA 4TVRA 3K1PA 1FOWA 1BN5A 2QENA 2X1CA 2LX7A 3CPFA 2BE9B 2K85A 5HK3A 5BPDA 4JRQA 3CDIA 3H5NA 3M1CA 2OX7A 4KGVB 1TOVA 2PJRA 3HOUJ 2X4XA 4Z2YA 2XDVA 3B6CA 4NBQA 3RR6A 2JS0A 1BJZA 5DCMA 2EYQA 1TW3A 1ZELA 3WTXC 4OMOA 3A8OB 3CCUI 3EUKL 3FZVA 2B86A 2EQIA 3RMQA 4M7AA 4N0AC 1UGRB 1UJYA 2EPFA 3H41A 1TW2A 3M0SA 1K8AR 3MD2A 1R1VA 1WH7A 4B44A 1E17A 3E6MA 2EZIA 2A7YA 1PVEA 2DTZA 4HRIA 5LJ5d 3EYIA 2FOWA 4OGCA 3FEOA 3QHSA 2ZT6A 3EUHA 3OYYA 4AMCA 4I02A 5KYYB 4KQEA 4Q4ZF 2RN8A 2IEKA 4B3XA 3DBLB 1Q1VA 2W85A 4PJLA 4HDUA 1NG7A 4CHUA 2BKDN 4PFOA 3NQOA 5DDGA 5GAOl 2F5KA 2NWMA 4P74A 3BCBA 4RTXA 2X51A 1VQ9T 2AMCB 1DUXC 5GANj 3LH5A 1VQPQ 3KLOA 3PIOA 1EH6A 3IH4A 1SMYF 1XOVA 3LOCA 4MQVA 5FD6A 1RAHB 2Y30A 3JRFA 1KZHA 1S72T 3ZFJA 1CF7B 2L3DA 2HSPA 3HM5A 2JMWA 2CUZA 5F04A 2IVWA 3M9QA 2EGAA 2K9NA 2E2IJ 2JUCA 2DAQA 2CFXA 2NOJB 1HC8A 1Q81C 3PCOB 5LJ3h 4M3FA 4M78A 3L09A 4KUDK 3CJQB 2RJFA 1JEGA 4OMLA 1OCRH 1BB9A 2L7ZA 4C30A 4UHTA 2WAQA 2DYSH 4BXUA 2DBKA 2YRDA 1UJ8A 2QQSA 2QKLB 4M7DC 3OSSC 2VQLA 1M1KR 5C51B 3J80Z 2DLPA 4D1QA 1VQKI 5FB2A 3I4NJ 4X1EA 2DX1A 1G51A 4LD9K 2PUKB 3SZPA 1Y96A 3BTLA 2R4GA 4GYGA 2VJIA 1SVOA 3M8JA 2M4KA 4Z8AA 2O9LA 3MVPA 5D7UA 1RLQC 2DJNA 3CMAT 1GBRA 2W1OA 2XUBA 2DQ3A 2OQGA 2DD5A 4XRSG 4BDYA 5ED4A 1TH7A 3META 2ZR3A 2A36A 1YS7A 1PC0A 2RDPA 3H3UA 2LJ3A 2XPUA 1VQ8Q 1PUFB 1Y57A 3MF2A 1SERA 1ZHIA 3A03A 2XKOC 4P3PA 1B72B 2W82A 4HLYA 2L7MP 2DXTA 1GXIE 1QF6A 3QOPA 3THKA 3GP8A 5ECAA 2P5LC 3J80E 2IXSA 2DMTA 1TXQA 2KRFA 1WHMA 5A2QK 3K4NA 1BI0A 3LA3A 3DB4A 5GANf 3HKZN 1RNLA 4IEJA 4JQFA 4GFBA 4L0YB 1TS9A 4CC4B 5KE2A 2K4JA 2LKPA 1EZZB 4WWCA 4CYDA 3CQZJ 2XAGA 4OLFA 4C8QA 1GFDA 1BIAA 3DFGA 2MF2A 5K7HA 4LNPA 4HNUA 2QGGA 1UZCA 3ULRB 1LJ9A 1JTXA 2DA6A 2KK4A 2WACA 5GAMj 5DM7R 2K3BA 1WJ5A 2K6DA 1YJWT 2GQQA 3GFMA 4ATOA 2JA7J 4BHPA 3KX2A 2CW7A 9ATCB 3UGQA 2DA9A 5FU6B 2JN0A 5LJ3e 1KK7A 3P8TA 3LSGA 1VUBA 2H3JA 2UZKA 4BY1J 4X9DA 5GAN8 3VQYA 3A8HB 1G3YA 3ISPA 5D4RA 1O4XA 3W2AA 4JUVA 4YFNF 4DYRA 2X9HA 3BFMA 4DBRA 4J01A 1QQJA 3R0JA 3DP7A 1P92A 2WWYA 3COAC 5I22A 1KMMA 4LG0B 4EGZA 3OMGA 2O8XA 2DL8A 4QVDA 4NDLA 2NS6A 2Z0WA 4ORZA 3FC3A 3CD6I 2DQRA 3OYDA 2QASA 4DBQA 1VQ8A 1P4XA 5ICGA 4J5YA 4EJVA 4YRNA 3VS5A 1OQYA 1JGGA 2LJ1A 3CCQT 2M8GX 3EH1A 3QJYA 4YCVA 2VOOA 3BJUA 3GLLA 4I7HA 5GADJ 4ZDLA 1PP7U 2GCXA 4A3DJ 2M30A 3QYBA 2VUMJ 5CKFA 1VQKQ 2A8EA 1VNDA 3CF5F 3ZN1A 3CCUQ 2VASA 4HCCA 1IGQA 1JQQA 4XK8E 2OTLT 2YRCA 5GAHJ 4UNOA 4M7DD 2JUGA 1SRYA 1K61A 4RGUA 3L42A 2HQXA 3TEHA 4JZ3A 1OCPA 2AIRB 2CS7A 3F6OA 5CVUA 3WTUC 1PCXA 3EFRA 1XTAA 4F14A 1A6QA 3NHNA 3MO8A 2LSOA 2VIXA 5KCMA 2Q5IA 2P84A 3ZMZA 4QSHA 3CUQA 4U88A 1QCNA 2ATCB 3AAFA 3BZCA 2Y69H 2Z9OA 1EV7A 3PJRA 2JZYA 3ZGKA 5LLQA 1BI1A 3NFCA 2BE5F 5LRRA 5CIUA 4M7AE 4OIQF 2EH3A 1RLPC 3PNTA 2GTJA 2XK0A 1V76A 3LMMA 2LCLA 5CQXA 5EG2A 1UG0A 3HEFA 3ML6A 1T0FC 4M71A 4EMKB 3CPWS 3DLLF 2L4MA 3O8HA 4BXXJ 2K5FA 4RLFA 4F17A 3REOA 5KYXA 5LHGA 1FPQA 1Y1VJ 2O5RA 2X35A 1J2XA 1D3BA 3QYGB 1LFUP 3JCMb 3DEEA 4MEYF 3ZN0A 5GAMh 1XCVA 1TU0B 1CKAA 1TUCA 2FB7A 2KDOA 4MQ9F 3A4CA 5D5VB 1Z7MA 3OQ5A 2M9HA 2MWOA 1VQ7I 1YB3A 3REUA 3E1SA 1TWHJ 1P4AA 4NC7A 4M77B 1UFMA 3ZMVA 2KY9A 2QA4I 1ZG1A 1MD0A 3WE2A 2QEXI 2WADA 3BR3A 3UKGA 2GXBA 1VQKA 2OTJQ 2DDZA 4XRFA 3M4OJ 3R6NA 4II2A 5FU6C 1OLTA 3G4SI 2IS6A 1K9MC 1HC7A 3OYIA 3DBHB 3C2BA 2E3HA 2J5PA 1RR7A 4CSWA 2L9NA 2HEQA 2EFQA 1TP4A 3M0RA 3DEUA 2OBPA 5CR2A 4CO8A 2LDUA 2ZCFB 3JTGA 1W6XA 2DK3A 1LKXA 1S72I 3X28B 4BB7A 3TKYA 1QKWA 2VPRA 5JVGF 1BOBA 2BZTA 2CRGA 3I64A 4G94A 2DI3A 4CH5A 4B47A 5DUKA 1LNXA 5BNGA 2Q1ZB 3M55A 3RMSA 1VQLA 2F5DA 4E7JA 2RQUA 3OYNA 3DLMA 1R9TJ 8AT1B 5FO5A 5LJ5g 2HZTA 2KIQA 4PJOA 1NYRA 3REXA 2RHIA 1S5LC 4LJZF 3I4MJ 1C6VX 1SSFA 4RB0A 4PGHA 5E1WA 2G7HA 4F52A 3RL6A 2KZGA 4BBSJ 1S3JA 2F2VA 4XM3A 1ACMB 2EJFA 5C44J 1V5GA 5CVVA 4ZYDA 3JCMe 1X1BA 2GFAA 1FP1D 2CQKA 5LHHA 4M7AG 2EQMA 3OSGA 4LDVA 1PYSA 4M9ZA 1FMWA 2DEQA 2ZT8A 2RHYA 3CXCA 3MFKA 4KH0B 4JRKA 5L23A 1IRZA 3EG3A 2ZJ2A 2K27A 2LY9A 1XMXA 2JA6J 3I5UA 2OTJA 2KT1A 1VOMA 2ALYB 2IPQX 4Z02A 4KR2A 4M78B 3H6ZA 1EFNA 2LF7A 1RUNA 2RKHA 4G8XA 1WZ2A 3A8GB 3MCZA 3NRVA 1Z9QA 2EILH 4FX4A 2R7RA 2FBKA 3G7ZA 1D0YA 1LFBA 2BGCA 1JU5C 2KT0A 2YRVA 4C0FA 1IF1A 2BHZA 2LTPA 1NLOC 4BYYA 4RTUA 3BJ6A 1I27A 3VFZA 3KZYA 1YYVA 5BMZA 1H88C 1MSFC 1GCQA 2D0NA 3RBBB 3BP8A 4AD9A 3EQLF 5CVRA 2LMDA 2ZB9A 1T39A 4GO1A 3RQIA 3V8JA 1R1TA 3RTRA 4BQNA 3F0CA 5D6YA 1IUYA 3H3VK 3CCET 3GTLJ 2VJ5A 2JMAA 5IHKA 5EEAA 2ID3A 2GQIA 1JJ2P 1B7TA 1LDDA 4JJCA 4HWPA 2M7AA 2COWA 5IAYA 4EM1A 1IN6A 5HLHA 2QYZA 1EH7A 4LIVA 1AT1B 2V1DA 1Y0NA 4P55A 2KDSA 4P9FA 3CC7A 1Q7YR 1SVLA 3X24B 4EEFG 5IOYA 4TWAA 1UGPB 1KHIA 2KRCA 1I1JA 3HRSA 1M30A 2YX7A 1Q81U 4FL6A 1BK2A 1B1BA 3L1AA 4CZZA 1PSFA 2RI5A 1AHJB 1C0MA 1FIPA 2CQ7A 2L2PA 5E18F 1FOKA 3IWFA 3E2UA 4PJMA 2J5OA 1LE8A 3GWZA 1KQ0A 2O0YA 2QQBA 2WAQN 3BG7A 4HOBA 2VODA 3DKYA 3Q0UA 3CCRI 2IVMA 2DA7A 3RPUD 1D09B 1YO5C 2GOXB 5A0GA 1MJBA 4ZZDA 3LA7A 4W97A 2DMNA 3HBLA 3SHFA 5FLVA 2OUMA 1ABOA 1ZBJA 3MKZA 1IUFA 4KMUX 3K70C 2ZT7A 4XRSA 5IXFA 4WXCA 5IYCJ 3UT1A 1NG6A 2DFEA 2PMHA 3ULQB 3U1DA 3NGPA 4AVZA 2JA2A 1CGPA 4A53A 3TCJA 3ZP5A 4C92E 2MOXA 3OYHA 1WI9A 3J80K 1K4US 5ICFA 2ROLA 4M9XA 4IIOA 2D1HA 1X4OA 2L3RA 2GIZA 2K9LA 1Y0UA 2W00A 1OISA 1L0OC 2VT3A 3KP3A 3PQJA 3J81K 1D5YA 1HCRA 5CYVA 1YFNA 2EBIA 4FHTA 1Y1WJ 4IHVA 2LKXA 2MW8A 2OTJI 1RAGB 2EQJA 3CC7Q 2CSQA 4H2SA 2HQAA 2VKVA 2CV0A 1B70B 1GHCA 3BWGA 2O61A 2R7TA 1F5TA 2VWFA 4ANJA 2MCNA 3REBB 1UDLA 1B34A 2JJ9A 5GAOq 1QVFA 4PJOC 3CBPA 2DTIA 3NTIA 3GF5A 2MLGA 3CCEI 2M5WA 3BY6A 3RDVA 1LYLA 1MH4A 5M3MJ 3GZ6A 1YN8A 4LFUA 2EPDA 2OAWA 4FTHA 4D5CA 2HS5A 3WGGA 2LP5A 5K7ZA 2A6EF 2P5VA 1S6LA 1WJRA 4NL3A 2KRSA 2QSHX 4TVAA 4G84A 3ASNH 1NTCA 5E3LA 2RJCA 2I4MA 2JVVA 3UR3C 2KT8A 3A2KA 1FP2A 2RN7A 3RKWA 4LITA 1QE0A 1W66A 4K87A 4YCWA 1H641 3AFHA 1VI0A 4AIDA 2QVOA 3BQYA 5E8GA 2PG4A 4I6ZA 2HR3A 3I55I 1TG0A 2P4TA 3IAS2 4QIWN 2PU9B 2PUOB 3OBWA 1WPKA 1U8BA 5GAMd 1UMQA 4G6QA 2IA0A 1E1TA 1Y07A 2N8GA 5L3GA 1FXXA 4X1VA 1YIJT 5H6RA 2F4IA 2M4GA 4H4KC 2XPVA 1GCPA 2X4HA 2KYMA 2XAHA 2E5KA 3CCLT 3HXXA 2HVQA 2IS2A 2W25A 4F16A 2F2XA 2DBBA 2K5CA 2J6KA 4B1RA 4V2GA 4X34A 4M73A 3I53A 2X6WA 2MLKA 4HZFA 4UVAA 3PGGA 3WU1B 1OYWA 2M2EA 4FASD 5IN1A 1YGBA 3JRAA 3LSIA 1Z1DA 1Y39A 1HSQA 3FIWA 2ZPIB 3JCMg 1LPQA 1ETXA 2CW0F 3QU6A 3SEZA 4EVIA 1LVAA 3KZZA 4HWOA 4UV8A 2ECZA 5DM7F 3FIFA 1TUDA 3CMEQ 3G2BA 2KRNA 3LSHA 3N4MA 3F72A 2V4JC 3VWBA 1WXBA 1Z0XA 5I2MA 5C4XJ 2K9SA 3CP2A 4Y4RA 3JRGA 2MIOA 1Q7YU 2ZC2A 2PLYA 5LL6S 2MBFA 3GW2A 4ABZA 3HOWJ 1Z05A 3ABLH 1YJ9I 1I07A 3CD6Q 3KIOA 2EB7A 2QUFA 3KCCA 3IKTA 2FNAA 1JT0A 2MG4A 2JUFA 3T9NA 2AKWB 1P7IA 2V9PA 2Y9ZA 3PVQA 3DWLE 1ERDA 1X2NA 1GVJA 2E71A 4M74A 5HS9A 2DXIA 4Y28E 4GGGA 2QQAA 2M8EA 4P5NA 1Q7YC 1MBGA 2DMOA 1WJCA 5LJ3g 1Q82C 2W0ZA 1K78B 3DKMA 1ZYRF 4IZZA 4XMYA 2X85A 2H8RA 1RI0A 3CPWP 1W2BS 2J7IA 3AG4H 1ZSZA 2Q5HA 2AHQA 4FE4A 3O5ZA 4PG3A 4WJ3M 1NJIR 2LG4A 1WQWA 5CJ9A 4RTWA 1I5ZA 3TVTA 1YJ9T 4BE0A 2R92J 2X6OA 1AWCA 4U0VA 3B73A 1UTIA 4G85A 3G6ET 4HXJA 2I4NA 2BXYA 4K86A 2YUQA 5DD4A 3EGXB 5GP9A 1WXUA 3MP6A 2KGTA 5ELOA 1M1EB 4UVCA 4G7ZF 2KIFA 3FXMA 2STTA 3GBQA 1I5OB 3KFVA 1BJAA 2NUPA 3AKZA 3IP4B 5DM6F 2DXBA 4HV6A 4M7AF 2NXNB 2L7FP 2VXDA 2ZMEA 2G0EA 2JTFA 1HDPA 1STZA 1ZLKA 4NHJA 2RNJA 2K79A 4M75B 6AT1B 5GMKl 2MSYA 3CD6A 2AZVA 1DGWY 1KC8C 1Z6TA 3D0SA 4MHGA 2W7NA 1PYVA 2QHUA 4P72C 4HT4A 1W5CC 2WY7Q 1P6RA 4IHSA 2Q7EA 2WA0A 4LK0F 2DXCA 1VQ5A 4CICA 3E0JB 1M2VB 4YTLA 3SDGA 4A5MA 3WQZA 2QQ9A 3C18A 3FDRA 2AQFA 2E7XA 4CXFA 1SFUA 1R8OB 3HFZB 5KNNA 4G9YA 4ZYAA 2FRYA 1AA7A 3G4ST 2ZXHA 2E64A 3HRIA 1UUEA 5CCAA 1Z7LA 2P4RA 3VS2A 1YJ9Q 1HKQA 3CCEQ 4WJ4A 1G2BA 3QO8A 3VRYA 3QNEA 3IH3A 3F6VA 4M4ZA 3G6EQ 1UB9A 3I55Q 4TTVA 4AT1B 4I2OA 3TEHB 1FOYA 3RPQA 4JJNK 2K86A 4CC3A 5LEJA 3GYHX 1QMCA 1TQPA 4II3A 1WYDA 1AWOA 4A6EA 3HOXJ 3QTCA 5HNHA 1U06A 3T8TA 1RUWA 4BE1A 2QHVA 2RHQA 4PL6A 1X3ZB 2M45A 2DM1A 2UUZA 3CCJQ 1IXSB 2OAZA 1YJWA 4IHXA 3ZR8X 3X20B 1XJWB 3TREA 1XSXA 3LQQA 4AC0A 1OR7C 3BJAA 4CH3A 2SEMA 4L6V5 2F5FA 4ITVA 3V8LA 1MV3A 5J1RA 3W6JB 3JCMd 4QWQA 3L00A 1G6NA 1UAAA 1DJ7B 1O3RA 3RESA 4PHCA 1ON1A 2QYOA 3P5JA 1TWBA 2CH0A 5D5XB 2JJ7A 2YU3A 1ZSZB 5FRNA 2WY8Q 2FPDA 2W48A 3T5XA 1E1OA 1FLIA 1HBXG 1SRLA 1U9OA 4IHTA 1A6IA 3TQNA 3HL8A 1QZZA 5LJ5h 1T0JA 1CSKA 2BTTA 4A3GJ 1UE9A 4XLAA 4NQWA 2DL5A 3A98A 3BROA 3VSLA 3DV8A 2Q2EB 1ETWA 1X3UA 5JLXA 3JREA 1PDNC 1FTZA 2A3LA 2CP6A 4J9HA 3CMAQ 1QP2A 2ECCA 4CZCA 2OTLA 2K5IA 1OEBA 1UFFA 3SXYA 2G3RA 2C7IA 2DIGA 2V26A 3J81Z 2A6TA 2XMFA 3U23A 1YQAA 3HXZA 1VQ4Q 4NC8A 5I2SA 4OF1A 4Y13A 4PLIA 4A3EJ 4RTTA 2CJBA 1WVRA 3CMAI 1SAXA 3H3ZA 2IS4A 2LCSA 1PYSB 1YJWQ 1WA7A 3JAMK 3G1MA 2ZKZA 5D4SA 1ZHFA 2MK5A 2KI7A 3PTAA 1X19A 1OOTA 5TISC 2MA3A 3TEDA 3I5RA 2Q8KA 1HJDA 4OIOF 5D5WB 2CU7A 3QOEA 1UG2A 3MKLA 1JO8A 1D8KA 3PUBA 1MBEA 2NUZA 2WSCE 2IBDA 3ZQ7A 2PZ1A 4XLNF 2VJ4A 4KUIA 2JWTA 3FHZA 2JT4A 2L3SA 4C5IA 4D7NA 3DXJF 3JTHA 4F55A 4BHCA 1YOVB 4GY5A 4D0PA 3A01B 3S1QJ 3AT1B 3DKWA 2VLAA 3P9CA 5GANe 2NYXA 5C52B 2ZPBB 1HOMA 4ZZLA 2QF7A 1OX8A 4R0KA 1EH8A 1MJ9A 3AG1H 3CCUT 3ECHA 4F7UG 1KQ8A 4ZIBA 2XIDA 4BNCA 5LJ5e 5HVQC 1NJ2A 5L3BA 3LSPA 4E51A 4BDZA 3CCMA 3F21A 2JTEA 3EUAA 1ZGWA 1TNTA 1HKTA 1E6GA 2XAFA 2KNBB 1YITA 4F7UA 1AU7A 2BXZA 3CMYA 2E5ZA 3CC4Q 3QP6A 4JX6A 1OQKA 3FK7A 3QKJA 1E22A 3QDRB 2BZXA 4LVLA 4OIPF 1AZEA 3DPUA 3ME9A 4HLXA 2AMCA 3V7SA 2B63J 3VQVA 1GBQA 4XU1A 1D5VA 5HDNA 5J39A 3BE3A 2KPMA 1VQ9I 4Q15A 5KYXB 3BCAA 1UHMA 1CKBA 3MJXA 1MBFA 2ZZFA 4ESJA 1I3QJ 4ZYGA 1GGMA 1REPC 4M6YA 3KP2A 5M9OA 3QO5A 4D9JA 4GLMA 2VONA 3EPZA 4XU3A 2DMPA 4LB5A 3VOEA 4YCUA 4J9FA 1TSFA 5F27A 1B3QA 4U87A 5K1XA 3QZ9B 2CSOA 2GOMA 4HVUA 3RNJA 5CQGA 4A6DA 3F8FA 4LUDA 5LJ3j 4O2DA 4K2EA 5F1RA 3RYRA 2QDYB 4CC7A 1N8RC 3U2RA 3BTIA 4VUBA 2DL4A 2VQHA 3MP1A 1JHHA 5LJ5j 2ZR2A 5GTHC 2FQ4A 5EG0B 2YUOA 4HT8A 2RVCA 4E7LA 1H89C 3F9KA 4M6XA 1DDNA 2NVTJ 3CTAA 4DW6A 1NPRA 1H8KA 4V2SA 3RF1A 3C94A 2A3SA 3HDDA 2YUSA 4O6JA 1I6XA 5EYRA 2V8KA 1JKQC 3K4JA 4M77F 1TWAJ 2YS9A 1QW1A 3LH0A 2EFOA 2E6ZA 3URGA 2X4WA 3NTKA 3CC4T 2LF8A 3EGXA 3HKSA 4XTYA 5J3BA 1YITQ 2Y0SA 2HBPA 1FT9A 3BW1A 3CC4A 3TQ7P 1G5IA 3IAM2 3K4CA 2JMCA 4KULA 3UGTA 1PSEA 2V9KA 3CMMA 2DL7A 3K7AJ 2RA2A 1R58A 4IIMA 3R6OA 2V7FA 3I9V2 5LHIA 2JZ2A 3DTEA 4JK1X 2XGEA 2R58A 1ON2A 2VXZA 3K6GA 3FB9A 2D6FA 3NPFA 2OA4A 4IQ4A 4IURA 2F2WA 1M9SA 3EGDA 3M59A 2Z3YA 4PJOF 1FYMA 1VIFA 2HNHA 2CYYA 2ISYA 1ZREA 2TDXA 1H4QA 3IUOA 3M57A 2LQWA 1Q86U 2CJ9A 1VQ7A 3BDUA 1QHHD 1WIEA 3BTJA 1Z9ZA 1POGA 3OS1A 2P0KA 4I09A 2XF5A 2DFUA 3M0QA 4OMYA 1RI9A 4N4NB 3OB9A 3FLGA 1X54A 1SF9A 4M3GA 1V55H 1VQOA 4L5GA 4C3HJ 3L2RA 1J0RA 1AKHA 1A35A 3CCRT 5K5RA 3JSPA 3A7RA 4N9HA 3GNGA 2A05A 2E5NA 2HZYA 3PIPA 2COBA 4E4HA 5KYUB 1A04A 1MJAA 2MC3A 4KGXB 5HY6A 3UFGA 1Y71A 2CT4A 1T56A 1K76A 3VEPA 4ELYC 3GNFB 2COMA 4M72A 2R5ZA 4XOTA 1I50J 2MAMA 3OIQA 3REAB 3JSCA 2ABLA 3HB9A 4OAZA 1R4MB 2FRWA 4EX5A 1RKTA 2LP0A 1JJ8C 2FD5A 4Q48A 5JLWA 5FLMJ 4PUSA 4MFEA 4BL0B 1XTDA 3V7RA 5EGOB 1X6OA 3C12A 4ZGEB 2HI3A 2HZDA 2IA2A 3HGGA 3EYYA 2XF7A 3DPTA 3JCUC 2XICA 4J9CA 5EDNA 3I59B 1HYOA 1KA8A 4D7MA 1Z6RA 4QKUA 1S8NA 2Z99A 3A0BC 1WFWA 4BAYA 1ZG3A 1BCOA 4FW2A 1KC8R 1K9MR 5HGQA 3GX4X 1QPIA 2P0LA 1IREB 3HY1A 4HAMA 3RGLA 5CVIA 5A0DA 1E3HA 1VQ7Q 2E2HJ 3V8KA 3GFJA 2NUPB 1YHQQ 3QZ5B 1IAWA 2CP0A 2EA2A 3JCMc 2BIVA 1WX6A 1OKRA 1UEBA 3QXEB 3PIPF 1ZKGA 2DA1A 4HV5A 3G73A 5GAOr 1WKMA 4A3FJ 4L59A 4NCXA 5KNLA 1WRJA 3KEYA 4AUXA 2R7ZJ 2BY2A 2GA2A 2KROA 3GLXA 5ICEA 5D6WA 4LOCA 1B8IB 3CUOA 5IH2A 4P9UA 4B09A 3PE0A 3ZBDA 1WQ2A 5KCOA 2MD0A 2PN6A 3E6DA 2FMLA 2DMQA 2XRLA 4L5JA 5DD8A 4E6KG 1H8AC 2GLOA 2E36A 2DZCA 4RB3C 3M0TA 1YI2A 3DQVC 3VS4A 5EZGA 3NWTA 5CPRB 3M0PA 4M7DF 4YYEA 3EG0A 2CIMA 1BYMA 1V1CA 3TO6A 2O9SA 3OMYA 4XEOA 1NK2P 2LOOA 4M75G 1R5HA 1QWEA 1UGQB 1XNIA 3U9GA 4MDXA 2P7VB 5EJCA 1PP8F 3CPWA 4RMFA 4YRGA 4F7UE 2DU5A 4UVBA 3ZRGA 2QQRA 3HC7A 2FPFA 2A68F 3GBGA 4FU6A 4KN7X 3VS1A 4IOAF 4EJWA 1LEAA 2HOTA 4M77A 2CUDA 1RUOA 3AL0B 3GTKJ 1WHUA 1WJBA 3ZMTA 1YIJA 3HXUA 1X55A 4KICA 2NYSA 1OU8A 2ROTA 3VKIA 4UP8A 2OPTA 5E1ZB 2GF7A 4TV7A 1BIBA 2Y75A 3DKXA 4BY7J 2VC8A 7AT1B 1M90C 4PFPA 4A0XA 4IPAA 2E6NA 4BI8B 3HP9A 1T3SA 2BOLA 3OA6A 1NK3P 2GZWA 2YU9J 2LT1A 2RHXA 3VYTB 2K7AA 4E2FB 3MEAA 3W3SA 2RF0A 3BR2A 2EFNA 1MMGA 2H1KA 4CI0C 1W2BP 3N05A 2OF7A 1I3AA 2HQEA 2OJED 2DKGA 1ADYA 3D5SC 4KDPA 4H02A 1AZGB 4BJ5C 4EMHA 3BR6A 1S7OA 4XTWA 3CCQA 4RKUE 2DK8A 1KU2A 5FD5A 3KFUA 3F3XA 4PSWA 4MFDA 2JT1A 2FUG2 4ZJZA 1U5TA 4C3IJ 4KFCA 2XF6A 2C0IA 4EMKA 1YI2Q 4CS2A 3SHWA 2EQKA 3KYDB 2V8JA 1A0NB 2O01E 1T2KA 3GEZA 1W7PD 2LLKA 2X48A 3R61A 3TBIA 1XMKA 2EQRA 1Z21A 3PQKA 1M1GA 1O57A 1M2VA 1H9GA 1QO0D 1KU9A 1JKRC 1ACIA 1VIEA 3OSFA 2KSSA 3EFOB 3QYHB 2KRMA 4MZMA 4X6AJ 1QVTA 1IDYA 1QU3A 3PNYA 1PD0A 2GNCA 1GV2A 3PL8A 5KAIC 1ZUYA 3I9QA 3P8YA 3CQTA 4HQEA 1U1TA 5FKMA 1HW1A 3PM1A 3M8FA 4I99C 4MNUA 4C2TA 1FYLA 4L0ZB 2E70A 1JJ2S 4BS9A 3C0CA 5DTDA 1IN4A 2E19A 3OYCA 1ZK8A 3HOTA 1I8FA 1ENHA 3KFWX 1UHWA 3O3KA 1M5Q1 1TTHB 4M75E 4CS4A 1WJSA 1U8RA 4M75F 4A2UA 2IGOA 2OTLI 1K6OA 1RKWA 1RZ4A 2YLBA 2YXYA 3R07A 1NH3A 1V5FA 2V1UA 3BZ6A 1ZH5A 4FYVB 5F6FA 1IJWC 4ZYHA 4C0GA 4WCGA 5L3DA 3UATA 1ITYA 3FWEA 3Q0WA 3HL2A 4BW9A 1B9MA 3G1JA 4A3CJ 4RM3A 4M78F 3DB3A 4YRKA 4BD3A 4C0ZA 2WB1N 3SD4A 4UB6C 4XLFA 3KP7A 2F6CA 1ETQA 4LK1F 3SFZA 1N9SA 5JVTA 1YJNI 1VQNA 1B8AA 1ZRFA 2V1XA 4MTDA 3HOVJ 2K40A 4QVCA 3A8MB 2DLLA 1M1KC 3PMTA 2H8HA 3CCVT 1TBXA 3BG3A 2NVYJ 2EJGA 1X6BA 4JS5A 2UWMA 4PKCC 2ID6A 1E3OC 3WU0A 3D1NI 4KMFA 1BR2A 3TL4X 1B9NA 3KE2A 2LRQA 4IUQA 4Y17A 2XRNA 3ABTA 4KGZB 4EPCA 1M3AA 3CCSI 2X6YA 3OMCA 3CEYA 3GOXA 1W7PA 3PCOA 2ZNJA 1BR1A 2XVCA 3MHXA 1NG2A 4LG3A 2VGNA 3EGUA 2VI6A 4Y7NJ 2FEZA 2DPPB 4I76A 4XLPF 5BPIA 4OGEA 2EFWA 4H2WA 2O31A 4B6MA 3RZOJ 3HTZA 4B9WA 3E6BA 5J1YA 1YWOA 1HA8A 5H2FC 2CMPA 2QEXT 2F2EA 3OYGA 1ZBXA 2ZT5A 3EG1A 4EJUA 2JM8A 2FL7A 4RLQA 3OYEA 5TRDA 1T8IA 2QEXA 4L9JA 4YRLA 4L5IA 4LVJA 3U21A 4HDVA 1X2HA 1YX5A 4CCKA 4M3EA 4UY8I 2DTOA 1XB4A 2BVLA 2RI2A 2BW3B 2FE3A 3ASOH 1YFTA 1NYQA 2DVEA 3ZQHA 3SWNC 3CP8A 4A5NA 4A63B 1ZQ1A 3HRKA 1DPRA 3S32A 5FGMA 4GLKA 1D1CA 3RPUA 4CH7A 1EX4A 2AKWA 2ZNIA 4KISA 4OWRB 4MGRA 1TTYA 2ZFWA 2CS3A 3LNQA 2FHDA 3JCMh 4QPQA 3L4GB 4MIMA 4BJ6C 1E6HA 2EGCA 2HGCA 4RAGA 1MIJA 1J3TA 2RJEA 4ELZC 3PO3J 2XDDA 3LSRA 3QG1A 4OP0A 1VQOQ 2EYZA 4TQFA 5CKTA 4GCVA 1HDDC 1N25A 1U9NA 2JOYA 4XTZA 5K5QA 1Z7UA 5H6QA 1Z3YA 2VBYA 3JAMZ 1EF4A 1PD1A 1G5VA 3GO5A 3TO7A 3BY7A 1J9IA 1X6GA 5TJJA 3CCQI 1TC3C 2EJ9A 5CQYA 3GTOJ 2RV8A 3K69A 2XU8A 3KYLA 4RQEA 1D1BA 2IA1A 1OPLA 5GAEJ 1ETOA 2LQKA 3JCMJ 3VSKA 3GZNB 2KE9A 5J4YA 5FRMA 4LDWA 2QQ8A 3S2HJ 2LDMA 1G3TA 1BCMA 2CZ1B 4OMMA 3HYIA 4F92B 4M77G 4A4EA 4C92F 3LL7A 2IRFG 3PSFA 5EGOA 1X4PA 3J7AO 2AT1B 5K7FA 5HKCA 4KJZA 1U5TB 2XGXA 3EDPA 2GBYA 3CC7T 2PX9A 3HOSA 2KP6A 4P1WA 2A0FB 1L0WA 2RGVA 3PFIA 2HEOA 4C8QC 5GANd 2MGQA 5AIPA 2HCKA 2M1HA 4IUVA 1HQCA 2L0KA 2VKDA 4CUGA 2GFUA 4XU2A 5DCFA 4IOCF 2QG9B 2OV7A 4FE7A 4F04B 5GAMg 3E5XA 2EIFA 4ON0A 3MZ8A 3EFOA 5FWBA 4GXOA 4ZTFA 3IKMB 4RTVA 1QNTA 2XGDA 2L7KA 3QU3A 1ZARA 1OMIA 2DT7B 4C92B 1EA3A 2DOEA 2JTMA 5LD2C 2ARTA 4C9YA 2IY5B 2OD5A 1FZPB 1YWPA 1GT0C 2EAYA 3SDZA 3FHNA 1JXSA 4PDKA 4LDYA 1B76A 2EW3A 3ICAA 2GIVA 3TP0A 4M6VA 2PJRB 2ZFUA 3CCMI 1IHVA 1ARKA 2X3XD 4AIHA 4HKEA 4DQ2A 4WX9A 2AXTC 3SEMA 3D5LA 3IRRA 1K1ZA 1Z9CA 1W4SA 2LC2A 3MKYB 1T6SA 2KHMA 3OL4A 1R71A 4FT2A 5GJWB 2LX9A 3S8PA 5E3OA 5HLGA 3CCVI 2HSEB 1P9QC 1X2QA 1FY7A 1J09A 3EFSA 4HVCA 1VQOI 1K83J 3FF5A 4UUVA 1M2OA 1LB2A 4JLGA 2DW4A 4L5EA 3WVEB 3IALA 3CLQA 1W5TA 2M02A 4QPOA 1WI3A 1GXPA 1C1AA 5EC7A 2M16A 4RGSA 5FKNA 2HWVA 2V1NA 1MBJA 4PSXA 3G71I 1K9AA 1ZA2B 3RKYA 2E4HA 1IG7A 3JV3A 5D6XA 1VQ6A 1JJ6C 5C53B 1RC9A 3FM5A 1SESA 4OMFB 2BY1A 4BACA 3ABMH 1WCMJ 3IWZA 1TQMA 4FSXA 3PSIA 1YI2T 1WGXA 5E3NA 1FBSA 3HRUA 3W2VA 2LQNA 3VQWA 4HWTA 3OYMA 1QKXA 5KK1A 2EZLA 2JS2A 3ZQQA 3QO3A 1R5GA 3KBGA 1OPCA 1GL5A 2HKXA 1QZYA 3OV8A 5JFRA 3OYFA 1HD3A 3N5BB 1T98A 2E7WA 5IPAA 4OMPA 3ZXSA 2EZHA 1BU1A 1UHFA 4AFZC 1WU7A 4WK8F 2K7LA 2BZ8A 2MMPA 3C4SA 4NOYA 4PFZA 1U5SA 1G8XA 2VJJA 3JRZA 2HXIA 3CC2A 1N77A 1QP3A 2IIMA 3M56A 3CD6T 3JRHA 1ZLMA 3OR1C 2HOAA 2RHQB 3QUIA 2XB5A 3EUHC 3PUFA 1GXQA 1Q86R 4C8QD 1J5YA 2O4XB 1YW9A 2FEIA 2F5EA 3KETA 5FKOA 5B1AH 3AG2H 1M27C 2QI2A 4M78E 2P5KA 3M54A 1OI1A 2DMUA 2KQWA 3K4MA 2NVXJ 1RRJA 1HK9A 1XMAA 2CP7A 2NLUA 1K4TA 5CK9A 3QAHA 2ZJPF 4CGZA 1IB8A 3DTIA 1AWXA 5CQEA 3RUXA 4I0BA 1OPKA 2K5LA 5IHIA 1X1PA 1YJWI 3HTSB 3OL3A 3CESA 2HKQB 1N78A 1NPPA 5FU7B 2DK5A 1LDKB 2DTRA 4BQQA 4ZN1A 4AFUC 1VQPA 3G1OA 2E12A 3EG2A 4ZTZB 1YIJI 4ENJA 5LEKA 2VT2A 3H0HA 1M90R 3JCMQ 2QXFA 3FJ5A 1FOXA 1B7YA 2FMYA 1M3CA 2VBZA 2ZJQF 1FYNA 3L1PA 1W2BA 2HL3A 3GTPJ 1KONA 5B3SH 1R36A 1D0XA 3RJPA 1LQ1A 4CH6A 1GVDA 1MSEC 3M5AA 2JN6A 2PBIA 2RQTA 2DA3A 2YPRA 5L8RE 1ULYA 5KHDA 2K4BA 1F4KA 2OU2A 5CLSA 3S17J 1PWTA 1RAEB 4JYKA 2KYBA 4IL6C 3I5SA 3H9GA 3P8HA 2JXBA 5GAN2 3M53A 4A3MJ 2QHSA 3M4PA 3LAPA 4TVWA 2I5UA 4ASNA 2FNPA 2KZVA 1K73R 1W36C 2V1RA 1AKHB 2VKNA 5J8CA 2DFHA 1G59A 1YNZA 3EHRA 4PJOD 2VBWA 1IZ6A 3HTRA 4V2FA 2DYIA 2I8DA 4EJTA 2D1XA 1W70A 3SB2A 2O8KA 4A12A 2P7CB 1RACB 2BV6A 1O9SA 4FT4A 2R5YA 2RHZA 1TT0A 1AD5A 1ZA1B 2MI6A 2P0PA 2PMUA 1I39A 2YWWA 3M4GA 5IOZA 2O6GE 2VXFA 1SMTA 3OSVA 4J6WA 5CO7A 3IHUA 2K3FA 5DUIA 3D7SB 1B59A 1W0UA 1D3BB 5FFZA 4MEXF 1N6AA 5AYFA 3HSBA 3FXQA 1YG2A 2E1MB 4EM2A 5ILVA 2K3XA 1HSJA 1TWGJ 2O03A 1YITT 3PZCA 4O5VA 2VL8A 2XGCA 1YRNA 3WODF 3ERED 3HSEA 2YHTA 2FOKA 2EFIA 2YR2A 3INZA 4M7AB 3MWMA 2FU4A 4Q6GA 4CS3A 4AWXB 3EHQA 2EL9A 4RM2A 5H20A 3EETA 1USTA 1SANA 4AG2C 4H2UA 3VB2A 4DIQA 1VQ8I 4M78D 4DJAA 3FXLA 1R6RA 1UHSA 2FF4A 3M0UA 1R00A 4RUGA 1HKSA 2QWWA 2W57A 3LGFA 2DNUA 11ASA 5DLQE 4PJOG 4ESBA 4LNSA 4AG1C 2CP3A 2DJQA 2NNNA 4JBAA 5GANh 1I1SA 2DT5A 1ZX6A 1Z3XA 2CUFA 4A0YA 1ZTRA 1D0ZA 4E7ZA 1E3PA 3WTYC 2RH2A 5AIQA 4XN0A 3TP3A 2ZZGA 1KQ2A 1DGRM 2R93J 1U3OA 1FX7A 2B0LA 4KYWA 2FBIA 2ZIOA 3MEYA 3CBOA 2DF6A 4QTRA 2RJDA 3B02A 3VYRB 5LJ3f 2RAEA 2VKEA 2LVMA 4D8KA 3HXVA 2KMUA 1VZ0A 4DGWB 3DPLC 2LT4A 3L9FA 3RCOA 2DVJA 2HYJA 4HSTA 4DNCA 2FJ1A 4XRMA 2YDLA 2ZPFB 1ZGJA 5DLOA 2QKMB 5E79C 1YHQI 1M3BA 4LN2A 4PCQA 2STWA 2O3FA 2CFOA 1MV0B 3J81E 3CCUA 3M1EA 3T8RA 1N8RU 1KC8U 3HUGA 2DO7A 5L3FA 3OBYA 3WTSC 4F91B 1XG1A 2PTKA 1K78A 1G3SA 3LQRA 1CQTA 2YT6A 2NS0A 4XKBA 2QSGX 2MD5A 1WFXA 1KU7A 2IS1A 2D0QB 1K8AC 3FX3A 3RACA 5JHFA 3UA6A 1NJ6A 5D6FA 1SETA 1O7FA 2O7OA 2YSQA 4WXDA 4OB3B 3MMYB 4FIBA 4F7UB 2ODRD 4GBQA 2ZMEB 2DU7A 3R4KA 3HXWA 1OU9A 4L9TA 4PNOA 2ME6A 2XD0A 2G4CA 2KEAA 4CA0A 1IXCA 2QHTA 1VQ7T 4KNYA 2BUDA 2Z2SB 3QPHA 5J4VA 2ZPHB 4UC4A 1VQZA 3E9FA 2DYBA 3IH2A 2M3AA 3TOAA 1JB0E 4QT7A 4ZDPA 4AFSC 3BG9A 3HFNA 2LBFA 1JJCA 4A4KA 3DU5A 2RNGA 3JCMV 2PI0A 4YIRX 4P73C 2DCEA 4XEMA 3HJEA 4M75A 4J6XA 1IN8A 1HSTA 1Y6IA 1NE8A 2DOFA 2ZXJA 4FQGA 2LNVA 2R57A 1D1AA 2PMEA 4B43A 2M87A 3HOZJ 1YCSB 3E19A 2E1MC 4EJOA 1IV8A 3ABKH 1R22A 2NVUB 1WI7A 2EWNA 1YX3A 2AQEA 3K10A 1A5JA 4C5GA 1AEYA 3RQ4A 4M7DA 5DS9A 1VQ5I 3WG7H 4G12A 5LFAA 1FWZA 4D6WA 1ZQ3P 1VYTA 4WCIA 4F3QA 2XDBA 5ELNA 4P5OA 4EATA 1IGUA 1QVGS 4OB2B 1M8MA 5GMKh 2ICWG 3ASKA 1EVKA 1IRFA 3Q1JA 3WTVC 3CC7I 4J9IA 4IQJA 4Z6YA 2IP2A 3M7GA 1IDZA 1SKUB 2R5AA 3PIOF 2X0LA 3G6EI 4R8HA 4ENNA 2QA4T 1S9HA 1XGMA 4NNJA 1J75A 2EGEA 2ZGWA 2HU9A 1MH3A 3CC4I 2W4SA 2DE0X 4M3DA 2FG0A 3CLOA 4J00A 3MCAB 5JI6A 3MQZA 3BOQA 3MZHA 4UUSB 3W6VA 2PVDB 3MKDA 4IUPA 2DERA 4ZYEA 1XGOA 4YRPA 4HG2A 4ZTUB 2J3LA 1XPXA 1VQLQ 5DYMA 5L3CA 1N9WA 1F9NA 2L3PA 3QIIA 1EQRA 2YSRA 1NNHA 4DYCA 2KLOA 3H5RA 3E5UA 3F8NA 4G6DA 2K3YA 2EIMH 2L54A 4Z88A 1X1AA 1JXMA 1KSWA 2HPMA 5F08A 3NMZC 4A3IJ 2KVQG 4JJBA 2IW5A 4UXNA 3A7UA 3K0LA 3PNVA 3MP8A 1DQUA 2ZTGA 3S15J 2VC0A 1LOJA 3CO7C 2LH9A 1NLPC 3S1NJ 1WQ7A 2E5QA 1CF7A 2E3IA 2KJBA 3CJNA 3OS5A 3VS0A 2DU9A 3A01A 4C8QE 3QRFF 4RDXA 2EKOA 2F1LA 2ZBKA 2KXCA 2R7UA 5J6XA 2AK5A 3ERMA 1RI7A 1BW5A 5FU7C 3P9KA 3JCMf 4HPQA 1I6HJ 1BBYA 3WHCA 1FC3A 3QP5A 2YUNA 1MMNA 3H35A 2A37A 2LVSA 4EO4A 4R1HA 2EV6A 4A0ZA 2AS5F 5KH6A 1BBWA 1MUZA 4KN4X 1QA6A 3S14J 1E7OA 2KJCA 1EFWA 2CUBA 3DTKA 1BR4A 2QBYA 1SRMA 4A3JJ 2H3EB 4KRTA 4N4HA 1EIYB 5M5XJ 1JUSA 4BHBA 2EBPA 3DLAA 2R5ZB 1IL2A 2R0QC 3SJMA 2WAEA 4E7KA 3ZQLA 2J6FA 4M78G 2QAZA 4HVVA 3VUZA 3OS2A 4C0DB 4MZPA 4DBHA 2H09A 2P4WA 1ZAOA 3S3MA 4RMOA 1YFSA 3SFMA 2HDAA 4O3MA 3LWHA 3O6BB 1JE8A 2EYXA 2LFBA 1Q82U 4RBOA 1BW6A 5M3FJ 1BC8C 1UJ0A 1AWWA 4LVKA 1TL8A 2DJZA 4H2XB 1RIOH 4P72A 3GF2A 1Y8RB 1V5EA 2HMAA 4PGGA 4OAYA 2L02A 3KXTA 5IT9Z 3JB9F 4PLLA 3MZYA 4HX8A 5FWCA 1RAIB 5KYNA 2IAIA 2VN2A 4CCMA 5GANg 2NS7A 2WSEE 2DFFA 4PJJA 3I56I 4OB0B 3C2GA 1OCTC 4C92A 2EV5A 4H2YA 3JB9G 3MQ0A 4YRCA 2X4JA 4LUEA 2VBXA 5GMKi 1N75A 2FXAA 4TVYA 2H27A 3PNWC 3OOPA 3ZMUA 4KBMB 3PVLA 2RC4A 5DEQA 2V6CA 5IP6A 4XKVA 1BOAA 2I0NA 2XAQA 2RM4A 3FM3A 4YRSA 3CZ6A 1IN7A 3EH2A 1QVPA 3VS6A 2IY5A 1KQ1A 1RADB 4BXFA 2RPNA 3OW2P 1NBEB 1RPWA 2QK0A 4D8DA 1KG1A 2P0WA 1Y8QB 5KYWA 1YJNT 2UXXA 4LVIA 4UP9A 1V29B 3F8BA 3WXMB 2CSIA 3E9GA 4N4IA 5CKBA 4IVNA 4ZC3A 1JKPC 4JX5A 4HQMA 3KLNA 1Z91A 4RMNA 3MKWB 4AM3A 4LLGF 4RAZA 1R49A 3IC7A 5HCKA 1OCOH 1TWCJ 1YE9A 4XLEA 3LAJA 2EYYA 3P8DA 2JSCA 2O2OA 4E7HA 5GJVB 4P71C 5M5YJ 1F36A 3GZ5A 4H2TA 2PQ8A 4XAXB 4N4OB 1OR7A 5KAFC 2J6OA 5IP9J 2ZINA 1OX9A 2KAFA 1WHGA 1X2GA 1FTTA 5IXBA 3VS3A 2LY1A 4IRIA 3L2VA 3BLYA 1G83A 1HW2A 5K1PA 5JR3A 4N0BA 3FK6A 1H9TA 3A5ZA 1RR8C 1MGQA 3L7WA 2DETA 4HX7A 1MZBA 3A0HC 2CP5A 3NETA 1BI3A 3QYFA 4Y52J 3P8BB 2JW4A 1QVGA 3VV0A 4C0DC 2Y0SN 5BQTA 2H94A 1IRGA 4C8QB 1SAUA 4AIJA 4Q5SF 3LFKA 1QLYA 2RQRA 4IRGA 3OY9A 1IO2A 2KRHA 2COZA 5CAIA 1VQOT 4M7DE 4JP0A 3DSQA 2VVKA 1JUPA 3BT9A 2RQVA 3BR1A 3LSQA 3RZDJ 5CKDA 2F4OB 3I0TA 3CCLI 2NRAC 5HLTA 1I4K1 1MKMA 1JHFA 5LGTA 2EV0A 5DY9A 3I56A 5ICCA 1IW7F 1NEGA 2YUPA 2F5TX 5A2QZ 1UCRA 4J9DA 1NZ9A 3HPGA 1JXOA 1XX5A 4ESFA 4YFKF 4F93B 3F22A 4C2UA 4RAFA 3I35A 5GMKm 1XDSA 3I4PA 1ORKA 4YIFA 2SRCA 1WJFA 4XU0A 3DBRB 4QW2A 1P7JA 1AOYA 2HOEA 5A2QE 1LVKA 4UV9A 1APLC 1WLEA 2QGUA 3WTZA 2RI3A 2QZ8A 5CKEA 3UWNA 1AHDP 3H36A 4QQDA 2D2WA 1Y7XA 4J15A 3TEEA 1E0EA 4RDUA 5BS6A 5D5UB 1BKBA 1K9MU 2DT6A 2ESNA 2HPIA 4EV0A 1SEUA 3UNGC 4A93J 5FLXE 5KCHA 2MC4A 1VQ4T 3CMEA 1V54H 3HXLA 2JPBA 1H4SA 1R0CB 4CCLA 2JNGA 2OI3A 3JRIA 5C4JJ 3CMET 2ZSIB 2FSWA 1PM3A 3WE3A 2BHYA 3FXUA 2OZUA 4XICA 2QTVA 3ZPLA 3QWXX 5HLIA 1QGPA 3NTHA 1XGNA 2DXUA 3P7NA 1TUGB 5KYUA 2DPDA 2NNYA 4FETA 1S72A 3M8EA 2E1NA 3I56Q 3H5AA 5F0FA 3T0YA 3M4QA 3ROUA 3I54A 1QZEA 3LSTA 3WGHA 2A61A 4DOZA 3VYUB 2LNHB 2HTSA 2TRTA 4L9VA 1OYXA 2O9VA 1NJ1A 2Z33A 3BPVA 2BEOA 12ASA 4XIDA 2M0YA 1UECA 3HSRA 1EKEA 4RCBA 4XBFA 2DA2A 1LJOA 3H92A 1KYWA 1K7AA 4KITB 4BWAA 3M07A 2L9VA 3QWLA 2XHKA 3I59A 3ZOBA 3K1NA 3A74A 5KYYA 5C0MA 1HTTA 3QYEA 1RESA 4CCOA 1PKTA 4HWSA 3H9NA 3A8LB 1MNDA 1KJWA 4FW1A 3X2QH 2DBMA 4RGXA 3C2HA 5E20A 1C0WA 1B34B 1USYC 3G3ZA 1M1FA 1SHFA 3HOYJ 1O7LA 1SD4A 2JA5J 4NUBA 3KEOA 4I0AA 5J8FA 4N4GA 3BJOA 1WYXA 2R5MA 1K73U 1VQ5T 1WJDA 4DZPA 5FFXA 5I11A 4A4HA 2UV1A 2ZMEC 1LNWA 4IUUA 1MDMA 3PFYA 2KL4A 1USSA 1IRXA 2LBFB 5E17F 3A5YA 2OTJT 2K9MA 2JVHA 5HNFA 4OU0A 2DDAA 1ZR2A 2ZPGB 4YRJA 3X26B 3CCVQ 2CW8A 2NUTA 4RTZA 2X9DA 2BVMA 1O3QA 1I1GA 1U6GA 4B9XA 3W6KB 1WSUA 3A32A 1NEBA 1KD1C 5LJ5f 1MMAA 5F5WA 1J5WA 3M4YA 1ETKA 4RTYA 4P71A 2A08A 2TCTA 2FO0A 2XPWA 4Y92A 5FKKA 1SD5A 4BKXA 1VQ5Q 2FRHA 3WU2C 2DN0A 3ESWB 3HHHA 3P9IA 3CF2A 4AU7A 1U0JA 4ENKA 3BDDA 1KQ9A 3KZIC 2KFDA 2M51A 3NARA 1SD7A 4BGDA 5KVRA 1DU0A 2JQ7A 3AHUA 1NM7A 4FYYB 3VQXA 3CO6C 3MEVA 3O8GA 4LXCA 4LD5A 1D3YA 3R6SA 2HYFA 2R7FA 4BU2A 1ODDA 1WHKA 3GMEA 1WJAA 3CCEA 4XONA 1TWFJ 2OQRA 2XI9A 2PEXA 3S3OA 4Q47A 2K02A 2KIUA 1RABB 3I55A 4HT9A 1IV6A 2K2VA 5AT1B 1B72A 1H0MA 2QGFB 3MEWA 3SZTA 2Y48A 1SD6A 1KYZA 2I4OA 3CC2I 2E3CA 3F70A 1SFKA 1G5HA 3GTJJ 4RB2C 1C0AA 4J19A 3L2WA 1OFCX 5GAN5 4BJTA 3Q9VA 4Y15A 1IO6A 2HBWA 3X25B 4ESRA 3UPUA 1NJIC 1JRIA 1U78A 3PT9A 4K88A 3CCVA 3JB9D 1UHCA 4IJAA 2ZZDA 4RG2A 4C5EA 4B8XA 4DOWA 4M7AC 4AYBN 5J40A 4PJNA 1JJCB 2CYZB 2BBYA 2VQCA 3HRMA 4WXHA 4KT6A 3W3CA 4RB1A 3CCJI 1I0CA 1KHCA 2EA4A 1AVZC 3ONQA 3H0FA 4LD6A 2LJ0A 2WC2A 1VQ6I 4OMZA 4CYCB 4UUSA 3SFIA 2VB6A 1TNSA 1PNJA 1H3HA 2DQLA 3K4BA 3OIPA 1R4NB 4B48A 4CCNA 1T0HA 2CZ6B 4WTOB 2Q7HA 2ZXWH 5ERIA 2LZ6B 3IKLA 1U3EM 4UPAA 2AO9A 1SC7A 2F5CA 5LGNA 4JDSA 2HKNA 3SWNB 2DODA 2XTIA 2HDDA 1T33A 5E8IA 3KP4A 2KISA 3OYJA 3RKXA 2GBQA 2OJ2A 3VU3C 4S05A 4F7UF 2LY2A 1VQMI 2M0MA 1TT5B 3FRNA 2MH9A 4IUTA 2OZ6A 1OV3A 2Q2EA 2FZGB 4JLIA 5GAN6 1VQPT 5EEHA 3GFLA 5EEGA 1G3WA 1IGNA 3UA7A 1Q82R 4LIUA 1OZ3A 3A1YA 2G9WA 2BW3A 4KUMA 3IG2A 3ELKA 2Y4XA 4PJOB 3OD1A 3HFOA 3MAJA 1X2MA 1R23A 2RREA 3QQAA 2DDBA 1JGSA 5J3LA 1VQ6T 4ZH4F 3C3WA 1ZSGA 4Z89A 2NS8A 1HLVA 2E10A 4YP0A 3JB9H 3SZGA 3BQZA 2D8HA 3G71T 2HOSA 3J7AY 2HDWA 2FBHA 2XB0X 2ZCWA 3JRCA 3SEQA 1T0FA 3TDUC 4FM4B 4C8QG 3CMQA 1GUUA 1I5LA 3VYGA 2FPEA 2EQUA 2CUEA 4AIKA 1ZSZC 2LTOA 3O2PE 3K4KA 2Q0OA 2JPCA 4JZ4A 3TGNA 2I10A 2H6BA 1MNEA 1T08B 3H0IA 1QRYA 5E3MA 2HNIA 2KIMA 3L2UA 4FYWB 1K6YA 1E2XA 5JHUA 4OB1B 4CH4A 3BDLA 1P2FA 2B7EA 2DTHA 2IT0A 4IHWA 1BBZA 1YJ9A 1PUEE 2ZNYA 4MTEA 2KXDA 4II1A 1ADJA 2RMOA 1ASYA 4RG8A 4YIIA 3BC8A 1WZOA 3KUFA 4PZJA 1FMKA 2M9UA 3G6EA 2D5VA 1N8RR 4EIKA 3A31A 1VQ8T 2RHSB 4JRPA 1PRMC 1YCYA 4M3BA 4GDFA 2VKHA 3LSKA 4HNTA 1QHGA 4YEJA 1D8JA 2W10A 1F1BB 4M7AD 3OR2C 2QM3A 4BQOA 4RA2A 5FJ8J 3E6CC 1T3LA 1XSVA 2MABA 4PK4A 2H6CA 3IKVA 3Q0VA 4ZTJA 1VA7A 4IXAA 2AKKA 2Y9YA 2RQQA 4IX7A 4HVWA 4Q5WA 1QVFP 1PRLC 1GRIA 4YREA 4U0YA 3RYPA 3HGYA 4BBRJ 3CCJA 3HPHA 3RERA 2CP2A 4N0AA 1V4RA 1N5ZA 3O8VA 2P8TA 4BI4A 4YRIA 1XD7A 2BE7D 1VQPI 2FA5A 1USYA 1FYKA 3A5ZB 3HRTA 3HKZA 2BZYA 5FROA 2IGNA 1YS6A 4C2MJ 1Q95G 4OMNA 4EMGA 5KYWB 3E9HA 5ILSA 2R7SA 2EK5A 2YX4A 4XK4A 1X75C 2CREA 1WHLA 3EG9A 1WXTA 4RCCA 4U7BA 1B4AA 3CCSA 5FLXK 4A4GA 2E65A 1VYVA 2LCCA 3GUDA 3Q5FA 1QPMA 3H9JA 3Q9SA 4XTVA 4KR3A 3GCMA 3KPHA 2JM9A 4W1UA 4HA8A