3V8KA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with biotin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
322
structure length
322
Chain Sequence
b'SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
molecule tags Ligase/ligase inhibitor
source organism Staphylococcus aureus
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
total genus 93
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8kA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8kA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8kA02
4CO8A 1Y96B 4M72A 2ZZFA 1IW7F 1TH7A 3TUPA 4ZYGA 4GGGA 1I81A 3GFIA 1SETA 2IPQX 2QBYA 3K1MA 2QENA 1N9SA 5GANd 2EAYA 2ZT5A 1WNLA 2I4OA 5F1RA 4R8HA 2ZKZA 3RKXA 3HTZA 4M77C 2ZNZA 4NCXA 3REUA 2YSRA 5DDGA 2E7WA 2YR2A 4YRQA 4NL3A 1JJCB 2LKPA 1B34B 2C8MA 4IPAA 1KU9A 4OOIA 1J5YA 4C8QB 1BI2A 5GAOm 4M7AG 2HGCA 5GMKl 5LRSA 5CLSA 2YU3A 1J59A 4A0XA 2UXXA 3NRVA 4P73A 1WSUA 4YRKA 1V4RA 1R22A 5HS8A 3PCOB 4HT8A 4XSXF 2VT2A 4HW0A 1E1TA 4L9VA 4IHTA 3JCMe 1I6XA 4O5VA 2RHQB 2K4JA 2Q5IA 4P9FA 3MAJA 3WGHA 2VT3A 3ERED 3M1EA 4I2OA 5L3BA 2DU7A 3MCZA 3OD1A 1G4DA 2A61A 1N9WA 4XEOA 5FLXZ 2PMFA 3LAJA 2L54A 4LLLA 5KK1A 4YRTA 1STZA 1X2HA 4P71C 2RM4A 4M7DE 4KA4A 2BYVE 3RPUA 4CH5A 4S05A 3QPHA 3FWEA 1D8KA 5GAOl 1USYC 4LLNA 3JAMK 3P7NA 4F7UE 3CUOA 2ZBKA 1OYYA 4PJOE 3O2PE 1YW9A 3KP6A 3GFMA 5BPDA 1I4K1 5TRDA 5LEJA 3BY7A 3I71A 5AONA 4UVCA 4RDXA 2NYXA 2IVMA 1ZLKA 1J9IA 5GAN7 1TQIA 4HWTA 4OIQF 2M30A 5LJ5e 3H92A 2HQRA 2Q0OA 2Y75A 5L3DA 3M9AA 2RGVA 4DPGA 2EJFA 4XU0A 1YB3A 3TOAA 3KP7A 1YIOA 1SAXA 1G5IA 1GXQA 5GAN6 3BY6A 4PJOA 1W7PD 1S6LA 2DK8A 3ZN0A 2HKOA 4AIKA 3L00A 5K1XA 5KVRA 4YRJA 3M4QA 2K86A 2P5IA 2UWMA 3F8BA 1T2KA 1EIYB 1RIQA 1T38A 5ILUA 1IN6A 2L4MA 3LQRA 4J5YA 1JJCA 3A74A 2ZCWA 3TDZC 3BFMA 1XDSA 4M78F 2O8XA 4XTWA 1C0AA 1NJ8A 4ENMA 5K5RA 1D5VA 4BNCA 2F5CA 2DLLA 1U5TA 2DQRA 5HLIA 2XAHA 4P74A 2CG4A 4OINF 2QUFA 1TLHB 2O0YA 3K2ZA 5D6FA 4M7AF 3BPVA 1TTYA 4K87A 2GQQA 4KR3A 3GFJA 1W7PA 2LSOA 3BJ6A 5LJ3h 4KICA 4ZYDA 3HHGA 3TGNA 1ZAOA 3HOSA 1A04A 3RIRA 3E9HA 3HSEA 1QQIA 4Y17A 4FX4A 2P0LA 3VOEA 1DDNA 1N9RA 2DVEA 4M78E 2FBKA 1ODDA 1IAWA 4S04A 3PQKA 3I58A 3M8EA 4XLPF 1TNSA 5AIPA 1X56A 3HXWA 2ISZA 1T39A 1GXPA 1D3BB 5E18F 2KIFA 1P4WA 3JB9H 4U7DA 2XUBA 1LVAA 4IXAA 1UHWA 3E6MA 2ZO4A 4XTVA 5HDGA 1H0MA 4EM2A 1K78B 2QQAA 1WLEA 4RCBA 5GMKh 3F6VA 3MF1A 2KKOA 1NJ6A 1LDJA 1KYWA 5LJ5h 1IRGA 1U3EM 4MEXF 2HS5A 4NHJA 2D45A 4Q48A 4AIHA 4M7AE 2DK5A 2VBYA 4PZJA 5F5WA 4HBLA 4EJUA 2V1DA 5GANe 2IA1A 4I09A 2K57A 3N97A 2DQLA 2XIGA 3EYYA 1HW5A 3K9TA 1R23A 5DD8A 4BW9A 2XHKA 4EM1A 4PG3A 2Z33A 3EYIA 5CYVA 1HSJA 2HFHA 3JCMd 11ASA 2AMCA 2Q7EA 1XCVA 3L9FA 2G7UA 4YRGA 2FQ3A 2CO5A 1BC8C 1KA8A 4LK1F 2NAZA 1FBQA 4ZH4F 4LLGF 3ZMUA 2P8TA 1NYRA 2JN0A 3ULQB 2PLYA 1FYMA 3BW1A 3FM3A 2BBYA 2AS5F 5GMKe 4AH6A 1CGPA 2NRAC 3NEMA 1I8FA 2DDZA 4Q4ZF 1ON2A 5EEGA 4HLYA 4G7HF 4IRGA 1B8AA 5JFRA 1LJ9A 2EL9A 5LHIA 5CVJA 2ZXFA 4YG2F 4EO4A 4YPFA 3CDHA 1XSXA 5LHHA 2Z99A 4GO1A 4P55A 3ERRA 3JCMP 3RYRA 4TVWA 2EFQA 4IRHA 3R61A 1P2FA 4N0AC 5HGQA 4C8QA 4M74A 4C92F 3T8TA 1SERA 3BP8A 2XTIA 1FP2A 2PMUA 1O3TA 1F1ZA 1BBWA 1FZPB 1R00A 2Z5UA 1WQWA 3EUHA 1MDMA 1MJ9A 3GZ6A 5IT9K 1WU7A 2JRTA 1ZG3A 3O6BB 5ILVA 3GX4X 1SRYA 3WU0A 3MF2A 1BI1A 2ODRC 2ZIOA 5GAMg 4Y15A 1YG2A 5ELNA 4KT5C 1R1UA 1HBXG 3ZMSA 4C8QG 5JVTA 2WC2A 5LJ3f 2J3MA 5LGNA 5D5WB 1NJ5A 4XTYA 5LJ5j 2PMEA 4MTDA 4TVAA 3IRQA 2OBPA 4HWPA 3ECOA 1USSA 1FY7A 3JCMW 2C6YA 4OMZA 3BZ6A 4HA8A 1K7AA 1Z7MA 2HYFA 4E51A 4P75A 4YIIA 3UGTA 1KYZA 4I98B 1NJ2A 3RPQA 1MGQA 4UP9A 1S7OA 3IALA 2O3FA 2DTHA 2HR3A 4CXFA 4UP7A 1HTTA 1M5Q1 2HZTA 4P73C 2H27A 1OPCA 1IRFA 5HLGA 1X54A 4O2DA 2V9VA 5LJ3j 3HFZB 2MH2A 4YRCA 1KU2A 2XVCA 4HV6A 4M75G 1HK9A 1G3SA 4K88A 3JSPA 4YFKF 3WODF 2GXBA 2H6CA 2P7CB 4Q6GA 4M7DD 4BHBA 6PAXA 4YRSA 1FSEA 4OIRF 2PMHA 2QZ8A 4TV7A 2FSWA 2LDUA 1D3BA 4M75F 1ZREA 2EFWA 3CJNA 4TVAB 1O57A 1U1SA 1OR7A 4EJVA 1WPYA 3VU3C 4WXCA 4QVDA 3SWNB 4HDVA 3L2CA 4JK1X 5A2QZ 1JBMA 5EEHA 4WK8F 4P72A 1XSVA 5H6RA 4TQFA 2ZNIA 2ELHA 2NNNA 1KQ9A 4LJZF 3L09A 1LQ1A 3KLNA 2QHVA 2CFXA 4HDUA 2BEOA 5DCMA 2EFNA 5LJ3d 4PJOC 2BV6A 4B8XA 1O3RA 3WE2A 1Z1DA 1R58A 3VQVA 4XTZA 1YO5C 5H6QA 4RB2C 3U9GA 5D8LB 2L4AA 2VXFA 3LSQA 3VEPA 2HTJA 3PFIA 2EJ9A 3P8TA 5LGTA 3DFGA 4HT9A 5CVIA 4KR2A 2HTSA 1D3YA 2L01A 3JB9J 3KZZA 4RAYA 2P5KA 4N0AA 1S8NA 2F2EA 5LLQA 4HVCA 3IRRA 2O61A 1EOVA 3REXA 4EX5A 2IT0A 1WQ7A 1LDDA 1LOJA 1EVLA 4IHSA 2QLZA 4F7UB 3M4PA 1KQ0A 2DO7A 2G9WA 4F7UA 3FMSA 3RF1A 4FHTA 2OZUA 2QBYB 2LNBA 4YIFA 3HFVA 5FFZA 4HX4A 4JBAA 4J6YA 1FC3A 1H9GA 4L9NA 1H4QA 3HY1A 1G51A 2EJGA 3FXQA 3UGQA 5L3EA 3GFLA 4M75A 2E65A 1S29A 4P3PA 2P5VA 5ILSA 3A7AA 1ZLJA 2YHTA 3LAPA 3SWNA 4HF1A 5GAMf 3JCMJ 3PGGA 4KFCA 4OU0A 2LF8A 3ZMTA 4XLNF 5HLHA 3WGIA 4M78D 3Q9VA 1IXCA 1SD6A 1CF7A 2CW0F 3E97A 2GA1A 4RGUA 4C92G 4N9HA 5LGUA 2LF7A 3T0YA 3SWNC 2WWYA 2RVCA 1L0WA 3CO6C 1FWZA 1XDUA 2Y90A 3LA2A 3P9IA 4I7HA 3J81Z 1W4MA 2ETHA 4EQQA 1J75A 4KIFA 4KYWA 1KOGA 1YS7A 3FJPA 4BH9A 3MFKA 4UVBA 4R1HA 3FXRA 3WTSC 1JRIA 3MQ0A 5F6FA 4YRLA 4OIOF 2PG4A 2XASA 4K86A 3F21A 3TQNA 2EJRA 1IN8A 5C53B 5ICGA 1DUXC 3CTAA 2COMA 2GWRA 1XGSA 1YFHA 1V3FA 3WTZA 4ENNA 1HSTA 1ULYA 2MLGA 1I1GA 2PEXA 1MDMB 3C3WA 3W3SA 4MEYF 1GVJA 3M4GA 1BIBA 3F23A 2RDPA 3IKTA 1O3QA 2HNIA 2QVOA 3K1PA 3EFSA 2KJCA 4U0YA 2FNPA 1QZZA 5I21A 2XGXA 3QO3A 3HRKA 2JZYA 3J81K 4ZYEA 3REOA 2V79A 2WV0A 3D5LA 1REPC 3WTWC 3SZPA 3P8VA 2DPDA 4KMUX 3BJAA 3LC0A 1PP7U 3GW2A 2D2WA 3QPTA 4UNOA 2A07F 5GAMd 1KQ8A 2RB6A 4C8QF 2MBFA 2JSCA 3V8KA 4M7AC 3O3KA 12ASA 2ARSA 4RQFA 4BHPA 1KMNA 4KIGA 4C8QC 1EFWA 4UV9A 1FOKA 1ZYRF 2VOPA 1E24A 1H9TA 2OU2A 4MQ9F 3LQQA 4QLCU 2R7FA 3RESA 1IXRC 3BOQA 4M78A 1K6OA 4OLFA 2RA2A 2OA4A 2M87A 1XSDA 2PI0A 1JGSA 2TDXA 2L3DA 3TEHB 3QSUA 4RB0A 4P3OA 3T5XA 4WJ3M 2ZMEA 2ZJ2A 3MZYA 2I4NA 5LJ3e 4KUMA 2AKWB 2OQRA 4PGHA 2YLCA 4H2XB 2QM3A 2ZCEA 5GAN2 2GXGA 1QGPA 1B76A 2A6HF 4HF2A 1TW3A 1HC7A 2VC8A 5LBQA 1C0WA 4XSZF 3N4MA 3RKYA 1J7KA 1KMMA 1WKMA 3RUXA 2FF4A 1QE0A 4M75C 2E1NA 2Q7GA 4KQEA 4WWCA 1WWXA 3PZCA 4C92D 5GANf 3C18A 2J5OA 3FZVA 2Y48A 4UP8A 3A32A 5E1WA 1PUEE 1YQAA 3ECHA 2A68F 2ZR2A 3VQWA 2J5PA 4CGZA 3HSBA 2RHQA 2DEQA 4P3NA 4MMLA 4D0PA 3HSRA 4M78G 2IA2A 2NS0A 1FX7A 2ESHA 1QNTA 3PCOA 3C7JA 3HIFA 4PJOF 1EQRA 5HS9A 2FB7A 4Q47A 3KE2A 4F7UF 1MJAA 2CSOA 4WX9A 1XMKA 4P96A 1VTNC 1IN4A 1FNNA 4WF2A 1ZARA 5FFXA 2XAQA 5ERIA 2V1XA 2DZCA 2E7XA 1XN7A 1H4SA 2HOEA 4RQEA 5GAN5 2VE9A 4G7OF 1QZYA 1IN7A 3DP7A 1R5GA 2XKPA 5D5XB 4A6EA 3SQNA 1SD5A 2FMYA 2VE8A 4DQ2A 5DUKA 2XAGA 1KGSA 4F7ZA 3V8JA 5E8IA 5GMKm 5FGMA 1OKRA 3G1ZA 2E3CA 3QUIA 1RUNA 3I0TA 3E5QA 4ZIBA 4X5OA 1Y0UA 4M6XA 5E17F 1JE8A 2VXEA 1YFSA 2A6EF 4RGRA 3KETA 4HLXA 3I64A 3QO7A 1VQZA 1ASYA 4L5JA 2STTA 1ZHFA 4Y13A 1X3UA 1JHHA 3D0SA 4TQDA 4H2YA 1OYWA 3RDIA 4L18B 1K78A 1XGMA 3FHZA 4HF0A 1USTA 5GAN8 2OZ6A 4RB1A 1ZRDA 4M7DF 1XCBA 3IKLA 4RMFA 2VC0A 1I1SA 3VODA 1O7LA 1OYIA 1Z6TA 4GYGA 3FIFA 2H6BA 1ADJA 4U0VA 3BROA 2R7DA 1DP7P 1B1BA 4L87A 3JAMZ 5BQTA 4M7AD 4YYEA 1Z91A 4XTUA 5DV5A 5DD4A 4XEMA 2JTVA 2VC1A 3HRSA 1U8RA 2ZNYA 3W6KB 4M9SA 4IRIA 3R0JA 2EK5A 4M77D 5BPIA 2AXLA 4UHTA 2FE3A 4YROA 2MH9A 1Z7UA 5E1ZB 3TDUC 1UB9A 3GVAA 1IF1A 4G6DA 5D4RA 3WTTC 1X2GA 3I5UA 2FMLA 2Q7HA 2DAOA 3LWFA 2JPCA 1ZRCA 3G73A 3S2WA 4L0YB 1BN5A 1O3SA 2W25A 4OP0A 1ASZA 5GAMe 2DXUA 4ZZDA 4MHGA 4C92C 2K27A 3G3ZA 1AOYA 4WXHA 1R1TA 2I4MA 4MNUA 1FT9A 4G94A 4GXOA 3TO7A 2HEOA 1HW2A 4CS3A 4NL2A 5C51B 2VBZA 4AD9A 1YYVA 3E6CC 3I59B 3HTUA 3W6JB 1B4AA 4HAMA 2CJBA 1FSHA 3JTHA 3I59A 2ZT7A 1Q1HA 2A69F 3KFUA 4YRMA 4L9JA 1IUYA 1RUOA 5E20A 3V7RA 2EB7A 1KQ2A 4M78B 4EMKC 4YREA 2RHSA 2ADUA 4EMGA 4H2TA 4NQWA 4WCGA 3ML6A 5FB2A 1XB4A 1YTYA 1RNLA 3OV8A 3QRFF 4EGYA 2D1VA 2GA2A 2M5WA 3L7WA 4G6QA 3T8RA 2W84A 3MZHA 3OOPA 3BWGA 3RKWA 5GAOn 3AHUA 4IJAA 2QHSA 1E17A 3GXOA 2YPRA 4C92A 3QHSA 3WTUC 3GF2A 3GYHX 3IKMB 4CS2A 4ZTZB 1MGTA 4MTEA 4I0AA 3DQVC 2EWNA 3HYIA 5K1YA 4UV8A 5TJJA 2DI3A 5K5OA 5BS6A 3PQJA 3HRMA 2BGCA 3U2RA 3JCMh 1U78A 2FYKA 1YW7A 4P5OA 1ZH5A 3EFRA 2VBXA 5GANh 4ETSA 2OD5A 1FP1D 1P92A 1E1OA 2ZTGA 4M7DA 4Y91A 1Z05A 1W5SA 4ESJA 4H2WA 3JB9F 1M8VA 3VQYA 3EDPA 4CDGA 5D6EA 4A5NA 4YP0A 2DJZA 4RAZA 4CS4A 2ISYA 2ZXJA 1QF6A 3C1DA 5ICEA 4HZFA 4LMYA 3SZTA 4A6DA 2IW5A 1SD7A 1B7YA 3ABUA 2MC3A 3QO8A 3DPTA 2QQ9A 2H94A 3EETA 2CQKA 1B59A 3B02A 1MKMA 1U5TB 3LSSA 3V7CA 3JB9I 4RS8A 4FT8A 4M78C 2FXAA 1F9NA 4YRFA 3J7AO 4IVNA 2CWEA 2V1UA 4XRFA 1Z9CA 1FYKA 1LEAA 3JSOA 3IWFA 3HRUA 2DT5A 2OQGA 2RKHA 2DQ0A 4AVPA 1ATIA 2AMCB 2XRNA 2FOKA 3F22A 4UVAA 1MD0A 4AWXB 3RYPA 1LYLA 3UH0A 4ESBA 1RI7A 3P8YA 5E8GA 2HYGD 4MMKA 2ZT8A 2DFIA 5HDKA 1ZRFA 2G4CA 4C8QD 4M77A 1IZ1A 4JQFA 3E9IA 4YRPA 1G3TA 3KP5A 3ABTA 3HXXA 3WQZA 3V8LA 3RI4A 3COAC 3CUQB 2CGHA 2F5FA 2UXNA 4I01A 1AWCA 2IA0A 2Y0MA 1RZ4A 4EMKA 2KJBA 4V2SA 4EMSA 4HWRA 1B9MA 1BI0A 5JI6A 5GAMj 4OIPF 2EV0A 4J6WA 3FM5A 1OMIA 4R79A 4MGRA 2K4BA 2E10A 2MD5A 4HOBA 3TOBA 2ARTA 5ELOA 2PQ8A 1EH6A 4JUVA 4LGWA 5K1PA 3I53A 3U1DA 5CVRA 4BAYA 1R5HA 4CH6A 1YLFA 3TKYA 2PFBA 5GMKi 2CGPA 5LEKA 1BJAA 3F3XA 1G3WA 3RGLA 1TNTA 1B9NA 1T0FA 4M77G 2YX7A 4M75D 1IN5A 5AIQA 3E3VA 1O7FA 3TEGA 5DCFA 2E5AA 3HRTA 1BIAA 3JCMf 4RCCA 3E6DA 3A7UA 1EH7A 2QYOA 3DEUA 1W7PB 2A5YB 1WRJA 5ICFA 4LG0B 3GIBA 5E1XA 2Z9OA 2DXTA 1KU7A 2VOOA 1X01A 1HKTA 4K2EA 4YDQA 3INZA 3LA3A 2ZMEB 5GAOp 1Z6RA 1BOAA 3TEHA 4AIJA 3E5XA 3QNEA 3EQLF 3DPLC 4ZTUB 3WGGA 4M7AB 5DUIA 2P7VB 5ED4A 1LNXA 4M7DB 5J6XA 1EIYA 4EV0A 3QO5A 1LB2A 1KQ1A 1I5ZA 4HWOA 3J80K 2R3SA 2RHSB 4M9ZA 4ESFA 4HQMA 1EV7A 3ZPLA 1B70B 2XGTA 4A0ZA 4H2XA 1J0RA 5DEQA 4EJOA 2FEZA 2KIMA 1ZG1A 2ALYA 3NELA 4HWSA 2MA3A 4C92B 4H02A 3IKVA 2RQPA 4A0YA 3QP5A 1HXDA 4E70A 4A12A 3CUQC 2DW4A 3DXJF 3QU3A 2I4LA 4PCQA 2Q8KA 4EGZA 3DF8A 4KIBA 1SMTA 4KDPA 2DKGA 1PYSB 2EFOA 4TVYA 3CUQA 4M7AA 4M73A 2FBIA 3BDUA 4XTXA 1X55A 2M45A 2O6GE 4CH3A 3A5ZA 3TO9A 4YCUA 3VFZA 5DY9A 1NHAA 1BBYA 2Q5HA 5D5VB 3K69A 5IT3A 3ICAA 4LG0A 2ZR3A 5DYMA 3QAHA 1ZG5A 1H4VB 2EA2A 3F8CA 3HFNA 2FBHA 2VODA 3JCMX 4J6XA 5HOOA 4L9TA 2X4HA 1LJOA 1I27A 4YFXF 1SFUA 1WI9A 2E1HA 5D4SA 3JTGA 2K7LA 4C92E 3F8FA 4PJOG 3QOPA 5IT9Z 4BXUA 1DPUA 1LDKB 5FO5A 3RERA 3FF5A 3E6BA 4LNSA 3ZMVA 3HHHA 4YCWA 1P4XA 4CHUA 2ESNA 1QPMA 2DTIA 2NNYA 2HQNA 4TWAA 3M7GA 5H20A 3IWZA 3KP3A 2IJLA 5D5UB 4H0EA 2EA4A 2Q2EA 1B34A 4U88A 3HUGA 2QQBA 1R1VA 4M71A 1EVKA 4M77B 4PDKA 4UPAA 4G7ZF 2K02A 1FYFA 3HRIA 3QTCA 1G3YA 2GAUA 2I2LA 1SFXA 1SFEA 4NOYA 2CIMA 5JHUA 2CJAA 3I4PA 1FYLA 3R4KA 3GEZA 5LJ5d 5J8CA 3IL2A 2C7IA 4OMYA 4CZZA 4XQ3A 3BJOA 2PBIA 4EMKB 3ZQ7A 4KN4X 5L3GA 2VBWA 4EMHA 3RJPA 2M1BA 2HKXA 4YRNA 3LFKA 1F4KA 2RN7A 1MJBA 3GWZA 4HX7A 4M7DG 3MEYA 2JPBA 2JT1A 1GHCA 2HDCA 3TO6A 1HW1A 2XROA 1T6SA 1XMAA 4H2UA 3NEUA 1YFRA 3DSQA 2J3LA 2KIUA 1WQ2A 1CF7B 4WXDA 2E41A 1H4TA 3BJUA 4YFNF 3J80Z 1BM9A 3NQOA 3ZMDA 3FB9A 4G84A 2ARUA 1ON1A 1FBSA 3HXYA 1I5LA 4H2VA 3A31A 3WE3A 2DBBA 3CLOA 1L0OC 3NENA 1FPQA 5JR3A 4I0BA 5FLXK 3IHUA 2X0LA 4A54A 5BMZA 2GIVA 1ADYA 2DU9A 3VQXA 2RV8A 2ALYB 1HQCA 3DKWA 5LJ5g 5C52B 1E22A 3KZYA 1SD4A 3K0LA 3HXUA 5HVQC 1HKQA 4UXNA 3HXVA 1DPRA 1B70A 3JCMV 1EH8A 4CH4A 3MEXA 3AAFA 2DU5A 1BBUA 2FNAA 3GZ5A 1Z7NA 3KFWX 4KN7X 1S7AA 1MZBA 1K79A 4X9DA 3FX3A 2UZKA 3R60A 4PJOD 3F8NA 2ZNJA 4FX0A 3VB2A 3SB2A 2W24A 3ISPA 1TBXA 2F5DA 2Z3YA 4JRIA 4ON0A 1XGOA 3A7RA 3GO5A 1FBUA 3Q9SA 4J15A 1ONVA 4Z2YA 3QP6A 2H09A 5K5QA 4C8QE 5GMKj 2ACJA 5E3IA 3Q5FA 5DCMB 4P75C 1U6GA 1F5TA 2P6SA 1D8JA 1P4AA 5CVUA 1J2XA 3CMQA 2EV5A 2KRFA 1H641 2RC4A 4XU2A 3R07A 4BHCA 4YCVA 5HS7A 3LA7A 3L4GB 2G7HA 3JW4A 2E64A 2L02A 2STWA 5LRRA 1UFMA 2ZINA 4NB5A 1WYDA 2AKWA 2IY5A 1BI3A 1USYA 1J5WA 3FMRA 4P72C 1YFTA 4QWQA 4U7BA 3JCMg 3A5YA 3JB9G 4HYEA 2ZZGA 5F64A 4MQVA 3L2ZA 3HFZA 3CO7C 5KNNA 2W57A 5BOXA 2ZT6A 1KU3A 3F72A 3L4GA 3V4GA 3SXYA 1PYSA 1W5TA 4Q15A 3HOTA 1XGNA 4EM0B 2YX4A 1SMYF 4Q5SF 3RACA 3BPXA 4M6YA 2CYYA 3FXUA 4XBFA 3HXZA 2DQ3A 4ASNA 1RIOH 1B6AA 4BWAA 1R7JA 2M8EA 4M77F 1Y96A 3WU1B 1U5TC 5GAMh 4P74C 4A2UA 4EJTA 3HFOA 4PHCA 2XKOA 4B09A 5HDNA 4LB6B 2D1HA 3QU6A 3ZMZA 4ZYHA 3GLXA 4M75B 1GGMA 5GANg 3MWMA 4L5IA 5CVVA 3KP4A 4UUVA 3ROUA 1P6RA 2ZGWA 2V6CA 3V7SA 2GZWA 4PNOA 1UCRA 2RNJA 1YS6A 2XAFA 4DNCA 2EV6A 4G9YA 3KEQA 5ICCA 4HQEA 4LFUA 1LNWA 1B7YB 4CYDA 2FA5A 2IY5B 4EVIA 4ZZLA 3F8MA 4U0WA 5J8FA 3FMQA 2IRFG 3R0AA 3R6SA 2DTRA 3K1NA 3P9KA 3F6OA 3KLOA 3T1BA 3M8FA 1NJ1A 4ENKA 2XAJA 2WTEA 1BC7C 2VXZA 4L0ZB 4JRKA 1YGBA 5FD6A 4RGSA 3KP2A 2P6TA 2CJ9A 3BDDA 2PJPA 5D8KB 2VONA 5FD5A 2P5LC 4BQAA 3KEOA 1LEBA 2VN2A 3DV8A 5L3CA 1E2XA 3H3UA 3UFGA 2O03A 5LJ5f 4O3MA 4O6JA 4JLIA 4KMFA 2HWVA 4M9XA 3WG9A 4PJOB 2P4WA 3KCCA 1T98A 1R36A 4HX8A 2QWWA 3B73A 4LD5A 4RGXA 4LB5A 1NNHA 3I54A 4RB3C 3HSFA 2XV4S 3WTYC 4TTVA 3WTVC 1G6NA 4ENJA 4GYIA 1QO0D 1TQPA 3NETA 2W85A 2DTOA 3ZP5A 1SESA 4YRIA 5GAOq 4CICA 4X9CA 4GCVA 1UHMA 1G5HA 1PDNC 5GANj 2ZIMA 2DPUA 3JCMc 3L1AA 4XU1A 4I02A 4PGGA 3I7FA 4F7UG 2E1CA 2QHUA 3P9CA 1TW2A 2ODRD 2DZ9A 3IG2A 3JB9D 2ZZEA 4M75E 1NYQA 1W66A 2QHTA 3HY0A 2BE5F 3RL6A 4HV5A 3HTSB 2A3SA 3SFZA 3SHFA 1ZN2A 4P71A 5CJ9A 1JXSA 1IXSB 1TQMA 3IC7A 3RTRA 4M7DC 3GUDA 1HKSA 4QVCA 5GAN4 5LJ3g 5GAN3 2ZFWA 4BYYA 2MLKA 4IF4A 1U1TA 1U2WA 2B0LA 5A2QK 4KNYA 2IP2A 1JHFA 4A5MA 1ZGJA 3LSTA 4M77E 1S3JA 2QTXA 4LK0F 4XU3A 3H3ZA 4G8XA 3ELKA 1FLIA 3ZN1A 2OAZA 5GAOr 4H2SA 5CAIA 2FU4A 1PP8F 1YW8A 1ZGAA 3WTXC 2PN6A 3E5UA 1L3LA 5LHGA 2FRHA 1IL2A 4N9IA 1YCYA 1QBJA 4WI1A 4G85A 4P9UA 4YRRA 1XD7A 5L3FA 2RD1A 3JCMb 3VBBA 2EFPA 2YLBA 4N0BA 2F5EA 4EJWA 4A53A 4WJ4A 3JCMQ
chains in the Genus database with same CATH superfamily
3WG7H 4NBQA 3FK7A 2HSPA 3CBOA 1QVFS 4CO8A 3HDDA 1Y96B 4C3IJ 1M2VA 4M72A 2JMWA 1YJ9I 2ZZFA 3QPLA 1IW7F 4XONA 3GBQA 1HSQA 1TH7A 4EDUA 3I56A 4ZYGA 4GGGA 2NS7A 1I81A 3GFIA 1Y07A 3QZ9B 2XF7A 1SETA 3CCUT 3QYEA 2IPQX 2QBYA 3K1MA 1AKHB 1Y71A 2QENA 1YHQI 1N9SA 2EAYA 5GANd 1AZEA 2ZT5A 2KZVA 1WNLA 2M9HA 2HQEA 2I4OA 1WI3A 1FMWA 2NVTJ 5F1RA 4R8HA 3KFVA 2ZKZA 3RKXA 1Z7MA 1NYGA 3HTZA 4M77C 2ZNZA 1HLVA 4NCXA 1N75A 3L2UA 1Q86R 3ZRGA 3REUA 3DLLF 2YSRA 1PJRA 5DDGA 2E7WA 2YR2A 2KEAA 5EZHA 3S15J 1NPRA 3E9FA 4IIMA 2DO3A 4YRQA 2PVOB 1D0XA 4NL3A 1SHFA 1JJCB 1W1FA 2LKPA 1B34B 2AZSA 3CQTA 2C8MA 4IPAA 1KU9A 4OOIA 1J5YA 4ZN3A 3K4LA 1BI2A 4C8QB 5GAOm 4M7AG 2HGCA 2CQQA 4GLMA 5GMKl 5LRSA 1WVRA 5E3LA 3CCMQ 4BDZA 1UG0A 5CLSA 5CPRB 2YU3A 1SEUA 4CCOA 1P7IA 2R5AA 5D6XA 1J59A 3WXMB 5D6WA 3VS5A 4A0XA 2UXXA 1E6HA 1UUEA 1YITT 3H1CA 3NRVA 4P73A 3VSKA 1LKXA 4BUPA 1KSWA 3A8OB 1WSUA 4YRKA 1V4RA 2O9VA 2RHIA 3NTKA 1R22A 5HS8A 2H8RA 2K4YA 2XI9A 1Y8RB 2DA6A 4XSXF 3CPFA 2VT2A 1BW6A 2NS8A 4HW0A 4OB0B 1E1TA 4L9VA 3TU4K 4IHTA 1JUPA 1VQ8I 2OTLI 1DU0A 2KY9A 3JCMe 1I6XA 4O5VA 1M1EB 5KNLA 2K4JA 1CKAA 3RDVA 1AOJA 5JHFA 1ERDA 3NFCA 1TWCJ 3I5RA 3URGA 2Q5IA 2QKMB 4P9FA 3I4MJ 3MAJA 3FISA 3WGHA 2VT3A 1KQSA 1TC3C 3P8DA 2DDBA 3ERED 2CP5A 3M1EA 2CZ6B 4I2OA 2R5MA 5L3BA 2DU7A 5GP9A 3MCZA 3VUZA 5C44J 3OD1A 8AT1B 1G4DA 2JQ7A 7AT1B 2A61A 5IHNA 2PVDB 3ZFJA 1MMDA 1N9WA 2QA4T 2UUZA 2B86A 1WZ2A 4XEOA 5FLXZ 4QKUA 3OSFA 2PMFA 3LAJA 2L54A 5CQGA 2PUOB 4LLLA 5KK1A 3EG1A 2BVMA 4C5GA 5IY5H 2DA3A 3DCFA 4YRTA 1STZA 4OMPA 1X2HA 2JNGA 4P71C 1QVGA 2RM4A 1Y0MA 3CC7A 4M7DE 3HBLA 4KA4A 5CQYA 2BYVE 4XLHA 3RPUA 4S05A 3QPHA 1ACIA 3FWEA 3EGDB 3CC4A 4CH5A 1D8KA 3BZCA 5GAOl 1USYC 1VQ7Q 4YIRX 1MIJA 1Q81R 3JRHA 4MZMA 3FC3A 2HCKA 1JGGA 2KQWA 4HVUA 4LLNA 4E7KA 3KPHA 2ELKA 3JAMK 1GFCA 4DA4A 3P7NA 1YHQQ 3D5RC 4F7UE 1WCMJ 3G1OA 3GTOJ 2ID6A 3BQZA 3CUOA 4E7IA 4A3JJ 2ZBKA 3OS2A 3IAS2 1ACMB 1OYYA 4PJOE 3O2PE 2CV1A 1YW9A 1FIAA 3KP6A 4NC8A 3GFMA 5BPDA 2CP6A 2RJCA 4RUGA 3A8LB 1I4K1 4GFBA 5TRDA 5LEJA 4KUDK 3BY7A 3L2WA 3I71A 2BXZA 5AONA 6AT1B 4UVCA 4J9IA 4D5CA 2HXIA 4RDXA 3REAB 2NYXA 4RKUE 1OJLA 2IVMA 1R4NB 3H9GA 1ZLKA 5ECAA 1J9IA 5CKHA 2O4XB 5GAN7 4IZZA 2Y4XA 1JKQC 1TQIA 3M5AA 4DOVA 2HQ5A 4HWTA 1XX5A 1BW5A 2ZSHB 4OIQF 1D5YA 2VIXA 3B6CA 2CV2A 4LOCA 1QCFA 2M30A 1IHVA 5LJ5e 2QEXQ 2V26A 3H92A 2V6EA 4JPBW 2E1MC 2HQRA 4B48A 4NUBA 2Q0OA 2P4TA 2Y75A 3DTKA 5L3DA 3ZQCA 1A35A 3CCQT 1YJWA 5M3MJ 3M9AA 1LFUP 2NOJB 4ABZA 2RGVA 3LMMA 3ONQA 4F17A 4IHXA 2EJFA 2FZGB 4DPGA 4R0KA 4XU0A 2DOAA 1YB3A 3TOAA 4RDUA 2X4XA 4Q5WA 1VQ8T 2NVUB 1H3ZA 1MBHA 2PX9A 3KP7A 4MFEA 4IHVA 1BBZA 1YIOA 4ANJA 1SAXA 1GXQA 1WLPB 2JUGA 5GAN6 1G5IA 2LJ3A 5K7HA 1UGQB 3BY6A 3UKGA 3OYYA 5J40A 4JJDA 4ELZC 4PJOA 1W7PD 1S6LA 2MK5A 2DK8A 3ZN0A 4BEHA 3MQZA 2NYSA 2QGFB 2HKOA 3OS0A 2QA4I 4AIKA 2DERA 3L00A 5K1XA 3GBGA 5KVRA 4YRJA 4BBRJ 4BY7J 2ZZDA 3I56Q 2K86A 4RAFA 1H89C 3CD6Q 2UWMA 2P5IA 3M4QA 1TP4A 3F8BA 1X1AA 2OCEA 5C4JJ 1T2KA 1GCPA 4KULA 1EIYB 3HUGB 2XF6A 2XGEA 2YS9A 3GP8A 1RIQA 1T38A 3EG2A 5ILUA 3PIPF 1WFWA 3QTCA 1IN6A 2L4MA 5KH6A 1XC5A 3LQRA 1TT0A 1X3WB 4A3KJ 4J5YA 3E0JB 4OB1B 2ZCWA 3PE0A 1JJCA 3A74A 3TDZC 3BFMA 2QEXA 1XDSA 4M78F 5F27A 4GRIA 1VQMT 2O8XA 2M4KA 1I6HJ 3LOCA 2JXBA 2QEXT 4XTWA 3CPWA 4XN0A 3DPUA 4PK4A 3OYGA 1OX9A 3CC7Q 4PL6A 1IO6A 2F1LA 2BIVA 4ENMA 2YSQA 4CCNA 3M0PA 4FYYB 4IQJA 5K5RA 4CCLA 3O8GA 2VLAA 1D5VA 4BNCA 1JXOA 2F5CA 4L6V5 4RTTA 2DLLA 1YE9A 4CCMA 1U5TA 2DQRA 3I9V2 1UECA 2CJJA 5HLIA 2XAHA 1N77A 5C4XJ 2ABLA 4P74A 4PFZA 2CG4A 4OINF 1GV2A 2QUFA 3W6VA 2CP2A 1TLHB 3TREA 2O0YA 4Z89A 1VQLA 4BEHB 2VJ4A 3A0HC 3K2ZA 5D6FA 1O4XA 4M7AF 2JS2A 3BPVA 1TTYA 3CC4Q 4K87A 1FTZA 2GQQA 9ANTA 4C3HJ 2QEXI 1E0EA 2DBMA 4FSXA 4H02A 3GMEA 4KR3A 3S32A 3GFJA 2KMTA 2HVQA 1W7PA 1OOTA 3I9QA 3OSSC 2F4IA 2LSOA 3BJ6A 3CP2A 4KICA 4DJAA 4ZYDA 3GTJJ 1NEGA 5LJ3h 3HHGA 1HF0A 3VYRB 2CUZA 3TGNA 1ZAOA 5DM7F 3HOSA 1A04A 3RIRA 3E9HA 3VUBA 2FUG2 1QQIA 3HSEA 4Y17A 4FX4A 1G2BA 4IO9F 1KHCA 3CBPA 5CIUA 3VOEA 4JP0A 2P0LA 1D0ZA 1WJEA 2ZJQF 1DDNA 1N9RA 1WJQA 1Y6IA 5E3MA 5DTDA 5LFAA 2DVEA 2KMUA 4ZGEB 3M0SA 5GJWB 4M78E 2FBKA 1ODDA 1IAWA 2DIQA 4S04A 2D5VA 1OQKA 2ZAEA 3PQKA 3DEEA 1S72I 2HSEB 3M59A 3I58A 3M8EA 4XLPF 3CEYA 5GAEJ 3RF1A 3DBRB 1TNSA 5AIPA 1GLNA 5J26A 1X56A 4N4OB 1UJYA 3HXWA 2I8DA 5J4YA 2ISZA 1T39A 3PO2J 3NMZC 1GXPA 1E3HA 1WJBA 2O7OA 5E18F 1D3BB 2KIFA 1T0HA 3TSZA 5C0MA 1VQKT 1P4WA 3JB9H 3A01A 1SPKA 2W4SA 1E3PA 4U7DA 2XUBA 1LVAA 5E79C 1LPLA 2F48A 4IXAA 2KRNA 3NHNA 1UHWA 1F36A 3E6MA 1WJSA 2ZO4A 2M0CA 2DD5A 2G3RA 2GNCA 5HDGA 1H0MA 4EM2A 2M0MA 1K78B 1M3CA 3TEEA 2QQAA 1WLEA 4RCBA 3ER0A 2H8HA 5GMKh 1ETQA 3F6VA 3CCRT 3WU2C 2HDAA 2KKOA 1NJ6A 3MF1A 1LDJA 1PC0A 1KYWA 2MD0A 3CZ6A 3UATA 4KGVB 5LJ5h 1WJDA 2RAEA 1AA7A 2CU7A 2HOAA 1U3EM 1IRGA 4MEXF 1WGSA 2HS5A 5J3LA 2D45A 4NHJA 1ZUUA 3CC4I 1EX4A 1ZBXA 4Q48A 4AIHA 2OUMA 2DK5A 5KYUB 4M7AE 2VBYA 4D1QA 2J6OA 5CQEA 2GXAA 3BG3A 3H9QA 1JKOC 2F2XA 2LC4A 3U23A 4IL6C 1YWOA 2EKHA 2LRQA 4A4KA 3IQLA 4PZJA 5F5WA 2M1HA 1YJ9T 4HBLA 4EJUA 2V1DA 2QDYB 5GANe 3D5SC 2E1OA 2VQLA 2IA1A 2X6OA 3HGGA 4I09A 2CS3A 4X0GA 2VJIA 2E60A 1M90C 4XIDA 3JRCA 2OAWA 4A3MJ 2K57A 2F4MB 3N97A 4OB2B 4FL6A 1RKWA 2LH9A 2CQ7A 2DQLA 2XIGA 3EYYA 1AZGB 3O8VA 1DGRM 1HW5A 3K9TA 1R23A 3K4NA 1APLC 5DD8A 4BW9A 2XHKA 3A8HB 3HZJA 5IH2A 4LDWA 1UMQA 4EM1A 4PG3A 1PKSA 2FZCB 1T95A 2Z33A 3EYIA 5CYVA 1HSJA 1YI2I 2HFHA 4QPQA 1JU5C 1KK7A 4AFZC 3JCMd 3CD6I 2YUPA 11ASA 2AMCA 1KZHA 3CCMI 1YJWQ 2LZ6B 2Q7EA 1XCVA 3L9FA 2G7UA 3VS6A 2M2EA 4YRGA 3CCRQ 2FQ3A 1H8AC 1BK2A 4FCYA 2IGMA 2CO5A 1W4SA 4QT7A 3BR1A 3HOYJ 1BC8C 3QDRB 2NXNB 2WADA 3CCEA 1KA8A 4LK1F 2KL4A 1OU9A 2NAZA 2Q1ZB 1S7EA 3HJEA 1FBQA 4ZH4F 1WXTA 1WDXA 4LLGF 1K8AU 3DKMA 2BW3B 3ZMUA 2OTLT 4E6KG 2P8TA 3ZQIA 1NYRA 3ASOH 3G2BA 2E6NA 4KISA 3SD4A 2JN0A 3ULQB 2PLYA 3DEWA 1FYMA 3OW2P 2HVSA 3BW1A 3FM3A 1UFFA 4XRSA 3KEYA 2BBYA 3N5BB 4NQWB 3FXJA 2AS5F 5GMKe 4AH6A 1CGPA 2NRAC 1PUFB 1QP2A 1OQYA 3NEMA 2D0QB 1I8FA 1VUBA 1K73R 2DDZA 4Q4ZF 3S14J 1VQKI 1ON2A 4FW1A 5EEGA 1NEBA 4HLYA 2HDDA 4G7HF 1VF9A 4IRGA 1T56A 1B8AA 4HEA2 5JFRA 1LJ9A 2EL9A 5LHIA 4JZ4A 2XRLA 4FE7A 3MD2A 4FW2A 1BYMA 4XKBA 5CVJA 2ZXFA 4YG2F 3EGXB 2P0PA 1YIJA 4EO4A 4YPFA 2DODA 1X4PA 2X4YA 2K5FA 3CDHA 2BE9B 1XSXA 3HM5A 2O31A 5LHHA 1M4ZA 2Z99A 3TW6A 1UE9A 4GO1A 2A7YA 2FVUA 2GBQA 2HEQA 3CXCP 3OMYA 1VQKA 4P55A 5FU6C 2K79A 3JCMP 3ERRA 3K4MA 1BOBA 3RYRA 3ZCOA 4TVWA 2EFQA 2M9UA 1WH5A 3S1QJ 4LUDA 4IRHA 3UA7A 3R61A 1P2FA 3UR3C 2IGOA 4HNUA 4N0AC 5HGQA 1YITI 3CC2A 4C8QA 4M74A 1YIJI 2YUNA 3C95A 4C92F 3T8TA 1SERA 3MP8A 5FWBA 3BP8A 3LSQA 5KYXA 3I55T 4FT4A 2XTIA 1EF4A 3F70A 2F6CA 1FP2A 4C3JJ 2PMUA 1O3TA 1F1ZA 5FKKA 4D8DA 3OW2A 4LNPA 1BBWA 1FZPB 1K76A 1LVKA 2R57A 1R00A 4CUGA 2RK2A 1LPQA 2EQRA 1YBYA 1OFCX 2KLOA 2LDMA 2LMJA 5J39A 2Z5UA 5GAHJ 1WQWA 3VYHB 3ZL7C 1JB0E 3EUHA 4XLFA 1MDMA 2IS2A 2D9TA 1MJ9A 2W0ZA 2GLOA 3GZ6A 1UGPB 5IT9K 4II2A 1WU7A 2L7ZA 1XTAA 3SFIA 1ETYA 2JRTA 4VUBA 3GPLA 1ZG3A 3O6BB 1P7JA 2DMQA 5ILVA 3WU0A 3GX4X 3MKZA 3OYCA 2CSIA 3EHRA 3H0FA 1SRYA 3MF2A 1BI1A 3AG2H 4BI4A 1KD1R 1RLPC 1MBFA 3A0BC 3TVTA 2ODRC 5GTIC 1GUUA 2ZIOA 1JTYA 5GAMg 4Y15A 1YG2A 3UF4A 5ELNA 2GTOA 1SRLA 3J7AF 4KT5C 4A3IJ 1ZR2A 1OCZH 2WY8Q 3H0GJ 5F0FA 3SEZA 4Y7NJ 2FQ4A 2RI5A 1R1UA 1HBXG 1TUDA 3MO8A 1GXIE 3ZMSA 1QHGA 3PMTA 5JVTA 3THKA 3J7ZI 2WC2A 4C8QG 2LX9A 4KBMB 4CC4B 4BQNA 5LJ3f 4AG2C 2J3MA 5LGNA 5D5WB 2L9NA 1NJ5A 4XTYA 5LJ5j 2PMEA 4MTDA 4TVAA 2KI7A 3QG1A 3IRQA 2BZTA 2OBPA 3DTEA 4D9JA 4HWPA 1C1AA 3ECOA 3QPSA 3BTJA 1USSA 1IO2A 2R92J 2DL7A 2E4HA 1PM3A 3LYIA 4DEYA 1FY7A 2E5ZA 2JN6A 4B3XA 4OMZA 2C6YA 1JUSA 3BZ6A 2DFFA 1FIPA 3S1MJ 4HA8A 1K7AA 4AM3A 1NZ9A 2HYFA 2IBDA 2DOFA 3HEFA 2DA9A 2RQRA 5KYYB 4E51A 4P75A 2HPMA 1OI1A 4YIIA 3UGTA 3DLMA 1KYZA 4I98B 3E19A 3PNWC 1NJ2A 3RPQA 2L2PA 1MGQA 5M5XJ 4UP9A 2K3PA 3C2HA 2H1KA 1NM7A 2NUTA 1S7OA 3IALA 4ZDLA 1J3TA 2O3FA 2KRCA 1BA5A 2HR3A 1WHHA 2DTHA 4CXFA 4BJTA 2M0YA 4JS4A 1M5Q1 1HTTA 4UP7A 5KCHA 4BXFA 1K6YA 1MMAA 2HZTA 2QASA 4DEXA 1K8AC 2AHQA 2F4OB 1V5EA 4P73C 1RI9A 5HK0A 4ZDPA 1OPCA 2H27A 3DB4A 1ABOA 1M27C 1IRFA 3NPFA 1VQMA 3L2QA 5HLGA 2OTJA 1L0WA 3CCEQ 3A1YA 1X54A 4RTYA 4O2DA 4HCKA 2AQEA 3TP0A 3OYKA 1NK2P 3BE3A 2DFEA 3CCLA 2V9VA 3DLAA 5LJ3j 1X19A 1T8IA 4X6AJ 2MH2A 5KCOA 3HFZB 3JSCA 4YRCA 2HQAA 1KU2A 2EINH 2XVCA 4HV6A 4GLKA 2MC4A 1G3SA 2KQRA 1HK9A 4L59A 3JSPA 4M75G 4K88A 4YFKF 2NVYJ 3WODF 2FHDA 2P84A 2GXBA 2H6CA 1JUMA 2P7CB 2OI3A 2VPLA 1M3AA 4RTXA 4Q6GA 4M7DD 5IXBA 2R7SA 3BQYA 4BHBA 1SF9A 2OJ2A 1NTCA 3DWLE 3H41A 2DXCA 6PAXA 3EH1A 1PNJA 4J9GA 4Y33A 1FSEA 2BHYA 2PMHA 2QZ8A 4TV7A 4OIRF 2NUPA 3WVDB 2W1OA 2EIKH 1WHJA 2FSWA 1RR7A 2LDUA 1D3BA 2DAQA 4M75F 3K4BA 5EG2A 1M90U 1ZREA 4CH7A 2EFWA 5FJ8J 2EIFA 2EBPA 5FU7B 1A6QA 1D1AA 3CJNA 2LNVA 2RHXA 4TVAB 1O57A 3C4SA 1U1SA 1OR7A 1SVMA 4EJVA 3I4NJ 1RABB 1WPYA 2M16A 3VU3C 4WXCA 1IJWC 3CCJI 4C5IA 2L89A 2M34A 3OYNA 4HDVA 3SWNB 4QVDA 3L2CA 4JK1X 5A2QZ 3S3MA 1B3QA 5IPAA 2DMUA 1FOYA 1JBMA 3LLRA 5EEHA 4WK8F 4P72A 1XSVA 3A4CA 5H6RA 1D1BA 2C0IA 2GGRA 5L23A 4XKWA 3JRAA 5KCMA 2ELHA 4TQFA 1AWJA 2ZNIA 2NNNA 1KQ9A 4LJZF 3CCRI 1I3AA 3S16J 3L09A 1LQ1A 3O8HA 3KLNA 5FKMA 2QHVA 3RQIA 2VV5A 4RTVA 2CFXA 4KITB 4M3BA 2VASA 5EDNA 4Z8AA 1WI7A 3REBB 4HDUA 2BEOA 2AO9A 5DCMA 3M4OJ 4AMCA 2EFNA 5HY6A 2RNAA 4UUSB 4BXXJ 2R7UA 2DETA 1N8RR 3E1SA 3HP9A 5LJ3d 4PJOC 2BV6A 4B8XA 1O3RA 4A4FA 3OR1C 3WE2A 1Z1DA 1B72B 2KFDA 2HI3A 1R58A 3H0DA 2D0NA 2Y9ZA 4XTZA 1YO5C 4BD3A 1I50J 2V1NA 1XG1A 5H6QA 1FMVA 1WYXA 4RB2C 3VRZA 1SANA 3U9GA 2L4AA 1WJ5A 5D8LB 2JRMA 2IIMA 2KYMA 3VEPA 2LP5A 2HTJA 4RTWA 3PFIA 4C0ZA 2EJ9A 4F14A 4L5GA 4BE0A 2XMFA 2JK3A 2ZPBB 4BL0B 1UGVA 2BE7D 1PUFA 1UTIA 3P8TA 3W2VA 5LGTA 3BG9A 1XOVA 4XNFA 4BE2A 3DFGA 1JT0A 2QK0A 3MEUA 1VQ9T 4HT9A 5CVIA 1XNIA 3I5SA 1OR7C 1YN8A 1I39A 5HK3A 1TWHJ 2HTSA 1G5VA 4KR2A 1D3YA 2LY9A 1M8MA 2O4XA 2L01A 3JB9J 3KZZA 4RAYA 2R5YA 2XF5A 3TEHB 2P5KA 3H5AA 2KIQA 3CCUI 4G12A 4N0AA 2CUDA 1S8NA 3CCMT 2F2EA 1S1NA 5LLQA 4HVCA 1R0BG 3PVLA 3IRRA 3LWHA 1PSFA 2O61A 2MWPA 2F5TX 1EOVA 9ATCB 2IT0A 1WQ7A 1LDDA 3REXA 4EX5A 2X48A 1LOJA 1IXDA 1RL2A 1EVLA 4XKCA 2K9SA 1EJ9A 2HL3A 4F92B 1WXBA 4IHSA 2QLZA 4F7UB 5FU6B 3M4PA 3H0IA 1KQ0A 2DO7A 3TL4X 2G9WA 4CRIA 5EG0A 1X6BA 4F7UA 3H36A 2ZC2A 3FMSA 5JLWA 4FHTA 3JR9A 1WPKA 2OZUA 2QBYB 3CCUA 2I4MA 4XOPA 3OYIA 2LNBA 3M8JA 1X2QA 3KYDB 2AK5A 4YIFA 2I5UA 3HFVA 3HRIA 5FFZA 5J3BA 4HX4A 4JBAA 4J6YA 2ZXHA 2QQSA 1FC3A 2QQ8A 1H9GA 4RTZA 4Z02A 4L9NA 4V2FA 2X4WA 1VQ4I 4CSWA 1TTHB 4HNVA 1O9SA 4J83A 2MCNA 2OTLQ 1G51A 2L3PA 3HY1A 1MV3A 2EJGA 3FXQA 2WAFA 3UGQA 1C6VX 2ELJA 5L3EA 3GFLA 4M75A 2E65A 1S29A 3VWBA 4P3PA 3SZGA 2P5VA 2NLUA 3Q1JA 4PKCC 2DFHA 5ILSA 4KRTA 2AZVA 4L5EA 4X1EA 1ZLJA 5IOZA 3A7AA 2YHTA 3LAPA 3SWNA 3DTIA 4HF1A 5GAMf 3JCMJ 1K73U 2RH2A 1OLTA 3PGGA 1WJAA 4RLFA 1QZEA 2KISA 2PMZN 1FEXA 2Y4YA 1U3OA 1VQPI 4KFCA 1VQNI 4OU0A 2LF8A 3ZMTA 3K7AJ 4XLNF 5HLHA 3WGIA 2KGTA 4Y92A 4M78D 2B9SA 3Q9VA 1IXCA 1SD6A 1CF7A 2CW0F 3E97A 4QTRA 2GA1A 3FK6A 4RGUA 4IX7A 4N9HA 1LFPA 5LGUA 1Y39A 2YUSA 1QKXA 4LVJA 2LF7A 1QRYA 2BOLA 3ZR8X 1WHMA 4J7IA 3T0YA 1OEBA 3SWNC 2WWYA 2RVCA 1AKHA 2VJ5A 4B47A 2EZIA 2JOYA 3CO6C 1TWGJ 3LH0A 3JCMX 1FWZA 1SRMA 1RAGB 5CK9A 1RETA 1XDUA 1ETOA 2LMDA 3CC7I 2Y90A 4A63B 1VQ9I 3LA2A 3P9IA 4I7HA 3J81Z 1FJLA 3P8HA 1W4MA 2ETHA 3MKLA 4EQQA 1J75A 2O9SA 2JTMA 2Y0SN 4KIFA 5J1UA 4C5HA 2AHJB 3IKLA 3FKJA 2ESWA 4QSHA 4KYWA 5EC7A 1UGRB 1KOGA 1YS7A 3FJPA 1QVPA 2RK1A 1I5OB 4BH9A 2QAZA 2QDLA 3MFKA 2EIJH 4UVBA 2V9KA 4R1HA 1SKUB 3FXRA 3WTSC 1JRIA 2V1RA 2GF7A 1JJ2P 5EF6A 3MQ0A 5F6FA 3LGFA 4YRLA 3BZKA 2LY1A 4OIOF 2K6DA 3OYJA 3G1MA 2PG4A 1WJFA 2XASA 4K86A 4BI3A 4C2UA 3F21A 2RJEA 4HCBA 3TQNA 2NUTB 4XK8E 3N05A 1M3BA 2EJRA 1WA7A 1IN8A 1FOWA 1K8AR 1ZR4A 2BZ8A 5C53B 1VQ5A 4AG1C 5ICGA 4DOZA 3H35A 1DUXC 1VA7A 1LUJB 1NE8A 4KGXB 2XGCA 1PD1A 2CW8A 1I3QJ 2COMA 3CTAA 1M1KU 2GWRA 1XGSA 2YRVA 1YFHA 1KC8C 1V3FA 3WTZA 4ENNA 1HSTA 1ULYA 2MLGA 1I1GA 2PEXA 1MDMB 2O9LA 3C3WA 4Y28E 3W3SA 4MEYF 1GVJA 3HL8A 3M4GA 3I55A 1BIBA 1YRNA 1BCOA 1EIFA 3F23A 2RDPA 1JO8A 1T08B 3OWTA 3IKTA 1O3QA 5I22A 2XDBA 1BR2A 2CP3A 2HNIA 2QVOA 3K1PA 1MH4A 3EFSA 2KJCA 5KE3A 2A8EA 4U0YA 1JQQA 4D7NA 1V55H 2FNPA 2GCXA 1QZZA 5GTHC 1SVLA 5I21A 3A8GB 2W00A 2XGXA 3QO3A 3HRKA 2JZYA 3B6AA 3J81K 2X51A 1X4OA 4ZYEA 2B8AA 2DA1A 1X1CA 1OPKA 3REOA 2V79A 2WV0A 3D5LA 2JW4A 3M0TA 4UUTA 4OGCA 1REPC 5CO7A 3SZPA 3WTWC 3P8VA 2DPDA 2O8KA 1K83J 1MBEA 4KMUX 3I55I 3BJAA 3LC0A 1PP7U 2CV0A 1N25A 3ZQFA 2R7XA 2EKOA 3GW2A 3ZQLA 2WY7Q 2D2WA 2E5KA 3QPTA 2HAXA 3CCVQ 3HOZJ 4UNOA 3J7AY 1QVGS 1XS9A 2ROTA 3IH2A 2M02A 1WXUA 2A07F 5J47A 1U5SA 1RKTA 1VQ5Q 3VKIA 3KX2A 3MVPA 5GAMd 1KQ8A 1YJNQ 4MFDA 1OCRH 2EZLA 3DKYA 4F52A 2MMPA 2RB6A 5B5EC 1ZLMA 3R6OA 5A2QE 2A6TA 3A01B 4B1RA 2XU8A 2LYCA 4C8QF 2MBFA 1AT1B 4IUQA 2WB1N 5FKOA 2EZKA 2JSCA 3V8KA 4DYRA 2R5ZA 3M3YJ 5K7ZA 1UJ0A 2RI2A 3CMAA 4MDXA 3CF2A 4M7AC 3KYCB 3O3KA 12ASA 2LBFB 2ARSA 1Y1WJ 4RQFA 3A7UA 4BHPA 2K9MA 3U1KA 4XQFA 1VYTA 1KMNA 2XHCA 2X85A 4KUIA 4TVRA 3BCBA 2L2OA 4KIGA 1K4SA 1MBJA 1W0TA 4C8QC 1EFWA 4UV9A 4D5FA 1FOKA 3EG9B 2K3XA 1YITA 5FKNA 3QQAA 1K1ZA 1ZYRF 1GBQA 2VOPA 3EG3A 1E24A 2SRCA 1H9TA 4OF1A 1SFOJ 1JJ8C 1MH3A 2BW3A 2OU2A 2YU9J 2KAFA 2VKVA 4MQ9F 3LQQA 1R6RA 2HPIA 4QLCU 2R7FA 2XICA 2EVRA 2YWWA 3RESA 3BOQA 1IXRC 4M78A 4RMNA 4CZCA 1K6OA 4OLFA 2RA2A 1Z3XA 2OA4A 3JV3A 3CJQB 4ZJZA 3W2WA 3CCJT 5FU7C 2M87A 5F08A 2XD0A 1XSDA 1JGSA 2TDXA 4JX6A 2L3DA 2PI0A 2MIOA 4RB0A 5F1JA 1VQLI 4PLIA 5KYYA 1RUWA 3QSUA 4P3OA 3T5XA 4WJ3M 3W3CA 2Z0WA 1IHWA 4FYVB 2IXSA 2ZMEA 2ZJ2A 3MZYA 3CMYA 2VKNA 4KUMA 4AT1B 5LJ3e 2I4NA 3VRYA 1M30A 2AKWB 2OQRA 4M3FA 2DXIA 4PGHA 2YLCA 4H2XB 4YREA 2QM3A 2ZCEA 2EGEA 1B8IB 1AWXA 2GXGA 3S3OA 1QHHD 1SSFA 2KDOA 5GAN2 2ECZA 1YX3A 3KBGA 1QGPA 1KG1A 1DQUA 1B76A 1YJ9A 3ZGKA 2A6HF 5B1AH 4HF2A 1TW3A 1SHGA 1AD5A 2DYBA 1HC7A 5EGOB 3OSGA 2VC8A 4LXCA 5LBQA 4B3AA 1C0WA 4EPCA 3EUAA 3SEMA 2K7AA 4QQGA 2LP0A 4XSZF 3CD6A 3K70C 3N4MA 3RKYA 1M2OA 1J7KA 1ZKGA 1UEBA 2VKDA 1WKMA 2QSGX 2D1XA 2RQWA 3RUXA 2FF4A 3I55Q 1QE0A 4HXJA 1VQOT 2YUQA 4M75C 2O2OA 2E1NA 2P0WA 1BB9A 2Q7GA 1Y0NA 2W10A 2XG8D 2OTJQ 5FROA 2L9VA 4WWCA 4KQEA 1WWXA 4EATA 3SHWA 4CA0A 1OCCH 4GBQA 3PZCA 4C92D 2PJRB 3RR6A 5GANf 3C18A 2J5OA 2XDVA 3FZVA 1EFNA 1QVFA 1KIKA 2Y48A 4UP8A 1UHFA 3G7ZA 3A32A 3FIWA 2E12A 5E1WA 1PUEE 2M8GX 3G4SA 4BUGA 1YQAA 3X24B 3QODA 3ECHA 2A68F 2IS1A 2ZR2A 4ATOA 3VQWA 2J5PA 2O5RA 4CGZA 3HSBA 3RQ4A 2RHQA 1LE8A 2DEQA 4P3NA 4MMLA 4D0PA 3HSRA 4W97A 3OYDA 1PRLC 4M78G 2IA2A 2NS0A 1FX7A 2ESHA 3AL0C 3HHTB 1QNTA 1BR1A 1KJWA 3PCOA 1KONA 4ME7A 3C7JA 3OMGA 3PTAA 3HIFA 2BUDA 3L2VA 4FIBA 4PJOF 3BG7A 1J09A 1EQRA 1YIJQ 4W1UA 3MZ8A 3PSFA 5HS9A 2FB7A 1K9MU 1OZ3A 4Q47A 3CC7T 3KE2A 4F7UF 3CP8A 1MJAA 2CSOA 3G4SI 4WX9A 4XRMA 5I11A 3JCMW 1OV3A 2JSPA 1Y7XA 1XMKA 5GADJ 4P96A 1UG2A 1VTNC 3BR3A 2KE9A 1IN4A 1FNNA 2VGNA 4Z88A 4WF2A 3ABLH 1ZARA 1XPXA 4UB8C 2R7VA 3DU5A 5FFXA 3GNFB 3ABMH 2XAQA 5ERIA 3BR5A 1MV0B 2KDSA 2V1XA 4N4NB 2COBA 2JWTA 4OVAA 1Q81U 1C0AA 1Y56A 2DZCA 1X2NA 1T0JA 2KT8A 2E7XA 1XN7A 4IQ4A 2ID3A 2I0NA 1VQ6A 1H4SA 3UDCA 2HOEA 4RQEA 3K4CA 1Q1VA 3TW7A 2CT3A 4F16A 2VE9A 5GAN5 1VZ0A 2Y0SA 4ZN1A 1LE8B 3LGLA 4V2GA 4G7OF 1QZYA 1IN7A 2CQNA 3DP7A 3ABKH 1B72A 3K4JA 1R5GA 2XKPA 5D5XB 4QIWN 3JRFA 4M6VA 4J01A 1K61A 1RACB 2WAQN 3OIOA 4A6EA 1B7TA 3SQNA 2TRTA 1SD5A 2FMYA 2VE8A 4FSSA 3CDLA 4DQ2A 4I76A 4OB3B 2GOXB 3IUOA 4OAZA 5DUKA 4IUVA 2DYIA 5I2MA 2XAGA 1KGSA 4F7ZA 3V8JA 5E8IA 2LCCA 5GMKm 5FGMA 3DKXA 3BG6A 2XSDC 3OYMA 4IKFA 1POGA 5J1YA 2J05A 1OKRA 3G1ZA 2MSYA 4XOTA 5GPAA 1TT5B 2JTEA 1YIJT 4C30A 2E3CA 3FJ5A 4ZYAA 1RUNA 3QUIA 4IEJA 3PMIA 2E2HJ 1VQPQ 1VQNQ 1K0SA 4ZIBA 3QWYA 1HCRA 1VYUA 3I0TA 3X26B 4HKEA 1SG5A 4E47A 3E5QA 3BTIA 1NG7A 4F91B 2LTPA 1Y0UA 5EEAA 2LQNA 4M6XA 3A98A 4HPQA 1QVTA 5E17F 1X27A 1JE8A 2VXEA 1YFSA 2A6EF 4RGRA 4JJCA 3KETA 2D6FA 1F43A 1A31A 2HOSA 2CZ7B 1QVUA 3CC2Q 1VIFA 4HLXA 3I64A 2IS6A 2JA7J 2L0AA 3QO7A 1VNDA 2X3XD 1VQZA 4L5JA 1VQ8Q 2HBPA 2STTA 1ASYA 1ZHFA 1YRNB 2ZJPF 2JTFA 4Y13A 1X3UA 1MNEA 1JHHA 1VQ4Q 4HWSA 2X6YA 3D0SA 2E2JJ 4TQDA 3PUBA 4H2YA 1OYWA 2ZXIA 4HSRA 2K9LA 2N8GA 4I99C 1XGMA 3RDIA 4HF0A 3FHZA 1K78A 4L18B 3F9KA 1PD0A 1USTA 2DMTA 5CKBA 5GAN8 3GTMJ 2OZ6A 4RB1A 1ZRDA 1XQHA 3SFMA 4M7DF 2ZCFB 1XCBA 4A3LJ 3LSPA 2VC0A 1DP3A 2IAIA 5E3OA 1I1SA 1ZX6A 4XMYA 2E70A 2DEUA 3LSMA 3VODA 1O7LA 1OYIA 1Z6TA 4GYGA 4E2FB 3FIFA 2H6BA 1ADJA 1MSFC 4U0VA 3BROA 2R7DA 3TMOA 1DP7P 1B1BA 1PSEA 1R0CB 1QW1A 3VS2A 3JAMZ 4L87A 5BQTA 4M7AD 3MN2A 3K70D 3NTIA 1N8RU 2GFUA 2WSCE 1Z91A 4YYEA 4XTUA 3PO3J 5DV5A 2KP6A 5DD4A 3BCAA 3TP3A 3S2HJ 2JTVA 4XEMA 3V42A 4LD6A 2VC1A 3HRSA 1U8RA 2MI6A 3RMSA 3SYTA 4XK4A 2DL4A 4A4EA 2ZNYA 4QW2A 3W6KB 3CDIA 3VQVA 4M9SA 2VB6A 4IRIA 2K5LA 4RA2A 2WB1A 3R0JA 2EK5A 4M77D 5BPIA 1OCPA 2AXLA 4UHTA 3KYLA 2FE3A 2LX7A 3I35A 2MH9A 4YROA 1Z7UA 2M7BA 5E1ZB 3TDUC 5HNHA 1WIEA 5KAIC 2RF0A 1UB9A 1R49A 1TSFA 3GVAA 2LY2A 5IHIA 1GCQC 1IF1A 2V7FA 2XDPA 2XDDA 2C06A 3GZNB 4G6DA 5D4RA 1G8XA 1NJIR 3WTTC 1E6GA 2P0KA 1AVZC 1X2GA 3I5UA 2FMLA 2HD0A 3M0RA 3DLLA 1JJ2S 2Q7HA 5J1RA 1NJIC 3QIIA 2CIMA 1Z67A 2DAOA 2EQUA 3LWFA 2ICWG 3FBIB 1MSEC 2JPCA 2CZ0B 3JAME 1XTDA 1ZRCA 2L9SA 2YRDA 4C5EA 2OTJT 4LG3A 2RPNA 1NJIU 1VQMQ 3G73A 4IOAF 3MEAA 2L7MP 1ZSZC 3LW5E 3FDYA 3EUHC 1UHSA 2WAEA 3S2WA 2JM9A 4MIMA 2ZFUA 4L0YB 1BN5A 3CLQA 2W25A 3MKWB 1O3SA 2KRMA 2XIDA 4NS5A 4OP0A 2F2VA 1ASZA 4IUUA 5GAMe 1U06A 2A36A 2NVXJ 2DXUA 1W1WE 4Y3OA 4ZZDA 4MHGA 2K9NA 4F93B 2EGAA 2KXCA 4C92C 1OISA 2K27A 3G3ZA 1AOYA 2KYBA 2KSSA 4AC0A 3RMQA 4WXHA 1R1TA 2WV1A 2M0OA 2RJDA 1FXXA 2QGGA 1S5LC 1FT9A 4G94A 4GXOA 4MNUA 3TO7A 1GT0C 1ZQ3P 2E34A 2HEOA 5A0LA 1QVGP 1HW2A 4LE9A 4CS3A 4NL2A 2DMNA 1ITYA 1ZBJA 2VKHA 3PFYA 3OIQA 3NTHA 5C51B 2VBZA 4AD9A 1YYVA 3HOVJ 1ZQ1A 2KT1A 2BTTA 3E6CC 4CC2A 4CC7A 3I59B 3HTUA 3W6JB 3G71A 4PUSA 1B4AA 4HAMA 1ZUKA 1AHJB 1A6IA 3CF5F 2FPDA 3EGXA 4JJNK 2CJBA 1LCKA 1N78A 2EW3A 2GFAA 4FYWB 1FSHA 3HKZN 2LCSA 3JTHA 1RC9A 5CKDA 3HOUJ 3G71T 3CCLQ 3I59A 1GCQA 4BGDA 2MG4A 2ZT7A 1Q1HA 2A69F 3KFUA 4YRMA 4L9JA 1IUYA 1RUOA 1W2BA 5E20A 3V7RA 2EB7A 3META 1KQ2A 2PJRA 2E5QA 1T0FC 2DTZA 2VPRA 5LD2C 2KR3A 4M78B 4EIKA 4EMKC 2VXFA 2ADUA 4EMGA 2RHSA 2D8HA 4NQWA 4WCGA 4H2TA 3ML6A 5FB2A 2DOEA 1XB4A 5HLTA 1RNLA 3OV8A 5DM6F 1YTYA 2XK0A 3QRFF 3CCJA 3J7YJ 1W36D 3UT1A 4EGYA 1VQLT 2VXDA 2W82A 2D1VA 3IP4B 3HL2A 2XSJC 3JRIA 2WSEE 4CCJA 2GA2A 2M5WA 1R8OB 3L7WA 4G6QA 2LJ0A 3HPHA 4R55A 3T8RA 2HYJA 2W84A 2JJ7A 2K5CA 3MZHA 1NK3P 4OMFB 3OOPA 3BWGA 3RKWA 4OWRB 1W5CC 5EGOA 1VFCA 2EYWA 3MPUB 3O5ZA 5GAOn 4IJAA 3AHUA 1CKBA 3E7LA 2QHSA 3M07A 2DMPA 1E17A 3CCSQ 2QSHX 3GTKJ 2EH3A 3GXOA 3A2KA 3CXCA 2YPRA 4C92A 3QHSA 4N4GA 2BY1A 1UB4A 1FOXA 4F3QA 3WTUC 3GF2A 3GYHX 1Y57A 3IKMB 4CS2A 1JI8A 2DM1A 4ZTZB 1MGTA 2E71A 4MTEA 4A3GJ 2HBWA 4I0AA 2KRHA 3PSIA 4KH1B 3VYSB 2EQMA 2IS4A 1XMXA 3DQVC 2EWNA 3HYIA 5K1YA 4UV8A 5TJJA 1N6AA 4G6TB 2DI3A 5TGTA 1ZTRA 3DBLB 5K5OA 3JRDA 5A0DA 2H3EB 5BS6A 3PQJA 5DLOA 3HRMA 2DA5A 2BGCA 2JA6J 4LVMA 3U2RA 4BBSJ 3JCMh 1NLOC 1SVOA 1U78A 3KZIC 2FYKA 2RHZA 3VV0A 1VQOI 3H0HA 2DMOA 1YW7A 4P5OA 2NS6A 3K2AA 1ZH5A 1G2HA 2VBXA 3EFRA 5GANh 4ETSA 2OD5A 1FP1D 4HSTA 1P92A 2BY2A 4XL9A 4B4CA 1FMKA 4N4IA 2HKNA 2JS0A 1E1OA 2DA4A 2ZTGA 4XAXB 4Y91A 1Z05A 4M7DA 1W5SA 4ESJA 4H2WA 2DT7B 3JB9F 1M8VA 2JVHA 3VQYA 3EDPA 4CDGA 1W70A 5D6EA 2F5VA 3ESWB 4IHYA 4A5NA 3VYGA 4YP0A 2OCCH 1A0NB 1MMNA 1D0YA 2DJZA 2J06A 2ZPEB 4RAZA 3OYEA 4CS4A 2ISYA 1GDTA 3JRGA 2FZKB 1Z9QA 3ASKA 2ZXJA 3SDZA 3C1DA 4ZGDB 1QF6A 4HZFA 5ICEA 3MCAB 4LMYA 2X6XA 2XC7A 3SZTA 5IYBJ 4A6DA 2L5QA 2IW5A 3ZOBA 1SD7A 3HPGA 3A1PA 1Q7YR 1B7YA 3ABUA 1VQOQ 2MC3A 2ECBA 3RZDJ 1IZ6A 2DL3A 4AIDA 3DPTA 2LQWA 3QO8A 3G4ST 2QQ9A 2H94A 3S2DJ 3EETA 4YELA 4HRIA 1X1DA 2CQKA 3CMAI 1B59A 2FRYA 2P4RA 2L0KA 3B02A 1QU3A 1DGWY 1CSKA 1MKMA 3BG5A 2F2WA 1IV6A 1U5TB 2RQQA 2CUEA 2MWOA 3V7CA 3FRNA 3OQ5A 4ORZA 3JB9I 3LSSA 4RS8A 2IG0A 3PL8A 3OYFA 4FT8A 2LNHB 4M78C 3HGYA 2FXAA 1F9NA 4YRFA 5KYWB 3OYAA 3J7AO 4IVNA 2CSQA 2CWEA 2V1UA 1T3SA 4PJ0C 4XRFA 2HQHA 3X20B 4D6WA 3PIOA 4E7SA 1Z9CA 1FYKA 1RESA 1LEAA 3JSOA 3S3NA 2G6FX 3A02A 1YHQA 2YXYA 1TL8A 2K5IA 1NPPA 3IWFA 3HRUA 2DT5A 4R56A 2CH4A 3CPWP 1C0MA 1ZSZA 2JA8J 2QXFA 3ERMA 2L3SA 2RHYA 2OQGA 4QVZA 5LL6S 2RKHA 3LX7A 2LC2A 2DQ0A 4IOCF 4AVPA 4XLEA 5KHDA 2DL8A 1YX5A 1ATIA 2AMCB 2A28A 3M55A 1KD1C 2RHQB 5A0GA 2XRNA 2FOKA 3AG4H 3F22A 4UVAA 1MD0A 4AWXB 1TWBA 3AG3H 1YNZA 3QKJA 4E6RA 3RYPA 3EGUA 4LIVA 1SEMA 3M53A 2VKEA 4J9DA 1LYLA 3UH0A 3RCOA 2XKOC 4ESBA 1RI7A 1F1BB 2Y30A 5M5YJ 1GGMA 1D09B 3P8YA 4B43A 2CQXA 5E8GA 2HYGD 3C2BA 2DJIA 1OU8A 4U87A 3OA6A 4C2MJ 4MMKA 2ZT8A 2DFIA 5HDKA 1ZRFA 2G4CA 3OSVA 4YTLA 4C8QD 1KMMA 4M77A 1IZ1A 4JQFA 3D7SB 3E9IA 4YRPA 3CPWS 1G3TA 2AQFA 3KP5A 3ABTA 2KBTA 2LJ1A 1M9SA 1Q81C 4LITA 3W2AA 2VUBA 3HXXA 3WQZA 4XM3A 1ETXA 3V8LA 3IH4A 2CKKA 3HC7A 3COAC 3RI4A 3CUQB 4C2TA 2DJQA 3FXOA 2CGHA 2F5FA 2CYZB 3MHXA 5KYXB 2KRSA 3X28B 2UXNA 1FTTA 2CZ1B 3H6ZA 4OGEA 3CQZJ 4J19A 4I01A 2DFUA 1A5JA 2GOMA 1AWCA 2IA0A 2JVVA 2Y0MA 1RZ4A 3EFOA 4EMKA 2KJBA 2GIZA 2Y2ZA 2Y9YA 3H9JA 2RN8A 2LK2A 4V2SA 1T33A 4EMSA 3OMCA 2K9QA 4HWRA 4PJNA 1B9MA 3M0UA 1BI0A 5JI6A 5GAMj 4OIPF 1T3LA 2EV0A 1X6GA 2PU9B 3CCJQ 2QQRA 1ZUYA 4J6WA 4OMQA 4DYCA 1JKRC 1UG1A 3UA6A 4AFQC 2OPTA 3FM5A 4AFUC 1OMIA 4R79A 1JJ6C 3SDGA 4BJ6C 3QWXX 4B6MA 4MGRA 1K4US 3TCJA 2F69A 2O88A 2K4BA 2E10A 2MD5A 1U8BA 4LUEA 4HOBA 1BL0A 3TOBA 2ARTA 2R7ZJ 5ELOA 2PQ8A 2DVJA 1UELB 4KT6A 3VS0A 2H1LA 2E36A 2D8JA 2JA2A 4XR6A 1EH6A 1WH7A 5E3NA 2M51A 4LGWA 4JUVA 3I53A 4MZTA 3U1DA 5DLQE 1VQ9A 3G71Q 2K40A 5CVRA 4BAYA 1R5HA 4FASD 3GNGA 4CH6A 1YLFA 3TKYA 5AYFA 2PFBA 5GMKi 2CGPA 5LEKA 1ZHIA 2MABA 1BJAA 1M1KR 3F3XA 2V8KA 1G3WA 2DF6A 3RGLA 1TNTA 1B9NA 1T0FA 1QA6A 1ENHA 3M4YA 4M77G 2YX7A 4M75D 1IN5A 5AIQA 3AFHA 5J4VA 3E3VA 3KIOA 1UDLA 1EKEA 1O7FA 5I2SA 5DCFA 1VQ9Q 3TEGA 4Y4RA 2E5AA 3HRTA 4DIQA 1BIAA 3QWLA 2C0TA 1MW7A 2CRGA 2EYQA 2K9GA 3E6DA 4RCCA 3JCMf 2MFZA 1EH7A 2QYOA 1R77A 3CCMA 4C0FA 1JEGA 1VYVA 2EQKA 2HKQB 3DEUA 1QCOA 1ZA2B 1W7PB 2A5YB 3M54A 2GM4A 1U9OA 1WRJA 5ICFA 2E2IJ 4BJ5C 4LG0B 3VS7A 5E1XA 3GIBA 1H4QA 2K3BA 1X75C 4XLCA 1IC8A 4NC7A 1VQOA 2Z9OA 2FG0A 2DXTA 1JJ2A 3M1CA 1KU7A 2VOOA 1X01A 1CQTA 1HKTA 2OTJI 4K2EA 4YDQA 3INZA 4OAYA 2V1QA 3LA3A 2X4JA 2ZMEB 1Z0XA 2EIMH 5GAOp 1R4MB 1BOAA 1Z6RA 1X43A 1Q82U 3MKDA 3GLLA 2Y31A 4LDUA 3TEHA 1K4TA 4AIJA 3MP1A 1MBKA 3OS1A 3E5XA 2CW7A 1OULA 2X1DA 3GTQJ 1YI2Q 2CS7A 3QNEA 3EQLF 5IP6A 3DPLC 4ZTUB 3WGGA 2AXTC 2DPPB 2FPFA 4M7AB 5DUIA 2J7IA 3M9QA 2P7VB 5ED4A 1LNXA 4II1A 2CJAA 4MDWA 4MZPA 4M7DB 3CCVA 4ZTJA 5J6XA 4HNTA 2PQWA 2E19A 2MAMA 1EIYA 4EV0A 3QO5A 3RSNA 1LB2A 1KQ1A 1ZA1B 4A3CJ 1IRXA 1I5ZA 4AUXA 4HWOA 1TWFJ 5KAFC 3J80K 2R3SA 2KT0A 2Y69H 3GOXA 1VIEA 3HTRA 2X1EA 2RHSB 4E4HA 3P5JA 4PJMA 4M9ZA 2ED0A 4ESFA 2GQVA 2X9HA 4HQMA 1VOMA 1EV7A 1QWEA 2JMCA 3EHQA 2JUFA 4DYQA 5FLXE 3ZPLA 2BKDN 3CCEI 4HVWA 1B70B 2XGTA 4A0ZA 5C3EJ 4H2XA 1J0RA 1MNMC 3C12A 2F5KA 5DEQA 3E9GA 1VQ6T 4A93J 2LT1A 4HCCA 5CKEA 4EJOA 2FEZA 2KIMA 3JRBA 3ZQQA 1ZG1A 4HCZA 4C0DC 2ALYA 3NELA 2MA3A 4C92B 1V54H 3IKVA 2RQPA 4PJLA 5CKTA 4A0YA 4FU6A 5IXFA 3BR6A 3QP5A 3NGPA 1GFDA 1HXDA 4E70A 4A12A 3GCMA 3BLYA 5H2FC 4QQDA 1KQSP 2LRDA 3CUQC 1PYVA 3GTLJ 2DW4A 3S1NJ 2ME0A 3DXJF 4FE4A 3CMAT 1GVDA 3QU3A 1IV8A 4PCQA 2Q8KA 2CT4A 3EG0A 2I4LA 1NYFA 1G59A 3C94A 4EGZA 4CI0C 4ZDOA 2DCEA 2KROA 3DF8A 4K11A 4KIBA 1SMTA 4KDPA 3G6ET 2DKGA 2MGQA 1PYSB 2B7EA 2E3IA 3E2UA 2EFOA 2RREA 4XTVA 3WHCA 4TVYA 1HC8A 3CUQA 2RQTA 4J9FA 5M9OA 1RAIB 4M7AA 4M73A 1WHGA 4BY6B 1NJ8A 2BVLA 2FBIA 2GTJA 2JZ2A 4RTUA 4ESRA 1S72Q 3OW2S 4JDSA 2PUKB 4IUTA 2DA7A 3BDUA 3L2RA 1NG6A 4XTXA 1X55A 1X3ZB 2M45A 2O6GE 2A08A 3J81E 1YJNT 4CH3A 3A5ZA 1IDYA 4AVZA 3TO9A 1PCXA 3TEDA 3TQ7P 1IUFA 5IT9E 4YCUA 3VFZA 2FOWA 3CC2I 5DY9A 3LNQA 5IP9J 1NHAA 1BBYA 1Z7NA 2Q5HA 5D5VB 2RI3A 2XB5A 1VQ6Q 1UHCA 4AFSC 2HVRA 3H5NA 3K69A 3PCOB 1H8KA 1E3OC 4A3DJ 2KPMA 5IT3A 3ICAA 3C0CA 3CCST 1OX8A 4LG0A 2ZR3A 1OCTC 5DYMA 4BE1A 3SDBA 4RMFA 3QAHA 4OMNA 2VI6A 1ZG5A 1H4VB 2EA2A 3LSGA 3F8CA 3HFNA 2FBHA 3BC8A 3UPUA 2VODA 1MMSA 3NAUA 2YUOA 5TISC 4J6XA 5HOOA 4MLOA 5FKLA 4L9TA 3VYUB 4JLGA 1I1JA 3NWSA 3EG9A 2NOGA 2X4HA 1LJOA 1I27A 4YFXF 1SFUA 1KC8R 1GL5A 3M56A 1Y1VJ 3FKIJ 4RM3A 2W7NA 4E7HA 1WI9A 2LR8A 2E1HA 3F0CA 5D4SA 2JJ9A 3JTGA 2DLPA 4H4KC 1WHKA 2K7LA 3Q0VA 5IP7J 4C92E 3F8FA 4M3EA 2V8JA 4PJOG 3QOPA 1VQ6I 1VQ4A 1TUGB 4GDFA 4BXUA 4EEFG 5IT9Z 1X69A 2E5NA 3LSJA 1QWFA 4KH0B 1DPUA 1LDKB 3CJTB 5FO5A 4BY1J 3RERA 1BJZA 3FF5A 5IYCJ 1YP5A 1VQ8A 3E6BA 3S93A 4LNSA 3ZMVA 3HHHA 3G71I 2EQIA 3CCVT 4YCWA 1P4XA 3G1LA 2EPDA 1VQMI 1BU1A 3QYFA 4M3DA 4CHUA 1BKBA 2ESNA 1QPMA 1M2VB 3H9NA 3SEQA 3EUKL 2DTIA 2NNYA 1HOMA 2EPFA 8ATCB 2BZXA 4CC3A 2HQNA 2NVQJ 2MYSA 3EFOB 4FM4B 4HVVA 4ZGJB 3PFSA 1SAUA 1QLYA 1K73C 3M7GA 1NBEB 5H20A 5K1PA 3BR0A 2CP0A 3IWZA 3OIPA 1IGNA 3KP3A 2IJLA 5D5UB 1VQ7I 4H0EA 1DU6A 2VWFA 2CREA 2EA4A 2Q2EA 3GTPJ 4YRVA 1B34A 1V1CA 4U88A 4JYKA 4DOWA 2VJJA 2LVMA 4X1VA 4S0HB 4CCKA 4UY8I 2L8DA 3HUGA 2EBIA 2QQBA 1R1VA 4M71A 1EVKA 4M77B 4PDKA 4UPAA 4G7ZF 2K02A 1FYFA 2QI2A 2QKLB 1G3YA 2GAUA 1QKWA 2I2LA 4FQGA 2QTVA 3OB9A 4M4ZA 3CC2T 1SFXA 1SFEA 3I3LA 3HG9A 1YJNI 1N27A 4IURA 5JHUA 4NOYA 2VUMJ 3I4PA 4WTOB 1TWAJ 1FYLA 3PUFA 3R4KA 1PRMC 2COZA 5HKCA 1JTXA 3GEZA 1QVFP 2HXOA 1R71A 1SFKA 3A03A 2L9RA 1ORKA 5CCAA 2ECCA 3MMYB 1ZGWA 5J8CA 1SC7A 5LJ5d 2GBYA 4Z6YA 1ETKA 2VQGA 3IL2A 4LD9K 1TU0B 2C7IA 4OMYA 1Z3YA 5EYRA 3A5ZB 4F04B 3VPRA 1KC8U 4CZZA 4XQ3A 3NWTA 1M90R 3BJOA 4UC4A 2PBIA 5HODA 1M1GA 2RHUA 4EMKB 3CMEI 2R4GA 3NENA 3ZQ7A 4KN4X 2C0OA 4I6ZA 5L3GA 2VBWA 1YITQ 2R7QA 4EMHA 1MMGA 3RJPA 1TOVA 1VQ5I 3RZOJ 2LQ8A 3G6EA 2M1BA 4D7MA 1KQSS 2R7OA 2HKXA 4YRNA 3LFKA 2L7FP 1F4KA 2RN7A 4LDXA 1WFXA 4BQOA 3ZEHA 2K3YA 1MJBA 2V9PA 2LT4A 4QPOA 4B9WA 4DZJA 3GWZA 4C9YA 1EZZB 1X1BA 2EILH 3PT9A 4RG8A 4ZNXA 4HX7A 3PM1A 4P1WA 2JPBA 4M7DG 3MEYA 2JT1A 2I10A 4E7ZA 1GHCA 1X6OA 2HDCA 2IVWA 3TO6A 1HW1A 3CMEA 1RPWA 2XROA 4DBHA 1RLQC 1VQ5T 2QYZA 4RLQA 4B9XA 1T6SA 2M7AA 2FPEA 2COYA 1Q7YU 3QYHB 1XMAA 1B8IA 4H2UA 3NEUA 1WJRA 4M3GA 2DBKA 2LREA 4J9CA 4F55A 1YFRA 3DSQA 3WVEB 1R9TJ 2J3LA 1YFNA 3CCUQ 2KIUA 3PVQA 3FHNA 1WQ2A 2LCLA 1CF7B 4WXDA 2E41A 4V19K 1H4TA 1UGSB 3BJUA 3EAEA 2PMZA 2DE0X 2YRCA 4YFNF 4RM2A 3J80Z 1BCMA 1BM9A 2KNBB 2DDAA 4J9HA 3NQOA 3ZMDA 4FISA 3FB9A 3FLGA 4BU2A 4G84A 3ZQGA 2ARUA 1ON1A 1FBSA 3CCQA 1YJ9Q 1I5LA 2E1MB 3HXYA 4H2VA 4DGWB 2NWMA 2ZPGB 5B1BH 1Q86U 3WHBA 2R7TA 3A31A 3WE3A 2DBBA 3CLOA 3CCSI 1RRJA 2H3JA 2X6WA 4BS9A 4DW6A 1L0OC 3OYLA 3BR2A 1V5FA 3PNYA 1FPQA 1FYNA 4A3EJ 5JR3A 2X35A 3AT1B 5D7UA 3VS4A 4I0BA 2KK4A 5FLXK 2VYTA 3IHUA 2X0LA 1YJWI 5EZGA 5BMZA 4A54A 2GIVA 1Y8QB 2GQIA 1ADYA 2DU9A 3VQXA 2E6ZA 4KT0E 2E35A 2RV8A 3CMMA 3UNGC 2ATCB 3CCQI 2ENMA 1H3HA 3BTLA 2ZMEC 3I56I 1HQCA 2CFOA 1OZ2A 3QDFA 4HT8A 1E7OA 2ALYB 2MW8A 3K6GA 3DKWA 1Z7LA 4CYCA 3G4SQ 5LJ5g 5C52B 1E22A 3KZYA 1SD4A 2VGMA 3ULRB 1ZSGA 3K0LA 1KD1U 3HXUA 3OR2C 5HVQC 1HKQA 4UXNA 3ASNH 1H88C 2MPXC 1DPRA 1K9MR 1B70A 3HXVA 1RAHB 4JJBA 3J80E 3JCMV 1EH8A 1K9MC 3MEXA 4CH4A 3AAFA 3X25B 2ZPHB 2DU5A 1BBUA 2FNAA 2LLKA 1RR8C 3MEWA 4D8KA 1VQPA 1VQNA 1EA3A 4AYBA 4AYBN 1Z21A 3H5RA 5GPCA 3GZ5A 1HDDC 2M4GA 3H3VK 1SSHA 2Z2SB 2YDLA 2LVSA 5EJCA 1KFZA 5IN1A 3OYBA 3RKQA 2CUBA 4ELYC 2Z1DA 3KFWX 2DYRH 4KN7X 1S7AA 3L1PA 1AHDP 4LN2A 1MZBA 1K79A 4ITVA 4X9DA 3FX3A 2UZKA 3R60A 2IEKA 4XKVA 4PJOD 4OMOA 3HPWA