3V8KA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with biotin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
total genus 93
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8kA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8kA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8kA02
3E97A 1J9IA 5LGNA 3KP6A 3M9AA 1FNNA 2BEOA 3J81Z 4XU0A 3HHGA 3UGQA 5J6XA 5ILVA 4A5MA 3CO6C 2XAFA 1F5TA 2OQGA 1X56A 3ZP5A 3G73A 4JBAA 3T0YA 4ETSA 3JSPA 2O6GE 4IRIA 1F4KA 1EH7A 1F1ZA 1FY7A 2XAHA 4O6JA 1HW2A 2ARSA 2P4WA 2LDUA 4BQAA 4FX4A 1EQRA 5LJ5d 3HYIA 4MEYF 3FMRA 2VBWA 4ESJA 1NJ8A 5GANd 2NAZA 2GAUA 2I4NA 4NCXA 4H2XA 2VBZA 4HF2A 1SERA 2F5DA 4WX9A 2IW5A 3M4QA 4YFXF 1M5Q1 4CS2A 1IXCA 2CW0F 3I0TA 1IW7F 4MHGA 1O7FA 4EMGA 4FHTA 2QYOA 2FXAA 2PG4A 3QTCA 1XSXA 2HGCA 5E20A 4XTZA 4HWPA 5FFXA 4TVAA 4C8QB 2GXGA 3OOPA 3S2WA 1LNWA 4PJOD 1FYKA 4RB3C 2W85A 2HQRA 2QQ9A 4IHTA 2E7XA 1YW9A 1KQ8A 4M7AE 1H9TA 3QRFF 2LF7A 4P75C 4ZTUB 4LNSA 3RYRA 1LDJA 4PDKA 4C92D 4YRKA 3E6BA 2Q0OA 1BBUA 4XRFA 2RVCA 1G51A 4LK1F 3ECHA 1S7AA 4A6DA 1GXPA 5GMKi 3QU6A 3QPTA 5EEHA 2EFOA 3L7WA 1ZREA 4B09A 3GO5A 1FZPB 1XN7A 3HTSB 4TQDA 1R1UA 3BY6A 5GMKj 3JCMX 1XGNA 2KIFA 3U1DA 1K78A 3L4GA 3KFWX 4L0ZB 4EM0B 1UFMA 1E24A 4M74A 4WK8F 3VFZA 2M30A 3L09A 3R4KA 4KICA 2DTOA 4M7DF 1DUXC 4M7DE 4HOBA 3COAC 2IP2A 5FD6A 1P4XA 4MMKA 2ZNIA 4U0WA 3MFKA 4M78B 2QWWA 3CUQB 4P96A 2X4HA 1B8AA 4AVPA 1WPYA 1J59A 1B1BA 4M7AF 4YREA 3UFGA 5HLIA 1BI0A 3HFNA 1PYSB 4HYEA 4YCUA 1X01A 4HA8A 2FYKA 3JB9I 1STZA 4XEOA 1N9WA 3F23A 4M77G 5C52B 1H4SA 1KU2A 2Y48A 2ZFWA 3JCMJ 4CDGA 1BIBA 2HYFA 2VBYA 2UXNA 3HIFA 4ENKA 5K1PA 1LQ1A 3HXYA 4X9DA 3QO7A 1ZGJA 2V1UA 3PGGA 2IJLA 4MNUA 2PEXA 1TTYA 3JAMZ 1HSJA 3G3ZA 1Y96B 5LGTA 2ESNA 4G94A 2DQ0A 1BC7C 4KMFA 3JTHA 2GA2A 2PI0A 3I64A 2ZT7A 5E18F 4WXCA 2FU4A 1IL2A 1SD4A 2FMYA 3ECOA 4RDXA 3CTAA 1YLFA 4H02A 1ZYRF 3WQZA 1J5YA 3TO9A 4OIOF 3ELKA 3DPTA 3PCOB 1NNHA 3IWFA 2A07F 2R7FA 2DT5A 4ZYHA 3BOQA 5LRRA 2Z5UA 3C7JA 2ZIMA 4M7AG 2CO5A 2P5LC 2RA2A 3SZTA 3BPVA 4LJZF 3FZVA 1TQMA 2Y0MA 3LFKA 4LD5A 4RGRA 3K1NA 4PJOF 2XROA 3CMQA 3FM3A 1CF7A 3HOSA 1MJBA 3P7NA 4XBFA 2XAGA 2PLYA 5LHHA 2HTJA 1B34B 2QENA 2BGCA 2XIGA 4EMHA 5AIPA 3QU3A 4YRJA 1FPQA 2XKPA 4YCWA 4YPFA 4M77D 4IRGA 2ZT6A 2K4JA 5C53B 2DU7A 4PGGA 5CVIA 1W7PA 3J81K 3CDHA 2VC1A 2WWYA 1HKSA 3QP6A 1I1GA 5K5QA 4RGSA 2ALYB 3HY1A 4G7HF 3LC0A 1EIYA 4ZZDA 3V4GA 4R79A 2KIUA 1KU9A 4HX7A 2IRFG 1XDSA 4KNYA 2HYGD 2V1DA 4ESFA 3V7SA 1IRFA 5GMKe 1LJ9A 2XGXA 3FXQA 1IN6A 1TQIA 2DPUA 2RHSB 1WQWA 2RB6A 4JLIA 4K87A 4G6DA 4XTWA 2DBBA 1SD7A 1SAXA 1RIQA 4U7DA 1U3EM 1OYIA 4M75A 3JCMh 1FP2A 3WGGA 3SHFA 2ADUA 4RB2C 2DK5A 4N0AC 3MWMA 1M8VA 1XD7A 1Z7MA 3CUQC 4BHPA 3RL6A 2G4CA 2CSOA 4MGRA 4P5OA 3R6SA 1QNTA 1YW8A 2VXFA 3JCMQ 2D1VA 2KJCA 6PAXA 1LJOA 2HNIA 2MD5A 3VB2A 4P74A 4M72A 3REUA 3U2RA 4R8HA 4BW9A 1D3YA 3TGNA 4BWAA 4IVNA 3L2ZA 4RMFA 5GAN2 2DU5A 1LOJA 2Q5IA 1FX7A 1KQ2A 4UXNA 2DI3A 3BJAA 4MTDA 1EOVA 3EETA 1NJ2A 1XCVA 4UP9A 3I5UA 4N0AA 5HGQA 3EDPA 4PZJA 2E1CA 2EFQA 3IL2A 4KN7X 3A31A 4OLFA 4M71A 5L3CA 1WKMA 2GA1A 4P55A 5DD4A 4A6EA 3IKMB 3RUXA 2H09A 4ZZLA 2VC8A 4Q6GA 3KLOA 3IKLA 4Y91A 2ZXJA 1XCBA 4RQFA 5GAN5 3KZYA 1U6GA 1U1TA 4EJUA 5ILSA 3GF2A 3SQNA 5DCMB 3P9KA 4CZZA 4KUMA 2H27A 4XQ3A 5D5XB 3E5UA 2XUBA 5TJJA 2HWVA 4G6QA 2HOEA 5DDGA 4IHSA 2YX4A 3LSTA 1EIYB 1MZBA 2V1XA 3JCMV 2EA4A 2L4AA 3OD1A 3JCMg 4LLLA 4WF2A 4AWXB 4LGWA 3WE2A 3JW4A 3GX4X 1VTNC 4M77C 3DPLC 5GANj 1NJ1A 1NHAA 4M78A 3U9GA 3MZHA 4YP0A 1HKTA 3TO6A 4OMZA 3FF5A 4HLYA 1TNSA 3GFLA 4ZYEA 5GAMe 5IT3A 4K88A 4H2SA 4M77B 3JAMK 2IY5A 1T0FA 1T38A 1W7PD 2LNBA 5I21A 4U0VA 2MH9A 3RESA 4L87A 1R5GA 2FB7A 1HTTA 3GZ6A 4R1HA 2RHQB 3KCCA 5L3FA 2W84A 4G7ZF 3HRSA 1U8RA 2E5AA 3HRKA 3QHSA 1D3BB 3MAJA 5GAMh 3N97A 2VXZA 3L4GB 5GAOr 3V7RA 4CICA 1ZRDA 1G3WA 5FD5A 1JHHA 1YTYA 1OYYA 4EJTA 4M78D 1R1VA 3D5LA 1G3SA 3KP7A 1SFXA 3OV8A 4M7AA 4ZYDA 3WU0A 1J0RA 3IRRA 4AIHA 3GWZA 4J15A 2V79A 1ZARA 2IVMA 4KFCA 2ZT5A 3M4PA 2XKOA 2DZ9A 2M5WA 2PFBA 1ZG3A 1SFUA 11ASA 3B02A 5K1XA 3K0LA 1FBUA 5IT9Z 2STTA 4V2SA 1XDUA 2TDXA 5CVUA 2E64A 4C92E 4X9CA 4ON0A 5FFZA 5HDGA 4ZIBA 4HF1A 1K79A 2ZMEB 4CS3A 2VT2A 2DAOA 2F5CA 2GXBA 2ESHA 2PMHA 2P5KA 2FBKA 1T6SA 3IHUA 4JUVA 1TNTA 4KYWA 3VOEA 3WG9A 4KDPA 1XGSA 3VQWA 3QNEA 1SD5A 2RGVA 3E5QA 5IT9K 1FLIA 2YSRA 4RCBA 3VQVA 4EGYA 1DPRA 5CJ9A 3HXXA 3ZPLA 5E1XA 1ZHFA 3BY7A 3RYPA 4AH6A 2FNAA 1T39A 3BP8A 1FC3A 2MH2A 4FX0A 1ZG1A 5LJ3g 4WI1A 4F7UE 3AHUA 4HWRA 4GGGA 1I5LA 2L02A 4XTUA 3KE2A 1WYDA 1B59A 3H3UA 1KU3A 2W24A 2PBIA 4YRTA 1IN7A 1WQ2A 2AXLA 4OINF 2YR2A 2RNJA 3EQLF 4P75A 3KZZA 5ICGA 3TDUC 4EGZA 2EWNA 1ONVA 1FBSA 3WTYC 5HVQC 2R3SA 4YIFA 3I4PA 2YU3A 4L9TA 4M77F 4M77E 1ZGAA 5DEQA 3I58A 3QP5A 2FBHA 4CH6A 1ZLJA 1NJ5A 2ARUA 4UPAA 2A6EF 3BZ6A 1E1OA 3FXRA 5BQTA 2VXEA 4KR2A 2ODRC 3SFZA 2STWA 2ALYA 4UV9A 4A0XA 3EYIA 4BH9A 1OR7A 2CJAA 4YYEA 1JGSA 2PMUA 3D0SA 2GWRA 3F8MA 3W3SA 4JK1X 4C8QG 3EFSA 4N9HA 1DP7P 2IPQX 1X55A 2Q7GA 4S05A 3K69A 1I81A 5GAN7 5E1WA 3RF1A 3FJPA 3NEMA 3DXJF 4YCVA 2K02A 2KJBA 2WV0A 2HS5A 1XSDA 2DTHA 1LDDA 1HXDA 2GIVA 3JCMd 2GZWA 1KMNA 3HOTA 3MEYA 5F1RA 3TEHA 1C0AA 1XGMA 3HXUA 1G4DA 1SRYA 5BPIA 1G5IA 4MQ9F 1ZLKA 1D8JA 4YROA 3A7RA 3K2ZA 5JHUA 4C92C 4XTXA 2CWEA 4PHCA 4P71A 1JJCA 4C8QF 4M75E 3HFZA 3P8TA 5D8KB 3KP5A 1NYRA 4M6XA 3BPXA 4NL2A 4L9VA 2ZCWA 1BI3A 4CH4A 4Y15A 1RI7A 2KKOA 3E6CC 2NNNA 5DYMA 3H3ZA 5GAMj 5JFRA 2YHTA 3CO7C 4HVCA 2L3DA 2QHVA 3FMSA 3I54A 1S29A 2OBPA 2E10A 2I4MA 3R07A 3R0JA 3ZMUA 5CVJA 2EJGA 2IA2A 1IN5A 4PJOC 2CFXA 1G5HA 2RHQA 3W6KB 1TBXA 2E3CA 3WE3A 5GAOn 4J6WA 3F8BA 1N9RA 4C92B 3RKWA 2XVCA 3O3KA 5HS8A 4HWTA 1WRJA 4M7AD 2KRFA 2MC3A 4KIGA 4GO1A 3HSBA 4YRMA 1HQCA 3BDUA 5CAIA 1IXRC 4AIJA 3KFUA 4LK0F 1EH6A 5GAMd 1B70B 4KMUX 3JB9H 1B9MA 2M1BA 3A7AA 2COMA 4M7AB 2XASA 4K86A 4G7OF 4OIRF 1V4RA 2QZ8A 3HRUA 4H2WA 1B9NA 1Z9CA 1ATIA 2R7DA 4ASNA 3ERRA 1QE0A 4HQMA 2E41A 3NETA 2FEZA 5FLXK 2IY5B 3QO8A 1J75A 2Z33A 1CF7B 3TO7A 1O3TA 1O3QA 4RQEA 1F9NA 2ZMEA 1P92A 2DXUA 5FO5A 3BROA 4YFNF 4M7DA 4K2EA 5LJ3h 4M75D 2BV6A 5DCMA 3ZMSA 3PQJA 3I59A 4CHUA 4BAYA 3ABTA 5KK1A 5ED4A 1OKRA 1OYWA 5H6QA 2P7CB 3F22A 2L01A 3HSEA 5BS6A 3WTXC 1FYLA 2HKOA 4M78E 3LSQA 3V8KA 1X54A 3C3WA 5ICEA 2ARTA 5EEGA 4HX4A 1WLEA 1R36A 4O2DA 1L0WA 5GAN4 5LJ3e 1YS7A 2EK5A 4RB1A 2AS5F 4Q48A 3HFVA 3KP2A 4H2YA 3RPQA 4Y17A 1FBQA 3P9CA 1JJCB 5E1ZB 2XTIA 4C8QD 2FQ3A 4F7ZA 4QVCA 3SWNC 1EVKA 2YLBA 2W25A 2ZTGA 4RAZA 4CXFA 3BJUA 2MLGA 3EFRA 4KIFA 2ZT8A 3H92A 1NYQA 4YDQA 4KA4A 3UH0A 3HXVA 4A53A 4Z2YA 3NEUA 2OA4A 3C1DA 1B34A 5ELOA 1GVJA 1REPC 4YRRA 3P9IA 3BJ6A 5CVVA 4RB0A 2XRNA 4UP7A 3LAPA 2Q2EA 3QSUA 2OAZA 1ON1A 5L3DA 2Z3YA 1ZRCA 4H2UA 3LA2A 1TLHB 4HDVA 4GYGA 4PJOG 2J5PA 2XAQA 2FSWA 3LA7A 3WU1B 4RGUA 4LMYA 4UV8A 5DV5A 5D5WB 2J5OA 4G9YA 1H0MA 1YYVA 2EA2A 2VONA 2WC2A 3A74A 1S6LA 2O03A 1HK9A 4PCQA 3HXWA 5ICFA 4EM2A 5E3IA 2FA5A 2C7IA 4O3MA 3IWZA 3N4MA 1E17A 5CYVA 1KYWA 4RS8A 5LJ5g 1H4VB 4PG3A 4UP8A 4YRQA 4G84A 5FB2A 3T8RA 3GFIA 2A5YB 3FWEA 3DP7A 1YGBA 4EM1A 2ZNJA 1B6AA 5BMZA 2NRAC 3HRMA 3ZMDA 4WWCA 4M75B 3HTZA 5GMKh 3L2CA 1X2GA 2VC0A 2ZIOA 3RJPA 3F21A 4LB5A 2ZR2A 2ZGWA 3BWGA 1YB3A 3LA3A 2FNPA 2L54A 2A3SA 4A5NA 2PJPA 3FXUA 4YIIA 4ZTZB 2BE5F 3HSFA 5E8IA 1HKQA 2AKWB 2QM3A 3JCMe 2AKWA 5HS9A 3RKYA 3WTTC 4TTVA 4BNCA 2QTXA 2JZYA 3E3VA 1LEAA 1VQZA 2MA3A 1TW2A 3WODF 3AAFA 4E70A 4NB5A 1U2WA 2RHSA 1S3JA 4HLXA 2RC4A 1W5SA 1TQPA 3ABUA 4L0YB 3GUDA 1LDKB 2OQRA 5D5VB 3ZMTA 3FHZA 1IF1A 3ZN1A 4ENJA 4J6YA 2V9VA 1W66A 4P3NA 5ELNA 3SWNA 1RUNA 3WTZA 4MQVA 3LQQA 4M78G 2P5IA 2YX7A 1YFHA 2G7HA 4N9IA 5BOXA 4U88A 4PJOE 4AD9A 5A2QZ 3VQXA 5LEKA 3VEPA 4C92A 3TEHB 1P6RA 5K5OA 2EL9A 2EJ9A 4P9FA 4AIKA 2ACJA 1Z1DA 4H2XB 5ERIA 3QAHA 1AOYA 4C92G 3VBBA 4CGZA 2M8EA 1JRIA 3PQKA 4A0ZA 3IKTA 3R60A 4GXOA 1RUOA 5LJ5f 3QPHA 3DKWA 2D45A 4WJ4A 2LF8A 1ZH5A 2CIMA 1N9SA 1YG2A 5ICCA 4M9SA 3E9HA 4ZYGA 4P3PA 3E6MA 1ZRFA 2ZR3A 4LB6B 2Q8KA 3GW2A 2DPDA 3KP4A 4A12A 2I4OA 4NHJA 1B4AA 2CG4A 2QHUA 5BPDA 1BBYA 2VOPA 1BJAA 1FYMA 2A61A 3I71A 4OOIA 1RZ4A 2D1HA 3KEQA 4OMYA 3RPUA 2QQBA 3JB9F 2Y90A 3QO3A 3RTRA 4LG0A 4H2VA 2GQQA 4L9NA 5L3EA 4M78F 4EMKA 4LFUA 1I5ZA 2K27A 2W57A 4F7UG 5F6FA 2ZZGA 2V6CA 3HTUA 5GMKl 1H4QA 2O8XA 1IUYA 3K1PA 4L18B 1UCRA 3HSRA 3CUQA 1SMYF 3T5XA 4HX8A 4C8QA 4ENMA 4GCVA 1PP8F 2ZXFA 2EJFA 4Q5SF 3MZYA 1C0WA 2PMFA 1CGPA 3ZMVA 1YFSA 3JCMc 4YRCA 1FSEA 4EMSA 3GEZA 4MTEA 3E6DA 1U5TA 2RDPA 2MLKA 4BHCA 2EFPA 5D4SA 1BIAA 2Q7EA 4EV0A 3Q9SA 1MDMB 4LG0B 2ZINA 5LRSA 3K9TA 2C6YA 1YS6A 1NJ6A 2A68F 4KIBA 4B8XA 1RNLA 2IA1A 3RERA 1D3BA 1R7JA 2VT3A 1ADJA 1SESA 1ULYA 3CUOA 1I8FA 4M9ZA 2DLLA 5D5UB 4F7UF 2EV6A 2M45A 1QO0D 1XGOA 4XU2A 1U78A 1OMIA 3SZPA 4UVCA 5LJ3d 2EFNA 1JHFA 1W5TA 4YRPA 4H0EA 4HT8A 1MD0A 4YRLA 5AIQA 3L00A 5ILUA 1YFTA 2DU9A 5C51B 3LQRA 3F6VA 1BC8C 3DF8A 3RIRA 1QGPA 1TW3A 1YQAA 2HFHA 2JSCA 1EFWA 1DDNA 1B7YA 1H641 3M4GA 2B0LA 2CGPA 4J6XA 2QBYA 2XHKA 5F5WA 1MJAA 4UVAA 1B7YB 2ZKZA 1PP7U 1Z6TA 2HTSA 1YO5C 5E8GA 3HUGA 2QBYB 5CVRA 2OD5A 4P73A 3QOPA 3REXA 4HBLA 4IRHA 1ON2A 1WWXA 3FIFA 1WI9A 2ZJ2A 4A0YA 4N0BA 2DKGA 1SD6A 2ISYA 2NNYA 1I4K1 4M75G 2FOKA 3F6OA 5LEJA 4M7DB 1LYLA 3Q9VA 2ZNYA 3IALA 1ADYA 2EV5A 4XLPF 4TWAA 3A5YA 1E1TA 1I27A 2P5VA 4I0AA 3P8YA 2LKPA 2HKXA 3GLXA 2CGHA 5HDNA 3L1AA 3DSQA 1IZ1A 4HF0A 3T8TA 3JCMW 4XEMA 2C8MA 3L9FA 4L5JA 2DK8A 3JSOA 4J5YA 1BI1A 1IRGA 2O0YA 5D6EA 2YLCA 2DQLA 1KQ9A 5GAMf 1L0OC 3MEXA 3ZN0A 5FGMA 4M77A 4M7DD 4M73A 4XSXF 3J80Z 1V3FA 2OZUA 3GVAA 4Q47A 5GAN6 1USTA 2P6TA 4NL3A 5LJ3f 1UHWA 4RGXA 4WCGA 3RGLA 2OZ6A 4JQFA 2ZNZA 1SMTA 4M75F 4G8XA 3MF2A 5GAOp 4JRKA 3NELA 2DFIA 1KOGA 1I6XA 2M87A 3R61A 3WTVC 1LB2A 2K4BA 2RKHA 2BBYA 1IN4A 4PNOA 5GAN3 2PQ8A 2DZCA 2JPBA 2H6CA 4O5VA 4YRGA 12ASA 4QWQA 2P8TA 2O3FA 4D0PA 4EJVA 3JCMP 1HW5A 3KP3A 3NENA 1E2XA 4YFKF 3ERED 2FBIA 4E51A 4TV7A 3DFGA 2DQ3A 5GAOl 2Q7HA 5H20A 3CJNA 4XU1A 2IT0A 2QLZA 5GAOq 2OU2A 4F7UB 1FP1D 1D8KA 4I02A 4P71C 2EV0A 4WXHA 3GFMA 4HV5A 4ESBA 3C18A 1TH7A 2I4LA 3G1ZA 4EJOA 1FYFA 4UNOA 2L4MA 3VU3C 5HLGA 2X0LA 4A54A 4I0BA 1W4MA 2DO7A 4PGHA 1FOKA 2EFWA 2ZZFA 1QF6A 3HXZA 4HDUA 5F64A 1OPCA 1W7PB 4MEXF 1JBMA 1O3RA 4WXDA 1B76A 4EMKC 3JCMf 1XMKA 1K6OA 4Y13A 2DTRA 1Z7NA 2CJBA 1IXSB 3TQNA 2WTEA 1T98A 3HY0A 4I2OA 2DDZA 4Q15A 5A2QK 1P4WA 1ZG5A 2D2WA 1KGSA 4IJAA 4U7BA 3ICAA 5JVTA 1IAWA 3IG2A 4GYIA 4BYYA 1KQ0A 2QHTA 5DD8A 4HWSA 3BW1A 4M75C 5FLXZ 4A2UA 1RIOH 2E7WA 4PJOA 3I53A 3MF1A 4UUVA 2MBFA 4CO8A 3WGIA 1HBXG 2I2LA 4M9XA 2PN6A 2VODA 2XGTA 3M1EA 2AMCA 3B73A 4ENNA 3RDIA 3BJOA 2G9WA 1Q1HA 2ELHA 4KQEA 4QLCU 3BFMA 5LLQA 3ULQB 4UHTA 3V8LA 1ASZA 3WTWC 4P74C 3FB9A 5J8CA 1FSHA 2E65A 1K78B 1HSTA 3NRVA 4I01A 4I7HA 3ROUA 2ZO4A 3LWFA 4UVBA 3MQ0A 2VE8A 1O57A 1Z05A 5JR3A 1USYC 4M6YA 3TOBA 1JXSA 2VBXA 1QZZA 4I09A 3J7AO 1KQ1A 5GAOm 1SETA 1J2XA 4P72C 4IPAA 3FM5A 5LJ5j 4HAMA 1WSUA 2ZCEA 3W6JB 3K1MA 1X3UA 2VE9A 1O3SA 2RM4A 3F8FA 3GIBA 2CYYA 2F2EA 3Q5FA 1DPUA 1KYZA 4IF4A 4NQWA 4C92F 4BXUA 4LLNA 4M7DG 4S04A 4CH5A 1GGMA 3JB9J 2QVOA 3GZ5A 2AMCB 5LJ5h 2XAJA 3ZQ7A 2JTVA 2P6SA 3HHHA 3GFJA 3M8EA 1G3TA 2K7LA 5CLSA 5DCFA 2CJ9A 1G3YA 3CLOA 1HW1A 2DEQA 2ISZA 4HQEA 4C8QE 5HOOA 1LVAA 2EJRA 1XSVA 1SFEA 4Q4ZF 1MGQA 2J3MA 2DVEA 1Z91A 2ZBKA 2J3LA 3IC7A 1QZYA 1U1SA 1EV7A 3TEGA 5LGUA 5JI6A 3UGTA 4CS4A 1IN8A 2DQRA 2RD1A 2PMEA 5D8LB 1L3LA 2DW4A 5GANe 4XTVA 5D4RA 1LNXA 3HRTA 3DV8A 1PDNC 1PYSA 2Q5HA 4KR3A 4KN4X 2H94A 1MDMA 5GANg 2NS0A 1U5TB 3KEOA 3DQVC 3ZMZA 2NYXA 5LBQA 1EVLA 1YFRA 4P3OA 4IXAA 4CH3A 2FMLA 3O6BB 3RACA 3GYHX 3FMQA 2FRHA 5GANh 3NQOA 5GANf 2BYVE 2Y75A 3I7FA 5AONA 1S7OA 3IRQA 1ZAOA 3V7CA 4X5OA 2JT1A 4L5IA 2QUFA 1BOAA 4RAYA 3INZA 4P9UA 2ETHA 1J7KA 1GHCA 3O2PE 3F8NA 3DEUA 3JB9D 5K1YA 3TUPA 1Y0UA 4U0YA 2HQNA 2JPCA 4I98B 1X2HA 4P73C 4FT8A 5DY9A 2HDCA 3QUIA 1S8NA 2DJZA 2E1HA 5LJ3j 4XLNF 5H6RA 1E22A 3M8FA 2F5EA 1G6NA 1MJ9A 4LLGF 5GAN8 3EUHA 4EVIA 1R1TA 1BM9A 2JN0A 4MMLA 2F5FA 1BN5A 2G7UA 3HFZB 3ISPA 4M7AC 3F3XA 2HR3A 3A32A 2EAYA 3MCZA 2DTIA 2JRTA 3SWNB 1EH8A 2FE3A 4M78C 1K7AA 4NOYA 1R58A 2VOOA 1Y96A 2O61A 1H4TA 4TQFA 5L3GA 4EO4A 3LSSA 1PUEE 4JRIA 4DPGA 3R0AA 1JE8A 2IA0A 5KNNA 5K5RA 2QQAA 2H6BA 1GXQA 1R22A 3WGHA 4OIPF 3J80K 2VN2A 1D5VA 4M7DC 2DXTA 4EJWA 3KETA 3JTGA 3VODA 1MGTA 1AWCA 2Z99A 3WTSC 1UHMA 1WU7A 5HLHA 2HEOA 4XU3A 4QVDA 5LHIA 3PCOA 2FF4A 4HW0A 4TVWA 3E5XA 1T2KA 3TDZC 5HS7A 3REOA 1WNLA 5J8FA 1ASYA 3SB2A 3HRIA 2RN7A 4DNCA 5KVRA 1KA8A 1U5TC 5DUKA 3RKXA 3JB9G 5LHGA 3HFOA 2P0LA 1ZN2A 1FT9A 4F7UA 4HT9A 5GAMg 1XB4A 3TKYA 4OIQF 4HWOA 2RQPA 4CYDA 1QBJA 4YRSA 5GMKm 1KMMA 3FX3A 4TVYA 3KLNA 2RV8A 3I59B 2QHSA 1QQIA 2UWMA 2XV4S 3BDDA 2EB7A 2UZKA 4XSZF 5L3BA 2E1NA 1UB9A 1HC7A 4HV6A 2K86A 2A6HF 2CQKA 1BI2A 4KT5C 1LEBA 1R5HA 2ZZEA 1MKMA 3M7GA 2HZTA 4L9JA 3EYYA 4G85A 3P8VA 4XTYA 2K57A 1Z7UA 4BHBA 4DQ2A 1A04A 2Z9OA 3QO5A 3F8CA 5DUIA 5LJ5e 3SXYA 4PJOB 4EX5A 1R00A 4OU0A 5D6FA 1R23A 3IKVA 4EQQA 1P4AA 1Z6RA 4RCCA 1QPMA 3F72A 4OP0A 4H2TA 3T1BA 3A5ZA 1J5WA 3PFIA 2KIMA 1YIOA 1YCYA 1USSA 2ODRD 1I1SA 1BBWA 4EMKB 1ODDA 1USYA 4C8QC 3A7UA 4YRIA 5E17F 3ML6A 4YRFA 1XMAA 3E9IA 4P72A 5HDKA 4YG2F 3JCMb 3RI4A 2YPRA 3V8JA 4WJ3M 3GXOA 4HZFA 1O7LA 2LSOA 3TOAA 1WQ7A 3PZCA 3LAJA 1B70A 1YW7A 4ZH4F 2UXXA 1KU7A 3VQYA 1H9GA 4YRNA 5TRDA 4TVAB 1FWZA 2A69F 3WTUC 1P2FA 2P7VB
chains in the Genus database with same CATH superfamily
1J09A 3FK6A 1TUDA 2KEAA 3E97A 3KIOA 1X2QA 4BUGA 3RF1A 4BE2A 4N4IA 1J9IA 5J47A 3KP6A 5LGNA 2KXDA 1W0TA 3M9AA 1UGSB 2E6ZA 3W3CA 1FNNA 2BEOA 1ZGWA 3J81Z 3ZFJA 4XU0A 3HHGA 3UGQA 2M7AA 2XF7A 5J6XA 2Q1ZB 1OYXA 2A5WA 1JO8A 5ILVA 4A5MA 4BY7J 3CO6C 3FHNA 5IHKA 1JXMA 1X2NA 2XAFA 3WHBA 1F5TA 3SFIA 2XF5A 2OQGA 1X56A 3ZP5A 1BJZA 5KYUA 1S9HA 4F92B 3G73A 3G6EQ 4JBAA 4HT4A 3ER0A 5DM6F 5KE2A 2VJIA 3T0YA 1TZLA 4ETSA 3JSPA 4FTHA 5CKEA 2EPFA 1I1JA 3VWBA 1A31A 4IUPA 1WXTA 2DL7A 3NTKA 3BR3A 1VYTA 2O6GE 4IRIA 1N78A 5CKFA 4BL0B 1F4KA 3LSMA 1AZGB 1EH7A 2W7NA 2F2VA 3SZGA 1F1ZA 1FY7A 2XAHA 4O6JA 1T56A 1HW2A 2P4WA 2LDUA 4RLQA 4FX4A 4BQAA 1HA8A 3T9NA 3CMEI 1HCRA 1EQRA 2DK3A 5LJ5d 3HYIA 3OYDA 4LDXA 5L8RE 4MEYF 3FMRA 2K5FA 3CC7T 1PG5B 2VBWA 3TW6A 3CCUI 3C2HA 4ESJA 2DA1A 1OULA 5GANd 2NAZA 1NJ8A 2LDMA 2GAUA 1T0HA 3I9QA 2VKHA 1YJWA 4LG3A 2I4NA 4NCXA 4H2XA 3I35A 3IH3A 2VBZA 2L3PA 1KJWA 4HF2A 3REBB 4A4FA 3JV3A 4OVAA 2R7SA 2F5DA 1VQ7T 1SERA 4WX9A 2IW5A 3M4QA 4YFXF 1M5Q1 2IIMA 1IXCA 2CW0F 2GIZA 2FX0A 3I0TA 3IH2A 1IW7F 4MHGA 2JTMA 1O7FA 4EMGA 1ZHIA 4FHTA 2ZPIB 2QYOA 4X0GA 2ROTA 1KD1U 1VQNT 2E3IA 2QEXI 2FXAA 2XC7A 2K3XA 3MP8A 2PG4A 3RCOA 1PD1A 4J9EA 3QTCA 2WAEA 4RTWA 1XSXA 2GOMA 2HGCA 5EZGA 3META 5E20A 4XTZA 4YTLA 5FFXA 4HWPA 4TVAA 4HCZA 4BUPA 3MEAA 1E3OC 1K9MU 1KQSP 3DTEA 2GXGA 3OOPA 3S2WA 1LNWA 1G59A 3VS0A 2JSPA 4C8QB 1D0YA 1M27C 1FYKA 3MO8A 4BEHA 4RB3C 4PJOD 4H2VA 2W85A 2DMUA 2HL5C 2HQRA 2QQ9A 2HXOA 4FYYB 4IHTA 2E7XA 1YW9A 1KQ8A 1XJWB 4M7AE 2AXTC 3E9FA 3EGXA 3BG5A 1H9TA 1MMNA 3QRFF 2LF7A 2F6CA 1YJNA 1MBEA 4P75C 4ZTUB 1HDPA 3A03A 2WB1A 4LNSA 3RYRA 1NE8A 2CYZB 2EKOA 1YIJT 1LDJA 4PDKA 4C92D 2R5MA 1Z3XA 2HQAA 3E6BA 2KYBA 4YRKA 4ABZA 1FIAA 1T0JA 2BTTA 2GM4A 2X4WA 4KGXB 5CQYA 1E6HA 1A0NB 2F4MB 2DYIA 4E7IA 2Q0OA 1BBUA 4XRFA 7AT1B 2RVCA 1G51A 4LK1F 3ECHA 2R93J 1S7AA 4A6DA 3JRBA 1GXPA 4LUDA 3QU6A 3QPTA 5EEHA 2EFOA 1WJAA 3L7WA 2RQUA 3FDRA 2BXZA 4NUBA 3KBGA 4OB0B 1VQ7I 4QPQA 1ZREA 4B09A 4DZJA 3C2BA 3GO5A 1TUCA 1WJFA 2ROLA 3MHXA 1FZPB 1XN7A 3HTSB 2VJ4A 3AT1B 1R1UA 4XN3A 4TQDA 1VQKT 3BY6A 5GMKj 3MKYB 1UFFA 3CCRQ 3JCMX 1XGNA 2KIFA 4I99C 3U1DA 3HDDA 1WJEA 1K78A 3PNVA 3KFWX 4L0ZB 2ELJA 2R5YA 2ED1A 2HSPA 3L42A 3VS3A 3L4GA 3OIPA 4EM0B 2OV7A 1JUPA 1UFMA 2JRMA 4ZDLA 2HDDA 2COWA 5LD2C 4A3LJ 3OL4A 2GFUA 1YHQQ 4KH0B 2LMDA 1H3ZA 1E24A 4M74A 4WK8F 3ZQQA 3VFZA 2M30A 3L09A 3R4KA 4KICA 2DTOA 1RAEB 4M7DF 1DUXC 4M7DE 4HOBA 3COAC 1Y56A 4F04B 1UG2A 3ZQCA 2IP2A 1U8BA 5FD6A 3I56I 4UY8I 1P4XA 2IVWA 1M8MA 4J7IA 4MMKA 4U0WA 2ZNIA 3MFKA 1D1AA 4M78B 3CD6A 2QWWA 3CUQB 4P96A 2X4HA 3H0DA 4ZC3A 4Z89A 1B72A 1KFZA 1B8AA 2VPRA 4AVPA 1WPYA 1J59A 1B1BA 2K2VA 3CXCA 4M7AF 2LTOA 2BHYA 2VKEA 1SSHA 4RMOA 4YREA 3UFGA 3EGDB 4E7KA 4XRMA 5HLIA 1BI0A 3HFNA 1PYSB 3IAM2 4HYEA 1X01A 2GGRA 4YCUA 3CMEA 4HA8A 2FYKA 2MF2A 3JB9I 1RLPC 1STZA 2LBFA 4XEOA 1N9WA 3F23A 4M77G 1WVRA 5C52B 1H4SA 2DTZA 1KU2A 2Y48A 1VIEA 2I10A 1X69A 1XNIA 1YJWI 2ZFWA 2QAZA 3JCMJ 4CDGA 1DU6A 1BIBA 2HYFA 2VBYA 2UXNA 3HIFA 4FQGA 3WU2C 1RR8C 4ENKA 5K1PA 1LQ1A 3CPFA 4C5EA 4X9DA 3HXYA 3QO7A 1RAFB 4P1WA 1ZGJA 3KYDB 3NWTA 2V1UA 2DM1A 3PGGA 2IJLA 2H8RA 2DXBA 1OX8A 2WV1A 4MNUA 1QMCA 2PEXA 1TTYA 2QSHX 4Z02A 1GXIE 1SC7A 2B7EA 4IIMA 3JAMZ 1HSJA 5FLVA 2R0QC 3EGUA 4XK8E 1K0SA 3G3ZA 1Y96B 1K73C 5LGTA 2ESNA 2LQ8A 4G94A 3G7ZA 4DBQA 4ORZA 1NJIU 2DQ0A 1BC7C 3DU6A 4KMFA 3JTHA 3H0HA 2GA2A 2PI0A 4PSXA 3I64A 3H5AA 5IHNA 2Y0SN 1IRZA 1RI0A 2ZT7A 5E18F 1ZUKA 4WXCA 2L7ZA 4KGZB 4MDWA 3BE3A 5F0CA 2FU4A 1WHJA 1IL2A 4UC4A 1SD4A 2EFIA 3VSKA 2FMYA 3ECOA 4UUSA 4RDXA 3CTAA 1VQPI 3EPZA 4ZDOA 2KRNA 3FC3A 1VQ9Q 3FKIJ 4PKCC 3HOXJ 4PSWA 1ARKA 3Q0UA 4V19K 2OAUA 4OMOA 2WAQN 1YLFA 2CJJA 2CP3A 4FCYA 4H02A 1ZYRF 1M1FA 3WQZA 2DA5A 1J5YA 3TO9A 3D5RC 4OIOF 3ELKA 3DPTA 1W1FA 3FXKA 2RHZA 3PCOB 4PLLA 1NNHA 3IWFA 2A07F 2EZLA 2R7FA 3QYFA 1SVOA 2DT5A 1I0CA 4ZYHA 3LYIA 3BOQA 3S8PA 2VVKA 3F9KA 5LRRA 2Z5UA 3C7JA 2ZIMA 4M7AG 2CO5A 3FISA 2P5LC 1LFUP 4AT1B 2RA2A 3GZNB 3SZTA 1UE9A 3BPVA 4LJZF 2M0OA 2OJ2A 3EHRA 2D5VA 3FZVA 1TQMA 3M55A 2Y0MA 3LFKA 4LD5A 4RGRA 1DGWY 1I39A 2D0QB 2HKQB 2PUOB 3VS7A 5KCMA 3K1NA 4XQFA 1UHFA 4PJOF 5L23A 2XROA 1GBQA 3VYGA 1JB0E 1C1AA 3URGA 4B3AA 3VKIA 3X28B 4BDZA 1ZR2A 3CMQA 1WHKA 3VS1A 3FM3A 5TGTA 4D5FA 3UKGA 2HI3A 4BS9A 1CF7A 2LQWA 1M90U 3HOSA 2LYCA 4A69C 1MJBA 3P7NA 2K5LA 4XBFA 3BC8A 1C0MA 2XAGA 4L6V5 2JK3A 3K7AJ 2PLYA 2LT4A 3CJTB 4PK4A 5CO7A 5LHHA 2K3BA 2HTJA 1B34B 5HY6A 1VQ8T 2ID6A 3OA6A 2QENA 4DEYA 1M90C 5D6XA 2E34A 3BR5A 3PMIA 2MCNA 3U21A 1UDLA 4Y92A 2BGCA 2XIGA 3SDGA 3CMAT 4EMHA 5AIPA 4NNJA 4TVAB 3QU3A 1S5LC 3JRIA 1FPQA 2XKPA 2J6FA 1H8KA 2ZR2A 4AYBN 2JWTA 4YCWA 4YPFA 4M77D 2EH3A 2L3RA 2JOYA 4IRGA 4NL3A 2K4JA 2RMOA 2KLOA 4MFEA 1AKHB 2ZT6A 2KMUA 1QVTA 2X6YA 2AO9A 3FXMA 3QQAA 4PGGA 5CVIA 4E4HA 2NVXJ 3NHNA 2DU7A 1W7PA 3J81K 2JVGA 3VV0A 2M0MA 2YUQA 1Q7YR 3CDHA 2NVTJ 2KMTA 2CSQA 2VC1A 2CH0A 2WWYA 4AUXA 1HKSA 1IG7A 5B3SH 2LJ0A 2VKNA 1S72Q 3QP6A 1I1GA 3B6CA 4RM3A 3ZGKA 5K5QA 4OWRB 2CZ1B 3PT9A 4JJCA 3CC2A 2WY8Q 4RGSA 2ALYB 5J1YA 1E7OA 3HY1A 1QHHD 4G7HF 3LC0A 3ZXSA 1EIYA 4ZZDA 4NDLA 3V4GA 4R79A 2KIUA 1KU9A 4HX7A 1KK7A 2IRFG 1YBYA 1XDSA 4KNYA 3UATA 1Z9QA 3VUBA 2HYGD 2V1DA 2JMWA 5EG0A 3I4NJ 1LPQA 2VKDA 4I76A 2KXCA 3OWTA 3I5RA 2PJRA 3TP3A 2JA5J 2D0NA 3VJPA 5CKDA 4ESFA 3CCUQ 3V7SA 1IRFA 4BE1A 5GMKe 3HJEA 3BLYA 3PM1A 2JTEA 2NVUB 4KISA 3OD1A 2LQNA 1LJ9A 2XGXA 3FXQA 1IN6A 1TQIA 3PNTA 2DPUA 1VQKA 2RHSB 2V7FA 2R5ZB 1RRJA 2IAIA 1LCKA 3G1OA 4D5CA 2XD0A 2XF6A 3CESA 2FEIA 3BG3A 3GTMJ 1WQWA 2NS8A 4ZJZA 2RB6A 2RK1A 2AKLA 4JLIA 4G6DA 4K87A 4XTWA 1Z21A 4BXFA 2DBBA 1VQLT 3CCEA 1M1KR 2ATCB 1SD7A 4PFOA 2BW3A 3KZIC 5EF6A 1SAXA 1R0BG 3DEEA 3S16J 1TU0B 4U7DA 2QQRA 4XLAA 1PKTA 2CP5A 1U3EM 2KE9A 1OYIA 4M75A 3A5ZB 3JCMh 1FP2A 3WGGA 3NAUA 1ETVA 2DIGA 2RN8A 1BB9A 3SHFA 3TEEA 2ADUA 4JPBW 3X2QH 3JRDA 1VQ5I 2F4IA 1O75A 2EQJA 4W1UA 3JREA 1QA6A 1IB8A 1J3TA 4RB2C 2DK5A 1GV5A 2NUTB 3MWMA 4N0AC 1M8VA 1QVUA 1XD7A 1NPRA 3CCSQ 1TWAJ 1A35A 3M4OJ 1F1BB 1Z7MA 4B1RA 2EQRA 3CUQC 4UP8A 2EIJH 4BHPA 4M3DA 1MHNA 1PC0A 1R77A 1Y57A 3LGLA 1ITYA 1M1KU 2G4CA 3RL6A 2CSOA 4MGRA 4P5OA 2HZYA 3ZCOA 2R7XA 3R6SA 1QNTA 4PL6A 1YW8A 2VXFA 3JCMQ 2D1VA 3PNWC 2KJCA 2X1DA 1V29B 6PAXA 1LJOA 2HNIA 2MD5A 3VB2A 4P74A 3MMYB 3GP8A 4M72A 3REUA 3U2RA 4R8HA 4LIVA 4BW9A 2LNHB 1D3YA 5FKOA 2PNIA 5IXFA 2KP6A 3B6AA 3TGNA 4BWAA 4IVNA 3L2ZA 4Q5WA 1XC5A 2M4GA 1SVLA 2DOEA 4RMFA 5GAN2 2DU5A 1LOJA 2Q5IA 1FX7A 2XB5A 1KQ2A 2X4YA 3JRAA 2M1HA 4UXNA 1HYOA 2DI3A 3BJAA 4MTDA 3W2AA 2GBQA 1EOVA 3EETA 2RAEA 1PHTA 1KQSS 4RAGA 3ZRGA 5I22A 1NJ2A 1ETYA 3LOCA 4II3A 1XCVA 3ZL7C 4UP9A 2DFEA 3I5UA 4N0AA 5F27A 5HGQA 3EDPA 4PZJA 1N75A 4J7FA 2KRHA 2E1CA 2EFQA 3IL2A 4KN7X 3A31A 1PYVA 4AU7A 4OLFA 4M71A 1LPLA 3D7SB 5L3CA 1WKMA 1BK2A 4OMLA 2E35A 2GA1A 2QA4Q 4P55A 2X85A 3OSGA 5DD4A 2M7BA 4A6EA 4DGWB 3IKMB 1UZCA 3RUXA 2RH2A 2H09A 4AVZA 4ZZLA 2FL7A 3PIPF 2G3RA 3ASKA 2VC8A 4Q6GA 3KLOA 3IKLA 4Y91A 2ZXJA 1XCBA 4NQWB 3OSFA 1YI2I 5GAN5 3KZYA 4RQFA 1XTDA 2IS1A 3OYBA 3CCMT 2Y31A 1F43A 3NPFA 4C9YA 4UB8C 2XGDA 4A4GA 1V5GA 1U6GA 1IV6A 1WXUA 1U1TA 2VJ5A 3BG7A 4EJUA 5ILSA 3CMAI 1H89C 3GF2A 2ESWA 4BI8B 2BZTA 3SQNA 5DCMB 2FVUA 3P9KA 3VYTB 4CZZA 3UF4A 2V6EA 3NFCA 1VQ6Q 4KUMA 2H27A 4LITA 4IHYA 4LDWA 2VI6A 2V1RA 4XQ3A 5D5XB 3E5UA 2XUBA 3E9GA 2GTOA 2M16A 4ZYAA 5TJJA 2HWVA 2HYJA 1Y1VJ 4G6QA 4IO9F 1RADB 2HOEA 5DDGA 1Q82U 1YIJA 4JX4A 3EG9B 1S1NA 4IHSA 2VQGA 2YX4A 2DDBA 3LSTA 1XOVA 1EIYB 4F55A 4XKBA 4HCBA 1M3CA 1MZBA 2LOOA 1TXQA 2V1XA 4CCOA 2EA4A 2L4AA 2XB0X 3JCMV 3JCMg 3PUFA 5FKKA 3ERMA 4WF2A 4LLLA 4Y52J 3PO2J 4AWXB 1V54H 2ICWG 4LGWA 3WE2A 1KD1C 4ITVA 3JW4A 1ETXA 5K7ZA 3GX4X 1VTNC 1X1CA 1Z67A 2L3QA 4M77C 3DPLC 4XOPA 1KC8C 3O5ZA 2IEKA 2MFZA 5GANj 3S93A 3HKZA 1ZSZA 1NJ1A 3RZDJ 1NHAA 3CCVI 4M78A 3U9GA 4F14A 3MZHA 3CC4T 4YP0A 3VDXA 1HKTA 1JJ6C 2O2OA 4FSSA 1M2VB 3K4LA 3TO6A 3K4JA 4BDYA 3EGDA 2QQ8A 4OMZA 2NUPB 2K9LA 3C94A 3FF5A 3S15J 4E6KG 3H5NA 2C0TA 2K7AA 3SYTA 1SSFA 5IHIA 4HLYA 4A3DJ 3GTQJ 5HNFA 1SF9A 3THKA 1VYUA 1TNSA 3GFLA 4ZYEA 3CCJQ 5GAMe 2CKKA 5IT3A 1UHCA 3GNGA 2E71A 2A8EA 4H2SA 1DU0A 2DIQA 1WJQA 2HBPA 3JAMK 4M77B 2IY5A 1T0FA 1A6QA 2E60A 1T38A 4QQGA 2QG9B 1W7PD 2LNBA 3AG3H 5GTHC 5I21A 3AG1H 4U0VA 2MH9A 4CH7A 1TSFA 1OU9A 2NWMA 1EJ9A 3RESA 4L87A 1R5GA 2FB7A 1HTTA 3REAB 3GZ6A 4R1HA 2WACA 2RHQB 3KCCA 5L3FA 2W84A 4AYBA 4G7ZF 2FUG2 1U3OA 3CMMA 2I8DA 5J3BA 1VNDA 3HRSA 2KT0A 1U8RA 4BACA 1RESA 5FKMA 1XTAA 2CUDA 2NLUA 2E5AA 3H9JA 3GMEA 4J00A 1N8RR 3HRKA 2LH9A 5JLWA 1XPXA 2CSIA 2YSQA 3GTJJ 1FTZA 5KYYA 3QHSA 1JT6A 3MAJA 4M3EA 1D3BB 5GAMh 3K10A 3N97A 1W1WE 2JA7J 2VXZA 3M56A 5GAOr 3V7RA 4CICA 4HCCA 3L4GB 2JXBA 2DA3A 1G3WA 4LOCA 1ZRDA 5FD5A 2QSGX 2KDSA 1JHHA 1YTYA 1OYYA 4EJTA 1RI9A 4M78D 5FRMA 1R1VA 3CC4A 3D5LA 3HOUJ 1WJCA 1G3SA 3LW5E 5A2QE 1UUEA 3KP7A 1SFXA 3OV8A 1YI2A 4M7AA 3X20B 4ZYDA 4UP7A 2Z1DA 3WU0A 1I07A 1J0RA 3HM5A 2EQIA 3CCJA 2R7OA 5EJCA 2XRLA 4AIHA 2V9PA 3IRRA 3GWZA 3KYLA 1SHGA 1Z0XA 2EYYA 3EUAA 2MI6A 4J15A 1E3PA 2V79A 1ZARA 2IVMA 3DCFA 3CP8A 4KFCA 1PSFA 2W0ZA 3CCQQ 1P9QC 2HDWA 2ZT5A 2MD0A 3M4PA 4DYQA 2MOXA 2BY0A 2P81A 2XKOA 2DZ9A 2LREA 1ZLMA 2O4XB 3VRYA 2M5WA 2PFBA 3R6OA 3J80E 1LFPA 1ZG3A 2DJNA 1SFUA 2KQWA 3CCVQ 4FM4B 11ASA 2PTKA 4XRSG 4XRSA 5FKLA 3B02A 8ATCB 4K88A 2LY1A 2ZXWH 5JHFA 2L0KA 5K1XA 3K0LA 1FBUA 3EUHC 2STTA 5DTDA 1XDUA 2TDXA 2WADA 3Q3SA 5CVUA 1RAIB 2E64A 2IBDA 4KRTA 2W48A 4C92E 4X9CA 3LSIA 1TL8A 4C2TA 4ON0A 1Y39A 2MGQA 1JEGA 4JOMA 4XMYA 5FFZA 5HDGA 2DBMA 2CH4A 4HF1A 2J6KA 4QW2A 4BD3A 3P8HA 4ZIBA 3S3OA 2X6WA 1K79A 3OYGA 1QCNA 2SEMA 2ZPFB 2ZMEB 4CS3A 2DT7B 3DEWA 1VQ9I 1PJRA 2VT2A 2DAOA 4FSXA 3H0GJ 3RR6A 5HKCA 3GOXA 3M53A 4D6WA 1M2OA 2F5CA 2GXBA 5FU7B 1IDZA 3IAS2 5M3MJ 2ESHA 2PMHA 4QTRA 1LE8B 1IHVA 2DL8A 2EYZA 2P5KA 2K9QA 2FBKA 1T6SA 3IHUA 1VQLQ 4JUVA 5FLXE 4CUGA 1TNTA 4KYWA 3TQ7P 3VOEA 3WG9A 3OY9A 1I6HJ 4J9FA 1BR4A 4KDPA 2M3AA 1Q1VA 1XGSA 1V5EA 2LX7A 4LNPA 1VQPA 3VQWA 5F0HA 3OYNA 4ZTFA 2DO3A 3QNEA 3MP1A 4A3CJ 2LCLA 2IXSA 1SD5A 2P4RA 2VKVA 1FEXA 2RGVA 3E5QA 5IT9K 1FLIA 2YSRA 4FT4A 4RCBA 3VQVA 2ZMEC 3FK7A 4YEJA 2VUMJ 2FPEA 3H8ZA 4EGYA 1DPRA 5CJ9A 3J7AF 3ZPLA 3HXXA 5E1XA 2QA4A 3ABLH 1ZHFA 3CD6I 3CCST 3SEQA 1X1DA 3A8LB 3BY7A 3QYHB 3RYPA 5FU7C 1X6OA 4AH6A 1YJNQ 2QGUA 2FNAA 4XLHA 1T39A 1YWOA 3BP8A 2RREA 3C12A 3FDYA 1FC3A 2Y4YA 1TC3C 3CCRT 5IT9E 2MH2A 2X9DA 4FX0A 1ZG1A 1NPPA 1WGXA 5LJ3g 3NTIA 1JJ2A 6AT1B 4UPAA 2V26A 3S1MJ 4BI3A 4F7UE 4WI1A 3KEYA 4F93B 1DGRM 3M0RA 3AHUA 5CIUA 4HWRA 1QPIA 4GGGA 1I5LA 5KYXA 4XICA 2L02A 4XTUA 3KE2A 1OPKA 1B59A 1TG0A 3CCQT 1WYDA 3H3UA 1KU3A 2W24A 2PBIA 2MPXC 1IN7A 4YRTA 1WQ2A 2AXLA 2R7ZJ 4OINF 1SKUB 2YR2A 1O4XA 2QDYB 2RNJA 3EQLF 4P75A 1GVDA 4A63B 3KZZA 2HQXA 5ICGA 1BOBA 1WX6A 2ME6A 3ZOBA 1WZ2A 3CCJI 3TDUC 4EGZA 2EWNA 1ONVA 2E70A 2XDBA 3FLGA 1FTTA 1FBSA 5IXBA 5FU6C 3WTYC 3CC4Q 3D1NI 3JRCA 5HVQC 2R3SA 4KUDK 4YIFA 1VQ4I 2ECBA 2DBKA 3PJRA 3I9V2 3I4PA 2K6DA 2YU3A 2GCXA 3JRZA 2JUCA 4KT0E 2L2PA 4GLMA 2KYMA 4L9TA 4M77F 4M77E 1ZGAA 4EEFG 5DEQA 1WYXA 4BBSJ 3EFOB 3I58A 3QP5A 3F0CA 5E3LA 1VIFA 2DFHA 2FBHA 4CH6A 2MAMA 1WIEA 4C0DC 2JM9A 1Y0NA 1ZLJA 1YI2Q 1NJ5A 2A6EF 3BZ6A 1VQNI 1E1OA 2ARUA 2D8HA 3LX7A 3FXRA 5BQTA 1MNEA 2VXEA 4KR2A 3ZQGA 2Y4XA 1NG2A 4FT2A 2ODRC 2QI2A 3SFZA 3OS2A 2CT4A 1LFBA 2STWA 2ALYA 4UV9A 4A0XA 1RAAB 1GRIA 3I56Q 3EYIA 1UMQA 3PSIA 4BH9A 1W0UA 1OR7A 2YWWA 3M54A 4C0ZA 2CJAA 1JGSA 2PMUA 2DXIA 3S2HJ 3D0SA 4YYEA 2GWRA 1ETWA 3G71Q 4ESRA 3DLAA 1Q86U 3F8MA 2KZGA 1NLPC 1LVKA 2M02A 3W3SA 4JK1X 4IL6C 4C2UA 4B47A 4C8QG 3X25B 3CPWP 5KHDA 4YDQA 1X4PA 4N9HA 4Y3OA 1DP7P 3EFSA 1NM7A 3O8HA 1FYNA 4RBOA 2IPQX 4R55A 1VQ9T 1YHQT 3HOYJ 2L7FP 4BBRJ 5KH6A 1BR1A 1X55A 1MMGA 2L7MP 3ASNH 1K8AU 2Q7GA 4S05A 1KHCA 4OB3B 4IUVA 4W97A 3K4BA 1B8IA 2K4YA 2CS3A 3K69A 1I81A 2JJ9A 5GAN7 3HUGB 5E1WA 4HNVA 1ZR4A 1EX4A 1QZEA 3CCLI 2J7IA 3FJPA 1SEUA 4A4EA 4LVKA 3BG9A 3NEMA 2NUPA 3CQTA 5B1AH 1D5YA 3DXJF 1K1ZA 2CS7A 4YCVA 2K02A 2KJBA 2WV0A 2HS5A 1VA7A 1OPLA 1OOTA 4H4KC 2QEXT 1XSDA 4IOAF 2DLPA 1I50J 1MV3A 2DTHA 3RDVA 1A6IA 5GJWB 1LDDA 3WHCA 4J8OA 5KYXB 1HXDA 3OL3A 4GY5A 2GIVA 3JCMd 2GZWA 4Y33A 2GXAA 1KMNA 3HOTA 5IP7J 1YX5A 4UB6C 3EG2A 1N77A 3MEYA 1T3SA 4XN0A 3IH4A 5F1RA 4YIRX 1NH3A 2YUPA 4IOCF 3ZBDA 3TEHA 1C0AA 1XGMA 1TTHB 3HXUA 1G4DA 5A0LA 2NYSA 4RQEA 4IURA 3FRNA 1SRYA 4WCIA 3LSPA 5BPIA 4HXJA 3EH1A 1G5IA 1X1AA 2KT1A 1QP2A 2X6XA 3OYLA 4MQ9F 3E2UA 1NLOC 2KSSA 1KD1R 1XX5A 2HL3A 1ZLKA 2QKMB 2ZCFB 3QKJA 1D8JA 2RJFA 4YROA 2FG0A 3OYJA 1VFCA 3A7RA 3K2ZA 2EBIA 2M2EA 1K4SA 1M30A 2P4TA 1JJ2S 3I3LA 1W70A 5JHUA 1TWCJ 4JP0A 5EDNA 2VWFA 4AIDA 4C3IJ 4DOWA 3PIOA 4J9DA 1W2BS 1QVGS 1Y8RB 5K7FA 3PIOF 4D7NA 4B43A 3H3VK 3DBHB 4C92C 4GLKA 2XU8A 4FIBA 3OYAA 4XTXA 1R6RA 2CWEA 2YUNA 4BU2A 1VQ4A 2ZPHB 1YITQ 4PHCA 4PFPA 4C3HJ 2Y9ZA 1X1PA 4P71A 3ABKH 1K8AR 1JJCA 4NC6A 4C8QF 4BJ5C 3DB3A 1GL5A 4M75E 3RNJA 3MN2A 4LVJA 3HFZA 3RMQA 4F52A 4HSRA 4CSWA 3P8TA 4M6VA 1OCZH 3KP5A 1T33A 5D8KB 2ZJPF 1BBZA 4M6XA 3M4YA 4RKUE 1NYRA 3ZQHA 3BPXA 4NL2A 3QWLA 2ZCWA 1BI3A 4L9VA 2HPMA 4CH4A 2Q7EA 1VQNA 5IOZA 4Y15A 1RI7A 2KKOA 3E6CC 2NNNA 5DYMA 3H3ZA 1FJLA 5GAMj 5JFRA 2O5RA 2YHTA 3H41A 4YRJA 3CO7C 4HVCA 2HOAA 3A4CA 2L3DA 3H0IA 3FMSA 3G2BA 1S29A 3I54A 2OBPA 5F1JA 2ZB9A 1FOXA 2KISA 1M3BA 3R0JA 3ZMUA 1NZ9A 1MNDA 2F48A 1NEGA 2KI7A 2YT6A 5CVJA 2NUTA 2EJGA 2IA2A 1IN5A 1SFOJ 1JKPC 4M3FA 2CFXA 1GCQA 1WJ5A 2DL5A 3GNFB 2R7WA 3H0FA 2YXYA 3LGFA 1Y6IA 1K9MC 1G5HA 3W6KB 2RHQA 3E19A 1VUBA 1TBXA 3P8BB 4OMNA 3WE3A 5GMKi 1KIKA 2E3CA 3HGYA 2K9GA 2JN6A 5IN1A 1ABQA 5GAOn 3CCVT 4J6WA 3MCAB 3F8BA 1N9RA 1ABOA 5KNLA 3QPSA 4C92B 3MKLA 3RKWA 2R7QA 3KYCB 2XVCA 3O3KA 5HS8A 3KFVA 4HWTA 1WRJA 1MSFC 4M7AD 1BW6A 2JVHA 2KRFA 5F08A 2MC3A 1K83J 4KIGA 4GO1A 4FASD 5C3EJ 3HSBA 4EO4A 1YIJI 4GBQA 1TWHJ 1TT5B 2GLOA 4YRMA 1HQCA 3BT9A 3BDUA 3PFSA 3QZ5B 5CAIA 1IXRC 4AIJA 2XPUA 3HXLA 3HB9A 4JX5A 4LK0F 3A01B 3I55I 3BQYA 2EKHA 2E3HA 4JJBA 1OCTC 1EH6A 2DRMA 4A3JJ 2EW3A 3R6NA 3S6WA 2QSFX 4BJTA 5GAMd 3CEYA 1B70B 1TWFJ 4AMCA 3N5BB 4XM3A 4KMUX 5IYBJ 3CC7A 3JB9H 3EG0A 2OTJQ 1B9MA 2M1BA 3OS0A 4BQOA 3A7AA 5DM7F 2COMA 1M9SA 5HODA 2V1QA 2VIXA 1HLVA 4M7AB 2XASA 4K86A 3PE0A 4G7OF 4OIRF 1V4RA 2IGOA 1X3WB 3Q0WA 1BKBA 2FRYA 4AFUC 3LWHA 2QZ8A 3HRUA 3MKWB 1ETQA 2RF0A 5EEAA 5EGOA 1S72T 4H2WA 3LSHA 3OS1A 4GFBA 1B9NA 1Z9CA 1Q86C 3KFUA 1JUMA 2ZC2A 2E2JJ 1ATIA 4XIDA 2R7DA 3CDIA 4ASNA 5C6SA 3UR3C 1M4ZA 1EKEA 4NBQA 4RMNA 1KZHA 1Q95G 2K5IA 3ME9A 2L5QA 3ERRA 3CD6Q 5IPAA 1P7IA 2ME0A 5EGOB 2BZYA 2QQSA 3QDRB 4C0FA 4J9BA 3FJ5A 1QE0A 4HQMA 4XLFA 2E41A 3NETA 2F5VA 2FEZA 2WB1N 1VQ5T 5FLXK 2OC6A 1QP3A 4N4GA 2WBMA 3CCUT 2IY5B 3QO8A 3W2VA 3CCLQ 3NGPA 1J75A 4A3BJ 2Z33A 1I3AA 1CF7B 2NXNB 4QPOA 3TO7A 1O3TA 1O3QA 1ZQ1A 3NARA 1QQJA 1F9NA 2ZMEA 1P92A 1WDXA 2DXUA 2JMAA 2X4JA 5FO5A 1VQ4T 3BROA 1OCCH 3HPHA 4YFNF 3VUZA 4M7DA 2MYSA 4K2EA 4B6MA 1VQ6I 1PVEA 2LY2A 4M75D 2BV6A 5LJ3h 4YELA 5DCMA 4RDUA 2DD4A 3ZMSA 3VYHB 3PQJA 1Y0MA 1GDTA 3I59A 2DL3A 2MIOA 4CHUA 2DOAA 4OGCA 3VRZA 4A93J 4BAYA 2X51A 3ABTA 5KK1A 5ED4A 1OKRA 3QBYA 1OYWA 1OX9A 5H6QA 3TCJA 2ZSIB 4CYCA 2P7CB 2FZGB 2JW4A 1NJIC 1KQSA 3F22A 2L01A 3HSEA 4IKFA 2AIRB 5BS6A 3WTXC 1FYLA 2HKOA 3LSGA 4M78E 3AL0C 3CCMQ 3LSQA 3CC4I 2D1XA 3V8KA 2V1NA 3C3WA 5ICEA 2HSEB 1X54A 3IUOA 1MSEC 1OV3A 4A3IJ 1QKWA 2ARTA 1S72A 5EEGA 3UNGC 2HXIA 3E7LA 4HX4A 4J19A 4GDFA 1WLEA 3OIOA 1UAAA 1R36A 3LMMA 4X1VA 4O2DA 1L0WA 5IOYA 4JZ3A 1VQMI 5LJ3e 1YS7A 5GAN4 5FLMJ 5FJ8J 2EK5A 4IZZA 4RB1A 2AS5F 4Q48A 5J1UA 2M0YA 3HFVA 3KP2A 2KGTA 1YJ9T 4FW2A 1MH3A 2FPDA 3CCVA 4H2YA 2QDLA 3G1JA 4BY6B 4EIKA 1EFNA 3PIPA 2VGNA 3M0QA 3RPQA 4Y17A 1VQPT 1FBQA 3P9CA 4BY1J 1JJCB 5FU6B 1UG0A 5E1ZB 3M58A 4C8QD 4EPCA 2CW8A 2XTIA 1K4TA 1O9SA 2PVDB 5IP9J 2FQ3A 3C4SA 4XL9A 3TBIA 2HVSA 4F7ZA 4QVCA 1MV0B 1M1EB 1AHJB 3SWNC 1ADYA 4N4NB 2KDZA 4RTYA 3K4KA 1X2MA 2DPPB 2YLBA 2W25A 1EVKA 4RAZA 1USYC 2ZTGA 4CXFA 3BJUA 2MLGA 3EFRA 1FIPA 2LRQA 2RO0A 2X4XA 4KIFA 2CUEA 2ZT8A 3H92A 2E1MB 3BCBA 4KA4A 3G71T 1NYQA 3UH0A 3WXMB 5E3MA 3HXVA 4A53A 2ZSHB 2QKLB 4MO7A 3OYFA 2IPOB 4XLEA 3FXLA 4B3XA 3G4SI 4Z2YA 3NEUA 2OA4A 3C1DA 1B34A 3K6GA 5ELOA 1GVJA 2L0AA 4HCKA 3OYKA 1REPC 3A8HB 1IZ6A 3IQLA 4YRRA 2R7TA 2E5ZA 3P9IA 3BJ6A 5CVVA 3SJMA 4RB0A 5KYNA 1VQ9A 5I2SA 2XRNA 5IP6A 4JX6A 3LAPA 4CC3A 2HPIA 2HVRA 2Q2EA 1V76A 1QU3A 2XDDA 3K4CA 4C5HA 3QSUA 2OAZA 1ON1A 5L3DA 2Z3YA 1ZRCA 1XS9A 3CCSA 4H2UA 2DMPA 3LA2A 1TLHB 4HDVA 4GYGA 2Y0SA 4PJOG 2AKKA 2J5PA 3MD2A 1Y1WJ 2NS7A 2XAQA 1A5JA 2QYZA 2FSWA 3LA7A 3WU1B 1NTCA 3CBOA 3VYUB 2K79A 4LE9A 1D0ZA 4LMYA 4RGUA 2DNUA 2QEXQ 4UV8A 5B66C 3NMZC 5DV5A 4JJNK 5D5WB 2J5OA 4G9YA 1H0MA 1YYVA 3QIIA 2EA2A 4F16A 2VONA 2AQEA 2WC2A 1IC8A 2W1OA 3A74A 3CDLA 3PNYA 1S6LA 4E7ZA 4OMQA 2OI3A 2M0CA 2O03A 5GPCA 1HK9A 2VB6A 4QKUA 3C95A 4PCQA 3RBBB 3HXWA 3OBYA 2O4XA 1HJDA 5ICFA 2XPWA 1TUGB 2BY3A 1M2VA 1K8AC 4EM2A 5E3IA 2FA5A 3KX2A 5HCKA 2C7IA 4O3MA 2CP2A 3IWZA 3N4MA 5I2MA 5KAIC 3DTKA 1IO6A 2E5KA 1E17A 5CYVA 5DS9A 1KYWA 4RS8A 1B8IB 1A36A 2K40A 1BW5A 2LC4A 2W00A 5LJ5g 1YITA 2CZ0B 2HD0A 1QVFP 1ZA2B 4G84A 5FB2A 3T8RA 3GFIA 2A5YB 3FWEA 2D8JA 4OB1B 2NVYJ 3DP7A 3H5RA 4ZN3A 1H92A 1YGBA 3A1YA 1VQMT 1IV8A 3AG2H 4EM1A 1B6AA 5BMZA 3HOVJ 2NRAC 2G6FX 2ZNJA 1UB4A 3HRMA 3ZMDA 4WWCA 1UG1A 1WA7A 4M75B 3ZEHA 3HTZA 4M4ZA 2TRTA 3CCEQ 1UJ0A 5GMKh 5GTIC 3L2CA 1X2GA 2VC0A 1JUSA 3HTRA 2R7VA 3RJPA 2R57A 3F21A 4LB5A 3JAME 1H4VB 2E6NA 2ZIOA 3HOZJ 1PD0A 2IGKA 2HCKA 1YHQA 1UGPB 1AKHA 4AM3A 3BWGA 4A3KJ 1HOMA 2YDLA 2ZGWA 1IXDA 3LA3A 4FETA 2FNPA 2L54A 4V2GA 1E0EA 1YB3A 2A3SA 4A5NA 2PJPA 4RTXA 3ESWB 3FXUA 2K3YA 4YIIA 2DCEA 3CCRA 2RHYA 4ZTZB 1Z9ZA 2AQFA 2BE5F 3HSFA 2DYSH 3OS5A 1FOYA 5E8IA 1K4US 1UJYA 2ZFUA 1Y07A 1Q7YC 1YRNB 1HKQA 2AKWB 2QM3A 3JCMe 2AKWA 5HS9A 3DKXA 2L9NA 3RKYA 3WTTC 4TTVA 4BNCA 5J40A 4F3QA 2IS6A 2QTXA 3LLRA 2JZYA 3E3VA 4DYRA 1LEAA 2DA7A 1VQZA 2OTLT 2MA3A 1TW2A 3WODF 3AAFA 2Y2ZA 3S3MA 1H3HA 2PJRB 3G4SA 1ZK8A 3L2UA 2DRKA 3CC2Q 1OJLA 1YNZA 2DXCA 4IEJA 2PVOB 2K2MA 4Z6YA 4E70A 2ZJQF 2LC2A 3X24B 1JTXA 4NB5A 1NG7A 1U2WA 4FE7A 4HNUA 2RHSA 3RQIA 3M57A 1S3JA 4HLXA 4EDUA 3UDCA 2RC4A 1WI3A 1WHLA 1W5SA 1YE9A 1TQPA 2HMAA 2DFFA 3ABUA 4KULA 2HQEA 3GTOJ 3VS4A 3L2VA 4L0YB 1SVMA 3JR9A 3GUDA 2D9TA 2GOXB 3LSJA 2VYTA 1IJWC 3F70A 1JGGA 4HVUA 1LDKB 3H9NA 2OQRA 5D5VB 3RKQA 1T08B 1MH4A 2EIKH 3LL7A 3ZMTA 3FHZA 1IF1A 1RL2A 3QDFA 3ZN1A 4ENJA 3CCLA 3M5AA 4J6YA 2V9VA 5H2FC 1W66A 4P3NA 2DA4A 1N5ZA 5ELNA 3SWNA 3QPLA 2LCSA 2K9MA 1RUNA 2VQLA 3WTZA 2FZKB 3M3YJ 4MQVA 1ZSZC 3I56A 3LQQA 1WPKA 4M78G 4DOVA 2P5IA 1D1BA 2YX7A 1U9NA 2XPVA 3OSSC 3A8MB 1YJWT 3HL8A 1Q82C 3ASOH 1YFHA 2G7HA 4RAFA 3S1RJ 1RLQC 3BTLA 4N9IA 2F5KA 5BOXA 4U88A 2CRGA 4NC7A 4PJOE 1T8IA 3OW2P 4AD9A 5EC7A 5A2QZ 4N4OB 1LE8A 3SFMA 3VQXA 5C4XJ 5LEKA 3QXEB 1I3QJ 2K9NA 3VEPA 3L2WA 2E12A 4C92A 3TEHB 1PNJA 1P6RA 1W5CC 2VQHA 5K5OA 1VQ7Q 2PX9A 2EL9A 2EJ9A 3R07A 4P9FA 4AIKA 2O88A 2C0IA 3BTJA 1NYGA 5B5EC 4PJLA 4XNFA 2ACJA 4MLOA 4KGVB 3RSNA 1Z1DA 1NK2P 4H2XB 2E5NA 1R0CB 2K9SA 1YX3A 5ERIA 4B9WA 5KYYB 3QAHA 4Y7NJ 1AOYA 4C92G 2QASA 1X2KA 4KH1B 3VBBA 2BVLA 4CGZA 1W6XA 3NTHA 2M8EA 3LSRA 2ED0A 1JRIA 3PQKA 4A0ZA 3IKTA 1FMWA 3R60A 1UTIA 1WHMA 4GXOA 1RUOA 4XONA 3W6VA 2JVVA 3EHQA 3PTAA 3BR2A 5LJ5f 3QPHA 4QIWN 3DKWA 1JQQA 1X58A 3S1QJ 4J9HA 2D45A 1AVZC 2LF8A 4QSHA 1ZH5A 1N9SA 2CIMA 1SFKA 1YG2A 4AG2C 5HK0A 1YFNA 1VQ7A 5EG0B 5ICCA 4UUTA 4M9SA 2MWPA 4ZYGA 4N4HA 4RG8A 3E6MA 3E9HA 4P3PA 2FO0A 1ZRFA 2ZR3A 1R9TJ 4LB6B 2Q8KA 4YRQA 3GW2A 2DPDA 3KP4A 4A12A 2HOSA 1WHGA 2DX1A 2P0KA 2I4OA 4NHJA 3OBWA 2LCCA 1GCQC 2PQWA 1B4AA 2CG4A 1YOVB 5J1RA 3QZ9B 4E7HA 5BPDA 4Z88A 1BBYA 2JA6J 2QHUA 4JDSA 5CKHA 2VOPA 1BCOA 1BJAA 2VL8A 1FYMA 2A61A 3I71A 4OOIA 1RUWA 4PFZA 1QVPA 1VQOA 1RZ4A 2CQQA 2D1HA 1BU1A 3KEQA 2JM8A 3MEUA 4OMYA 3RPUA 2RI3A 2QQBA 3TU4K 1B7TA 3JB9F 5GP9A 5GAGJ 2QHVA 3J81E 5J4VA 2KY9A 4FYWB 4RUGA 1JT0A 2EYQA 2Y90A 3H9GA 3QO3A 2WA0A 4LG0A 5CPRB 2GQQA 4L9NA 3MVPA 3RTRA 5L3EA 4E7JA 4M78F 3FBIB 2GTJA 4EMKA 1VQ6T 1P7JA 2E2HJ 2ZXHA 1VQKQ 2IGMA 4LFUA 1M1KC 1I5ZA 4XAXB 2K27A 3TEDA 1PUFA 2W57A 2GQIA 4F7UG 2COBA 3OQ5A 5IAYA 5F6FA 4J9CA 2HNHA 2DD5A 1YN8A 4KUIA 2BIVA 2ZZGA 4FE4A 2V6CA 5FKNA 1MUZA 3HTUA 1WJSA 2I0NA 4MIMA 5GMKl 1H4QA 1QVFA 2O8XA 4GRIA 1IUYA 3DBRB 1X6GA 2CZ7B 2HEQA 3M59A 3OMGA 3JRGA 3VS5A 3K1PA 4L18B 1JTYA 1UCRA 2DJIA 1EF4A 3PO3J 3ZQIA 1QKXA 1YCSB 4JZ4A 1VQMQ 4MDXA 3LH5A 4PJMA 5M5WJ 2QGFB 3G4SQ 4J01A 1WLPB 2GQVA 3HSRA 2K5CA 3CUQA 1SMYF 3H9QA 1KONA 4L5EA 2Z0WA 3I55A 2JJ7A 4C0GA 3BTIA 3T5XA 5C44J 3OYHA 4HX8A 2F2WA 2KQRA 3GLLA 2KROA 4C8QA 4ENMA 1YJ9I 1TOVA 3CBMA 4GCVA 4HG2A 2DA6A 4FW1A 1PP8F 4E47A 3AG4H 2VLAA 4BB7A 5DLOA 2XHCA 2ZXFA 2EJFA 5M3FJ 2O9LA 3UA6A 4Q5SF 2A37A 4JYKA 3MZYA 1C0WA 3QJ6A 1QHGA 1YP5A 5C0MA 2J05A 2PMFA 1CGPA 3TREA 3GTLJ 1W36D 3ZMVA 1YFSA 3JCMc 4YRCA 1FSEA 1UHSA 4EMSA 4DBRA 3GEZA 4LD6A 4MTEA 5FWBA 1RETA 3E6DA 3S14J 5J26A 2HKNA 1U5TA 4TQFA 3A1PA 4CI0C 2RDPA 2MLKA 3DKMA 1KC8U 2F1LA 3CF2A 2EFPA 5D4SA 4BHCA 1BIAA 2L9RA 4EV0A 4C2MJ 3Q9SA 1MDMB 4OB2B 4LG0B 3KXTA 3DLLA 2ZINA 5LRSA 5KCOA 4Y4RA 3K9TA 2R7UA 1GT0C 5C53B 2C6YA 1YS6A 1ZA1B 2DJQA 1X19A 2ZPGB 2A68F 2JUGA 4NS5A 1RABB 1NJ6A 4KIBA 4B8XA 2DT6A 1RNLA 2IA1A 4IUTA 3EG1A 1HC8A 5GPAA 2ECZA 3LWIA 3RERA 1TP4A 2VASA 1D3BA 1R7JA 2VT3A 1C6VX 2CUBA 2GFAA 4XLCA 1ULYA 2NOGA 3CUOA 5J3LA 2X3WD 1QCFA 1ADJA 1SESA 1I8FA 3PFYA 2OJED 4M9ZA 2DLLA 1VQKI 2KHMA 5D5UB 4F7UF 1MBGA 2EV6A 2Y30A 2M45A 2EINH 1F36A 1QO0D 1XGOA 3WG7H 3CCQI 1ORKA 1T3LA 1X75C 3M0UA 3PVQA 1U78A 1R4NB 1OMIA 4XU2A 4DBFA 4Y28E 3SZPA 3FEOA 4UVCA 4PG3A 5LJ3d 2EFNA 1JHFA 1W5TA 2KR3A 4B9XA 3IV5A 1VQOI 1VOMA 4YRPA 2PMZN 1MMDA 2O01E 4H0EA 4HT8A 1FMKA 1MD0A 4BI4A 2X1EA 1KHIA 4YRLA 4ZGEB 5AIQA 3G6EA 3L00A 5E3NA 1K76A 2O9VA 4VUBA 1QVFS 5ILUA 3JRFA 2DU9A 1S72I 1Y7XA 2OCCH 1HF0A 2HU9A 3LQRA 3P8DA 3X26B 3F6VA 1G2BA 1BC8C 3DF8A 5D6YA 5GAN8 3RIRA 3CC7I 1BA5A 4HWSA 1QGPA 1TW3A 3MEWA 1YQAA 2HFHA 1ERDA 2PMZA 2DA9A 2JSCA 1VQNQ 1EFWA 1DDNA 1B7YA 4CCKA 3H6ZA 1B72B 1H641 2WSEE 2KFDA 1M3AA 2E10A 1JKQC 2B0LA 1OLTA 2CGPA 2RHXA 3M4GA 4J6XA 2M8GX 2CV2A 2QBYA 2XAUA 2ID3A 4HNTA 2XHKA 1VQ8A 3UT1A 1MJAA 5F5WA 4UVAA 1B7YB 1GCPA 1WHUA 2ZKZA 4BGDA 2RI2A 1PP7U 5IH2A 1EA3A 2K3PA 1AT1B 1Z6TA 2HTSA 1GUUA 4L59A 1YO5C 1FOWA 5E8GA 3HUGA 4IIOA 3OYIA 1CSKA 2OTLQ 3CXCP 1V1CA 2QBYB 5CVRA 2R5ZA 4NC8A 2OD5A 2PVGB 4X34A 3QOPA 4P73A 5K7HA 2F69A 4RLFA 2Y9YA 3REXA 2JT4A 2X48A 1TWBA 4HBLA 3M9QA 2H1LA 3O8GA 1MBKA 4IRHA 1ON2A 1WWXA 2H3JA 3FIFA 1IGNA 3PVLA 1WI9A 1YJ9A 1TWGJ 2XGCA 2ZJ2A 2COZA 1IHWA 4A0YA 3O8VA 4N0BA 2JNGA 2GF7A 2DKGA 1SD6A 2ABLA 3ULRB 2ISYA 2NNYA 1K9MR 1I4K1 2OX7A 1KSWA 4M75G 2FOKA 2E5QA 4WJ4A 1B3QA 3F6OA 2CDTA 3Q0VA 3EG3A 5LEJA 4M7DB 1LYLA 5TISC 4D8DA 3Q9VA 2ZNYA 3IALA 2LG4A 3CCSI 3CD6T 1DJ7B 2R4GA 1DQUA 2EV5A 2KPMA 2LZ6B 2F2XA 2G0EA 2EVRA 5KCHA 2KRCA 4XLPF 4TWAA 3MEVA 3A5YA 1E1TA 2FOWA 1I27A 2P5VA 4DJAA 1PM3A 4I0AA 3C0CA 5EG2A 3P8YA 3CCLT 2LKPA 2HKXA 3GLXA 2LVMA 2QTVA 4IX7A 2CGHA 3I5SA 3GBQA 3I55Q 3HL2A 5LL6S 1YJNT 5HDNA 5HNHA 4XK4A 2XIDA 3CBPA 3L1AA 2I4MA 3DSQA 3JCUC 2LKSA 3HHTB 3A01A 1IUFA 1IZ1A 1G8XA 4HF0A 3T8TA 3JCMW 1VQMA 4XEMA 1VQ5A 4LDYA 2ZPEB 4A3EJ 2C8MA 3L9FA 4L5JA 3DU5A 1B07A 3CMAA 1VQLA 1IGQA 2RJEA 2DK8A 2CUFA 2L3SA 2XICA 4KT6A 2ZAEA 5BNGA 5CKBA 3JSOA 1FXXA 4J5YA 4R0KA 2E36A 2LVSA 1WJRA 1BI1A 2HAXA 1IRGA 5M5YJ 3OW2S 2O0YA 1LKXA 5D6EA 1YWPA 1ZSZB 2YLCA 3ZR8X 4CRIA 2CREA 1ACMB 2DQLA 1KQ9A 3W2WA 2RQVA 4E7SA 5GAMf 2LR8A 1YITI 2YU9J 1L0OC 4FYVB 3MEXA 4DBHA 3ZN0A 5M9OA 1BR2A 5FGMA 1XG1A 3ONQA 4QT7A 4M77A 2WY7Q 1OZ3A 3G6EI 2OF7A 2B8AA 4M7DD 4M73A 4XSXF 3J80Z 1V3FA 2R5AA 5CQXA 2OZUA 2W10A 1RIQA 2L89A 1BL0A 3GVAA 2JA8J 4EATA 3CXCS 4Q47A 5GAN6 3BQZA 2AZVA 1POGA 3M1CA 1MW7A 1USTA 2KZVA 1RR7A 5IYCJ 5FROA 1VZ0A 2DA2A 1MBJA 2P6TA 1YHQI 3S17J 1CQTA 2QK0A 1UHWA 4RGXA 5LJ3f 2LK2A 1YJWQ 4WCGA 3RGLA 2OZ6A 2DMNA 1N25A 2ZNZA 4JQFA 1SMTA 4CCJA 4AFQC 1U06A 3LNQA 4G8XA 4M75F 3MF2A 5GAOp 2ELKA 4JRKA 3G1MA 3NELA 2DFIA 4CA0A 2VPLA 1KOGA 1I6XA 1X1BA 1Z3YA 2M87A 3R61A 1YITT 4ZN1A 2VQCA 2OTJA 2O31A 4IHVA 3WTVC 1LB2A 2K4BA 3EG9A 2DMTA 3OIQA 2RKHA 4IQ4A 3HKZN 3AKZA 2BBYA 1IN4A 4PNOA 5GAN3 2IGNA 2CZ6B 2NOJB 1WI7A 2PQ8A 4S0HB 1K61A 2DZCA 3LFUA 2CP7A 2JPBA 2MK5A 2WSFE 2H6CA 1EIFA 3A0BC 4O5VA 1PRLC 4WTOB 4YRGA 4BEHB 3ZQFA 12ASA 4QWQA 2P8TA 2O3FA 3C2GA 3HPGA 4D0PA 4EJVA 4B48A 1D1CA 2KRSA 2A3LA 1HW5A 2LX9A 3JCMP 2FRWA 3KP3A 5IYDJ 2P0QA 1RAHB 4LUEA 2A28A 3NENA 1E2XA 4YFKF 1IREB 2W82A 4PJ0C 4CCNA 2FBIA 3ERED 2J6OA 1AA7A 5A0DA 2CUJA 4E51A 4TV7A 4B44A 1JXOA 3DFGA 2BE9B 5GAOl 2DQ3A 2A6TA 4V2FA 3S32A 2Q7HA 3PUBA 2RJCA 2SRCA 3PSFA 4K11A 5H20A 4AFSC 2DN0A 3CJNA 4RM2A 2KAFA 3GCMA 2IT0A 4XU1A 4C3JJ 2QLZA 4BJ6C 1QRYA 5GAOq 2OU2A 4QVZA 4F7UB 1FP1D 5IT9Z 2OTLI 1D8KA 4I02A 4P71C 2L2OA 2FJ1A 3NWSA 2FD5A 2EV0A 2QGGA 4WXHA 2J06A 1FMVA 4RTUA 4F91B 2EQMA 3GFMA 4HV5A 1VQPQ 2FQ4A 3C18A 3VSLA 4ESBA 1TH7A 2UV1A 3FIWA 2I4LA 4CZCA 3G1ZA 4EJOA 4BKXA 5KYWA 1FYFA 4ZTJA 4UNOA 2HDAA 3HG9A 1WFXA 2RQTA 2L4MA 3VU3C 4DEXA 3CMEQ 5HLGA 3OOUA 2X0LA 4X1EA 3CCRI 2P0PA 5KE3A 4A54A 3SDBA 1X4OA 3CMAQ 4I0BA 4YRVA 1PKSA 1W4MA 3MP6A 3HEFA 1WJDA 2A05A 2DO7A 1PUFB 3OYYA 4PGHA 3CMET 4A3FJ 1FOKA 3MQZA 2EFWA 2ZZFA 1QF6A 1K73U 2HQ5A 2MC4A 4HDUA 3HXZA 5F64A 1OPCA 1W7PB 4MEXF 3AL0B 2LRDA 1O3RA 1JBMA 3G1LA 4M3BA 3U1KA 1Y71A 1QWEA 5M5XJ 2V8JA 4OMMA 3CCMI 4WXDA 1B76A 4EMKC 1ZELA 2R58A 3JCMf 2PU9B 2V8IA 4CC4B 1XMKA 5C4JJ 1K6OA 4Y13A 2B86A 2BZ8A 2DTRA 2RQWA 1R71A 4ATOA 3OB9A 1Z7NA 2CJBA 1IXSB 3TQNA 2WTEA 1APLC 1T98A 3HY0A 1YIJQ 4I2OA 4XKCA 2DDZA 3UA7A 4Q15A 5A2QK 4ANJA 1P4WA 1ZG5A 2L8DA 2D2WA 1Q81U 2DEUA 1KGSA 3QODA 4OAZA 4IJAA 1OI1A 4U7BA 3ICAA 5JVTA 1QWFA 2H3EB 3H35A 1IAWA 3IG2A 4GYIA 2VUBA 1Q81R 1K0XA 4BYYA 2DAQA 1KQ0A 4QQDA 2QHTA 4J9IA 2YRVA 5DD8A 4C30A 2E1MC 2OTJI 3BW1A 5CR2A 2EZKA 4LIUA 3J7ZI 4M75C 3SHWA 1WHHA 3WVDB 4MFDA 3OW2A 5FLXZ 1GV2A 4A2UA 1RIOH 4LXCA 2CQXA 2E7WA 2C06A 2RPNA 3I53A 4PJOA 3CC7Q 2EPDA 3CC2T 4A4HA 3WVEB 4UUVA 3MKDA 2MBFA 3MF1A 2I5UA 4CO8A 3WGIA 3MKZA 2WSCE 1HBXG 2I2LA 1MMSA 4M9XA 1ETOA 3MPUB 4JLGA 2PN6A 2VODA 3MZ8A 2ZZDA 3U23A 4LDUA 2QA4I 5FW9A 2XGTA 3M1EA 2AMCA 5C51B 5E79C 1D09B 2L9SA 2AHQA 2DFUA 2EGCA 3B73A 1YFTA 4ENNA 3EH2A 3CF5F 2H8WA 5GJVB 4ELZC 2JZ2A 5DM7R 3RDIA 3BJOA 2CU7A 2BUDA 2G9WA 2OCEA 1Q1HA 2ELHA 4KQEA 4BQQA 3KUFA 4QLCU 2RQQA 2AHJB 5LLQA 3BFMA 3ULQB 1EZZB 4UHTA 3V8LA 1R4MB 3HC7A 1YRNA 1OU8A 2OPTA 3WTWC 3JSCA 2DETA 4P74C 1ASZA 4A3MJ 2HZDA 3G71A 3FB9A 1Q81C 2KNBB 5J8CA 1FSHA 2E65A 1N6AA 1K78B 1HSTA 3NRVA 4I01A 4UUSB 2Y69H 3UWNA 1QW1A 1R8OB 3A2KA 3CCET 4I7HA 3ROUA 1G83A 2ZO4A 4PJJA 3J7AY 3LWFA 5JLXA 2K85A 1NYFA 2QXFA 3TVTA 4UVBA 2BXYA 3MQ0A 2VE8A 1O57A 1JKOC 1Z05A 1OISA 2V9KA 5JR3A 3CMYA 2LMJA 4RG2A 2BE7D 4AFZC 2QEXA 4M6YA 3TOBA 1JXSA 4JS4A 2VBXA 1QZZA 2JQ7A 2L7KA 4I09A 2BOLA 3J7AO 1KQ1A 2ZPBB 4U87A 3GF5A 5AYFA 5GAOm 2AK5A 4ZDPA 5FWCA 1SETA 1X6BA 1J2XA 4LVMA 4P72C 2CUZA 1U0JA 4IPAA 3K70D 3TSZA 3FM5A 2X1CA 2MMPA 5GADJ 5LJ5j 4D1QA 4HAMA 1WSUA 2ZCEA 2RNGA 3TP0A 3K1MA 3W6JB 1X3UA 2VXDA 2M9UA 4A3GJ 3BR6A 3M0SA 4J83A 2P84A 2VGMA 2HVQA 3CZ6A 2VE9A 1O3SA 2RM4A 4R56A 3F8FA 3GIBA 2CYYA 1VQ5Q 2F2EA 1JKRC 4HRIA 4IUUA 1GFDA 2FHDA 2JTFA 4OF1A 1AU7A 2XDPA 2JUFA 3A0HC 3QOEA 3Q5FA 1K73R 1DPUA 1KYZA 3AFHA 3GTGJ 3DLMA 4IF4A 4NQWA 2HQHA 2CMPA 1AHDP 3BCAA 3BG6A 2LP5A 4LD9K 4C92F 1HD3A 2ARSA 4BXUA 4LLNA 2DL4A 4M7DG 1V5FA 2QA4T 4IQJA 4S04A 1UGRB 1GGMA 4CH5A 1UJ8A 3JB9J 2QVOA