3V8KA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with biotin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
322
structure length
322
Chain Sequence
b'SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
total genus 93
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8kA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8kA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8kA02
2P6SA 4O5VA 3TEHA 4U0VA 5JVTA 3MAJA 2EV6A 1XGMA 4PJOA 3MWMA 1YS7A 5GAN3 2D2WA 3U9GA 4KICA 4TVYA 5E3IA 2QQ9A 1B7YB 3P9IA 2RM4A 1QF6A 3IC7A 2STTA 2ZMEA 4BYYA 3TQNA 3NRVA 4M7DF 3LC0A 2B0LA 3KP6A 2LF8A 2A3SA 1NJ8A 1YYVA 2R7DA 4N0BA 2Z9OA 3VBBA 5DUKA 2HGCA 2QUFA 3H3ZA 4EMKC 4V2SA 4Z2YA 1R22A 1FBSA 3WTVC 1P4XA 1NJ5A 1BI1A 4R79A 4HV6A 2ALYA 2ZGWA 2DQ0A 1P4WA 1HC7A 2RB6A 4A0YA 3QO8A 2LKPA 2BGCA 1K78B 3G1ZA 2MH2A 4EMKA 3VODA 3JB9I 1H4VB 4M7AB 4YRGA 1ZG3A 3UFGA 5DEQA 4IRGA 4L0ZB 2P5IA 5DV5A 3H92A 1ZLKA 5GMKm 1EOVA 3ROUA 1ZN2A 4ESFA 4LK0F 5FGMA 4P72C 3FF5A 3RI4A 2W57A 1ATIA 2JT1A 1QZYA 4HDVA 4U7DA 2FA5A 2HFHA 3QU3A 3TOAA 4XLNF 4G6DA 4HBLA 3ZMVA 4WXCA 2DTOA 2UXXA 1S3JA 3E6DA 3WE3A 4P72A 2NNNA 1O57A 4MQ9F 2YU3A 3R61A 1WSUA 3BP8A 3RACA 3AAFA 2HOEA 4YCWA 1XSDA 4XQ3A 4P71C 4MEYF 4HQMA 4M78F 1X55A 4NOYA 1HKTA 3JB9D 2ZO4A 5E18F 1T0FA 2ZINA 2VBZA 3P8YA 2XASA 3HRSA 5E1WA 1WRJA 5L3GA 5ILVA 1I5LA 1TW3A 1W4MA 2IJLA 1UFMA 4H0EA 3VQXA 4C8QF 4HZFA 4P71A 2ZZEA 4N9HA 1ZAOA 2Z99A 5IT9Z 5GANh 3VQYA 3FMQA 4LD5A 1KOGA 2FQ3A 3C3WA 3F72A 5DCMB 5LJ5h 2Z33A 2Q7EA 3QU6A 4UNOA 3ZPLA 5GAMf 1D3YA 4AD9A 3RGLA 3FIFA 4WJ4A 4P3OA 3E5XA 1MJAA 1EVKA 1UCRA 1W66A 3HXYA 2ISZA 4XU3A 1FBQA 4L5IA 3MF1A 1R1VA 3HRTA 5JR3A 3RPUA 3EYYA 2DU9A 4HAMA 2VOOA 2D1VA 4Q5SF 1XGNA 3HTSB 4I01A 2EB7A 3K1NA 5E17F 3A31A 5L3EA 1D8KA 1IN4A 4AIJA 2YR2A 1B76A 3NEUA 4UXNA 1G3WA 3IRRA 2R3SA 3HTZA 2M45A 5LJ5e 2MLGA 1ZG5A 2D45A 4XU0A 3W6JB 5H6QA 3E3VA 1FYMA 1WNLA 2A07F 1LYLA 1BI3A 4I0BA 1G3TA 3WE2A 2GAUA 4RQEA 4L0YB 4F7UG 5LGNA 2ODRC 1KQ0A 4PJOF 3SZPA 4LLGF 4BWAA 1QPMA 1U78A 2FU4A 4HYEA 3LFKA 1ZGAA 2E10A 2O0YA 1USSA 3HSRA 3J80K 2WWYA 1R5GA 4L18B 4C92C 2YSRA 4D0PA 3KLOA 4KIBA 2DK8A 3FWEA 3KEQA 1DPUA 4X9DA 2QBYA 4DNCA 5DUIA 3UGQA 3LA2A 2CFXA 3R60A 1Y0UA 4B09A 1YFHA 3HY1A 3FX3A 5CVJA 3JCMV 1U3EM 2H27A 1R1TA 1YW9A 4RGUA 2ZCEA 5HGQA 4EMSA 2DAOA 2FE3A 4S05A 1H9TA 4YPFA 1ZYRF 1EH8A 1EIYB 4CH6A 4UV9A 2A6HF 2OAZA 4M7DG 5AIPA 2V9VA 3K0LA 1ZLJA 3HOTA 2VXZA 4G8XA 3P9CA 1KYZA 2P6TA 3T5XA 5LHGA 4C8QE 1B7YA 4HV5A 1SD4A 1GXPA 2PI0A 4ENMA 4CS3A 2VC0A 4QWQA 3JCMd 3TKYA 1SMTA 4XTZA 2D1HA 2KIMA 2QHUA 2E5AA 3HFVA 5GAOm 3GWZA 2ZJ2A 2ZT7A 1YQAA 4E51A 1QNTA 1I6XA 3FXUA 5K5QA 3D0SA 3GFMA 2GXGA 5LGTA 1V4RA 1X54A 3QPHA 4Q15A 3CUQB 3MEYA 1MGQA 2E65A 2ZNYA 4RGSA 1XMAA 1Z91A 4M7AC 1E24A 3A5YA 4YDQA 1OYIA 1BI2A 1BC8C 4NL2A 3QTCA 2XKOA 4KUMA 2F5DA 1BIAA 1T6SA 2Z3YA 4I2OA 3BW1A 4TVAB 4MGRA 4UVAA 4HF2A 1K78A 4M9ZA 3NQOA 1G5HA 2JZYA 2F5CA 4JK1X 2PEXA 5GANf 4WX9A 3VB2A 4XEMA 4M7AA 1Z6RA 5LJ5g 2WV0A 4Y91A 5LJ5f 4ESBA 2OZ6A 1S7AA 3TDZC 3VOEA 2XAFA 4H2XB 1UB9A 1ON2A 2QLZA 4FX0A 3U1DA 1J75A 3DSQA 1EH7A 2YHTA 4YRSA 1KQ2A 3F8NA 3TO7A 1CF7B 2IW5A 4M78G 5E8GA 1I1GA 2YX7A 1FSHA 4YG2F 5GAOr 2Q0OA 3QAHA 4YRQA 4EGZA 1W7PD 4P9UA 4HX4A 3CUOA 1EH6A 1BI0A 2KJCA 3DP7A 4OMZA 4L9NA 3F8MA 1KMMA 3A74A 3HXUA 3LWFA 3ICAA 1M8VA 4I0AA 2F5EA 2MA3A 5CJ9A 1LNXA 5J6XA 4M75B 3P7NA 1YTYA 1ZREA 2ZT8A 3TUPA 2AKWB 1USYC 1XSVA 1TNSA 3GIBA 3SHFA 3TOBA 3ZN0A 2X4HA 3F6VA 3EUHA 3ISPA 4O6JA 5LGUA 5CVRA 1BJAA 5BS6A 5FFXA 3E9IA 2PQ8A 1X56A 3NELA 4M75E 5DCMA 1B6AA 4TV7A 5HDKA 5D8KB 2HYFA 1KQ9A 3HOSA 4RGRA 1USYA 3HSEA 5K1PA 3KP5A 3HXZA 3ZMSA 3HXVA 2GZWA 2ESHA 3V7SA 1HKQA 2Q7GA 1I1SA 4MEXF 1AWCA 3ELKA 3QUIA 5J8CA 4RB3C 1BN5A 1W7PB 5KVRA 1HBXG 1U2WA 4OOIA 4O3MA 2MLKA 1O7LA 1TQIA 4KIFA 4A2UA 3DPTA 5IT3A 3N97A 5ILUA 4M77D 1O3RA 4PJOG 2QQBA 3GW2A 4YCVA 1YIOA 4HQEA 2K27A 2DDZA 3HRUA 3DPLC 1X01A 3JAMK 3U2RA 3I64A 3ZMTA 5HVQC 3V8JA 5GAMj 6PAXA 5KK1A 4CH3A 5GMKl 4HWSA 3DEUA 4MMLA 5BPIA 4HOBA 1A04A 5CVIA 4A0XA 4G6QA 2IRFG 5CLSA 4CH5A 1N9WA 3K1PA 2EJRA 1IAWA 1SFEA 3WTWC 1G3YA 3LAPA 1J59A 3L4GB 2K86A 5KNNA 5C53B 4YRFA 3N4MA 5F5WA 1SMYF 2QVOA 4TWAA 3WTYC 3NENA 2VXFA 4ZTUB 2M1BA 4HWOA 5ERIA 3JCMX 2XHKA 2ZFWA 4I02A 3PGGA 1WWXA 2HR3A 1O3SA 3HRIA 4RAYA 2FBHA 3BJOA 2C6YA 2O8XA 3SWNB 2RKHA 1DUXC 1EIYA 3BJUA 4CO8A 4L9JA 1U5TB 4M77B 4A12A 4YRMA 1LDDA 3C18A 2E1NA 2CWEA 2DBBA 2ZCWA 4Q6GA 2YLCA 3P8TA 3BZ6A 1XDUA 2HEOA 3JCMJ 4M7AF 4HF1A 3V7CA 1DP7P 4YRJA 1GVJA 4P3NA 2LNBA 1LJ9A 3SFZA 1LDJA 3RESA 4ZYHA 4KMUX 4YP0A 5GAOp 3I54A 4XSZF 2STWA 2UWMA 2A68F 3PQJA 1O3QA 4J6XA 1J5YA 4XBFA 1H4SA 3CUQA 3F21A 1HK9A 3TO6A 2ZBKA 2RV8A 5GAN2 4HT9A 3P9KA 3ULQB 5FFZA 3JTHA 3A32A 4TVAA 4EM0B 2DPUA 1H9GA 4ZTZB 4OU0A 2EFNA 4G7ZF 4G84A 2ARSA 2E1CA 4CDGA 5IT9K 1I4K1 1WI9A 4LK1F 3UGTA 2VT2A 4C92E 5GAN6 4I98B 1HKSA 5EEHA 2Q7HA 4ENNA 2DZ9A 4H2XA 3DF8A 5CVUA 2QTXA 1IN6A 4EO4A 4TQDA 1OPCA 1J0RA 4H02A 2Z5UA 5GAMe 1OYYA 5LBQA 3T8RA 2YX4A 3F22A 4I09A 2HYGD 1CF7A 1Z7NA 2DQLA 2H6BA 3HSFA 4UP8A 1FSEA 1L3LA 1JGSA 1G5IA 4GYGA 3RKYA 4PDKA 4M75C 1BBUA 1ONVA 1JJCB 4WI1A 1BBYA 2EJ9A 4M73A 1GHCA 2CGHA 5GANj 1FP2A 1FYLA 4N9IA 2GA1A 1FOKA 4EX5A 3FB9A 5LJ5j 1SFXA 3T0YA 2RC4A 1LQ1A 4TQFA 1IN7A 3KP4A 1XB4A 4M75A 4PHCA 4PGHA 2AKWA 3CMQA 5EEGA 3BPXA 2R7FA 5HOOA 1B8AA 4ON0A 2HWVA 3I53A 5L3DA 2NNYA 3L00A 1PUEE 3TO9A 4CICA 4J15A 5FO5A 2W24A 2EFOA 2HZTA 4M6YA 4M7AE 2BBYA 1E2XA 4RQFA 2XGTA 1B70B 4UPAA 4CS2A 5C51B 3GFIA 3BOQA 1PP8F 1HXDA 2PLYA 4M7DD 5GAOl 2M30A 4HF0A 4JRKA 4KA4A 4BHBA 1RUNA 2VE9A 5HLHA 5DD8A 3JW4A 3E6CC 5AONA 2DLLA 4ZYDA 4P74C 3J81K 1W7PA 1KU7A 1UHMA 2XVCA 5D6EA 2MD5A 2K4BA 4G7HF 3TEGA 1ZARA 1YCYA 3HIFA 4HX7A 2RHSA 1RZ4A 1GGMA 1G3SA 3QHSA 1NJ6A 2IA0A 3ABTA 4Y13A 2DW4A 4H2YA 4P74A 2Y90A 4M9SA 3WTXC 1QQIA 2A6EF 1YFSA 3HHGA 2AMCB 2M8EA 1SESA 1BOAA 2JTVA 2EJFA 3RERA 4DQ2A 2BV6A 4N0AC 3I4PA 3HTUA 2IVMA 3FXQA 1IZ1A 4KR2A 1IN8A 1LVAA 5CAIA 2UZKA 4YFXF 2DXUA 2MH9A 4ZYEA 3JCMP 1R7JA 5GAMg 2XIGA 4A6EA 2FYKA 4H2TA 2PJPA 2CO5A 2G7UA 3KZZA 3I59B 3Q9SA 1PDNC 3SWNC 2ARTA 3L4GA 4YRRA 4L9VA 1YW7A 3I71A 2ZR2A 1P92A 1LEBA 3E6MA 1U5TC 4M77C 3PQKA 2PFBA 3TDUC 1T38A 1QZZA 4EM1A 3CDHA 1JHHA 1MDMB 3QNEA 2VBWA 3W3SA 4XTWA 1WLEA 3LSSA 1BM9A 3FMRA 5GANe 3SWNA 3BY7A 4L9TA 3IKMB 2H6CA 4M7AG 3MZHA 4XEOA 1GXQA 1U5TA 1D3BB 2DQ3A 4M77A 1W5SA 1QGPA 2VT3A 3DFGA 2V1DA 3KZYA 2FNAA 1F1ZA 1XN7A 3MEXA 2P5LC 1S8NA 3BROA 3KE2A 2A5YB 1U8RA 5HS8A 5FD5A 3I58A 3VQWA 3M9AA 1WPYA 4KFCA 2J5OA 5K1XA 3DV8A 5LJ3h 1RIOH 1WYDA 1MGTA 3FHZA 3RYRA 3KEOA 1ZG1A 1K7AA 2DU7A 2P4WA 2ZIOA 3KFWX 4JUVA 2FSWA 3LQRA 1P2FA 4C92A 4NB5A 1E1OA 1EV7A 5HDNA 1Z7UA 2OQGA 2W85A 3GFJA 4ZZLA 1BC7C 3M8FA 3MZYA 2ZZGA 3DXJF 3A7AA 5HLIA 2P7VB 5D6FA 1ZRFA 1CGPA 2O6GE 2G4CA 4RDXA 1IRGA 3L7WA 1HW2A 5GAMd 2XV4S 2L4MA 2IPQX 4E70A 4M75F 4M71A 4YRKA 2XAQA 3GEZA 4ZIBA 4OLFA 5E8IA 4OMYA 4TVWA 2FBKA 2YPRA 2OZUA 2KIFA 2CW0F 3JB9J 4PJOD 2OU2A 3F8CA 1B4AA 2Q5IA 2VXEA 4FX4A 5D4SA 2W25A 2ETHA 3L2CA 4EMGA 4KDPA 3JCMW 1S6LA 3EQLF 2ESNA 2EK5A 2XAJA 5ICFA 1JJCA 2CGPA 2WTEA 2HQNA 1S7OA 4H2SA 1R5HA 1ZRCA 4HT8A 2P0LA 1Z7MA 1SFUA 5ICEA 3F3XA 4OIQF 2CQKA 5GANg 3ZMUA 1VTNC 4OIOF 2RQPA 3E5QA 4LGWA 3IHUA 4Q48A 3ZN1A 1M5Q1 1JRIA 4OIRF 3KCCA 3GXOA 3V8KA 3Q5FA 2XTIA 2ZNJA 1OYWA 2XGXA 5DDGA 1X2HA 2KKOA 1MKMA 3RKXA 1U1SA 3SXYA 1FP1D 5L3BA 3IRQA 3HFZB 3QPTA 1B70A 5E1XA 3KP7A 2LDUA 1H641 1R00A 4LLNA 2XAHA 3M4GA 4PG3A 2QHVA 3L9FA 3F6OA 3AHUA 1O3TA 4KYWA 3LSQA 4UP7A 2BYVE 3FM3A 3CO7C 4CH4A 1TH7A 2QZ8A 4ZYGA 1NYRA 1YO5C 5LRRA 2C8MA 4U0YA 4C8QG 1BIBA 1H0MA 1O7FA 2PMFA 4XLPF 3I5UA 2DO7A 3K9TA 3JSPA 4G7OF 1P6RA 3A7RA 4X5OA 1ZRDA 2AMCA 4UVCA 1JBMA 1LDKB 1D8JA 1USTA 2HTSA 4M77F 2IA1A 3ECOA 3BY6A 5ICCA 1IW7F 1NHAA 5LJ3f 2DQRA 1LEAA 2F2EA 2KJBA 4XTXA 4LB5A 1YW8A 5CYVA 1MD0A 1FBUA 2G9WA 1G6NA 4CXFA 2LSOA 2JPCA 3BJAA 3PFIA 1R23A 4DPGA 3I59A 2VONA 1TQMA 3SQNA 5GANd 3B73A 2O03A 1R58A 5GAOq 2EL9A 5LJ5d 1ULYA 4GXOA 1MDMA 4WF2A 5D5UB 3OD1A 1FY7A 5LHIA 3GVAA 1T39A 1FC3A 4U0WA 4C92F 4UVBA 2XRNA 5LEKA 5JFRA 4YFNF 1D3BA 2L4AA 4EJOA 2E1HA 1B34B 5ELOA 2A61A 2IA2A 1T2KA 4YRNA 2E64A 1KQ1A 3R4KA 5TRDA 2ZNIA 1YFTA 12ASA 1PYSB 5ED4A 3BWGA 3FXRA 4YIIA 3RUXA 3JCMb 3B02A 3WGIA 2YLBA 2ARUA 1U1TA 2DVEA 1I81A 5D5WB 2XAGA 1OMIA 4LNSA 5FLXZ 5F6FA 3CJNA 3RJPA 4FT8A 1TNTA 2EA4A 5DYMA 3A7UA 1Z1DA 2NRAC 4EJUA 3MF2A 3F23A 4B8XA 4WJ3M 5H6RA 1X2GA 3LQQA 4MQVA 4CGZA 4M72A 2NYXA 5LEJA 4YCUA 1ODDA 2OBPA 3IWFA 4S04A 2L3DA 4IXAA 4M75G 2O61A 2DTHA 3IG2A 4ETSA 5GMKi 3GZ5A 1HW1A 3JCMQ 1ZH5A 2ZTGA 4AWXB 2E41A 4HA8A 2V6CA 2KIUA 2COMA 3GYHX 2Y0MA 4LB6B 4FHTA 1XGOA 1E1TA 3GX4X 1NNHA 4NQWA 4YROA 1DDNA 1FNNA 2EWNA 4A5NA 4UP9A 4KT5C 4M77E 3KP3A 3ZMDA 4JRIA 1J2XA 1X3UA 1R36A 2F5FA 4P9FA 3WTZA 1LB2A 2Q5HA 1HQCA 4Q4ZF 2NS0A 4M9XA 4RB0A 5J8FA 1I8FA 2BEOA 1HSJA 4I7HA 3JTGA 2VODA 2C7IA 3W6KB 3L1AA 3GF2A 1RIQA 2VC1A 2BE5F 3WGGA 5HS7A 2RHQB 2LF7A 1VQZA 2XROA 4LFUA 3DQVC 3K69A 1IXRC 1FLIA 2P8TA 4K88A 1FPQA 2RD1A 5D5XB 3QO5A 4ESJA 4HWPA 4JQFA 1TQPA 1KU9A 3PCOB 3O6BB 5D5VB 1MJ9A 4EJWA 1OR7A 3RIRA 3LSTA 1NJ1A 4HWTA 2FF4A 3FM5A 4EQQA 3MCZA 3KP2A 3V8LA 1SETA 2ACJA 3BFMA 3HFZA 4CS4A 3JCMh 1TLHB 5GMKj 2M87A 2FB7A 1MJBA 3EYIA 4ASNA 1FZPB 5DCFA 3RL6A 2WC2A 4EM2A 1L0OC 5H20A 2PG4A 2DXTA 3OOPA 2VN2A 4J5YA 1BBWA 5TJJA 1JXSA 1DPRA 4BH9A 3JAMZ 5GAN5 4KN7X 2MC3A 4MNUA 1D5VA 1XCVA 4EJVA 4P75C 2CG4A 4OINF 3EDPA 4R8HA 2TDXA 4RS8A 5HS9A 1B1BA 1ZHFA 1H4TA 1E17A 3VQVA 4CYDA 2ZXJA 4M77G 2RNJA 2V79A 4RB2C 3ERRA 4NL3A 1XD7A 3JCMe 1B9MA 3DKWA 1F9NA 1KYWA 3WQZA 4P75A 3JB9F 2QYOA 2IP2A 4XSXF 1T98A 3QSUA 2JN0A 1FT9A 1STZA 1I27A 1XSXA 4ZZDA 4RCBA 4YREA 5K1YA 2RGVA 1QE0A 1YLFA 4XU2A 1EQRA 2PMEA 5L3FA 2AXLA 1K6OA 2K02A 5I21A 4EMHA 3QOPA 1F4KA 3LA7A 4H2WA 3F8FA 4RCCA 3EFSA 3GFLA 4C92G 1FWZA 4F7UB 4BHCA 2OA4A 3BDDA 2HTJA 5GMKh 4MTEA 3TGNA 5BPDA 2EFQA 2OD5A 4HLXA 4GYIA 1G51A 4QVDA 1SRYA 5A2QZ 3IKVA 1B59A 2I4OA 1B34A 2CYYA 4F7UE 4MTDA 4O2DA 5LJ3j 3RYPA 2UXNA 5FB2A 2IY5B 1PYSA 2J5PA 2W84A 4HLYA 1B9NA 1J7KA 3O3KA 1ASZA 3GZ6A 1W5TA 4BQAA 4IHSA 4KMFA 4QVCA 2CJBA 3K2ZA 3WG9A 5GMKe 3S2WA 3QP6A 1Y96B 3E6BA 4KIGA 2O3FA 2AS5F 4N0AA 4HVCA 3VFZA 4EV0A 1SAXA 2RN7A 4M7DB 1C0WA 4H2UA 1MZBA 3OV8A 4IPAA 4BAYA 4IF4A 3PZCA 3SZTA 5BOXA 1FYKA 2FOKA 3R0JA 1LJOA 2JPBA 3HXWA 2ZZFA 4M7DE 2ELHA 4M78D 3L09A 4OP0A 1Z05A 3HUGA 3HRKA 2EV0A 3JCMg 1WKMA 3JCMf 3R0AA 4PGGA 1J9IA 3INZA 1YB3A 1OKRA 4C8QD 3M7GA 4GO1A 1FYFA 1HSTA 2JSCA 3HYIA 3MQ0A 5JHUA 3WTUC 4P96A 4HWRA 1RUOA 1IXSB 2PMHA 4WCGA 2VE8A 5FD6A 1KU2A 2DI3A 4KNYA 4YRLA 5K5RA 1PP7U 2VBXA 2PN6A 2FRHA 1H4QA 5C52B 2DT5A 4IHTA 3I7FA 2IT0A 4RGXA 1IN5A 2RHQA 3ERED 1P4AA 3HSBA 2JRTA 1G4DA 1XCBA 2J3MA 2CSOA 3WGHA 4P73C 4M78B 4LMYA 1IXCA 2FNPA 2VC8A 4HDUA 3PCOA 4KN4X 1R1UA 5LJ3e 4PNOA 1KGSA 3RTRA 2DPDA 3CLOA 3J81Z 1JHFA 3IALA 2MBFA 4JBAA 4C8QB 3JB9H 4A53A 2EA2A 4M78E 4P73A 4YIFA 1YS6A 4R1HA 5LHHA 3EFRA 4M6XA 5AIQA 2DK5A 2FMLA 1C0AA 4CZZA 3MFKA 4LG0B 2HKXA 4BNCA 1KQ8A 1REPC 3M4QA 2ADUA 1RI7A 1I5ZA 2L01A 2QWWA 4LJZF 3Q9VA 4HX8A 1Q1HA 4G85A 2J3LA 3IKLA 2NAZA 4YRTA 2EFPA 4G9YA 2XUBA 2K4JA 4PCQA 4K87A 4G94A 2FMYA 4GCVA 4HW0A 4TTVA 1EVLA 4RAZA 3JB9G 3REUA 3LAJA 2VOPA 5GAN4 3WTTC 3FJPA 5F1RA 3WU1B 1NYQA 4Q47A 3R6SA 5CVVA 5F64A 1N9SA 2HKOA 2EFWA 3ECHA 3JSOA 1KA8A 4XU1A 4XTVA 4MMKA 1ZGJA 4P5OA 3ZP5A 3NEMA 2RVCA 2A69F 1AOYA 4WK8F 3LA3A 1L0WA 4UHTA 5FLXK 2GA2A 3SB2A 2FEZA 2GIVA 4M75D 1YFRA 5DY9A 4AIKA 4YRPA 2DU5A 3REXA 2GQQA 2EJGA 1HTTA 3TEHB 4YRIA 1ASYA 1JE8A 4NCXA 4PJOB 3R07A 2ZT6A 4QLCU 1SD6A 3E9HA 3E5UA 4PZJA 3M4PA 2XKPA 1UHWA 2H09A 1YGBA 2DZCA 2X0LA 4F7UA 2I2LA 4IVNA 2L54A 2ZMEB 2ZR3A 3BPVA 4AIHA 4XTYA 4PJOE 3WU0A 4WWCA 3G3ZA 2DFIA 4X9CA 2OQRA 3KLNA 2Y75A 1SD5A 5HLGA 2CJAA 4OIPF 2E7WA 3HHHA 3J80Z 3M1EA 4WXHA 5DD4A 2HDCA 4KQEA 2V1XA 4U7BA 3VU3C 1IF1A 3E97A 3J7AO 1K79A 1ADJA 1U6GA 4A5MA 4AVPA 3G73A 1LOJA 2I4LA 4EGYA 2DJZA 11ASA 1TTYA 5K5OA 3V7RA 2ALYB 3GO5A 2IY5A 4EVIA 1WQ2A 5LJ3g 1FX7A 4M7DC 1NJ2A 1WQ7A 5ILSA 4A6DA 1IRFA 3ABUA 4P55A 3HFOA 4EMKB 3CTAA 4IRHA 1V3FA 1Y96A 1LNWA 3M8EA 4BW9A 2FBIA 3NETA 2L02A 2K7LA 4M7DA 3QP5A 3HXXA 4YYEA 2V1UA 3QRFF 3KFUA 1RNLA 4NHJA 4BHPA 1XDSA 5HDGA 4ZH4F 5D8LB 4UV8A 2VBYA 1N9RA 3C7JA 2KRFA 2P5VA 3IWZA 4L5JA 4WXDA 5GAN8 3L2ZA 3RPQA 4Y17A 2ZIMA 1QO0D 4ENKA 3QO7A 1HW5A 4EJTA 4ENJA 1KMNA 2K57A 1XGSA 3RF1A 4AH6A 1IUYA 4F7ZA 4H2VA 2ZNZA 2M5WA 4UUVA 5E20A 2CIMA 4Y15A 2DTRA 2RHSB 4K86A 1S29A 4IJAA 4U88A 1TW2A 3O2PE 5BQTA 4RMFA 3T1BA 4A0ZA 1Z9CA 2PMUA 3I0TA 2QM3A 5L3CA 3D5LA 4XTUA 5GAOn 3C1DA 2P5KA 4M78C 2CJ9A 3ZMZA 2P7CB 5E1ZB 1WQWA 3A5ZA 2HNIA 4KR3A 2E7XA 1YG2A 2QHTA 2ZT5A 4M74A 2ZKZA 3FZVA 2Y48A 5LJ3d 2ODRD 4A54A 3HRMA 2RDPA 3UH0A 2DTIA 4C8QC 5JI6A 1XMKA 4MHGA 4M78A 3ML6A 1SERA 2PBIA 1ON1A 4CHUA 4BXUA 4C92D 3KETA 3CO6C 4LLLA 5D4RA 5LRSA 2ZXFA 3H3UA 3RDIA 2EAYA 3ZQ7A 1ADYA 4K2EA 4C8QA 3IKTA 2QHSA 4XRFA 4J6WA 1TBXA 3T8TA 2RA2A 2DKGA 3GLXA 1IL2A 4LG0A 3RKWA 1Z6TA 2GXBA 2Q2EA 3JCMc 4IRIA 2ISYA 4J6YA 3FMSA 4GGGA 3BDUA 1QBJA 2DEQA 3CUQC 3P8VA 5LLQA 4JLIA 1KU3A 3F8BA 5A2QK 2I4NA 4YFKF 5BMZA 4F7UF 2FXAA 2HQRA 3WTSC 1EFWA 3REOA 4L87A 3EETA 3IL2A 3GUDA 2QQAA 2H94A 3COAC 3HY0A 1SD7A 2QBYB 2I4MA 3QO3A 2Q8KA 1E22A 5GAMh 3BJ6A 3V4GA 2EV5A 4PJOC 2E3CA 3WODF 4C92B 3K1MA 5ELNA 1J5WA 5ICGA 1F5TA 2G7HA 3HFNA 2HS5A 3VEPA 4RB1A 4P3PA 4YRCA 2QENA 2GWRA 1WU7A 4M7AD 5GAN7
chains in the Genus database with same CATH superfamily
3CC7T 2EV6A 4HCCA 3MWMA 3H5NA 2D2WA 4KBMB 3U9GA 4A3IJ 2QQ9A 3P9IA 4XNFA 3K2AA 3QKJA 3NRVA 4N4OB 3CCVT 1M2OA 3LC0A 2E19A 4XICA 2A3SA 3EHRA 1NJ8A 2V6EA 5DUKA 2HGCA 2PMZA 3H3ZA 5FLVA 1R22A 3PO3J 3VSKA 1BI1A 4R79A 3ASKA 5IY5H 2OTJI 1EJ9A 2ZGWA 4H4KC 1P4WA 2AKKA 3LSJA 2RB6A 3CC2Q 2JUFA 3TQ7P 4F91B 1A31A 4KGXB 1ZLMA 3JAME 1X3ZB 3JB9I 4CCKA 3REAB 2QEXT 2CKKA 4NBQA 3VKIA 4PLIA 5GMKm 4ESFA 4LK0F 2DL4A 5IOZA 4ZDPA 3GTPJ 1M3CA 3ULRB 4PJMA 1PD0A 3ZMVA 3TCJA 2D8HA 1S3JA 3NPFA 2VQCA 4P72A 3KZIC 4MQ9F 3H5AA 2YT6A 5E3NA 3BP8A 2HOEA 4YCWA 5LL6S 3UA7A 4P71C 4HQMA 5IP6A 1X55A 4NOYA 3G4ST 1GUUA 1M90U 2LMDA 2ZINA 3CCEI 2XASA 3HRSA 5ILVA 2CUEA 4DOZA 2CP7A 1LFBA 3OYKA 2QYZA 3VQYA 3FMQA 2OJED 3C3WA 2GFUA 3ZPLA 1HOMA 4Y92A 3RGLA 1WHLA 3E5XA 1G59A 1UCRA 2ISZA 4L5IA 4BUPA 1UTIA 5JR3A 4HAMA 2D1VA 4CYCB 3HTSB 4I01A 3ABKH 1LUJB 4AIJA 3DB4A 3MP6A 2P4TA 2MLGA 3G71Q 4XU0A 1FOYA 3W6JB 1FYMA 2K40A 1WNLA 1W6XA 1Q82R 4AUXA 2JSPA 2M9HA 4F7UG 4CCLA 4PJOF 3CPWA 1U78A 1R5GA 4L18B 4OMFB 4NDLA 3VS7A 1ETVA 1ZSZC 3KLOA 4KIBA 1OU8A 4L59A 4OMNA 4RM2A 4BE1A 3H3VK 5DUIA 3F70A 1E7OA 1X27A 2JT4A 3HY1A 2H27A 1R1TA 4QW2A 3KYLA 1S1NA 5HGQA 2DAOA 2CJJA 2J6OA 1EIYB 4U87A 2K9MA 2QAZA 4JX4A 3M5AA 1ETXA 3OYGA 2A6HF 4DA4A 4R0KA 4KITB 3K0LA 1ZLJA 3HOTA 4G8XA 3T5XA 5LHGA 1B7YA 5I2SA 4HV5A 1GXPA 2PI0A 4CS3A 1SMTA 2QHUA 2KIMA 3CC7I 2XSDC 4E51A 1WJAA 3GP8A 1I1JA 2GXGA 3QPHA 1UG1A 3VYGA 1UECA 1YHQQ 2DL7A 3E19A 4CCJA 5IP7J 1Z91A 4YDQA 1OYIA 4BD3A 1QMCA 3CCVI 1S7EA 4HSRA 3FIWA 3BW1A 1CKBA 1BU1A 4M4ZA 1G5HA 3NQOA 5KCOA 5GANf 2I5UA 3VB2A 3CCUQ 4OGEA 4M7AA 1Z6RA 4Y91A 4W97A 2WAQA 1GCQA 1HCRA 5I2MA 3HHTB 4KISA 2ESWA 1ON2A 2QLZA 1AHDP 1MMDA 5E3MA 3EFOA 1KQ2A 2FUG2 2QEXI 5F0FA 5IHNA 2OTLQ 4M78G 4EATA 2WSEE 4YG2F 1MV0B 4B1RA 2QSGX 1SG5A 3CUOA 1EH6A 1AZGB 2OJ2A 3EUHC 2ZPEB 4OMZA 4L9NA 4IUTA 3HXUA 1M8VA 5CQYA 1H3ZA 4EPCA 2AKWB 2MW8A 1YRNB 1N6AA 1MMNA 2X4HA 3F6VA 1WJQA 5LGUA 3G4SI 3VWBA 1OCRH 3E9IA 2PQ8A 4PJNA 1B6AA 1GLNA 1SEMA 1KQ9A 2DDAA 2HCKA 2O5RA 2Z1DA 5K1PA 2K2MA 3KP5A 3PVLA 3HXZA 1M1GA 3VJPA 1TS9A 3HXVA 2GZWA 3VYSB 3V7SA 1HKQA 1UHSA 2L7MP 2Q7GA 4BY1J 2O8KA 3QUIA 3VYUB 3VSLA 3QYEA 1W7PB 3X24B 4LG3A 3OBWA 4O3MA 2MLKA 2AZVA 1IUFA 4KIFA 4A2UA 5IYDJ 2EBIA 3VS6A 3HOUJ 4J9CA 4YCVA 1YIOA 4HQEA 3JAMK 1RETA 1K4TA 2YUOA 3V8JA 5GAMj 1IGNA 4HWSA 3DEUA 2J7IA 4MMLA 4GLKA 5CVIA 4XOPA 2IRFG 3HOWJ 2LX9A 1SFEA 3WTWC 1J59A 1ZBXA 3HEFA 2MPXC 5KNNA 5C53B 5DM7R 4ZTUB 3JCMX 4KJZA 2XHKA 4FE7A 2LREA 3G1JA 1DUXC 1QCNA 1OZ3A 3TMOA 3PJRA 3HOVJ 3C18A 2E1NA 2ZCWA 2W7NA 5TGTA 4Q6GA 2YLCA 3GTQJ 3S15J 4HF1A 3LSHA 2MF2A 1GVJA 2L9VA 4HRIA 4IO9F 3SFZA 3OYNA 1SVLA 1X6GA 4J6XA 1QW1A 3CUQA 3QYGB 2LJ3A 4CI0C 4OMOA 2W48A 3CMAA 3C94A 2V4JC 4ELZC 4C0DC 3KIOA 2JN6A 3UGTA 2COWA 2VT2A 4C92E 1HKSA 2QF7A 2DZ9A 5DM7F 4H2XA 2QTXA 4EO4A 1TUDA 4FQGA 1J0RA 5C4XJ 2L9RA 4QKUA 2YX4A 2GGRA 4RLQA 3JRIA 5BNGA 2CV1A 4PDKA 4M75C 1BBUA 1ONVA 1JJCB 1B8IB 1G83A 4WI1A 1XTDA 2EJ9A 1FYLA 5LJ5j 3T0YA 1VQMA 3KP4A 4HKEA 3EG3A 2VKHA 4PGHA 3CMQA 5EEGA 3DWLE 2HWVA 1N5ZA 3M55A 5FO5A 2W24A 1KQSS 3WVDB 1ETYA 2K9QA 4M6YA 2XI9A 3I5RA 3IAS2 4RKUE 2HKNA 4UPAA 5C51B 4M7DD 2CZ7B 3J7AY 4KA4A 4LD6A 4XLCA 4ZYDA 1UHMA 5D6EA 3HIFA 4RM3A 1G3SA 2HPIA 3ABTA 4Y13A 2DW4A 2Y90A 1VQ7A 2A6EF 2DYIA 1SESA 3LFUA 2EJFA 2BV6A 3FXQA 1IN8A 1LVAA 5ECAA 4CC3A 1KONA 4ZYEA 2HDAA 5GAMg 4C0GA 4A6EA 4H2TA 3CCLA 3SWNC 3I59B 5DS9A 3L4GA 4YRRA 4L9VA 1M1KU 1Z9ZA 1U5TC 2ZJPF 3PQKA 2PFBA 1QZZA 1DGRM 3M0SA 4EM1A 3QNEA 3W3SA 3FXMA 3FMRA 3CCSA 4L9TA 4M7AG 4A3GJ 4XEOA 2M0OA 4M77A 4J7IA 2CV0A 3SFIA 2DVJA 4PK4A 2VT3A 1TWCJ 5KCHA 3MVPA 3VS3A 2HAXA 2A5YB 5HS8A 2LCLA 1N8RU 2EYWA 2J5OA 5CKDA 2MI6A 4RTXA 4M3DA 1VQPQ 1ZG1A 4JUVA 1MHNA 4XQFA 4X1VA 2DL8A 4C92A 4NB5A 2KQWA 1E1OA 1O9SA 5B1BH 3BR0A 1BC7C 3CC2A 2M2EA 4N4IA 2ZZGA 2QSHX 5D6FA 1KHIA 2O6GE 2X3WD 1IRGA 1HW2A 2WADA 2CZ0B 2L4MA 2IPQX 4M71A 2GBQA 1K8AC 3GEZA 2DOFA 4OMYA 2DA6A 2KE9A 2LH9A 1YOVB 2M0CA 5J1UA 2HVQA 4C0FA 2RQTA 2XAJA 4XL9A 1YE9A 4UC4A 4H2SA 2QKMB 2PVOB 3CPWS 3CXCA 1KZHA 2EFIA 5ICEA 2CQKA 4XM3A 2GFAA 4OIOF 2DOEA 3DBRB 3GOXA 1IC8A 4C0ZA 1WXBA 4V2FA 3V8KA 3Q5FA 2ZNJA 1X19A 2XGXA 2RH2A 2KKOA 1MKMA 4HVVA 3VS5A 1FP1D 3QPTA 4DYRA 4II1A 2CU7A 4LLNA 2XAHA 4XONA 4PG3A 2FPEA 2QHVA 3P8HA 1BB9A 3JRHA 1ACIA 1O3TA 3LSQA 4UP7A 1KC8U 4RAGA 4QQGA 4CH4A 3VUZA 4ZYGA 2P84A 1V76A 4J00A 1X1BA 3K9TA 3G71A 3JSPA 4G7OF 1YJWQ 1TOVA 1SPKA 3QOEA 4X5OA 4UVCA 3GTLJ 3CJQB 1USTA 2HTSA 5ICCA 2F2EA 3G2BA 1JT6A 2G9WA 1G6NA 4CXFA 2RF0A 1UAAA 2JPCA 3BJAA 3PFIA 4IL6C 2VONA 2VJ4A 2ME6A 5GAOq 2CP3A 3PO2J 2O31A 1BR1A 1ULYA 1POGA 2FX0A 1U0JA 5LHIA 2NUPA 4J8OA 1T39A 2JQ7A 4UVBA 2XRNA 1R6RA 4G12A 4EJOA 5ELOA 2IA2A 2E64A 12ASA 3JCMb 2ARUA 4J7FA 2JA7J 4BB7A 3S3MA 3NGPA 1SFOJ 5DYMA 1YHQA 2NRAC 3A8OB 4AC0A 3ZXSA 4ZGJB 3EHQA 4S04A 1YP5A 2LP5A 3CMAT 1EF4A 4AFSC 3GZ5A 3CCUA 1VOMA 4AWXB 4QIWN 1G5VA 1M1EB 2NUTB 4LB6B 4FHTA 2E6ZA 2Y30A 1K73U 4BKXA 2EWNA 1WPKA 3KP3A 3LSGA 2W1OA 3LSPA 4XK8E 2QQSA 2OTLA 2A36A 4CZCA 3WTZA 2XHCA 2QQ8A 4Q4ZF 2NS0A 3MN2A 1PUFA 3M57A 4E7HA 2EGCA 2KT1A 4II2A 3EG9A 2VC1A 2BE5F 1OR7C 2RHQB 4LIVA 2LF7A 2LBFB 3CQZJ 1RPWA 2L9NA 2XROA 4UY8I 4LFUA 3DQVC 3E2UA 5CKFA 3URGA 1FLIA 2P8TA 2OV7A 5GADJ 2RD1A 4HWPA 1TQPA 1AWWA 2P4RA 5D5VB 4D7MA 2R93J 4KGVB 2JJ7A 2FF4A 3FM5A 3MCZA 1SETA 3DKMA 3CJRB 3BFMA 1TLHB 2DYSH 2FB7A 3EYIA 5DCFA 3S8PA 4PFZA 4EM2A 1L0OC 5H20A 1IG7A 2DXTA 2HQHA 2JXBA 1BBWA 1JXSA 2RJDA 5JLXA 2VIXA 4BH9A 5GAN5 1UUEA 4EJVA 2IGMA 4P75C 3EDPA 4R8HA 4RS8A 3DCFA 1B1BA 1GFDA 3X2QH 2ZXJA 4PJLA 4M77G 2RNJA 4RB2C 2DPPB 1M3AA 1R49A 1XD7A 3DKWA 3JB9F 3GBQA 2QYOA 8AT1B 3CD6Q 2ZXHA 1JU5C 4Q5WA 4XSXF 8ATCB 1STZA 2ICWG 1I27A 1XSXA 2KSSA 3FRNA 7AT1B 3PSIA 4EMHA 1F4KA 3LA7A 3CCLT 2DDBA 3S2DJ 3EFSA 4C92G 4E7KA 2A6TA 2KR3A 5HY6A 4F7UB 4XOTA 3K4KA 2HTJA 1VA7A 2OF7A 2JUGA 2PJRA 3IKVA 2I4OA 4BL0B 3CCST 1XG1A 3M0QA 1M2VA 4O2DA 5LJ3j 4BBSJ 1ABQA 4YELA 2IY5B 2J5PA 1P7IA 1J7KA 1Y6IA 1JJ2A 2KPMA 3RKQA 4IHSA 4KMFA 1PCXA 3K2ZA 1IDYA 3QP6A 2BHYA 1Y96B 5D6WA 1ZTRA 4HVCA 3VFZA 5J4VA 4EV0A 3H0HA 4H2UA 4BAYA 5A2QE 1I3QJ 4IF4A 3PZCA 1YJ9T 2FOKA 1LJOA 1WLPB 2DMOA 4C3IJ 4M7DE 2Y2ZA 5GPAA 3CC2T 3P8BB 4OP0A 1Z05A 3R0AA 3BG7A 3HM5A 3QDRB 1RI0A 3C12A 3M7GA 3A02A 3CMAI 1HSTA 3UDCA 3R6OA 3BLYA 2EIMH 2J6KA 4HWRA 2PMHA 1V29B 2VE8A 5FD6A 4KNYA 3ZQIA 3DEWA 2A28A 3A5ZB 2F2XA 2DT5A 1IV8A 3I7FA 3OW2A 1IN5A 5GJWB 2OTJQ 2JRTA 1XCBA 2CSOA 4M78B 3BR6A 4BY6C 4HDUA 3PCOA 4KN4X 1KGSA 3RTRA 4JJBA 2OX7A 3X25B 3OYYA 4C8QB 3JB9H 4A53A 2EA2A 4P73A 4YIFA 1YS6A 1JJ8C 3PNVA 2FRYA 4LVJA 3BT9A 1WXUA 3MFKA 1REPC 2E6NA 2L01A 5C3EJ 2QWWA 3Q9VA 1Q1HA 1R8OB 4L5GA 4LXCA 2EFPA 4G9YA 4K87A 3M0TA 1EVLA 3UT1A 4GLMA 1OULA 3WTTC 3HZJA 2R7ZJ 3OYFA 3JRGA 2EFWA 4OAYA 1KA8A 2L3SA 1X3WB 4FM4B 1ZGJA 4P5OA 1LCKA 2RREA 1SHGA 3G71T 1H8AC 2A69F 1GCQC 1ZUUA 3HOXJ 4WK8F 3LA3A 5FLXK 3SB2A 4M75D 3PMTA 4AIKA 2NS7A 1OU9A 2GQQA 3OMGA 2DA2A 4NCXA 1FOXA 4PZJA 3M4PA 2X4YA 3DU6A 1UHWA 4A3BJ 3TVTA 2DZCA 2EBPA 4IVNA 3OA6A 5IYCJ 1YJNQ 4X9CA 2LVSA 3E9GA 3MQZA 3K10A 4V2GA 3M0RA 4BJTA 3CCLI 3CCMQ 1X2QA 3U23A 3OIPA 1ADJA 2DTZA 4EGYA 2EKOA 1K8AR 3GO5A 4I99C 5LJ3g 4KGZB 1WH5A 2XDBA 4FIBA 3HFOA 3CXCS 4NNJA 2JVVA 3CCSI 4IRHA 4RTZA 3K4JA 1T3SA 4BW9A 3Q1JA 1Z67A 3NETA 4XLEA 2L02A 2K7LA 1H3HA 4ZGDB 3OSVA 3QP5A 1VQPA 4M7DA 1FOWA 2VPLA 2RI3A 4NHJA 4LVKA 2VBYA 1PKSA 1WIEA 2YWWA 4B9WA 1YHQT 2P5VA 3IWZA 4WXDA 1MBEA 5IPAA 2RQWA 1K4SA 3MKLA 4IHWA 4ENKA 1HW5A 2DA4A 1KMNA 4A3CJ 1P7JA 5J1YA 2B63J 1IUYA 1YJ9I 4A3KJ 2M5WA 3UATA 4K86A 1A35A 3CC2I 2O88A 1TW2A 3O2PE 5BQTA 3RNJA 3T1BA 2EINH 2V8JA 1Z9CA 2LT1A 3SDGA 4GBQA 1WHGA 5L3CA 2CSQA 5GAOn 3PNTA 1SHFA 2P5KA 3ZMZA 1G2HA 5IOYA 2YDLA 4IZZA 2E1MB 2QHTA 2CT4A 2ODRD 2PZ1A 2RDPA 3HPWA 2X1CA 3RQIA 5JI6A 3CCVQ 1JXOA 1VQOT 2EYZA 1OPLA 4BXUA 3NWSA 5GPCA 2WV1A 1PRLC 4M3GA 2CUDA 2ZXFA 1TWFJ 3ZQ7A 3BCBA 2QHSA 4JS5A 3D5SC 2DKGA 3GLXA 2ELJA 4LG0A 1Z6TA 4IRIA 3UKGA 3SEZA 3Q0WA 2DE0X 2OCCH 3CUQC 4FSXA 4BACA 3K4MA 1OEBA 3F8BA 2E3IA 5A2QK 1RACB 4F7UF 1M3BA 4RG2A 2HQRA 3REOA 1YFNA 3IL2A 3HY0A 2QXFA 1YJWA 3NAUA 1ZBJA 2LKXA 1XS9A 2E3CA 1Q81C 4DBHA 2XDVA 2Y9ZA 3ZR8X 2Y4XA 2LP0A 4N4HA 2XD0A 2CQXA 3HFNA 2KRSA 4U0VA 3G4SQ 5GAN3 3G71I 2DL3A 1EX4A 4XK4A 2Y69H 3S1NJ 3P5JA 1B7YB 2JMAA 1QF6A 5DLQE 3OYAA 2HNHA 4B4CA 2J05A 4LDWA 3BR5A 1APLC 3AKZA 2BIVA 4N0BA 4D8KA 2HD0A 5CIUA 2K5CA 4Z2YA 2X85A 3WTVC 3S93A 1HJDA 3A1YA 2VUMJ 3FISA 3VDXA 1MMAA 3QO8A 3G1LA 2KYBA 2BGCA 2EYXA 4M7AB 4BU2A 4YRGA 5DEQA 3OSSC 4IRGA 5D6XA 2BE9B 1D1AA 5DV5A 3GTOJ 3H92A 1ZLKA 4G6TB 3U21A 3RI4A 2A08A 2JT1A 1OPKA 2ATCB 1OCOH 3EFOB 2D8JA 4RLFA 4C5GA 1PRMC 1T0FC 3E6DA 3VV0A 2ZPGB 3R61A 3RACA 2GTJA 4XQ3A 1YHQI 1FYNA 3I55A 4M78F 2OUMA 2HMAA 1HKTA 3GTGJ 4IQ4A 2KT0A 1ZUYA 2KNBB 5E1WA 1I5LA 1TW3A 1W4MA 2W0ZA 2LY2A 1AKHA 4C8QF 2FJ1A 5KYXA 4P71A 1X2MA 2ZZDA 1UDLA 5IT9Z 4FT4A 3L2UA 4J9BA 1QCFA 4P5NA 2JM9A 3M4YA 3QU6A 5GAMf 1D3YA 3IQLA 1RAAB 4AD9A 2NOJB 1EVKA 4HVUA 1SSHA 3MF1A 3HRTA 3EYYA 1FIPA 2VOOA 2LYCA 1XGNA 2LFBA 3K1NA 5E17F 4OMMA 4R56A 1IN4A 3VS4A 3QZ5B 4R55A 3NEUA 1G3WA 2R3SA 2M51A 2GNCA 5LJ5e 1ZG5A 3E3VA 1VQOI 3X20B 1OQKA 1BI3A 2GAUA 2OC6A 5IHIA 2VPRA 1KQ0A 1FMWA 1VQ4A 1D1BA 2O0YA 3HSRA 2K6DA 4C92C 2F2WA 2YSRA 1JJ2S 1Y39A 4AFQC 3FWEA 5CQEA 4X9DA 2KT8A 4DJAA 2CUZA 3CEYA 1KIKA 3UGQA 3LA2A 3R60A 2C0OA 5FU6B 1Y0UA 3CD6A 2ZSIB 3QBYA 1EZZB 1S5LC 1U3EM 4IEJA 1ZSZA 4EMSA 4CCMA 2I0NA 1NPPA 1ZYRF 1QVFP 1S72Q 3OS5A 1AWXA 2RHUA 4M7DG 5AIPA 1BL0A 2V9VA 1I5OB 3S32A 1ACMB 2VC0A 3TKYA 2CW8A 2KVQG 2D1HA 5GAOm 3ASNH 2XKOC 2ZT7A 1I6XA 4DEXA 1OI1A 4J9HA 4Z88A 3CUQB 1DGWY 2ZNYA 4RGSA 1XJWB 1E24A 1BI2A 1T6SA 4A3MJ 2Z3YA 1JTYA 1ZKGA 4MGRA 4UVAA 4HF2A 2JZYA 4WX9A 2EGEA 5LJ5f 4ESBA 3PVQA 4AYBN 1I3AA 4GY5A 2OI3A 2RQVA 4H2XB 2QGFB 1I50J 1GVDA 4FX0A 2FOWA 3BQYA 4IHVA 3RCOA 1J75A 1EH7A 2YHTA 3TO7A 2IW5A 1FSHA 2Q0OA 1W7PD 3OQ5A 2BKDN 1I0CA 3BG9A 2KJCA 4AFZC 3F8MA 2RHIA 3ICAA 2F5EA 2MA3A 1LNXA 3QIIA 5J6XA 1YTYA 4HG2A 2ZT8A 1M90C 1USYC 3GIBA 3ZN0A 3CCJQ 2RN8A 3ISPA 3EUHA 2HOTA 5CVRA 5DTDA 1BJAA 2HZYA 5BS6A 3P8DA 3QJYA 4BDYA 4M75E 1TZLA 5HNFA 2MD0A 2HYFA 1RRJA 3HSEA 1RESA 1JTXA 1ZQ3P 3ZMSA 1O75A 2OTJA 1I1SA 4MEXF 4A3FJ 2ECZA 3ELKA 1QP2A 2DD5A 3A03A 4A69C 2YRVA 1WVRA 1VQ6Q 3MP1A 1TQIA 3DPTA 2A0FB 5IT3A 3N97A 1R77A 1Y71A 3TU4K 5HK3A 3GW2A 2FD5A 2GF7A 2K27A 1DU6A 3I64A 3OYEA 3UR3C 3FKIJ 2RHZA 5J3BA 5EEAA 6PAXA 4JP0A 3ZQGA 5GMKl 3KEYA 4BQQA 2O9LA 2IAIA 4A0XA 4G6QA 4CH5A 1N9WA 2XIDA 1IAWA 3MEAA 2XGDA 2DA7A 4DOWA 4D5FA 4LIUA 3L4GB 2K86A 4YRFA 1BA5A 5F5WA 3WTYC 4ME7A 1PC0A 4HWOA 2DFHA 2JA2A 1YJWT 2X35A 2HR3A 1O3SA 1Q86R 4RAYA 2VQLA 1TT5B 2ZJQF 4L9JA 1QA6A 4M77B 4A12A 4YRMA 1LDDA 2PQWA 4Y4RA 1LFUP 4M7AF 4BS9A 3CQTA 4P3NA 3QXEB 1SVOA 3RESA 4ZYHA 1YJNA 4XSZF 4E7LA 2STWA 2A68F 1O3QA 4ZN3A 1J5YA 3CCMA 3F21A 3TO6A 2MSYA 2NWMA 4FISA 4XKWA 2FHDA 3ULQB 3A32A 3RMQA 4TVAA 4EM0B 1H9GA 1OCTC 1UG0A 4G7ZF 2FPDA 2DJNA 5GAGJ 2CYZB 3I9QA 1BOBA 1I4K1 1YIJQ 1SANA 5GAN6 5EEHA 3IV5A 1FMKA 1JB0E 3DF8A 3KPHA 4FL6A 1IN6A 4TQDA 5CKEA 4AM3A 2E2JJ 1OYYA 2XF6A 3T8RA 2K85A 1KQSP 2XDPA 3ME9A 1CF7A 3HSFA 5B3SH 3HC7A 2C0TA 3M9QA 3ZL7C 2B7EA 1OYXA 3K7AJ 1KG1A 1BBYA 2LKSA 2BXZA 1B72A 1GHCA 4N9IA 1FOKA 3META 3LGFA 3I55T 3QODA 5J4YA 3VYHB 2RC4A 4BEHA 3BR3A 4M75A 4PHCA 2AHJB 2R7FA 1B8AA 2WY7Q 3PUFA 5L3DA 2F4MB 1T08B 5C6SA 2MGQA 3C2BA 2QTVA 2X4JA 2BBYA 1IB8A 3DTEA 3D7SB 4VUBA 2DBKA 2XGTA 3GFIA 3BOQA 2P0PA 1KJWA 3QWYA 2M30A 4HF0A 4JRKA 5HLHA 3CCVA 1P9QC 5DD8A 3JW4A 2SRCA 1WJ5A 5AONA 2DLLA 4P74C 2VV5A 2LQWA 3PIOA 1Q81R 2MD5A 2K4BA 5LD2C 1YCYA 1BCOA 1NPRA 2RHSA 2CP0A 1OCPA 4CCNA 4IIMA 4H2YA 3UA6A 4A4HA 3HHGA 2PMZN 1BOAA 2JTVA 3HTUA 4KR2A 2UZKA 1PHTA 2EW3A 2L3PA 4BJ6C 1VQ4T 2FYKA 2RI2A 3KZZA 2ARTA 1V5GA 4DZJA 1CQTA 1NTCA 1P92A 1LEBA 3E6MA 2LC4A 4M6VA 5C4JJ 4ORZA 1PKTA 2VBWA 1D1CA 2AQEA 3UWNA 2X3XD 3CD6T 3SWNA 3BTIA 3BY7A 3IKMB 5IT9E 2NUPB 2H6CA 1GXQA 2CUFA 2GOMA 3VRZA 1U5TA 2DQ3A 3ZBDA 2DM1A 3SEMA 1BR2A 3EGDA 1QGPA 1AVZC 2ZPBB 1OCZH 4GRIA 3KZYA 2FNAA 1YJWI 1RKTA 1XN7A 3MEXA 3OYLA 1JEGA 2VB6A 1JKQC 2XB5A 3KE2A 3OMCA 5FD5A 3I58A 1RAEB 5M5WJ 2L2PA 5K1XA 3DV8A 1Q1VA 1RIOH 1MGTA 1HF0A 2ZIOA 3G6EQ 1E6HA 3EH2A 1Z77A 5J1RA 1P2FA 3H8ZA 2W85A 3JV3A 3GFJA 4ZZLA 1QVTA 3MZYA 3DXJF 2JJ9A 1NG6A 5HLIA 3CPWP 3J7AF 4AYBA 1ZRFA 4FCYA 2G4CA 4ATOA 1UJYA 4LUDA 2XV4S 2R5YA 2F5KA 4IIOA 4YRKA 2XAQA 4ZIBA 4TVWA 2CW0F 3JB9J 3F8CA 1GV2A 4FX4A 2AIRB 3L2CA 4EMGA 3JCMW 5E79C 1S6LA 1MBJA 2EGAA 2X6XA 3RBBB 1DQUA 1UGSB 2WTEA 4PUSA 3K70D 3MKWB 1PUFB 2BHZA 2VWFA 1SFUA 3EG9B 3F3XA 2EQJA 4RMOA 3E5QA 2IVWA 2L5QA 3IHUA 4Q48A 3ZN1A 2ZJRF 2ID3A 3RKXA 3I55I 4JJCA 1FTZA 5FROA 2V1QA 1B70A 1H641 3A98A 2Q1ZB 2DILA 1AA7A 2F2VA 3R6NA 3NTIA 3AHUA 3ER0A 1QWEA 2QZ8A 1NYRA 4J01A 1H0MA 1O7FA 4RMNA 2A3LA 4BE0A 3G1OA 2DO7A 4FSSA 5CQXA 3CCYA 3CMET 1H89C 1QVUA 2LQNA 3I5SA 4M77F 5LJ3f 1NZ9A 1LEAA 4XTXA 2VJ5A 1HSQA 1R23A 3OWTA 1TQMA 1I07A 5GANd 2WAQN 2G0EA 2EL9A 4DBQA 4HNTA 2M1HA 4PLLA 3C2GA 4WF2A 1M1KC 1VQ4I 2R7WA 1PSEA 1FY7A 4IUPA 2R7XA 1FC3A 2CH4W 4U0WA 4C92F 5LEKA 5JFRA 1D3BA 2PJRB 1S72A 2BY3A 1M2VB 4HNUA 2GQIA 3OSFA 1KQ1A 2D6FA 2ZNIA 3OYCA 1YFTA 3CD6I 3H9GA 2YLBA 2JTMA 2DVEA 1I81A 2XAGA 4LNSA 5F6FA 1BR4A 1E6GA 4YEJA 1YJNT 2WAEA 2EA4A 3SEQA 1N8RC 1JQQA 4EJUA 3MF2A 4B8XA 3OBYA 1X2GA 4CGZA 3CCMT 2LX7A 2OBPA 1D0YA 4M75G 2J06A 2DTHA 4ETSA 5GMKi 3OS2A 2MIOA 3AL0B 4ZGEB 3JCMQ 3FK7A 3S14J 1M90R 2ZTGA 2E41A 4JRPA 4HA8A 2KIUA 4AT1B 2X6OA 2Y0MA 1E1TA 4DW6A 2EVRA 5F08A 2COBA 4NQWA 4BI3A 4A5NA 2E5KA 3ZMDA 3C2HA 2QG9B 4RTWA 1R36A 4P9FA 1F1BB 4LDVA 1VQ8Q 2Q5HA 1UJ0A 1HQCA 4F3QA 4M9XA 4RB0A 3JRAA 1UG2A 2PVDB 1Z9QA 2VODA 1WGSA 2ZXIA 1RIQA 3CF5F 5KCMA 5HS7A 3JCUC 3CMMA 1VQZA 1KK7A 3K69A 1LKXA 1ARKA 1TXQA 2LCSA 4JQFA 3CCJA 3PCOB 3EG1A 2R5ZA 1OR7A 3RIRA 4HWTA 3V8LA 3HFZA 4CS4A 3ZQQA 2WC2A 2CP2A 2LCCA 2PG4A 2JS2A 5KHDA 2F5TX 2XF7A 4MNUA 1K61A 1D5VA 3L2VA 1RAFB 4J9IA 2TDXA 3NTHA 3M54A 1OISA 1VQ6A 1H4TA 1E17A 2EIJH 2V79A 3JCMe 2BVMA 1YBYA 1F9NA 1YJ9Q 4P75A 3DB3A 2IP2A 3ZQFA 3MJXA 3X28B 2K5FA 1EA3A 2EQIA 1FT9A 3K4NA 4BBRJ 3ASOH 4KUIA 4ZZDA 2VGNA 4P1WA 4A3LJ 5K1YA 2RGVA 5IAYA 1QE0A 1EQRA 4XU2A 3CMEI 2AXLA 3TEDA 5M5YJ 3IUOA 3JRZA 4QQ6A 3UNGC 1K9AA 4JJDA 3F8FA 4BXXJ 4RCCA 1VF9A 1FWZA 3NMZC 4MTEA 3TGNA 2HOAA 4HLXA 4GYIA 4IURA 2M7BA 2YRCA 1SRYA 4RTYA 1W1FA 1B34A 1IXDA 4MTDA 1ZA2B 5KNLA 1JXMA 3OL3A 2UXNA 3QPSA 5FB2A 4LVIA 2V9PA 4AVZA 1ASZA 5F27A 1HD3A 3H0DA 4QVCA 2GM4A 3WG9A 5GMKe 3S2WA 3U1KA 3QWLA 4BQOA 5AT1B 4OB0B 4M7DB 1PYVA 4IPAA 1Z3XA 2P0KA 4IHYA 3R0JA 1WJBA 4C2UA 3ZFJA 2BZ8A 3HXWA 3SYTA 1WI7A 1QZEA 3CJTB 4K11A 1YJNI 2P81A 4M78D 3L09A 1WKMA 4JS4A 1VQNQ 1YIJA 3JCMf 4XRSG 1JKOC 3INZA 1X1CA 3CCMI 5CQGA 2JA5J 4C8QD 3HYIA 2DERA 1K73C 3FDRA 3MQ0A 4IUVA 2EILH 2GOXB 1IXSB 1F36A 1PNJA 2L89A 2DI3A 1QVGS 1WFXA 2M0YA 5K5RA 5C52B 1E3PA 4RGXA 2YS9A 2LQKA 1P4AA 1SEUA 5I22A 1G4DA 4JPBW 1IXCA 4XRMA 3CLOA 9ANTA 3DLLF 1QP3A 3AG4H 3J81Z 2KXDA 3IALA 4LVLA 2HSEB 3PMIA 2BUDA 1BJZA 2HU9A 3EFRA 4NC7A 3VS1A 5AIQA 2FMLA 4ELYC 2L7KA 4LG0B 2HKXA 4IHXA 3OL4A 3M4QA 2ADUA 1I5ZA 1W4SA 2QQRA 2K3XA 2J3LA 2X6WA 4YRTA 2VASA 5KAFC 4PCQA 2KRNA 4D8DA 4HW0A 4TTVA 1NEBA 3A4CA 5GAN4 3WU1B 4Q47A 3R6SA 2R92J 2C0IA 4LITA 3ECHA 4MDWA 4XTVA 1PSFA 1YI2Q 5B5EC 2GA2A 1Z7LA 4DOVA 2GIVA 1YFRA 3CCQT 2DU5A 3REXA 1KHCA 3M59A 3R07A 4BJ5C 4QLCU 3E9HA 2HBWA 5FKLA 3OY9A 1JUPA 2L54A 3MKYB 3Q0UA 2HDDA 3G3ZA 1C1AA 3KLNA 1SD5A 5C0MA 4OIPF 2BZYA 2OPTA 2KMTA 3J7AO 3TSWA 1ZK8A 1K79A 1UJ8A 1U6GA 4A5MA 4AVPA 3HTRA 1S72T 11ASA 2E3HA 1UHFA 1M9SA 1WQ2A 3T9NA 1NJ2A 2DMNA 3JRCA 1VQOQ 1J3TA 3CTAA 1X1DA 4V19K 2X9DA 2DA9A 3HXXA 1IJWC 4YYEA 2V1UA 2K3PA 1ABOA 3J80E 1RNLA 4CCOA 1XDSA 3SJMA 3G6EA 5HDGA 4ZH4F 5D8LB 4CRIA 2LK2A 4FYXB 2XICA 4BE2A 5DM6F 5GAN8 3RPQA 1WJRA 1A36A 5CCAA 3QO7A 1C6VX 3Q3SA 1FEXA 2K57A 2KGTA 2BY1A 4Z89A 4F17A 2ZNZA 4UUVA 5E20A 2KFDA 2BW3A 3EG2A 4IJAA 2YUNA 1WA7A 3HKSA 1AKHB 4A0ZA 3OS1A 3I0TA 2IS4A 5KYXB 3FBNB 2R7SA 3LSMA 1Q95G 2DXIA 3SZGA 2VQGA 3C1DA 4AU7A 2JVGA 1WQWA 4KR3A 2E7XA 1AOJA 2R57A 4M74A 3FZVA 2NUZA 4A54A 3HRMA 4ITVA 4MHGA 3ML6A 2VKVA 2PBIA 1ON1A 4E7JA 1YITQ 4LLLA 5D4RA 2LY1A 5LRSA 2EAYA 1ADYA 2ZPHB 3CCJT 1K9MU 3IKTA 4J6WA 3T8TA 2M4GA 2Q2EA 2LJ1A 2E5ZA 4GGGA 2L7FP 1FXXA 2R0QC 1TG0A 2DEQA 1DP3A 5J39A 1KU3A 1M1KR 1RL2A 4AFUC 5BMZA 1EFWA 1WI3A 3EETA 3GUDA 2JOYA 1VQ6T 2QQAA 1SD7A 3QYHB 3QO3A 2Q8KA 1E22A 4FT2A 3BJ6A 4PJOC 3WODF 1TTHB 3K1MA 5ELNA 1J5WA 1ZSZB 5FWBA 1QRYA 2QENA 3JRBA 4M7AD 5FKOA 1IRXA 2ZMEC 2KHMA 3MAJA 5FLMJ 3OYIA 2X6YA 5E3IA 4MLOA 2QGGA 2G3RA 2RM4A 4EIKA 4M7DF 3CCQI 2K4YA 4J9EA 2KY9A 2B0LA 3KP6A 5K7FA 1YYVA 2XC7A 1GBQA 3F9KA 2MCNA 2Z9OA 2QUFA 4EMKC 1FBSA 5KH6A 4HV6A 3SHWA 2ALYA 2EH3A 2DQ0A 3X26B 1HC7A 1AD5A 1A0NB 2LKPA 4QPQA 1Q7YR 1TWBA 2MH2A 3VODA 2SEMA 1IZ6A 1H4VB 1YNZA 3UFGA 4M3EA 1MW7A 1WHUA 3WU2C 1S72I 2P5IA 1ZN2A 1BW5A 5FGMA 4KH1B 5CK9A 1ATIA 1QZYA 4IOCF 2FA5A 2EZHA 1UEBA 2KXCA 4FYYB 2HFHA 3TOAA 3M56A 2DTOA 3L2WA 2DXCA 2UXXA 3WE3A 2NNNA 4D1QA 2YU3A 3AAFA 1Q86U 4MEYF 4LOCA 1SVMA 3S3OA 1OFCX 1YIJT 4KT0E 5H2FC 3MEWA 1T0FA 5A0LA 3WHCA 1WRJA 1TL8A 2IJLA 1UFMA 4H0EA 2M02A 4JRQA 4C3HJ 2NXNB 4HZFA 1VYVA 4A93J 4N9HA 1ZAOA 2Z99A 4XR6A 5KE3A 5GANh 1VQ8A 4LD5A 2JTFA 2FQ3A 3F72A 2Q7EA 2Z33A 4UNOA 4KUDK 3FIFA 4WJ4A 2IBDA 4P3OA 2H8RA 1MJAA 1W66A 3HXYA 2I10A 3AT1B 1JJ2P 2EB7A 3I3LA 3A31A 5L3EA 1D8KA 3AG3H 2YR2A 1T56A 3HTZA 5M9OA 4MZTA 2D45A 4Y28E 4J19A 1LYLA 4RDUA 4I0BA 2YU9J 1G3TA 1X2KA 3WE2A 1WJCA 2F4IA 4L0YB 2ODRC 3SZPA 4LLGF 3CCJI 2RNAA 1QVFA 4BWAA 1QPMA 2FU4A 4HYEA 2E10A 1MSFC 3J80K 2FEIA 3A8MB 4E47A 4YRVA 1TUGB 1Z0XA 4MO7A 1D0XA 1DPUA 2QBYA 2O01E 1XTAA 3E7LA 1YJ9A 2CFXA 4B09A 2UV1A 3JCMV 2K79A 2ZCEA 1J09A 2DT6A 1RAGB 2FE3A 3MZ8A 4YPFA 4F93B 1VQ6I 1NJIC 4CH6A 1LVKA 3HG9A 2HQEA 3O8VA 4UV9A 1QWFA 1WFWA 2CH4A 1ZELA 2OAZA 2H1KA 2HZDA 3H9QA 3P9CA 1KYZA 4FTHA 3D1NI 1SF9A 1ETKA 5B1AH 2UUZA 4C8QE 4L5EA 2DD4A 3JR9A 4ENMA 4QWQA 2HVSA 3RZOJ 3A01A 3VUBA 2OAUA 1W70A 3GWZA 4C5IA 1QNTA 4NUBA 1I39A 5K5QA 3GFMA 3J81E 5F0CA 1Q81U 1W2BA 3MPUB 3A5YA 1XMAA 2YUSA 4NL2A 2MAMA 2XKOA 2F5DA 4I2OA 2HDWA 5F1JA 4TVAB 5HK0A 2WACA 1K78A 4M9ZA 4ZTJA 2F5CA 3ABMH 4JK1X 4XEMA 4ZDLA 5LJ5g 1AEYA 2WV0A 2O9SA 2IS6A 3HXLA 2XAFA 2ELKA 1ZQ1A 4C0DB 4LN2A 1IRZA 3U1DA 3G6ET 2LVMA 3F8NA 2R7OA 1CF7B 5E8GA 1I1GA 1JUSA 2YX7A 5GAOr 3QAHA 5IH2A 4EGZA 4P9UA 1VQNA 4J83A 1B72B 2WAFA 4C3JJ 1KMMA 2QDLA 3LWFA 4LE9A 4E6RA 4I0AA 4BEHB 2HBPA 2KRMA 5CJ9A 4M75B 3P7NA 1ZREA 2QDYB 3SHFA 3TOBA 1QKWA 4C2TA 4O6JA 1W0UA 1C0MA 1YIJI 1SRLA 5DCMA 4X1EA 4TV7A 2B86A 3LSKA 1USYA 5FJ8J 3A8LB 3VS0A 4KRTA 2ESHA 1N25A 3GZNB 1T95A 1M8MA 3QWXX 2H8WA 1AWCA 1VQKQ 4II3A 5J8CA 5KVRA 4UUTA 1ZUKA 1HBXG 1U2WA 2E5QA 1O7LA 2QA4T 2IS2A 2BTTA 5ILUA 4M77D 1O3RA 3PNYA 2QQBA 2K5LA 3UPUA 2DDZA 3HRUA 1TSFA 3K6GA 1X01A 3U2RA 3ZMTA 1ETWA 2KZVA 3HOYJ 5KK1A 5E3OA 5BPIA 1A04A 4XKVA 2EZKA 2H8HA 1KD1U 5CLSA 3I35A 3K1PA 1E3OC 1PG5B 4NC8A 4HT4A 3MP8A 4ESRA 1G3YA 4RTUA 5AYFA 3NTKA 3LW5E 5KYYA 1UGQB 3N4MA 1SMYF 2VXFA 2M1BA 2DL5A 1YI2A 2RJEA 3K4CA 2ZFWA 3BZKA 3PGGA 1WWXA 1JGGA 2DNUA 3BJOA 2C6YA 3SWNB 2RKHA 1QHHD 3EGUA 3BJUA 3S16J 3CCRQ 2JWTA 1U5TB 3FC3A 3EGDB 1LPQA 3I55Q 2YXYA 3HB9A 2HEOA 3JCMJ 2KIQA 4YRJA 1DP7P 4TVRA 2RJCA 3ABLH 3I4MJ 2LNBA 1LJ9A 2WA0A 1LDJA 3PM1A 2D5VA 3W3CA 4YP0A 1X58A 2UWMA 2DFEA 3PQJA 2E70A 2LLKA 4XBFA 4QTRA 1HK9A 5JLWA 4FE4A 2PTKA 4JJNK 5GAN2 3I56Q 3P9KA 2TCTA 3JTHA 4MFDA 4PJ0C 2XU8A 2DPUA 4ZTZB 4OU0A 4XMYA 1VQOA 2M34A 2E1CA 4DYQA 4BI4A 2R5YB 1MBGA 4E7SA 3I9V2 3PSFA 2E2IJ 1QCOA 4H02A 2IS1A 2ABLA 3PIPA 5EGOA 3F22A 1HC8A 3TREA 4IKFA 2DQLA 3AFHA 4C30A 1L3LA 1JGSA 1G5IA 4GYGA 2NYSA 1VQ4Q 2DETA 3CDLA 2HKQB 4M73A 2CGHA 3G6EI 3H9JA 2GA1A 4N4GA 2KDZA 3FB9A 1SFXA 3C95A 3NHNA 1LQ1A 2FZGB 1IN7A 1XB4A 1X1AA 3EUAA 3DLLA 4ON0A 3I53A 4UB6C 3K4BA 2KL4A 3L00A 4J15A 2V1RA 4Z02A 4M7AE 1VQ8T 4MZPA 2E2HJ 1E2XA 2K3BA 4CSWA 1B70B 2L9SA 2DA1A 1PP8F 2PLYA 5GAOl 3M1CA 2VE9A 2JA8J 2KYMA 5CKHA 3E6CC 2WSFE 2A7YA 3J81K 2EKHA 1YITA 4B48A 2KISA 4HX7A 2CQ7A 1JO8A 3F0CA 1RZ4A 1GGMA 3QHSA 5FRNA 4P74A 1VI0A 4M9SA 1QQIA 3WTXC 1YFSA 2EIFA 2M8EA 1XNIA 3FK6A 1ERDA 2Y0SA 3RERA 4ANJA 4KH0B 2E71A 1IZ1A 5CAIA 4OB3B 2QA4I 2DX1A 2DXUA 3CMYA 2MOXA 5FKKA 2VLAA 1U3OA 2DA5A 3PUBA 2PJPA 2D9TA 2CO5A 1ETOA 2G7UA 1B7TA 3Q9SA 1RUWA 2DMUA 2DODA 3I71A 1PWTA 1T38A 4IX7A 1XQHA 3CDHA 3DTIA 4XTWA 1WLEA 1BM9A 5GANe 1AWJA 4DBFA 5M5XJ 1QLYA 1D3BB 3KBGA 4A3EJ 3TW6A 3M0PA 1WGXA 1S8NA 3BROA 1U8RA 2D0QB 2P0WA 4KFCA 3GNFB 4E7IA 2M7AA 4D7NA 2CV2A 3E0JB 2RI5A 1HDPA 3S17J 2YUQA 2AK5A 2JM8A 1H88C 3DKYA 1Y0NA 1MBFA 5FWCA 1EV7A 5HDNA 3M8FA 2DRMA 2KDOA 3A7AA 3HKZA 4RDXA 1NYGA 5GAMd 3ERMA 2IGKA 3GTKJ 4M75F 2LRDA 2X48A 2XAUA 5E8IA 4NQWB 2FBKA 3CMEQ 2OZUA 2KIFA 1Y56A 4PJOD 2OU2A 3G1MA 2VXEA 5D4SA 2W25A 3NWTA 1TP4A 2ECBA 2X51A 1WCMJ 4BGDA 2HQ5A 5FU7C 5ICFA 3MO8A 1WX6A 2CGPA 4KULA 1S7OA 3MKDA 3LSIA 4HCKA 2X1DA 3MKZA 1QVFS 1VQNT 3GNGA 4HT8A 3PL8A 3PIOF 2DFUA 1WJEA 3ZMUA 1VTNC 3BQZA 2DA3A 3PT9A 1N77A 1JRIA 3JRDA 1RADB 1QKXA 2XTIA 5DDGA 1X2HA 2R5ZB 3GLLA 3QYBA 1BKBA 1U1SA 1WHJA 1T0HA 3SXYA 3IRQA 3HFZB 1V5FA 3KP7A 2LDUA 2IG0A 2NOGA 1VNDA 3F6OA 2GQVA 4KYWA 3CP8A 3VYRB 2BYVE 3FM3A 3CO7C 1TH7A 1VQ8I 1YO5C 5LRRA 2C8MA 4C8QG 2M16A 1BIBA 4UB8C 2HQXA 2ZXWH 3EAEA 1NJIR 3A1PA 1P6RA 2HXIA 3LH0A 2AMCA 1JBMA 1W2BS 3A8HB 4F55A 2IA1A 1IW7F 1NHAA 2I8DA 1MIJA 4Y33A 3B6AA 2KJBA 2RHXA 3S1QJ 4LB5A 1YW8A 5CYVA 1MD0A 1Q82U 3O8HA 2DMQA 4DPGA 2IGOA 5EG0A 2E5NA 2O03A 5EJCA 1R58A 4LNPA 5LJ5d 4GXOA 1MDMA 3LGLA 2F5VA 2NVYJ 4E4HA 5D5UB 2ZC2A 5HCKA 5KYUA 1YI2T 1T33A 3GVAA 2KDSA 3RPUD 4YFNF 1W36D 4A4KA 2E1HA 1B34B 1SSFA 2BXYA 2A61A 2KRHA 2CT3A 1VQLQ 5TRDA 5ED4A 3BWGA 3RUXA 4YIIA 1NG2A 3WGIA 1V55H 1U1TA 1U5SA 2DEUA 1OMIA 3H1CA 2K7AA 3OYHA 5FLXZ 1UHCA 2R58A 3RJPA 4FT8A 1TNTA 1M4ZA 3A7UA 1BYMA 3W2WA 3F23A 4WJ3M 3LQQA 4MQVA 4M72A 2FO0A 4WCIA 2NYXA 5LEJA 4YCUA 1ODDA 1NH3A 3IWFA 2ZFUA 4IXAA 2O61A 3IG2A 2V6CA 2QK0A 2COMA 3KFVA 1XGOA 2BVLA 3GX4X 2HI3A 1RAHB 4F52A 3TP0A 4C2MJ 2HXOA 4UP9A 4KT5C 4M77E 2C06A 3KYCB 4JRIA 1J2XA 1R9TJ 3S3NA 2Z0WA 2F5FA 4IUUA 4GFBA 1LB2A 1BCMA 2VYTA 2VKDA 2AT1B 1I8FA 2C7IA 3W6KB 4AIDA 2LC2A 3GF2A 3LWIA 3ZQHA 4M3BA 1JKPC 3DTKA 4A4GA 4K88A 4PJJA 1FPQA 3LYIA 9ATCB 1VQNI 3LSTA 1NJ1A 1NYFA 2JA6J 1LFPA 3KP2A 2ACJA 2V8KA 3CC4Q 5GMKj 2M87A 1MJBA 4BY6B 3K70C 3RL6A 2V8IA 1WJFA 3E1SA 4J5YA 5TJJA 3TBIA 2CP6A 3M4OJ 4KN7X 2MC3A 3WG7H 2TRTA 1XCVA 5GP9A 2PU9B 2CG4A 1VQKA 1M30A 3FXJA 1DJ7B 3FJ5A 5HS9A 1K0XA 1HYOA 1YITT 3VQVA 1VQ5Q 4CYDA 5EC7A 5FU7B 1B9MA 1KYWA 2BY2A 1M27C 2VL8A 2IXSA 1T98A 3QSUA 2CZ1B 2PMEA 2FPFA 1VYTA 3CPFA 3O8GA 1K6OA 5I21A 4H2WA 5HODA 2R5MA 4BHCA 3BDDA 2W00A 3RQ4A 2EFQA 2OD5A 3O5ZA 4B9XA 3CBOA 4QVDA 1F43A 5A2QZ 3CCRA 2CYYA 4ZJZA 1Y8QB 2ZB9A 2A05A 1OCCH 1PYSA 4RUGA 1YI2I 3GZ6A 4Y7NJ 1W5TA 4BQAA 1WHMA 1ZX6A 2O3FA 1ZGWA 4N0AA 1ITYA 4QT7A 4PFOA 1SAXA 3OV8A 3SZTA 2BOLA 5BOXA 3RR6A 3I56A 1FYKA 2BY0A 1QVGP 2JPBA 2RK2A 2ZZFA 2M9UA 2NVTJ 3HUGA 3EUKL 2VUBA 3JCMg 1J9IA 3WHBA 1OKRA 2ROTA 3SD4A 4GO1A 1FYFA 2HVRA 3A0HC 5IHKA 2JSCA 2BW3B 5JHUA 2QSFX 3M07A 1RUOA 3CCQQ 1KU2A 4DEYA 1FIAA 4UUSA 1QU3A 2PN6A 2F4OB 2FRHA 4IHTA 2IT0A 1GDTA 2LJ0A 3ERED 3HSBA 3J7YJ 3WGHA 2FNPA 1IO2A 2VC8A 2NLUA 1Q7YU 2LG4A 2DPDA 1X2NA 2CMPA 1JHFA 4MFEA 3ZQCA 2QCOA 3H35A 1LE8A 3OIOA 5LHHA 4M6XA 1TWAJ 2DK5A 4Z6YA 1C0AA 4CZZA 1R71A 4BNCA 2Q2EB 1W1WE 1W0TA 5FKNA 5F0HA 4HX8A 1RR7A 4G85A 2LOOA 2NAZA 2R5AA 2F6CA 2L0KA 3HPGA 4G94A 4RAZA 5DLOA 1N27A 1RR8C 3FJPA 1XMXA 2AQFA 5F64A 4B3XA 1N9SA 1Y0MA 2KQRA 4ZN1A 1SKUB 3JSOA 2Z2SB 2LDMA 2RVCA 1WHKA 5A0GA 2L2OA 5KAIC 4UHTA 1YITI 1NK3P 1RLQC 2FEZA 3LL7A 2GXAA 5DY9A 1U06A 3OW2S 1VFCA 1HTTA 1JE8A 1BK2A 5CPRB 5M3FJ 1VQ9Q 3CBMA 2XKPA 4F14A 2H09A 1YGBA 2X0LA 2YUPA 3M0UA 3BPVA 4XTYA 4PJOE 2Y75A 2CJAA 3BTJA 3M1EA 4WXHA 2MC4A 5DD4A 2HDCA 1V54H 4U7BA 3E97A 2R7RA 1TTYA 2A5WA 5IP9J 3V7RA 2ALYB 2WY8Q 4EVIA 1FX7A 5ILSA 4A6DA 1IRFA 2DF6A 2IGNA 3W2VA 1UB4A 1LNWA 2V7FA 2OCEA 4BDZA 1N78A 1T0JA 2R7UA 3QRFF 3KFUA 4BHPA 2DIGA 3C7JA 4B43A 2KRFA 2MABA 1IGQA 2JMCA 1Y8RB 3L2ZA 2IEKA 4BUGA 1JUMA 4Y17A 2KI7A 1QO0D 3FXLA 1T8IA 4RA2A 4ENJA 1XGSA 3RF1A 1CSKA 3WXMB 3E9FA 2CS3A 4F7ZA 3H5RA 4H2VA 4GDFA 2CIMA 4Y15A 2DTRA 2XRLA 3CMEA 4U88A 4RMFA 4NC6A 4X0GA 2PMUA 2R7VA 2QM3A 2H3EB 2NVQJ 2O2OA 3BR1A 2K3FA 1V1CA 4M78C 2P7CB 5E1ZB 2AZSA 2ZT5A 3EPZA 2ZKZA 5LJ3d 2E36A 4C8QC 1ZSGA 3KETA 3QZ9B 2KAFA 3CO6C 2EPFA 1B07A 5FLXE 3REBB 2K2VA 2XF5A 4K2EA 1GFCA 3W2AA 1K0SA 3TP3A 2XB0X 1TBXA 1AU7A 1VZ0A 1IL2A 2DYRH 3RKWA 5EG2A 1WJDA 3JCMc 3A0BC 2ISYA 4E6KG 3BDUA 1Y1WJ 1QBJA 4B44A 1E0EA 3WVEB 3P8VA 4JLIA 4OMPA 4A63B 1LPLA 1FTTA 3KYDB 1VQKT 3EGXA 3COAC 3RZDJ 2QBYB 2I4MA 5GAMh 1VQMT 4E7ZA 3GTMJ 3CESA 2EV5A 4C92B 2BE7D 2RPNA 5ICGA 2G7HA 2HS5A 3VEPA 5FRMA 4YRCA 1D0ZA 2GWRA 1WU7A 5GAN7 3GF5A 1R0BG 2P6SA 4O5VA 3TEHA 5KYWA 5JVTA 1NK2P 1XGMA 1IV6A 4RAFA 4PJOA 1NE8A 1YS7A 1WZ2A 4KICA 1IHVA 4TVYA 2COYA 3C4SA 3IC7A 2STTA 2ZMEA 4BYYA 3TQNA 3A01B 3OMYA 2LF8A 1MH3A 2R7DA 2JW4A 4HCZA 1AZEA 3VBBA 3IP4B 4V2SA 3IH2A 1P4XA 1NJ5A 1ORKA 1Y07A 3CCRT 1MUZA 1VQLA 1VQ7T 3Q0VA 4A0YA 3DBLB 1K78B 3G1ZA 4EMKA 1KFZA 1ZG3A 4L0ZB 3CLQA 3OSGA 1EOVA 3ROUA 4AG1C 1T3LA 3OYMA 4P72C 3J7ZI 3FF5A 2XGCA 2W57A 4HDVA 2BZTA 4U7DA 3IH3A 3QU3A 4CA0A 2EQKA 4XLNF 2X9HA 2EZIA 4G6DA 4HBLA 3I56T 4WXCA 2P0QA 5CKBA 4CH7A 3EH1A 5GAHJ 4FETA 1O57A 3I4NJ 2VGMA 1WSUA 3V42A 1XSDA 2WB1N 1WXTA 1X75C 3JB9D 2ZO4A 5E18F 2HPMA 1YCSB 2VBZA 3P8YA 5L3GA 3BG5A 1K1ZA 4A4FA 2PX9A 1MSEC 3VQXA 1X43A 2E1MC 4HSTA 2ZZEA 4HPQA 2XPWA 4PSWA 3FKJA 3BC8A 1KOGA 4JYKA 2LZ6B 3MCAB 2ME0A 5DCMB 5LJ5h 4HCBA 2O9VA 2DT7B 2QI2A 2M0MA 4XU3A 1FBQA 1R1VA 3GBGA 3RPUA 2DU9A 4Q5SF 2DK3A 3GMEA 1B76A 2CQNA 4UXNA 2F48A 3IRRA 4XKBA 2OAWA 1Y57A 2M45A 3CC4A 5H6QA 1K9MC 2A07F 3QQAA 1W5CC 2X1EA 2O4XA 4RQEA 5LGNA 3W6VA 2E4HA 3LFKA 1ZGAA 1USSA 3LWHA 2WWYA 4D0PA 1VQ5A 2DK8A 5C44J 3KEQA 2E12A 4DNCA 2LNVA 2LTPA 3DU5A 5KYYB 2DIQA 4A4EA 2E34A 1YFHA 3FX3A 5CVJA 2DO3A 1YW9A 4RGUA 1NM7A 1UGRB 1VQKI 1JJ6C 3SFMA 4I76A 4S05A 5EZHA 2CFOA 1H9TA 3SDBA 4QVZA 1EH8A 2JK3A 1TWGJ 1RC9A 3L2RA 1VQMI 4X6AJ 2VXZA 2P6TA 4JZ4A 3VS2A 4MDXA 4CUGA 3OIQA 1SD4A 2ZAEA 2NVUB 2JTEA 3JCMd 5KE2A 4XTZA 2E5AA 3HFVA 2ZJ2A 2Y4YA 4IQJA 3UF4A 1YQAA 2VI6A 3FXUA 1Z21A 3D0SA 1K83J 2FRWA 3TSZA 4OB1B 5LGTA 1V4RA 5D7UA 1X54A 4Q15A 3MEYA 1MGQA 2E65A 2M3AA 4M7AC 1TUCA 1BC8C 2JNGA 3QTCA 4KUMA 2RJFA 2JS0A 1BIAA 3CCEQ 2MG4A 5JVGF 3BTLA 4LVMA 3LSRA 2BZXA 5L8RE 1EKEA 2FL7A 3IH4A 2PEXA 4BQNA 1R0CB 2QA4Q 2OZ6A 1S7AA 1SAUA 3CCRI 3TDZC 4IOAF 2L7ZA 3VOEA 2HL5C 5CKTA 1XOVA 1VQ7I 2DBMA 2L8DA 4XRSA 1IREB 4J9GA 1UB9A 3A2KA 1Y7XA 1OZ2A 5B66C 4DYCA 2DCEA 5KYNA 1R4NB 3RSNA 4E2FB 3DSQA 5EGOB 4YRSA 2HOSA 1JT0A 3OYBA 2XPVA 4YRQA 2COZA 5HLTA 4HX4A 5M3MJ 1ETQA 1BI0A 2ZPIB 2QGUA 1A6IA 3DP7A 1MMGA 4HEA2 3I56I 3FDYA 1Q86C 3G7ZA 3A74A 1D5YA 2WBMA 4W1UA 3TUPA 3PE0A 1XSVA 1TNSA 1G2BA 3LH5A 3H41A 4XAXB 3CCQA 2XG8D 5FFXA 1OQYA 4XIDA 1X56A 3NELA 4D5CA 5HDKA 5D8KB 3HOSA 4RGRA 3MMYB 2LY9A 4ZNXA 2PNIA 4ABZA 4QSHA 3PFYA 3BG6A 2EYQA 3LX7A 2K3YA 4CYCA 3SDZA 4RB3C 1BN5A 4OB2B 3CCUT 1AT1B 4FYWB 4OOIA 2QKLB 4F92B 4HVWA 2CW7A 3ZQLA 4PJOG 4Y3OA 1FMVA 3RMSA 3DPLC 2AHQA 3HJEA 5HVQC 2OTLT 4CH3A 2KRCA 3CC7Q 1OX8A 5FU6C 3HPHA 4J9FA 2VXDA 4RG8A 4HOBA 3OR1C 2EJRA 4XLAA 2CRGA 3LAPA 1VYUA 2K9GA 2QVOA 4TWAA 3NENA 3DKXA 1KSWA 1UE9A 3LMMA 1RABB 3HGGA 5ERIA 1TT0A 4XLFA 4I02A 3HRIA 2FBHA 2O8XA 3VRYA