2EJFA

Crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 65
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ejfA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ejfA01
3HRKA 4YRSA 2DJZA 3UGTA 4J6YA 1GGMA 3JCMW 1EOVA 3BFMA 5C53B 1B70A 4H2WA 4K87A 5LJ3g 5GAOr 4EMKB 2RA2A 2ZZFA 5C51B 5GAOm 1E24A 1EIYB 3NETA 2Q5HA 4C92B 2J3LA 3A5YA 3RKXA 4M78C 5CAIA 1EVLA 1YFTA 5HGQA 1PYSB 2E65A 2I4LA 4YRLA 2DU5A 2YLBA 3PCOB 3V7SA 2YLCA 2ALYB 3QTCA 4OLFA 4C8QF 1EIYA 2ZTGA 4G84A 4YRIA 4C92A 4P71C 4ZTUB 4HWRA 1Y96B 1SESA 2ODRC 3INZA 1PYSA 4YRJA 3VQYA 5GMKj 4A53A 4M78D 2VXEA 3PCOA 2ALYA 1B7YA 2ZZGA 2ZT6A 3HFZB 1HK9A 2DU7A 2ZR3A 3QUIA 1X2GA 3G1ZA 2EL9A 3M4PA 2K57A 4RCBA 4YRNA 1SETA 1Y96A 4H2YA 4M78B 4P3NA 4JLIA 4G85A 3SWNC 3MEYA 12ASA 1H4VB 2I2LA 3JCMX 2QHVA 2E5AA 2E64A 4YYEA 4Y91A 2EJGA 2DXUA 2DDZA 3SB2A 2E3CA 5GAN4 3L4GB 4CH4A 3RGLA 2PMEA 4XQ3A 1X54A 1X01A 4P74A 1HC7A 3QO7A 3TEHA 3QO5A 3QO3A 1IL2A 5GAN2 4YRGA 1JRIA 3JCMf 5ELOA 3QNEA 5GAN6 1X55A 2EJFA 2DTIA 3V7CA 3M4GA 2DEQA 4M7AB 1B34B 3JCMg 3JCMP 1NYQA 2I4MA 4PHCA 3I7FA 4XTVA 4YRTA 3JB9D 1E1OA 1NJ8A 1SRYA 1WU7A 4QVCA 4H2TA 2RHQB 3HXXA 4EMGA 5GAN5 3MF2A 3KFUA 4WI1A 4M78F 2XGTA 4M7AA 4OP0A 3REUA 4J5YA 2I4NA 3NENA 4L87A 4H02A 1ASYA 4XTUA 3V8LA 2RHQA 5DY9A 4F7UB 2CJAA 4P73C 11ASA 4PJOD 2HNIA 3HY0A 1D3BB 5GAMj 4NCXA 1KOGA 5GAN7 2RHSB 3A7RA 4K86A 2FYKA 4UPAA 5GAMf 2Q7GA 4HWSA 4TVAA 3L1AA 3VQXA 5GAMg 4HWTA 2PMFA 3UFGA 3RESA 4M7DD 4PJOB 1YB3A 4XTZA 2ARTA 4F7UA 4HT8A 3NELA 3VBBA 4C92G 1ATIA 2RHSA 2DZ9A 2ZT8A 3TEGA 1U1TA 4C8QA 4TTVA 4M77C 5LJ3e 4Q6GA 4M77G 3HFVA 4M7DB 5ELNA 4DPGA 1NNHA 3JB9F 1TH7A 1EVKA 1N9WA 3QSUA 5GAOp 3E9IA 4C92E 1H641 1I81A 2EAYA 4J15A 1G51A 4HT9A 2CIMA 5LJ3d 4F7UF 3A32A 4KR2A 3HTZA 4KQEA 3M4QA 4M77E 5GMKh 1E1TA 3PZCA 4EMKA 4XU0A 2AKWB 4NOYA 4RQFA 3BW1A 4CS3A 3TUPA 1M5Q1 1Z7MA 2DQ0A 2ZIOA 4DQ2A 4PJOF 5F5WA 4TQFA 2QHSA 4YDQA 4ZTZB 2C7IA 5LJ5h 4P75A 3MF1A 2EWNA 1J5WA 4XEMA 3RKYA 5GAN3 4P72C 5GMKe 3HXVA 4WF2A 1NJ2A 3HXZA 4M7DF 1I8FA 3P8TA 3QO8A 4M75C 4M75G 5LJ5j 2ODRD 4RDXA 3JCMh 4XTWA 4H2XB 1E22A 4YREA 5LJ5f 3HXUA 3HFZA 3HY1A 2RM4A 1H4SA 5LJ5g 1USYC 2ZT7A 4M7AG 2ZT5A 4O2DA 4M78A 4YCWA 2ZINA 4M75E 3QHSA 4WJ4A 4N0AC 1B8AA 2ARSA 3RL6A 1LNXA 4H2XA 1HXDA 3JCMc 2QHTA 1YGBA 2E41A 1HTTA 4YRFA 1C0AA 4UP9A 4WJ3M 3JCMe 1EQRA 3L4GA 5GMKl 1YCYA 4HA8A 4YRCA 4M7AE 4P71A 2E10A 3A7AA 4YCVA 4TQDA 4UP7A 3RIRA 1BIAA 2VC8A 2ZGWA 4HWPA 4HWOA 2XTIA 3SWNB 4PNOA 2ZCEA 4YRKA 3JCMV 3E9HA 3WQZA 3FIFA 3JCMd 4YRRA 1B34A 5GANh 5GAMh 1SERA 4YROA 4MMKA 3R07A 4C8QC 4C8QG 1G5IA 3EFSA 4JRKA 1I5LA 1KQ2A 3LC0A 5GAOn 4H2VA 2JN0A 1QF6A 4JRIA 1WYDA 3HFOA 3VU3C 3SWNA 3AHUA 4A54A 5GANj 1H4QA 4LNSA 3JB9H 1M8VA 4ZIBA 4YP0A 3V8JA 5GANf 3LSQA 1H4TA 3ICAA 4C8QE 5GANg 5GAMe 5GAOl 2ZR2A 3FJPA 4EMKC 2EJ9A 1EFWA 4XU2A 4UP8A 3GIBA 1D3BA 3BDUA 4TWAA 4C92C 2DTOA 1KMMA 4BWAA 1X2HA 5GAMd 3JB9J 2Q7HA 3A7UA 2ZXFA 3RACA 2RD1A 3UGQA 4NL2A 4P75C 4P3PA 4PJOA 5GAOq 3HXYA 3JCMb 3HFNA 4H2SA 3A74A 1NJ6A 5LJ3j 4XU3A 3VQVA 4Q15A 3EFRA 4CH5A 5GAN8 4C92D 2P0LA 3IKMB 5LJ3f 4JUVA 3A5ZA 4XTYA 5GMKi 4K88A 1ASZA 2Y90A 4M7DA 3REXA 4YCUA 4M77D 2RB6A 3JCMQ 3OD1A 1JBMA 1JJCB 4P73A 1N9RA 2ARUA 4NL3A 4PG3A 4M78G 3W3SA 4P74C 2DTHA 1KMNA 1Z7NA 4M77B 1BBWA 1YFRA 2AKWA 2Q7EA 4EMHA 1B7YB 2ZNJA 1I4K1 1JJCA 2I4OA 3HXWA 2YHTA 1KQ1A 3DSQA 2DQ3A 4MMLA 2C8MA 4HVCA 4M78E 4QVDA 1W66A 3HRIA 1WQWA 1LYLA 4J6XA 4M77A 4XU1A 4CS2A 1WQ7A 3P8YA 1QE0A 3UH0A 3V7RA 5LJ5e 5I21A 3BY7A 4M7AC 4CH6A 1ADYA 4XEOA 3PGGA 4M75D 2ZZEA 5KNNA 3CMQA 3TEHB 1MGQA 4C92F 2AMCB 5LJ5d 4X9CA 3P8VA 2CJ9A 2J3MA 2DZCA 4XTXA 4H2UA 4TVWA 4M77F 3JB9G 2G4CA 4M7AD 4E51A 4M75B 2QTXA 3HSBA 2DXTA 1WNLA 2VXFA 4F7UG 4RMFA 2AMCA 1WLEA 3V8KA 5K1XA 4P72A 1LJOA 5K1PA 1VQZA 3LSSA 3VQWA 4J6WA 4M75A 3NEMA 2IY5B 1NJ1A 5C52B 3IG2A 4P3OA 4PJOC 2CGHA 4PJOG 1FYFA 1WPYA 4X9DA 4RQEA 1N9SA 1ADJA 4YRQA 4F7UE 1L0WA 2ZNIA 1NYRA 2QHUA 4BW9A 3FB9A 1BIBA 1USYA 5GANe 2P5IA 3RUXA 4TVAB 2ZIMA 2DKGA 2FB7A 3ERRA 4C8QD 4M7DC 4YRPA 4M7DG 2IY5A 4CH3A 5GMKm 5E3IA 4N0AA 3IALA 4TVYA 3RF1A 2E1HA 4PJOE 1BBUA 4CS4A 4YRMA 3IKLA 1LOJA 3JB9I 1X56A 4M75F 3A31A 1RIQA 5LJ3h 5GANd 2Q5IA 1NJ5A 4EO4A 4RCCA 4C8QB 1G5HA 1B70B 4YPFA 1U1SA 4KR3A 3RERA 3RKWA 4M7DE 4X5OA 1B76A 3JCMJ 3BJUA 4M7AF 4EX5A 4AH6A 4V2SA 3L2ZA 2CJBA 1YFSA 2DVEA
chains in the Genus database with same CATH superfamily
3UGTA 4BE2A 1FYNA 3BFMA 4MDXA 4FW1A 2ZPIB 3G6EQ 4MDWA 1ZQ1A 5GAOr 2A36A 3M0RA 5C51B 1D1AA 3NETA 5D6XA 1KJWA 1BI2A 1EVLA 1YFTA 1AD5A 2E65A 1K0XA 2ZPFB 1YWPA 3PCOB 2ALYB 1YITQ 3QTCA 4OLFA 3M0UA 4TVRA 1KQSA 4ZTUB 1YI2T 3SHWA 1M4ZA 4QQGA 2HL3A 3VS2A 4WTOB 4YRJA 3VQYA 3I56Q 1SSFA 1WLPB 4KGZB 2QI2A 1WI7A 3PCOA 2ALYA 1VQOA 3LGFA 2OTJA 3HFZB 2WSFE 1YJNT 1AEYA 1M3CA 3G1ZA 3VJPA 3C94A 3HKSA 1UE9A 5CKHA 3X28B 2DMOA 5CCAA 5GJVB 2EIFA 5CKEA 3MEYA 12ASA 3JCMX 2DDZA 2E3CA 4OMNA 2CH4W 1PD0A 3L4GB 2MWPA 5KYWB 1MNDA 4CH4A 2FPEA 3CCUT 4XQ3A 4NS5A 4ZTJA 2JUFA 3QO7A 3QO3A 1YJNQ 1IL2A 3I9QA 2GQVA 2K3YA 1JRIA 1RLQC 3QNEA 4E7SA 1X55A 4LVMA 5CR2A 2EYWA 4L59A 4M7AB 1A0NB 1C1AA 5KYWA 1ZBXA 4XTVA 1TTHB 5CO7A 3CMAA 1NJ8A 1SRYA 1WU7A 4CC3A 2RHZA 1K8AU 3FDRA 2K7AA 4WI1A 5I11A 3CCUQ 2BZXA 4M7AA 1QMCA 2RHXA 3GNFB 2E4HA 2FRWA 3EGDB 1WXUA 4H02A 1OV3A 3VS3A 3OYHA 2JM9A 4JJCA 3RNJA 3OS0A 4P73C 1KOGA 4RG2A 3CC2T 4JRQA 2RHSB 2HSEB 2MOXA 2Q7GA 4TVAA 3L1AA 1QWFA 2RQVA 2P4TA 3I55Q 3CPWP 1YHQT 3J7AF 2EQKA 2EQIA 4HT8A 1X27A 2R5MA 3VBBA 1D0YA 1ATIA 2RHSA 3TEGA 2ZCFB 2YRDA 1G83A 1TOVA 2IPOB 4Q6GA 2A8EA 3HFVA 3NFCA 5EC7A 3H0HA 1OZ3A 5DM7R 3CD6A 5FW9A 5IT9E 2DILA 2JM8A 3E2UA 4R55A 4ZGEB 4JS5A 2MIOA 2QTVA 1RAGB 5CQXA 1U5SA 3ZEHA 2AZVA 1G51A 3LWHA 3R6NA 3M4QA 4M77E 3L2RA 3PZCA 2L8DA 3OW2A 3OYDA 2GBQA 3FC3A 2GFUA 2H8HA 2O88A 2DD5A 2K3BA 3TUPA 1M5Q1 8ATCB 4ZTFA 2GCXA 4PFZA 3MEAA 2QQ9A 4YDQA 2IIMA 2OX7A 3T9NA 2DNUA 3MF1A 1H3HA 4P72C 3CCVA 3EGUA 5IXFA 2PZ1A 1NJ2A 1Q86C 2J6FA 1I8FA 1ZUUA 3P8TA 2M0YA 1UGPB 1VQ9T 3LYIA 3KBGA 5KYNA 2ODRD 4H2XB 1RI9A 3CCLQ 4KUDK 3VYGA 4FYXB 5HKCA 4KH1B 1AT1B 2JVVA 1H4SA 2ZZDA 1OOTA 2KR3A 1USYC 2F2VA 5FU7C 4M7AG 2ZT5A 2C0TA 2M16A 2DD4A 1BU1A 4M75E 2HL5C 1KC8R 2P0KA 4H2XA 1YGBA 2E41A 2EVRA 1B7TA 1C0AA 2QEXT 4UP9A 4WJ3M 1WJRA 1NM7A 2JZ2A 1YCYA 1AWJA 1YJWT 2OTLQ 1QCFA 2XDPA 4C5HA 4HWOA 3SWNB 3HTRA 4BDZA 2DXCA 1VQKA 1W2BA 4ZNXA 2O9SA 1RAEB 2FRYA 2PQWA 3EFSA 2RJDA 1I5LA 3EH2A 4FU6A 4B9XA 3G71A 1WYDA 3VU3C 3SWNA 1SF9A 1W70A 1VQPA 2DF6A 3PTAA 1PRLC 2XIDA 4FYVB 3KXTA 1VQ5Q 1YJWQ 4E7LA 1IRXA 5KH6A 2JOYA 4OB0B 3ICAA 4C8QE 3LGLA 4EIKA 5GANg 4LD9K 3I5RA 1MMNA 2X4YA 3PFSA 3CCMA 1Q81C 1EFWA 4XU2A 4KT0E 1D3BA 4OMMA 3BDUA 2OI3A 2HEQA 1EZZB 1OX8A 4L6V5 1OPKA 3H0IA 3L2QA 1ZA2B 3GBQA 2Q7HA 1Q82R 3EGXA 4NL2A 4PJOA 1JO8A 5GAOq 1XNIA 3DLLA 1KC8C 4DA4A 4JLGA 5LJ3j 4Q15A 4LVLA 3M0SA 5GAN8 3X26B 4AG1C 1PD1A 4M7DA 2X4JA 4DBFA 2MF2A 2RJEA 5FRNA 1D0ZA 4OGCA 1I0CA 3QYHB 2RI2A 1WHHA 2ARUA 3CPWA 2GTJA 3W3SA 3OB9A 4OMQA 2P84A 2QYZA 3H9NA 2DEUA 2KVQG 3OS1A 1YNZA 2Q7EA 1IB8A 4EMHA 1B7YB 1WXBA 2EYQA 2ZNJA 3QWXX 1HJDA 1FMVA 4DEYA 3CCEA 4QVDA 1W66A 1U8RA 1BBZA 4LVJA 2ROLA 4XU1A 1WQ7A 3V7RA 1QVGP 2HBWA 2D8HA 3UA6A 4M7AC 5CIUA 1CSKA 4CH6A 1JU5C 1WHKA 4LNPA 2E6NA 4LE9A 4FT2A 5DLQE 3OYGA 1M90C 5KNNA 4Z88A 3SFMA 3TEHB 1F1BB 1Q82C 1GCQA 3IQLA 3P8VA 2J3MA 4H2UA 3N5BB 3JB9G 2EBPA 2RMOA 4C5EA 1JQQA 3REAB 1YP5A 2DJQA 4F7UG 3M53A 3V8KA 1VQOQ 2OTJQ 2LCSA 3CQTA 4L5GA 2MCNA 3MQZA 1UHFA 4WCIA 1ZA1B 4J6WA 3A8OB 4ZGJB 2ZAEA 2XD0A 4PJOG 1FYFA 1WPYA 1QVFA 4HCKA 1YIJT 1TUDA 1Y7XA 2GF7A 1NYRA 2QHUA 2LNVA 3RUXA 2ZIMA 4YRPA 2XI9A 2LQ8A 3OYBA 4M7DG 4N0AA 7AT1B 3RF1A 1M1FA 4CS4A 1MV3A 1SRLA 1NJIR 3A31A 1RIQA 2EYYA 4PJJA 2FZKB 1NJ5A 1R0CB 1T0HA 1MV0B 2CZ0B 5KE2A 1OU8A 4KR3A 3CMAQ 1W4SA 1YIJQ 1VQLT 4FSXA 1B76A 4EX5A 4V2SA 3U23A 2EYXA 1Z9ZA 4IUTA 4C0GA 2CJBA 3PT9A 1YFSA 3AT1B 3HRKA 4YRSA 1WDXA 2DJZA 1GGMA 1KHCA 3VS6A 1G3WA 4H2WA 3LH0A 2DL7A 5IHNA 4EMKB 4J8OA 4OB2B 1X2KA 2RA2A 4BDYA 1EIYB 4D8DA 3CD6T 4FYWB 4C92B 3A5YA 2XK0A 3UPUA 1UFFA 1VYVA 3VS0A 4J9DA 4D8KA 1PYSB 1QCNA 3TEEA 2YRVA 2CKKA 1K73U 2PNIA 1O9SA 3MEVA 2VASA 1EIYA 1VQ6T 2XG8D 1YN8A 4C92A 1RLPC 4DBHA 4IURA 4HWRA 2ENMA 2ODRC 1SRMA 2A7YA 3INZA 4ZN1A 1J3TA 1PYSA 4M78D 2RN8A 1ACMB 2LJ1A 3CD6Q 2ZT6A 1GFDA 2DU7A 2A3LA 5EG2A 4LDUA 1NJIC 2J6OA 1SETA 3CCVT 3GOXA 4M78B 1RAAB 2QGGA 3GLXA 3SWNC 2I2LA 2VUBA 1PG5B 2E64A 4BY6B 1K9MC 1AWWA 4YYEA 4CC4B 2EJGA 3SB2A 5CK9A 4C5GA 2DL4A 3VS7A 2LJ3A 2E70A 2FEIA 1VQ7A 2KT8A 2E3IA 2O31A 1M1KU 1HC7A 1VUBA 2W0ZA 2JW4A 2DBKA 3M56A 4PJNA 4X34A 1M1GA 3JCMf 4IIOA 1G3SA 2D1XA 2DTIA 3CCVQ 4DOVA 1B34B 3JCMP 1EX4A 1LPLA 3QDFA 3I7FA 4IKFA 1KHIA 3G1JA 1SHFA 1VQ4T 1QVGA 1HYOA 3CC4T 2ABLA 2RHQB 2L89A 3CBMA 2P0QA 1X69A 1N8RR 4JJBA 1JJ2P 1VQ8T 3MF2A 3OMCA 4M78F 3M55A 3CCJA 2KYBA 1E6GA 2V26A 3QJ6A 3QBYA 1JJ2S 2YT6A 1ZUYA 4L87A 2L3RA 1S1NA 1JXOA 1RAFB 2RHQA 11ASA 3HY0A 4CC7A 1OX9A 1B07A 3G71T 1QCOA 2RO0A 3O8VA 2D8JA 5IAYA 5GAN7 2A08A 3A7RA 4K86A 2FYKA 1NG2A 2KXCA 5GAMf 4HWSA 3GPLA 4UC4A 3GP8A 1M30A 3SD4A 3CC7A 3DB4A 5I2SA 2ZPBB 3X25B 2PMFA 1W6XA 3RESA 3UFGA 1YB3A 4XTZA 4CRIA 2JTEA 1VQKQ 3MP8A 1K9AA 4C92G 2A0FB 2COZA 3H8ZA 1MMAA 3MEUA 1E6HA 1TU0B 3D7SB 3I56T 3M54A 5ELNA 2XMFA 3QKJA 4MZMA 3G71Q 4DPGA 1K73R 1TH7A 1GCPA 1VQPQ 3A8HB 5GAOp 3OYCA 3E9IA 3MO8A 2RK2A 3H6ZA 2HKQB 1K0SA 2LMJA 2CIMA 4KR2A 2BE9B 4KQEA 1TUGB 3CMET 3CXCA 1GCQC 2Z0WA 2CT4A 2AKWB 1W1FA 5FU6B 2KNBB 4NOYA 3CCMQ 4RQFA 1S72A 4B9WA 1YWOA 2GNCA 4CS3A 1N8RC 2ZIOA 3MP1A 1QVPA 3ZBDA 1Y0MA 2NUTB 5F5WA 4TQFA 2K79A 1QP2A 1J5WA 2CSIA 3OBWA 5GAN3 3LH5A 3S3OA 1OZ2A 3E9FA 2B86A 3EHRA 5CQYA 2O01E 1QW1A 4RTVA 4ME7A 1YFNA 1WA7A 2XHCA 2J06A 3CMEQ 2NUTA 2NYSA 4IUVA 4XTWA 3WVEB 1E22A 5LJ5f 2AKKA 3HXUA 3HFZA 3OSVA 4DBRA 3OMGA 2KRNA 4JS4A 3Q1JA 4YCWA 3RDVA 1WHGA 2VVKA 1Q7YR 2DETA 4WJ4A 4N0AC 1B8AA 2ARSA 2X9HA 3RL6A 1HXDA 2KROA 2QHTA 1NLOC 4YRFA 1HTTA 1G3YA 1X2QA 2DM1A 3BE3A 4Z8AA 3L4GA 3FLGA 3CCQT 4RMOA 2EGEA 4HA8A 4M7AE 4YRCA 4P71A 2EGAA 2LT4A 2E10A 3A7AA 3E9GA 4TQDA 4YCVA 4UP7A 3RIRA 2VC8A 3CCEQ 2ZGWA 4HWPA 2SRCA 3JCMV 3I55T 3OYJA 3OSSC 4YRRA 4OB1B 2WSEE 4YROA 2H3JA 2CZ6B 1V76A 2Y4XA 3R07A 3TQ7P 3LC0A 1UGVA 1KQ2A 4RG8A 4PFPA 2RNAA 2JN0A 1QF6A 3M9QA 1Y71A 4AFUC 1XQHA 3AHUA 1XOVA 4A54A 4HT4A 2GFAA 3CCQQ 4LNSA 3JB9H 4YP0A 5AYFA 3LSQA 2CYZB 2PUOB 3WVDB 3I35A 3ASKA 3EGDA 1UECA 3FJPA 1ZX6A 2EJ9A 2F2XA 2KRMA 4EMKC 2C0IA 3JAME 4LXCA 2WACA 2O9VA 3OYMA 2EQMA 2XKOC 4C92C 1YJ9A 2CP7A 3VKIA 2F5TX 3QJYA 4FYYB 3HL8A 2KRSA 2KEAA 2JXBA 2Y4YA 5HY6A 1AZGB 4OMFB 1I1JA 3C0CA 4C0FA 1C6VX 1NYFA 1Q7YC 3HXYA 4J9FA 1KIKA 2QASA 3G4SA 1JEGA 4JZ4A 3HFNA 4HVVA 4XU3A 4BB7A 3VQVA 4CH5A 4FIBA 1N6AA 3E1SA 2V1RA 4XTYA 4AFSC 3M57A 2NWMA 3VYHB 5HK0A 1GXIE 4YCUA 4M77D 4AFQC 3CCLT 2LNHB 2VKNA 1N9RA 1SKUB 4KBMB 1WHMA 1WXTA 4BI3A 4ELYC 1T0JA 2DTHA 4M77B 3KFVA 1FXXA 2CP2A 2HZYA 1UEBA 1YFRA 1MUZA 2RHUA 4BY6C 1BCOA 3H41A 2RQRA 3ZL7C 5L23A 4ESRA 2I4OA 3HXWA 2YHTA 5FWCA 1KQ1A 2D9TA 3VRYA 2OTLT 4M77A 1IGQA 1CKAA 5FROA 1N5ZA 3UH0A 4J9EA 3SDZA 3BY7A 1WFWA 4II1A 4IUQA 2FL7A 1G2BA 4XEOA 2C06A 4M75D 1WHJA 3CMQA 3OYLA 1MGQA 2P4RA 1YBYA 2BE7D 4MZPA 1K8AR 2JS2A 1VQ5T 2YRCA 4M77F 3RBBB 2G4CA 2ED0A 2IVWA 2K5FA 1AHJB 4XK8E 2K4YA 4M75B 2HQHA 1T3SA 2QTXA 1K1ZA 2DXTA 1WNLA 4RMFA 1VQMA 2K5LA 3QPHA 4JDSA 4PLLA 3EG1A 5FLXE 4Z02A 1NYGA 3VQWA 4M75A 2DL8A 2KDSA 3OYYA 1NJ1A 1NBEB 3IG2A 4P3OA 4F7UE 3MKDA 2X3WD 3TSZA 1M8MA 2EYZA 1BIBA 4CI0C 2P5IA 1VQ7Q 3ERRA 2DKGA 4C8QD 3OS5A 4CH3A 2HMAA 4LUEA 4TVYA 4LD6A 2KE9A 4PJOE 4YRMA 1AVZC 4M75F 4ORZA 2VWFA 1NE8A 4QW2A 5LJ3h 2Q5IA 4EO4A 3NTKA 4C8QB 1G5HA 1BI3A 1QP3A 1BYMA 1U1SA 2DPPB 1BI1A 2PVDB 2EPDA 3PIOA 3NMZC 4LDXA 4M7DE 3JCMJ 3CC7T 3CCJQ 2K3XA 1K8AC 1RI0A 2LTOA 2R5AA 3OYKA 4J6YA 1VYUA 1X6BA 3CCSA 3LW5E 1EOVA 5IHIA 1C0MA 3OYNA 1KG1A 4RTZA 4FT4A 1RABB 2EW3A 4IUUA 2ZZFA 1E24A 2RQWA 5KYXB 2J3LA 3THKA 3RKXA 5CAIA 3EG3A 1NPRA 2DL5A 4DBQA 4YRLA 3WXMB 2MAMA 4BI8B 4OVAA 2VV5A 1JB0E 2VGNA 2YLBA 4QQDA 3JV3A 2YUNA 3CC7Q 3PIPA 3I5SA 1YI2A 4C8QF 5D6YA 2DERA 4KRTA 2ZTGA 4G84A 1GBQA 1RAHB 3OYEA 4P71C 4N4IA 1BKBA 1SESA 5CKBA 1VIEA 2COYA 2KT1A 2NUPB 4A53A 5GMKj 1YJNA 2VXEA 2QDYB 2D0NA 5KCOA 4BE0A 2RQUA 2BIVA 1B7YA 4DEXA 3EH1A 3QUIA 1X2GA 1VQOT 2QG9B 2OTJT 2EL9A 2K57A 4RCBA 2OAWA 2X4WA 4P3NA 5HK3A 2NUPA 1Y07A 2QHVA 1O75A 2HKNA 3LX7A 3P8HA 2E5AA 2FZGB 1S72Q 4QT7A 5GAN4 1M2OA 2AKLA 3RGLA 1WJSA 1KD1U 3X24B 3TEHA 3QO5A 3OQ5A 3UF4A 2HQXA 2KYMA 3META 5GAN6 2PVOB 1XTDA 2DVJA 3UA7A 2DEQA 4PLIA 4PHCA 3M0TA 1NPPA 2OJ2A 1E1OA 3LLRA 1M9SA 2X35A 2JMCA 2MYSA 4QVCA 3URGA 3CMAT 3HXXA 1UG1A 2CT3A 3OYFA 1M3AA 4EMGA 2GGRA 3KFUA 3UT1A 3H0FA 2XGTA 2DK3A 3REUA 1HSQA 2I4NA 3NENA 4AFZC 1BI0A 1GRIA 2FHDA 4XTUA 2DYBA 2E12A 2MMPA 3V8LA 3CC2A 2CJAA 5GAMj 4AG2C 4NCXA 2RJFA 4E47A 2RHYA 2ZPEB 2KSSA 3HRTA 1X75C 1YHQA 4BI4A 2X4XA 2FPDA 5KYUB 1ARKA 4HWTA 4A4KA 2EGCA 2ARTA 3NELA 2RF0A 2DO3A 4IIMA 3ME9A 2ZT8A 3PMIA 4TTVA 4M77C 5LJ3e 1KQSP 5IH2A 1P92A 4PJLA 3RR6A 2KBTA 1UB4A 2P0PA 1EVKA 3ER0A 2A37A 3QSUA 1WYXA 1KQSS 5A0GA 2RI3A 4C92E 1H641 1I81A 2EAYA 4RTTA 2DBMA 4O5VA 4HT9A 5LJ3d 2NLUA 3HP9A 2KI7A 2ECZA 1KK7A 1M3BA 2K9GA 1E1TA 4EMKA 4XU0A 2SEMA 8AT1B 4KGXB 3BW1A 1QQJA 2E6ZA 1G5VA 1YJ9Q 3QXEB 5LJ5h 3OY9A 4XEMA 3RKYA 3C4SA 2QXFA 5LL6S 4E7IA 2HDAA 5GMKe 3EAEA 3HXVA 4WF2A 1VQ9A 4M75C 5LJ5j 3PVLA 4C0DB 4RDXA 2HQEA 1KD1R 1UHCA 3HY1A 2RM4A 1ZSGA 4FL6A 4O2DA 5I2MA 4M78A 2M1HA 2QEXA 4BUGA 1LNXA 2QQAA 3JCMc 4PJMA 1ZHIA 3JCMe 2L3SA 1CKBA 1OU9A 4E2FB 2M0OA 5CKDA 4J7IA 2BTTA 2JNGA 3FEOA 1BIAA 2E5KA 3EG0A 2O4XB 2ZCEA 2EFIA 4YRKA 1Z9QA 2F5KA 3FIFA 3JCMd 2RPNA 1B34A 1VQKT 1SERA 3L2VA 3C95A 4C8QC 1G5IA 4JRKA 1FMKA 1B3QA 1PM3A 2E3HA 2JT4A 2LX9A 2YSQA 1K76A 3HFOA 2O4XA 4KULA 3A8MB 1H4QA 3UWNA 4XAXB 1VQPT 6AT1B 5KE3A 5GANf 1SHGA 3P8DA 5GAMe 5GAOl 2ZR2A 2CZ1B 4LDYA 1ABOA 4EPCA 4QVZA 4UP8A 3GIBA 1PCXA 2CP3A 3TU4K 2LQNA 1VQMQ 4TWAA 3KUFA 1VQNA 1OULA 2DTOA 2F69A 3OBYA 3CCMT 5AT1B 3OW2P 1X2HA 5GAMd 3A7UA 2ZXFA 3RACA 4P5NA 1NEBA 1IO6A 2QQSA 3UGQA 3E19A 2QDLA 2X3XD 4P75C 4P3PA 1Q86U 3M0PA 2QGFB 3OW2S 2E5QA 2A28A 2AZSA 3G7ZA 3A74A 1NJ6A 3A1PA 3EFRA 3CCRA 2F1LA 2P0LA 3IKMB 2K2VA 4JUVA 1R77A 3M58A 1R0BG 5ECAA 1ASZA 2KAFA 2Y90A 3REXA 4FW2A 2GQIA 2DYIA 3CCST 2EKOA 2BZYA 1ZLMA 4LUDA 5J3BA 3ZFJA 3OD1A 1JBMA 1RACB 3VV0A 2DA9A 3EFOB 3ULRB 4NL3A 4M78G 2KXDA 4PG3A 1H3ZA 4Z89A 1Z7NA 3QDRB 2LT1A 4N4HA 2AKWA 4RUGA 1KFZA 2RQTA 1I4K1 2HSPA 4E7HA 3L2UA 2RK1A 3C12A 3DSQA 3EFOA 2DQ3A 3FJ5A 1RUWA 4KUIA 1TWBA 4MMLA 4BD3A 2LX7A 1OEBA 3CCSQ 2CH4A 4A4EA 1WQWA 4J6XA 2CS7A 3CCET 4D6WA 1M1KR 3CPFA 3P8YA 4O6JA 1VOMA 1UJYA 5DLOA 5FRMA 5LJ5e 2D6FA 2QA4A 4LDVA 4HXJA 1TXQA 2LRQA 2C0OA 3VUZA 1W2BP 3X20B 1AZEA 2VGMA 2ZZEA 1T3LA 2CSQA 4ZN3A 2AMCB 2L3QA 5LJ5d 3JRZA 4X9CA 2CJ9A 1W2BS 2BZ8A 2WSCE 2DZCA 2M02A 1SEMA 1YI2Q 1K73C 4ELZC 4EDUA 2RJCA 4M7AD 1Q81U 4E51A 3VUBA 4A4HA 1UUEA 4GLMA 4LVKA 2AMCA 5K1XA 2RHIA 2KK4A 1X6OA 5K1PA 1MHNA 3DLMA 1VQZA 3LSSA 4A63B 1KC8U 1SPKA 1QKWA 1WHLA 5C52B 1YIJA 3OYAA 2VB6A 4RQEA 4QQ6A 1QLYA 1D0XA 1ADJA 1L0WA 2ZNIA 3GNGA 2LC4A 2KY9A 4BW9A 1TUCA 1ZUKA 5J26A 4ANJA 1VIFA 4RTYA 3J81E 4TVAB 1GFCA 1MMGA 3QWYA 2DXBA 5E3IA 3IALA 1SG5A 1BBUA 3IKLA 1X56A 3JB9I 1D1BA 1Q86R 5HCKA 4OMLA 2L3PA 1M1KC 1IREB 4F16A 3M5AA 3UATA 1JJ2A 1VQLA 5A0LA 1B70B 5D6WA 2PTKA 3RERA 3RKWA 4F14A 2YWWA 3EHQA 2XDDA 1WX6A 4M7AF 3A98A 1MNEA 4E6RA 3MHXA 2DVEA 1EIFA 2COWA 3JCMW 2R58A 3CPWS 2K2MA 5C53B 1PKTA 1B70A 4BE1A 4K87A 5LJ3g 1LVKA 1E7OA 1IGUA 4J7FA 2DX1A 3CC2Q 5KCHA 5GAOm 4YTLA 3TCJA 2Q5HA 2DRMA 1M90U 1VA7A 4M78C 4Q5WA 2BUDA 4FM4B 5HGQA 1N27A 4OB3B 1Q82U 4BACA 2XICA 4E7ZA 4C0DC 3MEWA 2I4LA 2DU5A 1YHQQ 4DOWA 2EQJA 3V7SA 2YLCA 3EG9B 1VQ6A 2CDTA 2JS0A 3OYIA 4YRIA 4Y92A 2ESWA 2QQBA 1Y96B 2LP5A 1IHVA 2FPFA 4ATOA 3NGPA 1K4US 2CP5A 1GBRA 3EG9A 2ZZGA 4KH0B 1HK9A 5IHKA 2ZR3A 3CEYA 1QWEA 1UGQB 2DIGA 3M4PA 4YRNA 2LDMA 1Y96A 4H2YA 2D0QB 3MCAB 1ZBJA 4JLIA 5J39A 4G85A 1Q81R 1H4VB 5C6SA 2CUDA 4Y91A 2DXUA 5CVIA 5KYYB 3OS2A 4OGEA 2DIQA 2CREA 4HVUA 3JSCA 1QVFP 2PMEA 2K6DA 3VS5A 1X54A 1X01A 2F2WA 1VQ7T 4P74A 2EKHA 2I0NA 5GAN2 4YRGA 4E7KA 5ELOA 1QVFS 3NTIA 2ZPGB 5KYYA 2EJFA 3M4GA 3JCMg 3V7CA 1NYQA 1VQ4A 2I4MA 1VQ9Q 3CC4A 4YRTA 3JB9D 5A0DA 3OA6A 2LJ0A 1VQ8A 4H2TA 5GJWB 5GAN5 4B6MA 2JTMA 4C0ZA 2ROTA 4OP0A 3NHNA 1IXDA 3CCJT 1UGSB 1EFNA 5L8RE 4J5YA 1Y57A 3MPUB 3G6EA 2HAXA 1OPLA 1ASYA 2ATCB 2QEXQ 5DY9A 4F7UB 4FSSA 2HNIA 2X51A 4PJOD 1D3BB 3RMQA 3PNWC 2FZCB 2KMTA 2DAQA 4UPAA 4X1VA 2PU9B 3VQXA 1H92A 2L2PA 4HKEA 1WZOA 4HCCA 2CP0A 5GAMg 2V8IA 2DRKA 2XU8A 3EGXB 5FU6C 1YITA 4M7DD 4PJOB 4F7UA 1LCKA 3QYGB 1RAIB 2DZ9A 2MWOA 1U1TA 4C8QA 3I56A 1VQNT 3DKMA 1M90R 1WJQA 4M77G 2QK0A 4M7DB 1G8XA 1NJIU 3CBPA 1NNHA 4JPBW 3JB9F 1IZ6A 1ZSZB 1N9WA 2FO0A 1DJ7B 4GY5A 4RTWA 1RL2A 2FVUA 2EQUA 4J15A 4F17A 3CMEA 1AWXA 4F7UF 1K9MU 3A32A 2DLPA 3HTZA 2LQKA 5GMKh 2AIRB 3CCRT 4PK4A 4ZGDB 3PE0A 4OF1A 2L0AA 1HD3A 4N4GA 5KYXA 1ZSZA 2HD0A 1M27C 2MI6A 3BDLA 2QAZA 1VQNQ 1Z7MA 2DQ0A 3A8LB 4DQ2A 1S72T 3DB3A 2RH2A 1UTIA 4RKUE 1G3TA 4PJOF 1RADB 2QHSA 4ZTZB 2C7IA 4J83A 4P75A 2CP6A 2EWNA 4PFOA 3LWIA 1PNJA 2O2OA 3SEMA 1FX7A 4LVIA 3HXZA 4M7DF 3QO8A 1PSEA 2HCKA 4M75G 3CCRQ 2H3EB 1BB9A 3JCMh 1AOJA 3HRSA 4YREA 4JZ3A 2OAUA 3CCUA 1PKSA 5LJ5g 3VRZA 1ABQA 2ZT7A 1BK2A 1MMDA 4K11A 4F04B 2B8AA 2QA4T 2ZINA 3VS1A 1PRMC 3HHTB 3QHSA 1QVGS 1UJ0A 2MPXC 3CCQA 2AT1B 1PWTA 1EQRA 3J80E 2J7IA 3TREA 5GMKl 2W10A 3O5ZA 2K5IA 1X6GA 4J9BA 1TS9A 2G6FX 2YXYA 3I55A 2XTIA 4PNOA 3S6WA 3E9HA 3WQZA 1R8OB 5GANh 5GAMh 2QA4Q 2DL3A 1UGRB 4MMKA 4CC2A 1PSFA 4R0KA 4C8QG 3QZ9B 5GAOn 4H2VA 3MP6A 4JRIA 4OMPA 2XDBA 4M4ZA 4RTUA 5C0MA 5GANj 2YUPA 2YUOA 3RMSA 2YUQA 1M8VA 4ZIBA 2PVGB 4JRPA 3V8JA 1NLPC 1AWOA 2V1QA 2QQRA 4RTXA 2ZPHB 1H4TA 5FWBA 5CKFA 1NZ9A 2LQWA 4J9CA 3TVTA 4R56A 1N8RU 1Q95G 2V8JA 1U06A 1KMMA 1PHTA 4HCZA 4FCYA 4BWAA 3CXCP 1YJ9T 1IHWA 2JMAA 3JB9J 3A5ZB 2DE0X 4J9IA 2LCLA 5KYUA 3PVQA 1SSHA 2RD1A 1K9MR 2AK5A 2KQWA 3CXCS 3L2WA 3JCMb 1TSFA 2G3RA 5I22A 1UDLA 3M0QA 4H2SA 1PC0A 4GLKA 4IUPA 3G4ST 4KGVB 4C92D 4VUBA 2CZ7B 5IN1A 4AMCA 5LJ3f 3MJXA 3A5ZA 5GMKi 2NS6A 4K88A 4HVWA 3CCLA 2VYTA 2RB6A 3JCMQ 1BCMA 3PMTA 1JJCB 4P73A 1KSWA 3S3MA 1X43A 4MZTA 3HRUA 2L5QA 4P74C 1WIEA 1KMNA 1VQLQ 1BBWA 1M2VB 3F70A 1OI1A 2AHJB 1D1CA 3NPFA 3G4SQ 3QZ5B 1JJCA 3R6OA 5IXBA 2OTLA 2CUBA 2BKDN 4HVCA 2C8MA 4M78E 2LVMA 3HRIA 1LYLA 4CS2A 1JXMA 1QE0A 3HPWA 1M2VA 2DFUA 4E7JA 3REBB 5I21A 1FWZA 1ADYA 2M51A 3PGGA 3GF5A 4JJNK 1FMWA 1YCSB 1V29B 3M59A 4LN2A 4C92F 3TSWA 1VQ5A 1NEGA 5M9OA 1VQ6Q 4LDWA 1YJWA 3L42A 4XTXA 2GTOA 4TVWA 2RI5A 1TG0A 1WGSA 4A4GA 4A4FA 3M4YA 3HSBA 4QKUA 2VXFA 2IG0A 1WLEA 4P72A 1LJOA 1VQMT 5FU7B 1OQKA 1I5OB 1Q7YU 2JJ9A 1XJWB 1QKXA 4AT1B 2HBPA 3NEMA 2IY5B 4PL6A 2MK5A 3FRNA 3QIIA 4GBQA 4PJOC 2CGHA 4X9DA 1N9SA 4YRQA 9ATCB 2J6KA 3FB9A 5D7UA 1USYA 3NTHA 3A8GB 5GANe 1U3OA 2FB7A 3EG2A 1V1CA 4M7DC 2IY5A 2R57A 5GMKm 4JJDA 2V8KA 1H8KA 2E1HA 3S3NA 2KGTA 1ZSZC 2JTFA 3G6ET 1LOJA 3QG1A 4J9GA 2ED1A 1KD1C 3VS4A 4OMOA 5A2QE 5GANd 1VQ4Q 4RCCA 2M9UA 4C5IA 4YPFA 2FG0A 3CC4Q 2YDLA 3CBOA 4HCBA 2NUZA 4Y28E 3UDCA 1D09B 1VQ8Q 1OYXA 1GL5A 3P8BB 3BJUA 4X5OA 4AH6A 1VYTA 1I07A 2PUKB 2J05A 3L2ZA 4J9HA 2LZ6B 2LCCA 1YITT 4PKCC
chains in the Genus database with same CATH topology
3UGTA 4BE2A 3BFMA 4MDXA 2ZPIB 4MDWA 1ZQ1A 5GAOr 5C51B 3NETA 5D6XA 1BI2A 1EVLA 1YFTA 2E65A 2ZPFB 3PCOB 2ALYB 3QTCA 4OLFA 4TVRA 1KQSA 4ZTUB 1YI2T 1M4ZA 4QQGA 4YRJA 3VQYA 1SSFA 2QI2A 3PCOA 2ALYA 1VQOA 3LGFA 2OTJA 3HFZB 2WSFE 1YJNT 3G1ZA 3VJPA 3C94A 3HKSA 5CKHA 3X28B 5CCAA 2EIFA 5CKEA 3MEYA 12ASA 3JCMX 2DDZA 2E3CA 3L4GB 2MWPA 4CH4A 3CCUT 4XQ3A 4NS5A 4ZTJA 2JUFA 3QO7A 3QO3A 1IL2A 2GQVA 2K3YA 1JRIA 3QNEA 1X55A 4LVMA 5CR2A 4L59A 4M7AB 1ZBXA 4XTVA 5CO7A 3CMAA 1NJ8A 1SRYA 1WU7A 2RHZA 1K8AU 3FDRA 4WI1A 4M7AA 3GNFB 2RHXA 4H02A 3OYHA 3OS0A 4P73C 1KOGA 4RG2A 3CC2T 4JRQA 2RHSB 2Q7GA 4TVAA 3L1AA 2P4TA 1YHQT 3J7AF 2EQKA 4HT8A 2R5MA 3VBBA 1ATIA 2RHSA 3TEGA 2ZCFB 4Q6GA 2A8EA 3HFVA 3NFCA 1OZ3A 5DM7R 3CD6A 5IT9E 4R55A 4ZGEB 4JS5A 5CQXA 3ZEHA 1G51A 3LWHA 3M4QA 4M77E 3L2RA 3PZCA 2L8DA 3OW2A 3OYDA 3FC3A 2GFUA 2DD5A 3TUPA 1M5Q1 4ZTFA 2GCXA 3MEAA 2QQ9A 4YDQA 3T9NA 3MF1A 4P72C 3CCVA 1NJ2A 1Q86C 1I8FA 3P8TA 1UGPB 1VQ9T 3LYIA 3KBGA 2ODRD 4H2XB 4KUDK 3VYGA 5HKCA 2JVVA 1H4SA 2ZZDA 1USYC 5FU7C 4M7AG 2ZT5A 2M16A 2DD4A 4M75E 2P0KA 4H2XA 1YGBA 2E41A 1C0AA 2QEXT 4UP9A 4WJ3M 1WJRA 2JZ2A 1YCYA 1YJWT 2XDPA 4C5HA 4HWOA 3SWNB 4BDZA 2DXCA 1VQKA 1W2BA 2PQWA 3EFSA 2RJDA 1I5LA 4FU6A 4B9XA 3G71A 1WYDA 3VU3C 3SWNA 1VQPA 3PTAA 2XIDA 3KXTA 4E7LA 5KH6A 2JOYA 4OB0B 3ICAA 4C8QE 3LGLA 4LD9K 5GANg 2X4YA 3PFSA 3CCMA 1Q81C 1EFWA 4XU2A 4KT0E 1D3BA 3BDUA 4L6V5 3L2QA 2Q7HA 4NL2A 4PJOA 5GAOq 1XNIA 3DLLA 1KC8C 4DA4A 4JLGA 5LJ3j 4Q15A 4LVLA 5GAN8 3X26B 4M7DA 2X4JA 2MF2A 2RJEA 5FRNA 4OGCA 3QYHB 2RI2A 2ARUA 3CPWA 3W3SA 3OB9A 2KVQG 3OS1A 2Q7EA 4EMHA 1B7YB 2EYQA 2ZNJA 3CCEA 4QVDA 1W66A 1U8RA 4LVJA 4XU1A 1WQ7A 3V7RA 4M7AC 5CIUA 4CH6A 2E6NA 4FT2A 5DLQE 3OYGA 1M90C 5KNNA 3SFMA 3TEHB 1Q82C 3P8VA 2J3MA 4H2UA 3N5BB 3JB9G 4C5EA 4F7UG 3M53A 3V8KA 4L5GA 3MQZA 4J6WA 3A8OB 4ZGJB 2XD0A 4PJOG 1FYFA 1WPYA 1QVFA 1YIJT 1Y7XA 2GF7A 1NYRA 2QHUA 2LNVA 3RUXA 2ZIMA 4YRPA 2XI9A 2LQ8A 3OYBA 4M7DG 4N0AA 3RF1A 1M1FA 4CS4A 3A31A 1RIQA 1NJ5A 5KE2A 2CZ0B 4KR3A 1W4SA 1VQLT 4FSXA 1B76A 4EX5A 4V2SA 4IUTA 4C0GA 2CJBA 3PT9A 1YFSA 3HRKA 4YRSA 2DJZA 1GGMA 1KHCA 1G3WA 4H2WA 3LH0A 4EMKB 4J8OA 4OB2B 4BDYA 2RA2A 1EIYB 3CD6T 4C92B 3A5YA 2XK0A 3UPUA 1PYSB 3TEEA 2YRVA 2CKKA 1K73U 1O9SA 3MEVA 1EIYA 1VQ6T 2XG8D 4C92A 4IURA 4HWRA 2ODRC 2A7YA 3INZA 4ZN1A 1PYSA 4M78D 2ZT6A 2DU7A 2A3LA 5EG2A 4LDUA 1NJIC 1SETA 3CCVT 3GOXA 4M78B 3GLXA 3SWNC 2I2LA 2VUBA 4BY6B 2E64A 1K9MC 4YYEA 2EJGA 3SB2A 5CK9A 4C5GA 2E70A 1VQ7A 1M1KU 1HC7A 1VUBA 3M56A 4X34A 1M1GA 3JCMf 1G3SA 2DTIA 4DOVA 1B34B 3JCMP 3I7FA 4IKFA 1KHIA 1VQ4T 1QVGA 3CC4T 2RHQB 2L89A 3CBMA 2P0QA 1VQ8T 3MF2A 3OMCA 4M78F 3M55A 3CCJA 3QJ6A 3QBYA 1JJ2S 4L87A 2L3RA 2RHQA 11ASA 3HY0A 3G71T 2RO0A 3O8VA 5IAYA 5GAN7 3A7RA 4K86A 2FYKA 5GAMf 4HWSA 3GPLA 4UC4A 3GP8A 3SD4A 3CC7A 3DB4A 5I2SA 2ZPBB 3X25B 2PMFA 3UFGA 3RESA 1YB3A 4XTZA 4CRIA 3MP8A 4C92G 3H8ZA 3MEUA 3I56T 3M54A 5ELNA 4MZMA 3QKJA 4DPGA 1TH7A 3A8HB 5GAOp 3OYCA 3E9IA 3MO8A 2RK2A 3H6ZA 2CIMA 4KR2A 4KQEA 3CMET 3CXCA 2AKWB 5FU6B 4NOYA 4RQFA 1S72A 4B9WA 4CS3A 1N8RC 2ZIOA 3MP1A 1QVPA 3ZBDA 5F5WA 4TQFA 1QP2A 1J5WA 3OBWA 5GAN3 3S3OA 1OZ2A 3E9FA 5CQYA 2O01E 1QW1A 4ME7A 2XHCA 4IUVA 4XTWA 3WVEB 1E22A 5LJ5f 3HXUA 3HFZA 3OSVA 3OMGA 4JS4A 3Q1JA 4YCWA 4WJ4A 4N0AC 1B8AA 2ARSA 3RL6A 1HXDA 2QHTA 4YRFA 1HTTA 1G3YA 3L4GA 3FLGA 3CCQT 4RMOA 4HA8A 4YRCA 4M7AE 4P71A 2LT4A 2E10A 3A7AA 3E9GA 4TQDA 4YCVA 4UP7A 3RIRA 2VC8A 4HWPA 2ZGWA 3JCMV 3I55T 3OYJA 3OSSC 4YRRA 4OB1B 2WSEE 4YROA 2H3JA 2CZ6B 2Y4XA 3R07A 3LC0A 1KQ2A 4RG8A 2JN0A 1QF6A 3M9QA 1Y71A 1XQHA 3AHUA 1XOVA 4A54A 4HT4A 2GFAA 4LNSA 3JB9H 4YP0A 5AYFA 3LSQA 2CYZB 2PUOB 3WVDB 3ASKA 3FJPA 4EMKC 2EJ9A 3JAME 2WACA 3OYMA 2EQMA 2XKOC 4C92C 1YJ9A 3VKIA 2F5TX 3QJYA 3HL8A 2Y4YA 5HY6A 4OMFB 4C0FA 1Q7YC 3HXYA 3G4SA 3HFNA 4XU3A 4BB7A 3VQVA 4CH5A 4FIBA 1N6AA 3E1SA 4XTYA 3M57A 3VYHB 5HK0A 1GXIE 4YCUA 4M77D 3CCLT 1N9RA 4KBMB 4BI3A 4ELYC 2DTHA 4M77B 1FXXA 1YFRA 1UEBA 2RHUA 4BY6C 2I4OA 3HXWA 2YHTA 1KQ1A 2D9TA 2OTLT 4M77A 5FROA 3UH0A 3SDZA 3BY7A 4II1A 4IUQA 2FL7A 4XEOA 2C06A 4M75D 3CMQA 3OYLA 1MGQA 1YBYA 4MZPA 1VQ5T 4M77F 2G4CA 2IVWA 2K5FA 1AHJB 4XK8E 2K4YA 4M75B 2QTXA 2DXTA 1WNLA 4RMFA 1VQMA 2K5LA 3QPHA 4JDSA 4PLLA 5FLXE 4Z02A 3VQWA 4M75A 2KDSA 3OYYA 1NJ1A 3IG2A 4P3OA 4F7UE 1BIBA 4CI0C 2P5IA 3ERRA 2DKGA 4C8QD 3OS5A 4CH3A 4TVYA 4LD6A 4PJOE 4YRMA 4M75F 1NE8A 4QW2A 5LJ3h 2Q5IA 4EO4A 3NTKA 1G5HA 4C8QB 1BYMA 1BI3A 1QP3A 1U1SA 2DPPB 1BI1A 2PVDB 3PIOA 4LDXA 4M7DE 3JCMJ 3CC7T 2K3XA 1K8AC 1RI0A 2LTOA 2R5AA 3OYKA 4J6YA 3CCSA 3LW5E 1EOVA 3OYNA 1KG1A 4FT4A 4IUUA 2ZZFA 1E24A 2J3LA 3RKXA 5CAIA 1NPRA 4YRLA 3WXMB 2MAMA 4BI8B 4OVAA 2VV5A 1JB0E 2VGNA 2YLBA 4QQDA 3PIPA 1YI2A 4C8QF 5D6YA 2ZTGA 4G84A 3OYEA 4P71C 4N4IA 1BKBA 1SESA 5CKBA 1VIEA 4A53A 5GMKj 1YJNA 2VXEA 2QDYB 4BE0A 5KCOA 1B7YA 2BIVA 3QUIA 1X2GA 1VQOT 2OTJT 2EL9A 2K57A 4RCBA 2X4WA 4P3NA 5HK3A 1Y07A 2QHVA 1O75A 3LX7A 3P8HA 2E5AA 5GAN4 3RGLA 1WJSA 1KD1U 3X24B 3TEHA 3QO5A 3OQ5A 2HQXA 3META 5GAN6 2PVOB 1XTDA 2DEQA 4PLIA 4PHCA 1NPPA 1E1OA 3LLRA 1M9SA 2X35A 4QVCA 3URGA 3CMAT 3HXXA 3OYFA 4EMGA 3KFUA 3UT1A 2XGTA 2DK3A 3REUA 2I4NA 3NENA 1BI0A 2FHDA 4XTUA 2E12A 2MMPA 3V8LA 3CC2A 2CJAA 5GAMj 4NCXA 2RJFA 4E47A 2RHYA 2ZPEB 2KSSA 3HRTA 1X75C 1YHQA 4BI4A 2X4XA 4HWTA 4A4KA 2ARTA 3NELA 2DO3A 3ME9A 2ZT8A 3PMIA 4TTVA 4M77C 5LJ3e 1P92A 2P0PA 1UB4A 1EVKA 3ER0A 3QSUA 1KQSS 5A0GA 2RI3A 4C92E 1H641 1I81A 2EAYA 4O5VA 4HT9A 5LJ3d 2NLUA 3HP9A 1E1TA 4EMKA 4XU0A 3BW1A 2E6ZA 1G5VA 3QXEB 5LJ5h 3OY9A 4XEMA 3RKYA 3C4SA 2QXFA 5LL6S 4E7IA 5GMKe 3EAEA 3HXVA 4WF2A 1VQ9A 4M75C 5LJ5j 4C0DB 4RDXA 2HQEA 3HY1A 2RM4A 4FL6A 4O2DA 5I2MA 4M78A 2M1HA 2QEXA 4BUGA 1LNXA 2QQAA 3JCMc 1ZHIA 3JCMe 2M0OA 5CKDA 4J7IA 2JNGA 3FEOA 1BIAA 2O4XB 2ZCEA 2EFIA 4YRKA 2F5KA 3FIFA 3JCMd 1B34A 1VQKT 1SERA 3L2VA 3C95A 4C8QC 1G5IA 4JRKA 2LX9A 3HFOA 2O4XA 4KULA 3A8MB 1H4QA 3UWNA 4XAXB 1VQPT 5KE3A 5GANf 3P8DA 5GAMe 5GAOl 2ZR2A 2CZ1B 4LDYA 4EPCA 4QVZA 4UP8A 3GIBA 3TU4K 4TWAA 3KUFA 1VQNA 2DTOA 2F69A 3CCMT 3OBYA 1X2HA 5GAMd 3A7UA 2ZXFA 3RACA 4P5NA 2QQSA 3UGQA 3E19A 4P75C 4P3PA 1Q86U 3OW2S 2E5QA 3G7ZA 3A74A 1NJ6A 3EFRA 3CCRA 2P0LA 3IKMB 2K2VA 4JUVA 3M58A 1ASZA 2KAFA 2Y90A 3REXA 3CCST 2EKOA 5J3BA 3ZFJA 3OD1A 1JBMA 3VV0A 4NL3A 4PG3A 4M78G 1H3ZA 1Z7NA 3QDRB 2LT1A 4N4HA 2AKWA 4E7HA 1I4K1 3L2UA 2RK1A 3C12A 3DSQA 2DQ3A 4KUIA 4MMLA 4BD3A 4A4EA 1WQWA 4J6XA 2CS7A 3CCET 4D6WA 3CPFA 3P8YA 4O6JA 5DLOA 5FRMA 5LJ5e 2D6FA 2QA4A 4LDVA 2LRQA 3VUZA 3X20B 2VGMA 2ZZEA 4ZN3A 2AMCB 5LJ5d 3JRZA 4X9CA 2CJ9A 1W2BS 2WSCE 2DZCA 1K73C 4ELZC 4EDUA 2RJCA 4M7AD 1Q81U 4E51A 3VUBA 4A4HA 4LVKA 2AMCA 5K1XA 2RHIA 2KK4A 1X6OA 5K1PA 1MHNA 3DLMA 1VQZA 3LSSA 1KC8U 5C52B 1YIJA 3OYAA 4RQEA 4QQ6A 1ADJA 1L0WA 2ZNIA 3GNGA 2LC4A 2KY9A 4BW9A 5J26A 1VIFA 3J81E 4TVAB 2DXBA 5E3IA 3IALA 1BBUA 3IKLA 1X56A 3JB9I 1M1KC 1IREB 3M5AA 1JJ2A 1VQLA 5A0LA 1B70B 5D6WA 3RERA 3RKWA 2XDDA 4M7AF 3MHXA 2DVEA 1EIFA 3JCMW 2R58A 3CPWS 5C53B 1B70A 4BE1A 4K87A 5LJ3g 4J7FA 5KCHA 5GAOm 4YTLA 3TCJA 2Q5HA 1M90U 4M78C 4Q5WA 2BUDA 4FM4B 5HGQA 1N27A 4OB3B 1Q82U 4BACA 2XICA 2I4LA 4C0DC 3MEWA 2DU5A 4DOWA 2EQJA 3V7SA 2YLCA 1VQ6A 3OYIA 4YRIA 2QQBA 1Y96B 4ATOA 2ZZGA 1HK9A 2ZR3A 3CEYA 1UGQB 2DIGA 3M4PA 4YRNA 2LDMA 1Y96A 4H2YA 2D0QB 3MCAB 4JLIA 5J39A 4G85A 1H4VB 5C6SA 4Y91A 2DXUA 5CVIA 3OS2A 4OGEA 2DIQA 3JSCA 2PMEA 1X54A 1X01A 1VQ7T 4P74A 5GAN2 4YRGA 4E7KA 5ELOA 1QVFS 3NTIA 2ZPGB 2EJFA 3M4GA 3JCMg 3V7CA 1NYQA 1VQ4A 2I4MA 3CC4A 4YRTA 3JB9D 5A0DA 3OA6A 1VQ8A 4H2TA 5GAN5 2JTMA 4C0ZA 4OP0A 3CCJT 1UGSB 5L8RE 4J5YA 3G6EA 2HAXA 1ASYA 5DY9A 4F7UB 4PJOD 2HNIA 1D3BB 3RMQA 3PNWC 2KMTA 2DAQA 4UPAA 2PU9B 3VQXA 4HKEA 4HCCA 5GAMg 2V8IA 2XU8A 5FU6C 1YITA 4M7DD 4PJOB 4F7UA 3QYGB 2DZ9A 2MWOA 1U1TA 4C8QA 3I56A 1VQNT 3DKMA 1WJQA 4M77G 4M7DB 1NJIU 3CBPA 1NNHA 3JB9F 1IZ6A 1N9WA 1DJ7B 4GY5A 1RL2A 2FVUA 2EQUA 4J15A 3CMEA 1K9MU 4F7UF 3A32A 3HTZA 2LQKA 5GMKh 3CCRT 4ZGDB 4OF1A 4N4GA 2MI6A 2HD0A 3BDLA 1Z7MA 2DQ0A 3A8LB 4DQ2A 1S72T 3DB3A 2RH2A 4RKUE 1G3TA 4PJOF 2QHSA 4ZTZB 2C7IA 4J83A 4P75A 2EWNA 3LWIA 1FX7A 4LVIA 3HXZA 4M7DF 3QO8A 1PSEA 4M75G 3JCMh 3HRSA 4YREA 2OAUA 3CCUA 5LJ5g 2ZT7A 2B8AA 2QA4T 2ZINA 3HHTB 3QHSA 1QVGS 3CCQA 1EQRA 3J80E 3TREA 5GMKl 2K5IA 3I55A 2XTIA 4PNOA 3S6WA 3E9HA 3WQZA 1R8OB 5GANh 5GAMh 1UGRB 4MMKA 1PSFA 4C8QG 3QZ9B 5GAOn 4H2VA 3MP6A 4JRIA 2XDBA 5C0MA 5GANj 3RMSA 1M8VA 4ZIBA 2PVGB 4JRPA 3V8JA 2QQRA 2ZPHB 1H4TA 5CKFA 1NZ9A 4R56A 1N8RU 2V8JA 1KMMA 4HCZA 4BWAA 1YJ9T 3JB9J 3A5ZB 2LCLA 2RD1A 2KQWA 3CXCS 3L2WA 3JCMb 2G3RA 4H2SA 4GLKA 4IUPA 3G4ST 4C92D 4VUBA 2CZ7B 5IN1A 5LJ3f 3A5ZA 4K88A 5GMKi 2NS6A 3CCLA 2VYTA 2RB6A 3JCMQ 3PMTA 1JJCB 4P73A 3S3MA 4MZTA 3HRUA 2L5QA 4P74C 1KMNA 1BBWA 3F70A 1OI1A 2AHJB 3QZ5B 1JJCA 3R6OA 2OTLA 2BKDN 4HVCA 2C8MA 4M78E 2LVMA 3HRIA 1LYLA 4CS2A 1QE0A 3HPWA 4E7JA 5I21A 1FWZA 1ADYA 3PGGA 3GF5A 4JJNK 1V29B 3M59A 4C92F 1VQ5A 5M9OA 4LDWA 1YJWA 3L42A 4XTXA 4TVWA 2RI5A 1WGSA 4A4GA 4A4FA 3M4YA 3HSBA 2VXFA 2IG0A 1WLEA 4P72A 1LJOA 1VQMT 5FU7B 1Q7YU 2HBPA 3NEMA 2IY5B 4PL6A 3FRNA 3QIIA 4PJOC 2CGHA 4X9DA 1N9SA 4YRQA 3FB9A 1USYA 3NTHA 3A8GB 5GANe 2FB7A 4M7DC 2IY5A 2R57A 5GMKm 2V8KA 2E1HA 3S3NA 3G6ET 2JTFA 1LOJA 3QG1A 1KD1C 5A2QE 5GANd 4RCCA 2M9UA 4C5IA 4YPFA 3CBOA 4HCBA 4Y28E 3UDCA 4X5OA 1OYXA 3P8BB 3BJUA 4AH6A 2PUKB 1YITT 3L2ZA 2LCCA 4PKCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRK A;  4YRS A;  2DJZ A;  3UGT A;  4J6Y A;  1GGM A;  3JCM W;  1EOV A;  3BFM A;  5C53 B;  1B70 A;  4H2W A;  4K87 A;  5LJ3 g;  5GAO r;  4EMK B;  2RA2 A;  2ZZF A;  5C51 B;  5GAO m;  1E24 A;  1EIY B;  3NET A;  2Q5H A;  4C92 B;  2J3L A;  3A5Y A;  3RKX A;  4M78 C;  5CAI A;  1EVL A;  1YFT A;  5HGQ A;  1PYS B;  2E65 A;  2I4L A;  4YRL A;  2DU5 A;  2YLB A;  3PCO B;  3V7S A;  2YLC A;  2ALY B;  3QTC A;  4OLF A;  4C8Q F;  1EIY A;  2ZTG A;  4G84 A;  4YRI A;  4C92 A;  4P71 C;  4ZTU B;  4HWR A;  1Y96 B;  1SES A;  2ODR C;  3INZ A;  1PYS A;  4YRJ A;  3VQY A;  5GMK j;  4A53 A;  4M78 D;  2VXE A;  3PCO A;  2ALY A;  1B7Y A;  2ZZG A;  2ZT6 A;  3HFZ B;  1HK9 A;  2DU7 A;  2ZR3 A;  3QUI A;  1X2G A;  3G1Z A;  2EL9 A;  3M4P A;  2K57 A;  4RCB A;  4YRN A;  1SET A;  1Y96 A;  4H2Y A;  4M78 B;  4P3N A;  4JLI A;  4G85 A;  3SWN C;  3MEY A;  12AS A;  1H4V B;  2I2L A;  3JCM X;  2QHV A;  2E5A A;  2E64 A;  4YYE A;  4Y91 A;  2EJG A;  2DXU A;  2DDZ A;  3SB2 A;  2E3C A;  5GAN 4;  3L4G B;  4CH4 A;  3RGL A;  2PME A;  4XQ3 A;  1X54 A;  1X01 A;  4P74 A;  1HC7 A;  3QO7 A;  3TEH A;  3QO5 A;  3QO3 A;  1IL2 A;  5GAN 2;  4YRG A;  1JRI A;  3JCM f;  5ELO A;  3QNE A;  5GAN 6;  1X55 A;  2EJF A;  2DTI A;  3V7C A;  3M4G A;  2DEQ A;  4M7A B;  1B34 B;  3JCM g;  3JCM P;  1NYQ A;  2I4M A;  4PHC A;  3I7F A;  4XTV A;  4YRT A;  3JB9 D;  1E1O A;  1NJ8 A;  1SRY A;  1WU7 A;  4QVC A;  4H2T A;  2RHQ B;  3HXX A;  4EMG A;  5GAN 5;  3MF2 A;  3KFU A;  4WI1 A;  4M78 F;  2XGT A;  4M7A A;  4OP0 A;  3REU A;  4J5Y A;  2I4N A;  3NEN A;  4L87 A;  4H02 A;  1ASY A;  4XTU A;  3V8L A;  2RHQ A;  5DY9 A;  4F7U B;  2CJA A;  4P73 C;  11AS A;  4PJO D;  2HNI A;  3HY0 A;  1D3B B;  5GAM j;  4NCX A;  1KOG A;  5GAN 7;  2RHS B;  3A7R A;  4K86 A;  2FYK A;  4UPA A;  5GAM f;  2Q7G A;  4HWS A;  4TVA A;  3L1A A;  3VQX A;  5GAM g;  4HWT A;  2PMF A;  3UFG A;  3RES A;  4M7D D;  4PJO B;  1YB3 A;  4XTZ A;  2ART A;  4F7U A;  4HT8 A;  3NEL A;  3VBB A;  4C92 G;  1ATI A;  2RHS A;  2DZ9 A;  2ZT8 A;  3TEG A;  1U1T A;  4C8Q A;  4TTV A;  4M77 C;  5LJ3 e;  4Q6G A;  4M77 G;  3HFV A;  4M7D B;  5ELN A;  4DPG A;  1NNH A;  3JB9 F;  1TH7 A;  1EVK A;  1N9W A;  3QSU A;  5GAO p;  3E9I A;  4C92 E;  1H64 1;  1I81 A;  2EAY A;  4J15 A;  1G51 A;  4HT9 A;  2CIM A;  5LJ3 d;  4F7U F;  3A32 A;  4KR2 A;  3HTZ A;  4KQE A;  3M4Q A;  4M77 E;  5GMK h;  1E1T A;  3PZC A;  4EMK A;  4XU0 A;  2AKW B;  4NOY A;  4RQF A;  3BW1 A;  4CS3 A;  3TUP A;  1M5Q 1;  1Z7M A;  2DQ0 A;  2ZIO A;  4DQ2 A;  4PJO F;  5F5W A;  4TQF A;  2QHS A;  4YDQ A;  4ZTZ B;  2C7I A;  5LJ5 h;  4P75 A;  3MF1 A;  2EWN A;  1J5W A;  4XEM A;  3RKY A;  5GAN 3;  4P72 C;  5GMK e;  3HXV A;  4WF2 A;  1NJ2 A;  3HXZ A;  4M7D F;  1I8F A;  3P8T A;  3QO8 A;  4M75 C;  4M75 G;  5LJ5 j;  2ODR D;  4RDX A;  3JCM h;  4XTW A;  4H2X B;  1E22 A;  4YRE A;  5LJ5 f;  3HXU A;  3HFZ A;  3HY1 A;  2RM4 A;  1H4S A;  5LJ5 g;  1USY C;  2ZT7 A;  4M7A G;  2ZT5 A;  4O2D A;  4M78 A;  4YCW A;  2ZIN A;  4M75 E;  3QHS A;  4WJ4 A;  4N0A C;  1B8A A;  2ARS A;  3RL6 A;  1LNX A;  4H2X A;  1HXD A;  3JCM c;  2QHT A;  1YGB A;  2E41 A;  1HTT A;  4YRF A;  1C0A A;  4UP9 A;  4WJ3 M;  3JCM e;  1EQR A;  3L4G A;  5GMK l;  1YCY A;  4HA8 A;  4YRC A;  4M7A E;  4P71 A;  2E10 A;  3A7A A;  4YCV A;  4TQD A;  4UP7 A;  3RIR A;  1BIA A;  2VC8 A;  2ZGW A;  4HWP A;  4HWO A;  2XTI A;  3SWN B;  4PNO A;  2ZCE A;  4YRK A;  3JCM V;  3E9H A;  3WQZ A;  3FIF A;  3JCM d;  4YRR A;  1B34 A;  5GAN h;  5GAM h;  1SER A;  4YRO A;  4MMK A;  3R07 A;  4C8Q C;  4C8Q G;  1G5I A;  3EFS A;  4JRK A;  1I5L A;  1KQ2 A;  3LC0 A;  5GAO n;  4H2V A;  2JN0 A;  1QF6 A;  4JRI A;  1WYD A;  3HFO A;  3VU3 C;  3SWN A;  3AHU A;  4A54 A;  5GAN j;  1H4Q A;  4LNS A;  3JB9 H;  1M8V A;  4ZIB A;  4YP0 A;  3V8J A;  5GAN f;  3LSQ A;  1H4T A;  3ICA A;  4C8Q E;  5GAN g;  5GAM e;  5GAO l;  2ZR2 A;  3FJP A;  4EMK C;  2EJ9 A;  1EFW A;  4XU2 A;  4UP8 A;  3GIB A;  1D3B A;  3BDU A;  4TWA A;  4C92 C;  2DTO A;  1KMM A;  4BWA A;  1X2H A;  5GAM d;  3JB9 J;  2Q7H A;  3A7U A;  2ZXF A;  3RAC A;  2RD1 A;  3UGQ A;  4NL2 A;  4P75 C;  4P3P A;  4PJO A;  5GAO q;  3HXY A;  3JCM b;  3HFN A;  4H2S A;  3A74 A;  1NJ6 A;  5LJ3 j;  4XU3 A;  3VQV A;  4Q15 A;  3EFR A;  4CH5 A;  5GAN 8;  4C92 D;  2P0L A;  3IKM B;  5LJ3 f;  4JUV A;  3A5Z A;  4XTY A;  5GMK i;  4K88 A;  1ASZ A;  2Y90 A;  4M7D A;  3REX A;  4YCU A;  4M77 D;  2RB6 A;  3JCM Q;  3OD1 A;  1JBM A;  1JJC B;  4P73 A;  1N9R A;  2ARU A;  4NL3 A;  4PG3 A;  4M78 G;  3W3S A;  4P74 C;  2DTH A;  1KMN A;  1Z7N A;  4M77 B;  1BBW A;  1YFR A;  2AKW A;  2Q7E A;  4EMH A;  1B7Y B;  2ZNJ A;  1I4K 1;  1JJC A;  2I4O A;  3HXW A;  2YHT A;  1KQ1 A;  3DSQ A;  2DQ3 A;  4MML A;  2C8M A;  4HVC A;  4M78 E;  4QVD A;  1W66 A;  3HRI A;  1WQW A;  1LYL A;  4J6X A;  4M77 A;  4XU1 A;  4CS2 A;  1WQ7 A;  3P8Y A;  1QE0 A;  3UH0 A;  3V7R A;  5LJ5 e;  5I21 A;  3BY7 A;  4M7A C;  4CH6 A;  1ADY A;  4XEO A;  3PGG A;  4M75 D;  2ZZE A;  5KNN A;  3CMQ A;  3TEH B;  1MGQ A;  4C92 F;  2AMC B;  5LJ5 d;  4X9C A;  3P8V A;  2CJ9 A;  2J3M A;  2DZC A;  4XTX A;  4H2U A;  4TVW A;  4M77 F;  3JB9 G;  2G4C A;  4M7A D;  4E51 A;  4M75 B;  2QTX A;  3HSB A;  2DXT A;  1WNL A;  2VXF A;  4F7U G;  4RMF A;  2AMC A;  1WLE A;  3V8K A;  5K1X A;  4P72 A;  1LJO A;  5K1P A;  1VQZ A;  3LSS A;  3VQW A;  4J6W A;  4M75 A;  3NEM A;  2IY5 B;  1NJ1 A;  5C52 B;  3IG2 A;  4P3O A;  4PJO C;  2CGH A;  4PJO G;  1FYF A;  1WPY A;  4X9D A;  4RQE A;  1N9S A;  1ADJ A;  4YRQ A;  4F7U E;  1L0W A;  2ZNI A;  1NYR A;  2QHU A;  4BW9 A;  3FB9 A;  1BIB A;  1USY A;  5GAN e;  2P5I A;  3RUX A;  4TVA B;  2ZIM A;  2DKG A;  2FB7 A;  3ERR A;  4C8Q D;  4M7D C;  4YRP A;  4M7D G;  2IY5 A;  4CH3 A;  5GMK m;  5E3I A;  4N0A A;  3IAL A;  4TVY A;  3RF1 A;  2E1H A;  4PJO E;  1BBU A;  4CS4 A;  4YRM A;  3IKL A;  1LOJ A;  3JB9 I;  1X56 A;  4M75 F;  3A31 A;  1RIQ A;  5LJ3 h;  5GAN d;  2Q5I A;  1NJ5 A;  4EO4 A;  4RCC A;  4C8Q B;  1G5H A;  1B70 B;  4YPF A;  1U1S A;  4KR3 A;  3RER A;  3RKW A;  4M7D E;  4X5O A;  1B76 A;  3JCM J;  3BJU A;  4M7A F;  4EX5 A;  4AH6 A;  4V2S A;  3L2Z A;  2CJB A;  1YFS A;  2DVE A; 
#chains in the Genus database with same CATH topology
 3UGT A;  4BE2 A;  1FYN A;  3BFM A;  4MDX A;  4FW1 A;  2ZPI B;  3G6E Q;  4MDW A;  1ZQ1 A;  5GAO r;  2A36 A;  3M0R A;  5C51 B;  1D1A A;  3NET A;  5D6X A;  1KJW A;  1BI2 A;  1EVL A;  1YFT A;  1AD5 A;  2E65 A;  1K0X A;  2ZPF B;  1YWP A;  3PCO B;  2ALY B;  1YIT Q;  3QTC A;  4OLF A;  3M0U A;  4TVR A;  1KQS A;  4ZTU B;  1YI2 T;  3SHW A;  1M4Z A;  4QQG A;  2HL3 A;  3VS2 A;  4WTO B;  4YRJ A;  3VQY A;  3I56 Q;  1SSF A;  1WLP B;  4KGZ B;  2QI2 A;  1WI7 A;  3PCO A;  2ALY A;  1VQO A;  3LGF A;  2OTJ A;  3HFZ B;  2WSF E;  1YJN T;  1AEY A;  1M3C A;  3G1Z A;  3VJP A;  3C94 A;  3HKS A;  1UE9 A;  5CKH A;  3X28 B;  2DMO A;  5CCA A;  5GJV B;  2EIF A;  5CKE A;  3MEY A;  12AS A;  3JCM X;  2DDZ A;  2E3C A;  4OMN A;  2CH4 W;  1PD0 A;  3L4G B;  2MWP A;  5KYW B;  1MND A;  4CH4 A;  2FPE A;  3CCU T;  4XQ3 A;  4NS5 A;  4ZTJ A;  2JUF A;  3QO7 A;  3QO3 A;  1YJN Q;  1IL2 A;  3I9Q A;  2GQV A;  2K3Y A;  1JRI A;  1RLQ C;  3QNE A;  4E7S A;  1X55 A;  4LVM A;  5CR2 A;  2EYW A;  4L59 A;  4M7A B;  1A0N B;  1C1A A;  5KYW A;  1ZBX A;  4XTV A;  1TTH B;  5CO7 A;  3CMA A;  1NJ8 A;  1SRY A;  1WU7 A;  4CC3 A;  2RHZ A;  1K8A U;  3FDR A;  2K7A A;  4WI1 A;  5I11 A;  3CCU Q;  2BZX A;  4M7A A;  1QMC A;  2RHX A;  3GNF B;  2E4H A;  2FRW A;  3EGD B;  1WXU A;  4H02 A;  1OV3 A;  3VS3 A;  3OYH A;  2JM9 A;  4JJC A;  3RNJ A;  3OS0 A;  4P73 C;  1KOG A;  4RG2 A;  3CC2 T;  4JRQ A;  2RHS B;  2HSE B;  2MOX A;  2Q7G A;  4TVA A;  3L1A A;  1QWF A;  2RQV A;  2P4T A;  3I55 Q;  3CPW P;  1YHQ T;  3J7A F;  2EQK A;  2EQI A;  4HT8 A;  1X27 A;  2R5M A;  3VBB A;  1D0Y A;  1ATI A;  2RHS A;  3TEG A;  2ZCF B;  2YRD A;  1G83 A;  1TOV A;  2IPO B;  4Q6G A;  2A8E A;  3HFV A;  3NFC A;  5EC7 A;  3H0H A;  1OZ3 A;  5DM7 R;  3CD6 A;  5FW9 A;  5IT9 E;  2DIL A;  2JM8 A;  3E2U A;  4R55 A;  4ZGE B;  4JS5 A;  2MIO A;  2QTV A;  1RAG B;  5CQX A;  1U5S A;  3ZEH A;  2AZV A;  1G51 A;  3LWH A;  3R6N A;  3M4Q A;  4M77 E;  3L2R A;  3PZC A;  2L8D A;  3OW2 A;  3OYD A;  2GBQ A;  3FC3 A;  2GFU A;  2H8H A;  2O88 A;  2DD5 A;  2K3B A;  3TUP A;  1M5Q 1;  8ATC B;  4ZTF A;  2GCX A;  4PFZ A;  3MEA A;  2QQ9 A;  4YDQ A;  2IIM A;  2OX7 A;  3T9N A;  2DNU A;  3MF1 A;  1H3H A;  4P72 C;  3CCV A;  3EGU A;  5IXF A;  2PZ1 A;  1NJ2 A;  1Q86 C;  2J6F A;  1I8F A;  1ZUU A;  3P8T A;  2M0Y A;  1UGP B;  1VQ9 T;  3LYI A;  3KBG A;  5KYN A;  2ODR D;  4H2X B;  1RI9 A;  3CCL Q;  4KUD K;  3VYG A;  4FYX B;  5HKC A;  4KH1 B;  1AT1 B;  2JVV A;  1H4S A;  2ZZD A;  1OOT A;  2KR3 A;  1USY C;  2F2V A;  5FU7 C;  4M7A G;  2ZT5 A;  2C0T A;  2M16 A;  2DD4 A;  1BU1 A;  4M75 E;  2HL5 C;  1KC8 R;  2P0K A;  4H2X A;  1YGB A;  2E41 A;  2EVR A;  1B7T A;  1C0A A;  2QEX T;  4UP9 A;  4WJ3 M;  1WJR A;  1NM7 A;  2JZ2 A;  1YCY A;  1AWJ A;  1YJW T;  2OTL Q;  1QCF A;  2XDP A;  4C5H A;  4HWO A;  3SWN B;  3HTR A;  4BDZ A;  2DXC A;  1VQK A;  1W2B A;  4ZNX A;  2O9S A;  1RAE B;  2FRY A;  2PQW A;  3EFS A;  2RJD A;  1I5L A;  3EH2 A;  4FU6 A;  4B9X A;  3G71 A;  1WYD A;  3VU3 C;  3SWN A;  1SF9 A;  1W70 A;  1VQP A;  2DF6 A;  3PTA A;  1PRL C;  2XID A;  4FYV B;  3KXT A;  1VQ5 Q;  1YJW Q;  4E7L A;  1IRX A;  5KH6 A;  2JOY A;  4OB0 B;  3ICA A;  4C8Q E;  3LGL A;  4EIK A;  5GAN g;  4LD9 K;  3I5R A;  1MMN A;  2X4Y A;  3PFS A;  3CCM A;  1Q81 C;  1EFW A;  4XU2 A;  4KT0 E;  1D3B A;  4OMM A;  3BDU A;  2OI3 A;  2HEQ A;  1EZZ B;  1OX8 A;  4L6V 5;  1OPK A;  3H0I A;  3L2Q A;  1ZA2 B;  3GBQ A;  2Q7H A;  1Q82 R;  3EGX A;  4NL2 A;  4PJO A;  1JO8 A;  5GAO q;  1XNI A;  3DLL A;  1KC8 C;  4DA4 A;  4JLG A;  5LJ3 j;  4Q15 A;  4LVL A;  3M0S A;  5GAN 8;  3X26 B;  4AG1 C;  1PD1 A;  4M7D A;  2X4J A;  4DBF A;  2MF2 A;  2RJE A;  5FRN A;  1D0Z A;  4OGC A;  1I0C A;  3QYH B;  2RI2 A;  1WHH A;  2ARU A;  3CPW A;  2GTJ A;  3W3S A;  3OB9 A;  4OMQ A;  2P84 A;  2QYZ A;  3H9N A;  2DEU A;  2KVQ G;  3OS1 A;  1YNZ A;  2Q7E A;  1IB8 A;  4EMH A;  1B7Y B;  1WXB A;  2EYQ A;  2ZNJ A;  3QWX X;  1HJD A;  1FMV A;  4DEY A;  3CCE A;  4QVD A;  1W66 A;  1U8R A;  1BBZ A;  4LVJ A;  2ROL A;  4XU1 A;  1WQ7 A;  3V7R A;  1QVG P;  2HBW A;  2D8H A;  3UA6 A;  4M7A C;  5CIU A;  1CSK A;  4CH6 A;  1JU5 C;  1WHK A;  4LNP A;  2E6N A;  4LE9 A;  4FT2 A;  5DLQ E;  3OYG A;  1M90 C;  5KNN A;  4Z88 A;  3SFM A;  3TEH B;  1F1B B;  1Q82 C;  1GCQ A;  3IQL A;  3P8V A;  2J3M A;  4H2U A;  3N5B B;  3JB9 G;  2EBP A;  2RMO A;  4C5E A;  1JQQ A;  3REA B;  1YP5 A;  2DJQ A;  4F7U G;  3M53 A;  3V8K A;  1VQO Q;  2OTJ Q;  2LCS A;  3CQT A;  4L5G A;  2MCN A;  3MQZ A;  1UHF A;  4WCI A;  1ZA1 B;  4J6W A;  3A8O B;  4ZGJ B;  2ZAE A;  2XD0 A;  4PJO G;  1FYF A;  1WPY A;  1QVF A;  4HCK A;  1YIJ T;  1TUD A;  1Y7X A;  2GF7 A;  1NYR A;  2QHU A;  2LNV A;  3RUX A;  2ZIM A;  4YRP A;  2XI9 A;  2LQ8 A;  3OYB A;  4M7D G;  4N0A A;  7AT1 B;  3RF1 A;  1M1F A;  4CS4 A;  1MV3 A;  1SRL A;  1NJI R;  3A31 A;  1RIQ A;  2EYY A;  4PJJ A;  2FZK B;  1NJ5 A;  1R0C B;  1T0H A;  1MV0 B;  2CZ0 B;  5KE2 A;  1OU8 A;  4KR3 A;  3CMA Q;  1W4S A;  1YIJ Q;  1VQL T;  4FSX A;  1B76 A;  4EX5 A;  4V2S A;  3U23 A;  2EYX A;  1Z9Z A;  4IUT A;  4C0G A;  2CJB A;  3PT9 A;  1YFS A;  3AT1 B;  3HRK A;  4YRS A;  1WDX A;  2DJZ A;  1GGM A;  1KHC A;  3VS6 A;  1G3W A;  4H2W A;  3LH0 A;  2DL7 A;  5IHN A;  4EMK B;  4J8O A;  4OB2 B;  1X2K A;  2RA2 A;  4BDY A;  1EIY B;  4D8D A;  3CD6 T;  4FYW B;  4C92 B;  3A5Y A;  2XK0 A;  3UPU A;  1UFF A;  1VYV A;  3VS0 A;  4J9D A;  4D8K A;  1PYS B;  1QCN A;  3TEE A;  2YRV A;  2CKK A;  1K73 U;  2PNI A;  1O9S A;  3MEV A;  2VAS A;  1EIY A;  1VQ6 T;  2XG8 D;  1YN8 A;  4C92 A;  1RLP C;  4DBH A;  4IUR A;  4HWR A;  2ENM A;  2ODR C;  1SRM A;  2A7Y A;  3INZ A;  4ZN1 A;  1J3T A;  1PYS A;  4M78 D;  2RN8 A;  1ACM B;  2LJ1 A;  3CD6 Q;  2ZT6 A;  1GFD A;  2DU7 A;  2A3L A;  5EG2 A;  4LDU A;  1NJI C;  2J6O A;  1SET A;  3CCV T;  3GOX A;  4M78 B;  1RAA B;  2QGG A;  3GLX A;  3SWN C;  2I2L A;  2VUB A;  1PG5 B;  2E64 A;  4BY6 B;  1K9M C;  1AWW A;  4YYE A;  4CC4 B;  2EJG A;  3SB2 A;  5CK9 A;  4C5G A;  2DL4 A;  3VS7 A;  2LJ3 A;  2E70 A;  2FEI A;  1VQ7 A;  2KT8 A;  2E3I A;  2O31 A;  1M1K U;  1HC7 A;  1VUB A;  2W0Z A;  2JW4 A;  2DBK A;  3M56 A;  4PJN A;  4X34 A;  1M1G A;  3JCM f;  4IIO A;  1G3S A;  2D1X A;  2DTI A;  3CCV Q;  4DOV A;  1B34 B;  3JCM P;  1EX4 A;  1LPL A;  3QDF A;  3I7F A;  4IKF A;  1KHI A;  3G1J A;  1SHF A;  1VQ4 T;  1QVG A;  1HYO A;  3CC4 T;  2ABL A;  2RHQ B;  2L89 A;  3CBM A;  2P0Q A;  1X69 A;  1N8R R;  4JJB A;  1JJ2 P;  1VQ8 T;  3MF2 A;  3OMC A;  4M78 F;  3M55 A;  3CCJ A;  2KYB A;  1E6G A;  2V26 A;  3QJ6 A;  3QBY A;  1JJ2 S;  2YT6 A;  1ZUY A;  4L87 A;  2L3R A;  1S1N A;  1JXO A;  1RAF B;  2RHQ A;  11AS A;  3HY0 A;  4CC7 A;  1OX9 A;  1B07 A;  3G71 T;  1QCO A;  2RO0 A;  3O8V A;  2D8J A;  5IAY A;  5GAN 7;  2A08 A;  3A7R A;  4K86 A;  2FYK A;  1NG2 A;  2KXC A;  5GAM f;  4HWS A;  3GPL A;  4UC4 A;  3GP8 A;  1M30 A;  3SD4 A;  3CC7 A;  3DB4 A;  5I2S A;  2ZPB B;  3X25 B;  2PMF A;  1W6X A;  3RES A;  3UFG A;  1YB3 A;  4XTZ A;  4CRI A;  2JTE A;  1VQK Q;  3MP8 A;  1K9A A;  4C92 G;  2A0F B;  2COZ A;  3H8Z A;  1MMA A;  3MEU A;  1E6H A;  1TU0 B;  3D7S B;  3I56 T;  3M54 A;  5ELN A;  2XMF A;  3QKJ A;  4MZM A;  3G71 Q;  4DPG A;  1K73 R;  1TH7 A;  1GCP A;  1VQP Q;  3A8H B;  5GAO p;  3OYC A;  3E9I A;  3MO8 A;  2RK2 A;  3H6Z A;  2HKQ B;  1K0S A;  2LMJ A;  2CIM A;  4KR2 A;  2BE9 B;  4KQE A;  1TUG B;  3CME T;  3CXC A;  1GCQ C;  2Z0W A;  2CT4 A;  2AKW B;  1W1F A;  5FU6 B;  2KNB B;  4NOY A;  3CCM Q;  4RQF A;  1S72 A;  4B9W A;  1YWO A;  2GNC A;  4CS3 A;  1N8R C;  2ZIO A;  3MP1 A;  1QVP A;  3ZBD A;  1Y0M A;  2NUT B;  5F5W A;  4TQF A;  2K79 A;  1QP2 A;  1J5W A;  2CSI A;  3OBW A;  5GAN 3;  3LH5 A;  3S3O A;  1OZ2 A;  3E9F A;  2B86 A;  3EHR A;  5CQY A;  2O01 E;  1QW1 A;  4RTV A;  4ME7 A;  1YFN A;  1WA7 A;  2XHC A;  2J06 A;  3CME Q;  2NUT A;  2NYS A;  4IUV A;  4XTW A;  3WVE B;  1E22 A;  5LJ5 f;  2AKK A;  3HXU A;  3HFZ A;  3OSV A;  4DBR A;  3OMG A;  2KRN A;  4JS4 A;  3Q1J A;  4YCW A;  3RDV A;  1WHG A;  2VVK A;  1Q7Y R;  2DET A;  4WJ4 A;  4N0A C;  1B8A A;  2ARS A;  2X9H A;  3RL6 A;  1HXD A;  2KRO A;  2QHT A;  1NLO C;  4YRF A;  1HTT A;  1G3Y A;  1X2Q A;  2DM1 A;  3BE3 A;  4Z8A A;  3L4G A;  3FLG A;  3CCQ T;  4RMO A;  2EGE A;  4HA8 A;  4M7A E;  4YRC A;  4P71 A;  2EGA A;  2LT4 A;  2E10 A;  3A7A A;  3E9G A;  4TQD A;  4YCV A;  4UP7 A;  3RIR A;  2VC8 A;  3CCE Q;  2ZGW A;  4HWP A;  2SRC A;  3JCM V;  3I55 T;  3OYJ A;  3OSS C;  4YRR A;  4OB1 B;  2WSE E;  4YRO A;  2H3J A;  2CZ6 B;  1V76 A;  2Y4X A;  3R07 A;  3TQ7 P;  3LC0 A;  1UGV A;  1KQ2 A;  4RG8 A;  4PFP A;  2RNA A;  2JN0 A;  1QF6 A;  3M9Q A;  1Y71 A;  4AFU C;  1XQH A;  3AHU A;  1XOV A;  4A54 A;  4HT4 A;  2GFA A;  3CCQ Q;  4LNS A;  3JB9 H;  4YP0 A;  5AYF A;  3LSQ A;  2CYZ B;  2PUO B;  3WVD B;  3I35 A;  3ASK A;  3EGD A;  1UEC A;  3FJP A;  1ZX6 A;  2EJ9 A;  2F2X A;  2KRM A;  4EMK C;  2C0I A;  3JAM E;  4LXC A;  2WAC A;  2O9V A;  3OYM A;  2EQM A;  2XKO C;  4C92 C;  1YJ9 A;  2CP7 A;  3VKI A;  2F5T X;  3QJY A;  4FYY B;  3HL8 A;  2KRS A;  2KEA A;  2JXB A;  2Y4Y A;  5HY6 A;  1AZG B;  4OMF B;  1I1J A;  3C0C A;  4C0F A;  1C6V X;  1NYF A;  1Q7Y C;  3HXY A;  4J9F A;  1KIK A;  2QAS A;  3G4S A;  1JEG A;  4JZ4 A;  3HFN A;  4HVV A;  4XU3 A;  4BB7 A;  3VQV A;  4CH5 A;  4FIB A;  1N6A A;  3E1S A;  2V1R A;  4XTY A;  4AFS C;  3M57 A;  2NWM A;  3VYH B;  5HK0 A;  1GXI E;  4YCU A;  4M77 D;  4AFQ C;  3CCL T;  2LNH B;  2VKN A;  1N9R A;  1SKU B;  4KBM B;  1WHM A;  1WXT A;  4BI3 A;  4ELY C;  1T0J A;  2DTH A;  4M77 B;  3KFV A;  1FXX A;  2CP2 A;  2HZY A;  1UEB A;  1YFR A;  1MUZ A;  2RHU A;  4BY6 C;  1BCO A;  3H41 A;  2RQR A;  3ZL7 C;  5L23 A;  4ESR A;  2I4O A;  3HXW A;  2YHT A;  5FWC A;  1KQ1 A;  2D9T A;  3VRY A;  2OTL T;  4M77 A;  1IGQ A;  1CKA A;  5FRO A;  1N5Z A;  3UH0 A;  4J9E A;  3SDZ A;  3BY7 A;  1WFW A;  4II1 A;  4IUQ A;  2FL7 A;  1G2B A;  4XEO A;  2C06 A;  4M75 D;  1WHJ A;  3CMQ A;  3OYL A;  1MGQ A;  2P4R A;  1YBY A;  2BE7 D;  4MZP A;  1K8A R;  2JS2 A;  1VQ5 T;  2YRC A;  4M77 F;  3RBB B;  2G4C A;  2ED0 A;  2IVW A;  2K5F A;  1AHJ B;  4XK8 E;  2K4Y A;  4M75 B;  2HQH A;  1T3S A;  2QTX A;  1K1Z A;  2DXT A;  1WNL A;  4RMF A;  1VQM A;  2K5L A;  3QPH A;  4JDS A;  4PLL A;  3EG1 A;  5FLX E;  4Z02 A;  1NYG A;  3VQW A;  4M75 A;  2DL8 A;  2KDS A;  3OYY A;  1NJ1 A;  1NBE B;  3IG2 A;  4P3O A;  4F7U E;  3MKD A;  2X3W D;  3TSZ A;  1M8M A;  2EYZ A;  1BIB A;  4CI0 C;  2P5I A;  1VQ7 Q;  3ERR A;  2DKG A;  4C8Q D;  3OS5 A;  4CH3 A;  2HMA A;  4LUE A;  4TVY A;  4LD6 A;  2KE9 A;  4PJO E;  4YRM A;  1AVZ C;  4M75 F;  4ORZ A;  2VWF A;  1NE8 A;  4QW2 A;  5LJ3 h;  2Q5I A;  4EO4 A;  3NTK A;  4C8Q B;  1G5H A;  1BI3 A;  1QP3 A;  1BYM A;  1U1S A;  2DPP B;  1BI1 A;  2PVD B;  2EPD A;  3PIO A;  3NMZ C;  4LDX A;  4M7D E;  3JCM J;  3CC7 T;  3CCJ Q;  2K3X A;  1K8A C;  1RI0 A;  2LTO A;  2R5A A;  3OYK A;  4J6Y A;  1VYU A;  1X6B A;  3CCS A;  3LW5 E;  1EOV A;  5IHI A;  1C0M A;  3OYN A;  1KG1 A;  4RTZ A;  4FT4 A;  1RAB B;  2EW3 A;  4IUU A;  2ZZF A;  1E24 A;  2RQW A;  5KYX B;  2J3L A;  3THK A;  3RKX A;  5CAI A;  3EG3 A;  1NPR A;  2DL5 A;  4DBQ A;  4YRL A;  3WXM B;  2MAM A;  4BI8 B;  4OVA A;  2VV5 A;  1JB0 E;  2VGN A;  2YLB A;  4QQD A;  3JV3 A;  2YUN A;  3CC7 Q;  3PIP A;  3I5S A;  1YI2 A;  4C8Q F;  5D6Y A;  2DER A;  4KRT A;  2ZTG A;  4G84 A;  1GBQ A;  1RAH B;  3OYE A;  4P71 C;  4N4I A;  1BKB A;  1SES A;  5CKB A;  1VIE A;  2COY A;  2KT1 A;  2NUP B;  4A53 A;  5GMK j;  1YJN A;  2VXE A;  2QDY B;  2D0N A;  5KCO A;  4BE0 A;  2RQU A;  2BIV A;  1B7Y A;  4DEX A;  3EH1 A;  3QUI A;  1X2G A;  1VQO T;  2QG9 B;  2OTJ T;  2EL9 A;  2K57 A;  4RCB A;  2OAW A;  2X4W A;  4P3N A;  5HK3 A;  2NUP A;  1Y07 A;  2QHV A;  1O75 A;  2HKN A;  3LX7 A;  3P8H A;  2E5A A;  2FZG B;  1S72 Q;  4QT7 A;  5GAN 4;  1M2O A;  2AKL A;  3RGL A;  1WJS A;  1KD1 U;  3X24 B;  3TEH A;  3QO5 A;  3OQ5 A;  3UF4 A;  2HQX A;  2KYM A;  3MET A;  5GAN 6;  2PVO B;  1XTD A;  2DVJ A;  3UA7 A;  2DEQ A;  4PLI A;  4PHC A;  3M0T A;  1NPP A;  2OJ2 A;  1E1O A;  3LLR A;  1M9S A;  2X35 A;  2JMC A;  2MYS A;  4QVC A;  3URG A;  3CMA T;  3HXX A;  1UG1 A;  2CT3 A;  3OYF A;  1M3A A;  4EMG A;  2GGR A;  3KFU A;  3UT1 A;  3H0F A;  2XGT A;  2DK3 A;  3REU A;  1HSQ A;  2I4N A;  3NEN A;  4AFZ C;  1BI0 A;  1GRI A;  2FHD A;  4XTU A;  2DYB A;  2E12 A;  2MMP A;  3V8L A;  3CC2 A;  2CJA A;  5GAM j;  4AG2 C;  4NCX A;  2RJF A;  4E47 A;  2RHY A;  2ZPE B;  2KSS A;  3HRT A;  1X75 C;  1YHQ A;  4BI4 A;  2X4X A;  2FPD A;  5KYU B;  1ARK A;  4HWT A;  4A4K A;  2EGC A;  2ART A;  3NEL A;  2RF0 A;  2DO3 A;  4IIM A;  3ME9 A;  2ZT8 A;  3PMI A;  4TTV A;  4M77 C;  5LJ3 e;  1KQS P;  5IH2 A;  1P92 A;  4PJL A;  3RR6 A;  2KBT A;  1UB4 A;  2P0P A;  1EVK A;  3ER0 A;  2A37 A;  3QSU A;  1WYX A;  1KQS S;  5A0G A;  2RI3 A;  4C92 E;  1H64 1;  1I81 A;  2EAY A;  4RTT A;  2DBM A;  4O5V A;  4HT9 A;  5LJ3 d;  2NLU A;  3HP9 A;  2KI7 A;  2ECZ A;  1KK7 A;  1M3B A;  2K9G A;  1E1T A;  4EMK A;  4XU0 A;  2SEM A;  8AT1 B;  4KGX B;  3BW1 A;  1QQJ A;  2E6Z A;  1G5V A;  1YJ9 Q;  3QXE B;  5LJ5 h;  3OY9 A;  4XEM A;  3RKY A;  3C4S A;  2QXF A;  5LL6 S;  4E7I A;  2HDA A;  5GMK e;  3EAE A;  3HXV A;  4WF2 A;  1VQ9 A;  4M75 C;  5LJ5 j;  3PVL A;  4C0D B;  4RDX A;  2HQE A;  1KD1 R;  1UHC A;  3HY1 A;  2RM4 A;  1ZSG A;  4FL6 A;  4O2D A;  5I2M A;  4M78 A;  2M1H A;  2QEX A;  4BUG A;  1LNX A;  2QQA A;  3JCM c;  4PJM A;  1ZHI A;  3JCM e;  2L3S A;  1CKB A;  1OU9 A;  4E2F B;  2M0O A;  5CKD A;  4J7I A;  2BTT A;  2JNG A;  3FEO A;  1BIA A;  2E5K A;  3EG0 A;  2O4X B;  2ZCE A;  2EFI A;  4YRK A;  1Z9Q A;  2F5K A;  3FIF A;  3JCM d;  2RPN A;  1B34 A;  1VQK T;  1SER A;  3L2V A;  3C95 A;  4C8Q C;  1G5I A;  4JRK A;  1FMK A;  1B3Q A;  1PM3 A;  2E3H A;  2JT4 A;  2LX9 A;  2YSQ A;  1K76 A;  3HFO A;  2O4X A;  4KUL A;  3A8M B;  1H4Q A;  3UWN A;  4XAX B;  1VQP T;  6AT1 B;  5KE3 A;  5GAN f;  1SHG A;  3P8D A;  5GAM e;  5GAO l;  2ZR2 A;  2CZ1 B;  4LDY A;  1ABO A;  4EPC A;  4QVZ A;  4UP8 A;  3GIB A;  1PCX A;  2CP3 A;  3TU4 K;  2LQN A;  1VQM Q;  4TWA A;  3KUF A;  1VQN A;  1OUL A;  2DTO A;  2F69 A;  3OBY A;  3CCM T;  5AT1 B;  3OW2 P;  1X2H A;  5GAM d;  3A7U A;  2ZXF A;  3RAC A;  4P5N A;  1NEB A;  1IO6 A;  2QQS A;  3UGQ A;  3E19 A;  2QDL A;  2X3X D;  4P75 C;  4P3P A;  1Q86 U;  3M0P A;  2QGF B;  3OW2 S;  2E5Q A;  2A28 A;  2AZS A;  3G7Z A;  3A74 A;  1NJ6 A;  3A1P A;  3EFR A;  3CCR A;  2F1L A;  2P0L A;  3IKM B;  2K2V A;  4JUV A;  1R77 A;  3M58 A;  1R0B G;  5ECA A;  1ASZ A;  2KAF A;  2Y90 A;  3REX A;  4FW2 A;  2GQI A;  2DYI A;  3CCS T;  2EKO A;  2BZY A;  1ZLM A;  4LUD A;  5J3B A;  3ZFJ A;  3OD1 A;  1JBM A;  1RAC B;  3VV0 A;  2DA9 A;  3EFO B;  3ULR B;  4NL3 A;  4M78 G;  2KXD A;  4PG3 A;  1H3Z A;  4Z89 A;  1Z7N A;  3QDR B;  2LT1 A;  4N4H A;  2AKW A;  4RUG A;  1KFZ A;  2RQT A;  1I4K 1;  2HSP A;  4E7H A;  3L2U A;  2RK1 A;  3C12 A;  3DSQ A;  3EFO A;  2DQ3 A;  3FJ5 A;  1RUW A;  4KUI A;  1TWB A;  4MML A;  4BD3 A;  2LX7 A;  1OEB A;  3CCS Q;  2CH4 A;  4A4E A;  1WQW A;  4J6X A;  2CS7 A;  3CCE T;  4D6W A;  1M1K R;  3CPF A;  3P8Y A;  4O6J A;  1VOM A;  1UJY A;  5DLO A;  5FRM A;  5LJ5 e;  2D6F A;  2QA4 A;  4LDV A;  4HXJ A;  1TXQ A;  2LRQ A;  2C0O A;  3VUZ A;  1W2B P;  3X20 B;  1AZE A;  2VGM A;  2ZZE A;  1T3L A;  2CSQ A;  4ZN3 A;  2AMC B;  2L3Q A;  5LJ5 d;  3JRZ A;  4X9C A;  2CJ9 A;  1W2B S;  2BZ8 A;  2WSC E;  2DZC A;  2M02 A;  1SEM A;  1YI2 Q;  1K73 C;  4ELZ C;  4EDU A;  2RJC A;  4M7A D;  1Q81 U;  4E51 A;  3VUB A;  4A4H A;  1UUE A;  4GLM A;  4LVK A;  2AMC A;  5K1X A;  2RHI A;  2KK4 A;  1X6O A;  5K1P A;  1MHN A;  3DLM A;  1VQZ A;  3LSS A;  4A63 B;  1KC8 U;  1SPK A;  1QKW A;  1WHL A;  5C52 B;  1YIJ A;  3OYA A;  2VB6 A;  4RQE A;  4QQ6 A;  1QLY A;  1D0X A;  1ADJ A;  1L0W A;  2ZNI A;  3GNG A;  2LC4 A;  2KY9 A;  4BW9 A;  1TUC A;  1ZUK A;  5J26 A;  4ANJ A;  1VIF A;  4RTY A;  3J81 E;  4TVA B;  1GFC A;  1MMG A;  3QWY A;  2DXB A;  5E3I A;  3IAL A;  1SG5 A;  1BBU A;  3IKL A;  1X56 A;  3JB9 I;  1D1B A;  1Q86 R;  5HCK A;  4OML A;  2L3P A;  1M1K C;  1IRE B;  4F16 A;  3M5A A;  3UAT A;  1JJ2 A;  1VQL A;  5A0L A;  1B70 B;  5D6W A;  2PTK A;  3RER A;  3RKW A;  4F14 A;  2YWW A;  3EHQ A;  2XDD A;  1WX6 A;  4M7A F;  3A98 A;  1MNE A;  4E6R A;  3MHX A;  2DVE A;  1EIF A;  2COW A;  3JCM W;  2R58 A;  3CPW S;  2K2M A;  5C53 B;  1PKT A;  1B70 A;  4BE1 A;  4K87 A;  5LJ3 g;  1LVK A;  1E7O A;  1IGU A;  4J7F A;  2DX1 A;  3CC2 Q;  5KCH A;  5GAO m;  4YTL A;  3TCJ A;  2Q5H A;  2DRM A;  1M90 U;  1VA7 A;  4M78 C;  4Q5W A;  2BUD A;  4FM4 B;  5HGQ A;  1N27 A;  4OB3 B;  1Q82 U;  4BAC A;  2XIC A;  4E7Z A;  4C0D C;  3MEW A;  2I4L A;  2DU5 A;  1YHQ Q;  4DOW A;  2EQJ A;  3V7S A;  2YLC A;  3EG9 B;  1VQ6 A;  2CDT A;  2JS0 A;  3OYI A;  4YRI A;  4Y92 A;  2ESW A;  2QQB A;  1Y96 B;  2LP5 A;  1IHV A;  2FPF A;  4ATO A;  3NGP A;  1K4U S;  2CP5 A;  1GBR A;  3EG9 A;  2ZZG A;  4KH0 B;  1HK9 A;  5IHK A;  2ZR3 A;  3CEY A;  1QWE A;  1UGQ B;  2DIG A;  3M4P A;  4YRN A;  2LDM A;  1Y96 A;  4H2Y A;  2D0Q B;  3MCA B;  1ZBJ A;  4JLI A;  5J39 A;  4G85 A;  1Q81 R;  1H4V B;  5C6S A;  2CUD A;  4Y91 A;  2DXU A;  5CVI A;  5KYY B;  3OS2 A;  4OGE A;  2DIQ A;  2CRE A;  4HVU A;  3JSC A;  1QVF P;  2PME A;  2K6D A;  3VS5 A;  1X54 A;  1X01 A;  2F2W A;  1VQ7 T;  4P74 A;  2EKH A;  2I0N A;  5GAN 2;  4YRG A;  4E7K A;  5ELO A;  1QVF S;  3NTI A;  2ZPG B;  5KYY A;  2EJF A;  3M4G A;  3JCM g;  3V7C A;  1NYQ A;  1VQ4 A;  2I4M A;  1VQ9 Q;  3CC4 A;  4YRT A;  3JB9 D;  5A0D A;  3OA6 A;  2LJ0 A;  1VQ8 A;  4H2T A;  5GJW B;  5GAN 5;  4B6M A;  2JTM A;  4C0Z A;  2ROT A;  4OP0 A;  3NHN A;  1IXD A;  3CCJ T;  1UGS B;  1EFN A;  5L8R E;  4J5Y A;  1Y57 A;  3MPU B;  3G6E A;  2HAX A;  1OPL A;  1ASY A;  2ATC B;  2QEX Q;  5DY9 A;  4F7U B;  4FSS A;  2HNI A;  2X51 A;  4PJO D;  1D3B B;  3RMQ A;  3PNW C;  2FZC B;  2KMT A;  2DAQ A;  4UPA A;  4X1V A;  2PU9 B;  3VQX A;  1H92 A;  2L2P A;  4HKE A;  1WZO A;  4HCC A;  2CP0 A;  5GAM g;  2V8I A;  2DRK A;  2XU8 A;  3EGX B;  5FU6 C;  1YIT A;  4M7D D;  4PJO B;  4F7U A;  1LCK A;  3QYG B;  1RAI B;  2DZ9 A;  2MWO A;  1U1T A;  4C8Q A;  3I56 A;  1VQN T;  3DKM A;  1M90 R;  1WJQ A;  4M77 G;  2QK0 A;  4M7D B;  1G8X A;  1NJI U;  3CBP A;  1NNH A;  4JPB W;  3JB9 F;  1IZ6 A;  1ZSZ B;  1N9W A;  2FO0 A;  1DJ7 B;  4GY5 A;  4RTW A;  1RL2 A;  2FVU A;  2EQU A;  4J15 A;  4F17 A;  3CME A;  1AWX A;  4F7U F;  1K9M U;  3A32 A;  2DLP A;  3HTZ A;  2LQK A;  5GMK h;  2AIR B;  3CCR T;  4PK4 A;  4ZGD B;  3PE0 A;  4OF1 A;  2L0A A;  1HD3 A;  4N4G A;  5KYX A;  1ZSZ A;  2HD0 A;  1M27 C;  2MI6 A;  3BDL A;  2QAZ A;  1VQN Q;  1Z7M A;  2DQ0 A;  3A8L B;  4DQ2 A;  1S72 T;  3DB3 A;  2RH2 A;  1UTI A;  4RKU E;  1G3T A;  4PJO F;  1RAD B;  2QHS A;  4ZTZ B;  2C7I A;  4J83 A;  4P75 A;  2CP6 A;  2EWN A;  4PFO A;  3LWI A;  1PNJ A;  2O2O A;  3SEM A;  1FX7 A;  4LVI A;  3HXZ A;  4M7D F;  3QO8 A;  1PSE A;  2HCK A;  4M75 G;  3CCR Q;  2H3E B;  1BB9 A;  3JCM h;  1AOJ A;  3HRS A;  4YRE A;  4JZ3 A;  2OAU A;  3CCU A;  1PKS A;  5LJ5 g;  3VRZ A;  1ABQ A;  2ZT7 A;  1BK2 A;  1MMD A;  4K11 A;  4F04 B;  2B8A A;  2QA4 T;  2ZIN A;  3VS1 A;  1PRM C;  3HHT B;  3QHS A;  1QVG S;  1UJ0 A;  2MPX C;  3CCQ A;  2AT1 B;  1PWT A;  1EQR A;  3J80 E;  2J7I A;  3TRE A;  5GMK l;  2W10 A;  3O5Z A;  2K5I A;  1X6G A;  4J9B A;  1TS9 A;  2G6F X;  2YXY A;  3I55 A;  2XTI A;  4PNO A;  3S6W A;  3E9H A;  3WQZ A;  1R8O B;  5GAN h;  5GAM h;  2QA4 Q;  2DL3 A;  1UGR B;  4MMK A;  4CC2 A;  1PSF A;  4R0K A;  4C8Q G;  3QZ9 B;  5GAO n;  4H2V A;  3MP6 A;  4JRI A;  4OMP A;  2XDB A;  4M4Z A;  4RTU A;  5C0M A;  5GAN j;  2YUP A;  2YUO A;  3RMS A;  2YUQ A;  1M8V A;  4ZIB A;  2PVG B;  4JRP A;  3V8J A;  1NLP C;  1AWO A;  2V1Q A;  2QQR A;  4RTX A;  2ZPH B;  1H4T A;  5FWB A;  5CKF A;  1NZ9 A;  2LQW A;  4J9C A;  3TVT A;  4R56 A;  1N8R U;  1Q95 G;  2V8J A;  1U06 A;  1KMM A;  1PHT A;  4HCZ A;  4FCY A;  4BWA A;  3CXC P;  1YJ9 T;  1IHW A;  2JMA A;  3JB9 J;  3A5Z B;  2DE0 X;  4J9I A;  2LCL A;  5KYU A;  3PVQ A;  1SSH A;  2RD1 A;  1K9M R;  2AK5 A;  2KQW A;  3CXC S;  3L2W A;  3JCM b;  1TSF A;  2G3R A;  5I22 A;  1UDL A;  3M0Q A;  4H2S A;  1PC0 A;  4GLK A;  4IUP A;  3G4S T;  4KGV B;  4C92 D;  4VUB A;  2CZ7 B;  5IN1 A;  4AMC A;  5LJ3 f;  3MJX A;  3A5Z A;  5GMK i;  2NS6 A;  4K88 A;  4HVW A;  3CCL A;  2VYT A;  2RB6 A;  3JCM Q;  1BCM A;  3PMT A;  1JJC B;  4P73 A;  1KSW A;  3S3M A;  1X43 A;  4MZT A;  3HRU A;  2L5Q A;  4P74 C;  1WIE A;  1KMN A;  1VQL Q;  1BBW A;  1M2V B;  3F70 A;  1OI1 A;  2AHJ B;  1D1C A;  3NPF A;  3G4S Q;  3QZ5 B;  1JJC A;  3R6O A;  5IXB A;  2OTL A;  2CUB A;  2BKD N;  4HVC A;  2C8M A;  4M78 E;  2LVM A;  3HRI A;  1LYL A;  4CS2 A;  1JXM A;  1QE0 A;  3HPW A;  1M2V A;  2DFU A;  4E7J A;  3REB B;  5I21 A;  1FWZ A;  1ADY A;  2M51 A;  3PGG A;  3GF5 A;  4JJN K;  1FMW A;  1YCS B;  1V29 B;  3M59 A;  4LN2 A;  4C92 F;  3TSW A;  1VQ5 A;  1NEG A;  5M9O A;  1VQ6 Q;  4LDW A;  1YJW A;  3L42 A;  4XTX A;  2GTO A;  4TVW A;  2RI5 A;  1TG0 A;  1WGS A;  4A4G A;  4A4F A;  3M4Y A;  3HSB A;  4QKU A;  2VXF A;  2IG0 A;  1WLE A;  4P72 A;  1LJO A;  1VQM T;  5FU7 B;  1OQK A;  1I5O B;  1Q7Y U;  2JJ9 A;  1XJW B;  1QKX A;  4AT1 B;  2HBP A;  3NEM A;  2IY5 B;  4PL6 A;  2MK5 A;  3FRN A;  3QII A;  4GBQ A;  4PJO C;  2CGH A;  4X9D A;  1N9S A;  4YRQ A;  9ATC B;  2J6K A;  3FB9 A;  5D7U A;  1USY A;  3NTH A;  3A8G B;  5GAN e;  1U3O A;  2FB7 A;  3EG2 A;  1V1C A;  4M7D C;  2IY5 A;  2R57 A;  5GMK m;  4JJD A;  2V8K A;  1H8K A;  2E1H A;  3S3N A;  2KGT A;  1ZSZ C;  2JTF A;  3G6E T;  1LOJ A;  3QG1 A;  4J9G A;  2ED1 A;  1KD1 C;  3VS4 A;  4OMO A;  5A2Q E;  5GAN d;  1VQ4 Q;  4RCC A;  2M9U A;  4C5I A;  4YPF A;  2FG0 A;  3CC4 Q;  2YDL A;  3CBO A;  4HCB A;  2NUZ A;  4Y28 E;  3UDC A;  1D09 B;  1VQ8 Q;  1OYX A;  1GL5 A;  3P8B B;  3BJU A;  4X5O A;  4AH6 A;  1VYT A;  1I07 A;  2PUK B;  2J05 A;  3L2Z A;  4J9H A;  2LZ6 B;  2LCC A;  1YIT T;  4PKC C; 
#chains in the Genus database with same CATH homology
 3UGT A;  4BE2 A;  3BFM A;  4MDX A;  2ZPI B;  4MDW A;  1ZQ1 A;  5GAO r;  5C51 B;  3NET A;  5D6X A;  1BI2 A;  1EVL A;  1YFT A;  2E65 A;  2ZPF B;  3PCO B;  2ALY B;  3QTC A;  4OLF A;  4TVR A;  1KQS A;  4ZTU B;  1YI2 T;  1M4Z A;  4QQG A;  4YRJ A;  3VQY A;  1SSF A;  2QI2 A;  3PCO A;  2ALY A;  1VQO A;  3LGF A;  2OTJ A;  3HFZ B;  2WSF E;  1YJN T;  3G1Z A;  3VJP A;  3C94 A;  3HKS A;  5CKH A;  3X28 B;  5CCA A;  2EIF A;  5CKE A;  3MEY A;  12AS A;  3JCM X;  2DDZ A;  2E3C A;  3L4G B;  2MWP A;  4CH4 A;  3CCU T;  4XQ3 A;  4NS5 A;  4ZTJ A;  2JUF A;  3QO7 A;  3QO3 A;  1IL2 A;  2GQV A;  2K3Y A;  1JRI A;  3QNE A;  1X55 A;  4LVM A;  5CR2 A;  4L59 A;  4M7A B;  1ZBX A;  4XTV A;  5CO7 A;  3CMA A;  1NJ8 A;  1SRY A;  1WU7 A;  2RHZ A;  1K8A U;  3FDR A;  4WI1 A;  4M7A A;  3GNF B;  2RHX A;  4H02 A;  3OYH A;  3OS0 A;  4P73 C;  1KOG A;  4RG2 A;  3CC2 T;  4JRQ A;  2RHS B;  2Q7G A;  4TVA A;  3L1A A;  2P4T A;  1YHQ T;  3J7A F;  2EQK A;  4HT8 A;  2R5M A;  3VBB A;  1ATI A;  2RHS A;  3TEG A;  2ZCF B;  4Q6G A;  2A8E A;  3HFV A;  3NFC A;  1OZ3 A;  5DM7 R;  3CD6 A;  5IT9 E;  4R55 A;  4ZGE B;  4JS5 A;  5CQX A;  3ZEH A;  1G51 A;  3LWH A;  3M4Q A;  4M77 E;  3L2R A;  3PZC A;  2L8D A;  3OW2 A;  3OYD A;  3FC3 A;  2GFU A;  2DD5 A;  3TUP A;  1M5Q 1;  4ZTF A;  2GCX A;  3MEA A;  2QQ9 A;  4YDQ A;  3T9N A;  3MF1 A;  4P72 C;  3CCV A;  1NJ2 A;  1Q86 C;  1I8F A;  3P8T A;  1UGP B;  1VQ9 T;  3LYI A;  3KBG A;  2ODR D;  4H2X B;  4KUD K;  3VYG A;  5HKC A;  2JVV A;  1H4S A;  2ZZD A;  1USY C;  5FU7 C;  4M7A G;  2ZT5 A;  2M16 A;  2DD4 A;  4M75 E;  2P0K A;  4H2X A;  1YGB A;  2E41 A;  1C0A A;  2QEX T;  4UP9 A;  4WJ3 M;  1WJR A;  2JZ2 A;  1YCY A;  1YJW T;  2XDP A;  4C5H A;  4HWO A;  3SWN B;  4BDZ A;  2DXC A;  1VQK A;  1W2B A;  2PQW A;  3EFS A;  2RJD A;  1I5L A;  4FU6 A;  4B9X A;  3G71 A;  1WYD A;  3VU3 C;  3SWN A;  1VQP A;  3PTA A;  2XID A;  3KXT A;  4E7L A;  5KH6 A;  2JOY A;  4OB0 B;  3ICA A;  4C8Q E;  3LGL A;  4LD9 K;  5GAN g;  2X4Y A;  3PFS A;  3CCM A;  1Q81 C;  1EFW A;  4XU2 A;  4KT0 E;  1D3B A;  3BDU A;  4L6V 5;  3L2Q A;  2Q7H A;  4NL2 A;  4PJO A;  5GAO q;  1XNI A;  3DLL A;  1KC8 C;  4DA4 A;  4JLG A;  5LJ3 j;  4Q15 A;  4LVL A;  5GAN 8;  3X26 B;  4M7D A;  2X4J A;  2MF2 A;  2RJE A;  5FRN A;  4OGC A;  3QYH B;  2RI2 A;  2ARU A;  3CPW A;  3W3S A;  3OB9 A;  2KVQ G;  3OS1 A;  2Q7E A;  4EMH A;  1B7Y B;  2EYQ A;  2ZNJ A;  3CCE A;  4QVD A;  1W66 A;  1U8R A;  4LVJ A;  4XU1 A;  1WQ7 A;  3V7R A;  4M7A C;  5CIU A;  4CH6 A;  2E6N A;  4FT2 A;  5DLQ E;  3OYG A;  1M90 C;  5KNN A;  3SFM A;  3TEH B;  1Q82 C;  3P8V A;  2J3M A;  4H2U A;  3N5B B;  3JB9 G;  4C5E A;  4F7U G;  3M53 A;  3V8K A;  4L5G A;  3MQZ A;  4J6W A;  3A8O B;  4ZGJ B;  2XD0 A;  4PJO G;  1FYF A;  1WPY A;  1QVF A;  1YIJ T;  1Y7X A;  2GF7 A;  1NYR A;  2QHU A;  2LNV A;  3RUX A;  2ZIM A;  4YRP A;  2XI9 A;  2LQ8 A;  3OYB A;  4M7D G;  4N0A A;  3RF1 A;  1M1F A;  4CS4 A;  3A31 A;  1RIQ A;  1NJ5 A;  5KE2 A;  2CZ0 B;  4KR3 A;  1W4S A;  1VQL T;  4FSX A;  1B76 A;  4EX5 A;  4V2S A;  4IUT A;  4C0G A;  2CJB A;  3PT9 A;  1YFS A;  3HRK A;  4YRS A;  2DJZ A;  1GGM A;  1KHC A;  1G3W A;  4H2W A;  3LH0 A;  4EMK B;  4J8O A;  4OB2 B;  4BDY A;  2RA2 A;  1EIY B;  3CD6 T;  4C92 B;  3A5Y A;  2XK0 A;  3UPU A;  1PYS B;  3TEE A;  2YRV A;  2CKK A;  1K73 U;  1O9S A;  3MEV A;  1EIY A;  1VQ6 T;  2XG8 D;  4C92 A;  4IUR A;  4HWR A;  2ODR C;  2A7Y A;  3INZ A;  4ZN1 A;  1PYS A;  4M78 D;  2ZT6 A;  2DU7 A;  2A3L A;  5EG2 A;  4LDU A;  1NJI C;  1SET A;  3CCV T;  3GOX A;  4M78 B;  3GLX A;  3SWN C;  2I2L A;  2VUB A;  4BY6 B;  2E64 A;  1K9M C;  4YYE A;  2EJG A;  3SB2 A;  5CK9 A;  4C5G A;  2E70 A;  1VQ7 A;  1M1K U;  1HC7 A;  1VUB A;  3M56 A;  4X34 A;  1M1G A;  3JCM f;  1G3S A;  2DTI A;  4DOV A;  1B34 B;  3JCM P;  3I7F A;  4IKF A;  1KHI A;  1VQ4 T;  1QVG A;  3CC4 T;  2RHQ B;  2L89 A;  3CBM A;  2P0Q A;  1VQ8 T;  3MF2 A;  3OMC A;  4M78 F;  3M55 A;  3CCJ A;  3QJ6 A;  3QBY A;  1JJ2 S;  4L87 A;  2L3R A;  2RHQ A;  11AS A;  3HY0 A;  3G71 T;  2RO0 A;  3O8V A;  5IAY A;  5GAN 7;  3A7R A;  4K86 A;  2FYK A;  5GAM f;  4HWS A;  3GPL A;  4UC4 A;  3GP8 A;  3SD4 A;  3CC7 A;  3DB4 A;  5I2S A;  2ZPB B;  3X25 B;  2PMF A;  3UFG A;  3RES A;  1YB3 A;  4XTZ A;  4CRI A;  3MP8 A;  4C92 G;  3H8Z A;  3MEU A;  3I56 T;  3M54 A;  5ELN A;  4MZM A;  3QKJ A;  4DPG A;  1TH7 A;  3A8H B;  5GAO p;  3OYC A;  3E9I A;  3MO8 A;  2RK2 A;  3H6Z A;  2CIM A;  4KR2 A;  4KQE A;  3CME T;  3CXC A;  2AKW B;  5FU6 B;  4NOY A;  4RQF A;  1S72 A;  4B9W A;  4CS3 A;  1N8R C;  2ZIO A;  3MP1 A;  1QVP A;  3ZBD A;  5F5W A;  4TQF A;  1QP2 A;  1J5W A;  3OBW A;  5GAN 3;  3S3O A;  1OZ2 A;  3E9F A;  5CQY A;  2O01 E;  1QW1 A;  4ME7 A;  2XHC A;  4IUV A;  4XTW A;  3WVE B;  1E22 A;  5LJ5 f;  3HXU A;  3HFZ A;  3OSV A;  3OMG A;  4JS4 A;  3Q1J A;  4YCW A;  4WJ4 A;  4N0A C;  1B8A A;  2ARS A;  3RL6 A;  1HXD A;  2QHT A;  4YRF A;  1HTT A;  1G3Y A;  3L4G A;  3FLG A;  3CCQ T;  4RMO A;  4HA8 A;  4YRC A;  4M7A E;  4P71 A;  2LT4 A;  2E10 A;  3A7A A;  3E9G A;  4TQD A;  4YCV A;  4UP7 A;  3RIR A;  2VC8 A;  4HWP A;  2ZGW A;  3JCM V;  3I55 T;  3OYJ A;  3OSS C;  4YRR A;  4OB1 B;  2WSE E;  4YRO A;  2H3J A;  2CZ6 B;  2Y4X A;  3R07 A;  3LC0 A;  1KQ2 A;  4RG8 A;  2JN0 A;  1QF6 A;  3M9Q A;  1Y71 A;  1XQH A;  3AHU A;  1XOV A;  4A54 A;  4HT4 A;  2GFA A;  4LNS A;  3JB9 H;  4YP0 A;  5AYF A;  3LSQ A;  2CYZ B;  2PUO B;  3WVD B;  3ASK A;  3FJP A;  4EMK C;  2EJ9 A;  3JAM E;  2WAC A;  3OYM A;  2EQM A;  2XKO C;  4C92 C;  1YJ9 A;  3VKI A;  2F5T X;  3QJY A;  3HL8 A;  2Y4Y A;  5HY6 A;  4OMF B;  4C0F A;  1Q7Y C;  3HXY A;  3G4S A;  3HFN A;  4XU3 A;  4BB7 A;  3VQV A;  4CH5 A;  4FIB A;  1N6A A;  3E1S A;  4XTY A;  3M57 A;  3VYH B;  5HK0 A;  1GXI E;  4YCU A;  4M77 D;  3CCL T;  1N9R A;  4KBM B;  4BI3 A;  4ELY C;  2DTH A;  4M77 B;  1FXX A;  1YFR A;  1UEB A;  2RHU A;  4BY6 C;  2I4O A;  3HXW A;  2YHT A;  1KQ1 A;  2D9T A;  2OTL T;  4M77 A;  5FRO A;  3UH0 A;  3SDZ A;  3BY7 A;  4II1 A;  4IUQ A;  2FL7 A;  4XEO A;  2C06 A;  4M75 D;  3CMQ A;  3OYL A;  1MGQ A;  1YBY A;  4MZP A;  1VQ5 T;  4M77 F;  2G4C A;  2IVW A;  2K5F A;  1AHJ B;  4XK8 E;  2K4Y A;  4M75 B;  2QTX A;  2DXT A;  1WNL A;  4RMF A;  1VQM A;  2K5L A;  3QPH A;  4JDS A;  4PLL A;  5FLX E;  4Z02 A;  3VQW A;  4M75 A;  2KDS A;  3OYY A;  1NJ1 A;  3IG2 A;  4P3O A;  4F7U E;  1BIB A;  4CI0 C;  2P5I A;  3ERR A;  2DKG A;  4C8Q D;  3OS5 A;  4CH3 A;  4TVY A;  4LD6 A;  4PJO E;  4YRM A;  4M75 F;  1NE8 A;  4QW2 A;  5LJ3 h;  2Q5I A;  4EO4 A;  3NTK A;  1G5H A;  4C8Q B;  1BYM A;  1BI3 A;  1QP3 A;  1U1S A;  2DPP B;  1BI1 A;  2PVD B;  3PIO A;  4LDX A;  4M7D E;  3JCM J;  3CC7 T;  2K3X A;  1K8A C;  1RI0 A;  2LTO A;  2R5A A;  3OYK A;  4J6Y A;  3CCS A;  3LW5 E;  1EOV A;  3OYN A;  1KG1 A;  4FT4 A;  4IUU A;  2ZZF A;  1E24 A;  2J3L A;  3RKX A;  5CAI A;  1NPR A;  4YRL A;  3WXM B;  2MAM A;  4BI8 B;  4OVA A;  2VV5 A;  1JB0 E;  2VGN A;  2YLB A;  4QQD A;  3PIP A;  1YI2 A;  4C8Q F;  5D6Y A;  2ZTG A;  4G84 A;  3OYE A;  4P71 C;  4N4I A;  1BKB A;  1SES A;  5CKB A;  1VIE A;  4A53 A;  5GMK j;  1YJN A;  2VXE A;  2QDY B;  4BE0 A;  5KCO A;  1B7Y A;  2BIV A;  3QUI A;  1X2G A;  1VQO T;  2OTJ T;  2EL9 A;  2K57 A;  4RCB A;  2X4W A;  4P3N A;  5HK3 A;  1Y07 A;  2QHV A;  1O75 A;  3LX7 A;  3P8H A;  2E5A A;  5GAN 4;  3RGL A;  1WJS A;  1KD1 U;  3X24 B;  3TEH A;  3QO5 A;  3OQ5 A;  2HQX A;  3MET A;  5GAN 6;  2PVO B;  1XTD A;  2DEQ A;  4PLI A;  4PHC A;  1NPP A;  1E1O A;  3LLR A;  1M9S A;  2X35 A;  4QVC A;  3URG A;  3CMA T;  3HXX A;  3OYF A;  4EMG A;  3KFU A;  3UT1 A;  2XGT A;  2DK3 A;  3REU A;  2I4N A;  3NEN A;  1BI0 A;  2FHD A;  4XTU A;  2E12 A;  2MMP A;  3V8L A;  3CC2 A;  2CJA A;  5GAM j;  4NCX A;  2RJF A;  4E47 A;  2RHY A;  2ZPE B;  2KSS A;  3HRT A;  1X75 C;  1YHQ A;  4BI4 A;  2X4X A;  4HWT A;  4A4K A;  2ART A;  3NEL A;  2DO3 A;  3ME9 A;  2ZT8 A;  3PMI A;  4TTV A;  4M77 C;  5LJ3 e;  1P92 A;  2P0P A;  1UB4 A;  1EVK A;  3ER0 A;  3QSU A;  1KQS S;  5A0G A;  2RI3 A;  4C92 E;  1H64 1;  1I81 A;  2EAY A;  4O5V A;  4HT9 A;  5LJ3 d;  2NLU A;  3HP9 A;  1E1T A;  4EMK A;  4XU0 A;  3BW1 A;  2E6Z A;  1G5V A;  3QXE B;  5LJ5 h;  3OY9 A;  4XEM A;  3RKY A;  3C4S A;  2QXF A;  5LL6 S;  4E7I A;  5GMK e;  3EAE A;  3HXV A;  4WF2 A;  1VQ9 A;  4M75 C;  5LJ5 j;  4C0D B;  4RDX A;  2HQE A;  3HY1 A;  2RM4 A;  4FL6 A;  4O2D A;  5I2M A;  4M78 A;  2M1H A;  2QEX A;  4BUG A;  1LNX A;  2QQA A;  3JCM c;  1ZHI A;  3JCM e;  2M0O A;  5CKD A;  4J7I A;  2JNG A;  3FEO A;  1BIA A;  2O4X B;  2ZCE A;  2EFI A;  4YRK A;  2F5K A;  3FIF A;  3JCM d;  1B34 A;  1VQK T;  1SER A;  3L2V A;  3C95 A;  4C8Q C;  1G5I A;  4JRK A;  2LX9 A;  3HFO A;  2O4X A;  4KUL A;  3A8M B;  1H4Q A;  3UWN A;  4XAX B;  1VQP T;  5KE3 A;  5GAN f;  3P8D A;  5GAM e;  5GAO l;  2ZR2 A;  2CZ1 B;  4LDY A;  4EPC A;  4QVZ A;  4UP8 A;  3GIB A;  3TU4 K;  4TWA A;  3KUF A;  1VQN A;  2DTO A;  2F69 A;  3CCM T;  3OBY A;  1X2H A;  5GAM d;  3A7U A;  2ZXF A;  3RAC A;  4P5N A;  2QQS A;  3UGQ A;  3E19 A;  4P75 C;  4P3P A;  1Q86 U;  3OW2 S;  2E5Q A;  3G7Z A;  3A74 A;  1NJ6 A;  3EFR A;  3CCR A;  2P0L A;  3IKM B;  2K2V A;  4JUV A;  3M58 A;  1ASZ A;  2KAF A;  2Y90 A;  3REX A;  3CCS T;  2EKO A;  5J3B A;  3ZFJ A;  3OD1 A;  1JBM A;  3VV0 A;  4NL3 A;  4PG3 A;  4M78 G;  1H3Z A;  1Z7N A;  3QDR B;  2LT1 A;  4N4H A;  2AKW A;  4E7H A;  1I4K 1;  3L2U A;  2RK1 A;  3C12 A;  3DSQ A;  2DQ3 A;  4KUI A;  4MML A;  4BD3 A;  4A4E A;  1WQW A;  4J6X A;  2CS7 A;  3CCE T;  4D6W A;  3CPF A;  3P8Y A;  4O6J A;  5DLO A;  5FRM A;  5LJ5 e;  2D6F A;  2QA4 A;  4LDV A;  2LRQ A;  3VUZ A;  3X20 B;  2VGM A;  2ZZE A;  4ZN3 A;  2AMC B;  5LJ5 d;  3JRZ A;  4X9C A;  2CJ9 A;  1W2B S;  2WSC E;  2DZC A;  1K73 C;  4ELZ C;  4EDU A;  2RJC A;  4M7A D;  1Q81 U;  4E51 A;  3VUB A;  4A4H A;  4LVK A;  2AMC A;  5K1X A;  2RHI A;  2KK4 A;  1X6O A;  5K1P A;  1MHN A;  3DLM A;  1VQZ A;  3LSS A;  1KC8 U;  5C52 B;  1YIJ A;  3OYA A;  4RQE A;  4QQ6 A;  1ADJ A;  1L0W A;  2ZNI A;  3GNG A;  2LC4 A;  2KY9 A;  4BW9 A;  5J26 A;  1VIF A;  3J81 E;  4TVA B;  2DXB A;  5E3I A;  3IAL A;  1BBU A;  3IKL A;  1X56 A;  3JB9 I;  1M1K C;  1IRE B;  3M5A A;  1JJ2 A;  1VQL A;  5A0L A;  1B70 B;  5D6W A;  3RER A;  3RKW A;  2XDD A;  4M7A F;  3MHX A;  2DVE A;  1EIF A;  3JCM W;  2R58 A;  3CPW S;  5C53 B;  1B70 A;  4BE1 A;  4K87 A;  5LJ3 g;  4J7F A;  5KCH A;  5GAO m;  4YTL A;  3TCJ A;  2Q5H A;  1M90 U;  4M78 C;  4Q5W A;  2BUD A;  4FM4 B;  5HGQ A;  1N27 A;  4OB3 B;  1Q82 U;  4BAC A;  2XIC A;  2I4L A;  4C0D C;  3MEW A;  2DU5 A;  4DOW A;  2EQJ A;  3V7S A;  2YLC A;  1VQ6 A;  3OYI A;  4YRI A;  2QQB A;  1Y96 B;  4ATO A;  2ZZG A;  1HK9 A;  2ZR3 A;  3CEY A;  1UGQ B;  2DIG A;  3M4P A;  4YRN A;  2LDM A;  1Y96 A;  4H2Y A;  2D0Q B;  3MCA B;  4JLI A;  5J39 A;  4G85 A;  1H4V B;  5C6S A;  4Y91 A;  2DXU A;  5CVI A;  3OS2 A;  4OGE A;  2DIQ A;  3JSC A;  2PME A;  1X54 A;  1X01 A;  1VQ7 T;  4P74 A;  5GAN 2;  4YRG A;  4E7K A;  5ELO A;  1QVF S;  3NTI A;  2ZPG B;  2EJF A;  3M4G A;  3JCM g;  3V7C A;  1NYQ A;  1VQ4 A;  2I4M A;  3CC4 A;  4YRT A;  3JB9 D;  5A0D A;  3OA6 A;  1VQ8 A;  4H2T A;  5GAN 5;  2JTM A;  4C0Z A;  4OP0 A;  3CCJ T;  1UGS B;  5L8R E;  4J5Y A;  3G6E A;  2HAX A;  1ASY A;  5DY9 A;  4F7U B;  4PJO D;  2HNI A;  1D3B B;  3RMQ A;  3PNW C;  2KMT A;  2DAQ A;  4UPA A;  2PU9 B;  3VQX A;  4HKE A;  4HCC A;  5GAM g;  2V8I A;  2XU8 A;  5FU6 C;  1YIT A;  4M7D D;  4PJO B;  4F7U A;  3QYG B;  2DZ9 A;  2MWO A;  1U1T A;  4C8Q A;  3I56 A;  1VQN T;  3DKM A;  1WJQ A;  4M77 G;  4M7D B;  1NJI U;  3CBP A;  1NNH A;  3JB9 F;  1IZ6 A;  1N9W A;  1DJ7 B;  4GY5 A;  1RL2 A;  2FVU A;  2EQU A;  4J15 A;  3CME A;  1K9M U;  4F7U F;  3A32 A;  3HTZ A;  2LQK A;  5GMK h;  3CCR T;  4ZGD B;  4OF1 A;  4N4G A;  2MI6 A;  2HD0 A;  3BDL A;  1Z7M A;  2DQ0 A;  3A8L B;  4DQ2 A;  1S72 T;  3DB3 A;  2RH2 A;  4RKU E;  1G3T A;  4PJO F;  2QHS A;  4ZTZ B;  2C7I A;  4J83 A;  4P75 A;  2EWN A;  3LWI A;  1FX7 A;  4LVI A;  3HXZ A;  4M7D F;  3QO8 A;  1PSE A;  4M75 G;  3JCM h;  3HRS A;  4YRE A;  2OAU A;  3CCU A;  5LJ5 g;  2ZT7 A;  2B8A A;  2QA4 T;  2ZIN A;  3HHT B;  3QHS A;  1QVG S;  3CCQ A;  1EQR A;  3J80 E;  3TRE A;  5GMK l;  2K5I A;  3I55 A;  2XTI A;  4PNO A;  3S6W A;  3E9H A;  3WQZ A;  1R8O B;  5GAN h;  5GAM h;  1UGR B;  4MMK A;  1PSF A;  4C8Q G;  3QZ9 B;  5GAO n;  4H2V A;  3MP6 A;  4JRI A;  2XDB A;  5C0M A;  5GAN j;  3RMS A;  1M8V A;  4ZIB A;  2PVG B;  4JRP A;  3V8J A;  2QQR A;  2ZPH B;  1H4T A;  5CKF A;  1NZ9 A;  4R56 A;  1N8R U;  2V8J A;  1KMM A;  4HCZ A;  4BWA A;  1YJ9 T;  3JB9 J;  3A5Z B;  2LCL A;  2RD1 A;  2KQW A;  3CXC S;  3L2W A;  3JCM b;  2G3R A;  4H2S A;  4GLK A;  4IUP A;  3G4S T;  4C92 D;  4VUB A;  2CZ7 B;  5IN1 A;  5LJ3 f;  3A5Z A;  4K88 A;  5GMK i;  2NS6 A;  3CCL A;  2VYT A;  2RB6 A;  3JCM Q;  3PMT A;  1JJC B;  4P73 A;  3S3M A;  4MZT A;  3HRU A;  2L5Q A;  4P74 C;  1KMN A;  1BBW A;  3F70 A;  1OI1 A;  2AHJ B;  3QZ5 B;  1JJC A;  3R6O A;  2OTL A;  2BKD N;  4HVC A;  2C8M A;  4M78 E;  2LVM A;  3HRI A;  1LYL A;  4CS2 A;  1QE0 A;  3HPW A;  4E7J A;  5I21 A;  1FWZ A;  1ADY A;  3PGG A;  3GF5 A;  4JJN K;  1V29 B;  3M59 A;  4C92 F;  1VQ5 A;  5M9O A;  4LDW A;  1YJW A;  3L42 A;  4XTX A;  4TVW A;  2RI5 A;  1WGS A;  4A4G A;  4A4F A;  3M4Y A;  3HSB A;  2VXF A;  2IG0 A;  1WLE A;  4P72 A;  1LJO A;  1VQM T;  5FU7 B;  1Q7Y U;  2HBP A;  3NEM A;  2IY5 B;  4PL6 A;  3FRN A;  3QII A;  4PJO C;  2CGH A;  4X9D A;  1N9S A;  4YRQ A;  3FB9 A;  1USY A;  3NTH A;  3A8G B;  5GAN e;  2FB7 A;  4M7D C;  2IY5 A;  2R57 A;  5GMK m;  2V8K A;  2E1H A;  3S3N A;  3G6E T;  2JTF A;  1LOJ A;  3QG1 A;  1KD1 C;  5A2Q E;  5GAN d;  4RCC A;  2M9U A;  4C5I A;  4YPF A;  3CBO A;  4HCB A;  4Y28 E;  3UDC A;  4X5O A;  1OYX A;  3P8B B;  3BJU A;  4AH6 A;  2PUK B;  1YIT T;  3L2Z A;  2LCC A;  4PKC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...