2EJFA

Crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
total genus 65
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ejfA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ejfA01
3JCMd 1H4QA 2ZNIA 1BBWA 1EFWA 4YRQA 4YRTA 3JB9I 1JJCA 3JCMg 4TVYA 4PNOA 4EMKC 2I4LA 5GAN5 3MF2A 5GAN7 5LJ3f 3P8YA 4C8QA 4RCCA 1Z7MA 4NOYA 3QO5A 3HXZA 4EMGA 3RUXA 3PCOB 4WI1A 4XEOA 1QE0A 4QVCA 4RMFA 5GAMd 4TQFA 1QF6A 1KQ1A 4HWTA 3JCMW 4YDQA 3PGGA 4M78A 4JUVA 4M77E 2E41A 3PCOA 5HGQA 3PZCA 4M77F 4F7UF 2I4OA 4XU2A 3G1ZA 2DQ0A 4C8QF 3RESA 2AMCA 2AKWA 4YRGA 3NEMA 3BFMA 3JB9J 2DKGA 4UP9A 3TEGA 4PJOF 3NELA 4MMKA 3JB9F 2RHSB 5LJ5d 4DPGA 2QTXA 3V7RA 2QHVA 4UPAA 4RCBA 1E22A 2DDZA 4C92F 2YLCA 4YRJA 1YCYA 1TH7A 3QO3A 1Y96B 3HFZA 1MGQA 5GAMh 4YPFA 1ASYA 2DU5A 4JRIA 1HK9A 5GANg 1X01A 4M7AF 2QHTA 3HXWA 3V7SA 4HT9A 2ZT7A 4M7DG 3LSQA 4P71A 4M7AE 1NNHA 1SERA 4XTYA 5GAMe 1YFSA 1SETA 1Z7NA 2E64A 3IG2A 5GAOn 1B70A 4EX5A 2IY5A 5GMKm 2Q7GA 1PYSA 3W3SA 1N9SA 2J3LA 3BDUA 2ZTGA 4M7DB 5GAN2 5LJ3j 4YRLA 4M75A 5GAOm 4HWPA 3FJPA 3UGTA 3M4QA 3RGLA 3IALA 4YP0A 4EMKB 1X56A 5GAMj 4YRFA 3RKXA 3UGQA 1WQWA 4P3OA 2EWNA 3A5YA 4HT8A 3IKMB 2EJFA 4M77A 3JCMf 2AKWB 3BJUA 1IL2A 5LJ3e 2CIMA 2CJBA 4CS3A 3UFGA 2E65A 4XU1A 4YRSA 5GAN8 1EIYA 2XTIA 4WJ3M 1LOJA 2EJGA 4J15A 1RIQA 2FB7A 4C8QG 2DXUA 4N0AC 1EQRA 5LJ3h 3A32A 4M75D 1KMNA 3VQWA 1EOVA 2E1HA 1B7YA 4EMKA 5GMKj 4P74C 1JRIA 1X55A 4C92D 4M77C 3JCMJ 3L1AA 4M7AB 3A7RA 4TVWA 4N0AA 2Q7EA 4AH6A 2DZ9A 2ZR3A 3QO7A 4J5YA 4PJOD 1H4SA 3P8TA 4P75A 2I4NA 4L87A 3A5ZA 4M77D 4YCVA 2Y90A 1G5IA 4XU3A 4PJOG 2ALYA 3FB9A 4M7AG 1D3BB 1L0WA 1USYC 1NJ6A 4C92G 4CH5A 5C53B 4ZTZB 1B76A 4V2SA 3RL6A 4X5OA 1Y96A 5LJ3d 4CH6A 3A7AA 3HRIA 5GANj 3HXVA 2JN0A 4F7UE 4HWOA 3JCMP 1N9RA 4PHCA 2EL9A 1B7YB 4YCWA 2P0LA 4C92B 5F5WA 1E1OA 5LJ3g 3QSUA 1SRYA 4XTVA 3SWNA 3JB9H 1YGBA 3RF1A 3VU3C 3R07A 5LJ5h 5LJ5g 1E24A 1EVLA 3V8JA 4YRCA 5CAIA 2VC8A 4YCUA 1H4TA 2DJZA 3OD1A 4K86A 3HXXA 4Y91A 1BBUA 4XQ3A 2ZZFA 4F7UG 5GMKi 3RIRA 1GGMA 2CJAA 3CMQA 1USYA 4M78F 2PMFA 3VQYA 3JB9G 4M7AC 4H2WA 4O2DA 3NETA 4M7DF 3QUIA 4M7DD 4CS2A 1WPYA 5K1XA 4H2YA 4RQFA 3HFVA 5GMKe 2RHQB 2ARSA 4H2UA 4NL3A 4M78D 2EJ9A 5GAOp 5DY9A 3HFOA 4M75B 4K87A 2PMEA 2DEQA 3V7CA 2EAYA 5I21A 3LC0A 1I81A 4P75C 4UP7A 1BIBA 3TUPA 1KMMA 3LSSA 2IY5B 2DXTA 1LYLA 4XU0A 5GANd 1ADJA 1ATIA 2CGHA 4KQEA 1D3BA 4TQDA 2ALYB 2E5AA 4QVDA 1M8VA 1LNXA 1NJ2A 2RHQA 4WF2A 3JCMh 1FYFA 4H2XA 5GAOr 2RHSA 4JRKA 3RERA 3EFRA 1X2GA 5GAMg 3HFZB 4PJOB 4J6XA 4PG3A 5C52B 3TEHB 4M7AA 2DTOA 4P74A 4KR3A 1NYRA 4P3NA 3JCMX 4G84A 5C51B 2ARTA 4EO4A 4Q6GA 4Q15A 1H641 1NJ5A 4P71C 2ZXFA 4CS4A 4HA8A 2J3MA 3M4GA 1HTTA 2AMCB 3JCMQ 4X9DA 4A53A 4C8QE 1EIYB 5GAOl 2ODRC 5K1PA 4NL2A 3JCMb 1WNLA 2K57A 5ELNA 4UP8A 2QHSA 3ICAA 2ZINA 1M5Q1 4XEMA 4M75C 4M78G 2I2LA 4J6WA 4M7DC 2Q7HA 2ODRD 1U1SA 2ZZGA 4RQEA 3JCMc 1BIAA 5LJ5e 3EFSA 2E10A 4P73C 1W66A 4P72A 5GANe 3HSBA 2YLBA 3HY1A 4M7DA 2Q5HA 2QHUA 5GANf 4M75F 2VXEA 3L4GB 3BY7A 4EMHA 4M75E 2DZCA 4H2XB 1SESA 3E9IA 4X9CA 2ZT8A 4H2SA 1H4VB 3V8LA 2FYKA 1WYDA 4ZIBA 2RD1A 3QNEA 2CJ9A 4ZTUB 4P72C 4YROA 2G4CA 4YRIA 3A74A 3KFUA 3ERRA 1YFRA 11ASA 1X2HA 1I4K1 2I4MA 4CH4A 1NYQA 4MMLA 4XTZA 4WJ4A 4XTUA 4M78E 3VQXA 3RKYA 3DSQA 4TVAA 4M7DE 4YRKA 2VXFA 4H2TA 3QHSA 3A7UA 2DTIA 4XTXA 5GAN3 5GAN6 4G85A 1NJ8A 1WU7A 4OLFA 3REXA 3FIFA 5GAOq 4M7AD 5LJ5f 1E1TA 1NJ1A 1YFTA 2ZNJA 4P3PA 4M78B 4M77G 2C7IA 4NCXA 1WQ7A 12ASA 4PJOC 3VQVA 4J6YA 4XTWA 2ZR2A 3HXYA 2DVEA 2Q5IA 4HVCA 4TTVA 5ELOA 4BW9A 4DQ2A 4H2VA 5KNNA 3JCMV 4C8QC 4PJOA 3RACA 4JLIA 5GMKl 3JB9D 3SWNB 3V8KA 2ZIOA 2HNIA 5GAN4 4C92A 2RB6A 4C8QD 4OP0A 4YRPA 3IKLA 1KOGA 2ZT6A 3REUA 1I8FA 1JBMA 2C8MA 3P8VA 1KQ2A 1EVKA 3QO8A 5GMKh 1C0AA 2P5IA 2XGTA 1LJOA 2DTHA 5LJ5j 1B34A 4PJOE 3HTZA 5GANh 5E3IA 3L2ZA 5GAMf 3HXUA 4HWSA 3NENA 3MF1A 4KR2A 4YRNA 3INZA 3SWNC 1ADYA 4C92E 1J5WA 3HY0A 4TWAA 4LNSA 3E9HA 3HRKA 3AHUA 4F7UA 1ASZA 4HWRA 3A31A 3M4PA 1HXDA 2E3CA 4K88A 3UH0A 4E51A 1YB3A 2RA2A 3I7FA 3HFNA 1I5LA 4F7UB 4C92C 3QTCA 4TVAB 2ZGWA 4BWAA 4YRMA 3RKWA 1G5HA 2DQ3A 3VBBA 4RDXA 1VQZA 2ZT5A 2ZCEA 4A54A 1G51A 3TEHA 2DU7A 4C8QB 4M77B 1HC7A 3SB2A 4P73A 1N9WA 3BW1A 2ARUA 4YREA 1X54A 4YYEA 1B34B 1B70B 1JJCB 2RM4A 4YRRA 3GIBA 4H02A 2ZIMA 1U1TA 4CH3A 4M78C 4M75G 2ZZEA 2YHTA 3JCMe 1WLEA 3WQZA 3MEYA 1B8AA 3L4GA 1PYSB
chains in the Genus database with same CATH superfamily
3CCMA 1UGRB 4BDYA 2EQUA 2YDLA 2W0ZA 2ZNIA 5I2MA 2DXBA 2HSEB 1TTHB 5KCOA 3E1SA 4BB7A 2MPXC 3JCMg 1JJCA 4TVYA 1PM3A 3RNJA 4EMKC 1G3SA 4FSSA 4YTLA 3DLMA 5LJ3f 3TSZA 3MO8A 3QO5A 1KJWA 1VQ4A 4EMGA 1TUDA 2X4WA 4E7IA 1AVZC 2V1RA 4RMFA 5GAMd 1KQ1A 1T0JA 3LW5E 4M78A 2ZPEB 2IVWA 3QKJA 4M77E 1Q86C 2QXFA 5I2SA 1VQPA 2D8JA 4PLLA 5HGQA 4M4ZA 4M77F 2I4OA 1TU0B 4C8QF 4KH1B 2HSPA 3JSCA 3H8ZA 1EFNA 3NEMA 3RR6A 4Z02A 3G6ET 1ZHIA 4EIKA 4OGCA 3V7RA 4YRJA 5D6XA 1YHQA 1TH7A 3O5ZA 1Y96B 4CC2A 2DF6A 4F16A 3OYIA 1D0ZA 4YPFA 2DU5A 1NEGA 2FL7A 1BI1A 4ZGEB 2KRSA 4M7AF 2QHTA 1U3OA 4OF1A 3I55Q 2V26A 3LSQA 5IXFA 4M7AE 1SERA 4WJ3M 4AFSC 1YFSA 2RHUA 3CXCA 1HYOA 5GAOn 3A8MB 2CP3A 5KYUA 5IHNA 1H8KA 3W3SA 1WJQA 1MMDA 4HVUA 2LX9A 2CP5A 3VYHB 4M7DB 5GAN2 2QGGA 5GAOm 3UGTA 2LMJA 3FJPA 3M4QA 4WTOB 2KSSA 1W1FA 1EX4A 4EMKB 1X56A 2DRKA 2MWOA 3LX7A 3OYBA 2Y4YA 4P3OA 2HAXA 1N8RR 2NUPB 4HT8A 2HEQA 3H9NA 3CMAA 2DL5A 2CIMA 2M16A 4CS3A 1UTIA 2H3EB 1VQ7T 1WYXA 4OMMA 2XTIA 1I0CA 2RQWA 2FB7A 3CCLT 4MDXA 1KD1U 3A8OB 5LJ3h 4BDZA 3CD6Q 1EQRA 1KMNA 2MCNA 4A63B 5GMKj 1O75A 1VQKT 1X55A 3OW2A 1QWEA 3JCMJ 3A7RA 2CS7A 5D6WA 2OX7A 2ECZA 4HKEA 4JLGA 3CPWA 4LVLA 1BI2A 3QO7A 4J5YA 3EH1A 3PNWC 1X43A 3CC2T 1VYTA 1UGQB 2J06A 2B8AA 2JS2A 3A5ZA 5IN1A 3M9QA 3UA7A 4YCVA 2DL8A 2FPFA 2YUQA 3RMQA 1QW1A 1NJ6A 1E6HA 3Q1JA 3MP6A 5C53B 4ZTZB 3QZ5B 4OMNA 2IIMA 2NUTB 3MCAB 2CP0A 1M3BA 4F7UE 4LVKA 1N9RA 2YWWA 1BB9A 1AOJA 4LUEA 1KC8R 2K6DA 4YCWA 2EKOA 5LJ3g 2DILA 1M1KC 3QSUA 3SWNA 3JB9H 1JXOA 2FEIA 5L8RE 2QQSA 2GFUA 1EVLA 3V8JA 1M1FA 2DPPB 2SEMA 1KC8C 2AKKA 3JAME 1AD5A 1Z9QA 2KR3A 1QKXA 3VS5A 2VC8A 4LUDA 1UECA 4YCUA 1VQ4Q 2DJZA 3SHWA 1VQNA 1A0NB 4Y91A 4XQ3A 1WHMA 1GGMA 3VUZA 1BU1A 2AIRB 2PQWA 4X34A 4AT1B 3UA6A 1KC8U 5CR2A 3CEYA 3M0RA 4M7AC 4D6WA 3CCJA 4HCBA 2EYZA 3QUIA 4RTYA 4M7DD 2K7AA 4H2YA 3HFVA 2RHQB 2ARSA 1VQOQ 3VS2A 1MNDA 2DEQA 3V7CA 3TU4K 2OTJQ 2FZKB 1XOVA 1T3SA 1NM7A 4OB1B 2I0NA 1BIBA 1Q95G 1XQHA 3TUPA 2K2MA 4LN2A 1KD1R 2DXTA 5GANd 1ADJA 2CGHA 4TQDA 4PFPA 4QVDA 4E7HA 1LNXA 1IO6A 3OS0A 2RHQA 4HT4A 1FYFA 1WJSA 1V1CA 2HL5C 3C0CA 5GAOr 1G3TA 2RHSA 3PMTA 4BI8B 1JB0E 1Y71A 2YT6A 2DTOA 1R0CB 4C5GA 3FRNA 1QCNA 4JPBW 4G84A 1RAEB 2JTMA 4DOVA 4E7JA 3TVTA 3CCRQ 1H641 4LNPA 2E12A 3I55T 1R8OB 2CT4A 3MHXA 3M0UA 4CS4A 4IIOA 5C6SA 1M27C 2FPDA 1HTTA 2AMCB 5HKCA 4X9DA 4BUGA 5KCHA 3X20B 4NL2A 3H0FA 2K57A 2L5QA 5ELNA 2RNAA 1M5Q1 3NTHA 2I2LA 3GLXA 4J6WA 2OTLT 3FLGA 2GQVA 5AYFA 3EFSA 3G1JA 2E10A 5FROA 4P73C 2DFUA 4RG2A 2F1LA 1M1GA 4BY6B 1C1AA 2EQJA 1TWBA 5D6YA 4KBMB 3EGXB 3I5SA 1K9MU 4EMHA 4M75E 4MZMA 5KE2A 2BUDA 1SESA 1G5VA 3E9IA 4CC3A 1VQ6T 2FYKA 1WYDA 5A2QE 3LYIA 3SDZA 4ATOA 4ZIBA 3OYYA 2KYMA 5L23A 2HBWA 3EHQA 2JTFA 2E3IA 2G4CA 4YRIA 4KGVB 3CCQQ 11ASA 1X2HA 4LVIA 3EG2A 3M55A 1NYQA 1XTDA 2PUKB 3QG1A 1Y57A 3OSSC 3RKYA 1OU8A 3DSQA 4M7DE 4YRKA 3VYGA 4KGZB 4XAXB 5KYNA 4IUUA 3IQLA 2FVUA 4G85A 5FW9A 3UPUA 2JTEA 1WU7A 3NFCA 2HQXA 1YFTA 1VQ7Q 3ULRB 4BD3A 1K4US 4NCXA 3HRUA 3J80E 4J6YA 2OJ2A 2QK0A 2E6NA 2M0OA 4HVCA 2A28A 3JCMV 2DYIA 1WFWA 4C8QC 3OMCA 1ZSZB 4PJOA 4JLIA 2QG9B 1OQKA 2RJCA 4J9BA 2ZIOA 3I56Q 2J7IA 3OYLA 4C92A 2YUPA 3OYGA 3HP9A 4B9XA 4ZTJA 2EGAA 1NE8A 5FLXE 1YITT 1QQJA 3PE0A 3CCJQ 3OSVA 3OB9A 4E7KA 1MV3A 1YJNT 4KGXB 4XK8E 2XGTA 5E3IA 3L2ZA 3NENA 4LDYA 3MF1A 1VQLT 4LD6A 3KXTA 1PRLC 4OGEA 2RO0A 3QDFA 3ZEHA 3M54A 3QJ6A 4HWRA 2KRMA 2DETA 2OAWA 2LC4A 2QAZA 1NLPC 3OBWA 4K88A 3MP1A 3FJ5A 3CXCP 3ER0A 3OYFA 2X4JA 4F7UB 5CKFA 3QTCA 1OYXA 2H3JA 2ZGWA 4C0FA 4RDXA 4A54A 3OYHA 1G51A 1ZUKA 2RN8A 3SB2A 5KYUB 1B34B 1B70B 2PU9B 1UGVA 3NTIA 4YRRA 1K73U 3PVQA 4H02A 1VQ7A 1WDXA 2DNUA 4KULA 3M58A 2M0YA 2AT1B 1AEYA 1OV3A 1TOVA 3JCMd 3GBQA 3GPLA 1KSWA 3CCVT 1BBWA 2EQIA 1ZSZC 3NTKA 3FEOA 2L3SA 2OTLQ 4YRTA 3JB9I 2D1XA 1BK2A 2A8EA 5FU7C 1UJYA 5GAN5 1PG5B 4JJNK 5HK3A 2KROA 4OMPA 5I11A 2DIQA 2M02A 4C8QA 4NOYA 4JZ3A 1KK7A 3RUXA 2JT4A 3TEEA 4WI1A 4XEOA 1QE0A 4QVCA 3NMZC 3VS0A 3M0TA 1QF6A 4HWTA 4KUDK 2K3BA 2O9VA 2EPDA 2LP5A 1YJ9A 1W6XA 2E41A 2ABLA 3QBYA 3C4SA 3OQ5A 2DQ0A 3RESA 3NHNA 3EFOA 1WI7A 5IHKA 3BFMA 1Q86R 1N27A 9ATCB 5LJ5d 2O2OA 2EYYA 2X9HA 5HY6A 1E22A 4E7SA 4AG1C 2RPNA 2YLCA 3EGUA 3HPWA 2B86A 1RAGB 4FW1A 1VOMA 3HFZA 2F69A 4RKUE 1ASYA 1HK9A 2V8KA 2CP6A 2ATCB 3HXWA 1VQMA 2ZT7A 2K3YA 4ELZC 1RAAB 2D0NA 4P71A 1NNHA 2VUBA 3BE3A 1Z7NA 2JUFA 1B70A 2IY5A 2Q7GA 3E9FA 5GJWB 5FWCA 1N9SA 2J3LA 1ZUUA 4P5NA 3PIPA 1MMNA 1G83A 5LJ3j 4YRLA 3LWHA 3CCUQ 1UGSB 3RGLA 3IALA 1WHKA 5GAMj 4YRFA 1E7OA 3LWIA 4DBFA 2EWNA 4BI4A 3I56A 3A5YA 1QVGP 1OI1A 4LDVA 3JCMf 4CC7A 2COWA 1K8AR 1R77A 3M0SA 2CJBA 1E6GA 4YRSA 2GCXA 5GAN8 3CC7T 4ZTFA 5IT9E 4JZ4A 3MEVA 3TSWA 4EDUA 1EOVA 2E1HA 1B7YA 4EMKA 2AZSA 4MDWA 1NYFA 4BE0A 4N0AA 2Q7EA 4AH6A 2DZ9A 2ZR3A 2BKDN 2GQIA 4TVRA 4QW2A 4RTXA 3EGDB 3VJPA 1H4SA 3TCJA 4P75A 2MK5A 1NBEB 2JM9A 2I4NA 1MHNA 3P8HA 2HCKA 2Y90A 1YIJA 4PKCC 4FCYA 3TREA 2ALYA 1SSFA 2G3RA 1USYC 4LVJA 4AMCA 1VQ9A 2E4HA 4C92G 4HVWA 4CH5A 2HZYA 4AFQC 1TG0A 4X5OA 4BE1A 4CH6A 3HRIA 3LGFA 1YITA 1K9AA 1X6OA 3JCMP 3G6EQ 2EYXA 2EL9A 2DL4A 2P0LA 1X75C 2X3XD 1YJNA 2L8DA 2L89A 2C06A 4XTVA 1K76A 1VYUA 4J9HA 4C5IA 2HMAA 2KT8A 5LJ5g 3CCEQ 1IXDA 4EPCA 1KG1A 2A36A 1I1JA 4PL6A 1ZSGA 2MYSA 1WXUA 4Y92A 4K86A 2JZ2A 2ZZFA 2RQUA 1VYVA 2MOXA 3CMQA 2QQRA 1HD3A 2EVRA 2K5FA 4C5HA 2KDSA 2D0QB 4M7DF 4HCZA 4CS2A 1NEBA 1Q82U 2PTKA 1WPYA 4RQFA 2ZZDA 1UDLA 5CIUA 2O31A 4H2UA 2DIGA 4PFOA 2WSFE 1JJ2P 1CKAA 2NYSA 4QQDA 1M1KU 4K87A 2ED0A 3ASKA 2ZPIB 3DB3A 3NGPA 2XICA 2EAYA 2GNCA 2JVVA 3OS5A 8ATCB 2WSCE 1I81A 4UP7A 2XHCA 1KMMA 3LSSA 2IY5B 3PTAA 2DL3A 1LYLA 1Q7YU 2KXDA 2MMPA 2ALYB 1G3WA 2X35A 2JOYA 3ZBDA 1YJ9T 3CD6T 1M8VA 2HDAA 1NJ2A 2ZPHB 4F04B 5C0MA 3JCMh 4H2XA 3EG9A 3H0HA 1S72T 2DK3A 3THKA 1NYGA 5LL6S 3HFZB 1QP3A 1RABB 2GTOA 5C52B 4M7AA 4JJBA 4KR3A 2LDMA 4P3NA 2R58A 3META 1OU9A 2ARTA 1M4ZA 3GF5A 1Q7YR 2WSEE 4Q15A 4EO4A 1VQ5Q 3TQ7P 4P71C 2F5TX 1SHGA 4HA8A 2OTLA 5IH2A 1LCKA 3JCMQ 1EIYB 3PMIA 5GAOl 1KHCA 4UP8A 4DBQA 1VQOA 2JMAA 3HTRA 2ZINA 4CI0C 2YSQA 4M75C 4M7DC 1PNJA 5CK9A 3JCMc 1BIAA 5LJ5e 1KQSA 4HCKA 4A4KA 3LLRA 5M9OA 3HY1A 1MMAA 5GANf 2RHIA 2LJ1A 3L4GB 5D7UA 3EG9B 4BE2A 4H2XB 3OYKA 1FXXA 4X9CA 4H2SA 3C94A 2CP2A 3V8LA 3FC3A 4A4EA 1MMGA 2NLUA 2RD1A 3SFMA 3QNEA 4P72C 1M3CA 1UG1A 3ERRA 1YFRA 1NJIR 3PIOA 1I4K1 1YIJQ 2I4MA 4CH4A 3CCRA 4GBQA 4WJ4A 4XTUA 2ED1A 4IKFA 2V8IA 3VQXA 1SHFA 5FRNA 1T0HA 1HSQA 2NUZA 3PFSA 1AWXA 3A7UA 1OX8A 3CC4A 2KQWA 1BCMA 1EZZB 4OLFA 4B6MA 3REXA 2K79A 1UHCA 4M7AD 1JU5C 1K9MC 2EKHA 2C7IA 1WQ7A 1OZ2A 1FMWA 4XTWA 2ZR2A 2XD0A 1AHJB 2NS6A 4TTVA 1K8AU 3I35A 2F2WA 2LT1A 1BI3A 2ZCFB 5KNNA 2KXCA 1K1ZA 3RACA 5GMKl 2XMFA 2EBPA 1KFZA 2O4XA 1QVPA 2GFAA 1YCSB 5CVIA 3CCRT 4OP0A 3CCQA 4J83A 3M53A 4YRPA 1RAHB 2VWFA 1PSFA 1KOGA 2FPEA 3CC2A 3REUA 1I8FA 1JBMA 1KQ2A 1VQ6A 4QVZA 1U06A 3QO8A 1FWZA 1Q81R 2P5IA 2ENMA 5LJ5j 2DVJA 1B34A 4JJCA 3L2WA 2KEAA 5KYWB 4ZN1A 5EG2A 3INZA 3LH0A 1M8MA 3SWNC 4C92E 1J5WA 4II1A 1ARKA 4LNSA 2KMTA 2E5QA 2J05A 4RTZA 1Q86U 2K3XA 3HRKA 1ASZA 4QQ6A 1RLPC 3QPHA 1RUWA 5ECAA 2QGFB 4FL6A 4B9WA 1YB3A 3I7FA 2LRQA 3OYCA 1I5LA 1S72Q 2YRVA 4C92C 4FYVB 2EGCA 3L42A 4BWAA 1X2QA 2DQ3A 3VBBA 1VQZA 2CDTA 5CQXA 4P73A 3CC4Q 1BI0A 2LNVA 3BW1A 2ARUA 1X54A 3CCSQ 1D1AA 3HKSA 2RMOA 3OY9A 2IG0A 4ZN3A 4J9GA 3GOXA 3EHRA 2ZIMA 1QLYA 1VQPQ 4M75G 2YHTA 3JCMe 3WQZA 4BI3A 3MEYA 3S3OA 1B8AA 4TVWA 3L4GA 1PYSB 1T3LA 4C0ZA 1RACB 1VQKA 1H4QA 3S6WA 4A4FA 5FU6B 2KGTA 1GCPA 1BYMA 2L2PA 2D9TA 4YRQA 2DX1A 1YJWT 2FHDA 4PNOA 2I4LA 2O01E 4GY5A 5CKHA 3EGXA 5IHIA 4RCCA 1Z7MA 1ZSZA 2RJFA 2XKOC 3ZFJA 1IRXA 1SF9A 4IUPA 1D09B 3X28B 2KVQG 2LCSA 2RJEA 4OMFB 1WHJA 3QYHB 2VASA 3VV0A 3JCMW 4YDQA 2MF2A 1PSEA 3M59A 4JUVA 3AT1B 1RLQC 4DBHA 3G71T 3CCVA 2LX7A 1DJ7B 3PCOA 1AWOA 3G1ZA 1Z9ZA 2H8HA 2AMCA 2AKWA 4YRGA 1Y7XA 1FX7A 2LQWA 2W10A 1GBRA 3TEGA 4PJOF 2XDDA 1OEBA 1IZ6A 4MMKA 2DL7A 4DPGA 5J3BA 2QTXA 3CBPA 3KBGA 1YCYA 3CMEQ 4FIBA 3QO3A 3HRSA 4GLKA 2E3HA 3L2UA 1OX9A 1MNEA 1BCOA 3P8DA 1SRLA 1MGQA 2R5AA 1RAIB 1B3QA 1WXBA 4N4HA 2KT1A 2DEUA 3GP8A 3V7SA 2CP7A 5A0DA 1I07A 5CO7A 4M7DG 2YUNA 4FYXB 4XTYA 2FZCB 5GAMe 3IG2A 2E64A 1YN8A 2LQKA 4EX5A 4BACA 4AFZC 1M2VA 2LCCA 3VUBA 1PYSA 2DXCA 1W2BP 2A0FB 1YIJT 4OMQA 2Y4XA 3BDUA 2ZTGA 4OB2B 2CZ0B 4M75A 3CD6A 5CKBA 1S1NA 4YP0A 2BE9B 2IPOB 1PCXA 4L59A 3RKXA 3LH5A 3OYEA 1WQWA 1YFNA 2ZPGB 4QKUA 3IKMB 2EJFA 4HXJA 2QEXT 2AKWB 3BDLA 3REBB 2CSIA 3UFGA 2E65A 2J6OA 1EIYA 2DYBA 1N8RC 4J15A 3L2QA 1RIQA 1VQ6Q 4DEXA 1O9SA 1WX6A 2DXUA 7AT1B 1PWTA 1M2OA 4ESRA 3A32A 4M75D 3VQWA 2QASA 1QVGS 2JMCA 4P74C 1Y07A 1JRIA 4M77C 3L1AA 2JNGA 4M7AB 3C12A 2NUTA 1WXTA 2KYBA 4N4IA 4RTWA 3ME9A 4L87A 3L2RA 2CKKA 1G5IA 4XU3A 1ZA2B 3FB9A 2QA4Q 1SSHA 4WCIA 2DE0X 1AWJA 4OMLA 4OVAA 4FW2A 2DA9A 4RTVA 3RL6A 3J7AF 2DMOA 1Y96A 1GL5A 1YJWA 3HXVA 1P92A 1M9SA 1X27A 2P4RA 4HWOA 2HKQB 4PHCA 3CC4T 5HK0A 3UATA 1B7YB 3A5ZB 3M5AA 3PVLA 1E1OA 4MZPA 3E2UA 5I22A 3SEMA 3VU3C 1QP2A 5LJ5h 1E24A 2JM8A 1GFCA 4YRCA 3VKIA 2L3RA 2XDBA 2A08A 3QDRB 5CAIA 4O6JA 4ORZA 5EC7A 1NJIC 3HRTA 2XIDA 4FM4B 1D1BA 1H4TA 3HXXA 2CREA 3G71Q 1YP5A 2CJAA 4F14A 2Z0WA 1M90R 3CXCS 2QDYB 4R0KA 4OMOA 3JB9G 4O2DA 3GNGA 1QMCA 5K1XA 2QQAA 3OYMA 2ROTA 5GMKe 3CCST 3A8HB 1M90C 1EIFA 4M78D 2EJ9A 2A3LA 5GAOp 4KUIA 1TUGB 3N5BB 3HFOA 3CCSA 2PMEA 3LC0A 1YITQ 4HVVA 3CPWP 2DM1A 1UFFA 4LE9A 3UF4A 4KT0E 4P75C 2YRCA 1R0BG 4XU0A 3CCVQ 1ATIA 4KQEA 3X25B 3R6OA 2X4XA 3UDCA 2O4XB 1PKSA 2EYWA 3CMET 3EFRA 1Q7YC 1QCOA 5GAMg 2LTOA 3MEAA 3TEHB 5KE3A 1HJDA 1X6BA 4JS4A 3EAEA 1D1CA 1NLOC 1NYRA 2RI5A 3JCMX 4E7LA 5C51B 2X51A 2XDPA 4Q6GA 2BZYA 3MJXA 3QIIA 2ZXFA 2J3MA 2QEXQ 1C0MA 3EG0A 2RK2A 3URGA 2A7YA 2X3WD 2VGNA 4A53A 4J7FA 4C8QE 3M56A 5K1PA 1W2BA 2QHSA 4LDXA 3ICAA 3G7ZA 4XEMA 2LJ3A 4M78G 2Q7HA 1ZBXA 1U1SA 2ODRD 4RQEA 2NWMA 1JQQA 2RJDA 1WA7A 1FMKA 3RBBB 5DLOA 3WXMB 1W66A 1PD0A 2LNHB 5GANe 3HSBA 1H3HA 1ZLMA 2QQ9A 2QHUA 4M75F 4FSXA 1ACMB 4Y28E 3BY7A 4Z88A 4J9DA 2D8HA 2DRMA 2V8JA 3G4SA 1QVFP 1JJ2A 1KIKA 1SG5A 1B07A 3KUFA 4ZTUB 2L0AA 1VQ8T 2K9GA 3DKMA 2JJ9A 3A74A 3KFUA 2QDLA 2JS0A 3J81E 2LT4A 4LDUA 2JXBA 4MMLA 2CH4W 1WIEA 2KE9A 1LVKA 1RAFB 2O9SA 4M78E 2ROLA 1SPKA 4IIMA 4C0DC 4BY6C 2VXFA 1VQPT 1W2BS 2EQMA 2KAFA 2DTIA 5GAN3 1QVGA 5GAN6 2HL3A 2SRCA 3QWYA 1NJ8A 2YUOA 1VQ5A 3F70A 4QQGA 2AK5A 2VKNA 5GAOq 1E1TA 5LJ5f 1NJ1A 4MZTA 2ZNJA 1W4SA 1AT1B 6AT1B 2FG0A 3VQVA 3S3MA 1GFDA 2V1QA 2DLPA 2Q5IA 1D0XA 2F2VA 2RI3A 4BW9A 4DQ2A 4JDSA 2FO0A 2EW3A 3MP8A 2RI2A 4DBRA 8AT1B 3SWNB 5CQYA 3E19A 3V8KA 2AHJB 2HNIA 4LD9K 2F2XA 5KYXB 1D0YA 3OMGA 3G71A 1BKBA 2RHZA 2EFIA 1NPPA 5KYYB 2OTJT 2ZT6A 5CKDA 3DLLA 3OYJA 1VQMT 2C8MA 3P8VA 1NZ9A 1EVKA 2ESWA 4J9IA 3A8LB 5GMKh 1FYNA 2KK4A 4X1VA 2DO3A 2P0KA 4PFZA 3CCEA 2G6FX 2HD0A 3VS3A 1LJOA 1I5OB 4ZGDB 4PLIA 4PJOE 5GAMf 2CYZB 4KR2A 4YRNA 4IUQA 3HY0A 4TWAA 1AZGB 1SKUB 3H6ZA 1NG2A 1OPLA 2KNBB 4F7UA 3A31A 1TXQA 2DD4A 3M4PA 1ZQ1A 1HXDA 3OA6A 1W70A 4FT4A 2DBMA 1UUEA 1JO8A 2MIOA 4N4GA 2HBPA 5KH6A 4E51A 2RA2A 1PD1A 4TVAB 1RI0A 4YRMA 4A4HA 3TEHA 1K0XA 2DU7A 2PVOB 1ABOA 1M2VB 1N9WA 3I5RA 1G8XA 1J3TA 4YREA 4YYEA 2PUOB 2CZ6B 5A0GA 1X69A 2YXYA 1OPKA 3X24B 1U1TA 1WHLA 4M78C 2ZZEA 1NPRA 3HHTB 1WLEA 1QCFA 4CC4B 4FYWB 1EFWA 4K11A 1XNIA 3JV3A 2EYQA 1G2BA 2RHXA 3CPWS 1K0SA 1QWFA 1WJRA 1VQKQ 3MF2A 3UT1A 5GAN7 2L3QA 1ZUYA 2LJ0A 3P8YA 4PJMA 3D7SB 3CCET 3HXZA 1M30A 1B7TA 1YWOA 2P0PA 3PCOB 4DOWA 3CMAQ 4TQFA 3VS6A 4ANJA 1VQ5T 2GBQA 2ZAEA 2E5KA 3PGGA 2RQRA 1U5SA 3OYNA 3CCQT 2P4TA 3PZCA 4F7UF 4XU2A 4ME7A 2K5IA 1RI9A 3LGLA 5GJVB 4C0GA 3JB9J 2DKGA 4UP9A 3MEUA 4DA4A 3NELA 3EH2A 3WVEB 5DM7R 3JB9F 2RHSB 4ELYC 2QHVA 4UPAA 4RCBA 4D8KA 4O5VA 4C92F 2DDZA 2M9UA 1VA7A 2EQKA 3CCMT 2K5LA 4FT2A 5GAMh 4JRIA 2P0QA 4FYYB 2XK0A 5FU7B 1RL2A 4QT7A 5GANg 3O8VA 1UB4A 3I56T 1X01A 1YI2T 1KQSP 4HT9A 4JS5A 2D6FA 4KH0B 1YJ9Q 3OW2S 1SETA 4PK4A 1ABQA 1VQ8Q 3G4SQ 4LVMA 2OAUA 5GMKm 3L2VA 3WVDB 3M0PA 4E2FB 1YBYA 3MPUB 4HWPA 2XU8A 1TUCA 2PVGB 1VQLA 2DERA 2F5KA 3UGQA 1GBQA 1TSFA 4LXCA 4Q5WA 4M77A 2WACA 3EFOB 2EGEA 3OYAA 3BJUA 3PT9A 1IL2A 5LJ3e 2C0IA 4XU1A 1VQMQ 1VQNQ 1Q82R 2R57A 3ZL7C 1LOJA 2EJGA 1M3AA 1ZX6A 1YJNQ 4C8QG 4IUTA 4N0AC 1PKTA 3CCUA 2DAQA 1AWWA 1Q82C 2CT3A 4HCCA 3OYDA 2COYA 1UGPB 4C92D 2JW4A 3QWXX 3U23A 2K4YA 3FDRA 3QYGB 1TS9A 1UHFA 1PRMC 4PJOD 1GXIE 2J6FA 5KYYA 5J39A 3P8TA 2RHYA 2OI3A 4M77D 4PJOG 1GCQC 4M7AG 1KHIA 1D3BB 4R55A 1L0WA 3VS7A 5CKEA 1WGSA 4J9CA 3DB4A 3M4YA 2COZA 1B76A 4V2SA 4R56A 3VS4A 3A8GB 3E9GA 5LJ3d 3A7AA 5GANj 3SD4A 2JN0A 2OTJA 2QA4A 2RK1A 1X2KA 2C0TA 4C92B 5F5WA 3JRZA 2MAMA 2M51A 2PVDB 1SRYA 1YGBA 3RF1A 1UJ0A 2MI6A 3R07A 2LQ8A 1OZ3A 2BZ8A 1MV0B 2KBTA 2PNIA 3OBYA 4JJDA 4L5GA 2KY9A 1M1KR 1PHTA 1AZEA 1K73R 1GCQA 1IGQA 3OD1A 1VUBA 1BBUA 1VIEA 4F7UG 1IREB 5GMKi 3RIRA 2ZPFB 2LVMA 3M0QA 5IXBA 1USYA 4M78F 2PMFA 1VQ9Q 1KQSS 4H2WA 3VQYA 3R6NA 3NETA 2FRWA 1U8RA 1VIFA 1GRIA 3QJYA 4NL3A 3CPFA 4RG8A 3I9QA 3MKDA 4AFUC 1K9MR 3MQZA 5DY9A 4M75B 3S3NA 3CCMQ 5I21A 1IGUA 3MEWA 1M90U 1XJWB 3HL8A 3QXEB 1D3BA 1NJIU 3CCLQ 3VRYA 2E5AA 1QKWA 4RTUA 3KFVA 4WF2A 3G4ST 1X6GA 1N8RU 2LQNA 1KD1C 1CKBA 2R5MA 4JRKA 3RERA 1X2GA 1UEBA 4AG2C 2RQTA 4J6XA 4PJOB 1IHWA 4PG3A 2BTTA 2MWPA 3CCUT 5DLQE 4P74A 1VQ8A 2AKLA 1ZBJA 4A4GA 5FRMA 1JXMA 2L3PA 2VV5A 1JEGA 3A98A 4C5EA 4CRIA 1H92A 1YHQQ 1NJ5A 4L6V5 3VRZA 3UWNA 4J9FA 3M4GA 2QTVA 2CUBA 2VGMA 4E47A 1JJ2S 2CUDA 2ODRC 3CCJT 3JCMb 1WNLA 3CMEA 2A37A 2K2VA 2DBKA 4LDWA 2XG8D 1YNZA 5KYWA 2ZZGA 3GNFB 2HKNA 2ZPBB 2VVKA 4ZGJB 4PJNA 4P72A 1PC0A 1VQLQ 2YLBA 4GLMA 4M7DA 4F17A 2LCLA 2Q5HA 1V29B 2VXEA 2QI2A 1OULA 3CBMA 2BZXA 4DEYA 4UC4A 2DZCA 5IAYA 1YI2Q 3NPFA 2ZT8A 2CSQA 1V76A 1H4VB 1VQ4T 1WLPB 5FU6C 2O88A 2CJ9A 1YJWQ 4YROA 3EGDA 2P84A 4D8DA 3P8BB 4Z8AA 4RUGA 1MUZA 2DD5A 4XTZA 1K73C 4J9EA 4OB3B 4FU6A 3T9NA 3A1PA 2BIVA 4TVAA 1Q81U 2KRNA 1VQOT 3REAB 4Z89A 5CCAA 4VUBA 4H2TA 2AZVA 3QHSA 4XTXA 3EG3A 4JRQA 2RQVA 3CCLA 2M1HA 1QVFS 1LPLA 2QQBA 3FIFA 3I55A 2BE7D 3CC7Q 4P3PA 1CSKA 4M78B 4M77G 5FWBA 12ASA 4PJOC 1WHGA 2FZGB 3HXYA 2DVEA 5ELOA 4ZNXA 4H2VA 1ZA1B 2GF7A 2GTJA 4IUVA 4J8OA 2E6ZA 4E6RA 3JB9D 5J26A 2CZ7B 2QYZA 2GGRA 3CMAT 5GAN4 1WHHA 2RB6A 4C8QD 1SRMA 3H0IA 4NS5A 5A0LA 1OOTA 3IKLA 2VYTA 4PJJA 5KYXA 2QA4T 1IHVA 1Q81C 1FMVA 1BBZA 3H41A 2DJQA 1SEMA 1S72A 4RMOA 1C0AA 3RMSA 3RDVA 2LZ6B 2DTHA 3QZ9B 2VB6A 3HTZA 5GANh 1QVFA 1RADB 3HXUA 4HWSA 4J7IA 4RTTA 1N6AA 1YI2A 1YWPA 1IB8A 2PZ1A 1H3ZA 1ADYA 3G6EA 3CC2Q 3E9HA 4C0DB 3CQTA 3AHUA 2QEXA 1N5ZA 1G3YA 1Y0MA 3EG1A 1YHQT 1F1BB 3CBOA 1C6VX 2HQEA 3X26B 2RF0A 2EIFA 2E3CA 3UH0A 3VS1A 3OS2A 2KI7A 4IURA 3HFNA 2HQHA 4KRTA 2FRYA 1WZOA 3OW2P 3RKWA 1G5HA 2ZT5A 2ZCEA 2YRDA 1VQ9T 4C8QB 3C95A 2CZ1B 4M77B 2J6KA 2E70A 1HC7A 3M57A 4PJLA 2NUPA 1K8AC 4E7ZA 3OS1A 1JJCB 1UE9A 2RH2A 2RM4A 3GIBA 2X4YA 3CC7A 2XI9A 4CH3A 5HCKA 4OB0B 5AT1B 2CH4A 4JRPA 2C0OA 1VQNT
chains in the Genus database with same CATH topology
3CCMA 1UGRB 4BDYA 2EQUA 2ZNIA 5I2MA 2DXBA 5KCOA 3E1SA 4BB7A 1JJCA 4TVYA 3JCMg 4EMKC 1G3SA 4YTLA 3DLMA 5LJ3f 3MO8A 3QO5A 1VQ4A 4EMGA 2X4WA 4E7IA 4RMFA 5GAMd 1KQ1A 3LW5E 4M78A 2ZPEB 2IVWA 3QKJA 4M77E 1Q86C 2QXFA 5I2SA 1VQPA 4PLLA 5HGQA 4M77F 2I4OA 4C8QF 3JSCA 3H8ZA 3NEMA 4Z02A 3G6ET 1ZHIA 4OGCA 3V7RA 4YRJA 5D6XA 1YHQA 1TH7A 1Y96B 3OYIA 4YPFA 2DU5A 2FL7A 1BI1A 4ZGEB 4M7AF 2QHTA 4OF1A 3LSQA 4M7AE 1SERA 4WJ3M 1YFSA 2RHUA 3CXCA 5GAOn 3A8MB 3W3SA 1WJQA 2LX9A 3VYHB 4M7DB 5GAN2 5GAOm 3UGTA 3FJPA 3M4QA 2KSSA 4EMKB 1X56A 2MWOA 3LX7A 3OYBA 2Y4YA 4P3OA 2HAXA 4HT8A 3CMAA 2CIMA 2M16A 4CS3A 1VQ7T 2XTIA 2FB7A 3CCLT 4MDXA 1KD1U 3A8OB 5LJ3h 4BDZA 1EQRA 1KMNA 5GMKj 1O75A 1VQKT 1X55A 3OW2A 3JCMJ 3A7RA 2CS7A 5D6WA 4JLGA 4HKEA 3CPWA 4LVLA 1BI2A 3QO7A 4J5YA 3PNWC 3CC2T 1UGQB 2B8AA 3A5ZA 5IN1A 3M9QA 4YCVA 3RMQA 1QW1A 1NJ6A 3Q1JA 3MP6A 5C53B 4ZTZB 3QZ5B 3MCAB 4F7UE 4LVKA 1N9RA 4YCWA 2EKOA 5LJ3g 1M1KC 3QSUA 3SWNA 3JB9H 5L8RE 2QQSA 2GFUA 1EVLA 3V8JA 1M1FA 2DPPB 1KC8C 3JAME 2VC8A 4YCUA 2DJZA 1VQNA 4Y91A 4XQ3A 1GGMA 3VUZA 2PQWA 4X34A 1KC8U 5CR2A 3CEYA 4M7AC 4D6WA 3CCJA 4HCBA 3QUIA 4M7DD 4H2YA 3HFVA 2RHQB 2ARSA 2DEQA 3V7CA 3TU4K 1XOVA 4OB1B 1BIBA 3TUPA 1XQHA 2DXTA 5GANd 1ADJA 2CGHA 4TQDA 4QVDA 4E7HA 1LNXA 3OS0A 2RHQA 4HT4A 1FYFA 1WJSA 5GAOr 1G3TA 2RHSA 3PMTA 4BI8B 1JB0E 1Y71A 2DTOA 4C5GA 3FRNA 4G84A 2JTMA 4DOVA 4E7JA 1H641 2E12A 3I55T 1R8OB 3MHXA 4CS4A 5C6SA 1HTTA 2AMCB 5HKCA 4X9DA 4BUGA 5KCHA 3X20B 4NL2A 2K57A 2L5QA 5ELNA 1M5Q1 3NTHA 2I2LA 3GLXA 4J6WA 2OTLT 3FLGA 2GQVA 5AYFA 3EFSA 2E10A 5FROA 4P73C 4RG2A 1M1GA 4BY6B 2EQJA 5D6YA 4KBMB 1K9MU 4EMHA 4M75E 4MZMA 5KE2A 2BUDA 1SESA 1G5VA 3E9IA 1VQ6T 2FYKA 1WYDA 5A2QE 3LYIA 3SDZA 4ATOA 4ZIBA 3OYYA 2JTFA 2G4CA 4YRIA 11ASA 1X2HA 4LVIA 3M55A 1NYQA 1XTDA 2PUKB 3QG1A 3OSSC 3RKYA 3DSQA 4M7DE 4YRKA 3VYGA 4XAXB 4IUUA 2FVUA 4G85A 3UPUA 1WU7A 3NFCA 2HQXA 1YFTA 4BD3A 4NCXA 3HRUA 3J80E 4J6YA 2E6NA 2M0OA 4HVCA 3JCMV 4C8QC 3OMCA 4PJOA 4JLIA 2RJCA 2ZIOA 3OYLA 4C92A 3OYGA 3HP9A 4B9XA 4ZTJA 1NE8A 5FLXE 1YITT 3OSVA 3OB9A 4E7KA 1YJNT 4XK8E 2XGTA 5E3IA 3L2ZA 3NENA 4LDYA 3MF1A 1VQLT 4LD6A 3KXTA 4OGEA 2RO0A 3ZEHA 3M54A 3QJ6A 4HWRA 2LC4A 3OBWA 4K88A 3MP1A 3ER0A 3OYFA 2X4JA 4F7UB 5CKFA 3QTCA 1OYXA 2H3JA 2ZGWA 4C0FA 4RDXA 4A54A 3OYHA 1G51A 3SB2A 1B34B 1B70B 2PU9B 3NTIA 4YRRA 1K73U 4H02A 1VQ7A 4KULA 3M58A 3JCMd 3GPLA 3CCVT 1BBWA 3NTKA 3FEOA 4YRTA 3JB9I 2A8EA 5FU7C 5GAN5 4JJNK 5HK3A 2DIQA 4C8QA 4NOYA 3RUXA 3TEEA 4WI1A 4XEOA 1QE0A 4QVCA 1QF6A 4HWTA 4KUDK 1YJ9A 2E41A 3QBYA 3C4SA 3OQ5A 2DQ0A 3RESA 3BFMA 1N27A 5LJ5d 5HY6A 1E22A 2YLCA 3HPWA 3HFZA 2F69A 4RKUE 1ASYA 1HK9A 2V8KA 3HXWA 1VQMA 2ZT7A 2K3YA 4ELZC 4P71A 1NNHA 2VUBA 1Z7NA 2JUFA 1B70A 2IY5A 2Q7GA 3E9FA 1N9SA 2J3LA 4P5NA 3PIPA 5LJ3j 4YRLA 3LWHA 1UGSB 3RGLA 3IALA 5GAMj 4YRFA 3LWIA 2EWNA 4BI4A 3I56A 3A5YA 1OI1A 4LDVA 3JCMf 2CJBA 4YRSA 2GCXA 5GAN8 3CC7T 4ZTFA 5IT9E 3MEVA 4EDUA 1EOVA 2E1HA 1B7YA 4EMKA 4MDWA 4BE0A 4N0AA 2Q7EA 4AH6A 2DZ9A 2ZR3A 2BKDN 4TVRA 4QW2A 3VJPA 1H4SA 3TCJA 4P75A 2I4NA 1MHNA 3P8HA 2Y90A 1YIJA 4PKCC 3TREA 2ALYA 1SSFA 2G3RA 1USYC 4LVJA 1VQ9A 4C92G 4CH5A 4X5OA 4BE1A 4CH6A 3HRIA 3LGFA 1YITA 1X6OA 3JCMP 2EL9A 2P0LA 1X75C 1YJNA 2L8DA 2L89A 2C06A 4XTVA 4C5IA 5LJ5g 4EPCA 1KG1A 4PL6A 4K86A 2JZ2A 2ZZFA 3CMQA 2QQRA 2K5FA 4C5HA 2KDSA 2D0QB 4M7DF 4HCZA 4CS2A 1Q82U 1WPYA 4RQFA 2ZZDA 5CIUA 4H2UA 2DIGA 2WSFE 4QQDA 1M1KU 4K87A 3ASKA 2ZPIB 3DB3A 2XICA 2EAYA 2JVVA 3OS5A 2WSCE 1I81A 4UP7A 2XHCA 1KMMA 3LSSA 2IY5B 3PTAA 1LYLA 1Q7YU 2MMPA 2ALYB 1G3WA 2X35A 2JOYA 3ZBDA 1YJ9T 3CD6T 1M8VA 1NJ2A 2ZPHB 5C0MA 3JCMh 4H2XA 1S72T 2DK3A 5LL6S 3HFZB 1QP3A 5C52B 4M7AA 4KR3A 2LDMA 4P3NA 2R58A 3META 2ARTA 1M4ZA 3GF5A 4EO4A 2WSEE 4Q15A 4P71C 2F5TX 4HA8A 2OTLA 3JCMQ 1EIYB 3PMIA 5GAOl 1KHCA 4UP8A 1VQOA 2ZINA 4CI0C 4M75C 4M7DC 5CK9A 3JCMc 1BIAA 5LJ5e 1KQSA 4A4KA 3LLRA 5M9OA 3HY1A 5GANf 2RHIA 3L4GB 4BE2A 4H2XB 3OYKA 1FXXA 4X9CA 4H2SA 3C94A 3V8LA 3FC3A 4A4EA 2NLUA 2RD1A 3SFMA 3QNEA 4P72C 3ERRA 1YFRA 3PIOA 1I4K1 2I4MA 4CH4A 3CCRA 4WJ4A 4XTUA 3VQXA 4IKFA 2V8IA 5FRNA 3PFSA 3A7UA 3CC4A 2KQWA 4OLFA 3REXA 4M7AD 1K9MC 2C7IA 1WQ7A 1OZ2A 4XTWA 2ZR2A 2XD0A 1AHJB 2NS6A 4TTVA 1K8AU 2LT1A 1BI3A 2ZCFB 5KNNA 3RACA 5GMKl 2O4XA 1QVPA 2GFAA 5CVIA 3CCRT 4OP0A 3CCQA 4J83A 3M53A 4YRPA 1PSFA 1KOGA 3CC2A 3REUA 1I8FA 1JBMA 1KQ2A 1VQ6A 4QVZA 3QO8A 1FWZA 2P5IA 5LJ5j 1B34A 3L2WA 4ZN1A 5EG2A 3INZA 3LH0A 3SWNC 4C92E 1J5WA 4II1A 4LNSA 2KMTA 2E5QA 1Q86U 2K3XA 3HRKA 1ASZA 4QQ6A 3QPHA 4FL6A 4B9WA 1YB3A 3I7FA 2LRQA 3OYCA 1I5LA 2YRVA 4C92C 3L42A 4BWAA 2DQ3A 3VBBA 1VQZA 5CQXA 4P73A 1BI0A 2LNVA 3BW1A 2ARUA 1X54A 3HKSA 3OY9A 2IG0A 4ZN3A 3GOXA 2ZIMA 4M75G 2YHTA 3JCMe 3WQZA 4BI3A 3MEYA 3S3OA 4TVWA 1B8AA 3L4GA 1PYSB 4C0ZA 1VQKA 1H4QA 3S6WA 4A4FA 5FU6B 1BYMA 2D9TA 4YRQA 1YJWT 2FHDA 4PNOA 2I4LA 2O01E 4GY5A 5CKHA 4RCCA 1Z7MA 2RJFA 2XKOC 3ZFJA 4IUPA 3X28B 2KVQG 2RJEA 4OMFB 3QYHB 3VV0A 3JCMW 4YDQA 2MF2A 1PSEA 3M59A 4JUVA 3G71T 3CCVA 1DJ7B 3PCOA 3G1ZA 2AMCA 2AKWA 4YRGA 1Y7XA 1FX7A 3TEGA 4PJOF 2XDDA 1IZ6A 4MMKA 4DPGA 5J3BA 2QTXA 3CBPA 3KBGA 1YCYA 4FIBA 3QO3A 3HRSA 4GLKA 3L2UA 3P8DA 1MGQA 2R5AA 4N4HA 3GP8A 3V7SA 5A0DA 4M7DG 5CO7A 4XTYA 5GAMe 3IG2A 2E64A 2LQKA 4EX5A 4BACA 3VUBA 2LCCA 1PYSA 2DXCA 1YIJT 2Y4XA 3BDUA 2ZTGA 4OB2B 2CZ0B 4M75A 3CD6A 5CKBA 4YP0A 4L59A 3RKXA 3OYEA 1WQWA 2ZPGB 3IKMB 2EJFA 2QEXT 2AKWB 3BDLA 3UFGA 2E65A 1EIYA 1N8RC 4J15A 3L2QA 1RIQA 1O9SA 2DXUA 3A32A 4M75D 3VQWA 1QVGS 4P74C 1Y07A 1JRIA 4M77C 3L1AA 2JNGA 4M7AB 3C12A 4N4IA 3ME9A 4L87A 3L2RA 2CKKA 1G5IA 4XU3A 3FB9A 4OVAA 3RL6A 3J7AF 1Y96A 1YJWA 3HXVA 1P92A 1M9SA 4HWOA 4PHCA 3CC4T 5HK0A 1B7YB 3A5ZB 3M5AA 1E1OA 4MZPA 3VU3C 1QP2A 5LJ5h 1E24A 4YRCA 3VKIA 2L3RA 2XDBA 5CAIA 3QDRB 1NJIC 4O6JA 3HRTA 2XIDA 4FM4B 1H4TA 3HXXA 2CJAA 3CXCS 2QDYB 3JB9G 4O2DA 3GNGA 5K1XA 2QQAA 3OYMA 5GMKe 3CCST 3A8HB 1M90C 1EIFA 4M78D 2EJ9A 2A3LA 5GAOp 4KUIA 3N5BB 3HFOA 3CCSA 2PMEA 3LC0A 4KT0E 4P75C 4XU0A 1ATIA 4KQEA 3X25B 3R6OA 2X4XA 3UDCA 2O4XB 3CMET 3EFRA 1Q7YC 5GAMg 2LTOA 3MEAA 3TEHB 5KE3A 4JS4A 3EAEA 1NYRA 2RI5A 3JCMX 4E7LA 5C51B 2XDPA 4Q6GA 3QIIA 2ZXFA 2J3MA 2RK2A 3URGA 2A7YA 4A53A 2VGNA 4C8QE 4J7FA 3M56A 5K1PA 1W2BA 2QHSA 4LDXA 3ICAA 3G7ZA 4XEMA 4M78G 2Q7HA 1ZBXA 1U1SA 2ODRD 4RQEA 2RJDA 5DLOA 3WXMB 1W66A 5GANe 3HSBA 2QQ9A 2QHUA 4M75F 4FSXA 4Y28E 3BY7A 2V8JA 3G4SA 1JJ2A 3KUFA 4ZTUB 1VQ8T 3DKMA 3A74A 3KFUA 3J81E 2LT4A 4LDUA 4MMLA 4M78E 4C0DC 4BY6C 2VXFA 1VQPT 1W2BS 2EQMA 2KAFA 2DTIA 5GAN3 1QVGA 5GAN6 1NJ8A 1VQ5A 3F70A 4QQGA 5GAOq 1E1TA 5LJ5f 1NJ1A 4MZTA 2ZNJA 1W4SA 3VQVA 3S3MA 2Q5IA 4BW9A 2RI3A 4DQ2A 4JDSA 3MP8A 2RI2A 3SWNB 5CQYA 3E19A 3V8KA 2AHJB 2HNIA 4LD9K 3OMGA 3G71A 1BKBA 2RHZA 2EFIA 1NPPA 2OTJT 2ZT6A 5CKDA 3DLLA 3OYJA 1VQMT 2C8MA 3P8VA 1NZ9A 1EVKA 3A8LB 5GMKh 2KK4A 2DO3A 2P0KA 3CCEA 2HD0A 1LJOA 4ZGDB 4PLIA 4PJOE 5GAMf 2CYZB 4KR2A 4YRNA 4IUQA 3HY0A 4TWAA 3H6ZA 4F7UA 3A31A 2DD4A 3M4PA 1ZQ1A 1HXDA 3OA6A 4FT4A 4N4GA 2HBPA 5KH6A 4E51A 2RA2A 4TVAB 1RI0A 4YRMA 4A4HA 3TEHA 2DU7A 2PVOB 1N9WA 4YREA 4YYEA 2PUOB 2CZ6B 5A0GA 3X24B 1U1TA 4M78C 2ZZEA 1NPRA 3HHTB 1WLEA 1EFWA 1XNIA 2EYQA 2RHXA 3CPWS 1WJRA 3MF2A 3UT1A 5GAN7 3P8YA 3CCET 3HXZA 2P0PA 3PCOB 4DOWA 4TQFA 1VQ5T 3PGGA 3OYNA 3CCQT 2P4TA 3PZCA 4F7UF 4XU2A 4ME7A 2K5IA 3LGLA 4C0GA 3JB9J 2DKGA 4UP9A 3MEUA 4DA4A 3NELA 3JB9F 3WVEB 5DM7R 2RHSB 4ELYC 2QHVA 4UPAA 4RCBA 4O5VA 4C92F 2DDZA 2M9UA 2EQKA 3CCMT 2K5LA 4FT2A 5GAMh 4JRIA 2P0QA 2XK0A 5FU7B 1RL2A 5GANg 3I56T 3O8VA 1UB4A 1X01A 1YI2T 4HT9A 4JS5A 2D6FA 3OW2S 1SETA 4LVMA 2OAUA 5GMKm 3L2VA 3WVDB 1YBYA 4HWPA 2XU8A 2PVGB 1VQLA 2F5KA 3UGQA 4Q5WA 4M77A 2WACA 3OYAA 3BJUA 3PT9A 1IL2A 5LJ3e 4XU1A 2R57A 1LOJA 2EJGA 4C8QG 4IUTA 4N0AC 3CCUA 2DAQA 1Q82C 4HCCA 3OYDA 1UGPB 4C92D 2K4YA 3FDRA 3QYGB 4PJOD 1GXIE 5J39A 3P8TA 2RHYA 4M77D 4PJOG 4M7AG 1KHIA 1D3BB 4R55A 1L0WA 5CKEA 1WGSA 3DB4A 3M4YA 1B76A 4V2SA 4R56A 3A8GB 3E9GA 5LJ3d 3A7AA 5GANj 3SD4A 2JN0A 2OTJA 2QA4A 2RK1A 4C92B 5F5WA 3JRZA 2MAMA 2PVDB 1SRYA 1YGBA 3RF1A 2MI6A 3R07A 2LQ8A 1OZ3A 3OBYA 4L5GA 2KY9A 3OD1A 1VUBA 1BBUA 1VIEA 4F7UG 1IREB 5GMKi 3RIRA 2ZPFB 2LVMA 1USYA 4M78F 2PMFA 1KQSS 4H2WA 3VQYA 3NETA 1U8RA 1VIFA 3QJYA 4NL3A 3CPFA 4RG8A 3MQZA 5DY9A 4M75B 3S3NA 5I21A 3MEWA 1M90U 3HL8A 3QXEB 1D3BA 1NJIU 2E5AA 4WF2A 3G4ST 1N8RU 1KD1C 2R5MA 4JRKA 3RERA 1X2GA 1UEBA 4PJOB 4J6XA 4PG3A 2MWPA 3CCUT 5DLQE 4P74A 1VQ8A 4A4GA 5FRMA 2VV5A 4CRIA 4C5EA 1NJ5A 4L6V5 3UWNA 3M4GA 4E47A 2VGMA 1JJ2S 2ODRC 3CCJT 3JCMb 1WNLA 3CMEA 2K2VA 4LDWA 2XG8D 2ZZGA 3GNFB 2ZPBB 4ZGJB 4P72A 2YLBA 4M7DA 2LCLA 2Q5HA 1V29B 2VXEA 2QI2A 3CBMA 4UC4A 2DZCA 5IAYA 2ZT8A 1H4VB 1VQ4T 5FU6C 2CJ9A 4YROA 3P8BB 2DD5A 4XTZA 1K73C 4OB3B 4FU6A 3T9NA 2BIVA 4TVAA 1Q81U 1VQOT 5CCAA 4VUBA 4H2TA 3QHSA 4XTXA 4JRQA 3CCLA 2M1HA 1QVFS 2QQBA 3FIFA 3I55A 4P3PA 4M78B 4M77G 12ASA 4PJOC 3HXYA 2DVEA 5ELOA 4H2VA 2GF7A 4IUVA 4J8OA 2E6ZA 3JB9D 2CZ7B 5J26A 3CMAT 5GAN4 2RB6A 4C8QD 4NS5A 5A0LA 3IKLA 2VYTA 2QA4T 1Q81C 1S72A 4RMOA 1C0AA 3RMSA 2DTHA 3QZ9B 3HTZA 5GANh 1QVFA 3HXUA 4HWSA 4J7IA 1N6AA 1YI2A 1H3ZA 1ADYA 3G6EA 3E9HA 4C0DB 3AHUA 2QEXA 1G3YA 1YHQT 3CBOA 2HQEA 3X26B 2EIFA 2E3CA 3UH0A 3OS2A 4IURA 3HFNA 3RKWA 1G5HA 2ZT5A 2ZCEA 1VQ9T 4C8QB 3C95A 2CZ1B 4M77B 2E70A 1HC7A 3M57A 1K8AC 3OS1A 1JJCB 2RH2A 2RM4A 3GIBA 2X4YA 3CC7A 2XI9A 4CH3A 4OB0B 4JRPA 1VQNT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM d;  1H4Q A;  2ZNI A;  1BBW A;  1EFW A;  4YRQ A;  4YRT A;  3JB9 I;  1JJC A;  3JCM g;  4TVY A;  4PNO A;  4EMK C;  2I4L A;  5GAN 5;  3MF2 A;  5GAN 7;  5LJ3 f;  3P8Y A;  4C8Q A;  4RCC A;  1Z7M A;  4NOY A;  3QO5 A;  3HXZ A;  4EMG A;  3RUX A;  3PCO B;  4WI1 A;  4XEO A;  1QE0 A;  4QVC A;  4RMF A;  5GAM d;  4TQF A;  1QF6 A;  1KQ1 A;  4HWT A;  3JCM W;  4YDQ A;  3PGG A;  4M78 A;  4JUV A;  4M77 E;  2E41 A;  3PCO A;  5HGQ A;  3PZC A;  4M77 F;  4F7U F;  2I4O A;  4XU2 A;  3G1Z A;  2DQ0 A;  4C8Q F;  3RES A;  2AMC A;  2AKW A;  4YRG A;  3NEM A;  3BFM A;  3JB9 J;  2DKG A;  4UP9 A;  3TEG A;  4PJO F;  3NEL A;  4MMK A;  3JB9 F;  2RHS B;  5LJ5 d;  4DPG A;  2QTX A;  3V7R A;  2QHV A;  4UPA A;  4RCB A;  1E22 A;  2DDZ A;  4C92 F;  2YLC A;  4YRJ A;  1YCY A;  1TH7 A;  3QO3 A;  1Y96 B;  3HFZ A;  1MGQ A;  5GAM h;  4YPF A;  1ASY A;  2DU5 A;  4JRI A;  1HK9 A;  5GAN g;  1X01 A;  4M7A F;  2QHT A;  3HXW A;  3V7S A;  4HT9 A;  2ZT7 A;  4M7D G;  3LSQ A;  4P71 A;  4M7A E;  1NNH A;  1SER A;  4XTY A;  5GAM e;  1YFS A;  1SET A;  1Z7N A;  2E64 A;  3IG2 A;  5GAO n;  1B70 A;  4EX5 A;  2IY5 A;  5GMK m;  2Q7G A;  1PYS A;  3W3S A;  1N9S A;  2J3L A;  3BDU A;  2ZTG A;  4M7D B;  5GAN 2;  5LJ3 j;  4YRL A;  4M75 A;  5GAO m;  4HWP A;  3FJP A;  3UGT A;  3M4Q A;  3RGL A;  3IAL A;  4YP0 A;  4EMK B;  1X56 A;  5GAM j;  4YRF A;  3RKX A;  3UGQ A;  1WQW A;  4P3O A;  2EWN A;  3A5Y A;  4HT8 A;  3IKM B;  2EJF A;  4M77 A;  3JCM f;  2AKW B;  3BJU A;  1IL2 A;  5LJ3 e;  2CIM A;  2CJB A;  4CS3 A;  3UFG A;  2E65 A;  4XU1 A;  4YRS A;  5GAN 8;  1EIY A;  2XTI A;  4WJ3 M;  1LOJ A;  2EJG A;  4J15 A;  1RIQ A;  2FB7 A;  4C8Q G;  2DXU A;  4N0A C;  1EQR A;  5LJ3 h;  3A32 A;  4M75 D;  1KMN A;  3VQW A;  1EOV A;  2E1H A;  1B7Y A;  4EMK A;  5GMK j;  4P74 C;  1JRI A;  1X55 A;  4C92 D;  4M77 C;  3JCM J;  3L1A A;  4M7A B;  3A7R A;  4TVW A;  4N0A A;  2Q7E A;  4AH6 A;  2DZ9 A;  2ZR3 A;  3QO7 A;  4J5Y A;  4PJO D;  1H4S A;  3P8T A;  4P75 A;  2I4N A;  4L87 A;  3A5Z A;  4M77 D;  4YCV A;  2Y90 A;  1G5I A;  4XU3 A;  4PJO G;  2ALY A;  3FB9 A;  4M7A G;  1D3B B;  1L0W A;  1USY C;  1NJ6 A;  4C92 G;  4CH5 A;  5C53 B;  4ZTZ B;  1B76 A;  4V2S A;  3RL6 A;  4X5O A;  1Y96 A;  5LJ3 d;  4CH6 A;  3A7A A;  3HRI A;  5GAN j;  3HXV A;  2JN0 A;  4F7U E;  4HWO A;  3JCM P;  1N9R A;  4PHC A;  2EL9 A;  1B7Y B;  4YCW A;  2P0L A;  4C92 B;  5F5W A;  1E1O A;  5LJ3 g;  3QSU A;  1SRY A;  4XTV A;  3SWN A;  3JB9 H;  1YGB A;  3RF1 A;  3VU3 C;  3R07 A;  5LJ5 h;  5LJ5 g;  1E24 A;  1EVL A;  3V8J A;  4YRC A;  5CAI A;  2VC8 A;  4YCU A;  1H4T A;  2DJZ A;  3OD1 A;  4K86 A;  3HXX A;  4Y91 A;  1BBU A;  4XQ3 A;  2ZZF A;  4F7U G;  5GMK i;  3RIR A;  1GGM A;  2CJA A;  3CMQ A;  1USY A;  4M78 F;  2PMF A;  3VQY A;  3JB9 G;  4M7A C;  4H2W A;  4O2D A;  3NET A;  4M7D F;  3QUI A;  4M7D D;  4CS2 A;  1WPY A;  5K1X A;  4H2Y A;  4RQF A;  3HFV A;  5GMK e;  2RHQ B;  2ARS A;  4H2U A;  4NL3 A;  4M78 D;  2EJ9 A;  5GAO p;  5DY9 A;  3HFO A;  4M75 B;  4K87 A;  2PME A;  2DEQ A;  3V7C A;  2EAY A;  5I21 A;  3LC0 A;  1I81 A;  4P75 C;  4UP7 A;  1BIB A;  3TUP A;  1KMM A;  3LSS A;  2IY5 B;  2DXT A;  1LYL A;  4XU0 A;  5GAN d;  1ADJ A;  1ATI A;  2CGH A;  4KQE A;  1D3B A;  4TQD A;  2ALY B;  2E5A A;  4QVD A;  1M8V A;  1LNX A;  1NJ2 A;  2RHQ A;  4WF2 A;  3JCM h;  1FYF A;  4H2X A;  5GAO r;  2RHS A;  4JRK A;  3RER A;  3EFR A;  1X2G A;  5GAM g;  3HFZ B;  4PJO B;  4J6X A;  4PG3 A;  5C52 B;  3TEH B;  4M7A A;  2DTO A;  4P74 A;  4KR3 A;  1NYR A;  4P3N A;  3JCM X;  4G84 A;  5C51 B;  2ART A;  4EO4 A;  4Q6G A;  4Q15 A;  1H64 1;  1NJ5 A;  4P71 C;  2ZXF A;  4CS4 A;  4HA8 A;  2J3M A;  3M4G A;  1HTT A;  2AMC B;  3JCM Q;  4X9D A;  4A53 A;  4C8Q E;  1EIY B;  5GAO l;  2ODR C;  5K1P A;  4NL2 A;  3JCM b;  1WNL A;  2K57 A;  5ELN A;  4UP8 A;  2QHS A;  3ICA A;  2ZIN A;  1M5Q 1;  4XEM A;  4M75 C;  4M78 G;  2I2L A;  4J6W A;  4M7D C;  2Q7H A;  2ODR D;  1U1S A;  2ZZG A;  4RQE A;  3JCM c;  1BIA A;  5LJ5 e;  3EFS A;  2E10 A;  4P73 C;  1W66 A;  4P72 A;  5GAN e;  3HSB A;  2YLB A;  3HY1 A;  4M7D A;  2Q5H A;  2QHU A;  5GAN f;  4M75 F;  2VXE A;  3L4G B;  3BY7 A;  4EMH A;  4M75 E;  2DZC A;  4H2X B;  1SES A;  3E9I A;  4X9C A;  2ZT8 A;  4H2S A;  1H4V B;  3V8L A;  2FYK A;  1WYD A;  4ZIB A;  2RD1 A;  3QNE A;  2CJ9 A;  4ZTU B;  4P72 C;  4YRO A;  2G4C A;  4YRI A;  3A74 A;  3KFU A;  3ERR A;  1YFR A;  11AS A;  1X2H A;  1I4K 1;  2I4M A;  4CH4 A;  1NYQ A;  4MML A;  4XTZ A;  4WJ4 A;  4XTU A;  4M78 E;  3VQX A;  3RKY A;  3DSQ A;  4TVA A;  4M7D E;  4YRK A;  2VXF A;  4H2T A;  3QHS A;  3A7U A;  2DTI A;  4XTX A;  5GAN 3;  5GAN 6;  4G85 A;  1NJ8 A;  1WU7 A;  4OLF A;  3REX A;  3FIF A;  5GAO q;  4M7A D;  5LJ5 f;  1E1T A;  1NJ1 A;  1YFT A;  2ZNJ A;  4P3P A;  4M78 B;  4M77 G;  2C7I A;  4NCX A;  1WQ7 A;  12AS A;  4PJO C;  3VQV A;  4J6Y A;  4XTW A;  2ZR2 A;  3HXY A;  2DVE A;  2Q5I A;  4HVC A;  4TTV A;  5ELO A;  4BW9 A;  4DQ2 A;  4H2V A;  5KNN A;  3JCM V;  4C8Q C;  4PJO A;  3RAC A;  4JLI A;  5GMK l;  3JB9 D;  3SWN B;  3V8K A;  2ZIO A;  2HNI A;  5GAN 4;  4C92 A;  2RB6 A;  4C8Q D;  4OP0 A;  4YRP A;  3IKL A;  1KOG A;  2ZT6 A;  3REU A;  1I8F A;  1JBM A;  2C8M A;  3P8V A;  1KQ2 A;  1EVK A;  3QO8 A;  5GMK h;  1C0A A;  2P5I A;  2XGT A;  1LJO A;  2DTH A;  5LJ5 j;  1B34 A;  4PJO E;  3HTZ A;  5GAN h;  5E3I A;  3L2Z A;  5GAM f;  3HXU A;  4HWS A;  3NEN A;  3MF1 A;  4KR2 A;  4YRN A;  3INZ A;  3SWN C;  1ADY A;  4C92 E;  1J5W A;  3HY0 A;  4TWA A;  4LNS A;  3E9H A;  3HRK A;  3AHU A;  4F7U A;  1ASZ A;  4HWR A;  3A31 A;  3M4P A;  1HXD A;  2E3C A;  4K88 A;  3UH0 A;  4E51 A;  1YB3 A;  2RA2 A;  3I7F A;  3HFN A;  1I5L A;  4F7U B;  4C92 C;  3QTC A;  4TVA B;  2ZGW A;  4BWA A;  4YRM A;  3RKW A;  1G5H A;  2DQ3 A;  3VBB A;  4RDX A;  1VQZ A;  2ZT5 A;  2ZCE A;  4A54 A;  1G51 A;  3TEH A;  2DU7 A;  4C8Q B;  4M77 B;  1HC7 A;  3SB2 A;  4P73 A;  1N9W A;  3BW1 A;  2ARU A;  4YRE A;  1X54 A;  4YYE A;  1B34 B;  1B70 B;  1JJC B;  2RM4 A;  4YRR A;  3GIB A;  4H02 A;  2ZIM A;  1U1T A;  4CH3 A;  4M78 C;  4M75 G;  2ZZE A;  2YHT A;  3JCM e;  1WLE A;  3WQZ A;  3MEY A;  1B8A A;  3L4G A;  1PYS B; 
#chains in the Genus database with same CATH topology
 3CCM A;  1UGR B;  4BDY A;  2EQU A;  2YDL A;  2W0Z A;  2ZNI A;  5I2M A;  2DXB A;  2HSE B;  1TTH B;  5KCO A;  3E1S A;  4BB7 A;  2MPX C;  3JCM g;  1JJC A;  4TVY A;  1PM3 A;  3RNJ A;  4EMK C;  1G3S A;  4FSS A;  4YTL A;  3DLM A;  5LJ3 f;  3TSZ A;  3MO8 A;  3QO5 A;  1KJW A;  1VQ4 A;  4EMG A;  1TUD A;  2X4W A;  4E7I A;  1AVZ C;  2V1R A;  4RMF A;  5GAM d;  1KQ1 A;  1T0J A;  3LW5 E;  4M78 A;  2ZPE B;  2IVW A;  3QKJ A;  4M77 E;  1Q86 C;  2QXF A;  5I2S A;  1VQP A;  2D8J A;  4PLL A;  5HGQ A;  4M4Z A;  4M77 F;  2I4O A;  1TU0 B;  4C8Q F;  4KH1 B;  2HSP A;  3JSC A;  3H8Z A;  1EFN A;  3NEM A;  3RR6 A;  4Z02 A;  3G6E T;  1ZHI A;  4EIK A;  4OGC A;  3V7R A;  4YRJ A;  5D6X A;  1YHQ A;  1TH7 A;  3O5Z A;  1Y96 B;  4CC2 A;  2DF6 A;  4F16 A;  3OYI A;  1D0Z A;  4YPF A;  2DU5 A;  1NEG A;  2FL7 A;  1BI1 A;  4ZGE B;  2KRS A;  4M7A F;  2QHT A;  1U3O A;  4OF1 A;  3I55 Q;  2V26 A;  3LSQ A;  5IXF A;  4M7A E;  1SER A;  4WJ3 M;  4AFS C;  1YFS A;  2RHU A;  3CXC A;  1HYO A;  5GAO n;  3A8M B;  2CP3 A;  5KYU A;  5IHN A;  1H8K A;  3W3S A;  1WJQ A;  1MMD A;  4HVU A;  2LX9 A;  2CP5 A;  3VYH B;  4M7D B;  5GAN 2;  2QGG A;  5GAO m;  3UGT A;  2LMJ A;  3FJP A;  3M4Q A;  4WTO B;  2KSS A;  1W1F A;  1EX4 A;  4EMK B;  1X56 A;  2DRK A;  2MWO A;  3LX7 A;  3OYB A;  2Y4Y A;  4P3O A;  2HAX A;  1N8R R;  2NUP B;  4HT8 A;  2HEQ A;  3H9N A;  3CMA A;  2DL5 A;  2CIM A;  2M16 A;  4CS3 A;  1UTI A;  2H3E B;  1VQ7 T;  1WYX A;  4OMM A;  2XTI A;  1I0C A;  2RQW A;  2FB7 A;  3CCL T;  4MDX A;  1KD1 U;  3A8O B;  5LJ3 h;  4BDZ A;  3CD6 Q;  1EQR A;  1KMN A;  2MCN A;  4A63 B;  5GMK j;  1O75 A;  1VQK T;  1X55 A;  3OW2 A;  1QWE A;  3JCM J;  3A7R A;  2CS7 A;  5D6W A;  2OX7 A;  2ECZ A;  4HKE A;  4JLG A;  3CPW A;  4LVL A;  1BI2 A;  3QO7 A;  4J5Y A;  3EH1 A;  3PNW C;  1X43 A;  3CC2 T;  1VYT A;  1UGQ B;  2J06 A;  2B8A A;  2JS2 A;  3A5Z A;  5IN1 A;  3M9Q A;  3UA7 A;  4YCV A;  2DL8 A;  2FPF A;  2YUQ A;  3RMQ A;  1QW1 A;  1NJ6 A;  1E6H A;  3Q1J A;  3MP6 A;  5C53 B;  4ZTZ B;  3QZ5 B;  4OMN A;  2IIM A;  2NUT B;  3MCA B;  2CP0 A;  1M3B A;  4F7U E;  4LVK A;  1N9R A;  2YWW A;  1BB9 A;  1AOJ A;  4LUE A;  1KC8 R;  2K6D A;  4YCW A;  2EKO A;  5LJ3 g;  2DIL A;  1M1K C;  3QSU A;  3SWN A;  3JB9 H;  1JXO A;  2FEI A;  5L8R E;  2QQS A;  2GFU A;  1EVL A;  3V8J A;  1M1F A;  2DPP B;  2SEM A;  1KC8 C;  2AKK A;  3JAM E;  1AD5 A;  1Z9Q A;  2KR3 A;  1QKX A;  3VS5 A;  2VC8 A;  4LUD A;  1UEC A;  4YCU A;  1VQ4 Q;  2DJZ A;  3SHW A;  1VQN A;  1A0N B;  4Y91 A;  4XQ3 A;  1WHM A;  1GGM A;  3VUZ A;  1BU1 A;  2AIR B;  2PQW A;  4X34 A;  4AT1 B;  3UA6 A;  1KC8 U;  5CR2 A;  3CEY A;  3M0R A;  4M7A C;  4D6W A;  3CCJ A;  4HCB A;  2EYZ A;  3QUI A;  4RTY A;  4M7D D;  2K7A A;  4H2Y A;  3HFV A;  2RHQ B;  2ARS A;  1VQO Q;  3VS2 A;  1MND A;  2DEQ A;  3V7C A;  3TU4 K;  2OTJ Q;  2FZK B;  1XOV A;  1T3S A;  1NM7 A;  4OB1 B;  2I0N A;  1BIB A;  1Q95 G;  1XQH A;  3TUP A;  2K2M A;  4LN2 A;  1KD1 R;  2DXT A;  5GAN d;  1ADJ A;  2CGH A;  4TQD A;  4PFP A;  4QVD A;  4E7H A;  1LNX A;  1IO6 A;  3OS0 A;  2RHQ A;  4HT4 A;  1FYF A;  1WJS A;  1V1C A;  2HL5 C;  3C0C A;  5GAO r;  1G3T A;  2RHS A;  3PMT A;  4BI8 B;  1JB0 E;  1Y71 A;  2YT6 A;  2DTO A;  1R0C B;  4C5G A;  3FRN A;  1QCN A;  4JPB W;  4G84 A;  1RAE B;  2JTM A;  4DOV A;  4E7J A;  3TVT A;  3CCR Q;  1H64 1;  4LNP A;  2E12 A;  3I55 T;  1R8O B;  2CT4 A;  3MHX A;  3M0U A;  4CS4 A;  4IIO A;  5C6S A;  1M27 C;  2FPD A;  1HTT A;  2AMC B;  5HKC A;  4X9D A;  4BUG A;  5KCH A;  3X20 B;  4NL2 A;  3H0F A;  2K57 A;  2L5Q A;  5ELN A;  2RNA A;  1M5Q 1;  3NTH A;  2I2L A;  3GLX A;  4J6W A;  2OTL T;  3FLG A;  2GQV A;  5AYF A;  3EFS A;  3G1J A;  2E10 A;  5FRO A;  4P73 C;  2DFU A;  4RG2 A;  2F1L A;  1M1G A;  4BY6 B;  1C1A A;  2EQJ A;  1TWB A;  5D6Y A;  4KBM B;  3EGX B;  3I5S A;  1K9M U;  4EMH A;  4M75 E;  4MZM A;  5KE2 A;  2BUD A;  1SES A;  1G5V A;  3E9I A;  4CC3 A;  1VQ6 T;  2FYK A;  1WYD A;  5A2Q E;  3LYI A;  3SDZ A;  4ATO A;  4ZIB A;  3OYY A;  2KYM A;  5L23 A;  2HBW A;  3EHQ A;  2JTF A;  2E3I A;  2G4C A;  4YRI A;  4KGV B;  3CCQ Q;  11AS A;  1X2H A;  4LVI A;  3EG2 A;  3M55 A;  1NYQ A;  1XTD A;  2PUK B;  3QG1 A;  1Y57 A;  3OSS C;  3RKY A;  1OU8 A;  3DSQ A;  4M7D E;  4YRK A;  3VYG A;  4KGZ B;  4XAX B;  5KYN A;  4IUU A;  3IQL A;  2FVU A;  4G85 A;  5FW9 A;  3UPU A;  2JTE A;  1WU7 A;  3NFC A;  2HQX A;  1YFT A;  1VQ7 Q;  3ULR B;  4BD3 A;  1K4U S;  4NCX A;  3HRU A;  3J80 E;  4J6Y A;  2OJ2 A;  2QK0 A;  2E6N A;  2M0O A;  4HVC A;  2A28 A;  3JCM V;  2DYI A;  1WFW A;  4C8Q C;  3OMC A;  1ZSZ B;  4PJO A;  4JLI A;  2QG9 B;  1OQK A;  2RJC A;  4J9B A;  2ZIO A;  3I56 Q;  2J7I A;  3OYL A;  4C92 A;  2YUP A;  3OYG A;  3HP9 A;  4B9X A;  4ZTJ A;  2EGA A;  1NE8 A;  5FLX E;  1YIT T;  1QQJ A;  3PE0 A;  3CCJ Q;  3OSV A;  3OB9 A;  4E7K A;  1MV3 A;  1YJN T;  4KGX B;  4XK8 E;  2XGT A;  5E3I A;  3L2Z A;  3NEN A;  4LDY A;  3MF1 A;  1VQL T;  4LD6 A;  3KXT A;  1PRL C;  4OGE A;  2RO0 A;  3QDF A;  3ZEH A;  3M54 A;  3QJ6 A;  4HWR A;  2KRM A;  2DET A;  2OAW A;  2LC4 A;  2QAZ A;  1NLP C;  3OBW A;  4K88 A;  3MP1 A;  3FJ5 A;  3CXC P;  3ER0 A;  3OYF A;  2X4J A;  4F7U B;  5CKF A;  3QTC A;  1OYX A;  2H3J A;  2ZGW A;  4C0F A;  4RDX A;  4A54 A;  3OYH A;  1G51 A;  1ZUK A;  2RN8 A;  3SB2 A;  5KYU B;  1B34 B;  1B70 B;  2PU9 B;  1UGV A;  3NTI A;  4YRR A;  1K73 U;  3PVQ A;  4H02 A;  1VQ7 A;  1WDX A;  2DNU A;  4KUL A;  3M58 A;  2M0Y A;  2AT1 B;  1AEY A;  1OV3 A;  1TOV A;  3JCM d;  3GBQ A;  3GPL A;  1KSW A;  3CCV T;  1BBW A;  2EQI A;  1ZSZ C;  3NTK A;  3FEO A;  2L3S A;  2OTL Q;  4YRT A;  3JB9 I;  2D1X A;  1BK2 A;  2A8E A;  5FU7 C;  1UJY A;  5GAN 5;  1PG5 B;  4JJN K;  5HK3 A;  2KRO A;  4OMP A;  5I11 A;  2DIQ A;  2M02 A;  4C8Q A;  4NOY A;  4JZ3 A;  1KK7 A;  3RUX A;  2JT4 A;  3TEE A;  4WI1 A;  4XEO A;  1QE0 A;  4QVC A;  3NMZ C;  3VS0 A;  3M0T A;  1QF6 A;  4HWT A;  4KUD K;  2K3B A;  2O9V A;  2EPD A;  2LP5 A;  1YJ9 A;  1W6X A;  2E41 A;  2ABL A;  3QBY A;  3C4S A;  3OQ5 A;  2DQ0 A;  3RES A;  3NHN A;  3EFO A;  1WI7 A;  5IHK A;  3BFM A;  1Q86 R;  1N27 A;  9ATC B;  5LJ5 d;  2O2O A;  2EYY A;  2X9H A;  5HY6 A;  1E22 A;  4E7S A;  4AG1 C;  2RPN A;  2YLC A;  3EGU A;  3HPW A;  2B86 A;  1RAG B;  4FW1 A;  1VOM A;  3HFZ A;  2F69 A;  4RKU E;  1ASY A;  1HK9 A;  2V8K A;  2CP6 A;  2ATC B;  3HXW A;  1VQM A;  2ZT7 A;  2K3Y A;  4ELZ C;  1RAA B;  2D0N A;  4P71 A;  1NNH A;  2VUB A;  3BE3 A;  1Z7N A;  2JUF A;  1B70 A;  2IY5 A;  2Q7G A;  3E9F A;  5GJW B;  5FWC A;  1N9S A;  2J3L A;  1ZUU A;  4P5N A;  3PIP A;  1MMN A;  1G83 A;  5LJ3 j;  4YRL A;  3LWH A;  3CCU Q;  1UGS B;  3RGL A;  3IAL A;  1WHK A;  5GAM j;  4YRF A;  1E7O A;  3LWI A;  4DBF A;  2EWN A;  4BI4 A;  3I56 A;  3A5Y A;  1QVG P;  1OI1 A;  4LDV A;  3JCM f;  4CC7 A;  2COW A;  1K8A R;  1R77 A;  3M0S A;  2CJB A;  1E6G A;  4YRS A;  2GCX A;  5GAN 8;  3CC7 T;  4ZTF A;  5IT9 E;  4JZ4 A;  3MEV A;  3TSW A;  4EDU A;  1EOV A;  2E1H A;  1B7Y A;  4EMK A;  2AZS A;  4MDW A;  1NYF A;  4BE0 A;  4N0A A;  2Q7E A;  4AH6 A;  2DZ9 A;  2ZR3 A;  2BKD N;  2GQI A;  4TVR A;  4QW2 A;  4RTX A;  3EGD B;  3VJP A;  1H4S A;  3TCJ A;  4P75 A;  2MK5 A;  1NBE B;  2JM9 A;  2I4N A;  1MHN A;  3P8H A;  2HCK A;  2Y90 A;  1YIJ A;  4PKC C;  4FCY A;  3TRE A;  2ALY A;  1SSF A;  2G3R A;  1USY C;  4LVJ A;  4AMC A;  1VQ9 A;  2E4H A;  4C92 G;  4HVW A;  4CH5 A;  2HZY A;  4AFQ C;  1TG0 A;  4X5O A;  4BE1 A;  4CH6 A;  3HRI A;  3LGF A;  1YIT A;  1K9A A;  1X6O A;  3JCM P;  3G6E Q;  2EYX A;  2EL9 A;  2DL4 A;  2P0L A;  1X75 C;  2X3X D;  1YJN A;  2L8D A;  2L89 A;  2C06 A;  4XTV A;  1K76 A;  1VYU A;  4J9H A;  4C5I A;  2HMA A;  2KT8 A;  5LJ5 g;  3CCE Q;  1IXD A;  4EPC A;  1KG1 A;  2A36 A;  1I1J A;  4PL6 A;  1ZSG A;  2MYS A;  1WXU A;  4Y92 A;  4K86 A;  2JZ2 A;  2ZZF A;  2RQU A;  1VYV A;  2MOX A;  3CMQ A;  2QQR A;  1HD3 A;  2EVR A;  2K5F A;  4C5H A;  2KDS A;  2D0Q B;  4M7D F;  4HCZ A;  4CS2 A;  1NEB A;  1Q82 U;  2PTK A;  1WPY A;  4RQF A;  2ZZD A;  1UDL A;  5CIU A;  2O31 A;  4H2U A;  2DIG A;  4PFO A;  2WSF E;  1JJ2 P;  1CKA A;  2NYS A;  4QQD A;  1M1K U;  4K87 A;  2ED0 A;  3ASK A;  2ZPI B;  3DB3 A;  3NGP A;  2XIC A;  2EAY A;  2GNC A;  2JVV A;  3OS5 A;  8ATC B;  2WSC E;  1I81 A;  4UP7 A;  2XHC A;  1KMM A;  3LSS A;  2IY5 B;  3PTA A;  2DL3 A;  1LYL A;  1Q7Y U;  2KXD A;  2MMP A;  2ALY B;  1G3W A;  2X35 A;  2JOY A;  3ZBD A;  1YJ9 T;  3CD6 T;  1M8V A;  2HDA A;  1NJ2 A;  2ZPH B;  4F04 B;  5C0M A;  3JCM h;  4H2X A;  3EG9 A;  3H0H A;  1S72 T;  2DK3 A;  3THK A;  1NYG A;  5LL6 S;  3HFZ B;  1QP3 A;  1RAB B;  2GTO A;  5C52 B;  4M7A A;  4JJB A;  4KR3 A;  2LDM A;  4P3N A;  2R58 A;  3MET A;  1OU9 A;  2ART A;  1M4Z A;  3GF5 A;  1Q7Y R;  2WSE E;  4Q15 A;  4EO4 A;  1VQ5 Q;  3TQ7 P;  4P71 C;  2F5T X;  1SHG A;  4HA8 A;  2OTL A;  5IH2 A;  1LCK A;  3JCM Q;  1EIY B;  3PMI A;  5GAO l;  1KHC A;  4UP8 A;  4DBQ A;  1VQO A;  2JMA A;  3HTR A;  2ZIN A;  4CI0 C;  2YSQ A;  4M75 C;  4M7D C;  1PNJ A;  5CK9 A;  3JCM c;  1BIA A;  5LJ5 e;  1KQS A;  4HCK A;  4A4K A;  3LLR A;  5M9O A;  3HY1 A;  1MMA A;  5GAN f;  2RHI A;  2LJ1 A;  3L4G B;  5D7U A;  3EG9 B;  4BE2 A;  4H2X B;  3OYK A;  1FXX A;  4X9C A;  4H2S A;  3C94 A;  2CP2 A;  3V8L A;  3FC3 A;  4A4E A;  1MMG A;  2NLU A;  2RD1 A;  3SFM A;  3QNE A;  4P72 C;  1M3C A;  1UG1 A;  3ERR A;  1YFR A;  1NJI R;  3PIO A;  1I4K 1;  1YIJ Q;  2I4M A;  4CH4 A;  3CCR A;  4GBQ A;  4WJ4 A;  4XTU A;  2ED1 A;  4IKF A;  2V8I A;  3VQX A;  1SHF A;  5FRN A;  1T0H A;  1HSQ A;  2NUZ A;  3PFS A;  1AWX A;  3A7U A;  1OX8 A;  3CC4 A;  2KQW A;  1BCM A;  1EZZ B;  4OLF A;  4B6M A;  3REX A;  2K79 A;  1UHC A;  4M7A D;  1JU5 C;  1K9M C;  2EKH A;  2C7I A;  1WQ7 A;  1OZ2 A;  1FMW A;  4XTW A;  2ZR2 A;  2XD0 A;  1AHJ B;  2NS6 A;  4TTV A;  1K8A U;  3I35 A;  2F2W A;  2LT1 A;  1BI3 A;  2ZCF B;  5KNN A;  2KXC A;  1K1Z A;  3RAC A;  5GMK l;  2XMF A;  2EBP A;  1KFZ A;  2O4X A;  1QVP A;  2GFA A;  1YCS B;  5CVI A;  3CCR T;  4OP0 A;  3CCQ A;  4J83 A;  3M53 A;  4YRP A;  1RAH B;  2VWF A;  1PSF A;  1KOG A;  2FPE A;  3CC2 A;  3REU A;  1I8F A;  1JBM A;  1KQ2 A;  1VQ6 A;  4QVZ A;  1U06 A;  3QO8 A;  1FWZ A;  1Q81 R;  2P5I A;  2ENM A;  5LJ5 j;  2DVJ A;  1B34 A;  4JJC A;  3L2W A;  2KEA A;  5KYW B;  4ZN1 A;  5EG2 A;  3INZ A;  3LH0 A;  1M8M A;  3SWN C;  4C92 E;  1J5W A;  4II1 A;  1ARK A;  4LNS A;  2KMT A;  2E5Q A;  2J05 A;  4RTZ A;  1Q86 U;  2K3X A;  3HRK A;  1ASZ A;  4QQ6 A;  1RLP C;  3QPH A;  1RUW A;  5ECA A;  2QGF B;  4FL6 A;  4B9W A;  1YB3 A;  3I7F A;  2LRQ A;  3OYC A;  1I5L A;  1S72 Q;  2YRV A;  4C92 C;  4FYV B;  2EGC A;  3L42 A;  4BWA A;  1X2Q A;  2DQ3 A;  3VBB A;  1VQZ A;  2CDT A;  5CQX A;  4P73 A;  3CC4 Q;  1BI0 A;  2LNV A;  3BW1 A;  2ARU A;  1X54 A;  3CCS Q;  1D1A A;  3HKS A;  2RMO A;  3OY9 A;  2IG0 A;  4ZN3 A;  4J9G A;  3GOX A;  3EHR A;  2ZIM A;  1QLY A;  1VQP Q;  4M75 G;  2YHT A;  3JCM e;  3WQZ A;  4BI3 A;  3MEY A;  3S3O A;  1B8A A;  4TVW A;  3L4G A;  1PYS B;  1T3L A;  4C0Z A;  1RAC B;  1VQK A;  1H4Q A;  3S6W A;  4A4F A;  5FU6 B;  2KGT A;  1GCP A;  1BYM A;  2L2P A;  2D9T A;  4YRQ A;  2DX1 A;  1YJW T;  2FHD A;  4PNO A;  2I4L A;  2O01 E;  4GY5 A;  5CKH A;  3EGX A;  5IHI A;  4RCC A;  1Z7M A;  1ZSZ A;  2RJF A;  2XKO C;  3ZFJ A;  1IRX A;  1SF9 A;  4IUP A;  1D09 B;  3X28 B;  2KVQ G;  2LCS A;  2RJE A;  4OMF B;  1WHJ A;  3QYH B;  2VAS A;  3VV0 A;  3JCM W;  4YDQ A;  2MF2 A;  1PSE A;  3M59 A;  4JUV A;  3AT1 B;  1RLQ C;  4DBH A;  3G71 T;  3CCV A;  2LX7 A;  1DJ7 B;  3PCO A;  1AWO A;  3G1Z A;  1Z9Z A;  2H8H A;  2AMC A;  2AKW A;  4YRG A;  1Y7X A;  1FX7 A;  2LQW A;  2W10 A;  1GBR A;  3TEG A;  4PJO F;  2XDD A;  1OEB A;  1IZ6 A;  4MMK A;  2DL7 A;  4DPG A;  5J3B A;  2QTX A;  3CBP A;  3KBG A;  1YCY A;  3CME Q;  4FIB A;  3QO3 A;  3HRS A;  4GLK A;  2E3H A;  3L2U A;  1OX9 A;  1MNE A;  1BCO A;  3P8D A;  1SRL A;  1MGQ A;  2R5A A;  1RAI B;  1B3Q A;  1WXB A;  4N4H A;  2KT1 A;  2DEU A;  3GP8 A;  3V7S A;  2CP7 A;  5A0D A;  1I07 A;  5CO7 A;  4M7D G;  2YUN A;  4FYX B;  4XTY A;  2FZC B;  5GAM e;  3IG2 A;  2E64 A;  1YN8 A;  2LQK A;  4EX5 A;  4BAC A;  4AFZ C;  1M2V A;  2LCC A;  3VUB A;  1PYS A;  2DXC A;  1W2B P;  2A0F B;  1YIJ T;  4OMQ A;  2Y4X A;  3BDU A;  2ZTG A;  4OB2 B;  2CZ0 B;  4M75 A;  3CD6 A;  5CKB A;  1S1N A;  4YP0 A;  2BE9 B;  2IPO B;  1PCX A;  4L59 A;  3RKX A;  3LH5 A;  3OYE A;  1WQW A;  1YFN A;  2ZPG B;  4QKU A;  3IKM B;  2EJF A;  4HXJ A;  2QEX T;  2AKW B;  3BDL A;  3REB B;  2CSI A;  3UFG A;  2E65 A;  2J6O A;  1EIY A;  2DYB A;  1N8R C;  4J15 A;  3L2Q A;  1RIQ A;  1VQ6 Q;  4DEX A;  1O9S A;  1WX6 A;  2DXU A;  7AT1 B;  1PWT A;  1M2O A;  4ESR A;  3A32 A;  4M75 D;  3VQW A;  2QAS A;  1QVG S;  2JMC A;  4P74 C;  1Y07 A;  1JRI A;  4M77 C;  3L1A A;  2JNG A;  4M7A B;  3C12 A;  2NUT A;  1WXT A;  2KYB A;  4N4I A;  4RTW A;  3ME9 A;  4L87 A;  3L2R A;  2CKK A;  1G5I A;  4XU3 A;  1ZA2 B;  3FB9 A;  2QA4 Q;  1SSH A;  4WCI A;  2DE0 X;  1AWJ A;  4OML A;  4OVA A;  4FW2 A;  2DA9 A;  4RTV A;  3RL6 A;  3J7A F;  2DMO A;  1Y96 A;  1GL5 A;  1YJW A;  3HXV A;  1P92 A;  1M9S A;  1X27 A;  2P4R A;  4HWO A;  2HKQ B;  4PHC A;  3CC4 T;  5HK0 A;  3UAT A;  1B7Y B;  3A5Z B;  3M5A A;  3PVL A;  1E1O A;  4MZP A;  3E2U A;  5I22 A;  3SEM A;  3VU3 C;  1QP2 A;  5LJ5 h;  1E24 A;  2JM8 A;  1GFC A;  4YRC A;  3VKI A;  2L3R A;  2XDB A;  2A08 A;  3QDR B;  5CAI A;  4O6J A;  4ORZ A;  5EC7 A;  1NJI C;  3HRT A;  2XID A;  4FM4 B;  1D1B A;  1H4T A;  3HXX A;  2CRE A;  3G71 Q;  1YP5 A;  2CJA A;  4F14 A;  2Z0W A;  1M90 R;  3CXC S;  2QDY B;  4R0K A;  4OMO A;  3JB9 G;  4O2D A;  3GNG A;  1QMC A;  5K1X A;  2QQA A;  3OYM A;  2ROT A;  5GMK e;  3CCS T;  3A8H B;  1M90 C;  1EIF A;  4M78 D;  2EJ9 A;  2A3L A;  5GAO p;  4KUI A;  1TUG B;  3N5B B;  3HFO A;  3CCS A;  2PME A;  3LC0 A;  1YIT Q;  4HVV A;  3CPW P;  2DM1 A;  1UFF A;  4LE9 A;  3UF4 A;  4KT0 E;  4P75 C;  2YRC A;  1R0B G;  4XU0 A;  3CCV Q;  1ATI A;  4KQE A;  3X25 B;  3R6O A;  2X4X A;  3UDC A;  2O4X B;  1PKS A;  2EYW A;  3CME T;  3EFR A;  1Q7Y C;  1QCO A;  5GAM g;  2LTO A;  3MEA A;  3TEH B;  5KE3 A;  1HJD A;  1X6B A;  4JS4 A;  3EAE A;  1D1C A;  1NLO C;  1NYR A;  2RI5 A;  3JCM X;  4E7L A;  5C51 B;  2X51 A;  2XDP A;  4Q6G A;  2BZY A;  3MJX A;  3QII A;  2ZXF A;  2J3M A;  2QEX Q;  1C0M A;  3EG0 A;  2RK2 A;  3URG A;  2A7Y A;  2X3W D;  2VGN A;  4A53 A;  4J7F A;  4C8Q E;  3M56 A;  5K1P A;  1W2B A;  2QHS A;  4LDX A;  3ICA A;  3G7Z A;  4XEM A;  2LJ3 A;  4M78 G;  2Q7H A;  1ZBX A;  1U1S A;  2ODR D;  4RQE A;  2NWM A;  1JQQ A;  2RJD A;  1WA7 A;  1FMK A;  3RBB B;  5DLO A;  3WXM B;  1W66 A;  1PD0 A;  2LNH B;  5GAN e;  3HSB A;  1H3H A;  1ZLM A;  2QQ9 A;  2QHU A;  4M75 F;  4FSX A;  1ACM B;  4Y28 E;  3BY7 A;  4Z88 A;  4J9D A;  2D8H A;  2DRM A;  2V8J A;  3G4S A;  1QVF P;  1JJ2 A;  1KIK A;  1SG5 A;  1B07 A;  3KUF A;  4ZTU B;  2L0A A;  1VQ8 T;  2K9G A;  3DKM A;  2JJ9 A;  3A74 A;  3KFU A;  2QDL A;  2JS0 A;  3J81 E;  2LT4 A;  4LDU A;  2JXB A;  4MML A;  2CH4 W;  1WIE A;  2KE9 A;  1LVK A;  1RAF B;  2O9S A;  4M78 E;  2ROL A;  1SPK A;  4IIM A;  4C0D C;  4BY6 C;  2VXF A;  1VQP T;  1W2B S;  2EQM A;  2KAF A;  2DTI A;  5GAN 3;  1QVG A;  5GAN 6;  2HL3 A;  2SRC A;  3QWY A;  1NJ8 A;  2YUO A;  1VQ5 A;  3F70 A;  4QQG A;  2AK5 A;  2VKN A;  5GAO q;  1E1T A;  5LJ5 f;  1NJ1 A;  4MZT A;  2ZNJ A;  1W4S A;  1AT1 B;  6AT1 B;  2FG0 A;  3VQV A;  3S3M A;  1GFD A;  2V1Q A;  2DLP A;  2Q5I A;  1D0X A;  2F2V A;  2RI3 A;  4BW9 A;  4DQ2 A;  4JDS A;  2FO0 A;  2EW3 A;  3MP8 A;  2RI2 A;  4DBR A;  8AT1 B;  3SWN B;  5CQY A;  3E19 A;  3V8K A;  2AHJ B;  2HNI A;  4LD9 K;  2F2X A;  5KYX B;  1D0Y A;  3OMG A;  3G71 A;  1BKB A;  2RHZ A;  2EFI A;  1NPP A;  5KYY B;  2OTJ T;  2ZT6 A;  5CKD A;  3DLL A;  3OYJ A;  1VQM T;  2C8M A;  3P8V A;  1NZ9 A;  1EVK A;  2ESW A;  4J9I A;  3A8L B;  5GMK h;  1FYN A;  2KK4 A;  4X1V A;  2DO3 A;  2P0K A;  4PFZ A;  3CCE A;  2G6F X;  2HD0 A;  3VS3 A;  1LJO A;  1I5O B;  4ZGD B;  4PLI A;  4PJO E;  5GAM f;  2CYZ B;  4KR2 A;  4YRN A;  4IUQ A;  3HY0 A;  4TWA A;  1AZG B;  1SKU B;  3H6Z A;  1NG2 A;  1OPL A;  2KNB B;  4F7U A;  3A31 A;  1TXQ A;  2DD4 A;  3M4P A;  1ZQ1 A;  1HXD A;  3OA6 A;  1W70 A;  4FT4 A;  2DBM A;  1UUE A;  1JO8 A;  2MIO A;  4N4G A;  2HBP A;  5KH6 A;  4E51 A;  2RA2 A;  1PD1 A;  4TVA B;  1RI0 A;  4YRM A;  4A4H A;  3TEH A;  1K0X A;  2DU7 A;  2PVO B;  1ABO A;  1M2V B;  1N9W A;  3I5R A;  1G8X A;  1J3T A;  4YRE A;  4YYE A;  2PUO B;  2CZ6 B;  5A0G A;  1X69 A;  2YXY A;  1OPK A;  3X24 B;  1U1T A;  1WHL A;  4M78 C;  2ZZE A;  1NPR A;  3HHT B;  1WLE A;  1QCF A;  4CC4 B;  4FYW B;  1EFW A;  4K11 A;  1XNI A;  3JV3 A;  2EYQ A;  1G2B A;  2RHX A;  3CPW S;  1K0S A;  1QWF A;  1WJR A;  1VQK Q;  3MF2 A;  3UT1 A;  5GAN 7;  2L3Q A;  1ZUY A;  2LJ0 A;  3P8Y A;  4PJM A;  3D7S B;  3CCE T;  3HXZ A;  1M30 A;  1B7T A;  1YWO A;  2P0P A;  3PCO B;  4DOW A;  3CMA Q;  4TQF A;  3VS6 A;  4ANJ A;  1VQ5 T;  2GBQ A;  2ZAE A;  2E5K A;  3PGG A;  2RQR A;  1U5S A;  3OYN A;  3CCQ T;  2P4T A;  3PZC A;  4F7U F;  4XU2 A;  4ME7 A;  2K5I A;  1RI9 A;  3LGL A;  5GJV B;  4C0G A;  3JB9 J;  2DKG A;  4UP9 A;  3MEU A;  4DA4 A;  3NEL A;  3EH2 A;  3WVE B;  5DM7 R;  3JB9 F;  2RHS B;  4ELY C;  2QHV A;  4UPA A;  4RCB A;  4D8K A;  4O5V A;  4C92 F;  2DDZ A;  2M9U A;  1VA7 A;  2EQK A;  3CCM T;  2K5L A;  4FT2 A;  5GAM h;  4JRI A;  2P0Q A;  4FYY B;  2XK0 A;  5FU7 B;  1RL2 A;  4QT7 A;  5GAN g;  3O8V A;  1UB4 A;  3I56 T;  1X01 A;  1YI2 T;  1KQS P;  4HT9 A;  4JS5 A;  2D6F A;  4KH0 B;  1YJ9 Q;  3OW2 S;  1SET A;  4PK4 A;  1ABQ A;  1VQ8 Q;  3G4S Q;  4LVM A;  2OAU A;  5GMK m;  3L2V A;  3WVD B;  3M0P A;  4E2F B;  1YBY A;  3MPU B;  4HWP A;  2XU8 A;  1TUC A;  2PVG B;  1VQL A;  2DER A;  2F5K A;  3UGQ A;  1GBQ A;  1TSF A;  4LXC A;  4Q5W A;  4M77 A;  2WAC A;  3EFO B;  2EGE A;  3OYA A;  3BJU A;  3PT9 A;  1IL2 A;  5LJ3 e;  2C0I A;  4XU1 A;  1VQM Q;  1VQN Q;  1Q82 R;  2R57 A;  3ZL7 C;  1LOJ A;  2EJG A;  1M3A A;  1ZX6 A;  1YJN Q;  4C8Q G;  4IUT A;  4N0A C;  1PKT A;  3CCU A;  2DAQ A;  1AWW A;  1Q82 C;  2CT3 A;  4HCC A;  3OYD A;  2COY A;  1UGP B;  4C92 D;  2JW4 A;  3QWX X;  3U23 A;  2K4Y A;  3FDR A;  3QYG B;  1TS9 A;  1UHF A;  1PRM C;  4PJO D;  1GXI E;  2J6F A;  5KYY A;  5J39 A;  3P8T A;  2RHY A;  2OI3 A;  4M77 D;  4PJO G;  1GCQ C;  4M7A G;  1KHI A;  1D3B B;  4R55 A;  1L0W A;  3VS7 A;  5CKE A;  1WGS A;  4J9C A;  3DB4 A;  3M4Y A;  2COZ A;  1B76 A;  4V2S A;  4R56 A;  3VS4 A;  3A8G B;  3E9G A;  5LJ3 d;  3A7A A;  5GAN j;  3SD4 A;  2JN0 A;  2OTJ A;  2QA4 A;  2RK1 A;  1X2K A;  2C0T A;  4C92 B;  5F5W A;  3JRZ A;  2MAM A;  2M51 A;  2PVD B;  1SRY A;  1YGB A;  3RF1 A;  1UJ0 A;  2MI6 A;  3R07 A;  2LQ8 A;  1OZ3 A;  2BZ8 A;  1MV0 B;  2KBT A;  2PNI A;  3OBY A;  4JJD A;  4L5G A;  2KY9 A;  1M1K R;  1PHT A;  1AZE A;  1K73 R;  1GCQ A;  1IGQ A;  3OD1 A;  1VUB A;  1BBU A;  1VIE A;  4F7U G;  1IRE B;  5GMK i;  3RIR A;  2ZPF B;  2LVM A;  3M0Q A;  5IXB A;  1USY A;  4M78 F;  2PMF A;  1VQ9 Q;  1KQS S;  4H2W A;  3VQY A;  3R6N A;  3NET A;  2FRW A;  1U8R A;  1VIF A;  1GRI A;  3QJY A;  4NL3 A;  3CPF A;  4RG8 A;  3I9Q A;  3MKD A;  4AFU C;  1K9M R;  3MQZ A;  5DY9 A;  4M75 B;  3S3N A;  3CCM Q;  5I21 A;  1IGU A;  3MEW A;  1M90 U;  1XJW B;  3HL8 A;  3QXE B;  1D3B A;  1NJI U;  3CCL Q;  3VRY A;  2E5A A;  1QKW A;  4RTU A;  3KFV A;  4WF2 A;  3G4S T;  1X6G A;  1N8R U;  2LQN A;  1KD1 C;  1CKB A;  2R5M A;  4JRK A;  3RER A;  1X2G A;  1UEB A;  4AG2 C;  2RQT A;  4J6X A;  4PJO B;  1IHW A;  4PG3 A;  2BTT A;  2MWP A;  3CCU T;  5DLQ E;  4P74 A;  1VQ8 A;  2AKL A;  1ZBJ A;  4A4G A;  5FRM A;  1JXM A;  2L3P A;  2VV5 A;  1JEG A;  3A98 A;  4C5E A;  4CRI A;  1H92 A;  1YHQ Q;  1NJ5 A;  4L6V 5;  3VRZ A;  3UWN A;  4J9F A;  3M4G A;  2QTV A;  2CUB A;  2VGM A;  4E47 A;  1JJ2 S;  2CUD A;  2ODR C;  3CCJ T;  3JCM b;  1WNL A;  3CME A;  2A37 A;  2K2V A;  2DBK A;  4LDW A;  2XG8 D;  1YNZ A;  5KYW A;  2ZZG A;  3GNF B;  2HKN A;  2ZPB B;  2VVK A;  4ZGJ B;  4PJN A;  4P72 A;  1PC0 A;  1VQL Q;  2YLB A;  4GLM A;  4M7D A;  4F17 A;  2LCL A;  2Q5H A;  1V29 B;  2VXE A;  2QI2 A;  1OUL A;  3CBM A;  2BZX A;  4DEY A;  4UC4 A;  2DZC A;  5IAY A;  1YI2 Q;  3NPF A;  2ZT8 A;  2CSQ A;  1V76 A;  1H4V B;  1VQ4 T;  1WLP B;  5FU6 C;  2O88 A;  2CJ9 A;  1YJW Q;  4YRO A;  3EGD A;  2P84 A;  4D8D A;  3P8B B;  4Z8A A;  4RUG A;  1MUZ A;  2DD5 A;  4XTZ A;  1K73 C;  4J9E A;  4OB3 B;  4FU6 A;  3T9N A;  3A1P A;  2BIV A;  4TVA A;  1Q81 U;  2KRN A;  1VQO T;  3REA B;  4Z89 A;  5CCA A;  4VUB A;  4H2T A;  2AZV A;  3QHS A;  4XTX A;  3EG3 A;  4JRQ A;  2RQV A;  3CCL A;  2M1H A;  1QVF S;  1LPL A;  2QQB A;  3FIF A;  3I55 A;  2BE7 D;  3CC7 Q;  4P3P A;  1CSK A;  4M78 B;  4M77 G;  5FWB A;  12AS A;  4PJO C;  1WHG A;  2FZG B;  3HXY A;  2DVE A;  5ELO A;  4ZNX A;  4H2V A;  1ZA1 B;  2GF7 A;  2GTJ A;  4IUV A;  4J8O A;  2E6Z A;  4E6R A;  3JB9 D;  5J26 A;  2CZ7 B;  2QYZ A;  2GGR A;  3CMA T;  5GAN 4;  1WHH A;  2RB6 A;  4C8Q D;  1SRM A;  3H0I A;  4NS5 A;  5A0L A;  1OOT A;  3IKL A;  2VYT A;  4PJJ A;  5KYX A;  2QA4 T;  1IHV A;  1Q81 C;  1FMV A;  1BBZ A;  3H41 A;  2DJQ A;  1SEM A;  1S72 A;  4RMO A;  1C0A A;  3RMS A;  3RDV A;  2LZ6 B;  2DTH A;  3QZ9 B;  2VB6 A;  3HTZ A;  5GAN h;  1QVF A;  1RAD B;  3HXU A;  4HWS A;  4J7I A;  4RTT A;  1N6A A;  1YI2 A;  1YWP A;  1IB8 A;  2PZ1 A;  1H3Z A;  1ADY A;  3G6E A;  3CC2 Q;  3E9H A;  4C0D B;  3CQT A;  3AHU A;  2QEX A;  1N5Z A;  1G3Y A;  1Y0M A;  3EG1 A;  1YHQ T;  1F1B B;  3CBO A;  1C6V X;  2HQE A;  3X26 B;  2RF0 A;  2EIF A;  2E3C A;  3UH0 A;  3VS1 A;  3OS2 A;  2KI7 A;  4IUR A;  3HFN A;  2HQH A;  4KRT A;  2FRY A;  1WZO A;  3OW2 P;  3RKW A;  1G5H A;  2ZT5 A;  2ZCE A;  2YRD A;  1VQ9 T;  4C8Q B;  3C95 A;  2CZ1 B;  4M77 B;  2J6K A;  2E70 A;  1HC7 A;  3M57 A;  4PJL A;  2NUP A;  1K8A C;  4E7Z A;  3OS1 A;  1JJC B;  1UE9 A;  2RH2 A;  2RM4 A;  3GIB A;  2X4Y A;  3CC7 A;  2XI9 A;  4CH3 A;  5HCK A;  4OB0 B;  5AT1 B;  2CH4 A;  4JRP A;  2C0O A;  1VQN T; 
#chains in the Genus database with same CATH homology
 3CCM A;  1UGR B;  4BDY A;  2EQU A;  2ZNI A;  5I2M A;  2DXB A;  5KCO A;  3E1S A;  4BB7 A;  1JJC A;  4TVY A;  3JCM g;  4EMK C;  1G3S A;  4YTL A;  3DLM A;  5LJ3 f;  3MO8 A;  3QO5 A;  1VQ4 A;  4EMG A;  2X4W A;  4E7I A;  4RMF A;  5GAM d;  1KQ1 A;  3LW5 E;  4M78 A;  2ZPE B;  2IVW A;  3QKJ A;  4M77 E;  1Q86 C;  2QXF A;  5I2S A;  1VQP A;  4PLL A;  5HGQ A;  4M77 F;  2I4O A;  4C8Q F;  3JSC A;  3H8Z A;  3NEM A;  4Z02 A;  3G6E T;  1ZHI A;  4OGC A;  3V7R A;  4YRJ A;  5D6X A;  1YHQ A;  1TH7 A;  1Y96 B;  3OYI A;  4YPF A;  2DU5 A;  2FL7 A;  1BI1 A;  4ZGE B;  4M7A F;  2QHT A;  4OF1 A;  3LSQ A;  4M7A E;  1SER A;  4WJ3 M;  1YFS A;  2RHU A;  3CXC A;  5GAO n;  3A8M B;  3W3S A;  1WJQ A;  2LX9 A;  3VYH B;  4M7D B;  5GAN 2;  5GAO m;  3UGT A;  3FJP A;  3M4Q A;  2KSS A;  4EMK B;  1X56 A;  2MWO A;  3LX7 A;  3OYB A;  2Y4Y A;  4P3O A;  2HAX A;  4HT8 A;  3CMA A;  2CIM A;  2M16 A;  4CS3 A;  1VQ7 T;  2XTI A;  2FB7 A;  3CCL T;  4MDX A;  1KD1 U;  3A8O B;  5LJ3 h;  4BDZ A;  1EQR A;  1KMN A;  5GMK j;  1O75 A;  1VQK T;  1X55 A;  3OW2 A;  3JCM J;  3A7R A;  2CS7 A;  5D6W A;  4JLG A;  4HKE A;  3CPW A;  4LVL A;  1BI2 A;  3QO7 A;  4J5Y A;  3PNW C;  3CC2 T;  1UGQ B;  2B8A A;  3A5Z A;  5IN1 A;  3M9Q A;  4YCV A;  3RMQ A;  1QW1 A;  1NJ6 A;  3Q1J A;  3MP6 A;  5C53 B;  4ZTZ B;  3QZ5 B;  3MCA B;  4F7U E;  4LVK A;  1N9R A;  4YCW A;  2EKO A;  5LJ3 g;  1M1K C;  3QSU A;  3SWN A;  3JB9 H;  5L8R E;  2QQS A;  2GFU A;  1EVL A;  3V8J A;  1M1F A;  2DPP B;  1KC8 C;  3JAM E;  2VC8 A;  4YCU A;  2DJZ A;  1VQN A;  4Y91 A;  4XQ3 A;  1GGM A;  3VUZ A;  2PQW A;  4X34 A;  1KC8 U;  5CR2 A;  3CEY A;  4M7A C;  4D6W A;  3CCJ A;  4HCB A;  3QUI A;  4M7D D;  4H2Y A;  3HFV A;  2RHQ B;  2ARS A;  2DEQ A;  3V7C A;  3TU4 K;  1XOV A;  4OB1 B;  1BIB A;  3TUP A;  1XQH A;  2DXT A;  5GAN d;  1ADJ A;  2CGH A;  4TQD A;  4QVD A;  4E7H A;  1LNX A;  3OS0 A;  2RHQ A;  4HT4 A;  1FYF A;  1WJS A;  5GAO r;  1G3T A;  2RHS A;  3PMT A;  4BI8 B;  1JB0 E;  1Y71 A;  2DTO A;  4C5G A;  3FRN A;  4G84 A;  2JTM A;  4DOV A;  4E7J A;  1H64 1;  2E12 A;  3I55 T;  1R8O B;  3MHX A;  4CS4 A;  5C6S A;  1HTT A;  2AMC B;  5HKC A;  4X9D A;  4BUG A;  5KCH A;  3X20 B;  4NL2 A;  2K57 A;  2L5Q A;  5ELN A;  1M5Q 1;  3NTH A;  2I2L A;  3GLX A;  4J6W A;  2OTL T;  3FLG A;  2GQV A;  5AYF A;  3EFS A;  2E10 A;  5FRO A;  4P73 C;  4RG2 A;  1M1G A;  4BY6 B;  2EQJ A;  5D6Y A;  4KBM B;  1K9M U;  4EMH A;  4M75 E;  4MZM A;  5KE2 A;  2BUD A;  1SES A;  1G5V A;  3E9I A;  1VQ6 T;  2FYK A;  1WYD A;  5A2Q E;  3LYI A;  3SDZ A;  4ATO A;  4ZIB A;  3OYY A;  2JTF A;  2G4C A;  4YRI A;  11AS A;  1X2H A;  4LVI A;  3M55 A;  1NYQ A;  1XTD A;  2PUK B;  3QG1 A;  3OSS C;  3RKY A;  3DSQ A;  4M7D E;  4YRK A;  3VYG A;  4XAX B;  4IUU A;  2FVU A;  4G85 A;  3UPU A;  1WU7 A;  3NFC A;  2HQX A;  1YFT A;  4BD3 A;  4NCX A;  3HRU A;  3J80 E;  4J6Y A;  2E6N A;  2M0O A;  4HVC A;  3JCM V;  4C8Q C;  3OMC A;  4PJO A;  4JLI A;  2RJC A;  2ZIO A;  3OYL A;  4C92 A;  3OYG A;  3HP9 A;  4B9X A;  4ZTJ A;  1NE8 A;  5FLX E;  1YIT T;  3OSV A;  3OB9 A;  4E7K A;  1YJN T;  4XK8 E;  2XGT A;  5E3I A;  3L2Z A;  3NEN A;  4LDY A;  3MF1 A;  1VQL T;  4LD6 A;  3KXT A;  4OGE A;  2RO0 A;  3ZEH A;  3M54 A;  3QJ6 A;  4HWR A;  2LC4 A;  3OBW A;  4K88 A;  3MP1 A;  3ER0 A;  3OYF A;  2X4J A;  4F7U B;  5CKF A;  3QTC A;  1OYX A;  2H3J A;  2ZGW A;  4C0F A;  4RDX A;  4A54 A;  3OYH A;  1G51 A;  3SB2 A;  1B34 B;  1B70 B;  2PU9 B;  3NTI A;  4YRR A;  1K73 U;  4H02 A;  1VQ7 A;  4KUL A;  3M58 A;  3JCM d;  3GPL A;  3CCV T;  1BBW A;  3NTK A;  3FEO A;  4YRT A;  3JB9 I;  2A8E A;  5FU7 C;  5GAN 5;  4JJN K;  5HK3 A;  2DIQ A;  4C8Q A;  4NOY A;  3RUX A;  3TEE A;  4WI1 A;  4XEO A;  1QE0 A;  4QVC A;  1QF6 A;  4HWT A;  4KUD K;  1YJ9 A;  2E41 A;  3QBY A;  3C4S A;  3OQ5 A;  2DQ0 A;  3RES A;  3BFM A;  1N27 A;  5LJ5 d;  5HY6 A;  1E22 A;  2YLC A;  3HPW A;  3HFZ A;  2F69 A;  4RKU E;  1ASY A;  1HK9 A;  2V8K A;  3HXW A;  1VQM A;  2ZT7 A;  2K3Y A;  4ELZ C;  4P71 A;  1NNH A;  2VUB A;  1Z7N A;  2JUF A;  1B70 A;  2IY5 A;  2Q7G A;  3E9F A;  1N9S A;  2J3L A;  4P5N A;  3PIP A;  5LJ3 j;  4YRL A;  3LWH A;  1UGS B;  3RGL A;  3IAL A;  5GAM j;  4YRF A;  3LWI A;  2EWN A;  4BI4 A;  3I56 A;  3A5Y A;  1OI1 A;  4LDV A;  3JCM f;  2CJB A;  4YRS A;  2GCX A;  5GAN 8;  3CC7 T;  4ZTF A;  5IT9 E;  3MEV A;  4EDU A;  1EOV A;  2E1H A;  1B7Y A;  4EMK A;  4MDW A;  4BE0 A;  4N0A A;  2Q7E A;  4AH6 A;  2DZ9 A;  2ZR3 A;  2BKD N;  4TVR A;  4QW2 A;  3VJP A;  1H4S A;  3TCJ A;  4P75 A;  2I4N A;  1MHN A;  3P8H A;  2Y90 A;  1YIJ A;  4PKC C;  3TRE A;  2ALY A;  1SSF A;  2G3R A;  1USY C;  4LVJ A;  1VQ9 A;  4C92 G;  4CH5 A;  4X5O A;  4BE1 A;  4CH6 A;  3HRI A;  3LGF A;  1YIT A;  1X6O A;  3JCM P;  2EL9 A;  2P0L A;  1X75 C;  1YJN A;  2L8D A;  2L89 A;  2C06 A;  4XTV A;  4C5I A;  5LJ5 g;  4EPC A;  1KG1 A;  4PL6 A;  4K86 A;  2JZ2 A;  2ZZF A;  3CMQ A;  2QQR A;  2K5F A;  4C5H A;  2KDS A;  2D0Q B;  4M7D F;  4HCZ A;  4CS2 A;  1Q82 U;  1WPY A;  4RQF A;  2ZZD A;  5CIU A;  4H2U A;  2DIG A;  2WSF E;  4QQD A;  1M1K U;  4K87 A;  3ASK A;  2ZPI B;  3DB3 A;  2XIC A;  2EAY A;  2JVV A;  3OS5 A;  2WSC E;  1I81 A;  4UP7 A;  2XHC A;  1KMM A;  3LSS A;  2IY5 B;  3PTA A;  1LYL A;  1Q7Y U;  2MMP A;  2ALY B;  1G3W A;  2X35 A;  2JOY A;  3ZBD A;  1YJ9 T;  3CD6 T;  1M8V A;  1NJ2 A;  2ZPH B;  5C0M A;  3JCM h;  4H2X A;  1S72 T;  2DK3 A;  5LL6 S;  3HFZ B;  1QP3 A;  5C52 B;  4M7A A;  4KR3 A;  2LDM A;  4P3N A;  2R58 A;  3MET A;  2ART A;  1M4Z A;  3GF5 A;  4EO4 A;  2WSE E;  4Q15 A;  4P71 C;  2F5T X;  4HA8 A;  2OTL A;  3JCM Q;  1EIY B;  3PMI A;  5GAO l;  1KHC A;  4UP8 A;  1VQO A;  2ZIN A;  4CI0 C;  4M75 C;  4M7D C;  5CK9 A;  3JCM c;  1BIA A;  5LJ5 e;  1KQS A;  4A4K A;  3LLR A;  5M9O A;  3HY1 A;  5GAN f;  2RHI A;  3L4G B;  4BE2 A;  4H2X B;  3OYK A;  1FXX A;  4X9C A;  4H2S A;  3C94 A;  3V8L A;  3FC3 A;  4A4E A;  2NLU A;  2RD1 A;  3SFM A;  3QNE A;  4P72 C;  3ERR A;  1YFR A;  3PIO A;  1I4K 1;  2I4M A;  4CH4 A;  3CCR A;  4WJ4 A;  4XTU A;  3VQX A;  4IKF A;  2V8I A;  5FRN A;  3PFS A;  3A7U A;  3CC4 A;  2KQW A;  4OLF A;  3REX A;  4M7A D;  1K9M C;  2C7I A;  1WQ7 A;  1OZ2 A;  4XTW A;  2ZR2 A;  2XD0 A;  1AHJ B;  2NS6 A;  4TTV A;  1K8A U;  2LT1 A;  1BI3 A;  2ZCF B;  5KNN A;  3RAC A;  5GMK l;  2O4X A;  1QVP A;  2GFA A;  5CVI A;  3CCR T;  4OP0 A;  3CCQ A;  4J83 A;  3M53 A;  4YRP A;  1PSF A;  1KOG A;  3CC2 A;  3REU A;  1I8F A;  1JBM A;  1KQ2 A;  1VQ6 A;  4QVZ A;  3QO8 A;  1FWZ A;  2P5I A;  5LJ5 j;  1B34 A;  3L2W A;  4ZN1 A;  5EG2 A;  3INZ A;  3LH0 A;  3SWN C;  4C92 E;  1J5W A;  4II1 A;  4LNS A;  2KMT A;  2E5Q A;  1Q86 U;  2K3X A;  3HRK A;  1ASZ A;  4QQ6 A;  3QPH A;  4FL6 A;  4B9W A;  1YB3 A;  3I7F A;  2LRQ A;  3OYC A;  1I5L A;  2YRV A;  4C92 C;  3L42 A;  4BWA A;  2DQ3 A;  3VBB A;  1VQZ A;  5CQX A;  4P73 A;  1BI0 A;  2LNV A;  3BW1 A;  2ARU A;  1X54 A;  3HKS A;  3OY9 A;  2IG0 A;  4ZN3 A;  3GOX A;  2ZIM A;  4M75 G;  2YHT A;  3JCM e;  3WQZ A;  4BI3 A;  3MEY A;  3S3O A;  4TVW A;  1B8A A;  3L4G A;  1PYS B;  4C0Z A;  1VQK A;  1H4Q A;  3S6W A;  4A4F A;  5FU6 B;  1BYM A;  2D9T A;  4YRQ A;  1YJW T;  2FHD A;  4PNO A;  2I4L A;  2O01 E;  4GY5 A;  5CKH A;  4RCC A;  1Z7M A;  2RJF A;  2XKO C;  3ZFJ A;  4IUP A;  3X28 B;  2KVQ G;  2RJE A;  4OMF B;  3QYH B;  3VV0 A;  3JCM W;  4YDQ A;  2MF2 A;  1PSE A;  3M59 A;  4JUV A;  3G71 T;  3CCV A;  1DJ7 B;  3PCO A;  3G1Z A;  2AMC A;  2AKW A;  4YRG A;  1Y7X A;  1FX7 A;  3TEG A;  4PJO F;  2XDD A;  1IZ6 A;  4MMK A;  4DPG A;  5J3B A;  2QTX A;  3CBP A;  3KBG A;  1YCY A;  4FIB A;  3QO3 A;  3HRS A;  4GLK A;  3L2U A;  3P8D A;  1MGQ A;  2R5A A;  4N4H A;  3GP8 A;  3V7S A;  5A0D A;  4M7D G;  5CO7 A;  4XTY A;  5GAM e;  3IG2 A;  2E64 A;  2LQK A;  4EX5 A;  4BAC A;  3VUB A;  2LCC A;  1PYS A;  2DXC A;  1YIJ T;  2Y4X A;  3BDU A;  2ZTG A;  4OB2 B;  2CZ0 B;  4M75 A;  3CD6 A;  5CKB A;  4YP0 A;  4L59 A;  3RKX A;  3OYE A;  1WQW A;  2ZPG B;  3IKM B;  2EJF A;  2QEX T;  2AKW B;  3BDL A;  3UFG A;  2E65 A;  1EIY A;  1N8R C;  4J15 A;  3L2Q A;  1RIQ A;  1O9S A;  2DXU A;  3A32 A;  4M75 D;  3VQW A;  1QVG S;  4P74 C;  1Y07 A;  1JRI A;  4M77 C;  3L1A A;  2JNG A;  4M7A B;  3C12 A;  4N4I A;  3ME9 A;  4L87 A;  3L2R A;  2CKK A;  1G5I A;  4XU3 A;  3FB9 A;  4OVA A;  3RL6 A;  3J7A F;  1Y96 A;  1YJW A;  3HXV A;  1P92 A;  1M9S A;  4HWO A;  4PHC A;  3CC4 T;  5HK0 A;  1B7Y B;  3A5Z B;  3M5A A;  1E1O A;  4MZP A;  3VU3 C;  1QP2 A;  5LJ5 h;  1E24 A;  4YRC A;  3VKI A;  2L3R A;  2XDB A;  5CAI A;  3QDR B;  1NJI C;  4O6J A;  3HRT A;  2XID A;  4FM4 B;  1H4T A;  3HXX A;  2CJA A;  3CXC S;  2QDY B;  3JB9 G;  4O2D A;  3GNG A;  5K1X A;  2QQA A;  3OYM A;  5GMK e;  3CCS T;  3A8H B;  1M90 C;  1EIF A;  4M78 D;  2EJ9 A;  2A3L A;  5GAO p;  4KUI A;  3N5B B;  3HFO A;  3CCS A;  2PME A;  3LC0 A;  4KT0 E;  4P75 C;  4XU0 A;  1ATI A;  4KQE A;  3X25 B;  3R6O A;  2X4X A;  3UDC A;  2O4X B;  3CME T;  3EFR A;  1Q7Y C;  5GAM g;  2LTO A;  3MEA A;  3TEH B;  5KE3 A;  4JS4 A;  3EAE A;  1NYR A;  2RI5 A;  3JCM X;  4E7L A;  5C51 B;  2XDP A;  4Q6G A;  3QII A;  2ZXF A;  2J3M A;  2RK2 A;  3URG A;  2A7Y A;  4A53 A;  2VGN A;  4C8Q E;  4J7F A;  3M56 A;  5K1P A;  1W2B A;  2QHS A;  4LDX A;  3ICA A;  3G7Z A;  4XEM A;  4M78 G;  2Q7H A;  1ZBX A;  1U1S A;  2ODR D;  4RQE A;  2RJD A;  5DLO A;  3WXM B;  1W66 A;  5GAN e;  3HSB A;  2QQ9 A;  2QHU A;  4M75 F;  4FSX A;  4Y28 E;  3BY7 A;  2V8J A;  3G4S A;  1JJ2 A;  3KUF A;  4ZTU B;  1VQ8 T;  3DKM A;  3A74 A;  3KFU A;  3J81 E;  2LT4 A;  4LDU A;  4MML A;  4M78 E;  4C0D C;  4BY6 C;  2VXF A;  1VQP T;  1W2B S;  2EQM A;  2KAF A;  2DTI A;  5GAN 3;  1QVG A;  5GAN 6;  1NJ8 A;  1VQ5 A;  3F70 A;  4QQG A;  5GAO q;  1E1T A;  5LJ5 f;  1NJ1 A;  4MZT A;  2ZNJ A;  1W4S A;  3VQV A;  3S3M A;  2Q5I A;  4BW9 A;  2RI3 A;  4DQ2 A;  4JDS A;  3MP8 A;  2RI2 A;  3SWN B;  5CQY A;  3E19 A;  3V8K A;  2AHJ B;  2HNI A;  4LD9 K;  3OMG A;  3G71 A;  1BKB A;  2RHZ A;  2EFI A;  1NPP A;  2OTJ T;  2ZT6 A;  5CKD A;  3DLL A;  3OYJ A;  1VQM T;  2C8M A;  3P8V A;  1NZ9 A;  1EVK A;  3A8L B;  5GMK h;  2KK4 A;  2DO3 A;  2P0K A;  3CCE A;  2HD0 A;  1LJO A;  4ZGD B;  4PLI A;  4PJO E;  5GAM f;  2CYZ B;  4KR2 A;  4YRN A;  4IUQ A;  3HY0 A;  4TWA A;  3H6Z A;  4F7U A;  3A31 A;  2DD4 A;  3M4P A;  1ZQ1 A;  1HXD A;  3OA6 A;  4FT4 A;  4N4G A;  2HBP A;  5KH6 A;  4E51 A;  2RA2 A;  4TVA B;  1RI0 A;  4YRM A;  4A4H A;  3TEH A;  2DU7 A;  2PVO B;  1N9W A;  4YRE A;  4YYE A;  2PUO B;  2CZ6 B;  5A0G A;  3X24 B;  1U1T A;  4M78 C;  2ZZE A;  1NPR A;  3HHT B;  1WLE A;  1EFW A;  1XNI A;  2EYQ A;  2RHX A;  3CPW S;  1WJR A;  3MF2 A;  3UT1 A;  5GAN 7;  3P8Y A;  3CCE T;  3HXZ A;  2P0P A;  3PCO B;  4DOW A;  4TQF A;  1VQ5 T;  3PGG A;  3OYN A;  3CCQ T;  2P4T A;  3PZC A;  4F7U F;  4XU2 A;  4ME7 A;  2K5I A;  3LGL A;  4C0G A;  3JB9 J;  2DKG A;  4UP9 A;  3MEU A;  4DA4 A;  3NEL A;  3JB9 F;  3WVE B;  5DM7 R;  2RHS B;  4ELY C;  2QHV A;  4UPA A;  4RCB A;  4O5V A;  4C92 F;  2DDZ A;  2M9U A;  2EQK A;  3CCM T;  2K5L A;  4FT2 A;  5GAM h;  4JRI A;  2P0Q A;  2XK0 A;  5FU7 B;  1RL2 A;  5GAN g;  3I56 T;  3O8V A;  1UB4 A;  1X01 A;  1YI2 T;  4HT9 A;  4JS5 A;  2D6F A;  3OW2 S;  1SET A;  4LVM A;  2OAU A;  5GMK m;  3L2V A;  3WVD B;  1YBY A;  4HWP A;  2XU8 A;  2PVG B;  1VQL A;  2F5K A;  3UGQ A;  4Q5W A;  4M77 A;  2WAC A;  3OYA A;  3BJU A;  3PT9 A;  1IL2 A;  5LJ3 e;  4XU1 A;  2R57 A;  1LOJ A;  2EJG A;  4C8Q G;  4IUT A;  4N0A C;  3CCU A;  2DAQ A;  1Q82 C;  4HCC A;  3OYD A;  1UGP B;  4C92 D;  2K4Y A;  3FDR A;  3QYG B;  4PJO D;  1GXI E;  5J39 A;  3P8T A;  2RHY A;  4M77 D;  4PJO G;  4M7A G;  1KHI A;  1D3B B;  4R55 A;  1L0W A;  5CKE A;  1WGS A;  3DB4 A;  3M4Y A;  1B76 A;  4V2S A;  4R56 A;  3A8G B;  3E9G A;  5LJ3 d;  3A7A A;  5GAN j;  3SD4 A;  2JN0 A;  2OTJ A;  2QA4 A;  2RK1 A;  4C92 B;  5F5W A;  3JRZ A;  2MAM A;  2PVD B;  1SRY A;  1YGB A;  3RF1 A;  2MI6 A;  3R07 A;  2LQ8 A;  1OZ3 A;  3OBY A;  4L5G A;  2KY9 A;  3OD1 A;  1VUB A;  1BBU A;  1VIE A;  4F7U G;  1IRE B;  5GMK i;  3RIR A;  2ZPF B;  2LVM A;  1USY A;  4M78 F;  2PMF A;  1KQS S;  4H2W A;  3VQY A;  3NET A;  1U8R A;  1VIF A;  3QJY A;  4NL3 A;  3CPF A;  4RG8 A;  3MQZ A;  5DY9 A;  4M75 B;  3S3N A;  5I21 A;  3MEW A;  1M90 U;  3HL8 A;  3QXE B;  1D3B A;  1NJI U;  2E5A A;  4WF2 A;  3G4S T;  1N8R U;  1KD1 C;  2R5M A;  4JRK A;  3RER A;  1X2G A;  1UEB A;  4PJO B;  4J6X A;  4PG3 A;  2MWP A;  3CCU T;  5DLQ E;  4P74 A;  1VQ8 A;  4A4G A;  5FRM A;  2VV5 A;  4CRI A;  4C5E A;  1NJ5 A;  4L6V 5;  3UWN A;  3M4G A;  4E47 A;  2VGM A;  1JJ2 S;  2ODR C;  3CCJ T;  3JCM b;  1WNL A;  3CME A;  2K2V A;  4LDW A;  2XG8 D;  2ZZG A;  3GNF B;  2ZPB B;  4ZGJ B;  4P72 A;  2YLB A;  4M7D A;  2LCL A;  2Q5H A;  1V29 B;  2VXE A;  2QI2 A;  3CBM A;  4UC4 A;  2DZC A;  5IAY A;  2ZT8 A;  1H4V B;  1VQ4 T;  5FU6 C;  2CJ9 A;  4YRO A;  3P8B B;  2DD5 A;  4XTZ A;  1K73 C;  4OB3 B;  4FU6 A;  3T9N A;  2BIV A;  4TVA A;  1Q81 U;  1VQO T;  5CCA A;  4VUB A;  4H2T A;  3QHS A;  4XTX A;  4JRQ A;  3CCL A;  2M1H A;  1QVF S;  2QQB A;  3FIF A;  3I55 A;  4P3P A;  4M78 B;  4M77 G;  12AS A;  4PJO C;  3HXY A;  2DVE A;  5ELO A;  4H2V A;  2GF7 A;  4IUV A;  4J8O A;  2E6Z A;  3JB9 D;  2CZ7 B;  5J26 A;  3CMA T;  5GAN 4;  2RB6 A;  4C8Q D;  4NS5 A;  5A0L A;  3IKL A;  2VYT A;  2QA4 T;  1Q81 C;  1S72 A;  4RMO A;  1C0A A;  3RMS A;  2DTH A;  3QZ9 B;  3HTZ A;  5GAN h;  1QVF A;  3HXU A;  4HWS A;  4J7I A;  1N6A A;  1YI2 A;  1H3Z A;  1ADY A;  3G6E A;  3E9H A;  4C0D B;  3AHU A;  2QEX A;  1G3Y A;  1YHQ T;  3CBO A;  2HQE A;  3X26 B;  2EIF A;  2E3C A;  3UH0 A;  3OS2 A;  4IUR A;  3HFN A;  3RKW A;  1G5H A;  2ZT5 A;  2ZCE A;  1VQ9 T;  4C8Q B;  3C95 A;  2CZ1 B;  4M77 B;  2E70 A;  1HC7 A;  3M57 A;  1K8A C;  3OS1 A;  1JJC B;  2RH2 A;  2RM4 A;  3GIB A;  2X4Y A;  3CC7 A;  2XI9 A;  4CH3 A;  4OB0 B;  4JRP A;  1VQN T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...