2EJFA

Crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 65
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ejfA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ejfA01
2QHSA 4MMLA 5LJ5j 1ADYA 4K86A 4YRMA 1N9SA 3TEHB 4TWAA 5GANh 1I5LA 1NNHA 4CS3A 5ELOA 3DSQA 3VU3C 5F5WA 3QSUA 1LOJA 3V8LA 4RCCA 2ZT5A 3RL6A 4RQFA 5LJ5g 5GANg 1HC7A 3VQWA 1NJ8A 5GANf 4TQFA 4JRIA 3NEMA 4M77C 1Y96A 2RD1A 4EMKA 5GAMd 1NJ1A 1QE0A 4P75A 4P3OA 1I81A 1HK9A 3EFSA 4K88A 4TVYA 4RMFA 1EOVA 1BIAA 5GAMe 5GMKm 1USYC 1N9RA 1BBWA 4QVCA 4C92C 4YRKA 5LJ5d 5GANd 1SRYA 3BJUA 1Z7NA 4M78C 3HXUA 3L4GB 4L87A 4CS2A 4H2XB 4WI1A 4BW9A 3P8YA 2E3CA 3QTCA 1H641 4PJOC 2I4NA 1YCYA 4P73C 1FYFA 4F7UF 2ZR2A 4H2XA 3LSQA 4X9DA 5HGQA 2Q7GA 5E3IA 5C52B 2E10A 4YPFA 1SERA 4EMHA 4EO4A 4XTVA 2Q7HA 4E51A 4P3PA 4HWPA 4YYEA 1NYQA 3BY7A 4UP9A 1W66A 2XTIA 12ASA 3PCOB 4HA8A 4M77A 4HVCA 3INZA 4YP0A 1ATIA 4F7UB 2DQ3A 4WJ4A 3RF1A 4YRGA 3PCOA 3HFZB 11ASA 2YHTA 5GMKj 2E65A 4F7UA 1I8FA 5GMKi 3HFZA 1SESA 4M78A 1U1SA 2CGHA 3VQXA 2EAYA 4XU3A 4C8QF 1D3BB 4N0AC 4J15A 1B76A 2EWNA 5I21A 4P72A 1NJ2A 4Q15A 4M7DD 2DZ9A 1D3BA 1H4QA 2DU5A 1B8AA 4EX5A 1WPYA 3JCMb 5GAOn 4M75F 1WQ7A 3IG2A 5GAN3 2ARUA 4YDQA 2AMCB 3BDUA 4M7AF 4HT8A 3HXXA 4M7DA 2ZZFA 3RKYA 4K87A 2E1HA 3QO7A 3RGLA 4LNSA 4XEMA 2AMCA 4DPGA 3KFUA 4YRTA 4M77E 4C8QD 4PG3A 4F7UG 4P3NA 4C8QB 4XEOA 5GMKe 3ERRA 2J3MA 4XTUA 4OLFA 4YROA 3A7AA 1X56A 4P74C 4YRQA 4C8QA 4M75D 3V7RA 4NOYA 4M75B 3HFNA 4EMGA 4M7AD 4H02A 2VXEA 3SWNC 4M78E 4M7AB 1X54A 3M4GA 2IY5B 5GANj 5GAN7 4ZTUB 4M75A 4XTZA 2ZXFA 2DVEA 3W3SA 2DTHA 4TVAB 4M7AA 4DQ2A 3JB9F 2IY5A 3JCMX 3JCMh 4HWSA 3M4PA 3JCMJ 2RB6A 1Z7MA 4TVAA 2Q5HA 4J6XA 1Y96B 2DZCA 4EMKB 3WQZA 1LNXA 1YB3A 4X5OA 1KOGA 1G5IA 4M7DE 4G84A 4YRJA 3JCMg 4CH6A 4H2TA 3JCMf 5K1XA 5GMKl 2ALYB 4P71A 3UFGA 1KMNA 1LYLA 4C8QG 3RIRA 3GIBA 3HXVA 2CJAA 4YREA 5LJ3h 3A74A 3LC0A 3JB9D 4YRPA 2ALYA 3E9HA 3HRKA 4C8QE 2DTIA 4M77F 4M75G 4JRKA 5LJ5e 5GANe 5LJ3g 2DDZA 5LJ3f 4QVDA 4H2WA 4WF2A 3V7SA 4V2SA 4YRSA 1ADJA 3A5ZA 4M75E 2VXFA 4XTXA 1M8VA 4C92F 4Y91A 2DKGA 4M7AE 2RHSB 3UGQA 3IKMB 2G4CA 2DJZA 4M78F 5DY9A 4XTYA 3MF2A 1WLEA 1B70B 1HTTA 2EJGA 1X55A 4PJOF 5CAIA 2RHSA 2ODRC 2ZTGA 2DXUA 1B34B 1EVLA 3P8VA 4M77D 2CJ9A 4M77B 3HFOA 2PMFA 5GAN8 1B70A 4CS4A 1H4VB 4XU2A 2ZZGA 3MF1A 3QHSA 4A53A 2Y90A 3R07A 1B34A 2XGTA 2HNIA 1C0AA 3QUIA 2QHVA 4XQ3A 4C92D 4C92B 4M7DF 1WQWA 4NL2A 3JB9G 2RHQB 4M78D 1USYA 1B7YB 4M78B 4YCVA 4HWTA 4C92A 3HRIA 4PJOD 3A5YA 2RHQA 4PJOB 2YLBA 1B7YA 5GAOp 1I4K1 4PJOA 1KMMA 3V8KA 4P73A 1ASYA 3HTZA 3TUPA 4M7DB 5GAN6 3RERA 1G5HA 3NETA 3I7FA 1YFTA 4ZIBA 2FYKA 3JCMP 5C53B 2DTOA 4YRIA 3JB9J 4YRLA 4Q6GA 4M77G 1WU7A 2DEQA 4UPAA 4PHCA 3LSSA 4YCUA 3HY0A 1PYSB 4G85A 4CH3A 3V7CA 2ZT7A 4KR3A 1KQ1A 1E1TA 1WNLA 4MMKA 3HSBA 3FJPA 4C92G 1PYSA 1H4SA 2EL9A 1JJCB 1X01A 4NL3A 4M78G 3VQYA 1KQ2A 4XU1A 4C92E 2C8MA 4J6YA 1G51A 1JJCA 3A7RA 3IKLA 4H2VA 4YRRA 4EMKC 2ZNIA 4P75C 3JB9H 4HWOA 3SB2A 4H2SA 4J5YA 1H4TA 1RIQA 1X2HA 3QO8A 2YLCA 3BFMA 4PJOE 1E22A 3M4QA 3HXZA 4N0AA 2E5AA 2ZT6A 1JRIA 4M7DG 3QO3A 2DU7A 2Q7EA 3G1ZA 2I4LA 2DXTA 4H2YA 4H2UA 1EFWA 2QHUA 4UP8A 2RA2A 5GAMh 3A32A 4RCBA 4AH6A 1X2GA 1N9WA 4YRFA 3RKWA 3FB9A 5GAOm 2P5IA 5LJ3j 5GAMg 3JCMc 5LJ5h 2CJBA 5GAMf 3A7UA 2FB7A 2CIMA 4TQDA 4CH4A 2ZCEA 5GAN4 2EJFA 3TEHA 2ARTA 4HWRA 4HT9A 3JCMd 5GAOr 4P74A 2PMEA 3SWNB 3L1AA 5LJ5f 5GAOq 3QNEA 5KNNA 1IL2A 4M7AG 1NJ6A 3PGGA 2I2LA 2ARSA 3QO5A 4RDXA 4KR2A 3JCMe 1QF6A 2J3LA 3SWNA 4YRCA 1BIBA 4OP0A 2ZNJA 4ZTZB 5C51B 1E24A 3JCMW 2AKWB 2DQ0A 5LJ3d 1M5Q1 2ZIOA 1TH7A 5LJ3e 2AKWA 1EIYB 4WJ3M 1J5WA 2K57A 3JCMV 3P8TA 2ZT8A 3L4GA 4P72C 3VBBA 2ZGWA 3ICAA 1EIYA 3V8JA 4O2DA 4YRNA 3CMQA 1SETA 3RKXA 2Q5IA 4M7DC 5GAN5 3REXA 1WYDA 2I4MA 2QHTA 1ASZA 4YCWA 3IALA 2I4OA 5ELNA 2JN0A 3AHUA 3NELA 5K1PA 3OD1A 4RQEA 4XTWA 1NYRA 4NCXA 4PNOA 2EJ9A 2QTXA 4C8QC 2ODRD 3L2ZA 3BW1A 4UP7A 3HY1A 1E1OA 1GGMA 5GAN2 4A54A 5GMKh 1EQRA 4M75C 2ZIMA 3RUXA 1U1TA 4M7AC 2ZINA 4JUVA 3RESA 3HFVA 3UH0A 2E41A 1MGQA 4JLIA 3HXYA 3MEYA 2VC8A 3FIFA 4J6WA 3RACA 3UGTA 4PJOG 3TEGA 4BWAA 4TTVA 3EFRA 4XU0A 1YGBA 4P71C 1BBUA 3REUA 2RM4A 3HXWA 3E9IA 3JB9I 2E64A 4CH5A 1L0WA 2C7IA 1NJ5A 1LJOA 5GAMj 2ZR3A 1EVKA 2ZZEA 4X9CA 1YFRA 1YFSA 1VQZA 3NENA 4F7UE 1HXDA 2P0LA 3PZCA 1JBMA 3JCMQ 3VQVA 4KQEA 3A31A 5GAOl 4TVWA
chains in the Genus database with same CATH superfamily
3CMAQ 2QHSA 4MMLA 1KK7A 1ADYA 4F16A 2QQAA 3CCEQ 4J9HA 3TEHB 1GRIA 1QKXA 3PVQA 3C95A 3X24B 3DSQA 5F5WA 1R8OB 1LOJA 1PWTA 5AYFA 4L6V5 1OU8A 1RABB 3RL6A 2EYZA 3CCUA 4RQFA 2HBPA 2D8HA 3VQWA 1E6HA 2BKDN 5FU6C 2D8JA 4LVJA 4QVZA 1R77A 1NEGA 4M77C 4LVLA 4EMKA 2RD1A 3QWXX 5GAMd 4P75A 1RAFB 5EC7A 4K88A 1BIAA 5GAMe 1USYC 1BBWA 5L8RE 4AT1B 2F5TX 2ABLA 1YP5A 4YTLA 3A8OB 2PU9B 1YITT 2X9HA 1H641 2QQSA 1GCPA 3UDCA 2DYBA 2I4NA 3C12A 3QG1A 4H2XA 2L0AA 5E3IA 3CCQA 1SERA 4YPFA 2PVOB 2L89A 1K8AU 4HWPA 2F2XA 3EFOA 8ATCB 3G1JA 3L2VA 1M2VB 2XTIA 2X4XA 1VQ5Q 3QYHB 3EG1A 3CXCA 3WVEB 4HA8A 1QP3A 2IG0A 2KXCA 3VYGA 4HVCA 1OYXA 4KBMB 3INZA 2QA4T 1QKWA 4YP0A 1YJWQ 5HCKA 1VQ4T 1K0XA 4F7UB 2DQ3A 1RI9A 2VYTA 4WJ4A 2L3SA 3RF1A 2EQMA 4YRGA 3HFZB 3I5RA 2E65A 3CMAT 2LTOA 4AFUC 3TVTA 3S6WA 3CCET 1SESA 4M78A 2J7IA 3VQXA 2P0KA 3MPUB 4C8QF 1M3CA 1GCQC 1V1CA 1GBRA 1IHVA 2HKQB 4LDVA 1NJ2A 4M7DD 3A8GB 4FW1A 1B8AA 1U5SA 4M75F 2DMOA 2AMCB 2KR3A 4J9CA 1OZ3A 3MQZA 3RKYA 1ARKA 2K2MA 2EW3A 2E1HA 3QO7A 3RGLA 2LDMA 4YRTA 3I5SA 4C8QD 2XDBA 1PRLC 5CCAA 2J3MA 4XTUA 5ECAA 2K6DA 3S3NA 1IZ6A 1SEMA 4OLFA 1X56A 1X6BA 1TU0B 4M75D 1VQKA 1WXUA 2RQWA 2J06A 4EMGA 4H02A 1RAIB 2VXEA 4M78E 2HQHA 2JTMA 4ATOA 2LCCA 2X35A 1QVGP 5GAN7 3AT1B 3I55A 1D0XA 1PSFA 3JAME 2DVEA 2DTHA 4DQ2A 3JB9F 2O9VA 3NTIA 3JCMJ 1Z7MA 1G83A 4EMKB 1VQ5T 1G5IA 1Y71A 1YJWT 3EGDA 2RI3A 1EX4A 1MMDA 1WLPB 2YT6A 4Z02A 2C06A 3GOXA 1RAAB 1BB9A 3JB9D 2ALYA 2NUPA 1PRMC 2DTIA 1UDLA 3REBB 4FYXB 1Q7YC 3A5ZB 4RMOA 4JS5A 3CCRA 4H2WA 4WF2A 4HCBA 1AWWA 4A4HA 2PVDB 1H92A 2VXFA 2VVKA 4C92F 1NYFA 4Y91A 3I55Q 3H0FA 4LUDA 1K76A 2RHSB 3UGQA 2MWOA 4DEYA 4XTYA 2O4XB 4AFSC 3EFOB 2DF6A 1WLEA 5L23A 2YRVA 2KMTA 2RHYA 3C0CA 5CAIA 1IO6A 2DXUA 3MEUA 2PNIA 3EH1A 2GFUA 1Q7YR 1C6VX 3OW2A 1N6AA 4A53A 3R07A 2XGTA 1C0AA 3FC3A 2MIOA 1SRMA 2WSCE 4C92D 2A37A 5KYYA 5EG2A 1WQWA 1VYTA 2P0PA 4J9EA 2COZA 1GFDA 2RHQB 1B7YB 1T3LA 2XK0A 4M78B 4FW2A 4O6JA 4ZGEB 4YCVA 3GPLA 2IIMA 1ZA1B 3LX7A 2R58A 3M53A 2EVRA 2YLBA 3OYIA 4OB0B 1PM3A 5C0MA 1LPLA 2KXDA 2RHZA 3CXCP 4PJOA 1RACB 4PJJA 3A8MB 3PE0A 4IIMA 1ASYA 2A36A 3E1SA 3HTZA 4E7LA 1NPRA 4OMFB 1G5HA 2RK1A 1PG5B 4ZIBA 2RJEA 2DTOA 2DO3A 2HDAA 4RTXA 1VQ8A 1TUDA 2DEQA 2AHJB 4O5VA 3ULRB 4UPAA 3LSSA 3L2QA 3HY0A 1VQPA 4J9DA 1NPPA 1E1TA 1WNLA 4MMKA 3HSBA 1PYSA 2LQWA 3LGFA 2EL9A 2KROA 2CP6A 2X4YA 1OX8A 5LL6S 1AWJA 1Z9QA 2QAZA 5FWCA 4J6YA 4CRIA 1G8XA 3I55T 4PJLA 2ZNIA 5D6YA 4HWOA 2NYSA 3SB2A 1YHQA 3MCAB 4RTZA 3QO8A 4DBFA 4PJOE 1M1FA 1WJRA 3CC2A 1YWPA 4M7DG 5KCHA 4A4EA 2DYIA 4R0KA 5CO7A 3EGDB 4H2YA 3QWYA 2QHUA 2RA2A 2RF0A 1TUCA 1C0MA 1VQ8Q 3FLGA 1S1NA 3LLRA 1OI1A 2JMCA 4HCKA 2YSQA 3CBOA 1N9WA 1SSFA 4YRFA 3RKWA 5LJ3j 1VQPQ 1M1KR 2F69A 2X3WD 4OGCA 5LJ5h 1Q82R 3A7UA 1NBEB 2HMAA 3PMIA 2ZCEA 1M90R 2AK5A 3CBPA 4HT9A 3JCMd 3UF4A 2OTJQ 4PLIA 3SWNB 4D8DA 1TWBA 1YWOA 3L1AA 5LJ5f 4P74A 5KNNA 2O31A 4RDXA 3JCMe 1NE8A 2CH4W 2QQBA 3A8LB 4FYYB 2YWWA 1YHQQ 5FWBA 4Q5WA 1BIBA 2ZNJA 3CC2Q 3MKDA 2J05A 1K8AC 2DAQA 2CYZB 3JCMW 2C0OA 3H41A 1K9MR 5LJ3d 3RNJA 3MP1A 5LJ3e 2AKWA 1EIYB 1NJIR 5KYYB 1J5WA 3JCMV 3L4GA 1SHFA 2NUTA 3U23A 2RQUA 3ICAA 3SD4A 4DOWA 2HZYA 2LVMA 4YRNA 4E7HA 3P8DA 1SETA 2RPNA 3TEEA 3EHQA 4GLMA 4M7DC 1UGSB 1JJ2S 1HSQA 4OB2B 1WYDA 1W4SA 4RTVA 4HCZA 2XDDA 3OW2P 2D9TA 4DBHA 1K1ZA 1OQKA 4X34A 1AVZC 4OB3B 2H3EB 2JXBA 2QTXA 4C8QC 2BZ8A 5D6XA 3L2ZA 3BW1A 1VQ8T 4OF1A 3HY1A 2GQIA 2KAFA 3LYIA 3QIIA 2EGAA 5GAN2 1VQPT 2LT4A 2KVQG 4KGVB 1EQRA 4M75C 2ZIMA 4AFQC 5KYWB 3OYJA 4J83A 4C5IA 2KQWA 4JUVA 4N4HA 4DEXA 1ZQ1A 4OMMA 5CQXA 2OTJT 5CKEA 1R0CB 2LX7A 1WHJA 3CC4A 1YN8A 3RACA 1WHKA 3UATA 1YHQT 4IUQA 2O9SA 4RKUE 3ZEHA 4F14A 3L2WA 3G6EA 4BY6B 2PUOB 4IKFA 3CC2T 1WHHA 1BBUA 4MZTA 2RM4A 3JB9I 1K73R 1MUZA 1KD1R 2JJ9A 1UGQB 3IQLA 1LJOA 3ME9A 3CQTA 2ZR3A 3BDLA 4X9CA 2ZZEA 3NENA 4QKUA 1HXDA 3JCMQ 3A31A 4TVWA 2L5QA 4K86A 5IH2A 1X69A 1KC8R 2BTTA 1N9SA 2RJDA 4KH0B 4TWAA 1AHJB 1NNHA 4CS3A 3LWIA 4BI4A 5ELOA 3VU3C 2O88A 2O2OA 4RCCA 2D0QB 2ZT5A 1X6OA 5LJ5g 5GANg 1NJ8A 1VQLQ 3G6EQ 1WYXA 5IHNA 5I2MA 3OYHA 4P3OA 1I81A 1SSHA 3DLLA 4NS5A 1H3ZA 4RMFA 2DL3A 4KGZB 1N9RA 2ECZA 2FL7A 4QVCA 4C92C 4YRKA 1XTDA 2RQTA 3L4GB 4CS2A 1G2BA 1YFNA 2MK5A 2I0NA 2RMOA 2L3RA 1R0BG 4WI1A 1Q7YU 3VS0A 5A0GA 1YCYA 2ZCFB 2WACA 4P73C 1FYFA 3LSQA 1SF9A 1D1AA 2LZ6B 2FZKB 4EO4A 1TSFA 4RUGA 2GBQA 3O5ZA 4KULA 1YIJQ 3P8HA 3M54A 1WJQA 3PCOB 4M77A 2VB6A 1M4ZA 1PSEA 1LVKA 1M2VA 2CSQA 2QA4A 1FX7A 1VQ4A 4F7UA 3MO8A 2LQ8A 1WDXA 1I8FA 3HFZA 3CMAA 1VQ6Q 1ZA2B 1U1SA 2JOYA 2ESWA 4XU3A 3X20B 3OYCA 4AG2C 3CCEA 4N0AC 4J15A 1B76A 4P72A 2E12A 2IPOB 2MF2A 1VQLT 1H4QA 1KSWA 1WPYA 5GAOn 1TS9A 3G6ET 1WQ7A 2FRYA 5GAN3 4ZGJB 4YDQA 4HT8A 3HXXA 3GLXA 1ZBXA 3EGXB 2ZZFA 1D1BA 4HVWA 1M2OA 1MHNA 2AMCA 2R5AA 3KFUA 2YDLA 4L59A 3CC7A 1KQSP 4M77E 4OMNA 4F7UG 4P3NA 2EQJA 5GJVB 4JJDA 4YROA 4R55A 2FZCB 2DIGA 2XIDA 1M30A 1NYGA 4M7AB 4KH1B 4Z88A 2IY5B 2V1RA 4ZTUB 1BI0A 1FYNA 4XTZA 5D6WA 2ZXFA 4HKEA 2DVJA 1M1KU 3GNFB 1Q82U 1ZUYA 2XICA 3C4SA 2VUBA 2YUOA 1QVFA 4HWSA 3VRZA 4JRPA 1M90U 1Q86R 2RB6A 2R57A 1YIJT 4J6XA 2DZCA 2G3RA 2MAMA 3HP9A 2PTKA 1KJWA 5A0LA 4G84A 4YRJA 2A08A 3EG9A 1VQ5A 1V29B 1D1CA 1BCMA 4JDSA 3HPWA 4P71A 3UFGA 4J7FA 3F70A 3WVDB 1YJWA 4E7SA 1KMNA 3CC7Q 1N27A 1LYLA 1XJWB 1ZUKA 2M9UA 4C0DC 4YREA 4YRPA 3E9HA 3HRKA 1VQ6T 4BACA 1K9MU 4JRKA 4LXCA 4J9IA 1B7TA 1QVGS 1ZSZA 3J7AF 3I56A 4QVDA 1UEBA 4V2SA 1BBZA 1NJIU 5D7UA 2LCLA 3MEAA 1ADJA 3A5ZA 1SHGA 2DKGA 3OYGA 1AWOA 1BI3A 2VKNA 3DB3A 1WJSA 3MF2A 3DLMA 1HTTA 2RHSA 5FU6B 4PJOF 3S3MA 1B34B 3P8VA 3E19A 3OYEA 2CJ9A 2O4XA 4M77B 2MMPA 5GAN8 3CD6Q 2ZZGA 3MF1A 2GF7A 2JUFA 5AT1B 1YNZA 1QWFA 4M7DF 2W10A 2M0YA 2CT4A 4DBRA 4PJOD 2RHQA 1B7YA 4F04B 2ROLA 5GAOp 3I56Q 1I4K1 2RHUA 1OZ2A 3HRTA 4LE9A 3ZL7C 1CKBA 3EGUA 5DM7R 2HCKA 2RJCA 1E6GA 2EFIA 1G3YA 1OPKA 3I35A 4CC2A 3RR6A 4IIOA 4FCYA 3RERA 3NETA 3H8ZA 2ENMA 3I7FA 4PLLA 2FYKA 5C53B 1I0CA 3JB9J 4YRLA 4Q6GA 4A4FA 1WU7A 1VYUA 1EIFA 4PHCA 3CC7T 2QDLA 4YCUA 4G85A 3P8BB 4CH3A 3OYBA 3VS5A 2NS6A 2CP0A 2F5KA 2LNVA 2JZ2A 1YCSB 3N5BB 1K73U 3FJPA 1AZGB 1ZLMA 2C0IA 1KD1U 5IXFA 2RQRA 1JJCB 5DLQE 4CC4B 4D6WA 4M78G 2LT1A 1WA7A 1YJ9Q 1KQ2A 4XU1A 2YRDA 3VS2A 4E7IA 2JS0A 4LDWA 1G51A 3IKLA 4H2VA 2E3HA 4YRRA 4EMKC 1PCXA 3CXCS 2GNCA 4P75C 2EKHA 1X2HA 1KHIA 3BFMA 1KC8U 2V1QA 4RTYA 4J7IA 3M4QA 3R6OA 2EYWA 3QO3A 3G1ZA 2QQ9A 2I4LA 3EG9B 3CD6T 2DXTA 2A8EA 3DKMA 1EFWA 4F17A 3QZ5B 2HD0A 2OAUA 1QMCA 4VUBA 2PQWA 1BKBA 1VQOT 1IB8A 1RLPC 2J6KA 4HVUA 3FB9A 2LX9A 5GAMg 2RNAA 3MJXA 2FHDA 2FB7A 2NUZA 2CIMA 2QGFB 1RLQC 4CH4A 4C0ZA 1QVFP 1M9SA 1ZSZB 2CS7A 2EJFA 4HWRA 1CKAA 1WGSA 3I56T 1S72Q 4E7JA 3M57A 3QNEA 3OQ5A 2QASA 3QO5A 1QF6A 2J3LA 2MYSA 2K79A 3SWNA 1UUEA 3M0SA 4B9XA 1X2QA 5M9OA 5IHIA 1CSKA 4E7KA 1HYOA 3OB9A 1Y7XA 2ZPHB 2KI7A 1BCOA 1IRXA 2B8AA 1QVPA 3NMZC 4KGXB 2D1XA 4C0FA 2Z0WA 2LJ3A 3OYYA 2K57A 1GXIE 2DJQA 3P8TA 1D0ZA 2ZT8A 4JZ3A 3M0PA 2P4TA 2KY9A 2FO0A 2ZGWA 1YJ9T 1EIYA 3OSSC 3PNWC 3NTKA 2RI5A 1B07A 5KYXA 4FYVB 1BI2A 2A28A 1VYVA 2J6FA 2R5MA 5GAN5 3VS4A 2GFAA 2OI3A 3IALA 2QTVA 2I4OA 4WTOB 3AHUA 3CPWA 2W0ZA 1QCFA 1G3SA 3CCMQ 1TG0A 3M9QA 1IXDA 2K7AA 2KNBB 4PKCC 4BDYA 2KGTA 2O01E 5J3BA 2XHCA 1H8KA 1IHWA 3PFSA 5GMKh 3DB4A 3NFCA 3M5AA 2LJ1A 1PC0A 1U1TA 2ZINA 1X6GA 3NGPA 1PD1A 5KYWA 2VV5A 1MGQA 1S72T 4JLIA 2RJFA 2HL5C 2FPFA 2RH2A 2OTJA 4D8KA 3OW2S 3UGTA 4PJOG 1JU5C 2P84A 3UA6A 1M1KC 3OYFA 3HXWA 1Q82C 2E64A 3E9FA 4CH5A 4HVVA 1W2BA 2MOXA 1L0WA 1M90C 1K0SA 2JTFA 1M27C 1ZHIA 1Q86U 2DILA 1VQZA 2KK4A 2OX7A 5FRMA 3CEYA 1JBMA 3HTRA 2M1HA 2CP7A 1GL5A 4EPCA 1ABQA 1N8RR 2XKOC 4JLGA 5LJ5j 2L3PA 1G3TA 4YRMA 2OAWA 4OMOA 5GANh 1A0NB 1VQ9A 3NPFA 2KT8A 2K4YA 3V8LA 1K9MC 2E6ZA 2Y4YA 3R6NA 2QEXA 2EKOA 1HC7A 1NJIC 5GANf 1FMKA 3VV0A 4ZTFA 3CCMT 1JO8A 4JRIA 3NEMA 2K3XA 3UWNA 2EGEA 4XK8E 1QE0A 4BE2A 1HK9A 2VGNA 5GMKm 1TXQA 3MHXA 4FSSA 2ZPBB 5J39A 5LJ5d 1LCKA 4Y28E 5GANd 3T9NA 1SRYA 3BJUA 2CZ7B 4DOVA 3P8YA 1X75C 2E3CA 4X1VA 4PJOC 3QTCA 4LVMA 1IREB 1QW1A 2DA9A 5KYXB 2V8KA 4F7UF 3OYNA 4X9DA 1QCOA 3VUZA 4JS4A 3HHTB 5HGQA 2WSFE 2AZSA 1N5ZA 1VQ9Q 3D7SB 2DXBA 4LVKA 2Q7HA 2KE9A 2QEXQ 4E51A 4P3PA 4IURA 4YYEA 1PNJA 1NYQA 4UP9A 4B9WA 1W66A 1KIKA 12ASA 2CH4A 1QWEA 1TTHB 1Q81R 3ER0A 5KYNA 1D0YA 2V8JA 3CCSQ 5CKBA 3PCOA 11ASA 2CSIA 1UTIA 1OEBA 3TCJA 3URGA 2FVUA 1VIEA 5GMKi 7AT1B 4A4KA 2CUDA 3FDRA 3RMSA 1K73C 2EAYA 3CPWP 1RAGB 1SG5A 1D3BB 1KD1C 1K4US 1O9SA 2A3LA 2E5KA 2YRCA 3JSCA 4OMLA 5I21A 1KQSA 3GNGA 2LQKA 2HBWA 1D09B 1MMNA 2DD4A 3IG2A 3M0QA 2MWPA 2ARUA 3UT1A 1VQLA 2AKKA 1YJNA 1IGQA 1VQMA 4K87A 5IAYA 2KT1A 1KC8C 4DPGA 3QYGB 4C0GA 5KE2A 3OYLA 3LW5E 3OBWA 4J9FA 3EGXA 4C8QB 4XEOA 3ERRA 2DX1A 5FU7C 4ESRA 4P74C 2ZPIB 1YBYA 2DM1A 2KRMA 3CCJA 3MP6A 4M75B 3RMQA 3WXMB 5CKFA 3OY9A 2GQVA 3QZ9B 3CPFA 1VQ9T 3M0TA 1WX6A 1UB4A 4ZGDB 1W2BP 4TVAB 3E9GA 4M7AA 4ZN1A 2QEXT 2IY5A 4R56A 2AIRB 2XI9A 3SFMA 3J80E 1IGUA 1XOVA 1I1JA 1YI2A 3VJPA 3KBGA 2Q5HA 4J9BA 2DK3A 1LNXA 4X5OA 4A4GA 1KOGA 4PK4A 1YJNQ 2Y4XA 3JCMg 1VQMQ 2CT3A 1YIJA 2C0TA 5K1XA 5GMKl 3CCST 2BE9B 4LD6A 3J81E 3NHNA 3A74A 3LC0A 2JW4A 4ANJA 1BU1A 2MPXC 2DFUA 3M0RA 3CCJQ 3OSVA 5CKHA 5LJ3g 1VQ6A 3ZFJA 1JJ2P 1JXMA 4II1A 4B6MA 3OA6A 1WFWA 5IHKA 4XTXA 2H3JA 4M7AE 2JS2A 3JRZA 2DJZA 4M78F 2FEIA 3RBBB 2H8HA 1B70B 2EJGA 3H9NA 1VIFA 2CDTA 1YI2Q 1EVLA 2AT1B 4C5HA 2PMFA 2CP5A 2KEAA 1O75A 1V76A 4XU2A 1MV3A 1H4VB 5C6SA 2E5QA 2EPDA 1B34A 4IUPA 3QUIA 2L8DA 2QHVA 4RTUA 1PHTA 1ABOA 4C92B 2RI2A 3PVLA 2E70A 3CMEQ 4M78D 1USYA 4EIKA 2EGCA 4KT0E 4HWTA 3QBYA 3A5YA 1DJ7B 1NG2A 3S3OA 5CQYA 1AD5A 2GCXA 2RN8A 1KMMA 2KDSA 3TUPA 4ELZC 1YJNT 1UGVA 1UG1A 1VQMT 2QG9B 3L42A 3JCMP 2EQUA 3EHRA 2ZZDA 2SEMA 4M77G 2BZXA 4DA4A 1C1AA 2DL7A 2XDPA 2CKKA 1NZ9A 3V7CA 1OV3A 1KQ1A 9ATCB 3GP8A 3EAEA 4MDXA 4MZMA 2VASA 3CCJT 1Q86C 4PJMA 3OS5A 1F1BB 2HSEB 2EYXA 2KRSA 2KBTA 2K5IA 5HK3A 1KG1A 2C8MA 1JJCA 2F2VA 4ELYC 2E6NA 2FPEA 2HQEA 1N8RU 4J5YA 1RIQA 2GTJA 2YLCA 1ZSGA 2EQIA 2NWMA 3H6ZA 3HXZA 1YI2T 2AKLA 1GCQA 2M0OA 4FM4B 1Q95G 2ZT6A 2WSEE 3KUFA 4AG1C 2DU7A 2Q7EA 4LUEA 2P0QA 3PTAA 4QT7A 4H2UA 4JJNK 4ZNXA 5GAMh 3A32A 3CD6A 1MV0B 2P4RA 2QI2A 3H0HA 1X2GA 3JV3A 1JEGA 5GAOm 3CMET 1I5OB 2P5IA 2MCNA 1TOVA 2L3QA 4A63B 3JCMc 4LNPA 3QPHA 1VQOA 5GAMf 4PFPA 2CJBA 4K11A 2K3BA 3QKJA 3RDVA 2YXYA 2BIVA 5GAN4 1EZZB 5GAOr 5GAOq 1IL2A 3A8HB 2ATCB 4Y92A 1U3OA 4OP0A 2X3XD 3SHWA 4ZTZB 1E7OA 1VQ7Q 3PIPA 1E24A 2DQ0A 2LMJA 4C5GA 2EYYA 3OYDA 3VUBA 1WHGA 2FPDA 4WJ3M 1T0JA 1VQNA 2HSPA 4P72C 3X28B 3VBBA 2J6OA 4C0DB 1QVFS 4GBQA 1Q81U 1VQOQ 6AT1B 3CMQA 4BDZA 3OYAA 1YJ9A 2CUBA 4HCCA 2Q5IA 3EG2A 3CCUQ 3REXA 3REAB 2DBKA 2ZPFB 2A7YA 2RHIA 5KCOA 4LDYA 5ELNA 2E4HA 3GBQA 3FJ5A 1ACMB 2X51A 2F2WA 4RG2A 3NELA 3UA7A 3OD1A 4BI3A 4XTWA 1NYRA 4NCXA 5FROA 4PNOA 4ORZA 3HKSA 1RUWA 2ODRD 3VS1A 1AWXA 1GGMA 3TSWA 2K2VA 3ASKA 2L2PA 5FRNA 3MP8A 3HL8A 3ZBDA 1NLOC 1VQNQ 3RUXA 2HEQA 3RESA 4PFZA 4BB7A 3HFVA 3MEVA 5CKDA 2CP3A 5I11A 4C5EA 1XQHA 4L5GA 3CCQQ 2VC8A 5IXBA 4CI0C 1S72A 3PIOA 5DLOA 4J6WA 4FT2A 2LJ0A 4BWAA 3TQ7P 4TTVA 4P71C 2K5LA 1G5VA 1YGBA 5FW9A 3REUA 1VQ7T 3VYHB 3E9IA 3SDZA 1UJYA 4BE1A 4TVRA 1Y0MA 1BYMA 4LVIA 2ZAEA 1EVKA 2COYA 1YFRA 1ZSZC 1FXXA 2P0LA 4KQEA 5GAOl 3O8VA 2DNUA 1I5LA 4BI8B 1QQJA 1X27A 3CCUT 3QSUA 2XMFA 4KUDK 4E6RA 1M3BA 2QGGA 2EQKA 4TQFA 2RK2A 2HAXA 1Y96A 1NJ1A 3CCMA 3EFSA 4MZPA 2LCSA 5GJWB 4TVYA 1EOVA 1ZBJA 4GY5A 1VQNT 4M78C 1Z7NA 3HXUA 4L87A 3C94A 1VQKQ 2ED1A 4PFOA 4CC3A 4H2XB 4BW9A 2F1LA 2JVVA 1PKSA 4OMQA 3OBYA 2ZR2A 3CCQT 1J3TA 1NM7A 2Q7GA 8AT1B 5C52B 2GGRA 2BUDA 4LDXA 4E2FB 2E10A 4EMHA 1WHMA 1UHFA 1RI0A 3Q1JA 4XTVA 4JPBW 2ED0A 1QLYA 2LRQA 3BY7A 1M1GA 1VOMA 1WI7A 1BI1A 2RO0A 1ATIA 1WHLA 5HKCA 1TUGB 2CZ6B 2YHTA 5GMKj 3OS1A 5IN1A 3NTHA 2FG0A 3M0UA 4Z8AA 2QQRA 1Y57A 1SPKA 2YUPA 3CCRQ 2CGHA 1W70A 1T0HA 1Z9ZA 1RAHB 4ME7A 2VGMA 2OJ2A 2X4WA 2EWNA 1G3WA 2QYZA 2EIFA 1W6XA 2AZVA 4Q15A 3M59A 2DZ9A 1D3BA 3G7ZA 2LNHB 2DU5A 3EH2A 4EX5A 3JCMb 1UHCA 3TREA 3QJ6A 3BE3A 4BUGA 1MMAA 3BDUA 4M7AF 1H3HA 4M7DA 1N8RC 4RTTA 2PVGB 1M8MA 4LNSA 4XEMA 2DPPB 4PG3A 5CIUA 4QQ6A 3VRYA 5GMKe 2CREA 4PJNA 4N4IA 1VQKT 2DEUA 2XD0A 3A7AA 1AT1B 4YRQA 4C8QA 1EFNA 2D0NA 2KYBA 1U06A 3OYMA 3V7RA 4NOYA 2DLPA 1WZOA 3HFNA 3CPWS 4M7AD 3SWNC 4QQDA 1X54A 3M4GA 3LWHA 5GANj 4M75A 2B86A 3W3SA 1RADB 3JCMX 1HD3A 2XG8D 3JCMh 3M4PA 4TVAA 2BZYA 4MDWA 1Y96B 3KFVA 3WQZA 1YB3A 1AOJA 4M7DE 1AEYA 1JJ2A 4CH6A 4H2TA 2K5FA 4FYWB 3JCMf 3G4SA 1GFCA 2ALYB 2NUPB 2XU8A 4C8QG 3RIRA 3GIBA 4AMCA 3HXVA 3CCSA 2CJAA 5LJ3h 2M16A 2JNGA 2HQXA 3CCRT 2QK0A 4AFZC 4C8QE 3VKIA 4M77F 4M75G 2M51A 5LJ5e 4QW2A 5GANe 4FIBA 2DDZA 4OVAA 5LJ3f 3META 3V7SA 1W2BS 2BE7D 4JZ4A 4YRSA 1X2KA 3LGLA 1Q81C 4M75E 5HY6A 2ZPGB 1M8VA 3E2UA 5I2SA 3IKMB 2G4CA 4E7ZA 4RG8A 2JT4A 5DY9A 2DL5A 4OB1B 2ZPEB 2EYQA 1X55A 2ZTGA 2ODRC 4KRTA 3CCVA 4M77D 4JRQA 1JXOA 2CZ1B 3HFOA 1B70A 4CS4A 5CR2A 4BE0A 3QHSA 2Y90A 3HRSA 4IUTA 3G4SQ 4FU6A 2HNIA 1RAEB 1AZEA 4XQ3A 2G6FX 2E3IA 1FMWA 4P5NA 4NL2A 3JB9G 3M55A 2X4JA 4GLKA 1K8AR 4C92A 4LD9K 3HRIA 2QXFA 2OTLA 4PJOB 1W1FA 1UGPB 1U8RA 4IUVA 1MNEA 3CCLA 4BY6C 4FT4A 2DERA 3V8KA 1K9AA 4P73A 2K9GA 1OOTA 1SKUB 3VS6A 4M7DB 5GAN6 5HK0A 2LP5A 5CVIA 1YFTA 1XNIA 2V8IA 5CK9A 4DBQA 3VS7A 4YRIA 3CCVQ 1Y07A 1QCNA 1PYSB 1PKTA 2V26A 4OMPA 2DL4A 3OMGA 2ZT7A 4JJCA 1BK2A 4KR3A 4C92G 2JM9A 1H4SA 1HJDA 3KXTA 1JB0E 1X01A 4NL3A 3VQYA 1SRLA 4C92E 1UFFA 3A7RA 2M02A 2IVWA 2DBMA 5I22A 2OTLQ 1P92A 3JB9H 2LC4A 3A98A 5KYUA 3CCLQ 1OX9A 4H2SA 2CZ0B 1H4TA 2DL8A 5J26A 2KRNA 3SEMA 1E22A 2JM8A 2SRCA 4N0AA 2E5AA 1JRIA 4ZTJA 4LDUA 1FMVA 4LN2A 3LH5A 4PL6A 3G4ST 2EBPA 1M3AA 4UP8A 3G71A 4RCBA 4AH6A 4CC7A 1KQSS 2QDYB 1T3SA 3PT9A 2KYMA 4HXJA 3FEOA 2K3YA 2VWFA 2DE0X 2YUQA 5FU7B 3CMEA 3LH0A 2RHXA 4TQDA 3QXEB 3L2RA 3TEHA 2ARTA 4RTWA 2YUNA 3QDFA 3CC4Q 2PMEA 2GTOA 1OU9A 1UJ0A 1UE9A 4M7AG 1NJ6A 3PGGA 2I2LA 5A2QE 1KFZA 2ARSA 4KR2A 5A0DA 1KHCA 3QJYA 1OULA 4YRCA 1ZUUA 1NLPC 5KH6A 4EDUA 1B3QA 5C51B 2DIQA 3CCVT 1I07A 1QP2A 3X26B 2AKWB 3TU4K 3M56A 4WCIA 2NUTB 1M5Q1 2ZIOA 1TH7A 2DD5A 3PMTA 3G71Q 2JTEA 3EG3A 4ZN3A 1YITA 2PZ1A 4QQGA 3V8JA 1RL2A 1VUBA 4O2DA 2OTLT 3RKXA 3TSZA 3FRNA 3GF5A 4Z89A 3M58A 3CCLT 2HL3A 2FRWA 2I4MA 2QHTA 1ASZA 4YCWA 3H0IA 4FL6A 5FLXE 2JN0A 4XAXB 3OS0A 3A1PA 4KUIA 5K1PA 2DRMA 3OMCA 4RQEA 4J9GA 2EJ9A 3I9QA 4M4ZA 1WXBA 1GBQA 1MNDA 2FZGB 2MI6A 3OYKA 4UP7A 3UPUA 1E1OA 3X25B 4N4GA 4IUUA 2D6FA 1FWZA 2PUKB 4A54A 4JJBA 3CBMA 1UECA 2DXCA 4HT4A 4M7AC 1YITQ 2NLUA 1JQQA 5IT9E 3UH0A 2RQVA 2E41A 3CC4T 2KSSA 3HXYA 1UGRB 3VS3A 2LQNA 3L2UA 3MEYA 4BD3A 3FIFA 2HKNA 1PD0A 2DETA 3THKA 5KYUB 2JMAA 1NEBA 3MEWA 1WIEA 3EG0A 3TEGA 3EFRA 4XU0A 4E47A 3OS2A 1ZX6A 3HRUA 1MMGA 4UC4A 1QVGA 1X43A 4FSXA 4OGEA 1WXTA 2C7IA 1VQ7A 1NJ5A 2CP2A 3QDRB 5GAMj 2COWA 3G71T 2QA4Q 1VQ4Q 1YFSA 2ROTA 4F7UE 3VQVA 3PZCA 1VA7A 1OPLA 2A0FB 2DRKA 4J8OA 3M4YA 5KE3A
chains in the Genus database with same CATH topology
2QHSA 4MMLA 1ADYA 2QQAA 3TEHB 3DSQA 3C95A 3X24B 5F5WA 1R8OB 1LOJA 5AYFA 4L6V5 3RL6A 3CCUA 4RQFA 2HBPA 3VQWA 2BKDN 5FU6C 4LVJA 4QVZA 4M77C 4LVLA 4EMKA 2RD1A 5GAMd 4P75A 4K88A 1BIAA 5GAMe 1USYC 1BBWA 5L8RE 2F5TX 4YTLA 3A8OB 2PU9B 1YITT 1H641 2QQSA 3UDCA 2I4NA 3C12A 3QG1A 4H2XA 5E3IA 3CCQA 1SERA 4YPFA 2PVOB 2L89A 1K8AU 4HWPA 3L2VA 2XTIA 2X4XA 3QYHB 3CXCA 3WVEB 4HA8A 1QP3A 2IG0A 3VYGA 4HVCA 1OYXA 4KBMB 3INZA 2QA4T 4YP0A 1VQ4T 4F7UB 2DQ3A 2VYTA 4WJ4A 3RF1A 2EQMA 4YRGA 3HFZB 2E65A 3CMAT 2LTOA 3S6WA 3CCET 1SESA 4M78A 3VQXA 2P0KA 4C8QF 4LDVA 1NJ2A 4M7DD 3A8GB 1B8AA 4M75F 2AMCB 1OZ3A 3MQZA 3RKYA 2E1HA 3QO7A 3RGLA 2LDMA 4YRTA 4C8QD 2XDBA 5CCAA 2J3MA 4XTUA 3S3NA 1IZ6A 4OLFA 1X56A 4M75D 1VQKA 4EMGA 4H02A 2VXEA 4M78E 2JTMA 4ATOA 2LCCA 2X35A 5GAN7 3I55A 3JAME 1PSFA 2DVEA 2DTHA 4DQ2A 3JB9F 3NTIA 3JCMJ 1Z7MA 4EMKB 1VQ5T 1G5IA 1Y71A 1YJWT 2RI3A 4Z02A 2C06A 3GOXA 3JB9D 2ALYA 2DTIA 1Q7YC 3A5ZB 4RMOA 4JS5A 3CCRA 4H2WA 4WF2A 4HCBA 4A4HA 2PVDB 2VXFA 4C92F 4Y91A 3UGQA 2RHSB 2MWOA 4XTYA 2O4XB 1WLEA 2YRVA 2KMTA 2RHYA 5CAIA 2DXUA 3MEUA 2GFUA 3OW2A 1N6AA 4A53A 3R07A 2XGTA 1C0AA 3FC3A 2WSCE 4C92D 5EG2A 1WQWA 2P0PA 2RHQB 1B7YB 2XK0A 4M78B 4O6JA 4ZGEB 4YCVA 3GPLA 3LX7A 2R58A 3M53A 2YLBA 3OYIA 4OB0B 5C0MA 2RHZA 4PJOA 3A8MB 1ASYA 3E1SA 3HTZA 4E7LA 1NPRA 4OMFB 1G5HA 2RK1A 4ZIBA 2RJEA 2DTOA 2DO3A 1VQ8A 2DEQA 4O5VA 2AHJB 4UPAA 3LSSA 3L2QA 3HY0A 1VQPA 1NPPA 1E1TA 1WNLA 4MMKA 3HSBA 1PYSA 3LGFA 2EL9A 2X4YA 5LL6S 4J6YA 4CRIA 3I55T 2ZNIA 5D6YA 4HWOA 3SB2A 1YHQA 3MCAB 3QO8A 4PJOE 1M1FA 1WJRA 3CC2A 4M7DG 5KCHA 4A4EA 5CO7A 4H2YA 2QHUA 2RA2A 3FLGA 3LLRA 1OI1A 1N9WA 3CBOA 1SSFA 4YRFA 3RKWA 5LJ3j 2F69A 4OGCA 5LJ5h 3A7UA 2ZCEA 3PMIA 3CBPA 4HT9A 3JCMd 4P74A 4PLIA 3SWNB 3L1AA 5LJ5f 5KNNA 4RDXA 3JCMe 1NE8A 2QQBA 3A8LB 4Q5WA 1BIBA 2ZNJA 1K8AC 2DAQA 2CYZB 3JCMW 5LJ3d 3MP1A 5LJ3e 2AKWA 1EIYB 1J5WA 3JCMV 3L4GA 3ICAA 3SD4A 4DOWA 2LVMA 4YRNA 4E7HA 3P8DA 1SETA 3TEEA 4M7DC 1UGSB 1JJ2S 4OB2B 1WYDA 1W4SA 4HCZA 2XDDA 2D9TA 4X34A 4OB3B 2QTXA 4C8QC 5D6XA 3L2ZA 3BW1A 1VQ8T 4OF1A 3HY1A 2KAFA 3LYIA 3QIIA 5GAN2 1VQPT 2LT4A 2KVQG 1EQRA 4M75C 2ZIMA 3OYJA 4J83A 4C5IA 2KQWA 4JUVA 4N4HA 1ZQ1A 5CQXA 2OTJT 5CKEA 3CC4A 3RACA 1YHQT 4IUQA 4RKUE 3ZEHA 3L2WA 3G6EA 4BY6B 2PUOB 4IKFA 3CC2T 1BBUA 4MZTA 2RM4A 3JB9I 1UGQB 1LJOA 3ME9A 2ZR3A 3BDLA 4X9CA 2ZZEA 3NENA 1HXDA 3JCMQ 3A31A 4TVWA 2L5QA 4K86A 1N9SA 2RJDA 4TWAA 1AHJB 1NNHA 4CS3A 3LWIA 4BI4A 5ELOA 3VU3C 4RCCA 2D0QB 2ZT5A 1X6OA 5LJ5g 5GANg 1NJ8A 5I2MA 3OYHA 4P3OA 1I81A 3DLLA 4NS5A 1H3ZA 4RMFA 1N9RA 2FL7A 4QVCA 4C92C 4YRKA 1XTDA 3L4GB 4CS2A 2L3RA 4WI1A 1Q7YU 5A0GA 1YCYA 2ZCFB 2WACA 4P73C 1FYFA 3LSQA 4EO4A 4KULA 3P8HA 3M54A 1WJQA 3PCOB 4M77A 1M4ZA 1PSEA 2QA4A 1FX7A 1VQ4A 4F7UA 3MO8A 2LQ8A 1I8FA 3HFZA 3CMAA 1U1SA 2JOYA 4XU3A 3X20B 3OYCA 3CCEA 4N0AC 4J15A 1B76A 4P72A 2E12A 1H4QA 2MF2A 1VQLT 1WPYA 5GAOn 3G6ET 1WQ7A 5GAN3 4ZGJB 4YDQA 4HT8A 3HXXA 3GLXA 1ZBXA 2ZZFA 1MHNA 2AMCA 2R5AA 3KFUA 4L59A 3CC7A 4M77E 4F7UG 4P3NA 2EQJA 4YROA 4R55A 2DIGA 2XIDA 4M7AB 2IY5B 4ZTUB 1BI0A 4XTZA 5D6WA 2ZXFA 4HKEA 1M1KU 3GNFB 1Q82U 2XICA 3C4SA 2VUBA 1QVFA 4HWSA 4JRPA 1M90U 2RB6A 2R57A 1YIJT 4J6XA 2DZCA 2G3RA 2MAMA 3HP9A 4G84A 5A0LA 4YRJA 1VQ5A 1V29B 4JDSA 3HPWA 4P71A 3UFGA 4J7FA 3F70A 3WVDB 1YJWA 1KMNA 1LYLA 1N27A 2M9UA 4C0DC 4YREA 4YRPA 3E9HA 3HRKA 1VQ6T 4BACA 1K9MU 4JRKA 1QVGS 3J7AF 3I56A 4QVDA 1UEBA 4V2SA 1NJIU 2LCLA 3MEAA 1ADJA 3A5ZA 2DKGA 3OYGA 1BI3A 3DB3A 1WJSA 3MF2A 3DLMA 1HTTA 2RHSA 5FU6B 4PJOF 3S3MA 1B34B 3P8VA 3E19A 3OYEA 2CJ9A 2O4XA 4M77B 2MMPA 5GAN8 2ZZGA 3MF1A 2GF7A 2JUFA 4M7DF 4PJOD 2RHQA 1B7YA 5GAOp 1I4K1 2RHUA 1OZ2A 3HRTA 5DM7R 2RJCA 2EFIA 1G3YA 3RERA 3NETA 3H8ZA 3I7FA 4PLLA 2FYKA 5C53B 3JB9J 4YRLA 4Q6GA 4A4FA 1WU7A 4PHCA 1EIFA 3CC7T 4YCUA 4G85A 3P8BB 4CH3A 3OYBA 2NS6A 2F5KA 2LNVA 2JZ2A 1K73U 3N5BB 3FJPA 1KD1U 1JJCB 5DLQE 4D6WA 4M78G 2LT1A 1KQ2A 4XU1A 4E7IA 4LDWA 1G51A 3IKLA 4H2VA 4YRRA 4EMKC 3CXCS 4P75C 1X2HA 1KHIA 3BFMA 1KC8U 3M4QA 4J7IA 3R6OA 3QO3A 3G1ZA 2QQ9A 2I4LA 3CD6T 2DXTA 2A8EA 3DKMA 1EFWA 3QZ5B 2HD0A 2OAUA 4VUBA 2PQWA 1BKBA 1VQOT 3FB9A 2LX9A 5GAMg 2FHDA 2FB7A 2CIMA 4CH4A 4C0ZA 1M9SA 2CS7A 2EJFA 4HWRA 1WGSA 3I56T 4E7JA 3M57A 3QNEA 3OQ5A 3QO5A 1QF6A 2J3LA 3SWNA 4B9XA 5M9OA 4E7KA 3OB9A 1Y7XA 2ZPHB 2B8AA 1QVPA 4C0FA 3OYYA 2K57A 1GXIE 3P8TA 2ZT8A 2P4TA 2KY9A 2ZGWA 1YJ9T 1EIYA 3OSSC 3PNWC 3NTKA 2RI5A 1BI2A 2R5MA 5GAN5 2GFAA 3IALA 2I4OA 3AHUA 3CPWA 1G3SA 3M9QA 4PKCC 4BDYA 2O01E 5J3BA 2XHCA 3PFSA 5GMKh 3DB4A 3NFCA 3M5AA 1U1TA 2ZINA 2VV5A 1MGQA 1S72T 4JLIA 2RJFA 2RH2A 2OTJA 3OW2S 3UGTA 4PJOG 1M1KC 3OYFA 3HXWA 1Q82C 2E64A 3E9FA 4CH5A 1W2BA 1L0WA 1M90C 2JTFA 1ZHIA 1Q86U 1VQZA 2KK4A 5FRMA 3CEYA 1JBMA 2M1HA 4EPCA 2XKOC 4JLGA 5LJ5j 1G3TA 4YRMA 5GANh 1VQ9A 2K4YA 3V8LA 1K9MC 2E6ZA 2Y4YA 2QEXA 2EKOA 1HC7A 1NJIC 5GANf 3VV0A 4ZTFA 3CCMT 4JRIA 3NEMA 2K3XA 3UWNA 4XK8E 1QE0A 4BE2A 1HK9A 2VGNA 5GMKm 3MHXA 2ZPBB 5J39A 5LJ5d 4Y28E 5GANd 3T9NA 1SRYA 3BJUA 2CZ7B 4DOVA 3P8YA 1X75C 2E3CA 3QTCA 4PJOC 4LVMA 1IREB 1QW1A 2V8KA 4F7UF 3OYNA 4X9DA 5HGQA 3VUZA 4JS4A 3HHTB 2WSFE 2DXBA 4LVKA 2Q7HA 4E51A 4P3PA 4IURA 4YYEA 1NYQA 4UP9A 4B9WA 1W66A 12ASA 3ER0A 2V8JA 5CKBA 3PCOA 11ASA 3TCJA 3URGA 2FVUA 1VIEA 5GMKi 4A4KA 3FDRA 3RMSA 1K73C 2EAYA 1D3BB 1KD1C 1O9SA 2A3LA 3JSCA 1KQSA 5I21A 3GNGA 2LQKA 2DD4A 3IG2A 2MWPA 2ARUA 3UT1A 1VQLA 1YJNA 1VQMA 4K87A 5IAYA 1KC8C 4DPGA 3QYGB 4C0GA 5KE2A 3OYLA 3LW5E 3OBWA 4C8QB 4XEOA 3ERRA 5FU7C 4P74C 2ZPIB 1YBYA 3CCJA 3MP6A 4M75B 3RMQA 3WXMB 5CKFA 3OY9A 2GQVA 3QZ9B 3CPFA 1VQ9T 1UB4A 4ZGDB 4TVAB 3E9GA 4M7AA 4ZN1A 2QEXT 2IY5A 4R56A 2XI9A 3SFMA 3J80E 1XOVA 1YI2A 3VJPA 3KBGA 2Q5HA 2DK3A 1LNXA 4X5OA 4A4GA 1KOGA 2Y4XA 3JCMg 1YIJA 5K1XA 5GMKl 3CCST 4LD6A 3J81E 3A74A 3LC0A 3OSVA 5CKHA 5LJ3g 1VQ6A 3ZFJA 4II1A 3OA6A 4XTXA 2H3JA 4M7AE 3JRZA 2DJZA 4M78F 1B70B 2EJGA 1VIFA 1EVLA 4C5HA 2PMFA 1O75A 1H4VB 4XU2A 5C6SA 2E5QA 1B34A 4IUPA 3QUIA 2L8DA 2QHVA 4C92B 2RI2A 2E70A 4M78D 1USYA 4KT0E 4HWTA 3QBYA 3A5YA 1DJ7B 3S3OA 5CQYA 2GCXA 1KMMA 2KDSA 3TUPA 4ELZC 1YJNT 1VQMT 3L42A 3JCMP 2EQUA 2ZZDA 4M77G 4DA4A 2XDPA 2CKKA 1NZ9A 3V7CA 1KQ1A 3GP8A 3EAEA 4MDXA 4MZMA 3CCJT 1Q86C 3OS5A 2K5IA 5HK3A 1KG1A 2C8MA 1JJCA 4ELYC 2E6NA 2HQEA 1N8RU 4J5YA 1RIQA 2YLCA 3H6ZA 3HXZA 1YI2T 2M0OA 4FM4B 2ZT6A 2WSEE 3KUFA 2DU7A 2Q7EA 2P0QA 3PTAA 4H2UA 4JJNK 5GAMh 3A32A 3CD6A 2QI2A 1X2GA 5GAOm 3CMET 2P5IA 3JCMc 1VQOA 3QPHA 2CJBA 5GAMf 3QKJA 2BIVA 5GAN4 5GAOr 5GAOq 1IL2A 3A8HB 4OP0A 4ZTZB 3PIPA 1E24A 2DQ0A 4C5GA 3OYDA 3VUBA 4WJ3M 1VQNA 4P72C 3X28B 3VBBA 4C0DB 1QVFS 1Q81U 3CMQA 4BDZA 3OYAA 1YJ9A 4HCCA 2Q5IA 3REXA 2ZPFB 2A7YA 2RHIA 5KCOA 4LDYA 5ELNA 4RG2A 3NELA 3OD1A 4BI3A 4XTWA 1NYRA 4NCXA 5FROA 4PNOA 3HKSA 2ODRD 1GGMA 2K2VA 3ASKA 5FRNA 3MP8A 3HL8A 3ZBDA 3RUXA 3RESA 4BB7A 3HFVA 3MEVA 5CKDA 4C5EA 1XQHA 4L5GA 2VC8A 4CI0C 1S72A 3PIOA 5DLOA 4J6WA 4FT2A 4BWAA 4TTVA 4P71C 1YGBA 2K5LA 1G5VA 3REUA 1VQ7T 3VYHB 3E9IA 3SDZA 4BE1A 4TVRA 4LVIA 1BYMA 1EVKA 1YFRA 1FXXA 2P0LA 4KQEA 5GAOl 3O8VA 1I5LA 4BI8B 3CCUT 3QSUA 4KUDK 2EQKA 4TQFA 2RK2A 2HAXA 1Y96A 1NJ1A 3CCMA 3EFSA 4MZPA 4TVYA 1EOVA 4GY5A 1VQNT 4M78C 1Z7NA 3HXUA 4L87A 3C94A 4H2XB 4BW9A 2JVVA 3OBYA 2ZR2A 3CCQT 2Q7GA 5C52B 2BUDA 4LDXA 2E10A 4EMHA 1RI0A 3Q1JA 4XTVA 2LRQA 3BY7A 1M1GA 1BI1A 2RO0A 1ATIA 5HKCA 2CZ6B 2YHTA 5GMKj 3OS1A 5IN1A 3NTHA 2QQRA 2CGHA 4ME7A 2VGMA 2X4WA 2EWNA 1G3WA 2EIFA 4Q15A 3M59A 2DZ9A 1D3BA 3G7ZA 2DU5A 4EX5A 3JCMb 3TREA 3QJ6A 4BUGA 3BDUA 4M7AF 4M7DA 1N8RC 2PVGB 4LNSA 4XEMA 2DPPB 4PG3A 5CIUA 4QQ6A 5GMKe 4N4IA 1VQKT 2XD0A 3A7AA 4YRQA 4C8QA 3OYMA 3V7RA 4NOYA 3HFNA 3CPWS 4M7AD 3SWNC 4QQDA 1X54A 3M4GA 3LWHA 5GANj 4M75A 3W3SA 3JCMX 2XG8D 3JCMh 3M4PA 4TVAA 4MDWA 1Y96B 3WQZA 1YB3A 4M7DE 1JJ2A 4CH6A 4H2TA 2K5FA 3JCMf 3G4SA 2ALYB 2XU8A 4C8QG 3RIRA 3GIBA 3HXVA 3CCSA 2CJAA 5LJ3h 2M16A 2JNGA 2HQXA 3CCRT 4C8QE 3VKIA 4M77F 4M75G 5LJ5e 4QW2A 5GANe 4FIBA 2DDZA 4OVAA 5LJ3f 3META 3V7SA 1W2BS 4YRSA 3LGLA 1Q81C 4M75E 5HY6A 2ZPGB 1M8VA 5I2SA 3IKMB 2G4CA 4RG8A 5DY9A 4OB1B 2ZPEB 2EYQA 1X55A 2ZTGA 2ODRC 3CCVA 4M77D 4JRQA 2CZ1B 3HFOA 1B70A 4CS4A 5CR2A 4BE0A 3QHSA 2Y90A 3HRSA 4IUTA 4FU6A 2HNIA 4XQ3A 4P5NA 4NL2A 3JB9G 3M55A 2X4JA 4GLKA 4C92A 4LD9K 3HRIA 2QXFA 2OTLA 4PJOB 1UGPB 1U8RA 4IUVA 3CCLA 4BY6C 4FT4A 3V8KA 4P73A 4M7DB 5GAN6 5HK0A 5CVIA 1YFTA 1XNIA 2V8IA 5CK9A 4YRIA 1Y07A 1PYSB 3OMGA 2ZT7A 4KR3A 4C92G 1H4SA 3KXTA 1JB0E 1X01A 4NL3A 3VQYA 4C92E 3A7RA 2IVWA 1P92A 3JB9H 2LC4A 4H2SA 2CZ0B 1H4TA 5J26A 1E22A 4N0AA 2E5AA 1JRIA 4ZTJA 4LDUA 4PL6A 3G4ST 4UP8A 3G71A 4RCBA 4AH6A 1KQSS 2QDYB 3PT9A 3FEOA 2K3YA 5FU7B 3CMEA 3LH0A 2RHXA 4TQDA 3QXEB 3L2RA 3TEHA 2ARTA 2PMEA 4M7AG 1NJ6A 3PGGA 2I2LA 5A2QE 2ARSA 4KR2A 5A0DA 1KHCA 3QJYA 4YRCA 5KH6A 4EDUA 5C51B 2DIQA 3CCVT 1QP2A 3X26B 2AKWB 3TU4K 3M56A 1M5Q1 2ZIOA 1TH7A 2DD5A 3PMTA 4ZN3A 1YITA 4QQGA 3V8JA 1RL2A 1VUBA 4O2DA 2OTLT 3RKXA 3FRNA 3GF5A 3M58A 3CCLT 2I4MA 2QHTA 1ASZA 4YCWA 4FL6A 5FLXE 2JN0A 4XAXB 3OS0A 4KUIA 5K1PA 3OMCA 4RQEA 2EJ9A 2MI6A 3OYKA 4UP7A 3UPUA 1E1OA 3X25B 4N4GA 4IUUA 2D6FA 1FWZA 2PUKB 4A54A 3CBMA 2DXCA 4HT4A 4M7AC 2NLUA 5IT9E 3UH0A 2E41A 3CC4T 2KSSA 3HXYA 1UGRB 3L2UA 3MEYA 4BD3A 3FIFA 3MEWA 3TEGA 3EFRA 4XU0A 4E47A 3OS2A 3HRUA 4UC4A 1QVGA 4FSXA 4OGEA 2C7IA 1VQ7A 1NJ5A 3QDRB 5GAMj 3G71T 1YFSA 4F7UE 3VQVA 3PZCA 4J8OA 3M4YA 5KE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QHS A;  4MML A;  5LJ5 j;  1ADY A;  4K86 A;  4YRM A;  1N9S A;  3TEH B;  4TWA A;  5GAN h;  1I5L A;  1NNH A;  4CS3 A;  5ELO A;  3DSQ A;  3VU3 C;  5F5W A;  3QSU A;  1LOJ A;  3V8L A;  4RCC A;  2ZT5 A;  3RL6 A;  4RQF A;  5LJ5 g;  5GAN g;  1HC7 A;  3VQW A;  1NJ8 A;  5GAN f;  4TQF A;  4JRI A;  3NEM A;  4M77 C;  1Y96 A;  2RD1 A;  4EMK A;  5GAM d;  1NJ1 A;  1QE0 A;  4P75 A;  4P3O A;  1I81 A;  1HK9 A;  3EFS A;  4K88 A;  4TVY A;  4RMF A;  1EOV A;  1BIA A;  5GAM e;  5GMK m;  1USY C;  1N9R A;  1BBW A;  4QVC A;  4C92 C;  4YRK A;  5LJ5 d;  5GAN d;  1SRY A;  3BJU A;  1Z7N A;  4M78 C;  3HXU A;  3L4G B;  4L87 A;  4CS2 A;  4H2X B;  4WI1 A;  4BW9 A;  3P8Y A;  2E3C A;  3QTC A;  1H64 1;  4PJO C;  2I4N A;  1YCY A;  4P73 C;  1FYF A;  4F7U F;  2ZR2 A;  4H2X A;  3LSQ A;  4X9D A;  5HGQ A;  2Q7G A;  5E3I A;  5C52 B;  2E10 A;  4YPF A;  1SER A;  4EMH A;  4EO4 A;  4XTV A;  2Q7H A;  4E51 A;  4P3P A;  4HWP A;  4YYE A;  1NYQ A;  3BY7 A;  4UP9 A;  1W66 A;  2XTI A;  12AS A;  3PCO B;  4HA8 A;  4M77 A;  4HVC A;  3INZ A;  4YP0 A;  1ATI A;  4F7U B;  2DQ3 A;  4WJ4 A;  3RF1 A;  4YRG A;  3PCO A;  3HFZ B;  11AS A;  2YHT A;  5GMK j;  2E65 A;  4F7U A;  1I8F A;  5GMK i;  3HFZ A;  1SES A;  4M78 A;  1U1S A;  2CGH A;  3VQX A;  2EAY A;  4XU3 A;  4C8Q F;  1D3B B;  4N0A C;  4J15 A;  1B76 A;  2EWN A;  5I21 A;  4P72 A;  1NJ2 A;  4Q15 A;  4M7D D;  2DZ9 A;  1D3B A;  1H4Q A;  2DU5 A;  1B8A A;  4EX5 A;  1WPY A;  3JCM b;  5GAO n;  4M75 F;  1WQ7 A;  3IG2 A;  5GAN 3;  2ARU A;  4YDQ A;  2AMC B;  3BDU A;  4M7A F;  4HT8 A;  3HXX A;  4M7D A;  2ZZF A;  3RKY A;  4K87 A;  2E1H A;  3QO7 A;  3RGL A;  4LNS A;  4XEM A;  2AMC A;  4DPG A;  3KFU A;  4YRT A;  4M77 E;  4C8Q D;  4PG3 A;  4F7U G;  4P3N A;  4C8Q B;  4XEO A;  5GMK e;  3ERR A;  2J3M A;  4XTU A;  4OLF A;  4YRO A;  3A7A A;  1X56 A;  4P74 C;  4YRQ A;  4C8Q A;  4M75 D;  3V7R A;  4NOY A;  4M75 B;  3HFN A;  4EMG A;  4M7A D;  4H02 A;  2VXE A;  3SWN C;  4M78 E;  4M7A B;  1X54 A;  3M4G A;  2IY5 B;  5GAN j;  5GAN 7;  4ZTU B;  4M75 A;  4XTZ A;  2ZXF A;  2DVE A;  3W3S A;  2DTH A;  4TVA B;  4M7A A;  4DQ2 A;  3JB9 F;  2IY5 A;  3JCM X;  3JCM h;  4HWS A;  3M4P A;  3JCM J;  2RB6 A;  1Z7M A;  4TVA A;  2Q5H A;  4J6X A;  1Y96 B;  2DZC A;  4EMK B;  3WQZ A;  1LNX A;  1YB3 A;  4X5O A;  1KOG A;  1G5I A;  4M7D E;  4G84 A;  4YRJ A;  3JCM g;  4CH6 A;  4H2T A;  3JCM f;  5K1X A;  5GMK l;  2ALY B;  4P71 A;  3UFG A;  1KMN A;  1LYL A;  4C8Q G;  3RIR A;  3GIB A;  3HXV A;  2CJA A;  4YRE A;  5LJ3 h;  3A74 A;  3LC0 A;  3JB9 D;  4YRP A;  2ALY A;  3E9H A;  3HRK A;  4C8Q E;  2DTI A;  4M77 F;  4M75 G;  4JRK A;  5LJ5 e;  5GAN e;  5LJ3 g;  2DDZ A;  5LJ3 f;  4QVD A;  4H2W A;  4WF2 A;  3V7S A;  4V2S A;  4YRS A;  1ADJ A;  3A5Z A;  4M75 E;  2VXF A;  4XTX A;  1M8V A;  4C92 F;  4Y91 A;  2DKG A;  4M7A E;  2RHS B;  3UGQ A;  3IKM B;  2G4C A;  2DJZ A;  4M78 F;  5DY9 A;  4XTY A;  3MF2 A;  1WLE A;  1B70 B;  1HTT A;  2EJG A;  1X55 A;  4PJO F;  5CAI A;  2RHS A;  2ODR C;  2ZTG A;  2DXU A;  1B34 B;  1EVL A;  3P8V A;  4M77 D;  2CJ9 A;  4M77 B;  3HFO A;  2PMF A;  5GAN 8;  1B70 A;  4CS4 A;  1H4V B;  4XU2 A;  2ZZG A;  3MF1 A;  3QHS A;  4A53 A;  2Y90 A;  3R07 A;  1B34 A;  2XGT A;  2HNI A;  1C0A A;  3QUI A;  2QHV A;  4XQ3 A;  4C92 D;  4C92 B;  4M7D F;  1WQW A;  4NL2 A;  3JB9 G;  2RHQ B;  4M78 D;  1USY A;  1B7Y B;  4M78 B;  4YCV A;  4HWT A;  4C92 A;  3HRI A;  4PJO D;  3A5Y A;  2RHQ A;  4PJO B;  2YLB A;  1B7Y A;  5GAO p;  1I4K 1;  4PJO A;  1KMM A;  3V8K A;  4P73 A;  1ASY A;  3HTZ A;  3TUP A;  4M7D B;  5GAN 6;  3RER A;  1G5H A;  3NET A;  3I7F A;  1YFT A;  4ZIB A;  2FYK A;  3JCM P;  5C53 B;  2DTO A;  4YRI A;  3JB9 J;  4YRL A;  4Q6G A;  4M77 G;  1WU7 A;  2DEQ A;  4UPA A;  4PHC A;  3LSS A;  4YCU A;  3HY0 A;  1PYS B;  4G85 A;  4CH3 A;  3V7C A;  2ZT7 A;  4KR3 A;  1KQ1 A;  1E1T A;  1WNL A;  4MMK A;  3HSB A;  3FJP A;  4C92 G;  1PYS A;  1H4S A;  2EL9 A;  1JJC B;  1X01 A;  4NL3 A;  4M78 G;  3VQY A;  1KQ2 A;  4XU1 A;  4C92 E;  2C8M A;  4J6Y A;  1G51 A;  1JJC A;  3A7R A;  3IKL A;  4H2V A;  4YRR A;  4EMK C;  2ZNI A;  4P75 C;  3JB9 H;  4HWO A;  3SB2 A;  4H2S A;  4J5Y A;  1H4T A;  1RIQ A;  1X2H A;  3QO8 A;  2YLC A;  3BFM A;  4PJO E;  1E22 A;  3M4Q A;  3HXZ A;  4N0A A;  2E5A A;  2ZT6 A;  1JRI A;  4M7D G;  3QO3 A;  2DU7 A;  2Q7E A;  3G1Z A;  2I4L A;  2DXT A;  4H2Y A;  4H2U A;  1EFW A;  2QHU A;  4UP8 A;  2RA2 A;  5GAM h;  3A32 A;  4RCB A;  4AH6 A;  1X2G A;  1N9W A;  4YRF A;  3RKW A;  3FB9 A;  5GAO m;  2P5I A;  5LJ3 j;  5GAM g;  3JCM c;  5LJ5 h;  2CJB A;  5GAM f;  3A7U A;  2FB7 A;  2CIM A;  4TQD A;  4CH4 A;  2ZCE A;  5GAN 4;  2EJF A;  3TEH A;  2ART A;  4HWR A;  4HT9 A;  3JCM d;  5GAO r;  4P74 A;  2PME A;  3SWN B;  3L1A A;  5LJ5 f;  5GAO q;  3QNE A;  5KNN A;  1IL2 A;  4M7A G;  1NJ6 A;  3PGG A;  2I2L A;  2ARS A;  3QO5 A;  4RDX A;  4KR2 A;  3JCM e;  1QF6 A;  2J3L A;  3SWN A;  4YRC A;  1BIB A;  4OP0 A;  2ZNJ A;  4ZTZ B;  5C51 B;  1E24 A;  3JCM W;  2AKW B;  2DQ0 A;  5LJ3 d;  1M5Q 1;  2ZIO A;  1TH7 A;  5LJ3 e;  2AKW A;  1EIY B;  4WJ3 M;  1J5W A;  2K57 A;  3JCM V;  3P8T A;  2ZT8 A;  3L4G A;  4P72 C;  3VBB A;  2ZGW A;  3ICA A;  1EIY A;  3V8J A;  4O2D A;  4YRN A;  3CMQ A;  1SET A;  3RKX A;  2Q5I A;  4M7D C;  5GAN 5;  3REX A;  1WYD A;  2I4M A;  2QHT A;  1ASZ A;  4YCW A;  3IAL A;  2I4O A;  5ELN A;  2JN0 A;  3AHU A;  3NEL A;  5K1P A;  3OD1 A;  4RQE A;  4XTW A;  1NYR A;  4NCX A;  4PNO A;  2EJ9 A;  2QTX A;  4C8Q C;  2ODR D;  3L2Z A;  3BW1 A;  4UP7 A;  3HY1 A;  1E1O A;  1GGM A;  5GAN 2;  4A54 A;  5GMK h;  1EQR A;  4M75 C;  2ZIM A;  3RUX A;  1U1T A;  4M7A C;  2ZIN A;  4JUV A;  3RES A;  3HFV A;  3UH0 A;  2E41 A;  1MGQ A;  4JLI A;  3HXY A;  3MEY A;  2VC8 A;  3FIF A;  4J6W A;  3RAC A;  3UGT A;  4PJO G;  3TEG A;  4BWA A;  4TTV A;  3EFR A;  4XU0 A;  1YGB A;  4P71 C;  1BBU A;  3REU A;  2RM4 A;  3HXW A;  3E9I A;  3JB9 I;  2E64 A;  4CH5 A;  1L0W A;  2C7I A;  1NJ5 A;  1LJO A;  5GAM j;  2ZR3 A;  1EVK A;  2ZZE A;  4X9C A;  1YFR A;  1YFS A;  1VQZ A;  3NEN A;  4F7U E;  1HXD A;  2P0L A;  3PZC A;  1JBM A;  3JCM Q;  3VQV A;  4KQE A;  3A31 A;  5GAO l;  4TVW A; 
#chains in the Genus database with same CATH topology
 3CMA Q;  2QHS A;  4MML A;  1KK7 A;  1ADY A;  4F16 A;  2QQA A;  3CCE Q;  4J9H A;  3TEH B;  1GRI A;  1QKX A;  3PVQ A;  3C95 A;  3X24 B;  3DSQ A;  5F5W A;  1R8O B;  1LOJ A;  1PWT A;  5AYF A;  4L6V 5;  1OU8 A;  1RAB B;  3RL6 A;  2EYZ A;  3CCU A;  4RQF A;  2HBP A;  2D8H A;  3VQW A;  1E6H A;  2BKD N;  5FU6 C;  2D8J A;  4LVJ A;  4QVZ A;  1R77 A;  1NEG A;  4M77 C;  4LVL A;  4EMK A;  2RD1 A;  3QWX X;  5GAM d;  4P75 A;  1RAF B;  5EC7 A;  4K88 A;  1BIA A;  5GAM e;  1USY C;  1BBW A;  5L8R E;  4AT1 B;  2F5T X;  2ABL A;  1YP5 A;  4YTL A;  3A8O B;  2PU9 B;  1YIT T;  2X9H A;  1H64 1;  2QQS A;  1GCP A;  3UDC A;  2DYB A;  2I4N A;  3C12 A;  3QG1 A;  4H2X A;  2L0A A;  5E3I A;  3CCQ A;  1SER A;  4YPF A;  2PVO B;  2L89 A;  1K8A U;  4HWP A;  2F2X A;  3EFO A;  8ATC B;  3G1J A;  3L2V A;  1M2V B;  2XTI A;  2X4X A;  1VQ5 Q;  3QYH B;  3EG1 A;  3CXC A;  3WVE B;  4HA8 A;  1QP3 A;  2IG0 A;  2KXC A;  3VYG A;  4HVC A;  1OYX A;  4KBM B;  3INZ A;  2QA4 T;  1QKW A;  4YP0 A;  1YJW Q;  5HCK A;  1VQ4 T;  1K0X A;  4F7U B;  2DQ3 A;  1RI9 A;  2VYT A;  4WJ4 A;  2L3S A;  3RF1 A;  2EQM A;  4YRG A;  3HFZ B;  3I5R A;  2E65 A;  3CMA T;  2LTO A;  4AFU C;  3TVT A;  3S6W A;  3CCE T;  1SES A;  4M78 A;  2J7I A;  3VQX A;  2P0K A;  3MPU B;  4C8Q F;  1M3C A;  1GCQ C;  1V1C A;  1GBR A;  1IHV A;  2HKQ B;  4LDV A;  1NJ2 A;  4M7D D;  3A8G B;  4FW1 A;  1B8A A;  1U5S A;  4M75 F;  2DMO A;  2AMC B;  2KR3 A;  4J9C A;  1OZ3 A;  3MQZ A;  3RKY A;  1ARK A;  2K2M A;  2EW3 A;  2E1H A;  3QO7 A;  3RGL A;  2LDM A;  4YRT A;  3I5S A;  4C8Q D;  2XDB A;  1PRL C;  5CCA A;  2J3M A;  4XTU A;  5ECA A;  2K6D A;  3S3N A;  1IZ6 A;  1SEM A;  4OLF A;  1X56 A;  1X6B A;  1TU0 B;  4M75 D;  1VQK A;  1WXU A;  2RQW A;  2J06 A;  4EMG A;  4H02 A;  1RAI B;  2VXE A;  4M78 E;  2HQH A;  2JTM A;  4ATO A;  2LCC A;  2X35 A;  1QVG P;  5GAN 7;  3AT1 B;  3I55 A;  1D0X A;  1PSF A;  3JAM E;  2DVE A;  2DTH A;  4DQ2 A;  3JB9 F;  2O9V A;  3NTI A;  3JCM J;  1Z7M A;  1G83 A;  4EMK B;  1VQ5 T;  1G5I A;  1Y71 A;  1YJW T;  3EGD A;  2RI3 A;  1EX4 A;  1MMD A;  1WLP B;  2YT6 A;  4Z02 A;  2C06 A;  3GOX A;  1RAA B;  1BB9 A;  3JB9 D;  2ALY A;  2NUP A;  1PRM C;  2DTI A;  1UDL A;  3REB B;  4FYX B;  1Q7Y C;  3A5Z B;  4RMO A;  4JS5 A;  3CCR A;  4H2W A;  4WF2 A;  4HCB A;  1AWW A;  4A4H A;  2PVD B;  1H92 A;  2VXF A;  2VVK A;  4C92 F;  1NYF A;  4Y91 A;  3I55 Q;  3H0F A;  4LUD A;  1K76 A;  2RHS B;  3UGQ A;  2MWO A;  4DEY A;  4XTY A;  2O4X B;  4AFS C;  3EFO B;  2DF6 A;  1WLE A;  5L23 A;  2YRV A;  2KMT A;  2RHY A;  3C0C A;  5CAI A;  1IO6 A;  2DXU A;  3MEU A;  2PNI A;  3EH1 A;  2GFU A;  1Q7Y R;  1C6V X;  3OW2 A;  1N6A A;  4A53 A;  3R07 A;  2XGT A;  1C0A A;  3FC3 A;  2MIO A;  1SRM A;  2WSC E;  4C92 D;  2A37 A;  5KYY A;  5EG2 A;  1WQW A;  1VYT A;  2P0P A;  4J9E A;  2COZ A;  1GFD A;  2RHQ B;  1B7Y B;  1T3L A;  2XK0 A;  4M78 B;  4FW2 A;  4O6J A;  4ZGE B;  4YCV A;  3GPL A;  2IIM A;  1ZA1 B;  3LX7 A;  2R58 A;  3M53 A;  2EVR A;  2YLB A;  3OYI A;  4OB0 B;  1PM3 A;  5C0M A;  1LPL A;  2KXD A;  2RHZ A;  3CXC P;  4PJO A;  1RAC B;  4PJJ A;  3A8M B;  3PE0 A;  4IIM A;  1ASY A;  2A36 A;  3E1S A;  3HTZ A;  4E7L A;  1NPR A;  4OMF B;  1G5H A;  2RK1 A;  1PG5 B;  4ZIB A;  2RJE A;  2DTO A;  2DO3 A;  2HDA A;  4RTX A;  1VQ8 A;  1TUD A;  2DEQ A;  2AHJ B;  4O5V A;  3ULR B;  4UPA A;  3LSS A;  3L2Q A;  3HY0 A;  1VQP A;  4J9D A;  1NPP A;  1E1T A;  1WNL A;  4MMK A;  3HSB A;  1PYS A;  2LQW A;  3LGF A;  2EL9 A;  2KRO A;  2CP6 A;  2X4Y A;  1OX8 A;  5LL6 S;  1AWJ A;  1Z9Q A;  2QAZ A;  5FWC A;  4J6Y A;  4CRI A;  1G8X A;  3I55 T;  4PJL A;  2ZNI A;  5D6Y A;  4HWO A;  2NYS A;  3SB2 A;  1YHQ A;  3MCA B;  4RTZ A;  3QO8 A;  4DBF A;  4PJO E;  1M1F A;  1WJR A;  3CC2 A;  1YWP A;  4M7D G;  5KCH A;  4A4E A;  2DYI A;  4R0K A;  5CO7 A;  3EGD B;  4H2Y A;  3QWY A;  2QHU A;  2RA2 A;  2RF0 A;  1TUC A;  1C0M A;  1VQ8 Q;  3FLG A;  1S1N A;  3LLR A;  1OI1 A;  2JMC A;  4HCK A;  2YSQ A;  3CBO A;  1N9W A;  1SSF A;  4YRF A;  3RKW A;  5LJ3 j;  1VQP Q;  1M1K R;  2F69 A;  2X3W D;  4OGC A;  5LJ5 h;  1Q82 R;  3A7U A;  1NBE B;  2HMA A;  3PMI A;  2ZCE A;  1M90 R;  2AK5 A;  3CBP A;  4HT9 A;  3JCM d;  3UF4 A;  2OTJ Q;  4PLI A;  3SWN B;  4D8D A;  1TWB A;  1YWO A;  3L1A A;  5LJ5 f;  4P74 A;  5KNN A;  2O31 A;  4RDX A;  3JCM e;  1NE8 A;  2CH4 W;  2QQB A;  3A8L B;  4FYY B;  2YWW A;  1YHQ Q;  5FWB A;  4Q5W A;  1BIB A;  2ZNJ A;  3CC2 Q;  3MKD A;  2J05 A;  1K8A C;  2DAQ A;  2CYZ B;  3JCM W;  2C0O A;  3H41 A;  1K9M R;  5LJ3 d;  3RNJ A;  3MP1 A;  5LJ3 e;  2AKW A;  1EIY B;  1NJI R;  5KYY B;  1J5W A;  3JCM V;  3L4G A;  1SHF A;  2NUT A;  3U23 A;  2RQU A;  3ICA A;  3SD4 A;  4DOW A;  2HZY A;  2LVM A;  4YRN A;  4E7H A;  3P8D A;  1SET A;  2RPN A;  3TEE A;  3EHQ A;  4GLM A;  4M7D C;  1UGS B;  1JJ2 S;  1HSQ A;  4OB2 B;  1WYD A;  1W4S A;  4RTV A;  4HCZ A;  2XDD A;  3OW2 P;  2D9T A;  4DBH A;  1K1Z A;  1OQK A;  4X34 A;  1AVZ C;  4OB3 B;  2H3E B;  2JXB A;  2QTX A;  4C8Q C;  2BZ8 A;  5D6X A;  3L2Z A;  3BW1 A;  1VQ8 T;  4OF1 A;  3HY1 A;  2GQI A;  2KAF A;  3LYI A;  3QII A;  2EGA A;  5GAN 2;  1VQP T;  2LT4 A;  2KVQ G;  4KGV B;  1EQR A;  4M75 C;  2ZIM A;  4AFQ C;  5KYW B;  3OYJ A;  4J83 A;  4C5I A;  2KQW A;  4JUV A;  4N4H A;  4DEX A;  1ZQ1 A;  4OMM A;  5CQX A;  2OTJ T;  5CKE A;  1R0C B;  2LX7 A;  1WHJ A;  3CC4 A;  1YN8 A;  3RAC A;  1WHK A;  3UAT A;  1YHQ T;  4IUQ A;  2O9S A;  4RKU E;  3ZEH A;  4F14 A;  3L2W A;  3G6E A;  4BY6 B;  2PUO B;  4IKF A;  3CC2 T;  1WHH A;  1BBU A;  4MZT A;  2RM4 A;  3JB9 I;  1K73 R;  1MUZ A;  1KD1 R;  2JJ9 A;  1UGQ B;  3IQL A;  1LJO A;  3ME9 A;  3CQT A;  2ZR3 A;  3BDL A;  4X9C A;  2ZZE A;  3NEN A;  4QKU A;  1HXD A;  3JCM Q;  3A31 A;  4TVW A;  2L5Q A;  4K86 A;  5IH2 A;  1X69 A;  1KC8 R;  2BTT A;  1N9S A;  2RJD A;  4KH0 B;  4TWA A;  1AHJ B;  1NNH A;  4CS3 A;  3LWI A;  4BI4 A;  5ELO A;  3VU3 C;  2O88 A;  2O2O A;  4RCC A;  2D0Q B;  2ZT5 A;  1X6O A;  5LJ5 g;  5GAN g;  1NJ8 A;  1VQL Q;  3G6E Q;  1WYX A;  5IHN A;  5I2M A;  3OYH A;  4P3O A;  1I81 A;  1SSH A;  3DLL A;  4NS5 A;  1H3Z A;  4RMF A;  2DL3 A;  4KGZ B;  1N9R A;  2ECZ A;  2FL7 A;  4QVC A;  4C92 C;  4YRK A;  1XTD A;  2RQT A;  3L4G B;  4CS2 A;  1G2B A;  1YFN A;  2MK5 A;  2I0N A;  2RMO A;  2L3R A;  1R0B G;  4WI1 A;  1Q7Y U;  3VS0 A;  5A0G A;  1YCY A;  2ZCF B;  2WAC A;  4P73 C;  1FYF A;  3LSQ A;  1SF9 A;  1D1A A;  2LZ6 B;  2FZK B;  4EO4 A;  1TSF A;  4RUG A;  2GBQ A;  3O5Z A;  4KUL A;  1YIJ Q;  3P8H A;  3M54 A;  1WJQ A;  3PCO B;  4M77 A;  2VB6 A;  1M4Z A;  1PSE A;  1LVK A;  1M2V A;  2CSQ A;  2QA4 A;  1FX7 A;  1VQ4 A;  4F7U A;  3MO8 A;  2LQ8 A;  1WDX A;  1I8F A;  3HFZ A;  3CMA A;  1VQ6 Q;  1ZA2 B;  1U1S A;  2JOY A;  2ESW A;  4XU3 A;  3X20 B;  3OYC A;  4AG2 C;  3CCE A;  4N0A C;  4J15 A;  1B76 A;  4P72 A;  2E12 A;  2IPO B;  2MF2 A;  1VQL T;  1H4Q A;  1KSW A;  1WPY A;  5GAO n;  1TS9 A;  3G6E T;  1WQ7 A;  2FRY A;  5GAN 3;  4ZGJ B;  4YDQ A;  4HT8 A;  3HXX A;  3GLX A;  1ZBX A;  3EGX B;  2ZZF A;  1D1B A;  4HVW A;  1M2O A;  1MHN A;  2AMC A;  2R5A A;  3KFU A;  2YDL A;  4L59 A;  3CC7 A;  1KQS P;  4M77 E;  4OMN A;  4F7U G;  4P3N A;  2EQJ A;  5GJV B;  4JJD A;  4YRO A;  4R55 A;  2FZC B;  2DIG A;  2XID A;  1M30 A;  1NYG A;  4M7A B;  4KH1 B;  4Z88 A;  2IY5 B;  2V1R A;  4ZTU B;  1BI0 A;  1FYN A;  4XTZ A;  5D6W A;  2ZXF A;  4HKE A;  2DVJ A;  1M1K U;  3GNF B;  1Q82 U;  1ZUY A;  2XIC A;  3C4S A;  2VUB A;  2YUO A;  1QVF A;  4HWS A;  3VRZ A;  4JRP A;  1M90 U;  1Q86 R;  2RB6 A;  2R57 A;  1YIJ T;  4J6X A;  2DZC A;  2G3R A;  2MAM A;  3HP9 A;  2PTK A;  1KJW A;  5A0L A;  4G84 A;  4YRJ A;  2A08 A;  3EG9 A;  1VQ5 A;  1V29 B;  1D1C A;  1BCM A;  4JDS A;  3HPW A;  4P71 A;  3UFG A;  4J7F A;  3F70 A;  3WVD B;  1YJW A;  4E7S A;  1KMN A;  3CC7 Q;  1N27 A;  1LYL A;  1XJW B;  1ZUK A;  2M9U A;  4C0D C;  4YRE A;  4YRP A;  3E9H A;  3HRK A;  1VQ6 T;  4BAC A;  1K9M U;  4JRK A;  4LXC A;  4J9I A;  1B7T A;  1QVG S;  1ZSZ A;  3J7A F;  3I56 A;  4QVD A;  1UEB A;  4V2S A;  1BBZ A;  1NJI U;  5D7U A;  2LCL A;  3MEA A;  1ADJ A;  3A5Z A;  1SHG A;  2DKG A;  3OYG A;  1AWO A;  1BI3 A;  2VKN A;  3DB3 A;  1WJS A;  3MF2 A;  3DLM A;  1HTT A;  2RHS A;  5FU6 B;  4PJO F;  3S3M A;  1B34 B;  3P8V A;  3E19 A;  3OYE A;  2CJ9 A;  2O4X A;  4M77 B;  2MMP A;  5GAN 8;  3CD6 Q;  2ZZG A;  3MF1 A;  2GF7 A;  2JUF A;  5AT1 B;  1YNZ A;  1QWF A;  4M7D F;  2W10 A;  2M0Y A;  2CT4 A;  4DBR A;  4PJO D;  2RHQ A;  1B7Y A;  4F04 B;  2ROL A;  5GAO p;  3I56 Q;  1I4K 1;  2RHU A;  1OZ2 A;  3HRT A;  4LE9 A;  3ZL7 C;  1CKB A;  3EGU A;  5DM7 R;  2HCK A;  2RJC A;  1E6G A;  2EFI A;  1G3Y A;  1OPK A;  3I35 A;  4CC2 A;  3RR6 A;  4IIO A;  4FCY A;  3RER A;  3NET A;  3H8Z A;  2ENM A;  3I7F A;  4PLL A;  2FYK A;  5C53 B;  1I0C A;  3JB9 J;  4YRL A;  4Q6G A;  4A4F A;  1WU7 A;  1VYU A;  1EIF A;  4PHC A;  3CC7 T;  2QDL A;  4YCU A;  4G85 A;  3P8B B;  4CH3 A;  3OYB A;  3VS5 A;  2NS6 A;  2CP0 A;  2F5K A;  2LNV A;  2JZ2 A;  1YCS B;  3N5B B;  1K73 U;  3FJP A;  1AZG B;  1ZLM A;  2C0I A;  1KD1 U;  5IXF A;  2RQR A;  1JJC B;  5DLQ E;  4CC4 B;  4D6W A;  4M78 G;  2LT1 A;  1WA7 A;  1YJ9 Q;  1KQ2 A;  4XU1 A;  2YRD A;  3VS2 A;  4E7I A;  2JS0 A;  4LDW A;  1G51 A;  3IKL A;  4H2V A;  2E3H A;  4YRR A;  4EMK C;  1PCX A;  3CXC S;  2GNC A;  4P75 C;  2EKH A;  1X2H A;  1KHI A;  3BFM A;  1KC8 U;  2V1Q A;  4RTY A;  4J7I A;  3M4Q A;  3R6O A;  2EYW A;  3QO3 A;  3G1Z A;  2QQ9 A;  2I4L A;  3EG9 B;  3CD6 T;  2DXT A;  2A8E A;  3DKM A;  1EFW A;  4F17 A;  3QZ5 B;  2HD0 A;  2OAU A;  1QMC A;  4VUB A;  2PQW A;  1BKB A;  1VQO T;  1IB8 A;  1RLP C;  2J6K A;  4HVU A;  3FB9 A;  2LX9 A;  5GAM g;  2RNA A;  3MJX A;  2FHD A;  2FB7 A;  2NUZ A;  2CIM A;  2QGF B;  1RLQ C;  4CH4 A;  4C0Z A;  1QVF P;  1M9S A;  1ZSZ B;  2CS7 A;  2EJF A;  4HWR A;  1CKA A;  1WGS A;  3I56 T;  1S72 Q;  4E7J A;  3M57 A;  3QNE A;  3OQ5 A;  2QAS A;  3QO5 A;  1QF6 A;  2J3L A;  2MYS A;  2K79 A;  3SWN A;  1UUE A;  3M0S A;  4B9X A;  1X2Q A;  5M9O A;  5IHI A;  1CSK A;  4E7K A;  1HYO A;  3OB9 A;  1Y7X A;  2ZPH B;  2KI7 A;  1BCO A;  1IRX A;  2B8A A;  1QVP A;  3NMZ C;  4KGX B;  2D1X A;  4C0F A;  2Z0W A;  2LJ3 A;  3OYY A;  2K57 A;  1GXI E;  2DJQ A;  3P8T A;  1D0Z A;  2ZT8 A;  4JZ3 A;  3M0P A;  2P4T A;  2KY9 A;  2FO0 A;  2ZGW A;  1YJ9 T;  1EIY A;  3OSS C;  3PNW C;  3NTK A;  2RI5 A;  1B07 A;  5KYX A;  4FYV B;  1BI2 A;  2A28 A;  1VYV A;  2J6F A;  2R5M A;  5GAN 5;  3VS4 A;  2GFA A;  2OI3 A;  3IAL A;  2QTV A;  2I4O A;  4WTO B;  3AHU A;  3CPW A;  2W0Z A;  1QCF A;  1G3S A;  3CCM Q;  1TG0 A;  3M9Q A;  1IXD A;  2K7A A;  2KNB B;  4PKC C;  4BDY A;  2KGT A;  2O01 E;  5J3B A;  2XHC A;  1H8K A;  1IHW A;  3PFS A;  5GMK h;  3DB4 A;  3NFC A;  3M5A A;  2LJ1 A;  1PC0 A;  1U1T A;  2ZIN A;  1X6G A;  3NGP A;  1PD1 A;  5KYW A;  2VV5 A;  1MGQ A;  1S72 T;  4JLI A;  2RJF A;  2HL5 C;  2FPF A;  2RH2 A;  2OTJ A;  4D8K A;  3OW2 S;  3UGT A;  4PJO G;  1JU5 C;  2P84 A;  3UA6 A;  1M1K C;  3OYF A;  3HXW A;  1Q82 C;  2E64 A;  3E9F A;  4CH5 A;  4HVV A;  1W2B A;  2MOX A;  1L0W A;  1M90 C;  1K0S A;  2JTF A;  1M27 C;  1ZHI A;  1Q86 U;  2DIL A;  1VQZ A;  2KK4 A;  2OX7 A;  5FRM A;  3CEY A;  1JBM A;  3HTR A;  2M1H A;  2CP7 A;  1GL5 A;  4EPC A;  1ABQ A;  1N8R R;  2XKO C;  4JLG A;  5LJ5 j;  2L3P A;  1G3T A;  4YRM A;  2OAW A;  4OMO A;  5GAN h;  1A0N B;  1VQ9 A;  3NPF A;  2KT8 A;  2K4Y A;  3V8L A;  1K9M C;  2E6Z A;  2Y4Y A;  3R6N A;  2QEX A;  2EKO A;  1HC7 A;  1NJI C;  5GAN f;  1FMK A;  3VV0 A;  4ZTF A;  3CCM T;  1JO8 A;  4JRI A;  3NEM A;  2K3X A;  3UWN A;  2EGE A;  4XK8 E;  1QE0 A;  4BE2 A;  1HK9 A;  2VGN A;  5GMK m;  1TXQ A;  3MHX A;  4FSS A;  2ZPB B;  5J39 A;  5LJ5 d;  1LCK A;  4Y28 E;  5GAN d;  3T9N A;  1SRY A;  3BJU A;  2CZ7 B;  4DOV A;  3P8Y A;  1X75 C;  2E3C A;  4X1V A;  4PJO C;  3QTC A;  4LVM A;  1IRE B;  1QW1 A;  2DA9 A;  5KYX B;  2V8K A;  4F7U F;  3OYN A;  4X9D A;  1QCO A;  3VUZ A;  4JS4 A;  3HHT B;  5HGQ A;  2WSF E;  2AZS A;  1N5Z A;  1VQ9 Q;  3D7S B;  2DXB A;  4LVK A;  2Q7H A;  2KE9 A;  2QEX Q;  4E51 A;  4P3P A;  4IUR A;  4YYE A;  1PNJ A;  1NYQ A;  4UP9 A;  4B9W A;  1W66 A;  1KIK A;  12AS A;  2CH4 A;  1QWE A;  1TTH B;  1Q81 R;  3ER0 A;  5KYN A;  1D0Y A;  2V8J A;  3CCS Q;  5CKB A;  3PCO A;  11AS A;  2CSI A;  1UTI A;  1OEB A;  3TCJ A;  3URG A;  2FVU A;  1VIE A;  5GMK i;  7AT1 B;  4A4K A;  2CUD A;  3FDR A;  3RMS A;  1K73 C;  2EAY A;  3CPW P;  1RAG B;  1SG5 A;  1D3B B;  1KD1 C;  1K4U S;  1O9S A;  2A3L A;  2E5K A;  2YRC A;  3JSC A;  4OML A;  5I21 A;  1KQS A;  3GNG A;  2LQK A;  2HBW A;  1D09 B;  1MMN A;  2DD4 A;  3IG2 A;  3M0Q A;  2MWP A;  2ARU A;  3UT1 A;  1VQL A;  2AKK A;  1YJN A;  1IGQ A;  1VQM A;  4K87 A;  5IAY A;  2KT1 A;  1KC8 C;  4DPG A;  3QYG B;  4C0G A;  5KE2 A;  3OYL A;  3LW5 E;  3OBW A;  4J9F A;  3EGX A;  4C8Q B;  4XEO A;  3ERR A;  2DX1 A;  5FU7 C;  4ESR A;  4P74 C;  2ZPI B;  1YBY A;  2DM1 A;  2KRM A;  3CCJ A;  3MP6 A;  4M75 B;  3RMQ A;  3WXM B;  5CKF A;  3OY9 A;  2GQV A;  3QZ9 B;  3CPF A;  1VQ9 T;  3M0T A;  1WX6 A;  1UB4 A;  4ZGD B;  1W2B P;  4TVA B;  3E9G A;  4M7A A;  4ZN1 A;  2QEX T;  2IY5 A;  4R56 A;  2AIR B;  2XI9 A;  3SFM A;  3J80 E;  1IGU A;  1XOV A;  1I1J A;  1YI2 A;  3VJP A;  3KBG A;  2Q5H A;  4J9B A;  2DK3 A;  1LNX A;  4X5O A;  4A4G A;  1KOG A;  4PK4 A;  1YJN Q;  2Y4X A;  3JCM g;  1VQM Q;  2CT3 A;  1YIJ A;  2C0T A;  5K1X A;  5GMK l;  3CCS T;  2BE9 B;  4LD6 A;  3J81 E;  3NHN A;  3A74 A;  3LC0 A;  2JW4 A;  4ANJ A;  1BU1 A;  2MPX C;  2DFU A;  3M0R A;  3CCJ Q;  3OSV A;  5CKH A;  5LJ3 g;  1VQ6 A;  3ZFJ A;  1JJ2 P;  1JXM A;  4II1 A;  4B6M A;  3OA6 A;  1WFW A;  5IHK A;  4XTX A;  2H3J A;  4M7A E;  2JS2 A;  3JRZ A;  2DJZ A;  4M78 F;  2FEI A;  3RBB B;  2H8H A;  1B70 B;  2EJG A;  3H9N A;  1VIF A;  2CDT A;  1YI2 Q;  1EVL A;  2AT1 B;  4C5H A;  2PMF A;  2CP5 A;  2KEA A;  1O75 A;  1V76 A;  4XU2 A;  1MV3 A;  1H4V B;  5C6S A;  2E5Q A;  2EPD A;  1B34 A;  4IUP A;  3QUI A;  2L8D A;  2QHV A;  4RTU A;  1PHT A;  1ABO A;  4C92 B;  2RI2 A;  3PVL A;  2E70 A;  3CME Q;  4M78 D;  1USY A;  4EIK A;  2EGC A;  4KT0 E;  4HWT A;  3QBY A;  3A5Y A;  1DJ7 B;  1NG2 A;  3S3O A;  5CQY A;  1AD5 A;  2GCX A;  2RN8 A;  1KMM A;  2KDS A;  3TUP A;  4ELZ C;  1YJN T;  1UGV A;  1UG1 A;  1VQM T;  2QG9 B;  3L42 A;  3JCM P;  2EQU A;  3EHR A;  2ZZD A;  2SEM A;  4M77 G;  2BZX A;  4DA4 A;  1C1A A;  2DL7 A;  2XDP A;  2CKK A;  1NZ9 A;  3V7C A;  1OV3 A;  1KQ1 A;  9ATC B;  3GP8 A;  3EAE A;  4MDX A;  4MZM A;  2VAS A;  3CCJ T;  1Q86 C;  4PJM A;  3OS5 A;  1F1B B;  2HSE B;  2EYX A;  2KRS A;  2KBT A;  2K5I A;  5HK3 A;  1KG1 A;  2C8M A;  1JJC A;  2F2V A;  4ELY C;  2E6N A;  2FPE A;  2HQE A;  1N8R U;  4J5Y A;  1RIQ A;  2GTJ A;  2YLC A;  1ZSG A;  2EQI A;  2NWM A;  3H6Z A;  3HXZ A;  1YI2 T;  2AKL A;  1GCQ A;  2M0O A;  4FM4 B;  1Q95 G;  2ZT6 A;  2WSE E;  3KUF A;  4AG1 C;  2DU7 A;  2Q7E A;  4LUE A;  2P0Q A;  3PTA A;  4QT7 A;  4H2U A;  4JJN K;  4ZNX A;  5GAM h;  3A32 A;  3CD6 A;  1MV0 B;  2P4R A;  2QI2 A;  3H0H A;  1X2G A;  3JV3 A;  1JEG A;  5GAO m;  3CME T;  1I5O B;  2P5I A;  2MCN A;  1TOV A;  2L3Q A;  4A63 B;  3JCM c;  4LNP A;  3QPH A;  1VQO A;  5GAM f;  4PFP A;  2CJB A;  4K11 A;  2K3B A;  3QKJ A;  3RDV A;  2YXY A;  2BIV A;  5GAN 4;  1EZZ B;  5GAO r;  5GAO q;  1IL2 A;  3A8H B;  2ATC B;  4Y92 A;  1U3O A;  4OP0 A;  2X3X D;  3SHW A;  4ZTZ B;  1E7O A;  1VQ7 Q;  3PIP A;  1E24 A;  2DQ0 A;  2LMJ A;  4C5G A;  2EYY A;  3OYD A;  3VUB A;  1WHG A;  2FPD A;  4WJ3 M;  1T0J A;  1VQN A;  2HSP A;  4P72 C;  3X28 B;  3VBB A;  2J6O A;  4C0D B;  1QVF S;  4GBQ A;  1Q81 U;  1VQO Q;  6AT1 B;  3CMQ A;  4BDZ A;  3OYA A;  1YJ9 A;  2CUB A;  4HCC A;  2Q5I A;  3EG2 A;  3CCU Q;  3REX A;  3REA B;  2DBK A;  2ZPF B;  2A7Y A;  2RHI A;  5KCO A;  4LDY A;  5ELN A;  2E4H A;  3GBQ A;  3FJ5 A;  1ACM B;  2X51 A;  2F2W A;  4RG2 A;  3NEL A;  3UA7 A;  3OD1 A;  4BI3 A;  4XTW A;  1NYR A;  4NCX A;  5FRO A;  4PNO A;  4ORZ A;  3HKS A;  1RUW A;  2ODR D;  3VS1 A;  1AWX A;  1GGM A;  3TSW A;  2K2V A;  3ASK A;  2L2P A;  5FRN A;  3MP8 A;  3HL8 A;  3ZBD A;  1NLO C;  1VQN Q;  3RUX A;  2HEQ A;  3RES A;  4PFZ A;  4BB7 A;  3HFV A;  3MEV A;  5CKD A;  2CP3 A;  5I11 A;  4C5E A;  1XQH A;  4L5G A;  3CCQ Q;  2VC8 A;  5IXB A;  4CI0 C;  1S72 A;  3PIO A;  5DLO A;  4J6W A;  4FT2 A;  2LJ0 A;  4BWA A;  3TQ7 P;  4TTV A;  4P71 C;  2K5L A;  1G5V A;  1YGB A;  5FW9 A;  3REU A;  1VQ7 T;  3VYH B;  3E9I A;  3SDZ A;  1UJY A;  4BE1 A;  4TVR A;  1Y0M A;  1BYM A;  4LVI A;  2ZAE A;  1EVK A;  2COY A;  1YFR A;  1ZSZ C;  1FXX A;  2P0L A;  4KQE A;  5GAO l;  3O8V A;  2DNU A;  1I5L A;  4BI8 B;  1QQJ A;  1X27 A;  3CCU T;  3QSU A;  2XMF A;  4KUD K;  4E6R A;  1M3B A;  2QGG A;  2EQK A;  4TQF A;  2RK2 A;  2HAX A;  1Y96 A;  1NJ1 A;  3CCM A;  3EFS A;  4MZP A;  2LCS A;  5GJW B;  4TVY A;  1EOV A;  1ZBJ A;  4GY5 A;  1VQN T;  4M78 C;  1Z7N A;  3HXU A;  4L87 A;  3C94 A;  1VQK Q;  2ED1 A;  4PFO A;  4CC3 A;  4H2X B;  4BW9 A;  2F1L A;  2JVV A;  1PKS A;  4OMQ A;  3OBY A;  2ZR2 A;  3CCQ T;  1J3T A;  1NM7 A;  2Q7G A;  8AT1 B;  5C52 B;  2GGR A;  2BUD A;  4LDX A;  4E2F B;  2E10 A;  4EMH A;  1WHM A;  1UHF A;  1RI0 A;  3Q1J A;  4XTV A;  4JPB W;  2ED0 A;  1QLY A;  2LRQ A;  3BY7 A;  1M1G A;  1VOM A;  1WI7 A;  1BI1 A;  2RO0 A;  1ATI A;  1WHL A;  5HKC A;  1TUG B;  2CZ6 B;  2YHT A;  5GMK j;  3OS1 A;  5IN1 A;  3NTH A;  2FG0 A;  3M0U A;  4Z8A A;  2QQR A;  1Y57 A;  1SPK A;  2YUP A;  3CCR Q;  2CGH A;  1W70 A;  1T0H A;  1Z9Z A;  1RAH B;  4ME7 A;  2VGM A;  2OJ2 A;  2X4W A;  2EWN A;  1G3W A;  2QYZ A;  2EIF A;  1W6X A;  2AZV A;  4Q15 A;  3M59 A;  2DZ9 A;  1D3B A;  3G7Z A;  2LNH B;  2DU5 A;  3EH2 A;  4EX5 A;  3JCM b;  1UHC A;  3TRE A;  3QJ6 A;  3BE3 A;  4BUG A;  1MMA A;  3BDU A;  4M7A F;  1H3H A;  4M7D A;  1N8R C;  4RTT A;  2PVG B;  1M8M A;  4LNS A;  4XEM A;  2DPP B;  4PG3 A;  5CIU A;  4QQ6 A;  3VRY A;  5GMK e;  2CRE A;  4PJN A;  4N4I A;  1VQK T;  2DEU A;  2XD0 A;  3A7A A;  1AT1 B;  4YRQ A;  4C8Q A;  1EFN A;  2D0N A;  2KYB A;  1U06 A;  3OYM A;  3V7R A;  4NOY A;  2DLP A;  1WZO A;  3HFN A;  3CPW S;  4M7A D;  3SWN C;  4QQD A;  1X54 A;  3M4G A;  3LWH A;  5GAN j;  4M75 A;  2B86 A;  3W3S A;  1RAD B;  3JCM X;  1HD3 A;  2XG8 D;  3JCM h;  3M4P A;  4TVA A;  2BZY A;  4MDW A;  1Y96 B;  3KFV A;  3WQZ A;  1YB3 A;  1AOJ A;  4M7D E;  1AEY A;  1JJ2 A;  4CH6 A;  4H2T A;  2K5F A;  4FYW B;  3JCM f;  3G4S A;  1GFC A;  2ALY B;  2NUP B;  2XU8 A;  4C8Q G;  3RIR A;  3GIB A;  4AMC A;  3HXV A;  3CCS A;  2CJA A;  5LJ3 h;  2M16 A;  2JNG A;  2HQX A;  3CCR T;  2QK0 A;  4AFZ C;  4C8Q E;  3VKI A;  4M77 F;  4M75 G;  2M51 A;  5LJ5 e;  4QW2 A;  5GAN e;  4FIB A;  2DDZ A;  4OVA A;  5LJ3 f;  3MET A;  3V7S A;  1W2B S;  2BE7 D;  4JZ4 A;  4YRS A;  1X2K A;  3LGL A;  1Q81 C;  4M75 E;  5HY6 A;  2ZPG B;  1M8V A;  3E2U A;  5I2S A;  3IKM B;  2G4C A;  4E7Z A;  4RG8 A;  2JT4 A;  5DY9 A;  2DL5 A;  4OB1 B;  2ZPE B;  2EYQ A;  1X55 A;  2ZTG A;  2ODR C;  4KRT A;  3CCV A;  4M77 D;  4JRQ A;  1JXO A;  2CZ1 B;  3HFO A;  1B70 A;  4CS4 A;  5CR2 A;  4BE0 A;  3QHS A;  2Y90 A;  3HRS A;  4IUT A;  3G4S Q;  4FU6 A;  2HNI A;  1RAE B;  1AZE A;  4XQ3 A;  2G6F X;  2E3I A;  1FMW A;  4P5N A;  4NL2 A;  3JB9 G;  3M55 A;  2X4J A;  4GLK A;  1K8A R;  4C92 A;  4LD9 K;  3HRI A;  2QXF A;  2OTL A;  4PJO B;  1W1F A;  1UGP B;  1U8R A;  4IUV A;  1MNE A;  3CCL A;  4BY6 C;  4FT4 A;  2DER A;  3V8K A;  1K9A A;  4P73 A;  2K9G A;  1OOT A;  1SKU B;  3VS6 A;  4M7D B;  5GAN 6;  5HK0 A;  2LP5 A;  5CVI A;  1YFT A;  1XNI A;  2V8I A;  5CK9 A;  4DBQ A;  3VS7 A;  4YRI A;  3CCV Q;  1Y07 A;  1QCN A;  1PYS B;  1PKT A;  2V26 A;  4OMP A;  2DL4 A;  3OMG A;  2ZT7 A;  4JJC A;  1BK2 A;  4KR3 A;  4C92 G;  2JM9 A;  1H4S A;  1HJD A;  3KXT A;  1JB0 E;  1X01 A;  4NL3 A;  3VQY A;  1SRL A;  4C92 E;  1UFF A;  3A7R A;  2M02 A;  2IVW A;  2DBM A;  5I22 A;  2OTL Q;  1P92 A;  3JB9 H;  2LC4 A;  3A98 A;  5KYU A;  3CCL Q;  1OX9 A;  4H2S A;  2CZ0 B;  1H4T A;  2DL8 A;  5J26 A;  2KRN A;  3SEM A;  1E22 A;  2JM8 A;  2SRC A;  4N0A A;  2E5A A;  1JRI A;  4ZTJ A;  4LDU A;  1FMV A;  4LN2 A;  3LH5 A;  4PL6 A;  3G4S T;  2EBP A;  1M3A A;  4UP8 A;  3G71 A;  4RCB A;  4AH6 A;  4CC7 A;  1KQS S;  2QDY B;  1T3S A;  3PT9 A;  2KYM A;  4HXJ A;  3FEO A;  2K3Y A;  2VWF A;  2DE0 X;  2YUQ A;  5FU7 B;  3CME A;  3LH0 A;  2RHX A;  4TQD A;  3QXE B;  3L2R A;  3TEH A;  2ART A;  4RTW A;  2YUN A;  3QDF A;  3CC4 Q;  2PME A;  2GTO A;  1OU9 A;  1UJ0 A;  1UE9 A;  4M7A G;  1NJ6 A;  3PGG A;  2I2L A;  5A2Q E;  1KFZ A;  2ARS A;  4KR2 A;  5A0D A;  1KHC A;  3QJY A;  1OUL A;  4YRC A;  1ZUU A;  1NLP C;  5KH6 A;  4EDU A;  1B3Q A;  5C51 B;  2DIQ A;  3CCV T;  1I07 A;  1QP2 A;  3X26 B;  2AKW B;  3TU4 K;  3M56 A;  4WCI A;  2NUT B;  1M5Q 1;  2ZIO A;  1TH7 A;  2DD5 A;  3PMT A;  3G71 Q;  2JTE A;  3EG3 A;  4ZN3 A;  1YIT A;  2PZ1 A;  4QQG A;  3V8J A;  1RL2 A;  1VUB A;  4O2D A;  2OTL T;  3RKX A;  3TSZ A;  3FRN A;  3GF5 A;  4Z89 A;  3M58 A;  3CCL T;  2HL3 A;  2FRW A;  2I4M A;  2QHT A;  1ASZ A;  4YCW A;  3H0I A;  4FL6 A;  5FLX E;  2JN0 A;  4XAX B;  3OS0 A;  3A1P A;  4KUI A;  5K1P A;  2DRM A;  3OMC A;  4RQE A;  4J9G A;  2EJ9 A;  3I9Q A;  4M4Z A;  1WXB A;  1GBQ A;  1MND A;  2FZG B;  2MI6 A;  3OYK A;  4UP7 A;  3UPU A;  1E1O A;  3X25 B;  4N4G A;  4IUU A;  2D6F A;  1FWZ A;  2PUK B;  4A54 A;  4JJB A;  3CBM A;  1UEC A;  2DXC A;  4HT4 A;  4M7A C;  1YIT Q;  2NLU A;  1JQQ A;  5IT9 E;  3UH0 A;  2RQV A;  2E41 A;  3CC4 T;  2KSS A;  3HXY A;  1UGR B;  3VS3 A;  2LQN A;  3L2U A;  3MEY A;  4BD3 A;  3FIF A;  2HKN A;  1PD0 A;  2DET A;  3THK A;  5KYU B;  2JMA A;  1NEB A;  3MEW A;  1WIE A;  3EG0 A;  3TEG A;  3EFR A;  4XU0 A;  4E47 A;  3OS2 A;  1ZX6 A;  3HRU A;  1MMG A;  4UC4 A;  1QVG A;  1X43 A;  4FSX A;  4OGE A;  1WXT A;  2C7I A;  1VQ7 A;  1NJ5 A;  2CP2 A;  3QDR B;  5GAM j;  2COW A;  3G71 T;  2QA4 Q;  1VQ4 Q;  1YFS A;  2ROT A;  4F7U E;  3VQV A;  3PZC A;  1VA7 A;  1OPL A;  2A0F B;  2DRK A;  4J8O A;  3M4Y A;  5KE3 A; 
#chains in the Genus database with same CATH homology
 2QHS A;  4MML A;  1ADY A;  2QQA A;  3TEH B;  3DSQ A;  3C95 A;  3X24 B;  5F5W A;  1R8O B;  1LOJ A;  5AYF A;  4L6V 5;  3RL6 A;  3CCU A;  4RQF A;  2HBP A;  3VQW A;  2BKD N;  5FU6 C;  4LVJ A;  4QVZ A;  4M77 C;  4LVL A;  4EMK A;  2RD1 A;  5GAM d;  4P75 A;  4K88 A;  1BIA A;  5GAM e;  1USY C;  1BBW A;  5L8R E;  2F5T X;  4YTL A;  3A8O B;  2PU9 B;  1YIT T;  1H64 1;  2QQS A;  3UDC A;  2I4N A;  3C12 A;  3QG1 A;  4H2X A;  5E3I A;  3CCQ A;  1SER A;  4YPF A;  2PVO B;  2L89 A;  1K8A U;  4HWP A;  3L2V A;  2XTI A;  2X4X A;  3QYH B;  3CXC A;  3WVE B;  4HA8 A;  1QP3 A;  2IG0 A;  3VYG A;  4HVC A;  1OYX A;  4KBM B;  3INZ A;  2QA4 T;  4YP0 A;  1VQ4 T;  4F7U B;  2DQ3 A;  2VYT A;  4WJ4 A;  3RF1 A;  2EQM A;  4YRG A;  3HFZ B;  2E65 A;  3CMA T;  2LTO A;  3S6W A;  3CCE T;  1SES A;  4M78 A;  3VQX A;  2P0K A;  4C8Q F;  4LDV A;  1NJ2 A;  4M7D D;  3A8G B;  1B8A A;  4M75 F;  2AMC B;  1OZ3 A;  3MQZ A;  3RKY A;  2E1H A;  3QO7 A;  3RGL A;  2LDM A;  4YRT A;  4C8Q D;  2XDB A;  5CCA A;  2J3M A;  4XTU A;  3S3N A;  1IZ6 A;  4OLF A;  1X56 A;  4M75 D;  1VQK A;  4EMG A;  4H02 A;  2VXE A;  4M78 E;  2JTM A;  4ATO A;  2LCC A;  2X35 A;  5GAN 7;  3I55 A;  3JAM E;  1PSF A;  2DVE A;  2DTH A;  4DQ2 A;  3JB9 F;  3NTI A;  3JCM J;  1Z7M A;  4EMK B;  1VQ5 T;  1G5I A;  1Y71 A;  1YJW T;  2RI3 A;  4Z02 A;  2C06 A;  3GOX A;  3JB9 D;  2ALY A;  2DTI A;  1Q7Y C;  3A5Z B;  4RMO A;  4JS5 A;  3CCR A;  4H2W A;  4WF2 A;  4HCB A;  4A4H A;  2PVD B;  2VXF A;  4C92 F;  4Y91 A;  3UGQ A;  2RHS B;  2MWO A;  4XTY A;  2O4X B;  1WLE A;  2YRV A;  2KMT A;  2RHY A;  5CAI A;  2DXU A;  3MEU A;  2GFU A;  3OW2 A;  1N6A A;  4A53 A;  3R07 A;  2XGT A;  1C0A A;  3FC3 A;  2WSC E;  4C92 D;  5EG2 A;  1WQW A;  2P0P A;  2RHQ B;  1B7Y B;  2XK0 A;  4M78 B;  4O6J A;  4ZGE B;  4YCV A;  3GPL A;  3LX7 A;  2R58 A;  3M53 A;  2YLB A;  3OYI A;  4OB0 B;  5C0M A;  2RHZ A;  4PJO A;  3A8M B;  1ASY A;  3E1S A;  3HTZ A;  4E7L A;  1NPR A;  4OMF B;  1G5H A;  2RK1 A;  4ZIB A;  2RJE A;  2DTO A;  2DO3 A;  1VQ8 A;  2DEQ A;  4O5V A;  2AHJ B;  4UPA A;  3LSS A;  3L2Q A;  3HY0 A;  1VQP A;  1NPP A;  1E1T A;  1WNL A;  4MMK A;  3HSB A;  1PYS A;  3LGF A;  2EL9 A;  2X4Y A;  5LL6 S;  4J6Y A;  4CRI A;  3I55 T;  2ZNI A;  5D6Y A;  4HWO A;  3SB2 A;  1YHQ A;  3MCA B;  3QO8 A;  4PJO E;  1M1F A;  1WJR A;  3CC2 A;  4M7D G;  5KCH A;  4A4E A;  5CO7 A;  4H2Y A;  2QHU A;  2RA2 A;  3FLG A;  3LLR A;  1OI1 A;  1N9W A;  3CBO A;  1SSF A;  4YRF A;  3RKW A;  5LJ3 j;  2F69 A;  4OGC A;  5LJ5 h;  3A7U A;  2ZCE A;  3PMI A;  3CBP A;  4HT9 A;  3JCM d;  4P74 A;  4PLI A;  3SWN B;  3L1A A;  5LJ5 f;  5KNN A;  4RDX A;  3JCM e;  1NE8 A;  2QQB A;  3A8L B;  4Q5W A;  1BIB A;  2ZNJ A;  1K8A C;  2DAQ A;  2CYZ B;  3JCM W;  5LJ3 d;  3MP1 A;  5LJ3 e;  2AKW A;  1EIY B;  1J5W A;  3JCM V;  3L4G A;  3ICA A;  3SD4 A;  4DOW A;  2LVM A;  4YRN A;  4E7H A;  3P8D A;  1SET A;  3TEE A;  4M7D C;  1UGS B;  1JJ2 S;  4OB2 B;  1WYD A;  1W4S A;  4HCZ A;  2XDD A;  2D9T A;  4X34 A;  4OB3 B;  2QTX A;  4C8Q C;  5D6X A;  3L2Z A;  3BW1 A;  1VQ8 T;  4OF1 A;  3HY1 A;  2KAF A;  3LYI A;  3QII A;  5GAN 2;  1VQP T;  2LT4 A;  2KVQ G;  1EQR A;  4M75 C;  2ZIM A;  3OYJ A;  4J83 A;  4C5I A;  2KQW A;  4JUV A;  4N4H A;  1ZQ1 A;  5CQX A;  2OTJ T;  5CKE A;  3CC4 A;  3RAC A;  1YHQ T;  4IUQ A;  4RKU E;  3ZEH A;  3L2W A;  3G6E A;  4BY6 B;  2PUO B;  4IKF A;  3CC2 T;  1BBU A;  4MZT A;  2RM4 A;  3JB9 I;  1UGQ B;  1LJO A;  3ME9 A;  2ZR3 A;  3BDL A;  4X9C A;  2ZZE A;  3NEN A;  1HXD A;  3JCM Q;  3A31 A;  4TVW A;  2L5Q A;  4K86 A;  1N9S A;  2RJD A;  4TWA A;  1AHJ B;  1NNH A;  4CS3 A;  3LWI A;  4BI4 A;  5ELO A;  3VU3 C;  4RCC A;  2D0Q B;  2ZT5 A;  1X6O A;  5LJ5 g;  5GAN g;  1NJ8 A;  5I2M A;  3OYH A;  4P3O A;  1I81 A;  3DLL A;  4NS5 A;  1H3Z A;  4RMF A;  1N9R A;  2FL7 A;  4QVC A;  4C92 C;  4YRK A;  1XTD A;  3L4G B;  4CS2 A;  2L3R A;  4WI1 A;  1Q7Y U;  5A0G A;  1YCY A;  2ZCF B;  2WAC A;  4P73 C;  1FYF A;  3LSQ A;  4EO4 A;  4KUL A;  3P8H A;  3M54 A;  1WJQ A;  3PCO B;  4M77 A;  1M4Z A;  1PSE A;  2QA4 A;  1FX7 A;  1VQ4 A;  4F7U A;  3MO8 A;  2LQ8 A;  1I8F A;  3HFZ A;  3CMA A;  1U1S A;  2JOY A;  4XU3 A;  3X20 B;  3OYC A;  3CCE A;  4N0A C;  4J15 A;  1B76 A;  4P72 A;  2E12 A;  1H4Q A;  2MF2 A;  1VQL T;  1WPY A;  5GAO n;  3G6E T;  1WQ7 A;  5GAN 3;  4ZGJ B;  4YDQ A;  4HT8 A;  3HXX A;  3GLX A;  1ZBX A;  2ZZF A;  1MHN A;  2AMC A;  2R5A A;  3KFU A;  4L59 A;  3CC7 A;  4M77 E;  4F7U G;  4P3N A;  2EQJ A;  4YRO A;  4R55 A;  2DIG A;  2XID A;  4M7A B;  2IY5 B;  4ZTU B;  1BI0 A;  4XTZ A;  5D6W A;  2ZXF A;  4HKE A;  1M1K U;  3GNF B;  1Q82 U;  2XIC A;  3C4S A;  2VUB A;  1QVF A;  4HWS A;  4JRP A;  1M90 U;  2RB6 A;  2R57 A;  1YIJ T;  4J6X A;  2DZC A;  2G3R A;  2MAM A;  3HP9 A;  4G84 A;  5A0L A;  4YRJ A;  1VQ5 A;  1V29 B;  4JDS A;  3HPW A;  4P71 A;  3UFG A;  4J7F A;  3F70 A;  3WVD B;  1YJW A;  1KMN A;  1LYL A;  1N27 A;  2M9U A;  4C0D C;  4YRE A;  4YRP A;  3E9H A;  3HRK A;  1VQ6 T;  4BAC A;  1K9M U;  4JRK A;  1QVG S;  3J7A F;  3I56 A;  4QVD A;  1UEB A;  4V2S A;  1NJI U;  2LCL A;  3MEA A;  1ADJ A;  3A5Z A;  2DKG A;  3OYG A;  1BI3 A;  3DB3 A;  1WJS A;  3MF2 A;  3DLM A;  1HTT A;  2RHS A;  5FU6 B;  4PJO F;  3S3M A;  1B34 B;  3P8V A;  3E19 A;  3OYE A;  2CJ9 A;  2O4X A;  4M77 B;  2MMP A;  5GAN 8;  2ZZG A;  3MF1 A;  2GF7 A;  2JUF A;  4M7D F;  4PJO D;  2RHQ A;  1B7Y A;  5GAO p;  1I4K 1;  2RHU A;  1OZ2 A;  3HRT A;  5DM7 R;  2RJC A;  2EFI A;  1G3Y A;  3RER A;  3NET A;  3H8Z A;  3I7F A;  4PLL A;  2FYK A;  5C53 B;  3JB9 J;  4YRL A;  4Q6G A;  4A4F A;  1WU7 A;  4PHC A;  1EIF A;  3CC7 T;  4YCU A;  4G85 A;  3P8B B;  4CH3 A;  3OYB A;  2NS6 A;  2F5K A;  2LNV A;  2JZ2 A;  1K73 U;  3N5B B;  3FJP A;  1KD1 U;  1JJC B;  5DLQ E;  4D6W A;  4M78 G;  2LT1 A;  1KQ2 A;  4XU1 A;  4E7I A;  4LDW A;  1G51 A;  3IKL A;  4H2V A;  4YRR A;  4EMK C;  3CXC S;  4P75 C;  1X2H A;  1KHI A;  3BFM A;  1KC8 U;  3M4Q A;  4J7I A;  3R6O A;  3QO3 A;  3G1Z A;  2QQ9 A;  2I4L A;  3CD6 T;  2DXT A;  2A8E A;  3DKM A;  1EFW A;  3QZ5 B;  2HD0 A;  2OAU A;  4VUB A;  2PQW A;  1BKB A;  1VQO T;  3FB9 A;  2LX9 A;  5GAM g;  2FHD A;  2FB7 A;  2CIM A;  4CH4 A;  4C0Z A;  1M9S A;  2CS7 A;  2EJF A;  4HWR A;  1WGS A;  3I56 T;  4E7J A;  3M57 A;  3QNE A;  3OQ5 A;  3QO5 A;  1QF6 A;  2J3L A;  3SWN A;  4B9X A;  5M9O A;  4E7K A;  3OB9 A;  1Y7X A;  2ZPH B;  2B8A A;  1QVP A;  4C0F A;  3OYY A;  2K57 A;  1GXI E;  3P8T A;  2ZT8 A;  2P4T A;  2KY9 A;  2ZGW A;  1YJ9 T;  1EIY A;  3OSS C;  3PNW C;  3NTK A;  2RI5 A;  1BI2 A;  2R5M A;  5GAN 5;  2GFA A;  3IAL A;  2I4O A;  3AHU A;  3CPW A;  1G3S A;  3M9Q A;  4PKC C;  4BDY A;  2O01 E;  5J3B A;  2XHC A;  3PFS A;  5GMK h;  3DB4 A;  3NFC A;  3M5A A;  1U1T A;  2ZIN A;  2VV5 A;  1MGQ A;  1S72 T;  4JLI A;  2RJF A;  2RH2 A;  2OTJ A;  3OW2 S;  3UGT A;  4PJO G;  1M1K C;  3OYF A;  3HXW A;  1Q82 C;  2E64 A;  3E9F A;  4CH5 A;  1W2B A;  1L0W A;  1M90 C;  2JTF A;  1ZHI A;  1Q86 U;  1VQZ A;  2KK4 A;  5FRM A;  3CEY A;  1JBM A;  2M1H A;  4EPC A;  2XKO C;  4JLG A;  5LJ5 j;  1G3T A;  4YRM A;  5GAN h;  1VQ9 A;  2K4Y A;  3V8L A;  1K9M C;  2E6Z A;  2Y4Y A;  2QEX A;  2EKO A;  1HC7 A;  1NJI C;  5GAN f;  3VV0 A;  4ZTF A;  3CCM T;  4JRI A;  3NEM A;  2K3X A;  3UWN A;  4XK8 E;  1QE0 A;  4BE2 A;  1HK9 A;  2VGN A;  5GMK m;  3MHX A;  2ZPB B;  5J39 A;  5LJ5 d;  4Y28 E;  5GAN d;  3T9N A;  1SRY A;  3BJU A;  2CZ7 B;  4DOV A;  3P8Y A;  1X75 C;  2E3C A;  3QTC A;  4PJO C;  4LVM A;  1IRE B;  1QW1 A;  2V8K A;  4F7U F;  3OYN A;  4X9D A;  5HGQ A;  3VUZ A;  4JS4 A;  3HHT B;  2WSF E;  2DXB A;  4LVK A;  2Q7H A;  4E51 A;  4P3P A;  4IUR A;  4YYE A;  1NYQ A;  4UP9 A;  4B9W A;  1W66 A;  12AS A;  3ER0 A;  2V8J A;  5CKB A;  3PCO A;  11AS A;  3TCJ A;  3URG A;  2FVU A;  1VIE A;  5GMK i;  4A4K A;  3FDR A;  3RMS A;  1K73 C;  2EAY A;  1D3B B;  1KD1 C;  1O9S A;  2A3L A;  3JSC A;  1KQS A;  5I21 A;  3GNG A;  2LQK A;  2DD4 A;  3IG2 A;  2MWP A;  2ARU A;  3UT1 A;  1VQL A;  1YJN A;  1VQM A;  4K87 A;  5IAY A;  1KC8 C;  4DPG A;  3QYG B;  4C0G A;  5KE2 A;  3OYL A;  3LW5 E;  3OBW A;  4C8Q B;  4XEO A;  3ERR A;  5FU7 C;  4P74 C;  2ZPI B;  1YBY A;  3CCJ A;  3MP6 A;  4M75 B;  3RMQ A;  3WXM B;  5CKF A;  3OY9 A;  2GQV A;  3QZ9 B;  3CPF A;  1VQ9 T;  1UB4 A;  4ZGD B;  4TVA B;  3E9G A;  4M7A A;  4ZN1 A;  2QEX T;  2IY5 A;  4R56 A;  2XI9 A;  3SFM A;  3J80 E;  1XOV A;  1YI2 A;  3VJP A;  3KBG A;  2Q5H A;  2DK3 A;  1LNX A;  4X5O A;  4A4G A;  1KOG A;  2Y4X A;  3JCM g;  1YIJ A;  5K1X A;  5GMK l;  3CCS T;  4LD6 A;  3J81 E;  3A74 A;  3LC0 A;  3OSV A;  5CKH A;  5LJ3 g;  1VQ6 A;  3ZFJ A;  4II1 A;  3OA6 A;  4XTX A;  2H3J A;  4M7A E;  3JRZ A;  2DJZ A;  4M78 F;  1B70 B;  2EJG A;  1VIF A;  1EVL A;  4C5H A;  2PMF A;  1O75 A;  1H4V B;  4XU2 A;  5C6S A;  2E5Q A;  1B34 A;  4IUP A;  3QUI A;  2L8D A;  2QHV A;  4C92 B;  2RI2 A;  2E70 A;  4M78 D;  1USY A;  4KT0 E;  4HWT A;  3QBY A;  3A5Y A;  1DJ7 B;  3S3O A;  5CQY A;  2GCX A;  1KMM A;  2KDS A;  3TUP A;  4ELZ C;  1YJN T;  1VQM T;  3L42 A;  3JCM P;  2EQU A;  2ZZD A;  4M77 G;  4DA4 A;  2XDP A;  2CKK A;  1NZ9 A;  3V7C A;  1KQ1 A;  3GP8 A;  3EAE A;  4MDX A;  4MZM A;  3CCJ T;  1Q86 C;  3OS5 A;  2K5I A;  5HK3 A;  1KG1 A;  2C8M A;  1JJC A;  4ELY C;  2E6N A;  2HQE A;  1N8R U;  4J5Y A;  1RIQ A;  2YLC A;  3H6Z A;  3HXZ A;  1YI2 T;  2M0O A;  4FM4 B;  2ZT6 A;  2WSE E;  3KUF A;  2DU7 A;  2Q7E A;  2P0Q A;  3PTA A;  4H2U A;  4JJN K;  5GAM h;  3A32 A;  3CD6 A;  2QI2 A;  1X2G A;  5GAO m;  3CME T;  2P5I A;  3JCM c;  1VQO A;  3QPH A;  2CJB A;  5GAM f;  3QKJ A;  2BIV A;  5GAN 4;  5GAO r;  5GAO q;  1IL2 A;  3A8H B;  4OP0 A;  4ZTZ B;  3PIP A;  1E24 A;  2DQ0 A;  4C5G A;  3OYD A;  3VUB A;  4WJ3 M;  1VQN A;  4P72 C;  3X28 B;  3VBB A;  4C0D B;  1QVF S;  1Q81 U;  3CMQ A;  4BDZ A;  3OYA A;  1YJ9 A;  4HCC A;  2Q5I A;  3REX A;  2ZPF B;  2A7Y A;  2RHI A;  5KCO A;  4LDY A;  5ELN A;  4RG2 A;  3NEL A;  3OD1 A;  4BI3 A;  4XTW A;  1NYR A;  4NCX A;  5FRO A;  4PNO A;  3HKS A;  2ODR D;  1GGM A;  2K2V A;  3ASK A;  5FRN A;  3MP8 A;  3HL8 A;  3ZBD A;  3RUX A;  3RES A;  4BB7 A;  3HFV A;  3MEV A;  5CKD A;  4C5E A;  1XQH A;  4L5G A;  2VC8 A;  4CI0 C;  1S72 A;  3PIO A;  5DLO A;  4J6W A;  4FT2 A;  4BWA A;  4TTV A;  4P71 C;  1YGB A;  2K5L A;  1G5V A;  3REU A;  1VQ7 T;  3VYH B;  3E9I A;  3SDZ A;  4BE1 A;  4TVR A;  4LVI A;  1BYM A;  1EVK A;  1YFR A;  1FXX A;  2P0L A;  4KQE A;  5GAO l;  3O8V A;  1I5L A;  4BI8 B;  3CCU T;  3QSU A;  4KUD K;  2EQK A;  4TQF A;  2RK2 A;  2HAX A;  1Y96 A;  1NJ1 A;  3CCM A;  3EFS A;  4MZP A;  4TVY A;  1EOV A;  4GY5 A;  1VQN T;  4M78 C;  1Z7N A;  3HXU A;  4L87 A;  3C94 A;  4H2X B;  4BW9 A;  2JVV A;  3OBY A;  2ZR2 A;  3CCQ T;  2Q7G A;  5C52 B;  2BUD A;  4LDX A;  2E10 A;  4EMH A;  1RI0 A;  3Q1J A;  4XTV A;  2LRQ A;  3BY7 A;  1M1G A;  1BI1 A;  2RO0 A;  1ATI A;  5HKC A;  2CZ6 B;  2YHT A;  5GMK j;  3OS1 A;  5IN1 A;  3NTH A;  2QQR A;  2CGH A;  4ME7 A;  2VGM A;  2X4W A;  2EWN A;  1G3W A;  2EIF A;  4Q15 A;  3M59 A;  2DZ9 A;  1D3B A;  3G7Z A;  2DU5 A;  4EX5 A;  3JCM b;  3TRE A;  3QJ6 A;  4BUG A;  3BDU A;  4M7A F;  4M7D A;  1N8R C;  2PVG B;  4LNS A;  4XEM A;  2DPP B;  4PG3 A;  5CIU A;  4QQ6 A;  5GMK e;  4N4I A;  1VQK T;  2XD0 A;  3A7A A;  4YRQ A;  4C8Q A;  3OYM A;  3V7R A;  4NOY A;  3HFN A;  3CPW S;  4M7A D;  3SWN C;  4QQD A;  1X54 A;  3M4G A;  3LWH A;  5GAN j;  4M75 A;  3W3S A;  3JCM X;  2XG8 D;  3JCM h;  3M4P A;  4TVA A;  4MDW A;  1Y96 B;  3WQZ A;  1YB3 A;  4M7D E;  1JJ2 A;  4CH6 A;  4H2T A;  2K5F A;  3JCM f;  3G4S A;  2ALY B;  2XU8 A;  4C8Q G;  3RIR A;  3GIB A;  3HXV A;  3CCS A;  2CJA A;  5LJ3 h;  2M16 A;  2JNG A;  2HQX A;  3CCR T;  4C8Q E;  3VKI A;  4M77 F;  4M75 G;  5LJ5 e;  4QW2 A;  5GAN e;  4FIB A;  2DDZ A;  4OVA A;  5LJ3 f;  3MET A;  3V7S A;  1W2B S;  4YRS A;  3LGL A;  1Q81 C;  4M75 E;  5HY6 A;  2ZPG B;  1M8V A;  5I2S A;  3IKM B;  2G4C A;  4RG8 A;  5DY9 A;  4OB1 B;  2ZPE B;  2EYQ A;  1X55 A;  2ZTG A;  2ODR C;  3CCV A;  4M77 D;  4JRQ A;  2CZ1 B;  3HFO A;  1B70 A;  4CS4 A;  5CR2 A;  4BE0 A;  3QHS A;  2Y90 A;  3HRS A;  4IUT A;  4FU6 A;  2HNI A;  4XQ3 A;  4P5N A;  4NL2 A;  3JB9 G;  3M55 A;  2X4J A;  4GLK A;  4C92 A;  4LD9 K;  3HRI A;  2QXF A;  2OTL A;  4PJO B;  1UGP B;  1U8R A;  4IUV A;  3CCL A;  4BY6 C;  4FT4 A;  3V8K A;  4P73 A;  4M7D B;  5GAN 6;  5HK0 A;  5CVI A;  1YFT A;  1XNI A;  2V8I A;  5CK9 A;  4YRI A;  1Y07 A;  1PYS B;  3OMG A;  2ZT7 A;  4KR3 A;  4C92 G;  1H4S A;  3KXT A;  1JB0 E;  1X01 A;  4NL3 A;  3VQY A;  4C92 E;  3A7R A;  2IVW A;  1P92 A;  3JB9 H;  2LC4 A;  4H2S A;  2CZ0 B;  1H4T A;  5J26 A;  1E22 A;  4N0A A;  2E5A A;  1JRI A;  4ZTJ A;  4LDU A;  4PL6 A;  3G4S T;  4UP8 A;  3G71 A;  4RCB A;  4AH6 A;  1KQS S;  2QDY B;  3PT9 A;  3FEO A;  2K3Y A;  5FU7 B;  3CME A;  3LH0 A;  2RHX A;  4TQD A;  3QXE B;  3L2R A;  3TEH A;  2ART A;  2PME A;  4M7A G;  1NJ6 A;  3PGG A;  2I2L A;  5A2Q E;  2ARS A;  4KR2 A;  5A0D A;  1KHC A;  3QJY A;  4YRC A;  5KH6 A;  4EDU A;  5C51 B;  2DIQ A;  3CCV T;  1QP2 A;  3X26 B;  2AKW B;  3TU4 K;  3M56 A;  1M5Q 1;  2ZIO A;  1TH7 A;  2DD5 A;  3PMT A;  4ZN3 A;  1YIT A;  4QQG A;  3V8J A;  1RL2 A;  1VUB A;  4O2D A;  2OTL T;  3RKX A;  3FRN A;  3GF5 A;  3M58 A;  3CCL T;  2I4M A;  2QHT A;  1ASZ A;  4YCW A;  4FL6 A;  5FLX E;  2JN0 A;  4XAX B;  3OS0 A;  4KUI A;  5K1P A;  3OMC A;  4RQE A;  2EJ9 A;  2MI6 A;  3OYK A;  4UP7 A;  3UPU A;  1E1O A;  3X25 B;  4N4G A;  4IUU A;  2D6F A;  1FWZ A;  2PUK B;  4A54 A;  3CBM A;  2DXC A;  4HT4 A;  4M7A C;  2NLU A;  5IT9 E;  3UH0 A;  2E41 A;  3CC4 T;  2KSS A;  3HXY A;  1UGR B;  3L2U A;  3MEY A;  4BD3 A;  3FIF A;  3MEW A;  3TEG A;  3EFR A;  4XU0 A;  4E47 A;  3OS2 A;  3HRU A;  4UC4 A;  1QVG A;  4FSX A;  4OGE A;  2C7I A;  1VQ7 A;  1NJ5 A;  3QDR B;  5GAM j;  3G71 T;  1YFS A;  4F7U E;  3VQV A;  3PZC A;  4J8O A;  3M4Y A;  5KE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...