2EJFA

Crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
total genus 65
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ejfA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ejfA01
3IKLA 4NCXA 5GAN7 2DTOA 3VQYA 4M75F 5GANh 4J6WA 3HXVA 1H641 5K1XA 1HC7A 2RHQB 4TVAA 4XEOA 5E3IA 4CH4A 3IALA 4YRLA 3V8LA 3HSBA 4TWAA 4OP0A 3LSSA 1H4SA 3FIFA 5GAN6 4XQ3A 2Q7GA 1LNXA 4BWAA 1NNHA 2I4OA 5GAN8 2QHTA 2E65A 4C92D 4M78A 4JLIA 2RA2A 2PMEA 4CH6A 4A53A 1HTTA 3HFZB 3L2ZA 4C8QF 4HT9A 5LJ3h 3UFGA 3A31A 3QHSA 3BY7A 2P5IA 2I4NA 4E51A 3UH0A 2C8MA 1G51A 1EIYB 4XTVA 3GIBA 4Q6GA 2DQ0A 2DU5A 2ARSA 1G5HA 5CAIA 4KR3A 5GMKm 1GGMA 2J3MA 3A74A 2QHSA 1IL2A 4C8QD 4TQFA 4QVCA 4P72C 1PYSA 5GAN4 1I8FA 4P71C 4PJOG 3JB9H 1M8VA 5LJ5j 4M75A 4WJ4A 2ZZEA 4YRMA 4M78D 3HFVA 2P0LA 3HFOA 2ZIMA 3MF1A 4UPAA 4M75E 5LJ5g 1I5LA 3VBBA 4HWPA 2IY5B 2QHVA 4M77A 3JCMP 4TVAB 1I81A 3PZCA 4M77C 1KMNA 3OD1A 1YFSA 4Y91A 5GAOl 4HVCA 4UP7A 4M7AF 4CH5A 4M77G 4M78F 2ZNIA 3L4GB 2XTIA 4PJOF 1EQRA 3V7SA 1EIYA 1Y96A 3A5YA 3M4GA 2AMCA 3AHUA 1ADJA 4M77B 4XU3A 4O2DA 3BW1A 4X9CA 5LJ3e 5GAOq 4M7AG 4TVYA 4YREA 1MGQA 3HFZA 4OLFA 3A32A 3SWNA 5LJ5f 1I4K1 2HNIA 1B34A 5GAN2 5GAOp 2CIMA 2K57A 5GANd 1YCYA 3JCMX 4C92A 4YRRA 4X5OA 1J5WA 4PJOE 3HXYA 4M77D 4M7AB 1WQWA 3MF2A 4M78E 3P8VA 3RKYA 3HY1A 1KQ2A 4HA8A 1TH7A 3JCMW 3QO5A 2ZT5A 5GMKj 2AKWA 3IKMB 3CMQA 3SWNC 2AMCB 3QSUA 4M7AC 3L1AA 3RKWA 3JB9D 3R07A 2DVEA 4M7DB 3QNEA 4BW9A 1JBMA 3NETA 3M4PA 1E1OA 4PG3A 3RIRA 1X2HA 4P3PA 4J5YA 4P75A 2EWNA 3JCMQ 3NEMA 1E1TA 3INZA 4G85A 2Q7HA 3SWNB 4H2YA 4F7UE 4P73A 1D3BA 1E22A 2CJAA 2ZGWA 4M7DC 2J3LA 3REUA 3JCMV 3G1ZA 4TTVA 4NOYA 2YLCA 2ODRC 5GAOm 1LOJA 3TUPA 5GAMg 2JN0A 4L87A 3JCMh 3NELA 4M78C 3JB9G 2VXFA 4LNSA 4YRSA 1U1TA 1Z7MA 4YCWA 4KR2A 2RB6A 2ALYA 2YHTA 3M4QA 3IG2A 3FB9A 4XU0A 4F7UG 5GANj 4YPFA 5ELOA 1ASYA 3JCMf 4JUVA 4XEMA 2DTHA 1B7YA 4HT8A 2PMFA 2I4LA 4HWOA 4J6YA 4M78B 1JRIA 4YRCA 2DZ9A 4F7UB 5GMKl 2IY5A 3UGQA 2FYKA 4C92F 3DSQA 4RCCA 5GMKe 3RF1A 4HWTA 3JCMd 4PNOA 2ZINA 4XTWA 3RL6A 4JRKA 2RM4A 1VQZA 1EVKA 4M75B 3A7UA 4Q15A 1X01A 4UP9A 5GAN5 4WJ3M 4K86A 5LJ5d 3JCMJ 3RACA 4P3OA 2ZXFA 2EJFA 3MEYA 3PCOA 4M75G 4PJOA 1B7YB 4RCBA 4P71A 5GAMh 1X54A 4M75C 4C92G 2ZTGA 3JB9I 2DEQA 4M77F 1YB3A 3PGGA 1EFWA 4M7AD 2EJ9A 3JCMc 3JCMb 4M7AA 1B34B 4K87A 5GANe 4M7DD 4EMHA 4YRFA 4C92B 2E5AA 3UGTA 2EJGA 2ZZFA 2RHSA 3QO7A 4CS2A 4M7AE 3RUXA 1NJ8A 1W66A 4DPGA 5GMKi 1N9RA 1X55A 1PYSB 1SESA 1B70B 4A54A 1WPYA 3HTZA 1N9SA 1ATIA 1M5Q1 5ELNA 3HRIA 4CS4A 4XTUA 1H4QA 4C92C 4K88A 2ZR2A 4XTYA 1BIBA 2XGTA 1BBUA 1Z7NA 2EL9A 4N0AC 2Q7EA 2G4CA 4YDQA 3L4GA 3HRKA 1HK9A 1KMMA 2CJ9A 1BBWA 1SETA 5F5WA 4P72A 2DQ3A 4CS3A 4G84A 4YRKA 2I4MA 4YYEA 2ZNJA 3HXWA 3KFUA 3JCMe 2ZIOA 1NJ6A 4N0AA 3EFRA 4NL2A 5KNNA 4H2VA 4C8QB 4PHCA 1JJCB 1H4TA 2RHSB 1BIAA 4RQEA 4H2XB 3A5ZA 4H2SA 3HXXA 5LJ3g 1LYLA 3VU3C 4YRTA 3HY0A 4YROA 3I7FA 4P74C 4P75C 4H2UA 2E3CA 4C8QG 3E9IA 3E9HA 3ICAA 1KQ1A 2ALYB 2ZCEA 1L0WA 3VQVA 1Y96B 4C8QC 3QO8A 2ZZGA 3VQXA 1SERA 3HXZA 3LSQA 3QO3A 4DQ2A 5HGQA 5GMKh 4HWSA 2Q5HA 3LC0A 4KQEA 2CGHA 3BDUA 2RHQA 3EFSA 3JCMg 2DXTA 4V2SA 1WU7A 4F7UA 4EO4A 4XTXA 3RERA 5GAMf 1QE0A 3QTCA 3RGLA 4WF2A 2ARUA 5C51B 4M78G 4MMLA 3HFNA 4M7DE 4EMKB 1FYFA 2DKGA 3A7RA 3VQWA 2VC8A 3RKXA 5LJ3f 4M7DA 1WQ7A 4MMKA 3V7RA 2E64A 1SRYA 5LJ5e 5GAOr 5LJ5h 3PCOB 4PJOB 11ASA 1NYQA 3V8JA 5DY9A 2E41A 3NENA 1B70A 4EMKC 1USYC 5LJ3j 1YFTA 1USYA 2DJZA 3ERRA 4J6XA 1NJ1A 4UP8A 1WYDA 2E10A 4J15A 4P74A 2FB7A 4PJOD 4YRIA 1B8AA 1D3BB 4JRIA 2Q5IA 1KOGA 4CH3A 4PJOC 1C0AA 3W3SA 2YLBA 5C52B 5GAMd 1N9WA 2ZT7A 3TEHA 4NL3A 1X2GA 1B76A 4YRGA 4P3NA 2Y90A 2E1HA 5GAN3 4RDXA 3P8YA 4YP0A 3BJUA 1ADYA 1E24A 2ARTA 1HXDA 2VXEA 2ZR3A 2DZCA 4AH6A 4H2TA 1NJ5A 2C7IA 3QUIA 1QF6A 4EMKA 2ODRD 4XTZA 2I2LA 5GANg 1JJCA 1RIQA 4H2XA 3REXA 1NYRA 4P73C 4M77E 4M75D 5I21A 2DU7A 4QVDA 1ASZA 4EX5A 4HWRA 1YFRA 1LJOA 4F7UF 4C8QA 2ZT6A 4YRQA 4ZTUB 3P8TA 3V7CA 2EAYA 4XU1A 1NJ2A 2DXUA 4YRJA 3TEHB 5C53B 5GAOn 3FJPA 4C8QE 4TVWA 4ZTZB 3V8KA 4YCVA 1H4VB 3WQZA 1EVLA 1G5IA 4M7DG 1WNLA 4YRNA 4ZIBA 2QHUA 5LJ3d 4RMFA 4M7DF 3JB9J 4TQDA 2QTXA 4H2WA 4YCUA 12ASA 5GANf 4WI1A 1EOVA 2ZT8A 4YRPA 3TEGA 1U1SA 4C92E 2CJBA 5GAMe 5K1PA 5GAMj 2RD1A 4XU2A 1X56A 4EMGA 1WLEA 2AKWB 3A7AA 4RQFA 3HXUA 3JB9F 3RESA 1YGBA 2DDZA 4X9DA 2DTIA 3BFMA 4H02A 3SB2A
chains in the Genus database with same CATH superfamily
4C5IA 1VQNT 5GAN7 4M75F 3A8LB 5GANh 3I5SA 1H641 2DILA 3LLRA 2QDYB 4TVAA 2L0AA 1VQ7T 2RHQB 2M9UA 4XEOA 5E3IA 2X4XA 3V8LA 4YRLA 1H4SA 3OYDA 5GAN6 3CC2A 2Q7GA 4X1VA 2DRMA 4O5VA 3E9FA 3VKIA 1B07A 4CH6A 5HKCA 3MEUA 1MMGA 1HTTA 1T0HA 3L2ZA 4C8QF 1MNDA 2VYTA 3QHSA 3BY7A 1H3HA 5FW9A 2DYBA 2I4NA 4F04B 2CH4W 4E7IA 1N8RC 2CDTA 3M55A 1WA7A 2C8MA 2DQ0A 1EIFA 5CAIA 4KR3A 5KE3A 5GMKm 1K73C 3A98A 1IL2A 4C8QD 2PTKA 3OYMA 2MMPA 2QASA 1I8FA 3S6WA 1K9MU 3G4ST 2CZ6B 5D6XA 4WJ4A 2ZZEA 4YRMA 2YT6A 4BE1A 2ZIMA 3HFOA 4LDUA 4F14A 4M75E 2XIDA 1I5LA 2QEXA 3VYHB 4HWPA 4E7HA 4TVAB 1I81A 3I35A 3GP8A 2EYZA 3OD1A 1M1KR 3EGUA 1QCFA 4LVKA 3H0HA 3VS7A 4BDZA 3THKA 3CCRQ 1IREB 1Y96A 2EGAA 3M4GA 2AMCA 1ZX6A 4B9WA 1JB0E 4OMNA 4AMCA 3BW1A 4X9CA 1XTDA 5LJ3e 4OLFA 2X35A 4LDVA 3A32A 2KT1A 4MDXA 3SWNA 5LJ5f 2P0QA 4LNPA 1QLYA 4YRRA 1J5WA 4PJOE 1BI2A 4AFQC 4ZTJA 1Q81R 3E19A 3P8VA 2LJ0A 4IKFA 1CKAA 4OB2B 2LRQA 1KD1R 4JJDA 2RK1A 4MZMA 3CCVT 2YDLA 2FG0A 1TH7A 3JCMW 4CC3A 2K9GA 3M57A 1UFFA 3L2QA 4CC4B 1VQ7A 1VQ9Q 5A0LA 1VQ4Q 3R07A 1D1BA 4MZPA 3CCLT 3NETA 1E1OA 4PG3A 1UGRB 1R0CB 2F2VA 4RKUE 1BI0A 3JCMQ 1E1TA 2J06A 1NLOC 1JXMA 3SWNB 4H2YA 4F7UE 4OB0B 2VV5A 1HSQA 1E22A 5L23A 3G6EQ 1YJWA 2MK5A 1D0XA 3VS1A 3REUA 3CD6Q 4PFPA 2YLCA 2QGFB 1LOJA 5KYXA 2JN0A 1UGVA 4E7KA 3NELA 4M78C 2HAXA 4OMLA 3MJXA 1AZEA 1ABOA 2RB6A 2YHTA 3M4QA 2L2PA 5GANj 4PJLA 2CREA 1HYOA 1ASYA 1TU0B 3JCMf 4GBQA 4LN2A 4XEMA 1NEBA 1B7YA 2PMFA 2QEXQ 4KBMB 2VKNA 1S72T 4M78B 3CPFA 1Y0MA 3M4YA 5CKDA 5CK9A 2IY5A 3UGQA 2K3XA 3DSQA 2COWA 4LXCA 1BI1A 4X34A 1PCXA 3CC4T 1D1AA 2VB6A 4XTWA 4JRKA 3VS3A 4BI8B 3OQ5A 5IXFA 4UP9A 3M0PA 2FZCB 3CQTA 4JJBA 4GLMA 2COZA 5KH6A 4K86A 3RACA 3MEYA 4BE2A 2F1LA 4JRPA 1UJYA 1M30A 2AKLA 2LTOA 2BUDA 4BI3A 4RCBA 5HY6A 3UF4A 2YRDA 4RTUA 3UWNA 2K2MA 1OX9A 1YJ9Q 3LX7A 2KRNA 4J9CA 1YHQT 1B7TA 4DOVA 2GCXA 1KC8C 1IHWA 1PWTA 1B34B 2XDBA 4DEYA 3OW2A 4JDSA 2GQVA 4RTWA 1VIEA 2Y4XA 4C92B 2EJGA 2ZZFA 2NS6A 1UDLA 4KUIA 4M7AE 3RUXA 2QQAA 1QKWA 1W66A 4DPGA 2OJ2A 3DLMA 3MEWA 1B70B 3N5BB 3GF5A 2KDSA 1WPYA 1N9SA 2AIRB 2EKOA 1T3LA 2ZR2A 1W6XA 1GCQC 1K8AR 3ZBDA 1QKXA 2DMOA 3GBQA 2NUTA 5L8RE 1X6OA 1VQKQ 3EGDA 1NLPC 3G71T 1GCPA 3HRKA 1OEBA 1YITT 1HK9A 1BBWA 1SETA 2DQ3A 2CP0A 3CC7Q 2HL3A 3NGPA 3VS0A 1WZOA 2O4XB 1M90U 1NJ6A 3RNJA 1TUDA 2HCKA 3EFRA 4A4EA 2A0FB 5KNNA 4FW1A 1JJCB 1RL2A 2HQXA 4FYXB 4H2SA 1IGQA 2AT1B 4FYVB 1NJIR 3CPWS 3G4SQ 2EPDA 2QTVA 3C0CA 4P75C 2E3CA 2DD4A 3OYCA 2MWPA 1KQ1A 2ALYB 2O31A 1L0WA 4L59A 1TUGB 3VQVA 3QO8A 4CC7A 2GQIA 5GMKh 5CR2A 1W2BP 1YIJA 2DXCA 4HWSA 2JS2A 4OMQA 4ELZC 1RAEB 5KYUB 2D9TA 5HK3A 2CP2A 2RHQA 1WU7A 4IIOA 1MHNA 3RERA 3I56A 5GAMf 1QE0A 2V8JA 1AHJB 2ZCFB 1K73U 5FROA 4M78G 2GFUA 2ZPBB 4EMKB 2FPFA 4BDYA 3RKXA 1YJ9A 1UTIA 5LJ3f 3NTKA 1WQ7A 2EKHA 4MMKA 3V7RA 1VQ6Q 1PM3A 2JOYA 3NTIA 1WHLA 4PJOB 4QQDA 4LVMA 2DAQA 1Z9ZA 3CC4Q 1OYXA 1QVFS 2RMOA 2FEIA 1M8MA 1WFWA 1SSHA 2DEUA 1YFTA 1USYA 2EIFA 4K11A 1Q86C 1AOJA 2DJZA 2E5KA 3MQZA 3M59A 1SF9A 4J6XA 4E47A 1NJ1A 2JTEA 2L3PA 4UP8A 4P74A 4PJOD 4YRIA 1PD0A 1FMVA 4FL6A 4PJOC 3W3SA 3CCVA 5C52B 2GFAA 1OQKA 3TEHA 1X2GA 2F5KA 1B76A 8ATCB 2HSEB 2Y90A 2E1HA 4L6V5 2AK5A 1QCOA 3BJUA 1ADYA 1RAHB 2ARTA 5J39A 2DRKA 1MUZA 2DZCA 7AT1B 2H8HA 2CSIA 3PVQA 2ODRD 3FRNA 5KYXB 5CQYA 4H2XA 4P73C 3QDFA 2Y4YA 1X6GA 2DU7A 4EX5A 3TCJA 1YFRA 1QMCA 3P8TA 1H92A 4XU1A 1TXQA 2DXUA 1JEGA 4C8QE 4TVWA 1BK2A 3LGLA 3V8KA 2QEXT 1G5IA 1VQKT 4M7DG 5FWBA 2A7YA 2DBMA 4YRNA 4ZIBA 1VQMQ 2QHUA 5LJ3d 3R6NA 3I9QA 4M7DF 4RMFA 4H2WA 2EYQA 12ASA 4YCUA 5D6WA 1AWWA 1IHVA 2ZT8A 4IUVA 5C6SA 2HQEA 4YRPA 2ED0A 2CJBA 3O8VA 2PVDB 1KC8R 4EMGA 2AKWB 3CCUA 1FXXA 2YUQA 4ZN1A 3JB9F 3REBB 1V76A 3CMAT 4X9DA 3HP9A 2PUOB 1YJWQ 2LT4A 1MNEA 4BUGA 4F17A 2DTOA 1G83A 3S3MA 3HRUA 4J6WA 1BCMA 2RH2A 3J80E 1HC7A 3PMTA 1LVKA 1RI0A 2EQKA 2XKOC 3CEYA 3DLLA 2LNVA 4OP0A 3LSSA 1YHQA 3FIFA 1WJRA 3CC4A 3CCMA 1LNXA 3VYGA 5GAN8 5CKBA 3UDCA 3M56A 3CCJT 4A53A 5LJ3h 1YJNA 1VQ8T 4Z02A 1M1KU 4DBHA 3VRYA 1XNIA 3CCUT 1WIEA 2R58A 4HCCA 4XTVA 3GOXA 1G5HA 2DJQA 3I55T 1VQOQ 2CP5A 1GGMA 2J3MA 4J9DA 2KBTA 2XU8A 4FIBA 1AWOA 4TQFA 1KD1C 3DB3A 4JJNK 3RR6A 1PYSA 2ED1A 1WXUA 2EW3A 3SEMA 2IG0A 4M78D 3HFVA 1N8RU 3VBBA 3JCMP 2O9SA 1N27A 2K5FA 1KMNA 3PZCA 1OPLA 2LT1A 4UP7A 4CH5A 3L42A 4M78F 3JAME 2HD0A 3CC7T 1WJSA 3L4GB 4ZNXA 2XTIA 4PJOF 3V7SA 1P92A 2F69A 1EIYA 1YP5A 2LMJA 2YRVA 1C0MA 3OSSC 2K3BA 1OV3A 2MYSA 3FDRA 5GAOq 4M7AG 2BE9B 3HFZA 2H3EB 5IHKA 2LCSA 1VQPA 2HNIA 4N4GA 2KK4A 5GAN2 1VQOA 5IH2A 2LQKA 1VQLQ 2CIMA 4HT4A 5GANd 2CP6A 2LZ6B 1Z9QA 5ECAA 3QDRB 4ZGDB 4M4ZA 3MF2A 2A37A 1T3SA 3OYFA 3G7ZA 4PL6A 2ZPFB 3TU4K 4OMPA 2LX9A 1VQMA 2NUTB 2M0YA 1E6GA 5GMKj 2AKWA 3CMQA 3MO8A 3SWNC 2DERA 2PNIA 3L1AA 4N4IA 3JB9D 1GL5A 3DB4A 4BW9A 1BBZA 2OTLT 1I07A 1X2HA 2JTFA 5KCOA 4P75A 3BE3A 2RHUA 2DF6A 2FPDA 4G85A 2KGTA 2LCLA 4P73A 1D3BA 1VQLA 2BZ8A 2J7IA 1ZLMA 1ARKA 3LYIA 3R6OA 2D6FA 3EH2A 2J3LA 4TTVA 4LD6A 1VQ9A 4NOYA 1KJWA 3L2UA 3G4SA 5A0DA 4YRSA 1U1TA 1Z7MA 2ECZA 2ALYA 3CXCS 3CBOA 3OYLA 4YPFA 3OYJA 1FMKA 1KHIA 1XQHA 4CC2A 2EQMA 2XICA 2D0QB 2WSEE 2I4LA 4DA4A 4HWOA 1X27A 2KSSA 1JRIA 1FX7A 3PMIA 3LW5E 1M3CA 2AZVA 3M53A 1U5SA 3OYEA 3RF1A 1YNZA 4HWTA 4PNOA 4QVZA 3MEAA 2WSFE 2E12A 1KFZA 3WVDB 2SRCA 2RM4A 1EVKA 4M75B 3ZFJA 2M1HA 2EGCA 1K0XA 3VV0A 5GAN5 3EGDB 4WJ3M 2M0OA 4ORZA 5CO7A 2HKQB 4OVAA 3JCMJ 2K2VA 2ZXFA 2EJFA 3EG0A 3EFOA 4UC4A 2QAZA 4P71A 1IRXA 4OB3B 1VQPT 4M75C 3OYAA 2FZGB 1YB3A 3CC2T 4IIMA 4M7AD 2EJ9A 3JCMc 3JCMb 5IT9E 2QG9B 4EMHA 1R77A 1VYTA 2JVVA 1QVGA 3MHXA 1J3TA 2RHSA 1QVGS 1E7OA 4CS2A 2OTJQ 1SESA 2KYBA 2G6FX 2JW4A 4HCKA 4GY5A 1H3ZA 3HTZA 1ATIA 4BB7A 1AD5A 1JU5C 4CS4A 1R0BG 4XTUA 4K88A 4XTYA 4ZTFA 3TREA 1BIBA 5AYFA 2A28A 2Q7EA 4PJMA 5CQXA 1R8OB 2G4CA 1SKUB 4YDQA 1SPKA 4PLLA 3VJPA 2BZYA 1KQSA 1YWPA 1M2VA 2YUOA 2CJ9A 3HPWA 3I5RA 2NUZA 4KH0B 3OYBA 1VQ8Q 2J6OA 2KR3A 4RTTA 5CKEA 4G84A 3QG1A 4WTOB 3KFUA 3HXWA 3JCMe 3CCUQ 1NPPA 3H9NA 4NL2A 1C6VX 4PHCA 2AHJB 2RHSB 2Z0WA 4RQEA 2RQUA 4H2XB 2V26A 2RI3A 1U3OA 2X3XD 1OU9A 3X20B 4AG2C 2V8IA 2GF7A 1FWZA 3A8MB 1VQ7Q 2QDLA 4H2UA 3E9IA 1IZ6A 4OGEA 3E9HA 1FMWA 4KULA 1UE9A 3ICAA 1Y96B 1Q86U 2ZZGA 1SERA 3VUZA 3HXZA 3GNGA 3QO3A 3SD4A 4DQ2A 2Q5HA 1ZSGA 1YI2A 3ULRB 2ROTA 1ZBXA 2DXTA 3TQ7P 1NZ9A 4C0DC 4F7UA 4R0KA 4P5NA 1QW1A 2CT3A 3QTCA 3RGLA 2HKNA 4MMLA 2KNBB 3CCLQ 4M7DE 2DKGA 1GFCA 1KQSP 2BIVA 1UB4A 2LQ8A 2F2XA 1WHMA 3VS5A 3UA6A 3LH5A 1N6AA 1RABB 2DL8A 4WCIA 4C0DB 5GAOr 3QYHB 3PCOB 6AT1B 4J83A 2QQBA 11ASA 2CS7A 3G6ET 3V8JA 5FRNA 2BE7D 2E41A 3NENA 3CD6T 4JS5A 1USYC 3CBPA 1BYMA 1UECA 2LJ1A 1PG5B 3S3OA 2E10A 5A2QE 4QT7A 4JRIA 2Q5IA 1C0AA 2KXCA 1WLPB 5HK0A 2YLBA 3UA7A 5GAMd 1MMDA 1N9WA 1QVPA 2ZT7A 1ZBJA 2AKKA 2X4JA 2HMAA 5FRMA 3QWYA 1VQPQ 1WI7A 2ZPHB 3WXMB 5GAN3 4HCZA 3CC2Q 2RJEA 1OZ3A 3ASKA 2QI2A 3T9NA 1G8XA 2VXEA 2F5TX 2C7IA 1OPKA 3PVLA 2WSCE 4XTZA 2I2LA 5GANg 1IGUA 1OU8A 1UGQB 3FJ5A 3CCVQ 1RIQA 3REXA 2FPEA 1TSFA 3TSZA 2X3WD 3URGA 3CCSQ 2OAWA 5I21A 3CCMQ 1ASZA 2DNUA 1UJ0A 5KYWA 1LJOA 1UUEA 3V7CA 1KD1U 2EAYA 1QCNA 4DEXA 1WHHA 3FJPA 1PSFA 2V1QA 2ENMA 3QIIA 3QJYA 3EG3A 1NG2A 3WQZA 4O6JA 2CKKA 1YJ9T 1EVLA 1WXTA 4HCBA 1WNLA 2QTXA 1CKBA 2JM8A 3QZ5B 2EQUA 1RAIB 2K5LA 5KYUA 1AT1B 1LPLA 2K4YA 3TEGA 3FC3A 2DE0X 3O5ZA 1U8RA 1EZZB 2KT8A 2XDPA 2MI6A 2RD1A 4Z8AA 1F1BB 5D7UA 1VA7A 3RESA 1YIJT 3CBMA 2O88A 2DDZA 3OYYA 4H02A 4J9BA 2RN8A 1SRMA 2GGRA 3IKLA 4NCXA 1EFNA 4OF1A 4B6MA 3OS0A 5KYNA 4N4HA 3HXVA 5K1XA 3QZ9B 1OZ2A 1SRLA 4E2FB 4FCYA 3VUBA 4TWAA 2JZ2A 1S72Q 1K0SA 4XQ3A 1K9MR 3OBWA 2QHTA 4FSSA 1YITQ 2E65A 4JLIA 2RA2A 2X51A 3OYGA 3HFZB 1RLQC 4HKEA 3LH0A 3E1SA 2RQWA 4J9HA 2E70A 3NHNA 1JJ2S 2FVUA 4J9GA 2AZSA 2NLUA 2A8EA 2O2OA 1TS9A 2OTJT 4Q6GA 4LDWA 4C0GA 1N8RR 2XHCA 2MOXA 2YXYA 3A74A 2QHSA 4DBRA 1W70A 2JJ9A 1VYVA 1QQJA 1SHFA 2LQNA 5GAN4 2CZ0B 1M8VA 4M75A 4DBQA 4PKCC 1VUBA 2KMTA 3H0FA 1WYXA 2L89A 3M54A 5EG2A 4CRIA 4BY6C 2LP5A 4ANJA 4IUQA 4R55A 2LQWA 2D8JA 3EAEA 3G6EA 1YFSA 1BCOA 1VQ6A 3S3NA 5GAOl 1NYFA 1X2QA 3M58A 4BE0A 2YUNA 4M77G 1PKSA 2ZNIA 4DOWA 2DIGA 1EQRA 4BY6B 4A4KA 2O9VA 3A5YA 2XG8D 3FLGA 1NBEB 1YWOA 3AHUA 2RF0A 4M77B 4XU3A 1ZUKA 4O2DA 5I2SA 2M02A 4TVYA 4FSXA 2C06A 4YREA 1MGQA 3SDZA 3M0RA 1B34A 5GAOp 1Q95G 2G3RA 4F16A 1YCYA 4C92A 4ELYC 2OTJA 3HXYA 4M77D 1WQWA 3CMEA 3G71Q 1M9SA 4R56A 1WXBA 3RKYA 3RBBB 1Q81U 1KQ2A 4Q5WA 3HTRA 3QWXX 3REAB 1NEGA 3CCJA 1YFNA 1BKBA 1E6HA 2EYXA 4RTYA 1ZA1B 4HVUA 2EYWA 3CCMT 4MDWA 2AMCB 1O75A 5J3BA 3QSUA 4M7AC 1VQ5Q 4KUDK 1YCSB 2ZPEB 4LDYA 3QNEA 1M90R 3M4PA 1LCKA 3RIRA 1S72A 2HDAA 4C5HA 3CMAA 2EWNA 2RQVA 5GJVB 4AT1B 4LVJA 2BTTA 8AT1B 5AT1B 4M7DC 3JCMV 2JMCA 2RPNA 1K76A 3TUPA 3HKSA 3PE0A 3DKMA 3GLXA 4NS5A 2VXFA 2JM9A 1MV0B 2YSQA 5C0MA 4YCWA 4KR2A 1M2OA 4JJCA 2JUFA 3IG2A 4F7UG 1ACMB 5ELOA 3A5ZB 4KH1B 1VQNQ 4QQGA 2ZPGB 4JUVA 1Y07A 1ABQA 5CVIA 5DM7R 3BDLA 4HT8A 2K79A 4AFSC 1WX6A 1QVFA 1N5ZA 2E6ZA 4J6YA 1H8KA 2YUPA 4YRCA 1AWXA 3RMQA 4D8KA 4F7UB 5GMKl 2OTLA 2DL5A 5GMKe 1BI3A 1PRLC 2EVRA 2ZINA 5I11A 3CCET 3L2RA 2XDDA 2FO0A 1RACB 2FHDA 3KFVA 4Z89A 5D6YA 1TG0A 4IUPA 4A63B 4A4FA 2BZXA 5LJ5d 2QQRA 2MCNA 4P3OA 1TTHB 2J6FA 4PJOA 2P4TA 2ATCB 1B7YB 4ESRA 2FL7A 5GAMh 1X54A 3MCAB 4C92G 2FZKB 2ZTGA 3JB9I 3OW2P 1K73R 1KQSS 2LVMA 3HHTB 3CCEA 4XAXB 3PGGA 1EFWA 3EH1A 2P0KA 2E3IA 2QK0A 3CCJQ 3CCQT 2XI9A 5GANe 2LNHB 2KRSA 3CD6A 2E5AA 3QBYA 4ME7A 3QO7A 3CCRT 4AFZC 1UHFA 5FWCA 4C0ZA 1X55A 1N9RA 1PYSB 3OMCA 1MMAA 1X6BA 4A54A 1PKTA 2XK0A 2D1XA 2M16A 1X43A 1M5Q1 2YWWA 5ELNA 1X75C 1RADB 3CCQA 1ZQ1A 1G3WA 2XGTA 1WJQA 1BBUA 3MP6A 3OYHA 4IURA 1V29B 1Q81C 5DLQE 1OI1A 2L5QA 2D8HA 1VQMT 1RLPC 3EG2A 5J26A 3L4GA 1GCQA 4JRQA 3MKDA 1YI2T 2CUDA 1KMMA 1WHKA 4P72A 4E7LA 1I5OB 2HEQA 4CS3A 3G1JA 3SFMA 2MAMA 4YRKA 4YYEA 2ZNJA 2KVQG 3F70A 4N0AA 2P0PA 3QKJA 1M3BA 5KE2A 4C8QB 1KK7A 1BIAA 1VQ4T 1GXIE 1Q7YR 1SEMA 1K4US 2GNCA 1G5VA 3A5ZA 5LL6S 3HXXA 5LJ3g 4IUTA 1LYLA 3EHQA 4YRTA 3OMGA 4JLGA 3I7FA 4P74C 1OULA 4C8QG 4RUGA 1KIKA 2E3HA 1B3QA 1DJ7B 4J9FA 1VQNA 4C8QC 1NM7A 4E7ZA 3EG9A 2RI2A 2A36A 3LC0A 2CGHA 3OYNA 4E6RA 3EFSA 2O4XA 1JO8A 4EO4A 4XTXA 3CXCA 2FRYA 3I55Q 5CKHA 1A0NB 4AFUC 1FYFA 3A7RA 5FU6C 1KG1A 4JPBW 4AG1C 2HBWA 2IVWA 1ZSZC 2E64A 2IPOB 4OB1B 5LJ5h 5CCAA 3CPWA 3UT1A 5IHNA 5DY9A 3J81E 4OMMA 1Q86R 3META 3TVTA 3OY9A 2RQTA 2BKDN 2VVKA 3QXEB 3ZEHA 3ERRA 4PFOA 2E5QA 1W1FA 4CI0C 1WYDA 5HCKA 1TWBA 2E4HA 2FB7A 4TVRA 1KOGA 4CH3A 2L8DA 4BD3A 2LX7A 4J9EA 2ZAEA 3RMSA 2L3SA 4C5EA 2XD0A 1PD1A 3LWIA 4YRGA 2V1RA 4BI4A 4OGCA 2KXDA 1JXOA 1VQ8A 2CZ1B 3JRZA 1YHQQ 3KBGA 3HRSA 1E24A 1HXDA 2ZR3A 1GRIA 3CCQQ 4LD9K 1NJ5A 3QUIA 2W10A 5I22A 4KGVB 4ZN3A 3X26B 3C95A 3EGXA 4JZ4A 3OYIA 3C12A 3D7SB 2F2WA 4M75D 1OX8A 4II1A 2PU9B 4QVDA 3SHWA 2RJDA 1K9MC 2JTMA 4RMOA 4ZGEB 2DXBA 1M1KC 4F7UF 4C8QA 2ZT6A 4ZTUB 1W2BA 2HQHA 1WGSA 1KSWA 5C53B 1NE8A 3TEHB 5GAOn 3CCRA 4ZTZB 3GPLA 1Y71A 2ROLA 4YCVA 1YN8A 1H4VB 2OX7A 2ZZDA 2GTJA 3JB9J 2QXFA 1PNJA 5GANf 2RJCA 1EOVA 1VQ5A 1WHGA 2CH4A 1NPRA 2MIOA 3MP8A 5IHIA 3VS2A 2ABLA 5FLXE 4C92E 5K1PA 5GAMe 3TSWA 2MF2A 4D6WA 2EFIA 5GAMj 2VGNA 1X56A 3A7AA 4RQFA 4EIKA 3HXUA 4JZ3A 1RAAB 2DA9A 2KQWA 4LVLA 2C0TA 2DTIA 3C94A 3SB2A 2DYIA 4LUDA 3VQYA 4OMOA 1NJIC 1GBRA 4CH4A 3IALA 3M5AA 3P8DA 1V1CA 1M2VB 3HSBA 2DO3A 5KCHA 1K1ZA 5CIUA 5IN1A 3PTAA 1VQ4A 1XOVA 4BWAA 1NNHA 2K7AA 2NWMA 3RDVA 2I4OA 2RO0A 4C92D 1VOMA 4M78A 3E2UA 2PMEA 1QWFA 1O9SA 2GBQA 4HT9A 1OOTA 4RTZA 3UFGA 3TEEA 3A31A 2OI3A 2P5IA 4E51A 3UH0A 3PNWC 1G51A 1EIYB 3GIBA 3KUFA 3M0TA 2DU5A 2ARSA 1AZGB 3H41A 4HVVA 2J6KA 3G71A 4QVCA 3ZL7C 1HJDA 4P72C 4LUEA 3QJ6A 2K5IA 4P71C 2L3QA 4RG2A 4PJOG 3JB9H 3NTHA 5LJ5j 2DBKA 1VIFA 3NFCA 3CXCP 3MF1A 2P0LA 3I56T 1GFDA 4UPAA 1BB9A 1AWJA 2CP7A 5LJ5g 2IY5B 2QHVA 4M77A 5GJWB 1UG1A 1PHTA 3CCSA 4M77C 1YI2Q 4Y91A 2DK3A 4HVCA 4M7AF 1D1CA 4J7IA 1W4SA 3AT1B 3EFOB 3Q1JA 2HL5C 2RQRA 2RHXA 3MPUB 3NMZC 1C1AA 1ADJA 1JJ2P 1RAFB 2K3YA 3P8BB 1X69A 3OS5A 3A1PA 4LE9A 4PJJA 2DD5A 1I4K1 2DLPA 2K57A 3JCMX 4J7FA 4X5OA 4FYWB 4M7AB 4M78E 4C5GA 2B86A 2JS0A 1GBQA 3M9QA 3QYGB 1RAGB 3MP1A 1Y57A 4D8DA 3HY1A 4HA8A 5A0GA 4J9IA 5KYWB 1D0ZA 2QQ9A 1Y7XA 1M1FA 2P4RA 1NYGA 3QO5A 2ZT5A 5IXBA 4QQ6A 3IKMB 3ER0A 2V8KA 4ZGJB 2EYYA 3RKWA 2A08A 2O01E 2DVEA 4M7DB 1QVGP 3PT9A 2YRCA 4A4GA 1JBMA 3HRTA 3LWHA 2X4WA 3X28B 3A8OB 4P3PA 4J5YA 4KGZB 4B9XA 4PLIA 3CMET 1K8AC 3NEMA 1VQ6T 3INZA 2Q7HA 4E7SA 4XK8E 4QW2A 3OYKA 1G2BA 1ZUYA 2CYZB 2CJAA 2ZGWA 1BU1A 3G1ZA 2RJFA 4RG8A 3H8ZA 2ODRC 5GAOm 5GAMg 4L87A 3JCMh 3JB9G 2RHZA 4L5GA 4LNSA 3NPFA 1W2BS 2J05A 3CMAQ 1EX4A 2MPXC 3FB9A 4XU0A 1YJWT 2ESWA 3VS6A 3I55A 1G3SA 1QWEA 1UEBA 3CC7A 1XJWB 1U06A 2EQIA 2DTHA 4ATOA 1PC0A 2WACA 1D09B 5CKFA 2C0OA 2DZ9A 1RUWA 3ME9A 5FU7B 2FYKA 4C92F 2PUKB 4RCCA 1Q82U 3JCMd 2QA4T 2CZ7B 2XMFA 3A8HB 3RL6A 4Y28E 2DFUA 1M1GA 1VQZA 4QKUA 4JS4A 3A7UA 4Q15A 4HVWA 1X01A 2QYZA 3EG9B 2FRWA 4LDXA 1QVFP 2KYMA 1YIJQ 5FU7C 3HL8A 4VUBA 2VASA 4DBFA 2DL3A 3PCOA 1YJNT 4M75G 1SHGA 3L2VA 4HXJA 2L3RA 4PFZA 5IAYA 1KC8U 3IQLA 3I56Q 4BACA 3OB9A 2LDMA 2DEQA 4M77F 4FM4B 1M3AA 2I0NA 2IIMA 1ZUUA 4M7AA 4K87A 4EDUA 2PQWA 3C4SA 4PK4A 1Q7YU 4M7DD 1VQKA 2CUBA 4A4HA 4YRFA 3UGTA 1IO6A 3A8GB 1PRMC 3U23A 2RHIA 2RI5A 3VS4A 4J8OA 1NJ8A 1UHCA 1UGPB 5GMKi 4OMFB 3CPWP 3CCST 1ZA2B 3HRIA 3CCLA 2R5AA 1H4QA 2H3JA 4C92C 2HZYA 2A3LA 3OBYA 1K9AA 5I2MA 1WDXA 1M27C 1Z7NA 1G3TA 4KT0E 2EL9A 4N0AC 1JQQA 4RTVA 4IUUA 2HBPA 1YBYA 2MWOA 2DM1A 1T0JA 2K6DA 1I0CA 3M0SA 5F5WA 2C0IA 4FT4A 3VRZA 2I4MA 2ZIOA 2JXBA 1IB8A 3H6ZA 4H2VA 1VQOT 3UATA 1H4TA 2ZPIB 4C0FA 2RNAA 1AEYA 2PZ1A 2LJ3A 3VU3C 3HY0A 4LVIA 2R5MA 2CSQA 1X2KA 1CSKA 3CMEQ 4YROA 2PVGB 1G3YA 2RHYA 2COYA 2ZCEA 2HSPA 3VQXA 1IXDA 2DL7A 9ATCB 3LSQA 2JT4A 5HGQA 1QP2A 1UGSB 3GNFB 5FU6B 4KQEA 2P84A 4GLKA 3BDUA 2EQJA 3JCMg 3E9GA 1ZSZB 4V2SA 4RTXA 4Y92A 3JV3A 3P8HA 2QGGA 4Z88A 2DETA 1VQ5T 4WF2A 2VWFA 2R57A 2M51A 2JMAA 4MZTA 1VQ9T 2ARUA 5C51B 3HFNA 2PVOB 2SEMA 4KGXB 2NYSA 3VQWA 2LC4A 2KY9A 2DL4A 2VC8A 2DVJA 3J7AF 1VQLT 1QP3A 4KRTA 3MEVA 1D0YA 1M4ZA 3WVEB 3OS1A 4M7DA 2NUPA 1SRYA 1AVZC 5LJ5e 2EGEA 1MMNA 1RI9A 2CT4A 1SSFA 2VGMA 2QA4Q 1NYQA 3PFSA 3OSVA 3X24B 1B70A 4EMKC 4FYYB 4FW2A 4EPCA 5LJ3j 2JNGA 3LGFA 1Q82R 4J15A 1NJIU 3OS2A 3PIPA 1B8AA 1D3BB 2CP3A 3JSCA 3QPHA 2KRMA 2VUBA 3OW2S 1YJNQ 2OAUA 1ZSZA 2KAFA 3EGXB 4NL3A 2OTLQ 2X4YA 1WHJA 4P3NA 2D0NA 2DX1A 3OA6A 4RDXA 2DPPB 5EC7A 3P8YA 4YP0A 1YITA 5KYYA 3M0UA 3EHRA 4AH6A 4H2TA 1VYUA 2KEAA 2W0ZA 1QF6A 1S1NA 2NUPB 4EMKA 1FYNA 3CCEQ 3UPUA 1JJ2A 1JJCA 1Q7YC 2QA4A 2KROA 4YTLA 2KI7A 1NYRA 1M90C 4M77E 1K8AU 2B8AA 3FEOA 2RK2A 1I1JA 4FU6A 4HWRA 1SG5A 2E6NA 2DIQA 1Q82C 4YRQA 3M0QA 1TUCA 5M9OA 4YRJA 1NJ2A 2X9HA 1HD3A 4PJNA 3KXTA 4TQDA 3L2WA 1TOVA 4WI1A 2GTOA 1PSEA 3EG1A 1U1SA 5KYYB 3PIOA 1MV3A 4XU2A 2QQSA 1WLEA 4E7JA 5DLOA 1KHCA 1YGBA 1ZHIA 3H0IA 4FT2A 2EBPA 2LCCA 3BFMA 2KE9A 3X25B
chains in the Genus database with same CATH topology
4C5IA 1VQNT 5GAN7 4M75F 3A8LB 5GANh 1H641 3LLRA 2QDYB 4TVAA 1VQ7T 2RHQB 4XEOA 2M9UA 5E3IA 2X4XA 3V8LA 4YRLA 1H4SA 3OYDA 5GAN6 3CC2A 2Q7GA 4O5VA 3E9FA 3VKIA 4CH6A 5HKCA 3MEUA 1HTTA 3L2ZA 4C8QF 2VYTA 3QHSA 3BY7A 2I4NA 4E7IA 1N8RC 2C8MA 3M55A 2DQ0A 1EIFA 5CAIA 4KR3A 5KE3A 5GMKm 1K73C 1IL2A 4C8QD 3OYMA 2MMPA 1I8FA 3S6WA 1K9MU 3G4ST 2CZ6B 5D6XA 4WJ4A 2ZZEA 4YRMA 4BE1A 2ZIMA 3HFOA 4LDUA 4M75E 2XIDA 1I5LA 2QEXA 3VYHB 4HWPA 4E7HA 4TVAB 1I81A 3GP8A 3OD1A 4LVKA 4BDZA 1IREB 1Y96A 3M4GA 2AMCA 4B9WA 1JB0E 3BW1A 4X9CA 1XTDA 5LJ3e 4OLFA 2X35A 4LDVA 3A32A 4MDXA 3SWNA 5LJ5f 2P0QA 4YRRA 1J5WA 4PJOE 1BI2A 4ZTJA 3E19A 3P8VA 4IKFA 4OB2B 2LRQA 2RK1A 4MZMA 3CCVT 1TH7A 3JCMW 3M57A 3L2QA 1VQ7A 5A0LA 3R07A 4MZPA 3CCLT 3NETA 1E1OA 4PG3A 1UGRB 4RKUE 1BI0A 3JCMQ 1E1TA 3SWNB 4H2YA 4F7UE 4OB0B 2VV5A 1E22A 1YJWA 3REUA 2YLCA 1LOJA 2JN0A 4E7KA 3NELA 4M78C 2HAXA 2RB6A 2YHTA 3M4QA 5GANj 1ASYA 3JCMf 4XEMA 1B7YA 2PMFA 4KBMB 1S72T 4M78B 3CPFA 3M4YA 5CKDA 5CK9A 2IY5A 3UGQA 2K3XA 3DSQA 1BI1A 4X34A 3CC4T 4XTWA 4JRKA 4BI8B 3OQ5A 4UP9A 5KH6A 4K86A 3RACA 3MEYA 4BE2A 4JRPA 2LTOA 2BUDA 4BI3A 4RCBA 5HY6A 3UWNA 3LX7A 1YHQT 4DOVA 2GCXA 1KC8C 1B34B 2XDBA 3OW2A 4JDSA 2GQVA 1VIEA 2Y4XA 4C92B 2EJGA 2ZZFA 2NS6A 4KUIA 4M7AE 3RUXA 2QQAA 1W66A 4DPGA 3DLMA 3MEWA 1B70B 3N5BB 3GF5A 2KDSA 1WPYA 1N9SA 2EKOA 2ZR2A 3ZBDA 5L8RE 1X6OA 3G71T 3HRKA 1YITT 1HK9A 1BBWA 1SETA 2DQ3A 2O4XB 1M90U 1NJ6A 3EFRA 4A4EA 5KNNA 1JJCB 1RL2A 2HQXA 4H2SA 3CPWS 4P75C 2E3CA 2DD4A 3OYCA 2MWPA 1KQ1A 2ALYB 1L0WA 4L59A 3VQVA 3QO8A 5GMKh 5CR2A 4HWSA 1YIJA 2DXCA 4ELZC 2D9TA 5HK3A 2RHQA 1WU7A 1MHNA 3RERA 3I56A 5GAMf 1QE0A 2V8JA 1AHJB 2ZCFB 1K73U 5FROA 4M78G 2GFUA 2ZPBB 4EMKB 4BDYA 3RKXA 1YJ9A 5LJ3f 1WQ7A 3NTKA 4MMKA 3V7RA 2JOYA 3NTIA 4PJOB 4QQDA 4LVMA 2DAQA 1OYXA 1QVFS 1YFTA 1USYA 2EIFA 1Q86C 2DJZA 3MQZA 3M59A 4J6XA 4E47A 1NJ1A 4UP8A 4P74A 4PJOD 4YRIA 4FL6A 4PJOC 3W3SA 3CCVA 5C52B 2GFAA 3TEHA 1X2GA 2F5KA 1B76A 2Y90A 2E1HA 4L6V5 3BJUA 1ADYA 2ARTA 5J39A 2DZCA 2ODRD 3FRNA 5CQYA 4H2XA 4P73C 2Y4YA 2DU7A 4EX5A 3TCJA 1YFRA 3P8TA 4XU1A 2DXUA 4C8QE 4TVWA 3LGLA 3V8KA 2QEXT 1G5IA 1VQKT 4M7DG 2A7YA 4YRNA 4ZIBA 2QHUA 5LJ3d 4RMFA 4M7DF 4H2WA 4YCUA 2EYQA 12ASA 5D6WA 2ZT8A 4IUVA 5C6SA 2HQEA 4YRPA 2CJBA 3O8VA 2PVDB 4EMGA 2AKWB 3CCUA 1FXXA 3JB9F 4ZN1A 3CMAT 4X9DA 3HP9A 2PUOB 2LT4A 4BUGA 2DTOA 3S3MA 3HRUA 4J6WA 2RH2A 3J80E 1HC7A 3PMTA 1RI0A 2EQKA 2XKOC 3CEYA 3DLLA 2LNVA 4OP0A 3LSSA 1YHQA 3FIFA 1WJRA 3CC4A 3CCMA 1LNXA 3VYGA 5GAN8 5CKBA 3UDCA 3M56A 3CCJT 4A53A 5LJ3h 1YJNA 1VQ8T 4Z02A 1M1KU 1XNIA 3CCUT 2R58A 4HCCA 4XTVA 3GOXA 1G5HA 3I55T 1GGMA 2J3MA 2XU8A 4FIBA 4TQFA 1KD1C 3DB3A 4JJNK 1PYSA 2IG0A 4M78D 3HFVA 1N8RU 3VBBA 3JCMP 1N27A 2K5FA 1KMNA 3PZCA 2LT1A 4UP7A 4CH5A 3L42A 4M78F 3JAME 2HD0A 3CC7T 1WJSA 3L4GB 2XTIA 4PJOF 3V7SA 1P92A 2F69A 1EIYA 2YRVA 3OSSC 3FDRA 5GAOq 4M7AG 3HFZA 1VQPA 2HNIA 4N4GA 2KK4A 5GAN2 1VQOA 2CIMA 2LQKA 4HT4A 5GANd 3QDRB 4ZGDB 3MF2A 3OYFA 3G7ZA 4PL6A 2ZPFB 3TU4K 2LX9A 1VQMA 5GMKj 2AKWA 3CMQA 3MO8A 3SWNC 3L1AA 4N4IA 3JB9D 3DB4A 4BW9A 2OTLT 1X2HA 2JTFA 5KCOA 4P75A 2RHUA 4G85A 2LCLA 4P73A 1D3BA 1VQLA 3LYIA 3R6OA 2D6FA 2J3LA 4TTVA 4LD6A 1VQ9A 4NOYA 3L2UA 3G4SA 5A0DA 4YRSA 1U1TA 1Z7MA 2ALYA 3CXCS 3CBOA 3OYLA 4YPFA 3OYJA 1KHIA 1XQHA 2EQMA 2XICA 2D0QB 2WSEE 2I4LA 4DA4A 4HWOA 2KSSA 1JRIA 1FX7A 3PMIA 3LW5E 3M53A 3OYEA 3RF1A 4HWTA 4PNOA 4QVZA 3MEAA 2WSFE 2E12A 3WVDB 2RM4A 1EVKA 4M75B 3ZFJA 2M1HA 3VV0A 5GAN5 4WJ3M 2M0OA 5CO7A 4OVAA 3JCMJ 2K2VA 2ZXFA 2EJFA 4UC4A 4P71A 4OB3B 1VQPT 4M75C 3OYAA 1YB3A 3CC2T 4M7AD 2EJ9A 3JCMc 3JCMb 5IT9E 4EMHA 2JVVA 1QVGA 3MHXA 2RHSA 1QVGS 4CS2A 1SESA 4GY5A 1H3ZA 3HTZA 1ATIA 4BB7A 4CS4A 4XTUA 4K88A 4XTYA 4ZTFA 3TREA 1BIBA 5AYFA 2Q7EA 5CQXA 1R8OB 2G4CA 4YDQA 4PLLA 3VJPA 1KQSA 2CJ9A 3HPWA 3OYBA 4G84A 5CKEA 3QG1A 3KFUA 3HXWA 3JCMe 1NPPA 4NL2A 4PHCA 2AHJB 2RHSB 4RQEA 4H2XB 2RI3A 3X20B 2V8IA 2GF7A 1FWZA 3A8MB 4H2UA 3E9IA 1IZ6A 4OGEA 3E9HA 4KULA 3ICAA 1Y96B 1Q86U 2ZZGA 1SERA 3VUZA 3HXZA 3GNGA 3QO3A 3SD4A 4DQ2A 2Q5HA 1YI2A 1ZBXA 2DXTA 1NZ9A 4C0DC 4F7UA 4P5NA 1QW1A 3QTCA 3RGLA 4MMLA 4M7DE 2DKGA 2BIVA 1UB4A 2LQ8A 1N6AA 5GAOr 4C0DB 3QYHB 3PCOB 4J83A 2QQBA 11ASA 2CS7A 3G6ET 3V8JA 5FRNA 2E41A 3NENA 3CD6T 4JS5A 1USYC 3CBPA 1BYMA 3S3OA 2E10A 5A2QE 4JRIA 2Q5IA 1C0AA 5HK0A 2YLBA 5GAMd 1N9WA 1QVPA 2ZT7A 2X4JA 5FRMA 2ZPHB 3WXMB 5GAN3 4HCZA 2RJEA 1OZ3A 3ASKA 2QI2A 3T9NA 2VXEA 2F5TX 2C7IA 2WSCE 4XTZA 2I2LA 5GANg 1UGQB 1RIQA 3REXA 3URGA 5I21A 1ASZA 1LJOA 3V7CA 1KD1U 2EAYA 3FJPA 1PSFA 3QIIA 3QJYA 3WQZA 4O6JA 2CKKA 1YJ9T 1EVLA 4HCBA 1WNLA 2QTXA 3QZ5B 2EQUA 2K5LA 2K4YA 3TEGA 3FC3A 1U8RA 2XDPA 2MI6A 2RD1A 3RESA 1YIJT 3CBMA 2DDZA 3OYYA 4H02A 3IKLA 4NCXA 4OF1A 3OS0A 4N4HA 3HXVA 5K1XA 3QZ9B 1OZ2A 3VUBA 4TWAA 2JZ2A 4XQ3A 3OBWA 2QHTA 2E65A 4JLIA 2RA2A 3OYGA 3HFZB 4HKEA 3LH0A 3E1SA 2E70A 1JJ2S 2FVUA 2NLUA 2A8EA 2OTJT 4Q6GA 4LDWA 4C0GA 2XHCA 3A74A 2QHSA 5GAN4 2CZ0B 1M8VA 4M75A 4PKCC 1VUBA 2KMTA 2L89A 3M54A 5EG2A 4CRIA 4BY6C 4IUQA 4R55A 3EAEA 3G6EA 1YFSA 1VQ6A 3S3NA 5GAOl 3M58A 4BE0A 4M77G 2ZNIA 4DOWA 2DIGA 1EQRA 4BY6B 4A4KA 3A5YA 2XG8D 3FLGA 3AHUA 4M77B 4XU3A 4O2DA 5I2SA 4TVYA 4FSXA 2C06A 4YREA 1MGQA 3SDZA 1B34A 5GAOp 2G3RA 1YCYA 4C92A 4ELYC 2OTJA 3HXYA 4M77D 1WQWA 3CMEA 1M9SA 4R56A 3RKYA 1Q81U 1KQ2A 4Q5WA 3CCJA 1BKBA 3CCMT 4MDWA 2AMCB 1O75A 5J3BA 3QSUA 4M7AC 4KUDK 2ZPEB 4LDYA 3QNEA 3M4PA 3RIRA 1S72A 4C5HA 3CMAA 2EWNA 4LVJA 4M7DC 3JCMV 3TUPA 3HKSA 3DKMA 3GLXA 4NS5A 2VXFA 5C0MA 4YCWA 4KR2A 2JUFA 3IG2A 4F7UG 5ELOA 3A5ZB 4QQGA 2ZPGB 4JUVA 1Y07A 5CVIA 5DM7R 3BDLA 4HT8A 1QVFA 2E6ZA 4J6YA 4YRCA 3RMQA 4F7UB 5GMKl 2OTLA 5GMKe 1BI3A 2ZINA 3CCET 3L2RA 2XDDA 2FHDA 5D6YA 4IUPA 4A4FA 5LJ5d 2QQRA 4P3OA 4PJOA 2P4TA 1B7YB 5GAMh 2FL7A 1X54A 3MCAB 4C92G 2ZTGA 3JB9I 1KQSS 2LVMA 3HHTB 3CCEA 4XAXB 3PGGA 1EFWA 2P0KA 3CCQT 2XI9A 5GANe 3CD6A 2E5AA 3QBYA 4ME7A 3QO7A 3CCRT 4C0ZA 1X55A 1N9RA 1PYSB 3OMCA 4A54A 2XK0A 2M16A 1M5Q1 5ELNA 1X75C 3CCQA 1ZQ1A 1G3WA 2XGTA 1WJQA 1BBUA 3MP6A 3OYHA 4IURA 1V29B 1Q81C 1OI1A 2L5QA 5DLQE 1VQMT 5J26A 3L4GA 4JRQA 1YI2T 1KMMA 4P72A 4E7LA 4CS3A 3SFMA 2MAMA 4YRKA 4YYEA 2ZNJA 2KVQG 3F70A 4N0AA 2P0PA 3QKJA 5KE2A 4C8QB 1BIAA 1VQ4T 1GXIE 3A5ZA 1G5VA 5LL6S 3HXXA 5LJ3g 4IUTA 1LYLA 4YRTA 3OMGA 4JLGA 3I7FA 4P74C 4C8QG 1DJ7B 1VQNA 4C8QC 2RI2A 3LC0A 2CGHA 3OYNA 3EFSA 2O4XA 4EO4A 4XTXA 3CXCA 5CKHA 1FYFA 3A7RA 5FU6C 1KG1A 2IVWA 2E64A 4OB1B 5LJ5h 5CCAA 3CPWA 3UT1A 5DY9A 3J81E 3META 3OY9A 2BKDN 3QXEB 3ZEHA 3ERRA 2E5QA 4CI0C 1WYDA 2FB7A 4TVRA 1KOGA 4CH3A 2L8DA 4BD3A 3RMSA 4C5EA 2XD0A 3LWIA 4YRGA 4BI4A 4OGCA 1VQ8A 2CZ1B 3JRZA 3KBGA 3HRSA 1E24A 1HXDA 2ZR3A 4LD9K 1NJ5A 3QUIA 4ZN3A 3X26B 3C95A 3OYIA 3C12A 4M75D 4II1A 2PU9B 4QVDA 2RJDA 1K9MC 2JTMA 4RMOA 4ZGEB 2DXBA 1M1KC 4F7UF 4C8QA 2ZT6A 4ZTUB 1W2BA 1WGSA 5C53B 1NE8A 3TEHB 5GAOn 3CCRA 4ZTZB 3GPLA 1Y71A 4YCVA 1H4VB 2ZZDA 3JB9J 2QXFA 5GANf 2RJCA 1EOVA 1VQ5A 1NPRA 3MP8A 5FLXE 4C92E 5K1PA 5GAMe 2MF2A 4D6WA 2EFIA 5GAMj 2VGNA 1X56A 3A7AA 4RQFA 3HXUA 2KQWA 4LVLA 2DTIA 3C94A 3SB2A 3VQYA 1NJIC 4CH4A 3IALA 3M5AA 3P8DA 3HSBA 2DO3A 5KCHA 5IN1A 5CIUA 3PTAA 1VQ4A 1XOVA 4BWAA 1NNHA 2I4OA 2RO0A 4C92D 4M78A 2PMEA 1O9SA 4HT9A 3UFGA 3TEEA 3A31A 2P5IA 4E51A 3UH0A 3PNWC 1G51A 1EIYB 3GIBA 3KUFA 2DU5A 2ARSA 3G71A 4QVCA 4P72C 3QJ6A 2K5IA 4P71C 4RG2A 4PJOG 3JB9H 3NTHA 5LJ5j 1VIFA 3NFCA 3MF1A 2P0LA 3I56T 4UPAA 5LJ5g 2IY5B 2QHVA 4M77A 3CCSA 4M77C 4Y91A 2DK3A 4HVCA 4M7AF 4J7IA 1W4SA 3Q1JA 2RHXA 1ADJA 2K3YA 3P8BB 3OS5A 2DD5A 1I4K1 2K57A 3JCMX 4J7FA 4X5OA 4M7AB 4M78E 4C5GA 3M9QA 3QYGB 3MP1A 3HY1A 4HA8A 5A0GA 2QQ9A 1Y7XA 1M1FA 3QO5A 2ZT5A 3IKMB 4QQ6A 3ER0A 2V8KA 4ZGJB 3RKWA 2O01E 2DVEA 4M7DB 3PT9A 4A4GA 1JBMA 3HRTA 3LWHA 2X4WA 3X28B 3A8OB 4P3PA 4J5YA 3CMET 4B9XA 4PLIA 1K8AC 3NEMA 1VQ6T 3INZA 2Q7HA 4XK8E 4QW2A 3OYKA 2CYZB 2CJAA 2ZGWA 3G1ZA 2RJFA 4RG8A 3H8ZA 2ODRC 5GAOm 5GAMg 4L87A 3JCMh 3JB9G 2RHZA 4L5GA 4LNSA 1W2BS 3FB9A 4XU0A 1YJWT 3I55A 1G3SA 1UEBA 3CC7A 2DTHA 4ATOA 2WACA 5CKFA 2DZ9A 3ME9A 5FU7B 2FYKA 4C92F 2PUKB 4RCCA 1Q82U 3JCMd 2QA4T 2CZ7B 3A8HB 3RL6A 4Y28E 1M1GA 1VQZA 4JS4A 3A7UA 4Q15A 1X01A 4LDXA 5FU7C 3HL8A 4VUBA 3PCOA 1YJNT 4M75G 3L2VA 2L3RA 5IAYA 1KC8U 4BACA 3OB9A 2LDMA 2DEQA 4M77F 4FM4B 4M7AA 4K87A 4EDUA 2PQWA 3C4SA 1Q7YU 4M7DD 1VQKA 4YRFA 4A4HA 3UGTA 3A8GB 2RHIA 2RI5A 4J8OA 1NJ8A 1UGPB 5GMKi 4OMFB 3CCST 3HRIA 3CCLA 2R5AA 1H4QA 2H3JA 4C92C 3OBYA 2A3LA 5I2MA 1Z7NA 1G3TA 4KT0E 2EL9A 4N0AC 4IUUA 2HBPA 1YBYA 2MWOA 5F5WA 4FT4A 2I4MA 2ZIOA 3H6ZA 4H2VA 1VQOT 1H4TA 2ZPIB 4C0FA 3VU3C 3HY0A 4LVIA 2R5MA 4YROA 2PVGB 1G3YA 2RHYA 2ZCEA 3VQXA 3LSQA 5HGQA 1QP2A 1UGSB 3GNFB 5FU6B 4KQEA 4GLKA 3BDUA 2EQJA 3JCMg 3E9GA 4V2SA 3P8HA 1VQ5T 4WF2A 2R57A 4MZTA 1VQ9T 2ARUA 5C51B 3HFNA 2PVOB 3VQWA 2LC4A 2KY9A 2VC8A 3J7AF 1VQLT 4M7DA 1QP3A 3MEVA 3WVEB 1M4ZA 3OS1A 1SRYA 5LJ5e 1SSFA 2VGMA 1NYQA 3PFSA 3OSVA 3X24B 1B70A 4EMKC 4EPCA 5LJ3j 2JNGA 3LGFA 4J15A 1NJIU 3OS2A 3PIPA 1B8AA 1D3BB 3JSCA 3QPHA 2VUBA 3OW2S 2OAUA 2KAFA 4NL3A 2X4YA 4P3NA 3OA6A 4RDXA 2DPPB 3P8YA 4YP0A 1YITA 4AH6A 4H2TA 1QF6A 4EMKA 3UPUA 1JJ2A 1JJCA 1Q7YC 2QA4A 4YTLA 1NYRA 1M90C 4M77E 1K8AU 2B8AA 3FEOA 2RK2A 4FU6A 4HWRA 2E6NA 2DIQA 1Q82C 4YRQA 5M9OA 4YRJA 1NJ2A 3KXTA 4TQDA 3L2WA 4WI1A 1PSEA 1U1SA 3PIOA 4XU2A 2QQSA 1WLEA 4E7JA 5DLOA 1KHCA 1YGBA 1ZHIA 4FT2A 2LCCA 3BFMA 3X25B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKL A;  4NCX A;  5GAN 7;  2DTO A;  3VQY A;  4M75 F;  5GAN h;  4J6W A;  3HXV A;  1H64 1;  5K1X A;  1HC7 A;  2RHQ B;  4TVA A;  4XEO A;  5E3I A;  4CH4 A;  3IAL A;  4YRL A;  3V8L A;  3HSB A;  4TWA A;  4OP0 A;  3LSS A;  1H4S A;  3FIF A;  5GAN 6;  4XQ3 A;  2Q7G A;  1LNX A;  4BWA A;  1NNH A;  2I4O A;  5GAN 8;  2QHT A;  2E65 A;  4C92 D;  4M78 A;  4JLI A;  2RA2 A;  2PME A;  4CH6 A;  4A53 A;  1HTT A;  3HFZ B;  3L2Z A;  4C8Q F;  4HT9 A;  5LJ3 h;  3UFG A;  3A31 A;  3QHS A;  3BY7 A;  2P5I A;  2I4N A;  4E51 A;  3UH0 A;  2C8M A;  1G51 A;  1EIY B;  4XTV A;  3GIB A;  4Q6G A;  2DQ0 A;  2DU5 A;  2ARS A;  1G5H A;  5CAI A;  4KR3 A;  5GMK m;  1GGM A;  2J3M A;  3A74 A;  2QHS A;  1IL2 A;  4C8Q D;  4TQF A;  4QVC A;  4P72 C;  1PYS A;  5GAN 4;  1I8F A;  4P71 C;  4PJO G;  3JB9 H;  1M8V A;  5LJ5 j;  4M75 A;  4WJ4 A;  2ZZE A;  4YRM A;  4M78 D;  3HFV A;  2P0L A;  3HFO A;  2ZIM A;  3MF1 A;  4UPA A;  4M75 E;  5LJ5 g;  1I5L A;  3VBB A;  4HWP A;  2IY5 B;  2QHV A;  4M77 A;  3JCM P;  4TVA B;  1I81 A;  3PZC A;  4M77 C;  1KMN A;  3OD1 A;  1YFS A;  4Y91 A;  5GAO l;  4HVC A;  4UP7 A;  4M7A F;  4CH5 A;  4M77 G;  4M78 F;  2ZNI A;  3L4G B;  2XTI A;  4PJO F;  1EQR A;  3V7S A;  1EIY A;  1Y96 A;  3A5Y A;  3M4G A;  2AMC A;  3AHU A;  1ADJ A;  4M77 B;  4XU3 A;  4O2D A;  3BW1 A;  4X9C A;  5LJ3 e;  5GAO q;  4M7A G;  4TVY A;  4YRE A;  1MGQ A;  3HFZ A;  4OLF A;  3A32 A;  3SWN A;  5LJ5 f;  1I4K 1;  2HNI A;  1B34 A;  5GAN 2;  5GAO p;  2CIM A;  2K57 A;  5GAN d;  1YCY A;  3JCM X;  4C92 A;  4YRR A;  4X5O A;  1J5W A;  4PJO E;  3HXY A;  4M77 D;  4M7A B;  1WQW A;  3MF2 A;  4M78 E;  3P8V A;  3RKY A;  3HY1 A;  1KQ2 A;  4HA8 A;  1TH7 A;  3JCM W;  3QO5 A;  2ZT5 A;  5GMK j;  2AKW A;  3IKM B;  3CMQ A;  3SWN C;  2AMC B;  3QSU A;  4M7A C;  3L1A A;  3RKW A;  3JB9 D;  3R07 A;  2DVE A;  4M7D B;  3QNE A;  4BW9 A;  1JBM A;  3NET A;  3M4P A;  1E1O A;  4PG3 A;  3RIR A;  1X2H A;  4P3P A;  4J5Y A;  4P75 A;  2EWN A;  3JCM Q;  3NEM A;  1E1T A;  3INZ A;  4G85 A;  2Q7H A;  3SWN B;  4H2Y A;  4F7U E;  4P73 A;  1D3B A;  1E22 A;  2CJA A;  2ZGW A;  4M7D C;  2J3L A;  3REU A;  3JCM V;  3G1Z A;  4TTV A;  4NOY A;  2YLC A;  2ODR C;  5GAO m;  1LOJ A;  3TUP A;  5GAM g;  2JN0 A;  4L87 A;  3JCM h;  3NEL A;  4M78 C;  3JB9 G;  2VXF A;  4LNS A;  4YRS A;  1U1T A;  1Z7M A;  4YCW A;  4KR2 A;  2RB6 A;  2ALY A;  2YHT A;  3M4Q A;  3IG2 A;  3FB9 A;  4XU0 A;  4F7U G;  5GAN j;  4YPF A;  5ELO A;  1ASY A;  3JCM f;  4JUV A;  4XEM A;  2DTH A;  1B7Y A;  4HT8 A;  2PMF A;  2I4L A;  4HWO A;  4J6Y A;  4M78 B;  1JRI A;  4YRC A;  2DZ9 A;  4F7U B;  5GMK l;  2IY5 A;  3UGQ A;  2FYK A;  4C92 F;  3DSQ A;  4RCC A;  5GMK e;  3RF1 A;  4HWT A;  3JCM d;  4PNO A;  2ZIN A;  4XTW A;  3RL6 A;  4JRK A;  2RM4 A;  1VQZ A;  1EVK A;  4M75 B;  3A7U A;  4Q15 A;  1X01 A;  4UP9 A;  5GAN 5;  4WJ3 M;  4K86 A;  5LJ5 d;  3JCM J;  3RAC A;  4P3O A;  2ZXF A;  2EJF A;  3MEY A;  3PCO A;  4M75 G;  4PJO A;  1B7Y B;  4RCB A;  4P71 A;  5GAM h;  1X54 A;  4M75 C;  4C92 G;  2ZTG A;  3JB9 I;  2DEQ A;  4M77 F;  1YB3 A;  3PGG A;  1EFW A;  4M7A D;  2EJ9 A;  3JCM c;  3JCM b;  4M7A A;  1B34 B;  4K87 A;  5GAN e;  4M7D D;  4EMH A;  4YRF A;  4C92 B;  2E5A A;  3UGT A;  2EJG A;  2ZZF A;  2RHS A;  3QO7 A;  4CS2 A;  4M7A E;  3RUX A;  1NJ8 A;  1W66 A;  4DPG A;  5GMK i;  1N9R A;  1X55 A;  1PYS B;  1SES A;  1B70 B;  4A54 A;  1WPY A;  3HTZ A;  1N9S A;  1ATI A;  1M5Q 1;  5ELN A;  3HRI A;  4CS4 A;  4XTU A;  1H4Q A;  4C92 C;  4K88 A;  2ZR2 A;  4XTY A;  1BIB A;  2XGT A;  1BBU A;  1Z7N A;  2EL9 A;  4N0A C;  2Q7E A;  2G4C A;  4YDQ A;  3L4G A;  3HRK A;  1HK9 A;  1KMM A;  2CJ9 A;  1BBW A;  1SET A;  5F5W A;  4P72 A;  2DQ3 A;  4CS3 A;  4G84 A;  4YRK A;  2I4M A;  4YYE A;  2ZNJ A;  3HXW A;  3KFU A;  3JCM e;  2ZIO A;  1NJ6 A;  4N0A A;  3EFR A;  4NL2 A;  5KNN A;  4H2V A;  4C8Q B;  4PHC A;  1JJC B;  1H4T A;  2RHS B;  1BIA A;  4RQE A;  4H2X B;  3A5Z A;  4H2S A;  3HXX A;  5LJ3 g;  1LYL A;  3VU3 C;  4YRT A;  3HY0 A;  4YRO A;  3I7F A;  4P74 C;  4P75 C;  4H2U A;  2E3C A;  4C8Q G;  3E9I A;  3E9H A;  3ICA A;  1KQ1 A;  2ALY B;  2ZCE A;  1L0W A;  3VQV A;  1Y96 B;  4C8Q C;  3QO8 A;  2ZZG A;  3VQX A;  1SER A;  3HXZ A;  3LSQ A;  3QO3 A;  4DQ2 A;  5HGQ A;  5GMK h;  4HWS A;  2Q5H A;  3LC0 A;  4KQE A;  2CGH A;  3BDU A;  2RHQ A;  3EFS A;  3JCM g;  2DXT A;  4V2S A;  1WU7 A;  4F7U A;  4EO4 A;  4XTX A;  3RER A;  5GAM f;  1QE0 A;  3QTC A;  3RGL A;  4WF2 A;  2ARU A;  5C51 B;  4M78 G;  4MML A;  3HFN A;  4M7D E;  4EMK B;  1FYF A;  2DKG A;  3A7R A;  3VQW A;  2VC8 A;  3RKX A;  5LJ3 f;  4M7D A;  1WQ7 A;  4MMK A;  3V7R A;  2E64 A;  1SRY A;  5LJ5 e;  5GAO r;  5LJ5 h;  3PCO B;  4PJO B;  11AS A;  1NYQ A;  3V8J A;  5DY9 A;  2E41 A;  3NEN A;  1B70 A;  4EMK C;  1USY C;  5LJ3 j;  1YFT A;  1USY A;  2DJZ A;  3ERR A;  4J6X A;  1NJ1 A;  4UP8 A;  1WYD A;  2E10 A;  4J15 A;  4P74 A;  2FB7 A;  4PJO D;  4YRI A;  1B8A A;  1D3B B;  4JRI A;  2Q5I A;  1KOG A;  4CH3 A;  4PJO C;  1C0A A;  3W3S A;  2YLB A;  5C52 B;  5GAM d;  1N9W A;  2ZT7 A;  3TEH A;  4NL3 A;  1X2G A;  1B76 A;  4YRG A;  4P3N A;  2Y90 A;  2E1H A;  5GAN 3;  4RDX A;  3P8Y A;  4YP0 A;  3BJU A;  1ADY A;  1E24 A;  2ART A;  1HXD A;  2VXE A;  2ZR3 A;  2DZC A;  4AH6 A;  4H2T A;  1NJ5 A;  2C7I A;  3QUI A;  1QF6 A;  4EMK A;  2ODR D;  4XTZ A;  2I2L A;  5GAN g;  1JJC A;  1RIQ A;  4H2X A;  3REX A;  1NYR A;  4P73 C;  4M77 E;  4M75 D;  5I21 A;  2DU7 A;  4QVD A;  1ASZ A;  4EX5 A;  4HWR A;  1YFR A;  1LJO A;  4F7U F;  4C8Q A;  2ZT6 A;  4YRQ A;  4ZTU B;  3P8T A;  3V7C A;  2EAY A;  4XU1 A;  1NJ2 A;  2DXU A;  4YRJ A;  3TEH B;  5C53 B;  5GAO n;  3FJP A;  4C8Q E;  4TVW A;  4ZTZ B;  3V8K A;  4YCV A;  1H4V B;  3WQZ A;  1EVL A;  1G5I A;  4M7D G;  1WNL A;  4YRN A;  4ZIB A;  2QHU A;  5LJ3 d;  4RMF A;  4M7D F;  3JB9 J;  4TQD A;  2QTX A;  4H2W A;  4YCU A;  12AS A;  5GAN f;  4WI1 A;  1EOV A;  2ZT8 A;  4YRP A;  3TEG A;  1U1S A;  4C92 E;  2CJB A;  5GAM e;  5K1P A;  5GAM j;  2RD1 A;  4XU2 A;  1X56 A;  4EMG A;  1WLE A;  2AKW B;  3A7A A;  4RQF A;  3HXU A;  3JB9 F;  3RES A;  1YGB A;  2DDZ A;  4X9D A;  2DTI A;  3BFM A;  4H02 A;  3SB2 A; 
#chains in the Genus database with same CATH topology
 4C5I A;  1VQN T;  5GAN 7;  4M75 F;  3A8L B;  5GAN h;  3I5S A;  1H64 1;  2DIL A;  3LLR A;  2QDY B;  4TVA A;  2L0A A;  1VQ7 T;  2RHQ B;  2M9U A;  4XEO A;  5E3I A;  2X4X A;  3V8L A;  4YRL A;  1H4S A;  3OYD A;  5GAN 6;  3CC2 A;  2Q7G A;  4X1V A;  2DRM A;  4O5V A;  3E9F A;  3VKI A;  1B07 A;  4CH6 A;  5HKC A;  3MEU A;  1MMG A;  1HTT A;  1T0H A;  3L2Z A;  4C8Q F;  1MND A;  2VYT A;  3QHS A;  3BY7 A;  1H3H A;  5FW9 A;  2DYB A;  2I4N A;  4F04 B;  2CH4 W;  4E7I A;  1N8R C;  2CDT A;  3M55 A;  1WA7 A;  2C8M A;  2DQ0 A;  1EIF A;  5CAI A;  4KR3 A;  5KE3 A;  5GMK m;  1K73 C;  3A98 A;  1IL2 A;  4C8Q D;  2PTK A;  3OYM A;  2MMP A;  2QAS A;  1I8F A;  3S6W A;  1K9M U;  3G4S T;  2CZ6 B;  5D6X A;  4WJ4 A;  2ZZE A;  4YRM A;  2YT6 A;  4BE1 A;  2ZIM A;  3HFO A;  4LDU A;  4F14 A;  4M75 E;  2XID A;  1I5L A;  2QEX A;  3VYH B;  4HWP A;  4E7H A;  4TVA B;  1I81 A;  3I35 A;  3GP8 A;  2EYZ A;  3OD1 A;  1M1K R;  3EGU A;  1QCF A;  4LVK A;  3H0H A;  3VS7 A;  4BDZ A;  3THK A;  3CCR Q;  1IRE B;  1Y96 A;  2EGA A;  3M4G A;  2AMC A;  1ZX6 A;  4B9W A;  1JB0 E;  4OMN A;  4AMC A;  3BW1 A;  4X9C A;  1XTD A;  5LJ3 e;  4OLF A;  2X35 A;  4LDV A;  3A32 A;  2KT1 A;  4MDX A;  3SWN A;  5LJ5 f;  2P0Q A;  4LNP A;  1QLY A;  4YRR A;  1J5W A;  4PJO E;  1BI2 A;  4AFQ C;  4ZTJ A;  1Q81 R;  3E19 A;  3P8V A;  2LJ0 A;  4IKF A;  1CKA A;  4OB2 B;  2LRQ A;  1KD1 R;  4JJD A;  2RK1 A;  4MZM A;  3CCV T;  2YDL A;  2FG0 A;  1TH7 A;  3JCM W;  4CC3 A;  2K9G A;  3M57 A;  1UFF A;  3L2Q A;  4CC4 B;  1VQ7 A;  1VQ9 Q;  5A0L A;  1VQ4 Q;  3R07 A;  1D1B A;  4MZP A;  3CCL T;  3NET A;  1E1O A;  4PG3 A;  1UGR B;  1R0C B;  2F2V A;  4RKU E;  1BI0 A;  3JCM Q;  1E1T A;  2J06 A;  1NLO C;  1JXM A;  3SWN B;  4H2Y A;  4F7U E;  4OB0 B;  2VV5 A;  1HSQ A;  1E22 A;  5L23 A;  3G6E Q;  1YJW A;  2MK5 A;  1D0X A;  3VS1 A;  3REU A;  3CD6 Q;  4PFP A;  2YLC A;  2QGF B;  1LOJ A;  5KYX A;  2JN0 A;  1UGV A;  4E7K A;  3NEL A;  4M78 C;  2HAX A;  4OML A;  3MJX A;  1AZE A;  1ABO A;  2RB6 A;  2YHT A;  3M4Q A;  2L2P A;  5GAN j;  4PJL A;  2CRE A;  1HYO A;  1ASY A;  1TU0 B;  3JCM f;  4GBQ A;  4LN2 A;  4XEM A;  1NEB A;  1B7Y A;  2PMF A;  2QEX Q;  4KBM B;  2VKN A;  1S72 T;  4M78 B;  3CPF A;  1Y0M A;  3M4Y A;  5CKD A;  5CK9 A;  2IY5 A;  3UGQ A;  2K3X A;  3DSQ A;  2COW A;  4LXC A;  1BI1 A;  4X34 A;  1PCX A;  3CC4 T;  1D1A A;  2VB6 A;  4XTW A;  4JRK A;  3VS3 A;  4BI8 B;  3OQ5 A;  5IXF A;  4UP9 A;  3M0P A;  2FZC B;  3CQT A;  4JJB A;  4GLM A;  2COZ A;  5KH6 A;  4K86 A;  3RAC A;  3MEY A;  4BE2 A;  2F1L A;  4JRP A;  1UJY A;  1M30 A;  2AKL A;  2LTO A;  2BUD A;  4BI3 A;  4RCB A;  5HY6 A;  3UF4 A;  2YRD A;  4RTU A;  3UWN A;  2K2M A;  1OX9 A;  1YJ9 Q;  3LX7 A;  2KRN A;  4J9C A;  1YHQ T;  1B7T A;  4DOV A;  2GCX A;  1KC8 C;  1IHW A;  1PWT A;  1B34 B;  2XDB A;  4DEY A;  3OW2 A;  4JDS A;  2GQV A;  4RTW A;  1VIE A;  2Y4X A;  4C92 B;  2EJG A;  2ZZF A;  2NS6 A;  1UDL A;  4KUI A;  4M7A E;  3RUX A;  2QQA A;  1QKW A;  1W66 A;  4DPG A;  2OJ2 A;  3DLM A;  3MEW A;  1B70 B;  3N5B B;  3GF5 A;  2KDS A;  1WPY A;  1N9S A;  2AIR B;  2EKO A;  1T3L A;  2ZR2 A;  1W6X A;  1GCQ C;  1K8A R;  3ZBD A;  1QKX A;  2DMO A;  3GBQ A;  2NUT A;  5L8R E;  1X6O A;  1VQK Q;  3EGD A;  1NLP C;  3G71 T;  1GCP A;  3HRK A;  1OEB A;  1YIT T;  1HK9 A;  1BBW A;  1SET A;  2DQ3 A;  2CP0 A;  3CC7 Q;  2HL3 A;  3NGP A;  3VS0 A;  1WZO A;  2O4X B;  1M90 U;  1NJ6 A;  3RNJ A;  1TUD A;  2HCK A;  3EFR A;  4A4E A;  2A0F B;  5KNN A;  4FW1 A;  1JJC B;  1RL2 A;  2HQX A;  4FYX B;  4H2S A;  1IGQ A;  2AT1 B;  4FYV B;  1NJI R;  3CPW S;  3G4S Q;  2EPD A;  2QTV A;  3C0C A;  4P75 C;  2E3C A;  2DD4 A;  3OYC A;  2MWP A;  1KQ1 A;  2ALY B;  2O31 A;  1L0W A;  4L59 A;  1TUG B;  3VQV A;  3QO8 A;  4CC7 A;  2GQI A;  5GMK h;  5CR2 A;  1W2B P;  1YIJ A;  2DXC A;  4HWS A;  2JS2 A;  4OMQ A;  4ELZ C;  1RAE B;  5KYU B;  2D9T A;  5HK3 A;  2CP2 A;  2RHQ A;  1WU7 A;  4IIO A;  1MHN A;  3RER A;  3I56 A;  5GAM f;  1QE0 A;  2V8J A;  1AHJ B;  2ZCF B;  1K73 U;  5FRO A;  4M78 G;  2GFU A;  2ZPB B;  4EMK B;  2FPF A;  4BDY A;  3RKX A;  1YJ9 A;  1UTI A;  5LJ3 f;  3NTK A;  1WQ7 A;  2EKH A;  4MMK A;  3V7R A;  1VQ6 Q;  1PM3 A;  2JOY A;  3NTI A;  1WHL A;  4PJO B;  4QQD A;  4LVM A;  2DAQ A;  1Z9Z A;  3CC4 Q;  1OYX A;  1QVF S;  2RMO A;  2FEI A;  1M8M A;  1WFW A;  1SSH A;  2DEU A;  1YFT A;  1USY A;  2EIF A;  4K11 A;  1Q86 C;  1AOJ A;  2DJZ A;  2E5K A;  3MQZ A;  3M59 A;  1SF9 A;  4J6X A;  4E47 A;  1NJ1 A;  2JTE A;  2L3P A;  4UP8 A;  4P74 A;  4PJO D;  4YRI A;  1PD0 A;  1FMV A;  4FL6 A;  4PJO C;  3W3S A;  3CCV A;  5C52 B;  2GFA A;  1OQK A;  3TEH A;  1X2G A;  2F5K A;  1B76 A;  8ATC B;  2HSE B;  2Y90 A;  2E1H A;  4L6V 5;  2AK5 A;  1QCO A;  3BJU A;  1ADY A;  1RAH B;  2ART A;  5J39 A;  2DRK A;  1MUZ A;  2DZC A;  7AT1 B;  2H8H A;  2CSI A;  3PVQ A;  2ODR D;  3FRN A;  5KYX B;  5CQY A;  4H2X A;  4P73 C;  3QDF A;  2Y4Y A;  1X6G A;  2DU7 A;  4EX5 A;  3TCJ A;  1YFR A;  1QMC A;  3P8T A;  1H92 A;  4XU1 A;  1TXQ A;  2DXU A;  1JEG A;  4C8Q E;  4TVW A;  1BK2 A;  3LGL A;  3V8K A;  2QEX T;  1G5I A;  1VQK T;  4M7D G;  5FWB A;  2A7Y A;  2DBM A;  4YRN A;  4ZIB A;  1VQM Q;  2QHU A;  5LJ3 d;  3R6N A;  3I9Q A;  4M7D F;  4RMF A;  4H2W A;  2EYQ A;  12AS A;  4YCU A;  5D6W A;  1AWW A;  1IHV A;  2ZT8 A;  4IUV A;  5C6S A;  2HQE A;  4YRP A;  2ED0 A;  2CJB A;  3O8V A;  2PVD B;  1KC8 R;  4EMG A;  2AKW B;  3CCU A;  1FXX A;  2YUQ A;  4ZN1 A;  3JB9 F;  3REB B;  1V76 A;  3CMA T;  4X9D A;  3HP9 A;  2PUO B;  1YJW Q;  2LT4 A;  1MNE A;  4BUG A;  4F17 A;  2DTO A;  1G83 A;  3S3M A;  3HRU A;  4J6W A;  1BCM A;  2RH2 A;  3J80 E;  1HC7 A;  3PMT A;  1LVK A;  1RI0 A;  2EQK A;  2XKO C;  3CEY A;  3DLL A;  2LNV A;  4OP0 A;  3LSS A;  1YHQ A;  3FIF A;  1WJR A;  3CC4 A;  3CCM A;  1LNX A;  3VYG A;  5GAN 8;  5CKB A;  3UDC A;  3M56 A;  3CCJ T;  4A53 A;  5LJ3 h;  1YJN A;  1VQ8 T;  4Z02 A;  1M1K U;  4DBH A;  3VRY A;  1XNI A;  3CCU T;  1WIE A;  2R58 A;  4HCC A;  4XTV A;  3GOX A;  1G5H A;  2DJQ A;  3I55 T;  1VQO Q;  2CP5 A;  1GGM A;  2J3M A;  4J9D A;  2KBT A;  2XU8 A;  4FIB A;  1AWO A;  4TQF A;  1KD1 C;  3DB3 A;  4JJN K;  3RR6 A;  1PYS A;  2ED1 A;  1WXU A;  2EW3 A;  3SEM A;  2IG0 A;  4M78 D;  3HFV A;  1N8R U;  3VBB A;  3JCM P;  2O9S A;  1N27 A;  2K5F A;  1KMN A;  3PZC A;  1OPL A;  2LT1 A;  4UP7 A;  4CH5 A;  3L42 A;  4M78 F;  3JAM E;  2HD0 A;  3CC7 T;  1WJS A;  3L4G B;  4ZNX A;  2XTI A;  4PJO F;  3V7S A;  1P92 A;  2F69 A;  1EIY A;  1YP5 A;  2LMJ A;  2YRV A;  1C0M A;  3OSS C;  2K3B A;  1OV3 A;  2MYS A;  3FDR A;  5GAO q;  4M7A G;  2BE9 B;  3HFZ A;  2H3E B;  5IHK A;  2LCS A;  1VQP A;  2HNI A;  4N4G A;  2KK4 A;  5GAN 2;  1VQO A;  5IH2 A;  2LQK A;  1VQL Q;  2CIM A;  4HT4 A;  5GAN d;  2CP6 A;  2LZ6 B;  1Z9Q A;  5ECA A;  3QDR B;  4ZGD B;  4M4Z A;  3MF2 A;  2A37 A;  1T3S A;  3OYF A;  3G7Z A;  4PL6 A;  2ZPF B;  3TU4 K;  4OMP A;  2LX9 A;  1VQM A;  2NUT B;  2M0Y A;  1E6G A;  5GMK j;  2AKW A;  3CMQ A;  3MO8 A;  3SWN C;  2DER A;  2PNI A;  3L1A A;  4N4I A;  3JB9 D;  1GL5 A;  3DB4 A;  4BW9 A;  1BBZ A;  2OTL T;  1I07 A;  1X2H A;  2JTF A;  5KCO A;  4P75 A;  3BE3 A;  2RHU A;  2DF6 A;  2FPD A;  4G85 A;  2KGT A;  2LCL A;  4P73 A;  1D3B A;  1VQL A;  2BZ8 A;  2J7I A;  1ZLM A;  1ARK A;  3LYI A;  3R6O A;  2D6F A;  3EH2 A;  2J3L A;  4TTV A;  4LD6 A;  1VQ9 A;  4NOY A;  1KJW A;  3L2U A;  3G4S A;  5A0D A;  4YRS A;  1U1T A;  1Z7M A;  2ECZ A;  2ALY A;  3CXC S;  3CBO A;  3OYL A;  4YPF A;  3OYJ A;  1FMK A;  1KHI A;  1XQH A;  4CC2 A;  2EQM A;  2XIC A;  2D0Q B;  2WSE E;  2I4L A;  4DA4 A;  4HWO A;  1X27 A;  2KSS A;  1JRI A;  1FX7 A;  3PMI A;  3LW5 E;  1M3C A;  2AZV A;  3M53 A;  1U5S A;  3OYE A;  3RF1 A;  1YNZ A;  4HWT A;  4PNO A;  4QVZ A;  3MEA A;  2WSF E;  2E12 A;  1KFZ A;  3WVD B;  2SRC A;  2RM4 A;  1EVK A;  4M75 B;  3ZFJ A;  2M1H A;  2EGC A;  1K0X A;  3VV0 A;  5GAN 5;  3EGD B;  4WJ3 M;  2M0O A;  4ORZ A;  5CO7 A;  2HKQ B;  4OVA A;  3JCM J;  2K2V A;  2ZXF A;  2EJF A;  3EG0 A;  3EFO A;  4UC4 A;  2QAZ A;  4P71 A;  1IRX A;  4OB3 B;  1VQP T;  4M75 C;  3OYA A;  2FZG B;  1YB3 A;  3CC2 T;  4IIM A;  4M7A D;  2EJ9 A;  3JCM c;  3JCM b;  5IT9 E;  2QG9 B;  4EMH A;  1R77 A;  1VYT A;  2JVV A;  1QVG A;  3MHX A;  1J3T A;  2RHS A;  1QVG S;  1E7O A;  4CS2 A;  2OTJ Q;  1SES A;  2KYB A;  2G6F X;  2JW4 A;  4HCK A;  4GY5 A;  1H3Z A;  3HTZ A;  1ATI A;  4BB7 A;  1AD5 A;  1JU5 C;  4CS4 A;  1R0B G;  4XTU A;  4K88 A;  4XTY A;  4ZTF A;  3TRE A;  1BIB A;  5AYF A;  2A28 A;  2Q7E A;  4PJM A;  5CQX A;  1R8O B;  2G4C A;  1SKU B;  4YDQ A;  1SPK A;  4PLL A;  3VJP A;  2BZY A;  1KQS A;  1YWP A;  1M2V A;  2YUO A;  2CJ9 A;  3HPW A;  3I5R A;  2NUZ A;  4KH0 B;  3OYB A;  1VQ8 Q;  2J6O A;  2KR3 A;  4RTT A;  5CKE A;  4G84 A;  3QG1 A;  4WTO B;  3KFU A;  3HXW A;  3JCM e;  3CCU Q;  1NPP A;  3H9N A;  4NL2 A;  1C6V X;  4PHC A;  2AHJ B;  2RHS B;  2Z0W A;  4RQE A;  2RQU A;  4H2X B;  2V26 A;  2RI3 A;  1U3O A;  2X3X D;  1OU9 A;  3X20 B;  4AG2 C;  2V8I A;  2GF7 A;  1FWZ A;  3A8M B;  1VQ7 Q;  2QDL A;  4H2U A;  3E9I A;  1IZ6 A;  4OGE A;  3E9H A;  1FMW A;  4KUL A;  1UE9 A;  3ICA A;  1Y96 B;  1Q86 U;  2ZZG A;  1SER A;  3VUZ A;  3HXZ A;  3GNG A;  3QO3 A;  3SD4 A;  4DQ2 A;  2Q5H A;  1ZSG A;  1YI2 A;  3ULR B;  2ROT A;  1ZBX A;  2DXT A;  3TQ7 P;  1NZ9 A;  4C0D C;  4F7U A;  4R0K A;  4P5N A;  1QW1 A;  2CT3 A;  3QTC A;  3RGL A;  2HKN A;  4MML A;  2KNB B;  3CCL Q;  4M7D E;  2DKG A;  1GFC A;  1KQS P;  2BIV A;  1UB4 A;  2LQ8 A;  2F2X A;  1WHM A;  3VS5 A;  3UA6 A;  3LH5 A;  1N6A A;  1RAB B;  2DL8 A;  4WCI A;  4C0D B;  5GAO r;  3QYH B;  3PCO B;  6AT1 B;  4J83 A;  2QQB A;  11AS A;  2CS7 A;  3G6E T;  3V8J A;  5FRN A;  2BE7 D;  2E41 A;  3NEN A;  3CD6 T;  4JS5 A;  1USY C;  3CBP A;  1BYM A;  1UEC A;  2LJ1 A;  1PG5 B;  3S3O A;  2E10 A;  5A2Q E;  4QT7 A;  4JRI A;  2Q5I A;  1C0A A;  2KXC A;  1WLP B;  5HK0 A;  2YLB A;  3UA7 A;  5GAM d;  1MMD A;  1N9W A;  1QVP A;  2ZT7 A;  1ZBJ A;  2AKK A;  2X4J A;  2HMA A;  5FRM A;  3QWY A;  1VQP Q;  1WI7 A;  2ZPH B;  3WXM B;  5GAN 3;  4HCZ A;  3CC2 Q;  2RJE A;  1OZ3 A;  3ASK A;  2QI2 A;  3T9N A;  1G8X A;  2VXE A;  2F5T X;  2C7I A;  1OPK A;  3PVL A;  2WSC E;  4XTZ A;  2I2L A;  5GAN g;  1IGU A;  1OU8 A;  1UGQ B;  3FJ5 A;  3CCV Q;  1RIQ A;  3REX A;  2FPE A;  1TSF A;  3TSZ A;  2X3W D;  3URG A;  3CCS Q;  2OAW A;  5I21 A;  3CCM Q;  1ASZ A;  2DNU A;  1UJ0 A;  5KYW A;  1LJO A;  1UUE A;  3V7C A;  1KD1 U;  2EAY A;  1QCN A;  4DEX A;  1WHH A;  3FJP A;  1PSF A;  2V1Q A;  2ENM A;  3QII A;  3QJY A;  3EG3 A;  1NG2 A;  3WQZ A;  4O6J A;  2CKK A;  1YJ9 T;  1EVL A;  1WXT A;  4HCB A;  1WNL A;  2QTX A;  1CKB A;  2JM8 A;  3QZ5 B;  2EQU A;  1RAI B;  2K5L A;  5KYU A;  1AT1 B;  1LPL A;  2K4Y A;  3TEG A;  3FC3 A;  2DE0 X;  3O5Z A;  1U8R A;  1EZZ B;  2KT8 A;  2XDP A;  2MI6 A;  2RD1 A;  4Z8A A;  1F1B B;  5D7U A;  1VA7 A;  3RES A;  1YIJ T;  3CBM A;  2O88 A;  2DDZ A;  3OYY A;  4H02 A;  4J9B A;  2RN8 A;  1SRM A;  2GGR A;  3IKL A;  4NCX A;  1EFN A;  4OF1 A;  4B6M A;  3OS0 A;  5KYN A;  4N4H A;  3HXV A;  5K1X A;  3QZ9 B;  1OZ2 A;  1SRL A;  4E2F B;  4FCY A;  3VUB A;  4TWA A;  2JZ2 A;  1S72 Q;  1K0S A;  4XQ3 A;  1K9M R;  3OBW A;  2QHT A;  4FSS A;  1YIT Q;  2E65 A;  4JLI A;  2RA2 A;  2X51 A;  3OYG A;  3HFZ B;  1RLQ C;  4HKE A;  3LH0 A;  3E1S A;  2RQW A;  4J9H A;  2E70 A;  3NHN A;  1JJ2 S;  2FVU A;  4J9G A;  2AZS A;  2NLU A;  2A8E A;  2O2O A;  1TS9 A;  2OTJ T;  4Q6G A;  4LDW A;  4C0G A;  1N8R R;  2XHC A;  2MOX A;  2YXY A;  3A74 A;  2QHS A;  4DBR A;  1W70 A;  2JJ9 A;  1VYV A;  1QQJ A;  1SHF A;  2LQN A;  5GAN 4;  2CZ0 B;  1M8V A;  4M75 A;  4DBQ A;  4PKC C;  1VUB A;  2KMT A;  3H0F A;  1WYX A;  2L89 A;  3M54 A;  5EG2 A;  4CRI A;  4BY6 C;  2LP5 A;  4ANJ A;  4IUQ A;  4R55 A;  2LQW A;  2D8J A;  3EAE A;  3G6E A;  1YFS A;  1BCO A;  1VQ6 A;  3S3N A;  5GAO l;  1NYF A;  1X2Q A;  3M58 A;  4BE0 A;  2YUN A;  4M77 G;  1PKS A;  2ZNI A;  4DOW A;  2DIG A;  1EQR A;  4BY6 B;  4A4K A;  2O9V A;  3A5Y A;  2XG8 D;  3FLG A;  1NBE B;  1YWO A;  3AHU A;  2RF0 A;  4M77 B;  4XU3 A;  1ZUK A;  4O2D A;  5I2S A;  2M02 A;  4TVY A;  4FSX A;  2C06 A;  4YRE A;  1MGQ A;  3SDZ A;  3M0R A;  1B34 A;  5GAO p;  1Q95 G;  2G3R A;  4F16 A;  1YCY A;  4C92 A;  4ELY C;  2OTJ A;  3HXY A;  4M77 D;  1WQW A;  3CME A;  3G71 Q;  1M9S A;  4R56 A;  1WXB A;  3RKY A;  3RBB B;  1Q81 U;  1KQ2 A;  4Q5W A;  3HTR A;  3QWX X;  3REA B;  1NEG A;  3CCJ A;  1YFN A;  1BKB A;  1E6H A;  2EYX A;  4RTY A;  1ZA1 B;  4HVU A;  2EYW A;  3CCM T;  4MDW A;  2AMC B;  1O75 A;  5J3B A;  3QSU A;  4M7A C;  1VQ5 Q;  4KUD K;  1YCS B;  2ZPE B;  4LDY A;  3QNE A;  1M90 R;  3M4P A;  1LCK A;  3RIR A;  1S72 A;  2HDA A;  4C5H A;  3CMA A;  2EWN A;  2RQV A;  5GJV B;  4AT1 B;  4LVJ A;  2BTT A;  8AT1 B;  5AT1 B;  4M7D C;  3JCM V;  2JMC A;  2RPN A;  1K76 A;  3TUP A;  3HKS A;  3PE0 A;  3DKM A;  3GLX A;  4NS5 A;  2VXF A;  2JM9 A;  1MV0 B;  2YSQ A;  5C0M A;  4YCW A;  4KR2 A;  1M2O A;  4JJC A;  2JUF A;  3IG2 A;  4F7U G;  1ACM B;  5ELO A;  3A5Z B;  4KH1 B;  1VQN Q;  4QQG A;  2ZPG B;  4JUV A;  1Y07 A;  1ABQ A;  5CVI A;  5DM7 R;  3BDL A;  4HT8 A;  2K79 A;  4AFS C;  1WX6 A;  1QVF A;  1N5Z A;  2E6Z A;  4J6Y A;  1H8K A;  2YUP A;  4YRC A;  1AWX A;  3RMQ A;  4D8K A;  4F7U B;  5GMK l;  2OTL A;  2DL5 A;  5GMK e;  1BI3 A;  1PRL C;  2EVR A;  2ZIN A;  5I11 A;  3CCE T;  3L2R A;  2XDD A;  2FO0 A;  1RAC B;  2FHD A;  3KFV A;  4Z89 A;  5D6Y A;  1TG0 A;  4IUP A;  4A63 B;  4A4F A;  2BZX A;  5LJ5 d;  2QQR A;  2MCN A;  4P3O A;  1TTH B;  2J6F A;  4PJO A;  2P4T A;  2ATC B;  1B7Y B;  4ESR A;  2FL7 A;  5GAM h;  1X54 A;  3MCA B;  4C92 G;  2FZK B;  2ZTG A;  3JB9 I;  3OW2 P;  1K73 R;  1KQS S;  2LVM A;  3HHT B;  3CCE A;  4XAX B;  3PGG A;  1EFW A;  3EH1 A;  2P0K A;  2E3I A;  2QK0 A;  3CCJ Q;  3CCQ T;  2XI9 A;  5GAN e;  2LNH B;  2KRS A;  3CD6 A;  2E5A A;  3QBY A;  4ME7 A;  3QO7 A;  3CCR T;  4AFZ C;  1UHF A;  5FWC A;  4C0Z A;  1X55 A;  1N9R A;  1PYS B;  3OMC A;  1MMA A;  1X6B A;  4A54 A;  1PKT A;  2XK0 A;  2D1X A;  2M16 A;  1X43 A;  1M5Q 1;  2YWW A;  5ELN A;  1X75 C;  1RAD B;  3CCQ A;  1ZQ1 A;  1G3W A;  2XGT A;  1WJQ A;  1BBU A;  3MP6 A;  3OYH A;  4IUR A;  1V29 B;  1Q81 C;  5DLQ E;  1OI1 A;  2L5Q A;  2D8H A;  1VQM T;  1RLP C;  3EG2 A;  5J26 A;  3L4G A;  1GCQ A;  4JRQ A;  3MKD A;  1YI2 T;  2CUD A;  1KMM A;  1WHK A;  4P72 A;  4E7L A;  1I5O B;  2HEQ A;  4CS3 A;  3G1J A;  3SFM A;  2MAM A;  4YRK A;  4YYE A;  2ZNJ A;  2KVQ G;  3F70 A;  4N0A A;  2P0P A;  3QKJ A;  1M3B A;  5KE2 A;  4C8Q B;  1KK7 A;  1BIA A;  1VQ4 T;  1GXI E;  1Q7Y R;  1SEM A;  1K4U S;  2GNC A;  1G5V A;  3A5Z A;  5LL6 S;  3HXX A;  5LJ3 g;  4IUT A;  1LYL A;  3EHQ A;  4YRT A;  3OMG A;  4JLG A;  3I7F A;  4P74 C;  1OUL A;  4C8Q G;  4RUG A;  1KIK A;  2E3H A;  1B3Q A;  1DJ7 B;  4J9F A;  1VQN A;  4C8Q C;  1NM7 A;  4E7Z A;  3EG9 A;  2RI2 A;  2A36 A;  3LC0 A;  2CGH A;  3OYN A;  4E6R A;  3EFS A;  2O4X A;  1JO8 A;  4EO4 A;  4XTX A;  3CXC A;  2FRY A;  3I55 Q;  5CKH A;  1A0N B;  4AFU C;  1FYF A;  3A7R A;  5FU6 C;  1KG1 A;  4JPB W;  4AG1 C;  2HBW A;  2IVW A;  1ZSZ C;  2E64 A;  2IPO B;  4OB1 B;  5LJ5 h;  5CCA A;  3CPW A;  3UT1 A;  5IHN A;  5DY9 A;  3J81 E;  4OMM A;  1Q86 R;  3MET A;  3TVT A;  3OY9 A;  2RQT A;  2BKD N;  2VVK A;  3QXE B;  3ZEH A;  3ERR A;  4PFO A;  2E5Q A;  1W1F A;  4CI0 C;  1WYD A;  5HCK A;  1TWB A;  2E4H A;  2FB7 A;  4TVR A;  1KOG A;  4CH3 A;  2L8D A;  4BD3 A;  2LX7 A;  4J9E A;  2ZAE A;  3RMS A;  2L3S A;  4C5E A;  2XD0 A;  1PD1 A;  3LWI A;  4YRG A;  2V1R A;  4BI4 A;  4OGC A;  2KXD A;  1JXO A;  1VQ8 A;  2CZ1 B;  3JRZ A;  1YHQ Q;  3KBG A;  3HRS A;  1E24 A;  1HXD A;  2ZR3 A;  1GRI A;  3CCQ Q;  4LD9 K;  1NJ5 A;  3QUI A;  2W10 A;  5I22 A;  4KGV B;  4ZN3 A;  3X26 B;  3C95 A;  3EGX A;  4JZ4 A;  3OYI A;  3C12 A;  3D7S B;  2F2W A;  4M75 D;  1OX8 A;  4II1 A;  2PU9 B;  4QVD A;  3SHW A;  2RJD A;  1K9M C;  2JTM A;  4RMO A;  4ZGE B;  2DXB A;  1M1K C;  4F7U F;  4C8Q A;  2ZT6 A;  4ZTU B;  1W2B A;  2HQH A;  1WGS A;  1KSW A;  5C53 B;  1NE8 A;  3TEH B;  5GAO n;  3CCR A;  4ZTZ B;  3GPL A;  1Y71 A;  2ROL A;  4YCV A;  1YN8 A;  1H4V B;  2OX7 A;  2ZZD A;  2GTJ A;  3JB9 J;  2QXF A;  1PNJ A;  5GAN f;  2RJC A;  1EOV A;  1VQ5 A;  1WHG A;  2CH4 A;  1NPR A;  2MIO A;  3MP8 A;  5IHI A;  3VS2 A;  2ABL A;  5FLX E;  4C92 E;  5K1P A;  5GAM e;  3TSW A;  2MF2 A;  4D6W A;  2EFI A;  5GAM j;  2VGN A;  1X56 A;  3A7A A;  4RQF A;  4EIK A;  3HXU A;  4JZ3 A;  1RAA B;  2DA9 A;  2KQW A;  4LVL A;  2C0T A;  2DTI A;  3C94 A;  3SB2 A;  2DYI A;  4LUD A;  3VQY A;  4OMO A;  1NJI C;  1GBR A;  4CH4 A;  3IAL A;  3M5A A;  3P8D A;  1V1C A;  1M2V B;  3HSB A;  2DO3 A;  5KCH A;  1K1Z A;  5CIU A;  5IN1 A;  3PTA A;  1VQ4 A;  1XOV A;  4BWA A;  1NNH A;  2K7A A;  2NWM A;  3RDV A;  2I4O A;  2RO0 A;  4C92 D;  1VOM A;  4M78 A;  3E2U A;  2PME A;  1QWF A;  1O9S A;  2GBQ A;  4HT9 A;  1OOT A;  4RTZ A;  3UFG A;  3TEE A;  3A31 A;  2OI3 A;  2P5I A;  4E51 A;  3UH0 A;  3PNW C;  1G51 A;  1EIY B;  3GIB A;  3KUF A;  3M0T A;  2DU5 A;  2ARS A;  1AZG B;  3H41 A;  4HVV A;  2J6K A;  3G71 A;  4QVC A;  3ZL7 C;  1HJD A;  4P72 C;  4LUE A;  3QJ6 A;  2K5I A;  4P71 C;  2L3Q A;  4RG2 A;  4PJO G;  3JB9 H;  3NTH A;  5LJ5 j;  2DBK A;  1VIF A;  3NFC A;  3CXC P;  3MF1 A;  2P0L A;  3I56 T;  1GFD A;  4UPA A;  1BB9 A;  1AWJ A;  2CP7 A;  5LJ5 g;  2IY5 B;  2QHV A;  4M77 A;  5GJW B;  1UG1 A;  1PHT A;  3CCS A;  4M77 C;  1YI2 Q;  4Y91 A;  2DK3 A;  4HVC A;  4M7A F;  1D1C A;  4J7I A;  1W4S A;  3AT1 B;  3EFO B;  3Q1J A;  2HL5 C;  2RQR A;  2RHX A;  3MPU B;  3NMZ C;  1C1A A;  1ADJ A;  1JJ2 P;  1RAF B;  2K3Y A;  3P8B B;  1X69 A;  3OS5 A;  3A1P A;  4LE9 A;  4PJJ A;  2DD5 A;  1I4K 1;  2DLP A;  2K57 A;  3JCM X;  4J7F A;  4X5O A;  4FYW B;  4M7A B;  4M78 E;  4C5G A;  2B86 A;  2JS0 A;  1GBQ A;  3M9Q A;  3QYG B;  1RAG B;  3MP1 A;  1Y57 A;  4D8D A;  3HY1 A;  4HA8 A;  5A0G A;  4J9I A;  5KYW B;  1D0Z A;  2QQ9 A;  1Y7X A;  1M1F A;  2P4R A;  1NYG A;  3QO5 A;  2ZT5 A;  5IXB A;  4QQ6 A;  3IKM B;  3ER0 A;  2V8K A;  4ZGJ B;  2EYY A;  3RKW A;  2A08 A;  2O01 E;  2DVE A;  4M7D B;  1QVG P;  3PT9 A;  2YRC A;  4A4G A;  1JBM A;  3HRT A;  3LWH A;  2X4W A;  3X28 B;  3A8O B;  4P3P A;  4J5Y A;  4KGZ B;  4B9X A;  4PLI A;  3CME T;  1K8A C;  3NEM A;  1VQ6 T;  3INZ A;  2Q7H A;  4E7S A;  4XK8 E;  4QW2 A;  3OYK A;  1G2B A;  1ZUY A;  2CYZ B;  2CJA A;  2ZGW A;  1BU1 A;  3G1Z A;  2RJF A;  4RG8 A;  3H8Z A;  2ODR C;  5GAO m;  5GAM g;  4L87 A;  3JCM h;  3JB9 G;  2RHZ A;  4L5G A;  4LNS A;  3NPF A;  1W2B S;  2J05 A;  3CMA Q;  1EX4 A;  2MPX C;  3FB9 A;  4XU0 A;  1YJW T;  2ESW A;  3VS6 A;  3I55 A;  1G3S A;  1QWE A;  1UEB A;  3CC7 A;  1XJW B;  1U06 A;  2EQI A;  2DTH A;  4ATO A;  1PC0 A;  2WAC A;  1D09 B;  5CKF A;  2C0O A;  2DZ9 A;  1RUW A;  3ME9 A;  5FU7 B;  2FYK A;  4C92 F;  2PUK B;  4RCC A;  1Q82 U;  3JCM d;  2QA4 T;  2CZ7 B;  2XMF A;  3A8H B;  3RL6 A;  4Y28 E;  2DFU A;  1M1G A;  1VQZ A;  4QKU A;  4JS4 A;  3A7U A;  4Q15 A;  4HVW A;  1X01 A;  2QYZ A;  3EG9 B;  2FRW A;  4LDX A;  1QVF P;  2KYM A;  1YIJ Q;  5FU7 C;  3HL8 A;  4VUB A;  2VAS A;  4DBF A;  2DL3 A;  3PCO A;  1YJN T;  4M75 G;  1SHG A;  3L2V A;  4HXJ A;  2L3R A;  4PFZ A;  5IAY A;  1KC8 U;  3IQL A;  3I56 Q;  4BAC A;  3OB9 A;  2LDM A;  2DEQ A;  4M77 F;  4FM4 B;  1M3A A;  2I0N A;  2IIM A;  1ZUU A;  4M7A A;  4K87 A;  4EDU A;  2PQW A;  3C4S A;  4PK4 A;  1Q7Y U;  4M7D D;  1VQK A;  2CUB A;  4A4H A;  4YRF A;  3UGT A;  1IO6 A;  3A8G B;  1PRM C;  3U23 A;  2RHI A;  2RI5 A;  3VS4 A;  4J8O A;  1NJ8 A;  1UHC A;  1UGP B;  5GMK i;  4OMF B;  3CPW P;  3CCS T;  1ZA2 B;  3HRI A;  3CCL A;  2R5A A;  1H4Q A;  2H3J A;  4C92 C;  2HZY A;  2A3L A;  3OBY A;  1K9A A;  5I2M A;  1WDX A;  1M27 C;  1Z7N A;  1G3T A;  4KT0 E;  2EL9 A;  4N0A C;  1JQQ A;  4RTV A;  4IUU A;  2HBP A;  1YBY A;  2MWO A;  2DM1 A;  1T0J A;  2K6D A;  1I0C A;  3M0S A;  5F5W A;  2C0I A;  4FT4 A;  3VRZ A;  2I4M A;  2ZIO A;  2JXB A;  1IB8 A;  3H6Z A;  4H2V A;  1VQO T;  3UAT A;  1H4T A;  2ZPI B;  4C0F A;  2RNA A;  1AEY A;  2PZ1 A;  2LJ3 A;  3VU3 C;  3HY0 A;  4LVI A;  2R5M A;  2CSQ A;  1X2K A;  1CSK A;  3CME Q;  4YRO A;  2PVG B;  1G3Y A;  2RHY A;  2COY A;  2ZCE A;  2HSP A;  3VQX A;  1IXD A;  2DL7 A;  9ATC B;  3LSQ A;  2JT4 A;  5HGQ A;  1QP2 A;  1UGS B;  3GNF B;  5FU6 B;  4KQE A;  2P84 A;  4GLK A;  3BDU A;  2EQJ A;  3JCM g;  3E9G A;  1ZSZ B;  4V2S A;  4RTX A;  4Y92 A;  3JV3 A;  3P8H A;  2QGG A;  4Z88 A;  2DET A;  1VQ5 T;  4WF2 A;  2VWF A;  2R57 A;  2M51 A;  2JMA A;  4MZT A;  1VQ9 T;  2ARU A;  5C51 B;  3HFN A;  2PVO B;  2SEM A;  4KGX B;  2NYS A;  3VQW A;  2LC4 A;  2KY9 A;  2DL4 A;  2VC8 A;  2DVJ A;  3J7A F;  1VQL T;  1QP3 A;  4KRT A;  3MEV A;  1D0Y A;  1M4Z A;  3WVE B;  3OS1 A;  4M7D A;  2NUP A;  1SRY A;  1AVZ C;  5LJ5 e;  2EGE A;  1MMN A;  1RI9 A;  2CT4 A;  1SSF A;  2VGM A;  2QA4 Q;  1NYQ A;  3PFS A;  3OSV A;  3X24 B;  1B70 A;  4EMK C;  4FYY B;  4FW2 A;  4EPC A;  5LJ3 j;  2JNG A;  3LGF A;  1Q82 R;  4J15 A;  1NJI U;  3OS2 A;  3PIP A;  1B8A A;  1D3B B;  2CP3 A;  3JSC A;  3QPH A;  2KRM A;  2VUB A;  3OW2 S;  1YJN Q;  2OAU A;  1ZSZ A;  2KAF A;  3EGX B;  4NL3 A;  2OTL Q;  2X4Y A;  1WHJ A;  4P3N A;  2D0N A;  2DX1 A;  3OA6 A;  4RDX A;  2DPP B;  5EC7 A;  3P8Y A;  4YP0 A;  1YIT A;  5KYY A;  3M0U A;  3EHR A;  4AH6 A;  4H2T A;  1VYU A;  2KEA A;  2W0Z A;  1QF6 A;  1S1N A;  2NUP B;  4EMK A;  1FYN A;  3CCE Q;  3UPU A;  1JJ2 A;  1JJC A;  1Q7Y C;  2QA4 A;  2KRO A;  4YTL A;  2KI7 A;  1NYR A;  1M90 C;  4M77 E;  1K8A U;  2B8A A;  3FEO A;  2RK2 A;  1I1J A;  4FU6 A;  4HWR A;  1SG5 A;  2E6N A;  2DIQ A;  1Q82 C;  4YRQ A;  3M0Q A;  1TUC A;  5M9O A;  4YRJ A;  1NJ2 A;  2X9H A;  1HD3 A;  4PJN A;  3KXT A;  4TQD A;  3L2W A;  1TOV A;  4WI1 A;  2GTO A;  1PSE A;  3EG1 A;  1U1S A;  5KYY B;  3PIO A;  1MV3 A;  4XU2 A;  2QQS A;  1WLE A;  4E7J A;  5DLO A;  1KHC A;  1YGB A;  1ZHI A;  3H0I A;  4FT2 A;  2EBP A;  2LCC A;  3BFM A;  2KE9 A;  3X25 B; 
#chains in the Genus database with same CATH homology
 4C5I A;  1VQN T;  5GAN 7;  4M75 F;  3A8L B;  5GAN h;  1H64 1;  3LLR A;  2QDY B;  4TVA A;  1VQ7 T;  2RHQ B;  4XEO A;  2M9U A;  5E3I A;  2X4X A;  3V8L A;  4YRL A;  1H4S A;  3OYD A;  5GAN 6;  3CC2 A;  2Q7G A;  4O5V A;  3E9F A;  3VKI A;  4CH6 A;  5HKC A;  3MEU A;  1HTT A;  3L2Z A;  4C8Q F;  2VYT A;  3QHS A;  3BY7 A;  2I4N A;  4E7I A;  1N8R C;  2C8M A;  3M55 A;  2DQ0 A;  1EIF A;  5CAI A;  4KR3 A;  5KE3 A;  5GMK m;  1K73 C;  1IL2 A;  4C8Q D;  3OYM A;  2MMP A;  1I8F A;  3S6W A;  1K9M U;  3G4S T;  2CZ6 B;  5D6X A;  4WJ4 A;  2ZZE A;  4YRM A;  4BE1 A;  2ZIM A;  3HFO A;  4LDU A;  4M75 E;  2XID A;  1I5L A;  2QEX A;  3VYH B;  4HWP A;  4E7H A;  4TVA B;  1I81 A;  3GP8 A;  3OD1 A;  4LVK A;  4BDZ A;  1IRE B;  1Y96 A;  3M4G A;  2AMC A;  4B9W A;  1JB0 E;  3BW1 A;  4X9C A;  1XTD A;  5LJ3 e;  4OLF A;  2X35 A;  4LDV A;  3A32 A;  4MDX A;  3SWN A;  5LJ5 f;  2P0Q A;  4YRR A;  1J5W A;  4PJO E;  1BI2 A;  4ZTJ A;  3E19 A;  3P8V A;  4IKF A;  4OB2 B;  2LRQ A;  2RK1 A;  4MZM A;  3CCV T;  1TH7 A;  3JCM W;  3M57 A;  3L2Q A;  1VQ7 A;  5A0L A;  3R07 A;  4MZP A;  3CCL T;  3NET A;  1E1O A;  4PG3 A;  1UGR B;  4RKU E;  1BI0 A;  3JCM Q;  1E1T A;  3SWN B;  4H2Y A;  4F7U E;  4OB0 B;  2VV5 A;  1E22 A;  1YJW A;  3REU A;  2YLC A;  1LOJ A;  2JN0 A;  4E7K A;  3NEL A;  4M78 C;  2HAX A;  2RB6 A;  2YHT A;  3M4Q A;  5GAN j;  1ASY A;  3JCM f;  4XEM A;  1B7Y A;  2PMF A;  4KBM B;  1S72 T;  4M78 B;  3CPF A;  3M4Y A;  5CKD A;  5CK9 A;  2IY5 A;  3UGQ A;  2K3X A;  3DSQ A;  1BI1 A;  4X34 A;  3CC4 T;  4XTW A;  4JRK A;  4BI8 B;  3OQ5 A;  4UP9 A;  5KH6 A;  4K86 A;  3RAC A;  3MEY A;  4BE2 A;  4JRP A;  2LTO A;  2BUD A;  4BI3 A;  4RCB A;  5HY6 A;  3UWN A;  3LX7 A;  1YHQ T;  4DOV A;  2GCX A;  1KC8 C;  1B34 B;  2XDB A;  3OW2 A;  4JDS A;  2GQV A;  1VIE A;  2Y4X A;  4C92 B;  2EJG A;  2ZZF A;  2NS6 A;  4KUI A;  4M7A E;  3RUX A;  2QQA A;  1W66 A;  4DPG A;  3DLM A;  3MEW A;  1B70 B;  3N5B B;  3GF5 A;  2KDS A;  1WPY A;  1N9S A;  2EKO A;  2ZR2 A;  3ZBD A;  5L8R E;  1X6O A;  3G71 T;  3HRK A;  1YIT T;  1HK9 A;  1BBW A;  1SET A;  2DQ3 A;  2O4X B;  1M90 U;  1NJ6 A;  3EFR A;  4A4E A;  5KNN A;  1JJC B;  1RL2 A;  2HQX A;  4H2S A;  3CPW S;  4P75 C;  2E3C A;  2DD4 A;  3OYC A;  2MWP A;  1KQ1 A;  2ALY B;  1L0W A;  4L59 A;  3VQV A;  3QO8 A;  5GMK h;  5CR2 A;  4HWS A;  1YIJ A;  2DXC A;  4ELZ C;  2D9T A;  5HK3 A;  2RHQ A;  1WU7 A;  1MHN A;  3RER A;  3I56 A;  5GAM f;  1QE0 A;  2V8J A;  1AHJ B;  2ZCF B;  1K73 U;  5FRO A;  4M78 G;  2GFU A;  2ZPB B;  4EMK B;  4BDY A;  3RKX A;  1YJ9 A;  5LJ3 f;  1WQ7 A;  3NTK A;  4MMK A;  3V7R A;  2JOY A;  3NTI A;  4PJO B;  4QQD A;  4LVM A;  2DAQ A;  1OYX A;  1QVF S;  1YFT A;  1USY A;  2EIF A;  1Q86 C;  2DJZ A;  3MQZ A;  3M59 A;  4J6X A;  4E47 A;  1NJ1 A;  4UP8 A;  4P74 A;  4PJO D;  4YRI A;  4FL6 A;  4PJO C;  3W3S A;  3CCV A;  5C52 B;  2GFA A;  3TEH A;  1X2G A;  2F5K A;  1B76 A;  2Y90 A;  2E1H A;  4L6V 5;  3BJU A;  1ADY A;  2ART A;  5J39 A;  2DZC A;  2ODR D;  3FRN A;  5CQY A;  4H2X A;  4P73 C;  2Y4Y A;  2DU7 A;  4EX5 A;  3TCJ A;  1YFR A;  3P8T A;  4XU1 A;  2DXU A;  4C8Q E;  4TVW A;  3LGL A;  3V8K A;  2QEX T;  1G5I A;  1VQK T;  4M7D G;  2A7Y A;  4YRN A;  4ZIB A;  2QHU A;  5LJ3 d;  4RMF A;  4M7D F;  4H2W A;  4YCU A;  2EYQ A;  12AS A;  5D6W A;  2ZT8 A;  4IUV A;  5C6S A;  2HQE A;  4YRP A;  2CJB A;  3O8V A;  2PVD B;  4EMG A;  2AKW B;  3CCU A;  1FXX A;  3JB9 F;  4ZN1 A;  3CMA T;  4X9D A;  3HP9 A;  2PUO B;  2LT4 A;  4BUG A;  2DTO A;  3S3M A;  3HRU A;  4J6W A;  2RH2 A;  3J80 E;  1HC7 A;  3PMT A;  1RI0 A;  2EQK A;  2XKO C;  3CEY A;  3DLL A;  2LNV A;  4OP0 A;  3LSS A;  1YHQ A;  3FIF A;  1WJR A;  3CC4 A;  3CCM A;  1LNX A;  3VYG A;  5GAN 8;  5CKB A;  3UDC A;  3M56 A;  3CCJ T;  4A53 A;  5LJ3 h;  1YJN A;  1VQ8 T;  4Z02 A;  1M1K U;  1XNI A;  3CCU T;  2R58 A;  4HCC A;  4XTV A;  3GOX A;  1G5H A;  3I55 T;  1GGM A;  2J3M A;  2XU8 A;  4FIB A;  4TQF A;  1KD1 C;  3DB3 A;  4JJN K;  1PYS A;  2IG0 A;  4M78 D;  3HFV A;  1N8R U;  3VBB A;  3JCM P;  1N27 A;  2K5F A;  1KMN A;  3PZC A;  2LT1 A;  4UP7 A;  4CH5 A;  3L42 A;  4M78 F;  3JAM E;  2HD0 A;  3CC7 T;  1WJS A;  3L4G B;  2XTI A;  4PJO F;  3V7S A;  1P92 A;  2F69 A;  1EIY A;  2YRV A;  3OSS C;  3FDR A;  5GAO q;  4M7A G;  3HFZ A;  1VQP A;  2HNI A;  4N4G A;  2KK4 A;  5GAN 2;  1VQO A;  2CIM A;  2LQK A;  4HT4 A;  5GAN d;  3QDR B;  4ZGD B;  3MF2 A;  3OYF A;  3G7Z A;  4PL6 A;  2ZPF B;  3TU4 K;  2LX9 A;  1VQM A;  5GMK j;  2AKW A;  3CMQ A;  3MO8 A;  3SWN C;  3L1A A;  4N4I A;  3JB9 D;  3DB4 A;  4BW9 A;  2OTL T;  1X2H A;  2JTF A;  5KCO A;  4P75 A;  2RHU A;  4G85 A;  2LCL A;  4P73 A;  1D3B A;  1VQL A;  3LYI A;  3R6O A;  2D6F A;  2J3L A;  4TTV A;  4LD6 A;  1VQ9 A;  4NOY A;  3L2U A;  3G4S A;  5A0D A;  4YRS A;  1U1T A;  1Z7M A;  2ALY A;  3CXC S;  3CBO A;  3OYL A;  4YPF A;  3OYJ A;  1KHI A;  1XQH A;  2EQM A;  2XIC A;  2D0Q B;  2WSE E;  2I4L A;  4DA4 A;  4HWO A;  2KSS A;  1JRI A;  1FX7 A;  3PMI A;  3LW5 E;  3M53 A;  3OYE A;  3RF1 A;  4HWT A;  4PNO A;  4QVZ A;  3MEA A;  2WSF E;  2E12 A;  3WVD B;  2RM4 A;  1EVK A;  4M75 B;  3ZFJ A;  2M1H A;  3VV0 A;  5GAN 5;  4WJ3 M;  2M0O A;  5CO7 A;  4OVA A;  3JCM J;  2K2V A;  2ZXF A;  2EJF A;  4UC4 A;  4P71 A;  4OB3 B;  1VQP T;  4M75 C;  3OYA A;  1YB3 A;  3CC2 T;  4M7A D;  2EJ9 A;  3JCM c;  3JCM b;  5IT9 E;  4EMH A;  2JVV A;  1QVG A;  3MHX A;  2RHS A;  1QVG S;  4CS2 A;  1SES A;  4GY5 A;  1H3Z A;  3HTZ A;  1ATI A;  4BB7 A;  4CS4 A;  4XTU A;  4K88 A;  4XTY A;  4ZTF A;  3TRE A;  1BIB A;  5AYF A;  2Q7E A;  5CQX A;  1R8O B;  2G4C A;  4YDQ A;  4PLL A;  3VJP A;  1KQS A;  2CJ9 A;  3HPW A;  3OYB A;  4G84 A;  5CKE A;  3QG1 A;  3KFU A;  3HXW A;  3JCM e;  1NPP A;  4NL2 A;  4PHC A;  2AHJ B;  2RHS B;  4RQE A;  4H2X B;  2RI3 A;  3X20 B;  2V8I A;  2GF7 A;  1FWZ A;  3A8M B;  4H2U A;  3E9I A;  1IZ6 A;  4OGE A;  3E9H A;  4KUL A;  3ICA A;  1Y96 B;  1Q86 U;  2ZZG A;  1SER A;  3VUZ A;  3HXZ A;  3GNG A;  3QO3 A;  3SD4 A;  4DQ2 A;  2Q5H A;  1YI2 A;  1ZBX A;  2DXT A;  1NZ9 A;  4C0D C;  4F7U A;  4P5N A;  1QW1 A;  3QTC A;  3RGL A;  4MML A;  4M7D E;  2DKG A;  2BIV A;  1UB4 A;  2LQ8 A;  1N6A A;  5GAO r;  4C0D B;  3QYH B;  3PCO B;  4J83 A;  2QQB A;  11AS A;  2CS7 A;  3G6E T;  3V8J A;  5FRN A;  2E41 A;  3NEN A;  3CD6 T;  4JS5 A;  1USY C;  3CBP A;  1BYM A;  3S3O A;  2E10 A;  5A2Q E;  4JRI A;  2Q5I A;  1C0A A;  5HK0 A;  2YLB A;  5GAM d;  1N9W A;  1QVP A;  2ZT7 A;  2X4J A;  5FRM A;  2ZPH B;  3WXM B;  5GAN 3;  4HCZ A;  2RJE A;  1OZ3 A;  3ASK A;  2QI2 A;  3T9N A;  2VXE A;  2F5T X;  2C7I A;  2WSC E;  4XTZ A;  2I2L A;  5GAN g;  1UGQ B;  1RIQ A;  3REX A;  3URG A;  5I21 A;  1ASZ A;  1LJO A;  3V7C A;  1KD1 U;  2EAY A;  3FJP A;  1PSF A;  3QII A;  3QJY A;  3WQZ A;  4O6J A;  2CKK A;  1YJ9 T;  1EVL A;  4HCB A;  1WNL A;  2QTX A;  3QZ5 B;  2EQU A;  2K5L A;  2K4Y A;  3TEG A;  3FC3 A;  1U8R A;  2XDP A;  2MI6 A;  2RD1 A;  3RES A;  1YIJ T;  3CBM A;  2DDZ A;  3OYY A;  4H02 A;  3IKL A;  4NCX A;  4OF1 A;  3OS0 A;  4N4H A;  3HXV A;  5K1X A;  3QZ9 B;  1OZ2 A;  3VUB A;  4TWA A;  2JZ2 A;  4XQ3 A;  3OBW A;  2QHT A;  2E65 A;  4JLI A;  2RA2 A;  3OYG A;  3HFZ B;  4HKE A;  3LH0 A;  3E1S A;  2E70 A;  1JJ2 S;  2FVU A;  2NLU A;  2A8E A;  2OTJ T;  4Q6G A;  4LDW A;  4C0G A;  2XHC A;  3A74 A;  2QHS A;  5GAN 4;  2CZ0 B;  1M8V A;  4M75 A;  4PKC C;  1VUB A;  2KMT A;  2L89 A;  3M54 A;  5EG2 A;  4CRI A;  4BY6 C;  4IUQ A;  4R55 A;  3EAE A;  3G6E A;  1YFS A;  1VQ6 A;  3S3N A;  5GAO l;  3M58 A;  4BE0 A;  4M77 G;  2ZNI A;  4DOW A;  2DIG A;  1EQR A;  4BY6 B;  4A4K A;  3A5Y A;  2XG8 D;  3FLG A;  3AHU A;  4M77 B;  4XU3 A;  4O2D A;  5I2S A;  4TVY A;  4FSX A;  2C06 A;  4YRE A;  1MGQ A;  3SDZ A;  1B34 A;  5GAO p;  2G3R A;  1YCY A;  4C92 A;  4ELY C;  2OTJ A;  3HXY A;  4M77 D;  1WQW A;  3CME A;  1M9S A;  4R56 A;  3RKY A;  1Q81 U;  1KQ2 A;  4Q5W A;  3CCJ A;  1BKB A;  3CCM T;  4MDW A;  2AMC B;  1O75 A;  5J3B A;  3QSU A;  4M7A C;  4KUD K;  2ZPE B;  4LDY A;  3QNE A;  3M4P A;  3RIR A;  1S72 A;  4C5H A;  3CMA A;  2EWN A;  4LVJ A;  4M7D C;  3JCM V;  3TUP A;  3HKS A;  3DKM A;  3GLX A;  4NS5 A;  2VXF A;  5C0M A;  4YCW A;  4KR2 A;  2JUF A;  3IG2 A;  4F7U G;  5ELO A;  3A5Z B;  4QQG A;  2ZPG B;  4JUV A;  1Y07 A;  5CVI A;  5DM7 R;  3BDL A;  4HT8 A;  1QVF A;  2E6Z A;  4J6Y A;  4YRC A;  3RMQ A;  4F7U B;  5GMK l;  2OTL A;  5GMK e;  1BI3 A;  2ZIN A;  3CCE T;  3L2R A;  2XDD A;  2FHD A;  5D6Y A;  4IUP A;  4A4F A;  5LJ5 d;  2QQR A;  4P3O A;  4PJO A;  2P4T A;  1B7Y B;  5GAM h;  2FL7 A;  1X54 A;  3MCA B;  4C92 G;  2ZTG A;  3JB9 I;  1KQS S;  2LVM A;  3HHT B;  3CCE A;  4XAX B;  3PGG A;  1EFW A;  2P0K A;  3CCQ T;  2XI9 A;  5GAN e;  3CD6 A;  2E5A A;  3QBY A;  4ME7 A;  3QO7 A;  3CCR T;  4C0Z A;  1X55 A;  1N9R A;  1PYS B;  3OMC A;  4A54 A;  2XK0 A;  2M16 A;  1M5Q 1;  5ELN A;  1X75 C;  3CCQ A;  1ZQ1 A;  1G3W A;  2XGT A;  1WJQ A;  1BBU A;  3MP6 A;  3OYH A;  4IUR A;  1V29 B;  1Q81 C;  1OI1 A;  2L5Q A;  5DLQ E;  1VQM T;  5J26 A;  3L4G A;  4JRQ A;  1YI2 T;  1KMM A;  4P72 A;  4E7L A;  4CS3 A;  3SFM A;  2MAM A;  4YRK A;  4YYE A;  2ZNJ A;  2KVQ G;  3F70 A;  4N0A A;  2P0P A;  3QKJ A;  5KE2 A;  4C8Q B;  1BIA A;  1VQ4 T;  1GXI E;  3A5Z A;  1G5V A;  5LL6 S;  3HXX A;  5LJ3 g;  4IUT A;  1LYL A;  4YRT A;  3OMG A;  4JLG A;  3I7F A;  4P74 C;  4C8Q G;  1DJ7 B;  1VQN A;  4C8Q C;  2RI2 A;  3LC0 A;  2CGH A;  3OYN A;  3EFS A;  2O4X A;  4EO4 A;  4XTX A;  3CXC A;  5CKH A;  1FYF A;  3A7R A;  5FU6 C;  1KG1 A;  2IVW A;  2E64 A;  4OB1 B;  5LJ5 h;  5CCA A;  3CPW A;  3UT1 A;  5DY9 A;  3J81 E;  3MET A;  3OY9 A;  2BKD N;  3QXE B;  3ZEH A;  3ERR A;  2E5Q A;  4CI0 C;  1WYD A;  2FB7 A;  4TVR A;  1KOG A;  4CH3 A;  2L8D A;  4BD3 A;  3RMS A;  4C5E A;  2XD0 A;  3LWI A;  4YRG A;  4BI4 A;  4OGC A;  1VQ8 A;  2CZ1 B;  3JRZ A;  3KBG A;  3HRS A;  1E24 A;  1HXD A;  2ZR3 A;  4LD9 K;  1NJ5 A;  3QUI A;  4ZN3 A;  3X26 B;  3C95 A;  3OYI A;  3C12 A;  4M75 D;  4II1 A;  2PU9 B;  4QVD A;  2RJD A;  1K9M C;  2JTM A;  4RMO A;  4ZGE B;  2DXB A;  1M1K C;  4F7U F;  4C8Q A;  2ZT6 A;  4ZTU B;  1W2B A;  1WGS A;  5C53 B;  1NE8 A;  3TEH B;  5GAO n;  3CCR A;  4ZTZ B;  3GPL A;  1Y71 A;  4YCV A;  1H4V B;  2ZZD A;  3JB9 J;  2QXF A;  5GAN f;  2RJC A;  1EOV A;  1VQ5 A;  1NPR A;  3MP8 A;  5FLX E;  4C92 E;  5K1P A;  5GAM e;  2MF2 A;  4D6W A;  2EFI A;  5GAM j;  2VGN A;  1X56 A;  3A7A A;  4RQF A;  3HXU A;  2KQW A;  4LVL A;  2DTI A;  3C94 A;  3SB2 A;  3VQY A;  1NJI C;  4CH4 A;  3IAL A;  3M5A A;  3P8D A;  3HSB A;  2DO3 A;  5KCH A;  5IN1 A;  5CIU A;  3PTA A;  1VQ4 A;  1XOV A;  4BWA A;  1NNH A;  2I4O A;  2RO0 A;  4C92 D;  4M78 A;  2PME A;  1O9S A;  4HT9 A;  3UFG A;  3TEE A;  3A31 A;  2P5I A;  4E51 A;  3UH0 A;  3PNW C;  1G51 A;  1EIY B;  3GIB A;  3KUF A;  2DU5 A;  2ARS A;  3G71 A;  4QVC A;  4P72 C;  3QJ6 A;  2K5I A;  4P71 C;  4RG2 A;  4PJO G;  3JB9 H;  3NTH A;  5LJ5 j;  1VIF A;  3NFC A;  3MF1 A;  2P0L A;  3I56 T;  4UPA A;  5LJ5 g;  2IY5 B;  2QHV A;  4M77 A;  3CCS A;  4M77 C;  4Y91 A;  2DK3 A;  4HVC A;  4M7A F;  4J7I A;  1W4S A;  3Q1J A;  2RHX A;  1ADJ A;  2K3Y A;  3P8B B;  3OS5 A;  2DD5 A;  1I4K 1;  2K57 A;  3JCM X;  4J7F A;  4X5O A;  4M7A B;  4M78 E;  4C5G A;  3M9Q A;  3QYG B;  3MP1 A;  3HY1 A;  4HA8 A;  5A0G A;  2QQ9 A;  1Y7X A;  1M1F A;  3QO5 A;  2ZT5 A;  3IKM B;  4QQ6 A;  3ER0 A;  2V8K A;  4ZGJ B;  3RKW A;  2O01 E;  2DVE A;  4M7D B;  3PT9 A;  4A4G A;  1JBM A;  3HRT A;  3LWH A;  2X4W A;  3X28 B;  3A8O B;  4P3P A;  4J5Y A;  3CME T;  4B9X A;  4PLI A;  1K8A C;  3NEM A;  1VQ6 T;  3INZ A;  2Q7H A;  4XK8 E;  4QW2 A;  3OYK A;  2CYZ B;  2CJA A;  2ZGW A;  3G1Z A;  2RJF A;  4RG8 A;  3H8Z A;  2ODR C;  5GAO m;  5GAM g;  4L87 A;  3JCM h;  3JB9 G;  2RHZ A;  4L5G A;  4LNS A;  1W2B S;  3FB9 A;  4XU0 A;  1YJW T;  3I55 A;  1G3S A;  1UEB A;  3CC7 A;  2DTH A;  4ATO A;  2WAC A;  5CKF A;  2DZ9 A;  3ME9 A;  5FU7 B;  2FYK A;  4C92 F;  2PUK B;  4RCC A;  1Q82 U;  3JCM d;  2QA4 T;  2CZ7 B;  3A8H B;  3RL6 A;  4Y28 E;  1M1G A;  1VQZ A;  4JS4 A;  3A7U A;  4Q15 A;  1X01 A;  4LDX A;  5FU7 C;  3HL8 A;  4VUB A;  3PCO A;  1YJN T;  4M75 G;  3L2V A;  2L3R A;  5IAY A;  1KC8 U;  4BAC A;  3OB9 A;  2LDM A;  2DEQ A;  4M77 F;  4FM4 B;  4M7A A;  4K87 A;  4EDU A;  2PQW A;  3C4S A;  1Q7Y U;  4M7D D;  1VQK A;  4YRF A;  4A4H A;  3UGT A;  3A8G B;  2RHI A;  2RI5 A;  4J8O A;  1NJ8 A;  1UGP B;  5GMK i;  4OMF B;  3CCS T;  3HRI A;  3CCL A;  2R5A A;  1H4Q A;  2H3J A;  4C92 C;  3OBY A;  2A3L A;  5I2M A;  1Z7N A;  1G3T A;  4KT0 E;  2EL9 A;  4N0A C;  4IUU A;  2HBP A;  1YBY A;  2MWO A;  5F5W A;  4FT4 A;  2I4M A;  2ZIO A;  3H6Z A;  4H2V A;  1VQO T;  1H4T A;  2ZPI B;  4C0F A;  3VU3 C;  3HY0 A;  4LVI A;  2R5M A;  4YRO A;  2PVG B;  1G3Y A;  2RHY A;  2ZCE A;  3VQX A;  3LSQ A;  5HGQ A;  1QP2 A;  1UGS B;  3GNF B;  5FU6 B;  4KQE A;  4GLK A;  3BDU A;  2EQJ A;  3JCM g;  3E9G A;  4V2S A;  3P8H A;  1VQ5 T;  4WF2 A;  2R57 A;  4MZT A;  1VQ9 T;  2ARU A;  5C51 B;  3HFN A;  2PVO B;  3VQW A;  2LC4 A;  2KY9 A;  2VC8 A;  3J7A F;  1VQL T;  4M7D A;  1QP3 A;  3MEV A;  3WVE B;  1M4Z A;  3OS1 A;  1SRY A;  5LJ5 e;  1SSF A;  2VGM A;  1NYQ A;  3PFS A;  3OSV A;  3X24 B;  1B70 A;  4EMK C;  4EPC A;  5LJ3 j;  2JNG A;  3LGF A;  4J15 A;  1NJI U;  3OS2 A;  3PIP A;  1B8A A;  1D3B B;  3JSC A;  3QPH A;  2VUB A;  3OW2 S;  2OAU A;  2KAF A;  4NL3 A;  2X4Y A;  4P3N A;  3OA6 A;  4RDX A;  2DPP B;  3P8Y A;  4YP0 A;  1YIT A;  4AH6 A;  4H2T A;  1QF6 A;  4EMK A;  3UPU A;  1JJ2 A;  1JJC A;  1Q7Y C;  2QA4 A;  4YTL A;  1NYR A;  1M90 C;  4M77 E;  1K8A U;  2B8A A;  3FEO A;  2RK2 A;  4FU6 A;  4HWR A;  2E6N A;  2DIQ A;  1Q82 C;  4YRQ A;  5M9O A;  4YRJ A;  1NJ2 A;  3KXT A;  4TQD A;  3L2W A;  4WI1 A;  1PSE A;  1U1S A;  3PIO A;  4XU2 A;  2QQS A;  1WLE A;  4E7J A;  5DLO A;  1KHC A;  1YGB A;  1ZHI A;  4FT2 A;  2LCC A;  3BFM A;  3X25 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...