2EJFA

Crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
235
structure length
235
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 65
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ejfA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ejfA01
4M77A 4M7AD 4M7DE 1EIYA 1LOJA 4M77G 1YGBA 4HWRA 3FIFA 4EMKC 3NEMA 4YRTA 1G5HA 4M78B 2E65A 2QHSA 2EL9A 4YRKA 5I21A 3INZA 4YP0A 3JCMV 1E22A 2DU5A 1X2GA 4C92F 1WU7A 3V8LA 2ZNJA 3JCMP 4YRFA 3RL6A 2CGHA 4RCCA 3JB9G 4YRRA 4C8QE 4WF2A 3FJPA 1LNXA 5GMKe 4HVCA 1H641 1M8VA 1B7YB 3A31A 2ALYA 3A32A 4H2UA 4OLFA 4M7DD 1H4QA 5GANh 1ASZA 4LNSA 1C0AA 3PZCA 3VQVA 2CJ9A 3JCMe 2DU7A 3HSBA 1X01A 1L0WA 1U1SA 4AH6A 2DJZA 3JCMg 3BJUA 4YREA 2E5AA 3BW1A 3DSQA 5GAN6 4PG3A 4XTUA 4C92A 5LJ5e 4C92G 2YLBA 4A54A 4C8QD 1Y96A 5LJ5j 4YRGA 1PYSB 5LJ5g 2ZR2A 4JRKA 4M78C 2ZZGA 4M7AB 4XQ3A 2RA2A 4H2VA 4M78E 3HFZB 3A5ZA 5GAN7 2ZZEA 3TEGA 4PJOE 3PGGA 4F7UF 4H2TA 3HXYA 2P5IA 4RQFA 5GAOl 1USYC 4Q15A 5GANj 2IY5B 2EAYA 2E1HA 3JCMf 5GAMe 4NOYA 3SWNA 2I2LA 3HXVA 1RIQA 3HFVA 4HWPA 3JCMb 4J6XA 3BFMA 2YLCA 5C53B 3HY0A 3AHUA 1BBWA 3HTZA 5LJ5f 1G51A 3REUA 5ELNA 4M7DB 4RCBA 2ARSA 4XEOA 4M78D 1JJCB 4QVDA 4E51A 5GAMd 4PJOD 1YFSA 2ARUA 4F7UA 4X9DA 5GANf 2ZT8A 4F7UG 1BBUA 1N9SA 1X56A 3RACA 1KQ2A 2QHTA 4TVAA 1B76A 4HT8A 2VXFA 4M7AC 3RGLA 1EIYB 4C8QB 2Q7EA 2EJGA 3TEHA 5GMKl 3HXWA 4M75E 3HRKA 4HWSA 4CH5A 3VQXA 4P75C 3HXUA 2ZT6A 4BW9A 5GAOq 5GAOm 2Y90A 3L2ZA 4WJ3M 1EVKA 1NNHA 4KQEA 3V7CA 1NYRA 3JCMJ 3PCOB 4YYEA 1NJ6A 3VBBA 3GIBA 3MEYA 3JCMW 1BIAA 1WLEA 3A74A 3NENA 1I4K1 4XTYA 3FB9A 5LJ3j 2RB6A 1SERA 5GAN8 2DZCA 4M7DC 3QUIA 4PNOA 3JCMc 5GAOr 2ALYB 3QHSA 4JLIA 5LJ3g 4YRSA 2Q7HA 4M75D 3NETA 1YFRA 4P71C 4ZTUB 2DXTA 1ADYA 2XGTA 3BY7A 4PJOB 4P73A 1B34A 2AKWA 1EOVA 4K88A 4C92B 4C8QC 1LJOA 4BWAA 4XU3A 1W66A 4J6YA 3RKWA 4M77E 1D3BA 3HFNA 2AMCB 3EFSA 5GMKm 4G85A 1H4VB 5LJ3f 1M5Q1 2RD1A 4H2WA 4H2XB 4YRJA 5K1XA 3A7UA 3ERRA 2J3MA 5GAN2 2ZIOA 1Z7MA 4A53A 1NJ1A 2C7IA 1I5LA 4P3NA 3P8VA 4UP9A 2XTIA 3VQWA 3A7RA 3JCMQ 1NJ2A 3W3SA 4M77D 5GAN4 1KMMA 3SB2A 4DPGA 4XU2A 3V7SA 5GAMh 4PJOC 2ZR3A 4M75B 3JCMd 2ZIMA 4P74A 4CS2A 4J5YA 4YDQA 2FB7A 4XTXA 4L87A 2ZINA 4CH6A 1WYDA 4O2DA 4TWAA 3UGTA 4K86A 4M78G 1YCYA 4JUVA 5GANe 4KR3A 3JB9D 1KMNA 4YRCA 4C92E 4KR2A 4TVAB 2RHQA 3JB9H 3M4GA 5GANg 2EJ9A 5LJ5d 3RKYA 4YCWA 2ODRD 4NCXA 4H02A 2RHSB 4TTVA 3TEHB 3RKXA 1G5IA 5C51B 4M7AF 3RESA 3L1AA 3UGQA 4CH4A 4RMFA 3MF1A 5GAN3 3ICAA 1J5WA 3QSUA 1NJ5A 5GANd 4H2SA 1E1TA 1H4SA 4J15A 2ARTA 3HRIA 3V7RA 2P0LA 4YRLA 1HXDA 4XU1A 4C92D 3E9IA 2Q7GA 2PMFA 2DTOA 2Q5IA 2I4MA 2E41A 4M77B 3V8KA 4M75C 2DTIA 1B70A 2CIMA 1SRYA 12ASA 1FYFA 4M7DF 4WJ4A 3LSSA 4J6WA 4M7AA 3QO8A 4M7AG 3HFZA 3RIRA 4F7UE 2DKGA 2EWNA 3QNEA 3CMQA 1NYQA 1X2HA 4XTWA 2IY5A 1NJ8A 2YHTA 3M4QA 5F5WA 3P8YA 2CJAA 2E3CA 1WQ7A 4C8QF 2I4LA 5LJ3e 1HK9A 4N0AA 2QHUA 3I7FA 5ELOA 3WQZA 4YCVA 5GMKi 2E10A 1EQRA 3P8TA 2J3LA 3G1ZA 4M7DA 3MF2A 5C52B 3RUXA 4M7DG 4V2SA 4P72A 1B8AA 4MMKA 4XTZA 4CH3A 1EFWA 1TH7A 2C8MA 4EMKA 5GMKh 4EMGA 4M77C 3LC0A 4CS4A 5LJ3d 5GAOp 1Y96B 1BIBA 1Z7NA 3IKMB 3EFRA 11ASA 1KOGA 4TVYA 3L4GA 3JCMh 1X54A 5E3IA 4C8QA 4P73C 4C8QG 2DZ9A 1QE0A 4M78F 2PMEA 4Y91A 1E1OA 2ZCEA 3A5YA 4PJOF 4EO4A 2RHQB 4DQ2A 5LJ5h 2DEQA 5KNNA 2ODRC 1LYLA 4XU0A 3PCOA 3SWNB 2RM4A 2I4OA 2ZT7A 2EJFA 3TUPA 3RF1A 3IG2A 2HNIA 3HXXA 4HWTA 3UH0A 2ZTGA 4HT9A 5K1PA 4EMHA 4PHCA 2G4CA 4YRMA 2DDZA 5GMKj 1IL2A 2FYKA 2DQ3A 1WPYA 1YB3A 3R07A 1SETA 1I8FA 2ZGWA 2ZNIA 2VXEA 4NL2A 3JB9J 3HFOA 4C92C 2DXUA 1ADJA 4M78A 3IALA 1U1TA 4F7UB 3UFGA 1JRIA 2ZXFA 4PJOA 4ZTZB 4PJOG 1QF6A 3M4PA 1E24A 3NELA 3OD1A 3E9HA 3QO3A 1KQ1A 4MMLA 4P74C 1B70B 3HY1A 1USYA 4ZIBA 2DTHA 3JB9I 1N9WA 2Q5HA 2ZT5A 4WI1A 2AMCA 4EX5A 2I4NA 4YRQA 2QTXA 4M75F 1B7YA 2DVEA 3VU3C 4H2XA 3SWNC 5CAIA 2QHVA 4YRIA 4X9CA 4X5OA 4UPAA 4YRNA 1ASYA 1WNLA 5GAMj 1JBMA 4Q6GA 3V8JA 5GAOn 3IKLA 5GAMg 2K57A 4P3PA 1I81A 4TQFA 4TVWA 5DY9A 2ZZFA 3LSQA 1SESA 3BDUA 3QTCA 4JRIA 1PYSA 4RQEA 1MGQA 4H2YA 4M75A 1B34B 2AKWB 4YCUA 1VQZA 1N9RA 4M75G 4EMKB 5LJ3h 3JCMX 4HA8A 4HWOA 4P3OA 1X55A 1HTTA 3QO7A 4P75A 3KFUA 5GAMf 1D3BB 4RDXA 3L4GB 4TQDA 4M77F 3QO5A 3REXA 2DQ0A 2RHSA 2E64A 4UP7A 4M7AE 1GGMA 4G84A 4UP8A 1YFTA 5GAN5 4XTVA 3A7AA 1HC7A 3VQYA 2CJBA 4OP0A 1H4TA 4N0AC 1JJCA 3JB9F 4YRPA 4NL3A 5HGQA 2JN0A 4YROA 4CS3A 4P71A 1EVLA 3RERA 3HXZA 4XEMA 2VC8A 1ATIA 4YPFA 4K87A 1WQWA 4P72C 4QVCA
chains in the Genus database with same CATH superfamily
2X4YA 4IURA 3VJPA 1YJNT 1EIYA 3MO8A 4OVAA 4HWRA 3FIFA 3ZFJA 3NEMA 4BI8B 3CCLT 4MDXA 2QHSA 3CCQQ 4BDZA 3PNWC 1OPKA 4YP0A 1X43A 7AT1B 1K76A 1W70A 2E5KA 4XK8E 3RNJA 4YRFA 4J9EA 4Z8AA 3JSCA 2CGHA 4YTLA 4ORZA 3OYCA 4KUDK 3KUFA 4RTYA 2SRCA 3A31A 1WHKA 1NEGA 2ALYA 5KYXA 4H2UA 4AMCA 4M7DD 5GANh 2RJEA 1ASZA 2RI5A 4DEYA 3OS0A 4RTTA 4JDSA 3VQVA 1YJNA 3I5RA 2DU7A 1X01A 1U1SA 1VQOQ 2DJZA 2G3RA 3REBB 3WXMB 3CCUA 1Z9ZA 3BJUA 2FL7A 2CZ1B 2KMTA 2ROTA 2LX7A 4XTUA 4C92A 3QJYA 3CPFA 1RAIB 2LNVA 2YLBA 4A54A 4C8QD 5A0GA 4J9CA 5LJ5g 1K73C 3CD6A 3J7AF 4H2VA 2HDAA 3HFZB 5L23A 4R55A 3OY9A 3CCQA 3I9QA 4RQFA 4FU6A 3VS4A 4Q15A 3DKMA 3QKJA 1ZUYA 3CCVA 2E1HA 3UF4A 2A28A 1MUZA 2LCCA 2L3QA 4LVKA 2I2LA 4ELYC 3HFVA 3JCMb 4LVLA 2X4WA 2YLCA 1KQSS 3HY0A 1QCNA 3CCEQ 2PNIA 4B9WA 4FW2A 2CP7A 3E9GA 2LQWA 3VS3A 3MP1A 1M2VB 4QQ6A 4DOWA 1VQOA 3J81E 4PJOD 2DO3A 2WSCE 1Y57A 3QYHB 1YFSA 3HKSA 2GF7A 1CSKA 4X9DA 5GANf 2ZT8A 4F7UG 1X56A 1FMWA 2M0YA 1ZX6A 1UTIA 3OW2A 1UGQB 1SSHA 1EIYB 1ZBXA 2X4XA 3JV3A 4OB0B 2Q7EA 2BZ8A 2XICA 2HQXA 5GMKl 4RTWA 3M4YA 4M75E 3HRKA 1K73U 4CH5A 3VQXA 4E7JA 4BW9A 1YJ9T 2ZT6A 5GAOm 2Y90A 3X24B 1EVKA 3V7CA 1NYRA 4A4KA 1AZGB 4YYEA 1PSFA 1NJ6A 1SG5A 3MEYA 3HRSA 1BIAA 3URGA 2JTMA 3A74A 2J6OA 2B8AA 3SHWA 2QQBA 5LJ3j 2RB6A 3OA6A 3QUIA 4PNOA 5GAN8 5KYXB 2ALYB 2KSSA 2YRDA 3CCEA 2WACA 3CXCP 1WYXA 2Q7HA 1IB8A 6AT1B 3NETA 4P71C 4ZTUB 2GFUA 3ME9A 3J80E 2CS7A 1KQSP 2HMAA 1M90R 1HD3A 3VYGA 3L2UA 2AKWA 4OF1A 4K88A 4C92B 2FO0A 2DBKA 2QG9B 4K11A 1GCQA 1YI2A 1W66A 4M77E 1VQPQ 4TVRA 2L3SA 5IN1A 4II1A 1M5Q1 4LDXA 1IREB 2M1HA 2OTJT 4H2WA 2A3LA 2NUTA 1IXDA 2X4JA 2RHXA 1RAHB 1XNIA 4HXJA 2J3MA 3DLMA 1NJIR 1I0CA 1E7OA 1WLPB 2IVWA 2VUBA 5DM7R 2FG0A 1VQPT 1Y0MA 2CKKA 4UP9A 2XTIA 3VQWA 3VYHB 2GQVA 1NJ2A 5FWCA 1KMMA 1UGPB 2KNBB 2DVJA 3ULRB 1WXTA 3E19A 3OSSC 5GAMh 1M1KU 1AWOA 2RF0A 2FB7A 1AHJB 1Q7YC 1M3AA 4MDWA 3UGTA 2MWPA 4JUVA 2CP3A 2RHQA 1QVPA 3JB9H 4RTUA 5GANg 2QASA 4CI0C 2FEIA 2HKQB 3VRZA 4YCWA 2ODRD 2PU9B 2VWFA 1K9MR 4J7FA 2QA4Q 3UPUA 2CYZB 3RESA 1QWFA 2JZ2A 1MMDA 5GAN3 2YT6A 4PJJA 1KFZA 4E47A 2DRKA 5KE2A 5KCOA 3EHQA 3H0FA 1H4SA 2EYWA 1D1AA 3PIOA 2P0LA 2YWWA 1PM3A 2QA4T 2Q7GA 2LQKA 1LCKA 2PMFA 4A4FA 2DTOA 2I4MA 4PK4A 3V8KA 3PTAA 1Q81C 2DTIA 1B70A 4M7DF 2F5TX 3TQ7P 4WJ4A 2DILA 1W6XA 3QO8A 4KGVB 2GBQA 1X6GA 3QNEA 5I2SA 1OQKA 1BYMA 3I56Q 1GBRA 4IUPA 2C06A 1Q7YU 2LVMA 4BI3A 1NJ8A 3FEOA 1SSFA 2ECZA 2QEXQ 2HSEB 1PD0A 4IKFA 3HHTB 4C8QF 2KRSA 3G71Q 2KE9A 3I7FA 4YCVA 2NUTB 1RABB 4DBHA 1PSEA 1F1BB 1TS9A 3I56T 3UT1A 3OYHA 1K8AR 5A2QE 3EG9A 3G1ZA 1S1NA 3MF2A 4AFZC 3RUXA 4V2SA 2QEXT 1T0JA 1QVFP 1RAEB 4XTZA 5FU6C 4CH3A 2IIMA 5IXFA 3VUBA 2EQIA 3GOXA 2C8MA 5I2MA 3G71T 5CKBA 4KGXB 1Z7NA 4HCBA 4OGCA 2D0NA 4O6JA 3S3MA 1ZA2B 11ASA 3L4GA 3JCMh 5E3IA 2FRWA 3SDZA 1W2BS 1Q81U 3R6OA 1QE0A 3LYIA 4PFZA 4LUEA 2KXCA 1VQ5T 4Y91A 1GCQC 1S72Q 2QGFB 4PJOF 3CC4Q 2RQRA 2RHQB 3OBWA 3I56A 5KNNA 1M3CA 4XU0A 1GFCA 3PCOA 2ZT7A 1KK7A 2EJFA 3MCAB 2QEXA 3TUPA 1CKAA 1XTDA 2HNIA 2P0KA 3QYGB 2QQRA 4HT9A 4E7ZA 1TUDA 1VQ4Q 3G71A 1WXBA 1IL2A 2DQ3A 1S72T 1NPRA 4A4GA 1YB3A 1QLYA 5FRMA 1C0MA 1I8FA 2LJ1A 1KSWA 1ZSGA 2DXUA 3LW5E 2O31A 3M58A 2ZXFA 2NWMA 1WGSA 1QF6A 3OD1A 2CZ6B 2V1QA 1KQ1A 2HAXA 1VQMQ 1B70B 1NPPA 2EYXA 2DTHA 3JB9I 1MV0B 1SRLA 2AMCA 2PUKB 2I4NA 2K5IA 1B7YA 5HK0A 5IHKA 3CXCA 2H8HA 2DVEA 4H2XA 1S72A 5CAIA 2QHVA 2CP6A 1PRLC 2MF2A 3CC4A 1RADB 4UPAA 1BI3A 4YRNA 1WNLA 1X69A 1W2BP 5GAMg 2KK4A 2AK5A 4TVWA 1I81A 1IHWA 1RI0A 4HVWA 3VS2A 3M0TA 2DJQA 1VQ4A 3FC3A 1M27C 1ACMB 2CZ0B 4FT4A 3EG9B 1PYSA 1UHCA 4D8KA 4RQEA 1QMCA 4AFUC 5J26A 4M75A 2EYQA 2A08A 3CPWP 2EKOA 1UGVA 1U3OA 2EW3A 5LJ3h 2YDLA 1QKWA 4HWOA 1K73R 1VQKQ 4AFQC 1UB4A 1D3BB 2RK2A 5CK9A 3L2RA 4RDXA 2A37A 3L4GB 1VQMA 1IHVA 3QO5A 3TEEA 2ABLA 2LZ6B 3CCMA 4UP8A 4RTVA 3PMIA 1YFTA 2BUDA 1X75C 3VQYA 2RNAA 1JJCA 4MZTA 1OPLA 3EFOA 4YROA 3DB3A 1EVLA 3RERA 3E9FA 2X51A 2E4HA 4YPFA 3EG2A 4OMFB 4AT1B 2MI6A 2MPXC 4M77A 4M7DE 2P4TA 1YGBA 2PUOB 3CC7T 4YRTA 2EGEA 1G5HA 1AD5A 2EL9A 1KD1C 5I21A 1YWPA 3M5AA 5GJWB 1ZUUA 1E22A 2KVQG 2DU5A 1AWWA 5KYNA 1AOJA 1VQKA 2KXDA 5FLXE 3JB9G 1MNDA 1N8RC 4YRRA 4C8QE 2OAUA 1AWJA 1NG2A 3FJPA 1QVGP 1LNXA 4IUQA 5GMKe 4HVCA 1B7YB 1NJIU 3A32A 3O8VA 3PZCA 2AHJB 1BCOA 1WXUA 4QT7A 3HSBA 2XMFA 4AH6A 3JCMg 4ZN3A 3EG1A 2E5AA 3BW1A 1JJ2A 1PNJA 5GAN6 3VV0A 4PG3A 1I5OB 2EQKA 1VYTA 3G4ST 5LJ5e 2R5MA 1Y96A 3P8DA 1PYSB 4CC4B 1YP5A 2HKNA 2ZR2A 2QQ9A 3GPLA 2DEUA 4M7AB 4XQ3A 4BI4A 4D6WA 5CO7A 1BI0A 3A5ZA 2XG8D 3PT9A 1GBQA 2DIQA 4PJOE 1ZSZA 3OB9A 3PGGA 4F7UF 2BZXA 2KT8A 2P5IA 2JOYA 4JPBW 2J06A 5GAOl 1K9MU 1KD1U 2MYSA 2LCLA 1QVFA 1TG0A 1MV3A 1FMKA 4NOYA 3SWNA 5CKFA 1RIQA 4HWPA 2XIDA 3BFMA 3OYJA 4O5VA 5LJ5f 2P84A 1G51A 2E70A 4JJNK 3P8BB 1Q86C 2ARSA 4M78D 1JJCB 4E51A 1K0XA 1EZZB 4ZNXA 1HSQA 1G83A 2LNHB 3H41A 1SHGA 1N9SA 1KQ2A 2EQUA 5L8RE 1OEBA 2CUBA 3S3OA 2HEQA 4M7AC 2DAQA 3RGLA 4OB2B 1Q7YR 2EJGA 4FYYB 4HWSA 4FSSA 1JEGA 1M3BA 5GAOq 3RMSA 1WI7A 3L2ZA 3GNFB 5HY6A 1WFWA 4BY6B 3CCLQ 4DBQA 2NLUA 2VKNA 3F70A 3JCMW 4A63B 1I4K1 4JRQA 2KQWA 1K1ZA 1K8AU 5GAOr 3QWXX 5LJ3g 1VOMA 2P4RA 2RHIA 4DBFA 2QDLA 3OYFA 3NMZC 5KYWA 2BE9B 1YFRA 2DXTA 2EBPA 4BDYA 1M1GA 1H3ZA 2H3EB 3CC2T 1Q81R 4FSXA 2YUQA 1N5ZA 4BWAA 1JO8A 4XU3A 3RKWA 3GP8A 2JNGA 4M4ZA 3EFSA 4PFPA 1VA7A 1BU1A 2GQIA 4YRJA 1ZSZB 3QG1A 3U23A 4BY6C 3ERRA 3ZBDA 4RTXA 2KY9A 2QYZA 1Z7MA 1B3QA 3CEYA 3CCLA 1D0YA 3CPWA 1I5LA 3I55T 3P8VA 3MEAA 2K79A 2RO0A 2PTKA 1NLOC 5CR2A 4J7IA 4OMOA 1ZHIA 4AG1C 4XU2A 2EPDA 1P92A 2D1XA 3V7SA 1M2OA 4IUTA 2ZIMA 4CS2A 5IHNA 4XTXA 4L87A 4CH6A 4TWAA 4FL6A 5GANe 3JB9D 4KR2A 2WSFE 3OYNA 2ESWA 1D1BA 2MWOA 3G6EQ 2A7YA 2FVUA 2I0NA 2CH4W 2ZPGB 4E2FB 2RHSB 4TTVA 4DBRA 2JJ9A 3OS2A 5FROA 1ZSZC 3G1JA 2V8JA 1EX4A 2A0FB 1O75A 2KROA 3L1AA 3UGQA 1WDXA 4RMFA 1J5WA 5GANd 1D1CA 2DK3A 4OMMA 4H2SA 1ZLMA 1QCFA 4ZGJB 3G6ET 1KC8C 1QP2A 3N5BB 3HRIA 4XU1A 2ZPIB 1YJ9Q 2HBPA 4L6V5 1A0NB 2XU8A 3OYKA 2E41A 1WHLA 2XI9A 2KYBA 4FYWB 3OYMA 1SRYA 1TUGB 12ASA 1QVGA 3EGXA 1WIEA 4J6WA 2CP0A 2JM8A 4AFSC 4M7AG 3REAB 5IT9E 2K5LA 3ZEHA 4F7UE 2PQWA 2EWNA 4XTWA 2IY5A 1OV3A 1FYNA 2DL7A 3P8YA 5F5WA 2L5QA 3LX7A 3I5SA 4C0DB 1LVKA 4J9HA 3KXTA 1V29B 2R58A 2VB6A 1IGQA 4M7DA 5D6XA 5C52B 5DLOA 2R57A 3DB4A 2OTJQ 2L89A 4MMKA 1J3TA 1XOVA 3PFSA 1TH7A 4EMKA 1YJ9A 5D7UA 1EFNA 2DE0X 5GAOp 1BIBA 2L8DA 3PVLA 3IKMB 3TSWA 1YN8A 4Y92A 4C8QA 4XAXB 2L0AA 2DZ9A 3MEVA 4M78F 2K3YA 2FZKB 4FIBA 4QQDA 1M4ZA 4C0DC 4JZ4A 1LYLA 2RHYA 1WJSA 2I4OA 3RF1A 3L42A 4N4IA 5K1PA 2F69A 2FHDA 2LTOA 2E12A 1UJ0A 4RG2A 5GMKj 1YJWT 3H0HA 5D6YA 2FYKA 3QZ5B 2YXYA 1WPYA 1YIJT 2EVRA 1OZ2A 3R07A 4J9DA 1BBZA 1SETA 2ZGWA 2VXEA 2AIRB 1TU0B 2V26A 4IUUA 4C92C 2PVDB 1Z9QA 2OTJA 1JRIA 4PJOA 1KHIA 3CMAQ 4C5HA 3M4PA 1VQ8Q 3MJXA 3E9HA 1H92A 1TOVA 2HBWA 4ZIBA 1VQPA 3EGXB 4BE1A 1KD1R 2Q5HA 2OJ2A 4RG8A 2ZT5A 2ZPFB 5ECAA 4YRQA 3VS6A 2K9GA 1YBYA 3CMAT 2B86A 1N8RR 1D0XA 2GNCA 1VQ8T 4KBMB 2VYTA 1ASYA 1OULA 2QI2A 2P0PA 2GFAA 3IKLA 4PLLA 1RUWA 5DY9A 4Q5WA 2ZZFA 3LSQA 2FZCB 3M59A 1SF9A 2O4XA 2MK5A 1X27A 2RQUA 2VGMA 2K7AA 1MGQA 1UDLA 2AKWB 1VQZA 1I1JA 4EMKB 1C1AA 3JCMX 4HA8A 4P3OA 2DL4A 3QO7A 1VQ8A 4P75A 5GAMf 3E1SA 1PCXA 1MMGA 2LX9A 1UGRB 4C0GA 2QA4A 4N4GA 1UFFA 4G84A 2DD5A 4QW2A 4XTVA 1ZBJA 4LD9K 3OYIA 3JAME 4MZMA 1E6GA 1HC7A 2C0OA 4P5NA 3JB9F 4YRPA 3X20B 2OTLT 1VQ5Q 4JZ3A 4CS3A 1MNEA 3ASKA 3OMGA 2VC8A 2F2VA 1Q82C 4PJLA 1Q86R 2HD0A 2RQVA 3C12A 4N4HA 5EG2A 3ZL7C 2K3BA 4M7AD 2ATCB 2QTVA 5J3BA 1LOJA 1UGSB 3GBQA 1TSFA 1UHFA 4EMKC 1TTHB 3VKIA 4YRKA 2DL3A 1PC0A 4L5GA 2WSEE 3JCMV 1R0BG 2DPPB 3SFMA 2K5FA 1WU7A 2KDSA 3JCMP 3RL6A 2XKOC 4LD6A 3GNGA 3TREA 5GJVB 4LDWA 2MCNA 4WF2A 2COWA 4FYXB 3CCJQ 1H641 1M8VA 1ZUKA 1M30A 1NZ9A 1R77A 1H4QA 1C0AA 3EG3A 1RACB 2NS6A 3JCMe 1L0WA 2KI7A 1QKXA 1FXXA 1VQ5A 3CCJT 3A8MB 1YITT 4ATOA 2ED1A 2L3PA 4C92G 1RI9A 3CBMA 2XD0A 1YFNA 1N27A 2DA9A 4B9XA 5KH6A 2O4XB 2LT1A 4LDYA 4HVUA 3MP8A 2YRVA 4BE0A 2F2WA 2K4YA 2DL8A 2X3XD 4CC7A 4M78E 2ZZEA 3TEGA 4DOVA 1H8KA 5GANj 4QKUA 4DEXA 1KQSA 2EAYA 3JCMf 1AT1B 4A4EA 1CKBA 4E7KA 3A98A 2PZ1A 2YUOA 2LCSA 1R0CB 3BE3A 3VS5A 3CCJA 5C53B 3AHUA 3REUA 1U06A 5ELNA 2EQJA 2KR3A 4QVDA 1YHQT 3LWHA 1C6VX 2EYYA 3RR6A 2C0TA 3NTIA 2ARUA 4F7UA 3L2WA 1VQ6T 1U8RA 1RLQC 1B76A 5FW9A 1FWZA 4GBQA 3SD4A 2DETA 2XK0A 3EGUA 4PKCC 3JRZA 1VUBA 4BB7A 3TEHA 3QJ6A 3OW2S 1PG5B 3MHXA 4P75C 3ER0A 3HXUA 1WX6A 4J9BA 8ATCB 4KQEA 1K0SA 3CC7Q 3PCOB 3VBBA 4ZGDB 3NENA 2BTTA 4XTYA 2CSIA 4KRTA 2RI3A 1SERA 1ZA1B 3PIPA 2EIFA 2ZZDA 3I35A 1VIEA 1TUCA 1KC8R 2RK1A 3OQ5A 2LRQA 2DYIA 3M9QA 2DF6A 4ZN1A 1ADYA 2EGAA 3R6NA 2XGTA 2RQWA 1QW1A 4PJMA 4P73A 3FJ5A 1VQNQ 1B34A 1VQLQ 1EOVA 1BI2A 1OOTA 1LJOA 4J6YA 2COYA 3M0UA 2M16A 2PVOB 3HFNA 2AMCB 4G85A 4LUDA 2YRCA 5LJ3f 4ESRA 2RJDA 3G4SQ 4J8OA 4H2XB 1QQJA 1VQNT 1VQLT 1SRMA 4L59A 3X26B 5K1XA 2VGNA 3P8HA 4OMLA 2ZIOA 4A53A 3CC7A 4D8DA 4QVZA 4E7LA 4P3NA 5CQYA 2DXBA 3A7RA 3JCMQ 2JTFA 3T9NA 2KRMA 2KT1A 3SB2A 1GL5A 3Q1JA 4RUGA 4EIKA 2GTOA 2ZR3A 4M75B 4P74A 2ROLA 4YDQA 3VRYA 1K4US 1FMVA 2ZINA 1U5SA 3H0IA 4KR3A 1VQLA 4F14A 1KMNA 4YRCA 4HCCA 2CSQA 2BE7D 3M4GA 3S6WA 2EJ9A 5LJ5d 3RKYA 4HVVA 4PFOA 1ABOA 4NCXA 3UATA 1AZEA 4LNPA 3TEHB 4GLKA 1OU9A 4M7AF 1N8RU 3G4SA 4CH4A 2F5KA 3VS1A 3ICAA 4JLGA 5HKCA 2NUPA 1PD1A 4F04B 2A36A 1Y71A 2RJFA 3EFOB 4J15A 1NM7A 1HJDA 1SKUB 4C92D 2LP5A 1VYVA 2V1RA 4Z89A 1W4SA 1ZQ1A 1EIFA 1VQ7T 3M0PA 1NYFA 2CT3A 2FRYA 4M77B 3LGLA 2J6FA 3OYDA 4M75C 1GCPA 3C95A 2MAMA 3M0RA 3WVEB 1UUEA 1BK2A 2KBTA 3HFZA 5HCKA 3M0SA 4LDVA 3CMQA 1AWXA 1IGUA 2YHTA 2EFIA 1V76A 1YNZA 1GRIA 2O9VA 5EC7A 1QCOA 2MMPA 2CJAA 1WQ7A 3CC2Q 2HL5C 4KT0E 2RMOA 3NTKA 4LE9A 1EQRA 2QGGA 4PL6A 2J3LA 1BI1A 4OGEA 1MMAA 1UECA 4F17A 2ZPBB 3VS7A 2HZYA 4P72A 2DIGA 2HQEA 1Q86U 1UEBA 2NYSA 4EMGA 4M77C 3THKA 3LC0A 4CS4A 1Y96B 1W2BA 4JJBA 1BCMA 2M51A 3UDCA 2CT4A 3EFRA 4E7IA 1KOGA 2ZPEB 3CD6Q 3I55Q 2ZAEA 1X54A 4P73C 1M9SA 2Z0WA 3A5ZB 2FPDA 2K6DA 3CCUT 2PMEA 2O9SA 1E1OA 2DX1A 1W1FA 5M9OA 2ZCEA 5A0LA 3CCVQ 2JUFA 4HCKA 3SWNB 2RM4A 3H9NA 2AZVA 3CD6T 2KYMA 3EH2A 2C0IA 3UH0A 4EMHA 4PHCA 2G4CA 2M9UA 4E6RA 3CC2A 2CUDA 4OB1B 3CCQT 2CH4A 2RPNA 2NUPB 3GLXA 3CCVT 2JS0A 1OI1A 2ZNIA 3HFOA 3M0QA 1KJWA 4KULA 4M78A 2EGCA 1Q82R 3IALA 2BKDN 3UFGA 2LJ0A 3PE0A 3S3NA 1D0ZA 4ZTZB 5I11A 4F16A 3QXEB 3NELA 3QO3A 4FYVB 4MMLA 5KYYA 2R5AA 2QAZA 4P74C 1O9SA 1USYA 3I55A 4WI1A 2DRMA 2XDPA 1VQOT 4J9GA 2F1LA 4KUIA 3VU3C 3FLGA 3SWNC 2L2PA 3QZ9B 4X5OA 2QK0A 3CXCS 1JBMA 5GAOn 1AEYA 4LVJA 1IRXA 1WHJA 3META 2K57A 4IIOA 4TQFA 4ZTFA 1KHCA 3KFVA 1XJWB 2LC4A 3BDUA 1PWTA 5KYWB 4JS5A 4ZGEB 4RMOA 3GF5A 3A8LB 4H2YA 5CQXA 3OBYA 3M53A 5KE3A 1N9RA 4M75G 2O88A 5CKEA 2DXCA 2DMOA 2EQMA 2X35A 3NPFA 1PRMC 3A8HB 1X55A 3C4SA 1HTTA 3CCET 1YI2Q 4J83A 3G6EA 2COZA 3IQLA 3DLLA 5AYFA 3REXA 2YUNA 5AT1B 1JXOA 4UP7A 4M7AE 1GGMA 1H3HA 2MOXA 4VUBA 1QP3A 5IAYA 5GAN5 2AZSA 2ZCFB 2J7IA 4FCYA 3A7AA 4UC4A 2CJBA 2O01E 1LPLA 1YI2T 5I22A 1X2KA 5HGQA 2D9TA 5FU7B 4RKUE 3QIIA 1KC8U 3OSVA 1OX8A 2CZ7B 3FDRA 1ATIA 1ABQA 1M1KC 1WQWA 4BD3A 4QVCA 4P72C 1PHTA 2HSPA 4GY5A 4M77G 2W10A 1JB0E 4JS4A 4M78B 2E65A 1YJWQ 2W0ZA 3INZA 3HTRA 1YIJQ 1X2GA 4C92F 1G3TA 3V8LA 5KYYB 2ZNJA 1NE8A 4RCCA 2FPFA 1RLPC 3C94A 1FX7A 4HT4A 4KH1B 2IPOB 5FWBA 4OLFA 2V8KA 4LNSA 4A4HA 2J6KA 2CJ9A 5IXBA 5FU7C 2DERA 1AVZC 3OYAA 3UA7A 1Y07A 2VASA 4E7HA 3TSZA 4YREA 3DSQA 5C6SA 2E6ZA 1B07A 4C5IA 3OYEA 4FW1A 3MPUB 1JU5C 1G8XA 5LJ5j 4OMQA 4YRGA 2PVGB 1JJ2S 4JRKA 2LQ8A 4M78C 1KG1A 2ZZGA 3NHNA 1T3SA 1NLPC 2RA2A 4X34A 3H8ZA 2ED0A 1VYUA 2DFUA 2OI3A 5GAN7 1YJWA 2FZGB 2LJ3A 3FRNA 2JVVA 4H2TA 3NFCA 3HXYA 1YIJA 1NYGA 1USYC 2IY5B 3TCJA 5GAMe 2KEAA 3RBBB 1JQQA 3HXVA 4FM4B 4AG2C 5J39A 4J6XA 1RAFB 4GLMA 2F2XA 2QDYB 2HQHA 1TWBA 3OYBA 1QVFS 1BBWA 3HTZA 2IG0A 1N6AA 4M7DB 4RCBA 4XEOA 1VIFA 2RH2A 3EGDA 1GFDA 5CVIA 5GAMd 1RAGB 2D6FA 2HCKA 1NEBA 3M57A 2E3IA 5FU6B 3CMAA 2XDBA 1BBUA 3RACA 2QHTA 2JW4A 4LXCA 4TVAA 4HT8A 2VXFA 3VUZA 2DM1A 4C8QB 2OTLQ 2P0QA 1WJRA 4BE2A 4LVMA 1R8OB 3HXWA 2K3XA 2MIOA 3EHRA 1V1CA 3KBGA 1WJQA 4NS5A 2D8JA 5KYUA 4MZPA 3NGPA 4WJ3M 1PKSA 1JJ2P 1NNHA 5CKDA 3C0CA 3JCMJ 3GIBA 1WZOA 2K2VA 3G7ZA 5A0DA 1WLEA 3CBPA 3FB9A 2ENMA 4Y28E 2CP5A 3L2QA 3M56A 1QWEA 1G5VA 2DZCA 4M7DC 3JCMc 1OYXA 3QHSA 4JLIA 4YRSA 4C0FA 2BIVA 4M75D 2AKLA 4PJNA 1SPKA 3BY7A 4PJOB 1PKTA 4OB3B 2SEMA 1OX9A 4OMPA 4C8QC 3QWYA 1ARKA 2RHZA 1D3BA 2OTLA 3HPWA 4FT2A 2H3JA 5GMKm 1H4VB 2D8HA 1YITQ 3M54A 2RD1A 3OYLA 4BACA 3A1PA 4EDUA 2DD4A 2RQTA 2XDDA 3A7UA 5GAN2 2VVKA 4DA4A 1NJ1A 4R56A 3A8GB 2C7IA 1VQ9Q 4KGZB 2LMJA 3CBOA 4LN2A 3MEWA 1E6HA 4J9IA 2GTJA 3OYGA 3A8OB 2JMCA 1YWOA 4JJCA 4C0ZA 3W3SA 2BZYA 2M02A 4M77D 5GAN4 1YCSB 3CPWS 2O2OA 1Q82U 4DPGA 3CC4T 3EGDB 1G3WA 3RMQA 2AT1B 4PJOC 3JCMd 4J5YA 3X25B 1VQ9T 2OAWA 4JRPA 5IH2A 1WYDA 4O2DA 1MMNA 4K86A 4M78G 1YCYA 3EAEA 3MQZA 4C92E 3E2UA 1VQ4T 4TVAB 4WTOB 1RAAB 2FPEA 3QDRB 1GXIE 1YHQQ 1OZ3A 2LT4A 4H02A 4KH0B 1MHNA 5FRNA 3RKXA 1G5IA 5C51B 3CCMQ 1VQ6Q 1YITA 2ZPHB 5KYUB 4Z88A 3MF1A 1WHHA 3EG0A 3QSUA 1TXQA 1NJ5A 3MP6A 3QDFA 2J05A 1E1TA 3CCRQ 1KIKA 2RJCA 1UE9A 5C0MA 1IO6A 2YUPA 1VQMT 2ARTA 1SHFA 2LDMA 3V7RA 4YRLA 1HXDA 1VQ9A 3LH5A 3E9IA 1WHGA 1M90C 3CCMT 2JTEA 2Q5IA 5KCHA 4HKEA 2JXBA 2CIMA 1FYFA 2E6NA 4IUVA 2DL5A 4C5GA 4OMNA 3CCRT 3LSSA 4M7AA 2JT4A 3RIRA 2DKGA 3OYYA 1QVGS 1NBEB 3AT1B 1NYQA 1X2HA 3OS1A 1M1FA 3M4QA 1M8MA 1YHQA 2GCXA 1NJIC 2E3CA 2QHUA 2I4LA 5LJ3e 1HK9A 4N0AA 1Y7XA 2G6FX 3CQTA 3CMEQ 5ELOA 3WQZA 1VQ6A 5GMKi 2E10A 4CRIA 4WCIA 4LDUA 3O5ZA 3P8TA 3LGFA 1UG1A 2VV5A 3LH0A 1T0HA 1VQKT 4M7DG 5CIUA 1X2QA 3HRUA 3CCRA 1B8AA 4ZTJA 1G2BA 1EFWA 3OS5A 9ATCB 2X3WD 5GMKh 4CC3A 5LJ3d 3CMET 1WHMA 4X1VA 4B6MA 2KRNA 3H6ZA 1BKBA 2CP2A 5D6WA 5HK3A 1M90U 1RL2A 2QQAA 4TVYA 3SEMA 2KAFA 3CCSQ 4C8QG 2RI2A 2YSQA 2AKKA 4IIMA 1K9MC 2DLPA 2HL3A 1XQHA 3NTHA 2L3RA 4HCZA 1D09B 3HL8A 3A5YA 4EO4A 2JM9A 4DQ2A 5LJ5h 2DEQA 2ODRC 3OW2P 3IG2A 1Q95G 3HXXA 4ME7A 4HWTA 2ZTGA 3CCST 4YRMA 3MEUA 2RHUA 5IHIA 4JJDA 2DDZA 4R0KA 1OU8A 3CMEA 4CC2A 1SEMA 2EKHA 2CREA 3EH1A 4NL2A 3PMTA 3LWIA 2V8IA 3JB9J 1ADJA 4Z02A 2E5QA 1U1TA 4F7UB 2JMAA 1VQNA 2Y4XA 1M1KR 3OMCA 3TU4K 4PJOG 1E24A 1IZ6A 2QQSA 5DLQE 3HY1A 3LLRA 4J9FA 1N9WA 2EYZA 1UJYA 2DYBA 4EX5A 3CCSA 3M55A 2QTXA 1VQ7Q 4M75F 2KGTA 1B7TA 3MKDA 4YRIA 1I07A 3WVDB 4X9CA 4EPCA 3D7SB 5GAMj 4Q6GA 1K8AC 1X6OA 1WA7A 3V8JA 3PVQA 3RDVA 4P3PA 2OX7A 3BDLA 1SESA 4C5EA 3QBYA 3QTCA 1T3LA 3UA6A 1DJ7B 2NUZA 4JRIA 4ELZC 2DNUA 3HRTA 1K9AA 4PLIA 1B34B 2M0OA 4YCUA 3QPHA 2A8EA 5CKHA 2X9HA 3L2VA 8AT1B 1BB9A 4ANJA 3KFUA 2QXFA 4LVIA 2GGRA 1JXMA 4TQDA 4M77F 2JS2A 2DQ0A 2RHSA 2E64A 3UWNA 4RTZA 2DBMA 1VQ7A 2E3HA 3HP9A 2D0QB 5CCAA 1YJNQ 4BUGA 4OP0A 1H4TA 4QQGA 4N0AC 1X6BA 1M2VA 3VS0A 3X28B 4NL3A 5LL6S 2JN0A 1G3YA 3CCUQ 2XHCA 4P71A 2CDTA 2RN8A 1HYOA 3HXZA 2Y4YA 4E7SA 4XEMA 1G3SA 4K87A 2K2MA 2LQNA 3TVTA
chains in the Genus database with same CATH topology
2X4YA 4IURA 3VJPA 1YJNT 1EIYA 3MO8A 4OVAA 4HWRA 3FIFA 3ZFJA 3NEMA 4BI8B 3CCLT 4MDXA 2QHSA 4BDZA 3PNWC 4YP0A 4XK8E 4YRFA 3JSCA 2CGHA 4YTLA 3OYCA 4KUDK 3KUFA 3A31A 2ALYA 4H2UA 4M7DD 5GANh 2RJEA 1ASZA 2RI5A 3OS0A 4JDSA 3VQVA 1YJNA 2DU7A 1X01A 1U1SA 2DJZA 2G3RA 3WXMB 3CCUA 3BJUA 2FL7A 2CZ1B 2KMTA 4XTUA 4C92A 3QJYA 3CPFA 2LNVA 2YLBA 4A54A 4C8QD 5A0GA 5LJ5g 1K73C 3CD6A 3J7AF 4H2VA 3HFZB 3OY9A 4R55A 3CCQA 4RQFA 4FU6A 4Q15A 3DKMA 3QKJA 3CCVA 2E1HA 2LCCA 4LVKA 2I2LA 4ELYC 3HFVA 3JCMb 4LVLA 2X4WA 2YLCA 1KQSS 3HY0A 4B9WA 3E9GA 3MP1A 4QQ6A 4DOWA 1VQOA 3J81E 4PJOD 2DO3A 2WSCE 3QYHB 1YFSA 3HKSA 2GF7A 4X9DA 5GANf 2ZT8A 4F7UG 1X56A 3OW2A 1UGQB 1EIYB 1ZBXA 2X4XA 2Q7EA 4OB0B 2XICA 2HQXA 5GMKl 3M4YA 4M75E 3HRKA 1K73U 4CH5A 3VQXA 4E7JA 4BW9A 1YJ9T 2ZT6A 5GAOm 2Y90A 3X24B 1EVKA 3V7CA 1NYRA 4A4KA 4YYEA 1PSFA 1NJ6A 3MEYA 3HRSA 1BIAA 3URGA 2JTMA 3A74A 2B8AA 2QQBA 5LJ3j 2RB6A 3OA6A 3QUIA 4PNOA 5GAN8 2ALYB 2KSSA 3CCEA 2WACA 2Q7HA 3NETA 4P71C 4ZTUB 2GFUA 3ME9A 3J80E 2CS7A 3VYGA 3L2UA 2AKWA 4OF1A 4K88A 4C92B 1YI2A 1W66A 4M77E 4TVRA 5IN1A 4II1A 1M5Q1 4LDXA 1IREB 2M1HA 2OTJT 4H2WA 2A3LA 2X4JA 2RHXA 1XNIA 2J3MA 3DLMA 2IVWA 2VUBA 5DM7R 1VQPT 2CKKA 4UP9A 2XTIA 3VQWA 3VYHB 2GQVA 1NJ2A 1KMMA 1UGPB 3E19A 3OSSC 5GAMh 1M1KU 2FB7A 1AHJB 1Q7YC 4MDWA 3UGTA 2MWPA 4JUVA 2RHQA 1QVPA 3JB9H 5GANg 4CI0C 4YCWA 2ODRD 2PU9B 4J7FA 3UPUA 2CYZB 3RESA 2JZ2A 5GAN3 4E47A 5KE2A 5KCOA 1H4SA 3PIOA 2P0LA 2QA4T 2Q7GA 2LQKA 2PMFA 4A4FA 2DTOA 2I4MA 3V8KA 3PTAA 1Q81C 2DTIA 1B70A 4M7DF 2F5TX 4WJ4A 3QO8A 3QNEA 5I2SA 1BYMA 4IUPA 2C06A 1Q7YU 2LVMA 4BI3A 1NJ8A 3FEOA 1SSFA 4IKFA 3HHTB 4C8QF 3I7FA 4YCVA 1PSEA 3I56T 3G1ZA 3UT1A 3OYHA 5A2QE 3MF2A 3RUXA 4V2SA 2QEXT 4XTZA 5FU6C 4CH3A 3VUBA 3GOXA 2C8MA 5I2MA 3G71T 5CKBA 1Z7NA 4HCBA 4OGCA 4O6JA 3S3MA 11ASA 3L4GA 3JCMh 5E3IA 3SDZA 1W2BS 1Q81U 3R6OA 1QE0A 3LYIA 1VQ5T 4Y91A 4PJOF 2RHQB 3OBWA 3I56A 5KNNA 4XU0A 3PCOA 2ZT7A 2EJFA 3MCAB 2QEXA 3TUPA 1XTDA 2HNIA 2P0KA 3QYGB 2QQRA 4HT9A 3G71A 1IL2A 2DQ3A 1S72T 1NPRA 4A4GA 1YB3A 5FRMA 1I8FA 2DXUA 3LW5E 3M58A 2ZXFA 1WGSA 1QF6A 3OD1A 2CZ6B 1KQ1A 2HAXA 1B70B 1NPPA 2DTHA 3JB9I 2AMCA 2PUKB 2I4NA 2K5IA 1B7YA 5HK0A 3CXCA 2DVEA 4H2XA 1S72A 5CAIA 2QHVA 2MF2A 3CC4A 4UPAA 1BI3A 4YRNA 1WNLA 5GAMg 2KK4A 4TVWA 1I81A 1RI0A 1VQ4A 3FC3A 2CZ0B 4FT4A 1PYSA 4RQEA 5J26A 4M75A 2EYQA 2EKOA 5LJ3h 4HWOA 1UB4A 1D3BB 2RK2A 5CK9A 3L2RA 4RDXA 3L4GB 1VQMA 3QO5A 3TEEA 3CCMA 4UP8A 3PMIA 1YFTA 2BUDA 1X75C 3VQYA 1JJCA 4MZTA 4YROA 3DB3A 1EVLA 3RERA 3E9FA 4YPFA 4OMFB 2MI6A 4M77A 4M7DE 2P4TA 1YGBA 2PUOB 3CC7T 4YRTA 1G5HA 2EL9A 1KD1C 5I21A 3M5AA 1E22A 2KVQG 2DU5A 1VQKA 5FLXE 3JB9G 1N8RC 4YRRA 4C8QE 2OAUA 3FJPA 1LNXA 4IUQA 5GMKe 4HVCA 1B7YB 1NJIU 3A32A 3O8VA 3PZCA 2AHJB 3HSBA 4AH6A 3JCMg 4ZN3A 2E5AA 3BW1A 1JJ2A 5GAN6 3VV0A 4PG3A 2EQKA 3G4ST 5LJ5e 2R5MA 1Y96A 3P8DA 1PYSB 2ZR2A 2QQ9A 3GPLA 4M7AB 4XQ3A 4BI4A 4D6WA 5CO7A 1BI0A 3A5ZA 2XG8D 3PT9A 2DIQA 4PJOE 3OB9A 3PGGA 4F7UF 2P5IA 2JOYA 5GAOl 1K9MU 1KD1U 2LCLA 1QVFA 4NOYA 3SWNA 5CKFA 1RIQA 4HWPA 2XIDA 3BFMA 3OYJA 4O5VA 5LJ5f 1G51A 2E70A 4JJNK 3P8BB 1Q86C 2ARSA 4M78D 1JJCB 4E51A 1N9SA 1KQ2A 2EQUA 5L8RE 3S3OA 4M7AC 2DAQA 3RGLA 4OB2B 2EJGA 4HWSA 5GAOq 3RMSA 3L2ZA 3GNFB 5HY6A 4BY6B 2NLUA 3F70A 3JCMW 1I4K1 4JRQA 2KQWA 1K8AU 5GAOr 5LJ3g 2RHIA 3OYFA 1YFRA 2DXTA 4BDYA 1M1GA 1H3ZA 3CC2T 4FSXA 4BWAA 4XU3A 3RKWA 3GP8A 2JNGA 3EFSA 4YRJA 3QG1A 4BY6C 3ERRA 3ZBDA 2KY9A 1Z7MA 3CEYA 3CCLA 3CPWA 1I5LA 3I55T 3P8VA 3MEAA 2RO0A 5CR2A 4J7IA 1ZHIA 4XU2A 1P92A 3V7SA 4IUTA 2ZIMA 4CS2A 4XTXA 4L87A 4CH6A 4TWAA 4FL6A 5GANe 3JB9D 4KR2A 2WSFE 3OYNA 2MWOA 2A7YA 2FVUA 2ZPGB 2RHSB 4TTVA 3OS2A 5FROA 2V8JA 1O75A 3L1AA 3UGQA 4RMFA 1J5WA 5GANd 2DK3A 4H2SA 3G6ET 4ZGJB 1KC8C 1QP2A 3N5BB 3HRIA 4XU1A 2ZPIB 2HBPA 4L6V5 2XU8A 3OYKA 2E41A 2XI9A 3OYMA 1SRYA 12ASA 1QVGA 4J6WA 4M7AG 5IT9E 2K5LA 3ZEHA 4F7UE 2PQWA 2EWNA 4XTWA 2IY5A 5F5WA 3P8YA 2L5QA 3LX7A 4C0DB 3KXTA 1V29B 2R58A 4M7DA 5D6XA 5C52B 5DLOA 2R57A 3DB4A 2L89A 4MMKA 1XOVA 3PFSA 1TH7A 4EMKA 1YJ9A 5GAOp 1BIBA 2L8DA 3IKMB 4C8QA 4XAXB 2DZ9A 3MEVA 4M78F 2K3YA 4FIBA 4QQDA 1M4ZA 4C0DC 1LYLA 2RHYA 1WJSA 2I4OA 3RF1A 3L42A 4N4IA 5K1PA 2F69A 2FHDA 2LTOA 2E12A 4RG2A 5GMKj 1YJWT 5D6YA 2FYKA 3QZ5B 1YIJT 1WPYA 1OZ2A 3R07A 1SETA 2ZGWA 2VXEA 4IUUA 4C92C 2PVDB 2OTJA 1JRIA 4PJOA 1KHIA 4C5HA 3M4PA 3E9HA 4ZIBA 1VQPA 4BE1A 2Q5HA 4RG8A 2ZT5A 2ZPFB 4YRQA 1YBYA 3CMAT 1VQ8T 4KBMB 2VYTA 1ASYA 3IKLA 2QI2A 2P0PA 2GFAA 4PLLA 5DY9A 4Q5WA 2ZZFA 3LSQA 3M59A 2O4XA 2VGMA 1MGQA 2AKWB 1VQZA 4EMKB 3JCMX 4HA8A 4P3OA 3QO7A 1VQ8A 4P75A 5GAMf 3E1SA 2LX9A 1UGRB 4C0GA 2QA4A 4N4GA 4G84A 2DD5A 4QW2A 4XTVA 4LD9K 3OYIA 3JAME 4MZMA 1HC7A 4P5NA 3JB9F 4YRPA 3X20B 2OTLT 4CS3A 3ASKA 3OMGA 2VC8A 1Q82C 2HD0A 3C12A 4N4HA 5EG2A 4M7AD 5J3BA 1LOJA 1UGSB 4EMKC 3VKIA 4YRKA 4L5GA 2WSEE 3JCMV 3SFMA 2DPPB 2K5FA 1WU7A 2KDSA 3JCMP 3RL6A 2XKOC 4LD6A 3GNGA 3TREA 4LDWA 4WF2A 1H641 1M8VA 1NZ9A 1H4QA 1C0AA 2NS6A 3JCMe 1L0WA 1FXXA 1VQ5A 3CCJT 3A8MB 1YITT 4ATOA 4C92G 2XD0A 3CBMA 1N27A 4B9XA 5KH6A 2O4XB 2LT1A 4LDYA 4BE0A 3MP8A 2YRVA 2K4YA 4M78E 2ZZEA 3TEGA 4DOVA 5GANj 1KQSA 2EAYA 3JCMf 4A4EA 4E7KA 3CCJA 5C53B 3AHUA 3REUA 5ELNA 2EQJA 4QVDA 1YHQT 3LWHA 3NTIA 2ARUA 4F7UA 3L2WA 1VQ6T 1U8RA 1B76A 1FWZA 3SD4A 2XK0A 4PKCC 3JRZA 1VUBA 4BB7A 3TEHA 3QJ6A 3OW2S 3MHXA 4P75C 3ER0A 3HXUA 4KQEA 3PCOB 3VBBA 4ZGDB 3NENA 4XTYA 2RI3A 1SERA 3PIPA 2EIFA 2ZZDA 1VIEA 2RK1A 3OQ5A 2LRQA 3M9QA 4ZN1A 1ADYA 2XGTA 1QW1A 4P73A 1B34A 1EOVA 1BI2A 1LJOA 4J6YA 2M16A 2PVOB 3HFNA 2AMCB 4G85A 5LJ3f 2RJDA 4J8OA 4H2XB 1VQNT 1VQLT 3X26B 4L59A 5K1XA 2VGNA 3P8HA 2ZIOA 4A53A 3CC7A 4QVZA 4E7LA 4P3NA 5CQYA 2DXBA 3A7RA 3JCMQ 2JTFA 3T9NA 3SB2A 3Q1JA 2ZR3A 4M75B 4P74A 4YDQA 2ZINA 4KR3A 1VQLA 1KMNA 4YRCA 4HCCA 3M4GA 3S6WA 2EJ9A 5LJ5d 3RKYA 4NCXA 3TEHB 4GLKA 4M7AF 1N8RU 3G4SA 4CH4A 2F5KA 3ICAA 4JLGA 5HKCA 1Y71A 2RJFA 4J15A 4C92D 1W4SA 1ZQ1A 1EIFA 1VQ7T 4M77B 3LGLA 3OYDA 4M75C 3C95A 2MAMA 3WVEB 3HFZA 4LDVA 3CMQA 2YHTA 2EFIA 2MMPA 2CJAA 1WQ7A 4KT0E 3NTKA 1EQRA 4PL6A 2J3LA 1BI1A 4OGEA 2ZPBB 4P72A 2DIGA 2HQEA 1Q86U 1UEBA 4EMGA 4M77C 3LC0A 4CS4A 1Y96B 1W2BA 3UDCA 3EFRA 4E7IA 1KOGA 2ZPEB 1X54A 4P73C 1M9SA 3A5ZB 3CCUT 2PMEA 1E1OA 5M9OA 2ZCEA 5A0LA 2JUFA 3SWNB 2RM4A 3CD6T 3UH0A 4EMHA 4PHCA 2G4CA 2M9UA 3CC2A 4OB1B 3CCQT 3GLXA 3CCVT 1OI1A 2ZNIA 3HFOA 4KULA 3IALA 4M78A 2BKDN 3UFGA 3S3NA 4ZTZB 3QXEB 3NELA 3QO3A 4MMLA 2R5AA 4P74C 1O9SA 1USYA 3I55A 4WI1A 2XDPA 1VQOT 4KUIA 3VU3C 3FLGA 3SWNC 3QZ9B 4X5OA 3CXCS 1JBMA 5GAOn 4LVJA 3META 2K57A 4TQFA 4ZTFA 1KHCA 2LC4A 3BDUA 4JS5A 4ZGEB 4RMOA 3GF5A 3A8LB 4H2YA 5CQXA 3OBYA 3M53A 5KE3A 1N9RA 4M75G 5CKEA 2DXCA 2EQMA 2X35A 3A8HB 1X55A 3C4SA 1HTTA 3CCET 4J83A 3G6EA 3DLLA 5AYFA 3REXA 4UP7A 4M7AE 1GGMA 4VUBA 1QP3A 5IAYA 5GAN5 2ZCFB 3A7AA 4UC4A 2CJBA 2O01E 1YI2T 5HGQA 2D9TA 5FU7B 4RKUE 3QIIA 1KC8U 3OSVA 2CZ7B 3FDRA 1ATIA 1M1KC 1WQWA 4BD3A 4QVCA 4P72C 4GY5A 4M77G 1JB0E 4JS4A 4M78B 2E65A 3INZA 1X2GA 4C92F 1G3TA 3V8LA 2ZNJA 1NE8A 4RCCA 3C94A 1FX7A 4HT4A 4OLFA 2V8KA 4LNSA 4A4HA 2CJ9A 5FU7C 3OYAA 1Y07A 4E7HA 4YREA 3DSQA 5C6SA 2E6ZA 4C5IA 3OYEA 5LJ5j 4YRGA 2PVGB 1JJ2S 4JRKA 2LQ8A 4M78C 1KG1A 2ZZGA 2RA2A 4X34A 3H8ZA 5GAN7 1YJWA 3FRNA 2JVVA 4H2TA 3NFCA 3HXYA 1YIJA 1USYC 2IY5B 3TCJA 5GAMe 3HXVA 4FM4B 5J39A 4J6XA 3OYBA 2QDYB 1QVFS 1BBWA 3HTZA 2IG0A 1N6AA 4M7DB 4RCBA 4XEOA 1VIFA 2RH2A 5CVIA 5GAMd 2D6FA 3M57A 5FU6B 3CMAA 2XDBA 1BBUA 3RACA 2QHTA 4TVAA 4HT8A 2VXFA 3VUZA 4C8QB 2P0QA 1WJRA 4BE2A 4LVMA 1R8OB 3HXWA 2K3XA 3KBGA 1WJQA 4NS5A 4MZPA 4WJ3M 1NNHA 5CKDA 3JCMJ 3GIBA 2K2VA 3G7ZA 5A0DA 1WLEA 3CBPA 3FB9A 4Y28E 3L2QA 3M56A 1G5VA 2DZCA 4M7DC 3JCMc 1OYXA 3QHSA 4JLIA 4YRSA 4C0FA 2BIVA 4M75D 3BY7A 4PJOB 4OB3B 4C8QC 2RHZA 1D3BA 2OTLA 3HPWA 4FT2A 2H3JA 5GMKm 1H4VB 3M54A 2RD1A 3OYLA 4BACA 4EDUA 2DD4A 2XDDA 3A7UA 5GAN2 4DA4A 1NJ1A 4R56A 3A8GB 2C7IA 3CBOA 3MEWA 3OYGA 3A8OB 4C0ZA 3W3SA 4M77D 5GAN4 3CPWS 1Q82U 4DPGA 3CC4T 1G3WA 3RMQA 4PJOC 3JCMd 4J5YA 3X25B 1VQ9T 4JRPA 1WYDA 4O2DA 4K86A 4M78G 1YCYA 3EAEA 3MQZA 4C92E 1VQ4T 4TVAB 3QDRB 1GXIE 1OZ3A 2LT4A 4H02A 1MHNA 5FRNA 3RKXA 1G5IA 5C51B 1YITA 2ZPHB 3MF1A 3QSUA 1NJ5A 3MP6A 1E1TA 2RJCA 5C0MA 1VQMT 2ARTA 2LDMA 3V7RA 4YRLA 1HXDA 1VQ9A 3E9IA 1M90C 3CCMT 2Q5IA 5KCHA 4HKEA 2CIMA 1FYFA 2E6NA 4IUVA 4C5GA 3CCRT 3LSSA 4M7AA 3RIRA 2DKGA 3OYYA 1QVGS 1NYQA 1X2HA 3OS1A 1M1FA 3M4QA 1YHQA 2GCXA 1NJIC 2E3CA 2QHUA 2I4LA 5LJ3e 1HK9A 4N0AA 1Y7XA 5ELOA 3WQZA 1VQ6A 5GMKi 2E10A 4CRIA 4LDUA 3P8TA 3LGFA 2VV5A 3LH0A 1VQKT 4M7DG 5CIUA 3HRUA 1B8AA 3CCRA 4ZTJA 1EFWA 3OS5A 5GMKh 5LJ3d 3CMET 3H6ZA 1BKBA 5D6WA 5HK3A 1M90U 1RL2A 2QQAA 4TVYA 2KAFA 4C8QG 2RI2A 1K9MC 1XQHA 3NTHA 2L3RA 4HCZA 3HL8A 3A5YA 4EO4A 4DQ2A 5LJ5h 2DEQA 2ODRC 3IG2A 3HXXA 4ME7A 4HWTA 2ZTGA 3CCST 4YRMA 3MEUA 2RHUA 2DDZA 3CMEA 4NL2A 3PMTA 3LWIA 2V8IA 3JB9J 1ADJA 4Z02A 2E5QA 1U1TA 4F7UB 1VQNA 2Y4XA 3OMCA 3TU4K 4PJOG 1E24A 1IZ6A 2QQSA 5DLQE 3HY1A 3LLRA 1N9WA 4EX5A 3CCSA 3M55A 2QTXA 4M75F 4YRIA 3WVDB 4X9CA 4EPCA 5GAMj 4Q6GA 1K8AC 1X6OA 3V8JA 4P3PA 3BDLA 1SESA 4C5EA 3QBYA 3QTCA 1DJ7B 4JRIA 4ELZC 3HRTA 4PLIA 1B34B 2M0OA 4YCUA 3QPHA 2A8EA 5CKHA 3L2VA 3KFUA 2QXFA 4LVIA 4TQDA 4M77F 2DQ0A 2RHSA 2E64A 3UWNA 1VQ7A 3HP9A 2D0QB 5CCAA 4BUGA 4OP0A 1H4TA 4QQGA 4N0AC 3X28B 4NL3A 5LL6S 2JN0A 1G3YA 2XHCA 4P71A 3HXZA 2Y4YA 4XEMA 1G3SA 4K87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 A;  4M7A D;  4M7D E;  1EIY A;  1LOJ A;  4M77 G;  1YGB A;  4HWR A;  3FIF A;  4EMK C;  3NEM A;  4YRT A;  1G5H A;  4M78 B;  2E65 A;  2QHS A;  2EL9 A;  4YRK A;  5I21 A;  3INZ A;  4YP0 A;  3JCM V;  1E22 A;  2DU5 A;  1X2G A;  4C92 F;  1WU7 A;  3V8L A;  2ZNJ A;  3JCM P;  4YRF A;  3RL6 A;  2CGH A;  4RCC A;  3JB9 G;  4YRR A;  4C8Q E;  4WF2 A;  3FJP A;  1LNX A;  5GMK e;  4HVC A;  1H64 1;  1M8V A;  1B7Y B;  3A31 A;  2ALY A;  3A32 A;  4H2U A;  4OLF A;  4M7D D;  1H4Q A;  5GAN h;  1ASZ A;  4LNS A;  1C0A A;  3PZC A;  3VQV A;  2CJ9 A;  3JCM e;  2DU7 A;  3HSB A;  1X01 A;  1L0W A;  1U1S A;  4AH6 A;  2DJZ A;  3JCM g;  3BJU A;  4YRE A;  2E5A A;  3BW1 A;  3DSQ A;  5GAN 6;  4PG3 A;  4XTU A;  4C92 A;  5LJ5 e;  4C92 G;  2YLB A;  4A54 A;  4C8Q D;  1Y96 A;  5LJ5 j;  4YRG A;  1PYS B;  5LJ5 g;  2ZR2 A;  4JRK A;  4M78 C;  2ZZG A;  4M7A B;  4XQ3 A;  2RA2 A;  4H2V A;  4M78 E;  3HFZ B;  3A5Z A;  5GAN 7;  2ZZE A;  3TEG A;  4PJO E;  3PGG A;  4F7U F;  4H2T A;  3HXY A;  2P5I A;  4RQF A;  5GAO l;  1USY C;  4Q15 A;  5GAN j;  2IY5 B;  2EAY A;  2E1H A;  3JCM f;  5GAM e;  4NOY A;  3SWN A;  2I2L A;  3HXV A;  1RIQ A;  3HFV A;  4HWP A;  3JCM b;  4J6X A;  3BFM A;  2YLC A;  5C53 B;  3HY0 A;  3AHU A;  1BBW A;  3HTZ A;  5LJ5 f;  1G51 A;  3REU A;  5ELN A;  4M7D B;  4RCB A;  2ARS A;  4XEO A;  4M78 D;  1JJC B;  4QVD A;  4E51 A;  5GAM d;  4PJO D;  1YFS A;  2ARU A;  4F7U A;  4X9D A;  5GAN f;  2ZT8 A;  4F7U G;  1BBU A;  1N9S A;  1X56 A;  3RAC A;  1KQ2 A;  2QHT A;  4TVA A;  1B76 A;  4HT8 A;  2VXF A;  4M7A C;  3RGL A;  1EIY B;  4C8Q B;  2Q7E A;  2EJG A;  3TEH A;  5GMK l;  3HXW A;  4M75 E;  3HRK A;  4HWS A;  4CH5 A;  3VQX A;  4P75 C;  3HXU A;  2ZT6 A;  4BW9 A;  5GAO q;  5GAO m;  2Y90 A;  3L2Z A;  4WJ3 M;  1EVK A;  1NNH A;  4KQE A;  3V7C A;  1NYR A;  3JCM J;  3PCO B;  4YYE A;  1NJ6 A;  3VBB A;  3GIB A;  3MEY A;  3JCM W;  1BIA A;  1WLE A;  3A74 A;  3NEN A;  1I4K 1;  4XTY A;  3FB9 A;  5LJ3 j;  2RB6 A;  1SER A;  5GAN 8;  2DZC A;  4M7D C;  3QUI A;  4PNO A;  3JCM c;  5GAO r;  2ALY B;  3QHS A;  4JLI A;  5LJ3 g;  4YRS A;  2Q7H A;  4M75 D;  3NET A;  1YFR A;  4P71 C;  4ZTU B;  2DXT A;  1ADY A;  2XGT A;  3BY7 A;  4PJO B;  4P73 A;  1B34 A;  2AKW A;  1EOV A;  4K88 A;  4C92 B;  4C8Q C;  1LJO A;  4BWA A;  4XU3 A;  1W66 A;  4J6Y A;  3RKW A;  4M77 E;  1D3B A;  3HFN A;  2AMC B;  3EFS A;  5GMK m;  4G85 A;  1H4V B;  5LJ3 f;  1M5Q 1;  2RD1 A;  4H2W A;  4H2X B;  4YRJ A;  5K1X A;  3A7U A;  3ERR A;  2J3M A;  5GAN 2;  2ZIO A;  1Z7M A;  4A53 A;  1NJ1 A;  2C7I A;  1I5L A;  4P3N A;  3P8V A;  4UP9 A;  2XTI A;  3VQW A;  3A7R A;  3JCM Q;  1NJ2 A;  3W3S A;  4M77 D;  5GAN 4;  1KMM A;  3SB2 A;  4DPG A;  4XU2 A;  3V7S A;  5GAM h;  4PJO C;  2ZR3 A;  4M75 B;  3JCM d;  2ZIM A;  4P74 A;  4CS2 A;  4J5Y A;  4YDQ A;  2FB7 A;  4XTX A;  4L87 A;  2ZIN A;  4CH6 A;  1WYD A;  4O2D A;  4TWA A;  3UGT A;  4K86 A;  4M78 G;  1YCY A;  4JUV A;  5GAN e;  4KR3 A;  3JB9 D;  1KMN A;  4YRC A;  4C92 E;  4KR2 A;  4TVA B;  2RHQ A;  3JB9 H;  3M4G A;  5GAN g;  2EJ9 A;  5LJ5 d;  3RKY A;  4YCW A;  2ODR D;  4NCX A;  4H02 A;  2RHS B;  4TTV A;  3TEH B;  3RKX A;  1G5I A;  5C51 B;  4M7A F;  3RES A;  3L1A A;  3UGQ A;  4CH4 A;  4RMF A;  3MF1 A;  5GAN 3;  3ICA A;  1J5W A;  3QSU A;  1NJ5 A;  5GAN d;  4H2S A;  1E1T A;  1H4S A;  4J15 A;  2ART A;  3HRI A;  3V7R A;  2P0L A;  4YRL A;  1HXD A;  4XU1 A;  4C92 D;  3E9I A;  2Q7G A;  2PMF A;  2DTO A;  2Q5I A;  2I4M A;  2E41 A;  4M77 B;  3V8K A;  4M75 C;  2DTI A;  1B70 A;  2CIM A;  1SRY A;  12AS A;  1FYF A;  4M7D F;  4WJ4 A;  3LSS A;  4J6W A;  4M7A A;  3QO8 A;  4M7A G;  3HFZ A;  3RIR A;  4F7U E;  2DKG A;  2EWN A;  3QNE A;  3CMQ A;  1NYQ A;  1X2H A;  4XTW A;  2IY5 A;  1NJ8 A;  2YHT A;  3M4Q A;  5F5W A;  3P8Y A;  2CJA A;  2E3C A;  1WQ7 A;  4C8Q F;  2I4L A;  5LJ3 e;  1HK9 A;  4N0A A;  2QHU A;  3I7F A;  5ELO A;  3WQZ A;  4YCV A;  5GMK i;  2E10 A;  1EQR A;  3P8T A;  2J3L A;  3G1Z A;  4M7D A;  3MF2 A;  5C52 B;  3RUX A;  4M7D G;  4V2S A;  4P72 A;  1B8A A;  4MMK A;  4XTZ A;  4CH3 A;  1EFW A;  1TH7 A;  2C8M A;  4EMK A;  5GMK h;  4EMG A;  4M77 C;  3LC0 A;  4CS4 A;  5LJ3 d;  5GAO p;  1Y96 B;  1BIB A;  1Z7N A;  3IKM B;  3EFR A;  11AS A;  1KOG A;  4TVY A;  3L4G A;  3JCM h;  1X54 A;  5E3I A;  4C8Q A;  4P73 C;  4C8Q G;  2DZ9 A;  1QE0 A;  4M78 F;  2PME A;  4Y91 A;  1E1O A;  2ZCE A;  3A5Y A;  4PJO F;  4EO4 A;  2RHQ B;  4DQ2 A;  5LJ5 h;  2DEQ A;  5KNN A;  2ODR C;  1LYL A;  4XU0 A;  3PCO A;  3SWN B;  2RM4 A;  2I4O A;  2ZT7 A;  2EJF A;  3TUP A;  3RF1 A;  3IG2 A;  2HNI A;  3HXX A;  4HWT A;  3UH0 A;  2ZTG A;  4HT9 A;  5K1P A;  4EMH A;  4PHC A;  2G4C A;  4YRM A;  2DDZ A;  5GMK j;  1IL2 A;  2FYK A;  2DQ3 A;  1WPY A;  1YB3 A;  3R07 A;  1SET A;  1I8F A;  2ZGW A;  2ZNI A;  2VXE A;  4NL2 A;  3JB9 J;  3HFO A;  4C92 C;  2DXU A;  1ADJ A;  4M78 A;  3IAL A;  1U1T A;  4F7U B;  3UFG A;  1JRI A;  2ZXF A;  4PJO A;  4ZTZ B;  4PJO G;  1QF6 A;  3M4P A;  1E24 A;  3NEL A;  3OD1 A;  3E9H A;  3QO3 A;  1KQ1 A;  4MML A;  4P74 C;  1B70 B;  3HY1 A;  1USY A;  4ZIB A;  2DTH A;  3JB9 I;  1N9W A;  2Q5H A;  2ZT5 A;  4WI1 A;  2AMC A;  4EX5 A;  2I4N A;  4YRQ A;  2QTX A;  4M75 F;  1B7Y A;  2DVE A;  3VU3 C;  4H2X A;  3SWN C;  5CAI A;  2QHV A;  4YRI A;  4X9C A;  4X5O A;  4UPA A;  4YRN A;  1ASY A;  1WNL A;  5GAM j;  1JBM A;  4Q6G A;  3V8J A;  5GAO n;  3IKL A;  5GAM g;  2K57 A;  4P3P A;  1I81 A;  4TQF A;  4TVW A;  5DY9 A;  2ZZF A;  3LSQ A;  1SES A;  3BDU A;  3QTC A;  4JRI A;  1PYS A;  4RQE A;  1MGQ A;  4H2Y A;  4M75 A;  1B34 B;  2AKW B;  4YCU A;  1VQZ A;  1N9R A;  4M75 G;  4EMK B;  5LJ3 h;  3JCM X;  4HA8 A;  4HWO A;  4P3O A;  1X55 A;  1HTT A;  3QO7 A;  4P75 A;  3KFU A;  5GAM f;  1D3B B;  4RDX A;  3L4G B;  4TQD A;  4M77 F;  3QO5 A;  3REX A;  2DQ0 A;  2RHS A;  2E64 A;  4UP7 A;  4M7A E;  1GGM A;  4G84 A;  4UP8 A;  1YFT A;  5GAN 5;  4XTV A;  3A7A A;  1HC7 A;  3VQY A;  2CJB A;  4OP0 A;  1H4T A;  4N0A C;  1JJC A;  3JB9 F;  4YRP A;  4NL3 A;  5HGQ A;  2JN0 A;  4YRO A;  4CS3 A;  4P71 A;  1EVL A;  3RER A;  3HXZ A;  4XEM A;  2VC8 A;  1ATI A;  4YPF A;  4K87 A;  1WQW A;  4P72 C;  4QVC A; 
#chains in the Genus database with same CATH topology
 2X4Y A;  4IUR A;  3VJP A;  1YJN T;  1EIY A;  3MO8 A;  4OVA A;  4HWR A;  3FIF A;  3ZFJ A;  3NEM A;  4BI8 B;  3CCL T;  4MDX A;  2QHS A;  3CCQ Q;  4BDZ A;  3PNW C;  1OPK A;  4YP0 A;  1X43 A;  7AT1 B;  1K76 A;  1W70 A;  2E5K A;  4XK8 E;  3RNJ A;  4YRF A;  4J9E A;  4Z8A A;  3JSC A;  2CGH A;  4YTL A;  4ORZ A;  3OYC A;  4KUD K;  3KUF A;  4RTY A;  2SRC A;  3A31 A;  1WHK A;  1NEG A;  2ALY A;  5KYX A;  4H2U A;  4AMC A;  4M7D D;  5GAN h;  2RJE A;  1ASZ A;  2RI5 A;  4DEY A;  3OS0 A;  4RTT A;  4JDS A;  3VQV A;  1YJN A;  3I5R A;  2DU7 A;  1X01 A;  1U1S A;  1VQO Q;  2DJZ A;  2G3R A;  3REB B;  3WXM B;  3CCU A;  1Z9Z A;  3BJU A;  2FL7 A;  2CZ1 B;  2KMT A;  2ROT A;  2LX7 A;  4XTU A;  4C92 A;  3QJY A;  3CPF A;  1RAI B;  2LNV A;  2YLB A;  4A54 A;  4C8Q D;  5A0G A;  4J9C A;  5LJ5 g;  1K73 C;  3CD6 A;  3J7A F;  4H2V A;  2HDA A;  3HFZ B;  5L23 A;  4R55 A;  3OY9 A;  3CCQ A;  3I9Q A;  4RQF A;  4FU6 A;  3VS4 A;  4Q15 A;  3DKM A;  3QKJ A;  1ZUY A;  3CCV A;  2E1H A;  3UF4 A;  2A28 A;  1MUZ A;  2LCC A;  2L3Q A;  4LVK A;  2I2L A;  4ELY C;  3HFV A;  3JCM b;  4LVL A;  2X4W A;  2YLC A;  1KQS S;  3HY0 A;  1QCN A;  3CCE Q;  2PNI A;  4B9W A;  4FW2 A;  2CP7 A;  3E9G A;  2LQW A;  3VS3 A;  3MP1 A;  1M2V B;  4QQ6 A;  4DOW A;  1VQO A;  3J81 E;  4PJO D;  2DO3 A;  2WSC E;  1Y57 A;  3QYH B;  1YFS A;  3HKS A;  2GF7 A;  1CSK A;  4X9D A;  5GAN f;  2ZT8 A;  4F7U G;  1X56 A;  1FMW A;  2M0Y A;  1ZX6 A;  1UTI A;  3OW2 A;  1UGQ B;  1SSH A;  1EIY B;  1ZBX A;  2X4X A;  3JV3 A;  4OB0 B;  2Q7E A;  2BZ8 A;  2XIC A;  2HQX A;  5GMK l;  4RTW A;  3M4Y A;  4M75 E;  3HRK A;  1K73 U;  4CH5 A;  3VQX A;  4E7J A;  4BW9 A;  1YJ9 T;  2ZT6 A;  5GAO m;  2Y90 A;  3X24 B;  1EVK A;  3V7C A;  1NYR A;  4A4K A;  1AZG B;  4YYE A;  1PSF A;  1NJ6 A;  1SG5 A;  3MEY A;  3HRS A;  1BIA A;  3URG A;  2JTM A;  3A74 A;  2J6O A;  2B8A A;  3SHW A;  2QQB A;  5LJ3 j;  2RB6 A;  3OA6 A;  3QUI A;  4PNO A;  5GAN 8;  5KYX B;  2ALY B;  2KSS A;  2YRD A;  3CCE A;  2WAC A;  3CXC P;  1WYX A;  2Q7H A;  1IB8 A;  6AT1 B;  3NET A;  4P71 C;  4ZTU B;  2GFU A;  3ME9 A;  3J80 E;  2CS7 A;  1KQS P;  2HMA A;  1M90 R;  1HD3 A;  3VYG A;  3L2U A;  2AKW A;  4OF1 A;  4K88 A;  4C92 B;  2FO0 A;  2DBK A;  2QG9 B;  4K11 A;  1GCQ A;  1YI2 A;  1W66 A;  4M77 E;  1VQP Q;  4TVR A;  2L3S A;  5IN1 A;  4II1 A;  1M5Q 1;  4LDX A;  1IRE B;  2M1H A;  2OTJ T;  4H2W A;  2A3L A;  2NUT A;  1IXD A;  2X4J A;  2RHX A;  1RAH B;  1XNI A;  4HXJ A;  2J3M A;  3DLM A;  1NJI R;  1I0C A;  1E7O A;  1WLP B;  2IVW A;  2VUB A;  5DM7 R;  2FG0 A;  1VQP T;  1Y0M A;  2CKK A;  4UP9 A;  2XTI A;  3VQW A;  3VYH B;  2GQV A;  1NJ2 A;  5FWC A;  1KMM A;  1UGP B;  2KNB B;  2DVJ A;  3ULR B;  1WXT A;  3E19 A;  3OSS C;  5GAM h;  1M1K U;  1AWO A;  2RF0 A;  2FB7 A;  1AHJ B;  1Q7Y C;  1M3A A;  4MDW A;  3UGT A;  2MWP A;  4JUV A;  2CP3 A;  2RHQ A;  1QVP A;  3JB9 H;  4RTU A;  5GAN g;  2QAS A;  4CI0 C;  2FEI A;  2HKQ B;  3VRZ A;  4YCW A;  2ODR D;  2PU9 B;  2VWF A;  1K9M R;  4J7F A;  2QA4 Q;  3UPU A;  2CYZ B;  3RES A;  1QWF A;  2JZ2 A;  1MMD A;  5GAN 3;  2YT6 A;  4PJJ A;  1KFZ A;  4E47 A;  2DRK A;  5KE2 A;  5KCO A;  3EHQ A;  3H0F A;  1H4S A;  2EYW A;  1D1A A;  3PIO A;  2P0L A;  2YWW A;  1PM3 A;  2QA4 T;  2Q7G A;  2LQK A;  1LCK A;  2PMF A;  4A4F A;  2DTO A;  2I4M A;  4PK4 A;  3V8K A;  3PTA A;  1Q81 C;  2DTI A;  1B70 A;  4M7D F;  2F5T X;  3TQ7 P;  4WJ4 A;  2DIL A;  1W6X A;  3QO8 A;  4KGV B;  2GBQ A;  1X6G A;  3QNE A;  5I2S A;  1OQK A;  1BYM A;  3I56 Q;  1GBR A;  4IUP A;  2C06 A;  1Q7Y U;  2LVM A;  4BI3 A;  1NJ8 A;  3FEO A;  1SSF A;  2ECZ A;  2QEX Q;  2HSE B;  1PD0 A;  4IKF A;  3HHT B;  4C8Q F;  2KRS A;  3G71 Q;  2KE9 A;  3I7F A;  4YCV A;  2NUT B;  1RAB B;  4DBH A;  1PSE A;  1F1B B;  1TS9 A;  3I56 T;  3UT1 A;  3OYH A;  1K8A R;  5A2Q E;  3EG9 A;  3G1Z A;  1S1N A;  3MF2 A;  4AFZ C;  3RUX A;  4V2S A;  2QEX T;  1T0J A;  1QVF P;  1RAE B;  4XTZ A;  5FU6 C;  4CH3 A;  2IIM A;  5IXF A;  3VUB A;  2EQI A;  3GOX A;  2C8M A;  5I2M A;  3G71 T;  5CKB A;  4KGX B;  1Z7N A;  4HCB A;  4OGC A;  2D0N A;  4O6J A;  3S3M A;  1ZA2 B;  11AS A;  3L4G A;  3JCM h;  5E3I A;  2FRW A;  3SDZ A;  1W2B S;  1Q81 U;  3R6O A;  1QE0 A;  3LYI A;  4PFZ A;  4LUE A;  2KXC A;  1VQ5 T;  4Y91 A;  1GCQ C;  1S72 Q;  2QGF B;  4PJO F;  3CC4 Q;  2RQR A;  2RHQ B;  3OBW A;  3I56 A;  5KNN A;  1M3C A;  4XU0 A;  1GFC A;  3PCO A;  2ZT7 A;  1KK7 A;  2EJF A;  3MCA B;  2QEX A;  3TUP A;  1CKA A;  1XTD A;  2HNI A;  2P0K A;  3QYG B;  2QQR A;  4HT9 A;  4E7Z A;  1TUD A;  1VQ4 Q;  3G71 A;  1WXB A;  1IL2 A;  2DQ3 A;  1S72 T;  1NPR A;  4A4G A;  1YB3 A;  1QLY A;  5FRM A;  1C0M A;  1I8F A;  2LJ1 A;  1KSW A;  1ZSG A;  2DXU A;  3LW5 E;  2O31 A;  3M58 A;  2ZXF A;  2NWM A;  1WGS A;  1QF6 A;  3OD1 A;  2CZ6 B;  2V1Q A;  1KQ1 A;  2HAX A;  1VQM Q;  1B70 B;  1NPP A;  2EYX A;  2DTH A;  3JB9 I;  1MV0 B;  1SRL A;  2AMC A;  2PUK B;  2I4N A;  2K5I A;  1B7Y A;  5HK0 A;  5IHK A;  3CXC A;  2H8H A;  2DVE A;  4H2X A;  1S72 A;  5CAI A;  2QHV A;  2CP6 A;  1PRL C;  2MF2 A;  3CC4 A;  1RAD B;  4UPA A;  1BI3 A;  4YRN A;  1WNL A;  1X69 A;  1W2B P;  5GAM g;  2KK4 A;  2AK5 A;  4TVW A;  1I81 A;  1IHW A;  1RI0 A;  4HVW A;  3VS2 A;  3M0T A;  2DJQ A;  1VQ4 A;  3FC3 A;  1M27 C;  1ACM B;  2CZ0 B;  4FT4 A;  3EG9 B;  1PYS A;  1UHC A;  4D8K A;  4RQE A;  1QMC A;  4AFU C;  5J26 A;  4M75 A;  2EYQ A;  2A08 A;  3CPW P;  2EKO A;  1UGV A;  1U3O A;  2EW3 A;  5LJ3 h;  2YDL A;  1QKW A;  4HWO A;  1K73 R;  1VQK Q;  4AFQ C;  1UB4 A;  1D3B B;  2RK2 A;  5CK9 A;  3L2R A;  4RDX A;  2A37 A;  3L4G B;  1VQM A;  1IHV A;  3QO5 A;  3TEE A;  2ABL A;  2LZ6 B;  3CCM A;  4UP8 A;  4RTV A;  3PMI A;  1YFT A;  2BUD A;  1X75 C;  3VQY A;  2RNA A;  1JJC A;  4MZT A;  1OPL A;  3EFO A;  4YRO A;  3DB3 A;  1EVL A;  3RER A;  3E9F A;  2X51 A;  2E4H A;  4YPF A;  3EG2 A;  4OMF B;  4AT1 B;  2MI6 A;  2MPX C;  4M77 A;  4M7D E;  2P4T A;  1YGB A;  2PUO B;  3CC7 T;  4YRT A;  2EGE A;  1G5H A;  1AD5 A;  2EL9 A;  1KD1 C;  5I21 A;  1YWP A;  3M5A A;  5GJW B;  1ZUU A;  1E22 A;  2KVQ G;  2DU5 A;  1AWW A;  5KYN A;  1AOJ A;  1VQK A;  2KXD A;  5FLX E;  3JB9 G;  1MND A;  1N8R C;  4YRR A;  4C8Q E;  2OAU A;  1AWJ A;  1NG2 A;  3FJP A;  1QVG P;  1LNX A;  4IUQ A;  5GMK e;  4HVC A;  1B7Y B;  1NJI U;  3A32 A;  3O8V A;  3PZC A;  2AHJ B;  1BCO A;  1WXU A;  4QT7 A;  3HSB A;  2XMF A;  4AH6 A;  3JCM g;  4ZN3 A;  3EG1 A;  2E5A A;  3BW1 A;  1JJ2 A;  1PNJ A;  5GAN 6;  3VV0 A;  4PG3 A;  1I5O B;  2EQK A;  1VYT A;  3G4S T;  5LJ5 e;  2R5M A;  1Y96 A;  3P8D A;  1PYS B;  4CC4 B;  1YP5 A;  2HKN A;  2ZR2 A;  2QQ9 A;  3GPL A;  2DEU A;  4M7A B;  4XQ3 A;  4BI4 A;  4D6W A;  5CO7 A;  1BI0 A;  3A5Z A;  2XG8 D;  3PT9 A;  1GBQ A;  2DIQ A;  4PJO E;  1ZSZ A;  3OB9 A;  3PGG A;  4F7U F;  2BZX A;  2KT8 A;  2P5I A;  2JOY A;  4JPB W;  2J06 A;  5GAO l;  1K9M U;  1KD1 U;  2MYS A;  2LCL A;  1QVF A;  1TG0 A;  1MV3 A;  1FMK A;  4NOY A;  3SWN A;  5CKF A;  1RIQ A;  4HWP A;  2XID A;  3BFM A;  3OYJ A;  4O5V A;  5LJ5 f;  2P84 A;  1G51 A;  2E70 A;  4JJN K;  3P8B B;  1Q86 C;  2ARS A;  4M78 D;  1JJC B;  4E51 A;  1K0X A;  1EZZ B;  4ZNX A;  1HSQ A;  1G83 A;  2LNH B;  3H41 A;  1SHG A;  1N9S A;  1KQ2 A;  2EQU A;  5L8R E;  1OEB A;  2CUB A;  3S3O A;  2HEQ A;  4M7A C;  2DAQ A;  3RGL A;  4OB2 B;  1Q7Y R;  2EJG A;  4FYY B;  4HWS A;  4FSS A;  1JEG A;  1M3B A;  5GAO q;  3RMS A;  1WI7 A;  3L2Z A;  3GNF B;  5HY6 A;  1WFW A;  4BY6 B;  3CCL Q;  4DBQ A;  2NLU A;  2VKN A;  3F70 A;  3JCM W;  4A63 B;  1I4K 1;  4JRQ A;  2KQW A;  1K1Z A;  1K8A U;  5GAO r;  3QWX X;  5LJ3 g;  1VOM A;  2P4R A;  2RHI A;  4DBF A;  2QDL A;  3OYF A;  3NMZ C;  5KYW A;  2BE9 B;  1YFR A;  2DXT A;  2EBP A;  4BDY A;  1M1G A;  1H3Z A;  2H3E B;  3CC2 T;  1Q81 R;  4FSX A;  2YUQ A;  1N5Z A;  4BWA A;  1JO8 A;  4XU3 A;  3RKW A;  3GP8 A;  2JNG A;  4M4Z A;  3EFS A;  4PFP A;  1VA7 A;  1BU1 A;  2GQI A;  4YRJ A;  1ZSZ B;  3QG1 A;  3U23 A;  4BY6 C;  3ERR A;  3ZBD A;  4RTX A;  2KY9 A;  2QYZ A;  1Z7M A;  1B3Q A;  3CEY A;  3CCL A;  1D0Y A;  3CPW A;  1I5L A;  3I55 T;  3P8V A;  3MEA A;  2K79 A;  2RO0 A;  2PTK A;  1NLO C;  5CR2 A;  4J7I A;  4OMO A;  1ZHI A;  4AG1 C;  4XU2 A;  2EPD A;  1P92 A;  2D1X A;  3V7S A;  1M2O A;  4IUT A;  2ZIM A;  4CS2 A;  5IHN A;  4XTX A;  4L87 A;  4CH6 A;  4TWA A;  4FL6 A;  5GAN e;  3JB9 D;  4KR2 A;  2WSF E;  3OYN A;  2ESW A;  1D1B A;  2MWO A;  3G6E Q;  2A7Y A;  2FVU A;  2I0N A;  2CH4 W;  2ZPG B;  4E2F B;  2RHS B;  4TTV A;  4DBR A;  2JJ9 A;  3OS2 A;  5FRO A;  1ZSZ C;  3G1J A;  2V8J A;  1EX4 A;  2A0F B;  1O75 A;  2KRO A;  3L1A A;  3UGQ A;  1WDX A;  4RMF A;  1J5W A;  5GAN d;  1D1C A;  2DK3 A;  4OMM A;  4H2S A;  1ZLM A;  1QCF A;  4ZGJ B;  3G6E T;  1KC8 C;  1QP2 A;  3N5B B;  3HRI A;  4XU1 A;  2ZPI B;  1YJ9 Q;  2HBP A;  4L6V 5;  1A0N B;  2XU8 A;  3OYK A;  2E41 A;  1WHL A;  2XI9 A;  2KYB A;  4FYW B;  3OYM A;  1SRY A;  1TUG B;  12AS A;  1QVG A;  3EGX A;  1WIE A;  4J6W A;  2CP0 A;  2JM8 A;  4AFS C;  4M7A G;  3REA B;  5IT9 E;  2K5L A;  3ZEH A;  4F7U E;  2PQW A;  2EWN A;  4XTW A;  2IY5 A;  1OV3 A;  1FYN A;  2DL7 A;  3P8Y A;  5F5W A;  2L5Q A;  3LX7 A;  3I5S A;  4C0D B;  1LVK A;  4J9H A;  3KXT A;  1V29 B;  2R58 A;  2VB6 A;  1IGQ A;  4M7D A;  5D6X A;  5C52 B;  5DLO A;  2R57 A;  3DB4 A;  2OTJ Q;  2L89 A;  4MMK A;  1J3T A;  1XOV A;  3PFS A;  1TH7 A;  4EMK A;  1YJ9 A;  5D7U A;  1EFN A;  2DE0 X;  5GAO p;  1BIB A;  2L8D A;  3PVL A;  3IKM B;  3TSW A;  1YN8 A;  4Y92 A;  4C8Q A;  4XAX B;  2L0A A;  2DZ9 A;  3MEV A;  4M78 F;  2K3Y A;  2FZK B;  4FIB A;  4QQD A;  1M4Z A;  4C0D C;  4JZ4 A;  1LYL A;  2RHY A;  1WJS A;  2I4O A;  3RF1 A;  3L42 A;  4N4I A;  5K1P A;  2F69 A;  2FHD A;  2LTO A;  2E12 A;  1UJ0 A;  4RG2 A;  5GMK j;  1YJW T;  3H0H A;  5D6Y A;  2FYK A;  3QZ5 B;  2YXY A;  1WPY A;  1YIJ T;  2EVR A;  1OZ2 A;  3R07 A;  4J9D A;  1BBZ A;  1SET A;  2ZGW A;  2VXE A;  2AIR B;  1TU0 B;  2V26 A;  4IUU A;  4C92 C;  2PVD B;  1Z9Q A;  2OTJ A;  1JRI A;  4PJO A;  1KHI A;  3CMA Q;  4C5H A;  3M4P A;  1VQ8 Q;  3MJX A;  3E9H A;  1H92 A;  1TOV A;  2HBW A;  4ZIB A;  1VQP A;  3EGX B;  4BE1 A;  1KD1 R;  2Q5H A;  2OJ2 A;  4RG8 A;  2ZT5 A;  2ZPF B;  5ECA A;  4YRQ A;  3VS6 A;  2K9G A;  1YBY A;  3CMA T;  2B86 A;  1N8R R;  1D0X A;  2GNC A;  1VQ8 T;  4KBM B;  2VYT A;  1ASY A;  1OUL A;  2QI2 A;  2P0P A;  2GFA A;  3IKL A;  4PLL A;  1RUW A;  5DY9 A;  4Q5W A;  2ZZF A;  3LSQ A;  2FZC B;  3M59 A;  1SF9 A;  2O4X A;  2MK5 A;  1X27 A;  2RQU A;  2VGM A;  2K7A A;  1MGQ A;  1UDL A;  2AKW B;  1VQZ A;  1I1J A;  4EMK B;  1C1A A;  3JCM X;  4HA8 A;  4P3O A;  2DL4 A;  3QO7 A;  1VQ8 A;  4P75 A;  5GAM f;  3E1S A;  1PCX A;  1MMG A;  2LX9 A;  1UGR B;  4C0G A;  2QA4 A;  4N4G A;  1UFF A;  4G84 A;  2DD5 A;  4QW2 A;  4XTV A;  1ZBJ A;  4LD9 K;  3OYI A;  3JAM E;  4MZM A;  1E6G A;  1HC7 A;  2C0O A;  4P5N A;  3JB9 F;  4YRP A;  3X20 B;  2OTL T;  1VQ5 Q;  4JZ3 A;  4CS3 A;  1MNE A;  3ASK A;  3OMG A;  2VC8 A;  2F2V A;  1Q82 C;  4PJL A;  1Q86 R;  2HD0 A;  2RQV A;  3C12 A;  4N4H A;  5EG2 A;  3ZL7 C;  2K3B A;  4M7A D;  2ATC B;  2QTV A;  5J3B A;  1LOJ A;  1UGS B;  3GBQ A;  1TSF A;  1UHF A;  4EMK C;  1TTH B;  3VKI A;  4YRK A;  2DL3 A;  1PC0 A;  4L5G A;  2WSE E;  3JCM V;  1R0B G;  2DPP B;  3SFM A;  2K5F A;  1WU7 A;  2KDS A;  3JCM P;  3RL6 A;  2XKO C;  4LD6 A;  3GNG A;  3TRE A;  5GJV B;  4LDW A;  2MCN A;  4WF2 A;  2COW A;  4FYX B;  3CCJ Q;  1H64 1;  1M8V A;  1ZUK A;  1M30 A;  1NZ9 A;  1R77 A;  1H4Q A;  1C0A A;  3EG3 A;  1RAC B;  2NS6 A;  3JCM e;  1L0W A;  2KI7 A;  1QKX A;  1FXX A;  1VQ5 A;  3CCJ T;  3A8M B;  1YIT T;  4ATO A;  2ED1 A;  2L3P A;  4C92 G;  1RI9 A;  3CBM A;  2XD0 A;  1YFN A;  1N27 A;  2DA9 A;  4B9X A;  5KH6 A;  2O4X B;  2LT1 A;  4LDY A;  4HVU A;  3MP8 A;  2YRV A;  4BE0 A;  2F2W A;  2K4Y A;  2DL8 A;  2X3X D;  4CC7 A;  4M78 E;  2ZZE A;  3TEG A;  4DOV A;  1H8K A;  5GAN j;  4QKU A;  4DEX A;  1KQS A;  2EAY A;  3JCM f;  1AT1 B;  4A4E A;  1CKB A;  4E7K A;  3A98 A;  2PZ1 A;  2YUO A;  2LCS A;  1R0C B;  3BE3 A;  3VS5 A;  3CCJ A;  5C53 B;  3AHU A;  3REU A;  1U06 A;  5ELN A;  2EQJ A;  2KR3 A;  4QVD A;  1YHQ T;  3LWH A;  1C6V X;  2EYY A;  3RR6 A;  2C0T A;  3NTI A;  2ARU A;  4F7U A;  3L2W A;  1VQ6 T;  1U8R A;  1RLQ C;  1B76 A;  5FW9 A;  1FWZ A;  4GBQ A;  3SD4 A;  2DET A;  2XK0 A;  3EGU A;  4PKC C;  3JRZ A;  1VUB A;  4BB7 A;  3TEH A;  3QJ6 A;  3OW2 S;  1PG5 B;  3MHX A;  4P75 C;  3ER0 A;  3HXU A;  1WX6 A;  4J9B A;  8ATC B;  4KQE A;  1K0S A;  3CC7 Q;  3PCO B;  3VBB A;  4ZGD B;  3NEN A;  2BTT A;  4XTY A;  2CSI A;  4KRT A;  2RI3 A;  1SER A;  1ZA1 B;  3PIP A;  2EIF A;  2ZZD A;  3I35 A;  1VIE A;  1TUC A;  1KC8 R;  2RK1 A;  3OQ5 A;  2LRQ A;  2DYI A;  3M9Q A;  2DF6 A;  4ZN1 A;  1ADY A;  2EGA A;  3R6N A;  2XGT A;  2RQW A;  1QW1 A;  4PJM A;  4P73 A;  3FJ5 A;  1VQN Q;  1B34 A;  1VQL Q;  1EOV A;  1BI2 A;  1OOT A;  1LJO A;  4J6Y A;  2COY A;  3M0U A;  2M16 A;  2PVO B;  3HFN A;  2AMC B;  4G85 A;  4LUD A;  2YRC A;  5LJ3 f;  4ESR A;  2RJD A;  3G4S Q;  4J8O A;  4H2X B;  1QQJ A;  1VQN T;  1VQL T;  1SRM A;  4L59 A;  3X26 B;  5K1X A;  2VGN A;  3P8H A;  4OML A;  2ZIO A;  4A53 A;  3CC7 A;  4D8D A;  4QVZ A;  4E7L A;  4P3N A;  5CQY A;  2DXB A;  3A7R A;  3JCM Q;  2JTF A;  3T9N A;  2KRM A;  2KT1 A;  3SB2 A;  1GL5 A;  3Q1J A;  4RUG A;  4EIK A;  2GTO A;  2ZR3 A;  4M75 B;  4P74 A;  2ROL A;  4YDQ A;  3VRY A;  1K4U S;  1FMV A;  2ZIN A;  1U5S A;  3H0I A;  4KR3 A;  1VQL A;  4F14 A;  1KMN A;  4YRC A;  4HCC A;  2CSQ A;  2BE7 D;  3M4G A;  3S6W A;  2EJ9 A;  5LJ5 d;  3RKY A;  4HVV A;  4PFO A;  1ABO A;  4NCX A;  3UAT A;  1AZE A;  4LNP A;  3TEH B;  4GLK A;  1OU9 A;  4M7A F;  1N8R U;  3G4S A;  4CH4 A;  2F5K A;  3VS1 A;  3ICA A;  4JLG A;  5HKC A;  2NUP A;  1PD1 A;  4F04 B;  2A36 A;  1Y71 A;  2RJF A;  3EFO B;  4J15 A;  1NM7 A;  1HJD A;  1SKU B;  4C92 D;  2LP5 A;  1VYV A;  2V1R A;  4Z89 A;  1W4S A;  1ZQ1 A;  1EIF A;  1VQ7 T;  3M0P A;  1NYF A;  2CT3 A;  2FRY A;  4M77 B;  3LGL A;  2J6F A;  3OYD A;  4M75 C;  1GCP A;  3C95 A;  2MAM A;  3M0R A;  3WVE B;  1UUE A;  1BK2 A;  2KBT A;  3HFZ A;  5HCK A;  3M0S A;  4LDV A;  3CMQ A;  1AWX A;  1IGU A;  2YHT A;  2EFI A;  1V76 A;  1YNZ A;  1GRI A;  2O9V A;  5EC7 A;  1QCO A;  2MMP A;  2CJA A;  1WQ7 A;  3CC2 Q;  2HL5 C;  4KT0 E;  2RMO A;  3NTK A;  4LE9 A;  1EQR A;  2QGG A;  4PL6 A;  2J3L A;  1BI1 A;  4OGE A;  1MMA A;  1UEC A;  4F17 A;  2ZPB B;  3VS7 A;  2HZY A;  4P72 A;  2DIG A;  2HQE A;  1Q86 U;  1UEB A;  2NYS A;  4EMG A;  4M77 C;  3THK A;  3LC0 A;  4CS4 A;  1Y96 B;  1W2B A;  4JJB A;  1BCM A;  2M51 A;  3UDC A;  2CT4 A;  3EFR A;  4E7I A;  1KOG A;  2ZPE B;  3CD6 Q;  3I55 Q;  2ZAE A;  1X54 A;  4P73 C;  1M9S A;  2Z0W A;  3A5Z B;  2FPD A;  2K6D A;  3CCU T;  2PME A;  2O9S A;  1E1O A;  2DX1 A;  1W1F A;  5M9O A;  2ZCE A;  5A0L A;  3CCV Q;  2JUF A;  4HCK A;  3SWN B;  2RM4 A;  3H9N A;  2AZV A;  3CD6 T;  2KYM A;  3EH2 A;  2C0I A;  3UH0 A;  4EMH A;  4PHC A;  2G4C A;  2M9U A;  4E6R A;  3CC2 A;  2CUD A;  4OB1 B;  3CCQ T;  2CH4 A;  2RPN A;  2NUP B;  3GLX A;  3CCV T;  2JS0 A;  1OI1 A;  2ZNI A;  3HFO A;  3M0Q A;  1KJW A;  4KUL A;  4M78 A;  2EGC A;  1Q82 R;  3IAL A;  2BKD N;  3UFG A;  2LJ0 A;  3PE0 A;  3S3N A;  1D0Z A;  4ZTZ B;  5I11 A;  4F16 A;  3QXE B;  3NEL A;  3QO3 A;  4FYV B;  4MML A;  5KYY A;  2R5A A;  2QAZ A;  4P74 C;  1O9S A;  1USY A;  3I55 A;  4WI1 A;  2DRM A;  2XDP A;  1VQO T;  4J9G A;  2F1L A;  4KUI A;  3VU3 C;  3FLG A;  3SWN C;  2L2P A;  3QZ9 B;  4X5O A;  2QK0 A;  3CXC S;  1JBM A;  5GAO n;  1AEY A;  4LVJ A;  1IRX A;  1WHJ A;  3MET A;  2K57 A;  4IIO A;  4TQF A;  4ZTF A;  1KHC A;  3KFV A;  1XJW B;  2LC4 A;  3BDU A;  1PWT A;  5KYW B;  4JS5 A;  4ZGE B;  4RMO A;  3GF5 A;  3A8L B;  4H2Y A;  5CQX A;  3OBY A;  3M53 A;  5KE3 A;  1N9R A;  4M75 G;  2O88 A;  5CKE A;  2DXC A;  2DMO A;  2EQM A;  2X35 A;  3NPF A;  1PRM C;  3A8H B;  1X55 A;  3C4S A;  1HTT A;  3CCE T;  1YI2 Q;  4J83 A;  3G6E A;  2COZ A;  3IQL A;  3DLL A;  5AYF A;  3REX A;  2YUN A;  5AT1 B;  1JXO A;  4UP7 A;  4M7A E;  1GGM A;  1H3H A;  2MOX A;  4VUB A;  1QP3 A;  5IAY A;  5GAN 5;  2AZS A;  2ZCF B;  2J7I A;  4FCY A;  3A7A A;  4UC4 A;  2CJB A;  2O01 E;  1LPL A;  1YI2 T;  5I22 A;  1X2K A;  5HGQ A;  2D9T A;  5FU7 B;  4RKU E;  3QII A;  1KC8 U;  3OSV A;  1OX8 A;  2CZ7 B;  3FDR A;  1ATI A;  1ABQ A;  1M1K C;  1WQW A;  4BD3 A;  4QVC A;  4P72 C;  1PHT A;  2HSP A;  4GY5 A;  4M77 G;  2W10 A;  1JB0 E;  4JS4 A;  4M78 B;  2E65 A;  1YJW Q;  2W0Z A;  3INZ A;  3HTR A;  1YIJ Q;  1X2G A;  4C92 F;  1G3T A;  3V8L A;  5KYY B;  2ZNJ A;  1NE8 A;  4RCC A;  2FPF A;  1RLP C;  3C94 A;  1FX7 A;  4HT4 A;  4KH1 B;  2IPO B;  5FWB A;  4OLF A;  2V8K A;  4LNS A;  4A4H A;  2J6K A;  2CJ9 A;  5IXB A;  5FU7 C;  2DER A;  1AVZ C;  3OYA A;  3UA7 A;  1Y07 A;  2VAS A;  4E7H A;  3TSZ A;  4YRE A;  3DSQ A;  5C6S A;  2E6Z A;  1B07 A;  4C5I A;  3OYE A;  4FW1 A;  3MPU B;  1JU5 C;  1G8X A;  5LJ5 j;  4OMQ A;  4YRG A;  2PVG B;  1JJ2 S;  4JRK A;  2LQ8 A;  4M78 C;  1KG1 A;  2ZZG A;  3NHN A;  1T3S A;  1NLP C;  2RA2 A;  4X34 A;  3H8Z A;  2ED0 A;  1VYU A;  2DFU A;  2OI3 A;  5GAN 7;  1YJW A;  2FZG B;  2LJ3 A;  3FRN A;  2JVV A;  4H2T A;  3NFC A;  3HXY A;  1YIJ A;  1NYG A;  1USY C;  2IY5 B;  3TCJ A;  5GAM e;  2KEA A;  3RBB B;  1JQQ A;  3HXV A;  4FM4 B;  4AG2 C;  5J39 A;  4J6X A;  1RAF B;  4GLM A;  2F2X A;  2QDY B;  2HQH A;  1TWB A;  3OYB A;  1QVF S;  1BBW A;  3HTZ A;  2IG0 A;  1N6A A;  4M7D B;  4RCB A;  4XEO A;  1VIF A;  2RH2 A;  3EGD A;  1GFD A;  5CVI A;  5GAM d;  1RAG B;  2D6F A;  2HCK A;  1NEB A;  3M57 A;  2E3I A;  5FU6 B;  3CMA A;  2XDB A;  1BBU A;  3RAC A;  2QHT A;  2JW4 A;  4LXC A;  4TVA A;  4HT8 A;  2VXF A;  3VUZ A;  2DM1 A;  4C8Q B;  2OTL Q;  2P0Q A;  1WJR A;  4BE2 A;  4LVM A;  1R8O B;  3HXW A;  2K3X A;  2MIO A;  3EHR A;  1V1C A;  3KBG A;  1WJQ A;  4NS5 A;  2D8J A;  5KYU A;  4MZP A;  3NGP A;  4WJ3 M;  1PKS A;  1JJ2 P;  1NNH A;  5CKD A;  3C0C A;  3JCM J;  3GIB A;  1WZO A;  2K2V A;  3G7Z A;  5A0D A;  1WLE A;  3CBP A;  3FB9 A;  2ENM A;  4Y28 E;  2CP5 A;  3L2Q A;  3M56 A;  1QWE A;  1G5V A;  2DZC A;  4M7D C;  3JCM c;  1OYX A;  3QHS A;  4JLI A;  4YRS A;  4C0F A;  2BIV A;  4M75 D;  2AKL A;  4PJN A;  1SPK A;  3BY7 A;  4PJO B;  1PKT A;  4OB3 B;  2SEM A;  1OX9 A;  4OMP A;  4C8Q C;  3QWY A;  1ARK A;  2RHZ A;  1D3B A;  2OTL A;  3HPW A;  4FT2 A;  2H3J A;  5GMK m;  1H4V B;  2D8H A;  1YIT Q;  3M54 A;  2RD1 A;  3OYL A;  4BAC A;  3A1P A;  4EDU A;  2DD4 A;  2RQT A;  2XDD A;  3A7U A;  5GAN 2;  2VVK A;  4DA4 A;  1NJ1 A;  4R56 A;  3A8G B;  2C7I A;  1VQ9 Q;  4KGZ B;  2LMJ A;  3CBO A;  4LN2 A;  3MEW A;  1E6H A;  4J9I A;  2GTJ A;  3OYG A;  3A8O B;  2JMC A;  1YWO A;  4JJC A;  4C0Z A;  3W3S A;  2BZY A;  2M02 A;  4M77 D;  5GAN 4;  1YCS B;  3CPW S;  2O2O A;  1Q82 U;  4DPG A;  3CC4 T;  3EGD B;  1G3W A;  3RMQ A;  2AT1 B;  4PJO C;  3JCM d;  4J5Y A;  3X25 B;  1VQ9 T;  2OAW A;  4JRP A;  5IH2 A;  1WYD A;  4O2D A;  1MMN A;  4K86 A;  4M78 G;  1YCY A;  3EAE A;  3MQZ A;  4C92 E;  3E2U A;  1VQ4 T;  4TVA B;  4WTO B;  1RAA B;  2FPE A;  3QDR B;  1GXI E;  1YHQ Q;  1OZ3 A;  2LT4 A;  4H02 A;  4KH0 B;  1MHN A;  5FRN A;  3RKX A;  1G5I A;  5C51 B;  3CCM Q;  1VQ6 Q;  1YIT A;  2ZPH B;  5KYU B;  4Z88 A;  3MF1 A;  1WHH A;  3EG0 A;  3QSU A;  1TXQ A;  1NJ5 A;  3MP6 A;  3QDF A;  2J05 A;  1E1T A;  3CCR Q;  1KIK A;  2RJC A;  1UE9 A;  5C0M A;  1IO6 A;  2YUP A;  1VQM T;  2ART A;  1SHF A;  2LDM A;  3V7R A;  4YRL A;  1HXD A;  1VQ9 A;  3LH5 A;  3E9I A;  1WHG A;  1M90 C;  3CCM T;  2JTE A;  2Q5I A;  5KCH A;  4HKE A;  2JXB A;  2CIM A;  1FYF A;  2E6N A;  4IUV A;  2DL5 A;  4C5G A;  4OMN A;  3CCR T;  3LSS A;  4M7A A;  2JT4 A;  3RIR A;  2DKG A;  3OYY A;  1QVG S;  1NBE B;  3AT1 B;  1NYQ A;  1X2H A;  3OS1 A;  1M1F A;  3M4Q A;  1M8M A;  1YHQ A;  2GCX A;  1NJI C;  2E3C A;  2QHU A;  2I4L A;  5LJ3 e;  1HK9 A;  4N0A A;  1Y7X A;  2G6F X;  3CQT A;  3CME Q;  5ELO A;  3WQZ A;  1VQ6 A;  5GMK i;  2E10 A;  4CRI A;  4WCI A;  4LDU A;  3O5Z A;  3P8T A;  3LGF A;  1UG1 A;  2VV5 A;  3LH0 A;  1T0H A;  1VQK T;  4M7D G;  5CIU A;  1X2Q A;  3HRU A;  3CCR A;  1B8A A;  4ZTJ A;  1G2B A;  1EFW A;  3OS5 A;  9ATC B;  2X3W D;  5GMK h;  4CC3 A;  5LJ3 d;  3CME T;  1WHM A;  4X1V A;  4B6M A;  2KRN A;  3H6Z A;  1BKB A;  2CP2 A;  5D6W A;  5HK3 A;  1M90 U;  1RL2 A;  2QQA A;  4TVY A;  3SEM A;  2KAF A;  3CCS Q;  4C8Q G;  2RI2 A;  2YSQ A;  2AKK A;  4IIM A;  1K9M C;  2DLP A;  2HL3 A;  1XQH A;  3NTH A;  2L3R A;  4HCZ A;  1D09 B;  3HL8 A;  3A5Y A;  4EO4 A;  2JM9 A;  4DQ2 A;  5LJ5 h;  2DEQ A;  2ODR C;  3OW2 P;  3IG2 A;  1Q95 G;  3HXX A;  4ME7 A;  4HWT A;  2ZTG A;  3CCS T;  4YRM A;  3MEU A;  2RHU A;  5IHI A;  4JJD A;  2DDZ A;  4R0K A;  1OU8 A;  3CME A;  4CC2 A;  1SEM A;  2EKH A;  2CRE A;  3EH1 A;  4NL2 A;  3PMT A;  3LWI A;  2V8I A;  3JB9 J;  1ADJ A;  4Z02 A;  2E5Q A;  1U1T A;  4F7U B;  2JMA A;  1VQN A;  2Y4X A;  1M1K R;  3OMC A;  3TU4 K;  4PJO G;  1E24 A;  1IZ6 A;  2QQS A;  5DLQ E;  3HY1 A;  3LLR A;  4J9F A;  1N9W A;  2EYZ A;  1UJY A;  2DYB A;  4EX5 A;  3CCS A;  3M55 A;  2QTX A;  1VQ7 Q;  4M75 F;  2KGT A;  1B7T A;  3MKD A;  4YRI A;  1I07 A;  3WVD B;  4X9C A;  4EPC A;  3D7S B;  5GAM j;  4Q6G A;  1K8A C;  1X6O A;  1WA7 A;  3V8J A;  3PVQ A;  3RDV A;  4P3P A;  2OX7 A;  3BDL A;  1SES A;  4C5E A;  3QBY A;  3QTC A;  1T3L A;  3UA6 A;  1DJ7 B;  2NUZ A;  4JRI A;  4ELZ C;  2DNU A;  3HRT A;  1K9A A;  4PLI A;  1B34 B;  2M0O A;  4YCU A;  3QPH A;  2A8E A;  5CKH A;  2X9H A;  3L2V A;  8AT1 B;  1BB9 A;  4ANJ A;  3KFU A;  2QXF A;  4LVI A;  2GGR A;  1JXM A;  4TQD A;  4M77 F;  2JS2 A;  2DQ0 A;  2RHS A;  2E64 A;  3UWN A;  4RTZ A;  2DBM A;  1VQ7 A;  2E3H A;  3HP9 A;  2D0Q B;  5CCA A;  1YJN Q;  4BUG A;  4OP0 A;  1H4T A;  4QQG A;  4N0A C;  1X6B A;  1M2V A;  3VS0 A;  3X28 B;  4NL3 A;  5LL6 S;  2JN0 A;  1G3Y A;  3CCU Q;  2XHC A;  4P71 A;  2CDT A;  2RN8 A;  1HYO A;  3HXZ A;  2Y4Y A;  4E7S A;  4XEM A;  1G3S A;  4K87 A;  2K2M A;  2LQN A;  3TVT A; 
#chains in the Genus database with same CATH homology
 2X4Y A;  4IUR A;  3VJP A;  1YJN T;  1EIY A;  3MO8 A;  4OVA A;  4HWR A;  3FIF A;  3ZFJ A;  3NEM A;  4BI8 B;  3CCL T;  4MDX A;  2QHS A;  4BDZ A;  3PNW C;  4YP0 A;  4XK8 E;  4YRF A;  3JSC A;  2CGH A;  4YTL A;  3OYC A;  4KUD K;  3KUF A;  3A31 A;  2ALY A;  4H2U A;  4M7D D;  5GAN h;  2RJE A;  1ASZ A;  2RI5 A;  3OS0 A;  4JDS A;  3VQV A;  1YJN A;  2DU7 A;  1X01 A;  1U1S A;  2DJZ A;  2G3R A;  3WXM B;  3CCU A;  3BJU A;  2FL7 A;  2CZ1 B;  2KMT A;  4XTU A;  4C92 A;  3QJY A;  3CPF A;  2LNV A;  2YLB A;  4A54 A;  4C8Q D;  5A0G A;  5LJ5 g;  1K73 C;  3CD6 A;  3J7A F;  4H2V A;  3HFZ B;  3OY9 A;  4R55 A;  3CCQ A;  4RQF A;  4FU6 A;  4Q15 A;  3DKM A;  3QKJ A;  3CCV A;  2E1H A;  2LCC A;  4LVK A;  2I2L A;  4ELY C;  3HFV A;  3JCM b;  4LVL A;  2X4W A;  2YLC A;  1KQS S;  3HY0 A;  4B9W A;  3E9G A;  3MP1 A;  4QQ6 A;  4DOW A;  1VQO A;  3J81 E;  4PJO D;  2DO3 A;  2WSC E;  3QYH B;  1YFS A;  3HKS A;  2GF7 A;  4X9D A;  5GAN f;  2ZT8 A;  4F7U G;  1X56 A;  3OW2 A;  1UGQ B;  1EIY B;  1ZBX A;  2X4X A;  2Q7E A;  4OB0 B;  2XIC A;  2HQX A;  5GMK l;  3M4Y A;  4M75 E;  3HRK A;  1K73 U;  4CH5 A;  3VQX A;  4E7J A;  4BW9 A;  1YJ9 T;  2ZT6 A;  5GAO m;  2Y90 A;  3X24 B;  1EVK A;  3V7C A;  1NYR A;  4A4K A;  4YYE A;  1PSF A;  1NJ6 A;  3MEY A;  3HRS A;  1BIA A;  3URG A;  2JTM A;  3A74 A;  2B8A A;  2QQB A;  5LJ3 j;  2RB6 A;  3OA6 A;  3QUI A;  4PNO A;  5GAN 8;  2ALY B;  2KSS A;  3CCE A;  2WAC A;  2Q7H A;  3NET A;  4P71 C;  4ZTU B;  2GFU A;  3ME9 A;  3J80 E;  2CS7 A;  3VYG A;  3L2U A;  2AKW A;  4OF1 A;  4K88 A;  4C92 B;  1YI2 A;  1W66 A;  4M77 E;  4TVR A;  5IN1 A;  4II1 A;  1M5Q 1;  4LDX A;  1IRE B;  2M1H A;  2OTJ T;  4H2W A;  2A3L A;  2X4J A;  2RHX A;  1XNI A;  2J3M A;  3DLM A;  2IVW A;  2VUB A;  5DM7 R;  1VQP T;  2CKK A;  4UP9 A;  2XTI A;  3VQW A;  3VYH B;  2GQV A;  1NJ2 A;  1KMM A;  1UGP B;  3E19 A;  3OSS C;  5GAM h;  1M1K U;  2FB7 A;  1AHJ B;  1Q7Y C;  4MDW A;  3UGT A;  2MWP A;  4JUV A;  2RHQ A;  1QVP A;  3JB9 H;  5GAN g;  4CI0 C;  4YCW A;  2ODR D;  2PU9 B;  4J7F A;  3UPU A;  2CYZ B;  3RES A;  2JZ2 A;  5GAN 3;  4E47 A;  5KE2 A;  5KCO A;  1H4S A;  3PIO A;  2P0L A;  2QA4 T;  2Q7G A;  2LQK A;  2PMF A;  4A4F A;  2DTO A;  2I4M A;  3V8K A;  3PTA A;  1Q81 C;  2DTI A;  1B70 A;  4M7D F;  2F5T X;  4WJ4 A;  3QO8 A;  3QNE A;  5I2S A;  1BYM A;  4IUP A;  2C06 A;  1Q7Y U;  2LVM A;  4BI3 A;  1NJ8 A;  3FEO A;  1SSF A;  4IKF A;  3HHT B;  4C8Q F;  3I7F A;  4YCV A;  1PSE A;  3I56 T;  3G1Z A;  3UT1 A;  3OYH A;  5A2Q E;  3MF2 A;  3RUX A;  4V2S A;  2QEX T;  4XTZ A;  5FU6 C;  4CH3 A;  3VUB A;  3GOX A;  2C8M A;  5I2M A;  3G71 T;  5CKB A;  1Z7N A;  4HCB A;  4OGC A;  4O6J A;  3S3M A;  11AS A;  3L4G A;  3JCM h;  5E3I A;  3SDZ A;  1W2B S;  1Q81 U;  3R6O A;  1QE0 A;  3LYI A;  1VQ5 T;  4Y91 A;  4PJO F;  2RHQ B;  3OBW A;  3I56 A;  5KNN A;  4XU0 A;  3PCO A;  2ZT7 A;  2EJF A;  3MCA B;  2QEX A;  3TUP A;  1XTD A;  2HNI A;  2P0K A;  3QYG B;  2QQR A;  4HT9 A;  3G71 A;  1IL2 A;  2DQ3 A;  1S72 T;  1NPR A;  4A4G A;  1YB3 A;  5FRM A;  1I8F A;  2DXU A;  3LW5 E;  3M58 A;  2ZXF A;  1WGS A;  1QF6 A;  3OD1 A;  2CZ6 B;  1KQ1 A;  2HAX A;  1B70 B;  1NPP A;  2DTH A;  3JB9 I;  2AMC A;  2PUK B;  2I4N A;  2K5I A;  1B7Y A;  5HK0 A;  3CXC A;  2DVE A;  4H2X A;  1S72 A;  5CAI A;  2QHV A;  2MF2 A;  3CC4 A;  4UPA A;  1BI3 A;  4YRN A;  1WNL A;  5GAM g;  2KK4 A;  4TVW A;  1I81 A;  1RI0 A;  1VQ4 A;  3FC3 A;  2CZ0 B;  4FT4 A;  1PYS A;  4RQE A;  5J26 A;  4M75 A;  2EYQ A;  2EKO A;  5LJ3 h;  4HWO A;  1UB4 A;  1D3B B;  2RK2 A;  5CK9 A;  3L2R A;  4RDX A;  3L4G B;  1VQM A;  3QO5 A;  3TEE A;  3CCM A;  4UP8 A;  3PMI A;  1YFT A;  2BUD A;  1X75 C;  3VQY A;  1JJC A;  4MZT A;  4YRO A;  3DB3 A;  1EVL A;  3RER A;  3E9F A;  4YPF A;  4OMF B;  2MI6 A;  4M77 A;  4M7D E;  2P4T A;  1YGB A;  2PUO B;  3CC7 T;  4YRT A;  1G5H A;  2EL9 A;  1KD1 C;  5I21 A;  3M5A A;  1E22 A;  2KVQ G;  2DU5 A;  1VQK A;  5FLX E;  3JB9 G;  1N8R C;  4YRR A;  4C8Q E;  2OAU A;  3FJP A;  1LNX A;  4IUQ A;  5GMK e;  4HVC A;  1B7Y B;  1NJI U;  3A32 A;  3O8V A;  3PZC A;  2AHJ B;  3HSB A;  4AH6 A;  3JCM g;  4ZN3 A;  2E5A A;  3BW1 A;  1JJ2 A;  5GAN 6;  3VV0 A;  4PG3 A;  2EQK A;  3G4S T;  5LJ5 e;  2R5M A;  1Y96 A;  3P8D A;  1PYS B;  2ZR2 A;  2QQ9 A;  3GPL A;  4M7A B;  4XQ3 A;  4BI4 A;  4D6W A;  5CO7 A;  1BI0 A;  3A5Z A;  2XG8 D;  3PT9 A;  2DIQ A;  4PJO E;  3OB9 A;  3PGG A;  4F7U F;  2P5I A;  2JOY A;  5GAO l;  1K9M U;  1KD1 U;  2LCL A;  1QVF A;  4NOY A;  3SWN A;  5CKF A;  1RIQ A;  4HWP A;  2XID A;  3BFM A;  3OYJ A;  4O5V A;  5LJ5 f;  1G51 A;  2E70 A;  4JJN K;  3P8B B;  1Q86 C;  2ARS A;  4M78 D;  1JJC B;  4E51 A;  1N9S A;  1KQ2 A;  2EQU A;  5L8R E;  3S3O A;  4M7A C;  2DAQ A;  3RGL A;  4OB2 B;  2EJG A;  4HWS A;  5GAO q;  3RMS A;  3L2Z A;  3GNF B;  5HY6 A;  4BY6 B;  2NLU A;  3F70 A;  3JCM W;  1I4K 1;  4JRQ A;  2KQW A;  1K8A U;  5GAO r;  5LJ3 g;  2RHI A;  3OYF A;  1YFR A;  2DXT A;  4BDY A;  1M1G A;  1H3Z A;  3CC2 T;  4FSX A;  4BWA A;  4XU3 A;  3RKW A;  3GP8 A;  2JNG A;  3EFS A;  4YRJ A;  3QG1 A;  4BY6 C;  3ERR A;  3ZBD A;  2KY9 A;  1Z7M A;  3CEY A;  3CCL A;  3CPW A;  1I5L A;  3I55 T;  3P8V A;  3MEA A;  2RO0 A;  5CR2 A;  4J7I A;  1ZHI A;  4XU2 A;  1P92 A;  3V7S A;  4IUT A;  2ZIM A;  4CS2 A;  4XTX A;  4L87 A;  4CH6 A;  4TWA A;  4FL6 A;  5GAN e;  3JB9 D;  4KR2 A;  2WSF E;  3OYN A;  2MWO A;  2A7Y A;  2FVU A;  2ZPG B;  2RHS B;  4TTV A;  3OS2 A;  5FRO A;  2V8J A;  1O75 A;  3L1A A;  3UGQ A;  4RMF A;  1J5W A;  5GAN d;  2DK3 A;  4H2S A;  3G6E T;  4ZGJ B;  1KC8 C;  1QP2 A;  3N5B B;  3HRI A;  4XU1 A;  2ZPI B;  2HBP A;  4L6V 5;  2XU8 A;  3OYK A;  2E41 A;  2XI9 A;  3OYM A;  1SRY A;  12AS A;  1QVG A;  4J6W A;  4M7A G;  5IT9 E;  2K5L A;  3ZEH A;  4F7U E;  2PQW A;  2EWN A;  4XTW A;  2IY5 A;  5F5W A;  3P8Y A;  2L5Q A;  3LX7 A;  4C0D B;  3KXT A;  1V29 B;  2R58 A;  4M7D A;  5D6X A;  5C52 B;  5DLO A;  2R57 A;  3DB4 A;  2L89 A;  4MMK A;  1XOV A;  3PFS A;  1TH7 A;  4EMK A;  1YJ9 A;  5GAO p;  1BIB A;  2L8D A;  3IKM B;  4C8Q A;  4XAX B;  2DZ9 A;  3MEV A;  4M78 F;  2K3Y A;  4FIB A;  4QQD A;  1M4Z A;  4C0D C;  1LYL A;  2RHY A;  1WJS A;  2I4O A;  3RF1 A;  3L42 A;  4N4I A;  5K1P A;  2F69 A;  2FHD A;  2LTO A;  2E12 A;  4RG2 A;  5GMK j;  1YJW T;  5D6Y A;  2FYK A;  3QZ5 B;  1YIJ T;  1WPY A;  1OZ2 A;  3R07 A;  1SET A;  2ZGW A;  2VXE A;  4IUU A;  4C92 C;  2PVD B;  2OTJ A;  1JRI A;  4PJO A;  1KHI A;  4C5H A;  3M4P A;  3E9H A;  4ZIB A;  1VQP A;  4BE1 A;  2Q5H A;  4RG8 A;  2ZT5 A;  2ZPF B;  4YRQ A;  1YBY A;  3CMA T;  1VQ8 T;  4KBM B;  2VYT A;  1ASY A;  3IKL A;  2QI2 A;  2P0P A;  2GFA A;  4PLL A;  5DY9 A;  4Q5W A;  2ZZF A;  3LSQ A;  3M59 A;  2O4X A;  2VGM A;  1MGQ A;  2AKW B;  1VQZ A;  4EMK B;  3JCM X;  4HA8 A;  4P3O A;  3QO7 A;  1VQ8 A;  4P75 A;  5GAM f;  3E1S A;  2LX9 A;  1UGR B;  4C0G A;  2QA4 A;  4N4G A;  4G84 A;  2DD5 A;  4QW2 A;  4XTV A;  4LD9 K;  3OYI A;  3JAM E;  4MZM A;  1HC7 A;  4P5N A;  3JB9 F;  4YRP A;  3X20 B;  2OTL T;  4CS3 A;  3ASK A;  3OMG A;  2VC8 A;  1Q82 C;  2HD0 A;  3C12 A;  4N4H A;  5EG2 A;  4M7A D;  5J3B A;  1LOJ A;  1UGS B;  4EMK C;  3VKI A;  4YRK A;  4L5G A;  2WSE E;  3JCM V;  3SFM A;  2DPP B;  2K5F A;  1WU7 A;  2KDS A;  3JCM P;  3RL6 A;  2XKO C;  4LD6 A;  3GNG A;  3TRE A;  4LDW A;  4WF2 A;  1H64 1;  1M8V A;  1NZ9 A;  1H4Q A;  1C0A A;  2NS6 A;  3JCM e;  1L0W A;  1FXX A;  1VQ5 A;  3CCJ T;  3A8M B;  1YIT T;  4ATO A;  4C92 G;  2XD0 A;  3CBM A;  1N27 A;  4B9X A;  5KH6 A;  2O4X B;  2LT1 A;  4LDY A;  4BE0 A;  3MP8 A;  2YRV A;  2K4Y A;  4M78 E;  2ZZE A;  3TEG A;  4DOV A;  5GAN j;  1KQS A;  2EAY A;  3JCM f;  4A4E A;  4E7K A;  3CCJ A;  5C53 B;  3AHU A;  3REU A;  5ELN A;  2EQJ A;  4QVD A;  1YHQ T;  3LWH A;  3NTI A;  2ARU A;  4F7U A;  3L2W A;  1VQ6 T;  1U8R A;  1B76 A;  1FWZ A;  3SD4 A;  2XK0 A;  4PKC C;  3JRZ A;  1VUB A;  4BB7 A;  3TEH A;  3QJ6 A;  3OW2 S;  3MHX A;  4P75 C;  3ER0 A;  3HXU A;  4KQE A;  3PCO B;  3VBB A;  4ZGD B;  3NEN A;  4XTY A;  2RI3 A;  1SER A;  3PIP A;  2EIF A;  2ZZD A;  1VIE A;  2RK1 A;  3OQ5 A;  2LRQ A;  3M9Q A;  4ZN1 A;  1ADY A;  2XGT A;  1QW1 A;  4P73 A;  1B34 A;  1EOV A;  1BI2 A;  1LJO A;  4J6Y A;  2M16 A;  2PVO B;  3HFN A;  2AMC B;  4G85 A;  5LJ3 f;  2RJD A;  4J8O A;  4H2X B;  1VQN T;  1VQL T;  3X26 B;  4L59 A;  5K1X A;  2VGN A;  3P8H A;  2ZIO A;  4A53 A;  3CC7 A;  4QVZ A;  4E7L A;  4P3N A;  5CQY A;  2DXB A;  3A7R A;  3JCM Q;  2JTF A;  3T9N A;  3SB2 A;  3Q1J A;  2ZR3 A;  4M75 B;  4P74 A;  4YDQ A;  2ZIN A;  4KR3 A;  1VQL A;  1KMN A;  4YRC A;  4HCC A;  3M4G A;  3S6W A;  2EJ9 A;  5LJ5 d;  3RKY A;  4NCX A;  3TEH B;  4GLK A;  4M7A F;  1N8R U;  3G4S A;  4CH4 A;  2F5K A;  3ICA A;  4JLG A;  5HKC A;  1Y71 A;  2RJF A;  4J15 A;  4C92 D;  1W4S A;  1ZQ1 A;  1EIF A;  1VQ7 T;  4M77 B;  3LGL A;  3OYD A;  4M75 C;  3C95 A;  2MAM A;  3WVE B;  3HFZ A;  4LDV A;  3CMQ A;  2YHT A;  2EFI A;  2MMP A;  2CJA A;  1WQ7 A;  4KT0 E;  3NTK A;  1EQR A;  4PL6 A;  2J3L A;  1BI1 A;  4OGE A;  2ZPB B;  4P72 A;  2DIG A;  2HQE A;  1Q86 U;  1UEB A;  4EMG A;  4M77 C;  3LC0 A;  4CS4 A;  1Y96 B;  1W2B A;  3UDC A;  3EFR A;  4E7I A;  1KOG A;  2ZPE B;  1X54 A;  4P73 C;  1M9S A;  3A5Z B;  3CCU T;  2PME A;  1E1O A;  5M9O A;  2ZCE A;  5A0L A;  2JUF A;  3SWN B;  2RM4 A;  3CD6 T;  3UH0 A;  4EMH A;  4PHC A;  2G4C A;  2M9U A;  3CC2 A;  4OB1 B;  3CCQ T;  3GLX A;  3CCV T;  1OI1 A;  2ZNI A;  3HFO A;  4KUL A;  3IAL A;  4M78 A;  2BKD N;  3UFG A;  3S3N A;  4ZTZ B;  3QXE B;  3NEL A;  3QO3 A;  4MML A;  2R5A A;  4P74 C;  1O9S A;  1USY A;  3I55 A;  4WI1 A;  2XDP A;  1VQO T;  4KUI A;  3VU3 C;  3FLG A;  3SWN C;  3QZ9 B;  4X5O A;  3CXC S;  1JBM A;  5GAO n;  4LVJ A;  3MET A;  2K57 A;  4TQF A;  4ZTF A;  1KHC A;  2LC4 A;  3BDU A;  4JS5 A;  4ZGE B;  4RMO A;  3GF5 A;  3A8L B;  4H2Y A;  5CQX A;  3OBY A;  3M53 A;  5KE3 A;  1N9R A;  4M75 G;  5CKE A;  2DXC A;  2EQM A;  2X35 A;  3A8H B;  1X55 A;  3C4S A;  1HTT A;  3CCE T;  4J83 A;  3G6E A;  3DLL A;  5AYF A;  3REX A;  4UP7 A;  4M7A E;  1GGM A;  4VUB A;  1QP3 A;  5IAY A;  5GAN 5;  2ZCF B;  3A7A A;  4UC4 A;  2CJB A;  2O01 E;  1YI2 T;  5HGQ A;  2D9T A;  5FU7 B;  4RKU E;  3QII A;  1KC8 U;  3OSV A;  2CZ7 B;  3FDR A;  1ATI A;  1M1K C;  1WQW A;  4BD3 A;  4QVC A;  4P72 C;  4GY5 A;  4M77 G;  1JB0 E;  4JS4 A;  4M78 B;  2E65 A;  3INZ A;  1X2G A;  4C92 F;  1G3T A;  3V8L A;  2ZNJ A;  1NE8 A;  4RCC A;  3C94 A;  1FX7 A;  4HT4 A;  4OLF A;  2V8K A;  4LNS A;  4A4H A;  2CJ9 A;  5FU7 C;  3OYA A;  1Y07 A;  4E7H A;  4YRE A;  3DSQ A;  5C6S A;  2E6Z A;  4C5I A;  3OYE A;  5LJ5 j;  4YRG A;  2PVG B;  1JJ2 S;  4JRK A;  2LQ8 A;  4M78 C;  1KG1 A;  2ZZG A;  2RA2 A;  4X34 A;  3H8Z A;  5GAN 7;  1YJW A;  3FRN A;  2JVV A;  4H2T A;  3NFC A;  3HXY A;  1YIJ A;  1USY C;  2IY5 B;  3TCJ A;  5GAM e;  3HXV A;  4FM4 B;  5J39 A;  4J6X A;  3OYB A;  2QDY B;  1QVF S;  1BBW A;  3HTZ A;  2IG0 A;  1N6A A;  4M7D B;  4RCB A;  4XEO A;  1VIF A;  2RH2 A;  5CVI A;  5GAM d;  2D6F A;  3M57 A;  5FU6 B;  3CMA A;  2XDB A;  1BBU A;  3RAC A;  2QHT A;  4TVA A;  4HT8 A;  2VXF A;  3VUZ A;  4C8Q B;  2P0Q A;  1WJR A;  4BE2 A;  4LVM A;  1R8O B;  3HXW A;  2K3X A;  3KBG A;  1WJQ A;  4NS5 A;  4MZP A;  4WJ3 M;  1NNH A;  5CKD A;  3JCM J;  3GIB A;  2K2V A;  3G7Z A;  5A0D A;  1WLE A;  3CBP A;  3FB9 A;  4Y28 E;  3L2Q A;  3M56 A;  1G5V A;  2DZC A;  4M7D C;  3JCM c;  1OYX A;  3QHS A;  4JLI A;  4YRS A;  4C0F A;  2BIV A;  4M75 D;  3BY7 A;  4PJO B;  4OB3 B;  4C8Q C;  2RHZ A;  1D3B A;  2OTL A;  3HPW A;  4FT2 A;  2H3J A;  5GMK m;  1H4V B;  3M54 A;  2RD1 A;  3OYL A;  4BAC A;  4EDU A;  2DD4 A;  2XDD A;  3A7U A;  5GAN 2;  4DA4 A;  1NJ1 A;  4R56 A;  3A8G B;  2C7I A;  3CBO A;  3MEW A;  3OYG A;  3A8O B;  4C0Z A;  3W3S A;  4M77 D;  5GAN 4;  3CPW S;  1Q82 U;  4DPG A;  3CC4 T;  1G3W A;  3RMQ A;  4PJO C;  3JCM d;  4J5Y A;  3X25 B;  1VQ9 T;  4JRP A;  1WYD A;  4O2D A;  4K86 A;  4M78 G;  1YCY A;  3EAE A;  3MQZ A;  4C92 E;  1VQ4 T;  4TVA B;  3QDR B;  1GXI E;  1OZ3 A;  2LT4 A;  4H02 A;  1MHN A;  5FRN A;  3RKX A;  1G5I A;  5C51 B;  1YIT A;  2ZPH B;  3MF1 A;  3QSU A;  1NJ5 A;  3MP6 A;  1E1T A;  2RJC A;  5C0M A;  1VQM T;  2ART A;  2LDM A;  3V7R A;  4YRL A;  1HXD A;  1VQ9 A;  3E9I A;  1M90 C;  3CCM T;  2Q5I A;  5KCH A;  4HKE A;  2CIM A;  1FYF A;  2E6N A;  4IUV A;  4C5G A;  3CCR T;  3LSS A;  4M7A A;  3RIR A;  2DKG A;  3OYY A;  1QVG S;  1NYQ A;  1X2H A;  3OS1 A;  1M1F A;  3M4Q A;  1YHQ A;  2GCX A;  1NJI C;  2E3C A;  2QHU A;  2I4L A;  5LJ3 e;  1HK9 A;  4N0A A;  1Y7X A;  5ELO A;  3WQZ A;  1VQ6 A;  5GMK i;  2E10 A;  4CRI A;  4LDU A;  3P8T A;  3LGF A;  2VV5 A;  3LH0 A;  1VQK T;  4M7D G;  5CIU A;  3HRU A;  1B8A A;  3CCR A;  4ZTJ A;  1EFW A;  3OS5 A;  5GMK h;  5LJ3 d;  3CME T;  3H6Z A;  1BKB A;  5D6W A;  5HK3 A;  1M90 U;  1RL2 A;  2QQA A;  4TVY A;  2KAF A;  4C8Q G;  2RI2 A;  1K9M C;  1XQH A;  3NTH A;  2L3R A;  4HCZ A;  3HL8 A;  3A5Y A;  4EO4 A;  4DQ2 A;  5LJ5 h;  2DEQ A;  2ODR C;  3IG2 A;  3HXX A;  4ME7 A;  4HWT A;  2ZTG A;  3CCS T;  4YRM A;  3MEU A;  2RHU A;  2DDZ A;  3CME A;  4NL2 A;  3PMT A;  3LWI A;  2V8I A;  3JB9 J;  1ADJ A;  4Z02 A;  2E5Q A;  1U1T A;  4F7U B;  1VQN A;  2Y4X A;  3OMC A;  3TU4 K;  4PJO G;  1E24 A;  1IZ6 A;  2QQS A;  5DLQ E;  3HY1 A;  3LLR A;  1N9W A;  4EX5 A;  3CCS A;  3M55 A;  2QTX A;  4M75 F;  4YRI A;  3WVD B;  4X9C A;  4EPC A;  5GAM j;  4Q6G A;  1K8A C;  1X6O A;  3V8J A;  4P3P A;  3BDL A;  1SES A;  4C5E A;  3QBY A;  3QTC A;  1DJ7 B;  4JRI A;  4ELZ C;  3HRT A;  4PLI A;  1B34 B;  2M0O A;  4YCU A;  3QPH A;  2A8E A;  5CKH A;  3L2V A;  3KFU A;  2QXF A;  4LVI A;  4TQD A;  4M77 F;  2DQ0 A;  2RHS A;  2E64 A;  3UWN A;  1VQ7 A;  3HP9 A;  2D0Q B;  5CCA A;  4BUG A;  4OP0 A;  1H4T A;  4QQG A;  4N0A C;  3X28 B;  4NL3 A;  5LL6 S;  2JN0 A;  1G3Y A;  2XHC A;  4P71 A;  3HXZ A;  2Y4Y A;  4XEM A;  1G3S A;  4K87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...