3V7SA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor 0364
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
b'SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
total genus 98
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7sA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7sA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7sA02
4NL3A 5CVRA 4YRSA 1E1TA 1XD7A 2P5IA 2VT3A 4J5YA 4H02A 2QM3A 2QENA 2DBBA 3GWZA 1Z6RA 1JGSA 4F7UG 2IT0A 4A0ZA 1BBYA 1F4KA 3WTYC 3TEHA 2IY5B 3ULQB 4YFNF 4PJOC 1ZLKA 2NRAC 4M77C 2PLYA 2HYGD 4MQVA 3JAMZ 3SWNC 4M78C 5EEHA 2E1HA 3K1MA 2QLZA 2MD5A 4P9FA 2XAGA 4HLYA 2YR2A 2CQKA 4X5OA 2XHKA 2FMLA 2R3SA 1XSXA 3F6OA 2Y0MA 1EV7A 5ILUA 1XDSA 3ECHA 2MLGA 1KGSA 4HWOA 1XCVA 3CO7C 5HGQA 3HYIA 4A2UA 2EL9A 4JRIA 4XEOA 2ZNYA 3M8FA 4M71A 2P5VA 5F64A 4EM2A 5LJ3f 3QO5A 3E6CC 4P71A 3FM3A 3HTZA 2CWEA 1NJ5A 3U9GA 2VC1A 5HVQC 2EA2A 1K6OA 1USYC 5LGNA 5ICFA 2DQLA 5DY9A 1B70B 4M7DD 3NEMA 4UVCA 2FRHA 3JTGA 4CO8A 3VQWA 1ZG3A 2ZR3A 1QZZA 2ZZEA 4I01A 1FT9A 4R1HA 1FZPB 3QU3A 3GEZA 2P7CB 5DCMB 1REPC 1DPRA 2FYKA 2ZNZA 4OIOF 1KU9A 1IL2A 4RGSA 1LB2A 3BP8A 4I7HA 2FA5A 2GWRA 3HRUA 2RHSB 3ML6A 5DCFA 2DPUA 3SZTA 3G3ZA 2QTXA 4RS8A 1B4AA 5CVVA 2ZJ2A 4UUVA 4HWPA 4A5MA 3JCMg 3GFLA 3LWFA 2DPDA 4C92C 1KYZA 1J7KA 3LA7A 3O6BB 4BHCA 1E17A 2HOEA 3BOQA 1U2WA 2F5EA 4LLLA 2BYVE 1MJBA 2ZMEA 1QE0A 2IRFG 1JHFA 2K02A 4P75C 5LGTA 5CAIA 4HT8A 3HSBA 2L01A 3I0TA 3K0LA 1P4XA 3JCMW 2K57A 1SFXA 4H2SA 4CYDA 3A7UA 2D1HA 2L54A 1P2FA 4M78E 3IWFA 4HF1A 3ABTA 3N4MA 4CHUA 1KQ1A 1W66A 1HQCA 1S7AA 3QO8A 1G3SA 2QVOA 4XRFA 3RYPA 2O0YA 4BH9A 2GQQA 2WC2A 2Y90A 1YW8A 4KUMA 2JPBA 4L5IA 2DT5A 3I64A 1H0MA 2ZR2A 11ASA 4ZYGA 4HOBA 3V4GA 1RZ4A 3INZA 2EV6A 4A6DA 3L1AA 4M7AA 2ARSA 1OR7A 1LQ1A 2ZBKA 2A5YB 2DZ9A 1PDNC 1SERA 4RB3C 3R4KA 2M87A 4GXOA 1SFUA 3EQLF 1CF7A 1XSVA 2STWA 5LJ3e 4P72A 4AIJA 3I59A 4WK8F 2ZT8A 2UZKA 4L9NA 3T5XA 3J80Z 3IALA 4N0AC 2D1VA 1DUXC 4ENKA 4M7DF 4LFUA 4YRGA 4A5NA 1LYLA 2YPRA 2D45A 1JJCA 2HTJA 5D6EA 1PP7U 4EMHA 2VXZA 3A32A 2CSOA 1NYQA 1X54A 1UHWA 1B6AA 4XBFA 3FHZA 3H3UA 3P8TA 4ZYHA 2Q2EA 2M45A 1KOGA 5GAMh 1Z1DA 2E5AA 1UCRA 2OBPA 4P3PA 4XQ3A 4XSXF 2P5LC 1FYMA 4LNSA 3LQQA 5DUIA 3R6SA 3QNEA 4A12A 4YRRA 3CO6C 2QYOA 3FX3A 4EX5A 3T0YA 2ALYB 3CUOA 2VBZA 3FZVA 3IRRA 4H2XB 3TUPA 1WWXA 3MCZA 2WTEA 3KP2A 4LB5A 1BI0A 2P7VB 1IN8A 1C0AA 4ON0A 4YRKA 5E8GA 1OKRA 3IC7A 5L3FA 4XU3A 4A0XA 2MC3A 3E5QA 2ARUA 6PAXA 3KP7A 1ZGAA 5HLHA 2ZINA 3EFSA 2VE9A 3MF2A 5GAN3 2XAQA 4H2VA 5JVTA 1EIYA 2YX4A 5AIQA 1XN7A 2JSCA 4YREA 4TVYA 4AD9A 5HS8A 1KQ2A 2OQRA 1U3EM 1U5TA 2L4AA 2QQ9A 3R60A 4M7AD 1KYWA 1Z7NA 1UB9A 4L9VA 4CGZA 1HKTA 2P6SA 5F1RA 1M8VA 3L4GA 2AMCA 1E24A 4OMZA 1K79A 1ADYA 3EYYA 4G6DA 2DFIA 3IHUA 1BI1A 1R1VA 4IPAA 4YFXF 3KE2A 3H3ZA 5FO5A 4LK1F 1B1BA 1T39A 2ESHA 2I4OA 4H2TA 3GW2A 4UHTA 2RQPA 5D4SA 4B8XA 3ELKA 1QGPA 3TQNA 2MLKA 3LAJA 1XB4A 1EH8A 3TOBA 3CMQA 4XTVA 5FLXK 1MJAA 4HQEA 3QRFF 5BMZA 2DXUA 2G4CA 2P5KA 5HOOA 5GAN2 4YCWA 5J8CA 3A7AA 4QWQA 3CTAA 1EVLA 4R79A 4ZH4F 1O57A 3FXQA 4HDUA 4I0BA 2FU4A 3DV8A 3ZN1A 3W3SA 3ZQ7A 2H6BA 1ON1A 5D8LB 3TO9A 4X9CA 3MZYA 5L3EA 4Y15A 3M8EA 1MZBA 3WTUC 1OPCA 3KFWX 4K86A 1IUYA 1LEAA 3HHHA 4UP9A 1Z7MA 3SWNA 4M78A 5DYMA 2JRTA 3ZMDA 2Z99A 1M5Q1 2M8EA 2IA2A 4LJZF 3QAHA 1RNLA 4AIKA 1KQ8A 3NETA 4H2YA 5KNNA 3A31A 1IXSB 1BIBA 1TH7A 4G85A 1GXPA 2XIGA 4EM1A 3J81K 1SD5A 4FHTA 3Q9VA 3FJPA 2Q5IA 5KK1A 1IN5A 5HS9A 2CJ9A 2KRFA 2L02A 4IRHA 1Y96B 5LJ5g 5ICCA 3VBBA 2YU3A 5HLIA 4J15A 5DV5A 3F21A 4M6XA 4M7AB 3V7CA 1T0FA 4LGWA 3HXVA 1P6RA 4M7AF 4HX7A 2ETHA 2O8XA 3JCMf 1AOYA 1JRIA 1BC8C 1VTNC 1USYA 3I59B 2K4BA 2ZO4A 3R61A 2Z5UA 1BBUA 4K2EA 4CS4A 4L9TA 1W7PA 5CVUA 1B70A 1QO0D 5E1ZB 2E41A 2A61A 3REOA 2XGTA 4U0VA 1XSDA 2PI0A 2DI3A 2ARTA 2X4HA 4HW0A 3WTWC 3RPQA 3RJPA 2UWMA 1F5TA 2H94A 2XAJA 4OINF 5DCMA 5LJ3j 2BE5F 2GA2A 3UH0A 2HDCA 3GZ5A 3BW1A 2NAZA 5HDKA 5HLGA 1LDJA 4KIGA 3F6VA 4RB1A 2DEQA 2GAUA 4KN4X 4PJOD 1T6SA 1ASZA 2RDPA 3BY6A 4HV5A 2KIUA 2A6EF 5FFXA 2KKOA 3NELA 3DFGA 1DPUA 2JZYA 2BGCA 4M78D 3KFUA 1ZREA 1QPMA 3TO6A 4C8QC 1NJ6A 3VQYA 2Q7EA 2RV8A 3RACA 4PG3A 3N97A 1G51A 5GANh 2RD1A 4ZTUB 4PGHA 5BQTA 5K5RA 1EQRA 3HHGA 1EIYB 1QBJA 1EVKA 3A7RA 1FSHA 4TTVA 5GAOp 4Y91A 5H20A 2WV0A 2ESNA 3E6DA 2XGXA 2XKPA 4MNUA 3EYIA 5KVRA 4YRMA 1D3BB 3MFKA 3OOPA 2XAFA 4J6XA 4NL2A 1A04A 1RI7A 3TKYA 2QUFA 5IT9Z 3GFMA 4RAZA 4XTXA 1YIOA 4YRPA 3V7SA 3PGGA 1O3RA 4KYWA 1W7PD 3NQOA 1R7JA 1OYWA 3JCMe 4NQWA 3KZZA 3I53A 3EDPA 5D4RA 2EFWA 4A0YA 4AH6A 4OIQF 3ZMVA 2HS5A 3DXJF 4EGZA 3KP6A 5K1YA 3WE3A 1R23A 2HFHA 3ZP5A 4YYEA 3JCMd 3C18A 4M75C 1G3WA 1TLHB 1EH6A 3IKLA 4E51A 2P8TA 3DPLC 2EJRA 4NB5A 4XU2A 2HQNA 2OD5A 4KA4A 2CG4A 3SB2A 3RKYA 4C92D 4YG2F 4JBAA 2R7DA 4PJOB 1F1ZA 5K1PA 1SMTA 4M77B 1BOAA 1FSEA 2L3DA 5ERIA 2CJBA 4G6QA 4PJOF 4YRNA 1C0WA 4Q47A 1JHHA 3BJAA 4GCVA 1ATIA 3SWNB 3R07A 4M78B 3RGLA 3BZ6A 4ZZLA 4OIPF 1FBUA 3WGHA 1QZYA 3ZN0A 4M78F 4YRCA 2OAZA 2DKGA 2ALYA 2ZCEA 2ISZA 3GF2A 4QVCA 2PEXA 4H2XA 1KU2A 4KMFA 4MTEA 5GAOl 3U2RA 4Y17A 4MTDA 1WYDA 2NNNA 4XEMA 4EVIA 4OP0A 2ZXJA 2CGPA 4BYYA 2GXBA 3LQRA 5CVJA 4R8HA 3O3KA 1OYIA 1TQPA 1U1TA 1I8FA 3NENA 4G7HF 5LLQA 5E1XA 1G5HA 1RIQA 3WTZA 1AWCA 4LD5A 3ZMZA 4TQDA 3P9CA 2K86A 1S29A 2J3MA 1J5WA 4RAYA 4H0EA 2ACJA 2IJLA 1ZLJA 2WWYA 1J59A 2K4JA 1W7PB 1Z91A 3DQVC 2C7IA 5A2QZ 1RIOH 5LGUA 3LFKA 4BAYA 4HF2A 2MA3A 1E1OA 4M7DG 3SQNA 5J8FA 2FQ3A 4ZYDA 1D3YA 4XTWA 5E3IA 2TDXA 3BROA 4I0AA 3LSQA 2PJPA 5DDGA 2VONA 3TEGA 1GVJA 4NCXA 1WLEA 1FYLA 3V8JA 1JBMA 4PDKA 3D5LA 5GMKj 2DDZA 4M75E 4U7DA 5LJ5f 4G8XA 3FF5A 1R22A 3QSUA 4C92B 1UHMA 4PCQA 1ZAOA 4L9JA 2Q0OA 4C92F 4ZTZB 3MEXA 2VC8A 3HTUA 3BFMA 3O2PE 5GAMg 5LRRA 5ICEA 1ZHFA 4PJOE 1K78B 1H9GA 5GAOn 4M9XA 3LC0A 4BHPA 3I5UA 1W4MA 5E8IA 1YFTA 4M77E 1X3UA 2ISYA 2DW4A 2PQ8A 3BY7A 4EMGA 4RDXA 4JRKA 1SMYF 5HDGA 3DKWA 1O3QA 4UV9A 3UGTA 3F8BA 1R00A 1GHCA 1FY7A 1T98A 1IN4A 1PP8F 2OU2A 1Y96A 1IW7F 2YLCA 2DQ3A 1L0OC 3RERA 2DU5A 2ZGWA 1B7YA 5FLXZ 2VC0A 2W24A 2UXXA 3E3VA 3ISPA 1V3FA 2LNBA 1I4K1 3QTCA 1GGMA 1W5TA 2E7WA 3IKMB 1LDDA 2UXNA 4DNCA 2DK5A 3QP5A 4EJWA 2EV0A 5GAOq 3QHSA 3HRMA 1Y0UA 2P4WA 4KIFA 4XLNF 3JAMK 3FWEA 1PUEE 2HWVA 4JQFA 5LEJA 1UFMA 3CUQC 4YRJA 5CYVA 2GIVA 3F8NA 1YO5C 3HXUA 2DO7A 1WI9A 2J3LA 4RB2C 3WTVC 5D5WB 2ZCWA 1H4QA 4U0WA 4EMSA 4LG0B 4HV6A 1H641 3HIFA 2V1UA 4CH4A 2PN6A 4CH3A 1IN6A 2VN2A 4M7DC 2HYFA 1OYYA 1F9NA 4IHTA 1SD6A 4MEXF 3PQKA 2V9VA 3GXOA 3VB2A 1U78A 4HA8A 2VBWA 4P74A 2MH2A 3JB9H 5FGMA 4O3MA 2H6CA 4N9IA 3T8TA 3HFZA 3KP4A 3ABUA 1OMIA 1TBXA 4C92E 1U6GA 4C8QA 4L0ZB 4YCUA 3RTRA 5LJ5d 5GAN6 4P5OA 1SD4A 2M30A 1ZN2A 2FBIA 5JHUA 3JSOA 1HSJA 4HBLA 2QWWA 1BC7C 1ZH5A 4F7UE 4U88A 5J6XA 1O7FA 4QVDA 1WQWA 2JPCA 3VODA 3HOTA 4YFKF 2J5OA 1BI2A 4UXNA 5BOXA 1ZARA 1LOJA 1J5YA 4KICA 1I6XA 4EJUA 2VBYA 5H6QA 4M7AG 4WCGA 1LNXA 1D3BA 3TOAA 4PZJA 1P4WA 2E64A 1YTYA 1YB3A 2XASA 3A5YA 2Q7GA 3CLOA 4CH6A 4XTZA 5D5VB 1MJ9A 3WODF 3F8CA 4LLGF 1YFHA 1Z05A 4WWCA 3JB9D 1IF1A 3DPTA 4EJTA 4H2WA 4ETSA 2H09A 4OIRF 1J0RA 3HTSB 3LA3A 4LMYA 5CVIA 3ZMTA 3RUXA 4I09A 2CW0F 2CIMA 4AWXB 4M75A 2A07F 2LF8A 3KEOA 3R0JA 3LA2A 5L3GA 4ZYEA 3UFGA 2I2LA 4HLXA 5GMKm 2I4MA 4TVAB 2YX7A 1IRFA 2RVCA 3RF1A 2EFOA 3ERED 3M1EA 1D8KA 1HKQA 5CLSA 3I71A 2HGCA 5GAN7 1RUNA 2DK8A 1ON2A 4EGYA 2C8MA 4BXUA 4PJOA 3HRIA 3KLNA 5E1WA 4CZZA 2BBYA 4NHJA 4M77A 4IRGA 1WU7A 1I27A 4C8QD 2K27A 3PFIA 4XLPF 2I4LA 1WRJA 3JCMQ 3J80K 2DVEA 4RQEA 1O3SA 2E7XA 3K2ZA 3H92A 2I4NA 1LDKB 3BDDA 2KIFA 5CJ9A 3E5XA 3GFJA 1YCYA 1HW2A 2G7HA 2HKOA 1NYRA 1VQZA 2FBKA 2PMHA 4WJ3M 4YRTA 1FP2A 4WJ4A 4AIHA 2W84A 1H4TA 4MMLA 4KN7X 4E70A 4M74A 1B7YB 1H4SA 3BJOA 1SAXA 1ZRCA 5GANg 1FYFA 2ODRC 1I1GA 2W85A 4O2DA 1IAWA 1G5IA 4Q6GA 3BJ6A 4M73A 4MMKA 2DLLA 3FXRA 2W57A 1YW9A 4WF2A 5LHHA 2ZTGA 3R0AA 3I58A 3HFVA 2XTIA 4YDQA 3C1DA 5GMKe 2EAYA 3JCMX 2A68F 4PNOA 5GAMf 5GAOr 3JB9F 4FX4A 2DTOA 4M75D 3WTSC 3JB9J 2O61A 1LEBA 4Q5SF 2W25A 1I5ZA 1FX7A 3IRQA 4D0PA 2JT1A 2G7UA 3P8VA 4P73C 4HWRA 4K88A 3PQJA 2F5DA 3RPUA 3VFZA 1WNLA 5HS7A 5LJ3h 3K1PA 1I81A 3HSRA 4RGXA 3DP7A 3LSSA 3NEUA 4I2OA 5GMKl 1YFSA 1HK9A 4U0YA 4C92A 4HYEA 5H6RA 5FD6A 3WG9A 1SD7A 4M77D 3HFZB 2ZIOA 2HTSA 2IP2A 4P9UA 2G9WA 5GAN5 3HOSA 1R5HA 4HWTA 4C8QB 4P75A 1XMAA 1HBXG 3ZMUA 4M78G 3HXZA 4C8QF 1STZA 1KMMA 4A6EA 1X2GA 4EO4A 4F7UA 5GAOm 4CICA 4P96A 2VXEA 3DF8A 1K78A 1BIAA 2CYYA 1XGSA 3HY0A 3MZHA 3J7AO 3F72A 2LSOA 3IWZA 2H27A 3M9AA 1H9TA 3HSFA 5LJ5j 1J9IA 1NJ2A 5E17F 4EMKC 4CDGA 1X2HA 1K7AA 3ZPLA 4Y13A 2VODA 1YLFA 4A54A 5ELOA 5ELNA 2HKXA 4YP0A 1R58A 2EK5A 4BNCA 2VOOA 4EM0B 3M4GA 2IA0A 1SESA 1ODDA 2RNJA 4KR2A 1Z9CA 4P55A 1FOKA 4ENMA 1GXQA 3RKXA 3KZYA 1G6NA 3HXXA 2XKOA 1U5TC 2RA2A 4N0AA 5JFRA 1SETA 3RDIA 4KR3A 3GVAA 4M75B 1B8AA 2RB6A 4MQ9F 4OMYA 4YRLA 1XMKA 1S7OA 4L0YB 3HSEA 4M75F 1QF6A 1ZRFA 3DSQA 2BEOA 5DEQA 5AONA 5GAMe 2RHQB 2O6GE 3G73A 1FBSA 4LG0A 1IZ1A 2ZXFA 3GLXA 5D6FA 2Q7HA 4KNYA 4ENJA 1QQIA 3HXYA 1HW5A 5GAMd 4UVAA 2Z3YA 4CS3A 2DTIA 4XTUA 2E3CA 3BWGA 4C92G 1MDMB 3BPVA 4B09A 3BPXA 1X56A 3E97A 3V8LA 2OA4A 3HUGA 4PGGA 4M77F 4XU1A 3P7NA 1R1UA 3JB9I 1XGOA 1E22A 1B76A 1Q1HA 5ED4A 1EH7A 1KU7A 4HVCA 2V1DA 2Q8KA 2XRNA 2DQ0A 5C51B 3RKWA 4ESBA 1V4RA 1KMNA 2XV4S 4DPGA 4C8QE 3GYHX 1RUOA 1U1SA 1NNHA 1USSA 2FF4A 2V1XA 1S6LA 3MF1A 4I02A 2YSRA 1ZGJA 3QPTA 2QZ8A 2QHTA 3HRSA 2XROA 4UP7A 4ENNA 1JE8A 1ZG1A 4HWSA 1DP7P 1L0WA 2RGVA 1BI3A 2DQRA 2NYXA 5I21A 2M5WA 3D0SA 4MHGA 3JW4A 1XCBA 1TW3A 3WU1B 2Z33A 3MEYA 4EV0A 1NJ1A 4YRIA 5L3BA 4J6YA 4O6JA 2IW5A 2FMYA 4S04A 1X01A 2EJGA 1YS7A 5ICGA 2COMA 4IXAA 4P3NA 2Y48A 3I54A 3NRVA 3F3XA 5BPIA 5K5QA 1HXDA 1XDUA 2XVCA 2QBYA 3L09A 1NJ8A 2P0LA 3K1NA 1I5LA 3P9IA 1KQ0A 4TVAA 5L3DA 3ZMSA 2AKWA 3OV8A 3M4QA 2O3FA 3TDZC 1FYKA 4G84A 5GMKh 3E6MA 2M1BA 5GANf 4N9HA 1MGQA 2VT2A 1FWZA 2F5CA 4YRQA 1LNWA 5IT9K 2FBHA 4WXCA 3BJUA 3PZCA 4HZFA 3L2CA 2PBIA 4L18B 1W5SA 2RM4A 1S3JA 4BW9A 2O03A 2B0LA 2PMUA 5K1XA 1YW7A 4F7UB 1R5GA 4ESJA 1ZYRF 1NHAA 4IVNA 3HRKA 4F7UF 3GO5A 3TDUC 3WTXC 1PYSB 4M9SA 4RB0A 2HNIA 1JXSA 5L3CA 2E1NA 3A5ZA 4G7OF 2ZT6A 3FIFA 4Q15A 3ROUA 3JTHA 4Q4ZF 4TQFA 1WQ7A 4MGRA 2EWNA 2KJBA 1HKSA 4ZIBA 1DDNA 2GZWA 2E65A 2QQAA 4RCCA 2JN0A 3A74A 4RGRA 3B73A 3KCCA 4XU0A 2K7LA 5FB2A 4RGUA 2DU7A 1SRYA 3KP3A 3KLOA 3AHUA 3FXUA 4KDPA 5ILSA 3JCMc 2MBFA 2E1CA 1TQMA 3V7RA 3F22A 4G7ZF 5BS6A 3CUQB 2CO5A 3FMRA 3HFNA 1EFWA 3QUIA 1P4AA 4CH5A 1BBWA 5GAN4 2P6TA 2OZUA 4L87A 1B59A 4KQEA 2D2WA 1CGPA 3GIBA 4FT8A 4FX0A 5BPDA 5JI6A 3JCMV 2HEOA 2DTHA 5E20A 1QNTA 1Z6TA 4P73A 1MD0A 4M7DB 2VBXA 3E9HA 5F6FA 4H2UA 5LJ3d 3CDHA 1ONVA 4IF4A 3F8FA 3COAC 3VOEA 3QP6A 3JCMP 3JCMh 2X0LA 2PFBA 2GA1A 5IT3A 1D5VA 2MH9A 2ZZGA 1YS6A 3J81Z 4ZZDA 5GAN8 4BWAA 3ICAA 3LAPA 5LJ5e 4HAMA 5GAMj 3MWMA 1N9RA 2ZT7A 1Z7UA 3ERRA 2DXTA 4BHBA 2F2EA 5A2QK 2LF7A 5GANe 4HX8A 3RL6A 3QO3A 3E6BA 3PCOA 3WGGA 3W6KB 4YIFA 3TEHB 5F5WA 1L3LA 2E10A 2V79A 5EEGA 2EB7A 2DTRA 5K5OA 3ECOA 5GANd 4EJOA 3TGNA 3Q9SA 3SXYA 1FP1D 4PHCA 2V6CA 4OU0A 4HDVA 3GX4X 2FEZA 2FE3A 2L4MA 3UGQA 2LDUA 4EMKA 4U7BA 2ZZFA 4JK1X 5D8KB 2ODRD 5DD4A 4KFCA 1YGBA 4GYIA 4OOIA 4DQ2A 4TV7A 1G3TA 2C6YA 4A53A 4UP8A 2DJZA 3L2ZA 4HQMA 4WXHA 2J5PA 1G4DA 3VEPA 1TNSA 5AIPA 4J6WA 2QHSA 1R1TA 2F5FA 1B34A 3IKVA 1USTA 4K87A 3T8RA 4GYGA 3GZ6A 5LEKA 5DD8A 1YFRA 3QU6A 4UV8A 2VXFA 3WE2A 3JB9G 4P71C 1FLIA 3WTTC 2JTVA 3I7FA 4G9YA 1HC7A 4X9DA 4TVWA 1X55A 1E2XA 3REUA 3C7JA 3VU3C 2QBYB 1FPQA 3P9KA 2CGHA 3OD1A 3JSPA 2Q5HA 2EFNA 3GUDA 2RHQA 5LRSA 4IRIA 2AKWB 4YCVA 4XSZF 2XUBA 3Q5FA 3K9TA 2QQBA 2EFQA 3IG2A 3V8KA 3U1DA 2QHVA 4UVBA 5LHIA 4M7DE 3MAJA 4M6YA 3FM5A 5TRDA 1MDMA 1G3YA 2XAHA 1TW2A 3IKTA 3RIRA 1B9MA 1LVAA 2EV5A 3KEQA 4IHSA 3FMSA 3E9IA 3FB9A 5LJ3g 3HFOA 3SZPA 4GGGA 4HF0A 1O3TA 4C8QG 3FMQA 1N9SA 4Z2YA 1KA8A 2BV6A 2ADUA 4M72A 4QLCU 3CJNA 4V2SA 1IRGA 4ESFA 3L7WA 2ZMEB 4P3OA 2YHTA 2LKPA 2DU9A 2QHUA 1I1SA 5D5XB 4RMFA 1XGNA 2IY5A 4O5VA 2PMEA 5DUKA 4S05A 4GO1A 3M4PA 2STTA 2A69F 1FBQA 1YQAA 2ELHA 1LJOA 2KIMA 2A3SA 2ZNJA 1BN5A 4BQAA 5C52B 2YLBA 2DZCA 1T2KA 3EETA 3S2WA 3HXWA 2ZIMA 1FC3A 2RC4A 1J75A 1IXRC 1YYVA 3B02A 3BDUA 4IJAA 3VQXA 1R36A 1D8JA 4LK0F 1WQ2A 3L00A 1U8RA 1LJ9A 2DAOA 4M7AC 4JLIA 1WPYA 3JCMJ 5D5UB 1CF7B 12ASA 1B9NA 2IPQX 1ULYA 4M75G 4OLFA 4YRFA 3I4PA 2ZFWA 4HX4A 2KJCA 4P72C 4RCBA 1KQ9A 1N9WA 3HY1A 3F8MA 3K69A 2VE8A 4WX9A 2PG4A 1HSTA 4HT9A 1JJCB 1J2XA 3TO7A 4ASNA 3QOPA 2CJAA 3VQVA 3REXA 4XTYA 2HR3A 5FD5A 1MKMA 3RYRA 1SFEA 4UNOA 3RESA 1IXCA 4LB6B 4G94A 4CS2A 2FB7A 4LLNA 1BM9A 1KU3A 5LHGA 1ADJA 2EJ9A 4PJOG 1ASYA 2IVMA 3EFRA 2NNYA 4M77G 2ZKZA 1S8NA 3RI4A 5E18F 4RQFA 5GMKi 3PCOB 4MEYF 1HW1A 3AAFA 1ZG5A 2RHSA 3L9FA 4I98B 4M9ZA 2FSWA 2OQGA 2AXLA 4P74C 2FXAA 1IN7A 1PYSA 2Z9OA 4WI1A 3WGIA 3F23A 2ZNIA 1WKMA 4EMKB 2EFPA 4YPFA 3SFZA 3LSTA 2FNPA 4UPAA 1TQIA 4KMUX 3KETA 5LJ5h 1O7LA 5GANj 4Q48A 3W6JB 1P92A 4F7ZA 4YIIA 4YROA 4EJVA 3SHFA 2HZTA 3P8YA 2RN7A 4NOYA 3GFIA 4WXDA 1WSUA 1T38A 1B34B 3QO7A 1MGTA 4AVPA 2FNAA 1BJAA 2FOKA 3JCMb 1U5TB 1H4VB 4L5JA 5LBQA 4KIBA 2PMFA 3C3WA 1TTYA 5HDNA 3IL2A 3M7GA 3CUQA 3L4GB 2AMCB 2VOPA 3DEUA 3E5UA 3HRTA 4JUVA 4CXFA 2EA4A 1ZRDA 2Y75A 3WU0A 3G1ZA 5ILVA 2EJFA 4EQQA 2HQRA 4N0BA 2RKHA 4M7AE 4KT5C 2CFXA 3EUHA 5TJJA 2ZT5A 2NS0A 3QPHA 2R7FA 3T1BA 3WQZA 5JR3A 4M7DA 2GXGA 3MQ0A 1TNTA 2AS5F 2A6HF 1HTTA 3KP5A 4TWAA 2OZ6A 5C53B 1XGMA 1EOVA 1FNNA 2IA1A 5FFZA 1YG2A
chains in the Genus database with same CATH superfamily
3CCEA 1VQLT 5CK9A 4YRSA 1E1TA 2VT3A 4DBQA 2PJRA 4FSXA 2WY7Q 2QENA 4XK4A 4XLEA 2E5NA 3GWZA 1Z6RA 1JGSA 5HNHA 3CMEQ 1BBYA 3TEHA 3LWIA 3BZKA 3H1CA 3JRFA 2NRAC 1K8AR 2PLYA 1R4MB 4NDLA 2RJDA 3SEZA 2XAGA 2CQKA 2CQQA 2R3SA 4R56A 2JA2A 5ILUA 1XDSA 3VYRB 1W4SA 3D1NI 3ECHA 2W00A 4ZTJA 1E3PA 3X25B 1KGSA 3HHTB 1XCVA 1PRLC 3HYIA 2JVVA 1MNMC 4JRIA 5EEAA 4XKWA 1Q81C 2KEAA 1M1FA 3QO5A 3KX2A 3FM3A 4P71A 2NUZA 3LYIA 1GT0C 2E35A 3G71Q 1K6OA 3RZOJ 5C4XJ 1HLVA 2KGTA 4A3EJ 2P4RA 2P4TA 2FRHA 4MIMA 3VQWA 3B6AA 1WXUA 3EGXB 1FT9A 3TW7A 2E6ZA 1PNJA 5HK3A 2GBQA 1I50J 2WAQN 5IN1A 1KU9A 1IL2A 1LB2A 4BB7A 3HRUA 5DCFA 2QTXA 5KAIC 5CVVA 3M4YA 1WHKA 5IHKA 1KYZA 1E17A 3BOQA 2JUFA 3HKZA 4LLLA 1K61A 1MJBA 1YJWQ 2GBYA 2DA5A 1JHFA 4HT8A 1FOWA 3I5RA 4A3JJ 1NE8A 3A7UA 1TWFJ 2D1HA 2CH0A 2GXAA 5F04A 1P2FA 4M78E 3CBPA 5EZGA 1S7AA 3S93A 1BKBA 2GQQA 1LE8B 1Z7LA 1PKTA 1VOMA 3TVTA 4ZYGA 4HOBA 1VQLA 3V4GA 1RZ4A 4B3XA 3K2AA 2DT6A 2A5YB 4J9BA 1PDNC 1SERA 3EQLF 1CF7A 5LJ3e 4BXXJ 3J80Z 4W1UA 2O5RA 1DUXC 2HXIA 1ABOA 4LFUA 4A5NA 4BBRJ 1LYLA 1PP7U 5D6EA 3OYDA 2VXZA 2ZJQF 1D0YA 1JUPA 3LGFA 4XN0A 2EZIA 1B6AA 1JTXA 2J05A 3FHZA 4J83A 3P8TA 4ZGJB 4DOZA 2KQRA 3FK7A 1Z1DA 1UCRA 2OBPA 2E12A 4PFOA 4F14A 3BR6A 2HL3A 3CUOA 3IRRA 4H2XB 3TUPA 1EA3A 4AFUC 2CDTA 1JKRC 3KP2A 3UNGC 3D7SB 3K4KA 5D6WA 2OJ2A 4A0XA 4PLIA 3HPHA 2DA6A 1PVEA 1ZGAA 3EFSA 5BNGA 2YX4A 4DEYA 4NC7A 3A8LB 4TVYA 2VPRA 2QA4Q 1U3EM 1U5TA 1KYWA 1UB9A 5AT1B 2KROA 1E24A 1BI1A 3H3ZA 5FO5A 4LK1F 1B1BA 1PWTA 2WBMA 1M1EB 4UHTA 3X2QH 2A05A 2V1QA 3ELKA 1QGPA 2R5YA 2K9MA 2KXDA 2V8KA 1EH8A 3TOBA 3CMQA 4XTVA 2JZ2A 1W2BA 5FLXK 2JOYA 4M3DA 1O57A 2LX9A 4CCOA 4UUSB 5TISC 5CPRB 4I0BA 2DJNA 2CSQA 2HDWA 3W3SA 1WHMA 5D8LB 3MKDA 3HGYA 3N5BB 1OPCA 3A2KA 9ANTA 2GGRA 3GPLA 4UP9A 2AHQA 4ZDLA 4LITA 3ZMDA 3OS0A 2M8EA 3QAHA 3H35A 4H2YA 1VQ9T 3CCEI 1IXSB 1TH7A 1B72B 3J81K 1SD5A 3FXOA 4FHTA 2CUFA 3Q9VA 5HS9A 2L02A 3AG2H 5LJ5g 3VBBA 2ZJRF 4XOTA 5HLIA 5D6XA 1Y8RB 3BR0A 1UGRB 2E1MC 1RC9A 1EF4A 3KFVA 1M1KR 4LGWA 1UAAA 1P6RA 4M7AF 1K1ZA 3E19A 4A4GA 5B66C 1QHGA 4HSRA 4JS4A 2EQRA 1BBUA 4CS4A 3K4CA 1W7PA 2H3JA 5CVUA 1QO0D 2XGTA 4U0VA 3RBBB 1Y1VJ 3RPQA 5IYBJ 5GPAA 1F5TA 1KQSP 5DCMA 1IREB 3J81E 2LTPA 1W70A 2EBIA 4FYWB 2HDCA 1TG0A 4F52A 2WB1A 5HDKA 1LDJA 2HOSA 3CXCS 1WZ2A 2GAUA 2KL4A 4C9YA 4X34A 1SEUA 2RDPA 3BY6A 3HOYJ 4HV5A 3ZEHA 3NELA 2KKOA 1ZA2B 1FMVA 4M6VA 1MNDA 3LLRA 1NJ6A 2L2PA 4BY6C 2RV8A 4AFZC 2R7VA 3TREA 3OYNA 4LVLA 4DOVA 3H3VK 2XPWA 2Z1DA 3C95A 3EG2A 4B47A 2WA0A 2ZXWH 1FSHA 4TTVA 3OW2P 2XGXA 2A6TA 2XGDA 3MFKA 4NL2A 1RI7A 4E7LA 3CPWA 3M57A 4XTXA 4IKFA 5CQEA 4KYWA 4C5IA 3DLLF 1VIEA 4NQWA 3I53A 2ABLA 3KP6A 5K1YA 1R23A 3OR1C 3ZP5A 2M02A 4LDUA 1TLHB 1EH6A 3IKLA 4E51A 3DPLC 2IPOB 1VQ9A 2EJRA 1VQLI 3MD2A 2LJ1A 1OZ3A 2Y9ZA 4JBAA 2R7DA 4PJOB 1R4NB 2OAWA 2MI6A 1SMTA 3H5RA 4M77B 2L3DA 1H88C 2CJBA 4G6QA 1AVZC 1JHHA 3BJAA 4GCVA 1ATIA 3SWNB 1GV2A 4M78B 5EG0B 3RGLA 1ZBXA 2DKGA 4QKUA 4RAFA 1KU2A 1BR1A 4KMFA 1JEGA 3LW5E 2VKDA 1AWOA 2DM1A 2A28A 2DL5A 4ZDPA 4BEHA 3GBQA 4EVIA 1KFZA 4OP0A 4BYYA 4OGCA 4C0GA 1HA8A 3LQRA 2DL7A 3O3KA 1M3AA 1OYIA 3CD6Q 3LX7A 1WJRA 1G5HA 2I8DA 1RIQA 4ELYC 4D8DA 5FKLA 1J5WA 4H0EA 1Q86U 4OMOA 3DQVC 2C7IA 2Y0SN 4DIQA 5A2QZ 2ZCFB 1FMWA 2MA3A 1E1OA 4M7DG 1X2QA 4CCKA 5J8FA 2FRYA 2KE9A 4ZYDA 3OYJA 5E3IA 2TDXA 4I0AA 4A4FA 4CUGA 2F4OB 1JBMA 3D5LA 1KQSS 1R22A 4C92B 2WAFA 1ZAOA 2Q0OA 4LIVA 4LNPA 2ME0A 2K5FA 3QYEA 3BFMA 4DZJA 5J47A 3UKGA 4ZN3A 1K83J 1K78B 2DA2A 4M9XA 3LC0A 4N4HA 4RKUE 2ISYA 2ESWA 2PQ8A 3UA6A 1ETXA 1SMYF 1DQUA 3DKWA 1YITQ 4OB1B 1SVLA 4FT2A 4CCJA 2KRNA 1FY7A 4IO9F 1PP8F 2QQSA 5FLVA 1JUMA 2L9RA 1SFOJ 2OX7A 2DQ3A 3RERA 2IXSA 3OW2S 1B7YA 2VC0A 1YHQT 1I4K1 3HXLA 2KMTA 3NPFA 1LDDA 1KK7A 2VPLA 2BHYA 4EJWA 1NPRA 3U23A 3FWEA 3FHNA 1HD3A 2XKOC 2EGAA 5CYVA 2JA5J 3E7LA 5GJWB 2L9NA 4RB2C 3CMET 3DEEA 4LG0B 1YIJQ 5DM7F 2V1UA 3VJPA 1T0HA 5E79C 3RMSA 2WV1A 3L2RA 1WJBA 2HYFA 4IHTA 1SD6A 2DOFA 4HA8A 1MSEC 2MH2A 5C3EJ 3JB9H 2DRKA 5KE3A 5CCAA 3TW6A 4FM4B 5LJ5d 2L3PA 3C12A 1KIKA 1R0BG 2LP0A 1BC7C 2KFDA 4U88A 1O7FA 3HOTA 2X6WA 1U9OA 3G6EQ 1BI2A 3OYIA 4M4ZA 3G71T 1ZARA 4B1RA 4KICA 2MSYA 3PNTA 1LNXA 1P4WA 2E64A 1YTYA 3CLOA 4XTZA 3WODF 3A8HB 4HRIA 1YFHA 3HOXJ 4EJTA 1N27A 3HTSB 5CVIA 5GJVB 4M75A 2WY8Q 4N4IA 1KHCA 4TVAB 3OYLA 1V5FA 1IRFA 3M1EA 1YJWT 2ZC2A 3I9V2 5A0DA 2C0TA 3E1SA 3HOUJ 3H36A 4IRGA 4QQDA 3CP8A 2V8IA 3LOCA 1WRJA 2DLPA 3JCMQ 2DVEA 2RNAA 3ESWB 2IS4A 1YHQA 2IAIA 3K2ZA 2XSJC 2I4NA 3Q0UA 3BDDA 5CJ9A 2DODA 1VQ9I 3IV5A 4YRTA 2XSDC 1FOYA 3LSJA 2BW3B 1H4TA 3HEFA 2P0WA 3BJOA 2K40A 1AKHB 2W85A 2QKLB 2M7AA 2CW7A 4HCZA 3CMEA 1MMAA 4C2UA 2DLLA 2COWA 2MWPA 3K4BA 5LHHA 1M2VB 3R0AA 2AKLA 2XTIA 3C1DA 1LCKA 3BC8A 4L59A 1OR7C 2E71A 3JB9J 1LEBA 4KT0E 3MEUA 2W25A 1I5ZA 1FX7A 2G7UA 4P73C 4K88A 3VDXA 3PQJA 3VFZA 1C0MA 2LVMA 2EW3A 3K1PA 1I81A 3HSRA 2EQJA 1Y39A 1YFSA 4U0YA 3WG9A 2RHZA 1T33A 3OYCA 4M77D 2HTSA 2EYZA 2G9WA 3G71A 5KYXA 3HOSA 4C8QB 2XAUA 2A36A 5J3LA 3HXZA 1X2GA 2VXEA 2IGMA 4PFPA 1PM3A 3I55I 3MZHA 2QA4T 1BCMA 3IWZA 3LSHA 1JI8A 3HSFA 1NJ2A 2LMJA 1RACB 2LVSA 2HKQB 5ELOA 2HKXA 3S8PA 2YUSA 4EM0B 3FKIJ 1SESA 1ODDA 2KRSA 4LN2A 4KR2A 5HODA 3RKXA 1TTHB 2CP3A 2HBWA 1YJWA 1A0NB 2ROLA 3TP3A 1ZUYA 2RA2A 4LD6A 3RDIA 1Z9ZA 4KR3A 2KT8A 4QT7A 1OI1A 2QSHX 4MQ9F 4YRLA 3H6ZA 2BEOA 3RPUD 2RHQB 2O6GE 3G73A 2ZXFA 2X9HA 1QKXA 4KNYA 2VGNA 1BU1A 1HW5A 2M9HA 3BWGA 3BE3A 4BS9A 4YEJA 2Z0WA 1SSFA 3X28B 2C0IA 4XU1A 3P7NA 2GNCA 1R1UA 2R7TA 5FJ8J 1Q1HA 2V1DA 2Q8KA 2BE9B 3FDRA 3TEDA 2L7ZA 3EG9A 1U1SA 2V1XA 2QHTA 3HRSA 1RLPC 3OS5A 1YP5A 3D5RC 4RTTA 3OB9A 4LUEA 2LY9A 2KI7A 1H89C 4EV0A 3OY9A 4J6YA 2FMYA 3H9GA 2CV1A 3ZQHA 2EJGA 2COMA 4IXAA 1D1BA 1AWXA 2Y48A 4AFSC 4XKBA 2CT3A 1ETQA 5BPIA 1G83A 2WADA 1ZKGA 4KJZA 2L7KA 4KGXB 1NJ8A 1T3SA 3K1NA 3O8HA 1KQ0A 3ZMSA 1OCOH 2QA4A 3TDZC 4G84A 3E6MA 5GANf 2XF5A 2VT2A 4XL9A 4M3EA 2LD5A 4ZGDB 2K85A 1QQJA 3J7AF 2FBHA 3ZL7C 3BJUA 1IV8A 4AIDA 5KNLA 4N4OB 4HZFA 3JRIA 5K1XA 1X2MA 3ABKH 1ZYRF 1PYSB 4M9SA 1Y07A 1TS9A 2E1NA 3A5ZA 4JX5A 5LD2C 4Q4ZF 4TQFA 2O7OA 1DDNA 2E65A 1SVOA 3PIOF 4VUBA 2JN0A 2L7FP 1NG7A 4RGRA 3KCCA 3JRBA 2K7LA 5FB2A 1SRYA 5LFAA 2CH4A 1H3HA 3QIIA 1VQPQ 3F22A 4G7ZF 4J9GA 3VRYA 1B59A 3GF5A 2D2WA 1CGPA 1KC8U 3GIBA 3CJTB 3JCMV 3ASKA 2QGFB 1QNTA 1WI7A 3E9HA 5CQYA 4H2UA 2KSSA 1ONVA 3F8FA 1MBFA 3NWSA 3VOEA 3QP6A 1KSWA 1BOBA 2DD4A 2GA1A 2ZZGA 4Y92A 1YS6A 3J81Z 3HUGB 1UGVA 4IHVA 5GAMj 3MWMA 3IH2A 1Z7UA 1QP3A 2L0KA 2HKNA 5I2MA 1MBKA 3RL6A 3QO3A 3S1MJ 5B3SH 3OWTA 4LVJA 2V79A 5EEGA 1RLQC 3TP0A 3H9QA 1FP1D 1UHFA 3CD6T 1SC7A 4EMKA 4ME7A 5DD4A 4DQ2A 3I35A 2C6YA 5H2FC 2HQHA 1OQYA 1G4DA 3G71I 1U5SA 5AIPA 1M4ZA 4FCYA 2BXYA 4B3AA 1UEBA 3B6CA 3T8RA 4CH7A 2QGUA 3QU6A 1BBZA 3EH1A 5E3LA 3H9NA 3WTTC 2JTVA 5KYUB 4G9YA 3S3OA 1Q86C 4TVWA 2CU7A 1MMSA 1WH5A 3JSPA 3CC2Q 2FG0A 2EFNA 3GUDA 3EG0A 3RZDJ 4YCVA 1R6RA 2C06A 3U1DA 2BE7D 4M7DE 2LJ0A 4M6YA 3FM5A 4E7SA 1MDMA 1G3YA 1X27A 2F5KA 4IHSA 2RQTA 3HFOA 1YITT 3FMQA 1N9SA 1KA8A 4BL0B 3SD4A 1K8AC 1UGPB 1W2BP 3CCQQ 1Z77A 2DMTA 1QMCA 4WCIA 3M1CA 1R0CB 4JOMA 2JM8A 3HGGA 2XU8A 3MEAA 2E5ZA 2A69F 2PMZA 2KIMA 2ZNJA 3CCMQ 1T2KA 4KBMB 2RC4A 1J75A 1U0JA 2ZPFB 3J7ZI 2D8HA 3BDUA 4F04B 3VQXA 1D8JA 3VKIA 1U8RA 4BKXA 3CPFA 5D5UB 1OEBA 1W36D 2L9VA 4M75G 3I4PA 3EAEA 1N6AA 2RF0A 3F8MA 3K69A 1JJCB 4XTYA 1MKMA 3RYRA 3CD6A 4LB6B 2R7RA 2FB7A 4LLNA 1KU3A 1ADJA 1RAFB 3CC7Q 2EJ9A 4MZMA 1ASYA 3MCAB 5E18F 4UB8C 4IUQA 3PCOB 4MEYF 5DM7R 3AAFA 2RHSA 4M9ZA 2OQGA 3G6ET 1S1NA 2M2EA 4WI1A 1TL8A 1IUFA 1X1AA 4YPFA 3LSTA 1TQIA 3DB4A 2QA4I 2KDZA 2EZHA 3RNJA 2RN7A 4NOYA 1NZ9A 1B34B 1TC3C 1BJAA 2FOKA 2QASA 2JUGA 5TGTA 1A31A 1TTYA 1BR4A 4FQGA 3VYTB 7AT1B 3M7GA 3ABLH 4RTZA 2HVRA 3DEUA 3E5UA 3SFIA 2SRCA 1ZRDA 2TRTA 3VS2A 5J1UA 5ILVA 2OI3A 1D09B 1YITA 4KT5C 3EUHA 1AHDP 2VB6A 4ABZA 1X4PA 2GXGA 1TNTA 4BQOA 2OZ6A 5C53B 5CKBA 2RJFA 1OCZH 4ANJA 4B43A 1TZLA 5K7HA 2CZ7B 3DBHB 1E0EA 4J5YA 3GTLJ 1WJQA 2JW4A 3EFOA 3GOXA 5EYRA 2RH2A 2DBBA 2UV1A 3M07A 2E3HA 2ZPIB 4YFNF 4PJOC 1ZLKA 4Q5WA 2W0ZA 4XKVA 4M77C 1W2BS 1OU8A 1BCOA 3VV0A 3SWNC 4M78C 5EEHA 3ER0A 2E1HA 1YIJA 2QLZA 2MD5A 3S2DJ 2KT1A 3FKJA 1Q1VA 3F6OA 3I9QA 1OPKA 3GTPJ 5GADJ 2JA6J 5DS9A 1A6IA 4HWOA 3CO7C 2R0QC 2K5CA 3MP1A 2ZNYA 4KITB 3M8FA 2HZYA 3F0CA 4M71A 2P5VA 5F64A 2FRWA 3E6CC 2HVSA 2VKEA 3EHQA 2CWEA 5HVQC 3EH2A 4WTOB 1ORKA 1LPQA 3MN2A 1B70B 2IBDA 3ZGKA 2M4KA 3PSFA 4UVCA 4IOAF 3G6EA 4ATOA 1QZZA 2ZZEA 5C0MA 3QU3A 2PZ1A 4RTYA 1BB9A 2FYKA 2BZ8A 4I7HA 2FA5A 2GWRA 3ML6A 3LSKA 1UG1A 1B4AA 1ZSZA 4HWPA 2DPDA 4C92C 1J7KA 3FJ5A 4BHCA 2HOEA 1U2WA 2F5EA 3IH3A 1ZX6A 5KYWA 2IRFG 3HP9A 4P75C 1TWCJ 5CAIA 3HSBA 1FIPA 1P4XA 2K57A 2AO9A 1KHIA 4NNJA 1JB0E 2L54A 2ENMA 4F3QA 4HF1A 3ABTA 4HCKA 2KZVA 1KQ1A 1W66A 1HQCA 4AMCA 1G3SA 2P84A 1M1KC 4ZN1A 5EGOB 4OMFB 2JPBA 3K4JA 2O9SA 2DT5A 3I64A 2WACA 2ZR2A 2R7SA 4A6DA 1OR7A 3M59A 5JLWA 4P72A 1RI0A 3I59A 2PUOB 2ZT8A 3PO2J 3WHCA 5J39A 4YRGA 1QP2A 2YPRA 4EMHA 1TUDA 1AT1B 2D6FA 2W82A 2PJRB 1ZR2A 3NFCA 1ZUUA 4FTHA 1VYUA 2Q2EA 2M45A 3A8GB 1NJIR 2VLAA 3OIPA 4EATA 4A3CJ 4P3PA 4XQ3A 4XSXF 2P5LC 4II1A 3LQQA 2AHJB 1I5OB 4A12A 3CO6C 2X4WA 4EX5A 2ALYB 3FZVA 1R5ID 1W1FA 2CUZA 3LFUA 3MCZA 3CD6I 2WTEA 4LB5A 1BI0A 2P7VB 2CW8A 1IN8A 1LVKA 4YRKA 2KLOA 5E8GA 3IC7A 5L3FA 2MC3A 3T9NA 2ARUA 1VQOQ 2RREA 3MF2A 1ETYA 2XAQA 4H2VA 1EIYA 2JSCA 2KNBB 2EGEA 3PTAA 4I99C 3HM5A 4UY8I 2QQ9A 3R60A 4M7AD 2I5UA 3QJYA 3S16J 2V4JC 1X75C 4CGZA 2P6SA 1PCXA 2AMCA 4OMZA 1K79A 2FPFA 1ADYA 2V9KA 1T39A 5F0FA 5D4SA 1OU9A 1XB4A 5J4YA 1QZEA 4JYKA 2G4CA 4G6TB 5GAN2 4QWQA 1EKEA 4R79A 5HLTA 4KUIA 4ZH4F 4JJBA 4J19A 4D7MA 2H6BA 2RN8A 2LLKA 2MW8A 1X4OA 5L3EA 1YITI 1FYNA 4PJ0C 2XDPA 3HHHA 5GPCA 1WDXA 2Z99A 2HOAA 1O75A 3PE0A 2J7IA 3NETA 2CRGA 3DU6A 5HCKA 2VUMJ 1VQPT 4G85A 2HOTA 2Q5IA 2KRFA 5J4VA 2YU3A 5CKEA 4J15A 5DV5A 1YOVB 3F21A 2XGCA 1IZ6A 2JUCA 3HXVA 4HX7A 3O5ZA 2O8XA 3JCMf 1AOYA 4A3BJ 1VTNC 3H5NA 1USYA 4LDVA 1V5EA 3R61A 4K2EA 2JRMA 3REOA 4QPOA 2PI0A 1OCRH 1FIAA 2OPTA 2UWMA 2H94A 2GA2A 5KHDA 4XOPA 1Z9QA 3JREA 2DN0A 2NAZA 5HLGA 2BXZA 3PVLA 4RB1A 3K7AJ 4KN4X 4PJMA 1ASZA 3FISA 2KIUA 5FFXA 3LMMA 2JZYA 3E9GA 1ZREA 1QPMA 2RJEA 3TO6A 4BQNA 4C8QC 1OLTA 2X48A 2Q7EA 3I4MJ 4C0ZA 3N97A 2YWWA 5GANh 4PGHA 1BK2A 5K5RA 1EQRA 2NS8A 1J09A 1UFFA 4DBRA 2DA7A 2DPPB 2F4MB 2RHIA 4FIBA 5GP9A 1E3HA 3E6DA 4B9WA 1QVGA 2HL5C 4DBFA 3EYIA 3CBMA 4RMNA 3OOPA 3CC2T 1A04A 2VYTA 3LH0A 3GFMA 4C2TA 4C30A 1BW6A 1YIOA 2LR8A 4W97A 2E19A 1O3RA 4JZ4A 3OYHA 5C4JJ 1QKWA 5KYYB 3EG3A 5D4RA 3ZMVA 2HS5A 2D8JA 2LYCA 4EGZA 1LFPA 2HFHA 1IHWA 2EQKA 1YJ9Q 3GNGA 3CCQT 4KA4A 1OQKA 1GVDA 3PM1A 1VQPA 1QVFA 2X4JA 2OTLQ 4F17A 2XDBA 2KZGA 1X69A 1BOAA 3FXJA 4PJOF 2X35A 1WJAA 3CCMT 4ZZLA 1QZYA 4QW2A 2W4SA 4M78F 2YU9J 4YRCA 5K7FA 1JKQC 2OAUA 2M0MA 3GF2A 2ZCEA 4H2XA 1AZGB 5IHNA 3RQIA 4IIOA 4MTDA 1WYDA 1R71A 3M0RA 2CQ7A 2ZXJA 6AT1B 3M53A 2GXBA 2CFOA 1N8RR 5HNFA 1TQPA 1U1TA 3UR3C 1I8FA 1KJWA 2K3FA 3U21A 4G7HF 3SDZA 1JJ2P 3S1RJ 3VS1A 4TQDA 3P9CA 1K76A 2K86A 1S29A 4RAYA 2ACJA 1W7PB 2D0QB 1RIOH 2C0OA 2EIFA 4BAYA 3CC7T 3CC4Q 2FQ3A 2FJ1A 5DDGA 1FMKA 3TEGA 4NCXA 2VASA 2M51A 4JJDA 1FYLA 5GMKj 2R93J 4M75E 4U7DA 4Z88A 2L2OA 3QSUA 1UHMA 4L9JA 4C92F 2VXDA 3HTUA 4BJ6C 3L2VA 3S32A 2NYSA 1DP3A 5ICEA 5GAOn 3CC2A 4BUPA 4BHPA 1YFTA 3CLQA 4EMGA 2E5QA 4UV9A 3PT9A 4A3GJ 2KRMA 1WI3A 2OU2A 2EYYA 1IW7F 4JJCA 3GBGA 1JU5C 2DYSH 4Y52J 2AIRB 2IGNA 3EUKL 1GGMA 3A4CA 1Q7YR 2UXNA 4DNCA 3FIWA 3QP5A 1ACMB 2EV0A 3QHSA 3CCQA 3HRMA 1LUJB 1Y0UA 4KIFA 2HWVA 3PVQA 1HOMA 1SHGA 4YRJA 4CI0C 1G59A 3F8NA 2DXBA 1D0ZA 1GL5A 1I6HJ 3CCMA 5D5WB 2DFHA 3C2GA 4HV6A 1H641 3F9KA 4CH4A 2PN6A 2DCEA 2VN2A 4AU7A 1T56A 3GXOA 1X6GA 3VB2A 1U78A 5FGMA 2Y31A 3EG1A 3BDLA 1H3ZA 2GTOA 3KP4A 1OMIA 3HOWJ 1ZTRA 3KUFA 4X0GA 1M8MA 1SD4A 1VQNQ 2M30A 1ZN2A 2FBIA 3JSOA 3PUFA 1WHGA 3PNVA 2K3XA 4BEHB 5J6XA 1WQWA 1NTCA 3VODA 4ZJZA 3CC7A 5FLMJ 1VQ6I 1B8IB 1G2HA 3H5AA 5DLQE 1J5YA 2ZSHB 3AFHA 4EJUA 2M16A 3OYMA 4WCGA 4J9EA 2QAZA 2ZSIB 2XASA 3A5YA 2Q7GA 2F6CA 3TBIA 4OIRF 3LA3A 3BG6A 4I09A 2CW0F 2E2HJ 4V19K 1SHFA 3AL0B 2LF8A 1KD1R 5L3GA 1OFCX 3UFGA 2I2LA 4HLXA 2XDDA 2I4MA 4Z8AA 2YX7A 1NJIU 2EYWA 1WGSA 2MABA 2L3RA 5CLSA 5GAN7 2K6DA 2DK8A 1EJ9A 2C8MA 2K79A 2K9LA 1A36A 2DMOA 2GQVA 4PJOA 3HRIA 1GCPA 4M77A 2K27A 1VQ4T 1Y0NA 1P7JA 5EG0A 1UG2A 3I4NJ 1OULA 2YRVA 1LDKB 2JMAA 3DB3A 3E5XA 4H4KC 2I10A 2HKOA 1HW2A 1NYRA 4WJ3M 4WJ4A 1VQPI 1VQ5Q 3QXEB 3W2VA 4E70A 5IY5H 1B7YB 4PSWA 2FD5A 3CBOA 1ZRCA 5GANg 4I6ZA 2ID6A 4GY5A 2LT4A 2DERA 2ODRC 2DL3A 1OCPA 2IGOA 3BJ6A 4M73A 4MMKA 3FXRA 3J7AY 2W57A 1YW9A 3I58A 3HFVA 1XMXA 4YDQA 1IB8A 2DDAA 2EAYA 5GMKe 4DYQA 5GAMf 3JB9F 1PC0A 3NTIA 1TT5B 2O61A 2OUMA 4OB2B 3P8VA 4HWRA 4XRSA 3RPUA 5HS7A 1NYGA 3DP7A 3VUBA 4C92A 4HYEA 4A3KJ 5H6RA 5FD6A 1SD7A 1TU0B 4M3GA 2ZIOA 2IP2A 3SHWA 4P9UA 2ATCB 1K6YA 4HWTA 4P75A 1XMAA 4E7IA 3ZMUA 4C8QF 1XOVA 1VQOT 4F7UA 5GAOm 4NC6A 1PD0A 1K78A 1BIAA 3NTHA 1XGSA 3HPGA 2MC4A 3ZFJA 3M9AA 1J9IA 2W10A 3K10A 4CDGA 4RTXA 3JRAA 3ZPLA 2VODA 3ZOBA 4PSXA 1UECA 1R58A 4YP0A 2EK5A 4CC4B 3M4GA 2VKVA 1Z9CA 4P55A 2O01E 1EFNA 1WPKA 3CC2I 4AYBN 1RR7A 2AKKA 3M0UA 3MO8A 3QPSA 4M75B 2RB6A 1XMKA 2YDLA 4L0YB 3HSEA 3WG7H 4EIKA 1QF6A 4HG2A 2OTJQ 3D5SC 3M9QA 2VQCA 1UJYA 3G4SQ 3MHXA 4LG0A 1IZ1A 3GLXA 2X1EA 3F70A 1M2OA 2D0NA 4UVAA 2Z3YA 4XTUA 3CCQI 4B09A 4KGVB 4F92B 2DYRH 1K9MR 1TOVA 1GUUA 1BL0A 4CCNA 1XGOA 1Y0MA 3VS3A 5ED4A 3MVPA 1X3ZB 3CCMI 2DQ0A 4ESBA 1KMNA 2XV4S 2A3LA 3CESA 3GYHX 4AG2C 2FF4A 4I02A 4C3IJ 3QPTA 2QZ8A 3LNQA 4UP7A 4HSTA 1JE8A 3TSZA 1ZG1A 4IQJA 2LCLA 2DYIA 1L0WA 2RGVA 4ORZA 3OMGA 1ETOA 3C2BA 3JW4A 4MHGA 1XCBA 1IO2A 1NJ1A 4YRIA 1RUWA 5IAYA 3A8MB 3FC3A 2IW5A 2M34A 2V26A 1FTTA 2VQLA 4JZ3A 1F36A 1EX4A 2IS2A 1T0FC 4OMMA 2J06A 2MMPA 1UG0A 3I54A 3NRVA 3F3XA 2BIVA 1XC5A 2X3XD 3CC7I 2KRHA 1U3OA 4EPCA 4M3FA 5F0CA 1VQOA 3K4MA 4E6KG 2QBYA 2L5QA 4OMNA 2NWMA 5L3DA 4QQGA 4TVAA 3OV8A 3JSCA 1FYKA 4N9HA 4YRQA 3QWLA 5IT9K 1R9TJ 4GDFA 2KYMA 4FETA 5DTDA 2DNUA 4Y33A 1S3JA 4BW9A 2O03A 2PMUA 4ESJA 1I39A 4MZPA 3OYBA 3GO5A 3WTXC 2RQUA 4RB0A 3EHRA 2DEUA 4BE0A 2V7FA 3A01B 4GLMA 2ZT6A 3FIFA 4Q15A 2BZXA 3ROUA 3JTHA 1QWEA 4HKEA 3BTCA 3SYTA 1RKWA 1ETKA 1HKSA 3PIPA 2DBKA 2QQAA 2BW3A 2JQ7A 1GV5A 4B4CA 4OAYA 2CREA 2DU7A 3KP3A 3FXUA 1UTIA 5IT9E 2MBFA 4PK4A 2E1CA 5BS6A 1M2VA 2FEIA 3HFNA 2PMZN 3LSIA 1P4AA 4CH5A 5GAN4 4KQEA 1YJ9T 2RI5A 3PMTA 1OV3A 5E20A 2V1RA 3Q0WA 2CV2A 1MD0A 4ZTFA 2OTLT 1AD5A 2IG0A 2FZCB 5LJ3d 3L2QA 3QYHB 2Y4YA 2HXOA 1D1AA 3JCMP 3JCMh 2PFBA 1D5VA 1JT6A 3BLYA 3E0JB 3CXCP 1ENHA 3WHBA 5GANe 4HX8A 4DZPA 3A1YA 3DBRB 4YIFA 1L3LA 3GTQJ 4FU6A 1VQMI 3EG9B 5GANd 3UF4A 2M9UA 4II2A 4HDVA 2FEZA 3C2HA 1MV3A 4U7BA 2ZZFA 5D8KB 2Z16A 4GYIA 4FW1A 2DJZA 1SRMA 4HQMA 4JP0A 4N4NB 2J5PA 3VEPA 3VS4A 1C6VX 3AG4H 4J6WA 3CC4T 2QHSA 2HAXA 3IKVA 2CP5A 2BVMA 3CMMA 3NTKA 1YFRA 4LDWA 1JKOC 4UV8A 2VXFA 4P71C 1FLIA 3CJQB 1WHJA 2CQXA 5DM6F 3VU3C 1FPQA 3P9KA 2Q5HA 4F55A 1GRIA 3JV3A 2DF6A 2RHQA 5LRSA 1NM7A 3Q5FA 4QSHA 1ZQ1A 2EFQA 1VQKQ 3IG2A 3V8KA 2QHVA 4QQ6A 3PJRA 3HG9A 3MAJA 2QYZA 4P5NA 3IKTA 2JN6A 1AA7A 1POGA 1UZCA 3FB9A 1N75A 1GXIE 2KDOA 1SAUA 3SZPA 1H92A 2WSEE 4HF0A 3ZQCA 2K9QA 3N05A 4QLCU 3CJNA 2L89A 4V2SA 1IXDA 1VQ4I 3L7WA 4AM3A 2ZMEB 2LKPA 2DU9A 2QHUA 2IY5A 4O5VA 2PMEA 4GO1A 2QQRA 1K9AA 2STTA 1PD1A 1YJ9A 3KYDB 2BVLA 2LBFA 5D6YA 1RABB 1BN5A 5FLXE 3S2WA 4YELA 5IHIA 2OTLA 3HXWA 4Z6YA 2M3AA 1IXRC 3B02A 1IRXA 4IJAA 5M5YJ 1IDYA 3L00A 4JLIA 4PJLA 3HL8A 1SRLA 2OC6A 12ASA 2CP6A 4OLFA 4YRFA 2EIJH 4HX4A 5IOZA 3J7YJ 4WX9A 2ID3A 3OOUA 3W2AA 4HT9A 3TO7A 4ASNA 3REXA 2YUPA 4J9DA 2HSPA 4K11A 4UNOA 4HVVA 4CS2A 3L2UA 5LHGA 4PJOG 1S5LC 2DXIA 1VQNT 4LDYA 4M77G 3CCRQ 2ZKZA 1S8NA 4RQFA 2VIXA 1ZQ3P 2VI6A 4I98B 1UUEA 4P74C 1WFXA 3CC4A 1PYSA 2Z9OA 1VQOI 1RESA 4EMKB 3SFZA 4UPAA 4HCBA 3A02A 4Q48A 3W6JB 1P92A 1VQ8Q 2CJJA 4YIIA 3SEQA 3SHFA 2GM4A 2HZTA 3P8YA 3ZCOA 2L7MP 2FOWA 4WXDA 1T38A 2TCTA 1M3CA 4YTLA 1H4VB 2OCEA 3CCUQ 5LBQA 2PMFA 5HDNA 3IL2A 1WH7A 3L4GB 3C4SA 3KEYA 2LY2A 3HRTA 4JUVA 3A03A 1VI0A 2X85A 1Y1WJ 3WU0A 2EJFA 3CF5F 4EQQA 2HQRA 4N0BA 4KT6A 2RKHA 2NS0A 4XRSG 3T1BA 5EDNA 2A6HF 3I56Q 1FNNA 1QVGP 2HDAA 3CQZJ 2IA1A 4NL3A 2E1OA 3ASNH 1NJIC 4H02A 1E6GA 4FSSA 4HXJA 4F7UG 2EINH 3WTYC 1D0XA 4UUTA 4J9HA 1VQ5T 4BGDA 3ULQB 3REAB 3SEMA 4C0DB 5CQXA 2HYGD 4MQVA 3K4NA 4XK8E 3K1MA 2Y2ZA 2YR2A 3W3CA 2XHKA 1QVFP 2FMLA 2Y0MA 1EV7A 3HOZJ 2DXCA 3IP4B 1K0SA 5FWBA 3RDVA 2EL9A 4IHYA 2F1LA 4XEOA 2ECBA 3HTZA 1NJ5A 1KONA 1VQNA 2VC1A 5KYUA 2P81A 2EA2A 5LGNA 2XHCA 5ICFA 2DQLA 2DRMA 1YJNQ 5DY9A 4QVZA 2KISA 5FWCA 4CO8A 3JRZA 5JVGF 1ZG3A 4I01A 1FZPB 3AG3H 2QDYB 3H0FA 4QPQA 3GEZA 1WZOA 1DPRA 2ZNZA 4OIOF 1K9MU 2GF7A 4J7IA 3BP8A 3M56A 2RHSB 3CF2A 1PUFA 3G3ZA 2O9LA 1X6OA 3JCMg 2YUOA 3GFLA 3PO3J 2D5VA 3LA7A 2MD0A 3QYGB 2QGGA 1K8AU 1IV6A 2A8EA 1QE0A 1WHHA 2L01A 3K0LA 1SFXA 1ARKA 4CYDA 2GQIA 4A4HA 2RHUA 3N4MA 3S15J 2QQ8A 2XIDA 3OR2C 4BH9A 4R0KA 3LWHA 3AT1B 4KUMA 1WXTA 1H0MA 4D9JA 2OTJT 2HSEB 1KG1A 1QPIA 2ECCA 3INZA 2EV6A 4M7AA 2ARSA 3G4ST 3ZR8X 2B8AA 1ZELA 4RB3C 1XX5A 2M87A 4GXOA 1SFUA 1XSVA 1YJ9I 4AIJA 4WK8F 4L9NA 3T5XA 3IALA 4N0AC 2D1VA 1QCNA 1VQ5A 4M7DF 4LOCA 1HC8A 1JJCA 2HTJA 1A5JA 3G1JA 2OTLI 3A32A 1QVPA 2CSOA 3M54A 3A0HC 1QVGS 1XTAA 1X54A 3LSMA 4XBFA 3REBB 4ZYHA 2JTFA 5GAMh 3UWNA 1PYVA 3RR6A 4KUDK 1FYMA 1TP4A 2WAEA 3IAM2 3QNEA 2X1CA 1X3WB 2QYOA 1TWGJ 1X2NA 2VBZA 5KH6A 1WWXA 4E6RA 2E4HA 1RAGB 3JRDA 4ON0A 1OKRA 4XU3A 3E5QA 2FZGB 6PAXA 3KP7A 5HLHA 3I55Q 1QVFS 1MSFC 2VE9A 5B1AH 5GAN3 5AIQA 1XN7A 5M9OA 2LDMA 2M8GX 3VUZA 1KQ2A 1QRYA 2L4AA 3R6NA 1M1GA 3CC4I 3H8ZA 2PNIA 1M8VA 2DFIA 3IHUA 4MDWA 1R1VA 4IPAA 4YFXF 3KE2A 5I11A 4BDZA 1JTYA 4OF1A 2RQPA 2J6OA 3DLLA 3TQNA 2MLKA 1ZA1B 2K3YA 3QRFF 4PKCC 5BMZA 2DXUA 1VNDA 1YWOA 2P5KA 3MKYB 5HOOA 3ZQGA 5IP7J 5J8CA 2ELKA 2EYQA 2QXFA 1EVLA 4EDUA 3AL0C 3FXQA 2PVDB 3S3MA 4BU2A 3ZN1A 1ZSZB 1XJWB 1Y8QB 1ON1A 2A5WA 4X9CA 1Y71A 1RKTA 4Y15A 1MZBA 3WTUC 4J00A 3MMYB 1IUYA 1LEAA 1Z7MA 1FTZA 5M3FJ 2OTJA 1M5Q1 4LJZF 3G4SA 4AIKA 5KNNA 1VFCA 2Q1ZB 3G7ZA 3M3YJ 3FXLA 1BIBA 2KT0A 4YRVA 2XIGA 4BE1A 5KK1A 1IN5A 3CMYA 1C1AA 2CJ9A 4IRHA 1Y96B 1I0CA 1H8KA 4M6XA 2FO0A 1T0FA 2EKHA 1RADB 1JRIA 1BC8C 3I59B 1YX5A 3TCJA 1B70A 3OS1A 2EZLA 5E1ZB 2E41A 2VUBA 1XSDA 2R5MA 2DI3A 2X4HA 4HW0A 3WTWC 3RJPA 2KBTA 4JX6A 2XAJA 1T08B 4OINF 5LJ3j 2BE5F 2EH3A 1XQHA 3GZ5A 3BW1A 4GBQA 4IZZA 5FKNA 2MPXC 2BZTA 3F6VA 2X4XA 4IHWA 1VQNI 2CS3A 4PJOD 2BY3A 1HYOA 2X9DA 2A6EF 4J7FA 3DFGA 1TT0A 1DPUA 4M78D 4A3FJ 3KFUA 2QTVA 2DFEA 3ZQQA 1NPPA 4Z02A 3VQYA 3ZQFA 3RACA 4PG3A 5IPAA 1G51A 4ZTUB 1RL2A 1XNIA 3MEVA 5BQTA 3HHGA 2KR3A 1EIYB 1Y56A 5GAOp 4Y91A 5H20A 1BR2A 2VKNA 2XKPA 1YRNB 1M1KU 1Q7YC 4ZGEB 1D3BB 2E6NA 2ZPGB 2XAFA 4PLLA 3QPLA 5IT9Z 4JRPA 3CJRB 2F5VA 3V7SA 3PGGA 1VQKT 1R7JA 2XB0X 2R5ZA 1OYWA 3JCMe 1Y57A 4JS5A 2PX9A 4PFZA 2EFWA 4A0YA 4AH6A 3Q1JA 2Z2SB 3DXJF 1YCSB 3WE3A 3JCMd 4M75C 4RTWA 1G3WA 2CZ6B 3OA6A 2PVOB 2IEKA 4NB5A 2RQQA 3SB2A 3RKYA 2R7QA 3M4OJ 1UJ8A 4YG2F 4C92D 4CC2A 1DJ7B 1F1ZA 1FSEA 1C0WA 3CMAQ 2DFFA 3R07A 1VQ5I 4IHXA 1FBUA 3WGHA 3CZ6A 2ALYA 4QVCA 2PEXA 2IS6A 5B5EC 3GTKJ 2LC2A 4FT4A 4MTEA 5GAOl 3U2RA 4Y17A 4QIWN 4XEMA 1JXMA 2CGPA 3BCBA 3AG1H 2JJ7A 3GMEA 4R8HA 3SJMA 1AU7A 2X6YA 2DETA 1AWCA 3M58A 2HEQA 1SFKA 3VRZA 1ZLJA 5GTIC 1J59A 1I3QJ 2A08A 5KCHA 2K4JA 4LG3A 5LGUA 1IGNA 2DA3A 3LFKA 2ELJA 4HF2A 1VQ7Q 4HT4A 2BY2A 1KD1C 3CCRT 4XTWA 4LDXA 3LSQA 1P9QC 2VONA 1GVJA 3GTMJ 1LKXA 1WLEA 2F69A 3V8JA 4PDKA 3FF5A 3HKSA 2ZZDA 3EGDA 3CCVQ 4CRIA 4OB3B 1VQ8T 3MQZA 5GAMg 5LRRA 4AC0A 2HD0A 2O9VA 3ASOH 1ZHFA 4PJOE 1H9GA 2CS7A 5E8IA 1W4MA 4M77E 1X3UA 1ERDA 2V1NA 1QVTA 3BY7A 4IUPA 5FROA 5HDGA 3CCUT 2R7XA 1O3QA 2RK1A 1VQKA 3UGTA 2QK0A 1R00A 1GHCA 1JJ6C 2NUPA 5D7UA 2M0YA 1MHNA 4AYBA 2YLCA 2O4XB 2DU5A 5FLXZ 2W24A 2LCSA 3E3VA 3ISPA 1V3FA 2NUTA 3IAS2 3QTCA 2DAQA 2LCCA 1W5TA 3WVEB 1Y6IA 2E7WA 3IKMB 4BUGA 3I56T 2OTJI 1YHQI 4GLKA 2P4WA 3JAMK 3G4SI 1PUEE 1VIFA 2XG8D 2WSCE 3H41A 1GLNA 4F16A 2GIVA 3PFSA 2VVKA 3OS2A 2NVTJ 3HXUA 4MLOA 4F91B 3WTVC 2ZCWA 4OMQA 1H4QA 2DOAA 5FU6B 2V6EA 3HIFA 4AG1C 1X1PA 4CH3A 1IN6A 4P1WA 3CMEI 1X1CA 3CEYA 1I3AA 2LREA 1O9SA 2YRDA 2B9SA 1PHTA 1OYYA 4MEXF 3PQKA 2V9VA 4P74A 2LH9A 3S3NA 1XG1A 3LL7A 4HVWA 3FBNB 4FW2A 4N9IA 3AKZA 3HFZA 1AZEA 1PSFA 3HZJA 4KH0B 4C92E 1U6GA 1WLPB 4L0ZB 3P8BB 3JAME 2KMUA 1OPLA 1X1DA 3VS5A 4Y3OA 3JRCA 2XRLA 1ETWA 4EEFG 4F7UE 4BACA 5GAGJ 4CYCB 2R58A 2KPMA 2F2VA 5BOXA 3CCRA 1T0JA 1ITYA 1YJNT 1JGGA 4M7AG 1IDZA 3TOAA 5J1YA 5FKOA 1YB3A 4CH6A 4LXCA 3PNYA 5D5VB 2ZPEB 2HQXA 1OYXA 4WWCA 3JB9D 1IF1A 4H2WA 2NVYJ 4NBQA 2JSPA 1SANA 2H09A 5KYYA 1J0RA 1VQ8A 3ZMTA 1WHUA 1QW1A 2CIMA 2A07F 3TEEA 4ZYEA 2F5TX 2AK5A 5F0HA 4XKCA 3RF1A 3ERED 3CCUA 3I71A 2HGCA 1K9MC 1RUNA 1VYVA 3OBYA 2LNHB 4NUBA 3PFYA 2DFUA 5EF6A 1YJWI 4NHJA 1WU7A 1I27A 2JT4A 4C8QD 3PFIA 4XLPF 4XONA 2BKDN 4RQEA 4DGWB 2E7XA 2CT4A 1YWPA 4RUGA 1BA5A 2KIFA 3I56A 3GFJA 1ZLMA 1IC8A 1GDTA 2RQRA 2MOXA 1VQZA 2ZMEC 2FBKA 2PMHA 4AIHA 1WJEA 3QYFA 4MMLA 4KN7X 4M74A 4FASD 3DPUA 1GFCA 3S1NJ 4B6MA 1YX3A 1U8BA 2W48A 4Y4RA 1G5IA 4Q6GA 2ROTA 1WCMJ 4WF2A 3HDDA 5K7ZA 2MFZA 2L0AA 4A63B 3JCMX 2A68F 3G1MA 1RAEB 5GAOr 1YIJT 2R7UA 2DTOA 4TVRA 2NVUB 3VYSB 3IRQA 4BJ5C 1WNLA 1MIJA 3DU5A 3LSSA 1IRZA 5GMKl 1HK9A 2K3PA 1M3BA 1V5GA 4XLCA 1R5HA 2MF2A 5E3MA 1HBXG 4Z89A 4MZTA 1SG5A 3OBWA 5CR2A 3I55T 4A6EA 1YJNA 1KMMA 4EO4A 4P96A 1WIEA 3OYAA 2CYYA 3QKJA 3J7AO 3F72A 2LSOA 2A0FB 5LJ5j 2IIMA 5E17F 4EMKC 3JRHA 3PIOA 1X2HA 1K7AA 5M5XJ 1YLFA 5GAEJ 1TSFA 5ELNA 2MYSA 4RTUA 3SFMA 4BNCA 2GLOA 4BY7J 2W7NA 1FOKA 3KZYA 2R5AA 1G6NA 3BTIA 2XKOA 4N0AA 5JFRA 3QODA 1VQKI 2P0QA 5FKKA 3GVAA 4OMPA 4IL6C 5E3NA 1B8AA 4OMYA 1S7OA 2YUQA 4M75F 1ZRFA 1RPWA 5DEQA 5AONA 5GAMe 5KYNA 1FBSA 2LKSA 2DIQA 2Q7HA 5CKTA 4A3LJ 3NARA 1QQIA 4KGZB 5GAMd 2DTIA 1V29B 1HSQA 3E2UA 2COBA 3BPXA 1X56A 3CPWP 2LFBA 2FPEA 4BI3A 2JXBA 1B76A 1EH7A 4HVCA 3VPRA 4B44A 2H8HA 4C8QE 5J40A 1RUOA 2Y4XA 1OCCH 4C0DC 1NNHA 1S6LA 2R7OA 1ZGJA 4IURA 1B3QA 1UGSB 2ME6A 2EPDA 2K2MA 4D5CA 1DP7P 1B8IA 2RMOA 3SZGA 2DQRA 5I21A 1N5ZA 3D0SA 2M5WA 2XDVA 3WU1B 2Z33A 2KIQA 4O6JA 2K9SA 1VZ0A 3ZQLA 4S04A 1X01A 1YBYA 1YS7A 5ICGA 2YSQA 4P3NA 3K6GA 1KC8R 4HPQA 5K5QA 2O88A 3TL4X 2YS9A 4E7HA 1ZR4A 1HJDA 2BUDA 3CCRI 3I55A 2XVCA 8ATCB 1WVRA 3KIOA 2GCXA 1I5LA 1K73R 4XLHA 2AKWA 3M4QA 2O3FA 5GMKh 2M1BA 2F5CA 3EPZA 2OV7A 3PZCA 3M0TA 3L2CA 4L18B 3MKWB 1YW7A 3VYHB 4F7UB 2JS2A 1VQ8I 3GTGJ 2HU9A 5KE2A 3CCYA 2HNIA 5L3CA 1PG5B 2CH4W 4HNUA 4BI8B 3A0BC 2B63J 2H3EB 3CCSQ 5J3BA 2HI3A 2EWNA 4N4GA 3KXTA 3CCUI 2GZWA 1FJLA 2RQVA 4RCCA 3A74A 2CQNA 1YE9A 2HQ5A 2LOOA 1QLYA 4XU0A 2HZDA 1W5CC 4KDPA 2QSGX 2PU9B 1RAHB 5LL6S 3V7RA 3CUQB 2CO5A 3OL4A 1EFWA 2QEXQ 3I56I 2P6TA 2O31A 4LVMA 3NHNA 4D7NA 4FT8A 2QG9B 4FX0A 3L42A 5JI6A 4A69C 3FK6A 2DTHA 2KXCA 2XD0A 2DTZA 4P73A 3EUHC 4M7DB 3C0CA 2O2OA 2VBXA 3CMAT 3CDHA 1JQQA 2VL8A 3O8GA 5EC7A 4IF4A 3COAC 3I3LA 4LE9A 2X0LA 3GLLA 2MH9A 2BHZA 5GAN8 4BWAA 4UC4A 2H1LA 3ICAA 5LJ5e 1N9RA 3HOVJ 3CPWS 2XPVA 2F2EA 2LF7A 1X58A 2BY0A 3E6BA 3WGGA 3W6KB 3TEHB 4HEA2 1P7IA 2EB7A 3LH5A 4EJOA 3TGNA 3Q9SA 3SXYA 4RG2A 1W0UA 1R77A 3UGQA 2L4MA 3H0GJ 2XC7A 2M0CA 4HCCA 2CMPA 4KRTA 4JK1X 2ODRD 2LNVA 1YGBA 2RNGA 4OOIA 4A53A 4TV7A 1HDPA 2GOMA 2KY9A 3OIQA 4BE2A 4WXHA 2CSIA 4LVKA 1TNSA 2JA8J 1VQ7T 1R1TA 2X3WD 3A1PA 4K87A 1YJNI 2X6OA 4GYGA 1NH3A 2CV0A 3GZ6A 3RQ4A 5DD8A 4LUDA 1WXBA 3PUBA 3ME9A 3WE2A 3VSKA 1SF9A 2DL8A 4X9DA 1X55A 1YI2Q 1E2XA 3REUA 2P0KA 1GFDA 2QBYB 1WJ5A 3OD1A 2CGHA 3CCVT 1WX6A 5J1RA 2YRCA 1WJDA 3CDLA 5L8RE 4IRIA 3K9TA 1BW5A 2ZXHA 2DA4A 5GTHC 3GZNB 1JO8A 4UVBA 5LHIA 2JVHA 1B7TA 1SKUB 3FBIB 3KEQA 3FMSA 2F2WA 1X19A 4IX7A 4GGGA 1O3TA 2EYXA 1OOTA 3UATA 1V1CA 4XR6A 3BR2A 1ZSZC 1I1JA 3M0QA 2JS0A 4ESFA 3MP8A 4P3OA 1I1SA 5D5XB 1LFBA 2DMUA 2VJ4A 5DUKA 2EVRA 1WHLA 3OIOA 3V42A 4X6AJ 2QDLA 2YLBA 3DLAA 2ZIMA 1FC3A 1PKSA 2Y30A 4BJTA 3CMAA 1V54H 4RLQA 3FLGA 3M0PA 1R8OB 3CCLQ 1R36A 4LK0F 1WQ2A 2V9PA 2DAOA 1BJZA 1WPYA 2NS7A 1CF7B 1TXQA 1B9NA 1HCRA 2K3BA 1K4SA 1YIJI 2EBPA 2P0PA 2KJCA 3BG3A 1A6QA 4GRIA 4P72C 2VWFA 3TSWA 1KQ9A 4KISA 1N9WA 3HY1A 1M90R 2VE8A 4Y28E 4LVIA 2A37A 1K0XA 3QOPA 3VQVA 4C5HA 1MBJA 3EGXA 2CUEA 4G94A 1BM9A 4FISA 2JTMA 3EFRA 3CP2A 3RCOA 2BTTA 5GMKi 2DA1A 1AOJA 1VA7A 3K4LA 1VQ7A 2KDSA 4BI4A 2JVGA 4XLFA 1E6HA 3WGIA 4BY1J 2LT1A 1WKMA 2DIGA 2EFPA 3G6EI 3A01A 2K5LA 2FNPA 3PSIA 4FYVB 3CDIA 4C3HJ 5M3MJ 2JMCA 2E60A 4F7ZA 3M5AA 4EJVA 4ESRA 3CCVA 2VJ5A 3GFIA 4D1QA 4E7JA 3QO7A 5I2SA 4XQFA 2EIKH 1MGTA 5A0LA 3JCMb 1K4US 1U5TB 2L8DA 3TQ7P 4Y7NJ 5FU7B 2FX0A 2LQ8A 1LE8A 1Q82R 3PNWC 3RMQA 4BBSJ 2PUKB 2EA4A 5KCOA 4MFDA 3OYGA 3G1OA 2MWOA 2HYJA 4L6V5 3NWTA 4M7AE 1WA7A 2CFXA 3DTEA 3FXKA 2ZT5A 2R5YB 2R7FA 4B9XA 4UB6C 3WQZA 1FEXA 4MO7A 3MQ0A 2AS5F 3DBLB 1CKAA 1XGMA 1NLPC 1EOVA 3QWYA 4XN3A 4QTRA 5CVRA 4RBOA 1N77A 3U1KA 1Z21A 1XD7A 3P8HA 2P5IA 5CKHA 4RM3A 2QM3A 2HQEA 4G12A 3VYGA 2IT0A 4A0ZA 1JJ2A 1F4KA 2H8RA 3OQ5A 2IY5B 3VWBA 4RA2A 4XIDA 1TUCA 4D8KA 4E4HA 3JAMZ 3ERMA 2LBFB 4RM2A 3LGLA 2QF7A 4P9FA 4HLYA 4X5OA 4FYXB 1XSXA 4FE4A 2ED0A 2MLGA 2HCKA 3THKA 5HGQA 4A2UA 4JRQA 4D5FA 5LJ3f 4EM2A 1VQ6Q 2I0NA 3BR3A 3G1LA 1KZHA 2K9GA 3U9GA 2ED1A 1I07A 1USYC 2AZVA 1EZZB 2GFAA 4M7DD 3NEMA 5IOYA 1MUZA 3JTGA 1MMDA 2ZR3A 5HY6A 4R1HA 1AWJA 5C6SA 2P7CB 1VF9A 5DCMB 1REPC 3MPUB 2J6FA 4RGSA 3QDFA 5IXFA 2R92J 1ZBJA 4UUSA 1F43A 2DPUA 3SZTA 2R57A 3LSPA 4RS8A 1TWAJ 2ZJ2A 4UUVA 4A5MA 1QCFA 2CUBA 3LWFA 3GCMA 4IUTA 3O6BB 1WJFA 2LRQA 2K7AA 2DMNA 2BYVE 3H0DA 2ZMEA 2K02A 3KZIC 2E2JJ 5LGTA 3I0TA 2H1KA 1W0TA 5JLXA 3JCMW 4H2SA 2DK3A 3WU2C 3O8VA 4A4KA 3IWFA 4CHUA 2D9TA 3QO8A 1IHVA 1B72A 2QVOA 3KYCB 4XRFA 3RYPA 2O0YA 1S72Q 2WC2A 2Y90A 5IYDJ 5F08A 1YW8A 2MG4A 4L5IA 11ASA 3QOEA 5CKFA 2DYBA 1JKPC 3L1AA 2D1XA 3MZ8A 1LQ1A 2ZBKA 2ZPHB 2DZ9A 3MKLA 2K5IA 3R4KA 2STWA 2FVUA 4NQWB 2UZKA 3K70D 4RDUA 1K73U 4CCLA 2M0OA 3CCJQ 4CCMA 4ENKA 4IIMA 3DTIA 1LPLA 2D45A 1UB4A 1NYQA 2YUNA 1MV0B 2DT7B 5ECAA 3CMAI 3BR1A 3S14J 2R4GA 1UHWA 3P5JA 5FU6C 3H3UA 3RKQA 1KOGA 2E5AA 4RMOA 5HK0A 5IP9J 3R6OA 4LNSA 5DUIA 4ZDOA 3R6SA 1T8IA 4YRRA 2HDDA 3FX3A 3T0YA 5FRNA 1C0AA 3FXMA 4V2FA 1LFUP 2ZINA 3LSRA 1NK2P 1M27C 5L23A 1OJLA 5JVTA 1AHJB 1NYFA 4YREA 3HPWA 4AD9A 3VYUB 5HS8A 2OQRA 1VQ7I 2ECZA 1Z7NA 4L9VA 3FEOA 1HKTA 5F1RA 1Q81R 3L4GA 1TWBA 2WAQA 3EYYA 4A3IJ 3C94A 4G6DA 2YXYA 4D6WA 2X51A 1V76A 4H2TA 2I4OA 2ESHA 4C5GA 3GW2A 4B8XA 4C5EA 3X24B 3LAJA 3CCVI 2KAFA 1MJAA 4HQEA 4OAZA 4YCWA 3A7AA 2DE0X 4KH1B 3CTAA 3JCUC 3PL8A 2AXTC 4HDUA 1PUFB 2FU4A 3DV8A 5EG2A 3ZQ7A 1MBGA 1E7OA 2XB5A 3CCST 3TO9A 3MZYA 3M8EA 1APLC 3KFWX 4K86A 2CZ1B 1Q95G 1NEGA 3SWNA 3A8OB 4M78A 5DYMA 2JRTA 3MJXA 1OZ2A 2IA2A 1MBHA 1D1CA 1W1WE 1RNLA 1KQ8A 3MP6A 1ACIA 1MBEA 2J6KA 3A31A 2F48A 1FOXA 4JDSA 1X43A 4HNTA 1GXPA 2FHDA 4EM1A 2QEXT 3FJPA 3UA7A 3M8JA 2KRCA 5ICCA 3S2HJ 4M7AB 1DU0A 3V7CA 1OX8A 1SVMA 1UMQA 4C2MJ 2ETHA 1X1BA 2K4BA 1U06A 2BZYA 2XI9A 2ZO4A 2Z5UA 2EKOA 4L9TA 1X6BA 2A61A 3QJ6A 2CKKA 2ARTA 4J8OA 1IGQA 2CUDA 3I5SA 4M3BA 1YN8A 3NAUA 3E9FA 4J01A 3UH0A 4J9CA 2XMFA 4KIGA 2DEQA 2L3QA 1T6SA 4OWRB 2PVGB 2BGCA 4BXFA 3IH4A 3OL3A 4GFBA 2RD1A 1UGQB 1MH4A 1QBJA 3HKZN 1EVKA 3A7RA 3MEWA 2NVXJ 2WV0A 2ESNA 2XK0A 1TUGB 2DVJA 4MNUA 1YI2T 1ABQA 5KVRA 2HQAA 4YRMA 3DWLE 2AT1B 4J6XA 3QWXX 3TKYA 2QUFA 3BT9A 4RAZA 3DKYA 1UDLA 4YRPA 1W7PD 3NQOA 1M90U 3CCSA 3KZZA 3EDPA 4OIQF 2OJED 2RAEA 1QWFA 2XICA 2QI2A 4YYEA 3C18A 2ZXIA 5FRMA 2P8TA 3VS6A 3QZ9B 4XU2A 2HQNA 2OD5A 2CG4A