3V7SA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor 0364
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 98
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7sA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7sA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7sA02
3BJOA 2IA0A 2PMEA 3F8NA 3S2WA 4JRIA 2Q0OA 3WQZA 1WWXA 4AVPA 4M75C 1YFTA 3EETA 1ZGAA 4YIFA 2IPQX 2MH2A 5K1XA 1EH6A 4UP7A 3QOPA 2AS5F 3IKMB 2HGCA 2STWA 1R58A 4UVAA 3V7CA 3NQOA 2ISZA 4IJAA 5FD5A 1YW8A 2VXFA 2EFPA 1U1SA 4C8QE 1YIOA 1B34B 3A32A 12ASA 4M7DB 3GUDA 2OZ6A 5LGNA 5GAOq 2VBZA 1TBXA 2PBIA 3W6JB 1ZN2A 2XRNA 4U0WA 2MC3A 2NNNA 3MFKA 3INZA 5ERIA 4OINF 2K86A 1TH7A 4IVNA 1YCYA 3HTZA 4WJ4A 5HS9A 1FYKA 2CIMA 1XGSA 3DQVC 4KUMA 1J59A 2O3FA 1B4AA 4F7UF 2IP2A 2JSCA 5LJ5f 2FSWA 1AWCA 1TNSA 4HX8A 4PNOA 3TDUC 1J9IA 1I1GA 4RGXA 1Z9CA 3V8KA 1JRIA 3I0TA 1USYA 4HV5A 2P7VB 5GAN6 4F7UA 1X55A 2GXBA 4P73A 1SD7A 4KN4X 5DEQA 4A12A 2P5VA 2YLBA 2CGHA 3ZN1A 4M71A 1J0RA 2VN2A 1F4KA 2RB6A 2CO5A 3IRQA 3WU1B 4MTDA 4N0AA 4A53A 1FOKA 4M77G 2RVCA 4EM0B 3WTZA 1U6GA 2J5OA 4HWTA 3HRMA 2BYVE 3PFIA 1J5WA 2PI0A 2P8TA 1R1TA 5J6XA 2L02A 4M7AD 4RS8A 1HXDA 2GZWA 3K1MA 4O3MA 3SFZA 3L00A 2D45A 4PHCA 4EM1A 4XTUA 5LJ3e 4G7OF 5DDGA 1H641 5I21A 1WQ7A 2RNJA 4BHPA 3KZZA 2OA4A 4P75C 5E1ZB 1W4MA 2ARTA 2HEOA 4NL2A 3HY1A 1M5Q1 2ZNJA 2DZ9A 1IF1A 4JRKA 4RMFA 5E8GA 2OQGA 1QQIA 1EFWA 2VXEA 3F21A 5GANg 2DDZA 3RDIA 1KYWA 5ICCA 5EEGA 1LEBA 2VT2A 1U5TB 2XGTA 3KP4A 4XQ3A 4ZZLA 2IJLA 2IRFG 2IW5A 2GQQA 3HFVA 5D8KB 3GVAA 1E22A 3I4PA 3VEPA 4I2OA 1MGTA 1JHFA 3JTHA 2CJ9A 3BJ6A 2GIVA 4D0PA 1WI9A 4I98B 3GFJA 1ZAOA 4YYEA 5LRSA 4M77F 2ZZFA 4H2SA 2ZT7A 2M45A 5LJ3d 4M7AB 1XB4A 4Y17A 3U1DA 2HWVA 2XASA 4DPGA 1T39A 2HKXA 4M77A 2ODRC 3TUPA 4G85A 1R7JA 4XU2A 5H6QA 5GAN8 1KGSA 5ELOA 1RUOA 5DCFA 2XAHA 4XSXF 1L0OC 4ZIBA 1DUXC 2OQRA 2PJPA 3ZMDA 3QO3A 4DNCA 5HGQA 4M7DE 5HS8A 3SQNA 4P55A 3TKYA 1X2HA 2DJZA 4YRIA 4I0AA 4A5MA 1I8FA 1I6XA 4M75D 1MD0A 3ICAA 3GZ5A 2H27A 4B8XA 1KU2A 1ONVA 1BIBA 4KIBA 5GAOl 1NJ8A 4TVAA 3TGNA 3RKYA 1D5VA 2EWNA 1YO5C 2P0LA 5JR3A 2E5AA 3WTVC 3EYIA 5F64A 5FGMA 3NRVA 1G6NA 1ZLKA 2QWWA 4RCCA 4ZTZB 4J6XA 2GA1A 3FXQA 3JB9F 1SMTA 1JJCA 1Z7MA 3H3UA 4WCGA 5GAN5 3P9IA 2HYFA 11ASA 2FA5A 4EO4A 5GMKe 2DK8A 4E70A 3QU3A 4CS3A 2QM3A 2A6EF 4YFXF 1HW5A 5GMKl 4M77C 1NJ1A 5GAN7 3HXZA 2AMCA 1B7YB 2EFWA 4LNSA 5D5VB 3SXYA 2ZO4A 4MGRA 1S6LA 1ZGJA 4RB2C 3LQQA 1P92A 4ZTUB 4B09A 4Y13A 2VC8A 2ACJA 3V8JA 2JN0A 5LEJA 2FMYA 3I71A 1MDMA 4K86A 3P9CA 3W6KB 1LJOA 1HSTA 2VC0A 2WTEA 3M8FA 1KMNA 3W3SA 5FO5A 3JW4A 1K78B 1WNLA 2EL9A 3L2CA 4YRSA 4M74A 2G9WA 3RI4A 1T38A 3QSUA 2K02A 3QUIA 3RERA 2WV0A 5TJJA 1OMIA 2L01A 1FYMA 3TOAA 2Z33A 1FPQA 1DDNA 2P7CB 5CVVA 2P4WA 2PN6A 1T6SA 4LD5A 2RHQB 4M7AG 1X2GA 4ZYHA 3VODA 3RKWA 3TO6A 4X9CA 1F9NA 4RAYA 3HRTA 3TOBA 2E3CA 4PGGA 3HRSA 4WK8F 1OYWA 2PLYA 5J8FA 1MZBA 1XSXA 4EGZA 3KLOA 1RIQA 1KQ2A 3DPTA 2DI3A 2P6TA 5LGTA 2RA2A 1QPMA 1W66A 2KIFA 2AKWB 2KJBA 1I5LA 4YP0A 4P71A 4M7DC 4JLIA 1EVKA 5LJ5g 5L3GA 1YFRA 1XGNA 5LGUA 3HHHA 4LG0A 3BP8A 1TLHB 4BNCA 1B8AA 2MBFA 2UXNA 4MNUA 4U7BA 4KA4A 2Y48A 2XVCA 1YYVA 3ULQB 5K5RA 4XEMA 2FBKA 4A2UA 1BI0A 5LLQA 2ZFWA 4C8QD 1SRYA 2IY5A 4QWQA 4OOIA 1T0FA 2VOPA 3JCMJ 3PCOA 3DP7A 3JCMW 4PJOF 4FT8A 4X5OA 3VQVA 1ZHFA 3FMQA 4YREA 2KKOA 1S7OA 1BBYA 3U2RA 3ROUA 5GAN3 1KQ1A 1XSDA 2I4LA 3ERRA 3TEHB 4QLCU 2ODRD 4PJOA 1TW3A 2P5LC 2PG4A 3V4GA 4CHUA 3JCMh 3F72A 1OKRA 1LNXA 5F6FA 3M7GA 4P71C 3GIBA 3BFMA 4E51A 1E24A 1RNLA 4A0ZA 3DPLC 2EJGA 4AIJA 1AOYA 5GAMe 5E20A 1FYFA 2XAFA 3GYHX 1W5SA 1LQ1A 3I7FA 3CLOA 3JCMf 4NQWA 3L9FA 3WTXC 3KCCA 1FBUA 3M4PA 1E1TA 3M1EA 4WF2A 1FBSA 2LF8A 4KDPA 2PFBA 3HFZA 2C8MA 4XU3A 4OMYA 3HXXA 4ZZDA 1H4QA 4C8QB 2ZKZA 1UHMA 3NEMA 4N0BA 1U5TC 2W84A 1W7PB 2ZNYA 2QTXA 1DPRA 1I1SA 4TQDA 4WJ3M 2UZKA 4RCBA 3K2ZA 3M4QA 3Q9SA 4XU1A 2R7FA 4HWSA 2A5YB 2C6YA 3BJUA 4UVCA 1BI3A 2DU5A 3N4MA 3G1ZA 5HDNA 5GAOm 3EFRA 3HOTA 1Z91A 2WC2A 1G5IA 4ENMA 2A68F 4XTVA 4CO8A 3CUQB 3SWNB 3E6DA 4I7HA 2EFOA 4M7AC 5KNNA 4A0XA 1IXSB 2XUBA 1YFSA 3MF1A 4Q47A 5GAMd 1E2XA 2Z3YA 3REOA 4ZYEA 4FX0A 3VQWA 2O03A 4IHSA 1M8VA 1GHCA 1ZYRF 3A5ZA 5E1XA 4BW9A 2XHKA 3JCMQ 5GMKm 4G7ZF 2YR2A 3FJPA 2ZT8A 4X9DA 4M75F 2E1NA 4EX5A 3R61A 3IC7A 3RPQA 2Q7HA 2F5FA 3WE2A 3FXRA 5H6RA 5IT9Z 3FX3A 3WTTC 4BHBA 4LFUA 2QUFA 2ZMEB 3HSEA 2K57A 4M75A 1BBUA 1SD6A 1HW2A 2FRHA 5CVIA 4YIIA 3WTYC 3CJNA 4G7HF 3VOEA 2XTIA 1R1VA 3GZ6A 2V9VA 3BROA 2DQLA 5E1WA 2HS5A 3QAHA 3U9GA 3FXUA 3IG2A 2HKOA 1OPCA 2QVOA 1TQIA 3HYIA 3TDZC 1UB9A 1IN5A 4M7DD 2OU2A 5GAMj 1G3TA 4OLFA 2ZBKA 2DPDA 3BZ6A 5DCMB 3VFZA 4JBAA 2ZNZA 4G6QA 1Y96A 4IHTA 1IL2A 3I59B 1MJBA 2Q7EA 2NAZA 3HUGA 1BI1A 2CJBA 3F3XA 3T1BA 1X3UA 1E17A 4Q6GA 2G7UA 1N9WA 4UXNA 3RJPA 2GXGA 2VXZA 1WQWA 4LK1F 2QHUA 4C8QG 4I09A 1MKMA 2EV5A 3NELA 4Y91A 4P9UA 4YG2F 3P8YA 5K1PA 4YCWA 1GVJA 1ZREA 1LJ9A 3FZVA 1O3TA 4A0YA 4HA8A 1R23A 4RB3C 5AIQA 2HQRA 1CF7A 2FF4A 2DXUA 1RIOH 2V79A 2JPCA 3RESA 2I4NA 2DQRA 5FFZA 5K5OA 3QHSA 3QU6A 4YFKF 4GXOA 3KFWX 1I5ZA 4H2XB 3F23A 5D4RA 5GANe 1FWZA 4EVIA 2DKGA 5DYMA 4P75A 3HSFA 2E1CA 3RUXA 5L3DA 3QPTA 2H94A 1I4K1 2RM4A 5LBQA 4KR2A 3M9AA 5BOXA 1H9TA 2QHSA 3EFSA 2ZNIA 1C0AA 4YRGA 2EJ9A 4EV0A 2ISYA 1D3BA 2ARUA 5FFXA 1USTA 1FSEA 2YSRA 2Z99A 4XTXA 3JCMV 1B9NA 1W5TA 4A6DA 3JCMX 4HX4A 2DLLA 3TO9A 4Q5SF 1XN7A 1EV7A 4CYDA 2DW4A 3MAJA 2FB7A 1H0MA 2KIUA 5GAN4 1TW2A 1B1BA 1G3SA 4NHJA 4XTZA 4HQEA 1R22A 2QBYB 5D5XB 1U1TA 3MWMA 5GANd 4FX4A 4MMLA 2LNBA 4HQMA 2UWMA 4KFCA 1QNTA 5J8CA 2NYXA 4L87A 4GGGA 2VT3A 3O6BB 3IKVA 3JCMg 2BE5F 2QZ8A 1ZLJA 1S29A 2RN7A 2DVEA 3MZHA 1C0WA 1T98A 1MGQA 4P74C 2MA3A 3SB2A 4XLPF 4KQEA 5BMZA 1DP7P 1HC7A 4YDQA 1S7AA 4ESJA 4HZFA 2ESHA 3J7AO 3GO5A 2K4JA 2X4HA 2W85A 4UHTA 1IAWA 3JSPA 3L4GA 4KICA 1U3EM 1G51A 4L18B 2EFQA 4H2UA 4HLYA 3E5QA 1ASYA 3C7JA 4HT8A 2Q2EA 4C8QC 1X54A 3FB9A 2HTJA 2FBHA 2CQKA 2BV6A 1HBXG 3KETA 3ZMSA 1QZZA 2EFNA 2RKHA 4M7DG 3CDHA 2YHTA 4BHCA 3VU3C 5D5UB 2O6GE 1FP2A 1HTTA 1PYSA 3JB9I 2CJAA 2FYKA 2K7LA 1PUEE 1ZRDA 1IXCA 3EQLF 2KJCA 3HTUA 4MHGA 3FMSA 4M72A 3CUQC 3SWNC 3COAC 4J5YA 3HSBA 1XD7A 3KEOA 4YRQA 1WLEA 1B70A 1STZA 3E3VA 2EV0A 5AIPA 3JCMc 3DXJF 3HRKA 2HDCA 4G6DA 5L3CA 3AAFA 5GAOp 4KMUX 3BW1A 2CW0F 5ICFA 4CH3A 3QO5A 3G3ZA 4Y15A 3ZP5A 5GAMh 4BQAA 3HRIA 1ON1A 2MD5A 5CVRA 2I4MA 4TTVA 4MEXF 4YRPA 4NB5A 1FSHA 5LJ3j 1WQ2A 1YFHA 2ZT5A 4HDUA 3BOQA 5D6FA 5JFRA 2DPUA 3REXA 4YRJA 3RACA 2NRAC 4EMKB 2BEOA 4M7DF 4Q48A 4KT5C 5LJ5e 4YPFA 4A54A 1KMMA 3BJAA 4L9JA 4HDVA 3ZMZA 2EJFA 2H09A 1MJAA 3E9HA 1B34A 5JVTA 4M7DA 3ZMUA 1RI7A 3ISPA 3WTSC 5A2QK 2ALYB 2E7WA 5L3FA 1N9SA 4XTWA 1YQAA 4KYWA 5DY9A 5LEKA 1EIYB 3CUOA 3GFIA 4TQFA 1XCVA 1P6RA 1ZG1A 1X56A 2ZGWA 3D0SA 2L3DA 1SD5A 4RAZA 1TQMA 3HXYA 3WODF 3E9IA 1F1ZA 4HWOA 2W24A 1J5YA 4M78B 3NETA 4UV8A 4IXAA 3FIFA 1TTYA 3HSRA 5F1RA 2PQ8A 1ADJA 1Z6RA 1Y0UA 4JUVA 2FNAA 2O61A 3KP3A 1OYIA 3R0JA 1IN8A 4CXFA 5DUIA 1O57A 5LJ5d 4CS4A 5ILUA 3FM5A 1UFMA 1SERA 4A6EA 3I53A 4YRKA 1WU7A 4EMGA 2CSOA 2H6BA 2K27A 2EAYA 2JTVA 4XBFA 3REUA 5HDGA 5LHGA 1O3QA 2STTA 3KE2A 2RHSB 3F6OA 3F8CA 5F5WA 1QGPA 2FBIA 3L09A 4O5VA 2V1DA 1IRGA 4YRCA 1BBWA 1FNNA 5ICEA 2XIGA 1FT9A 5D8LB 3FF5A 3CO7C 2DT5A 4PJOE 1XMKA 2O0YA 5BPIA 2XKPA 2MLGA 3F8FA 3KP6A 2ZTGA 2EV6A 3LQRA 4HWRA 3FM3A 2GAUA 2I2LA 1W7PD 2IT0A 4HF2A 1U5TA 3KP7A 4GCVA 4P72C 5LJ5j 3HRUA 5GMKi 4LLLA 5GMKj 4JK1X 2RC4A 3QP5A 2PMFA 4P9FA 1SMYF 4YRNA 5IT9K 2YPRA 4EJOA 3RYRA 2A07F 3DEUA 4M7AF 2E64A 2C7IA 3A74A 4KR3A 2CYYA 2V6CA 3F6VA 5A2QZ 4XRFA 1DPUA 3ERED 4EJUA 4M7AA 4KIGA 3QO7A 5GAN2 1Z7UA 1H9GA 3R60A 5BPDA 3HFOA 2Q5HA 2ZIMA 3Q9VA 3RYPA 3P7NA 1G3YA 3JSOA 2VONA 2OBPA 2DEQA 2EA4A 3K1PA 1R1UA 2CG4A 1FBQA 3R4KA 3SZPA 3TQNA 4C92E 3LA7A 2A3SA 4WX9A 3JB9H 2ZCEA 3VBBA 2LDUA 5KK1A 2M87A 1ZRFA 3KLNA 3M4GA 2L54A 3VQXA 3FHZA 2XAJA 4LLGF 3CMQA 4UUVA 1L0WA 4F7UB 1MJ9A 5C53B 4KMFA 4HYEA 3LFKA 3DKWA 4LJZF 4BYYA 2FEZA 2EB7A 2GA2A 4P5OA 4J15A 3KEQA 2Z5UA 1QZYA 2ZZEA 2ZT6A 3K9TA 3WE3A 4RQFA 3JTGA 4M78E 3A7UA 1EOVA 5ILVA 4EJTA 2HQNA 4L0YB 3AHUA 1XSVA 2P5KA 3C18A 4ESBA 3JAMK 3ML6A 4ENKA 5DD4A 3IKLA 5GAOn 4U7DA 1UHWA 2E10A 4M75E 3GW2A 1WSUA 1JHHA 2VOOA 1B7YA 4HX7A 1VTNC 3GXOA 3BDUA 5LJ3h 4OMZA 3JCMb 1O3RA 1ZG5A 1SESA 5FD6A 3DF8A 1YB3A 2LF7A 2I4OA 2A69F 1FYLA 3QO8A 3LSQA 3K1NA 4ZH4F 1REPC 2PMUA 4LK0F 3DV8A 1K78A 4G94A 2ZZGA 3KP5A 3TO7A 4H0EA 4PDKA 2QQBA 3IHUA 4LMYA 2DTRA 3C1DA 1LDKB 3LA3A 4Q15A 5LJ3f 3OD1A 5FB2A 3V8LA 5ICGA 3RPUA 2DFIA 3IWFA 1LNWA 5AONA 3NENA 4ENNA 1B59A 3IKTA 1NNHA 3DFGA 4NCXA 2VBWA 2ZINA 1BJAA 4O2DA 4EM2A 2IA2A 2RHQA 4TWAA 4EMKC 1EQRA 3ZPLA 5LHHA 1G5HA 1IZ1A 2O8XA 4PCQA 3JB9D 4LB6B 4PGHA 3ZMTA 4L0ZB 3HXUA 3R0AA 4MQVA 2AKWA 3QRFF 4CZZA 1F5TA 2DTHA 1WRJA 4BAYA 1KU9A 5CAIA 2ARSA 1P4WA 1LDDA 3I5UA 4G8XA 1RZ4A 3UGTA 2XAGA 4CS2A 4H2VA 2F5CA 3LA2A 1J75A 1FLIA 4BH9A 5FLXK 4RGRA 4ETSA 2COMA 2YLCA 4F7UG 3HXWA 2W57A 4I02A 2NNYA 3IRRA 1X01A 3TEGA 3WGHA 3RF1A 3RTRA 4UPAA 1JGSA 1KYZA 4K2EA 1LVAA 4M78C 5D6EA 3GLXA 1IUYA 2ZR3A 5L3EA 4TVAB 4UVBA 1K79A 3HXVA 2UXXA 4R1HA 4OP0A 4L9NA 2RGVA 2XROA 3JAMZ 1SFUA 2H6CA 3BY6A 4HF0A 1FP1D 2P6SA 4EGYA 3JCMe 2D2WA 2LKPA 4EJWA 4OIPF 4YRFA 1R00A 4CICA 2JT1A 2ZR2A 4F7UE 3TEHA 1JJCB 2ADUA 4QVCA 3A5YA 4WWCA 2PEXA 4EJVA 5HDKA 2QENA 4GYIA 1E1OA 5LHIA 4CH4A 2AMCB 1I27A 2JRTA 1YLFA 1D3YA 5LJ5h 4HVCA 5GMKh 1HSJA 3M8EA 1IN7A 5D5WB 4HT9A 1B6AA 4P74A 1K7AA 3CO6C 2YX4A 2NS0A 1ZG3A 2IA1A 2J5PA 4PG3A 1BIAA 1RUNA 4C8QF 1MDMB 2YX7A 1H4SA 1U78A 1L3LA 5C52B 3BDDA 1Z7NA 1KOGA 4WI1A 3F8BA 3QTCA 4EMSA 3LWFA 1GXPA 4HAMA 4C8QA 2A61A 4BXUA 1TNTA 4YCUA 1NJ2A 3UFGA 2EJRA 4AIKA 2HR3A 3QPHA 1W7PA 3GX4X 3WTWC 1ULYA 3T0YA 2Z9OA 3JCMd 2R7DA 3K0LA 5ILSA 2F5EA 4R8HA 4AWXB 2FMLA 2EK5A 1O7LA 4S04A 1SFEA 4PJOD 2OAZA 1NYRA 1YGBA 4UP8A 3VQYA 5BS6A 3P9KA 4HF1A 3P8VA 4MQ9F 2HYGD 1QE0A 1ZARA 2VBXA 2ZXFA 4P3PA 1P4AA 3CUQA 3SWNA 4V2SA 4H2WA 4RGSA 4XEOA 5FLXZ 1V4RA 1S8NA 1BOAA 4HW0A 2GWRA 4LG0B 3L1AA 5KVRA 1S3JA 3I58A 2KIMA 4YFNF 5HVQC 3HHGA 1OYYA 2ZXJA 3LAJA 1LYLA 1BN5A 3B73A 1BC8C 4Q4ZF 2HTSA 4PZJA 5K5QA 2EA2A 3I54A 3PQKA 3E5XA 4M77E 4BWAA 4P96A 4OIOF 4XSZF 1SAXA 1XGOA 3RL6A 2IY5B 5LRRA 4L9TA 4HBLA 4IRIA 1A04A 1USSA 1USYC 4DQ2A 2VE9A 4CH5A 3FWEA 3PCOB 6PAXA 5ELNA 4JQFA 3GFMA 2ZMEA 4AH6A 3BWGA 1BI2A 3KFUA 4P73C 5HLGA 5GANj 1OR7A 3E6BA 3OOPA 2DK5A 4GYGA 2BGCA 4RQEA 5DV5A 4C92D 3ZMVA 1JXSA 2QQAA 4M9ZA 3T8RA 4HOBA 4LB5A 3P8TA 1IXRC 1T2KA 5D4SA 2YU3A 1GXQA 4N0AC 2DQ0A 4PJOB 3JB9G 3MCZA 2Y0MA 4G84A 2XKOA 2FOKA 5DCMA 1U8RA 1ODDA 1YW9A 1P2FA 1U2WA 1Z6TA 4M9XA 4H2TA 3QP6A 2HZTA 2CWEA 3I59A 2DZCA 1YS6A 4R79A 4U0YA 3L7WA 3PQJA 1R5HA 4I0BA 5HLHA 3MZYA 5K1YA 4UP9A 2CGPA 3VB2A 3ABUA 5LJ3g 2DAOA 2ZCWA 4M78D 4IPAA 2DU9A 2Q7GA 3HFZB 1Z05A 4LLNA 2M5WA 2HFHA 2DTIA 4GO1A 4CGZA 4YRLA 5DD8A 2ESNA 2DBBA 3K69A 2V1UA 1QBJA 5DUKA 1KQ0A 1KU7A 4LGWA 4CDGA 1XDUA 3OV8A 2Q5IA 1KQ9A 1QF6A 1FX7A 3EUHA 2E7XA 1WPYA 5GAMf 4YCVA 3A7RA 3CTAA 4C92B 3KP2A 4G9YA 1FC3A 3LAPA 2HNIA 1ZH5A 5HS7A 2TDXA 2B0LA 3N97A 3FMRA 3BY7A 4I01A 1G4DA 3LSSA 3MQ0A 2DQ3A 4H2XA 3C3WA 2QHTA 4U88A 1ZRCA 1H4VB 4TVWA 2Y90A 1EVLA 3ECOA 3E5UA 4ON0A 5CYVA 2M8EA 1KU3A 4P3OA 2F2EA 5E17F 2PMHA 1KA8A 4UNOA 4K87A 4Z2YA 4YROA 2F5DA 1XMAA 3PZCA 3IL2A 3IWZA 1D8KA 3RKXA 4P72A 1IN4A 3T5XA 4M6XA 2VC1A 1IRFA 1XDSA 2CFXA 2MH9A 4AD9A 1NJ5A 4XU0A 2VBYA 4TVYA 3MF2A 4M75B 2KRFA 4J6YA 4S05A 4UV9A 1HW1A 1J2XA 2J3LA 3JCMP 2W25A 1WYDA 3H3ZA 2E41A 4FHTA 1YS7A 4PJOG 4J6WA 1XGMA 3V7RA 4L5JA 3ZN0A 2QHVA 4NL3A 1N9RA 5ED4A 4H2YA 3WGGA 1O7FA 5HOOA 3WU0A 4YRTA 1IW7F 4IRHA 5E18F 1XCBA 2QBYA 3HOSA 3V7SA 4YRMA 1HKQA 2FNPA 4RB1A 1TQPA 2L4MA 3ELKA 1NJ6A 2BBYA 2L4AA 3A31A 2ELHA 1B76A 1J7KA 3IALA 2R3SA 3J81K 3GFLA 1Y96B 1UCRA 2E1HA 4F7ZA 1ATIA 1GGMA 4MEYF 2FE3A 4H02A 5C51B 3E6CC 4CH6A 1IN6A 3SHFA 2AXLA 2HOEA 4N9HA 4AIHA 4M7AE 3R6SA 4RGUA 4RB0A 1KQ8A 3I64A 2RV8A 3LSTA 2RD1A 2M30A 3RIRA 4MMKA 3WG9A 3WGIA 4N9IA 1R5GA 4C92G 4TV7A 2ZIOA 3F8MA 3E97A 2FQ3A 3BPVA 1HK9A 1CF7B 1FZPB 4RDXA 4MTEA 2D1VA 1JE8A 2WWYA 2P5IA 1ON2A 4NOYA 3L2ZA 3EDPA 2OZUA 5H20A 4HV6A 1LEAA 1FY7A 3Q5FA 1PDNC 3RGLA 1HKSA 3GEZA 1NYQA 4WXCA 5CVJA 1YW7A 4IF4A 5CJ9A 3ECHA 3HFNA 5GANh 1QO0D 4QVDA 4M78G 4HWPA 1HKTA 4L9VA 1D3BB 2LSOA 3ABTA 3MEXA 3LC0A 3J80K 1HQCA 3R07A 3ZQ7A 5L3BA 1BM9A 4M75G 1VQZA 1O3SA 3E6MA 2V1XA 4ZYGA 3QNEA 4P3NA 2QLZA 2RDPA 3HIFA 5JI6A 1YTYA 5GANf 1SETA 1K6OA 1ASZA 3BPXA 1P4XA 4OU0A 4KNYA 4C92F 3NEUA 3GF2A 4XLNF 5CVUA 2VODA 3O2PE 3HTSB 2FU4A 1EH7A 1JBMA 3J81Z 1WKMA 2RQPA 4EMKA 2JPBA 1PP7U 3O3KA 4C92A 4M9SA 4YRRA 1CGPA 4U0VA 2DU7A 3UH0A 2X0LA 3EYYA 4M77D 1NHAA 4PJOC 4HLXA 1SD4A 4WXDA 4IRGA 2K4BA 1PP8F 1SFXA 5JHUA 2ALYA 5TRDA 1Q1HA 1EIYA 5GAOr 3D5LA 5CLSA 1Z1DA 1LOJA 4M78F 2Y75A 5HLIA 1R36A 2ETHA 3UGQA 2MLKA 3MEYA 4KIFA 2M1BA 1BC7C 3L4GB 4ESFA 1G3WA 4ASNA 4M78A 5GAMg 3JB9J 2DTOA 1ADYA 3PGGA 1B9MA 2JZYA 3A7AA 4M73A 3B02A 4ZYDA 2QYOA 2G7HA 3KZYA 4ENJA 4C92C 1LB2A 2DO7A 5EEHA 1YG2A 3F22A 1I81A 2OD5A 1PYSB 4O6JA 3WTUC 3SZTA 2Q8KA 4EQQA 4M77B 4EMHA 4M6YA 4KN7X 3T8TA 1LDJA 2RHSA 4WXHA 1V3FA 3J80Z 3G73A 1EH8A 3DSQA 1B70B 5BQTA 3H92A 4L5IA 3HY0A 4K88A 2XGXA 2D1HA 2G4CA 2E65A 2FXAA 5E8IA 2VE8A 2XAQA 4A5NA 2ZJ2A 2A6HF 2J3MA 5IT3A 2IVMA 4OIRF 2XV4S 5E3IA 4XTYA 2QQ9A 1D8JA 3GWZA 1H4TA 2DXTA 4OIQF
chains in the Genus database with same CATH superfamily
3DWLE 2DN0A 2K2MA 1D1CA 1NG7A 3CCSQ 2WSFE 1HJDA 1ZGAA 3GTKJ 1XOVA 2JOYA 1A36A 3IKMB 2HGCA 1ZA2B 3GNFB 1D1AA 3V7CA 4M3EA 3HGGA 4C8QE 2QSHX 2CQNA 1O9SA 3W6JB 1ZN2A 2CH4A 3INZA 1MBGA 1M4ZA 1YCYA 4RTVA 2LDMA 2CIMA 1XGSA 1UHFA 1KFZA 1NJIU 2JSCA 3GBGA 1J9IA 1I1GA 2R58A 3V8KA 1JRIA 3I0TA 4XICA 1USYA 2P7VB 4UUSB 2JMWA 3M0RA 4KN4X 4XN3A 2CGHA 1R9TJ 1Q82C 1NLOC 2NUPA 3WU1B 4MTDA 1VA7A 2ED1A 1FOKA 5EZHA 2RVCA 2P4TA 2VQCA 2PI0A 3H8ZA 2GZWA 2CUJA 2HU9A 4XTUA 5LJ3e 5FLVA 3JV3A 4G7OF 2GF7A 5FU6C 1JT0A 3J7AY 3QYGB 1WQ7A 3TEEA 3ABLH 1POGA 1IF1A 5KYXA 2CS3A 2JUFA 3VRYA 1VYUA 3CCSI 3TMOA 4B3AA 2NVQJ 1E3PA 3WVEB 2DIQA 4XQ3A 1MV0B 1VQOT 5D8KB 2P0KA 3VEPA 2CT4A 1MGTA 1OEBA 3QPSA 1Z77A 1NZ9A 2P4RA 2E3HA 2K5CA 4LXCA 1ZAOA 1LFUP 4YYEA 2KXCA 2M45A 2K40A 1XS9A 3U1DA 1YCSB 1W1WE 1T39A 3C4SA 2OTJQ 3G71T 3NPFA 3ZFJA 1I0CA 3QO3A 4DNCA 2Y4YA 4XOTA 1WZOA 1NBEB 4YRIA 4A5MA 1JJ2A 3ABKH 3FK6A 2H27A 4B8XA 4IUUA 4L6V5 1BIBA 1JXOA 2VUBA 1NJ8A 2C06A 4TVAA 3OS5A 3RKYA 2EWNA 2P0LA 4FASD 5JR3A 3OYLA 3META 4HCCA 3EYIA 5F64A 3P8HA 4RCCA 3FXQA 3JB9F 3ESWB 3PE0A 3CCUA 2HYFA 3H0DA 3QU3A 2QM3A 2HDAA 1YITA 1NJ1A 1PWTA 2QA4T 2EFWA 2QAZA 1ZLMA 2EH3A 3LQQA 1P92A 4ZTUB 3SEZA 4B09A 1Z67A 2ACJA 1VQ8A 1VQNT 2JN0A 2FMYA 1SHGA 4FE7A 1LJOA 2VC0A 2OUMA 2WTEA 4ZDOA 7AT1B 3JW4A 2BVMA 1WNLA 3BG3A 1B72B 2OV7A 4G12A 1YNZA 2MI6A 2DMQA 2XSDC 2WV0A 2GTJA 4BE2A 3JSCA 4JZ4A 3OMCA 2CUZA 1DDNA 1N8RU 4AMCA 3G4SQ 5CVVA 1C6VX 2PN6A 4M7AG 3VODA 2YXYA 3TO6A 1F9NA 3HBLA 3HRTA 1ZK8A 2M4GA 5J8FA 2OTJI 2LG4A 4EGZA 1JTYA 3DPTA 5LGTA 2P6TA 1W66A 4YP0A 1Y71A 3K4CA 2M3AA 4E7IA 3HHHA 4BNCA 4MFEA 4U7BA 1UEBA 4KA4A 4ME7A 2XVCA 5L23A 1YYVA 2FBKA 3OOUA 4ZDLA 4Y4RA 4F14A 1U5SA 4C8QD 4ABZA 3FDRA 2KQRA 1QCNA 2FRYA 1BBYA 1OU9A 3U2RA 3ERRA 1Y07A 1N78A 5IHNA 4C5EA 2PG4A 2RJEA 1N75A 3VDXA 1LNXA 3C2HA 3GZNB 3GIBA 2LT4A 3BFMA 2PVOB 1E24A 1VQMA 4A0ZA 4TVRA 3OYHA 1HC8A 5E20A 4C5IA 4OMPA 1LQ1A 3I55A 3MPUB 3ONQA 5B1AH 2XDBA 3ZCOA 3WTXC 4J9HA 1JJ8C 1FBSA 2E3IA 4XU3A 2DA9A 3HXXA 4ZZDA 4C8QB 2ZKZA 3TSWA 3NEMA 3G4SI 3AG1H 4N0BA 2ICWG 2DYBA 2W84A 1W7PB 2W1OA 2YRDA 2ZNYA 4YIRX 1ZSGA 3FKIJ 4TQDA 1TC3C 2UZKA 3NTIA 3M4QA 2A5YB 2C6YA 2CP5A 2BZ8A 3REAB 2DU5A 3N4MA 3OSVA 5GAOm 3EFRA 4LDVA 2VJIA 3VPRA 2ZPEB 4ENMA 2A68F 4A4GA 3CUQB 3E6DA 4I7HA 5KNNA 1Z3YA 4OB2B 1IXSB 1RKWA 5F0HA 5GAMd 2HSPA 1TUCA 3HPWA 2Z3YA 2C0TA 3VQWA 3L42A 2Y69H 3O8GA 3CCEA 5GMKm 1MBKA 3A01A 1BCMA 3R61A 3IC7A 2Q7HA 2F5FA 3WE2A 5H6RA 2ECZA 3CMAQ 4LFUA 2QUFA 4F17A 2ZMEB 3PIPF 4M75A 1SD6A 1HW2A 3DB4A 4G7HF 1R1VA 2V9VA 3BROA 2DQLA 4A3IJ 2HS5A 3QAHA 1W1FA 3EFOB 4F3QA 5GAMj 1G5VA 3VFZA 3JRGA 3EGDB 4QTRA 2GXAA 2ZNZA 1SSFA 1IL2A 2FOWA 2Q7EA 2EZHA 3F3XA 1RACB 3T1BA 3CF2A 2LMDA 1OJLA 3P8DA 2VXZA 4LK1F 1O4XA 3GTJJ 4I09A 1WXBA 2EV5A 5KE2A 4OMFB 4OMQA 5CKTA 5HNFA 1ZREA 1V55H 3FZVA 1O3TA 4A0YA 4HA8A 1R23A 3CDIA 4XL9A 1VQ5T 5CKEA 4RB3C 2QQSA 2LY1A 2HZYA 2FF4A 2DXUA 1RIOH 2IVWA 1UTIA 1ZHIA 3UR3C 3J80E 2V79A 5J1UA 3G7ZA 2XPUA 1LFPA 3CC4T 3OYKA 4OB1B 3KFWX 4IURA 2OCEA 3F23A 1W36D 3IAS2 5D4RA 5GANe 4EVIA 4P75A 1YITQ 3QPTA 2RM4A 1H9TA 1K9MR 2E1OA 3S2DJ 2EJ9A 4EV0A 1IJWC 2PQWA 4LNPA 3CMAI 1VQ8Q 1Q81C 3Q0WA 3VS3A 2MWPA 3VS7A 2MSYA 2YSRA 1ABOA 3JCMV 1DJ7B 1GBQA 5KAFC 2DLLA 2EYXA 1EV7A 3ZQLA 3UKGA 3MAJA 5GTHC 2FB7A 1U0JA 1YX5A 1JUSA 2MW8A 4NHJA 2QBYB 1HDDC 3SYTA 1SVOA 3MWMA 1E0EA 4KFCA 4MO7A 5FWBA 5GP9A 2VT3A 1T3SA 3IKVA 1DU0A 2PUOB 2L3QA 2ROTA 2E2HJ 1ZLJA 4LDYA 4DEYA 5BMZA 1DP7P 1QVGP 4IHVA 2HNHA 4J19A 4D9JA 4A3JJ 1JQQA 1VQPA 1IAWA 4FT4A 2RI3A 2XAUA 3L4GA 4KICA 1U3EM 2V8KA 4H2UA 1OCTC 3C7JA 4HT8A 4C8QC 3FB9A 3DTIA 2HTJA 2LKXA 2EFNA 1Z3XA 4KRTA 3CDHA 4BHCA 2F48A 1KD1C 5KYWB 4XM3A 1YITI 3P8BB 2CJAA 2QSFX 4YELA 1NEGA 4CH7A 5M5YJ 8ATCB 2LH9A 3FMSA 3NGPA 3CUQC 4DZPA 3COAC 1T3LA 1VQ8I 1XD7A 3FK7A 4IX7A 3FXKA 3FC3A 1VQMQ 3HRKA 2KP6A 2BY3A 1PHTA 4G6DA 3AAFA 5GAOp 4HCKA 2FEIA 3FJ5A 1MIJA 2CW0F 2LC2A 3RPUD 4BQAA 2MD5A 2LCSA 2KIQA 1UDLA 4MDWA 3NAUA 1IUFA 3CCST 2JQ7A 1YFHA 2ZT5A 2ZMEC 3QYHB 5D6FA 5JFRA 2DETA 1HOMA 3OMGA 4IEJA 1OR7C 3RACA 2NRAC 2O8KA 2L7ZA 5LJ5e 5KCHA 5DS9A 1MJAA 1RR8C 1B34A 1RI7A 3ISPA 2XDDA 3EH1A 2DERA 3WTSC 2R7ZJ 2LTPA 4LDUA 2VYTA 4TQFA 1G2BA 4A3BJ 2A3LA 3IUOA 2NLUA 2RHIA 1AD5A 2ZGWA 1K76A 2QYZA 4RAZA 1J5YA 3LX7A 1RPWA 3FIFA 3PIOF 2O9SA 1X75C 1YX3A 5F1RA 3OL3A 2RJCA 1DGRM 1Y0UA 4JUVA 3KP3A 1GFCA 5EEAA 1GCQA 2W10A 4IIOA 3I53A 2EAYA 2KRHA 2NXNB 3REUA 4XBFA 4NDLA 5LHGA 2STTA 2JK3A 1VQMI 2RHSB 3UDCA 3HKSA 3L09A 1BBWA 3X26B 5FKLA 3DU6A 3FIWA 4AFSC 2DT5A 5KHDA 4S0HB 5KNLA 2O0YA 4NBQA 2XKPA 3F8FA 3KP6A 3LLRA 2GAUA 4DBQA 4BU2A 2G6FX 4LLLA 4JK1X 2ZPFB 4P9FA 4YRNA 4RUGA 4M7AF 2ENMA 4KR3A 2CYYA 3KFVA 1WA7A 2ZJQF 4KIGA 3QO7A 3R60A 5BPDA 1J09A 4RA2A 5EG0A 3Q9VA 3RYPA 3P7NA 3JSOA 2VONA 2OBPA 1W36C 2CG4A 3R4KA 3LA7A 2A3SA 2OTJT 3JB9H 2P0WA 2LDUA 2X3XD 5KK1A 3KLNA 1D1BA 2VKNA 3M4GA 2OC6A 2HOSA 1K8AC 2WACA 2RHZA 1NK3P 5EGOA 4KMFA 4HYEA 3LFKA 2L9SA 2FEZA 2F4IA 2NUPB 1GDTA 4L0YB 2P5KA 2JTMA 3JAMK 2E10A 4M75E 2CP0A 1TWFJ 3QPLA 2VOOA 4FSXA 1VTNC 3JCMb 2AXTC 5KYXB 1O3RA 3H5NA 1NE8A 1R77A 1FYLA 1REPC 2PMUA 4G94A 2XG8D 2XF6A 3TO7A 2QQBA 1VQPQ 1I3AA 3QQAA 2DFIA 5AONA 1WI3A 2RHQA 2IIMA 4TWAA 4II3A 1MH3A 3QDRB 1QVGA 4KT6A 1EQRA 1U9NA 2K9SA 1OPLA 1IZ1A 3B6CA 4HVUA 3ZMTA 2AKWA 4MQVA 2ROLA 2DTHA 2OX7A 4CC7A 2K3YA 1P4WA 1LDDA 4CS2A 4H2VA 3LA2A 1J75A 5FLXK 4RGRA 2YLCA 1X1DA 3ABMH 2W57A 1OZ2A 2WSEE 4ZYAA 4BQOA 2DFEA 1VIFA 1X01A 3RTRA 3M4YA 5J4YA 2JW4A 5KYNA 4OMNA 1SF9A 4TVAB 1M3CA 1K79A 4XNFA 2FZCB 4CC2A 2UXXA 2RGVA 1XQHA 3JAMZ 1TS9A 2K9MA 4HF0A 3EGXA 4EGYA 2D2WA 2LKPA 1OU8A 1UGVA 2DCEA 4FW2A 4QVCA 3DKXA 5HDKA 2CZ0B 2QENA 2R5MA 3A0BC 4IO9F 4CH4A 1I27A 2JRTA 4FYYB 1YLFA 1D3YA 4CYCA 2F2VA 3A1PA 4HVCA 1HSJA 5FRNA 3VRZA 1B6AA 1K7AA 2NS0A 1RLQC 1Z9ZA 2YSQA 2H3EB 1VQPI 3OYNA 4J01A 2YX7A 1L3LA 3CCJA 4WI1A 3F8BA 3QTCA 2KZVA 1EZZB 4HAMA 2A61A 4BXUA 1LE8A 3UFGA 1GFDA 2D0NA 1MBJA 4X1EA 1QVFP 4BUPA 1B3QA 3SEQA 4F91B 1YIJT 4C2TA 1YGBA 2HZDA 3VQYA 5BS6A 3P8VA 4MQ9F 4VUBA 1NPRA 3SWNA 4V2SA 5FLXZ 4HW0A 1PKSA 4OF1A 4R55A 2RQVA 3L1AA 3K70C 4YFNF 3HHGA 1LYLA 3B73A 1BC8C 5K5QA 4M77E 2NS6A 4AFQC 4XSZF 1SAXA 1XGOA 1YN8A 1USYC 4CH5A 3FWEA 5ELNA 2GFAA 1Q7YU 1IGUA 3CMAT 3BWGA 5DV5A 1JXSA 1RKTA 4HOBA 1T2KA 5D4SA 1YJNA 5EC7A 2YU3A 3LH5A 2Y9YA 3PO3J 1W5CC 2FOKA 1XPXA 4HXJA 2HZTA 2CWEA 3BG5A 5KAIC 2BXZA 1YS6A 1AA7A 4DGWB 4U0YA 3L7WA 3LSPA 3ZQFA 2NVUB 4I0BA 3HKZN 5K1YA 3M3YJ 4UP9A 3O5ZA 3ABUA 2DU9A 3ZGKA 1UHCA 1M1KR 1B8IA 2M5WA 1MMSA 4KH1B 4CGZA 2ESNA 4E47A 3RZOJ 1KU7A 1AVZC 3A7RA 2XMFA 3KP2A 4G9YA 5FU7B 1QQJA 2EZKA 1ZH5A 5CQGA 3FMRA 2DOEA 2R7QA 3PTAA 3L2UA 1R4NB 4E7LA 2H1LA 2L9NA 1ZRCA 4TVWA 2LQ8A 3I9QA 5IXBA 3QDFA 4RTYA 3DBHB 1AT1B 4P3OA 2PMHA 2VUMJ 1VIEA 2MK5A 1TWHJ 4D7MA 3A01B 1M8MA 1VQ8T 1D8KA 1PVEA 3OW2A 1IN4A 2VC1A 1TUDA 1BOBA 3CCVA 2HPMA 4XU0A 3JRFA 4M75B 2KRFA 4S05A 3JCMP 1XGMA 3AFHA 4L5JA 2H1KA 5ED4A 4ZGDB 4A3CJ 1E3HA 1XCBA 5HK0A 4YRMA 1TQPA 1NJ6A 4KBMB 2BBYA 3A31A 3IALA 2KFDA 2E1HA 2I0NA 1ATIA 1GGMA 2IS4A 4MEYF 2FE3A 4E7ZA 3VYRB 5C51B 3UF4A 3QOEA 1IN6A 3SHFA 1IRZA 2HOEA 2OAUA 2AZSA 4PLLA 2BE9B 4RGUA 4F55A 3PNWC 4XKCA 2ZC2A 2ABLA 3RIRA 3WG9A 3WGIA 1OPKA 4C92G 1R4MB 3E97A 1M2VA 2EQMA 2FQ3A 1H3ZA 4RDXA 4MTEA 1JE8A 1MUZA 2DMPA 3PFSA 4F52A 2EQKA 3L2ZA 5M5XJ 3EDPA 5H20A 2ZXWH 1OV3A 1LEAA 3GTQJ 3Q5FA 1PDNC 1HKSA 3GEZA 3QODA 5CVJA 1YW7A 3BR1A 5CJ9A 3LL7A 3MHXA 3VS5A 1VQMT 3MEXA 3LC0A 4IQ4A 3R07A 2V1XA 4ZYGA 2VV5A 3QNEA 5A2QE 2QLZA 4JJCA 2OI3A 3HIFA 1YTYA 4E2FB 2CV1A 1K6OA 1P4XA 4KNYA 3PSFA 4GLKA 4QT7A 1OCCH 1EH7A 2R57A 2QSGX 2RQPA 3VKIA 2JPBA 3DKMA 4M9SA 1CGPA 2DU7A 3UH0A 2ZZDA 3HB9A 4GBQA 4M77D 3SDZA 4OAYA 1QU3A 4IRGA 2ZPBB 2CV0A 4AU7A 1Y1VJ 1SFXA 5JHUA 5TRDA 1Q1HA 4YEJA 3CMMA 1S1NA 3EG1A 1X2KA 1S72A 1WGSA 1Z1DA 5J4VA 2GNCA 4CUGA 1QVFA 2E71A 2X9HA 2ETHA 1M90R 2W0ZA 3L4GB 4LD6A 1VQKA 4M78A 4QQ6A 1UGQB 1YJWT 1OLTA 2DOAA 1X6GA 2JZYA 3A7AA 3Q1JA 2DFUA 4RG2A 4V2GA 5HKCA 3OYEA 3H3VK 3KYCB 3LYIA 5FU7C 4G6TB 1YJNQ 4EQQA 4M77B 4B43A 4M6YA 1EH8A 3DSQA 2R7RA 4XKVA 3I4MJ 4K88A 2DILA 2E65A 2XAQA 4A5NA 1VQ9A 2J3MA 2IVMA 3A8GB 2NWMA 3GWZA 1FOXA 2LJ3A 1ZKGA 3F8NA 3IH4A 1WWXA 4AVPA 4M75C 3EETA 3NARA 3C95A 2KRMA 3VS0A 1GRIA 4YIFA 1UJ0A 3MO8A 2WADA 1EH6A 3QOPA 2AS5F 4JX4A 1R58A 1YW8A 2VXFA 2EFPA 1B34B 1VQLT 3GUDA 4ATOA 1A5JA 2DFHA 1M1FA 2VBZA 2PBIA 1FJLA 2NNNA 2R0QC 4IVNA 1SSHA 4KUMA 2EPFA 3X25B 3CP2A 1AWCA 4PNOA 5J39A 1Z9CA 4UC4A 1QKXA 1WXUA 2LP5A 1X55A 3HKZA 2AO9A 4BY7J 5DEQA 1W0TA 2YLBA 3K7AJ 2OF7A 1YJNI 3VS1A 2IS6A 5IAYA 4M71A 1J0RA 4AC0A 2UV1A 1EF4A 4A53A 4B48A 1Q86R 4EM0B 2DO3A 4HWTA 1MHNA 5J6XA 3G6EA 2L02A 3L00A 2D45A 1PRMC 5FW9A 3CC2A 4PHCA 4M6VA 4LIVA 1PRLC 4BE1A 1WH7A 4BHPA 3TW6A 4P75C 5E1ZB 2ARTA 2V4JC 1ZA1B 4XKWA 2A37A 2E6NA 4JRKA 4RMFA 4L59A 2VXEA 3F21A 3RDIA 5ICCA 5EEGA 1LEBA 3S1QJ 2XGTA 3CD6Q 1PYVA 4ZZLA 2IJLA 1VQPT 2IW5A 1Y8QB 1E22A 5B3SH 1J3TA 3N05A 4M3FA 1Q82U 3JTHA 2CJ9A 2GIVA 4D0PA 1WI9A 4I98B 2N8GA 4M77F 2M02A 1YWOA 3A4CA 2ZZFA 2ZT7A 4ZN1A 4A4HA 1X6OA 5EG0B 1VQ4A 2XASA 3A8LB 2ODRC 5DTDA 3U1KA 3GPLA 1PD0A 4BQQA 5H6QA 1KGSA 5ELOA 4ZIBA 2OQRA 3ZMDA 4WTOB 4M7DE 5HS8A 4P55A 2A36A 1M1GA 3TKYA 4XAXB 1MD0A 1K73R 5EGOB 2JA6J 3BT9A 2CT3A 1KU2A 1ONVA 4V19K 2COBA 2KISA 2E5AA 5FGMA 1ZLKA 4CRIA 4ZTZB 3ZQGA 2GA1A 2Z2SB 3RKQA 3I56A 4D7NA 1Z7MA 2CQQA 3H3UA 3P9IA 11ASA 4EO4A 4XR6A 2DK8A 4E70A 5IHKA 2JVHA 4N4IA 4YFXF 2YU9J 4M77C 5GAN7 2AMCA 5CPRB 3PVQA 4QKUA 4LNSA 4MGRA 2RHUA 3CD6I 4LIUA 3V8JA 1S72Q 1WHLA 5CKHA 3P9CA 5AYFA 2YS9A 3W3SA 5FO5A 2RAEA 2EL9A 3A1YA 3L2CA 2OTLA 1BR2A 1Y39A 3QUIA 2LR8A 2EVRA 3IV5A 3G1MA 2CH4W 2DYSH 5TJJA 1FPQA 2P7CB 3ZQHA 1H89C 2RHQB 3DB3A 4ZYHA 2CZ1B 1PG5B 2L7KA 4RAYA 1BR4A 1BBZA 2FJ1A 4PGGA 4WK8F 1X1AA 1F1BB 1RIQA 1QPMA 2KIFA 4CCOA 2AKWB 1WJDA 4JRPA 5ECAA 5LGUA 2KT1A 1QHHD 4LG0A 3E9FA 2E36A 4MNUA 2RI2A 2Y48A 4CCNA 5K5RA 3MP1A 4FCYA 2QASA 1VQ9Q 3FHNA 4QQDA 5LLQA 1WCMJ 1OULA 2IY5A 2B9SA 1Q1VA 4OOIA 2WB1N 5K7ZA 1VQ6A 3DP7A 3M9QA 4FT8A 1JUPA 4YREA 2D8HA 3EGXB 1BR1A 4B1RA 3ROUA 3RQIA 2LREA 1GCQC 1KQ1A 1XSDA 5GAN3 2QQ8A 3CF5F 1TW3A 2P5LC 1ZBXA 1OKRA 4BDYA 3ZBDA 2EGEA 2VVKA 4P71C 1S72I 4CYCB 2LMJA 3JCUC 2JWTA 5GAMe 1FYFA 2XAFA 4XRSA 3CLOA 3KCCA 1FBUA 3C2BA 3BZKA 3M4PA 1E1TA 3M1EA 4WF2A 1P7JA 3CC7A 4XOPA 1LE8B 2LVSA 1UHMA 2Z1DA 3NWTA 2QTXA 1WZ2A 1I1SA 2VJ4A 4RCBA 2R7FA 1RRJA 4UVCA 3G1ZA 3HOTA 1Z91A 2WC2A 4D5FA 2ZPGB 1G5IA 3TBIA 4XTVA 1YHQA 3G6EQ 3SWNB 5F1JA 3S3NA 1YBYA 3MF1A 1YFSA 5EDNA 1PJRA 3CPWS 4Z8AA 4Q47A 3CC2Q 1ZUKA 2IPOB 1E2XA 4ZYEA 2VQLA 5FKMA 1VQ9I 1TWAJ 1JT6A 2ZB9A 1GHCA 5DLQE 1ZYRF 3A5ZA 4BW9A 3JCMQ 3CDLA 2LY2A 2ZT8A 4X9DA 4EX5A 3J81E 4RMNA 3OIQA 1FTTA 3FXRA 5IT9Z 3HSEA 4OGCA 1OQKA 3BTCA 3GBQA 3VOEA 2XTIA 4FYXB 3AT1B 3U9GA 2KRCA 2HKOA 3PIPA 5F04A 5C4JJ 1IG7A 3L2QA 4M7DD 5CKBA 3BCAA 1FXXA 2ZBKA 2DPDA 1FIAA 4JBAA 1WHUA 3MEWA 1MJBA 2RQTA 3CMYA 1VQ4Q 3HUGA 2CJBA 1X3UA 2CP3A 3GOXA 1E17A 5IP7J 1BA5A 1N9WA 3RJPA 3HHTB 1EA3A 3S1NJ 4MZMA 4Y91A 2XGDA 4YG2F 4C30A 2IGNA 1GVJA 5F08A 3VYSB 1KC8C 3M56A 2HQRA 1CF7A 2IG0A 3G6EI 4GFBA 3RESA 2I4NA 5FFZA 3CC2I 5K5OA 3VUBA 3I56Q 1I5ZA 1BCOA 2JA2A 4JDSA 2DKGA 4E7KA 3RUXA 4KUDK 5LBQA 4KR2A 3M9AA 2QHSA 2ZNIA 2PJRA 4Z89A 1SFOJ 4JS5A 5FFXA 1USTA 3QKJA 4J9GA 2VL8A 3M0PA 2XPWA 1HLVA 4Y3OA 2CUBA 2F6CA 2OTLQ 1W5TA 4C5GA 1BW6A 3F70A 3TO9A 2DLPA 2DA2A 1X6BA 1H0MA 2KIUA 1X19A 2BTTA 1QVUA 1G3SA 4HQEA 2Y0SA 1VQ4I 2XSJC 4RBOA 2LNBA 2CQ7A 2D5VA 2DOFA 4GGGA 4A3MJ 2DVEA 2FPEA 1T98A 3SB2A 4XLPF 4KQEA 1WPKA 1LPLA 1NJIR 1S7AA 1Q81U 4ESJA 2K4JA 2VPRA 2EFQA 4HLYA 1UAAA 4JLGA 1GBRA 2CQKA 1M2VB 1HBXG 4H4KC 1VQ6Q 1QZZA 1QCOA 2G3RA 1X2NA 3CJRB 1FP2A 3JB9I 2FYKA 1YI2A 1PUEE 3EQLF 5HODA 2KJCA 3IH2A 4MHGA 4M72A 1X3WB 3JR9A 1GCPA 3SWNC 2XC7A 4J5YA 3HSBA 2QK0A 3KEOA 4ZNXA 1ETYA 3HOWJ 2EV0A 1IZ6A 2ZXIA 4A4EA 2I5UA 1PM3A 5L3CA 2OTLI 3BW1A 5ICFA 4CH3A 1UG0A 4Y15A 1UGPB 3ZP5A 1ON1A 4HPQA 5CVRA 1I39A 4Z02A 3CC7Q 3JRHA 4MEXF 1O75A 4NB5A 5LJ3j 3EG2A 3H6ZA 2K3BA 2BEOA 4IL6C 2JVGA 4M7DF 1KD1U 4KT5C 4YPFA 4IHWA 4A54A 1G2HA 2YUSA 2WB1A 1VQ7A 4L9JA 4FIBA 2EJFA 3E9HA 1YRNA 2KL4A 2SEMA 3M07A 4RM2A 2HEQA 1YHQQ 2XICA 2E7WA 5L3FA 1N9SA 4XTWA 1YQAA 5LEKA 3CUOA 3VUZA 2DRMA 1P6RA 1ACMB 3AG4H 2X6XA 2HYJA 3D0SA 2PUKB 2L3DA 1CKBA 4AT1B 2L3PA 1TQMA 2M51A 3E9IA 4HWOA 1PC0A 4M78B 1VQ6I 1AZGB 2K9QA 3OYYA 1WH5A 2A05A 3L2VA 1ZR4A 2JTFA 1W2BP 4XLAA 5M3MJ 2A5WA 4UY8I 3PIOA 3FM5A 2JA5J 1UFMA 1SERA 4YRKA 3U21A 4RDUA 2W82A 1O3QA 3M57A 4HT4A 3F8CA 3JREA 2HVSA 3X20B 4O5VA 2MOXA 5ICEA 5D8LB 3JRBA 5CKFA 2F4OB 2J6OA 3CC7I 2ID6A 3LQRA 3FM3A 2LBFA 3ZL7C 1T0HA 4GCVA 3CD6T 2L9RA 2KT0A 5GMKi 1R8OB 2CP2A 4C0DB 2B7EA 3CLQA 1M3BA 2PMFA 4FM4B 5KE3A 2YPRA 5EJCA 1N8RR 2A07F 3DEUA 2E64A 4HG2A 3OQ5A 4BJ5C 3F6VA 4PKCC 1YHQI 4XRFA 4EJUA 2CDTA 3MJXA 2L7MP 4M7AA 5GAN2 1Z7UA 1H9GA 2K6DA 3PJRA 2DEQA 2LX9A 3K1PA 1R1UA 4WX9A 2YRCA 2TRTA 2X51A 3CCRA 3H9GA 2FZKB 1JB0E 2L54A 3VQXA 3ZQIA 3FHZA 1X58A 3CMQA 3S8PA 2KVQG 1L0WA 2P0QA 2JT4A 2EB7A 4P5OA 2LQNA 4J15A 2ZZEA 3FDYA 5HK3A 3HEFA 5IXFA 3WE3A 5JLXA 3A7UA 1NK2P 3AHUA 3C18A 4ESBA 3ML6A 4XQFA 1UHWA 2LJ1A 4BS9A 3UNGC 1UG2A 2LQWA 1WDXA 2A69F 3QO8A 5E3NA 3LSQA 2KROA 3K1NA 1K8AU 4B6MA 4II1A 1K78A 3L1PA 1WYXA 2EIKH 5FB2A 4F16A 3RPUA 4IQJA 1LNWA 2O9LA 3NENA 1NNHA 3SDGA 3C2GA 1BJAA 4A3LJ 1ETOA 4BY6B 3OS0A 4JX6A 3I35A 3CCMA 1G5HA 1RETA 2O8XA 1XJWB 3JB9D 3R0AA 1YI2Q 3QRFF 4CZZA 4PJLA 1F5TA 1I07A 4BAYA 3OS1A 3M58A 3OL4A 5CAIA 2ARSA 2XF5A 4DBHA 2XDVA 3UGTA 4KT0E 1SPKA 4AIDA 3VYUB 1HA8A 4ETSA 4F7UG 2OAWA 2NNYA 3IRRA 3WGHA 2QG9B 4K2EA 2YUPA 3ZR8X 4M78C 4PFPA 5D6EA 4HVVA 2ZR3A 4UVBA 4R1HA 2VPLA 1IDYA 2QEXT 1M2OA 1FP1D 4EJWA 4CICA 2JT1A 2RF0A 4F7UE 3ASKA 3TEHA 2B8AA 5FLMJ 2M8GX 4WWCA 4E7JA 2XHCA 1VQ7Q 4GYIA 3VS2A 5LHIA 1SAUA 2AMCB 5LJ5h 3SJMA 5GMKh 3OWTA 1GV5A 1IN7A 4DYRA 4P74A 4PG3A 4XLEA 2EKHA 4FW1A 5C52B 3A02A 5F0CA 2R4GA 3MMYB 1KOGA 1GXPA 1E7OA 2HR3A 3QPHA 2EQIA 3GX4X 1WJ5A 2JXBA 4C0DC 3T0YA 2Z9OA 4NUBA 1NG2A 5ILSA 3D1NI 4R8HA 2E70A 2FMLA 2RK2A 2EK5A 1YI2I 1SFEA 2OAZA 1H8KA 3CCQA 3MKYB 4UP8A 3P9KA 1QE0A 3S14J 2ZXFA 4IKFA 4RGSA 4H2WA 4XEOA 4ZDPA 2F5VA 1BOAA 3CC2T 3H9QA 2BZXA 2A8EA 4LG0B 2JN6A 1S3JA 2EQJA 1XNIA 3PMIA 1BU1A 5HVQC 5E3MA 1W2BA 1OYYA 1VQOA 4DW6A 1PCXA 1X1BA 4Q4ZF 2EA2A 3PQKA 3DLAA 4OIOF 3CMEQ 2IXSA 3RL6A 4E6RA 2IY5B 5LRRA 2GFUA 4IRIA 1A04A 1LFBA 6PAXA 4Z88A 2DXIA 4AH6A 1BI2A 5GANj 2ZSHB 4GYGA 1IGQA 2BGCA 4RQEA 2QQAA 4M9ZA 3T8RA 4BGDA 1VQ7I 2BZYA 1IXRC 2HXIA 1EFNA 2DQ0A 1GXQA 2H8HA 2L0AA 2Y0MA 2AIRB 4G84A 1MBEA 5DCMA 2LY9A 3MKZA 2M9UA 1ODDA 1YW9A 3TU4K 2V9PA 4H2TA 3QP6A 2FHDA 3I59A 2NOGA 1NEBA 1VQ4T 4R79A 3PQJA 2LTOA 1R5HA 4DBFA 3GP8A 2V1RA 3MZYA 4IUTA 4BI8B 3VB2A 1IHWA 3CCRQ 2Q7GA 4A3DJ 1JO8A 2DTIA 5GAGJ 4YRLA 3FXOA 2KGTA 2MMPA 4LG3A 4FT2A 4N4HA 2Q5IA 2W48A 1TL8A 1FX7A 2L8DA 1KQSP 4HVWA 5FRMA 3BR2A 4QSHA 3CTAA 2DL4A 3M55A 1T33A 1FC3A 2HNIA 5HS7A 4RLFA 2QA4A 2KDZA 2RHXA 4BY6C 2BIVA 3MQ0A 4XLCA 4H2XA 1PSFA 2MPXC 3QYEA 3T9NA 3SDBA 1VQNA 2JTEA 4DYQA 3ECOA 5GAEJ 1K0SA 3TP0A 2WA0A 3CMEI 5E17F 3EUAA 3A5ZB 1KA8A 2ZPIB 2YT6A 4K87A 5A0LA 4Z2YA 1DGWY 3FXLA 2QDYB 1QVFS 3PZCA 1ZBJA 2XD0A 3VYHB 3IWZA 4OAZA 4F93B 3T5XA 5IOZA 2JZ2A 4D5CA 2DT7B 1GVDA 1NJ5A 4TVYA 2OTLT 1HW1A 2J3LA 4C3IJ 1WYDA 4LVMA 4FHTA 4PJOG 4B44A 2QHVA 3LGFA 1MW7A 4NL3A 1X1CA 2DDBA 4H2YA 3WGGA 3GTPJ 1O7FA 5HOOA 3GCMA 2L4MA 4Y52J 2CU7A 3CCMQ 3GFLA 4IUVA 2XRLA 4M3DA 4F7ZA 3HUGB 2COZA 2VGNA 3CCRI 2DA3A 1ZGWA 4GDFA 5KCMA 3E6CC 3EG9A 3AG3H 2AXLA 4N9HA 1GLNA 4M7AE 4RB0A 3LSTA 4YTLA 2M30A 2JUCA 1SEUA 1CF7B 1RAFB 2K9NA 1VQ6T 1OISA 2WWYA 2P5IA 4NOYA 1RLPC 3P5JA 5M5WJ 3VSLA 2E4HA 2AHQA 1FY7A 4F92B 2JA7J 1NYQA 4WXCA 2X3WD 4KISA 1QO0D 4M78G 2PJRB 2BY0A 1HKTA 4UB6C 5KCOA 4L9VA 2LSOA 3M0QA 3DTEA 1M27C 3ZQ7A 4D6WA 1BM9A 1MSFC 1VQZA 1O3SA 3J7YJ 4IZZA 2R7UA 2RDPA 5JI6A 2CUDA 2L3RA 4D8KA 1RC9A 3BPXA 4BY1J 2AKLA 1LVKA 3GF2A 2DTZA 5CVUA 1MH4A 3O2PE 3HTSB 1Y8RB 1JBMA 3CCMI 3O3KA 3DBLB 3Q0UA 1UFFA 4U0VA 2O4XA 1K83J 2X0LA 4JJBA 3EYYA 2GGRA 2JA8J 4HLXA 3CCQQ 1PP8F 4PJMA 2J05A 1YHQT 2ALYA 1UZCA 2BE7D 5GAOr 4OWRB 1K9MC 1UE9A 4LN2A 2Y75A 4OMLA 1A35A 4IOAF 1VQOQ 3VSKA 2E6ZA 2X9DA 4CC3A 4KIFA 2E2JJ 4ESFA 1G3WA 4ASNA 2DBKA 3HOUJ 2DTOA 5A0GA 3PGGA 1BJZA 3VS6A 3FEOA 1VYTA 4XONA 2KY9A 3OS2A 4ENJA 2WV1A 4W1UA 2DO7A 2ZAEA 1I81A 2OD5A 1M30A 3WTUC 4EMHA 3T8TA 1UJYA 3FXJA 2BHZA 1XTAA 3H92A 2XGXA 2RN8A 2D1HA 2DVJA 5E8IA 1MNMC 4C0ZA 2A6HF 1BK2A 1Y7XA 2XV4S 2QQ9A 1B07A 1D8JA 4IHYA 1VQ5A 4R0KA 2WY7Q 4EPCA 3BJOA 2IA0A 2PMEA 3S2WA 4JRIA 1Z21A 2Q0OA 4OB0B 2IPQX 2FUG2 3CCQI 1UUEA 1KIKA 2MF2A 2STWA 2E2IJ 4UVAA 2ISZA 5FD5A 1U1SA 1YRNB 3A32A 2OZ6A 5LGNA 1U06A 4B47A 2DIGA 5GAOq 1IREB 1TBXA 4Y33A 3CCUQ 2HDWA 2XRNA 3X28B 5K7FA 1VQNQ 4U0WA 2MC3A 1VQOI 4WCIA 2K86A 3HTZA 2D8JA 4WJ4A 1MBFA 1KQSA 1J59A 1B4AA 2GOMA 4F7UF 4LVKA 2IP2A 2FSWA 2GBQA 2R5ZA 1TNSA 5FKOA 3JAME 2ZJRF 4HX8A 2AHJB 3TDUC 5I2MA 3CZ6A 4HV5A 2GXBA 2RNGA 5DLOA 4P73A 2RO0A 3FKJA 2P5VA 3H9JA 2JNGA 3ZN1A 4LITA 2VN2A 1G83A 5IN1A 2DAQA 1U6GA 2J5OA 2XGCA 3HRMA 2BYVE 3PFIA 2KEAA 3QZ9B 1J5WA 3CBMA 1R1TA 4M7AD 1HXDA 3PNVA 3K1MA 3SFZA 1CQTA 2HCKA 4EM1A 1CSKA 1WJAA 3MKWB 5IHIA 2GLOA 2EYZA 3KYLA 4NL2A 3VWBA 2ZNJA 2IEKA 3EPZA 1V5FA 2OQGA 4KITB 3NFCA 4DOVA 1EFWA 2DDZA 1KYWA 3MD2A 2LBFB 2HKNA 2VKVA 2WAFA 3KP4A 9ANTA 2FZGB 3BR5A 2MC4A 2ESWA 4N4OB 2GQQA 3HFVA 2M34A 4KGZB 4I2OA 2M7BA 3BE3A 2HQXA 2PU9B 5FLXE 3BJ6A 2CP7A 3TEDA 3LW5E 3GFJA 3CCUI 1VQNI 3TVTA 1FIPA 4M7AB 1MNEA 1XB4A 1UGRB 4Y17A 2HWVA 1OOTA 4DIQA 4M77A 1YI2T 3A0HC 4CCKA 1R7JA 4XU2A 5GAN8 1WJBA 1RUOA 2V1NA 1Y0NA 2QDLA 4XSXF 1L0OC 1DUXC 4C2UA 5F0FA 3CXCS 1AHJB 2CQXA 4BACA 3HTRA 4X6AJ 2L2OA 2DJZA 4I0AA 3I55Q 2MGQA 3WU2C 3I3LA 4KIBA 2VQHA 3EG0A 2DMOA 1D5VA 1YO5C 1RI0A 2ECCA 3WTVC 1TWBA 3NRVA 1PUFA 2QWWA 1K0XA 4QPOA 1SMTA 1JJCA 5GAN5 5I11A 3KYDB 3ASOH 2E5KA 2FA5A 5GMKe 5IYBJ 2JS2A 2DD5A 1MMAA 1RADB 4BEHA 5D5VB 5C6SA 2ZO4A 2KXDA 4X34A 1S6LA 4Y13A 4JYKA 2ZXHA 1ZELA 5LEJA 1MDMA 4K86A 2KQWA 1KMNA 1K78B 1QCFA 4YRSA 4M74A 1KJWA 2G9WA 3RI4A 3CCEQ 3PNYA 1T38A 3LOCA 3RERA 2MCNA 2NUZA 1OMIA 2L01A 3TOAA 2Z33A 2DRKA 4D8DA 3FRNA 1HYOA 3W2VA 2P4WA 1M9SA 2CH0A 3RKWA 3TOBA 2E3CA 2W7NA 3HRSA 3OYJA 3ZEHA 5BNGA 4XRSG 1AWWA 1KQ2A 2L3SA 2KJBA 1I5LA 4P71A 3S16J 1ETXA 1YFRA 3S15J 4JZ3A 3BP8A 1B8AA 4UB8C 3KEYA 4ZTJA 2MBFA 2R7XA 3I55I 4A69C 3ULQB 4NNJA 4A2UA 3SFMA 4QIWN 4MIMA 1BI0A 2ZFWA 3CMET 1SRYA 1VQ5Q 1SEMA 3W2AA 3JCMJ 2HI3A 4L5EA 3JCMW 4PJOF 2VB6A 3VQVA 1ZHFA 2E5ZA 3FMQA 3OYCA 3M0SA 1S7OA 2YRVA 2KBTA 3GMEA 3TEHB 2DK3A 3DU5A 4ELYC 5J40A 4OMMA 4CHUA 3F72A 5EYRA 1QP2A 1LCKA 1FTZA 1JKOC 1ZR2A 4AVZA 5FKNA 3H0GJ 3DPLC 2LOOA 4AIJA 1AOYA 3GYHX 4BB7A 3I7FA 3SD4A 3CCEI 1UMQA 3JCMf 2CYZB 5E79C 4NQWA 3L9FA 4OVAA 1OI1A 3LGLA 2LF8A 3CCRT 2PFBA 4ZN3A 3HFZA 2C8MA 3HXLA 4OMYA 4XLHA 2DA5A 2ELKA 2VASA 3OSFA 1W70A 1DPRA 4RTXA 4WJ3M 2V1QA 3K2ZA 4DOZA 2EFIA 2FG0A 1BI3A 3PUBA 5HDNA 5KH6A 4C0FA 3OW2P 4CI0C 2W00A 2EFOA 4M7AC 4A0XA 3GTMJ 2R7SA 2LCCA 2F69A 2CFOA 4BI4A 4FX0A 2W4SA 3IH3A 2PMZN 2XHKA 1VQ5I 3FJPA 1GL5A 3RPQA 1BL0A 1A6IA 4B3XA 3LMMA 3FX3A 2EGAA 3WTTC 4BHBA 2K57A 1BBUA 1JKQC 5CQXA 2HSEB 2FRHA 5CVIA 3WTYC 3CJNA 2K5IA 5E1WA 2R7TA 3FXUA 2NS8A 2QVOA 1TQIA 3HYIA 1UB9A 1IN5A 3G4ST 2OU2A 1VUBA 3SEMA 4KH0B 4OLFA 3O8HA 5DCMB 3GTOJ 1ABQA 2D1XA 4IHTA 3I59B 2B63J 1BI1A 2O01E 2G7UA 3RMQA 1X69A 2RJFA 3LH0A 4UXNA 1TWCJ 2QHUA 4C8QG 2R7WA 1U8BA 1TSFA 4P9UA 2KAFA 3P8YA 2DPPB 2V26A 5K1PA 4YCWA 1LJ9A 2K4YA 2OJ2A 3OYAA 1RR7A 2X6OA 5AIQA 3TP3A 3A8MB 5IYCJ 4IUPA 2JPCA 3OYDA 3QHSA 1ZX6A 4XK4A 2DL5A 2XDPA 4H2XB 1FEXA 5HY6A 2HOTA 3HSFA 5L3DA 1XC5A 1I4K1 2NYSA 3OMYA 5J3LA 3A8HB 2DA4A 2K3FA 2M0CA 5CKDA 3M1CA 2K79A 1M1KC 1YJ9A 4XTXA 2GQIA 1B9NA 1KC8U 4A6DA 1AEYA 3K4LA 2JMAA 3JCMX 1YIJA 4A3FJ 4Q5SF 3JRIA 4CYDA 2DW4A 1G8XA 2BOLA 2C0OA 5GAN4 1TW2A 4RM3A 4XTZA 5CO7A 1R22A 4DJAA 5F27A 5D5XB 1VFCA 1U1TA 1RL2A 1KG1A 4MMLA 1ETKA 2HBPA 3CCQT 4L87A 2ED0A 3JCMg 5KYUA 2CKKA 1SVLA 2QZ8A 3ZRGA 2RN7A 3MZHA 1C0WA 1TT5B 4P74C 3EG9B 4YDQA 1HC7A 3E2UA 3QXEB 4HZFA 2YWWA 3CMAA 3GO5A 3REBB 2W85A 4UHTA 3KPHA 3LFUA 4UUTA 2K9GA 1ASYA 3BQYA 1X54A 2FBHA 2X1DA 4J9IA 2ECBA 2RREA 2RKHA 3URGA 3VU3C 3E0JB 5D5UB 2K2VA 4M4ZA 1HTTA 3BG7A 3FBNB 2K7LA 4RTTA 1ZRDA 1IXCA 4JS4A 3M8JA 9ATCB 3RMSA 2MAMA 2LNVA 4RAGA 1OYXA 1KSWA 5D7UA 1B70A 4IUQA 1NG6A 1V1CA 3E3VA 5AIPA 3JCMc 2HDCA 1OQYA 2O5RA 3IQLA 4MLOA 3K6GA 3R6NA 5GAMh 2I4MA 1PKTA 4KJZA 3A2KA 1FSHA 1ZTRA 1N6AA 1A0NB 1WQ2A 1Q82R 3S1MJ 1VZ0A 2DPUA 1LUJB 3CP8A 3REXA 4A3GJ 3FXMA 2M1HA 2F5KA 1WHHA 4Q48A 1AZEA 2O4XB 1KMMA 3BQZA 3BJAA 2V8JA 5KYYA 4HDVA 1E6GA 2H09A 4M7DA 2ALYB 3CCUT 3THKA 4J9EA 2DD4A 4MFDA 4KYWA 2JVVA 5DY9A 2NUTA 1WHMA 1YITT 4IOCF 1X56A 3RR6A 3CPWP 1SD5A 3OSSC 1IXDA 2BVLA 3HXYA 1T0JA 1UECA 4N4GA 2PQ8A 3HOYJ 1WIEA 2FNAA 2JS0A 2LK2A 1OYIA 3R0JA 1IN8A 5DUIA 4CS4A 1Z7LA 1OZ3A 4A6EA 1WU7A 4EMGA 2CSOA 5EF6A 2K27A 2KRSA 2JTVA 2WAQN 5HDGA 2DJQA 3KE2A 2FD5A 3M59A 3F6OA 4C3JJ 5F5WA 4P1WA 1QGPA 2V1DA 4YRCA 4JX5A 1FNNA 2XIGA 1FT9A 3CO7C 3DLLF 2GOXB 1RESA 5BPIA 2ZTGA 2OJED 4HWRA 3OYFA 1W7PD 1M90C 4HF2A 3K4MA 1U5TA 4BQNA 3CJTB 2DM1A 3DKYA 3HRUA 2PMZA 2MABA 1SMYF 4AG1C 4PJ0C 4EJOA 1IC8A 1NH3A 2C7IA 1KZHA 2VQGA 3ERED 2KLOA 3OB9A 2ZIMA 3LWHA 3TW7A 2EA4A 1FBQA 3TQNA 3MVPA 4C92E 2F1LA 3G2BA 1UB4A 3VBBA 1I5OB 1T8IA 2ID3A 1EIFA 2P84A 2R5ZB 5GPAA 2XAJA 4DEXA 2EBPA 4LLGF 4M3GA 4EATA 3DBRB 1X43A 3HL2A 4UUVA 3I55T 5C53B 4PLIA 3DKWA 4LJZF 1XX5A 2EIJH 3CCJQ 1OCOH 1YJ9Q 2VKHA 2XB0X 2DL3A 2M0MA 1UJ8A 3KEQA 1QZYA 3ZQCA 1Y57A 1YIJQ 3K9TA 3BR6A 1AOJA 1I50J 1WJSA 4RQFA 2LD5A 3K2AA 1EOVA 4J9BA 2HQNA 3A98A 2D6FA 3I9V2 3IKLA 5GAOn 4U7DA 2HMAA 3TL4X 3GW2A 1WSUA 1JHHA 1B7YA 4HX7A 4D1QA 1SESA 5FD6A 3DF8A 1YJWA 1W2BS 2I4OA 1F36A 2QCOA 3PMTA 3KX2A 2ZZGA 3KP5A 4H0EA 4PDKA 2X4XA 3WXMB 1FMWA 1LDKB 3LA3A 4Q15A 5LJ3f 3OD1A 3CCET 3LWIA 2XPVA 3C0CA 3NMZC 3IKTA 3N5BB 4NCXA 4O2DA 4HNUA 2IA2A 3HG9A 2DBMA 1Q86C 4JRQA 3ZPLA 5LHHA 1GV2A 2RNAA 3M0TA 3M54A 4PCQA 5H2FC 3ASNH 4AUXA 4L0ZB 3HXUA 2D9TA 3TSZA 3M0UA 1WRJA 3H5RA 5IT9E 4C5HA 4Q5WA 5CIUA 1K6YA 3I5UA 1RZ4A 2XAGA 2F5CA 3PL8A 4BH9A 2COMA 3CCJI 1YJ9I 4XK8E 1V29B 8AT1B 4UPAA 1JGSA 1YIJI 4AFZC 1TT0A 3C94A 3BG9A 1JJ2S 5L3EA 3MCAB 1ZUUA 4DBRA 1SFUA 4LVJA 3BY6A 1VQLA 1PUFB 2DXCA 1R00A 4YRFA 3LSKA 2ZR2A 1ENHA 4ITVA 1JJCB 2X1CA 3A5YA 1K4TA 1ZQ1A 4EJVA 2HQAA 3IP4B 1E1OA 1W4SA 5GJVB 4FQGA 4BEHB 4HT9A 3CO6C 5IH2A 2YX4A 2P81A 1ZG3A 5TGTA 3H35A 3H9NA 1RUNA 4C8QF 2EYQA 1MDMB 1U78A 1EX4A 3BDDA 1HDPA 3RZDJ 4EMSA 3LWFA 4B4CA 3HPHA 3R6OA 1K73C 1NJ2A 2EJRA 2WSCE 1WXTA 4XN0A 3S3MA 3QJYA 3JCMd 2R7DA 1QWEA 2F5EA 1M3AA 4E7SA 2Y31A 3DPUA 2J6KA 3CCVQ 2HDDA 4AWXB 2GBYA 4J9DA 5B66C 1O7LA 4PK4A 1BKBA 3CPWA 2BZTA 4JJNK 1IGNA 3ER0A 4P3PA 3AL0B 1P4AA 1V4RA 2M4KA 1K4US 1S8NA 1NM7A 5KVRA 3I58A 2EGCA 1S9HA 3LAJA 1BN5A 3I54A 2LFBA 3E5XA 4BWAA 3TREA 4CCMA 2F5TX 4P96A 3W2WA 2RQWA 4L9TA 4HBLA 1U9OA 4JQFA 3GFMA 3PM1A 1UHSA 5FWCA 5HLGA 4P73C 4JOMA 2DL7A 1RAIB 1V76A 3OOPA 4NC6A 1E3OC 4C92D 3ZMVA 1NPPA 1QRYA 3KIOA 4LB5A 1OFCX 3P8TA 2COWA 2QGFB 2LYCA 3HM5A 2FX0A 4PJNA 3RQ4A 2X85A 4ELZC 2XK0A 1Y1WJ 1U8RA 1P2FA 1Z6TA 3SFIA 1QP3A 5HLHA 1Y0MA 2WAQA 2CGPA 4NQWB 1Q81R 5LJ3g 2DAOA 2ZCWA 3HFZB 1MBHA 4LLNA 2HFHA 1MSEC 1YE9A 2YUQA 5DD8A 2FPDA 2KK4A 3CCVI 2DBBA 2RPNA 3K69A 2V1UA 2DXBA 1KQ0A 4CDGA 1XDUA 4ZGJB 3OV8A 2RK1A 1KQ9A 4XLFA 3EUHA 1G59A 1WPYA 1UELB 1ZSZA 4C92B 3HZJA 3LAPA 2KPMA 1SANA 3OYBA 2DX1A 2TDXA 2B0LA 3N97A 3RSNA 2XKOC 1G4DA 1T95A 5FKKA 2CZ6B 3C3WA 2QHTA 2VJJA 2QTVA 1QMCA 1H4VB 2CW7A 3H36A 3E5UA 4BL0B 4ON0A 2X4YA 2BY1A 2M8EA 1KU3A 2MWOA 2O31A 3ERMA 4UNOA 1ETWA 4GY5A 4YROA 2F5DA 3UT1A 1XMAA 5A0DA 2M9HA 1TTHB 1YJWQ 4P72A 1R49A 3K4KA 1IRFA 1XDSA 2CFXA 4A4KA 4AD9A 1T56A 1WJFA 2QF7A 1U3OA 4J6YA 4UV9A 3F9KA 3H3ZA 1VQKQ 1NTCA 1MV3A 1YS7A 3ZN0A 3V7RA 1KD1R 1BW5A 1IW7F 3J7ZI 5E18F 3V7SA 2FNPA 4RB1A 3ELKA 5HLTA 1B76A 3K70D 1DQUA 2MYSA 2UUZA 2R3SA 3O8VA 2KNBB 2HAXA 3VJPA 1UCRA 1D09B 3S6WA 1QVPA 2EZIA 3GNGA 1XTDA 1GT0C 1WFXA 3R6SA 3JRCA 1KQ8A 3I64A 4J7FA 4BJTA 3SZGA 4N9IA 2V7FA 4TV7A 1X2QA 1RUWA 2EIMH 3BPVA 1HK9A 3MP6A 5CK9A 4PJJA 1FZPB 1RAHB 5LD2C 5L8RE 3CBPA 2HXOA 2GQVA 1VQLQ 3X2QH 4JP0A 3BLYA 5J1YA 3UATA 4HV6A 3LSJA 4QPQA 3UA6A 3AL0C 4KUIA 3JRAA 3S17J 3AG2H 4IF4A 1YJWI 3ECHA 3E19A 1ARKA 2X4WA 3KXTA 4HNVA 1KQSS 3ABTA 2E5QA 3J80K 2DA1A 1ETVA 4I99C 5L3BA 4M75G 3QZ5B 2EQUA 1VQKI 1VOMA 2BW3A 2GCXA 1AWJA 4P3NA 5B1BH 5GANf 2HKQB 1ASZA 3WHBA 4A63B 4C92F 3NEUA 2LCLA 4XLNF 1BB9A 2FU4A 2DJNA 1WKMA 4EMKA 2DNUA 1PP7U 4J00A 4YRRA 3G1JA 1WLPB 2CREA 2K4BA 1VI0A 4CCLA 5C4XJ 2E19A 5KYUB 1FMKA 1EIYA 5CLSA 2MD0A 2I8DA 2VI6A 3UGQA 2M1BA 2V6EA 1ADYA 2B86A 2EKOA 1B9MA 1NLPC 3DTKA 1W0UA 4M73A 1VQLI 3B02A 4ZYDA 3KZYA 2PZ1A 4HKEA 1AHDP 3GTLJ 4C92C 1MMNA 3NHNA 5EEHA 1YG2A 3F22A 4LVIA 4O6JA 2CSQA 5I22A 3ZOBA 3SZTA 1HCRA 1WI7A 1LDJA 2RQQA 4BI3A 1V3FA 3J80Z 3G73A 1B70B 5BQTA 3M53A 5HCKA 3HY0A 2KE9A 1K9MU 2FXAA 2IGKA 2VE8A 1WHKA 4OB3B 2ZJ2A 5IT3A 3CPFA 1K8AR 3VV0A 1NJIC 5E3IA 3F0CA 1GXIE 3VYTB 4LD9K 3K10A 5J3BA 2DXTA 2E41A 4OIQF 4MZTA 1JJ6C 4ANJA 3UPUA 3WQZA 3I5SA 4NC8A 2KHMA 1YFTA 3I4NJ 2X4JA 4BXXJ 3OBYA 2MH2A 4LUDA 5K1XA 4UP7A 2E12A 5C0MA 3GTGJ 5KYYB 3NQOA 3BC8A 4IJAA 1YIOA 12ASA 3QWLA 1OX9A 4M7DB 2X48A 2FL7A 2LKSA 1SRMA 2NUTB 3MFKA 5ERIA 4OINF 1TH7A 5HNHA 2J7IA 5HS9A 1FYKA 2LLKA 5DM7F 3PVLA 3DQVC 2QGGA 2RH2A 2E1MB 2O3FA 2NVTJ 5LJ5f 1RI9A 2R92J 2JM8A 1ZQ3P 4RGXA 4RLQA 4XIDA 5GAN6 1CKAA 4F7UA 1SD7A 5J26A 3H0IA 2RMOA 1VF9A 2H8RA 1H92A 4A12A 3CCJT 3W6VA 1QWFA 1YJ9T 1QPIA 2EINH 3B6AA 2R7VA 2VKEA 1F4KA 2RB6A 2CO5A 3IRQA 2CW8A 4I6ZA 4N0AA 4J9CA 2KYBA 4M77G 3WTZA 1SFKA 2P8TA 2K7AA 4RS8A 4O3MA 1VYVA 1XMXA 2DF6A 3AKZA 3OBWA 5DDGA 1H641 5I21A 2HVRA 3WG7H 2ELJA 2RNJA 3KZZA 2OA4A 1W4MA 2HEOA 4QVZA 2BHYA 3HY1A 3EAEA 1M5Q1 2DZ9A 2HL3A 5E8GA 1K9AA 1FOYA 1QQIA 5GANg 2CUEA 2VT2A 1U5TB 3ULRB 2IRFG 2L2PA 3LSMA 2YDLA 1SHFA 3GVAA 3I4PA 1D0ZA 1JHFA 1TUGB 2XIDA 3I56I 3OYMA 5LRSA 4H2SA 5LJ3d 3EH2A 2ZCFB 2H8WA 1YJNT 1FMVA 4DPGA 2HKXA 2CUFA 3TUPA 4G85A 2M0OA 5DCFA 1OCRH 2XAHA 2PJPA 1C1AA 5HGQA 3SQNA 1PNJA 2O9VA 1X2HA 1I8FA 4M75D 1I6XA 1S5LC 3FISA 3ICAA 3GZ5A 5GAOl 1LPQA 1K4SA 3TGNA 2FPFA 4JPBW 1N8RC 1G6NA 4J6XA 1ITYA 2EIFA 1ORKA 5D6XA 4WCGA 1T08B 1K1ZA 2L9VA 3FLGA 1KONA 4CS3A 2A6EF 1HW5A 5GMKl 3HXZA 3IAM2 2L89A 1B7YB 4HSRA 1PSEA 2X35A 3SXYA 4RB2C 1ZGJA 3D7SB 4EEFG 1RAAB 2VC8A 4FTHA 4PFZA 3I71A 2EILH 3VYGA 3W6KB 3MKDA 1HSTA 3M8FA 4LOCA 5DM7R 1RAGB 3QSUA 2K02A 3HC7A 5C3EJ 1QLYA 4BD3A 1FYMA 2F2XA 2QKMB 1TXQA 4F04B 3QYFA 4LD5A 1T6SA 3CCVT 1X2GA 1F43A 4X9CA 1ERDA 3DEWA 2MIOA 3H0HA 2A0FB 1OYWA 2L0KA 2PLYA 2RI5A 1MZBA 1XSXA 3KLOA 2RA2A 2DI3A 1QVGS 2CP6A 4M7DC 2L7FP 4JLIA 2KRNA 2DA7A 1EVKA 5LJ5g 5L3GA 1XGNA 2DA6A 4AM3A 1TLHB 2NVXJ 4Z6YA 2UXNA 4J9FA 3CD6A 3CCLA 2F4MB 4XEMA 2E1MC 3QWXX 2AKKA 4RTZA 4XMYA 4QWQA 1T0FA 2VOPA 3PCOA 2YUOA 3C12A 3QWYA 4X5OA 1OCZH 2KKOA 2CS7A 1A31A 2SRCA 3PUFA 2XU8A 2I4LA 1IO6A 4QLCU 2ODRD 4PJOA 2KZGA 3V4GA 3JCMh 2LRDA 2CSIA 1Y6IA 3LSGA 2LJ0A 4EIKA 5F6FA 4PFOA 3OYIA 3W3CA 3M7GA 3HOVJ 4ZC3A 4E51A 2VJ5A 1RNLA 2EJGA 3KUFA 3E1SA 1W5SA 5D6WA 1JXMA 1UGSB 2KI7A 2EBIA 4KDPA 2JSPA 3H5AA 4FYVB 4KGVB 4KGXB 1H4QA 3I5RA 1JUMA 5I2SA 1U5TC 2LVMA 2X6YA 4HCBA 2DJIA 2ZSIB 3Q9SA 4XU1A 1JTXA 2LRQA 4OGEA 4HWSA 3BJUA 2EQRA 2EZLA 1X27A 1LKXA 2AQFA 2Z0WA 4FYWB 4CO8A 1EKEA 2CJJA 2XUBA 3BR0A 5EZGA 2XB5A 5K7HA 1I1JA 3REOA 2O03A 4IHSA 1M8VA