3V7SA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor 0364
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
total genus 98
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7sA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7sA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7sA02
2LKPA 4BW9A 3GZ5A 1RUNA 2VBYA 2XRNA 1OKRA 1U5TC 2B0LA 3RPQA 4M78D 4NHJA 4OLFA 2LF8A 2XIGA 1I5ZA 1QQIA 1S7OA 5DYMA 1NJ6A 3BJ6A 5GAOr 4KMFA 4H2WA 3W6JB 2ACJA 3F8NA 5LJ5j 2ZT7A 4TVAA 4A0ZA 3MFKA 3L4GA 1VTNC 2ZR3A 5HS8A 3ZPLA 2HTSA 4LK1F 3QRFF 2AS5F 2ZCWA 2L4MA 1TQMA 1X2GA 5GAMe 3JCMh 1V4RA 3H3ZA 3IG2A 3R0AA 1YW8A 3T8TA 3EFSA 2HQRA 1SFUA 2ZTGA 3GF2A 3DF8A 3HXYA 3ROUA 4I0AA 3KFWX 3LSTA 1EQRA 1LDDA 4XSXF 1XSXA 5ILSA 4HBLA 1R00A 1ZG3A 1KMNA 1XGNA 3JCMW 2XHKA 1GXPA 2OZ6A 5DUKA 1FWZA 3REXA 1USTA 2JRTA 3VQXA 2NRAC 1O7FA 1OPCA 1OR7A 1Z7MA 3FF5A 1IRFA 4QLCU 4P75C 2ALYA 2EV6A 4ZZLA 2ZFWA 2DTOA 3J80K 3LA3A 2A68F 1G4DA 2E7XA 3J81K 3L1AA 2RNJA 4LLLA 1R58A 3NQOA 4XEOA 1BI1A 4OP0A 2AMCB 5F6FA 5E1ZB 3UFGA 4PZJA 4GGGA 5D5UB 1T38A 4G7ZF 5L3EA 1IL2A 4YYEA 2E1NA 1PYSB 1TQIA 2EV5A 2X0LA 1SD4A 1BIAA 1PP8F 4RAYA 1B6AA 3ZMZA 4XRFA 3CMQA 4HLXA 3F23A 2IP2A 5DCMA 2DQLA 2YX7A 4Q5SF 2P5VA 1EIYB 2MD5A 2JTVA 3WTTC 2QHTA 4YRPA 4U7BA 1B70A 3R61A 4KT5C 2L54A 5FGMA 3MZYA 3P9CA 4M6XA 2KIUA 2DO7A 4BHCA 1LJOA 1BN5A 2OQRA 4YDQA 2OQGA 5HS9A 5GAN6 1KU3A 4PJOG 2UWMA 2ZNZA 2J5PA 2IPQX 2RKHA 2K7LA 2NYXA 3M8EA 1HC7A 3FM3A 3A5YA 3M4QA 1UHWA 1MZBA 3ZP5A 5LJ5g 1B8AA 1I4K1 4M78C 3RDIA 2H6BA 4U0VA 2VOOA 3O3KA 3E97A 4HWPA 3HY0A 5A2QK 5GAOp 2E3CA 1QGPA 3CUQC 4N0BA 4PGHA 2GIVA 3KP6A 2DK5A 2LNBA 5LBQA 4M75F 2R3SA 4AVPA 4YRRA 3N97A 5LJ3g 4C8QE 3M7GA 4YRQA 2W25A 1FNNA 2XKPA 3SFZA 3ZMVA 2VODA 3CDHA 5FD5A 2PJPA 3BW1A 3I7FA 5GAMg 1YFSA 4A5MA 2FA5A 4KN4X 4DPGA 4F7UF 3JAMZ 5BPDA 2JPBA 3JCMe 3IHUA 4ZH4F 3DPLC 1HSTA 3MEYA 1QE0A 2DU9A 3MEXA 1MDMA 3FMSA 1RNLA 1W66A 3SWNA 1SAXA 3RTRA 1BI2A 3VQYA 2CYYA 2FRHA 4ENNA 3MCZA 5LGUA 1S6LA 4HF1A 1T39A 4IJAA 4LLGF 3W6KB 4EQQA 1Z1DA 1TNTA 4ETSA 5GANd 1JHHA 1MJAA 1GXQA 3F8MA 2ISYA 1P4AA 3HFVA 2ZXJA 4M7AG 4CDGA 5HGQA 2G4CA 2IT0A 3INZA 5CVVA 2RHSA 4FT8A 1EV7A 2QZ8A 2E1HA 1R1TA 4UP7A 4O5VA 5D6FA 4I98B 4J5YA 3FB9A 3RYRA 3L9FA 3IC7A 5H6RA 2FXAA 3JCMJ 4OINF 2CO5A 3JTGA 1M8VA 4G6QA 3WTZA 4H0EA 1SD6A 1LNWA 2DT5A 3IALA 2XTIA 3RF1A 4RDXA 2GA1A 3HFOA 2Y48A 2RA2A 2COMA 2P8TA 2KKOA 2BEOA 4EJUA 4QVDA 1R22A 3JB9F 3FMRA 4H2VA 4IF4A 1O57A 5GANj 1SRYA 3HFZB 1QNTA 2K57A 4O2DA 1FC3A 1B34B 4ZZDA 1I8FA 3E9HA 2VT2A 5EEHA 2O0YA 4F7UG 1N9SA 3HXWA 2ZIMA 3F3XA 4HF0A 3T8RA 2HS5A 3HXXA 1Z9CA 2I2LA 3K2ZA 4EJTA 1T2KA 3R4KA 2O6GE 1S29A 4L0YB 4H2TA 1U6GA 4UV8A 4RQEA 1S8NA 2WV0A 5HS7A 1LVAA 2STTA 3ZN1A 1U1SA 3JCMQ 1JJCB 4RB3C 1UFMA 1O3SA 1VQZA 5LJ3f 2HFHA 2QLZA 2ESHA 1HSJA 4M75G 1PP7U 1FX7A 4GCVA 5AONA 4M78F 5LJ3j 3O2PE 4YRGA 3UGTA 1NNHA 1TW3A 5LRRA 1Z7NA 5E8IA 3JAMK 5GAMf 1JBMA 4M7DA 4HWRA 4PGGA 1X01A 1REPC 3QU6A 3RKYA 3RACA 2DDZA 4L9JA 1UHMA 4CICA 4I01A 1J0RA 2WTEA 4CH6A 3Q5FA 4KDPA 2DVEA 3BPVA 3HY1A 1LOJA 3ABTA 4UVAA 5JHUA 1U8RA 3JTHA 4H02A 4JUVA 3WU0A 2QENA 5JVTA 4PJOD 4ZTZB 1ZG5A 2Y90A 4EMHA 2ZBKA 3M8FA 2K86A 3TO6A 3BPXA 3S2WA 1LEBA 3VQVA 4CGZA 2G7HA 4XU2A 1BJAA 3PQKA 5FB2A 2W57A 5KVRA 2KIFA 1J59A 5GAN7 2A61A 4Y91A 4C92C 1FP1D 4R79A 4RCCA 2ZT5A 2C6YA 1R5HA 3QO5A 2VC8A 4BXUA 3TOBA 4HDVA 3F8BA 1ZRCA 1A04A 4DNCA 2BYVE 4AIKA 2RDPA 4OIPF 1IAWA 3H92A 4ZYDA 1YFRA 4M75C 3KP7A 4EMKA 2ADUA 1H4VB 1E22A 2Q7EA 2IJLA 1IN6A 5F1RA 5E8GA 4LB6B 1K79A 1BM9A 1MGTA 4M75E 3E6CC 3HTSB 2P5LC 2P6TA 4EMKB 5LJ3d 4RGSA 5CVIA 5DUIA 1E1TA 3RI4A 4H2XB 2QHVA 1XD7A 4RB0A 4C92D 4M7AF 1YO5C 2XVCA 1H641 2AKWB 1ZN2A 2EK5A 5IT3A 4AH6A 4C8QC 2ZNYA 1YIOA 5GAN5 2QBYB 5HLIA 3GX4X 4AIJA 4P3NA 4LNSA 4JK1X 2ZNJA 3V7CA 1CGPA 4OMZA 1LJ9A 3RJPA 1MKMA 1ZGJA 4M77F 2F2EA 2IRFG 4XQ3A 5C53B 1H4TA 4M77D 1KQ9A 4RGRA 3G73A 4CS2A 3DEUA 4P9FA 2RV8A 2BE5F 5ICFA 1WWXA 3WTWC 3GO5A 3SWNB 3WU1B 2KJBA 2OZUA 4WF2A 1W4MA 4LLNA 3TEHA 3L4GB 2XUBA 4Q6GA 1Z6TA 2A69F 4MHGA 4OMYA 4CZZA 1QZZA 2HR3A 3TQNA 1I5LA 2VC0A 1C0WA 1BOAA 4M77B 4YRNA 5CVJA 1D5VA 4M7DB 5CYVA 5J8FA 4KUMA 1QBJA 1FZPB 4EMSA 3VQWA 1ZHFA 2FMLA 1WPYA 1ULYA 1XN7A 4M72A 4KFCA 5GANf 4L9VA 4YP0A 1ZLJA 2V9VA 3L2CA 4B09A 5K5QA 1R1VA 1ZARA 4XLNF 3QAHA 1I1SA 2OU2A 1IXRC 1H9GA 3Q9SA 5FFZA 4HVCA 1XCBA 3IKVA 4GXOA 4EM1A 2C8MA 1WYDA 2ARUA 4ESBA 1W5TA 3KCCA 2L01A 4N0AC 2XAFA 2EFQA 2PMFA 3F6OA 2W24A 3COAC 3ECOA 2E5AA 3PZCA 3V7RA 3QTCA 4CH3A 5L3CA 2EFNA 4UV9A 3LC0A 3GZ6A 2E64A 3E9IA 1WLEA 2VBXA 1J7KA 4CO8A 1EVKA 3OOPA 4BQAA 5FD6A 4HT9A 2M8EA 1L0WA 1UCRA 3DPTA 1MDMB 4P71A 4MMLA 4G6DA 1HTTA 2I4OA 2XGTA 1DP7P 5HVQC 4EJOA 4EM2A 4BYYA 2W85A 4RGUA 3NELA 3WTVC 2JPCA 4M77E 2XKOA 3EETA 1YQAA 2EFOA 3GXOA 3QPHA 4M7DG 1SFEA 2CFXA 1W7PB 1ON2A 1HKTA 5GMKi 4J6YA 2VBZA 3HXVA 1FP2A 1K6OA 4QVCA 2Y75A 4CYDA 2WC2A 3JCMX 3JCMc 2NNYA 2QVOA 3C7JA 1R1UA 2OBPA 3IWZA 4KN7X 3L2ZA 2QQAA 3JCMd 3HUGA 4MGRA 4P73A 4ESJA 1PDNC 3KEOA 2DJZA 5D8KB 2VN2A 4MQ9F 4KIBA 4YRFA 3C18A 3FXRA 3ZMTA 4RCBA 4M73A 3Q9VA 4WK8F 4HX8A 4XU0A 3I54A 1NJ2A 3SZTA 5EEGA 1T0FA 2GZWA 2IY5B 3JSOA 2Y0MA 2Z99A 3QO3A 4G7HF 3JB9J 2A3SA 2ZZEA 1Y96B 4AIHA 3R6SA 2IW5A 5TRDA 4RMFA 3KZYA 1O3QA 3RESA 4M77G 2O8XA 4HV6A 3WE2A 4E70A 3BFMA 3NEMA 2EFPA 2FMYA 2HKXA 3F6VA 3R60A 4OIRF 1UB9A 2BGCA 3E6MA 3HTUA 1LDKB 2KIMA 1XMKA 3JCMV 5GMKh 5E1WA 3WTSC 5GAMj 3P9IA 1S7AA 3FXUA 3WG9A 1FT9A 4M7AA 3I5UA 2A5YB 3FHZA 1E2XA 3WTUC 2EL9A 3CO7C 3QP6A 2G7UA 2PI0A 5E20A 2L3DA 3WGHA 3QNEA 2DFIA 2RHSB 4TVAB 3GFIA 5A2QZ 1TNSA 4M77A 1LQ1A 1SMTA 4XEMA 2YR2A 5ERIA 1ZLKA 4UVBA 5DCFA 1X55A 3ML6A 3QPTA 4CS3A 1HKQA 4KR3A 1LDJA 1OMIA 5DDGA 1MGQA 1YS7A 2EB7A 2O61A 2LSOA 4IRIA 4QWQA 4Y13A 4YCUA 4UHTA 4MQVA 4V2SA 3HOTA 4YCWA 4WX9A 2FEZA 1DDNA 4HAMA 2P7VB 1H9TA 3H3UA 1U5TA 1ZYRF 1I6XA 3KEQA 2QUFA 5LEKA 3MZHA 1IN8A 5LJ3h 2MC3A 12ASA 5GAOm 3NENA 3RERA 1QPMA 4Q48A 1IZ1A 5GAOn 3G1ZA 4G7OF 1GHCA 4G85A 5KK1A 5GAN8 1S3JA 1KMMA 1D3YA 4J6WA 3BJOA 2Q5HA 4K87A 1ZAOA 2M1BA 4PDKA 2RD1A 4C92G 5AIPA 4FX0A 3IL2A 2M5WA 4YG2F 1FSEA 2QTXA 1ONVA 4YFXF 2Z33A 4EO4A 1W5SA 4WXDA 3K1PA 1Q1HA 4M7DF 2O3FA 1YGBA 4UP8A 2IA0A 3N4MA 2A07F 1YFHA 2ZXFA 5K1PA 6PAXA 3EYIA 5FFXA 3WTXC 3LAJA 3WODF 3U1DA 1K78A 1WQWA 4EV0A 4LG0A 4PJOA 3DFGA 2EA2A 3KE2A 4NL3A 3HFZA 2OA4A 1N9RA 3DP7A 1KQ1A 2CJBA 1IRGA 4M7DD 1U1TA 4YIIA 1XDSA 3F21A 1MJBA 3GWZA 4MMKA 3ZN0A 1CF7B 3R07A 4TTVA 2EWNA 4HA8A 1JGSA 2VXZA 3KP5A 3L7WA 3BDDA 2V1UA 4LJZF 2ZO4A 1B7YA 2A6EF 3HOSA 4E51A 4HT8A 4M7DE 3HRKA 1IN4A 4U7DA 2RN7A 3CLOA 3E5QA 3TDZC 3GUDA 5F64A 4M7AB 5DV5A 4F7ZA 5LJ5f 5D5VB 1ASYA 4X5OA 3QO7A 4IXAA 4CH5A 5HDGA 2ZINA 4K86A 2PMUA 2HDCA 1SD7A 3HRSA 2QM3A 1W7PD 4LFUA 2D2WA 2HWVA 4G8XA 3A31A 4M9XA 1BC8C 2PEXA 1KU7A 1USYC 2QYOA 4H2YA 5ICGA 5L3DA 3FM5A 3L00A 2F5FA 2UXXA 5GANh 2E41A 3F22A 2ZMEA 3SB2A 3NETA 3HYIA 4ASNA 1HK9A 1YLFA 3G3ZA 4JQFA 1YTYA 1YS6A 4A12A 4S05A 2GQQA 2KRFA 2H6CA 3BWGA 3EUHA 3L09A 1ADYA 2FU4A 2H94A 2DPUA 5D4SA 1XGOA 3I59A 2E1CA 5L3FA 2XV4S 1DPUA 2PMHA 2FBHA 2RHQA 5LEJA 1WSUA 4OIQF 2FBIA 1IXSB 1X54A 3ZMUA 1DPRA 4P3OA 2DBBA 4HZFA 1HBXG 2EAYA 1PUEE 2FNAA 2STWA 4P74C 1B70B 4WXCA 2YLCA 4D0PA 4U88A 4AD9A 1Y0UA 1CF7A 1EOVA 3BOQA 2MH2A 3PQJA 3JB9I 4P72A 5CVRA 1ODDA 3BP8A 4AWXB 2RB6A 3RKXA 5FO5A 1RUOA 3RUXA 3WGIA 1FBUA 3KLOA 2ODRC 5LGTA 1E17A 4LG0B 1BBWA 2FYKA 4XBFA 3I59B 4G94A 1F4KA 2FSWA 2O03A 1LNXA 1KOGA 1G3SA 1B76A 4UPAA 4LB5A 4M74A 1YYVA 2UXNA 3TO9A 2V1XA 1V3FA 3E6BA 1RIOH 1HW1A 4KR2A 3HSRA 4YREA 1FBQA 5ICCA 3A32A 1BIBA 4PNOA 2YLBA 1E1OA 2XAHA 3UH0A 2QQBA 1KA8A 2DQ3A 4Q15A 2PMEA 3CUOA 2PQ8A 3HFNA 4X9CA 1B9NA 2JT1A 1KQ2A 3W3SA 3KLNA 1H4SA 2DZCA 2R7FA 3LAPA 4HQMA 1OYYA 2PFBA 2A6HF 4YRKA 3RL6A 5GAN2 3FXQA 1JXSA 2V79A 4CH4A 2DI3A 3HRMA 2EA4A 4PCQA 4ZTUB 2IA1A 3RIRA 1IUYA 2FB7A 2WWYA 3UGQA 2G9WA 1WI9A 5LJ3e 2HQNA 5LHIA 4ESFA 3EFRA 4MTDA 4NL2A 2ZT6A 4I7HA 3PGGA 4G9YA 5BMZA 3QOPA 2RM4A 5K1YA 2ALYB 2CSOA 3FIFA 3JB9G 3WE3A 1LB2A 2HYFA 4JBAA 1XSDA 4TQDA 3JCMg 4M9ZA 1B4AA 2NS0A 5LJ5e 1B1BA 2Q8KA 1TTYA 4R8HA 5GAOq 4B8XA 1G5HA 2Q7HA 2PLYA 3V7SA 4YRIA 4I02A 1HW5A 4IRGA 2FF4A 3MQ0A 2P5IA 2MBFA 2NNNA 3I0TA 3GFJA 4ZYEA 4S04A 2VONA 3A7RA 3GIBA 4PJOB 2J3LA 2CIMA 2HEOA 4YRCA 2AKWA 2XGXA 2FQ3A 5LLQA 4P75A 1MJ9A 3GFMA 4UP9A 3BJUA 1G6NA 3R0JA 4EX5A 1LEAA 3REOA 3V8KA 3A7UA 1WU7A 4CHUA 2XAJA 3MF1A 4K88A 4TQFA 1XGMA 2DXUA 3IRQA 3P8YA 2CJAA 3JCMf 3EQLF 2QQ9A 5BS6A 3B73A 1Z7UA 4XTWA 3F8CA 4LK0F 2CJ9A 1XMAA 3CUQB 11ASA 4XSZF 3MAJA 2ETHA 2JZYA 1Z91A 4HF2A 4LMYA 2Q2EA 4YRTA 4TWAA 1AWCA 2M87A 2RQPA 2Q7GA 4O3MA 1FY7A 4HDUA 3BDUA 4L9TA 1BBYA 4RAZA 1D3BB 2P0LA 4HWTA 3T5XA 1I1GA 4A6DA 3IWFA 2HGCA 4MNUA 1RIQA 4BWAA 4YRSA 2D45A 1P92A 2V1DA 3V8JA 1HKSA 3DQVC 5C52B 4A54A 2DU5A 3TOAA 4IPAA 4M78A 3NRVA 4YROA 2PBIA 1RI7A 2EJ9A 1ATIA 5J6XA 5GMKj 1P6RA 2HTJA 4HW0A 4YRLA 3CUQA 5GAMh 4BH9A 2VE9A 4TV7A 1X2HA 2EFWA 2NAZA 1R36A 5CJ9A 5ELOA 2YSRA 1DUXC 3VOEA 4EGZA 2GA2A 1BI0A 2D1HA 2GAUA 2VE8A 1L3LA 5E18F 1G3TA 4MTEA 2HYGD 3TEHB 3BZ6A 5D4RA 4KA4A 3HRUA 3GW2A 1KQ8A 4LD5A 2ODRD 3ULQB 3FZVA 4NQWA 2F5EA 4KIFA 4Y17A 3M1EA 1EH8A 5HOOA 4H2XA 1SFXA 1B9MA 3FX3A 1KU2A 1J75A 2W84A 1EH6A 2VXEA 2VT3A 3SWNC 5JFRA 2P4WA 3DSQA 3VB2A 5H20A 1NHAA 1FBSA 3M4GA 1Z6RA 1J9IA 3KETA 4A5NA 1IN5A 3GVAA 4HX4A 1P2FA 1R5GA 2Q5IA 3JW4A 4YIFA 4L0ZB 2RC4A 5BQTA 4Z2YA 3SHFA 4ZYHA 5HLGA 3I4PA 3LWFA 2LF7A 4EJVA 1F9NA 1WNLA 1ZH5A 4WI1A 4M71A 3P8VA 5GAMd 3CTAA 3GFLA 2VC1A 2DTHA 4YFKF 3D0SA 5IT9Z 5TJJA 2QWWA 1EFWA 2VBWA 3E5XA 1KYWA 3FMQA 4Q4ZF 1YW7A 3F8FA 2IVMA 1H4QA 1Y96A 3HXZA 4HQEA 1JJCA 1KU9A 1XDUA 2K02A 2OD5A 2EJFA 2XAQA 5E3IA 5KNNA 4X9DA 3E3VA 4RQFA 5HDNA 4P55A 2P5KA 2RVCA 3CO6C 4MEXF 1FYLA 1JHFA 4WXHA 1SD5A 4DQ2A 2ZGWA 5GANg 2R7DA 4GO1A 3A74A 4PG3A 1IXCA 4M6YA 3FWEA 4A53A 2FNPA 2YHTA 4U0WA 1SMYF 4I2OA 3VU3C 5DY9A 2P7CB 3OD1A 2HZTA 3VBBA 3PCOA 2ZNIA 1OYIA 3JCMb 3DKWA 5GMKm 4IRHA 2HOEA 2M45A 4C8QF 5BPIA 4PHCA 1O3TA 3HRTA 5GAOl 5E17F 1EIYA 1QZYA 3GEZA 3SXYA 4RB2C 3V4GA 4YFNF 3HRIA 4EJWA 3IKLA 5LHHA 4MEYF 4KQEA 2E65A 1O7LA 3ZMDA 2FE3A 4UNOA 5DD8A 2DQRA 3TO7A 1ADJA 3C3WA 4P9UA 4M7DC 1BC7C 2OAZA 3FJPA 4ENMA 3ERED 4I0BA 4XU1A 1IF1A 1G3WA 2DW4A 5IT9K 3IRRA 4P73C 5D5XB 2AMCA 3HTZA 1AOYA 4M9SA 3KP3A 2GXGA 2F5DA 4KICA 2IA2A 2MLGA 5I21A 4ZYGA 5J8CA 1F5TA 2QBYA 1RZ4A 2K4JA 4UUVA 1IN7A 4J15A 4BHPA 1FYKA 2X4HA 1W7PA 3A5ZA 3T1BA 2ZZFA 4WJ4A 3QSUA 2QHUA 4U0YA 3U9GA 4XTYA 5C51B 4C92A 1J2XA 2ZCEA 3M9AA 3QP5A 1LYLA 3PCOB 2Z3YA 4YCVA 2DKGA 3HSEA 4N9HA 3OV8A 4FHTA 3QUIA 2EV0A 2I4LA 3RGLA 3RPUA 1P4XA 2I4NA 4EMGA 2V6CA 4ENJA 4M75A 4EMKC 5D5WB 1SERA 1KQ0A 2RGVA 3KP4A 3AHUA 2D1VA 3EYYA 3JSPA 1QO0D 4ZIBA 5DD4A 1O3RA 3K69A 4UVCA 1X3UA 1ZGAA 2VXFA 4M78G 4C8QB 3EDPA 4RB1A 3M4PA 1F1ZA 2E7WA 4HWSA 5HDKA 4R1HA 1ZG1A 3LA2A 1I27A 1Z05A 4F7UA 5HLHA 2DAOA 3IKMB 3T0YA 2PG4A 2MH9A 4C8QA 4KMUX 4P5OA 1KGSA 1C0AA 4H2UA 1T6SA 3E5UA 1K78B 1NYQA 5K5RA 4F7UE 3J81Z 1R7JA 1IW7F 2PN6A 5GANe 1U78A 2K27A 4C8QD 3IKTA 1HW2A 3QHSA 4NB5A 4C92B 4OU0A 1TW2A 1TH7A 4FX4A 1HQCA 3K1MA 1FYMA 2DQ0A 3DXJF 4TVYA 1T98A 4L5JA 3SZPA 3TDUC 4JRIA 1SETA 3QO8A 2M30A 1YB3A 5ILUA 4WCGA 1YW9A 3K9TA 2ZZGA 1NJ5A 3E6DA 3LA7A 5H6QA 2ZJ2A 1JRIA 2DLLA 4M75D 3I58A 4NCXA 1ZREA 2BBYA 1PYSA 4GYGA 5GAN4 1GGMA 4XTZA 3REUA 1XCVA 3VEPA 1MD0A 4C92E 5LHGA 4BNCA 2QHSA 3K1NA 4ENKA 4OOIA 1K7AA 4M78E 2UZKA 3ECHA 5LRSA 4P96A 4IVNA 3I64A 3HSBA 1HXDA 3V8LA 1BI3A 3ICAA 5F5WA 3WQZA 5FLXZ 3BY6A 1M5Q1 4K2EA 1QF6A 2H27A 4Q47A 1GVJA 3K0LA 4PJOC 4KYWA 3LQRA 4HX7A 1FYFA 2YX4A 1E24A 4A0XA 4RS8A 2Q0OA 1XSVA 1OYWA 4G84A 2ESNA 4N0AA 4XU3A 2JSCA 3DV8A 3HHHA 4TVWA 1B7YB 1ON1A 4M78B 3J80Z 1STZA 3LFKA 5GMKe 1ZRDA 2DZ9A 5JI6A 2XAGA 4M7AD 2HNIA 2MLKA 2E10A 2Z5UA 3J7AO 4OIOF 4L5IA 1P4WA 4I09A 1G51A 3JCMP 4L9NA 3KP2A 1FOKA 3WTYC 2XROA 2RHQB 4L87A 2P6SA 2EJGA 1D3BA 3MF2A 4A0YA 5LJ5h 1R23A 1KYZA 4A6EA 3B02A 1YG2A 3HXUA 4IHTA 2DXTA 5E1XA 2CG4A 1I81A 1L0OC 4M7AE 4EGYA 2BV6A 1G5IA 2EJRA 4P71C 4O6JA 3F72A 4BAYA 3BY7A 5BOXA 4WJ3M 2Z9OA 4HOBA 5JR3A 3HIFA 4KNYA 3TEGA 3BJAA 1NJ8A 1ZRFA 5GMKl 2ISZA 1WQ2A 1D8KA 3CJNA 4UXNA 1YFTA 1TLHB 3O6BB 5AIQA 3U2RA 3RYPA 2FOKA 5ED4A 2YPRA 3P8TA 4H2SA 2C7IA 4HLYA 4YRJA 5D6EA 1USYA 4EVIA 2CW0F 4HWOA 2DTRA 2XASA 4GYIA 4N9IA 2CGHA 2JN0A 4HV5A 3D5LA 3HSFA 4XTUA 2KJCA 1YCYA 3KFUA 3VODA 3P7NA 3JB9D 3ZQ7A 2DPDA 1X56A 1U2WA 4IHSA 3C1DA 2FBKA 5CVUA 3TUPA 2TDXA 3AAFA 1G3YA 4ON0A 2DK8A 1D8JA 3ELKA 2L4AA 3MWMA 4JRKA 1TQPA 3NEUA 4NOYA 3GLXA 4CS4A 5K1XA 3A7AA 2GWRA 4HYEA 4C92F 1B59A 4J6XA 2CQKA 4BHBA 5LGNA 2CWEA 5FLXK 2ZT8A 3PFIA 4PJOE 2J5OA 2CGPA 4P74A 4L18B 3BROA 2IY5A 4F7UB 2ZKZA 5DEQA 3TGNA 5LJ5d 2J3MA 4XTXA 2ZMEB 2DU7A 2VOPA 4A2UA 2HKOA 4XTVA 3VFZA 1TBXA 5ICEA 4P72C 4CXFA 1SESA 5ELNA 1WQ7A 3HHGA 4C8QG 4EM0B 4YRMA 2GXBA 3QU3A 2H09A 5DCMB 1B34A 3I71A 1EH7A 3SQNA 1FPQA 3I53A 1N9WA 4JLIA 3LQQA 3LSQA 2F5CA 3GYHX 5CLSA 4M7AC 1FSHA 4M75B 3P9KA 1J5YA 3ISPA 2ARSA 5ILVA 2LDUA 1U3EM 4WWCA 2YU3A 1ASZA 4PJOF 4KIGA 1USSA 5L3GA 1FLIA 1EVLA 1XB4A 2L02A 4YPFA 2K4BA 3ZMSA 4M77C 5CAIA 1WRJA 3ABUA 5L3BA 5D8LB 4XLPF 3JB9H 1H0MA 2I4MA 1NJ1A 2MA3A 3RKWA 2ZR2A 1J5WA 1U5TB 2DEQA 1JE8A 1BBUA 2ELHA 4Y15A 3ERRA 4LGWA 3WGGA 3KZZA 4RGXA 2DTIA 2ARTA 4P3PA 5K5OA 1WKMA 2AXLA 3LSSA 5GAN3 1XGSA 1NYRA 2ZIOA 3TKYA
chains in the Genus database with same CATH superfamily
2LKPA 1EZZB 3PVLA 4BW9A 1OZ2A 3GZ5A 1RUNA 2VBYA 2XRNA 2DFFA 2PX9A 3CJRB 1OKRA 1U5TC 5CQEA 1GFDA 2K7AA 2RO0A 2P84A 2B0LA 2SEMA 1N8RU 1X2QA 4DEYA 3RPQA 2LY2A 4M78D 5F0FA 4NHJA 1VQNA 3G71I 3Q1JA 2Y31A 2PUKB 2LF8A 3AG4H 4II1A 3GMEA 1YJNA 1U3OA 2XIGA 2RHXA 1I5ZA 1QQIA 5GANh 1S7OA 5DYMA 1NJ6A 1W2BA 3BJ6A 5GAOr 4KMFA 5A0LA 4ABZA 4H2WA 3W6JB 2HQHA 2VJ4A 5CIUA 2WSEE 4CCKA 2ACJA 3F8NA 2GQIA 4BJTA 1M9SA 5LJ5j 2ZT7A 4TVAA 1Q1VA 2DL5A 1ZA1B 2EYWA 1R5ID 4A0ZA 1ETXA 1AWWA 3MFKA 2VI6A 4DZJA 4OWRB 3L4GA 1VTNC 2K9LA 3LGLA 2RHYA 2ZR3A 1TT5B 2DFUA 5HS8A 3CLQA 1XX5A 5KYWA 4BI3A 4KT6A 4A3IJ 2DL7A 4AT1B 2VKNA 3ZPLA 2CQXA 4DBRA 5IOZA 2OUMA 5M3FJ 4Z88A 2L9NA 4DIQA 2DETA 1SHGA 2HTSA 2YWWA 1WHJA 4A3GJ 3PFYA 4LK1F 3QRFF 4HKEA 2AS5F 2ZCWA 1QKXA 1WHGA 2L4MA 1TQMA 1X2GA 3UH0A 5KCHA 5GAMe 3JCMh 1M90U 4RTTA 2PQWA 3GTPJ 1V4RA 1BCMA 2KRHA 3H3ZA 1ZR4A 1ZUKA 3CCLQ 2OTJT 3R0AA 2CSIA 3IG2A 1YW8A 5H2FC 5EEAA 3M55A 4LG3A 3T8TA 1PM3A 3EFSA 2HQRA 1N75A 1SFUA 2B7EA 2ZTGA 3GF2A 2XF6A 4GRIA 4XK4A 3HHTB 3Q0UA 2EIKH 3DF8A 1S1NA 1OJLA 1W2BS 3HXYA 2OC6A 4IHVA 1F1BB 2EQJA 3ASKA 1M1KC 1PSEA 3EH2A 1PG5B 1NK2P 3ONQA 2OV7A 2I5UA 3ROUA 4I0AA 3KFWX 2DXBA 2UUZA 3CF2A 2KQRA 1WZ2A 1G83A 4X1VA 1Y1WJ 4JZ4A 3LSTA 1EQRA 1LDDA 4XSXF 2CU7A 1XSXA 1SFOJ 5ILSA 2E6ZA 2VVKA 2LJ1A 4HBLA 5FROA 1R00A 1ZG3A 2X1EA 1YN8A 1E3OC 3PIOA 1KC8C 3N05A 1V54H 1KMNA 1XGNA 4LVJA 2EW3A 3ASNH 2P0QA 4RTXA 3JCMW 4JDSA 2XHKA 4AM3A 4LVMA 3LSMA 4ZDPA 2DYRH 1GXPA 3P8HA 2I8DA 2OZ6A 2RHSA 5DUKA 1FWZA 3REXA 1USTA 2KDSA 4IHYA 2RJDA 2RNAA 2JRTA 3SD4A 2DDAA 2BE7D 3VQXA 2H8WA 2Y0SA 2QEXI 2NRAC 1O7FA 4FISA 1Y39A 1OPCA 1MW7A 1OR7A 1Z7MA 2L3PA 4HWOA 3FF5A 1IRFA 4QLCU 3CC4T 1VQPI 4P75C 2R5ZA 1MMAA 2ALYA 3G4SQ 1WLPB 1WA7A 2EV6A 2XPUA 4ZZLA 2K9MA 2ZFWA 4A3KJ 1E3PA 1GCQA 1RETA 4AFUC 2DTOA 3J80K 3JV3A 3LA3A 2A68F 1G4DA 1YRNB 2E7XA 3J81K 1YHQQ 3CC4Q 2FPDA 4CC7A 2CP5A 3EG0A 3GLLA 2EYZA 3JCUC 3L1AA 3OY9A 4KH0B 2RNJA 4LLLA 4HSTA 1R58A 3NQOA 1B72A 1BI1A 2EBPA 4OP0A 4DGWB 5F6FA 1BK2A 4EATA 5E1ZB 3CMYA 2GM4A 3C94A 4ZNXA 1VQNI 3UFGA 1QWEA 5DM7R 2M3AA 4XN3A 1V76A 4PZJA 2K85A 1HOMA 4GGGA 4RG2A 3CBOA 5IP7J 5D5UB 1T38A 4F52A 4G7ZF 2RNGA 1YOVB 1BB9A 1T3LA 3EG9B 3CCLI 1K61A 3PIPF 5IHNA 3VS1A 2EQMA 5L3EA 3E9GA 4A3EJ 1IL2A 1Y07A 3NGPA 4XORA 4YYEA 4DYRA 1D1CA 2E1NA 4N4OB 2BUDA 1YJNQ 1QVFS 3CF5F 1KONA 3VWBA 1KC8U 1TP4A 1PYSB 3META 2LJ3A 3LLRA 1TQIA 2EV5A 1D09B 3AFHA 1DU0A 2X0LA 3ER0A 2A5WA 1SD4A 2WAFA 2FD5A 3K4KA 5DTDA 1VYTA 1BIAA 1PP8F 1YJWA 4RAYA 4XLHA 1B6AA 1C0MA 5DM7F 3ZMZA 1FOXA 4XRFA 1ZA2B 1ZSGA 2K79A 2VYTA 2P4RA 2Z0WA 2X3WD 3EG9A 2DOFA 4HLXA 3F23A 2IP2A 3CJQB 1WJQA 1GV2A 5DCMA 3A8GB 2DQLA 3X25B 2L7MP 2YX7A 4Q5SF 2COYA 2VGNA 4D9JA 1T8IA 3ME9A 2P5VA 1OULA 1EIYB 2MD5A 3BLYA 5GAMd 2JTVA 3WTTC 2QHTA 4BQOA 4YRPA 1NYFA 2E2HJ 4U7BA 2J06A 4IUVA 2PJRB 2GBYA 1B70A 3R61A 1VQ8I 1TWAJ 2ZMEC 4KT5C 2L54A 4FTHA 2RQWA 5FGMA 1K0SA 3MZYA 3P9CA 3AG2H 4M6XA 1I3AA 1TTHB 2IGOA 2OX7A 1Y7XA 3HEFA 2KIUA 2DO7A 3BC8A 4BHCA 4AYBA 1BN5A 2OQRA 1FTTA 1LJOA 2GNCA 3AT1B 2Q2EB 2OQGA 5HS9A 5GAN6 4G84A 4YDQA 1KU3A 1UEBA 2UWMA 2ZNZA 4PJOG 2J5PA 2IPQX 2RKHA 2K7LA 2NYXA 3M8EA 1HC7A 3FM3A 3PO3J 3A5YA 1W1WE 2FO0A 4KH1B 3M4QA 1UHWA 1MZBA 4CCLA 1KD1C 3M4YA 5CPRB 3EUHC 3ZP5A 4OMFB 5LJ5g 4J01A 1I4K1 4M78C 1B8AA 1B07A 3CXCS 4HSRA 4B44A 1IV8A 3RDIA 5F0HA 2H6BA 4U0VA 3DU6A 2VOOA 1MV0B 3O3KA 2ZFUA 3MP6A 5GADJ 3E97A 3G1LA 3S1MJ 3OS5A 3LWIA 3E9FA 3H41A 2GCXA 2E5KA 5CQXA 5AYFA 4HWPA 2NUPA 4MLOA 3VYTB 4BUPA 4CCMA 3CCQT 3HY0A 5A2QK 3H9NA 5GAOp 4V2GA 2X3XD 2KYBA 2KAFA 1M3AA 2E3CA 1QGPA 2DX1A 4MIMA 4MZPA 3CUQC 4KITB 2DA7A 4N0BA 2DA5A 4PGHA 2ZZDA 2EYYA 3HXLA 1I6HJ 2LP5A 2GIVA 2H1LA 3KP6A 3CMAA 1VQ7I 4YRJA 2CZ0B 2DK5A 2LNBA 2CV0A 2GF7A 2HQ5A 5LBQA 4M75F 2R3SA 3BR1A 1NJIR 5E3LA 3MJXA 1J3TA 2E5QA 2X9DA 2LMJA 3TVTA 1AWOA 3ZQLA 2HOSA 4AVPA 4ORZA 2J7IA 1I5OB 3QWLA 1D5YA 4YRRA 3N97A 1X1AA 1T0HA 2RQTA 2PJRA 1BCOA 2JM8A 3HM5A 4A3LJ 3QKJA 5LJ3g 4C8QE 3S2HJ 2EVRA 3MKYB 3M7GA 5CKDA 2XDVA 4YRQA 2LQ8A 2K5CA 3GTQJ 2W25A 2OAUA 3GNGA 1FNNA 2XKPA 3MEAA 5IHIA 3SFZA 1TC3C 3MO8A 3ZMVA 1WJSA 2VODA 3CDHA 5FD5A 3ZEHA 2FL7A 2PJPA 2QQ8A 2GBQA 2JVHA 3BW1A 3I7FA 3HPWA 1R0CB 1Z3XA 5GAMg 5IYBJ 1YFSA 3CC7T 4A5MA 2DD5A 2FA5A 2EQKA 1YJ9Q 3PUFA 2CUJA 4KN4X 4DPGA 4Y3OA 1RR8C 4F7UF 3JAMZ 1UGVA 2NUZA 2RJFA 3J80E 1ZKGA 1BL0A 1OCOH 5BPDA 1YIJQ 2JPBA 3JCMe 5FKLA 3IHUA 4ZH4F 3DPLC 3OBWA 4X0GA 3EG3A 1HSTA 1VQ7T 1QE0A 3MEYA 2DU9A 3MEXA 1MDMA 1H8KA 3FMSA 1RNLA 1W66A 1ZELA 3SWNA 1X19A 1SAXA 4BS9A 3RTRA 1OLTA 1G5VA 1BI2A 2XPWA 3PTAA 3JRCA 2E6NA 5D7UA 2CYYA 2FRHA 3LSRA 3G1MA 2NXNB 3A8HB 4ENNA 3H5AA 3MCZA 5LGUA 4E7JA 1UUEA 1S6LA 4HF1A 2L0AA 1T39A 4IJAA 4LLGF 1RADB 2P0PA 3M58A 4A4KA 3W6KB 1QVPA 1BJZA 4EQQA 2CP6A 1WXBA 4J9GA 2V8IA 4PSXA 3LX7A 2CRGA 2DXIA 1SVOA 1Z1DA 2QA4T 1TNTA 2M7BA 4DYCA 1JHHA 4ETSA 1RAFB 4LIUA 2MOXA 5GANd 1HCRA 1MJAA 1GXQA 1ZGWA 3F8MA 1VQ6I 2XGEA 2ISYA 1P4AA 1SKUB 2DRKA 3IV5A 2ZXJA 2JZ2A 4LDWA 4M7AG 3HFVA 4CDGA 5HGQA 3SYTA 1WHMA 2IT0A 4C5HA 2LKXA 3INZA 1G8XA 3KYCB 5CVVA 4FT8A 4A3BJ 1EV7A 2QZ8A 2E1HA 5HY6A 1R1TA 2LC2A 1KG1A 3LC0A 4UP7A 4O5VA 2EZLA 1VI0A 5D6FA 2D5VA 4I98B 2PUOB 2XF7A 1NJIC 1SEUA 3FB9A 4J5YA 3RYRA 3L9FA 3NTKA 3IC7A 4S0HB 3H35A 1Y8QB 2FXAA 4ITVA 3I9V2 5H6RA 2CO5A 4OINF 5C3EJ 3OSFA 2IS4A 3JTGA 3WG7H 1K1ZA 1Q82U 3EFOA 3V42A 4DOZA 2GOMA 1LPLA 2DD4A 4RAFA 1M8VA 1VQPQ 4G6QA 3WTZA 4H0EA 1GLNA 1LFPA 3REAB 1SD6A 1ZTRA 1LNWA 2ZAEA 2DT5A 3L2QA 2XTIA 2O4XB 2BVLA 3IALA 3RF1A 3PO2J 2FRWA 3IH3A 4NNJA 1KHCA 4B3XA 4RDXA 2GA1A 3H0IA 3HFOA 2Y48A 2RA2A 3QJYA 2COMA 2P8TA 4A3MJ 2K4YA 2KKOA 3H9QA 2BEOA 2AQEA 4EJUA 2LNHB 1YJ9I 4RTVA 5EG2A 4QVDA 1X1CA 2R7ZJ 1R22A 1B8IB 1MNMC 3E19A 4J9CA 2LVMA 3JB9F 4X6AJ 3FMRA 3L42A 4H2VA 4OF1A 4IF4A 2QA4I 1O57A 1X4PA 3SJMA 5GANj 2MPXC 1SRYA 1USYA 2LOOA 1IGUA 4F14A 3HFZB 1QNTA 2K57A 3JRHA 4Z8AA 3EHQA 3RBBB 1TXQA 1FC3A 2VKHA 4ZZDA 1B34B 1I8FA 2LY1A 2VT2A 3SFMA 5EEHA 3E9HA 2O0YA 2M7AA 3OOUA 2R7QA 4F7UG 3GOXA 4B6MA 3I55Q 1P9QC 3OW2P 3R6NA 1M4ZA 1N9SA 2GTJA 3HXWA 2PNIA 2DL8A 4XOTA 2X6YA 2ZIMA 5A2QE 3F3XA 2YDLA 2BW3B 2M16A 4A4FA 4HF0A 2QSHX 2EKHA 3T8RA 2HS5A 4R0KA 4XLAA 3FXJA 2DA9A 2IVWA 1SRMA 3PT9A 3HXXA 1Z9CA 2VB6A 4DBQA 4BE1A 2E2JJ 4BACA 1RAHB 1X6OA 3K2ZA 2I2LA 2WADA 1T2KA 3R4KA 2O6GE 1S29A 4EJTA 4L0YB 4H2TA 8ATCB 2KQWA 1U6GA 4UV8A 5C6SA 4RQEA 1S8NA 1UZCA 1OI1A 1X27A 2WV0A 5HS7A 1LVAA 3OWTA 3UKGA 2STTA 3TCJA 3A03A 2Z1DA 2HOAA 3ZN1A 1IREB 2L7ZA 3MEWA 4R55A 3G71T 1K73R 4BBRJ 4M6VA 1VQNQ 1VQMI 3HGYA 5J3BA 1U1SA 3JCMQ 1JJCB 4RB3C 1UFMA 1O3SA 1VQZA 5ECAA 5LJ3f 2HFHA 2QLZA 2ESHA 1HSJA 3CP8A 2CQ7A 4M75G 1PP7U 1FX7A 4GCVA 5AONA 5HKCA 1YHQI 4M78F 1G2BA 1OX8A 2KHMA 3O2PE 2Y4XA 5LJ3j 4YRGA 1M2VB 2AT1B 1R4MB 3UGTA 1NNHA 1TW3A 5LRRA 2DRMA 1Z7NA 5E8IA 3JAMK 3TU4K 3EHRA 3QXEB 4C9YA 3BTIA 1JBMA 5IOYA 3O8VA 5GAMf 4M7DA 3P8BB 4PGGA 4HWRA 3GP8A 3JRGA 1X01A 1REPC 3QU6A 3RKYA 3RACA 2VJJA 2DDZA 4JX5A 3KBGA 4L9JA 1TOVA 4MFDA 3M53A 4P73C 1UHMA 1WIEA 4CICA 2X6XA 4I01A 2D6FA 3OYMA 3UT1A 1J0RA 7AT1B 2WTEA 3WHCA 2OPTA 3TEDA 4RA2A 4IIMA 5D6XA 3REBB 2P0WA 2DLPA 4CH6A 2KY9A 3DB3A 1UELB 3Q5FA 4F17A 4ZTJA 4KDPA 2KVQG 2PVGB 3QPSA 3BPVA 1BOBA 2DVEA 1AT1B 2DYIA 2MCNA 3HY1A 1LOJA 5CKHA 3ABTA 4UVAA 1VQMT 5JHUA 2G3RA 2YU9J 2K5LA 1U8RA 2DODA 4KRTA 3JTHA 1V5FA 4ELYC 3CC4A 5AT1B 4H02A 2MWOA 4JUVA 4OMMA 3WU0A 2QENA 5JVTA 4PJOD 3G4SA 1YHQT 2HVQA 1SVMA 3CCRA 2W4SA 1ZG5A 1BBZA 2Y90A 4HXJA 2VKDA 4EMHA 4ZTZB 2ZBKA 3M8FA 4RBOA 5KNLA 1HF0A 2EZIA 2K86A 3TO6A 2M0OA 3PIPA 1OPLA 3BPXA 3S2WA 1LEBA 2QQSA 2RQUA 4CGZA 2G7HA 2H3JA 2AKLA 3OR1C 2HZYA 4XU2A 3SDZA 1BJAA 3PQKA 3CMAT 4ME7A 1JQQA 2W57A 5KVRA 5FB2A 2KIFA 1NH3A 1J59A 1XJWB 2A61A 2JMAA 4Y91A 4A3FJ 4C92C 5KH6A 5GAN7 1FP1D 3OL3A 4R79A 2ZCFB 3C0CA 4RCCA 2C6YA 1R5HA 2ZT5A 3QO5A 2HQXA 1YBYA 1RR7A 2V1NA 2XG8D 5HLTA 2CP0A 2ME0A 2VC8A 3WHBA 3OYDA 4XR6A 4BXUA 3TOBA 1RACB 3CCYA 2R7RA 3F8BA 5M5WJ 4HDVA 1JI8A 2JXBA 1ZRCA 1A04A 4DNCA 4LDXA 2BYVE 2L0KA 2RDPA 4AIKA 4GDFA 3FISA 3SDBA 1Q86U 4OIPF 1IAWA 1FIPA 3H92A 5C4XJ 4ZYDA 2CT4A 2ELKA 1YFRA 2K3FA 3HC7A 1ZBXA 1YWOA 2HBPA 2RQRA 3KP7A 1OCRH 4M75C 2XU8A 3CBMA 4EMKA 4OAZA 2ZSIB 1Y6IA 2DM1A 2EGAA 1P7IA 1X1BA 4N4IA 3C4SA 3CMAQ 2ADUA 3QOEA 1YRNA 1H4VB 1E22A 4F16A 2Q7EA 3Q0WA 1QA6A 2IJLA 1IN6A 1PRLC 3RSNA 5E8GA 5F1RA 3SEMA 3L2VA 1A35A 3M8JA 4LB6B 1BM9A 1MGTA 5IYCJ 1K79A 4M75E 4YELA 5L23A 3OYJA 3CJTB 3E6CC 3HTSB 2P5LC 1F36A 3PIOF 2LCLA 2P6TA 1YX5A 2XK0A 4IURA 1IG7A 1YX3A 5LJ3d 4AFZC 4RGSA 4C0DC 4BJ5C 4DOVA 4EMKB 5CVIA 3ZQFA 1WJRA 5DUIA 3OYKA 4IUPA 2CUDA 4W1UA 3RI4A 1AHJB 1E1TA 5TGTA 4EPCA 4H2XB 2QHVA 1Y56A 3ZRGA 1XD7A 1WJ5A 4NUBA 4RB0A 4C92D 3MKZA 4CCOA 4M7AF 3MEVA 3AL0B 2BHYA 1WJEA 3VPRA 1YO5C 3VV0A 4J00A 2XVCA 3LSGA 1H641 5DLQE 1VQ9A 2AKWB 1ZN2A 2EK5A 5IT3A 4AH6A 3A01B 4C8QC 3I56Q 1Z0XA 3NWSA 2ZNYA 2JJ9A 1YIOA 5I2MA 1VQ5A 2ZJRF 4P5NA 4ZN1A 1X2MA 3C12A 2QBYB 4OGEA 5HLIA 3LH0A 5GAN5 3GX4X 4ESRA 4F04B 3VUZA 4AIJA 3L1PA 4P3NA 4LNSA 4JK1X 2ZNJA 3V7CA 1WJBA 1CGPA 4IUTA 4OMZA 2KRMA 1LJ9A 3A0HC 5GP9A 2H3EB 3CC2A 3RJPA 1MKMA 2J6KA 2KXDA 2MAMA 1ZGJA 4M77F 2F2EA 2IRFG 4XQ3A 3OL4A 3CCUA 5C53B 2RHQB 1H4TA 4MFEA 3X2QH 2DIQA 5DS9A 3EH1A 4M77D 1KQ9A 4P74A 4RGRA 3G73A 2P4TA 3JRIA 4CS2A 3M0PA 3DEUA 4P9FA 3CCJA 2RV8A 2BE5F 2L9RA 2RK1A 1RLPC 5ICFA 1SVLA 3B6AA 1PVEA 2ZXWH 1WWXA 1UB4A 2C0IA 2HSPA 3OSVA 1WI3A 2V1QA 3WTWC 5M9OA 4BDYA 3GO5A 3SWNB 3WU1B 1SANA 2KJBA 2OZUA 3CBPA 4HG2A 4WF2A 1PCXA 4HPQA 1BKBA 1W4MA 1WHUA 2VJIA 3FIWA 3HZJA 4LLNA 4ZDOA 4XU3A 2R4GA 3CCQI 3CPWA 1X6BA 2JRMA 1YI2T 3E1SA 4CCNA 2X35A 2YRVA 3CC2T 5K7ZA 3L4GB 2XUBA 3MKLA 1DGWY 4XAXB 3MQZA 4Q6GA 4D5CA 1MBKA 1Z6TA 2A69F 3AKZA 4MHGA 3K70C 4QT7A 1WYXA 1Q81U 3LNQA 4CZZA 1QZZA 2HR3A 1GDTA 4OMYA 3TQNA 1I5LA 2N8GA 2QKLB 2VC0A 3CMMA 1C0WA 1BOAA 1R77A 2CP3A 3M59A 4M77B 4YRNA 1JTXA 5CVJA 1D5VA 5KYNA 1M90C 4M7DB 1BW6A 2EILH 5CYVA 4E2FB 3DPUA 5FWBA 1ZBJA 4LVIA 3VS7A 5J8FA 3G2BA 4KUMA 3VQVA 4CC3A 2L7KA 1QBJA 3GCMA 4EMSA 3MKWB 1FZPB 2KISA 3VQWA 2X4XA 1ZHFA 2FMLA 2MYSA 3BR5A 4CZCA 3JRFA 1WPYA 1ULYA 5F1JA 2R0QC 3VS5A 1ETOA 1XN7A 4M72A 5FKOA 2CW7A 3M0QA 4CC2A 2XSDC 3QQAA 4KFCA 1JJ8C 2X4JA 2RREA 4JJBA 4RTUA 1BYMA 2LT1A 4Y33A 2GIZA 1BR4A 3ULRB 5GANf 3TEHA 2VQGA 4L9VA 3S6WA 4AU7A 3CCRT 4M3EA 3RUXA 4YP0A 2AZSA 4UB8C 1E7OA 1EF4A 1V1CA 3C95A 1ZLJA 3EG1A 1VQPA 3CD6A 3CC7I 3DTIA 2V9VA 1WJCA 1VQ6A 3L2CA 4CYCA 3CPWP 1WHKA 3DEEA 5J4VA 4B09A 5K5QA 2L9VA 1E6GA 1UG2A 1R1VA 3CCEI 3I9QA 1ZARA 4XLNF 3QAHA 1I1SA 1T3SA 2OU2A 2QGFB 2C06A 3DLLF 2K9GA 1IXRC 3CCSA 1H9GA 2CQQA 2PMZA 3Q9SA 2NVYJ 5FFZA 2CUFA 5IY5H 1AHDP 2QASA 1XCBA 2DEUA 3IKVA 4HVCA 4GXOA 4EM1A 2C8MA 1WYDA 2ARUA 4ESBA 1W5TA 3SEZA 4LDYA 3CCMA 3D5RC 4UC4A 2CSQA 3J7AY 3KCCA 2L01A 1UGPB 4N0AC 2XAFA 4BQNA 4J9FA 2BTTA 2L2PA 3OSSC 3TSWA 2EFQA 2PMFA 1GVDA 1SAUA 3E7LA 3F6OA 3HBLA 3ZCOA 2CS7A 4AYBN 3DB4A 1ZR2A 2QYZA 2AO9A 2W24A 3A1YA 4HVWA 3COAC 3ECOA 2E5AA 4CC4B 1VQ5Q 3PZCA 3RQIA 2E4HA 3A8OB 3V7RA 3QTCA 2ZPEB 4ANJA 3MCAB 3BTLA 4CH3A 5L3CA 5IAYA 3FXOA 1QZEA 2EFNA 1NPRA 4UV9A 4ZJZA 2QEXT 3GZ6A 3BZKA 2E64A 2XGDA 2VBXA 1WLEA 2QG9B 3E9IA 1N77A 3CMEI 2HEQA 1J7KA 4FW2A 3I55I 3H9JA 1E3HA 2DT7B 4CO8A 1Y1VJ 1EVKA 3CC4I 4IUQA 3VS0A 3OOPA 4BQAA 2LBFA 2MIOA 5FD6A 3KUFA 2M8EA 3JRBA 1GT0C 3M0SA 4HT9A 1L0WA 1IO2A 2H1KA 1UCRA 3DPTA 4FL6A 1MDMB 3ZFJA 4A4HA 4P71A 1FEXA 1AOJA 2AHJB 4CYCB 4MMLA 4G6DA 1HTTA 3DTEA 3M4OJ 1TUGB 4C5GA 2I4OA 2MF2A 3AG3H 4B48A 2VPLA 1WH5A 1SF9A 2XGTA 4TVRA 1DP7P 2LYCA 5HVQC 1Z3YA 3FKIJ 1IB8A 4EJOA 4EM2A 3H1CA 1PC0A 4BYYA 2W85A 3FLGA 2JTFA 3O5ZA 1FOWA 4RGUA 2V6EA 3RMSA 2FPFA 3CESA 3WTVC 5KYXB 4JS4A 2JPCA 3NELA 1ETWA 2KP6A 3KX2A 1PHTA 4M77E 2XKOA 3H6ZA 3EETA 1QHGA 5E3NA 1YQAA 1YITQ 4HCZA 2EFOA 3GXOA 3QPHA 1M27C 1SFEA 2CFXA 4M7DG 1W7PB 3S32A 2OTLT 1GBRA 3C2GA 1ON2A 1X4OA 5C4JJ 3CCJI 1HKTA 5GMKi 3E2UA 4J6YA 5BNGA 5HK3A 4O2DA 2XMFA 2VBZA 4IQJA 3PL8A 2MW8A 2AK5A 4B47A 3HXVA 1FP2A 2LD5A 1K6OA 1FYNA 4QVCA 2Y75A 4IOCF 1AWXA 4CYDA 2C0TA 2WC2A 2CP2A 3JCMX 1VQMQ 3JCMc 2NNYA 2QVOA 3C7JA 1R1UA 2OBPA 3IWZA 1IHWA 1GUUA 1ABOA 1T08B 4KN7X 5FU7C 3LGFA 2YT6A 1T0JA 3L2ZA 1VQ9T 5F04A 1MMSA 2RAEA 2QQAA 3FC3A 3CCQA 4PFPA 3JCMd 1VQLA 5GAGJ 1VQLI 2K2MA 3HUGA 4Y52J 2QI2A 2KNBB 2AXTC 3IH2A 1UG0A 4MGRA 1WH7A 4ESJA 4P73A 1LE8B 1PDNC 1AZGB 3EFOB 1NE8A 3KEOA 2DJZA 2MGQA 4U87A 1I0CA 5D8KB 2VN2A 3K4NA 4MQ9F 4KIBA 4NC7A 1VQOA 2H8HA 2ZXHA 3I56I 4YRFA 3C18A 1VQ4A 3FXRA 2DMOA 2K40A 3OS0A 3ZMTA 3VYRB 4RCBA 4M73A 3FBIB 3Q9VA 4WK8F 2K9NA 2GQVA 2KT1A 2K2VA 4HX8A 2LC4A 4XU0A 1KHIA 2V7FA 1WVRA 3I54A 3SZTA 1VFCA 3UR3C 1NJ2A 4XKCA 5EEGA 1T0FA 2DILA 3AG1H 3BG9A 2GZWA 2M9HA 5KYXA 2OTLI 4RUGA 3H8ZA 1W1FA 1K73U 2IY5B 1UGQB 2QDLA 3JSOA 1R71A 2Y0MA 2Z99A 1JB0E 5EZHA 2L2OA 1WZOA 3S93A 3HDDA 2Y9YA 4G7HF 1DP3A 2NUTB 3QO3A 4A3DJ 2HL3A 3VS3A 4B9XA 2A3SA 3JB9J 4XNFA 1NBEB 2V4JC 2ZZEA 1Y96B 4AIHA 3R6SA 2IW5A 5TRDA 2RJCA 3G71Q 4RMFA 3ZBDA 2ZSHB 1QVGA 2DL3A 2DMTA 5GJVB 1C1AA 4FT4A 2A36A 1YJWT 2X4YA 1Q7YC 2R7SA 1RAEB 2R5AA 3LL7A 3KXTA 3KZYA 4ZDLA 1O3QA 2L3RA 1EX4A 3RESA 1D0XA 2EYXA 3KFVA 4M77G 2O8XA 2ZPIB 2JT4A 2XGCA 4HV6A 3WE2A 2WV1A 4E70A 2ENMA 3BFMA 1KD1R 3CPFA 3NEMA 1AWJA 2EFPA 1LCKA 1LKXA 1M3CA 1TU0B 2E12A 2FMYA 2HKXA 3F6VA 3R60A 4OIRF 1UB9A 4X34A 2BGCA 2PMZN 1D1AA 2ATCB 3E6MA 4AFSC 3HTUA 1LDKB 2KIMA 1XMKA 4I6ZA 1UTIA 2QAZA 3JCMV 2EQRA 1JKOC 5E1WA 3IQLA 5J39A 1VF9A 3WTSC 1R8OB 5GMKh 4C0ZA 4F3QA 2DA3A 1VQ6Q 1TZLA 2DFEA 5GAMj 3FXKA 3P9IA 3PE0A 2B63J 1V5EA 4V19K 1S7AA 2X6WA 1MH4A 3FXUA 3L2UA 5KYUB 3WG9A 1VQ9Q 1H8AC 1FT9A 4B1RA 4M7AA 3TL4X 1FJLA 2QGUA 1O4XA 3I5UA 3ABMH 4DA4A 1KZHA 3A01A 2A5YB 1N8RC 3FHZA 3ZXSA 4BXFA 1E2XA 3WTUC 4KISA 3I55A 3TSZA 1EKEA 2IPOB 2JTEA 2EL9A 3CO7C 3QP6A 2G7UA 1R49A 2GGRA 1RLQC 4IQ4A 3BCBA 1MNDA 2PI0A 5E20A 2L3DA 2YSQA 3WGHA 2BE9B 3QNEA 5JLWA 1AZEA 2DFIA 2RHSB 4TVAB 1PWTA 3BG5A 2TCTA 5EDNA 3GFIA 5KE3A 5A2QZ 1TNSA 2KGTA 4M77A 1LQ1A 1SMTA 3CD6I 2ECZA 4XEMA 1ZX6A 3BTCA 2L8DA 4UB6C 2YR2A 1A6QA 5ERIA 4UVBA 1ZLKA 5DCFA 1X55A 3ML6A 3QPTA 4RLQA 2G4CA 1HKQA 4CS3A 3PNTA 1LDJA 1OMIA 4UUTA 5DDGA 4KR3A 1MGQA 1YS7A 2EB7A 3H0GJ 3K6GA 2O61A 1A6IA 1AVZC 3ZQGA 2FZCB 2LSOA 4BXXJ 3M1CA 4QWQA 4IRIA 4JS5A 2HZDA 4Y13A 3VYUB 4YCUA 2M34A 1FIAA 3OR2C 4UHTA 4MQVA 4V2SA 4B3AA 3TP0A 3HOTA 4YCWA 4WX9A 2A7YA 2FEZA 1DDNA 1V5GA 2MC4A 4HAMA 2R7WA 4XEOA 2P7VB 1NEBA 3O8GA 3PSFA 4CRIA 4B9WA 1H9TA 3H3UA 1U5TA 3H9GA 1ZYRF 3CCUQ 1I6XA 3KEQA 2QUFA 5LEKA 3MZHA 1IN8A 1YITI 1QVFP 5LJ3h 2MC3A 4CH7A 5GAOm 2KROA 2KXCA 2RQVA 1M1EB 12ASA 3NENA 3VRYA 3M0RA 3RERA 2CJJA 3A2KA 1QPMA 3A0BC 4Q48A 1IZ1A 1TUDA 5GAOn 3G1ZA 3UA7A 1BA5A 2F4MB 4G7OF 1GHCA 2ESWA 4G85A 5KK1A 5LD2C 5GAN8 1S3JA 2NOJB 3X24B 2JA8J 1KMMA 1D3YA 2DA6A 2LFBA 2J05A 3JSCA 3BJOA 2O9LA 3H0FA 4J6WA 4DBHA 3CCVA 3M3YJ 1YJ9T 2Q5HA 1TL8A 1K4TA 4K87A 1CKAA 1ZAOA 2M1BA 3VUBA 1J09A 4PDKA 1AD5A 2RD1A 4C92G 5J3LA 5AIPA 5FKMA 1VQOI 4FCYA 1I50J 4Y4RA 4BL0B 4FX0A 3IL2A 2M5WA 4YG2F 1FSEA 2LR8A 2LP0A 1YIJI 2QTXA 1ONVA 1QCOA 4YFXF 2JW4A 1JTYA 2COZA 2XRLA 1UHSA 2W1OA 2Z33A 2OJ2A 5E79C 4EO4A 3CMEQ 1W5SA 4WXDA 1D0ZA 3K1PA 1Q1HA 2A28A 3DCFA 1M90R 2AKKA 4PJMA 2ZPGB 4M7DF 2O3FA 4XOPA 4A69C 3QYEA 3CEYA 4M7AE 2K5IA 1YGBA 4UP8A 1A5JA 1YJ9A 1VQ5I 2IA0A 3N4MA 1PD0A 2A07F 1WFWA 2KFDA 1YFHA 2V1RA 2ZXFA 5K1PA 2GFAA 6PAXA 1A0NB 3K7AJ 2OTJI 3FBNB 3EYIA 2O4XA 5FFXA 2KRCA 4N4GA 2AMCB 3WTXC 4XLCA 3LAJA 1S7EA 2W10A 3WODF 2E2IJ 1WDXA 3U1DA 2DMQA 4P1WA 1K78A 1WQWA 1YE9A 2DBMA 3CCVI 4EV0A 3IH4A 4LG0A 4C30A 4AMCA 4RDUA 1WHLA 1JJ2S 3DFGA 2EA2A 4PJOA 1W5CC 2K9SA 3KE2A 4NL3A 3HFZA 3HL2A 3HKZA 4C2TA 2Y0SN 2OA4A 5CKTA 4QPQA 1VA7A 1N9RA 3DP7A 1KQ1A 5M3MJ 3GBQA 4LE9A 2CJBA 1K9MR 1IRGA 4M7DD 1U1TA 4YIIA 1XDSA 3F21A 1MJBA 5CQGA 3GWZA 4MMKA 1X1PA 3ZN0A 3TW7A 1F43A 4JOMA 1CF7B 1RC9A 1RPWA 3R07A 4TTVA 2EWNA 4QSHA 3LYIA 4PK4A 3S3MA 4HA8A 2RI3A 1JGSA 2VXZA 2EKOA 4JX6A 3KP5A 3KEYA 3L7WA 3BDDA 1KFZA 3OYGA 4M3DA 4IIOA 2V1UA 4LJZF 3BTJA 2ZO4A 4YTLA 1B7YA 2A6EF 2M8GX 3LSIA 2IAIA 3HOSA 3TREA 4E51A 1JT6A 2LVSA 3F0CA 3LFUA 2MMPA 3LSHA 4VUBA 3OYFA 4HT8A 4M7DE 3LSKA 2KMUA 3RPUD 4J9HA 3HRKA 2BZXA 3VYSB 1IN4A 2LH9A 4U7DA 1PKSA 2RN7A 3CLOA 3K10A 1QRYA 2WAQN 3NFCA 3E5QA 2IBDA 1R6RA 3TDZC 3GUDA 5F64A 2NVUB 5DV5A 4F7ZA 4HEA2 3H3VK 4N4HA 4M7AB 3CCVT 4NS5A 4LITA 2F69A 3HTZA 2R93J 2B8AA 4KBMB 4OMPA 5D5VB 9ATCB 5LJ5f 1KD1U 1ASYA 3VDXA 2DO3A 1OEBA 4EEFG 4X5OA 2WA0A 3QO7A 3GTJJ 3M54A 1K8AC 3JREA 2NS6A 4J9IA 1X43A 4XMYA 1G59A 2AQFA 4IXAA 3FRNA 2JMWA 4PLIA 4CH5A 5HDGA 1VZ0A 2ZINA 4K86A 2DYSH 2O31A 2PMUA 2HDCA 3CCLT 3HOZJ 1SD7A 3HRSA 1UE9A 2QM3A 1W7PD 2G6FX 4LFUA 4KUDK 2D2WA 1GV5A 2HWVA 4G8XA 3A31A 4M9XA 1BC8C 2PEXA 3M07A 2NS8A 2PU9B 2VQLA 3F9KA 3CCJQ 4ELZC 2FVUA 1TT0A 2JSPA 1KU7A 3RR6A 3MMYB 1USYC 2HPMA 2QYOA 2W48A 4H2YA 4NQWB 2ZJQF 5F0CA 2LK2A 3OW2A 2CZ6B 5ICGA 2ECBA 5L3DA 3FM5A 2BZ8A 3M0UA 3L00A 3W6VA 1DQUA 2EFIA 2F5FA 4BY1J 3GF5A 1GCPA 1IXDA 2UXXA 2VQCA 5HNFA 3F22A 2E41A 4JPBW 2ZMEA 2VXDA 3ABLH 3SB2A 2RK2A 3L2RA 3VQYA 3NETA 3HYIA 4ASNA 1HK9A 1YLFA 4A93J 1UHCA 1WGXA 3G3ZA 4JQFA 2BHZA 4XIDA 2D0NA 2JNGA 1JEGA 1JKRC 3G6EI 1YTYA 1FMKA 1YS6A 4A12A 3MP1A 2O01E 4S05A 1VQ7A 3MVPA 2GQQA 1X3WB 4GBQA 5I22A 5GAHJ 1XQHA 3A1PA 3HPGA 2OF7A 2L89A 2Z16A 4MZTA 3URGA 2KRFA 1N8RR 2H6CA 3BWGA 2EZHA 3EUHA 3L09A 2D9TA 9ANTA 2FU4A 2H94A 4RMNA 2DPUA 5D4SA 3FEOA 1ADYA 1YHQA 1XGOA 4LOCA 3I59A 2NOGA 2E1CA 5L3FA 1W70A 2IIMA 4FYYB 2XV4S 2EPFA 2PMHA 3QODA 3U1KA 2FBHA 1ITYA 1DPUA 3A98A 1OCZH 5GTHC 4J83A 2RHQA 2DN0A 5LEJA 1WSUA 4OIQF 2FBIA 3S16J 3NTHA 2HSEB 4XRMA 1IXSB 2F1LA 3ZMUA 1X54A 1DPRA 2RPNA 4P3OA 2DBBA 2DAQA 2VL8A 1W4SA 4HZFA 4QTRA 4OAYA 2JVVA 1HBXG 2EAYA 1PUEE 4K11A 2FNAA 3I5SA 3PM1A 1LFBA 1X2NA 4D5FA 3LSPA 1PUFB 3CDIA 4ATOA 2STWA 2O7OA 4G12A 4P74C 1MSEC 2BXYA 2K3XA 1B70B 2O9SA 2CUZA 2QSGX 3PVQA 5I2SA 1VQLT 4WXCA 2YLCA 4D0PA 2NVTJ 1VQ4I 4U88A 3G6ET 4AD9A 5FU7B 1Y0UA 5EF6A 1NK3P 1CF7A 1FTZA 3BOQA 1X75C 3BCAA 3QYFA 1W0UA 2RH2A 1EOVA 1R0BG 4YEJA 3KYLA 2MH2A 3PQJA 3E0JB 2QDYB 3JB9I 1Y8RB 1MBEA 3PJRA 4P72A 2K3PA 3CQZJ 1PJRA 5CVRA 1ODDA 3KIOA 3QZ9B 1RKTA 3BP8A 1JT0A 2JA7J 3JRDA 2E3IA 4AWXB 2RB6A 3RKXA 2M4GA 5FO5A 1RUOA 1H3ZA 4JLGA 3U21A 4OMOA 3WGIA 1FBUA 3KLOA 2KZVA 5LGTA 1E17A 5M5XJ 1TWBA 2WSFE 2E1MC 2ODRC 1KIKA 4LG0B 3S1NJ 1K83J 2LBFB 2FYKA 1APLC 1OFCX 4HVVA 2GOXB 4XBFA 1ENHA 1BBWA 2NUPB 3I59B 1K9AA 2HYJA 1QLYA 4G94A 3DLMA 1F4KA 1AA7A 5J26A 2FSWA 3NTIA 2O03A 1YI2A 2OJED 1UGRB 3OMGA 3BR6A 3HOXJ 4BGDA 1LNXA 1KOGA 1G3SA 1B76A 4UPAA 4LB5A 5KCOA 4M74A 3GPLA 1HA8A 1YIJT 1RUWA 1YFNA 2L3SA 4HNTA 2R57A 2VKVA 1YYVA 2UXNA 3TO9A 2V1XA 1WCMJ 3WU2C 1VQ4T 1V3FA 3E6BA 1RIOH 2YUOA 1HW1A 1XNIA 4KR2A 3HSRA 4YREA 1FBQA 5ICCA 2KIQA 5CKBA 2VLAA 2LX9A 5FRNA 4A4EA 4F93B 3CXCP 3A32A 1BIBA 4HCCA 4PNOA 2YLBA 2MI6A 2LCSA 1E1OA 2XAHA 2ROLA 2W0ZA 5IHKA 3OIQA 2QQBA 3GTOJ 1KA8A 3K4JA 5IP6A 2RN8A 4BI8B 2DQ3A 4Q15A 2FJ1A 2PMEA 3CUOA 2WY7Q 2PQ8A 3HFNA 4X9CA 2NVQJ 1B9NA 1M3BA 1RKWA 2WB1A 1JXMA 2JT1A 3HB9A 1KQ2A 3W3SA 3FDRA 1ZSZC 2L9SA 1IRZA 2IS1A 2DMUA 3KLNA 2V8JA 2Y9ZA 4D7NA 3BZCA 4RG8A 1H4SA 2DZCA 1QU3A 2R7FA 3LAPA 1PUFA 2F5KA 1LE8A 4NDLA 2DBKA 4HQMA 2DE0X 2XD0A 1OYYA 2J6FA 5KYUA 3OYHA 3S14J 2PFBA 2A6HF 2LTPA 1CKBA 3QPLA 4DW6A 1MBJA 4YRKA 4M3BA 3RL6A 1Z7LA 5GAN2 3JCMJ 3FXQA 3KZIC 5EG0B 1JXSA 2HL5C 2V79A 4RM2A 1B7TA 3MPUB 1TWHJ 2DI3A 3HRMA 2EA4A 2ZJPF 1QP3A 5C0MA 4CH4A 1JUMA 2VV5A 4JJDA 4PCQA 4ZTUB 1HD3A 2Y4YA 2IA1A 3CD6Q 3RIRA 1N27A 3GTGJ 1IUYA 1WPKA 2ZPHB 3CXCA 4XKVA 2CDTA 2FB7A 3S15J 4IL6C 2WWYA 1KK7A 2F2XA 1WGSA 3UGQA 2G9WA 3S8PA 3HOYJ 2JS0A 4OLFA 2IGKA 1WI9A 2X6OA 3VRZA 2COBA 1ARKA 1K0XA 2WAQA 1IO6A 2M51A 1E0EA 5LJ3e 2HQNA 5EJCA 2E1OA 3ZQCA 4LN2A 5LHIA 4ESFA 3EFRA 2VUBA 4MTDA 4NL2A 4G6TB 4D8KA 4IEJA 2I0NA 1ETYA 2ZT6A 1V29B 4I7HA 5EGOA 2O2OA 5EC7A 3PGGA 3GZNB 2HKQB 4G9YA 5CO7A 2FOWA 5BMZA 3QOPA 2RM4A 2JVGA 5K1YA 2ZPFB 2ALYB 2CFOA 2CSOA 3M57A 3FIFA 2V9PA 3HP9A 4HNUA 3HOVJ 1P7JA 4E7LA 3WE3A 3M9QA 3JB9G 1LB2A 4IOAF 2HYFA 4JBAA 1XSDA 2EH3A 1SPKA 4C0GA 4TQDA 4E47A 3JCMg 3ESWB 4M9ZA 2ZPBB 2LDMA 2F48A 3UPUA 1K73C 1B4AA 1JJ2P 2DJNA 2NS0A 5LJ5e 1B1BA 2JN6A 2Q8KA 1TTYA 2E71A 3W2WA 2XDDA 2E35A 4R8HA 5GAOq 1UDLA 1M30A 2JM9A 4B8XA 5GJWB 1QHHD 1G5HA 3DWLE 2Q7HA 2EPDA 2PLYA 3V7SA 3G7ZA 4YRIA 2JK3A 4I02A 4CCJA 3J7YJ 1DJ7B 1HW5A 4IRGA 2FF4A 3MQ0A 5IXFA 2P5IA 5B5EC 2RHZA 1VQOT 2MBFA 2YS9A 3QYBA 4B4CA 3ZQHA 4FSXA 5KCMA 2NNNA 3I0TA 2UV1A 3GFJA 4ZYEA 4S04A 3OYAA 2KDZA 3RKQA 2VONA 1VQKQ 5KE2A 3GIBA 1VQPT 5F08A 2R7TA 3A7RA 4AG1C 4LD6A 4PJOB 2J3LA 1CQTA 2M02A 4R56A 1ABQA 2CIMA 5IP9J 1MMDA 2NS7A 2QKMB 1LPQA 1OR7C 4X1EA 2HEOA 4YRCA 1RI0A 2GTOA 3VS6A 2AKWA 1YNZA 1EIFA 2XGXA 2FQ3A 5LLQA 1QMCA 1QWFA 1MJ9A 2HU9A 3GFMA 3I56A 4P75A 1MNEA 4XLFA 1SHFA 1TUCA 1SG5A 5IT9E 4DYQA 1GCQC 5GAEJ 4QVZA 4UP9A 1XMXA 3HG9A 2YUPA 1IGNA 2Y30A 3BJUA 2LQWA 2BY2A 1ACIA 3G1JA 1G6NA 3R0JA 4FYVB 1VQNT 4EX5A 1LEAA 3REOA 2LJ0A 3V8KA 1S5LC 3A7UA 2IXSA 4CHUA 1WU7A 2XAJA 1X3ZB 3MF1A 2XI9A 2R7OA 4ZTFA 4K88A 4TQFA 4OMLA 1XGMA 2DXUA 3IRQA 3P8YA 2CJAA 1M2OA 3JCMf 3EQLF 3VYHB 4YCVA 3P5JA 2QQ9A 5BS6A 3B73A 1X58A 1Z7UA 4XTWA 4PFZA 3F8CA 1FMWA 2OCEA 2CKKA 4LK0F 1N78A 2Z2SB 4IHXA 1Y0MA 4IUUA 2BZTA 2JA2A 2CJ9A 3OYCA 2IG0A 3SDGA 1CSKA 4ZGJB 1MUZA 3NARA 4H4KC 2LRQA 4E7ZA 2OAWA 2WB1N 3W2VA 4KGXB 1XMAA 3FXMA 3CUQB 1Y71A 11ASA 1JJ6C 2ED1A 1IRXA 4XSZF 3HKSA 3LW5E 3MAJA 2ETHA 3OYIA 4QKUA 2JZYA 1Z91A 4ZGDB 4HF2A 3MD2A 5J40A 4LMYA 1YJWI 3FHNA 4OB3B 2F4IA 2Q2EA 4YRTA 4L6V5 1I1JA 1IHVA 4MDXA 4J9EA 4LXCA 2E34A 4FE4A 2BY3A 1AWCA 1YITA 1W2BP 4TWAA 2M87A 2DVJA 5EZGA 2RQPA 2Q7GA 4O3MA 3CP2A 1FY7A 4HDUA 3I4NJ 2KRSA 3BDUA 2Q5IA 1D0YA 4JRPA 3FXLA 4L9TA 1BBYA 4RAZA 3S3NA 1D3BB 3NAUA 5L8RE 2P0LA 5KAIC 4HWTA 4M4ZA 3T5XA 1I1GA 4A6DA 2CUBA 2QEXA 2ELJA 3IWFA 2HGCA 4MNUA 1RIQA 1VQKI 2XB5A 3UATA 4D7MA 2D45A 1P92A 1RESA 4CA0A 5M5YJ 1NYGA 4BWAA 2V1DA 2XAUA 3V8JA 3HOUJ 3S1RJ 4LVLA 2BW3A 2FRYA 5A0DA 2XC7A 1SSHA 3RQ4A 2CP7A 4LDUA 1HKSA 2A3LA 1XG1A 3DQVC 1RABB 2VIXA 5C52B 4A54A 2DU5A 3TOAA 2CMPA 2WBMA 3MN2A 4IPAA 4M78A 4B43A 3NRVA 2E5ZA 3S17J 4RTZA 3PNWC 3D7SB 2ID3A 4YROA 4NBQA 1RAIB 1TWGJ 2JWTA 2PBIA 1RI7A 2EJ9A 4E6RA 2K3YA 1ATIA 5J6XA 4YRSA 1N6AA 1HDDC 1HSQA 2YUNA 4JYKA 1UJYA 4DOWA 1P6RA 2HTJA 4HW0A 5GMKj 3DLLA 4EDUA 1W6XA 3CUQA 3OIPA 4YRLA 4LD9K 2DYBA 5GAMh 4BH9A 1JJ2A 2VE9A 4TV7A 3WVDB 1O75A 2CH4W 4EIKA 1X2HA 2EFWA 1VUBA 2NAZA 2DCEA 1R36A 5CJ9A 3OYBA 5ELOA 4W97A 4FE7A 2YSRA 1H89C 1DUXC 2VGMA 1VQ7Q 3VOEA 4EGZA 3BG3A 2GA2A 1BI0A 2KSSA 1UMQA 1WJDA 2D1HA 3DU5A 2HAXA 2GAUA 1MSFC 3CCSI 3CD6T 2X48A 4ZYAA 5I11A 1V55H 2VE8A 3DBHB 1L3LA 3TEEA 5E18F 3BT9A 2D8HA 1G3TA 3IAM2 4MTEA 1ZLMA 2LNVA 2HYGD 4UUSA 2JJ7A 2PVOB 1YJWQ 3TEHB 3BZ6A 1JXOA 2ROTA 2E5NA 5D4RA 4DBFA 4KA4A 3HRUA 4FQGA 4UY8I 2J6OA 4GLMA 1IDZA 3GW2A 1KQ8A 4LD5A 4XQFA 5K7FA 2ODRD 3ULQB 2FQ4A 5DLOA 2AHQA 3H36A 3JR9A 1ZSZB 2XB0X 3M5AA 1W36D 2OTLA 2EZKA 4PJJA 3FZVA 4NQWA 2XHCA 5J1UA 3D1NI 2F5EA 5CKEA 4KIFA 4Y17A 3BR2A 1EH8A 3M1EA 5HOOA 1I39A 1YJNI 3LMMA 1SFXA 3U23A 3G71A 4M3FA 2BY0A 1B9MA 1YITT 1YWPA 3FX3A 1KU2A 2ME6A 5JLXA 3TW6A 4Q5WA 4RKUE 2CH0A 1J75A 1YI2I 2F5TX 3OS1A 2W84A 2R5MA 1EH6A 1VYUA 2EBIA 2DA4A 2VXEA 2VT3A 2OTJA 1OU8A 3SWNC 5JFRA 3MHXA 2PZ1A 4LIVA 2DFHA 3JRZA 4F91B 2P4WA 3DSQA 3VB2A 2XICA 5H20A 1OOTA 4XN0A 4FYXB 3OBYA 3RMQA 1QVGS 4BDZA 2BKDN 3CCST 1NHAA 1FBSA 4XRSA 1Z6RA 2EYQA 3M4GA 4CI0C 3ZQQA 3GTMJ 1J9IA 2JMCA 1LFUP 4A63B 3KETA 1I07A 4A5NA 1IN5A 3EPZA 3K4CA 2LQKA 3X20B 3GVAA 4HX4A 1P2FA 4PJNA 4BB7A 4D6WA 1R5GA 1VQ6T 4HCBA 1M1KU 2CQNA 3JW4A 4FW1A 1NTCA 4YIFA 4L0ZB 2RC4A 5BQTA 2DJQA 5LL6S 4Z2YA 4LDVA 1X1DA 3SHFA 3CCEQ 4ZYHA 3GNFB 3QYHB 2F5VA 3VS4A 4ZGEB 5HLGA 4JJCA 3DKYA 3I4PA 3LWFA 1X69A 1VYVA 2LF7A 2F4OB 2LMDA 2HPIA 1OZ3A 1Q86R 4EJVA 1F9NA 2QEXQ 1WNLA 2K5FA 4KUIA 1POGA 1ZH5A 2O8KA 4M71A 4WI1A 3FK6A 3P8VA 2QSFX 3CTAA 2Y2ZA 4JP0A 1QPIA 1QW1A 2WSCE 3GFLA 2VPRA 3SEQA 2VC1A 3RZDJ 1Q82R 3CZ6A 1AU7A 2DTHA 4E7SA 4YFKF 3D0SA 3VYGA 1VQ5T 5IT9Z 5TJJA 2QWWA 1ZUUA 2M0YA 2VBWA 3E5XA 3HUGB 3FMQA 1KYWA 3ASOH 1YW7A 3F8FA 4Q4ZF 1U8BA 3G1OA 2DJIA 2JUGA 3BG6A 1XPXA 2IVMA 5J47A 5DM6F 4IX7A 3QWYA 2DK3A 2KK4A 4DZPA 4Y92A 4DJAA 1Y96A 1KQSP 1H4QA 4M3GA 2FUG2 3I3LA 3QJ6A 4HQEA 5IN1A 2MG4A 1JJCA 3HXZA 4XK8E 4LUEA 1WFXA 1RL2A 1KU9A 3OQ5A 1XDUA 2WAEA 2K02A 2OD5A 5JHFA 2R5ZB 3CDLA 2EJFA 2XAQA 2YXYA 1ETQA 4RM3A 4BKXA 1AKHB 4X9DA 1K9MC 3E3VA 1K4US 2FZKB 5KNNA 5HDNA 4RQFA 1U9OA 2EIMH 3Q0VA 4P55A 2CH4A 2HBWA 3CCLA 2X51A 4Z89A 2P5KA 2RVCA 3R6OA 4J9BA 3CO6C 4V2FA 4MEXF 1FYLA 2DTZA 1N25A 1JHFA 2ID6A 4WXHA 2CS3A 4RLFA 1SD5A 4DQ2A 4A3JJ 2ZGWA 3CMEA 1NG2A 4XM3A 1AKHA 4AUXA 5GANg 1OU9A 2R7DA 1DU6A 4GO1A 1M1FA 3A74A 3VSLA 3DBRB 4OB1B 3CCVQ 2HMAA 2VJ5A 3HPHA 4PG3A 1IXCA 2O9VA 2PVDB 4M6YA 1ETVA 3FWEA 4A53A 2FNPA 2YHTA 2LREA 4NC6A 4U0WA 1SMYF 2GXAA 1OCTC 3L2WA 3PNYA 1W0TA 4I2OA 3VU3C 5DY9A 4FT2A 2P7CB 3ABKH 3HOWJ 3OD1A 2HZTA 3VS2A 3VBBA 1NJIU 2OCCH 3PCOA 2AIRB 1OYIA 1RAGB 2ZNIA 2Q1ZB 2HVSA 4FYWB 1VIEA 3DKWA 1NEGA 4Z02A 5GMKm 4BJ6C 3JCMb 1Q82C 4IRHA 2HOEA 2M45A 1ACMB 4C8QF 3NHNA 5BPIA 4JZ3A 4PHCA 1O3TA 3HRTA 2RI5A 5GAOl 3G6EA 1Q86C 3K4BA 4ZC3A 5E17F 2OTLQ 1EIYA 1QZYA 3A02A 3GEZA 3SXYA 4RB2C 4OVAA 4J8OA 3CCMQ 3IAS2 4C0FA 3A5ZB 3V4GA 4YFNF 1WXTA 1O9SA 4EJWA 2NUTA 3HRIA 3N5BB 3IKLA 5LHHA 4YRVA 2QK0A 4MEYF 4KQEA 2E65A 2IGMA 1O7LA 5E3OA 2R92J 3UNGC 4E7HA 3ZMDA 2FE3A 2ABLA 3CPWS 1OX9A 4BE2A 1Q81R 2HI3A 4UNOA 3A8MB 4BY6B 4IZZA 2ZC2A 2P81A 2BOLA 4LVKA 5DD8A 1NLOC 3RCOA 2DQRA 3TO7A 1Q7YU 1ADJA 3C3WA 4YIRX 4P9UA 5J1YA 2RHUA 3CCJT 2DERA 3CMQA 3OSGA 4M7DC 1BC7C 4BEHB 5F27A 2OAZA 1I3QJ 3OYLA 2DMPA 4OGCA 3FJPA 4ENMA 2V9KA 4UUSB 3S2DJ 5FU6B 2QCOA 3TQ7P 3ERED 4I0BA 2XSJC 4J19A 4XU1A 1T56A 1IF1A 3OMCA 1G3WA 2DW4A 5IT9K 3IRRA 2HNHA 5D5XB 1TWFJ 1ZK8A 3A8LB 3OYYA 4BY6C 1JUPA 2AMCA 1PRMC 1MBHA 3FDYA 1AOYA 1SSFA 4M9SA 2LLKA 3LSJA 2D0QB 3KP3A 3QDRB 1EFWA 2GXGA 2F5DA 4KICA 2IA2A 1ZQ3P 3UF4A 3ERMA 4QW2A 2VUMJ 2MLGA 5GPAA 2ZXIA 2A37A 2X9HA 2DXCA 5I21A 4ZYGA 5J8CA 4RMOA 3HGGA 2KL4A 3BQYA 1OCCH 1F5TA 1Z9QA 2QBYA 2K9QA 1JGGA 3C2HA 1RZ4A 2WY8Q 1U0JA 3HXUA 3I56T 3TMOA 3X26B 2EQIA 2K4JA 4UUVA 2KI7A 1IN7A 1T0FC 6AT1B 1YI2Q 2OTJQ 3UA6A 4J15A 2D1XA 4OMNA 4BHPA 1FYKA 5HODA 3CMAI 2F2VA 1ZQ1A 3K4LA 2LT4A 2M0MA 2X4HA 1W7PA 3IP4B 3JRAA 3A5ZA 1U5SA 3T1BA 3TBIA 2H8RA 2LKSA 2ZZFA 4WJ4A 4PJLA 2HCKA 1JO8A 1Q7YR 4IHWA 1MV3A 3QSUA 2QHUA 4U0YA 3U9GA 4XTYA 1MHNA 2HDDA 1MIJA 4C5IA 5KYWB 4BQQA 5C51B 4C92A 1J2XA 3KPHA 2KDOA 1UFFA 2BZYA 3UDCA 5B66C 2R5YA 5KYYA 3G6EQ 1S72T 1VQLQ 2ZCEA 3M9AA 2NVXJ 3QP5A 2KYMA 3DKMA 1LYLA 3PCOB 1WI7A 4N4NB 2Z3YA 2KZGA 2JUCA 2R7XA 2A0FB 1VQMA 2F6CA 4KGVB 1Z9ZA 4AC0A 2DKGA 1Q95G 2LCCA 5B1BH 2SRCA 3M0TA 3HSEA 4N9HA 1K8AU 3OV8A 3K70D 4QQDA 4FHTA 3EG2A 2LG4A 1TSFA 2EV0A 3D5SC 3QUIA 3EGDA 2I4LA 3RGLA 2CREA 3RPUA 3CC2Q 1P4XA 3MZ8A 2R58A 5HK0A 2I4NA 4EMGA 1XTAA 2V6CA 4ENJA 2VQHA 4M75A 4I99C 1XS9A 4AFQC 4EMKC 2KLOA 5D5WB 2COWA 1SERA 1KQ0A 3PMIA 2NWMA 1ZUYA 3H0DA 2A08A 4QPOA 3NPFA 1TWCJ 2RGVA 3KP4A 5A0GA 4XKBA 3AHUA 3VSKA 1UGSB 2D1VA 3EYYA 3JSPA 2MK5A 3EGXB 1QO0D 1KC8R 4ZIBA 5DD4A 3BR3A 1O3RA 3K69A 3AL0C 4UVCA 1S9HA 3CCUI 1X3UA 1ZGAA 2VXFA 2X1DA 2FX0A 5E3IA 4M78G 5IXBA 4C8QB 3EDPA 4RB1A 3ZL7C 2JQ7A 1GRIA 3M4PA 1F1ZA 4AVZA 2E7WA 3HTRA 1FXXA 1S72I 2FG0A 4HWSA 5HDKA 4FSSA 2DT6A 4R1HA 1ZG1A 3LA2A 2DL4A 2EINH 3CCMT 3G4ST 1B3QA 3X28B 1OV3A 1I27A 3O8HA 1GFCA 1Z05A 1YIJA 4F7UA 1X2KA 5HLHA 2DF6A 2DAOA 3IKMB 3T0YA 2PG4A 2MH9A 3QWXX