3V7SA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor 0364
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
total genus 98
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7sA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7sA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7sA02
3ZMSA 1YLFA 4G94A 1HQCA 5E1XA 2AKWA 1T39A 4PCQA 2QVOA 4CGZA 4CO8A 4L87A 1ZLJA 1WQ2A 1E2XA 4OINF 3M4PA 2MD5A 4A54A 2ZJ2A 4XRFA 4K88A 4QVCA 4M77B 4HWSA 4M75B 2JN0A 3D5LA 3L9FA 4ZZLA 3E6DA 3U2RA 4M74A 2ETHA 3GZ6A 2DPDA 1P2FA 5L3DA 4C92G 4XSXF 2VE9A 1YCYA 1G3YA 3JCMP 2ARUA 4BYYA 3KZZA 5GANg 5LEKA 5D8KB 1B70A 3IRRA 1ZG5A 3RDIA 4YYEA 1BI1A 4A0YA 2XV4S 3VB2A 3JCMb 1B34B 1YG2A 2MLGA 2UXNA 2TDXA 4RB2C 1LJ9A 4M77D 4G8XA 2VC1A 1HKQA 4LD5A 3DXJF 3REOA 3QO3A 5D8LB 2PQ8A 4KIGA 2HTJA 2IY5B 2GAUA 2FRHA 3CDHA 4BHCA 2CYYA 3HXUA 4G6QA 1KQ1A 1NYQA 3LQQA 4ASNA 3VODA 2FU4A 1TBXA 2FBHA 4A5MA 2K27A 2WWYA 3P8VA 4QLCU 1D3YA 2YU3A 3WU1B 4G7OF 3I4PA 5IT9K 2EK5A 3B73A 1X56A 4P55A 5K1XA 2ZTGA 4Q15A 5FO5A 4MHGA 1XDSA 4J6XA 3FXUA 2QM3A 3A7AA 2F2EA 2DAOA 3HTSB 1MZBA 3FM3A 3GXOA 5BQTA 1X3UA 4RAZA 1EFWA 5LJ3j 2G7HA 3LA2A 3WTSC 4IRIA 4RQEA 2XAFA 5JR3A 1U1TA 3HOSA 3G1ZA 3RACA 3I64A 1W7PA 5FD6A 2QQBA 1BI2A 4RGUA 1BBYA 4YRGA 3IG2A 1JGSA 3KLOA 3LSQA 1FY7A 1PUEE 4RB0A 4NQWA 4L5IA 4EJWA 2ZCWA 2J5OA 3WGGA 3TEGA 1G6NA 3P9CA 1S29A 3HFVA 4ZTUB 3K2ZA 4PJOD 5E8GA 1ZGAA 5GAOq 4I7HA 2DTOA 4R8HA 1KYWA 1OR7A 4RS8A 1FSEA 1GVJA 1PP8F 3V8LA 1K78A 3F8BA 5JI6A 4P71A 5C53B 4RDXA 1H9GA 1EH8A 4I01A 2V9VA 3E5UA 1ZRCA 2PBIA 4PHCA 1G5IA 2MH9A 1USYC 4MQVA 1XSVA 4TQDA 4U7DA 2EV5A 4M7AF 1LNXA 1D8JA 2ODRD 4YRPA 1BJAA 1RIOH 3NENA 1TQIA 1BOAA 1D5VA 2P5IA 2RB6A 1LJOA 2XAQA 2ZO4A 1ZREA 2PEXA 2DQRA 2F5FA 2ZNZA 2YPRA 2Y0MA 1QBJA 4TVAB 1FC3A 1I1GA 5GAMd 11ASA 4LK0F 2ZR3A 1MKMA 3QRFF 4HLXA 5GAOn 2LDUA 5CVIA 4M78C 1NJ8A 4C92F 1KA8A 3TKYA 5E8IA 1YW7A 1BIAA 5GAN6 4OMYA 4HBLA 2RC4A 4J6YA 3UGQA 4HDUA 4NOYA 3AAFA 3KP6A 4I2OA 3RF1A 4RGRA 2VOOA 2W85A 4Y13A 3IALA 4Y15A 4X9DA 4A6EA 2VXZA 3BJAA 4TV7A 1AWCA 3CO7C 4K87A 3RKYA 5ILUA 3RPQA 3N4MA 1J9IA 2YLBA 4OOIA 2ZXJA 2ZMEB 2NNNA 2K57A 2Q0OA 3R60A 1LEAA 2V6CA 1TQMA 2AXLA 1DUXC 1WNLA 2Y90A 4F7UA 4ENJA 3TDUC 1XB4A 3WG9A 3PZCA 5DCMB 4RAYA 1HW5A 5BPIA 1WYDA 1U2WA 4XTYA 1DPRA 2H6CA 1KQ0A 5GMKm 1G51A 1GGMA 3OD1A 1ZN2A 1YO5C 1TTYA 1ZGJA 3EFSA 4P3OA 4PJOC 1Z6RA 3F8MA 3FMQA 4LG0B 1Q1HA 2DK8A 5FLXK 5GMKh 1MD0A 1TNSA 4FHTA 4WCGA 2VOPA 5DEQA 1J75A 1G3WA 4L0YB 4RCCA 3ABTA 4P75A 4ZTZB 3SWNB 1IN8A 3G73A 2DK5A 5ED4A 1ON1A 2ZCEA 4EX5A 1R36A 1T38A 4M9SA 5BS6A 4HOBA 2MC3A 4PGGA 4PJOA 5D4SA 1OYYA 3K1PA 1Z9CA 3QHSA 1ZAOA 4KA4A 2QUFA 4P9FA 2LF7A 1D3BB 2DT5A 3JTHA 2RHQA 5E20A 4U0YA 1EV7A 4YRLA 5K1PA 2C8MA 1QGPA 1SFEA 5DD4A 1BC8C 3CUQB 1NJ2A 1UB9A 3TO9A 5CVVA 4AIJA 5GAN5 4JBAA 4P3PA 4Y17A 4CS2A 4A6DA 2IY5A 5GAMh 2D1HA 3JCMh 3WTZA 1G4DA 2EV0A 1ON2A 1XMAA 1J5WA 4EQQA 3GVAA 1DDNA 5J8CA 2OAZA 1P4XA 3WTWC 2L4AA 3RKWA 3ROUA 2XVCA 2R3SA 3ECOA 4IJAA 2UWMA 1ZRFA 4LJZF 2ZZFA 4EGZA 2HYGD 4YFXF 4G9YA 2DPUA 4P73A 5TJJA 1XGNA 5LGNA 2HR3A 3JB9D 2PJPA 4P71C 4C8QD 4H2YA 5ICFA 2MA3A 5LGTA 1FBSA 1TW3A 4YFKF 4EJTA 4ON0A 3NRVA 4MTDA 4IVNA 3L4GA 3MEXA 3QP6A 2A6EF 2O61A 2V1DA 3BDUA 2OQRA 1WLEA 2FMLA 3LSTA 3KP5A 1EQRA 3TEHB 2FEZA 5HLHA 3NELA 1YQAA 3KE2A 4P74C 5LGUA 3ZMZA 3ZN0A 4MMLA 4XU3A 2WTEA 5LHHA 1FSHA 3ZMUA 4L0ZB 3J81K 3REXA 2RVCA 3PCOB 4NL3A 3KP2A 2P7CB 2YX7A 1XGMA 2O0YA 3QPHA 4EM2A 4J5YA 4M78F 1KOGA 4M71A 2OZ6A 1HSTA 3JCMe 5BMZA 4M77E 2IP2A 3BW1A 2P5VA 3ICAA 1U5TA 4EMKC 2UXXA 4Z2YA 2H6BA 3L7WA 2DQ0A 3F6VA 3E3VA 3GZ5A 3E6BA 5EEGA 2DTHA 1U3EM 3IKMB 2DO7A 4H2UA 4TWAA 1W7PD 2H94A 1Z7NA 4K86A 1R7JA 4F7UF 1DP7P 3RUXA 2PMHA 4OU0A 5L3FA 3KCCA 3KP4A 3L4GB 2OBPA 2UZKA 2E1HA 5LJ5j 1OPCA 4PGHA 5DCFA 5F5WA 3V4GA 4A2UA 3G3ZA 1R1UA 2XKOA 1L0OC 3H92A 3WGIA 3HY0A 3HSBA 2RNJA 1WQWA 1SETA 5HDNA 2XGXA 2ADUA 2QTXA 3A31A 3DSQA 2ALYA 1RNLA 1EIYA 2ZZEA 1TLHB 3GLXA 2M1BA 5HS7A 2HFHA 4H2XA 3E6MA 1XGSA 1R5GA 4CICA 2L01A 5JVTA 1CGPA 1OMIA 3WE2A 3BY7A 1I5LA 2M30A 3M1EA 3IKTA 4M78A 1WU7A 1B7YB 4ZYEA 3ULQB 3J81Z 4C8QG 2HDCA 3JW4A 2EFOA 3I71A 1J7KA 1H4VB 1QE0A 3FMRA 3BOQA 1K7AA 2FBKA 2V1XA 3FF5A 1QQIA 1YTYA 4I98B 4XBFA 1LB2A 4HX7A 4A12A 5CVJA 1QF6A 4M7AB 3TOBA 3I59B 5DUIA 2DQ3A 3A32A 1RIQA 2FOKA 1JHHA 4M7DD 2CFXA 1HSJA 4BWAA 4UXNA 5GAOr 5JFRA 3BFMA 2NNYA 3BY6A 2ZBKA 4YRQA 3LFKA 1LNWA 3CUQC 4HWPA 2EFQA 2DTIA 1ZRDA 2V79A 2KJCA 3RKXA 2DJZA 2YLCA 2GIVA 4OIPF 2LSOA 3SWNA 4EM1A 2BBYA 5LJ5e 5GAN8 3ZMTA 5DDGA 3M9AA 5HLGA 4B09A 4V2SA 5ILVA 3WODF 1YFRA 3BPVA 2PMEA 2Y48A 1I81A 2E1CA 1H641 4AH6A 1WWXA 1RUNA 4IHTA 2AS5F 3QPTA 5KVRA 2A61A 4KR3A 1IF1A 2YR2A 2DKGA 4M6XA 3MF1A 4O2DA 3JCMW 1J2XA 1ZG3A 4O6JA 3KFUA 3QO7A 2D45A 3I7FA 2ZMEA 3JSPA 2PLYA 1V3FA 1N9SA 5HS8A 4M78G 4WJ3M 2J3MA 4HX8A 3Q5FA 1O3RA 5KNNA 4M6YA 3HIFA 3SHFA 5J8FA 2VBXA 3JCMd 5J6XA 4MGRA 1Y96A 1XCBA 2O03A 2PI0A 3KLNA 3DFGA 4PJOB 2I2LA 1FLIA 4KMUX 3QU6A 3AHUA 2EWNA 1B9MA 4AVPA 3UGTA 1IRGA 2E65A 4X9CA 4PJOG 4BH9A 3SWNC 1FBQA 4M77C 3ML6A 3BDDA 3E9HA 3LQRA 4GGGA 4OLFA 3F72A 2RHSA 4XU1A 1NJ6A 5GMKe 1KU9A 3UFGA 1ASYA 3JB9H 5LJ5g 4ZIBA 3LC0A 4WF2A 2ISYA 2E64A 1QZYA 5LRRA 3E6CC 4M77A 1FOKA 4ENKA 5DCMA 3F3XA 4F7UB 3JCMc 1Z05A 2DI3A 3KFWX 3M8EA 3V8KA 3IKLA 3KETA 3HXVA 2P6TA 4TVYA 3C18A 1R23A 5F6FA 2FSWA 1FT9A 2DQLA 4Q48A 3IWFA 1XD7A 2ZNIA 2XHKA 3EYIA 2COMA 1J5YA 3BZ6A 1PP7U 3R4KA 2EA4A 3RTRA 2O8XA 3TGNA 1KQ8A 4KMFA 5AIPA 3Q9VA 4C92A 1XMKA 4IHSA 5GAN4 1NNHA 4HF2A 5LJ5f 4KICA 1EIYB 3SB2A 4B8XA 4PDKA 1TQPA 1KU3A 3CMQA 2J5PA 1IUYA 3PCOA 1VQZA 4PG3A 5DD8A 3J7AO 3HRUA 5K5OA 1SRYA 4XU0A 5H6QA 2RHSB 4HWOA 3WGHA 3RERA 1KQ2A 4UP7A 4Q47A 1HK9A 1B6AA 4PZJA 1IW7F 4H2TA 3K9TA 2YHTA 3FWEA 3HRMA 1U8RA 4KIBA 2RQPA 1BI3A 3GW2A 4Q5SF 1ASZA 2QBYA 3HFNA 2ZT5A 4YRFA 1ATIA 4M75D 1ULYA 4L18B 1JRIA 1LDJA 5GMKl 2VT3A 1KQ9A 1B7YA 1S8NA 4KYWA 2MLKA 2NS0A 4XEOA 1MGTA 2A3SA 3HXXA 4XTWA 2Z33A 4I0BA 4A5NA 4HW0A 2STTA 1Z7MA 4OIOF 3DP7A 4M9XA 6PAXA 2QYOA 4ZYGA 2CSOA 3RYRA 2KIFA 1LEBA 5TRDA 1Y0UA 1ONVA 4HZFA 1IL2A 3NEMA 3NEUA 5LJ5h 4UV8A 4IRHA 1GHCA 2Y75A 3HSEA 4AIKA 1IN5A 2FNPA 4YG2F 1XCVA 3PGGA 3QAHA 2KJBA 3TQNA 1GXQA 2P7VB 5HLIA 4ESBA 4YRJA 2ALYB 1Y96B 3WTYC 2E41A 2EL9A 1SMYF 4M7DB 1ZH5A 2RM4A 2H27A 2RD1A 2IA1A 1LDKB 1Z6TA 3QTCA 3H3ZA 2MBFA 5GANe 2STWA 4HYEA 1X2HA 1TH7A 1P4AA 2A69F 2X4HA 1SMTA 3EDPA 2HKXA 2EFWA 3I58A 2JT1A 4M9ZA 2F5DA 5D5WB 4M7DE 3W6JB 2JRTA 2K4BA 4FX0A 4HX4A 5C51B 2RA2A 1BIBA 2VXEA 5CJ9A 1M5Q1 4YREA 3LWFA 1F1ZA 2RV8A 5DV5A 2AMCA 3FZVA 2XTIA 4YIFA 3DEUA 2P5KA 2W57A 4YCVA 2BV6A 3IWZA 5LBQA 3HHGA 4M7DC 4BW9A 4LMYA 2ELHA 1Z7UA 1YFTA 4LFUA 2JPBA 2YX4A 4HF0A 2CG4A 4KUMA 4P9UA 1SFUA 2K7LA 5GAOp 1J0RA 3QNEA 3A7RA 3DKWA 1I27A 1T0FA 4M7DF 5ILSA 3V7RA 2EJGA 1CF7B 3ERED 4U0WA 3LAPA 2K86A 1WKMA 3RL6A 3O6BB 4PJOF 4TTVA 4CZZA 2FNAA 2ZNYA 1JHFA 1R1TA 2DZCA 4UHTA 3EUHA 4JUVA 5IT3A 1W5SA 3T8RA 2Q7HA 1IN6A 1B9NA 4LNSA 4UPAA 4I02A 4KIFA 3MEYA 3TO7A 2M8EA 4EJOA 1BBWA 2CJAA 2Z99A 5A2QZ 3RPUA 3F8CA 4TVAA 3P7NA 2Q8KA 4MMKA 3P8YA 4HAMA 3RGLA 4CS4A 2Z3YA 4KDPA 5FD5A 3F8FA 2VXFA 2ZIOA 4L5JA 2CGHA 4ENNA 4YRIA 2L02A 4KQEA 1RZ4A 1VTNC 2O6GE 4R79A 3HRTA 4A0ZA 4ZH4F 2HTSA 1PYSB 1KMMA 3S2WA 2EFNA 4BQAA 3REUA 4GCVA 4WX9A 1ODDA 2A5YB 3OV8A 1LQ1A 5ELNA 4YRKA 4Q6GA 5F1RA 4H2XB 4AIHA 4EO4A 3U9GA 3FJPA 3R61A 1S3JA 2A6HF 3BWGA 3F6OA 1K78B 3GFJA 1U6GA 2Q7GA 5ICGA 3CJNA 3DPLC 4RGSA 4G85A 1HXDA 2GQQA 4DQ2A 2RKHA 3MFKA 3BJUA 1I5ZA 1SD5A 4LG0A 2ZGWA 4I0AA 4OP0A 4LGWA 4EMHA 5L3CA 5LHGA 2OD5A 1MJBA 2KKOA 2VBYA 5HVQC 4L9TA 1LVAA 1I8FA 2ACJA 1XDUA 4X5OA 3BJ6A 5AIQA 4H2VA 3ZPLA 4YDQA 1U5TB 3WTVC 1ZARA 2O3FA 3VBBA 4C92C 2DDZA 3K69A 3E9IA 3FIFA 2C6YA 3M7GA 5D5UB 5GANh 1I4K1 2EAYA 2RDPA 2C7IA 2X0LA 1O3TA 3RESA 1KGSA 4NHJA 4E70A 1EH6A 3INZA 2A68F 1N9WA 4HA8A 4N9HA 4RMFA 4EJUA 1GXPA 4HF1A 5LJ3h 2PG4A 3EETA 1U1SA 2ZIMA 5L3EA 2EJ9A 4PJOE 2GA2A 5E1WA 1O7LA 2HKOA 2CQKA 4H2SA 1P6RA 2LNBA 4FT8A 1FP2A 4P72A 4CH5A 2LKPA 1MJ9A 4N0AA 2DVEA 3M8FA 4K2EA 5CLSA 3EYYA 4R1HA 2JPCA 4NB5A 3HTUA 1JE8A 1USSA 4M75G 3JCMV 4UP8A 2L3DA 3K1MA 3F8NA 1PDNC 4IF4A 4UVCA 2L54A 3KP3A 4XEMA 1WRJA 3QSUA 3MZYA 2ZT7A 3H3UA 2NYXA 2ARTA 2JZYA 1Z1DA 2PMUA 3VQYA 2EA2A 4F7UE 4GYGA 4M77F 2HZTA 5D4RA 4MEYF 1H4TA 3WQZA 1SAXA 2AKWB 3O2PE 3DF8A 5K5RA 1WI9A 3WTXC 2G9WA 3IHUA 2FQ3A 3QO8A 2HQNA 4GXOA 1WSUA 3KEOA 1R22A 4P73C 3VQVA 4NCXA 1YB3A 3IRQA 2XGTA 2JTVA 4YRSA 5LJ3f 4XTXA 4EJVA 4O5VA 4UNOA 5HOOA 3LA3A 1B8AA 2M45A 4H02A 3K1NA 4GYIA 4P75C 4XTZA 2XAGA 1NJ1A 3T5XA 4ZYHA 3CTAA 5GAN2 4N0AC 5GMKj 4Q4ZF 1U78A 4HV6A 2DXUA 3HRIA 2JSCA 2FYKA 1B34A 3HTZA 3JB9F 4C8QC 1R1VA 4C8QF 2H09A 3WE3A 1YGBA 3GO5A 3FHZA 3MAJA 3GUDA 1B76A 3V7CA 2P6SA 2QWWA 5DUKA 5GAMg 4TQFA 4RCBA 5GAN3 1XGOA 1B59A 1FYMA 1E1TA 4YRCA 2Q5HA 4YRTA 3BJOA 4F7UG 3TO6A 2V1UA 1N9RA 3P8TA 4XTVA 2RN7A 4KT5C 1G5HA 2KIMA 1W7PB 4CH4A 2FB7A 1YYVA 4HWTA 1HC7A 2CIMA 3TUPA 1ZHFA 3L2CA 4M78D 5GAMe 3GIBA 1ADJA 1X2GA 2CGPA 2OZUA 2DU9A 2YSRA 3W6KB 5ICCA 4M75C 4HV5A 2RGVA 4S05A 4JQFA 3K0LA 5F64A 2P5LC 3QP5A 3KEQA 1BBUA 2I4LA 1YIOA 3LA7A 2CO5A 3P9IA 4LLNA 3HRSA 1OKRA 3QOPA 5D5XB 4BNCA 2ODRC 5CYVA 2Q2EA 1UFMA 1UHMA 3VEPA 1KYZA 4YROA 3ZN1A 1G3SA 1BN5A 3F22A 1FWZA 3F23A 2FF4A 5JHUA 1O3QA 4O3MA 1EVLA 2W25A 3MCZA 4P3NA 2ZZGA 3DQVC 3RIRA 1HTTA 4YP0A 1BC7C 4PNOA 2IJLA 3FXQA 4UV9A 5A2QK 3ERRA 1H4SA 2OU2A 5GMKi 1C0WA 4CXFA 3V7SA 2GZWA 2LF8A 1MGQA 2G4CA 5LJ3e 1FYLA 5AONA 1TW2A 2D2WA 3FX3A 2QHSA 3JCMf 4M77G 3M4QA 1XSDA 1H4QA 2VBZA 1H9TA 4I09A 5FFZA 1F9NA 4YRRA 4KR2A 2L4MA 3HSFA 5LEJA 4J6WA 5D5VB 2EV6A 2XUBA 4DNCA 3QO5A 4M73A 4FX4A 1USYA 1REPC 1ZG1A 3JCMJ 3JB9I 2ZKZA 3LSSA 1YW8A 3WU0A 5BOXA 1ZLKA 1D8KA 2HWVA 4XTUA 2GXBA 3I0TA 2HYFA 3HXZA 4MEXF 3KZYA 3VFZA 1JJCB 3A5ZA 3BROA 3TEHA 2PFBA 4U0VA 1V4RA 4P96A 3SXYA 2J3LA 3CUOA 3R0AA 1DPUA 2F5EA 2BE5F 1T98A 1FYKA 2DFIA 3FXRA 1E1OA 3GFLA 2DW4A 1B1BA 4M75E 5GAMf 4OIQF 4ZYDA 2HS5A 3I54A 5K5QA 3W3SA 2IW5A 1H0MA 4L9VA 3IKVA 3RI4A 3JCMQ 2FE3A 4WXHA 3A7UA 1O7FA 5E3IA 1USTA 1IXRC 3I59A 4HQMA 1UCRA 4YIIA 2CJ9A 3BPXA 3IC7A 5GAMj 3V8JA 4CDGA 4M75A 3OOPA 4C92E 4WJ4A 1L0WA 1QPMA 2VODA 1T2KA 2IRFG 3PQJA 1UHWA 3HRKA 4YRMA 4P5OA 5HDGA 4KFCA 4CS3A 1A04A 3NETA 2WV0A 4LLGF 1I1SA 1STZA 2Q5IA 2K4JA 4HDVA 4WWCA 3COAC 2CWEA 3CUQA 1SFXA 4HWRA 1W5TA 2QENA 4WXDA 2NAZA 3MF2A 4CHUA 1D3BA 1IN7A 1O3SA 1HW1A 2FMYA 3MZHA 2ZFWA 5FGMA 1FNNA 3JB9G 5KK1A 3SFZA 4GO1A 2EFPA 3T0YA 2BYVE 3T8TA 5LLQA 4JLIA 3LAJA 3E97A 3C3WA 1JJCA 2DZ9A 1JBMA 4IRGA 4ETSA 3HFOA 1X54A 4RB1A 3MWMA 3PQKA 5GAOm 3DV8A 4QWQA 2CJBA 3HFZA 2VBWA 2Q7EA 2DU5A 3R6SA 3GF2A 5FLXZ 1I6XA 4WK8F 5E17F 2CW0F 1K79A 1NYRA 3HUGA 3L09A 1NHAA 4BHBA 1FPQA 1BI0A 4CH6A 2B0LA 4AD9A 2AMCB 4RQFA 2E3CA 1QO0D 2XAHA 4KNYA 3T1BA 1NJ5A 4BHPA 2R7FA 3VU3C 2W24A 5GAN7 1R5HA 2GXGA 4LK1F 2IA2A 2VN2A 1OYWA 2XKPA 2XRNA 2QBYB 2EJFA 4N0BA 2EB7A 1SD6A 4UVAA 2PN6A 4HT8A 1OYIA 5E1ZB 2DU7A 2KRFA 1YS6A 1G3TA 5K1YA 4YCUA 1M8VA 3ISPA 2XASA 5LHIA 1LDDA 1W66A 1TNTA 4AWXB 1SERA 1SESA 2ESHA 3C7JA 4J15A 3E5XA 4LB5A 3RJPA 1KU2A 4XSZF 3JTGA 2D1VA 4U88A 4HLYA 2EJRA 4C8QA 3ELKA 4C92B 4EVIA 4RB3C 2I4NA 2P4WA 3ZMDA 1EOVA 3JAMK 3SQNA 3SZPA 4A53A 1S6LA 3CLOA 3GEZA 4EV0A 2GA1A 5HDKA 1FBUA 3FM5A 3L2ZA 5BPDA 2ESNA 5C52B 2BEOA 3L00A 4ESFA 4NL2A 4M7DG 2E5AA 3GFMA 1R58A 3KP7A 1HKTA 2P0LA 2Z9OA 5IT9Z 5CVUA 1WQ7A 2M5WA 3J80Z 5DYMA 4QVDA 3GFIA 1X01A 5LJ5d 3JCMX 4CYDA 4G7ZF 3HXWA 4G7HF 4BXUA 3GYHX 3DPTA 4OIRF 1HBXG 2HGCA 1LOJA 3M4GA 2DTRA 2WC2A 3SZTA 3U1DA 3HXYA 4M7DA 1QZZA 1IXCA 1F5TA 4M7AC 1EH7A 4KN4X 4JRIA 3JCMg 4N9IA 2RHQB 1IRFA 2HQRA 3Q9SA 2ZT8A 3A74A 2DXTA 4M7AE 2E7WA 3TDZC 4UUVA 4YRNA 4XQ3A 2FXAA 2ARSA 3GWZA 3B02A 4XLNF 2QHVA 2ZR2A 2OQGA 2K02A 1CF7A 2DEQA 1LYLA 3F21A 5HGQA 2VT2A 2G7UA 3EQLF 1T6SA 3HYIA 1P92A 3EFRA 5D6FA 4CH3A 3IL2A 2A07F 3L1AA 2QQAA 1YFSA 1AOYA 2QQ9A 4S04A 3PFIA 4HQEA 3WTTC 4XLPF 2E10A 2VONA 4LB6B 2XAJA 4YFNF 2BGCA 5HS9A 4TVWA 1KU7A 3TOAA 2IVMA 3I53A 4M7AD 1C0AA 4H0EA 2F5CA 4M78E 2XIGA 2ISZA 1E17A 1IAWA 2QHUA 1IXSB 2OA4A 2VC8A 4LLLA 1O57A 3FMSA 4EMSA 3FB9A 3VQXA 5GAOl 2GWRA 5L3BA 3J80K 5L3GA 1HW2A 3P9KA 4RGXA 3ZQ7A 1YW9A 5CAIA 1EVKA 1KMNA 3JB9J 5D6EA 2QLZA 1RUOA 1R00A 4G6DA 4BAYA 3VQWA 4XU2A 4P72C 3HHHA 4C92D 2XROA 4M78B 12ASA 5E18F 1IN4A 2E7XA 2Z5UA 4KN7X 1J59A 2QHTA 4YCWA 3N97A 1IZ1A 2KIUA 4G84A 3E5QA 2W84A 1QNTA 1FZPB 1F4KA 1E24A 4U7BA 1W4MA 3HFZB 5GANf 1B4AA 2DLLA 1RI7A 4D0PA 1S7AA 1B70B 2FBIA 1K6OA 1ADYA 5DY9A 1P4WA 1XN7A 5FB2A 1YS7A 2VE8A 5FFXA 3JSOA 3NQOA 4HT9A 4ZZDA 4YPFA 4MTEA 4WI1A 1YFHA 4DPGA 5ELOA 1JXSA 5H20A 2QZ8A 5LRSA 2I4MA 3C1DA 2IA0A 2NRAC 2IT0A 3JAMZ 4JK1X 3VOEA 4IXAA 5ERIA 3A5YA 3UH0A 2PMFA 2IPQX 5LJ3g 2FA5A 1FYFA 5EEHA 1MDMA 3HSRA 1ZYRF 2P8TA 2ZINA 3I5UA 1SD7A 4UP9A 5LJ3d 2R7DA 4F7ZA 5I21A 4WXCA 4Y91A 4C8QE 4EMGA 4EMKB 4MQ9F 3HOTA 3CO6C 4OMZA 2ZNJA 1BM9A 3GX4X 3R07A 2HOEA 3ABUA 2ZT6A 5GANd 1X55A 1XSXA 1FX7A 5ICEA 3HY1A 3QU3A 3BP8A 4A0XA 1Z91A 3D0SA 4P74A 5H6RA 2MH2A 3MQ0A 2I4OA 1SD4A 4HVCA 2M87A 5CVRA 4C8QB 3O3KA 3ECHA 4UVBA 1FP1D 2HEOA 1E22A 4ESJA 4M72A 3ZP5A 3WTUC 3QUIA 4L9NA 1U5TC 4L9JA 4EMKA 1PYSA 4JRKA 3ZMVA 2HNIA 4EM0B 4M7AA 3R0JA 3RYPA 4ENMA 4MNUA 1HKSA 4M75F 1S7OA 5GANj 2DBBA 4E51A 4EGYA 2ZXFA 4M7AG 2VC0A 1L3LA 1MJAA 1MDMB 1WPYA 4H2WA 4IPAA 2E1NA
chains in the Genus database with same CATH superfamily
3ZMSA 1KONA 4JZ4A 4IO9F 1YLFA 4G94A 1WI7A 2HBWA 1HQCA 2R92J 5E1XA 5CO7A 4UC4A 5GTIC 1T39A 2AKWA 1XX5A 4PCQA 4OMMA 2QVOA 4CGZA 3PT9A 4CO8A 2DL4A 3NTIA 3Q1JA 4L87A 3SFMA 1ZLJA 1WQ2A 4PSXA 2GTOA 1E2XA 1K76A 4OINF 1VQOT 3M4PA 2MD5A 3W6VA 4A54A 3A01B 2CH0A 2ZJ2A 4XRFA 1HDDC 2KXCA 4QVCA 4M77B 4CI0C 3MP1A 3SEQA 3QYGB 3HZJA 3CD6T 2PU9B 2WAQA 4HWSA 1E3HA 2K40A 3LSMA 2JN0A 4M75B 2JOYA 3QZ9B 3FC3A 3D5LA 3ERMA 3L9FA 4ZZLA 1XPXA 1E3PA 5EYRA 4LDYA 4XLHA 3E6DA 4Y33A 1VQ9A 2ZPFB 2E1MC 4M74A 3U2RA 2W10A 2LVMA 2ETHA 3GZ6A 3OYIA 2R7WA 1P2FA 2DPDA 3GTMJ 5L3DA 4C92G 1RAFB 4XSXF 4CCMA 3LSPA 4BACA 4IIMA 2VE9A 1K8AC 1YCYA 4LIVA 2CP7A 1G3YA 1K61A 4C2UA 3JCMP 2ARUA 2ZSIB 4BY7J 4BYYA 5HK3A 3KZZA 1WHGA 5GANg 1YBYA 4X0GA 2W48A 5LEKA 4QQDA 1UJ8A 3HGGA 5D8KB 2P0KA 1B70A 1M90U 3IRRA 1ZG5A 3RDIA 1GCQC 4YYEA 1BI1A 2VPLA 4OP0A 4A0YA 5C0MA 1IRXA 3CCQQ 2XV4S 3VB2A 1YI2Q 5IP6A 4J9IA 2EQKA 2DETA 2K5FA 2O9SA 4N4HA 3JCMb 1IDYA 2KLOA 1B34B 1YG2A 3LGLA 2MLGA 2UXNA 2TDXA 4RB2C 3NPFA 1LJ9A 1VQNT 3Q3SA 4G8XA 2E34A 2N8GA 2VC1A 1LE8A 1HKQA 4FW2A 4E7ZA 3I5SA 4LD5A 3DXJF 3REOA 4MDXA 3QO3A 2EZLA 5D8LB 2RHUA 2PQ8A 2K5IA 4BW9A 3P8DA 1YJNA 1EF4A 4KIGA 2HTJA 2QAZA 3VKIA 2IY5B 2GAUA 2KDZA 1W4SA 1X6BA 2CZ1B 2DXCA 2FRHA 3CDHA 1QQJA 2FPDA 5EG2A 4BHCA 2CYYA 3HXUA 1RC9A 4DYQA 2JT4A 4G6QA 1KQ1A 1YHQQ 3LQQA 4ASNA 1NYQA 1Y0NA 3VODA 2FU4A 5KNLA 1TBXA 2Q2EB 4BXFA 2KDSA 3L1PA 2RQVA 1UG2A 2FBHA 4A5MA 2K27A 2K9QA 2WWYA 3CCSI 1NPPA 2K5LA 3CCQT 3P8VA 4QLCU 4OMNA 4PLIA 1D3YA 2EKOA 2R7QA 1SF9A 1ZBJA 3H6ZA 1PSFA 2VB6A 2YU3A 3WU1B 3M53A 1WJQA 1Y56A 2GNCA 4G7OF 3I4PA 2F69A 5IT9K 1KZHA 2EK5A 3B73A 2D6FA 1YJWI 1X56A 5C52B 4P55A 1V54H 2O5RA 5K1XA 2OTLI 2OV7A 3REAB 2ZTGA 4Q15A 2BY3A 5FO5A 1JKRC 5IHIA 1QVFS 4MHGA 2QA4Q 2UV1A 1XDSA 2YUNA 4J6XA 3FXUA 2WADA 3BT9A 4PJJA 2QM3A 3A7AA 1VQ8I 4Q5WA 1O4XA 1WXTA 1JTXA 2DAOA 2F2EA 3HTSB 2VUMJ 2XICA 5EJCA 2DFHA 1MZBA 1EZZB 1ZX6A 3FM3A 1AVZC 2P0PA 5KYXA 4LVJA 1HC8A 2XGCA 3J7AY 1JT6A 3GXOA 5E3MA 1Z67A 5BQTA 2E2JJ 2NWMA 2PUKB 1X3UA 4RAZA 4FQGA 2FZKB 4FL6A 4J01A 1EFWA 5LJ3j 2G7HA 1SFKA 5CQEA 2WB1A 3S17J 1PD0A 3LA2A 2E2HJ 1ZHIA 3WTSC 4IRIA 4RQEA 2XAFA 2COYA 4QSHA 5JR3A 1U1TA 3HOSA 3G1ZA 3RACA 5CPRB 4QIWN 1ETVA 3I64A 4A3CJ 1TL8A 4PL6A 4LIUA 3BTJA 1W7PA 3W2VA 5FD6A 5I22A 2QQBA 1BI2A 4RGUA 4JJCA 1BBYA 2NVXJ 2PVOB 2GTJA 4E6KG 2HQEA 4YRGA 4DBHA 4J83A 1JGSA 3KLOA 3IG2A 3LSQA 1FY7A 5GAHJ 2CZ6B 1PUEE 4RB0A 4NQWA 4L5IA 4EJWA 2ZCWA 2J5OA 3WGGA 4BQNA 1R77A 3TEGA 1VQ5I 1G6NA 3P9CA 2R93J 3VS0A 1SKUB 3EG9A 3H9QA 4FISA 2OTJQ 1S29A 3HFVA 4ZTUB 3K2ZA 4D8DA 1S72I 3OSFA 3RKQA 2QEXI 3PUBA 4PJOD 2DOAA 2ATCB 5E8GA 3AL0B 1ZGAA 3VV0A 5GAOq 4A3BJ 4I7HA 2DTOA 4RTYA 2R7SA 4R8HA 3HPHA 1PRMC 4GLKA 1KYWA 3OSVA 3WVEB 1OR7A 4RS8A 1K73C 4HVWA 3CCUQ 1FSEA 2DL5A 1ZKGA 1GVJA 1PP8F 2R58A 3FK6A 3V8LA 1K78A 2EFIA 1ZLMA 4Z88A 1JXMA 1VQKA 3C95A 1KD1C 2OF7A 1D0ZA 3F8BA 2XC7A 4KBMB 2DT7B 5JI6A 2AKLA 1RAHB 4P71A 5C53B 4RDXA 4AFZC 1H9GA 2OTLQ 2F48A 1EH8A 4K11A 1MH3A 3NWSA 3OOUA 4I01A 1RADB 1Q95G 2K6DA 1FTZA 3ZR8X 1OYXA 2V9VA 1WLEA 5TGTA 1MMDA 3E5UA 2XG8D 1FIPA 3BR5A 3L2QA 2PBIA 1ZRCA 1M3CA 1M2VB 5ECAA 1Z77A 4PHCA 1G5IA 2MH9A 2RHZA 4MQVA 1XSVA 2RI5A 2AIRB 2HSPA 3MEWA 2JA8J 4TQDA 4U7DA 2EV5A 3QWXX 4M7AF 1LNXA 1D8JA 2K3YA 3CCSQ 2ODRD 4FE4A 3QJYA 1GV2A 3HXYA 4YRPA 1BJAA 2WAEA 1RIOH 1CKAA 1IUFA 1TQIA 5FLMJ 2NVTJ 2LQNA 3QDFA 2QKLB 2COWA 3HL8A 1BOAA 1D5VA 2P5IA 2RB6A 3K7AJ 2JMWA 1LJOA 2XAQA 3I56T 2H1LA 2DOEA 3QKJA 2ZO4A 2WAFA 2PEXA 3MZ8A 4ABZA 1ZREA 1Z3YA 1VI0A 2V9KA 3ZQIA 1BW5A 1W2BP 3TMOA 2DQRA 2F5FA 5LFAA 5DLOA 1QVUA 4VUBA 2ZNZA 2ID6A 2YPRA 1UE9A 4RUGA 2Y0MA 2L9NA 2TCTA 1QBJA 4TVAB 1FC3A 1T08B 3BTIA 5IAYA 1I1GA 1G2HA 5GAMd 4LK0F 5B66C 2ZR3A 11ASA 1MKMA 3QRFF 2A05A 4QW2A 1GV5A 4HLXA 4J7IA 4ME7A 5GAOn 2PZ1A 2LDUA 1VQ4I 3U1KA 1YN8A 5CVIA 4A3FJ 1JKQC 3UWNA 4M78C 1NJ8A 3CESA 3H9NA 3TL4X 3VS4A 5HLTA 5FU6C 2ROLA 4C92F 4A4FA 3S1QJ 1OCOH 5KYWB 2O88A 1KA8A 3TKYA 5E8IA 3W2WA 1UGVA 1YW7A 1BIAA 1WXBA 2K3FA 1YWPA 5I11A 5GAN6 1B3QA 4OMYA 4HBLA 2RC4A 1OU8A 4J6YA 4V2GA 4KULA 2EH3A 2RPNA 4KH0B 4HDUA 4D8KA 4NOYA 3UGQA 2X3XD 4HG2A 2YDLA 3AAFA 1UGSB 3KP6A 2EIKH 4I2OA 2LDMA 1RI0A 2PUOB 4RGRA 1MV0B 3RF1A 1V76A 1Y57A 1OU9A 2VOOA 2W85A 3RGLA 4Y13A 1SEUA 4Y15A 1D09B 2DFUA 3IALA 2NUPB 2DM1A 4X9DA 3RQ4A 4A6EA 2VXZA 2VQGA 3BJAA 4TV7A 2NVYJ 1AWCA 1WVRA 3G7ZA 3HPGA 3CO7C 4K87A 2GXAA 1OZ3A 3RKYA 2DAQA 5ILUA 3RPQA 3N4MA 3NHNA 2OCEA 1IO2A 1J9IA 1OPLA 2L7ZA 2BVMA 1H89C 2JRMA 2WB1N 1HOMA 4OOIA 2ZXJA 3ZQQA 2YLBA 3CC2A 4HT4A 5GPAA 5H2FC 2ZMEB 1NPRA 4FE7A 2NNNA 2K57A 1VQ8Q 3FXMA 2Q0OA 3CPWP 3R60A 2LYCA 4E47A 1LEAA 2V6CA 1RPWA 1TQMA 4XRMA 3JRDA 1JQQA 9ATCB 2WBMA 2M34A 3DPUA 1M1GA 2BZ8A 2GFAA 2P4RA 4F17A 2AXLA 2CMPA 1DUXC 1WNLA 5EF6A 2NUZA 2Y90A 3M1CA 3ME9A 2HXIA 4XM3A 4CRIA 4F7UA 4ENJA 1IGNA 5FROA 3CCVI 2LJ0A 3TDUC 4CUGA 1XB4A 3WG9A 3PZCA 5DCMB 4RAYA 2HPIA 3UPUA 3QUIA 1HW5A 3NARA 5BPIA 1HD3A 1WYDA 4LN2A 1U2WA 5B1AH 4XTYA 1DPRA 4LD6A 1HLVA 2H6CA 4GLMA 2DDAA 2EBPA 1KQ0A 3BG5A 8ATCB 1ETXA 1TWAJ 5GMKm 1K8AU 2JNGA 3OS0A 1G51A 2KP6A 3HG9A 1M2OA 1GGMA 3OD1A 1ZN2A 1YO5C 1TTYA 1UELB 1ZGJA 2LC2A 2VL8A 3EFSA 4P3OA 4PJOC 1Z6RA 3CCEI 3F8MA 2H8HA 3FMQA 1S7EA 3N05A 4LG0B 2A0FB 3TSWA 5FU7B 1FIAA 1Q1HA 2DK8A 5HKCA 5FLXK 5GMKh 1MD0A 1I07A 1TNSA 1NNHA 4FHTA 4WCGA 2DO3A 2VOPA 5DEQA 1J75A 1G3WA 4L0YB 4RCCA 3ABTA 4P75A 4ZTZB 2KI7A 3SWNB 1IN8A 4CSWA 3G73A 1R49A 2YU9J 1U5SA 4FT2A 3SDZA 2LR8A 2DK5A 5ED4A 2JN6A 1ON1A 3FEOA 4DA4A 2ZCEA 4EX5A 2JWTA 4JYKA 4Y7NJ 4J00A 1BR4A 2YSQA 1UAAA 3ZGKA 3LX7A 1R36A 2LOOA 1JT0A 1T38A 1VQ6I 4M9SA 1T0JA 5CIUA 5BS6A 4HOBA 1JU5C 2MC3A 4PGGA 2E3HA 4A4EA 4PFPA 3OYAA 4PJOA 3E2UA 3C2HA 1WX6A 3M0PA 4AC0A 3M3YJ 4G6TB 1SSFA 5D4SA 1OYYA 3K1PA 2ZSHB 1Z9CA 3QHSA 1W70A 3HKSA 1ZAOA 2QUFA 4KA4A 4LDWA 4P9FA 2K9SA 2LF7A 3KUFA 1D3BB 2DT5A 4AYBN 2Q1ZB 3JTHA 3OMCA 2XF5A 4B9XA 2DMQA 2L7FP 4BJ6C 5A2QE 2JZ2A 1M4ZA 4Z6YA 3CCST 1G2BA 3MEAA 2RHQA 5E20A 4U0YA 1EV7A 4RCBA 4YRLA 5K1PA 4L6V5 2K2MA 2C8MA 1QGPA 3CCUT 1GFDA 1SFEA 2R7TA 5DD4A 2KEAA 3QODA 1UFFA 1D0XA 1BC8C 3CUQB 1NJ2A 2ZPHB 3BC8A 1UB9A 1E6GA 3HOUJ 3TO9A 2K85A 5CVVA 4AIJA 5GAN5 4X34A 1MNDA 1R0CB 1AWXA 4PSWA 4JBAA 3DLMA 3G71Q 2R7RA 4IHYA 4P3PA 2CSQA 4Y17A 3FDRA 4CS2A 2DK3A 4A6DA 3UDCA 2XF7A 2O4XA 2K9MA 2L89A 5GAMh 3AG2H 2W0ZA 2NLUA 2E3IA 3HHTB 2D1HA 1GCPA 3JCMh 3WTZA 1G4DA 2EV0A 1ON2A 1XMAA 3K4KA 2W4SA 1JUPA 1RETA 3I5RA 1J5WA 2HMAA 3MO8A 3UF4A 1GL5A 4B6MA 2EVRA 3HKZA 4EQQA 1ZBXA 3TW6A 2HQHA 3GVAA 4D5CA 1DDNA 2RF0A 5J8CA 1JGGA 1UMQA 4JX5A 1BKBA 1AEYA 1XC5A 1SRLA 2FZGB 2OAZA 4FYVB 4A4HA 5HK0A 1P4XA 1X1BA 1R5ID 3WTWC 1JKOC 1W6XA 4J9FA 2L4AA 3ZL7C 3OW2A 3FRNA 3RKWA 1YJWA 2BW3B 1W0UA 3ZBDA 2CUEA 3ROUA 2XVCA 3BLYA 1X19A 2R3SA 4IHXA 3BG9A 4OF1A 1M1KR 3ECOA 4IJAA 4QKUA 4LUEA 3IAM2 2UWMA 3H9JA 1ZRFA 1T8IA 4LJZF 2OTJT 2HNHA 1QP3A 2RJEA 2ZZFA 4EGZA 2HYGD 4YFXF 4G9YA 1WH7A 4AIDA 1VQPT 2DPUA 4P73A 5TJJA 1XGNA 5LGNA 2HR3A 4YRVA 3M55A 2PJPA 2DF6A 2R5ZB 3A4CA 4DOVA 2CV2A 2KRCA 3JB9D 4P71C 2ROTA 3G4SA 1BA5A 2HDAA 4C8QD 3RZDJ 3EG9B 5J26A 4H2YA 5ICFA 2MA3A 3GLLA 5LGTA 1RAEB 3LOCA 2BW3A 1FBSA 1TW3A 2XPUA 3HB9A 4YFKF 4EJTA 1PC0A 4ON0A 3A0HC 4CYCA 3MKZA 2B7EA 3NRVA 3CCJI 2P0QA 3MKYB 3G1JA 4YTLA 1M1KC 2AO9A 4MTDA 3H5RA 4IVNA 3FBIB 3L4GA 1RR8C 3MEXA 1YHQT 3QP6A 2A6EF 2H8WA 2O61A 2V1DA 1GBQA 2OQRA 1NYFA 2FMLA 3DU6A 3BDUA 4ZNXA 2XDDA 3VS2A 3LSTA 4QVZA 3KP5A 3CMEA 1MNEA 1PD1A 3CD6A 2EQJA 3HJEA 1Q82U 1EQRA 4F14A 2F5TX 2FEZA 3TEHB 5HLHA 2AK5A 3NELA 1N27A 1VIFA 3OYEA 1YQAA 3KE2A 1VQ9T 4P74C 4NBQA 4F91B 5LGUA 2KDOA 3ZMZA 3ZN0A 3CCMA 2F2VA 3JRHA 3QZ5B 4MMLA 3PO2J 4XU3A 2PMZA 4HVVA 4D6WA 2ZB9A 3CDLA 2WTEA 2COBA 5LHHA 1QP2A 5C3EJ 3ZMUA 4L0ZB 1FSHA 5EGOB 3J81K 4OMQA 3REXA 2RVCA 2LREA 3PCOB 2PNIA 4NL3A 2LFBA 3KP2A 2P7CB 2YX7A 1XGMA 2O0YA 4MIMA 1ZSZC 3CQTA 1AWWA 1WJFA 3QPHA 2OX7A 4EM2A 4J5YA 4JX6A 3ASKA 4M78F 1BCMA 4M71A 1KOGA 2KPMA 4TVRA 1T56A 2OZ6A 1ETQA 1HSTA 4J9DA 3CCEQ 3JCMe 4LVIA 5FLVA 5BMZA 4M77E 1NJ5A 2IP2A 1YRNB 3S1NJ 3BW1A 3X28B 3A8GB 3G4SI 2ME0A 1M9SA 3PO3J 4MZPA 2P5VA 4EATA 1FOWA 2HKQB 3DBRB 1W1FA 2M4GA 1PYVA 1U5TA 4FSXA 4EMKC 3ICAA 2DRMA 2KZGA 2UXXA 1X3WB 4Z2YA 2H6BA 4E7LA 3L7WA 2DQ0A 1MIJA 1NTCA 5HNHA 3F6VA 3LL7A 3LSJA 3E3VA 2LD5A 1BK2A 2R5AA 3GZ5A 3S8PA 3L42A 1WJBA 3E6BA 5EEGA 3O8HA 2DTHA 1MBKA 1U3EM 2QTVA 3FLGA 4FM4B 3IKMB 2DO7A 4H2UA 1ETKA 3J81E 1EFNA 4TWAA 3I9V2 1W7PD 2DMPA 2CQXA 2EZHA 2H94A 3PNTA 4LUDA 2VKVA 4BI3A 1T0FC 1R7JA 4F7UF 1M1KU 1VQ7T 1DP7P 1Z7NA 4K86A 1W0TA 5IY5H 4IUTA 3RUXA 1IC8A 2DL7A 2LTOA 3LW5E 3OA6A 1KQSS 4J7FA 1WCMJ 2PMHA 4OU0A 5L3FA 1X4OA 3TREA 1M90R 3KZIC 3JRFA 3KCCA 3KP4A 3L4GB 4C3IJ 2OBPA 1NEGA 4JJBA 3J7AF 1K73U 1JB0E 2UZKA 2VJ4A 2E1HA 5LJ5j 1OPCA 4PGHA 5DCFA 5F5WA 4QQ6A 1LFPA 4UY8I 1Q81U 4LDXA 3V4GA 4A2UA 4F16A 1YX3A 1TUDA 3G3ZA 2DL8A 3C2GA 1R1UA 4K88A 2E36A 1X2NA 1L0OC 2DT6A 2XKOA 2QGGA 2O8KA 3H92A 3WGIA 2A37A 3HY0A 2OTLT 1VNDA 3HSBA 2RNJA 1UJ0A 1WQWA 2DPPB 5HDNA 2K7AA 2M9HA 1SETA 1Z21A 5M5XJ 2LMJA 4ZDLA 5D6YA 1S1NA 2KRHA 2AT1B 3OWTA 2XGXA 2ADUA 2QTXA 3A31A 3GMEA 1KHIA 3DSQA 4L5GA 3C94A 2PX9A 2ALYA 2QASA 1RNLA 1VOMA 2LH9A 1EIYA 5EG0B 2ZZEA 2DXIA 1WHUA 5GJWB 1TLHB 1QVFA 3GLXA 2JMAA 1FMVA 4RMNA 3H35A 1QZEA 3PSFA 2M1BA 4DGWB 4ELYC 2IGMA 1EKEA 1P7JA 3OYGA 5HS7A 2HFHA 3H41A 1K9MC 2KVQG 2DEUA 1ZSZA 4H2XA 3E6MA 3J7YJ 3BR6A 4QTRA 1XGSA 1R5GA 4CICA 2KFDA 2L01A 4OAYA 5JVTA 1CGPA 1MUZA 1KC8R 1JKPC 1E0EA 4AT1B 2ZPIB 1OMIA 3S3MA 3WE2A 3BY7A 1AA7A 1I5LA 2MG4A 3ABLH 2M30A 3M1EA 3IKTA 3GTPJ 3QPSA 1UHFA 1WLPB 2L3QA 2FJ1A 4M78A 4RTWA 1WU7A 1B7YB 4ZYEA 3ULQB 2IGOA 3J81Z 1XS9A 2HDCA 1M2VA 4MDWA 4C8QG 3CBMA 1LKXA 3JW4A 2EFOA 3I71A 1J7KA 1H4VB 1QE0A 5GAEJ 1W5CC 1VQPQ 3A02A 3FMRA 3BOQA 1K7AA 1KG1A 2EILH 3BTCA 2H1KA 2FBKA 2V1XA 3GF5A 3K4LA 1J09A 3FF5A 1WI3A 3VYRB 2CH4W 5AYFA 1JJ2S 1QQIA 1YTYA 3FXKA 4I98B 2XSDC 4XBFA 3GTLJ 1ZUYA 2DLPA 2KGTA 1LB2A 3GBQA 4HX7A 4OGEA 5IN1A 5HY6A 4A12A 5CVJA 3OYNA 3DU5A 5LL6S 1QF6A 4M7AB 1E3OC 1RAGB 2VJ5A 3I59B 2XB0X 3TOBA 5DUIA 1KSWA 2DQ3A 3A32A 2LLKA 3S3OA 3KFVA 1JHHA 2FOKA 2R7XA 4M7DD 1RIQA 3DB4A 1Y71A 3DCFA 1Y1VJ 2CFXA 3CDIA 2LJ3A 2LQKA 3CCLT 1QVGA 1HSJA 5C4JJ 2YT6A 4BWAA 4UXNA 5GAOr 4JJNK 1Y7XA 3OR1C 3VRYA 5JFRA 3BFMA 2NNYA 3BY6A 4I99C 2ZBKA 3CCQI 4YRQA 1C1AA 1ACMB 2CUDA 4JRQA 1JTYA 1LNWA 1MBGA 3LFKA 3CUQC 4BQQA 1SSHA 4HWPA 3CMEQ 3M56A 3CCVA 2EFQA 1D1BA 3Q0WA 3LSIA 1ZRDA 2DTIA 2HL5C 3VUZA 2V79A 2J6FA 2QDYB 4XN3A 2YWWA 5CKHA 2KJCA 3RKXA 4NQWB 1TT5B 1PCXA 2DJZA 5D7UA 3CMET 2GLOA 2YLCA 3JRCA 2GIVA 1OX9A 1APLC 4OIPF 4JJDA 2LSOA 1K9MR 3SWNA 4MZMA 3DKYA 1T0HA 2C0OA 4EM1A 2BBYA 1TC3C 5LJ5e 5GAN8 3TU4K 1ZR2A 2QEXQ 2JUGA 3Q0VA 3EGUA 3ZMTA 5A0LA 4XLEA 3G71A 2X9DA 5DDGA 3BCBA 4XQFA 3ZQCA 3M9AA 2M0CA 5HLGA 4IZZA 4B09A 4RTTA 2QEXT 1X75C 1Q7YR 1B07A 4V2SA 1HDPA 2V8IA 5ILVA 1SG5A 3WODF 1UTIA 1QCOA 1UB4A 1YFRA 3BPVA 2PMEA 3HXLA 4BY6B 2Y48A 1AOJA 1I81A 1A5JA 4B47A 2HCKA 2E1CA 1H641 2H3EB 2JMCA 2O9VA 3P8BB 4IUVA 1DQUA 2QSHX 2QF7A 3QWYA 4AH6A 4BD3A 1X1CA 1WWXA 1RUNA 4IHTA 1AWJA 1QCFA 1V5EA 1FJLA 2AS5F 3QPTA 3A1PA 5KVRA 4ZTJA 4N4OB 2A61A 3FBNB 4KR3A 1IF1A 2YR2A 2E1OA 2ID3A 2DKGA 4M6XA 3MF1A 4PFZA 4O2DA 4XKCA 3A1YA 3CMAA 1VQ5T 3JCMW 4XMYA 2LQWA 2DA3A 5F0FA 1J2XA 1ZG3A 4O6JA 2DXBA 2JVVA 3KFUA 3QO7A 4E7KA 1WGSA 1E7OA 4NC6A 1X3ZB 2D45A 3EH2A 2ZMEA 3JSPA 2PLYA 2MIOA 1V3FA 4DEXA 1N9SA 2KR3A 4DBFA 4KH1B 5HS8A 4M78G 2M3AA 4BUGA 2QA4I 3CCYA 5IHKA 1JUSA 2J3MA 3ASOH 3C2BA 4HX8A 1V1CA 3E0JB 1W2BS 3Q5FA 3I56A 1O3RA 5KNNA 1IV8A 4A3EJ 4M6YA 3HIFA 4AFUC 3SHFA 4A3JJ 1LPQA 1G83A 5J8FA 3L2UA 1Y1WJ 2VBXA 3JCMd 4BBSJ 5J6XA 4MGRA 1Y96A 4RTXA 1XCBA 3VS5A 1U8BA 5FWCA 2O03A 1AKHA 1RUWA 2E70A 3MPUB 4E6RA 2PI0A 3KLNA 1TWBA 1WHKA 2I0NA 3U21A 1KK7A 3DFGA 2FVUA 4BY1J 4PJOB 2I2LA 2QG9B 4FETA 1FLIA 3R6NA 1H3HA 2ZFUA 4XRSG 4KMUX 1LCKA 3QU6A 1M3BA 3JRIA 3AHUA 2EWNA 1B9MA 3KBGA 4AVPA 3UT1A 4RLFA 3PNVA 1MMNA 1IRGA 2E65A 1VQ4T 3UGTA 4X9CA 2FOWA 4PJOG 1OCRH 4BH9A 1WYXA 1FBQA 3SWNC 2E5QA 2DODA 2X4JA 1QRYA 4M77C 2MD0A 3ML6A 1A6IA 3QYEA 3BDDA 1AZGB 3E9HA 5KYYB 2I5UA 3LQRA 4GGGA 4OLFA 4Y28E 3F72A 3VS6A 2RHSA 4XU1A 2YXYA 2X3WD 3U23A 4CC4B 5GMKe 1NJ6A 3PMTA 3OMGA 1KU9A 3UFGA 1ASYA 1YIJA 3JB9H 3AG4H 3BG3A 5LJ5g 1H8AC 5KYUA 4ZIBA 4CC2A 1VQ5Q 3LC0A 1Q82C 4FW1A 4WF2A 3I55I 3EGDA 4A3KJ 2JM8A 4A4GA 2ISYA 1FMKA 1IHVA 2E64A 1QZYA 3KYDB 5LRRA 3E6CC 3IP4B 4ENKA 1FOKA 3K70C 4M77A 1WHHA 4XOPA 5DCMA 1X6GA 3B6CA 2X4WA 3C0CA 4C5HA 3F3XA 4MLOA 2W7NA 4IUUA 1WHJA 4F7UB 2KNBB 4CS4A 4J19A 3A0BC 3JCMc 1Z05A 2DI3A 2K3BA 2MW8A 5CKFA 3KFWX 3M8EA 1POGA 3V8KA 3GTGJ 2EINH 5FRMA 1KJWA 3KETA 3UNGC 4ATOA 3OBWA 3HXVA 2P6TA 3IKLA 4MFDA 3G6EA 4TVYA 2JSPA 2OPTA 3C18A 2DA2A 1R23A 1VZ0A 5F6FA 2FSWA 2ABLA 2AKKA 1FT9A 1B8IB 2RQTA 1VQ7A 4IHVA 5IOYA 1IG7A 2DQLA 1MMAA 2QGFB 4Q48A 3IWFA 1XD7A 4RTUA 1USYC 2XHKA 1IREB 1D1AA 3DBHB 5EZGA 2OI3A 3EG2A 3EYIA 2COMA 2DYBA 2WSFE 1J5YA 2RMOA 2NS8A 2RNAA 1JI8A 4QT7A 1ZQ3P 3BZ6A 3E1SA 2NYSA 3R4KA 2EA4A 3RTRA 3TGNA 2O8XA 1PP7U 5FKKA 1KQ8A 3F0CA 4JRPA 1E6HA 5D6WA 2JA2A 2LY1A 2RHXA 4KMFA 3FISA 3CCLA 5AIPA 3Q9VA 4C92A 1XMKA 4C2MJ 4IHSA 5J1UA 4AM3A 5GAN4 4HF2A 4E7HA 2LY9A 2WA0A 4M3GA 4C9YA 3E19A 1WHLA 4KICA 5LJ5f 3RSNA 1LFUP 2PJRA 1EIYB 2KMUA 3H3VK 1XTAA 3K4JA 4B8XA 3SB2A 5J3BA 4PDKA 1PWTA 1TQPA 2DA9A 1KU3A 3ABMH 3CMQA 4II1A 2J5PA 2W82A 3NAUA 2NVQJ 1IUYA 3TBIA 2RHIA 3PCOA 1VQZA 4PG3A 5DD8A 4CYCB 2K3XA 4XOTA 2OJ2A 3J7AO 4OGCA 4XKWA 3HRUA 5K5OA 2J7IA 3BTLA 2JS2A 1SRYA 4BUPA 2KAFA 3MKWB 1ZTRA 2RI2A 1O9SA 4XU0A 3E9GA 2F5VA 2D9TA 5H6QA 3OYJA 2EYWA 2KY9A 4I6ZA 2CSIA 2AQEA 2RHSB 4HWOA 3WGHA 2VYTA 3RERA 1LFBA 1D1CA 1KQ2A 4UP7A 4DYRA 4Q47A 4YELA 1HK9A 1NJIU 1B6AA 3DTKA 4PZJA 3CMAI 3CCRA 1SFOJ 1CSKA 3A8HB 3LSRA 1IW7F 4H2TA 3DKXA 3K9TA 2YHTA 4FIBA 1N8RC 3FWEA 3HRMA 1U8RA 4KIBA 2RQPA 1BI3A 3GW2A 4Q5SF 1ASZA 2CT3A 2QBYA 3OYBA 3HFNA 2QEXA 3ZQGA 5HNFA 2A08A 1I50J 3FXLA 1MMSA 1Q86C 2ZT5A 4X1EA 4YRFA 1ATIA 1B8IA 1ULYA 4L18B 4M75D 2RO0A 2K9GA 1JRIA 1LDJA 1UHSA 5GMKl 3CMAQ 1Z9ZA 2VT3A 1KQ9A 1B7YA 4A3MJ 1SHGA 1FXXA 1S8NA 4KYWA 1SHFA 2MLKA 2NS0A 4HKEA 1VQKI 2DVJA 1MGTA 2QKMB 3F9KA 3NGPA 4P5NA 2A3SA 3HXXA 1HA8A 1NH3A 2XPVA 3OIPA 2KL4A 4XTWA 4HNUA 4B3XA 2Z33A 2IS6A 3CCSA 1ZSZB 4I0BA 3S1MJ 4A5NA 2LCLA 4HW0A 3SYTA 2OAWA 2STTA 1UG1A 1Z7MA 2DNUA 4OIOF 3PUFA 3IH2A 1T95A 3DP7A 4M9XA 1NJIC 6PAXA 2QYOA 1BCOA 2GGRA 1IO6A 4HCCA 4ZYGA 2CSOA 3CCVQ 4A3DJ 1VQ9I 3RYRA 2KIFA 4KGVB 1LEBA 5TRDA 1TWHJ 1ONVA 1Y0UA 1K1ZA 2E5KA 2KRSA 2C0IA 2LTPA 4XR6A 4HZFA 4FYWB 1IL2A 2XPWA 3EHQA 4FSSA 1TT0A 3NEMA 3BR1A 3NEUA 5LJ5h 4UV8A 3ZFJA 2MAMA 5KHDA 2CREA 1LE8B 1WA7A 3PNWC 2DRKA 4FCYA 4IRHA 2BZTA 1GHCA 2Y75A 3HSEA 2YUOA 1UGRB 1A6QA 3CP8A 4A4KA 1ETYA 4AIKA 4EIKA 1IN5A 4BEHA 2FNPA 4YG2F 2E4HA 1I3AA 5JLXA 2RK1A 1ABOA 1XCVA 2AQFA 3QAHA 3VDXA 1GRIA 2P4TA 3PGGA 1GT0C 2R7ZJ 2HVQA 5I2MA 2KJBA 3TQNA 1GXQA 2P7VB 5HLIA 4Z02A 1SPKA 2YUSA 4ESBA 1F1BB 4YRJA 1OEBA 1DP3A 2VPRA 1EIFA 1Y96B 2ALYB 2KT0A 3WTYC 2E41A 1SMYF 2KXDA 5I2SA 5KE2A 2EL9A 4M7DB 2ELKA 2O2OA 4D1QA 1ZH5A 2K9NA 2ZXWH 2OAUA 1D0YA 4FASD 3S1RJ 2RM4A 2H27A 3CPWA 4Y52J 3LSGA 4BJ5C 2RD1A 4DYCA 3DKMA 3WVDB 4DOWA 2LKSA 2DN0A 5TISC 1H92A 2IA1A 1LDKB 1MV3A 1Z6TA 2L3PA 2XU8A 3QTCA 3H3ZA 2MWPA 5FU6B 2MBFA 4W1UA 1MMGA 5GANe 4HCKA 2L3SA 2STWA 1YWOA 1U06A 1UGQB 2LCCA 1AZEA 4HYEA 3G1LA 1X2HA 1TH7A 2EW3A 1P4AA 2A69F 1ITYA 2X4HA 5GADJ 2GFUA 4OMLA 1YJNQ 1SMTA 2HOTA 3EDPA 2HKXA 2WSCE 2EGEA 2EFWA 3CQZJ 1TS9A 2CQNA 4LITA 2KQRA 3H0GJ 2JT1A 3I58A 4KJZA 4M9ZA 4OB0B 2F5DA 5D5WB 3LSHA 5J39A 1Q86U 4M7DE 1YOVB 1PKSA 2GBYA 3W6JB 1I3QJ 4J9CA 5CKTA 1I39A 2JRTA 2K4BA 4FX0A 4JS4A 4HX4A 4BE0A 1P7IA 5KE3A 1YI2A 4PJLA 2GBQA 5C51B 2RA2A 2X4YA 1BIBA 2HEQA 2CUBA 2VXEA 3EG3A 5CJ9A 1M5Q1 1WJCA 2JTFA 3LWFA 2KT1A 2EIJH 4YREA 1BOBA 1F1ZA 2RV8A 2HPMA 3IAS2 5DV5A 4C3HJ 1W36C 2AMCA 3FZVA 2XTIA 3DEUA 4YIFA 2P5KA 2W57A 2ED1A 2VWFA 4RTZA 3TCJA 2BV6A 3IWZA 3HHGA 5LBQA 1ABQA 2HQXA 4LMYA 4QPOA 2HD0A 4M7DC 4BI8B 3SDGA 4CCLA 2ELHA 3M5AA 5DS9A 1Z7UA 4J9HA 5CKBA 2ZCFB 3TP0A 1YFTA 4LFUA 2EZIA 2JPBA 2YX4A 4HF0A 4A3IJ 2KISA 5KYUB 3CCEA 2CG4A 4KUMA 4P9UA 4UUSB 1SFUA 1JUMA 2K7LA 4XLAA 4BXXJ 1B7TA 2EIFA 2DD4A 2LT4A 2VI6A 5GAOp 4OMOA 3SEZA 3H9GA 2R5YA 1J0RA 3H36A 2M2EA 2K2VA 3QNEA 3A7RA 3DKWA 1I27A 2VGMA 1T0FA 1Y39A 1RR7A 2LT1A 4BE2A 3R6OA 3PIOA 5ILSA 2KYMA 4M7DF 3V7RA 1T33A 3GTQJ 2VLAA 4D5FA 2EJGA 3ASNH 1CF7B 3ERED 2XSJC 2EGAA 4YCVA 4U0WA 1K6YA 2EIMH 1MW7A 3OYLA 3LAPA 2D8HA 1VQLA 1U0JA 1IGQA 2K86A 1WKMA 3JREA 1WIEA 2EPFA 1WHMA 3ULRB 4B9WA 3CCMQ 1M27C 3RL6A 3O6BB 4PJOF 2YRDA 2PTKA 4TTVA 4CZZA 3GBGA 2FNAA 4HVCA 2ZNYA 1IGUA 1JHFA 1R1TA 1NZ9A 3HM5A 1H88C 2D0QB 3ESWB 3HP9A 3WXMB 1IZ6A 2DZCA 4UHTA 3EUHA 2CT4A 4JUVA 5BNGA 5IT3A 3TSZA 1W5SA 3PM1A 3T8RA 4QQGA 2R7UA 1YITQ 4OVAA 1IN6A 1B9NA 2CZ0B 2IVWA 2OCCH 2JS0A 2JJ9A 2DMOA 1DU0A 5DM7R 4LNSA 4UPAA 3OS1A 4I02A 2IXSA 5F1JA 2CP6A 4KIFA 3BZKA 1YITT 3MEYA 3TO7A 2M8EA 3KX2A 4EJOA 1VQ6A 1BBWA 4JLGA 2CJAA 3CCJA 1U9OA 1WFXA 3LMMA 2Z99A 2EYXA 5A2QZ 1BYMA 3KEYA 1UHCA 3RPUA 3OY9A 6AT1B 3F8CA 2K4YA 4TVAA 2DA7A 1ERDA 1VYTA 2O01E 1VQKQ 1TZLA 3P7NA 2R5YB 2Q8KA 2E71A 5M5WJ 2Z0WA 4MMKA 4HAMA 3ONQA 2LRDA 3P8YA 2Z3YA 3HDDA 2EBIA 3CMEI 5FD5A 4KDPA 5IYCJ 1OPKA 3VS7A 3X25B 3F8FA 2VXFA 1YIJI 5IH2A 2ZIOA 4L5JA 4B3AA 2Y0SN 2CGHA 4ENNA 1YRNA 4YRIA 2KSSA 2L02A 3F70A 3FIWA 1RZ4A 3BG6A 1VTNC 2O6GE 4ZGDB 4KQEA 4R79A 3G4ST 1VQ4Q 3HRTA 4A0ZA 5KAFC 3JRAA 4ZH4F 1YJWQ 2IIMA 2BKDN 4LVMA 2HTSA 1UDLA 2HBPA 4HCBA 1PYSB 1T3LA 1QVGS 1KMMA 1GXIE 3I7FA 3FHNA 3S2WA 5HODA 3QYBA 5GPCA 2QYZA 3VYSB 2EFNA 3CMMA 2G3RA 4BQAA 1TWGJ 3OIOA 1WZ2A 4GCVA 4WX9A 1Y8QB 1FTTA 3REUA 1AHDP 1ODDA 2A5YB 3OV8A 2VVKA 3V42A 1LQ1A 5FKNA 5ELNA 4YRKA 4N4GA 3ZRGA 4Q6GA 5F1RA 2PMZN 4H2XB 4AIHA 3A2KA 3U9GA 1VQ7I 3FJPA 1OJLA 3ZEHA 4EO4A 1MNMC 3R61A 3CF2A 1A35A 3CCJQ 2Y9ZA 5C44J 1S3JA 3G6EI 2A6HF 3BWGA 3F6OA 4IOCF 1K78B 4DOZA 2IGKA 3GFJA 1U6GA 2X6YA 3I4MJ 1TUGB 1UGPB 3EGXB 4ZGJB 2Q7GA 1PVEA 1WJDA 5ICGA 3CJNA 3DPLC 4RGSA 1ZUUA 4G85A 2IS4A 1HXDA 1QVPA 2GQQA 4DQ2A 4RG8A 3CPFA 2I10A 2RKHA 2F6CA 5DM6F 3MFKA 1HSQA 2CS7A 3BJUA 1I5ZA 1SD5A 2MYSA 3FKIJ 4XKBA 4LG0A 3RCOA 2ZGWA 1FOXA 2HAXA 3BG7A 4I0AA 4LGWA 2GM4A 2B8AA 3EGDB 4PJMA 5L3CA 5LHGA 2OD5A 1MJBA 1YI2I 5IXBA 1K8AR 2KKOA 2NOJB 2VBYA 3D5SC 5HVQC 4L9TA 3QG1A 1LVAA 3K4CA 2ACJA 1I8FA 1VQMA 3QWLA 1XDUA 2QSGX 4C0DC 2JM9A 2RQQA 3BJ6A 5AIQA 5E79C 4H2VA 4X5OA 3ZPLA 1VQKT 3OS2A 1U5TB 2HU9A 3WTVC 3S15J 1H8KA 1NLPC 1ZARA 2O3FA 3DBLB 5E3NA 4C92C 3VBBA 4R55A 2DDZA 2M1HA 3K69A 1ENHA 3FIFA 3E9IA 1LPLA 3H0IA 2XGEA 2C6YA 3JRZA 2HXOA 3M7GA 5A0GA 2HVRA 5D5UB 1H3ZA 3EUKL 5GANh 1G59A 3D7SB 4XEOA 4IHWA 2HKNA 1I4K1 2EAYA 2RDPA 2C7IA 3DLAA 1TSFA 2XKOC 2X0LA 2V26A 1O3TA 3RESA 1KGSA 4NHJA 2XDVA 2Y9YA 3EPZA 4E70A 2DFEA 2F1LA 1EH6A 3O8GA 3INZA 4BEHB 2A68F 3CCRQ 2PVGB 5FKMA 4CH7A 2DL3A 2K3PA 2QI2A 4HA8A 4N9HA 1N9WA 2IAIA 4RMFA 4EJUA 2YUQA 3S3NA 1YE9A 3CCRI 3JRGA 1GXPA 4HF1A 3HOWJ 5LJ3h 3BR3A 1SVMA 1Q81R 2CS3A 3NTKA 2X6WA 2A28A 2PG4A 4JPBW 2YUPA 3EETA 2HI3A 1U1SA 2FG0A 2E19A 2ZIMA 4AU7A 5C6SA 5L3EA 2GQIA 2EJ9A 2H3JA 2LBFA 3CCJT 4PJOE 2GA2A 5E1WA 3DLLA 1QMCA 1N8RR 1O7LA 2MC4A 4A3LJ 2KBTA 2HKOA 2AZSA 3O8VA 3OBYA 2CQKA 2XK0A 2Z2SB 4H2SA 1Q86R 1R9TJ 1P6RA 4A93J 2LNBA 5EC7A 2LVSA 4FT8A 1FP2A 1QHHD 3K4NA 4B43A 4P72A 2J06A 2LKPA 1MJ9A 2JA6J 4N0AA 3CCLI 2DJNA 2DVEA 3M8FA 4K2EA 3EAEA 3M0RA 1KC8C 4LVKA 5CLSA 1PKTA 3EYYA 2NOGA 1GLNA 2V7FA 4R1HA 2XMFA 2JPCA 5KH6A 4M3BA 2O7OA 4NB5A 3HTUA 1JE8A 1DJ7B 5CK9A 3PVLA 1USSA 1OULA 2F5KA 4JX4A 1QVGP 4M75G 5C4XJ 3JCMV 4KISA 3CC2Q 2L3DA 2Z1DA 2WY8Q 3K1MA 4XORA 3MCAB 3F8NA 4UP8A 3PIPF 2O9LA 1PDNC 3PJRA 3AKZA 1T3SA 3SHWA 2Q7HA 4RLQA 4IF4A 4UVCA 3VWBA 2L54A 2L7MP 1WJEA 3KP3A 1WRJA 4XEMA 3QYFA 1AT1B 3QSUA 3MZYA 2EYYA 2ZJRF 1GVDA 4ESRA 2ZT7A 3H3UA 2CUZA 2NYXA 4C0ZA 1KFZA 3VSKA 1WJAA 5J1YA 2M7AA 2ARTA 1G5VA 3EUHC 2HZDA 2RI3A 3JSCA 5GTHC 3HL2A 1TG0A 3CCMT 4C5EA 2JZYA 1EX4A 1Z1DA 2L9RA 2PMUA 4IURA 2J3LA 3VQYA 2KYBA 2A6TA 2EA2A 4F7UE 4GYGA 5B5EC 4B44A 3JRBA 4M77F 2HZTA 5D4RA 4MEYF 1H4TA 2VUBA 3WQZA 3JAME 2DA4A 1SAXA 2GOXB 1EA3A 2XHCA 2XB5A 2RHYA 5J4YA 2ICWG 1Q81C 2AKWB 1IJWC 3O2PE 1QWEA 3DF8A 5K5RA 4KT0E 2R5MA 2D0NA 2DD5A 1WI9A 3LH0A 1YIJT 3AG1H 4OWRB 3WTXC 1VQLQ 2G9WA 3IHUA 3HUGB 1R6RA 2B9SA 2FQ3A 3QO8A 4M6VA 3SZGA 1QKWA 2HQNA 4GXOA 3HOXJ 3KEOA 1R22A 2LMDA 4GRIA 1WSUA 1TWFJ 4P73C 3VQVA 2OTJI 4EMHA 3KPHA 3GNFB 4NCXA 2IS2A 2DYIA 2WAQN 2B63J 3VUBA 1U9NA 4NS5A 1A36A 3CC4T 3IRQA 2D8JA 1YB3A 2XGTA 2JTVA 3DTIA 2F4IA 3HKZN 2HL3A 5LJ3f 4YRSA 4XTXA 4EJVA 2ZJPF 1OV3A 4O5VA 3CXCP 4UNOA 5HOOA 3A98A 4A63B 3M0QA 3LA3A 1NLOC 1B8AA 2M45A 4H02A 4BDYA 1Q7YC 4L59A 3K1NA 4GYIA 4AG1C 4XTZA 2XAGA 4P75C 3H5NA 1NJ1A 3T5XA 4ZYHA 5D6XA 2HDWA 3CTAA 4PKCC 5GAN2 4N0AC 5GMKj 4Q4ZF 1U78A 4HV6A 3K6GA 4DIQA 2ED0A 3OW2S 1BBZA 2WV1A 4II3A 2A5WA 4LOCA 2DXUA 3M4YA 4XAXB 2JSCA 4XKVA 2FYKA 1VQLT 3HRIA 2HQ5A 1B34A 4OAZA 3HTZA 4X1VA 3JB9F 4C8QC 1BW6A 3QYHB 1GFCA 2BE7D 1R1VA 2QQ8A 2H09A 5FKOA 3WE3A 4C8QF 1YGBA 4XL9A 5FLXE 5JVGF 3GO5A 2ZMEC 3FHZA 3MAJA 4OMPA 3GUDA 1PJRA 3L2VA 1NK3P 1YI2T 1Z7LA 3I9QA 1MSEC 2M7BA 1Y0MA 1B76A 3GTJJ 3V7CA 2P6SA 5F27A 2QWWA 3X24B 5DUKA 2R0QC 2M9UA 5GAMg 4TQFA 1DGRM 1C0MA 3B6AA 2JVHA 4KT6A 4GFBA 3CJQB 5J40A 2BXZA 1XGOA 1B59A 1FYMA 1QU3A 4J8OA 2E5ZA 2Y31A 5GAN3 3CJTB 1E1TA 3BDLA 3CXCA 4YRCA 2Q5HA 3DEWA 2HVSA 2ZAEA 1NJIR 2KK4A 3WU2C 3CMYA 2KRNA 3BJOA 3QJ6A 4P1WA 2COZA 5FU7C 2KZVA 5CKDA 5KCOA 1FOYA 1DU6A 3EG0A 1WH5A 3CMAT 2CZ7B 1R8OB 2NVUB 3TO6A 2V1UA 4F7UG 1BR1A 2VXDA 3VPRA 1N9RA 3P8TA 4XTVA 2RN7A 2R5ZA 1PG5B 3THKA 1JJ2A 4KT5C 1VQ7Q 1G5HA 1NG2A 2KIMA 3EHRA 1W7PB 4CH4A 1UEBA 2MMPA 2FB7A 1YYVA 2MGQA 3GZNB 2X35A 3K10A 2VV5A 3OYYA 4OMFB 1X1AA 3I55T 2EQMA 2V9PA 5LD2C 4HWTA 2CW8A 3RZOJ 1W1WE 3KYCB 2KQWA 1HC7A 2W1OA 2CIMA 2E60A 3TUPA 1ZHFA 3L2CA 3IV5A 1Y07A 4M78D 3NENA 1XNIA 1N78A 3WG7H 5GAMe 3GIBA 1ADJA 1X2GA 2CGPA 3LWHA 1OCTC 4ZC3A 1VUBA 2OZUA 2DU9A 2XRLA 2YSRA 3W6KB 5ICCA 4YIRX 1Q7YU 4ITVA 3OYHA 2LNVA 4ANJA 3LNQA 4M75C 4HV5A 2RGVA 3W3CA 4S05A 2L0KA 4JQFA 1VYUA 4MZTA 2V1NA 4C0FA 3CCLQ 3S14J 1RAIB 2L2PA 2ZXIA 3K0LA 5F64A 2P5LC 1YNZA 3S2HJ 1M1FA 3QP5A 2EQRA 2DBKA 1VQ8A 3KEQA 1BBUA 2I4LA 3O5ZA 1YIOA 3NMZC 4ZDPA 3LA7A 4Y92A 2CO5A 1BB9A 1M90C 2MSYA 2XF6A 3P9IA 2V6EA 2X9HA 1A0NB 4WCIA 4LLNA 3HRSA 4HRIA 1OKRA 3QOPA 2MABA 2L3RA 3I3LA 5KYNA 2DOFA 2K9LA 1RKTA 2M0YA 8AT1B 1N8RU 2O31A 2LX7A 1QHGA 1O75A 3CPWS 5D5XB 4BNCA 4J9GA 2ODRC 5CYVA 1UUEA 2Q2EA 3N5BB 1UFMA 1UHMA 2JA5J 2X4XA 3H0FA 3VEPA 1MBFA 1KYZA 3EGXA 4C5GA 3ZN1A 2KROA 4YROA 1G3SA 3HEFA 1BN5A 4RAFA 2JK3A 3F22A 3MP6A 5A0DA 1FWZA 2ELJA 3F23A 2FF4A 2VKHA 3CBOA 2IS1A 2FL7A 3PVQA 5JHUA 1O3QA 1X4PA 4O3MA 1M8MA 1X1DA 4RBOA 2OC6A 2D1XA 1YHQA 1I6HJ 3ER0A 2G0EA 1EVLA 2W25A 2FUG2 3OYMA 3I4NJ 3MCZA 2QA4A 5GJVB 4P3NA 3G2BA 4J9EA 2ZZGA 3DQVC 3LYIA 2Z16A 2CKKA 3PE0A 2E6ZA 3RIRA 5B1BH 2QDLA 4JDSA 4B1RA 5IYDJ 4ZN3A 1HTTA 1BC7C 4YP0A 1SVLA 5DLQE 3MEVA 2DILA 4PNOA 2CUJA 2IJLA 3FXQA 4UV9A 5A2QK 3JV3A 3ERRA 1H4SA 2OU2A 2LZ6B 5GMKi 4L5EA 1TXQA 1C0WA 4CXFA 3V7SA 4IX7A 1WGXA 2MF2A 2GZWA 2LF8A 1X2KA 2F4MB 5FW9A 1MGQA 2G4CA 5JHFA 5LJ3e 1FYLA 5AONA 1TW2A 2D2WA 1P9QC 4BKXA 4KGXB 1VQMI 3MQZA 3GPLA 1KC8U 3JR9A 3FX3A 3G71I 3LGFA 1ZK8A 4HSTA 3TVTA 2QHSA 3JCMf 2BHZA 3PNYA 5K7ZA 2RREA 3H0DA 1F36A 1PUFA 1N77A 1WZOA 3M59A 4M77G 1RACB 2EYZA 5FWBA 3M4QA 1XSDA 2EPDA 1X6OA 4KUDK 5KYXB 1H4QA 2M4KA 2VBZA 5JLWA 4I09A 5FFZA 1H9TA 1F9NA 2JUCA 2JW4A 2RH2A 3IQLA 2MCNA 4YRRA 4KR2A 1X43A 2DMNA 1N5ZA 2L4MA 3HSFA 5LEJA 3MEUA 2MFZA 4J6WA 1KHCA 5D5VB 2EV6A 2XUBA 4QPQA 4BL0B 4DNCA 2LNHB 3QO5A 4M73A 3S93A 5J4VA 2RQWA 5K7HA 4FX4A 1USYA 4YRNA 1Y6IA 1YJ9I 3I56Q 3X2QH 1REPC 2LRQA 3RBBB 3CC7Q 1ZG1A 2MK5A 4HVUA 3JCMJ 3LWIA 1MBEA 2CP2A 1JEGA 1J3TA 5KCMA 3JB9I 1ZELA 2ZKZA 4E7SA 2P81A 2M51A 3LSSA 2FZCB 2GIZA 1UECA 1YW8A 2HQAA 3M07A 2KHMA 3WU0A 5BOXA 1ZLKA 3GTKJ 3S2DJ 1D8KA 3C4SA 2CQ7A 3EH1A 2HWVA 2YRVA 3CCQA 1MHNA 4XTUA 2GXBA 5KAIC 3I0TA 2HYFA 1V5FA 3HXZA 4C2TA 4MEXF 2BE9B 2WY7Q 2MWOA 4LDVA 3KZYA 5IXFA 3VFZA 5B3SH 3M54A 1JJCB 2NUPA 2X1CA 4JZ3A 3A5ZA 4YRTA 3BROA 3TEHA 1V55H 2PFBA 4U0VA 1QW1A 1KQSA 1V4RA 4AVZA 1AU7A 3CC4Q 2GQVA 1CKBA 3AL0C 2ECZA 4P96A 3SXYA 3S16J 3CUOA 2BIVA 3AT1B 2LK2A 3R0AA 1DPUA 2F5EA 3K2AA 2BE5F 1T98A 2CDTA 1ZSGA 2DYRH 3H0HA 1WPKA 1FYKA 4XK8E 2QA4T 2DFIA 3FXRA 4DEYA 1E1OA 3GFLA 2DW4A 1OZ2A 4E4HA 1B1BA 2WACA 3QBYA 4RMOA 4M75E 5FRNA 5GAMf 4OIQF 4CA0A 1QVTA 1VF9A 5K7FA 4ZYDA 1MBHA 2UUZA 2ENMA 3FJ5A 2CRGA 2HS5A 4UB8C 2RN8A 3I54A 1RI9A 5K5QA 1VFCA 1K0XA 3W3SA 3A8MB 2IW5A 1H0MA 3M9QA 1XTDA 4L9VA 1JJ8C 2VASA 3IKVA 3RI4A 3JCMQ 3G1OA 1QPIA 2FE3A 4D9JA 3QOEA 4BDZA 1VQNA 5EZHA 4IUPA 2FRWA 1D5YA 1SEMA 4WXHA 3A7UA 4DJAA 4GY5A 5E3LA 3QIIA 1O7FA 5IP9J 4EDUA 2NS6A 1USTA 5E3IA 1IXRC 3EUAA 3QXEB 3I59A 4PFOA 5CKEA 1S72Q 5J1RA 2AZVA 1TU0B 4FTHA 3I55A 1BL0A 2E2IJ 1X2MA 5M5YJ 3VYUB 4HQMA 3G6ET 1UCRA 2M0MA 4LG3A 4YIIA 2CJ9A 2ECBA 2DBMA 3BPXA 3IC7A 5GAMj 1PRLC 2OTJA 3V8JA 4CDGA 4M75A 3NTHA 3OOPA 1B72B 3MJXA 4C92E 4WJ4A 1L0WA 1QPMA 2VODA 2QQSA 1T2KA 2IRFG 3PQJA 2X6XA 5M3FJ 1UHWA 1B72A 2DA6A 5IP7J 4N4IA 3HRKA 4YRMA 4P5OA 2V4JC 1SC7A 2NUTB 4PLLA 3EG1A 2PQWA 4IIOA 3P5JA 3L2WA 2RJDA 2XDPA 2RK2A 1N75A 5HDGA 2LQ8A 4KFCA 1AWOA 1RRJA 4CS3A 1A04A 2LP0A 3NETA 2WV0A 4LLGF 2V8KA 1I1SA 4BS9A 1ZQ1A 1YITA 1STZA 3GCMA 4LE9A 2NXNB 1LVKA 1NG6A 3FXOA 1V29B 2ZPEB 2B86A 1PUFB 4KITB 2EQIA 3KIOA 1VQ8T 2Q5IA 2K4JA 4HDVA 4WWCA 5GP9A 2ZZDA 1FEXA 2BHYA 2IEKA 1VQ5A 2YRCA 3COAC 1F43A 1VQPA 2CWEA 2DA1A 3PL8A 5KYYA 3ZXSA 5EEAA 2JA7J 3I55Q 3CUQA 2V1QA 2C06A 4ZGEB 1SFXA 3LSKA 1ARKA 1OQYA 4HWRA 2JQ7A 1OISA 1W5TA 2QENA 4WXDA 3A8OB 3EFOA 2NAZA 3M0UA 1KQSP 4LVLA 2ZNIA 4HNTA 2J05A 3PFSA 4Y3OA 1JJ6C 3MF2A 3BR0A 2MI6A 2QXFA 5HCKA 4CHUA 4BI4A 1TTHB 1D3BA 2I8DA 1IN7A 1O3SA 4N4NB 1HW1A 2FMYA 3MZHA 2ZFWA 5FGMA 1FNNA 3KXTA 3JB9G 5KK1A 3SFZA 5DM7F 3CC7A 2P84A 2IGNA 2BY1A 4GO1A 2EFPA 3T0YA 2BYVE 3T8TA 1VIEA 2FO0A 5LLQA 1OCPA 2AXTC 3LAJA 4JLIA 3RNJA 3E97A 3C3WA 1JJCA 2DZ9A 2L5QA 5M3MJ 1JBMA 4IRGA 5L8RE 2XAUA 4ETSA 3HFOA 1X54A 4RB1A 4F92B 1YJNT 2GCXA 2DERA 3MWMA 3PQKA 3RMSA 4AMCA 1QKXA 5GAOm 4EEFG 3UA7A 4CH5A 3DV8A 4QWQA 2CJBA 4F52A 2VBWA 4AG2C 3HFZA 2Q7EA 3R6SA 2DU5A 3IUOA 2F2XA 1G8XA 2QCOA 2VJJA 3GF2A 4AYBA 3VYGA 5FLXZ 1I6XA 4WK8F 3CD6I 3OR2C 5E17F 2CW0F 1K79A 3PIPA 3QDRB 1K73R 1NYRA 3E7LA 4CCKA 3CC2I 3HUGA 3CP2A 3L09A 1NHAA 2DFFA 4BHBA 2DTZA 1FPQA 1BI0A 1K4SA 1VQMQ 4CH6A 2B0LA 4AD9A 2AMCB 4RQFA 4XLCA 3RDVA 4I76A 4CCOA 4YDQA 1ORKA 2HSEB 5KYWA 4M4ZA 2XGDA 3GOXA 3OL3A 2X1DA 2E3CA 1QO0D 2QGUA 2XAHA 4KNYA 3T1BA 3CCUA 4BHPA 2R7FA 3VU3C 2W24A 5GAN7 2LKXA 1OCCH 3BZCA 4F93B 2Y4YA 1K4US 1X69A 1TP4A 1XMXA 2W00A 1R5HA 4NNJA 3DTEA 4C30A 3A01A 2GXGA 3CEYA 2ME6A 4JOMA 1Z9QA 4LK1F 2G6FX 2IA2A 2VN2A 4V19K 1OYWA 2XKPA 2VIXA 2XRNA 2QBYB 2EJFA 1Q82R 5CCAA 4N0BA 1MBJA 2Y2ZA 2EB7A 1OFCX 1SD6A 1NM7A 1K83J 4UVAA 4C5IA 2PN6A 3CXCS 3OS5A 1K9MU 4HT8A 1OYIA 5E1ZB 2DU7A 2KRFA 1YS6A 3DLLF 1G3TA 3CLQA 3IH4A 5K1YA 3VRZA 4YCUA 1M8VA 3ISPA 2XASA 3ZOBA 1IB8A 2RNGA 2DIQA 2KMTA 4IQJA 1KMNA 5IT9E 2R7OA 4C3JJ 5EGOA 5CQYA 5LHIA 1VQ9Q 5E3OA 2L2OA 4RAGA 1LDDA 1JO8A 1X2QA 3BR2A 2DJIA 2DMUA 1W66A 1TNTA 4AWXB 1RAAB 1R0BG 2K79A 1SERA 4J9BA 1SESA 2ZPBB 4ZTFA 1ETOA 2ESHA 3C7JA 2LG4A 5IPAA 1PHTA 1MSFC 4R56A 1Y8RB 4E7IA 4J15A 4DW6A 3E5XA 4LB5A 3RJPA 2Y0SA 4LXCA 1KU2A 4XSZF 2CV1A 3HOYJ 4ORZA 1S5LC 3JTGA 3MP8A 2D1VA 4U88A