3V7SA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor 0364
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
total genus 98
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7sA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7sA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7sA02
1P92A 3A32A 4Q4ZF 1F1ZA 3HRMA 2GAUA 2HNIA 3MEYA 4H0EA 4AWXB 5KK1A 1SMYF 3F8BA 3L7WA 3QO8A 3WODF 1S6LA 1S7AA 2V1DA 2PFBA 5H6QA 4EO4A 2R7DA 3CTAA 1LJ9A 4PGHA 2QZ8A 4U0WA 2DK8A 4PJOB 2VC1A 3QAHA 4WXDA 1ZN2A 1REPC 3I59B 3WGHA 2ALYA 4MHGA 3GLXA 4UP7A 4WX9A 2JRTA 4R1HA 4DNCA 1K78A 4P71A 1DPUA 1KQ2A 1DDNA 4P3NA 2P4WA 2M45A 3SFZA 4C92D 1BI0A 1JHFA 1LEAA 4NOYA 4RDXA 3RGLA 2ESHA 2HTSA 1J2XA 3QU3A 1BM9A 3E5QA 4G9YA 2RM4A 3RERA 1P4XA 5C52B 2C8MA 5TJJA 1MD0A 4KR3A 2V1XA 2VBXA 3M4GA 3VQXA 2FQ3A 3KP7A 4MTDA 2EJGA 4CH4A 2ODRD 5GAOq 4XTXA 4TTVA 4IPAA 4ENMA 3LFKA 1IN5A 2VBYA 3WTWC 2QENA 5DV5A 1R00A 1NJ5A 4M7AD 1B70B 2O03A 5JFRA 3P9IA 2ZKZA 5D5WB 2P0LA 4P71C 3BROA 2JPCA 2QLZA 3DFGA 2VONA 2VC8A 4A2UA 3GF2A 1F9NA 2XIGA 4GYGA 1N9RA 3CO7C 4YFXF 2IY5A 4UVCA 1OYIA 1FYMA 1MDMB 5D5XB 2UXNA 2ZNZA 1FOKA 2ZIOA 3PFIA 5E1WA 1QNTA 1D3BB 4YCUA 3BY7A 5ILUA 4Y91A 3F8CA 1USTA 5CVRA 3JB9G 2NYXA 3RYPA 2XTIA 4YREA 2M30A 1AWCA 2DT5A 1YIOA 3JCMV 4LLNA 1T98A 3A5YA 4JLIA 1HW1A 4QLCU 4XTVA 5GAOn 5A2QZ 4HBLA 3DV8A 5F64A 4F7UB 4P5OA 5DD8A 2ZBKA 4HV5A 3QSUA 5GMKl 3GUDA 1I6XA 2IA1A 3SXYA 1Z7UA 4IF4A 5LHIA 3K2ZA 4HF2A 4HQEA 2HWVA 1JE8A 2EFPA 2E5AA 4LB6B 4S05A 2H94A 2ZXJA 4KDPA 2HQRA 2VT2A 4HLXA 4NHJA 2UZKA 4JUVA 1KU7A 3UGQA 4S04A 4OLFA 5LJ5g 4EM1A 3LQRA 4C92A 2NNYA 3HSFA 2PEXA 1H4TA 2FMYA 3V8KA 4G84A 1IXCA 1PP7U 3QTCA 4J15A 4UUVA 2QQ9A 5DDGA 4CDGA 2LF8A 4CH5A 3NEUA 4L18B 1IXSB 4M77C 1DUXC 2VXFA 5L3BA 4IJAA 2VN2A 4M78D 4E51A 4J6WA 2GA2A 5FLXK 1IN6A 2P6TA 3BP8A 1IN7A 1OR7A 5CJ9A 1GXPA 4UV8A 4QVCA 5GMKh 4ESBA 3JCMh 3JCMP 4OIRF 1H4VB 1U6GA 1Z91A 1YTYA 2EJ9A 3NELA 1R1VA 3N97A 5E8GA 1IRFA 4JBAA 5E18F 4ETSA 1G4DA 4ESFA 2ARUA 3HFZB 1USYA 1H0MA 2LF7A 4RS8A 4EMSA 2UWMA 2AMCA 5LJ5d 4M77A 5HDKA 1R58A 1ON1A 3L2ZA 2K4BA 3EETA 3HXYA 3W6JB 3VODA 4LMYA 2A3SA 1SD7A 2X0LA 4HF1A 2QVOA 1FT9A 3SQNA 2YR2A 4H2YA 4C92F 1I4K1 3HXVA 2MBFA 4PCQA 3WE2A 5ICEA 4GO1A 3DEUA 2Z99A 2F5DA 2RD1A 1OKRA 2P7VB 2B0LA 2ARSA 5LJ3e 2KIMA 3I58A 1P4WA 3VU3C 4EM2A 4ZTUB 4HWSA 5F5WA 3KE2A 4ENKA 3PZCA 2EA4A 3C18A 3K1PA 3W6KB 5D6EA 1G6NA 3N4MA 2Y75A 1BBWA 4QVDA 3M7GA 1ZH5A 2YLBA 1ZG1A 2VBZA 1HKSA 2P7CB 2XAQA 1IN8A 3GFIA 2DU5A 3TEHB 2NNNA 5HDGA 4UV9A 1Y96B 1KOGA 2I4MA 2MH2A 3P7NA 2M87A 3ISPA 1WWXA 4LFUA 1FZPB 4CICA 2WC2A 5AONA 1FSEA 4ON0A 3MF2A 1KQ9A 2UXXA 4K2EA 4LLLA 4KNYA 4KICA 1ZLKA 2Z5UA 3QNEA 4OP0A 2HTJA 4A5NA 4M7AE 4M75D 4JRKA 2ISYA 4CHUA 4H2VA 2PBIA 5LEJA 1A04A 1HSTA 3IWZA 3SWNC 4H02A 4HX8A 2WV0A 1FP1D 4WWCA 4ENJA 1W7PD 5D5VB 2CSOA 3ABTA 3BJUA 1G5IA 4P75A 4PJOF 1ASZA 2DFIA 2XAGA 3KP2A 1WPYA 5GMKj 2RB6A 4Y15A 1H4SA 2DLLA 3V7SA 1G51A 2DQ3A 3DSQA 1XCBA 3CLOA 3K1NA 4X5OA 3E6MA 3WU1B 2ZNYA 4M78C 1N9WA 3ABUA 4Y13A 4YRGA 3I5UA 2R7FA 5GMKi 1W7PB 1BBYA 3A31A 2EJRA 3KEQA 2AXLA 2Y90A 4YRRA 4OIQF 1EVLA 3HRIA 2HEOA 2E7WA 2YX7A 3F6OA 5HOOA 2DTRA 5CAIA 3HXUA 1EH7A 2CG4A 1U78A 1TNSA 4RAYA 3I0TA 2Q8KA 3U2RA 3R0JA 4M9ZA 2O0YA 4O6JA 5ICCA 3G3ZA 4N9IA 4KMFA 4HWRA 1KU2A 2FU4A 1GVJA 3BPXA 1Y96A 2RV8A 4M75E 3TQNA 2VBWA 3JAMK 1YW8A 2L4AA 1ZGJA 2M5WA 1XD7A 2WTEA 3T8TA 4YG2F 1LDKB 2QYOA 3ZMDA 1PYSB 5LJ5e 4F7UA 5AIPA 4ZTZB 4RB0A 1X01A 1B9NA 3TDUC 1YB3A 4P9FA 3QOPA 2OZUA 4F7UF 4XLNF 5DUKA 3QO7A 5FFXA 1XN7A 2BEOA 3IKVA 2MH9A 1U3EM 1NJ2A 3ELKA 5HLIA 3GW2A 3KFWX 4HT8A 4PJOC 3RTRA 3WTYC 4H2XB 2OD5A 5ILVA 4GGGA 1I27A 3Q9SA 1IXRC 1TW2A 4XTYA 4H2SA 4BQAA 4ENNA 3A74A 1GHCA 4U0VA 5ICFA 4EJUA 2RHQB 2PMUA 2RC4A 4NL2A 5E17F 1B7YA 4Z2YA 1YFTA 2KRFA 2F5FA 3REXA 1LOJA 1ZLJA 1KMMA 1GXQA 1B34A 1XSXA 4M7DD 3R07A 4C8QC 1B70A 4ZIBA 3EYIA 3JCMX 4M7DA 4YRNA 3V7CA 1E1TA 2I4NA 2L01A 3BZ6A 3GFMA 4HLYA 3HHHA 4IVNA 2I2LA 2JTVA 1OMIA 5K1XA 4M73A 5BPDA 1IN4A 2EFWA 1X56A 2DZ9A 5ELNA 5J8FA 2VE8A 3ZMVA 1ASYA 2HKOA 1ZRDA 3NRVA 3JCMg 5GANj 3IC7A 3E5XA 1B8AA 3ZMZA 2XHKA 2ARTA 4RQEA 3CO6C 3TKYA 1FBSA 2HZTA 2EL9A 2GXGA 3JTHA 2FA5A 5JR3A 2DZCA 2DPDA 3KEOA 3HRSA 1BI3A 4A6EA 4KR2A 3EFSA 3VBBA 1HQCA 1IZ1A 4N9HA 3RL6A 1JBMA 3WU0A 1G3TA 4A12A 5GAMh 4P73A 4Y17A 1ZAOA 2RGVA 1R5HA 4JRIA 1I81A 2L54A 3TOBA 2ZTGA 4L87A 3MAJA 2ZCWA 1MJBA 3F22A 3E6CC 3GO5A 3G73A 3QRFF 3U1DA 1J5YA 1YW7A 3DP7A 5CYVA 1Z1DA 3M9AA 3PGGA 3K69A 2FNPA 4N0BA 4YRQA 1T0FA 3JW4A 3H92A 1EIYB 3KP4A 4BHBA 3MCZA 5GAMd 4R8HA 4M77D 3HUGA 4LG0B 1P2FA 4G85A 3IKMB 4I0BA 3WTTC 4G8XA 1CGPA 1NYRA 3RPUA 4OIPF 1B6AA 1MGQA 1SAXA 1SD5A 4M78B 2VXZA 2CIMA 3HHGA 4JK1X 3OV8A 1R7JA 4U0YA 2STWA 4NCXA 5LEKA 1TNTA 3AAFA 1RI7A 4G94A 1PDNC 4FX4A 3UH0A 5DY9A 3QPHA 5GMKe 2XGTA 2L3DA 5CVUA 1QE0A 1O3TA 4HVCA 2V9VA 2I4OA 1R36A 1SETA 1EV7A 5GAN2 4YROA 5I21A 3A7UA 4H2UA 1U2WA 3GZ5A 2LDUA 2Z3YA 2H6CA 4WJ4A 5BMZA 3RI4A 4Q5SF 3HOSA 1J0RA 1LNWA 4KT5C 3A7RA 1Z7NA 2J5PA 4FX0A 3E97A 3JCMJ 4KUMA 1KQ1A 1Z6RA 4K88A 4M77F 1WSUA 4HX4A 2IT0A 1LDJA 3S2WA 2DDZA 4HAMA 3REOA 2PG4A 3SHFA 3P8TA 2FBHA 1BIBA 5FO5A 3T8RA 3IKTA 1OYYA 1QZYA 3ULQB 4P75C 2C7IA 1JGSA 3RIRA 1S29A 1WQWA 2DJZA 5LJ3h 4IRIA 2J3LA 4MMKA 1B4AA 1D8JA 5GAN6 5BQTA 3SWNB 4M6XA 1E24A 4J6YA 3V7RA 2D1VA 1F5TA 4M75A 4AIKA 2ZINA 2MD5A 3PQJA 2GZWA 4BW9A 2F2EA 1FLIA 4HWOA 3OD1A 3VOEA 1ZG3A 2DXUA 3FHZA 5DCFA 4CH3A 2IRFG 1LDDA 2O8XA 4NQWA 1WU7A 1YYVA 1R23A 4LGWA 5F6FA 2Y48A 3A7AA 4CZZA 5FB2A 1OPCA 4F7UG 1O7LA 4KQEA 4G7HF 4EM0B 2ESNA 3FMSA 5LBQA 5E20A 1JRIA 1NYQA 1KA8A 2ZT8A 2W57A 1HC7A 2W85A 4A0YA 2QHSA 4P96A 3L1AA 4IRHA 1KU3A 4H2WA 4EQQA 3GFLA 5HVQC 2Q5IA 4WXHA 4AVPA 4BYYA 4K87A 5E3IA 4IHTA 4LB5A 2DAOA 1R5GA 2HOEA 1ADJA 1KMNA 2EK5A 2J3MA 4I01A 4BNCA 2CJAA 3CDHA 2DEQA 1L0WA 4IXAA 4C92B 4A54A 3L4GA 4XU2A 3P9CA 2E1HA 5LGUA 1P6RA 4CS4A 1G3SA 3ZN1A 3R0AA 1R22A 1ADYA 4XTZA 2JN0A 1WNLA 3C3WA 5FD5A 4YRIA 2PMEA 2EV0A 2PMHA 3K9TA 3TO9A 2XASA 2K7LA 2EWNA 3U9GA 3GIBA 4P73C 2K27A 2G7HA 1FYFA 2LNBA 1X54A 3JB9J 5DYMA 2ZIMA 5DCMB 3H3UA 3GFJA 4D0PA 3J80Z 4QWQA 1XGNA 2V1UA 2RKHA 3ZQ7A 4P55A 1O7FA 3V8JA 1X55A 1YGBA 1FNNA 4EV0A 5KNNA 2FMLA 3L9FA 2C6YA 3WGIA 2XKOA 4M7DE 1I5LA 5GAMf 5JHUA 2E1NA 1K6OA 3WTXC 3BDDA 3HOTA 2ZT5A 3B73A 3ERED 2HGCA 4EMKA 1BJAA 1IW7F 1BI1A 3F8NA 5GAN8 4JQFA 3JAMZ 4P3OA 4CO8A 4HF0A 4M77E 3HFVA 4KIBA 3Q5FA 4K86A 4EJWA 2XGXA 3QP6A 3JCMQ 2GXBA 1L0OC 2E10A 4I98B 1U1TA 2PJPA 4HZFA 1RUOA 2A07F 1LB2A 5LJ5h 1MJAA 1C0AA 1LQ1A 3DKWA 4IHSA 1OYWA 2RNJA 3ZMTA 3AHUA 5L3GA 4YYEA 1ZHFA 4TV7A 1E17A 4CS3A 4OU0A 2DO7A 3FF5A 4U88A 3RKXA 2QTXA 4UP9A 1XDSA 1H9TA 5LJ3f 2HDCA 1HW2A 3GZ6A 3M8EA 1LJOA 2OAZA 2P6SA 4EMGA 4M75F 1SFUA 1LNXA 1K7AA 3SZTA 4C8QF 3LWFA 1J75A 4U7DA 3T0YA 5GANd 1LEBA 2QHVA 1QF6A 4UVBA 3TGNA 2JSCA 3FZVA 2VT3A 2GWRA 4N0AC 4CGZA 4J5YA 4XLPF 3TDZC 4MGRA 5K5QA 3KZZA 5DD4A 4PGGA 4M78F 3J81Z 1HBXG 2DQLA 3LAPA 3JB9I 1SESA 4L0YB 4RGSA 4ZYHA 2Z9OA 3HTZA 2GQQA 1KQ8A 3W3SA 2M8EA 3P8VA 3IHUA 5GAN7 4TVAA 1TQMA 2MLKA 4G6DA 5LLQA 1DP7P 2YHTA 1Z9CA 2P8TA 4M78E 4XSZF 1RUNA 4YRPA 3I64A 3KETA 3QO3A 2FXAA 4FHTA 3WG9A 1FP2A 4UVAA 2K86A 3HSRA 1H641 1W5SA 3D5LA 4YIFA 4TVAB 4KYWA 3B02A 2H6BA 3KP3A 4UXNA 3QO5A 1U5TC 3MZYA 5LJ3j 4A0ZA 4C92G 1XCVA 2QQBA 1SERA 1ZARA 3R4KA 5EEGA 1NJ6A 4EJOA 3NQOA 2IY5B 2HYGD 1J59A 4B09A 5GANh 5GAN4 1S3JA 3HY1A 3DXJF 4EGYA 3T1BA 2W84A 5CVVA 5GAMe 2BBYA 4O3MA 4LK0F 3WE3A 2ZGWA 3FXUA 1FC3A 3G1ZA 3K1MA 3L09A 1R1TA 3I7FA 4YFNF 3FXRA 3CUQB 2EAYA 2YLCA 2HR3A 3KCCA 2EB7A 5LGNA 4P72A 4HYEA 5HLHA 2CW0F 3LA3A 1H9GA 4ZYGA 2PLYA 4ESJA 2EV6A 4XRFA 2ZMEA 2OU2A 2IA2A 3TO7A 1MZBA 1SMTA 1BN5A 3ECHA 3F23A 1ZYRF 1PYSA 3ZMUA 3VQYA 1Y0UA 3UFGA 1IUYA 2CFXA 2A5YB 1VTNC 2A69F 2COMA 1EFWA 2XV4S 1EQRA 2V6CA 2EFNA 3GYHX 2IJLA 4NL3A 3M8FA 4OINF 4PHCA 4YRSA 4M7AB 5L3CA 1T6SA 3QHSA 4HDVA 5LJ5f 5D4RA 2P5IA 4UPAA 5D6FA 4KN4X 4ZYEA 3SZPA 3VQWA 4A53A 1D3BA 4M75C 2G4CA 3BJ6A 3FM5A 4MNUA 2QHTA 3FX3A 4M7DF 1I1GA 1EOVA 2I4LA 4YRTA 4G6QA 5E8IA 2DPUA 4EJVA 1BI2A 2QQAA 4R79A 3KLOA 5J8CA 2OZ6A 4LNSA 4M6YA 4OIOF 3SB2A 3LSSA 1N9SA 1YO5C 1XMKA 1HTTA 1FYKA 4BWAA 1KQ0A 2XUBA 4YRLA 1FYLA 4M9XA 4TQDA 1USSA 5GMKm 3I53A 4X9CA 3GWZA 1S7OA 4RB2C 3O3KA 3P8YA 3HXWA 4LK1F 5HS8A 4XU1A 2AMCB 4ASNA 2OBPA 4GYIA 3GEZA 2VE9A 4M78A 3IL2A 3HIFA 3A5ZA 4KIGA 4XTUA 2E1CA 1YS7A 4O2DA 4EVIA 5LGTA 1SFEA 1D5VA 1W7PA 5K1PA 4Q15A 1B34B 5DEQA 2E3CA 1T39A 4P9UA 3BW1A 5C51B 3FIFA 2HFHA 4KA4A 4MMLA 4YP0A 1E1OA 4P3PA 1IL2A 3JCMc 5IT3A 3R61A 1ZREA 4GCVA 4M71A 3HRTA 3TO6A 2W24A 5FGMA 3BY6A 4C8QG 2D45A 3LA7A 4M7AF 4PG3A 2LSOA 2R3SA 1NNHA 5DCMA 5LRSA 4ZH4F 1F4KA 2JPBA 4YFKF 1U5TA 3PCOA 1DPRA 4M75B 2K02A 4M78G 4L9TA 4C8QB 1TW3A 1P4AA 3EDPA 1W4MA 1TQPA 2A61A 2QM3A 3REUA 5K5RA 2OQGA 4O5VA 4L0ZB 4XTWA 1V4RA 5BS6A 1AOYA 3TOAA 2IW5A 2ZNJA 4PJOE 5KVRA 5L3EA 2STTA 3HTSB 4WCGA 2LKPA 1B9MA 2Q7HA 4OMYA 2ELHA 2EV5A 4C92E 2GA1A 3RPQA 4HA8A 3QP5A 4P74C 5LHHA 3QU6A 1W66A 3IRRA 5GANf 1E2XA 2RQPA 1YS6A 3LSTA 4EMKC 1J9IA 1SD6A 2J5OA 3JSOA 3E5UA 1TTYA 1NHAA 3J80K 3J7AO 3R60A 1TH7A 3VEPA 1BBUA 3KZYA 5CLSA 1LVAA 1ONVA 2P5KA 4P72C 1B7YB 2DW4A 2XAFA 1RIQA 2IA0A 2ZZEA 1Z7MA 3GXOA 4OOIA 1W5TA 2NAZA 2ZFWA 5GAOl 4EX5A 2E7XA 5K5OA 1O3RA 4CXFA 3QPTA 3IRQA 1YG2A 2AS5F 2BE5F 2VOPA 2FRHA 3ROUA 4ZZDA 1KYWA 1C0WA 3HSBA 4EJTA 4M7AG 2Q7GA 2XAJA 3TUPA 2MC3A 2FE3A 3DPLC 2X4HA 1XGMA 3P9KA 3BFMA 5F1RA 5HLGA 5JI6A 3IALA 3HRUA 2OA4A 4TVWA 3KP5A 2XRNA 4WXCA 4HQMA 3C7JA 3H3ZA 3IG2A 1I1SA 2DKGA 4HDUA 2FNAA 5HS7A 1QGPA 2G9WA 3MZHA 3HXXA 4HX7A 2ZMEB 4AD9A 1B59A 3UGTA 2CJ9A 1YQAA 4YDQA 4M75G 2Q0OA 3PCOB 1RIOH 3EFRA 1L3LA 1M8VA 3NENA 2AKWB 5A2QK 4LG0A 2E64A 5LJ3d 2HQNA 4LLGF 1BOAA 3E6DA 4E70A 3COAC 1ODDA 1EH6A 4HW0A 2BYVE 3JB9D 3V4GA 2H09A 2ZZFA 2PI0A 3JCMW 4Q6GA 3BDUA 4RB1A 2GIVA 4BAYA 3WTUC 1XSVA 2ZNIA 4MQ9F 3R6SA 1RZ4A 1PUEE 2ZR3A 1WI9A 2Q2EA 2JT1A 2E65A 1R1UA 1QZZA 5GAOr 1KGSA 3EUHA 1K79A 1ZG5A 2ZXFA 4M7DB 4P74A 2RHSA 1WQ2A 3VFZA 2IPQX 1U8RA 1U5TB 2YPRA 4RCBA 3E3VA 1YW9A 3CJNA 4I2OA 3HXZA 4C8QA 1E22A 4WJ3M 1VQZA 2DTHA 1FBUA 2HYFA 2YU3A 4F7ZA 5GANe 3DQVC 1SRYA 2MA3A 2E41A 2Q7EA 1ULYA 4AIHA 5K1YA 2EFOA 4HWTA 1I5ZA 4G7ZF 2K57A 5ELOA 4ZZLA 3JB9F 2DXTA 3ECOA 2RN7A 4XSXF 3TEHA 4WK8F 3WQZA 3JCMb 2DU9A 1UHWA 2MLGA 3WTSC 2FBKA 1HW5A 3M4PA 2XKPA 1YCYA 2CJBA 1XGSA 3RESA 1X2GA 2IVMA 5ED4A 4G7OF 2OQRA 3EYYA 2O3FA 4C8QE 3CUQA 1YFRA 1NJ8A 2G7UA 1STZA 1SD4A 4WF2A 2TDXA 3LA2A 3FXQA 4MEXF 5ERIA 1O3QA 4HWPA 4YIIA 5L3FA 4RGRA 1YLFA 5HS9A 2EFQA 2VC0A 2IP2A 5ICGA 4I0AA 4PNOA 1JJCA 2Z33A 5ILSA 1GGMA 2ZT7A 3RACA 5CVIA 2AKWA 3EQLF 2YX4A 3VQVA 4PJOD 4A6DA 2XAHA 4HOBA 1HSJA 2CO5A 2FB7A 6PAXA 3MFKA 2HS5A 3JSPA 4XQ3A 2D1HA 3JB9H 2ZO4A 1JJCB 1FWZA 4L5IA 3M1EA 2A6HF 4Q48A 2PQ8A 3L00A 1M5Q1 3BOQA 1EH8A 5FFZA 1B1BA 2NS0A 1SFXA 2O61A 1YFSA 2BGCA 5HDNA 1X2HA 2A6EF 2KIFA 5D4SA 4UNOA 1K78B 2QHUA 1B76A 3I4PA 3LQQA 3L4GB 2L02A 3ZMSA 3FJPA 2M1BA 4AH6A 3INZA 1JHHA 3RUXA 4BH9A 5JVTA 2XROA 3FWEA 3JTGA 1FX7A 5L3DA 5GAOm 2A68F 1U1SA 2CGPA 2QBYA 5HGQA 2RDPA 4HV6A 5LHGA 2Q5HA 3GVAA 2QWWA 1BC8C 1MDMA 4YPFA 2JZYA 5IT9Z 2KIUA 2KJCA 1FPQA 11ASA 3DF8A 3HFZA 4M7AC 4N0AA 5D8KB 3FMQA 2DTIA 5H20A 3ICAA 4TWAA 1O57A 4A0XA 4M7DG 3F3XA 1Q1HA 3HY0A 3JCMd 2F5CA 3RJPA 4AIJA 1YFHA 4YCWA 3FMRA 4TVYA 2L4MA 3SWNA 3TEGA 1WYDA 4CS2A 4RQFA 1G3YA 3C1DA 3T5XA 2RHSB 2ACJA 2V79A 1G5HA 2H27A 5AIQA 4M7AA 4EMKB 4L9JA 1J7KA 1BC7C 2CGHA 1UHMA 4YRKA 4M77B 3HFOA 2O6GE 5LRRA 4I02A 4YRCA 2FEZA 3BPVA 1S8NA 2QBYB 1H4QA 4M9SA 4RMFA 2DQRA 2P5LC 1T2KA 3QUIA 2DVEA 3WTVC 4M74A 1IF1A 3F72A 3NEMA 3O2PE 3FM3A 3ERRA 3KLNA 1WQ7A 2ALYB 1KYZA 4DQ2A 4I7HA 4C8QD 1CF7A 2ZCEA 1QPMA 2F5EA 3L2CA 3WTZA 4IRGA 3LAJA 2ISZA 3D0SA 5FLXZ 1XMAA 2W25A 1I8FA 3GX4X 1TBXA 1FY7A 5E1ZB 2ZJ2A 4L9VA 1T38A 5TRDA 4XBFA 4V2SA 4F7UE 1XDUA 2ZZGA 1KU9A 1CF7B 1EVKA 3HFNA 2FBIA 1RNLA 5GANg 2FOKA 3V8LA 4DPGA 3F6VA 2CWEA 3RKWA 1EIYA 4L5JA 3JCMe 1D3YA 4PJOG 3E9IA 4M7DC 2WWYA 2YSRA 3FB9A 3J81K 2VODA 3ZPLA 2DQ0A 4H2TA 1Z6TA 2DBBA 4PZJA 1XB4A 5GAMj 5GAMg 2ZT6A 3K0LA 5FD6A 4B8XA 1XGOA 4LD5A 4ZYDA 2D2WA 2ZR2A 3F8FA 1IAWA 4LJZF 1O3SA 5GAN5 2KKOA 3Q9VA 2ODRC 5CVJA 4H2XA 1QBJA 5C53B 1X3UA 2EA2A 2P5VA 1QO0D 4TQFA 1UFMA 4RAZA 3RYRA 5BPIA 1FBQA 1ZGAA 4BXUA 4PJOA 2RHQA 2Y0MA 3ZN0A 3HRKA 1HKTA 2ETHA 2HKXA 5EEHA 3O6BB 1ATIA 1QQIA 3DPTA 1D8KA 2FF4A 2NRAC 3KFUA 5DUIA 3VB2A 5J6XA 2EJFA 2RA2A 1HK9A 3PQKA 2FSWA 5LJ5j 4NB5A 3ML6A 2DI3A 4BHCA 3MWMA 2DU7A 3MQ0A 3OOPA 1HKQA 4CH6A 4YRMA 4FT8A 3I71A 3MF1A 4RB3C 1Z05A 1WLEA 1LYLA 1V3FA 1WKMA 2CQKA 4MTEA 1MJ9A 2VXEA 4Q47A 4J6XA 3CMQA 3BWGA 3E9HA 4KN7X 1ZRCA 2QUFA 4BHPA 1HXDA 3KP6A 3M4QA 2KJBA 4XEOA 5D5UB 5GAOp 4A5MA 4YCVA 4U7BA 2DK5A 4I09A 1UB9A 3LSQA 4L9NA 3LC0A 4RGXA 2DTOA 2RVCA 4KMUX 4RGUA 3RDIA 3CUOA 3WGGA 1BIAA 4XU0A 4RCCA 2ADUA 2XVCA 1TQIA 4GXOA 1MGTA 2CYYA 4MQVA 4XU3A 4C92C 1TLHB 5BOXA 4KFCA 5GAN3 3E6BA 5IT9K 4UP8A 4YRFA 1ON2A 2BV6A 3BJAA 4WI1A 4M77G 4EMHA 2VOOA 1ZRFA 3NETA 2K4JA 3JCMf 1IRGA 1J5WA 4HT9A 3MEXA 4X9DA 3F21A 1NJ1A 2PMFA 3HTUA 1G3WA 12ASA 3IKLA 4CYDA 1WRJA 4EGZA 4OMZA 5H6RA 1JXSA 3BJOA 4PDKA 3I54A 4MEYF 3IWFA 1PP8F 3RF1A 4XEMA 4M72A 3ZP5A 4YRJA 5E1XA 4KIFA 1UCRA 4UHTA 5D8LB 3RKYA 3CUQC 3HSEA 1USYC 1MKMA 1XSDA 5LJ3g 2PN6A 3F8MA 3HYIA 2FYKA 1FSHA 3I59A
chains in the Genus database with same CATH superfamily
1UB4A 1P92A 2UUZA 1AT1B 3UR3C 1JKPC 4Q4ZF 2EBPA 1F1ZA 3GP8A 3A32A 3HRMA 3I9QA 2GAUA 2HNIA 3MEYA 5KNLA 4LXCA 1IDYA 4AWXB 4H0EA 1QVGA 5KK1A 3MKLA 4BUGA 5D7UA 1SMYF 1E0EA 2EIKH 2DD5A 2K7AA 2YWWA 3F8BA 2HYJA 3L7WA 1FTZA 2IGNA 3WODF 1S6LA 1S7AA 2V1DA 2PFBA 5H6QA 2CUEA 3PIPF 1WH5A 2OC6A 2R7DA 3CTAA 4EO4A 1LJ9A 4PGHA 1OLTA 1SVMA 2QZ8A 2DK8A 2XGCA 4U0WA 1PRMC 4PJOB 1X3ZB 2LJ3A 2HQHA 2VC1A 3QAHA 3TBIA 1HSQA 4RA2A 2EVRA 4WXDA 1ZN2A 1REPC 1YIJI 2VIXA 3I59B 2M3AA 3WGHA 1AVZC 1QMCA 1LPLA 1IJWC 1VIEA 4MHGA 5C44J 2YUNA 3GLXA 2CUDA 2G0EA 4WX9A 5DM6F 2JRTA 4II2A 2ZPIB 4IEJA 1S5LC 4R1HA 3ZL7C 3G1MA 4DNCA 1K78A 1QP2A 2V8IA 4P71A 4FASD 4J7FA 3FXMA 3NAUA 5E79C 4CUGA 1DPUA 3ER0A 4C5HA 1KQ2A 5FKLA 1DDNA 2HL3A 5I22A 4P3NA 3BLYA 1SRLA 2P4WA 5KYNA 2M45A 3SFZA 4LE9A 3G4SI 3CXCA 4C92D 1BI0A 4BBRJ 4LD9K 2K2VA 1JHFA 1LEAA 4NOYA 1VQ4I 4RDXA 4HT4A 2XHCA 1MMDA 3RGLA 2DFEA 2PX9A 2ESHA 2DA1A 2HTSA 1J2XA 3FISA 1YOVB 3QU3A 2QYZA 3UA6A 4MIMA 1ZQ1A 3CBOA 1BM9A 2HVSA 3E5QA 4BE1A 4N4OB 3EG1A 4E47A 1KK7A 4G9YA 2RM4A 3RERA 1P4XA 5C52B 4OAYA 2C8MA 4KH1B 5TJJA 1MD0A 4A3CJ 1NYFA 2V1XA 2VBXA 3M4GA 3VYHB 3VQXA 2FQ3A 3KP7A 4MTDA 1B72A 2EJGA 1W70A 2ODRD 4CH4A 5GAOq 4XTXA 2GOMA 2ZXHA 3LSIA 1VQ4T 4TTVA 4IPAA 4ENMA 1G59A 1JT0A 3LFKA 3RNJA 1PM3A 4HSTA 1O9SA 3OS1A 2GF7A 2ELKA 1IN5A 1R5ID 2VBYA 3SDGA 3WTWC 1EA3A 2QENA 2VQHA 3MZ8A 3ZCOA 3GTGJ 5DV5A 2R7VA 2PUKB 4N4HA 1R00A 2ZSHB 4Y3OA 4V2FA 3LH5A 4QPOA 4EIKA 4M7AD 1NJ5A 3GTLJ 1B70B 2O03A 5JFRA 1ZSZA 2FHDA 2QI2A 1VIFA 3P9IA 4E4HA 2VGNA 3FRNA 1TTHB 4JS5A 2MWPA 4A3EJ 2ZKZA 5D5WB 4DOZA 2FPEA 2P0LA 4P71C 3BROA 1DU0A 2IG0A 2JPCA 3JRAA 4BKXA 1Q81U 1KQSA 4BXXJ 2QLZA 3LX7A 2CKKA 3DFGA 2VONA 2VC8A 4A2UA 1M1KC 3GF2A 3BG5A 1F9NA 1WFXA 2V26A 2XIGA 5K7ZA 1HF0A 1FTTA 2DYIA 3GTJJ 4GYGA 2BW3B 5IN1A 1ZBJA 4BU2A 3LWIA 2HQ5A 3QYFA 4HNVA 2L2OA 3CO7C 4A3FJ 1N9RA 4YFXF 1PC0A 2E70A 5IXFA 2IY5A 1VQ5A 4UVCA 5FRMA 1ZA2B 5IHKA 2ZSIB 4DA4A 1OYIA 4BACA 2CSQA 1Z3YA 1FYMA 4ZDOA 1MDMB 1A35A 2MG4A 5D5XB 2UXNA 1Y1VJ 2ZNZA 1FOKA 1LCKA 2ZIOA 3PFIA 2EIMH 2VXDA 1QNTA 5E1WA 2C0OA 4UY8I 1D3BB 4II3A 1T95A 2PMZA 3FK6A 4YCUA 3BY7A 3KZIC 3OW2S 5ILUA 4Y91A 3F8CA 1USTA 5CVRA 2M4KA 2F5TX 3JB9G 3VYRB 2NYXA 3VYSB 3RYPA 3SDBA 3D1NI 3UKGA 2L9SA 3G4ST 2XTIA 4YREA 1NG6A 3BTIA 2M30A 3M0PA 5IH2A 2E71A 1AWCA 2DT5A 2R5ZA 2K3XA 1YIOA 3JCMV 3VS1A 4LLNA 2ID6A 1T98A 2ABLA 3A5YA 4JLIA 2EINH 4HVVA 1HW1A 4OWRB 4QLCU 1RLQC 2IS4A 4XTVA 3CCQQ 5GAOn 3E0JB 5A2QZ 1GXIE 4HBLA 3DV8A 1P7IA 1TZLA 5F64A 4F7UB 3MKDA 5CQYA 1YJ9Q 5M3MJ 3BG9A 4P5OA 5DD8A 2HQXA 4G6TB 2ZBKA 1NJ2A 4HV5A 3QSUA 5GMKl 3A5ZB 1TSFA 3FBIB 3GUDA 1E3OC 4BY7J 5CKHA 4KITB 3C0CA 1TT0A 1I6XA 2IA1A 2OF7A 3SXYA 4F93B 1Z7UA 2KMUA 2WB1N 4IF4A 3K2ZA 5LHIA 4IUQA 4A4EA 4ELZC 1R0BG 3H9JA 3PL8A 4HF2A 2RQRA 4HQEA 2HSPA 2HWVA 3OS2A 1JE8A 2EFPA 2E5AA 5IHIA 3G71A 1N8RC 3QZ5B 4LB6B 4M3BA 4S05A 3OYFA 3A01A 2AK5A 4YRFA 2H94A 2ZXJA 1X2NA 4UP8A 4KDPA 4E7LA 3EGXA 2HQRA 2K3FA 2VT2A 3CCLA 4HLXA 1ZHIA 4NHJA 2UZKA 4JUVA 3LSKA 1YJWI 3R6NA 1KU7A 2HKNA 4S04A 3VRZA 3CCEA 4OLFA 4IUVA 1NEBA 3UGQA 3I35A 5LJ5g 3BC8A 1ZR4A 3DKYA 4EM1A 2QDYB 2BY2A 3LQRA 3QWLA 1D0ZA 2OV7A 2NNYA 4C92A 3HSFA 4RG8A 2PEXA 2R7UA 3OYBA 1H4TA 2FMYA 3V8KA 3LSMA 1IXCA 1X6GA 1PP7U 2AHQA 1UECA 2SRCA 3QTCA 4G84A 1WDXA 4J15A 4UUVA 2QQ9A 1F43A 3THKA 3S1NJ 3FJ5A 3META 1UGPB 3PIPA 2DOFA 4JOMA 5DDGA 2ZZDA 2QGGA 4CDGA 2LF8A 1SANA 1SHFA 2YXYA 4CH5A 2FL7A 3OSGA 1NYGA 1S72Q 3NEUA 3CMAQ 4BJ6C 4AM3A 2HNHA 5A2QE 4PFPA 1OZ3A 4UP7A 3CCET 4LOCA 3C2HA 4NNJA 4L18B 1VQKI 1U5SA 4B6MA 1IXSB 5IPAA 4M77C 1DUXC 2VXFA 5L3BA 2DERA 4IJAA 2VN2A 1TU0B 3E7LA 4J6WA 2W1OA 4M78D 1S72T 4E51A 2GA2A 1D09B 1VQ7I 5FLXK 1IN6A 5GPCA 2P6TA 3HOZJ 3BP8A 2IGOA 2P0WA 2JVVA 4YRVA 1IN7A 3MMYB 2EPFA 1OR7A 5CJ9A 2NXNB 2KQWA 1GXPA 5K7FA 3ABKH 1JKOC 2GTJA 1T0FC 3EGXB 2QSFX 4UV8A 4RUGA 4QVCA 2R7WA 2K79A 1QKWA 5GMKh 3BQZA 3S14J 3MEVA 4ESBA 3JCMh 3JCMP 1SPKA 1YJWA 4OIRF 1H4VB 1U6GA 4ESRA 1Z91A 2LFBA 1YTYA 2E36A 3M3YJ 1R1VA 2EJ9A 3CF2A 3NELA 1JJ2P 3N97A 5E8GA 5EG2A 1IRFA 3BR5A 4JBAA 5E18F 4ETSA 2X3XD 1G4DA 4ESFA 2ARUA 3O8VA 3HFZB 1X2KA 1USYA 1X1DA 2GXAA 1H0MA 2W82A 2LF7A 4RS8A 1EKEA 4EMSA 1YITI 2UWMA 1R6RA 5LJ5d 2A8EA 4IX7A 2AMCA 4M77A 5IOZA 2COYA 3QPLA 2LCCA 5HDKA 5AT1B 1G8XA 1R58A 2OTLQ 1ON1A 1IUFA 3L2ZA 2K4BA 3EETA 4JPBW 4OGCA 1Y57A 3CMAT 3HXYA 3BDLA 3W6JB 1K0XA 1BJZA 3VODA 4TVAB 3IH3A 4LMYA 2MYSA 3MP8A 2A3SA 3CCUT 1VQNQ 4OMMA 1Q1VA 1UAAA 1Y7XA 1SD7A 2X0LA 4HF1A 2O88A 3I55T 2QVOA 1FT9A 3LFUA 3SQNA 2YR2A 4H2YA 4C92F 1I4K1 2E5NA 2HOSA 1X43A 2MBFA 4PCQA 1VQ7T 3WE2A 5ICEA 2ZR3A 3HXVA 4GO1A 4MO7A 3DEUA 2EH3A 2Z99A 2F5DA 1WFWA 2RD1A 2RQWA 4BL0B 3MJXA 3UA7A 1T3SA 1OKRA 2P7VB 2B0LA 3HXLA 2ARSA 5LJ3e 3AG4H 4GFBA 2KIMA 4XM3A 3I58A 4ABZA 1P4WA 4C3IJ 3VU3C 4EM2A 4ZTUB 2LYCA 4MFEA 3DBRB 1S7EA 3QOEA 4A3GJ 4HWSA 1H8AC 4JP0A 5M5XJ 3EUHC 2KR3A 2QXFA 3CD6A 5F5WA 3HOXJ 3KE2A 4ENKA 3PZCA 2EA4A 3C18A 3K1PA 4PKCC 1LKXA 2HDWA 3W6KB 5D6EA 3OSVA 3EG9A 1G6NA 3N4MA 1NEGA 1PCXA 4BJTA 2Y75A 1BBWA 4QVDA 4P1WA 4JRPA 3M7GA 1ZH5A 2RNAA 2YLBA 1YJNA 1ZG1A 2PNIA 2M1HA 2VBZA 2F6CA 1HKSA 2P7CB 1RABB 3EH2A 3TQ7P 5M5YJ 2AZVA 2IGKA 1XMXA 5CPRB 2XAQA 4D7MA 1IN8A 3LSJA 3J80E 1D1CA 3GFIA 1M90U 2DU5A 4DBQA 2O9SA 2RF0A 2RHYA 3TEHB 2I10A 4H2UA 2I0NA 2NNNA 5HDGA 4UV9A 1Y96B 3CPFA 3LOCA 2I4MA 1E6GA 1HJDA 1KOGA 2CS7A 4LDUA 2MH2A 3TSZA 1QWEA 3P7NA 2M87A 4KULA 3ISPA 2QG9B 1WWXA 4LFUA 3VS3A 4CICA 1FZPB 2LMDA 2WC2A 2F2XA 5AONA 1FSEA 2DL7A 4F91B 4ON0A 3MF2A 1KQ9A 1UMQA 2UXXA 4NDLA 5EF6A 2YUOA 4K2EA 4LDWA 4FCYA 1GCPA 3FC3A 4LLLA 4KNYA 1B7TA 1M8MA 1WHMA 3C95A 1RAHB 3SDZA 2BVMA 3OOUA 4KICA 2Y9YA 1AHJB 2KROA 1ZLKA 2Z5UA 3QNEA 1B07A 4OP0A 4XRMA 3SEQA 3A02A 1RAAB 1APLC 2HTJA 2HOAA 2LTOA 2PUOB 4A5NA 2WAQN 4M7AE 4M75D 1WHHA 4M3FA 4JRKA 1VNDA 3DCFA 1BCMA 2ISYA 4CHUA 2F1LA 4H2VA 2PBIA 4XK4A 5LEJA 1A04A 1WPKA 3HBLA 3HEFA 1HSTA 4II1A 3IWZA 2QA4T 3SWNC 1ZTRA 4AYBA 3PM1A 4H02A 2GFUA 2M9UA 3K4JA 3BCAA 3NARA 4HX8A 2WV0A 5FLMJ 4L6V5 3OYYA 1FP1D 4WWCA 2AKLA 4CCLA 3X24B 4HSRA 1UUEA 1Q7YR 4ATOA 2DMTA 4ENJA 5FKKA 1KD1R 1MHNA 1WHLA 1W7PD 5D5VB 2CSOA 3K2AA 3CMEI 4F52A 2BVLA 3ABTA 5F04A 1N6AA 2ALYA 3CD6Q 2FQ4A 3BJUA 4LIVA 1G5IA 4LVLA 4P75A 2P81A 2KIQA 3AL0B 2B9SA 2R57A 2JQ7A 4PJOF 2CZ1B 1ASZA 2DFIA 2XAGA 3KP2A 1WPYA 2KFDA 5GMKj 3OY9A 2MGQA 3VYGA 2RB6A 2IBDA 4Y15A 4E7JA 3MEWA 1OJLA 4CCJA 4OMPA 2ME6A 2FG0A 1IC8A 4Y4RA 1H4SA 2DLLA 3V7SA 1PKTA 4RTYA 1G51A 2X4XA 2DQ3A 3DSQA 1XCBA 4HNUA 3PE0A 4KUIA 2RPNA 3CLOA 3K1NA 1SEUA 4X5OA 1E3PA 1R4NB 3E6MA 3VRYA 2OTJQ 3WU1B 2COBA 1I0CA 2VJJA 2ZNYA 2J06A 4M78C 4OMOA 1N9WA 3ABUA 4Y13A 1VQNA 3I5UA 4YRGA 2R7FA 5GMKi 5D6YA 1W7PB 1X3WB 1BBYA 1VQMQ 1ETOA 2HZDA 4V2GA 2DA5A 4XLEA 2KY9A 3EUAA 3A31A 2X48A 1WHKA 2EJRA 4NQWB 3KEQA 3PMTA 2AXLA 3OYGA 2Y90A 3CQTA 1K0SA 2VV5A 1N75A 4YRRA 3S16J 4OIQF 2CMPA 3A8HB 1EVLA 1WHUA 9ATCB 3J81E 3CMEA 2CQNA 2LQKA 3HRIA 4LVIA 1ZELA 2HEOA 3X26B 3FXKA 2JA8J 2E7WA 2YX7A 3F6OA 2HDAA 5HOOA 2W10A 3C4SA 2DTRA 5CAIA 3HXUA 1EH7A 3EH1A 2O9VA 3FXOA 4DIQA 1Z7LA 3OIOA 4CC3A 2CG4A 4BQOA 1U78A 2QQRA 1TNSA 2D1XA 4RAYA 1ENHA 3I0TA 3ZBDA 1EVKA 2Q8KA 2EQKA 1IRXA 4L5EA 2M7AA 3U2RA 2FPDA 3GLLA 5FU7C 3J7YJ 3REBB 3R0JA 2DEUA 4CYCB 3PUFA 4M9ZA 2O0YA 4O6JA 5J1UA 5FU6B 5ICCA 3CCST 3G3ZA 4N9IA 4KMFA 4HWRA 1KU2A 2FU4A 1F1BB 1GVJA 3BPXA 3C2GA 2DFHA 3RCOA 1Y96A 2Y9ZA 2RV8A 4M75E 3EGUA 5CKTA 3TQNA 4RDUA 2VBWA 3V42A 3JAMK 3I55I 1YW8A 2L4AA 3CC2I 1ZGJA 3FLGA 3JAME 2M5WA 3VS4A 1YIJT 4Y52J 1XD7A 1LE8A 2WTEA 5KAIC 3T8TA 2WAQA 2CUZA 1LDKB 4YG2F 2VUMJ 2QYOA 3ZMDA 1PVEA 1PYSB 5LJ5e 4F7UA 5AIPA 5A0DA 3VS6A 1KC8U 1N27A 4E2FB 4ZTZB 1OQKA 2JN6A 2NUPB 5J39A 3CC2T 1UG0A 4RB0A 2RHIA 1X01A 5KHDA 1B9NA 3TDUC 5J1RA 1Z21A 2K9MA 2X9HA 4P9FA 1YB3A 3QOPA 2OZUA 4F7UF 3FHNA 4XLNF 5F0CA 2ESWA 5DUKA 5J4VA 3QO7A 1SFOJ 4CCOA 2CP5A 1KHCA 2P0KA 2VPLA 1B8IB 5FFXA 1XN7A 2R7XA 2BEOA 3IKVA 3JRFA 2XF6A 2D8JA 3CBMA 2LBFB 3OYAA 3CCLQ 3RBBB 1RRJA 2MH9A 2LY2A 1U3EM 5HCKA 2K5LA 2ROLA 1N8RU 2JMCA 1RI9A 3CCLI 2X6YA 4RTTA 4C9YA 3ELKA 5HLIA 2R7QA 3X20B 3JR9A 3LSRA 3GW2A 1LFUP 2RN8A 3KFWX 3W2AA 3QJYA 4C0DB 4HT8A 4PJOC 3H36A 3RTRA 5IP6A 2RI5A 3WTYC 4JJNK 3TL4X 3NWSA 4H2XB 1M2VB 2OD5A 5ILVA 4GGGA 1I27A 3Q9SA 5LFAA 1IXRC 1TW2A 1YJ9I 4XTYA 3CCUA 1M90C 4H2SA 4BQAA 2W4SA 4ENNA 5D6WA 4JJDA 3HG9A 5IYCJ 2FPFA 1KC8R 4IO9F 1GHCA 3JRDA 2HMAA 3M0UA 1JUSA 1X4OA 2HI3A 4U0VA 5ICFA 4GLKA 5BNGA 4PJNA 4EJUA 1U06A 6AT1B 5FLVA 1ZBXA 5E3LA 2PMUA 2RC4A 4DYCA 4Z6YA 5IP9J 3FK7A 5E17F 2DE0X 4NL2A 1B7YA 1T3LA 4Z2YA 2IVWA 1YFTA 2KRFA 2XF7A 2L8DA 2F5FA 3AG3H 3ZQHA 1WJ5A 1I1JA 1ZLJA 1LOJA 4GBQA 5KH6A 2K3PA 1TWBA 1VOMA 2C06A 1KMMA 1GXQA 1B34A 1XSXA 4M7DD 3SFIA 4Y7NJ 3PJRA 2BE9B 1BR1A 3R07A 4C8QC 1B70A 4ZIBA 3EYIA 1PRLC 1VF9A 5F0FA 2JUGA 3JCMX 2KLOA 1NE8A 1RUWA 5KE3A 1YJWT 3DEWA 4JRQA 4M7DA 2KI7A 2P0PA 4E7IA 3QODA 4YRNA 3V7CA 1E1TA 4HRIA 1VQ5T 2L01A 3BZ6A 2I4NA 3GFMA 3GMEA 4HLYA 4Y33A 2M0OA 3M59A 3G6EQ 4NUBA 2GIZA 3HHHA 4IVNA 2DLPA 2I2LA 4LVMA 2JTVA 3E19A 1OMIA 1OEBA 1VQ5Q 5K1XA 4M73A 3HOWJ 3BG6A 5BPDA 1IN4A 1OCCH 5JHFA 1K9MC 1FMWA 4H4KC 2EFWA 1OCZH 1JGGA 2D0QB 2DZ9A 4K11A 3M57A 3RMQA 1RAEB 1VQ5I 2EGEA 5ELNA 3RQ4A 2VE8A 3ZMVA 5J8FA 2COZA 2SEMA 2HKOA 3JRGA 2YDLA 2DDAA 1ZRDA 3NRVA 1ASYA 3JCMg 1E6HA 3A1PA 3IC7A 3E5XA 5EJCA 2OI3A 5GANj 1B8AA 2B8AA 3ZMZA 3BTLA 4XONA 4IOCF 2XHKA 3CZ6A 1C0MA 3CO6C 2ARTA 4RQEA 3TKYA 4ANJA 1FBSA 3KYDB 4XIDA 1EJ9A 1VQMA 2ZXWH 2HZTA 2EL9A 2VGMA 3CC7Q 1MNEA 2L0KA 2GXGA 3JTHA 2FA5A 5JR3A 2DZCA 3UWNA 1RPWA 2DPDA 2IY5B 3M5AA 4D1QA 1D1BA 1V5GA 2PVOB 3KEOA 3HRSA 4EX5A 4ZGEB 1SKUB 1UJYA 5A0GA 2QSGX 4F92B 1BI3A 2X4YA 4A6EA 4KR2A 3DTEA 1A6IA 4AG1C 3EFSA 3VBBA 1HQCA 1UHSA 2E6NA 1IZ1A 4N9HA 3OYNA 3RL6A 4FU6A 1JBMA 3WU0A 3OYHA 1G3TA 2GM4A 4A12A 2JTEA 5GAMh 4P73A 3SEZA 3ABMH 4Y17A 2EZIA 1Z9ZA 1ZAOA 2R7ZJ 2JA5J 2RGVA 1G2BA 4A93J 3BG7A 1R5HA 3JRHA 1I81A 4JRIA 4M7DE 3P5JA 3I5RA 2L54A 3TOBA 2F2WA 2ZTGA 4NL3A 4L87A 3MAJA 2ZCWA 3PFYA 1MJBA 3DU6A 3F22A 2BY3A 3E6CC 4UB8C 3GO5A 3G73A 3QRFF 2HD0A 3U1DA 4JJBA 1J5YA 3DU5A 1YW7A 3B6CA 3DP7A 5CYVA 3R6OA 4BJ5C 2E2JJ 1HCRA 4RMOA 1PJRA 1YJNI 1Z1DA 2QASA 3K6GA 4KUDK 1RAGB 5C4JJ 3M9AA 1OU8A 3PGGA 4IUPA 2HAXA 3K69A 2FNPA 5GAGJ 5HODA 2YRVA 4N0BA 2QSHX 4YRQA 2JJ7A 4BY1J 1T0FA 3JW4A 2DRKA 5KE2A 2NVYJ 3H92A 4Y92A 1EIYB 1YNZA 5KYUB 3CEYA 3KP4A 4KGVB 3GTOJ 4BHBA 3MCZA 5GAMd 4R8HA 1VA7A 4M77D 3HUGA 5KYYA 3PUBA 4LG0B 1P2FA 2EZKA 2BXZA 4G85A 2LCLA 3IKMB 2M9HA 4I0BA 3WTTC 2HU9A 5EG0B 4IQJA 4G8XA 3A2KA 3QYEA 2KDZA 1CGPA 1NYRA 1NG7A 3WVDB 3RPUA 4OIPF 3MKZA 1B6AA 1MGQA 2PQWA 2J6KA 1SAXA 1SD5A 3T9NA 3CCMA 4M78B 1H3HA 4RLFA 3CC4A 2RHQA 3DLLF 3AG1H 8ATCB 1VYUA 1DJ7B 4BB7A 2VXZA 2MSYA 1HC8A 2DOAA 1RAIB 4Z89A 3CJQB 3HHGA 1C1AA 4C5GA 4JK1X 2CIMA 4A3BJ 3CCSI 4QVZA 3TMOA 3WHCA 3OV8A 1MBJA 1R7JA 2VLAA 1LVKA 4U0YA 2C0TA 3CCVQ 2X1CA 2STWA 5LEKA 2CT4A 4NCXA 1VQ6T 4JX4A 1TNTA 2R5MA 4XLCA 2F69A 2Q2EB 2XG8D 3AAFA 1RI7A 3G1OA 1IHVA 4G94A 4BQNA 3EGDB 1PDNC 4FX4A 4HNTA 3UH0A 1CQTA 5DY9A 3QPHA 3HDDA 1V76A 5GMKe 2Y30A 2LCSA 1POGA 1MNMC 3PO3J 2L3DA 5CVUA 2ZPFB 3K4LA 3MEAA 4OMNA 1VQ6Q 1QE0A 1O3TA 1UDLA 4HVCA 2V9VA 5FJ8J 2I4OA 1R36A 2E35A 2E60A 4X6AJ 3I56Q 2P84A 1SETA 1EV7A 4GRIA 2R5YA 4CCKA 4F17A 4VUBA 2DBMA 1V1CA 5J1YA 5GAN2 3CMAA 1KD1U 4XN0A 4A63B 2UV1A 4F16A 1SRMA 5I21A 3GZ5A 1U2WA 2LDUA 1NG2A 2IEKA 2H6CA 2Z3YA 2M51A 2RK1A 2BOLA 3OL4A 3PNWC 5F08A 3K4BA 3RI4A 4NC6A 3HOSA 5BMZA 2R7OA 4Q5SF 5FWBA 1J0RA 1LNWA 2M0MA 4KT5C 4B44A 3H3VK 1Z7NA 3A7RA 3VS2A 2J5PA 3L2UA 4FX0A 5I2MA 3UT1A 2D5VA 5IT9E 1T33A 3E97A 3JCMJ 4KUMA 1KQ1A 1JUPA 2VQCA 1Z6RA 1SG5A 4BI8B 4K88A 3Q0WA 4M77F 1WXBA 1WSUA 4HX4A 3O8GA 2A37A 2IT0A 3CCSA 4KT0E 2XDDA 1LDJA 3S2WA 1QVTA 3ERMA 1FOXA 2DDZA 2ALYB 1OX8A 2GQVA 1AWJA 1WJSA 4JYKA 3S2HJ 1WXUA 4HAMA 3REOA 2PG4A 2MI6A 3QKJA 3SHFA 1A0NB 2E1MC 3P8TA 2RHUA 2JTFA 2FBHA 1BIBA 5FO5A 3T8RA 3IKTA 1R49A 4AT1B 1KD1C 1OYYA 1QZYA 3ULQB 2DMQA 4P75C 2C7IA 1JGSA 3RIRA 1S29A 2A5WA 4AVZA 1VQKT 1WJEA 1WQWA 2JNGA 2DJZA 5LJ3h 4IRIA 2ECCA 2NUTA 2J3LA 4MMKA 1B4AA 1D8JA 5GAN6 5BQTA 3SWNB 2OTLT 4M6XA 2N8GA 1E24A 4J6YA 3V7RA 2D1VA 1F5TA 5CKDA 3CCRI 1M4ZA 3U23A 4M75A 2X1EA 4AIKA 2OTLI 2ZINA 1QCFA 2LNHB 2MD5A 4FSSA 3PQJA 4R55A 4C2TA 3CCQA 2LVSA 2GZWA 4BW9A 2F2EA 1YITQ 1FLIA 2V8KA 4FYXB 4HWOA 2YSQA 3L42A 1K73R 2K2MA 3KBGA 3OD1A 2ZFUA 3M58A 3VYTB 2QEXI 3VOEA 1PD1A 1X54A 4EPCA 1ZG3A 2CQ7A 3S1MJ 5KCMA 3L2RA 2DRMA 4XLHA 1VI0A 2DXUA 1NJIR 4AMCA 3FHZA 4PJLA 5DCFA 2R0QC 2DBKA 2OUMA 1PHTA 3L2QA 2L5QA 2E1OA 4CH3A 5E3MA 1N5ZA 3BQYA 1C6VX 2PJRB 3DBLB 2IRFG 1CKAA 2A6TA 3PMIA 3EAEA 4PJOE 4OVAA 1LDDA 2GBYA 1QHHD 5EZGA 2O8XA 4NQWA 5C4XJ 5I2SA 4HCCA 1WU7A 1ACMB 2X6OA 1YYVA 1R23A 4LGWA 1BBZA 4E6RA 4FW2A 5F6FA 2Y48A 2LBFA 2M16A 2W00A 2CP6A 3A7AA 1X1CA 3CESA 3H0GJ 4CZZA 5FB2A 1B8IA 1OPCA 4F7UG 1O7LA 2F5VA 2JWTA 2BIVA 4OF1A 2JXBA 2JJ9A 2LVMA 2ECZA 4KQEA 4G7HF 2AXTC 3OW2A 3BZCA 3CMMA 4EM0B 2ESNA 3FMSA 2NVXJ 4GDFA 3PNVA 5LBQA 4J8OA 3W2WA 3GNFB 5E20A 1JRIA 1NYQA 3AFHA 1KA8A 1MV3A 2ZT8A 2W57A 1HC7A 2W85A 4A0YA 2QHSA 4P96A 3LNQA 1Q82R 3L1AA 5EC7A 1QU3A 5KCOA 1MSFC 2X4WA 2KT0A 4IRHA 1KU3A 2GBQA 4H2WA 4EQQA 2XDBA 1ABQA 1UHCA 3GFLA 2CQXA 3EG3A 5HVQC 3SJMA 1MSEC 2Q5IA 3VS7A 2MD0A 3LLRA 4WXHA 4AVPA 4BYYA 4K87A 2CRGA 4IHTA 5E3IA 4LB5A 2DO3A 2OJ2A 2DAOA 1R5GA 2HOEA 2TRTA 5EGOA 1Y0NA 1VQ8I 1B3QA 1ADJA 1KMNA 2EK5A 2CREA 2J3MA 1NK3P 4I01A 4BNCA 2CJAA 3CDHA 2DEQA 1L0WA 4OAZA 4IXAA 1VUBA 4A54A 4C92B 2AKKA 4C0DC 1RAFB 2EW3A 3QQAA 3L4GA 3GOXA 1P9QC 2HXIA 4XU2A 1BR4A 2EZLA 4B3XA 2XPWA 3P9CA 1EZZB 2E1HA 5LGUA 2YUQA 3VS0A 3G71T 1P6RA 2EPDA 3CMQA 4CS4A 1G3SA 2ZPHB 3K4KA 2V1RA 1YI2I 4DOWA 1YJ9A 1UGSB 4ITVA 3OMYA 3ZN1A 3R0AA 1OYXA 4XR6A 1NPPA 1R22A 1ADYA 4XTZA 2JN0A 1MBEA 1H89C 2MWOA 2BZTA 1WNLA 1NTCA 2LH9A 3C3WA 5FD5A 4YRIA 4U87A 1N25A 2DMPA 5FROA 4BS9A 2EV0A 2PMHA 2DYBA 2PMEA 1SSFA 3K9TA 4RAFA 2XASA 2K7LA 3TO9A 4IOAF 2EWNA 3U9GA 1BK2A 2GTOA 4JX6A 3GIBA 4P73C 2B86A 5D6XA 2K27A 2G7HA 4C0FA 3PNYA 4FETA 2DN0A 2LNBA 3M56A 4CRIA 5DYMA 4EDUA 3JB9J 2QK0A 5DCMB 3OL3A 5M5WJ 2VQGA 3H3UA 3GFJA 4D5FA 2CSIA 2LY1A 4JLGA 4AG2C 1YJNT 3KYLA 4HEA2 4D0PA 2GNCA 2J7IA 3J80Z 4QWQA 4PFZA 1W2BS 1XGNA 2V1UA 1TUGB 3H9GA 2RKHA 2CDTA 3ZQ7A 4P55A 2RAEA 1O7FA 3V8JA 1X55A 1WJQA 1YGBA 3M0TA 3A98A 2NVTJ 1JQQA 2LZ6B 1VQ7Q 1FNNA 4EV0A 5KNNA 1OCRH 4LN2A 2FMLA 3L9FA 2C6YA 2XI9A 2DIQA 1N8RR 5EYRA 3WGIA 2M0YA 1VQOA 1MNDA 2XKOA 1R77A 1NPRA 4IHXA 3BR1A 5JHUA 2E1NA 3TP0A 2ME0A 1QCNA 2QAZA 3E2UA 3GNGA 5FKNA 1K6OA 2R93J 1ZSZB 3WTXC 3BDDA 3B6AA 3HOTA 1HLVA 4FYWB 2ZT5A 3B73A 3KIOA 2TCTA 2DA4A 3ERED 2JZ2A 2HGCA 3H8ZA 1RC9A 2EILH 1BJAA 4EMKA 1IW7F 1BI1A 3F8NA 2LNVA 1YRNB 5GAN8 2KMTA 3OYDA 1ZKGA 3EG2A 5CKEA 2HXOA 4JQFA 5TGTA 2QTVA 2J05A 1AZEA 3JAMZ 4P3OA 4CA0A 2E34A 1HOMA 4CO8A 4HF0A 4M77E 2XGDA 4KIBA 3Q5FA 1PWTA 3HFVA 2VJ4A 5IYDJ 3CC2A 4K86A 3QZ9B 4EJWA 2XGXA 2E2HJ 4X1VA 4R56A 4I6ZA 1X56A 3SFMA 2DVJA 3CCUI 3QP6A 3FDYA 1VFCA 7AT1B 2WSCE 3JCMQ 2GXBA 3M8JA 2R7RA 1L0OC 1EF4A 2A05A 4I98B 2E10A 1U1TA 2PJPA 2HQEA 4PLLA 3CCRQ 2LT1A 4HZFA 1X1AA 1RUOA 2A07F 1LB2A 4EEFG 1X75C 4J9HA 2AQEA 4BY6C 5LJ5h 1YIJA 1MJAA 5GTIC 3BG3A 5DTDA 3ZQQA 4BQQA 3OYKA 3KFVA 1LQ1A 4J9DA 1C0AA 3DKWA 3AT1B 3FKJA 4IHSA 4DYRA 1OYWA 4D8KA 2RNJA 1FYNA 2KK4A 5JVGF 2M34A 3OMCA 5IAYA 1QP3A 2XB0X 3ZMTA 4QQGA 3AHUA 5L3GA 4YYEA 1MBKA 1ZHFA 4TV7A 1E17A 5CK9A 4CS3A 4OU0A 2DO7A 3FF5A 2QDLA 4U88A 4FTHA 3RKXA 1SHGA 1ZSZC 4B3AA 3CXCS 3ZQLA 2B7EA 2X1DA 1OPLA 2QTXA 4UP9A 1UJ8A 1XDSA 1AWWA 2EGCA 1H9TA 3M1CA 5LJ3f 2HDCA 1HW2A 2NLUA 2IXSA 3GZ6A 4F14A 3AG2H 3M8EA 2GGRA 1XG1A 4PK4A 4BDYA 1LJOA 2OAZA 1IGNA 2P0QA 3ZR8X 2P6SA 4EMGA 1K9MR 4M75F 1SFUA 1LNXA 1K7AA 1OULA 3SZTA 2E3HA 5B3SH 4C8QF 1I3QJ 2L9VA 3LWFA 1J75A 4U7DA 1A36A 2K5IA 2QA4Q 1W2BA 3T0YA 5GANd 1YX3A 1LEBA 3NTIA 3SYTA 2CP0A 3X25B 2IS6A 2QHVA 1QF6A 3CQZJ 3IUOA 1RKTA 4UVBA 1JJ6C 2MAMA 3E9GA 4MZTA 3TGNA 3CPWS 2JSCA 3FZVA 2KBTA 2ZR2A 2KISA 4IIOA 2VT3A 2O7OA 5KYWA 2GWRA 4D9JA 5HNFA 4CGZA 3OMGA 4XLPF 4J5YA 3H9NA 3TDZC 4N0AC 3A0BC 3MD2A 1WIEA 1QHGA 1UZCA 3HOVJ 1PSFA 4MGRA 2LMJA 1IG7A 5E3OA 3FKIJ 5K5QA 3KZZA 3W2VA 5DD4A 3J7AY 4PGGA 3EHQA 5LD2C 5J4YA 4M78F 5CQXA 3CCLT 3J81Z 3CD6T 4DEXA 1HBXG 2BY0A 1AA7A 1Z0XA 3IAS2 3WU2C 4B47A 2RHXA 5KCHA 2DQLA 3LAPA 4QT7A 1RESA 4IZZA 3JB9I 1ETKA 2RI2A 1VQ6A 4PHCA 1SESA 4L0YB 3HPHA 1KFZA 1V55H 4RGSA 3QYBA 1Y56A 2YRCA 1V29B 4ZYHA 2E12A 2Z9OA 3HTZA 5FRNA 2GQQA 1KQ8A 1DP3A 1W66A 3JRIA 1Y0MA 2M8EA 2YUSA 3A7UA 3P8VA 3W3SA 3IHUA 3S32A 2QQSA 3OSSC 1GCQC 5GAN7 3CCJA 1W1WE 4TVAA 5GP9A 1TQMA 2MLKA 4G6DA 5LLQA 3CCVT 2WAEA 1WI3A 1PKSA 1DP7P 2YHTA 1K6YA 1Z9CA 4XOPA 2ID3A 1RADB 3ASOH 4WCIA 2P8TA 4M78E 2JM9A 4XSZF 3S3NA 5FW9A 4UUSB 1RUNA 1OCOH 3H0DA 1K9AA 2X3WD 4UUTA 2BHYA 4L59A 2FRWA 5IYBJ 2P4RA 3CCMQ 1X1PA 4QQDA 4YRPA 3I64A 3KETA 2BUDA 3QO3A 2FXAA 4FHTA 3WG9A 2XC7A 2QA4A 3G1JA 2NUPA 1FP2A 3REAB 1FXXA 4UVAA 2K86A 3HSRA 2ZMEC 5B1AH 3TP3A 2E5QA 1H641 1W5SA 1WCMJ 2L2PA 4AYBN 4LD6A 4E6KG 3D5LA 2XICA 2XDVA 5GTHC 4YIFA 2K3BA 3DPUA 4KT6A 1NK2P 3OR1C 1Y6IA 3TW7A 4KYWA 2FZKB 2DL4A 3MP6A 3B02A 5CKFA 3BCBA 3G4SQ 2H6BA 3OIQA 3FXJA 4AUXA 3KP3A 4UXNA 5GAEJ 2NUTB 1U5TC 3ULRB 1K4TA 5IHNA 1YHQQ 3VS5A 3QO5A 3MZYA 2C0IA 4M3DA 5LJ3j 1FMVA 2H1LA 2KHMA 3I3LA 4A0ZA 4Z02A 4C92G 3G6ET 1JEGA 3K7AJ 1LPQA 1XCVA 2QQBA 2A36A 1SERA 1ZARA 3R4KA 5EEGA 1NJ6A 3H35A 4EJOA 3NQOA 4D7NA 2DF6A 2H8HA 2KRSA 2HYGD 1J59A 4B09A 4DEYA 1QVFA 3UDCA 2H1KA 5GANh 5GAN4 1S3JA 3HY1A 3DXJF 2LC2A 3PIOF 1AZGB 4JJCA 1M90R 1U8BA 3SD4A 2R5ZB 4EGYA 3T1BA 4BI3A 4CC4B 2GFAA 2W84A 4PFOA 5CVVA 2BBYA 4O3MA 2Y4XA 2RJFA 3DB3A 2E6ZA 4FM4B 5GAMe 4JS4A 2FX0A 5B5EC 4LK0F 3WE3A 2ZGWA 3FXUA 3QXEB 3CDIA 2Q7HA 1FC3A 3G1ZA 2CYZB 2EQRA 2LY9A 2KYMA 4DBHA 2HQAA 1WA7A 1YJWQ 2KL4A 3K1MA 3HKSA 4C0ZA 3L09A 2ZJQF 1TS9A 1M9SA 5DLOA 2QGUA 1R1TA 3I7FA 4FE7A 4MFDA 4J7IA 1M1EB 3AKZA 3IQLA 4YFNF 1T0JA 3FXRA 3CUQB 2EAYA 2WBMA 2Z2SB 4EATA 2YLCA 1ETYA 2HR3A 3KCCA 5DLQE 1U9OA 3JRBA 4D6WA 3CC2Q 2EB7A 2QKLB 5LGNA 1X4PA 2L3SA 4P72A 2JA2A 4HYEA 5HLHA 2B63J 1M1KR 1ITYA 1OFCX 2CW0F 3CCYA 4HG2A 3EGDA 3LA3A 1QVGS 2E4HA 3LWHA 4FE4A 1H9GA 4ZYGA 3CCVA 2PLYA 4IIMA 4ESJA 3RR6A 2EV6A 4XRFA 1PD0A 2HEQA 4DJAA 3PTAA 4P72C 2ZMEA 1M1FA 2OU2A 2IA2A 5IP7J 1X27A 1X6BA 3TO7A 2KE9A 2YUPA 2LK2A 4OB3B 1LE8B 1MZBA 1SMTA 2DX1A 1BN5A 3ECHA 3D5RC 3F23A 2DA7A 2PZ1A 1ZYRF 1IZ6A 2H3EB 3QIIA 4OB0B 4DBRA 4J19A 4XKWA 3HKZN 3RQIA 2BE7D 1PYSA 5FKOA 1TWHJ 3ZOBA 4NC7A 1IDZA 1TWAJ 3EFOA 3ZMUA 4BI4A 1XS9A 5KYYB 5DM7F 1M1KU 3VQYA 2CQQA 5M3FJ 1OISA 1VQ7A 1Y0UA 4KGZB 1J3TA 1IHWA 2MPXC 3UFGA 1UG2A 2CFXA 1IUYA 2FD5A 5FKMA 2KZVA 2LD5A 4X34A 3G6EA 3X28B 3CF5F 2BZXA 1Q81C 1YWPA 5CQEA 2K3YA 4L5GA 2L0AA 3EUKL 1WJCA 2A5YB 2DYRH 1VTNC 4PL6A 2W7NA 1ZUYA 1QRYA 3CC7T 3BZKA 2A69F 2COMA 4XRSA 1ERDA 1GL5A 1EFWA 4ZN3A 2KP6A 1NJIU 2XV4S 3U1KA 1EQRA 3PNTA 2V6CA 2EFNA 3GYHX 2XU8A 3WVEB 2VJIA 3TCJA 1X2MA 2IJLA 3M8FA 4OINF 3VDXA 3MCAB 4XAXB 2CZ0B 3H0HA 5L3CA 1T6SA 2VKVA 2VKEA 4M7AB 1ETVA 3TEDA 2OCCH 1BB9A 3Q0VA 3S8PA 3QHSA 4HDVA 4B9XA 1O75A 3H0FA 5LJ5f 1WI7A 5D4RA 2P5IA 2IAIA 1QZEA 3HZJA 1GBRA 1VQLT 4UPAA 1XJWB 5D6FA 4KN4X 2XSJC 3SZPA 4ZYEA 3JREA 3PSIA 1BL0A 4A53A 1X6OA 3VQWA 1D3BA 4M75C 2G4CA 3X2QH 3BJ6A 2W0ZA 1X1BA 3FM5A 4OGEA 1XOVA 3CCUQ 2KVQG 4MNUA 1VQLQ 2HVRA 1FEXA 1UE9A 2OX7A 2QHTA 3FX3A 3I55Q 1I1GA 4M7DF 2OCEA 2LRDA 1UGVA 3S93A 2BKDN 1EOVA 4WTOB 2EQUA 2BHZA 2I4LA 2XPVA 4MZPA 4KH0B 2CP3A 4YRTA 4G6QA 1D0YA 2J6OA 1VQ4Q 2MIOA 5E8IA 3HHTB 2DPUA 4EJVA 1BI2A 3LL7A 3LSPA 3CP8A 1ZK8A 4B1RA 2QQAA 2EYZA 4R79A 1TOVA 3KLOA 3QJ6A 5J8CA 1X2QA 2IIMA 3EPZA 2OZ6A 3H5RA 4LNSA 3ZQGA 4M6YA 4B48A 1Y1WJ 5ECAA 2X6XA 5FLXE 4DYQA 4OIOF 3SB2A 3LSSA 4KGXB 2LREA 1VQNI 4KISA 1N9SA 3GF5A 11ASA 4DGWB 3W6VA 2PTKA 2KDSA 3JCUC 2RK2A 5A0LA 3IP4B 4R0KA 1U9NA 3D5SC 2ZJRF 4A4HA 1YO5C 1XMKA 3DKXA 1FYKA 1HTTA 4BWAA 1KQ0A 2XUBA 4YRLA 3ABLH 2JS2A 2K5FA 5GAMf 1OQYA 1RACB 1FYLA 2LG4A 3M9QA 4M9XA 4TQDA 1USSA 2QA4I 1KONA 5GMKm 3I53A 2EFIA 4B4CA 3MKYB 3RZDJ 1K61A 3GWZA 3W3CA 2Y31A 1S7OA 4D5CA 2H8RA 3VWBA 1UEBA 1W4SA 3LGLA 3I56A 4RB2C 1SVOA 2L7KA 3O3KA 2ZNJA 3P8YA 4UC4A 1OU9A 5C3EJ 3OYMA 2NYSA 3HXWA 1I6HJ 5JLXA 4V19K 4LK1F 5HS8A 4OB2B 4XU1A 1W2BP 2AMCB 4ASNA 2ZPGB 2OBPA 1I07A 4GYIA 3GEZA 2VE9A 1ARKA 2CP2A 3TVTA 1O4XA 2DNUA 1PNJA 2NUZA 3N5BB 3IL2A 4M78A 1VQ4A 3HIFA 4XQFA 2R5AA 3LGFA 3A5ZA 3DB4A 4KIGA 1GCQA 3WHBA 3OS0A 3BR6A 2E1CA 1MW7A 1MUZA 1YS7A 1WZOA 4J9IA 4XTUA 1WJAA 2FUG2 2LDMA 4O2DA 4S0HB 1JT6A 4EVIA 2LOOA 1R4MB 5LGTA 1J09A 4ZDLA 1OCTC 1SFEA 4IHVA 1D5VA 1MMGA 1W7PA 3HL2A 1XTDA 4ME7A 4Q15A 5K1PA 1I3AA 5DEQA 3IH4A 1B34B 2IPOB 3JV3A 2E3CA 4A69C 1T39A 1NJIC 1WJRA 4P9UA 4MDWA 1BCOA 4M4ZA 2R7TA 3LSGA 3BW1A 3ASKA 3MPUB 3CC4Q 5C51B 3FIFA 4QQ6A 3A03A 2HFHA 3J7AF 4MLOA 4UB6C 4I99C 1M1GA 3EG0A 4KA4A 3VJPA 5C0MA 4BY6B 3CCQT 2MMPA 4MMLA 4YP0A 1E1OA 4P3PA 1KIKA 2QCOA 1IL2A 4Z88A 5GAHJ 1FIAA 4A4FA 4RBOA 3JCMc 2R4GA 4FISA 1ORKA 3RSNA 3KYCB 3R61A 5IT3A 1ZREA 4GCVA 2RMOA 2MC4A 4M71A 3HRTA 2WSFE 1WX6A 3TO6A 2W24A 1QLYA 2KYBA 5FGMA 2OTJA 2MK5A 3BY6A 2O4XB 2PU9B 2RI3A 2RJDA 4C8QG 2D45A 3LA7A 4M7AF 4PG3A 2LSOA 2R3SA 3CCJT 1G83A 1NNHA 5DCMA 3G1LA 1SFKA 4A3DJ 2I5UA 2HCKA 3H5NA 2E3IA 2COWA 5LRSA 2DA3A 2CH4A 4ZH4F 2MOXA 1VYVA 1W5CC 1F4KA 2JPBA 4YFKF 2JUFA 3ZGKA 3ZXSA 2F4IA 1U5TA 2KGTA 3FEOA 2K9NA 4XN3A 1Q82U 2RQVA 1DPRA 1FOWA 3PCOA 4AIDA 3D7SB 3DBHB 2LKXA 4M75B 2DETA 1HDDC 5J26A 2K02A 1V5FA 4L9TA 2L7FP 1IB8A 4M78G 4C8QB 1YP5A 1TWFJ 1TW3A 1P4AA 4C2MJ 3CMYA 2JM8A 3EDPA 1W4MA 1TQPA 2A61A 8AT1B 2QM3A 3ZRGA 1Y39A 1MH4A 5K5RA 1QVFS 3REUA 2OQGA 4O5VA 1YN8A 4RTZA 1IO6A 4L0ZB 2ZC2A 1V4RA 1VZ0A 1X69A 2HZYA 5BS6A 3OYIA 4XTWA 1AOYA 3TOAA 2IW5A 2V4JC 1JJ2S 4KBMB 3KPHA 5KVRA 1VYTA 2BZ8A 4JX5A 2DMNA 2CV1A 5HKCA 5L3EA 5KYXB 3ZQIA 1VQPQ 2STTA 3HTSB 4MDXA 4WCGA 4F04B 4UUSA 2LKPA 1B9MA 2DAQA 1KHIA 4OMYA 4BBSJ 5J47A 1Q7YC 3DKMA 2ELHA 1AWOA 1T08B 1KJWA 1OPKA 4LDXA 2EIFA 2EV5A 1GBQA 1W6XA 3SEMA 1VQPT 5F27A 2QKMB 4C92E 2GA1A 1OCPA 1IXDA 1WVRA 2JTMA 4YEJA 3RPQA 4HA8A 3QP5A 4P74C 3CXCP 5LHHA 3QU6A 1IGQA 3IRRA 1SF9A 1EIFA 1WLPB 2F5KA 3DTIA 3U21A 2LQNA 5GANf 1E2XA 2RQPA 3HOUJ 2DTZA 9ANTA 1EFNA 4DOVA 1YS6A 3LSTA 4CSWA 3NTHA 3CP2A 3K70C 4EMKC 1VQKQ 1I39A 3GPLA 1J9IA 1SD6A 4LVKA 4LITA 2E5KA 2J5OA 3JSOA 2L7ZA 3E5UA 1RR8C 2DK3A 2JOYA 3N05A 1TTYA 1M30A 1NHAA 3J80K 3J7AO 2DILA 2M2EA 2QEXT 2AHJB 3R60A 2WSEE 4OB1B 1GT0C 3VEPA 1TH7A 1MBHA 3KZYA 1NLOC 2DFUA 3FDRA 1BBUA 2QF7A 1LVAA 1ONVA 2P5KA 5CLSA 3S3OA 3Q3SA 2XKOC 1DQUA 3M4OJ 2DW4A 1VQ9Q 2DA9A 2XAFA 1EX4A 1B7YB 2IA0A 2AIRB 1S1NA 1RIQA 2ZZEA 4LUDA 3VSLA 3PSFA 2FVUA 1Z7MA 1QA6A 3GXOA 3NHNA 3DWLE 4RTUA 4OOIA 2M8GX 2E2IJ 4FT2A 1TWCJ 1W5TA 2NAZA 2ZFWA 5KAFC 3GTPJ 1AOJA 4C5EA 5GAOl 4XRSG 5H2FC 2E7XA 3CLQA 5K5OA 4IQ4A 1O3RA 1NM7A 2ZPBB 3EG9B 4LNPA 4CXFA 3QPTA 3IRQA 3MKWB 1VQNT 1ZUKA 2KT1A 3OBWA 1YG2A 1Y8RB 2AS5F 2BE5F 2VOPA 1CKBA 2DMUA 2FRHA 1WHGA 2JRMA 5AYFA 1GFCA 1YCSB 3ROUA 1SEMA 4BD3A 4ZZDA 4FL6A 1KYWA 3MEUA 1JU5C 2AZSA 3SZGA 2DFFA 1C0WA 2V7FA 2ENMA 3HSBA 1XTAA 4EJTA 4M7AG 2GQIA 2R7SA 3NFCA 2Q7GA 2XAJA 3TUPA 2CW8A 3TREA 2MC3A 2FE3A 2NS7A 3H1CA 2OAUA 3DPLC 4MZMA 2X4HA 1XGMA 3P9KA 2GLOA 3Q1JA 1K8AU 2XGEA 4F3QA 4RAGA 4AU7A 3BFMA 1IV8A 5F1RA 2JA6J 5HLGA 5JI6A 2LT4A 4QPQA 2J6FA 3IALA 2NVQJ 1ZX6A 3HRUA 2OA4A 4C3JJ 4TVWA 3KP5A 2JMWA 2XRNA 4WXCA 2JW4A 2X85A 4FYVB 3S6WA 4CC2A 2QQ8A 1JB0E 4HQMA 3CDLA 3C7JA 1FOYA 4N4GA 1XPXA 1OR7C 3H3ZA 1TUDA 3P8DA 4GY5A 3IG2A 1I1SA 3KEYA 5CKBA 2AO9A 4ZGDB 4PSWA 3I4MJ 3KUFA 3GTQJ 2DKGA 4HDUA 3EFOB 1VQ9A 2FNAA 2CV2A 5HS7A 4FW1A 3OYJA 1QGPA 2G9WA 3MZHA 3HXXA 4HX7A 2ZMEB 4AD9A 3CC7I 1B59A 3UGTA 2CJ9A 1YQAA 2CUJA 1ACIA 4YDQA 1V5EA 2EYXA 3RDVA 1MH3A 4M75G 2Q0OA 4J9GA 1XNIA 4ZNXA 3PCOB 1RIOH 2HDDA 2K4YA 1L3LA 3EFRA 1M8VA 1VQKA 4M3GA 3NENA 1ZGWA 1ZLMA 1A31A 2AKWB 3FIWA 5A2QK 2JA7J 1JXMA 4E7KA 1I50J 4LG0A 2E64A 2RQQA 1K4US 5LJ3d 2HQNA 2V1NA 1GRIA 4LLGF 1JTYA 1BOAA 3E6DA 4E70A 1ZR2A 1IV6A 3COAC 1VQ6I 1M27C 1ETQA 1EH6A 1ODDA 2MFZA 2PMZN 4HW0A 4OMQA 1HYOA 2BYVE 2VB6A 4N4IA 3AL0C 3JB9D 3V4GA 1WGSA 5HNHA 2BXYA 2H09A 5DM7R 3Q0UA 3HC7A 3P8BB 2ZZFA 1UTIA 2PI0A 3JCMW 2CJJA 4Q6GA 3BDUA 4ORZA 4RB1A 4Z8AA 1V54H 2GIVA 1VQPA 5EZHA 2LTPA 2ZJPF 4BAYA 3WTUC 1LFBA 1XSVA 1JUMA 1CSKA 4FSXA 4XMYA 2ZNIA 1OV3A 2AT1B 4MQ9F 3R6SA 4A3LJ 2XF5A 2I8DA 1RZ4A 1ETXA 5FU7B 1PUEE 1YJNQ 2X6WA 2O5RA 2FZCB 1WJDA 1WI9A 1VQ9T 1U3OA 2Q2EA 4FT4A 4IUUA 4LUEA 2JT1A 2JUCA 1KQSS 2E65A 5FWCA 1R1UA 1QZZA 4QSHA 2EBIA 2HPMA 3E9FA 2D9TA 3M55A 5GAOr 1KGSA 3EUHA 1K79A 3UPUA 1ZG5A 3JSCA 1AWXA 2HOTA 2ZXFA 4M7DB 1TT5B 4M6VA 2NVUB 2PJRA 2KAFA 2V1QA 2VJ5A 3TSWA 4P74A 4J00A 2RJCA 5J3BA 2RHSA 4PUSA 1WQ2A 2F4MB 2IPQX 3VFZA 3HPWA 3UF4A 5HLTA 4KJZA 1U8RA 1HD3A 1U5TB 2YPRA 3IAM2 1N78A 1Q86C 4RCBA 3CJTB 3E3VA 1YW9A 3CJNA 4I2OA 4FYYB 2K9GA 3HXZA 2XIDA 4C8QA 1E22A 1QW1A 4WJ3M 1W36C 1YWOA 3I5SA 2RREA 1VQZA 1Y8QB 2DTHA 1PUFA 1FBUA 3G7ZA 2HYFA 2KXDA 3CPWA 2YU3A 2CT3A 4F7ZA 5EGOB 1I5OB 3OQ5A 4BUPA 4D8DA 3VV0A 5GANe 1Q86U 2WY7Q 1K1ZA 3DQVC 1DU6A 2YU9J 1T8IA 1D5YA 2ZAEA 1SRYA 3S1QJ 2MA3A 2E41A 2Q7EA 1ULYA 2LLKA 4XL9A 2OTJT 4AIHA 5K1YA 2XSDC 5IY5H 2EFOA 2D0NA 1ZSGA 4HWTA 1I5ZA 4G7ZF 2K57A 4ZDPA 2DPPB 5KYXA 4ZZLA 2DT7B 4IHWA 4IUTA 1NBEB 2DXTA 2Z0WA 1Y71A 3JB9F 3ECOA 2RN7A 4XSXF 3TEHA 4KRTA 4WK8F 3WQZA 3G6EI 2JMAA 3JCMb 3FBNB 5GADJ 2IS1A 1H3ZA 1G5VA 2DMOA 2FJ1A 2DU9A 1UHWA 2MLGA 3P8HA 1Y07A 3WTSC 2G3RA 1K8AR 3S15J 2EIJH 2FBKA 3ZQFA 2VL8A 1HW5A 4DW6A 3M4PA 2XKPA 4RM2A 4DZPA 1BR2A 3K4CA 4YELA 1RI0A 1YCYA 4QW2A 2CJBA 1XGSA 5F0HA 3RESA 1X2GA 1GV2A 2IVMA 2A7YA 5ED4A 4G7OF 3CCVI 2DJNA 2KRHA 2OQRA 3EYYA 3HJEA 1FJLA 3QBYA 2O3FA 3OWTA 4C8QE 3CUQA 1YFRA 3DLLA 2L89A 1NJ8A 3JRCA 2E5ZA 2G7UA 1STZA 1SD4A 2JK3A 2VVKA 2V9PA 1GLNA 2GCXA 5GJWB 2WAFA 4WF2A 2TDXA 3H41A 2OPTA 2F2VA 5GJVB 2VKNA 4AFUC 3LA2A 4ZC3A 3FXQA 4MEXF 5ERIA 1O3QA 2O4XA 4YIIA 5L3FA 1S72A 4HWPA 4RGRA 1YLFA 4N4NB 5HS9A 2EFQA 5E3NA 4XICA 2VC0A 2IP2A 2R92J 5ICGA 3IV5A 1W36D 2ECBA 4I0AA 3CD6I 4RLQA 2Z33A 4PNOA 5IXBA 1JJCA 5ILSA 1GGMA 2ZT7A 4WI1A 3RACA 5CVIA 2AKWA 3EQLF 2YX4A 2RHZA 3VQVA 1WZ2A 2D6FA 3I4NJ 4PJOD 1PYVA 5B1BH 5EEAA 3K10A 4A6DA 2XAHA 4HOBA 1HSJA 3VYUB 4JDSA 2CO5A 3K4NA 1T56A 1QWFA 2FB7A 2LR8A 6PAXA 2DL3A 4CI0C 2R58A 4LDVA 1YE9A 3MN2A 2L9NA 2RQUA 3MFKA 2RQTA 2OTJI 2K9QA 2HS5A 3JSPA 3E1SA 1ZUUA 4XQ3A 2D1HA 3JB9H 3L1PA 2ZO4A 2CS3A 1JJCB 1FWZA 1TWGJ 3OB9A 4L5IA 2ATCB 1WGXA 3M1EA 3BR0A 2A6HF 2XDPA 3MHXA 4M3EA 4Q48A 3RKQA 2PQ8A 1KG1A 3L00A 3ASNH 2DXCA 4RKUE 2EQMA 1M5Q1 2VKHA 3BOQA 4P5NA 1EH8A 4ZTJA 2ZB9A 5FFZA 3VUBA 2VWFA 1FMKA 4IURA 1B1BA 4E7ZA 2NS0A 1SFXA 2O61A 1SSHA 1YFSA 2F48A 2BGCA 2CUBA 5HDNA 1MIJA 4J9CA 2O31A 3GCMA 3H0IA 4NC8A 2KRMA 1X2HA 2A6EF 2K40A 2KIFA 5D4SA 1D0XA 3BT9A 3F0CA 4AC0A 1K78B 4UNOA 3LH0A 1RL2A 3NMZC 2QHUA 5EG0A 3VUZA 1QVUA 3UNGC 3CCMT 2JSPA 1B76A 3I4PA 3LQQA 2G6FX 3L4GB 2L02A 4XKVA 4XLAA 3ZMSA 3MVPA 2M1BA 3FJPA 3QDFA 5CO7A 1K73U 1AEYA 3KX2A 4AH6A 1XC5A 2PVDB 3INZA 3SHWA 1JHHA 4CYCA 2Y4YA 3RUXA 1FYFA 3HOYJ 1YHQI 4A4GA 4BH9A 5JVTA 1YFNA 2RJEA 2VUBA 4QKUA 1QVFP 3PT9A 2XROA 1NZ9A 3TU4K 3FWEA 3JTGA 1FX7A 2KRNA 2MF2A 5L3DA 5GAOm 2A68F 1U1SA 2CGPA 3G4SA 1BA5A 4CH7A 3A8GB 2QBYA 2OAWA 2RO0A 2EYYA 2RDPA 4HV6A 5LHGA 2Q5HA 5ELOA 5HGQA 3GVAA 1QKXA 1TXQA 2X4JA 2QWWA 1BC8C 1IO2A 2V9KA 1MDMA 1YBYA 1X19A 4JZ3A 4CCMA 4YPFA 1MBFA 2H8WA 2JZYA 5IT9Z 2OTLA 2DL8A 2KIUA 2KJCA 1FPQA 3FXLA 4PJOA 3DF8A 4F55A 4G12A 1TL8A 1K4SA