3V7SA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor 0364
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
total genus 98
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7sA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7sA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7sA02
4ZYEA 1B9NA 5A2QK 4GYIA 2HZTA 1WPYA 4LLLA 4JK1X 1BI3A 2ZNIA 4N9IA 4RAYA 2R7FA 4Y13A 2Q7EA 2HGCA 5D5WB 3HRMA 2DT5A 2ZR2A 3MEXA 2EJGA 2IJLA 5HLGA 4KN7X 2DDZA 1I8FA 1QZZA 4H2XA 2C6YA 3BW1A 3CMQA 1WNLA 3FF5A 1LYLA 1IXCA 2DXUA 2DPUA 3ZN0A 2COMA 5L3GA 2CQKA 3K1NA 1KU7A 4IXAA 5JR3A 4Y91A 1HW5A 1LDJA 5FLXZ 1XSVA 1I1SA 4TVAB 1E1OA 1I4K1 4UUVA 3QRFF 3WE3A 4LLGF 3E9IA 1ZN2A 4OU0A 1NYQA 1QPMA 3GZ5A 1D3BB 1ZG5A 3E9HA 2IRFG 4EV0A 2W25A 5BOXA 2EFPA 4L5IA 4LMYA 1LDKB 3LQRA 2PMEA 1FNNA 3R61A 2RNJA 1KQ2A 3QO3A 4PGHA 3SFZA 4P96A 4GXOA 2P7VB 3ZN1A 1TLHB 4M7AC 1SD4A 3ZP5A 1ZRDA 1Z7NA 5K5QA 1O57A 4PJOC 4YCWA 4JRIA 1CGPA 3QOPA 3HTSB 4C92G 2PN6A 4I01A 2K4BA 4YRGA 2LNBA 3GEZA 4PNOA 1NHAA 2QQ9A 1YW8A 1R23A 1A04A 1XGOA 1XDSA 2W84A 3REXA 3K2ZA 3G3ZA 4Q47A 4F7UG 2E1NA 4MQ9F 3HRKA 4LB6B 5JFRA 2R7DA 5ICEA 2DZCA 4H2VA 2EB7A 2VBYA 3D5LA 4M7AA 5CJ9A 3KETA 4PJOA 1JHHA 4X5OA 2DXTA 4MTEA 1G4DA 4RDXA 3IKVA 4UVAA 3L2ZA 1BJAA 1S3JA 4CYDA 5LBQA 1LVAA 5GAN6 3T8RA 3SQNA 2XAQA 3P9KA 4YRMA 3V7RA 5LGUA 2P6TA 1VQZA 2D1HA 2YHTA 1B6AA 3BDUA 1BBWA 2P5KA 4BHCA 3KE2A 4M77F 4FX4A 4Q4ZF 3ABUA 4HQEA 3JCMQ 2EJ9A 2DK5A 5GAMf 4MQVA 2IVMA 4HVCA 5ELNA 4C92E 4HV5A 4O5VA 5DCMA 3FB9A 3BROA 5L3EA 4ZTZB 4L5JA 4R79A 3HY1A 2FE3A 3KP2A 5LJ3f 2HOEA 5IT9Z 4ENKA 2VN2A 2VBZA 3H3ZA 3O6BB 2V79A 3U1DA 4EM1A 2M30A 3C1DA 1KYWA 1H4VB 3M8EA 4L9JA 4A5MA 3O3KA 2G9WA 1QNTA 2FF4A 3R4KA 5CVVA 1YLFA 3WQZA 3JCMb 4PDKA 2FNAA 5GAN4 4AWXB 3F8NA 4MGRA 1SFEA 2F5FA 4HX7A 1Q1HA 3J80Z 3KLNA 2Q7GA 3QP6A 2Z33A 2FRHA 2K7LA 1ZARA 2Y90A 1SD6A 2VXFA 4XU2A 4A53A 2KKOA 1ZGAA 1B76A 5L3DA 3HXWA 1W7PB 2YSRA 2O3FA 5LJ5d 1KQ8A 4M6YA 3NEUA 2RGVA 5IT9K 4M72A 2QBYB 2HQNA 2L4AA 4LG0A 1XSDA 2A68F 1NJ5A 4CHUA 1XGNA 4XTXA 4L9NA 5HVQC 4WJ4A 2FU4A 2IP2A 3JSOA 1BC8C 5GANj 5LJ5e 1B70A 1Z05A 4CS4A 1SAXA 2CJ9A 4D0PA 1LQ1A 1H4TA 5K5RA 1BN5A 4G7ZF 2C8MA 4C8QE 4YRIA 4DPGA 3CO6C 2QUFA 3IWZA 2XAJA 2P5VA 3K9TA 2DTIA 4TVWA 4H2TA 3JCMX 1W66A 2K02A 4PZJA 1BI1A 3E6MA 3CJNA 2XRNA 2DPDA 2VBWA 4M77D 2X4HA 5DUIA 5GAOp 1Y0UA 2UXXA 3TEHA 4YYEA 4B09A 4WXDA 4BAYA 2FNPA 1OKRA 3QP5A 2P6SA 3SXYA 1B8AA 4OIOF 3K69A 5D8KB 4M75E 2RHQA 3A7RA 3VOEA 1S8NA 3FMQA 1O7LA 5GAOq 4CDGA 2EV6A 4S04A 4X9DA 1WQ7A 2HTSA 4OOIA 4EM2A 1HKTA 1XD7A 3RYRA 4HDVA 2W24A 2XAGA 4YRSA 2XV4S 1YB3A 2EJRA 2ODRC 1HXDA 1RNLA 5L3CA 2EJFA 3RIRA 3RKYA 1IF1A 5C51B 3WTSC 1USYC 1Z9CA 2P8TA 4WCGA 3SZPA 2E1CA 4KR3A 4XEMA 4M77G 3LAJA 3Q9SA 5TJJA 4HX8A 5D5XB 3IALA 4ZYDA 1KYZA 4ASNA 2NS0A 1OYYA 3NENA 3WE2A 3MF1A 1P4XA 3FXUA 3JSPA 1M8VA 1GXQA 1BIAA 2WC2A 4NQWA 3F8CA 3E6DA 3IG2A 1FBSA 2HKOA 2LDUA 5E1XA 3E97A 4ZZLA 1USYA 2YLCA 5D6EA 1SD5A 4BWAA 3FMRA 4EJTA 3M4GA 4M74A 4JUVA 1ULYA 2HS5A 2PQ8A 5HDNA 1CF7A 3KZYA 4P73C 4NL3A 1G5HA 1F4KA 3MAJA 2A61A 3LSQA 2YX7A 3BPVA 4R1HA 1G3YA 3MWMA 4CZZA 2MA3A 3VU3C 5F6FA 4G94A 4OIPF 2LF8A 3FHZA 1B4AA 5DEQA 1WSUA 4EMSA 4NCXA 1S7OA 3P8VA 4M78C 2CG4A 3GZ6A 3AHUA 4JRKA 1T6SA 4RMFA 3GF2A 2HR3A 1IAWA 4EO4A 2IY5A 2DFIA 1Z1DA 1LNWA 4IF4A 4U88A 1S6LA 2ZCWA 4XLNF 3KZZA 2GWRA 5I21A 1FZPB 4KYWA 3HXYA 4F7ZA 2DTHA 4P73A 3A74A 1KMNA 3BDDA 2L54A 1PP8F 1V4RA 1X2HA 1HSTA 3I53A 3I64A 1UCRA 2ESHA 2CIMA 1UB9A 4AIHA 2PBIA 3KFWX 3TDUC 3IKLA 3GUDA 4M78A 1O7FA 5E1ZB 4C8QC 1AOYA 4KNYA 2DQRA 2PMUA 4P74C 4ZH4F 1XMAA 2BGCA 2DO7A 2RN7A 1IRFA 1TBXA 5GMKi 5LJ5j 4AH6A 2I4MA 2QTXA 3BY7A 2EFOA 3LA7A 4XTUA 5K5OA 4ENMA 3RKWA 1GHCA 3IKTA 4AIKA 5E20A 1X01A 3VBBA 4M73A 1TTYA 1SESA 2ZZGA 1KOGA 3RL6A 3ECOA 4ON0A 4ZTUB 3H3UA 4P3PA 1E1TA 3HXZA 4EJOA 2DVEA 4P75C 4UV9A 4P9UA 1MD0A 3BJ6A 4RB1A 3DP7A 4XU0A 4C8QA 4YP0A 3O2PE 2XAFA 3V8KA 4P74A 2E41A 3ICAA 3FXQA 1YFSA 1J5WA 3DF8A 1ZRCA 1BM9A 3BJAA 3JB9F 2GZWA 3L9FA 1R1VA 2DJZA 4XTYA 4WI1A 4HLXA 2D2WA 2E7WA 5DD8A 3UFGA 5GAOn 1KU3A 3F8BA 4ENNA 1T39A 6PAXA 1BI2A 4M7AE 5L3BA 1RUOA 4C92F 4PJOE 2AKWA 4XSZF 4P75A 3VFZA 3QSUA 5HDKA 4H2YA 4TQFA 1J9IA 4ZIBA 3RDIA 3JCMP 4HQMA 5E3IA 1O3RA 5E8GA 3I54A 3L4GA 4LD5A 4F7UF 3E6BA 1HQCA 2YU3A 3BWGA 1K79A 4G84A 1MGQA 2OAZA 1N9RA 5C53B 3J81Z 2Q2EA 4GYGA 4YRRA 1F5TA 1YFHA 1SD7A 1EIYA 1ZRFA 2STTA 2E10A 1JGSA 5GANg 3A5YA 5FD6A 3IRQA 3MQ0A 4E51A 4A0XA 3JCMf 4NL2A 1QGPA 1D8JA 2JPCA 2DQLA 3R0JA 1V3FA 3HOSA 4A12A 3HRSA 3A31A 3BP8A 3RI4A 5LEJA 4H0EA 3HSEA 5KVRA 1D3YA 2FMYA 3CUQC 1IXRC 4M77B 4HWOA 4PGGA 3J81K 3JCMV 4G7HF 3ERED 2BYVE 4RB3C 1YGBA 1U5TC 4NHJA 2QYOA 4YRFA 4RS8A 3PFIA 2ZINA 2BBYA 1ZYRF 1ASYA 4PG3A 3G1ZA 1H4QA 2ODRD 1KQ1A 4Q6GA 1FBQA 1E22A 3AAFA 5LJ5h 2IA0A 5CVRA 1BIBA 3LC0A 3CUQA 3HOTA 4WF2A 1F9NA 3JB9D 1L3LA 1IL2A 1MJBA 4AD9A 2V1DA 1U5TA 5K1XA 4M75F 2V9VA 3HFZB 4I2OA 4C92D 5GANd 2B0LA 1G51A 2DU5A 3LSSA 4HF2A 2ZFWA 4YPFA 4LGWA 1FSHA 5GAN5 1E2XA 4HWRA 2RM4A 5FB2A 1EQRA 2Y48A 3QUIA 3HXVA 1QF6A 4GGGA 2ZMEB 4KIGA 1KU2A 1C0WA 5GANe 1LJOA 3DSQA 3FJPA 2ZT7A 4KQEA 5LRSA 1UHMA 3JB9J 4KIFA 5CVJA 3UGQA 3E5UA 4N0AC 2XHKA 3HIFA 1ON2A 1WLEA 5D5VB 2JN0A 2K57A 4J6YA 2ALYA 3PCOB 4HW0A 4K86A 2ISYA 1MDMB 3JB9G 2J5PA 2VODA 1XCVA 2BV6A 2M1BA 2QENA 5LHGA 1W4MA 2M45A 3ZMVA 1ADJA 4Y17A 2HNIA 1T0FA 4YROA 5JI6A 5FLXK 4BNCA 1KQ0A 1Z6TA 4UXNA 2WWYA 4N0AA 2GIVA 1JJCB 3LAPA 5H6QA 3SWNB 1D5VA 1FSEA 5AIQA 4P71C 3QO7A 4A5NA 2ARTA 5FGMA 1B34B 1J59A 5E17F 2MH9A 2BE5F 4CO8A 3SZTA 4N9HA 4KUMA 1W5TA 2VC1A 4UV8A 4IPAA 4UHTA 1R5GA 4A6EA 5LLQA 3PZCA 3WTWC 1BI0A 5KNNA 3QPHA 5ELOA 3TOBA 4TVAA 2QM3A 4YIIA 1HKSA 3GXOA 4EM0B 1YS7A 3M8FA 4KIBA 4OIQF 1I1GA 1P2FA 3C7JA 5LGNA 3WTXC 2A6EF 1D3BA 3GX4X 3NQOA 4IRIA 5LJ5g 4EJUA 3BY6A 4P71A 3F3XA 1I5LA 2ZGWA 5HLIA 1G3TA 5GAN8 2AMCB 3J7AO 1F1ZA 2GXGA 4HT8A 1FP1D 4RB2C 2I4OA 3KP6A 2XGTA 4M75D 3RF1A 4BH9A 4YFKF 2CSOA 1BC7C 4YRTA 4G85A 2CJBA 2CGPA 1T98A 2H6BA 3K1PA 3TUPA 3N4MA 2NYXA 2GA2A 2OU2A 1IN8A 4DNCA 2ZZEA 2AXLA 3TQNA 4KDPA 2I2LA 1R22A 1O3TA 1P4AA 1H641 1S29A 4QLCU 3FWEA 4C8QG 3ERRA 1B1BA 4Q5SF 4P3NA 4Y15A 1QQIA 4ESFA 4YFNF 3ISPA 5CYVA 4P55A 3RPQA 2EWNA 1J75A 2CWEA 5BPDA 3F6OA 1ASZA 4UP7A 2VE9A 2ZXJA 2PFBA 3WGIA 2H6CA 1XCBA 2V1UA 1ZGJA 1N9SA 3KP5A 3VODA 1GXPA 2ZJ2A 2F5CA 1KU9A 4M75G 5J6XA 2QQAA 4WWCA 5GAMe 4CXFA 5LJ5f 4UP8A 3MZHA 4M78E 3JAMZ 4GO1A 4ZYGA 2A3SA 2QHSA 2FOKA 4M7AF 1WQWA 1BBYA 2W85A 3GFIA 4PJOF 1DPRA 1Z91A 2MH2A 3I0TA 1BOAA 4UVBA 5GMKm 1LB2A 4I98B 2NRAC 5K1PA 5ILSA 4ENJA 3LFKA 1UFMA 3B02A 2PI0A 3VEPA 1IN6A 2EFQA 4M6XA 5CVIA 3G73A 3J80K 3M4PA 1OYWA 2XAHA 5D4RA 4ZYHA 2KIUA 5GAN7 3D0SA 2KJCA 4MEXF 1NYRA 1N9WA 3JAMK 2A07F 2Q7HA 3I71A 1JRIA 1R1UA 3P9IA 5DD4A 1YFTA 4XRFA 4LJZF 3RPUA 3QNEA 1IN4A 1ZG3A 2DBBA 1YW7A 2QWWA 5FFZA 4KT5C 2YR2A 4M9XA 3KP7A 2ZR3A 5ILUA 4AIJA 2KRFA 2D45A 3F21A 3KP3A 3RACA 1WRJA 3SHFA 1DP7P 4TVYA 2P0LA 1ZH5A 2P5IA 2RDPA 1W7PA 3DQVC 1ZHFA 1K7AA 4G7OF 2QBYA 4YREA 4C92B 4RGUA 2ZNYA 1ONVA 2P5LC 5ICGA 1E17A 2RHSB 4I09A 5CVUA 5D5UB 2RB6A 1J2XA 4JQFA 5J8FA 3UH0A 4J5YA 5ERIA 3JCMc 4F7UB 5DDGA 4M71A 1YS6A 1YO5C 2JZYA 3ZMUA 2GQQA 5F1RA 2PEXA 3RKXA 3F8MA 2FSWA 1U78A 2V1XA 2EK5A 3BFMA 1WWXA 1FX7A 2FYKA 1NJ6A 3RJPA 1UHWA 2RQPA 5LHHA 4M7AD 1AWCA 4U0VA 4PJOD 1C0AA 4YRJA 1FY7A 1DDNA 2DLLA 3WODF 5H20A 4E70A 4YCUA 2H09A 2RVCA 4G6QA 3V7SA 2ARUA 3OD1A 3I59B 4WXCA 3R0AA 4KR2A 4HF0A 1B7YB 4P72C 4I02A 3M1EA 2EA2A 1LNXA 2FBKA 2KIMA 1PYSA 2M5WA 5HDGA 1QZYA 2M8EA 4YRKA 2IA1A 5EEHA 1U2WA 4U7BA 1U6GA 4EX5A 5GANh 4P5OA 2EV0A 5E18F 2F5EA 1T2KA 5GMKl 2G4CA 1ODDA 2O61A 5K1YA 1Y96B 4FX0A 5AONA 5LEKA 3EQLF 5HS7A 1ON1A 2DI3A 2E1HA 3F8FA 5GAMj 3L2CA 4P72A 4M7AG 3KEQA 2DU7A 4PJOG 2J5OA 3W6KB 2E65A 2XIGA 2IA2A 2L4MA 1FT9A 1EV7A 5D6FA 4IHSA 1OMIA 2RC4A 5LJ3j 1G3SA 3QHSA 3RUXA 4HT9A 2WTEA 2VOOA 1STZA 3JCMJ 4M7DE 2UWMA 1DUXC 1IZ1A 3WG9A 1QBJA 2Q0OA 1O3QA 4G9YA 2A6HF 3A5ZA 4M75B 4UVCA 4HX4A 3KP4A 3L1AA 1SMTA 1U3EM 3REUA 1K78B 5IT3A 3HXXA 3HRIA 1EH6A 1P92A 2RKHA 2XTIA 2LSOA 5D8LB 4EMKB 1TQMA 2O0YA 5HS9A 3GLXA 2ZCEA 3E5XA 4CH3A 1EIYB 1FOKA 1EOVA 2Y75A 5BQTA 2HFHA 3V8LA 2FB7A 1G6NA 2P7CB 4XSXF 2CYYA 3HYIA 2FXAA 1HK9A 2L02A 4KN4X 2XASA 1R5HA 3F22A 1USTA 2DKGA 3HSRA 3RGLA 5EEGA 1LEAA 1IW7F 3V8JA 1X54A 2D1VA 4Q48A 1TNSA 2MBFA 3ZMZA 1R58A 2FBIA 3FM3A 1LEBA 3HHGA 4RGSA 5TRDA 4XU1A 4L87A 1ZG1A 2Q8KA 5ED4A 3PGGA 1JXSA 5LGTA 3QPTA 1X3UA 3LQQA 2QHUA 1GVJA 3LSTA 1X56A 5DV5A 4MMKA 4PHCA 1YCYA 3I5UA 3QU6A 2FMLA 2HYGD 2F2EA 2ISZA 3IC7A 1REPC 2QLZA 3WU1B 5FFXA 5E1WA 2OBPA 3CUQB 4G6DA 4M9ZA 1EVKA 1R1TA 2DQ0A 3GWZA 2A69F 4M78F 3BJUA 1GGMA 3ZMSA 3GYHX 4CS3A 5CLSA 3T8TA 3FIFA 4H2XB 3PQJA 2I4NA 3BJOA 3K1MA 4EJWA 4YG2F 5GAMh 2FBHA 3WTTC 3REOA 5A2QZ 1X55A 1QE0A 2L01A 4TQDA 2ZKZA 3ZMDA 4MEYF 2QZ8A 1L0WA 4IRGA 1WU7A 4ETSA 3EYIA 4IHTA 4O2DA 3HSBA 4LK1F 1IUYA 5KK1A 1J7KA 4EGZA 3ELKA 2K86A 1WQ2A 4O3MA 4C8QF 4TWAA 1H4SA 3WGHA 3JW4A 1HKQA 3JCMe 3C3WA 4EVIA 2EFNA 2G7HA 1OPCA 5DY9A 2ALYB 2OD5A 2E7XA 4XTZA 3TO9A 3V7CA 3WTVC 3R60A 2ZT6A 4M7DC 3EFSA 2QVOA 5GANf 2GA1A 4M77C 2OA4A 2V6CA 3HUGA 1OR7A 5BMZA 4EQQA 3BPXA 3COAC 3P7NA 5ICFA 4H2WA 4Q15A 4MHGA 1R7JA 5HS8A 2O8XA 3ML6A 3HFOA 1B9MA 1LJ9A 5L3FA 4L0YB 4KFCA 4HLYA 2DTRA 3DPLC 4S05A 1IN5A 1XB4A 3MEYA 1W5SA 3WU0A 4K87A 4M7AB 3WGGA 4M7DA 3NEMA 4M77A 4PJOB 2YPRA 3P9CA 2Q5IA 4KICA 1NJ2A 5FD5A 4H2SA 2LKPA 1OYIA 2CGHA 2GXBA 1G5IA 4YRQA 1B59A 2HDCA 2PMFA 3HFVA 3HRTA 3I58A 5H6RA 4LLNA 4XEOA 3DEUA 1RZ4A 4NOYA 1SRYA 1NNHA 2XKOA 1HBXG 4M78D 2G7UA 1FBUA 4V2SA 1USSA 3ZMTA 3I4PA 4A0ZA 1YW9A 4RQEA 2Y0MA 3TGNA 3GIBA 3U9GA 3N97A 5J8CA 2JT1A 1E24A 4YDQA 1Z7MA 3L7WA 2W57A 1MKMA 2VT3A 1O3SA 3VQVA 3EETA 3BOQA 1TQPA 2MLKA 5GAMg 3FXRA 3HSFA 3WTZA 2VC8A 3HFZA 4XU3A 3VQWA 5JVTA 4UPAA 5DCMB 2HQRA 3TO6A 1IRGA 4C8QD 2FEZA 4EJVA 5GAOm 2ETHA 3OOPA 3MCZA 3Q5FA 5LJ3g 3K0LA 3TEGA 3TOAA 1KGSA 2ZMEA 3KLOA 1VTNC 3R07A 2ZIMA 3S2WA 4HZFA 4M78G 2NAZA 4HBLA 3SWNC 4H02A 5HLHA 4R8HA 1KA8A 3RERA 2Z99A 3M9AA 3PCOA 2R3SA 2OZ6A 1MDMA 1MJAA 4DQ2A 2XGXA 1MGTA 2DZ9A 2NNNA 2ARSA 2Z5UA 2RA2A 1NJ1A 1NJ8A 3VQXA 5HGQA 1WYDA 1ADYA 1MZBA 2CO5A 4M7DF 2HKXA 1R00A 4LG0B 3A7UA 1T38A 1ATIA 2ZIOA 1JJCA 1PUEE 4J15A 3SWNA 4LB5A 2ZNJA 3LWFA 4QVDA 2PMHA 3DFGA 2O6GE 1XMKA 1B70B 3MF2A 2QQBA 2E5AA 4HV6A 1B34A 5ICCA 2Z9OA 3NETA 4RAZA 2CFXA 3T0YA 5BS6A 5GAMd 2FA5A 4IRHA 4KMUX 2VXEA 2ZZFA 5AIPA 2IPQX 4J6WA 3CTAA 4F7UE 3LA2A 3VB2A 4NB5A 1TW2A 3GVAA 3ZPLA 1FYKA 1YQAA 4I0BA 1FYFA 1H9GA 5LJ3d 4TV7A 3QO8A 2ELHA 3JTHA 3B73A 3TEHB 2EA4A 4YFXF 1JE8A 4XBFA 4L18B 2OQGA 3QO5A 3T5XA 5ILVA 2AMCA 3T1BA 5LJ3e 2O03A 4LFUA 2RHQB 1QO0D 4I7HA 4QWQA 4G8XA 3LA3A 2XROA 4RB0A 4YIFA 2H94A 5GMKe 2ZXFA 2I4LA 3ECHA 2VXZA 3DKWA 4CGZA 2PLYA 2Z3YA 4O6JA 4OMZA 1I27A 4OLFA 4WX9A 3HTZA 3RESA 5BPIA 4RQFA 3FX3A 2CJAA 4J6XA 2VC0A 3ULQB 2VE8A 2KJBA 3CLOA 1WKMA 1HTTA 4K2EA 3EDPA 1HW2A 3NRVA 2H27A 1JHFA 2HYFA 3VQYA 4CICA 2E3CA 3GFJA 4XTVA 3KCCA 2Q5HA 5GAOl 1X2GA 3V4GA 2EAYA 2BEOA 1U8RA 4ZZDA 2F5DA 1R36A 5D4SA 1FPQA 2X0LA 4M7DD 3KFUA 2ESNA 3IKMB 3GO5A 1RI7A 4Z2YA 3OV8A 3M7GA 1HC7A 1YIOA 3DV8A 5LRRA 1FYLA 4KA4A 4L0ZB 4BHBA 1CF7B 5DCFA 1FLIA 2J3MA 2P4WA 1YFRA 4WJ3M 3CDHA 4ESJA 4XQ3A 2ZT5A 5E8IA 4K88A 1U1TA 1EVLA 3HTUA 2JRTA 3JCMW 1TNTA 1PYSB 1SERA 3UGTA 4HOBA 3HXUA 1SETA 2K4JA 1Z6RA 5FO5A 2IY5B 4A0YA 4UNOA 1M5Q1 2RV8A 1DPUA 2HWVA 1IXSB 1I6XA 3WTYC 4HYEA 3ZQ7A 5DUKA 2J3LA 4BYYA 2NNYA 4BHPA 3IHUA 4A2UA 3JCMh 1J0RA 1ZAOA 2TDXA 3WTUC 4M7DG 2QHVA 4MTDA 2DQ3A 4OMYA 3U2RA 1D8KA 3W3SA 4ESBA 4C92C 4HF1A 4L9TA 4M78B 3F72A 3L00A 4P9FA 5GAN2 1EH8A 2XUBA 5CAIA 2ZT8A 4RGRA 2AS5F 4IVNA 2EL9A 2M87A 3A7AA 4HWTA 4FT8A 4EMGA 4OP0A 2HEOA 3C18A 3INZA 3E5QA 4XTWA 3H92A 3QU3A 4MNUA 1KMMA 3P8YA 5DYMA 1TW3A 4C92A 5GAOr 3M4QA 1XSXA 2L3DA 3TKYA 2UZKA 4JBAA 2RHSA 5JHUA 4U7DA 4C8QB 2CW0F 3FM5A 4HAMA 4M9SA 4YRLA 4PCQA 4F7UA 2DAOA 2VT2A 2IW5A 3ROUA 1HW1A 1PP7U 3E6CC 4OIRF 5GAN3 1TH7A 3P8TA 3A32A 1EFWA 1ZLKA 2PG4A 3BZ6A 2VONA 5GMKj 4A54A 2JSCA 2XVCA 4M77E 2AKWB 1FC3A 1HSJA 2DTOA 1BBUA 4XLPF 2JTVA 1J5YA 4B8XA 3E3VA 1H9TA 3L4GB 4TTVA 3GFLA 3I59A 2VOPA 1P4WA 1EH7A 2OQRA 1I81A 3EFRA 1B7YA 3KEOA 4EGYA 2ADUA 2ZBKA 2EV5A 2MLGA 4A6DA 2VBXA 4IJAA 4CS2A 4WXHA 1XGMA 3F6VA 1SFXA 1G3WA 4CH5A 2STWA 2LF7A 1WI9A 2MC3A 2DEQA 4X9CA 4MMLA 3EYYA 2WV0A 4YRPA 2A5YB 1S7AA 2JPBA 3MZYA 4GCVA 3SB2A 2QHTA 1YTYA 1Y96A 1I5ZA 3JCMg 3DPTA 1IN7A 4M75C 1TQIA 3R6SA 3RTRA 4I0AA 1LDDA 1XDUA 2ZO4A 1SFUA 3HRUA 4CH4A 3EUHA 4L9VA 4YRNA 1MJ9A 3MFKA 3NELA 2K27A 4LK0F 2UXNA 4BQAA 4EMKC 4OINF 2IT0A 3QTCA 12ASA 1XGSA 3GW2A 3F23A 3TDZC 1XN7A 3JTGA 3QAHA 3IL2A 1ZLJA 2ZTGA 3HY0A 4BXUA 4U0YA 3CUOA 4BW9A 3IRRA 4M75A 2HTJA 4FHTA 4P3OA 4EMHA 4HA8A 2KIFA 1LOJA 3CO7C 3TO7A 5HOOA 4LNSA 2MD5A 3FZVA 4HDUA 2ZNZA 1K78A 3HFNA 3ABTA 4WK8F 1FP2A 1KQ9A 3DXJF 3IWFA 3JB9I 4EMKA 1RIQA 3RYPA 1W7PD 4JLIA 5F5WA 4U0WA 4N0BA 3W6JB 3GFMA 2GAUA 1U5TB 3L09A 2E64A 2RD1A 1PDNC 4RGXA 3HHHA 1Z7UA 5LHIA 4UP9A 3I7FA 4KMFA 4RCBA 2PJPA 2DW4A 4YRCA 1P6RA 5C52B 4HWPA 3Q9VA 1YYVA 3JCMd 2OZUA 4RCCA 2YLBA 2C7IA 5LJ3h 4YCVA 3FMSA 2YX4A 2EFWA 4M7DB 5F64A 1RUNA 5GMKh 2DU9A 2ACJA 3JB9H 1U1SA 1L0OC 4QVCA 1FWZA 4H2UA 4AVPA 2FQ3A 1RIOH 3PQKA 4HWSA 1ZREA 1K6OA 11ASA 1SMYF 2XKPA 4CH6A 1H0MA 1FYMA 1JBMA 2DK8A 1YG2A
chains in the Genus database with same CATH superfamily
1K8AU 3ZFJA 1WPYA 2BXYA 2ZNIA 4N9IA 4RAYA 1TTHB 2XDPA 1JT0A 4Y13A 1VOMA 5D5WB 3HRMA 3EG9B 3SDZA 3MEXA 4XK4A 4C0FA 1BCOA 1QZZA 3EGDB 3W2AA 2BKDN 3A0HC 5CKEA 3OOUA 4QPOA 5L3GA 3K1NA 1KU7A 4IXAA 1HW5A 2E19A 4TVAB 1I4K1 4IKFA 3ZGKA 3QRFF 4LLGF 3E9IA 1ZN2A 4OU0A 3UKGA 4OMOA 3UA6A 2YUSA 3CMEA 2IRFG 4XKCA 3M56A 1YOVB 2LBFB 3CCMQ 3ABKH 2HZYA 2VUBA 2KP6A 3GTQJ 1MIJA 2RNJA 1IDYA 1WLPB 3M0PA 4PGHA 4P96A 3E7LA 2LMDA 3M4YA 1ZRDA 1Z7NA 4OWRB 4JRIA 1S1NA 2JW4A 1CGPA 2F5KA 3PUBA 1ABQA 4I01A 2EH3A 4PNOA 2OAUA 2QQ9A 1A04A 1XGOA 4TVRA 3REXA 3K2ZA 3G3ZA 2K5IA 1QP2A 5JFRA 2F4OB 1K83J 2HOTA 4H2VA 2EB7A 4M7AA 3A8LB 4JPBW 4I99C 4PJOA 2R7VA 2RJFA 4X5OA 4UVAA 1BJAA 1G8XA 3K4LA 2DF6A 5LGUA 1WH7A 2D1HA 2YHTA 4ABZA 2KDZA 2P5KA 3BCBA 3IP4B 1PC0A 4C0DB 2LJ0A 4FX4A 1ERDA 3KEYA 3P8HA 2HXOA 5IOYA 1YITT 4O5VA 3HY1A 5IT9Z 2KRSA 3VYSB 2VBZA 1TG0A 3S1NJ 3M8EA 1YI2Q 4A5MA 3VS0A 3WQZA 3JCMb 5DS9A 2X9DA 2FEIA 4XMYA 2Q7GA 4N4GA 4A53A 2KKOA 1ZGAA 2JS2A 2A3LA 3HXWA 1W7PB 2LQ8A 3S14J 2QA4T 1EJ9A 1V1CA 2L4AA 4LG0A 4CHUA 3ZQIA 3ZR8X 2V8KA 4L9NA 3DU6A 2HSPA 2IP2A 3JSOA 4RM2A 5LJ5e 1RUWA 4CS4A 2CJ9A 3CJTB 3OSFA 1H4TA 5K5RA 2PQWA 3JRGA 4DPGA 3CO6C 2XAJA 3K9TA 2R7SA 4H2TA 2EIJH 4GBQA 1MMDA 2XRNA 2XDVA 2VBWA 4M77D 1NPPA 3M3YJ 4B09A 5FROA 1NM7A 1VQ9Q 4M75E 2HL5C 1IGUA 3CD6T 1YITI 1HKTA 1E6GA 2EQJA 4HDVA 3AG1H 1OU8A 1HXDA 2NUPA 2X3XD 1EFNA 3JRAA 5C51B 4ZJZA 1USYC 1Z9CA 3CCRA 3SZPA 2E1CA 2CSQA 3J7YJ 4KR3A 4D9JA 1QCFA 4M77G 3Q9SA 4HX8A 3M53A 5D5XB 4ASNA 2LQWA 1MV3A 3PL8A 3EUAA 2E2IJ 3I4NJ 3CZ6A 1K8AC 4KRTA 3P8BB 3JSPA 2LTOA 1YBYA 2QA4I 3CCJA 3REBB 4A4HA 1K73C 4RG2A 2HS5A 5HDNA 1FEXA 1CF7A 3CCET 1G5HA 3MAJA 3PIOA 2X4XA 4R1HA 4CZZA 2MA3A 3LSGA 1AWJA 3FHZA 2Z0WA 1B4AA 1S7OA 3GZ6A 4RMFA 3GF2A 2IY5A 1QVPA 4IF4A 1S6LA 2GWRA 1FZPB 3URGA 3VS2A 4P73A 3A74A 1KMNA 1H3ZA 2H3JA 1FOYA 3HKSA 2PJRA 1KD1R 1B8IB 1X2HA 1OX8A 2F5VA 5KYXB 4PJLA 1UB9A 4AIHA 3CD6I 3KFWX 3TDUC 2R7XA 2E60A 2CZ1B 3M07A 2ESWA 1ZR2A 3BG5A 2JSPA 4RTVA 1TBXA 2ZXWH 2I4MA 2DA1A 2GQIA 4AIKA 5E20A 2BZTA 4M73A 1TTYA 4HVVA 1SESA 1KOGA 3RL6A 4ON0A 3H3UA 2DVEA 4P75C 3HB9A 5J39A 3M0SA 3DP7A 4A4EA 4PK4A 1XNIA 4E7SA 2NXNB 2WA0A 2NS7A 1J5WA 2RF0A 1ZRCA 3OYYA 3JB9F 3CMMA 1Q81U 3A01A 5DD8A 4FU6A 5GAOn 3BLYA 1T39A 1OCTC 1BI2A 1YIJT 3VFZA 1T33A 4J9BA 3RDIA 1I07A 5E3IA 3CCSI 5E8GA 4F7UF 3M0RA 2YU3A 1K79A 3DLLF 2EZLA 1PRLC 4R56A 1SEUA 5C53B 2K5CA 2MG4A 1W36D 3CC2A 2NWMA 1UECA 4C5GA 1ZRFA 3HUGB 2STTA 4XKVA 4QVZA 1Z67A 2RQRA 2COBA 3ZQFA 1QGPA 5J47A 2JPCA 1V3FA 3HRSA 3RI4A 5LEJA 3F70A 2CJJA 3P5JA 2HBWA 4HWOA 3HM5A 3NPFA 3A98A 3J81K 4A3BJ 2GTOA 3ERED 4NHJA 4YRFA 1MH4A 4RS8A 3PFIA 3MD2A 1H4QA 1KQ1A 3G4ST 2DMOA 2BE7D 1VQ8A 1BIBA 1WJBA 3CUQA 1EIFA 1L3LA 2VL8A 4C2UA 3F0CA 4PUSA 4AD9A 1U5TA 4A3GJ 2IIMA 2H8RA 4I2OA 4C92D 5GANd 3CCQQ 3LSSA 1LE8B 4XK8E 4LGWA 1YIJI 2D5VA 3TVTA 4HWRA 2RM4A 3CC4T 2KE9A 3QUIA 3HXVA 2RNAA 2XI9A 2ZMEB 1C0WA 4M4ZA 1T0FC 3WVEB 5GTIC 2ZT7A 3LWIA 1UHMA 3HOUJ 2GFUA 1WLEA 1JUPA 2QEXA 3R6NA 3PCOB 2ISYA 3MMYB 3UNGC 1E6HA 2QENA 5LHGA 2EQUA 5KE3A 2KI7A 4YROA 5JI6A 1ZBXA 2DTZA 4A3IJ 1Z6TA 4UXNA 4XRSG 4N0AA 3H8ZA 2XK0A 3EG9A 3SWNB 1FSEA 5AIQA 2A08A 1VA7A 4A5NA 3EGDA 3H9GA 5FGMA 2RHZA 4Z8AA 1CSKA 2BE5F 1X1CA 1W5TA 1Z7LA 1PYVA 2VC1A 4IPAA 1ZR4A 5LLQA 2VB6A 3TOBA 2C0OA 4TVAA 2KT8A 1HKSA 4MLOA 3G4SI 3J7ZI 4OIQF 3C7JA 2NS6A 4JX5A 3NQOA 4IRIA 5EC7A 3F3XA 2LBFA 3DB4A 2M4GA 3J7AO 2GXGA 1W5CC 3KP6A 3MO8A 3RF1A 1M1KR 1JB0E 4YFKF 1BC7C 4G85A 2Z16A 1T98A 1WFWA 3TUPA 2NYXA 1R71A 1IGQA 4KUIA 2GA2A 3TQNA 3CC4I 1BA5A 1VIFA 1H641 2AHQA 4C8QG 4XLEA 1Y0NA 3FEOA 2E5KA 1J75A 4HG2A 4BBRJ 4J7FA 2VPRA 3JREA 1ASZA 3H3VK 3WGIA 1BKBA 1SRLA 2CS7A 3SFMA 2V1UA 1N9SA 3KP5A 2DE0X 2L7FP 2ZJ2A 2F5CA 3JAMZ 4GO1A 3TBIA 5I11A 3W2WA 3CJQB 1OULA 2F4IA 4M7AF 1WQWA 1BBYA 3QODA 1JTXA 4PJOF 5FU7B 3I0TA 1Q81C 1LB2A 5HNHA 4GY5A 4ENJA 4A3DJ 1TXQA 3VEPA 3Q0VA 2L9NA 4I76A 3G6EA 2EFQA 1GXIE 2O9VA 5CVIA 5KYWB 4FSSA 3M4PA 2KIUA 5GAN7 2KJCA 1N9WA 2Q7HA 1JRIA 3TEEA 1VQOA 1ABOA 5E3LA 3A03A 1T0JA 1Y57A 2V6EA 3QNEA 1WX6A 3PMTA 5IHKA 1ZG3A 1ZSZB 3RNJA 4M3GA 3KP7A 5EJCA 4P5NA 2RJDA 4OB2B 3SHFA 4TVYA 3GTPJ 2JA6J 4JJDA 2P0LA 1W7PA 4OMMA 3UR3C 4DEYA 2X6OA 2ZNYA 4V19K 5D5UB 4KGXB 3OYGA 5DDGA 3MP6A 1YO5C 1D1AA 4C5EA 3ZMUA 1MHNA 2DX1A 3M9QA 2VJJA 3OS1A 3RKXA 2HQEA 5CKDA 2EK5A 4IHVA 1QPIA 2GGRA 1GLNA 4E70A 4YCUA 1BBZA 3G2BA 2H09A 4AM3A 2ARUA 2QI2A 5FU6C 2TRTA 2HXIA 1D0XA 4HF0A 1WGSA 1WI7A 5HDGA 1QZYA 1U2WA 4RDUA 2M8GX 5E18F 3A8OB 2LJ3A 2F5EA 1ODDA 2O61A 3AG4H 5K1YA 1Y96B 4X1EA 5CO7A 2DI3A 5GAMj 3L2CA 2O31A 2LZ6B 4CYCB 2J5OA 3PSFA 3W6KB 3OYLA 2H3EB 1EV7A 2VVKA 1ETOA 4BACA 3OL3A 1UJ0A 2RO0A 3JCMJ 4M7DE 3TSWA 3WG9A 5A0DA 4M75B 4A3EJ 2DMNA 3ULRB 2QG9B 1U3EM 4R0KA 3HRIA 2XTIA 3UT1A 1OPLA 3ZOBA 4PJNA 3GLXA 1CKBA 2RH2A 3GLLA 3IAS2 2P7CB 2L02A 2IVWA 2HPMA 3CCRI 1LEAA 1ACMB 2JQ7A 1XMXA 5GAGJ 3PIOF 1TNSA 3ZMZA 3SJMA 1B8IA 4J19A 2HI3A 2LY9A 5KYXA 4LVLA 4QT7A 2VASA 2GOMA 1QHHD 1T95A 2W00A 3DTKA 2LRDA 1ZG1A 5ED4A 3QPTA 3LQQA 1GVJA 2VIXA 2ISZA 1W6XA 1REPC 4D7MA 2K3YA 1R1TA 1IB8A 1WJSA 4CS3A 3T8TA 4AFQC 1K76A 4H2XB 5C44J 1QKWA 3DKYA 3PQJA 2F2VA 2I4NA 2FL7A 2YRDA 1IHWA 1J3TA 3JRFA 2ZKZA 2I8DA 4OB3B 4MEYF 2Y4YA 4J9FA 3EYIA 1OR7C 3HSBA 4LK1F 3CCUA 1J7KA 4N4IA 1HA8A 2XMFA 2EIKH 1A0NB 1POGA 1H4SA 3WGHA 1HKQA 3JCMe 1QA6A 5DY9A 2OD5A 3TO9A 4EEFG 1JKRC 3V7CA 3R60A 4M7DC 5GANf 2I0NA 1UMQA 2V6CA 3MN2A 3HUGA 5J4VA 1UHCA 5BMZA 4EQQA 3COAC 1NG2A 1QVFP 2GOXB 4MDWA 1R7JA 4ZYAA 2MC4A 5HS8A 3EH2A 1HLVA 1LJ9A 5FLVA 2XKOC 4LUEA 4LIUA 4KFCA 5CKTA 4PJJA 4JZ3A 3MVPA 3LWHA 1W5SA 2ED1A 5GAEJ 3G71T 2YPRA 2DA7A 3P9CA 4KICA 1NJ2A 3OMYA 2HDCA 4RTWA 1YJWQ 3HFVA 2BY0A 3V42A 2DT6A 1RZ4A 1FBUA 1USSA 2Y0SN 4RQEA 2MMPA 2CZ6B 1WJRA 2JMWA 1E24A 4YDQA 1TL8A 1Z7MA 2W57A 2VT3A 3MEAA 3NTHA 3BR1A 4LDWA 3CQTA 5GAMg 2DXBA 4BGDA 2XRLA 3BCAA 5DCMB 1N27A 2OTLA 3I9QA 2CKKA 3HOVJ 3H9NA 2E5QA 2ETHA 3DEWA 2DDBA 2ZMEA 1T3SA 2FPFA 2EQMA 5D7UA 4IOAF 1F43A 5HK3A 3VYHB 2JVHA 4H02A 4CC7A 2GFAA 3PCOA 1AZEA 2R3SA 4BU2A 1MJAA 3LSHA 1YRNB 2ARSA 3N5BB 1WJCA 2L2OA 1M90C 2E4HA 5HGQA 3S1MJ 1VQ8I 2KRMA 2QGUA 1MZBA 2HKXA 3QWLA 1R5ID 4DJAA 3EAEA 1PUEE 4J15A 3SWNA 2I5UA 3LWFA 2PMHA 1XMKA 1B70B 3QYEA 3NETA 2CFXA 2PMZN 2VXEA 3D1NI 4J6WA 2IPQX 2BHYA 5K7FA 1OOTA 3H41A 4F7UE 3LA2A 1QLYA 1SSFA 3NMZC 3GVAA 1YQAA 4I0BA 3SEQA 3PVLA 3I55T 1X1PA 4Y4RA 1VQKT 2VUMJ 2NVYJ 4AFUC 4XBFA 4L18B 2ZJQF 5ILVA 3LA3A 2XROA 2KGTA 3DLAA 3VS7A 4YIFA 2H94A 2I4LA 1WHMA 2R7TA 2PVOB 2DMTA 2DL4A 1ITYA 3CBOA 2CJAA 4J6XA 2V4JC 1N8RR 2QXFA 4AG1C 2XG8D 4OMQA 5I2MA 5EDNA 2E3CA 3KCCA 1GVDA 4N4OB 4LITA 2DA2A 1MBGA 2ELKA 5EEAA 4F92B 4FQGA 2EPFA 1VI0A 3KFUA 1IG7A 2ESNA 2DOFA 4ZC3A 4NQWB 1YIOA 4ZGEB 5LRRA 3NAUA 1D0ZA 5F08A 4KA4A 5KH6A 3DWLE 3BC8A 4ESJA 4XQ3A 1NK2P 3WHBA 2WB1A 2K9LA 3LL7A 1PYSB 1Y07A 4Y52J 1I0CA 1HSQA 2KT1A 5KYWA 1KD1U 4A0YA 4ELYC 1M5Q1 2RV8A 3I55I 3CMAA 2HVSA 1PG5B 2DFEA 2HVRA 1ZAOA 2M7BA 2QHVA 2CP3A 1ZSZA 1X3ZB 4HF1A 1WZOA 3OL4A 3F72A 4P9FA 4A63B 4W1UA 1CQTA 2DYRH 2EQKA 2EL9A 1Q7YU 3S1RJ 3E5QA 3H92A 2KISA 2VKVA 3TL4X 1X1BA 4MNUA 3P8YA 4ZNXA 2ELJA 3X24B 5GAOr 1XSXA 4JBAA 4C8QB 2CW0F 1TT5B 3FBIB 2ZPIB 2VT2A 3G6EI 1LVKA 3O8GA 2OTJT 3EG0A 1NK3P 2QK0A 1EFWA 3GTGJ 2KAFA 2WAQA 3BZ6A 2VONA 5GMKj 3E0JB 2DTOA 5EZHA 4XLPF 3E3VA 5F0HA 3L4GB 2EZKA 3QZ9B 3UATA 1YWOA 1Y8RB 2ADUA 2MLGA 2VBXA 4CS2A 4ORZA 1D0YA 1G3WA 2JK3A 4MMLA 5HLTA 2O2OA 4YRPA 1S7AA 3K4NA 1YTYA 3GCMA 2NVTJ 1Y96A 3OYKA 3HXLA 4I0AA 4CYCA 3EUHA 2WSFE 3U1KA 2UXNA 1YJNA 3UA7A 4OINF 2HEQA 2IT0A 3F23A 3EG1A 2NVXJ 1JXMA 3PSIA 3S3OA 3VRZA 2X85A 4HSTA 3CUOA 4ESRA 4M75A 2HTJA 1Y56A 4P3OA 3W2VA 4HA8A 4AFZC 2KK4A 5DLQE 2MD5A 1JJ6C 4Y33A 4YELA 3HFNA 1FP2A 1KQ9A 1QVTA 1S72A 5F5WA 2OCCH 2R93J 3L09A 4Z02A 3HKZA 4UP9A 4RCBA 2ATCB 4E7HA 2HDDA 1YP5A 5C52B 3PNWC 4D5FA 3CCLA 1YYVA 3JCMd 2FHDA 2YLBA 5LJ3h 3W6VA 3TEDA 4M7DB 3MP8A 2ACJA 3JB9H 1FWZA 4AVPA 2YT6A 1RIOH 4HWSA 1K6OA 11ASA 4CH6A 1FYMA 2DK8A 1YG2A 2HZTA 4LLLA 1X75C 1BI3A 1HCRA 2R7FA 4C3HJ 2AIRB 5IOZA 2O9LA 2Q7EA 1YJ9T 4Z6YA 2DT5A 2P0KA 4ZGJB 2ZR2A 2EJGA 2XPUA 1WDXA 4H2XA 4AYBN 2C6YA 3CMQA 3M57A 2DXUA 2DPUA 3ZN0A 1NEGA 4IUPA 2COMA 2CQKA 1LPLA 2J06A 1I1SA 1E1OA 3LH5A 5GADJ 3G1MA 3CCMA 1QPMA 1M1KU 1ZG5A 3E9HA 1T08B 4D6WA 1GRIA 2NVQJ 2DOAA 1LDKB 2DYIA 1FNNA 1W2BA 3ZCOA 2QEXQ 1TLHB 4M7AC 1KD1C 1JKOC 1ETVA 1Q82R 4MZPA 4PJOC 2XD0A 5HODA 3HTSB 3HGYA 2LNBA 2CMPA 1BU1A 3JRDA 3LMMA 2L3RA 1XDSA 2W84A 4Q47A 3I56T 1VQ5A 4LB6B 2DZCA 3D5LA 1ZQ3P 1Q7YC 4L5EA 4LG3A 4RDXA 3L2ZA 3ASOH 4E7JA 1S3JA 4CYDA 5LBQA 1LVAA 3T8RA 3SQNA 2X6WA 3GZNB 3P9KA 4B48A 1B6AA 3BDUA 3CLQA 5CKHA 1WZ2A 4Q4ZF 2YDLA 4HQEA 2EJ9A 1R77A 2DK5A 3FXMA 3HJEA 4MQVA 1XTDA 2IVMA 5ELNA 2XSDC 5DCMA 4ZTZB 1T3LA 4L5JA 2FE3A 4ENKA 3O6BB 1BJZA 1YI2A 4EM1A 2M30A 3C1DA 5CK9A 2IS6A 3O3KA 4S0HB 2XICA 1PWTA 2P4TA 4OF1A 1G59A 4YTLA 3VS1A 3QP6A 2K7LA 1V5GA 2CFOA 4LOCA 1YRNA 3R6OA 2VQLA 2VXFA 1B76A 1N77A 4M6YA 3LX7A 3I56I 1NJ5A 1XGNA 2RI3A 2LC4A 1BC8C 1B70A 1SAXA 4AVZA 2PU9B 1TOVA 1J09A 4G7ZF 3BQYA 3IWZA 2P5VA 2FZGB 2EZHA 1F36A 4FT2A 4Y92A 2K02A 2Q1ZB 2D0QB 1BI1A 3E6MA 3CJNA 2DPDA 3CD6Q 5GAOp 5L23A 1VQOQ 1JJ2S 4WXDA 2LQKA 4BAYA 3S93A 3QYBA 2KRCA 2CUBA 3QP5A 3K69A 1VQ4T 3A7RA 3VOEA 1S8NA 3FMQA 2KZVA 5GAOq 3CBPA 2EV6A 2EGEA 4X9DA 1WQ7A 4EM2A 1XD7A 2Y4XA 2CYZB 1QCNA 4YRSA 1ZLMA 2ODRC 2D6FA 5L3CA 2EJFA 3RIRA 1IF1A 3BG9A 3A8GB 2P8TA 2WADA 4WCGA 1WFXA 3JR9A 2GLOA 1KYZA 2L3QA 1QWEA 4IIMA 3CCEQ 1M8VA 1X58A 3C2BA 4NQWA 3F8CA 1FBSA 2HKOA 4JS5A 4BWAA 2H8WA 4JUVA 4P73C 3BR3A 3KBGA 1BL0A 2EYZA 3BPVA 4XRSA 1TWFJ 5F6FA 1TUGB 4ZTFA 1RESA 1WSUA 4EMSA 4NCXA 3P8VA 4JDSA 3OIOA 5KYNA 1IAWA 1ZBJA 3RZOJ 2DFIA 1Z1DA 4XLNF 5I21A 1M1KC 1K6YA 4F7ZA 2R58A 1AT1B 1HSTA 1VQ4I 1H8KA 3ESWB 2E12A 2M9UA 3VUBA 3GUDA 2A6TA 3HOWJ 3BTJA 5E1ZB 4KNYA 2DQRA 3RKQA 2RN7A 1IRFA 2P84A 4JJBA 4OB0B 2YUPA 2QTXA 3BY7A 3LA7A 3K6GA 4HCKA 5CR2A 1GHCA 2HZDA 4VUBA 4A69C 3ECOA 2X51A 4P9UA 4RB1A 1IZ6A 4XU0A 4C8QA 2XAFA 3H0FA 2VQGA 2J7IA 4CA0A 1TU0B 1YIJQ 1RABB 3EUKL 1BM9A 2GZWA 3CMAI 4F3QA 3OYBA 1I6HJ 2DJZA 1S9HA 4WI1A 2D2WA 4XNFA 3UFGA 2IAIA 4ENNA 4IX7A 4XSZF 3RMQA 5HDKA 4X6AJ 1YHQT 2DILA 3JCMP 2K85A 3L4GA 3E6BA 2JM8A 4FE7A 5C4JJ 4RBOA 1D1CA 1UGVA 1TWHJ 4GYGA 4YRRA 2ZFUA 1EIYA 2E10A 2DIQA 8ATCB 1JEGA 3O5ZA 3LSMA 5FD6A 5EYRA 4E51A 3JCMf 4NL2A 3R0JA 2K9NA 2BHZA 4A12A 1X1DA 3BP8A 1YN8A 4KJZA 4H0EA 2K40A 3TW6A 3PNTA 2KQWA 1C0MA 1D3YA 3CUQC 2PVGB 1IXRC 4PGGA 1TUDA 3G4SQ 2DNUA 3X28B 3H35A 2XHCA 3JCMV 5E3NA 1U5TC 3S6WA 2ZINA 3CCUQ 1ZGWA 2BBYA 2L5QA 2GTJA 1S5LC 3AAFA 5LJ5h 3LC0A 5EGOB 4WF2A 3JB9D 3S15J 2R5AA 2V1DA 4CCKA 1K9AA 1ZHIA 3JCUC 5K1XA 1SG5A 4M75F 3FBNB 4XLHA 4HF2A 1MV0B 2FX0A 2R7OA 2IGMA 1M1EB 1FSHA 5GAN5 1YHQI 5FB2A 3GOXA 1LJOA 3FJPA 1GT0C 4ZGDB 3JB9J 1R6RA 3TQ7P 1WH5A 5C4XJ 5CVJA 4N0AC 5C0MA 3CF5F 2RREA 3CCVA 2K57A 2P0PA 4K86A 3JB9G 1X69A 2VODA 2M1BA 4FISA 2ID6A 4J9HA 2G0EA 4PJ0C 4II2A 5FWBA 4BNCA 3G1JA 1S72I 2WWYA 2EQRA 2GIVA 2E2JJ 1JJCB 5CIUA 3LAPA 1D5VA 1ZK8A 1KK7A 3DTEA 1OEBA 2EPDA 1RL2A 2IEKA 3GNFB 3SZTA 4KUMA 2ZPGB 3CCLI 2OTLQ 5EZGA 1W70A 5KNNA 3QPHA 5ELOA 4YIIA 3G1OA 3GXOA 2ROLA 1YS7A 3M8FA 3OSVA 4KIBA 1I1GA 1P2FA 3KX2A 1V76A 2ABLA 1OI1A 4BY6B 1I5LA 2M34A 3ZBDA 1OYXA 1G3TA 2AMCB 1LFBA 1F1ZA 2P0WA 2XGTA 4BH9A 1RAGB 4YRTA 2CJBA 4XR6A 2CT4A 3PFSA 2KNBB 2DBMA 2CGPA 5FWCA 3K1PA 3N4MA 1N8RU 5HNFA 3FXOA 3LNQA 3N05A 1S29A 3ERRA 1B1BA 2QSHX 3MHXA 4P3NA 5CQYA 3RPQA 1RLPC 4LXCA 4C0DC 4QQGA 3F6OA 1GCPA 4UP7A 5IAYA 3E2UA 1ZGJA 1O4XA 1VQ6A 1GXPA 1Y71A 4XQFA 3CCMI 4QTRA 3MZHA 4M78E 1SRMA 2K3BA 3NWSA 2A3SA 1K4TA 5I22A 1QP3A 2R5YB 2JJ9A 5D6WA 4BY1J 1QVGS 2HDWA 2XSJC 1BOAA 4G6TB 5GMKm 4I98B 2NRAC 1QZEA 3LFKA 1UFMA 2CQNA 1V5EA 2LCLA 4IO9F 4MEXF 1NYRA 4E4HA 1VQLT 3P9IA 5DD4A 8AT1B 3SHWA 1WHHA 4XRFA 4OAZA 4A3JJ 4M9XA 4XLFA 2ZR3A 5ILUA 1VQMA 1UDLA 4AIJA 2KRFA 1RAHB 3KP3A 3RACA 1WRJA 3MJXA 3H0DA 1RAEB 4BJ6C 1K7AA 1SFKA 1PD0A 1VQ9T 4G7OF 1HDDC 4YREA 1SF9A 2M16A 4RGUA 2AT1B 4FT4A 5ICGA 2SEMA 4I09A 2RB6A 1J2XA 5J8FA 4HNVA 4RUGA 1KQSP 2XC7A 5HKCA 3HDDA 2CZ7B 1AD5A 4UUTA 1LFPA 1YI2I 2A5WA 1MNMC 1ETQA 1IRZA 3BFMA 1FX7A 3O8VA 2RQPA 4M7AD 1AWCA 2B7EA 5GPCA 4U0VA 4BI3A 4PJOD 4YRJA 5H20A 4QIWN 2RVCA 3V7SA 3OD1A 5E3MA 1AA7A 2P81A 2VKHA 3R0AA 3OR1C 2QGFB 4HNTA 3M1EA 4X1VA 5B1AH 2VJ4A 2M5WA 3RSNA 4YRKA 4OMNA 1U6GA 4EX5A 2EV0A 2KHMA 1N6AA 1VQLI 4FX0A 4C5IA 5AONA 5HS7A 1ON1A 3VYGA 4P72A 1MMSA 4M7AG 4PJOG 5D6FA 4IHSA 3VYUB 3QHSA 3RUXA 4F17A 2WTEA 2VOOA 1STZA 2UWMA 1DUXC 3PTAA 2E1MC 1IZ1A 1QBJA 1X4PA 2Q0OA 3A5ZA 1VQ9I 1SMTA 3REUA 1O9SA 1VQ7A 2LSOA 1M27C 3TU4K 2ZCEA 2Y75A 1G6NA 2BW3A 4XSXF 2CYYA 3J7AF 2XASA 2LX9A 3F22A 1USTA 3DBRB 2DKGA 1YX3A 3RGLA 1OX9A 3M8JA 1IW7F 3KYLA 2DFUA 2FBIA 2X48A 2JA5J 2X9HA 4RGSA 1N8RC 2KEAA 1H89C 1YJNQ 4AMCA 2Q8KA 2DD5A 5A2QE 3PGGA 1JXSA 4DBQA 1X3UA 3PIPA 5DV5A 2JUCA 1A6IA 2KVQG 2P4RA 5IHNA 3CUQB 1IRXA 5IXFA 2A69F 1I3QJ 3HC7A 1ETXA 1UEBA 1TSFA 3UDCA 1RAIB 1EA3A 3BJOA 1IJWC 3REOA 1JO8A 5A2QZ 1QE0A 2R57A 4TQDA 2DVJA 1UE9A 1D5YA 3ZMDA 2QZ8A 1L0WA 1IC8A 2DLPA 4IHTA 1VQPT 2CP5A 2O9SA 1JJ2A 3OW2S 3M55A 2K86A 3H5RA 4O3MA 4C8QF 1BR1A 3JW4A 3NWTA 1Q82U 2G7HA 4CCNA 1OPCA 2JM9A 4D8KA 4BUPA 2HL3A 2MWOA 4UY8I 2AZVA 3EFSA 2QVOA 2GA1A 2D8JA 2NYSA 5ICFA 1R8OB 4AYBA 3G71Q 3DKMA 4DBRA 1FXXA 2ZCFB 4HLYA 3IUOA 4S05A 1IN5A 3WU0A 3CCQT 3BR6A 3BR5A 2M0MA 4V2GA 3UF4A 4H2SA 1YJWA 2CGHA 1G5IA 3L2UA 3HRTA 1WGXA 2NS8A 3OMGA 1NNHA 3FJ5A 3Q1JA 5AT1B 1OPKA 3N97A 5KYUB 3RCOA 5J8CA 2O88A 2ZMEC 5EGOA 2M51A 2RN8A 4L6V5 1O3SA 1UHSA 3VYRB 2WBMA 4JS4A 1FIAA 4GFBA 2VC8A 3LOCA 1PJRA 1VQPI 3TO6A 1A6QA 3KXTA 2OI3A 4EJVA 5GAOm 1I39A 4DOWA 5GPAA 2MSYA 2DIGA 2YWWA 3OSSC 3DPUA 2O5RA 1VQ5Q 1QWFA 2BE9B 3PFYA 2NAZA 3SWNC 4R8HA 1KA8A 2AKLA 2XPVA 2Z99A 1T0HA 2OZ6A 4LVIA 2DL7A 5IT9E 2AQFA 2IPOB 1NJ8A 1VQNA 1WYDA 4M7DF 3HP9A 3A7UA 2O01E 1RI9A 4W97A 2ZIOA 1JJCA 5J1YA 2ZNJA 3CCQI 4QVDA 1K9MU 4KISA 2QQBA 2E5AA 1Z21A 4HV6A 3OYDA 5ICCA 2O7OA 1VQKQ 1MMNA 3T0YA 5BS6A 3META 4IRHA 3JSCA 4KMUX 1UG1A 2ZZFA 2DBKA 2LRQA 1K4SA 1TW2A 2GBQA 3ZPLA 1G5VA 1H9GA 2FRYA 2IBDA 5LJ3d 4TV7A 1R9TJ 3C4SA 5IP7J 4OGEA 3FKIJ 5E3OA 3S1QJ 3M54A 1JE8A 1GV5A 3CF2A 3T5XA 2LC2A 2AMCA 4LFUA 1QO0D 2LREA 4I7HA 2JN6A 4RB0A 1SEMA 2ZXFA 1JGGA 4CGZA 2JMCA 2PX9A 1TP4A 1I27A 5J3LA 3TCJA 4OLFA 3PVQA 4M3FA 5BPIA 4RQFA 3QPSA 3ULQB 1QW1A 3GP8A 3EDPA 1HW2A 3NRVA 1SHGA 3LGLA 2DD4A 2MW8A 2HYFA 3VQYA 1SVMA 3GFJA 5FU7C 2EAYA 1Z0XA 1HDPA 1R36A 5D4SA 1FPQA 2X0LA 1QVGP 3GO5A 1V5FA 1RI7A 4Z2YA 4BQOA 3M7GA 3E19A 3DV8A 1FYLA 3DLMA 3QG1A 3LGFA 1YCSB 3VS3A 2R5YA 4BHBA 3OS0A 2MIOA 3E1SA 5FKKA 2P4WA 2A05A 2JRTA 3EG2A 1U3OA 4LD6A 2VQCA 1SERA 3DTIA 1ZSZC 3A4CA 1VYUA 4IL6C 1BW5A 1Y1WJ 2HWVA 1IXSB 4HYEA 5DUKA 1IREB 4BYYA 2MWPA 3JCMh 2RI2A 1Q82C 3IAM2 2HDAA 1D8KA 3WU2C 4IIOA 3L2WA 3SYTA 2LOOA 4M78B 5GAN2 2M0YA 2DDAA 2AK5A 4IOCF 2XUBA 1WJEA 2M87A 3A7AA 4HWTA 2OF7A 4FT8A 2HEOA 2I10A 3C18A 4JLGA 4XTWA 4CC3A 3QU3A 2OTJQ 1KMMA 4BXXJ 2DEUA 2E2HJ 3ONQA 3CCST 2M1HA 3M4QA 3OR2C 2UZKA 5JHUA 4HAMA 4M9SA 4N4NB 4YRLA 2E1MB 1X3WB 2IW5A 3A8HB 1HW1A 3IH3A 4OIRF 1UUEA 5GAN3 1TH7A 1SKUB 3A32A 2D8HA 4JRQA 2XVCA 4M77E 2AKWB 1HSJA 4RLQA 2J05A 2W4SA 4AU7A 1J5YA 4B8XA 1H9TA 2RPNA 4G12A 5CQXA 4TTVA 3GFLA 4XRMA 4QQDA 1P4WA 1EH7A 3MKLA 2OQRA 3EFRA 3EUHC 4CH5A 1WI9A 2MC3A 4CCOA 2V9KA 1FOWA 2WV0A 2JPBA 1Q7YR 1I5ZA 1PSEA 4M75C 3OYCA 3RTRA 1VFCA 2W48A 1LDDA 4XLAA 2TCTA 2ZO4A 3EGUA 3IH2A 4CH4A 4IUQA 3VKIA 2ID3A 3NELA 2V7FA 3LH0A 4HNUA 4YEJA 1TWCJ 3FK7A 3TDZC 1XN7A 4C9YA 2E70A 3H5AA 3WXMB 3HY0A 2ZTGA 4XAXB 4U0YA 3HL2A 2X1EA 3OIPA 2PUKB 2DOEA 1LFUP 1QVGA 4HDUA 3FZVA 1K9MC 2ZNZA 1QHGA 2R7ZJ 3CC7T 1X6GA 3IWFA 3JB9I 1RIQA 3RYPA 1W7PD 1ZX6A 3AL0B 4A3MJ 3QYHB 3SEZA 2GQVA 2CH0A 1QKXA 3ZQGA 3P8DA 4RGXA 5FLMJ 2RJEA 3CXCS 1Z7UA 2QAZA 1P9QC 1ORKA 4KMFA 2PJPA 2FJ1A 3I9V2 4HWPA 3Q9VA 2N8GA 2V26A 3OS5A 4RCCA 1QVFS 2YX4A 1JTYA 5F64A 2DU9A 2VQHA 1FJLA 1L0OC 2L7KA 1KFZA 1ZREA 3DB3A 3ER0A 1UZCA 1YJ9Q 2XKPA 5FKNA 1DGWY 4PSWA 4J83A 5A2QK 2FRWA 2E71A 1MMGA 2K9GA 1M2VB 2IJLA 4KBMB 4XORA 2DDZA 3HZJA 1WCMJ 2JTMA 3OW2P 3HOZJ 3MKYB 3QJYA 1XSVA 4UUVA 4LNPA 1NYQA 4OMFB 1P7IA 4E7ZA 3GZ5A 2OJED 1E3HA 1UGQB 3H1CA 3RMSA 3CC7I 2KLOA 2VLAA 5KCHA 2EFPA 1B7TA 2L3PA 2W10A 4LDXA 2R4GA 3LQRA 1RADB 2PMEA 2P0QA 2KFDA 3CCVQ 3QO3A 3SFZA 4GXOA 2HMAA 2P7VB 4D7NA 1H3HA 1SD4A 5K5QA 2B9SA 4YCWA 2W7NA 3OIQA 3HOXJ 3FHNA 3CMET 4C92G 2PN6A 4YRGA 5FRMA 3GEZA 2A8EA 1OU9A 1NHAA 4BY7J 1C6VX 3K10A 1YW8A 4LD9K 4MQ9F 3HRKA 2R7DA 5ICEA 1UJ8A 4AUXA 1Z3XA 2F69A 3IKVA 2FPDA 4BI4A 5FRNA 5GAN6 3MZ8A 3C94A 2CW7A 5GJWB 2PTKA 1PD1A 4YRMA 2ED0A 3V7RA 1YITA 3MQZA 5KYUA 2AXTC 4V2FA 2JXBA 3JCMQ 5L8RE 3J80E 3AKZA 1PNJA 2M02A 3GBQA 5IXBA 4J01A 4HVCA 1LUJB 4C92E 2LCCA 3JAME 4M6VA 1OCOH 3FB9A 5L3EA 1TWAJ 2LLKA 1TWBA 2K9SA 4R79A 5LJ3f 2R7QA 2VN2A 1XG1A 3ABLH 3H3ZA 5J3BA 3KFVA 3BR0A 4ATOA 4L9JA 1QNTA 4BXFA 1XC5A 3CDLA 3NHNA 2QA4A 3R4KA 5CVVA 1YJWI 1OQKA 1MBFA 2FNAA 3I5RA 5GAN4 4AWXB 3F8NA 4MGRA 1SFEA 2F5FA 4HX7A 1Q1HA 1DGRM 3J80Z 3KLNA 1ZARA 3CMEI 4LUDA 1VQ6Q 2EYYA 1AWWA 1SD6A 4XU2A 5J1UA 1WHLA 4DZPA 1VZ0A 5LJ5d 4A3KJ 2J6KA 2RGVA 5IT9K 2QBYB 2QQSA 1SHFA 4FW2A 1XSDA 2A68F 4BE2A 4XTXA 4WJ4A 2FU4A 5GANj 2R5ZA 2DJIA 4DZJA 4A4GA 2BOLA 5J1RA 3MKWB 1LQ1A 2HNHA 3GF5A 1BN5A 2C8MA 2XU8A 4C8QE 4YRIA 1VUBA 1U9NA 3S2HJ 4YIRX 2DTIA 2HQHA 4TVWA 3JCMX 2E6NA 1W66A 3CD6A 2B63J 4PZJA 3S3NA 5EF6A 1NE8A 2X4HA 1Y0UA 2UXXA 2FZCB 2FNPA 1OKRA 5E79C 3SXYA 5D8KB 1W1FA 2DA9A 2OUMA 3SEMA 1VQMQ 1Z9ZA 2JTFA 1KJWA 4CDGA 2HTSA 4OOIA 1XS9A 3RYRA 2XAGA 1TZLA 2E34A 3DCFA 4PFOA 1RNLA 4D1QA 3WTSC 2FOWA 2EKOA 3FXJA 2ME0A 4XEMA 2LVMA 1U9OA 4ZYDA 2O8KA 2EW3A 2DL8A 1OYYA 1QRYA 3RQIA 3NENA 4CC2A 3CCEA 3WE2A 1P4XA 2EVRA 1KZHA 2AQEA 3MEUA 1C1AA 3S8PA 3E6DA 3CCRT 3IG2A 5E1XA 3DBLB 3E97A 4ZZLA 2YLCA 1SD5A 2WAFA 4DBHA 1ULYA 5IYDJ 3KZYA 2IS1A 4NL3A 3BZCA 3LSQA 2RQTA 4B9WA 2M4KA 1G3YA 2PZ1A 3MWMA 3ZEHA 1NH3A 3VU3C 3BG7A 3CCJT 3PUFA 2CG4A 3AHUA 1T6SA 1K61A 3VSLA 2HR3A 4EO4A 1WI3A 2ZCWA 4KYWA 3HXYA 2EILH 2DTHA 4DIQA 1HF0A 3BDDA 1PP8F 2MD0A 5CQEA 2L3SA 1OV3A 1UCRA 1W0TA 2DYBA 2CIMA 4DYCA 2PBIA 4M78A 1PUFB 2EINH 1RPWA 4C8QC 4IEJA 2PMUA 3QQAA 3TREA 1XMAA 1WXUA 3LSKA 5F0FA 5GMKi 5LJ5j 4AH6A 5DM6F 4Y28E 3PE0A 2XAUA 4BQNA 4ZTUB 4P3PA 1E1TA 1SPKA 1MD0A 1YIJA 2LVSA 4BJTA 1VQ7Q 4YP0A 3O2PE 1M1FA 3V8KA 4P74A 2E41A 3ICAA 3FXQA 1GCQA 5EG2A 4K11A 3DF8A 3BJAA 1UG2A 2RQUA 1R1VA 4XTYA 1K0SA 3EG3A 4HLXA 2E7WA 1RUOA 3K70C 1UJYA 1RI0A 1SAUA 2AKWA 3QSUA 4A4KA 1J9IA 4ZIBA 3UPUA 1HQCA 3BWGA 4G84A 1MGQA 2OAZA 1N9RA 3A1YA 1E7OA 2F48A 3CCJI 4UC4A 3J81Z 3HGGA 2KPMA 1MNDA 2DRKA 1OZ2A 5F27A 1JGSA 5GANg 2GBYA 3HBLA 4E2FB 1X6OA 3A5YA 4A0XA 2CRGA 1D8JA 2RJCA 4XN0A 3CC2T 2FQ4A 4UUSB 3C2HA 3BT9A 2LK2A 2IGNA 5KVRA 3G4SA 2FMYA 4LE9A 3G1LA 4M77B 2KMUA 1X2MA 3PM1A 2BYVE 5FKMA 4J7IA 3K4KA 2Z1DA 1ZYRF 1ASYA 3G1ZA 1FBQA 2IA0A 5IP9J 1MBJA 3CXCP 5KAFC 3CC4A 5IHIA 1OLTA 3K4BA 3HPHA 2VV5A 1K73U 1IL2A 2MAMA 5M5WJ 1MJBA 1GFDA 2JA7J 2V9VA 4LDYA 4J00A 2B0LA 2AKKA 1G51A 4YPFA 3S2DJ 1Z9QA 1VQ8T 2VKDA 1E2XA 1EQRA 2Y48A 3SDGA 5M3FJ 1QF6A 1WHKA 4KIGA 1KU2A 5GANe 3RQ4A 1G2BA 3M58A 2NOGA 5ECAA 2JJ7A 3UGQA 1NBEB 2XHKA 3TW7A 5D5VB 1RKWA 4J6YA 2ALYA 3QWYA 4HW0A 2J5PA 1VIEA 1E3OC 3L42A 2DL3A 2E35A 2M45A 1UAAA 3TP3A 2HKQB 3CC2I 1RAFB 1KC8R 2QEXT 1M2VA 4FYWB 4MZTA 2CH4A 2ARTA 1ZTRA 2GIZA 1B34B 3F9KA 2MH9A 3OYIA 1Y8QB 4F91B 3ZQCA 2IGOA 4KGZB 2LCSA 4UHTA 1R5GA 4A6EA 3PNYA 3PZCA 3WTWC 1BI0A 4E7IA 3FDRA 3DU5A 2QM3A 3WTXC 1BR2A 5LJ5g 3BY6A 4P71A 2JUGA 3OBWA 4AIDA 5EG0B 2ZGWA 3KUFA 5HLIA 4HT8A 3CESA 4RB2C 4M75D 2CP0A 2ZSIB 2UUZA 2OU2A 1DU6A 1IN8A 1VYTA 4DNCA 2AXLA 5FKOA 1VQNQ 2CP6A 3C12A 1O3TA 1P4AA 3PJRA 4QLCU 3FWEA 4IUTA 1QQIA 3CQZJ 1DJ7B 2CUEA 1YX5A 3ISPA 5CYVA 4P55A 2EWNA 1MBHA 2DA3A 5TGTA 4J9CA 4JJNK 2VE9A 2PFBA 1XCBA 2RK1A 2QASA 4FTHA 1KU9A 4M75G 5J6XA 5GAMe 5LJ5f 4UP8A 1OQYA 4ZYGA 2QHSA 4XKBA 4XIDA 2QEXI 4XOPA 2W85A 3GFIA 3D5SC 3AG2H 1DPRA 5JLXA 2MH2A 5DM7R 4C0GA 4UVBA 1KIKA 4OGCA 3CJRB 3CXCA 1VQLQ 5ILSA 2E6ZA 2HAXA 2G6FX 2PI0A 1AU7A 4QKUA 2XGCA 2LYCA 3J80K 1OYWA 4C5HA 3QBYA 3D0SA 1QVFA 2JVGA 1MBKA 3JAMK 2A07F 1OCPA 4RTTA 1YFTA 2HCKA 4LJZF 3RPUA 1IN4A 1YW7A 2QWWA 5FFZA 2YR2A 3G6ET 1GV2A 2D45A 3F21A 5KE2A 4B47A 1DP7P 1RETA 1B72B 1ZH5A 1GL5A 1VQOT 1ETWA 2BVLA 3ZRGA 4LVJA 3DQVC 5A0LA 1ZHFA 5IN1A 4IQJA 2DJQA 1A5JA 2QBYA 2HQXA 2WB1N 4C92B 3JRCA 5FJ8J 1E17A 2RHSB 3ABMH 2DETA 4LVKA 4JQFA 4J5YA 5ERIA 4M71A 1YS6A 2E3HA 3PO3J 2JZYA 1ACIA 2RAEA 2GQQA 5F1RA 5M5YJ 3F8MA 2FSWA 2V1XA 4N4HA 3JRZA 2GXAA 3CCYA 1ETKA 1FY7A 2DLLA 3WODF 2CSIA 4JX4A 5C6SA 3H36A 7AT1B 4KGVB 1KHCA 5LFAA 3M5AA 3ZL7C 1B7YB 4P72C 4I02A 4OAYA 2LNVA 1X6BA 4PFZA 2B86A 4DOVA 2EA2A 1LNXA 2FBKA 5M9OA 1H92A 2M8EA 1YFNA 2IA1A 5EEHA 3A2KA 4U7BA 1X4OA 1AHJB 3B6AA 1G83A 5LEKA 1JKQC 3Q0WA 2E1HA 2NUTB 1DP3A 4HSRA 1MNEA 5IYCJ 2E65A 2Y9YA 3WG7H 1FT9A 1WJ5A 2MGQA 2WAQN 2RC4A 1YNZA 1VQOI 2FZKB 3EHRA 3VUZA 5D6XA 1IV8A 3S32A 3H6ZA 1O3QA 4G9YA 2A6HF 4UVCA 2ZPFB 4HXJA 4CCLA 1NLPC 1IUFA 2QSGX 4HX4A 3KP4A 3HXXA 1EH6A 2RKHA 2XF5A 3CBMA 1M3CA 4FYVB 5D8LB 2VJIA 4EMKB 2NLUA 2BVMA 1TQMA 4IZZA 2O0YA 3E5XA 1EIYB 3HHTB 4LIVA 3HYIA 2FXAA 1HK9A 2K4YA 2R5MA 2ZAEA 3ASNH 2DN0A 3V8JA 1X54A 1Y0MA 2VYTA 4Q48A 4YRVA 2QYZA 3LSIA 1R58A 3FM3A 2KZGA 1LEBA 2X1DA 3CCEI 4FE4A 5TRDA 1PUFA 2XPWA 4L87A 5LGTA 1OCCH 2QHUA 3LSTA 1BB9A 3GTOJ 3MKDA 2HVQA 1YCYA 1Q86R 2HYGD 2COWA 3IC7A 2A7YA 2QLZA 3WU1B 5FFXA 2C06A 3I3LA 2OBPA 4G6DA 4M9ZA 1EVKA 3GWZA 1NJIU 4M78F 3ZMSA 4WCIA 5CLSA 1VQPQ 5B1BH 4HVUA 3HKZN 2E1OA 3K1MA 5J40A 2L0KA 4EJWA 3U23A 2LNHB 2FBHA 1UFFA 2JUFA 2L01A 4IRGA 2FG0A 1IUYA 5KK1A 4KH0B 1MUZA 2ECCA 3AT1B 5GTHC 1GFCA 4TWAA 2AHJB 1V29B 3GTKJ 2ZXHA 4GRIA 3C3WA 4EVIA 2K9MA 4IHXA 2E7XA 4XTZA 2ZT6A 3CCUT 4BS9A 3BPXA 3P7NA 2X4WA 4OVAA 3G71A 4H2WA 4Q15A 1UGRB 4A3FJ 4MHGA 4F16A 4B44A 2O8XA 3HFOA 2CW8A 1RLQC 4L0YB 3DPLC 4UUSA 3MEYA 1XB4A 5DM7F 3WGGA 3NEMA 2PVDB 4M77A 2Q5IA 5FD5A 1OYIA 2GCXA 3SZGA 2GXBA 1FYNA 1B59A 4PL6A 1WIEA 3I58A 4XEOA 3DEUA 3G7ZA 1NZ9A 3ZMTA 3I4PA 4A0ZA 3GIBA 2CT3A 3U9GA 2Y9ZA 2JT1A 3M59A 2QDLA 2ZZDA 4NC8A 2J6FA 3E9GA 3OMCA 3VQVA 3BOQA 1TQPA 2MLKA 1KSWA 2K6DA 3FXRA 3HSFA 2MCNA 2EBIA 2DYSH 2LDMA 4XU3A 3VQWA 2DK3A 2HQRA 1IRGA 4HKEA 4C8QD 2FEZA 3OOPA 3BZKA 3MCZA 3Q5FA 3TOAA 4B6MA 3R07A 5IPAA 3S3MA 3S2WA 4HZFA 1EF4A 4HBLA 2OTLT 3CCUI 3RERA 3M9AA 4DQ2A 2XGXA 2DZ9A 2Z5UA 2CUZA 2RA2A 3EGXB 1NJ1A 3VQXA 2OAWA 1YITQ 4GDFA 2ZJRF 4PLIA 1R00A 2R7WA 1E3PA 3K70D 3I55A 4J9GA 2O6GE 1VQKA 4BY6C 1V55H 3K2AA 1B34A 2Z9OA 3DBHB 3S17J 5GAMd 2FA5A 3U21A 2RK2A 1KG1A 1FYFA 1LKXA 2HOSA 3D7SB 2CREA 4NDLA 3QO8A 3BTLA 3JTHA 3TEHB 2L89A 2F4MB 3PMIA 4YFXF 2OQGA 5EG0A 3QO5A 2K7AA 2QA4Q 1ZA1B 3T1BA 3OYHA 3FRNA 3B6CA 2RHQB 4G8XA 2ME6A 4LN2A 1AWXA 2EGAA 5GMKe 2LP5A 3ECHA 2VXZA 3DKWA 4O6JA 3GBGA 4WX9A 4JJCA 3RESA 3OS2A 2DMUA 2VE8A 2E3IA 2KJBA 3QXEB 1WKMA 3BTIA 2CUDA 1Y39A 2H27A 4A4FA 3OSGA 2OTLI 4CICA 4B1RA 4XTVA 2QTVA 1X2GA 3MEVA 3V4GA 1K9MR 1U8RA 2L9VA 1W1WE 3K4JA 4M7DD 1MSFC 1KQSS 3CPWS 3OV8A 1HC7A 3O8HA 3VPRA 1K4US 1NJIC 1OJLA 3VS6A 4L0ZB 1PKSA 2ZPEB 1FLIA 1R0CB 2VI6A 2J3MA 1YFRA 4WJ3M 3CDHA 2ZT5A 1U1TA 3TSZA 4RTYA 1TNTA 4HOBA 4NC6A 3HXUA 1FMWA 4MZMA 1SETA 3ASKA 3L2RA 1Z6RA 5F0CA 4UNOA 1DPUA 2EIFA 4OMLA 1I6XA 3WTYC 2J3LA 3ZQ7A 4BB7A 4BHPA 3DKXA 2KROA 4A2UA 1J0RA 2TDXA 4M7DG 4MTDA 2DQ3A 4OMYA 3U2RA 3VS4A 3A02A 1IV6A 4L9TA 2CP2A 3CMAT 2JA2A 3C2GA 1EH8A 5CAIA 3CCSQ 3THKA 1B72A 3KYCB 4RGRA 2AS5F 3I35A 4IVNA 3A5ZB 2RMOA 4OP0A 4MDXA 4BD3A 4BE0A 1W2BS 3INZA 2OTJA 2WSEE 2MABA 1ENHA 3TP0A 4FW1A 4IUUA 2KRNA 2CUFA 5DYMA 1M90U 4C92A 3LLRA 2X6YA 1JQQA 3TKYA 4BDZA 5KCOA 2RHSA 2LP0A 4U7DA 5IP6A 4C3JJ 2F2XA 1IHVA 2KL4A 4PCQA 2DAOA 1WXTA 2X4JA 2BW3B 1X2KA 1AHDP 4B43A 3E6CC 2D9TA 2KSSA 1HD3A 4PJMA 1UHFA 1JKPC 2GM4A 2BZYA 5IY5H 4A54A 4FCYA 2JSCA 2IXSA 1FC3A 3OB9A 4JX6A 2K3XA 1BBUA 5HCKA 1E0EA 2FVUA 2H1KA 3I5SA 2LJ1A 1F1BB 1WHJA 5KYYB 4KT6A 3A1PA 1I81A 1B7YA 3KEOA 4EGYA 2F6CA 4IJAA 2DRMA 2Q2EB 1XGMA 4JZ4A 1VF9A 4XONA 2JOYA 4ME7A 2A5YB 2QHTA 2XF7A 3BTCA 3JCMg 1IN7A 1TQIA 2ZXIA 1AKHB 4B9XA 1XDUA 2NUTA 1SFUA 1AZGB 4FASD 2K27A 1N5ZA 3LSRA 4RAFA 2ZPHB 1ETYA 3QTCA 3CDIA 1XGSA 2KIQA 4JYKA 4RAGA 3CC7Q 4QQ6A 4RMOA 3IL2A 3H0IA 2LKXA 5DTDA 4BXUA 1TUCA 4BW9A 4FHTA 2OX7A 4FYXB 3CO7C 3TO7A 5HOOA 1TC3C 4EATA 2OJ2A 2VWFA 1YJNT 4WK8F 3X25B 4CZCA 4EMKA 4JLIA 4U0WA 4N0BA 3W6JB 5BNGA 3HOYJ 2RD1A 1M9SA 2QQRA 4WTOB 3ME9A 3I7FA 5KCMA 4AC0A 2DW4A 4YRCA 1MSEC 2M0OA 1S72T 2C7IA 1FMKA 5HK0A 2V1NA 3GMEA 2HQ5A 1U1SA 1OFCX 3K4CA 5GAHJ 1YJ9A 2QSFX 1PSFA 3VV0A 3CCLT 4ZTJA 4IUVA 5FLXE 1KC8U 4ZYEA 1B9NA 4GYIA 4JK1X 2LTPA 1ZA2B 2HGCA 1HC8A 3CC4Q 1KONA 5HLGA 4KN7X 1I8FA 3HPGA 3JRHA 4IQ4A 2BZXA 2F5TX 3BW1A 2Y31A 1WNLA 3FF5A 1LYLA 1IXCA 2R92J 3M1CA 5JR3A 4Y91A 1LDJA 3NFCA 5FLXZ 5M5XJ 4ZDPA 2ZPBB 1XX5A 3WE3A 2C0TA 2DT7B 2DODA 2OC6A 3GTJJ 1D3BB 1YJNI 2M2EA 4EV0A 2W25A 5BOXA 3CMEQ 4L5IA 4LMYA 4L5GA 2Y0SA 3KIOA 3R61A 1KQ2A 2MOXA 4Z88A 4D8DA 3I56A 1I5OB 3ZN1A 1EX4A 3ZP5A 1M8MA 1O57A 3Q0UA 3WVDB 4RM3A 3CCMT 3MPUB 3QOPA 2K4BA 1LE8A 1PCXA 1R23A 2RI5A 4F7UG 1IDZA 2M0CA 4UB8C 5I2SA 2RNGA 2E1NA 3ZXSA 2VBYA 5CJ9A 3KETA 4RTZA 1JHHA 2MPXC 4FSXA 2DXTA 4MTEA 1G4DA 4HCBA 3EPZA 1QQJA 2CP7A 2XAQA 2FO0A 3HTRA 1VQ5T 2CV0A 2P6TA 1VQZA 3K4MA 1BBWA 4BHCA 3KE2A 4M77F 3ABUA 3MP1A 2DO3A 5GAMf 3G71I 2JRMA 3NTIA 3BDLA 4HV5A 3OYEA 1NYFA 3BROA 3L1PA 1Q95G 2COYA 1JUMA 4F55A 3KP2A 2HOEA 2PMZA 2V79A 3U1DA 3MKZA 3GNGA 2DM1A 1OCRH 2HBPA 1KYWA 1H4VB 1K1ZA 2CQQA 1ARKA 3FK6A 2G9WA 2FF4A 4CRIA 1YLFA 4PDKA 2H8HA 2Z33A 2FRHA 1XPXA 2Y90A 3X20B 3M0TA 1YI2T 5J26A 4KULA 5L3DA 3EGXA 2YSRA 4IURA 2O3FA 3EHQA 4LVMA 1KQ8A 3NEUA 3OYMA 1PVEA 4M72A 1D09B 2HQNA 1WA7A 2ECBA 2KY9A 2JWTA 4F52A 5HVQC 1Z05A 4IHYA 4D0PA 2R7RA 2JA8J 2XDBA 4H4KC 2LX7A 4E6KG 1WJFA 2CH4W 2QUFA 1VQ4A 2B8AA 1EKEA 1VQ5I 2E5ZA 3TMOA 2D1XA 2UV1A 5H2FC 5DUIA 4Y7NJ 4CI0C 2DA5A 2Y2ZA 3TEHA 4YYEA 5AYFA 4FM4B 2P6SA 2VJ5A 2CS3A 1B8AA 4OIOF 2LR8A 3FISA 2ZC2A 2RHQA 1ZKGA 3FC3A 1O7LA 4DA4A 1HJDA 4S04A 2EYQA 3QYFA 4CCMA 2W24A 1CKAA 1QCOA 2XV4S 1IO6A 1YB3A 2EJRA 1UGPB 1AVZC 2KXDA 3RKYA 2LQNA 5FU6B 1ZUKA 2QQ8A 1VQKI 1OZ3A 4NS5A 2X4YA 2QKMB 3FKJA 3LAJA 5TJJA 4HEA2 2QDYB 3CPWP 3CCRQ 2COZA 3IALA 2NS0A 1D1BA 1KC8C 3MF1A 2O4XB 5GJVB 1WPKA 3FXUA 3VJPA 1M2OA 1GXQA 4KITB 1BIAA 2WC2A 2LDUA 1BK2A 1USYA 1JI8A 5D6EA 3FMRA 3CCJQ 4EJTA 3M4GA 4M74A 2PQ8A 1F4KA 2A61A 4IHWA 2YX7A 1XQHA 2WY8Q 2K5LA 4RG8A 1RKTA 4G94A 4OIPF 2LF8A 2HU9A 5DEQA 4M78C 3A0BC 5F1JA 4JRKA 4PSXA 4XOTA 2IS2A 2JZ2A 1UTIA 1R4MB 4E7LA 1LNWA 4U88A 3KZIC 3KZZA 2ZJPF 1UELB 5CKBA 4XKWA 1H88C 3OY9A 2L54A 1V4RA 3I53A 3I64A 2ESHA 1W2BP 3IKLA 1O7FA 1AOYA 4P74C 1Q86U 4ZH4F 2BGCA 2DO7A 1GCQC 1M30A 1PHTA 3M0QA 4HVWA 1WHUA 5IYBJ 3QKJA 4XM3A 1P7JA 2EFOA 4MIMA 2YUQA 2Y69H 3M4OJ 1YE9A 4XTUA 5K5OA 4ENMA 3RKWA 3IKTA 1X01A 3VBBA 3BR2A 2ZZGA 4J9EA 3HXZA 4EJOA 4UV9A 3BJ6A 4A3LJ 1YHQA 1YFSA 3ZQLA 2ECZA 1R49A 3L9FA 1N78A 3PNVA 1KU3A 3F8BA 6PAXA 4M7AE 5L3BA 1NG7A 4C92F 4PJOE 1T8IA 4P75A 4H2YA 4TQFA 3HPWA 4B3XA 1RACB 4HQMA 1U5SA 1O3RA 3I54A 4LD5A 3X2QH 3QPLA 2K9QA 3CEYA 2BIVA 1LPQA 5KYYA 2CZ0B 1X2QA 3FIWA 1WJQA 2QF7A 1UB4A 2GNCA 1X27A 5A0GA 2Q2EA 2V1QA 1F5TA 2OTJI 3ERMA 1YFHA 2IG0A 3CC2Q 1SD7A 4CH7A 4DW6A 2F1LA 2JNGA 2PNIA 3IRQA 3MQ0A 4HT4A 2KYBA 4ZDLA 2YSQA 2EYXA 2DQLA 3J7AY 3HOSA 2QCOA 3A31A 1AKHA 3UWNA 3HSEA 1Q1VA 4ZDOA 4DBFA 1BYMA 2L9SA 3AL0C 1KQSA