4LVIA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt). mn-bound crystal structure at ph 4.6
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
190
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
molecule keywords Plasmid recombination enzyme
total genus 60
structure length 190
sequence length 194
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lviA01
2NS6A 4LVMA 4LVKA 4LVJA 4HT4A 4LVLA 4LVIA
chains in the Genus database with same CATH superfamily
1B8AA 4H2VA 1USYA 4P74A 4RMFA 2ZINA 2E3CA 1EVLA 4UP8A 2ZNIA 1YGBA 4P75A 2RHQB 4P73C 4K86A 5C53B 2ODRC 3RACA 4HWSA 2ZZFA 2CIMA 3HRIA 4XU2A 1RIQA 2DDZA 4YRNA 4RDXA 2ZT8A 3LC0A 2DZCA 1G5IA 4BWAA 5C52B 3HTZA 3MF2A 1EIYA 3IG2A 3I7FA 2EL9A 1H4TA 1HC7A 1WQWA 3PCOA 4YRKA 2DTHA 3UFGA 4YROA 1Z7NA 2Q7GA 2Q5HA 3E9HA 2Q7EA 3RKYA 4ZTUB 3HXXA 4YCWA 4XTVA 4CH4A 4CS2A 4YCUA 4KQEA 2DXTA 3A7RA 2ZNJA 4H02A 1EIYB 4P72A 4P72C 2E10A 4EO4A 1YFSA 4TWAA 3KFUA 2RHQA 11ASA 1B76A 2ZZEA 4YRIA 2PMFA 3IKMB 4OP0A 1EVKA 1EOVA 4YREA 2ARTA 3V7RA 2Q7HA 2ZT6A 2IY5A 4L87A 3NENA 5ELNA 4XTYA 4ZTZB 3HXZA 4TVWA 4XTUA 3NEMA 1N9WA 3VQWA 4E51A 4HA8A 3W3SA 4XU3A 3MEYA 3A74A 4H2UA 5HGQA 4YRGA 2QHUA 3A5YA 4HWPA 4ZIBA 2P0LA 2EJGA 4P3PA 1YFRA 2DXUA 2I4OA 4YRQA 1B7YB 2DTIA 4P75C 1G51A 4XTXA 3QO8A 3PZCA 3A5ZA 3HY0A 3VQYA 1NYRA 1QE0A 2PMEA 4YPFA 3QO7A 1E24A 1VQZA 2ZR2A 2ZXFA 3A7UA 1H4QA 2DU7A 3L4GB 2QHSA 5ELOA 1X2GA 3RL6A 2ZR3A 2Q5IA 4BW9A 3TEHB 3E9IA 4YP0A 3L1AA 1E22A 5K1XA 4NCXA 4XEMA 1ATIA 3NELA 1X01A 1G5HA 3R07A 4P71A 4LVKA 4DPGA 1B7YA 1BIBA 1WQ7A 2DVEA 4YRPA 2QHTA 4UP9A 4K88A 3HFZA 3V7CA 3TUPA 3EFRA 1NJ8A 4WF2A 4Q15A 1HTTA 4XU0A 4KR3A 1WPYA 2EAYA 3A31A 2FYKA 2I4LA 2CJ9A 3VBBA 1NJ5A 4AH6A 4YRCA 4CS4A 3TEHA 4TTVA 2E65A 3IKLA 3UGQA 1H4VB 1E1TA 3A7AA 3V8JA 4TVAA 3UGTA 3L4GA 4Q6GA 2P5IA 3REUA 2DQ3A 2CJAA 3HFVA 1FYFA 4YRSA 4LVLA 2DKGA 12ASA 1SETA 3M4PA 4H2SA 3HXYA 2ZT7A 1ADJA 3M4QA 2I4NA 3HFZB 4TQDA 1LYLA 3DSQA 1J5WA 3LSSA 1KMMA 1YFTA 3RKXA 2AKWA 3P8TA 1EFWA 3HY1A 1C0AA 1NNHA 3ICAA 3HXWA 2ZZGA 3EFSA 3IALA 2ZGWA 2DQ0A 1ADYA 4G84A 3RUXA 4YRJA 3RGLA 4HVCA 4KR2A 1NJ6A 4J15A 1SRYA 1WU7A 3G1ZA 4G85A 2AKWB 4YRLA 4X5OA 1EQRA 1E1OA 4WJ4A 4CS3A 3HXVA 4DQ2A 2NS6A 4YRFA 1JJCA 1SESA 3QO5A 3ERRA 4EX5A 3P8VA 2A8EA 4TVYA 4P73A 4PG3A 3CMQA 2RHSA 4OLFA 1SERA 4UPAA 1WLEA 3VQXA 2G4CA 4YRMA 1H4SA 4YRTA 4HWOA 3HXUA 1IL2A 3A32A 3BFMA 1BIAA 2EWNA 2DTOA 1BBWA 1QF6A 1JJCB 3P8YA 1KMNA 2ALYB 4P71C 4H2YA 4UP7A 2ZTGA 2ARSA 2I4MA 4P3OA 4XEOA 2AMCB 1PYSB 4TVAB 2ODRD 3WQZA 2HNIA 3RIRA 1ASZA 2CJBA 1BBUA 4CH6A 1W66A 4XTZA 2E1HA 4RQFA 5C51B 4H2TA 3V8KA 4H2WA 2C7IA 4PHCA 2ZIMA 2DU5A 3NETA 4HWTA 2ZT5A 3UH0A 1WNLA 1NJ1A 1PYSA 4WJ3M 1YB3A 2E41A 3QNEA 2ARUA 2QHVA 2XGTA 4P74C 1USYC 3PCOB 2AMCA 4LNSA 3OD1A 3BJUA 1X54A 4XTWA 2J3MA 2DJZA 3LSQA 1X55A 1B70B 4YYEA 1NYQA 3RF1A 4YDQA 2XTIA 4LVIA 2E5AA 3HRKA 4LVMA 4LVJA 2J3LA 4O2DA 1NJ2A 1KOGA 3V7SA 3L2ZA 3MQZA 3FJPA 3MF1A 1B70A 1Z7MA 4YCVA 1X56A 5K1PA 4P3NA 5KNNA 4HWRA 1L0WA 2ZIOA 2C8MA 3QTCA 3TEGA 4CH5A 2IY5B 2RHSB 5E3IA 2ZCEA 4H2XA 3RKWA 3VQVA 4CH3A 4WI1A 4YRRA 3V8LA 4HT4A 4TQFA 1HXDA 5F5WA 1GGMA 2ALYA 2E64A 4K87A 2DEQA 4XU1A 1X2HA 1WYDA 4H2XB 1ASYA 4RQEA 2CGHA 3REXA 2EJ9A 2DZ9A 2EJFA
chains in the Genus database with same CATH topology
1B8AA 4H2VA 1USYA 4P74A 4RMFA 2ZINA 2E3CA 1EVLA 4UP8A 2ZNIA 1YGBA 4P75A 2RHQB 4P73C 4K86A 5C53B 2ODRC 3RACA 4HWSA 2ZZFA 2CIMA 3HRIA 4XU2A 1RIQA 2DDZA 4YRNA 4RDXA 2ZT8A 3LC0A 2DZCA 1G5IA 4BWAA 5C52B 3HTZA 3MF2A 1EIYA 3IG2A 3I7FA 2EL9A 1H4TA 1HC7A 1WQWA 3PCOA 4YRKA 2DTHA 3UFGA 4YROA 1Z7NA 2Q7GA 2Q5HA 3E9HA 2Q7EA 3RKYA 4ZTUB 3HXXA 4YCWA 4XTVA 4CH4A 4CS2A 4YCUA 4KQEA 2DXTA 3A7RA 2ZNJA 4H02A 1EIYB 4P72A 4P72C 2E10A 4EO4A 1YFSA 4TWAA 3KFUA 2RHQA 11ASA 1B76A 2ZZEA 4YRIA 2PMFA 3IKMB 4OP0A 1EVKA 1EOVA 4YREA 2ARTA 3V7RA 2Q7HA 2ZT6A 2IY5A 4L87A 3NENA 5ELNA 4XTYA 4ZTZB 3HXZA 4TVWA 4XTUA 3NEMA 1N9WA 3VQWA 4E51A 4HA8A 3W3SA 4XU3A 3MEYA 3A74A 4H2UA 5HGQA 4YRGA 2QHUA 3A5YA 4HWPA 4ZIBA 2P0LA 2EJGA 4P3PA 1YFRA 2DXUA 2I4OA 4YRQA 1B7YB 2DTIA 4P75C 1G51A 4XTXA 3QO8A 3PZCA 3A5ZA 3HY0A 3VQYA 1NYRA 1QE0A 2PMEA 4YPFA 3QO7A 1E24A 1VQZA 2ZR2A 2ZXFA 3A7UA 1H4QA 2DU7A 3L4GB 2QHSA 5ELOA 1X2GA 3RL6A 2ZR3A 2Q5IA 4BW9A 3TEHB 3E9IA 4YP0A 3L1AA 1E22A 5K1XA 4NCXA 4XEMA 1ATIA 3NELA 1X01A 1G5HA 3R07A 4P71A 4LVKA 4DPGA 1B7YA 1BIBA 1WQ7A 2DVEA 4YRPA 2QHTA 4UP9A 4K88A 3HFZA 3V7CA 3TUPA 3EFRA 1NJ8A 4WF2A 4Q15A 1HTTA 4XU0A 4KR3A 1WPYA 2EAYA 3A31A 2FYKA 2I4LA 2CJ9A 3VBBA 1NJ5A 4AH6A 4YRCA 4CS4A 3TEHA 4TTVA 2E65A 3IKLA 3UGQA 1H4VB 1E1TA 3A7AA 3V8JA 4TVAA 3UGTA 3L4GA 4Q6GA 2P5IA 3REUA 2DQ3A 2CJAA 3HFVA 1FYFA 4YRSA 4LVLA 2DKGA 12ASA 1SETA 3M4PA 4H2SA 3HXYA 2ZT7A 1ADJA 3M4QA 2I4NA 3HFZB 4TQDA 1LYLA 3DSQA 1J5WA 3LSSA 1KMMA 1YFTA 3RKXA 2AKWA 3P8TA 1EFWA 3HY1A 1C0AA 1NNHA 3ICAA 3HXWA 2ZZGA 3EFSA 3IALA 2ZGWA 2DQ0A 1ADYA 4G84A 3RUXA 4YRJA 3RGLA 4HVCA 4KR2A 1NJ6A 4J15A 1SRYA 1WU7A 3G1ZA 4G85A 2AKWB 4YRLA 4X5OA 1EQRA 1E1OA 4WJ4A 4CS3A 3HXVA 4DQ2A 2NS6A 4YRFA 1JJCA 1SESA 3QO5A 3ERRA 4EX5A 3P8VA 2A8EA 4TVYA 4P73A 4PG3A 3CMQA 2RHSA 4OLFA 1SERA 4UPAA 1WLEA 3VQXA 2G4CA 4YRMA 1H4SA 4YRTA 4HWOA 3HXUA 1IL2A 3A32A 3BFMA 1BIAA 2EWNA 2DTOA 1BBWA 1QF6A 1JJCB 3P8YA 1KMNA 2ALYB 4P71C 4H2YA 4UP7A 2ZTGA 2ARSA 2I4MA 4P3OA 4XEOA 2AMCB 1PYSB 4TVAB 2ODRD 3WQZA 2HNIA 3RIRA 1ASZA 2CJBA 1BBUA 4CH6A 1W66A 4XTZA 2E1HA 4RQFA 5C51B 4H2TA 3V8KA 4H2WA 2C7IA 4PHCA 2ZIMA 2DU5A 3NETA 4HWTA 2ZT5A 3UH0A 1WNLA 1NJ1A 1PYSA 4WJ3M 1YB3A 2E41A 3QNEA 2ARUA 2QHVA 2XGTA 4P74C 1USYC 3PCOB 2AMCA 4LNSA 3OD1A 3BJUA 1X54A 4XTWA 2J3MA 2DJZA 3LSQA 1X55A 1B70B 4YYEA 1NYQA 3RF1A 4YDQA 2XTIA 4LVIA 2E5AA 3HRKA 4LVMA 4LVJA 2J3LA 4O2DA 1NJ2A 1KOGA 3V7SA 3L2ZA 3MQZA 3FJPA 3MF1A 1B70A 1Z7MA 4YCVA 1X56A 5K1PA 4P3NA 5KNNA 4HWRA 1L0WA 2ZIOA 2C8MA 3QTCA 3TEGA 4CH5A 2IY5B 2RHSB 5E3IA 2ZCEA 4H2XA 3RKWA 3VQVA 4CH3A 4WI1A 4YRRA 3V8LA 4HT4A 4TQFA 1HXDA 5F5WA 1GGMA 2ALYA 2E64A 4K87A 2DEQA 4XU1A 1X2HA 1WYDA 4H2XB 1ASYA 4RQEA 2CGHA 3REXA 2EJ9A 2DZ9A 2EJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS6 A;  4LVM A;  4LVK A;  4LVJ A;  4HT4 A;  4LVL A;  4LVI A; 
#chains in the Genus database with same CATH topology
 1B8A A;  4H2V A;  1USY A;  4P74 A;  4RMF A;  2ZIN A;  2E3C A;  1EVL A;  4UP8 A;  2ZNI A;  1YGB A;  4P75 A;  2RHQ B;  4P73 C;  4K86 A;  5C53 B;  2ODR C;  3RAC A;  4HWS A;  2ZZF A;  2CIM A;  3HRI A;  4XU2 A;  1RIQ A;  2DDZ A;  4YRN A;  4RDX A;  2ZT8 A;  3LC0 A;  2DZC A;  1G5I A;  4BWA A;  5C52 B;  3HTZ A;  3MF2 A;  1EIY A;  3IG2 A;  3I7F A;  2EL9 A;  1H4T A;  1HC7 A;  1WQW A;  3PCO A;  4YRK A;  2DTH A;  3UFG A;  4YRO A;  1Z7N A;  2Q7G A;  2Q5H A;  3E9H A;  2Q7E A;  3RKY A;  4ZTU B;  3HXX A;  4YCW A;  4XTV A;  4CH4 A;  4CS2 A;  4YCU A;  4KQE A;  2DXT A;  3A7R A;  2ZNJ A;  4H02 A;  1EIY B;  4P72 A;  4P72 C;  2E10 A;  4EO4 A;  1YFS A;  4TWA A;  3KFU A;  2RHQ A;  11AS A;  1B76 A;  2ZZE A;  4YRI A;  2PMF A;  3IKM B;  4OP0 A;  1EVK A;  1EOV A;  4YRE A;  2ART A;  3V7R A;  2Q7H A;  2ZT6 A;  2IY5 A;  4L87 A;  3NEN A;  5ELN A;  4XTY A;  4ZTZ B;  3HXZ A;  4TVW A;  4XTU A;  3NEM A;  1N9W A;  3VQW A;  4E51 A;  4HA8 A;  3W3S A;  4XU3 A;  3MEY A;  3A74 A;  4H2U A;  5HGQ A;  4YRG A;  2QHU A;  3A5Y A;  4HWP A;  4ZIB A;  2P0L A;  2EJG A;  4P3P A;  1YFR A;  2DXU A;  2I4O A;  4YRQ A;  1B7Y B;  2DTI A;  4P75 C;  1G51 A;  4XTX A;  3QO8 A;  3PZC A;  3A5Z A;  3HY0 A;  3VQY A;  1NYR A;  1QE0 A;  2PME A;  4YPF A;  3QO7 A;  1E24 A;  1VQZ A;  2ZR2 A;  2ZXF A;  3A7U A;  1H4Q A;  2DU7 A;  3L4G B;  2QHS A;  5ELO A;  1X2G A;  3RL6 A;  2ZR3 A;  2Q5I A;  4BW9 A;  3TEH B;  3E9I A;  4YP0 A;  3L1A A;  1E22 A;  5K1X A;  4NCX A;  4XEM A;  1ATI A;  3NEL A;  1X01 A;  1G5H A;  3R07 A;  4P71 A;  4LVK A;  4DPG A;  1B7Y A;  1BIB A;  1WQ7 A;  2DVE A;  4YRP A;  2QHT A;  4UP9 A;  4K88 A;  3HFZ A;  3V7C A;  3TUP A;  3EFR A;  1NJ8 A;  4WF2 A;  4Q15 A;  1HTT A;  4XU0 A;  4KR3 A;  1WPY A;  2EAY A;  3A31 A;  2FYK A;  2I4L A;  2CJ9 A;  3VBB A;  1NJ5 A;  4AH6 A;  4YRC A;  4CS4 A;  3TEH A;  4TTV A;  2E65 A;  3IKL A;  3UGQ A;  1H4V B;  1E1T A;  3A7A A;  3V8J A;  4TVA A;  3UGT A;  3L4G A;  4Q6G A;  2P5I A;  3REU A;  2DQ3 A;  2CJA A;  3HFV A;  1FYF A;  4YRS A;  4LVL A;  2DKG A;  12AS A;  1SET A;  3M4P A;  4H2S A;  3HXY A;  2ZT7 A;  1ADJ A;  3M4Q A;  2I4N A;  3HFZ B;  4TQD A;  1LYL A;  3DSQ A;  1J5W A;  3LSS A;  1KMM A;  1YFT A;  3RKX A;  2AKW A;  3P8T A;  1EFW A;  3HY1 A;  1C0A A;  1NNH A;  3ICA A;  3HXW A;  2ZZG A;  3EFS A;  3IAL A;  2ZGW A;  2DQ0 A;  1ADY A;  4G84 A;  3RUX A;  4YRJ A;  3RGL A;  4HVC A;  4KR2 A;  1NJ6 A;  4J15 A;  1SRY A;  1WU7 A;  3G1Z A;  4G85 A;  2AKW B;  4YRL A;  4X5O A;  1EQR A;  1E1O A;  4WJ4 A;  4CS3 A;  3HXV A;  4DQ2 A;  2NS6 A;  4YRF A;  1JJC A;  1SES A;  3QO5 A;  3ERR A;  4EX5 A;  3P8V A;  2A8E A;  4TVY A;  4P73 A;  4PG3 A;  3CMQ A;  2RHS A;  4OLF A;  1SER A;  4UPA A;  1WLE A;  3VQX A;  2G4C A;  4YRM A;  1H4S A;  4YRT A;  4HWO A;  3HXU A;  1IL2 A;  3A32 A;  3BFM A;  1BIA A;  2EWN A;  2DTO A;  1BBW A;  1QF6 A;  1JJC B;  3P8Y A;  1KMN A;  2ALY B;  4P71 C;  4H2Y A;  4UP7 A;  2ZTG A;  2ARS A;  2I4M A;  4P3O A;  4XEO A;  2AMC B;  1PYS B;  4TVA B;  2ODR D;  3WQZ A;  2HNI A;  3RIR A;  1ASZ A;  2CJB A;  1BBU A;  4CH6 A;  1W66 A;  4XTZ A;  2E1H A;  4RQF A;  5C51 B;  4H2T A;  3V8K A;  4H2W A;  2C7I A;  4PHC A;  2ZIM A;  2DU5 A;  3NET A;  4HWT A;  2ZT5 A;  3UH0 A;  1WNL A;  1NJ1 A;  1PYS A;  4WJ3 M;  1YB3 A;  2E41 A;  3QNE A;  2ARU A;  2QHV A;  2XGT A;  4P74 C;  1USY C;  3PCO B;  2AMC A;  4LNS A;  3OD1 A;  3BJU A;  1X54 A;  4XTW A;  2J3M A;  2DJZ A;  3LSQ A;  1X55 A;  1B70 B;  4YYE A;  1NYQ A;  3RF1 A;  4YDQ A;  2XTI A;  4LVI A;  2E5A A;  3HRK A;  4LVM A;  4LVJ A;  2J3L A;  4O2D A;  1NJ2 A;  1KOG A;  3V7S A;  3L2Z A;  3MQZ A;  3FJP A;  3MF1 A;  1B70 A;  1Z7M A;  4YCV A;  1X56 A;  5K1P A;  4P3N A;  5KNN A;  4HWR A;  1L0W A;  2ZIO A;  2C8M A;  3QTC A;  3TEG A;  4CH5 A;  2IY5 B;  2RHS B;  5E3I A;  2ZCE A;  4H2X A;  3RKW A;  3VQV A;  4CH3 A;  4WI1 A;  4YRR A;  3V8L A;  4HT4 A;  4TQF A;  1HXD A;  5F5W A;  1GGM A;  2ALY A;  2E64 A;  4K87 A;  2DEQ A;  4XU1 A;  1X2H A;  1WYD A;  4H2X B;  1ASY A;  4RQE A;  2CGH A;  3REX A;  2EJ9 A;  2DZ9 A;  2EJF A; 
#chains in the Genus database with same CATH homology
 1B8A A;  4H2V A;  1USY A;  4P74 A;  4RMF A;  2ZIN A;  2E3C A;  1EVL A;  4UP8 A;  2ZNI A;  1YGB A;  4P75 A;  2RHQ B;  4P73 C;  4K86 A;  5C53 B;  2ODR C;  3RAC A;  4HWS A;  2ZZF A;  2CIM A;  3HRI A;  4XU2 A;  1RIQ A;  2DDZ A;  4YRN A;  4RDX A;  2ZT8 A;  3LC0 A;  2DZC A;  1G5I A;  4BWA A;  5C52 B;  3HTZ A;  3MF2 A;  1EIY A;  3IG2 A;  3I7F A;  2EL9 A;  1H4T A;  1HC7 A;  1WQW A;  3PCO A;  4YRK A;  2DTH A;  3UFG A;  4YRO A;  1Z7N A;  2Q7G A;  2Q5H A;  3E9H A;  2Q7E A;  3RKY A;  4ZTU B;  3HXX A;  4YCW A;  4XTV A;  4CH4 A;  4CS2 A;  4YCU A;  4KQE A;  2DXT A;  3A7R A;  2ZNJ A;  4H02 A;  1EIY B;  4P72 A;  4P72 C;  2E10 A;  4EO4 A;  1YFS A;  4TWA A;  3KFU A;  2RHQ A;  11AS A;  1B76 A;  2ZZE A;  4YRI A;  2PMF A;  3IKM B;  4OP0 A;  1EVK A;  1EOV A;  4YRE A;  2ART A;  3V7R A;  2Q7H A;  2ZT6 A;  2IY5 A;  4L87 A;  3NEN A;  5ELN A;  4XTY A;  4ZTZ B;  3HXZ A;  4TVW A;  4XTU A;  3NEM A;  1N9W A;  3VQW A;  4E51 A;  4HA8 A;  3W3S A;  4XU3 A;  3MEY A;  3A74 A;  4H2U A;  5HGQ A;  4YRG A;  2QHU A;  3A5Y A;  4HWP A;  4ZIB A;  2P0L A;  2EJG A;  4P3P A;  1YFR A;  2DXU A;  2I4O A;  4YRQ A;  1B7Y B;  2DTI A;  4P75 C;  1G51 A;  4XTX A;  3QO8 A;  3PZC A;  3A5Z A;  3HY0 A;  3VQY A;  1NYR A;  1QE0 A;  2PME A;  4YPF A;  3QO7 A;  1E24 A;  1VQZ A;  2ZR2 A;  2ZXF A;  3A7U A;  1H4Q A;  2DU7 A;  3L4G B;  2QHS A;  5ELO A;  1X2G A;  3RL6 A;  2ZR3 A;  2Q5I A;  4BW9 A;  3TEH B;  3E9I A;  4YP0 A;  3L1A A;  1E22 A;  5K1X A;  4NCX A;  4XEM A;  1ATI A;  3NEL A;  1X01 A;  1G5H A;  3R07 A;  4P71 A;  4LVK A;  4DPG A;  1B7Y A;  1BIB A;  1WQ7 A;  2DVE A;  4YRP A;  2QHT A;  4UP9 A;  4K88 A;  3HFZ A;  3V7C A;  3TUP A;  3EFR A;  1NJ8 A;  4WF2 A;  4Q15 A;  1HTT A;  4XU0 A;  4KR3 A;  1WPY A;  2EAY A;  3A31 A;  2FYK A;  2I4L A;  2CJ9 A;  3VBB A;  1NJ5 A;  4AH6 A;  4YRC A;  4CS4 A;  3TEH A;  4TTV A;  2E65 A;  3IKL A;  3UGQ A;  1H4V B;  1E1T A;  3A7A A;  3V8J A;  4TVA A;  3UGT A;  3L4G A;  4Q6G A;  2P5I A;  3REU A;  2DQ3 A;  2CJA A;  3HFV A;  1FYF A;  4YRS A;  4LVL A;  2DKG A;  12AS A;  1SET A;  3M4P A;  4H2S A;  3HXY A;  2ZT7 A;  1ADJ A;  3M4Q A;  2I4N A;  3HFZ B;  4TQD A;  1LYL A;  3DSQ A;  1J5W A;  3LSS A;  1KMM A;  1YFT A;  3RKX A;  2AKW A;  3P8T A;  1EFW A;  3HY1 A;  1C0A A;  1NNH A;  3ICA A;  3HXW A;  2ZZG A;  3EFS A;  3IAL A;  2ZGW A;  2DQ0 A;  1ADY A;  4G84 A;  3RUX A;  4YRJ A;  3RGL A;  4HVC A;  4KR2 A;  1NJ6 A;  4J15 A;  1SRY A;  1WU7 A;  3G1Z A;  4G85 A;  2AKW B;  4YRL A;  4X5O A;  1EQR A;  1E1O A;  4WJ4 A;  4CS3 A;  3HXV A;  4DQ2 A;  2NS6 A;  4YRF A;  1JJC A;  1SES A;  3QO5 A;  3ERR A;  4EX5 A;  3P8V A;  2A8E A;  4TVY A;  4P73 A;  4PG3 A;  3CMQ A;  2RHS A;  4OLF A;  1SER A;  4UPA A;  1WLE A;  3VQX A;  2G4C A;  4YRM A;  1H4S A;  4YRT A;  4HWO A;  3HXU A;  1IL2 A;  3A32 A;  3BFM A;  1BIA A;  2EWN A;  2DTO A;  1BBW A;  1QF6 A;  1JJC B;  3P8Y A;  1KMN A;  2ALY B;  4P71 C;  4H2Y A;  4UP7 A;  2ZTG A;  2ARS A;  2I4M A;  4P3O A;  4XEO A;  2AMC B;  1PYS B;  4TVA B;  2ODR D;  3WQZ A;  2HNI A;  3RIR A;  1ASZ A;  2CJB A;  1BBU A;  4CH6 A;  1W66 A;  4XTZ A;  2E1H A;  4RQF A;  5C51 B;  4H2T A;  3V8K A;  4H2W A;  2C7I A;  4PHC A;  2ZIM A;  2DU5 A;  3NET A;  4HWT A;  2ZT5 A;  3UH0 A;  1WNL A;  1NJ1 A;  1PYS A;  4WJ3 M;  1YB3 A;  2E41 A;  3QNE A;  2ARU A;  2QHV A;  2XGT A;  4P74 C;  1USY C;  3PCO B;  2AMC A;  4LNS A;  3OD1 A;  3BJU A;  1X54 A;  4XTW A;  2J3M A;  2DJZ A;  3LSQ A;  1X55 A;  1B70 B;  4YYE A;  1NYQ A;  3RF1 A;  4YDQ A;  2XTI A;  4LVI A;  2E5A A;  3HRK A;  4LVM A;  4LVJ A;  2J3L A;  4O2D A;  1NJ2 A;  1KOG A;  3V7S A;  3L2Z A;  3MQZ A;  3FJP A;  3MF1 A;  1B70 A;  1Z7M A;  4YCV A;  1X56 A;  5K1P A;  4P3N A;  5KNN A;  4HWR A;  1L0W A;  2ZIO A;  2C8M A;  3QTC A;  3TEG A;  4CH5 A;  2IY5 B;  2RHS B;  5E3I A;  2ZCE A;  4H2X A;  3RKW A;  3VQV A;  4CH3 A;  4WI1 A;  4YRR A;  3V8L A;  4HT4 A;  4TQF A;  1HXD A;  5F5W A;  1GGM A;  2ALY A;  2E64 A;  4K87 A;  2DEQ A;  4XU1 A;  1X2H A;  1WYD A;  4H2X B;  1ASY A;  4RQE A;  2CGH A;  3REX A;  2EJ9 A;  2DZ9 A;  2EJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...