4LVIA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt). mn-bound crystal structure at ph 4.6
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
190
Chain Sequence
b'SYMVARMQKMKAGNLGGAFKHNERVSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid recombination enzyme
molecule tags Dna binding protein/dna
source organism Streptococcus agalactiae
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
total genus 60
structure length 190
sequence length 194
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lviA01
4LVMA 4HT4A 4LVJA 2NS6A 4LVKA 4LVLA 4LVIA
chains in the Genus database with same CATH superfamily
3BFMA 5HGQA 2CJ9A 1YB3A 3VQVA 1QE0A 1X54A 2ZZEA 4YRCA 2Q5HA 3W3SA 2J3MA 4P74C 4KR2A 2ZT6A 4H2XA 4OLFA 4XEMA 3HXYA 5ELNA 4WJ3M 3RGLA 2EWNA 4G85A 3REXA 4NCXA 5C52B 4LVKA 5C51B 3HRIA 3A31A 1WU7A 4K86A 1H4VB 4H2SA 4P71A 1NJ1A 2E3CA 2ODRC 1E1TA 4XEOA 4XTZA 2DZCA 2E1HA 2J3LA 3DSQA 2ZXFA 2ARUA 3REUA 3TEGA 2PMFA 3NEMA 1SESA 4YRPA 4H2YA 4Q15A 2PMEA 4YDQA 2ZTGA 3UGTA 1EVKA 1X56A 4K88A 4XU3A 1E22A 1H4QA 4PG3A 4Q6GA 4P3OA 2ALYB 1WQ7A 2RHQB 3ERRA 4H2WA 4TQFA 3HXUA 4CH5A 3HY0A 3HY1A 4HWTA 1HTTA 4HWRA 4H2TA 4YCVA 2RHSB 2ZT5A 4HWOA 1IL2A 2ZIMA 1H4TA 5E3IA 4LVJA 4HA8A 4WJ4A 1YFRA 2EL9A 3RKXA 1W66A 3QO8A 4TWAA 1FYFA 4P73C 4YRIA 4YRSA 2QHSA 2DKGA 3HFZA 3NETA 4HVCA 2NS6A 4O2DA 2DQ0A 4UP9A 3RACA 4DQ2A 4YRFA 2ZGWA 2DTIA 3RKWA 3V8JA 2DXTA 3FJPA 5K1XA 1ASZA 2AKWB 3LC0A 4G84A 1NJ8A 1YFTA 3V8LA 3NENA 4YROA 4P75A 2AMCB 4YRGA 2FYKA 2ZR2A 3HXZA 2C7IA 2DDZA 3HFVA 1WLEA 1JJCB 1SRYA 3KFUA 4YRTA 4CH4A 1Z7MA 2E10A 2ZR3A 11ASA 4J15A 2I4OA 4YRRA 1NYRA 2RHSA 2ZCEA 1KMMA 3HXXA 2EAYA 2ZT7A 3LSQA 2E5AA 3PCOA 4P74A 2DQ3A 1RIQA 3OD1A 12ASA 1SERA 3A7AA 3QNEA 3L4GB 3HXVA 3EFSA 3IG2A 1EIYA 2E64A 3UH0A 4L87A 1GGMA 1B7YA 4YRKA 4XTVA 4LVLA 2ALYA 1EIYB 3P8VA 4WF2A 3TEHB 4HWPA 3QTCA 3A32A 4YCUA 4P73A 3RKYA 3VQXA 1PYSA 2Q7HA 1G51A 4P72C 4YREA 4K87A 1WNLA 3VQYA 1QF6A 2EJGA 3HRKA 4CS4A 2XGTA 4H2VA 1USYC 3V8KA 1PYSB 4LVMA 5F5WA 4DPGA 3MEYA 3PZCA 1WQWA 4H2UA 2ZZGA 2DTHA 3VBBA 4YP0A 2ZIOA 2QHTA 1USYA 3V7RA 4XTUA 4YCWA 1WPYA 1NYQA 1E24A 1H4SA 3LSSA 3VQWA 1G5IA 2I4LA 1L0WA 3I7FA 4OP0A 2EJFA 1EVLA 1KMNA 2CJAA 3NELA 4RDXA 1BBUA 1X2GA 1E1OA 4YRLA 2ZT8A 5KNNA 4X5OA 4H2XB 5ELOA 1X2HA 1N9WA 2HNIA 4YRNA 4PHCA 2ODRD 1NNHA 1X55A 4KR3A 4ZTZB 2AMCA 1ATIA 3MF1A 3MQZA 4UPAA 2E41A 5C53B 1B76A 2DXUA 2DU5A 3A7RA 4P3NA 4UP7A 3PCOB 3P8YA 3RL6A 3G1ZA 4YYEA 3R07A 4XTXA 1LYLA 3A5ZA 3HXWA 4TVYA 2C8MA 4CH3A 4CS3A 2DVEA 2A8EA 1YGBA 3A74A 4YRJA 3M4PA 3ICAA 1ADYA 4P71C 1EOVA 1WYDA 2P5IA 4HT4A 4CS2A 2I4NA 1NJ5A 4LNSA 2DEQA 2I4MA 1B8AA 4ZIBA 1HC7A 2ARTA 1C0AA 1X01A 2P0LA 4TVAB 1SETA 2CGHA 4BW9A 4YRQA 3RUXA 4E51A 1YFSA 3RIRA 4TVAA 2QHVA 4BWAA 1EQRA 2IY5B 4YPFA 1JJCA 2ZNIA 2DJZA 2RHQA 4EX5A 2IY5A 4HWSA 4RQFA 3L1AA 3UFGA 3P8TA 2CJBA 4TTVA 3UGQA 4P75C 4RQEA 5K1PA 4XU2A 1NJ2A 1J5WA 3QO5A 1KOGA 4YRMA 1HXDA 3M4QA 3TEHA 3WQZA 3A5YA 2AKWA 3BJUA 3TUPA 4H02A 2QHUA 4RMFA 3RF1A 4XTYA 2XTIA 2ZINA 3V7SA 4AH6A 1G5HA 2Q5IA 4EO4A 2ZNJA 2G4CA 3MF2A 1ASYA 2DZ9A 1BIAA 3A7UA 3IALA 4XU0A 4KQEA 3E9HA 3IKLA 1ADJA 1NJ6A 4XU1A 4P72A 1EFWA 2ZZFA 4WI1A 3CMQA 4CH6A 3HTZA 1Z7NA 3E9IA 2EJ9A 4LVIA 3EFRA 4TQDA 4TVWA 1B70A 4XTWA 4P3PA 3L2ZA 4ZTUB 3IKMB 2DU7A 1B70B 1BIBA 3V7CA 1VQZA 1B7YB 2Q7EA 3HFZB 2Q7GA 4UP8A 2E65A 2CIMA 3L4GA 3QO7A 2ARSA 1BBWA 2DTOA
chains in the Genus database with same CATH topology
3BFMA 5HGQA 2CJ9A 1YB3A 3VQVA 1QE0A 1X54A 2ZZEA 4YRCA 2Q5HA 3W3SA 2J3MA 4P74C 4KR2A 2ZT6A 4H2XA 4OLFA 4XEMA 3HXYA 5ELNA 4WJ3M 3RGLA 2EWNA 4G85A 3REXA 4NCXA 5C52B 4LVKA 5C51B 3HRIA 3A31A 1WU7A 4K86A 1H4VB 4H2SA 4P71A 1NJ1A 2E3CA 2ODRC 1E1TA 4XEOA 4XTZA 2DZCA 2E1HA 2J3LA 3DSQA 2ZXFA 2ARUA 3REUA 3TEGA 2PMFA 3NEMA 1SESA 4YRPA 4H2YA 4Q15A 2PMEA 4YDQA 2ZTGA 3UGTA 1EVKA 1X56A 4K88A 4XU3A 1E22A 1H4QA 4PG3A 4Q6GA 4P3OA 2ALYB 1WQ7A 2RHQB 3ERRA 4H2WA 4TQFA 3HXUA 4CH5A 3HY0A 3HY1A 4HWTA 1HTTA 4HWRA 4H2TA 4YCVA 2RHSB 2ZT5A 4HWOA 1IL2A 2ZIMA 1H4TA 5E3IA 4LVJA 4HA8A 4WJ4A 1YFRA 2EL9A 3RKXA 1W66A 3QO8A 4TWAA 1FYFA 4P73C 4YRIA 4YRSA 2QHSA 2DKGA 3HFZA 3NETA 4HVCA 2NS6A 4O2DA 2DQ0A 4UP9A 3RACA 4DQ2A 4YRFA 2ZGWA 2DTIA 3RKWA 3V8JA 2DXTA 3FJPA 5K1XA 1ASZA 2AKWB 3LC0A 4G84A 1NJ8A 1YFTA 3V8LA 3NENA 4YROA 4P75A 2AMCB 4YRGA 2FYKA 2ZR2A 3HXZA 2C7IA 2DDZA 3HFVA 1WLEA 1JJCB 1SRYA 3KFUA 4YRTA 4CH4A 1Z7MA 2E10A 2ZR3A 11ASA 4J15A 2I4OA 4YRRA 1NYRA 2RHSA 2ZCEA 1KMMA 3HXXA 2EAYA 2ZT7A 3LSQA 2E5AA 3PCOA 4P74A 2DQ3A 1RIQA 3OD1A 12ASA 1SERA 3A7AA 3QNEA 3L4GB 3HXVA 3EFSA 3IG2A 1EIYA 2E64A 3UH0A 4L87A 1GGMA 1B7YA 4YRKA 4XTVA 4LVLA 2ALYA 1EIYB 3P8VA 4WF2A 3TEHB 4HWPA 3QTCA 3A32A 4YCUA 4P73A 3RKYA 3VQXA 1PYSA 2Q7HA 1G51A 4P72C 4YREA 4K87A 1WNLA 3VQYA 1QF6A 2EJGA 3HRKA 4CS4A 2XGTA 4H2VA 1USYC 3V8KA 1PYSB 4LVMA 5F5WA 4DPGA 3MEYA 3PZCA 1WQWA 4H2UA 2ZZGA 2DTHA 3VBBA 4YP0A 2ZIOA 2QHTA 1USYA 3V7RA 4XTUA 4YCWA 1WPYA 1NYQA 1E24A 1H4SA 3LSSA 3VQWA 1G5IA 2I4LA 1L0WA 3I7FA 4OP0A 2EJFA 1EVLA 1KMNA 2CJAA 3NELA 4RDXA 1BBUA 1X2GA 1E1OA 4YRLA 2ZT8A 5KNNA 4X5OA 4H2XB 5ELOA 1X2HA 1N9WA 2HNIA 4YRNA 4PHCA 2ODRD 1NNHA 1X55A 4KR3A 4ZTZB 2AMCA 1ATIA 3MF1A 3MQZA 4UPAA 2E41A 5C53B 1B76A 2DXUA 2DU5A 3A7RA 4P3NA 4UP7A 3PCOB 3P8YA 3RL6A 3G1ZA 4YYEA 3R07A 4XTXA 1LYLA 3A5ZA 3HXWA 4TVYA 2C8MA 4CH3A 4CS3A 2DVEA 2A8EA 1YGBA 3A74A 4YRJA 3M4PA 3ICAA 1ADYA 4P71C 1EOVA 1WYDA 2P5IA 4HT4A 4CS2A 2I4NA 1NJ5A 4LNSA 2DEQA 2I4MA 1B8AA 4ZIBA 1HC7A 2ARTA 1C0AA 1X01A 2P0LA 4TVAB 1SETA 2CGHA 4BW9A 4YRQA 3RUXA 4E51A 1YFSA 3RIRA 4TVAA 2QHVA 4BWAA 1EQRA 2IY5B 4YPFA 1JJCA 2ZNIA 2DJZA 2RHQA 4EX5A 2IY5A 4HWSA 4RQFA 3L1AA 3UFGA 3P8TA 2CJBA 4TTVA 3UGQA 4P75C 4RQEA 5K1PA 4XU2A 1NJ2A 1J5WA 3QO5A 1KOGA 4YRMA 1HXDA 3M4QA 3TEHA 3WQZA 3A5YA 2AKWA 3BJUA 3TUPA 4H02A 2QHUA 4RMFA 3RF1A 4XTYA 2XTIA 2ZINA 3V7SA 4AH6A 1G5HA 2Q5IA 4EO4A 2ZNJA 2G4CA 3MF2A 1ASYA 2DZ9A 1BIAA 3A7UA 3IALA 4XU0A 4KQEA 3E9HA 3IKLA 1ADJA 1NJ6A 4XU1A 4P72A 1EFWA 2ZZFA 4WI1A 3CMQA 4CH6A 3HTZA 1Z7NA 3E9IA 2EJ9A 4LVIA 3EFRA 4TQDA 4TVWA 1B70A 4XTWA 4P3PA 3L2ZA 4ZTUB 3IKMB 2DU7A 1B70B 1BIBA 3V7CA 1VQZA 1B7YB 2Q7EA 3HFZB 2Q7GA 4UP8A 2E65A 2CIMA 3L4GA 3QO7A 2ARSA 1BBWA 2DTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVM A;  4HT4 A;  4LVJ A;  2NS6 A;  4LVK A;  4LVL A;  4LVI A; 
#chains in the Genus database with same CATH topology
 3BFM A;  5HGQ A;  2CJ9 A;  1YB3 A;  3VQV A;  1QE0 A;  1X54 A;  2ZZE A;  4YRC A;  2Q5H A;  3W3S A;  2J3M A;  4P74 C;  4KR2 A;  2ZT6 A;  4H2X A;  4OLF A;  4XEM A;  3HXY A;  5ELN A;  4WJ3 M;  3RGL A;  2EWN A;  4G85 A;  3REX A;  4NCX A;  5C52 B;  4LVK A;  5C51 B;  3HRI A;  3A31 A;  1WU7 A;  4K86 A;  1H4V B;  4H2S A;  4P71 A;  1NJ1 A;  2E3C A;  2ODR C;  1E1T A;  4XEO A;  4XTZ A;  2DZC A;  2E1H A;  2J3L A;  3DSQ A;  2ZXF A;  2ARU A;  3REU A;  3TEG A;  2PMF A;  3NEM A;  1SES A;  4YRP A;  4H2Y A;  4Q15 A;  2PME A;  4YDQ A;  2ZTG A;  3UGT A;  1EVK A;  1X56 A;  4K88 A;  4XU3 A;  1E22 A;  1H4Q A;  4PG3 A;  4Q6G A;  4P3O A;  2ALY B;  1WQ7 A;  2RHQ B;  3ERR A;  4H2W A;  4TQF A;  3HXU A;  4CH5 A;  3HY0 A;  3HY1 A;  4HWT A;  1HTT A;  4HWR A;  4H2T A;  4YCV A;  2RHS B;  2ZT5 A;  4HWO A;  1IL2 A;  2ZIM A;  1H4T A;  5E3I A;  4LVJ A;  4HA8 A;  4WJ4 A;  1YFR A;  2EL9 A;  3RKX A;  1W66 A;  3QO8 A;  4TWA A;  1FYF A;  4P73 C;  4YRI A;  4YRS A;  2QHS A;  2DKG A;  3HFZ A;  3NET A;  4HVC A;  2NS6 A;  4O2D A;  2DQ0 A;  4UP9 A;  3RAC A;  4DQ2 A;  4YRF A;  2ZGW A;  2DTI A;  3RKW A;  3V8J A;  2DXT A;  3FJP A;  5K1X A;  1ASZ A;  2AKW B;  3LC0 A;  4G84 A;  1NJ8 A;  1YFT A;  3V8L A;  3NEN A;  4YRO A;  4P75 A;  2AMC B;  4YRG A;  2FYK A;  2ZR2 A;  3HXZ A;  2C7I A;  2DDZ A;  3HFV A;  1WLE A;  1JJC B;  1SRY A;  3KFU A;  4YRT A;  4CH4 A;  1Z7M A;  2E10 A;  2ZR3 A;  11AS A;  4J15 A;  2I4O A;  4YRR A;  1NYR A;  2RHS A;  2ZCE A;  1KMM A;  3HXX A;  2EAY A;  2ZT7 A;  3LSQ A;  2E5A A;  3PCO A;  4P74 A;  2DQ3 A;  1RIQ A;  3OD1 A;  12AS A;  1SER A;  3A7A A;  3QNE A;  3L4G B;  3HXV A;  3EFS A;  3IG2 A;  1EIY A;  2E64 A;  3UH0 A;  4L87 A;  1GGM A;  1B7Y A;  4YRK A;  4XTV A;  4LVL A;  2ALY A;  1EIY B;  3P8V A;  4WF2 A;  3TEH B;  4HWP A;  3QTC A;  3A32 A;  4YCU A;  4P73 A;  3RKY A;  3VQX A;  1PYS A;  2Q7H A;  1G51 A;  4P72 C;  4YRE A;  4K87 A;  1WNL A;  3VQY A;  1QF6 A;  2EJG A;  3HRK A;  4CS4 A;  2XGT A;  4H2V A;  1USY C;  3V8K A;  1PYS B;  4LVM A;  5F5W A;  4DPG A;  3MEY A;  3PZC A;  1WQW A;  4H2U A;  2ZZG A;  2DTH A;  3VBB A;  4YP0 A;  2ZIO A;  2QHT A;  1USY A;  3V7R A;  4XTU A;  4YCW A;  1WPY A;  1NYQ A;  1E24 A;  1H4S A;  3LSS A;  3VQW A;  1G5I A;  2I4L A;  1L0W A;  3I7F A;  4OP0 A;  2EJF A;  1EVL A;  1KMN A;  2CJA A;  3NEL A;  4RDX A;  1BBU A;  1X2G A;  1E1O A;  4YRL A;  2ZT8 A;  5KNN A;  4X5O A;  4H2X B;  5ELO A;  1X2H A;  1N9W A;  2HNI A;  4YRN A;  4PHC A;  2ODR D;  1NNH A;  1X55 A;  4KR3 A;  4ZTZ B;  2AMC A;  1ATI A;  3MF1 A;  3MQZ A;  4UPA A;  2E41 A;  5C53 B;  1B76 A;  2DXU A;  2DU5 A;  3A7R A;  4P3N A;  4UP7 A;  3PCO B;  3P8Y A;  3RL6 A;  3G1Z A;  4YYE A;  3R07 A;  4XTX A;  1LYL A;  3A5Z A;  3HXW A;  4TVY A;  2C8M A;  4CH3 A;  4CS3 A;  2DVE A;  2A8E A;  1YGB A;  3A74 A;  4YRJ A;  3M4P A;  3ICA A;  1ADY A;  4P71 C;  1EOV A;  1WYD A;  2P5I A;  4HT4 A;  4CS2 A;  2I4N A;  1NJ5 A;  4LNS A;  2DEQ A;  2I4M A;  1B8A A;  4ZIB A;  1HC7 A;  2ART A;  1C0A A;  1X01 A;  2P0L A;  4TVA B;  1SET A;  2CGH A;  4BW9 A;  4YRQ A;  3RUX A;  4E51 A;  1YFS A;  3RIR A;  4TVA A;  2QHV A;  4BWA A;  1EQR A;  2IY5 B;  4YPF A;  1JJC A;  2ZNI A;  2DJZ A;  2RHQ A;  4EX5 A;  2IY5 A;  4HWS A;  4RQF A;  3L1A A;  3UFG A;  3P8T A;  2CJB A;  4TTV A;  3UGQ A;  4P75 C;  4RQE A;  5K1P A;  4XU2 A;  1NJ2 A;  1J5W A;  3QO5 A;  1KOG A;  4YRM A;  1HXD A;  3M4Q A;  3TEH A;  3WQZ A;  3A5Y A;  2AKW A;  3BJU A;  3TUP A;  4H02 A;  2QHU A;  4RMF A;  3RF1 A;  4XTY A;  2XTI A;  2ZIN A;  3V7S A;  4AH6 A;  1G5H A;  2Q5I A;  4EO4 A;  2ZNJ A;  2G4C A;  3MF2 A;  1ASY A;  2DZ9 A;  1BIA A;  3A7U A;  3IAL A;  4XU0 A;  4KQE A;  3E9H A;  3IKL A;  1ADJ A;  1NJ6 A;  4XU1 A;  4P72 A;  1EFW A;  2ZZF A;  4WI1 A;  3CMQ A;  4CH6 A;  3HTZ A;  1Z7N A;  3E9I A;  2EJ9 A;  4LVI A;  3EFR A;  4TQD A;  4TVW A;  1B70 A;  4XTW A;  4P3P A;  3L2Z A;  4ZTU B;  3IKM B;  2DU7 A;  1B70 B;  1BIB A;  3V7C A;  1VQZ A;  1B7Y B;  2Q7E A;  3HFZ B;  2Q7G A;  4UP8 A;  2E65 A;  2CIM A;  3L4G A;  3QO7 A;  2ARS A;  1BBW A;  2DTO A; 
#chains in the Genus database with same CATH homology
 3BFM A;  5HGQ A;  2CJ9 A;  1YB3 A;  3VQV A;  1QE0 A;  1X54 A;  2ZZE A;  4YRC A;  2Q5H A;  3W3S A;  2J3M A;  4P74 C;  4KR2 A;  2ZT6 A;  4H2X A;  4OLF A;  4XEM A;  3HXY A;  5ELN A;  4WJ3 M;  3RGL A;  2EWN A;  4G85 A;  3REX A;  4NCX A;  5C52 B;  4LVK A;  5C51 B;  3HRI A;  3A31 A;  1WU7 A;  4K86 A;  1H4V B;  4H2S A;  4P71 A;  1NJ1 A;  2E3C A;  2ODR C;  1E1T A;  4XEO A;  4XTZ A;  2DZC A;  2E1H A;  2J3L A;  3DSQ A;  2ZXF A;  2ARU A;  3REU A;  3TEG A;  2PMF A;  3NEM A;  1SES A;  4YRP A;  4H2Y A;  4Q15 A;  2PME A;  4YDQ A;  2ZTG A;  3UGT A;  1EVK A;  1X56 A;  4K88 A;  4XU3 A;  1E22 A;  1H4Q A;  4PG3 A;  4Q6G A;  4P3O A;  2ALY B;  1WQ7 A;  2RHQ B;  3ERR A;  4H2W A;  4TQF A;  3HXU A;  4CH5 A;  3HY0 A;  3HY1 A;  4HWT A;  1HTT A;  4HWR A;  4H2T A;  4YCV A;  2RHS B;  2ZT5 A;  4HWO A;  1IL2 A;  2ZIM A;  1H4T A;  5E3I A;  4LVJ A;  4HA8 A;  4WJ4 A;  1YFR A;  2EL9 A;  3RKX A;  1W66 A;  3QO8 A;  4TWA A;  1FYF A;  4P73 C;  4YRI A;  4YRS A;  2QHS A;  2DKG A;  3HFZ A;  3NET A;  4HVC A;  2NS6 A;  4O2D A;  2DQ0 A;  4UP9 A;  3RAC A;  4DQ2 A;  4YRF A;  2ZGW A;  2DTI A;  3RKW A;  3V8J A;  2DXT A;  3FJP A;  5K1X A;  1ASZ A;  2AKW B;  3LC0 A;  4G84 A;  1NJ8 A;  1YFT A;  3V8L A;  3NEN A;  4YRO A;  4P75 A;  2AMC B;  4YRG A;  2FYK A;  2ZR2 A;  3HXZ A;  2C7I A;  2DDZ A;  3HFV A;  1WLE A;  1JJC B;  1SRY A;  3KFU A;  4YRT A;  4CH4 A;  1Z7M A;  2E10 A;  2ZR3 A;  11AS A;  4J15 A;  2I4O A;  4YRR A;  1NYR A;  2RHS A;  2ZCE A;  1KMM A;  3HXX A;  2EAY A;  2ZT7 A;  3LSQ A;  2E5A A;  3PCO A;  4P74 A;  2DQ3 A;  1RIQ A;  3OD1 A;  12AS A;  1SER A;  3A7A A;  3QNE A;  3L4G B;  3HXV A;  3EFS A;  3IG2 A;  1EIY A;  2E64 A;  3UH0 A;  4L87 A;  1GGM A;  1B7Y A;  4YRK A;  4XTV A;  4LVL A;  2ALY A;  1EIY B;  3P8V A;  4WF2 A;  3TEH B;  4HWP A;  3QTC A;  3A32 A;  4YCU A;  4P73 A;  3RKY A;  3VQX A;  1PYS A;  2Q7H A;  1G51 A;  4P72 C;  4YRE A;  4K87 A;  1WNL A;  3VQY A;  1QF6 A;  2EJG A;  3HRK A;  4CS4 A;  2XGT A;  4H2V A;  1USY C;  3V8K A;  1PYS B;  4LVM A;  5F5W A;  4DPG A;  3MEY A;  3PZC A;  1WQW A;  4H2U A;  2ZZG A;  2DTH A;  3VBB A;  4YP0 A;  2ZIO A;  2QHT A;  1USY A;  3V7R A;  4XTU A;  4YCW A;  1WPY A;  1NYQ A;  1E24 A;  1H4S A;  3LSS A;  3VQW A;  1G5I A;  2I4L A;  1L0W A;  3I7F A;  4OP0 A;  2EJF A;  1EVL A;  1KMN A;  2CJA A;  3NEL A;  4RDX A;  1BBU A;  1X2G A;  1E1O A;  4YRL A;  2ZT8 A;  5KNN A;  4X5O A;  4H2X B;  5ELO A;  1X2H A;  1N9W A;  2HNI A;  4YRN A;  4PHC A;  2ODR D;  1NNH A;  1X55 A;  4KR3 A;  4ZTZ B;  2AMC A;  1ATI A;  3MF1 A;  3MQZ A;  4UPA A;  2E41 A;  5C53 B;  1B76 A;  2DXU A;  2DU5 A;  3A7R A;  4P3N A;  4UP7 A;  3PCO B;  3P8Y A;  3RL6 A;  3G1Z A;  4YYE A;  3R07 A;  4XTX A;  1LYL A;  3A5Z A;  3HXW A;  4TVY A;  2C8M A;  4CH3 A;  4CS3 A;  2DVE A;  2A8E A;  1YGB A;  3A74 A;  4YRJ A;  3M4P A;  3ICA A;  1ADY A;  4P71 C;  1EOV A;  1WYD A;  2P5I A;  4HT4 A;  4CS2 A;  2I4N A;  1NJ5 A;  4LNS A;  2DEQ A;  2I4M A;  1B8A A;  4ZIB A;  1HC7 A;  2ART A;  1C0A A;  1X01 A;  2P0L A;  4TVA B;  1SET A;  2CGH A;  4BW9 A;  4YRQ A;  3RUX A;  4E51 A;  1YFS A;  3RIR A;  4TVA A;  2QHV A;  4BWA A;  1EQR A;  2IY5 B;  4YPF A;  1JJC A;  2ZNI A;  2DJZ A;  2RHQ A;  4EX5 A;  2IY5 A;  4HWS A;  4RQF A;  3L1A A;  3UFG A;  3P8T A;  2CJB A;  4TTV A;  3UGQ A;  4P75 C;  4RQE A;  5K1P A;  4XU2 A;  1NJ2 A;  1J5W A;  3QO5 A;  1KOG A;  4YRM A;  1HXD A;  3M4Q A;  3TEH A;  3WQZ A;  3A5Y A;  2AKW A;  3BJU A;  3TUP A;  4H02 A;  2QHU A;  4RMF A;  3RF1 A;  4XTY A;  2XTI A;  2ZIN A;  3V7S A;  4AH6 A;  1G5H A;  2Q5I A;  4EO4 A;  2ZNJ A;  2G4C A;  3MF2 A;  1ASY A;  2DZ9 A;  1BIA A;  3A7U A;  3IAL A;  4XU0 A;  4KQE A;  3E9H A;  3IKL A;  1ADJ A;  1NJ6 A;  4XU1 A;  4P72 A;  1EFW A;  2ZZF A;  4WI1 A;  3CMQ A;  4CH6 A;  3HTZ A;  1Z7N A;  3E9I A;  2EJ9 A;  4LVI A;  3EFR A;  4TQD A;  4TVW A;  1B70 A;  4XTW A;  4P3P A;  3L2Z A;  4ZTU B;  3IKM B;  2DU7 A;  1B70 B;  1BIB A;  3V7C A;  1VQZ A;  1B7Y B;  2Q7E A;  3HFZ B;  2Q7G A;  4UP8 A;  2E65 A;  2CIM A;  3L4G A;  3QO7 A;  2ARS A;  1BBW A;  2DTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...