4LVIA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt). mn-bound crystal structure at ph 4.6
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
190
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Plasmid recombination enzyme
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
total genus 60
structure length 190
sequence length 194
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lviA01
4LVIA 4LVMA 2NS6A 4LVLA 4HT4A 4LVKA 4LVJA
chains in the Genus database with same CATH superfamily
5ELOA 2DZ9A 2Q7EA 2QHVA 4HWSA 3RKYA 2QHTA 4TQFA 3MEYA 1QE0A 3A7RA 3M4PA 3HXYA 4PG3A 3RIRA 4YYEA 1IL2A 2DEQA 4NCXA 5C53B 2AMCB 1HC7A 1H4SA 3IALA 4XTXA 3VQYA 1X56A 2ZIMA 5K1XA 2I4NA 1YFRA 2ZNIA 3L4GB 3WQZA 1WPYA 3L1AA 1C0AA 4PHCA 2QHUA 3M4QA 2I4MA 3A7UA 1WYDA 1B76A 2DXTA 2XGTA 4K86A 4OP0A 2ALYB 4XEMA 2DTHA 1E1OA 2DU5A 12ASA 4HWRA 3OD1A 2ZNJA 2AKWB 1VQZA 2J3LA 3UGQA 2IY5A 2ZTGA 2E65A 4HWTA 4H2XB 4RDXA 3EFRA 3G1ZA 4J15A 3UGTA 3A7AA 4LVJA 1B8AA 1JJCB 5KNNA 2NS6A 4BW9A 1NJ1A 3VQWA 3A32A 2EJFA 4G84A 4P74A 2EAYA 1HXDA 2I4LA 3UFGA 3CMQA 4TTVA 3NETA 2C8MA 2EJ9A 4G85A 1ASYA 2ARTA 4XEOA 2A8EA 3MF1A 1B7YB 2ZZGA 2C7IA 2DTIA 4YRJA 4WF2A 3QNEA 3HXZA 3HFZA 1GGMA 3HY1A 1BIAA 1NJ5A 1X2HA 4DPGA 3E9HA 2PMEA 2CIMA 1E1TA 4P3OA 4H2YA 2QHSA 4LVIA 4P72A 3RGLA 1ASZA 3A5YA 3HY0A 1NJ8A 2ZIOA 2Q7GA 4YROA 1FYFA 4YDQA 4WI1A 1BBWA 1J5WA 2E41A 2I4OA 3P8TA 3QTCA 3LSQA 5C51B 3V8JA 1LYLA 4K87A 3RF1A 3FJPA 3HRKA 3IG2A 1X54A 4P75A 4EX5A 4TQDA 4L87A 2ZR3A 2E64A 2E10A 1H4QA 1X01A 4YREA 1QF6A 3KFUA 2ZT8A 2IY5B 3V7CA 4HA8A 4UP8A 1WLEA 4LVKA 4RMFA 5ELNA 3HFVA 3A31A 1G51A 4H02A 4P71A 4BWAA 1SERA 2ZR2A 1EVLA 3TEHA 4WJ4A 1ADYA 5F5WA 4HVCA 1SETA 4XTWA 3PCOA 3IKMB 2ODRC 1E24A 2RHSA 3ERRA 4XTVA 2Q5HA 11ASA 4TVAA 3DSQA 2PMFA 1G5HA 1YFTA 4YCUA 2E5AA 3HFZB 2CGHA 3VBBA 2CJAA 4P74C 2E3CA 4YRTA 4YRSA 3RKXA 3R07A 1BBUA 2EL9A 3V8KA 4Q6GA 4CS4A 1EIYA 1YFSA 3A74A 3NELA 4P3NA 3IKLA 2EWNA 4XU2A 4UP7A 3P8YA 4OLFA 5HGQA 4TVYA 3ICAA 1YGBA 4LVMA 4P72C 3A5ZA 4YP0A 1E22A 3HTZA 3TEGA 4YRMA 1NJ2A 3NEMA 4P3PA 4UP9A 2Q7HA 1WNLA 1X55A 4YRPA 3VQVA 1KMMA 1Z7NA 4LNSA 4ZIBA 4E51A 3I7FA 3TUPA 4YRKA 4AH6A 4H2UA 4WJ3M 4DQ2A 1EFWA 4YRCA 3UH0A 1PYSA 4P75C 2RHQA 4YRNA 2ZINA 2DZCA 2ZCEA 2ARSA 2ZGWA 2J3MA 3BFMA 4CS2A 3TEHB 3REUA 1X2GA 3V7RA 1HTTA 3P8VA 3PCOB 2ZZFA 2ZT5A 1L0WA 1WQWA 2RHSB 1BIBA 4P71C 2P5IA 4CS3A 4TVAB 4P73C 3HRIA 4H2VA 1NYQA 1WU7A 4XU3A 3V8LA 4UPAA 2FYKA 4X5OA 4Q15A 4XTUA 4CH5A 3E9IA 1NNHA 2E1HA 4YRGA 4CH3A 3RKWA 2DDZA 4TWAA 3REXA 4P73A 2CJ9A 2P0LA 1W66A 1USYA 2DTOA 2DXUA 4EO4A 2DKGA 5K1PA 1EIYB 5E3IA 4YRLA 3W3SA 4YCVA 1ATIA 4HWPA 4K88A 1B70A 3HXXA 4KR3A 4H2WA 1RIQA 4YRFA 1EOVA 3VQXA 2DQ3A 1YB3A 3NENA 1EVKA 2ZZEA 4RQEA 3LSSA 2ZT6A 4HWOA 3RACA 1WQ7A 4ZTZB 1N9WA 2AMCA 2DVEA 3QO5A 2G4CA 1PYSB 4YCWA 2RHQB 3RUXA 1H4TA 4XU0A 2DJZA 1SRYA 1G5IA 4KQEA 1SESA 3L4GA 1Z7MA 2DQ0A 4TVWA 4O2DA 3HXWA 2ZT7A 3PZCA 1NYRA 3L2ZA 4XTZA 4XTYA 2DU7A 4ZTUB 2ARUA 3MQZA 2ALYA 5C52B 3RL6A 2ZXFA 4H2TA 1H4VB 3BJUA 2AKWA 2XTIA 4H2XA 4HT4A 4XU1A 2EJGA 4YRRA 2HNIA 4RQFA 4CH6A 1JJCA 4CH4A 3HXUA 3V7SA 1NJ6A 4KR2A 3LC0A 4YPFA 1ADJA 1KMNA 2Q5IA 1EQRA 2ODRD 1KOGA 2CJBA 1B7YA 3MF2A 3QO8A 4LVLA 1B70B 4H2SA 3EFSA 1USYC 4YRQA 3QO7A 3HXVA 4YRIA
chains in the Genus database with same CATH topology
5ELOA 2DZ9A 2Q7EA 2QHVA 4HWSA 3RKYA 2QHTA 4TQFA 3MEYA 1QE0A 3A7RA 3M4PA 3HXYA 4PG3A 3RIRA 4YYEA 1IL2A 2DEQA 4NCXA 5C53B 2AMCB 1HC7A 1H4SA 3IALA 4XTXA 3VQYA 1X56A 2ZIMA 5K1XA 2I4NA 1YFRA 2ZNIA 3L4GB 3WQZA 1WPYA 3L1AA 1C0AA 4PHCA 2QHUA 3M4QA 2I4MA 3A7UA 1WYDA 1B76A 2DXTA 2XGTA 4K86A 4OP0A 2ALYB 4XEMA 2DTHA 1E1OA 2DU5A 12ASA 4HWRA 3OD1A 2ZNJA 2AKWB 1VQZA 2J3LA 3UGQA 2IY5A 2ZTGA 2E65A 4HWTA 4H2XB 4RDXA 3EFRA 3G1ZA 4J15A 3UGTA 3A7AA 4LVJA 1B8AA 1JJCB 5KNNA 2NS6A 4BW9A 1NJ1A 3VQWA 3A32A 2EJFA 4G84A 4P74A 2EAYA 1HXDA 2I4LA 3UFGA 3CMQA 4TTVA 3NETA 2C8MA 2EJ9A 4G85A 1ASYA 2ARTA 4XEOA 2A8EA 3MF1A 1B7YB 2ZZGA 2C7IA 2DTIA 4YRJA 4WF2A 3QNEA 3HXZA 3HFZA 1GGMA 3HY1A 1BIAA 1NJ5A 1X2HA 4DPGA 3E9HA 2PMEA 2CIMA 1E1TA 4P3OA 4H2YA 2QHSA 4LVIA 4P72A 3RGLA 1ASZA 3A5YA 3HY0A 1NJ8A 2ZIOA 2Q7GA 4YROA 1FYFA 4YDQA 4WI1A 1BBWA 1J5WA 2E41A 2I4OA 3P8TA 3QTCA 3LSQA 5C51B 3V8JA 1LYLA 4K87A 3RF1A 3FJPA 3HRKA 3IG2A 1X54A 4P75A 4EX5A 4TQDA 4L87A 2ZR3A 2E64A 2E10A 1H4QA 1X01A 4YREA 1QF6A 3KFUA 2ZT8A 2IY5B 3V7CA 4HA8A 4UP8A 1WLEA 4LVKA 4RMFA 5ELNA 3HFVA 3A31A 1G51A 4H02A 4P71A 4BWAA 1SERA 2ZR2A 1EVLA 3TEHA 4WJ4A 1ADYA 5F5WA 4HVCA 1SETA 4XTWA 3PCOA 3IKMB 2ODRC 1E24A 2RHSA 3ERRA 4XTVA 2Q5HA 11ASA 4TVAA 3DSQA 2PMFA 1G5HA 1YFTA 4YCUA 2E5AA 3HFZB 2CGHA 3VBBA 2CJAA 4P74C 2E3CA 4YRTA 4YRSA 3RKXA 3R07A 1BBUA 2EL9A 3V8KA 4Q6GA 4CS4A 1EIYA 1YFSA 3A74A 3NELA 4P3NA 3IKLA 2EWNA 4XU2A 4UP7A 3P8YA 4OLFA 5HGQA 4TVYA 3ICAA 1YGBA 4LVMA 4P72C 3A5ZA 4YP0A 1E22A 3HTZA 3TEGA 4YRMA 1NJ2A 3NEMA 4P3PA 4UP9A 2Q7HA 1WNLA 1X55A 4YRPA 3VQVA 1KMMA 1Z7NA 4LNSA 4ZIBA 4E51A 3I7FA 3TUPA 4YRKA 4AH6A 4H2UA 4WJ3M 4DQ2A 1EFWA 4YRCA 3UH0A 1PYSA 4P75C 2RHQA 4YRNA 2ZINA 2DZCA 2ZCEA 2ARSA 2ZGWA 2J3MA 3BFMA 4CS2A 3TEHB 3REUA 1X2GA 3V7RA 1HTTA 3P8VA 3PCOB 2ZZFA 2ZT5A 1L0WA 1WQWA 2RHSB 1BIBA 4P71C 2P5IA 4CS3A 4TVAB 4P73C 3HRIA 4H2VA 1NYQA 1WU7A 4XU3A 3V8LA 4UPAA 2FYKA 4X5OA 4Q15A 4XTUA 4CH5A 3E9IA 1NNHA 2E1HA 4YRGA 4CH3A 3RKWA 2DDZA 4TWAA 3REXA 4P73A 2CJ9A 2P0LA 1W66A 1USYA 2DTOA 2DXUA 4EO4A 2DKGA 5K1PA 1EIYB 5E3IA 4YRLA 3W3SA 4YCVA 1ATIA 4HWPA 4K88A 1B70A 3HXXA 4KR3A 4H2WA 1RIQA 4YRFA 1EOVA 3VQXA 2DQ3A 1YB3A 3NENA 1EVKA 2ZZEA 4RQEA 3LSSA 2ZT6A 4HWOA 3RACA 1WQ7A 4ZTZB 1N9WA 2AMCA 2DVEA 3QO5A 2G4CA 1PYSB 4YCWA 2RHQB 3RUXA 1H4TA 4XU0A 2DJZA 1SRYA 1G5IA 4KQEA 1SESA 3L4GA 1Z7MA 2DQ0A 4TVWA 4O2DA 3HXWA 2ZT7A 3PZCA 1NYRA 3L2ZA 4XTZA 4XTYA 2DU7A 4ZTUB 2ARUA 3MQZA 2ALYA 5C52B 3RL6A 2ZXFA 4H2TA 1H4VB 3BJUA 2AKWA 2XTIA 4H2XA 4HT4A 4XU1A 2EJGA 4YRRA 2HNIA 4RQFA 4CH6A 1JJCA 4CH4A 3HXUA 3V7SA 1NJ6A 4KR2A 3LC0A 4YPFA 1ADJA 1KMNA 2Q5IA 1EQRA 2ODRD 1KOGA 2CJBA 1B7YA 3MF2A 3QO8A 4LVLA 1B70B 4H2SA 3EFSA 1USYC 4YRQA 3QO7A 3HXVA 4YRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVI A;  4LVM A;  2NS6 A;  4LVL A;  4HT4 A;  4LVK A;  4LVJ A; 
#chains in the Genus database with same CATH topology
 5ELO A;  2DZ9 A;  2Q7E A;  2QHV A;  4HWS A;  3RKY A;  2QHT A;  4TQF A;  3MEY A;  1QE0 A;  3A7R A;  3M4P A;  3HXY A;  4PG3 A;  3RIR A;  4YYE A;  1IL2 A;  2DEQ A;  4NCX A;  5C53 B;  2AMC B;  1HC7 A;  1H4S A;  3IAL A;  4XTX A;  3VQY A;  1X56 A;  2ZIM A;  5K1X A;  2I4N A;  1YFR A;  2ZNI A;  3L4G B;  3WQZ A;  1WPY A;  3L1A A;  1C0A A;  4PHC A;  2QHU A;  3M4Q A;  2I4M A;  3A7U A;  1WYD A;  1B76 A;  2DXT A;  2XGT A;  4K86 A;  4OP0 A;  2ALY B;  4XEM A;  2DTH A;  1E1O A;  2DU5 A;  12AS A;  4HWR A;  3OD1 A;  2ZNJ A;  2AKW B;  1VQZ A;  2J3L A;  3UGQ A;  2IY5 A;  2ZTG A;  2E65 A;  4HWT A;  4H2X B;  4RDX A;  3EFR A;  3G1Z A;  4J15 A;  3UGT A;  3A7A A;  4LVJ A;  1B8A A;  1JJC B;  5KNN A;  2NS6 A;  4BW9 A;  1NJ1 A;  3VQW A;  3A32 A;  2EJF A;  4G84 A;  4P74 A;  2EAY A;  1HXD A;  2I4L A;  3UFG A;  3CMQ A;  4TTV A;  3NET A;  2C8M A;  2EJ9 A;  4G85 A;  1ASY A;  2ART A;  4XEO A;  2A8E A;  3MF1 A;  1B7Y B;  2ZZG A;  2C7I A;  2DTI A;  4YRJ A;  4WF2 A;  3QNE A;  3HXZ A;  3HFZ A;  1GGM A;  3HY1 A;  1BIA A;  1NJ5 A;  1X2H A;  4DPG A;  3E9H A;  2PME A;  2CIM A;  1E1T A;  4P3O A;  4H2Y A;  2QHS A;  4LVI A;  4P72 A;  3RGL A;  1ASZ A;  3A5Y A;  3HY0 A;  1NJ8 A;  2ZIO A;  2Q7G A;  4YRO A;  1FYF A;  4YDQ A;  4WI1 A;  1BBW A;  1J5W A;  2E41 A;  2I4O A;  3P8T A;  3QTC A;  3LSQ A;  5C51 B;  3V8J A;  1LYL A;  4K87 A;  3RF1 A;  3FJP A;  3HRK A;  3IG2 A;  1X54 A;  4P75 A;  4EX5 A;  4TQD A;  4L87 A;  2ZR3 A;  2E64 A;  2E10 A;  1H4Q A;  1X01 A;  4YRE A;  1QF6 A;  3KFU A;  2ZT8 A;  2IY5 B;  3V7C A;  4HA8 A;  4UP8 A;  1WLE A;  4LVK A;  4RMF A;  5ELN A;  3HFV A;  3A31 A;  1G51 A;  4H02 A;  4P71 A;  4BWA A;  1SER A;  2ZR2 A;  1EVL A;  3TEH A;  4WJ4 A;  1ADY A;  5F5W A;  4HVC A;  1SET A;  4XTW A;  3PCO A;  3IKM B;  2ODR C;  1E24 A;  2RHS A;  3ERR A;  4XTV A;  2Q5H A;  11AS A;  4TVA A;  3DSQ A;  2PMF A;  1G5H A;  1YFT A;  4YCU A;  2E5A A;  3HFZ B;  2CGH A;  3VBB A;  2CJA A;  4P74 C;  2E3C A;  4YRT A;  4YRS A;  3RKX A;  3R07 A;  1BBU A;  2EL9 A;  3V8K A;  4Q6G A;  4CS4 A;  1EIY A;  1YFS A;  3A74 A;  3NEL A;  4P3N A;  3IKL A;  2EWN A;  4XU2 A;  4UP7 A;  3P8Y A;  4OLF A;  5HGQ A;  4TVY A;  3ICA A;  1YGB A;  4LVM A;  4P72 C;  3A5Z A;  4YP0 A;  1E22 A;  3HTZ A;  3TEG A;  4YRM A;  1NJ2 A;  3NEM A;  4P3P A;  4UP9 A;  2Q7H A;  1WNL A;  1X55 A;  4YRP A;  3VQV A;  1KMM A;  1Z7N A;  4LNS A;  4ZIB A;  4E51 A;  3I7F A;  3TUP A;  4YRK A;  4AH6 A;  4H2U A;  4WJ3 M;  4DQ2 A;  1EFW A;  4YRC A;  3UH0 A;  1PYS A;  4P75 C;  2RHQ A;  4YRN A;  2ZIN A;  2DZC A;  2ZCE A;  2ARS A;  2ZGW A;  2J3M A;  3BFM A;  4CS2 A;  3TEH B;  3REU A;  1X2G A;  3V7R A;  1HTT A;  3P8V A;  3PCO B;  2ZZF A;  2ZT5 A;  1L0W A;  1WQW A;  2RHS B;  1BIB A;  4P71 C;  2P5I A;  4CS3 A;  4TVA B;  4P73 C;  3HRI A;  4H2V A;  1NYQ A;  1WU7 A;  4XU3 A;  3V8L A;  4UPA A;  2FYK A;  4X5O A;  4Q15 A;  4XTU A;  4CH5 A;  3E9I A;  1NNH A;  2E1H A;  4YRG A;  4CH3 A;  3RKW A;  2DDZ A;  4TWA A;  3REX A;  4P73 A;  2CJ9 A;  2P0L A;  1W66 A;  1USY A;  2DTO A;  2DXU A;  4EO4 A;  2DKG A;  5K1P A;  1EIY B;  5E3I A;  4YRL A;  3W3S A;  4YCV A;  1ATI A;  4HWP A;  4K88 A;  1B70 A;  3HXX A;  4KR3 A;  4H2W A;  1RIQ A;  4YRF A;  1EOV A;  3VQX A;  2DQ3 A;  1YB3 A;  3NEN A;  1EVK A;  2ZZE A;  4RQE A;  3LSS A;  2ZT6 A;  4HWO A;  3RAC A;  1WQ7 A;  4ZTZ B;  1N9W A;  2AMC A;  2DVE A;  3QO5 A;  2G4C A;  1PYS B;  4YCW A;  2RHQ B;  3RUX A;  1H4T A;  4XU0 A;  2DJZ A;  1SRY A;  1G5I A;  4KQE A;  1SES A;  3L4G A;  1Z7M A;  2DQ0 A;  4TVW A;  4O2D A;  3HXW A;  2ZT7 A;  3PZC A;  1NYR A;  3L2Z A;  4XTZ A;  4XTY A;  2DU7 A;  4ZTU B;  2ARU A;  3MQZ A;  2ALY A;  5C52 B;  3RL6 A;  2ZXF A;  4H2T A;  1H4V B;  3BJU A;  2AKW A;  2XTI A;  4H2X A;  4HT4 A;  4XU1 A;  2EJG A;  4YRR A;  2HNI A;  4RQF A;  4CH6 A;  1JJC A;  4CH4 A;  3HXU A;  3V7S A;  1NJ6 A;  4KR2 A;  3LC0 A;  4YPF A;  1ADJ A;  1KMN A;  2Q5I A;  1EQR A;  2ODR D;  1KOG A;  2CJB A;  1B7Y A;  3MF2 A;  3QO8 A;  4LVL A;  1B70 B;  4H2S A;  3EFS A;  1USY C;  4YRQ A;  3QO7 A;  3HXV A;  4YRI A; 
#chains in the Genus database with same CATH homology
 5ELO A;  2DZ9 A;  2Q7E A;  2QHV A;  4HWS A;  3RKY A;  2QHT A;  4TQF A;  3MEY A;  1QE0 A;  3A7R A;  3M4P A;  3HXY A;  4PG3 A;  3RIR A;  4YYE A;  1IL2 A;  2DEQ A;  4NCX A;  5C53 B;  2AMC B;  1HC7 A;  1H4S A;  3IAL A;  4XTX A;  3VQY A;  1X56 A;  2ZIM A;  5K1X A;  2I4N A;  1YFR A;  2ZNI A;  3L4G B;  3WQZ A;  1WPY A;  3L1A A;  1C0A A;  4PHC A;  2QHU A;  3M4Q A;  2I4M A;  3A7U A;  1WYD A;  1B76 A;  2DXT A;  2XGT A;  4K86 A;  4OP0 A;  2ALY B;  4XEM A;  2DTH A;  1E1O A;  2DU5 A;  12AS A;  4HWR A;  3OD1 A;  2ZNJ A;  2AKW B;  1VQZ A;  2J3L A;  3UGQ A;  2IY5 A;  2ZTG A;  2E65 A;  4HWT A;  4H2X B;  4RDX A;  3EFR A;  3G1Z A;  4J15 A;  3UGT A;  3A7A A;  4LVJ A;  1B8A A;  1JJC B;  5KNN A;  2NS6 A;  4BW9 A;  1NJ1 A;  3VQW A;  3A32 A;  2EJF A;  4G84 A;  4P74 A;  2EAY A;  1HXD A;  2I4L A;  3UFG A;  3CMQ A;  4TTV A;  3NET A;  2C8M A;  2EJ9 A;  4G85 A;  1ASY A;  2ART A;  4XEO A;  2A8E A;  3MF1 A;  1B7Y B;  2ZZG A;  2C7I A;  2DTI A;  4YRJ A;  4WF2 A;  3QNE A;  3HXZ A;  3HFZ A;  1GGM A;  3HY1 A;  1BIA A;  1NJ5 A;  1X2H A;  4DPG A;  3E9H A;  2PME A;  2CIM A;  1E1T A;  4P3O A;  4H2Y A;  2QHS A;  4LVI A;  4P72 A;  3RGL A;  1ASZ A;  3A5Y A;  3HY0 A;  1NJ8 A;  2ZIO A;  2Q7G A;  4YRO A;  1FYF A;  4YDQ A;  4WI1 A;  1BBW A;  1J5W A;  2E41 A;  2I4O A;  3P8T A;  3QTC A;  3LSQ A;  5C51 B;  3V8J A;  1LYL A;  4K87 A;  3RF1 A;  3FJP A;  3HRK A;  3IG2 A;  1X54 A;  4P75 A;  4EX5 A;  4TQD A;  4L87 A;  2ZR3 A;  2E64 A;  2E10 A;  1H4Q A;  1X01 A;  4YRE A;  1QF6 A;  3KFU A;  2ZT8 A;  2IY5 B;  3V7C A;  4HA8 A;  4UP8 A;  1WLE A;  4LVK A;  4RMF A;  5ELN A;  3HFV A;  3A31 A;  1G51 A;  4H02 A;  4P71 A;  4BWA A;  1SER A;  2ZR2 A;  1EVL A;  3TEH A;  4WJ4 A;  1ADY A;  5F5W A;  4HVC A;  1SET A;  4XTW A;  3PCO A;  3IKM B;  2ODR C;  1E24 A;  2RHS A;  3ERR A;  4XTV A;  2Q5H A;  11AS A;  4TVA A;  3DSQ A;  2PMF A;  1G5H A;  1YFT A;  4YCU A;  2E5A A;  3HFZ B;  2CGH A;  3VBB A;  2CJA A;  4P74 C;  2E3C A;  4YRT A;  4YRS A;  3RKX A;  3R07 A;  1BBU A;  2EL9 A;  3V8K A;  4Q6G A;  4CS4 A;  1EIY A;  1YFS A;  3A74 A;  3NEL A;  4P3N A;  3IKL A;  2EWN A;  4XU2 A;  4UP7 A;  3P8Y A;  4OLF A;  5HGQ A;  4TVY A;  3ICA A;  1YGB A;  4LVM A;  4P72 C;  3A5Z A;  4YP0 A;  1E22 A;  3HTZ A;  3TEG A;  4YRM A;  1NJ2 A;  3NEM A;  4P3P A;  4UP9 A;  2Q7H A;  1WNL A;  1X55 A;  4YRP A;  3VQV A;  1KMM A;  1Z7N A;  4LNS A;  4ZIB A;  4E51 A;  3I7F A;  3TUP A;  4YRK A;  4AH6 A;  4H2U A;  4WJ3 M;  4DQ2 A;  1EFW A;  4YRC A;  3UH0 A;  1PYS A;  4P75 C;  2RHQ A;  4YRN A;  2ZIN A;  2DZC A;  2ZCE A;  2ARS A;  2ZGW A;  2J3M A;  3BFM A;  4CS2 A;  3TEH B;  3REU A;  1X2G A;  3V7R A;  1HTT A;  3P8V A;  3PCO B;  2ZZF A;  2ZT5 A;  1L0W A;  1WQW A;  2RHS B;  1BIB A;  4P71 C;  2P5I A;  4CS3 A;  4TVA B;  4P73 C;  3HRI A;  4H2V A;  1NYQ A;  1WU7 A;  4XU3 A;  3V8L A;  4UPA A;  2FYK A;  4X5O A;  4Q15 A;  4XTU A;  4CH5 A;  3E9I A;  1NNH A;  2E1H A;  4YRG A;  4CH3 A;  3RKW A;  2DDZ A;  4TWA A;  3REX A;  4P73 A;  2CJ9 A;  2P0L A;  1W66 A;  1USY A;  2DTO A;  2DXU A;  4EO4 A;  2DKG A;  5K1P A;  1EIY B;  5E3I A;  4YRL A;  3W3S A;  4YCV A;  1ATI A;  4HWP A;  4K88 A;  1B70 A;  3HXX A;  4KR3 A;  4H2W A;  1RIQ A;  4YRF A;  1EOV A;  3VQX A;  2DQ3 A;  1YB3 A;  3NEN A;  1EVK A;  2ZZE A;  4RQE A;  3LSS A;  2ZT6 A;  4HWO A;  3RAC A;  1WQ7 A;  4ZTZ B;  1N9W A;  2AMC A;  2DVE A;  3QO5 A;  2G4C A;  1PYS B;  4YCW A;  2RHQ B;  3RUX A;  1H4T A;  4XU0 A;  2DJZ A;  1SRY A;  1G5I A;  4KQE A;  1SES A;  3L4G A;  1Z7M A;  2DQ0 A;  4TVW A;  4O2D A;  3HXW A;  2ZT7 A;  3PZC A;  1NYR A;  3L2Z A;  4XTZ A;  4XTY A;  2DU7 A;  4ZTU B;  2ARU A;  3MQZ A;  2ALY A;  5C52 B;  3RL6 A;  2ZXF A;  4H2T A;  1H4V B;  3BJU A;  2AKW A;  2XTI A;  4H2X A;  4HT4 A;  4XU1 A;  2EJG A;  4YRR A;  2HNI A;  4RQF A;  4CH6 A;  1JJC A;  4CH4 A;  3HXU A;  3V7S A;  1NJ6 A;  4KR2 A;  3LC0 A;  4YPF A;  1ADJ A;  1KMN A;  2Q5I A;  1EQR A;  2ODR D;  1KOG A;  2CJB A;  1B7Y A;  3MF2 A;  3QO8 A;  4LVL A;  1B70 B;  4H2S A;  3EFS A;  1USY C;  4YRQ A;  3QO7 A;  3HXV A;  4YRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...