4LVIA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt). mn-bound crystal structure at ph 4.6
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
190
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid recombination enzyme
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
total genus 60
structure length 190
sequence length 194
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lviA01
4HT4A 4LVJA 2NS6A 4LVMA 4LVIA 4LVLA 4LVKA
chains in the Genus database with same CATH superfamily
1RIQA 1QF6A 4P72C 1YGBA 1NYQA 1USYC 4YRNA 1B76A 3RACA 2CGHA 1NJ1A 2DTIA 2ODRC 3VQWA 1IL2A 11ASA 4TQDA 2ZZGA 2DU5A 2DQ3A 4YCWA 4YRFA 2PMEA 2EL9A 4XTYA 4DPGA 3VQYA 1NNHA 4OLFA 2J3LA 1LYLA 1X56A 2ALYB 4LVMA 3E9IA 2AMCB 1PYSA 4NCXA 2CIMA 4P75A 4XEMA 3HFZB 3NELA 1FYFA 4LVKA 3REUA 3RGLA 3RKWA 1GGMA 2ZGWA 2DTHA 3A7UA 2RHQA 4UP7A 4LVIA 4BWAA 2E5AA 5K1PA 3A5YA 4P72A 1ASYA 3VQVA 4HWSA 1USYA 4YRLA 1ASZA 2I4LA 4J15A 4YRSA 3HXUA 1B70B 2DXUA 3VQXA 1B7YB 2ZIMA 1C0AA 4KR3A 3UGTA 5E3IA 4H2YA 3IKLA 4TVAA 4HT4A 3EFSA 5ELNA 1SESA 1NJ6A 2ZT8A 4CH6A 4YCVA 3TUPA 1G5HA 4KR2A 2I4OA 4YYEA 3NETA 3PCOA 2ALYA 3QNEA 2E65A 4P3PA 2C7IA 3RL6A 4CH3A 2ZT6A 3QO8A 4EX5A 1Z7NA 3MQZA 4OP0A 1W66A 1X01A 4TVWA 2AKWB 3OD1A 3P8VA 3E9HA 4RQEA 1WYDA 2Q7EA 2XTIA 4YRCA 4P74C 4PG3A 3TEHB 2ZT7A 1HXDA 1H4TA 1EIYA 2ARTA 2ZNJA 4H02A 4PHCA 4P73C 1B70A 1X2GA 3DSQA 1KOGA 3WQZA 2DKGA 2DQ0A 5F5WA 4Q15A 4Q6GA 4YROA 1WNLA 3M4PA 3A32A 2EJ9A 4YREA 3M4QA 4E51A 1X55A 1Z7MA 1E22A 3A31A 4YRMA 2E41A 1EFWA 4L87A 4XTUA 3UH0A 1KMMA 3HXZA 3RUXA 2Q5HA 2ARSA 4XTXA 1X54A 1QE0A 4K86A 3PZCA 2IY5B 2CJ9A 4HA8A 3LC0A 1BIBA 1HC7A 2EJGA 3A5ZA 1WQ7A 4WJ4A 3I7FA 1EVLA 4P74A 2ZNIA 4ZTZB 1E24A 1SRYA 2DEQA 1B8AA 2NS6A 4P73A 2XGTA 2AKWA 3REXA 3L4GA 2E64A 2QHUA 2RHSB 2ZIOA 4LVLA 4EO4A 1BBWA 2PMFA 3LSSA 3MF1A 4H2UA 4UPAA 1WU7A 4RMFA 3RF1A 4XU3A 4CS4A 1BBUA 3P8YA 4YRIA 4O2DA 1JJCB 1EVKA 2CJBA 4ZIBA 1KMNA 2EAYA 1ADJA 3HTZA 2DJZA 2ODRD 3FJPA 1H4VB 3W3SA 4CS2A 3NENA 2ZXFA 4YRKA 2QHVA 1SERA 3QO5A 3L1AA 3HY1A 1G5IA 4AH6A 2ARUA 5K1XA 4XU0A 2DDZA 4CH5A 3CMQA 4ZTUB 2IY5A 2AMCA 4YDQA 4XEOA 2J3MA 3HFZA 5C53B 3BJUA 4XU1A 1E1TA 4P71C 3KFUA 3IKMB 3P8TA 1WQWA 1PYSB 2DXTA 3HY0A 4H2XB 1SETA 4BW9A 1E1OA 1NJ8A 1ATIA 2E1HA 4P3OA 2ZZEA 3A7AA 3HRKA 2P5IA 4YRPA 1YFTA 4HVCA 1WPYA 3V7SA 1EOVA 1B7YA 4YRJA 2Q5IA 4G85A 4WF2A 1BIAA 4CH4A 3ICAA 4YRQA 3G1ZA 4P3NA 4RQFA 2E3CA 2DTOA 2A8EA 3L2ZA 4YRGA 2I4MA 1L0WA 4HWOA 1NJ2A 3QO7A 1HTTA 3V8KA 3TEGA 4TVAB 4YP0A 2P0LA 4P71A 4HWTA 4TTVA 3UGQA 3VBBA 1VQZA 3A7RA 3R07A 2DVEA 1H4SA 1J5WA 3HXWA 1NYRA 1G51A 4K88A 2C8MA 2I4NA 1YFSA 4K87A 3PCOB 4X5OA 4RDXA 3RIRA 4WJ3M 4TWAA 3HXXA 2QHTA 4H2WA 2ZINA 4HWPA 1ADYA 4H2XA 2Q7HA 3TEHA 1H4QA 3RKYA 2ZTGA 3HXYA 4UP8A 2DZCA 5HGQA 4XTWA 2EJFA 3V7RA 4H2SA 3HXVA 1EQRA 4WI1A 1EIYB 3IALA 5ELOA 3IG2A 3HRIA 4G84A 3LSQA 2G4CA 1NJ5A 3V7CA 4YRTA 5C52B 3V8LA 4DQ2A 5KNNA 4YRRA 12ASA 2ZT5A 4LNSA 1YB3A 3MEYA 4XTZA 3NEMA 3A74A 2CJAA 2FYKA 2DU7A 4XTVA 4YCUA 3V8JA 1X2HA 2HNIA 4HWRA 2QHSA 3QTCA 4TQFA 2Q7GA 3BFMA 4LVJA 3ERRA 3HFVA 4TVYA 2RHSA 2ZZFA 2EWNA 1YFRA 3RKXA 4CS3A 2E10A 2RHQB 1WLEA 2ZR3A 5C51B 4H2TA 4H2VA 4UP9A 2ZR2A 4P75C 3L4GB 3MF2A 4KQEA 4XU2A 1N9WA 4YPFA 1JJCA 3EFRA 2DZ9A 3UFGA 2ZCEA
chains in the Genus database with same CATH topology
1RIQA 1QF6A 4P72C 1YGBA 1NYQA 1USYC 4YRNA 1B76A 3RACA 2CGHA 1NJ1A 2DTIA 2ODRC 3VQWA 1IL2A 11ASA 4TQDA 2ZZGA 2DU5A 2DQ3A 4YCWA 4YRFA 2PMEA 2EL9A 4XTYA 4DPGA 3VQYA 1NNHA 4OLFA 2J3LA 1LYLA 1X56A 2ALYB 4LVMA 3E9IA 2AMCB 1PYSA 4NCXA 2CIMA 4P75A 4XEMA 3HFZB 3NELA 1FYFA 4LVKA 3REUA 3RGLA 3RKWA 1GGMA 2ZGWA 2DTHA 3A7UA 2RHQA 4UP7A 4LVIA 4BWAA 2E5AA 5K1PA 3A5YA 4P72A 1ASYA 3VQVA 4HWSA 1USYA 4YRLA 1ASZA 2I4LA 4J15A 4YRSA 3HXUA 1B70B 2DXUA 3VQXA 1B7YB 2ZIMA 1C0AA 4KR3A 3UGTA 5E3IA 4H2YA 3IKLA 4TVAA 4HT4A 3EFSA 5ELNA 1SESA 1NJ6A 2ZT8A 4CH6A 4YCVA 3TUPA 1G5HA 4KR2A 2I4OA 4YYEA 3NETA 3PCOA 2ALYA 3QNEA 2E65A 4P3PA 2C7IA 3RL6A 4CH3A 2ZT6A 3QO8A 4EX5A 1Z7NA 3MQZA 4OP0A 1W66A 1X01A 4TVWA 2AKWB 3OD1A 3P8VA 3E9HA 4RQEA 1WYDA 2Q7EA 2XTIA 4YRCA 4P74C 4PG3A 3TEHB 2ZT7A 1HXDA 1H4TA 1EIYA 2ARTA 2ZNJA 4H02A 4PHCA 4P73C 1B70A 1X2GA 3DSQA 1KOGA 3WQZA 2DKGA 2DQ0A 5F5WA 4Q15A 4Q6GA 4YROA 1WNLA 3M4PA 3A32A 2EJ9A 4YREA 3M4QA 4E51A 1X55A 1Z7MA 1E22A 3A31A 4YRMA 2E41A 1EFWA 4L87A 4XTUA 3UH0A 1KMMA 3HXZA 3RUXA 2Q5HA 2ARSA 4XTXA 1X54A 1QE0A 4K86A 3PZCA 2IY5B 2CJ9A 4HA8A 3LC0A 1BIBA 1HC7A 2EJGA 3A5ZA 1WQ7A 4WJ4A 3I7FA 1EVLA 4P74A 2ZNIA 4ZTZB 1E24A 1SRYA 2DEQA 1B8AA 2NS6A 4P73A 2XGTA 2AKWA 3REXA 3L4GA 2E64A 2QHUA 2RHSB 2ZIOA 4LVLA 4EO4A 1BBWA 2PMFA 3LSSA 3MF1A 4H2UA 4UPAA 1WU7A 4RMFA 3RF1A 4XU3A 4CS4A 1BBUA 3P8YA 4YRIA 4O2DA 1JJCB 1EVKA 2CJBA 4ZIBA 1KMNA 2EAYA 1ADJA 3HTZA 2DJZA 2ODRD 3FJPA 1H4VB 3W3SA 4CS2A 3NENA 2ZXFA 4YRKA 2QHVA 1SERA 3QO5A 3L1AA 3HY1A 1G5IA 4AH6A 2ARUA 5K1XA 4XU0A 2DDZA 4CH5A 3CMQA 4ZTUB 2IY5A 2AMCA 4YDQA 4XEOA 2J3MA 3HFZA 5C53B 3BJUA 4XU1A 1E1TA 4P71C 3KFUA 3IKMB 3P8TA 1WQWA 1PYSB 2DXTA 3HY0A 4H2XB 1SETA 4BW9A 1E1OA 1NJ8A 1ATIA 2E1HA 4P3OA 2ZZEA 3A7AA 3HRKA 2P5IA 4YRPA 1YFTA 4HVCA 1WPYA 3V7SA 1EOVA 1B7YA 4YRJA 2Q5IA 4G85A 4WF2A 1BIAA 4CH4A 3ICAA 4YRQA 3G1ZA 4P3NA 4RQFA 2E3CA 2DTOA 2A8EA 3L2ZA 4YRGA 2I4MA 1L0WA 4HWOA 1NJ2A 3QO7A 1HTTA 3V8KA 3TEGA 4TVAB 4YP0A 2P0LA 4P71A 4HWTA 4TTVA 3UGQA 3VBBA 1VQZA 3A7RA 3R07A 2DVEA 1H4SA 1J5WA 3HXWA 1NYRA 1G51A 4K88A 2C8MA 2I4NA 1YFSA 4K87A 3PCOB 4X5OA 4RDXA 3RIRA 4WJ3M 4TWAA 3HXXA 2QHTA 4H2WA 2ZINA 4HWPA 1ADYA 4H2XA 2Q7HA 3TEHA 1H4QA 3RKYA 2ZTGA 3HXYA 4UP8A 2DZCA 5HGQA 4XTWA 2EJFA 3V7RA 4H2SA 3HXVA 1EQRA 4WI1A 1EIYB 3IALA 5ELOA 3IG2A 3HRIA 4G84A 3LSQA 2G4CA 1NJ5A 3V7CA 4YRTA 5C52B 3V8LA 4DQ2A 5KNNA 4YRRA 12ASA 2ZT5A 4LNSA 1YB3A 3MEYA 4XTZA 3NEMA 3A74A 2CJAA 2FYKA 2DU7A 4XTVA 4YCUA 3V8JA 1X2HA 2HNIA 4HWRA 2QHSA 3QTCA 4TQFA 2Q7GA 3BFMA 4LVJA 3ERRA 3HFVA 4TVYA 2RHSA 2ZZFA 2EWNA 1YFRA 3RKXA 4CS3A 2E10A 2RHQB 1WLEA 2ZR3A 5C51B 4H2TA 4H2VA 4UP9A 2ZR2A 4P75C 3L4GB 3MF2A 4KQEA 4XU2A 1N9WA 4YPFA 1JJCA 3EFRA 2DZ9A 3UFGA 2ZCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HT4 A;  4LVJ A;  2NS6 A;  4LVM A;  4LVI A;  4LVL A;  4LVK A; 
#chains in the Genus database with same CATH topology
 1RIQ A;  1QF6 A;  4P72 C;  1YGB A;  1NYQ A;  1USY C;  4YRN A;  1B76 A;  3RAC A;  2CGH A;  1NJ1 A;  2DTI A;  2ODR C;  3VQW A;  1IL2 A;  11AS A;  4TQD A;  2ZZG A;  2DU5 A;  2DQ3 A;  4YCW A;  4YRF A;  2PME A;  2EL9 A;  4XTY A;  4DPG A;  3VQY A;  1NNH A;  4OLF A;  2J3L A;  1LYL A;  1X56 A;  2ALY B;  4LVM A;  3E9I A;  2AMC B;  1PYS A;  4NCX A;  2CIM A;  4P75 A;  4XEM A;  3HFZ B;  3NEL A;  1FYF A;  4LVK A;  3REU A;  3RGL A;  3RKW A;  1GGM A;  2ZGW A;  2DTH A;  3A7U A;  2RHQ A;  4UP7 A;  4LVI A;  4BWA A;  2E5A A;  5K1P A;  3A5Y A;  4P72 A;  1ASY A;  3VQV A;  4HWS A;  1USY A;  4YRL A;  1ASZ A;  2I4L A;  4J15 A;  4YRS A;  3HXU A;  1B70 B;  2DXU A;  3VQX A;  1B7Y B;  2ZIM A;  1C0A A;  4KR3 A;  3UGT A;  5E3I A;  4H2Y A;  3IKL A;  4TVA A;  4HT4 A;  3EFS A;  5ELN A;  1SES A;  1NJ6 A;  2ZT8 A;  4CH6 A;  4YCV A;  3TUP A;  1G5H A;  4KR2 A;  2I4O A;  4YYE A;  3NET A;  3PCO A;  2ALY A;  3QNE A;  2E65 A;  4P3P A;  2C7I A;  3RL6 A;  4CH3 A;  2ZT6 A;  3QO8 A;  4EX5 A;  1Z7N A;  3MQZ A;  4OP0 A;  1W66 A;  1X01 A;  4TVW A;  2AKW B;  3OD1 A;  3P8V A;  3E9H A;  4RQE A;  1WYD A;  2Q7E A;  2XTI A;  4YRC A;  4P74 C;  4PG3 A;  3TEH B;  2ZT7 A;  1HXD A;  1H4T A;  1EIY A;  2ART A;  2ZNJ A;  4H02 A;  4PHC A;  4P73 C;  1B70 A;  1X2G A;  3DSQ A;  1KOG A;  3WQZ A;  2DKG A;  2DQ0 A;  5F5W A;  4Q15 A;  4Q6G A;  4YRO A;  1WNL A;  3M4P A;  3A32 A;  2EJ9 A;  4YRE A;  3M4Q A;  4E51 A;  1X55 A;  1Z7M A;  1E22 A;  3A31 A;  4YRM A;  2E41 A;  1EFW A;  4L87 A;  4XTU A;  3UH0 A;  1KMM A;  3HXZ A;  3RUX A;  2Q5H A;  2ARS A;  4XTX A;  1X54 A;  1QE0 A;  4K86 A;  3PZC A;  2IY5 B;  2CJ9 A;  4HA8 A;  3LC0 A;  1BIB A;  1HC7 A;  2EJG A;  3A5Z A;  1WQ7 A;  4WJ4 A;  3I7F A;  1EVL A;  4P74 A;  2ZNI A;  4ZTZ B;  1E24 A;  1SRY A;  2DEQ A;  1B8A A;  2NS6 A;  4P73 A;  2XGT A;  2AKW A;  3REX A;  3L4G A;  2E64 A;  2QHU A;  2RHS B;  2ZIO A;  4LVL A;  4EO4 A;  1BBW A;  2PMF A;  3LSS A;  3MF1 A;  4H2U A;  4UPA A;  1WU7 A;  4RMF A;  3RF1 A;  4XU3 A;  4CS4 A;  1BBU A;  3P8Y A;  4YRI A;  4O2D A;  1JJC B;  1EVK A;  2CJB A;  4ZIB A;  1KMN A;  2EAY A;  1ADJ A;  3HTZ A;  2DJZ A;  2ODR D;  3FJP A;  1H4V B;  3W3S A;  4CS2 A;  3NEN A;  2ZXF A;  4YRK A;  2QHV A;  1SER A;  3QO5 A;  3L1A A;  3HY1 A;  1G5I A;  4AH6 A;  2ARU A;  5K1X A;  4XU0 A;  2DDZ A;  4CH5 A;  3CMQ A;  4ZTU B;  2IY5 A;  2AMC A;  4YDQ A;  4XEO A;  2J3M A;  3HFZ A;  5C53 B;  3BJU A;  4XU1 A;  1E1T A;  4P71 C;  3KFU A;  3IKM B;  3P8T A;  1WQW A;  1PYS B;  2DXT A;  3HY0 A;  4H2X B;  1SET A;  4BW9 A;  1E1O A;  1NJ8 A;  1ATI A;  2E1H A;  4P3O A;  2ZZE A;  3A7A A;  3HRK A;  2P5I A;  4YRP A;  1YFT A;  4HVC A;  1WPY A;  3V7S A;  1EOV A;  1B7Y A;  4YRJ A;  2Q5I A;  4G85 A;  4WF2 A;  1BIA A;  4CH4 A;  3ICA A;  4YRQ A;  3G1Z A;  4P3N A;  4RQF A;  2E3C A;  2DTO A;  2A8E A;  3L2Z A;  4YRG A;  2I4M A;  1L0W A;  4HWO A;  1NJ2 A;  3QO7 A;  1HTT A;  3V8K A;  3TEG A;  4TVA B;  4YP0 A;  2P0L A;  4P71 A;  4HWT A;  4TTV A;  3UGQ A;  3VBB A;  1VQZ A;  3A7R A;  3R07 A;  2DVE A;  1H4S A;  1J5W A;  3HXW A;  1NYR A;  1G51 A;  4K88 A;  2C8M A;  2I4N A;  1YFS A;  4K87 A;  3PCO B;  4X5O A;  4RDX A;  3RIR A;  4WJ3 M;  4TWA A;  3HXX A;  2QHT A;  4H2W A;  2ZIN A;  4HWP A;  1ADY A;  4H2X A;  2Q7H A;  3TEH A;  1H4Q A;  3RKY A;  2ZTG A;  3HXY A;  4UP8 A;  2DZC A;  5HGQ A;  4XTW A;  2EJF A;  3V7R A;  4H2S A;  3HXV A;  1EQR A;  4WI1 A;  1EIY B;  3IAL A;  5ELO A;  3IG2 A;  3HRI A;  4G84 A;  3LSQ A;  2G4C A;  1NJ5 A;  3V7C A;  4YRT A;  5C52 B;  3V8L A;  4DQ2 A;  5KNN A;  4YRR A;  12AS A;  2ZT5 A;  4LNS A;  1YB3 A;  3MEY A;  4XTZ A;  3NEM A;  3A74 A;  2CJA A;  2FYK A;  2DU7 A;  4XTV A;  4YCU A;  3V8J A;  1X2H A;  2HNI A;  4HWR A;  2QHS A;  3QTC A;  4TQF A;  2Q7G A;  3BFM A;  4LVJ A;  3ERR A;  3HFV A;  4TVY A;  2RHS A;  2ZZF A;  2EWN A;  1YFR A;  3RKX A;  4CS3 A;  2E10 A;  2RHQ B;  1WLE A;  2ZR3 A;  5C51 B;  4H2T A;  4H2V A;  4UP9 A;  2ZR2 A;  4P75 C;  3L4G B;  3MF2 A;  4KQE A;  4XU2 A;  1N9W A;  4YPF A;  1JJC A;  3EFR A;  2DZ9 A;  3UFG A;  2ZCE A; 
#chains in the Genus database with same CATH homology
 1RIQ A;  1QF6 A;  4P72 C;  1YGB A;  1NYQ A;  1USY C;  4YRN A;  1B76 A;  3RAC A;  2CGH A;  1NJ1 A;  2DTI A;  2ODR C;  3VQW A;  1IL2 A;  11AS A;  4TQD A;  2ZZG A;  2DU5 A;  2DQ3 A;  4YCW A;  4YRF A;  2PME A;  2EL9 A;  4XTY A;  4DPG A;  3VQY A;  1NNH A;  4OLF A;  2J3L A;  1LYL A;  1X56 A;  2ALY B;  4LVM A;  3E9I A;  2AMC B;  1PYS A;  4NCX A;  2CIM A;  4P75 A;  4XEM A;  3HFZ B;  3NEL A;  1FYF A;  4LVK A;  3REU A;  3RGL A;  3RKW A;  1GGM A;  2ZGW A;  2DTH A;  3A7U A;  2RHQ A;  4UP7 A;  4LVI A;  4BWA A;  2E5A A;  5K1P A;  3A5Y A;  4P72 A;  1ASY A;  3VQV A;  4HWS A;  1USY A;  4YRL A;  1ASZ A;  2I4L A;  4J15 A;  4YRS A;  3HXU A;  1B70 B;  2DXU A;  3VQX A;  1B7Y B;  2ZIM A;  1C0A A;  4KR3 A;  3UGT A;  5E3I A;  4H2Y A;  3IKL A;  4TVA A;  4HT4 A;  3EFS A;  5ELN A;  1SES A;  1NJ6 A;  2ZT8 A;  4CH6 A;  4YCV A;  3TUP A;  1G5H A;  4KR2 A;  2I4O A;  4YYE A;  3NET A;  3PCO A;  2ALY A;  3QNE A;  2E65 A;  4P3P A;  2C7I A;  3RL6 A;  4CH3 A;  2ZT6 A;  3QO8 A;  4EX5 A;  1Z7N A;  3MQZ A;  4OP0 A;  1W66 A;  1X01 A;  4TVW A;  2AKW B;  3OD1 A;  3P8V A;  3E9H A;  4RQE A;  1WYD A;  2Q7E A;  2XTI A;  4YRC A;  4P74 C;  4PG3 A;  3TEH B;  2ZT7 A;  1HXD A;  1H4T A;  1EIY A;  2ART A;  2ZNJ A;  4H02 A;  4PHC A;  4P73 C;  1B70 A;  1X2G A;  3DSQ A;  1KOG A;  3WQZ A;  2DKG A;  2DQ0 A;  5F5W A;  4Q15 A;  4Q6G A;  4YRO A;  1WNL A;  3M4P A;  3A32 A;  2EJ9 A;  4YRE A;  3M4Q A;  4E51 A;  1X55 A;  1Z7M A;  1E22 A;  3A31 A;  4YRM A;  2E41 A;  1EFW A;  4L87 A;  4XTU A;  3UH0 A;  1KMM A;  3HXZ A;  3RUX A;  2Q5H A;  2ARS A;  4XTX A;  1X54 A;  1QE0 A;  4K86 A;  3PZC A;  2IY5 B;  2CJ9 A;  4HA8 A;  3LC0 A;  1BIB A;  1HC7 A;  2EJG A;  3A5Z A;  1WQ7 A;  4WJ4 A;  3I7F A;  1EVL A;  4P74 A;  2ZNI A;  4ZTZ B;  1E24 A;  1SRY A;  2DEQ A;  1B8A A;  2NS6 A;  4P73 A;  2XGT A;  2AKW A;  3REX A;  3L4G A;  2E64 A;  2QHU A;  2RHS B;  2ZIO A;  4LVL A;  4EO4 A;  1BBW A;  2PMF A;  3LSS A;  3MF1 A;  4H2U A;  4UPA A;  1WU7 A;  4RMF A;  3RF1 A;  4XU3 A;  4CS4 A;  1BBU A;  3P8Y A;  4YRI A;  4O2D A;  1JJC B;  1EVK A;  2CJB A;  4ZIB A;  1KMN A;  2EAY A;  1ADJ A;  3HTZ A;  2DJZ A;  2ODR D;  3FJP A;  1H4V B;  3W3S A;  4CS2 A;  3NEN A;  2ZXF A;  4YRK A;  2QHV A;  1SER A;  3QO5 A;  3L1A A;  3HY1 A;  1G5I A;  4AH6 A;  2ARU A;  5K1X A;  4XU0 A;  2DDZ A;  4CH5 A;  3CMQ A;  4ZTU B;  2IY5 A;  2AMC A;  4YDQ A;  4XEO A;  2J3M A;  3HFZ A;  5C53 B;  3BJU A;  4XU1 A;  1E1T A;  4P71 C;  3KFU A;  3IKM B;  3P8T A;  1WQW A;  1PYS B;  2DXT A;  3HY0 A;  4H2X B;  1SET A;  4BW9 A;  1E1O A;  1NJ8 A;  1ATI A;  2E1H A;  4P3O A;  2ZZE A;  3A7A A;  3HRK A;  2P5I A;  4YRP A;  1YFT A;  4HVC A;  1WPY A;  3V7S A;  1EOV A;  1B7Y A;  4YRJ A;  2Q5I A;  4G85 A;  4WF2 A;  1BIA A;  4CH4 A;  3ICA A;  4YRQ A;  3G1Z A;  4P3N A;  4RQF A;  2E3C A;  2DTO A;  2A8E A;  3L2Z A;  4YRG A;  2I4M A;  1L0W A;  4HWO A;  1NJ2 A;  3QO7 A;  1HTT A;  3V8K A;  3TEG A;  4TVA B;  4YP0 A;  2P0L A;  4P71 A;  4HWT A;  4TTV A;  3UGQ A;  3VBB A;  1VQZ A;  3A7R A;  3R07 A;  2DVE A;  1H4S A;  1J5W A;  3HXW A;  1NYR A;  1G51 A;  4K88 A;  2C8M A;  2I4N A;  1YFS A;  4K87 A;  3PCO B;  4X5O A;  4RDX A;  3RIR A;  4WJ3 M;  4TWA A;  3HXX A;  2QHT A;  4H2W A;  2ZIN A;  4HWP A;  1ADY A;  4H2X A;  2Q7H A;  3TEH A;  1H4Q A;  3RKY A;  2ZTG A;  3HXY A;  4UP8 A;  2DZC A;  5HGQ A;  4XTW A;  2EJF A;  3V7R A;  4H2S A;  3HXV A;  1EQR A;  4WI1 A;  1EIY B;  3IAL A;  5ELO A;  3IG2 A;  3HRI A;  4G84 A;  3LSQ A;  2G4C A;  1NJ5 A;  3V7C A;  4YRT A;  5C52 B;  3V8L A;  4DQ2 A;  5KNN A;  4YRR A;  12AS A;  2ZT5 A;  4LNS A;  1YB3 A;  3MEY A;  4XTZ A;  3NEM A;  3A74 A;  2CJA A;  2FYK A;  2DU7 A;  4XTV A;  4YCU A;  3V8J A;  1X2H A;  2HNI A;  4HWR A;  2QHS A;  3QTC A;  4TQF A;  2Q7G A;  3BFM A;  4LVJ A;  3ERR A;  3HFV A;  4TVY A;  2RHS A;  2ZZF A;  2EWN A;  1YFR A;  3RKX A;  4CS3 A;  2E10 A;  2RHQ B;  1WLE A;  2ZR3 A;  5C51 B;  4H2T A;  4H2V A;  4UP9 A;  2ZR2 A;  4P75 C;  3L4G B;  3MF2 A;  4KQE A;  4XU2 A;  1N9W A;  4YPF A;  1JJC A;  3EFR A;  2DZ9 A;  3UFG A;  2ZCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...