4LVIA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt). mn-bound crystal structure at ph 4.6
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
190
Chain Sequence
b'SYMVARMQKMKAGNLGGAFKHNERVSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid recombination enzyme
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
total genus 60
structure length 190
sequence length 194
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lviA01
4LVKA 4LVLA 2NS6A 4LVJA 4LVMA 4LVIA 4HT4A
chains in the Genus database with same CATH superfamily
1FYFA 4CH4A 2IY5B 2ODRC 3VQWA 3RKYA 3L4GB 3MQZA 2DKGA 3HXVA 4Q6GA 2QHUA 2IY5A 2HNIA 1SRYA 1B7YB 2RHSB 2ODRD 3KFUA 3L4GA 4DPGA 5K1PA 3MF1A 4RQEA 3V7SA 2EJFA 3A32A 2DXUA 2P0LA 2RHQB 1B7YA 2RHSA 1H4VB 2DDZA 3E9IA 1YFTA 3V7RA 4KR3A 2E41A 5KNNA 4YREA 2RHQA 4H2VA 2FYKA 3QO5A 2J3LA 4YCWA 2ZIMA 4TWAA 3P8YA 5C51B 2Q5HA 1NJ2A 3HTZA 1ATIA 3HFVA 1ASYA 2ZTGA 2J3MA 4CH5A 1Z7NA 3RIRA 1YFSA 1PYSB 4UP9A 4LVJA 1KMMA 2DEQA 2I4MA 2XGTA 4XTUA 4RQFA 1KMNA 4H2SA 2Q7EA 1PYSA 2ALYB 4P75A 4YDQA 1BBUA 4P74A 1USYA 1X01A 4YRSA 3RL6A 3UGQA 4DQ2A 3HXXA 2ALYA 2I4NA 3DSQA 4LVLA 3V7CA 4LVMA 3REXA 1IL2A 3NELA 3PZCA 2PMFA 3MF2A 4ZTZB 2E64A 4RDXA 2EJ9A 3BFMA 3ERRA 2ZXFA 4XEOA 2ZT6A 4H2UA 4EX5A 1W66A 1H4TA 1ADJA 3QO8A 4LVKA 1X55A 4KR2A 1WU7A 3CMQA 4UPAA 4H2WA 4CH6A 2EJGA 4XTWA 5F5WA 4G84A 1B76A 3VQVA 2E65A 2EL9A 2DTHA 4HWRA 4XTXA 2ZINA 4HA8A 4XTVA 3ICAA 2DZCA 1L0WA 4TVYA 3BJUA 4YRNA 3A7RA 4UP8A 4P3PA 3FJPA 4P73A 5C53B 3A74A 1WQWA 2DZ9A 3A7AA 2DQ0A 3I7FA 1JJCB 3RKXA 1X2GA 2ZR3A 1X2HA 4NCXA 4TTVA 1Z7MA 1EOVA 1G51A 1HTTA 1JJCA 2ZZFA 1WQ7A 2DU7A 1G5HA 2QHVA 2ARSA 1BBWA 3M4PA 1QF6A 4J15A 1YFRA 5C52B 2QHTA 4TQFA 2AMCB 4TVAB 2NS6A 1B8AA 1ADYA 1NJ6A 4UP7A 2DVEA 4YCUA 3V8JA 1NJ5A 2ZT8A 11ASA 1B70B 4WJ3M 1LYLA 1RIQA 2AMCA 4P71C 4TVAA 4HWPA 4HWSA 12ASA 3RUXA 1VQZA 3V8LA 2ZT7A 2CJ9A 3QNEA 1C0AA 3IKMB 2XTIA 1B70A 2DXTA 3L2ZA 1H4SA 3HY0A 1QE0A 1EQRA 3UFGA 3A5ZA 4LVIA 5E3IA 2DQ3A 2C8MA 2CJBA 3RACA 3LC0A 3UH0A 3EFSA 4YRJA 2AKWB 5K1XA 1USYC 2C7IA 3HXUA 4YRIA 1SERA 4WJ4A 3L1AA 2ARUA 2AKWA 4YPFA 1NNHA 4XTYA 3A5YA 3VQXA 1E22A 2DU5A 1NJ8A 2I4LA 2CIMA 4CS4A 4CS3A 4YRKA 4TQDA 4OP0A 4BWAA 1E1OA 2Q5IA 2DTOA 4K88A 4P72A 2E3CA 4YRPA 3VQYA 2ZR2A 3LSQA 1ASZA 1SETA 4BW9A 3WQZA 3HY1A 4H2XB 1WYDA 2PMEA 2ZGWA 4XU3A 4PHCA 4CH3A 3HRKA 1E24A 4YRMA 1SESA 4P3NA 2ZNJA 4EO4A 3IALA 2Q7HA 3HXYA 3HFZB 4RMFA 3QTCA 4YRCA 3TUPA 4H2XA 1EIYB 2E5AA 4ZTUB 3QO7A 3E9HA 1NYQA 3NEMA 4K86A 4HWTA 1E1TA 3M4QA 3HFZA 4YRLA 1EIYA 1BIAA 4XU2A 3RGLA 1NYRA 2ZIOA 4P73C 4YRTA 4CS2A 1HXDA 2ZCEA 4P3OA 3UGTA 2ZNIA 2ZZGA 1YB3A 5HGQA 3A31A 4YROA 3TEHB 3OD1A 4YRRA 2EWNA 4K87A 3RF1A 2Q7GA 3V8KA 1N9WA 2DJZA 3TEHA 3TEGA 3HXZA 4YYEA 4KQEA 3G1ZA 4XTZA 3PCOB 4HVCA 1NJ1A 3HRIA 3REUA 4TVWA 4O2DA 2P5IA 4LNSA 4YRGA 3IKLA 1YGBA 3PCOA 3MEYA 3IG2A 5ELOA 1WLEA 4P71A 2ZZEA 3LSSA 4AH6A 3RKWA 4YRQA 3R07A 4H2YA 4Q15A 2ARTA 4P75C 1HC7A 4E51A 2E10A 3HXWA 3NENA 4P74C 1H4QA 3VBBA 1EFWA 4WF2A 1EVLA 4XU0A 1BIBA 5ELNA 2A8EA 2E1HA 1G5IA 3A7UA 4L87A 1X56A 2G4CA 4H02A 3P8TA 4XEMA 3W3SA 1KOGA 2QHSA 2CJAA 2EAYA 2ZT5A 3EFRA 4G85A 4YRFA 2I4OA 4HT4A 4ZIBA 4P72C 4X5OA 1EVKA 1WNLA 4XU1A 1GGMA 4HWOA 4OLFA 1X54A 3P8VA 4PG3A 4YP0A 2CGHA 4H2TA 3NETA 1WPYA 4YCVA 2DTIA 1J5WA 4WI1A
chains in the Genus database with same CATH topology
1FYFA 4CH4A 2IY5B 2ODRC 3VQWA 3RKYA 3L4GB 3MQZA 2DKGA 3HXVA 4Q6GA 2QHUA 2IY5A 2HNIA 1SRYA 1B7YB 2RHSB 2ODRD 3KFUA 3L4GA 4DPGA 5K1PA 3MF1A 4RQEA 3V7SA 2EJFA 3A32A 2DXUA 2P0LA 2RHQB 1B7YA 2RHSA 1H4VB 2DDZA 3E9IA 1YFTA 3V7RA 4KR3A 2E41A 5KNNA 4YREA 2RHQA 4H2VA 2FYKA 3QO5A 2J3LA 4YCWA 2ZIMA 4TWAA 3P8YA 5C51B 2Q5HA 1NJ2A 3HTZA 1ATIA 3HFVA 1ASYA 2ZTGA 2J3MA 4CH5A 1Z7NA 3RIRA 1YFSA 1PYSB 4UP9A 4LVJA 1KMMA 2DEQA 2I4MA 2XGTA 4XTUA 4RQFA 1KMNA 4H2SA 2Q7EA 1PYSA 2ALYB 4P75A 4YDQA 1BBUA 4P74A 1USYA 1X01A 4YRSA 3RL6A 3UGQA 4DQ2A 3HXXA 2ALYA 2I4NA 3DSQA 4LVLA 3V7CA 4LVMA 3REXA 1IL2A 3NELA 3PZCA 2PMFA 3MF2A 4ZTZB 2E64A 4RDXA 2EJ9A 3BFMA 3ERRA 2ZXFA 4XEOA 2ZT6A 4H2UA 4EX5A 1W66A 1H4TA 1ADJA 3QO8A 4LVKA 1X55A 4KR2A 1WU7A 3CMQA 4UPAA 4H2WA 4CH6A 2EJGA 4XTWA 5F5WA 4G84A 1B76A 3VQVA 2E65A 2EL9A 2DTHA 4HWRA 4XTXA 2ZINA 4HA8A 4XTVA 3ICAA 2DZCA 1L0WA 4TVYA 3BJUA 4YRNA 3A7RA 4UP8A 4P3PA 3FJPA 4P73A 5C53B 3A74A 1WQWA 2DZ9A 3A7AA 2DQ0A 3I7FA 1JJCB 3RKXA 1X2GA 2ZR3A 1X2HA 4NCXA 4TTVA 1Z7MA 1EOVA 1G51A 1HTTA 1JJCA 2ZZFA 1WQ7A 2DU7A 1G5HA 2QHVA 2ARSA 1BBWA 3M4PA 1QF6A 4J15A 1YFRA 5C52B 2QHTA 4TQFA 2AMCB 4TVAB 2NS6A 1B8AA 1ADYA 1NJ6A 4UP7A 2DVEA 4YCUA 3V8JA 1NJ5A 2ZT8A 11ASA 1B70B 4WJ3M 1LYLA 1RIQA 2AMCA 4P71C 4TVAA 4HWPA 4HWSA 12ASA 3RUXA 1VQZA 3V8LA 2ZT7A 2CJ9A 3QNEA 1C0AA 3IKMB 2XTIA 1B70A 2DXTA 3L2ZA 1H4SA 3HY0A 1QE0A 1EQRA 3UFGA 3A5ZA 4LVIA 5E3IA 2DQ3A 2C8MA 2CJBA 3RACA 3LC0A 3UH0A 3EFSA 4YRJA 2AKWB 5K1XA 1USYC 2C7IA 3HXUA 4YRIA 1SERA 4WJ4A 3L1AA 2ARUA 2AKWA 4YPFA 1NNHA 4XTYA 3A5YA 3VQXA 1E22A 2DU5A 1NJ8A 2I4LA 2CIMA 4CS4A 4CS3A 4YRKA 4TQDA 4OP0A 4BWAA 1E1OA 2Q5IA 2DTOA 4K88A 4P72A 2E3CA 4YRPA 3VQYA 2ZR2A 3LSQA 1ASZA 1SETA 4BW9A 3WQZA 3HY1A 4H2XB 1WYDA 2PMEA 2ZGWA 4XU3A 4PHCA 4CH3A 3HRKA 1E24A 4YRMA 1SESA 4P3NA 2ZNJA 4EO4A 3IALA 2Q7HA 3HXYA 3HFZB 4RMFA 3QTCA 4YRCA 3TUPA 4H2XA 1EIYB 2E5AA 4ZTUB 3QO7A 3E9HA 1NYQA 3NEMA 4K86A 4HWTA 1E1TA 3M4QA 3HFZA 4YRLA 1EIYA 1BIAA 4XU2A 3RGLA 1NYRA 2ZIOA 4P73C 4YRTA 4CS2A 1HXDA 2ZCEA 4P3OA 3UGTA 2ZNIA 2ZZGA 1YB3A 5HGQA 3A31A 4YROA 3TEHB 3OD1A 4YRRA 2EWNA 4K87A 3RF1A 2Q7GA 3V8KA 1N9WA 2DJZA 3TEHA 3TEGA 3HXZA 4YYEA 4KQEA 3G1ZA 4XTZA 3PCOB 4HVCA 1NJ1A 3HRIA 3REUA 4TVWA 4O2DA 2P5IA 4LNSA 4YRGA 3IKLA 1YGBA 3PCOA 3MEYA 3IG2A 5ELOA 1WLEA 4P71A 2ZZEA 3LSSA 4AH6A 3RKWA 4YRQA 3R07A 4H2YA 4Q15A 2ARTA 4P75C 1HC7A 4E51A 2E10A 3HXWA 3NENA 4P74C 1H4QA 3VBBA 1EFWA 4WF2A 1EVLA 4XU0A 1BIBA 5ELNA 2A8EA 2E1HA 1G5IA 3A7UA 4L87A 1X56A 2G4CA 4H02A 3P8TA 4XEMA 3W3SA 1KOGA 2QHSA 2CJAA 2EAYA 2ZT5A 3EFRA 4G85A 4YRFA 2I4OA 4HT4A 4ZIBA 4P72C 4X5OA 1EVKA 1WNLA 4XU1A 1GGMA 4HWOA 4OLFA 1X54A 3P8VA 4PG3A 4YP0A 2CGHA 4H2TA 3NETA 1WPYA 4YCVA 2DTIA 1J5WA 4WI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVK A;  4LVL A;  2NS6 A;  4LVJ A;  4LVM A;  4LVI A;  4HT4 A; 
#chains in the Genus database with same CATH topology
 1FYF A;  4CH4 A;  2IY5 B;  2ODR C;  3VQW A;  3RKY A;  3L4G B;  3MQZ A;  2DKG A;  3HXV A;  4Q6G A;  2QHU A;  2IY5 A;  2HNI A;  1SRY A;  1B7Y B;  2RHS B;  2ODR D;  3KFU A;  3L4G A;  4DPG A;  5K1P A;  3MF1 A;  4RQE A;  3V7S A;  2EJF A;  3A32 A;  2DXU A;  2P0L A;  2RHQ B;  1B7Y A;  2RHS A;  1H4V B;  2DDZ A;  3E9I A;  1YFT A;  3V7R A;  4KR3 A;  2E41 A;  5KNN A;  4YRE A;  2RHQ A;  4H2V A;  2FYK A;  3QO5 A;  2J3L A;  4YCW A;  2ZIM A;  4TWA A;  3P8Y A;  5C51 B;  2Q5H A;  1NJ2 A;  3HTZ A;  1ATI A;  3HFV A;  1ASY A;  2ZTG A;  2J3M A;  4CH5 A;  1Z7N A;  3RIR A;  1YFS A;  1PYS B;  4UP9 A;  4LVJ A;  1KMM A;  2DEQ A;  2I4M A;  2XGT A;  4XTU A;  4RQF A;  1KMN A;  4H2S A;  2Q7E A;  1PYS A;  2ALY B;  4P75 A;  4YDQ A;  1BBU A;  4P74 A;  1USY A;  1X01 A;  4YRS A;  3RL6 A;  3UGQ A;  4DQ2 A;  3HXX A;  2ALY A;  2I4N A;  3DSQ A;  4LVL A;  3V7C A;  4LVM A;  3REX A;  1IL2 A;  3NEL A;  3PZC A;  2PMF A;  3MF2 A;  4ZTZ B;  2E64 A;  4RDX A;  2EJ9 A;  3BFM A;  3ERR A;  2ZXF A;  4XEO A;  2ZT6 A;  4H2U A;  4EX5 A;  1W66 A;  1H4T A;  1ADJ A;  3QO8 A;  4LVK A;  1X55 A;  4KR2 A;  1WU7 A;  3CMQ A;  4UPA A;  4H2W A;  4CH6 A;  2EJG A;  4XTW A;  5F5W A;  4G84 A;  1B76 A;  3VQV A;  2E65 A;  2EL9 A;  2DTH A;  4HWR A;  4XTX A;  2ZIN A;  4HA8 A;  4XTV A;  3ICA A;  2DZC A;  1L0W A;  4TVY A;  3BJU A;  4YRN A;  3A7R A;  4UP8 A;  4P3P A;  3FJP A;  4P73 A;  5C53 B;  3A74 A;  1WQW A;  2DZ9 A;  3A7A A;  2DQ0 A;  3I7F A;  1JJC B;  3RKX A;  1X2G A;  2ZR3 A;  1X2H A;  4NCX A;  4TTV A;  1Z7M A;  1EOV A;  1G51 A;  1HTT A;  1JJC A;  2ZZF A;  1WQ7 A;  2DU7 A;  1G5H A;  2QHV A;  2ARS A;  1BBW A;  3M4P A;  1QF6 A;  4J15 A;  1YFR A;  5C52 B;  2QHT A;  4TQF A;  2AMC B;  4TVA B;  2NS6 A;  1B8A A;  1ADY A;  1NJ6 A;  4UP7 A;  2DVE A;  4YCU A;  3V8J A;  1NJ5 A;  2ZT8 A;  11AS A;  1B70 B;  4WJ3 M;  1LYL A;  1RIQ A;  2AMC A;  4P71 C;  4TVA A;  4HWP A;  4HWS A;  12AS A;  3RUX A;  1VQZ A;  3V8L A;  2ZT7 A;  2CJ9 A;  3QNE A;  1C0A A;  3IKM B;  2XTI A;  1B70 A;  2DXT A;  3L2Z A;  1H4S A;  3HY0 A;  1QE0 A;  1EQR A;  3UFG A;  3A5Z A;  4LVI A;  5E3I A;  2DQ3 A;  2C8M A;  2CJB A;  3RAC A;  3LC0 A;  3UH0 A;  3EFS A;  4YRJ A;  2AKW B;  5K1X A;  1USY C;  2C7I A;  3HXU A;  4YRI A;  1SER A;  4WJ4 A;  3L1A A;  2ARU A;  2AKW A;  4YPF A;  1NNH A;  4XTY A;  3A5Y A;  3VQX A;  1E22 A;  2DU5 A;  1NJ8 A;  2I4L A;  2CIM A;  4CS4 A;  4CS3 A;  4YRK A;  4TQD A;  4OP0 A;  4BWA A;  1E1O A;  2Q5I A;  2DTO A;  4K88 A;  4P72 A;  2E3C A;  4YRP A;  3VQY A;  2ZR2 A;  3LSQ A;  1ASZ A;  1SET A;  4BW9 A;  3WQZ A;  3HY1 A;  4H2X B;  1WYD A;  2PME A;  2ZGW A;  4XU3 A;  4PHC A;  4CH3 A;  3HRK A;  1E24 A;  4YRM A;  1SES A;  4P3N A;  2ZNJ A;  4EO4 A;  3IAL A;  2Q7H A;  3HXY A;  3HFZ B;  4RMF A;  3QTC A;  4YRC A;  3TUP A;  4H2X A;  1EIY B;  2E5A A;  4ZTU B;  3QO7 A;  3E9H A;  1NYQ A;  3NEM A;  4K86 A;  4HWT A;  1E1T A;  3M4Q A;  3HFZ A;  4YRL A;  1EIY A;  1BIA A;  4XU2 A;  3RGL A;  1NYR A;  2ZIO A;  4P73 C;  4YRT A;  4CS2 A;  1HXD A;  2ZCE A;  4P3O A;  3UGT A;  2ZNI A;  2ZZG A;  1YB3 A;  5HGQ A;  3A31 A;  4YRO A;  3TEH B;  3OD1 A;  4YRR A;  2EWN A;  4K87 A;  3RF1 A;  2Q7G A;  3V8K A;  1N9W A;  2DJZ A;  3TEH A;  3TEG A;  3HXZ A;  4YYE A;  4KQE A;  3G1Z A;  4XTZ A;  3PCO B;  4HVC A;  1NJ1 A;  3HRI A;  3REU A;  4TVW A;  4O2D A;  2P5I A;  4LNS A;  4YRG A;  3IKL A;  1YGB A;  3PCO A;  3MEY A;  3IG2 A;  5ELO A;  1WLE A;  4P71 A;  2ZZE A;  3LSS A;  4AH6 A;  3RKW A;  4YRQ A;  3R07 A;  4H2Y A;  4Q15 A;  2ART A;  4P75 C;  1HC7 A;  4E51 A;  2E10 A;  3HXW A;  3NEN A;  4P74 C;  1H4Q A;  3VBB A;  1EFW A;  4WF2 A;  1EVL A;  4XU0 A;  1BIB A;  5ELN A;  2A8E A;  2E1H A;  1G5I A;  3A7U A;  4L87 A;  1X56 A;  2G4C A;  4H02 A;  3P8T A;  4XEM A;  3W3S A;  1KOG A;  2QHS A;  2CJA A;  2EAY A;  2ZT5 A;  3EFR A;  4G85 A;  4YRF A;  2I4O A;  4HT4 A;  4ZIB A;  4P72 C;  4X5O A;  1EVK A;  1WNL A;  4XU1 A;  1GGM A;  4HWO A;  4OLF A;  1X54 A;  3P8V A;  4PG3 A;  4YP0 A;  2CGH A;  4H2T A;  3NET A;  1WPY A;  4YCV A;  2DTI A;  1J5W A;  4WI1 A; 
#chains in the Genus database with same CATH homology
 1FYF A;  4CH4 A;  2IY5 B;  2ODR C;  3VQW A;  3RKY A;  3L4G B;  3MQZ A;  2DKG A;  3HXV A;  4Q6G A;  2QHU A;  2IY5 A;  2HNI A;  1SRY A;  1B7Y B;  2RHS B;  2ODR D;  3KFU A;  3L4G A;  4DPG A;  5K1P A;  3MF1 A;  4RQE A;  3V7S A;  2EJF A;  3A32 A;  2DXU A;  2P0L A;  2RHQ B;  1B7Y A;  2RHS A;  1H4V B;  2DDZ A;  3E9I A;  1YFT A;  3V7R A;  4KR3 A;  2E41 A;  5KNN A;  4YRE A;  2RHQ A;  4H2V A;  2FYK A;  3QO5 A;  2J3L A;  4YCW A;  2ZIM A;  4TWA A;  3P8Y A;  5C51 B;  2Q5H A;  1NJ2 A;  3HTZ A;  1ATI A;  3HFV A;  1ASY A;  2ZTG A;  2J3M A;  4CH5 A;  1Z7N A;  3RIR A;  1YFS A;  1PYS B;  4UP9 A;  4LVJ A;  1KMM A;  2DEQ A;  2I4M A;  2XGT A;  4XTU A;  4RQF A;  1KMN A;  4H2S A;  2Q7E A;  1PYS A;  2ALY B;  4P75 A;  4YDQ A;  1BBU A;  4P74 A;  1USY A;  1X01 A;  4YRS A;  3RL6 A;  3UGQ A;  4DQ2 A;  3HXX A;  2ALY A;  2I4N A;  3DSQ A;  4LVL A;  3V7C A;  4LVM A;  3REX A;  1IL2 A;  3NEL A;  3PZC A;  2PMF A;  3MF2 A;  4ZTZ B;  2E64 A;  4RDX A;  2EJ9 A;  3BFM A;  3ERR A;  2ZXF A;  4XEO A;  2ZT6 A;  4H2U A;  4EX5 A;  1W66 A;  1H4T A;  1ADJ A;  3QO8 A;  4LVK A;  1X55 A;  4KR2 A;  1WU7 A;  3CMQ A;  4UPA A;  4H2W A;  4CH6 A;  2EJG A;  4XTW A;  5F5W A;  4G84 A;  1B76 A;  3VQV A;  2E65 A;  2EL9 A;  2DTH A;  4HWR A;  4XTX A;  2ZIN A;  4HA8 A;  4XTV A;  3ICA A;  2DZC A;  1L0W A;  4TVY A;  3BJU A;  4YRN A;  3A7R A;  4UP8 A;  4P3P A;  3FJP A;  4P73 A;  5C53 B;  3A74 A;  1WQW A;  2DZ9 A;  3A7A A;  2DQ0 A;  3I7F A;  1JJC B;  3RKX A;  1X2G A;  2ZR3 A;  1X2H A;  4NCX A;  4TTV A;  1Z7M A;  1EOV A;  1G51 A;  1HTT A;  1JJC A;  2ZZF A;  1WQ7 A;  2DU7 A;  1G5H A;  2QHV A;  2ARS A;  1BBW A;  3M4P A;  1QF6 A;  4J15 A;  1YFR A;  5C52 B;  2QHT A;  4TQF A;  2AMC B;  4TVA B;  2NS6 A;  1B8A A;  1ADY A;  1NJ6 A;  4UP7 A;  2DVE A;  4YCU A;  3V8J A;  1NJ5 A;  2ZT8 A;  11AS A;  1B70 B;  4WJ3 M;  1LYL A;  1RIQ A;  2AMC A;  4P71 C;  4TVA A;  4HWP A;  4HWS A;  12AS A;  3RUX A;  1VQZ A;  3V8L A;  2ZT7 A;  2CJ9 A;  3QNE A;  1C0A A;  3IKM B;  2XTI A;  1B70 A;  2DXT A;  3L2Z A;  1H4S A;  3HY0 A;  1QE0 A;  1EQR A;  3UFG A;  3A5Z A;  4LVI A;  5E3I A;  2DQ3 A;  2C8M A;  2CJB A;  3RAC A;  3LC0 A;  3UH0 A;  3EFS A;  4YRJ A;  2AKW B;  5K1X A;  1USY C;  2C7I A;  3HXU A;  4YRI A;  1SER A;  4WJ4 A;  3L1A A;  2ARU A;  2AKW A;  4YPF A;  1NNH A;  4XTY A;  3A5Y A;  3VQX A;  1E22 A;  2DU5 A;  1NJ8 A;  2I4L A;  2CIM A;  4CS4 A;  4CS3 A;  4YRK A;  4TQD A;  4OP0 A;  4BWA A;  1E1O A;  2Q5I A;  2DTO A;  4K88 A;  4P72 A;  2E3C A;  4YRP A;  3VQY A;  2ZR2 A;  3LSQ A;  1ASZ A;  1SET A;  4BW9 A;  3WQZ A;  3HY1 A;  4H2X B;  1WYD A;  2PME A;  2ZGW A;  4XU3 A;  4PHC A;  4CH3 A;  3HRK A;  1E24 A;  4YRM A;  1SES A;  4P3N A;  2ZNJ A;  4EO4 A;  3IAL A;  2Q7H A;  3HXY A;  3HFZ B;  4RMF A;  3QTC A;  4YRC A;  3TUP A;  4H2X A;  1EIY B;  2E5A A;  4ZTU B;  3QO7 A;  3E9H A;  1NYQ A;  3NEM A;  4K86 A;  4HWT A;  1E1T A;  3M4Q A;  3HFZ A;  4YRL A;  1EIY A;  1BIA A;  4XU2 A;  3RGL A;  1NYR A;  2ZIO A;  4P73 C;  4YRT A;  4CS2 A;  1HXD A;  2ZCE A;  4P3O A;  3UGT A;  2ZNI A;  2ZZG A;  1YB3 A;  5HGQ A;  3A31 A;  4YRO A;  3TEH B;  3OD1 A;  4YRR A;  2EWN A;  4K87 A;  3RF1 A;  2Q7G A;  3V8K A;  1N9W A;  2DJZ A;  3TEH A;  3TEG A;  3HXZ A;  4YYE A;  4KQE A;  3G1Z A;  4XTZ A;  3PCO B;  4HVC A;  1NJ1 A;  3HRI A;  3REU A;  4TVW A;  4O2D A;  2P5I A;  4LNS A;  4YRG A;  3IKL A;  1YGB A;  3PCO A;  3MEY A;  3IG2 A;  5ELO A;  1WLE A;  4P71 A;  2ZZE A;  3LSS A;  4AH6 A;  3RKW A;  4YRQ A;  3R07 A;  4H2Y A;  4Q15 A;  2ART A;  4P75 C;  1HC7 A;  4E51 A;  2E10 A;  3HXW A;  3NEN A;  4P74 C;  1H4Q A;  3VBB A;  1EFW A;  4WF2 A;  1EVL A;  4XU0 A;  1BIB A;  5ELN A;  2A8E A;  2E1H A;  1G5I A;  3A7U A;  4L87 A;  1X56 A;  2G4C A;  4H02 A;  3P8T A;  4XEM A;  3W3S A;  1KOG A;  2QHS A;  2CJA A;  2EAY A;  2ZT5 A;  3EFR A;  4G85 A;  4YRF A;  2I4O A;  4HT4 A;  4ZIB A;  4P72 C;  4X5O A;  1EVK A;  1WNL A;  4XU1 A;  1GGM A;  4HWO A;  4OLF A;  1X54 A;  3P8V A;  4PG3 A;  4YP0 A;  2CGH A;  4H2T A;  3NET A;  1WPY A;  4YCV A;  2DTI A;  1J5W A;  4WI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...