4LVIA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt). mn-bound crystal structure at ph 4.6
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
190
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
molecule keywords Plasmid recombination enzyme
total genus 60
structure length 190
sequence length 194
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lviA01
4HT4A 4LVMA 4LVLA 2NS6A 4LVJA 4LVKA 4LVIA
chains in the Genus database with same CATH superfamily
4DPGA 3OD1A 4H2YA 1W66A 2ZNIA 4HWTA 4HVCA 4P3NA 2E3CA 1G5HA 1YB3A 4LVJA 2QHVA 5F5WA 2RHSA 2ZTGA 3MQZA 3RIRA 2DDZA 3VQXA 4HT4A 2ZNJA 3QO7A 4OLFA 4G85A 3TEHA 4K87A 3E9IA 2C7IA 3VQWA 3PZCA 1ATIA 1JJCA 3L2ZA 4H2SA 1EQRA 1YGBA 4YRCA 2NS6A 4WJ4A 5E3IA 4UP9A 3IKMB 2ZZGA 1WYDA 4P3PA 12ASA 3PCOB 4YRQA 1EOVA 1NJ5A 3VBBA 1NNHA 1NJ8A 2PMEA 1NYQA 1QE0A 3VQYA 3HFZA 4BWAA 1SESA 2I4NA 1G51A 4EO4A 2DXTA 3TUPA 2J3MA 1C0AA 3NETA 3QO8A 4YRGA 3RF1A 2CJ9A 3RKWA 3HRIA 4RMFA 4YRKA 3V8KA 3REXA 2DU5A 4OP0A 4Q15A 4RQEA 3V7RA 1YFRA 2E5AA 4TVYA 4ZTZB 1J5WA 4UP7A 1WPYA 4XU3A 1FYFA 4XEMA 2E65A 4LVLA 2ODRC 3CMQA 2I4MA 4H2XA 1BBUA 4YRRA 4YRIA 4ZIBA 2DZCA 4O2DA 3HXUA 2E41A 3EFSA 4CH5A 4YCVA 3L4GB 5C51B 2IY5B 1H4SA 5HGQA 1WQ7A 2ZT7A 3NELA 3HFVA 3A7AA 4LNSA 2ZIOA 1ASYA 2PMFA 3NENA 1USYC 2AMCA 4YRSA 3ERRA 2ZZEA 5K1PA 1E1OA 3R07A 2CIMA 1B7YB 3DSQA 3RACA 4CS3A 1E22A 4H02A 1X01A 2EWNA 4J15A 4PG3A 2E10A 4YREA 3REUA 3UGQA 5ELNA 4YRTA 4XTVA 1X2HA 1EIYB 4P73A 3ICAA 4YRJA 3G1ZA 1N9WA 3QNEA 3HXXA 4YPFA 4XU1A 2ARSA 1G5IA 2ZR2A 4HA8A 1VQZA 4TWAA 2EJGA 4YCWA 2EL9A 4YP0A 4RQFA 4YCUA 3V8LA 2XGTA 3HXYA 2A8EA 1GGMA 1HTTA 3A74A 4XEOA 1X2GA 2ZINA 4RDXA 2P0LA 4LVMA 1PYSA 4CS4A 4CH4A 3UH0A 2G4CA 2CGHA 2ZIMA 4YROA 1H4QA 2DQ0A 4UP8A 2DEQA 4P71C 3FJPA 1WU7A 1WNLA 1ADJA 1ASZA 3V8JA 1B76A 1EIYA 4WI1A 1LYLA 2XTIA 1SERA 4XU0A 3HY1A 4LVIA 4P75A 4P75C 1X54A 3HXVA 4YYEA 4YRPA 4AH6A 4TVAA 1B70B 4XTXA 1BIAA 2AKWA 3EFRA 2Q7EA 4WF2A 3MF2A 3RKXA 4KQEA 2ZT6A 4K86A 4P72C 2EAYA 2ZXFA 4YRFA 4P3OA 2E1HA 4XTZA 4Q6GA 1Z7NA 3HTZA 5ELOA 2DQ3A 3A5YA 1USYA 3RL6A 2Q7GA 4TVWA 2ALYA 1SETA 1RIQA 2ARTA 4YRLA 4X5OA 3P8TA 2AMCB 4YRNA 1WLEA 1BBWA 1EFWA 4L87A 1NYRA 2FYKA 4EX5A 11ASA 1E24A 1E1TA 2AKWB 4WJ3M 3A7RA 2DKGA 2DVEA 3A5ZA 3WQZA 4P73C 1NJ1A 1BIBA 2EJ9A 1KMNA 3MF1A 3HXZA 2Q5IA 1L0WA 5C52B 2QHSA 4XTUA 3W3SA 1H4TA 3RGLA 1QF6A 3L4GA 5KNNA 3QO5A 4H2TA 3P8YA 3L1AA 1H4VB 2DTHA 1B7YA 4G84A 2EJFA 2Q7HA 3VQVA 4YRMA 4H2VA 4KR3A 1KMMA 3IKLA 1B8AA 4PHCA 1YFSA 1EVKA 3MEYA 5C53B 1NJ2A 2DXUA 2I4LA 2RHQB 4K88A 4DQ2A 2ALYB 1HC7A 2Q5HA 4P74A 1ADYA 3BJUA 1NJ6A 4H2XB 1X56A 3I7FA 3KFUA 3M4QA 3HY0A 4HWOA 4CS2A 1EVLA 2IY5A 1JJCB 3HFZB 4LVKA 4YDQA 2ZT5A 4BW9A 2DZ9A 2ARUA 3IALA 2C8MA 3NEMA 3RKYA 4HWSA 2DTOA 3HXWA 2ZGWA 3IG2A 2QHUA 3V7SA 5K1XA 2QHTA 2E64A 4TVAB 3V7CA 3A31A 1WQWA 2DJZA 4ZTUB 4P71A 3M4PA 3P8VA 2I4OA 4HWPA 3E9HA 3TEGA 4P72A 4H2UA 3QTCA 3LC0A 4UPAA 4P74C 4XU2A 2ZT8A 3LSSA 4NCXA 3BFMA 4TTVA 1SRYA 2RHSB 2HNIA 4HWRA 3LSQA 4XTYA 2DU7A 2ODRD 4CH6A 3RUXA 3PCOA 4H2WA 2ZZFA 3UGTA 4E51A 2CJAA 4TQFA 1X55A 3A7UA 1B70A 2P5IA 2DTIA 2CJBA 1HXDA 1IL2A 1YFTA 2RHQA 4XTWA 4KR2A 2J3LA 3UFGA 1Z7MA 4CH3A 3HRKA 2ZR3A 3A32A 1PYSB 2ZCEA 3TEHB 1KOGA 4TQDA
chains in the Genus database with same CATH topology
4DPGA 3OD1A 4H2YA 1W66A 2ZNIA 4HWTA 4HVCA 4P3NA 2E3CA 1G5HA 1YB3A 4LVJA 2QHVA 5F5WA 2RHSA 2ZTGA 3MQZA 3RIRA 2DDZA 3VQXA 4HT4A 2ZNJA 3QO7A 4OLFA 4G85A 3TEHA 4K87A 3E9IA 2C7IA 3VQWA 3PZCA 1ATIA 1JJCA 3L2ZA 4H2SA 1EQRA 1YGBA 4YRCA 2NS6A 4WJ4A 5E3IA 4UP9A 3IKMB 2ZZGA 1WYDA 4P3PA 12ASA 3PCOB 4YRQA 1EOVA 1NJ5A 3VBBA 1NNHA 1NJ8A 2PMEA 1NYQA 1QE0A 3VQYA 3HFZA 4BWAA 1SESA 2I4NA 1G51A 4EO4A 2DXTA 3TUPA 2J3MA 1C0AA 3NETA 3QO8A 4YRGA 3RF1A 2CJ9A 3RKWA 3HRIA 4RMFA 4YRKA 3V8KA 3REXA 2DU5A 4OP0A 4Q15A 4RQEA 3V7RA 1YFRA 2E5AA 4TVYA 4ZTZB 1J5WA 4UP7A 1WPYA 4XU3A 1FYFA 4XEMA 2E65A 4LVLA 2ODRC 3CMQA 2I4MA 4H2XA 1BBUA 4YRRA 4YRIA 4ZIBA 2DZCA 4O2DA 3HXUA 2E41A 3EFSA 4CH5A 4YCVA 3L4GB 5C51B 2IY5B 1H4SA 5HGQA 1WQ7A 2ZT7A 3NELA 3HFVA 3A7AA 4LNSA 2ZIOA 1ASYA 2PMFA 3NENA 1USYC 2AMCA 4YRSA 3ERRA 2ZZEA 5K1PA 1E1OA 3R07A 2CIMA 1B7YB 3DSQA 3RACA 4CS3A 1E22A 4H02A 1X01A 2EWNA 4J15A 4PG3A 2E10A 4YREA 3REUA 3UGQA 5ELNA 4YRTA 4XTVA 1X2HA 1EIYB 4P73A 3ICAA 4YRJA 3G1ZA 1N9WA 3QNEA 3HXXA 4YPFA 4XU1A 2ARSA 1G5IA 2ZR2A 4HA8A 1VQZA 4TWAA 2EJGA 4YCWA 2EL9A 4YP0A 4RQFA 4YCUA 3V8LA 2XGTA 3HXYA 2A8EA 1GGMA 1HTTA 3A74A 4XEOA 1X2GA 2ZINA 4RDXA 2P0LA 4LVMA 1PYSA 4CS4A 4CH4A 3UH0A 2G4CA 2CGHA 2ZIMA 4YROA 1H4QA 2DQ0A 4UP8A 2DEQA 4P71C 3FJPA 1WU7A 1WNLA 1ADJA 1ASZA 3V8JA 1B76A 1EIYA 4WI1A 1LYLA 2XTIA 1SERA 4XU0A 3HY1A 4LVIA 4P75A 4P75C 1X54A 3HXVA 4YYEA 4YRPA 4AH6A 4TVAA 1B70B 4XTXA 1BIAA 2AKWA 3EFRA 2Q7EA 4WF2A 3MF2A 3RKXA 4KQEA 2ZT6A 4K86A 4P72C 2EAYA 2ZXFA 4YRFA 4P3OA 2E1HA 4XTZA 4Q6GA 1Z7NA 3HTZA 5ELOA 2DQ3A 3A5YA 1USYA 3RL6A 2Q7GA 4TVWA 2ALYA 1SETA 1RIQA 2ARTA 4YRLA 4X5OA 3P8TA 2AMCB 4YRNA 1WLEA 1BBWA 1EFWA 4L87A 1NYRA 2FYKA 4EX5A 11ASA 1E24A 1E1TA 2AKWB 4WJ3M 3A7RA 2DKGA 2DVEA 3A5ZA 3WQZA 4P73C 1NJ1A 1BIBA 2EJ9A 1KMNA 3MF1A 3HXZA 2Q5IA 1L0WA 5C52B 2QHSA 4XTUA 3W3SA 1H4TA 3RGLA 1QF6A 3L4GA 5KNNA 3QO5A 4H2TA 3P8YA 3L1AA 1H4VB 2DTHA 1B7YA 4G84A 2EJFA 2Q7HA 3VQVA 4YRMA 4H2VA 4KR3A 1KMMA 3IKLA 1B8AA 4PHCA 1YFSA 1EVKA 3MEYA 5C53B 1NJ2A 2DXUA 2I4LA 2RHQB 4K88A 4DQ2A 2ALYB 1HC7A 2Q5HA 4P74A 1ADYA 3BJUA 1NJ6A 4H2XB 1X56A 3I7FA 3KFUA 3M4QA 3HY0A 4HWOA 4CS2A 1EVLA 2IY5A 1JJCB 3HFZB 4LVKA 4YDQA 2ZT5A 4BW9A 2DZ9A 2ARUA 3IALA 2C8MA 3NEMA 3RKYA 4HWSA 2DTOA 3HXWA 2ZGWA 3IG2A 2QHUA 3V7SA 5K1XA 2QHTA 2E64A 4TVAB 3V7CA 3A31A 1WQWA 2DJZA 4ZTUB 4P71A 3M4PA 3P8VA 2I4OA 4HWPA 3E9HA 3TEGA 4P72A 4H2UA 3QTCA 3LC0A 4UPAA 4P74C 4XU2A 2ZT8A 3LSSA 4NCXA 3BFMA 4TTVA 1SRYA 2RHSB 2HNIA 4HWRA 3LSQA 4XTYA 2DU7A 2ODRD 4CH6A 3RUXA 3PCOA 4H2WA 2ZZFA 3UGTA 4E51A 2CJAA 4TQFA 1X55A 3A7UA 1B70A 2P5IA 2DTIA 2CJBA 1HXDA 1IL2A 1YFTA 2RHQA 4XTWA 4KR2A 2J3LA 3UFGA 1Z7MA 4CH3A 3HRKA 2ZR3A 3A32A 1PYSB 2ZCEA 3TEHB 1KOGA 4TQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HT4 A;  4LVM A;  4LVL A;  2NS6 A;  4LVJ A;  4LVK A;  4LVI A; 
#chains in the Genus database with same CATH topology
 4DPG A;  3OD1 A;  4H2Y A;  1W66 A;  2ZNI A;  4HWT A;  4HVC A;  4P3N A;  2E3C A;  1G5H A;  1YB3 A;  4LVJ A;  2QHV A;  5F5W A;  2RHS A;  2ZTG A;  3MQZ A;  3RIR A;  2DDZ A;  3VQX A;  4HT4 A;  2ZNJ A;  3QO7 A;  4OLF A;  4G85 A;  3TEH A;  4K87 A;  3E9I A;  2C7I A;  3VQW A;  3PZC A;  1ATI A;  1JJC A;  3L2Z A;  4H2S A;  1EQR A;  1YGB A;  4YRC A;  2NS6 A;  4WJ4 A;  5E3I A;  4UP9 A;  3IKM B;  2ZZG A;  1WYD A;  4P3P A;  12AS A;  3PCO B;  4YRQ A;  1EOV A;  1NJ5 A;  3VBB A;  1NNH A;  1NJ8 A;  2PME A;  1NYQ A;  1QE0 A;  3VQY A;  3HFZ A;  4BWA A;  1SES A;  2I4N A;  1G51 A;  4EO4 A;  2DXT A;  3TUP A;  2J3M A;  1C0A A;  3NET A;  3QO8 A;  4YRG A;  3RF1 A;  2CJ9 A;  3RKW A;  3HRI A;  4RMF A;  4YRK A;  3V8K A;  3REX A;  2DU5 A;  4OP0 A;  4Q15 A;  4RQE A;  3V7R A;  1YFR A;  2E5A A;  4TVY A;  4ZTZ B;  1J5W A;  4UP7 A;  1WPY A;  4XU3 A;  1FYF A;  4XEM A;  2E65 A;  4LVL A;  2ODR C;  3CMQ A;  2I4M A;  4H2X A;  1BBU A;  4YRR A;  4YRI A;  4ZIB A;  2DZC A;  4O2D A;  3HXU A;  2E41 A;  3EFS A;  4CH5 A;  4YCV A;  3L4G B;  5C51 B;  2IY5 B;  1H4S A;  5HGQ A;  1WQ7 A;  2ZT7 A;  3NEL A;  3HFV A;  3A7A A;  4LNS A;  2ZIO A;  1ASY A;  2PMF A;  3NEN A;  1USY C;  2AMC A;  4YRS A;  3ERR A;  2ZZE A;  5K1P A;  1E1O A;  3R07 A;  2CIM A;  1B7Y B;  3DSQ A;  3RAC A;  4CS3 A;  1E22 A;  4H02 A;  1X01 A;  2EWN A;  4J15 A;  4PG3 A;  2E10 A;  4YRE A;  3REU A;  3UGQ A;  5ELN A;  4YRT A;  4XTV A;  1X2H A;  1EIY B;  4P73 A;  3ICA A;  4YRJ A;  3G1Z A;  1N9W A;  3QNE A;  3HXX A;  4YPF A;  4XU1 A;  2ARS A;  1G5I A;  2ZR2 A;  4HA8 A;  1VQZ A;  4TWA A;  2EJG A;  4YCW A;  2EL9 A;  4YP0 A;  4RQF A;  4YCU A;  3V8L A;  2XGT A;  3HXY A;  2A8E A;  1GGM A;  1HTT A;  3A74 A;  4XEO A;  1X2G A;  2ZIN A;  4RDX A;  2P0L A;  4LVM A;  1PYS A;  4CS4 A;  4CH4 A;  3UH0 A;  2G4C A;  2CGH A;  2ZIM A;  4YRO A;  1H4Q A;  2DQ0 A;  4UP8 A;  2DEQ A;  4P71 C;  3FJP A;  1WU7 A;  1WNL A;  1ADJ A;  1ASZ A;  3V8J A;  1B76 A;  1EIY A;  4WI1 A;  1LYL A;  2XTI A;  1SER A;  4XU0 A;  3HY1 A;  4LVI A;  4P75 A;  4P75 C;  1X54 A;  3HXV A;  4YYE A;  4YRP A;  4AH6 A;  4TVA A;  1B70 B;  4XTX A;  1BIA A;  2AKW A;  3EFR A;  2Q7E A;  4WF2 A;  3MF2 A;  3RKX A;  4KQE A;  2ZT6 A;  4K86 A;  4P72 C;  2EAY A;  2ZXF A;  4YRF A;  4P3O A;  2E1H A;  4XTZ A;  4Q6G A;  1Z7N A;  3HTZ A;  5ELO A;  2DQ3 A;  3A5Y A;  1USY A;  3RL6 A;  2Q7G A;  4TVW A;  2ALY A;  1SET A;  1RIQ A;  2ART A;  4YRL A;  4X5O A;  3P8T A;  2AMC B;  4YRN A;  1WLE A;  1BBW A;  1EFW A;  4L87 A;  1NYR A;  2FYK A;  4EX5 A;  11AS A;  1E24 A;  1E1T A;  2AKW B;  4WJ3 M;  3A7R A;  2DKG A;  2DVE A;  3A5Z A;  3WQZ A;  4P73 C;  1NJ1 A;  1BIB A;  2EJ9 A;  1KMN A;  3MF1 A;  3HXZ A;  2Q5I A;  1L0W A;  5C52 B;  2QHS A;  4XTU A;  3W3S A;  1H4T A;  3RGL A;  1QF6 A;  3L4G A;  5KNN A;  3QO5 A;  4H2T A;  3P8Y A;  3L1A A;  1H4V B;  2DTH A;  1B7Y A;  4G84 A;  2EJF A;  2Q7H A;  3VQV A;  4YRM A;  4H2V A;  4KR3 A;  1KMM A;  3IKL A;  1B8A A;  4PHC A;  1YFS A;  1EVK A;  3MEY A;  5C53 B;  1NJ2 A;  2DXU A;  2I4L A;  2RHQ B;  4K88 A;  4DQ2 A;  2ALY B;  1HC7 A;  2Q5H A;  4P74 A;  1ADY A;  3BJU A;  1NJ6 A;  4H2X B;  1X56 A;  3I7F A;  3KFU A;  3M4Q A;  3HY0 A;  4HWO A;  4CS2 A;  1EVL A;  2IY5 A;  1JJC B;  3HFZ B;  4LVK A;  4YDQ A;  2ZT5 A;  4BW9 A;  2DZ9 A;  2ARU A;  3IAL A;  2C8M A;  3NEM A;  3RKY A;  4HWS A;  2DTO A;  3HXW A;  2ZGW A;  3IG2 A;  2QHU A;  3V7S A;  5K1X A;  2QHT A;  2E64 A;  4TVA B;  3V7C A;  3A31 A;  1WQW A;  2DJZ A;  4ZTU B;  4P71 A;  3M4P A;  3P8V A;  2I4O A;  4HWP A;  3E9H A;  3TEG A;  4P72 A;  4H2U A;  3QTC A;  3LC0 A;  4UPA A;  4P74 C;  4XU2 A;  2ZT8 A;  3LSS A;  4NCX A;  3BFM A;  4TTV A;  1SRY A;  2RHS B;  2HNI A;  4HWR A;  3LSQ A;  4XTY A;  2DU7 A;  2ODR D;  4CH6 A;  3RUX A;  3PCO A;  4H2W A;  2ZZF A;  3UGT A;  4E51 A;  2CJA A;  4TQF A;  1X55 A;  3A7U A;  1B70 A;  2P5I A;  2DTI A;  2CJB A;  1HXD A;  1IL2 A;  1YFT A;  2RHQ A;  4XTW A;  4KR2 A;  2J3L A;  3UFG A;  1Z7M A;  4CH3 A;  3HRK A;  2ZR3 A;  3A32 A;  1PYS B;  2ZCE A;  3TEH B;  1KOG A;  4TQD A; 
#chains in the Genus database with same CATH homology
 4DPG A;  3OD1 A;  4H2Y A;  1W66 A;  2ZNI A;  4HWT A;  4HVC A;  4P3N A;  2E3C A;  1G5H A;  1YB3 A;  4LVJ A;  2QHV A;  5F5W A;  2RHS A;  2ZTG A;  3MQZ A;  3RIR A;  2DDZ A;  3VQX A;  4HT4 A;  2ZNJ A;  3QO7 A;  4OLF A;  4G85 A;  3TEH A;  4K87 A;  3E9I A;  2C7I A;  3VQW A;  3PZC A;  1ATI A;  1JJC A;  3L2Z A;  4H2S A;  1EQR A;  1YGB A;  4YRC A;  2NS6 A;  4WJ4 A;  5E3I A;  4UP9 A;  3IKM B;  2ZZG A;  1WYD A;  4P3P A;  12AS A;  3PCO B;  4YRQ A;  1EOV A;  1NJ5 A;  3VBB A;  1NNH A;  1NJ8 A;  2PME A;  1NYQ A;  1QE0 A;  3VQY A;  3HFZ A;  4BWA A;  1SES A;  2I4N A;  1G51 A;  4EO4 A;  2DXT A;  3TUP A;  2J3M A;  1C0A A;  3NET A;  3QO8 A;  4YRG A;  3RF1 A;  2CJ9 A;  3RKW A;  3HRI A;  4RMF A;  4YRK A;  3V8K A;  3REX A;  2DU5 A;  4OP0 A;  4Q15 A;  4RQE A;  3V7R A;  1YFR A;  2E5A A;  4TVY A;  4ZTZ B;  1J5W A;  4UP7 A;  1WPY A;  4XU3 A;  1FYF A;  4XEM A;  2E65 A;  4LVL A;  2ODR C;  3CMQ A;  2I4M A;  4H2X A;  1BBU A;  4YRR A;  4YRI A;  4ZIB A;  2DZC A;  4O2D A;  3HXU A;  2E41 A;  3EFS A;  4CH5 A;  4YCV A;  3L4G B;  5C51 B;  2IY5 B;  1H4S A;  5HGQ A;  1WQ7 A;  2ZT7 A;  3NEL A;  3HFV A;  3A7A A;  4LNS A;  2ZIO A;  1ASY A;  2PMF A;  3NEN A;  1USY C;  2AMC A;  4YRS A;  3ERR A;  2ZZE A;  5K1P A;  1E1O A;  3R07 A;  2CIM A;  1B7Y B;  3DSQ A;  3RAC A;  4CS3 A;  1E22 A;  4H02 A;  1X01 A;  2EWN A;  4J15 A;  4PG3 A;  2E10 A;  4YRE A;  3REU A;  3UGQ A;  5ELN A;  4YRT A;  4XTV A;  1X2H A;  1EIY B;  4P73 A;  3ICA A;  4YRJ A;  3G1Z A;  1N9W A;  3QNE A;  3HXX A;  4YPF A;  4XU1 A;  2ARS A;  1G5I A;  2ZR2 A;  4HA8 A;  1VQZ A;  4TWA A;  2EJG A;  4YCW A;  2EL9 A;  4YP0 A;  4RQF A;  4YCU A;  3V8L A;  2XGT A;  3HXY A;  2A8E A;  1GGM A;  1HTT A;  3A74 A;  4XEO A;  1X2G A;  2ZIN A;  4RDX A;  2P0L A;  4LVM A;  1PYS A;  4CS4 A;  4CH4 A;  3UH0 A;  2G4C A;  2CGH A;  2ZIM A;  4YRO A;  1H4Q A;  2DQ0 A;  4UP8 A;  2DEQ A;  4P71 C;  3FJP A;  1WU7 A;  1WNL A;  1ADJ A;  1ASZ A;  3V8J A;  1B76 A;  1EIY A;  4WI1 A;  1LYL A;  2XTI A;  1SER A;  4XU0 A;  3HY1 A;  4LVI A;  4P75 A;  4P75 C;  1X54 A;  3HXV A;  4YYE A;  4YRP A;  4AH6 A;  4TVA A;  1B70 B;  4XTX A;  1BIA A;  2AKW A;  3EFR A;  2Q7E A;  4WF2 A;  3MF2 A;  3RKX A;  4KQE A;  2ZT6 A;  4K86 A;  4P72 C;  2EAY A;  2ZXF A;  4YRF A;  4P3O A;  2E1H A;  4XTZ A;  4Q6G A;  1Z7N A;  3HTZ A;  5ELO A;  2DQ3 A;  3A5Y A;  1USY A;  3RL6 A;  2Q7G A;  4TVW A;  2ALY A;  1SET A;  1RIQ A;  2ART A;  4YRL A;  4X5O A;  3P8T A;  2AMC B;  4YRN A;  1WLE A;  1BBW A;  1EFW A;  4L87 A;  1NYR A;  2FYK A;  4EX5 A;  11AS A;  1E24 A;  1E1T A;  2AKW B;  4WJ3 M;  3A7R A;  2DKG A;  2DVE A;  3A5Z A;  3WQZ A;  4P73 C;  1NJ1 A;  1BIB A;  2EJ9 A;  1KMN A;  3MF1 A;  3HXZ A;  2Q5I A;  1L0W A;  5C52 B;  2QHS A;  4XTU A;  3W3S A;  1H4T A;  3RGL A;  1QF6 A;  3L4G A;  5KNN A;  3QO5 A;  4H2T A;  3P8Y A;  3L1A A;  1H4V B;  2DTH A;  1B7Y A;  4G84 A;  2EJF A;  2Q7H A;  3VQV A;  4YRM A;  4H2V A;  4KR3 A;  1KMM A;  3IKL A;  1B8A A;  4PHC A;  1YFS A;  1EVK A;  3MEY A;  5C53 B;  1NJ2 A;  2DXU A;  2I4L A;  2RHQ B;  4K88 A;  4DQ2 A;  2ALY B;  1HC7 A;  2Q5H A;  4P74 A;  1ADY A;  3BJU A;  1NJ6 A;  4H2X B;  1X56 A;  3I7F A;  3KFU A;  3M4Q A;  3HY0 A;  4HWO A;  4CS2 A;  1EVL A;  2IY5 A;  1JJC B;  3HFZ B;  4LVK A;  4YDQ A;  2ZT5 A;  4BW9 A;  2DZ9 A;  2ARU A;  3IAL A;  2C8M A;  3NEM A;  3RKY A;  4HWS A;  2DTO A;  3HXW A;  2ZGW A;  3IG2 A;  2QHU A;  3V7S A;  5K1X A;  2QHT A;  2E64 A;  4TVA B;  3V7C A;  3A31 A;  1WQW A;  2DJZ A;  4ZTU B;  4P71 A;  3M4P A;  3P8V A;  2I4O A;  4HWP A;  3E9H A;  3TEG A;  4P72 A;  4H2U A;  3QTC A;  3LC0 A;  4UPA A;  4P74 C;  4XU2 A;  2ZT8 A;  3LSS A;  4NCX A;  3BFM A;  4TTV A;  1SRY A;  2RHS B;  2HNI A;  4HWR A;  3LSQ A;  4XTY A;  2DU7 A;  2ODR D;  4CH6 A;  3RUX A;  3PCO A;  4H2W A;  2ZZF A;  3UGT A;  4E51 A;  2CJA A;  4TQF A;  1X55 A;  3A7U A;  1B70 A;  2P5I A;  2DTI A;  2CJB A;  1HXD A;  1IL2 A;  1YFT A;  2RHQ A;  4XTW A;  4KR2 A;  2J3L A;  3UFG A;  1Z7M A;  4CH3 A;  3HRK A;  2ZR3 A;  3A32 A;  1PYS B;  2ZCE A;  3TEH B;  1KOG A;  4TQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...