3RKXA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
308
Chain Sequence
KYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 99
structure length 308
sequence length 321
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkxA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkxA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkxA02
1P4AA 2XAJA 4MEXF 3WTYC 3GVAA 3FB9A 4EMKC 2FEZA 1X2HA 4ENMA 4OIOF 5LGUA 3M7GA 1I6XA 5F1RA 1E1OA 2EJFA 1C0AA 3W3SA 2I4MA 4M7AD 3ZN1A 2M30A 2DI3A 1D3BA 4OLFA 2DPUA 5CAIA 1WRJA 2ZNJA 3HFNA 5LGNA 2P4WA 2OZUA 3BPXA 2ZR3A 5TRDA 1XD7A 1YLFA 3F8FA 4P72C 2PMFA 4HLXA 2D2WA 4A12A 2XROA 3ZPLA 4RCBA 4UP9A 1I5ZA 4YREA 3RDIA 2QVOA 3U1DA 1ASZA 2OA4A 3L9FA 3HOSA 4NOYA 3VQXA 1G51A 1WU7A 2Z3YA 3AHUA 3RESA 3L2CA 2NRAC 2QQAA 3VEPA 2HYGD 4ZTZB 1QE0A 2DBBA 4A5NA 5GAOn 4TVAA 2PBIA 2BV6A 5JR3A 1FC3A 2XAHA 3VU3C 3QU3A 3R4KA 4PG3A 3MF1A 3HHHA 3KP5A 3TQNA 4CS4A 4B09A 4C92G 2H94A 1TNSA 4QVCA 4UPAA 1BI0A 5CYVA 3CO6C 1R1VA 2DDZA 2E7XA 3F3XA 3GFIA 1QNTA 3FX3A 1JJCB 3AAFA 4C92A 1TTYA 4EJTA 4KFCA 2H09A 3WTUC 1GVJA 5LRRA 1H9TA 4CH3A 2FNAA 2EWNA 3QO5A 1FBQA 1P4WA 1ONVA 2A3SA 1IF1A 4O3MA 1PDNC 2K4BA 2FQ3A 3T5XA 4EJWA 1LOJA 1Z7MA 3OV8A 1GXQA 2AMCB 1S29A 4Y91A 2FYKA 4U7BA 4WK8F 1SD4A 4AVPA 3QUIA 1S3JA 2EFNA 3G1ZA 4EJOA 3RTRA 2PFBA 3L4GB 1T39A 4BW9A 2CGHA 2ARUA 1PP8F 2X4HA 2Z5UA 5HDNA 4CZZA 2HWVA 1XDSA 4S05A 1USSA 1J5WA 3JW4A 4KN7X 1SRYA 3I4PA 3MF2A 3GEZA 1PP7U 4EM0B 2FBIA 3HTSB 4PGGA 1BM9A 4P72A 4BHCA 4YRGA 1Y96B 3QSUA 1ZLKA 2I4LA 3E97A 4Y13A 2K02A 1G3TA 1D8JA 5D6FA 3CTAA 1K79A 4KA4A 2E10A 2NYXA 1Z7NA 4ZIBA 3JB9D 3LSSA 3RL6A 1YS6A 4J5YA 4RCCA 3QRFF 2EFOA 2C7IA 3H92A 4ZH4F 3HRSA 2W24A 4XTZA 4P74C 1R22A 3E6CC 1JRIA 3F22A 4C8QE 3L00A 1NJ5A 2UXXA 2ZT5A 2JPCA 1ON1A 3ABUA 3GO5A 1BIAA 2Q7EA 3EETA 1XSXA 4BWAA 1KQ8A 3E6MA 5LHHA 5LGTA 3SWNB 4ESBA 4HX8A 2DZCA 1U1TA 2M1BA 1N9SA 3E9HA 1FNNA 5HOOA 5LHGA 2K4JA 2LF8A 2ADUA 2CJ9A 2MLKA 3B73A 3MEXA 5JFRA 2STTA 4I09A 2G9WA 3FZVA 5LJ3d 3F8CA 1BC8C 2O8XA 2M5WA 4LG0B 2EFPA 3SZTA 2PMHA 3IHUA 3KP3A 3E5QA 4UV8A 5GAN6 4YCVA 2HKOA 5ERIA 3WE2A 3FWEA 2P7CB 2FB7A 4M78D 4ESJA 2OU2A 4M9SA 5DD8A 4M75B 1YW8A 1LDDA 3WU1B 3HFVA 2XUBA 3KLNA 6PAXA 3ABTA 2IA0A 1FYLA 5DV5A 3ERRA 3BJOA 5HS7A 5BOXA 2ZT8A 3CUQB 2EA2A 4CO8A 2XKPA 4LD5A 4C92F 4YPFA 1HW5A 5GAMe 4YRRA 4N9HA 2HKXA 2B0LA 1FP2A 1R1TA 5DEQA 3BROA 1N9RA 1U1SA 2PLYA 2DTHA 3EFSA 2HFHA 2FF4A 4J6XA 5GANe 5D4SA 3KLOA 2GXBA 1HBXG 3JCMg 4A6DA 3BW1A 1EOVA 4KMUX 4ENKA 4M75F 2RHSA 1B1BA 5D4RA 3QO3A 3VB2A 3ERED 1J0RA 2W84A 2H6CA 4Q47A 5E8GA 1QF6A 1XSDA 5BQTA 1MJAA 5KNNA 1VTNC 2QYOA 3FXUA 1X3UA 3Q9SA 3WTTC 3JCMc 3U9GA 2KJCA 1L0WA 4YIFA 2GZWA 4O5VA 5ILVA 3KP4A 2XAQA 4IVNA 4AD9A 3OD1A 1Z6TA 4WXHA 3HHGA 1S7OA 1O3RA 1NJ1A 4OIRF 5LEKA 1R1UA 1Z9CA 2GWRA 2CYYA 3IKVA 1KQ2A 1NJ8A 4M72A 1JE8A 2QHTA 4GYGA 5HDKA 1QGPA 3DFGA 1X01A 4P3OA 3JCMf 2DO7A 2E1HA 2ALYA 5GAN7 1B9NA 4U88A 3C3WA 2HEOA 5E1XA 3BJ6A 2DJZA 1JHHA 4MTDA 5CVUA 1U3EM 3R6SA 4M77E 4MNUA 3V7RA 3V4GA 5K1XA 5GAMj 2FMLA 3KZZA 4EVIA 4EMKB 5FGMA 4UXNA 4YRMA 3JCMV 1X56A 4P73C 4HWRA 2P6SA 4QLCU 4R8HA 1K78A 4XTYA 4PJOG 1QZYA 3A5ZA 1B34B 3FM3A 1FSHA 4GGGA 2PI0A 5D6EA 1OYIA 2BE5F 3L09A 3QU6A 4XBFA 5L3EA 1WYDA 1R5HA 4RQFA 2F2EA 1BC7C 4YROA 4NCXA 4F7UA 2FOKA 5D5WB 2MH9A 3F72A 2DU9A 2QLZA 4K87A 2ZBKA 4CS3A 2P7VB 4C92D 4CDGA 3KEQA 3C18A 2A68F 2L4AA 1IRGA 3B02A 2VXZA 1QQIA 4TVYA 3TOAA 4M7DF 4J6YA 2DLLA 4LJZF 2QBYA 1IN4A 2EA4A 3U2RA 3RYRA 5GAN8 1K7AA 3ECHA 3FF5A 5GAN5 2DTIA 3QOPA 1HKQA 4HZFA 4YRQA 4EMSA 3F6OA 2MA3A 3V7CA 1EIYB 4RGUA 3IKLA 3V8LA 4RB2C 1UCRA 4IF4A 4I0AA 4M7AB 3EQLF 1X54A 5HGQA 3PGGA 1U78A 4EM1A 3UGQA 2D45A 3QP5A 4RS8A 4KIBA 4YRCA 2FXAA 2FBKA 4XSZF 4WF2A 2Q8KA 5CVJA 1EVLA 2ESHA 5LJ3e 1E22A 4IRIA 2DT5A 2CQKA 2GAUA 5LJ3j 3A7AA 5F5WA 4HA8A 1ZRCA 1ZHFA 5I21A 1MGQA 2XGXA 4Q5SF 1ON2A 4EGYA 4XRFA 4N0AC 4M7DE 3IC7A 4YG2F 4PJOA 1YIOA 2OBPA 4A6EA 1XGNA 3RKWA 3FJPA 4Q15A 3DPTA 3DF8A 4R79A 1X2GA 2EK5A 1HTTA 2HNIA 5ICFA 2WV0A 2ZTGA 1JHFA 4IHTA 4L9TA 4OIPF 1G4DA 3I0TA 3ZMSA 3IKMB 2ZIMA 4P3PA 4BYYA 3F6VA 4L9NA 5K1YA 2RGVA 2ZXJA 2CG4A 5GMKe 3HY0A 3P9KA 3IRQA 3K2ZA 1YGBA 4K86A 4C8QB 1G5IA 4H2VA 4WXDA 5BPDA 2JPBA 3RI4A 2JSCA 1QPMA 1XGOA 5A2QK 3F8NA 5DY9A 2RV8A 1G3YA 2Y48A 4O2DA 5HVQC 1WLEA 3LA7A 4WCGA 4C8QA 3ROUA 3HIFA 5DCMA 1BN5A 3INZA 4XU2A 2HDCA 3DXJF 1B70B 4KNYA 3FMRA 2E1CA 3HTUA 4YRNA 2Y0MA 1F4KA 5E17F 4X9DA 3QTCA 3K1MA 1R5GA 5LJ5g 4P71A 1UFMA 1BI3A 4NL2A 5C52B 1IN7A 3UGTA 3K9TA 5LLQA 5HLHA 3K0LA 1HW1A 1MDMB 3BP8A 1YTYA 5LRSA 5K5QA 2E64A 2V6CA 1LJ9A 5D5UB 4BH9A 4PNOA 3SFZA 4F7UB 4PJOF 1HQCA 3N4MA 3TGNA 3J80K 4JRKA 4HQMA 1I81A 3SZPA 3K69A 2X0LA 4G7ZF 2Q7GA 2ZIOA 3T0YA 5LJ5j 4WI1A 4WJ3M 2M8EA 2LKPA 2A6HF 1DP7P 3HXUA 2DK5A 2QWWA 3GZ6A 4PJOC 4LB5A 5ILUA 4CGZA 1YFTA 3KP2A 4AWXB 2CIMA 2KIFA 4WX9A 1T38A 4CHUA 5C53B 5CVRA 3TDUC 2G7UA 4KICA 2VBYA 4AIJA 4M7DG 1H641 3R60A 3MQ0A 2HGCA 2DXTA 2HTSA 4HT8A 4U7DA 2IY5A 3T8TA 2XVCA 1FWZA 1E17A 2LNBA 1S8NA 4EX5A 2A6EF 2JTVA 1RZ4A 3C1DA 5LHIA 1O3QA 3TUPA 2W85A 3R61A 3LAJA 3F23A 1YYVA 2DPDA 1Z1DA 1X55A 1DPUA 1YG2A 3JB9F 4I98B 3BY7A 3JB9H 5DYMA 5GAOq 2VC1A 4JRIA 3M1EA 5L3BA 4HDUA 3WGGA 2VN2A 2QBYB 1ZRFA 3R0AA 5GANf 4HWOA 1O7LA 1B70A 5E3IA 1BJAA 4C8QC 2ZT6A 4RGSA 1KYZA 3WU0A 1SFUA 1Z6RA 3K1NA 5FO5A 3V8KA 2IPQX 2DTRA 2HS5A 4WXCA 3L4GA 4LB6B 3QAHA 3RUXA 2ZKZA 1Y0UA 1FOKA 4CYDA 2IJLA 2A07F 3TO6A 3FHZA 1ZH5A 2QM3A 2VE8A 1TBXA 2XHKA 5EEHA 3MFKA 5LJ3g 3DKWA 3GFMA 2O61A 5ELOA 2CSOA 3L1AA 4TQFA 2ZJ2A 2Z99A 3CMQA 4I01A 2ZGWA 2EV6A 3P9IA 3ZN0A 1XGSA 1KQ1A 2RNJA 4X9CA 3TEHA 2ZCEA 3CUQC 2PEXA 2E7WA 2QTXA 2HQRA 3J81Z 4PJOD 2V1XA 3JCMd 4IPAA 4OIQF 2KIMA 1WI9A 1KGSA 3FMSA 4H2WA 3I64A 3M8EA 4RB1A 3IWFA 5LBQA 4RB0A 3E6BA 3KCCA 1TQMA 4WJ4A 5BS6A 2RKHA 1MKMA 3KEOA 1ZN2A 3QHSA 4YRKA 4UNOA 4Q4ZF 4ASNA 1D3YA 2VXEA 2QQ9A 4HF1A 1QZZA 1SMYF 1E1TA 3CUOA 4HF0A 2OQRA 5D8KB 4P75A 1SFEA 2OAZA 4GO1A 1HC7A 5FB2A 2RC4A 2Z33A 1IN8A 2E65A 1Q1HA 2FRHA 3HXZA 3RPUA 2KJBA 2FNPA 4HW0A 3WG9A 4NB5A 4KYWA 3WTSC 5LJ3f 3E6DA 3I71A 3ML6A 4ZYGA 2YX4A 3RJPA 2JZYA 3VQWA 2EFQA 3SWNA 3D5LA 4ZZLA 5KK1A 4OINF 4YCUA 3P8TA 3IWZA 5GAMg 3HFZA 2ZNZA 4HX4A 1TH7A 2ZZEA 4EMGA 3JCMP 2DK8A 4UV9A 3SXYA 4YRSA 2ARTA 4K2EA 1TW2A 1T98A 1Z05A 1FLIA 3H3ZA 1EH6A 5C51B 2ELHA 4M7AA 2DQLA 1RUOA 5HLIA 4ETSA 4MMLA 3I54A 1T6SA 3WTZA 3BDUA 4NL3A 2EV0A 2H6BA 2ZZGA 1LEAA 2FMYA 1O3SA 4CICA 4LNSA 1L3LA 1W4MA 1KQ9A 1MD0A 3DP7A 1XDUA 2W57A 4LLLA 4H0EA 4P55A 3JB9G 1YB3A 4UVCA 2OQGA 4BQAA 1K6OA 4RDXA 3EYYA 4EGZA 2MH2A 1XCVA 1AOYA 2IA2A 4M7DA 1M8VA 2O0YA 3HRTA 4E70A 2H27A 4HX7A 3JAMK 3P8YA 3TOBA 4H2XB 3GZ5A 2ESNA 1USTA 3LA2A 4RAYA 3JB9J 1NYRA 4M73A 4H2TA 1E2XA 2IY5B 2L4MA 1GHCA 1MZBA 2ETHA 4JBAA 2R3SA 3DPLC 4UUVA 1ADJA 1R00A 3HFZB 4EM2A 1MJBA 2CWEA 1LEBA 1IXRC 1XN7A 4JUVA 4LLGF 3BPVA 5CLSA 4M78B 4F7UF 4XU0A 3MZHA 4M78E 4MEYF 2UZKA 2K27A 3O3KA 3GUDA 4IXAA 4RB3C 1WKMA 4P3NA 3HSEA 2DQ0A 1SD5A 2IW5A 4U0VA 1SETA 4HLYA 4XQ3A 4KDPA 4TTVA 4CXFA 2FA5A 4HVCA 1OYWA 3W6JB 4TWAA 1U6GA 4L18B 4M7AC 3P9CA 4MGRA 5DUIA 5DCFA 5HLGA 4A5MA 2DTOA 2YLCA 2WWYA 4EJUA 4OP0A 1H4TA 2L02A 3REXA 1B8AA 4F7UE 2YX7A 1XMKA 4PZJA 3KFUA 2J5PA 2G7HA 3E9IA 4L87A 3QNEA 4M7DD 4IJAA 1UHMA 1FZPB 4UHTA 2P5LC 2YR2A 1YCYA 1MJ9A 1XCBA 4EMKA 4Q48A 1FBSA 3RACA 2KRFA 3LSTA 4M75A 2Q7HA 2NNYA 3PCOA 3WQZA 5K5RA 1W7PD 2OZ6A 1RNLA 1IN6A 3K1PA 4ZTUB 3MZYA 5E20A 2RM4A 5CVIA 1J75A 4ENNA 4RGRA 1H4SA 2F5CA 2EJ9A 2DZ9A 4C92C 2VE9A 3E5XA 3JSOA 1IXCA 1U2WA 4YRLA 2FBHA 2M87A 2I4NA 2GQQA 1HSTA 4P9FA 2LSOA 1IZ1A 2ISYA 5BPIA 2XKOA 2RHQB 4L5IA 4YFXF 5FLXZ 5GMKm 4UP8A 2ISZA 1JGSA 3ZP5A 1P92A 3A5YA 1UB9A 2QHVA 4WWCA 3ZQ7A 4TVAB 1GGMA 3CLOA 4JK1X 5L3DA 1I5LA 2MBFA 4PJOB 2ARSA 3J81K 4P5OA 3NENA 4M75G 4DNCA 3HXYA 3EUHA 4AIKA 5LJ5d 1GXPA 4YCWA 4LG0A 4UVBA 4IRGA 1A04A 3MCZA 1C0WA 5L3GA 4XLNF 3UH0A 2L3DA 4XU1A 3NEUA 5FFXA 3HRKA 2VONA 2V1DA 2VC0A 4PDKA 5GAOm 1WQ7A 4K88A 2DU7A 2PN6A 3HY1A 3VODA 1ATIA 4EO4A 2IT0A 4HDVA 4P74A 2JT1A 5FD6A 4J15A 1B9MA 2P0LA 3RPQA 2XAGA 3SB2A 3JCMJ 3HRMA 2V79A 4FX4A 2QENA 4KR2A 1IN5A 4L9JA 2VT2A 3KZYA 4M75C 2PG4A 2XV4S 3UFGA 1YS7A 3NETA 3HXVA 4XTVA 1P2FA 1ZG1A 5D8LB 1HK9A 4F7UG 4XEOA 5CJ9A 3BDDA 4A2UA 2UWMA 1W5TA 2M45A 3FM5A 3JAMZ 2NNNA 5J6XA 2K7LA 1H0MA 1Y96A 2EAYA 5D5VB 2L01A 2VBZA 2COMA 5AONA 2TDXA 4G84A 2XAFA 3HFOA 4BHPA 1D3BB 4LFUA 4G6QA 5E8IA 4UP7A 1FX7A 1R23A 3BZ6A 2ZO4A 4X5OA 4E51A 2D1HA 3JTGA 4XTXA 3CDHA 1J59A 3TEGA 2Q5HA 1YQAA 4XLPF 3PCOB 4A54A 5E1ZB 5GAMf 3HSFA 1G3SA 1G6NA 3EFRA 4I7HA 2VOOA 2ZNIA 3KP7A 4AIHA 4M9ZA 1QBJA 1V4RA 2BYVE 4CH4A 2J3LA 4DQ2A 1W5SA 3P8VA 3GLXA 1I27A 1XSVA 1RIQA 2DFIA 1MGTA 1PYSB 3PZCA 2EB7A 2V1UA 5GANg 1B6AA 1YW7A 3PQKA 1U5TA 3TKYA 2C8MA 3S2WA 3SHFA 3REOA 5GMKh 4EV0A 1KU3A 1NNHA 1P6RA 1FSEA 3ECOA 4M7AG 5CVVA 3R07A 1EH7A 2K57A 3IKTA 1FY7A 1LDKB 2HYFA 4LLNA 2DW4A 4G7OF 2RDPA 2AXLA 3FMQA 4TVWA 1S7AA 3A7UA 1BIBA 3ZMUA 2DQ3A 1OR7A 4V2SA 4NHJA 5GANh 3JSPA 3RIRA 4XEMA 3V7SA 2ZCWA 4D0PA 3HXWA 5H6RA 1USYA 3ZMTA 2HTJA 4L9VA 4M78A 4YRPA 4M78F 1ZAOA 1I1GA 2IP2A 5L3FA 3TEHB 4MQ9F 4M9XA 1ODDA 3WTXC 1PYSA 5LJ5h 2ZFWA 2P5KA 1B4AA 1J7KA 1TW3A 4QVDA 5EEGA 5TJJA 3HUGA 3GWZA 3A74A 3IG2A 3FIFA 1B59A 3A32A 2AKWB 1EIYA 5D5XB 1DDNA 5GAN2 2IVMA 4FX0A 4M77D 3MEYA 1L0OC 4M7DB 5L3CA 5HS8A 1ZRDA 3HTZA 5GAOl 1SD6A 4B8XA 4PCQA 5ICCA 1IXSB 1KA8A 3VOEA 1NHAA 1H4QA 3WTVC 4KQEA 4A53A 4C8QG 1OKRA 3RYPA 3P7NA 1LVAA 1KU7A 2L54A 2CW0F 2Q2EA 3CJNA 2P8TA 3JTHA 5H6QA 2GA1A 2YU3A 1U5TC 3J7AO 3M9AA 5GAMh 5J8FA 3DQVC 1BBYA 3I59A 2AS5F 1F9NA 2QUFA 1IUYA 4YRFA 3HYIA 5FD5A 4EQQA 4A0ZA 4A0YA 1J5YA 1BI2A 3TO7A 3M4GA 2YSRA 1D5VA 5LEJA 4XU3A 2R7DA 12ASA 1OPCA 1OMIA 4HYEA 5GAOr 4M77C 2J5OA 3C7JA 1KMMA 3QPHA 2VBXA 2DU5A 1LDJA 1FP1D 1USYC 1CGPA 4ZZDA 4JLIA 4QWQA 1YFRA 1TNTA 5FLXK 4M78C 3WTWC 4HT9A 1STZA 4P73A 2W25A 4RQEA 3LSQA 4HAMA 1WSUA 2NS0A 2LF7A 3IRRA 4HWPA 1Z91A 2XGTA 1NJ6A 4YIIA 3HXXA 1P4XA 3JCMe 4FHTA 1IAWA 4IHSA 4BNCA 2K86A 3F21A 4HOBA 3GF2A 4FT8A 4ZYDA 1XMAA 2ZZFA 2YLBA 3GX4X 4G7HF 2JRTA 1W7PB 4Y15A 2DXUA 2Q5IA 4RAZA 2CFXA 4HWSA 4ON0A 2IA1A 2Q0OA 3FXQA 4G6DA 1G5HA 5JHUA 1TQPA 3Q9VA 3LFKA 4GXOA 3F8MA 4N0AA 4TV7A 2DVEA 3LC0A 1EV7A 1VQZA 2ZT7A 1FYFA 5F6FA 2STWA 4MHGA 5IT3A 4KMFA 4M7AF 2D1VA 4DPGA 5K1PA 5ELNA 5AIQA 3LQQA 2P5VA 4LMYA 5GMKj 1FBUA 2A61A 4KIGA 2QHUA 1KU2A 2Y90A 4H2YA 1REPC 1LQ1A 2G4CA 5LJ5e 4UVAA 3FXRA 1SERA 4N9IA 2PQ8A 4M78G 4PGHA 1KYWA 1T0FA 2VXFA 2WC2A 2KKOA 2DAOA 1K78B 5IT9Z 1YW9A 1O57A 3RGLA 2EV5A 2P5IA 1B7YA 4LK0F 2E3CA 3I58A 5F64A 4M74A 5JI6A 3GFJA 1WQWA 4M77A 3CO7C 1KU9A 1H4VB 1NYQA 1SAXA 3T1BA 1T2KA 3RKYA 1ZGAA 4EMHA 1CF7B 2UXNA 1IRFA 1EVKA 2GIVA 3GIBA 3OOPA 2YHTA 2ALYB 2GA2A 1FPQA 2ZMEA 5GMKi 3R0JA 3HSBA 2I4OA 5JVTA 11ASA 3M4PA 2FSWA 3COAC 1RUNA 5GANd 1LNXA 1H9GA 4HV6A 4GYIA 1WQ2A 5DD4A 5ICGA 3HRUA 4H02A 3DSQA 2EJGA 2RN7A 1ZARA 1HKTA 5GMKl 2EL9A 1BI1A 2O3FA 4C8QF 3E3VA 1ZG3A 2VT3A 1BBWA 3VQVA 2FU4A 3BY6A 3WGIA 3JB9I 3LA3A 1R58A 2KIUA 1R36A 4CH5A 4O6JA 5J8CA 2PMUA 3JCMh 3T8RA 2F5EA 1UHWA 4M6XA 1W66A 3IL2A 1AWCA 1ZGJA 3GYHX 2JN0A 3JCMX 2VC8A 3VBBA 1ADYA 2VOPA 3I5UA 1B76A 4MMKA 4YFKF 3NELA 4TQDA 2CO5A 3A7RA 4P71C 3D0SA 2PMEA 3ZMZA 3I59B 1R7JA 1O3TA 4OMYA 1W7PA 1V3FA 5GAOp 3BJUA 4PHCA 4YRIA 1HSJA 4HBLA 3BFMA 3BOQA 2A5YB 2ACJA 1HKSA 2Z9OA 4S04A 5HDGA 3O6BB 3HRIA 2BGCA 1M5Q1 3MAJA 1ZREA 2CJAA 1I1SA 2ODRC 1YFHA 2GXGA 4LGWA 2RHSB 4YFNF 5GAMd 3Q5FA 1SMTA 3JCMQ 4I0BA 1FYMA 1BBUA 2AMCA 3TO9A 2HZTA 4M75E 2VODA 1E24A 2F5DA 2RHQA 4U0WA 2DEQA 2O6GE 2Y75A 2ODRD 1N9WA 2CJBA 2RB6A 1YO5C 4G85A 4MQVA 4XTWA 2MD5A 1ASYA 3NRVA 5A2QZ 4L0ZB 3NQOA 4BAYA 4F7ZA 2AKWA 3L2ZA 4ZYEA 4KUMA 4M77G 3GW2A 2R7FA 2E1NA 3EDPA 1RIOH 4A0XA 3KFWX 4I2OA 3LAPA 3G73A 1LJOA 1JXSA 1WPYA 3JCMW 4ENJA 3VQYA 4YRTA 4XTUA 2BBYA 4C8QD 3G3ZA 2F5FA 3ICAA 4H2XA 5KVRA 4OU0A 2BEOA 2E5AA 1J9IA 4HWTA 2FE3A 4KN4X 3QP6A 3V8JA 4CH6A 3J80Z 1KQ0A 4Z2YA 4L0YB 3IALA 5GAN3 4HF2A 3I53A 2ZNYA 3LWFA 1J2XA 4PJOE 3O2PE 4U0YA 4BHBA 4CS2A 4KIFA 3HOTA 2E41A 2XIGA 1ZYRF 2HQNA 1U8RA 1JBMA 3H3UA 3LQRA 4KR3A 1B7YB 1EH8A 1XB4A 1U5TB 2P6TA 4P75C 4C92E 1KMNA 3QPTA 3EYIA 4Y17A 2QZ8A 1Z7UA 4N0BA 4H2SA 3CUQA 2C6YA 3WGHA 4GCVA 3DV8A 4G9YA 5E1WA 3QO8A 3SWNC 1RI7A 5ED4A 5BMZA 4NQWA 4M77B 4HQEA 4I02A 3ZMDA 5LJ5f 4XSXF 4MTEA 2EJRA 2MLGA 1D8KA 1YFSA 5ICEA 2RQPA 2HOEA 1QO0D 4ESFA 1HXDA 1SFXA 2WTEA 3A31A 3F8BA 3W6KB 2VBWA 2YPRA 4M75D 2A69F 1I8FA 4P9UA 1F5TA 2DKGA 3M4QA 2OD5A 1EFWA 2PJPA 3ELKA 2HR3A 2XASA 2CGPA 1DUXC 3VFZA 1S6LA 3E5UA 2LDUA 5AIPA 2J3MA 5HS9A 2MC3A 5ILSA 2RVCA 2DQRA 3DEUA 1WWXA 4KT5C 4OMZA 5GAN4 2QQBA 3N97A 1EQRA 1SD7A 1LB2A 1SESA 3BWGA 1LNWA 4LK1F 2EFWA 4L5JA 2XTIA 4M7DC 1CF7A 4OOIA 4YYEA 3PQJA 1KOGA 2O03A 4AH6A 1NJ2A 1OYYA 5K5OA 4M7AE 1LYLA 1ZG5A 4R1HA 4Q6GA 1IW7F 3SQNA 5H20A 1I4K1 3KP6A 5DUKA 3ZMVA 4RMFA 3WODF 1FYKA 4HV5A 4J6WA 4M77F 3NEMA 1HW2A 2ZR2A 4P96A 3HSRA 4H2UA 1F1ZA 4YDQA 3KE2A 1TQIA 4M6YA 2IRFG 5IT9K 3BJAA 5DCMB 4G94A 1DPRA 3JCMb 3QO7A 4YP0A 3GXOA 4ZYHA 1ULYA 1ZLJA 1BOAA 3TDZC 3WE3A 2I2LA 3GFLA 4G8XA 3M8FA 2RA2A 3PFIA 3RKXA 5LJ3h 4YRJA 5DDGA 3RF1A 1IL2A 2XRNA 3REUA 4JQFA 1MDMA 3ULQB 3MWMA 4IRHA 1WNLA 3RERA 5E18F 2ZXFA 4EJVA 1G3WA 4M71A 1B34A 3KETA 4C92B 1JJCA 5GANj 2NAZA 1O7FA 4BXUA 1PUEE 2RD1A 2QHSA 2V9VA 2ZMEB 1XGMA 3ISPA 1TLHB 3I7FA 4RGXA 5FFZA 1FT9A 2ZINA 3L7WA
chains in the Genus database with same CATH superfamily
1P4AA 2RK1A 3BTLA 2O88A 1ZGWA 2XAJA 1O4XA 1B72A 4MEXF 3CCRT 3WTYC 3GLLA 2AXTC 1T56A 3GVAA 1WZOA 3FB9A 4EMKC 3PL8A 1KONA 3DTIA 2FEZA 4F92B 3C12A 1X2HA 2LMDA 4ENMA 4OIOF 1NBEB 1UGRB 3MKLA 5LGUA 5IOZA 4UB8C 4BBRJ 3M7GA 1I6XA 2YUOA 5F1RA 1E1OA 2EJFA 1C0AA 5IOYA 2KY9A 2I4MA 3W3SA 4WJ3M 4MZTA 4M7AD 3ZN1A 2MWOA 3RCOA 2XD0A 2M30A 5CQXA 2RAEA 2DI3A 1D3BA 1F43A 1H3ZA 4OLFA 2DPUA 4V2FA 1WRJA 3S93A 5CAIA 1PC0A 2DOAA 2XPVA 2ZPHB 3HFNA 2ZNJA 5LGNA 2P4WA 2R7RA 1WHUA 1FOWA 2OZUA 5TISC 2JUGA 2X1DA 3BPXA 5TRDA 2ZR3A 1XD7A 2H1LA 3NHNA 2DBMA 1YLFA 4BI8B 1KQSP 5E3OA 2QEXA 3F8FA 4P72C 3S8PA 2PMFA 4HLXA 2DFEA 4MLOA 2DYSH 4AC0A 2D2WA 2F5VA 3A8LB 4RUGA 4A12A 1YWOA 3KEYA 2L7MP 2XROA 3ZPLA 1M1GA 4NC8A 4RCBA 4A3KJ 1I5ZA 2OTJI 4UP9A 2V7FA 1YJNI 3RDIA 1T8IA 4E2FB 2CMPA 2QVOA 2H8WA 4Y92A 4LUEA 3U1DA 1ASZA 1ENHA 3QBYA 4K11A 2OA4A 3L9FA 3HOSA 4M3GA 4NOYA 3VQXA 1G51A 2QCOA 4KBMB 3M3YJ 1WU7A 2Z3YA 4AYBA 3BLYA 2FL7A 3AHUA 3EH1A 4J9FA 1GT0C 2XKOC 3RESA 3L2CA 2NRAC 2QQAA 4QSHA 3CMAI 3VEPA 3G71Q 2ZFUA 2HYGD 4ZTZB 3N05A 1FXXA 1X69A 1QE0A 2DBBA 3CPWS 3H0HA 4A5NA 4GRIA 4IHXA 4DOZA 4L6V5 5GAOn 4TVAA 5D7UA 2PBIA 3VKIA 2BV6A 4CCMA 3QZ9B 1BCMA 5FLXE 5JR3A 1FC3A 3OL4A 2XAHA 1M2OA 3QU3A 3R4KA 2WB1N 2IS4A 3VU3C 2RF0A 3J7AF 4PG3A 3OMCA 1Y1VJ 4FCYA 2LNVA 2RJEA 3LH0A 3H5RA 3MF1A 3HHHA 3KP5A 3REBB 2R5YB 3TQNA 2YU9J 1HSQA 1MBHA 4CS4A 1WJBA 4B09A 4FM4B 3VQYA 4X1VA 4CCKA 1JJ2P 4C92G 1GCPA 2H94A 3W2VA 2AKLA 2G6FX 2KISA 1TNSA 1N25A 3K10A 4QVCA 3CC7A 4PK4A 3JRGA 2CZ6B 2CREA 2L3SA 4UPAA 2CP2A 1K8AC 1BI0A 1MW7A 2CQNA 2EYYA 5CYVA 2KZGA 3CO6C 5IXBA 1R1VA 3CCUI 3MQZA 2DDZA 2E7XA 4BEHB 2EQJA 2R58A 3F3XA 3GFIA 1NH3A 1QNTA 3BR2A 3BR0A 2KZVA 3FX3A 5EGOA 2HMAA 3AAFA 4C92A 1JJCB 1TTYA 3DTEA 4JX5A 3WXMB 2E70A 4EJTA 4KFCA 1RLPC 1WXBA 2H09A 2XDVA 1GVJA 5LRRA 3WTUC 3QWLA 1H9TA 1WJQA 4L5EA 2QQRA 5KCHA 1ABQA 2FNAA 1RESA 2EYWA 2GNCA 2EWNA 2CUFA 2Y0SN 1QVPA 2HXOA 3L2UA 1AWXA 2KRNA 1VQ5A 3QO5A 4KH0B 5K1XA 1OISA 1FBQA 1H92A 1P4WA 1ONVA 2A3SA 3CBMA 1MV3A 3EAEA 1IF1A 4O3MA 1PDNC 2K4BA 4RG8A 2HKNA 2FQ3A 3T5XA 2DL5A 5C6SA 4B3XA 4EJWA 1LOJA 2ZPFB 2M9HA 2OUMA 3OV8A 2E3HA 1GXQA 5CKTA 2E1OA 5KYXA 1S29A 1Z0XA 2FYKA 4Y91A 1TUCA 2AMCB 4U7BA 4WK8F 1SD4A 4AVPA 3QUIA 2R5ZA 4RAFA 4EDUA 1S3JA 2EFNA 3G1ZA 4EJOA 4ANJA 3RTRA 2A5WA 3CDLA 4A69C 2PFBA 4BY7J 1T39A 2GFAA 1QPIA 2CGHA 1Q7YU 1MMSA 1VIFA 2ARUA 3L4GB 4BW9A 4B4CA 1K83J 1PP8F 2X4HA 2WAEA 4B48A 3H36A 1ZBXA 3UATA 3OYEA 1D0ZA 2HOSA 2Z5UA 5HDNA 3OW2S 2JVGA 4CZZA 3E9FA 2HWVA 1XDSA 4RLFA 4PL6A 4LVJA 1YJ9T 4HWSA 2LT4A 2GBYA 4S05A 1K8AR 2ZPIB 1USSA 3OBWA 1J5WA 3CCRA 3ZL7C 3JW4A 4KN7X 3OYJA 3VYGA 3CC7Q 1UGQB 4YTLA 4J9BA 3I4PA 5CKDA 2D5VA 2QA4Q 1SRYA 5KH6A 2QHTA 1XNIA 3GBQA 3MF2A 3GEZA 2VQLA 1PP7U 2KK4A 5J3BA 4EM0B 2FBIA 3HTSB 4PGGA 3ASOH 3VUBA 1WJRA 2BZXA 5GJWB 1BM9A 4P72A 1VQPA 4X1EA 4BHCA 3G71T 4YRGA 1Y96B 3QSUA 1Z9ZA 4BACA 1ZLKA 2I4LA 3E97A 4Y13A 2BW3A 4XRSG 2K02A 1G3TA 1D8JA 1WJCA 5D6FA 4DW6A 1W6XA 3VS2A 1PSFA 2DFHA 3CTAA 1K79A 4KA4A 1GBQA 2NYXA 2E10A 4ZDOA 4IIOA 1Z7NA 4XOPA 5K7HA 2OTJQ 3TW7A 3VRZA 4ZIBA 3EGXA 4HRIA 4J9CA 3JB9D 3LSSA 3SDBA 3QIIA 1YIJQ 1YS6A 2DXBA 4J5YA 4RCCA 3RL6A 3QRFF 4E7SA 2EFOA 2C7IA 2DOFA 4AFSC 3ZQGA 3H92A 2EGEA 3E19A 5C0MA 4ZH4F 3HRSA 5JLWA 3MEAA 2W24A 2K3YA 1JT6A 4XTZA 3QTCA 1R22A 4P74C 3E6CC 1JRIA 3H6ZA 3F22A 5FKLA 4C8QE 3L00A 5KAIC 3C0CA 3C95A 2MSYA 2ZSHB 5I2MA 1NJ5A 1LVKA 3OOUA 2P0KA 4OMPA 2UXXA 3EH2A 3TMOA 1XTAA 1QVFA 1JKPC 2WSCE 3M9QA 2ZT5A 2JPCA 3LWIA 1IRXA 5M5WJ 1ON1A 2JMCA 1HDPA 3ABUA 3GO5A 1B70B 1BIAA 3ZQCA 3QG1A 2AHQA 3M5AA 2Q7EA 3EETA 1XSXA 4BWAA 1KQ8A 2Y9YA 3E6MA 5LHHA 1RR8C 5LGTA 2RPNA 3SWNB 4ESBA 4HX8A 4EEFG 2DZCA 1U1TA 2K79A 4HKEA 1EF4A 2M1BA 3TEDA 2JUFA 1N9SA 3E9HA 1FNNA 2COBA 4Y7NJ 5LHGA 5HOOA 1QZEA 2K4JA 1OULA 3AG3H 2M0OA 1JJ2S 2LF8A 4IIMA 3VS6A 4BS9A 4J01A 1AOJA 4XLHA 2ADUA 3S1RJ 2GM4A 1M30A 2RO0A 2CJ9A 2MLKA 3B73A 3MEXA 5JFRA 3HKSA 2STTA 1ZHIA 4I09A 4YELA 2G9WA 3FZVA 3J7AY 5LJ3d 2CH4A 3F8CA 2IGOA 1VQLA 1BC8C 3P8HA 1VQ8Q 2O8XA 2M5WA 1NJ8A 2C0IA 2O9VA 4LG0B 2EFPA 4CC3A 3LNQA 1R9TJ 3SZTA 1UG0A 5HK0A 4ZN1A 2PMHA 3IHUA 2RJCA 3KP3A 1JU5C 3KUFA 4IEJA 2LLKA 3E5QA 4UV8A 3LWHA 5GAN6 3ASKA 4YCVA 2HKOA 3FK6A 5ERIA 3WE2A 3FWEA 2P7CB 2KXDA 2IVWA 1MMGA 5EG2A 2WAFA 2FB7A 3DLMA 3CJQB 5A0GA 3BZCA 4M78D 2E1MB 4A3CJ 4ESJA 2OU2A 4M9SA 5DD8A 2D9TA 2OAUA 2XDBA 2EKOA 2X6WA 2PMZN 2X6YA 4M75B 4HNTA 1Y0NA 3Q3SA 2JZ2A 5CKEA 1YW8A 3CC2A 1LDDA 3WU1B 1OOTA 2X6XA 3P8DA 1YJNQ 3HFVA 4OMLA 2RQWA 2XUBA 3KLNA 4AIDA 2A05A 6PAXA 2E3IA 3ABTA 2IA0A 1FYLA 2CUBA 2GXAA 3BCAA 2JSPA 2MWPA 5DV5A 1HF0A 2Q1ZB 4JJCA 4RTTA 4LOCA 3ERRA 2KROA 2EYZA 2OJED 4C0DB 3TREA 3BJOA 3CXCA 2QEXQ 1IV8A 5HS7A 1Q82U 2BHYA 1HYOA 1BBZA 4BGDA 2R7QA 5BOXA 3MO8A 2ZT8A 4N4OB 1VQ5T 2PVDB 3I9QA 3CUQB 3WG7H 1ZQ3P 4Y52J 3R6OA 2EA2A 1A6QA 2XKPA 4LD5A 4CO8A 3DB4A 4LDUA 1HW5A 2IBDA 1UB4A 2JMAA 4RTXA 4C92F 4N9HA 1TWBA 5GAMe 2HKXA 1X2NA 2F1LA 3QZ5B 4KJZA 4YRRA 1YE9A 2B0LA 1QVFP 1FP2A 2DA6A 1R1TA 1B7TA 3D1NI 1YITI 2DAQA 3DWLE 5DEQA 2KYMA 5DM7R 1YHQT 3BROA 1N9RA 3BR5A 1U1SA 5M9OA 1RAFB 1QWFA 2AQEA 4E7ZA 2XGCA 2PLYA 1N8RR 2X3XD 1MNDA 2BVMA 1SFOJ 5CKBA 1WHHA 4ZGDB 4J9HA 2MCNA 3N5BB 1NJIR 2DTHA 3EFSA 2HFHA 2FF4A 1OCTC 4J6XA 1ETKA 5D4SA 3BR3A 4XRMA 4C5EA 5GANe 1Z3XA 4Z89A 1M3CA 2E34A 3KLOA 2GXBA 3JR9A 1HBXG 3JCMg 4AT1B 5CK9A 3G1JA 4A6DA 2Z2SB 2KGTA 4OAYA 1YJ9A 3BW1A 1IRZA 1VQNA 1EOVA 4KMUX 1WHMA 2GGRA 4ENKA 4M75F 5FKMA 2R7VA 2RHSA 1B1BA 1D0XA 4P1WA 3M0UA 2FEIA 5D4RA 3QO3A 3H0IA 3VB2A 3ERED 2COWA 2E4HA 2KE9A 1J0RA 5IP9J 2XMFA 2W84A 4DA4A 2H6CA 4Q47A 3BDLA 5E8GA 3CLQA 4BJ6C 2K5IA 2OJ2A 1VQPT 3FXOA 1QF6A 4F93B 1XSDA 3LFUA 1MJAA 5BQTA 3H8ZA 1YNZA 3PNWC 1IGUA 1VTNC 4X34A 3CD6T 1C1AA 5KNNA 2CUDA 1DGRM 1I3QJ 2QYOA 3FXUA 3GTLJ 2FZKB 1X3UA 5FW9A 1D1AA 1FIAA 1X1PA 2IGKA 3Q9SA 3CCRI 4IOCF 3WTTC 1X27A 2DD5A 5IYCJ 3NPFA 3JCMc 4DEXA 4LNPA 3U9GA 4XKCA 2KJCA 2DL3A 3META 3QYHB 1L0WA 4YIFA 2GZWA 4O5VA 5ILVA 2VGNA 3KP4A 2EZHA 2XAQA 4IVNA 4AD9A 3OD1A 1Z6TA 1TT0A 1WIEA 3CC4Q 4WXHA 2R7SA 2CZ7B 2MAMA 4LN2A 4PFZA 1N8RC 2FUG2 3HHGA 2AK5A 5A0LA 3ONQA 1S7OA 1O3RA 3JREA 1RR7A 1X3ZB 3ER0A 1TP4A 3J81E 4OIRF 5LEKA 3CBPA 1R1UA 3AFHA 1VNDA 2GWRA 2X9DA 3OYKA 1Z9CA 1V5FA 5CO7A 2CYYA 3IKVA 2QXFA 1WCMJ 3M55A 3NFCA 2W48A 3DLAA 3GCMA 4M72A 3OYNA 1JE8A 4GYGA 5HDKA 1HDDC 1HC8A 1UEBA 4F04B 2XF6A 3PIOF 1QGPA 3DFGA 1M8MA 1W70A 1X01A 3EG9B 1VQ6Q 4P3OA 3REXA 3JCMf 4B1RA 2DO7A 4S0HB 4XM3A 2E1HA 2ALYA 1EKEA 2DL7A 1JKRC 1X43A 5GAN7 3KPHA 1B9NA 5D6YA 4U88A 2DXIA 3CPFA 3C3WA 2ZXIA 3I5RA 2AKKA 2HEOA 5E1XA 3BJ6A 5EG0A 2DJZA 3L42A 2DVJA 4FE7A 4FTHA 1KG1A 1JHHA 2JRMA 4MTDA 2RQQA 5CVUA 1U3EM 2A08A 4XR6A 3OYHA 1MH4A 3R6SA 1LCKA 3X24B 4LD6A 4MNUA 3V7RA 3V4GA 2ME6A 1NK2P 4M77E 3IAS2 4F16A 2FMLA 5GAMj 4IL6C 1WGXA 2X4XA 1K61A 1CKBA 2X9HA 3LSJA 3KZZA 2QA4I 3FIWA 2J06A 1NJ1A 2VVKA 2D6FA 4LVKA 2HL3A 2VIXA 4EVIA 2R7ZJ 4QQ6A 4EMKB 1N75A 5FGMA 4UXNA 3REAB 1VQPI 2M7BA 3JCMV 1X56A 3CCLI 2EQKA 3TL4X 4P73C 4YRMA 2HVRA 4HWRA 2P6SA 4QLCU 4R8HA 1K78A 3UDCA 4XNFA 1AU7A 4XTYA 4PJOG 1QZYA 3A5ZA 4RDUA 1B34B 3FM3A 2MABA 5IYBJ 4GGGA 1H8AC 5D6EA 2PI0A 1FSHA 2N8GA 4BY1J 1K76A 4DBFA 1OYIA 2BE5F 2WB1A 2RNAA 3L09A 1MMAA 3QU6A 4XBFA 2EZIA 5L3EA 4XK8E 1R5HA 1WYDA 4RQFA 2O5RA 2F2EA 1BC7C 4YROA 2F2WA 3ZBDA 4NCXA 1MBFA 1V54H 2WSEE 4F7UA 7AT1B 3MKWB 1MIJA 2FOKA 5F0FA 5D5WB 2FZGB 3HEFA 3MP8A 4XKBA 2OPTA 2HXIA 1DU6A 2EYQA 2XAUA 2MH9A 2M4GA 3F72A 2DU9A 2QLZA 2ID6A 3MP6A 4K87A 2ZBKA 2P4RA 4C0DC 3HKZN 4CS3A 2P7VB 2LKXA 4C92D 4CDGA 2A7YA 1JO8A 3KEQA 3C18A 2A68F 3O8VA 2L4AA 3RKQA 3B02A 1IRGA 4DEYA 1MSFC 2RHIA 5E3MA 2VXZA 1M3BA 4BEHA 2PQWA 1QQIA 3EFOA 5GADJ 4TVYA 3TOAA 1EA3A 4J6YA 4M7DF 3KFVA 3VV0A 5KYUA 2DLLA 3CESA 4LJZF 3VS4A 2DA1A 2QBYA 1IN4A 3ABMH 1S1NA 1WHLA 2EA4A 3U2RA 2YUQA 3RYRA 1S7EA 2QDYB 4OB1B 5KYWA 5KYXB 5CKFA 4QKUA 3P5JA 5GAN8 1K7AA 3ECHA 4A3GJ 3FF5A 1WFWA 5GAN5 2Y31A 2DTIA 3QOPA 4KGZB 2Y4XA 1JTXA 2IXSA 1UHSA 1ETYA 1HKQA 1X1AA 4HZFA 1YHQI 4EMSA 3F6OA 2NVTJ 2MA3A 3DKYA 3V7CA 4A3EJ 4RGUA 2E12A 2HKQB 3V8LA 4N4IA 4RB2C 1UCRA 4IF4A 4I0AA 4IUVA 3IKLA 1PKTA 3X2QH 4ELZC 2Y2ZA 2GF7A 2LDMA 4M7AB 3EQLF 1PRLC 1X54A 3OR1C 3MMYB 5HGQA 3OS5A 4IURA 5KAFC 3PGGA 2GIZA 1U78A 4EM1A 2PUOB 3UGQA 2D45A 3QP5A 4RS8A 1NG7A 4XLAA 4KIBA 2BXYA 3L2RA 4YRCA 1GCQA 4N4GA 4XLFA 2W0ZA 2VKVA 2FXAA 2FBKA 4XSZF 2LT1A 2RN8A 4CYCA 4WF2A 2Q8KA 3QYBA 3S3OA 1SAUA 2HNHA 4AU7A 3S15J 2DCEA 3HGGA 5CVJA 1VYVA 2K3XA 3HOUJ 2ESHA 5HCKA 5LJ3e 1E22A 1EVLA 2K5LA 2VKHA 4BQQA 2GAUA 2DT5A 2CQKA 4M3DA 4IRIA 5LJ3j 3A7AA 2M0MA 3CJRB 3LSPA 5F5WA 3BR6A 4HA8A 4E47A 1ZRCA 1ZHFA 3LSRA 3BTJA 1VQOT 5I21A 1R0CB 1MGQA 1XMXA 2XGXA 2K3PA 4Q5SF 4PLLA 1Y56A 2IIMA 1ON2A 3M07A 2YDLA 4EGYA 4XRFA 1QWEA 1UTIA 3GNFB 4N0AC 1KD1U 4M7DE 1GVDA 3IC7A 3W6VA 4YG2F 4OMFB 5D6XA 4PJOA 1YIOA 2OBPA 1SFKA 4A6EA 1FEXA 2CU7A 3OB9A 2CV2A 1XGNA 5C4JJ 3RKWA 4A4FA 2CP6A 3QDRB 3FJPA 2BZTA 3D5SC 4Q15A 3DPTA 3DF8A 2QKMB 4R79A 4B6MA 1X2GA 2EK5A 1HTTA 2HNIA 3VSKA 1DJ7B 1KQSS 1M27C 3EGDA 2WY7Q 2WV0A 5ICFA 2ZTGA 2Y0SA 3MVPA 1FIPA 5AT1B 2HD0A 1TWGJ 1TWFJ 1JHFA 4Z6YA 1M1FA 1XJWB 3J80E 3I55A 2HOAA 3ZXSA 4IHTA 3KXTA 4L9TA 4OIPF 3OSVA 5H2FC 1SVLA 1IDZA 1G4DA 2LRQA 5I22A 1TSFA 1Q7YC 2HI3A 3CCLA 2BUDA 1K4US 1PSEA 3I0TA 1TUGB 1RAHB 3PMIA 3ZMSA 2EGCA 4KH1B 3IKMB 2ZIMA 4P3PA 1MMNA 2V26A 4PJNA 1X6GA 4C2TA 2A3LA 4BYYA 2JM9A 3SEZA 3TSZA 3F6VA 1DP3A 5IP7J 1T0FC 2CZ0B 1H89C 3M0RA 4L9NA 4B9XA 2JN6A 3RSNA 2RGVA 5K1YA 1HJDA 3L1PA 2ZXJA 3HOVJ 3JCMe 1VQ6A 2CG4A 1FYNA 3EUKL 5FWBA 5GMKe 3AG1H 1OQYA 3HY0A 3P9KA 3IRQA 3K2ZA 4C5HA 1YGBA 1AZGB 1YIJA 3JSCA 4K86A 1IV6A 2WSFE 4HSRA 4BDYA 4C8QB 1G5IA 4H2VA 3FDYA 5BNGA 3TP3A 4WXDA 1PD1A 4J9IA 1FMWA 2F2VA 4CI0C 1NE8A 5BPDA 2D8HA 3CCVA 2JPBA 3RI4A 2CV1A 2L9SA 2DXCA 2JSCA 3AKZA 1QPMA 1XGOA 5A2QK 1X19A 4E4HA 3G71I 1AT1B 3F8NA 5DY9A 1IC8A 1TG0A 3PVQA 2RV8A 1G3YA 2Y48A 4L59A 1M1KR 4O2DA 5HVQC 1MBKA 2ZMEC 2O9LA 2DJNA 1WLEA 3LA7A 4WCGA 3IV5A 1YCSB 4C8QA 3ROUA 3HIFA 5DCMA 1K9MC 1BN5A 2O7OA 1VQ8T 3INZA 4XU2A 2HDCA 3DXJF 2V9PA 3HM5A 3DBLB 2WA0A 3JRAA 4KNYA 3FMRA 1JUPA 1Q81U 3EG3A 1Z7MA 5AYFA 2E1CA 2NOGA 4LDYA 3IUOA 2JUCA 3HTUA 4YRNA 1QU3A 2Y0MA 1F4KA 3VWBA 5E17F 2ID3A 1VQ5I 2CT4A 2GQIA 1PVEA 1TL8A 3K1MA 3FJ5A 2DMTA 4X9DA 3CCQT 5IT9E 2HQ5A 2KP6A 1R5GA 4OVAA 5LJ5g 1K73C 1UFMA 1BI3A 1W0UA 4NL2A 1E6GA 4P71A 1IN7A 5C52B 3UGTA 3S16J 3NWTA 4P74A 3K9TA 5LLQA 2CP7A 5HLHA 5LD2C 4OB3B 3K0LA 1HW1A 2WAQA 3BP8A 1MDMB 1YTYA 5LRSA 5K5QA 2E64A 3LLRA 2V6CA 1LJ9A 5D5UB 4BH9A 4PNOA 5KYYA 1YITQ 3SFZA 2NS7A 2VQGA 1WGSA 2HDAA 4F7UB 4PJOF 1HQCA 3H9QA 4BXFA 3N4MA 2RQTA 2XGEA 2HPIA 1PWTA 1YITT 1VQLQ 1BOBA 3HHTB 3TGNA 1X1DA 3J80K 3J7ZI 4JRKA 1T08B 4HQMA 2OTLI 1VQNI 3SZPA 1C0MA 1I81A 3K69A 2RMOA 1NJIU 2X0LA 1B07A 1I3AA 2OCEA 4G7ZF 1Q95G 4BD3A 2Q7GA 5KYNA 3T0YA 5LJ5j 2ZIOA 4WI1A 1MH3A 2M8EA 2LKPA 1NEBA 2C06A 3FLGA 2BY0A 1I39A 3AL0C 2A6HF 1DP7P 4BI3A 3WHBA 1D0YA 3HXUA 4QIWN 2E5ZA 2DK5A 2QWWA 3GZ6A 2ROTA 4PJOC 2XICA 2P0PA 3H5AA 4LB5A 3CCSQ 4XORA 5ILUA 2ELJA 4CGZA 5C3EJ 2IS2A 3KP2A 1W2BS 4AWXB 4OMOA 3DCFA 1JJ8C 3S14J 4NS5A 1ZSGA 2WV1A 2CIMA 2KIFA 4WX9A 1T38A 2EQMA 3SEQA 1YHQQ 2R92J 4XKVA 1Q81C 3UT1A 1FOXA 4CHUA 3RR6A 2BY3A 4H4KC 5CVRA 1PG5B 5C53B 4R56A 1GLNA 3TDUC 3GF5A 2G7UA 4KICA 2VBYA 5M3MJ 4AIJA 4M7DG 3S3NA 3CCEQ 5EG0B 4BI4A 3SFMA 1H641 3JRZA 3R60A 3MQ0A 2HGCA 1CKAA 4CSWA 1PM3A 3M54A 1OU8A 2DXTA 1BW6A 2L9RA 2HTSA 1RPWA 2CQ7A 4HT8A 4U7DA 3OYIA 2IY5A 3T8TA 2XVCA 2E2HJ 2EINH 1FWZA 2MC4A 4FE4A 1E17A 2F69A 5J1YA 2LNBA 3U23A 1S8NA 4EX5A 2XG8D 4ZN3A 2A6EF 2JTVA 4II1A 4IX7A 3CC7T 1RZ4A 3C1DA 5LHIA 1O3QA 3PIPA 3JRIA 3CMAT 2MYSA 1H8KA 1VA7A 2PMZA 1VYTA 2ED0A 1I50J 2K9MA 2W85A 3W2WA 4RMOA 3TUPA 3OYAA 1WJSA 3R61A 3I5SA 3LAJA 3F23A 1YYVA 1GXIE 2DPDA 1LPLA 1VQ4Q 1Z1DA 4J7IA 2G3RA 1Y0MA 2ICWG 3ASNH 2HPMA 1DPUA 2FZCB 1X55A 1YG2A 4I99C 4I98B 4JYKA 3HOXJ 3LX7A 3JB9F 4M3EA 1LPQA 3UKGA 2QAZA 2NVYJ 3BY7A 4IUPA 1K4SA 3VYHB 1ZSZA 1XC5A 3CCST 1VQKT 5DYMA 3JB9H 1DU0A 4OMNA 2ATCB 5GAOq 2VC1A 2F4MB 4JRIA 3K4JA 3M1EA 1G2HA 1IHWA 4KT6A 5L3BA 4HDUA 1YP5A 4HCCA 3WGGA 4QQGA 1E3OC 2VN2A 1TOVA 2C0TA 5HLTA 3RMQA 2QBYB 1ZRFA 3R0AA 3JRHA 1A31A 2ZJPF 3SD4A 5GANf 4HWOA 1O7LA 4DJAA 1B70A 5E3IA 1S72I 1BJAA 4C8QC 4B9WA 2ZT6A 3CCVT 4RGSA 3VJPA 4BQNA 2E71A 3KYCB 2L7FP 1KYZA 3WU0A 3JRBA 1SFUA 2R93J 1RACB 4CH3A 2ELKA 1P7JA 1SHFA 1Z6RA 3K1NA 5FO5A 4ZTFA 3V8KA 3J7YJ 3V42A 2IPQX 2DTRA 4OB0B 2HS5A 2JJ7A 2NS8A 4WXCA 3VPRA 2VKEA 5IPAA 3ZQIA 1VQMI 4LB6B 3QAHA 1PUFB 1E6HA 3HXZA 3RUXA 1APLC 2ZKZA 4BXXJ 3X25B 2X3WD 1Y0UA 3OWTA 1FOKA 1BR2A 4CYDA 5FJ8J 2IJLA 3LMMA 3OL3A 1UE9A 2A07F 2BTTA 3ZOBA 3NTIA 4ZNXA 3TO6A 3BR1A 3FHZA 1ZH5A 1T3SA 2QM3A 2VE8A 1TBXA 1YX3A 2XHKA 5EEHA 3MFKA 2GOMA 2PZ1A 2ZAEA 4JX4A 4FT2A 3SEMA 5I2SA 3DKWA 2Q2EB 3GFMA 2X48A 2O61A 4KISA 5LJ3g 1RAEB 4IHYA 5ELOA 3IH2A 1VFCA 4OWRB 3EHQA 4E7KA 3NTKA 2CSOA 3PUBA 5J4VA 3L1AA 3CCQA 3CCVI 4TQFA 1AD5A 2ZJ2A 2Z99A 3CMQA 4JS5A 2ZPGB 4I01A 4AFQC 2M7AA 2ZGWA 1M4ZA 2DJIA 2MG4A 1E3HA 2EV6A 3P9IA 3ZN0A 1XGSA 1KQ1A 2RNJA 1OX8A 1JI8A 1UFFA 1OFCX 2KRSA 2LQKA 4X9CA 5M3FJ 3A2KA 2LP0A 4D5CA 3A03A 3OSGA 3TEHA 4J83A 4W1UA 1TWHJ 2ZCEA 1UECA 3CUQC 2NXNB 1OQKA 3PIOA 3CCMQ 2PEXA 1SSHA 4XN0A 2E7WA 4N4HA 2DOEA 5KNLA 2HQRA 3J81Z 3FKIJ 2QTXA 4PJOD 2V1XA 3HL2A 1FTZA 3JCMd 4J00A 4IPAA 4OIQF 2KIMA 1WI9A 2NVXJ 1KGSA 3A8HB 5DLQE 1Q86C 3FMSA 4H2WA 3I64A 1R8OB 4HCZA 2KVQG 3M8EA 4RB1A 3QJ6A 3IWFA 5LBQA 4RB0A 4F14A 3E6BA 3HKZA 2IPOB 2W7NA 3KCCA 1TQMA 1FMKA 4FL6A 3G2BA 5CQGA 4WJ4A 4C0ZA 2LRDA 2RKHA 5BS6A 2VPLA 4AG2C 3I55I 1MKMA 5KYWB 4FU6A 1PHTA 2J6FA 3PTAA 3KEOA 1QLYA 1ZN2A 3QHSA 4FW2A 4LIVA 1J3TA 4YRKA 4UNOA 1NLOC 3UR3C 4Q4ZF 2K4YA 1VQKQ 1U3OA 3E2UA 4C5IA 1M2VB 4ASNA 1D3YA 2VXEA 3E9GA 1NYFA 1YITA 2QQ9A 4HF1A 1QZZA 2KQWA 2A8EA 1LFUP 1SMYF 4C3HJ 3ZQHA 3K70D 4IUUA 4YRQA 1E24A 4BY6C 1Q82C 4PJJA 2FQ4A 1E1TA 1U9OA 9ANTA 1Y6IA 2LCLA 3CUOA 4HF0A 2QSGX 4RTZA 4OGEA 2JS2A 2ROLA 2OQRA 4XMYA 2JVVA 5D8KB 4P75A 1X3WB 1SFEA 2OAZA 5IXFA 4GO1A 4LDXA 5FB2A 1T3LA 1WHKA 1W36C 1K0SA 2RC4A 1HC7A 1Y39A 2FX0A 1U9NA 1TWAJ 2Z33A 1IN8A 1K9MU 3RDVA 2X4JA 1SF9A 2E65A 1Q1HA 3DKMA 1VZ0A 5FU7C 4XIDA 2B63J 2PU9B 2FRHA 1VQ8I 3GP8A 3RPUA 2IAIA 2CP0A 4CA0A 2KJBA 2RHYA 3CXCP 2FNPA 4HW0A 4LITA 4NB5A 3WG9A 3WTSC 4KYWA 2MI6A 5LJ3f 3E6DA 3RPUD 3I71A 1KK7A 5IN1A 3K7AJ 3ML6A 3NARA 2E2JJ 4ZYGA 3QQAA 2YX4A 3RJPA 2JZYA 2Z1DA 4PUSA 2EFQA 2HYJA 4CCNA 3VQWA 3QYFA 3SWNA 3D5LA 1A35A 1V76A 4II3A 4ZZLA 5KK1A 3PO3J 1RL2A 2DRKA 4OINF 2W10A 4YCUA 1I6HJ 2L5QA 1SVOA 3P8TA 3IWZA 5GAMg 3A1YA 3HFZA 1UMQA 2ZNZA 1I07A 4HX4A 4BE1A 1IJWC 3TBIA 4ESRA 1K6YA 3H35A 1TH7A 5IH2A 2ZZEA 1MBGA 2XF7A 2KI7A 1WH7A 4NC7A 2HQHA 4EMGA 3JCMP 2DK8A 2E2IJ 2L3QA 3RQ4A 4UV9A 4XOTA 3EFOB 3M58A 2YUPA 1ZELA 3SXYA 1QKWA 1QVGP 2ARTA 1XQHA 4K2EA 1TW2A 4YRSA 4FW1A 1PNJA 3GTQJ 4ZC3A 1T98A 1Z05A 2DX1A 1FLIA 3L4GA 1S5LC 3H3ZA 4JP0A 2H8RA 1ZLMA 2B7EA 2KL4A 1EH6A 4EATA 2JJ9A 3M0TA 2W4SA 4X0GA 3CC4A 2ELHA 1VQ9T 3VSLA 5C51B 5J39A 1SRMA 2DILA 4ZYAA 1ORKA 4LG3A 2JS0A 4M7AA 2DQLA 2QYZA 2H3EB 2EQRA 5CQEA 5HLIA 4ETSA 1RUOA 3S1MJ 3I54A 4MMLA 3PFYA 1YJNT 1T6SA 3WTZA 2GCXA 3BDUA 4NL3A 2EV0A 2H6BA 5F0CA 2VUMJ 2ZZGA 1LEAA 1PJRA 2FMYA 2LC2A 1O3SA 2GLOA 2BE9B 1SRLA 1TS9A 2CP5A 5HKCA 2L0KA 4CICA 1YBYA 3A5ZB 4KGXB 1G2BA 3G4SQ 2VJIA 3CC4T 4RA2A 4LNSA 1L3LA 4PJMA 1W4MA 3VS0A 2DLPA 2AZSA 1KQ9A 1MD0A 1XOVA 3F0CA 3I56Q 3DP7A 5C4XJ 1XDUA 2W57A 4LLLA 3LH5A 4J7FA 1KHIA 2EIKH 4H0EA 5FU6B 1JJCA 4P55A 1V29B 3LSGA 1YRNA 2FG0A 3SYTA 3JB9G 2QGGA 3D5RC 3K4BA 5DLOA 2YS9A 4UVCA 1YB3A 2OQGA 1VQMQ 1ZA2B 2RHXA 5IHNA 2LCSA 3C2BA 1UZCA 3GPLA 1IG7A 1K6OA 4BQAA 4RDXA 3VYUB 2VL8A 1MUZA 2ZXHA 3EYYA 1MV0B 4EGZA 2MH2A 3IH3A 3M0QA 1XCVA 1QP2A 2OX7A 1AOYA 2IA2A 5FU7B 3URGA 1F1BB 4M7DA 2ZJRF 1BCOA 1I5OB 2FRYA 1M8VA 1KQ2A 2O0YA 3HRTA 4E70A 3RQIA 2H27A 3UA7A 4HX7A 3JV3A 3JAMK 3PNVA 2RH2A 2RJDA 2XHCA 1V5EA 2OF7A 3TOBA 2BKDN 3GZ5A 2R7TA 1BR4A 1BYMA 3P8YA 4H2XB 2UUZA 3EG9A 2ESNA 2EIJH 1USTA 3LA2A 1VQ6I 4RAYA 1ZK8A 3JB9J 1X2KA 1NYRA 4BE2A 3F9KA 4M73A 4Y33A 3CMEI 3K70C 4JZ3A 3QODA 3MN2A 4H2TA 4V2GA 2XRLA 1E2XA 3KIOA 2K9GA 2WACA 1W2BA 2L4MA 2EBPA 2IY5B 2ZPBB 4D6WA 2V9KA 4IQJA 1WX6A 1PCXA 2DFUA 2CFOA 1KJWA 1E0EA 1GHCA 3G1OA 1MZBA 1ZKGA 2ETHA 2R3SA 4JBAA 3DPLC 4JDSA 2JTMA 1JEGA 4UUVA 3DU6A 1ADJA 3OIOA 1GV2A 3BZKA 4PFPA 1R00A 4E7LA 1VOMA 4EM2A 2KDSA 4EIKA 3HFZB 3I56A 2BY2A 1MJBA 2CWEA 4IQ4A 1LEBA 1ACIA 1CSKA 2OAWA 2X51A 2W82A 4YIRX 5JLXA 1IXRC 3P8BB 2P4TA 1W5CC 1XN7A 2DJQA 4JUVA 4LLGF 3BPVA 5CLSA 4MO7A 4C2UA 1B3QA 2GBQA 4M78B 4XU0A 4F7UF 3CXCS 2NVUB 1R5ID 3MZHA 1G8XA 2LQNA 1ZTRA 3HDDA 4M78E 2KFDA 4MEYF 2HZDA 2K27A 3O3KA 4RM2A 2UZKA 1UJYA 2E5KA 3CCMA 2M0YA 5IHKA 3IAM2 3OBYA 1LKXA 3GUDA 4IXAA 2HSEB 5EC7A 3GTJJ 1SEMA 4RB3C 1WKMA 3G6EQ 2VUBA 4P3NA 2BOLA 3HSEA 2DQ0A 1SD5A 2IW5A 3IP4B 4U0VA 2YRDA 1W1WE 2M4KA 5B3SH 4A93J 1SETA 4HLYA 4XAXB 4XQ3A 3C2GA 4KDPA 4TTVA 1UAAA 2K2VA 4A4EA 4CXFA 4WTOB 2FA5A 4HPQA 4HVCA 2O4XA 3H9JA 2HL5C 1VQ6T 1OYWA 4B44A 2HDWA 1W36D 3W6JB 2UV1A 4TWAA 1U6GA 4GDFA 4L18B 4M7AC 3P9CA 4MGRA 5DUIA 5DCFA 5EYRA 5HLGA 1RUWA 3CCUQ 1S72A 3PM1A 3RNJA 4A5MA 2DTOA 1QHGA 2WWYA 4EJUA 2YLCA 4OP0A 2XDDA 2L02A 1WDXA 4ZGJB 2HQEA 1B8AA 3GTPJ 1H4TA 1QW1A 4F7UE 1GUUA 2YX7A 3CD6I 1XMKA 4PZJA 1NG2A 3BE3A 2I8DA 3KFUA 2J5PA 3LSIA 2DA2A 4J9GA 1VQMT 3OW2A 2G7HA 1ETOA 1N6AA 2XC7A 1WFXA 1X4PA 2DRMA 3E9IA 1V1CA 2M1HA 1VQ9A 3QNEA 2CUJA 4L87A 5FLMJ 4RBOA 3IQLA 1Q7YR 4M7DD 5CCAA 4IJAA 1UHMA 3UNGC 1POGA 1EIFA 2F48A 2L3PA 1N8RU 1FZPB 4UHTA 3D7SB 4CC7A 1GBRA 2P5LC 2YR2A 1KFZA 1R4MB 1YCYA 1MJ9A 2XPUA 3EGUA 1JKQC 1IDYA 5C44J 3CMAQ 2X6OA 2OC6A 2NLUA 2DODA 1XCBA 1UGSB 4EMKA 4Q48A 4DYQA 1FBSA 1ERDA 2ZSIB 2V6EA 4I6ZA 2CDTA 2ME0A 3NAUA 1UELB 1RI9A 2NUPB 4LUDA 3RACA 2KRFA 2WAQN 3MD2A 3LSTA 5J1RA 5FLVA 4M75A 2Q7HA 4F55A 2NNYA 2JK3A 1AEYA 1Q82R 4RKUE 2YRVA 3CC2Q 3PCOA 2E60A 4D8KA 3WQZA 1XG1A 5K5RA 5KYUB 1W7PD 2HAXA 1T95A 2OZ6A 3ZQQA 1RNLA 1IN6A 4DBRA 5FRNA 1LUJB 3K1PA 1X1BA 4ZTUB 2KMUA 1VQ7Q 3MZYA 3PE0A 5GTHC 5E20A 4A3BJ 2RI3A 3HG9A 2RM4A 5CVIA 1AZEA 5L23A 1J75A 4ENNA 3X20B 4RGRA 1G5VA 1H4SA 3CCJI 2F5CA 4RTYA 2EJ9A 1UHCA 3DTKA 3M8JA 4BJ5C 1M3AA 2KQRA 3RZDJ 2A37A 2DZ9A 3X26B 4C92C 2W00A 3E5XA 4DIQA 3G4SI 2VE9A 4XONA 4BKXA 3JSOA 1IZ6A 1WI3A 1BB9A 1WXUA 1IXCA 2KT1A 4E7IA 2M9UA 2RHUA 3A98A 2EFIA 1U2WA 4FYYB 4YRLA 2FBHA 3A01A 4RG2A 2M87A 2I4NA 2GQQA 4B43A 1HSTA 4P9FA 3BQYA 3OYGA 2LSOA 1VUBA 1IZ1A 3EG0A 2ISYA 5F04A 5BPIA 2XKOA 1ZUKA 2OTLA 2R4GA 2RHQB 4L5IA 4YFXF 5FLXZ 2NUZA 3MCAB 2ISZA 5GMKm 3FXMA 1JGSA 1PYVA 3ZP5A 1P92A 4AVZA 2EZLA 2JTFA 3A5YA 2W1OA 1QMCA 4PSXA 1YHQA 4BU2A 3PT9A 1YI2T 1UB9A 1V5GA 2VASA 4ORZA 2QHVA 4WWCA 1ZBJA 3ZQ7A 3OQ5A 4XRSA 4TVAB 2QGUA 2DIQA 2H3JA 4R55A 1GGMA 3CLOA 4LIUA 4C0FA 3CCUT 2V1RA 3SJMA 4JK1X 5L3DA 1RI0A 3AL0B 1I5LA 4JOMA 3MKYB 2MBFA 3DEEA 1A5JA 4PJOB 3TP0A 2ARSA 2EKHA 3J81K 4P5OA 2YXYA 4JJBA 3NENA 1Z7LA 4M75G 1VQNT 4DNCA 3PSFA 4MFEA 3EUHA 5IAYA 1VQ7T 3HXYA 3CCJA 3O8HA 4AIKA 5LJ5d 3GOXA 1GXPA 4YCWA 4LG0A 4UVBA 4ZTJA 3E7LA 3GTOJ 2TCTA 4Q5WA 4IRGA 2WBMA 2XB0X 2F5KA 2K5CA 1VQ8A 5IYDJ 2KSSA 4G12A 1A04A 3MCZA 5K7FA 3H0DA 1C0WA 1E3PA 5L3GA 4AG1C 4XLNF 1XX5A 1YFTA 3ZEHA 2KNBB 4QQDA 1A0NB 3UH0A 2VYTA 3S2HJ 3LGFA 3I55T 3I35A 2L9VA 1QRYA 4Z88A 3GTGJ 2L3DA 4PSWA 4XU1A 2ENMA 3HPWA 4VUBA 3VUZA 4DGWB 3NEUA 5FFXA 5IY5H 2MK5A 3HRKA 2LVSA 1KIKA 2VONA 3H9GA 4A3IJ 2V1DA 2XSJC 4MFDA 2VC0A 2C0OA 4PDKA 5GAOm 1WQ7A 4K88A 1YIJI 2DU7A 2PN6A 2LBFA 3Q0UA 1AWJA 2P84A 4NUBA 3VODA 2VKDA 4JJDA 2IT0A 4KGVB 1ATIA 3HY1A 5E3LA 4HDVA 2FPFA 3PVLA 2JT1A 4DBQA 5FD6A 1XS9A 2CH4W 5FWCA 1B9MA 3FXKA 5GJVB 2P0LA 4J15A 2DE0X 1VI0A 3RPQA 4QPOA 2XAGA 3OA6A 3SB2A 1MNEA 2M0CA 4CC2A 3JCMJ 3HRMA 4C2MJ 1OPLA 2V79A 4FX4A 2E1MC 2K9SA 2JWTA 2MW8A 1HLVA 2QENA 1PD0A 1QCFA 3MKDA 4KR2A 1IN5A 2HQAA 2VT2A 4L9JA 3KZYA 4HNVA 1AA7A 1U5SA 4FSSA 4M75C 2DA4A 2PG4A 2AT1B 2LY1A 2XV4S 2LY9A 3UFGA 2BY1A 1YS7A 3NETA 3HXVA 4XTVA 1P2FA 2R0QC 1ZG1A 5KE3A 4P5NA 2ZXWH 5D8LB 1HK9A 1Z9QA 4OGCA 1GRIA 2VJ5A 4F7UG 1S72T 4XEOA 3L2VA 1A36A 5CJ9A 3FXLA 4KUDK 3OYLA 3BDDA 1Y71A 4A2UA 2UWMA 2RK2A 3CMEQ 1W5TA 3F70A 2DETA 4QW2A 2QG9B 2M45A 3ERMA 3FM5A 4DOWA 2LZ6B 3JAMZ 2NNNA 2R7OA 2K7LA 5J6XA 1H0MA 2ZZDA 3JAME 1M90R 1OU9A 1ZSZB 1Y96A 5HODA 5D6WA 2EAYA 4RAGA 5D5VB 2COYA 3WVDB 2JTEA 3CCSI 2L01A 3A01B 2BW3B 2VBZA 5J4YA 2NWMA 2VPRA 2DTZA 2COMA 3H5NA 3E1SA 3KYDB 1QKXA 2LJ1A 3M4YA 2P81A 5AONA 3MJXA 2TDXA 1WPKA 2HBWA 4M4ZA 4G84A 1BJZA 2RQUA 2XAFA 5A0DA 3OSFA 1BW5A 3OS1A 4NDLA 3HFOA 4BHPA 1J09A 3DEWA 5IP6A 2AQFA 4LFUA 1D3BB 1I0CA 1T0HA 2QI2A 4G6QA 5E8IA 1QA6A 4YRVA 1ACMB 1BR1A 1SKUB 2CSQA 1R77A 4D8DA 2XF5A 2K9NA 4UP7A 4NBQA 1FX7A 1R23A 3S32A 1WA7A 3AT1B 3BZ6A 2EPFA 2ZO4A 4X5OA 2EBIA 2D1HA 4E51A 5KHDA 1BA5A 3K2AA 1I1JA 3JTGA 4XTXA 3CDHA 4MIMA 2F4OB 1J59A 3UF4A 3TEGA 2OTLQ 1YOVB 5A2QE 2Q5HA 1YQAA 2KIQA 2DM1A 4XLPF 2J7IA 3WVEB 3JRFA 1VQ4T 3PCOB 3QJYA 2R5ZB 3CC2I 4A54A 5E1ZB 3BG9A 5GAMf 2X4YA 3HSFA 1G3SA 2DFFA 1G6NA 3EFRA 1ZQ1A 2NUTB 2QK0A 2KHMA 1YI2A 4Y28E 3EUHC 4I7HA 1VQ7I 1TT5B 2VOOA 1UJ0A 2ED1A 2VV5A 3A1PA 3O5ZA 2ZNIA 3S3MA 3KP7A 2QEXT 4AIHA 4M9ZA 5B1AH 2CKKA 1QBJA 1V4RA 2BYVE 1Y07A 3TVTA 4CH4A 3K4CA 2DA3A 3CC7I 2J3LA 1VQ4I 4DQ2A 3ZRGA 2O2OA 1OEBA 2SEMA 3KZIC 2KRMA 2HBPA 2FVUA 2JQ7A 4HSTA 1W5SA 2D0NA 3CF2A 3P8VA 2DPPB 3GLXA 1VQ7A 1I27A 1YI2I 1XSVA 3CCJT 4BJTA 2DFIA 2YWWA 1RIQA 3A7UA 2J05A 1MGTA 1PYSB 3PZCA 2EB7A 2V1UA 5GANg 1B6AA 1YW7A 4FASD 3DLLF 3SDZA 5DM6F 1VQOA 3PQKA 1U5TA 2QGFB 4LVMA 5FROA 3M56A 3TKYA 2C8MA 4F17A 3S2WA 3SHFA 1NJIC 1YWPA 3REOA 2LX7A 5GMKh 4EV0A 4G6TB 1VIEA 3HOYJ 3CQZJ 3ULRB 1Y8RB 1H3HA 1EX4A 2CYZB 2EQUA 3EHRA 1KU3A 3ZR8X 1ZUYA 5K7ZA 4XN3A 5FRMA 1W2BP 1P6RA 3CCVQ 1NNHA 1FSEA 3CMAA 3ECOA 4M3BA 1AKHB 4M7AG 5CVVA 3R07A 1EH7A 2R7UA 2K57A 5KCOA 1U8BA 3IKTA 2HQXA 3PNTA 1FY7A 1LDKB 4QPQA 1Y57A 1WH5A 2HYFA 2DW4A 4LLNA 4G7OF 5I11A 2RDPA 2JA5J 2AXLA 3FMQA 5CPRB 2L9NA 3MEVA 1S7AA 3CCSA 2G0EA 2XU8A 1BIBA 3ZMUA 2IG0A 4A4HA 3HSBA 2DQ3A 1OR7A 1RRJA 5CR2A 4V2SA 3HPGA 1AHDP 4NHJA 2BHZA 1X75C 3OSSC 4OMQA 4HCKA 5GANh 2XK0A 3JSPA 3OYBA 3RIRA 4DBHA 4XEMA 2LYCA 2ZCWA 3V7SA 4D0PA 5H6RA 4A3MJ 3E0JB 3SHWA 2VQCA 2DO3A 1USYA 3HXWA 2LK2A 2QSHX 1UDLA 3ZMTA 2CUZA 4LD9K 2HTJA 4L9VA 4M78A 2RHQA 4YRPA 4M78F 1ZAOA 3CCJQ 1S72Q 1NM7A 2A36A 2FHDA 1BL0A 1I1GA 3CJTB 4CYCB 2IP2A 5L3FA 5GTIC 3TEHB 2D1XA 1IGQA 2NYSA 2RI5A 4MQ9F 4M9XA 1ODDA 1P9QC 3H1CA 3WTXC 2LH9A 2PVGB 1V55H 3KYLA 2BIVA 5LJ5h 1PYSA 3OYDA 2ZFWA 1RC9A 2KRCA 2P5KA 1YIJT 4TVRA 1M90C 1B4AA 1VQ5Q 1J7KA 1TW3A 4QVDA 5EEGA 1VQOQ 1UGPB 1T33A 3A4CA 5TJJA 3ZGKA 2CS3A 3CBOA 2EVRA 3HUGA 3GWZA 1F36A 4CCOA 2M51A 1D1CA 2R7XA 4RM3A 4KULA 3A74A 4I76A 3IG2A 3FIFA 2ECZA 4MZPA 1B59A 4E6KG 1JQQA 2HVQA 1EQRA 2AKWB 1T0JA 3A32A 2QA4T 1EIYA 4YREA 2K3FA 3CEYA 5J1UA 3I3LA 5D5XB 1DDNA 1KD1C 1QVUA 4FISA 3M1CA 2HDDA 5GAN2 2IVMA 4FX0A 1M1KC 4CUGA 4W97A 1NLPC 2JT4A 4M77D 3VS5A 1L0OC 4RTVA 1AWOA 3GZNB 2ZCFB 3MEYA 2HSPA 4M7DB 5L3CA 2M02A 1W4SA 5HS8A 3C4SA 3H0FA 4Z02A 1ZRDA 1ITYA 3HTZA 1GDTA 5GAOl 2XB5A 1SD6A 3MKZA 1DGWY 3ZFJA 4B8XA 3L2QA 2AO9A 4PCQA 3QOEA 1SPKA 3G71A 3CCLQ 5ICCA 1R0BG 1IXSB 4JRPA 1C6VX 3CMYA 1KA8A 3VOEA 1RAGB 1NHAA 2E5NA 2CQQA 1H4QA 3WTVC 4KQEA 2LFBA 2K2MA 4LDWA 4FETA 4A53A 4C8QG 1OKRA 2QSFX 4RMNA 3RYPA 3P7NA 3G6EA 1LVAA 1KU7A 3TSWA 1EIYB 3LL7A 2L54A 2CW0F 2P0WA 2Q2EA 1WHJA 2X4WA 4HCBA 3CJNA 1S9HA 3FISA 1WVRA 2P8TA 3HTRA 3JTHA 4FYWB 5FU6C 1YI2Q 1K73U 2CV0A 2CH0A 3LSKA 5H6QA 1ETWA 2GA1A 1U5TC 2YU3A 3M9AA 3VYSB 2WADA 2JA6J 3J7AO 3A8OB 5GAMh 5J8FA 3DQVC 1BBYA 1TXQA 3I59A 3KX2A 5FKKA 2AS5F 3M59A 4OF1A 4C0GA 3CMET 2OV7A 1F9NA 2QUFA 4UB6C 1IUYA 2GQVA 3FKJA 2CW8A 1NZ9A 1BK2A 1IREB 1OJLA 1OCOH 3HYIA 4YRFA 5FD5A 2GTJA 4EQQA 2QDLA 4A0ZA 4A0YA 1J5YA 3PO2J 1QHHD 3CCRQ 1HA8A 2PX9A 1BI2A 4RTUA 1OZ2A 3TO7A 3M4GA 2YSRA 1D5VA 5LEJA 1WJDA 1OCZH 4XU3A 2R7DA 12ASA 1OPCA 1OMIA 4HYEA 4ZJZA 4RTWA 1Q86U 2KR3A 1NG6A 5GAOr 4M77C 4JZ4A 2J5OA 3C7JA 4XKWA 3A8MB 1OR7C 3G4SA 3CQTA 3QPHA 2LD5A 1KMMA 3ZQFA 4ITVA 3S2DJ 3M53A 2VBXA 1CQTA 3RBBB 4LVLA 1MBJA 2DU5A 3QDFA 1LDJA 1FP1D 2R5YA 2JW4A 1USYC 2LQWA 1CGPA 3BTIA 1SSFA 2JVHA 4ZZDA 4QWQA 2EGAA 4JLIA 1YFRA 4J19A 3QYGB 1TNTA 4HEA2 5FLXK 2DMOA 2K7AA 4M78C 3VS3A 3WTWC 4HT9A 1STZA 4P73A 2W25A 4RQEA 1KHCA 3LSQA 1WJEA 3BCBA 4HAMA 1O75A 3QPLA 1WSUA 2VJ4A 3NTHA 3I4NJ 2LNHB 2NS0A 2LF7A 3WHCA 2GTOA 3IRRA 1WHGA 3EG1A 3UPUA 4KT0E 4HWPA 1N27A 1JUMA 2L7ZA 4ME7A 2LG4A 1Z91A 1VQMA 2OTJA 1R49A 3PNYA 2M16A 4A4GA 2KRHA 1NJ6A 2EIFA 2XGTA 4YIIA 5EGOB 3HXXA 1P4XA 2XGDA 5EDNA 4A3JJ 4FHTA 4CRIA 3OYYA 4C9YA 1IAWA 1NYGA 3HJEA 4BNCA 2K86A 1R6RA 5LFAA 3CC4I 3EUAA 4IHSA 4FT4A 1HD3A 2DBKA 4DYCA 3F21A 3DPUA 4HOBA 4D7NA 3GF2A 3PIPF 4FT8A 4ZYDA 1XMAA 1Z67A 1JXMA 1SHGA 2RJFA 3K4KA 3LSHA 4FYXB 2ZZFA 2YLBA 2E35A 3GX4X 4G7HF 3OR2C 2JRTA 1W7PB 3M57A 1Z21A 3O8GA 4Y15A 1ZUUA 2DXUA 2Q5IA 4RAZA 2CFXA 2WY8Q 2Q0OA 1WJAA 3FXQA 2IA1A 4G6DA 4ON0A 2NVQJ 4UC4A 2L89A 3S17J 5GAEJ 3HXLA 4II2A 4QTRA 4UY8I 5JHUA 1VQ9I 2HVSA 1K9AA 2DERA 1G5HA 1TQPA 3Q9VA 1VQLT 3LFKA 1B8IB 1JUSA 3WU2C 3OYFA 1FTTA 4IUQA 1HOMA 4GXOA 4HVWA 3F8MA 2KPMA 1TWCJ 4N0AA 4TV7A 3A02A 2DVEA 2LP5A 3OYCA 3LC0A 1EV7A 2LREA 1VQZA 2ZT7A 5J26A 1FYFA 5F6FA 2RHZA 2VXDA 2STWA 4MHGA 5IT3A 4KMFA 1ETQA 2K9QA 4M7AF 2D1VA 1AKHA 2HZYA 4DPGA 5GPAA 5K1PA 2LY2A 3OY9A 5ELNA 1X2QA 5AIQA 1RABB 2K9LA 3LQQA 2HEQA 2EH3A 2CUEA 2P5VA 4LMYA 1BKBA 5GMKj 1FBUA 2A61A 1W0TA 2DYBA 4KIGA 4A63B 2QHUA 1KU2A 2GOXB 1WJ5A 2R7WA 2Y90A 4H2YA 3TQ7P 3IH4A 4DOVA 1X4OA 1REPC 1W1FA 3DU5A 2EQIA 2LJ0A 2VI6A 3HB9A 1LQ1A 2EZKA 4ZDLA 5LJ5e 2G4CA 2CT3A 4UVAA 4JRQA 4C5GA 3G6ET 4LE9A 3FXRA 1GCQC 1SERA 4N9IA 1LE8A 2PQ8A 2A0FB 4M78G 1OZ3A 4PGHA 1KYWA 1T0FA 2VXFA 3PJRA 2WC2A 3OS0A 2KKOA 1MMDA 2DAOA 1K78B 5IT9Z 1JJ2A 3DKXA 1YW9A 2E19A 3MZ8A 1YJWI 1RKWA 1R71A 1O57A 3RGLA 2LOOA 2EV5A 4AFUC 2P5IA 3CD6Q 4LK0F 1B7YA 3I58A 5F64A 2FPDA 4M74A 3G7ZA 5JI6A 3CF5F 1X2MA 3EPZA 4B47A 3GFJA 2NUPA 4UP8A 3QYEA 4NQWB 1WQWA 1Y7XA 3OMGA 4M77A 3CO7C 1KU9A 1H4VB 1NYQA 2X85A 4EO4A 1SAXA 3T1BA 1T2KA 1PUFA 1AWWA 3RKYA 1ZGAA 1MHNA 2O9SA 4EMHA 2IEKA 1IO6A 1CF7B 2JA7J 4JLGA 2UXNA 3CCYA 5DM7F 1ZR4A 1IRFA 3LSMA 4HG2A 4YEJA 1U06A 2MIOA 2R5MA 4MZMA 1EVKA 3B6CA 2GIVA 4E6RA 2MPXC 1OCRH 3BG6A 3EGDB 1MNMC 3OOPA 1JB0E 1ZX6A 2VGMA 2YHTA 3GIBA 2ALYB 2GA2A 1FPQA 2ZMEA 2Y4YA 3R0JA 5GMKi 2DT6A 3CPWA 5JHFA 3I9V2 2MMPA 3LYIA 3CCET 5JVTA 2IS6A 4R0KA 2I4OA 1GL5A 2ECCA 11ASA 3M4PA 2FSWA 3COAC 1O9SA 2KDZA 2LMJA 2I0NA 1RUNA 3A8GB 1LNXA 3FDRA 5GANd 3QWXX 1H9GA 4LVIA 2D0QB 4HV6A 2I10A 1WQ2A 4GYIA 5DD4A 5ICGA 3HRUA 4CH7A 4B3AA 4BL0B 4HXJA 3DSQA 2EJGA 2JNGA 4H02A 2RN7A 2Y69H 5J47A 3HL8A 1ZARA 1Y1WJ 4FYVB 1HKTA 5GMKl 2M3AA 1DQUA 1SG5A 3CCEA 1N5ZA 2EL9A 3B6AA 2A6TA 1BI1A 5B66C 2O3FA 1K1ZA 3TW6A 2DYIA 4C8QF 1IHVA 3HZJA 1KD1R 2KMTA 2ECBA 2LJ3A 2O31A 3E3VA 1PRMC 3VS1A 1ZG3A 3NMZC 2V8IA 3OW2P 4MDXA 3BT9A 1GFCA 2O4XB 1R4NB 2VT3A 2FO0A 1BBWA 3VQVA 2FU4A 3BY6A 3WGIA 1MSEC 1ZA1B 4JPBW 3LA3A 3JB9I 1R58A 2KIUA 1R36A 3Q0VA 4CH5A 1Z77A 4O6JA 4D1QA 4A3LJ 3THKA 2K40A 5J8CA 2LR8A 2PMUA 3ZQLA 2CSIA 3JCMh 1YJ9Q 2FRWA 3T8RA 2F5EA 5HK3A 1UHWA 4M6XA 4IHVA 2Y9ZA 3Q1JA 4C3JJ 1W66A 3IL2A 2OCCH 4D7MA 3HPHA 3VDXA 1AWCA 1WLPB 1ZGJA 4F52A 2H8HA 3GYHX 2LTOA 2XDPA 2ZINA 2JN0A 2DA9A 3QPSA 3JCMX 3MEWA 1VF9A 2F6CA 2VC8A 3VBBA 1QCNA 3PSIA 1ADYA 3CMEA 3JCUC 3MP1A 2VOPA 2VKNA 4NNJA 2O8KA 1QVGA 3I5UA 3RMSA 3VRYA 4MMKA 4UUSA 4CCLA 1B76A </