3RKXA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
308
Chain Sequence
KYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 99
structure length 308
sequence length 321
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkxA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkxA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkxA02
3HRIA 4BHCA 1W5SA 4M7DB 3FJPA 4CGZA 4L9VA 3VODA 4IJAA 3TO9A 3HOSA 2IVMA 5HLGA 3RKWA 4M78F 4I01A 3MWMA 2AMCB 1I5ZA 3T8TA 4IHSA 4YREA 2CG4A 1I6XA 4U88A 4RQFA 2ZGWA 2AKWA 3HTZA 3MF2A 2RKHA 2OQRA 1EIYB 4RGSA 1BBWA 4XU2A 2DKGA 4ZIBA 4JK1X 3L1AA 2YLCA 4WK8F 3TOBA 1HKSA 4UPAA 3RERA 3ZMSA 2F5EA 1STZA 1OPCA 4ESBA 3BY7A 5J6XA 3RACA 3KFWX 4MEXF 3HRUA 5CYVA 1XMKA 4M75A 2OZ6A 3CJNA 1O3SA 4JQFA 3GFLA 3FXQA 1SETA 2ZTGA 3ECOA 4ZYEA 4LK0F 1Z9CA 3ERED 4L18B 2LSOA 3L2CA 3UGTA 1SRYA 4PG3A 4KIFA 1QZZA 1JHFA 4YRKA 3WE2A 1I5LA 4XTUA 2QBYB 1N9WA 5HGQA 3S2WA 5GANe 4HBLA 2K86A 4IRGA 3JB9F 1E2XA 3TEHB 3JSPA 4HF1A 5BQTA 4ENKA 4CXFA 3HHGA 3P9KA 1D8JA 1WU7A 2RHSB 4RB3C 1TQMA 5CVUA 1W66A 3WTUC 3SB2A 1GGMA 5ED4A 3SWNB 1RZ4A 5LRRA 3M9AA 3BWGA 4CH6A 3EFSA 1NYRA 1XSVA 4HLYA 2R7FA 1JJCB 5LJ3g 1S6LA 5GAOq 3HFZB 4A0YA 4M7DC 4N9HA 1Y0UA 3I58A 5BPDA 4AH6A 2DXUA 2IA2A 3QNEA 3R07A 3NRVA 4CZZA 2HOEA 2JN0A 4HYEA 4CS4A 2I2LA 2YR2A 2A6HF 1RIQA 2P5KA 3ML6A 4KNYA 1P4XA 4M77A 2ARSA 1QZYA 4L87A 3QP6A 1ZG1A 4UVCA 1FPQA 1EVKA 4YRJA 2L4AA 2ZR2A 3L00A 3B02A 2M45A 2VXFA 5K1YA 1L0WA 2OD5A 1FYKA 1FC3A 4MMKA 4YRTA 1FY7A 4M7DD 2DT5A 5CVIA 2AS5F 4GGGA 5JFRA 5DYMA 1USYA 1HSTA 3RUXA 4NL2A 3H3ZA 4UVAA 2ADUA 3J81K 4EJWA 3QO5A 1G51A 4E70A 3LSQA 1T98A 5DUIA 5LJ5j 2PFBA 2QENA 3SZPA 4UNOA 1DDNA 2RNJA 2VBWA 1FBQA 4YFKF 2DTOA 1JXSA 3PZCA 1YW8A 2BEOA 3PCOB 5DD8A 2V1DA 5LBQA 1F5TA 2DQ0A 2GZWA 2I4OA 4IXAA 1PYSA 3V8LA 2H94A 3JSOA 3Q5FA 4ESFA 1B34B 1QNTA 1YYVA 1E17A 5GAN7 1EFWA 3ZMVA 4IHTA 1NJ5A 4CH5A 4HQEA 3A7RA 3J81Z 5HDKA 4Q5SF 3GZ5A 1WLEA 4P73C 3QO8A 3VB2A 4P96A 1N9RA 2EFWA 1FSEA 2FXAA 3GF2A 1XCVA 4YRIA 5FFZA 2PMHA 5ERIA 4PZJA 1ON2A 3K9TA 2GIVA 3TUPA 1XGMA 4J6WA 2MA3A 4M78G 1R22A 3WTWC 1VTNC 3BFMA 1B4AA 1H4VB 5GAN6 5H6QA 4PJOB 5A2QK 4RB0A 3HTSB 3A31A 2IW5A 2ISYA 5EEGA 1R1UA 3HIFA 6PAXA 5HDGA 4U0VA 3AAFA 3F6OA 5IT3A 3IKTA 1IRGA 2ALYA 3P7NA 1DPUA 1Z05A 2P0LA 3HXVA 3CLOA 4OOIA 4I09A 5L3DA 2DU7A 1P4AA 1KQ1A 2KIUA 2XAHA 3K1PA 4CS3A 2QLZA 3JCMX 3JCMg 2BGCA 2J5PA 4M7AF 5K5RA 5A2QZ 4UVBA 2J3LA 4JBAA 1ZGAA 2QUFA 5DCFA 4C92F 2KRFA 2PI0A 4UP7A 1KYZA 2DO7A 4G7OF 2VBXA 2OQGA 2BV6A 4LGWA 3K1MA 3VQXA 1YB3A 4YIIA 3REOA 2P4WA 3JB9G 2VBYA 4TVAA 5DUKA 4WX9A 3CUQB 1WSUA 1K78A 1Z7MA 2EV0A 5FLXK 1OR7A 3TDZC 3ROUA 2HR3A 4XU0A 5GMKh 3K2ZA 2EFPA 2OU2A 3LFKA 3LC0A 1G3WA 1B76A 4YRQA 4BAYA 3FHZA 1TQPA 1Z91A 4YROA 1B8AA 3KLNA 5F6FA 4MQVA 1LYLA 4K2EA 3HXXA 2EA4A 2K02A 2XGTA 4A6DA 4I98B 1EH6A 2E3CA 3GX4X 2H6BA 5FLXZ 4M7DA 4MEYF 4F7UF 5F1RA 2ZZGA 4HV5A 4PJOC 2PG4A 4YRCA 3TKYA 5KNNA 3WG9A 3VBBA 5E1WA 2G7UA 4TV7A 2W24A 4S04A 3E5XA 5DEQA 4XEMA 1IN8A 5E3IA 5K5QA 3FXRA 4HWSA 3INZA 3FM3A 1EIYA 1R58A 5HOOA 3F8CA 2ZO4A 5ELOA 5LJ5d 3JCMJ 4KIBA 1B6AA 1FT9A 4MNUA 3HYIA 1HW1A 2RA2A 2F5DA 1YS7A 3BOQA 4YRNA 1FP2A 1HQCA 5E1ZB 3OV8A 3JAMK 4PJOD 2IRFG 4EM0B 4M78A 1ASYA 4X9DA 4NHJA 3H92A 4HWPA 1O7LA 4HA8A 5D5XB 2EV6A 1SD5A 1WI9A 5GAN8 4XLPF 3V8KA 2ARTA 5EEHA 2DU5A 4ENNA 2ZR3A 1T6SA 2X0LA 3M4GA 3CUQC 5L3EA 1G3YA 1YFSA 2P5VA 3ERRA 3GWZA 4ETSA 5GAOr 1KA8A 3VFZA 3RKXA 2K4JA 3FWEA 3TEHA 2E1CA 2GXGA 4KFCA 3A5YA 3DFGA 3JAMZ 2Y90A 2JPBA 5GANg 5ILSA 1PP8F 3SQNA 4M75E 4RCCA 1IN4A 1MJ9A 1S3JA 2FNAA 4HV6A 1ZG5A 4P73A 4EJTA 1R7JA 1SFXA 2M5WA 2DK5A 3WTSC 11ASA 4H0EA 2DQLA 2PEXA 3R0AA 1QQIA 4XQ3A 2E1NA 2HS5A 3IC7A 1E1OA 5CLSA 3G1ZA 2UXXA 3U9GA 1T0FA 1T2KA 1R1VA 4HQMA 3BJOA 1YFRA 3MAJA 5H6RA 4I0AA 5JHUA 2G9WA 5GMKj 2DZ9A 3F6VA 1KMNA 3HHHA 4PHCA 2WTEA 3I54A 2ALYB 1JGSA 1C0AA 3ZN1A 4R8HA 4RGUA 3FXUA 5GAMh 1GXPA 4C8QC 3RESA 1X54A 4XTXA 4R79A 3P9CA 4QWQA 1LOJA 5D8LB 4GXOA 1LDDA 3TO6A 3K1NA 3ABTA 3R60A 2F5CA 4F7ZA 4Y13A 4M7AG 5ELNA 2KJBA 3WGGA 1BOAA 3KEQA 3IKMB 4C92G 1IAWA 4D0PA 3HSBA 2C8MA 3ISPA 1PDNC 4BNCA 4UXNA 2KKOA 2Z33A 3KE2A 1L3LA 4WXCA 1A04A 1TQIA 1REPC 2IT0A 1OYYA 4TVAB 4M77E 3I59A 1KU7A 3I7FA 4C8QD 3I53A 1FYMA 1P6RA 4EVIA 1K78B 4BHBA 1SMTA 2EJRA 4BXUA 2ZXFA 3I4PA 1TTYA 5BOXA 4Y17A 4TWAA 4NL3A 4CO8A 1KQ8A 2ELHA 5E17F 2C6YA 2LF7A 2XRNA 4HDUA 1ONVA 1UB9A 1S7AA 3L7WA 2ZZFA 2M8EA 1BBYA 4Y91A 1DP7P 2HFHA 4ENJA 3ELKA 1JHHA 4OU0A 2G7HA 2X4HA 4YIFA 2PLYA 3GZ6A 3M4QA 2CJ9A 2EAYA 4F7UG 5D5VB 2LKPA 4MTEA 4ZZLA 4YRPA 1TNSA 2L4MA 5TJJA 1ZN2A 4KMFA 3HXYA 4MMLA 1IN7A 3LWFA 2Q0OA 4LLGF 4OINF 3ZMZA 2QHVA 2D2WA 1OYWA 3EDPA 1UCRA 3PFIA 3TEGA 1F4KA 1KQ9A 5FGMA 4ZYDA 3E5UA 5F64A 2VC8A 3MCZA 4PJOA 5K1PA 1IXCA 2HTSA 5LGTA 4L5IA 3RI4A 4JRIA 4IVNA 1ZGJA 3T0YA 3COAC 1W4MA 2DPUA 2D1HA 4GYGA 5ILUA 4YCVA 1C0WA 4XTVA 2DI3A 4FHTA 1IN6A 2GXBA 4U7BA 4G8XA 4M78B 2VOOA 4Q15A 2JT1A 5GAN3 4WCGA 3JB9J 4H02A 4M74A 5BS6A 3MQ0A 3AHUA 4MQ9F 1JRIA 4L0YB 2W57A 4X5OA 2EJFA 2QYOA 1G5IA 5ICGA 4J6XA 4AD9A 5LJ5e 1F9NA 4I2OA 2CQKA 1WQWA 2FYKA 5GAMj 4CS2A 5LGNA 1ASZA 2MBFA 4KN7X 1NJ1A 2H27A 3WTYC 1X2GA 1LDJA 2ESHA 4P3NA 1G6NA 4OIRF 3CUQA 5LGUA 4K88A 2QVOA 2MD5A 4L5JA 12ASA 1BI3A 1U6GA 4LNSA 2QTXA 4OIOF 3KETA 2ZZEA 4CH3A 2RC4A 5GAOn 4A5MA 5DDGA 3EFRA 2ISZA 4RCBA 1B70A 5D6FA 3KP2A 1E1TA 3DSQA 4FT8A 2DK8A 1BC7C 3MFKA 3MF1A 2CFXA 3CO6C 5JR3A 5GAN2 4RB2C 1HTTA 3C3WA 5LEKA 2DTRA 2XASA 3BDDA 2DBBA 2HWVA 2P5IA 1MKMA 3QO3A 2J5OA 3LSTA 2O0YA 2OAZA 2FEZA 1D3YA 1M8VA 4HX4A 4HDVA 2ZT6A 4O5VA 2TDXA 2QZ8A 3REUA 1WRJA 2HGCA 2GA1A 1B59A 2EL9A 5D5WB 2ZNYA 1UFMA 4OMZA 2P7CB 3VQVA 2ZINA 4H2VA 4HAMA 4C8QA 2PMUA 1B1BA 5E1XA 3P9IA 1BJAA 1ADYA 1Q1HA 1KU9A 4U7DA 3F21A 1MDMA 4NOYA 4EJVA 3QTCA 3KZZA 3G3ZA 4P72A 3NENA 3O3KA 4M78C 3FMQA 5D5UB 2PMEA 2Q2EA 2EB7A 4EQQA 4M7DE 1LNWA 5DCMA 1O3QA 3D0SA 3I59B 4YFNF 1BI2A 2HKXA 3TDUC 1KMMA 4DPGA 2RQPA 3L4GB 2A5YB 1R00A 4K87A 1QF6A 2BBYA 1ZRFA 2FMYA 1TW2A 3CO7C 5HLHA 4LMYA 1L0OC 1YQAA 3JCMb 4M78D 3DEUA 1WYDA 4EGYA 1H4QA 4ASNA 3HRKA 3BJAA 1KU3A 3U1DA 1J5YA 2CIMA 5HS9A 5ICEA 3E5QA 1TBXA 4HX8A 4M78E 1O7FA 5DV5A 1YO5C 4ZH4F 2E7XA 3LQQA 3DP7A 3I64A 1I27A 4B8XA 2IA0A 2MH9A 3D5LA 3JCMP 3T5XA 3HFNA 3GW2A 1X01A 1H0MA 2RDPA 4A12A 4AIJA 4HVCA 3LA7A 4ESJA 2EJGA 1FZPB 5AIQA 2QHUA 4I0BA 3VU3C 3IALA 4M71A 2V1XA 5GMKm 3B73A 2VONA 1D5VA 1J59A 1R5HA 2DZCA 3I0TA 2FOKA 4G9YA 1TNTA 4M75F 3NELA 1CGPA 2MLGA 2ZCWA 4O2DA 3Q9SA 3RYPA 3E6BA 5GAMf 3JB9D 3T8RA 3MZYA 1FBUA 2QM3A 4L9TA 1ZYRF 3QPHA 1PUEE 2DW4A 5GAMd 4XSXF 1XCBA 4KMUX 2YLBA 3JCMV 3PQKA 2BE5F 2O03A 4RGRA 1KYWA 1MJBA 3M8EA 1HKQA 5E8IA 1T39A 5LJ3h 2DLLA 3R6SA 3HTUA 1W5TA 1WQ2A 1ZARA 3SFZA 1LEAA 1X56A 2ZT7A 2XKPA 2Z99A 1B70B 3VQWA 2VT2A 4E51A 1RNLA 5TRDA 3HY0A 1MJAA 2STTA 3LAJA 3HFVA 1IUYA 2K27A 5C53B 2QQ9A 3QU3A 4K86A 4NQWA 1H641 1WQ7A 1FNNA 4RQEA 1LJ9A 1I4K1 2ZJ2A 5GAN4 4NB5A 2XGXA 2QHSA 4N0BA 4M77F 3V7CA 5AONA 2GQQA 2NNYA 1V4RA 4IRHA 4XSZF 3C18A 4I02A 4TQFA 2EV5A 3NEMA 3A74A 3QRFF 3ZMUA 3SZTA 5GMKe 4EJUA 4ZYGA 2UZKA 4MGRA 1ODDA 4BW9A 2RB6A 4HWTA 2FB7A 4YRRA 1IXSB 4C8QB 3HSRA 1J9IA 4KIGA 2ZFWA 1KGSA 3RTRA 4LLNA 2YPRA 5L3FA 1EH8A 2MC3A 3V8JA 5FB2A 1MDMB 4YRFA 1MD0A 5JVTA 1X2HA 1BN5A 2A07F 3FIFA 2HKOA 1R36A 4PCQA 4F7UB 1ATIA 4ENMA 3F3XA 4A5NA 1I8FA 4HT9A 3IL2A 4ZTZB 5I21A 5DCMB 5DY9A 4YRLA 2EFNA 2RN7A 1S7OA 3V7RA 1NYQA 5GAOm 1USTA 4KQEA 2LDUA 1ZRCA 1G3TA 4TQDA 4UUVA 3FX3A 2XAQA 2I4NA 4Q47A 3DXJF 4J15A 2PMFA 5GANf 1HXDA 4PJOE 3F72A 3KP5A 4BH9A 4KICA 1FOKA 4OIPF 2OZUA 2K4BA 1V3FA 5GAN5 1QO0D 1RIOH 1UHMA 2HEOA 1R5GA 5LJ5g 5LEJA 2F2EA 3GYHX 1BC8C 3HRMA 2WWYA 4YRSA 3M4PA 1IRFA 3O6BB 3WU0A 2XIGA 2A69F 2B0LA 4M9SA 4M7AC 2RHQA 1ZLJA 1WNLA 4M9XA 3R4KA 4LG0A 4C92C 1U1SA 5GMKl 1ON1A 4IF4A 5LHIA 2C7IA 2DXTA 4PNOA 4J6YA 3BW1A 3M8FA 2CYYA 4ZYHA 4P74C 3R0JA 5E18F 4EO4A 1XSDA 2XAGA 3EQLF 2VT3A 4TVYA 3NQOA 4LB6B 5LJ3j 3L2ZA 1SD6A 1B7YA 1HW5A 5ILVA 1E22A 2Z9OA 2A3SA 4WJ4A 3DF8A 2V6CA 4M7AD 3JCMh 3WE3A 1LB2A 3TOAA 3RF1A 3LA3A 3VEPA 2Y48A 4HOBA 4AVPA 3K69A 4C92D 4M72A 1SD7A 1S8NA 4UV8A 1CF7B 5D4SA 3HXWA 4B09A 4M75G 1EOVA 2DQRA 5E8GA 1IF1A 1XSXA 2FA5A 4XU3A 2HZTA 1X55A 2VC1A 5HVQC 2KJCA 1AOYA 5CVJA 4EGZA 3E97A 3BDUA 4Y15A 3RDIA 4EMGA 1RUNA 1IN5A 1BM9A 4RAYA 3E9HA 4P55A 3HXUA 4P72C 1J7KA 1G3SA 1IW7F 4A2UA 4TVWA 2E65A 5C51B 3NEUA 2ZMEA 4LLLA 2JZYA 2YHTA 2A6EF 5F5WA 3QSUA 1YG2A 4CICA 2VE9A 2NNNA 3U2RA 4WF2A 1WKMA 2JSCA 2ACJA 1SESA 5DD4A 2L54A 1BI1A 2DU9A 2Y75A 1YTYA 3P8YA 4L9NA 3FZVA 1U5TC 3L4GA 5GAMe 4A53A 2ODRC 2ZCEA 2OA4A 3J80K 2H09A 4C8QE 1KU2A 4U0WA 4KR2A 3KEOA 4AIHA 1LEBA 2DTHA 1E24A 1D3BA 3M1EA 2L01A 4GYIA 3GXOA 3ZMTA 2JPCA 2H6CA 5D8KB 4EJOA 2V79A 3SXYA 1W7PA 2ZNZA 2Q7GA 3VOEA 2F5FA 1ULYA 3JW4A 4UHTA 4UV9A 3V4GA 4M7DF 5E20A 2NS0A 4M77G 4A0XA 4NCXA 2V1UA 3JB9I 5K1XA 2ODRD 1HW2A 3EYYA 3C7JA 1U2WA 3JB9H 1IL2A 3J80Z 1U8RA 2Q5HA 3KP3A 2IPQX 1YIOA 3QU6A 4H2XA 1N9SA 4JUVA 1PP7U 2FBHA 1G4DA 3NETA 2DFIA 1I1SA 2RGVA 3P8TA 1O57A 2P6TA 1X3UA 4RMFA 2P7VB 5LLQA 5LHGA 4P9UA 4A0ZA 3RPUA 3QP5A 1ZRDA 4BHPA 3IG2A 3KZYA 4HF0A 2NRAC 4MHGA 2M87A 5JI6A 3RKYA 1RI7A 2Q7HA 3G73A 5LJ5h 2I4MA 5KK1A 4BYYA 2ZNJA 2O6GE 2FBKA 4OIQF 2DAOA 1FYFA 5AIPA 4ZZDA 3KCCA 1Y96A 5LHHA 2IY5A 4R1HA 2VOPA 5GANh 2FSWA 4OP0A 4HF2A 3TQNA 3A5ZA 3HY1A 3GIBA 4AIKA 5J8CA 3OD1A 3TO7A 3CTAA 3JCMW 2QQBA 4YCWA 1BBUA 2ZBKA 4L0ZB 2NYXA 4KT5C 1U78A 3T1BA 3GEZA 4XU1A 3IWZA 4S05A 5LJ3f 2RHQB 1XGOA 1J2XA 4RS8A 3TGNA 4LG0B 4U0YA 1YCYA 2W84A 2UWMA 5LJ3d 2ZIMA 1JE8A 4M7AA 4ON0A 5D6EA 3CUOA 1FSHA 1KQ0A 4C92A 2RVCA 4CDGA 3WTVC 3IKLA 2FQ3A 3RJPA 2VE8A 2XAFA 3HRSA 2W25A 2NAZA 1SFUA 4V2SA 1EV7A 2VXEA 4N0AC 3BY6A 2PBIA 2Y0MA 3LAPA 4X9CA 2P5LC 4P74A 1B7YB 4G6QA 4XRFA 1QPMA 2IJLA 2GWRA 3PGGA 2DPDA 5FD5A 2HYGD 4L9JA 1OMIA 1QBJA 4WXHA 3WGIA 1NJ2A 4PGHA 2E1HA 3LA2A 5C52B 4QLCU 4LD5A 1LVAA 3LQRA 1B9MA 4P71A 1D8KA 5H20A 3W6KB 2VN2A 2YSRA 3N97A 1J75A 2W85A 1GVJA 1EQRA 1TLHB 3QO7A 4Q6GA 1ZAOA 3JCMQ 5J8FA 2HQRA 4HZFA 5L3GA 4EMKA 4EMSA 3WODF 4YDQA 5ICFA 4YPFA 2MH2A 1LJOA 2Z5UA 1M5Q1 3KLOA 1K6OA 2ZMEB 1EVLA 4RGXA 4F7UA 2DVEA 5GAOp 2COMA 4A54A 1TH7A 2A61A 2ZXJA 1I1GA 1ZG3A 5CVVA 3GVAA 2FE3A 3BROA 2V9VA 1K79A 2JTVA 1HK9A 3RGLA 3BPXA 5K5OA 3L09A 4DNCA 3HFOA 3QAHA 1YW7A 2FBIA 3IKVA 2EA2A 2Q5IA 5KVRA 4OMYA 1U5TA 5CAIA 1OKRA 1O3RA 3HXZA 3ABUA 1WWXA 3J7AO 4BWAA 3E6MA 1XDUA 3RYRA 2FF4A 1D3BB 3RIRA 3UH0A 5FO5A 3EUHA 1T38A 2QWWA 4M7DG 1W7PB 1P2FA 2E10A 5GANj 1SAXA 3W3SA 1SFEA 4P3OA 4HWOA 2YX4A 2JRTA 4BQAA 1H4TA 1J0RA 2HDCA 2HQNA 3IHUA 1SERA 4G7HF 2DDZA 4KR3A 1FWZA 3SHFA 1G5HA 3ICAA 2HTJA 2KIMA 1NJ8A 2ZNIA 2E41A 2G4CA 2R3SA 4PJOF 4M6XA 1QGPA 2EK5A 3ULQB 1YFTA 4H2XB 3VQYA 1Z1DA 4HT8A 1KQ2A 4P75C 3KP6A 4H2WA 4OLFA 5CJ9A 3SWNC 2I4LA 3E3VA 3A7AA 2XV4S 3E6CC 4LFUA 4EX5A 3JCMf 1FP1D 4XEOA 1CF7A 1QE0A 4UP8A 2CGHA 4AWXB 4KDPA 4GO1A 2K57A 3Q9VA 3JCMd 1EH7A 1BIAA 4DQ2A 4HW0A 2VBZA 2DTIA 2Q7EA 1XD7A 1U3EM 3WTTC 3GFJA 4KUMA 1XGSA 2AKWB 2FNPA 2DEQA 2XAJA 1Y96B 2CJAA 2IY5B 1F1ZA 5LRSA 2PN6A 2FU4A 3FF5A 1P4WA 3IRRA 1H9TA 1MZBA 5BPIA 1I81A 4G6DA 3F8BA 1WPYA 2XVCA 1TW3A 4M75B 4KA4A 1NNHA 3RL6A 4HX7A 3WQZA 5CVRA 3K0LA 2EFQA 3BJUA 4ZTUB 3ECHA 1FYLA 2P6SA 2KIFA 3DQVC 4JRKA 1NHAA 4M6YA 4GCVA 3A7UA 3DPTA 2D1VA 4P3PA 4KYWA 4M7AB 3EETA 2CSOA 2WC2A 5GAMg 2XTIA 4YFXF 4C92B 1RUOA 4G84A 4JLIA 2O61A 2ESNA 3QPTA 5ICCA 4G7ZF 3FMRA 5HS7A 5FFXA 3FB9A 2CWEA 1GHCA 4H2UA 1MGTA 2GAUA 4MTDA 4HLXA 3CDHA 1Z7NA 3F23A 4P5OA 4N0AA 3JTHA 4EM2A 2IP2A 1DUXC 2HYFA 4M9ZA 4LB5A 2YU3A 3KP7A 4WJ3M 2Q8KA 4RB1A 5LJ3e 5FD6A 4M73A 4WI1A 3WTXC 3GO5A 3I5UA 3BP8A 1YGBA 1XN7A 3RPQA 3F22A 1LQ1A 4C8QF 3P8VA 1W7PD 3DPLC 1ZHFA 3IWFA 1HKTA 1VQZA 4EV0A 4O6JA 4XBFA 4XTYA 3PQJA 3ZP5A 1YW9A 2ZT5A 1IZ1A 3OOPA 4IPAA 4EMKB 3MEYA 1JBMA 3QUIA 4M77B 1O3TA 2BYVE 1R1TA 2STWA 4QVDA 3KFUA 3M7GA 2VXZA 4O3MA 2AMCA 4XLNF 3O2PE 2IA1A 1HC7A 5LJ5f 5HS8A 3L9FA 2ZIOA 1R23A 3I71A 2QQAA 1J5WA 2VC0A 1LNXA 1S29A 3HUGA 1FBSA 1XMAA 1OYIA 4TTVA 2Z3YA 4M75C 3HSFA 4PGGA 2QHTA 2EWNA 1ZH5A 5HLIA 1LDKB 3FM5A 1U5TB 1SD4A 5GANd 3HRTA 4HWRA 2CJBA 4Q4ZF 1P92A 2E64A 2RV8A 3V7SA 4YRGA 1XB4A 1MGQA 2M30A 5L3BA 4RDXA 2E5AA 1XGNA 1U1TA 4LJZF 2CGPA 1SMYF 4A6EA 2PJPA 1PYSB 2ARUA 2XUBA 3GLXA 1ZLKA 4N9IA 2K7LA 2QBYA 4M75D 4CH4A 2DJZA 5IT9K 1BIBA 4PJOG 2PQ8A 3UFGA 2L02A 1AWCA 4I7HA 3IRQA 4P9FA 3W6JB 4EMHA 1ZREA 4XTZA 3GFIA 3WTZA 4FX4A 1FX7A 3BJ6A 3E6DA 5GMKi 3MEXA 2RHSA 1HBXG 2O8XA 2FMLA 3EYIA 3QOPA 4P71C 1H4SA 4P75A 3BPVA 4RAZA 4LK1F 3SWNA 2D45A 1B9NA 2LNBA 1USSA 4EM1A 3CMQA 1DPRA 3F8FA 3ZN0A 4M7AE 1Z6TA 1JJCA 3H3UA 1H9GA 2CW0F 3HFZA 3ZQ7A 4C92E 5IT9Z 4UP9A 3R61A 4EMKC 3ZPLA 2ETHA 2E7WA 3F8MA 2O3FA 4M77C 3DV8A 1K7AA 4XTWA 2P8TA 4YCUA 1Z7UA 3BZ6A 2FRHA 2EFOA 3MZHA 2R7DA 2L3DA 3C1DA 1KOGA 3E9IA 4WWCA 2XROA 2ZKZA 5BMZA 5L3CA 4KN4X 3JCMe 2OBPA 4J5YA 1USYC 2CO5A 3F8NA 2MLKA 4G85A 4YP0A 3JTGA 2M1BA 1UHWA 4H2SA 2RM4A 4PDKA 4M77D 2UXNA 3FMSA 2YX7A 4YG2F 2WV0A 4H2TA 1GXQA 3UGQA 2EJ9A 3DKWA 1IXRC 3HOTA 2VODA 4FX0A 1YS6A 2AXLA 4CYDA 3REXA 2XHKA 4F7UE 2LF8A 1XDSA 2ZT8A 1FLIA 3KP4A 1Z6RA 3WU1B 2XKOA 1YFHA 3PCOA 5D4RA 4WXDA 1HSJA 1YLFA 2RD1A 3N4MA 2GA2A 3JCMc 4G94A 2DQ3A 1B34A 4Z2YA 3QHSA 1ADJA 4H2YA 4YYEA 4QVCA 3ZMDA 3WGHA 1NJ6A 4C8QG 2HNIA 3GUDA 4IRIA 3A32A 4YRMA 2A68F 3LSSA 3GFMA 4Q48A 2J3MA 3HSEA 5GAOl 1BI0A 4CHUA 5HDNA
chains in the Genus database with same CATH superfamily
3HRIA 2DD4A 2L3PA 4VUBA 1W5SA 3QKJA 3IQLA 3VODA 1ZQ1A 1P7IA 3TO9A 4M6VA 3HOSA 1UJ8A 3IV5A 1RR7A 4IZZA 5CKHA 2K9LA 1Y7XA 2ELKA 4MFDA 3RKWA 4NBQA 4JZ3A 3ASNH 1UTIA 4ZGDB 2LVMA 2CG4A 2AT1B 4RTZA 3ZQIA 2RKHA 3ZQFA 1W36D 5F0CA 1BBWA 2DDBA 2HYJA 4ZIBA 3L1AA 5FWCA 2DL3A 4UPAA 1YITI 2RJCA 1STZA 2LQWA 3K6GA 5C4JJ 1ZKGA 3HRUA 4MEXF 2M9HA 1KHCA 5CYVA 1XMKA 3OSSC 1K73U 4ZYEA 3CCLA 3CCRT 1Z9CA 2LJ3A 2X1EA 3L2CA 3CCMT 4OMMA 2MABA 1SRYA 1YX3A 9ANTA 4PG3A 1UAAA 2RO0A 2CUEA 3WE2A 1IGUA 3M4OJ 2CZ1B 2K86A 4IRGA 4LVLA 2JTMA 4JRPA 3CCVQ 4YELA 2OUMA 1TWHJ 3CDLA 2AK5A 4RB3C 2RHSB 1TQMA 3G1LA 1C1AA 5ED4A 1RZ4A 3PO3J 3BWGA 2R7FA 2Z16A 1S9HA 3HKSA 3M54A 2DXUA 3QNEA 3R07A 1FTZA 2HOEA 4II1A 2QQRA 2ARSA 1X1CA 3JRGA 2UV1A 1V5FA 3QP6A 3X28B 4UVCA 4YRJA 1TZLA 3DBLB 1FYKA 4JJBA 4MMKA 4M7DD 5CVIA 5DYMA 1K76A 3J80E 2LQNA 4RKUE 3CCLI 2Y0SA 1LKXA 1HSTA 1R8OB 2IXSA 4UVAA 2QEXQ 3J81K 5FKMA 3EG3A 2E1OA 3LSQA 1KC8U 1T98A 1I6HJ 5DUIA 5LJ5j 4OF1A 3SZPA 1N77A 4UNOA 1NYGA 2BHZA 5I22A 4XN0A 4Z6YA 2JA7J 3PZCA 3VJPA 3K4NA 3HHTB 5LBQA 2NS8A 3CD6T 3V8LA 2H94A 1E17A 1EFWA 2AQFA 4CH5A 4HQEA 2Z0WA 3A7RA 3K7AJ 3UNGC 1FOXA 1MMAA 1Y0NA 4J9CA 3ZEHA 1RI9A 3QO8A 2E6ZA 4F16A 3CMAA 1QVPA 1G83A 1XCVA 3CC2Q 3HP9A 2R0QC 1T0FC 4AM3A 1FTTA 2CDTA 3WTWC 1Q7YR 4ITVA 5CPRB 2FL7A 5GAN6 4PJJA 4XLHA 1HDPA 1Y71A 1K9MR 3A31A 1F1BB 3HIFA 3HOYJ 4I76A 4A4KA 4DEXA 3E1SA 2WY8Q 2ZPBB 3HXVA 4XQFA 3WVEB 3EG9A 5L3DA 1P4AA 2KPMA 2KIUA 2HNHA 3HZJA 3S93A 4BY7J 2WACA 2J5PA 1QVFS 5IYBJ 3HOXJ 4CCKA 4G7OF 5C3EJ 3KEYA 2OQGA 2QA4Q 2BV6A 3K1MA 4YIIA 2VBYA 3CBOA 2O8KA 2VQHA 3S14J 2F48A 1WX6A 3K2ZA 3NTHA 3CMAI 3A8LB 1VF9A 2BY0A 3OL3A 1FMVA 1FOYA 3EG2A 3M59A 2H1KA 1AWXA 3H9NA 4I98B 5EJCA 1I0CA 2E3CA 3G7ZA 2H6BA 2O88A 4F7UF 2JJ7A 3UDCA 2ZZGA 2Y0SN 4HV5A 4YTLA 2HDAA 3TKYA 2COZA 5E1WA 2W24A 4S04A 2DLPA 1IN8A 4GBQA 4HWSA 2PMZA 3INZA 3FM3A 1EIYA 1WJBA 3F8CA 4MNUA 3HYIA 3JRBA 3BOQA 3AL0B 5E1ZB 2JUFA 4PJOD 4CH7A 4PSXA 4EM0B 4M78A 4HCKA 1Q82R 3GTKJ 2HEQA 5D5XB 1PYVA 2EV6A 3MKWB 3V8KA 2DU5A 2ZR3A 1V55H 2X0LA 1SHGA 4JRQA 5L3EA 1OZ2A 4ETSA 3OOUA 1JT0A 3RQ4A 4A69C 3VFZA 2K4JA 1YITQ 1Q86U 4F14A 5GANg 5ILSA 2KT1A 1MJ9A 1S3JA 2EKHA 4P73A 3BG6A 2VPRA 4H0EA 2DDAA 1K1ZA 4E7ZA 4XQ3A 2K3PA 1NJIR 2UXXA 4IIMA 1R1VA 3BJOA 2LFBA 2C06A 2FRWA 4ABZA 2KIQA 5GMKj 4E6KG 2ZXWH 1KMNA 1UELB 3M1CA 1WHGA 3DTIA 2ALYB 4U87A 5JHFA 4RGUA 3FXUA 5GAMh 3RESA 2EZKA 1X54A 4L5EA 3P9CA 2R7RA 1LOJA 1T3LA 4GXOA 2CQ7A 4M7AG 3EAEA 4D0PA 1PDNC 3KE2A 2HZYA 3QDFA 1A04A 4OGCA 1ETKA 1HDDC 2KP6A 4M77E 3I59A 1KU7A 3I53A 1FYMA 2EJRA 4BXUA 2M3AA 1TTYA 2I5UA 4TWAA 4CO8A 1KQ8A 5E17F 4HCCA 4LVIA 2EYQA 2XRNA 1ONVA 2H8HA 4AFQC 3CP8A 4HCBA 3O8GA 1A35A 4NQWB 3M5AA 1JHHA 3MEAA 3OS2A 2X4HA 4FW2A 2CUZA 2CJ9A 2PMZN 3QJ6A 4ZZLA 4YRPA 2L4MA 3HXYA 1IN7A 4BEHB 3LWFA 4LLGF 2QHVA 4X1EA 3OW2P 2PTKA 2GQVA 3PFIA 1UHFA 1B3QA 5FU6C 4ZYDA 3E5UA 2HTSA 2DOEA 1U06A 3OYCA 3GTOJ 4OAZA 4LD6A 4L5IA 5IY5H 5CO7A 2DPUA 4GYGA 5ILUA 4UUSA 1DQUA 4XTVA 2YSQA 1IN6A 1OPKA 2EFIA 3VS5A 2VOOA 2ZPFB 2JT1A 5GAN3 4H02A 2E3IA 3MQ0A 1NG7A 4L0YB 3G71A 1TOVA 5FRNA 5LD2C 2E35A 1Q81R 5IT9E 4CS2A 2MBFA 2R7TA 4KN7X 3EG0A 3JCUC 1NJ1A 2H27A 3P8DA 1VQ4T 5EG0B 2K3BA 3CUQA 3BG7A 4A4FA 12ASA 4LNSA 3VS6A 5GAOn 4A5MA 3D7SB 4KGXB 2ISZA 3S8PA 2K9NA 1PKSA 3PIPA 2ZC2A 2ICWG 2LJ0A 3GF5A 1NEGA 4RB2C 2M4KA 4FL6A 3C3WA 1EA3A 3S3OA 1WVRA 1YI2A 3QO3A 4QQDA 3HKZA 3QYHB 4C2TA 3PTAA 4JJDA 2QZ8A 4LUDA 1WRJA 2RPNA 1QVGP 2M1HA 2OAUA 2P7CB 1NK2P 1XPXA 4HAMA 5IP9J 3P9IA 4U7DA 1M1KR 5ECAA 3G3ZA 4PUSA 2EQIA 4P72A 3DKXA 2OTJQ 3OS5A 4RM3A 1LNWA 2XDVA 3G71I 1O3QA 2VASA 1IC8A 4YFNF 3NPFA 3MD2A 1M90U 3TDUC 1KMMA 4DPGA 2RQPA 3NHNA 4II2A 2A5YB 1R00A 1B72A 3MHXA 4XLAA 2CP7A 4LMYA 7AT1B 1TC3C 1N25A 1WYDA 3FK6A 4ASNA 1TWBA 1EKEA 1ZK8A 2EIJH 3U1DA 4IURA 2PX9A 1Z3XA 1S7EA 1TBXA 1M4ZA 5DV5A 5IXBA 2J05A 1YI2I 1A6QA 2KLOA 1TWGJ 1RLQC 1VQPA 1NE8A 3JCMP 1NBEB 3GW2A 2ECBA 4HVCA 3LA7A 4ESJA 4AYBA 1K4TA 2DMQA 4B3AA 2IGOA 1R5HA 1AU7A 2YUSA 4CC7A 4IOAF 3NELA 3E6BA 3OR2C 1UGPB 3JB9D 2QM3A 2KXDA 1ZYRF 3RNJA 3AG1H 1VQ5A 5GAMd 1ZBXA 4V2FA 3BQYA 2LNVA 2RHXA 3JCMV 3PQKA 4ZDLA 2CUBA 2DA5A 3FXJA 1TUDA 1W70A 5E8IA 3G4ST 4B3XA 1ZA1B 2KRCA 3WHBA 1AKHB 1ZARA 5JVGF 1X56A 2ZT7A 1B70B 2HAXA 3HKZN 4E51A 3HDDA 1RNLA 3IAS2 2P84A 3VPRA 4LDXA 5C53B 3CXCP 2QQ9A 2R7VA 1MMDA 5IP6A 2V1QA 1VQPI 1H641 1VA7A 1FNNA 2WB1A 3ZQHA 1LJ9A 1VUBA 1T08B 2DERA 2QDYB 4N0BA 4LDUA 5AONA 5LFAA 1V4RA 4A3CJ 3S3MA 4IRHA 5A0GA 3C18A 1VQNA 3QRFF 2VKNA 2MPXC 3CC7T 3CC4Q 2FB7A 3JR9A 3RTRA 4LLNA 3V8JA 3X24B 1MDMB 1VQ5I 3OYMA 1NM7A 1X2HA 2HKOA 2FOWA 4F7UB 3BZKA 4ENMA 2GM4A 5I21A 2MMPA 4AT1B 4C0DB 1S7OA 2COYA 1NYQA 4G12A 2WADA 1USTA 2LDUA 1ZRCA 2I4NA 1M2VA 3DXJF 2PMFA 1HXDA 4BH9A 2VPLA 2K4BA 2BZTA 4C2UA 3GYHX 1BC8C 3HRMA 3E2UA 1OJLA 3WU0A 2RQRA 5GJWB 2MYSA 1U1SA 1Y8RB 4AYBN 2C7IA 1OU8A 2JMAA 3VWBA 5FLMJ 5LJ3j 5A2QE 1VQNI 1BW6A 2M9UA 2EZIA 3TOAA 1JTXA 3LA3A 1PRLC 1VQMQ 1BR4A 3K69A 4C92D 4M72A 1S8NA 4JYKA 5D4SA 1ENHA 1IF1A 2VC1A 3SEZA 1YJNA 1VQ6Q 2ESWA 3BDUA 3RDIA 3NTIA 4EMGA 1WJRA 1W2BA 4Z8AA 3I9V2 4D9JA 4LLLA 3S17J 2KSSA 5KYYB 2E70A 1A31A 4PLIA 1A36A 4WF2A 2RNGA 2GFAA 5FLXE 2DA9A 2Y75A 2WB1N 2H09A 4C8QE 4N4OB 3CQTA 1E24A 3M1EA 2KRMA 3ZMTA 2JPCA 2H6CA 1X27A 1W7PA 3L2VA 4UV9A 5E20A 3SFMA 4A0XA 2EVRA 2V1UA 5K1XA 4DA4A 3CPWS 3EYYA 2VKHA 2IPQX 1UGSB 2BUDA 3QU6A 2CU7A 3DB3A 3NETA 2DFIA 1I1SA 1YJNI 3OBYA 1JTYA 4KITB 4IHVA 1WH5A 1K8AU 2DYSH 3EGUA 5F27A 5IHIA 4HF0A 2JUCA 2WY7Q 5JI6A 5KK1A 1YI2Q 4J83A 2CP5A 2XB5A 3RQIA 2XF5A 5AIPA 3E0JB 1Y96A 2MF2A 1YBYA 2VOPA 2CKKA 2WSEE 2KGTA 4OP0A 1PC0A 2KE9A 3A5ZA 3TQNA 1T33A 4AIKA 3OD1A 1KJWA 2QQBA 2ZBKA 2D1XA 1GCQC 4HXJA 2BE9B 1WGSA 4PJ0C 3BCBA 3IWZA 1AA7A 1J2XA 4D1QA 3CMEI 1E3OC 1UMQA 4XK4A 2UWMA 2LBFB 1N27A 4M7AA 4ON0A 3MMYB 5KYUB 4X34A 2IS4A 2RVCA 4LNPA 4CDGA 1D5YA 3RJPA 3S16J 1EV7A 4X9CA 1OX9A 1B7YB 3PVQA 1VQOQ 1JO8A 2IJLA 3PGGA 4HNTA 4BKXA 4CC4B 1WXUA 1X1PA 3HPHA 2FEIA 4WXHA 1E6GA 2NWMA 1VQLT 2ZB9A 4QLCU 1MNEA 1JUSA 1LVAA 3GPLA 2X6XA 2E5ZA 2MFZA 1J75A 1JJ2P 1GVJA 1EQRA 4LG3A 4A93J 3QO7A 1RABB 4XAXB 3M07A 2NUPB 4GLMA 2YU9J 2Z5UA 2ZMEB 1YX5A 3ZFJA 5GAOp 2X48A 1PM3A 4F04B 1V5GA 1UJYA 1G8XA 3GVAA 3DLLA 3J7ZI 4HT4A 2LC2A 5K5OA 3L09A 3VS1A 3CCUA 2FX0A 4C5IA 5KVRA 4OMYA 1U5TA 1OKRA 5CKFA 2BVMA 2EGAA 3UR3C 4HVVA 4M7DG 1NK3P 2XAUA 1QLYA 4FCYA 2NVTJ 1QVFA 1SFEA 2VVKA 4HWOA 4BQAA 1H4TA 4E7HA 4DBQA 4G7HF 5J39A 3OYKA 2KIMA 4ELYC 5IXFA 4M6XA 4JJCA 3QPSA 1QGPA 4H2XB 4HT8A 4H2WA 3W2WA 1GFDA 3QWYA 2HVSA 3CQZJ 4EX5A 3K4LA 1YJWA 4OMLA 4XEOA 1QE0A 4UP8A 2GCXA 2CGHA 4FE4A 1CKAA 4GO1A 4J8OA 1EH7A 4DQ2A 4HW0A 2RQUA 2DTIA 3VYTB 3WTTC 3KZIC 2LTPA 2DEQA 2CJAA 1FEXA 3DBRB 5HCKA 2HQXA 2ZMEC 5LRSA 2PN6A 2LK2A 1P4WA 3IRRA 1B8IA 5DLOA 3FKJA 1GCPA 1M2OA 1VQNQ 1I81A 2XVCA 3CCUI 1TW3A 4LXCA 3K0LA 1FYLA 2CUDA 3DQVC 4FIBA 4JRKA 5B66C 1ZUKA 2LP5A 3M0RA 3A7UA 2MC4A 4BJ5C 2D1VA 4P3PA 3PIPF 5J1YA 2GLOA 3ESWB 4UC4A 5GAMg 4YFXF 2CUFA 4C92B 4G84A 4JLIA 3QPTA 1U5SA 2CWEA 2XMFA 1KQSS 3VYGA 2X1DA 4MTDA 4OB2B 3BCAA 1Z7NA 4R55A 4P5OA 2IP2A 1NPRA 5DLQE 2QA4T 2YU3A 3KP7A 1K73R 1VNDA 2MWPA 1E6HA 2HKQB 4D8DA 1S72A 3L2WA 1YJWI 2M16A 3BP8A 1Q7YC 3GOXA 2A08A 2EYYA 3DPLC 1ZHFA 5FKLA 1HKTA 1K9MC 5C44J 3BR1A 5M3MJ 2RF0A 3VS7A 2K5CA 3PQJA 3ZP5A 1SPKA 3ONQA 2QI2A 4EMKB 1JBMA 1X43A 3QUIA 3D5RC 1R1TA 1NLPC 2K9MA 3M7GA 1YHQA 2PNIA 3O2PE 2IA1A 3L9FA 1R23A 4RDUA 3I71A 2OI3A 2K5FA 1S29A 3RPUD 4PGGA 2ME0A 2QHTA 1ZH5A 4BD3A 2ECZA 1YJNQ 1SD4A 3HRTA 3A1PA 4HWRA 4Q4ZF 5B1AH 4J7FA 1MIJA 2RV8A 3V7SA 1MGQA 1WYXA 2E5AA 1XGNA 4A6EA 2PJPA 1M3CA 2ARUA 2XUBA 3OMYA 2K7LA 2M7BA 2DJZA 4PJOG 4F55A 4I7HA 3W6JB 1X4PA 1ZREA 3GFIA 1S72I 1FX7A 2VJ5A 2CW8A 1KC8R 3E6DA 3UA7A 2E2HJ 2RHSA 1HBXG 2R7SA 2LNBA 1IB8A 2P81A 4EM1A 2M0YA 1YITT 1DPRA 5CQYA 3H3UA 1H9GA 3WVDB 3R61A 4EMKC 2E7WA 1YHQI 1ETVA 1SVMA 5FW9A 2P8TA 3BZ6A 3RMSA 2E2JJ 2XROA 3QOEA 3EG9B 1TWAJ 4XN3A 2EGEA 5CQGA 2I10A 1Q82C 4G85A 4YP0A 1UHWA 4PDKA 4M77D 3RR6A 3I5SA 4IHWA 3K10A 3DKWA 2RREA 3HOTA 4QTRA 3G6EA 2BXYA 4ESRA 3CCYA 3REXA 2XHKA 4A3IJ 2F6CA 2XKOA 3HOWJ 2RK2A 3DEWA 1YFHA 1QWFA 2JM9A 2MGQA 4WXDA 3NTKA 2RD1A 3N4MA 3FKIJ 3CF5F 4LDYA 1H88C 4H2YA 3FDYA 1NJIC 1NJ6A 4A3MJ 4PJNA 3HB9A 4DOVA 2W00A 3LWHA 3OYNA 1Y56A 2O01E 3H5NA 1KK7A 3UPUA 3LGLA 3FJPA 4KT6A 4L9VA 4W97A 3S1RJ 3CCLT 2IVMA 3WU2C 5HLGA 1PSEA 4I01A 3MWMA 3H0HA 2AMCB 3T8TA 2RJFA 4LOCA 1I6XA 4A3EJ 4U88A 3DWLE 2K3XA 3MF2A 1EIYB 3RZOJ 2DJQA 1T0JA 2GF7A 1ZSZA 2EINH 1SSHA 3KFWX 2PQWA 4ZDOA 1O3SA 2C0OA 3GFLA 4I6ZA 3MP1A 1SETA 1OEBA 4JLGA 2ID6A 3G6EI 1SEUA 3H35A 3H36A 2Z1DA 2KL4A 4KIFA 5J40A 3S2WA 5GANe 3X20B 2VQLA 3JSPA 1IV6A 4CXFA 4XOPA 3HHGA 3MN2A 2ZAEA 3CCUQ 3ZQLA 3H0GJ 3SDGA 5CK9A 1SAUA 3WTUC 5KCHA 3M9AA 2KEAA 2EYZA 4CH6A 1XSVA 1S6LA 1QCNA 2HKNA 4IEJA 3NRVA 4RG8A 4AC0A 2A6HF 3LGFA 5IP7J 4KNYA 1P4XA 1ERDA 5B3SH 4L87A 2MCNA 1FPQA 3BG5A 3RDVA 2L4AA 2L7KA 2RQTA 3B02A 2M45A 2G3RA 2VXFA 1L0WA 2OD5A 1YJWQ 2AS5F 4GGGA 1USYA 4AMCA 2RN8A 1RL2A 2MOXA 2ADUA 4BI4A 3CMAT 2MI6A 2WV1A 2QENA 4NNJA 1DDNA 2VBWA 1Z21A 4YFKF 5JLWA 2DTOA 3MJXA 1JXSA 3A02A 3ABLH 4E7SA 1YW8A 2BEOA 2V1DA 4AUXA 3ZRGA 2GZWA 4IXAA 3Q5FA 5C6SA 1AEYA 5GAN7 3ZMVA 1NJ5A 1FYNA 3J81Z 5HDKA 3M57A 2NVUB 4P73C 1FMWA 3VB2A 1N9RA 5EYRA 1OCZH 4CCMA 2C0TA 2FXAA 2CS3A 2PMHA 4AIDA 5ERIA 3VUZA 4PZJA 1ON2A 2JN6A 4ZGJB 1XGMA 4RG2A 3TMOA 2MA3A 1R22A 1RPWA 5HK3A 1B4AA 2X3XD 3DPUA 2LQKA 4ZGEB 1R1UA 6PAXA 3K4JA 4DIQA 2LCLA 3O8VA 3IKTA 1IRGA 2ALYA 2JA8J 1DPUA 3PIOA 4OOIA 4RUGA 4R56A 2XAHA 2EQMA 1KD1U 2HQ5A 2QLZA 2Z2SB 4A3KJ 4M7AF 1Q95G 4UVBA 1GV5A 4JBAA 1ZGAA 1OX8A 2KRFA 2CQQA 4GY5A 4LGWA 2RQVA 3REOA 4C5EA 5EZGA 3JB9G 2E12A 2AXTC 4WX9A 3CUQB 4A3DJ 1WSUA 3VYRB 1ZTRA 2EV0A 4CC2A 1OR7A 1SVLA 3TDZC 3ROUA 5GMKh 2NVXJ 3LSRA 3OYFA 2EH3A 4DYCA 3LFKA 4BAYA 3FHZA 2DA4A 3KLNA 5F6FA 2XF6A 5CKDA 1LYLA 1SANA 4K2EA 3HXXA 2EA4A 1OCOH 2K02A 3HM5A 2V1NA 4BBSJ 4RM2A 3GX4X 4M7DA 4MEYF 5F1RA 4BEHA 2OTLQ 4YRCA 5KNNA 3WG9A 3DLLF 3E5XA 2JJ9A 2KISA 5K5QA 1ZHIA 1SG5A 4F91B 3ABMH 1ORKA 2ZO4A 5LJ5d 3VYSB 2RI5A 1YS7A 3ERMA 2PVGB 4YRNA 1FP2A 4FSXA 3OV8A 3JAMK 4J9GA 2K9GA 3HG9A 4QQ6A 4HWPA 1O7LA 1WI9A 3VRZA 5GAN8 5CR2A 1G59A 2XI9A 5CCAA 3CEYA 4JP0A 2L9VA 1IRZA 3CUQC 5B5EC 1TTHB 3ERRA 3TEDA 3GWZA 5EG0A 2ED0A 3S3NA 3TEHA 2GXGA 4KFCA 3A5YA 4PL6A 3GNFB 4M75E 4RCCA 1WJ5A 3R6NA 2I8DA 1X2MA 2FNAA 3OIQA 3L42A 1M90R 1ZG5A 4EJTA 4RMOA 1TUCA 3VYHB 2M5WA 1VQKA 2DK5A 2L3RA 3WTSC 2E4HA 2PEXA 4DZPA 4Y3OA 3AKZA 1YIJT 1PNJA 3A8GB 4KUDK 1ACMB 4FW1A 1T2KA 1BJZA 1OYXA 2RHUA 5H6RA 4I0AA 4GFBA 1WHKA 3OB9A 3KIOA 3F6VA 1YWOA 3K70C 5DS9A 2WTEA 3I54A 4M3BA 2A6TA 3CPWA 1K6YA 2D5VA 1YNZA 1N6AA 1GXPA 2F4OB 1Y1WJ 4LDVA 4XTXA 1NZ9A 2E36A 3TO6A 2F5CA 3OL4A 3CCQQ 2KJBA 3WGGA 4C92G 5A0LA 1MBFA 2Y31A 1GFCA 3BG9A 3HSBA 4BNCA 4UXNA 1Y07A 2KKOA 3JRDA 3V42A 3SHWA 2M34A 1PHTA 2KMTA 4TVAB 4C8QD 2QKMB 1P6RA 4XR6A 4M3DA 4OWRB 2HBWA 4C0FA 2BE7D 2JRMA 5HKCA 3I4PA 5DM7F 5BOXA 2Y2ZA 2C6YA 1KSWA 5CIUA 3LX7A 4HDUA 4KGZB 3PT9A 1VQKI 1UB9A 2M8EA 1DP7P 4ENJA 2J6OA 4HCZA 2RHZA 3M4QA 3OW2A 4IHXA 5EDNA 1TNSA 5TJJA 3CCSA 3E9FA 4FYWB 1GLNA 4BQNA 2D2WA 3QYFA 1BW5A 2JMWA 3G71T 5FGMA 2VC8A 5F64A 4PJOA 5K1PA 1IXCA 5K7FA 3NWSA 5LGTA 1IGQA 2JMCA 3RI4A 2D1HA 2EIKH 2DI3A 4Q5WA 2GXBA 3K2AA 1LFUP 2VJ4A 4OAYA 4Q15A 4CZCA 4MQ9F 4HSRA 3QYGB 1RAIB 2YUNA 3FJ5A 4X5OA 2EJFA 2P0KA 1WQWA 2QF7A 5LGNA 3CCJA 2VGMA 4XICA 3WTYC 1LDJA 4P3NA 4K88A 3BTIA 4RTUA 4L5JA 1BI3A 1AKHA 4OIOF 4CH3A 3EFRA 1B70A 1H92A 2DK8A 3C2BA 2B9SA 2HMAA 2XDBA 5JR3A 3CCSI 2LZ6B 1HTTA 1WHMA 5LEKA 4BE1A 2DTRA 3CCMA 2XASA 3BDDA 2DBBA 2HWVA 2HXIA 2CS7A 1MKMA 1F36A 3H5RA 3JREA 4BQQA 3LSTA 1QVGA 2FEZA 4HDVA 4O5VA 1O75A 1UFFA 3HOUJ 3EUAA 2HGCA 3SDZA 2GA1A 1B59A 1YFNA 5D5WB 2ZNYA 2XB0X 1UFMA 4OMZA 4M3GA 1FJLA 2KZGA 5HNHA 4W1UA 2GTOA 2PMUA 2GOXB 1B1BA 3Q0UA 2YS9A 1LVKA 2XGCA 4UUTA 5E1XA 1ADYA 1Q1HA 2TRTA 1MDMA 2CZ6B 4EJVA 3QTCA 5E3NA 4DZJA 2QGUA 2K6DA 4RTVA 3QYEA 4V19K 3M4YA 3CCJI 3CCVA 1VQPT 4F92B 3NFCA 2BBYA 1ZRFA 2JA2A 3MKYB 2JT4A 3B6AA 2VI6A 3FXKA 1YQAA 3JCMb 4M78D 1SRLA 4EGYA 2RNAA 2DODA 3HRKA 1KU3A 2C0IA 1GL5A 1D1AA 2CIMA 5ICEA 4XRSA 3CCMI 1SHFA 1IDYA 2DMTA 3LQQA 3J7YJ 3Q1JA 1VQ5T 1V29B 3A01B 4B8XA 2MH9A 3D5LA 1Z0XA 3HFNA 4CYCB 2RDPA 4A12A 2HPMA 3BTCA 2A0FB 1UZCA 2KDZA 2FOKA 4V2GA 4G9YA 3IAM2 1TNTA 4KULA 1CGPA 2MLGA 2ZCWA 2KXCA 4O2DA 1JT6A 3S1NJ 5GP9A 5GAMf 1FBUA 3QPHA 2DW4A 4F3QA 4KMUX 4RAFA 1HA8A 3CCVI 3REAB 1U8BA 4ELZC 3I56Q 4XOTA 2BE5F 2O03A 4XK8E 1K8AR 4RGRA 1KYWA 1D0XA 3M8EA 1HKQA 5LJ3h 2DLLA 4QKUA 4C5GA 3HTUA 1W5TA 1WQ2A 1VQNT 1LEAA 3OIPA 2R7WA 2XKPA 2Z99A 3CXCA 3CC2A 5EGOB 3SJMA 5TRDA 3PNWC 3MKZA 1A6IA 3LAJA 3HFVA 3QU3A 4K86A 3C0CA 4QSHA 4BUPA 2MIOA 2J6KA 4B43A 4XSZF 3U1KA 1RAFB 3NEMA 3A74A 3FK7A 2VQCA 3HL8A 2VJIA 3SZTA 4EJUA 2QTVA 1YJ9T 1MBGA 4BW9A 4YRRA 1I07A 4C8QB 3HSRA 4DYQA 2YPRA 1VQKQ 1EH8A 2MC3A 2LRDA 1MD0A 5JVTA 3BLYA 1BN5A 1GRIA 1R36A 1ATIA 1CSKA 2Q2EB 3PE0A 1UDLA 4KT0E 1BA5A 5DCMB 2EFNA 2VKEA 2RN7A 2CRGA 3V7RA 3ER0A 5GAOm 1G3TA 4TQDA 1R5ID 2OCCH 2R7ZJ 3PSIA 4Q47A 3QBYA 3PVLA 4P5NA 1G2BA 1FOKA 3FEOA 3E7LA 3CC2I 3TP3A 2HEOA 5LJ5g 2WWYA 4E47A 4JX5A 1IRFA 3MCAB 4M7AC 3JV3A 5GMKl 1ON1A 4IF4A 3A2KA 1K73C 4PNOA 4LIUA 3GTGJ 2R58A 3EQLF 2VT3A 4TVYA 3NQOA 3OMGA 3L2ZA 1B7YA 3QXEB 2OV7A 2A3SA 3M56A 3TREA 3DF8A 2V6CA 2HL5C 1LB2A 3VEPA 4AVPA 2V7FA 1SD7A 3PIOF 5HLTA 3JRHA 4B09A 1EOVA 2X4YA 5E8GA 2HZTA 2KJCA 5CVJA 2IBDA 4EGZA 4Y15A 5L23A 1RUNA 1IN5A 2KQWA 1BM9A 3HXUA 1AHDP 3H3VK 3CCSQ 1G3SA 4A2UA 3CMET 1VZ0A 2E65A 5C51B 4M4ZA 2JZ2A 2ZMEA 1XMXA 2JZYA 4HVWA 2YHTA 2A6EF 2VE9A 1MBHA 3FBNB 1WHHA 3GTLJ 3FZVA 1U5TC 5GAMe 2NUZA 2OA4A 3J80K 2KZVA 3X26B 1D1CA 1JGGA 1Q7YU 3EGXA 4KR2A 3KEOA 1H3HA 1K9MU 2X3WD 2LQ8A 2L01A 2EBIA 3GXOA 4GYIA 5D8KB 2V79A 2VB6A 3SXYA 2Q7GA 4HG2A 3VOEA 3JW4A 4M7DF 2NS0A 4M77G 3OMCA 3JB9I 4EDUA 2ODRD 3VDXA 1LFPA 5D6XA 1U8RA 2XD0A 4H2XA 1AZGB 2FBHA 1W2BS 2P6TA 1JU5C 2E5NA 1TUGB 1QKXA 3BR0A 2P7VB 1LFBA 4P9UA 4BHPA 1R4MB 2H3JA 3TW7A 2M87A 1X6GA 2Q7HA 3CCMQ 3G73A 4IIOA 3PNYA 4BU2A 1N78A 2DAOA 1NG6A 3KCCA 3OYGA 4IQJA 2E1MB 3GIBA 2K7AA 2EPDA 2LYCA 4ZN1A 1U78A 3T1BA 3M9QA 1JI8A 4OMNA 3VSKA 4S05A 2RHQB 2COBA 1XGOA 4LG0B 5A0DA 3FXMA 4C5HA 4U0YA 2W84A 5LJ3d 5D6EA 3DU5A 1VQ8T 2LY9A 3PMTA 4C92A 2IGMA 3WTVC 3IKLA 2FQ3A 2R57A 2XAFA 2IPOB 3L2UA 2FZGB 2O9LA 2PBIA 2Y0MA 2P5LC 4P74A 3L2RA 2DPDA 2X9DA 2HYGD 1MBJA 2VIXA 3QQAA 1JJ2A 1BYMA 1WHUA 1B9MA 2P0QA 5H20A 1Q82U 5J1RA 1MHNA 3CCUT 3N97A 3A1YA 1ABQA 2R7XA 3A98A 4Q6GA 1ZAOA 3JCMQ 4EMKA 2HSEB 5ICFA 2MH2A 1J09A 1LJOA 1M5Q1 1UEBA 4RGXA 3OSVA 5HNFA 3C2GA 4A54A 1E3PA 1TH7A 2A61A 2ZXJA 3CD6Q 4BB7A 3SEQA 2FE3A 2E1MC 1K79A 3RGLA 2QXFA 5GAHJ 3QAHA 2EA2A 4K11A 1NJIU 2EILH 1WWXA 3E6MA 1HYOA 3PFYA 1XDUA 3RYRA 2FF4A 1YJWT 3C4SA 1X4OA 2QWWA 2L9NA 3H5AA 4P3OA 2KK4A 3P8HA 4XORA 2HQNA 4EPCA 4KR3A 1G5HA 2G4CA 2R3SA 4PJOF 3X25B 4XKVA 3ULQB 1Z1DA 3BZCA 3EUKL 3PFSA 3KP6A 4OLFA 3ZGKA 3E6CC 4LFUA 3GTPJ 1M1EB 3ASKA 4Y28E 1XOVA 2CYZB 2IIMA 1MBEA 2F69A 1FP1D 1RKWA 2HVQA 2E6NA 2OTJA 2AHQA 2K57A 2DL7A 3GFJA 1N8RR 2FO0A 1SSFA 2FNPA 1Y39A 3JRFA 2QSFX 2IY5B 4CCLA 1ZSZB 1MZBA 4B44A 3FC3A 5BNGA 3F8BA 4KA4A 4GDFA 3KFVA 4HX7A 2EFQA 4ZTUB 4RMNA 1S72T 4QQGA 4GCVA 3DPTA 4EATA 2BZXA 2CSOA 4XONA 1ZLMA 1RUOA 4XKWA 2DIGA 5ICCA 4G7ZF 4JPBW 5FFXA 2XKOC 2A7YA 1X2QA 3M0PA 2GAUA 2DMUA 3CDHA 1T56A 4N0AA 4EM2A 1DUXC 2HYFA 2HSPA 2YUPA 1YHQT 1I1JA 2NYSA 4RB1A 5FD6A 4WI1A 1RESA 5C4XJ 3I5UA 4C2MJ 1XN7A 3RPQA 1LQ1A 1W7PD 2OTJI 2DXCA 5GTHC 1WA7A 5J4VA 3S1MJ 4O6JA 4E7LA 2R4GA 1YW9A 2DTZA 2GNCA 3HGGA 5CQXA 2BYVE 1JJ6C 2JA6J 2QQ8A 2KT0A 2AMCA 2HQAA 4J9IA 2D0QB 1ZSZC 4MO7A 1J5WA 3WHCA 3FDRA 4JZ4A 1Y0MA 3GMEA 3A8OB 1MUZA 2YUQA 2L2OA 1OYIA 4TTVA 3ZQCA 2Z3YA 2EWNA 5HLIA 3FM5A 2DBMA 4YRVA 4BE2A 1BR1A 1WZ2A 2CJBA 4BS9A 5L8RE 2E64A 5TGTA 1XB4A 4Y7NJ 2GGRA 5L3BA 4RDXA 3OS1A 1MSEC 1ZUUA 1I3AA 2CGPA 1SMYF 1ZLKA 4M75D 5IT9K 1BIBA 1KFZA 3UFGA 1AWCA 3IRQA 4P9FA 2D6FA 4PK4A 3S32A 2O9SA 3WTZA 4NUBA 1DU6A 4DBHA 2QAZA 3CC4A 2BY1A 2OAWA 1WHLA 4IKFA 3EYIA 3N5BB 1OISA 1H4SA 2ID3A 2ED1A 4RAZA 1B9NA 2QGGA 1AWWA 1YWPA 3F8FA 1Z6TA 1JB0E 1TG0A 2XU8A 3DCFA 2DA3A 4LVMA 2A3LA 2ETHA 3F8MA 1K7AA 1N75A 2KMUA 1OQYA 4YCUA 1Z7UA 3MZHA 3G6ET 3KPHA 2E34A 2L3DA 5E3OA 1OI1A 4D6WA 1K4SA 1POGA 5BMZA 4J9BA 3OS0A 1RAEB 1USYC 2OX7A 1WXBA 1VYUA 2MLKA 3SEMA 2HOAA 2QQSA 2ZPEB 2RM4A 2PU9B 2M51A 3AL0C 4B47A 4BE0A 2KQRA 4YG2F 2WV0A 5KAFC 8AT1B 4FX0A 4FE7A 4F7UE 2K9SA 1XDSA 2ZT8A 1S5LC 4XRMA 3WU1B 1KD1R 1PCXA 5D4RA 1HSJA 3CC4I 1VQMA 2LR8A 2DQ3A 4Z2YA 3QHSA 4Y52J 1R71A 3ZMDA 3D1NI 2DNUA 4C8QG 1WZOA 3A32A 1VQ6A 2A68F 3GFMA 2X6OA 1W36C 2YRDA 3IH4A 4CRIA 4RTXA 5HDNA 1MW7A 2HOSA 3FLGA 4BHCA 2JVGA 4M7DB 4JS4A 4OB0B 2K3YA 2L89A 1C6VX 4IJAA 3RMQA 2BTTA 5KH6A 2CT4A 2JVVA 1I5ZA 4HEA2 2RAEA 4YREA 2ZGWA 2AKWA 5HODA 2OQRA 4RGSA 1ACIA 1VQ4Q 6AT1B 4HRIA 4JK1X 3RCOA 2YLCA 4C3JJ 3TOBA 4WK8F 2K79A 1HKSA 5J3LA 2DYBA 3BY7A 1KG1A 1OPCA 2J06A 4ANJA 2QG9B 5J6XA 1X1BA 3RACA 1X19A 2R7OA 2MG4A 2OZ6A 4C3IJ 2FQ4A 2XPWA 3FXQA 1G5VA 2ZTGA 4LK0F 1W5CC 4AG2C 2JUGA 4L18B 3EHQA 3QJYA 2DYRH 1UGVA 4PFZA 3UGTA 1JHFA 4YRKA 1I5LA 1N9WA 1OR7C 1Z67A 1VQMI 5HGQA 3JB9F 3TEHB 2DFFA 2HCKA 4ENKA 2HVRA 3P9KA 1D8JA 2OC6A 1VQ6I 1WU7A 1IG7A 1IZ6A 2F1LA 1W66A 3SB2A 3M0TA 1GGMA 3SWNB 5LRRA 4B1RA 3EFSA 4HLYA 2DFUA 1JJCB 3PL8A 5LJ3g 5KE3A 4A0YA 4M7DC 4N9HA 5BPDA 3I58A 4C9YA 2IA2A 4CZZA 2BZYA 3ME9A 3G2BA 2JN0A 1YE9A 1FIAA 4HYEA 2DEUA 2I2LA 2YR2A 1RIQA 2P5KA 4M77A 4IL6C 2EBPA 2LTOA 2HU9A 1EVKA 3LMMA 2WSFE 2ZR2A 5K1YA 1FC3A 4YRTA 2DT5A 2EKOA 2NUTB 1W4SA 1NLOC 1K83J 2KHMA 2HDDA 4NL2A 3RUXA 3H9QA 1XC5A 1G51A 1S1NA 2RNJA 1FBQA 1VQOA 5GPAA 2RMOA 3EFOB 3BT9A 1IO2A 2I4OA 1PYSA 1TXQA 1MNDA 1QNTA 1YYVA 1WXTA 4MIMA 4IHTA 2ZJQF 1QVFP 4BBRJ 1Y8QB 4Q5SF 3GZ5A 2QDLA 1WLEA 4JX6A 1QCOA 2EFWA 2GBQA 1T0HA 1FSEA 3GF2A 4DGWB 3K9TA 1SKUB 3TUPA 4M78G 2H8RA 1VTNC 3BFMA 4FTHA 4PJOB 5A2QK 4RB0A 2YWWA 5EEGA 4ZJZA 1V76A 3FHNA 5HDGA 1A0NB 3AAFA 3G4SQ 3F6OA 3ZXSA 2WSCE 4HPQA 3H41A 3P7NA 4LITA 2LT1A 2WBMA 3CLOA 1TT0A 2MSYA 4FSSA 2L9RA 3LSMA 3T9NA 2FPDA 1O4XA 2CP6A 1MH4A 2BGCA 5K5RA 2J3LA 1VQOI 4C92F 1NPPA 3MP6A 2PI0A 4UP7A 1KYZA 2Q1ZB 2V6EA 2KROA 2VBXA 2DCEA 3BTJA 2CH4A 1YB3A 2DRMA 4TVAA 5DUKA 5FLXK 3VKIA 4J7IA 5HK0A 4FISA 2HR3A 4XU0A 3TCJA 2A8EA 2FPFA 3CC7Q 3LC0A 1G3WA 1B76A 4AU7A 1TQPA 4YROA 4QPQA 2V8JA 1ETQA 4CC3A 4XLEA 5I11A 4OMFB 2DRKA 3ZBDA 4A6DA 3VUBA 1EH6A 4KH0B 4G6TB 4UY8I 4D5FA 4N4GA 4PJOC 3I55T 1ZR2A 5J3BA 1JEGA 4KH1B 4TV7A 1R0CB 5DEQA 3NGPA 2COWA 3P5JA 2Y4XA 5KHDA 1R58A 5EC7A 5ELOA 3JCMJ 1Z77A 4Z02A 1FT9A 3MEVA 2RA2A 2F5DA 2BXZA 2VKVA 3TU4K 1K8AC 1HQCA 3LNQA 3LYIA 1OCCH 4PKCC 3BDLA 4X9DA 3B6CA 3H9JA 2DVJA 1SD5A 1OOTA 5H2FC 1T3SA 5EEHA 2E2IJ 2BZ8A 4ENNA 4OVAA 3DTEA 1VQ7T 2PUOB 2FRYA 3E9GA 5KE2A 1G3YA 1YFSA 2P5VA 1RLPC 5GAOr 3RKXA 2E1CA 3JAMZ 2Y90A 2JPBA 3DU6A 1P9QC 3SQNA 4JDSA 4BI3A 2AKLA 2HXOA 11ASA 2E1NA 2HS5A 1E1OA 1E3HA 5CLSA 3QZ5B 3U9GA 2LNHB 3MAJA 1K61A 5FWBA 5JHUA 1AZEA 2KRSA 2G9WA 2DO3A 3CCET 4C0ZA 3A0HC 1VFCA 4PHCA 1XJWB 1HF0A 4R8HA 4GLKA 3VRYA 2LY2A 2R5AA 1MH3A 4EIKA 1IXDA 2Y30A 1M1GA 4QWQA 5D8LB 3PNTA 3K1NA 3ABTA 3R60A 1QW1A 4F7ZA 4Y13A 1BOAA 3KEQA 3F0CA 4J00A 3IKMB 3FBIB 4C0DC 3M55A 3IH3A 4HNVA 3ISPA 1IHVA 1JXOA 2C8MA 2ZJPF 4A4GA 2Z33A 4XM3A 4WXCA 4ZTJA 1REPC 2O5RA 2IT0A 1OYYA 3I7FA 2R92J 1WI7A 5FROA 3ZQGA 1K78B 4BHBA 2LX7A 1SMTA 1PSFA 3C94A 2ZXFA 3I35A 4NL3A 2FZCB 2F4IA 2ELHA 2LF7A 1XTAA 3ZCOA 3GZNB 3L7WA 3NARA 5CQEA 3QODA 2R5ZB 1BBYA 4Y91A 2L0AA 2HFHA 2R5MA 3P8BB 3UA6A 2GOMA 4OU0A 1EZZB 4YIFA 2I0NA 1YOVB 3GZ6A 4KJZA 5D5VB 2LKPA 4KMFA 4MMLA 2Q0OA 3A01A 1H8AC 1WGXA 1QHHD 1FIPA 3EDPA 3TEGA 4CYCA 4S0HB 1K0XA 2ZPIB 1DGRM 3MCZA 1MMNA 3CCJT 5F0FA 3CP2A 4JRIA 1ZGJA 3COAC 3SZGA 3MPUB 1QHGA 4YCVA 1PKTA 1C0WA 4OB1B 2LLKA 4U7BA 4G8XA 2EQUA 4CUGA 2W4SA 4DEYA 1H3ZA 3JB9J 4WCGA 5M9OA 3MVPA 1JKOC 2X35A 3H0FA 4E4HA 5BS6A 3AHUA 1JRIA 2W57A 3VS3A 1G5IA 4J6XA 4AD9A 5LJ5e 2KT8A 3I4MJ 2CQKA 1GBQA 2FYKA 1UHCA 2V9KA 1NYFA 1SFOJ 1O9SA 1VQLQ 2ESHA 1X2GA 2XSDC 2QVOA 3Q3SA 1OPLA 3OW2S 3KETA 2ZZEA 1M1FA 2RC4A 2ZSHB 5EGOA 5D6FA 5DTDA 3KP2A 3DSQA 1BC7C 3MFKA 1QCFA 3MF1A 1AWOA 2L3QA 2F5VA 1SF9A 3ULRB 3EPZA 3KUFA 3HOZJ 4YIRX 2J5OA 1H89C 4CCOA 2O0YA 2ZXIA 1D3YA 2ZT6A 5K7HA 2F2XA 3CCVT 4RAGA 3LW5E 1R49A 2H3EB 1AWJA 1VIEA 1D0YA 1Y6IA 4N4IA 1BBZA 4C8QA 4H4KC 3F21A 4DJAA 2HL3A 5M3FJ 3KZZA 3NENA 3FMQA 3ZR8X 2Q2EA 5DCMA 3D0SA 2XHCA 2VXDA 2HKXA 4RA2A 2W0ZA 2YXYA 3EGXB 2G0EA 2XG8D 1UGRB 3H1CA 2XK0A 1OQKA 3M58A 1BCMA 3BJAA 1QVGS 4BXXJ 2ME6A 2QEXT 5HS9A 4LN2A 1X6BA 4M78E 1O7FA 1DU0A 3DP7A 2DD5A 3OIOA 2JVHA 1W0TA 3T5XA 1H0MA 1W1WE 1IDZA 2ELJA 1FZPB 5AIQA 5M5WJ 1RAGB 3VU3C 3IALA 5GMKm 3B73A 1J59A 4HVUA 3I0TA 3A8MB 4E7JA 3Q9SA 3RYPA 1IHWA 3MKLA 3CC2T 3T8RA 1M3AA 3CBMA 2E71A 4PJLA 1PUEE 2LCCA 4XSXF 1XCBA 1M3BA 2YLBA 4LE9A 2BY2A 2JA5J 2LKSA 1T39A 2RH2A 3VYUB 2NS6A 2CREA 3SFZA 1WDXA 3VQWA 2VT2A 5D7UA 3TL4X 1IUYA 2DJNA 2RJDA 2G6FX 2LD5A 2K27A 2DXBA 4A3BJ 1MNMC 2EZHA 1I4K1 2E60A 4NB5A 2XGXA 2QHSA 3TBIA 4M77F 2NNYA 5B1BH 4I02A 1ZA2B 2EV5A 3G1JA 1SC7A 3ZMUA 2RQQA 5GMKe 4FYXB 1N8RC 5FJ8J 1JKQC 4HWTA 1IXSB 2KYMA 2HQEA 5FB2A 4YRFA 2A37A 4LIVA 3VV0A 2A07F 3BR6A 3J81E 4PCQA 3FISA 4A5NA 3IL2A 4ZTZB 4KQEA 3FX3A 2XAQA 2HOTA 3CXCS 2CV0A 4CCJA 5GANf 3F72A 4MZTA 3KP5A 3HXLA 2OZUA 2KDOA 1V3FA 1C0MA 3OYBA 5GAN5 1RIOH 3K4BA 1V1CA 2F2EA 2DETA 4ZDPA 2A69F 2B0LA 2RHQA 1ZLJA 1RETA 4LG0A 4C92C 2K9QA 1BCOA 4XMYA 4ZYHA 4P74C 2OTLA 5DM6F 2DT7B 1SD6A 1HW5A 5ILVA 2Z9OA 4WJ4A 1X1DA 3AG3H 3META 4PFPA 5FU6B 3JCMh 4P1WA 3RF1A 4HOBA 3M0UA 1HJDA 3HXWA 2JWTA 3C95A 4M75G 1XSXA 2FA5A 3ZL7C 5I2MA 5HVQC 2QSGX 1OCPA 1AOYA 1ZUYA 3GLLA 3E97A 3JRIA 3CPWP 1JUMA 1R4NB 4RAYA 1YIJA 3E9HA 3DEEA 1WJQA 1XG1A 1J7KA 2R5YA 1IW7F 2PVOB 2VQGA 1RAHB 3G1OA 1VOMA 3QSUA 1YG2A 2NNNA 1G2HA 4PSWA 1WKMA 2JSCA 1SESA 5DD4A 2L54A 1BI1A 2W1OA 3OSFA 1YTYA 3P8YA 3L4GA 4A53A 4FT2A 2ZCEA 2JQ7A 2PVDB 3FRNA 3BE3A 2X85A 1SEMA 4AIHA 2R7QA 1XNIA 2KRHA 3M0SA 2OTLI 1U9OA 4EJOA 3CCLQ 2ZNZA 4UHTA 3V4GA 2EGCA 1ZQ3P 4ZN3A 1QMCA 1Y57A 1ETYA 1HW2A 2LRQA 2V9PA 1QWEA 4YEJA 1IL2A 2YRVA 3J80Z 2DN0A 3KP3A 1YIOA 1AOJA 2IS2A 1RUWA 2TCTA 4LVKA 3NMZC 3CCQA 4RMFA 3C2HA 4MZPA 4CA0A 1TS9A 5LLQA 1VYTA 2O4XB 3QP5A 1YIJI 2IVWA 3KZYA 3CMYA 2XRLA 4MHGA 3RKYA 3H0IA 5LJ5h 3SYTA 2L5QA 3FXLA 4KRTA 2IY5A 4R1HA 3HY1A 2VYTA 3OYLA 2XF7A 5J8CA 3TO7A 3CTAA 2NYXA 3GEZA 4XU1A 5LJ3f 4D8KA 1KD1C 5GPCA 3MEUA 2ZIMA 2GQIA 2JW4A 2V8KA 3GTQJ 1FSHA 3HRSA 1SFUA 4V2SA 3S1QJ 2DOFA 2DK3A 2VXEA 4N0AC 2ROLA 1YP5A 4G6QA 1UHSA 4XRFA 5AT1B 2F5KA 2AZVA 1OMIA 4UB6C 1NJ2A 1QP2A 3BTLA 3LA2A 3CCQI 3LQRA 1UG2A 1YCSB 4JJNK 1TL8A 2VN2A 2YSRA 2M4GA 3H0DA 3IP4B 1R77A 2W85A 3CMAQ 2CH4W 3KXTA 3I4NJ 3QWXX 2BW3A 4HZFA 5IYCJ 5L3GA 2NOGA 1Q86R 4A3JJ 1XS9A 3WODF 4EMSA 4YDQA 3NWTA 2A5WA 4IHYA 2D0NA 1I50J 1Y1VJ 3BROA 2V9VA 2JTVA 4PJMA 3HL2A 1JQQA 3BPXA 2ZSIB 4DNCA 3HFOA 1TWFJ 1YW7A 2FBIA 3BC8A 3IKVA 2Q5IA 3THKA 1Q81C 1VQ9A 5HY6A 4C3HJ 3HXZA 3ABUA 3DKYA 3ZOBA 4E7IA 1D3BB 3RIRA 3EUHA 2X51A 1ZBJA 1P2FA 3GBGA 3LLRA 1PVEA 2OTJT 5GANj 1JXMA 3VS4A 3RSNA 2AQEA 4JS5A 1JJ2S 2YX4A 2JRTA 2HDCA 3IHUA 2DDZA 1QP3A 5GJVB 1NJ8A 2ZNIA 1EFNA 3JRAA 2PJRB 1KQ2A 2FD5A 4FQGA 1FOWA 3E3VA 3A7AA 2XV4S 1UE9A 1Z7LA 5K7ZA 3NAUA 3GP8A 3IH2A 3QYBA 1KQSP 1CF7A 1RKTA 1EF4A 4AWXB 1A5JA 3Q9VA 2FG0A 3JCMd 1BIAA 2Q7EA 2VBZA 2VUBA 1BL0A 1WFXA 1U3EM 2D8JA 4KUMA 1XGSA 2AKWB 2QYZA 3Q0VA 1M1KC 2FU4A 3FF5A 2XDDA 2RQWA 1NNHA 1CKBA 1VQ9I 3WQZA 2P6SA 2KIFA 2CSQA 4L59A 1FXXA 2IGKA 2ROTA 2JXBA 2DL5A 2XTIA 5CKBA 2O61A 1ITYA 4N4HA 3EGDA 3TVTA 4FT4A 3FB9A 4BXFA 1GHCA 1BB9A 1Z3YA 4HLXA 1I39A 3JTHA 4KGVB 4LB5A 2CP3A 4WJ3M 2Q8KA 1RI0A 4PLLA 5LJ3e 4IO9F 3PO2J 3LWIA 1U0JA 5CKEA 1WJCA 2XSJC 4C8QF 2XPVA 5EG2A 1VQZA 4EV0A 4XBFA 4RTTA 5I2SA 1SFKA 3PJRA 2ZT5A 1OV3A 2KRNA 3MEYA 4M77B 3OY9A 2M02A 3I56A 1R9TJ 1K9AA 3OYHA 4O3MA 4WTOB 4XLNF 5D6YA 1HC7A 1QU3A 2ZCFB 2QQAA 2X6YA 1NG2A 3HUGA 1FBSA 4B9WA 1YRNA 1WJSA 1YJ9A 2ATCB 3CC4T 1PUFB 2WAQA 1OCRH 1WJEA 4X1VA 4RLFA 1P92A 3OSGA 5KYNA 1WH7A 4AG1C 1YIJQ 1NEBA 4YRGA 3MP8A 1U1TA 2VGNA 1PYSB 2L3SA 3GLXA 2E5QA 2L02A 1LE8B 4EMHA 4FX4A 3BJ6A 3LSKA 3MEXA 2D9TA 1HCRA 3QOPA 4P71C 4P75A 3BPVA 3N05A 3SWNA 1USSA 3CMQA 3R6OA 3BR2A 3ZN0A 4M7AE 3I56I 1JJCA 2X9HA 2NXNB 3UT1A 1X58A 2CW0F 2JSPA 3ZQ7A 5IT9Z 4UP9A 3A03A 1B7TA 3ZPLA 4M77C 2O3FA 2QASA 2EZLA 2IG0A 2W82A 2L7FP 2FRHA 2R7DA 1KOGA 3QDRB 3HTRA 5L3CA 4KN4X 2AIRB 1YJ9I 2OBPA 3FIWA 4IUUA 1VQMT 2HPIA 5IN1A 2CO5A 3I3LA 1J3TA 4Y92A 2CZ0B 3JTGA 4D7NA 2M1BA 4H2SA 2NUTA 3KYCB 4NDLA 2UUZA 2UXNA 1VQ6T 4B6MA 4FYYB 3FMSA 2YX7A 4H2TA 4R0KA 1GXQA 2NS7A 1IXRC 1M27C 3M0QA 5KYWA 2XICA 2VODA 1WIEA 4CYDA 5GADJ 3TEEA 3CMEA 3EFOA 1FLIA 3KP4A 1Z6RA 2LH9A 1OFCX 1RADB 1RC9A 3G71Q 1YLFA 2X4WA 2QK0A 5GAGJ 3JCMc 4G94A 1ADJA 2CMPA 3W6VA 4IOCF 2K4YA 4HSTA 4YYEA 3M3YJ 2LCSA 1MBKA 3I5RA 3LSSA 5FLVA 3HSEA 5GAOl 3O8HA 4LVJA 4J9DA 2EW3A 4CHUA 1GUUA 1ZSGA 4CGZA 2DMNA 2XPUA 2NVQJ 2O2OA 4M78F 4XIDA 2DA7A 1WFWA 4IHSA 5IHKA 1TP4A 4AVZA 2WAQN 4RQFA 3HTZA 1WJAA 3ASOH 4XU2A 2DKGA 1BKBA 3RERA 3ZMSA 2F5EA 4ESBA 5F0HA 4J9HA 4M75A 3CJNA 5KYXB 4JQFA 2EQJA 3ECOA 4A4HA 1HLVA 3ERED 4ZNXA 2LSOA 2DMPA 2OJ2A 3O5ZA 1I5OB 1YI2T 1WHJA 1QZZA 4CI0C 3MZ8A 4IX7A 1T95A 1D0ZA 4XTUA 2QBYB 4OGEA 4XLFA 3CZ6A 2Y69H 4HBLA 1SRMA 1E2XA 4HF1A 5BQTA 3EH1A 3TW6A 2LMJA 4X6AJ 1VQ9Q 5CVUA 3JRZA 5M5XJ 3CCRA 2ZPHB 1NYRA 3TP0A 4A4EA 4NC6A 5GAOq 4J19A 3HFZB 1Y0UA 5IHNA 4AH6A 1VQ8A 3LH5A 4ZTFA 3DKMA 4CS4A 2M7AA 2BVLA 3ML6A 2DYIA 1VQPQ 1VQOT 1QZYA 1ZG1A 2EIMH 3EHRA 3L00A 2XC7A 1FY7A 5JFRA 2B63J 4B9XA 2R93J 1T8IA 3H3ZA 3GNGA 4EJWA 1D09B 3QO5A 1UG1A 4E70A 1D1BA 4MFEA 2PFBA 2O7OA 1VQ5Q 2M0CA 2LKXA 2L9SA 3PCOB 5DD8A 1HOMA 3H6ZA 1IJWC 1F5TA 2DQ0A 3JSOA 4ESFA 1V5EA 5F04A 1IV8A 1B34B 2DILA 1M30A 3CCRI 3DLAA 4P96A 2DBKA 3BR5A 3IUOA 2A36A 4YRIA 5FFZA 2GIVA 1VQ8I 5GAEJ 4J6WA 4J9EA 2FJ1A 3AG4H 1H4VB 5H6QA 3G1MA 3CD6A 3HTSB 2IW5A 2ISYA 4U0VA 2LDMA 2HZDA 5IT3A 2HI3A 1Z05A 2P0LA 4I09A 1MV3A 2DU7A 2DL8A 1KQ1A 3K1PA 4CS3A 1QRYA 2P4TA 3JCMX 3JCMg 1ABOA 3QWLA 1MSFC 5A2QZ 3L1PA 1W0UA 1HSQA 2QUFA 5DCFA 5KCMA 1WCMJ 3LSHA 2DO7A 1EJ9A 3VQXA 2P4WA 2DA2A 2DAQA 1K78A 1Z7MA 5FKKA 2OF7A 1YJ9Q 2EFPA 4B48A 2LG4A 2OU2A 2KI7A 3E19A 1TWCJ 2MD0A 4YRQA 4C30A 3CBPA 4AFUC 1GDTA 1Z91A 2CZ7B 1B8AA 4MQVA 2R5ZA 1VYVA 3H9GA 1TU0B 4MDXA 2XGTA 2X6WA 5FRMA 2VWFA 3CD6I 5FLXZ 1XTDA 2QCOA 3DBHB 2V8IA 2PG4A 3CJQB 3VBBA 3TSZA 2G7UA 2K85A 4XEMA 5E3IA 1ETXA 4BUGA 3FXRA 5D6WA 5HOOA 2O31A 2ZXHA 4KBMB 1RR8C 4KIBA 1B6AA 1HW1A 2F5TX 3M8JA 2IRFG 2LX9A 1ASYA 1WI3A 2K5IA 4NHJA 3H92A 3OYDA 2JK3A 2LJ1A 4HA8A 3U23A 3DLMA 2DOAA 2LVSA 4XLPF 2ARTA 1AHJB 2DX1A 2JOYA 2WAEA 2JTEA 1T6SA 1XQHA 3M4GA 1KA8A 2NLUA 3FWEA 3MO8A 4DOWA 4QIWN 1X69A 3OBWA 4LD9K 3DFGA 1YJNT 1PP8F 1IN4A 4QW2A 4HV6A 3HC7A 1R7JA 1SFXA 2DQLA 4NS5A 3R0AA 2AZSA 1QQIA 3IC7A 3G1ZA 1T0FA 3CMMA 4HQMA 3CMEQ 1YFRA 1PWTA 4FETA 4ATOA 1KZHA 2BKDN 2J6FA 1FMKA 2DZ9A 3HHHA 1JGSA 1UJ0A 3GCMA 1C0AA 4BDZA 3ZN1A 1OULA 2OPTA 1LCKA 4C8QC 3X2QH 1YN8A 3GTMJ 4R79A 4UB8C 2IAIA 3MEWA 1LDDA 2BY3A 5ELNA 1IAWA 1U9NA 4FU6A 4E6RA 1M9SA 1QA6A 4RTYA 3K70D 2EQKA 1L3LA 1IO6A 3CESA 1TQIA 3UKGA 3OQ5A 5J47A 1OU9A 2CH0A 4MLOA 4EVIA 2AKKA 3VSLA 4Y17A 5KNLA 5IAYA 2HQHA 3CLQA 1UGQB 2DA6A 1N8RU 4II3A 2P0WA 3HGYA 1S7AA 2ZZFA 5IPAA 3Q0WA 3ELKA 1KC8C 2G7HA 5DM7R 4FASD 2PLYA 3F9KA 3D5SC 2VUMJ 2EAYA 4F7UG 4MTEA 2E19A 4RLQA 3LL7A 1ZN2