3RKXA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
308
Chain Sequence
KYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 99
structure length 308
sequence length 321
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkxA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkxA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkxA02
4AIKA 3OV8A 2ZXFA 1R5GA 2X0LA 2Q5IA 4TTVA 5ILUA 1VQZA 4OINF 1YTYA 1F5TA 5LJ5h 1HKTA 1R23A 1LJ9A 3UFGA 3JSOA 1FP2A 1FNNA 2ZIOA 2CJBA 2M87A 1J5WA 1KYZA 2ISYA 1G51A 4MHGA 4EMKC 3GXOA 1P92A 2DTHA 1RUNA 4JLIA 2DK8A 5LJ5e 5C51B 4M6YA 3W6JB 1YCYA 2RHQA 2ALYA 1FBQA 4RS8A 4HLXA 3LA3A 1Z6TA 2DTIA 1FYLA 1HK9A 3RDIA 5C53B 2NRAC 4XSXF 2E65A 4HA8A 1XD7A 4M7DB 4RGRA 4P75A 4IPAA 5D4SA 4A12A 2KRFA 2EJFA 1J9IA 5GAMd 1B34B 3F22A 5L3DA 4YRFA 2C6YA 1ZG1A 3M9AA 3WQZA 1IN8A 3CJNA 2E10A 5F64A 1TW2A 3ERRA 2OBPA 4A5NA 1W7PD 4YRTA 3R07A 5DCMA 5ERIA 3ELKA 1FX7A 1LDKB 1BI3A 2VE8A 3Q9VA 5E1ZB 3QAHA 1AOYA 1I4K1 5AONA 1U1TA 3QUIA 4ESJA 4H2WA 2AS5F 3I71A 1DPRA 1ZH5A 4J6WA 1HSJA 5H6RA 2HS5A 3MF1A 1ATIA 2CIMA 5DDGA 3HFOA 1NJ1A 5LJ5f 3GVAA 4ENNA 3Q9SA 2A61A 2UXNA 3LC0A 5HGQA 1TNSA 4UV8A 4PJOE 3I59A 2JT1A 2Q7EA 3NEMA 3EYYA 4XBFA 3K9TA 3RYRA 5IT9Z 2DW4A 4Q4ZF 5DUKA 1Z7NA 3DSQA 3JCMf 3E9HA 2FOKA 4HVCA 4UP7A 3WTTC 4X9CA 1EFWA 1GXPA 1Z6RA 4XU1A 1RIOH 3WGHA 2FE3A 5ILVA 3WU0A 2C8MA 2VOOA 2G7HA 4P55A 3E5XA 4ZZDA 2V1UA 1FPQA 4A5MA 4UVCA 1TQMA 3MFKA 4HW0A 5BPIA 2FA5A 3H3ZA 1U5TA 3A31A 1N9RA 4YRQA 4LK1F 5LJ5d 5DY9A 3L2CA 3R60A 5AIPA 3G73A 3A32A 4EX5A 1O7LA 1LDDA 3QO5A 4KMFA 2V1DA 1UB9A 3K0LA 4WXHA 5ICCA 3ZP5A 4PNOA 1JBMA 1JE8A 2RGVA 1O3RA 2EJ9A 1H4VB 5H6QA 1UFMA 5FD5A 2Z9OA 2AMCB 3KE2A 2DI3A 1IXSB 2M45A 1E24A 4M7DA 3I64A 5LGTA 3L9FA 1YFTA 1ZLKA 4OIRF 4ZYHA 3RGLA 1Z05A 2EV0A 1RZ4A 2XIGA 1NHAA 1MD0A 3T8RA 5L3FA 4L0ZB 1R00A 3KEQA 4UV9A 2ETHA 3P7NA 3F72A 2V1XA 1KU7A 2ZIMA 1M5Q1 4BW9A 1EV7A 4C8QA 3W6KB 4CH3A 3R4KA 4YRLA 2EJRA 4EM2A 2K27A 1H4SA 4RGXA 4G7HF 4M75C 2ZT8A 5D8LB 4NL3A 4D0PA 2DT5A 3CTAA 1U2WA 3EQLF 3VQXA 1R1TA 4CH5A 4WCGA 4IRGA 2KJCA 4XTWA 1ASZA 2CW0F 2QHUA 4Q47A 2IA2A 2EL9A 4HLYA 4MQ9F 3JTHA 4B09A 4P3NA 1B8AA 2E7XA 2G9WA 1B9MA 4ZTZB 4IHTA 5CVVA 2VXFA 4C92C 2O3FA 2MC3A 2LF8A 1W5SA 5LJ3e 4GYIA 3RJPA 5K5QA 1U5TC 5E17F 3K2ZA 2JRTA 11ASA 5GAN5 2QYOA 1IF1A 5GMKi 1D3BB 5DD8A 4BWAA 3H3UA 3PQJA 4XLNF 1BIBA 1QBJA 1FC3A 2E1HA 4EO4A 3GW2A 1NJ2A 2QQBA 2LDUA 2DQ3A 4JBAA 2M30A 1LQ1A 1EIYA 1S8NA 1QZYA 4N9HA 2PJPA 2HFHA 4YRKA 1ZYRF 2H6BA 3J81Z 2GIVA 3HSEA 3HOTA 3L09A 4H2XA 1G6NA 4G9YA 5LRRA 4I02A 3FMRA 3P8YA 1WRJA 2RQPA 3KZZA 1NYRA 5EEHA 2QHVA 2VBWA 5GMKj 3ULQB 2BEOA 5FGMA 1XGMA 1FZPB 1P6RA 2WWYA 3Q5FA 4BHCA 2HEOA 4XSZF 4G84A 1ADJA 2DU9A 4A0ZA 2P5VA 1S7OA 2EFPA 2J3MA 3BROA 1XSDA 3NELA 5GAMe 4PGGA 3KETA 1N9SA 4RAYA 3ISPA 5CLSA 4M75A 2B0LA 4ESBA 1KQ0A 2GA1A 2MH9A 5HDNA 2FXAA 1HXDA 5LJ3f 3D5LA 4L87A 4I98B 1D8JA 4GYGA 5DV5A 3WTVC 2OAZA 1P2FA 1QO0D 3DQVC 4ZIBA 1T39A 2QENA 3QP5A 2DXUA 1HQCA 2E7WA 3VQWA 3ZMDA 4H02A 1L3LA 1I6XA 1EH6A 2E1NA 3V8JA 3E97A 3ECHA 2YR2A 4M73A 1KQ2A 1SFEA 2ZGWA 3JCMX 3F3XA 4I7HA 4M72A 1G5HA 3BY6A 2XVCA 2R7DA 2RKHA 2FF4A 4U0WA 2XKOA 1SD4A 2D2WA 3J81K 3BJAA 4HAMA 2NYXA 2O6GE 2ZTGA 2ZCEA 2RHSB 5GAMg 4HOBA 3AAFA 2IA0A 2CJ9A 3IWZA 2CGPA 3INZA 4GO1A 4ENJA 3V7CA 2PEXA 2FBKA 3FZVA 1KYWA 4AVPA 4HZFA 3SXYA 4RB2C 2LF7A 3V8LA 4C8QB 4YRSA 4CHUA 5GAN4 4M77B 1FYFA 4YRGA 5KVRA 4A6DA 3HFNA 2EAYA 1T6SA 3WTXC 3LA7A 1ZN2A 1EVKA 2ZR3A 1G5IA 4WX9A 3SB2A 1R58A 2ARTA 3PGGA 4H2VA 4M75B 1YS7A 4KFCA 3BDUA 1WYDA 3HYIA 1SD5A 5HS9A 3RPUA 2QVOA 5D5VB 1OKRA 3LWFA 4K87A 2KJBA 4J6XA 2E41A 3VQYA 2EFQA 4G94A 1O57A 3FWEA 4P3OA 1Y96B 4WJ3M 3M8FA 1KA8A 2DQRA 1D3YA 1CGPA 4MEYF 2VXZA 5JFRA 3MCZA 2ELHA 1MDMA 1LOJA 3O3KA 2PMUA 2YX7A 3E6BA 3KEOA 3BOQA 1FWZA 1H9GA 2ZNZA 4BNCA 4BAYA 1TTYA 2DU5A 1HKQA 4H2XB 2XV4S 4XU0A 1ZLJA 3JCMd 4M77E 1KGSA 4BYYA 2PBIA 2XGXA 3D0SA 1F1ZA 3HOSA 3HXVA 1STZA 2MH2A 3TEHA 2HKOA 4KN7X 4YIFA 4R1HA 1AWCA 1MJ9A 4U0YA 3HRIA 4MMLA 1WSUA 4TV7A 2IRFG 5GAOq 3GWZA 4CYDA 3GFIA 3UGQA 2NNNA 4C92A 4JK1X 3DPTA 4KIGA 3WTZA 1ZG5A 4M77A 2FBHA 2V6CA 3RL6A 2PI0A 4RQFA 4QVDA 3C18A 2EFNA 3CUOA 3CO6C 4HYEA 4C92F 4YRNA 3MEYA 2L4MA 1TQPA 1XMAA 4A2UA 2PG4A 5LRSA 2FNPA 4NB5A 3F6VA 5I21A 1ADYA 3MEXA 3BJUA 2ZNIA 4B8XA 3IRQA 3BFMA 2MLKA 1OR7A 1RNLA 1YO5C 3ZQ7A 1BM9A 1ZHFA 2ESHA 4YRIA 1XB4A 5K1XA 5DUIA 1Y96A 3F8CA 4PCQA 2YU3A 1U3EM 5E1XA 4P73A 2HR3A 4TQFA 2PMEA 3T0YA 1ONVA 3LQQA 4F7UE 1USYA 3JCMP 4Q15A 1EOVA 2FEZA 1USTA 3LFKA 1TH7A 3B73A 2XKPA 4UUVA 3REOA 2K4BA 2ZMEA 4YP0A 1KQ9A 2H6CA 1Q1HA 2EWNA 3QO3A 1J7KA 2NS0A 1E22A 4XRFA 1XDSA 5ICEA 4KNYA 3BZ6A 2XRNA 4M7DG 2K02A 2XAQA 4UNOA 4WI1A 1FYKA 1FBSA 2QUFA 4M6XA 3SZTA 4HT8A 4HWOA 3QU6A 2DQLA 4L9JA 3L1AA 4TVWA 2Z99A 4R8HA 4YRJA 4M7AG 4HWRA 4CH6A 3VB2A 3SWNC 1SESA 2CG4A 2ZNYA 4PJOA 3HFVA 1MKMA 1MJBA 4C92G 5LGUA 1BBUA 4CDGA 2HOEA 2FRHA 4KN4X 3DFGA 3NRVA 2Y75A 2Q5HA 3TOBA 1K6OA 3LSTA 4A0XA 5GAOn 1E1OA 1T98A 2Y90A 1N9WA 4MMKA 3ZN0A 3ZN1A 2YHTA 5GAMj 3BPXA 3P9IA 3GF2A 1D5VA 5J8FA 5L3GA 3JB9J 2DAOA 2ZBKA 4GGGA 1PYSB 5FB2A 5LBQA 3KP2A 3CMQA 1O7FA 2KKOA 5IT9K 2XGTA 3I54A 2HQNA 3U1DA 3L2ZA 4F7UA 3L4GA 3TQNA 1P4XA 1T0FA 2RNJA 4C8QE 2ZMEB 1EVLA 3PZCA 3FXQA 3EFSA 2ZZFA 2WV0A 4I2OA 5A2QK 5E8IA 2QBYA 1BI1A 2XAGA 3GIBA 3VU3C 4AD9A 3FX3A 1NJ8A 4EGYA 2DJZA 3ZMZA 3F6OA 3G1ZA 3L4GB 3RKWA 3IKLA 4G8XA 1G3TA 1O3TA 4BXUA 3P8TA 4XTVA 3W3SA 4WWCA 3VFZA 5CYVA 4KMUX 3WGGA 2I4NA 5K1YA 1LDJA 5ELNA 4L5IA 2PMFA 5EEGA 5CJ9A 3RERA 2O8XA 5J8CA 3COAC 2ZT6A 5GMKm 1I81A 2EV5A 2W85A 1KU9A 3MQ0A 3FM3A 2DTRA 4XEOA 1RIQA 3IALA 1DP7P 3GUDA 1LEAA 5LHHA 2QWWA 4EJUA 2A07F 4PJOD 2Z3YA 4YIIA 3RUXA 1SFUA 3CUQA 3IWFA 3I58A 2WTEA 1IRGA 3REXA 4KDPA 4ZTUB 1YS6A 1B59A 1BOAA 4FX4A 2H27A 3HHHA 5E20A 2L54A 4RGUA 1IXCA 3B02A 4M7DD 4R79A 2L01A 1X3UA 2BBYA 2F5FA 2W25A 4M78D 3T8TA 3VEPA 2E64A 5HS7A 3CLOA 1Z9CA 5LHIA 5GANf 3NENA 4HF0A 4CICA 2EA4A 2YPRA 1FT9A 5IT3A 4HT9A 1K79A 1G3SA 1C0AA 1FBUA 1OYWA 3GZ6A 3F8MA 1LJOA 4EJTA 3KP3A 2IA1A 5F5WA 2VT3A 4OOIA 1LVAA 3IKVA 4QVCA 4PHCA 4PJOC 3REUA 1IZ1A 2OD5A 4IHSA 1FOKA 3T1BA 1NNHA 3KFWX 2WC2A 4WJ4A 2Z5UA 2DU7A 3KCCA 2I4OA 2ZT7A 3HY0A 4YCWA 2C7IA 3QO8A 2HYGD 3TO6A 4ASNA 4Y15A 5CAIA 4ZYEA 4UXNA 4N0AC 2ALYB 4Y17A 5AIQA 3ML6A 3FJPA 3EUHA 5GAOp 5HLGA 4EV0A 3I0TA 2Y0MA 4EMHA 3HTUA 4HDUA 1YQAA 4P9UA 3CUQB 3FHZA 2XASA 2XUBA 4PDKA 5H20A 5F1RA 5ILSA 4M75E 5CVJA 1K78A 3JCMg 2K7LA 3WTSC 2EFWA 3RKYA 3CUQC 1WKMA 3QO7A 1HSTA 1NJ5A 2CJAA 5GMKh 2DPDA 3A7RA 4YCVA 1MGTA 1YW9A 1K78B 2P5LC 5BQTA 3RTRA 2HYFA 2XAFA 1TLHB 2DO7A 4LB6B 3JB9D 3HRKA 1R1UA 2RVCA 2Q0OA 4KA4A 2W57A 4DQ2A 3LQRA 4HF2A 4KT5C 1FP1D 1QPMA 5E18F 1ZAOA 4ZYGA 4ENKA 3K1MA 3JAMK 4OIPF 1Z1DA 3P9KA 3RPQA 3U9GA 4M7AD 4CS4A 2CQKA 3HHGA 1T2KA 3NEUA 2IW5A 3JAMZ 3LSSA 2Q2EA 4F7UG 4L0YB 3A5ZA 1BBYA 4FX0A 3HRSA 2AMCA 2VC8A 3SQNA 1H9TA 4C8QF 3GFMA 4GXOA 4M77F 4H2SA 5KNNA 3TGNA 2ODRD 4S05A 3ICAA 1SFXA 3IG2A 3ABUA 3V7SA 4N0AA 1QNTA 3R0AA 1BBWA 3WTUC 2RB6A 3FIFA 3RKXA 3JCMJ 2FMYA 3L00A 4S04A 1IRFA 4QLCU 4RB0A 3MWMA 5CVRA 4UP9A 4TVAA 3ZMSA 2E1CA 3LAPA 4TWAA 1VTNC 4F7UF 3GFLA 1SMTA 5FLXK 4MNUA 1BC7C 1JJCA 1X56A 3HFZA 3BPVA 3RESA 2DZCA 2ARUA 2CGHA 2GXGA 3A5YA 1XCVA 1WQ7A 3DF8A 1LEBA 1QE0A 3SZPA 1PYSA 2ZXJA 4QWQA 4TVAB 1KU3A 2VC1A 3G3ZA 4E51A 4P74C 3N97A 4H2UA 1B76A 2XAJA 1KMNA 4BHBA 2GA2A 1K7AA 4PJOB 1D3BA 4FT8A 5FFZA 2JPCA 5D6FA 4G85A 3IKMB 2W84A 2LSOA 5GAOl 3IHUA 5LHGA 2Q8KA 3QOPA 1WQWA 3TEHB 2COMA 3O6BB 3HUGA 4P72C 5JR3A 4P74A 1O3SA 3QPTA 2RHQB 2M1BA 5GAN2 3HXYA 1ZRCA 4M9XA 4HDVA 4M77D 5E1WA 3SHFA 5HLIA 5GAOr 1EH7A 3QTCA 1HW1A 1YW7A 2F5CA 3HXZA 4LNSA 1ZRDA 2R7FA 3KLNA 1USYC 1J59A 4OIQF 2DQ0A 2ZZEA 2DZ9A 3L7WA 1FSEA 3KP6A 2PQ8A 3WE3A 4YYEA 1OYIA 4IXAA 1Y0UA 1R1VA 2A69F 4MEXF 3HRMA 1Z7MA 4CH4A 3KZYA 4Q48A 4LG0B 1G3YA 1ZREA 2QBYB 3S2WA 3JW4A 2P8TA 1B4AA 2RV8A 2RN7A 5GAN8 1I27A 4M9SA 1HW2A 3JCMQ 2BYVE 4CGZA 3CO7C 1I8FA 3R6SA 3HXWA 2JSCA 1WLEA 4WK8F 4AIHA 3DP7A 1X54A 2VT2A 3NQOA 4P96A 1XGSA 3ZMTA 3VBBA 5ICGA 4ZZLA 3HSRA 3PFIA 5HDGA 4V2SA 3QNEA 1U78A 3PCOA 1R22A 2HTJA 3MAJA 4EQQA 1UCRA 1DDNA 5GANj 3C7JA 2D1VA 3E6CC 1WQ2A 2GAUA 3E5QA 2FNAA 2DPUA 4WF2A 3I59B 3TEGA 1B70B 5E8GA 3MZHA 4KQEA 2FB7A 4M78E 1W5TA 1YYVA 4LK0F 5GANh 1E17A 3U2RA 1WI9A 1J2XA 4ESFA 4EMSA 4P71C 3FMQA 4CO8A 3FMSA 2IJLA 4RCCA 5LJ3g 2HQRA 2GZWA 2TDXA 4M75G 2UXXA 5GMKe 4M78B 3RIRA 3DPLC 2EA2A 4XU3A 2VBZA 5GAMh 1XMKA 4ON0A 4NQWA 5LEKA 1QGPA 1JRIA 4YRRA 4LG0A 4A53A 4PZJA 2J3LA 4RQEA 3GZ5A 5LEJA 4P5OA 4L9TA 1IN5A 2HNIA 1TW3A 1LYLA 2ZZGA 3I5UA 3AHUA 1JHFA 2MD5A 4KUMA 2AXLA 3FB9A 2DXTA 3I4PA 5D5XB 2ZO4A 1LB2A 4EVIA 5LJ3j 2PFBA 4C92D 1M8VA 3BWGA 1MZBA 4C92E 2G4CA 4WXDA 2I4MA 2FSWA 2P6TA 4K88A 4YCUA 3BJOA 5GAMf 2M5WA 4MTDA 4NHJA 1B34A 4M75D 1X01A 5K5RA 4U88A 4CXFA 1PUEE 2ARSA 1B70A 3P8VA 4ZYDA 1DPUA 5D4RA 3F8BA 4HWPA 5HDKA 4A54A 4IRHA 2L02A 2PLYA 2VOPA 4UHTA 4M78F 4CZZA 1XDUA 1FLIA 2G7UA 4N9IA 3WU1B 3V4GA 1ULYA 1V3FA 2D1HA 5TJJA 1YLFA 4M78A 1BI2A 1QQIA 3TO7A 3VOEA 3P9CA 4P71A 4FHTA 4NL2A 5F6FA 5JVTA 1TQIA 3J80Z 1IN7A 2ZKZA 2GXBA 3HY1A 2ZINA 2Q7HA 1UHWA 2OQGA 2QTXA 2KIUA 4HX4A 3BY7A 4L9NA 1ODDA 1LNWA 2EV6A 4KR2A 2BGCA 4XTZA 3WTYC 1PP7U 3ROUA 3GYHX 1GHCA 1U6GA 4H2YA 1SD7A 4KR3A 4YRPA 4Z2YA 4M78C 2P0LA 4GCVA 4I0BA 4M7AF 2QLZA 1X55A 2RA2A 3GFJA 5C52B 4EMKA 2HKXA 3UH0A 1I5ZA 4HWTA 1H4QA 3OD1A 1YW8A 4RCBA 1USSA 2YX4A 1YB3A 4HBLA 4Y13A 4KIBA 3WE2A 4M75F 3OOPA 2P4WA 3WGIA 2R3SA 1R36A 5D8KB 4X5OA 2FBIA 1RUOA 3KLOA 4EJWA 12ASA 2EK5A 1H4TA 2FQ3A 1ZARA 5BS6A 2VONA 1R7JA 1G3WA 5ELOA 3FXUA 3HRUA 3IRRA 4LMYA 4L5JA 3F23A 1BJAA 1SMYF 1H0MA 2PMHA 3R0JA 4ZH4F 3UGTA 4LB5A 2PN6A 2P7VB 2L4AA 4AH6A 3C1DA 4LD5A 4J15A 3A7AA 2CO5A 4HX7A 3WODF 3DV8A 4IJAA 4EM0B 2OQRA 5DD4A 1G4DA 5CVIA 3ZMUA 2FYKA 1B7YB 3F8FA 2XTIA 1U1SA 3HRTA 5DCFA 5TRDA 4UVAA 1KOGA 4XLPF 3GLXA 4I09A 1W4MA 1Z91A 2ZJ2A 1J5YA 4CS3A 1X2GA 3HFZB 4LLNA 4TQDA 1TBXA 3RI4A 2IP2A 3FF5A 2E5AA 1IN6A 2UWMA 3TUPA 4Q5SF 4M9ZA 5FLXZ 1D8KA 4NOYA 2ISZA 4ENMA 4G7OF 1Z7UA 3K1PA 2DTOA 1E2XA 3QHSA 5GAN7 1FYMA 1J75A 4OP0A 4I01A 3E5UA 4EMKB 1GXQA 4YREA 1I1SA 3H92A 2JPBA 4M77G 4LGWA 4L9VA 3PQKA 4C8QG 4HQEA 5GAN3 1SD6A 3EFRA 2E3CA 4C92B 2DEQA 4BH9A 3E9IA 3HTZA 2VBXA 3ECOA 2J5PA 2OA4A 1YFSA 4EGZA 4EJVA 1W7PB 2NAZA 2ZR2A 4M7AC 5L3CA 1C0WA 2ZNJA 2XAHA 1S7AA 5ICFA 2QM3A 2HDCA 1V4RA 5D5UB 4OLFA 3HIFA 2J5OA 4H2TA 4UP8A 2A5YB 2O61A 4NCXA 5DEQA 4OMZA 1T38A 4YFKF 3LA2A 5FO5A 1U5TB 2NNYA 1TNTA 3DEUA 3QPHA 1REPC 1WU7A 2DK5A 3JB9H 4XTYA 1XSVA 4OMYA 2LNBA 4E70A 4IVNA 5LJ5j 2Q7GA 3JCMW 4N0BA 4XQ3A 1ZRFA 4PGHA 4YG2F 2DVEA 4HWSA 4U0VA 1GGMA 2EB7A 4JRKA 2MLGA 1FY7A 5D5WB 1OMIA 2VE9A 4L18B 2I4LA 1SETA 4M7DE 2CYYA 3SFZA 3IKTA 4XTXA 4G6DA 4CS2A 4M74A 5CVUA 3KP4A 5L3EA 4OU0A 3JCMc 5GMKl 3PCOB 4HQMA 2YLCA 2JZYA 1L0WA 1RI7A 3FXRA 2IVMA 4YRMA 4O6JA 2X4HA 2W24A 2STTA 3TKYA 3TDZC 4G7ZF 5LJ3d 4EJOA 4C8QD 1H641 2CFXA 1HKSA 1PP8F 2STWA 4U7DA 5FFXA 3M4GA 5K5OA 3M1EA 4OIOF 3LSQA 3JCMh 3ZPLA 4M7AA 2KIMA 1P4WA 3JB9I 5GANg 4MTEA 1S6LA 2HGCA 2VC0A 1J0RA 4P75C 3QSUA 3WG9A 2OZ6A 3BJ6A 3LAJA 1SAXA 1BN5A 4RMFA 1KQ1A 2ESNA 5GAN6 2ZFWA 3C3WA 3KP7A 2BV6A 2DFIA 4K2EA 3ZMVA 3J80K 2ACJA 1KU2A 4TVYA 4H0EA 3SWNA 4YPFA 3EETA 3M4QA 3JCMb 2Y48A 4KICA 1CF7B 2H94A 4G6QA 1L0OC 4LFUA 1F4KA 4XU2A 3M8EA 4JQFA 4P72A 2DKGA 4C8QC 2P5IA 1UHMA 2ZCWA 4M77C 4MQVA 2EJGA 1OPCA 2YSRA 1LNXA 4BQAA 1XN7A 1KQ8A 1O3QA 4P3PA 1IAWA 3HTSB 3K1NA 3K69A 1MJAA 4MGRA 3DKWA 3NETA 5GANd 1YG2A 3ERED 1FSHA 2XROA 1W66A 3RACA 1EH8A 4U7BA 4J5YA 2BE5F 1ASYA 1WPYA 5HS8A 4P9FA 1QF6A 2D45A 1ON2A 3HSFA 4PJOG 5HVQC 1JGSA 3JB9F 4M7AE 2P7CB 4UPAA 4RB1A 1P4AA 2MBFA 3BW1A 3TO9A 3HXXA 1XGOA 3HXUA 4A6EA 4XEMA 5LGNA 5LJ3h 2QQAA 5GAOm 4IF4A 4YROA 4KYWA 1YGBA 3QP6A 3T5XA 2GWRA 4HV6A 1MDMB 1YIOA 2QZ8A 4LLLA 4JRIA 1X2HA 1IN4A 1IW7F 2K86A 2DDZA 4I0AA 4JUVA 4YDQA 4O3MA 4HF1A 2A3SA 2A68F 1CF7A 3GO5A 3BDDA 2YLBA 1W7PA 1BI0A 1S3JA 2DBBA 4KIFA 2I2LA 3RYPA 1ZGJA 2ADUA 4BHPA 2IY5A 2OZUA 3QRFF 4O5VA 5KK1A 2QHSA 3J7AO 1XGNA 1BC8C 4K86A 3KFUA 2VXEA 2GQQA 4HX8A 2M8EA 4WXCA 1I5LA 1YFRA 3EDPA 2HTSA 3QU3A 2RC4A 5LJ5g 4M7DC 4Q6GA 1DUXC 2O03A 2KIFA 1ON1A 1IUYA 4X9DA 2IY5B 2RDPA 3VODA 3DXJF 3ABTA 3CDHA 3JTGA 2OU2A 2F5EA 4DNCA 2ZT5A 1BIAA 2IPQX 5ED4A 3WTWC 1WNLA 3A74A 4EMGA 2VBYA 4RB3C 3A7UA 1F9NA 1B6AA 3VQVA 4A0YA 1A04A 2JN0A 4YFXF 2DLLA 2VN2A 5A2QZ 1HW5A 2UZKA 1HBXG 2K57A 2FMLA 3TDUC 2RD1A 1MGQA 3KP5A 4J6YA 2O0YA 3GX4X 1ZG3A 3TOAA 1NYQA 3SWNB 2V9VA 1QZZA 4IRIA 2RM4A 3R61A 5JI6A 2F5DA 3MZYA 4XTUA 5E3IA 3M7GA 5HOOA 1EQRA 3E3VA 5FD6A 1S29A 1PDNC 1B1BA 3V8KA 5GANe 4YRCA 3E6DA 5BOXA 4RGSA 5K1PA 4P73C 1ZGAA 4LLGF 2HZTA 2RHSA 1IL2A 2QHTA 4M71A 5DYMA 3RF1A 3I53A 2H09A 4PG3A 2L3DA 3F21A 1B9NA 4M7AB 3JCMV 4ETSA 3F8NA 6PAXA 1NJ6A 2A6HF 1B7YA 2JTVA 1JHHA 2F2EA 5JHUA 1EIYB 1IXRC 3N4MA 1OYYA 2AKWB 1SERA 3I7FA 4AIJA 2CSOA 1E1TA 5J6XA 2VODA 5L3BA 4RAZA 1KMMA 3MF2A 1HC7A 2A6EF 4RDXA 5BPDA 2MA3A 4M78G 1XSXA 5HLHA 3HSBA 3EYIA 2HWVA 1I1GA 3IL2A 2AKWA 1WWXA 2CWEA 3M4PA 4F7UB 3IC7A 2K4JA 1XCBA 1SRYA 3E6MA 4UVBA 3JSPA 4M7DF 2LKPA 1U8RA 4YFNF 2P6SA 5D6EA 1JXSA 4Y91A 2Z33A 2V79A 1JJCB 4EM1A 5BMZA 1HTTA 3V7RA 3BP8A 5DCMB 1YFHA 2QQ9A 1GVJA 2XHKA 3O2PE 3JCMe 3FM5A 4F7ZA 2IT0A 2ODRC 4AWXB 5LLQA 4DPGA 3JB9G 2EFOA 4O2DA 2FU4A 4LJZF 4HV5A 1R5HA 2P5KA 4PJOF 3GEZA
chains in the Genus database with same CATH superfamily
4AIKA 3OV8A 3Q0VA 4E7HA 2LQKA 4ZDLA 3QWYA 1WVRA 3M07A 2E2HJ 2XRLA 4N4IA 2O88A 2R7XA 2ZXFA 1R5GA 4UUTA 2VV5A 2X0LA 4Y28E 4IO9F 4LDXA 2P81A 3K70D 2Q5IA 4IKFA 3FDYA 1HSQA 1RACB 1X1CA 4TTVA 2DCEA 2FD5A 3VSLA 5KYWB 4CYCA 4FTHA 3ZXSA 5ILUA 1IB8A 4OINF 1YTYA 3QJ6A 3RMQA 1VQZA 2BXYA 4D7MA 1F5TA 2VQGA 5ECAA 5LJ5h 1V5GA 5FWCA 4PSXA 1HKTA 1QCNA 1R23A 1Z67A 3RCOA 1LJ9A 4DPGA 3VUZA 3JSOA 1FP2A 1FNNA 3UFGA 2ZIOA 2CJBA 1OZ3A 2M87A 1GDTA 3OYEA 1K1ZA 1MMAA 1J5WA 1KYZA 3I56A 2ISYA 1LFBA 4PJLA 4MHGA 2L5QA 3DCFA 3VYHB 3C12A 4EMKC 1G51A 1R9TJ 3GXOA 4CCJA 1GT0C 1P92A 2DTHA 1RUNA 1BW6A 4JLIA 1DU6A 4M4ZA 2DLPA 2DK8A 3BG3A 3PVLA 5LJ5e 5C51B 4E4HA 5CPRB 2DNUA 2DA3A 3H9JA 1QVGA 4M6YA 4J9EA 3W6JB 1YCYA 5JHFA 2RHQA 4F52A 3TSWA 2KNBB 2ALYA 1OCZH 1FBQA 1ZUYA 4RS8A 3GTMJ 4JZ3A 4HLXA 2RAEA 3BR5A 1Z6TA 3LA3A 1BR2A 1I50J 1FYLA 2DTIA 5CQGA 1HK9A 3A1PA 2Y0SA 4M3FA 3RDIA 4L6V5 5C53B 2NRAC 4XSXF 3V42A 3DTKA 2E65A 2GBYA 5FKLA 2DERA 3JV3A 1RPWA 4HG2A 3TP0A 4L5EA 1WA7A 4HA8A 1XD7A 4M7DB 4IHXA 4FSXA 3G71Q 3BQYA 2CRGA 3HEFA 4RGRA 4IPAA 5D4SA 2ZJPF 3MN2A 1NPPA 2R58A 4P75A 2XDDA 4A12A 3JRIA 1VQ9A 2KRFA 2EJFA 4F04B 1J9IA 1R4MB 3PFYA 5B1AH 1RRJA 1BBZA 1W0UA 1B34B 2YS9A 3F22A 1VYUA 5L3DA 2OCEA 2GFUA 3X25B 2C6YA 2HDDA 2DMTA 3GTGJ 4YRFA 5DTDA 5AYFA 2W0ZA 1ZG1A 4BI8B 2HCKA 1ZBJA 3M9AA 3WQZA 2A7YA 1KC8U 1IN8A 2Y69H 3CJNA 3LSMA 2E10A 1Y8RB 3PUFA 5F64A 1TW2A 1HC8A 3K6GA 4FASD 2MF2A 4DEYA 2OBPA 2KMTA 4A5NA 3ERRA 4BQOA 3VV0A 1W7PD 2L7FP 1WZOA 4YRTA 4OVAA 2OJED 3CCVA 3R07A 5DCMA 4HVUA 3OYNA 1Q95G 5J4VA 4BY6C 2HOTA 1QP2A 2HVQA 5ERIA 3OYJA 2F2WA 1MNDA 3ELKA 1FX7A 1LDKB 1BI3A 2VE8A 3Q9VA 5E1ZB 3QAHA 4HNUA 1EJ9A 5AONA 1AOYA 1I4K1 1U1TA 1SAUA 2VKEA 1NTCA 1FIPA 2R7QA 4XMYA 4IOCF 4ESJA 1U8BA 2AS5F 1M8MA 2KR3A 3TMOA 3I71A 2LQNA 1DPRA 5IYCJ 1Q86R 1ZH5A 4J6WA 1HSJA 3RMSA 3MMYB 4J9HA 5I11A 4B9WA 5H6RA 1AU7A 2HS5A 3H1CA 3MF1A 3CCVQ 3CF5F 2E5NA 5K7FA 2M8GX 4YRVA 1ATIA 2CIMA 3EGXA 5DDGA 5KYWA 2L9SA 3HFOA 5GP9A 1Q81U 1NJ1A 1SSHA 1UGQB 4A3MJ 5KYYB 5LJ5f 2AZVA 3GVAA 2R7WA 4ENNA 2F69A 2K79A 2N8GA 3G4SA 4FE7A 2CT3A 2HMAA 1OX9A 4AFUC 1JEGA 2QAZA 3FC3A 3Q9SA 2A61A 4CI0C 3K7AJ 2CUEA 2UXNA 3LC0A 5HGQA 3CMAI 1TNSA 2DXBA 4UV8A 2JT4A 4PJOE 2B63J 2LC2A 3I59A 2QCOA 5A0DA 2QK0A 4LVIA 2JT1A 3Q1JA 2EQKA 3NEMA 3EYYA 2Q7EA 4XBFA 3K9TA 2HQXA 2Z1DA 2VKDA 2BW3B 1LE8A 2P0KA 1R5ID 4J01A 3RYRA 2E6ZA 2Y4XA 3I55A 5IT9Z 5EC7A 2DW4A 2L89A 4Q4ZF 5DUKA 3W3CA 1Z7NA 4N4HA 1ETQA 4IURA 1T0JA 3PNVA 2LH9A 3DSQA 2JUGA 3JCMf 3E9HA 4LVLA 1GRIA 4CCKA 1LCKA 2YRCA 2FOKA 1JUSA 2HU9A 3FKJA 2KBTA 1YX5A 3A01B 1IUFA 1B3QA 3BCBA 4CRIA 3GBGA 4XONA 4Y92A 4F16A 4HVCA 2HQAA 4UP7A 3ZEHA 3WTTC 1NBEB 4X9CA 2EQIA 2KK4A 3J7AY 1WHHA 2HQEA 2V8IA 1GXPA 1Z6RA 1ZTRA 4HPQA 4XU1A 5CO7A 2DJNA 1RIOH 3WGHA 1T3SA 2FE3A 3KBGA 2K9NA 5ILVA 1M2VB 3CXCP 3WU0A 1Z7LA 2C8MA 2VOOA 2G7HA 4P55A 3E5XA 2EW3A 4ZZDA 2KY9A 2V1QA 2V1UA 2H8RA 3FRNA 9ANTA 1FPQA 4A5MA 4UVCA 2ZPGB 4FT4A 3OYAA 4UC4A 2XF7A 1VQKT 4XOTA 1WLPB 1ZA1B 2ECCA 1EOVA 3WVEB 3UF4A 1JUMA 3CCEQ 1SFKA 1X4PA 1TQMA 3MFKA 4HW0A 5BPIA 4LDYA 2FA5A 3X2QH 1VIEA 2EFIA 2J6OA 2R93J 2XTIA 3HHTB 2EZLA 2HSPA 1I0CA 3H3ZA 2JM9A 1U5TA 3A31A 1EFWA 1M4ZA 3PSIA 4ZGJB 1N9RA 2QSFX 2HXOA 1YFTA 3IAM2 4YRQA 4RM2A 4LK1F 2GQIA 1GCQC 5LJ5d 2DPPB 5DY9A 1QRYA 1FOYA 3L2CA 2VKNA 2RK2A 1VQPT 3R60A 3H6ZA 1OX8A 2E34A 3HC7A 1OYXA 1UTIA 5AIPA 3G73A 1RLQC 3WXMB 1H4TA 3LMMA 1O7LA 3A32A 1LDDA 4EX5A 1M1GA 1NE8A 4KMFA 3GNFB 3QO5A 3QZ5B 4R0KA 1OISA 2V1NA 2V1DA 4OMFB 1JJCB 1UB9A 2RJCA 3CMYA 2E60A 3K0LA 3H0GJ 4WXHA 1W0TA 3FIWA 2AZSA 2KRCA 5ICCA 3OBWA 3ZP5A 2MMPA 4PNOA 1RADB 1JBMA 1JE8A 2RGVA 2WB1N 3PNTA 3LSRA 1O3RA 2EJ9A 5C6SA 3Q0WA 1X6GA 1H4VB 5H6QA 3G6EA 1K73R 1UFMA 2HEQA 5FD5A 2MI6A 2Z9OA 2AMCB 3RDVA 3CMET 2A05A 2KSSA 1X1PA 3KE2A 2DI3A 1IXSB 3CMAA 2M45A 4D5FA 1VQ9I 2DDBA 4Y3OA 1E24A 4M7DA 2R57A 3I64A 3FJ5A 3LH0A 5LGTA 4OMLA 3L9FA 4DGWB 4V2FA 1ZLKA 2VQHA 4MFDA 3CESA 4OIRF 1NH3A 4ZYHA 1OV3A 3RGLA 1FXXA 1Z05A 3CD6Q 2RHIA 2CUFA 2EV0A 3M58A 1W36D 1RZ4A 1IJWC 3FEOA 5CCAA 7AT1B 2XIGA 1NHAA 4AFSC 1MD0A 3T8RA 1PVEA 5L3FA 1T3LA 4L0ZB 4AFQC 1R00A 3KEQA 4Q5WA 1K6YA 3HUGB 3VRZA 3EFOA 5IYBJ 3GCMA 4UV9A 4ZJZA 1GBRA 1VQPQ 2F48A 3HGGA 4MO7A 2ETHA 3HL2A 3P7NA 2XICA 4NS5A 1KD1R 3F72A 4HCBA 2V1XA 2WV1A 2G0EA 3JR9A 4BS9A 3J7AF 3IH2A 3OYFA 1KU7A 1M5Q1 4FISA 1QVPA 1EV7A 4C8QA 2HAXA 1AVZC 2ZIMA 3A8GB 3W6KB 2D5VA 4CS4A 2W4SA 2KISA 4R56A 4CH3A 3R4KA 2K85A 3CEYA 2EJRA 4EM2A 4YRLA 2K27A 1H4SA 4JX6A 4RGXA 3ZQIA 4G7HF 4M75C 2CQ7A 5D8LB 4E6RA 4NL3A 1N77A 4ELZC 4D0PA 3KYDB 4RM3A 2QEXA 4J9FA 2DT5A 2QG9B 1XQHA 3JAME 3EG9A 2RQWA 3EQLF 3CTAA 1U2WA 2Q1ZB 4M3GA 2J05A 1TSFA 1R1TA 3CJTB 3VQXA 4WCGA 4IRGA 2O9VA 4CH5A 2KJCA 4RKUE 4XTWA 2QEXT 4XIDA 1ASZA 1P7JA 2CW0F 1RAHB 2GXAA 1F36A 2ZFUA 2QHUA 2BOLA 1BCMA 4Q47A 2HNHA 3QPLA 2IA2A 3SEZA 3G4SI 2RQVA 1VQ9T 2EL9A 4HLYA 4MQ9F 3JTHA 1EIFA 2RHUA 2MCNA 4B09A 4LD9K 4P3NA 2CKKA 2QEXI 2E7XA 2G9WA 5IT9E 1B8AA 3CCUQ 3JREA 1ZBXA 1G83A 1TG0A 9ATCB 1ABQA 1XOVA 2CJJA 1ABOA 1B9MA 3GF5A 4ZNXA 2R7ZJ 2BTTA 4ZTZB 4IHTA 5CVVA 1RKWA 2VXFA 2VI6A 4C92C 2O3FA 4XLHA 2YUSA 2MC3A 4YEJA 2LF8A 4ESRA 2PUKB 1BR4A 1W5SA 5LJ3e 2WSEE 4GYIA 3RJPA 1E3HA 5K5QA 1WZ2A 1U5TC 5E17F 1WXUA 1ZSZC 3K2ZA 2JRTA 3HP9A 1KQSA 11ASA 1YJNA 2MABA 5GAN5 1SF9A 2QYOA 1IF1A 4BBRJ 1NLOC 1D3BB 2FPEA 5GMKi 5DD8A 1N8RR 4BWAA 1HJDA 1X19A 3H3UA 3PQJA 1BIBA 4XLNF 1NZ9A 3MJXA 4B4CA 1QBJA 5KYYA 1FC3A 2E1HA 4PK4A 5IY5H 3GW2A 1H89C 1ZQ1A 2QQBA 3ZBDA 2LDUA 1NJ2A 4JBAA 2M30A 1LQ1A 2DQ3A 1EIYA 1S8NA 3RPUD 1XTDA 1QZYA 4N9HA 5DM6F 2PJPA 2K6DA 3LW5E 3KXTA 2WAQN 2HFHA 3MVPA 2KDOA 4J8OA 4YRKA 1ZYRF 2HKQB 2F5KA 2CU7A 3CDLA 2H6BA 4DBRA 3J81Z 3ERMA 3FHNA 2GIVA 2JRMA 2XPWA 3HSEA 1K73C 2L9NA 3HOTA 3L09A 2KYBA 1ZSZB 4H2XA 4IX7A 1G6NA 4G9YA 2OTJI 5LRRA 1I1JA 4I02A 3FMRA 2QASA 3FK6A 1S72A 1X69A 1WRJA 3DEWA 2DA9A 2RQPA 3P8YA 3KZZA 1NYRA 4MLOA 3QWLA 1JKOC 2DL5A 4F92B 5EEHA 2LG4A 2YT6A 5D7UA 1N6AA 1X2NA 2VBWA 5GMKj 2QHVA 4XN0A 2BEOA 3ULQB 1MUZA 2CSIA 5FGMA 4A4EA 2ZPIB 1XGMA 3ZRGA 1P6RA 1X3ZB 3TP3A 1FZPB 2WWYA 3Q5FA 2ED1A 2M51A 1BCOA 3CCJI 2I10A 3VS5A 4C5GA 2JZ2A 2LR8A 4BHCA 2HEOA 4XSZF 1XJWB 3G1JA 4G84A 1GFDA 2OTJA 2DU9A 1ADJA 4A0ZA 1IDYA 1WHUA 2P5VA 1S7OA 2J6KA 4JPBW 2KQWA 1M2VA 1KQSP 2EFPA 2E36A 2J3MA 3BROA 3M0PA 3QYFA 1XSDA 2K3YA 2AQFA 3NELA 2LT1A 1YJ9A 3S1NJ 4PGGA 5GAMe 1QMCA 3KETA 1M90U 2RH2A 4LIUA 3BLYA 4RAYA 4NC7A 1N9SA 1J09A 3QUIA 3ISPA 5CLSA 1WYDA 3FBNB 3CD6T 3HBLA 4B48A 2V8KA 1I3QJ 4RMNA 3WG7H 4KT6A 2K9QA 4N4OB 4M75A 1M3CA 2B0LA 4IL6C 4ESBA 5EF6A 2KRMA 4KGVB 1KQ0A 2GA1A 2FUG2 2MH9A 4RA2A 3I3LA 1OZ2A 4LIVA 5HDNA 3QYGB 4OB0B 2FXAA 1HXDA 3VRYA 5LJ3f 3D5LA 4L87A 2ZJRF 4I98B 1D8JA 2ME6A 1POGA 5F1JA 5IN1A 4GYGA 4Y52J 1YHQT 5DV5A 2D6FA 1YJWQ 8ATCB 3VS0A 3WTVC 2OAZA 1P2FA 1WJBA 2XKOC 3OYCA 5GPCA 1QO0D 1JXMA 2CP0A 3QYBA 1NJIC 3DQVC 4ZIBA 1FOWA 2CV1A 1T39A 2ZC2A 3O8HA 2QENA 1UELB 3PSFA 3QP5A 3L2RA 2DXUA 1HQCA 2E7WA 3KEYA 3VQWA 3ZMDA 2R7TA 4XNFA 2D8JA 4NNJA 5CQXA 3UATA 4H02A 4CSWA 1L3LA 1I6XA 1QZEA 1EH6A 1TT0A 2E1NA 3V8JA 5HODA 3E97A 1CKBA 3HOUJ 3ECHA 3P8HA 3GPLA 2YR2A 2K9SA 3SDBA 4M73A 4AYBN 3CMEA 1KQ2A 3TCJA 1SFEA 2O4XB 2ZGWA 2Q7GA 3JCMX 3EG0A 3F3XA 3H5RA 3NTKA 1D0XA 2P5KA 4I7HA 1QHHD 4M72A 4J9BA 2O8KA 5HNHA 4P1WA 2F6CA 3BY6A 4N4NB 2XVCA 4D7NA 2R7DA 2RKHA 3AL0C 4IUTA 4KITB 1WGXA 2ICWG 5GPAA 3DB3A 1ZK8A 4QT7A 2CZ1B 2FF4A 4U0WA 2XKOA 3E19A 1SD4A 2D2WA 2XGDA 3J81K 2MK5A 3BJAA 4HAMA 2NYXA 2O6GE 4PJNA 3BTCA 1UGVA 2IIMA 2ZCEA 3DLLF 1K9AA 4BACA 2RHSB 2ZTGA 1JXOA 2XPUA 5GAMg 1OCRH 2WB1A 4HOBA 3AAFA 2CH4A 3QBYA 4C0FA 3E9FA 3GZNB 2IA0A 2CJ9A 3M55A 1ENHA 2LRQA 3IWZA 2CGPA 3INZA 2ID3A 4LVKA 4GO1A 1VQ6T 2OUMA 4ENJA 4DA4A 4ZYAA 2PMZN 3V7CA 3FZVA 2FBKA 2L9RA 2PEXA 5B66C 1AWXA 1D09B 5J3LA 1OU8A 1VF9A 1KYWA 1V5FA 4AVPA 1NG2A 1M9SA 2X3XD 2MW8A 4HZFA 3SXYA 3CCRI 5E3MA 4RB2C 1MNEA 2LF7A 4QSHA 3V8LA 3VJPA 1WI3A 4C8QB 2HI3A 4YRSA 4LOCA 4CHUA 1QQJA 4M77B 4NQWB 5GAN4 1FYFA 4YRGA 5EG2A 5KVRA 4A6DA 1FOXA 1VYVA 3HFNA 4A4HA 3CPWA 1XNIA 2EAYA 1BL0A 1OFCX 1T6SA 2VIXA 3WTXC 3LA7A 2E2IJ 3UT1A 1ZN2A 1GLNA 3PL8A 1YI2T 1EVKA 2DJIA 4WX9A 1R58A 2LD5A 1PSFA 3PGGA 3SB2A 1G5IA 2ARTA 4H2VA 4M75B 1YS7A 4KFCA 4BXXJ 1YJNI 2L2OA 3D5SC 1BYMA 2CV0A 4CYCB 2XDVA 3CCRA 3LSJA 2ELKA 4XLFA 2LBFB 3EUHC 3HYIA 2W7NA 3BDUA 2Y9ZA 2RMOA 4LDUA 4RTZA 3SEMA 3CPWP 3CC2Q 1SD5A 1GFCA 5HS9A 3RPUA 2QSGX 1WGSA 2QVOA 3F0CA 2X3WD 4EO4A 4ZGEB 5D5VB 1OKRA 3CMMA 1M27C 1PRMC 3DBLB 2E5QA 3LWFA 1B7YB 5GTHC 4K87A 2DT7B 3W6VA 2P0PA 3NTHA 3QIIA 2KJBA 5IH2A 1SEUA 2VPRA 1QPIA 3I55T 1X3WB 3PJRA 5J4YA 2E41A 4J6XA 3VQYA 2EFQA 4G94A 4OAZA 1O57A 2JMCA 4J9GA 3HKSA 2NUPB 1IV6A 3FWEA 4P3OA 4A4GA 1Y96B 2RN8A 4WJ3M 3M8FA 2JXBA 2AT1B 4DZPA 1KA8A 4IQJA 4A3GJ 2COWA 2B86A 4CCOA 2DQRA 1D3YA 1CGPA 2O4XA 1MNMC 2CZ7B 2HQHA 1Z9QA 2GCXA 4MEYF 2VXZA 2WAQA 5JFRA 3OYKA 1EFNA 3H5NA 1ZHIA 1U0JA 3MCZA 3RNJA 2ENMA 2ELHA 1MDMA 3GTLJ 2YDLA 1K4US 2CS3A 3K70C 3O3KA 3BR6A 1AHJB 1LOJA 2PMUA 2YX7A 3E6BA 5I2SA 3KEOA 3BOQA 1FWZA 3G1LA 3RQIA 1H9GA 1VQ9Q 2ZNZA 4BNCA 1S1NA 2DMPA 3EG2A 3VS7A 4BAYA 1TTYA 2DU5A 3CCLT 2HZDA 1HKQA 1JU5C 2CUDA 4H2XB 4LVMA 2XV4S 4XU0A 1ZLJA 3C94A 3H0IA 4LUDA 1ZX6A 2BHYA 1OCOH 4M77E 1KGSA 2PTKA 3JCMd 1IXDA 4BYYA 2PBIA 1HDPA 2XGXA 3D0SA 3CC4I 2ZZDA 1BK2A 3DKMA 3C2GA 1F1ZA 3HOSA 5KHDA 1STZA 2MH2A 3TW6A 2CUBA 3BDLA 3HXVA 1X2MA 3CC7Q 3TEHA 2HKOA 4KN7X 1SC7A 4YIFA 3PIOA 4R1HA 3CCVT 1AWCA 1MJ9A 4U0YA 3A01A 2KRSA 3HRIA 4MMLA 1WSUA 2XHCA 4I76A 4TV7A 3S32A 2H1LA 1Y57A 2IRFG 2R7VA 1AOJA 5GAOq 2RQRA 1X6OA 5DLQE 3GWZA 4XK4A 1OR7C 4CYDA 1PSEA 3MEAA 3OYLA 3GFIA 4ZTFA 3OW2S 2L7ZA 3UGQA 2NNNA 3CC4A 4H2WA 4C92A 4JK1X 3VPRA 3LH5A 3DPTA 3G2BA 4KIGA 3WTZA 1ZG5A 2FBHA 2V6CA 2ZJQF 3S14J 3JRAA 2PI0A 3RL6A 4RQFA 4QVDA 5JLWA 1ZELA 3GTJJ 4AFZC 3C18A 2EFNA 3CUOA 1QCOA 3CO6C 3RUXA 2IGOA 4HYEA 4C92F 4YRNA 2EKHA 3MEYA 4CC4B 1ETXA 1TQPA 2L4MA 4KH0B 1TS9A 1RKTA 3CMEI 1XMAA 1I3AA 1U9OA 1Z21A 4A2UA 2PG4A 5LRSA 2ZPBB 3CPWS 2HYJA 1SVMA 2KZGA 3VKIA 3CQTA 2FNPA 4NB5A 2FJ1A 3F6VA 3L2UA 2MIOA 3MEXA 3H9NA 5I21A 1ADYA 2X4JA 1TWGJ 3BJUA 2ZNIA 1JB0E 2JTFA 2E19A 1TP4A 4B8XA 3IRQA 3BFMA 2MLKA 2ECZA 1OR7A 4DYRA 5H2FC 1E3PA 3O8VA 2QA4A 2ZMEC 1SKUB 3K4JA 1RNLA 2XB0X 5IP9J 2IG0A 2OAUA 2YUNA 1Y71A 1YO5C 2KYMA 3ZQ7A 3R6NA 1BM9A 1TUDA 2KFDA 1O4XA 1ZHFA 2ESHA 3PUBA 3TBIA 3TU4K 2OAWA 4YRIA 1XB4A 2DF6A 3I55I 5K1XA 5DUIA 1VQ4A 1D1BA 3F8CA 4PCQA 2YU3A 1U3EM 5E1XA 3CD6I 2IS6A 1Y96A 3DKXA 2G6FX 3QYHB 2HR3A 4P73A 1F43A 2LX7A 1VQKQ 4TQFA 2PMEA 3T0YA 2DA4A 2EQRA 1ONVA 1M1EB 3SFMA 2FPDA 3LQQA 1S72I 4E6KG 2XSJC 3EG1A 1U3OA 3M59A 4XKBA 4F7UE 1USYA 3JCMP 4Q15A 4WCIA 2FEZA 3PO2J 2DK3A 2CFOA 2HVRA 1USTA 3EAEA 1NEGA 3LFKA 5F08A 1RAGB 1TH7A 2RREA 3B73A 2J06A 1QVFP 2M16A 2XKPA 2CUZA 5CKTA 4UUVA 1VQ4T 2JA2A 2F2VA 4JRPA 3REOA 2K4BA 5J1UA 1W70A 2ZMEA 5CQEA 3OIOA 3S1RJ 4YP0A 2JMWA 4DEXA 3OS5A 3MQZA 1KQ9A 3ZQGA 1Q1HA 2H6CA 3CF2A 4B3XA 2EWNA 5FRNA 2GBQA 1WJQA 3QO3A 1J7KA 2NS0A 2F4OB 3KYCB 3NAUA 3ULRB 4XRFA 2A36A 3M0QA 1E22A 1XDSA 1QVFA 5ICEA 4KNYA 2NYSA 1JGGA 2QQSA 3BZ6A 2XRNA 4ME7A 4M7DG 3RBBB 2V6EA 2K02A 5M3MJ 2XAQA 1OPKA 1WJCA 2ECBA 4UNOA 4WI1A 3A0BC 4BJTA 3OBYA 1FYKA 1FBSA 2QUFA 3CJRB 4M6XA 3SZTA 4HT8A 4HWOA 3QU6A 2NVXJ 2DQLA 2M02A 4PL6A 4L9JA 1OEBA 2ZPEB 3L1AA 4D8KA 4TVWA 2Z99A 2CMPA 4R8HA 4YRJA 1IL2A 4M7AG 1OQYA 4HWRA 4CH6A 3VB2A 3M8JA 4J9CA 3SWNC 3DTIA 3TQ7P 5EZHA 1SESA 3DEEA 2MD0A 3C0CA 3QKJA 2CG4A 2ZNYA 5E3OA 4F7UA 4PJOA 1VQNQ 3HFVA 2XB5A 3NARA 1MKMA 1N5ZA 1MJBA 1UECA 1PCXA 1UFFA 4C92G 3MCAB 1AKHB 1B72A 1UGRB 1LE8B 5I22A 1VNDA 5LGUA 1VUBA 1BBUA 3FXLA 4CDGA 2CW7A 1HA8A 4HXJA 3NGPA 2HOEA 2FRHA 4JOMA 2B7EA 2X1EA 4KN4X 3ZCOA 3FBIB 4A3DJ 3M53A 1I39A 3BTLA 3DFGA 2L2PA 3NRVA 2Y75A 2Q5HA 3TOBA 3TEDA 2L3SA 1K6OA 3S2DJ 3LSTA 4A0XA 5FW9A 1ZGWA 4C3JJ 3RR6A 1UGPB 4EEFG 2FG0A 5GAOn 3A0HC 2EPFA 3MEWA 4KUDK 1WH5A 1VQNT 1E1OA 1DQUA 1T98A 3LSHA 1X2QA 2Y90A 1N9WA 4MMKA 3ZN0A 3H0HA 3CQZJ 3ZN1A 2YHTA 2VKVA 3BPXA 5GAMj 1R0BG 1IV8A 3H35A 3IALA 3P9IA 3GF2A 2XAUA 1D5VA 5J8FA 5J40A 3CD6A 1FMVA 5L3GA 4LD6A 2DAOA 3JB9J 1RESA 2ZBKA 1IGQA 4GGGA 3CCMA 4KT0E 1PYSB 2XK0A 1KQSS 2KVQG 5FB2A 5GAHJ 1YCSB 2EGEA 5LBQA 3KP2A 1K61A 3CMQA 1O7FA 3LWHA 2GIZA 2IAIA 2KKOA 1WCMJ 5IT9K 2XGTA 5HK0A 1Q1VA 2HQNA 3I54A 3U1DA 3W2AA 1UHCA 2VWFA 3L2ZA 2K4YA 3TQNA 1BW5A 3CC4Q 2IVWA 3L4GA 1P4XA 1T0FA 1BA5A 2R7RA 2RNJA 4C8QE 1GL5A 2ZMEB 1EVLA 2PNIA 1K4SA 4C5EA 4KRTA 3FXQA 3PZCA 2YWWA 3R6OA 3EFSA 3WU2C 4K11A 2ZZFA 4Z6YA 2WV0A 2DJQA 5FLXE 2VGNA 2H3JA 2WA0A 4I2OA 5EYRA 5A2QK 1DP3A 2I5UA 3X26B 2CV2A 3CCVI 2EZHA 2KZVA 5E8IA 4PFOA 3VYSB 4AG1C 2QBYA 4A4KA 1BI1A 4BDYA 2XAGA 3GIBA 2E71A 2ZCFB 1OJLA 1O75A 2DL4A 3VU3C 4AD9A 2AO9A 3FX3A 1NJ8A 4NDLA 4EGYA 4E7JA 3HKZN 1HF0A 2DJZA 3ZMZA 3F6OA 2X4YA 3G1ZA 1VQMA 3E2UA 3L4GB 2JSPA 3RKWA 4J7IA 1ZR2A 2EQMA 1IRZA 3IKLA 4G8XA 1FTZA 2F5TX 2LP0A 1G3TA 2F4IA 4BXUA 1O3TA 2ATCB 3EGXB 4B9XA 2CSQA 1SVLA 3KPHA 2DXIA 3P8TA 3L2QA 1FTTA 1LFPA 4XTVA 3W3SA 2QA4I 1GCQA 4WWCA 3M4YA 3VFZA 1N75A 4CCMA 3S16J 1ITYA 5CYVA 1MBFA 3TW7A 1VQ4Q 4B3AA 4KMUX 5M5WJ 2X4XA 8AT1B 1ACMB 3WGGA 4DBQA 1U5SA 2HVSA 4OF1A 2I4NA 5K1YA 1LDJA 5ELNA 4L5IA 2PMFA 5EEGA 3CCSI 5CJ9A 1WYXA 2CP6A 1SANA 3RERA 2O8XA 3DKYA 4E7ZA 5J8CA 1X27A 3COAC 4UB6C 4BU2A 3M0UA 2ZT6A 3META 5C3EJ 4FSSA 5GMKm 4A69C 2EV5A 2W85A 1KU9A 1I81A 2GTJA 4ELYC 3LGFA 3MQ0A 5CK9A 4X6AJ 3FM3A 2DTRA 4XEOA 2L7MP 2L7KA 2VASA 2VJ4A 1DP7P 4M3EA 1T8IA 1A31A 2DN0A 1KD1C 3H36A 2Y0SN 3GUDA 1LEAA 2PJRA 2J7IA 2LY9A 5LHHA 1ARKA 4DZJA 5JVGF 3LGLA 2Z0WA 1J3TA 2QWWA 4EJUA 2A07F 2M0YA 2JJ9A 2R0QC 1FYNA 4FYVB 4PJOD 2Z3YA 3D1NI 4YIIA 3RQ4A 1X1DA 2LZ6B 3PFSA 1Q82U 1DGRM 3BC8A 2BIVA 3ASKA 2OV7A 4F91B 1SFUA 3CUQA 1VIFA 4AU7A 3IWFA 2CP5A 2K5FA 4VUBA 2P84A 1UZCA 5HCKA 3M9QA 1K9MC 1V29B 1UJ8A 2CUJA 3LOCA 3PIOF 1KJWA 3GP8A 5CKFA 3I58A 4MZMA 2KRNA 3BG9A 2I0NA 1W2BA 3M0TA 2WTEA 1IRGA 1IHWA 2A6TA 5FJ8J 2GNCA 4KDPA 3REXA 4ZTUB 1YS6A 3JRCA 1AD5A 1B59A 1BOAA 4FX4A 3MF2A 3VS2A 2H27A 2JUCA 4OB1B 4GLMA 4E7IA 4A93J 3HHHA 5E20A 2L54A 2FQ4A 4RGUA 1RR8C 4NC6A 1WDXA 2DMNA 1IXCA 4JDSA 3B02A 4M7DD 2FVUA 3G1MA 4R79A 2ZB9A 3H8ZA 2L01A 2EYYA 2RO0A 3S2HJ 4BXFA 1Y7XA 1X3UA 2KPMA 2BBYA 2F5FA 3BQZA 1APLC 2KDSA 2W25A 4M78D 3CPFA 3T8TA 3VYGA 3VEPA 2A08A 4RAGA 2E64A 5DM7R 5KH6A 5HS7A 3CLOA 2JQ7A 3MP6A 3I5RA 4XORA 3CC2T 4CC7A 2Y9YA 1Z9CA 5CKHA 3DU6A 5LHIA 1KC8R 3FLGA 3JRGA 5GANf 1VQMI 3NENA 3OIQA 4F3QA 2HL5C 1VQOQ 4JP0A 4A63B 4HF0A 4CICA 2EA4A 2YPRA 2ID6A 1FT9A 1TT5B 3CDIA 5IT3A 2VUMJ 5J3BA 4HT9A 1OOTA 2FO0A 1K79A 1G3SA 3C2HA 4RAFA 4PJ0C 1KHCA 3CMAT 1FBUA 1C0AA 1OYWA 3GZ6A 1VQMT 1RC9A 3F8MA 1LJOA 4EJTA 2DEUA 1Q82R 3KP3A 1TC3C 1A6QA 2IA1A 2VT3A 4OOIA 5M5XJ 1LVAA 3IKVA 3PIPF 1BR1A 2MPXC 3P8BB 4QVCA 3MKYB 4NBQA 5FRMA 2Y4YA 1CQTA 4PJOC 4PHCA 3REUA 1IZ1A 3G6EI 1MBGA 3J7YJ 3AKZA 2OD5A 4IHSA 1ERDA 1FOKA 2NOJB 3T1BA 2JM8A 2DYBA 2F4MB 3KFWX 2QA4T 2DFHA 2DA6A 2WC2A 1FEXA 2FZKB 4D6WA 2Z5UA 2KLOA 4WJ4A 2DU7A 3KCCA 2I4OA 1ZSZA 2O5RA 3MEUA 2ZT7A 4HSTA 2C7IA 5A0GA 3HY0A 4YCWA 4C2TA 3QO8A 2HYGD 2RK1A 4PSWA 3TO6A 4ASNA 1A6IA 4Y15A 2BZTA 5CAIA 3S3NA 2R5MA 4ZYEA 1K0XA 4UXNA 2OC6A 1PYVA 4FYXB 4N0AC 3KYLA 1YIJI 4OMMA 4FT2A 5J26A 3VYTB 2ALYB 4Y17A 5AIQA 3ML6A 1JTYA 3FJPA 3EUHA 5GAOp 5HLGA 3DPUA 3I0TA 2Y0MA 4EV0A 4EMHA 4F14A 4EIKA 3HTUA 1M2OA 4HDUA 1RAEB 1YQAA 4P9UA 3L2WA 1QVFS 4KR2A 3CUQB 4BQQA 2XC7A 2MG4A 5GAEJ 2XASA 3FHZA 2LQ8A 2YSQA 4IEJA 2IGNA 2EYXA 2XUBA 2FZGB 4IHYA 1RAAB 2RHSA 3HPWA 4UUSB 4PDKA 5H20A 3M56A 5TISC 5FU6C 2M34A 4A3KJ 1YIJA 1BJZA 3CCQQ 5F1RA 5ILSA 2DIGA 2LCCA 3F9KA 2V7FA 5D6YA 4M75E 5CVJA 3N05A 2E1MB 2YUQA 5IP6A 1K78A 5CQYA 3A1YA 3JCMg 1D1CA 2C06A 1PNJA 4OB2B 4IUUA 3X24B 2K7LA 5EJCA 3WTSC 4D1QA 2EFWA 3RKYA 3FXMA 3CUQC 1WKMA 1PJRA 2V9PA 3B6CA 3H9QA 4BUPA 1IZ6A 2LK2A 2DDAA 1Y0MA 1HSTA 1MBHA 3QO7A 3S93A 4ITVA 1NJ5A 2M0OA 1Q82C 5GMKh 2CJAA 3QOEA 4XICA 3E1SA 2DPDA 1Q86U 3HTRA 2W1OA 4ZDOA 2R92J 3HOVJ 3A7RA 1BB9A 3S3MA 5IXFA 1AZEA 2D1XA 4YCVA 3SDZA 1P9QC 2EIKH 5GAMd 1MGTA 1YW9A 1K78B 2P5LC 5BQTA 3RTRA 2NVYJ 4DOWA 1JT6A 2HYFA 1QWFA 2XAFA 5IOZA 4LXCA 3SD4A 4C2MJ 1TLHB 2DO7A 2EINH 4LB6B 2W10A 4XK8E 3JB9D 3HXLA 1T08B 2PVDB 1R1UA 5E3NA 3M4OJ 5GAGJ 1VQLA 5BNGA 4MDXA 3HRKA 2RVCA 2K5CA 2Q0OA 4KA4A 1JJ8C 3IH4A 4B47A 2JA5J 1B72B 2EKOA 4IUPA 1UB4A 2W57A 4DQ2A 3LQRA 4HF2A 4BD3A 4KT5C 1FP1D 5TGTA 1X75C 1QPMA 4G6TB 3OWTA 5E18F 3OYBA 3VS4A 4GDFA 1ZAOA 3BZKA 4M3BA 4ZYGA 4ENKA 1WJEA 3K1MA 3JAMK 4OIPF 3CCSQ 5F0FA 3NTIA 2GQVA 4MIMA 1Z1DA 3ASNH 1WJFA 2FX0A 3P9KA 3RPQA 3U9GA 2LKXA 4C2UA 2CQKA 3HHGA 1T2KA 3NEUA 1WHGA 2O2OA 4OMQA 3A98A 2DYSH 2IW5A 2NUPA 3PVQA 3VUBA 3JAMZ 3I5SA 2ZPHB 2Q2EA 3QPSA 1WHMA 5FLMJ 2ZXIA 4L0YB 2QYZA 4F7UG 3A5ZA 1RI0A 1IRXA 3I35A 1BBYA 2K5LA 4FX0A 2QEXQ 3HRSA 1S9HA 2JK3A 2AMCA 2VC8A 3IQLA 2ZSHB 4KGZB 3SQNA 4G12A 1H9TA 5KAIC 2K2MA 4QTRA 3LYIA 2DA2A 2LMDA 1JKQC 1ETOA 3GFMA 4AC0A 4C8QF 1S72Q 4GXOA 4M77F 2K2VA 2EZKA 1KZHA 4H2SA 3UR3C 2O7OA 5KNNA 1ZLMA 3TGNA 2LJ0A 4BE1A 2LJ1A 2RI3A 2P0QA 4S05A 4A3FJ 2NVQJ 1SFXA 2NUTB 2ODRD 3ICAA 3IG2A 3FK7A 3CCMT 3ABUA 4H4KC 1XC5A 4M6VA 2DX1A 5L23A 3CCJA 3ZFJA 3V7SA 3RZDJ 2HL3A 3UWNA 3A5ZB 4OAYA 4N0AA 2OTLQ 3ER0A 1QNTA 4I99C 3R0AA 2BUDA 1BBWA 3WTUC 3GTKJ 3BG5A 2RB6A 3FIFA 4QKUA 2KAFA 3UPUA 1N25A 3RKXA 3JCMJ 2FMYA 3QQAA 2KGTA 1W6XA 3L00A 1M3BA 4RTTA 1AEYA 1AKHA 4S04A 1IRFA 4QLCU 2KI7A 3G71T 1Z9ZA 4RB0A 3MWMA 3CJQB 1YJ9T 1YJNQ 5CVRA 2DL3A 4UP9A 3A8MB 1WPKA 2ZXWH 4BKXA 3SZGA 3S3OA 4TVAA 3ZMSA 2E1CA 1FMKA 4A4FA 3LAPA 4EPCA 2X35A 4TWAA 1VTNC 4Y4RA 4F7UF 1RL2A 3GFLA 3QDRB 3EUKL 1SMTA 4LDWA 3TEEA 5FLXK 4MNUA 1BC7C 1JJCA 1X56A 3CBPA 3VSKA 3BPVA 5A0LA 3RESA 3BG6A 3HFZA 2X1CA 2DZCA 5FKOA 1WIEA 1VQ8Q 3CCQT 2ARUA 2CGHA 2GXGA 4Z02A 3CC4T 1XCVA 1WQ7A 1Y8QB 5F04A 3A5YA 3DF8A 4CH7A 1LEBA 1QE0A 5B3SH 3S1QJ 4V2GA 3SZPA 1Y07A 3SFIA 1SSFA 1X6BA 2Y31A 4A3BJ 1VYTA 2ZXJA 4QWQA 1PYSA 4TVAB 1KU3A 2VC1A 3JRZA 3G3ZA 4S0HB 2A3LA 3OSVA 1MHNA 1WI7A 2PU9B 3MKDA 4E51A 4CZCA 4DYCA 3G4ST 4P74C 3N97A 4H2UA 1B76A 2XAJA 4KISA 2YU9J 2CP7A 1KMNA 1Q7YC 4BHBA 2M1HA 2VGMA 2GA2A 5FROA 2RQTA 4J7FA 1H92A 1K7AA 2LREA 4XR6A 1Z0XA 4PJOB 1D3BA 1TOVA 4FT8A 5FFZA 1X1BA 1MV0B 1X58A 4B6MA 2JPCA 1VQ5I 1OCTC 3MD2A 3QJYA 5D6FA 3LNQA 5DS9A 2SEMA 4G85A 5F5WA 3IKMB 2MFZA 2W84A 2LSOA 3DB4A 4OGEA 5GAOl 3IHUA 5LHGA 4QW2A 2Q8KA 3S15J 3QOPA 1EX4A 1WQWA 2CYZB 3OB9A 2MWOA 3A8HB 3TEHB 2COMA 1NJIR 2M4GA 3O6BB 5D6WA 1NM7A 3HUGA 2DA5A 1B8IA 4P72C 3A8OB 4CA0A 5JR3A 1OU9A 4FQGA 3GNGA 4BGDA 4P74A 1GCPA 2OPTA 2K7AA 2RPNA 1O3SA 3QPTA 2C0TA 4CUGA 1TUGB 2E3HA 1KFZA 2M1BA 5GAN2 2RHQB 1MW7A 3HXYA 4UUSA 1ZRCA 2IBDA 4M9XA 4KGXB 4HDVA 4M77D 5E1WA 2NUTA 3SHFA 1YITT 2DMQA 2VB6A 5HLIA 5GAOr 4ZTJA 1EH7A 2BY1A 1NPRA 1TWAJ 3QTCA 1U06A 2MOXA 2JMAA 2EQUA 4JJBA 1HW1A 1Y39A 1YW7A 2F5CA 3HXZA 4LNSA 1ZRDA 2AHJB 2KT0A 2R7FA 2XF6A 2E1MC 1GV5A 3KLNA 3M54A 1USYC 1J59A 4OIQF 2DQ0A 2ZZEA 2BE9B 3QODA 2DZ9A 2A5WA 2OTJQ 2BZYA 2L3RA 3L7WA 1FSEA 3KP6A 2PQ8A 3AG1H 3WE3A 1OYIA 1TUCA 3CCSA 4YYEA 4IXAA 3JRHA 4YTLA 1Y0UA 3Q3SA 1R1VA 4XKCA 2A69F 4MEXF 3HRMA 2QKLB 4HRIA 2GTOA 5FU6B 1RIQA 1Z7MA 4CH4A 3KZYA 4Q48A 4LG0B 3CCRT 5HNFA 1LPLA 1G3YA 2LY1A 2E1OA 1ZREA 2QBYB 3BT9A 3S2WA 2AHQA 5E3LA 2E70A 2FPFA 2XIDA 2K3FA 3JW4A 3DBHB 2DRKA 1ZUKA 2P8TA 3OL3A 1LPQA 1B4AA 3F70A 3OQ5A 3PMIA 1OQKA 5GJWB 2VJ5A 2RV8A 5K7ZA 1VQ7A 1G2BA 2RN7A 2CQQA 3GOXA 1E7OA 1I27A 5B5EC 2P4RA 4M9SA 1HW2A 3JCMQ 1WHLA 5GAN8 5KYUB 2HQ5A 2BYVE 4CGZA 3CO7C 1I8FA 3R6SA 3HXWA 2KP6A 1FJLA 2JSCA 1UG1A 1WLEA 3FXOA 1S5LC 4WK8F 4AIHA 1QVGP 3DP7A 1X54A 2VT2A 3NQOA 4P96A 3KZIC 1XGSA 1SFOJ 3CCLQ 3MEVA 3ZMTA 2RHZA 4F93B 1MBEA 1VQ5T 4TVRA 2EBIA 3VBBA 1QA6A 1TTHB 5ICGA 2C0IA 2JTMA 2LNVA 3DLMA 3HOXJ 4E7KA 4MDWA 2VLAA 2LVMA 1VQ7Q 2M0MA 3CBOA 2VXDA 4ZZLA 3RZOJ 1VQKI 3HSRA 3PFIA 5HDGA 4V2SA 3RKQA 3QNEA 4LE9A 1U78A 2VJJA 2RHYA 2XG8D 1AZGB 3PCOA 3PIPA 2UV1A 1R22A 3QYEA 2HTJA 2XPVA 3MAJA 1NNHA 4EQQA 2V1RA 1SVOA 1UCRA 1DDNA 5GANj 3C7JA 2WAEA 2D1VA 3E6CC 3EGDA 4RTUA 1WQ2A 4ATOA 2GAUA 4FM4B 1N27A 3E5QA 2FNAA 2DPUA 3WHBA 2JA7J 4WF2A 3I59B 3TEGA 3PTAA 1B70B 2EH3A 4AM3A 5E8GA 1QWEA 1T95A 4W97A 3MZHA 4ABZA 2GGRA 1Q7YU 4KQEA 2FB7A 3CLQA 2X48A 4M78E 1W5TA 2M9UA 1YYVA 1R6RA 3L1PA 1YNZA 2AIRB 4LK0F 5GANh 1E17A 1MIJA 3JCUC 2DBMA 3U2RA 1WI9A 1J2XA 4UB8C 4ESFA 2YUPA 4EMSA 1UJYA 3FMQA 2G3RA 3QXEB 1KG1A 1YI2Q 4P71C 4CO8A 1PRLC 1JJ2S 2MYSA 3LFUA 3H0FA 5FKNA 1OULA 3FMSA 3RSNA 2NS6A 2IJLA 2AK5A 2R5AA 3T9NA 4RCCA 5LJ3g 2HQRA 2GZWA 2TDXA 4M75G 2UXXA 5GMKe 4M78B 3RIRA 4DOZA 4C0DB 1VQMQ 3NWSA 3DPLC 1YOVB 2EA2A 3CC2I 2WBMA 3OIPA 3H0DA 2VBZA 2LNHB 2X6XA 4XU3A 5GAMh 1XMKA 2DYIA 4ON0A 2E12A 1QKWA 1E6HA 3L42A 4NQWA 3VYRB 4BL0B 5LEKA 1QGPA 3BR0A 1JRIA 2QGFB 1IHVA 3ZQLA 4BI4A 1Q81C 1TWFJ 1NK3P 4YRRA 1T0HA 2ABLA 2HXIA 1FIAA 4LG0A 3VS1A 4A53A 4PZJA 2J3LA 4RQEA 3GZ5A 2DOFA 5LEJA 1B7TA 2CZ6B 1QU3A 2JS2A 4OWRB 4P5OA 4L9TA 5C44J 1YHQQ 1SHFA 1YHQI 2BVMA 2W82A 1IN5A 4C9YA 2HNIA 1TW3A 4Z8AA 1LYLA 2H3EB 3QZ9B 2DD5A 3ZQCA 1R49A 3GBQA 2ZZGA 1AT1B 1W36C 2AXTC 3I5UA 1S7EA 4DIQA 1NLPC 2P0WA 3AHUA 1JHFA 2L8DA 2MD5A 1JQQA 4KUMA 2L9VA 1D1AA 2VKHA 5C4JJ 2AXLA 1G2HA 3FB9A 2DXTA 3I4PA 5D5XB 2ZO4A 1LB2A 4EVIA 1DU0A 1C0MA 5KCMA 4HKEA 2VQLA 2PFBA 1VQ4I 5FWBA 1UEBA 2P4TA 4C92D 3ZR8X 5LJ3j 4JJNK 3BWGA 1M8VA 2GOMA 1MZBA 5GADJ 4C92E 1V54H 2LRDA 2W48A 3JRDA 4LN2A 2G4CA 2MSYA 4WXDA 1C1AA 3CCJT 2FSWA 2P6TA 2I4MA 1KSWA 4K88A 4YCUA 3OMGA 3BJOA 5GAMf 1S72T 2NS8A 2M5WA 4MTDA 2LCLA 3OYMA 3ZQFA 4RG8A 3M3YJ 2Z16A 4MZTA 4NHJA 3FXJA 1B34A 4M75D 1TWHJ 1MMNA 2ELJA 2OCCH 1H8KA 4RLQA 2DA1A 5K5RA 4U88A 1X01A 1PKSA 4RTYA 4CXFA 2NWMA 5AT1B 3DTEA 4JYKA 5LD2C 1PUEE 3LSKA 2DFFA 4QQDA 2ARSA 3LSSA 3CC7I 1B70A 4FYWB 4X0GA 1VQOT 1RI9A 1V1CA 2M7BA 3P8VA 2KXDA 2NS7A 1XTAA 4ZYDA 1DPUA 5D4RA 3F8BA 1YJWA 2O9LA 2EGAA 4HWPA 5HDKA 4RDXA 4A54A 2EIMH 4IRHA 5M5YJ 1K83J 2DYRH 3FDRA 1Z77A 4QPOA 2WSFE 1VQLI 2L02A 5HKCA 3PO3J 5KCHA 4JX4A 2PLYA 2HBWA 2VOPA 4UHTA 4M78F 1EZZB 1KIKA 4CZZA 3VDXA 4D5CA 1YBYA 1XDUA 1FLIA 2G7UA 4IIOA 4N9IA 3WU1B 3V4GA 1H88C 1C6VX 2HOSA 5KE3A 1ULYA 1V3FA 2D1HA 5TJJA 2A28A 2EIFA 1YLFA 2JOYA 4Z89A 5F0HA 4M78A 1I5OB 1BI2A 1QQIA 3TO7A 3VOEA 3P9CA 4P71A 4FHTA 1UHFA 1VQOA 1Q7YR 4NL2A 5F6FA 5JVTA 1TQIA 1GUUA 3J80Z 1WX6A 2LBFA 2RF0A 1IN7A 4FCYA 2ZKZA 1WXBA 1W2BP 2GXBA 4B43A 4II3A 3HY1A 3BTIA 2A37A 4OB3B 1M90R 2KQRA 2ZINA 2Q7HA 1UHWA 1JUPA 2OQGA 1YWOA 2PUOB 4J83A 2QTXA 2KIUA 2PJRB 2FOWA 4HX4A 3BY7A 4L9NA 4IHWA 1ODDA 1V76A 1JTXA 1LNWA 2EV6A 2HDAA 1VZ0A 5E79C 4BEHA 1B07A 2KMUA 2BGCA 2PMZA 2K9GA 3S17J 3WTYC 3EHRA 4XTZA 1PP7U 3OYIA 4J9IA 3QDFA 3ROUA 2EQJA 5L8RE 3GYHX 1GHCA 4HCKA 1U6GA 3EGUA 1SD7A 3I56Q 1KC8C 4H2YA 4KR3A 3P8DA 4YRPA 4Z2YA 4M78C 1DJ7B 2HPMA 4GCVA 2P0LA 1D5YA 4I0BA 5IHIA 2QLZA 4M7AF 3M1CA 3FISA 4X1VA 5CKEA 1EF4A 4A3CJ 1X55A 2RA2A 1AWOA 3GFJA 4DJAA 1VQ5A 5C52B 4EMKA 2HKXA 1K73U 3UH0A 2DE0X 3CP2A 3CCMI 1Y56A 4XKVA 2FRYA 2RNGA 3LLRA 1I5ZA 4HWTA 1FMWA 1H4QA 3I56T 3OD1A 1YW8A 3GTPJ 3U21A 2IS4A 1PUFA 1USSA 1Z3XA 2EGCA 2UUZA 4RCBA 2TRTA 2YX4A 3A4CA 1VQ6I 3EH2A 1YI2A 2QF7A 4HBLA 4CCNA 4Y13A 4KIBA 1YB3A 3WE2A 4M75F 3OOPA 5J39A 2P4WA 3WGIA 2QDLA 2VJIA 2R3SA 1R36A 5D8KB 2HKNA 2LLKA 3WVDB 2FBIA 3CCRQ 1RUOA 2E6NA 1VQKA 1PM3A 5CKDA 4XQFA 2FRWA 4DBHA 4QIWN 2NUZA 3KLOA 4EJWA 2DILA 3KUFA 1ZSGA 2DOAA 4ORZA 2E3IA 3MHXA 2EK5A 12ASA 2CW8A 4XLCA 3AT1B 3ZQQA 3J7ZI 5FKKA 5C4XJ 2HZYA 3BE3A 2FQ3A 1ZARA 5BS6A 2COZA 1YRNB 4AMCA 1VQNA 2VONA 1R7JA 1YJWI 1G3WA 4YIRX 3MP1A 2HOAA 2OJ2A 4RTXA 5ELOA 4KJZA 3FXUA 2NVUB 3HRUA 4LDVA 4RG2A 4KH1B 3A02A 2FHDA 3TSZA 1KD1U 3OSFA 2KRHA 3IRRA 1LVKA 3CP8A 2PVGB 4LMYA 3HOYJ 4BI3A 4L5JA 4B1RA 3F23A 1BJAA 1SMYF 3LWIA 3G71I 3ZGKA 4A3IJ 3OMYA 2IEKA 1H0MA 1SEMA 1WHKA 2H8HA 2PMHA 3R0JA 5M3FJ 4A3EJ 2HSEB 3CCST 1VQ8T 1K0SA 4ZH4F 2DOEA 4LB5A 3CCET 4AIDA 2RJEA 2KROA 3UGTA 2EYZA 5D6XA 2PN6A 2P7VB 1PWTA 4JJCA 2H8WA 2IGMA 2L4AA 3OYYA 5EG0B 3C1DA 4AH6A 4LD5A 2DMOA 4DOVA 3A7AA 4J19A 4J15A 2CO5A 1WXTA 2PX9A 4HX7A 4HCZA 3WODF 2RQQA 3DV8A 4IJAA 2OQRA 4EM0B 5DD4A 1MMSA 5CVIA 3ZMUA 1G4DA 2FYKA 2XU8A 3F8FA 1NG7A 4PKCC 1U1SA 3HRTA 3URGA 2BZ8A 4ANJA 5DCFA 5TRDA 3I4MJ 4UVAA 3HOWJ 1KOGA 1MH3A 4XLPF 5IPAA 3GLXA 4XLAA 1VQ7I 4BB7A 3A2KA 2OI3A 3VS6A 4HCCA 1KK7A 4I09A 1W4MA 1Z91A 2WY8Q 2ZJ2A 5LL6S 1J5YA 4LG3A 2YUOA 4JJDA 1M1KC 2DL7A 1RLPC 3SYTA 3DLLA 1PC0A 4CS3A 3SEQA 3S1MJ 4C0ZA 2YRVA 1X2GA 3HFZB 4LLNA 4TQDA 2DODA 1ETVA 1VQPI 1TBXA 3OL4A 3ABLH 2IP2A 3RI4A 3FF5A 4XKWA 2R7SA 2E5AA 1IN6A 3LSPA 2X4WA 2NOGA 2UWMA 1A36A 4LNPA 4Q5SF 4M9ZA 4XAXB 5FLXZ 1D8KA 1H3HA 3TUPA 4BJ5C 4D8DA 3CBMA 4NOYA 2DBKA 2ISZA 4ENMA 4G7OF 4BY6B 1UJ0A 1Z7UA 3K1PA 1QVUA 4HVWA 1W2BS 2DTOA 4OGCA 4FU6A 1T56A 1E2XA 1M3AA 1EA3A 3QHSA 5GAN7 1FYMA 1J75A 2E5KA 4OP0A 3I55Q 1WFXA 5JLXA 1Y1VJ 4I01A 3M0RA 3E5UA 4RBOA 4EMKB 1G5VA 1GXQA 2DL8A 1YWPA 3J80E 4YREA 1I1SA 2K9LA 3H92A 4HSRA 1XMXA 2JPBA 3OYDA 2K3PA 4F55A 4LGWA 1YI2I 2X9HA 4M77G 1VQ6A 3BCAA 3UDCA 4L9VA 3WHCA 3D7SB 3PQKA 3MP8A 4C8QG 3HDDA 4HQEA 4XRSG 2V8JA 2BE7D 4N4GA 3OS1A 1SD6A 1PUFB 3EFRA 3UA6A 5GAN3 2E3CA 4E7LA 3HZJA 3G6EQ 4C92B 2DEQA 2WADA 4BH9A 2ZT8A 3HOZJ 1QW1A 3E9IA 3FXKA 3HTZA 2VBXA 2LVSA 4FE4A 3ECOA 2J5PA 2FZCB 2OA4A 2OTJT 2QKMB 4EGZA 4EJVA 1W7PB 3CMAQ 1YFSA 3BR2A 2F5VA 2NAZA 2B9SA 4FW1A 2ZR2A 4NC8A 1IGUA 4M7AC 1V55H 5L3CA 3CMEQ 3EG9B 1C0WA 4ZDPA 2DIQA 2ZNJA 1OPLA 3TVTA 1WH7A 2XAHA 1YN8A 5FKMA 2RI2A 1I6HJ 5IHNA 1VQ8I 4HEA2 1VQ6Q 4MFEA 5IP7J 1Z3YA 1S7AA 5ICFA 3G6ET 3NPFA 2QM3A 2HDCA 1V4RA 5D5UB 4OLFA 3HIFA 2J5OA 2JVHA 2E2JJ 1WHJA 3LX7A 2DA7A 4XM3A 4H2TA 4UP8A 2A5YB 2JWTA 2O61A 4KULA 4NCXA 4FETA 5DEQA 3I4NJ 3K4LA 2COBA 3H5AA 4OMZA 4DW6A 1T38A 4BJ6C 4YFKF 3LA2A 4X34A 5FO5A 1PG5B 1U5TB 1TNTA 2NNYA 3DEUA 1VQ8A 3QPHA 1REPC 1WU7A 4Y33A 2DK5A 2DXCA 4CCLA 3JB9H 2Q2EB 4UY8I 1TU0B 1WJDA 2K5IA 5F0CA 3GTOJ 2DO3A 1T0FC 2PZ1A 4JZ4A 4XTYA 3THKA 2IS2A 1WJRA 1XSVA 4OMYA 1QCFA 4RUGA 3E7LA 2DM1A 3X28B 3ESWB 3OYHA 3J81E 2LNBA 4E70A 4IVNA 4OMNA 5LJ5j 5IOYA 4RLFA 3CCLI 1XG1A 4LUEA 3JCMW 3G1OA 1JI8A 3BR3A 4N0BA 3PM1A 4XQ3A 1OCCH 3VWBA 2R5ZB 1ZRFA 4PGHA 4YG2F 3IP4B 1YIJT 2DVEA 1VI0A 4HWSA 4BEHB 4U0VA 5EGOB 4JX5A 3OOUA 2H1KA 1BU1A 1GGMA 2EB7A 4JRKA 2MLGA 3I9QA 1SG5A 5KE2A 3KX2A 1FY7A 4YELA 1W4SA 3C95A 2EYWA 1R77A 2CS7A 2CREA 1IREB 3OY9A 4DYQA 5D5WB 3DLAA 1OMIA 4GLKA 2VE9A 3HL8A 2ROTA 1R0CB 3OSSC 4WTOB 4L18B 4X1EA 1UDLA 2KT1A 1YIJQ 3MPUB 2I4LA 1UUEA 2EVRA 2LY2A 1SETA 4EATA 1TXQA 3CCQA 2CYYA 3L2VA 4AYBA 3SFZA 3IKTA 4M7DE 4XTXA 1M1KU 1SHGA 4G6DA 4CS2A 1GV2A 4M74A 5CVUA 2OTLI 3KP4A 5L3EA 1HLVA 3UNGC 3CCEA 2RHXA 4OU0A 4JLGA 1VFCA 4PLIA 3JCMc 3K4KA 4A3LJ 5GMKl 3PCOB 3ZQHA 1M30A 4HQMA 2YLCA 3KIOA 1A5JA 4RMOA 3K10A 2AQEA 2JZYA 2QSHX 2WACA 1VOMA 4IIMA 1RI7A 6AT1B 3BTJA 3FXRA 1HDDC 2DFUA 3OW2A 1L0WA 2IVMA 4YRMA 2QQ8A 1LKXA 4O6JA 2X4HA 3CCJQ 5DLOA 2W24A 3MZ8A 2STTA 2M2EA 4RTWA 4J00A 3UKGA 2HDWA 3I9V2 3U23A 4F17A 1KHIA 3JSCA 4FW2A 1E6GA 3TKYA 3TDZC 2BZXA 4XN3A 2A8EA 4G7ZF 2XSDC 4EJOA 1LUJB 2PVOB 2BY3A 5LJ3d 4C8QD 5IHKA 1H641 4QQGA 2CFXA 1HKSA 1MMDA 1PP8F 2WAFA 4U7DA 4C3HJ 2STWA 2IXSA 5FFXA 4V19K 1AWJA 3CCUT 3M4GA 5K5OA 1TWBA 3REBB 3M1EA 4OIOF 2EZIA 3LSQA 4IOAF 2JNGA 3JCMh 2LCSA 2LC4A 3ZPLA 1U9NA 4M7AA 4PUSA 2LTPA 4HNVA 4GFBA 2KIMA 1P4WA 4FL6A 5CKBA 3JB9I 3CCUA 4HT4A 5GANg 1K4TA 1R4NB 4AUXA 3VYUB 2KHMA 2JN6A 4MTEA 1OLTA 1S6LA 1IO6A 2VYTA 2HGCA 4Z88A 2VC0A 1J0RA 4P75C 1UG2A 3QSUA 2MGQA 3BZCA 3WG9A 2OZ6A 3IV5A 1JT0A 2W00A 2XGCA 3NHNA 1YJWT 3BJ6A 5FU7C 1H3ZA </