3RKXA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
308
Chain Sequence
b'KYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 99
structure length 308
sequence length 321
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkxA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkxA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkxA02
2HR3A 3C18A 2ZMEB 3FXRA 4LJZF 3GFMA 1KU2A 3DFGA 4A53A 3BY6A 2FRHA 1K78A 3NQOA 4J15A 4YFXF 3ABTA 4KN4X 3JCMd 1I5ZA 1ZYRF 3GZ6A 3L2CA 1S6LA 5E1XA 1O7FA 3ERRA 2YHTA 1EQRA 2CFXA 1P4AA 3IWZA 1KA8A 5GANj 2XTIA 4CZZA 1IAWA 4PNOA 3GFIA 4M7AE 3JCMX 3T1BA 2HZTA 3V8LA 4RCBA 3F6VA 4HWRA 4KFCA 4HA8A 1IRFA 3CJNA 5HDNA 3L9FA 3FXUA 2QUFA 3E6DA 4A0YA 3RJPA 4TV7A 4YIIA 1UFMA 1PYSA 3TQNA 5H6QA 3V4GA 2Z9OA 1W5TA 1SD5A 3IKMB 2EV5A 2OA4A 1YFHA 1B9NA 4PJOC 5LGNA 4HF1A 2R7FA 1KQ9A 2O03A 3HFZB 4A5NA 1MGQA 5HDKA 4ENKA 1R1TA 4YRSA 3R07A 4YRKA 1RUNA 1V3FA 1YTYA 1L0WA 1HK9A 2HWVA 3BPVA 2C6YA 1BBUA 1Z6TA 5FD6A 3HXVA 3JAMZ 4MTEA 3OOPA 1KU3A 2QWWA 1W7PA 3J81Z 1P4XA 2UWMA 3QPHA 4ZZDA 1M5Q1 5GAN5 3F72A 2HKOA 1B6AA 3CUQA 5GAOp 5DCMB 4M77C 3K2ZA 4L9NA 4HLXA 2Z99A 4MQVA 5K1YA 4YRCA 3BJ6A 1ASZA 4A12A 4TQFA 1FYMA 5FD5A 1UCRA 1HC7A 4U7DA 2H27A 2P4WA 4HDUA 1M8VA 1YO5C 2CGPA 1Q1HA 1FY7A 4P3OA 1TQMA 1R1UA 2A3SA 4RS8A 4WXDA 1WWXA 4N9HA 1I1GA 3WTTC 5H20A 4C8QC 5K5RA 1G4DA 4QVCA 3SWNA 2A6EF 1YLFA 2QQ9A 4Q4ZF 5E1WA 2L4AA 3B73A 4YFKF 5ELOA 4AH6A 1TTYA 5DYMA 2ALYA 4H2VA 2FYKA 1ODDA 3QO7A 5CVIA 4L9VA 2DQ3A 1P92A 3S2WA 3H92A 1I27A 2JZYA 2O8XA 2P7VB 4M7AG 2ADUA 1FBUA 4H2UA 4RGRA 4IRGA 3MCZA 4L5IA 2M87A 4M7DC 2XAGA 3D5LA 3F23A 2DI3A 1B1BA 2HKXA 2TDXA 5DD4A 1IXSB 2KIMA 5GAN6 5A2QZ 2GA2A 3VBBA 1TLHB 3F8MA 5E8GA 3J80Z 2EB7A 4A6DA 1XCBA 1NJ6A 4TVAA 4WF2A 3WTVC 1J7KA 1O3SA 4PDKA 3I59B 3R0JA 2F2EA 4NQWA 2GQQA 2KIUA 1ZRCA 2DKGA 5GAMf 3LSTA 5LJ5e 3I71A 4HV6A 3WGGA 2J3MA 2PMEA 4U7BA 1JGSA 1S3JA 5ICEA 1ZLKA 3LSQA 3MZHA 1JE8A 5GANg 4TVWA 3ABUA 3ZP5A 1ZN2A 3IL2A 4Y91A 5HOOA 3ZN0A 2QYOA 2UXXA 3RDIA 1F5TA 3K1MA 4XLNF 4UV9A 4G85A 2QQAA 3I5UA 3HRMA 1JHFA 2FA5A 1I1SA 3EUHA 3HTUA 1BC8C 1PP7U 1T38A 2X0LA 2ZT7A 1ZAOA 3P9IA 4A5MA 1LYLA 4OIPF 2I4LA 3DKWA 1ZHFA 3FWEA 4YP0A 2EL9A 4HDVA 2VBXA 4I7HA 4P75C 4ZYEA 4NL3A 3WODF 4UNOA 3E6CC 2DVEA 3FMSA 2IY5A 4KIFA 1I4K1 3W6JB 5DY9A 2A5YB 3RIRA 3REXA 1B34A 3KE2A 1XSXA 5TRDA 3TEHA 1SFEA 2XVCA 1EH8A 4H2TA 3V7RA 2BYVE 3O6BB 1MJ9A 4EM2A 5DDGA 3HY0A 3ISPA 5GAOq 3L1AA 1UB9A 2P0LA 5CVRA 1KU9A 1ZRFA 4H2XB 2XKPA 3A5YA 2GIVA 4F7ZA 4RB1A 1TH7A 1U1TA 1AWCA 4L5JA 2MH9A 2H6CA 2MLGA 4P74C 4YIFA 3R61A 3OV8A 3RF1A 4L9JA 5F64A 1I5LA 4BXUA 4ZH4F 3IKTA 2VE8A 3WTYC 4V2SA 1XSDA 4WI1A 3JSOA 3RKWA 2YX4A 1J5YA 3BDUA 2MLKA 3LQRA 3TO7A 2P5LC 3GWZA 1LJOA 2GZWA 3RI4A 4M73A 1S7OA 1BIBA 2XUBA 3HYIA 2PQ8A 3F22A 2H94A 3GEZA 4WXHA 4XSZF 2UXNA 3GYHX 5KNNA 4U0YA 3G73A 2PMHA 4JBAA 5GAN2 3HRSA 3E6BA 3IRQA 3CLOA 4KT5C 1KQ1A 4YCUA 3GFLA 3HSRA 1U2WA 2XAQA 2CJBA 3UGQA 3VODA 4C92D 1X55A 3H3ZA 1XMKA 4B8XA 1WNLA 1LB2A 1YB3A 2XRNA 3WTZA 2EA4A 4TTVA 3ULQB 2DPDA 2C7IA 4ENJA 4TQDA 2ODRC 3RYRA 3HRTA 3TO9A 3HRUA 4U88A 2EJ9A 4J5YA 2JPCA 1MGTA 3RYPA 4KDPA 1WQWA 2IRFG 1Z91A 2RHQA 3MWMA 2KRFA 3ZMUA 5LGUA 2EFQA 4NOYA 1DPUA 1ASYA 4IHTA 3MQ0A 5LJ3j 5D4RA 2M45A 2E5AA 3I64A 3M4GA 1MDMB 4YRNA 3HFOA 4PCQA 2G4CA 4AVPA 2A07F 5HDGA 4G7HF 1XGMA 2D2WA 4EJUA 4PJOF 1SESA 5BQTA 2FF4A 3JB9I 2DPUA 1O57A 4P9UA 3J7AO 3G1ZA 3JB9F 4OOIA 1FP1D 2HQRA 3GUDA 4C92E 2AKWB 5ERIA 5GAMe 2FMYA 1OYIA 2ARSA 2BBYA 2A6HF 3QU3A 1ULYA 3EYYA 2VC0A 2IA0A 1KYWA 4G7ZF 4ZYGA 2ZT5A 3REUA 1S8NA 3ZQ7A 4JLIA 2V79A 4M77F 5HS7A 1EOVA 4M6YA 11ASA 3WGIA 4LG0A 3KCCA 2WV0A 4A2UA 4PJOA 1H4TA 2P6TA 4MQ9F 1LVAA 2RN7A 1L0OC 2DZ9A 2J3LA 1USYA 1G6NA 2M8EA 2ZTGA 2VOOA 3MAJA 5GMKj 1NJ2A 4AIJA 2K86A 1H9TA 4C8QF 1B70B 2PN6A 2RM4A 3KEOA 3HFNA 2EFNA 4BNCA 1G3WA 2K4JA 1G5IA 1R23A 4MMKA 1U6GA 1YCYA 1C0AA 4BYYA 1SFXA 3V8KA 2P5VA 1EFWA 1YW7A 4H2SA 1FNNA 3IRRA 2XHKA 3L00A 4HQMA 1HKTA 4M77A 4IRHA 3LQQA 1ZG1A 4UPAA 4O3MA 1WSUA 2OQGA 3HXUA 3SXYA 4MTDA 5ICCA 3HSFA 3F6OA 5GMKl 4UHTA 3SB2A 2J5OA 1ZREA 3BW1A 3DF8A 5L3GA 12ASA 4M7DF 3JCMQ 3F8BA 1X2HA 4P3NA 3EFRA 3KP4A 1DPRA 4C8QA 1NJ5A 4I02A 4R8HA 4L9TA 2K7LA 1HSJA 4RGXA 1K78B 4I98B 1ON2A 1KMNA 2I4NA 4RB3C 4XRFA 3JCMb 2XIGA 1E1OA 4DNCA 1Z6RA 2P5KA 4RCCA 2D1VA 2DTHA 2W24A 2XAJA 3QU6A 4G7OF 1ZGAA 1HKSA 3VOEA 3ZMDA 5LJ5h 5CVJA 4IRIA 1IL2A 2FNPA 2M30A 1X01A 4Z2YA 3K1NA 2ESHA 5GAOr 2B0LA 4IJAA 2DT5A 3JCMP 4NCXA 1SMYF 3FM3A 1BI0A 2IT0A 4A6EA 1MJAA 4C92G 5GANf 5BOXA 3ICAA 4H2YA 5E3IA 3JB9J 1BM9A 3BZ6A 3DSQA 2E3CA 2JT1A 4F7UA 2ZO4A 2HNIA 3C1DA 4QVDA 3JCMW 4I01A 4N9IA 3TDZC 5I21A 2KIFA 1F1ZA 4ZYHA 2HYGD 1LDKB 2DO7A 2RA2A 1F9NA 3HSEA 4ZTZB 1W7PD 1HTTA 5LJ3g 3TOAA 4M78C 3KLOA 3I0TA 4RQFA 2K02A 3K0LA 2P8TA 1QNTA 2EFOA 1SAXA 1Y96B 4YRLA 2ZIMA 5IT9Z 4P3PA 4BHCA 3W6KB 4UP8A 2V1UA 1FP2A 1D5VA 3LA3A 2EK5A 4NB5A 1W7PB 5LJ5d 3GIBA 3HHHA 2Q7GA 3V8JA 1E22A 3CO7C 2FQ3A 3RPQA 3FXQA 3TGNA 1KGSA 3T8RA 3JB9H 2F5EA 4KA4A 4LK1F 3IWFA 5D6FA 1LJ9A 3Q5FA 1W66A 2QLZA 2CW0F 1NYRA 3ML6A 1XGOA 4P75A 5E17F 5ICGA 3WE3A 3KETA 4HF2A 3RACA 3CDHA 4GYGA 3HXZA 2E65A 4XU3A 1YFTA 1MZBA 1T2KA 4EGZA 4PHCA 3O3KA 2RD1A 1XSVA 2V9VA 4EMKA 2ACJA 4S05A 1Z05A 2NYXA 3ERED 2X4HA 1YW9A 2FBIA 2UZKA 3A7AA 4JRKA 4M75C 4YRTA 2QBYA 4LLNA 5BS6A 3SZPA 4XU0A 1XDSA 2P7CB 4I09A 3RKXA 4XTWA 5JI6A 1ZLJA 1GXQA 4WX9A 2Z5UA 4M72A 3HXWA 3PQKA 1U78A 5GAOl 4YDQA 4P74A 3GXOA 5IT3A 3ZMTA 4FX0A 4EO4A 3INZA 3RKYA 2DK8A 2VBWA 1VQZA 3CO6C 3ECHA 2NRAC 3VQYA 1T6SA 2EA2A 3G3ZA 5EEGA 2VODA 2VBYA 4ZZLA 1B7YA 4LFUA 3RPUA 2P6SA 1FT9A 2VC8A 3NEMA 5TJJA 5DUKA 5F6FA 4E70A 2QHVA 3FX3A 2XAFA 4I0BA 4OIOF 3A7RA 2QQBA 5LEJA 3E97A 2K27A 2P5IA 1NJ8A 1T98A 3MZYA 1U5TC 4S04A 2DQLA 2MBFA 6PAXA 1IN6A 4GXOA 2ZNZA 2IP2A 1U3EM 2VXFA 1J0RA 1D3BA 4P72A 3ROUA 1TQIA 3E5QA 4KMUX 5LGTA 2J5PA 3V7SA 4YG2F 2E10A 5FFXA 4HF0A 1CGPA 4CICA 1ADYA 1HQCA 2DU5A 3M8EA 4KUMA 5GAMh 1XD7A 3RTRA 1WKMA 2JPBA 1FBQA 3ZPLA 2HOEA 1H4VB 4KIGA 3PCOA 2OZUA 4BAYA 1TNSA 4DQ2A 1FZPB 3MF1A 1NYQA 4RB2C 1TW3A 3QOPA 1EV7A 4RAYA 1DP7P 3HFVA 1B34B 5GANe 3O2PE 1KU7A 5BMZA 1OYWA 4BWAA 4IVNA 3TEHB 4KNYA 4J6WA 2ELHA 1WLEA 3M4PA 4BHPA 1BIAA 2Z33A 3JCMg 4CH4A 1SFUA 2D1HA 2VC1A 4WK8F 2EJGA 1IN4A 4KIBA 3TUPA 3BP8A 4YROA 1IRGA 4P71C 2ISZA 1AOYA 1V4RA 4RDXA 3F21A 4UP7A 3TEGA 1R58A 3VB2A 1FWZA 1IW7F 2WWYA 3ZMVA 1FYLA 4M7AC 4ON0A 1X54A 3L4GA 1IN7A 1H641 2E7XA 3CMQA 3IHUA 2QVOA 5GAMd 5BPIA 4M9SA 1KYZA 4ZYDA 4YRRA 5LHIA 4RAZA 5CVUA 4UP9A 2CQKA 5LHGA 1BOAA 2ARTA 4QLCU 3KP3A 1SMTA 2STWA 2HYFA 3GX4X 3NEUA 4LLLA 3WU1B 3JCMc 3KFUA 4R79A 3KEQA 1C0WA 1W5SA 4U0WA 1BI1A 3LSSA 3HIFA 4I0AA 3QUIA 4K86A 3WQZA 4BQAA 2ZIOA 1YFRA 4HZFA 1IXCA 1G5HA 3I58A 2CSOA 2V1DA 2CO5A 2MH2A 4G6DA 5E1ZB 3UGTA 1PUEE 2ZZEA 3HTSB 1BBWA 2DTRA 1QGPA 3BY7A 4EJTA 3KP7A 2ZJ2A 2AMCA 3T8TA 4YREA 2QHTA 1YS6A 1R1VA 4P5OA 2FOKA 1RUOA 2OBPA 5EEHA 4ESJA 4GGGA 3QPTA 3ZN1A 2RHQB 3P8YA 1H4QA 5LBQA 1K6OA 2DJZA 2W25A 1E17A 3E6MA 4E51A 2ARUA 4IPAA 2QM3A 4M6XA 1B8AA 2HQNA 2EJRA 3F3XA 5LJ3f 4LD5A 3N4MA 4HQEA 4IXAA 5ED4A 3COAC 5GAOn 4M78F 3Q9SA 2E1HA 2HDCA 3VQXA 3E5XA 2AS5F 3VQVA 1ZH5A 4EMGA 2XV4S 4CXFA 2EV0A 2H6BA 5FO5A 4UVAA 2R3SA 3HOTA 1KQ2A 5L3DA 4H0EA 2MD5A 4XTXA 4PJOD 4HW0A 3RL6A 2G9WA 1IN8A 3MF2A 1CF7A 2E1NA 1IZ1A 2FBKA 2XROA 2DU9A 4C92B 3K1PA 4IF4A 1GXPA 4A54A 5E8IA 3IKLA 1H4SA 4JQFA 1ZRDA 1JJCA 1HSTA 1Z7UA 1QE0A 3UFGA 4XBFA 5FLXK 1H9GA 1HW1A 4LG0B 2EFWA 2RGVA 2FBHA 3P7NA 4M78A 3TDUC 3LC0A 3A31A 1EVLA 4KQEA 2Z3YA 3A5ZA 4M77D 1WPYA 2ZR2A 4IHSA 4GCVA 3VEPA 3Q9VA 5LLQA 1STZA 3FIFA 2ESNA 1D8JA 3KLNA 1MKMA 2ZFWA 4AD9A 1A04A 2A61A 2ZCEA 5LRSA 4M75F 1Y0UA 2WC2A 2ISYA 2JSCA 2VOPA 3SQNA 2K4BA 3BJAA 5D8KB 3T5XA 4C8QD 2Y90A 4QWQA 3C7JA 1P2FA 3WU0A 1VTNC 2QHSA 1B76A 3JW4A 4LB6B 1MD0A 4KICA 5GAOm 2YPRA 4H2WA 4ASNA 4PJOE 4JRIA 2Q0OA 1S29A 3TOBA 2ZZFA 3IG2A 1U8RA 3P8VA 3PQJA 4CH3A 4M9XA 4CDGA 1YFSA 1NNHA 5JHUA 1SERA 2RV8A 4RMFA 2DQRA 4C8QB 3F8FA 4EX5A 2ZBKA 2FNAA 5HLIA 3V7CA 2Q5HA 2OQRA 3GO5A 3PZCA 1PDNC 2I4OA 1RIOH 1WI9A 4M75A 2L54A 1I8FA 1B59A 5AIQA 4M77E 1ZGJA 4NL2A 2NS0A 2DK5A 2ZNIA 1QF6A 3C3WA 2YLCA 1ONVA 3I54A 4LB5A 3E9IA 1K7AA 2ZINA 5FB2A 4FHTA 1TBXA 4AWXB 4TVYA 2RB6A 2CIMA 2XGTA 5ILUA 4LGWA 4MNUA 2PMUA 5DV5A 1YS7A 4F7UB 3MEXA 1QZZA 2FE3A 2AKWA 5FGMA 4EM0B 4ETSA 4OP0A 3AHUA 5DD8A 2CWEA 4C8QE 1H0MA 1TNTA 3E9HA 2XAHA 4K2EA 4YFNF 3QP5A 3HY1A 1TQPA 2LKPA 1R22A 4A0XA 3BJOA 5CVVA 1XN7A 1EIYA 2PFBA 2ZT6A 1REPC 4EJWA 4KN7X 2HGCA 5HLHA 3QP6A 2KJCA 3HXXA 1N9WA 1G3SA 4BW9A 2DQ0A 2LNBA 4HT8A 1IF1A 5GANh 2Y75A 5HS8A 4X9DA 5CLSA 1BI2A 4CS4A 4G6QA 2YR2A 1FYKA 3WG9A 2ZKZA 1N9RA 5D5VB 4RGUA 2JRTA 3VQWA 4MGRA 2IA2A 4F7UE 4M7DE 1U5TA 2W84A 4PGHA 4CS3A 4KR2A 1YQAA 3JCMf 1T0FA 5D5UB 2BGCA 2QENA 5D5XB 3D0SA 4M7DA 1LDDA 4LK0F 4XTUA 5GAN8 4A0ZA 4LMYA 4UV8A 2H09A 1K79A 1PYSB 1X56A 4CYDA 5LJ3e 2VT2A 3WTSC 4PJOG 1J75A 2NNNA 5GAN4 1S7AA 3SHFA 3JAMK 3QHSA 4UVBA 1J5WA 1BJAA 3WGHA 3RGLA 1LNWA 2Y0MA 2RVCA 1FC3A 1OKRA 3J81K 4Q6GA 4K87A 4M9ZA 1XB4A 2ETHA 2OD5A 3QO3A 3HOSA 4M7AF 3E5UA 1XDUA 2C8MA 2DU7A 4EMKB 2E41A 4CGZA 3LA2A 4WCGA 1USSA 3B02A 3BFMA 2YLBA 2LF8A 2GXBA 3HHGA 2QBYB 5GANd 4M77G 4P73C 1B4AA 2RHSA 1R5HA 2G7UA 1HKQA 4YRIA 2CGHA 4HX7A 3GZ5A 3CUQB 4YRMA 4Q15A 4J6YA 4ESFA 2BV6A 2ZCWA 4P71A 5AIPA 5LJ5j 1FX7A 5H6RA 2GWRA 4PGGA 1LOJA 2DLLA 1LDJA 2PEXA 4EV0A 4KYWA 4C8QG 2V6CA 2ZNYA 3AAFA 5L3EA 4M7AA 4L0ZB 1RZ4A 2Q7EA 1SD4A 5LRRA 3BOQA 4C92C 3L2ZA 5GMKe 4XTYA 4B09A 3MEYA 2F5CA 3SWNB 1WQ2A 2ZMEA 2NNYA 1B7YB 2ZR3A 2EFPA 2PI0A 2F5FA 4CH5A 1D8KA 2ALYB 2PJPA 4I2OA 4XTVA 1B9MA 4CH6A 2BEOA 1USYC 2L01A 3GF2A 3VFZA 1Y96A 1OYYA 5A2QK 4F7UG 4M7DG 1R36A 5K5QA 4KR3A 5CJ9A 2ODRD 2OAZA 3LA7A 3J80K 1O7LA 3FZVA 4ZIBA 2RQPA 4KMFA 5K1XA 1IUYA 1ZG3A 1D3BB 3QRFF 4P9FA 3CTAA 1SD6A 2HTSA 1HBXG 2YSRA 4BHBA 2VONA 1R00A 4L87A 3NRVA 4Q48A 1P4WA 1USTA 1JXSA 5K1PA 5F5WA 2G7HA 5DEQA 4TVAB 2QHUA 3MFKA 2K57A 4CS2A 4NHJA 3PCOB 5F1RA 3DXJF 4GYIA 3ZMZA 1YIOA 2I2LA 1WYDA 3K9TA 4MEYF 1Z9CA 1EH7A 4HYEA 4RB0A 4J6XA 2EV6A 1YYVA 3HFZA 1W4MA 5KVRA 2WTEA 5LHHA 2ZNJA 4YCVA 3W3SA 2VT3A 3BJUA 1WQ7A 3UH0A 1SD7A 3ECOA 4AIHA 2I4MA 1SRYA 4HWOA 2XKOA 2VXZA 3M1EA 5JVTA 4DPGA 1Z7MA 2FEZA 4HWTA 1YGBA 4WJ3M 4O6JA 5AONA 3KP2A 1O3RA 2O6GE 2QTXA 2GA1A 4G9YA 4XU2A 3JCMJ 5DCMA 3N97A 4RQEA 3EQLF 2PLYA 5KK1A 5D5WB 3DQVC 4XQ3A 1GVJA 4OLFA 3U1DA 4MEXF 4GO1A 1BC7C 1ATIA 2DBBA 4N0BA 4XEOA 4N0AC 3L4GB 2KKOA 3A74A 2IY5B 4OIRF 4XU1A 1DUXC 5CAIA 3WE2A 3JCMe 3NETA 5ILVA 1RNLA 2YX7A 1O3TA 1O3QA 3U9GA 2DW4A 1IN5A 1QZYA 3JCMV 4ESBA 4HVCA 1GGMA 4CHUA 3F8NA 3NENA 3OD1A 3GVAA 2LDUA 4XSXF 3FB9A 5D8LB 1WRJA 2DZCA 1UHMA 2DXUA 3DPLC 3FMQA 2R7DA 4X5OA 5LJ5g 1FLIA 4MMLA 3SFZA 5L3BA 1EVKA 2COMA 4G8XA 2RKHA 2EAYA 1EH6A 3HRKA 4Y17A 3GFJA 2FU4A 4FT8A 2W57A 1SETA 1X3UA 2AMCB 4OMYA 4UVCA 3T0YA 3LAJA 1D3YA 3ZMSA 4EJVA 5ICFA 3RERA 5GMKm 2JTVA 2Q8KA 5L3FA 2OZ6A 1R5GA 3I59A 2ZXFA 3QTCA 5JR3A 5GAMj 1FSEA 3PGGA 3ELKA 2W85A 1HXDA 3EFSA 1KQ8A 3R60A 2EWNA 3LWFA 3RUXA 1F4KA 1LNXA 3I7FA 3K69A 4EMKC 4BH9A 4D0PA 1XCVA 2GXGA 3JSPA 2STTA 1PP8F 3HXYA 3QO5A 3FJPA 1U1SA 4ENMA 3EDPA 3FMRA 3R6SA 1HW2A 4Q47A 3CUQC 1QO0D 5J8CA 1ADJA 4JK1X 3M8FA 1OR7A 4L18B 5FFZA 4L0YB 2Q7HA 4Q5SF 3QAHA 5LEKA 4M78D 2LSOA 1WU7A 4M71A 4YCWA 1CF7B 5J6XA 2IJLA 1HW5A 4G84A 1I6XA 4YRJA 5ILSA 3P9KA 5LJ3h 3A7UA 3VU3C 1LQ1A 1KOGA 1YW8A 2DXTA 5C53B 1JHHA 1JJCB 2D45A 2YU3A 2CJAA 3DPTA 3SWNC 4EMHA 3PFIA 1OPCA 1QPMA 4M78B 5GAN7 3IALA 5D4SA 5GAN3 1JRIA 2AXLA 2QZ8A 4OU0A 5D6EA 2XGXA 2GAUA 1FBSA 1J2XA 1L3LA 4UXNA 1NHAA 4H2XA 2A69F 1RI7A 2DFIA 1KMMA 5HVQC 1FYFA 4XLPF 2BE5F 1KQ0A 4P55A 1BI3A 4EQQA 2VBZA 5JFRA 4O2DA 4P72C 4K88A 3LFKA 3NELA 3WTWC 2VXEA 3JB9D 3EYIA 5HGQA 2L4MA 2OU2A 3TKYA 1FOKA 4JUVA 4M78E 3BPXA 2LF7A 4HT9A 1J59A 4M75D 1ON1A 2VE9A 3FM5A 2DEQA 1N9SA 4EVIA 1FPQA 3WTUC 5LJ3d 1RIQA 4PJOB 5GMKh 3EETA 4Y13A 3FHZA 2ZZGA 4RGSA 2DDZA 4HAMA 2PMFA 4H02A 2PG4A 2RDPA 5CYVA 2E7WA 2MA3A 1LEAA 1MJBA 3REOA 2IPQX 4C92F 3BROA 3P9CA 2M5WA 1XGNA 2JN0A 3QO8A 2FSWA 4OINF 4M75B 4LNSA 2DTIA 2XASA 4P73A 4HWSA 1I81A 2ZXJA 4P96A 3TO6A 3WTXC 5HLGA 3KFWX 4EGYA 2RNJA 1TW2A 2RC4A 4YRPA 4M77B 1NJ1A 2KJBA 3JTGA 4HLYA 2EJFA 4HOBA 1JBMA 4HWPA 2DTOA 1YG2A 2O0YA 3U2RA 3I53A 3KZZA 1QQIA 2CG4A 5J8FA 4MHGA 4LLGF 3DEUA 3M7GA 2E1CA 3QSUA 4HBLA 1J9IA 2FXAA 2HFHA 2PBIA 1G51A 1LEBA 4G94A 1BN5A 3HRIA 4C92A 2DAOA 1EIYB 3KP6A 1QBJA 5E18F 2O61A 5GAMg 5BPDA 4M75E 3HSBA 3L7WA 1E1TA 2E64A 4YYEA 2VN2A 3P8TA 5HS9A 4M7DD 1MDMA 1E2XA 2Y48A 4HV5A 4WXCA 1Z7NA 4TWAA 3BDDA 3GLXA 3A32A 4HX8A 3M4QA 3L09A 3SZTA 2Q2EA 4EMSA 5L3CA 3I4PA 4O5VA 1U5TB 3CUOA 2L02A 4XEMA 5DUIA 1ZARA 5FLXZ 4OIQF 4YRFA 1BBYA 1XGSA 1G3YA 4HX4A 1UHWA 4AIKA 2ZGWA 2FMLA 4M7DB 2M1BA 1ZG5A 3BWGA 4R1HA 4WJ4A 4ZTUB 2IA1A 1E24A 4OMZA 4M78G 1GHCA 5IT9K 2HS5A 5K5OA 3IKVA 4YRQA 4YRGA 3R0AA 2Q5IA 4FX4A 3H3UA 1XMAA 5E20A 3R4KA 3JTHA 4Y15A 4YPFA 2F5DA 1IXRC 3JCMh 4F7UF 4CO8A 2FB7A 5C52B 4M74A 4EM1A 2CYYA 2IVMA 1Z1DA 3FF5A 4UUVA 1FSHA 4XTZA 4ENNA 2ZT8A 2A68F 3QNEA 4U0VA 1B70A 4WWCA 3HUGA 1DDNA 5DCFA 2RHSB 4EJOA 2NAZA 5ELNA 4M7AD 5C51B 2CJ9A 3RESA 3DP7A 4PG3A 1X2GA 2MC3A 2L3DA 3E3VA 1G3TA 2HEOA 3HTZA 2HTJA 4X9CA 3F8CA 3KP5A 3DV8A 3LAPA 5LJ5f 1T39A 2V1XA 3M9AA 2IW5A 3GW2A 4PZJA 1R7JA 2O3FA 5GMKi 4M7AB 3JB9G 4N0AA 3IC7A 1OMIA 3KZYA 1P6RA 4M75G
chains in the Genus database with same CATH superfamily
2HR3A 3C18A 3GFMA 1KU2A 1M90R 1R0BG 4A53A 4YFXF 4F52A 1VQPA 3L2CA 3CJRB 5E1XA 2F69A 3ERRA 2HU9A 1EQRA 1ZUUA 2CFXA 1P4AA 4NDLA 4PNOA 3GFIA 2L9NA 2HZTA 1YHQQ 2CZ0B 4KFCA 3L9FA 3FXUA 4A0YA 4XIDA 2K2VA 3RQ4A 4PJNA 2EINH 2JWTA 1UFMA 3S93A 4ZYAA 2OA4A 2VKDA 1B9NA 4PJOC 5LGNA 3LSPA 5KYNA 2IIMA 2WAFA 4OGEA 1TP4A 1YTYA 2YUPA 2C6YA 1BBUA 5FD6A 3QG1A 4ZTJA 1Z67A 2XGDA 4M77C 3K2ZA 1WFXA 2Z99A 4MQVA 3BJ6A 2KIQA 2DL5A 2ABLA 4A12A 1NPRA 4TQFA 1D0XA 3K4NA 4OWRB 4U7DA 4HDUA 1KHCA 1TQMA 4IIMA 2R0QC 4N9HA 3X28B 1I1GA 1NYGA 2M34A 5H20A 4C8QC 2EIJH 3HGGA 1G4DA 2A6EF 3M0TA 4A4KA 1IV6A 5DYMA 5EYRA 3VYHB 2ALYA 4H2VA 3REBB 1ODDA 3QO7A 1IGNA 3EGXA 2DQ3A 2M1HA 1P92A 4XLCA 5IYBJ 1N25A 3FBIB 1K8AC 2ADUA 1K61A 3MCZA 2FPFA 1YJ9T 1X58A 2M87A 3ZQGA 4M7DC 3D5LA 2KQWA 2DI3A 2HKXA 3HG9A 4LN2A 3F8MA 2FZCB 3J80Z 2DIQA 2LCLA 3CEYA 4A6DA 4WF2A 2KSSA 3KYDB 2A36A 1VUBA 4NQWA 2KIUA 2FPDA 5GAMf 5LJ5e 4AC0A 4XLEA 4U7BA 1DGRM 1JGSA 1S3JA 5ICEA 2R58A 3MZHA 4EATA 1N5ZA 1E6GA 3ABUA 1ZN2A 2O8KA 2GNCA 4DGWB 2QYOA 2UXXA 3K1MA 4G85A 4KH0B 2DFEA 3HRMA 1BC8C 3E0JB 3AG1H 2EGCA 1T38A 3M1CA 2X0LA 2CZ6B 3P9IA 4A5MA 4C5HA 2EL9A 3CCJT 4ZYEA 3FMSA 5DY9A 3CD6T 4IUTA 3REXA 2Y9ZA 4LVMA 1GCQA 1EH8A 2BYVE 3HY0A 3ISPA 2DYIA 1UB9A 1YJWT 4NBQA 2GIVA 4E4HA 1TH7A 1U1TA 2HDAA 4XKVA 4JJDA 2H6CA 1WJ5A 2LH9A 1ZA2B 1RABB 3R61A 5F64A 1B07A 1G2BA 2KVQG 4BXUA 5HCKA 1IG7A 1SVOA 1IRZA 3CC4T 2VE8A 2JUFA 3WTYC 4V2SA 1HF0A 1XSDA 1OCCH 5IP6A 3SDGA 2YX4A 2ECCA 2MLKA 3LQRA 1LPQA 1KG1A 1BYMA 2HNHA 2GZWA 1S7OA 1BIBA 2CH4A 3CCLT 1UG2A 3K4KA 2X1DA 4WXHA 3GYHX 1G5VA 4XLHA 3G73A 5GAN2 1VQ7A 3E1SA 1BW5A 3E6BA 3IRQA 2QEXI 3CLOA 3OIPA 2DDBA 4BEHA 4YCUA 1VQ4Q 2QYZA 3UGQA 2EQRA 4C92D 1WJFA 5TISC 1XMKA 1WNLA 2DERA 1YB3A 1WCMJ 2BTTA 2XRNA 1IHVA 1GV2A 4TQDA 5EDNA 3RYRA 1IZ6A 3X25B 2DOEA 2JPCA 2DPPB 1WQWA 4DYQA 2XDPA 3MWMA 2KRFA 4XR6A 3ZMUA 1YFNA 5LGUA 3ZOBA 2BY3A 1ASYA 4IHTA 3CCLA 3M4GA 3PFYA 4PCQA 4AVPA 2V9PA 2Y30A 5HDGA 4EJUA 4LDVA 2QQ8A 5GPAA 2CP0A 3EGDB 1QZEA 1JKQC 4KGXB 1F43A 2FF4A 3JB9I 2QQSA 2JK3A 3JB9F 4OOIA 3CCEI 3GUDA 1N78A 3E9GA 4DBRA 3ZQFA 2HXIA 3LSIA 1KYWA 1K0SA 4ZYGA 4KGZB 2V79A 5FKOA 1MMSA 3PNWC 2CUFA 3B6CA 4F3QA 4KUDK 4A2UA 4MQ9F 2OTLT 2J3LA 5F04A 1G6NA 2BKDN 1PCXA 4IIOA 3MN2A 1NJ2A 1K4SA 4AIJA 2V8IA 4IEJA 2EFNA 2K4JA 3CCVI 1UE9A 4MMKA 1U6GA 3CESA 4HVVA 2E36A 2K3XA 4FU6A 3L00A 3JRAA 2HSPA 1YITT 4IHXA 3LQQA 1AZEA 3VDXA 1WSUA 1ACIA 1W5CC 2LRDA 5FU6C 3HXUA 1XTDA 3SEMA 2YUSA 1F1BB 3W2AA 1WHJA 12ASA 1EFNA 3F8BA 4MDWA 4P3NA 3KP4A 1DPRA 1NJ5A 4L9TA 1HSJA 2X4JA 2EYWA 1UJYA 4XRFA 3JCMb 3BCBA 1Z6RA 4RCCA 3DCFA 2E60A 1TWGJ 3VOEA 1SF9A 1EJ9A 1M2VB 1IV8A 2ESHA 2B0LA 3M55A 4A3MJ 4NCXA 4JX4A 4B9XA 5AT1B 3GNFB 3J80E 2LD5A 3ICAA 4H2YA 5E3IA 4F7UA 3C1DA 4QVDA 2KRNA 4A93J 1KD1C 4I01A 4C5IA 2EIFA 4ZYHA 1LDKB 4XQFA 3HSEA 4ZTZB 2M0CA 1HTTA 1K9AA 3KLOA 2P4RA 1M2OA 2P8TA 3S3NA 3FK6A 1Y96B 1WJRA 3W6KB 4UP8A 2V1UA 1OCRH 2VQGA 1JUPA 2EK5A 2VYTA 1W7PB 2BUDA 2D0QB 3ME9A 3TCJA 2FQ3A 3FXQA 1KGSA 3CCRI 3SJMA 2KR3A 5D6WA 4C0DC 1BCOA 4CCKA 4MZMA 3NTHA 2DXBA 3PIOF 1NTCA 4BJ6C 2V7FA 4P75A 3WE3A 1YI2I 3CDHA 1T2KA 4EGZA 3M56A 2CS7A 3H1CA 3K10A 1OZ3A 1Z05A 2NYXA 1VQMA 2DK3A 3HPHA 2FBIA 5IXFA 2E2HJ 4JRKA 4BDZA 1J3TA 4QW2A 4MLOA 3OW2S 3I9V2 2Z2SB 3ONQA 2JA8J 2QI2A 1ZLJA 3K4CA 2Z5UA 4YDQA 3PQKA 4P74A 2Y31A 3GXOA 3RMSA 4BDYA 3N05A 3K6GA 3CMAQ 4FX0A 3S17J 2PUOB 1WIEA 3INZA 2OTJI 1T6SA 2B7EA 2AZSA 2GBQA 2EA2A 2XRLA 1YHQI 3NEMA 1QVFP 3ASNH 3EUAA 5F6FA 1FYNA 2XAFA 2F4OB 3MQZA 2X4YA 2H1KA 2O9LA 2SRCA 1LKXA 3IH4A 4S04A 1PM3A 3OL3A 5FW9A 1VQNT 1J0RA 4P72A 1TQIA 1ZKGA 3LWHA 3V7SA 4YG2F 2E10A 1OV3A 2VGNA 4CICA 1ETOA 1TUCA 1A6QA 2N8GA 1MNMC 1FBQA 2HOEA 2W7NA 2LC2A 1TNSA 1U9OA 1GV5A 2F2VA 2YSQA 4KNYA 3OS0A 4BS9A 3I56A 2YRVA 4VUBA 2K3BA 4BHPA 4DBQA 2Z33A 2K9GA 3JCMg 2DXIA 4X34A 1BJZA 2XPVA 2HQAA 1LE8A 4DOWA 4YROA 5IYDJ 2JUGA 1IRGA 2ISZA 1DU6A 1OU8A 3K7AJ 3BZCA 3SZGA 4RDXA 2AO9A 3CMET 1FWZA 1X69A 2K7AA 3I4MJ 4ZNXA 2V9KA 4ON0A 2K3FA 1IN7A 4BY7J 1MW7A 3QZ9B 2KT0A 2FEIA 3D5SC 5JHFA 2FL7A 2CJJA 1X4PA 2BY2A 2ECBA 1KYZA 2F2WA 4ZYDA 4UC4A 2DO3A 4YRRA 5CVUA 4NC6A 2CQKA 2PX9A 2ARTA 4QLCU 3OYAA 1IXDA 5M5YJ 3JCMc 4R79A 1C0WA 4U0WA 2CFOA 1BI1A 4I0AA 1SAUA 1YFRA 4XOPA 6AT1B 2K3PA 1X2QA 3CMEA 1BBWA 1QGPA 3KP7A 3MCAB 3GBGA 4YREA 3T8TA 4Y52J 1YS6A 1A6IA 1UGPB 1A36A 3QPTA 3PE0A 3ZN1A 2RHQB 1K6OA 2DJZA 4E51A 4JDSA 1B8AA 1E3PA 3MZ8A 4D6WA 2EJRA 5IAYA 3S2DJ 3COAC 1KSWA 1R4NB 1TWFJ 4M78F 2HDCA 3EG2A 3S16J 3VQXA 3A4CA 3A8GB 2XV4S 2K2MA 2AZVA 5B66C 4UVAA 2R3SA 3M58A 4H0EA 4XTXA 1M3AA 4HW0A 2FBKA 2M16A 4C92B 2DMTA 5KE3A 3PVQA 4YEJA 1JJCA 1Z7UA 4C5GA 2IGKA 1HW1A 3EGUA 4B6MA 1X27A 2EFWA 4F91B 3P7NA 3TDUC 1Q81C 3MKLA 3A31A 4GCVA 1AKHB 1B8IB 1QU3A 5CKHA 3FLGA 2ESNA 3HPWA 1MKMA 4AD9A 2GM4A 4ZDPA 5LRSA 1Y0UA 4ZN1A 2DA2A 4ATOA 4CYCB 2VI6A 2K4BA 3BJAA 4BUPA 3C7JA 4M6VA 2JW4A 3EG3A 1T0JA 3CPWP 1VQ4I 1JJ2A 2VJ5A 2ZZFA 4I6ZA 2KZGA 4B44A 3VS1A 4C2MJ 1VQ5Q 2H3JA 2FNAA 5HLIA 3V7CA 2OQRA 1PDNC 2KDSA 1QVGP 2I4OA 1HC8A 3MKZA 4M75A 4AUXA 4QQDA 4NL2A 2E35A 3ZR8X 2DK5A 2ZNIA 3FIWA 3E9IA 2XDBA 1WLPB 1TBXA 2RB6A 1WHKA 5DV5A 3MEXA 1T3LA 2AQEA 5FGMA 4ETSA 1FMKA 1RKWA 3CDIA 1TNTA 1U9NA 4Q5WA 4K2EA 4YFNF 1TWAJ 2VJIA 3QP5A 3G1MA 1TQPA 2LKPA 3LW5E 3CMYA 2EKHA 3BJOA 1F36A 2PFBA 3SEQA 1JXMA 4KN7X 2KJCA 5H2FC 3L2QA 1K83J 4Y28E 1OU9A 1N9WA 1G3SA 4BW9A 2DQ0A 2Y75A 3G71A 1VQ8A 2JMWA 2W4SA 4G6QA 2HMAA 4PL6A 3FDRA 3AG3H 3WG9A 2ZKZA 1N9RA 4BQQA 3CXCS 2IA2A 1OLTA 2EVRA 1YQAA 3JCMf 1T0FA 2BGCA 1WJSA 2QENA 5D5XB 2V8JA 2F1LA 5FKNA 2VKNA 3PIPF 2H09A 1LFPA 2EBIA 1UGQB 1D0ZA 5FRMA 3WGHA 1LNWA 2Y0MA 3EG9A 4JX6A 1M90U 1XB4A 3ZQHA 2OD5A 3QO3A 3AL0B 2R5YA 4M7AF 2A28A 2DU7A 2E41A 1USSA 1ZX6A 3BTIA 1AA7A 2XI9A 2YLBA 3HHGA 4IOCF 3A1YA 5GANd 4P73C 2RHSA 4IO9F 2GTJA 4HX7A 4J6YA 4ESFA 4W1UA 1SPKA 2BV6A 5AIPA 5J47A 2PEXA 1RESA 4HCZA 4JZ3A 2V8KA 1M3BA 1OYXA 4BD3A 4XTYA 4B09A 3IV5A 1ZUYA 2GOMA 3VS7A 3L42A 2NNYA 2EQKA 2E2IJ 1BR4A 2ZR3A 1G59A 2ALYB 2I8DA 3Q0UA 3EGXB 4XTVA 1ITYA 3S14J 1B7TA 5FU7C 3T9NA 4CH6A 2HBPA 2L01A 4J9EA 1OYYA 5A2QK 1R36A 4KR3A 5CJ9A 1YJ9Q 5K1XA 1RLQC 1D3BB 2DYRH 3CCUT 1Q81R 3VYUB 3CTAA 1SD6A 1HBXG 1ZSGA 4L87A 3NRVA 2VUBA 1TXQA 4ELZC 2CP2A 5CO7A 3PCOB 2JZ2A 1WHMA 4GYIA 3OMGA 2RN8A 4HYEA 4LIVA 4J6XA 1I0CA 1WPKA 2ZNJA 3VKIA 4XRSA 3CCMT 3BJUA 1WQ7A 1M3CA 1SRYA 2RI3A 3M1EA 4LE9A 3H0GJ 2CSIA 2FEZA 4HWTA 2QGUA 4WJ3M 4O6JA 3KP2A 2WB1N 1U5SA 3PNYA 4G9YA 4XU2A 3JCMJ 1GFCA 3CCJQ 5KK1A 3G7ZA 2GCXA 3HC7A 4MEXF 4GO1A 3CD6Q 1ETYA 5EGOB 1JJ8C 4A3DJ 4B1RA 2JT4A 4DYCA 1EA3A 2I10A 3FKJA 5ILVA 1RNLA 3QPLA 3CMAI 3U9GA 2WA0A 1YJWQ 1T8IA 4CHUA 3BTCA 3F8NA 1YJNA 3PFSA 2E1OA 3CCMA 1LVKA 4XSXF 3FB9A 2DA3A 2JVVA 1ABQA 2R7DA 3SEZA 1N77A 3CC4Q 3BR1A 5LJ5g 1ARKA 1EVKA 2COMA 2RKHA 2HPMA 3CCST 2EAYA 2CUDA 1EH6A 2O2OA 2R7XA 2FU4A 1UHCA 1X1DA 1X3UA 4UVCA 2YWWA 2G6FX 4JP0A 1YWOA 2ZAEA 4MZPA 3H5AA 1M27C 2OC6A 3ELKA 2W85A 1VYTA 1KK7A 5F0HA 2EWNA 4LUEA 1F4KA 1Q82C 1TUDA 3I7FA 1T95A 2GXGA 1PP8F 1FEXA 2WSEE 2KFDA 1WXTA 1U1SA 4W97A 4ENMA 3EDPA 1HW2A 4JK1X 2Q7HA 4S0HB 3QAHA 1WHUA 2LSOA 2DXCA 4HCKA 1Q86R 1HW5A 3VS5A 4HKEA 3VU3C 1LQ1A 1Z9QA 1GVDA 3WHCA 2X1EA 1JT0A 3FKIJ 1KC8C 2CJAA 4K11A 3DPTA 3SWNC 1PC0A 3PFIA 1QPMA 2DT7B 2RF0A 4X1VA 1UZCA 3RNJA 1WXUA 2LJ0A 2ZPBB 1J2XA 1NHAA 4H2XA 1GBQA 2PVOB 3LH0A 4P55A 2X1CA 4D5FA 4RDUA 4P72C 3A2KA 4D9JA 2LOOA 3EYIA 2EZKA 3M57A 2JTMA 1J59A 1ZSZC 2D6FA 4M75D 1ON1A 5IN1A 2OTLQ 3BR6A 1RUWA 5LJ3d 1RIQA 2L8DA 4XKWA 3FHZA 3M4YA 4H02A 2PG4A 1W1WE 4DYRA 5CYVA 2E7WA 2LDMA 3REOA 2IPQX 4C92F 3P8HA 4A3GJ 3P9CA 5I2SA 3BCAA 5J3LA 1I81A 1YITQ 2XIDA 3I5SA 2RNJA 3QBYA 1TW2A 1NJ1A 2EJFA 4HOBA 2OUMA 2DTOA 1IJWC 3CC2T 1YBYA 2E1CA 2FRWA 1J9IA 2FXAA 1S1NA 2X51A 1KJWA 5BPDA 2EQUA 3SYTA 3L7WA 4YYEA 3NARA 5HS9A 1AVZC 4ABZA 2EQIA 2Y48A 3BDDA 2ELKA 5K7ZA 2R93J 2P0PA 5GAGJ 3L09A 1NLPC 4EMSA 5L3CA 3CUOA 4HCCA 1ZARA 5FLXZ 4OIQF 2EH3A 1BBYA 4N4GA 1G3YA 4HX4A 4JRPA 4AIKA 2M1BA 3QQAA 1U06A 4R1HA 3CCQA 1VQLT 4WJ4A 4J8OA 4ZTUB 4OMZA 1GHCA 4XM3A 5K5OA 5EC7A 4YRGA 3S3MA 2Q5IA 5E20A 3R4KA 3ZEHA 3JTHA 5M5WJ 1K73R 1VQOT 5E3OA 4IKFA 3K70C 4G6TB 4M3GA 3FF5A 2E5NA 2R7OA 4ENNA 2ZT8A 2PJRA 3QNEA 4E7HA 3HUGA 1DDNA 4EJOA 4RM3A 1NG6A 1EIFA 9ATCB 1NK2P 4LVLA 1VQ5I 2HTJA 3DV8A 5LJ5f 1T39A 2IW5A 4PZJA 1RPWA 3KYLA 1XS9A 2O3FA 4Y3OA 4N0AA 3VUZA 2QSFX 3KZYA 1Y8RB 3CC7A 2ZPFB 1VQOA 3NQOA 4J15A 4FYVB 5E3MA 1ZYRF 3GZ6A 4JJCA 1V5EA 5A0LA 2JA7J 4JZ4A 1JI8A 3OYNA 1KC8R 2KLOA 4CZCA 1X6GA 1X2NA 5GANj 2XTIA 4N4NB 1NZ9A 4AU7A 2MD0A 2HAXA 1MNDA 2GTOA 4HA8A 1IRFA 2WB1A 2QUFA 3E6DA 1WGSA 4TV7A 4YIIA 2KMTA 3EH1A 2HXOA 2FRYA 1W5TA 1SD5A 3IKMB 4C0FA 4X1EA 2DDAA 2K9NA 2KRSA 2R7FA 4DZJA 2O03A 3DWLE 4A5NA 4RG8A 2O4XB 1NJIR 4YRSA 1VQNQ 1YIJA 1SHGA 5B1BH 2I5UA 5TGTA 3JAMZ 2RHUA 3OOPA 1KU3A 3CPFA 3J81Z 1P4XA 2UWMA 1AZGB 3G6ET 4ZZDA 1UUEA 1K9MC 5GAN5 3CUQA 2R7WA 3X20B 4YRCA 3VSKA 4A4EA 2G0EA 3Q1JA 5D6XA 1HC7A 1M8VA 1Q1HA 1FY7A 2AKLA 3RDVA 1QVUA 4L59A 3LGLA 4LNPA 2QQ9A 1DJ7B 4YFKF 1XJWB 2DODA 3DTIA 4KUIA 1S72T 1LE8B 3S2WA 1JU5C 1RI9A 1PKTA 3CMEQ 2DRMA 3I35A 3TQ7P 2DMPA 1WJCA 5K7FA 3LGFA 3OW2P 2CH0A 2L0AA 1JUSA 1H3ZA 4H2UA 1T0FC 1V5FA 2R4GA 3M0SA 3F23A 3DU5A 2TDXA 4BB7A 2DFHA 5GAN6 2VQHA 2GA2A 1TLHB 1OQYA 4OF1A 3PL8A 1YJ9I 3CP8A 2EB7A 4AYBN 3WTVC 2ED0A 2RMOA 3I59B 3J7ZI 2Y9YA 3R0JA 4D7NA 2DEUA 2OCCH 2GQQA 2DKGA 1N8RR 3LSTA 3I71A 2J3MA 2JS0A 1MNEA 1MUZA 2M4GA 2LQWA 3ZBDA 2J6OA 3IL2A 4Y91A 3HJEA 3ZN0A 2ECZA 4XLNF 4J9BA 3D5RC 1JHFA 1I1SA 3EUHA 2ZT7A 1LYLA 4OIPF 5LL6S 1ZHFA 3FWEA 2XMFA 3K2AA 4UNOA 3E6CC 3FHNA 2R92J 2IY5A 3AL0C 3HP9A 3CCJI 1WX6A 3LSKA 3GTQJ 4QPOA 5FLXE 1SFEA 3MO8A 4H2TA 2K85A 2L2OA 3O6BB 3CD6I 5DDGA 1KQSA 3KEYA 4V19K 2CP7A 5GAOq 3L1AA 5CVRA 3DKXA 4XK4A 3TBIA 3EFOB 1AWCA 4CCNA 2MLGA 1YJWI 2JA2A 1PUFA 4ZH4F 1NLOC 1W6XA 3IH3A 1M1KC 2FZGB 2R5ZB 3I55T 3RKWA 3CC4I 3JCUC 3TO7A 2P5LC 3PUFA 2E2JJ 4A69C 3RI4A 3HEFA 3MEWA 4LDXA 2XUBA 3HYIA 3HB9A 1JKRC 1JJ6C 1VQ6A 2H94A 2VGMA 4XSZF 4U0YA 2LKSA 5KNLA 4LXCA 1XX5A 3RZDJ 4RMOA 3CCLI 3HXLA 1H8KA 4KITB 1U2WA 2CJBA 3UDCA 1X55A 3H3ZA 1VQKT 4LG3A 1VZ0A 5D7UA 1LB2A 1D09B 1VIEA 3VS2A 2EA4A 3PTAA 3CCYA 1IREB 2LQKA 1MH4A 2HQHA 2QXFA 3HRTA 3HRUA 4J5YA 1RAHB 1OX8A 2IRFG 3GOXA 1Z91A 4D8DA 1X6BA 3LSRA 5LJ3j 2M45A 3KXTA 2LK2A 1MDMB 4PLIA 4CH7A 4FSXA 1Y8QB 2E3IA 1XGMA 1PKSA 1Q1VA 4FT2A 5KYXB 4GBQA 3ZQCA 1O57A 3G1ZA 2L9SA 1FP1D 1VQKA 2XGEA 2EZLA 2HQRA 1JO8A 5ERIA 1OYIA 4C9YA 2F2XA 2BBYA 2P0WA 4ZC3A 3QU3A 2IA0A 1J09A 4PJJA 3REUA 3JREA 1VIFA 2O7OA 1LPLA 4BUGA 1Y1WJ 3QPSA 4M6YA 1O75A 2FHDA 3JAME 1VQ9T 4LG0A 4FIBA 2KK4A 3J81E 4PJOA 2RN7A 2DZ9A 1RL2A 5I22A 3MAJA 5GMKj 2KMUA 1E3OC 1H9TA 4RMNA 2OTLI 3HFNA 4BNCA 1G5IA 1YE9A 4OMOA 2ED1A 1XTAA 1SFXA 5C6SA 3HOXJ 1RR8C 1EFWA 3OYYA 1B72B 2DA7A 3IRRA 1HKTA 3M59A 4C0GA 4M77A 4IRHA 1ZG1A 2CV0A 4O3MA 2OQGA 1T3SA 4MTDA 3HSFA 3F6OA 5GMKl 1YITI 3EPZA 2LCSA 4XAXB 5L3GA 5BNGA 2R5YB 3HL8A 5EG0B 2ZXHA 2DIGA 5KYUA 1QA6A 3EFRA 3HOUJ 4C8QA 1SKUB 1K78B 3ULRB 1ON2A 4RB3C 2XIGA 3LSGA 4DNCA 2P5KA 4QIWN 2DTHA 2XAJA 3QU6A 2BY0A 4RG2A 2M30A 3QDRB 5KHDA 5GAOr 3JCMP 1SMYF 1BI0A 4LVIA 2IT0A 1FIAA 4OAYA 2JJ9A 1Y0MA 1WGXA 1BM9A 1Z77A 3JB9J 2E3CA 2JT1A 2ZO4A 1W2BS 1TZLA 4J9IA 4N9IA 5I21A 2KIFA 1ENHA 3H36A 4OMQA 4ZGDB 1F1ZA 2HYGD 4BXFA 4XKCA 1FTZA 3I0TA 4HNVA 2K02A 3K0LA 3LL7A 1ERDA 1TC3C 4B9WA 4P3PA 2BZ8A 2HQXA 3CCUQ 1M1KU 1FP2A 1D5VA 3LA3A 1WFWA 2ZPIB 4UUSA 4NB5A 1X1BA 4A3BJ 3CXCP 5DM7F 1Q7YC 3CO7C 1S9HA 4LD6A 2QSHX 4LK1F 2ID3A 3IWFA 4KGVB 5D6FA 4DA4A 2MPXC 2NOGA 3URGA 3KETA 4HF2A 2L7FP 3VV0A 3G4ST 3HXZA 3NWTA 3CCMQ 4PHCA 1XSVA 2V9VA 4EMKA 2X4HA 3GP8A 3X24B 2AIRB 1ZR4A 5J1YA 1I07A 2A5WA 4E7IA 1XDSA 4FTHA 4I09A 5JI6A 1GXQA 4WX9A 2PMZA 5GAOl 5IT3A 2HDWA 3ZMTA 2KDZA 4FYWB 3RKYA 2RI2A 1VQZA 4J9DA 2NRAC 2Y4XA 2VODA 2DJIA 3I4NJ 3VS4A 2VBYA 4ZZLA 2IS4A 1OPKA 3RPUA 1FT9A 3K4JA 2VLAA 3FX3A 2QQBA 5LEJA 3QDFA 1ETVA 3ZXSA 3E97A 4KT6A 2QA4T 2P5IA 1NJ8A 3MZYA 4LDYA 3CCSQ 3JV3A 2YRCA 1IN6A 4GXOA 1WJAA 3E5QA 4KMUX 3ZGKA 3L2UA 4XKBA 4RTXA 1D1AA 1MBEA 2EBPA 4JS5A 1VQNI 2ZJRF 4KUMA 4M3FA 2LMJA 2JPBA 1SVLA 4KIGA 2OZUA 2MWOA 1Z9ZA 1FZPB 1NYQA 4RB2C 1EV7A 1B34B 1HOMA 1KU7A 1I1JA 5BMZA 4BWAA 4IVNA 3TEHB 2KT1A 3O8HA 1K4TA 4CH4A 4GLMA 1SFUA 2D1HA 4WK8F 5I2MA 2DMUA 3BP8A 4P71C 1V4RA 4UP7A 1ABOA 1BCMA 3J7AY 1X19A 4A63B 1R58A 5ECAA 3VB2A 3A01A 1IW7F 2WWYA 2CH4W 1FYLA 4JJBA 1RI0A 3L4GA 3CMEI 3VS3A 3OMYA 5GAMd 2O01E 3OYHA 5LHIA 1RETA 5LHGA 1UFFA 2KRHA 2ZFUA 2HYFA 5E79C 3GX4X 4LLLA 3KEQA 1SSHA 4XICA 2A37A 2ME6A 2IGNA 2HL5C 1OCZH 4HZFA 5EG2A 1IXCA 2V1DA 2A8EA 4G6DA 5E1ZB 2X6WA 2ZZEA 2DRKA 2K5FA 1Q86U 4EJTA 1SRMA 4A4GA 2AMCA 2AT1B 2LQ8A 2Y4YA 4P5OA 2F5KA 2NVTJ 1RUOA 2OBPA 4ESJA 1JT6A 3CDLA 5LBQA 2W25A 3E6MA 2DA5A 1T33A 2HQNA 3LSMA 1LCKA 5HNFA 4LD5A 5ED4A 5GAOn 2AS5F 1P9QC 1ZH5A 4EMGA 3X26B 2M2EA 3CC2Q 9ANTA 2H6BA 3HOTA 5IHKA 1KQ2A 1ZQ3P 3G2BA 5L3DA 2FVUA 1FOYA 4PJOD 3RL6A 2E1NA 1IZ1A 2XROA 2DU9A 3R6OA 3M0UA 1ZELA 4A54A 1HSTA 3UFGA 2QEXA 2QK0A 3A0HC 1H9GA 2XPWA 5GTHC 1XC5A 3TP0A 2P81A 3LC0A 2MGQA 2CQXA 1EVLA 4KQEA 4M77D 1IC8A 3S6WA 3SD4A 1ACMB 1D8JA 2LYCA 1PVEA 1UB4A 3KLNA 1VQLQ 4M75F 1UELB 2LTPA 2VOPA 3SQNA 3T5XA 1NG7A 4C8QD 4IUVA 3JW4A 2MCNA 4E6KG 4KICA 5GAOm 3D7SB 1JTYA 4AG1C 1VQOQ 2BW3A 4AIDA 3IG2A 3P8VA 2DA6A 3PQJA 4CH3A 4M9XA 4QVZA 3M5AA 1SERA 3JRCA 4F17A 2LY1A 5J26A 2PJRB 4HSRA 3CCEA 3HUGB 4FISA 2L54A 1B59A 1HD3A 2Y0SN 3C3WA 2YLCA 1ONVA 1Z3YA 4CCJA 3TEDA 1K7AA 2ZINA 2H8RA 1OR7C 4TVYA 4AWXB 2CIMA 4A3CJ 5ILUA 1V29B 4RLQA 1YS7A 2FE3A 4LD9K 1YX3A 5DD8A 1H0MA 2L7MP 2LX7A 1HLVA 2ZXIA 1R22A 5E3LA 2ICWG 5CVVA 1XN7A 1K73U 1RACB 4DJAA 2HGCA 3CCVA 2DAQA 3A8LB 1IF1A 5GANh 4X9DA 4XRMA 4CS4A 2IEKA 2JM9A 2YR2A 4J83A 1VQPT 3MPUB 5D5VB 2JRTA 2RK1A 2W84A 1GT0C 3H3VK 4CS3A 2R7ZJ 1WJQA 5GJWB 3H6ZA 2R7UA 4X0GA 2Y2ZA 5GAN8 4A0ZA 1C6VX 5GAEJ 5FKKA 1X56A 4CYDA 4BY6B 2VT2A 1J75A 2CU7A 2JN6A 5GAN4 3SHFA 3S2HJ 1BJAA 3RGLA 1OKRA 4M9ZA 3HOSA 3E5UA 2C8MA 1K4US 2QSGX 4CGZA 3LA2A 1YN8A 3OYCA 2QF7A 3BFMA 1X1PA 3G6EQ 4XORA 2LF8A 4E7KA 1TUGB 2QBYB 4GDFA 2CP3A 3H5NA 4C3IJ 3M3YJ 1HKQA 3BT9A 2CGHA 5IYCJ 1C0MA 3CUQB 1Q95G 3KPHA 3BDLA 4Q15A 2OTJQ 3TL4X 5H6RA 1SFKA 3RPUD 2GWRA 2DYBA 2WV1A 2LJ3A 2QQRA 1LOJA 4PFOA 2DLLA 4KYWA 2WAQA 2ZNYA 1SEMA 4L0ZB 1MH3A 4XK8E 2UUZA 3BOQA 5KAFC 5FKMA 2RI5A 1WQ2A 1B7YB 2FOWA 4IL6C 1S72Q 3WXMB 4CH5A 2PJPA 1NJIU 2IGMA 1X43A 1CKAA 1OJLA 1YWPA 1UMQA 3GF2A 3CCRA 1RAEB 4HXJA 3J80K 2BVMA 3FZVA 4ZIBA 2RQPA 4KMFA 2DM1A 2YSRA 4BHBA 1ZHIA 1YI2A 2VONA 1R00A 1P4WA 2DD4A 2RQUA 3CCUI 3RCOA 1JXSA 5DEQA 3K4LA 2QHUA 2K57A 4CS2A 1WI7A 5F0FA 1YIOA 2I2LA 2CS3A 1WYDA 3K9TA 1Z9CA 2FZKB 2E12A 3MP1A 3VS0A 1YYVA 5EZHA 4CCMA 3ABLH 3DLAA 1WXBA 1SD7A 4AIHA 3A1PA 2CZ1B 4HWOA 2VXZA 2BZTA 3PJRA 4JYKA 3CCMI 2LBFB 5HNHA 3DQVC 4XQ3A 1TS9A 1YHQA 3U1DA 2OJ2A 1BC7C 1ATIA 2DBBA 2DA9A 2K9LA 4DBFA 2KKOA 2IY5B 2LNHB 1R5ID 4Z02A 2E5ZA 1O3TA 1O3QA 1N8RU 3IAS2 1IN5A 3BE3A 1QZYA 3FK7A 4ESBA 4YIRX 2D5VA 1GGMA 4HVCA 1RAIB 2JMAA 4C2TA 2LDUA 2HZDA 2DZCA 2HVSA 1UHMA 1M9SA 3OYMA 4QKUA 4J9HA 3CBOA 3SFZA 1PUFB 2VJ4A 4G8XA 1YCSB 3I55Q 2BZYA 4J01A 3O8GA 4BY1J 3GTLJ 2ZZDA 3ZCOA 2W57A 1SETA 3CCSI 3T0YA 2FO0A 1QVFA 2AHQA 3OYEA 2A08A 5C0MA 1QLYA 5JR3A 5GAMj 3PGGA 1KQ8A 3RUXA 4B4CA 1LNXA 4EMKC 2P84A 3C4SA 1WZ2A 1VQKQ 1XCVA 2STTA 1A0NB 1VQ7T 3QO5A 3FJPA 1ETXA 2DETA 4HNTA 1GFDA 3VPRA 3FMRA 3P5JA 5J8CA 1ADJA 3OQ5A 3FC3A 3VWBA 3OA6A 4AT1B 1CF7B 1VYUA 1TG0A 5IP7J 5LJ3h 3WG7H 4FT4A 2DXTA 3GTPJ 2D45A 2JJ7A 2AQFA 4EMHA 1WHGA 3RQIA 4M78B 3C2BA 2W10A 2AXLA 4ESRA 3SFIA 2DFFA 3A5ZB 2XGXA 4UXNA 1X1AA 2VJJA 3GZNB 2V26A 2DFIA 3OYIA 1KMMA 4D8KA 4XLPF 2BE5F 4AM3A 3VYRB 4IUPA 4K88A 5JLWA 1KIKA 3DBHB 3LFKA 1CSKA 3EAEA 3JB9D 2L4MA 2OU2A 3TKYA 1FOKA 3H0IA 4M78E 2CQNA 3BPXA 1VQ9Q 4UY8I 1BU1A 2WSFE 3SHWA 5FWBA 1OCOH 4PJOB 5GMKh 2PU9B 1OISA 3EETA 4Y13A 1V76A 2D9TA 4DW6A 3BC8A 2LT4A 2PNIA 2MA3A 2CRGA 2M5WA 1MIJA 1XGNA 4OAZA 1CQTA 3SFMA 3QO8A 3K4MA 2XASA 4P73A 2LKXA 2MSYA 3HTRA 3KFWX 1E7OA 4YRPA 4M77B 2HSEB 4HLYA 1PSEA 3GLLA 2IBDA 1YG2A 1W1FA 3I53A 4LITA 4JPBW 4MHGA 3HKZN 2OCEA 3QSUA 1O9SA 1Y71A 1ZBJA 2HFHA 1Z21A 2PBIA 1G51A 5KYUB 4G94A 1BN5A 3CC2I 1EIYB 3KP6A 1QBJA 5E18F 2O61A 2MAMA 1K8AR 2KEAA 2CW7A 1E1TA 2E64A 5B5EC 1PRLC 2LP5A 3P8TA 5A0GA 2DD5A 2GQIA 2XICA 4TWAA 1QWEA 3BQZA 3GLXA 3A32A 4HX8A 4OMPA 2Q2EA 3A0BC 3EGDA 1U5TB 3TSWA 1BR1A 2JQ7A 3OSFA 2R7SA 1VQ4A 2ZGWA 4M7DB 1YRNA 1ZG5A 2DOFA 2E70A 4M78G 2YUQA 1WYXA 2NS6A 3GNGA 3HBLA 3KYCB 2QAZA 1VQLI 3H3UA 5F27A 1R8OB 4BE1A 1WA7A 4NUBA 2HDDA 4YPFA 2F5DA 5CQYA 1IXRC 4CO8A 2FB7A 5C52B 2LCCA 2VKHA 1VQOI 4U0VA 3C0CA 2NUTB 2CJ9A 2M9HA 3E3VA 2GFAA 2BXYA 2KGTA 4XL9A 3BG3A 2L7KA 1BK2A 1ZLMA 3CPWA 1LFBA 4HG2A 1IUFA 3G4SQ 2P0KA 2V1XA 2HPIA 3RBBB 1V1CA 3HOZJ 4M7AB 3I3LA 1PYVA 3IC7A 2DFUA 4AFQC 2E1MC 1QVGA 2ZMEB 3FXRA 4LJZF 3GCMA 3DFGA 3VYGA 4BBSJ 1NEBA 2NS7A 1JKPC 2RJCA 4F04B 2LTOA 3JCMd 3BR0A 2NWMA 1VQMT 3UF4A 1O7FA 2YHTA 3PIPA 3S1MJ 4JOMA 2KY9A 2EYXA 1QCOA 4CZZA 1WI3A 3C2HA 1IAWA 4M7AE 1M1GA 1GL5A 3JCMX 1WJEA 3V8LA 2YUOA 3RJPA 5F08A 2DMNA 5H6QA 3V4GA 2Z9OA 1W2BP 2NVXJ 2VQLA 1QPIA 1UGVA 4DOZA 2CDTA 3MKWB 2QA4Q 2KYBA 1KQ9A 4ZDLA 1WDXA 3HFZB 1X3ZB 1VF9A 1MGQA 5HDKA 4ENKA 1R1TA 3R07A 4YRKA 1RUNA 1L0WA 1RKTA 1Z6TA 1WZOA 4MTEA 2QWWA 3OS2A 1W7PA 3CJQB 3F72A 2HKOA 5GAOp 5DLQE 5DCMB 4L9NA 4HLXA 5K1YA 3G6EI 1ASZA 5M3MJ 1TOVA 2H27A 4RKUE 3GTKJ 1YO5C 2CGPA 4P3OA 2LRQA 1R1UA 4RS8A 1WWXA 2CZ7B 3WTTC 3SWNA 1MBFA 1D1BA 1YLFA 4Q4ZF 5E1WA 4JS4A 2L4AA 3TP3A 2E71A 2EILH 2X4WA 3I56T 1BOBA 2WY8Q 1QKWA 3LNQA 2FUG2 2O8XA 4B43A 1S72I 1V54H 4M7AG 5DLOA 4L5IA 3A01B 4FYYB 2XAGA 1AHDP 4BI3A 1B1BA 1X2KA 2XB0X 2VUMJ 2LJ1A 3TSZA 5E8GA 1RAAB 3MMYB 1VYVA 1ZSZA 4LVKA 1XCBA 4TVAA 1ZTRA 1O3SA 4PDKA 5AYFA 4IX7A 4QT7A 1QP2A 2F2EA 2EGEA 2BVLA 5CIUA 1ZLKA 3LSQA 2XDDA 1JE8A 4TVWA 1QHHD 3RDIA 1F5TA 4UV9A 4J9FA 1ZQ1A 3I5UA 3DTEA 1PP7U 1ZAOA 1VA7A 2I4LA 1PRMC 3DKWA 3CMAA 4YP0A 4HSTA 4HDVA 2E4HA 4P5NA 2DVEA 3W6JB 4E6RA 2M7BA 3RIRA 3H9GA 3KE2A 1XSXA 4IOAF 5TRDA 1NYFA 2XVCA 2K5LA 4B3XA 5KYWB 3DLLA 1KD1R 3CBPA 2EZHA 3A5YA 3FEOA 1SSFA 1MBGA 2X6OA 3BG7A 4RB1A 1QHGA 4YRVA 4L5JA 2MH9A 2K5IA 1M90C 3Q0WA 3RF1A 1KZHA 4QTRA 4BI8B 3IKTA 1UDLA 2OPTA 3F0CA 5I11A 3JSOA 4DZPA 1HSQA 3GWZA 3TVTA 2IS1A 4G12A 3I55I 4AFZC 2L3PA 3GEZA 3LSHA 2KQRA 5KNNA 2F5VA 3CMMA 2LREA 2PMHA 4JBAA 2MF2A 3HRSA 1Z3XA 2VIXA 1XNIA 4RA2A 2WACA 1C1AA 4B8XA 3QZ5B 2CSQA 2VASA 4C0DB 1K0XA 4TTVA 2DPDA 1VQKI 2BW3B 2ZJPF 2ODRC 3HOVJ 3TO9A 4U88A 2EJ9A 2NUPA 5J4VA 2RHQA 1ORKA 2EFQA 3QWLA 5DTDA 5D4RA 2E5AA 2RJFA 5D6YA 4YRNA 3HFOA 2G4CA 1S7EA 1E0EA 2D2WA 4PJOF 5BQTA 3EG0A 3HOWJ 3NWSA 2ME0A 2ZB9A 2GBYA 4C92E 5FWCA 2EQMA 1K76A 4I76A 2RNGA 2ARSA 2A6HF 3EYYA 2VC0A 2BIVA 3F70A 1R0CB 3ZQ7A 2X3WD 1GCPA 4M77F 2VPRA 1EOVA 2R7TA 3WGIA 1B3QA 3NHNA 8AT1B 4QQ6A 1VQPQ 2WV0A 2EGAA 4OB1B 2ZSHB 3OWTA 2M8EA 3OL4A 1HDDC 1VQ9I 2ZTGA 1R71A 3G71T 2K86A 4C8QF 1VQ8T 1ZGWA 1B70B 2PN6A 1TT0A 1B8IA 1QMCA 1G3WA 4E7JA 1YCYA 1C0AA 1AWJA 4BYYA 2ZC2A 3V8KA 2P5VA 5KCMA 1D5YA 4PJLA 1YW7A 2XHKA 4HQMA 3P8DA 1QVPA 2W00A 2P0QA 1IO6A 2HVQA 1PSFA 3SXYA 2ROLA 4UHTA 4PJ0C 2J5OA 1ZREA 2RNAA 3NFCA 4BQOA 3BW1A 3DF8A 4M7DF 1G2HA 3DEWA 4AFUC 1YOVB 2CP6A 4I02A 4RGXA 1R49A 1KMNA 2I4NA 3GTGJ 2D1VA 2W24A 4G7OF 1ZGAA 1BBZA 3ZMDA 2EYQA 5CVJA 2Z0WA 4Z2YA 3K1NA 2TRTA 1RAGB 4IJAA 2M4KA 2W48A 3FM3A 1HJDA 2RHIA 2L9RA 4C92G 5BOXA 2K5CA 3VSLA 2RHZA 3DSQA 2HNIA 2HCKA 3JCMW 3TDZC 1KFZA 1FOWA 1G83A 3CF2A 4FSSA 2CUJA 1JGGA 2RA2A 2TCTA 1W7PD 2ID6A 2KHMA 4M78C 1VQ5A 4YRLA 4ANJA 2ZIMA 5IT9Z 2MFZA 2X4XA 2PVGB 4Y4RA 1SEUA 5LJ5d 1E22A 2BXZA 4P1WA 1H3HA 3JB9H 2F5EA 5GAHJ 2COWA 1LJ9A 2CW0F 5E17F 3RR6A 1MZBA 2MG4A 5LFAA 1MSFC 3O3KA 1M1EB 2ACJA 4S05A 3WVEB 3G4SI 4EEFG 3BQYA 1TTHB 4LLNA 5BS6A 4XTWA 1I3QJ 2CKKA 3OYDA 2LNVA 1RRJA 3D1NI 1U78A 3B6AA 1T56A 1UJ8A 1VI0A 2DOAA 3M0PA 3VQYA 1LFUP 4ZDOA 4BGDA 3G3ZA 5EEGA 3QYBA 4LFUA 4MZTA 2VC8A 4RTTA 4A3KJ 5DUKA 1I50J 4NQWB 4E70A 1RADB 4XLAA 4OIOF 5IOZA 1DU0A 3HOYJ 1YJNT 4FM4B 1U5TC 2DQLA 2MBFA 2JA6J 6PAXA 2CW8A 1U3EM 2VXFA 1D3BA 2QA4I 1Z0XA 5FRNA 2J5PA 1D0YA 2L5QA 5FFXA 4HF0A 1Y07A 1DP3A 1ADYA 2DU5A 2OAWA 3M8EA 5GAMh 1XD7A 3RTRA 3MHXA 2A05A 3ZPLA 2CP5A 3PCOA 3MF1A 3RZOJ 1TW3A 4RAYA 1DP7P 1AT1B 5GANe 3O2PE 1VQ7Q 1OYWA 2ELHA 1PNJA 3M0QA 2EIKH 2IPOB 4Z6YA 1WHLA 3CJTB 2LR8A 2VC1A 1IN4A 1I6HJ 4KIBA 3TUPA 4IUUA 4CSWA 3L1PA 1YJ9A 3F21A 1MBJA 3AKZA 3K70D 3ABMH 1CKBA 3ZMVA 2HI3A 4M7AC 5EGOA 3KFVA 1X54A 1H641 2E7XA 3CMQA 3IHUA 2H1LA 2QVOA 1JJ2S 1GDTA 4Y92A 3OYFA 3CCLQ 5BPIA 4UB6C 2ZMEC 5M3FJ 2V1RA 1H92A 4RAZA 2HOAA 4E7SA 4UP9A 2ZPEB 1T0HA 3RSNA 1TL8A 3BZKA 3PMTA 2STWA 2HBWA 2JUCA 2YU9J 1K6YA 3NEUA 3OW2A 3WU1B 4ME7A 3KFUA 4BEHB 3LSSA 3QUIA 4K86A 2ZIOA 4E7LA 1G5HA 3I58A 2CSOA 2LC4A 3UA7A 1PUEE 3HTSB 3CZ6A 2DTRA 3BY7A 3CCJA 1X1CA 2ZJ2A 2QHTA 4C3HJ 2FOKA 2E3HA 4GGGA 3CD6A 3P8YA 2HQEA 2X48A 5EZGA 5CR2A 4NC7A 5J40A 1NK3P 1E17A 2ARUA 4IPAA 4IURA 2QM3A 2VL8A 3OOUA 4M6XA 1AEYA 3JSCA 1M8MA 3F3XA 1JQQA 2XKOC 3N4MA 1YJWA 4IXAA 2XB5A 3TW7A 2KXDA 3E5XA 2CT4A 3P8BB 3VQVA 1M30A 1QCNA 5FO5A 2XG8D 2PTKA 4BJTA 2MD5A 4IHWA 1W70A 3CC4A 5HK3A 2JA5J 2G9WA 1IN8A 3MF2A 1OULA 3PSIA 3K1PA 2EYZA 5F1JA 3IKLA 5IT9E 1QE0A 1OOTA 5FLXK 3BR3A 3H9JA 2RGVA 4A3IJ 5KYYA 5FU7B 2M9UA 2C0IA 2Z3YA 3OYBA 2Q2EB 3W6VA 2ZR2A 3Q3SA 4IHSA 4CUGA 3FIFA 3ZQQA 4PSXA 3BTJA 2HD0A 2CYZB 1AHJB 1YRNB 1V5GA 2EW3A 1A04A 2ZCEA 2MI6A 2COBA 2WC2A 3NPFA 3EUKL 2JSCA 4ELYC 2Y90A 4QWQA 1P2FA 1VTNC 2QHSA 3JRGA 1MD0A 3CCQT 2YPRA 3ESWB 2EPDA 1S29A 3M4OJ 2WBMA 4M3BA 4FCYA 1H8AC 1FTTA 5LD2C 3G1LA 1K8AU 1YFSA 3LFUA 1OI1A 4RMFA 3A8HB 3A8OB 4UB8C 1QQJA 3GO5A 3WVDB 3PZCA 2HOTA 2O5RA 5E3NA 5AIQA 2NS0A 4CC7A 5C4JJ 1QF6A 3I54A 4LB5A 2HOSA 4RUGA 4JRQA 5FB2A 2KROA 1FOXA 2XSDC 3X2QH 4MNUA 2PMUA 4DIQA 3LWIA 5C4XJ 4F7UB 2AKWA 4EM0B 2GOXB 4OP0A 2KRCA 2W1OA 2XAHA 4UUTA 4A0XA 1WH5A 1VQMQ 2OTLA 3KIOA 3V42A 3HXXA 3HPGA 2LNBA 1NH3A 3CC7T 3OBWA 5HS8A 5CLSA 1TT5B 1NEGA 1FYKA 1XOVA 3MVPA 4MGRA 4OMMA 4F7UE 1RAFB 3N5BB 4KR2A 2LLKA 2DLPA 1IGQA 1VQPI 2D0NA 2MC4A 1YITA 3D0SA 2SEMA 2XGCA 1LDDA 1AOJA 4LK0F 4XTUA 1Q82R 4UV8A 1K79A 3H35A 5LJ3e 4FW1A 1KONA 3A8MB 3JAMK 3QHSA 4UVBA 1J5WA 4L6V5 2RVCA 2L3RA 3J81K 4Q6GA 2DILA 2ZCFB 2IAIA 4FW2A 2C0TA 3FISA 2H8WA 3MEVA 2MIOA 3IP4B 1ETQA 2O88A 1A5JA 2ROTA 5FJ8J 2LFBA 3C2GA 4LVJA 2D8HA 1YIJT 4J7IA 4YRIA 2J6FA 1EZZB 1X2MA 3TMOA 4EIKA 4YRMA 1X6OA 2DF6A 1BW6A 4A3JJ 3DKYA 4J9CA 2PZ1A 4P71A 5LJ5j 2FX0A 3E7LA 1FX7A 5IP9J 2EZIA 1ZA1B 3NTIA 1I39A 4EV0A 2V6CA 5L3EA 1BB9A 4E2FB 1RZ4A 2Q7EA 1SD4A 5LRRA 4C92C 3UT1A 4RTWA 3LX7A 5GMKe 8ATCB 3MEYA 3SWNB 3DB4A 3I56Q 2DL3A 3QXEB 2PI0A 1MSEC 3VYTB 1B9MA 3UNGC 3VFZA 1TU0B 3S1RJ 3BG9A 4F7UG 2OJED 5K5QA 2OAZA 1O7LA 1ZG3A 3QRFF 4P9FA 5CKDA 2HTSA 2F5TX 2UV1A 4CCOA 2PQWA 3C12A 1USTA 4KH1B 1ZSZB 2AK5A 5K1PA 1SRLA 4TVAB 5F1RA 4OB0B 3DXJF 1JXOA 2KI7A 3ZMZA 4MEYF 2JSPA 1EH7A 4RB0A 2EV6A 2GXAA 4GY5A 3R6NA 1W4MA 5KVRA 2WTEA 5LHHA 2XSJC 1SFOJ 4YCVA 2O4XA 2MMPA 3CXCA 2M51A 2DN0A 3DBRB 5KH6A 4DPGA 5KCOA 2EIMH 1AD5A 2NYSA 2BY1A 2CV1A 1O3RA 5IHIA 2GA1A 2A6TA 4JX5A 2LQNA 2E19A 1QW1A 3HGYA 5D5WB 4A4HA 1GVJA 2VVKA 3QWYA 2ZSIB 4OLFA 4MDXA 3PM1A 5K7HA 2RAEA 2RQQA 4XU1A 1MMDA 3PNVA 2HZYA 3WE2A 3EHQA 1ZUKA 2RJDA 4DEXA 1JUMA 1I5OB 2V4JC 2DW4A 1W0UA 3JCMV 2EQJA 2CT3A 1FMVA 4PLLA 3GVAA 1E3HA 2DT6A 1BA5A 5D8LB 4JJNK 4D5CA 2M0YA 1VQNA 3M07A 2DXUA 1QRYA 4X5OA 2F4IA 1FLIA 3ABKH 4Z89A 1PWTA 3HRKA 2KISA 4Y17A 3GFJA 3BR5A 3H8ZA 1EX4A 4OMYA 3LAJA 1D3YA 3ZMSA 4EJVA 4BL0B 3RERA 2JTVA 2NVUB 2KDOA 2CQQA 1R9TJ 1R5GA 3I59A 1N75A 2ZXFA 3QTCA 5FKLA 1U0JA 2OV7A 3EG1A 1HXDA 2L89A 3WU2C 2Z1DA 1VQ6T 2K9MA 1KD1U 4D0PA 3JSPA 3HXYA 3EH2A 1PD0A 3R6SA 4Q47A 1QO0D 3M8FA 1OR7A 1VQ7I 4L18B 4L0YB 4Q5SF 2WADA 5EF6A 5LEKA 1WU7A 3OY9A 4YCWA 5J6XA 2IJLA 4G84A 3UA6A 5ILSA 2NUPB 3A7UA 2YT6A 1YW8A 5C53B 1JHHA 1JJCB 3PO3J 4XLFA 3U1KA 1OPCA 5DS9A 5GAN7 5FLMJ 5GAN3 2QZ8A 4OU0A 5D6EA 2CREA 3WHBA 2V6EA 3GTOJ 4QPQA 1FBSA 2JXBA 3E2UA 1L3LA 1BL0A 3EFOA 1KQ0A 2X35A 4EQQA 1WH7A 5JFRA 2GGRA 3M0RA 1OQKA 2VXEA 1IB8A 2R5ZA 4JUVA 1D1CA 4HT9A 1X4OA 2VE9A 3FM5A 4EVIA 2EYYA 2IXSA 3VUBA 1K9MR 3G71Q 2DDZA 4HAMA 1VQ8Q 2RDPA 1LEAA 2XU8A 2A3LA 5GJVB 3REAB 1Y56A 3UATA 2FPEA 1N27A 2FSWA 4OINF 4M75B 2DTIA 4HWSA 1OZ2A 2ZXJA 3TO6A 5HLGA 2BHZA 3HHTB 2RC4A 2KJBA 3QYFA 3JTGA 1AWOA 4HWPA 2O0YA 3U2RA 2RPNA 5J8FA 2L0KA 3DEUA 1WJBA 3HRIA 2VB6A 2KXCA 4M75E 3HSBA 2XDVA 4Y7NJ 3E19A 1GCQC 2VN2A 1MDMA 1E2XA 5EEAA 4HV5A 4WXCA 1Z7NA 1GXIE 3VJPA 3RKQA 1IDYA 3FDYA 2YRDA 3M4QA 2K40A 3SZTA 3UKGA 4A3LJ 5KYXA 4XEMA 5DUIA 2MW8A 5C44J 2MABA 4FE7A 3BG6A 1UHWA 4HT4A 2QDYB 3BG5A 4KBMB 4KRTA 4YTLA 2Y69H 1E24A 1OX9A 2HS5A 3H5RA 1U8BA 4YRQA 3EG9B 2F48A 4Y15A 2P4TA 2BHYA 3THKA 3JCMh 4F7UF 1IGUA 5J1RA 2LVSA 2F6CA 2CYYA 1YX5A 2IVMA 2A68F 3PO2J 5DCFA 2RHSB 2ATCB 2NAZA 5ELNA 5C51B 4PSWA 3RESA 4PG3A 2L3DA 2CQ7A 1VNDA 1G3TA 2HEOA 1B72A 4X9CA 4CI0C 3F8CA 3KP5A 1E6HA 2QDLA 2ZPGB 3J7AF 3GW2A 4RAFA 2KE9A 3RMQA 1SG5A 1OMIA 3HM5A 5EG0A 4M75G 2DJQA 1N6AA 3QYGB 3BY6A 2FRHA 1K78A 2OX7A 1Y0NA 2J06A 3ABTA 4KN4X 3OR1C 3MKDA 1I5ZA 1S6LA 3ERMA 4F16A 1Q86C 1M1KR 3IAM2 1YNZA 2L3QA 3VRYA 3OIOA 3IWZA 1KA8A 4CA0A 1VQMI 1XQHA 4OB3B 2L9VA 3T1BA 3LSJA 4C3JJ 2XF7A 1PG5B 1UGSB 1NBEB 4RCBA 3F6VA 4HWRA 1MBHA 2E5QA 3CJNA 5HDNA 1NPPA 4GLKA 3H0FA 1PYSA 3TQNA 2M3AA 3FXOA 1JKOC 3HDDA 1VOMA 2EV5A 1RR7A 5GADJ 1YFHA 1SVMA 1YJNQ 2C0OA 1U3OA 4HF1A 4AYBA 1Y57A 3I9QA 4R55A 1V3FA 1HK9A 3AT1B 2HWVA 3BPVA 4ZTFA 2EKOA 3HXVA 1KQSS 5IH2A 3OSSC 2R7RA 2XHCA 3C94A 1P7JA 2BZXA 3QPHA 1M5Q1 1B6AA 3QWXX 1Q81U 2MK5A 2JRMA 3UWNA 3ZQIA 4A4FA 1FYMA 5FD5A 1UCRA 2P4WA 4L5EA 2E6NA 4LUDA 4NNJA 2A3SA 4WXDA 4IQJA 5K5RA 4QVCA 3B73A 2IG0A 5ELOA 4AH6A 1TTYA 2FYKA 5CVIA 4L9VA 2BOLA 2XC7A 1ZK8A 2RQRA 3H92A 1ZR2A 1I27A 2JZYA 3CCUA 2KPMA 3I56I 2P7VB 1FBUA 4RGRA 4IRGA 3MP6A 2GF7A 5DD4A 1IXSB 2KIMA 3OYGA 5A2QZ 3PT9A 3VBBA 7AT1B 2RK2A 2DYSH 4II3A 1NJ6A 1J7KA 2J6KA 2WAEA 3FXJA 1APLC 2DMOA 1UTIA 1ZRCA 3WGGA 4HV6A 2LT1A 2PMEA 5CKBA 2KNBB 1H88C 4BACA 5GANg 3W2VA 3SDBA 3ZP5A 3VYSB 3DLLF 5HOOA 2RQWA 1K73C 1YP5A 4F93B 1OCPA 3OSGA 3ZRGA 2QQAA 2FA5A 3HTUA 3CQTA 3BLYA 4HVUA 2VBXA 4I7HA 2DBMA 4YELA 4P75C 4NL3A 3WODF 3JRIA 2CUBA 4XRSG 2JM8A 4KIFA 1I4K1 4HCBA 3W3CA 1S5LC 3DU6A 2A5YB 1B34A 3TEHA 2OF7A 4C30A 1EKEA 4ZN3A 3FXKA 3V7RA 2HVRA 1MJ9A 4EM2A 3S1NJ 4KJZA 1XPXA 3I5RA 2P0LA 1RLPC 2VWFA 2Q1ZB 1KU9A 2RHXA 1ZRFA 4H2XB 4HNUA 2XKPA 4F7ZA 4CC2A 3CCSA 4P74C 4YIFA 1OCTC 3OV8A 4L9JA 1I5LA 1TWHJ 1Z7LA 3KX2A 2J05A 2Z16A 4WI1A 4AMCA 2E6ZA 1J5YA 3BDUA 3OYLA 1LJOA 1IDZA 2M7AA 3TEEA 4M73A 1JJ2P 5KYYB 2YDLA 1Q7YR 2QEXT 2PQ8A 3F22A 1A31A 2UXNA 2IVWA 3DLMA 2CV2A 2ZJQF 2NOJB 4OB2B 1M1FA 4KT5C 4XN0A 1KQ1A 1FXXA 3GFLA 3HSRA 2XAQA 3VODA 2WSCE 3TU4K 5M9OA 3QOEA 2H3EB 3CCQQ 2KT8A 2IS6A 3WTZA 2B86A 1SC7A 1NJIC 3ULQB 2C7IA 3FXMA 4ENJA 1IHWA 2LZ6B 1WVRA 2X3XD 1MGTA 3RYPA 4KDPA 4IHVA 2FJ1A 4NOYA 1DPUA 2GLOA 3MQ0A 3I64A 4CC3A 2D8JA 2CMPA 4CC4B 2A07F 4G7HF 1SHFA 3CCET 2DNUA 1W4SA 3AG4H 4C2UA 1SESA 4KISA 4JLGA 2DPUA 2O31A 4P9UA 3J7AO 2X6YA 5IY5H 4XONA 2AKWB 3OMCA 5CCAA 2F4MB 5GAMe 2FMYA 4B47A 3PSFA 1ULYA 4PFZA 3SDZA 4G7ZF 3ASOH 2ZT5A 1S8NA 4JLIA 3CC7Q 5HS7A 2VPLA 4WTOB 11ASA 2M0MA 4NC8A 3KCCA 3PMIA 3U23A 2MOXA 2LMDA 1H4TA 2P6TA 1LVAA 1L0OC 1RC9A 1USYA 3CCVT 2IGOA 4XNFA 4PFPA 2VOOA 4OVAA 3NTKA 2RM4A 3KEOA 2MYSA 1R23A 2ZPHB 3G71I 1VQ8I 4H2SA 1FNNA 3CP2A 3CC2A 1SANA 5KCHA 1N8RC 3HZJA