3RKXA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
308
Chain Sequence
KYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
total genus 99
structure length 308
sequence length 321
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkxA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkxA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkxA02
5FLXZ 2A69F 4YROA 4NOYA 4AH6A 4A12A 2W25A 1IXRC 4GCVA 1FPQA 3FMRA 2XAFA 4YRKA 1X3UA 1MZBA 4IJAA 2G7UA 2GZWA 5GAOn 2QHSA 4HV5A 3IKVA 3E6BA 2GAUA 3L9FA 4O5VA 4ZYGA 4RQEA 1ZRDA 2VC1A 1WRJA 4IRGA 3FM3A 4M78D 5HS9A 4LB6B 3NEUA 4CS4A 3QAHA 2RDPA 3O3KA 4M77G 5HGQA 2Z5UA 2HR3A 3QTCA 3QU3A 4J15A 4IHSA 5LJ3j 4Q5SF 4PJOB 4EO4A 2K57A 2VT2A 4GO1A 1R1TA 2MD5A 2A6EF 5LJ3h 4PHCA 2RHQB 1W5TA 3BJUA 1B34A 3VBBA 1R5GA 4HT8A 2PEXA 2XAGA 3ZPLA 4A0ZA 4UV9A 3SHFA 5D5UB 4PZJA 3HFVA 4EJWA 3V7RA 4PJOC 1IRGA 4LFUA 2YSRA 2NNYA 5DUKA 3Q9SA 3N97A 3K1MA 2Q8KA 4M78B 3MF1A 3L7WA 1B7YA 3KFUA 2CO5A 4M78A 4LD5A 3IRQA 2P5VA 2EV5A 2FOKA 2OQRA 4G7HF 3P8TA 2GXBA 3U9GA 4V2SA 2NS0A 1YYVA 1MJBA 2QQAA 2QM3A 3H92A 2E64A 2LF8A 3HXXA 5D6FA 4L0ZB 2EV0A 3JSPA 2PMHA 4M7AD 4O6JA 4M73A 3C1DA 4YRJA 4CS3A 3HRSA 1G3YA 3JCMb 4BXUA 4XTUA 4WCGA 3CO7C 4EM2A 2AMCA 4M7DG 4QWQA 2ALYB 1P4XA 5LRSA 4HLYA 2ELHA 4Y15A 1XGMA 2ZINA 2O61A 4RGSA 1BC7C 2Q5IA 1GXQA 1WNLA 4I98B 2Y48A 3JB9D 2STTA 1XB4A 3DF8A 1U1SA 5HLIA 3VQYA 4I09A 2L4MA 3ELKA 1W4MA 4M7AB 4MEXF 3ABTA 4M7AA 3UFGA 4EQQA 4KFCA 5GMKl 1WPYA 4P73C 1Z05A 1E17A 1K7AA 3QU6A 2I4LA 3JCMe 1X55A 4JRKA 3F8MA 4L0YB 4KUMA 4HQMA 4ZH4F 1JXSA 4PGHA 4M77D 2XGTA 3GVAA 2FNAA 5GAMj 4M7AC 3HY0A 3JCMf 1YFSA 2H09A 1P92A 5GAMh 3EFSA 2A5YB 2AKWB 2D45A 4CH6A 2RHSB 2QVOA 1WQWA 4OLFA 3REOA 2PN6A 2AKWA 2P5IA 2PBIA 3LSTA 5CLSA 4X9DA 1NJ2A 4FX0A 4WK8F 3M7GA 3ERED 3N4MA 3PFIA 6PAXA 4Q6GA 3QP5A 2I4MA 3LWFA 3ZP5A 3R07A 4MTEA 2EV6A 4LNSA 2PMEA 5K1XA 4M6XA 4NHJA 4M77B 4XLNF 4C92A 5IT9Z 3BDDA 1MDMB 4N0BA 1I5ZA 1RZ4A 4M77A 4P3NA 2H6CA 3IKLA 2W84A 3FJPA 1ZYRF 5K1PA 1SMTA 2FBHA 1ZGJA 3IKTA 1IUYA 3G1ZA 3M8EA 5GAN7 1DUXC 5LJ5h 1ZREA 5D5XB 1TH7A 1QZZA 4RB2C 3HRTA 3J80K 3TEHA 5EEGA 1YQAA 4M77C 4A0YA 1FSHA 4KIGA 4P72C 1R5HA 3HOSA 2MA3A 5ICGA 3EYYA 3C18A 3P8YA 4QLCU 5LJ3g 2E7WA 1U2WA 5D8LB 4WXDA 4K88A 4G7OF 2FU4A 3VODA 3V7SA 1JGSA 2ODRD 2DXTA 1NNHA 2I2LA 5HDNA 4FHTA 1MGTA 1ZARA 4PCQA 4YRQA 4F7UF 5LGUA 2RN7A 2E7XA 3CUOA 2R7FA 4WXCA 5A2QZ 3JCMQ 3VQWA 1BN5A 3E5XA 4AIJA 4WWCA 1IF1A 1J75A 1Z6RA 4E70A 4YRIA 3KP7A 1AWCA 3RKWA 2YLCA 1YLFA 3HTZA 3FF5A 1MJAA 4M7DA 1YW9A 2EJ9A 1QF6A 1SFUA 3ECHA 3FIFA 4IF4A 4I01A 3RYRA 2QBYA 4BH9A 4EV0A 3AAFA 1T6SA 3IHUA 2H6BA 4PDKA 4HQEA 4P75C 4RAZA 4DQ2A 2XHKA 2ODRC 4LGWA 1OR7A 2M8EA 5GMKj 2ARUA 2ZZGA 3ZMZA 1U6GA 2PJPA 3SZPA 5GMKh 3HTUA 4OIQF 3JTGA 1X01A 3EYIA 1KQ0A 4JQFA 3Q5FA 1BI1A 3HOTA 3NELA 4P74A 1PP8F 2O6GE 3A7AA 1JJCA 3L2CA 3KP2A 4M6YA 4YRNA 3FMSA 3S2WA 3BROA 1KQ1A 1SFEA 4UUVA 2P8TA 2PQ8A 1XDUA 1W7PB 3PCOA 1OYWA 2KIMA 2Y90A 1W7PA 2V1DA 2XASA 4KIBA 3K1NA 4EMHA 5H6QA 2MH9A 3FMQA 2W24A 5C52B 3MFKA 1R36A 3VU3C 1BC8C 5GAMg 1IN5A 1RIQA 2O3FA 1H0MA 3F21A 2ZR2A 5HDKA 4IHTA 4L18B 3GXOA 4CGZA 4HWRA 4LG0A 4EMKA 4ETSA 5L3GA 2AS5F 1G3SA 5ICFA 4M72A 3LSQA 2X4HA 2V6CA 1XGSA 2K27A 3UH0A 4HLXA 5HLGA 2JTVA 3ZMSA 2CYYA 4YP0A 1Z6TA 3HRIA 4YRMA 1V3FA 1NYQA 3VOEA 4BAYA 4CYDA 2I4NA 5E3IA 3BJOA 1E2XA 2QENA 1U5TA 1W66A 1EIYB 2TDXA 1QNTA 1GGMA 2IJLA 1EIYA 4H2TA 1ASZA 3HIFA 2DZCA 3WTYC 3MEYA 3WTWC 1ZH5A 5LJ5g 1SRYA 4PJOG 1IZ1A 1H4TA 3R0JA 2ZKZA 5FO5A 3RUXA 3OD1A 1U1TA 3T5XA 4LK1F 5LBQA 1HKSA 2R7DA 2DAOA 2DK8A 3IWZA 3WODF 4OIOF 1USYA 4ZTUB 3IALA 4ZYDA 2CJAA 2QQ9A 1IN6A 3GEZA 4I2OA 1TBXA 2L3DA 3LSSA 1I4K1 3JSOA 2ZCWA 5F64A 1BM9A 4HWSA 2FYKA 1TW3A 3E97A 1HTTA 2MBFA 1IL2A 4C8QF 2ZT8A 4HWTA 3I64A 3A31A 2RV8A 3EUHA 2HTJA 3DPTA 2D1HA 2DPUA 3LQQA 3T8RA 2LF7A 2KRFA 5ELNA 3O6BB 1S6LA 3ISPA 4JUVA 2Y75A 2YX4A 5E8IA 1B70A 1FT9A 3SQNA 2WV0A 3RKYA 4HA8A 4P71A 1TNTA 1YO5C 1P4WA 1WYDA 1CGPA 3SWNB 3WQZA 1ODDA 3RERA 3GWZA 5LJ3d 4J6YA 2BGCA 5DCMB 5GAN4 3RKXA 1FY7A 1L0OC 2OD5A 2FNPA 3WTXC 1GHCA 5DCMA 2EA2A 2K7LA 5BPIA 2DDZA 2P6TA 5AONA 2ACJA 1JE8A 3SWNC 2YLBA 2RA2A 5GAOp 2HYGD 1CF7B 5EEHA 1BI0A 2F5EA 4U0VA 1EFWA 3IKMB 5LGTA 1ADJA 1KU3A 4M75E 2M45A 2HTSA 4N0AC 3J81Z 3GX4X 3E9HA 1YB3A 1HC7A 1D3YA 2CQKA 5K5RA 4M71A 3CDHA 3MF2A 3M4GA 3TQNA 4KIFA 1EH8A 3FM5A 2ZMEB 3CUQB 2QHTA 3A7UA 2VOPA 3M9AA 2V9VA 1FYMA 1OYIA 2NNNA 3TDUC 3QNEA 2E65A 3I53A 3F8NA 1KGSA 2FB7A 4NB5A 4JBAA 1HSJA 2UXXA 1YGBA 3QO8A 2BYVE 4MGRA 4HF0A 1YW8A 3D5LA 1UHMA 1LNXA 5K5OA 1G4DA 4N9IA 1QE0A 2Z3YA 5C53B 2HQRA 3GFJA 4OMZA 5H20A 2P5LC 4KN4X 2DQRA 3CUQC 4BHPA 1ZRFA 5BQTA 4TQFA 2ETHA 3WE3A 4J5YA 1MKMA 5JR3A 1PDNC 1G3TA 1IN8A 5GANd 3GFIA 3T8TA 2ZJ2A 3W3SA 2QLZA 1RNLA 3GF2A 1B1BA 4IRHA 1P6RA 3RF1A 2ZIMA 1BI3A 3KP3A 3TOAA 2XKOA 4RB0A 2F5FA 5DDGA 2WWYA 3BOQA 4I0BA 1JRIA 1WQ2A 1DP7P 1BBWA 1YG2A 1TLHB 3DP7A 1E1OA 2E1CA 3KEOA 4PJOA 4U7BA 3COAC 4G84A 5GAOm 1FX7A 1IN4A 2L01A 4M75F 3I0TA 1S7OA 3VEPA 2RHQA 4EM0B 1UB9A 1FBSA 1XCVA 2CW0F 4OIPF 4Q48A 5J8CA 3KLNA 5LEJA 4Z2YA 5GAMd 1XCBA 3LC0A 5GAN6 2CJBA 5HVQC 1Y96B 1ZN2A 2NRAC 4M9XA 5CYVA 1HW1A 3QRFF 4M75G 3DQVC 2MLGA 2DJZA 2BBYA 1UFMA 4YRCA 1J2XA 4EX5A 1XD7A 2IY5B 2KJBA 2DXUA 2K4JA 3V8LA 2ZGWA 2G9WA 3F22A 2K4BA 2VBYA 1GVJA 1H4SA 2JSCA 3DEUA 5CVVA 2LDUA 2M1BA 3ROUA 2EA4A 3CO6C 4Y91A 4CH5A 1FC3A 2J5OA 2DEQA 2CGPA 3HSBA 2UZKA 1X2GA 4TWAA 2IT0A 3P8VA 5DUIA 5FB2A 3JB9I 2F5DA 4L9NA 2ALYA 5LJ5d 2DKGA 3T0YA 3BP8A 4HZFA 1SESA 4C8QC 3HXVA 1TW2A 3M1EA 1O3RA 1NYRA 1I1SA 3R6SA 3SFZA 4JLIA 4XU0A 2ZR3A 2CG4A 2YPRA 4EGZA 4KR3A 2O03A 2KIFA 3I59B 3HSEA 4P73A 3HFZB 5ILSA 2JZYA 4TVAB 4G94A 3IL2A 4RQFA 4O2DA 3I59A 2EFOA 3MZYA 2GA1A 4P55A 1E22A 4TVAA 2ZNIA 5GMKi 2DZ9A 3KP5A 1O3SA 4UV8A 2J5PA 2I4OA 3BZ6A 3PQKA 1NJ5A 2L4AA 1FLIA 3NEMA 1S3JA 3QUIA 2E3CA 2EAYA 4YFNF 3NQOA 3L2ZA 2FA5A 3JB9J 3BPXA 5IT9K 3RESA 1HSTA 4E51A 2IA2A 1W5SA 1SD4A 1I81A 2A6HF 3P9IA 4P9UA 4F7UE 1RUNA 3O2PE 2DVEA 1HW5A 4LMYA 3A32A 5E1XA 1R1VA 4A6DA 3R60A 4IXAA 3ZQ7A 2CGHA 1PP7U 4H2UA 2RHSA 4XSZF 4L9TA 1DPRA 4K87A 3E6DA 5D4SA 5E1WA 4BNCA 2EL9A 3QO3A 4HF2A 2WC2A 3GZ5A 2DU7A 4L9JA 1SERA 5KNNA 2OBPA 1K78B 1QBJA 3Q9VA 2OQGA 2PFBA 2FBKA 4NQWA 2OZ6A 2W57A 3BWGA 4M75D 2NAZA 1TTYA 4A54A 2WTEA 2CSOA 1USTA 4KDPA 2STWA 1L3LA 1MDMA 1TQIA 2ZT5A 4P72A 5D8KB 4RS8A 5A2QK 2Z33A 2IRFG 4KT5C 4AVPA 3HXWA 2ZZFA 4ZTZB 4I0AA 1K6OA 3RTRA 1R7JA 4UVCA 3QO7A 2Q0OA 4J6WA 3ICAA 2FSWA 5H6RA 4G85A 4HF1A 4YRGA 5GAN5 3FXUA 3ZMUA 4EMSA 3EFRA 3DPLC 4M75B 3HXZA 1ZLJA 1LDKB 2M5WA 2NYXA 4YCUA 3K1PA 1MGQA 5CVIA 5AIQA 4P9FA 1SAXA 4XTXA 1NJ1A 3I58A 2GQQA 5J8FA 3F23A 3UGTA 4YRSA 4M9SA 1ON1A 4U7DA 2VXZA 2JT1A 3ML6A 4M75C 4H2YA 2IP2A 5ERIA 3CJNA 2ZCEA 2OA4A 3FHZA 4HAMA 4F7UG 2QHUA 3F3XA 3TO7A 2XTIA 4KMUX 3TDZC 2VBWA 4U0WA 2M87A 4UP7A 4P3OA 2XUBA 3KE2A 3C7JA 3J80Z 5LJ3e 4IVNA 1J9IA 4P75A 1YFTA 2KKOA 3K9TA 3W6JB 2GA2A 1O57A 2QZ8A 4ZIBA 2VXEA 1EVKA 5FD5A 3VB2A 4FX4A 1X2HA 3KZZA 4LLNA 2DU5A 2DLLA 3KEQA 1YS6A 2PG4A 4NCXA 5LHGA 2LNBA 5CVRA 5BMZA 1O3TA 4BWAA 1K79A 4A2UA 2ZXJA 4P5OA 1EQRA 3OOPA 4ESBA 3HYIA 1KQ9A 2Q7HA 1QPMA 5TJJA 4EJVA 1WI9A 4L9VA 1YW7A 1PUEE 4KR2A 2VC8A 2F2EA 2DQ3A 2ADUA 4XU2A 4IRIA 3BY6A 5LGNA 11ASA 2HS5A 5FGMA 2EJFA 2VXFA 4YRLA 5F6FA 3REUA 3C3WA 3KP4A 2A07F 2P4WA 3WE2A 1Z7NA 2Q2EA 3V4GA 3E6CC 1S29A 4J6XA 4IPAA 4HX4A 4H2VA 4M78E 1XSVA 3A5ZA 4AIHA 4LJZF 2DPDA 3VFZA 1U78A 4LK0F 1R58A 3QP6A 5DD4A 4LB5A 3ABUA 2RVCA 4C8QE 2FXAA 1IW7F 2KJCA 1LJ9A 3MQ0A 3JCMJ 5GANe 1NJ8A 1SD5A 4K86A 3WU0A 3PQJA 2L54A 2PMUA 4ON0A 2OAZA 3EDPA 3F8CA 5GANf 5GAN3 4F7ZA 1JHFA 4AD9A 5JHUA 4Y13A 2Q7GA 4YDQA 2OU2A 4FT8A 1XDSA 1WKMA 2VOOA 1FP2A 2ZNZA 3JCMc 2VN2A 2G7HA 4L5IA 4UPAA 2QWWA 4RGRA 4XRFA 5LHIA 4S04A 2JRTA 2HYFA 4RDXA 3KP6A 4YIIA 2Z99A 5K1YA 4G7ZF 3QPTA 5HLHA 5ICEA 5DY9A 4UXNA 5LRRA 4UNOA 3E5UA 1S7AA 5LEKA 3MZHA 4XU3A 5GAMe 4GYIA 1RUOA 2XAHA 4CH4A 1LJOA 2CJ9A 1VQZA 4NL3A 2ISYA 3ZMVA 1KA8A 1PYSB 2YR2A 3GFMA 2EJGA 1EOVA 2KIUA 1EVLA 1C0AA 3WU1B 3FXRA 2H94A 3OV8A 1D5VA 1IN7A 3G3ZA 4M78F 5BPDA 1J5YA 2XV4S 4X9CA 3RPQA 3I7FA 4GYGA 2HDCA 4F7UB 1E24A 3ECOA 3FB9A 3JAMK 5FFXA 3TKYA 3LAPA 2EFNA 2LSOA 4A53A 1J0RA 4XEMA 4KYWA 3BPVA 2P0LA 2RGVA 4YPFA 5K5QA 2DU9A 5LJ5e 5I21A 3RYPA 4RB3C 4EJTA 4XTVA 3B02A 1FBQA 4C8QG 1BBUA 2UXNA 1FWZA 3JCMh 3DFGA 1G6NA 2HWVA 4WJ3M 4D0PA 4C92E 3E9IA 3I71A 4XBFA 3SWNA 3ERRA 3JTHA 4MMLA 2F5CA 2K02A 2VT3A 3B73A 4CHUA 3BDUA 1F5TA 4WXHA 5GAN8 1I5LA 5FFZA 4HYEA 5FLXK 4N0AA 1WQ7A 1G51A 1BI2A 4HOBA 2ZIOA 4A6EA 4M7AF 3VQXA 3LA3A 1CF7A 4U88A 4ENMA 2JPCA 3ZMTA 1N9RA 3J7AO 1NJ6A 1WWXA 4MMKA 3T1BA 5F1RA 4R79A 1IXSB 5LLQA 3RI4A 2HEOA 2JN0A 1HQCA 5FD6A 1LDJA 4B09A 3EETA 3BJ6A 3SXYA 4XEOA 2X0LA 1FBUA 4CO8A 5D5VB 3IC7A 1KU7A 2AXLA 3L09A 2ZMEA 3CUQA 2QUFA 1H4VB 12ASA 2DBBA 2W85A 5HDGA 4PG3A 4AWXB 4ENJA 1YTYA 5BOXA 4ZYHA 4H2XB 5HS7A 1H9TA 3NENA 5GMKe 4UVBA 1B76A 2C7IA 4H0EA 5KK1A 1FYLA 4M7DE 2XGXA 3WGIA 4TV7A 4C92F 2E5AA 2XAJA 4MQVA 1IXCA 2Z9OA 4M74A 5F5WA 2ZO4A 2HGCA 4M77F 2RD1A 5L3FA 1YFRA 4WJ4A 1HK9A 3JCMP 2ZT7A 4NL2A 1SD6A 5ELOA 1OKRA 2COMA 3L00A 5E20A 1A04A 4KMFA 1LQ1A 2D2WA 3F6OA 1ZG5A 4O3MA 4C92G 1O3QA 4RCCA 3HXYA 1IRFA 4EM1A 2EB7A 3EQLF 4HDVA 4H2WA 3A7RA 4EMGA 4C8QD 2ZZEA 2UWMA 1LVAA 5L3BA 1SFXA 2P5KA 3GW2A 1B34B 4HW0A 5CJ9A 3R4KA 2IW5A 3E3VA 4EVIA 2V79A 3HSRA 2IVMA 1Y96A 2RM4A 1EV7A 3HHHA 3HXUA 5ED4A 4WI1A 1B7YB 1X56A 2ESNA 4OIRF 1XMKA 4KNYA 1DPUA 4ESJA 3GIBA 2IY5A 4MNUA 3TOBA 4RB1A 4P96A 1F1ZA 3LA7A 2ZXFA 4UP8A 2IA0A 2XKPA 1IAWA 4C8QB 1KQ2A 4G6DA 3F8BA 3GYHX 4EJUA 2HNIA 4BYYA 4MEYF 1EH7A 4C8QA 4M7DF 1SD7A 1P4AA 1LNWA 2FRHA 1STZA 2M30A 1T2KA 2P6SA 3ZN0A 1XSDA 2C6YA 3DV8A 4M78C 2VE8A 3KETA 4R8HA 3TEGA 3QO5A 2GIVA 4WF2A 1Z7UA 1REPC 3IRRA 1ZRCA 3QPHA 2ESHA 4MQ9F 2AMCB 3JCMg 4PGGA 2ZT6A 5DCFA 1LDDA 3R0AA 2ZFWA 2HFHA 1HW2A 5E18F 3SB2A 2DI3A 5E17F 1OPCA 2BE5F 2QYOA 2G4CA 5GANj 2HQNA 2RKHA 3HFZA 3L1AA 4WX9A 5GANh 1N9WA 3F8FA 3QOPA 3RPUA 4UVAA 1HKQA 4XTYA 2MLKA 2FMLA 5HOOA 3V7CA 3NETA 5D6EA 3K2ZA 2L02A 2DT5A 2A68F 1KMNA 3HTSB 1EH6A 1V4RA 1H9GA 2JPBA 2A3SA 1S8NA 2FEZA 1FYFA 1T0FA 2DTRA 4RGUA 4UHTA 1JHHA 2D1VA 4XLPF 4C92D 1I27A 4HVCA 5LHHA 3DXJF 4CS2A 3WGHA 1FYKA 2BEOA 3FXQA 3BW1A 4GXOA 1UHWA 3M4QA 2BV6A 1N9SA 1ZG1A 2VODA 1BIAA 2DTIA 2P7CB 1X54A 3L4GB 1D8KA 1RI7A 1SMYF 1FSEA 1K78A 1O7FA 1HXDA 3L4GA 1QO0D 3GLXA 3WTUC 4RAYA 2EFPA 1Z7MA 5DV5A 2V1UA 5GMKm 1ULYA 3JW4A 1KYWA 5GAN2 1T39A 1ATIA 4L87A 4C92B 4H2SA 2C8MA 3V8KA 3CMQA 1D8JA 3HUGA 1U8RA 3A74A 4YYEA 1FNNA 4XSXF 2Q5HA 2EFQA 1Z1DA 4ZZLA 1I6XA 4QVCA 2O8XA 5LJ5j 1TNSA 4OMYA 3TEHB 4RMFA 4C92C 4TQDA 5ILVA 2DQ0A 1ZLKA 5AIPA 1OYYA 4AIKA 2E41A 4CXFA 2EK5A 2VBXA 1T98A 1H641 2HKXA 2QQBA 4M75A 4U0YA 3MAJA 3K69A 1WSUA 2RQPA 3JCMV 3CTAA 3LQRA 5ILUA 1HBXG 4M7DD 4XTWA 1KYZA 3GFLA 5GAOr 3KFWX 2CWEA 1C0WA 4X5OA 3GO5A 1KU9A 4YCVA 1TQMA 3HY1A 3UGQA 1UCRA 4TTVA 1B9MA 2YX7A 4EGYA 2H27A 3BY7A 1MD0A 2ARSA 1G5IA 1H4QA 2QTXA 2ARTA 3JB9H 3K0LA 4HT9A 1XSXA 1QGPA 3DSQA 3HRKA 4JRIA 4B8XA 2HZTA 2J3LA 3E5QA 4LLLA 2P7VB 1B8AA 3M8FA 1LYLA 5LJ3f 3WTTC 3SZTA 3F6VA 3A5YA 2EJRA 4M7DB 4I7HA 2A61A 3P9CA 5JVTA 4G8XA 4HWOA 3WTSC 1I1GA 5E8GA 1GXPA 3LA2A 2Y0MA 4ENKA 2QBYB 3WG9A 5TRDA 2PI0A 4CICA 2MC3A 3HFNA 3KZYA 1B9NA 1W7PD 2DW4A 1U3EM 4JK1X 4M7DC 1J5WA 1KOGA 3W6KB 4L5JA 2GWRA 1QQIA 3RJPA 4PJOE 1E1TA 5DD8A 2XIGA 2FMYA 5KVRA 4YRTA 3TUPA 1YIOA 2FQ3A 4YRPA 5GANg 4OINF 5DYMA 4YRRA 3BJAA 4Q47A 1JJCB 1L0WA 4Q15A 2DO7A 1USSA 4OP0A 4Y17A 4A5MA 3H3ZA 3RDIA 1G5HA 3I4PA 4BHCA 2XRNA 4KN7X 1OMIA 4RCBA 1DDNA 3MEXA 1KQ8A 2HKOA 4XTZA 3PCOB 4S05A 4H02A 3E6MA 1FP1D 4HX8A 4P74C 4HV6A 2FF4A 4HBLA 4PNOA 3I5UA 2ISZA 4RGXA 5IT3A 3QHSA 2RB6A 3JCMd 3HFOA 4YREA 4P3PA 4OU0A 5E1ZB 5JI6A 5L3CA 2E10A 3LAJA 1FZPB 1R23A 4LG0B 4EMKB 3AHUA 1QZYA 1TQPA 1Z9CA 1F4KA 3I54A 3RACA 1ADYA 3M4PA 4BW9A 4CZZA 2QHVA 5HS8A 4I02A 1XN7A 3HHGA 5L3EA 4MTDA 2VC0A 1XGOA 4EJOA 5JFRA 2J3MA 2V1XA 1HKTA 3HRMA 2PMFA 1BOAA 2E1HA 1ASYA 3INZA 3R61A 3TO9A 4OOIA 3VQVA 4EMKC 3MCZA 4BHBA 3H3UA 3GUDA 3CLOA 4TVYA 1U5TB 2O0YA 1LB2A 2IA1A 4PJOF 2EWNA 4YFKF 1XGNA 3WTVC 1I8FA 1YCYA 3D0SA 1ZG3A 4N9HA 5GAMf 1F9NA 1MJ9A 5ICCA 2XVCA 4R1HA 2EFWA 4YFXF 4YCWA 3U2RA 1B4AA 4M7AE 1G3WA 4G6QA 3BFMA 4YG2F 1KU2A 1U5TC 1PYSA 4HX7A 4A0XA 5CVUA 2XROA 4CDGA 4ENNA 1P2FA 4ZZDA 1ZGAA 2GXGA 2LKPA 1Z91A 4XU1A 3KCCA 1YS7A 1FOKA 3V8JA 2YU3A 1Y0UA 4G9YA 3PGGA 1M8VA 4F7UA 1R00A 1YFHA 1SETA 1BJAA 1WU7A 5GAOq 3PZCA 3REXA 3P7NA 4DNCA 4M9ZA 2YHTA 2ZTGA 4DPGA 1B59A 1LEBA 3ULQB 5C51B 4MHGA 4M78G 1J7KA 1R1UA 3ZN1A 1USYC 1XMAA 2Q7EA 4ASNA 2DQLA 3TGNA 5D5WB 4CH3A 2RC4A 3KLOA 4BQAA 5LJ5f 4YIFA 2MH2A 3RL6A 3J81K 3WTZA 2HOEA 3JCMX 1B6AA 5CVJA 1B70B 4XQ3A 4TVWA 4KQEA 3ZMDA 5BS6A 1D3BB 4M77E 4UP9A 1R22A 2FBIA 3HSFA 2PLYA 3IWFA 4GGGA 5L3DA 1T38A 1D3BA 2DTHA 1NHAA 3LFKA 4KA4A 4YRFA 1WLEA 2VONA 2OZUA 4A5NA 4ESFA 1ZAOA 3U1DA 3G73A 1LOJA 3JCMW 3TO6A 4P71C 3FX3A 4LLGF 3JAMZ 2DFIA 1AOYA 2RNJA 2VE9A 1O7LA 1ZHFA 3GZ6A 5D4RA 3IG2A 2DTOA 1BIBA 1VTNC 3FWEA 2E1NA 2ZNJA 4QVDA 3HRUA 4HDUA 1KMMA 5J6XA 4M7AG 3NRVA 5DEQA 2K86A 2XAQA 1JBMA 2VBZA 3DKWA 3F72A 2FE3A 3JB9F 1ONVA 1J59A 3WGGA 4Q4ZF 2IPQX 5CAIA 3P9KA 4HWPA 3RIRA 5GAOl 2ZNYA 2B0LA 2R3SA 3QSUA 4ZYEA 1BBYA 2CIMA 2CFXA 4KICA 2DK5A 4H2XA 4K2EA 1LEAA 1Q1HA 4PJOD 1M5Q1 2ZBKA 3MWMA 3JB9G 1RIOH 1ON2A 3FZVA 3RGLA
chains in the Genus database with same CATH superfamily
2GQVA 4YROA 4NOYA 4Y3OA 3QYBA 1NG6A 2XAFA 4YRKA 5B66C 4IJAA 5GAOn 2QHSA 2EVRA 4HV5A 3CCLT 1A5JA 1Z9QA 1X43A 4O5VA 2QG9B 4C9YA 4ZYGA 4JPBW 2EZLA 3SEMA 2Y9ZA 2PTKA 5HGQA 1SKUB 2HR3A 3QU3A 3WXMB 1VQOQ 4IHSA 5A0LA 4EO4A 4CUGA 2MD5A 2ZCFB 2OCEA 3CQTA 1Y8QB 4BS9A 1W5TA 3VBBA 3LSRA 4HT8A 2PEXA 2MAMA 2XAGA 3ZPLA 1JT6A 5D5UB 4PJOC 2F4OB 1IRGA 4JS5A 4LFUA 5DUKA 3S17J 4M78B 1W36C 3MF1A 2JM8A 2VGNA 2R7VA 3IRQA 2P5VA 3QJ6A 2BZTA 2RQRA 2NS0A 4M3FA 5J26A 1YYVA 1VQMI 1PKSA 4QPQA 2QM3A 2LF8A 3HXXA 4W97A 5D6FA 1UHFA 3QKJA 1VQOI 3C1DA 4FSSA 4BXUA 4UY8I 4WCGA 3CO7C 3GTPJ 2AMCA 1PSEA 2K9GA 2ELHA 4RGSA 2P0QA 1M1FA 4OB1B 5B1BH 4I98B 2PMZN 1JJ2S 1RC9A 4XLFA 5HLIA 2L4MA 3ELKA 1XC5A 2XG8D 2NYSA 5FKOA 2RHIA 4RTWA 1UG0A 2EZHA 4EQQA 1XJWB 3QU6A 3F8MA 2HDWA 3SFIA 4PSWA 4FYWB 2XGTA 3H5AA 5A2QE 1YFSA 4IUPA 4Y33A 1P92A 2KPMA 4RLFA 5GAMh 1NH3A 4XRSA 3GTQJ 1WQWA 2AKKA 2DCEA 2P5IA 2JA8J 3REBB 2PBIA 1JKOC 5FW9A 2O5RA 4X9DA 2CUZA 4WK8F 4LVMA 4Q6GA 1ZSZB 1ZSGA 2Y0SN 2O4XA 3R07A 1ENHA 2KHMA 3C12A 5IXBA 4M6XA 2DLPA 1PUFB 4C92A 5IT9Z 3BDDA 1ZUUA 4JJBA 3A8MB 2P4RA 1T95A 1RZ4A 1K4TA 4M77A 4P3NA 2H6CA 1I3QJ 5HLTA 4HEA2 1ZYRF 2CW7A 3WVEB 3VYHB 3IKTA 1UJ0A 1CKAA 5D5XB 1TH7A 2O88A 4M77C 4A0YA 1FSHA 3CLQA 1X1AA 3D7SB 1E3PA 3EYYA 3CCSI 3C18A 1OJLA 2E7WA 2DMNA 3CC7I 5D8LB 3V7SA 1IV8A 2MCNA 2K3FA 2LKSA 1ZLMA 2DXTA 1M2OA 3CCQQ 4FHTA 1UHSA 4YRQA 5JLXA 5KAIC 1TL8A 3VQWA 5LL6S 1J75A 1Z6RA 3BTCA 3M9QA 3RKWA 4M3GA 3ASOH 5FU7C 5K7FA 2GF7A 3HTZA 1N27A 3FF5A 2EJ9A 1QF6A 4AG1C 4CCOA 3ECHA 3UA7A 4I01A 2UV1A 3CMYA 1WZOA 1QPIA 2DOAA 3UF4A 4PDKA 4ABZA 4HQEA 4RAZA 4DQ2A 2XHKA 2ODRC 1OR7A 2ARUA 3CCUI 1F36A 2PJPA 3FDRA 5GMKh 3HTUA 3JTGA 2VQHA 4KT6A 2CT4A 4QTRA 2O6GE 3LX7A 3CCET 2XPVA 3KP2A 5EG0B 4YRNA 3S2WA 3CPWA 2VWFA 4RTZA 1R0BG 1H89C 2BVLA 3UNGC 3PCOA 4HRIA 2KIMA 2Y90A 1W7PA 2QKMB 3X2QH 2DODA 2YU9J 3AG1H 2K79A 3MFKA 1R36A 5I22A 1Q81U 1IN5A 3ZQQA 3G71Q 1EA3A 4PJNA 3A8HB 4LG0A 4EMKA 3DBRB 2YUSA 4M72A 2X4HA 3VV0A 1XGSA 2K27A 2HCKA 4ZN1A 1QKWA 4F17A 4ZNXA 3LSIA 2HEQA 2JTVA 1Q82U 4YP0A 1YI2T 4M3BA 1M3AA 3HRIA 3Q0VA 2A28A 1V3FA 2OF7A 2GBYA 3VOEA 2YS9A 4CYDA 2I4NA 5E3IA 1E2XA 4MZTA 4UUSA 1KQSP 1W66A 3EGXA 3HEFA 1GGMA 3H0FA 3EG1A 3HIFA 2DZCA 1RAEB 3AG3H 1YRNB 4TVRA 1SRYA 3KXTA 2L5QA 2WY7Q 4F91B 3OD1A 2FG0A 5LBQA 3F0CA 3WODF 1USYA 4ZTUB 3IALA 3OYBA 1X19A 2CJAA 1RRJA 4HCCA 3CF5F 2VIXA 1I4K1 3JSOA 3FISA 1BM9A 1AEYA 4RG8A 2KXCA 4C8QF 2ZT8A 1MV0B 3P8BB 1S9HA 2OCCH 2QTVA 4H4KC 3M53A 1MUZA 3HOVJ 4GLMA 1YOVB 1SFKA 1B70A 1FT9A 3SQNA 3RKYA 4HA8A 3MO8A 5ECAA 1BYMA 1ODDA 5IOZA 2PUKB 3GWZA 2JW4A 3I4MJ 2WAQN 5LJ3d 2RI2A 4XLHA 1IDYA 3RKXA 2OD5A 2FNPA 2VQLA 5DCMA 1PC0A 2J6OA 3M4OJ 3E1SA 5EEHA 4U0VA 1ADJA 2M45A 2C0IA 4IUQA 5KYXA 1T3SA 1Q1VA 4NNJA 3CDHA 3MF2A 3TQNA 1A6IA 1OCOH 3FM5A 3QWLA 3M9AA 3QNEA 2V8IA 2YRCA 2E4HA 2E65A 3I53A 4J9EA 3QO8A 2BYVE 4MGRA 1YW8A 2QSGX 3D5LA 2EQRA 1G4DA 1QE0A 5C53B 2HQRA 3GFJA 3CUQC 3O8VA 1PDNC 1G3TA 1IN8A 3GFIA 2BY0A 3NWTA 1WHJA 4IRHA 2ZIMA 3CC4Q 3KP3A 2XKOA 3OYYA 1V54H 1Z21A 1QHGA 1KG1A 1TLHB 3DP7A 2PMZA 1E1OA 2E1CA 4G84A 4BY7J 3H6ZA 1OISA 1U9OA 3PMIA 4M75F 3KYCB 1NLOC 2CW0F 4OIPF 4N4IA 5J4YA 3G7ZA 5J8CA 3KLNA 2BIVA 3BTJA 4FIBA 2R7RA 3S3MA 3LC0A 1A6QA 2ATCB 5GAN6 1ZHIA 2COZA 1Y96B 2NRAC 5CYVA 2P84A 2FPDA 2MLGA 1W0UA 5E3OA 2DXUA 2K4JA 2D5VA 3CC4I 2G9WA 2K7AA 4Q5WA 3OYDA 2GNCA 1FC3A 1X69A 3M0QA 2J5OA 3TEDA 1BR4A 5GAGJ 4CC4B 2UZKA 1AZGB 2DXIA 1BCOA 3P8VA 3H5RA 2Y0SA 3JB9I 4L9NA 5LJ5d 3T0YA 1DP3A 3HXVA 2EZIA 3R6SA 4XU0A 4EGZA 4KR3A 4HVWA 1IV6A 2O03A 4A63B 1VQNT 2Y69H 3HSEA 4P73A 4IHVA 5ILSA 4RQFA 2EFOA 1E22A 2V1NA 4JLGA 5GMKi 1EJ9A 3KP5A 1O3SA 3HPGA 2LTPA 2FHDA 1YJNA 3B6CA 2IXSA 1T8IA 2RF0A 2CRGA 5IT9K 3RESA 1HSTA 4E51A 1SHFA 3WU2C 2DVEA 4LMYA 4FYVB 5IHKA 2I8DA 2V4JC 4XR6A 1HOMA 4K87A 3VS7A 3FC3A 3MKZA 5E1WA 3C2BA 2YXYA 3I55A 1ZSZA 2XSJC 1APLC 5IAYA 2FBKA 2J6FA 4A54A 2K5IA 4A3GJ 1H3HA 1PUFA 4P72A 2PQWA 5D8KB 2IRFG 2TRTA 4I0AA 4J9CA 3H0GJ 1AZEA 2FSWA 5GAN5 4K11A 3CDIA 3FXUA 2NS8A 4DYRA 1X6OA 3CCMQ 4ELYC 2M5WA 2NYXA 4QPOA 1WZ2A 4DW6A 3PNYA 3WHCA 2LH9A 2X6WA 2L3RA 4IOAF 2FO0A 3ZGKA 1LPQA 1I07A 5KYWB 2VXZA 2DT7B 2R58A 2CSQA 2GOMA 2IP2A 3S15J 2DXBA 3FHZA 1R49A 1JJ2A 2M3AA 3FKIJ 2XTIA 3JRGA 3PT9A 2VBWA 4U0WA 4XL9A 4ZDLA 4UP7A 4P3OA 1JJ8C 3C7JA 3HL2A 3J80Z 4IVNA 1Q86C 4P75A 1YFTA 2GA2A 1O57A 3QJYA 5CPRB 3LFUA 3VB2A 1QVUA 1X2HA 3G1JA 1IO2A 1BW6A 5LHGA 5EZHA 2LNBA 1O3TA 1K79A 4A2UA 1EQRA 2Q7HA 3ZQFA 5F1JA 1N8RC 1QPMA 3TSWA 4EJVA 1R0CB 1YW7A 2KRSA 8ATCB 2GTJA 4KR2A 1WVRA 4HVVA 1LCKA 2ADUA 4XU2A 2LQWA 5EG0A 3GLLA 2RI3A 2EJFA 2VXFA 4YRLA 2JVHA 3G1LA 2EIKH 1VQLA 3K4JA 5CKBA 3VFZA 1GBQA 5DD4A 4LB5A 2RVCA 1WJAA 2JA5J 4C0DC 3WU0A 2PMUA 3FXMA 5GANf 2K3YA 3VS1A 4D8KA 1JHFA 2OU2A 4FT8A 1HLVA 1XDSA 2ZNZA 3CMAT 4QQDA 1GL5A 4E7JA 4UPAA 4RGRA 3NAUA 4XRFA 4A3LJ 5LHIA 4S04A 2JRTA 3IH2A 1IO6A 4G6TB 3S1QJ 4YIIA 4Z88A 2ECCA 2HNHA 2BXZA 2G0EA 1X6BA 4G7ZF 3D5SC 5J3BA 2QCOA 4YEJA 2R7OA 4ZN3A 2WAQA 1R6RA 4UXNA 4V2FA 2RI5A 4XU3A 4BY6C 2CKKA 2E5NA 3ABLH 1YRNA 3ZQCA 2EYXA 1VQZA 1N8RR 3ZMVA 3CCRA 3G6EA 2ZJQF 1MBKA 2K9MA 2JTFA 1C0AA 2CV0A 3G3ZA 4M78F 5K7HA 3I7FA 1Y0NA 4GYGA 2HDCA 1E24A 1Z3XA 1J0RA 4KYWA 5I21A 1K9MC 3ZQGA 2ED1A 3B02A 4C8QG 2JJ9A 3M0SA 3FK7A 1FWZA 4DOWA 1UE9A 4A3BJ 5GADJ 2HWVA 3LMMA 4WJ3M 2ECZA 4XBFA 3LYIA 2WB1N 5GPAA 3QOEA 1GV5A 1IGUA 3BDUA 1OULA 2X6YA 1I5LA 4HYEA 2DM1A 4N0AA 1WQ7A 2BE7D 1WHKA 2V8KA 4A6EA 4N4GA 3LA3A 4XOTA 2JPCA 2K9QA 1WWXA 5F1RA 2X6XA 3PIPF 2PJRA 5FD6A 1LDJA 2ABLA 3SXYA 2X0LA 5D5VB 1KU7A 2AXLA 3L09A 1K73R 4JS4A 2EH3A 1VQ9A 1VQ6T 4A3IJ 3C95A 4H2XB 1KC8C 1H9TA 2UUZA 3OYAA 1OCTC 2Z0WA 3HL8A 4H0EA 1K9MR 3WGIA 2E5AA 2XAJA 1W6XA 5F5WA 3BLYA 5L3FA 1J3TA 5C3EJ 3I4NJ 4WJ4A 4LNPA 3S1RJ 3P8DA 4NL2A 1SD6A 3L00A 1A04A 1LQ1A 4C92G 2G3RA 4B3AA 3HXYA 3RZDJ 3EQLF 4H2WA 4CI0C 3A7RA 4C8QD 2ZZEA 1LVAA 3S14J 1K83J 4NC7A 4RDUA 3OW2P 2MABA 3GW2A 1B34B 5CJ9A 2LD5A 3OL4A 1OQYA 1HD3A 1JU5C 1GCPA 1Y96A 1EV7A 3HHHA 2XGCA 4WI1A 2LC2A 3REAB 1X56A 1Y1VJ 4II3A 1SG5A 3N05A 1K8AR 3TOBA 4P96A 3LA7A 1RESA 3IQLA 1B72B 4MEYF 1SD7A 1P4AA 2M30A 1AHDP 1OPKA 1KC8R 2P6SA 3OQ5A 4ZC3A 3QO5A 1S72A 1PRMC 1F43A 4BACA 3IRRA 2HPIA 1FEXA 4IKFA 4PGGA 3JSCA 5DCFA 4Z8AA 3R0AA 2ZFWA 3LGLA 4OF1A 5IP6A 2COBA 3I55I 5E17F 1OPCA 2BE5F 2QYOA 2G4CA 2HQNA 2RKHA 1SPKA 2RHZA 3RPUA 4BBRJ 1YWOA 1HKQA 2QGGA 2FMLA 5HOOA 3CMEA 4ZTFA 3V7CA 2L02A 3HTSB 3GBGA 4A3CJ 2Z2SB 2XF6A 3VDXA 1K73U 2FEZA 1FYFA 3IP4B 4UHTA 1JHHA 3A01B 4KH0B 4C92D 1I27A 1RETA 3OSFA 1JXMA 4Y92A 3FXQA 4ORZA 5D6WA 3M4QA 4UB6C 1ZK8A 4IHWA 2DTIA 3ASNH 1X54A 3LSPA 4QKUA 1K1ZA 3PNWC 1O7FA 3WTUC 2PUOB 5DV5A 3QBYA 2OTLT 1KYWA 4H2SA 1M3BA 1MHNA 4LDXA 2DFUA 1U8RA 3A74A 4YYEA 1WX6A 3VS3A 1RABB 1IHVA 1JB0E 2O8XA 5LJ5j 4KBMB 1TNSA 2LMJA 3JR9A 2RJCA 4AIKA 2E41A 3R6OA 2DL3A 1X2MA 1H641 1WFXA 1MIJA 3MMYB 3MAJA 4B4CA 2E5QA 3EG2A 3IH3A 3KFWX 1W70A 4NUBA 4PFZA 1K8AU 2DFHA 3GO5A 4II2A 1TQMA 3ZL7C 3UGQA 4TTVA 4EGYA 5KYWA 1MD0A 2M0YA 3CXCA 3GTMJ 2QEXA 3HGGA 2VPLA 1OU8A 3OOUA 2HZTA 2J3LA 3E5QA 4LLLA 1WA7A 3EGUA 1X6GA 5LJ3f 4A3DJ 4KITB 4HSRA 2RJEA 5JVTA 4HWOA 2HQEA 2H8HA 1I1GA 4A3MJ 4ENKA 2QBYB 2VJ4A 1N6AA 3IH4A 2ECBA 2YUNA 1W7PD 2DW4A 4M7DC 1J5WA 3W6KB 2GWRA 3BR2A 1E1TA 4JDSA 3A1PA 4C30A 5C6SA 1K61A 5GANg 4CRIA 4YRRA 2C0OA 4BDZA 2DO7A 5M5YJ 3M0TA 2KMUA 3RDIA 1G5HA 2XRNA 4KN7X 3UDCA 4RCBA 4DOZA 2OV7A 4FM4B 4H02A 3TP3A 2VPRA 4P74C 3CCRI 3MKYB 2FF4A 2K3XA 3RBBB 4PNOA 2CSIA 5IYCJ 3JCMd 3HFOA 4P3PA 4OU0A 5E1ZB 5JI6A 1P9QC 2AT1B 2Y31A 1FZPB 4AT1B 2DA3A 1JT0A 3CCEQ 3I54A 2VV5A 1ADYA 2R7ZJ 2DK3A 1XN7A 2QA4T 1BOAA 3ONQA 2E1HA 2PVDB 4OOIA 1I1JA 3MCZA 1WHLA 2ENMA 4TVYA 2WB1A 2O0YA 4RMNA 4PJOF 2EWNA 4YFKF 2RH2A 1XGNA 3UR3C 5M3FJ 1ZG3A 1MJ9A 3CBPA 5ICCA 4R1HA 1BB9A 5F04A 4YCWA 4M7AE 1MMDA 1RR8C 3M0UA 4OB0B 4AFZC 4L5GA 4HNUA 2DJIA 4IUVA 1ZGAA 1LFBA 1YN8A 1Z91A 4XU1A 3TVTA 4A4FA 1YFHA 5GAOq 3PZCA 4IHXA 1V1CA 3ULQB 5C51B 1J09A 1FXXA 4M78G 2ME0A 1J7KA 1R1UA 5E3NA 1D0YA 3EH1A 5LJ5f 4RMOA 4UB8C 3HDDA 3OIQA 3RL6A 1ACIA 1B6AA 1VQ9I 4XRMA 2MC4A 2PVOB 4TVWA 1YX5A 5CKTA 3EUHC 4BUPA 2FBIA 3HSFA 1GCQC 3MQZA 5L3DA 1O4XA 1OZ3A 1NHAA 2VONA 1VQKA 3H0IA 4ESFA 1ZAOA 2XDVA 4FT4A 1WGXA 4LLGF 4CYCB 2DYIA 2ZJPF 2VE9A 1O7LA 1ZHFA 1WHHA 3I5RA 2COWA 3FWEA 2ZNJA 4HDUA 2HAXA 3NRVA 2NUTB 3F72A 3JB9F 1ONVA 1J59A 1PVEA 2LVMA 2XIDA 4ME7A 1VQMT 2W7NA 4H2XA 4K2EA 1LEAA 1Q1HA 1VQOT 1MH3A 2VB6A 3FZVA 2W25A 1KZHA 2XMFA 1X3UA 1MZBA 2GBQA 4OAYA 1NBEB 5EF6A 1ZRDA 1WRJA 4IRGA 4M78D 2VKNA 1S72I 4MO7A 2FD5A 3O3KA 2Z5UA 2BZXA 3QTCA 1BR2A 1CKBA 2K57A 1E3OC 1WJQA 2XGDA 4ZGJB 2RHQB 2JQ7A 2A36A 3RSNA 1B34A 3HC7A 2HL3A 4UV9A 2VASA 3OSGA 2ED0A 4EJWA 1IHWA 2QDYB 2PX9A 2NNYA 3CCJT 3K1MA 2X51A 2AZSA 3KFUA 1T56A 1WJBA 2VUMJ 2CO5A 5EDNA 5KCHA 2LKXA 3U1KA 2OQRA 4P1WA 4G7HF 2R7QA 2KSSA 2VYTA 4AM3A 4XK4A 2DD5A 4HKEA 4O6JA 4PLIA 1NJIC 4QWQA 5IT9E 1AKHB 2ZPIB 4A3JJ 1XGMA 3HZJA 1BC7C 3HKSA 2Q5IA 2VKHA 2QI2A 3EUKL 1XB4A 3DF8A 3MKDA 1U1SA 3CCST 4II1A 1W4MA 3CC7T 4M7AB 3NTHA 4FSXA 2HKQB 3ABTA 1TOVA 3ZRGA 4FCYA 1Z05A 2L2PA 2QDLA 2OTJA 3A01A 3KUFA 4KUMA 1JXSA 2FZKB 3GVAA 2OUMA 1VOMA 5GAMj 2L9NA 3BR1A 2JMCA 3EFSA 5CCAA 4GDFA 2AKWB 1VQNQ 3GF5A 2QVOA 1IRZA 4LUEA 3CCLA 2PN6A 3HOZJ 3OIOA 3PSFA 3M7GA 3N4MA 3LWFA 3PNVA 2QEXI 4LNSA 4FE4A 5A0DA 3GP8A 1NJIR 4NHJA 1E6GA 1TUCA 1U9NA 1MDMB 2AQFA 4N0BA 1M4ZA 1NG2A 3CCUT 3IKLA 2LLKA 2DA9A 2M4KA 2KE9A 1MSFC 3RDVA 1IUYA 3G1ZA 1DUXC 4RTVA 1U06A 1P7JA 2K5CA 1ORKA 3J7YJ 1VQPA 3GNFB 3HOSA 1AA7A 5LJ3g 1BL0A 2D0NA 2K9NA 3VODA 1JGSA 2JTMA 2IS2A 2M7BA 5HDNA 2NS7A 1OU9A 1MGTA 1ZARA 2XHCA 2R7FA 1VFCA 2BY3A 1E0EA 3OL3A 5D7UA 4YRIA 2M0CA 4BJ6C 4IIMA 4RM2A 3ULRB 1MMAA 1XQHA 1OCPA 4QIWN 4BE2A 3FIFA 1SVMA 3RYRA 2QBYA 4BH9A 3OYLA 3LGFA 2H6BA 1MMGA 2DJNA 2RQTA 1EF4A 4LGWA 5GMKj 3CCVA 2ZZGA 2F5KA 2MI6A 3H35A 4HNVA 2RJFA 3HP9A 4IOCF 3EYIA 5FKLA 2H3EB 4JQFA 1BI1A 3NELA 3BG9A 1B7TA 4X1EA 4CA0A 3C2HA 2E34A 3DU6A 4J7FA 4M6YA 1GXIE 3FMSA 1QVFS 4PLLA 4UUVA 2PQ8A 3CD6A 2DL5A 1OYWA 4DJAA 4OB3B 2XASA 3PNTA 4KIBA 1VQ4T 1ZELA 4EMHA 1UGRB 5C52B 2JWTA 1RIQA 2O3FA 5IOYA 3NARA 2ZR2A 4IHTA 4CGZA 3GXOA 2MYSA 2AS5F 1YJ9A 3LSQA 5FLVA 1PNJA 3UH0A 4YRVA 1M90C 1VQ7A 1Z6TA 4ELZC 1NYQA 3UT1A 4C2MJ 3BJOA 2QENA 1A35A 3O5ZA 1EIYB 2E6ZA 2TDXA 3DCFA 1YIJA 5HK0A 2EYZA 1ASZA 1DGWY 3WTWC 1ZH5A 2LY9A 5LJ5g 4PJOG 3OYJA 4A3EJ 4ZJZA 5FO5A 1VQKI 1QQJA 3RUXA 1OI1A 1YJWA 3CMAQ 1U1TA 3T5XA 2DYBA 2NVUB 1HKSA 4OIOF 4E6KG 4ZYDA 2XICA 2QQ9A 2KMTA 2LQ8A 2L3DA 1TT5B 4PUSA 1QW1A 3DTEA 2ZCWA 3WHBA 2FYKA 3BT9A 2DYRH 1HTTA 2MBFA 4D7MA 2RV8A 5B5EC 2HDAA 2DPUA 2LF7A 2KRFA 5ELNA 3VS0A 1S6LA 2CH4A 3ISPA 4JUVA 3QPLA 3CEYA 1AHJB 1ETKA 3SD4A 4J6YA 2F2WA 2ID3A 4F14A 5GAN4 1FTZA 3OIPA 1GHCA 1LFPA 2F4IA 1UB4A 4CYCA 5BPIA 2DDZA 5AONA 3NWSA 3SWNC 3ZR8X 5KYUB 2HYGD 5JHFA 2YDLA 1EFWA 3VKIA 1KU3A 1VYUA 4M75E 1VQ8Q 4MFDA 3J81Z 1FOWA 3E9HA 1D3YA 1BJZA 2NUTA 1M9SA 2V6EA 2RQVA 3M0PA 3J7AF 1YE9A 1KGSA 4OMNA 3ESWB 4JBAA 1YGBA 4C5IA 4HPQA 1LNXA 1YI2A 4LVLA 3GCMA 4YIRX 2M0OA 5H20A 2P5LC 4DBHA 2DQRA 2ZMEC 4BHPA 4RAFA 4J5YA 1MKMA 5JR3A 2QAZA 1KIKA 3M54A 3HKZN 3MD2A 1X4OA 2EIMH 3T8TA 1ACMB 2ZJ2A 2QLZA 1MW7A 1Y8RB 1P6RA 1BR1A 1VQ8I 2MW8A 2OPTA 4DOVA 4RB0A 1QRYA 5DDGA 1R9TJ 2WWYA 1VQ6Q 5B3SH 1JRIA 1W1WE 4J9HA 4U7BA 5GAOm 5TISC 1FX7A 3S1NJ 2L01A 4KUDK 2RHQA 4EM0B 1UB9A 1FBSA 1XCVA 2CYZB 4Q48A 4Z2YA 5E3LA 4JZ4A 2XF5A 2CQQA 1KQSS 1X1BA 2IGOA 1JI8A 1MNMC 3MZ8A 3FIWA 4EX5A 1XD7A 5L23A 2IY5B 4I99C 2KJBA 3LSKA 3VRYA 1GFCA 3RPUD 2D8JA 3CO6C 1VQ6I 3VJPA 4OMPA 4CH5A 1YITA 2VJJA 2DEQA 1OCRH 1FTTA 2CGPA 3HSBA 3KYLA 2IT0A 2MF2A 5L8RE 3DKMA 1AKHA 4HZFA 1SESA 1TW2A 3M1EA 3OR1C 2CZ6B 1NYRA 5EGOA 1SHGA 1I1SA 3SFZA 1UAAA 2YPRA 4CH7A 3TMOA 1JKPC 3I59B 1XX5A 4TVAB 4G94A 2EGEA 4BI8B 3MZYA 1VQ5A 2DZ9A 2LBFB 2KDSA 2YRDA 1YNZA 3PQKA 1NJ5A 2L4AA 2HVQA 4YFNF 3NQOA 1TXQA 1VQPI 3BPXA 1I81A 4D9JA 1D1CA 2A6HF 3X24B 2HDDA 2XDPA 4S0HB 3AG4H 4A6DA 1FYNA 2CGHA 2GM4A 2JVVA 4XSZF 2L9VA 1DPRA 3OYCA 1T0FC 1BCMA 2EL9A 4HF2A 3GZ5A 3ZEHA 4MZMA 3J80E 3ME9A 2OBPA 1K78B 1T08B 1QBJA 3KFVA 3L2RA 3CPFA 5HCKA 2CSOA 5FLMJ 3J7AY 1MDMA 3CPWS 2ZT5A 4RS8A 3S3OA 1D0ZA 2X48A 9ANTA 4D5FA 2ZZFA 2K6DA 2KZVA 1QWEA 1ETXA 3RTRA 1R7JA 2Q0OA 2X1EA 4I6ZA 4QSHA 4HF1A 5A0GA 1IGQA 4XNFA 2R5MA 4EMSA 2OJED 1ZGWA 4M75B 3CCVI 3HXZA 4YCUA 3JRBA 3K1PA 1MGQA 1NPPA 4P9FA 2OTLQ 4LD6A 2DEUA 3E2UA 2EKOA 1G83A 1NG7A 4U7DA 2JT1A 2LCCA 3QQAA 5ERIA 1X3ZB 2E1MC 2OA4A 4HAMA 2E3HA 3CD6I 4KMUX 3TDZC 2J6KA 2XUBA 2AK5A 3KE2A 5LJ3e 1JGGA 1XOVA 3K9TA 2BXYA 2KT1A 2VXEA 4EIKA 4FX4A 3PO2J 1V55H 2RPNA 2E12A 1YJ9I 3KEQA 3DB3A 4HSTA 3GTOJ 2KBTA 5CVRA 1RUWA 4BWAA 3KIOA 4P5OA 1VQ7I 2JS2A 4OMMA 4DYQA 4A3FJ 4FW2A 1PCXA 1AD5A 2KQRA 1TWBA 2MWOA 2VC8A 2F2EA 1S5LC 4XQFA 1ZBJA 2DQ3A 2DVJA 4BE1A 1YIJI 3BY6A 5LGNA 11ASA 3M55A 4KH1B 1M30A 3C3WA 1SEMA 2A07F 2EW3A 2Q2EA 1Z7NA 3E6CC 1S29A 4IPAA 4M78E 1XSVA 1YJWI 2JJ7A 4LK0F 1R58A 3KPHA 1DJ7B 2B86A 1IW7F 2IEKA 2F48A 3PQJA 4B47A 5GAN3 4AD9A 5JHUA 3CJRB 3S8PA 3L1PA 1FP2A 3OYNA 3QODA 4L5IA 3AKZA 3LH0A 1RLQC 2JA6J 2Z99A 2IGNA 4E7SA 3X25B 5ICEA 2D0QB 4OB2B 5LRRA 1OOTA 4UNOA 1S7AA 4XMYA 1M1EB 3MZHA 4BXFA 5DS9A 4BJTA 2ISYA 1KA8A 2HVSA 1PYSB 2YR2A 2RHXA 2W0ZA 1V5GA 4Y7NJ 1H3ZA 3OV8A 2VQCA 2QA4Q 1IN7A 1D5VA 1UUEA 1J5YA 2XV4S 5CO7A 3N5BB 4DBQA 5FFXA 4GBQA 5EG2A 3ZCOA 2CMPA 4HCKA 2P0LA 4IQJA 2Q1ZB 5LJ5e 2CP0A 1TTHB 4RB3C 3QZ5B 1BBUA 4GRIA 4QQ6A 3HOUJ 2UXNA 1I39A 1ARKA 1VIFA 1WGSA 4D0PA 3HKZA 3CQZJ 3OBWA 1W0TA 2DA4A 3JTHA 2GOXB 1MNEA 4LE9A 2DXCA 2ROLA 4WXHA 5FWCA 2X6OA 2ICWG 5GAN8 5FLXK 1G51A 4HOBA 1LE8A 2XK0A 2ZIOA 2CUBA 5D6XA 4M7AF 3VQXA 3ZMTA 3J7AO 3T1BA 4R79A 3RI4A 2M0MA 2HEOA 2JN0A 3O8HA 2VVKA 2R0QC 4J9BA 2NUPB 2BZYA 1VNDA 2QUFA 4DIQA 5F0CA 2DBBA 2W85A 4PG3A 4B6MA 3VS6A 1YTYA 5BOXA 1EX4A 1FOYA 3NENA 1KD1R 1B76A 5KK1A 3BC8A 4M74A 1XS9A 7AT1B 2ZO4A 3I55T 1YFRA 1ZR2A 2KFDA 1HK9A 2ZT7A 1YITI 1OKRA 2RQQA 4KMFA 4BBSJ 4QT7A 2Y4XA 1O3QA 1VQMQ 1IRFA 4EM1A 2DIGA 2F4MB 4EMGA 2DNUA 1Y0MA 1SFXA 2BHYA 3DEEA 4OMQA 5CKEA 2NVTJ 4HW0A 1ZUYA 5LD2C 4XN3A 1VYVA 3HSRA 2IVMA 5DLOA 4AMCA 3H0HA 5ED4A 1M1GA 2ESNA 4OIRF 1XMKA 1X1DA 3GIBA 2IY5A 1TT0A 2ZXFA 4UP8A 2IA0A 1IAWA 4EJUA 2HNIA 1H8AC 4C8QA 4M7DF 2EKHA 2M51A 1STZA 3ZN0A 1XSDA 2C6YA 3DV8A 2VE8A 4R8HA 2H8WA 1Z7UA 4LIUA 3M5AA 5J1UA 1Z0XA 2BTTA 3QPHA 3E7LA 3JCMg 3OS5A 2O9SA 3IAM2 3CCJQ 5E18F 3SB2A 2MGQA 2DI3A 3K4KA 2YUQA 3L1AA 3EUAA 3H0DA 5GANh 3F8FA 4UVAA 2DTZA 4XTYA 2MLKA 2R93J 3CZ6A 3NETA 4RA2A 3ZBDA 2LBFA 3OMGA 2A68F 2LY1A 5CQXA 2H8RA 3C94A 3EFOB 2D1VA 3JRCA 2QQSA 3HBLA 4HVCA 3DLLA 5LHHA 3WGHA 2BEOA 3MKWB 3VS5A 1UHWA 3CCJI 1N9SA 1KD1U 1ZG1A 3CCSQ 1VQLT 1BIAA 2P7CB 4B44A 1D5YA 3L4GB 3CC7Q 1FSEA 1K78A 1HXDA 3EG0A 1W2BP 4GLKA 1Z7MA 4C3JJ 3UWNA 1ULYA 1KQSA 1ATIA 2C8MA 3HUGB 1AWWA 3CMQA 2KP6A 2M34A 1D8JA 1WI3A 5J1YA 3PFYA 5DM7F 2KYMA 1Z1DA 4QVCA 3CC2A 4OMYA 3TEHB 4C92C 5ILVA 1D1BA 1M1KC 4A4GA 1OYYA 2DX1A 1YWPA 5KAFC 4CXFA 1T98A 4BJ5C 2DIQA 3JREA 3LSGA 2QQBA 4M75A 4U0YA 3JCMV 3K69A 1WSUA 2RQPA 3CTAA 1BA5A 5ILUA 1NPRA 1KYZA 2O31A 2XU8A 3G1MA 3CCRT 1PG5B 4YCVA 3HY1A 1UCRA 1B9MA 2YX7A 3CCUQ 2ARSA 3K0LA 4HT9A 1XSXA 3OW2S 1QGPA 2CS3A 3DSQA 4JRIA 2X3XD 2JN6A 4LITA 3WTTC 2JMAA 1JUMA 2EJRA 4BXXJ 4X6AJ 2DOFA 2A61A 4PJMA 3P9CA 5GTIC 2Y0MA 5FKNA 3OMCA 4JK1X 1KOGA 4E7ZA 1EFNA 4PJOE 1QKXA 5KVRA 3CBOA 4XKWA 1YIOA 1S1NA 2FQ3A 5DYMA 3BJAA 4Q47A 3CBMA 4Q15A 1M1KR 4XM3A 1USSA 1OR7C 3VUBA 3H3ZA 1G8XA 4BHCA 1X2KA 5F0FA 1OMIA 2HKOA 5M5XJ 4HV6A 4XLEA 9ATCB 1UZCA 4HBLA 2K2MA 3I5UA 4RGXA 2PNIA 2HZDA 1OQKA 2HSEB 3LAJA 4RLQA 4LDUA 1VQ9T 1DU6A 3OYEA 4PJ0C 1QZYA 1MMNA 1F4KA 4G12A 2AHQA 3M4PA 4BW9A 4CZZA 5HS8A 5L3EA 4CCLA 1HKTA 3HRMA 2PMFA 2HSPA 1ASYA 3TO9A 1WCMJ 4KULA 4EMKC 1U5TB 1VQ4Q 4C5EA 2IA1A 4M3DA 3WTVC 1FJLA 4RUGA 1YCYA 2LY2A 1TUDA 2XVCA 2O2OA 3K6GA 4JRQA 1G3WA 5EEAA 1N5ZA 2FUG2 1PYSA 1QHHD 2JOYA 5CVUA 4ZZDA 2X4YA 2GXGA 1UFFA 2EQKA 3V8JA 4FE7A 3PGGA 1R00A 1SETA 1OYXA 3REXA 3QWYA 4Y4RA 4M9ZA 2ZTGA 1Q7YC 4DPGA 2DERA 2EBPA 1USYC 4ASNA 2DQLA 3TGNA 1VQ4I 4BQAA 5DM6F 1UECA 1PWTA 5CVJA 4XQ3A 2XAUA 4KQEA 2E2IJ 5BS6A 4M77E 4AYBN 4F55A 1R22A 3IWFA 1JUSA 1C1AA 1T38A 3DWLE 1S72T 2DA1A 1D3BA 2DTHA 3VYUB 1XNIA 3BQZA 5FU6C 4YRFA 1M8MA 2QXFA 4A5NA 3U1DA 3G73A 1LOJA 3TO6A 3FX3A 3HXLA 4C5HA 3GOXA 3OBYA 3GZ6A 1B8IB 4QVDA 3HRUA 3PVLA 1KMMA 4M7AG 2K86A 1JBMA 3DKWA 1M27C 1VIEA 3I56A 4Y28E 3WGGA 3DLLF 3T9NA 3NGPA 4HWPA 1XTDA 2ZNYA 4L5EA 2R3SA 3ZQLA 5KYYB 4RG2A 4ZYEA 3IV5A 2WSFE 2LRQA 1ON2A 2ZAEA 1IXRC 2K4YA 1FPQA 2CQXA 1NTCA 3QXEB 2DILA 3IKVA 3E6BA 2HBWA 2AKLA 2ZFUA 2KDZA 2GAUA 4XKCA 3FM3A 1MBGA 3RNJA 4LB6B 2QF7A 4CS4A 1LPLA 2VKEA 2ZXIA 1R4NB 1VZ0A 3FXOA 4Q5SF 4PJOB 2LREA 4GO1A 1RI9A 1R1TA 3WVDB 5LJ3h 4PHCA 2XKOC 3TU4K 3QIIA 3BJUA 1NEBA 1IDZA 1R5GA 1PHTA 1Z77A 1YX3A 3I3LA 1R4MB 2V8JA 4BDYA 4PZJA 3HFVA 2Z1DA 5F27A 5JVGF 3FXLA 1ZKGA 2L8DA 2YSRA 2BE9B 3Q9SA 3N97A 3PFSA 3MEAA 3L7WA 1RKWA 4M78A 5IHIA 3OYKA 2I10A 2DAQA 4V2SA 2EPDA 1MJBA 2E64A 3OWTA 4L0ZB 2EV0A 3JSPA 2QEXT 4M7AD 5EYRA 1AWJA 4M73A 4XLAA 4YRJA 3EH2A 3DTKA 3HRSA 1G3YA 3JCUC 3JCMb 4XTUA 5AYFA 4EM2A 1G2HA 4M7DG 4LOCA 1QCOA 5DLQE 2ALYB 5LRSA 4HLYA 1I5OB 5I2MA 2E2HJ 1YHQA 4AFSC 5BNGA 2STTA 3V42A 1ZX6A 3CXCS 1WJFA 1POGA 2L3PA 3VQYA 4I09A 3EG9B 4J01A 5HNFA 2LYCA 5GPCA 4UC4A 3BR6A 1OFCX 3UFGA 4JOMA 4P73C 3CC2I 2E2JJ 3A02A 3JCMe 1Q95G 3PIPA 2LMDA 4L0YB 4NBQA 4HQMA 4ZH4F 4IO9F 1VQOA 4E2FB 2FNAA 3HY0A 2XDBA 2X85A 2H09A 3FBNB 2D45A 2ZXWH 2X4JA 2D8HA 4OLFA 3REOA 1GT0C 4FYXB 3SDBA 2KZGA 3PM1A 5CLSA 1NJ2A 2DE0X 3ERED 5KNLA 6PAXA 3QP5A 2JUGA 4D7NA 4NQWB 1IG7A 4A4HA 2E60A 2ZC2A 2LX9A 2EGAA 2PMEA 4M77B 4XLNF 3DKYA 3BG7A 5C4XJ 4J9IA 1UHCA 2W84A 3FJPA 1ZSZC 5K1PA 1SMTA 2XI9A 2DMPA 5LJ5h 3RCOA 1ZREA 4E6RA 4RB2C 2DYSH 3TEHA 5EEGA 1YQAA 4KIGA 4P72C 1R5HA 3X20B 3I9V2 4EEFG 5ICGA 1JQQA 3P8YA 4QLCU 5FWBA 1U2WA 4WXDA 4FTHA 5FJ8J 2IVWA 2DETA 4CCMA 2ME6A 2VLAA 2I2LA 3H8ZA 4PCQA 1Z3YA 5LGUA 5FU7B 2RN7A 3CCYA 2E7XA 3CUOA 1Z67A 3CP2A 2GLOA 2HL5C 1WJEA 1UMQA 2NOGA 3E5XA 4AIJA 1P7IA 4WWCA 5EC7A 3HGYA 3G4SA 1OEBA 2JTEA 5IXFA 2N8GA 2YLCA 5GTHC 1YLFA 2NVXJ 1RLPC 3ZXSA 2L7KA 3CMMA 1QVGP 2V26A 1ITYA 2RK1A 3VS2A 3AAFA 4FISA 4P75C 4DZPA 2M8EA 1U6GA 3SZPA 4OIQF 3OYFA 1JO8A 1VQKT 4KRTA 3HOTA 3A7AA 1SRLA 3JRAA 2LJ3A 3PIOF 3JRIA 2CQ7A 3BROA 1KQ1A 3RMQA 2QSFX 4KGVB 2P8TA 1W7PB 4R56A 5GAEJ 2V1DA 3K1NA 3PL8A 3D1NI 3A5ZB 3FMQA 3UKGA 1KSWA 4OMOA 4JRPA 3VU3C 2LCLA 4C5GA 1H0MA 3F21A 5HDKA 4L18B 4HWRA 4ETSA 5L3GA 2DFEA 5HODA 4EPCA 5ICFA 3CCQA 3BDLA 3LL7A 1UDLA 2A0FB 4HLXA 2E6NA 3SZGA 3JRFA 3ZMSA 2M7AA 3HOWJ 2CS7A 3LSMA 4YRMA 3P8HA 4AYBA 1Q86R 3OYIA 1AOJA 4RBOA 1NLPC 2FJ1A 1U5TA 3K4CA 5IP9J 3OW2A 3WTYC 3HOYJ 3M59A 4C0GA 4BI4A 4AG2C 1IZ1A 1C6VX 1H4TA 2EQMA 2ZKZA 2HXIA 2V1QA 2KYBA 2A37A 3J81E 2R7DA 2DK8A 3IWZA 3PMTA 3HTRA 1MV3A 3GEZA 2R7SA 3MP1A 2I5UA 3UATA 1IL2A 2GQIA 3I64A 2ZJRF 5FLXE 1KJWA 2XRLA 3TEEA 3DPTA 3I56I 3LQQA 3T8RA 4MZPA 5IY5H 3O6BB 1X1PA 3M1CA 3ABKH 2KL4A 3VYRB 1VQ8T 4P71A 1GFDA 4E47A 2KNBB 1P4WA 1NK3P 3LOCA 1WYDA 1CGPA 3WQZA 4D6WA 3RERA 2MOXA 3G71A 1U0JA 5DCMB 1L0OC 1Y71A 2YSQA 3Q3SA 2ACJA 1JE8A 5GAOp 1CF7B 3Q0UA 3FJ5A 3AT1B 5LGTA 2HQXA 1H92A 2HTSA 4OWRB 4AFUC 4N0AC 3W3CA 5F0HA 3GX4X 1YB3A 1PSFA 3BQYA 2CQKA 4M71A 1WDXA 3M4GA 4KIFA 1EH8A 3CUQB 2QHTA 2V9VA 1FYMA 1OYIA 2NNNA 3TDUC 3PTAA 2V7FA 2OTJT 3F8NA 3ABMH 4NB5A 1HSJA 2CW8A 2HBPA 2Z3YA 2B8AA 2Y2ZA 2ZXHA 4KN4X 4TQFA 2ETHA 1MMSA 3WE3A 2KGTA 2K2VA 2DBMA 3MPUB 2LZ6B 5GANd 2O8KA 1Q86U 1PD1A 5J3LA 3RMSA 1B1BA 3RF1A 1YJNQ 1IZ6A 3TOAA 1RAGB 3BOQA 1AWXA 2LFBA 4DA4A 1BBWA 4PJOA 2DDAA 1S7OA 1N8RU 1YHQI 1VQPT 5LEJA 2K9LA 5GAMd 3L2QA 1XCBA 2IPOB 5C4JJ 3LH5A 4M9XA 2HXOA 3I55Q 2X1CA 4M75G 3DQVC 2F1LA 2BBYA 1Q81C 1UFMA 1J2XA 3K70D 2NWMA 1YJNI 3V8LA 4E4HA 2VBYA 3DEUA 5CVVA 2KVQG 2LDUA 1RACB 2MIOA 1Q82C 2EILH 1X2GA 4TWAA 3TQ7P 3DBLB 1N25A 3K10A 2L2OA 5FB2A 2D9TA 1QVFP 1Z7LA 1YBYA 3VYSB 2ALYA 2DKGA 3BP8A 3HM5A 2L7FP 1V76A 2JUFA 1QZEA 2KT0A 1D0XA 2CG4A 4A3KJ 1VF9A 3VSLA 3AG2H 2KIFA 2RHUA 1LKXA 2JZYA 3IL2A 2GXAA 3A8OB 4O2DA 3EG9A 4LVKA 3G4SQ 2ZNIA 2VKVA 4QW2A 3CCVT 3RQIA 2J5PA 2CQNA 2HYJA 3BZ6A 2EQUA 3CC4A 2LT4A 1FLIA 5M5WJ 3QUIA 1MBFA 1K0XA 2IG0A 2FA5A 3JB9J 2X35A 4B43A 1W5SA 3P9IA 1IXDA 4F7UE 2FX0A 2K40A 2SRCA 2LCSA 1RUNA 3A32A 5GP9A 5E1XA 4D1QA 2DD4A 4BE0A 3ZQ7A 3CD6T 2GFUA 4H2UA 2JM9A 4L9TA 1Q81R 2YUOA 2FOWA 1SSHA 2WAFA 2KXDA 2CREA 2JT4A 3E6DA 5D4SA 2LJ1A 4BNCA 3SEQA 2WC2A 2DU7A 3Q9VA 2OQGA 2VUBA 1K9MU 2PFBA 4NQWA 2OZ6A 3A8LB 2W57A 1Q82R 3G4SI 4M75D 1TTYA 3S2HJ 4OGCA 1YJ9T 2WTEA 2L3QA 2EBIA 4KDPA 2M4GA 5KCMA 1VQ7T 2Z33A 3PVQA 3IUOA 4KT5C 4AVPA 1W5CC 1S7EA 4ZTZB 4IHYA 2X1DA 3OS2A 2D1XA 4J6WA 4AVZA 1VQLQ 1KHCA 1YIJT 2FQ4A 4ITVA 3EFRA 3DPLC 2W4SA 5B1AH 4ESRA 1ZLJA 5CVIA 5AIQA 2LOOA 1WYXA 3M0RA 1YJWT 4M9SA 1JJ6C 1WXBA 1M2VB 3ML6A 4H2YA 5CIUA 3CJNA 2ZCEA 2QGUA 3NFCA 3W2WA 1K0SA 2M87A 1FOXA 4BEHB 3OY9A 4C3HJ 1I3AA 2V9PA 4JJDA 1KC8U 2HI3A 3CF2A 2KLOA 3W6JB 1VQLI 2KT8A 4ZIBA 1EVKA 4JX6A 3QPSA 4OGEA 8AT1B 3CCRQ 2X4XA 1T0HA 3KZZA 4LLNA 2DU5A 3G6EQ 5J4VA 3CCQI 2PG4A 3M8JA 2DJQA 2QQRA 4ESBA 1TU0B 1QA6A 1HDPA 4BQNA 4L9VA 2L0KA 1PUEE 4C2TA 4JYKA 3MCAB 1QP2A 3DEWA 2JSPA 2EYQA 3BCAA 4PL6A 2ZSIB 1UGPB 2HS5A 5FGMA 2EIJH 3B6AA 5F6FA 2P4TA 3KP4A 4C0DB 4VUBA 3V4GA 1IGNA 5DTDA 4HX4A 3A5ZA 4AIHA 3J7ZI 2DPDA 2JK3A 1UGVA 3CJTB 2IS4A 2WAEA 3QP6A 5IHNA 3ABUA 3G6EI 2KJCA 1LJ9A 4K86A 3CCMA 4ON0A 2OAZA 2LK2A 3EDPA 4F7ZA 3MEUA 1JTXA 4Y13A 2Q7GA 4YDQA 2VOOA 1IREB 3JCMc 2G7HA 5EZGA 2QWWA 4BY6B 2HYFA 2DL8A 3KP6A 4V2GA 5CQGA 4KISA 5K1YA 4GFBA 3QPTA 3U23A 3SHWA 4NDLA 2DF6A 2F2VA 4DBRA 5LEKA 4GYIA 3GTKJ 2Z16A 4CH4A 2R4GA 2C06A 1LJOA 2CJ9A 1Y7XA 4NL3A 1VQ9Q 4CSWA 3G71I 3QYEA 2OI3A 1EOVA 1EVLA 5AT1B 2FZCB 3WU1B 3FXRA 3SJMA 3PE0A 2H94A 5BPDA 2WV1A 4X9CA 3RPQA 4F7UB 3KBGA 3ECOA 3FB9A 4A69C 3JAMK 2KEAA 3META 3TKYA 1QVPA 3LAPA 5GAHJ 2KDOA 2LSOA 4A53A 4XEMA 3BPVA 3MHXA 2RGVA 4YPFA 5K5QA 4XKVA 4BU2A 2DU9A 4J9DA 3RYPA 4EJTA 4P5NA 1FBQA 3RQ4A 3JCMh 4J9FA 4BQOA 3BCBA 4M4ZA 1G6NA 1WXTA 3LW5E 1X3WB 1YITT 3MP6A 3E9IA 2ELKA 3I71A 2A7YA 2K5LA 3ERRA 4MMLA 2CJJA 1QLYA 4RKUE 4RTYA 2K02A 3B73A 1ZR4A 5FFZA 5JLWA 1BI2A 5GJWB 4NS5A 2H1KA 3DLMA 1CF7A 4U88A 2LDMA 4ENMA 5IN1A 2PJRB 4MMKA 4XICA 2GGRA 1VQ5T 1SSFA 1OLTA 2WSCE 3MKLA 4B09A 3ZQHA 4JZ3A 3EETA 3BJ6A 4CO8A 1DQUA 4HCZA 3CPWP 1S72Q 3CUQA 3M07A 4PFOA 4U87A 4CC2A 3JRHA 3L2WA 1IUFA 5HDGA 3QWXX 5DM7R 2BVMA 2TCTA 5HS7A 3K4MA 1IJWC 4UVBA 1FYLA 4M7DE 4CC7A 2XGXA 4JX5A 4C92F 3M3YJ 1IXCA 2Z9OA 3CMEQ 2RAEA 2HGCA 4M77F 2RD1A 1ZQ3P 3JRDA 1OPLA 2COMA 2M16A 1FIPA 2D2WA 1ZG5A 1G2BA 4RCCA 3BTLA 1H88C 1ETVA 5L3BA 2P5KA 1WJRA 2CT3A 4XLCA 3THKA 2IBDA 3R4KA 2IW5A 2CP6A 3X26B 3E3VA 4EVIA 2V79A 1O9SA 5E3MA 3GMEA 1B7YB 3VSKA 2DA7A 3CMEI 4ESJA 2LNVA 4RB1A 2AXTC 2XKPA 4G6DA 1LFUP 4PK4A 3F8BA 4X0GA 3GYHX 1Y56A 2OC6A 2CP2A 4BYYA 1EH7A 1BU1A 1WH5A 1B72A 1TP4A 2L89A 2B9SA 1REPC 1ZRCA 2BY1A 3ASKA 1LDDA 2HOAA 2NLUA 1UGQB 2HFHA 1HW2A 2LX7A 1SRMA 5GANj 3RR6A 3H5NA 2DRKA 4NC6A 4WX9A 3QOPA 5J1RA 1KHIA 5LFAA 4LG3A 1K6YA 3K2ZA 2DT5A 2QEXQ 1KMNA 1EH6A 1ETYA 1H9GA 2JPBA 2DMUA 4RGUA 4XLPF 1E7OA 3OSVA 3M56A 4JP0A 3WG7H 4CS2A 3VYTB 2CZ1B 3BW1A 4GXOA 2HU9A 1X2QA 2MPXC 3PSIA 2CUEA 2VODA 1G59A 1HSQA 1SMYF 1QO0D 3GLXA 4IEJA 2EFPA 2M2EA 3S16J 1V29B 2V1UA 1RAFB 2JXBA 3JW4A 1TZLA 1T39A 3G2BA 2EGCA 1Y57A 5F08A 1FNNA 1PM3A 2EFQA 4ZZLA 5CKHA 4RMFA 4TQDA 2HOSA 1ZLKA 5AIPA 1BKBA 4CZCA 3VS4A 1RI0A 2W82A 1HBXG 4AC0A 4HVUA 2KRMA 4XTWA 2EINH 1W1FA 3GFLA 1C0WA 4X5OA 1KU9A 4J8OA 3K4NA 1M2VA 3JB9H 1DU0A 1WPKA 3HRKA 2LT1A 2K3BA 4BI3A 2XPUA 4BEHA 3QYFA 2NUZA 4YELA 1UELB 3M8FA 4FYYB 1LYLA 3HG9A 3A5YA 4M7DB 4I7HA 4N4HA 2AIRB 4G8XA 2BKDN 3CCMI 4LDWA 5I11A 4Z6YA 1K4US 1ZA1B 1MBJA 2PI0A 2K85A 3HFNA 1QU3A 1U3EM 2F5TX 2IIMA 2H3JA 3LSHA 2DL7A 2GTOA 2R5ZB 2ZSHB 1IC8A 3K7AJ 2BW3B 4YRTA 3TUPA 5J39A 2HD0A 4YRPA 4OINF 3FXKA 3Q1JA 1AU7A 1JJCB 3K2AA 5EJCA 1RPWA 5C44J 4Y17A 1NK2P 4C0FA 4A5MA 4W1UA 1DDNA 3MEXA 4A93J 1X2NA 4JJCA 3K4BA 2ISZA 2X9DA 3BE3A 3A0BC 5I2SA 3QHSA 4IUUA 3L2UA 2RB6A 1VA7A 5L3CA 2E10A 3MEVA 5HK3A 1WXUA 3W2AA 1VQKQ 3AHUA 1TQPA 1K76A 2QYZA 3RACA 3EAEA 5FROA 3W6VA 2QHVA 2B7EA 4RM3A 3HHGA 2VC0A 1TWAJ 1XGOA 4EJOA 5JFRA 1NJIU 5FKKA 3R61A 3VQVA 2L7MP 3A1YA 1RL2A 1X75C 3H3UA 3GUDA 1LB2A 3C2GA 5GAMf 3KYDB 1SFOJ 4YFXF 1B4AA 1W2BS 3BFMA 1KU2A 1I50J 1K73C 2XROA 4CDGA 1P2FA 2W00A 2BZ8A 1I0CA 3KCCA 3SFMA 4AU7A 2WY8Q 2EZKA 4F7UA 2AHJB 2RREA 1WU7A 1RKTA 2EQJA 2YHTA 2E1OA 4FT2A 1GVDA 2E3IA 2QSHX 4PJJA 4IX7A 1T0JA 5D5WB 1HDDC 4YIFA 1JJ2P 2MH2A 3CDLA 3WTZA 3VYGA 5HNHA 4KJZA 4HT4A 4GY5A 1YP5A 3ZMDA 4UP9A 2FVUA 2GCXA 1SANA 1OV3A 5TGTA 2B63J 1M90R 3LFKA 4KA4A 5E79C 3JCMW 3CCEA 2JZ2A 3F9KA 2M8GX 2KIQA 4BD3A 2RNJA 3JRZA 3IG2A 3K4LA 2DTOA 2O01E 1VTNC 2A5WA 5J6XA 3NHNA 1K8AC 5DEQA 2XAQA 3OSSC 3GNGA 2VBZA 3C4SA 2KRNA 4Q4ZF 2IPQX 5CAIA 3P9KA 4PFPA 4PKCC 4PSXA 3RIRA 5GAOl 4BKXA 3QSUA 2QKLB 4KICA 3GTGJ 2DK5A 3VRZA 4XRSG 2P0KA 1UG2A 3LSJA 4PJOD 2ZBKA 3MWMA 3JB9G 1RIOH 3RGLA 5FLXZ 2A69F 2L9RA 3O8GA 4AH6A 4A12A 1W36D 4GCVA 4E7IA 3FMRA 3BZCA 5FRMA 2G7UA 2GZWA 5IP7J 4BQQA 3L9FA 4RQEA 2VC1A 4ZDPA 3DPUA 5HS9A 3NEUA 2CH4W 3QAHA 2RDPA 4M77G 2OTJQ 3TL4X 2MSYA 4J15A 2P0WA 5LJ3j 2KK4A 2VT2A 2A6EF 3I35A 1FMKA 3CC2T 3CCLQ 3KEYA 3BG3A 4A0ZA 3HJEA 3SHFA 3V7RA 3I5SA 4MFEA 2Q8KA 1K4SA 1B7YA 1X1CA 4N4OB 2CP3A 1WJSA 4LD5A 2EV5A 2FOKA 4QVZA 4BGDA 4PJLA 3P8TA 2GXBA 3U9GA 2X4WA 1ETOA 2QQAA 3H9QA 3H92A 1Y1WJ 2OTJI 2PMHA 2LP0A 1TC3C 1VQPQ 4CS3A 5KE2A 1M90U 1P4XA 3CCLI 1UJYA 4Y15A 2ZINA 2O61A 1TWGJ 1QCFA 1GXQA 1RADB 1WNLA 2Y48A 3CJQB 4F93B 3JB9D 2G6FX 4MEXF 2DMOA 1TG0A 4M7AA 1SEUA 4E7HA 2LR8A 4KFCA 5GMKl 1WPYA 2FPEA 3NTKA 1E17A 1K7AA 2I4LA 3Q0WA 1X55A 1SC7A 2XD0A 2CUJA 4JRKA 1WFWA 4J19A 1ZBXA 4PGHA 4M77D 4WTOB 4M7AC 3JCMf 3A98A 3F70A 2A5YB 2RQWA 4CH6A 2RHSB 1QCNA 2ELJA 2LQNA 2AKWA 1QWFA 4XOPA 2KRHA 1HF0A 1H8KA 3VPRA 3LSTA 4FX0A 3CCVQ 4FASD 2KI7A 3PFIA 2I4MA 3VUZA 3ZP5A 4MTEA 4FQGA 2EV6A 3FRNA 4RTXA 2HOTA 5K1XA 1OX9A 4FETA 1I5ZA 4DGWB 4V19K 2DT6A 1Y6IA 3TSZA 2PZ1A 1R71A 2FBHA 1ZGJA 3CD6Q 2L3SA 3M8EA 5GAN7 4X34A 3AL0C 1QZZA 4YTLA 3HRTA 2R5AA 3KX2A 3J80K 2NVYJ 2R7XA 1IB8A 2MA3A 2F2XA 2ZPFB 1JEGA 4K88A 4G7OF 2FU4A 2ODRD 4L59A 5CQYA 1YJ9Q 3D5RC 1NNHA 2QQ8A 4F7UF 1RAHB 2HMAA 1VQ7Q 1R77A 4WXCA 5A2QZ 3JCMQ 4B1RA 3EPZA 1BN5A 1IF1A 4E70A 3KP7A 1AWCA 2M9HA 2A05A 2VJIA 2VI6A 1YIJQ 3FEOA 2XDDA 3H9JA 3LWIA 1MJAA 4M7DA 1YW9A 1I6HJ 4RTTA 1SFUA 4IF4A 1U3OA 1VQNA 2F69A 4EV0A 2O9LA 1YJWQ 1T6SA 3IHUA 2VKDA 2RO0A 5KH6A 3ZMZA 2R5ZA 3BR3A 4KGXB 3FXJA 2JA2A 2BW3A 1X01A 1KQ0A 3OMYA 3Q5FA 3HOXJ 4P74A 1PP8F 2ESWA 1JJCA 3L2CA 3OYGA 3C0CA 3ERMA 3QG1A 1SFEA 1XDUA 1A0NB 3TW6A 4KGZB 1MNDA 5KE3A 5H6QA 2MH9A 2W24A 2ZZDA 1BC8C 3I56T 5GAMg 2KQWA 1WJDA 4J83A 2DO3A 3FLGA 1G3SA 2V6CA 2DMQA 5HLGA 4JX4A 3FHNA 2CYYA 2R5YB 1U5SA 2NVQJ 2YUPA 4BAYA 1KFZA 3MN2A 1X27A 3JAME 3FK6A 3OS1A 1QNTA 2IJLA 3H1CA 1EIYA 4H2TA 2AQEA 3MEYA 4R0KA 3MVPA 2EYYA 2CP5A 3R0JA 2HQ5A 4HNTA 4UUTA 1YI2Q 2QGFB 4J7IA 4LK1F 3CCEI 2K3PA 2DAOA 2WBMA 1CSKA 1IN6A 1K9AA 4I2OA 1TBXA 1JUPA 1LVKA 3LSSA 5F64A 3S6WA 4HWSA 1TW3A 2CZ0B 3E97A 4CC3A 2ZPEB 4HWTA 3A31A 1PYVA 3EUHA 4IURA 2FEIA 3CXCP 2HTJA 2HQAA 1F1BB 1GCQA 1RR7A 2D1HA 3SEZA 3HB9A 4CCNA 2Y75A 2YX4A 4DBFA 5E8IA 3QYGB 4EATA 2WV0A 1TNTA 1YO5C 5CK9A 3NTIA 2MK5A 3SWNB 1YI2I 2XB0X 4DYCA 2OJ2A 2HPMA 2BGCA 4M6VA 1FY7A 2KROA 2DMTA 2BY2A 3WTXC 2EA2A 2K7LA 1E3HA 1YHQT 2P6TA