3RKXA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
308
Chain Sequence
KYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 99
structure length 308
sequence length 321
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkxA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkxA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkxA02
5KNNA 2O03A 4MMLA 3RIRA 4AH6A 3P8TA 3EDPA 3WTSC 4A5NA 2NRAC 3JCMg 1WYDA 4MNUA 1R1TA 4ESFA 5D5WB 5CVJA 4NOYA 1EIYB 1ZN2A 3IC7A 1G5HA 3HXZA 1LNWA 4HQMA 1LDDA 1XD7A 5HLGA 5HDGA 1JHFA 4CGZA 3V8JA 2DU7A 2O8XA 4KIBA 4M7DF 3P9CA 3PZCA 1USTA 3EYYA 2Q7HA 4J15A 1TQPA 3N97A 4OINF 2ELHA 1K6OA 3FF5A 2KJCA 2ZNZA 1IRGA 1SFEA 1B59A 4GYGA 2HYFA 5E17F 2ZZEA 1H0MA 1R36A 2COMA 3LA3A 3JCMh 3JCMf 4XTXA 3L4GA 1DUXC 4D0PA 1NHAA 2QZ8A 1O7FA 4DPGA 5ICEA 1SD4A 3QAHA 2F5EA 4P75A 5J8CA 4EVIA 2EFPA 5BPDA 4F7UG 3OOPA 5IT9K 4Q5SF 3DF8A 4G85A 1LJOA 5D6FA 1Y0UA 5AIPA 4MTDA 3I59B 3M7GA 2UZKA 4N9HA 3Q5FA 2EJRA 1SERA 2WWYA 3ABUA 2G7HA 2GXBA 2W85A 3GO5A 5DD8A 4XTWA 3CUQB 3LSTA 1YG2A 3A31A 1S7AA 5CLSA 2QYOA 3MZYA 3A74A 4X5OA 3K1MA 5J8FA 3LSSA 2LDUA 3GW2A 3JSOA 3BFMA 3WTUC 3TEHB 1B6AA 5F6FA 3G1ZA 3JW4A 3BOQA 1FBSA 2RM4A 4XLNF 3QO3A 4HZFA 2J5OA 4XTZA 2ZCEA 3JB9G 5FLXK 3EUHA 3QOPA 5LJ5f 3W6KB 4P9UA 2HTSA 1H4QA 3K69A 1ZAOA 4L18B 4NHJA 4RDXA 5BS6A 2XKPA 1B70B 4EMKB 4H2VA 1TTYA 2DQ0A 2H27A 2EJFA 1Z91A 5CVVA 2KRFA 1EV7A 4A6EA 4KDPA 3I0TA 5L3BA 3M8EA 3MFKA 2L01A 1ZG5A 3KCCA 3QP5A 1SD7A 1IN4A 1YFHA 4QVDA 1E22A 1JJCA 3IRRA 2XV4S 4M9SA 1YO5C 1W66A 3TGNA 4KIGA 3D0SA 4LG0A 2D1HA 4ESBA 1U78A 1GHCA 3JB9H 4U0VA 3R61A 2F5DA 2G9WA 4XU0A 2LNBA 1G3SA 4LLLA 3BJUA 2FBIA 4M7AF 4N0AA 4CYDA 3A7UA 2ZKZA 3VQVA 4P3PA 3FXQA 3FXRA 5FFXA 2OQGA 4GGGA 1IL2A 3I58A 2Y90A 1HBXG 3W6JB 3F21A 2AXLA 1Z9CA 5GANf 4PGGA 5LJ5j 3EFRA 5GAN4 2ZO4A 1EQRA 1GVJA 1I27A 3PCOA 3FX3A 4RGRA 1KA8A 2OA4A 4KYWA 5E3IA 4XTYA 2LF8A 4PJOD 4M6YA 3NELA 4Q48A 4I01A 3V7SA 2ARTA 1FWZA 1MKMA 4PCQA 4PZJA 2L3DA 3GYHX 1QPMA 1YW8A 1ADJA 2E5AA 4PGHA 1GXQA 4R79A 1H4TA 3I5UA 1YGBA 4YRQA 3MEXA 1X3UA 3H3UA 1BBUA 2R7FA 4BHBA 4PJOE 5GAOm 3E6MA 3GFJA 1YW7A 3CO7C 3BJAA 1RI7A 4IRHA 4UV8A 3RUXA 5E18F 1DP7P 4M7AG 1OR7A 2WTEA 1QNTA 1P2FA 4M78F 5DD4A 3WTVC 1EVKA 3FMRA 2C8MA 2OZ6A 3VU3C 2HOEA 3BJOA 1P92A 2JT1A 2F5CA 1ZRDA 4MMKA 4AVPA 2K4BA 3IKTA 1OPCA 1FYLA 4HLYA 2MA3A 1IUYA 2MD5A 3ISPA 4LJZF 2RN7A 1HSTA 2VXEA 2XGXA 1FYMA 5GANj 1O3RA 5E1ZB 1ASYA 4A6DA 5LEKA 1B8AA 1K78A 2VXZA 2FRHA 5H6RA 4EM2A 1W5TA 3F3XA 2XASA 3GWZA 2IA1A 5FGMA 5GAOl 1LEAA 2HTJA 2P5IA 5FD6A 4TQFA 2EFOA 1TH7A 3NEMA 4WJ3M 3CUOA 1PP7U 5LJ3g 1BI0A 1RZ4A 5D8LB 3M4QA 4MGRA 2HWVA 3LQRA 4LLGF 3JB9F 3A32A 3T5XA 1WSUA 2H94A 5CYVA 4ZZDA 3G73A 2DPDA 4OIPF 3J7AO 4HF1A 4PG3A 4YCVA 1TQIA 2K4JA 2XGTA 1B9MA 2I4OA 3CLOA 3QU3A 3TEGA 4MTEA 2PI0A 5A2QZ 2MH2A 2H09A 3R07A 4R8HA 1J7KA 3HRMA 4HWSA 3P7NA 1R5GA 2ZT5A 1HW2A 2AS5F 2E1NA 3FM3A 4G6QA 4XLPF 4EMGA 4P5OA 3V7RA 1E1TA 2M30A 2PJPA 5LJ3h 1YLFA 3NETA 4F7UF 4UNOA 4ZYEA 4JBAA 3QP6A 4U0YA 3TEHA 4K88A 3VQXA 2DXTA 2PFBA 1UCRA 2QWWA 4BQAA 2FMLA 1ASZA 3SFZA 4ZYDA 4Y15A 4RGXA 4NB5A 1WKMA 1SD5A 5HS9A 3SZPA 1TNSA 4ENJA 1IN5A 4JLIA 3KE2A 4IVNA 4KN4X 2V79A 4KA4A 1X55A 4YDQA 5LJ3e 3K1PA 4BXUA 2IW5A 2Z5UA 5ICFA 3R0JA 1YFTA 1FYFA 4M7DG 4M6XA 2CIMA 3WGGA 4HT8A 5LHGA 2Q7EA 1F1ZA 4CDGA 2M1BA 4IRGA 1B70A 4DNCA 5GANg 3QPHA 4Q47A 3WG9A 3HSFA 5GAOp 2EAYA 3FIFA 2VT2A 1QZZA 1HTTA 1F9NA 4HBLA 3HXUA 4M7AC 5GAMg 1JJCB 3TO6A 4G7OF 3WU0A 1YW9A 4C8QB 4L9VA 3D5LA 3R60A 2AMCA 3RJPA 3F8FA 2OAZA 3UGTA 5BOXA 3MCZA 4CHUA 3L09A 1ULYA 2ZZFA 3JAMZ 2VC1A 4YCUA 3F8NA 4CS4A 4HAMA 5GMKi 3PCOB 4Q6GA 3REXA 3BDUA 3TO9A 2OZUA 3ICAA 1X2HA 4AD9A 3ML6A 3F6OA 4JK1X 3T8TA 3I7FA 1B7YA 2HDCA 4M7DE 3JCMe 4O5VA 4YRNA 5GANe 1BBYA 3GEZA 3QO8A 2Z99A 1MZBA 4LLNA 2DZ9A 2VXFA 5HLIA 2KJBA 4JRIA 3DEUA 4M78C 4XRFA 2QHSA 4LG0B 2O6GE 4CICA 4HX7A 3ULQB 2D45A 1Y96B 5ELOA 3IG2A 4UXNA 5E8GA 4ZIBA 2ZMEA 5KK1A 3K1NA 3WTYC 4U7DA 2A6HF 2RA2A 4XSZF 1FOKA 3E5QA 1M5Q1 4P71C 4ENKA 3FB9A 2MLKA 1XSVA 4YP0A 5LGNA 3JB9J 2FQ3A 2RKHA 4UVBA 4PJOC 2EA4A 1EIYA 4TWAA 4G84A 4P74C 1RUOA 2HQRA 1ZG3A 4M73A 2JPCA 4HV6A 5D4SA 2P7CB 2QQAA 5AIQA 2HNIA 1B9NA 3KEOA 2CWEA 2ACJA 4R1HA 4YFKF 4KR3A 2FE3A 3A7AA 4PHCA 2VC8A 4M77F 2P5KA 1FSEA 3CUQA 1NJ2A 2K86A 2BE5F 3QRFF 3MAJA 4RB1A 2VOPA 1F4KA 4M78E 4J6XA 3I64A 1G4DA 1JBMA 3GX4X 3L2ZA 3QNEA 3RF1A 4HWRA 5D6EA 3U1DA 3TUPA 2Y0MA 3NEUA 4L5JA 2G7UA 3NRVA 4OLFA 4I0BA 3S2WA 3F8BA 2YLCA 4C8QF 3HYIA 1I8FA 2RQPA 2FSWA 4M75A 1WI9A 2Q2EA 3WTWC 1MJBA 1YS6A 3MEYA 5DDGA 1ZG1A 3I71A 2ARSA 1D3BA 4F7ZA 1ZRFA 2PEXA 4G7HF 1RUNA 4YREA 1VQZA 1R22A 4J6WA 3DPTA 3J81K 3JCMJ 1NJ1A 3LC0A 1XDSA 4HF0A 1Z6TA 2Q8KA 5D8KB 2DI3A 2ZIMA 5EEGA 2K27A 3E6DA 1KQ2A 2DTHA 1TW2A 3DP7A 2IPQX 5LRRA 1XDUA 1N9WA 2W24A 1NYRA 3M1EA 1ZARA 4LNSA 1J59A 1YIOA 2ZMEB 3FXUA 4C92G 1Z7MA 3CDHA 5GAMj 1V3FA 5GMKh 2CW0F 1P4XA 4RQFA 1Y96A 2PN6A 1XGMA 4L9JA 4YRRA 4H2TA 1UB9A 3KFUA 4M78B 2RHSA 5K5RA 4ESJA 1E1OA 2ZNYA 2IJLA 1UFMA 4M72A 3I53A 2CFXA 4LD5A 4YRMA 3KETA 3KLOA 1FZPB 4HT9A 1T6SA 1I1SA 4IJAA 1KQ9A 3F72A 2ZINA 3RL6A 1YS7A 5GMKe 2UXNA 4XU1A 4IRIA 3IWZA 2DDZA 4CXFA 1IW7F 4YCWA 2IA2A 4RMFA 1W7PA 1IF1A 4KR2A 2XAGA 4J6YA 1J9IA 3J81Z 2XVCA 1UHMA 3ZMDA 2RVCA 4EQQA 2FOKA 1ONVA 5D5VB 2H6CA 5E1WA 3WGHA 5A2QK 4L9TA 2JN0A 2BBYA 4ASNA 4EMSA 1SFXA 2ODRC 5CVRA 2EV5A 5GAMf 1G5IA 1FBQA 3IL2A 3P8YA 3BZ6A 2M8EA 1EOVA 1WLEA 1KQ0A 3CJNA 4MEYF 1KQ1A 4BW9A 3LAPA 3LFKA 2A5YB 3HY1A 2I4MA 1K7AA 3HY0A 1KYZA 4UPAA 4X9CA 1HKQA 2DPUA 3C18A 4YRGA 5GMKj 3QTCA 2M87A 1USYC 4BHCA 1J75A 1V4RA 4Y13A 4P72A 3PFIA 1DPRA 2K02A 3RKYA 4G94A 3FZVA 2OQRA 2ALYA 3GVAA 2M5WA 4CZZA 2P6SA 1CGPA 2IY5B 2JZYA 1TNTA 4OMYA 1M8VA 2PMHA 1FP1D 4GYIA 3VQWA 3U2RA 1QQIA 3KEQA 5D5UB 2YPRA 2FYKA 1SETA 3HFVA 1BIAA 1H9TA 3VQYA 4HW0A 3I4PA 4UV9A 4F7UE 4BNCA 5BMZA 4P3NA 3WQZA 5F64A 1K79A 3WGIA 4OIRF 1ZHFA 3F6VA 5GAOn 3TDUC 2NNNA 4LGWA 2FB7A 2ZGWA 5LBQA 2E64A 1KOGA 3JTGA 3BY6A 3C3WA 5FLXZ 5CVIA 1R1UA 3REUA 2RV8A 1FT9A 2Y75A 4U0WA 4LB6B 1DPUA 1IN8A 4Q15A 4RAZA 4YIFA 2PLYA 2QTXA 2DQLA 2HZTA 5DYMA 1O3TA 3HHHA 2DZCA 2FNPA 1J0RA 1LQ1A 3IRQA 4O3MA 1X01A 1S7OA 4C8QC 3MF1A 4UUVA 4M75F 2L4AA 3KZZA 2STTA 1TW3A 1NJ5A 1REPC 2Q5HA 4P71A 1ODDA 5K5OA 1XGNA 3CTAA 2QHUA 3QHSA 3ZMUA 1VTNC 1U5TB 4M77G 4EJUA 2JTVA 1LDKB 4L0ZB 4J5YA 1X56A 2RC4A 2Z3YA 4XEOA 2OBPA 1R7JA 3T0YA 2D2WA 2TDXA 1L0WA 1ZLKA 2IY5A 5HDNA 4KT5C 2RDPA 4P75C 3R4KA 4M7DC 4M74A 1W7PB 2W57A 3RKWA 2DK5A 4M78A 3JCMV 4HVCA 1IZ1A 5ICCA 4M77E 2CG4A 4NCXA 1KU9A 4IHTA 3QO5A 2PMUA 3K9TA 3OD1A 4S04A 4I7HA 2DT5A 3SXYA 4LFUA 2EWNA 2AKWA 1R1VA 3BP8A 4MQ9F 1SFUA 2HEOA 3KFWX 2EA2A 2XAJA 1SESA 2DQRA 3BPVA 3EETA 1CF7A 1EH7A 3BROA 3GZ5A 2J5PA 4EV0A 2VT3A 3HTZA 4WJ4A 4UP9A 1G3TA 3WU1B 4HV5A 3JTHA 2I2LA 2VBWA 4YRPA 3FJPA 5GAN8 4WXDA 3ZN0A 4M7AE 1PUEE 1WWXA 4A12A 2FF4A 1FSHA 4UHTA 1ATIA 5K1PA 1WRJA 1QF6A 3Q9VA 5K1YA 4P3OA 4CO8A 1Z7NA 2PMFA 3ZP5A 4EM0B 5DUKA 3BY7A 4M7AA 5FB2A 1QGPA 2FMYA 3M4GA 1IXSB 4RGUA 5GANd 4Q4ZF 3MZHA 4P9FA 2QHVA 1IN7A 1BM9A 1S29A 2FU4A 3HTUA 2ZR3A 2Q5IA 3V8LA 2GZWA 4A0YA 3GFIA 4CH4A 4H2XA 1KU2A 2BGCA 4RB2C 3LAJA 1LNXA 2VBXA 2GA1A 3AAFA 1N9RA 4QVCA 5LLQA 3ECOA 4WWCA 4HYEA 3L9FA 1B7YB 2ZXJA 2IT0A 1LVAA 1T0FA 1XMKA 2HKXA 2RHQA 1HKSA 4ETSA 5HOOA 3F22A 4M7AB 5F1RA 3IKMB 1S3JA 1D3YA 2A61A 4Y91A 4NL2A 1H4SA 1KQ8A 1TQMA 2ZT6A 3BJ6A 3HSEA 4A0ZA 4EJTA 1U5TC 3KLNA 4RGSA 4C8QA 4BAYA 4H2SA 2QQBA 4P73A 2YU3A 3DXJF 5ILVA 5HDKA 2QLZA 3WE3A 1PDNC 4IHSA 1D3BB 4OP0A 4I09A 4OIOF 3SZTA 1W4MA 3HRTA 1T98A 4NQWA 1P4WA 1OKRA 4XU3A 4CH3A 2P5LC 2L02A 2ZTGA 4XBFA 1PYSB 1JRIA 3M4PA 4KICA 3HIFA 1EH8A 2EK5A 3DV8A 2G4CA 2P0LA 4H2WA 3F23A 1D8JA 2MC3A 1BN5A 1BI2A 2A6EF 3HXWA 1I81A 2CJBA 3REOA 4ZH4F 4U88A 2A68F 3VEPA 1P4AA 2DAOA 4HOBA 4YRCA 5DCMA 2GIVA 4G7ZF 3PGGA 2DJZA 4C92E 1U5TA 5GAN6 3E9IA 2P4WA 4LK1F 2V1UA 1HSJA 1UHWA 2XAFA 2A69F 3JCMd 2RGVA 3KP5A 2VE8A 3RPUA 4ZTUB 2VONA 3INZA 1OYYA 2GQQA 3ERED 1BBWA 4B8XA 4EO4A 3T8RA 3F8MA 4F7UA 4HWOA 4YYEA 3O6BB 1T39A 1IXCA 2ZT7A 2ESHA 3HRIA 2V1DA 5GAMh 12ASA 4OU0A 4L5IA 2KIMA 2NAZA 5LHIA 2AKWB 3RTRA 2DK8A 1F5TA 4JQFA 4BWAA 2AMCB 2BV6A 2E3CA 2WV0A 3P8VA 4M7AD 3BW1A 2CO5A 1ON2A 5IT3A 3BWGA 4RQEA 4AIJA 2ZBKA 3HSBA 4M7DB 4S05A 2YX7A 3R6SA 1J2XA 2FBHA 1FLIA 5GAMe 1XCBA 1J5WA 2E7XA 4M75D 4UVCA 4M78G 3RACA 4A2UA 5JR3A 5C52B 3HXVA 4C92A 4CS2A 5LJ5e 2QENA 3TOBA 1EH6A 4YRKA 3VBBA 4H2YA 1FY7A 3NENA 4M71A 1U3EM 1X2GA 2ZXFA 4OOIA 1JXSA 4ZZLA 1MD0A 4HX8A 1LYLA 4XTUA 1FYKA 1HW5A 2UWMA 2L54A 2EJGA 2I4LA 1FPQA 2NNYA 2XROA 3Q9SA 1R58A 5IT9Z 2DTIA 5LJ5h 3N4MA 1BC8C 2RNJA 4U7BA 4HWTA 1BJAA 5ELNA 3KP6A 1U1SA 2IA0A 3RESA 3IALA 2PMEA 5ICGA 3KP3A 2ZCWA 4YRSA 4O2DA 3WTXC 3HXYA 2DKGA 3ZPLA 2E65A 5I21A 1GXPA 4GCVA 4A53A 3RYPA 4ZYGA 1KU3A 2KIFA 1HKTA 3HUGA 1WQWA 4PJOB 4TVYA 4RS8A 3ABTA 1GGMA 1XSXA 1MGQA 2XTIA 3JCMP 4EJWA 3F8CA 4CH5A 4RB0A 3SWNB 1DDNA 1W7PD 2BEOA 5H20A 1NNHA 2FNAA 2FEZA 2CGPA 3A7RA 3BPXA 3JCMX 3G3ZA 2EFWA 2CGHA 4WK8F 4RCBA 1G3WA 6PAXA 4M75E 5L3GA 2ESNA 2Y48A 1I1GA 2HGCA 2VN2A 4Z2YA 4C8QD 4CH6A 4P96A 4BHPA 1K78B 1G3YA 1D5VA 4H02A 3CMQA 3ELKA 2OU2A 2WC2A 1G51A 1R23A 1A04A 3FWEA 2RHSB 4K2EA 1B76A 5DV5A 2DW4A 4C92C 2CSOA 4HQEA 2C6YA 3E6BA 3HTSB 2DU5A 4UP7A 1BIBA 2GAUA 4I0AA 1XSDA 3FM5A 3ERRA 3DKWA 2DU9A 3H3ZA 2CQKA 1I5ZA 2QQ9A 3TDZC 3GFMA 1LJ9A 2RD1A 4F7UB 2GWRA 5KVRA 4KNYA 2KKOA 4YRTA 4RB3C 1BC7C 5E20A 4H0EA 1ZRCA 5HGQA 5ED4A 3EFSA 2CYYA 1XMAA 5E8IA 3V8KA 2DO7A 1ZYRF 3KP7A 4RCCA 4K86A 2VBZA 3HRSA 2GXGA 2IRFG 1USYA 5HVQC 2VBYA 4YRLA 1FX7A 2ISYA 5E1XA 2QUFA 1NYQA 2F2EA 3I59A 1P6RA 1HXDA 3HFNA 2ZNIA 1T38A 2CJ9A 3DFGA 3IWFA 5DCFA 1HC7A 3GFLA 3LSQA 2DVEA 3QU6A 3MWMA 4YG2F 2PBIA 4YPFA 4YRIA 1PP8F 3QUIA 2EFQA 1BI3A 1OYWA 3LA2A 1STZA 2DTOA 4FX4A 4M7DA 3L2CA 3M9AA 3JB9I 1JHHA 2XAQA 3RDIA 5HLHA 11ASA 4YROA 2XAHA 4KUMA 1S8NA 3QPTA 2V1XA 4OIQF 1C0AA 3GUDA 1HK9A 5LJ3j 1KU7A 2PQ8A 3SQNA 3SWNC 1NJ8A 4C92D 5GAOq 5D4RA 2P5VA 2M45A 4ON0A 5ILSA 1HQCA 5GMKm 1QO0D 2X0LA 3ECHA 1WPYA 4P55A 3P9IA 2R7DA 4RAYA 2ARUA 2ODRD 3WE2A 1L0OC 5JFRA 4XQ3A 2Q7GA 5TJJA 3JCMW 4EGZA 1RIOH 1Q1HA 2BYVE 4KFCA 1ON1A 3PQKA 4C92B 4EX5A 4TV7A 3JCMb 2J3MA 2IP2A 2QBYA 1BI1A 5EEHA 3V4GA 1EFWA 1H641 3L4GB 3WTZA 5F5WA 1G6NA 5J6XA 2FA5A 3HOSA 1L3LA 4MEXF 3UGQA 1YFRA 2L4MA 3H92A 3SHFA 5LHHA 4EGYA 5FO5A 5GANh 5LJ3f 2DXUA 3AHUA 3VODA 4TVAA 4TQDA 4PJOG 4IF4A 1KYWA 2P8TA 1KMNA 4KMUX 4ENMA 1YFSA 4EMKA 2ZNJA 3HOTA 4AWXB 3RERA 2Z33A 1O7LA 2UXXA 2LSOA 3E5XA 3HHGA 1Z05A 4Y17A 2YLBA 3B02A 2E1HA 4M9XA 3W3SA 3IHUA 4C92F 4XTVA 3RGLA 2D1VA 4B09A 3QSUA 1QE0A 1ZLJA 1W5SA 2VE9A 3KP4A 1SMTA 2QM3A 1U8RA 2QHTA 5DCMB 4G8XA 3GIBA 5DEQA 3VFZA 4EJOA 2ISZA 5GAN3 1FC3A 4G6DA 1LEBA 4C8QE 5JI6A 1E17A 3V7CA 1EVLA 4WF2A 1ZREA 4M75G 1WQ2A 4G9YA 5FD5A 1PYSA 4P74A 3JCMQ 2VOOA 1ZGAA 2X4HA 4C8QG 3HFZB 4BYYA 2A07F 2P7VB 1D8KA 1R5HA 3U9GA 4M7DD 3DPLC 2EJ9A 3M8FA 1B4AA 3GZ6A 5LRSA 2I4NA 3O3KA 3HRKA 1LB2A 4XU2A 3LQQA 3E9HA 1O3SA 1YB3A 3PQJA 1AOYA 1OYIA 2XRNA 1CF7B 3R0AA 1U2WA 3VOEA 4BH9A 2K7LA 4KN7X 2DLLA 3FMSA 3LA7A 5GAOr 2E41A 4TVAB 2V6CA 5HS8A 2MLGA 4NL3A 4M78D 1XGOA 4HDVA 3ROUA 5BQTA 3CO6C 1B34A 1B1BA 4N0AC 4EMHA 2RHQB 4WX9A 4LMYA 2A3SA 4ENNA 2GA2A 5ILUA 1XCVA 3P9KA 1U1TA 4HX4A 1Z7UA 3EQLF 4M77A 1FBUA 4YRFA 4MHGA 1MDMA 1QBJA 4WI1A 2ZFWA 3E5UA 1FNNA 3A5YA 3BDDA 5L3EA 2QBYB 3RKXA 4JRKA 4H2XB 4P72C 2HR3A 4XEMA 4EM1A 5H6QA 2XKOA 3RYRA 1XGSA 2DBBA 4PJOF 4A0XA 5L3FA 3J80K 2Q0OA 3SB2A 4LK0F 1U6GA 1X54A 3O2PE 4L9NA 4JUVA 4M75C 3HXXA 2ALYB 5JVTA 5CJ9A 4MQVA 1T2KA 3RPQA 5C51B 1TLHB 3C7JA 2YHTA 2ZIOA 4P73C 4M77C 1C0WA 3HSRA 4YFXF 4A5MA 2NS0A 5CVUA 3C1DA 4TTVA 1IAWA 5GAN2 2K57A 2O0YA 3HRUA 1KGSA 4EMKC 5CAIA 3ZMSA 2W84A 1AWCA 3L7WA 1WU7A 2EB7A 1ADYA 2DEQA 1SMYF 4E70A 5K5QA 3TO7A 2EFNA 2LKPA 3COAC 2LF7A 4KMFA 3E97A 2VODA 5DUIA 2EL9A 1LOJA 2EV0A 1O3QA 3A5ZA 3ZN1A 2YSRA 4PNOA 1JE8A 3JSPA 1NJ6A 1YQAA 2XHKA 3MQ0A 1XN7A 2ZR2A 3L1AA 3HFOA 3J80Z 1S6LA 1ZH5A 3VB2A 3UFGA 5AONA 2DFIA 2E7WA 1YCYA 1JGSA 2XUBA 4UVAA 5C53B 4L0YB 2HKOA 2DTRA 2F5FA 5D5XB 3I54A 3EYIA 3WTTC 2HQNA 1IXRC 1MJAA 3FMQA 1SD6A 3GXOA 2CJAA 2YR2A 1WNLA 1R00A 3IKVA 1LDJA 5TRDA 4GXOA 4HA8A 3E6CC 4UP8A 2FXAA 1H9GA 5L3CA 3NQOA 2IVMA 2OD5A 1N9SA 3SWNA 2DQ3A 4HF2A 4I2OA 2C7IA 2O3FA 4A54A 4QLCU 5GAMd 1Z6RA 2B0LA 3DQVC 4HWPA 2JPBA 4IPAA 1IRFA 3JCMc 1H4VB 4TVWA 3GF2A 4ZYHA 2HYGD 2XIGA 4I98B 4AIKA 4H2UA 4WCGA 4N9IA 1XB4A 4I02A 4XSXF 3MF2A 1USSA 4YIIA 2E1CA 4ZTZB 5L3DA 1E2XA 4DQ2A 3T1BA 1I5LA 4X9DA 4E51A 4KQEA 4WXCA 5ERIA 2ADUA 3TKYA 5FFZA 2HFHA 4M77D 3K2ZA 5K1XA 4QWQA 4HDUA 1TBXA 2E10A 3OV8A 3RI4A 4YRJA 1I6XA 5GMKl 1MGTA 1MDMB 4GO1A 2QVOA 4M77B 4IXAA 4FT8A 3KP2A 1OMIA 3TQNA 1BOAA 2P6TA 3IKLA 2ZT8A 4PDKA 1HW1A 3JB9D 1KMMA 3KZYA 3LWFA 4LB5A 5DY9A 3TOAA 2EV6A 3JAMK 3E3VA 5JHUA 2W25A 2MH9A 1B34B 4WXHA 4PJOA 2ETHA 1O57A 2J3LA 1SRYA 2Z9OA 3ZQ7A 4FHTA 1YYVA 4EJVA 1RIQA 3CUQC 1E24A 1ZGJA 5BPIA 2JSCA 2VC0A 3B73A 1QZYA 5LJ5g 2ZJ2A 4KIFA 1FP2A 5LGUA 2YX4A 1YTYA 1Z1DA 2KIUA 3L00A 4L87A 3ZMZA 2H6BA 5GAN7 3HFZA 4AIHA 5LJ3d 4HLXA 2R3SA 1I4K1 2STWA 5LJ5d 5LGTA 4V2SA 1J5YA 5GAN5 4K87A 4M9ZA 4YFNF 3ZMTA 1WQ7A 2ZZGA 1MJ9A 2RB6A 4O6JA 2NYXA 3DSQA 2V9VA 5LEJA 3ZMVA 2FBKA 2MBFA 4N0BA 3WODF 3GLXA 1IN6A 1SAXA 3QO7A 3FHZA 4FX0A 2O61A 2PG4A 4M75B 3K0LA 2JRTA 2HS5A 3UH0A 1RNLA 5HS7A 4OMZA 4CS3A
chains in the Genus database with same CATH superfamily
4LITA 5KNNA 2O03A 4F91B 2CUEA 2M2EA 3RIRA 2GF7A 4MMLA 4AH6A 3I4NJ 3P8TA 2ID3A 3EDPA 3M56A 3WTSC 2BZXA 2PUKB 1MMDA 4M6VA 4A5NA 2NRAC 2NUZA 3M57A 3JCMg 1WYDA 2MOXA 2RI5A 1ZGWA 4MNUA 3HOVJ 1R1TA 2KR3A 4XRMA 3CF2A 1KMMA 4N4OB 5F0FA 5DLQE 4ESFA 1VQLT 2CUDA 5E3NA 1TT0A 5CVJA 5D5WB 4NOYA 4GFBA 1QVUA 3RCOA 3VUZA 1EIYB 4RLQA 4D5CA 5HNFA 3ME9A 1ZN2A 3IC7A 3ZRGA 3NTIA 3H5NA 3ZBDA 1G5HA 3H3VK 2F4MB 5EG2A 3HXZA 1LNWA 3I56Q 1WJ5A 1WH7A 4HQMA 1LDDA 1XD7A 2JSPA 4PSWA 1M2OA 4PFPA 5HLGA 4S0HB 5I2SA 5HDGA 1JHFA 1M2VB 5LL6S 4CGZA 3W6VA 4KT6A 3CMYA 2PVOB 2R58A 2RHUA 1RAEB 2M0YA 3V8JA 1S72I 1V5EA 2H8WA 2R7ZJ 2DU7A 2O8XA 4KIBA 2M9HA 3GCMA 3P9CA 4M7DF 3PZCA 2D8JA 1USTA 3EYYA 3VWBA 2Q7HA 1TQPA 3N97A 1WHUA 2MK5A 3TW6A 3QYHB 4FISA 4J15A 3FKIJ 1OCZH 4OINF 4XTYA 1DGRM 4A3DJ 2ELHA 1K6OA 2VI6A 4D7MA 3CCLT 1JTYA 1S5LC 3FF5A 2JA8J 2KJCA 1GDTA 2ZNZA 1Z9QA 2WB1A 1IRGA 4R55A 1SFEA 1ZSZB 1W36D 2RN8A 3WG7H 3HTRA 2J05A 1B59A 2JTEA 2LK2A 2MF2A 4JZ3A 1YHQT 4GYGA 2HYFA 1VQ7T 3I55I 2L5QA 2AO9A 5E17F 1H0MA 1QCNA 4AT1B 2E2HJ 1R36A 2COMA 2ZZEA 4KH0B 3LA3A 1LKXA 5DLOA 3JCMh 1NBEB 4P5NA 2G0EA 3C12A 3JCMf 4XTXA 3L4GA 4DOWA 1DUXC 1Q86U 4D0PA 1NHAA 2QZ8A 1O7FA 1Y6IA 4DPGA 5ICEA 2HKQB 1SD4A 1X69A 4RTVA 1D1AA 3QAHA 3CC4A 2F5EA 1TTHB 3H41A 4P75A 1JUSA 2KRMA 5J8CA 5IH2A 3J7AF 2VPLA 4EVIA 2JTFA 2RF0A 2EFPA 4RBOA 3KZIC 5BPDA 3J7AY 2HZYA 2M0OA 2E60A 3IH2A 2C0TA 4Z8AA 3VRYA 3OOPA 5IT9K 2IGOA 4Q5SF 3DF8A 1RKWA 4XICA 3IV5A 4G85A 1LJOA 5D6FA 4GDFA 2E35A 2R7VA 1Y0UA 1B07A 4XR6A 5AIPA 2VLAA 3TSZA 4MTDA 3I59B 3M7GA 2UZKA 4N9HA 3Q5FA 2EJRA 2K9QA 3GTKJ 2DMOA 1SERA 1VQ5A 1ZUYA 2WWYA 1EA3A 4AFZC 3DLLA 3ABUA 2HOSA 2G7HA 4DJAA 2GXBA 3DEEA 2W85A 3QG1A 1WIEA 2BE9B 2K4YA 2WBMA 1RI9A 4XLCA 3QXEB 1V5FA 3GO5A 3TVTA 3UDCA 4JRQA 2JK3A 5DD8A 1XC5A 4XTWA 3CUQB 1YWOA 2K2VA 3U23A 3LSTA 1YG2A 3S1RJ 2DDZA 1S7AA 3A31A 5CLSA 2QYOA 3MZYA 3A74A 2Y4XA 3TQ7P 3ABLH 4X5OA 3K1MA 4UUTA 3S93A 5J8FA 1N6AA 2R5YA 1VQ4Q 2LDUA 3LSSA 3GW2A 3JSOA 2KE9A 2OTLT 3BFMA 2JVHA 3WTUC 1Z0XA 4MZPA 1B6AA 2RQQA 5F6FA 3TEHB 1KIKA 3G1ZA 4BE2A 5CKDA 3JW4A 5CQYA 3BOQA 1FBSA 2RM4A 2RMOA 4XLNF 3QO3A 2KXCA 4HZFA 1GV5A 3E9FA 1U8BA 2J5OA 1TWBA 1Q95G 3MCAB 4XTZA 2ZCEA 3JB9G 4RAFA 3VYGA 3UR3C 3BR6A 5FLXK 3EUHA 3ZQQA 3QOPA 1MMGA 4XKVA 5LJ5f 3W6KB 1ZK8A 3CC2A 4P9UA 5HK0A 1Y0NA 1G59A 2HTSA 1H4QA 3K69A 3X2QH 1ZAOA 2OAWA 5E3MA 2LMDA 4L18B 2PNIA 2FPDA 4NHJA 2ESWA 4RDXA 4HNTA 5BS6A 2XKPA 1NZ9A 1B70B 4EMKB 4H2VA 1TTYA 2DQ0A 2H27A 2EYQA 2L3RA 2EJFA 2CS3A 4AYBA 1Z91A 1NYGA 1K4TA 3THKA 1X58A 5CVVA 4IHXA 2KRFA 3N05A 4FL6A 2QEXT 3M0SA 1UMQA 4HVWA 1EV7A 4A6EA 4KDPA 4ZDOA 3GF5A 3I0TA 3PIOF 5L3BA 3M8EA 3MFKA 1KHIA 2L01A 1ZG5A 1W4SA 3KCCA 3KIOA 2H1LA 1RETA 2W1OA 2EQUA 3QP5A 4Y3OA 4BUPA 1JU5C 1SD7A 5J47A 1IN4A 1BR1A 1YFHA 4QVDA 1E22A 1JJCA 2COYA 3IRRA 2XV4S 4M9SA 1YO5C 8ATCB 1W66A 3TGNA 1UGPB 2OF7A 1S72A 3H8ZA 4C2MJ 4KIGA 3D0SA 4DBHA 4LG0A 3EGXA 2C0IA 3CCQT 1VQ7I 1ORKA 2D1HA 4ESBA 1RLQC 4FYWB 5DM7R 2L0KA 1U78A 1GHCA 1TUCA 1W1FA 3EPZA 4RTZA 4LD9K 3JB9H 4C2UA 2HKNA 5FLVA 3PVLA 1ZBJA 4U0VA 3R61A 2L3PA 3SD4A 3VS2A 2DYBA 2ME6A 1MBFA 2F5DA 2G9WA 2LNBA 2A7YA 2AZVA 3D7SB 1G3SA 4LLLA 4XU0A 5IHKA 3BJUA 2FBIA 1VQ7A 1DQUA 4M7AF 4RMOA 1J3TA 4N0AA 5KYUB 5FKLA 4MIMA 4CYDA 3JREA 1J09A 3BTCA 1PM3A 3A7UA 2LKSA 2ZKZA 3VQVA 1VQMA 1X19A 4P3PA 5GPCA 2WAFA 3FXQA 3FXRA 4LIUA 5FFXA 1UGVA 2BZ8A 2HVRA 2OQGA 2J06A 2KRHA 3K4LA 4GGGA 1IL2A 1R77A 3I58A 4ZTJA 1ETXA 1QCOA 2Y90A 5IN1A 1VQOQ 4BJ5C 1HBXG 3S1QJ 2P0LA 2CUFA 3W6JB 3F21A 2AXLA 1Z9CA 1HLVA 4U87A 4PGGA 3SHWA 1BOBA 4XL9A 2KNBB 5LJ5j 3EFRA 3P8BB 5IPAA 3VQYA 5GAN4 2ZO4A 4BE0A 1GVJA 1PVEA 4A3IJ 2HQ5A 4FT2A 1SAUA 4KGZB 1EQRA 1I27A 3PCOA 5E3IA 3FX3A 2HPMA 1SVOA 1KA8A 2OA4A 4RGRA 5EZHA 2LFBA 2EZHA 3BZCA 2LF8A 4KYWA 3HL2A 1O75A 2GCXA 2H3JA 2KY9A 2QG9B 4PJOD 1YJWT 3G1MA 4M6YA 1Q7YC 2IGNA 4Q48A 1NH3A 4I01A 1SSHA 3V7SA 1WHJA 4J83A 2ARTA 3NELA 1PYVA 3AL0B 2VVKA 4J9FA 5IYCJ 1FWZA 1MKMA 2EYYA 1OU9A 4PCQA 2K9NA 2MI6A 1PD0A 3FBNB 2ZPEB 3JB9F 4A3LJ 4PZJA 2L3DA 3GYHX 1QPMA 1YW8A 3K4KA 3N5BB 1ADJA 2E5AA 2DA3A 4PGHA 1NK2P 1GXQA 3X24B 4R79A 4C0FA 1H4TA 5FROA 3I5UA 2ZPFB 3KUFA 1Q7YR 3MEXA 1KSWA 1YGBA 3CCUI 1X3UA 3H3UA 2CU7A 1R8OB 2EYZA 4GY5A 2OTLQ 3CCQA 2R7FA 1BBUA 3BLYA 4BHBA 1WDXA 4PJOE 5GAOm 3SYTA 2LD5A 3LWHA 3E6MA 3GFJA 1YW7A 3CO7C 1EFNA 2B7EA 5L8RE 3BJAA 3HPHA 4DYQA 1RI7A 1OCRH 4IRHA 1K61A 4HCZA 4UV8A 3DPUA 1MHNA 1BJZA 5E18F 3RUXA 1P9QC 1DP7P 3UF4A 3CCSQ 1VQ4A 4M7AG 1SRLA 2EZLA 2DDBA 1OR7A 3OS0A 2VKHA 2WTEA 1XOVA 4ITVA 1QNTA 2JWTA 1P2FA 2BW3A 2CZ0B 2AHQA 5DD4A 3WTVC 1WXTA 2L2OA 4XLAA 2XI9A 4M78F 1EVKA 1K0XA 2W48A 3FMRA 3HJEA 5DM6F 1OOTA 2C8MA 2OZ6A 3VU3C 2P0KA 2HOEA 2BOLA 5CQGA 1XG1A 2O7OA 3BJOA 3I55T 1P92A 2OTJA 2JT1A 1UDLA 2F5CA 2ECZA 1ZRDA 4L59A 4MMKA 2FO0A 4AVPA 1MUZA 2HQAA 2K4BA 2JJ7A 4QVZA 1UUEA 3IKTA 1PCXA 1OPCA 1FYLA 1WYXA 2MA3A 4HLYA 2QSGX 1IUYA 4QQGA 2QKLB 3OMGA 2MD5A 2EZIA 3ISPA 5B66C 4LJZF 1S1NA 2JN6A 5KH6A 3CLQA 2RN7A 1HSTA 1QZEA 2VXEA 2XGXA 1FYMA 2CV2A 3SFMA 3M59A 5GANj 1O3RA 5E1ZB 4IKFA 1NLPC 2E5ZA 4A6DA 1EF4A 3M1CA 2W0ZA 2QSFX 5LEKA 1WA7A 1VQKI 4X6AJ 4HVVA 1B8AA 1K78A 2VXZA 2FRHA 2X9DA 5H6RA 4BB7A 4EM2A 1W5TA 2E70A 3F3XA 2XASA 3GWZA 2IA1A 4IEJA 5FGMA 3AG4H 1LEAA 4DGWB 2P0PA 2O9SA 2HTJA 2MABA 3PFSA 3G4SI 5FD6A 3LWIA 2P5IA 3K10A 4TQFA 2EFOA 2R7RA 1TH7A 2QQSA 2AQEA 3CUOA 3M3YJ 3NEMA 1PP7U 3CCSA 4WJ3M 5LJ3g 1BI0A 1OFCX 3J7YJ 1B7TA 2L9VA 2LVMA 2CZ7B 1RZ4A 1NM7A 5KAFC 2VL8A 5D8LB 3M4QA 4MGRA 1QVGP 2VJ5A 2HWVA 3LQRA 4LLGF 4XNFA 1F36A 1M8MA 2AIRB 2DL3A 3CBPA 3OS5A 3A32A 3T5XA 1WSUA 2V1NA 2QEXI 2H94A 3R6OA 4ZN1A 2DMPA 1XNIA 1FOWA 5CYVA 4ZZDA 3G73A 2DPDA 4OIPF 3J7AO 4HF1A 1C1AA 2KI7A 2X35A 4PG3A 1TQIA 3CZ6A 3HB9A 1M4ZA 3ZFJA 4GLKA 5FKKA 3AG1H 2L9NA 2DXBA 3PT9A 2K4JA 2DL5A 4A4HA 3CC4Q 4ZGDB 1B9MA 1OLTA 3CCEA 2JOYA 4EATA 3CMAI 3EUHC 2XGTA 2CH0A 1TWFJ 3CLOA 2I4OA 4CUGA 3QU3A 3TEGA 4MTEA 2PI0A 2SRCA 5A2QZ 4QQDA 4II1A 2MH2A 2H09A 3SZGA 1MMSA 3R07A 2BW3B 1Q86R 4R8HA 1J7KA 3EFOB 1NJIR 3NPFA 4PJOB 1E3HA 1ETKA 2ZXHA 3HRMA 3CC7A 3CC7T 1KONA 2M8GX 2KT1A 5FU6C 3CCRT 3P7NA 4HWSA 1R5GA 3NFCA 2ZT5A 1HW2A 2AS5F 2E1NA 3FM3A 4G6QA 4XLPF 3JRAA 1G2HA 1UHCA 2DX1A 2WSEE 4RAGA 3FJ5A 1OISA 1VQPT 1X2MA 3GTMJ 2GIZA 4V2FA 4RTWA 1NK3P 3REBB 1JQQA 4DOZA 4EMGA 1LUJB 2VUMJ 4P5OA 3V7RA 2DD5A 1YJNT 1E1TA 2M30A 4JYKA 1GV2A 2PJPA 3CQTA 2L8DA 2K9GA 5LJ3h 1YLFA 2FQ4A 1BL0A 1JXOA 3NETA 4F7UF 3A8LB 3LSJA 2JA6J 4UNOA 4ZYEA 1RR8C 2K5LA 4JBAA 2ZFUA 3QP6A 4U0YA 3EAEA 5L23A 2Z16A 3A8OB 4B47A 2X9HA 3P8HA 2ZB9A 2DXTA 4K88A 2R7OA 3TEHA 2PFBA 3VQXA 4F55A 1UCRA 2QWWA 1FJLA 2FMLA 4BQAA 5F1JA 2PZ1A 1RC9A 3K7AJ 1VUBA 3SFZA 3EG2A 3QYGB 4IUTA 1R71A 1YOVB 3CCJQ 4ZYDA 2KBTA 2WAQA 4Y15A 4RGXA 1NG2A 5KE2A 2RHZA 2Y4YA 3EH1A 3HPGA 4WI1A 1AA7A 4NB5A 1WKMA 1SD5A 5HS9A 3KFVA 2XDDA 3SZPA 1TNSA 4ENJA 4BY6B 11ASA 1IN5A 3A1YA 1F43A 2WACA 3BCBA 4XIDA 1FMWA 3ZQLA 2QGGA 4JLIA 3KE2A 4IVNA 1N8RU 4KN4X 1PSFA 2V79A 3FBIB 3O8VA 4KA4A 3AL0C 4J8OA 3A02A 1VA7A 2X3WD 1Y57A 3QZ9B 3CJTB 3PNVA 1X55A 2V26A 4YDQA 5LJ3e 3C2GA 1HYOA 3K1PA 4BXUA 3QWYA 3IP4B 2IW5A 3AT1B 2Z5UA 5ICFA 3R0JA 1YFTA 1FYFA 3SDGA 2Z1DA 2V9KA 3BE3A 4MDXA 4M7DG 4IUPA 2ZJRF 4M6XA 4G12A 2CIMA 3WGGA 4JJDA 3W2WA 4HT8A 5LHGA 3P8DA 4LDXA 2XGEA 2Q7EA 1VQKT 4C3HJ 1F1ZA 2DFHA 3AFHA 4CDGA 3WVEB 2M1BA 4IRGA 5CR2A 2QA4A 4BY7J 5AYFA 3Q1JA 2KYMA 3MKLA 4LDVA 1B70A 4DNCA 5HLTA 2CH4A 3QPHA 4Q47A 3WG9A 2EQJA 3HSFA 3EGXB 1X1DA 3M55A 3QZ5B 2EAYA 3FIFA 5GAOp 2VT2A 2FVUA 1QZZA 4I76A 1IREB 1HTTA 1F9NA 4HBLA 3HXUA 4M7AC 5GAMg 4JOMA 5F0HA 3TO6A 1JJCB 3OW2P 3PUBA 4M3GA 3D5SC 4G7OF 3WU0A 2OV7A 4ABZA 2DXIA 1YW9A 1TZLA 2BZTA 2DBMA 4C8QB 3X28B 2IPOB 5IXFA 4L9VA 2GLOA 4RTXA 3D5LA 2CQXA 3R60A 3CCEQ 2CP3A 2AMCA 3RJPA 4KRTA 2QI2A 3F8FA 3FC3A 2X48A 4Y28E 4E47A 2OAZA 4J9BA 2QQRA 4HCCA 4XKBA 5BOXA 1TWAJ 3UGTA 1K9AA 3MCZA 5K7HA 3G1LA 2K6DA 4CHUA 3QJ6A 1WJCA 5HNHA 3L09A 1B72B 1ULYA 4Y7NJ 1TG0A 1UE9A 3JAMZ 2VC1A 2RI2A 1MH3A 2ZZFA 4YCUA 3S1NJ 1TC3C 3F8NA 4CS4A 2JA2A 4HAMA 4A4KA 4KT0E 5GMKi 3PCOB 4Q6GA 1SHFA 2MSYA 5EZGA 4Z02A 3REXA 2QASA 3BDUA 3TO9A 2OZUA 1ZLMA 2AKLA 1LE8A 1C0MA 3NGPA 2KIQA 3IH4A 4AG1C 2CP5A 1HSQA 3OYKA 3ICAA 2QK0A 3G71I 1X2HA 2P81A 4CCNA 1KD1C 4AD9A 4R56A 3ML6A 3F6OA 4JK1X 3T8TA 4DYRA 3I7FA 1B7YA 1C6VX 2DYRH 2HDCA 2FHDA 4EDUA 2CP2A 4M7DE 3JCMe 1PD1A 2IAIA 4O5VA 3FKJA 1VIEA 4YRNA 4OMFB 3G71A 1QVFP 5GANe 2JM9A 1BBYA 3GEZA 1H92A 3QO8A 4XRSG 2DAQA 2RHIA 2Z99A 3OYEA 1MZBA 2R5YB 1VYTA 4IL6C 4LLNA 2DZ9A 4RG8A 2I10A 2B8AA 2VXFA 3JR9A 1TS9A 4IURA 5HLIA 2C06A 1IGQA 2KJBA 2MGQA 4M3BA 1H88C 2K9MA 1OX9A 2OTLA 4JRIA 4RM3A 2BXZA 3DEUA 1ZR4A 2HD0A 4LDWA 4M78C 4ZN3A 4XRFA 2QHSA 4LG0B 3MEWA 2V8JA 2O6GE 1X1CA 4CICA 1EJ9A 3PIPF 1WI3A 3S14J 2VKDA 4HX7A 5JHFA 3OIPA 2H8RA 3PE0A 3CCVQ 3ULQB 4F92B 2IS2A 2HQXA 1OR7C 3OBYA 1K4US 2D45A 4AIDA 1Y96B 3IG2A 5ELOA 3A98A 3CPFA 4UXNA 5E8GA 5KCOA 2FPFA 3OQ5A 4ZIBA 2ZMEA 1JKQC 1GUUA 2CQNA 2P0WA 5KK1A 5KNLA 2KDSA 3EGDB 3LX7A 4VUBA 3MP6A 3K1NA 2DCEA 1JEGA 4F52A 3WTYC 4U7DA 2K3XA 2A6HF 4JS4A 2RA2A 4HEA2 5I22A 4LN2A 4XSZF 1FOKA 3OYLA 3E5QA 3BTJA 3Q0UA 1M5Q1 4QT7A 4P71C 4ENKA 1FIAA 3FB9A 2NUTB 5I11A 2MLKA 1XSVA 1WJAA 4YP0A 1AWXA 3OIQA 5LGNA 4JJNK 4MLOA 4C5IA 1RAFB 2K85A 3JB9J 2FQ3A 2RKHA 4UVBA 3M0TA 1N75A 2LT4A 4PJOC 2EA4A 4XM3A 1EIYA 1X6BA 3DLMA 1M3CA 1MMNA 5JLXA 3M0PA 4TWAA 1YITQ 4G84A 4P74C 2YUSA 2HQRA 1RUOA 3HOYJ 1IV8A 1ZG3A 1ETWA 2CV1A 3LGLA 4M73A 2K5FA 2JPCA 4HV6A 5D4SA 4BUGA 1VZ0A 2P7CB 1U9NA 1PRLC 4A4FA 2QQAA 5AIQA 2HNIA 1B9NA 3KEOA 2XDPA 2ZPGB 2CWEA 2E71A 1UZCA 2KZGA 2LTPA 8AT1B 3QBYA 2ACJA 1IRXA 3HP9A 3JRCA 3C0CA 2RQTA 2VJJA 4R1HA 1P7JA 4YFKF 3VS1A 4KR3A 1Q81C 4D7NA 4E7HA 2FE3A 3A7AA 3CBOA 4PHCA 2LVSA 2VC8A 4M77F 3ZQIA 2P5KA 2CREA 1FSEA 3K70D 3CUQA 1HOMA 2JXBA 2XMFA 3M54A 4J9EA 3OB9A 5DY9A 1X3ZB 2X6YA 1NJ2A 2K86A 3OSSC 1HDPA 2BE5F 1R0CB 3CP8A 3EGDA 1LVKA 2F5TX 3QRFF 2LBFA 3MAJA 4FW1A 4RB1A 1YITT 2VOPA 3O5ZA 2FZCB 1F4KA 4QSHA 1ETQA 4M78E 4J6XA 1KHCA 3I64A 1G4DA 1JBMA 3GX4X 3L2ZA 3URGA 3QNEA 3RF1A 4HWRA 2VYTA 5D6EA 3U1DA 2KMTA 2LJ0A 2WSCE 3LLRA 3PIOA 3TUPA 2VASA 1G8XA 2DRKA 1KQ2A 2Y0MA 4Y52J 3NEUA 4L5JA 5KYYA 2G7UA 3NRVA 2L9RA 2O2OA 4OLFA 4I0BA 2EIKH 3SDBA 3S2WA 4E7KA 3PJRA 2CJJA 3F8BA 2YLCA 4OF1A 3OYAA 2EQIA 1JT0A 2P4RA 3CCVA 4C8QF 2VKNA 3HYIA 1I8FA 4A3EJ 2EPFA 2RQPA 2FSWA 2R93J 2KP6A 1X75C 1WI9A 1A6IA 4M75A 2Q2EA 3WTWC 3BT9A 2DXCA 1M90R 1AOJA 4F17A 1MJBA 1YS6A 3MEYA 1WHGA 2EFIA 5DDGA 5B1AH 5CKEA 3RQ4A 3I71A 1ZG1A 1UEBA 2ARSA 1D3BA 1FYNA 2Q1ZB 2DA4A 4F7ZA 1ZRFA 2M0MA 2PEXA 3MJXA 4G7HF 2HDDA 2GFAA 1RUNA 4YREA 1VQZA 3I5RA 1R22A 2D0QB 4J6WA 1RLPC 2FJ1A 2BE7D 3DPTA 5FKMA 3VSLA 5ECAA 5EEAA 3J81K 1ITYA 3JCMJ 4QTRA 1NJ1A 3LC0A 1R9TJ 1XDSA 4HF0A 2A8EA 1W6XA 1Z6TA 3DEWA 2Q8KA 5D8KB 2DI3A 2ZIMA 5EEGA 2FRWA 2K27A 3E6DA 3ONQA 4CZCA 2DTHA 2JNGA 1TW2A 3WU2C 2JZ2A 3KBGA 4D8DA 3F0CA 2KT0A 3DP7A 4XOPA 5TGTA 3QOEA 4LNSA 3EG3A 1SPKA 4HSTA 1UGQB 3A8HB 1QU3A 2IPQX 5LRRA 1YIJQ 1XDUA 2R5AA 1VQ6T 2BVLA 1N9WA 1ASYA 2W24A 5KCMA 1KFZA 3M1EA 4C0DC 1ZARA 1YITI 1NYRA 2QEXQ 3UFGA 3OYFA 1E0EA 3H0HA 3CCUQ 4EEFG 3OYHA 1YIOA 2ZMEB 3FXUA 1J59A 2D0NA 4C92G 3CDHA 5GAMj 1Z7MA 1V3FA 5GMKh 2ENMA 2LR8A 2CW0F 4MO7A 1P4XA 3HXLA 4RQFA 1Y96A 2PN6A 1XGMA 2DMTA 4L9JA 4YRRA 3L2WA 1UB9A 4UY8I 3MZ8A 1G2BA 2DK3A 2QDYB 4M78B 1ZTRA 5FWBA 5GJVB 3KFUA 3L2UA 2P0QA 2RHYA 1T08B 2RHSA 5K5RA 2HU9A 4ESJA 2YRDA 3OSGA 2ZNYA 1E1OA 3JRGA 1YI2I 4V19K 1Z21A 1IJWC 4OB2B 2IJLA 3GTJJ 5D6XA 2LREA 5IAYA 1UFMA 4IUQA 4M72A 1FOYA 1POGA 3I53A 5IYDJ 2ZPIB 2O5RA 3DB3A 2CFXA 4LD5A 4J7IA 3FEOA 3KETA 3L2VA 3LH0A 4YRMA 3K4MA 3KLOA 2E4HA 1FZPB 4HT9A 4BEHA 4OVAA 1T6SA 4DBQA 3BG9A 1I1SA 4IJAA 2HSPA 2JS0A 1YI2A 1KQ9A 5CKHA 1JUPA 2BY3A 3BR0A 3F72A 2ZINA 1OZ2A 1YS7A 1MV3A 5GMKe 3RL6A 1UFFA 2XU8A 3G7ZA 2J6KA 5C44J 3A8GB 2UXNA 4XU1A 2F5VA 1VQ4T 1OJLA 2JA5J 4IRIA 4M3DA 3JRDA 2W7NA 1E3OC 5M3MJ 3IWZA 2F2WA 2XRLA 4HG2A 1IW7F 4CXFA 5K7ZA 1M1FA 2CYZB 2IA2A 3RQIA 4YCWA 1AT1B 1K9MR 2OTJQ 4RMFA 5C4JJ 1S7EA 1W7PA 1FIPA 4ZDLA 1W0UA 1IF1A 2FX0A 3SJMA 4KR2A 2YU9J 1I39A 1WXUA 2HVQA 4BI8B 4C3IJ 1SFOJ 1TUDA 1N77A 2XAGA 1WHKA 4YRVA 1WGXA 4J6YA 3A03A 1J9IA 1AEYA 2DOFA 4NDLA 2RJFA 2ZCFB 4FE4A 3J81Z 2XVCA 3CMEQ 2L89A 1NG6A 5JLWA 3BG7A 4V2GA 2NVXJ 1UHMA 2CQ7A 2M4GA 3ZMDA 2RVCA 1I1JA 3SEZA 1X6GA 2YDLA 2XG8D 4EQQA 2FOKA 1WX6A 3G71T 1ONVA 3M0RA 2I5UA 5D5VB 2H6CA 3HUGB 5C3EJ 4IOCF 2GTJA 2GBQA 2IS6A 5E1WA 3WGHA 5A2QK 3I4MJ 1ETYA 2LY2A 4L9TA 1N5ZA 4KITB 2RQVA 4LUDA 2JN0A 2BBYA 5CPRB 1K6YA 4RM2A 4ASNA 1LFBA 3FXOA 4EMSA 1SFXA 2EIMH 3DKMA 2ODRC 1M9SA 2AK5A 5EF6A 5CVRA 1BKBA 2EV5A 2RJDA 2LH9A 4B48A 4CSWA 2K5CA 1FBQA 4YELA 1H89C 4UUSA 3IL2A 2CW7A 5GAMf 1YJ9T 3BZ6A 1JJ2A 3P8YA 4MDWA 2M8EA 3FK7A 5EDNA 1OEBA 4UC4A 1EOVA 4XRSA 4K11A 4ZC3A 1WLEA 5FU7C 1KG1A 1JGGA 3HEFA 3PMTA 3CESA 1KQ0A 4BACA 2UUZA 3QYEA 1UB4A 3CJNA 2AXTC 4MEYF 5IP9J 1KQ1A 1QW1A 4OB1B 4BW9A 2CSIA 3LAPA 1YHQA 3GBGA 3LFKA 4NNJA 2A5YB 2E2JJ 1QVFA 3HY1A 1GLNA 4HT4A 2I4MA 4DBRA 1WJDA 1DU0A 4PL6A 1K7AA 2KDZA 3HY0A 1KYZA 3ZR8X 1ZQ3P 4X9CA 1HKQA 4UPAA 2DMNA 5E79C 2DPUA 3RMSA 3C18A 2LYCA 2TCTA 4YRGA 3OYMA 3LSPA 3A01A 1OULA 5GMKj 2ZXWH 4A3FJ 3QTCA 2M87A 5IY5H 4B6MA 1USYC 2IXSA 4BHCA 1J75A 2RK2A 2HAXA 1K83J 1V4RA 1Z77A 4H4KC 4Y13A 3PFIA 4P72A 4FSXA 3CCRQ 1DPRA 2K02A 3RKYA 3X26B 4G94A 3FZVA 3CCLI 1S9HA 2OQRA 2ALYA 3BC8A 2X51A 3GVAA 2M5WA 4CZZA 2P6SA 1W1WE 5KYNA 2CUZA 3JCUC 1CGPA 1PKTA 2IY5B 2KQWA 2JZYA 3A01B 1TNTA 4C30A 1WJRA 3BDLA 1YHQQ 1Y1VJ 1R4MB 2DA6A 4OMYA 2RI3A 1M8VA 4YTLA 1V76A 2KHMA 3A2KA 2FPEA 1ZUKA 2PMHA 2EGCA 2BY2A 1FP1D 2GNCA 4PJ0C 1QMCA 5KE3A 3H9QA 2ROTA 4GYIA 3VQWA 3U2RA 3JRFA 1QQIA 3ZQCA 3KEQA 4BXXJ 2LC2A 5D5UB 1QRYA 2YPRA 2FYKA 1HD3A 3M5AA 1BIAA 1MNEA 1H9TA 3TP0A 2EYXA 2K9LA 3I4PA 4HW0A 4UV9A 2DM1A 2LJ3A 4F7UE 2WA0A 4XLHA 5BMZA 4BNCA 4P3NA 1PG5B 1ZA2B 3WQZA 5F64A 2C0OA 1K79A 3O8HA 1XTDA 4RTTA 3WGIA 5HK3A 4OIRF 1ZHFA 3F6VA 2DT6A 5GAOn 5B5EC 3TDUC 2NNNA 4UUSB 3I5SA 3PTAA 2V4JC 4LGWA 2FB7A 5LBQA 2E64A 2ZGWA 3JTGA 3BY6A 4QPQA 4BU2A 1KOGA 3G71Q 3C3WA 5FLXZ 5CVIA 4HNVA 4R0KA 1R1UA 3JRIA 1YRNA 3QJYA 2VXDA 3REUA 2RV8A 3BCAA 1FT9A 2Y75A 3FHNA 1MIJA 5J3BA 1K73C 3CD6Q 2Y30A 4JX5A 2XAUA 4U0WA 3DLAA 4LB6B 1DPUA 3JV3A 4BKXA 1IN8A 3HOUJ 4Q15A 4RAZA 2ELKA 4YIFA 2PLYA 2QTXA 3GBQA 2DQLA 2HZTA 5DYMA 1O3TA 3HHHA 1QP3A 2DZCA 4FYXB 2FNPA 1J0RA 5H2FC 2D9TA 4OMNA 1LQ1A 1JKPC 2KAFA 3OMYA 3IRQA 4O3MA 5GJWB 3CCVT 1X01A 1S7OA 4C8QC 4XN3A 2COZA 4UUVA 4M75F 2LDMA 3MF1A 2ZAEA 2L4AA 4IO9F 5C0MA 3KZZA 1UJ0A 2STTA 2P4TA 3C4SA 1TW3A 2KK4A 1NJ5A 1AU7A 5KAIC 2M7AA 3I9V2 2EQMA 1REPC 2Q5HA 3ZEHA 5HODA 2VPRA 1ODDA 5K5OA 4P71A 1XGNA 1UTIA 2PMZA 3S1MJ 1W2BS 3CTAA 1ASZA 2QHUA 3QHSA 2KZVA 2DFEA 3ZMUA 1HF0A 4NC8A 2EGEA 4AU7A 2LZ6B 2LX9A 3ZQFA 4A69C 1VTNC 2XK0A 4ESRA 1YJNQ 1WPKA 1CQTA 1U5TB 4M77G 5KYUA 4EJUA 2JTVA 1LDKB 3NWSA 1LFUP 3L42A 3JRBA 4L0ZB 4GLMA 4CC4B 2HMAA 4HCBA 1UGRB 1BA5A 2R7WA 2AZSA 2RC4A 3FDRA 2PUOB 2Z3YA 4J5YA 1Y39A 5EGOA 3EHRA 1XMXA 2OBPA 1I0CA 4XEOA 1R7JA 4IQ4A 3T0YA 3H9GA 1T0FC 2D2WA 3MHXA 2TDXA 2KEAA 1L0WA 1ZLKA 3VYUB 5FU7B 2IY5A 4RKUE 2K40A 5HDNA 1VOMA 5D6YA 2DA2A 4KT5C 2RDPA 4P75C 3R4KA 3GMEA 1WJSA 4M7DC 1SETA 3S17J 4M74A 1W7PB 1M90U 2W57A 3RKWA 2E6NA 2LQ8A 2DK5A 4M78A 3JCMV 3HGYA 4HVCA 4RTUA 2EYWA 1IZ1A 1ETOA 3MKWB 4E7SA 5ICCA 1R6RA 1WFWA 4E2FB 4M77E 1ERDA 2CG4A 5F27A 2DOEA 4NCXA 2ECCA 3G4SQ 1KU9A 4IHTA 4JX6A 3QO5A 2VB6A 2PMUA 2M02A 3K9TA 3OD1A 3CP2A 5CQEA 4S04A 1Q86C 1PRMC 2WV1A 3KPHA 2ATCB 4I7HA 2DT5A 3SXYA 4LFUA 2EWNA 3TMOA 2AKWA 2R7TA 1R1VA 3BP8A 4XMYA 3DLLF 2CRGA 4MQ9F 1SFUA 2HEOA 3MQZA 3KFWX 2A36A 2EA2A 2XAJA 1SESA 2DQRA 2Y0SA 4KJZA 4XK4A 2MFZA 1X1BA 3BPVA 3EETA 5M5WJ 1EH7A 1CF7A 1Q82C 1GXIE 1N8RC 4HNUA 3BROA 4BDYA 2E12A 3GZ5A 2J5PA 4EV0A 1SRMA 2VT3A 3HTZA 4WJ4A 4UP9A 2A3LA 1G3TA 4C3JJ 3WU1B 1OU8A 4HV5A 1I6HJ 3JSCA 3CCJA 2AHJB 2PX9A 3JTHA 1RAAB 2DJQA 2VBWA 4OAYA 2I2LA 3G1JA 1VQMI 4XAXB 1JI8A 4YRPA 3FJPA 1NTCA 2NVTJ 2V8KA 4CCKA 2L7KA 1YITA 5GAN8 1Q7YU 4C0DB 4WXDA 3OYGA 3K6GA 3VYRB 3ZN0A 1VYUA 2LJ1A 4M7AE 3OSVA 4LXCA 1PUEE 2JTMA 3J81E 2LX7A 3FISA 1JJ6C 1WWXA 2HBPA 3G6ET 2H8HA 3B6AA 1VQOA 2L7MP 3T9NA 4A12A 5IOYA 2FF4A 3MEVA 1FSHA 4UHTA 2YUPA 3O8GA 2A37A 3H0IA 3I3LA 3CD6T 1ATIA 5K1PA 1WJBA 1QQJA 1WRJA 1QF6A 1BK2A 1R4NB 3Q9VA 5K1YA 2D5VA 2BY1A 4ELZC 4P3OA 4CO8A 1Z7NA 1UJ8A 2PMFA 3RSNA 3WHBA 4EM0B 5DUKA 3ZP5A 3BY7A 1JXMA 1PKSA 4FM4B 3WXMB 3ASKA 1EZZB 4FT4A 1GFDA 1I50J 4M7AA 3PFYA 3ERMA 5FB2A 4F3QA 1QGPA 4OB0B 5IT9E 1JTXA 3HKSA 4KBMB 3VYHB 5IHIA 2FMYA 3M4GA 4C5HA 4RTYA 3VS4A 3CCRA 4PSXA 3RBBB 2JMAA 3HG9A 2RH2A 1IXSB 1X2NA 4RGUA 7AT1B 1YNZA 5GANd 4Q4ZF 3MZHA 2H1KA 4P9FA 1U0JA 2QHVA 3RGLA 1OX8A 1ZX6A 1IN7A 1BM9A 1S29A 2FU4A 1ARKA 2DE0X 3CC2Q 1YP5A 3HTUA 2ZR3A 2Q5IA 1GBRA 2Q2EB 4H2TA 1ZELA 3V8LA 3BZKA 2GZWA 4A0YA 2IGKA 3GFIA 2CS7A 4CH4A 1RAHB 4H2XA 1KQSA 2KQRA 4C5GA 1O9SA 1FOXA 2RO0A 4DEXA 2CP0A 1KU2A 3DWLE 2BGCA 2IGMA 4RB2C 3LAJA 3S3NA 2JA7J 9ANTA 2VBXA 2GA1A 1LNXA 3RDVA 3AAFA 1N9RA 2O88A 4QVCA 4A63B 5LLQA 4OMOA 1M27C 3ECOA 1TL8A 4WWCA 4HYEA 3L9FA 3CBMA 1WJQA 1B7YB 5J4VA 1X43A 4L5GA 2ZXJA 2VUBA 1AWOA 1OPLA 2PJRB 1Q82R 3OYJA 4RDUA 1LVAA 5J4YA 1VQ5I 2GM4A 1T0FA 2IT0A 2ROLA 2XPWA 1XMKA 2HKXA 1QKWA 3JAME 2RHQA 2E36A 3EHQA 4YIRX 1HKSA 3PM1A 4IUVA 3Q0VA 4ETSA 5HOOA 3F22A 4M7AB 1RPWA 3LFUA 1W36C 1WZOA 1P7IA 5F1RA 1S3JA 2KL4A 4DBFA 1VQOT 3IKMB 3GTGJ 5HKCA 4CH7A 1D3YA 4BE1A 2RNAA 4Y92A 3REAB 3H5AA 3LGFA 2A61A 4Y91A 2L7FP 3FK6A 4NL2A 4GRIA 1KQ8A 4BI4A 1H4SA 2LKXA 1OCTC 1TQMA 3BQYA 2ZT6A 4AYBN 3BJ6A 3HSEA 3B6CA 4A0ZA 2DO3A 3MP1A 1YHQI 2VKEA 4J9CA 5J3LA 3CCLQ 2L9SA 1U5TC 4EJTA 2WB1N 3QQAA 1UHSA 4PJNA 4J7FA 5EC7A 2JQ7A 5A2QE 2N8GA 3M07A 5HCKA 2D6FA 1W5CC 1VYVA 2O9LA 3PNWC 3KLNA 4RGSA 1T56A 3LSHA 4P1WA 4B1RA 1HDDC 2VGMA 2QA4T 3MKDA 4F16A 4C8QA 4BAYA 1TSFA 4BI3A 1IRZA 2F69A 2GFUA 3CMEI 2LCCA 4H2SA 2QQBA 2QGFB 4P73A 2YU3A 3DXJF 5ILVA 5HDKA 2QLZA 3WE3A 1PDNC 4IHSA 1RABB 4FIBA 3CCQI 3RMQA 3P5JA 1D3BB 1SANA 2O4XA 3UT1A 4OP0A 4I09A 2K3PA 2J6OA 2KT8A 1I3QJ 2DETA 4OIOF 2QGUA 1W4MA 3HRTA 3SZTA 2CP6A 2ED0A 2ECBA 5M9OA 4LDYA 1T98A 4N4HA 4E4HA 2DBKA 1K73R 3DTKA 4NQWA 3RKQA 1P4WA 1OKRA 2JW4A 4XU3A 4ATOA 4CH3A 2E1MC 2P5LC 2L02A 2ZTGA 1VQ8T 3HKZA 2L2PA 4B3XA 4XBFA 1PYSB 4HPQA 1JRIA 1UJYA 2O31A 3M4PA 4KICA 3ZOBA 1KQSS 1AZEA 1NE8A 3HIFA 1UG1A 1EH8A 3A8MB 3EG9A 2EK5A 3DV8A 3L1PA 2KVQG 1NYFA 4OMLA 1SEUA 3ASNH 2GTOA 4OMPA 1GCQA 1Z9ZA 2G4CA 3LMMA 5CKBA 3CC2T 2HSEB 2F2VA 3SEMA 4FTHA 1LPLA 1GT0C 3F23A 1WHLA 1D8JA 1QVFS 4H2WA 2MC3A 1MSEC 3CC2I 4XONA 1BN5A 1BI2A 1OQYA 2A6EF 3HBLA 1R5ID 1I81A 1PHTA 3GZNB 1B3QA 2F5KA 1RADB 3MEAA 3TSWA 1I5OB 3I56A 4X34A 2CJBA 3REOA 4ZH4F 4U88A 2A68F 2WAEA 1T33A 2NVYJ 3VEPA 3CF5F 1JT6A 4E6RA 3VYTB 4DZPA 1P4AA 4Z6YA 2M9UA 2XIDA 1VQPI 3PIPA 1VQ9T 4E7IA 2DAOA 4PJMA 4HOBA 4J19A 4YRCA 1PNJA 1BU1A 1ETVA 2XF7A 5DCMA 1WHHA 4CRIA 3S8PA 1K76A 2EGAA 2GIVA 4G7ZF 1SKUB 3CCVI 2AKKA 3PGGA 4ANJA 2DJZA 1M3BA 4LVLA 1AKHB 3GTPJ 2ZSIB 4C92E 1U5TA 5GAN6 2BHYA 1JUMA 1VQPA 2NWMA 3E9IA 4A4EA 2V1RA 2P4WA 4LK1F 2V1UA 3CCUT 1HSJA 1UHWA 2XAFA 1UG0A 2A69F 3ASOH 4M3FA 4XKCA 4IUUA 3JCMd 2RGVA 3CXCA 2ME0A 2EKOA 2MAMA 3KP5A 2VE8A 3RPUA 3NARA 1NG7A 1V1CA 4ZGJB 4ZTUB 2VONA 1VQ9Q 3INZA 1OYYA 4NBQA 2GQQA 3K4BA 3ZQHA 3ERED 3CCRI 2ED1A 5CCAA 1BBWA 2PVDB 4L5EA 2FOWA 4B8XA 1KQSP 2IEKA 4EO4A 4NC7A 3T8RA 3F8MA 2NUTA 4YCVA 2IBDA 1RKTA 2BIVA 4F7UA 4HWOA 3META 4YYEA 2ZC2A 2QQ8A 2V7FA 2KSSA 3O6BB 3E1SA 1T39A 1IXCA 2ZT7A 4X0GA 1T95A 2ESHA 3HRIA 2V1DA 5GAMh 12ASA 2CH4W 3OS2A 3X25B 4C9YA 4OU0A 4L5IA 2KIMA 2NAZA 5LHIA 2HL5C 3GOXA 2AKWB 1X4PA 3RTRA 3LSKA 2M7BA 1YX5A 2DK8A 4JQFA 1F5TA 4FW2A 2AMCB 2BV6A 5J1UA 4BWAA 1YIJT 1AWJA 1XQHA 1VQ8Q 2E3CA 2WV0A 3P8VA 3IQLA 3VS7A 4M7AD 3BW1A 1IC8A 2CO5A 1BBZA 1FMKA 1OCOH 2PMZN 1NPRA 1W70A 4CCOA 3MEUA 3NTHA 1ON2A 4FU6A 4CYCA 5KCHA 4LG3A 3VKIA 3UPUA 5IT3A 3UA6A 2OI3A 3BWGA 4RQEA 4AIJA 4C0GA 3H5RA 2ZBKA 2VQGA 2YSQA 3HSBA 4M7DB 4S05A 2YX7A 3R6SA 4QPOA 1JJ8C 4AFSC 1J2XA 2A6TA 2FBHA 4D5FA 1FLIA 4KISA 3VS0A 5FU6B 3G4ST 5GAMe 4A3KJ 1PWTA 2IVWA 1XCBA 1J5WA 2E7XA 3K2AA 4M75D 3S2HJ 4UVCA 1ZA1B 2KYBA 4JDSA 2DL4A 1FXXA 4M78G 3TREA 3RACA 4A2UA 4BQNA 5JR3A 1M3AA 4M4ZA 1SF9A 3HXVA 4C92A 4CS2A 5LJ5e 5C52B 2QENA 3TOBA 4RA2A 2NOGA 5FWCA 2Y31A 3M9QA 1EH6A 4YRKA 1DP3A 3BR1A 4DW6A 3VBBA 4H2YA 1FY7A 1UAAA 1QVTA 4OGCA 3NENA 3M8JA 1VQMT 2XPUA 4M71A 2ZPBB 1U3EM 3E19A 1YJNI 1X2GA 3FDYA 2ZXFA 4OOIA 2R5ZB 1JXSA 4ZZLA 1IV6A 1Y0MA 2Z2SB 4Q5WA 1MD0A 4HX8A 1RAIB 4BJTA 3CMEA 1LYLA 1M1KR 1U3OA 2X1DA 3S6WA 3C2HA 4XTUA 1FYKA 2XSJC 4JLGA 1HW5A 2UWMA 2L54A 2EJGA 1MH4A 1WFXA 2I4LA 1FPQA 2NNYA 2XROA 2FD5A 2E3IA 3Q9SA 1R58A 3ZL7C 5IT9Z 2DTIA 2L3SA 2Z0WA 2R5MA 3E9GA 5LJ5h 3LYIA 3MO8A 1BYMA 1D0ZA 3OOUA 4ZTFA 1FTTA 3N4MA 5M3FJ 1FMVA 1BC8C 1VQ5T 4PUSA 1CSKA 2RNJA 3FXJA 3G2BA 3MD2A 4U7BA 4QKUA 1U9OA 4HWTA 1BJAA 3MP8A 1SHGA 5ELNA 3KP6A 4FE7A 1U1SA 2IA0A 3RESA 4XLEA 2CW8A 3IALA 2PMEA 5ICGA 2DA7A 3U1KA 5KYXB 3KP3A 2ZCWA 3TP3A 1KC8R 4O2DA 1NPPA 4YRSA 2OJ2A 2A5WA 3WTXC 3HXYA 2DKGA 2MCNA 1IGUA 3ZPLA 2CMPA 4OWRB 2R0QC 4N4NB 2E65A 5EYRA 1GXPA 2QF7A 5I21A 5CKFA 1E7OA 4GCVA 1MNMC 3HOZJ 3VS5A 4A53A 3EFOA 1BR4A 3G4SA 3RYPA 4ZYGA 1KU3A 2KIFA 4FQGA 3HUGA 1ENHA 3CC4I 1HKTA 1WQWA 1EKEA 1ABQA 1IO6A 1TUGB 1TXQA 2W10A 3DBRB 5FW9A 4TVYA 2MC4A 1YN8A 4RS8A 3ABTA 5EG0B 1GGMA 3HFVA 3LSRA 1XSXA 2KPMA 3CCYA 2KROA 1MBEA 1MGQA 1YWPA 2XTIA 3JCMP 4EJWA 3F8CA 2MD0A 4IHVA 1UGSB 2MWOA 2XKOC 2HI3A 4II3A 4F7UG 4OGEA 2HPIA 4RB0A 4Y33A 1VQ9A 4CH5A 3QIIA 3SWNB 1DDNA 1KJWA 1W7PD 2BEOA 1IDYA 1Z67A 1E6HA 3GNGA 5H20A 4GBQA 1NNHA 2FNAA 3ABMH 2LCSA 2FEZA 2CGPA 3A7RA 3BPXA 3JCMX 3G3ZA 1EFWA 2EFWA 2CGHA 4WK8F 4J9DA 1GFCA 1Y71A 3VRZA 4FETA 4RCBA 1G3WA 6PAXA 2JRMA 1X1PA 1XS9A 1RACB 2DA9A 4M75E 4PLLA 5L3GA 3OMCA 2ESNA 1XPXA 4FYYB 3PMIA 2XICA 3GNFB 2Y48A 1I1GA 1AVZC 5FRNA 1SEMA 3A5ZB 3VDXA 3PNYA 2HGCA 2VN2A 4B3AA 4RUGA 4A4GA 3QPSA 2KRSA 2EINH 4Z2YA 3A0BC 4C8QD 2RQRA 5A0LA 4CH6A 2LY1A 4P96A 2K9SA 1G3YA 4BHPA 3CDLA 1K78B 1N78A 1D5VA 3FXLA 2D8HA 4H02A 5HY6A 3ELKA 3CMQA 2OU2A 3H0DA 2WC2A 1HJDA 1G51A 1SC7A 2DEUA 3M0UA 1R23A 1UECA 1A04A 3FWEA 4PFZA 2RHSB 2Y9YA 4K2EA 1YIJI 1B76A 5DV5A 2DW4A 2HZDA 4E6KG 1H8AC 2R7SA 2DIGA 2HEQA 4TVRA 1RL2A 2YT6A 4C92C 5GANg 5KYXA 1V29B 2DERA 2CSOA 4HQEA 4A93J 2JMCA 4UB8C 5LD2C 2RPNA 4FYVB 3BQZA 3CMAQ 2C6YA 2COBA 3E6BA 2ID6A 3HTSB 2DU5A 4UP7A 3I56T 2XC7A 2X4JA 5KYWA 2W82A 2NUPB 2X4XA 4CCLA 3V42A 2NYSA 1BIBA 2GAUA 4I0AA 4I6ZA 1XSDA 3FM5A 3AG2H 1OI1A 3DKWA 2DU9A 3CD6A 3ERRA 2MYSA 2CZ6B 2X1CA 3DTEA 3H3ZA 3IUOA 4J01A 2CQKA 2O01E 1I3AA 2HNHA 1I5ZA 2QQ9A 3TDZC 2K7AA 3PNTA 3GFMA 1LJ9A 2RD1A 4F7UB 4XK8E 2GWRA 5KYWB 3ZXSA 5KVRA 5IHNA 3SFIA 5F0CA 2WY8Q 3IAM2 3OYDA 3M53A 1VQMQ 3RNJA 2LQKA 3Q3SA 4KNYA 3IAS2 2BUDA 3MPUB 2KKOA 4LE9A 4YRTA 1ZHIA 3TU4K 4CC3A 4RB3C 1BC7C 3Q0WA 5E20A 3DU5A 4H0EA 1ZRCA 5ED4A 3EFSA 2CYYA 5HGQA 1VNDA 2VQHA 3JRHA 1B8IB 1XMAA 5E8IA 3V8KA 2DODA 1OCCH 1SVLA 1YJ9A 4W1UA 4IIOA 2F4IA 2DO7A 1V54H 2MPXC 2ELJA 1ZYRF 3CCJI 3KP7A 3PO3J 2ABLA 1YJ9Q 3BG6A 4RCCA 1X2KA 3CCEI 4K86A 2VBZA 2OC6A 3HRSA 5GAGJ 3M4YA 2X6XA 4X1VA 2GXGA 1YJ9I 1GCQC 5IXBA 2J6FA 4Y4RA 2IRFG 3DU6A 5HVQC 4KGVB 4AC0A 1YX3A 1USYA 2FUG2 4LDUA 2VBYA 2DD4A 1VQOI 2FRYA 2YUNA 4KGXB 4YRLA 3LSIA 1ABOA 2E1OA 1YBYA 1QA6A 4CC2A 1FX7A 3I55Q 3BTLA 2ISYA 2MW8A 2QUFA 5E1XA 1UELB 2EVRA 1NYQA 2F2EA 2R4GA 2Y2ZA 1OV3A 4CYCB 3BR5A 2LQNA 1VF9A 4DZJA 1KZHA 1TWHJ 3I59A 4XLFA 1IXDA 4F04B 4YRQA 1P6RA 3TL4X 1HXDA 2DJIA 3A0HC 4A3MJ 1EIFA 3HHTB 2HL3A 3HFNA 2ZNIA 4X1EA 1T38A 3CCMT 2CJ9A 3DFGA 2QDLA 3IWFA 5DCFA 1VFCA 2KXDA 3GFLA 1HC7A 2FG0A 4IIMA 1MW7A 2A08A 4AFUC 2YRCA 3LSQA 5GTIC 1UG2A 2ICWG 2EBPA 2DVEA 3QU6A 3MWMA 4XQFA 4DEYA 2BY0A 3CMAA 3WHCA 2A05A 4YG2F 1MBKA 2PBIA 3CCMA 3BG3A 4D8KA 2YUQA 4YPFA 5A0GA 1D1CA 4YRIA 1PP8F 2GQVA 5IP6A 3QUIA 1VQPQ 2EFQA 1BI3A 1OYWA 4NQWB 3L2QA 4LIVA 3LA2A 1STZA 2DTOA 4FX4A 4HRIA 1HA8A 3L2CA 2E19A 3M9AA 3H35A 3KYLA 4M7DA 5GAHJ 1QHGA 3JB9I 1IO2A 1JHHA 2XAQA 4M3EA 3RDIA 4CCJA 2XGDA 5HLHA 3GTOJ 2YXYA 4XN0A 4YROA 2NXNB 3PSIA 1K1ZA 1M30A 2XAHA 1ZQ1A 2CDTA 2WY7Q 3DTIA 4KUMA 1RAGB 4AMCA 1S8NA 3GPLA 3QPTA 2V1XA 5GP9A 2X4YA 1H3HA 4NC6A 4OIQF 4LVJA 1C0AA 3GUDA 1D1BA 1HK9A 1KU7A 4WCIA 5LJ3j 2PQ8A 3SQNA 1AHDP 1HCRA 3OBWA 3SWNC 1K8AC 1NJ8A 3FXMA 4C92D 5GAOq 1GVDA 2HDWA 2P5VA 2M45A 3LSGA 5D4RA 1K9MC 4ON0A 3OR2C 2EW3A 2GQIA 2PVGB 2V9PA 5EJCA 3H1CA 3I9QA 3CDIA 5ILSA 2HXOA 2RJEA 1HQCA 1D0XA 1R49A 5K7FA 1ZSZC 2LY9A 3NHNA 5C6SA 5GMKm 1QO0D 4HXJA 3D5RC 3CJQB 2X0LA 2KRNA 2VKVA 3UA7A 5F08A 3ECHA 4XKWA 1WPYA 4P55A 3P9IA 2R7DA 4RAYA 1PUFA 4IOAF 3MN2A 4IHYA 2JM8A 3ULRB 2ARUA 5CIUA 2ODRD 3WE2A 3F70A 1L0OC 5JFRA 3S16J 3PUFA 3CXCP 2LNHB 1LPQA 2R5ZA 1AD5A 1WHMA 5GPAA 3H9NA 4DOVA 1N25A 4XQ3A 2E1MB 5TJJA 1F1BB 2H3EB 3JCMW 4EGZA 2Q7GA 2YS9A 3LL7A 5DM7F 1JO8A 1X1AA 4II2A 3KXTA 2LMJA 2UV1A 3GP8A 1QKXA 4HSRA 4QQ6A 1VQNI 1N27A 3OR1C 1HC8A 2GOMA 2E6ZA 1RIOH 3CCQQ 2VV5A 1Q1HA 5JVGF 2BYVE 4KFCA 1Z3XA 1ON1A 3PQKA 2V1QA 3FRNA 4C92B 4EX5A 2ZMEC 3G1OA 4TV7A 3JCMb 2J3MA 1VQ6I 3NMZC 1SVMA 2IP2A 1T8IA 2QBYA 2HDAA 1BI1A 1MNDA 2VJIA 5EEHA 3V4GA 3CCSI 3OYIA 3CD6I 2GBYA 3VS6A 1VQ7Q 2JVVA 3W2VA 2QA4I 1H641 1KD1U 3WTZA 3L4GB 5F5WA 1G6NA 4PJLA 2DT7B 5J6XA 5J1YA 2FA5A 3H9JA 3HOSA 4C2TA 4LNPA 1L3LA 4MEXF 5AT1B 1FEXA 9ATCB 3CCUA 2QA4Q 1ACMB 2O4XB 2DA5A 3K4JA 3OIOA 2WADA 2HXIA 3UGQA 1YFRA 2L4MA 1TP4A 3H92A 3AKZA 2A28A 1T3SA 4J9IA 3SHFA 2DMUA 5LHHA 4EGYA 5FO5A 4E7LA 1R0BG 2O9VA 4F93B 2OX7A 5GANh 2EPDA 2P84A 5LJ3f 4A3CJ 2DXUA 4J9GA 1NLOC 3AHUA 4BY6C 3VODA 2OTJI 4TVAA 4TQDA 4PJOG 4IF4A 3QKJA 1KYWA 1A31A 3UWNA 2DL8A 1K8AU 1XX5A 2R7XA 2P8TA 1KMNA 2JUCA 4KMUX 3W3CA 4ENMA 1BR2A 1B72A 2CT3A 4N4IA 1YFSA 4EMKA 5GAEJ 2IS1A 2RJCA 2ZNJA 3HOTA 1X56A 3UKGA 1N8RR 2DYSH 4AWXB 2RHXA 3RERA 2Z33A 3HXWA 1O7LA 2UXXA 1V55H 2BKDN 2BTTA 4JJCA 2LSOA 3BTIA 3W2AA 2R7QA 3E5XA 3HHGA 3WVDB 2GXAA 2LQWA 2DA1A 2DDAA 3NWTA 1BW6A 1Z05A 2XDVA 4Y17A 4AUXA 2YLBA 4Z88A 3B02A 2CZ1B 1YI2T 1ZKGA 2E1HA 4BQQA 3EUAA 4L6V5 3UATA 3VS3A 3L2RA 1VQ9I 4M9XA 3W3SA 1WH5A 3OSFA 1Q81U 3IHUA 4IX7A 4XTVA 2L7ZA 2D1VA 1VQLI 4B09A 2KGTA 4C92F 3QSUA 1QE0A 4LVIA 1ZLJA 1W5SA 3HKZN 2F4OB 5FJ8J 3MKZA 2BZYA 1IDZA 2VE9A 3QDFA 3KP4A 1SMTA 2QM3A 3NAUA 1U8RA 5DCMB 2QHTA 1OZ3A 2YWWA 1M1KU 1NEBA 3OY9A 4G8XA 3GIBA 5DEQA 5TISC 1BW5A 2O8KA 3OYCA 4C5EA 3H36A 2L3QA 1M1GA 3VFZA 4EJOA 2ISZA 3CCMI 4CA0A 5D7UA 1QPIA 3K70C 3CJRB 5GAN3 2XF6A 2JJ9A 4ZNXA 1FC3A 1H3ZA 3OWTA 4G6DA 2WAQN 4BBRJ 5DS9A 1APLC 1LEBA 2NOJB 3VSKA 1MV0B 4C8QE 5JI6A 1NJIC 3I55A 2EKHA 3E0JB 2PJRA 1E17A 2LP5A 5I2MA 2RAEA 3V7CA 1EVLA 3DKYA 1Y1WJ 2DTZA 1IUFA 4WF2A 2NLUA 3G6EQ 2XDBA 3HGGA 3I56I 3HOXJ 3CMET 1ZREA 4M75G 2ZJPF 4J00A 2B63J 4IQJA 2LLKA 1JKRC 2LCLA 1WQ2A 2JVGA 3CC7I 1V5GA 3DKXA 2TRTA 2F48A 5J1RA 3S15J 4G9YA 5FD5A 1PYSA 4P74A 1YIJA 3JCMQ 2M0CA 1VQNT 1SG5A 1G5IA 2DJNA 3OL3A 2R57A 2VOOA 3VJPA 3KX2A 1A36A 1ZGAA 2X4HA 5IP7J 4JPBW 3DBHB 4E7ZA 4C8QG 1M90C 3S32A 3HFZB 2HOTA 4BYYA 3ABKH 2X6OA 1H8KA 2M34A 3M4OJ 2A07F 2P7VB 1ZSGA 2J7IA 1D8KA 1R5HA 2I8DA 2XSDC 1RUWA 3GTQJ 1VIFA 1VQ8A 4CI0C 3U9GA 1OQKA 4M7DD 2X1EA 4CCMA 1RR7A 2ZSHB 2Y0SN 3DPLC 2EJ9A 4E7JA 3M8FA 1B4AA 3CCJT 1IB8A 3GZ6A 5LRSA 2DN0A 1WJEA 3K4NA 2B9SA 2I4NA 3O3KA 2AQFA 4CC7A 3TEEA 4HVUA 4KH1B 5GAOl 3HRKA 1LB2A 2PU9B 3LQQA 3MKYB 1LE8B 2LRQA 3KEYA 3GTLJ 1X27A 1O3SA 4XU2A 3E9HA 1YJWQ 1YB3A 3ZGKA 1D09B 3A1PA 1GCPA 2B86A 4XORA 3PQJA </