3RKXA

Structural characterisation of staphylococcus aureus biotin protein ligase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
308
Chain Sequence
KYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Structural characterisation of staphylococcus aureus biotin protein ligase
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 99
structure length 308
sequence length 321
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rkxA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3rkxA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rkxA02
4JK1X 3QHSA 4YRTA 4J6WA 2DK8A 1LVAA 3FM3A 3A32A 1XGNA 3Q5FA 5LJ3d 1R5HA 1E1OA 2K7LA 1LNWA 4ESBA 4OP0A 1FC3A 1B9NA 1RNLA 1SMYF 5EEHA 2MBFA 5D5XB 3DXJF 2Y48A 5ED4A 2OD5A 5D5UB 4RGUA 2PBIA 3W3SA 5DUIA 2E5AA 3BP8A 2PMEA 4KMFA 4YRRA 2VT2A 2UZKA 3ZMDA 3VOEA 3TUPA 1MGTA 3HRUA 1XGSA 4HBLA 4RCBA 3JCMf 4A54A 4M77D 4U0WA 3L1AA 3TKYA 2H94A 1DPUA 1MGQA 2W85A 5LRSA 4R79A 3JCMe 4ZYHA 2ZZGA 3VB2A 2MH2A 4L0ZB 2M1BA 1X54A 2RGVA 1ADYA 1FYFA 1KYZA 1VTNC 1IXCA 3ECOA 4CH4A 1W4MA 1HSJA 2EFQA 1YO5C 1XSXA 2DBBA 4HT8A 5DCMB 4ZZDA 5DUKA 2RN7A 4M73A 2FSWA 3CLOA 4YDQA 1W5TA 1D3YA 2ODRC 4BXUA 2P7CB 3I7FA 4JBAA 5KNNA 1OPCA 4L18B 2IP2A 1JJCA 1YFTA 4DNCA 1PP8F 4IXAA 3ZN1A 1WQWA 1S7OA 1BBUA 4XTUA 2E65A 1JRIA 1EH8A 5GAOp 3QO3A 1IXRC 3RACA 2PG4A 4CH6A 4XRFA 1G5IA 3LFKA 4UVBA 3L09A 5ICGA 2QLZA 4H2XA 3RI4A 4A12A 1U5TA 1N9RA 4FX0A 1HKTA 4M6YA 5K1XA 4FX4A 4KUMA 5ICFA 3E3VA 1USYC 4RGXA 3REOA 2JRTA 3SHFA 1XGOA 4MEXF 1C0AA 2XGXA 2E1HA 4IF4A 3SZTA 3HFZB 4PGHA 2E3CA 3N4MA 2O6GE 3V8KA 3AHUA 1R22A 3PFIA 3ZMTA 1IF1A 3E5XA 1IN6A 5E18F 3I54A 5GMKi 5GANf 2ZCWA 2FRHA 4M7AE 1I1GA 4J5YA 5LGTA 1FYKA 2ODRD 3D5LA 2UWMA 4TQFA 2KIMA 1R58A 3P9CA 3JCMX 1EOVA 3LAJA 5HLIA 2GAUA 3F21A 3F8NA 3IKMB 5D4SA 2FMLA 4H0EA 1IZ1A 2OQRA 3HOSA 4HWRA 1SD4A 2YHTA 4NOYA 3K1MA 3KLNA 3KP6A 4M7DB 1CF7A 5LHHA 5C53B 2H09A 3CUOA 4KMUX 5GAN4 3G73A 5LHGA 1B6AA 1FWZA 1TNSA 3A7AA 2I4MA 1PP7U 4TTVA 1KMMA 1ON2A 4YRQA 3IRRA 2KKOA 4O5VA 2O61A 2FBHA 3FIFA 1GGMA 1MKMA 4ENJA 5KVRA 5CVUA 4KR2A 4N0BA 3JTGA 5H6QA 3DP7A 2QENA 2RM4A 2H6CA 3KP4A 3ZMUA 2L3DA 4M77E 3DSQA 4AD9A 1YS7A 4RGRA 5ERIA 3TOAA 3FXQA 2RD1A 3I71A 4AIKA 1A04A 2XAQA 2MLGA 4H2UA 1BIAA 2VN2A 2YLBA 4KN4X 4U7BA 5D6FA 5GMKm 1TQIA 4HF1A 4PNOA 2ARUA 4M7AB 1BOAA 2GA2A 1ZH5A 3BZ6A 4LK1F 2XHKA 1YGBA 4CH3A 1W5SA 1WI9A 1Q1HA 3QO8A 4PJOF 4LLNA 4P71C 3AAFA 1QBJA 1G3SA 3EETA 3EFRA 4L9TA 2CFXA 3F72A 4R8HA 2YR2A 3GLXA 5K5QA 2HYGD 4ZZLA 1SAXA 4ESFA 3A74A 4CO8A 1MJAA 4KQEA 3WE3A 3MAJA 3A7UA 3HIFA 3JB9I 1YG2A 5DY9A 2CYYA 3HXXA 4YRFA 5DEQA 1LQ1A 3HFVA 3UFGA 2DXTA 1BJAA 2IW5A 3EYYA 1ZLJA 3JCMb 1IXSB 5BS6A 1F5TA 2ZGWA 4HF2A 1XCBA 3GWZA 2W25A 4NL3A 1T98A 3MWMA 3FHZA 3RKWA 4P72A 1H4SA 2C6YA 1XD7A 5C52B 4M77B 2GWRA 3U2RA 3BJUA 2FBKA 1Z7UA 1KQ2A 1OYIA 4P75A 1HSTA 2DLLA 3QU6A 1D3BB 1GHCA 2AKWB 5HOOA 2QQ9A 2DK5A 4CS4A 3J81K 2EJRA 2ESHA 2FE3A 1UHMA 1LYLA 2YU3A 4PDKA 4XSXF 4U88A 1Z1DA 1WQ2A 3ABUA 3F8CA 4EQQA 1MZBA 2QQAA 4EJOA 1H9GA 3BPVA 2DQ3A 3R07A 1NJ1A 2M87A 5FLXK 4KIFA 2A07F 4JLIA 4LK0F 2BBYA 5DV5A 3M4PA 1I4K1 4KFCA 3REXA 3V7RA 4O6JA 5GAMf 4BHPA 1W7PD 2DEQA 5LJ5f 1KQ8A 4RQEA 1R5GA 5CJ9A 3REUA 2EJGA 4IRHA 1ZRCA 1EH7A 2RQPA 5GAMe 4UP7A 1U6GA 4LGWA 2IY5A 5LJ5e 3QNEA 4XLNF 2D1VA 5ILUA 1FBUA 2LF7A 5ICCA 3SWNA 3PQKA 3KLOA 4Q15A 3W6JB 4HX8A 4I0BA 4L87A 2JZYA 4K86A 1T0FA 4P73C 4KT5C 3FXRA 5JHUA 4MTEA 4CYDA 3R6SA 4MMKA 2P4WA 4UNOA 4XU0A 2XAJA 5JR3A 4MQ9F 2E7XA 1OYYA 4G9YA 4YRPA 1ASYA 4HDVA 5E1XA 4C8QD 1XGMA 1NHAA 1P4AA 2HTJA 2XKOA 1X56A 1IN4A 5I21A 3WGGA 3L4GB 1ULYA 4HA8A 3T5XA 3TO9A 4AVPA 4EJTA 3DEUA 4M78A 1MDMA 2ZJ2A 2LSOA 4AH6A 5J8CA 5LJ3h 1ZARA 1FSHA 2GZWA 1HC7A 4EO4A 2J3LA 3RPUA 2VODA 4M78D 4WWCA 4YFNF 3KEOA 1ZGAA 1ZYRF 3O6BB 1EFWA 1RUNA 3EYIA 4ESJA 4M7DC 3M8EA 3FF5A 4PJOD 2ARTA 4AIHA 4IPAA 2CIMA 2ZCEA 4WXHA 1ZN2A 1LEAA 2RNJA 3E97A 3CO7C 1KQ9A 2VBZA 4EV0A 3KETA 4BW9A 1JHHA 3WTWC 4YCVA 4YRGA 3GW2A 4A0ZA 5HDNA 3R0JA 2QQBA 5GAN7 4QVCA 4I01A 2V9VA 4C92D 3DFGA 3C1DA 4HT9A 3LSQA 1XDSA 3WE2A 1B1BA 1TTYA 2P7VB 3LA7A 4A5NA 2Q5IA 4LD5A 2RHQA 2W57A 4A6EA 3HXUA 4YP0A 2PMHA 4ETSA 2ALYA 3HRTA 3C3WA 1NJ6A 3I59B 1H9TA 1ZREA 1S29A 2XKPA 4BHCA 1R7JA 1H4QA 3A31A 4JUVA 1BI2A 2A6HF 1HKQA 2ZMEA 2FNAA 3VBBA 4M78G 4KIGA 4TVAB 5ELOA 2MLKA 4P9FA 1YW8A 4ENMA 1B34A 2EA2A 4M75A 3JCMJ 1SRYA 4CS3A 1D8KA 2WTEA 3B02A 2Q7GA 4EMSA 2P5KA 1R23A 2CQKA 2IRFG 4YRSA 4MGRA 5EEGA 2E1NA 1O3SA 4M75D 4IRIA 2VC8A 4YFKF 3U9GA 5BQTA 1SERA 3QO7A 1C0WA 2NRAC 5HS8A 3I0TA 4XTXA 1HQCA 2PI0A 2FYKA 2FQ3A 3F6OA 1SD6A 1Z05A 3J80K 1YQAA 1REPC 3GF2A 3PQJA 1ZHFA 3E6BA 4WX9A 4M77C 2XROA 1J5YA 2ZO4A 1HBXG 3VEPA 2DQRA 3ERED 2WV0A 1DUXC 1FZPB 3HHHA 3I64A 1X55A 1B7YA 2QZ8A 3KFUA 5J8FA 5D4RA 1XSDA 4HVCA 1R00A 4RB2C 1LDKB 5D8LB 4NHJA 3LA2A 2DDZA 2F2EA 1E22A 4ZIBA 4PG3A 3CJNA 1MD0A 2ZFWA 3VQWA 1EIYB 1T39A 3T1BA 3R4KA 1FYMA 1USTA 4A0XA 4MHGA 3JCMV 3WU1B 1NJ8A 3LQRA 4YRIA 3DPLC 1FT9A 1OKRA 2NAZA 4YRJA 1P4XA 4Q5SF 4M71A 4TV7A 1BM9A 2R7DA 4CICA 4M75G 3FJPA 3WGIA 4WXCA 5GAN6 1JE8A 1H4TA 4UVAA 4XTYA 1IAWA 4HW0A 1FLIA 5E3IA 2QBYA 1BC7C 1N9WA 3L9FA 1WQ7A 1O3RA 3K9TA 2QHVA 3RL6A 1NYRA 3GXOA 1W7PB 2M30A 2P5VA 3BW1A 4PJOE 2Z9OA 4LG0A 1EVLA 4YRLA 3RJPA 2IPQX 5K1YA 1YB3A 3WTTC 2E41A 1LOJA 4L9VA 3R61A 5F1RA 1QE0A 3LA3A 5LEKA 4LFUA 3V7CA 2HS5A 5GAN5 3SWNB 1LJOA 3JCMh 1H4VB 4J15A 1OMIA 3GFLA 1JGSA 3CUQA 2V79A 4XU2A 1KYWA 1V4RA 3RKXA 2FF4A 4MMLA 4K88A 4C8QB 1RUOA 3FB9A 1FPQA 4HQEA 2YSRA 1BBWA 1R36A 4BH9A 1K78B 2EV0A 5LHIA 3ZQ7A 3UH0A 5HS9A 3WTYC 1KU3A 3I4PA 2R3SA 1YCYA 1BI1A 3SXYA 3TEHA 2VOOA 1ONVA 4RB0A 4M78B 5FFXA 4L9NA 3FM5A 2EJ9A 4M6XA 1BC8C 4XU1A 4EMKA 4GCVA 4M7DE 4M9SA 1B59A 4PJOB 1Y96B 1FP2A 5D8KB 5GAOl 1P92A 3HTUA 4RGSA 4RMFA 2AMCA 1Z9CA 3QU3A 2R7FA 3JB9J 2O3FA 2ZT8A 2EB7A 4JRKA 5E1ZB 3JB9H 2H6BA 1IW7F 5ICEA 3ML6A 4XTZA 4P3NA 1KOGA 2EFWA 4MTDA 4ZYDA 4C92B 3TO6A 4HV5A 5GAN3 4IHSA 4WCGA 3EUHA 2ZNJA 1AOYA 1QNTA 2PQ8A 4TQDA 4TVYA 3RGLA 1FBQA 2ZT5A 5LJ3g 2KIFA 2XUBA 1F9NA 1TQMA 2OZ6A 4EM0B 1QZZA 4EJVA 4XTVA 1Z7NA 1ZAOA 3TEGA 2J3MA 4A6DA 2Z5UA 2ALYB 5GAN8 2P0LA 1KQ1A 2OZUA 4OIOF 4XTWA 2AXLA 4Y91A 4Q48A 3RESA 4E70A 3LC0A 4PGGA 3JB9G 1WNLA 5GAOm 4UV8A 2ZNZA 5TRDA 2XAFA 4H2TA 1O7LA 2CGPA 2RKHA 1B70A 3IALA 1HW5A 5GANh 4YCUA 1HXDA 3L7WA 3GZ6A 1XN7A 3JCMW 2DW4A 3BJ6A 2RHSB 3E9HA 4J6XA 4Q4ZF 4NQWA 2K02A 3ZMVA 2VE8A 3V7SA 5BMZA 2EJFA 1FSEA 5CLSA 4LLLA 2IA0A 4BAYA 3GVAA 3ECHA 1PYSA 5GAOq 1YW9A 4RB1A 2A61A 1TBXA 2CW0F 2ARSA 2FOKA 3IL2A 5BPIA 2K86A 4HQMA 1UFMA 1D8JA 2GXBA 2Q5HA 4YREA 4C8QF 2O0YA 3TO7A 4AWXB 3VQVA 4XSZF 4F7UA 3B73A 3JCMd 4P3PA 5GANj 2V6CA 1J7KA 2M8EA 4P72C 4I2OA 3TQNA 2Y0MA 3SB2A 2ZNIA 4EVIA 5J6XA 1Z7MA 4BHBA 1E1TA 3HXZA 4P75C 4YRNA 4M78F 3PCOB 3RYPA 4DPGA 1SFXA 1T38A 2RDPA 1B76A 3V4GA 3M8FA 2HQRA 5CVVA 4OMYA 2FMYA 3E5QA 4BWAA 4P74A 1YIOA 4YFXF 2HTSA 4HWTA 1ON1A 2GXGA 3HTSB 5D5WB 4KN7X 3CDHA 4N0AC 3BWGA 1FBSA 3JAMK 2Q7HA 2LKPA 5CVRA 1XMKA 2DI3A 2FNPA 2LDUA 4I09A 2K4BA 4C92F 2BYVE 2A68F 1I6XA 1GXQA 3F8FA 2K4JA 3P9KA 4A5MA 2NS0A 2K27A 3QPTA 2VBYA 1QQIA 4F7ZA 4YRCA 2QVOA 4G8XA 1V3FA 3K1PA 1I8FA 2F5FA 3J81Z 3G3ZA 2STWA 3IWFA 3LQQA 1ZG1A 3SWNC 1B8AA 3GEZA 5L3FA 1U1SA 2QM3A 2WWYA 3H3ZA 4ZH4F 5FLXZ 3P8YA 3T8RA 2P5IA 1ODDA 4F7UG 2XAHA 3F8BA 2L02A 1KGSA 2ADUA 2CGHA 4C8QC 4GGGA 4FT8A 3E6DA 2Q8KA 3WTVC 2G7UA 2VXEA 2UXNA 3IHUA 1IL2A 3JCMP 1YFRA 2XIGA 3HSRA 1NJ2A 2OAZA 1X2HA 1SMTA 3O3KA 3CMQA 3I53A 4M75F 1G3YA 4UVCA 5DD4A 4M78C 4RDXA 3RF1A 5K1PA 3R0AA 3R60A 2D45A 3NRVA 5GANd 2EV5A 2JTVA 3MEXA 1LDJA 4P71A 4PJOC 1SD5A 1O3TA 3BJAA 5LGUA 1KU7A 4H02A 2A69F 5CVJA 4QWQA 2ZTGA 4H2YA 3Q9VA 2L54A 2JSCA 2VXFA 4TVWA 3QO5A 3JSOA 4OOIA 1JJCB 3NETA 4MNUA 5IT9K 5GAMh 3ZN0A 3K1NA 5H6RA 2E10A 3COAC 5LJ5h 2DU7A 3HY1A 4C92C 2VXZA 1MJBA 2DQ0A 1N9SA 2DTIA 4H2XB 2YPRA 3JCMg 4EMGA 1U5TB 5DDGA 5GMKh 2ZT6A 1HKSA 1J9IA 1BI0A 3KZYA 1M5Q1 2O03A 5F64A 4UV9A 1UHWA 1OR7A 1T2KA 3KE2A 4U0VA 2JPCA 4WI1A 5DD8A 1SFEA 4HWOA 5DCMA 4DQ2A 5GAMj 3DKWA 5E1WA 1X2GA 4CZZA 5LJ5j 1FY7A 4P9UA 2DPUA 5K5OA 1RIOH 4Q6GA 4IVNA 1P6RA 1R1VA 2HKOA 4P5OA 2Z99A 5GMKj 2G9WA 4UP8A 2JT1A 1WLEA 1KA8A 3BFMA 5LJ3e 3ZMZA 4M75C 5L3BA 3MF1A 2YX7A 2WC2A 3RTRA 1HK9A 4RCCA 3HOTA 1X3UA 1HW1A 4Z2YA 4YIFA 4Y13A 1STZA 3K0LA 1I81A 3KP3A 4OINF 4CDGA 4L5JA 3ZMSA 5BPDA 2HGCA 2F5DA 4K87A 1TQPA 1HTTA 2C8MA 4KA4A 5E17F 3IG2A 2L01A 4B8XA 5FFZA 5AONA 1XCVA 1IN5A 2ZZEA 1CF7B 4X5OA 3WTXC 2EFOA 3HFZA 3V8LA 3OOPA 2ISZA 1ATIA 3OV8A 1QO0D 3A7RA 3E5UA 2ZR2A 2DVEA 4CGZA 4H2SA 2L4MA 2VBWA 4LLGF 4KIBA 3VQYA 3JCMQ 2QHSA 3HSBA 2I2LA 2M45A 2M5WA 2ACJA 4YCWA 1BI3A 4YRMA 4GYIA 2ZT7A 1G4DA 4FHTA 3WQZA 3TDUC 3LSSA 2HWVA 5HGQA 1F4KA 2CWEA 3RKYA 5C51B 3ROUA 4KNYA 2DZ9A 3INZA 1YYVA 4HF0A 5ILVA 4ZTZB 2MC3A 3HRKA 2QWWA 2DKGA 3J80Z 5GANg 3FMRA 4HX4A 3LWFA 2ZXJA 4BQAA 1RZ4A 4UHTA 2KJCA 4N9HA 3NQOA 2DTOA 4GYGA 1FOKA 2NNNA 4ZYGA 4M7DA 4BNCA 2IJLA 3I5UA 1Y0UA 1CGPA 3KP2A 5JVTA 1WYDA 3H92A 2EFPA 5GAMd 2QUFA 4B09A 5HLGA 1EQRA 3PZCA 2F5CA 2COMA 5LJ5d 3UGQA 1UCRA 2HOEA 4PHCA 3GFJA 2NYXA 4L5IA 2V1XA 2Z33A 1G3WA 5GAOr 3P8VA 5E8IA 1WSUA 1YFHA 3GO5A 5FB2A 4NL2A 3GIBA 5L3CA 3HFNA 3F8MA 5D5VB 2LNBA 2FU4A 1XDUA 3L00A 3WG9A 2DU9A 3FMSA 3ULQB 4XQ3A 1SD7A 1R1TA 3BDUA 1DP7P 4X9DA 1K6OA 3HXYA 1AWCA 1PUEE 4C8QE 4ENKA 1G5HA 3P9IA 4M7AA 5AIQA 3IKLA 3CUQC 4ZTUB 3KFWX 3GYHX 5H20A 4RAYA 2FB7A 3WTZA 3RDIA 4EGZA 4M7AD 3NEUA 3HYIA 1S7AA 2VE9A 2XRNA 3LSTA 1WKMA 2XAGA 2VBXA 4M78E 2FA5A 4PCQA 4G6DA 4JQFA 1K79A 1JBMA 3ZP5A 2EV6A 5CYVA 3KCCA 4M7DG 2E64A 3BY7A 1E24A 2C7IA 4EMKC 4OU0A 1UB9A 1U5TC 2VOPA 3F22A 5FO5A 1BN5A 4XU3A 2EWNA 2DTHA 4ENNA 4LMYA 4R1HA 2QHTA 2IY5B 1O57A 2E1CA 2HFHA 4F7UF 4M77A 1TLHB 4C92E 4A2UA 3ERRA 1J75A 2IA1A 2ISYA 2MA3A 2Y75A 1D3BA 3MCZA 1WU7A 2AKWA 3KP7A 4K2EA 2ZKZA 1ZLKA 2ZINA 2QTXA 3BROA 4EJWA 2PMUA 3EDPA 2EL9A 1P2FA 2DO7A 2VT3A 2EK5A 2UXXA 4WJ4A 1JHFA 4P96A 3JSPA 3QTCA 4I0AA 4G84A 4M7AG 3N97A 3IKTA 2JN0A 4TWAA 4Y17A 1LNXA 2XTIA 4U7DA 2K57A 5FD6A 1EH6A 3JB9D 2ZIOA 1H641 2ZBKA 2OU2A 1MDMB 3QOPA 2GIVA 1QZYA 1QGPA 4KDPA 1NNHA 3DV8A 1ZG5A 3ICAA 5GAMg 1S3JA 1RI7A 3NELA 3QRFF 1J59A 1O3QA 3DPTA 5LJ5g 3BY6A 4M75E 3M7GA 3A5YA 2KJBA 4OIPF 4G6QA 2QYOA 3EFSA 1YLFA 1ZRDA 3GFMA 1SFUA 4O2DA 3T8TA 3BJOA 2DT5A 4HLXA 2P6TA 2F5EA 3HSEA 4WJ3M 3KP5A 2ELHA 3JW4A 3FXUA 2HR3A 1ZGJA 1NYQA 1Z6RA 1IUYA 2TDXA 4M77G 2Z3YA 3EQLF 4G85A 4YRKA 4M9XA 2ZIMA 4HOBA 2MH9A 3L4GA 5ILSA 4AIJA 2RHQB 1E17A 3M9AA 2VONA 3WTUC 3WGHA 2PFBA 2BV6A 4LNSA 2ZZFA 2ETHA 3HFOA 5F5WA 4GXOA 4L9JA 4Q47A 5GAOn 5E20A 2OBPA 2ZR3A 1JXSA 1ZG3A 4XLPF 4EM2A 5JFRA 1KU9A 2ESNA 2YLCA 1RIQA 4P74C 2ZMEB 4YG2F 3KZZA 2PLYA 3RPQA 2QHUA 3C7JA 4HX7A 2CJAA 3HXVA 5ELNA 4EJUA 1B34B 1H0MA 4M75B 4HLYA 5GANe 2IA2A 5HDGA 3C18A 5LRRA 1O7FA 4G7HF 5GMKl 2XVCA 2MD5A 1TNTA 3QP5A 1XMAA 1EV7A 5TJJA 3UGTA 3WTSC 11ASA 3HRSA 1USYA 3SZPA 4LB5A 1FYLA 4NB5A 4XEOA 3IWZA 5L3EA 3F3XA 3L2CA 4NCXA 2HQNA 4OMZA 3I59A 2AS5F 3BPXA 1FX7A 4MQVA 2RVCA 5LBQA 3HRIA 1MJ9A 4I98B 3CO6C 4P55A 4HZFA 1ASZA 4WXDA 2G4CA 1I27A 4WK8F 1KQ0A 1GVJA 5HLHA 2STTA 2YX4A 3HRMA 1U78A 3FZVA 3JAMZ 1B7YB 4A0YA 5HDKA 3J7AO 4TVAA 4HWPA 2HYFA 5AIPA 1B4AA 5DYMA 2P8TA 2Y90A 2HZTA 5D6EA 4HDUA 3H3UA 4RQFA 2DPDA 3RYRA 4RAZA 1LJ9A 3NEMA 4D0PA 1J5WA 4CHUA 1LB2A 4QLCU 2X0LA 1IN7A 3FMQA 2A5YB 4S04A 3GX4X 2GQQA 2FEZA 4KICA 3VQXA 1ZRFA 3G1ZA 4YPFA 3RUXA 5KK1A 1D5VA 4O3MA 5JI6A 2X4HA 3TGNA 1Z91A 3K2ZA 5BOXA 2VC0A 2QBYB 3F23A 4V2SA 1G51A 12ASA 4EGYA 3JTHA 1VQZA 3HTZA 1SETA 2H27A 1U8RA 4LG0B 2I4OA 3SQNA 5DCFA 1B9MA 2KRFA 3I58A 3BDDA 3E6CC 4HWSA 4IHTA 3OD1A 1IRFA 2XGTA 1WWXA 1EIYA 1J2XA 4WF2A 3HUGA 3QAHA 2A6EF 2E7WA 2NNYA 5L3GA 4G7OF 1J0RA 1U1TA 1XSVA 1TH7A 2HKXA 4I7HA 3V8JA 4HYEA 4KYWA 3CUQB 5IT9Z 1QF6A 2ZXFA 2J5PA 3QPHA 1HW2A 1BIBA 3VODA 2A3SA 4BYYA 3E6MA 3MF2A 4M7DF 1PDNC 2DXUA 2CSOA 2I4LA 1YW7A 2RC4A 3S2WA 3QSUA 1DDNA 1W7PA 4RB3C 2HEOA 1YTYA 4M9ZA 4MEYF 1S6LA 4YROA 2IT0A 4N0AA 2DFIA 3TEHB 2KIUA 2EFNA 2CJBA 3GUDA 4OIQF 2Q2EA 2B0LA 1OYWA 3NENA 3F6VA 2EAYA 4EMKB 2OQGA 4CH5A 1DPRA 3BOQA 1BBYA 2BE5F 1QPMA 1P4WA 3ZPLA 2BEOA 2AMCB 4H2VA 4PZJA 1Z6TA 3U1DA 1XB4A 1L3LA 2W24A 5GMKe 3T0YA 4E51A 4EM1A 1IRGA 1W66A 4C8QA 4M7AF 2DAOA 3IC7A 4N9IA 4F7UE 1TW3A 4X9CA 3L2ZA 2P5LC 5LJ3f 1K78A 3WU0A 1M8VA 3RIRA 2PEXA 3HY0A 2W84A 2HNIA 3MZYA 4ASNA 1WPYA 4M74A 4YIIA 3QP6A 1E2XA 4P3OA 2G7HA 4UUVA 1S8NA 5LGNA 5LEJA 6PAXA 5GAN2 2D1HA 2P6SA 4LB6B 1X01A 4PJOA 1Y96A 2HDCA 2BGCA 3TOBA 3GFIA 4OIRF 3HHGA 2PMFA 4KR3A 4XEMA 2RB6A 1B70B 5HS7A 2DQLA 3ABTA 4U0YA 5K5RA 1I5ZA 2V1DA 4QVDA 4L0YB 2V1UA 1KU2A 1L0OC 4M72A 3HSFA 2PN6A 5LLQA 2OA4A 3O2PE 4XBFA 2L4AA 5IT3A 4M77F 4P73A 4RS8A 4C92A 3E9IA 2JPBA 1I5LA 2EA4A 1YS6A 3M4GA 2XV4S 5FGMA 2LF8A 1G3TA 4IRGA 1WRJA 1PYSB 3CTAA 5LJ3j 1U2WA 1GXPA 3GZ5A 4IJAA 3MFKA 3IRQA 4G7ZF 3MZHA 1YFSA 4UP9A 2Q0OA 3KEQA 4J6YA 2DJZA 4F7UB 4I02A 4C8QG 3JB9F 2ZNYA 3M4QA 4UPAA 1USSA 5CAIA 2CJ9A 3P7NA 1IN8A 3FX3A 4M7AC 4CS2A 3HXWA 3P8TA 3MQ0A 4S05A 2I4NA 3TDZC 1EVKA 1LDDA 5CVIA 2J5OA 4UXNA 2DU5A 2XASA 4A53A 4JRIA 1KMNA 4ON0A 1ADJA 2CO5A 2VC1A 3A5ZA 1K7AA 2FBIA 2RHSA 3LAPA 1SESA 4OLFA 2Q7EA 1L0WA 4Y15A 3DF8A 3K69A 5FD5A 3D0SA 3W6KB 4PJOG 4M7DD 1F1ZA 3JCMc 3PGGA 4H2WA 4CXFA 2GA1A 5HVQC 2D2WA 3ELKA 4ZYEA 3M1EA 4G94A 2CG4A 5F6FA 3SFZA 1LEBA 1I1SA 1T6SA 3ISPA 1TW2A 3VFZA 5A2QZ 3IKVA 2O8XA 5E8GA 4C92G 1U3EM 3VU3C 3QUIA 2DZCA 4HV6A 2IVMA 2FXAA 1FNNA 3MEYA 3RERA 3PCOA 4GO1A 4YYEA 3DQVC 2RV8A 2PJPA 3Q9SA 1FP1D 5A2QK 2RA2A 2DTRA 4EX5A 3WODF 1NJ5A 1G6NA 3FWEA 4LJZF 5L3DA 4EMHA 1R1UA 4HAMA
chains in the Genus database with same CATH superfamily
3HGYA 3LSRA 1RAAB 3PMTA 5F08A 1XGNA 3Q5FA 4AFQC 1N8RR 2L3PA 4NC7A 2B8AA 2MWOA 1EF4A 4C0DC 4J00A 1H3ZA 3FBNB 2W10A 2ECCA 3SFIA 5ED4A 3TQ7P 2PBIA 3C95A 3LSGA 2VT2A 5IY5H 3TUPA 3L1PA 4N4GA 1XGSA 4HBLA 5CK9A 3JCMf 3M4YA 3CCRQ 2IGMA 3L1AA 3TKYA 2H94A 5LRSA 3CF5F 3JCMe 2JJ9A 3OYEA 4ZYHA 5GP9A 1Q82R 3G7ZA 1A35A 1SHGA 3Q0VA 1Y0NA 3VUBA 1ADYA 3VS2A 5EGOB 3ECOA 2K9QA 2CYZB 2VL8A 2B7EA 5F0HA 1M3CA 2O4XA 1KJWA 1D09B 2RN7A 3CLOA 3J7AF 4ITVA 1W5TA 2ODRC 3CMEQ 3OL3A 4BXUA 1Y7XA 3NTKA 1Z0XA 2LC2A 4F91B 4KUDK 1YFTA 3FK6A 1VOMA 3K4KA 4DNCA 4IXAA 1WQWA 1S7OA 1BBUA 1I50J 1IXRC 4XRFA 1G5IA 5HKCA 2CH4W 4UVBA 2JN6A 2HOAA 3J7YJ 4F93B 4JRQA 1N9RA 3M54A 3A8HB 5K1XA 1U5SA 2AK5A 3BR0A 3SEMA 3WU2C 1AHDP 1WCMJ 3NHNA 4IIMA 1YJNA 1XGOA 4MEXF 2L2OA 2LQWA 2ENMA 2K3FA 2WSCE 1VQLQ 2DA7A 4HVWA 4ZYAA 2D5VA 1HDDC 4PK4A 1B3QA 2ZXWH 1R22A 1QVFP 3ZMTA 2X4JA 1A6IA 1KD1R 2L9RA 1NH3A 4M7AE 1I1GA 5CIUA 4J5YA 4TQFA 3P9CA 3LYIA 3LAJA 2NOJB 2GAUA 1R77A 1ZA1B 2FMLA 1WLPB 4BY6B 2OQRA 1SD4A 2YHTA 4NOYA 1I3QJ 4IZZA 1V55H 1QVFS 3KP6A 1ZX6A 4M7DB 2R5YA 3DPUA 5LHGA 1B6AA 1W0UA 3A7AA 5C4XJ 2MD0A 4FTHA 5J1YA 3G1OA 1KMMA 2KVQG 3S16J 4QKUA 3FBIB 1TUGB 1HD3A 1ABQA 2O61A 3FIFA 2XD0A 4AG1C 4ENJA 5KVRA 5FKNA 4KR2A 3CZ6A 2KZVA 2GTJA 3DP7A 2EKOA 2H6CA 1NK3P 1IDYA 2DMNA 4M77E 2A3LA 4X1VA 1X1BA 3TOAA 2RD1A 1A04A 3D5SC 1ARKA 1BIAA 1OZ3A 3BTIA 4H2UA 4E2FB 3ZQGA 4QPOA 1YI2T 4HF1A 4CH3A 1WI9A 1Q1HA 4P71C 3LSJA 2RH2A 2YUPA 3AAFA 3GTMJ 1E3PA 3PVLA 3EFRA 2E2JJ 5DM7R 4R8HA 2X1CA 4BQQA 4CO8A 3GBQA 3OSGA 1YRNB 2DXIA 3A7UA 3HIFA 1R4NB 1U9NA 4RUGA 3HXXA 1MUZA 1BJAA 2IW5A 2AQFA 1ZLJA 1IXSB 2ZGWA 3KYDB 1JJ8C 3ZQLA 1SG5A 5CO7A 4V2FA 2GWRA 4PKCC 1Z7UA 2ZJQF 1D3BB 4IUTA 1GHCA 5K7FA 2DK5A 1YJWI 1UHMA 4ZC3A 4PDKA 4FL6A 1WQ2A 3CJRB 4EQQA 2KT1A 2DA6A 5GAEJ 2DQ3A 3C94A 1NJ1A 3ZL7C 4KIFA 2BBYA 5DV5A 3PMIA 4OB3B 4KFCA 3A8GB 2L9VA 1H3HA 1Z67A 1W7PD 2WADA 5LJ5f 1W4SA 4UP7A 2IY5A 2M16A 5LJ5e 3QNEA 2D1VA 3H5NA 1V5FA 5ICCA 4Q15A 1SAUA 2LY1A 4L87A 2BZXA 3S3NA 2HKNA 1UG2A 4PJNA 2XGDA 1LCKA 2XB5A 3BR6A 4XU0A 3SYTA 4G9YA 4YRPA 1K8AU 1P4AA 3LX7A 4IHVA 3LOCA 3WGGA 4JPBW 1ULYA 4HA8A 3T5XA 1K9AA 1W6XA 4OB1B 3BT9A 2O88A 3DEUA 1MDMA 1X69A 1RAGB 4UUSB 3DLAA 4CZCA 2JA6J 2GXAA 3RPUA 4WWCA 1ZGAA 4C3HJ 1B8IB 3CBMA 1W1FA 4DIQA 3FF5A 4PJOD 1ZKGA 2ME0A 4IPAA 2CIMA 3CD6T 1WHUA 1LEAA 5M9OA 2RNJA 2ZSIB 2XB0X 2LBFA 2JS2A 4A3EJ 4LOCA 4CI0C 4QVCA 4I01A 3DFGA 3C1DA 4UC4A 4QTRA 2LC4A 2Q5IA 4A5NA 4LD5A 1LKXA 2W57A 3MN2A 1VQKA 4A6EA 1IDZA 4YP0A 3HGGA 2ALYA 3X28B 2VQGA 4BS9A 1H9TA 4BUGA 3H0FA 5FLVA 1SEUA 2ZMEA 2X51A 2MWPA 4JS4A 1MNMC 1ETWA 2EZIA 3E1SA 4KIGA 1YHQQ 1MW7A 2EA2A 2L3RA 4KRTA 1D8KA 2XK0A 2IRFG 3PFSA 1S72I 1O3SA 4IRIA 2L7ZA 5BQTA 2DRMA 3E0JB 3CCEI 3JR9A 5HS8A 4P1WA 3CC2I 4MLOA 4LDUA 2M3AA 2GF7A 3F6OA 1Z05A 3J80K 1AWOA 1UHCA 4FW2A 3PQJA 4RBOA 2X1DA 4WX9A 3IAS2 2MGQA 4M77C 2ZO4A 2EQKA 4C0FA 2A37A 1B7YA 3JRHA 2GTOA 1RAFB 4HVCA 1VA7A 5D8LB 1OU8A 2DDZA 3LA2A 2IS2A 4ZIBA 3IUOA 1MD0A 3CCJQ 1EIYB 3T1BA 1FYMA 4A0XA 4MHGA 3DPLC 1AZGB 1NM7A 1FT9A 3FXMA 3UDCA 1JE8A 2NVTJ 1PNJA 1YIJA 3EGDB 1N9WA 3MP1A 1M1GA 5F0CA 3K9TA 2QHVA 3RL6A 3GXOA 1W7PB 2M30A 2WACA 3BW1A 2F4OB 2Z9OA 3VYGA 2RHZA 2EQMA 2X6YA 1EVLA 2WSFE 4JJCA 2LQ8A 1YB3A 3WTTC 2E41A 1ZELA 2VIXA 1MHNA 1T3SA 4XIDA 3URGA 2V1RA 5J26A 2XG8D 3PUFA 3J80E 1I0CA 1JGSA 3I35A 3CUQA 1V4RA 3I4NJ 3BR3A 5EF6A 4K88A 3FB9A 2BIVA 1FPQA 2YSRA 2W00A 2EPFA 2ECZA 2RJEA 1RI9A 1BBWA 1RLPC 4BH9A 1K78B 3U23A 2EV0A 2M9UA 3UH0A 1O75A 1KU3A 1YCYA 1BI1A 3CC7A 3TEHA 1ONVA 3LW5E 5FFXA 5J47A 2HQXA 1OI1A 1VQ5T 1JJ2P 3KIOA 2XF6A 1B59A 4PJOB 1FP2A 1P92A 1Y07A 1PD1A 4RMFA 3G4SQ 2A08A 3JB9J 2O3FA 4B47A 2LNHB 3FDYA 2EFWA 1RL2A 4ZYDA 5GAN3 3F0CA 1JJ2S 1AOYA 1QNTA 2PQ8A 3M57A 3CMMA 1MNEA 4C5IA 5IP9J 4L5GA 2Y9YA 1YJ9I 5LJ3g 2KIFA 2OZ6A 5IXBA 1VQ9T 4EJVA 2F2XA 2PU9B 5C6SA 4Q5WA 1PWTA 1R49A 2J3MA 3JREA 1KQ1A 1TU0B 2K5FA 4H2TA 1Q95G 2CGPA 1A36A 3IALA 5GANh 1LVKA 2DJIA 3JCMW 5B3SH 1T0JA 1ZK8A 2DW4A 2RHSB 3ZMVA 4BD3A 2EJFA 4BAYA 2COWA 2QSHX 2FOKA 4XR6A 1UFMA 1D8JA 2O0YA 1GV5A 2NWMA 2QSFX 4AWXB 5GANj 3ZFJA 4P72C 2Y0MA 2ZNIA 4EVIA 1QMCA 4M3FA 4EDUA 4D6WA 3RYPA 3VS7A 4DPGA 1B76A 2HPMA 3CP2A 1Q81C 3CCLQ 4DBRA 4RLQA 3K70C 3E5QA 1GT0C 1KG1A 3CCMA 5KYWA 3BTLA 1ON1A 4IUVA 1VQ6I 1FBSA 2QA4A 2LKPA 2LDUA 4I09A 4LITA 2BUDA 4B44A 2VVKA 3F8FA 2K4JA 4YRCA 2QVOA 2L2PA 3K1PA 3J81Z 2DL7A 2STWA 3LQQA 5L3FA 2O9SA 3T9NA 3VSLA 4CC3A 2LX7A 1VQMA 3DLLA 3T8RA 1UEBA 1RAEB 4F7UG 4VUBA 2CGHA 2G7UA 3CCQA 2J6OA 3GBGA 5M5YJ 1X2HA 3CBPA 1SMTA 3O3KA 4UVCA 1X19A 4M78C 3QYGB 3RF1A 5KCMA 2EV5A 2DFFA 1LDJA 1SD5A 1O3TA 1RR8C 4RLFA 1SRMA 2RJCA 3QWYA 2JSCA 1UHSA 2VXFA 3QO5A 4TVWA 3REBB 4OOIA 3EG9B 2DL3A 5FKOA 4OAZA 2M0YA 3ZN0A 3COAC 3HY1A 1WHHA 2DQ0A 1VQNT 4H2XB 4HCBA 2ZT6A 3CC4A 1M1EB 5F64A 1UHWA 1OR7A 3KE2A 2NVYJ 2F69A 2X9DA 1OX8A 4Y7NJ 2EPDA 3MMYB 5E1WA 1YITI 5FW9A 2CP7A 5K5OA 1VQ8T 1RIOH 1ZBXA 4IVNA 2JTEA 4F17A 2Z99A 1O4XA 4UP8A 1OPKA 2OTJI 2JT1A 1WLEA 5CQGA 3ZMZA 4M75C 2KSSA 4S0HB 2R58A 2JA5J 1NEGA 4Y13A 1STZA 3KP3A 4OINF 1ABOA 2HGCA 2EIJH 1HTTA 2C8MA 1GBRA 5E17F 5AONA 2DOFA 3V8LA 1ATIA 3UA6A 2YUSA 3E19A 2L4MA 2VBWA 3GTPJ 4KIBA 2I2LA 2M45A 4YRMA 2ZT7A 3WQZA 2HWVA 3P5JA 2IBDA 3BTCA 3RKYA 5C51B 3ROUA 2ED0A 2DZ9A 3INZA 3DKXA 3P8DA 1YYVA 4CCOA 2VGNA 4ZTZB 5LD2C 4IKFA 3M07A 4HX4A 2ZXJA 1Q1VA 1QCFA 3BG3A 4FE7A 4UHTA 2KJCA 4Y28E 2W1OA 2NNNA 3JRFA 5JVTA 1K83J 3MO8A 2EFPA 5GAMd 2QEXA 1MH3A 4OGEA 9ANTA 3UGQA 2HOEA 4PHCA 3GFJA 2PQWA 2V1XA 3P8VA 4CH7A 2DA4A 3GIBA 1FMVA 2RQTA 2FU4A 3ZCOA 2Y9ZA 3WG9A 3HKZN 3C12A 3CMAA 2DU9A 1Z9ZA 4XQ3A 3BDUA 1DP7P 1ZSZA 9ATCB 2XSDC 4AIDA 1G5HA 4A3CJ 5AIQA 1MMNA 4XOPA 1M27C 4BL0B 3WTZA 5EC7A 3RDIA 4EGZA 3HYIA 3LSTA 1WKMA 2XAGA 4CYCA 2FA5A 1YNZA 2K79A 2RHUA 2QGUA 2EV6A 5A0GA 2VJJA 2E64A 2OCCH 2RQQA 1VQ7T 3BY7A 4EMKC 4XU3A 2EWNA 1WHGA 2MIOA 2C0OA 2E1CA 2HFHA 5EG0A 3OYJA 1T33A 2RMOA 2OI3A 1WU7A 3BC8A 4K2EA 5BNGA 1TC3C 2DOAA 1TWGJ 1VQ4Q 1VQOI 2EIMH 1BCMA 2RHIA 4EJWA 3NMZC 1P2FA 5DM6F 1IXDA 4A3IJ 1JHFA 4P96A 2DNUA 4M7AG 1T3LA 4TWAA 4PLIA 5ECAA 3CMEA 2OTLQ 1EH6A 3KBGA 3BLYA 2ZIOA 5IHNA 1BBZA 2GIVA 5H2FC 2CKKA 4KDPA 1QLYA 3ICAA 1WI3A 5GAMg 1S3JA 3NELA 4E7KA 3DPTA 2FRWA 1QCOA 3A5YA 2KJBA 2HAXA 2EVRA 8AT1B 4G6QA 1HJDA 3BJOA 2L5QA 4JJDA 3JW4A 3H9NA 2AZVA 1NYQA 1Z6RA 3HP9A 1WHMA 4M77G 2EYXA 1VQLA 2JS0A 3EQLF 1JTYA 4HOBA 1DJ7B 4XN3A 3M9AA 4KBMB 2PFBA 1IGUA 3OYFA 4LNSA 3ZQCA 2PUKB 5E3LA 2M4KA 4L9JA 5E20A 5IHIA 2OBPA 2DA2A 2DYSH 2ESNA 4P74C 4YG2F 1Z21A 1UDLA 1M1FA 3KZZA 2PLYA 2GQIA 2V8KA 5DTDA 4LE9A 3HPHA 5EG2A 4LDVA 4G7HF 5GMKl 1IV6A 2F6CA 3I55Q 3QP5A 1XMAA 2EGCA 2H8RA 1M90R 3WTSC 2X3XD 3LLRA 2A05A 3DWLE 3SZPA 4LB5A 1Y57A 4WTOB 4NB5A 3K4LA 3F3XA 5D6XA 4MQVA 2NLUA 3HRIA 1J09A 4I98B 3PNWC 4ABZA 1WH7A 4BE1A 2QXFA 2CU7A 1U78A 3HRMA 4A0YA 4YRVA 3C4SA 1SVLA 2ZFUA 2NVUB 1JTXA 4QLCU 2X0LA 2A6TA 3A1YA 1VQPT 3H8ZA 3CCRT 2FEZA 3IP4B 1ZRFA 2L3SA 2K3PA 1D5VA 1Z91A 4C0ZA 4HNTA 1YBYA 2YT6A 3W2WA 4A93J 4EGYA 4A4GA 2NUTA 1SETA 2H27A 4LG0B 4BJTA 3GLLA 4II2A 2HDAA 2KRFA 3I58A 1Y56A 2PTKA 3BDDA 2AQEA 2XPUA 3KZIC 1IRFA 2ID3A 1WWXA 1U3OA 1P9QC 4ZJZA 3TEDA 3HUGA 1XSVA 3F9KA 4HYEA 4RTTA 2DOEA 5IT9Z 1IGQA 3QPHA 1BIBA 3VODA 2R7VA 1B72B 3MF2A 3OYGA 2RC4A 3K2AA 1UZCA 3H41A 1YTYA 1S6LA 4YROA 2KIUA 2DFEA 3Q1JA 2R7SA 2Q2EA 1U0JA 3G71Q 2B0LA 1X1DA 1M1KU 1OYWA 3DU5A 3NENA 3F6VA 4BI4A 2EAYA 2Z0WA 3CPWS 2JZ2A 2DA3A 1RESA 2BE5F 4IEJA 3TMOA 4XQFA 3ZPLA 2AMCB 4PZJA 1Z6TA 1JGGA 2GNCA 1EA3A 2W24A 1IRGA 1W66A 4C8QA 4AVZA 2ZPBB 2D1XA 4BQOA 3GTQJ 1HLVA 3S2HJ 2P5LC 2ZMEC 4LXCA 3RIRA 3AT1B 4M74A 3FDRA 4A3DJ 1M2VA 4BGDA 3QG1A 4UUVA 3M9QA 2LKSA 1POGA 3M1CA 5LEJA 4D5CA 1IV8A 1V5EA 1KC8C 4BY6C 2BY1A 2BGCA 3GFIA 4OIRF 2G3RA 2PMFA 4XEMA 4BY7J 2DQLA 5K5RA 2LR8A 4L0YB 4KULA 1L0OC 1NLPC 4OAYA 4M72A 2OA4A 2L4AA 4NQWB 4RS8A 4C92A 3CJTB 1C0MA 3E9IA 1X2MA 2JPBA 3SDBA 3M4GA 2XV4S 5FGMA 2LF8A 1MV3A 3AKZA 1U2WA 4IJAA 3MFKA 2MI6A 4C2TA 4G7ZF 4NDLA 4QQGA 3KEQA 3M4OJ 4XKBA 1ACMB 4J6YA 4LNPA 2DYIA 4F7UB 5EDNA 2ZNYA 2DF6A 3SD4A 1WIEA 1YHQA 2M51A 2PJRA 1QW1A 3META 3A01A 3M3YJ 4LDWA 2DU5A 2XASA 3CCST 2VC1A 2EGEA 3H9JA 3A5ZA 2A7YA 2GFUA 2V8JA 4OLFA 3DF8A 4M6VA 1G2BA 1XG1A 3W6KB 2VPLA 4IIOA 2E36A 2CMPA 3LWHA 5KYYA 3ELKA 4ZYEA 3B6AA 5F6FA 2KGTA 1T6SA 2HI3A 3ISPA 5A2QZ 2HCKA 1MMAA 1TZLA 3X26B 3CCUQ 4HV6A 2IVMA 2JM8A 3RERA 5KAIC 5J1RA 2H8HA 2RV8A 1FP1D 3CCJA 3WODF 1TUDA 5B5EC 1OCRH 4JK1X 3QHSA 1LVAA 1IO6A 3FM3A 3A32A 2NVQJ 5B1BH 2OJ2A 3VYHB 1LNWA 2JTMA 4D1QA 4BU2A 2OAWA 1SMYF 5EEHA 4JX5A 3CF2A 3X2QH 5CKDA 2OD5A 2VI6A 5D5UB 2E5NA 5JLWA 3W3SA 4NBQA 2E5AA 2CRGA 3OYCA 1GLNA 4YRRA 4PFZA 4PL6A 2UZKA 1XC5A 1MGTA 3N05A 3HRUA 1CKAA 2EYQA 4M77D 1RR7A 2ZZDA 2O01E 1DPUA 2R4GA 3LMMA 3VB2A 1X6GA 2EQUA 1FYFA 1KYZA 1VTNC 1MBHA 2RI3A 2EFQA 1YO5C 3A98A 4MDWA 2DBBA 1VQ5I 1I6HJ 1MMGA 3OMGA 4HT8A 2K3YA 1VQKI 4M73A 1K61A 1PSFA 3AL0B 5KNNA 3QPSA 2K9SA 2DMPA 1JJCA 2KIQA 4X6AJ 2K3BA 3AG4H 5KH6A 1PP8F 1EH8A 1OOTA 3QO3A 5HK3A 3RACA 1Y0MA 4CH6A 1UG0A 3LFKA 3G4SA 1UG1A 3BQZA 4BI8B 1U5TA 3OOUA 3RQIA 3PNTA 2KLOA 4A3JJ 2DODA 3GMEA 3HL2A 4RM2A 5ICFA 5GADJ 2F5TX 1X1CA 3REOA 3FJ5A 1JKRC 2E1HA 4B4CA 5HCKA 1RAIB 3SZTA 3N4MA 1YJNQ 3CLQA 3A03A 3AHUA 3PFIA 4XRMA 1K73R 3E5XA 4DJAA 3HOVJ 1SVOA 2LP5A 2YUOA 1KIKA 5GANf 2ZCWA 2FRHA 1PSEA 2LJ3A 1OZ2A 3D5LA 4AG2C 3S32A 2KIMA 4Z02A 2DA5A 3DBRB 3F21A 3IKMB 5D4SA 4H0EA 3QOEA 4HWRA 2R0QC 3KLNA 5LHHA 2H09A 1W1WE 5GAN4 3G73A 4CCMA 1TNSA 4X34A 3MEUA 2PMZN 3PTAA 5L23A 4B6MA 2KKOA 2BW3B 1GGMA 2VKHA 3OMCA 4FU6A 1Q82U 1XS9A 2E5QA 2QENA 2RM4A 3S1QJ 3DSQA 4RGRA 5ERIA 3OYAA 5KYXA 3FXQA 4RMNA 3ESWB 3CCLA 1WJCA 5E79C 1MBEA 4KN4X 3EUAA 5GMKm 2LY2A 4M7AB 1BOAA 4AFSC 1OLTA 2ELJA 1PUFB 4AT1B 3BDLA 2LOOA 2YR2A 3GLXA 5CKBA 2JA7J 4E7LA 5C4JJ 1MJAA 2QGFB 4KQEA 2QKLB 1NG6A 4YRFA 3L2WA 5DEQA 1LQ1A 4JRPA 5GPAA 3EYYA 4N4IA 3CC7I 1BB9A 4OMLA 3JCMb 2HZYA 1XCBA 4B9WA 2KYBA 2W25A 1SSHA 2C6YA 1XD7A 4M77B 2FBKA 2EGAA 1KQ2A 2BTTA 1OYIA 4BXFA 4P75A 5IH2A 2MOXA 2AKWB 1WDXA 5HOOA 2QQ9A 3J81K 4L6V5 4KH1B 2ESHA 4BEHA 2EYYA 4U88A 1Z1DA 2QQAA 2JWTA 1BW5A 1X43A 3R07A 3K70D 2A07F 4JLIA 4LK0F 4HCKA 3H5AA 1E3OC 2E6ZA 1QKWA 3MQZA 1YJWT 1DGWY 2FO0A 2DEQA 2WA0A 1KQ8A 1R5GA 5CJ9A 1YN8A 1RC9A 1EH7A 1U6GA 3TREA 2EIFA 4KT6A 2LY9A 5E3OA 2LF7A 4I0BA 1UMQA 4K86A 4B43A 1WHJA 3FXRA 3IV5A 2EYWA 4ESRA 1GUUA 2P4WA 4UNOA 2R7ZJ 2R7OA 2HPIA 5E1XA 2XGEA 2HTJA 1IN4A 5I21A 3CCVA 2CQQA 2CSIA 1X1PA 4AH6A 5LJ3h 1HC7A 4EO4A 2J3LA 4M78D 4LIUA 2VODA 2JA2A 3G6EA 1AU7A 1K8AC 2AZSA 3O6BB 3VS6A 1RUNA 4ESJA 3J81E 3M8EA 3L42A 4AIHA 2ABLA 1WH5A 3E97A 1IGNA 4A4KA 4R56A 2A5WA 4NC8A 4BW9A 3GW2A 4GRIA 2AKLA 3NFCA 3HC7A 4IURA 3CCMI 2YXYA 5HDNA 3R0JA 2V9VA 2IPOB 3LSQA 2RHQA 2LTPA 1IB8A 1WHKA 3HXUA 3HOUJ 1NJ6A 1ZSZC 2JJ7A 4R55A 3OYDA 1YOVB 2GBYA 1R7JA 1H4QA 3A31A 2A6HF 1HKQA 3VBBA 4QVZA 1JXMA 1QQJA 3BZCA 1X3ZB 3R6NA 4TVAB 3TU4K 4ENMA 3JCMJ 1SRYA 4J9FA 1TT5B 4EMSA 4YRSA 4CRIA 5EEGA 2E1NA 4M75D 2QTVA 4C30A 4Z88A 4YFKF 1Y8QB 2V7FA 3FKIJ 1SERA 4ELYC 4XTXA 1HQCA 4XLFA 4ZNXA 3LL7A 3ASNH 1REPC 3GF2A 1ZHFA 1WJRA 1R8OB 3HM5A 2XROA 3VEPA 2WV0A 3CCET 3ZEHA 3I64A 2QZ8A 4DOZA 3KFUA 2YUNA 1XSDA 1R00A 1LDKB 4NHJA 4PG3A 3CJNA 4JJNK 1IRXA 4R0KA 4FSXA 1R5ID 2ZFWA 1MSEC 1T39A 2XGCA 3K10A 3CC4I 3S15J 1NJ8A 3LQRA 2X4YA 3DBLB 1OKRA 4OMFB 2NAZA 4YRJA 1P4XA 2W4SA 4TV7A 2R7DA 3WGIA 5DS9A 2H1KA 1FXXA 5GAN6 1IAWA 1FLIA 4ZGEB 2D0QB 1BC7C 2YS9A 2CUDA 4HRIA 1YIJQ 1SC7A 4XONA 2R5ZA 2UV1A 2IPQX 2L0AA 2QI2A 2PUOB 5KHDA 2RNGA 1QE0A 3Q0WA 3CP8A 1LJOA 1AWWA 1QA6A 1H4VB 1OMIA 3S2DJ 1X2KA 5JLXA 1VQ6Q 5L8RE 2X4WA 4MMLA 5KYUB 2H8WA 4HQEA 3VS3A 3R6OA 3H9GA 3SDZA 5LHIA 3WTYC 3QKJA 4M78B 2ME6A 4OMQA 3I56A 2Y0SA 4GCVA 2X6XA 4M7DE 3SJMA 5GAOl 4C9YA 4RGSA 3LSKA 2JVHA 1UFFA 2ZT8A 4JRKA 5E1ZB 1T8IA 3JB9H 5ICEA 2O8KA 3DLMA 5EYRA 3D1NI 4IHSA 2VGMA 4RAFA 4TQDA 3RGLA 1FBQA 1QVGP 1SPKA 4EM0B 4XTVA 1ZAOA 3TEGA 4GY5A 4A6DA 2NVXJ 5GAN8 1JB0E 4XTWA 2AXLA 3PVQA 3ZOBA 3RESA 4E70A 2DD4A 1YJ9T 2RQRA 2E19A 2XSJC 1ZQ1A 1B70A 4K11A 4YCUA 1HXDA 3GZ6A 1XN7A 2D0NA 1QVGS 2W48A 5F0FA 3OIQA 4J6XA 3I55A 4Q4ZF 2ELKA 2K02A 2P0WA 3V7SA 4PSWA 5CLSA 4LLLA 3GVAA 2HQHA 2E2HJ 4DW6A 4PFOA 2X3WD 4MZPA 1PYSA 4RB1A 1TBXA 2ARSA 2WAEA 3L2QA 5BPIA 2ZC2A 3HBLA 1YE9A 2F4IA 3TO7A 2R93J 4RTWA 4P3PA 2OTJQ 5KAFC 1NBEB 3TQNA 1FJLA 1E1TA 1VZ0A 1QP3A 4YRNA 4M78F 3PCOB 3PJRA 3GF5A 1SFXA 3NGPA 2RDPA 1VQPI 5J40A 3CCRI 3M8FA 4YFXF 2KRNA 4RG8A 1Q7YR 2HTSA 1JT0A 2GXGA 3HTSB 5D5WB 2DPPB 3CDHA 2Q7HA 2DI3A 1VQ4T 1ZR4A 4YELA 2K4BA 2BYVE 1GXQA 1NYGA 1N78A 1SSFA 4F7ZA 1QQIA 4G8XA 3CMEI 1V3FA 5FU6C 2QA4Q 1MMSA 1BW6A 1XNIA 3IWFA 3SWNC 2E1MC 1B8AA 3OW2A 3GEZA 2OTLT 1MMDA 2QM3A 2WWYA 3L2UA 4ZH4F 5FLXZ 1ODDA 1KGSA 4WCIA 4C8QC 4GGGA 4CUGA 4FT8A 3CDLA 3E6DA 2Q8KA 3TSWA 2UXNA 4X1EA 1VQMQ 4J19A 2CZ0B 2XIGA 1DGRM 3HOYJ 1Y39A 2DJQA 3CMQA 4M75F 4RDXA 4EIKA 5K1PA 3CCQQ 1VQLI 1XTDA 2DN0A 4DEXA 1X27A 2O4XB 3UWNA 3G71A 2E70A 4QWQA 4BJ6C 4H2YA 4MNUA 5IT9K 5GAMh 4JZ3A 2FVUA 2DU7A 5GAGJ 4C92C 2RQVA 4E7SA 4YIRX 2YPRA 1K9MU 2J6KA 5DDGA 1SFKA 2HQ5A 1J9IA 5CQXA 3H0DA 4UV9A 1TS9A 3J7AY 1SFEA 1GDTA 5DCMA 5GAMj 1ACIA 3H0IA 4Y92A 2R57A 4CZZA 2DPUA 2L3QA 4MZTA 4A3MJ 5B1AH 3F70A 3BFMA 3RPUD 1BR2A 3MF1A 2YX7A 2WC2A 3RTRA 1HK9A 4RCCA 3HOTA 1IHWA 3DB4A 1I81A 2KRHA 2B9SA 2RHXA 5BPDA 2F5DA 4K87A 1TQPA 1ETQA 3ZQIA 2D6FA 1WXBA 3LSMA 1IN5A 2OUMA 4X5OA 3HFZA 2FPFA 3OSSC 2ISZA 2R5YB 3WHCA 1YX5A 3A7RA 2ZR2A 3VUZA 4LLGF 3WXMB 3VQYA 2COZA 3CPWA 4ZN1A 2M5WA 4YCWA 4GYIA 3I3LA 5IT9E 1R0BG 3ASKA 3TDUC 1OISA 3LSSA 3CCSI 1F4KA 4U87A 1V1CA 1OFCX 4M3GA 4RTXA 4HF0A 4I76A 2P0KA 4HVVA 2MC3A 1HF0A 3LWFA 2RAEA 4JJBA 2BOLA 4XORA 5F04A 4C5GA 4E4HA 4ZYGA 1Y0UA 1M4ZA 4J7FA 2Z16A 1X75C 5HLGA 1EQRA 4B48A 2F5CA 3HPWA 2LNVA 2NYXA 1IUFA 2GQVA 2DT6A 6AT1B 3GO5A 3GTJJ 5L3CA 4F52A 1SHFA 1Y8RB 3F8MA 5CKHA 2FRYA 3FMSA 1SANA 3PSFA 3HPGA 1PUEE 3VDXA 1XJWB 2CW7A 4ENKA 3P9IA 3GYHX 3EGXA 2NS8A 5H20A 1A31A 2KMUA 2K2MA 3NEUA 1S7AA 2VE9A 2XRNA 3MHXA 1RAHB 2PZ1A 4PSXA 4LD6A 4G6DA 2CT4A 1K79A 1WX6A 3ZP5A 5CYVA 4IUQA 4BXXJ 1YI2Q 2F5VA 2C7IA 1AVZC 4A3BJ 4B9XA 2CT3A 2R5AA 2IGKA 1UB9A 1U5TC 5FO5A 3OIOA 2DTHA 1PKTA 4ZDPA 3SZGA 5IOZA 4CCNA 5FU7C 1ZR2A 2IY5B 2IAIA 2LFBA 2CREA 1J75A 4JYKA 3FC3A 3BCBA 2EIKH 4GFBA 2ZKZA 4KISA 1ZLKA 3SHWA 1JEGA 1LFUP 2QTXA 4CA0A 4IO9F 3ABMH 5IAYA 2KR3A 2EL9A 1LUJB 2DO7A 3RR6A 4WJ4A 1HDPA 1M30A 3JCUC 4RG2A 2ATCB 1G2HA 4I0AA 2CZ6B 1IZ6A 3KYCB 5F1JA 4Y17A 2EQIA 1VQOT 1MDMB 3QOPA 1QZYA 1W5CC 2FL7A 2R5MA 3DV8A 4W1UA 2CUJA 4KT0E 3QRFF 1J59A 1O3QA 3BY6A 4FCYA 5A2QE 5GAHJ 1YHQI 4OIPF 5K7HA 3M0TA 3EFSA 3OR1C 1YLFA 1D1CA 2COBA 4O2DA 1WJDA 2DT5A 2P6TA 3UF4A 3FXUA 2HR3A 2LBFB 1ZGJA 1IUYA 4M9XA 2ZIMA 3L4GA 5ILSA 1UGRB 1E17A 8ATCB 2VONA 3WTUC 2WB1A 4OB0B 4HT4A 2E6NA 2WAQA 4PLLA 3HFOA 4MZMA 2E2IJ 2FEIA 4D8DA 3AG3H 5JFRA 2ZMEB 2K4YA 3RPQA 3FLGA 2QHUA 2XAUA 3C7JA 4HX7A 3CCUT 3HXVA 5ELNA 1AEYA 2M0MA 3CCJI 4NS5A 2IA2A 5HDGA 2K2VA 5LRRA 1O7FA 3FXJA 3OS0A 2XVCA 2XRLA 2KE9A 3H0HA 2DO3A 2BY3A 3IAM2 4BJ5C 5FRMA 1FYLA 4XEOA 3I5RA 1FIAA 5L3EA 2VLAA 2R92J 3L2CA 4OMZA 2LJ0A 3I59A 4UB8C 1MNDA 1Z3XA 1NEBA 3CD6Q 3LFUA 4P55A 3KUFA 4WXDA 2G4CA 5KE2A 1I27A 1NPRA 1GVJA 2YX4A 4CSWA 3GTKJ 3FZVA 3JAMZ 1B7YB 2KBTA 3J7AO 5DYMA 2P8TA 1UAAA 3LGLA 2DTZA 2DYBA 3H3UA 4RQFA 2DPDA 1A6QA 4Z6YA 1J5WA 1IN7A 3FMQA 1SEMA 2XHCA 2E5KA 2GQQA 2JM9A 4YPFA 2MSYA 1KZHA 3EHRA 2HDWA 1Q86U 5JI6A 2X4HA 1ZHIA 3TGNA 1UGVA 3K2ZA 1UGSB 2VC0A 5M3MJ 3UATA 2RK1A 12ASA 5FRNA 1B7TA 1VQZA 3HTZA 1D0XA 2MW8A 3CPFA 2JW4A 1U8RA 4PFPA 2I4OA 2E3HA 1W2BA 3E6CC 3RDVA 1S72A 4XN0A 3W6VA 4IHTA 1FOYA 5FWBA 2XGTA 3G4SI 2X4XA 1J2XA 3QAHA 2KISA 5L3GA 5IN1A 3CC2A 5CCAA 4QQ6A 4LD9K 2IGOA 1U1TA 4I7HA 3V8JA 4KITB 5HODA 3EUKL 3CUQB 3EFOA 1QF6A 1HW2A 2A3SA 2KRMA 1KHIA 3AL0C 2DDAA 2M7BA 4AYBA 4D9JA 4FIBA 1Y71A 3FXLA 4M7DF 1PDNC 1U06A 2ZPIB 3HEFA 3HOZJ 4MEYF 2RJDA 2DFIA 3TEHB 1WPKA 5GTIC 2N8GA 1YJNT 3VSKA 4FT4A 3NAUA 1DPRA 3NWTA 4FE4A 4GLKA 4LVJA 1P4WA 2O31A 2DCEA 4H2VA 3IH3A 1XB4A 3OS2A 5GMKe 2DDBA 1M1KC 3T0YA 4E51A 4NNJA 2LP0A 2EZKA 2BVMA 3QPLA 4N9IA 4RTYA 1TW3A 3QYHB 4X9CA 1UELB 4FASD 5LJ3f 3WU0A 4ZGJB 1NJIC 3MZYA 1WPYA 1N75A 1ZTRA 2L8DA 3ABKH 2D1HA 2HL5C 2P6SA 1Y96A 2HDCA 2BE7D 3TOBA 3BQYA 1FTTA 4XOTA 3CCLI 4KR3A 3BG9A 2V1UA 1KU2A 4XLHA 2DT7B 2DJNA 2PN6A 5LLQA 3O2PE 4XBFA 1X2QA 1YS6A 5K7ZA 1ERDA 2E1OA 4IRGA 4C3IJ 3M8JA 1GXPA 4ZDOA 1AA7A 1TUCA 2Q0OA 5TGTA 1GL5A 1WZ2A 1X4OA 1AOJA 4C8QG 2VKNA 2EZLA 3RKQA 1RABB 2JMWA 4M7AC 3HXWA 2K5LA 3HJEA 3L2VA 2I4NA 4S05A 1LDDA 4A53A 4JRIA 2JOYA 1KMNA 4ON0A 2CO5A 2LQKA 2IEKA 2LZ6B 4Z89A 2P84A 4E7ZA 2W0ZA 3LAPA 2DM1A 1QVUA 1L0WA 1X58A 1WZOA 3D0SA 1VQ9Q 1E6GA 1QKXA 5KYWB 2K3XA 1F1ZA 3G2BA 4H2WA 3KPHA 3M1EA 4G94A 2ESWA 2DA1A 2DAQA 2LK2A 1WYXA 1CQTA 3SFZA 2FZCB 1H89C 1FIPA 2CZ7B 4C92G 4QQDA 4XLCA 2FXAA 3J7ZI 2PJPA 2C06A 1KQSP 1TWAJ 1G6NA 4J9IA 4LJZF 1PHTA 4HAMA 3M0RA 4YRTA 4J6WA 2DK8A 4KUIA 5LJ3d 3CMYA 1YWPA 1E1OA 2K7LA 2HXOA 4ESBA 2BE9B 4OP0A 1RNLA 2HSPA 1UUEA 4YEJA 2MBFA 2VKEA 3P8HA 2QK0A 3MP6A 1KQSS 1RADB 4DYQA 1EJ9A 2IS1A 3QYFA 2KY9A 3VPRA 3TL4X 3OSVA 3VOEA 2QKMB 4HEA2 2P4TA 3GTGJ 3JRZA 2DX1A 4U0WA 2YDLA 1SF9A 3MVPA 4R79A 2DILA 1VQ6A 2ZZGA 3CESA 1X54A 2VQHA 2RGVA 2E3IA 2R7QA 5E3NA 1W4MA 2X6WA 1OCZH 2XF7A 3ERMA 1XSXA 5DUKA 2EBIA 4B3XA 1KFZA 3C2BA 1D3YA 1ETVA 1QWFA 4JBAA 1OPCA 4CCLA 5EEAA 3ZN1A 2E65A 1JRIA 5GAOp 5I2MA 2PG4A 2LRQA 3RZDJ 2M0CA 3L09A 4A12A 1VQKT 3AFHA 4FQGA 4FX0A 1HKTA 3OYBA 3TSZA 2OV7A 3DLLF 4FX4A 3GPLA 2CH0A 3E3VA 4OGCA 1USYC 2JRTA 3SHFA 2K9MA 2XGXA 2Z1DA 1XQHA 3MEAA 5KE3A 3ULRB 2O6GE 3GNGA 4BBRJ 2L9NA 1VQNQ 3AG2H 1AZEA 1IF1A 5E18F 3I54A 3FIWA 1JO8A 5LGTA 2UWMA 5CKEA 3FRNA 2LLKA 1IZ1A 3HOSA 1OCTC 2VJIA 3K1MA 1N8RC 1VQ8Q 4PJMA 2EILH 1CF7A 5C53B 3CUOA 4KMUX 3KXTA 1BR1A 1X1AA 3JRAA 1YITA 1TL8A 2I4MA 2F1LA 1YFNA 1ON2A 3IRRA 2OTJA 3PNVA 5H6QA 3OYMA 2L3DA 1AKHA 1YS7A 1M3BA 3QWXX 2ZXIA 1BOBA 2CP2A 4AIKA 1C6VX 1NPPA 1ZSZB 3BR5A 1OCOH 2LYCA 5CKTA 1YIJT 5D6FA 1PJRA 2GA2A 1ZH5A 1VQ4I 4DOWA 4C5HA 1Q82C 4LK1F 1NLOC 3QO8A 2E5ZA 4PJOF 4LLNA 3JV3A 3LH5A 5HY6A 2DD5A 1G3SA 4L9TA 4CYCB 3S1MJ 2CFXA 5K5QA 4ESFA 1ZUKA 3A74A 4EATA 2OTLI 1DU0A 3WHBA 3WE3A 3MAJA 3I9QA 1YG2A 2CYYA 4HNVA 3A0HC 2VUMJ 1V54H 4PUSA 2DXTA 3S3MA 1MBKA 3HHTB 1F5TA 1QVGA 4HF2A 3GWZA 1T98A 2E71A 3MWMA 4P72A 5C52B 5EG0B 2MYSA 3X25B 3U2RA 2AKKA 1HSTA 2DLLA 3QU6A 4CS4A 3CC7T 4ATOA 2YU3A 4XSXF 3ABUA 1MZBA 2DERA 4EJOA 3QXEB 3BPVA 5FLXK 1JXOA 1QVTA 1I4K1 3REXA 5GAMf 4BHPA 1KD1C 1MH4A 3OMYA 2O7OA 3WVEB 2EJGA 4IRHA 1ZRCA 3MCAB 2RQPA 5GAMe 4LGWA 4M3DA 5ILUA 4LVIA 5AT1B 1FBUA 5FKLA 1T0FA 1H8KA 2QQRA 4P73C 3DTKA 3O5ZA 3BR2A 5JHUA 4MTEA 4CYDA 3R6SA 1VQ7Q 4DZPA 2JT4A 3PIOA 3I55I 5C44J 4MQ9F 2E7XA 3A1PA 2XIDA 4C8QD 1NHAA 2XKOA 1N6AA 3QQAA 1K0SA 1T56A 4AVPA 4HVUA 4M78A 2ZJ2A 2LSOA 4GLMA 3C2HA 5J8CA 2GZWA 3EH2A 1ORKA 1ZYRF 3CCVQ 3MD2A 3EYIA 2VUBA 2ARTA 2EQJA 3M5AA 3G6EQ 1ZN2A 2VASA 4F16A 2MPXC 3CO7C 1NZ9A 2VBZA 4EV0A 3KETA 4RTZA 5FLXE 1EX4A 4YCVA 4YRGA 2HSEB 1F43A 2QQBA 4C92D 2DFHA 4HT9A 2KMTA 3WE2A 5EJCA 1TTYA 2JNGA 3HB9A 3QWLA 2RK2A 2PMHA 4ETSA 3TEEA 3HRTA 3C3WA 2PNIA 3M55A 2JUGA 3TP0A 1R71A 2HXIA 1ZREA 3FEOA 2DETA 1S29A 3CCMT 2XKPA 4BHCA 2IIMA 3BZKA 4D7MA 2V26A 1I39A 4E7JA 3CBOA 2M9HA 4CC4B 2OCEA 2QA4T 2P4RA 4XKVA 1U9OA 4P9FA 1B34A 4M75A 4G12A 1RKTA 2I8DA 4CS3A 2WTEA 3B02A 2Q7GA 2FPEA 2P5KA 1R23A 2CQKA 1MBJA 4MGRA 2RN8A 1WA7A 3EPZA 1NTCA 2NRAC 5FROA 2FYKA 1VYVA 4LVLA 1GVDA 2FQ3A 1VQMT 1YQAA 4AFUC 1H88C 3E6BA 3HOWJ 2BZ8A 5KCHA 3CCQT 1HBXG 2DQRA 3ERED 3G71I 2NUTB 2BXZA 1VYUA 4LUDA 5J8FA 2R7WA 3VYTB 2KT8A 4RB2C 3HXLA 2VV5A 2F2EA 1E22A 2MFZA 2Z2SB 3VQWA 2SRCA 3HUGB 5A0LA 3TP3A 1USTA 3JCMV 3WU1B 3VS4A 3H36A 3OB9A 2LCCA 4CICA 4WXCA 2A36A 1YI2A 1H4TA 4UVAA 4XTYA 2QBYA 1U8BA 2UUZA 3L9FA 1WQ7A 4HG2A 3CC4T 2DK3A 1NYRA 3W2VA 3DBHB 1RPWA 3KEYA 2Q2EB 1WJEA 1VQPQ 4RMOA 5K1YA 2F4MB 3R61A 5F1RA 5FU6B 3IH2A 3LA3A 1Q81R 4LFUA 2VKVA 3V7CA 2HS5A 4QIWN 3TCJA 5GAN5 3SWNB 1QRYA 2E1MB 3OA6A 1VNDA 4DBFA 3HKSA 3TW6A 1VYTA 3RKXA 2FF4A 4C8QB 2ZB9A 1RUOA 1LE8A 1WFWA 1R36A 4ELZC 3ZQ7A 5HS9A 3I4PA 3SXYA 4HCZA 2NS7A 5DLQE 3L2RA 2CV0A 2VOOA 3QJ6A 2NXNB 4RB0A 1EZZB 2EJ9A 1M2VB 2XMFA 4LG3A 4M6XA 1BC8C 4ZTJA 4XU1A 2EQRA 4EMKA 2E12A 4M9SA 4JZ4A 3I56Q 3A02A 1Z9CA 2R7FA 2DL4A 2PVDB 4BY1J 4DYRA 2H6BA 3SEQA 1ZSGA 1VUBA 2V8IA 5CQYA 4MTDA 4C92B 5HLTA 3TO6A 1E7OA 1J3TA 4WCGA 3EUHA 2ZNJA 4YTLA 2RPNA 1JUMA 4TVYA 1R6RA 4A3GJ 2XUBA 1F9NA 1QZZA 5C0MA 4DBQA 3IH4A 3OW2P 3CCUI 1N77A 4I6ZA 4KGVB 4I99C 4PGGA 2QEXT 2PJRB 2HZDA 2ZNZA 3LGFA 5TRDA 3A01B 1O7LA 1QPIA 2RKHA 2Y4YA 1HW5A 3K7AJ 4JOMA 1WJSA 3A5ZB 3BJ6A 2LVSA 2DIQA 3OW2S 5BMZA 1FSEA 2X48A 5KYYB 4XNFA 3CMAT 1YW9A 2A61A 2CW0F 2K86A 3DB3A 3CD6A 4YREA 4C8QF 1UJYA 4XSZF 3JCMd 5IYCJ 4XKCA 2V6CA 1J7KA 1I3AA 2M8EA 5KCOA 1BU1A 4I2OA 2JUFA 3JRDA 1IG7A 4BHBA 3G1JA 2AXTC 3S14J 3V4GA 1PVEA 2MABA 2MG4A 3VS1A 2HQRA 5IPAA 2HBPA 2QDYB 4P74A 1YIOA 2X1EA 1UJ0A 4AMCA 1ENHA 4HWTA 4KN7X 5GTHC 4CCJA 3JAMK 2E4HA 1XMKA 5CVRA 2FNPA 2OJED 2VQLA 3CXCP 2VYTA 4C92F 2A68F 1I6XA 1W36C 4A5MA 2NS0A 3QPTA 3CCSQ 1I8FA 2F5FA 2RI5A 2EW3A 4L5EA 1BK2A 3VWBA 1ZG1A 5KNLA 2ZPFB 1JJ6C 1ITYA 3H3ZA 2LREA 5LFAA 2XAHA 3F8BA 3CXCS 1RUWA 3CMET 3WTVC 2VXEA 4M3BA 1IL2A 1BR4A 3JCMP 4GDFA 3E9FA 4BKXA 1YFRA 3HSRA 4DGWB 2OAZA 3FISA 1Z3YA 1G3YA 3X20B 2RO0A 4J83A 2CUZA 3CPWP 3R60A 4E6RA 1YJNI 2JTVA 3MEXA 4XLEA 2FHDA 3BJAA 5LGUA 4IX7A 2HVQA 3Q3SA 2ZPHB 1ZUUA 4A3KJ 3JSOA 1JJCB 2ID6A 2LMJA 4BQNA 1VQLT 2E10A 1N5ZA 3EH1A 1BL0A 4QW2A 1MJBA 4J9GA 2BZTA 1N9SA 2DTIA 3OBWA 3JCMg 1U5TB 3DEWA 2LRDA 1FYNA 3JAME 2ZPGB 4IOAF 5FU7B 3MKZA 2COYA 2KFDA 2O03A 1TG0A 5EGOA 1NJIU 4WI1A 2AHJB 1OCPA 4DQ2A 2L7MP 1K9MC 1A0NB 2OX7A 3N5BB 4D7NA 1FY7A 4P9UA 2WV1A 1WXTA 3V42A 3MKDA 1Q7YU 4OMNA 1FOXA 1JKOC 1YX3A 2Y0SN 2HVSA 2V1QA 2DVJA 3ABLH 5L3BA 2LJ1A 2JMCA 5FWCA 3KFVA 4FYWB 2HKQB 1X3UA 4Z2YA 4YIFA 3CJQB 2A0FB 4L5JA 3U21A 3H9QA 1JT6A 2JXBA 4C3JJ 3IG2A 4B8XA 3VS5A 3NPFA 5FFZA 2XDVA 1VQ5A 3WTXC 2EFOA 3OOPA 3UPUA 3MEVA 4RKUE 3S1RJ 2JQ7A 2DVEA 1T08B 4CGZA 4H2SA 3JCMQ 2QHSA 3HSBA 3ER0A 4A4FA 1FEXA 2ACJA 1BI3A 4IL6C 4FHTA 1TTHB 5HGQA 1JKQC 5JHFA 2JTFA 1Z7LA 4IHXA 1TWBA 5ILVA 1XPXA 5KYXB 3S1NJ 3FMRA 5FKKA 1AT1B 3VJPA 5IP7J 5FLMJ 2NYSA 1RZ4A 1VQ9A 3NQOA 4GYGA 4A69C 3RCOA 5AYFA 1UB4A 4M7DA 2HL3A 4BNCA 3I5UA 1GCQA 1M2OA 3C2GA 3H92A 2QUFA 2FQ4A 1QWEA 5LJ5d 4DYCA 2L7FP 3DTEA 2Z33A 1F36A 1G3WA 4IHYA 2IVWA 5GAOr 3GCMA 4JDSA 1YFHA 5FB2A 2WY8Q 2HOTA 2FUG2 3HFNA 3A8OB 4D5FA 1RLQC 1VIFA 2LNBA 1XDUA 2Y30A 2GBQA 3W3CA 1X4PA 1SD7A 1X6BA 2CSQA 1OCCH 3UR3C 2XICA 3IKLA 3CUQC 4ZTUB 2MC4A 3KFWX 1TSFA 3MKLA 1D0ZA 3OYLA 3RZOJ 4M7AD 3DKYA 1UE9A 4BEHB 2K9NA 2NS6A 4M78E 4LIVA 1JBMA 2R7UA 1RKWA 1S7EA 1XOVA 2LCSA 1YRNA 3KCCA 1Y1VJ 2RJFA 4NC6A 1BCOA 4MFDA 2VOPA 3F22A 1BN5A 2Y4XA 1UHFA 4R1HA 4JX6A 4DEYA 2QHTA 3S6WA 4F7UF 2X6OA 1TLHB 4A2UA 3ERRA 2IA1A 2ISYA 2MA3A 2Y75A 1D3BA 3MCZA 4FETA 1S9HA 2RQUA 2LD5A 3BROA 2L89A 5CQEA 3EDPA 2VT3A 2UXXA 1TP4A 4JP0A 4TVRA 3QTCA 3MKWB 4G84A 4BBSJ 3N97A 3IKTA 1LNXA 2K57A 3VYRB 2AIRB 1H641 2EBPA 2OU2A 1QGPA 3PUBA 4C2MJ 3ZQHA 1ZG5A 3JSCA 1RI7A 5LJ5g 4OB2B 3OYYA 4M75E 2LMDA 3BG7A 3RQ4A 3M7GA 3W2AA 1VI0A 2E35A 1ZRDA 1FTZA 2CFOA 4HLXA 2F5EA 3HSEA 2WAFA 3KP5A 2ELHA 1YJWQ 3FKJA 1KQSA 4F55A 2TDXA 5J3LA 3DKMA 1YHQT 1RRJA 4J9HA 2RHQB 1VQNA 3QZ5B 3WGHA 4UUSA 4J9EA 2ZZFA 1MBGA 1LFPA 2ETHA 5KYNA 4GXOA 5GAOn 1W2BP 1JXSA 1B8IA 4XLPF 4EM2A 1KU9A 1N8RU 2DXCA 1OQKA 2QG9B 2FG0A 4EJUA 4UB6C 3ZBDA 1VQ8A 5GANe 3C18A 4H4KC 1W2BS 2MD5A 1TNTA 3DCFA 2ICWG 1EV7A 3EHQA 5TJJA 3UGTA 2P81A 3K4MA 1K9MR 2Y2ZA 2EINH 3CCJT 3IWZA 4NCXA 2HQNA 3UT1A 3WVDB 1FX7A 2RVCA 5LBQA 3OYNA 1YIJI 4HZFA 4KGXB 1ASZA 3D5RC 1KK7A 1QZEA 5GPCA 4WK8F 2XU8A 1KQ0A 1KC8R 4HWPA 2HYFA 1B4AA 2Y90A 5D6EA 4HDUA 3QIIA 3I5SA 5J1UA 3NEMA 4D0PA 1G59A 2CUEA 4E7IA 4CHUA 2H1LA 1K76A 3GX4X 1IREB 4IOCF 4KICA 3VQXA 4B1RA 3G1ZA 1E6HA 3H6ZA 4O3MA 2R7XA 5BOXA 2CW8A 3F23A 2O9VA 4V2SA 1G51A 2CP5A 1HSQA 1T0FC 5J4VA 3VYUB 3SQNA 5DCFA 2R5ZB 3H0GJ 3PO2J 2ZXHA 1TWHJ 1B9MA 2ZAEA 3A0BC 2RREA 4HWSA 2BY0A 1VIEA 3JRBA 1Q86C 4XRSA 1EIYA 1LPLA 1OR7C 1WHLA 2A6EF 2XKOC 2NNYA 4RTUA 1J0RA 2DBMA 2GGRA 1S72Q 4KYWA 2QDLA 4HCCA 1KD1U 3CCEQ 3CC2Q 4W97A 2NUZA 2FX0A 4BYYA 3JRGA 1Z77A 3EGDA 3TW7A 3G4ST 2DXUA 1YW7A 3S2WA 1W7PA 4RB3C 1I07A 4F04B 4N0AA 3PE0A 4XICA 2EFNA 1Y1WJ 3GUDA 5IHKA 2ECBA 2FOWA 4RTVA 3BOQA 2H3EB 3OR2C 1G83A 1VQ7A 2BEOA 3U1DA 2BXYA 2QGGA 2CH4A 2LCLA 1M90C 2B86A 4M7AF 2DAOA 1ZGWA 1K78A 2PEXA 2HNIA 2DMOA 4KJZA 3QP6A 4P3OA 2HYJA 4X0GA 6PAXA 1X01A 4PJOA 3OWTA 3EG1A 2QSGX 1X6OA 1ZA2B 3HHGA 1WVRA 3VRZA 2M0OA 1B70B 2HOSA 5HS7A 3VS0A 3ABTA 4U0YA 1GFDA 2YRCA 3LSHA 4A4HA 3U1KA 4M77F 2MF2A 3E9GA 2EA4A 2NUPB 1G3TA 2WB1N 3CCLT 1PYSB 3CTAA 5LJ3j 2WAQN 3IRQA 2R7TA 3MZHA 1HC8A 1YFSA 3REAB 4UP9A 2RQWA 2QA4I 2DJZA 4I02A 3M4QA 5CAIA 2CJ9A 3P7NA 3FX3A 2EFIA 3P8TA 3TDZC 1EVKA 1D5YA 4OVAA 5CVIA 2J5OA 4UXNA 4LDXA 1ADJA 1H92A 2CJJA 2FBIA 2RHSA 1VQMI 2KL4A 4ZDLA 2Q7EA 4Y15A 4ORZA 5FD5A 3JCMc 1ETXA 2GA1A 4CXFA 5HVQC 2D2WA 1YP5A 3CCQI 2CG4A 3VYSB 2XC7A 4NUBA 1I1SA 4BACA 1ETKA 3VFZA 1YJ9Q 1GV2A 2YWWA 2O8XA 5E8GA 4V19K 1AWXA 1U3EM 3VU3C 1OJLA 3QZ9B 3VKIA 5J3BA 3MEYA 1HCRA 3DQVC 2CZ1B 1QHGA 1ZQ3P 1NJ5A 3FWEA 4G6TB 1I5OB 4EMHA 3KLOA 1AD5A 3A8LB 2HD0A 1R5HA 1XX5A 3I4MJ 1M3AA 2KK4A 1HOMA 1FC3A 1B9NA 4A4EA 5D5XB 3DXJF 2Y48A 3P8BB 3S93A 3RMSA 4RGUA 1LPQA 2R7RA 5DUIA 3BP8A 1VQPA 2PMEA 4KMFA 1M9SA 3CCRA 3M0PA 3ZMDA 3M56A 4BDYA 3HDDA 4V2GA 4RCBA 4A54A 4M4ZA 1N25A 4EEFG 1MGQA 3A4CA 2W85A 2F5KA 1WJ5A 3EUHC 3CCVT 2GOXB 2MH2A 4L0ZB 2M1BA 2EYZA 4AYBN 1QVPA 3M53A 3G6ET 1IXCA 3O8VA 3H3VK 1A5JA 2KXDA 4CH4A 1HSJA 3FHNA 5DCMB 4ZZDA 5HK0A 2DL8A 4LN2A 5J39A 1K1ZA 2FSWA 2TCTA 4YDQA 2P7CB 3I7FA 4L18B 3EG9A 2IP2A 3JRCA 4XTUA 5C3EJ 3GZNB 2CS7A 3EG2A 4AU7A 2O5RA 1Q86R 5ICGA 2QLZA 4H2XA 3RI4A 3LH0A 4M6YA 3G1MA 2QF7A 3EAEA 4KUMA 3B6CA 4PJLA 3MPUB 4RGXA 4ME7A 1C0AA 2KDSA 4IF4A 2AT1B 3PIPF 3HFZB 4PGHA 2E3CA 3DEEA 2HBWA 2QEXI 4FYXB 4Y3OA 3V8KA 2BHZA 1IN6A 5GMKi 3SFMA 2ODRD 1FYKA 4ANJA 2LVMA 1W70A 1R58A 1EOVA 3JCMX 5M3FJ 1OV3A 5HLIA 1PKSA 3CMAI 3F8NA 2DL5A 4Y4RA 3JRIA 4QSHA 4AFZC 2KDZA 3PNYA 5DLOA 1T0HA 1FWZA 1WGXA 2DMUA 1WJAA 4IUPA 1PP7U 4TTVA 4YRQA 3RNJA 3K4NA 4O5VA 2L7KA 2FBHA 1YITQ 1D1BA 1MKMA 2GIZA 1YI2I 5CVUA 4N0BA 1E3HA 3JTGA 2C0IA 4M3EA 2KHMA 3KP4A 2MK5A 3ZMUA 2FZKB 2KRCA 4AD9A 2BY2A 1K8AR 3I71A 1LFBA 2XAQA 2MLGA 2VN2A 2YLBA 4U7BA 1TQIA 4E47A 2ARUA 4PNOA 1KONA 3BZ6A 2XHKA 1YGBA 3EGXB 1W5SA 4IQJA 2K6DA 4HPQA 3K4CA 2IS6A 4MIMA 1QBJA 3EETA 3EGUA 3F72A 1SAXA 2HYGD 4ZZLA 3CCSA 1WJFA 3QYBA 4XKWA 5DY9A 3JB9I 3HL8A 3RMQA 3GTOJ 3HFVA 3UFGA 1QVFA 5BS6A 5B66C 3TBIA 2VB6A 3OBYA 4NL3A 3FHZA 3RKWA 1H4SA 2DRKA 1PRMC 4OMOA 3BJUA 4N4NB 2BZYA 1KHCA 2WSEE 2EJRA 1UJ8A 2FE3A 1LYLA 1R0CB 5I2SA 1K4SA 4BE0A 3F8CA 2GFAA 1H9GA 3I56T 2M87A 2V6EA 3CEYA 1W0TA 3M4PA 2JVVA 2KROA 2FPDA 4C0DB 3V7RA 1K73C 4O6JA 5IYDJ 3OQ5A 1TOVA 4RQEA 3REUA 5DM7F 4XLNF 1W36D 2F48A 3SWNA 3PQKA 3W6JB 2DYRH 4HX8A 2JZYA 1V29B 4KT5C 2K5IA 2W7NA 4MMKA 2XAJA 5JR3A 4XK4A 1OYYA 2O2OA 1ASYA 4HDVA 5HNHA 4N4OB 1XGMA 2K9GA 1X56A 2RHYA 3L4GB 3TO9A 1PC0A 4EJTA 3LSIA 3CD6I 2HNHA 3CXCA 1ZARA 3FXOA 1FSHA 3I55T 1YWOA 2H3JA 4YFNF 3KEOA 1EFWA 4J7IA 4M7DC 2QYZA 1GCQC 4UUTA 1OEBA 2ZCEA 4A63B 4DOVA 4WXHA 2DEUA 1KQ9A 1VQOQ 3QDFA 1JHHA 3WTWC 4A0ZA 3BG6A 2HU9A 5GAN7 3NTIA 1XDSA 1B1BA 4HNUA 2P7VB 3LA7A 2CUBA 1FMWA 4OF1A 1OYXA 1EIF