3HTZA

Crystal structure of the catalytic fragment of alanyl-trna synthetase in complex with l-serine: re-refined
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
457
structure length
447
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
publication title Serine Paradox
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 159
structure length 447
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2009-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3htzA01
3V7CA 3L1AA 4P71C 4BWAA 3TUPA 2ODRD 4YRIA 1HTTA 1SERA 3QTCA 4XTUA 4XTZA 5KNNA 3P8TA 4XTXA 1X01A 4DQ2A 4TTVA 4YRSA 4TQDA 3V7RA 2DXTA 3UGTA 5K1XA 2EWNA 2DU7A 1B7YB 3UFGA 4H2XB 1C0AA 4PHCA 1H4TA 1ASYA 4H02A 2CJAA 3L4GB 1X2HA 3A32A 5ELNA 2XTIA 2QHVA 2RHQB 4EO4A 5C51B 1JJCA 2ZT8A 2EAYA 4HA8A 3A74A 4K86A 2E3CA 5ELOA 1NYRA 4P72C 2CJBA 4WF2A 2XGTA 4XU3A 1GGMA 2ARSA 4ZTZB 2AKWA 1HXDA 3ICAA 3REXA 3LC0A 4L87A 4UPAA 3UGQA 2DZCA 1PYSA 1N9WA 3VBBA 3EFSA 3MF1A 3E9IA 4J15A 1BBUA 1BIBA 3NENA 3M4PA 3RKYA 1SETA 1USYA 2ZGWA 4H2VA 3RKWA 4UP8A 4Q15A 4H2XA 3FJPA 4P75C 3QO5A 3L4GA 5HGQA 3HXUA 2J3MA 3IG2A 4YRQA 2RHQA 3HXWA 4H2SA 3REUA 3R07A 1SESA 3RACA 4CH5A 3CMQA 4XTYA 1JJCB 4XU0A 4ZIBA 1LYLA 4RQFA 2E65A 1HC7A 4WJ3M 1E24A 2P0LA 3IKMB 1QF6A 4P3OA 1Z7NA 2DXUA 1IL2A 4YCWA 1NJ6A 3A31A 2EJGA 1PYSB 3W3SA 2DQ3A 2E41A 3A7UA 1G5HA 4CS2A 2QHSA 2ZNIA 4HWOA 1H4QA 2I4NA 1X2GA 1B76A 3A5YA 2IY5A 4TVAA 4G85A 1YB3A 3QO7A 4YRRA 2C8MA 2ARTA 1NYQA 1G5IA 1EVKA 2ZZEA 3M4QA 4P3PA 3HFZB 1ATIA 2ZT5A 4CH4A 2AMCB 3P8VA 3RF1A 3RL6A 4XEMA 3PCOB 2ZR3A 4YRGA 2P5IA 1J5WA 4P74A 4EX5A 4HWTA 2PMFA 4HWRA 1SRYA 3VQVA 4DPGA 3HXYA 4YRCA 2I4MA 1EVLA 5C53B 3WQZA 5C52B 4YRJA 1WQWA 4RDXA 4KQEA 4CH6A 4KR2A 2Q7HA 1NJ8A 2DTIA 1WQ7A 1L0WA 3G1ZA 1WYDA 4XU2A 1KMMA 4YRMA 4YROA 4E51A 3NETA 1X54A 2C7IA 3OD1A 2DVEA 3TEHB 4YREA 3IALA 1EOVA 1KOGA 4ZTUB 1H4VB 2IY5B 4TVAB 5K1PA 2Q5IA 4NCXA 4YRKA 3HFZA 4YP0A 2DDZA 3V7SA 3HFVA 2AMCA 2I4OA 1ADYA 2Q7EA 3TEGA 4XTVA 3PCOA 1W66A 4TVWA 4OLFA 4P74C 2Q5HA 4H2TA 4TQFA 4G84A 1X55A 3HY1A 4UP9A 4H2YA 1FYFA 2I4LA 4BW9A 2ZT6A 4YDQA 1KMNA 2ARUA 2DQ0A 2J3LA 4LNSA 2DTOA 3A7AA 1EIYB 4Q6GA 2Q7GA 1WLEA 4CS4A 2RHSB 4KR3A 1USYC 2ZR2A 4YYEA 4P3NA 4X5OA 3TEHA 1B70B 1EQRA 2E64A 4YRFA 4YCVA 4YRNA 2E5AA 4H2UA 3MEYA 4P72A 3L2ZA 1E22A 1WU7A 3EFRA 1VQZA 4YPFA 3BFMA 3HXXA 1H4SA 4XEOA 3LSQA 2ZINA 3HTZA 1YFRA 2ZIMA 2QHUA 3MF2A 3V8KA 3IKLA 3HRKA 4XU1A 4TVYA 1NJ2A 2ZT7A 3BJUA 2ZIOA 3I7FA 4P75A 11ASA 3A7RA 4K88A 3A5ZA 3HXVA 2ZXFA 3ERRA 4CH3A 1EIYA 1NNHA 1RIQA 2EJFA 2RHSA 4PG3A 2CIMA 3VQYA 3VQXA 1B70A 4RQEA 2ZTGA 3DSQA 1WNLA 4YRLA 2ALYB 1NJ1A 2ZNJA 4YCUA 4UP7A 4P73A 4TWAA 1WPYA 4RMFA 4XTWA 2HNIA 3KFUA 1G51A 1BIAA 1E1TA 2FYKA 4OP0A 2PMEA 4WI1A 1YGBA 3QNEA 3UH0A 4P71A 1YFTA 2DU5A 3PZCA 3HXZA 3RKXA 1B7YA 2ZZFA 5E3IA 4YRPA 2DEQA 2EJ9A 3P8YA 3NELA 2E10A 1EFWA 5F5WA 1YFSA 2G4CA 3HRIA 1ADJA 1E1OA 2DTHA 4HVCA 2ODRC 1Z7MA 12ASA 2ZCEA 1X56A 3V8JA 3QO8A 3RUXA 2DJZA 4AH6A 3NEMA 1BBWA 2EL9A 3V8LA 4CS3A 1ASZA 2ALYA 1B8AA 2CGHA 4P73C 2QHTA 4K87A 1QE0A 2ZZGA 4HWSA 2DZ9A 4WJ4A 4YRTA 2CJ9A 2DKGA 4H2WA 1NJ5A 3VQWA 3RIRA 2E1HA 3HY0A 4O2DA 3E9HA 2AKWB 3LSSA 4HWPA 3RGLA
chains in the Genus database with same CATH superfamily
3V7CA 3L1AA 4P71C 4BWAA 3TUPA 2ODRD 4YRIA 1HTTA 1SERA 3QTCA 4XTUA 4XTZA 5KNNA 3P8TA 4XTXA 4LVLA 1X01A 4DQ2A 4TTVA 4YRSA 4TQDA 3V7RA 2DXTA 3UGTA 5K1XA 2EWNA 2DU7A 1B7YB 3UFGA 4H2XB 1C0AA 4PHCA 1H4TA 1ASYA 4H02A 2CJAA 3L4GB 1X2HA 3A32A 5ELNA 2XTIA 2QHVA 2RHQB 4EO4A 5C51B 1JJCA 2ZT8A 2EAYA 4HA8A 3A74A 4K86A 2E3CA 5ELOA 1NYRA 4P72C 2CJBA 4WF2A 2XGTA 4XU3A 1GGMA 2ARSA 4ZTZB 3MQZA 2AKWA 1HXDA 3ICAA 3REXA 3LC0A 4L87A 4UPAA 3UGQA 2DZCA 1PYSA 1N9WA 3VBBA 3EFSA 3MF1A 3E9IA 4J15A 1BBUA 1BIBA 3NENA 3M4PA 3RKYA 1SETA 1USYA 2ZGWA 4H2VA 3RKWA 4UP8A 4Q15A 4H2XA 3FJPA 4P75C 3QO5A 4LVMA 3L4GA 5HGQA 3HXUA 2J3MA 3IG2A 4YRQA 2RHQA 3HXWA 4H2SA 3REUA 3R07A 1SESA 3RACA 4CH5A 3CMQA 4XTYA 1JJCB 4XU0A 4ZIBA 1LYLA 4RQFA 2E65A 1HC7A 4WJ3M 1E24A 2P0LA 3IKMB 1QF6A 4P3OA 1Z7NA 2DXUA 1IL2A 4YCWA 1NJ6A 3A31A 2EJGA 1PYSB 3W3SA 2DQ3A 2E41A 3A7UA 1G5HA 4CS2A 2QHSA 2ZNIA 4HWOA 1H4QA 2I4NA 1X2GA 1B76A 3A5YA 2IY5A 4TVAA 4G85A 1YB3A 3QO7A 4YRRA 2C8MA 2ARTA 1NYQA 1G5IA 1EVKA 2ZZEA 3M4QA 4P3PA 3HFZB 1ATIA 2ZT5A 4CH4A 2AMCB 3P8VA 3RF1A 3RL6A 4XEMA 3PCOB 2ZR3A 4YRGA 2P5IA 1J5WA 4P74A 4EX5A 4HWTA 2PMFA 4HWRA 4LVKA 1SRYA 3VQVA 4DPGA 3HXYA 4YRCA 2I4MA 1EVLA 5C53B 3WQZA 5C52B 4YRJA 1WQWA 4RDXA 2A8EA 4KQEA 4CH6A 4KR2A 2Q7HA 1NJ8A 2DTIA 1WQ7A 1L0WA 3G1ZA 1WYDA 4XU2A 1KMMA 4YRMA 4YROA 4E51A 3NETA 1X54A 2C7IA 3OD1A 2DVEA 3TEHB 4YREA 3IALA 1EOVA 2NS6A 1KOGA 4ZTUB 1H4VB 2IY5B 4TVAB 5K1PA 2Q5IA 4NCXA 4YRKA 3HFZA 4YP0A 2DDZA 3V7SA 3HFVA 2AMCA 2I4OA 1ADYA 2Q7EA 3TEGA 4XTVA 3PCOA 1W66A 4TVWA 4OLFA 4P74C 2Q5HA 4H2TA 4TQFA 4G84A 1X55A 3HY1A 4UP9A 4H2YA 1FYFA 2I4LA 4BW9A 2ZT6A 4YDQA 1KMNA 2ARUA 2DQ0A 2J3LA 4LNSA 2DTOA 3A7AA 1EIYB 4Q6GA 2Q7GA 1WLEA 4CS4A 2RHSB 4KR3A 1USYC 2ZR2A 4YYEA 4P3NA 4X5OA 3TEHA 1B70B 1EQRA 2E64A 4YRFA 4YCVA 4YRNA 2E5AA 4H2UA 3MEYA 4P72A 3L2ZA 4LVJA 1E22A 1WU7A 3EFRA 1VQZA 4YPFA 3BFMA 3HXXA 1H4SA 4XEOA 3LSQA 2ZINA 3HTZA 1YFRA 2ZIMA 2QHUA 3MF2A 3V8KA 3IKLA 3HRKA 4XU1A 4TVYA 1NJ2A 2ZT7A 3BJUA 2ZIOA 3I7FA 4P75A 11ASA 3A7RA 4K88A 3A5ZA 3HXVA 2ZXFA 3ERRA 4CH3A 1EIYA 1NNHA 1RIQA 2EJFA 4LVIA 2RHSA 4PG3A 2CIMA 3VQYA 4HT4A 3VQXA 1B70A 4RQEA 2ZTGA 3DSQA 1WNLA 4YRLA 2ALYB 1NJ1A 2ZNJA 4YCUA 4UP7A 4P73A 4TWAA 1WPYA 4RMFA 4XTWA 2HNIA 3KFUA 1G51A 1BIAA 1E1TA 2FYKA 4OP0A 2PMEA 4WI1A 1YGBA 3QNEA 3UH0A 4P71A 1YFTA 2DU5A 3PZCA 3HXZA 3RKXA 1B7YA 2ZZFA 5E3IA 4YRPA 2DEQA 2EJ9A 3P8YA 3NELA 2E10A 1EFWA 5F5WA 1YFSA 2G4CA 3HRIA 1ADJA 1E1OA 2DTHA 4HVCA 2ODRC 1Z7MA 12ASA 2ZCEA 1X56A 3V8JA 3QO8A 3RUXA 2DJZA 4AH6A 3NEMA 1BBWA 2EL9A 3V8LA 4CS3A 1ASZA 2ALYA 1B8AA 2CGHA 4P73C 2QHTA 4K87A 1QE0A 2ZZGA 4HWSA 2DZ9A 4WJ4A 4YRTA 2CJ9A 2DKGA 4H2WA 1NJ5A 3VQWA 3RIRA 2E1HA 3HY0A 4O2DA 3E9HA 2AKWB 3LSSA 4HWPA 3RGLA
chains in the Genus database with same CATH topology
3V7CA 3L1AA 4P71C 4BWAA 3TUPA 2ODRD 4YRIA 1HTTA 1SERA 3QTCA 4XTUA 4XTZA 5KNNA 3P8TA 4XTXA 4LVLA 1X01A 4DQ2A 4TTVA 4YRSA 4TQDA 3V7RA 2DXTA 3UGTA 5K1XA 2EWNA 2DU7A 1B7YB 3UFGA 4H2XB 1C0AA 4PHCA 1H4TA 1ASYA 4H02A 2CJAA 3L4GB 1X2HA 3A32A 5ELNA 2XTIA 2QHVA 2RHQB 4EO4A 5C51B 1JJCA 2ZT8A 2EAYA 4HA8A 3A74A 4K86A 2E3CA 5ELOA 1NYRA 4P72C 2CJBA 4WF2A 2XGTA 4XU3A 1GGMA 2ARSA 4ZTZB 3MQZA 2AKWA 1HXDA 3ICAA 3REXA 3LC0A 4L87A 4UPAA 3UGQA 2DZCA 1PYSA 1N9WA 3VBBA 3EFSA 3MF1A 3E9IA 4J15A 1BBUA 1BIBA 3NENA 3M4PA 3RKYA 1SETA 1USYA 2ZGWA 4H2VA 3RKWA 4UP8A 4Q15A 4H2XA 3FJPA 4P75C 3QO5A 4LVMA 3L4GA 5HGQA 3HXUA 2J3MA 3IG2A 4YRQA 2RHQA 3HXWA 4H2SA 3REUA 3R07A 1SESA 3RACA 4CH5A 3CMQA 4XTYA 1JJCB 4XU0A 4ZIBA 1LYLA 4RQFA 2E65A 1HC7A 4WJ3M 1E24A 2P0LA 3IKMB 1QF6A 4P3OA 1Z7NA 2DXUA 1IL2A 4YCWA 1NJ6A 3A31A 2EJGA 1PYSB 3W3SA 2DQ3A 2E41A 3A7UA 1G5HA 4CS2A 2QHSA 2ZNIA 4HWOA 1H4QA 2I4NA 1X2GA 1B76A 3A5YA 2IY5A 4TVAA 4G85A 1YB3A 3QO7A 4YRRA 2C8MA 2ARTA 1NYQA 1G5IA 1EVKA 2ZZEA 3M4QA 4P3PA 3HFZB 1ATIA 2ZT5A 4CH4A 2AMCB 3P8VA 3RF1A 3RL6A 4XEMA 3PCOB 2ZR3A 4YRGA 2P5IA 1J5WA 4P74A 4EX5A 4HWTA 2PMFA 4HWRA 4LVKA 1SRYA 3VQVA 4DPGA 3HXYA 4YRCA 2I4MA 1EVLA 5C53B 3WQZA 5C52B 4YRJA 1WQWA 4RDXA 2A8EA 4KQEA 4CH6A 4KR2A 2Q7HA 1NJ8A 2DTIA 1WQ7A 1L0WA 3G1ZA 1WYDA 4XU2A 1KMMA 4YRMA 4YROA 4E51A 3NETA 1X54A 2C7IA 3OD1A 2DVEA 3TEHB 4YREA 3IALA 1EOVA 2NS6A 1KOGA 4ZTUB 1H4VB 2IY5B 4TVAB 5K1PA 2Q5IA 4NCXA 4YRKA 3HFZA 4YP0A 2DDZA 3V7SA 3HFVA 2AMCA 2I4OA 1ADYA 2Q7EA 3TEGA 4XTVA 3PCOA 1W66A 4TVWA 4OLFA 4P74C 2Q5HA 4H2TA 4TQFA 4G84A 1X55A 3HY1A 4UP9A 4H2YA 1FYFA 2I4LA 4BW9A 2ZT6A 4YDQA 1KMNA 2ARUA 2DQ0A 2J3LA 4LNSA 2DTOA 3A7AA 1EIYB 4Q6GA 2Q7GA 1WLEA 4CS4A 2RHSB 4KR3A 1USYC 2ZR2A 4YYEA 4P3NA 4X5OA 3TEHA 1B70B 1EQRA 2E64A 4YRFA 4YCVA 4YRNA 2E5AA 4H2UA 3MEYA 4P72A 3L2ZA 4LVJA 1E22A 1WU7A 3EFRA 1VQZA 4YPFA 3BFMA 3HXXA 1H4SA 4XEOA 3LSQA 2ZINA 3HTZA 1YFRA 2ZIMA 2QHUA 3MF2A 3V8KA 3IKLA 3HRKA 4XU1A 4TVYA 1NJ2A 2ZT7A 3BJUA 2ZIOA 3I7FA 4P75A 11ASA 3A7RA 4K88A 3A5ZA 3HXVA 2ZXFA 3ERRA 4CH3A 1EIYA 1NNHA 1RIQA 2EJFA 4LVIA 2RHSA 4PG3A 2CIMA 3VQYA 4HT4A 3VQXA 1B70A 4RQEA 2ZTGA 3DSQA 1WNLA 4YRLA 2ALYB 1NJ1A 2ZNJA 4YCUA 4UP7A 4P73A 4TWAA 1WPYA 4RMFA 4XTWA 2HNIA 3KFUA 1G51A 1BIAA 1E1TA 2FYKA 4OP0A 2PMEA 4WI1A 1YGBA 3QNEA 3UH0A 4P71A 1YFTA 2DU5A 3PZCA 3HXZA 3RKXA 1B7YA 2ZZFA 5E3IA 4YRPA 2DEQA 2EJ9A 3P8YA 3NELA 2E10A 1EFWA 5F5WA 1YFSA 2G4CA 3HRIA 1ADJA 1E1OA 2DTHA 4HVCA 2ODRC 1Z7MA 12ASA 2ZCEA 1X56A 3V8JA 3QO8A 3RUXA 2DJZA 4AH6A 3NEMA 1BBWA 2EL9A 3V8LA 4CS3A 1ASZA 2ALYA 1B8AA 2CGHA 4P73C 2QHTA 4K87A 1QE0A 2ZZGA 4HWSA 2DZ9A 4WJ4A 4YRTA 2CJ9A 2DKGA 4H2WA 1NJ5A 3VQWA 3RIRA 2E1HA 3HY0A 4O2DA 3E9HA 2AKWB 3LSSA 4HWPA 3RGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7C A;  3L1A A;  4P71 C;  4BWA A;  3TUP A;  2ODR D;  4YRI A;  1HTT A;  1SER A;  3QTC A;  4XTU A;  4XTZ A;  5KNN A;  3P8T A;  4XTX A;  1X01 A;  4DQ2 A;  4TTV A;  4YRS A;  4TQD A;  3V7R A;  2DXT A;  3UGT A;  5K1X A;  2EWN A;  2DU7 A;  1B7Y B;  3UFG A;  4H2X B;  1C0A A;  4PHC A;  1H4T A;  1ASY A;  4H02 A;  2CJA A;  3L4G B;  1X2H A;  3A32 A;  5ELN A;  2XTI A;  2QHV A;  2RHQ B;  4EO4 A;  5C51 B;  1JJC A;  2ZT8 A;  2EAY A;  4HA8 A;  3A74 A;  4K86 A;  2E3C A;  5ELO A;  1NYR A;  4P72 C;  2CJB A;  4WF2 A;  2XGT A;  4XU3 A;  1GGM A;  2ARS A;  4ZTZ B;  2AKW A;  1HXD A;  3ICA A;  3REX A;  3LC0 A;  4L87 A;  4UPA A;  3UGQ A;  2DZC A;  1PYS A;  1N9W A;  3VBB A;  3EFS A;  3MF1 A;  3E9I A;  4J15 A;  1BBU A;  1BIB A;  3NEN A;  3M4P A;  3RKY A;  1SET A;  1USY A;  2ZGW A;  4H2V A;  3RKW A;  4UP8 A;  4Q15 A;  4H2X A;  3FJP A;  4P75 C;  3QO5 A;  3L4G A;  5HGQ A;  3HXU A;  2J3M A;  3IG2 A;  4YRQ A;  2RHQ A;  3HXW A;  4H2S A;  3REU A;  3R07 A;  1SES A;  3RAC A;  4CH5 A;  3CMQ A;  4XTY A;  1JJC B;  4XU0 A;  4ZIB A;  1LYL A;  4RQF A;  2E65 A;  1HC7 A;  4WJ3 M;  1E24 A;  2P0L A;  3IKM B;  1QF6 A;  4P3O A;  1Z7N A;  2DXU A;  1IL2 A;  4YCW A;  1NJ6 A;  3A31 A;  2EJG A;  1PYS B;  3W3S A;  2DQ3 A;  2E41 A;  3A7U A;  1G5H A;  4CS2 A;  2QHS A;  2ZNI A;  4HWO A;  1H4Q A;  2I4N A;  1X2G A;  1B76 A;  3A5Y A;  2IY5 A;  4TVA A;  4G85 A;  1YB3 A;  3QO7 A;  4YRR A;  2C8M A;  2ART A;  1NYQ A;  1G5I A;  1EVK A;  2ZZE A;  3M4Q A;  4P3P A;  3HFZ B;  1ATI A;  2ZT5 A;  4CH4 A;  2AMC B;  3P8V A;  3RF1 A;  3RL6 A;  4XEM A;  3PCO B;  2ZR3 A;  4YRG A;  2P5I A;  1J5W A;  4P74 A;  4EX5 A;  4HWT A;  2PMF A;  4HWR A;  1SRY A;  3VQV A;  4DPG A;  3HXY A;  4YRC A;  2I4M A;  1EVL A;  5C53 B;  3WQZ A;  5C52 B;  4YRJ A;  1WQW A;  4RDX A;  4KQE A;  4CH6 A;  4KR2 A;  2Q7H A;  1NJ8 A;  2DTI A;  1WQ7 A;  1L0W A;  3G1Z A;  1WYD A;  4XU2 A;  1KMM A;  4YRM A;  4YRO A;  4E51 A;  3NET A;  1X54 A;  2C7I A;  3OD1 A;  2DVE A;  3TEH B;  4YRE A;  3IAL A;  1EOV A;  1KOG A;  4ZTU B;  1H4V B;  2IY5 B;  4TVA B;  5K1P A;  2Q5I A;  4NCX A;  4YRK A;  3HFZ A;  4YP0 A;  2DDZ A;  3V7S A;  3HFV A;  2AMC A;  2I4O A;  1ADY A;  2Q7E A;  3TEG A;  4XTV A;  3PCO A;  1W66 A;  4TVW A;  4OLF A;  4P74 C;  2Q5H A;  4H2T A;  4TQF A;  4G84 A;  1X55 A;  3HY1 A;  4UP9 A;  4H2Y A;  1FYF A;  2I4L A;  4BW9 A;  2ZT6 A;  4YDQ A;  1KMN A;  2ARU A;  2DQ0 A;  2J3L A;  4LNS A;  2DTO A;  3A7A A;  1EIY B;  4Q6G A;  2Q7G A;  1WLE A;  4CS4 A;  2RHS B;  4KR3 A;  1USY C;  2ZR2 A;  4YYE A;  4P3N A;  4X5O A;  3TEH A;  1B70 B;  1EQR A;  2E64 A;  4YRF A;  4YCV A;  4YRN A;  2E5A A;  4H2U A;  3MEY A;  4P72 A;  3L2Z A;  1E22 A;  1WU7 A;  3EFR A;  1VQZ A;  4YPF A;  3BFM A;  3HXX A;  1H4S A;  4XEO A;  3LSQ A;  2ZIN A;  3HTZ A;  1YFR A;  2ZIM A;  2QHU A;  3MF2 A;  3V8K A;  3IKL A;  3HRK A;  4XU1 A;  4TVY A;  1NJ2 A;  2ZT7 A;  3BJU A;  2ZIO A;  3I7F A;  4P75 A;  11AS A;  3A7R A;  4K88 A;  3A5Z A;  3HXV A;  2ZXF A;  3ERR A;  4CH3 A;  1EIY A;  1NNH A;  1RIQ A;  2EJF A;  2RHS A;  4PG3 A;  2CIM A;  3VQY A;  3VQX A;  1B70 A;  4RQE A;  2ZTG A;  3DSQ A;  1WNL A;  4YRL A;  2ALY B;  1NJ1 A;  2ZNJ A;  4YCU A;  4UP7 A;  4P73 A;  4TWA A;  1WPY A;  4RMF A;  4XTW A;  2HNI A;  3KFU A;  1G51 A;  1BIA A;  1E1T A;  2FYK A;  4OP0 A;  2PME A;  4WI1 A;  1YGB A;  3QNE A;  3UH0 A;  4P71 A;  1YFT A;  2DU5 A;  3PZC A;  3HXZ A;  3RKX A;  1B7Y A;  2ZZF A;  5E3I A;  4YRP A;  2DEQ A;  2EJ9 A;  3P8Y A;  3NEL A;  2E10 A;  1EFW A;  5F5W A;  1YFS A;  2G4C A;  3HRI A;  1ADJ A;  1E1O A;  2DTH A;  4HVC A;  2ODR C;  1Z7M A;  12AS A;  2ZCE A;  1X56 A;  3V8J A;  3QO8 A;  3RUX A;  2DJZ A;  4AH6 A;  3NEM A;  1BBW A;  2EL9 A;  3V8L A;  4CS3 A;  1ASZ A;  2ALY A;  1B8A A;  2CGH A;  4P73 C;  2QHT A;  4K87 A;  1QE0 A;  2ZZG A;  4HWS A;  2DZ9 A;  4WJ4 A;  4YRT A;  2CJ9 A;  2DKG A;  4H2W A;  1NJ5 A;  3VQW A;  3RIR A;  2E1H A;  3HY0 A;  4O2D A;  3E9H A;  2AKW B;  3LSS A;  4HWP A;  3RGL A; 
#chains in the Genus database with same CATH topology
 3V7C A;  3L1A A;  4P71 C;  4BWA A;  3TUP A;  2ODR D;  4YRI A;  1HTT A;  1SER A;  3QTC A;  4XTU A;  4XTZ A;  5KNN A;  3P8T A;  4XTX A;  4LVL A;  1X01 A;  4DQ2 A;  4TTV A;  4YRS A;  4TQD A;  3V7R A;  2DXT A;  3UGT A;  5K1X A;  2EWN A;  2DU7 A;  1B7Y B;  3UFG A;  4H2X B;  1C0A A;  4PHC A;  1H4T A;  1ASY A;  4H02 A;  2CJA A;  3L4G B;  1X2H A;  3A32 A;  5ELN A;  2XTI A;  2QHV A;  2RHQ B;  4EO4 A;  5C51 B;  1JJC A;  2ZT8 A;  2EAY A;  4HA8 A;  3A74 A;  4K86 A;  2E3C A;  5ELO A;  1NYR A;  4P72 C;  2CJB A;  4WF2 A;  2XGT A;  4XU3 A;  1GGM A;  2ARS A;  4ZTZ B;  3MQZ A;  2AKW A;  1HXD A;  3ICA A;  3REX A;  3LC0 A;  4L87 A;  4UPA A;  3UGQ A;  2DZC A;  1PYS A;  1N9W A;  3VBB A;  3EFS A;  3MF1 A;  3E9I A;  4J15 A;  1BBU A;  1BIB A;  3NEN A;  3M4P A;  3RKY A;  1SET A;  1USY A;  2ZGW A;  4H2V A;  3RKW A;  4UP8 A;  4Q15 A;  4H2X A;  3FJP A;  4P75 C;  3QO5 A;  4LVM A;  3L4G A;  5HGQ A;  3HXU A;  2J3M A;  3IG2 A;  4YRQ A;  2RHQ A;  3HXW A;  4H2S A;  3REU A;  3R07 A;  1SES A;  3RAC A;  4CH5 A;  3CMQ A;  4XTY A;  1JJC B;  4XU0 A;  4ZIB A;  1LYL A;  4RQF A;  2E65 A;  1HC7 A;  4WJ3 M;  1E24 A;  2P0L A;  3IKM B;  1QF6 A;  4P3O A;  1Z7N A;  2DXU A;  1IL2 A;  4YCW A;  1NJ6 A;  3A31 A;  2EJG A;  1PYS B;  3W3S A;  2DQ3 A;  2E41 A;  3A7U A;  1G5H A;  4CS2 A;  2QHS A;  2ZNI A;  4HWO A;  1H4Q A;  2I4N A;  1X2G A;  1B76 A;  3A5Y A;  2IY5 A;  4TVA A;  4G85 A;  1YB3 A;  3QO7 A;  4YRR A;  2C8M A;  2ART A;  1NYQ A;  1G5I A;  1EVK A;  2ZZE A;  3M4Q A;  4P3P A;  3HFZ B;  1ATI A;  2ZT5 A;  4CH4 A;  2AMC B;  3P8V A;  3RF1 A;  3RL6 A;  4XEM A;  3PCO B;  2ZR3 A;  4YRG A;  2P5I A;  1J5W A;  4P74 A;  4EX5 A;  4HWT A;  2PMF A;  4HWR A;  4LVK A;  1SRY A;  3VQV A;  4DPG A;  3HXY A;  4YRC A;  2I4M A;  1EVL A;  5C53 B;  3WQZ A;  5C52 B;  4YRJ A;  1WQW A;  4RDX A;  2A8E A;  4KQE A;  4CH6 A;  4KR2 A;  2Q7H A;  1NJ8 A;  2DTI A;  1WQ7 A;  1L0W A;  3G1Z A;  1WYD A;  4XU2 A;  1KMM A;  4YRM A;  4YRO A;  4E51 A;  3NET A;  1X54 A;  2C7I A;  3OD1 A;  2DVE A;  3TEH B;  4YRE A;  3IAL A;  1EOV A;  2NS6 A;  1KOG A;  4ZTU B;  1H4V B;  2IY5 B;  4TVA B;  5K1P A;  2Q5I A;  4NCX A;  4YRK A;  3HFZ A;  4YP0 A;  2DDZ A;  3V7S A;  3HFV A;  2AMC A;  2I4O A;  1ADY A;  2Q7E A;  3TEG A;  4XTV A;  3PCO A;  1W66 A;  4TVW A;  4OLF A;  4P74 C;  2Q5H A;  4H2T A;  4TQF A;  4G84 A;  1X55 A;  3HY1 A;  4UP9 A;  4H2Y A;  1FYF A;  2I4L A;  4BW9 A;  2ZT6 A;  4YDQ A;  1KMN A;  2ARU A;  2DQ0 A;  2J3L A;  4LNS A;  2DTO A;  3A7A A;  1EIY B;  4Q6G A;  2Q7G A;  1WLE A;  4CS4 A;  2RHS B;  4KR3 A;  1USY C;  2ZR2 A;  4YYE A;  4P3N A;  4X5O A;  3TEH A;  1B70 B;  1EQR A;  2E64 A;  4YRF A;  4YCV A;  4YRN A;  2E5A A;  4H2U A;  3MEY A;  4P72 A;  3L2Z A;  4LVJ A;  1E22 A;  1WU7 A;  3EFR A;  1VQZ A;  4YPF A;  3BFM A;  3HXX A;  1H4S A;  4XEO A;  3LSQ A;  2ZIN A;  3HTZ A;  1YFR A;  2ZIM A;  2QHU A;  3MF2 A;  3V8K A;  3IKL A;  3HRK A;  4XU1 A;  4TVY A;  1NJ2 A;  2ZT7 A;  3BJU A;  2ZIO A;  3I7F A;  4P75 A;  11AS A;  3A7R A;  4K88 A;  3A5Z A;  3HXV A;  2ZXF A;  3ERR A;  4CH3 A;  1EIY A;  1NNH A;  1RIQ A;  2EJF A;  4LVI A;  2RHS A;  4PG3 A;  2CIM A;  3VQY A;  4HT4 A;  3VQX A;  1B70 A;  4RQE A;  2ZTG A;  3DSQ A;  1WNL A;  4YRL A;  2ALY B;  1NJ1 A;  2ZNJ A;  4YCU A;  4UP7 A;  4P73 A;  4TWA A;  1WPY A;  4RMF A;  4XTW A;  2HNI A;  3KFU A;  1G51 A;  1BIA A;  1E1T A;  2FYK A;  4OP0 A;  2PME A;  4WI1 A;  1YGB A;  3QNE A;  3UH0 A;  4P71 A;  1YFT A;  2DU5 A;  3PZC A;  3HXZ A;  3RKX A;  1B7Y A;  2ZZF A;  5E3I A;  4YRP A;  2DEQ A;  2EJ9 A;  3P8Y A;  3NEL A;  2E10 A;  1EFW A;  5F5W A;  1YFS A;  2G4C A;  3HRI A;  1ADJ A;  1E1O A;  2DTH A;  4HVC A;  2ODR C;  1Z7M A;  12AS A;  2ZCE A;  1X56 A;  3V8J A;  3QO8 A;  3RUX A;  2DJZ A;  4AH6 A;  3NEM A;  1BBW A;  2EL9 A;  3V8L A;  4CS3 A;  1ASZ A;  2ALY A;  1B8A A;  2CGH A;  4P73 C;  2QHT A;  4K87 A;  1QE0 A;  2ZZG A;  4HWS A;  2DZ9 A;  4WJ4 A;  4YRT A;  2CJ9 A;  2DKG A;  4H2W A;  1NJ5 A;  3VQW A;  3RIR A;  2E1H A;  3HY0 A;  4O2D A;  3E9H A;  2AKW B;  3LSS A;  4HWP A;  3RGL A; 
#chains in the Genus database with same CATH homology
 3V7C A;  3L1A A;  4P71 C;  4BWA A;  3TUP A;  2ODR D;  4YRI A;  1HTT A;  1SER A;  3QTC A;  4XTU A;  4XTZ A;  5KNN A;  3P8T A;  4XTX A;  4LVL A;  1X01 A;  4DQ2 A;  4TTV A;  4YRS A;  4TQD A;  3V7R A;  2DXT A;  3UGT A;  5K1X A;  2EWN A;  2DU7 A;  1B7Y B;  3UFG A;  4H2X B;  1C0A A;  4PHC A;  1H4T A;  1ASY A;  4H02 A;  2CJA A;  3L4G B;  1X2H A;  3A32 A;  5ELN A;  2XTI A;  2QHV A;  2RHQ B;  4EO4 A;  5C51 B;  1JJC A;  2ZT8 A;  2EAY A;  4HA8 A;  3A74 A;  4K86 A;  2E3C A;  5ELO A;  1NYR A;  4P72 C;  2CJB A;  4WF2 A;  2XGT A;  4XU3 A;  1GGM A;  2ARS A;  4ZTZ B;  3MQZ A;  2AKW A;  1HXD A;  3ICA A;  3REX A;  3LC0 A;  4L87 A;  4UPA A;  3UGQ A;  2DZC A;  1PYS A;  1N9W A;  3VBB A;  3EFS A;  3MF1 A;  3E9I A;  4J15 A;  1BBU A;  1BIB A;  3NEN A;  3M4P A;  3RKY A;  1SET A;  1USY A;  2ZGW A;  4H2V A;  3RKW A;  4UP8 A;  4Q15 A;  4H2X A;  3FJP A;  4P75 C;  3QO5 A;  4LVM A;  3L4G A;  5HGQ A;  3HXU A;  2J3M A;  3IG2 A;  4YRQ A;  2RHQ A;  3HXW A;  4H2S A;  3REU A;  3R07 A;  1SES A;  3RAC A;  4CH5 A;  3CMQ A;  4XTY A;  1JJC B;  4XU0 A;  4ZIB A;  1LYL A;  4RQF A;  2E65 A;  1HC7 A;  4WJ3 M;  1E24 A;  2P0L A;  3IKM B;  1QF6 A;  4P3O A;  1Z7N A;  2DXU A;  1IL2 A;  4YCW A;  1NJ6 A;  3A31 A;  2EJG A;  1PYS B;  3W3S A;  2DQ3 A;  2E41 A;  3A7U A;  1G5H A;  4CS2 A;  2QHS A;  2ZNI A;  4HWO A;  1H4Q A;  2I4N A;  1X2G A;  1B76 A;  3A5Y A;  2IY5 A;  4TVA A;  4G85 A;  1YB3 A;  3QO7 A;  4YRR A;  2C8M A;  2ART A;  1NYQ A;  1G5I A;  1EVK A;  2ZZE A;  3M4Q A;  4P3P A;  3HFZ B;  1ATI A;  2ZT5 A;  4CH4 A;  2AMC B;  3P8V A;  3RF1 A;  3RL6 A;  4XEM A;  3PCO B;  2ZR3 A;  4YRG A;  2P5I A;  1J5W A;  4P74 A;  4EX5 A;  4HWT A;  2PMF A;  4HWR A;  4LVK A;  1SRY A;  3VQV A;  4DPG A;  3HXY A;  4YRC A;  2I4M A;  1EVL A;  5C53 B;  3WQZ A;  5C52 B;  4YRJ A;  1WQW A;  4RDX A;  2A8E A;  4KQE A;  4CH6 A;  4KR2 A;  2Q7H A;  1NJ8 A;  2DTI A;  1WQ7 A;  1L0W A;  3G1Z A;  1WYD A;  4XU2 A;  1KMM A;  4YRM A;  4YRO A;  4E51 A;  3NET A;  1X54 A;  2C7I A;  3OD1 A;  2DVE A;  3TEH B;  4YRE A;  3IAL A;  1EOV A;  2NS6 A;  1KOG A;  4ZTU B;  1H4V B;  2IY5 B;  4TVA B;  5K1P A;  2Q5I A;  4NCX A;  4YRK A;  3HFZ A;  4YP0 A;  2DDZ A;  3V7S A;  3HFV A;  2AMC A;  2I4O A;  1ADY A;  2Q7E A;  3TEG A;  4XTV A;  3PCO A;  1W66 A;  4TVW A;  4OLF A;  4P74 C;  2Q5H A;  4H2T A;  4TQF A;  4G84 A;  1X55 A;  3HY1 A;  4UP9 A;  4H2Y A;  1FYF A;  2I4L A;  4BW9 A;  2ZT6 A;  4YDQ A;  1KMN A;  2ARU A;  2DQ0 A;  2J3L A;  4LNS A;  2DTO A;  3A7A A;  1EIY B;  4Q6G A;  2Q7G A;  1WLE A;  4CS4 A;  2RHS B;  4KR3 A;  1USY C;  2ZR2 A;  4YYE A;  4P3N A;  4X5O A;  3TEH A;  1B70 B;  1EQR A;  2E64 A;  4YRF A;  4YCV A;  4YRN A;  2E5A A;  4H2U A;  3MEY A;  4P72 A;  3L2Z A;  4LVJ A;  1E22 A;  1WU7 A;  3EFR A;  1VQZ A;  4YPF A;  3BFM A;  3HXX A;  1H4S A;  4XEO A;  3LSQ A;  2ZIN A;  3HTZ A;  1YFR A;  2ZIM A;  2QHU A;  3MF2 A;  3V8K A;  3IKL A;  3HRK A;  4XU1 A;  4TVY A;  1NJ2 A;  2ZT7 A;  3BJU A;  2ZIO A;  3I7F A;  4P75 A;  11AS A;  3A7R A;  4K88 A;  3A5Z A;  3HXV A;  2ZXF A;  3ERR A;  4CH3 A;  1EIY A;  1NNH A;  1RIQ A;  2EJF A;  4LVI A;  2RHS A;  4PG3 A;  2CIM A;  3VQY A;  4HT4 A;  3VQX A;  1B70 A;  4RQE A;  2ZTG A;  3DSQ A;  1WNL A;  4YRL A;  2ALY B;  1NJ1 A;  2ZNJ A;  4YCU A;  4UP7 A;  4P73 A;  4TWA A;  1WPY A;  4RMF A;  4XTW A;  2HNI A;  3KFU A;  1G51 A;  1BIA A;  1E1T A;  2FYK A;  4OP0 A;  2PME A;  4WI1 A;  1YGB A;  3QNE A;  3UH0 A;  4P71 A;  1YFT A;  2DU5 A;  3PZC A;  3HXZ A;  3RKX A;  1B7Y A;  2ZZF A;  5E3I A;  4YRP A;  2DEQ A;  2EJ9 A;  3P8Y A;  3NEL A;  2E10 A;  1EFW A;  5F5W A;  1YFS A;  2G4C A;  3HRI A;  1ADJ A;  1E1O A;  2DTH A;  4HVC A;  2ODR C;  1Z7M A;  12AS A;  2ZCE A;  1X56 A;  3V8J A;  3QO8 A;  3RUX A;  2DJZ A;  4AH6 A;  3NEM A;  1BBW A;  2EL9 A;  3V8L A;  4CS3 A;  1ASZ A;  2ALY A;  1B8A A;  2CGH A;  4P73 C;  2QHT A;  4K87 A;  1QE0 A;  2ZZG A;  4HWS A;  2DZ9 A;  4WJ4 A;  4YRT A;  2CJ9 A;  2DKG A;  4H2W A;  1NJ5 A;  3VQW A;  3RIR A;  2E1H A;  3HY0 A;  4O2D A;  3E9H A;  2AKW B;  3LSS A;  4HWP A;  3RGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...