3HTZA

Crystal structure of the catalytic fragment of alanyl-trna synthetase in complex with l-serine: re-refined
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
457
structure length
447
Chain Sequence
b'SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKPVYSHLKELGKTSAFVGAAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
publication title Serine Paradox
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 159
structure length 447
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2009-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3htzA01
1WQ7A 3TEHB 3VQXA 1SERA 3A7UA 1HTTA 2ZT8A 3RKYA 3RKWA 12ASA 4P73C 4H2TA 5ELOA 4G84A 3V8LA 3EFSA 3PZCA 2RHQA 1B76A 3NEMA 4L87A 3V8KA 3RGLA 3L1AA 4XU0A 4KR3A 4YRTA 4WF2A 2PMEA 3RL6A 1BIAA 2QHVA 5E3IA 3A7AA 2RHQB 5F5WA 3BFMA 4XU3A 3RKXA 2ZCEA 2I4MA 2ODRD 3I7FA 2ZTGA 4WJ4A 1YB3A 2ZZEA 4YRKA 3HRKA 4P72A 4UP9A 3CMQA 3PCOA 4BWAA 2AMCA 3MF1A 1Z7NA 2DZ9A 3L2ZA 2ZNIA 2ALYA 3PCOB 3HFZA 1EVKA 2AMCB 1X2HA 3IALA 3WQZA 3HRIA 2ZXFA 4WJ3M 3ERRA 3A5YA 1NJ8A 2DEQA 4HWPA 1E1TA 4XTZA 2ALYB 1QF6A 3LC0A 3NENA 3MF2A 4CS3A 1C0AA 2E5AA 1EFWA 2QHTA 2Q7EA 2P5IA 3A5ZA 2I4OA 2C7IA 4KR2A 4H02A 1E1OA 2E41A 1ASYA 1EIYA 2ZT5A 3UH0A 2P0LA 2Q5IA 4CS4A 4RDXA 2Q7GA 4XU2A 2E64A 2ARSA 2QHSA 2I4LA 1YGBA 1B8AA 1E24A 3RUXA 3V7RA 3UGQA 3OD1A 3M4PA 2XTIA 4P71A 5K1XA 3HXWA 1X55A 2DKGA 4XEOA 4WI1A 2ARUA 4P74C 3RACA 2C8MA 3A74A 1EQRA 4UPAA 4OLFA 1ASZA 4Q6GA 1FYFA 4ZTZB 2E1HA 2E65A 4TQFA 1SETA 1J5WA 4HWSA 2J3LA 3UFGA 1X01A 3HFVA 1W66A 2PMFA 4DPGA 3FJPA 4TVYA 2CJ9A 3UGTA 2ZGWA 1LYLA 2AKWA 1WQWA 1WYDA 3RIRA 4H2UA 4YREA 2DQ0A 3QO5A 4YPFA 3LSQA 1YFSA 4EO4A 4LNSA 2DU5A 4O2DA 4K88A 4XTVA 3LSSA 3HXUA 5HGQA 3W3SA 1NYRA 4EX5A 3P8TA 3VQYA 4P73A 4YRNA 2FYKA 1BBWA 2DQ3A 4YRLA 2CGHA 4CH6A 4UP7A 1Z7MA 2Q5HA 2ZZGA 1PYSA 3HY0A 2E10A 3NETA 1G5HA 4HVCA 2RHSA 4TTVA 1PYSB 4P72C 2EAYA 4P3PA 2RHSB 4TQDA 3G1ZA 4XTXA 1BBUA 4J15A 2EWNA 4XU1A 3NELA 1NNHA 3A7RA 4YRJA 4CH4A 4H2YA 5ELNA 1WNLA 3HFZB 4G85A 3A31A 4KQEA 1BIBA 3REXA 1EVLA 3ICAA 4P3OA 4H2VA 2EJ9A 1KMMA 1H4SA 3V7CA 3VQVA 2HNIA 2IY5A 1X56A 5C52B 3DSQA 1X54A 4Q15A 1NJ6A 4YCVA 2ARTA 1L0WA 1SESA 1USYA 2J3MA 3QTCA 1H4QA 1JJCA 3V8JA 4P75A 4TVAA 4CS2A 1EIYB 3KFUA 2Q7HA 4HWRA 3E9HA 2ZR2A 4YYEA 1B7YA 4HWTA 4YROA 3BJUA 2ZINA 2DXTA 1WU7A 1B7YB 2EL9A 2CJBA 5K1PA 1EOVA 3IG2A 4TVWA 1KMNA 4PHCA 4YRGA 3HTZA 3RF1A 2ZR3A 1G5IA 2DZCA 4H2SA 2EJGA 4YDQA 2DVEA 4YRCA 4YRSA 2DU7A 1NJ1A 2AKWB 4ZIBA 3HXYA 2ZIMA 3VBBA 3VQWA 2DTOA 1HXDA 1H4VB 2ZT6A 3HXXA 4YRRA 1IL2A 1ADYA 3IKMB 1NYQA 2ZNJA 4RQFA 1N9WA 4H2XA 4PG3A 1VQZA 3HXZA 2DTHA 3QNEA 5C51B 3P8YA 2QHUA 1ADJA 4H2XB 2G4CA 4TWAA 1HC7A 2CJAA 4K87A 1G51A 2XGTA 1YFRA 4HA8A 1GGMA 4H2WA 3IKLA 2CIMA 4YCUA 1X2GA 2EJFA 1B70A 3HY1A 4CH3A 1H4TA 5C53B 3R07A 4BW9A 4XTWA 4YRQA 4K86A 4RMFA 3V7SA 3MEYA 1B70B 1WPYA 4YRPA 2DXUA 3TUPA 1NJ5A 3HXVA 4YRIA 3P8VA 4XEMA 4AH6A 3A32A 3EFRA 2DJZA 3L4GA 3TEGA 4YP0A 4E51A 4XTYA 3L4GB 1USYC 2IY5B 2DDZA 4P75C 1WLEA 4CH5A 2ZT7A 5KNNA 4DQ2A 4P71C 2ZIOA 1JJCB 4TVAB 1KOGA 4YCWA 4XTUA 2ZZFA 1YFTA 1E22A 1ATIA 4NCXA 4P3NA 3M4QA 4P74A 3REUA 11ASA 2E3CA 3E9IA 4OP0A 4YRFA 1QE0A 4X5OA 1SRYA 3QO7A 3TEHA 3QO8A 2I4NA 4ZTUB 2ODRC 1RIQA 4YRMA 4UP8A 4RQEA 1NJ2A 4HWOA 2DTIA
chains in the Genus database with same CATH superfamily
1WQ7A 3TEHB 3VQXA 1SERA 3A7UA 1HTTA 2ZT8A 3RKYA 3RKWA 12ASA 4P73C 4H2TA 5ELOA 4G84A 3V8LA 3EFSA 3PZCA 2RHQA 1B76A 3NEMA 4L87A 3V8KA 3RGLA 3L1AA 4XU0A 4KR3A 4YRTA 4WF2A 2PMEA 3RL6A 1BIAA 2QHVA 5E3IA 3A7AA 2RHQB 5F5WA 3BFMA 4XU3A 3RKXA 2ZCEA 2I4MA 2ODRD 3I7FA 2ZTGA 4WJ4A 1YB3A 2ZZEA 4YRKA 3HRKA 4P72A 4UP9A 3CMQA 3PCOA 4BWAA 2AMCA 3MF1A 1Z7NA 2DZ9A 3L2ZA 2ZNIA 2ALYA 3PCOB 3HFZA 1EVKA 2AMCB 1X2HA 3IALA 3WQZA 3HRIA 2ZXFA 4WJ3M 3ERRA 3A5YA 1NJ8A 2DEQA 4HWPA 1E1TA 4XTZA 2ALYB 1QF6A 3LC0A 3NENA 3MF2A 4CS3A 4HT4A 1C0AA 2E5AA 1EFWA 2QHTA 2Q7EA 2P5IA 3A5ZA 2I4OA 2C7IA 4KR2A 4H02A 2NS6A 1E1OA 2E41A 1ASYA 1EIYA 2ZT5A 3UH0A 2P0LA 2Q5IA 4LVJA 4CS4A 4RDXA 2Q7GA 4XU2A 2E64A 2ARSA 2QHSA 2I4LA 1YGBA 1B8AA 4LVKA 1E24A 3RUXA 3V7RA 3UGQA 3OD1A 3M4PA 2XTIA 4P71A 5K1XA 3HXWA 1X55A 2DKGA 4XEOA 4WI1A 2ARUA 4P74C 3RACA 2C8MA 3A74A 1EQRA 4UPAA 4OLFA 1ASZA 4Q6GA 1FYFA 4ZTZB 2E1HA 2E65A 4TQFA 1SETA 1J5WA 4HWSA 2J3LA 3UFGA 1X01A 3HFVA 1W66A 2PMFA 4DPGA 3FJPA 4TVYA 2CJ9A 3UGTA 2ZGWA 1LYLA 2AKWA 1WQWA 1WYDA 3RIRA 4H2UA 4YREA 2DQ0A 3QO5A 4YPFA 3LSQA 1YFSA 4EO4A 4LNSA 2DU5A 4O2DA 4K88A 4XTVA 3LSSA 3HXUA 5HGQA 3W3SA 1NYRA 4EX5A 3P8TA 3VQYA 4P73A 4YRNA 2FYKA 1BBWA 2DQ3A 4YRLA 2CGHA 4CH6A 4UP7A 1Z7MA 4LVLA 2Q5HA 2ZZGA 1PYSA 3HY0A 2E10A 3NETA 1G5HA 4HVCA 2RHSA 4TTVA 3MQZA 1PYSB 4P72C 2EAYA 4P3PA 2RHSB 4TQDA 3G1ZA 4XTXA 1BBUA 4J15A 2EWNA 4XU1A 3NELA 1NNHA 3A7RA 4YRJA 4CH4A 4H2YA 5ELNA 1WNLA 3HFZB 4G85A 3A31A 4KQEA 1BIBA 3REXA 1EVLA 3ICAA 4P3OA 4H2VA 2EJ9A 1KMMA 1H4SA 3V7CA 3VQVA 2HNIA 2IY5A 1X56A 5C52B 3DSQA 1X54A 4Q15A 1NJ6A 4YCVA 2ARTA 1L0WA 1SESA 1USYA 2J3MA 3QTCA 1H4QA 1JJCA 3V8JA 4P75A 4TVAA 4CS2A 1EIYB 3KFUA 2Q7HA 4HWRA 3E9HA 2ZR2A 4YYEA 1B7YA 4HWTA 4YROA 3BJUA 2ZINA 2DXTA 1WU7A 1B7YB 2EL9A 2CJBA 5K1PA 1EOVA 3IG2A 4TVWA 1KMNA 4PHCA 4YRGA 3HTZA 3RF1A 2ZR3A 4LVMA 1G5IA 2DZCA 4H2SA 2EJGA 4YDQA 2DVEA 4YRCA 4YRSA 2DU7A 1NJ1A 2AKWB 4ZIBA 3HXYA 2ZIMA 3VBBA 3VQWA 2DTOA 1HXDA 1H4VB 2ZT6A 3HXXA 4YRRA 2A8EA 1IL2A 1ADYA 3IKMB 1NYQA 2ZNJA 4RQFA 1N9WA 4H2XA 4PG3A 1VQZA 3HXZA 2DTHA 3QNEA 5C51B 3P8YA 2QHUA 1ADJA 4H2XB 2G4CA 4TWAA 1HC7A 2CJAA 4K87A 1G51A 2XGTA 1YFRA 4HA8A 1GGMA 4H2WA 3IKLA 2CIMA 4YCUA 1X2GA 2EJFA 1B70A 3HY1A 4CH3A 1H4TA 5C53B 3R07A 4BW9A 4XTWA 4YRQA 4K86A 4RMFA 3V7SA 3MEYA 1B70B 1WPYA 4YRPA 2DXUA 3TUPA 1NJ5A 3HXVA 4YRIA 3P8VA 4XEMA 4AH6A 3A32A 3EFRA 2DJZA 3L4GA 3TEGA 4YP0A 4E51A 4XTYA 3L4GB 1USYC 2IY5B 2DDZA 4P75C 1WLEA 4CH5A 2ZT7A 5KNNA 4DQ2A 4P71C 2ZIOA 1JJCB 4TVAB 1KOGA 4YCWA 4XTUA 2ZZFA 4LVIA 1YFTA 1E22A 1ATIA 4NCXA 4P3NA 3M4QA 4P74A 3REUA 11ASA 2E3CA 3E9IA 4OP0A 4YRFA 1QE0A 4X5OA 1SRYA 3QO7A 3TEHA 3QO8A 2I4NA 4ZTUB 2ODRC 1RIQA 4YRMA 4UP8A 4RQEA 1NJ2A 4HWOA 2DTIA
chains in the Genus database with same CATH topology
1WQ7A 3TEHB 3VQXA 1SERA 3A7UA 1HTTA 2ZT8A 3RKYA 3RKWA 12ASA 4P73C 4H2TA 5ELOA 4G84A 3V8LA 3EFSA 3PZCA 2RHQA 1B76A 3NEMA 4L87A 3V8KA 3RGLA 3L1AA 4XU0A 4KR3A 4YRTA 4WF2A 2PMEA 3RL6A 1BIAA 2QHVA 5E3IA 3A7AA 2RHQB 5F5WA 3BFMA 4XU3A 3RKXA 2ZCEA 2I4MA 2ODRD 3I7FA 2ZTGA 4WJ4A 1YB3A 2ZZEA 4YRKA 3HRKA 4P72A 4UP9A 3CMQA 3PCOA 4BWAA 2AMCA 3MF1A 1Z7NA 2DZ9A 3L2ZA 2ZNIA 2ALYA 3PCOB 3HFZA 1EVKA 2AMCB 1X2HA 3IALA 3WQZA 3HRIA 2ZXFA 4WJ3M 3ERRA 3A5YA 1NJ8A 2DEQA 4HWPA 1E1TA 4XTZA 2ALYB 1QF6A 3LC0A 3NENA 3MF2A 4CS3A 4HT4A 1C0AA 2E5AA 1EFWA 2QHTA 2Q7EA 2P5IA 3A5ZA 2I4OA 2C7IA 4KR2A 4H02A 2NS6A 1E1OA 2E41A 1ASYA 1EIYA 2ZT5A 3UH0A 2P0LA 2Q5IA 4LVJA 4CS4A 4RDXA 2Q7GA 4XU2A 2E64A 2ARSA 2QHSA 2I4LA 1YGBA 1B8AA 4LVKA 1E24A 3RUXA 3V7RA 3UGQA 3OD1A 3M4PA 2XTIA 4P71A 5K1XA 3HXWA 1X55A 2DKGA 4XEOA 4WI1A 2ARUA 4P74C 3RACA 2C8MA 3A74A 1EQRA 4UPAA 4OLFA 1ASZA 4Q6GA 1FYFA 4ZTZB 2E1HA 2E65A 4TQFA 1SETA 1J5WA 4HWSA 2J3LA 3UFGA 1X01A 3HFVA 1W66A 2PMFA 4DPGA 3FJPA 4TVYA 2CJ9A 3UGTA 2ZGWA 1LYLA 2AKWA 1WQWA 1WYDA 3RIRA 4H2UA 4YREA 2DQ0A 3QO5A 4YPFA 3LSQA 1YFSA 4EO4A 4LNSA 2DU5A 4O2DA 4K88A 4XTVA 3LSSA 3HXUA 5HGQA 3W3SA 1NYRA 4EX5A 3P8TA 3VQYA 4P73A 4YRNA 2FYKA 1BBWA 2DQ3A 4YRLA 2CGHA 4CH6A 4UP7A 1Z7MA 4LVLA 2Q5HA 2ZZGA 1PYSA 3HY0A 2E10A 3NETA 1G5HA 4HVCA 2RHSA 4TTVA 3MQZA 1PYSB 4P72C 2EAYA 4P3PA 2RHSB 4TQDA 3G1ZA 4XTXA 1BBUA 4J15A 2EWNA 4XU1A 3NELA 1NNHA 3A7RA 4YRJA 4CH4A 4H2YA 5ELNA 1WNLA 3HFZB 4G85A 3A31A 4KQEA 1BIBA 3REXA 1EVLA 3ICAA 4P3OA 4H2VA 2EJ9A 1KMMA 1H4SA 3V7CA 3VQVA 2HNIA 2IY5A 1X56A 5C52B 3DSQA 1X54A 4Q15A 1NJ6A 4YCVA 2ARTA 1L0WA 1SESA 1USYA 2J3MA 3QTCA 1H4QA 1JJCA 3V8JA 4P75A 4TVAA 4CS2A 1EIYB 3KFUA 2Q7HA 4HWRA 3E9HA 2ZR2A 4YYEA 1B7YA 4HWTA 4YROA 3BJUA 2ZINA 2DXTA 1WU7A 1B7YB 2EL9A 2CJBA 5K1PA 1EOVA 3IG2A 4TVWA 1KMNA 4PHCA 4YRGA 3HTZA 3RF1A 2ZR3A 4LVMA 1G5IA 2DZCA 4H2SA 2EJGA 4YDQA 2DVEA 4YRCA 4YRSA 2DU7A 1NJ1A 2AKWB 4ZIBA 3HXYA 2ZIMA 3VBBA 3VQWA 2DTOA 1HXDA 1H4VB 2ZT6A 3HXXA 4YRRA 2A8EA 1IL2A 1ADYA 3IKMB 1NYQA 2ZNJA 4RQFA 1N9WA 4H2XA 4PG3A 1VQZA 3HXZA 2DTHA 3QNEA 5C51B 3P8YA 2QHUA 1ADJA 4H2XB 2G4CA 4TWAA 1HC7A 2CJAA 4K87A 1G51A 2XGTA 1YFRA 4HA8A 1GGMA 4H2WA 3IKLA 2CIMA 4YCUA 1X2GA 2EJFA 1B70A 3HY1A 4CH3A 1H4TA 5C53B 3R07A 4BW9A 4XTWA 4YRQA 4K86A 4RMFA 3V7SA 3MEYA 1B70B 1WPYA 4YRPA 2DXUA 3TUPA 1NJ5A 3HXVA 4YRIA 3P8VA 4XEMA 4AH6A 3A32A 3EFRA 2DJZA 3L4GA 3TEGA 4YP0A 4E51A 4XTYA 3L4GB 1USYC 2IY5B 2DDZA 4P75C 1WLEA 4CH5A 2ZT7A 5KNNA 4DQ2A 4P71C 2ZIOA 1JJCB 4TVAB 1KOGA 4YCWA 4XTUA 2ZZFA 4LVIA 1YFTA 1E22A 1ATIA 4NCXA 4P3NA 3M4QA 4P74A 3REUA 11ASA 2E3CA 3E9IA 4OP0A 4YRFA 1QE0A 4X5OA 1SRYA 3QO7A 3TEHA 3QO8A 2I4NA 4ZTUB 2ODRC 1RIQA 4YRMA 4UP8A 4RQEA 1NJ2A 4HWOA 2DTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQ7 A;  3TEH B;  3VQX A;  1SER A;  3A7U A;  1HTT A;  2ZT8 A;  3RKY A;  3RKW A;  12AS A;  4P73 C;  4H2T A;  5ELO A;  4G84 A;  3V8L A;  3EFS A;  3PZC A;  2RHQ A;  1B76 A;  3NEM A;  4L87 A;  3V8K A;  3RGL A;  3L1A A;  4XU0 A;  4KR3 A;  4YRT A;  4WF2 A;  2PME A;  3RL6 A;  1BIA A;  2QHV A;  5E3I A;  3A7A A;  2RHQ B;  5F5W A;  3BFM A;  4XU3 A;  3RKX A;  2ZCE A;  2I4M A;  2ODR D;  3I7F A;  2ZTG A;  4WJ4 A;  1YB3 A;  2ZZE A;  4YRK A;  3HRK A;  4P72 A;  4UP9 A;  3CMQ A;  3PCO A;  4BWA A;  2AMC A;  3MF1 A;  1Z7N A;  2DZ9 A;  3L2Z A;  2ZNI A;  2ALY A;  3PCO B;  3HFZ A;  1EVK A;  2AMC B;  1X2H A;  3IAL A;  3WQZ A;  3HRI A;  2ZXF A;  4WJ3 M;  3ERR A;  3A5Y A;  1NJ8 A;  2DEQ A;  4HWP A;  1E1T A;  4XTZ A;  2ALY B;  1QF6 A;  3LC0 A;  3NEN A;  3MF2 A;  4CS3 A;  1C0A A;  2E5A A;  1EFW A;  2QHT A;  2Q7E A;  2P5I A;  3A5Z A;  2I4O A;  2C7I A;  4KR2 A;  4H02 A;  1E1O A;  2E41 A;  1ASY A;  1EIY A;  2ZT5 A;  3UH0 A;  2P0L A;  2Q5I A;  4CS4 A;  4RDX A;  2Q7G A;  4XU2 A;  2E64 A;  2ARS A;  2QHS A;  2I4L A;  1YGB A;  1B8A A;  1E24 A;  3RUX A;  3V7R A;  3UGQ A;  3OD1 A;  3M4P A;  2XTI A;  4P71 A;  5K1X A;  3HXW A;  1X55 A;  2DKG A;  4XEO A;  4WI1 A;  2ARU A;  4P74 C;  3RAC A;  2C8M A;  3A74 A;  1EQR A;  4UPA A;  4OLF A;  1ASZ A;  4Q6G A;  1FYF A;  4ZTZ B;  2E1H A;  2E65 A;  4TQF A;  1SET A;  1J5W A;  4HWS A;  2J3L A;  3UFG A;  1X01 A;  3HFV A;  1W66 A;  2PMF A;  4DPG A;  3FJP A;  4TVY A;  2CJ9 A;  3UGT A;  2ZGW A;  1LYL A;  2AKW A;  1WQW A;  1WYD A;  3RIR A;  4H2U A;  4YRE A;  2DQ0 A;  3QO5 A;  4YPF A;  3LSQ A;  1YFS A;  4EO4 A;  4LNS A;  2DU5 A;  4O2D A;  4K88 A;  4XTV A;  3LSS A;  3HXU A;  5HGQ A;  3W3S A;  1NYR A;  4EX5 A;  3P8T A;  3VQY A;  4P73 A;  4YRN A;  2FYK A;  1BBW A;  2DQ3 A;  4YRL A;  2CGH A;  4CH6 A;  4UP7 A;  1Z7M A;  2Q5H A;  2ZZG A;  1PYS A;  3HY0 A;  2E10 A;  3NET A;  1G5H A;  4HVC A;  2RHS A;  4TTV A;  1PYS B;  4P72 C;  2EAY A;  4P3P A;  2RHS B;  4TQD A;  3G1Z A;  4XTX A;  1BBU A;  4J15 A;  2EWN A;  4XU1 A;  3NEL A;  1NNH A;  3A7R A;  4YRJ A;  4CH4 A;  4H2Y A;  5ELN A;  1WNL A;  3HFZ B;  4G85 A;  3A31 A;  4KQE A;  1BIB A;  3REX A;  1EVL A;  3ICA A;  4P3O A;  4H2V A;  2EJ9 A;  1KMM A;  1H4S A;  3V7C A;  3VQV A;  2HNI A;  2IY5 A;  1X56 A;  5C52 B;  3DSQ A;  1X54 A;  4Q15 A;  1NJ6 A;  4YCV A;  2ART A;  1L0W A;  1SES A;  1USY A;  2J3M A;  3QTC A;  1H4Q A;  1JJC A;  3V8J A;  4P75 A;  4TVA A;  4CS2 A;  1EIY B;  3KFU A;  2Q7H A;  4HWR A;  3E9H A;  2ZR2 A;  4YYE A;  1B7Y A;  4HWT A;  4YRO A;  3BJU A;  2ZIN A;  2DXT A;  1WU7 A;  1B7Y B;  2EL9 A;  2CJB A;  5K1P A;  1EOV A;  3IG2 A;  4TVW A;  1KMN A;  4PHC A;  4YRG A;  3HTZ A;  3RF1 A;  2ZR3 A;  1G5I A;  2DZC A;  4H2S A;  2EJG A;  4YDQ A;  2DVE A;  4YRC A;  4YRS A;  2DU7 A;  1NJ1 A;  2AKW B;  4ZIB A;  3HXY A;  2ZIM A;  3VBB A;  3VQW A;  2DTO A;  1HXD A;  1H4V B;  2ZT6 A;  3HXX A;  4YRR A;  1IL2 A;  1ADY A;  3IKM B;  1NYQ A;  2ZNJ A;  4RQF A;  1N9W A;  4H2X A;  4PG3 A;  1VQZ A;  3HXZ A;  2DTH A;  3QNE A;  5C51 B;  3P8Y A;  2QHU A;  1ADJ A;  4H2X B;  2G4C A;  4TWA A;  1HC7 A;  2CJA A;  4K87 A;  1G51 A;  2XGT A;  1YFR A;  4HA8 A;  1GGM A;  4H2W A;  3IKL A;  2CIM A;  4YCU A;  1X2G A;  2EJF A;  1B70 A;  3HY1 A;  4CH3 A;  1H4T A;  5C53 B;  3R07 A;  4BW9 A;  4XTW A;  4YRQ A;  4K86 A;  4RMF A;  3V7S A;  3MEY A;  1B70 B;  1WPY A;  4YRP A;  2DXU A;  3TUP A;  1NJ5 A;  3HXV A;  4YRI A;  3P8V A;  4XEM A;  4AH6 A;  3A32 A;  3EFR A;  2DJZ A;  3L4G A;  3TEG A;  4YP0 A;  4E51 A;  4XTY A;  3L4G B;  1USY C;  2IY5 B;  2DDZ A;  4P75 C;  1WLE A;  4CH5 A;  2ZT7 A;  5KNN A;  4DQ2 A;  4P71 C;  2ZIO A;  1JJC B;  4TVA B;  1KOG A;  4YCW A;  4XTU A;  2ZZF A;  1YFT A;  1E22 A;  1ATI A;  4NCX A;  4P3N A;  3M4Q A;  4P74 A;  3REU A;  11AS A;  2E3C A;  3E9I A;  4OP0 A;  4YRF A;  1QE0 A;  4X5O A;  1SRY A;  3QO7 A;  3TEH A;  3QO8 A;  2I4N A;  4ZTU B;  2ODR C;  1RIQ A;  4YRM A;  4UP8 A;  4RQE A;  1NJ2 A;  4HWO A;  2DTI A; 
#chains in the Genus database with same CATH topology
 1WQ7 A;  3TEH B;  3VQX A;  1SER A;  3A7U A;  1HTT A;  2ZT8 A;  3RKY A;  3RKW A;  12AS A;  4P73 C;  4H2T A;  5ELO A;  4G84 A;  3V8L A;  3EFS A;  3PZC A;  2RHQ A;  1B76 A;  3NEM A;  4L87 A;  3V8K A;  3RGL A;  3L1A A;  4XU0 A;  4KR3 A;  4YRT A;  4WF2 A;  2PME A;  3RL6 A;  1BIA A;  2QHV A;  5E3I A;  3A7A A;  2RHQ B;  5F5W A;  3BFM A;  4XU3 A;  3RKX A;  2ZCE A;  2I4M A;  2ODR D;  3I7F A;  2ZTG A;  4WJ4 A;  1YB3 A;  2ZZE A;  4YRK A;  3HRK A;  4P72 A;  4UP9 A;  3CMQ A;  3PCO A;  4BWA A;  2AMC A;  3MF1 A;  1Z7N A;  2DZ9 A;  3L2Z A;  2ZNI A;  2ALY A;  3PCO B;  3HFZ A;  1EVK A;  2AMC B;  1X2H A;  3IAL A;  3WQZ A;  3HRI A;  2ZXF A;  4WJ3 M;  3ERR A;  3A5Y A;  1NJ8 A;  2DEQ A;  4HWP A;  1E1T A;  4XTZ A;  2ALY B;  1QF6 A;  3LC0 A;  3NEN A;  3MF2 A;  4CS3 A;  4HT4 A;  1C0A A;  2E5A A;  1EFW A;  2QHT A;  2Q7E A;  2P5I A;  3A5Z A;  2I4O A;  2C7I A;  4KR2 A;  4H02 A;  2NS6 A;  1E1O A;  2E41 A;  1ASY A;  1EIY A;  2ZT5 A;  3UH0 A;  2P0L A;  2Q5I A;  4LVJ A;  4CS4 A;  4RDX A;  2Q7G A;  4XU2 A;  2E64 A;  2ARS A;  2QHS A;  2I4L A;  1YGB A;  1B8A A;  4LVK A;  1E24 A;  3RUX A;  3V7R A;  3UGQ A;  3OD1 A;  3M4P A;  2XTI A;  4P71 A;  5K1X A;  3HXW A;  1X55 A;  2DKG A;  4XEO A;  4WI1 A;  2ARU A;  4P74 C;  3RAC A;  2C8M A;  3A74 A;  1EQR A;  4UPA A;  4OLF A;  1ASZ A;  4Q6G A;  1FYF A;  4ZTZ B;  2E1H A;  2E65 A;  4TQF A;  1SET A;  1J5W A;  4HWS A;  2J3L A;  3UFG A;  1X01 A;  3HFV A;  1W66 A;  2PMF A;  4DPG A;  3FJP A;  4TVY A;  2CJ9 A;  3UGT A;  2ZGW A;  1LYL A;  2AKW A;  1WQW A;  1WYD A;  3RIR A;  4H2U A;  4YRE A;  2DQ0 A;  3QO5 A;  4YPF A;  3LSQ A;  1YFS A;  4EO4 A;  4LNS A;  2DU5 A;  4O2D A;  4K88 A;  4XTV A;  3LSS A;  3HXU A;  5HGQ A;  3W3S A;  1NYR A;  4EX5 A;  3P8T A;  3VQY A;  4P73 A;  4YRN A;  2FYK A;  1BBW A;  2DQ3 A;  4YRL A;  2CGH A;  4CH6 A;  4UP7 A;  1Z7M A;  4LVL A;  2Q5H A;  2ZZG A;  1PYS A;  3HY0 A;  2E10 A;  3NET A;  1G5H A;  4HVC A;  2RHS A;  4TTV A;  3MQZ A;  1PYS B;  4P72 C;  2EAY A;  4P3P A;  2RHS B;  4TQD A;  3G1Z A;  4XTX A;  1BBU A;  4J15 A;  2EWN A;  4XU1 A;  3NEL A;  1NNH A;  3A7R A;  4YRJ A;  4CH4 A;  4H2Y A;  5ELN A;  1WNL A;  3HFZ B;  4G85 A;  3A31 A;  4KQE A;  1BIB A;  3REX A;  1EVL A;  3ICA A;  4P3O A;  4H2V A;  2EJ9 A;  1KMM A;  1H4S A;  3V7C A;  3VQV A;  2HNI A;  2IY5 A;  1X56 A;  5C52 B;  3DSQ A;  1X54 A;  4Q15 A;  1NJ6 A;  4YCV A;  2ART A;  1L0W A;  1SES A;  1USY A;  2J3M A;  3QTC A;  1H4Q A;  1JJC A;  3V8J A;  4P75 A;  4TVA A;  4CS2 A;  1EIY B;  3KFU A;  2Q7H A;  4HWR A;  3E9H A;  2ZR2 A;  4YYE A;  1B7Y A;  4HWT A;  4YRO A;  3BJU A;  2ZIN A;  2DXT A;  1WU7 A;  1B7Y B;  2EL9 A;  2CJB A;  5K1P A;  1EOV A;  3IG2 A;  4TVW A;  1KMN A;  4PHC A;  4YRG A;  3HTZ A;  3RF1 A;  2ZR3 A;  4LVM A;  1G5I A;  2DZC A;  4H2S A;  2EJG A;  4YDQ A;  2DVE A;  4YRC A;  4YRS A;  2DU7 A;  1NJ1 A;  2AKW B;  4ZIB A;  3HXY A;  2ZIM A;  3VBB A;  3VQW A;  2DTO A;  1HXD A;  1H4V B;  2ZT6 A;  3HXX A;  4YRR A;  2A8E A;  1IL2 A;  1ADY A;  3IKM B;  1NYQ A;  2ZNJ A;  4RQF A;  1N9W A;  4H2X A;  4PG3 A;  1VQZ A;  3HXZ A;  2DTH A;  3QNE A;  5C51 B;  3P8Y A;  2QHU A;  1ADJ A;  4H2X B;  2G4C A;  4TWA A;  1HC7 A;  2CJA A;  4K87 A;  1G51 A;  2XGT A;  1YFR A;  4HA8 A;  1GGM A;  4H2W A;  3IKL A;  2CIM A;  4YCU A;  1X2G A;  2EJF A;  1B70 A;  3HY1 A;  4CH3 A;  1H4T A;  5C53 B;  3R07 A;  4BW9 A;  4XTW A;  4YRQ A;  4K86 A;  4RMF A;  3V7S A;  3MEY A;  1B70 B;  1WPY A;  4YRP A;  2DXU A;  3TUP A;  1NJ5 A;  3HXV A;  4YRI A;  3P8V A;  4XEM A;  4AH6 A;  3A32 A;  3EFR A;  2DJZ A;  3L4G A;  3TEG A;  4YP0 A;  4E51 A;  4XTY A;  3L4G B;  1USY C;  2IY5 B;  2DDZ A;  4P75 C;  1WLE A;  4CH5 A;  2ZT7 A;  5KNN A;  4DQ2 A;  4P71 C;  2ZIO A;  1JJC B;  4TVA B;  1KOG A;  4YCW A;  4XTU A;  2ZZF A;  4LVI A;  1YFT A;  1E22 A;  1ATI A;  4NCX A;  4P3N A;  3M4Q A;  4P74 A;  3REU A;  11AS A;  2E3C A;  3E9I A;  4OP0 A;  4YRF A;  1QE0 A;  4X5O A;  1SRY A;  3QO7 A;  3TEH A;  3QO8 A;  2I4N A;  4ZTU B;  2ODR C;  1RIQ A;  4YRM A;  4UP8 A;  4RQE A;  1NJ2 A;  4HWO A;  2DTI A; 
#chains in the Genus database with same CATH homology
 1WQ7 A;  3TEH B;  3VQX A;  1SER A;  3A7U A;  1HTT A;  2ZT8 A;  3RKY A;  3RKW A;  12AS A;  4P73 C;  4H2T A;  5ELO A;  4G84 A;  3V8L A;  3EFS A;  3PZC A;  2RHQ A;  1B76 A;  3NEM A;  4L87 A;  3V8K A;  3RGL A;  3L1A A;  4XU0 A;  4KR3 A;  4YRT A;  4WF2 A;  2PME A;  3RL6 A;  1BIA A;  2QHV A;  5E3I A;  3A7A A;  2RHQ B;  5F5W A;  3BFM A;  4XU3 A;  3RKX A;  2ZCE A;  2I4M A;  2ODR D;  3I7F A;  2ZTG A;  4WJ4 A;  1YB3 A;  2ZZE A;  4YRK A;  3HRK A;  4P72 A;  4UP9 A;  3CMQ A;  3PCO A;  4BWA A;  2AMC A;  3MF1 A;  1Z7N A;  2DZ9 A;  3L2Z A;  2ZNI A;  2ALY A;  3PCO B;  3HFZ A;  1EVK A;  2AMC B;  1X2H A;  3IAL A;  3WQZ A;  3HRI A;  2ZXF A;  4WJ3 M;  3ERR A;  3A5Y A;  1NJ8 A;  2DEQ A;  4HWP A;  1E1T A;  4XTZ A;  2ALY B;  1QF6 A;  3LC0 A;  3NEN A;  3MF2 A;  4CS3 A;  4HT4 A;  1C0A A;  2E5A A;  1EFW A;  2QHT A;  2Q7E A;  2P5I A;  3A5Z A;  2I4O A;  2C7I A;  4KR2 A;  4H02 A;  2NS6 A;  1E1O A;  2E41 A;  1ASY A;  1EIY A;  2ZT5 A;  3UH0 A;  2P0L A;  2Q5I A;  4LVJ A;  4CS4 A;  4RDX A;  2Q7G A;  4XU2 A;  2E64 A;  2ARS A;  2QHS A;  2I4L A;  1YGB A;  1B8A A;  4LVK A;  1E24 A;  3RUX A;  3V7R A;  3UGQ A;  3OD1 A;  3M4P A;  2XTI A;  4P71 A;  5K1X A;  3HXW A;  1X55 A;  2DKG A;  4XEO A;  4WI1 A;  2ARU A;  4P74 C;  3RAC A;  2C8M A;  3A74 A;  1EQR A;  4UPA A;  4OLF A;  1ASZ A;  4Q6G A;  1FYF A;  4ZTZ B;  2E1H A;  2E65 A;  4TQF A;  1SET A;  1J5W A;  4HWS A;  2J3L A;  3UFG A;  1X01 A;  3HFV A;  1W66 A;  2PMF A;  4DPG A;  3FJP A;  4TVY A;  2CJ9 A;  3UGT A;  2ZGW A;  1LYL A;  2AKW A;  1WQW A;  1WYD A;  3RIR A;  4H2U A;  4YRE A;  2DQ0 A;  3QO5 A;  4YPF A;  3LSQ A;  1YFS A;  4EO4 A;  4LNS A;  2DU5 A;  4O2D A;  4K88 A;  4XTV A;  3LSS A;  3HXU A;  5HGQ A;  3W3S A;  1NYR A;  4EX5 A;  3P8T A;  3VQY A;  4P73 A;  4YRN A;  2FYK A;  1BBW A;  2DQ3 A;  4YRL A;  2CGH A;  4CH6 A;  4UP7 A;  1Z7M A;  4LVL A;  2Q5H A;  2ZZG A;  1PYS A;  3HY0 A;  2E10 A;  3NET A;  1G5H A;  4HVC A;  2RHS A;  4TTV A;  3MQZ A;  1PYS B;  4P72 C;  2EAY A;  4P3P A;  2RHS B;  4TQD A;  3G1Z A;  4XTX A;  1BBU A;  4J15 A;  2EWN A;  4XU1 A;  3NEL A;  1NNH A;  3A7R A;  4YRJ A;  4CH4 A;  4H2Y A;  5ELN A;  1WNL A;  3HFZ B;  4G85 A;  3A31 A;  4KQE A;  1BIB A;  3REX A;  1EVL A;  3ICA A;  4P3O A;  4H2V A;  2EJ9 A;  1KMM A;  1H4S A;  3V7C A;  3VQV A;  2HNI A;  2IY5 A;  1X56 A;  5C52 B;  3DSQ A;  1X54 A;  4Q15 A;  1NJ6 A;  4YCV A;  2ART A;  1L0W A;  1SES A;  1USY A;  2J3M A;  3QTC A;  1H4Q A;  1JJC A;  3V8J A;  4P75 A;  4TVA A;  4CS2 A;  1EIY B;  3KFU A;  2Q7H A;  4HWR A;  3E9H A;  2ZR2 A;  4YYE A;  1B7Y A;  4HWT A;  4YRO A;  3BJU A;  2ZIN A;  2DXT A;  1WU7 A;  1B7Y B;  2EL9 A;  2CJB A;  5K1P A;  1EOV A;  3IG2 A;  4TVW A;  1KMN A;  4PHC A;  4YRG A;  3HTZ A;  3RF1 A;  2ZR3 A;  4LVM A;  1G5I A;  2DZC A;  4H2S A;  2EJG A;  4YDQ A;  2DVE A;  4YRC A;  4YRS A;  2DU7 A;  1NJ1 A;  2AKW B;  4ZIB A;  3HXY A;  2ZIM A;  3VBB A;  3VQW A;  2DTO A;  1HXD A;  1H4V B;  2ZT6 A;  3HXX A;  4YRR A;  2A8E A;  1IL2 A;  1ADY A;  3IKM B;  1NYQ A;  2ZNJ A;  4RQF A;  1N9W A;  4H2X A;  4PG3 A;  1VQZ A;  3HXZ A;  2DTH A;  3QNE A;  5C51 B;  3P8Y A;  2QHU A;  1ADJ A;  4H2X B;  2G4C A;  4TWA A;  1HC7 A;  2CJA A;  4K87 A;  1G51 A;  2XGT A;  1YFR A;  4HA8 A;  1GGM A;  4H2W A;  3IKL A;  2CIM A;  4YCU A;  1X2G A;  2EJF A;  1B70 A;  3HY1 A;  4CH3 A;  1H4T A;  5C53 B;  3R07 A;  4BW9 A;  4XTW A;  4YRQ A;  4K86 A;  4RMF A;  3V7S A;  3MEY A;  1B70 B;  1WPY A;  4YRP A;  2DXU A;  3TUP A;  1NJ5 A;  3HXV A;  4YRI A;  3P8V A;  4XEM A;  4AH6 A;  3A32 A;  3EFR A;  2DJZ A;  3L4G A;  3TEG A;  4YP0 A;  4E51 A;  4XTY A;  3L4G B;  1USY C;  2IY5 B;  2DDZ A;  4P75 C;  1WLE A;  4CH5 A;  2ZT7 A;  5KNN A;  4DQ2 A;  4P71 C;  2ZIO A;  1JJC B;  4TVA B;  1KOG A;  4YCW A;  4XTU A;  2ZZF A;  4LVI A;  1YFT A;  1E22 A;  1ATI A;  4NCX A;  4P3N A;  3M4Q A;  4P74 A;  3REU A;  11AS A;  2E3C A;  3E9I A;  4OP0 A;  4YRF A;  1QE0 A;  4X5O A;  1SRY A;  3QO7 A;  3TEH A;  3QO8 A;  2I4N A;  4ZTU B;  2ODR C;  1RIQ A;  4YRM A;  4UP8 A;  4RQE A;  1NJ2 A;  4HWO A;  2DTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...