3HTZA

Crystal structure of the catalytic fragment of alanyl-trna synthetase in complex with l-serine: re-refined
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
457
structure length
447
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serine Paradox
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
total genus 159
structure length 447
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2009-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3htzA01
4PG3A 4J15A 1B7YA 1USYC 3QO7A 3HXZA 3IKLA 3RACA 1L0WA 4RMFA 4HWOA 3BJUA 1USYA 2QHVA 4OLFA 1KOGA 1X01A 4H2SA 3VQVA 4L87A 4XTUA 3HFZA 1G5HA 2RHSB 3L4GA 4XTWA 2ZNIA 1WLEA 4TQFA 3HXYA 1LYLA 1EIYB 4RDXA 3L4GB 3OD1A 2DTIA 3UFGA 4HA8A 3FJPA 4XEOA 4H2UA 4DPGA 3VQXA 3TEHA 2DXUA 3A7RA 4HWRA 1SESA 3A32A 1H4SA 1X55A 2Q5IA 3HTZA 2AMCA 4NCXA 1YFRA 3QNEA 3MEYA 2QHTA 4H2XA 2ZXFA 1YGBA 3HFZB 3V7CA 3V7SA 5ELOA 3A5ZA 4P74A 3RIRA 4YCUA 3HXXA 4HWPA 3NELA 1HC7A 4UP8A 4P75C 2DZ9A 4KQEA 2ZCEA 3RGLA 2DZCA 4YRGA 2I4LA 4XEMA 4XTZA 3L2ZA 4BW9A 4AH6A 1ADJA 2ARSA 2EL9A 4P3PA 4XU1A 2EJGA 5HGQA 4P3NA 2CGHA 1IL2A 1H4VB 2E1HA 2ODRD 1EVLA 4CH5A 2ZT8A 2E64A 4KR3A 4YROA 4K88A 4YRTA 3LC0A 3W3SA 3PCOB 2PMFA 3NENA 2DDZA 4CS4A 2ZGWA 4P3OA 2DQ3A 4WI1A 1KMMA 2ZIMA 3TUPA 5C52B 4CH3A 4ZTZB 4H2XB 2HNIA 1VQZA 5C51B 2DU7A 1NJ1A 3KFUA 4CH6A 4HVCA 2I4NA 2ARTA 4YPFA 2RHSA 2ZT5A 1WU7A 5KNNA 1N9WA 3RF1A 3VQWA 4P71A 2IY5A 4XU2A 3V8LA 4CS3A 3M4QA 2ZZGA 3A31A 1QF6A 2AKWB 2E65A 3VQYA 1EIYA 1E22A 2J3LA 3HRKA 2ZTGA 2IY5B 3A5YA 4YRFA 1NJ2A 3LSQA 3A7AA 2ARUA 3UH0A 3E9IA 3HXWA 1ATIA 2DJZA 1B7YB 1B70B 4YRNA 3MF1A 4YRQA 4XU3A 4RQFA 2DTHA 2CJAA 3IALA 2DVEA 2EJ9A 3PZCA 4CS2A 5ELNA 3M4PA 4WF2A 4Q15A 2QHUA 3PCOA 3EFRA 3HFVA 1RIQA 4ZTUB 4TVAA 2ZNJA 1EOVA 1YFSA 2DU5A 3IG2A 3HXUA 3L1AA 2ZT6A 3NEMA 2CJBA 1ADYA 4G85A 4Q6GA 2EJFA 4OP0A 1JJCA 1FYFA 2P0LA 4BWAA 2Q7GA 4YP0A 2DEQA 3HXVA 2AKWA 1G5IA 1E1OA 3REXA 4RQEA 4TVYA 3E9HA 3RKXA 2RHQB 2ZZEA 3UGQA 2C7IA 3BFMA 4P72C 1PYSA 1BBUA 1BIBA 12ASA 2Q7HA 2DTOA 4YRRA 4XU0A 3EFSA 4K86A 3G1ZA 3TEGA 4WJ3M 4YRIA 2AMCB 2QHSA 1NYRA 4YCWA 1ASYA 1PYSB 3HY1A 4YRPA 4P71C 3UGTA 4YRMA 5F5WA 1X2HA 2PMEA 4P73A 2ALYB 1KMNA 4H02A 1JJCB 1WNLA 4YYEA 2I4OA 2ZR2A 3HY0A 1QE0A 2DXTA 2E10A 4KR2A 1SERA 3A74A 1NJ8A 3ICAA 1J5WA 4CH4A 3I7FA 2Q7EA 2Q5HA 1YFTA 1W66A 1EQRA 2P5IA 2E3CA 3DSQA 4G84A 4TVWA 2DKGA 3NETA 2C8MA 3VBBA 1YB3A 2XGTA 4H2TA 3REUA 4WJ4A 3QTCA 1X54A 3RKWA 3CMQA 2ZINA 4TQDA 3LSSA 1B70A 1ASZA 1HXDA 1H4QA 4YRLA 1NNHA 4K87A 1Z7MA 4P75A 2XTIA 3HRIA 2ALYA 3R07A 4O2DA 4YRCA 5E3IA 1WYDA 1EVKA 3MF2A 3TEHB 2G4CA 4EO4A 1EFWA 4H2WA 1BBWA 4UPAA 1B76A 4TWAA 4E51A 1NJ6A 3QO8A 2CIMA 2EWNA 11ASA 3A7UA 3P8TA 3WQZA 3IKMB 1H4TA 1E24A 4P74C 2E41A 2ZIOA 4UP7A 4YREA 2CJ9A 4ZIBA 4YRKA 3ERRA 4XTVA 3RL6A 3RKYA 1X56A 2RHQA 1WPYA 2ZZFA 1WQWA 2E5AA 2EAYA 4PHCA 1E1TA 4X5OA 2J3MA 1SETA 1G51A 2ODRC 4UP9A 1NJ5A 1WQ7A 2FYKA 5K1PA 4TTVA 2I4MA 2DQ0A 4HWTA 2ZR3A 1B8AA 1GGMA 4H2VA 3P8VA 1X2GA 4LNSA 1NYQA 4YDQA 4YCVA 1C0AA 4P73C 4YRSA 4TVAB 1BIAA 1HTTA 5K1XA 4YRJA 4H2YA 3P8YA 1SRYA 3QO5A 4XTXA 3V8JA 4HWSA 4P72A 4EX5A 4XTYA 5C53B 1Z7NA 2ZT7A 3RUXA 4DQ2A 3V7RA 3V8KA
chains in the Genus database with same CATH superfamily
4PG3A 4J15A 1B7YA 1USYC 3QO7A 3HXZA 3IKLA 3RACA 1L0WA 4RMFA 4HWOA 3BJUA 1USYA 2QHVA 4OLFA 1KOGA 1X01A 4H2SA 3VQVA 4L87A 4XTUA 3HFZA 1G5HA 2RHSB 3L4GA 4XTWA 2ZNIA 1WLEA 4TQFA 3HXYA 1LYLA 1EIYB 4RDXA 2NS6A 3L4GB 3OD1A 2DTIA 3UFGA 4HA8A 3FJPA 4XEOA 4H2UA 4DPGA 3VQXA 3TEHA 2DXUA 3A7RA 4HWRA 1SESA 3A32A 1H4SA 1X55A 2Q5IA 3HTZA 2AMCA 4NCXA 1YFRA 3QNEA 3MEYA 2QHTA 4LVIA 4H2XA 2ZXFA 1YGBA 3HFZB 3V7CA 3V7SA 4HT4A 5ELOA 3A5ZA 4P74A 3RIRA 4YCUA 3HXXA 4HWPA 3NELA 1HC7A 4UP8A 4P75C 2DZ9A 4KQEA 2ZCEA 3RGLA 2DZCA 4YRGA 2I4LA 4XEMA 4XTZA 3L2ZA 4BW9A 4AH6A 1ADJA 2ARSA 2EL9A 4P3PA 4XU1A 2EJGA 5HGQA 4P3NA 2CGHA 1IL2A 1H4VB 3MQZA 2E1HA 2ODRD 1EVLA 4CH5A 2ZT8A 2E64A 4KR3A 4YROA 4K88A 4YRTA 3LC0A 3W3SA 3PCOB 2PMFA 3NENA 2DDZA 4CS4A 2ZGWA 4P3OA 2DQ3A 4WI1A 1KMMA 2ZIMA 3TUPA 5C52B 4CH3A 4ZTZB 4H2XB 2HNIA 1VQZA 5C51B 2DU7A 1NJ1A 3KFUA 4CH6A 4HVCA 2I4NA 2ARTA 4YPFA 2RHSA 2ZT5A 1WU7A 5KNNA 1N9WA 3RF1A 3VQWA 4P71A 2IY5A 4XU2A 3V8LA 4CS3A 3M4QA 2ZZGA 3A31A 1QF6A 2AKWB 2E65A 3VQYA 1EIYA 1E22A 2J3LA 3HRKA 2ZTGA 2IY5B 3A5YA 4YRFA 1NJ2A 3LSQA 3A7AA 2ARUA 3UH0A 3E9IA 3HXWA 1ATIA 2DJZA 1B7YB 1B70B 4YRNA 3MF1A 4YRQA 4XU3A 4RQFA 2DTHA 2CJAA 3IALA 2DVEA 2EJ9A 3PZCA 4CS2A 5ELNA 3M4PA 4WF2A 4Q15A 2QHUA 3PCOA 3EFRA 3HFVA 1RIQA 4ZTUB 4TVAA 2ZNJA 1EOVA 1YFSA 2DU5A 3IG2A 3HXUA 3L1AA 2ZT6A 4LVMA 3NEMA 2CJBA 1ADYA 4G85A 4Q6GA 2EJFA 4OP0A 1JJCA 1FYFA 2P0LA 4BWAA 2Q7GA 4YP0A 2DEQA 3HXVA 2AKWA 1G5IA 1E1OA 3REXA 4RQEA 4TVYA 3E9HA 3RKXA 2RHQB 2ZZEA 3UGQA 2C7IA 3BFMA 4P72C 1PYSA 1BBUA 1BIBA 12ASA 2Q7HA 2DTOA 4YRRA 4XU0A 3EFSA 4K86A 3G1ZA 3TEGA 4WJ3M 4YRIA 2AMCB 2QHSA 1NYRA 4YCWA 1ASYA 1PYSB 4LVKA 3HY1A 4YRPA 4P71C 3UGTA 4YRMA 5F5WA 1X2HA 2PMEA 4P73A 2ALYB 1KMNA 4LVJA 4H02A 1JJCB 1WNLA 4YYEA 2I4OA 2ZR2A 3HY0A 1QE0A 2DXTA 2E10A 4KR2A 1SERA 3A74A 1NJ8A 3ICAA 1J5WA 4CH4A 3I7FA 2Q7EA 2Q5HA 1YFTA 1W66A 1EQRA 2P5IA 2E3CA 3DSQA 4G84A 4TVWA 2DKGA 3NETA 2C8MA 3VBBA 1YB3A 2XGTA 4H2TA 3REUA 4WJ4A 3QTCA 2A8EA 1X54A 3CMQA 3RKWA 2ZINA 4TQDA 3LSSA 1B70A 1ASZA 1HXDA 1H4QA 4YRLA 1NNHA 4K87A 1Z7MA 4P75A 2XTIA 3HRIA 2ALYA 3R07A 4O2DA 4YRCA 5E3IA 1WYDA 1EVKA 3MF2A 3TEHB 2G4CA 4EO4A 1EFWA 4H2WA 1BBWA 4UPAA 1B76A 4TWAA 4E51A 1NJ6A 3QO8A 2CIMA 2EWNA 11ASA 3A7UA 3P8TA 3WQZA 3IKMB 1H4TA 1E24A 4P74C 2E41A 2ZIOA 4UP7A 4YREA 2CJ9A 4ZIBA 4YRKA 3ERRA 4XTVA 3RL6A 3RKYA 1X56A 2RHQA 1WPYA 2ZZFA 1WQWA 2E5AA 2EAYA 4PHCA 1E1TA 4X5OA 2J3MA 1SETA 1G51A 2ODRC 4UP9A 1NJ5A 1WQ7A 2FYKA 5K1PA 4TTVA 2I4MA 2DQ0A 4LVLA 4HWTA 2ZR3A 1B8AA 1GGMA 4H2VA 3P8VA 1X2GA 4LNSA 1NYQA 4YDQA 4YCVA 1C0AA 4P73C 4YRSA 4TVAB 1BIAA 1HTTA 5K1XA 4YRJA 4H2YA 3P8YA 1SRYA 3QO5A 4XTXA 3V8JA 4HWSA 4P72A 4EX5A 4XTYA 5C53B 1Z7NA 2ZT7A 3RUXA 4DQ2A 3V7RA 3V8KA
chains in the Genus database with same CATH topology
4PG3A 4J15A 1B7YA 1USYC 3QO7A 3HXZA 3IKLA 3RACA 1L0WA 4RMFA 4HWOA 3BJUA 1USYA 2QHVA 4OLFA 1KOGA 1X01A 4H2SA 3VQVA 4L87A 4XTUA 3HFZA 1G5HA 2RHSB 3L4GA 4XTWA 2ZNIA 1WLEA 4TQFA 3HXYA 1LYLA 1EIYB 4RDXA 2NS6A 3L4GB 3OD1A 2DTIA 3UFGA 4HA8A 3FJPA 4XEOA 4H2UA 4DPGA 3VQXA 3TEHA 2DXUA 3A7RA 4HWRA 1SESA 3A32A 1H4SA 1X55A 2Q5IA 3HTZA 2AMCA 4NCXA 1YFRA 3QNEA 3MEYA 2QHTA 4LVIA 4H2XA 2ZXFA 1YGBA 3HFZB 3V7CA 3V7SA 4HT4A 5ELOA 3A5ZA 4P74A 3RIRA 4YCUA 3HXXA 4HWPA 3NELA 1HC7A 4UP8A 4P75C 2DZ9A 4KQEA 2ZCEA 3RGLA 2DZCA 4YRGA 2I4LA 4XEMA 4XTZA 3L2ZA 4BW9A 4AH6A 1ADJA 2ARSA 2EL9A 4P3PA 4XU1A 2EJGA 5HGQA 4P3NA 2CGHA 1IL2A 1H4VB 3MQZA 2E1HA 2ODRD 1EVLA 4CH5A 2ZT8A 2E64A 4KR3A 4YROA 4K88A 4YRTA 3LC0A 3W3SA 3PCOB 2PMFA 3NENA 2DDZA 4CS4A 2ZGWA 4P3OA 2DQ3A 4WI1A 1KMMA 2ZIMA 3TUPA 5C52B 4CH3A 4ZTZB 4H2XB 2HNIA 1VQZA 5C51B 2DU7A 1NJ1A 3KFUA 4CH6A 4HVCA 2I4NA 2ARTA 4YPFA 2RHSA 2ZT5A 1WU7A 5KNNA 1N9WA 3RF1A 3VQWA 4P71A 2IY5A 4XU2A 3V8LA 4CS3A 3M4QA 2ZZGA 3A31A 1QF6A 2AKWB 2E65A 3VQYA 1EIYA 1E22A 2J3LA 3HRKA 2ZTGA 2IY5B 3A5YA 4YRFA 1NJ2A 3LSQA 3A7AA 2ARUA 3UH0A 3E9IA 3HXWA 1ATIA 2DJZA 1B7YB 1B70B 4YRNA 3MF1A 4YRQA 4XU3A 4RQFA 2DTHA 2CJAA 3IALA 2DVEA 2EJ9A 3PZCA 4CS2A 5ELNA 3M4PA 4WF2A 4Q15A 2QHUA 3PCOA 3EFRA 3HFVA 1RIQA 4ZTUB 4TVAA 2ZNJA 1EOVA 1YFSA 2DU5A 3IG2A 3HXUA 3L1AA 2ZT6A 4LVMA 3NEMA 2CJBA 1ADYA 4G85A 4Q6GA 2EJFA 4OP0A 1JJCA 1FYFA 2P0LA 4BWAA 2Q7GA 4YP0A 2DEQA 3HXVA 2AKWA 1G5IA 1E1OA 3REXA 4RQEA 4TVYA 3E9HA 3RKXA 2RHQB 2ZZEA 3UGQA 2C7IA 3BFMA 4P72C 1PYSA 1BBUA 1BIBA 12ASA 2Q7HA 2DTOA 4YRRA 4XU0A 3EFSA 4K86A 3G1ZA 3TEGA 4WJ3M 4YRIA 2AMCB 2QHSA 1NYRA 4YCWA 1ASYA 1PYSB 4LVKA 3HY1A 4YRPA 4P71C 3UGTA 4YRMA 5F5WA 1X2HA 2PMEA 4P73A 2ALYB 1KMNA 4LVJA 4H02A 1JJCB 1WNLA 4YYEA 2I4OA 2ZR2A 3HY0A 1QE0A 2DXTA 2E10A 4KR2A 1SERA 3A74A 1NJ8A 3ICAA 1J5WA 4CH4A 3I7FA 2Q7EA 2Q5HA 1YFTA 1W66A 1EQRA 2P5IA 2E3CA 3DSQA 4G84A 4TVWA 2DKGA 3NETA 2C8MA 3VBBA 1YB3A 2XGTA 4H2TA 3REUA 4WJ4A 3QTCA 2A8EA 1X54A 3CMQA 3RKWA 2ZINA 4TQDA 3LSSA 1B70A 1ASZA 1HXDA 1H4QA 4YRLA 1NNHA 4K87A 1Z7MA 4P75A 2XTIA 3HRIA 2ALYA 3R07A 4O2DA 4YRCA 5E3IA 1WYDA 1EVKA 3MF2A 3TEHB 2G4CA 4EO4A 1EFWA 4H2WA 1BBWA 4UPAA 1B76A 4TWAA 4E51A 1NJ6A 3QO8A 2CIMA 2EWNA 11ASA 3A7UA 3P8TA 3WQZA 3IKMB 1H4TA 1E24A 4P74C 2E41A 2ZIOA 4UP7A 4YREA 2CJ9A 4ZIBA 4YRKA 3ERRA 4XTVA 3RL6A 3RKYA 1X56A 2RHQA 1WPYA 2ZZFA 1WQWA 2E5AA 2EAYA 4PHCA 1E1TA 4X5OA 2J3MA 1SETA 1G51A 2ODRC 4UP9A 1NJ5A 1WQ7A 2FYKA 5K1PA 4TTVA 2I4MA 2DQ0A 4LVLA 4HWTA 2ZR3A 1B8AA 1GGMA 4H2VA 3P8VA 1X2GA 4LNSA 1NYQA 4YDQA 4YCVA 1C0AA 4P73C 4YRSA 4TVAB 1BIAA 1HTTA 5K1XA 4YRJA 4H2YA 3P8YA 1SRYA 3QO5A 4XTXA 3V8JA 4HWSA 4P72A 4EX5A 4XTYA 5C53B 1Z7NA 2ZT7A 3RUXA 4DQ2A 3V7RA 3V8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PG3 A;  4J15 A;  1B7Y A;  1USY C;  3QO7 A;  3HXZ A;  3IKL A;  3RAC A;  1L0W A;  4RMF A;  4HWO A;  3BJU A;  1USY A;  2QHV A;  4OLF A;  1KOG A;  1X01 A;  4H2S A;  3VQV A;  4L87 A;  4XTU A;  3HFZ A;  1G5H A;  2RHS B;  3L4G A;  4XTW A;  2ZNI A;  1WLE A;  4TQF A;  3HXY A;  1LYL A;  1EIY B;  4RDX A;  3L4G B;  3OD1 A;  2DTI A;  3UFG A;  4HA8 A;  3FJP A;  4XEO A;  4H2U A;  4DPG A;  3VQX A;  3TEH A;  2DXU A;  3A7R A;  4HWR A;  1SES A;  3A32 A;  1H4S A;  1X55 A;  2Q5I A;  3HTZ A;  2AMC A;  4NCX A;  1YFR A;  3QNE A;  3MEY A;  2QHT A;  4H2X A;  2ZXF A;  1YGB A;  3HFZ B;  3V7C A;  3V7S A;  5ELO A;  3A5Z A;  4P74 A;  3RIR A;  4YCU A;  3HXX A;  4HWP A;  3NEL A;  1HC7 A;  4UP8 A;  4P75 C;  2DZ9 A;  4KQE A;  2ZCE A;  3RGL A;  2DZC A;  4YRG A;  2I4L A;  4XEM A;  4XTZ A;  3L2Z A;  4BW9 A;  4AH6 A;  1ADJ A;  2ARS A;  2EL9 A;  4P3P A;  4XU1 A;  2EJG A;  5HGQ A;  4P3N A;  2CGH A;  1IL2 A;  1H4V B;  2E1H A;  2ODR D;  1EVL A;  4CH5 A;  2ZT8 A;  2E64 A;  4KR3 A;  4YRO A;  4K88 A;  4YRT A;  3LC0 A;  3W3S A;  3PCO B;  2PMF A;  3NEN A;  2DDZ A;  4CS4 A;  2ZGW A;  4P3O A;  2DQ3 A;  4WI1 A;  1KMM A;  2ZIM A;  3TUP A;  5C52 B;  4CH3 A;  4ZTZ B;  4H2X B;  2HNI A;  1VQZ A;  5C51 B;  2DU7 A;  1NJ1 A;  3KFU A;  4CH6 A;  4HVC A;  2I4N A;  2ART A;  4YPF A;  2RHS A;  2ZT5 A;  1WU7 A;  5KNN A;  1N9W A;  3RF1 A;  3VQW A;  4P71 A;  2IY5 A;  4XU2 A;  3V8L A;  4CS3 A;  3M4Q A;  2ZZG A;  3A31 A;  1QF6 A;  2AKW B;  2E65 A;  3VQY A;  1EIY A;  1E22 A;  2J3L A;  3HRK A;  2ZTG A;  2IY5 B;  3A5Y A;  4YRF A;  1NJ2 A;  3LSQ A;  3A7A A;  2ARU A;  3UH0 A;  3E9I A;  3HXW A;  1ATI A;  2DJZ A;  1B7Y B;  1B70 B;  4YRN A;  3MF1 A;  4YRQ A;  4XU3 A;  4RQF A;  2DTH A;  2CJA A;  3IAL A;  2DVE A;  2EJ9 A;  3PZC A;  4CS2 A;  5ELN A;  3M4P A;  4WF2 A;  4Q15 A;  2QHU A;  3PCO A;  3EFR A;  3HFV A;  1RIQ A;  4ZTU B;  4TVA A;  2ZNJ A;  1EOV A;  1YFS A;  2DU5 A;  3IG2 A;  3HXU A;  3L1A A;  2ZT6 A;  3NEM A;  2CJB A;  1ADY A;  4G85 A;  4Q6G A;  2EJF A;  4OP0 A;  1JJC A;  1FYF A;  2P0L A;  4BWA A;  2Q7G A;  4YP0 A;  2DEQ A;  3HXV A;  2AKW A;  1G5I A;  1E1O A;  3REX A;  4RQE A;  4TVY A;  3E9H A;  3RKX A;  2RHQ B;  2ZZE A;  3UGQ A;  2C7I A;  3BFM A;  4P72 C;  1PYS A;  1BBU A;  1BIB A;  12AS A;  2Q7H A;  2DTO A;  4YRR A;  4XU0 A;  3EFS A;  4K86 A;  3G1Z A;  3TEG A;  4WJ3 M;  4YRI A;  2AMC B;  2QHS A;  1NYR A;  4YCW A;  1ASY A;  1PYS B;  3HY1 A;  4YRP A;  4P71 C;  3UGT A;  4YRM A;  5F5W A;  1X2H A;  2PME A;  4P73 A;  2ALY B;  1KMN A;  4H02 A;  1JJC B;  1WNL A;  4YYE A;  2I4O A;  2ZR2 A;  3HY0 A;  1QE0 A;  2DXT A;  2E10 A;  4KR2 A;  1SER A;  3A74 A;  1NJ8 A;  3ICA A;  1J5W A;  4CH4 A;  3I7F A;  2Q7E A;  2Q5H A;  1YFT A;  1W66 A;  1EQR A;  2P5I A;  2E3C A;  3DSQ A;  4G84 A;  4TVW A;  2DKG A;  3NET A;  2C8M A;  3VBB A;  1YB3 A;  2XGT A;  4H2T A;  3REU A;  4WJ4 A;  3QTC A;  1X54 A;  3RKW A;  3CMQ A;  2ZIN A;  4TQD A;  3LSS A;  1B70 A;  1ASZ A;  1HXD A;  1H4Q A;  4YRL A;  1NNH A;  4K87 A;  1Z7M A;  4P75 A;  2XTI A;  3HRI A;  2ALY A;  3R07 A;  4O2D A;  4YRC A;  5E3I A;  1WYD A;  1EVK A;  3MF2 A;  3TEH B;  2G4C A;  4EO4 A;  1EFW A;  4H2W A;  1BBW A;  4UPA A;  1B76 A;  4TWA A;  4E51 A;  1NJ6 A;  3QO8 A;  2CIM A;  2EWN A;  11AS A;  3A7U A;  3P8T A;  3WQZ A;  3IKM B;  1H4T A;  1E24 A;  4P74 C;  2E41 A;  2ZIO A;  4UP7 A;  4YRE A;  2CJ9 A;  4ZIB A;  4YRK A;  3ERR A;  4XTV A;  3RL6 A;  3RKY A;  1X56 A;  2RHQ A;  1WPY A;  2ZZF A;  1WQW A;  2E5A A;  2EAY A;  4PHC A;  1E1T A;  4X5O A;  2J3M A;  1SET A;  1G51 A;  2ODR C;  4UP9 A;  1NJ5 A;  1WQ7 A;  2FYK A;  5K1P A;  4TTV A;  2I4M A;  2DQ0 A;  4HWT A;  2ZR3 A;  1B8A A;  1GGM A;  4H2V A;  3P8V A;  1X2G A;  4LNS A;  1NYQ A;  4YDQ A;  4YCV A;  1C0A A;  4P73 C;  4YRS A;  4TVA B;  1BIA A;  1HTT A;  5K1X A;  4YRJ A;  4H2Y A;  3P8Y A;  1SRY A;  3QO5 A;  4XTX A;  3V8J A;  4HWS A;  4P72 A;  4EX5 A;  4XTY A;  5C53 B;  1Z7N A;  2ZT7 A;  3RUX A;  4DQ2 A;  3V7R A;  3V8K A; 
#chains in the Genus database with same CATH topology
 4PG3 A;  4J15 A;  1B7Y A;  1USY C;  3QO7 A;  3HXZ A;  3IKL A;  3RAC A;  1L0W A;  4RMF A;  4HWO A;  3BJU A;  1USY A;  2QHV A;  4OLF A;  1KOG A;  1X01 A;  4H2S A;  3VQV A;  4L87 A;  4XTU A;  3HFZ A;  1G5H A;  2RHS B;  3L4G A;  4XTW A;  2ZNI A;  1WLE A;  4TQF A;  3HXY A;  1LYL A;  1EIY B;  4RDX A;  2NS6 A;  3L4G B;  3OD1 A;  2DTI A;  3UFG A;  4HA8 A;  3FJP A;  4XEO A;  4H2U A;  4DPG A;  3VQX A;  3TEH A;  2DXU A;  3A7R A;  4HWR A;  1SES A;  3A32 A;  1H4S A;  1X55 A;  2Q5I A;  3HTZ A;  2AMC A;  4NCX A;  1YFR A;  3QNE A;  3MEY A;  2QHT A;  4LVI A;  4H2X A;  2ZXF A;  1YGB A;  3HFZ B;  3V7C A;  3V7S A;  4HT4 A;  5ELO A;  3A5Z A;  4P74 A;  3RIR A;  4YCU A;  3HXX A;  4HWP A;  3NEL A;  1HC7 A;  4UP8 A;  4P75 C;  2DZ9 A;  4KQE A;  2ZCE A;  3RGL A;  2DZC A;  4YRG A;  2I4L A;  4XEM A;  4XTZ A;  3L2Z A;  4BW9 A;  4AH6 A;  1ADJ A;  2ARS A;  2EL9 A;  4P3P A;  4XU1 A;  2EJG A;  5HGQ A;  4P3N A;  2CGH A;  1IL2 A;  1H4V B;  3MQZ A;  2E1H A;  2ODR D;  1EVL A;  4CH5 A;  2ZT8 A;  2E64 A;  4KR3 A;  4YRO A;  4K88 A;  4YRT A;  3LC0 A;  3W3S A;  3PCO B;  2PMF A;  3NEN A;  2DDZ A;  4CS4 A;  2ZGW A;  4P3O A;  2DQ3 A;  4WI1 A;  1KMM A;  2ZIM A;  3TUP A;  5C52 B;  4CH3 A;  4ZTZ B;  4H2X B;  2HNI A;  1VQZ A;  5C51 B;  2DU7 A;  1NJ1 A;  3KFU A;  4CH6 A;  4HVC A;  2I4N A;  2ART A;  4YPF A;  2RHS A;  2ZT5 A;  1WU7 A;  5KNN A;  1N9W A;  3RF1 A;  3VQW A;  4P71 A;  2IY5 A;  4XU2 A;  3V8L A;  4CS3 A;  3M4Q A;  2ZZG A;  3A31 A;  1QF6 A;  2AKW B;  2E65 A;  3VQY A;  1EIY A;  1E22 A;  2J3L A;  3HRK A;  2ZTG A;  2IY5 B;  3A5Y A;  4YRF A;  1NJ2 A;  3LSQ A;  3A7A A;  2ARU A;  3UH0 A;  3E9I A;  3HXW A;  1ATI A;  2DJZ A;  1B7Y B;  1B70 B;  4YRN A;  3MF1 A;  4YRQ A;  4XU3 A;  4RQF A;  2DTH A;  2CJA A;  3IAL A;  2DVE A;  2EJ9 A;  3PZC A;  4CS2 A;  5ELN A;  3M4P A;  4WF2 A;  4Q15 A;  2QHU A;  3PCO A;  3EFR A;  3HFV A;  1RIQ A;  4ZTU B;  4TVA A;  2ZNJ A;  1EOV A;  1YFS A;  2DU5 A;  3IG2 A;  3HXU A;  3L1A A;  2ZT6 A;  4LVM A;  3NEM A;  2CJB A;  1ADY A;  4G85 A;  4Q6G A;  2EJF A;  4OP0 A;  1JJC A;  1FYF A;  2P0L A;  4BWA A;  2Q7G A;  4YP0 A;  2DEQ A;  3HXV A;  2AKW A;  1G5I A;  1E1O A;  3REX A;  4RQE A;  4TVY A;  3E9H A;  3RKX A;  2RHQ B;  2ZZE A;  3UGQ A;  2C7I A;  3BFM A;  4P72 C;  1PYS A;  1BBU A;  1BIB A;  12AS A;  2Q7H A;  2DTO A;  4YRR A;  4XU0 A;  3EFS A;  4K86 A;  3G1Z A;  3TEG A;  4WJ3 M;  4YRI A;  2AMC B;  2QHS A;  1NYR A;  4YCW A;  1ASY A;  1PYS B;  4LVK A;  3HY1 A;  4YRP A;  4P71 C;  3UGT A;  4YRM A;  5F5W A;  1X2H A;  2PME A;  4P73 A;  2ALY B;  1KMN A;  4LVJ A;  4H02 A;  1JJC B;  1WNL A;  4YYE A;  2I4O A;  2ZR2 A;  3HY0 A;  1QE0 A;  2DXT A;  2E10 A;  4KR2 A;  1SER A;  3A74 A;  1NJ8 A;  3ICA A;  1J5W A;  4CH4 A;  3I7F A;  2Q7E A;  2Q5H A;  1YFT A;  1W66 A;  1EQR A;  2P5I A;  2E3C A;  3DSQ A;  4G84 A;  4TVW A;  2DKG A;  3NET A;  2C8M A;  3VBB A;  1YB3 A;  2XGT A;  4H2T A;  3REU A;  4WJ4 A;  3QTC A;  2A8E A;  1X54 A;  3CMQ A;  3RKW A;  2ZIN A;  4TQD A;  3LSS A;  1B70 A;  1ASZ A;  1HXD A;  1H4Q A;  4YRL A;  1NNH A;  4K87 A;  1Z7M A;  4P75 A;  2XTI A;  3HRI A;  2ALY A;  3R07 A;  4O2D A;  4YRC A;  5E3I A;  1WYD A;  1EVK A;  3MF2 A;  3TEH B;  2G4C A;  4EO4 A;  1EFW A;  4H2W A;  1BBW A;  4UPA A;  1B76 A;  4TWA A;  4E51 A;  1NJ6 A;  3QO8 A;  2CIM A;  2EWN A;  11AS A;  3A7U A;  3P8T A;  3WQZ A;  3IKM B;  1H4T A;  1E24 A;  4P74 C;  2E41 A;  2ZIO A;  4UP7 A;  4YRE A;  2CJ9 A;  4ZIB A;  4YRK A;  3ERR A;  4XTV A;  3RL6 A;  3RKY A;  1X56 A;  2RHQ A;  1WPY A;  2ZZF A;  1WQW A;  2E5A A;  2EAY A;  4PHC A;  1E1T A;  4X5O A;  2J3M A;  1SET A;  1G51 A;  2ODR C;  4UP9 A;  1NJ5 A;  1WQ7 A;  2FYK A;  5K1P A;  4TTV A;  2I4M A;  2DQ0 A;  4LVL A;  4HWT A;  2ZR3 A;  1B8A A;  1GGM A;  4H2V A;  3P8V A;  1X2G A;  4LNS A;  1NYQ A;  4YDQ A;  4YCV A;  1C0A A;  4P73 C;  4YRS A;  4TVA B;  1BIA A;  1HTT A;  5K1X A;  4YRJ A;  4H2Y A;  3P8Y A;  1SRY A;  3QO5 A;  4XTX A;  3V8J A;  4HWS A;  4P72 A;  4EX5 A;  4XTY A;  5C53 B;  1Z7N A;  2ZT7 A;  3RUX A;  4DQ2 A;  3V7R A;  3V8K A; 
#chains in the Genus database with same CATH homology
 4PG3 A;  4J15 A;  1B7Y A;  1USY C;  3QO7 A;  3HXZ A;  3IKL A;  3RAC A;  1L0W A;  4RMF A;  4HWO A;  3BJU A;  1USY A;  2QHV A;  4OLF A;  1KOG A;  1X01 A;  4H2S A;  3VQV A;  4L87 A;  4XTU A;  3HFZ A;  1G5H A;  2RHS B;  3L4G A;  4XTW A;  2ZNI A;  1WLE A;  4TQF A;  3HXY A;  1LYL A;  1EIY B;  4RDX A;  2NS6 A;  3L4G B;  3OD1 A;  2DTI A;  3UFG A;  4HA8 A;  3FJP A;  4XEO A;  4H2U A;  4DPG A;  3VQX A;  3TEH A;  2DXU A;  3A7R A;  4HWR A;  1SES A;  3A32 A;  1H4S A;  1X55 A;  2Q5I A;  3HTZ A;  2AMC A;  4NCX A;  1YFR A;  3QNE A;  3MEY A;  2QHT A;  4LVI A;  4H2X A;  2ZXF A;  1YGB A;  3HFZ B;  3V7C A;  3V7S A;  4HT4 A;  5ELO A;  3A5Z A;  4P74 A;  3RIR A;  4YCU A;  3HXX A;  4HWP A;  3NEL A;  1HC7 A;  4UP8 A;  4P75 C;  2DZ9 A;  4KQE A;  2ZCE A;  3RGL A;  2DZC A;  4YRG A;  2I4L A;  4XEM A;  4XTZ A;  3L2Z A;  4BW9 A;  4AH6 A;  1ADJ A;  2ARS A;  2EL9 A;  4P3P A;  4XU1 A;  2EJG A;  5HGQ A;  4P3N A;  2CGH A;  1IL2 A;  1H4V B;  3MQZ A;  2E1H A;  2ODR D;  1EVL A;  4CH5 A;  2ZT8 A;  2E64 A;  4KR3 A;  4YRO A;  4K88 A;  4YRT A;  3LC0 A;  3W3S A;  3PCO B;  2PMF A;  3NEN A;  2DDZ A;  4CS4 A;  2ZGW A;  4P3O A;  2DQ3 A;  4WI1 A;  1KMM A;  2ZIM A;  3TUP A;  5C52 B;  4CH3 A;  4ZTZ B;  4H2X B;  2HNI A;  1VQZ A;  5C51 B;  2DU7 A;  1NJ1 A;  3KFU A;  4CH6 A;  4HVC A;  2I4N A;  2ART A;  4YPF A;  2RHS A;  2ZT5 A;  1WU7 A;  5KNN A;  1N9W A;  3RF1 A;  3VQW A;  4P71 A;  2IY5 A;  4XU2 A;  3V8L A;  4CS3 A;  3M4Q A;  2ZZG A;  3A31 A;  1QF6 A;  2AKW B;  2E65 A;  3VQY A;  1EIY A;  1E22 A;  2J3L A;  3HRK A;  2ZTG A;  2IY5 B;  3A5Y A;  4YRF A;  1NJ2 A;  3LSQ A;  3A7A A;  2ARU A;  3UH0 A;  3E9I A;  3HXW A;  1ATI A;  2DJZ A;  1B7Y B;  1B70 B;  4YRN A;  3MF1 A;  4YRQ A;  4XU3 A;  4RQF A;  2DTH A;  2CJA A;  3IAL A;  2DVE A;  2EJ9 A;  3PZC A;  4CS2 A;  5ELN A;  3M4P A;  4WF2 A;  4Q15 A;  2QHU A;  3PCO A;  3EFR A;  3HFV A;  1RIQ A;  4ZTU B;  4TVA A;  2ZNJ A;  1EOV A;  1YFS A;  2DU5 A;  3IG2 A;  3HXU A;  3L1A A;  2ZT6 A;  4LVM A;  3NEM A;  2CJB A;  1ADY A;  4G85 A;  4Q6G A;  2EJF A;  4OP0 A;  1JJC A;  1FYF A;  2P0L A;  4BWA A;  2Q7G A;  4YP0 A;  2DEQ A;  3HXV A;  2AKW A;  1G5I A;  1E1O A;  3REX A;  4RQE A;  4TVY A;  3E9H A;  3RKX A;  2RHQ B;  2ZZE A;  3UGQ A;  2C7I A;  3BFM A;  4P72 C;  1PYS A;  1BBU A;  1BIB A;  12AS A;  2Q7H A;  2DTO A;  4YRR A;  4XU0 A;  3EFS A;  4K86 A;  3G1Z A;  3TEG A;  4WJ3 M;  4YRI A;  2AMC B;  2QHS A;  1NYR A;  4YCW A;  1ASY A;  1PYS B;  4LVK A;  3HY1 A;  4YRP A;  4P71 C;  3UGT A;  4YRM A;  5F5W A;  1X2H A;  2PME A;  4P73 A;  2ALY B;  1KMN A;  4LVJ A;  4H02 A;  1JJC B;  1WNL A;  4YYE A;  2I4O A;  2ZR2 A;  3HY0 A;  1QE0 A;  2DXT A;  2E10 A;  4KR2 A;  1SER A;  3A74 A;  1NJ8 A;  3ICA A;  1J5W A;  4CH4 A;  3I7F A;  2Q7E A;  2Q5H A;  1YFT A;  1W66 A;  1EQR A;  2P5I A;  2E3C A;  3DSQ A;  4G84 A;  4TVW A;  2DKG A;  3NET A;  2C8M A;  3VBB A;  1YB3 A;  2XGT A;  4H2T A;  3REU A;  4WJ4 A;  3QTC A;  2A8E A;  1X54 A;  3CMQ A;  3RKW A;  2ZIN A;  4TQD A;  3LSS A;  1B70 A;  1ASZ A;  1HXD A;  1H4Q A;  4YRL A;  1NNH A;  4K87 A;  1Z7M A;  4P75 A;  2XTI A;  3HRI A;  2ALY A;  3R07 A;  4O2D A;  4YRC A;  5E3I A;  1WYD A;  1EVK A;  3MF2 A;  3TEH B;  2G4C A;  4EO4 A;  1EFW A;  4H2W A;  1BBW A;  4UPA A;  1B76 A;  4TWA A;  4E51 A;  1NJ6 A;  3QO8 A;  2CIM A;  2EWN A;  11AS A;  3A7U A;  3P8T A;  3WQZ A;  3IKM B;  1H4T A;  1E24 A;  4P74 C;  2E41 A;  2ZIO A;  4UP7 A;  4YRE A;  2CJ9 A;  4ZIB A;  4YRK A;  3ERR A;  4XTV A;  3RL6 A;  3RKY A;  1X56 A;  2RHQ A;  1WPY A;  2ZZF A;  1WQW A;  2E5A A;  2EAY A;  4PHC A;  1E1T A;  4X5O A;  2J3M A;  1SET A;  1G51 A;  2ODR C;  4UP9 A;  1NJ5 A;  1WQ7 A;  2FYK A;  5K1P A;  4TTV A;  2I4M A;  2DQ0 A;  4LVL A;  4HWT A;  2ZR3 A;  1B8A A;  1GGM A;  4H2V A;  3P8V A;  1X2G A;  4LNS A;  1NYQ A;  4YDQ A;  4YCV A;  1C0A A;  4P73 C;  4YRS A;  4TVA B;  1BIA A;  1HTT A;  5K1X A;  4YRJ A;  4H2Y A;  3P8Y A;  1SRY A;  3QO5 A;  4XTX A;  3V8J A;  4HWS A;  4P72 A;  4EX5 A;  4XTY A;  5C53 B;  1Z7N A;  2ZT7 A;  3RUX A;  4DQ2 A;  3V7R A;  3V8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...