3HTZA

Crystal structure of the catalytic fragment of alanyl-trna synthetase in complex with l-serine: re-refined
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
457
structure length
447
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
publication title Serine Paradox
rcsb
source organism Aquifex aeolicus
total genus 159
structure length 447
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2009-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3htzA01
4TVYA 4CS4A 2DZCA 4XU0A 1EQRA 4H2YA 1ADJA 4UP7A 4YP0A 4YRCA 3BJUA 1G5IA 1G5HA 2ZIMA 3EFSA 4P72A 3HTZA 4HWPA 4EX5A 3RKYA 5KNNA 4YRLA 2XGTA 4PG3A 4YYEA 3A7UA 1J5WA 5F5WA 3RL6A 4YRMA 4K86A 4YRRA 3WQZA 1SESA 4ZTUB 1X56A 3VQYA 4HWRA 3RIRA 2PMFA 2CGHA 3LC0A 3MF2A 2ODRD 3EFRA 4K87A 2I4LA 2ZINA 1FYFA 2E1HA 3V8LA 4XTUA 4ZTZB 3ICAA 2FYKA 3HXXA 1E22A 1ATIA 4P3NA 1B70A 4WJ3M 4HWSA 3M4PA 3HXWA 1X2HA 3VBBA 4CH3A 1USYC 4H2UA 1KMNA 2ZCEA 3V8JA 3NENA 4HWOA 4TTVA 1X2GA 3ERRA 4XTYA 1WQWA 4TWAA 3HFZB 1NJ8A 4LNSA 4WF2A 1WYDA 4EO4A 3A32A 2ZZEA 4P74C 4AH6A 4KR2A 1B70B 2EL9A 1H4SA 2EJ9A 1WU7A 5C53B 4YRQA 4CH5A 4UP9A 4HWTA 5HGQA 4TVAA 1B7YA 2EJGA 1IL2A 4YDQA 3R07A 1H4VB 3E9IA 2C8MA 3L1AA 2ZGWA 2ZZFA 4BW9A 1YGBA 3HXUA 2AKWA 3RUXA 2P0LA 2RHSA 3IALA 3PZCA 2I4OA 1BIBA 2E41A 3OD1A 3HXVA 1SETA 3E9HA 1G51A 3NEMA 1NJ6A 2CJ9A 2DXTA 1WLEA 4CH6A 1NNHA 2EAYA 3IG2A 1B7YB 3REUA 2E10A 1B76A 4H2WA 4DPGA 1USYA 2AKWB 1BBWA 2RHSB 1BBUA 4OP0A 5C51B 4XEOA 4P71C 3HY0A 2C7IA 4UPAA 3VQVA 2RHQA 4YRSA 4RQFA 2ODRC 4YRFA 3I7FA 3V7SA 3TUPA 2I4MA 1WQ7A 4H02A 4P74A 2QHUA 3UGQA 2EJFA 3V7RA 3TEHA 4P75C 4XTVA 3V8KA 1EVKA 2ZR2A 1X54A 3M4QA 4Q6GA 4RMFA 3P8YA 1X01A 4XTWA 3UH0A 3QO8A 1KMMA 3QO5A 1B8AA 1E1OA 3UFGA 4XTZA 4BWAA 2ZNIA 1HXDA 3TEHB 2CJAA 4YRPA 2IY5A 2DU5A 2ARUA 1RIQA 3CMQA 1H4QA 4YCWA 3RF1A 4CS2A 2ARTA 2QHVA 3TEGA 1EFWA 4P3OA 4TQFA 2ZR3A 1NJ2A 3PCOA 4P71A 1ASYA 4E51A 1NJ1A 4H2VA 2E3CA 3RACA 2DTHA 2Q5HA 1VQZA 1YFRA 1PYSA 5K1XA 2IY5B 3VQWA 3G1ZA 3A31A 3LSSA 3RGLA 4RQEA 4PHCA 1EVLA 4WI1A 1WPYA 4P75A 3MEYA 2DDZA 3A7RA 1Z7MA 5ELNA 3P8VA 1LYLA 3IKMB 2E65A 3HFVA 4UP8A 11ASA 2Q7HA 2ZT7A 3A7AA 2EWNA 2DJZA 2ZT8A 4Q15A 4TQDA 1C0AA 2DTOA 4TVAB 4TVWA 4YRTA 1ASZA 1EOVA 3RKXA 3A5ZA 4YCUA 4DQ2A 2CJBA 2Q5IA 3QO7A 2PMEA 1E1TA 4XU3A 3FJPA 3KFUA 3HXYA 2AMCA 1NYQA 4KQEA 4WJ4A 4O2DA 4P73C 4H2TA 1GGMA 2E64A 2DXUA 1NYRA 2I4NA 1JJCA 2ZT6A 4XTXA 2ZZGA 1YFTA 2DEQA 4RDXA 2RHQB 2ZNJA 2DVEA 4G85A 3HY1A 4CS3A 2AMCB 4H2XA 1Z7NA 2ARSA 4XU2A 4XEMA 4YRJA 4P3PA 4YRIA 3V7CA 1SRYA 1SERA 1KOGA 4KR3A 4H2SA 3REXA 1JJCB 2DKGA 3HFZA 3QTCA 1ADYA 4YROA 4YREA 3LSQA 4X5OA 2DZ9A 4K88A 1EIYA 3IKLA 3NETA 3A5YA 1YB3A 3P8TA 5E3IA 3L4GA 4YRGA 3UGTA 4HVCA 2ZT5A 4H2XB 1H4TA 1E24A 3QNEA 3VQXA 2ZTGA 2P5IA 4XU1A 2ALYA 4P72C 5K1PA 3BFMA 3RKWA 1QE0A 2DQ3A 4HA8A 2ZIOA 4P73A 3NELA 5C52B 1EIYB 2ZXFA 1HC7A 4CH4A 2QHTA 1HTTA 4J15A 4G84A 3L4GB 1WNLA 2DU7A 2G4CA 3PCOB 2J3LA 2CIMA 3A74A 1QF6A 4NCXA 4YRNA 2J3MA 2Q7EA 1N9WA 2ALYB 2DTIA 2Q7GA 1X55A 1PYSB 1YFSA 2HNIA 4YCVA 3L2ZA 1NJ5A 2DQ0A 1W66A 4YRKA 1BIAA 3HRKA 3HXZA 3DSQA 3HRIA 1L0WA 2E5AA 4OLFA 4YPFA 3MF1A 4L87A 12ASA 4ZIBA 5ELOA 3W3SA 2XTIA 2QHSA
chains in the Genus database with same CATH superfamily
4TVYA 4CS4A 2DZCA 4XU0A 1EQRA 4H2YA 1ADJA 4UP7A 4YP0A 4YRCA 3BJUA 1G5IA 1G5HA 2ZIMA 3EFSA 4P72A 3HTZA 4HWPA 4EX5A 3RKYA 5KNNA 4YRLA 2XGTA 4HT4A 4PG3A 4YYEA 3A7UA 1J5WA 5F5WA 3RL6A 4YRMA 4K86A 4YRRA 3WQZA 1SESA 4ZTUB 1X56A 3VQYA 4HWRA 3RIRA 2PMFA 2CGHA 3LC0A 3MF2A 2ODRD 3EFRA 4K87A 2I4LA 2ZINA 1FYFA 2E1HA 3V8LA 4XTUA 4ZTZB 3ICAA 2FYKA 3HXXA 1E22A 1ATIA 4P3NA 1B70A 4WJ3M 4HWSA 3M4PA 3HXWA 1X2HA 3VBBA 4CH3A 1USYC 4H2UA 1KMNA 2ZCEA 3V8JA 3NENA 4HWOA 2NS6A 4TTVA 1X2GA 3ERRA 4XTYA 1WQWA 4TWAA 3HFZB 4LVIA 1NJ8A 4LNSA 4WF2A 1WYDA 4LVKA 4EO4A 3A32A 2ZZEA 4P74C 4AH6A 4KR2A 1B70B 2EL9A 1H4SA 2EJ9A 1WU7A 5C53B 4YRQA 4CH5A 4LVJA 4UP9A 4HWTA 5HGQA 4TVAA 1B7YA 2EJGA 1IL2A 4YDQA 3R07A 1H4VB 3E9IA 2C8MA 3L1AA 2ZGWA 2ZZFA 4BW9A 1YGBA 3HXUA 2AKWA 3RUXA 2P0LA 2RHSA 3IALA 3PZCA 2I4OA 1BIBA 2E41A 3OD1A 3HXVA 1SETA 3E9HA 4LVMA 1G51A 3NEMA 1NJ6A 2CJ9A 2DXTA 1WLEA 4CH6A 1NNHA 2EAYA 3IG2A 1B7YB 3REUA 2E10A 1B76A 4H2WA 4DPGA 1USYA 2AKWB 1BBWA 2RHSB 1BBUA 4OP0A 5C51B 4XEOA 4P71C 3HY0A 2C7IA 4UPAA 3VQVA 2RHQA 4YRSA 4RQFA 2ODRC 4YRFA 3I7FA 3V7SA 3TUPA 2I4MA 1WQ7A 4H02A 4P74A 2QHUA 3UGQA 2EJFA 3V7RA 3TEHA 4P75C 4XTVA 3V8KA 1EVKA 2ZR2A 1X54A 3M4QA 4Q6GA 4RMFA 3P8YA 1X01A 4XTWA 3UH0A 3QO8A 1KMMA 3QO5A 1B8AA 1E1OA 3UFGA 4XTZA 4BWAA 2ZNIA 2A8EA 1HXDA 3TEHB 2CJAA 4YRPA 2IY5A 2DU5A 2ARUA 1RIQA 3CMQA 1H4QA 4YCWA 3RF1A 4CS2A 2ARTA 2QHVA 3TEGA 1EFWA 4P3OA 4TQFA 2ZR3A 1NJ2A 3PCOA 4P71A 1ASYA 4E51A 1NJ1A 4H2VA 2E3CA 3RACA 2DTHA 2Q5HA 1VQZA 1YFRA 1PYSA 5K1XA 2IY5B 3VQWA 3G1ZA 3A31A 3LSSA 3RGLA 4RQEA 4PHCA 1EVLA 4WI1A 1WPYA 4P75A 3MEYA 2DDZA 3A7RA 1Z7MA 5ELNA 3P8VA 1LYLA 3IKMB 2E65A 3HFVA 4UP8A 11ASA 2Q7HA 2ZT7A 3A7AA 2EWNA 2DJZA 2ZT8A 4Q15A 4TQDA 1C0AA 2DTOA 4TVAB 4TVWA 4YRTA 1ASZA 1EOVA 3RKXA 3A5ZA 4YCUA 4DQ2A 2CJBA 2Q5IA 3QO7A 2PMEA 1E1TA 4XU3A 3FJPA 3KFUA 3HXYA 2AMCA 1NYQA 4KQEA 4WJ4A 4O2DA 4P73C 4H2TA 1GGMA 2E64A 2DXUA 1NYRA 2I4NA 1JJCA 2ZT6A 4XTXA 2ZZGA 1YFTA 2DEQA 4RDXA 2RHQB 2ZNJA 2DVEA 4G85A 3HY1A 4CS3A 2AMCB 4H2XA 1Z7NA 2ARSA 4XU2A 4XEMA 4YRJA 4P3PA 4YRIA 3V7CA 1SRYA 1SERA 1KOGA 4KR3A 4H2SA 3REXA 1JJCB 2DKGA 3HFZA 3QTCA 1ADYA 4YROA 4YREA 3LSQA 4X5OA 2DZ9A 4K88A 1EIYA 3IKLA 3NETA 3A5YA 1YB3A 3P8TA 5E3IA 3L4GA 4YRGA 3UGTA 4HVCA 2ZT5A 4H2XB 1H4TA 1E24A 3QNEA 3VQXA 2ZTGA 2P5IA 4XU1A 3MQZA 2ALYA 4P72C 5K1PA 3BFMA 3RKWA 1QE0A 2DQ3A 4HA8A 2ZIOA 4P73A 3NELA 5C52B 1EIYB 2ZXFA 1HC7A 4CH4A 2QHTA 1HTTA 4J15A 4G84A 3L4GB 1WNLA 2DU7A 2G4CA 3PCOB 2J3LA 2CIMA 3A74A 4LVLA 1QF6A 4NCXA 4YRNA 2J3MA 2Q7EA 1N9WA 2ALYB 2DTIA 2Q7GA 1X55A 1PYSB 1YFSA 2HNIA 4YCVA 3L2ZA 1NJ5A 2DQ0A 1W66A 4YRKA 1BIAA 3HRKA 3HXZA 3DSQA 3HRIA 1L0WA 2E5AA 4OLFA 4YPFA 3MF1A 4L87A 12ASA 4ZIBA 5ELOA 3W3SA 2XTIA 2QHSA
chains in the Genus database with same CATH topology
4TVYA 4CS4A 2DZCA 4XU0A 1EQRA 4H2YA 1ADJA 4UP7A 4YP0A 4YRCA 3BJUA 1G5IA 1G5HA 2ZIMA 3EFSA 4P72A 3HTZA 4HWPA 4EX5A 3RKYA 5KNNA 4YRLA 2XGTA 4HT4A 4PG3A 4YYEA 3A7UA 1J5WA 5F5WA 3RL6A 4YRMA 4K86A 4YRRA 3WQZA 1SESA 4ZTUB 1X56A 3VQYA 4HWRA 3RIRA 2PMFA 2CGHA 3LC0A 3MF2A 2ODRD 3EFRA 4K87A 2I4LA 2ZINA 1FYFA 2E1HA 3V8LA 4XTUA 4ZTZB 3ICAA 2FYKA 3HXXA 1E22A 1ATIA 4P3NA 1B70A 4WJ3M 4HWSA 3M4PA 3HXWA 1X2HA 3VBBA 4CH3A 1USYC 4H2UA 1KMNA 2ZCEA 3V8JA 3NENA 4HWOA 2NS6A 4TTVA 1X2GA 3ERRA 4XTYA 1WQWA 4TWAA 3HFZB 4LVIA 1NJ8A 4LNSA 4WF2A 1WYDA 4LVKA 4EO4A 3A32A 2ZZEA 4P74C 4AH6A 4KR2A 1B70B 2EL9A 1H4SA 2EJ9A 1WU7A 5C53B 4YRQA 4CH5A 4LVJA 4UP9A 4HWTA 5HGQA 4TVAA 1B7YA 2EJGA 1IL2A 4YDQA 3R07A 1H4VB 3E9IA 2C8MA 3L1AA 2ZGWA 2ZZFA 4BW9A 1YGBA 3HXUA 2AKWA 3RUXA 2P0LA 2RHSA 3IALA 3PZCA 2I4OA 1BIBA 2E41A 3OD1A 3HXVA 1SETA 3E9HA 4LVMA 1G51A 3NEMA 1NJ6A 2CJ9A 2DXTA 1WLEA 4CH6A 1NNHA 2EAYA 3IG2A 1B7YB 3REUA 2E10A 1B76A 4H2WA 4DPGA 1USYA 2AKWB 1BBWA 2RHSB 1BBUA 4OP0A 5C51B 4XEOA 4P71C 3HY0A 2C7IA 4UPAA 3VQVA 2RHQA 4YRSA 4RQFA 2ODRC 4YRFA 3I7FA 3V7SA 3TUPA 2I4MA 1WQ7A 4H02A 4P74A 2QHUA 3UGQA 2EJFA 3V7RA 3TEHA 4P75C 4XTVA 3V8KA 1EVKA 2ZR2A 1X54A 3M4QA 4Q6GA 4RMFA 3P8YA 1X01A 4XTWA 3UH0A 3QO8A 1KMMA 3QO5A 1B8AA 1E1OA 3UFGA 4XTZA 4BWAA 2ZNIA 2A8EA 1HXDA 3TEHB 2CJAA 4YRPA 2IY5A 2DU5A 2ARUA 1RIQA 3CMQA 1H4QA 4YCWA 3RF1A 4CS2A 2ARTA 2QHVA 3TEGA 1EFWA 4P3OA 4TQFA 2ZR3A 1NJ2A 3PCOA 4P71A 1ASYA 4E51A 1NJ1A 4H2VA 2E3CA 3RACA 2DTHA 2Q5HA 1VQZA 1YFRA 1PYSA 5K1XA 2IY5B 3VQWA 3G1ZA 3A31A 3LSSA 3RGLA 4RQEA 4PHCA 1EVLA 4WI1A 1WPYA 4P75A 3MEYA 2DDZA 3A7RA 1Z7MA 5ELNA 3P8VA 1LYLA 3IKMB 2E65A 3HFVA 4UP8A 11ASA 2Q7HA 2ZT7A 3A7AA 2EWNA 2DJZA 2ZT8A 4Q15A 4TQDA 1C0AA 2DTOA 4TVAB 4TVWA 4YRTA 1ASZA 1EOVA 3RKXA 3A5ZA 4YCUA 4DQ2A 2CJBA 2Q5IA 3QO7A 2PMEA 1E1TA 4XU3A 3FJPA 3KFUA 3HXYA 2AMCA 1NYQA 4KQEA 4WJ4A 4O2DA 4P73C 4H2TA 1GGMA 2E64A 2DXUA 1NYRA 2I4NA 1JJCA 2ZT6A 4XTXA 2ZZGA 1YFTA 2DEQA 4RDXA 2RHQB 2ZNJA 2DVEA 4G85A 3HY1A 4CS3A 2AMCB 4H2XA 1Z7NA 2ARSA 4XU2A 4XEMA 4YRJA 4P3PA 4YRIA 3V7CA 1SRYA 1SERA 1KOGA 4KR3A 4H2SA 3REXA 1JJCB 2DKGA 3HFZA 3QTCA 1ADYA 4YROA 4YREA 3LSQA 4X5OA 2DZ9A 4K88A 1EIYA 3IKLA 3NETA 3A5YA 1YB3A 3P8TA 5E3IA 3L4GA 4YRGA 3UGTA 4HVCA 2ZT5A 4H2XB 1H4TA 1E24A 3QNEA 3VQXA 2ZTGA 2P5IA 4XU1A 3MQZA 2ALYA 4P72C 5K1PA 3BFMA 3RKWA 1QE0A 2DQ3A 4HA8A 2ZIOA 4P73A 3NELA 5C52B 1EIYB 2ZXFA 1HC7A 4CH4A 2QHTA 1HTTA 4J15A 4G84A 3L4GB 1WNLA 2DU7A 2G4CA 3PCOB 2J3LA 2CIMA 3A74A 4LVLA 1QF6A 4NCXA 4YRNA 2J3MA 2Q7EA 1N9WA 2ALYB 2DTIA 2Q7GA 1X55A 1PYSB 1YFSA 2HNIA 4YCVA 3L2ZA 1NJ5A 2DQ0A 1W66A 4YRKA 1BIAA 3HRKA 3HXZA 3DSQA 3HRIA 1L0WA 2E5AA 4OLFA 4YPFA 3MF1A 4L87A 12ASA 4ZIBA 5ELOA 3W3SA 2XTIA 2QHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TVY A;  4CS4 A;  2DZC A;  4XU0 A;  1EQR A;  4H2Y A;  1ADJ A;  4UP7 A;  4YP0 A;  4YRC A;  3BJU A;  1G5I A;  1G5H A;  2ZIM A;  3EFS A;  4P72 A;  3HTZ A;  4HWP A;  4EX5 A;  3RKY A;  5KNN A;  4YRL A;  2XGT A;  4PG3 A;  4YYE A;  3A7U A;  1J5W A;  5F5W A;  3RL6 A;  4YRM A;  4K86 A;  4YRR A;  3WQZ A;  1SES A;  4ZTU B;  1X56 A;  3VQY A;  4HWR A;  3RIR A;  2PMF A;  2CGH A;  3LC0 A;  3MF2 A;  2ODR D;  3EFR A;  4K87 A;  2I4L A;  2ZIN A;  1FYF A;  2E1H A;  3V8L A;  4XTU A;  4ZTZ B;  3ICA A;  2FYK A;  3HXX A;  1E22 A;  1ATI A;  4P3N A;  1B70 A;  4WJ3 M;  4HWS A;  3M4P A;  3HXW A;  1X2H A;  3VBB A;  4CH3 A;  1USY C;  4H2U A;  1KMN A;  2ZCE A;  3V8J A;  3NEN A;  4HWO A;  4TTV A;  1X2G A;  3ERR A;  4XTY A;  1WQW A;  4TWA A;  3HFZ B;  1NJ8 A;  4LNS A;  4WF2 A;  1WYD A;  4EO4 A;  3A32 A;  2ZZE A;  4P74 C;  4AH6 A;  4KR2 A;  1B70 B;  2EL9 A;  1H4S A;  2EJ9 A;  1WU7 A;  5C53 B;  4YRQ A;  4CH5 A;  4UP9 A;  4HWT A;  5HGQ A;  4TVA A;  1B7Y A;  2EJG A;  1IL2 A;  4YDQ A;  3R07 A;  1H4V B;  3E9I A;  2C8M A;  3L1A A;  2ZGW A;  2ZZF A;  4BW9 A;  1YGB A;  3HXU A;  2AKW A;  3RUX A;  2P0L A;  2RHS A;  3IAL A;  3PZC A;  2I4O A;  1BIB A;  2E41 A;  3OD1 A;  3HXV A;  1SET A;  3E9H A;  1G51 A;  3NEM A;  1NJ6 A;  2CJ9 A;  2DXT A;  1WLE A;  4CH6 A;  1NNH A;  2EAY A;  3IG2 A;  1B7Y B;  3REU A;  2E10 A;  1B76 A;  4H2W A;  4DPG A;  1USY A;  2AKW B;  1BBW A;  2RHS B;  1BBU A;  4OP0 A;  5C51 B;  4XEO A;  4P71 C;  3HY0 A;  2C7I A;  4UPA A;  3VQV A;  2RHQ A;  4YRS A;  4RQF A;  2ODR C;  4YRF A;  3I7F A;  3V7S A;  3TUP A;  2I4M A;  1WQ7 A;  4H02 A;  4P74 A;  2QHU A;  3UGQ A;  2EJF A;  3V7R A;  3TEH A;  4P75 C;  4XTV A;  3V8K A;  1EVK A;  2ZR2 A;  1X54 A;  3M4Q A;  4Q6G A;  4RMF A;  3P8Y A;  1X01 A;  4XTW A;  3UH0 A;  3QO8 A;  1KMM A;  3QO5 A;  1B8A A;  1E1O A;  3UFG A;  4XTZ A;  4BWA A;  2ZNI A;  1HXD A;  3TEH B;  2CJA A;  4YRP A;  2IY5 A;  2DU5 A;  2ARU A;  1RIQ A;  3CMQ A;  1H4Q A;  4YCW A;  3RF1 A;  4CS2 A;  2ART A;  2QHV A;  3TEG A;  1EFW A;  4P3O A;  4TQF A;  2ZR3 A;  1NJ2 A;  3PCO A;  4P71 A;  1ASY A;  4E51 A;  1NJ1 A;  4H2V A;  2E3C A;  3RAC A;  2DTH A;  2Q5H A;  1VQZ A;  1YFR A;  1PYS A;  5K1X A;  2IY5 B;  3VQW A;  3G1Z A;  3A31 A;  3LSS A;  3RGL A;  4RQE A;  4PHC A;  1EVL A;  4WI1 A;  1WPY A;  4P75 A;  3MEY A;  2DDZ A;  3A7R A;  1Z7M A;  5ELN A;  3P8V A;  1LYL A;  3IKM B;  2E65 A;  3HFV A;  4UP8 A;  11AS A;  2Q7H A;  2ZT7 A;  3A7A A;  2EWN A;  2DJZ A;  2ZT8 A;  4Q15 A;  4TQD A;  1C0A A;  2DTO A;  4TVA B;  4TVW A;  4YRT A;  1ASZ A;  1EOV A;  3RKX A;  3A5Z A;  4YCU A;  4DQ2 A;  2CJB A;  2Q5I A;  3QO7 A;  2PME A;  1E1T A;  4XU3 A;  3FJP A;  3KFU A;  3HXY A;  2AMC A;  1NYQ A;  4KQE A;  4WJ4 A;  4O2D A;  4P73 C;  4H2T A;  1GGM A;  2E64 A;  2DXU A;  1NYR A;  2I4N A;  1JJC A;  2ZT6 A;  4XTX A;  2ZZG A;  1YFT A;  2DEQ A;  4RDX A;  2RHQ B;  2ZNJ A;  2DVE A;  4G85 A;  3HY1 A;  4CS3 A;  2AMC B;  4H2X A;  1Z7N A;  2ARS A;  4XU2 A;  4XEM A;  4YRJ A;  4P3P A;  4YRI A;  3V7C A;  1SRY A;  1SER A;  1KOG A;  4KR3 A;  4H2S A;  3REX A;  1JJC B;  2DKG A;  3HFZ A;  3QTC A;  1ADY A;  4YRO A;  4YRE A;  3LSQ A;  4X5O A;  2DZ9 A;  4K88 A;  1EIY A;  3IKL A;  3NET A;  3A5Y A;  1YB3 A;  3P8T A;  5E3I A;  3L4G A;  4YRG A;  3UGT A;  4HVC A;  2ZT5 A;  4H2X B;  1H4T A;  1E24 A;  3QNE A;  3VQX A;  2ZTG A;  2P5I A;  4XU1 A;  2ALY A;  4P72 C;  5K1P A;  3BFM A;  3RKW A;  1QE0 A;  2DQ3 A;  4HA8 A;  2ZIO A;  4P73 A;  3NEL A;  5C52 B;  1EIY B;  2ZXF A;  1HC7 A;  4CH4 A;  2QHT A;  1HTT A;  4J15 A;  4G84 A;  3L4G B;  1WNL A;  2DU7 A;  2G4C A;  3PCO B;  2J3L A;  2CIM A;  3A74 A;  1QF6 A;  4NCX A;  4YRN A;  2J3M A;  2Q7E A;  1N9W A;  2ALY B;  2DTI A;  2Q7G A;  1X55 A;  1PYS B;  1YFS A;  2HNI A;  4YCV A;  3L2Z A;  1NJ5 A;  2DQ0 A;  1W66 A;  4YRK A;  1BIA A;  3HRK A;  3HXZ A;  3DSQ A;  3HRI A;  1L0W A;  2E5A A;  4OLF A;  4YPF A;  3MF1 A;  4L87 A;  12AS A;  4ZIB A;  5ELO A;  3W3S A;  2XTI A;  2QHS A; 
#chains in the Genus database with same CATH topology
 4TVY A;  4CS4 A;  2DZC A;  4XU0 A;  1EQR A;  4H2Y A;  1ADJ A;  4UP7 A;  4YP0 A;  4YRC A;  3BJU A;  1G5I A;  1G5H A;  2ZIM A;  3EFS A;  4P72 A;  3HTZ A;  4HWP A;  4EX5 A;  3RKY A;  5KNN A;  4YRL A;  2XGT A;  4HT4 A;  4PG3 A;  4YYE A;  3A7U A;  1J5W A;  5F5W A;  3RL6 A;  4YRM A;  4K86 A;  4YRR A;  3WQZ A;  1SES A;  4ZTU B;  1X56 A;  3VQY A;  4HWR A;  3RIR A;  2PMF A;  2CGH A;  3LC0 A;  3MF2 A;  2ODR D;  3EFR A;  4K87 A;  2I4L A;  2ZIN A;  1FYF A;  2E1H A;  3V8L A;  4XTU A;  4ZTZ B;  3ICA A;  2FYK A;  3HXX A;  1E22 A;  1ATI A;  4P3N A;  1B70 A;  4WJ3 M;  4HWS A;  3M4P A;  3HXW A;  1X2H A;  3VBB A;  4CH3 A;  1USY C;  4H2U A;  1KMN A;  2ZCE A;  3V8J A;  3NEN A;  4HWO A;  2NS6 A;  4TTV A;  1X2G A;  3ERR A;  4XTY A;  1WQW A;  4TWA A;  3HFZ B;  4LVI A;  1NJ8 A;  4LNS A;  4WF2 A;  1WYD A;  4LVK A;  4EO4 A;  3A32 A;  2ZZE A;  4P74 C;  4AH6 A;  4KR2 A;  1B70 B;  2EL9 A;  1H4S A;  2EJ9 A;  1WU7 A;  5C53 B;  4YRQ A;  4CH5 A;  4LVJ A;  4UP9 A;  4HWT A;  5HGQ A;  4TVA A;  1B7Y A;  2EJG A;  1IL2 A;  4YDQ A;  3R07 A;  1H4V B;  3E9I A;  2C8M A;  3L1A A;  2ZGW A;  2ZZF A;  4BW9 A;  1YGB A;  3HXU A;  2AKW A;  3RUX A;  2P0L A;  2RHS A;  3IAL A;  3PZC A;  2I4O A;  1BIB A;  2E41 A;  3OD1 A;  3HXV A;  1SET A;  3E9H A;  4LVM A;  1G51 A;  3NEM A;  1NJ6 A;  2CJ9 A;  2DXT A;  1WLE A;  4CH6 A;  1NNH A;  2EAY A;  3IG2 A;  1B7Y B;  3REU A;  2E10 A;  1B76 A;  4H2W A;  4DPG A;  1USY A;  2AKW B;  1BBW A;  2RHS B;  1BBU A;  4OP0 A;  5C51 B;  4XEO A;  4P71 C;  3HY0 A;  2C7I A;  4UPA A;  3VQV A;  2RHQ A;  4YRS A;  4RQF A;  2ODR C;  4YRF A;  3I7F A;  3V7S A;  3TUP A;  2I4M A;  1WQ7 A;  4H02 A;  4P74 A;  2QHU A;  3UGQ A;  2EJF A;  3V7R A;  3TEH A;  4P75 C;  4XTV A;  3V8K A;  1EVK A;  2ZR2 A;  1X54 A;  3M4Q A;  4Q6G A;  4RMF A;  3P8Y A;  1X01 A;  4XTW A;  3UH0 A;  3QO8 A;  1KMM A;  3QO5 A;  1B8A A;  1E1O A;  3UFG A;  4XTZ A;  4BWA A;  2ZNI A;  2A8E A;  1HXD A;  3TEH B;  2CJA A;  4YRP A;  2IY5 A;  2DU5 A;  2ARU A;  1RIQ A;  3CMQ A;  1H4Q A;  4YCW A;  3RF1 A;  4CS2 A;  2ART A;  2QHV A;  3TEG A;  1EFW A;  4P3O A;  4TQF A;  2ZR3 A;  1NJ2 A;  3PCO A;  4P71 A;  1ASY A;  4E51 A;  1NJ1 A;  4H2V A;  2E3C A;  3RAC A;  2DTH A;  2Q5H A;  1VQZ A;  1YFR A;  1PYS A;  5K1X A;  2IY5 B;  3VQW A;  3G1Z A;  3A31 A;  3LSS A;  3RGL A;  4RQE A;  4PHC A;  1EVL A;  4WI1 A;  1WPY A;  4P75 A;  3MEY A;  2DDZ A;  3A7R A;  1Z7M A;  5ELN A;  3P8V A;  1LYL A;  3IKM B;  2E65 A;  3HFV A;  4UP8 A;  11AS A;  2Q7H A;  2ZT7 A;  3A7A A;  2EWN A;  2DJZ A;  2ZT8 A;  4Q15 A;  4TQD A;  1C0A A;  2DTO A;  4TVA B;  4TVW A;  4YRT A;  1ASZ A;  1EOV A;  3RKX A;  3A5Z A;  4YCU A;  4DQ2 A;  2CJB A;  2Q5I A;  3QO7 A;  2PME A;  1E1T A;  4XU3 A;  3FJP A;  3KFU A;  3HXY A;  2AMC A;  1NYQ A;  4KQE A;  4WJ4 A;  4O2D A;  4P73 C;  4H2T A;  1GGM A;  2E64 A;  2DXU A;  1NYR A;  2I4N A;  1JJC A;  2ZT6 A;  4XTX A;  2ZZG A;  1YFT A;  2DEQ A;  4RDX A;  2RHQ B;  2ZNJ A;  2DVE A;  4G85 A;  3HY1 A;  4CS3 A;  2AMC B;  4H2X A;  1Z7N A;  2ARS A;  4XU2 A;  4XEM A;  4YRJ A;  4P3P A;  4YRI A;  3V7C A;  1SRY A;  1SER A;  1KOG A;  4KR3 A;  4H2S A;  3REX A;  1JJC B;  2DKG A;  3HFZ A;  3QTC A;  1ADY A;  4YRO A;  4YRE A;  3LSQ A;  4X5O A;  2DZ9 A;  4K88 A;  1EIY A;  3IKL A;  3NET A;  3A5Y A;  1YB3 A;  3P8T A;  5E3I A;  3L4G A;  4YRG A;  3UGT A;  4HVC A;  2ZT5 A;  4H2X B;  1H4T A;  1E24 A;  3QNE A;  3VQX A;  2ZTG A;  2P5I A;  4XU1 A;  3MQZ A;  2ALY A;  4P72 C;  5K1P A;  3BFM A;  3RKW A;  1QE0 A;  2DQ3 A;  4HA8 A;  2ZIO A;  4P73 A;  3NEL A;  5C52 B;  1EIY B;  2ZXF A;  1HC7 A;  4CH4 A;  2QHT A;  1HTT A;  4J15 A;  4G84 A;  3L4G B;  1WNL A;  2DU7 A;  2G4C A;  3PCO B;  2J3L A;  2CIM A;  3A74 A;  4LVL A;  1QF6 A;  4NCX A;  4YRN A;  2J3M A;  2Q7E A;  1N9W A;  2ALY B;  2DTI A;  2Q7G A;  1X55 A;  1PYS B;  1YFS A;  2HNI A;  4YCV A;  3L2Z A;  1NJ5 A;  2DQ0 A;  1W66 A;  4YRK A;  1BIA A;  3HRK A;  3HXZ A;  3DSQ A;  3HRI A;  1L0W A;  2E5A A;  4OLF A;  4YPF A;  3MF1 A;  4L87 A;  12AS A;  4ZIB A;  5ELO A;  3W3S A;  2XTI A;  2QHS A; 
#chains in the Genus database with same CATH homology
 4TVY A;  4CS4 A;  2DZC A;  4XU0 A;  1EQR A;  4H2Y A;  1ADJ A;  4UP7 A;  4YP0 A;  4YRC A;  3BJU A;  1G5I A;  1G5H A;  2ZIM A;  3EFS A;  4P72 A;  3HTZ A;  4HWP A;  4EX5 A;  3RKY A;  5KNN A;  4YRL A;  2XGT A;  4HT4 A;  4PG3 A;  4YYE A;  3A7U A;  1J5W A;  5F5W A;  3RL6 A;  4YRM A;  4K86 A;  4YRR A;  3WQZ A;  1SES A;  4ZTU B;  1X56 A;  3VQY A;  4HWR A;  3RIR A;  2PMF A;  2CGH A;  3LC0 A;  3MF2 A;  2ODR D;  3EFR A;  4K87 A;  2I4L A;  2ZIN A;  1FYF A;  2E1H A;  3V8L A;  4XTU A;  4ZTZ B;  3ICA A;  2FYK A;  3HXX A;  1E22 A;  1ATI A;  4P3N A;  1B70 A;  4WJ3 M;  4HWS A;  3M4P A;  3HXW A;  1X2H A;  3VBB A;  4CH3 A;  1USY C;  4H2U A;  1KMN A;  2ZCE A;  3V8J A;  3NEN A;  4HWO A;  2NS6 A;  4TTV A;  1X2G A;  3ERR A;  4XTY A;  1WQW A;  4TWA A;  3HFZ B;  4LVI A;  1NJ8 A;  4LNS A;  4WF2 A;  1WYD A;  4LVK A;  4EO4 A;  3A32 A;  2ZZE A;  4P74 C;  4AH6 A;  4KR2 A;  1B70 B;  2EL9 A;  1H4S A;  2EJ9 A;  1WU7 A;  5C53 B;  4YRQ A;  4CH5 A;  4LVJ A;  4UP9 A;  4HWT A;  5HGQ A;  4TVA A;  1B7Y A;  2EJG A;  1IL2 A;  4YDQ A;  3R07 A;  1H4V B;  3E9I A;  2C8M A;  3L1A A;  2ZGW A;  2ZZF A;  4BW9 A;  1YGB A;  3HXU A;  2AKW A;  3RUX A;  2P0L A;  2RHS A;  3IAL A;  3PZC A;  2I4O A;  1BIB A;  2E41 A;  3OD1 A;  3HXV A;  1SET A;  3E9H A;  4LVM A;  1G51 A;  3NEM A;  1NJ6 A;  2CJ9 A;  2DXT A;  1WLE A;  4CH6 A;  1NNH A;  2EAY A;  3IG2 A;  1B7Y B;  3REU A;  2E10 A;  1B76 A;  4H2W A;  4DPG A;  1USY A;  2AKW B;  1BBW A;  2RHS B;  1BBU A;  4OP0 A;  5C51 B;  4XEO A;  4P71 C;  3HY0 A;  2C7I A;  4UPA A;  3VQV A;  2RHQ A;  4YRS A;  4RQF A;  2ODR C;  4YRF A;  3I7F A;  3V7S A;  3TUP A;  2I4M A;  1WQ7 A;  4H02 A;  4P74 A;  2QHU A;  3UGQ A;  2EJF A;  3V7R A;  3TEH A;  4P75 C;  4XTV A;  3V8K A;  1EVK A;  2ZR2 A;  1X54 A;  3M4Q A;  4Q6G A;  4RMF A;  3P8Y A;  1X01 A;  4XTW A;  3UH0 A;  3QO8 A;  1KMM A;  3QO5 A;  1B8A A;  1E1O A;  3UFG A;  4XTZ A;  4BWA A;  2ZNI A;  2A8E A;  1HXD A;  3TEH B;  2CJA A;  4YRP A;  2IY5 A;  2DU5 A;  2ARU A;  1RIQ A;  3CMQ A;  1H4Q A;  4YCW A;  3RF1 A;  4CS2 A;  2ART A;  2QHV A;  3TEG A;  1EFW A;  4P3O A;  4TQF A;  2ZR3 A;  1NJ2 A;  3PCO A;  4P71 A;  1ASY A;  4E51 A;  1NJ1 A;  4H2V A;  2E3C A;  3RAC A;  2DTH A;  2Q5H A;  1VQZ A;  1YFR A;  1PYS A;  5K1X A;  2IY5 B;  3VQW A;  3G1Z A;  3A31 A;  3LSS A;  3RGL A;  4RQE A;  4PHC A;  1EVL A;  4WI1 A;  1WPY A;  4P75 A;  3MEY A;  2DDZ A;  3A7R A;  1Z7M A;  5ELN A;  3P8V A;  1LYL A;  3IKM B;  2E65 A;  3HFV A;  4UP8 A;  11AS A;  2Q7H A;  2ZT7 A;  3A7A A;  2EWN A;  2DJZ A;  2ZT8 A;  4Q15 A;  4TQD A;  1C0A A;  2DTO A;  4TVA B;  4TVW A;  4YRT A;  1ASZ A;  1EOV A;  3RKX A;  3A5Z A;  4YCU A;  4DQ2 A;  2CJB A;  2Q5I A;  3QO7 A;  2PME A;  1E1T A;  4XU3 A;  3FJP A;  3KFU A;  3HXY A;  2AMC A;  1NYQ A;  4KQE A;  4WJ4 A;  4O2D A;  4P73 C;  4H2T A;  1GGM A;  2E64 A;  2DXU A;  1NYR A;  2I4N A;  1JJC A;  2ZT6 A;  4XTX A;  2ZZG A;  1YFT A;  2DEQ A;  4RDX A;  2RHQ B;  2ZNJ A;  2DVE A;  4G85 A;  3HY1 A;  4CS3 A;  2AMC B;  4H2X A;  1Z7N A;  2ARS A;  4XU2 A;  4XEM A;  4YRJ A;  4P3P A;  4YRI A;  3V7C A;  1SRY A;  1SER A;  1KOG A;  4KR3 A;  4H2S A;  3REX A;  1JJC B;  2DKG A;  3HFZ A;  3QTC A;  1ADY A;  4YRO A;  4YRE A;  3LSQ A;  4X5O A;  2DZ9 A;  4K88 A;  1EIY A;  3IKL A;  3NET A;  3A5Y A;  1YB3 A;  3P8T A;  5E3I A;  3L4G A;  4YRG A;  3UGT A;  4HVC A;  2ZT5 A;  4H2X B;  1H4T A;  1E24 A;  3QNE A;  3VQX A;  2ZTG A;  2P5I A;  4XU1 A;  3MQZ A;  2ALY A;  4P72 C;  5K1P A;  3BFM A;  3RKW A;  1QE0 A;  2DQ3 A;  4HA8 A;  2ZIO A;  4P73 A;  3NEL A;  5C52 B;  1EIY B;  2ZXF A;  1HC7 A;  4CH4 A;  2QHT A;  1HTT A;  4J15 A;  4G84 A;  3L4G B;  1WNL A;  2DU7 A;  2G4C A;  3PCO B;  2J3L A;  2CIM A;  3A74 A;  4LVL A;  1QF6 A;  4NCX A;  4YRN A;  2J3M A;  2Q7E A;  1N9W A;  2ALY B;  2DTI A;  2Q7G A;  1X55 A;  1PYS B;  1YFS A;  2HNI A;  4YCV A;  3L2Z A;  1NJ5 A;  2DQ0 A;  1W66 A;  4YRK A;  1BIA A;  3HRK A;  3HXZ A;  3DSQ A;  3HRI A;  1L0W A;  2E5A A;  4OLF A;  4YPF A;  3MF1 A;  4L87 A;  12AS A;  4ZIB A;  5ELO A;  3W3S A;  2XTI A;  2QHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...