3HTZA

Crystal structure of the catalytic fragment of alanyl-trna synthetase in complex with l-serine: re-refined
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
457
structure length
447
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serine Paradox
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
total genus 159
structure length 447
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2009-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3htzA01
2CIMA 3HFVA 2ZR2A 11ASA 3HTZA 4LNSA 3VQWA 2DVEA 2I4OA 1USYA 2DDZA 2ZIMA 4CS2A 1H4QA 1YFRA 12ASA 4TVWA 1NNHA 4XTYA 2ZTGA 4E51A 2ZZEA 2AKWB 1EQRA 3KFUA 1GGMA 3UH0A 1HC7A 1VQZA 4YRLA 1RIQA 2EJ9A 2J3MA 4PG3A 4YCVA 2C7IA 1W66A 2CGHA 3HXUA 3A7AA 3VBBA 2Q5IA 3P8TA 4OLFA 2ZT6A 2Q5HA 4CS3A 3A5ZA 4RDXA 3L4GB 4RMFA 2ZNIA 4YCWA 4CH6A 2ARSA 1PYSB 5C53B 2DZCA 5KNNA 4HVCA 1E24A 3MF2A 4DQ2A 1SRYA 1EIYA 1ASZA 2ODRD 1X54A 3BFMA 3V7CA 4X5OA 1YB3A 2DZ9A 2CJBA 2ARUA 2RHSB 4TVAA 3ERRA 4DPGA 2ZINA 3HY0A 4YROA 3REXA 3TEHA 2ZT7A 3L2ZA 4XTXA 4YRMA 3A5YA 4K88A 4P73C 4P72A 3QTCA 3PCOB 1NJ5A 4TVAB 4YRSA 4WJ3M 4P3OA 3RGLA 2P0LA 4O2DA 2ZT5A 2XTIA 3PZCA 1B7YB 4BWAA 4G84A 4H2XA 4KR3A 3I7FA 3R07A 4XTVA 3NELA 3TEHB 2DTOA 4YRJA 2E64A 3ICAA 4ZTZB 4TWAA 4HWOA 1HTTA 1Z7MA 4YRGA 4P74C 4Q15A 3LSQA 3BJUA 3WQZA 4KQEA 1NYRA 2E41A 3PCOA 3L1AA 2CJ9A 3IALA 2G4CA 3LC0A 5ELNA 2IY5A 2ALYA 3IKLA 4NCXA 4RQFA 4HWRA 2DKGA 4HA8A 3M4QA 3HFZA 3MEYA 2QHSA 2CJAA 4YYEA 3HRIA 3HXVA 1C0AA 3HXZA 4TVYA 3RL6A 3QNEA 4XEOA 4P3PA 3RIRA 1NYQA 4RQEA 2DTIA 2RHQA 3P8VA 2I4NA 2HNIA 1BIBA 4XU1A 2EJGA 4HWPA 1JJCA 1KMNA 3RUXA 5C51B 3A74A 3RKYA 1NJ6A 4TQFA 5E3IA 1SERA 2DJZA 2XGTA 1X56A 1ADJA 1YGBA 3E9IA 3VQVA 2ARTA 4CS4A 2Q7HA 4WJ4A 2AKWA 3TEGA 4P75A 3RKXA 1ASYA 4OP0A 1X2GA 3V7SA 1BBWA 1YFSA 1L0WA 4EO4A 1KOGA 1WQ7A 3A7UA 2EAYA 2ODRC 3EFRA 4TQDA 1EFWA 2QHTA 4P72C 4YRIA 3RACA 2EWNA 1QF6A 3QO5A 2E1HA 1JJCB 1B76A 2J3LA 3MF1A 3RKWA 4P3NA 4ZTUB 3HXYA 2PMFA 2P5IA 4P75C 4YP0A 2AMCA 1WU7A 3A7RA 4EX5A 1H4SA 2DU5A 3EFSA 1X01A 2ZT8A 2ZGWA 2I4MA 4PHCA 3VQXA 4UP9A 1B70B 1EOVA 1ADYA 1BIAA 3V8LA 4K87A 2DXUA 4H2VA 2DEQA 4BW9A 1SETA 3NEMA 3UGTA 3IKMB 5F5WA 2DXTA 5C52B 2E3CA 2DQ3A 4YRPA 1NJ2A 1WPYA 1QE0A 1E1OA 4L87A 1H4VB 3V8JA 3RF1A 3HXXA 3VQYA 4CH5A 4YCUA 1YFTA 3W3SA 1EVLA 5K1XA 3V8KA 3UFGA 2ZNJA 4P73A 3QO7A 3DSQA 3IG2A 3M4PA 4G85A 4H2UA 4H2YA 1B8AA 1EIYB 4YPFA 2DQ0A 4HWSA 4XU2A 1X55A 4YDQA 1USYC 4CH4A 4YRTA 2IY5B 1X2HA 4H2SA 4YRRA 3A32A 4AH6A 4CH3A 3REUA 3HRKA 3HXWA 5ELOA 2ALYB 1G51A 1WQWA 2RHQB 3LSSA 2ZZGA 2ZCEA 1E1TA 4UPAA 1BBUA 2DU7A 2C8MA 4YREA 1E22A 2E5AA 4YRNA 3NENA 3FJPA 4XTUA 3UGQA 3NETA 4H02A 1Z7NA 1IL2A 4UP7A 1HXDA 4ZIBA 3E9HA 3L4GA 2RHSA 4TTVA 1FYFA 3HFZB 2QHVA 1NJ1A 4J15A 3TUPA 1EVKA 3A31A 2E65A 4H2WA 2Q7GA 1J5WA 4P71C 2EJFA 2DTHA 4K86A 2ZR3A 4XTWA 5HGQA 4H2XB 4XEMA 3HY1A 2ZZFA 4KR2A 2E10A 2Q7EA 2EL9A 3G1ZA 4XU0A 4YRKA 2AMCB 4UP8A 1LYLA 1WNLA 4YRCA 4YRQA 3OD1A 4WI1A 1ATIA 1H4TA 1G5IA 3CMQA 1PYSA 1WLEA 5K1PA 3P8YA 2I4LA 3QO8A 2PMEA 1B70A 1WYDA 4H2TA 4WF2A 1B7YA 1KMMA 1G5HA 2ZIOA 4P71A 4XTZA 2ZXFA 4XU3A 4P74A 1SESA 3V7RA 2FYKA 1NJ8A 4HWTA 4Q6GA 2QHUA 1N9WA 4YRFA
chains in the Genus database with same CATH superfamily
2CIMA 3HFVA 2ZR2A 11ASA 3HTZA 4LNSA 3VQWA 2DVEA 2I4OA 1USYA 2DDZA 2ZIMA 4CS2A 1H4QA 1YFRA 12ASA 4TVWA 1NNHA 4XTYA 2ZTGA 4E51A 2ZZEA 2AKWB 1EQRA 3KFUA 1GGMA 3UH0A 1HC7A 1VQZA 4YRLA 1RIQA 2EJ9A 2J3MA 4PG3A 4YCVA 2C7IA 1W66A 2CGHA 3HXUA 3A7AA 3VBBA 2Q5IA 3P8TA 4OLFA 2ZT6A 2Q5HA 4CS3A 3A5ZA 4RDXA 3L4GB 4RMFA 2ZNIA 4YCWA 4CH6A 2ARSA 1PYSB 5C53B 2DZCA 5KNNA 4HVCA 1E24A 3MF2A 4DQ2A 1SRYA 1EIYA 1ASZA 2ODRD 1X54A 3BFMA 3V7CA 4X5OA 1YB3A 2DZ9A 2CJBA 2ARUA 2RHSB 4TVAA 3ERRA 4DPGA 2ZINA 3HY0A 4YROA 3REXA 3TEHA 2ZT7A 3L2ZA 4XTXA 4YRMA 3A5YA 4K88A 4P73C 4P72A 3QTCA 3PCOB 1NJ5A 4TVAB 4YRSA 4WJ3M 4P3OA 3RGLA 2P0LA 4O2DA 2ZT5A 2XTIA 3PZCA 1B7YB 4BWAA 4G84A 4H2XA 4KR3A 3I7FA 3R07A 4XTVA 3NELA 3TEHB 2DTOA 4YRJA 2E64A 3ICAA 4ZTZB 4TWAA 4HWOA 1HTTA 1Z7MA 4YRGA 4P74C 4Q15A 3LSQA 3BJUA 3WQZA 4KQEA 1NYRA 2E41A 3PCOA 3L1AA 2CJ9A 3IALA 2G4CA 3LC0A 2NS6A 5ELNA 2IY5A 2ALYA 3IKLA 4NCXA 4RQFA 4HWRA 2DKGA 4HA8A 3M4QA 3HFZA 3MEYA 2QHSA 2CJAA 4YYEA 3HRIA 3HXVA 1C0AA 3HXZA 4TVYA 3RL6A 3QNEA 4XEOA 4P3PA 3RIRA 1NYQA 4RQEA 2DTIA 2RHQA 3P8VA 2I4NA 2HNIA 1BIBA 4XU1A 2EJGA 4HWPA 1JJCA 1KMNA 3RUXA 5C51B 3A74A 3MQZA 3RKYA 1NJ6A 4TQFA 5E3IA 1SERA 2DJZA 2XGTA 1X56A 1ADJA 1YGBA 3E9IA 3VQVA 2ARTA 4CS4A 2Q7HA 4WJ4A 2AKWA 3TEGA 4P75A 3RKXA 1ASYA 4OP0A 1X2GA 3V7SA 1BBWA 1YFSA 1L0WA 4EO4A 1KOGA 1WQ7A 3A7UA 2EAYA 2ODRC 3EFRA 4TQDA 1EFWA 2QHTA 4P72C 4YRIA 3RACA 2EWNA 1QF6A 3QO5A 2E1HA 1JJCB 1B76A 2J3LA 3MF1A 3RKWA 4P3NA 4ZTUB 3HXYA 2PMFA 2P5IA 4P75C 4YP0A 2AMCA 1WU7A 3A7RA 4EX5A 1H4SA 2DU5A 3EFSA 1X01A 2ZT8A 2ZGWA 2I4MA 4PHCA 3VQXA 4UP9A 1B70B 1EOVA 1ADYA 1BIAA 3V8LA 4K87A 2DXUA 4H2VA 2DEQA 4BW9A 1SETA 3NEMA 3UGTA 3IKMB 5F5WA 2DXTA 5C52B 2E3CA 2DQ3A 4YRPA 1NJ2A 1WPYA 1QE0A 1E1OA 4L87A 1H4VB 3V8JA 3RF1A 3HXXA 3VQYA 4CH5A 4YCUA 1YFTA 3W3SA 1EVLA 5K1XA 3V8KA 3UFGA 2ZNJA 4P73A 3QO7A 3DSQA 3IG2A 3M4PA 4G85A 4H2UA 4H2YA 1B8AA 1EIYB 4HT4A 4YPFA 2DQ0A 4HWSA 4XU2A 1X55A 4YDQA 1USYC 4CH4A 4YRTA 2IY5B 1X2HA 4H2SA 4YRRA 3A32A 4AH6A 4CH3A 3REUA 3HRKA 3HXWA 5ELOA 2ALYB 1G51A 1WQWA 2RHQB 3LSSA 2ZZGA 2ZCEA 1E1TA 4UPAA 1BBUA 2DU7A 2C8MA 4YREA 4LVMA 1E22A 2E5AA 4YRNA 3NENA 3FJPA 4XTUA 3UGQA 3NETA 4H02A 1Z7NA 1IL2A 4UP7A 1HXDA 4ZIBA 3E9HA 3L4GA 2RHSA 4TTVA 1FYFA 3HFZB 2QHVA 1NJ1A 4J15A 3TUPA 1EVKA 3A31A 2E65A 4H2WA 2Q7GA 1J5WA 4P71C 2EJFA 2DTHA 4K86A 2ZR3A 4XTWA 5HGQA 4H2XB 4XEMA 3HY1A 2ZZFA 4KR2A 2E10A 2Q7EA 2EL9A 3G1ZA 4XU0A 4YRKA 2AMCB 4UP8A 1LYLA 1WNLA 4YRCA 4YRQA 3OD1A 4WI1A 1ATIA 1H4TA 1G5IA 3CMQA 1PYSA 1WLEA 4LVIA 5K1PA 3P8YA 2I4LA 3QO8A 2PMEA 4LVKA 2A8EA 1B70A 1WYDA 4H2TA 4WF2A 4LVLA 1B7YA 1KMMA 1G5HA 2ZIOA 4P71A 4XTZA 4LVJA 2ZXFA 4XU3A 4P74A 1SESA 3V7RA 2FYKA 1NJ8A 4HWTA 4Q6GA 2QHUA 1N9WA 4YRFA
chains in the Genus database with same CATH topology
2CIMA 3HFVA 2ZR2A 11ASA 3HTZA 4LNSA 3VQWA 2DVEA 2I4OA 1USYA 2DDZA 2ZIMA 4CS2A 1H4QA 1YFRA 12ASA 4TVWA 1NNHA 4XTYA 2ZTGA 4E51A 2ZZEA 2AKWB 1EQRA 3KFUA 1GGMA 3UH0A 1HC7A 1VQZA 4YRLA 1RIQA 2EJ9A 2J3MA 4PG3A 4YCVA 2C7IA 1W66A 2CGHA 3HXUA 3A7AA 3VBBA 2Q5IA 3P8TA 4OLFA 2ZT6A 2Q5HA 4CS3A 3A5ZA 4RDXA 3L4GB 4RMFA 2ZNIA 4YCWA 4CH6A 2ARSA 1PYSB 5C53B 2DZCA 5KNNA 4HVCA 1E24A 3MF2A 4DQ2A 1SRYA 1EIYA 1ASZA 2ODRD 1X54A 3BFMA 3V7CA 4X5OA 1YB3A 2DZ9A 2CJBA 2ARUA 2RHSB 4TVAA 3ERRA 4DPGA 2ZINA 3HY0A 4YROA 3REXA 3TEHA 2ZT7A 3L2ZA 4XTXA 4YRMA 3A5YA 4K88A 4P73C 4P72A 3QTCA 3PCOB 1NJ5A 4TVAB 4YRSA 4WJ3M 4P3OA 3RGLA 2P0LA 4O2DA 2ZT5A 2XTIA 3PZCA 1B7YB 4BWAA 4G84A 4H2XA 4KR3A 3I7FA 3R07A 4XTVA 3NELA 3TEHB 2DTOA 4YRJA 2E64A 3ICAA 4ZTZB 4TWAA 4HWOA 1HTTA 1Z7MA 4YRGA 4P74C 4Q15A 3LSQA 3BJUA 3WQZA 4KQEA 1NYRA 2E41A 3PCOA 3L1AA 2CJ9A 3IALA 2G4CA 3LC0A 2NS6A 5ELNA 2IY5A 2ALYA 3IKLA 4NCXA 4RQFA 4HWRA 2DKGA 4HA8A 3M4QA 3HFZA 3MEYA 2QHSA 2CJAA 4YYEA 3HRIA 3HXVA 1C0AA 3HXZA 4TVYA 3RL6A 3QNEA 4XEOA 4P3PA 3RIRA 1NYQA 4RQEA 2DTIA 2RHQA 3P8VA 2I4NA 2HNIA 1BIBA 4XU1A 2EJGA 4HWPA 1JJCA 1KMNA 3RUXA 5C51B 3A74A 3MQZA 3RKYA 1NJ6A 4TQFA 5E3IA 1SERA 2DJZA 2XGTA 1X56A 1ADJA 1YGBA 3E9IA 3VQVA 2ARTA 4CS4A 2Q7HA 4WJ4A 2AKWA 3TEGA 4P75A 3RKXA 1ASYA 4OP0A 1X2GA 3V7SA 1BBWA 1YFSA 1L0WA 4EO4A 1KOGA 1WQ7A 3A7UA 2EAYA 2ODRC 3EFRA 4TQDA 1EFWA 2QHTA 4P72C 4YRIA 3RACA 2EWNA 1QF6A 3QO5A 2E1HA 1JJCB 1B76A 2J3LA 3MF1A 3RKWA 4P3NA 4ZTUB 3HXYA 2PMFA 2P5IA 4P75C 4YP0A 2AMCA 1WU7A 3A7RA 4EX5A 1H4SA 2DU5A 3EFSA 1X01A 2ZT8A 2ZGWA 2I4MA 4PHCA 3VQXA 4UP9A 1B70B 1EOVA 1ADYA 1BIAA 3V8LA 4K87A 2DXUA 4H2VA 2DEQA 4BW9A 1SETA 3NEMA 3UGTA 3IKMB 5F5WA 2DXTA 5C52B 2E3CA 2DQ3A 4YRPA 1NJ2A 1WPYA 1QE0A 1E1OA 4L87A 1H4VB 3V8JA 3RF1A 3HXXA 3VQYA 4CH5A 4YCUA 1YFTA 3W3SA 1EVLA 5K1XA 3V8KA 3UFGA 2ZNJA 4P73A 3QO7A 3DSQA 3IG2A 3M4PA 4G85A 4H2UA 4H2YA 1B8AA 1EIYB 4HT4A 4YPFA 2DQ0A 4HWSA 4XU2A 1X55A 4YDQA 1USYC 4CH4A 4YRTA 2IY5B 1X2HA 4H2SA 4YRRA 3A32A 4AH6A 4CH3A 3REUA 3HRKA 3HXWA 5ELOA 2ALYB 1G51A 1WQWA 2RHQB 3LSSA 2ZZGA 2ZCEA 1E1TA 4UPAA 1BBUA 2DU7A 2C8MA 4YREA 4LVMA 1E22A 2E5AA 4YRNA 3NENA 3FJPA 4XTUA 3UGQA 3NETA 4H02A 1Z7NA 1IL2A 4UP7A 1HXDA 4ZIBA 3E9HA 3L4GA 2RHSA 4TTVA 1FYFA 3HFZB 2QHVA 1NJ1A 4J15A 3TUPA 1EVKA 3A31A 2E65A 4H2WA 2Q7GA 1J5WA 4P71C 2EJFA 2DTHA 4K86A 2ZR3A 4XTWA 5HGQA 4H2XB 4XEMA 3HY1A 2ZZFA 4KR2A 2E10A 2Q7EA 2EL9A 3G1ZA 4XU0A 4YRKA 2AMCB 4UP8A 1LYLA 1WNLA 4YRCA 4YRQA 3OD1A 4WI1A 1ATIA 1H4TA 1G5IA 3CMQA 1PYSA 1WLEA 4LVIA 5K1PA 3P8YA 2I4LA 3QO8A 2PMEA 4LVKA 2A8EA 1B70A 1WYDA 4H2TA 4WF2A 4LVLA 1B7YA 1KMMA 1G5HA 2ZIOA 4P71A 4XTZA 4LVJA 2ZXFA 4XU3A 4P74A 1SESA 3V7RA 2FYKA 1NJ8A 4HWTA 4Q6GA 2QHUA 1N9WA 4YRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CIM A;  3HFV A;  2ZR2 A;  11AS A;  3HTZ A;  4LNS A;  3VQW A;  2DVE A;  2I4O A;  1USY A;  2DDZ A;  2ZIM A;  4CS2 A;  1H4Q A;  1YFR A;  12AS A;  4TVW A;  1NNH A;  4XTY A;  2ZTG A;  4E51 A;  2ZZE A;  2AKW B;  1EQR A;  3KFU A;  1GGM A;  3UH0 A;  1HC7 A;  1VQZ A;  4YRL A;  1RIQ A;  2EJ9 A;  2J3M A;  4PG3 A;  4YCV A;  2C7I A;  1W66 A;  2CGH A;  3HXU A;  3A7A A;  3VBB A;  2Q5I A;  3P8T A;  4OLF A;  2ZT6 A;  2Q5H A;  4CS3 A;  3A5Z A;  4RDX A;  3L4G B;  4RMF A;  2ZNI A;  4YCW A;  4CH6 A;  2ARS A;  1PYS B;  5C53 B;  2DZC A;  5KNN A;  4HVC A;  1E24 A;  3MF2 A;  4DQ2 A;  1SRY A;  1EIY A;  1ASZ A;  2ODR D;  1X54 A;  3BFM A;  3V7C A;  4X5O A;  1YB3 A;  2DZ9 A;  2CJB A;  2ARU A;  2RHS B;  4TVA A;  3ERR A;  4DPG A;  2ZIN A;  3HY0 A;  4YRO A;  3REX A;  3TEH A;  2ZT7 A;  3L2Z A;  4XTX A;  4YRM A;  3A5Y A;  4K88 A;  4P73 C;  4P72 A;  3QTC A;  3PCO B;  1NJ5 A;  4TVA B;  4YRS A;  4WJ3 M;  4P3O A;  3RGL A;  2P0L A;  4O2D A;  2ZT5 A;  2XTI A;  3PZC A;  1B7Y B;  4BWA A;  4G84 A;  4H2X A;  4KR3 A;  3I7F A;  3R07 A;  4XTV A;  3NEL A;  3TEH B;  2DTO A;  4YRJ A;  2E64 A;  3ICA A;  4ZTZ B;  4TWA A;  4HWO A;  1HTT A;  1Z7M A;  4YRG A;  4P74 C;  4Q15 A;  3LSQ A;  3BJU A;  3WQZ A;  4KQE A;  1NYR A;  2E41 A;  3PCO A;  3L1A A;  2CJ9 A;  3IAL A;  2G4C A;  3LC0 A;  5ELN A;  2IY5 A;  2ALY A;  3IKL A;  4NCX A;  4RQF A;  4HWR A;  2DKG A;  4HA8 A;  3M4Q A;  3HFZ A;  3MEY A;  2QHS A;  2CJA A;  4YYE A;  3HRI A;  3HXV A;  1C0A A;  3HXZ A;  4TVY A;  3RL6 A;  3QNE A;  4XEO A;  4P3P A;  3RIR A;  1NYQ A;  4RQE A;  2DTI A;  2RHQ A;  3P8V A;  2I4N A;  2HNI A;  1BIB A;  4XU1 A;  2EJG A;  4HWP A;  1JJC A;  1KMN A;  3RUX A;  5C51 B;  3A74 A;  3RKY A;  1NJ6 A;  4TQF A;  5E3I A;  1SER A;  2DJZ A;  2XGT A;  1X56 A;  1ADJ A;  1YGB A;  3E9I A;  3VQV A;  2ART A;  4CS4 A;  2Q7H A;  4WJ4 A;  2AKW A;  3TEG A;  4P75 A;  3RKX A;  1ASY A;  4OP0 A;  1X2G A;  3V7S A;  1BBW A;  1YFS A;  1L0W A;  4EO4 A;  1KOG A;  1WQ7 A;  3A7U A;  2EAY A;  2ODR C;  3EFR A;  4TQD A;  1EFW A;  2QHT A;  4P72 C;  4YRI A;  3RAC A;  2EWN A;  1QF6 A;  3QO5 A;  2E1H A;  1JJC B;  1B76 A;  2J3L A;  3MF1 A;  3RKW A;  4P3N A;  4ZTU B;  3HXY A;  2PMF A;  2P5I A;  4P75 C;  4YP0 A;  2AMC A;  1WU7 A;  3A7R A;  4EX5 A;  1H4S A;  2DU5 A;  3EFS A;  1X01 A;  2ZT8 A;  2ZGW A;  2I4M A;  4PHC A;  3VQX A;  4UP9 A;  1B70 B;  1EOV A;  1ADY A;  1BIA A;  3V8L A;  4K87 A;  2DXU A;  4H2V A;  2DEQ A;  4BW9 A;  1SET A;  3NEM A;  3UGT A;  3IKM B;  5F5W A;  2DXT A;  5C52 B;  2E3C A;  2DQ3 A;  4YRP A;  1NJ2 A;  1WPY A;  1QE0 A;  1E1O A;  4L87 A;  1H4V B;  3V8J A;  3RF1 A;  3HXX A;  3VQY A;  4CH5 A;  4YCU A;  1YFT A;  3W3S A;  1EVL A;  5K1X A;  3V8K A;  3UFG A;  2ZNJ A;  4P73 A;  3QO7 A;  3DSQ A;  3IG2 A;  3M4P A;  4G85 A;  4H2U A;  4H2Y A;  1B8A A;  1EIY B;  4YPF A;  2DQ0 A;  4HWS A;  4XU2 A;  1X55 A;  4YDQ A;  1USY C;  4CH4 A;  4YRT A;  2IY5 B;  1X2H A;  4H2S A;  4YRR A;  3A32 A;  4AH6 A;  4CH3 A;  3REU A;  3HRK A;  3HXW A;  5ELO A;  2ALY B;  1G51 A;  1WQW A;  2RHQ B;  3LSS A;  2ZZG A;  2ZCE A;  1E1T A;  4UPA A;  1BBU A;  2DU7 A;  2C8M A;  4YRE A;  1E22 A;  2E5A A;  4YRN A;  3NEN A;  3FJP A;  4XTU A;  3UGQ A;  3NET A;  4H02 A;  1Z7N A;  1IL2 A;  4UP7 A;  1HXD A;  4ZIB A;  3E9H A;  3L4G A;  2RHS A;  4TTV A;  1FYF A;  3HFZ B;  2QHV A;  1NJ1 A;  4J15 A;  3TUP A;  1EVK A;  3A31 A;  2E65 A;  4H2W A;  2Q7G A;  1J5W A;  4P71 C;  2EJF A;  2DTH A;  4K86 A;  2ZR3 A;  4XTW A;  5HGQ A;  4H2X B;  4XEM A;  3HY1 A;  2ZZF A;  4KR2 A;  2E10 A;  2Q7E A;  2EL9 A;  3G1Z A;  4XU0 A;  4YRK A;  2AMC B;  4UP8 A;  1LYL A;  1WNL A;  4YRC A;  4YRQ A;  3OD1 A;  4WI1 A;  1ATI A;  1H4T A;  1G5I A;  3CMQ A;  1PYS A;  1WLE A;  5K1P A;  3P8Y A;  2I4L A;  3QO8 A;  2PME A;  1B70 A;  1WYD A;  4H2T A;  4WF2 A;  1B7Y A;  1KMM A;  1G5H A;  2ZIO A;  4P71 A;  4XTZ A;  2ZXF A;  4XU3 A;  4P74 A;  1SES A;  3V7R A;  2FYK A;  1NJ8 A;  4HWT A;  4Q6G A;  2QHU A;  1N9W A;  4YRF A; 
#chains in the Genus database with same CATH topology
 2CIM A;  3HFV A;  2ZR2 A;  11AS A;  3HTZ A;  4LNS A;  3VQW A;  2DVE A;  2I4O A;  1USY A;  2DDZ A;  2ZIM A;  4CS2 A;  1H4Q A;  1YFR A;  12AS A;  4TVW A;  1NNH A;  4XTY A;  2ZTG A;  4E51 A;  2ZZE A;  2AKW B;  1EQR A;  3KFU A;  1GGM A;  3UH0 A;  1HC7 A;  1VQZ A;  4YRL A;  1RIQ A;  2EJ9 A;  2J3M A;  4PG3 A;  4YCV A;  2C7I A;  1W66 A;  2CGH A;  3HXU A;  3A7A A;  3VBB A;  2Q5I A;  3P8T A;  4OLF A;  2ZT6 A;  2Q5H A;  4CS3 A;  3A5Z A;  4RDX A;  3L4G B;  4RMF A;  2ZNI A;  4YCW A;  4CH6 A;  2ARS A;  1PYS B;  5C53 B;  2DZC A;  5KNN A;  4HVC A;  1E24 A;  3MF2 A;  4DQ2 A;  1SRY A;  1EIY A;  1ASZ A;  2ODR D;  1X54 A;  3BFM A;  3V7C A;  4X5O A;  1YB3 A;  2DZ9 A;  2CJB A;  2ARU A;  2RHS B;  4TVA A;  3ERR A;  4DPG A;  2ZIN A;  3HY0 A;  4YRO A;  3REX A;  3TEH A;  2ZT7 A;  3L2Z A;  4XTX A;  4YRM A;  3A5Y A;  4K88 A;  4P73 C;  4P72 A;  3QTC A;  3PCO B;  1NJ5 A;  4TVA B;  4YRS A;  4WJ3 M;  4P3O A;  3RGL A;  2P0L A;  4O2D A;  2ZT5 A;  2XTI A;  3PZC A;  1B7Y B;  4BWA A;  4G84 A;  4H2X A;  4KR3 A;  3I7F A;  3R07 A;  4XTV A;  3NEL A;  3TEH B;  2DTO A;  4YRJ A;  2E64 A;  3ICA A;  4ZTZ B;  4TWA A;  4HWO A;  1HTT A;  1Z7M A;  4YRG A;  4P74 C;  4Q15 A;  3LSQ A;  3BJU A;  3WQZ A;  4KQE A;  1NYR A;  2E41 A;  3PCO A;  3L1A A;  2CJ9 A;  3IAL A;  2G4C A;  3LC0 A;  2NS6 A;  5ELN A;  2IY5 A;  2ALY A;  3IKL A;  4NCX A;  4RQF A;  4HWR A;  2DKG A;  4HA8 A;  3M4Q A;  3HFZ A;  3MEY A;  2QHS A;  2CJA A;  4YYE A;  3HRI A;  3HXV A;  1C0A A;  3HXZ A;  4TVY A;  3RL6 A;  3QNE A;  4XEO A;  4P3P A;  3RIR A;  1NYQ A;  4RQE A;  2DTI A;  2RHQ A;  3P8V A;  2I4N A;  2HNI A;  1BIB A;  4XU1 A;  2EJG A;  4HWP A;  1JJC A;  1KMN A;  3RUX A;  5C51 B;  3A74 A;  3MQZ A;  3RKY A;  1NJ6 A;  4TQF A;  5E3I A;  1SER A;  2DJZ A;  2XGT A;  1X56 A;  1ADJ A;  1YGB A;  3E9I A;  3VQV A;  2ART A;  4CS4 A;  2Q7H A;  4WJ4 A;  2AKW A;  3TEG A;  4P75 A;  3RKX A;  1ASY A;  4OP0 A;  1X2G A;  3V7S A;  1BBW A;  1YFS A;  1L0W A;  4EO4 A;  1KOG A;  1WQ7 A;  3A7U A;  2EAY A;  2ODR C;  3EFR A;  4TQD A;  1EFW A;  2QHT A;  4P72 C;  4YRI A;  3RAC A;  2EWN A;  1QF6 A;  3QO5 A;  2E1H A;  1JJC B;  1B76 A;  2J3L A;  3MF1 A;  3RKW A;  4P3N A;  4ZTU B;  3HXY A;  2PMF A;  2P5I A;  4P75 C;  4YP0 A;  2AMC A;  1WU7 A;  3A7R A;  4EX5 A;  1H4S A;  2DU5 A;  3EFS A;  1X01 A;  2ZT8 A;  2ZGW A;  2I4M A;  4PHC A;  3VQX A;  4UP9 A;  1B70 B;  1EOV A;  1ADY A;  1BIA A;  3V8L A;  4K87 A;  2DXU A;  4H2V A;  2DEQ A;  4BW9 A;  1SET A;  3NEM A;  3UGT A;  3IKM B;  5F5W A;  2DXT A;  5C52 B;  2E3C A;  2DQ3 A;  4YRP A;  1NJ2 A;  1WPY A;  1QE0 A;  1E1O A;  4L87 A;  1H4V B;  3V8J A;  3RF1 A;  3HXX A;  3VQY A;  4CH5 A;  4YCU A;  1YFT A;  3W3S A;  1EVL A;  5K1X A;  3V8K A;  3UFG A;  2ZNJ A;  4P73 A;  3QO7 A;  3DSQ A;  3IG2 A;  3M4P A;  4G85 A;  4H2U A;  4H2Y A;  1B8A A;  1EIY B;  4HT4 A;  4YPF A;  2DQ0 A;  4HWS A;  4XU2 A;  1X55 A;  4YDQ A;  1USY C;  4CH4 A;  4YRT A;  2IY5 B;  1X2H A;  4H2S A;  4YRR A;  3A32 A;  4AH6 A;  4CH3 A;  3REU A;  3HRK A;  3HXW A;  5ELO A;  2ALY B;  1G51 A;  1WQW A;  2RHQ B;  3LSS A;  2ZZG A;  2ZCE A;  1E1T A;  4UPA A;  1BBU A;  2DU7 A;  2C8M A;  4YRE A;  4LVM A;  1E22 A;  2E5A A;  4YRN A;  3NEN A;  3FJP A;  4XTU A;  3UGQ A;  3NET A;  4H02 A;  1Z7N A;  1IL2 A;  4UP7 A;  1HXD A;  4ZIB A;  3E9H A;  3L4G A;  2RHS A;  4TTV A;  1FYF A;  3HFZ B;  2QHV A;  1NJ1 A;  4J15 A;  3TUP A;  1EVK A;  3A31 A;  2E65 A;  4H2W A;  2Q7G A;  1J5W A;  4P71 C;  2EJF A;  2DTH A;  4K86 A;  2ZR3 A;  4XTW A;  5HGQ A;  4H2X B;  4XEM A;  3HY1 A;  2ZZF A;  4KR2 A;  2E10 A;  2Q7E A;  2EL9 A;  3G1Z A;  4XU0 A;  4YRK A;  2AMC B;  4UP8 A;  1LYL A;  1WNL A;  4YRC A;  4YRQ A;  3OD1 A;  4WI1 A;  1ATI A;  1H4T A;  1G5I A;  3CMQ A;  1PYS A;  1WLE A;  4LVI A;  5K1P A;  3P8Y A;  2I4L A;  3QO8 A;  2PME A;  4LVK A;  2A8E A;  1B70 A;  1WYD A;  4H2T A;  4WF2 A;  4LVL A;  1B7Y A;  1KMM A;  1G5H A;  2ZIO A;  4P71 A;  4XTZ A;  4LVJ A;  2ZXF A;  4XU3 A;  4P74 A;  1SES A;  3V7R A;  2FYK A;  1NJ8 A;  4HWT A;  4Q6G A;  2QHU A;  1N9W A;  4YRF A; 
#chains in the Genus database with same CATH homology
 2CIM A;  3HFV A;  2ZR2 A;  11AS A;  3HTZ A;  4LNS A;  3VQW A;  2DVE A;  2I4O A;  1USY A;  2DDZ A;  2ZIM A;  4CS2 A;  1H4Q A;  1YFR A;  12AS A;  4TVW A;  1NNH A;  4XTY A;  2ZTG A;  4E51 A;  2ZZE A;  2AKW B;  1EQR A;  3KFU A;  1GGM A;  3UH0 A;  1HC7 A;  1VQZ A;  4YRL A;  1RIQ A;  2EJ9 A;  2J3M A;  4PG3 A;  4YCV A;  2C7I A;  1W66 A;  2CGH A;  3HXU A;  3A7A A;  3VBB A;  2Q5I A;  3P8T A;  4OLF A;  2ZT6 A;  2Q5H A;  4CS3 A;  3A5Z A;  4RDX A;  3L4G B;  4RMF A;  2ZNI A;  4YCW A;  4CH6 A;  2ARS A;  1PYS B;  5C53 B;  2DZC A;  5KNN A;  4HVC A;  1E24 A;  3MF2 A;  4DQ2 A;  1SRY A;  1EIY A;  1ASZ A;  2ODR D;  1X54 A;  3BFM A;  3V7C A;  4X5O A;  1YB3 A;  2DZ9 A;  2CJB A;  2ARU A;  2RHS B;  4TVA A;  3ERR A;  4DPG A;  2ZIN A;  3HY0 A;  4YRO A;  3REX A;  3TEH A;  2ZT7 A;  3L2Z A;  4XTX A;  4YRM A;  3A5Y A;  4K88 A;  4P73 C;  4P72 A;  3QTC A;  3PCO B;  1NJ5 A;  4TVA B;  4YRS A;  4WJ3 M;  4P3O A;  3RGL A;  2P0L A;  4O2D A;  2ZT5 A;  2XTI A;  3PZC A;  1B7Y B;  4BWA A;  4G84 A;  4H2X A;  4KR3 A;  3I7F A;  3R07 A;  4XTV A;  3NEL A;  3TEH B;  2DTO A;  4YRJ A;  2E64 A;  3ICA A;  4ZTZ B;  4TWA A;  4HWO A;  1HTT A;  1Z7M A;  4YRG A;  4P74 C;  4Q15 A;  3LSQ A;  3BJU A;  3WQZ A;  4KQE A;  1NYR A;  2E41 A;  3PCO A;  3L1A A;  2CJ9 A;  3IAL A;  2G4C A;  3LC0 A;  2NS6 A;  5ELN A;  2IY5 A;  2ALY A;  3IKL A;  4NCX A;  4RQF A;  4HWR A;  2DKG A;  4HA8 A;  3M4Q A;  3HFZ A;  3MEY A;  2QHS A;  2CJA A;  4YYE A;  3HRI A;  3HXV A;  1C0A A;  3HXZ A;  4TVY A;  3RL6 A;  3QNE A;  4XEO A;  4P3P A;  3RIR A;  1NYQ A;  4RQE A;  2DTI A;  2RHQ A;  3P8V A;  2I4N A;  2HNI A;  1BIB A;  4XU1 A;  2EJG A;  4HWP A;  1JJC A;  1KMN A;  3RUX A;  5C51 B;  3A74 A;  3MQZ A;  3RKY A;  1NJ6 A;  4TQF A;  5E3I A;  1SER A;  2DJZ A;  2XGT A;  1X56 A;  1ADJ A;  1YGB A;  3E9I A;  3VQV A;  2ART A;  4CS4 A;  2Q7H A;  4WJ4 A;  2AKW A;  3TEG A;  4P75 A;  3RKX A;  1ASY A;  4OP0 A;  1X2G A;  3V7S A;  1BBW A;  1YFS A;  1L0W A;  4EO4 A;  1KOG A;  1WQ7 A;  3A7U A;  2EAY A;  2ODR C;  3EFR A;  4TQD A;  1EFW A;  2QHT A;  4P72 C;  4YRI A;  3RAC A;  2EWN A;  1QF6 A;  3QO5 A;  2E1H A;  1JJC B;  1B76 A;  2J3L A;  3MF1 A;  3RKW A;  4P3N A;  4ZTU B;  3HXY A;  2PMF A;  2P5I A;  4P75 C;  4YP0 A;  2AMC A;  1WU7 A;  3A7R A;  4EX5 A;  1H4S A;  2DU5 A;  3EFS A;  1X01 A;  2ZT8 A;  2ZGW A;  2I4M A;  4PHC A;  3VQX A;  4UP9 A;  1B70 B;  1EOV A;  1ADY A;  1BIA A;  3V8L A;  4K87 A;  2DXU A;  4H2V A;  2DEQ A;  4BW9 A;  1SET A;  3NEM A;  3UGT A;  3IKM B;  5F5W A;  2DXT A;  5C52 B;  2E3C A;  2DQ3 A;  4YRP A;  1NJ2 A;  1WPY A;  1QE0 A;  1E1O A;  4L87 A;  1H4V B;  3V8J A;  3RF1 A;  3HXX A;  3VQY A;  4CH5 A;  4YCU A;  1YFT A;  3W3S A;  1EVL A;  5K1X A;  3V8K A;  3UFG A;  2ZNJ A;  4P73 A;  3QO7 A;  3DSQ A;  3IG2 A;  3M4P A;  4G85 A;  4H2U A;  4H2Y A;  1B8A A;  1EIY B;  4HT4 A;  4YPF A;  2DQ0 A;  4HWS A;  4XU2 A;  1X55 A;  4YDQ A;  1USY C;  4CH4 A;  4YRT A;  2IY5 B;  1X2H A;  4H2S A;  4YRR A;  3A32 A;  4AH6 A;  4CH3 A;  3REU A;  3HRK A;  3HXW A;  5ELO A;  2ALY B;  1G51 A;  1WQW A;  2RHQ B;  3LSS A;  2ZZG A;  2ZCE A;  1E1T A;  4UPA A;  1BBU A;  2DU7 A;  2C8M A;  4YRE A;  4LVM A;  1E22 A;  2E5A A;  4YRN A;  3NEN A;  3FJP A;  4XTU A;  3UGQ A;  3NET A;  4H02 A;  1Z7N A;  1IL2 A;  4UP7 A;  1HXD A;  4ZIB A;  3E9H A;  3L4G A;  2RHS A;  4TTV A;  1FYF A;  3HFZ B;  2QHV A;  1NJ1 A;  4J15 A;  3TUP A;  1EVK A;  3A31 A;  2E65 A;  4H2W A;  2Q7G A;  1J5W A;  4P71 C;  2EJF A;  2DTH A;  4K86 A;  2ZR3 A;  4XTW A;  5HGQ A;  4H2X B;  4XEM A;  3HY1 A;  2ZZF A;  4KR2 A;  2E10 A;  2Q7E A;  2EL9 A;  3G1Z A;  4XU0 A;  4YRK A;  2AMC B;  4UP8 A;  1LYL A;  1WNL A;  4YRC A;  4YRQ A;  3OD1 A;  4WI1 A;  1ATI A;  1H4T A;  1G5I A;  3CMQ A;  1PYS A;  1WLE A;  4LVI A;  5K1P A;  3P8Y A;  2I4L A;  3QO8 A;  2PME A;  4LVK A;  2A8E A;  1B70 A;  1WYD A;  4H2T A;  4WF2 A;  4LVL A;  1B7Y A;  1KMM A;  1G5H A;  2ZIO A;  4P71 A;  4XTZ A;  4LVJ A;  2ZXF A;  4XU3 A;  4P74 A;  1SES A;  3V7R A;  2FYK A;  1NJ8 A;  4HWT A;  4Q6G A;  2QHU A;  1N9W A;  4YRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...