2ZNJA

Crystal structure of pyrrolysyl-trna synthetase from desulfitobacterium hafniense
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
278
structure length
278
Chain Sequence
SSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Pyrrolysyl-tRNA synthetase-tRNA(Pyl) structure reveals the molecular basis of orthogonality
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase
total genus 79
structure length 278
sequence length 278
chains with identical sequence B, C
ec nomenclature ec 6.1.1.26: Pyrrolysine--tRNA(Pyl) ligase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2znjA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2znjA02
1EOVA 3VQXA 5HGQA 2AMCA 1WQWA 1SRYA 3WQZA 2ZT5A 3R07A 4P74C 4UP9A 4HWPA 4H2UA 1GGMA 4CH6A 3ZEDA 3NENA 4ZTZB 4OP0A 2E5AA 3NEMA 4PG3A 1WLEA 3HRIA 2E64A 4Q6GA 4L87A 4UP7A 4H2SA 2E65A 4CH3A 1ASZA 2ZCEA 1B8AA 4XTYA 2DU7A 3HFVA 4P74A 3V7SA 2AKWB 3P8TA 4CH4A 1EVLA 2C7IA 2QHSA 4YRNA 4CS3A 4CS4A 2ZR3A 2ZZFA 4BW9A 3A5YA 2ZXFA 2Q5HA 4KR3A 4P73A 3DSQA 5C52B 1SETA 4H2XA 2ALYA 2EJFA 4TVAB 1B76A 1H4SA 1WPYA 1NJ5A 1ADYA 2R72A 2E41A 4P73C 3BFMA 3RUXA 4HWSA 3OD1A 2Q7EA 1O9HA 2ZT7A 3RF1A 4K88A 1JJCA 4XU1A 2YIBA 1WU7A 3TEGA 4P72A 4K86A 3NETA 2ARUA 2Q5IA 3LSSA 5K1PA 2I4NA 1Z7NA 2HEPA 3ERRA 2DXTA 3HY0A 1YFTA 3A7AA 4HWRA 2ARSA 4P75A 3VBBA 1G51A 4YRCA 1SERA 4HVCA 3I7FA 3IKMB 2CGHA 4YCUA 4P3NA 1EQRA 1N9WA 4P75C 4WI1A 3L2ZA 2DEQA 3L1AA 2ZT6A 4HA8A 4YRTA 3HXYA 3HXWA 2ZR2A 3QNEA 2C8MA 1H4TA 1PYSB 2YIAA 1KMNA 1EIYB 2AKWA 4KR2A 3V8JA 2ZT8A 3V8KA 4H2YA 1RIQA 4TVWA 2PUSA 4TTVA 1E22A 2EAYA 3UFGA 3NELA 4OLFA 2DZCA 2RHQB 4TWAA 4XTXA 3V7CA 4X5OA 3A31A 3P8VA 2RJZA 1G5IA 2ODRD 3A32A 3M4QA 4TVAA 1YGBA 1B70B 2R70A 2EL9A 3RACA 3A7UA 4G84A 3RGLA 2PMEA 2ZZEA 2ZINA 2DTIA 3A5ZA 4TQDA 3RKXA 3RKYA 3FJPA 3QO8A 3L4GB 3UGTA 2DTHA 3RKWA 1EFWA 2CJBA 1NYRA 2ZNIA 1X56A 4KQEA 4YDQA 3UGQA 4CH5A 1HC7A 4YRIA 1KOGA 1BBWA 4YRSA 2ARTA 4UPAA 4RQEA 2XGTA 4TVYA 3PCOB 1IL2A 3TUPA 3HXZA 3QO7A 4EO4A 4EX5A 2CJ9A 4AH6A 1HXDA 5KNNA 2G4CA 1YFSA 1USYA 3UH0A 4DQ2A 3HTZA 1PYSA 3QO5A 1QE0A 2EJGA 2DQ0A 4H2TA 2JVDA 1EIYA 3VQYA 2QHTA 2QHUA 1USYC 1WYDA 4YRFA 3IKLA 1H4QA 4YCVA 1YFRA 4YRRA 1ATIA 2P5IA 2EJ9A 4Q15A 2YIBD 2RHQA 3E9IA 1BIBA 3V7RA 1O9GA 3RIRA 4YCWA 1KMMA 1X55A 4YPFA 2DQ3A 4WJ4A 1B70A 1ADJA 4YP0A 3W3SA 2IY5B 3QTCA 4YRLA 1ASYA 2RQ6A 1YB3A 3BHPA 1BBUA 1E1OA 2QJ1A 4YRQA 3HRKA 2XTIA 4O2DA 1B7YB 3HFZB 3IALA 4K87A 4XEMA 4YYEA 4YRGA 4TQFA 2ZZGA 3L4GA 2YI8A 1WQ7A 3HY1A 1NJ8A 4H2VA 4BWAA 2CJAA 3CMQA 2ZIMA 2EWNA 1L0WA 2Q7GA 3RL6A 1NJ6A 2ZTGA 4RQFA 4XU3A 2FYKA 3MF1A 4YREA 4RDXA 3PCOA 1H4VB 3HXXA 1W66A 3TEHB 2ZNJA 4H2WA 4UP8A 2DJZA 4XTUA 2ODRC 1HTTA 1NYQA 4ZIBA 4RMFA 3HXUA 1E24A 1G5HA 2I4MA 2QHVA 1EVKA 2RHSB 5F5WA 2PMFA 1X2HA 12ASA 4E51A 3VQVA 4HWOA 1G6UA 4WJ3M 2J3MA 4WF2A 4DPGA 4NCXA 4XU2A 3LC0A 3IG2A 4XTVA 11ASA 4XTWA 3A7RA 2AMCB 2E3CA 4G85A 3PZCA 1BIAA 4XU0A 4YROA 1QF6A 4YRMA 4HWTA 2IY5A 2I4OA 2DDZA 2CIMA 2PGGA 3BJUA 4J15A 2DZ9A 4YRPA 1E1TA 4P3OA 1NJ2A 5ELNA 2ZGWA 4P3PA 3REXA 3MF2A 5C53B 3ICAA 4H02A 3HFZA 1B7YA 5K1XA 1C0AA 2Q7HA 1X54A 4ZTUB 3KFUA 1LYLA 3E9HA 3A74A 4LNSA 1Z7MA 3EFSA 2DU5A 3MEYA 1J5WA 1X01A 2DVEA 3P8YA 2HNIA 4PHCA 1FYFA 3LSQA 4P71A 5ELOA 4XTZA 3REUA 1NNHA 3M4PA 2YI9A 3TEHA 1VQZA 2P0LA 4P72C 4H2XB 2ZIOA 1NJ1A 1WNLA 2ALYB 4XEOA 4P71C 1SESA 1X2GA 4YRJA 4CS2A 2I4LA 2E10A 5E3IA 4YRKA 2RHSA 5C51B 3HXVA 3EFRA 2DKGA 2DTOA 2DXUA 1JJCB 2J3LA 3V8LA 2E1HA 3VQWA 3G1ZA
chains in the Genus database with same CATH superfamily
5JH7B 1FXHA 5HGQA 4R7CA 3L72H 3RWRD 3PN1A 4HNAA 2DYRB 2CH7A 1WQWA 5LHIA 2OTJV 3WQZA 4OPAA 3R07A 4YJ2A 5IYBO 1K4CC 4DV3O 3ZS8C 2CUGA 4LH7A 5LHHA 2UXDB 2EJ7A 4JF3A 3NENA 2QKCA 5CBFA 3NEMA 3L74H 5BZBA 4PD4F 3OR6C 4O4HB 2QTSA 5CA0A 2EX3A 1YDXA 3CCMV 4CH3A 1EBOA 3RVYA 4NXNO 1KMIZ 2ZCEA 1B8AA 1I08A 4PI0A 1I94B 1VQNV 1SQXH 4DRXB 1BS3A 4MVZA 4E2LA 2AKWB 2YUAA 1AP6A 1SZXA 5JJEB 1SQPH 2XAGA 3A0BZ 2QWQB 3ASNB 4D6TH 1QU7A 1UPGA 2ZQMA 1XBLA 1WJZA 4I50A 1Q6HA 1B06A 3RYHB 5LYJB 4IGGA 4B08A 2ZXFA 1X4TA 2P4VA 1XILA 3DSQA 3K0DA 4EB6B 3CC7V 4H2XA 2DW4A 3GWOA 1OCRC 4TVAB 5C8YB 2F95B 1B76A 4L8JA 2F43G 5B66Z 2E41A 2R72A 4MVRA 4TOIA 3BFMA 3A0RA 1AJQA 1Q6IA 4QIWF 3A8TA 1N32B 1V55C 5EBWC 3RFRA 3JASA 3CRAA 4K88A 1OJHA 1GM8A 4KP4A 4RUEA 2YIBA 2F93B 4GT1A 4MVMA 5JH7A 3NETA 4HBNA 2ARUA 3OAAG 2Q5IA 1Z7NA 2HEPA 2L6LA 4LF6B 4FM2A 4YRCA 3SJQC 4TSFG 3OTOO 4O4JB 3JALB 5IWAB 1EQRA 1GRJA 2GHYA 1D5AA 5B1BC 3TCUA 4NB5A 4PA9A 4O4HA 2KB1A 3M99B 2DEQA 3L1AA 1GN3A 1P84F 2ADPA 4J9ZB 1PPJH 1BGYH 3QNEA 2C8MA 1PYSB 4LVMA 1R1BA 4DRXA 4DK0A 1OCOC 1CPYA 4K3AA 2AKWA 5C93A 1VP7A 2RNBA 4WFAV 4LF7B 4H2YA 4TWKA 3OEEG 4OX9O 1P7BA 3NELA 4OLFA 5LYJA 3RYHA 5FPOA 5BY1A 3MQZA 4LNUB 1W0JG 3A31A 3N2GB 2IM9A 3CCJV 3KCXA 1AR4A 4EB6A 2ODRD 1SC5B 3ETEA 4TVAA 5C8YA 1NS1A 5KAFZ 1IXBA 1MNGA 4R50A 3R65A 3A7UA 4MVQA 4NXMO 3RACA 1QLNA 4G84A 3I5DA 2PMEA 1K5SA 3K9SA 4PA6A 2ZINA 1N8RW 4O4IB 4TQDA 5B1OA 4LF9O 1R3JC 3WB1A 2OWOA 4JTDB 3FJPA 4QE9A 1S3JA 2FYUH 3ZX6A 2DTHA 3RKWA 1VARA 3GB7C 1Y76B 3CWBH 4FLWA 3SPIA 1WB7A 3ZCCA 4JI3O 1HWYA 1VQ6V 2WAMA 1ORQC 4YDQA 3G6EV 4CH5A 5LMUO 2P4KA 2HHHB 1R3IC 2GSMB 5D5QA 1JA8A 2Y69B 2ARTA 1DGSA 4H33A 1VQ7V 4TVYA 1SA0B 2JEUA 2EINC 3JCUZ 4O4JA 3JALA 3HXZA 3QO7A 4DR2O 1YTFD 4LF8O 4FLTA 4GUNA 2V4DA 3UH0A 3SJBC 2YXLA 4P2ZA 3HTZA 2Q8VA 1SQVH 5L3EA 3B40A 4X62O 4JTCB 4MTXA 4YHHO 3BA9A 4Z1MG 3QO5A 1N36O 1PYSA 4FM1A 2QHTA 1GKFA 2BSKB 3H1HH 3ABMC 4JPRA 4I4TB 2IU0A 3IKLA 1H4QA 1WPBA 3MHHC 4MVOA 2UU9O 1GM7A 4GX1A 4FZ0A 1YFRA 1ATIA 1GN2A 3PJSK 2Y0IA 2YIBD 2QR4A 4AI8A 1E79G 3N2GA 1Q7YW 2QSAA 4QJFB 3W7SA 1K9MW 4YP0A 1EN5A 3CMAV 1RM1C 3THOA 4B3TB 1ZSPA 3JAMN 2Z5UA 1YB3A 3N2KB 2E76B 4O4IA 4O2DA 1B7YB 4XEMA 4YYEA 4YRGA 5H6RA 1NKDA 4ZOLB 3HY1A 4DV7B 4JV5O 3AG4C 1M1KW 4WFEA 2AHYA 4H2VA 2BE3A 1HDJA 4LFCO 2OCCC 3CCRV 1SZTA 5EIBC 4UCUA 1U97A 4GKKB 3X2QB 5EC1C 4DR7O 4NKGB 3FB5C 3E83A 3E2EA 1Q81W 4RDXA 1K5QA 1K33A 2G38A 1M57B 2W0FC 3DTUB 4DYLA 1H2NA 3AG4B 2WPDG 2ZNJA 4UP8A 2ZM6B 5LGUA 3L9DA 1U96A 1NH2B 1NYQA 4ZIBA 4PV1B 3H1LH 4ICGA 2ZXWB 3HXUA 3GWKC 1E24A 2QHVA 1VQLV 1WB8A 4GCZA 1EVKA 2RHSB 1H8EG 5F5WA 2BSKA 3OE7G 2VWKA 3K59A 12ASA 4DV4B 4I4TA 2WLJA 4R8CA 2W0XA 2BOCC 2CTPA 1MOFA 1NTMH 11ASA 1AR1B 1P4RA 2PTMA 2E3CA 4G85A 3PZCA 4UVAA 2XTAA 3CXCU 1BIAA 4XU0A 1IXMA 1HNXO 3BA8A 3J80N 4YRMA 1QR8A 2X6AA 1VQ4V 2I4OA 2DDZA 1OHHG 1N34O 2PGGA 4DUYO 4HAMA 4BR6A 1E1TA 3WB2A 3SYQA 1MSWD 1NJ2A 2WSSG 3N2KA 1KP3A 4WFBV 2ZGWA 1ZWIC 4EKWA 1HR0O 3MF2A 3IJ4A 1AP5A 4H02A 2F1MA 3CE2A 1B7YA 1C0AA 4ZOLA 4DV1O 4NTXA 1NBMG 2Y48A 3A2FA 1F51A 3K06A 2QTOA 4X66B 5KHJA 4DV0O 3A74A 1JOYA 3SYOA 4LNSA 2C2AA 3C3SA 2GDSA 5JJNB 2AHZA 2DU5A 4U3JB 1I0HA 1J5WA 3MEYA 4X1YB 1X01A 2DVEA 3JSNA 5LMNB 4DV2B 5B3SC 3DXRB 4LFBB 4D7SA 3E22B 1LUWA 4FPPA 2DWEC 1QLEC 1XNQB 4XTZA 2QEXV 2L35A 2UXDO 4ZI7B 3SJAC 2Q5ZA 1VQZA 2ZKOA 3M7MX 2ZIOA 3ZN0A 4P71C 1SESA 2OIEA 2I4LA 1EZVH 4DV5B 1B3QA 5E3IA 2BTQB 5B3SB 2PZSA 2RHSA 5GW7A 4B3SO 4PDLA 5BR8O 1I94O 2J3LA 2Q73A 4JAUA 4J9YB 5JQGB 2ILMA 2E1HA 1K7DA 3VQWA 1WP8A 3VQXA 3ZMTA 4OGQB 3D3QA 4KXRA 4PI2A 3S3WA 3JARB 1JPXA 4P74C 1RSOB 4H37A 5JCOC 1IZ3A 3ZHQA 4HWPA 5KA5A 4H2UA 1FPOA 4CH6A 3ZEDA 2EZOA 4LVIA 5L3BA 1BE3H 3CP1A 4OP0A 4FVMA 1KC8W 1K34A 3HRIA 2E64A 4RWUA 2YIDA 1I5XA 5GONB 5LGTA 2Q9LA 4B3MB 4LFAO 2E65A 3E8FA 2WLNA 5LBQA 1ASZA 4O4LB 3K5LA 3CCVV 2DU7A 3V7SA 2Z3YA 5AG2A 4U3JA 4X1YA 3P8TA 2GUZB 1G4YB 2YICA 3DXRA 3G4SV 4YRNA 3E22A 5H5NA 1Y66A 2ZZFA 1HNWB 2P22C 4LF6O 1OV9A 2B1GA 2Q5HA 2Q68A 1PNLA 4ZI7A 4P73A 4GX5A 2EJFA 2ADQB 2A3QA 3SPCA 3B2EE 4UV8A 3QVNA 1YJWV 3ASOB 1NJ5A 3ABLC 4W4LA 2BTQA 2PF4E 1OCCB 4HWSA 3K03A 3Q4HB 3OD1A 3ML0A 1ZAUA 2Q7EA 2XT9A 1O9HA 2ZT7A 1YEWA 2PI5A 3K08A 4JZGA 2A0LA 5JQGA 2RMKB 1XUQA 3TEGA 4K86A 3ZHSA 1FJGB 3OUFA 5KLVH 3WG7B 2GTAA 4UB8Z 2DXTA 3HY0A 3OM3B 3ABLB 1XEQA 4DR4B 3JARA 1RSOA 4P75A 4PDRA 1G51A 5D5PA 1SERA 3IKMB 1WA8B 2DYRC 3T1YO 3D36A 4DUZO 4DR1O 1KU9A 5GONA 3SYCA 2JS3A 2ZT6A 4HA8A 3HXYA 4I55B 4JI6B 4O4LA 2K1EA 5B1AC 4PA7A 3ZN1A 3F7VC 2YIAA 1EIYB 1N33B 3S3XA 3ZRSA 2QM8A 4MT8A 5LP6C 2QM7A 2GUZA 2YEVB 4TVWA 2W6IG 1RPRA 1Z5WA 2ETNA 1E22A 1FXKB 4H13B 2HHHO 4JI1B 4K8ZA 2DZCA 4A5UB 2RHQB 2JJ2G 3ZMVA 4XTXA 3V7CA 3P8VA 2WLMA 5KMGB 3E8GA 2MW2B 3ASNC 5B1AB 3G71V 4KHPB 4FFBB 2VRZA 1W59A 3LDCA 3B8MA 5LP6B 2V7QG 3HKEB 1VQ8V 1HNZB 3Q4HA 4P9OA 3TXQA 3LDDA 3NR7A 1QVFU 5GTHZ 1NTZH 2PY5A 1AJNA 3K04A 5IY5B 4IHJB 4LP8A 2WLKA 4CC6A 1AILA 3W7XA 4K0KB 1L1FA 1X56A 1JMKC 2IJKA 3SGIA 4JAAA 1QVGU 1PL0A 4EFBA 4OPHA 4LR3A 4UUJC 1KOGA 4LF4B 4LVKA 4YY3O 1BBWA 3EVKA 4UCSA 5EBMC 1BHBA 1V54C 4OXSA 2QWPB 3TK1A 4DR6B 4GKJB 4UPAA 1WA8A 2VQEB 3OD4A 5CMUA 4RQEA 3PCOB 1NVPB 4EO4A 4EFEA 1ENVA 4EX5A 1MZFA 2P6JA 3IFXA 1Q3EA 4B3TO 4LVJA 2JGUA 4JI4B 5JWPA 4DQ2A 1US6A 4I55A 3ZHUA 3ABUA 1BQZA 3CRMA 1EIYA 4DV7O 1V54B 3RGBA 1M93A 1BQ0A 5EBLC 5IDJA 3W7UA 2YEVA 4YRFA 3W7WA 3B77A 1XL6A 4IL6Z 4GKKO 4YJ3B 4YRRA 1FXKA 1Q86W 1M9NA 4D7TA 4JI8B 1UJWB 1BT8A 3AG2B 2YSUB 2RHQA 2UXCB 1BIBA 3E9IA 4J80A 1O9GA 3RIRA 5KMGA 5CBHA 4IYHA 1X55A 5F2VO 2DQ3A 4LC1A 4FFBA 4WJ4A 1PKXA 4ZBMA 1VQMV 3AG1B 3QTCA 5LP6A 4YRLA 1ASYA 3HKEA 2ZM6O 2FMLA 2DOSA 2QJ1A 1OZ0A 1E1OA 4MS2A 2ZDIC 1G1XB 1WAZA 2XTIA 3HFZB 3IALA 1B6QA 4TQFA 2YI8A 1WQ7A 3CX5F 3A0HZ 4IHJA 1FXVA 4AQYB 3CS5A 4BWAA 1GAXA 3CXHF 3CMQA 4KL1A 1YI2V 5J2TB 3FFQA 1S72V 1DF4A 1Z5VA 1WPXA 1BSMA 2LFRA 1NR1A 1NJ6A 2ZTGA 2KG7B 4XU3A 2FYKA 5JJJB 3IC9A 3PCOA 5H9CA 3HXXA 1K92A 1GMGA 4H2WA 3KCYA 3FYIB 4HZ3A 1PV0A 3RBZA 1TVKB 2Y69C 4JZ2A 4XTUA 4XDKA 1A32A 4RMFA 5L3FA 2EIJB 1XMQB 2Z0AA 3LUTB 5IT9N 3GVMA 3ZMSA 5EC2C 5IYZB 2PMFA 4I0XB 4E51A 2EILB 3CRCA 4YJ3A 2AW9A 4H44B 3LC0A 5LA6B 3IG2A 5A9GA 4XTWA 4DV2O 2AMCB 4LFBO 2WLLB 1NQTA 3H01A 1R3KC 3AEIA 1FYJA 1P49A 2DYSB 4PA3A 4MTFA 4YROA 2IH3C 3IAYA 1QF6A 4HWTA 1VEWA 2HVKC 4X65O 3CSXA 1GO3F 4DR5B 4JI2B 4P3PA 3REXA 1KKCA 1NZ6A 3JD3A 4DV5O 3HFZA 3EXAA 2NS6A 4FK5C 2H3OA 2KSDA 1MABG 5CBGA 5DN6G 1X54A 5B5EZ 5J2TA 1Z7MA 3P3PA 3EFSA 4LVLA 4LNUA 2KG7A 3HPLC 4R6ZA 2GTSA 1BL8A 4Z1VA 3CEIA 3CCQV 3QG5A 3P8YA 2Q0AA 4IIJB 2X7RB 5LL6Y 1FYFA 2ZDIA 5L3CA 3X2QC 1XQ8A 4AILC 1R6KA 3M4PA 2YC0A 1AR5A 1EM1A 4JI7O 2P0LA 4TUYB 1AVMA 1QCEA 1TVKA 1WP7A 1GK9A 3E8HA 4F4LA 1WNLA 2ALYB 5LHGA 2ZE5A 1M57C 2ZD9A 4RO2A 4CS2A 2E10A 2UXNA 4UB6Z 3SPJA 4Z2WA 1Y76A 1NI8A 2HFEC 2EIKC 5IYZA 2LFSA 4MW8A 4NR1A 3HXVA 3CD6V 1XREA 2DTOA 4I0XA 2DXUA 1YSCA 4QPJA 2LQTA 1JJCB 4WCEV 4JYAB 2ZXWC 3AG7A 1NJIW 1YXBA 3G1ZA 3ABKC 3U11A 4I9QA 5LA6A 1S77D 2QWRB 4I9WA 1W2BU 2AMCA 2VQFB 2OT5A 1KKDA 2WLLA 3SJCC 1SA0A 3ZHRA 2CK3G 3E35A 1SRYA 5HFLA 1HNWO 3F5WC 2ZT5A 2R9IA 2NLJC 4UP9A 2V1DA 2EIKB 3APOA 3BEHA 2ARHA 2P06A 3UKMA 3I56V 1J5EO 4J7JA 1GTOA 5KHHA 1M5IA 2X6BA 1AB3A 4WFHA 5HFMA 1CXZB 1L0NH 3B4SA 3OTOB 3U0ZA 1NVPD 4J7ZA 2HVJC 3ABKB 4LF5O 1KUQA 3JD2A 3BAAA 2QM4A 1F23A 2E74B 3KZIZ 2IJHA 3O9OA 4P9PA 5KHKA 3CCEV 3HFVA 1Q90D 3UT5B 1VQOV 3RT3C 4DO2A 2A8EA 1EVLA 2C7IA 2QHSA 2LW7A 2CDYA 4IIJA 4N21A 4U7OA 3OR7C 1XMOB 1XNRO 2FTKA 4CS3A 2ZR3A 4CS4A 2UUBO 4DR4O 1HP8A 4RAIA 1KB9F 4QPKA 4TUYA 2E75B 5C52B 1SETA 5L3DA 2DMXA 3J7AU 2ALYA 3T4DA 3BCCH 4XDLA 4B7KA 5H6QA 1DLBA 4P73C 3ZHTA 3RUXA 1LR1A 2A7WA 4NXMB 2FKXA 2F66C 4QGPA 3WB0A 1FS0G 4JI6O 3RF1A 1JJCA 3DC6A 2Q0OC 1FKAO 1N33O 1EZJA 3JAWB 3STZC 4H0LB 1Q5OA 3J81N 4GYCB 2XAJA 2N04A 3LSSA 2XUMA 3TGUH 2HG5C 2QGNA 1PD3A 4HWRA 4FIPC 2ARSA 1VF6C 5LMUB 5H2FZ 3I55V 1M4UA 2UXXA 1URFA 4HVCA 2Q69A 3JAKB 4UV9A 1VQ5V 4KHPO 2R9AA 3UM7A 3UO3A 4P75C 4X9QA 3CC2V 4YXWG 2XHBA 3FB6C 1XDCA 2WA4A 1HNZO 5KAIZ 4K35A 4YRTA 3F5TA 3H1IH 3D36C 3CHXA 1SQGA 3D8CA 3HXWA 4NYKA 4F6EA 2JGDB 4MTGA 3UT5A 3V8JA 2CTQA 2EZPA 1IDSA 1IBMB 4K0KO 3U10A 2HJFC 2PUSA 4TTVA 2EAYA 3UFGA 3MD0A 2UU9B 4LF4O 5KHGA 3L70H 5DEDA 3ETQA 4X5OA 2RJZA 4EEQA 1G5IA 3IC7A 3A32A 2PI4A 1D2DA 3ABTA 1YGBA 2R70A 2EL9A 2ATKC 4X88A 2DWDC 3T1HB 2UXBB 1N32O 3H1KH 4KFMA 5IJ0B 4JI4O 3RGLA 1IBKB 2LGQA 1I7FA 3ETDA 5FPRA 3OUSA 4PELA 1DK1A 2DTIA 3APQA 2AGAA 1VQPV 4K8XA 1CEZA 3RKXA 3M8AA 3ZRXA 3L73H 3RKYA 1WNSA 1EFRG 1XL4A 2A9HA 4FJCC 3SR2C 3ASOC 3L4GB 2XNDG 3UGTA 3JAWA 2CTRA 1YIJV 3EHBB 3UCSC 4PDMA 1EFWA 1OCCC 2CJBA 1Y74B 4JYCA 4U7NA 2IJJA 4X20B 4KQEA 1KBHA 3UGQA 1H2KA 1KP2A 1HC7A 1K73W 4YRIA 5IYCO 1JJOA 3HKCB 4G27B 2UXCO 2PYLA 4W4KA 1XI1A 4J10A 2GV9A 4J41A 3WG7C 5IWAO 3TUPA 1IL2A 2CH7B 3JAKA 4B3RB 2NR5A 2M6YA 3G6BA 1SQQH 1HXDA 2G4CA 1H2GA 5CN0A 4I7ZB 4BAYA 4FLXA 2QWNB 4MW3A 1AROP 1USYA 1GM9A 3BPZA 3K5NA 3C3TA 2EIMB 2ZE6A 4XBFA 1QE0A 3SYAA 1VF6A 1AI7A 2DQ0A 3ZHVA 2JGDA 3VQYA 2E5LB 1IBLB 4AQYO 1THZA 2QHUA 4LF7O 4IYIA 4O2AB 1PNKA 4CC5A 1FAFA 4YCVA 4G28B 1UFIA 2Q6AA 4E4EA 5KHIA 3V7RA 3ZMZA 3ZRWB 2UUCB 3JCZA 3BVOA 4GX0A 1FXKC 1D5NA 1HNXB 1YTFB 1ADJA 3K5MA 5IE9A 4FMTA 3E86A 5IJ0A 3H9VA 4DUYB 4WBNB 1NH2D 1XMQO 4YRQA 3HRKA 3RVZA 2QWOB 1HR0B 3HKBB 2ZZGA 3L4GA 1YVWA 5KA6A 1NJ8A 1B04A 3W7TA 1Y74A 2ZIMA 4HYOA 1EN4A 4X20A 2IU3A 4DV0B 1L0WA 1MZEA 2H94A 2HR3A 2Q7GA 5IY5C 3HKCA 3OMIB 4JI0B 1S5HC 1PNMA 2DJVA 4PHZA 1F4MA 2ITDC 1NR7A 2P90A 4ABMA 4DK1A 5KUMA 3SYPA 1LNQA 1H38A 3AK3A 3G67A 5FLXN 3QF7A 4BIOA 1HTTA 4DR5O 2XASA 4JI2O 2EJRA 2JK5C 5BMVB 2F4VB 3CRQA 4FLVA 4BW5A 1VQ9V 2W6JG 3AK2A 1Q8IA 4UCOA 1X2HA 3K5OA 4O2AA 1NT2B 4LH6A 1BZKA 2J3MA 4B3SB 4WF9V 4WF2A 5BR8B 1NU1H 2DE0X 3T2MA 3OMAB 2XAQA 4XTVA 4DV6B 4G2KA 2AXTZ 4DXWA 2IH1C 2XOKG 2UUAB 3ZRWA 1T5EA 1YCIA 3AG3C 3AG2C 2CIMA 1VQKV 3BJUA 4J15A 2DZ9A 4P3OA 3ICXA 5ELNA 3EFFK 2Q67A 4WBNA 5FNVB 1PL4A 4DR3B 1ZTEA 3AG1C 3HB3B 3HKBA 2HP8A 4JI5B 1JFFB 4LFAB 3T4ZA 1IVSA 4QNHB 3CMEV 3SPHA 4B7EA 2ODMA 3KFUA 1LYLA 1BHAA 3OGIB 4FLZA 3ZBHA 4PJ0Z 4TV9B 3HKDB 4JYAO 4YIOA 3AG3B 2A79B 2KQXA 3K57A 4TT3G 4MVSA 2VQFO 2HNIA 2Y0PA 4UVCA 2N05A 2YS8A 1OCRB 2JDIG 3LSQA 3TXSA 2AZ2A 4J42A 4ZHQB 2JRIA 5LXTB 1QR9A 5ELOA 3REUA 5BXZA 2QDOA 1K97A 4Q20A 1CP9A 2Y4UA 4P72C 1V55B 4UVBA 2CAZC 3E8BA 1S5JA 2GBOA 4XEOA 1MA1A 5BMVA 3WU2Z 2QKSA 3T1CA 4DV4O 1COWG 5C51B 3EFRA 4NTYA 3STLC 2DKGA 1AI6A 3C90A 2EIJC 4QE7A 3O65A 1L0LH 1H2LA 1SQFA 3CB2A 1EOVA 1F4NA 2OCHA 3CPWU 3ZMUA 3RYIB 4X8AA 1XMOO 1IX9A 2EILC 3RN4A 2RN9A 1HW7A 3G80A 4X64B 5B1BB 3N27A 2X6CA 1YJ9V 3E89A 2B1IA 1GGMA 4BIUA 1R6NA 3OMNB 4ZTZB 3DC5A 4JGSA 2E5AA 4PG3A 3ZRVA 1WLEA 2F23A 4Q6GA 2DYSC 5FNVA 5KUKA 4L87A 3T1YB 4GX2A 1VIBA 2X0LA 4DUZB 4H2SA 4UP7A 1OCOB 2EBOA 4DR1B 2AZ0A 4F6RB 4FM0A 2IBZH 3OGCC 1JFFA 3FAVB 4X66O 1N0JA 3L71H 4AHCA 4XTYA 4TV9A 3HKDA 1TA8A 4BIZA 4LWSB 1YJNV 2EULA 5LMNO 4JTAB 3OTFA 4CH4A 1E1RG 1DF5A 3DGEA 2B5UA 1XNQO 1SS3A 4BW9A 3RYCB 4ZHQA 3A5YA 5J2UB 5LXTA 5KX5B 4DV3B 3HR0A 1Y67A 1H2MA 4KR3A 4NTWA 2JS5A 3JD4A 3UQ8A 1GN6A 1F7YA 1ZX3A 2N74A 3FX7A 4I5SA 1H4SA 1WPYA 1ADYA 1PM9A 4O2BB 2CGNA 3P3NA 4DW0A 4LCUC 4NXNB 3R66A 2D2CB 4XU1A 1Q82W 5TISZ 1WU7A 4N23A 4LBEC 5J9PC 5LGNA 2VWJA 4P72A 1IBMO 1R3LC 5K1PA 3RYIA 2I4NA 2EINB 3ERRA 1YFTA 3A7AA 2OYQA 3VBBA 1I5YA 2NNUA 4YY3B 2YDEA 3I7FA 2CGHA 1M90W 2XAHA 4B3MO 4P3NA 4YCUA 1R6TA 1N9WA 3B09A 4UFZA 4WI1A 3T1HO 3L2ZA 2UXBO 4UCRA 1MMMA 1BMFG 4F6RA 2JEXA 4DW1A 1IBKO 3FAVA 3NXSA 1R73A 1X59A 3ABMB 1Q43A 2IJIA 5DM6V 4GZRB 3F7YC 1S5LZ 2FL4A 4JASA 1QQCA 2ZR2A 1H4TA 5CA3A 1DTOA 3MHSC 1KMNA 4LWSA 1YZBA 1GN4A 1E1QG 4KR2A 2ITCC 4PDVA 2QA4V 4ZKIA 2ZT8A 4JAVA 3V8KA 1RIQA 3RYCA 1M56C 5J2UA 5KX5A 1RM1B 4TWAA 1ZLZA 1KD1W 1JQ0A 5GTIZ 3TJTA 3UO2A 3M4QA 4TV8B 4B3RO 3KG2A 5IJ9B 1B70B 1J95A 3JATB 2ZE8A 1QBZA 2JJ1G 2ZZEA 4O2BA 2OCCB 4J11A 4P30A 4WFFA 2MK3A 3A5ZA 1AI5A 4JYYA 3CYOA 2OIGA 2WA3A 2DN9A 1M56B 3QO8A 5L3GA 2E5LO 1IBLO 1OCZC 1FJGO 1VMGA 4FZ1A 1NYRA 2WLIB 2ZNIA 1XHXA 4OX9B 5CB4B 4MTOA 3CCLV 2JIZG 4FLUA 4XDJA 2BCCH 1H8HG 1TGOA 4YRSA 4YIPA 5ITZB 3RYFB 2UUCO 3FD9A 4FLYA 1Y4MA 1NTKH 1EN6A 3BRCA 2XGTA 1V9PA 5DECA 3VOUA 4MSWC 1TUBB 2HKOA 1JVMA 1OCZB 2CJ9A 4AH6A 2HLDG 5KNNA 1KYOF 4CBCA 3LNMB 1YFSA 4J7KA 2K9PA 5E1AC 2B9ZA 2LGWA 2VS0A 3K79A 3FYEB 1XOUA 1AI4A 4LF9B 1QNMA 1L8DA 3TETA 4WFGA 3KKYA 2EJGA 4H2TA 2JVDA 4UXNA 1USYC 3H1JH 1BCCH 2XAFA 3ETGA 3FB8C 1G8MA 1WYDA 1N4CA 1IURA 1Y6XA 4FFKA 1FFTB 5EK0A 4JI3B 4JI1O 1YITV 3CCSV 3K58A 1AJPA 4UCVA 3MDSA 3ZIAG 2IW5A 2P5IA 2Q4PA 4JI0O 2EJ9A 4Q15A 3ZJZA 5JVDB 4MVUA 5LOVB 4YCWA 1VF5B 3B8NA 1KMMA 1JR9A 4YPFA 4TV8A 2R9RB 3BABA 2M7WA 5IJ9A 4DR2B 1B70A 3W3SA 2IY5B 3JATA 4LF8B 3JD1A 2RQ6A 1RFYA 4KUMA 3WFVA 3BHPA 4C7UA 1BBUA 4X65B 3CJHB 4HT4A 2F4VO 4X62B 1ZUQA 3JSLA 4YHHB 4K87A 5B1NA 1N36B 3LNNA 3FKSG 4U3FH 1TAEA 3MAQA 1ZL8B 3K0GA 4UCTA 1SF9A 2CJAA 2FB5A 2WLIA 1MSDA 2P67A 1FFXB 2EWNA 1K4DC 4RUFA 3BFRA 1QLEB 3RL6A 5CB4A 3JD0A 2QE7G 4DV6O 1YHQV 4RQFA 3P30A 4DR6O 3CC4V 4GKJO 2VQEO 3L75H 2BTOA 3MF1A 2UUAO 4YREA 4X1IB 3RYFA 5ITZA 1QHTA 3D3IA 2BOBC 1JCHA 1H4VB 1TUBA 1KECA 1W66A 3TEHB 4ASUG 2P5OA 5EYPB 2Y4TA 2H8PC 5CA1B 2DJZA 4X1KB 4JI7B 1GH6A 2ODRC 1K3EA 5EZYB 4DR3O 2CE4A 2CTWA 1G5HA 2I4MA 4PA4A 4CZZA 4JI5O 4JV5B 3LDEA 3P32A 1PP9H 2RDCA 4LFCB 1N0NA 3VQVA 4HWOA 1G6UA 3AK1A 4WJ3M 2EIMC 4JI8O 1YF2A 4GLXA 4DPGA 4NCXA 4XU2A 1JJ2U 4DR7B 2P7TC 3A7RA 5JVDA 5LOVA 4HNAB 4JYBA 3FB7C 4IT5A 2HJDA 2ZT9B 4YJ2B 3CCUV 1S0VA 3LSUA 5E79Z 2IY5A 2LW1A 1VF7A 2LJ2A 2YXHA 1J5EB 1P7GA 2WLHA 5A2QN 4YRPA 2CGOA 3CJHA 2QKAA 5C53B 3ICAA 3SPGA 1JX9A 5K1XA 3RW0A 5FL7G 5CA0B 2Q7HA 4LF5B 1ZL8A 4ZTUB 2OTLV 1FD9A 1SQBH 3E9HA 1RP3B 2YXYA 2LO1A 2KKWA 2O57A 1Q6UA 2A06H 1FFXA 1H2SB 1TUEB 1MG1A 4NVPA 2D3OW 2NN4A 3JYCA 2WWWA 1S76D 3OW2U 1ROPA 4PHCA 1K8AW 4X1IA 1RPOA 5IYDO 3OT7A 4I50B 4P71A 1XNRB 4X64O 3CRRA 1LUVA 3SDLA 2UUBB 1NNHA 3K3WA 3TEHA 2YI9A 5EYPA 1KQSU 2ZE7A 1N34B 4H2XB 5CA1A 4X1KA 1XHZA 1NJ1A 3OEHG 1Z2GA 5EZYA 1W0KG 4X89A 1X2GA 4YRJA 4DV1B 4YRKA 1WN7A 1SKVA 2LP7A 3BY6A 3JASB 3IGAC 5EIBD 3OFNG 2PYJA 2RCVA 3V8LA 4P74A 3K9AA 5JCOA
chains in the Genus database with same CATH topology
3U11A 4I9QA 3CB2A 5LA6A 5JH7B 1EOVA 3VQXA 5HGQA 2AMCA 2VQFB 3RWRD 3RYIB 3PN1A 4HNAA 3SJCC 1SA0A 1WQWA 4PI2A 1SRYA 3WQZA 2ZT5A 3R07A 4YJ2A 1HW7A 3JARB 4P74C 4UP9A 4X64B 5JCOC 3ZS8C 4HWPA 4LH7A 2UXDB 4H2UA 1GGMA 4CH6A 3ZEDA 3NENA 5KHHA 4ZTZB 4LVIA 1M5IA 4OP0A 2E5AA 3NEMA 4FVMA 4PG3A 1WLEA 3HRIA 2E64A 4Q6GA 5FNVA 5GONB 4L87A 3OTOB 3T1YB 3U0ZA 4DUZB 4UP7A 4H2SA 4B3MB 4DR1B 4O4HB 4F6RB 4FM0A 2E65A 5CA0A 2EX3A 1JFFA 3BAAA 2QM4A 4CH3A 1ASZA 1KMIZ 2ZCEA 4O4LB 4AHCA 1B8AA 4PI0A 3K5LA 4XTYA 1I94B 2DU7A 4TV9A 3HKDA 5KHKA 3HFVA 4DRXB 1TA8A 4P74A 3V7SA 4U3JA 2AKWB 3UT5B 4X1YA 2A8EA 3OTFA 5JJEB 4CH4A 3P8TA 1EVLA 2C7IA 2QHSA 4IIJA 1XMOB 4YRNA 3E22A 4CS3A 4CS4A 2ZR3A 4I50A 2ZZFA 4BW9A 2P22C 3RYCB 1HNWB 4ZHQA 3A5YA 3RYHB 5J2UB 5LXTA 5KX5B 5LYJB 4DV3B 4B08A 2ZXFA 1X4TA 2Q5HA 4KR3A 4ZI7A 3DSQA 2JS5A 4P73A 3UQ8A 4TUYA 4EB6B 5C52B 1SETA 4H2XA 2ALYA 2EJFA 4TVAB 5C8YB 2F95B 1B76A 1H4SA 3B2EE 1WPYA 4L8JA 1NJ5A 1ADYA 2R72A 2E41A 4TOIA 4P73C 3BFMA 3RUXA 2BTQA 4O2BB 4NXMB 4HWSA 1N32B 3OD1A 2Q7EA 1ZAUA 3RFRA 1O9HA 3JASA 2F66C 1YEWA 3WB0A 4NXNB 2ZT7A 3RF1A 4K88A 1JJCA 4XU1A 5JQGA 3JAWB 2YIBA 2F93B 1WU7A 3TEGA 1Q5OA 5JH7A 4K86A 2VWJA 4GYCB 3NETA 4P72A 4HBNA 1FJGB 2ARUA 2Q5IA 3LSSA 5K1PA 3RYIA 2I4NA 1Z7NA 2HEPA 3ERRA 2DXTA 3HY0A 1YFTA 3A7AA 4LF6B 2OYQA 4DR4B 3JARA 4HWRA 1RSOA 2ARSA 4P75A 3VBBA 4FM2A 5LMUB 1G51A 1M4UA 5D5PA 4YRCA 4YY3B 1SERA 4HVCA 3I7FA 3IKMB 2CGHA 3JAKB 4O4JB 3JALB 4YCUA 5IWAB 4P3NA 2R9AA 1EQRA 1KU9A 5GONA 1N9WA 4UFZA 4P75C 4WI1A 1D5AA 3L2ZA 4UCRA 2XHBA 4O4HA 4F6RA 2DEQA 3L1AA 1Q43A 2ZT6A 4HA8A 4YRTA 3HXYA 4I55B 4JI6B 4O4LA 1QQCA 1SQGA 3CHXA 2ZR2A 3HXWA 2C8MA 3QNEA 1H4TA 1PYSB 4LVMA 4DRXA 2YIAA 4DK0A 1N33B 1KMNA 1EIYB 2AKWA 3UT5A 4KR2A 5LP6C 3V8JA 1IBMB 2ZT8A 4LF7B 3V8KA 4H2YA 3U10A 1RIQA 4TVWA 2PUSA 1Z5WA 4TTVA 1E22A 2EAYA 3UFGA 2UU9B 3NELA 4OLFA 4JI1B 3RYCA 5KHGA 4K8ZA 5LYJA 3RYHA 5FPOA 5KX5A 5J2UA 2DZCA 2RHQB 3MQZA 4LNUB 4TWAA 4XTXA 3ETQA 3V7CA 4X5OA 3A31A 3P8VA 3N2GB 2IM9A 2RJZA 4EEQA 5KMGB 1G5IA 4EB6A 2ODRD 3A32A 3M4QA 4TV8B 4TVAA 5IJ9B 4FFBB 5C8YA 4KHPB 1B70B 2R70A 1YGBA 3JATB 2EL9A 3T1HB 3RACA 2UXBB 3A7UA 5LP6B 4G84A 5IJ0B 3RGLA 3HKEB 2ZZEA 1IBKB 4O2BA 2PMEA 1I7FA 1HNZB 5FPRA 2ZINA 2DTIA 3A5ZA 4O4IB 4TQDA 4K8XA 3WB1A 3RKXA 2OWOA 3RKYA 3FJPA 1WNSA 3QO8A 3SR2C 3L4GB 2PY5A 3UGTA 3JAWA 2DTHA 4IHJB 3RKWA 1EFWA 2CJBA 4FLWA 1NYRA 4CC6A 4X20B 4K0KB 2ZNIA 1X56A 1JMKC 4KQEA 3SGIA 3UGQA 1XHXA 4YDQA 4CH5A 4EFBA 4OX9B 5CB4B 1HC7A 4YRIA 4LR3A 2HHHB 1JJOA 3HKCB 4LF4B 1KOGA 4LVKA 4FLUA 1BBWA 2PYLA 4UCSA 1TGOA 5D5QA 1XI1A 4YRSA 2ARTA 1DGSA 5ITZB 3RYFB 4GKJB 4DR6B 4UPAA 2GV9A 4FLYA 2VQEB 3BRCA 2XGTA 4TVYA 3PCOB 1SA0B 1V9PA 3JAKA 4O4JA 4RQEA 1IL2A 3TUPA 3JALA 3HXZA 4B3RB 3QO7A 4EO4A 4EFEA 1TUBB 4EX5A 2CJ9A 4AH6A 4FLTA 1HXDA 5KNNA 2G4CA 1Q3EA 4LVJA 4FLXA 2JGUA 1YFSA 4JI4B 2V4DA 1USYA 3UH0A 3BPZA 3K5NA 3SJBC 4DQ2A 2YXLA 3HTZA 4I55A 4LF9B 1L8DA 3BA9A 1PYSA 3QO5A 1QE0A 2EJGA 4FM1A 2DQ0A 4H2TA 2JVDA 1EIYA 3VQYA 2E5LB 3RGBA 1M93A 1IBLB 2QHTA 2QHUA 1USYC 1WYDA 4I4TB 4O2AB 4YRFA 3IKLA 1H4QA 1WPBA 4CC5A 4JI3B 4YCVA 3K58A 4YJ3B 1YFRA 4YRRA 1ATIA 4UCVA 4D7TA 2P5IA 4JI8B 2EJ9A 4Q15A 2YIBD 2RHQA 5KHIA 2UXCB 1BIBA 3E9IA 3V7RA 5JVDB 1O9GA 5LOVB 3RIRA 3N2GA 5KMGA 2UUCB 4YCWA 1KMMA 1X55A 1SQFA 4YPFA 4TV8A 2DQ3A 3BABA 5IJ9A 4FFBA 4DR2B 1HNXB 1B70A 4WJ4A 1ADJA 4YP0A 3K5MA 3W3SA 2IY5B 3JATA 4LF8B 3QTCA 3THOA 5LP6A 4B3TB 4YRLA 1ASYA 5IJ0A 2RQ6A 3HKEA 1YB3A 3BHPA 3N2KB 4DUYB 1BBUA 4X65B 4WBNB 2QJ1A 1E1OA 4HT4A 4O4IA 4YRQA 4X62B 3HRKA 3JSLA 4YHHB 2XTIA 3HFZB 1B7YB 3IALA 1HR0B 4K87A 4O2DA 4XEMA 1N36B 3HKBB 4TQFA 3LNNA 4ZOLB 2ZZGA 2YI8A 1WQ7A 3L4GA 3HY1A 1TAEA 3MAQA 4DV7B 4IHJA 4AQYB 1NJ8A 4H2VA 4BWAA 1B04A 4UCTA 2CJAA 3CMQA 4KL1A 5J2TB 2ZIMA 3FFQA 5EIBC 4UCUA 4X20A 1FFXB 2EWNA 4DV0B 1L0WA 1Z5VA 2Q7GA 4GKKB 3RL6A 5CB4A 1NJ6A 2ZTGA 3HKCA 4JI0B 4RQFA 4XU3A 2FYKA 5JJJB 4PHZA 2BTOA 3MF1A 4YREA 4X1IB 3RYFA 5ITZA 4YYEA 4RDXA 4DK1A 1QHTA 3PCOA 1H4VB 3HXXA 1TUBA 1W66A 3TEHB 2P5OA 5EYPB 2ZNJA 4H2WA 4UP8A 1TVKB 3QF7A 5CA1B 2ZM6B 2DJZA 4X1KB 4JI7B 4XTUA 2ODRC 1HTTA 1NYQA 4ZIBA 4RMFA 5EZYB 1XMQB 5BMVB 2F4VB 4FLVA 3HXUA 1E24A 1G5HA 2I4MA 2QHVA 4JV5B 1EVKA 2RHSB 1Q8IA 5IYZB 5F5WA 4UCOA 2PMFA 2VWKA 4LFCB 1X2HA 3K59A 12ASA 3K5OA 4I4TA 3VQVA 4DV4B 4O2AA 4E51A 4HWOA 1G6UA 1NT2B 4LH6A 4WJ3M 2J3MA 4B3SB 4WF2A 5BR8B 4YJ3A 4DPGA 4GLXA 4NCXA 4XU2A 4DR7B 5LA6B 3IG2A 4DV6B 3LC0A 4XTWA 4XTVA 11ASA 3A7RA 2AMCB 2PTMA 2E3CA 5JVDA 4G85A 5LOVA 3PZCA 4HNAB 2UUAB 1BIAA 4XU0A 1P49A 3BA8A 4YROA 4YJ2B 1T5EA 3IAYA 4YRMA 1QF6A 4HWTA 2IY5A 2I4OA 2DDZA 2CIMA 1VF7A 2PGGA 1J5EB 3CSXA 3BJUA 4J15A 2DZ9A 4YRPA 1E1TA 4P3OA 3WB2A 1NJ2A 3ICXA 3N2KA 4DR5B 5ELNA 4WBNA 4JI2B 2ZGWA 5FNVB 4P3PA 3REXA 3MF2A 5C53B 4DR3B 3ICAA 4H02A 2F1MA 3HFZA 1B7YA 5K1XA 1C0AA 3HKBA 2NS6A 4ZOLA 4JI5B 5CA0B 1JFFB 4LFAB 2Q7HA 3A2FA 4LF5B 1X54A 4ZTUB 4X66B 5KHJA 1LYLA 5J2TA 3E9HA 4FLZA 3A74A 3KFUA 2KKWA 4TV9B 4LNSA 3HKDB 1FFXA 1Z7MA 1H2SB 5JJNB 3EFSA 2DU5A 4NVPA 4U3JB 3K57A 3MEYA 1J5WA 4LVLA 4X1YB 4LNUA 1X01A 2DVEA 3JSNA 5LMNB 4DV2B 3QG5A 3P8YA 2Q0AA 2HNIA 4LFBB 4IIJB 4D7SA 3E22B 4PHCA 4X1IA 1FYFA 3LSQA 4I50B 4ZHQB 4P71A 1XNQB 5LXTB 1XNRB 5ELOA 1XQ8A 4AILC 4XTZA 2UUBB 3REUA 1NNHA 4ZI7B 2YI9A 3SJAC 3M4PA 3TEHA 5EYPA 1VQZA 2P0LA 4TUYB 1N34B 4P72C 3M7MX 4H2XB 1TVKA 5CA1A 2CAZC 2ZIOA 4X1KA 1XHZA 1NJ1A 1WNLA 2ALYB 4YRGA 1S5JA 4XEOA 5EZYA 5BMVA 4P71C 1SESA 1X2GA 4YRJA 4CS2A 2I4LA 4DV5B 2E10A 5E3IA 2BTQB 4DV1B 2PZSA 4YRKA 1WN7A 2RHSA 5IYZA 1SKVA 5C51B 3HXVA 3EFRA 3JASB 2DKGA 2DTOA 2DXUA 1JJCB 2J3LA 5EIBD 2PYJA 5JQGB 4JYAB 3V8LA 2E1HA 3VQWA 3G1ZA 5JCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOV A;  3VQX A;  5HGQ A;  2AMC A;  1WQW A;  1SRY A;  3WQZ A;  2ZT5 A;  3R07 A;  4P74 C;  4UP9 A;  4HWP A;  4H2U A;  1GGM A;  4CH6 A;  3ZED A;  3NEN A;  4ZTZ B;  4OP0 A;  2E5A A;  3NEM A;  4PG3 A;  1WLE A;  3HRI A;  2E64 A;  4Q6G A;  4L87 A;  4UP7 A;  4H2S A;  2E65 A;  4CH3 A;  1ASZ A;  2ZCE A;  1B8A A;  4XTY A;  2DU7 A;  3HFV A;  4P74 A;  3V7S A;  2AKW B;  3P8T A;  4CH4 A;  1EVL A;  2C7I A;  2QHS A;  4YRN A;  4CS3 A;  4CS4 A;  2ZR3 A;  2ZZF A;  4BW9 A;  3A5Y A;  2ZXF A;  2Q5H A;  4KR3 A;  4P73 A;  3DSQ A;  5C52 B;  1SET A;  4H2X A;  2ALY A;  2EJF A;  4TVA B;  1B76 A;  1H4S A;  1WPY A;  1NJ5 A;  1ADY A;  2R72 A;  2E41 A;  4P73 C;  3BFM A;  3RUX A;  4HWS A;  3OD1 A;  2Q7E A;  1O9H A;  2ZT7 A;  3RF1 A;  4K88 A;  1JJC A;  4XU1 A;  2YIB A;  1WU7 A;  3TEG A;  4P72 A;  4K86 A;  3NET A;  2ARU A;  2Q5I A;  3LSS A;  5K1P A;  2I4N A;  1Z7N A;  2HEP A;  3ERR A;  2DXT A;  3HY0 A;  1YFT A;  3A7A A;  4HWR A;  2ARS A;  4P75 A;  3VBB A;  1G51 A;  4YRC A;  1SER A;  4HVC A;  3I7F A;  3IKM B;  2CGH A;  4YCU A;  4P3N A;  1EQR A;  1N9W A;  4P75 C;  4WI1 A;  3L2Z A;  2DEQ A;  3L1A A;  2ZT6 A;  4HA8 A;  4YRT A;  3HXY A;  3HXW A;  2ZR2 A;  3QNE A;  2C8M A;  1H4T A;  1PYS B;  2YIA A;  1KMN A;  1EIY B;  2AKW A;  4KR2 A;  3V8J A;  2ZT8 A;  3V8K A;  4H2Y A;  1RIQ A;  4TVW A;  2PUS A;  4TTV A;  1E22 A;  2EAY A;  3UFG A;  3NEL A;  4OLF A;  2DZC A;  2RHQ B;  4TWA A;  4XTX A;  3V7C A;  4X5O A;  3A31 A;  3P8V A;  2RJZ A;  1G5I A;  2ODR D;  3A32 A;  3M4Q A;  4TVA A;  1YGB A;  1B70 B;  2R70 A;  2EL9 A;  3RAC A;  3A7U A;  4G84 A;  3RGL A;  2PME A;  2ZZE A;  2ZIN A;  2DTI A;  3A5Z A;  4TQD A;  3RKX A;  3RKY A;  3FJP A;  3QO8 A;  3L4G B;  3UGT A;  2DTH A;  3RKW A;  1EFW A;  2CJB A;  1NYR A;  2ZNI A;  1X56 A;  4KQE A;  4YDQ A;  3UGQ A;  4CH5 A;  1HC7 A;  4YRI A;  1KOG A;  1BBW A;  4YRS A;  2ART A;  4UPA A;  4RQE A;  2XGT A;  4TVY A;  3PCO B;  1IL2 A;  3TUP A;  3HXZ A;  3QO7 A;  4EO4 A;  4EX5 A;  2CJ9 A;  4AH6 A;  1HXD A;  5KNN A;  2G4C A;  1YFS A;  1USY A;  3UH0 A;  4DQ2 A;  3HTZ A;  1PYS A;  3QO5 A;  1QE0 A;  2EJG A;  2DQ0 A;  4H2T A;  2JVD A;  1EIY A;  3VQY A;  2QHT A;  2QHU A;  1USY C;  1WYD A;  4YRF A;  3IKL A;  1H4Q A;  4YCV A;  1YFR A;  4YRR A;  1ATI A;  2P5I A;  2EJ9 A;  4Q15 A;  2YIB D;  2RHQ A;  3E9I A;  1BIB A;  3V7R A;  1O9G A;  3RIR A;  4YCW A;  1KMM A;  1X55 A;  4YPF A;  2DQ3 A;  4WJ4 A;  1B70 A;  1ADJ A;  4YP0 A;  3W3S A;  2IY5 B;  3QTC A;  4YRL A;  1ASY A;  2RQ6 A;  1YB3 A;  3BHP A;  1BBU A;  1E1O A;  2QJ1 A;  4YRQ A;  3HRK A;  2XTI A;  4O2D A;  1B7Y B;  3HFZ B;  3IAL A;  4K87 A;  4XEM A;  4YYE A;  4YRG A;  4TQF A;  2ZZG A;  3L4G A;  2YI8 A;  1WQ7 A;  3HY1 A;  1NJ8 A;  4H2V A;  4BWA A;  2CJA A;  3CMQ A;  2ZIM A;  2EWN A;  1L0W A;  2Q7G A;  3RL6 A;  1NJ6 A;  2ZTG A;  4RQF A;  4XU3 A;  2FYK A;  3MF1 A;  4YRE A;  4RDX A;  3PCO A;  1H4V B;  3HXX A;  1W66 A;  3TEH B;  2ZNJ A;  4H2W A;  4UP8 A;  2DJZ A;  4XTU A;  2ODR C;  1HTT A;  1NYQ A;  4ZIB A;  4RMF A;  3HXU A;  1E24 A;  1G5H A;  2I4M A;  2QHV A;  1EVK A;  2RHS B;  5F5W A;  2PMF A;  1X2H A;  12AS A;  4E51 A;  3VQV A;  4HWO A;  1G6U A;  4WJ3 M;  2J3M A;  4WF2 A;  4DPG A;  4NCX A;  4XU2 A;  3LC0 A;  3IG2 A;  4XTV A;  11AS A;  4XTW A;  3A7R A;  2AMC B;  2E3C A;  4G85 A;  3PZC A;  1BIA A;  4XU0 A;  4YRO A;  1QF6 A;  4YRM A;  4HWT A;  2IY5 A;  2I4O A;  2DDZ A;  2CIM A;  2PGG A;  3BJU A;  4J15 A;  2DZ9 A;  4YRP A;  1E1T A;  4P3O A;  1NJ2 A;  5ELN A;  2ZGW A;  4P3P A;  3REX A;  3MF2 A;  5C53 B;  3ICA A;  4H02 A;  3HFZ A;  1B7Y A;  5K1X A;  1C0A A;  2Q7H A;  1X54 A;  4ZTU B;  3KFU A;  1LYL A;  3E9H A;  3A74 A;  4LNS A;  1Z7M A;  3EFS A;  2DU5 A;  3MEY A;  1J5W A;  1X01 A;  2DVE A;  3P8Y A;  2HNI A;  4PHC A;  1FYF A;  3LSQ A;  4P71 A;  5ELO A;  4XTZ A;  3REU A;  1NNH A;  3M4P A;  2YI9 A;  3TEH A;  1VQZ A;  2P0L A;  4P72 C;  4H2X B;  2ZIO A;  1NJ1 A;  1WNL A;  2ALY B;  4XEO A;  4P71 C;  1SES A;  1X2G A;  4YRJ A;  4CS2 A;  2I4L A;  2E10 A;  5E3I A;  4YRK A;  2RHS A;  5C51 B;  3HXV A;  3EFR A;  2DKG A;  2DTO A;  2DXU A;  1JJC B;  2J3L A;  3V8L A;  2E1H A;  3VQW A;  3G1Z A; 
#chains in the Genus database with same CATH topology
 5JH7 B;  1FXH A;  5HGQ A;  4R7C A;  3L72 H;  3RWR D;  3PN1 A;  4HNA A;  2DYR B;  2CH7 A;  1WQW A;  5LHI A;  2OTJ V;  3WQZ A;  4OPA A;  3R07 A;  4YJ2 A;  5IYB O;  1K4C C;  4DV3 O;  3ZS8 C;  2CUG A;  4LH7 A;  5LHH A;  2UXD B;  2EJ7 A;  4JF3 A;  3NEN A;  2QKC A;  5CBF A;  3NEM A;  3L74 H;  5BZB A;  4PD4 F;  3OR6 C;  4O4H B;  2QTS A;  5CA0 A;  2EX3 A;  1YDX A;  3CCM V;  4CH3 A;  1EBO A;  3RVY A;  4NXN O;  1KMI Z;  2ZCE A;  1B8A A;  1I08 A;  4PI0 A;  1I94 B;  1VQN V;  1SQX H;  4DRX B;  1BS3 A;  4MVZ A;  4E2L A;  2AKW B;  2YUA A;  1AP6 A;  1SZX A;  5JJE B;  1SQP H;  2XAG A;  3A0B Z;  2QWQ B;  3ASN B;  4D6T H;  1QU7 A;  1UPG A;  2ZQM A;  1XBL A;  1WJZ A;  4I50 A;  1Q6H A;  1B06 A;  3RYH B;  5LYJ B;  4IGG A;  4B08 A;  2ZXF A;  1X4T A;  2P4V A;  1XIL A;  3DSQ A;  3K0D A;  4EB6 B;  3CC7 V;  4H2X A;  2DW4 A;  3GWO A;  1OCR C;  4TVA B;  5C8Y B;  2F95 B;  1B76 A;  4L8J A;  2F43 G;  5B66 Z;  2E41 A;  2R72 A;  4MVR A;  4TOI A;  3BFM A;  3A0R A;  1AJQ A;  1Q6I A;  4QIW F;  3A8T A;  1N32 B;  1V55 C;  5EBW C;  3RFR A;  3JAS A;  3CRA A;  4K88 A;  1OJH A;  1GM8 A;  4KP4 A;  4RUE A;  2YIB A;  2F93 B;  4GT1 A;  4MVM A;  5JH7 A;  3NET A;  4HBN A;  2ARU A;  3OAA G;  2Q5I A;  1Z7N A;  2HEP A;  2L6L A;  4LF6 B;  4FM2 A;  4YRC A;  3SJQ C;  4TSF G;  3OTO O;  4O4J B;  3JAL B;  5IWA B;  1EQR A;  1GRJ A;  2GHY A;  1D5A A;  5B1B C;  3TCU A;  4NB5 A;  4PA9 A;  4O4H A;  2KB1 A;  3M99 B;  2DEQ A;  3L1A A;  1GN3 A;  1P84 F;  2ADP A;  4J9Z B;  1PPJ H;  1BGY H;  3QNE A;  2C8M A;  1PYS B;  4LVM A;  1R1B A;  4DRX A;  4DK0 A;  1OCO C;  1CPY A;  4K3A A;  2AKW A;  5C93 A;  1VP7 A;  2RNB A;  4WFA V;  4LF7 B;  4H2Y A;  4TWK A;  3OEE G;  4OX9 O;  1P7B A;  3NEL A;  4OLF A;  5LYJ A;  3RYH A;  5FPO A;  5BY1 A;  3MQZ A;  4LNU B;  1W0J G;  3A31 A;  3N2G B;  2IM9 A;  3CCJ V;  3KCX A;  1AR4 A;  4EB6 A;  2ODR D;  1SC5 B;  3ETE A;  4TVA A;  5C8Y A;  1NS1 A;  5KAF Z;  1IXB A;  1MNG A;  4R50 A;  3R65 A;  3A7U A;  4MVQ A;  4NXM O;  3RAC A;  1QLN A;  4G84 A;  3I5D A;  2PME A;  1K5S A;  3K9S A;  4PA6 A;  2ZIN A;  1N8R W;  4O4I B;  4TQD A;  5B1O A;  4LF9 O;  1R3J C;  3WB1 A;  2OWO A;  4JTD B;  3FJP A;  4QE9 A;  1S3J A;  2FYU H;  3ZX6 A;  2DTH A;  3RKW A;  1VAR A;  3GB7 C;  1Y76 B;  3CWB H;  4FLW A;  3SPI A;  1WB7 A;  3ZCC A;  4JI3 O;  1HWY A;  1VQ6 V;  2WAM A;  1ORQ C;  4YDQ A;  3G6E V;  4CH5 A;  5LMU O;  2P4K A;  2HHH B;  1R3I C;  2GSM B;  5D5Q A;  1JA8 A;  2Y69 B;  2ART A;  1DGS A;  4H33 A;  1VQ7 V;  4TVY A;  1SA0 B;  2JEU A;  2EIN C;  3JCU Z;  4O4J A;  3JAL A;  3HXZ A;  3QO7 A;  4DR2 O;  1YTF D;  4LF8 O;  4FLT A;  4GUN A;  2V4D A;  3UH0 A;  3SJB C;  2YXL A;  4P2Z A;  3HTZ A;  2Q8V A;  1SQV H;  5L3E A;  3B40 A;  4X62 O;  4JTC B;  4MTX A;  4YHH O;  3BA9 A;  4Z1M G;  3QO5 A;  1N36 O;  1PYS A;  4FM1 A;  2QHT A;  1GKF A;  2BSK B;  3H1H H;  3ABM C;  4JPR A;  4I4T B;  2IU0 A;  3IKL A;  1H4Q A;  1WPB A;  3MHH C;  4MVO A;  2UU9 O;  1GM7 A;  4GX1 A;  4FZ0 A;  1YFR A;  1ATI A;  1GN2 A;  3PJS K;  2Y0I A;  2YIB D;  2QR4 A;  4AI8 A;  1E79 G;  3N2G A;  1Q7Y W;  2QSA A;  4QJF B;  3W7S A;  1K9M W;  4YP0 A;  1EN5 A;  3CMA V;  1RM1 C;  3THO A;  4B3T B;  1ZSP A;  3JAM N;  2Z5U A;  1YB3 A;  3N2K B;  2E76 B;  4O4I A;  4O2D A;  1B7Y B;  4XEM A;  4YYE A;  4YRG A;  5H6R A;  1NKD A;  4ZOL B;  3HY1 A;  4DV7 B;  4JV5 O;  3AG4 C;  1M1K W;  4WFE A;  2AHY A;  4H2V A;  2BE3 A;  1HDJ A;  4LFC O;  2OCC C;  3CCR V;  1SZT A;  5EIB C;  4UCU A;  1U97 A;  4GKK B;  3X2Q B;  5EC1 C;  4DR7 O;  4NKG B;  3FB5 C;  3E83 A;  3E2E A;  1Q81 W;  4RDX A;  1K5Q A;  1K33 A;  2G38 A;  1M57 B;  2W0F C;  3DTU B;  4DYL A;  1H2N A;  3AG4 B;  2WPD G;  2ZNJ A;  4UP8 A;  2ZM6 B;  5LGU A;  3L9D A;  1U96 A;  1NH2 B;  1NYQ A;  4ZIB A;  4PV1 B;  3H1L H;  4ICG A;  2ZXW B;  3HXU A;  3GWK C;  1E24 A;  2QHV A;  1VQL V;  1WB8 A;  4GCZ A;  1EVK A;  2RHS B;  1H8E G;  5F5W A;  2BSK A;  3OE7 G;  2VWK A;  3K59 A;  12AS A;  4DV4 B;  4I4T A;  2WLJ A;  4R8C A;  2W0X A;  2BOC C;  2CTP A;  1MOF A;  1NTM H;  11AS A;  1AR1 B;  1P4R A;  2PTM A;  2E3C A;  4G85 A;  3PZC A;  4UVA A;  2XTA A;  3CXC U;  1BIA A;  4XU0 A;  1IXM A;  1HNX O;  3BA8 A;  3J80 N;  4YRM A;  1QR8 A;  2X6A A;  1VQ4 V;  2I4O A;  2DDZ A;  1OHH G;  1N34 O;  2PGG A;  4DUY O;  4HAM A;  4BR6 A;  1E1T A;  3WB2 A;  3SYQ A;  1MSW D;  1NJ2 A;  2WSS G;  3N2K A;  1KP3 A;  4WFB V;  2ZGW A;  1ZWI C;  4EKW A;  1HR0 O;  3MF2 A;  3IJ4 A;  1AP5 A;  4H02 A;  2F1M A;  3CE2 A;  1B7Y A;  1C0A A;  4ZOL A;  4DV1 O;  4NTX A;  1NBM G;  2Y48 A;  3A2F A;  1F51 A;  3K06 A;  2QTO A;  4X66 B;  5KHJ A;  4DV0 O;  3A74 A;  1JOY A;  3SYO A;  4LNS A;  2C2A A;  3C3S A;  2GDS A;  5JJN B;  2AHZ A;  2DU5 A;  4U3J B;  1I0H A;  1J5W A;  3MEY A;  4X1Y B;  1X01 A;  2DVE A;  3JSN A;  5LMN B;  4DV2 B;  5B3S C;  3DXR B;  4LFB B;  4D7S A;  3E22 B;  1LUW A;  4FPP A;  2DWE C;  1QLE C;  1XNQ B;  4XTZ A;  2QEX V;  2L35 A;  2UXD O;  4ZI7 B;  3SJA C;  2Q5Z A;  1VQZ A;  2ZKO A;  3M7M X;  2ZIO A;  3ZN0 A;  4P71 C;  1SES A;  2OIE A;  2I4L A;  1EZV H;  4DV5 B;  1B3Q A;  5E3I A;  2BTQ B;  5B3S B;  2PZS A;  2RHS A;  5GW7 A;  4B3S O;  4PDL A;  5BR8 O;  1I94 O;  2J3L A;  2Q73 A;  4JAU A;  4J9Y B;  5JQG B;  2ILM A;  2E1H A;  1K7D A;  3VQW A;  1WP8 A;  3VQX A;  3ZMT A;  4OGQ B;  3D3Q A;  4KXR A;  4PI2 A;  3S3W A;  3JAR B;  1JPX A;  4P74 C;  1RSO B;  4H37 A;  5JCO C;  1IZ3 A;  3ZHQ A;  4HWP A;  5KA5 A;  4H2U A;  1FPO A;  4CH6 A;  3ZED A;  2EZO A;  4LVI A;  5L3B A;  1BE3 H;  3CP1 A;  4OP0 A;  4FVM A;  1KC8 W;  1K34 A;  3HRI A;  2E64 A;  4RWU A;  2YID A;  1I5X A;  5GON B;  5LGT A;  2Q9L A;  4B3M B;  4LFA O;  2E65 A;  3E8F A;  2WLN A;  5LBQ A;  1ASZ A;  4O4L B;  3K5L A;  3CCV V;  2DU7 A;  3V7S A;  2Z3Y A;  5AG2 A;  4U3J A;  4X1Y A;  3P8T A;  2GUZ B;  1G4Y B;  2YIC A;  3DXR A;  3G4S V;  4YRN A;  3E22 A;  5H5N A;  1Y66 A;  2ZZF A;  1HNW B;  2P22 C;  4LF6 O;  1OV9 A;  2B1G A;  2Q5H A;  2Q68 A;  1PNL A;  4ZI7 A;  4P73 A;  4GX5 A;  2EJF A;  2ADQ B;  2A3Q A;  3SPC A;  3B2E E;  4UV8 A;  3QVN A;  1YJW V;  3ASO B;  1NJ5 A;  3ABL C;  4W4L A;  2BTQ A;  2PF4 E;  1OCC B;  4HWS A;  3K03 A;  3Q4H B;  3OD1 A;  3ML0 A;  1ZAU A;  2Q7E A;  2XT9 A;  1O9H A;  2ZT7 A;  1YEW A;  2PI5 A;  3K08 A;  4JZG A;  2A0L A;  5JQG A;  2RMK B;  1XUQ A;  3TEG A;  4K86 A;  3ZHS A;  1FJG B;  3OUF A;  5KLV H;  3WG7 B;  2GTA A;  4UB8 Z;  2DXT A;  3HY0 A;  3OM3 B;  3ABL B;  1XEQ A;  4DR4 B;  3JAR A;  1RSO A;  4P75 A;  4PDR A;  1G51 A;  5D5P A;  1SER A;  3IKM B;  1WA8 B;  2DYR C;  3T1Y O;  3D36 A;  4DUZ O;  4DR1 O;  1KU9 A;  5GON A;  3SYC A;  2JS3 A;  2ZT6 A;  4HA8 A;  3HXY A;  4I55 B;  4JI6 B;  4O4L A;  2K1E A;  5B1A C;  4PA7 A;  3ZN1 A;  3F7V C;  2YIA A;  1EIY B;  1N33 B;  3S3X A;  3ZRS A;  2QM8 A;  4MT8 A;  5LP6 C;  2QM7 A;  2GUZ A;  2YEV B;  4TVW A;  2W6I G;  1RPR A;  1Z5W A;  2ETN A;  1E22 A;  1FXK B;  4H13 B;  2HHH O;  4JI1 B;  4K8Z A;  2DZC A;  4A5U B;  2RHQ B;  2JJ2 G;  3ZMV A;  4XTX A;  3V7C A;  3P8V A;  2WLM A;  5KMG B;  3E8G A;  2MW2 B;  3ASN C;  5B1A B;  3G71 V;  4KHP B;  4FFB B;  2VRZ A;  1W59 A;  3LDC A;  3B8M A;  5LP6 B;  2V7Q G;  3HKE B;  1VQ8 V;  1HNZ B;  3Q4H A;  4P9O A;  3TXQ A;  3LDD A;  3NR7 A;  1QVF U;  5GTH Z;  1NTZ H;  2PY5 A;  1AJN A;  3K04 A;  5IY5 B;  4IHJ B;  4LP8 A;  2WLK A;  4CC6 A;  1AIL A;  3W7X A;  4K0K B;  1L1F A;  1X56 A;  1JMK C;  2IJK A;  3SGI A;  4JAA A;  1QVG U;  1PL0 A;  4EFB A;  4OPH A;  4LR3 A;  4UUJ C;  1KOG A;  4LF4 B;  4LVK A;  4YY3 O;  1BBW A;  3EVK A;  4UCS A;  5EBM C;  1BHB A;  1V54 C;  4OXS A;  2QWP B;  3TK1 A;  4DR6 B;  4GKJ B;  4UPA A;  1WA8 A;  2VQE B;  3OD4 A;  5CMU A;  4RQE A;  3PCO B;  1NVP B;  4EO4 A;  4EFE A;  1ENV A;  4EX5 A;  1MZF A;  2P6J A;  3IFX A;  1Q3E A;  4B3T O;  4LVJ A;  2JGU A;  4JI4 B;  5JWP A;  4DQ2 A;  1US6 A;  4I55 A;  3ZHU A;  3ABU A;  1BQZ A;  3CRM A;  1EIY A;  4DV7 O;  1V54 B;  3RGB A;  1M93 A;  1BQ0 A;  5EBL C;  5IDJ A;  3W7U A;  2YEV A;  4YRF A;  3W7W A;  3B77 A;  1XL6 A;  4IL6 Z;  4GKK O;  4YJ3 B;  4YRR A;  1FXK A;  1Q86 W;  1M9N A;  4D7T A;  4JI8 B;  1UJW B;  1BT8 A;  3AG2 B;  2YSU B;  2RHQ A;  2UXC B;  1BIB A;  3E9I A;  4J80 A;  1O9G A;  3RIR A;  5KMG A;  5CBH A;  4IYH A;  1X55 A;  5F2V O;  2DQ3 A;  4LC1 A;  4FFB A;  4WJ4 A;  1PKX A;  4ZBM A;  1VQM V;  3AG1 B;  3QTC A;  5LP6 A;  4YRL A;  1ASY A;  3HKE A;  2ZM6 O;  2FML A;  2DOS A;  2QJ1 A;  1OZ0 A;  1E1O A;  4MS2 A;  2ZDI C;  1G1X B;  1WAZ A;  2XTI A;  3HFZ B;  3IAL A;  1B6Q A;  4TQF A;  2YI8 A;  1WQ7 A;  3CX5 F;  3A0H Z;  4IHJ A;  1FXV A;  4AQY B;  3CS5 A;  4BWA A;  1GAX A;  3CXH F;  3CMQ A;  4KL1 A;  1YI2 V;  5J2T B;  3FFQ A;  1S72 V;  1DF4 A;  1Z5V A;  1WPX A;  1BSM A;  2LFR A;  1NR1 A;  1NJ6 A;  2ZTG A;  2KG7 B;  4XU3 A;  2FYK A;  5JJJ B;  3IC9 A;  3PCO A;  5H9C A;  3HXX A;  1K92 A;  1GMG A;  4H2W A;  3KCY A;  3FYI B;  4HZ3 A;  1PV0 A;  3RBZ A;  1TVK B;  2Y69 C;  4JZ2 A;  4XTU A;  4XDK A;  1A32 A;  4RMF A;  5L3F A;  2EIJ B;  1XMQ B;  2Z0A A;  3LUT B;  5IT9 N;  3GVM A;  3ZMS A;  5EC2 C;  5IYZ B;  2PMF A;  4I0X B;  4E51 A;  2EIL B;  3CRC A;  4YJ3 A;  2AW9 A;  4H44 B;  3LC0 A;  5LA6 B;  3IG2 A;  5A9G A;  4XTW A;  4DV2 O;  2AMC B;  4LFB O;  2WLL B;  1NQT A;  3H01 A;  1R3K C;  3AEI A;  1FYJ A;  1P49 A;  2DYS B;  4PA3 A;  4MTF A;  4YRO A;  2IH3 C;  3IAY A;  1QF6 A;  4HWT A;  1VEW A;  2HVK C;  4X65 O;  3CSX A;  1GO3 F;  4DR5 B;  4JI2 B;  4P3P A;  3REX A;  1KKC A;  1NZ6 A;  3JD3 A;  4DV5 O;  3HFZ A;  3EXA A;  2NS6 A;  4FK5 C;  2H3O A;  2KSD A;  1MAB G;  5CBG A;  5DN6 G;  1X54 A;  5B5E Z;  5J2T A;  1Z7M A;  3P3P A;  3EFS A;  4LVL A;  4LNU A;  2KG7 A;  3HPL C;  4R6Z A;  2GTS A;  1BL8 A;  4Z1V A;  3CEI A;  3CCQ V;  3QG5 A;  3P8Y A;  2Q0A A;  4IIJ B;  2X7R B;  5LL6 Y;  1FYF A;  2ZDI A;  5L3C A;  3X2Q C;  1XQ8 A;  4AIL C;  1R6K A;  3M4P A;  2YC0 A;  1AR5 A;  1EM1 A;  4JI7 O;  2P0L A;  4TUY B;  1AVM A;  1QCE A;  1TVK A;  1WP7 A;  1GK9 A;  3E8H A;  4F4L A;  1WNL A;  2ALY B;  5LHG A;  2ZE5 A;  1M57 C;  2ZD9 A;  4RO2 A;  4CS2 A;  2E10 A;  2UXN A;  4UB6 Z;  3SPJ A;  4Z2W A;  1Y76 A;  1NI8 A;  2HFE C;  2EIK C;  5IYZ A;  2LFS A;  4MW8 A;  4NR1 A;  3HXV A;  3CD6 V;  1XRE A;  2DTO A;  4I0X A;  2DXU A;  1YSC A;  4QPJ A;  2LQT A;  1JJC B;  4WCE V;  4JYA B;  2ZXW C;  3AG7 A;  1NJI W;  1YXB A;  3G1Z A;  3ABK C;  3U11 A;  4I9Q A;  5LA6 A;  1S77 D;  2QWR B;  4I9W A;  1W2B U;  2AMC A;  2VQF B;  2OT5 A;  1KKD A;  2WLL A;  3SJC C;  1SA0 A;  3ZHR A;  2CK3 G;  3E35 A;  1SRY A;  5HFL A;  1HNW O;  3F5W C;  2ZT5 A;  2R9I A;  2NLJ C;  4UP9 A;  2V1D A;  2EIK B;  3APO A;  3BEH A;  2ARH A;  2P06 A;  3UKM A;  3I56 V;  1J5E O;  4J7J A;  1GTO A;  5KHH A;  1M5I A;  2X6B A;  1AB3 A;  4WFH A;  5HFM A;  1CXZ B;  1L0N H;  3B4S A;  3OTO B;  3U0Z A;  1NVP D;  4J7Z A;  2HVJ C;  3ABK B;  4LF5 O;  1KUQ A;  3JD2 A;  3BAA A;  2QM4 A;  1F23 A;  2E74 B;  3KZI Z;  2IJH A;  3O9O A;  4P9P A;  5KHK A;  3CCE V;  3HFV A;  1Q90 D;  3UT5 B;  1VQO V;  3RT3 C;  4DO2 A;  2A8E A;  1EVL A;  2C7I A;  2QHS A;  2LW7 A;  2CDY A;  4IIJ A;  4N21 A;  4U7O A;  3OR7 C;  1XMO B;  1XNR O;  2FTK A;  4CS3 A;  2ZR3 A;  4CS4 A;  2UUB O;  4DR4 O;  1HP8 A;  4RAI A;  1KB9 F;  4QPK A;  4TUY A;  2E75 B;  5C52 B;  1SET A;  5L3D A;  2DMX A;  3J7A U;  2ALY A;  3T4D A;  3BCC H;  4XDL A;  4B7K A;  5H6Q A;  1DLB A;  4P73 C;  3ZHT A;  3RUX A;  1LR1 A;  2A7W A;  4NXM B;  2FKX A;  2F66 C;  4QGP A;  3WB0 A;  1FS0 G;  4JI6 O;  3RF1 A;  1JJC A;  3DC6 A;  2Q0O C;  1FKA O;  1N33 O;  1EZJ A;  3JAW B;  3STZ C;  4H0L B;  1Q5O A;  3J81 N;  4GYC B;  2XAJ A;  2N04 A;  3LSS A;  2XUM A;  3TGU H;  2HG5 C;  2QGN A;  1PD3 A;  4HWR A;  4FIP C;  2ARS A;  1VF6 C;  5LMU B;  5H2F Z;  3I55 V;  1M4U A;  2UXX A;  1URF A;  4HVC A;  2Q69 A;  3JAK B;  4UV9 A;  1VQ5 V;  4KHP O;  2R9A A;  3UM7 A;  3UO3 A;  4P75 C;  4X9Q A;  3CC2 V;  4YXW G;  2XHB A;  3FB6 C;  1XDC A;  2WA4 A;  1HNZ O;  5KAI Z;  4K35 A;  4YRT A;  3F5T A;  3H1I H;  3D36 C;  3CHX A;  1SQG A;  3D8C A;  3HXW A;  4NYK A;  4F6E A;  2JGD B;  4MTG A;  3UT5 A;  3V8J A;  2CTQ A;  2EZP A;  1IDS A;  1IBM B;  4K0K O;  3U10 A;  2HJF C;  2PUS A;  4TTV A;  2EAY A;  3UFG A;  3MD0 A;  2UU9 B;  4LF4 O;  5KHG A;  3L70 H;  5DED A;  3ETQ A;  4X5O A;  2RJZ A;  4EEQ A;  1G5I A;  3IC7 A;  3A32 A;  2PI4 A;  1D2D A;  3ABT A;  1YGB A;  2R70 A;  2EL9 A;  2ATK C;  4X88 A;  2DWD C;  3T1H B;  2UXB B;  1N32 O;  3H1K H;  4KFM A;  5IJ0 B;  4JI4 O;  3RGL A;  1IBK B;  2LGQ A;  1I7F A;  3ETD A;  5FPR A;  3OUS A;  4PEL A;  1DK1 A;  2DTI A;  3APQ A;  2AGA A;  1VQP V;  4K8X A;  1CEZ A;  3RKX A;  3M8A A;  3ZRX A;  3L73 H;  3RKY A;  1WNS A;  1EFR G;  1XL4 A;  2A9H A;  4FJC C;  3SR2 C;  3ASO C;  3L4G B;  2XND G;  3UGT A;  3JAW A;  2CTR A;  1YIJ V;  3EHB B;  3UCS C;  4PDM A;  1EFW A;  1OCC C;  2CJB A;  1Y74 B;  4JYC A;  4U7N A;  2IJJ A;  4X20 B;  4KQE A;  1KBH A;  3UGQ A;  1H2K A;  1KP2 A;  1HC7 A;  1K73 W;  4YRI A;  5IYC O;  1JJO A;  3HKC B;  4G27 B;  2UXC O;  2PYL A;  4W4K A;  1XI1 A;  4J10 A;  2GV9 A;  4J41 A;  3WG7 C;  5IWA O;  3TUP A;  1IL2 A;  2CH7 B;  3JAK A;  4B3R B;  2NR5 A;  2M6Y A;  3G6B A;  1SQQ H;  1HXD A;  2G4C A;  1H2G A;  5CN0 A;  4I7Z B;  4BAY A;  4FLX A;  2QWN B;  4MW3 A;  1ARO P;  1USY A;  1GM9 A;  3BPZ A;  3K5N A;  3C3T A;  2EIM B;  2ZE6 A;  4XBF A;  1QE0 A;  3SYA A;  1VF6 A;  1AI7 A;  2DQ0 A;  3ZHV A;  2JGD A;  3VQY A;  2E5L B;  1IBL B;  4AQY O;  1THZ A;  2QHU A;  4LF7 O;  4IYI A;  4O2A B;  1PNK A;  4CC5 A;  1FAF A;  4YCV A;  4G28 B;  1UFI A;  2Q6A A;  4E4E A;  5KHI A;  3V7R A;  3ZMZ A;  3ZRW B;  2UUC B;  3JCZ A;  3BVO A;  4GX0 A;  1FXK C;  1D5N A;  1HNX B;  1YTF B;  1ADJ A;  3K5M A;  5IE9 A;  4FMT A;  3E86 A;  5IJ0 A;  3H9V A;  4DUY B;  4WBN B;  1NH2 D;  1XMQ O;  4YRQ A;  3HRK A;  3RVZ A;  2QWO B;  1HR0 B;  3HKB B;  2ZZG A;  3L4G A;  1YVW A;  5KA6 A;  1NJ8 A;  1B04 A;  3W7T A;  1Y74 A;  2ZIM A;  4HYO A;  1EN4 A;  4X20 A;  2IU3 A;  4DV0 B;  1L0W A;  1MZE A;  2H94 A;  2HR3 A;  2Q7G A;  5IY5 C;  3HKC A;  3OMI B;  4JI0 B;  1S5H C;  1PNM A;  2DJV A;  4PHZ A;  1F4M A;  2ITD C;  1NR7 A;  2P90 A;  4ABM A;  4DK1 A;  5KUM A;  3SYP A;  1LNQ A;  1H38 A;  3AK3 A;  3G67 A;  5FLX N;  3QF7 A;  4BIO A;  1HTT A;  4DR5 O;  2XAS A;  4JI2 O;  2EJR A;  2JK5 C;  5BMV B;  2F4V B;  3CRQ A;  4FLV A;  4BW5 A;  1VQ9 V;  2W6J G;  3AK2 A;  1Q8I A;  4UCO A;  1X2H A;  3K5O A;  4O2A A;  1NT2 B;  4LH6 A;  1BZK A;  2J3M A;  4B3S B;  4WF9 V;  4WF2 A;  5BR8 B;  1NU1 H;  2DE0 X;  3T2M A;  3OMA B;  2XAQ A;  4XTV A;  4DV6 B;  4G2K A;  2AXT Z;  4DXW A;  2IH1 C;  2XOK G;  2UUA B;  3ZRW A;  1T5E A;  1YCI A;  3AG3 C;  3AG2 C;  2CIM A;  1VQK V;  3BJU A;  4J15 A;  2DZ9 A;  4P3O A;  3ICX A;  5ELN A;  3EFF K;  2Q67 A;  4WBN A;  5FNV B;  1PL4 A;  4DR3 B;  1ZTE A;  3AG1 C;  3HB3 B;  3HKB A;  2HP8 A;  4JI5 B;  1JFF B;  4LFA B;  3T4Z A;  1IVS A;  4QNH B;  3CME V;  3SPH A;  4B7E A;  2ODM A;  3KFU A;  1LYL A;  1BHA A;  3OGI B;  4FLZ A;  3ZBH A;  4PJ0 Z;  4TV9 B;  3HKD B;  4JYA O;  4YIO A;  3AG3 B;  2A79 B;  2KQX A;  3K57 A;  4TT3 G;  4MVS A;  2VQF O;  2HNI A;  2Y0P A;  4UVC A;  2N05 A;  2YS8 A;  1OCR B;  2JDI G;  3LSQ A;  3TXS A;  2AZ2 A;  4J42 A;  4ZHQ B;  2JRI A;  5LXT B;  1QR9 A;  5ELO A;  3REU A;  5BXZ A;  2QDO A;  1K97 A;  4Q20 A;  1CP9 A;  2Y4U A;  4P72 C;  1V55 B;  4UVB A;  2CAZ C;  3E8B A;  1S5J A;  2GBO A;  4XEO A;  1MA1 A;  5BMV A;  3WU2 Z;  2QKS A;  3T1C A;  4DV4 O;  1COW G;  5C51 B;  3EFR A;  4NTY A;  3STL C;  2DKG A;  1AI6 A;  3C90 A;  2EIJ C;  4QE7 A;  3O65 A;  1L0L H;  1H2L A;  1SQF A;  3CB2 A;  1EOV A;  1F4N A;  2OCH A;  3CPW U;  3ZMU A;  3RYI B;  4X8A A;  1XMO O;  1IX9 A;  2EIL C;  3RN4 A;  2RN9 A;  1HW7 A;  3G80 A;  4X64 B;  5B1B B;  3N27 A;  2X6C A;  1YJ9 V;  3E89 A;  2B1I A;  1GGM A;  4BIU A;  1R6N A;  3OMN B;  4ZTZ B;  3DC5 A;  4JGS A;  2E5A A;  4PG3 A;  3ZRV A;  1WLE A;  2F23 A;  4Q6G A;  2DYS C;  5FNV A;  5KUK A;  4L87 A;  3T1Y B;  4GX2 A;  1VIB A;  2X0L A;  4DUZ B;  4H2S A;  4UP7 A;  1OCO B;  2EBO A;  4DR1 B;  2AZ0 A;  4F6R B;  4FM0 A;  2IBZ H;  3OGC C;  1JFF A;  3FAV B;  4X66 O;  1N0J A;  3L71 H;  4AHC A;  4XTY A;  4TV9 A;  3HKD A;  1TA8 A;  4BIZ A;  4LWS B;  1YJN V;  2EUL A;  5LMN O;  4JTA B;  3OTF A;  4CH4 A;  1E1R G;  1DF5 A;  3DGE A;  2B5U A;  1XNQ O;  1SS3 A;  4BW9 A;  3RYC B;  4ZHQ A;  3A5Y A;  5J2U B;  5LXT A;  5KX5 B;  4DV3 B;  3HR0 A;  1Y67 A;  1H2M A;  4KR3 A;  4NTW A;  2JS5 A;  3JD4 A;  3UQ8 A;  1GN6 A;  1F7Y A;  1ZX3 A;  2N74 A;  3FX7 A;  4I5S A;  1H4S A;  1WPY A;  1ADY A;  1PM9 A;  4O2B B;  2CGN A;  3P3N A;  4DW0 A;  4LCU C;  4NXN B;  3R66 A;  2D2C B;  4XU1 A;  1Q82 W;  5TIS Z;  1WU7 A;  4N23 A;  4LBE C;  5J9P C;  5LGN A;  2VWJ A;  4P72 A;  1IBM O;  1R3L C;  5K1P A;  3RYI A;  2I4N A;  2EIN B;  3ERR A;  1YFT A;  3A7A A;  2OYQ A;  3VBB A;  1I5Y A;  2NNU A;  4YY3 B;  2YDE A;  3I7F A;  2CGH A;  1M90 W;  2XAH A;  4B3M O;  4P3N A;  4YCU A;  1R6T A;  1N9W A;  3B09 A;  4UFZ A;  4WI1 A;  3T1H O;  3L2Z A;  2UXB O;  4UCR A;  1MMM A;  1BMF G;  4F6R A;  2JEX A;  4DW1 A;  1IBK O;  3FAV A;  3NXS A;  1R73 A;  1X59 A;  3ABM B;  1Q43 A;  2IJI A;  5DM6 V;  4GZR B;  3F7Y C;  1S5L Z;  2FL4 A;  4JAS A;  1QQC A;  2ZR2 A;  1H4T A;  5CA3 A;  1DTO A;  3MHS C;  1KMN A;  4LWS A;  1YZB A;  1GN4 A;  1E1Q G;  4KR2 A;  2ITC C;  4PDV A;  2QA4 V;  4ZKI A;  2ZT8 A;  4JAV A;  3V8K A;  1RIQ A;  3RYC A;  1M56 C;  5J2U A;  5KX5 A;  1RM1 B;  4TWA A;  1ZLZ A;  1KD1 W;  1JQ0 A;  5GTI Z;  3TJT A;  3UO2 A;  3M4Q A;  4TV8 B;  4B3R O;  3KG2 A;  5IJ9 B;  1B70 B;  1J95 A;  3JAT B;  2ZE8 A;  1QBZ A;  2JJ1 G;  2ZZE A;  4O2B A;  2OCC B;  4J11 A;  4P30 A;  4WFF A;  2MK3 A;  3A5Z A;  1AI5 A;  4JYY A;  3CYO A;  2OIG A;  2WA3 A;  2DN9 A;  1M56 B;  3QO8 A;  5L3G A;  2E5L O;  1IBL O;  1OCZ C;  1FJG O;  1VMG A;  4FZ1 A;  1NYR A;  2WLI B;  2ZNI A;  1XHX A;  4OX9 B;  5CB4 B;  4MTO A;  3CCL V;  2JIZ G;  4FLU A;  4XDJ A;  2BCC H;  1H8H G;  1TGO A;  4YRS A;  4YIP A;  5ITZ B;  3RYF B;  2UUC O;  3FD9 A;  4FLY A;  1Y4M A;  1NTK H;  1EN6 A;  3BRC A;  2XGT A;  1V9P A;  5DEC A;  3VOU A;  4MSW C;  1TUB B;  2HKO A;  1JVM A;  1OCZ B;  2CJ9 A;  4AH6 A;  2HLD G;  5KNN A;  1KYO F;  4CBC A;  3LNM B;  1YFS A;  4J7K A;  2K9P A;  5E1A C;  2B9Z A;  2LGW A;  2VS0 A;  3K79 A;  3FYE B;  1XOU A;  1AI4 A;  4LF9 B;  1QNM A;  1L8D A;  3TET A;  4WFG A;  3KKY A;  2EJG A;  4H2T A;  2JVD A;  4UXN A;  1USY C;  3H1J H;  1BCC H;  2XAF A;  3ETG A;  3FB8 C;  1G8M A;  1WYD A;  1N4C A;  1IUR A;  1Y6X A;  4FFK A;  1FFT B;  5EK0 A;  4JI3 B;  4JI1 O;  1YIT V;  3CCS V;  3K58 A;  1AJP A;  4UCV A;  3MDS A;  3ZIA G;  2IW5 A;  2P5I A;  2Q4P A;  4JI0 O;  2EJ9 A;  4Q15 A;  3ZJZ A;  5JVD B;  4MVU A;  5LOV B;  4YCW A;  1VF5 B;  3B8N A;  1KMM A;  1JR9 A;  4YPF A;  4TV8 A;  2R9R B;  3BAB A;  2M7W A;  5IJ9 A;  4DR2 B;  1B70 A;  3W3S A;  2IY5 B;  3JAT A;  4LF8 B;  3JD1 A;  2RQ6 A;  1RFY A;  4KUM A;  3WFV A;  3BHP A;  4C7U A;  1BBU A;  4X65 B;  3CJH B;  4HT4 A;  2F4V O;  4X62 B;  1ZUQ A;  3JSL A;  4YHH B;  4K87 A;  5B1N A;  1N36 B;  3LNN A;  3FKS G;  4U3F H;  1TAE A;  3MAQ A;  1ZL8 B;  3K0G A;  4UCT A;  1SF9 A;  2CJA A;  2FB5 A;  2WLI A;  1MSD A;  2P67 A;  1FFX B;  2EWN A;  1K4D C;  4RUF A;  3BFR A;  1QLE B;  3RL6 A;  5CB4 A;  3JD0 A;  2QE7 G;  4DV6 O;  1YHQ V;  4RQF A;  3P30 A;  4DR6 O;  3CC4 V;  4GKJ O;  2VQE O;  3L75 H;  2BTO A;  3MF1 A;  2UUA O;  4YRE A;  4X1I B;  3RYF A;  5ITZ A;  1QHT A;  3D3I A;  2BOB C;  1JCH A;  1H4V B;  1TUB A;  1KEC A;  1W66 A;  3TEH B;  4ASU G;  2P5O A;  5EYP B;  2Y4T A;  2H8P C;  5CA1 B;  2DJZ A;  4X1K B;  4JI7 B;  1GH6 A;  2ODR C;  1K3E A;  5EZY B;  4DR3 O;  2CE4 A;  2CTW A;  1G5H A;  2I4M A;  4PA4 A;  4CZZ A;  4JI5 O;  4JV5 B;  3LDE A;  3P32 A;  1PP9 H;  2RDC A;  4LFC B;  1N0N A;  3VQV A;  4HWO A;  1G6U A;  3AK1 A;  4WJ3 M;  2EIM C;  4JI8 O;  1YF2 A;  4GLX A;  4DPG A;  4NCX A;  4XU2 A;  1JJ2 U;  4DR7 B;  2P7T C;  3A7R A;  5JVD A;  5LOV A;  4HNA B;  4JYB A;  3FB7 C;  4IT5 A;  2HJD A;  2ZT9 B;  4YJ2 B;  3CCU V;  1S0V A;  3LSU A;  5E79 Z;  2IY5 A;  2LW1 A;  1VF7 A;  2LJ2 A;  2YXH A;  1J5E B;  1P7G A;  2WLH A;  5A2Q N;  4YRP A;  2CGO A;  3CJH A;  2QKA A;  5C53 B;  3ICA A;  3SPG A;  1JX9 A;  5K1X A;  3RW0 A;  5FL7 G;  5CA0 B;  2Q7H A;  4LF5 B;  1ZL8 A;  4ZTU B;  2OTL V;  1FD9 A;  1SQB H;  3E9H A;  1RP3 B;  2YXY A;  2LO1 A;  2KKW A;  2O57 A;  1Q6U A;  2A06 H;  1FFX A;  1H2S B;  1TUE B;  1MG1 A;  4NVP A;  2D3O W;  2NN4 A;  3JYC A;  2WWW A;  1S76 D;  3OW2 U;  1ROP A;  4PHC A;  1K8A W;  4X1I A;  1RPO A;  5IYD O;  3OT7 A;  4I50 B;  4P71 A;  1XNR B;  4X64 O;  3CRR A;  1LUV A;  3SDL A;  2UUB B;  1NNH A;  3K3W A;  3TEH A;  2YI9 A;  5EYP A;  1KQS U;  2ZE7 A;  1N34 B;  4H2X B;  5CA1 A;  4X1K A;  1XHZ A;  1NJ1 A;  3OEH G;  1Z2G A;  5EZY A;  1W0K G;  4X89 A;  1X2G A;  4YRJ A;  4DV1 B;  4YRK A;  1WN7 A;  1SKV A;  2LP7 A;  3BY6 A;  3JAS B;  3IGA C;  5EIB D;  3OFN G;  2PYJ A;  2RCV A;  3V8L A;  4P74 A;  3K9A A;  5JCO A; 
#chains in the Genus database with same CATH homology
 3U11 A;  4I9Q A;  3CB2 A;  5LA6 A;  5JH7 B;  1EOV A;  3VQX A;  5HGQ A;  2AMC A;  2VQF B;  3RWR D;  3RYI B;  3PN1 A;  4HNA A;  3SJC C;  1SA0 A;  1WQW A;  4PI2 A;  1SRY A;  3WQZ A;  2ZT5 A;  3R07 A;  4YJ2 A;  1HW7 A;  3JAR B;  4P74 C;  4UP9 A;  4X64 B;  5JCO C;  3ZS8 C;  4HWP A;  4LH7 A;  2UXD B;  4H2U A;  1GGM A;  4CH6 A;  3ZED A;  3NEN A;  5KHH A;  4ZTZ B;  4LVI A;  1M5I A;  4OP0 A;  2E5A A;  3NEM A;  4FVM A;  4PG3 A;  1WLE A;  3HRI A;  2E64 A;  4Q6G A;  5FNV A;  5GON B;  4L87 A;  3OTO B;  3T1Y B;  3U0Z A;  4DUZ B;  4UP7 A;  4H2S A;  4B3M B;  4DR1 B;  4O4H B;  4F6R B;  4FM0 A;  2E65 A;  5CA0 A;  2EX3 A;  1JFF A;  3BAA A;  2QM4 A;  4CH3 A;  1ASZ A;  1KMI Z;  2ZCE A;  4O4L B;  4AHC A;  1B8A A;  4PI0 A;  3K5L A;  4XTY A;  1I94 B;  2DU7 A;  4TV9 A;  3HKD A;  5KHK A;  3HFV A;  4DRX B;  1TA8 A;  4P74 A;  3V7S A;  4U3J A;  2AKW B;  3UT5 B;  4X1Y A;  2A8E A;  3OTF A;  5JJE B;  4CH4 A;  3P8T A;  1EVL A;  2C7I A;  2QHS A;  4IIJ A;  1XMO B;  4YRN A;  3E22 A;  4CS3 A;  4CS4 A;  2ZR3 A;  4I50 A;  2ZZF A;  4BW9 A;  2P22 C;  3RYC B;  1HNW B;  4ZHQ A;  3A5Y A;  3RYH B;  5J2U B;  5LXT A;  5KX5 B;  5LYJ B;  4DV3 B;  4B08 A;  2ZXF A;  1X4T A;  2Q5H A;  4KR3 A;  4ZI7 A;  3DSQ A;  2JS5 A;  4P73 A;  3UQ8 A;  4TUY A;  4EB6 B;  5C52 B;  1SET A;  4H2X A;  2ALY A;  2EJF A;  4TVA B;  5C8Y B;  2F95 B;  1B76 A;  1H4S A;  3B2E E;  1WPY A;  4L8J A;  1NJ5 A;  1ADY A;  2R72 A;  2E41 A;  4TOI A;  4P73 C;  3BFM A;  3RUX A;  2BTQ A;  4O2B B;  4NXM B;  4HWS A;  1N32 B;  3OD1 A;  2Q7E A;  1ZAU A;  3RFR A;  1O9H A;  3JAS A;  2F66 C;  1YEW A;  3WB0 A;  4NXN B;  2ZT7 A;  3RF1 A;  4K88 A;  1JJC A;  4XU1 A;  5JQG A;  3JAW B;  2YIB A;  2F93 B;  1WU7 A;  3TEG A;  1Q5O A;  5JH7 A;  4K86 A;  2VWJ A;  4GYC B;  3NET A;  4P72 A;  4HBN A;  1FJG B;  2ARU A;  2Q5I A;  3LSS A;  5K1P A;  3RYI A;  2I4N A;  1Z7N A;  2HEP A;  3ERR A;  2DXT A;  3HY0 A;  1YFT A;  3A7A A;  4LF6 B;  2OYQ A;  4DR4 B;  3JAR A;  4HWR A;  1RSO A;  2ARS A;  4P75 A;  3VBB A;  4FM2 A;  5LMU B;  1G51 A;  1M4U A;  5D5P A;  4YRC A;  4YY3 B;  1SER A;  4HVC A;  3I7F A;  3IKM B;  2CGH A;  3JAK B;  4O4J B;  3JAL B;  4YCU A;  5IWA B;  4P3N A;  2R9A A;  1EQR A;  1KU9 A;  5GON A;  1N9W A;  4UFZ A;  4P75 C;  4WI1 A;  1D5A A;  3L2Z A;  4UCR A;  2XHB A;  4O4H A;  4F6R A;  2DEQ A;  3L1A A;  1Q43 A;  2ZT6 A;  4HA8 A;  4YRT A;  3HXY A;  4I55 B;  4JI6 B;  4O4L A;  1QQC A;  1SQG A;  3CHX A;  2ZR2 A;  3HXW A;  2C8M A;  3QNE A;  1H4T A;  1PYS B;  4LVM A;  4DRX A;  2YIA A;  4DK0 A;  1N33 B;  1KMN A;  1EIY B;  2AKW A;  3UT5 A;  4KR2 A;  5LP6 C;  3V8J A;  1IBM B;  2ZT8 A;  4LF7 B;  3V8K A;  4H2Y A;  3U10 A;  1RIQ A;  4TVW A;  2PUS A;  1Z5W A;  4TTV A;  1E22 A;  2EAY A;  3UFG A;  2UU9 B;  3NEL A;  4OLF A;  4JI1 B;  3RYC A;  5KHG A;  4K8Z A;  5LYJ A;  3RYH A;  5FPO A;  5KX5 A;  5J2U A;  2DZC A;  2RHQ B;  3MQZ A;  4LNU B;  4TWA A;  4XTX A;  3ETQ A;  3V7C A;  4X5O A;  3A31 A;  3P8V A;  3N2G B;  2IM9 A;  2RJZ A;  4EEQ A;  5KMG B;  1G5I A;  4EB6 A;  2ODR D;  3A32 A;  3M4Q A;  4TV8 B;  4TVA A;  5IJ9 B;  4FFB B;  5C8Y A;  4KHP B;  1B70 B;  2R70 A;  1YGB A;  3JAT B;  2EL9 A;  3T1H B;  3RAC A;  2UXB B;  3A7U A;  5LP6 B;  4G84 A;  5IJ0 B;  3RGL A;  3HKE B;  2ZZE A;  1IBK B;  4O2B A;  2PME A;  1I7F A;  1HNZ B;  5FPR A;  2ZIN A;  2DTI A;  3A5Z A;  4O4I B;  4TQD A;  4K8X A;  3WB1 A;  3RKX A;  2OWO A;  3RKY A;  3FJP A;  1WNS A;  3QO8 A;  3SR2 C;  3L4G B;  2PY5 A;  3UGT A;  3JAW A;  2DTH A;  4IHJ B;  3RKW A;  1EFW A;  2CJB A;  4FLW A;  1NYR A;  4CC6 A;  4X20 B;  4K0K B;  2ZNI A;  1X56 A;  1JMK C;  4KQE A;  3SGI A;  3UGQ A;  1XHX A;  4YDQ A;  4CH5 A;  4EFB A;  4OX9 B;  5CB4 B;  1HC7 A;  4YRI A;  4LR3 A;  2HHH B;  1JJO A;  3HKC B;  4LF4 B;  1KOG A;  4LVK A;  4FLU A;  1BBW A;  2PYL A;  4UCS A;  1TGO A;  5D5Q A;  1XI1 A;  4YRS A;  2ART A;  1DGS A;  5ITZ B;  3RYF B;  4GKJ B;  4DR6 B;  4UPA A;  2GV9 A;  4FLY A;  2VQE B;  3BRC A;  2XGT A;  4TVY A;  3PCO B;  1SA0 B;  1V9P A;  3JAK A;  4O4J A;  4RQE A;  1IL2 A;  3TUP A;  3JAL A;  3HXZ A;  4B3R B;  3QO7 A;  4EO4 A;  4EFE A;  1TUB B;  4EX5 A;  2CJ9 A;  4AH6 A;  4FLT A;  1HXD A;  5KNN A;  2G4C A;  1Q3E A;  4LVJ A;  4FLX A;  2JGU A;  1YFS A;  4JI4 B;  2V4D A;  1USY A;  3UH0 A;  3BPZ A;  3K5N A;  3SJB C;  4DQ2 A;  2YXL A;  3HTZ A;  4I55 A;  4LF9 B;  1L8D A;  3BA9 A;  1PYS A;  3QO5 A;  1QE0 A;  2EJG A;  4FM1 A;  2DQ0 A;  4H2T A;  2JVD A;  1EIY A;  3VQY A;  2E5L B;  3RGB A;  1M93 A;  1IBL B;  2QHT A;  2QHU A;  1USY C;  1WYD A;  4I4T B;  4O2A B;  4YRF A;  3IKL A;  1H4Q A;  1WPB A;  4CC5 A;  4JI3 B;  4YCV A;  3K58 A;  4YJ3 B;  1YFR A;  4YRR A;  1ATI A;  4UCV A;  4D7T A;  2P5I A;  4JI8 B;  2EJ9 A;  4Q15 A;  2YIB D;  2RHQ A;  5KHI A;  2UXC B;  1BIB A;  3E9I A;  3V7R A;  5JVD B;  1O9G A;  5LOV B;  3RIR A;  3N2G A;  5KMG A;  2UUC B;  4YCW A;  1KMM A;  1X55 A;  1SQF A;  4YPF A;  4TV8 A;  2DQ3 A;  3BAB A;  5IJ9 A;  4FFB A;  4DR2 B;  1HNX B;  1B70 A;  4WJ4 A;  1ADJ A;  4YP0 A;  3K5M A;  3W3S A;  2IY5 B;  3JAT A;  4LF8 B;  3QTC A;  3THO A;  5LP6 A;  4B3T B;  4YRL A;  1ASY A;  5IJ0 A;  2RQ6 A;  3HKE A;  1YB3 A;  3BHP A;  3N2K B;  4DUY B;  1BBU A;  4X65 B;  4WBN B;  2QJ1 A;  1E1O A;  4HT4 A;  4O4I A;  4YRQ A;  4X62 B;  3HRK A;  3JSL A;  4YHH B;  2XTI A;  3HFZ B;  1B7Y B;  3IAL A;  1HR0 B;  4K87 A;  4O2D A;  4XEM A;  1N36 B;  3HKB B;  4TQF A;  3LNN A;  4ZOL B;  2ZZG A;  2YI8 A;  1WQ7 A;  3L4G A;  3HY1 A;  1TAE A;  3MAQ A;  4DV7 B;  4IHJ A;  4AQY B;  1NJ8 A;  4H2V A;  4BWA A;  1B04 A;  4UCT A;  2CJA A;  3CMQ A;  4KL1 A;  5J2T B;  2ZIM A;  3FFQ A;  5EIB C;  4UCU A;  4X20 A;  1FFX B;  2EWN A;  4DV0 B;  1L0W A;  1Z5V A;  2Q7G A;  4GKK B;  3RL6 A;  5CB4 A;  1NJ6 A;  2ZTG A;  3HKC A;  4JI0 B;  4RQF A;  4XU3 A;  2FYK A;  5JJJ B;  4PHZ A;  2BTO A;  3MF1 A;  4YRE A;  4X1I B;  3RYF A;  5ITZ A;  4YYE A;  4RDX A;  4DK1 A;  1QHT A;  3PCO A;  1H4V B;  3HXX A;  1TUB A;  1W66 A;  3TEH B;  2P5O A;  5EYP B;  2ZNJ A;  4H2W A;  4UP8 A;  1TVK B;  3QF7 A;  5CA1 B;  2ZM6 B;  2DJZ A;  4X1K B;  4JI7 B;  4XTU A;  2ODR C;  1HTT A;  1NYQ A;  4ZIB A;  4RMF A;  5EZY B;  1XMQ B;  5BMV B;  2F4V B;  4FLV A;  3HXU A;  1E24 A;  1G5H A;  2I4M A;  2QHV A;  4JV5 B;  1EVK A;  2RHS B;  1Q8I A;  5IYZ B;  5F5W A;  4UCO A;  2PMF A;  2VWK A;  4LFC B;  1X2H A;  3K59 A;  12AS A;  3K5O A;  4I4T A;  3VQV A;  4DV4 B;  4O2A A;  4E51 A;  4HWO A;  1G6U A;  1NT2 B;  4LH6 A;  4WJ3 M;  2J3M A;  4B3S B;  4WF2 A;  5BR8 B;  4YJ3 A;  4DPG A;  4GLX A;  4NCX A;  4XU2 A;  4DR7 B;  5LA6 B;  3IG2 A;  4DV6 B;  3LC0 A;  4XTW A;  4XTV A;  11AS A;  3A7R A;  2AMC B;  2PTM A;  2E3C A;  5JVD A;  4G85 A;  5LOV A;  3PZC A;  4HNA B;  2UUA B;  1BIA A;  4XU0 A;  1P49 A;  3BA8 A;  4YRO A;  4YJ2 B;  1T5E A;  3IAY A;  4YRM A;  1QF6 A;  4HWT A;  2IY5 A;  2I4O A;  2DDZ A;  2CIM A;  1VF7 A;  2PGG A;  1J5E B;  3CSX A;  3BJU A;  4J15 A;  2DZ9 A;  4YRP A;  1E1T A;  4P3O A;  3WB2 A;  1NJ2 A;  3ICX A;  3N2K A;  4DR5 B;  5ELN A;  4WBN A;  4JI2 B;  2ZGW A;  5FNV B;  4P3P A;  3REX A;  3MF2 A;  5C53 B;  4DR3 B;  3ICA A;  4H02 A;  2F1M A;  3HFZ A;  1B7Y A;  5K1X A;  1C0A A;  3HKB A;  2NS6 A;  4ZOL A;  4JI5 B;  5CA0 B;  1JFF B;  4LFA B;  2Q7H A;  3A2F A;  4LF5 B;  1X54 A;  4ZTU B;  4X66 B;  5KHJ A;  1LYL A;  5J2T A;  3E9H A;  4FLZ A;  3A74 A;  3KFU A;  2KKW A;  4TV9 B;  4LNS A;  3HKD B;  1FFX A;  1Z7M A;  1H2S B;  5JJN B;  3EFS A;  2DU5 A;  4NVP A;  4U3J B;  3K57 A;  3MEY A;  1J5W A;  4LVL A;  4X1Y B;  4LNU A;  1X01 A;  2DVE A;  3JSN A;  5LMN B;  4DV2 B;  3QG5 A;  3P8Y A;  2Q0A A;  2HNI A;  4LFB B;  4IIJ B;  4D7S A;  3E22 B;  4PHC A;  4X1I A;  1FYF A;  3LSQ A;  4I50 B;  4ZHQ B;  4P71 A;  1XNQ B;  5LXT B;  1XNR B;  5ELO A;  1XQ8 A;  4AIL C;  4XTZ A;  2UUB B;  3REU A;  1NNH A;  4ZI7 B;  2YI9 A;  3SJA C;  3M4P A;  3TEH A;  5EYP A;  1VQZ A;  2P0L A;  4TUY B;  1N34 B;  4P72 C;  3M7M X;  4H2X B;  1TVK A;  5CA1 A;  2CAZ C;  2ZIO A;  4X1K A;  1XHZ A;  1NJ1 A;  1WNL A;  2ALY B;  4YRG A;  1S5J A;  4XEO A;  5EZY A;  5BMV A;  4P71 C;  1SES A;  1X2G A;  4YRJ A;  4CS2 A;  2I4L A;  4DV5 B;  2E10 A;  5E3I A;  2BTQ B;  4DV1 B;  2PZS A;  4YRK A;  1WN7 A;  2RHS A;  5IYZ A;  1SKV A;  5C51 B;  3HXV A;  3EFR A;  3JAS B;  2DKG A;  2DTO A;  2DXU A;  1JJC B;  2J3L A;  5EIB D;  2PYJ A;  5JQG B;  4JYA B;  3V8L A;  2E1H A;  3VQW A;  3G1Z A;  5JCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...