2ZNJA

Crystal structure of pyrrolysyl-trna synthetase from desulfitobacterium hafniense
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
278
structure length
278
Chain Sequence
SSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Pyrrolysyl-tRNA synthetase-tRNA(Pyl) structure reveals the molecular basis of orthogonality
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase
total genus 79
structure length 278
sequence length 278
chains with identical sequence B, C
ec nomenclature ec 6.1.1.26: Pyrrolysine--tRNA(Pyl) ligase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2znjA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2znjA02
2PMFA 4UP8A 1O9GA 3NENA 3HXWA 2IY5A 2E5AA 2E65A 4CH3A 1Z7MA 3L4GB 1E24A 4XU1A 2ODRD 4WJ3M 2DU7A 4P73A 2RHSB 4RQEA 1SERA 2EJGA 3RKWA 1WYDA 3M4QA 2ZCEA 1H4VB 1X2HA 1PYSB 1EVLA 2AMCA 5K1XA 4CH6A 4UP7A 2ZNJA 4ZIBA 2RJZA 4YCUA 3REUA 3HXYA 1VQZA 1X56A 2DTOA 1B70B 3I7FA 2RHQA 3QNEA 4YRCA 2ARUA 3L1AA 3G1ZA 4YRKA 1H4SA 3IG2A 3A5YA 3W3SA 1USYC 3E9IA 3PZCA 3V8LA 3IKLA 4YYEA 2ZTGA 3OD1A 5ELOA 4H2XA 2DXTA 1ASZA 4YCVA 3V7SA 2CGHA 3A74A 2E64A 3BFMA 4H2YA 4RQFA 4RDXA 1NYRA 4XEOA 4HA8A 2P0LA 4KR2A 2EAYA 4K88A 4HWSA 2DZCA 2DKGA 1X55A 3VQWA 1SRYA 2QHVA 3PCOB 1YB3A 4L87A 4XTWA 3A31A 2C8MA 1KMMA 1E1OA 4P73C 4ZTUB 2Q5IA 4P75A 3V7CA 1EFWA 2RQ6A 3V8KA 3HXUA 4XEMA 2Q7EA 2YIAA 3ICAA 2ODRC 4YRGA 3E9HA 3ERRA 3LC0A 4CS3A 1YGBA 4TTVA 3TEHB 3A32A 4P3PA 3TEGA 2Q7HA 3WQZA 2YI9A 4P3OA 4YRTA 3V8JA 3R07A 1QE0A 3NELA 2EJFA 2ZGWA 2ZIMA 2AKWB 2ZZFA 2YIBD 2ZNIA 1JJCB 2DTIA 3BJUA 4YCWA 1EIYA 2P5IA 1LYLA 4HWOA 2ZT8A 4YRIA 1NJ6A 1NJ1A 1B8AA 2PMEA 1G51A 2ZZGA 1HTTA 2J3LA 1ADJA 2YIBA 4TQFA 3HXZA 3HFZB 3L4GA 2E10A 4EO4A 2CJBA 2DU5A 2ZXFA 4TVWA 4XU2A 2DJZA 1NYQA 3HXVA 2RHSA 3TUPA 2CJ9A 4BW9A 4CS2A 4TVAB 3A7AA 1X01A 3MF2A 1EQRA 3L2ZA 1PYSA 2DQ3A 1IL2A 12ASA 3VQXA 4P75C 4YRQA 2ALYB 3UGTA 3RKXA 4YRFA 4EX5A 3MEYA 4XTUA 1NNHA 2DVEA 1BIBA 3RIRA 1SETA 4YRPA 1B70A 4OP0A 4CH4A 2ZIOA 4ZTZB 4H2XB 2ZR3A 4WJ4A 1J5WA 1B76A 2CIMA 3IALA 2J3MA 4HWPA 2I4NA 4KR3A 1O9HA 3LSQA 1E22A 1NJ8A 2HEPA 3A7UA 4H2SA 3RL6A 4TVYA 2QJ1A 2ZZEA 1EOVA 4YRRA 4XTXA 1BBUA 1G5IA 4BWAA 3EFRA 3HXXA 3P8TA 2ZINA 3UH0A 2R70A 3VQVA 2C7IA 4H2WA 5K1PA 4WI1A 2EJ9A 4YPFA 1BBWA 3RKYA 4H02A 1C0AA 1Z7NA 4PG3A 5C51B 2PUSA 3HRIA 3V7RA 3KFUA 1QF6A 1N9WA 1WNLA 3QTCA 2FYKA 2ZT5A 2Q5HA 3NETA 4TWAA 1G6UA 4LNSA 3TEHA 2Q7GA 2QHSA 4P74A 4YRMA 1NJ5A 2I4OA 1B7YB 3RF1A 1SESA 1E1TA 2E1HA 2IY5B 5HGQA 2QHUA 2EL9A 4HWTA 3A5ZA 1JJCA 3RACA 4YREA 2QHTA 1YFTA 4XTVA 3UFGA 1WLEA 2R72A 2XGTA 4K86A 2AMCB 1NJ2A 3P8YA 2DEQA 3CMQA 3RGLA 3P8VA 4X5OA 3QO7A 2JVDA 4CS4A 4XTZA 1ASYA 3FJPA 1B7YA 5F5WA 1YFRA 3HFZA 4P72A 4CH5A 1ATIA 3UGQA 1HXDA 4Q15A 3VBBA 2RHQB 3M4PA 4XU0A 4P71A 1RIQA 4TVAA 1HC7A 5ELNA 2I4LA 4E51A 4H2UA 3NEMA 2ALYA 4KQEA 4G84A 3DSQA 2ARTA 2DXUA 4UP9A 4NCXA 4J15A 1WU7A 2I4MA 1WQWA 2XTIA 4YRNA 2CJAA 3MF1A 3HFVA 4P74C 3HTZA 4YRJA 2HNIA 4OLFA 3VQYA 1G5HA 3RUXA 1YFSA 4PHCA 4XU3A 1EVKA 3LSSA 5C53B 1WPYA 4H2TA 3A7RA 4UPAA 5KNNA 1KMNA 3IKMB 4DPGA 2DTHA 4TQDA 3PCOA 5E3IA 4WF2A 3QO8A 4RMFA 2YI8A 1ADYA 3ZEDA 4AH6A 4O2DA 4YP0A 3HRKA 2DDZA 4YROA 4G85A 2G4CA 4K87A 1W66A 1H4TA 4P72C 4YRSA 1FYFA 4HVCA 1GGMA 2E41A 2ZR2A 1KOGA 3HY1A 2PGGA 3EFSA 4P71C 1USYA 2E3CA 2EWNA 11ASA 1X2GA 1H4QA 2ZT7A 1L0WA 4XTYA 4P3NA 1WQ7A 3REXA 3BHPA 4H2VA 1BIAA 1EIYB 5C52B 4YRLA 2ARSA 3HY0A 4YDQA 2DQ0A 2AKWA 2ZT6A 2DZ9A 4DQ2A 1X54A 3QO5A 4HWRA 4Q6GA
chains in the Genus database with same CATH superfamily
4LFCO 5IDJA 1ZAUA 3NENA 2IY5A 1AP5A 2DYRC 3OR6C 2H3OA 1Z7MA 4LC1A 1NS1A 2XAQA 5H6RA 3K59A 1YJWV 3CCQV 4O4LA 2DW4A 2D2CB 2RDCA 4P73A 1J5EB 2F4VO 2EBOA 1FJGO 1QU7A 2ZCEA 4HNAA 1DF5A 1BQZA 4UVAA 1PYSB 2AMCA 2WLJA 1Y74A 5K1XA 1WPXA 1VF6A 4FZ0A 4DR1B 1GN2A 3C90A 2P06A 3AK1A 3JATB 1QLEC 1XNRO 1I08A 1YF2A 3CC2V 5B1AC 4YCUA 1OJHA 4QGPA 3B2EE 3CCMV 3ZRWA 1B70B 3LDDA 5LHIA 4GCZA 5CA1B 3E86A 4YRCA 3KZIZ 4JGSA 3BRCA 3N27A 2LGQA 3L73H 1S5JA 4MVSA 2W6JG 4B3RO 4DV1B 3SPGA 3V8LA 1FXKB 4PDLA 5ELOA 4W4LA 1Q6IA 1ORQC 3AG3B 4YCVA 4H37A 2LW1A 2HVKC 4U3JA 2E64A 4PDMA 1KMIZ 3BFMA 4RQFA 4LF8B 1ZWIC 3IJ4A 1QHTA 1VEWA 4FLWA 1YSCA 4FLVA 4TWKA 1OCOC 4R50A 4K88A 4QPKA 2PI5A 2UXXA 3WB2A 1G1XB 3SYCA 1TUEB 2JEUA 4JF3A 1SRYA 2OTJV 2UU9B 1WNSA 4P9PA 3BEHA 3ASNB 4ZOLB 2OCCB 1AI5A 1W59A 3L71H 4I55B 1KMMA 3RW0A 4I0XA 1ZUQA 1FFTB 3HB3B 3N2KB 4TV8B 4KHPO 2V7QG 4ZTUB 3QVNA 2KSDA 2Q5IA 1AJPA 4P75A 1FAFA 3SDLA 1GMGA 4JV5B 4UCOA 4IGGA 3ZS8C 1LUWA 2ODRC 4JI4B 1YEWA 3U0ZA 1WAZA 3LC0A 3TEHB 4OPHA 3HKBB 1JMKC 1Y76A 2NN4A 4JAUA 2JJ2G 2YI9A 5EIBC 2E76B 1K8AW 3UO3A 3QF7A 3R07A 1YVWA 5IJ9B 1OCZB 1M9NA 5IJ0A 4GX2A 2YIBD 4UFZA 2ZNIA 2HR3A 5EZYA 2Q67A 4MVMA 2DTIA 3B40A 4J7JA 3BJUA 4NTYA 4YCWA 2P5IA 4YRIA 4LNUB 1KBHA 1NJ6A 3ZX6A 3AG1B 1D5AA 1NJ1A 5BR8O 5EYPA 1THZA 2CAZC 3PN1A 3H1HH 1SQGA 1N36O 3ABTA 3A0HZ 1XBLA 4O4LB 3ETQA 3L4GA 3J80N 2E10A 4EO4A 1K73W 2CJBA 2DU5A 2CDYA 4P2ZA 4HNAB 4QJFB 4JI1B 1BZKA 2QWOB 4O2BA 4NXNO 3ABKB 2O57A 1HP8A 1NYQA 2DJZA 2RHSA 2CJ9A 1BSMA 1H8EG 4BW9A 1V54C 4X62O 2XAHA 2YSUB 3BA9A 1BHBA 3S3WA 1JCHA 4C7UA 1DLBA 4LFCB 4FFBA 3RKXA 1QR8A 4EX5A 3MEYA 4IT5A 4DRXA 4NTWA 2Q8VA 3K57A 1L8DA 4OP0A 4HZ3A 2F4VB 2D3OW 3OTOB 1J5WA 4X1YB 4B3TB 2ZM6O 4H33A 1B76A 1XILA 1TGOA 3IALA 4AI8A 4LF9O 3ZRVA 1H2GA 2CTRA 4JZ2A 3K06A 1E22A 3A7UA 4DR3O 3TCUA 1XREA 3FFQA 2CH7A 4AQYO 4OPAA 1XNRB 3RL6A 4WFEA 1KB9F 5FLXN 2ZDIA 3K0DA 1LNQA 3D36C 1NR1A 2QJ1A 5B1BB 3F5WC 1YIJV 1DGSA 1BBUA 1CP9A 3RN4A 2IH3C 2EINC 3HXXA 4PHZA 4I0XB 2C7IA 4JI8O 4H44B 4LF5O 2HJDA 4G2KA 4B3RB 4YPFA 4JI7O 1AR4A 1K5QA 3JARB 3OMIB 1VF6C 4H02A 1MOFA 2NR5A 3RYCB 4BIOA 4JYBA 2UXCB 2UUAO 3KFUA 1SKVA 4YJ3B 5H9CA 5C8YA 1V55B 2A7WA 4JI2O 2LFRA 3F7VC 4QE7A 5GONA 3QTCA 3SJQC 3ETEA 3FYIB 4X66O 2FYKA 2QM4A 4R6ZA 2W0FC 4LFBO 2FL4A 4DR6O 4K8ZA 1BE3H 4GZRB 2IU0A 4NB5A 2VQFO 1VQ8V 1V9PA 4LNSA 4JPRA 4DUYO 5L3BA 4TV9B 4DV5O 1Q8IA 2WSSG 3C3TA 1U97A 4GYCB 1NR7A 1OCCB 2E1HA 1ZSPA 4KHPB 5B3SB 3ZRSA 4DV4O 4PA7A 1EM1A 5CA0B 4JAVA 4PI2A 3OFNG 4DV2O 1KUQA 4J7ZA 1BHAA 1JJOA 1WJZA 1YCIA 1XNQO 4OX9B 4XTVA 5IT9N 1B04A 5DEDA 1DTOA 4X64O 3L9DA 5L3FA 5LP6C 4X88A 1NJ2A 4FZ1A 1TA8A 2EIMB 2ILMA 3ZHQA 3P8VA 1WA8B 4DO2A 4XTZA 4CS4A 1N32O 3FJPA 5F5WA 1FFXB 4FLTA 4P72A 4CC5A 4X65B 1VQ4V 1TVKA 2XASA 3UGQA 2WPDG 1HXDA 4Q15A 3VBBA 2RHQB 4FFBB 5H6QA 1XMOO 4P71A 2Q4PA 1LUVA 5J2UA 5BR8B 1EN6A 2I4LA 2FKXA 1N36B 3RYHB 4CBCA 3DSQA 4BIZA 4JAAA 2BOBC 1OCRB 2ARTA 4CZZA 1EBOA 4A5UB 5J2TA 4MS2A 1YDXA 2I4MA 1HNWB 3BFRA 3K5MA 5LYJA 4NXNB 3N2GA 4X89A 1IBMO 2R9IA 3VQYA 2OIEA 2QSAA 2ITDC 1G5HA 4X62B 3RUXA 3FD9A 1YHQV 1GRJA 5KAIZ 1JOYA 1AJNA 1G4YB 5KA5A 5C53B 3STZC 3SYAA 3ABMB 4TUYB 2QWQB 4DR4B 3AG4C 1K34A 3SJBC 3X2QB 2DTHA 4TQDA 3PCOA 4I7ZB 3CB2A 2GHYA 4B7EA 4X1IB 2EILC 1L0NH 4RUFA 1GN3A 2IJKA 1Q3EA 3ASOC 2YXHA 5EBWC 2P90A 1XL6A 4YJ2A 4O2DA 1E1RG 2Q6AA 1P7GA 4YP0A 4WFHA 3HRKA 4H0LB 2ZM6B 4YROA 3ZMSA 2ZE7A 5CB4A 4LF9B 2DWDC 2EIKB 3JD0A 4DR3B 5AG2A 1R6KA 3WG7B 1SA0A 1L0LH 1NTMH 4AQYB 4OGQB 5HFMA 3HY1A 1UPGA 2PGGA 3EFSA 3G71V 5CN0A 3CCLV 3ZMTA 2E3CA 4DR5B 5IYZA 4LCUC 2ZT7A 1L0WA 1B6QA 2CTWA 4XTYA 4MSWC 4P3NA 1WQ7A 4DR1O 3ABLC 3L70H 2QKAA 5C52B 1B3QA 2DQ0A 2IU3A 3GVMA 5KX5A 4I50A 2P67A 5EC2C 2AKWA 1X4TA 1NH2B 1X54A 4YRMA 4LVIA 4E4EA 4IHJA 4Q6GA 4DR7B 2GUZB 4UP8A 4PDVA 3HXWA 4UCSA 2UUAB 4FLZA 4WCEV 1RSOA 4CH3A 4J7KA 1Z5WA 5JQGA 4FM0A 1E24A 1VMGA 4WFBV 1Q90D 2WLMA 2DU7A 4TT3G 4PA9A 1XOUA 5DN6G 2GTSA 2VQFB 1X2HA 1PL0A 4DV5B 4CH6A 3CC4V 2G38A 1OZ0A 1PV0A 2BTQB 2Z0AA 3P3PA 1RM1B 4OXSA 5JJNB 1S72V 2UXBO 4DV4B 2F95B 5KA6A 2L35A 3CD6V 3REUA 1HDJA 1K3EA 1X56A 2ARHA 4FJCC 3JAMN 3UO2A 1R3KC 3QNEA 1VQ6V 3L1AA 1XNQB 2N74A 3FYEB 3A5YA 4X64B 2XHBA 1USYC 1MSDA 1M56C 3CMAV 4DUZO 3JCZA 2ZTGA 4BR6A 3LSUA 3FAVA 5LYJB 1FYJA 4PD4F 1N32B 2CGHA 3A74A 3W7UA 2DYRB 2ZE5A 4CC6A 4K3AA 1S0VA 1NYRA 3DGEA 1E79G 3GWOA 2P0LA 3OEEG 2YEVB 4FK5C 2EAYA 4YXWG 2AZ2A 1PNMA 1XMOB 1I5XA 3D3IA 5GW7A 1VQ5V 2DKGA 4IIJA 4J41A 4R8CA 3GB7C 3VQWA 1VF5B 3PCOB 4P9OA 4FFKA 3FX7A 4LF7O 2GV9A 1Q82W 5E1AC 3RYFA 2QA4V 3CYOA 2X7RB 2C8MA 2OT5A 1E1OA 1SF9A 2XUMA 1ZL8B 3W7XA 5B1AB 4DK0A 3V7CA 4ZKIA 1EFWA 3HXUA 5KAFZ 1S3JA 2YIDA 1SA0B 2Q7EA 4XEMA 3H9VA 1G8MA 4UCVA 2OYQA 2YIAA 4EB6B 3UKMA 2Q0OC 2LW7A 1NVPD 3E9HA 4YRGA 1YGBA 3CC7V 1DK1A 2EIJC 1RFYA 2JRIA 3V8JA 1Q7YW 5CBGA 3H1LH 2Q68A 4YIOA 3M99B 2ZD9A 2JIZG 2AKWB 5EC1C 1JJCB 1SC5B 1L1FA 4IHJB 5IY5C 2NLJC 4XDJA 1MG1A 4O4HB 5LGNA 4HWOA 1FD9A 3D36A 3IFXA 4J9ZB 4I4TB 2UUCO 2Z3YA 2P22C 3JAKB 1KC8W 5JQGB 5LHGA 1EZVH 4QIWF 1N34B 2PMEA 1AI4A 3OTOO 3CCEV 4B3TO 2DYSC 1HTTA 1ADJA 2WLLB 1N0JA 3HFZB 4BW5A 2PI4A 2PTMA 3HKEA 5E79Z 4TVWA 4XU2A 4O4IA 5JH7A 4JASA 4X1KB 3A7AA 2KG7A 2DQ3A 4DV0O 1M57C 2UUBB 3RFRA 1ROPA 2ALYB 5LOVA 2EJRA 3E89A 4O2AB 3EHBB 4XTUA 2CK3G 1GM8A 3ZHSA 2VS0A 3OGIB 4X8AA 3OUSA 3DTUB 2DVEA 3E8FA 3CCUV 1BIBA 4YRPA 2IJHA 3CS5A 5LL6Y 3LDCA 2AGAA 4XDKA 1LR1A 1RP3B 1FXHA 2UXCO 4LVKA 2CIMA 1GKFA 4D6TH 3Q4HA 2I4NA 4HWPA 3LSQA 4F6RB 3KCXA 2QKSA 4YIPA 2QTSA 4LP8A 2Y4TA 4H2SA 1QNMA 1GO3F 2UXBB 1H2SB 1BMFG 4TVYA 5LP6A 2ZZEA 2X6AA 3H1KH 4KFMA 4W4KA 2HLDG 2Y0PA 3G6BA 3P8TA 3EXAA 1KD1W 2ZINA 3CE2A 4WI1A 3KG2A 1W2BU 3A2FA 1V54B 5KMGA 4DUZB 3ML0A 1PP9H 1BBWA 2PF4E 5L3EA 2IBZH 1C0AA 4OX9O 2JDIG 4Q20A 1HWYA 3G80A 5C51B 1IXBA 1GTOA 3AEIA 2F43G 4J10A 5EK0A 5CBHA 1Q6UA 3H01A 3K9SA 5J9PC 2ZT5A 4MVRA 4U3FH 2Q5HA 3NETA 4TWAA 2GBOA 1G6UA 3OR7C 3LNMB 4X65O 3L75H 3D8CA 4LF7B 2A8EA 1F7YA 3RF1A 1B7YB 2HVJC 1SESA 1E1TA 3ZHUA 5LGUA 4QE9A 2EZPA 2IY5B 2WLKA 4B3MO 2QHUA 2EL9A 3UQ8A 4HWTA 1OV9A 1Q43A 3CJHA 4MW3A 1FXKC 3ZHTA 3EFFK 2EZOA 4YREA 3AG3C 4AILC 4FM1A 3JALA 1WLEA 1HNWO 2R72A 4RWUA 4UUJC 2XGTA 2AMCB 3P8YA 2FMLA 1Y74B 3HKEB 3ZHRA 3HKDA 4DW1A 3CMQA 3RGLA 2A79B 1BCCH 2FTKA 3QO7A 2JVDA 2Y0IA 1ASYA 1A32A 2VRZA 3E22A 4ABMA 3E2EA 4CH5A 1ATIA 3ABUA 3ZRWB 3ASNC 4X20A 2OCCC 4DR4O 1N33O 2YICA 4LFAO 4XU0A 4TVAA 1GM7A 2EJ7A 2UUCB 4MTOA 4H2UA 3NEMA 3SJCC 2JS3A 1Y67A 4U3JB 1WQWA 4YRNA 3MF1A 2RN9A 2Y4UA 2M6YA 4ASUG 1IBLB 4MTGA 2GTAA 1SQPH 1K5SA 4DR5O 4PHCA 4XU3A 2OWOA 1OCZC 5DECA 3RVZA 4DV0B 1MMMA 2UXDO 3HKCA 1WPYA 4LVMA 2XTAA 3STLC 1TAEA 5IWAB 5HFLA 2RMKB 3K3WA 3MDSA 3CXHF 4WBNA 3QO8A 2DJVA 1U96A 1ZTEA 5LGTA 4DR7O 1ADYA 3ZEDA 3IC7A 3ZN0A 4I9WA 3NR7A 2R9RB 3B77A 5JJEB 1KU9A 3BABA 2CTQA 4JYCA 3APQA 2P4KA 1H4TA 4NR1A 4F6EA 4YHHO 4LF4O 4F4LA 5GTHZ 1YXBA 1Y76B 1KOGA 2DOSA 2IW5A 1AB3A 3ZIAG 2LJ2A 1N0NA 2B1GA 4O4JA 1USYA 2N05A 2BSKA 1ZLZA 1X2GA 1F4MA 1JA8A 5IJ0B 4WFAV 1VP7A 3E8GA 3WB0A 3OE7G 5EZYB 3OW2U 1YTFB 4H2VA 3BAAA 4I5SA 4ZHQA 1ZX3A 4WFFA 1KP3A 2B1IA 2ARSA 3DXRA 2ZT6A 1F51A 3JYCA 5EYPB 4FM2A 3QO5A 3LDEA 1IURA 1XUQA 4N21A 3C3SA 2WA3A 4NTXA 2E5AA 3T1YO 5JVDA 4JI6O 3L4GB 1M1KW 4J11A 5H5NA 4EFEA 1E1QG 2GSMB 4J9YB 2XAFA 4XDLA 3AG2B 4O2BB 5B5EZ 2Y69C 2Q69A 2RHSB 2LO1A 1SERA 2EJGA 1AI6A 3A8TA 3RKWA 3M4QA 1EFRG 1EVLA 1VQNV 4UP7A 1PL4A 2VWKA 2HFEC 5LXTA 1YITV 2OIGA 3UT5A 4B3MB 2RJZA 1WB8A 4GKKO 4NVPA 4JZGA 4DRXB 3OMAB 3HXYA 5BY1A 1NU1H 2OTLV 3CSXA 3I7FA 4BAYA 1S76D 1SZXA 3IGAC 5JJJB 1H4SA 5JCOC 1YJNV 3IG2A 2KB1A 1K9MW 1R3LC 2VQEO 3K5OA 1V55C 3PZCA 1YI2V 5A2QN 1D5NA 4H2XA 4NKGB 2CH7B 4P30A 3V7SA 1ASZA 3ETDA 1JQ0A 5H2FZ 2R9AA 4H2YA 4UVBA 3ZHVA 1N33B 2MW2B 2V1DA 4LFAB 2MK3A 3NXSA 1OCCC 4EFBA 1X55A 4N23A 1BQ0A 1QR9A 3J81N 5B3SC 3FKSG 4L87A 3SPHA 4B3SO 2AHZA 1IBKO 3A31A 1XDCA 2JGDA 3MHHC 1NT2B 3OT7A 4JI5B 3WFVA 2ATKC 5C8YB 4HAMA 3JD3A 1T5EA 2RQ6A 5GONB 4FLUA 1N34O 2EIMC 1NZ6A 1GAXA 3RYIA 2LGWA 2UXDB 4LWSA 3ERRA 3S3XA 4CS3A 3T4ZA 1M56B 3A32A 3OUFA 3TEGA 5LA6A 1WB7A 3WQZA 1QBZA 4YRTA 2QM8A 4PDRA 1SQVH 4ZI7A 3NELA 1QQCA 1FXVA 1K4DC 2JGUA 2UUBO 1SQXH 2ZIMA 1VQLV 2ZZFA 3ZMUA 2RNBA 5KUKA 1OCRC 5LHHA 1EIYA 2ZT8A 3ZCCA 2GDSA 4UB6Z 5KLVH 4YHHB 4LF4B 3ZMVA 4G27B 1B8AA 3RT3C 5B1OA 4ICGA 3SPIA 5IE9A 4UCTA 3W7TA 1WP8A 2YIBA 4MVQA 1QVGU 1TVKB 3JCUZ 1IX9A 2E74B 1B06A 4BIUA 3W7SA 3ABMC 3JAWA 3IC9A 3HXVA 3TUPA 5EBLC 1M90W 5KHIA 1OHHG 1X01A 1NTKH 3L2ZA 4D7TA 5J2UB 1PYSA 1EZJA 2BOCC 1IL2A 1NKDA 3LUTB 3RWRD 4GKJO 3JATA 2EIJB 3CRMA 3T1YB 2V4DA 1PNLA 5J2TB 1HNZO 4JI6B 1PM9A 2H8PC 3SGIA 4GT1A 3RIRA 3BCCH 1H2MA 2K9PA 3T4DA 1B70A 4CH4A 2ZIOA 3N2GB 2PZSA 3WG7C 1H38A 3O9OA 4ZTZB 2ZT9B 4H2XB 3TXQA 2ZR3A 4WJ4A 4JI3O 2QM7A 3HPLC 1IVSA 4KR3A 2OCHA 1BGYH 1FXKA 3GWKC 4K0KB 3E35A 2M7WA 3P32A 5JWPA 4AHCA 4GKKB 2DYSB 3O65A 3A0RA 4PELA 2KKWA 4H13B 1Q6HA 1EOVA 4YRRA 4XTXA 2XT9A 1KYOF 1G5IA 4BWAA 3I55V 3EFRA 4YJ2B 1EN4A 1QLEB 3VQVA 4DR2O 2IJJA 4GX0A 2VQEB 5CB4B 3BPZA 4ZOLA 3BVOA 3MHSC 3J7AU 1JVMA 4I55A 1HR0O 3THOA 3OGCC 1CEZA 1I94B 1Z7NA 4PG3A 4IYIA 4DV6O 3N2KA 3HRIA 3CCJV 4GUNA 4TV8A 2P7TC 3JSLA 5IYZB 3RYIB 4QPJA 4LWSB 4MT8A 4MW8A 3H1IH 1NH2D 5LA6B 3CP1A 1NI8A 4FMTA 1RM1C 3CCSV 3QG5A 1J95A 5KX5B 2HG5C 4I50B 5EBMC 4NXMB 3E8BA 3TEHA 1VIBA 3HKBA 3OD4A 4B3SB 2QHSA 2WLNA 1IBKB 1OCOB 1Z5VA 3TETA 5A9GA 2Q0AA 1K4CC 1R6TA 2B9ZA 3CX5F 5HGQA 1H2KA 4DV3O 1MA1A 1RSOB 3PJSK 2CGOA 3A5ZA 1IXMA 3P30A 3APOA 1MZFA 2BTOA 1US6A 3RACA 1KECA 4LNUA 1YFTA 2E75B 2CUGA 1KKDA 1S5LZ 1R73A 3FB5C 4K86A 1AR1B 4K35A 3LNNA 3BY6A 5ITZA 1MSWD 1K92A 2WLIA 3OM3B 4WFGA 2DEQA 1IBLO 1K33A 3JAWB 2QKCA 1I5YA 1URFA 2E5LO 3ZMZA 4UXNA 1R3JC 1NTZH 1VQMV 1PKXA 4KP4A 4MVUA 2YDEA 5IWAO 1ENVA 1RIQA 1HC7A 5ELNA 1XL4A 1SS3A 5D5PA 3RGBA 2QR4A 4K8XA 3FAVB 4PI0A 4UB8Z 2Q5ZA 2DXUA 5D5QA 1VQKV 4J15A 3H1JH 2XTIA 4B08A 3G67A 2CJAA 1F23A 1MNGA 4MTFA 2N04A 2A0LA 4RUEA 2ZXWC 2QEXV 3HFVA 3HTZA 4P74C 4YRJA 3KKYA 1XMQB 3A0BZ 2XOKG 3FB7C 4X1YA 3BA8A 3TXSA 3U11A 5BXZA 4DW0A 4IIJB 1P49A 1YFSA 3MD0A 2IH1C 4RAIA 3IAYA 4DV7O 3LSSA 4H2TA 1PD3A 4GKJB 3RYFB 5KHGA 4UPAA 3L72H 1KMNA 4DPGA 2YS8A 5CMUA 1HNZB 3SJAC 5E3IA 5C93A 2AZ0A 2PYLA 1CXZB 4RMFA 1AI7A 1AP6A 4GX5A 1XHZA 2YI8A 4FIPC 3SYPA 3K0GA 1W0KG 4JI3B 4JTDB 3UCSC 2DDZA 2G4CA 3JASA 1W66A 3ZJZA 4YRSA 1N4CA 4HVCA 4GLXA 3JARA 2ZR2A 3RYCA 3L74H 5JCOA 5IYBO 4YJ3A 2ZKOA 4PA6A 2EWNA 2WA4A 11ASA 2CE4A 2YXYA 3RBZA 1H4QA 1FPOA 3K58A 2Y48A 3RVYA 3BHPA 5IYDO 3B4SA 1XI1A 1BIAA 4DR2B 1KQSU 2P6JA 4IYHA 1Y4MA 1WN7A 5L3DA 4YRLA 2WWWA 3CPWU 1EN5A 2QWPB 2DZ9A 4TV9A 1HR0B 4HWRA 3K04A 2EINB 2IJIA 2PMFA 1HNXB 1O9GA 2VWJA 4Z1MG 4DV6B 2E65A 4MVOA 1I0HA 3ICXA 2JEXA 1VF7A 5F2VO 4XU1A 2ODRD 5B66Z 5CA0A 2AXTZ 4WJ3M 2ADPA 2ETNA 4O4IB 2QWRB 5JH7B 5ITZB 2WLIB 4RQEA 3ZBHA 2X6CA 3SYOA 1WYDA 3WB1A 1H4VB 4KUMA 2KG7B 5EIBD 1P7BA 4PV1B 4PA4A 2C2AA 2L6LA 2ZNJA 1WA8A 1H2LA 2YXLA 1RPOA 2F1MA 4FPPA 4ZIBA 1I7FA 5LOVB 4DV3B 1FFXA 5BZBA 4LF6O 2ADQB 5CA3A 1VQZA 2DTOA 3K79A 3SPCA 2RHQA 1VQ7V 1QVFU 1JX9A 2ARUA 2B5UA 2F66C 3G1ZA 4YRKA 3W3SA 5FPOA 3CRAA 3VOUA 4JI5O 2QTOA 2FYUH 3Q4HB 5BMVA 5LBQA 3E9IA 3IKLA 3CRQA 4YYEA 3OD1A 1Z2GA 3RYHA 2HHHO 2DXTA 3DC5A 4UV8A 4LBEC 1YZBA 1SQQH 2E5LB 4KXRA 1FJGB 4PA3A 4D7SA 5LP6B 4RDXA 1DF4A 4IL6Z 4XEOA 4HA8A 2XAJA 1PNKA 4KR2A 4HWSA 1QCEA 3TK1A 2Y69B 2DZCA 4DK1A 3CCRV 4HYOA 2QHVA 3AG1C 1XHXA 1YB3A 2ZE8A 2BCCH 5KMGB 4XTWA 4TUYA 1IZ3A 1KP2A 2LQTA 1AVMA 3M8AA 4P73C 1VQPV 2QDOA 3JASB 4RO2A 4X1IA 4JYAO 3R65A 3V8KA 4U7NA 4FLXA 3ABKC 4Z1VA 4I9QA 4NYKA 2LP7A 4JTAB 2NNUA 3ICAA 1JR9A 3D3QA 3I56V 1RPRA 1XQ8A 1Y6XA 2HP8A 4DV7B 4TTVA 4P3PA 2A06H 2Q7HA 3UM7A 3OEHG 1GM9A 4P3OA 4EKWA 3P3NA 1PPJH 4PJ0Z 2ITCC 4JI0O 1QE0A 2JJ1G 2EJFA 2ZGWA 1MZEA 2XAGA 3CJHB 1HW7A 3AG4B 1S77D 2RCVA 3SYQA 4QNHB 3HR0A 1LYLA 4TSFG 3JALB 2QWNB 1P4RA 2EILB 3T1HO 2DMXA 5LMNO 3TJTA 1R6NA 3ASOB 1VARA 1XEQA 3DC6A 2PY5A 2GUZA 2P4VA 1Q86W 1G51A 3HKDB 2ZZGA 2J3LA 1GK9A 3E22B 4TQFA 3SR2C 2Q73A 3HXZA 3F7YC 5B1BC 1MABG 3MAQA 2NS6A 2JK5C 2ZXFA 4X20B 5KHHA 4K0KO 4DYLA 1AILA 5LMUO 1IDSA 3CHXA 2QGNA 4CS2A 5L3GA 4TVAB 4R7CA 2AHYA 2Q9LA 3OMNB 1UJWB 1EQRA 3MF2A 3CRRA 2F93B 3VQXA 12ASA 4P75C 4YRQA 3ABLB 3UGTA 3B8NA 4YRFA 5FPRA 2BTQA 4EEQA 3FB6C 4LH6A 1NNHA 3CEIA 3OAAG 1SETA 1VQ9V 2A3QA 3T1CA 5TISZ 3CMEV 5BMVB 5FNVA 4YY3O 1P84F 1I94O 4L8JA 2ZE6A 4JYYA 1NJIW 2J3MA 1BL8A 4J80A 1O9HA 1NJ8A 3HKCB 2IM9A 2HEPA 2HKOA 3K08A 5L3CA 4GX1A 4X9QA 1K97A 3ZRXA 1QLNA 1AR5A 4LF6B 4NXMO 4WBNB 1TUBA 2YEVA 3UH0A 2R70A 4H2WA 4LVJA 5K1PA 3OTFA 2EJ9A 4E2LA 2H94A 4G28B 2HHHB 1GH6A 3ZN1A 3RKYA 3AG2C 2XNDG 3K03A 1FKAO 3EVKA 1Q81W 2X0LA 1ZL8A 4XBFA 2PUSA 4O4JB 4Z2WA 1YTFD 3V7RA 5KHKA 1QF6A 1BS3A 1N9WA 2BSKB 1CPYA 4UVCA 3JSNA 1GN4A 1WNLA 5KUMA 2WAMA 3M7MX 4WF9V 4B7KA 2LFSA 1NQTA 2FB5A 5DM6V 4ZHQB 3G6EV 4EB6A 1J5EO 2DWEC 1FS0G 3DXRB 1H2NA 4UCUA 2Q7GA 1JFFA 4P74A 3K9AA 1M5IA 1NJ5A 2I4OA 2DE0X 1NVPB 1GN6A 2ZQMA 3CRCA 3B09A 4JI8B 4LF5B 5IYCO 5JVDB 4JYAB 4JTCB 1M93A 4JI7B 3I5DA 1KKCA 1JJCA 3CWBH 3KCYA 5GTIZ 3ETGA 4LR3A 2CGNA 1VQOV 3JD1A 4O4HA 4MVZA 1NBMG 1JPXA 2QHTA 4TOIA 3UFGA 3T2MA 2ZDIC 4I4TA 3JAKA 4DV1O 4JI2B 4X66B 1M4UA 1XMQO 2WLHA 4X5OA 3X2QC 4LFBB 5LXTB 3B8MA 4DR6B 2PYJA 1COWG 3F5TA 2WLLA 3UT5B 4JI0B 1YFRA 3HFZA 4UCRA 4LF8O 2AW9A 4DUYB 2CTPA 3SPJA 2K1EA 5FL7G 1YJ9V 3E8HA 3M4PA 1H8HG 1SZTA 4X1KA 1Q5OA 3K5LA 5B1NA 2UU9O 3T1HB 2EIKC 3CXCU 5LMNB 1SQFA 2F23A 4E51A 4U7OA 5CA1A 2ALYA 1SQBH 4KQEA 4G84A 5IY5B 4UP9A 1WPBA 1F4NA 1BT8A 4DV2B 4NCXA 1K7DA 4O2AA 5FNVB 2P5OA 4HT4A 1R1BA 4LH7A 1WU7A 4FLYA 3AK3A 4FVMA 5LMUB 2W0XA 5KHJA 2X6BA 2EULA 4JV5O 3JD2A 3G4SV 1R3IC 2HNIA 4OLFA 2BE3A 3R66A 4JI4O 4F6RA 1EVKA 1AROP 2DN9A 3A7RA 5KNNA 3W7WA 1S5HC 1TUBB 2JGDB 3IKMB 2YC0A 4J42A 3CCVV 2ODMA 2UXNA 2QE7G 2HJFC 4WF2A 2KQXA 1M57B 4HBNA 1D2DA 1AJQA 1HNXO 1WP7A 4AH6A 4YY3B 3FB8C 1UFIA 3WU2Z 2A9HA 4G85A 4UV9A 4K87A 4ZBMA 3U10A 4P72C 1FYFA 5CBFA 4LVLA 1GGMA 2E41A 3JD4A 1W0JG 1IBMB 4P71C 4ZI7B 3AK2A 4KL1A 2EX3A 3K5NA 2JS5A 1JFFB 3REXA 2ZXWB 4JI1O 4DXWA 3E83A 3AG7A 2Z5UA 1JJ2U 2YUAA 1EIYB 5IJ9A 4MTXA 2W6IG 3HY0A 4YDQA 3TGUH 4DQ2A 1B7YA 1N8RW 1Y66A 3MQZA 1X59A
chains in the Genus database with same CATH topology
4DR7B 2PMFA 1HNXB 4UP8A 1O9GA 2VWJA 1ZAUA 3NENA 3HXWA 4DV6B 2IY5A 2E5AA 4UCSA 2UUAB 4FLZA 1RSOA 2E65A 4CH3A 5JVDA 1Z7MA 1Z5WA 3ICXA 5JQGA 3L4GB 4FM0A 1E24A 1VF7A 4EFEA 4XU1A 2ODRD 3K59A 5CA0A 4WJ3M 4O4LA 2DU7A 4O2BB 4O4IB 5JH7B 5ITZB 4P73A 1J5EB 2RHSB 4RQEA 1SERA 2EJGA 2VQFB 3RKWA 1WYDA 3WB1A 3M4QA 2ZCEA 1H4VB 1X2HA 4HNAA 5EIBD 1PYSB 1EVLA 2AMCA 5K1XA 4DV5B 4CH6A 4UP7A 4DR1B 2ZNJA 2YXLA 2F1MA 2VWKA 4ZIBA 5LOVB 1I7FA 3JATB 5LXTA 2BTQB 3UT5A 4B3MB 2RJZA 4DV3B 1FFXA 5JJNB 4NVPA 4YCUA 4DV4B 4DRXB 2F95B 3B2EE 3REUA 3HXYA 1VQZA 1X56A 2DTOA 1B70B 3CSXA 2RHQA 3I7FA 3QNEA 5CA1B 4YRCA 2ARUA 1XNQB 3L1AA 5JJJB 3G1ZA 2F66C 5JCOC 4YRKA 1H4SA 3IG2A 3BRCA 3A5YA 3W3SA 5FPOA 4X64B 2XHBA 1S5JA 1USYC 3K5OA 5BMVA 4DV1B 3E9IA 3PZCA 3V8LA 3IKLA 4YYEA 2ZTGA 3OD1A 5ELOA 4H2XA 3RYHA 2DXTA 5LYJB 1ASZA 4YCVA 1N32B 3V7SA 2CGHA 4U3JA 2E5LB 2R9AA 3A74A 2E64A 1KMIZ 3BFMA 4CC6A 1FJGB 4H2YA 4LF8B 4RQFA 4D7SA 5LP6B 4RDXA 1NYRA 1QHTA 4FLWA 4XEOA 4HA8A 1N33B 4FLVA 2P0LA 4KR2A 4LFAB 2EAYA 4K88A 4HWSA 3WB2A 1XMOB 2DZCA 4EFBA 1X55A 2DKGA 4DK1A 4IIJA 3VQWA 1SRYA 2QHVA 1XHXA 2UU9B 3PCOB 1WNSA 1YB3A 5KMGB 4L87A 4XTWA 4ZOLB 4TUYA 2GV9A 3RYFA 3A31A 4I55B 2C8MA 1KMMA 1E1OA 4P73C 3N2KB 4TV8B 4ZTUB 1NT2B 4JI5B 2Q5IA 4DK0A 3JASB 4X1IA 5C8YB 4P75A 3V7CA 1T5EA 1EFWA 2RQ6A 5GONB 4FLUA 3V8KA 4JV5B 3HXUA 4FLXA 4I9QA 4UCOA 3ZS8C 4XEMA 1SA0B 2Q7EA 4UCVA 2OYQA 2YIAA 4EB6B 3ICAA 2ODRC 4JI4B 3E9HA 1YEWA 3RYIA 2UXDB 3U0ZA 3ERRA 4YRGA 1XQ8A 3LC0A 4CS3A 4DV7B 1YGBA 4TTVA 3HKBB 3TEHB 3A32A 4P3PA 3TEGA 2Q7HA 5LA6A 1JMKC 3WQZA 2YI9A 4P3OA 5EIBC 4YRTA 3V8JA 4ZI7A 3QF7A 3R07A 5IJ9B 1QE0A 3NELA 1QQCA 5IJ0A 2EJFA 2ZGWA 2JGUA 1HW7A 2ZIMA 2AKWB 2ZZFA 2YIBD 4UFZA 2ZNIA 1JJCB 5EZYA 2DTIA 3BJUA 4IHJB 4YCWA 1EIYA 2P5IA 4O4HB 1LYLA 4HWOA 4LNUB 2ZT8A 1NJ6A 4YRIA 3JALB 4YHHB 4LF4B 4I4TB 1D5AA 2P22C 1NJ1A 5EYPA 3JAKB 2CAZC 5JQGB 1B8AA 2PY5A 3PN1A 1SQGA 1N34B 2PMEA 4UCTA 1G51A 3HKDB 4O4LB 2ZZGA 1HTTA 2J3LA 1ADJA 3E22B 2YIBA 4TQFA 3SR2C 3HXZA 3ETQA 3HFZB 3L4GA 2E10A 4EO4A 3MAQA 2CJBA 2NS6A 2DU5A 1TVKB 2PTMA 3HKEA 4LVIA 2ZXFA 4HNAB 4X20B 5KHHA 4TVWA 4JI1B 4XU2A 3JAWA 4O2BA 4O4IA 5JH7A 2DJZA 3CHXA 1NYQA 2RHSA 3HXVA 3TUPA 2CJ9A 4BW9A 4CS2A 4TVAB 5KHIA 4X1KB 1X01A 3A7AA 3MF2A 1EQRA 3L2ZA 4D7TA 5J2UB 1PYSA 2DQ3A 1IL2A 3BA9A 2F93B 3VQXA 2UUBB 12ASA 4P75C 4YRQA 3RFRA 3RWRD 2ALYB 4LFCB 3UGTA 4FFBA 5LOVA 3RKXA 3JATA 4YRFA 5FPRA 2BTQA 4EEQA 3T1YB 4O2AB 2V4DA 4EX5A 3MEYA 5J2TB 4XTUA 4LH6A 4JI6B 1NNHA 2DVEA 4DRXA 3SGIA 1BIBA 3RIRA 1SETA 4YRPA 3K57A 1B70A 1L8DA 5BMVB 4OP0A 4CH4A 2ZIOA 3N2GB 2PZSA 5FNVA 2F4VB 4ZTZB 4H2XB 2ZR3A 4WJ4A 3OTOB 1J5WA 4X1YB 4B3TB 4L8JA 1B76A 4LVKA 2CIMA 1TGOA 3IALA 2J3MA 4HWPA 2I4NA 4KR3A 1O9HA 3LSQA 4F6RB 1E22A 1NJ8A 3HKCB 2IM9A 2HEPA 4K0KB 3A7UA 4H2SA 3FFQA 1XNRB 3RL6A 4AHCA 4GKKB 2UXBB 1H2SB 4LF6B 2KKWA 4TVYA 5LP6A 2QJ1A 2ZZEA 1EOVA 1DGSA 4YRRA 4WBNB 4XTXA 1BBUA 1G5IA 4BWAA 1TUBA 3EFRA 3HXXA 4YJ2B 4PHZA 3QO5A 3P8TA 2ZINA 3UH0A 2R70A 3VQVA 2C7IA 4H2WA 4LVJA 5K1PA 2VQEB 4WI1A 3OTFA 4B3RB 5CB4B 2EJ9A 4YPFA 3A2FA 3BPZA 5KMGA 4ZOLA 4DUZB 3JARB 2HHHB 1BBWA 3RKYA 4I55A 4H02A 3THOA 3RYCB 1C0AA 1I94B 1Z7NA 4PG3A 2UXCB 3N2KA 2PUSA 3HRIA 4O4JB 3V7RA 4TV8A 5C51B 5KHKA 1SKVA 4YJ3B 3KFUA 1QF6A 3JSLA 1N9WA 5C8YA 3RYIB 5IYZB 3JSNA 5GONA 1WNLA 3QTCA 3M7MX 2FYKA 2QM4A 5LA6B 2ZT5A 4ZHQB 2Q5HA 4EB6A 4K8ZA 3NETA 4TWAA 3QG5A 5KX5B 1G6UA 4NXMB 4I50B 1V9PA 4LNSA 4UCUA 3TEHA 2Q7GA 3HKBA 4B3SB 2QHSA 1JFFA 2A8EA 4LF7B 4P74A 4YRMA 1IBKB 1NJ5A 1M5IA 1B7YB 4TV9B 2I4OA 1Q8IA 3RF1A 1Z5VA 4GYCB 1SESA 1E1TA 2Q0AA 2E1HA 2IY5B 4JI8B 5HGQA 4LF5B 4KHPB 2QHUA 2EL9A 5JVDB 3UQ8A 4JYAB 4HWTA 3A5ZA 1Q43A 1M93A 4JI7B 1JJCA 2BTOA 5CA0B 4PI2A 3RACA 4LR3A 4YREA 1JJOA 4O4HA 2QHTA 4AILC 4LNUA 4TOIA 4OX9B 1YFTA 4FM1A 1B04A 3JALA 4XTVA 3UFGA 1WLEA 4I4TA 2R72A 2XGTA 3JAKA 4K86A 5LP6C 2AMCB 1NJ2A 3LNNA 3P8YA 4JI2B 5ITZA 1TA8A 3HKEB 4X66B 1M4UA 2DEQA 3HKDA 3CMQA 3RGLA 3P8VA 4X5OA 3JAWB 3QO7A 4LFBB 2JVDA 4CS4A 5LXTB 4XTZA 4DR6B 3E22A 2PYJA 1ASYA 3UT5B 4JI0B 3FJPA 5F5WA 1FFXB 4FLTA 1YFRA 3HFZA 4P72A 4UCRA 4CH5A 1ATIA 4CC5A 4X65B 1TVKA 4DUYB 4X20A 3UGQA 1HXDA 4Q15A 3VBBA 2RHQB 3M4PA 4XU0A 4FFBB 4P71A 1RIQA 4TVAA 4X1KA 1Q5OA 1HC7A 3K5LA 2UUCB 5J2UA 5BR8B 5ELNA 3T1HB 5D5PA 2I4LA 3RGBA 5LMNB 1SQFA 4K8XA 4E51A 1N36B 5CA1A 3NEMA 2ALYA 4H2UA 4KQEA 4PI0A 4G84A 3RYHB 3SJCC 3DSQA 1WPBA 4DV2B 2ARTA 5D5QA 2DXUA 4NCXA 4UP9A 4J15A 4O2AA 5FNVB 2P5OA 4HT4A 4LH7A 5J2TA 1WU7A 4U3JB 4FLYA 2I4MA 1WQWA 2XTIA 1HNWB 4YRNA 4B08A 2CJAA 4FVMA 3MF1A 3K5MA 3HFVA 4P74C 3HTZA 4YRJA 5LMUB 5LYJA 5KHJA 4NXNB 3N2GA 1XMQB 1IBLB 2HNIA 4X1YA 3BA8A 3VQYA 3U11A 4OLFA 4IIJB 1G5HA 1P49A 4X62B 3RUXA 1YFSA 4PHCA 4XU3A 2OWOA 4DV0B 4F6RA 3IAYA 1EVKA 3LSSA 3HKCA 1WPYA 5C53B 4H2TA 4LVMA 4TUYB 4GKJB 1TAEA 3RYFB 4DR4B 5KHGA 3A7RA 4UPAA 5KNNA 3SJBC 1TUBB 1KMNA 5IWAB 3IKMB 4DPGA 2DTHA 1HNZB 4TQDA 3PCOA 3SJAC 5E3IA 4WF2A 3CB2A 2PYLA 4WBNA 4X1IB 4HBNA 3QO8A 4RMFA 1Q3EA 1XHZA 2YI8A 1ADYA 3ZEDA 4AH6A 4YY3B 4YJ2A 4O2DA 4IHJA 4YP0A 3HRKA 4JI3B 2ZM6B 5JJEB 2DDZA 4YROA 1KU9A 3BABA 4G85A 2G4CA 4K87A 3JASA 1W66A 5CB4A 4LF9B 1H4TA 4P72C 3U10A 4YRSA 1FYFA 4LVLA 4HVCA 4GLXA 1GGMA 3JARA 4DR3B 2E41A 1SA0A 2ZR2A 1KOGA 4AQYB 3RYCA 5JCOA 3HY1A 1IBMB 2PGGA 3EFSA 4P71C 4O4JA 4ZI7B 1USYA 4YJ3A 2E3CA 4DR5B 4KL1A 2EWNA 11ASA 1X2GA 5IYZA 1H4QA 2ZT7A 1L0WA 2EX3A 5IJ0B 3K5NA 4XTYA 2JS5A 3WB0A 3K58A 4P3NA 1JFFB 1WQ7A 3REXA 5EZYB 3BHPA 4H2VA 3BAAA 1XI1A 4ZHQA 4DR2B 1BIAA 1EIYB 5IJ9A 5C52B 4YRLA 2ARSA 1WN7A 3HY0A 2DQ0A 4YDQA 5KX5A 4I50A 2AKWA 2ZT6A 1X4TA 5EYPB 2DZ9A 4DQ2A 1X54A 4FM2A 1B7YA 4TV9A 1HR0B 4HWRA 4Q6GA 3MQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMF A;  4UP8 A;  1O9G A;  3NEN A;  3HXW A;  2IY5 A;  2E5A A;  2E65 A;  4CH3 A;  1Z7M A;  3L4G B;  1E24 A;  4XU1 A;  2ODR D;  4WJ3 M;  2DU7 A;  4P73 A;  2RHS B;  4RQE A;  1SER A;  2EJG A;  3RKW A;  1WYD A;  3M4Q A;  2ZCE A;  1H4V B;  1X2H A;  1PYS B;  1EVL A;  2AMC A;  5K1X A;  4CH6 A;  4UP7 A;  2ZNJ A;  4ZIB A;  2RJZ A;  4YCU A;  3REU A;  3HXY A;  1VQZ A;  1X56 A;  2DTO A;  1B70 B;  3I7F A;  2RHQ A;  3QNE A;  4YRC A;  2ARU A;  3L1A A;  3G1Z A;  4YRK A;  1H4S A;  3IG2 A;  3A5Y A;  3W3S A;  1USY C;  3E9I A;  3PZC A;  3V8L A;  3IKL A;  4YYE A;  2ZTG A;  3OD1 A;  5ELO A;  4H2X A;  2DXT A;  1ASZ A;  4YCV A;  3V7S A;  2CGH A;  3A74 A;  2E64 A;  3BFM A;  4H2Y A;  4RQF A;  4RDX A;  1NYR A;  4XEO A;  4HA8 A;  2P0L A;  4KR2 A;  2EAY A;  4K88 A;  4HWS A;  2DZC A;  2DKG A;  1X55 A;  3VQW A;  1SRY A;  2QHV A;  3PCO B;  1YB3 A;  4L87 A;  4XTW A;  3A31 A;  2C8M A;  1KMM A;  1E1O A;  4P73 C;  4ZTU B;  2Q5I A;  4P75 A;  3V7C A;  1EFW A;  2RQ6 A;  3V8K A;  3HXU A;  4XEM A;  2Q7E A;  2YIA A;  3ICA A;  2ODR C;  4YRG A;  3E9H A;  3ERR A;  3LC0 A;  4CS3 A;  1YGB A;  4TTV A;  3TEH B;  3A32 A;  4P3P A;  3TEG A;  2Q7H A;  3WQZ A;  2YI9 A;  4P3O A;  4YRT A;  3V8J A;  3R07 A;  1QE0 A;  3NEL A;  2EJF A;  2ZGW A;  2ZIM A;  2AKW B;  2ZZF A;  2YIB D;  2ZNI A;  1JJC B;  2DTI A;  3BJU A;  4YCW A;  1EIY A;  2P5I A;  1LYL A;  4HWO A;  2ZT8 A;  4YRI A;  1NJ6 A;  1NJ1 A;  1B8A A;  2PME A;  1G51 A;  2ZZG A;  1HTT A;  2J3L A;  1ADJ A;  2YIB A;  4TQF A;  3HXZ A;  3HFZ B;  3L4G A;  2E10 A;  4EO4 A;  2CJB A;  2DU5 A;  2ZXF A;  4TVW A;  4XU2 A;  2DJZ A;  1NYQ A;  3HXV A;  2RHS A;  3TUP A;  2CJ9 A;  4BW9 A;  4CS2 A;  4TVA B;  3A7A A;  1X01 A;  3MF2 A;  1EQR A;  3L2Z A;  1PYS A;  2DQ3 A;  1IL2 A;  12AS A;  3VQX A;  4P75 C;  4YRQ A;  2ALY B;  3UGT A;  3RKX A;  4YRF A;  4EX5 A;  3MEY A;  4XTU A;  1NNH A;  2DVE A;  1BIB A;  3RIR A;  1SET A;  4YRP A;  1B70 A;  4OP0 A;  4CH4 A;  2ZIO A;  4ZTZ B;  4H2X B;  2ZR3 A;  4WJ4 A;  1J5W A;  1B76 A;  2CIM A;  3IAL A;  2J3M A;  4HWP A;  2I4N A;  4KR3 A;  1O9H A;  3LSQ A;  1E22 A;  1NJ8 A;  2HEP A;  3A7U A;  4H2S A;  3RL6 A;  4TVY A;  2QJ1 A;  2ZZE A;  1EOV A;  4YRR A;  4XTX A;  1BBU A;  1G5I A;  4BWA A;  3EFR A;  3HXX A;  3P8T A;  2ZIN A;  3UH0 A;  2R70 A;  3VQV A;  2C7I A;  4H2W A;  5K1P A;  4WI1 A;  2EJ9 A;  4YPF A;  1BBW A;  3RKY A;  4H02 A;  1C0A A;  1Z7N A;  4PG3 A;  5C51 B;  2PUS A;  3HRI A;  3V7R A;  3KFU A;  1QF6 A;  1N9W A;  1WNL A;  3QTC A;  2FYK A;  2ZT5 A;  2Q5H A;  3NET A;  4TWA A;  1G6U A;  4LNS A;  3TEH A;  2Q7G A;  2QHS A;  4P74 A;  4YRM A;  1NJ5 A;  2I4O A;  1B7Y B;  3RF1 A;  1SES A;  1E1T A;  2E1H A;  2IY5 B;  5HGQ A;  2QHU A;  2EL9 A;  4HWT A;  3A5Z A;  1JJC A;  3RAC A;  4YRE A;  2QHT A;  1YFT A;  4XTV A;  3UFG A;  1WLE A;  2R72 A;  2XGT A;  4K86 A;  2AMC B;  1NJ2 A;  3P8Y A;  2DEQ A;  3CMQ A;  3RGL A;  3P8V A;  4X5O A;  3QO7 A;  2JVD A;  4CS4 A;  4XTZ A;  1ASY A;  3FJP A;  1B7Y A;  5F5W A;  1YFR A;  3HFZ A;  4P72 A;  4CH5 A;  1ATI A;  3UGQ A;  1HXD A;  4Q15 A;  3VBB A;  2RHQ B;  3M4P A;  4XU0 A;  4P71 A;  1RIQ A;  4TVA A;  1HC7 A;  5ELN A;  2I4L A;  4E51 A;  4H2U A;  3NEM A;  2ALY A;  4KQE A;  4G84 A;  3DSQ A;  2ART A;  2DXU A;  4UP9 A;  4NCX A;  4J15 A;  1WU7 A;  2I4M A;  1WQW A;  2XTI A;  4YRN A;  2CJA A;  3MF1 A;  3HFV A;  4P74 C;  3HTZ A;  4YRJ A;  2HNI A;  4OLF A;  3VQY A;  1G5H A;  3RUX A;  1YFS A;  4PHC A;  4XU3 A;  1EVK A;  3LSS A;  5C53 B;  1WPY A;  4H2T A;  3A7R A;  4UPA A;  5KNN A;  1KMN A;  3IKM B;  4DPG A;  2DTH A;  4TQD A;  3PCO A;  5E3I A;  4WF2 A;  3QO8 A;  4RMF A;  2YI8 A;  1ADY A;  3ZED A;  4AH6 A;  4O2D A;  4YP0 A;  3HRK A;  2DDZ A;  4YRO A;  4G85 A;  2G4C A;  4K87 A;  1W66 A;  1H4T A;  4P72 C;  4YRS A;  1FYF A;  4HVC A;  1GGM A;  2E41 A;  2ZR2 A;  1KOG A;  3HY1 A;  2PGG A;  3EFS A;  4P71 C;  1USY A;  2E3C A;  2EWN A;  11AS A;  1X2G A;  1H4Q A;  2ZT7 A;  1L0W A;  4XTY A;  4P3N A;  1WQ7 A;  3REX A;  3BHP A;  4H2V A;  1BIA A;  1EIY B;  5C52 B;  4YRL A;  2ARS A;  3HY0 A;  4YDQ A;  2DQ0 A;  2AKW A;  2ZT6 A;  2DZ9 A;  4DQ2 A;  1X54 A;  3QO5 A;  4HWR A;  4Q6G A; 
#chains in the Genus database with same CATH topology
 4LFC O;  5IDJ A;  1ZAU A;  3NEN A;  2IY5 A;  1AP5 A;  2DYR C;  3OR6 C;  2H3O A;  1Z7M A;  4LC1 A;  1NS1 A;  2XAQ A;  5H6R A;  3K59 A;  1YJW V;  3CCQ V;  4O4L A;  2DW4 A;  2D2C B;  2RDC A;  4P73 A;  1J5E B;  2F4V O;  2EBO A;  1FJG O;  1QU7 A;  2ZCE A;  4HNA A;  1DF5 A;  1BQZ A;  4UVA A;  1PYS B;  2AMC A;  2WLJ A;  1Y74 A;  5K1X A;  1WPX A;  1VF6 A;  4FZ0 A;  4DR1 B;  1GN2 A;  3C90 A;  2P06 A;  3AK1 A;  3JAT B;  1QLE C;  1XNR O;  1I08 A;  1YF2 A;  3CC2 V;  5B1A C;  4YCU A;  1OJH A;  4QGP A;  3B2E E;  3CCM V;  3ZRW A;  1B70 B;  3LDD A;  5LHI A;  4GCZ A;  5CA1 B;  3E86 A;  4YRC A;  3KZI Z;  4JGS A;  3BRC A;  3N27 A;  2LGQ A;  3L73 H;  1S5J A;  4MVS A;  2W6J G;  4B3R O;  4DV1 B;  3SPG A;  3V8L A;  1FXK B;  4PDL A;  5ELO A;  4W4L A;  1Q6I A;  1ORQ C;  3AG3 B;  4YCV A;  4H37 A;  2LW1 A;  2HVK C;  4U3J A;  2E64 A;  4PDM A;  1KMI Z;  3BFM A;  4RQF A;  4LF8 B;  1ZWI C;  3IJ4 A;  1QHT A;  1VEW A;  4FLW A;  1YSC A;  4FLV A;  4TWK A;  1OCO C;  4R50 A;  4K88 A;  4QPK A;  2PI5 A;  2UXX A;  3WB2 A;  1G1X B;  3SYC A;  1TUE B;  2JEU A;  4JF3 A;  1SRY A;  2OTJ V;  2UU9 B;  1WNS A;  4P9P A;  3BEH A;  3ASN B;  4ZOL B;  2OCC B;  1AI5 A;  1W59 A;  3L71 H;  4I55 B;  1KMM A;  3RW0 A;  4I0X A;  1ZUQ A;  1FFT B;  3HB3 B;  3N2K B;  4TV8 B;  4KHP O;  2V7Q G;  4ZTU B;  3QVN A;  2KSD A;  2Q5I A;  1AJP A;  4P75 A;  1FAF A;  3SDL A;  1GMG A;  4JV5 B;  4UCO A;  4IGG A;  3ZS8 C;  1LUW A;  2ODR C;  4JI4 B;  1YEW A;  3U0Z A;  1WAZ A;  3LC0 A;  3TEH B;  4OPH A;  3HKB B;  1JMK C;  1Y76 A;  2NN4 A;  4JAU A;  2JJ2 G;  2YI9 A;  5EIB C;  2E76 B;  1K8A W;  3UO3 A;  3QF7 A;  3R07 A;  1YVW A;  5IJ9 B;  1OCZ B;  1M9N A;  5IJ0 A;  4GX2 A;  2YIB D;  4UFZ A;  2ZNI A;  2HR3 A;  5EZY A;  2Q67 A;  4MVM A;  2DTI A;  3B40 A;  4J7J A;  3BJU A;  4NTY A;  4YCW A;  2P5I A;  4YRI A;  4LNU B;  1KBH A;  1NJ6 A;  3ZX6 A;  3AG1 B;  1D5A A;  1NJ1 A;  5BR8 O;  5EYP A;  1THZ A;  2CAZ C;  3PN1 A;  3H1H H;  1SQG A;  1N36 O;  3ABT A;  3A0H Z;  1XBL A;  4O4L B;  3ETQ A;  3L4G A;  3J80 N;  2E10 A;  4EO4 A;  1K73 W;  2CJB A;  2DU5 A;  2CDY A;  4P2Z A;  4HNA B;  4QJF B;  4JI1 B;  1BZK A;  2QWO B;  4O2B A;  4NXN O;  3ABK B;  2O57 A;  1HP8 A;  1NYQ A;  2DJZ A;  2RHS A;  2CJ9 A;  1BSM A;  1H8E G;  4BW9 A;  1V54 C;  4X62 O;  2XAH A;  2YSU B;  3BA9 A;  1BHB A;  3S3W A;  1JCH A;  4C7U A;  1DLB A;  4LFC B;  4FFB A;  3RKX A;  1QR8 A;  4EX5 A;  3MEY A;  4IT5 A;  4DRX A;  4NTW A;  2Q8V A;  3K57 A;  1L8D A;  4OP0 A;  4HZ3 A;  2F4V B;  2D3O W;  3OTO B;  1J5W A;  4X1Y B;  4B3T B;  2ZM6 O;  4H33 A;  1B76 A;  1XIL A;  1TGO A;  3IAL A;  4AI8 A;  4LF9 O;  3ZRV A;  1H2G A;  2CTR A;  4JZ2 A;  3K06 A;  1E22 A;  3A7U A;  4DR3 O;  3TCU A;  1XRE A;  3FFQ A;  2CH7 A;  4AQY O;  4OPA A;  1XNR B;  3RL6 A;  4WFE A;  1KB9 F;  5FLX N;  2ZDI A;  3K0D A;  1LNQ A;  3D36 C;  1NR1 A;  2QJ1 A;  5B1B B;  3F5W C;  1YIJ V;  1DGS A;  1BBU A;  1CP9 A;  3RN4 A;  2IH3 C;  2EIN C;  3HXX A;  4PHZ A;  4I0X B;  2C7I A;  4JI8 O;  4H44 B;  4LF5 O;  2HJD A;  4G2K A;  4B3R B;  4YPF A;  4JI7 O;  1AR4 A;  1K5Q A;  3JAR B;  3OMI B;  1VF6 C;  4H02 A;  1MOF A;  2NR5 A;  3RYC B;  4BIO A;  4JYB A;  2UXC B;  2UUA O;  3KFU A;  1SKV A;  4YJ3 B;  5H9C A;  5C8Y A;  1V55 B;  2A7W A;  4JI2 O;  2LFR A;  3F7V C;  4QE7 A;  5GON A;  3QTC A;  3SJQ C;  3ETE A;  3FYI B;  4X66 O;  2FYK A;  2QM4 A;  4R6Z A;  2W0F C;  4LFB O;  2FL4 A;  4DR6 O;  4K8Z A;  1BE3 H;  4GZR B;  2IU0 A;  4NB5 A;  2VQF O;  1VQ8 V;  1V9P A;  4LNS A;  4JPR A;  4DUY O;  5L3B A;  4TV9 B;  4DV5 O;  1Q8I A;  2WSS G;  3C3T A;  1U97 A;  4GYC B;  1NR7 A;  1OCC B;  2E1H A;  1ZSP A;  4KHP B;  5B3S B;  3ZRS A;  4DV4 O;  4PA7 A;  1EM1 A;  5CA0 B;  4JAV A;  4PI2 A;  3OFN G;  4DV2 O;  1KUQ A;  4J7Z A;  1BHA A;  1JJO A;  1WJZ A;  1YCI A;  1XNQ O;  4OX9 B;  4XTV A;  5IT9 N;  1B04 A;  5DED A;  1DTO A;  4X64 O;  3L9D A;  5L3F A;  5LP6 C;  4X88 A;  1NJ2 A;  4FZ1 A;  1TA8 A;  2EIM B;  2ILM A;  3ZHQ A;  3P8V A;  1WA8 B;  4DO2 A;  4XTZ A;  4CS4 A;  1N32 O;  3FJP A;  5F5W A;  1FFX B;  4FLT A;  4P72 A;  4CC5 A;  4X65 B;  1VQ4 V;  1TVK A;  2XAS A;  3UGQ A;  2WPD G;  1HXD A;  4Q15 A;  3VBB A;  2RHQ B;  4FFB B;  5H6Q A;  1XMO O;  4P71 A;  2Q4P A;  1LUV A;  5J2U A;  5BR8 B;  1EN6 A;  2I4L A;  2FKX A;  1N36 B;  3RYH B;  4CBC A;  3DSQ A;  4BIZ A;  4JAA A;  2BOB C;  1OCR B;  2ART A;  4CZZ A;  1EBO A;  4A5U B;  5J2T A;  4MS2 A;  1YDX A;  2I4M A;  1HNW B;  3BFR A;  3K5M A;  5LYJ A;  4NXN B;  3N2G A;  4X89 A;  1IBM O;  2R9I A;  3VQY A;  2OIE A;  2QSA A;  2ITD C;  1G5H A;  4X62 B;  3RUX A;  3FD9 A;  1YHQ V;  1GRJ A;  5KAI Z;  1JOY A;  1AJN A;  1G4Y B;  5KA5 A;  5C53 B;  3STZ C;  3SYA A;  3ABM B;  4TUY B;  2QWQ B;  4DR4 B;  3AG4 C;  1K34 A;  3SJB C;  3X2Q B;  2DTH A;  4TQD A;  3PCO A;  4I7Z B;  3CB2 A;  2GHY A;  4B7E A;  4X1I B;  2EIL C;  1L0N H;  4RUF A;  1GN3 A;  2IJK A;  1Q3E A;  3ASO C;  2YXH A;  5EBW C;  2P90 A;  1XL6 A;  4YJ2 A;  4O2D A;  1E1R G;  2Q6A A;  1P7G A;  4YP0 A;  4WFH A;  3HRK A;  4H0L B;  2ZM6 B;  4YRO A;  3ZMS A;  2ZE7 A;  5CB4 A;  4LF9 B;  2DWD C;  2EIK B;  3JD0 A;  4DR3 B;  5AG2 A;  1R6K A;  3WG7 B;  1SA0 A;  1L0L H;  1NTM H;  4AQY B;  4OGQ B;  5HFM A;  3HY1 A;  1UPG A;  2PGG A;  3EFS A;  3G71 V;  5CN0 A;  3CCL V;  3ZMT A;  2E3C A;  4DR5 B;  5IYZ A;  4LCU C;  2ZT7 A;  1L0W A;  1B6Q A;  2CTW A;  4XTY A;  4MSW C;  4P3N A;  1WQ7 A;  4DR1 O;  3ABL C;  3L70 H;  2QKA A;  5C52 B;  1B3Q A;  2DQ0 A;  2IU3 A;  3GVM A;  5KX5 A;  4I50 A;  2P67 A;  5EC2 C;  2AKW A;  1X4T A;  1NH2 B;  1X54 A;  4YRM A;  4LVI A;  4E4E A;  4IHJ A;  4Q6G A;  4DR7 B;  2GUZ B;  4UP8 A;  4PDV A;  3HXW A;  4UCS A;  2UUA B;  4FLZ A;  4WCE V;  1RSO A;  4CH3 A;  4J7K A;  1Z5W A;  5JQG A;  4FM0 A;  1E24 A;  1VMG A;  4WFB V;  1Q90 D;  2WLM A;  2DU7 A;  4TT3 G;  4PA9 A;  1XOU A;  5DN6 G;  2GTS A;  2VQF B;  1X2H A;  1PL0 A;  4DV5 B;  4CH6 A;  3CC4 V;  2G38 A;  1OZ0 A;  1PV0 A;  2BTQ B;  2Z0A A;  3P3P A;  1RM1 B;  4OXS A;  5JJN B;  1S72 V;  2UXB O;  4DV4 B;  2F95 B;  5KA6 A;  2L35 A;  3CD6 V;  3REU A;  1HDJ A;  1K3E A;  1X56 A;  2ARH A;  4FJC C;  3JAM N;  3UO2 A;  1R3K C;  3QNE A;  1VQ6 V;  3L1A A;  1XNQ B;  2N74 A;  3FYE B;  3A5Y A;  4X64 B;  2XHB A;  1USY C;  1MSD A;  1M56 C;  3CMA V;  4DUZ O;  3JCZ A;  2ZTG A;  4BR6 A;  3LSU A;  3FAV A;  5LYJ B;  1FYJ A;  4PD4 F;  1N32 B;  2CGH A;  3A74 A;  3W7U A;  2DYR B;  2ZE5 A;  4CC6 A;  4K3A A;  1S0V A;  1NYR A;  3DGE A;  1E79 G;  3GWO A;  2P0L A;  3OEE G;  2YEV B;  4FK5 C;  2EAY A;  4YXW G;  2AZ2 A;  1PNM A;  1XMO B;  1I5X A;  3D3I A;  5GW7 A;  1VQ5 V;  2DKG A;  4IIJ A;  4J41 A;  4R8C A;  3GB7 C;  3VQW A;  1VF5 B;  3PCO B;  4P9O A;  4FFK A;  3FX7 A;  4LF7 O;  2GV9 A;  1Q82 W;  5E1A C;  3RYF A;  2QA4 V;  3CYO A;  2X7R B;  2C8M A;  2OT5 A;  1E1O A;  1SF9 A;  2XUM A;  1ZL8 B;  3W7X A;  5B1A B;  4DK0 A;  3V7C A;  4ZKI A;  1EFW A;  3HXU A;  5KAF Z;  1S3J A;  2YID A;  1SA0 B;  2Q7E A;  4XEM A;  3H9V A;  1G8M A;  4UCV A;  2OYQ A;  2YIA A;  4EB6 B;  3UKM A;  2Q0O C;  2LW7 A;  1NVP D;  3E9H A;  4YRG A;  1YGB A;  3CC7 V;  1DK1 A;  2EIJ C;  1RFY A;  2JRI A;  3V8J A;  1Q7Y W;  5CBG A;  3H1L H;  2Q68 A;  4YIO A;  3M99 B;  2ZD9 A;  2JIZ G;  2AKW B;  5EC1 C;  1JJC B;  1SC5 B;  1L1F A;  4IHJ B;  5IY5 C;  2NLJ C;  4XDJ A;  1MG1 A;  4O4H B;  5LGN A;  4HWO A;  1FD9 A;  3D36 A;  3IFX A;  4J9Z B;  4I4T B;  2UUC O;  2Z3Y A;  2P22 C;  3JAK B;  1KC8 W;  5JQG B;  5LHG A;  1EZV H;  4QIW F;  1N34 B;  2PME A;  1AI4 A;  3OTO O;  3CCE V;  4B3T O;  2DYS C;  1HTT A;  1ADJ A;  2WLL B;  1N0J A;  3HFZ B;  4BW5 A;  2PI4 A;  2PTM A;  3HKE A;  5E79 Z;  4TVW A;  4XU2 A;  4O4I A;  5JH7 A;  4JAS A;  4X1K B;  3A7A A;  2KG7 A;  2DQ3 A;  4DV0 O;  1M57 C;  2UUB B;  3RFR A;  1ROP A;  2ALY B;  5LOV A;  2EJR A;  3E89 A;  4O2A B;  3EHB B;  4XTU A;  2CK3 G;  1GM8 A;  3ZHS A;  2VS0 A;  3OGI B;  4X8A A;  3OUS A;  3DTU B;  2DVE A;  3E8F A;  3CCU V;  1BIB A;  4YRP A;  2IJH A;  3CS5 A;  5LL6 Y;  3LDC A;  2AGA A;  4XDK A;  1LR1 A;  1RP3 B;  1FXH A;  2UXC O;  4LVK A;  2CIM A;  1GKF A;  4D6T H;  3Q4H A;  2I4N A;  4HWP A;  3LSQ A;  4F6R B;  3KCX A;  2QKS A;  4YIP A;  2QTS A;  4LP8 A;  2Y4T A;  4H2S A;  1QNM A;  1GO3 F;  2UXB B;  1H2S B;  1BMF G;  4TVY A;  5LP6 A;  2ZZE A;  2X6A A;  3H1K H;  4KFM A;  4W4K A;  2HLD G;  2Y0P A;  3G6B A;  3P8T A;  3EXA A;  1KD1 W;  2ZIN A;  3CE2 A;  4WI1 A;  3KG2 A;  1W2B U;  3A2F A;  1V54 B;  5KMG A;  4DUZ B;  3ML0 A;  1PP9 H;  1BBW A;  2PF4 E;  5L3E A;  2IBZ H;  1C0A A;  4OX9 O;  2JDI G;  4Q20 A;  1HWY A;  3G80 A;  5C51 B;  1IXB A;  1GTO A;  3AEI A;  2F43 G;  4J10 A;  5EK0 A;  5CBH A;  1Q6U A;  3H01 A;  3K9S A;  5J9P C;  2ZT5 A;  4MVR A;  4U3F H;  2Q5H A;  3NET A;  4TWA A;  2GBO A;  1G6U A;  3OR7 C;  3LNM B;  4X65 O;  3L75 H;  3D8C A;  4LF7 B;  2A8E A;  1F7Y A;  3RF1 A;  1B7Y B;  2HVJ C;  1SES A;  1E1T A;  3ZHU A;  5LGU A;  4QE9 A;  2EZP A;  2IY5 B;  2WLK A;  4B3M O;  2QHU A;  2EL9 A;  3UQ8 A;  4HWT A;  1OV9 A;  1Q43 A;  3CJH A;  4MW3 A;  1FXK C;  3ZHT A;  3EFF K;  2EZO A;  4YRE A;  3AG3 C;  4AIL C;  4FM1 A;  3JAL A;  1WLE A;  1HNW O;  2R72 A;  4RWU A;  4UUJ C;  2XGT A;  2AMC B;  3P8Y A;  2FML A;  1Y74 B;  3HKE B;  3ZHR A;  3HKD A;  4DW1 A;  3CMQ A;  3RGL A;  2A79 B;  1BCC H;  2FTK A;  3QO7 A;  2JVD A;  2Y0I A;  1ASY A;  1A32 A;  2VRZ A;  3E22 A;  4ABM A;  3E2E A;  4CH5 A;  1ATI A;  3ABU A;  3ZRW B;  3ASN C;  4X20 A;  2OCC C;  4DR4 O;  1N33 O;  2YIC A;  4LFA O;  4XU0 A;  4TVA A;  1GM7 A;  2EJ7 A;  2UUC B;  4MTO A;  4H2U A;  3NEM A;  3SJC C;  2JS3 A;  1Y67 A;  4U3J B;  1WQW A;  4YRN A;  3MF1 A;  2RN9 A;  2Y4U A;  2M6Y A;  4ASU G;  1IBL B;  4MTG A;  2GTA A;  1SQP H;  1K5S A;  4DR5 O;  4PHC A;  4XU3 A;  2OWO A;  1OCZ C;  5DEC A;  3RVZ A;  4DV0 B;  1MMM A;  2UXD O;  3HKC A;  1WPY A;  4LVM A;  2XTA A;  3STL C;  1TAE A;  5IWA B;  5HFL A;  2RMK B;  3K3W A;  3MDS A;  3CXH F;  4WBN A;  3QO8 A;  2DJV A;  1U96 A;  1ZTE A;  5LGT A;  4DR7 O;  1ADY A;  3ZED A;  3IC7 A;  3ZN0 A;  4I9W A;  3NR7 A;  2R9R B;  3B77 A;  5JJE B;  1KU9 A;  3BAB A;  2CTQ A;  4JYC A;  3APQ A;  2P4K A;  1H4T A;  4NR1 A;  4F6E A;  4YHH O;  4LF4 O;  4F4L A;  5GTH Z;  1YXB A;  1Y76 B;  1KOG A;  2DOS A;  2IW5 A;  1AB3 A;  3ZIA G;  2LJ2 A;  1N0N A;  2B1G A;  4O4J A;  1USY A;  2N05 A;  2BSK A;  1ZLZ A;  1X2G A;  1F4M A;  1JA8 A;  5IJ0 B;  4WFA V;  1VP7 A;  3E8G A;  3WB0 A;  3OE7 G;  5EZY B;  3OW2 U;  1YTF B;  4H2V A;  3BAA A;  4I5S A;  4ZHQ A;  1ZX3 A;  4WFF A;  1KP3 A;  2B1I A;  2ARS A;  3DXR A;  2ZT6 A;  1F51 A;  3JYC A;  5EYP B;  4FM2 A;  3QO5 A;  3LDE A;  1IUR A;  1XUQ A;  4N21 A;  3C3S A;  2WA3 A;  4NTX A;  2E5A A;  3T1Y O;  5JVD A;  4JI6 O;  3L4G B;  1M1K W;  4J11 A;  5H5N A;  4EFE A;  1E1Q G;  2GSM B;  4J9Y B;  2XAF A;  4XDL A;  3AG2 B;  4O2B B;  5B5E Z;  2Y69 C;  2Q69 A;  2RHS B;  2LO1 A;  1SER A;  2EJG A;  1AI6 A;  3A8T A;  3RKW A;  3M4Q A;  1EFR G;  1EVL A;  1VQN V;  4UP7 A;  1PL4 A;  2VWK A;  2HFE C;  5LXT A;  1YIT V;  2OIG A;  3UT5 A;  4B3M B;  2RJZ A;  1WB8 A;  4GKK O;  4NVP A;  4JZG A;  4DRX B;  3OMA B;  3HXY A;  5BY1 A;  1NU1 H;  2OTL V;  3CSX A;  3I7F A;  4BAY A;  1S76 D;  1SZX A;  3IGA C;  5JJJ B;  1H4S A;  5JCO C;  1YJN V;  3IG2 A;  2KB1 A;  1K9M W;  1R3L C;  2VQE O;  3K5O A;  1V55 C;  3PZC A;  1YI2 V;  5A2Q N;  1D5N A;  4H2X A;  4NKG B;  2CH7 B;  4P30 A;  3V7S A;  1ASZ A;  3ETD A;  1JQ0 A;  5H2F Z;  2R9A A;  4H2Y A;  4UVB A;  3ZHV A;  1N33 B;  2MW2 B;  2V1D A;  4LFA B;  2MK3 A;  3NXS A;  1OCC C;  4EFB A;  1X55 A;  4N23 A;  1BQ0 A;  1QR9 A;  3J81 N;  5B3S C;  3FKS G;  4L87 A;  3SPH A;  4B3S O;  2AHZ A;  1IBK O;  3A31 A;  1XDC A;  2JGD A;  3MHH C;  1NT2 B;  3OT7 A;  4JI5 B;  3WFV A;  2ATK C;  5C8Y B;  4HAM A;  3JD3 A;  1T5E A;  2RQ6 A;  5GON B;  4FLU A;  1N34 O;  2EIM C;  1NZ6 A;  1GAX A;  3RYI A;  2LGW A;  2UXD B;  4LWS A;  3ERR A;  3S3X A;  4CS3 A;  3T4Z A;  1M56 B;  3A32 A;  3OUF A;  3TEG A;  5LA6 A;  1WB7 A;  3WQZ A;  1QBZ A;  4YRT A;  2QM8 A;  4PDR A;  1SQV H;  4ZI7 A;  3NEL A;  1QQC A;  1FXV A;  1K4D C;  2JGU A;  2UUB O;  1SQX H;  2ZIM A;  1VQL V;  2ZZF A;  3ZMU A;  2RNB A;  5KUK A;  1OCR C;  5LHH A;  1EIY A;  2ZT8 A;  3ZCC A;  2GDS A;  4UB6 Z;  5KLV H;  4YHH B;  4LF4 B;  3ZMV A;  4G27 B;  1B8A A;  3RT3 C;  5B1O A;  4ICG A;  3SPI A;  5IE9 A;  4UCT A;  3W7T A;  1WP8 A;  2YIB A;  4MVQ A;  1QVG U;  1TVK B;  3JCU Z;  1IX9 A;  2E74 B;  1B06 A;  4BIU A;  3W7S A;  3ABM C;  3JAW A;  3IC9 A;  3HXV A;  3TUP A;  5EBL C;  1M90 W;  5KHI A;  1OHH G;  1X01 A;  1NTK H;  3L2Z A;  4D7T A;  5J2U B;  1PYS A;  1EZJ A;  2BOC C;  1IL2 A;  1NKD A;  3LUT B;  3RWR D;  4GKJ O;  3JAT A;  2EIJ B;  3CRM A;  3T1Y B;  2V4D A;  1PNL A;  5J2T B;  1HNZ O;  4JI6 B;  1PM9 A;  2H8P C;  3SGI A;  4GT1 A;  3RIR A;  3BCC H;  1H2M A;  2K9P A;  3T4D A;  1B70 A;  4CH4 A;  2ZIO A;  3N2G B;  2PZS A;  3WG7 C;  1H38 A;  3O9O A;  4ZTZ B;  2ZT9 B;  4H2X B;  3TXQ A;  2ZR3 A;  4WJ4 A;  4JI3 O;  2QM7 A;  3HPL C;  1IVS A;  4KR3 A;  2OCH A;  1BGY H;  1FXK A;  3GWK C;  4K0K B;  3E35 A;  2M7W A;  3P32 A;  5JWP A;  4AHC A;  4GKK B;  2DYS B;  3O65 A;  3A0R A;  4PEL A;  2KKW A;  4H13 B;  1Q6H A;  1EOV A;  4YRR A;  4XTX A;  2XT9 A;  1KYO F;  1G5I A;  4BWA A;  3I55 V;  3EFR A;  4YJ2 B;  1EN4 A;  1QLE B;  3VQV A;  4DR2 O;  2IJJ A;  4GX0 A;  2VQE B;  5CB4 B;  3BPZ A;  4ZOL A;  3BVO A;  3MHS C;  3J7A U;  1JVM A;  4I55 A;  1HR0 O;  3THO A;  3OGC C;  1CEZ A;  1I94 B;  1Z7N A;  4PG3 A;  4IYI A;  4DV6 O;  3N2K A;  3HRI A;  3CCJ V;  4GUN A;  4TV8 A;  2P7T C;  3JSL A;  5IYZ B;  3RYI B;  4QPJ A;  4LWS B;  4MT8 A;  4MW8 A;  3H1I H;  1NH2 D;  5LA6 B;  3CP1 A;  1NI8 A;  4FMT A;  1RM1 C;  3CCS V;  3QG5 A;  1J95 A;  5KX5 B;  2HG5 C;  4I50 B;  5EBM C;  4NXM B;  3E8B A;  3TEH A;  1VIB A;  3HKB A;  3OD4 A;  4B3S B;  2QHS A;  2WLN A;  1IBK B;  1OCO B;  1Z5V A;  3TET A;  5A9G A;  2Q0A A;  1K4C C;  1R6T A;  2B9Z A;  3CX5 F;  5HGQ A;  1H2K A;  4DV3 O;  1MA1 A;  1RSO B;  3PJS K;  2CGO A;  3A5Z A;  1IXM A;  3P30 A;  3APO A;  1MZF A;  2BTO A;  1US6 A;  3RAC A;  1KEC A;  4LNU A;  1YFT A;  2E75 B;  2CUG A;  1KKD A;  1S5L Z;  1R73 A;  3FB5 C;  4K86 A;  1AR1 B;  4K35 A;  3LNN A;  3BY6 A;  5ITZ A;  1MSW D;  1K92 A;  2WLI A;  3OM3 B;  4WFG A;  2DEQ A;  1IBL O;  1K33 A;  3JAW B;  2QKC A;  1I5Y A;  1URF A;  2E5L O;  3ZMZ A;  4UXN A;  1R3J C;  1NTZ H;  1VQM V;  1PKX A;  4KP4 A;  4MVU A;  2YDE A;  5IWA O;  1ENV A;  1RIQ A;  1HC7 A;  5ELN A;  1XL4 A;  1SS3 A;  5D5P A;  3RGB A;  2QR4 A;  4K8X A;  3FAV B;  4PI0 A;  4UB8 Z;  2Q5Z A;  2DXU A;  5D5Q A;  1VQK V;  4J15 A;  3H1J H;  2XTI A;  4B08 A;  3G67 A;  2CJA A;  1F23 A;  1MNG A;  4MTF A;  2N04 A;  2A0L A;  4RUE A;  2ZXW C;  2QEX V;  3HFV A;  3HTZ A;  4P74 C;  4YRJ A;  3KKY A;  1XMQ B;  3A0B Z;  2XOK G;  3FB7 C;  4X1Y A;  3BA8 A;  3TXS A;  3U11 A;  5BXZ A;  4DW0 A;  4IIJ B;  1P49 A;  1YFS A;  3MD0 A;  2IH1 C;  4RAI A;  3IAY A;  4DV7 O;  3LSS A;  4H2T A;  1PD3 A;  4GKJ B;  3RYF B;  5KHG A;  4UPA A;  3L72 H;  1KMN A;  4DPG A;  2YS8 A;  5CMU A;  1HNZ B;  3SJA C;  5E3I A;  5C93 A;  2AZ0 A;  2PYL A;  1CXZ B;  4RMF A;  1AI7 A;  1AP6 A;  4GX5 A;  1XHZ A;  2YI8 A;  4FIP C;  3SYP A;  3K0G A;  1W0K G;  4JI3 B;  4JTD B;  3UCS C;  2DDZ A;  2G4C A;  3JAS A;  1W66 A;  3ZJZ A;  4YRS A;  1N4C A;  4HVC A;  4GLX A;  3JAR A;  2ZR2 A;  3RYC A;  3L74 H;  5JCO A;  5IYB O;  4YJ3 A;  2ZKO A;  4PA6 A;  2EWN A;  2WA4 A;  11AS A;  2CE4 A;  2YXY A;  3RBZ A;  1H4Q A;  1FPO A;  3K58 A;  2Y48 A;  3RVY A;  3BHP A;  5IYD O;  3B4S A;  1XI1 A;  1BIA A;  4DR2 B;  1KQS U;  2P6J A;  4IYH A;  1Y4M A;  1WN7 A;  5L3D A;  4YRL A;  2WWW A;  3CPW U;  1EN5 A;  2QWP B;  2DZ9 A;  4TV9 A;  1HR0 B;  4HWR A;  3K04 A;  2EIN B;  2IJI A;  2PMF A;  1HNX B;  1O9G A;  2VWJ A;  4Z1M G;  4DV6 B;  2E65 A;  4MVO A;  1I0H A;  3ICX A;  2JEX A;  1VF7 A;  5F2V O;  4XU1 A;  2ODR D;  5B66 Z;  5CA0 A;  2AXT Z;  4WJ3 M;  2ADP A;  2ETN A;  4O4I B;  2QWR B;  5JH7 B;  5ITZ B;  2WLI B;  4RQE A;  3ZBH A;  2X6C A;  3SYO A;  1WYD A;  3WB1 A;  1H4V B;  4KUM A;  2KG7 B;  5EIB D;  1P7B A;  4PV1 B;  4PA4 A;  2C2A A;  2L6L A;  2ZNJ A;  1WA8 A;  1H2L A;  2YXL A;  1RPO A;  2F1M A;  4FPP A;  4ZIB A;  1I7F A;  5LOV B;  4DV3 B;  1FFX A;  5BZB A;  4LF6 O;  2ADQ B;  5CA3 A;  1VQZ A;  2DTO A;  3K79 A;  3SPC A;  2RHQ A;  1VQ7 V;  1QVF U;  1JX9 A;  2ARU A;  2B5U A;  2F66 C;  3G1Z A;  4YRK A;  3W3S A;  5FPO A;  3CRA A;  3VOU A;  4JI5 O;  2QTO A;  2FYU H;  3Q4H B;  5BMV A;  5LBQ A;  3E9I A;  3IKL A;  3CRQ A;  4YYE A;  3OD1 A;  1Z2G A;  3RYH A;  2HHH O;  2DXT A;  3DC5 A;  4UV8 A;  4LBE C;  1YZB A;  1SQQ H;  2E5L B;  4KXR A;  1FJG B;  4PA3 A;  4D7S A;  5LP6 B;  4RDX A;  1DF4 A;  4IL6 Z;  4XEO A;  4HA8 A;  2XAJ A;  1PNK A;  4KR2 A;  4HWS A;  1QCE A;  3TK1 A;  2Y69 B;  2DZC A;  4DK1 A;  3CCR V;  4HYO A;  2QHV A;  3AG1 C;  1XHX A;  1YB3 A;  2ZE8 A;  2BCC H;  5KMG B;  4XTW A;  4TUY A;  1IZ3 A;  1KP2 A;  2LQT A;  1AVM A;  3M8A A;  4P73 C;  1VQP V;  2QDO A;  3JAS B;  4RO2 A;  4X1I A;  4JYA O;  3R65 A;  3V8K A;  4U7N A;  4FLX A;  3ABK C;  4Z1V A;  4I9Q A;  4NYK A;  2LP7 A;  4JTA B;  2NNU A;  3ICA A;  1JR9 A;  3D3Q A;  3I56 V;  1RPR A;  1XQ8 A;  1Y6X A;  2HP8 A;  4DV7 B;  4TTV A;  4P3P A;  2A06 H;  2Q7H A;  3UM7 A;  3OEH G;  1GM9 A;  4P3O A;  4EKW A;  3P3N A;  1PPJ H;  4PJ0 Z;  2ITC C;  4JI0 O;  1QE0 A;  2JJ1 G;  2EJF A;  2ZGW A;  1MZE A;  2XAG A;  3CJH B;  1HW7 A;  3AG4 B;  1S77 D;  2RCV A;  3SYQ A;  4QNH B;  3HR0 A;  1LYL A;  4TSF G;  3JAL B;  2QWN B;  1P4R A;  2EIL B;  3T1H O;  2DMX A;  5LMN O;  3TJT A;  1R6N A;  3ASO B;  1VAR A;  1XEQ A;  3DC6 A;  2PY5 A;  2GUZ A;  2P4V A;  1Q86 W;  1G51 A;  3HKD B;  2ZZG A;  2J3L A;  1GK9 A;  3E22 B;  4TQF A;  3SR2 C;  2Q73 A;  3HXZ A;  3F7Y C;  5B1B C;  1MAB G;  3MAQ A;  2NS6 A;  2JK5 C;  2ZXF A;  4X20 B;  5KHH A;  4K0K O;  4DYL A;  1AIL A;  5LMU O;  1IDS A;  3CHX A;  2QGN A;  4CS2 A;  5L3G A;  4TVA B;  4R7C A;  2AHY A;  2Q9L A;  3OMN B;  1UJW B;  1EQR A;  3MF2 A;  3CRR A;  2F93 B;  3VQX A;  12AS A;  4P75 C;  4YRQ A;  3ABL B;  3UGT A;  3B8N A;  4YRF A;  5FPR A;  2BTQ A;  4EEQ A;  3FB6 C;  4LH6 A;  1NNH A;  3CEI A;  3OAA G;  1SET A;  1VQ9 V;  2A3Q A;  3T1C A;  5TIS Z;  3CME V;  5BMV B;  5FNV A;  4YY3 O;  1P84 F;  1I94 O;  4L8J A;  2ZE6 A;  4JYY A;  1NJI W;  2J3M A;  1BL8 A;  4J80 A;  1O9H A;  1NJ8 A;  3HKC B;  2IM9 A;  2HEP A;  2HKO A;  3K08 A;  5L3C A;  4GX1 A;  4X9Q A;  1K97 A;  3ZRX A;  1QLN A;  1AR5 A;  4LF6 B;  4NXM O;  4WBN B;  1TUB A;  2YEV A;  3UH0 A;  2R70 A;  4H2W A;  4LVJ A;  5K1P A;  3OTF A;  2EJ9 A;  4E2L A;  2H94 A;  4G28 B;  2HHH B;  1GH6 A;  3ZN1 A;  3RKY A;  3AG2 C;  2XND G;  3K03 A;  1FKA O;  3EVK A;  1Q81 W;  2X0L A;  1ZL8 A;  4XBF A;  2PUS A;  4O4J B;  4Z2W A;  1YTF D;  3V7R A;  5KHK A;  1QF6 A;  1BS3 A;  1N9W A;  2BSK B;  1CPY A;  4UVC A;  3JSN A;  1GN4 A;  1WNL A;  5KUM A;  2WAM A;  3M7M X;  4WF9 V;  4B7K A;  2LFS A;  1NQT A;  2FB5 A;  5DM6 V;  4ZHQ B;  3G6E V;  4EB6 A;  1J5E O;  2DWE C;  1FS0 G;  3DXR B;  1H2N A;  4UCU A;  2Q7G A;  1JFF A;  4P74 A;  3K9A A;  1M5I A;  1NJ5 A;  2I4O A;  2DE0 X;  1NVP B;  1GN6 A;  2ZQM A;  3CRC A;  3B09 A;  4JI8 B;  4LF5 B;  5IYC O;  5JVD B;  4JYA B;  4JTC B;  1M93 A;  4JI7 B;  3I5D A;  1KKC A;  1JJC A;  3CWB H;  3KCY A;  5GTI Z;  3ETG A;  4LR3 A;  2CGN A;  1VQO V;  3JD1 A;  4O4H A;  4MVZ A;  1NBM G;  1JPX A;  2QHT A;  4TOI A;  3UFG A;  3T2M A;  2ZDI C;  4I4T A;  3JAK A;  4DV1 O;  4JI2 B;  4X66 B;  1M4U A;  1XMQ O;  2WLH A;  4X5O A;  3X2Q C;  4LFB B;  5LXT B;  3B8M A;  4DR6 B;  2PYJ A;  1COW G;  3F5T A;  2WLL A;  3UT5 B;  4JI0 B;  1YFR A;  3HFZ A;  4UCR A;  4LF8 O;  2AW9 A;  4DUY B;  2CTP A;  3SPJ A;  2K1E A;  5FL7 G;  1YJ9 V;  3E8H A;  3M4P A;  1H8H G;  1SZT A;  4X1K A;  1Q5O A;  3K5L A;  5B1N A;  2UU9 O;  3T1H B;  2EIK C;  3CXC U;  5LMN B;  1SQF A;  2F23 A;  4E51 A;  4U7O A;  5CA1 A;  2ALY A;  1SQB H;  4KQE A;  4G84 A;  5IY5 B;  4UP9 A;  1WPB A;  1F4N A;  1BT8 A;  4DV2 B;  4NCX A;  1K7D A;  4O2A A;  5FNV B;  2P5O A;  4HT4 A;  1R1B A;  4LH7 A;  1WU7 A;  4FLY A;  3AK3 A;  4FVM A;  5LMU B;  2W0X A;  5KHJ A;  2X6B A;  2EUL A;  4JV5 O;  3JD2 A;  3G4S V;  1R3I C;  2HNI A;  4OLF A;  2BE3 A;  3R66 A;  4JI4 O;  4F6R A;  1EVK A;  1ARO P;  2DN9 A;  3A7R A;  5KNN A;  3W7W A;  1S5H C;  1TUB B;  2JGD B;  3IKM B;  2YC0 A;  4J42 A;  3CCV V;  2ODM A;  2UXN A;  2QE7 G;  2HJF C;  4WF2 A;  2KQX A;  1M57 B;  4HBN A;  1D2D A;  1AJQ A;  1HNX O;  1WP7 A;  4AH6 A;  4YY3 B;  3FB8 C;  1UFI A;  3WU2 Z;  2A9H A;  4G85 A;  4UV9 A;  4K87 A;  4ZBM A;  3U10 A;  4P72 C;  1FYF A;  5CBF A;  4LVL A;  1GGM A;  2E41 A;  3JD4 A;  1W0J G;  1IBM B;  4P71 C;  4ZI7 B;  3AK2 A;  4KL1 A;  2EX3 A;  3K5N A;  2JS5 A;  1JFF B;  3REX A;  2ZXW B;  4JI1 O;  4DXW A;  3E83 A;  3AG7 A;  2Z5U A;  1JJ2 U;  2YUA A;  1EIY B;  5IJ9 A;  4MTX A;  2W6I G;  3HY0 A;  4YDQ A;  3TGU H;  4DQ2 A;  1B7Y A;  1N8R W;  1Y66 A;  3MQZ A;  1X59 A; 
#chains in the Genus database with same CATH homology
 4DR7 B;  2PMF A;  1HNX B;  4UP8 A;  1O9G A;  2VWJ A;  1ZAU A;  3NEN A;  3HXW A;  4DV6 B;  2IY5 A;  2E5A A;  4UCS A;  2UUA B;  4FLZ A;  1RSO A;  2E65 A;  4CH3 A;  5JVD A;  1Z7M A;  1Z5W A;  3ICX A;  5JQG A;  3L4G B;  4FM0 A;  1E24 A;  1VF7 A;  4EFE A;  4XU1 A;  2ODR D;  3K59 A;  5CA0 A;  4WJ3 M;  4O4L A;  2DU7 A;  4O2B B;  4O4I B;  5JH7 B;  5ITZ B;  4P73 A;  1J5E B;  2RHS B;  4RQE A;  1SER A;  2EJG A;  2VQF B;  3RKW A;  1WYD A;  3WB1 A;  3M4Q A;  2ZCE A;  1H4V B;  1X2H A;  4HNA A;  5EIB D;  1PYS B;  1EVL A;  2AMC A;  5K1X A;  4DV5 B;  4CH6 A;  4UP7 A;  4DR1 B;  2ZNJ A;  2YXL A;  2F1M A;  2VWK A;  4ZIB A;  5LOV B;  1I7F A;  3JAT B;  5LXT A;  2BTQ B;  3UT5 A;  4B3M B;  2RJZ A;  4DV3 B;  1FFX A;  5JJN B;  4NVP A;  4YCU A;  4DV4 B;  4DRX B;  2F95 B;  3B2E E;  3REU A;  3HXY A;  1VQZ A;  1X56 A;  2DTO A;  1B70 B;  3CSX A;  2RHQ A;  3I7F A;  3QNE A;  5CA1 B;  4YRC A;  2ARU A;  1XNQ B;  3L1A A;  5JJJ B;  3G1Z A;  2F66 C;  5JCO C;  4YRK A;  1H4S A;  3IG2 A;  3BRC A;  3A5Y A;  3W3S A;  5FPO A;  4X64 B;  2XHB A;  1S5J A;  1USY C;  3K5O A;  5BMV A;  4DV1 B;  3E9I A;  3PZC A;  3V8L A;  3IKL A;  4YYE A;  2ZTG A;  3OD1 A;  5ELO A;  4H2X A;  3RYH A;  2DXT A;  5LYJ B;  1ASZ A;  4YCV A;  1N32 B;  3V7S A;  2CGH A;  4U3J A;  2E5L B;  2R9A A;  3A74 A;  2E64 A;  1KMI Z;  3BFM A;  4CC6 A;  1FJG B;  4H2Y A;  4LF8 B;  4RQF A;  4D7S A;  5LP6 B;  4RDX A;  1NYR A;  1QHT A;  4FLW A;  4XEO A;  4HA8 A;  1N33 B;  4FLV A;  2P0L A;  4KR2 A;  4LFA B;  2EAY A;  4K88 A;  4HWS A;  3WB2 A;  1XMO B;  2DZC A;  4EFB A;  1X55 A;  2DKG A;  4DK1 A;  4IIJ A;  3VQW A;  1SRY A;  2QHV A;  1XHX A;  2UU9 B;  3PCO B;  1WNS A;  1YB3 A;  5KMG B;  4L87 A;  4XTW A;  4ZOL B;  4TUY A;  2GV9 A;  3RYF A;  3A31 A;  4I55 B;  2C8M A;  1KMM A;  1E1O A;  4P73 C;  3N2K B;  4TV8 B;  4ZTU B;  1NT2 B;  4JI5 B;  2Q5I A;  4DK0 A;  3JAS B;  4X1I A;  5C8Y B;  4P75 A;  3V7C A;  1T5E A;  1EFW A;  2RQ6 A;  5GON B;  4FLU A;  3V8K A;  4JV5 B;  3HXU A;  4FLX A;  4I9Q A;  4UCO A;  3ZS8 C;  4XEM A;  1SA0 B;  2Q7E A;  4UCV A;  2OYQ A;  2YIA A;  4EB6 B;  3ICA A;  2ODR C;  4JI4 B;  3E9H A;  1YEW A;  3RYI A;  2UXD B;  3U0Z A;  3ERR A;  4YRG A;  1XQ8 A;  3LC0 A;  4CS3 A;  4DV7 B;  1YGB A;  4TTV A;  3HKB B;  3TEH B;  3A32 A;  4P3P A;  3TEG A;  2Q7H A;  5LA6 A;  1JMK C;  3WQZ A;  2YI9 A;  4P3O A;  5EIB C;  4YRT A;  3V8J A;  4ZI7 A;  3QF7 A;  3R07 A;  5IJ9 B;  1QE0 A;  3NEL A;  1QQC A;  5IJ0 A;  2EJF A;  2ZGW A;  2JGU A;  1HW7 A;  2ZIM A;  2AKW B;  2ZZF A;  2YIB D;  4UFZ A;  2ZNI A;  1JJC B;  5EZY A;  2DTI A;  3BJU A;  4IHJ B;  4YCW A;  1EIY A;  2P5I A;  4O4H B;  1LYL A;  4HWO A;  4LNU B;  2ZT8 A;  1NJ6 A;  4YRI A;  3JAL B;  4YHH B;  4LF4 B;  4I4T B;  1D5A A;  2P22 C;  1NJ1 A;  5EYP A;  3JAK B;  2CAZ C;  5JQG B;  1B8A A;  2PY5 A;  3PN1 A;  1SQG A;  1N34 B;  2PME A;  4UCT A;  1G51 A;  3HKD B;  4O4L B;  2ZZG A;  1HTT A;  2J3L A;  1ADJ A;  3E22 B;  2YIB A;  4TQF A;  3SR2 C;  3HXZ A;  3ETQ A;  3HFZ B;  3L4G A;  2E10 A;  4EO4 A;  3MAQ A;  2CJB A;  2NS6 A;  2DU5 A;  1TVK B;  2PTM A;  3HKE A;  4LVI A;  2ZXF A;  4HNA B;  4X20 B;  5KHH A;  4TVW A;  4JI1 B;  4XU2 A;  3JAW A;  4O2B A;  4O4I A;  5JH7 A;  2DJZ A;  3CHX A;  1NYQ A;  2RHS A;  3HXV A;  3TUP A;  2CJ9 A;  4BW9 A;  4CS2 A;  4TVA B;  5KHI A;  4X1K B;  1X01 A;  3A7A A;  3MF2 A;  1EQR A;  3L2Z A;  4D7T A;  5J2U B;  1PYS A;  2DQ3 A;  1IL2 A;  3BA9 A;  2F93 B;  3VQX A;  2UUB B;  12AS A;  4P75 C;  4YRQ A;  3RFR A;  3RWR D;  2ALY B;  4LFC B;  3UGT A;  4FFB A;  5LOV A;  3RKX A;  3JAT A;  4YRF A;  5FPR A;  2BTQ A;  4EEQ A;  3T1Y B;  4O2A B;  2V4D A;  4EX5 A;  3MEY A;  5J2T B;  4XTU A;  4LH6 A;  4JI6 B;  1NNH A;  2DVE A;  4DRX A;  3SGI A;  1BIB A;  3RIR A;  1SET A;  4YRP A;  3K57 A;  1B70 A;  1L8D A;  5BMV B;  4OP0 A;  4CH4 A;  2ZIO A;  3N2G B;  2PZS A;  5FNV A;  2F4V B;  4ZTZ B;  4H2X B;  2ZR3 A;  4WJ4 A;  3OTO B;  1J5W A;  4X1Y B;  4B3T B;  4L8J A;  1B76 A;  4LVK A;  2CIM A;  1TGO A;  3IAL A;  2J3M A;  4HWP A;  2I4N A;  4KR3 A;  1O9H A;  3LSQ A;  4F6R B;  1E22 A;  1NJ8 A;  3HKC B;  2IM9 A;  2HEP A;  4K0K B;  3A7U A;  4H2S A;  3FFQ A;  1XNR B;  3RL6 A;  4AHC A;  4GKK B;  2UXB B;  1H2S B;  4LF6 B;  2KKW A;  4TVY A;  5LP6 A;  2QJ1 A;  2ZZE A;  1EOV A;  1DGS A;  4YRR A;  4WBN B;  4XTX A;  1BBU A;  1G5I A;  4BWA A;  1TUB A;  3EFR A;  3HXX A;  4YJ2 B;  4PHZ A;  3QO5 A;  3P8T A;  2ZIN A;  3UH0 A;  2R70 A;  3VQV A;  2C7I A;  4H2W A;  4LVJ A;  5K1P A;  2VQE B;  4WI1 A;  3OTF A;  4B3R B;  5CB4 B;  2EJ9 A;  4YPF A;  3A2F A;  3BPZ A;  5KMG A;  4ZOL A;  4DUZ B;  3JAR B;  2HHH B;  1BBW A;  3RKY A;  4I55 A;  4H02 A;  3THO A;  3RYC B;  1C0A A;  1I94 B;  1Z7N A;  4PG3 A;  2UXC B;  3N2K A;  2PUS A;  3HRI A;  4O4J B;  3V7R A;  4TV8 A;  5C51 B;  5KHK A;  1SKV A;  4YJ3 B;  3KFU A;  1QF6 A;  3JSL A;  1N9W A;  5C8Y A;  3RYI B;  5IYZ B;  3JSN A;  5GON A;  1WNL A;  3QTC A;  3M7M X;  2FYK A;  2QM4 A;  5LA6 B;  2ZT5 A;  4ZHQ B;  2Q5H A;  4EB6 A;  4K8Z A;  3NET A;  4TWA A;  3QG5 A;  5KX5 B;  1G6U A;  4NXM B;  4I50 B;  1V9P A;  4LNS A;  4UCU A;  3TEH A;  2Q7G A;  3HKB A;  4B3S B;  2QHS A;  1JFF A;  2A8E A;  4LF7 B;  4P74 A;  4YRM A;  1IBK B;  1NJ5 A;  1M5I A;  1B7Y B;  4TV9 B;  2I4O A;  1Q8I A;  3RF1 A;  1Z5V A;  4GYC B;  1SES A;  1E1T A;  2Q0A A;  2E1H A;  2IY5 B;  4JI8 B;  5HGQ A;  4LF5 B;  4KHP B;  2QHU A;  2EL9 A;  5JVD B;  3UQ8 A;  4JYA B;  4HWT A;  3A5Z A;  1Q43 A;  1M93 A;  4JI7 B;  1JJC A;  2BTO A;  5CA0 B;  4PI2 A;  3RAC A;  4LR3 A;  4YRE A;  1JJO A;  4O4H A;  2QHT A;  4AIL C;  4LNU A;  4TOI A;  4OX9 B;  1YFT A;  4FM1 A;  1B04 A;  3JAL A;  4XTV A;  3UFG A;  1WLE A;  4I4T A;  2R72 A;  2XGT A;  3JAK A;  4K86 A;  5LP6 C;  2AMC B;  1NJ2 A;  3LNN A;  3P8Y A;  4JI2 B;  5ITZ A;  1TA8 A;  3HKE B;  4X66 B;  1M4U A;  2DEQ A;  3HKD A;  3CMQ A;  3RGL A;  3P8V A;  4X5O A;  3JAW B;  3QO7 A;  4LFB B;  2JVD A;  4CS4 A;  5LXT B;  4XTZ A;  4DR6 B;  3E22 A;  2PYJ A;  1ASY A;  3UT5 B;  4JI0 B;  3FJP A;  5F5W A;  1FFX B;  4FLT A;  1YFR A;  3HFZ A;  4P72 A;  4UCR A;  4CH5 A;  1ATI A;  4CC5 A;  4X65 B;  1TVK A;  4DUY B;  4X20 A;  3UGQ A;  1HXD A;  4Q15 A;  3VBB A;  2RHQ B;  3M4P A;  4XU0 A;  4FFB B;  4P71 A;  1RIQ A;  4TVA A;  4X1K A;  1Q5O A;  1HC7 A;  3K5L A;  2UUC B;  5J2U A;  5BR8 B;  5ELN A;  3T1H B;  5D5P A;  2I4L A;  3RGB A;  5LMN B;  1SQF A;  4K8X A;  4E51 A;  1N36 B;  5CA1 A;  3NEM A;  2ALY A;  4H2U A;  4KQE A;  4PI0 A;  4G84 A;  3RYH B;  3SJC C;  3DSQ A;  1WPB A;  4DV2 B;  2ART A;  5D5Q A;  2DXU A;  4NCX A;  4UP9 A;  4J15 A;  4O2A A;  5FNV B;  2P5O A;  4HT4 A;  4LH7 A;  5J2T A;  1WU7 A;  4U3J B;  4FLY A;  2I4M A;  1WQW A;  2XTI A;  1HNW B;  4YRN A;  4B08 A;  2CJA A;  4FVM A;  3MF1 A;  3K5M A;  3HFV A;  4P74 C;  3HTZ A;  4YRJ A;  5LMU B;  5LYJ A;  5KHJ A;  4NXN B;  3N2G A;  1XMQ B;  1IBL B;  2HNI A;  4X1Y A;  3BA8 A;  3VQY A;  3U11 A;  4OLF A;  4IIJ B;  1G5H A;  1P49 A;  4X62 B;  3RUX A;  1YFS A;  4PHC A;  4XU3 A;  2OWO A;  4DV0 B;  4F6R A;  3IAY A;  1EVK A;  3LSS A;  3HKC A;  1WPY A;  5C53 B;  4H2T A;  4LVM A;  4TUY B;  4GKJ B;  1TAE A;  3RYF B;  4DR4 B;  5KHG A;  3A7R A;  4UPA A;  5KNN A;  3SJB C;  1TUB B;  1KMN A;  5IWA B;  3IKM B;  4DPG A;  2DTH A;  1HNZ B;  4TQD A;  3PCO A;  3SJA C;  5E3I A;  4WF2 A;  3CB2 A;  2PYL A;  4WBN A;  4X1I B;  4HBN A;  3QO8 A;  4RMF A;  1Q3E A;  1XHZ A;  2YI8 A;  1ADY A;  3ZED A;  4AH6 A;  4YY3 B;  4YJ2 A;  4O2D A;  4IHJ A;  4YP0 A;  3HRK A;  4JI3 B;  2ZM6 B;  5JJE B;  2DDZ A;  4YRO A;  1KU9 A;  3BAB A;  4G85 A;  2G4C A;  4K87 A;  3JAS A;  1W66 A;  5CB4 A;  4LF9 B;  1H4T A;  4P72 C;  3U10 A;  4YRS A;  1FYF A;  4LVL A;  4HVC A;  4GLX A;  1GGM A;  3JAR A;  4DR3 B;  2E41 A;  1SA0 A;  2ZR2 A;  1KOG A;  4AQY B;  3RYC A;  5JCO A;  3HY1 A;  1IBM B;  2PGG A;  3EFS A;  4P71 C;  4O4J A;  4ZI7 B;  1USY A;  4YJ3 A;  2E3C A;  4DR5 B;  4KL1 A;  2EWN A;  11AS A;  1X2G A;  5IYZ A;  1H4Q A;  2ZT7 A;  1L0W A;  2EX3 A;  5IJ0 B;  3K5N A;  4XTY A;  2JS5 A;  3WB0 A;  3K58 A;  4P3N A;  1JFF B;  1WQ7 A;  3REX A;  5EZY B;  3BHP A;  4H2V A;  3BAA A;  1XI1 A;  4ZHQ A;  4DR2 B;  1BIA A;  1EIY B;  5IJ9 A;  5C52 B;  4YRL A;  2ARS A;  1WN7 A;  3HY0 A;  2DQ0 A;  4YDQ A;  5KX5 A;  4I50 A;  2AKW A;  2ZT6 A;  1X4T A;  5EYP B;  2DZ9 A;  4DQ2 A;  1X54 A;  4FM2 A;  1B7Y A;  4TV9 A;  1HR0 B;  4HWR A;  4Q6G A;  3MQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...