2ZNJA

Crystal structure of pyrrolysyl-trna synthetase from desulfitobacterium hafniense
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
278
structure length
278
Chain Sequence
SSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Putative uncharacterized protein
publication title Pyrrolysyl-tRNA synthetase-tRNA(Pyl) structure reveals the molecular basis of orthogonality
pubmed doi rcsb
source organism Desulfitobacterium hafniense
total genus 79
structure length 278
sequence length 278
chains with identical sequence B, C
ec nomenclature ec 6.1.1.26: Pyrrolysine--tRNA(Pyl) ligase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2znjA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2znjA02
3RKXA 1HXDA 1B7YB 2C7IA 4XU1A 4YREA 3PCOA 5ELOA 3EFSA 4P71A 3IG2A 1PYSB 1LYLA 2JVDA 3LSQA 1NJ6A 3VBBA 3QNEA 4PG3A 2YIAA 3UGTA 2DJZA 3A7UA 2PUSA 3EFRA 2I4OA 3V7CA 1BIBA 4P74A 4XU2A 4YPFA 1HC7A 2ZZEA 3HXWA 3E9HA 2DEQA 1HTTA 1X2HA 4E51A 1KMNA 4YROA 4TVAB 2ZR2A 1JJCB 1VQZA 2Q7HA 2XGTA 2ZNIA 4J15A 3QO8A 1X56A 4P72A 2DTHA 4WF2A 2DU7A 2J3MA 1YFSA 1O9HA 3BFMA 2PGGA 4P3PA 3PCOB 3TEHA 1NJ5A 4HWTA 4HWRA 2DKGA 3VQVA 4O2DA 4YRQA 1ATIA 1Z7NA 2ZIOA 3G1ZA 2CJ9A 4WI1A 2ZR3A 4AH6A 4YCUA 4HWPA 3ERRA 1X01A 1BIAA 4ZTUB 2ZINA 4XU3A 2E65A 1G6UA 4DPGA 1NJ8A 4UP8A 2DDZA 4YRLA 4RMFA 1USYA 4YRGA 3NEMA 3HY0A 3V7SA 2ZTGA 4XTWA 2DU5A 2YI9A 1ASYA 1SETA 4TVYA 4YCWA 4H2WA 4RDXA 4KR2A 1O9GA 4CH4A 4EO4A 1WQ7A 4PHCA 11ASA 3HFZA 2ZT7A 1H4VB 3TEHB 4YRMA 4P73C 3RKYA 2EAYA 1NYRA 2DQ3A 3NETA 2ARUA 3REXA 4YRKA 2YI8A 3M4PA 1WNLA 1SESA 2DXUA 3DSQA 5F5WA 3A74A 3V8JA 4YRSA 2QHSA 1WU7A 5E3IA 3M4QA 5ELNA 4HVCA 1WYDA 4HA8A 1KOGA 3V7RA 3UFGA 4YRTA 3IALA 1BBWA 5K1XA 2EJFA 3VQWA 3RIRA 3P8TA 4OLFA 4P75C 3OD1A 4ZTZB 3HFZB 2E1HA 4TTVA 1ASZA 4XTZA 1EVLA 3HRIA 2Q5HA 3UH0A 3MF1A 1L0WA 4X5OA 1WQWA 4CS4A 1G5IA 3I7FA 4TQFA 1B70B 2DVEA 2QHTA 3A7RA 3RGLA 2DQ0A 4BWAA 1ADJA 3IKLA 2DXTA 2YIBA 3HY1A 4YRRA 2I4MA 2E3CA 3QO7A 1B8AA 1G51A 2CJAA 2RJZA 3ZEDA 1EIYA 2XTIA 2HEPA 2I4NA 3V8KA 4CS2A 4DQ2A 1B76A 3R07A 3HTZA 2P5IA 5C51B 5C53B 1YFTA 4K86A 1BBUA 4CH5A 1ADYA 3FJPA 4EX5A 2R70A 2P0LA 3E9IA 3P8YA 3HXXA 4KQEA 1YGBA 2C8MA 1EVKA 3A5YA 2ZZFA 1NJ1A 2G4CA 3A7AA 1YFRA 1E1OA 4H2UA 2DZ9A 3L4GA 4XTXA 2EWNA 2ZIMA 3RF1A 3HXYA 1EIYB 1IL2A 3A5ZA 3QO5A 4H02A 4YRCA 2ZCEA 2AKWA 3REUA 4TQDA 4K88A 2EJGA 4H2VA 3RL6A 1QE0A 4G84A 2ALYA 4CH3A 4YRFA 1YB3A 2DTIA 2Q5IA 1WPYA 2ODRD 4WJ4A 3KFUA 4P74C 2ZT8A 3HRKA 2PMEA 1NYQA 3A32A 4CS3A 3LC0A 4XTYA 2E41A 2ZT6A 3NENA 1EOVA 2E64A 1Z7MA 2CJBA 4P73A 4TVWA 1EQRA 5HGQA 1NJ2A 4H2XA 4XEOA 1SERA 1KMMA 3L4GB 3RKWA 4P72C 3ICAA 2HNIA 2J3LA 2FYKA 2RHSA 2IY5A 4YYEA 4ZIBA 4KR3A 2RQ6A 2ARTA 4HWOA 1WLEA 2AKWB 3IKMB 4Q6GA 2I4LA 4YRIA 5C52B 3WQZA 4CH6A 2ALYB 4UP9A 4WJ3M 4YDQA 1H4QA 4XU0A 3HFVA 3P8VA 4YP0A 1EFWA 2Q7GA 1X2GA 4YRPA 3BJUA 2RHQA 4P75A 1N9WA 3LSSA 4YRJA 1W66A 2ZZGA 3RACA 1E22A 2DTOA 1H4TA 3UGQA 3PZCA 4XTVA 1USYC 1J5WA 4OP0A 4H2XB 2YIBD 2ARSA 2ZXFA 3V8LA 3HXUA 4K87A 4XTUA 1X55A 4UPAA 4P3NA 2RHSB 2AMCA 4H2YA 2IY5B 4HWSA 1RIQA 1E1TA 3NELA 3VQYA 3TEGA 2Q7EA 1E24A 3L2ZA 3BHPA 5KNNA 2ODRC 2QHVA 4G85A 2CGHA 3HXZA 2R72A 2QJ1A 3A31A 1B7YA 2DZCA 4NCXA 1NNHA 4H2TA 1C0AA 4H2SA 1PYSA 2CIMA 2RHQB 3TUPA 4BW9A 1H4SA 12ASA 1FYFA 3MF2A 5K1PA 2EL9A 3CMQA 1QF6A 1G5HA 4TWAA 4P71C 1X54A 3W3SA 2QHUA 2E5AA 2ZGWA 1GGMA 4RQFA 3HXVA 4RQEA 4LNSA 4XEMA 4YRNA 4YCVA 2ZT5A 2E10A 4Q15A 3L1AA 2EJ9A 2AMCB 3VQXA 4TVAA 2PMFA 4P3OA 3MEYA 2ZNJA 1JJCA 1SRYA 1B70A 3RUXA 4UP7A 4L87A 3QTCA
chains in the Genus database with same CATH superfamily
3TXSA 1F4MA 4MVRA 4JI5O 2C7IA 4XU1A 1H2SB 4YREA 3L72H 4DR5B 3PCOA 5IJ9B 5H6RA 5KHIA 3EFSA 4OPAA 4LVIA 2DMXA 3IG2A 1K5QA 2ODMA 3RVZA 4I50B 4P9OA 2A3QA 4I7ZB 4JZ2A 3ZBHA 2OCCC 1NJ6A 1JA8A 3CRCA 1SQPH 1IZ3A 1Q6HA 4PG3A 4LVMA 4UVAA 4Q20A 1NT2B 1TUBB 2P22C 3ZMVA 3NXSA 4MTXA 4TV9A 4UXNA 2UXNA 2Y0IA 1KBHA 4YPFA 1PD3A 2CGNA 2Q8VA 3E9HA 1HTTA 3CCSV 1WAZA 1MSWD 1V9PA 4CC6A 1H2LA 3K57A 4JAUA 1SQBH 4X20B 3BY6A 4RO2A 1VQZA 1D2DA 3U0ZA 1Q6IA 5JQGB 2Q7HA 2XGTA 2XAGA 3F7VC 2ZNIA 2Q69A 3ZRWA 3QO8A 4B7EA 2ZM6B 5JJNB 4IHJB 1A32A 5B5EZ 4GCZA 3A0BZ 3CCLV 1YFSA 1O9HA 3T4ZA 2IJIA 2PGGA 2WLJA 4ZI7B 2AZ2A 4I5SA 2QKAA 4AQYB 1B06A 1M4UA 3C3SA 1X59A 2HJFC 5H6QA 1BHBA 2ADPA 1LNQA 4B3RB 1GTOA 1QHTA 1B04A 2CJ9A 4WI1A 2ZR3A 4AH6A 4YCUA 1QLEB 2BSKB 1WB7A 3ERRA 4JI5B 1BIAA 4ZTUB 4B7KA 5B3SC 4CZZA 2EIMB 4NVPA 3CYOA 4DPGA 4O4JA 4YRLA 4LVLA 4YRGA 3HY0A 4PI2A 4BIZA 1K34A 1HW7A 3A0RA 2DU5A 4J80A 1ASYA 1SETA 1VQ8V 1COWG 1YEWA 3CJHA 3FAVB 3D8CA 4LF9O 1O9GA 2Z5UA 4U3JB 2YS8A 1FJGO 4LVJA 1WQ7A 1WA8B 5KA6A 3KG2A 2V7QG 2WA4A 5IYBO 1V54C 2WLIB 3RBZA 1H4VB 3TEHB 4I4TB 4UV8A 4P73C 2QKSA 4DV5O 1MZEA 2EAYA 2F93B 2DQ3A 4JF3A 4EB6A 3REXA 3TETA 1XHZA 2XAJA 2QE7G 3RYFA 3ASNB 1W2BU 1AROP 2F23A 2JIZG 1WNLA 1NR7A 5J2TB 5LP6B 1SESA 1HNWO 2DXUA 2FB5A 1PNKA 4DV2O 1WU7A 2CTQA 4HVCA 3AG4B 2QGNA 1S3JA 1KOGA 1GKFA 1E79G 2P7TC 2WLLB 4B3SB 3V7RA 5CA0A 3OGCC 2W0FC 5LGUA 3AEIA 4I9QA 1BBWA 1F23A 1Z5VA 4JAVA 3SGIA 4PDRA 4OLFA 2QWRB 5ITZA 1Y76B 4LF8O 3D3IA 2FYUH 2CK3G 2E75B 5EC2C 3GWKC 4HAMA 4NTXA 2ITDC 1TVKA 4F6RA 1R73A 5IWAB 5B1OA 1G5IA 4E2LA 3A7RA 4LF9B 3JATB 3K08A 4DW0A 4FM0A 2GBOA 1FJGB 5FLXN 1Q5OA 1NJIW 2OWOA 4YJ3A 4XDKA 4IT5A 4YJ2A 1W59A 1IDSA 1EZJA 3IKLA 1NBMG 2Y69C 4JYBA 1S76D 1ROPA 1YITV 4DV5B 4YRRA 5GW7A 1IBKO 4O2BB 1B8AA 2RMKB 1P84F 3ZEDA 3TK1A 2OT5A 4LF7O 4FM2A 3B77A 3HKBB 3GVMA 3GWOA 3HKEA 4LVKA 3K59A 3CHXA 3JSNA 4FFKA 4H0LB 4KXRA 1AJNA 3E8GA 1RSOA 4H44B 2LGWA 4CC5A 2JDIG 1YFTA 3APQA 5CBGA 1OCRC 4B3TO 4CH5A 1ADYA 5LGTA 1I94O 3FJPA 5BR8O 2R70A 2X0LA 1YCIA 4LNUA 3JSLA 4BIOA 1VQOV 2XUMA 1YXBA 4FM1A 4KQEA 1FYJA 1AI4A 3SYOA 4FLTA 2C8MA 1KKDA 3B4SA 4LF8B 3SYCA 1VF5B 3ASOC 1HNZO 3KZIZ 1E1OA 1R6KA 3T2MA 2DZ9A 4H2UA 3L4GA 4DV1O 1YJ9V 1XILA 1H2MA 2OYQA 1FFTB 1VF6C 1EIYB 3HXYA 3OTOB 4AHCA 1JVMA 1AB3A 3MD0A 1IL2A 3QO5A 4JAAA 4DR2B 4K88A 2HHHO 3RL6A 1GN6A 1KB9F 4WFHA 3AG1C 3FB5C 4B08A 4FLWA 5LA6A 1KECA 1IBKB 3ETEA 1WPYA 1T5EA 4HNAB 3F5WC 5B66Z 5CB4A 4P74C 3HRKA 1NYQA 4CS3A 1ZL8A 3CC7V 2IH3C 4XTYA 2ZE6A 3L75H 5LHIA 1DTOA 1DF4A 1Z7MA 2EINC 2CJBA 4TVWA 2VWJA 4LWSA 3LUTB 5HGQA 5GONB 1NJ2A 2IH1C 4H2XA 3C90A 3T4DA 1OJHA 1AP6A 2JJ2G 2E5LO 2YICA 4P72C 4P30A 3E89A 5EZYB 5BR8B 3SPJA 4GX0A 4O4HB 2H94A 2ILMA 1V55C 4XBFA 4KR3A 1LR1A 3RN4A 3E8FA 3ZS8C 1BHAA 5L3EA 2X7RB 3IKMB 1JMKC 1QU7A 5JJJB 4YRIA 3BFRA 5KX5A 3AK2A 4Z1VA 1NU1H 4XU0A 1FPOA 2K1EA 4NB5A 2XHBA 4X62O 4YP0A 4DV1B 5LYJB 1EFWA 2R9RB 2WA3A 4O4LB 4YRPA 3X2QC 2FKXA 4QIWF 4DK0A 4I55A 1N9WA 1N8RW 2ZZGA 1WNSA 3UT5B 4DUYO 3UGQA 5KHHA 1J5WA 4WF9V 2VQEO 1XL4A 3W7SA 3HKDB 2HHHB 5IYZA 4JI8O 1WPXA 3V8LA 3IGAC 3JAWB 2D3OW 3O65A 4G2KA 4FZ1A 1OCZC 2Q68A 4OXSA 1S77D 1BGYH 2MK3A 2QTOA 2IY5B 1AI7A 3AG3C 4NTYA 4K0KO 3S3WA 1ZSPA 1VQ6V 3CP1A 1KUQA 2NR5A 3TEGA 1SA0B 4IYIA 3HR0A 3E8BA 3JAKA 1PNMA 1VQLV 4OGQB 3A31A 2E5LB 2DZCA 2XTAA 1KMIZ 4H2TA 1PYSA 2IJJA 2IU0A 1PNLA 2QWPB 3CCVV 3B09A 1OCCB 3TUPA 4BW9A 4JI2O 2Q73A 4NXNO 1QF6A 3L71H 4P71C 1N0NA 5C93A 4JTDB 1Q90D 1GGMA 5TISZ 3HXVA 4X62B 4LNSA 2JGDB 1Q6UA 3E22A 1Z2GA 2O57A 4X1KB 4DUYB 3NR7A 1B70A 1WB8A 4MVZA 5CA1A 4K8ZA 4DRXA 1Q82W 2GHYA 2PYJA 4PA3A 4JI8B 1B7YB 1IXBA 5ELOA 4YY3O 4GZRB 4P71A 2Q6AA 1Y74A 4X1IB 2AHZA 3BAAA 3CC2V 1IBMO 4LH6A 4QJFB 1SZTA 2QDOA 3LSQA 4K0KB 3VBBA 2YSUB 1RFYA 4UCVA 2YIAA 3A7UA 5B1AB 2F95B 2DN9A 3EFRA 2I4OA 1PKXA 2ARHA 2UUAO 5EYPA 4DR3B 2KB1A 1W0KG 3ETGA 1IXMA 4XU2A 1P7BA 3DGEA 2JEXA 3SPGA 2WLMA 3HXWA 1JFFB 4G27B 3W7XA 2W0XA 1HWYA 1R6NA 1K33A 4MT8A 1X2HA 3ZMUA 4E51A 4NTWA 1KMNA 4JASA 4O2AA 4MVMA 4YROA 4TVAB 3S3XA 2G38A 1VMGA 1JJCB 3U10A 4LFAO 2IBZH 1URFA 4JI2B 3RYCA 4NXNB 4FK5C 1TGOA 3OMIB 1K5SA 3ZX6A 3JD4A 5IY5C 1ZUQA 2DTHA 3BA9A 3M7MX 2F66C 3ML0A 3N2GA 3PCOB 1MA1A 2R9AA 1AR4A 2VRZA 4JZGA 1JOYA 4QE7A 4E4EA 4K8XA 3DXRA 2KG7A 2DKGA 2OCHA 1RPRA 3OW2U 1QR9A 3G1ZA 2PTMA 3FB6C 3T1YO 3TCUA 4TV9B 3P3NA 3BVOA 3RT3C 4LFCO 2E65A 3SJAC 1NJ8A 2HKOA 4UFZA 4AI8A 1FXVA 2ZXWC 4BAYA 2QEXV 3ZHQA 4LP8A 2ZTGA 1IBMB 4XTWA 3DTUB 3RYIA 3CCRV 1BMFG 2Y4TA 4YCWA 1AR5A 3ZRWB 2C2AA 3DC6A 2GTSA 2DE0X 3BABA 2CTWA 2UUAB 1M5IA 4PHCA 2DYRC 2EZOA 1VQ4V 5L3GA 2B5UA 3RKYA 2JJ1G 4DR1B 4ZHQA 1GM9A 2ARUA 3NETA 4JI1B 3QG5A 1IVSA 4LFAB 4MVQA 3B40A 4J9ZB 1S5HC 3E8HA 2P90A 2ITCC 2YIDA 3M4PA 1H8EG 3OR7C 3JARA 2EIJB 1H2KA 2Q0OC 3ZMTA 1H2NA 3AG2C 3WB2A 2NS6A 2P4KA 4O4JB 1XHXA 5EIBC 1AP5A 2PI5A 2UXBO 4HA8A 4JI6O 4WBNA 2YXHA 4FLUA 1BS3A 4O4IA 3CJHB 3OGIB 5C8YA 1EN4A 5JJEB 1ZAUA 5BY1A 2GSMB 3VOUA 3VQWA 3OD1A 4ZTZB 2NN4A 4LFCB 1ASZA 4UCTA 3L9DA 5CBFA 4DV4O 1BQ0A 3UH0A 4EB6B 3KKYA 1H2GA 5KUMA 3G4SV 3SPHA 4J42A 3EVKA 3RYFB 1S72V 1M56B 4MVUA 1KP2A 3H1HH 4TQFA 2BOCC 3EXAA 1FXKB 2DVEA 1R3IC 1TUEB 3MHSC 2DQ0A 1LUVA 5A2QN 1ADJA 2ADQB 4PD4F 3STLC 2XAQA 2B1IA 3H1JH 3QO7A 1VQNV 1AJQA 4UB6Z 2PF4E 2RJZA 4MSWC 4X9QA 5CA0B 4OX9O 1L8DA 1K4CC 2DJVA 2XAFA 4OPHA 3CMEV 4DV7B 1AJPA 3IFXA 2NNUA 3V8KA 4UCRA 3TJTA 3E86A 3ZHTA 5ITZB 2KKWA 5L3FA 4F4LA 4JPRA 5JVDA 3OEEG 2P5IA 5C53B 1WPBA 3MDSA 2UXBB 1BBUA 1VQPV 1TVKB 3ZHUA 2VQFO 3N27A 4ZOLA 3K58A 4F6RB 1G8MA 3CXCU 3SYQA 2CTRA 4A5UB 3E9IA 2ZDIC 4C7UA 3CCUV 3HXXA 1YGBA 4WFAV 2JK5C 4YJ3B 1EVKA 3APOA 3WFVA 3OM3B 4HZ3A 1XBLA 3HKCA 2OTJV 4YJ2B 2DWDC 4FZ0A 5HFMA 2YEVA 2FL4A 4DV4B 5LMNO 4XTXA 3GB7C 1HR0O 1OZ0A 3SPIA 5DEDA 3CPWU 1M9NA 2W6JG 1GO3F 5FPRA 2JS3A 3HKEB 3SJQC 2E74B 1R3JC 2DYSB 5GTHZ 2EULA 4YRCA 2ZCEA 3REUA 1HP8A 1QE0A 2ZDIA 3K0GA 5J2UA 3K5MA 1RSOB 4TWKA 4CH3A 4J41A 4PI0A 3FKSG 3ABKB 1TA8A 3CMAV 3UO3A 3H1KH 2ODRD 2IJHA 1QLEC 4MTFA 3ABUA 2NLJC 4N21A 4OX9B 3A32A 4LNUB 3LC0A 3EFFK 2EIMC 3NENA 5LHGA 1K4DC 3JALA 3B2EE 4P73A 4UCSA 4IHJA 2AXTZ 2B1GA 1YJNV 4EKWA 2F43G 3FYIB 3IJ4A 2M7WA 2MW2B 3MHHC 5D5QA 3L4GB 4LF6O 3RKWA 1KKCA 3CRMA 2XNDG 4FVMA 4EFBA 4WFGA 2J3LA 2QSAA 5BMVA 2RQ6A 2WSSG 2PI4A 1OCRB 1WLEA 4J10A 4W4KA 1F7YA 4IL6Z 4Q6GA 1XNRO 5C52B 4CH6A 4WJ3M 3UKMA 5KUKA 4YDQA 1H4QA 3ASNC 3SDLA 1M57B 3WG7B 5LA6B 3P8VA 1FFXA 2P67A 5CB4B 2Q7GA 2RHQA 1N32O 5LP6C 4YRJA 1W66A 1ZL8B 4LF5O 4F6EA 1DK1A 1JQ0A 3PZCA 1R1BA 1USYC 4XTVA 4LWSB 3AG4C 4PDVA 4GT1A 4QPKA 4LR3A 4OP0A 1QBZA 4WCEV 1HNWB 2LFSA 4H2XB 4DV2B 1N33O 2B9ZA 2JS5A 1NTKH 2QWOB 4K87A 3JASA 1JPXA 1VF7A 4PV1B 2JEUA 5KMGA 5BZBA 1SQQH 1J5EO 3OTFA 3CCMV 3K06A 4GKKO 4H2YA 1MSDA 2A0LA 1E1TA 2EJRA 3VQYA 3A0HZ 5KNNA 5KX5B 3SJCC 3DC5A 1KC8W 1EFRG 2HVJC 4H13B 1US6A 4DR7O 4DR4O 1OV9A 4LF6B 1HDJA 3CC4V 2EIKC 4X88A 1NNHA 1C0AA 1DLBA 4X8AA 4I55B 4X65O 4TV8A 1YZBA 2Q67A 12ASA 1FYFA 5HFLA 4PELA 4I9WA 1Q7YW 1AR1B 1YIJV 3N2KA 2EX3A 1NTZH 5IYZB 2E5AA 1Y66A 4U7NA 3W7WA 1Y67A 5FNVA 2GUZA 3P32A 1NI8A 1SF9A 1IBLO 3CCJV 4YRNA 2ZT5A 2E10A 5J9PC 4Q15A 1ENVA 1N32B 2EJ9A 4FLYA 2PMFA 4YHHO 2ZNJA 1Q8IA 4FLXA 4DUZO 4LF7B 3RW0A 4UP7A 5E1AC 3ZRXA 3QTCA 2HFEC 1JJOA 4HYOA 3OMAB 3RFRA 1VF6A 3JAKB 2RNBA 1N33B 1K7DA 1VP7A 2A06H 3UM7A 4CBCA 2WWWA 1PYSB 4B3TB 1GN3A 2GDSA 1MG1A 1QLNA 1LYLA 1J5EB 2JVDA 1I94B 4UV9A 4GKKB 4L8JA 5EBLC 1DGSA 3QNEA 3Q4HA 3T1HO 2VWKA 2LW7A 3V7CA 3QVNA 5F2VO 4P74A 4PA7A 2P06A 4DR7B 4DR4B 2DEQA 1HNZB 3E22B 4X1YA 1XQ8A 3QF7A 4X65B 2UXDO 5AG2A 4HT4A 2IJKA 5CA1B 1KU9A 4J15A 1VIBA 1X56A 4P72A 1AVMA 1AILA 4DRXB 2V4DA 4WF2A 2DU7A 3D36C 1XOUA 1QR8A 4LF4O 3PJSK 1I5XA 1IBLB 1ORQC 5A9GA 1Y74B 3IC9A 2UXXA 4NYKA 4YHHB 2CH7B 1NTMH 1GM8A 2OIGA 4YRQA 2QM8A 4DUZB 4I0XA 3MQZA 1NH2D 2F1MA 4MTGA 1YVWA 4TUYA 3L73H 3K03A 5EYPB 4HWPA 1X01A 2R9IA 4PA9A 3ZIAG 2LJ2A 1D5AA 2ZKOA 3RYHA 4UP8A 2LGQA 4TSFG 4RMFA 2OIEA 2EILB 4WFFA 3ZCCA 3V7SA 1HNXO 4O2AB 1E1RG 3ZRVA 1OCOB 2YI9A 3ETDA 1RPOA 4KUMA 3RYCB 4KP4A 4H2WA 1XMOO 1PM9A 5LOVA 5LXTB 3IC7A 4RDXA 1MNGA 4EO4A 4JTAB 3ABMB 4XDLA 4W4LA 3HFZA 2ZT7A 4YRMA 2XT9A 3AK3A 4MTOA 1L1FA 1PP9H 3DXRB 2KG7B 4PDLA 5DN6G 4UCUA 2F4VO 2UXDB 1RM1C 4IIJA 3JYCA 3SYAA 1PV0A 5H2FZ 4FJCC 3PN1A 2ZD9A 2VQEB 2CAZC 1WJZA 2RCVA 4JI3O 3ZMSA 4LF4B 3RGBA 2XAHA 2QHSA 1FD9A 1XREA 5E3IA 5ELNA 1S5JA 3TXQA 5IY5B 1GRJA 3RYIB 4AILC 5B1BB 1VEWA 3E83A 3CCQV 5FPOA 3UFGA 1FXHA 3IALA 5K1XA 1IURA 4ABMA 3RIRA 4P75C 3LNNA 2E1HA 4XTZA 1OCCC 2KSDA 5JH7A 1KP3A 1SQVH 5EK0A 2M6YA 1EVLA 2A8EA 4ZHQB 4UB8Z 1L0WA 1CPYA 1U96A 2Z3YA 2YDEA 1WQWA 2YC0A 4JI4O 1XUQA 4DYLA 3H1LH 4K3AA 4DO2A 2QHTA 3BEHA 1XMOB 3FFQA 4EEQA 4JV5O 3RGLA 3CD6V 4Z1MG 3CEIA 3JARB 3O9OA 1SA0A 4DR6O 1WP8A 2YXLA 4FIPC 5E79Z 1I08A 4BWAA 1CP9A 1JX9A 2DXTA 2YIBA 3OR6C 2P4VA 3H1IH 2E3CA 3CE2A 3G67A 1XDCA 2CJAA 1SC5B 4FFBA 2F4VB 1ZLZA 3ABLB 4O4IB 3ZN1A 2HEPA 1XMQO 5C8YB 3ICXA 2I4NA 3G71V 3JD3A 4PDMA 2OTLV 1NS1A 4CS2A 4DQ2A 3LSUA 1XNQO 3R07A 2Y4UA 4YY3B 5C51B 4KHPO 3OUSA 5B1AC 4K86A 1PL0A 2A79B 4EX5A 1G4YB 5FL7G 1M90W 3LDEA 2JRIA 1QNMA 2Y48A 1IX9A 2OCCB 1NJ1A 3H01A 3SPCA 1NVPD 2XASA 1P49A 3RF1A 4JI4B 4MVOA 2L6LA 4P9PA 2WLHA 4JV5B 3K5OA 2W6IG 2WAMA 4DR6B 1P7GA 3WU2Z 2AKWA 4TQDA 1Z5WA 3CX5F 4G84A 5JVDB 2ALYA 2DTIA 1K73W 3UO2A 4JTCB 2Q5IA 4WFBV 1ZTEA 4ZOLB 5H5NA 1H38A 3KCXA 3THOA 1EZVH 2PMEA 4UVCA 1XMQB 1R6TA 1EOVA 3T1YB 2LO1A 3CWBH 3HKCB 2HVKC 2EJ7A 4ZBMA 1PPJH 1R3KC 1EN6A 3FB7C 1XNQB 2YEVB 3RVYA 5LGNA 1KMMA 1Q86W 1CXZB 4KHPB 2ZQMA 1QVGU 2HNIA 1EN5A 5B3SB 2FYKA 2RHSA 3BPZA 3ZHRA 4ZIBA 2FMLA 1Q81W 2HG5C 2ARTA 2HLDG 4HWOA 1Q43A 4KFMA 2BTQA 2I4LA 2CUGA 3WQZA 5J2UB 3ZHVA 4ZKIA 2JGUA 5DECA 5LHHA 1WN7A 1SZXA 3HFVA 4B3MO 3L74H 4UVBA 1X2GA 2EIJC 2HJDA 3BJUA 2IW5A 3LSSA 1V54B 2IM9A 1VQ5V 1E22A 2DTOA 3G6EV 3JALB 5D5PA 3K9SA 2Q0AA 1GMGA 5IJ0A 1NQTA 2YIBD 2ARSA 3HXUA 1EBOA 3HB3B 2ZE5A 3CS5A 1K8AW 1YSCA 2HR3A 4XTUA 4JI6B 1VQMV 1X55A 2N04A 5IT9N 2AMCA 4B3SO 5BMVB 5KHKA 1SKVA 4HWSA 4UUJC 2YXYA 3FD9A 4MW8A 4DV0O 1N36O 1E24A 4PJ0Z 3SJBC 1BT8A 4G85A 3HXZA 1M56C 1FXKC 2WLNA 4NCXA 1FFXB 5IJ9A 4LBEC 4H2SA 1Y4MA 4GKJO 2Q4PA 4PA6A 2CIMA 2RHQB 3G6BA 4I50A 4LFBO 5IWAO 1TAEA 3C3TA 4TT3G 3MF2A 1NH2B 2EL9A 3CMQA 1AI6A 4JI7O 1G5HA 2PY5A 1UPGA 4TWAA 1TUBA 1X54A 2QM7A 5B1NA 3W3SA 2QKCA 3CRRA 4P2ZA 4RQEA 4GX1A 3JASB 4JYYA 4B3MB 4XEMA 5KMGB 4JYCA 3OUFA 1NR1A 4X20A 1UJWB 2K9PA 3MEYA 4J9YB 2Y69B 4P3OA 1QCEA 1SRYA 2CGOA 4RUEA 1FXKA 5JQGA 3J7AU 3CRAA 1Q3EA 3K5NA 1H8HG 2RDCA 3RKXA 1HXDA 2BTOA 5DM6V 4ZI7A 3TGUH 5KAIZ 3F7YC 4GLXA 2WLKA 2VQFB 5IYCO 4TV8B 1GN4A 5GTIZ 1AI5A 1X4TA 1GM7A 3UGTA 2DJZA 2PUSA 4DV0B 3ETQA 1N36B 3N2KB 2BSKA 1BIBA 5FNVB 4YXWG 2GUZB 1HC7A 1K3EA 2ZZEA 2LP7A 3P3PA 2A7WA 4QNHB 4DV6O 4D7TA 2QM4A 4GKJB 3P30A 5LMNB 2DYSC 4LFBB 2ZR2A 1BSMA 1HR0B 2WPDG 5CN0A 5EIBD 3OTOO 3ASOB 2EIKB 1D5NA 3FAVA 3LDCA 4R6ZA 4JI7B 2H8PC 3ABKC 4DR2O 3OE7G 4U3JA 3CXHF 2X6CA 1GK9A 3LDDA 4YIPA 3FB8C 1KQSU 2J3MA 3BFMA 1WA8A 1E1QG 4P3PA 2V1DA 2DOSA 2Z0AA 2WLIA 3TEHA 4H33A 4I4TA 3E2EA 1NJ5A 4HWTA 3R66A 1YHQV 5KA5A 4HWRA 3VQVA 1Y6XA 3AG1B 4O2DA 1VQ7V 1YTFD 3Q4HB 1ATIA 1Z7NA 2ZIOA 4GUNA 3J81N 2UUBO 5J2TA 4H37A 4LH7A 5KHJA 1BE3H 5LP6A 5L3CA 2VS0A 2ZINA 4XU3A 1G6UA 1NZ6A 2DDZA 3ZN0A 2EINB 1USYA 1B3QA 3NEMA 4X1YB 5BXZA 4X66O 5CA3A 1EM1A 4TVYA 2QA4V 3K9AA 2WLLA 4J7KA 2CE4A 4DXWA 2XOKG 1M57C 3R65A 1N4CA 1NKDA 3WG7C 2ETNA 2GV9A 4KR2A 4CH4A 1K9MW 4NKGB 4HBNA 11ASA 1XNRB 3OEHG 3SR2C 5KHGA 1V55B 1CEZA 1Y76A 4J11A 4YIOA 1U97A 4DV6B 1MABG 1UFIA 4KL1A 1GH6A 2UU9O 4TOIA 1NYRA 4YRKA 3OT7A 2HP8A 2DWEC 5EBMC 2EBOA 2QR4A 4I0XB 4LF5B 5JWPA 2YI8A 4LC1A 4TUYB 3WB0A 1ZX3A 3JATA 4U3FH 5KLVH 4X64O 3X2QB 3DSQA 5F5WA 4JGSA 4X89A 3A74A 3RYHB 2QTSA 3M8AA 3V8JA 4YRSA 3M4QA 1NVPB 1WYDA 4G28B 4J7JA 4O2BA 5CBHA 2CDYA 4JYAO 3K04A 1I0HA 3STZC 5LOVB 4YRTA 5IE9A 1XI1A 1OCZB 3T1CA 4ASUG 2UUBB 3HKBA 2EJFA 4MW3A 3P8TA 2GTAA 4BR6A 3HFZB 4TTVA 3AG3B 1G1XB 1L0NH 2BCCH 4DW1A 3B8MA 5L3BA 1KD1W 3HRIA 1N34O 2Q5HA 4EFEA 2P5OA 3MF1A 4X66B 4NXMO 2QWQB 4X5OA 5LL6Y 1VQ9V 4IIJB 4CS4A 1RP3B 1N0JA 3I7FA 1DF5A 1P4RA 1B70B 1S5LZ 3ZHSA 4IGGA 4NR1A 1BZKA 1YJWV 1SQFA 1FAFA 1S0VA 2H3OA 4QE9A 1FS0G 2AGAA 1XL6A 2Q5ZA 3ZJZA 3HY1A 2PYLA 1WP7A 2UU9B 2I4MA 2BE3A 5EC1C 3W7TA 4JI0O 4D6TH 1G51A 3BCCH 3B8NA 1EIYA 3OD4A 2XTIA 4BIUA 4FMTA 2D2CB 2E76B 3EHBB 3FX7A 1THZA 4X64B 5LMUO 1RM1B 3A2FA 2DW4A 1I5YA 1B76A 2N74A 5JH7B 1FKAO 4D7SA 3OAAG 3HTZA 1JJ2U 1OHHG 2AZ0A 1J95A 1K97A 4HNAA 2ZE8A 1YI2V 4JYAB 2P0LA 3D36A 1MZFA 1SS3A 1BQZA 1YDXA 1JCHA 1K92A 1KYOF 1SQGA 1VARA 3ZMZA 4RWUA 3T1HB 2UUCO 3P8YA 1JR9A 4R7CA 2BOBC 3KCYA 4DR3O 2KQXA 3A5YA 3E35A 2ZZFA 3D3QA 4QPJA 2A9HA 5GONA 3N2GB 2G4CA 3A7AA 3K5LA 4FLVA 1YFRA 2UXCO 3LNMB 1VQKV 1N34B 1SQXH 5L3DA 4R8CA 4NXMB 4FFBB 3CSXA 2EWNA 2ZIMA 4PA4A 5EZYA 3MAQA 4O4HA 5H9CA 3AK1A 3UCSC 3A5ZA 3SYPA 3K3WA 4H02A 1MOFA 3F5TA 2YUAA 3ZRSA 3L70H 5CMUA 2EJGA 4H2VA 4DV3O 1PL4A 3JCZA 3I5DA 4YRFA 4Z2WA 1YB3A 3IAYA 4JI0B 5LYJA 4WJ4A 2RN9A 3KFUA 2AW9A 1QQCA 4O4LA 2ZT8A 1M1KW 1LUWA 2IU3A 3UT5A 4DK1A 2E41A 2ZT6A 2E64A 2EILC 1EQRA 5LMUB 4U7OA 4K35A 3HKDA 1OCOC 3UQ8A 4XEOA 4R50A 2X6BA 5IYDO 1SERA 3JCUZ 2ATKC 3JAWA 3WB1A 2LFRA 1HNXB 3ICAA 4QGPA 1GAXA 2CH7A 3M99B 3ABMC 1ZWIC 2IY5A 3FYEB 4YYEA 1I7FA 2UUCB 2ZXWB 3CRQA 1L0LH 3G80A 2AKWB 4BW5A 2LQTA 2ALYB 4UP9A 2UXCB 4MVSA 3OFNG 1BL8A 4DR1O 1MMMA 1F4NA 3I55V 4RAIA 4JI1O 4WBNB 1W0JG 5IDJA 2DYRB 4P75A 3RACA 3I56V 3BA8A 1H4TA 4J7ZA 5JCOC 4IYHA 3J80N 5LXTA 2LW1A 4JI3B 1B6QA 2CTPA 5B1BC 4GX2A 4DV3B 4GYCB 2ZXFA 4DR5O 4FLZA 2JGDA 3OMNB 2Y0PA 3U11A 4UPAA 4P3NA 4MS2A 3AG2B 1XEQA 3JD0A 4X1KA 2RHSB 4L87A 3RWRD 4XDJA 2QWNB 4GX5A 1RIQA 3NELA 1GN2A 2BTQB 2Q7EA 4WFEA 3L2ZA 3BHPA 4UCOA 2ODRC 2QHVA 5LBQA 3W7UA 2N05A 2CGHA 5JCOA 2R72A 2QJ1A 3K0DA 1R3LC 1B7YA 2P6JA 2PZSA 3ABTA 3BRCA 4X1IA 3JAMN 5KAFZ 1H4SA 3HPLC 1YTFB 4LCUC 5K1PA 3CCEV 2AHYA 2ZT9B 2ZM6O 4PHZA 5IJ0B 2QHUA 3H9VA 1BCCH 4ICGA 1QVFU 2ZGWA 3ABLC 4RQFA 2ZE7A 1JFFA 3JD2A 1F51A 4YCVA 2X6AA 5EBWC 4AQYO 3L1AA 4N23A 2AMCB 3VQXA 3AG7A 4TVAA 2FTKA 1JJCA 2EZPA 4FPPA 4B3RO 2L35A 4DV7O 3RUXA 3CB2A 1YF2A 2Q9LA 3K79A 3A8TA 4RUFA 3JD1A 1M93A
chains in the Genus database with same CATH topology
1JJOA 3RFRA 4DRXA 3RKXA 3JAKB 1HXDA 2BTOA 2PYJA 4JI8B 1N33B 1B7YB 2C7IA 1H2SB 4ZI7A 4XU1A 4YREA 4DR5B 3PCOA 5IJ9B 5ELOA 5KHIA 3EFSA 4P71A 4LVIA 3IG2A 1PYSB 4X1IB 4GLXA 4B3TB 2VQFB 4I50B 1LYLA 1J5EB 2JVDA 4TV8B 3BAAA 1I94B 4LH6A 4GKKB 4L8JA 3LSQA 4K0KB 1NJ6A 3VBBA 1DGSA 1X4TA 3QNEA 4PG3A 4UCVA 4LVMA 2YIAA 3UGTA 2DJZA 3A7UA 1NT2B 1TUBB 2F95B 2P22C 2PUSA 4DV0B 3ETQA 1N36B 3N2KB 2VWKA 3EFRA 2I4OA 3V7CA 4TV9A 5EYPA 4DR3B 1BIBA 5FNVB 4P74A 4XU2A 4YPFA 1HC7A 2ZZEA 3HXWA 4DR7B 1JFFB 4DR4B 3E9HA 2DEQA 1HNZB 1HTTA 1X2HA 4D7TA 2QM4A 3E22B 1V9PA 4CC6A 4X1YA 4GKJB 1XQ8A 5LMNB 4E51A 3K57A 1KMNA 3QF7A 4O2AA 4X20B 4LFBB 4TVAB 4X65B 2ZR2A 4YROA 1HR0B 1JJCB 3U10A 5EIBD 1VQZA 3U0ZA 5JQGB 4JI2B 4HT4A 2Q7HA 2XGTA 5CA1B 2ZNIA 1KU9A 4J15A 3RYCA 4JI7B 4NXNB 3QO8A 1X56A 1TGOA 4P72A 2ZM6B 5JJNB 4IHJB 4DRXB 4U3JA 2V4DA 2DTHA 4WF2A 2DU7A 2J3MA 3BA9A 1O9HA 1YFSA 3BFMA 2PGGA 3M7MX 2F66C 3N2GA 4ZI7B 4P3PA 3PCOB 3TEHA 2R9AA 1IBLB 4I4TA 1NJ5A 4HWTA 4AQYB 1M4UA 4HWRA 4K8XA 2DKGA 3VQVA 4YHHB 4B3RB 4O2DA 4YRQA 4DUZB 3MQZA 1ATIA 1Z7NA 2ZIOA 1QHTA 2F1MA 1B04A 3G1ZA 2CJ9A 2PTMA 4TUYA 4WI1A 2ZR3A 4AH6A 4TV9B 4YCUA 5EYPB 4HWPA 3ERRA 1X01A 5J2TA 4LH7A 5KHJA 4JI5B 5LP6A 1BIAA 4ZTUB 2ZINA 4XU3A 2E65A 1G6UA 1D5AA 3SJAC 3RYHA 4NVPA 4DPGA 1NJ8A 4UP8A 4O4JA 4UFZA 2DDZA 4RMFA 4YRLA 4LVLA 1USYA 4YRGA 3NEMA 4X1YB 3HY0A 4PI2A 3V7SA 1HW7A 4O2AB 2ZTGA 1IBMB 4XTWA 2DU5A 3RYIA 2YI9A 1ASYA 1SETA 4TVYA 1YEWA 4YCWA 3RYCB 4H2WA 3BABA 5LOVA 5LXTB 2GV9A 4RDXA 4KR2A 1O9GA 4U3JB 4CH4A 4EO4A 4LVJA 2UUAB 1WQ7A 1M5IA 4PHCA 4HBNA 11ASA 1XNRB 3HFZA 3SR2C 5KHGA 2ZT7A 1H4VB 3TEHB 4YRMA 4I4TB 4DV6B 4KL1A 4P73C 3RKYA 2EAYA 2F93B 4TOIA 4DR1B 4ZHQA 1NYRA 2ARUA 4EB6A 2DQ3A 3NETA 3REXA 4JI1B 4YRKA 3QG5A 4UCUA 2UXDB 1XHZA 4IIJA 4LFAB 3RYFA 4LF5B 2YI8A 3PN1A 4TUYB 3WB0A 3M4PA 3JATA 2VQEB 2CAZC 1WNLA 3JARA 5J2TB 5LP6B 1SESA 2DXUA 3DSQA 4LF4B 5F5WA 3WB2A 3RYHB 2NS6A 3A74A 3RGBA 3V8JA 4O4JB 4YRSA 1XHXA 5EIBC 2QHSA 1WU7A 5E3IA 3M4QA 5ELNA 4HVCA 1S5JA 1WYDA 4HA8A 1KOGA 4O2BA 4WBNA 3RYIB 4AILC 4FLUA 4O4IA 4B3SB 3V7RA 5CA0A 5FPOA 3UFGA 5LOVB 4YRTA 5C8YA 1XI1A 4I9QA 3IALA 5JJEB 1BBWA 1ZAUA 5K1XA 2UUBB 3HKBA 2EJFA 1Z5VA 3VQWA 3SGIA 3P8TA 4OLFA 4P75C 3RIRA 3OD1A 4ZTZB 4LFCB 3LNNA 3HFZB 2E1HA 5ITZA 4TTVA 1ASZA 4UCTA 4XTZA 5JH7A 4K8ZA 1EVLA 3HRIA 2A8EA 2Q5HA 3UH0A 4ZHQB 4EFEA 2P5OA 4EB6B 3MF1A 4X66B 1L0WA 4X5OA 1TVKA 1WQWA 4IIJB 4CS4A 4F6RA 3RYFB 5IWAB 1G5IA 3I7FA 4TQFA 1B70B 2DVEA 2QHTA 3A7RA 1XMOB 4LF9B 3FFQA 3JATB 4EEQA 4FM0A 3RGLA 3JARB 1FJGB 1SA0A 1Q5OA 1SQFA 2OWOA 2DQ0A 4YJ3A 2YXLA 4BWAA 4YJ2A 1ADJA 3IKLA 2DXTA 2YIBA 2PYLA 3HY1A 2UU9B 4YRRA 4DV5B 2I4MA 2E3CA 3QO7A 4O2BB 1B8AA 1G51A 2CJAA 4FFBA 2F4VB 2RJZA 3ZEDA 4O4IB 1EIYA 2XTIA 5CA0B 1L8DA 2HEPA 4DV7B 4FM2A 5C8YB 3ICXA 2I4NA 3HKBB 3HKEA 4LVKA 4X64B 3K59A 3CHXA 3A2FA 3JSNA 3V8KA 4UCRA 5ITZB 4CS2A 2KKWA 4DQ2A 1B76A 5JH7B 4D7SA 3R07A 1RSOA 5JVDA 4CC5A 3HTZA 4YY3B 2P5IA 5C51B 5C53B 1YFTA 1WPBA 2UXBB 4K86A 1BBUA 4CH5A 1TVKB 1ADYA 4HNAA 4ZOLA 3K58A 4F6RB 3FJPA 4EX5A 4JYAB 2R70A 2P0LA 3E9IA 1SQGA 4LNUA 3JSLA 3T1HB 4FM1A 3P8YA 3HXXA 4KQEA 1YGBA 4FLTA 2C8MA 4YJ3B 1EVKA 3HKCA 3A5YA 4YJ2B 2ZZFA 1NJ1A 2G4CA 5GONA 3N2GB 4LF8B 3A7AA 3K5LA 4FLVA 1YFRA 1E1OA 4H2UA 4DV4B 1N34B 2DZ9A 3L4GA 4NXMB 4XTXA 4FFBB 3CSXA 2OYQA 2ZIMA 2EWNA 1P49A 3RF1A 5EZYA 3HXYA 1EIYB 3MAQA 4O4HA 3OTOB 4AHCA 4JI4B 1IL2A 3A5ZA 3QO5A 5FPRA 4JV5B 3HKEB 3K5OA 4H02A 4DR6B 4YRCA 2ZCEA 2AKWA 4DR2B 3REUA 4TQDA 4K88A 2EJGA 4H2VA 1Z5WA 3RL6A 1QE0A 5J2UA 3K5MA 4G84A 5JVDB 4CH3A 2ALYA 4PI0A 4YRFA 1YB3A 2DTIA 4B08A 4FLWA 2Q5IA 1TA8A 5LA6A 1IBKB 3IAYA 4JI0B 1WPYA 1T5EA 4HNAB 4ZOLB 5LYJA 2ODRD 4WJ4A 5CB4A 3KFUA 1QQCA 4O4LA 3THOA 4P74C 2ZT8A 3HRKA 4OX9B 1NYQA 2PMEA 3A32A 4LNUB 4CS3A 3LC0A 1XMQB 3UT5A 4XTYA 4DK1A 2E41A 2ZT6A 1EOVA 2E64A 3NENA 1Z7MA 3JALA 3B2EE 3T1YB 2CJBA 4P73A 4TVWA 4UCSA 2VWJA 4IHJA 5LMUB 1EQRA 3HKCB 5HGQA 3HKDA 5GONB 1NJ2A 3UQ8A 4H2XA 1XNQB 4XEOA 1SERA 5D5QA 1KMMA 3JAWA 4KHPB 3L4GB 3WB1A 3RKWA 4P72C 1HNXB 3ICAA 4FVMA 5EZYB 5BR8B 2HNIA 4EFBA 4O4HB 2J3LA 2FYKA 2RHSA 2IY5A 3BPZA 4YYEA 4ZIBA 1I7FA 5BMVA 4KR3A 2UUCB 2RQ6A 2ARTA 3ZS8C 4HWOA 1Q43A 1WLEA 2AKWB 2BTQA 3IKMB 1JMKC 4Q6GA 5JJJB 2I4LA 4YRIA 5C52B 3WQZA 4CH6A 5J2UB 5KX5A 2ALYB 4UP9A 4WJ3M 4YDQA 1H4QA 4XU0A 2UXCB 2JGUA 2XHBA 1WN7A 5LA6B 3HFVA 3P8VA 4YP0A 1FFXA 5LYJB 4DV1B 1EFWA 5CB4B 2Q7GA 1X2GA 4O4LB 4WBNB 4YRPA 3BJUA 2RHQA 4P75A 5LP6C 4I55A 4DK0A 1N9WA 3LSSA 1W66A 4YRJA 2IM9A 2ZZGA 1WNSA 3UT5B 1E22A 2DTOA 3BA8A 1H4TA 3RACA 5JCOC 3UGQA 5KHHA 3JALB 5D5PA 1USYC 1J5WA 3PZCA 4XTVA 5LXTA 2Q0AA 4LR3A 4OP0A 4JI3B 3HKDB 2HHHB 1HNWB 5IJ0A 5IYZA 4DV3B 4H2XB 2YIBD 2ARSA 4GYCB 4DV2B 2ZXFA 3V8LA 3JAWB 2JS5A 3HXUA 4K87A 3JASA 4FLZA 1VF7A 5KMGA 4XTUA 4JI6B 3U11A 1X55A 4UPAA 4P3NA 3OTFA 4X1KA 2RHSB 2AMCA 4H2YA 2IY5B 5BMVB 3RWRD 5KHKA 1SKVA 4HWSA 1RIQA 1E1TA 3NELA 3VQYA 3TEGA 1SA0B 2BTQB 2Q7EA 1E24A 3L2ZA 3BHPA 4UCOA 3SJBC 5KNNA 2ODRC 5KX5B 2QHVA 4G85A 2CGHA 3SJCC 3JAKA 3HXZA 2R72A 5JCOA 2QJ1A 3A31A 1B7YA 2E5LB 4LF6B 2DZCA 4NCXA 1FFXB 5IJ9A 1KMIZ 1NNHA 2PZSA 4H2TA 1C0AA 4H2SA 1PYSA 3BRCA 4X1IA 2CIMA 2RHQB 4I55B 4I50A 4TV8A 1TAEA 3TUPA 4BW9A 1H4SA 12ASA 1FYFA 3MF2A 5K1PA 2EL9A 3CMQA 1QF6A 1G5HA 2PY5A 4P71C 4TWAA 1TUBA 1X54A 4PHZA 3N2KA 2EX3A 5IJ0B 2QHUA 3W3SA 5IYZB 2E5AA 5FNVA 2ZGWA 1GGMA 4RQFA 3HXVA 1JFFA 3JASB 4X62B 4B3MB 4LNSA 4XEMA 4RQEA 5KMGB 4YRNA 4YCVA 3E22A 2ZT5A 2E10A 4Q15A 3L1AA 4X1KB 1N32B 2EJ9A 2AMCB 4X20A 3VQXA 4FLYA 4TVAA 2PMFA 4P3OA 3MEYA 2ZNJA 1Q8IA 1JJCA 4DUYB 1SRYA 4FLXA 5JQGA 1B70A 4LF7B 3RUXA 1Q3EA 3CB2A 5CA1A 4UP7A 3K5NA 4L87A 3QTCA 1M93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKX A;  1HXD A;  1B7Y B;  2C7I A;  4XU1 A;  4YRE A;  3PCO A;  5ELO A;  3EFS A;  4P71 A;  3IG2 A;  1PYS B;  1LYL A;  2JVD A;  3LSQ A;  1NJ6 A;  3VBB A;  3QNE A;  4PG3 A;  2YIA A;  3UGT A;  2DJZ A;  3A7U A;  2PUS A;  3EFR A;  2I4O A;  3V7C A;  1BIB A;  4P74 A;  4XU2 A;  4YPF A;  1HC7 A;  2ZZE A;  3HXW A;  3E9H A;  2DEQ A;  1HTT A;  1X2H A;  4E51 A;  1KMN A;  4YRO A;  4TVA B;  2ZR2 A;  1JJC B;  1VQZ A;  2Q7H A;  2XGT A;  2ZNI A;  4J15 A;  3QO8 A;  1X56 A;  4P72 A;  2DTH A;  4WF2 A;  2DU7 A;  2J3M A;  1YFS A;  1O9H A;  3BFM A;  2PGG A;  4P3P A;  3PCO B;  3TEH A;  1NJ5 A;  4HWT A;  4HWR A;  2DKG A;  3VQV A;  4O2D A;  4YRQ A;  1ATI A;  1Z7N A;  2ZIO A;  3G1Z A;  2CJ9 A;  4WI1 A;  2ZR3 A;  4AH6 A;  4YCU A;  4HWP A;  3ERR A;  1X01 A;  1BIA A;  4ZTU B;  2ZIN A;  4XU3 A;  2E65 A;  1G6U A;  4DPG A;  1NJ8 A;  4UP8 A;  2DDZ A;  4YRL A;  4RMF A;  1USY A;  4YRG A;  3NEM A;  3HY0 A;  3V7S A;  2ZTG A;  4XTW A;  2DU5 A;  2YI9 A;  1ASY A;  1SET A;  4TVY A;  4YCW A;  4H2W A;  4RDX A;  4KR2 A;  1O9G A;  4CH4 A;  4EO4 A;  1WQ7 A;  4PHC A;  11AS A;  3HFZ A;  2ZT7 A;  1H4V B;  3TEH B;  4YRM A;  4P73 C;  3RKY A;  2EAY A;  1NYR A;  2DQ3 A;  3NET A;  2ARU A;  3REX A;  4YRK A;  2YI8 A;  3M4P A;  1WNL A;  1SES A;  2DXU A;  3DSQ A;  5F5W A;  3A74 A;  3V8J A;  4YRS A;  2QHS A;  1WU7 A;  5E3I A;  3M4Q A;  5ELN A;  4HVC A;  1WYD A;  4HA8 A;  1KOG A;  3V7R A;  3UFG A;  4YRT A;  3IAL A;  1BBW A;  5K1X A;  2EJF A;  3VQW A;  3RIR A;  3P8T A;  4OLF A;  4P75 C;  3OD1 A;  4ZTZ B;  3HFZ B;  2E1H A;  4TTV A;  1ASZ A;  4XTZ A;  1EVL A;  3HRI A;  2Q5H A;  3UH0 A;  3MF1 A;  1L0W A;  4X5O A;  1WQW A;  4CS4 A;  1G5I A;  3I7F A;  4TQF A;  1B70 B;  2DVE A;  2QHT A;  3A7R A;  3RGL A;  2DQ0 A;  4BWA A;  1ADJ A;  3IKL A;  2DXT A;  2YIB A;  3HY1 A;  4YRR A;  2I4M A;  2E3C A;  3QO7 A;  1B8A A;  1G51 A;  2CJA A;  2RJZ A;  3ZED A;  1EIY A;  2XTI A;  2HEP A;  2I4N A;  3V8K A;  4CS2 A;  4DQ2 A;  1B76 A;  3R07 A;  3HTZ A;  2P5I A;  5C51 B;  5C53 B;  1YFT A;  4K86 A;  1BBU A;  4CH5 A;  1ADY A;  3FJP A;  4EX5 A;  2R70 A;  2P0L A;  3E9I A;  3P8Y A;  3HXX A;  4KQE A;  1YGB A;  2C8M A;  1EVK A;  3A5Y A;  2ZZF A;  1NJ1 A;  2G4C A;  3A7A A;  1YFR A;  1E1O A;  4H2U A;  2DZ9 A;  3L4G A;  4XTX A;  2EWN A;  2ZIM A;  3RF1 A;  3HXY A;  1EIY B;  1IL2 A;  3A5Z A;  3QO5 A;  4H02 A;  4YRC A;  2ZCE A;  2AKW A;  3REU A;  4TQD A;  4K88 A;  2EJG A;  4H2V A;  3RL6 A;  1QE0 A;  4G84 A;  2ALY A;  4CH3 A;  4YRF A;  1YB3 A;  2DTI A;  2Q5I A;  1WPY A;  2ODR D;  4WJ4 A;  3KFU A;  4P74 C;  2ZT8 A;  3HRK A;  2PME A;  1NYQ A;  3A32 A;  4CS3 A;  3LC0 A;  4XTY A;  2E41 A;  2ZT6 A;  3NEN A;  1EOV A;  2E64 A;  1Z7M A;  2CJB A;  4P73 A;  4TVW A;  1EQR A;  5HGQ A;  1NJ2 A;  4H2X A;  4XEO A;  1SER A;  1KMM A;  3L4G B;  3RKW A;  4P72 C;  3ICA A;  2HNI A;  2J3L A;  2FYK A;  2RHS A;  2IY5 A;  4YYE A;  4ZIB A;  4KR3 A;  2RQ6 A;  2ART A;  4HWO A;  1WLE A;  2AKW B;  3IKM B;  4Q6G A;  2I4L A;  4YRI A;  5C52 B;  3WQZ A;  4CH6 A;  2ALY B;  4UP9 A;  4WJ3 M;  4YDQ A;  1H4Q A;  4XU0 A;  3HFV A;  3P8V A;  4YP0 A;  1EFW A;  2Q7G A;  1X2G A;  4YRP A;  3BJU A;  2RHQ A;  4P75 A;  1N9W A;  3LSS A;  4YRJ A;  1W66 A;  2ZZG A;  3RAC A;  1E22 A;  2DTO A;  1H4T A;  3UGQ A;  3PZC A;  4XTV A;  1USY C;  1J5W A;  4OP0 A;  4H2X B;  2YIB D;  2ARS A;  2ZXF A;  3V8L A;  3HXU A;  4K87 A;  4XTU A;  1X55 A;  4UPA A;  4P3N A;  2RHS B;  2AMC A;  4H2Y A;  2IY5 B;  4HWS A;  1RIQ A;  1E1T A;  3NEL A;  3VQY A;  3TEG A;  2Q7E A;  1E24 A;  3L2Z A;  3BHP A;  5KNN A;  2ODR C;  2QHV A;  4G85 A;  2CGH A;  3HXZ A;  2R72 A;  2QJ1 A;  3A31 A;  1B7Y A;  2DZC A;  4NCX A;  1NNH A;  4H2T A;  1C0A A;  4H2S A;  1PYS A;  2CIM A;  2RHQ B;  3TUP A;  4BW9 A;  1H4S A;  12AS A;  1FYF A;  3MF2 A;  5K1P A;  2EL9 A;  3CMQ A;  1QF6 A;  1G5H A;  4TWA A;  4P71 C;  1X54 A;  3W3S A;  2QHU A;  2E5A A;  2ZGW A;  1GGM A;  4RQF A;  3HXV A;  4RQE A;  4LNS A;  4XEM A;  4YRN A;  4YCV A;  2ZT5 A;  2E10 A;  4Q15 A;  3L1A A;  2EJ9 A;  2AMC B;  3VQX A;  4TVA A;  2PMF A;  4P3O A;  3MEY A;  2ZNJ A;  1JJC A;  1SRY A;  1B70 A;  3RUX A;  4UP7 A;  4L87 A;  3QTC A; 
#chains in the Genus database with same CATH topology
 3TXS A;  1F4M A;  4MVR A;  4JI5 O;  2C7I A;  4XU1 A;  1H2S B;  4YRE A;  3L72 H;  4DR5 B;  3PCO A;  5IJ9 B;  5H6R A;  5KHI A;  3EFS A;  4OPA A;  4LVI A;  2DMX A;  3IG2 A;  1K5Q A;  2ODM A;  3RVZ A;  4I50 B;  4P9O A;  2A3Q A;  4I7Z B;  4JZ2 A;  3ZBH A;  2OCC C;  1NJ6 A;  1JA8 A;  3CRC A;  1SQP H;  1IZ3 A;  1Q6H A;  4PG3 A;  4LVM A;  4UVA A;  4Q20 A;  1NT2 B;  1TUB B;  2P22 C;  3ZMV A;  3NXS A;  4MTX A;  4TV9 A;  4UXN A;  2UXN A;  2Y0I A;  1KBH A;  4YPF A;  1PD3 A;  2CGN A;  2Q8V A;  3E9H A;  1HTT A;  3CCS V;  1WAZ A;  1MSW D;  1V9P A;  4CC6 A;  1H2L A;  3K57 A;  4JAU A;  1SQB H;  4X20 B;  3BY6 A;  4RO2 A;  1VQZ A;  1D2D A;  3U0Z A;  1Q6I A;  5JQG B;  2Q7H A;  2XGT A;  2XAG A;  3F7V C;  2ZNI A;  2Q69 A;  3ZRW A;  3QO8 A;  4B7E A;  2ZM6 B;  5JJN B;  4IHJ B;  1A32 A;  5B5E Z;  4GCZ A;  3A0B Z;  3CCL V;  1YFS A;  1O9H A;  3T4Z A;  2IJI A;  2PGG A;  2WLJ A;  4ZI7 B;  2AZ2 A;  4I5S A;  2QKA A;  4AQY B;  1B06 A;  1M4U A;  3C3S A;  1X59 A;  2HJF C;  5H6Q A;  1BHB A;  2ADP A;  1LNQ A;  4B3R B;  1GTO A;  1QHT A;  1B04 A;  2CJ9 A;  4WI1 A;  2ZR3 A;  4AH6 A;  4YCU A;  1QLE B;  2BSK B;  1WB7 A;  3ERR A;  4JI5 B;  1BIA A;  4ZTU B;  4B7K A;  5B3S C;  4CZZ A;  2EIM B;  4NVP A;  3CYO A;  4DPG A;  4O4J A;  4YRL A;  4LVL A;  4YRG A;  3HY0 A;  4PI2 A;  4BIZ A;  1K34 A;  1HW7 A;  3A0R A;  2DU5 A;  4J80 A;  1ASY A;  1SET A;  1VQ8 V;  1COW G;  1YEW A;  3CJH A;  3FAV B;  3D8C A;  4LF9 O;  1O9G A;  2Z5U A;  4U3J B;  2YS8 A;  1FJG O;  4LVJ A;  1WQ7 A;  1WA8 B;  5KA6 A;  3KG2 A;  2V7Q G;  2WA4 A;  5IYB O;  1V54 C;  2WLI B;  3RBZ A;  1H4V B;  3TEH B;  4I4T B;  4UV8 A;  4P73 C;  2QKS A;  4DV5 O;  1MZE A;  2EAY A;  2F93 B;  2DQ3 A;  4JF3 A;  4EB6 A;  3REX A;  3TET A;  1XHZ A;  2XAJ A;  2QE7 G;  3RYF A;  3ASN B;  1W2B U;  1ARO P;  2F23 A;  2JIZ G;  1WNL A;  1NR7 A;  5J2T B;  5LP6 B;  1SES A;  1HNW O;  2DXU A;  2FB5 A;  1PNK A;  4DV2 O;  1WU7 A;  2CTQ A;  4HVC A;  3AG4 B;  2QGN A;  1S3J A;  1KOG A;  1GKF A;  1E79 G;  2P7T C;  2WLL B;  4B3S B;  3V7R A;  5CA0 A;  3OGC C;  2W0F C;  5LGU A;  3AEI A;  4I9Q A;  1BBW A;  1F23 A;  1Z5V A;  4JAV A;  3SGI A;  4PDR A;  4OLF A;  2QWR B;  5ITZ A;  1Y76 B;  4LF8 O;  3D3I A;  2FYU H;  2CK3 G;  2E75 B;  5EC2 C;  3GWK C;  4HAM A;  4NTX A;  2ITD C;  1TVK A;  4F6R A;  1R73 A;  5IWA B;  5B1O A;  1G5I A;  4E2L A;  3A7R A;  4LF9 B;  3JAT B;  3K08 A;  4DW0 A;  4FM0 A;  2GBO A;  1FJG B;  5FLX N;  1Q5O A;  1NJI W;  2OWO A;  4YJ3 A;  4XDK A;  4IT5 A;  4YJ2 A;  1W59 A;  1IDS A;  1EZJ A;  3IKL A;  1NBM G;  2Y69 C;  4JYB A;  1S76 D;  1ROP A;  1YIT V;  4DV5 B;  4YRR A;  5GW7 A;  1IBK O;  4O2B B;  1B8A A;  2RMK B;  1P84 F;  3ZED A;  3TK1 A;  2OT5 A;  4LF7 O;  4FM2 A;  3B77 A;  3HKB B;  3GVM A;  3GWO A;  3HKE A;  4LVK A;  3K59 A;  3CHX A;  3JSN A;  4FFK A;  4H0L B;  4KXR A;  1AJN A;  3E8G A;  1RSO A;  4H44 B;  2LGW A;  4CC5 A;  2JDI G;  1YFT A;  3APQ A;  5CBG A;  1OCR C;  4B3T O;  4CH5 A;  1ADY A;  5LGT A;  1I94 O;  3FJP A;  5BR8 O;  2R70 A;  2X0L A;  1YCI A;  4LNU A;  3JSL A;  4BIO A;  1VQO V;  2XUM A;  1YXB A;  4FM1 A;  4KQE A;  1FYJ A;  1AI4 A;  3SYO A;  4FLT A;  2C8M A;  1KKD A;  3B4S A;  4LF8 B;  3SYC A;  1VF5 B;  3ASO C;  1HNZ O;  3KZI Z;  1E1O A;  1R6K A;  3T2M A;  2DZ9 A;  4H2U A;  3L4G A;  4DV1 O;  1YJ9 V;  1XIL A;  1H2M A;  2OYQ A;  1FFT B;  1VF6 C;  1EIY B;  3HXY A;  3OTO B;  4AHC A;  1JVM A;  1AB3 A;  3MD0 A;  1IL2 A;  3QO5 A;  4JAA A;  4DR2 B;  4K88 A;  2HHH O;  3RL6 A;  1GN6 A;  1KB9 F;  4WFH A;  3AG1 C;  3FB5 C;  4B08 A;  4FLW A;  5LA6 A;  1KEC A;  1IBK B;  3ETE A;  1WPY A;  1T5E A;  4HNA B;  3F5W C;  5B66 Z;  5CB4 A;  4P74 C;  3HRK A;  1NYQ A;  4CS3 A;  1ZL8 A;  3CC7 V;  2IH3 C;  4XTY A;  2ZE6 A;  3L75 H;  5LHI A;  1DTO A;  1DF4 A;  1Z7M A;  2EIN C;  2CJB A;  4TVW A;  2VWJ A;  4LWS A;  3LUT B;  5HGQ A;  5GON B;  1NJ2 A;  2IH1 C;  4H2X A;  3C90 A;  3T4D A;  1OJH A;  1AP6 A;  2JJ2 G;  2E5L O;  2YIC A;  4P72 C;  4P30 A;  3E89 A;  5EZY B;  5BR8 B;  3SPJ A;  4GX0 A;  4O4H B;  2H94 A;  2ILM A;  1V55 C;  4XBF A;  4KR3 A;  1LR1 A;  3RN4 A;  3E8F A;  3ZS8 C;  1BHA A;  5L3E A;  2X7R B;  3IKM B;  1JMK C;  1QU7 A;  5JJJ B;  4YRI A;  3BFR A;  5KX5 A;  3AK2 A;  4Z1V A;  1NU1 H;  4XU0 A;  1FPO A;  2K1E A;  4NB5 A;  2XHB A;  4X62 O;  4YP0 A;  4DV1 B;  5LYJ B;  1EFW A;  2R9R B;  2WA3 A;  4O4L B;  4YRP A;  3X2Q C;  2FKX A;  4QIW F;  4DK0 A;  4I55 A;  1N9W A;  1N8R W;  2ZZG A;  1WNS A;  3UT5 B;  4DUY O;  3UGQ A;  5KHH A;  1J5W A;  4WF9 V;  2VQE O;  1XL4 A;  3W7S A;  3HKD B;  2HHH B;  5IYZ A;  4JI8 O;  1WPX A;  3V8L A;  3IGA C;  3JAW B;  2D3O W;  3O65 A;  4G2K A;  4FZ1 A;  1OCZ C;  2Q68 A;  4OXS A;  1S77 D;  1BGY H;  2MK3 A;  2QTO A;  2IY5 B;  1AI7 A;  3AG3 C;  4NTY A;  4K0K O;  3S3W A;  1ZSP A;  1VQ6 V;  3CP1 A;  1KUQ A;  2NR5 A;  3TEG A;  1SA0 B;  4IYI A;  3HR0 A;  3E8B A;  3JAK A;  1PNM A;  1VQL V;  4OGQ B;  3A31 A;  2E5L B;  2DZC A;  2XTA A;  1KMI Z;  4H2T A;  1PYS A;  2IJJ A;  2IU0 A;  1PNL A;  2QWP B;  3CCV V;  3B09 A;  1OCC B;  3TUP A;  4BW9 A;  4JI2 O;  2Q73 A;  4NXN O;  1QF6 A;  3L71 H;  4P71 C;  1N0N A;  5C93 A;  4JTD B;  1Q90 D;  1GGM A;  5TIS Z;  3HXV A;  4X62 B;  4LNS A;  2JGD B;  1Q6U A;  3E22 A;  1Z2G A;  2O57 A;  4X1K B;  4DUY B;  3NR7 A;  1B70 A;  1WB8 A;  4MVZ A;  5CA1 A;  4K8Z A;  4DRX A;  1Q82 W;  2GHY A;  2PYJ A;  4PA3 A;  4JI8 B;  1B7Y B;  1IXB A;  5ELO A;  4YY3 O;  4GZR B;  4P71 A;  2Q6A A;  1Y74 A;  4X1I B;  2AHZ A;  3BAA A;  3CC2 V;  1IBM O;  4LH6 A;  4QJF B;  1SZT A;  2QDO A;  3LSQ A;  4K0K B;  3VBB A;  2YSU B;  1RFY A;  4UCV A;  2YIA A;  3A7U A;  5B1A B;  2F95 B;  2DN9 A;  3EFR A;  2I4O A;  1PKX A;  2ARH A;  2UUA O;  5EYP A;  4DR3 B;  2KB1 A;  1W0K G;  3ETG A;  1IXM A;  4XU2 A;  1P7B A;  3DGE A;  2JEX A;  3SPG A;  2WLM A;  3HXW A;  1JFF B;  4G27 B;  3W7X A;  2W0X A;  1HWY A;  1R6N A;  1K33 A;  4MT8 A;  1X2H A;  3ZMU A;  4E51 A;  4NTW A;  1KMN A;  4JAS A;  4O2A A;  4MVM A;  4YRO A;  4TVA B;  3S3X A;  2G38 A;  1VMG A;  1JJC B;  3U10 A;  4LFA O;  2IBZ H;  1URF A;  4JI2 B;  3RYC A;  4NXN B;  4FK5 C;  1TGO A;  3OMI B;  1K5S A;  3ZX6 A;  3JD4 A;  5IY5 C;  1ZUQ A;  2DTH A;  3BA9 A;  3M7M X;  2F66 C;  3ML0 A;  3N2G A;  3PCO B;  1MA1 A;  2R9A A;  1AR4 A;  2VRZ A;  4JZG A;  1JOY A;  4QE7 A;  4E4E A;  4K8X A;  3DXR A;  2KG7 A;  2DKG A;  2OCH A;  1RPR A;  3OW2 U;  1QR9 A;  3G1Z A;  2PTM A;  3FB6 C;  3T1Y O;  3TCU A;  4TV9 B;  3P3N A;  3BVO A;  3RT3 C;  4LFC O;  2E65 A;  3SJA C;  1NJ8 A;  2HKO A;  4UFZ A;  4AI8 A;  1FXV A;  2ZXW C;  4BAY A;  2QEX V;  3ZHQ A;  4LP8 A;  2ZTG A;  1IBM B;  4XTW A;  3DTU B;  3RYI A;  3CCR V;  1BMF G;  2Y4T A;  4YCW A;  1AR5 A;  3ZRW B;  2C2A A;  3DC6 A;  2GTS A;  2DE0 X;  3BAB A;  2CTW A;  2UUA B;  1M5I A;  4PHC A;  2DYR C;  2EZO A;  1VQ4 V;  5L3G A;  2B5U A;  3RKY A;  2JJ1 G;  4DR1 B;  4ZHQ A;  1GM9 A;  2ARU A;  3NET A;  4JI1 B;  3QG5 A;  1IVS A;  4LFA B;  4MVQ A;  3B40 A;  4J9Z B;  1S5H C;  3E8H A;  2P90 A;  2ITC C;  2YID A;  3M4P A;  1H8E G;  3OR7 C;  3JAR A;  2EIJ B;  1H2K A;  2Q0O C;  3ZMT A;  1H2N A;  3AG2 C;  3WB2 A;  2NS6 A;  2P4K A;  4O4J B;  1XHX A;  5EIB C;  1AP5 A;  2PI5 A;  2UXB O;  4HA8 A;  4JI6 O;  4WBN A;  2YXH A;  4FLU A;  1BS3 A;  4O4I A;  3CJH B;  3OGI B;  5C8Y A;  1EN4 A;  5JJE B;  1ZAU A;  5BY1 A;  2GSM B;  3VOU A;  3VQW A;  3OD1 A;  4ZTZ B;  2NN4 A;  4LFC B;  1ASZ A;  4UCT A;  3L9D A;  5CBF A;  4DV4 O;  1BQ0 A;  3UH0 A;  4EB6 B;  3KKY A;  1H2G A;  5KUM A;  3G4S V;  3SPH A;  4J42 A;  3EVK A;  3RYF B;  1S72 V;  1M56 B;  4MVU A;  1KP2 A;  3H1H H;  4TQF A;  2BOC C;  3EXA A;  1FXK B;  2DVE A;  1R3I C;  1TUE B;  3MHS C;  2DQ0 A;  1LUV A;  5A2Q N;  1ADJ A;  2ADQ B;  4PD4 F;  3STL C;  2XAQ A;  2B1I A;  3H1J H;  3QO7 A;  1VQN V;  1AJQ A;  4UB6 Z;  2PF4 E;  2RJZ A;  4MSW C;  4X9Q A;  5CA0 B;  4OX9 O;  1L8D A;  1K4C C;  2DJV A;  2XAF A;  4OPH A;  3CME V;  4DV7 B;  1AJP A;  3IFX A;  2NNU A;  3V8K A;  4UCR A;  3TJT A;  3E86 A;  3ZHT A;  5ITZ B;  2KKW A;  5L3F A;  4F4L A;  4JPR A;  5JVD A;  3OEE G;  2P5I A;  5C53 B;  1WPB A;  3MDS A;  2UXB B;  1BBU A;  1VQP V;  1TVK B;  3ZHU A;  2VQF O;  3N27 A;  4ZOL A;  3K58 A;  4F6R B;  1G8M A;  3CXC U;  3SYQ A;  2CTR A;  4A5U B;  3E9I A;  2ZDI C;  4C7U A;  3CCU V;  3HXX A;  1YGB A;  4WFA V;  2JK5 C;  4YJ3 B;  1EVK A;  3APO A;  3WFV A;  3OM3 B;  4HZ3 A;  1XBL A;  3HKC A;  2OTJ V;  4YJ2 B;  2DWD C;  4FZ0 A;  5HFM A;  2YEV A;  2FL4 A;  4DV4 B;  5LMN O;  4XTX A;  3GB7 C;  1HR0 O;  1OZ0 A;  3SPI A;  5DED A;  3CPW U;  1M9N A;  2W6J G;  1GO3 F;  5FPR A;  2JS3 A;  3HKE B;  3SJQ C;  2E74 B;  1R3J C;  2DYS B;  5GTH Z;  2EUL A;  4YRC A;  2ZCE A;  3REU A;  1HP8 A;  1QE0 A;  2ZDI A;  3K0G A;  5J2U A;  3K5M A;  1RSO B;  4TWK A;  4CH3 A;  4J41 A;  4PI0 A;  3FKS G;  3ABK B;  1TA8 A;  3CMA V;  3UO3 A;  3H1K H;  2ODR D;  2IJH A;  1QLE C;  4MTF A;  3ABU A;  2NLJ C;  4N21 A;  4OX9 B;  3A32 A;  4LNU B;  3LC0 A;  3EFF K;  2EIM C;  3NEN A;  5LHG A;  1K4D C;  3JAL A;  3B2E E;  4P73 A;  4UCS A;  4IHJ A;  2AXT Z;  2B1G A;  1YJN V;  4EKW A;  2F43 G;  3FYI B;  3IJ4 A;  2M7W A;  2MW2 B;  3MHH C;  5D5Q A;  3L4G B;  4LF6 O;  3RKW A;  1KKC A;  3CRM A;  2XND G;  4FVM A;  4EFB A;  4WFG A;  2J3L A;  2QSA A;  5BMV A;  2RQ6 A;  2WSS G;  2PI4 A;  1OCR B;  1WLE A;  4J10 A;  4W4K A;  1F7Y A;  4IL6 Z;  4Q6G A;  1XNR O;  5C52 B;  4CH6 A;  4WJ3 M;  3UKM A;  5KUK A;  4YDQ A;  1H4Q A;  3ASN C;  3SDL A;  1M57 B;  3WG7 B;  5LA6 B;  3P8V A;  1FFX A;  2P67 A;  5CB4 B;  2Q7G A;  2RHQ A;  1N32 O;  5LP6 C;  4YRJ A;  1W66 A;  1ZL8 B;  4LF5 O;  4F6E A;  1DK1 A;  1JQ0 A;  3PZC A;  1R1B A;  1USY C;  4XTV A;  4LWS B;  3AG4 C;  4PDV A;  4GT1 A;  4QPK A;  4LR3 A;  4OP0 A;  1QBZ A;  4WCE V;  1HNW B;  2LFS A;  4H2X B;  4DV2 B;  1N33 O;  2B9Z A;  2JS5 A;  1NTK H;  2QWO B;  4K87 A;  3JAS A;  1JPX A;  1VF7 A;  4PV1 B;  2JEU A;  5KMG A;  5BZB A;  1SQQ H;  1J5E O;  3OTF A;  3CCM V;  3K06 A;  4GKK O;  4H2Y A;  1MSD A;  2A0L A;  1E1T A;  2EJR A;  3VQY A;  3A0H Z;  5KNN A;  5KX5 B;  3SJC C;  3DC5 A;  1KC8 W;  1EFR G;  2HVJ C;  4H13 B;  1US6 A;  4DR7 O;  4DR4 O;  1OV9 A;  4LF6 B;  1HDJ A;  3CC4 V;  2EIK C;  4X88 A;  1NNH A;  1C0A A;  1DLB A;  4X8A A;  4I55 B;  4X65 O;  4TV8 A;  1YZB A;  2Q67 A;  12AS A;  1FYF A;  5HFL A;  4PEL A;  4I9W A;  1Q7Y W;  1AR1 B;  1YIJ V;  3N2K A;  2EX3 A;  1NTZ H;  5IYZ B;  2E5A A;  1Y66 A;  4U7N A;  3W7W A;  1Y67 A;  5FNV A;  2GUZ A;  3P32 A;  1NI8 A;  1SF9 A;  1IBL O;  3CCJ V;  4YRN A;  2ZT5 A;  2E10 A;  5J9P C;  4Q15 A;  1ENV A;  1N32 B;  2EJ9 A;  4FLY A;  2PMF A;  4YHH O;  2ZNJ A;  1Q8I A;  4FLX A;  4DUZ O;  4LF7 B;  3RW0 A;  4UP7 A;  5E1A C;  3ZRX A;  3QTC A;  2HFE C;  1JJO A;  4HYO A;  3OMA B;  3RFR A;  1VF6 A;  3JAK B;  2RNB A;  1N33 B;  1K7D A;  1VP7 A;  2A06 H;  3UM7 A;  4CBC A;  2WWW A;  1PYS B;  4B3T B;  1GN3 A;  2GDS A;  1MG1 A;  1QLN A;  1LYL A;  1J5E B;  2JVD A;  1I94 B;  4UV9 A;  4GKK B;  4L8J A;  5EBL C;  1DGS A;  3QNE A;  3Q4H A;  3T1H O;  2VWK A;  2LW7 A;  3V7C A;  3QVN A;  5F2V O;  4P74 A;  4PA7 A;  2P06 A;  4DR7 B;  4DR4 B;  2DEQ A;  1HNZ B;  3E22 B;  4X1Y A;  1XQ8 A;  3QF7 A;  4X65 B;  2UXD O;  5AG2 A;  4HT4 A;  2IJK A;  5CA1 B;  1KU9 A;  4J15 A;  1VIB A;  1X56 A;  4P72 A;  1AVM A;  1AIL A;  4DRX B;  2V4D A;  4WF2 A;  2DU7 A;  3D36 C;  1XOU A;  1QR8 A;  4LF4 O;  3PJS K;  1I5X A;  1IBL B;  1ORQ C;  5A9G A;  1Y74 B;  3IC9 A;  2UXX A;  4NYK A;  4YHH B;  2CH7 B;  1NTM H;  1GM8 A;  2OIG A;  4YRQ A;  2QM8 A;  4DUZ B;  4I0X A;  3MQZ A;  1NH2 D;  2F1M A;  4MTG A;  1YVW A;  4TUY A;  3L73 H;  3K03 A;  5EYP B;  4HWP A;  1X01 A;  2R9I A;  4PA9 A;  3ZIA G;  2LJ2 A;  1D5A A;  2ZKO A;  3RYH A;  4UP8 A;  2LGQ A;  4TSF G;  4RMF A;  2OIE A;  2EIL B;  4WFF A;  3ZCC A;  3V7S A;  1HNX O;  4O2A B;  1E1R G;  3ZRV A;  1OCO B;  2YI9 A;  3ETD A;  1RPO A;  4KUM A;  3RYC B;  4KP4 A;  4H2W A;  1XMO O;  1PM9 A;  5LOV A;  5LXT B;  3IC7 A;  4RDX A;  1MNG A;  4EO4 A;  4JTA B;  3ABM B;  4XDL A;  4W4L A;  3HFZ A;  2ZT7 A;  4YRM A;  2XT9 A;  3AK3 A;  4MTO A;  1L1F A;  1PP9 H;  3DXR B;  2KG7 B;  4PDL A;  5DN6 G;  4UCU A;  2F4V O;  2UXD B;  1RM1 C;  4IIJ A;  3JYC A;  3SYA A;  1PV0 A;  5H2F Z;  4FJC C;  3PN1 A;  2ZD9 A;  2VQE B;  2CAZ C;  1WJZ A;  2RCV A;  4JI3 O;  3ZMS A;  4LF4 B;  3RGB A;  2XAH A;  2QHS A;  1FD9 A;  1XRE A;  5E3I A;  5ELN A;  1S5J A;  3TXQ A;  5IY5 B;  1GRJ A;  3RYI B;  4AIL C;  5B1B B;  1VEW A;  3E83 A;  3CCQ V;  5FPO A;  3UFG A;  1FXH A;  3IAL A;  5K1X A;  1IUR A;  4ABM A;  3RIR A;  4P75 C;  3LNN A;  2E1H A;  4XTZ A;  1OCC C;  2KSD A;  5JH7 A;  1KP3 A;  1SQV H;  5EK0 A;  2M6Y A;  1EVL A;  2A8E A;  4ZHQ B;  4UB8 Z;  1L0W A;  1CPY A;  1U96 A;  2Z3Y A;  2YDE A;  1WQW A;  2YC0 A;  4JI4 O;  1XUQ A;  4DYL A;  3H1L H;  4K3A A;  4DO2 A;  2QHT A;  3BEH A;  1XMO B;  3FFQ A;  4EEQ A;  4JV5 O;  3RGL A;  3CD6 V;  4Z1M G;  3CEI A;  3JAR B;  3O9O A;  1SA0 A;  4DR6 O;  1WP8 A;  2YXL A;  4FIP C;  5E79 Z;  1I08 A;  4BWA A;  1CP9 A;  1JX9 A;  2DXT A;  2YIB A;  3OR6 C;  2P4V A;  3H1I H;  2E3C A;  3CE2 A;  3G67 A;  1XDC A;  2CJA A;  1SC5 B;  4FFB A;  2F4V B;  1ZLZ A;  3ABL B;  4O4I B;  3ZN1 A;  2HEP A;  1XMQ O;  5C8Y B;  3ICX A;  2I4N A;  3G71 V;  3JD3 A;  4PDM A;  2OTL V;  1NS1 A;  4CS2 A;  4DQ2 A;  3LSU A;  1XNQ O;  3R07 A;  2Y4U A;  4YY3 B;  5C51 B;  4KHP O;  3OUS A;  5B1A C;  4K86 A;  1PL0 A;  2A79 B;  4EX5 A;  1G4Y B;  5FL7 G;  1M90 W;  3LDE A;  2JRI A;  1QNM A;  2Y48 A;  1IX9 A;  2OCC B;  1NJ1 A;  3H01 A;  3SPC A;  1NVP D;  2XAS A;  1P49 A;  3RF1 A;  4JI4 B;  4MVO A;  2L6L A;  4P9P A;  2WLH A;  4JV5 B;  3K5O A;  2W6I G;  2WAM A;  4DR6 B;  1P7G A;  3WU2 Z;  2AKW A;  4TQD A;  1Z5W A;  3CX5 F;  4G84 A;  5JVD B;  2ALY A;  2DTI A;  1K73 W;  3UO2 A;  4JTC B;  2Q5I A;  4WFB V;  1ZTE A;  4ZOL B;  5H5N A;  1H38 A;  3KCX A;  3THO A;  1EZV H;  2PME A;  4UVC A;  1XMQ B;  1R6T A;  1EOV A;  3T1Y B;  2LO1 A;  3CWB H;  3HKC B;  2HVK C;  2EJ7 A;  4ZBM A;  1PPJ H;  1R3K C;  1EN6 A;  3FB7 C;  1XNQ B;  2YEV B;  3RVY A;  5LGN A;  1KMM A;  1Q86 W;  1CXZ B;  4KHP B;  2ZQM A;  1QVG U;  2HNI A;  1EN5 A;  5B3S B;  2FYK A;  2RHS A;  3BPZ A;  3ZHR A;  4ZIB A;  2FML A;  1Q81 W;  2HG5 C;  2ART A;  2HLD G;  4HWO A;  1Q43 A;  4KFM A;  2BTQ A;  2I4L A;  2CUG A;  3WQZ A;  5J2U B;  3ZHV A;  4ZKI A;  2JGU A;  5DEC A;  5LHH A;  1WN7 A;  1SZX A;  3HFV A;  4B3M O;  3L74 H;  4UVB A;  1X2G A;  2EIJ C;  2HJD A;  3BJU A;  2IW5 A;  3LSS A;  1V54 B;  2IM9 A;  1VQ5 V;  1E22 A;  2DTO A;  3G6E V;  3JAL B;  5D5P A;  3K9S A;  2Q0A A;  1GMG A;  5IJ0 A;  1NQT A;  2YIB D;  2ARS A;  3HXU A;  1EBO A;  3HB3 B;  2ZE5 A;  3CS5 A;  1K8A W;  1YSC A;  2HR3 A;  4XTU A;  4JI6 B;  1VQM V;  1X55 A;  2N04 A;  5IT9 N;  2AMC A;  4B3S O;  5BMV B;  5KHK A;  1SKV A;  4HWS A;  4UUJ C;  2YXY A;  3FD9 A;  4MW8 A;  4DV0 O;  1N36 O;  1E24 A;  4PJ0 Z;  3SJB C;  1BT8 A;  4G85 A;  3HXZ A;  1M56 C;  1FXK C;  2WLN A;  4NCX A;  1FFX B;  5IJ9 A;  4LBE C;  4H2S A;  1Y4M A;  4GKJ O;  2Q4P A;  4PA6 A;  2CIM A;  2RHQ B;  3G6B A;  4I50 A;  4LFB O;  5IWA O;  1TAE A;  3C3T A;  4TT3 G;  3MF2 A;  1NH2 B;  2EL9 A;  3CMQ A;  1AI6 A;  4JI7 O;  1G5H A;  2PY5 A;  1UPG A;  4TWA A;  1TUB A;  1X54 A;  2QM7 A;  5B1N A;  3W3S A;  2QKC A;  3CRR A;  4P2Z A;  4RQE A;  4GX1 A;  3JAS B;  4JYY A;  4B3M B;  4XEM A;  5KMG B;  4JYC A;  3OUF A;  1NR1 A;  4X20 A;  1UJW B;  2K9P A;  3MEY A;  4J9Y B;  2Y69 B;  4P3O A;  1QCE A;  1SRY A;  2CGO A;  4RUE A;  1FXK A;  5JQG A;  3J7A U;  3CRA A;  1Q3E A;  3K5N A;  1H8H G;  2RDC A;  3RKX A;  1HXD A;  2BTO A;  5DM6 V;  4ZI7 A;  3TGU H;  5KAI Z;  3F7Y C;  4GLX A;  2WLK A;  2VQF B;  5IYC O;  4TV8 B;  1GN4 A;  5GTI Z;  1AI5 A;  1X4T A;  1GM7 A;  3UGT A;  2DJZ A;  2PUS A;  4DV0 B;  3ETQ A;  1N36 B;  3N2K B;  2BSK A;  1BIB A;  5FNV B;  4YXW G;  2GUZ B;  1HC7 A;  1K3E A;  2ZZE A;  2LP7 A;  3P3P A;  2A7W A;  4QNH B;  4DV6 O;  4D7T A;  2QM4 A;  4GKJ B;  3P30 A;  5LMN B;  2DYS C;  4LFB B;  2ZR2 A;  1BSM A;  1HR0 B;  2WPD G;  5CN0 A;  5EIB D;  3OTO O;  3ASO B;  2EIK B;  1D5N A;  3FAV A;  3LDC A;  4R6Z A;  4JI7 B;  2H8P C;  3ABK C;  4DR2 O;  3OE7 G;  4U3J A;  3CXH F;  2X6C A;  1GK9 A;  3LDD A;  4YIP A;  3FB8 C;  1KQS U;  2J3M A;  3BFM A;  1WA8 A;  1E1Q G;  4P3P A;  2V1D A;  2DOS A;  2Z0A A;  2WLI A;  3TEH A;  4H33 A;  4I4T A;  3E2E A;  1NJ5 A;  4HWT A;  3R66 A;  1YHQ V;  5KA5 A;  4HWR A;  3VQV A;  1Y6X A;  3AG1 B;  4O2D A;  1VQ7 V;  1YTF D;  3Q4H B;  1ATI A;  1Z7N A;  2ZIO A;  4GUN A;  3J81 N;  2UUB O;  5J2T A;  4H37 A;  4LH7 A;  5KHJ A;  1BE3 H;  5LP6 A;  5L3C A;  2VS0 A;  2ZIN A;  4XU3 A;  1G6U A;  1NZ6 A;  2DDZ A;  3ZN0 A;  2EIN B;  1USY A;  1B3Q A;  3NEM A;  4X1Y B;  5BXZ A;  4X66 O;  5CA3 A;  1EM1 A;  4TVY A;  2QA4 V;  3K9A A;  2WLL A;  4J7K A;  2CE4 A;  4DXW A;  2XOK G;  1M57 C;  3R65 A;  1N4C A;  1NKD A;  3WG7 C;  2ETN A;  2GV9 A;  4KR2 A;  4CH4 A;  1K9M W;  4NKG B;  4HBN A;  11AS A;  1XNR B;  3OEH G;  3SR2 C;  5KHG A;  1V55 B;  1CEZ A;  1Y76 A;  4J11 A;  4YIO A;  1U97 A;  4DV6 B;  1MAB G;  1UFI A;  4KL1 A;  1GH6 A;  2UU9 O;  4TOI A;  1NYR A;  4YRK A;  3OT7 A;  2HP8 A;  2DWE C;  5EBM C;  2EBO A;  2QR4 A;  4I0X B;  4LF5 B;  5JWP A;  2YI8 A;  4LC1 A;  4TUY B;  3WB0 A;  1ZX3 A;  3JAT A;  4U3F H;  5KLV H;  4X64 O;  3X2Q B;  3DSQ A;  5F5W A;  4JGS A;  4X89 A;  3A74 A;  3RYH B;  2QTS A;  3M8A A;  3V8J A;  4YRS A;  3M4Q A;  1NVP B;  1WYD A;  4G28 B;  4J7J A;  4O2B A;  5CBH A;  2CDY A;  4JYA O;  3K04 A;  1I0H A;  3STZ C;  5LOV B;  4YRT A;  5IE9 A;  1XI1 A;  1OCZ B;  3T1C A;  4ASU G;  2UUB B;  3HKB A;  2EJF A;  4MW3 A;  3P8T A;  2GTA A;  4BR6 A;  3HFZ B;  4TTV A;  3AG3 B;  1G1X B;  1L0N H;  2BCC H;  4DW1 A;  3B8M A;  5L3B A;  1KD1 W;  3HRI A;  1N34 O;  2Q5H A;  4EFE A;  2P5O A;  3MF1 A;  4X66 B;  4NXM O;  2QWQ B;  4X5O A;  5LL6 Y;  1VQ9 V;  4IIJ B;  4CS4 A;  1RP3 B;  1N0J A;  3I7F A;  1DF5 A;  1P4R A;  1B70 B;  1S5L Z;  3ZHS A;  4IGG A;  4NR1 A;  1BZK A;  1YJW V;  1SQF A;  1FAF A;  1S0V A;  2H3O A;  4QE9 A;  1FS0 G;  2AGA A;  1XL6 A;  2Q5Z A;  3ZJZ A;  3HY1 A;  2PYL A;  1WP7 A;  2UU9 B;  2I4M A;  2BE3 A;  5EC1 C;  3W7T A;  4JI0 O;  4D6T H;  1G51 A;  3BCC H;  3B8N A;  1EIY A;  3OD4 A;  2XTI A;  4BIU A;  4FMT A;  2D2C B;  2E76 B;  3EHB B;  3FX7 A;  1THZ A;  4X64 B;  5LMU O;  1RM1 B;  3A2F A;  2DW4 A;  1I5Y A;  1B76 A;  2N74 A;  5JH7 B;  1FKA O;  4D7S A;  3OAA G;  3HTZ A;  1JJ2 U;  1OHH G;  2AZ0 A;  1J95 A;  1K97 A;  4HNA A;  2ZE8 A;  1YI2 V;  4JYA B;  2P0L A;  3D36 A;  1MZF A;  1SS3 A;  1BQZ A;  1YDX A;  1JCH A;  1K92 A;  1KYO F;  1SQG A;  1VAR A;  3ZMZ A;  4RWU A;  3T1H B;  2UUC O;  3P8Y A;  1JR9 A;  4R7C A;  2BOB C;  3KCY A;  4DR3 O;  2KQX A;  3A5Y A;  3E35 A;  2ZZF A;  3D3Q A;  4QPJ A;  2A9H A;  5GON A;  3N2G B;  2G4C A;  3A7A A;  3K5L A;  4FLV A;  1YFR A;  2UXC O;  3LNM B;  1VQK V;  1N34 B;  1SQX H;  5L3D A;  4R8C A;  4NXM B;  4FFB B;  3CSX A;  2EWN A;  2ZIM A;  4PA4 A;  5EZY A;  3MAQ A;  4O4H A;  5H9C A;  3AK1 A;  3UCS C;  3A5Z A;  3SYP A;  3K3W A;  4H02 A;  1MOF A;  3F5T A;  2YUA A;  3ZRS A;  3L70 H;  5CMU A;  2EJG A;  4H2V A;  4DV3 O;  1PL4 A;  3JCZ A;  3I5D A;  4YRF A;  4Z2W A;  1YB3 A;  3IAY A;  4JI0 B;  5LYJ A;  4WJ4 A;  2RN9 A;  3KFU A;  2AW9 A;  1QQC A;  4O4L A;  2ZT8 A;  1M1K W;  1LUW A;  2IU3 A;  3UT5 A;  4DK1 A;  2E41 A;  2ZT6 A;  2E64 A;  2EIL C;  1EQR A;  5LMU B;  4U7O A;  4K35 A;  3HKD A;  1OCO C;  3UQ8 A;  4XEO A;  4R50 A;  2X6B A;  5IYD O;  1SER A;  3JCU Z;  2ATK C;  3JAW A;  3WB1 A;  2LFR A;  1HNX B;  3ICA A;  4QGP A;  1GAX A;  2CH7 A;  3M99 B;  3ABM C;  1ZWI C;  2IY5 A;  3FYE B;  4YYE A;  1I7F A;  2UUC B;  2ZXW B;  3CRQ A;  1L0L H;  3G80 A;  2AKW B;  4BW5 A;  2LQT A;  2ALY B;  4UP9 A;  2UXC B;  4MVS A;  3OFN G;  1BL8 A;  4DR1 O;  1MMM A;  1F4N A;  3I55 V;  4RAI A;  4JI1 O;  4WBN B;  1W0J G;  5IDJ A;  2DYR B;  4P75 A;  3RAC A;  3I56 V;  3BA8 A;  1H4T A;  4J7Z A;  5JCO C;  4IYH A;  3J80 N;  5LXT A;  2LW1 A;  4JI3 B;  1B6Q A;  2CTP A;  5B1B C;  4GX2 A;  4DV3 B;  4GYC B;  2ZXF A;  4DR5 O;  4FLZ A;  2JGD A;  3OMN B;  2Y0P A;  3U11 A;  4UPA A;  4P3N A;  4MS2 A;  3AG2 B;  1XEQ A;  3JD0 A;  4X1K A;  2RHS B;  4L87 A;  3RWR D;  4XDJ A;  2QWN B;  4GX5 A;  1RIQ A;  3NEL A;  1GN2 A;  2BTQ B;  2Q7E A;  4WFE A;  3L2Z A;  3BHP A;  4UCO A;  2ODR C;  2QHV A;  5LBQ A;  3W7U A;  2N05 A;  2CGH A;  5JCO A;  2R72 A;  2QJ1 A;  3K0D A;  1R3L C;  1B7Y A;  2P6J A;  2PZS A;  3ABT A;  3BRC A;  4X1I A;  3JAM N;  5KAF Z;  1H4S A;  3HPL C;  1YTF B;  4LCU C;  5K1P A;  3CCE V;  2AHY A;  2ZT9 B;  2ZM6 O;  4PHZ A;  5IJ0 B;  2QHU A;  3H9V A;  1BCC H;  4ICG A;  1QVF U;  2ZGW A;  3ABL C;  4RQF A;  2ZE7 A;  1JFF A;  3JD2 A;  1F51 A;  4YCV A;  2X6A A;  5EBW C;  4AQY O;  3L1A A;  4N23 A;  2AMC B;  3VQX A;  3AG7 A;  4TVA A;  2FTK A;  1JJC A;  2EZP A;  4FPP A;  4B3R O;  2L35 A;  4DV7 O;  3RUX A;  3CB2 A;  1YF2 A;  2Q9L A;  3K79 A;  3A8T A;  4RUF A;  3JD1 A;  1M93 A; 
#chains in the Genus database with same CATH homology
 1JJO A;  3RFR A;  4DRX A;  3RKX A;  3JAK B;  1HXD A;  2BTO A;  2PYJ A;  4JI8 B;  1N33 B;  1B7Y B;  2C7I A;  1H2S B;  4ZI7 A;  4XU1 A;  4YRE A;  4DR5 B;  3PCO A;  5IJ9 B;  5ELO A;  5KHI A;  3EFS A;  4P71 A;  4LVI A;  3IG2 A;  1PYS B;  4X1I B;  4GLX A;  4B3T B;  2VQF B;  4I50 B;  1LYL A;  1J5E B;  2JVD A;  4TV8 B;  3BAA A;  1I94 B;  4LH6 A;  4GKK B;  4L8J A;  3LSQ A;  4K0K B;  1NJ6 A;  3VBB A;  1DGS A;  1X4T A;  3QNE A;  4PG3 A;  4UCV A;  4LVM A;  2YIA A;  3UGT A;  2DJZ A;  3A7U A;  1NT2 B;  1TUB B;  2F95 B;  2P22 C;  2PUS A;  4DV0 B;  3ETQ A;  1N36 B;  3N2K B;  2VWK A;  3EFR A;  2I4O A;  3V7C A;  4TV9 A;  5EYP A;  4DR3 B;  1BIB A;  5FNV B;  4P74 A;  4XU2 A;  4YPF A;  1HC7 A;  2ZZE A;  3HXW A;  4DR7 B;  1JFF B;  4DR4 B;  3E9H A;  2DEQ A;  1HNZ B;  1HTT A;  1X2H A;  4D7T A;  2QM4 A;  3E22 B;  1V9P A;  4CC6 A;  4X1Y A;  4GKJ B;  1XQ8 A;  5LMN B;  4E51 A;  3K57 A;  1KMN A;  3QF7 A;  4O2A A;  4X20 B;  4LFB B;  4TVA B;  4X65 B;  2ZR2 A;  4YRO A;  1HR0 B;  1JJC B;  3U10 A;  5EIB D;  1VQZ A;  3U0Z A;  5JQG B;  4JI2 B;  4HT4 A;  2Q7H A;  2XGT A;  5CA1 B;  2ZNI A;  1KU9 A;  4J15 A;  3RYC A;  4JI7 B;  4NXN B;  3QO8 A;  1X56 A;  1TGO A;  4P72 A;  2ZM6 B;  5JJN B;  4IHJ B;  4DRX B;  4U3J A;  2V4D A;  2DTH A;  4WF2 A;  2DU7 A;  2J3M A;  3BA9 A;  1O9H A;  1YFS A;  3BFM A;  2PGG A;  3M7M X;  2F66 C;  3N2G A;  4ZI7 B;  4P3P A;  3PCO B;  3TEH A;  2R9A A;  1IBL B;  4I4T A;  1NJ5 A;  4HWT A;  4AQY B;  1M4U A;  4HWR A;  4K8X A;  2DKG A;  3VQV A;  4YHH B;  4B3R B;  4O2D A;  4YRQ A;  4DUZ B;  3MQZ A;  1ATI A;  1Z7N A;  2ZIO A;  1QHT A;  2F1M A;  1B04 A;  3G1Z A;  2CJ9 A;  2PTM A;  4TUY A;  4WI1 A;  2ZR3 A;  4AH6 A;  4TV9 B;  4YCU A;  5EYP B;  4HWP A;  3ERR A;  1X01 A;  5J2T A;  4LH7 A;  5KHJ A;  4JI5 B;  5LP6 A;  1BIA A;  4ZTU B;  2ZIN A;  4XU3 A;  2E65 A;  1G6U A;  1D5A A;  3SJA C;  3RYH A;  4NVP A;  4DPG A;  1NJ8 A;  4UP8 A;  4O4J A;  4UFZ A;  2DDZ A;  4RMF A;  4YRL A;  4LVL A;  1USY A;  4YRG A;  3NEM A;  4X1Y B;  3HY0 A;  4PI2 A;  3V7S A;  1HW7 A;  4O2A B;  2ZTG A;  1IBM B;  4XTW A;  2DU5 A;  3RYI A;  2YI9 A;  1ASY A;  1SET A;  4TVY A;  1YEW A;  4YCW A;  3RYC B;  4H2W A;  3BAB A;  5LOV A;  5LXT B;  2GV9 A;  4RDX A;  4KR2 A;  1O9G A;  4U3J B;  4CH4 A;  4EO4 A;  4LVJ A;  2UUA B;  1WQ7 A;  1M5I A;  4PHC A;  4HBN A;  11AS A;  1XNR B;  3HFZ A;  3SR2 C;  5KHG A;  2ZT7 A;  1H4V B;  3TEH B;  4YRM A;  4I4T B;  4DV6 B;  4KL1 A;  4P73 C;  3RKY A;  2EAY A;  2F93 B;  4TOI A;  4DR1 B;  4ZHQ A;  1NYR A;  2ARU A;  4EB6 A;  2DQ3 A;  3NET A;  3REX A;  4JI1 B;  4YRK A;  3QG5 A;  4UCU A;  2UXD B;  1XHZ A;  4IIJ A;  4LFA B;  3RYF A;  4LF5 B;  2YI8 A;  3PN1 A;  4TUY B;  3WB0 A;  3M4P A;  3JAT A;  2VQE B;  2CAZ C;  1WNL A;  3JAR A;  5J2T B;  5LP6 B;  1SES A;  2DXU A;  3DSQ A;  4LF4 B;  5F5W A;  3WB2 A;  3RYH B;  2NS6 A;  3A74 A;  3RGB A;  3V8J A;  4O4J B;  4YRS A;  1XHX A;  5EIB C;  2QHS A;  1WU7 A;  5E3I A;  3M4Q A;  5ELN A;  4HVC A;  1S5J A;  1WYD A;  4HA8 A;  1KOG A;  4O2B A;  4WBN A;  3RYI B;  4AIL C;  4FLU A;  4O4I A;  4B3S B;  3V7R A;  5CA0 A;  5FPO A;  3UFG A;  5LOV B;  4YRT A;  5C8Y A;  1XI1 A;  4I9Q A;  3IAL A;  5JJE B;  1BBW A;  1ZAU A;  5K1X A;  2UUB B;  3HKB A;  2EJF A;  1Z5V A;  3VQW A;  3SGI A;  3P8T A;  4OLF A;  4P75 C;  3RIR A;  3OD1 A;  4ZTZ B;  4LFC B;  3LNN A;  3HFZ B;  2E1H A;  5ITZ A;  4TTV A;  1ASZ A;  4UCT A;  4XTZ A;  5JH7 A;  4K8Z A;  1EVL A;  3HRI A;  2A8E A;  2Q5H A;  3UH0 A;  4ZHQ B;  4EFE A;  2P5O A;  4EB6 B;  3MF1 A;  4X66 B;  1L0W A;  4X5O A;  1TVK A;  1WQW A;  4IIJ B;  4CS4 A;  4F6R A;  3RYF B;  5IWA B;  1G5I A;  3I7F A;  4TQF A;  1B70 B;  2DVE A;  2QHT A;  3A7R A;  1XMO B;  4LF9 B;  3FFQ A;  3JAT B;  4EEQ A;  4FM0 A;  3RGL A;  3JAR B;  1FJG B;  1SA0 A;  1Q5O A;  1SQF A;  2OWO A;  2DQ0 A;  4YJ3 A;  2YXL A;  4BWA A;  4YJ2 A;  1ADJ A;  3IKL A;  2DXT A;  2YIB A;  2PYL A;  3HY1 A;  2UU9 B;  4YRR A;  4DV5 B;  2I4M A;  2E3C A;  3QO7 A;  4O2B B;  1B8A A;  1G51 A;  2CJA A;  4FFB A;  2F4V B;  2RJZ A;  3ZED A;  4O4I B;  1EIY A;  2XTI A;  5CA0 B;  1L8D A;  2HEP A;  4DV7 B;  4FM2 A;  5C8Y B;  3ICX A;  2I4N A;  3HKB B;  3HKE A;  4LVK A;  4X64 B;  3K59 A;  3CHX A;  3A2F A;  3JSN A;  3V8K A;  4UCR A;  5ITZ B;  4CS2 A;  2KKW A;  4DQ2 A;  1B76 A;  5JH7 B;  4D7S A;  3R07 A;  1RSO A;  5JVD A;  4CC5 A;  3HTZ A;  4YY3 B;  2P5I A;  5C51 B;  5C53 B;  1YFT A;  1WPB A;  2UXB B;  4K86 A;  1BBU A;  4CH5 A;  1TVK B;  1ADY A;  4HNA A;  4ZOL A;  3K58 A;  4F6R B;  3FJP A;  4EX5 A;  4JYA B;  2R70 A;  2P0L A;  3E9I A;  1SQG A;  4LNU A;  3JSL A;  3T1H B;  4FM1 A;  3P8Y A;  3HXX A;  4KQE A;  1YGB A;  4FLT A;  2C8M A;  4YJ3 B;  1EVK A;  3HKC A;  3A5Y A;  4YJ2 B;  2ZZF A;  1NJ1 A;  2G4C A;  5GON A;  3N2G B;  4LF8 B;  3A7A A;  3K5L A;  4FLV A;  1YFR A;  1E1O A;  4H2U A;  4DV4 B;  1N34 B;  2DZ9 A;  3L4G A;  4NXM B;  4XTX A;  4FFB B;  3CSX A;  2OYQ A;  2ZIM A;  2EWN A;  1P49 A;  3RF1 A;  5EZY A;  3HXY A;  1EIY B;  3MAQ A;  4O4H A;  3OTO B;  4AHC A;  4JI4 B;  1IL2 A;  3A5Z A;  3QO5 A;  5FPR A;  4JV5 B;  3HKE B;  3K5O A;  4H02 A;  4DR6 B;  4YRC A;  2ZCE A;  2AKW A;  4DR2 B;  3REU A;  4TQD A;  4K88 A;  2EJG A;  4H2V A;  1Z5W A;  3RL6 A;  1QE0 A;  5J2U A;  3K5M A;  4G84 A;  5JVD B;  4CH3 A;  2ALY A;  4PI0 A;  4YRF A;  1YB3 A;  2DTI A;  4B08 A;  4FLW A;  2Q5I A;  1TA8 A;  5LA6 A;  1IBK B;  3IAY A;  4JI0 B;  1WPY A;  1T5E A;  4HNA B;  4ZOL B;  5LYJ A;  2ODR D;  4WJ4 A;  5CB4 A;  3KFU A;  1QQC A;  4O4L A;  3THO A;  4P74 C;  2ZT8 A;  3HRK A;  4OX9 B;  1NYQ A;  2PME A;  3A32 A;  4LNU B;  4CS3 A;  3LC0 A;  1XMQ B;  3UT5 A;  4XTY A;  4DK1 A;  2E41 A;  2ZT6 A;  1EOV A;  2E64 A;  3NEN A;  1Z7M A;  3JAL A;  3B2E E;  3T1Y B;  2CJB A;  4P73 A;  4TVW A;  4UCS A;  2VWJ A;  4IHJ A;  5LMU B;  1EQR A;  3HKC B;  5HGQ A;  3HKD A;  5GON B;  1NJ2 A;  3UQ8 A;  4H2X A;  1XNQ B;  4XEO A;  1SER A;  5D5Q A;  1KMM A;  3JAW A;  4KHP B;  3L4G B;  3WB1 A;  3RKW A;  4P72 C;  1HNX B;  3ICA A;  4FVM A;  5EZY B;  5BR8 B;  2HNI A;  4EFB A;  4O4H B;  2J3L A;  2FYK A;  2RHS A;  2IY5 A;  3BPZ A;  4YYE A;  4ZIB A;  1I7F A;  5BMV A;  4KR3 A;  2UUC B;  2RQ6 A;  2ART A;  3ZS8 C;  4HWO A;  1Q43 A;  1WLE A;  2AKW B;  2BTQ A;  3IKM B;  1JMK C;  4Q6G A;  5JJJ B;  2I4L A;  4YRI A;  5C52 B;  3WQZ A;  4CH6 A;  5J2U B;  5KX5 A;  2ALY B;  4UP9 A;  4WJ3 M;  4YDQ A;  1H4Q A;  4XU0 A;  2UXC B;  2JGU A;  2XHB A;  1WN7 A;  5LA6 B;  3HFV A;  3P8V A;  4YP0 A;  1FFX A;  5LYJ B;  4DV1 B;  1EFW A;  5CB4 B;  2Q7G A;  1X2G A;  4O4L B;  4WBN B;  4YRP A;  3BJU A;  2RHQ A;  4P75 A;  5LP6 C;  4I55 A;  4DK0 A;  1N9W A;  3LSS A;  1W66 A;  4YRJ A;  2IM9 A;  2ZZG A;  1WNS A;  3UT5 B;  1E22 A;  2DTO A;  3BA8 A;  1H4T A;  3RAC A;  5JCO C;  3UGQ A;  5KHH A;  3JAL B;  5D5P A;  1USY C;  1J5W A;  3PZC A;  4XTV A;  5LXT A;  2Q0A A;  4LR3 A;  4OP0 A;  4JI3 B;  3HKD B;  2HHH B;  1HNW B;  5IJ0 A;  5IYZ A;  4DV3 B;  4H2X B;  2YIB D;  2ARS A;  4GYC B;  4DV2 B;  2ZXF A;  3V8L A;  3JAW B;  2JS5 A;  3HXU A;  4K87 A;  3JAS A;  4FLZ A;  1VF7 A;  5KMG A;  4XTU A;  4JI6 B;  3U11 A;  1X55 A;  4UPA A;  4P3N A;  3OTF A;  4X1K A;  2RHS B;  2AMC A;  4H2Y A;  2IY5 B;  5BMV B;  3RWR D;  5KHK A;  1SKV A;  4HWS A;  1RIQ A;  1E1T A;  3NEL A;  3VQY A;  3TEG A;  1SA0 B;  2BTQ B;  2Q7E A;  1E24 A;  3L2Z A;  3BHP A;  4UCO A;  3SJB C;  5KNN A;  2ODR C;  5KX5 B;  2QHV A;  4G85 A;  2CGH A;  3SJC C;  3JAK A;  3HXZ A;  2R72 A;  5JCO A;  2QJ1 A;  3A31 A;  1B7Y A;  2E5L B;  4LF6 B;  2DZC A;  4NCX A;  1FFX B;  5IJ9 A;  1KMI Z;  1NNH A;  2PZS A;  4H2T A;  1C0A A;  4H2S A;  1PYS A;  3BRC A;  4X1I A;  2CIM A;  2RHQ B;  4I55 B;  4I50 A;  4TV8 A;  1TAE A;  3TUP A;  4BW9 A;  1H4S A;  12AS A;  1FYF A;  3MF2 A;  5K1P A;  2EL9 A;  3CMQ A;  1QF6 A;  1G5H A;  2PY5 A;  4P71 C;  4TWA A;  1TUB A;  1X54 A;  4PHZ A;  3N2K A;  2EX3 A;  5IJ0 B;  2QHU A;  3W3S A;  5IYZ B;  2E5A A;  5FNV A;  2ZGW A;  1GGM A;  4RQF A;  3HXV A;  1JFF A;  3JAS B;  4X62 B;  4B3M B;  4LNS A;  4XEM A;  4RQE A;  5KMG B;  4YRN A;  4YCV A;  3E22 A;  2ZT5 A;  2E10 A;  4Q15 A;  3L1A A;  4X1K B;  1N32 B;  2EJ9 A;  2AMC B;  4X20 A;  3VQX A;  4FLY A;  4TVA A;  2PMF A;  4P3O A;  3MEY A;  2ZNJ A;  1Q8I A;  1JJC A;  4DUY B;  1SRY A;  4FLX A;  5JQG A;  1B70 A;  4LF7 B;  3RUX A;  1Q3E A;  3CB2 A;  5CA1 A;  4UP7 A;  3K5N A;  4L87 A;  3QTC A;  1M93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...