2ZNJA

Crystal structure of pyrrolysyl-trna synthetase from desulfitobacterium hafniense
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
278
structure length
278
Chain Sequence
SSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolysyl-tRNA synthetase-tRNA(Pyl) structure reveals the molecular basis of orthogonality
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase
molecule keywords Putative uncharacterized protein
total genus 79
structure length 278
sequence length 278
chains with identical sequence B, C
ec nomenclature ec 6.1.1.26: Pyrrolysine--tRNA(Pyl) ligase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2znjA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2znjA02
3A32A 3MF1A 2CJ9A 3EFRA 4WJ4A 3TUPA 4YRCA 4WF2A 3HXVA 5HGQA 1GGMA 4H2XA 4CH4A 4P71C 1WQ7A 4TQDA 1NJ6A 3RIRA 3KFUA 2AMCB 2RQ6A 2RHSB 2DJZA 4CH6A 1EVLA 1E1OA 2DTHA 4H2WA 4YP0A 11ASA 3A7UA 1LYLA 4P73C 4NCXA 4KR2A 1WLEA 3I7FA 3RKYA 3M4QA 3A7AA 1BBUA 1NJ1A 1H4SA 2E1HA 2ZINA 2DKGA 3TEHA 2DTIA 2ZR3A 2DU7A 3HY0A 4YRJA 3L1AA 3WQZA 4O2DA 3QO5A 3LC0A 4Q6GA 2DTOA 3HY1A 1BBWA 2I4LA 2IY5A 4HVCA 2EWNA 4P73A 5ELNA 3A74A 4BW9A 3V7RA 1JJCA 2HEPA 4YRMA 4WJ3M 1BIBA 4XTUA 2E65A 1NYQA 2DQ3A 2ZT6A 4YCWA 1H4QA 3HFZB 4LNSA 4EO4A 4YRRA 4RQEA 4G85A 5E3IA 2R72A 1G5HA 1YGBA 1WU7A 4HWSA 1HXDA 4P75C 3PCOA 3BFMA 1H4TA 2ZZEA 3V7SA 1EIYA 1QF6A 4YRIA 4RMFA 3V8LA 3L2ZA 1NNHA 4J15A 2I4NA 3QO8A 3NENA 2XTIA 3ZEDA 4X5OA 3MEYA 3UH0A 1L0WA 2Q5HA 2IY5B 5K1PA 3L4GA 1HTTA 4BWAA 3HTZA 3UGTA 4XU2A 3PCOB 4ZTUB 1X56A 2EAYA 4HWOA 1G5IA 2ZNJA 4UP7A 1KMNA 2ZGWA 4YRSA 2ODRC 1NJ8A 1JJCB 2E64A 1NJ5A 2CJBA 4YRTA 4KR3A 4P74C 2ARTA 3RF1A 3QO7A 4RDXA 2J3MA 3P8YA 3E9HA 3BJUA 1ASZA 4YRPA 4XTVA 3RUXA 2ZT5A 1EOVA 3W3SA 4UP9A 4YRFA 4TQFA 3REUA 3VQYA 2QHTA 2DZCA 1HC7A 2YIBA 5C53B 1B7YB 2E10A 2ZCEA 3A7RA 1EIYB 1KOGA 4CS2A 4XU1A 1O9GA 3M4PA 3CMQA 2CIMA 2E3CA 4HWPA 3HRKA 4YYEA 3RKXA 2EJFA 3NETA 1X2HA 2EJ9A 1USYA 2DU5A 1NYRA 2ZR2A 4H2UA 1FYFA 2P5IA 3MF2A 3VQXA 3EFSA 3G1ZA 3UFGA 1X54A 1O9HA 1J5WA 3NELA 4TVAA 4YRKA 2E5AA 3IKLA 3P8TA 4UP8A 1C0AA 3HXYA 1E1TA 3RKWA 3FJPA 1G51A 2QHUA 2RHQB 2AKWA 3V8JA 2ALYB 4P74A 2YI8A 1USYC 3RACA 2I4OA 4CS4A 2RHSA 2FYKA 4XTXA 2DZ9A 2DDZA 4YDQA 4DPGA 3IALA 2ZTGA 4XEOA 2R70A 3VQVA 1SERA 1YFTA 3VQWA 3TEGA 3QTCA 2DEQA 3LSSA 5ELOA 4YROA 3HXWA 2G4CA 2ODRD 3REXA 2PMEA 4OLFA 1YFRA 4TTVA 1EFWA 2Q7EA 3VBBA 3BHPA 1X2GA 4ZIBA 4WI1A 1EQRA 3R07A 1B76A 4YRLA 2I4MA 2J3LA 4P72C 4CS3A 1WQWA 4P75A 4UPAA 3DSQA 2DVEA 1EVKA 1KMMA 4XU0A 3QNEA 4G84A 2DXTA 1WYDA 4HA8A 1SRYA 4EX5A 1ASYA 1W66A 3A5YA 2Q5IA 1SETA 1VQZA 2E41A 4XTZA 4XU3A 2JVDA 2QHSA 4YRNA 1BIAA 1YB3A 2C8MA 3IG2A 4H02A 4AH6A 5C51B 4TVYA 1WNLA 4K87A 2EL9A 2RHQA 3V8KA 3HXXA 1QE0A 3RGLA 4K86A 3NEMA 4RQFA 1B70B 2EJGA 1E22A 1RIQA 3ICAA 12ASA 3IKMB 2PMFA 2Q7GA 4H2VA 4E51A 2YI9A 4K88A 4PHCA 2ZZGA 2AMCA 4TVWA 4H2YA 4HWTA 4CH3A 4DQ2A 3UGQA 4KQEA 3HXUA 4CH5A 4HWRA 3PZCA 4H2TA 4H2XB 4YREA 1Z7MA 2DQ0A 4XEMA 1ATIA 4PG3A 1Z7NA 3V7CA 2Q7HA 2CJAA 2RJZA 4YCUA 2ZXFA 3HFZA 4P72A 2ARUA 1H4VB 3E9IA 2YIAA 4YCVA 1IL2A 2PGGA 1X01A 1B8AA 2PUSA 1ADJA 4H2SA 1B7YA 4ZTZB 4YPFA 3A31A 5KNNA 5K1XA 1YFSA 2CGHA 3HFVA 1B70A 2ALYA 4P3NA 3P8VA 4P71A 2QHVA 2YIBD 2AKWB 2ZIOA 1ADYA 1WPYA 4XTYA 4TWAA 3TEHB 1N9WA 3LSQA 4P3PA 2C7IA 3HRIA 4OP0A 3OD1A 2ZZFA 4YRGA 3ERRA 2ZT7A 2DXUA 4TVAB 3HXZA 4XTWA 3A5ZA 2HNIA 4L87A 4Q15A 1X55A 2P0LA 3RL6A 3L4GB 1G6UA 2ZNIA 1PYSB 5C52B 1NJ2A 4YRQA 5F5WA 2ZT8A 2ZIMA 2XGTA 2ARSA 1SESA 1PYSA 1E24A 2QJ1A 4P3OA
chains in the Genus database with same CATH superfamily
4LFAO 2E76B 1NVPD 1BQ0A 2FB5A 3EFRA 2FKXA 5JH7B 5LHHA 1BHBA 3P3NA 5L3EA 1FYJA 3RYFA 4YRCA 3HXVA 2CH7A 5EC2C 3RYIB 4H2XA 5LGUA 4AQYB 4MTXA 2FTKA 4KHPO 4CBCA 1OHHG 1QNMA 4UUJC 3ZMUA 3CYOA 2RHSB 2DJZA 2R9RB 5JVDB 5J2UB 1D2DA 1K92A 3A8TA 3F5TA 1P49A 2AGAA 1WLEA 3M4QA 4FLYA 1ZUQA 2YIDA 4H33A 3A0HZ 4UCTA 5B3SC 1AJQA 3CJHB 3TEHA 2DTIA 3FX7A 2DU7A 3HY0A 1AI5A 4PDRA 3WQZA 4HNAB 3QO5A 4JAUA 5IJ0A 3HY1A 1BBWA 2I4LA 3L74H 3RFRA 3ZMZA 3ASNC 5ELNA 4BW9A 5KMGA 1XUQA 3N27A 4WJ3M 2QWPB 1DTOA 1FFTB 1MA1A 1NYQA 1P7BA 2DQ3A 4EKWA 3HFZB 4LNSA 1P84F 4EO4A 2LJ2A 1MG1A 3ZCCA 5E3IA 1JVMA 2XAJA 5EZYB 1S5JA 2CAZC 1JJ2U 1ORQC 1MZEA 3ZHSA 3OMAB 5KHHA 2EILB 5L3DA 1VEWA 2V1DA 3BFMA 3ZRWB 3K59A 4ZOLB 1H4TA 2ZZEA 2Z0AA 2GV9A 3V7SA 4H0LB 4TUYB 4X9QA 2WLIB 2N04A 4NXNB 2QM7A 4PDMA 4J15A 5H6QA 2BSKA 4LF4O 3NENA 1B04A 2DN9A 2HJFC 3JD1A 2Q5HA 4G28B 3UCSC 2IY5B 3L4GA 1HTTA 4JI2B 4QJFB 4F4LA 4DW1A 1P7GA 4FPPA 4LNUB 3E83A 2NN4A 3HKDA 4ZTUB 3MHSC 2EAYA 1GN3A 2ZXWB 1MMMA 4NTXA 1G5IA 2Y48A 4U3JA 3CCJV 2ZNJA 4J7ZA 4ABMA 2C2AA 3B4SA 4X89A 4YRSA 1W0KG 1G4YB 2B1GA 4UCRA 2E5LB 4DR3B 3UO2A 4FLTA 4DUZO 1UFIA 1VQ5V 3R65A 1H2LA 4P74C 4QE7A 1IURA 3P8YA 2R9AA 3E9HA 3BJUA 4PV1B 3RUXA 1WP7A 3H1HH 3K9AA 2JGDA 1EOVA 4YRFA 3ASOB 4TQFA 2A8EA 1TVKA 1QCEA 2EULA 3LUTB 3JALB 2MW2B 1BCCH 2QHTA 3K5NA 3SGIA 1RM1C 2R9IA 2YIBA 5C53B 5KAIZ 4FLXA 1WA8B 3OTOB 2F23A 1E1RG 4DV7B 1KOGA 3BCCH 4JI8B 2PYLA 3CEIA 3CMQA 4QPJA 4X1IA 2Z3YA 5EK0A 4L8JA 2F93B 1P4RA 4J42A 3JATB 2XT9A 2ZE8A 5KX5B 3RKXA 1I08A 2DU5A 2DYSB 4HBNA 3RVZA 3MF2A 3G1ZA 5CA0B 2F66C 1L0NH 4BW5A 1M1KW 1OCRC 4TVAA 1NTZH 2F43G 2QWQB 4RWUA 4H37A 1QLEC 4KUMA 2OYQA 1C0AA 4X20A 5H9CA 4MS2A 1ROPA 4B3MB 2PY5A 1DGSA 3E86A 1G51A 3T1HO 1HNXO 4DR7B 1RPOA 2VWKA 1TUBA 1OCZB 3LDDA 3JAWB 3JSNA 3RACA 3Q4HB 1VQOV 2I4OA 3KZIZ 1YF2A 1GM9A 1WAZA 3M8AA 5CB4B 2DDZA 2KG7A 2P5OA 1R6KA 1COWG 2ZTGA 2FYUH 1BHAA 3VQVA 3D8CA 1Y66A 4WBNA 1K4CC 3C3TA 3E22A 2DEQA 3ZHVA 3HXWA 2G4CA 1AP6A 4HZ3A 4KP4A 1R3KC 5JJEB 1IXMA 1BL8A 1YFRA 1YDXA 3BHPA 2VQFB 2BTQB 1MOFA 3ZN0A 2WLJA 4W4LA 1F51A 4JI0B 1SS3A 3AG3B 4JYBA 3R07A 4DR1O 4H44B 3AG7A 3OMIB 4I0XA 1YZBA 1H8EG 1NQTA 4DR7O 1EFRG 1XL4A 4P75A 4UPAA 3ZHRA 2DVEA 1VF6A 2OCCC 4LFAB 1Y67A 5LOVA 2X0LA 1VIBA 1FXHA 1KKCA 1SRYA 1ZTEA 4GX1A 3RYHA 1K97A 3A5YA 2A7WA 2UU9B 4JI6B 2E41A 4XTZA 5H2FZ 4GX0A 4P9OA 3SPGA 1B06A 2JS3A 2V4DA 2G38A 4KHPB 5FNVB 3E2EA 3IG2A 1HNZO 2HG5C 1NH2D 2QKSA 5BZBA 1R3IC 2ZDIC 4QNHB 4OX9B 3CX5F 3HXXA 3ETQA 2ADQB 4DR4O 2W0XA 4FM0A 1KQSU 1XILA 3ABUA 1QE0A 3DC6A 1NU1H 1IBMB 2ODMA 1PL4A 4K86A 4RQFA 3IKMB 1FKAO 1PKXA 2P22C 12ASA 1XREA 5BMVB 4K88A 5J2TA 2Y4TA 4W4KA 4TSFG 2AMCA 3W7UA 4TVWA 4H2YA 4CH3A 2NLJC 4K0KB 2ZM6O 5DN6G 2WLLA 3HXUA 5E1AC 3T1CA 4X62O 1S77D 2DQ0A 1K8AW 4XEMA 4D7SA 2OIEA 4DK0A 1ATIA 4PG3A 1GKFA 1Z7NA 3V7CA 2Q7HA 3UT5A 1S72V 2VQEB 4GKKB 4P72A 3CCUV 1IL2A 2PGGA 3N2GB 2XTAA 3K9SA 4YJ3B 1XQ8A 2PUSA 3JAKB 4NXNO 3EFFK 3AG4C 3ZHQA 1OCOC 4IHJA 4FM1A 2EIJB 2HHHB 4NKGB 2GTAA 2CGHA 4TV8B 1B70A 4P3NA 4O4JA 1FJGO 3P8VA 4P71A 5JQGA 2QHVA 1YITV 2AKWB 1XHZA 2JGDB 3MAQA 5KHGA 5F2VO 3LSQA 2F95B 2Q8VA 5IJ9B 2C7IA 4F6RA 1SF9A 1K73W 3EVKA 2ZZFA 3WG7B 3ETEA 3ZN1A 5EBLC 4FIPC 2DXUA 1YEWA 2W6IG 1J5EO 4JZ2A 1AJPA 1VP7A 2GDSA 1CP9A 3HXZA 1SA0B 1H8HG 3ZS8C 4PI2A 2IJIA 4FJCC 4PD4F 4X1KB 2HNIA 2DYRC 1YTFD 3ABMC 5IYZA 1NKDA 2W6JG 4K35A 4Q15A 4JASA 1OCRB 1Z5VA 4O4HA 5H6RA 3D3QA 3SJBC 5JQGB 3RT3C 4B3SB 2ZNIA 4YIPA 1R1BA 2Z5UA 2X6AA 4DR2B 3TJTA 4PA7A 5F5WA 4TV9B 2AHYA 1XMOB 2ZQMA 3JAKA 4JI3B 2BSKB 5CMUA 2ARSA 2OTJV 2IBZH 5LMUB 4DV6O 3A2FA 3MF1A 2RMKB 3TCUA 1LR1A 1KB9F 4DV0B 3JCZA 2UXBO 5HGQA 3D36C 3FAVA 1WQ7A 3RIRA 4IYHA 1FPOA 1S5LZ 1JR9A 3HKBB 1WPXA 3PN1A 5JJJB 2AMCB 2RQ6A 5KMGB 1Q81W 3BPZA 11ASA 2WSSG 2EZPA 5KA5A 4FVMA 2HP8A 1LYLA 1NTKH 1DF4A 4NCXA 1AI7A 1FFXA 4K8ZA 4GKJB 4P73C 2XAHA 3ZMSA 1BBUA 4MTFA 3RN4A 2E1HA 1UPGA 3FFQA 3ASNB 4BIZA 4B08A 2Q73A 1VMGA 1M57C 3L1AA 3GWKC 1XMOO 5AG2A 3P3PA 1KUQA 4Q6GA 2DTOA 4D7TA 2EINB 4WFFA 5IYCO 1IXBA 3V7RA 2PF4E 1JJCA 2HJDA 1YHQV 5B1OA 1V55C 1R3JC 2KSDA 2QKCA 2XNDG 3CXCU 1AP5A 3NXSA 4J11A 3M99B 1OV9A 1FXKB 5GONB 1H4QA 2QDOA 2EZOA 4N23A 4YRRA 2CK3G 3RYHB 1YGBA 1Y74A 1F4MA 5LP6C 4HWSA 1YCIA 5FL7G 1Y74B 4F6EA 4IT5A 4KL1A 1FXKA 3TK1A 3G6EV 1G1XB 1EIYA 1QF6A 4YRIA 4RMFA 5LMNO 1H2KA 2DYRB 4DV2B 1H2SB 1GN2A 2Q69A 3ZEDA 1I0HA 5HFMA 4D6TH 1AJNA 2P4KA 3F5WC 3E8FA 4P2ZA 3UGTA 4N21A 2EIMC 2DWEC 3DGEA 4MT8A 1NJIW 3J80N 3E22B 1JFFB 1NI8A 4X66O 2JS5A 4JI8O 4UP7A 4DV5B 4YHHO 2Y0PA 5D5QA 3W7SA 4I9WA 2KG7B 4LF4B 2HKOA 4B3SO 1JJCB 5B3SB 1NJ5A 4O4LB 3ZMVA 4YRTA 3GWOA 1XNRO 3SYOA 2CTRA 4YXWG 3ZHUA 3RF1A 3HKCA 3HKEA 4DR6O 3ZX6A 3OGIB 1SC5B 4RDXA 4UCSA 3B8MA 1ASZA 2EIKB 4XTVA 4DV6B 5E79Z 1Q6IA 4DW0A 3REUA 5L3CA 1M56B 1QLNA 2QWRB 2ILMA 3CC2V 1Q7YW 4GZRB 2D3OW 4DR1B 1GK9A 4TV9A 3CCRV 2B5UA 1RP3B 1L0LH 1YVWA 3N2KB 1W59A 3A7RA 5HFLA 2ZE7A 4CS2A 4XU1A 4MVOA 4WFGA 1QBZA 4DV1B 2UUBB 2HVKC 5BR8O 1H38A 3MHHC 1WJZA 4YHHB 4E2LA 3LNMB 5B1AB 5BXZA 4B3MO 1Q43A 2W0FC 3G80A 2EJFA 5L3GA 1NYRA 4GX5A 4DK1A 4H2UA 2YXYA 1FYFA 3UO3A 3QG5A 4G2KA 3IAYA 4I55B 3EFSA 4XDLA 2UUAB 3FKSG 4B3TB 1O9HA 3CP1A 2UUAO 1Q6UA 3FB5C 5JWPA 1J5WA 4YRKA 1Z5WA 1IVSA 3BA9A 2AXTZ 3OR6C 3CB2A 3E8BA 3ZRVA 1BQZA 5LA6B 3DXRA 2IH1C 1E1TA 1AB3A 4IGGA 4XBFA 1GN4A 2OWOA 2WAMA 2LGWA 3CCVV 4J7KA 2AKWA 3DXRB 3CXHF 2IW5A 2IJJA 5IE9A 4P74A 2OCCB 4WFEA 5LHIA 3CRRA 2AZ2A 3OTFA 1SQBH 2XOKG 2HVJC 4CS4A 2FYKA 1HP8A 4I7ZB 4JTAB 4KFMA 2YUAA 3OR7C 4MVUA 3RGBA 2JK5C 4MW3A 4JYAO 2CGOA 3OD4A 4EB6B 3WB2A 1NVPB 2VQEO 4UFZA 4X88A 3STLC 1FS0G 3TEGA 3QTCA 1TAEA 2YSUB 1QVFU 1OCCB 3SJQC 4WFBV 1F23A 4HT4A 2ITCC 4TV8A 4UB8Z 2PMEA 2WA4A 2QR4A 1X2GA 2EBOA 5LBQA 3CWBH 1SQXH 1B76A 3AK3A 2I4MA 3BY6A 3OGCC 1RPRA 3JSLA 2J3LA 1MABG 3OUSA 4ZOLA 2A9HA 1OCZC 2DMXA 1KMMA 4XU0A 2IU0A 4MVQA 3OMNB 4HA8A 4X65O 1I5XA 1GH6A 3HKEB 5CN0A 1VARA 3K79A 2VQFO 4JYAB 4XU3A 3CCEV 1TUEB 4FM2A 4JI0O 3PJSK 4GX2A 1QLEB 2X6BA 4GKKO 4UCUA 4TVYA 1N36O 3ZJZA 3ABKB 4K87A 2YS8A 5C93A 3K03A 4JZGA 2JJ2G 1AR1B 4RUFA 1JFFA 3ABLC 5LOVB 5KLVH 2WA3A 1I7FA 4LH7A 2EJGA 1E22A 4J41A 2PMFA 4U7NA 2UUCO 4AHCA 2NR5A 1N8RW 4E51A 4NXMB 1QVGU 5EIBC 3F7VC 3OTOO 2D2CB 2ZD9A 4RO2A 5D5PA 4Z1MG 4X64O 5CBHA 3WB0A 4HWTA 4B3TO 1L8DA 2Q9LA 4LVMA 4HWRA 3PZCA 4OPHA 4H2XB 4YREA 1Z7MA 3RYFB 5JH7A 1WPBA 3EXAA 4LFCO 1VQ8V 1IBMO 1V54B 2QM8A 5EBMC 2E75B 3CCQV 1U96A 5LGTA 4GLXA 4I0XB 4UVBA 1R6TA 2ARUA 3E9IA 2YIAA 4YCVA 3GVMA 3JAMN 1N36B 2OTLV 1B8AA 3BFRA 5LMNB 4H2SA 1XDCA 1IBKB 1B7YA 1CEZA 1E1QG 3AG1C 4ZI7A 4LCUC 3P32A 2IU3A 2AW9A 1KU9A 1XHXA 3JD0A 4JYYA 3J81N 1KP3A 4XTYA 4TWAA 1XMQB 1N9WA 3J7AU 1NR1A 4JGSA 2L35A 2H3OA 2VRZA 1XI1A 4YY3B 4BAYA 3ML0A 1KMIZ 4TVAB 1US6A 3Q4HA 3T1YB 1S3JA 3CS5A 4XTWA 1ZAUA 1HNXB 1B6QA 2LQTA 3A5ZA 4ZBMA 1F7YA 2ADPA 1EN4A 2JEXA 4L87A 3K04A 1URFA 4ZKIA 3CRMA 5FPOA 1XEQA 2ARHA 4LVJA 1FFXB 1A32A 2BOCC 3APQA 5B1BB 1EN5A 3RW0A 1NJ2A 1WA8A 1Q90D 1ZL8A 3HKBA 4EFEA 4QIWF 1K4DC 1JX9A 2ZT8A 2ZIMA 3MDSA 3X2QB 1N34B 3L70H 4G27B 2DW4A 4LVIA 5KHIA 4DV5O 3X2QC 3FD9A 3TXQA 2EIMB 2OT5A 3U11A 4WJ4A 3VOUA 1VQ9V 3RVYA 3SJCC 1XNQB 3L9DA 2WLNA 4EB6A 1VF5B 4CH4A 1D5AA 4TQDA 1NJ6A 3ETDA 3KFUA 1IBLO 4K8XA 1XOUA 4UV8A 2QEXV 1M9NA 2JGUA 2YICA 3UKMA 4CH6A 4BIOA 1E1OA 3O65A 5GTIZ 2Q68A 3E35A 2RN9A 4RAIA 1QR9A 3LNNA 4C7UA 3I7FA 3RKYA 4PJ0Z 3A7AA 3E8HA 4LF9O 5IJ9A 4O4HB 1JA8A 1H4SA 1VQPV 2DKGA 1OJHA 5IYZB 2IJHA 4UVAA 2EJ7A 1JPXA 4K3AA 4MTGA 4DYLA 3LC0A 2IY5A 4FFBA 2A06H 4PA3A 2HEPA 1BIBA 4XTUA 4YJ3A 2E65A 2UU9O 1FXVA 2K9PA 2WLIA 2JJ1G 4YCWA 4J10A 3T4DA 1X4TA 2JEUA 5LYJB 4JYCA 4G85A 1G5HA 3AG2C 2ITDC 1KC8W 1HR0O 4GYCB 4FLUA 2EX3A 1Y4MA 3BRCA 1HR0B 4LF6B 1WB7A 3JASB 1GO3F 3SPJA 4A5UB 2Q0AA 2LO1A 3L2ZA 3K0DA 4BR6A 2CDYA 2XTIA 2IJKA 1YSCA 3HB3B 4X5OA 2QKAA 5KUMA 4TUYA 5BY1A 1NH2B 3OW2U 3LDCA 4NYKA 3K57A 4BWAA 5B66Z 4HNAA 4LVKA 3FYEB 4FZ1A 1TA8A 2H8PC 1EZVH 4HWOA 4LF5B 1GTOA 3CC7V 2FMLA 4LFBO 3CRAA 3C3SA 4GUNA 3G67A 2ZGWA 3JD3A 5KAFZ 2WLLB 4LP8A 1EM1A 4JF3A 2CTQA 1VF6C 4O4LA 4DV2O 3CHXA 3K5LA 3ABLB 2CE4A 2QWNB 2CJBA 1Q8IA 5IJ0B 2DJVA 2AZ0A 3AK2A 3T1HB 2ARTA 3G6BA 2QTSA 2J3MA 2CH7B 3ABMB 3SPHA 4DV3B 4WF9V 5IY5B 4R8CA 2XAFA 1DLBA 2P4VA 4WFAV 1ZLZA 3IJ4A 1M90W 3W3SA 4X62B 4UP9A 4FFKA 2ETNA 3AEIA 4Q20A 4ZI7B 1BT8A 1HC7A 4JI3O 4J9YB 4NXMO 1DF5A 1NBMG 2GHYA 3L73H 2E10A 3H1IH 1FAFA 1AROP 1EIYB 4JI4B 2M7WA 3M4PA 2CIMA 2E3CA 1PP9H 3OFNG 4IIJB 1NR7A 4MVMA 2HHHO 1X2HA 4J80A 5GONA 2ZR2A 1THZA 2P5IA 4PDVA 2L6LA 3VQXA 3UFGA 2KKWA 5TISZ 5CB4A 1GM7A 4UV9A 1HW7A 2EJRA 3IKLA 2N74A 4P9PA 4UXNA 3T2MA 1G8MA 1VQLV 2UXBB 3OEEG 3HXYA 3LSUA 4AQYO 2IM9A 4U3FH 4B7KA 4I4TB 1OZ0A 2QHUA 3H1LH 2RHQB 3FYIB 3MD0A 5LHGA 4MTOA 1VQKV 1N33O 3V8JA 2PYJA 1R3LC 2YI8A 1PL0A 3OEHG 5B1BC 3T4ZA 1USYC 2BTOA 5JCOA 4O2BB 1LUVA 4XTXA 3SYCA 1TUBB 4DPGA 4JV5B 3FAVB 2NS6A 4PELA 4XEOA 1SQFA 2UXCO 1SERA 4TOIA 3SYPA 2UXCB 1YFTA 3FB8C 4LWSB 4NVPA 3IGAC 1N4CA 3JARB 4GKJO 1X59A 1DK1A 4X1IB 2Q4PA 1GAXA 3OE7G 3W7TA 3REXA 4K0KO 4TTVA 1UJWB 3G4SV 4B7EA 1OCCC 3P30A 4JI1B 4O2AA 4ZIBA 4WI1A 1EQRA 4MVRA 5CA0A 1EBOA 4YRLA 2UXDB 2DE0X 1TVKB 3K58A 4P72C 4DV4O 1WQWA 1PNKA 2P6JA 1W0JG 1EVKA 1SQPH 3H1JH 3ICXA 3JATA 3KCXA 4G84A 2YEVA 3RWRD 4DV3O 2RDCA 1PV0A 1ASYA 4X1KA 2ZDIA 2X6CA 1W66A 1M56C 2Q5IA 1SA0A 3SYQA 3S3XA 4JI7B 2EIKC 1IBLB 1KD1W 2QHSA 3RYCA 4JI7O 1YB3A 2C8MA 4MVZA 1HNWO 2RCVA 2XASA 4AH6A 1Q6HA 3D36A 2Y0IA 2M6YA 2K1EA 2RHQA 4LF9B 2HLDG 4DV0O 1SKVA 3B40A 3K5MA 3K08A 1KBHA 2BCCH 3L75H 1B70B 3ICAA 5J9PC 3JCUZ 2Q7GA 1D5NA 4H2VA 1ZX3A 4GCZA 4R50A 3UM7A 2YI9A 5L3FA 3CMEV 1S76D 4EFBA 4DR5O 2P7TC 4CC5A 5B5EZ 3N2GA 1SQGA 4JTCB 4I55A 3UGQA 3K06A 2IH3C 2F1MA 3ZRWA 5IWAB 1R73A 3UT5B 2JDIG 5CBGA 5DECA 3WFVA 2QSAA 4LNUA 4JI2O 1H2NA 4IIJA 3K3WA 4YCUA 1WN7A 2ZXFA 4DR6B 3HFZA 3W7WA 2HFEC 3A0RA 4DV7O 1H4VB 2GSMB 4QPKA 5H5NA 1X01A 4X64B 5LP6A 1ADJA 5J2TB 1Q86W 4AILC 2DYSC 4JI6O 1AILA 1SQVH 1Y76B 1FXKC 3EHBB 3HFVA 2QTOA 1H2GA 2ALYA 2UXNA 2E5LO 1N32O 2YIBD 4I5SA 2ZIOA 3K5OA 1ADYA 1WPYA 1V55B 3ZIAG 3TEHB 5EZYA 3W7XA 4P3PA 2GTSA 3HRIA 3TETA 4LFBB 4OX9O 1W2BU 4YRGA 3ERRA 2B9ZA 1RM1B 2ZT7A 3WU2Z 3HPLC 4JI5O 5JVDA 5IY5C 2Q5ZA 2LFSA 1KKDA 4OPAA 2OIGA 4JI1O 1EN6A 2DOSA 1AI6A 3JYCA 4NTWA 4X66B 4LF6O 5A2QN 1I5YA 4FMTA 1K33A 1X55A 2P0LA 1M93A 1YXBA 5DM6V 2PI4A 1PD3A 1PYSB 1U97A 1Y76A 4DUYB 1F4NA 2LW7A 5C52B 4PI0A 1SQQH 3E8GA 5LXTA 4YRQA 1Q3EA 4PHZA 2LW1A 5CA1B 3GB7C 5LP6B 2BTQA 2XGTA 1YJ9V 1SESA 3B77A 4FK5C 2QJ1A 4P3OA 3A32A 3ZRXA 2FL4A 2CJ9A 1Q82W 4HAMA 1K7DA 4WBNB 3BVOA 3TUPA 3CMAV 2ZE5A 4CC6A 4WF2A 4Z2WA 1ENVA 4PA9A 4LF8O 1XL6A 3DTUB 1GGMA 3ABTA 1JCHA 4P71C 3B2EE 5EC1C 1JJOA 4TT3G 3SDLA 3CCLV 5JJNB 5DEDA 2E74B 2F4VB 3JAWA 1EVLA 2DTHA 4H2WA 4YP0A 3U0ZA 3A7UA 5CA3A 4KR2A 2WWWA 2AHZA 5FLXN 4J9ZB 1NJ1A 1IZ3A 2ZINA 5IWAO 2WPDG 2WLHA 3ZMTA 2ZR3A 1BE3H 4YRJA 4O2DA 1V54C 2A0LA 4FZ0A 3WG7C 2CUGA 5KUKA 1XNRB 2YXLA 2BE3A 4HVCA 2EWNA 5B1NA 1JMKC 1RSOB 4P73A 3A74A 3RYCB 2Y4UA 4UB6Z 1HWYA 1K5QA 3FB6C 3O9OA 4X8AA 1KP2A 4PDLA 2ZT6A 1NS1A 4DR2O 4LF8B 4RQEA 2R72A 2GBOA 1WU7A 2YEVB 3SR2C 1OCOB 5EYPB 4DRXA 1HXDA 4P75C 2B1IA 4FLWA 2YC0A 5L3BA 3PCOA 5LMUO 1BGYH 4FLZA 2F4VO 1XBLA 3V8LA 1NNHA 4Z1VA 3CC4V 2HR3A 1QR8A 4LBEC 3HR0A 2I4NA 1EZJA 3QO8A 1K3EA 4H13B 4O2AB 3TGUH 2BOBC 3MEYA 3UH0A 1L0WA 1MNGA 5K1PA 1T5EA 3C90A 2VWJA 2P06A 3TXSA 1XMQO 3HTZA 2XAQA 4XU2A 3JD4A 1SZXA 2NNUA 4CZZA 3PCOB 3JARA 3NR7A 1X56A 1PNMA 2WLKA 4DO2A 3L71H 4KXRA 1KMNA 1GRJA 3QF7A 4ZHQA 2Y69B 1PM9A 2ODRC 1NJ8A 4LH6A 3T1YO 1FJGB 1Z2GA 2E64A 3ZBHA 4P30A 1GN6A 4I50B 4KR3A 2N05A 1FD9A 5KHJA 4F6RB 3QO7A 1GM8A 4JTDB 3B8NA 4UVCA 4UCVA 3KCYA 2ZE6A 2P67A 4I4TA 4YRPA 1YJNV 2QE7G 5LL6Y 3AG4B 3HKDB 4OGQB 2ZM6B 1BMFG 2ZT5A 4O4JB 2GUZB 2QWOB 4YJ2A 4JV5O 1AVMA 3ZRSA 1QQCA 3VQYA 2PTMA 2UXDO 2DZCA 4QGPA 4IHJB 4LR3A 2XUMA 3I5DA 5KA6A 1VQ6V 1B7YB 1N34O 5KHKA 1QHTA 1M57B 5LXTB 2ZCEA 1N33B 2O57A 4FLVA 3BAAA 1HDJA 1V9PA 1O9GA 5ITZA 3ETGA 1MSWD 3AK1A 2XAGA 2ZKOA 4X1YB 2JRIA 4HWPA 1N0NA 4YIOA 3HRKA 1YTFB 3AG3C 1MSDA 3ZHTA 3JD2A 4YYEA 3NETA 2EJ9A 1USYA 4R7CA 3APOA 3CRCA 1GMGA 1TGOA 1X54A 4BIUA 1HNWB 1K5SA 4IYIA 5CA1A 4LC1A 3NELA 2E5AA 4EEQA 3I55V 5BMVA 4O4IB 3P8TA 4YY3O 2QGNA 4UP8A 4WFHA 1WB8A 2KB1A 4X65B 1PNLA 3G71V 4IL6Z 4LFCB 3RKWA 2LGQA 3CJHA 3FJPA 1LUWA 4PA4A 3L72H 1WNSA 4DV4B 2ALYB 4O4IA 5J2UA 4DR5B 5FNVA 3STZC 1IBKO 4QE9A 2RHSA 3MQZA 3CE2A 4NB5A 4JI5B 2H94A 2PI5A 3H1KH 2DZ9A 3WB1A 4YDQA 3IALA 2YXHA 3ABKC 3CD6V 2R70A 3RYIA 3AG1B 3SPIA 1S5HC 3VQWA 2YDEA 2UUCB 1NTMH 3LSSA 1ZWIC 5ELOA 3SJAC 3B09A 4YROA 2CTPA 4X1YA 1I94B 2V7QG 5BR8B 5C8YA 3D3IA 4NTYA 5ITZB 2ODRD 1IDSA 4OLFA 2ZT9B 3H01A 1EFWA 3H9VA 2Q7EA 3VBBA 5LGNA 1NT2B 2RNBA 4J7JA 2QA4V 1R6NA 4DXWA 3KG2A 1HNZB 2XHBA 5EIBD 2GUZA 4CS3A 1L1FA 4LF5O 2ATKC 4HYOA 4R6ZA 3DSQA 5GTHZ 3JASA 1YJWV 1YI2V 3QNEA 2DXTA 1K34A 5IT9N 2EIJC 1WYDA 1H2MA 4EX5A 5LYJA 3IC7A 2Q67A 1SETA 3ASOC 1VQZA 4B3RB 4I50A 3THOA 2LP7A 2JVDA 4DUZB 3S3WA 3U10A 4YRNA 1BIAA 4FFBB 4H02A 1AR4A 1NZ6A 5C51B 4YJ2B 1WNLA 1I94O 3OM3B 3OT7A 2EL9A 4NR1A 4LF7B 2UUBO 5A9GA 3V8KA 2CGNA 2A3QA 5JCOC 4LF7O 1VQMV 1PPJH 4XDJA 3SPCA 3RGLA 3DC5A 4X20B 3NEMA 4TWKA 1Q5OA 5LA6A 1RIQA 4MSWC 5IYDO 1J95A 3KKYA 2WLMA 3FB7C 4PHCA 4JPRA 4JI4O 2ZZGA 4XDKA 2UXXA 4DQ2A 4WCEV 1BZKA 4ZHQB 4KQEA 1VQNV 4CH5A 3QVNA 4H2TA 1CPYA 4ASUG 1KYOF 4GT1A 2EINC 3CPWU 5EYPA 4DRXB 5KX5A 3UQ8A 2CTWA 1N32B 1YIJV 3A0BZ 2RJZA 2CJAA 3SYAA 3CCMV 2PZSA 1S0VA 2QM4A 3BA8A 3N2KA 4PA6A 1JQ0A 1ZSPA 3F7YC 2EILC 1M5IA 1ZL8B 1VF7A 3CSXA 2A79B 1J5EB 4ZTZB 4YPFA 3A31A 3JALA 5KNNA 1SZTA 5K1XA 1RFYA 2MK3A 1YFSA 1KECA 1K9MW 4LVLA 4U7OA 5EBWC 1XNQO 2OCHA 1Y6XA 3I56V 4LWSA 3CRQA 3R66A 4MW8A 1BS3A 4OP0A 1MZFA 3OAAG 3HKCB 4JAAA 3OD1A 4MVSA 4JAVA 1B3QA 4DV1O 4ICGA 3IC9A 4O2BA 4DUYO 2ZXWC 1RSOA 3BABA 4OXSA 3E89A 3CCSV 1VQ7V 3RBZA 2KQXA 3K0GA 1BSMA 1QU7A 4U3JB 1JOYA 3BEHA 5FPRA 3OUFA 1AI4A 2LFRA 1AR5A 4DR4B 4UCOA 2Q0OC 2X7RB 3RL6A 5IDJA 1IX9A 4RUEA 4DR3O 3L4GB 1G6UA 3AG2B 1LNQA 2JIZG 1E79G 2Y69C 5IYBO 5GW7A 1CXZB 5B1AC 1WP8A 3IFXA 4B3RO 2VS0A 4AI8A 1N0JA 3LDEA 4E4EA 4I9QA 3M7MX 1PYSA 2Q6AA 2P90A 1VQ4V 5CBFA 2DWDC 5C8YB 1E24A 1M4UA 4YRMA
chains in the Genus database with same CATH topology
3A2FA 3A32A 3MF1A 2CJ9A 3EFRA 3U11A 4WBNB 5JH7B 3TUPA 4WJ4A 4DV0B 3RYFA 4CC6A 4WF2A 4YRCA 3HXVA 3SJCC 3RYIB 1XNQB 1GGMA 4EB6A 4H2XA 5HGQA 4CH4A 4AQYB 1D5AA 4P71C 1WQ7A 4TQDA 1NJ6A 3RIRA 3B2EE 3KFUA 1JJOA 4K8XA 5JJJB 3HKBB 3PN1A 5JJNB 2AMCB 2RQ6A 2RHSB 2DJZA 2F4VB 5KMGB 2JGUA 5JVDB 3JAWA 3BPZA 5J2UB 4CH6A 1E1OA 1EVLA 2DTHA 3U0ZA 4H2WA 4YP0A 3A7UA 4FVMA 1LYLA 4P73C 4NCXA 4KR2A 1FFXA 4K8ZA 4GKJB 1P49A 3LNNA 1WLEA 3I7FA 3RKYA 3M4QA 4FLYA 3A7AA 1BBUA 5IJ9A 1NJ1A 4O4HB 1H4SA 2E1HA 2ZINA 3FFQA 4UCTA 2DKGA 5IYZB 4B08A 3TEHA 2DTIA 2ZR3A 2DU7A 3HY0A 4YRJA 3L1AA 3WQZA 4O2DA 4HNAB 3QO5A 3LC0A 1XNRB 2YXLA 4Q6GA 5IJ0A 2DTOA 3HY1A 1BBWA 4D7TA 2I4LA 2IY5A 3RFRA 4HVCA 2EWNA 4FFBA 1JMKC 4P73A 5ELNA 3A74A 3RYCB 4BW9A 5KMGA 1JJCA 2HEPA 3V7RA 4YRMA 1BIBA 4WJ3M 4XTUA 4YJ3A 2E65A 1NYQA 2DQ3A 2ZT6A 4YCWA 5GONB 1H4QA 3HFZB 4LNSA 1X4TA 5LYJB 4LF8B 4YRRA 4EO4A 4RQEA 4G85A 5E3IA 3RYHB 2R72A 1G5HA 1YGBA 1WU7A 4GYCB 1S5JA 2CAZC 5EZYB 3SR2C 4FLUA 5LP6C 4HWSA 2EX3A 3BRCA 5KHHA 1HR0B 5EYPB 4DRXA 4LF6B 3JASB 1HXDA 4FLWA 4P75C 3PCOA 3BFMA 4KL1A 3K59A 4ZOLB 4FLZA 1H4TA 2ZZEA 2Q0AA 2GV9A 3V7SA 1EIYA 1QF6A 4TUYB 4YRIA 4RMFA 4NXNB 3V8LA 3L2ZA 1NNHA 4J15A 2I4NA 3QO8A 4O2AB 4DV2B 1H2SB 3NENA 2XTIA 1B04A 3ZEDA 4X5OA 3MEYA 3UH0A 1L0WA 2Q5HA 2IY5B 4TUYA 5K1PA 1HTTA 4JI2B 1T5EA 3L4GA 3K57A 2VWJA 4BWAA 4HNAA 3HTZA 3UGTA 4XU2A 4LNUB 4LVKA 3PCOB 3JARA 3HKDA 1TA8A 4ZTUB 1X56A 2EAYA 3E22B 4LF5B 4HWOA 1JFFB 1G5IA 2JS5A 4U3JA 2ZNJA 4UP7A 4DV5B 1KMNA 2ZGWA 3QF7A 4YRSA 4ZHQA 2ODRC 5D5QA 1NJ8A 4LH6A 4UCRA 4O4LA 2E5LB 4LF4B 1FJGB 4DR3B 3CHXA 3K5LA 1JJCB 2E64A 1NJ5A 4FLTA 4O4LB 2CJBA 4YRTA 4I50B 1Q8IA 5IJ0B 4KR3A 4P74C 5KHJA 3T1HB 2ARTA 3RF1A 4F6RB 3HKCA 3HKEA 3QO7A 4RDXA 2J3MA 3P8YA 2R9AA 4UCVA 4DV3B 4UCSA 3E9HA 4I4TA 3BJUA 1ASZA 4YRPA 4XTVA 3HKDB 4DV6B 2ZM6B 3RUXA 2ZT5A 4O4JB 1EOVA 3W3SA 4X62B 4YJ2A 2A8EA 4TQFA 4UP9A 4YRFA 1TVKA 3REUA 3JALB 1QQCA 4ZI7B 3VQYA 2PTMA 2QHTA 3K5NA 3SGIA 2DZCA 1HC7A 4IHJB 2YIBA 4LR3A 4DR1B 5C53B 1B7YB 2E10A 4TV9A 5KHKA 1QHTA 4FLXA 5LXTB 3OTOB 2ZCEA 1N33B 3N2KB 4DV7B 4FLVA 3A7RA 3BAAA 1EIYB 1KOGA 4JI4B 1V9PA 4CS2A 2PYLA 4JI8B 1O9GA 5ITZA 4XU1A 3M4PA 4DV1B 2UUBB 3CMQA 4X1IA 4X1YB 2E3CA 2CIMA 4L8JA 2F93B 4YHHB 4HWPA 4IIJB 3JATB 3HRKA 5KX5B 1Q43A 3RKXA 4YYEA 2EJFA 3NETA 1X2HA 2EJ9A 1USYA 2DU5A 1NYRA 5GONA 4DK1A 2ZR2A 4HBNA 4H2UA 1FYFA 2P5IA 3QG5A 3IAYA 3MF2A 4I55B 3VQXA 3EFSA 3G1ZA 2UUAB 3UFGA 1TGOA 1X54A 5CA0B 2F66C 2KKWA 4B3TB 1O9HA 1HNWB 5CB4A 5CA1A 1J5WA 3NELA 4TVAA 4YRKA 1Z5WA 2E5AA 1HW7A 4EEQA 5BMVA 3IKLA 4O4IB 3P8TA 3BA9A 2OYQA 4UP8A 1C0AA 2UXBB 3CB2A 3HXYA 4X20A 5LA6B 1E1TA 4X65B 4B3MB 2PY5A 4LFCB 3RKWA 2IM9A 2OWOA 1DGSA 3FJPA 4I4TB 1G51A 2QHUA 2RHQB 2AKWA 4DR7B 1WNSA 4DV4B 3V8JA 2PYJA 2ALYB 4P74A 2YI8A 2VWKA 1TUBA 4O4IA 3OTFA 3JAWB 3JSNA 5J2UA 4DR5B 5FNVA 1USYC 3RACA 2BTOA 2I4OA 4CS4A 5JCOA 4O2BB 2RHSA 2FYKA 3MQZA 4JI5B 4XTXA 5CB4B 2DZ9A 3WB1A 2DDZA 2P5OA 4YDQA 1TUBB 3RGBA 4DPGA 4JV5B 3IALA 2ZTGA 2NS6A 4XEOA 4EB6B 3WB2A 1SQFA 4UFZA 2R70A 3RYIA 3VQVA 1SERA 4TOIA 2UXCB 3VQWA 1YFTA 3TEGA 2UUCB 4WBNA 11ASA 3QTCA 3E22A 4NVPA 1TAEA 2DEQA 3LSSA 5ELOA 3SJAC 3JARB 4YROA 4X1YA 4X1IB 1I94B 5BR8B 5C8YA 2G4CA 3HXWA 4HT4A 4TV8A 5ITZB 2ODRD 5JJEB 3REXA 2PMEA 4OLFA 1YFRA 4TTVA 1EFWA 2Q7EA 3VBBA 3BHPA 2VQFB 2BTQB 1X2GA 1NT2B 4JI1B 4O2AA 4JI0B 4ZIBA 4WI1A 1EQRA 5CA0A 3R07A 1B76A 4YRLA 2I4MA 1HNZB 2UXDB 2XHBA 3JSLA 2J3LA 5EIBD 1TVKB 3K58A 4P72C 4CS3A 4ZOLA 1WQWA 4P75A 4UPAA 3DSQA 2DVEA 3JASA 1EVKA 1KMMA 4XU0A 4LFAB 3ICXA 3QNEA 3JATA 5LOVA 4G84A 2DXTA 3RWRD 1WYDA 4HA8A 3RYHA 1SRYA 4EX5A 1ASYA 5LYJA 4X1KA 3HKEB 1W66A 3A5YA 2UU9B 2Q5IA 1SETA 4JI6B 1VQZA 2E41A 4XTZA 1SA0A 4B3RB 4JYAB 4I50A 4XU3A 4FM2A 4JI7B 3THOA 2V4DA 1IBLB 4KHPB 2JVDA 4DUZB 2QHSA 4YRNA 3U10A 5FNVB 3RYCA 1BIAA 1YB3A 2C8MA 3IG2A 4FFBB 4H02A 4UCUA 4AH6A 5C51B 4TVYA 4YJ2B 1WNLA 4K87A 2EL9A 4LF7B 4OX9B 2RHQA 3V8KA 4LF9B 3HXXA 1JFFA 3ETQA 5LOVB 4FM0A 1SKVA 5JCOC 3K5MA 1QE0A 3RGLA 1I7FA 1IBMB 4K86A 4LH7A 4X20B 3NEMA 4RQFA 1Q5OA 5LA6A 1B70B 1E22A 1RIQA 12ASA 2P22C 2EJGA 2PMFA 3ICAA 3IKMB 4AHCA 2Q7GA 4H2VA 4E51A 4NXMB 5BMVB 2YI9A 5EIBC 4K88A 5J2TA 5D5PA 4PHCA 2ZZGA 4EFBA 2AMCA 3WB0A 4TVWA 4H2YA 4HWTA 4CH3A 4CC5A 3N2GA 4DQ2A 1SQGA 4I55A 4K0KB 3UGQA 4ZHQB 1L8DA 4KQEA 3HXUA 4LVMA 4CH5A 4HWRA 3PZCA 4H2TA 4H2XB 2F1MA 4YREA 5IWAB 3UT5B 1Z7MA 2DQ0A 4XEMA 3RYFB 4D7SA 5EYPA 4DRXB 5KX5A 3UQ8A 4DK0A 1N32B 1ATIA 5JH7A 1WPBA 1Z7NA 4PG3A 3V7CA 2Q7HA 4LNUA 3UT5A 2RJZA 4IIJA 2CJAA 4YCUA 1WN7A 2VQEB 2ZXFA 4DR6B 3HFZA 4GLXA 2PZSA 4GKKB 4P72A 2ARUA 1H4VB 3E9IA 2YIAA 4YCVA 1IL2A 2QM4A 2PGGA 3N2GB 1X01A 3BA8A 3N2KA 1N36B 4X64B 1B8AA 4YJ3B 2PUSA 1XQ8A 3JAKB 5LP6A 5LMNB 1ADJA 4H2SA 1M5IA 5J2TB 1IBKB 1VF7A 1B7YA 4IHJA 3CSXA 1J5EB 4ZTZB 4FM1A 4AILC 4YPFA 3A31A 3JALA 4ZI7A 5KNNA 5K1XA 2HHHB 1YFSA 2CGHA 4TV8B 3HFVA 4LVLA 1B70A 2ALYA 4P3NA 4O4JA 3P8VA 4P71A 5JQGA 1KU9A 2QHVA 2YIBD 1XHXA 2AKWB 2ZIOA 3K5OA 1XHZA 1ADYA 3MAQA 1WPYA 5KHGA 4TWAA 1XMQB 1N9WA 3LSQA 4XTYA 3TEHB 2F95B 5EZYA 4P3PA 5IJ9B 2C7IA 4F6RA 4LFBB 3HRIA 4OP0A 3HKCB 3OD1A 2ZZFA 4YRGA 1XI1A 4YY3B 3ERRA 2ZT7A 1KMIZ 2DXUA 5JVDA 1YEWA 4O2BA 1RSOA 3BABA 4TVAB 3T1YB 3HXZA 1SA0B 3ZS8C 4XTWA 1ZAUA 4PI2A 1HNXB 3A5ZA 4X1KB 2HNIA 4L87A 4U3JB 5FPRA 5IYZA 4X66B 4Q15A 1Z5VA 4O4HA 1X55A 2P0LA 5FPOA 1M93A 3SJBC 4DR4B 4UCOA 5JQGB 3RL6A 4LVJA 1FFXB 4B3SB 3L4GB 1G6UA 2ZNIA 1PYSB 4DUYB 5C52B 4PI0A 1NJ2A 5LXTA 4YRQA 4DR2B 5F5WA 3HKBA 4EFEA 5CA1B 1Q3EA 4PHZA 4TV9B 1XMOB 2ZT8A 2ZIMA 2BTQA 3JAKA 4JI3B 5LP6B 2XGTA 2ARSA 4I9QA 1SESA 3M7MX 1N34B 1PYSA 4LVIA 5C8YB 5KHIA 5LMUB 1E24A 2QJ1A 1M4UA 4P3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A32 A;  3MF1 A;  2CJ9 A;  3EFR A;  4WJ4 A;  3TUP A;  4YRC A;  4WF2 A;  3HXV A;  5HGQ A;  1GGM A;  4H2X A;  4CH4 A;  4P71 C;  1WQ7 A;  4TQD A;  1NJ6 A;  3RIR A;  3KFU A;  2AMC B;  2RQ6 A;  2RHS B;  2DJZ A;  4CH6 A;  1EVL A;  1E1O A;  2DTH A;  4H2W A;  4YP0 A;  11AS A;  3A7U A;  1LYL A;  4P73 C;  4NCX A;  4KR2 A;  1WLE A;  3I7F A;  3RKY A;  3M4Q A;  3A7A A;  1BBU A;  1NJ1 A;  1H4S A;  2E1H A;  2ZIN A;  2DKG A;  3TEH A;  2DTI A;  2ZR3 A;  2DU7 A;  3HY0 A;  4YRJ A;  3L1A A;  3WQZ A;  4O2D A;  3QO5 A;  3LC0 A;  4Q6G A;  2DTO A;  3HY1 A;  1BBW A;  2I4L A;  2IY5 A;  4HVC A;  2EWN A;  4P73 A;  5ELN A;  3A74 A;  4BW9 A;  3V7R A;  1JJC A;  2HEP A;  4YRM A;  4WJ3 M;  1BIB A;  4XTU A;  2E65 A;  1NYQ A;  2DQ3 A;  2ZT6 A;  4YCW A;  1H4Q A;  3HFZ B;  4LNS A;  4EO4 A;  4YRR A;  4RQE A;  4G85 A;  5E3I A;  2R72 A;  1G5H A;  1YGB A;  1WU7 A;  4HWS A;  1HXD A;  4P75 C;  3PCO A;  3BFM A;  1H4T A;  2ZZE A;  3V7S A;  1EIY A;  1QF6 A;  4YRI A;  4RMF A;  3V8L A;  3L2Z A;  1NNH A;  4J15 A;  2I4N A;  3QO8 A;  3NEN A;  2XTI A;  3ZED A;  4X5O A;  3MEY A;  3UH0 A;  1L0W A;  2Q5H A;  2IY5 B;  5K1P A;  3L4G A;  1HTT A;  4BWA A;  3HTZ A;  3UGT A;  4XU2 A;  3PCO B;  4ZTU B;  1X56 A;  2EAY A;  4HWO A;  1G5I A;  2ZNJ A;  4UP7 A;  1KMN A;  2ZGW A;  4YRS A;  2ODR C;  1NJ8 A;  1JJC B;  2E64 A;  1NJ5 A;  2CJB A;  4YRT A;  4KR3 A;  4P74 C;  2ART A;  3RF1 A;  3QO7 A;  4RDX A;  2J3M A;  3P8Y A;  3E9H A;  3BJU A;  1ASZ A;  4YRP A;  4XTV A;  3RUX A;  2ZT5 A;  1EOV A;  3W3S A;  4UP9 A;  4YRF A;  4TQF A;  3REU A;  3VQY A;  2QHT A;  2DZC A;  1HC7 A;  2YIB A;  5C53 B;  1B7Y B;  2E10 A;  2ZCE A;  3A7R A;  1EIY B;  1KOG A;  4CS2 A;  4XU1 A;  1O9G A;  3M4P A;  3CMQ A;  2CIM A;  2E3C A;  4HWP A;  3HRK A;  4YYE A;  3RKX A;  2EJF A;  3NET A;  1X2H A;  2EJ9 A;  1USY A;  2DU5 A;  1NYR A;  2ZR2 A;  4H2U A;  1FYF A;  2P5I A;  3MF2 A;  3VQX A;  3EFS A;  3G1Z A;  3UFG A;  1X54 A;  1O9H A;  1J5W A;  3NEL A;  4TVA A;  4YRK A;  2E5A A;  3IKL A;  3P8T A;  4UP8 A;  1C0A A;  3HXY A;  1E1T A;  3RKW A;  3FJP A;  1G51 A;  2QHU A;  2RHQ B;  2AKW A;  3V8J A;  2ALY B;  4P74 A;  2YI8 A;  1USY C;  3RAC A;  2I4O A;  4CS4 A;  2RHS A;  2FYK A;  4XTX A;  2DZ9 A;  2DDZ A;  4YDQ A;  4DPG A;  3IAL A;  2ZTG A;  4XEO A;  2R70 A;  3VQV A;  1SER A;  1YFT A;  3VQW A;  3TEG A;  3QTC A;  2DEQ A;  3LSS A;  5ELO A;  4YRO A;  3HXW A;  2G4C A;  2ODR D;  3REX A;  2PME A;  4OLF A;  1YFR A;  4TTV A;  1EFW A;  2Q7E A;  3VBB A;  3BHP A;  1X2G A;  4ZIB A;  4WI1 A;  1EQR A;  3R07 A;  1B76 A;  4YRL A;  2I4M A;  2J3L A;  4P72 C;  4CS3 A;  1WQW A;  4P75 A;  4UPA A;  3DSQ A;  2DVE A;  1EVK A;  1KMM A;  4XU0 A;  3QNE A;  4G84 A;  2DXT A;  1WYD A;  4HA8 A;  1SRY A;  4EX5 A;  1ASY A;  1W66 A;  3A5Y A;  2Q5I A;  1SET A;  1VQZ A;  2E41 A;  4XTZ A;  4XU3 A;  2JVD A;  2QHS A;  4YRN A;  1BIA A;  1YB3 A;  2C8M A;  3IG2 A;  4H02 A;  4AH6 A;  5C51 B;  4TVY A;  1WNL A;  4K87 A;  2EL9 A;  2RHQ A;  3V8K A;  3HXX A;  1QE0 A;  3RGL A;  4K86 A;  3NEM A;  4RQF A;  1B70 B;  2EJG A;  1E22 A;  1RIQ A;  3ICA A;  12AS A;  3IKM B;  2PMF A;  2Q7G A;  4H2V A;  4E51 A;  2YI9 A;  4K88 A;  4PHC A;  2ZZG A;  2AMC A;  4TVW A;  4H2Y A;  4HWT A;  4CH3 A;  4DQ2 A;  3UGQ A;  4KQE A;  3HXU A;  4CH5 A;  4HWR A;  3PZC A;  4H2T A;  4H2X B;  4YRE A;  1Z7M A;  2DQ0 A;  4XEM A;  1ATI A;  4PG3 A;  1Z7N A;  3V7C A;  2Q7H A;  2CJA A;  2RJZ A;  4YCU A;  2ZXF A;  3HFZ A;  4P72 A;  2ARU A;  1H4V B;  3E9I A;  2YIA A;  4YCV A;  1IL2 A;  2PGG A;  1X01 A;  1B8A A;  2PUS A;  1ADJ A;  4H2S A;  1B7Y A;  4ZTZ B;  4YPF A;  3A31 A;  5KNN A;  5K1X A;  1YFS A;  2CGH A;  3HFV A;  1B70 A;  2ALY A;  4P3N A;  3P8V A;  4P71 A;  2QHV A;  2YIB D;  2AKW B;  2ZIO A;  1ADY A;  1WPY A;  4XTY A;  4TWA A;  3TEH B;  1N9W A;  3LSQ A;  4P3P A;  2C7I A;  3HRI A;  4OP0 A;  3OD1 A;  2ZZF A;  4YRG A;  3ERR A;  2ZT7 A;  2DXU A;  4TVA B;  3HXZ A;  4XTW A;  3A5Z A;  2HNI A;  4L87 A;  4Q15 A;  1X55 A;  2P0L A;  3RL6 A;  3L4G B;  1G6U A;  2ZNI A;  1PYS B;  5C52 B;  1NJ2 A;  4YRQ A;  5F5W A;  2ZT8 A;  2ZIM A;  2XGT A;  2ARS A;  1SES A;  1PYS A;  1E24 A;  2QJ1 A;  4P3O A; 
#chains in the Genus database with same CATH topology
 4LFA O;  2E76 B;  1NVP D;  1BQ0 A;  2FB5 A;  3EFR A;  2FKX A;  5JH7 B;  5LHH A;  1BHB A;  3P3N A;  5L3E A;  1FYJ A;  3RYF A;  4YRC A;  3HXV A;  2CH7 A;  5EC2 C;  3RYI B;  4H2X A;  5LGU A;  4AQY B;  4MTX A;  2FTK A;  4KHP O;  4CBC A;  1OHH G;  1QNM A;  4UUJ C;  3ZMU A;  3CYO A;  2RHS B;  2DJZ A;  2R9R B;  5JVD B;  5J2U B;  1D2D A;  1K92 A;  3A8T A;  3F5T A;  1P49 A;  2AGA A;  1WLE A;  3M4Q A;  4FLY A;  1ZUQ A;  2YID A;  4H33 A;  3A0H Z;  4UCT A;  5B3S C;  1AJQ A;  3CJH B;  3TEH A;  2DTI A;  3FX7 A;  2DU7 A;  3HY0 A;  1AI5 A;  4PDR A;  3WQZ A;  4HNA B;  3QO5 A;  4JAU A;  5IJ0 A;  3HY1 A;  1BBW A;  2I4L A;  3L74 H;  3RFR A;  3ZMZ A;  3ASN C;  5ELN A;  4BW9 A;  5KMG A;  1XUQ A;  3N27 A;  4WJ3 M;  2QWP B;  1DTO A;  1FFT B;  1MA1 A;  1NYQ A;  1P7B A;  2DQ3 A;  4EKW A;  3HFZ B;  4LNS A;  1P84 F;  4EO4 A;  2LJ2 A;  1MG1 A;  3ZCC A;  5E3I A;  1JVM A;  2XAJ A;  5EZY B;  1S5J A;  2CAZ C;  1JJ2 U;  1ORQ C;  1MZE A;  3ZHS A;  3OMA B;  5KHH A;  2EIL B;  5L3D A;  1VEW A;  2V1D A;  3BFM A;  3ZRW B;  3K59 A;  4ZOL B;  1H4T A;  2ZZE A;  2Z0A A;  2GV9 A;  3V7S A;  4H0L B;  4TUY B;  4X9Q A;  2WLI B;  2N04 A;  4NXN B;  2QM7 A;  4PDM A;  4J15 A;  5H6Q A;  2BSK A;  4LF4 O;  3NEN A;  1B04 A;  2DN9 A;  2HJF C;  3JD1 A;  2Q5H A;  4G28 B;  3UCS C;  2IY5 B;  3L4G A;  1HTT A;  4JI2 B;  4QJF B;  4F4L A;  4DW1 A;  1P7G A;  4FPP A;  4LNU B;  3E83 A;  2NN4 A;  3HKD A;  4ZTU B;  3MHS C;  2EAY A;  1GN3 A;  2ZXW B;  1MMM A;  4NTX A;  1G5I A;  2Y48 A;  4U3J A;  3CCJ V;  2ZNJ A;  4J7Z A;  4ABM A;  2C2A A;  3B4S A;  4X89 A;  4YRS A;  1W0K G;  1G4Y B;  2B1G A;  4UCR A;  2E5L B;  4DR3 B;  3UO2 A;  4FLT A;  4DUZ O;  1UFI A;  1VQ5 V;  3R65 A;  1H2L A;  4P74 C;  4QE7 A;  1IUR A;  3P8Y A;  2R9A A;  3E9H A;  3BJU A;  4PV1 B;  3RUX A;  1WP7 A;  3H1H H;  3K9A A;  2JGD A;  1EOV A;  4YRF A;  3ASO B;  4TQF A;  2A8E A;  1TVK A;  1QCE A;  2EUL A;  3LUT B;  3JAL B;  2MW2 B;  1BCC H;  2QHT A;  3K5N A;  3SGI A;  1RM1 C;  2R9I A;  2YIB A;  5C53 B;  5KAI Z;  4FLX A;  1WA8 B;  3OTO B;  2F23 A;  1E1R G;  4DV7 B;  1KOG A;  3BCC H;  4JI8 B;  2PYL A;  3CEI A;  3CMQ A;  4QPJ A;  4X1I A;  2Z3Y A;  5EK0 A;  4L8J A;  2F93 B;  1P4R A;  4J42 A;  3JAT B;  2XT9 A;  2ZE8 A;  5KX5 B;  3RKX A;  1I08 A;  2DU5 A;  2DYS B;  4HBN A;  3RVZ A;  3MF2 A;  3G1Z A;  5CA0 B;  2F66 C;  1L0N H;  4BW5 A;  1M1K W;  1OCR C;  4TVA A;  1NTZ H;  2F43 G;  2QWQ B;  4RWU A;  4H37 A;  1QLE C;  4KUM A;  2OYQ A;  1C0A A;  4X20 A;  5H9C A;  4MS2 A;  1ROP A;  4B3M B;  2PY5 A;  1DGS A;  3E86 A;  1G51 A;  3T1H O;  1HNX O;  4DR7 B;  1RPO A;  2VWK A;  1TUB A;  1OCZ B;  3LDD A;  3JAW B;  3JSN A;  3RAC A;  3Q4H B;  1VQO V;  2I4O A;  3KZI Z;  1YF2 A;  1GM9 A;  1WAZ A;  3M8A A;  5CB4 B;  2DDZ A;  2KG7 A;  2P5O A;  1R6K A;  1COW G;  2ZTG A;  2FYU H;  1BHA A;  3VQV A;  3D8C A;  1Y66 A;  4WBN A;  1K4C C;  3C3T A;  3E22 A;  2DEQ A;  3ZHV A;  3HXW A;  2G4C A;  1AP6 A;  4HZ3 A;  4KP4 A;  1R3K C;  5JJE B;  1IXM A;  1BL8 A;  1YFR A;  1YDX A;  3BHP A;  2VQF B;  2BTQ B;  1MOF A;  3ZN0 A;  2WLJ A;  4W4L A;  1F51 A;  4JI0 B;  1SS3 A;  3AG3 B;  4JYB A;  3R07 A;  4DR1 O;  4H44 B;  3AG7 A;  3OMI B;  4I0X A;  1YZB A;  1H8E G;  1NQT A;  4DR7 O;  1EFR G;  1XL4 A;  4P75 A;  4UPA A;  3ZHR A;  2DVE A;  1VF6 A;  2OCC C;  4LFA B;  1Y67 A;  5LOV A;  2X0L A;  1VIB A;  1FXH A;  1KKC A;  1SRY A;  1ZTE A;  4GX1 A;  3RYH A;  1K97 A;  3A5Y A;  2A7W A;  2UU9 B;  4JI6 B;  2E41 A;  4XTZ A;  5H2F Z;  4GX0 A;  4P9O A;  3SPG A;  1B06 A;  2JS3 A;  2V4D A;  2G38 A;  4KHP B;  5FNV B;  3E2E A;  3IG2 A;  1HNZ O;  2HG5 C;  1NH2 D;  2QKS A;  5BZB A;  1R3I C;  2ZDI C;  4QNH B;  4OX9 B;  3CX5 F;  3HXX A;  3ETQ A;  2ADQ B;  4DR4 O;  2W0X A;  4FM0 A;  1KQS U;  1XIL A;  3ABU A;  1QE0 A;  3DC6 A;  1NU1 H;  1IBM B;  2ODM A;  1PL4 A;  4K86 A;  4RQF A;  3IKM B;  1FKA O;  1PKX A;  2P22 C;  12AS A;  1XRE A;  5BMV B;  4K88 A;  5J2T A;  2Y4T A;  4W4K A;  4TSF G;  2AMC A;  3W7U A;  4TVW A;  4H2Y A;  4CH3 A;  2NLJ C;  4K0K B;  2ZM6 O;  5DN6 G;  2WLL A;  3HXU A;  5E1A C;  3T1C A;  4X62 O;  1S77 D;  2DQ0 A;  1K8A W;  4XEM A;  4D7S A;  2OIE A;  4DK0 A;  1ATI A;  4PG3 A;  1GKF A;  1Z7N A;  3V7C A;  2Q7H A;  3UT5 A;  1S72 V;  2VQE B;  4GKK B;  4P72 A;  3CCU V;  1IL2 A;  2PGG A;  3N2G B;  2XTA A;  3K9S A;  4YJ3 B;  1XQ8 A;  2PUS A;  3JAK B;  4NXN O;  3EFF K;  3AG4 C;  3ZHQ A;  1OCO C;  4IHJ A;  4FM1 A;  2EIJ B;  2HHH B;  4NKG B;  2GTA A;  2CGH A;  4TV8 B;  1B70 A;  4P3N A;  4O4J A;  1FJG O;  3P8V A;  4P71 A;  5JQG A;  2QHV A;  1YIT V;  2AKW B;  1XHZ A;  2JGD B;  3MAQ A;  5KHG A;  5F2V O;  3LSQ A;  2F95 B;  2Q8V A;  5IJ9 B;  2C7I A;  4F6R A;  1SF9 A;  1K73 W;  3EVK A;  2ZZF A;  3WG7 B;  3ETE A;  3ZN1 A;  5EBL C;  4FIP C;  2DXU A;  1YEW A;  2W6I G;  1J5E O;  4JZ2 A;  1AJP A;  1VP7 A;  2GDS A;  1CP9 A;  3HXZ A;  1SA0 B;  1H8H G;  3ZS8 C;  4PI2 A;  2IJI A;  4FJC C;  4PD4 F;  4X1K B;  2HNI A;  2DYR C;  1YTF D;  3ABM C;  5IYZ A;  1NKD A;  2W6J G;  4K35 A;  4Q15 A;  4JAS A;  1OCR B;  1Z5V A;  4O4H A;  5H6R A;  3D3Q A;  3SJB C;  5JQG B;  3RT3 C;  4B3S B;  2ZNI A;  4YIP A;  1R1B A;  2Z5U A;  2X6A A;  4DR2 B;  3TJT A;  4PA7 A;  5F5W A;  4TV9 B;  2AHY A;  1XMO B;  2ZQM A;  3JAK A;  4JI3 B;  2BSK B;  5CMU A;  2ARS A;  2OTJ V;  2IBZ H;  5LMU B;  4DV6 O;  3A2F A;  3MF1 A;  2RMK B;  3TCU A;  1LR1 A;  1KB9 F;  4DV0 B;  3JCZ A;  2UXB O;  5HGQ A;  3D36 C;  3FAV A;  1WQ7 A;  3RIR A;  4IYH A;  1FPO A;  1S5L Z;  1JR9 A;  3HKB B;  1WPX A;  3PN1 A;  5JJJ B;  2AMC B;  2RQ6 A;  5KMG B;  1Q81 W;  3BPZ A;  11AS A;  2WSS G;  2EZP A;  5KA5 A;  4FVM A;  2HP8 A;  1LYL A;  1NTK H;  1DF4 A;  4NCX A;  1AI7 A;  1FFX A;  4K8Z A;  4GKJ B;  4P73 C;  2XAH A;  3ZMS A;  1BBU A;  4MTF A;  3RN4 A;  2E1H A;  1UPG A;  3FFQ A;  3ASN B;  4BIZ A;  4B08 A;  2Q73 A;  1VMG A;  1M57 C;  3L1A A;  3GWK C;  1XMO O;  5AG2 A;  3P3P A;  1KUQ A;  4Q6G A;  2DTO A;  4D7T A;  2EIN B;  4WFF A;  5IYC O;  1IXB A;  3V7R A;  2PF4 E;  1JJC A;  2HJD A;  1YHQ V;  5B1O A;  1V55 C;  1R3J C;  2KSD A;  2QKC A;  2XND G;  3CXC U;  1AP5 A;  3NXS A;  4J11 A;  3M99 B;  1OV9 A;  1FXK B;  5GON B;  1H4Q A;  2QDO A;  2EZO A;  4N23 A;  4YRR A;  2CK3 G;  3RYH B;  1YGB A;  1Y74 A;  1F4M A;  5LP6 C;  4HWS A;  1YCI A;  5FL7 G;  1Y74 B;  4F6E A;  4IT5 A;  4KL1 A;  1FXK A;  3TK1 A;  3G6E V;  1G1X B;  1EIY A;  1QF6 A;  4YRI A;  4RMF A;  5LMN O;  1H2K A;  2DYR B;  4DV2 B;  1H2S B;  1GN2 A;  2Q69 A;  3ZED A;  1I0H A;  5HFM A;  4D6T H;  1AJN A;  2P4K A;  3F5W C;  3E8F A;  4P2Z A;  3UGT A;  4N21 A;  2EIM C;  2DWE C;  3DGE A;  4MT8 A;  1NJI W;  3J80 N;  3E22 B;  1JFF B;  1NI8 A;  4X66 O;  2JS5 A;  4JI8 O;  4UP7 A;  4DV5 B;  4YHH O;  2Y0P A;  5D5Q A;  3W7S A;  4I9W A;  2KG7 B;  4LF4 B;  2HKO A;  4B3S O;  1JJC B;  5B3S B;  1NJ5 A;  4O4L B;  3ZMV A;  4YRT A;  3GWO A;  1XNR O;  3SYO A;  2CTR A;  4YXW G;  3ZHU A;  3RF1 A;  3HKC A;  3HKE A;  4DR6 O;  3ZX6 A;  3OGI B;  1SC5 B;  4RDX A;  4UCS A;  3B8M A;  1ASZ A;  2EIK B;  4XTV A;  4DV6 B;  5E79 Z;  1Q6I A;  4DW0 A;  3REU A;  5L3C A;  1M56 B;  1QLN A;  2QWR B;  2ILM A;  3CC2 V;  1Q7Y W;  4GZR B;  2D3O W;  4DR1 B;  1GK9 A;  4TV9 A;  3CCR V;  2B5U A;  1RP3 B;  1L0L H;  1YVW A;  3N2K B;  1W59 A;  3A7R A;  5HFL A;  2ZE7 A;  4CS2 A;  4XU1 A;  4MVO A;  4WFG A;  1QBZ A;  4DV1 B;  2UUB B;  2HVK C;  5BR8 O;  1H38 A;  3MHH C;  1WJZ A;  4YHH B;  4E2L A;  3LNM B;  5B1A B;  5BXZ A;  4B3M O;  1Q43 A;  2W0F C;  3G80 A;  2EJF A;  5L3G A;  1NYR A;  4GX5 A;  4DK1 A;  4H2U A;  2YXY A;  1FYF A;  3UO3 A;  3QG5 A;  4G2K A;  3IAY A;  4I55 B;  3EFS A;  4XDL A;  2UUA B;  3FKS G;  4B3T B;  1O9H A;  3CP1 A;  2UUA O;  1Q6U A;  3FB5 C;  5JWP A;  1J5W A;  4YRK A;  1Z5W A;  1IVS A;  3BA9 A;  2AXT Z;  3OR6 C;  3CB2 A;  3E8B A;  3ZRV A;  1BQZ A;  5LA6 B;  3DXR A;  2IH1 C;  1E1T A;  1AB3 A;  4IGG A;  4XBF A;  1GN4 A;  2OWO A;  2WAM A;  2LGW A;  3CCV V;  4J7K A;  2AKW A;  3DXR B;  3CXH F;  2IW5 A;  2IJJ A;  5IE9 A;  4P74 A;  2OCC B;  4WFE A;  5LHI A;  3CRR A;  2AZ2 A;  3OTF A;  1SQB H;  2XOK G;  2HVJ C;  4CS4 A;  2FYK A;  1HP8 A;  4I7Z B;  4JTA B;  4KFM A;  2YUA A;  3OR7 C;  4MVU A;  3RGB A;  2JK5 C;  4MW3 A;  4JYA O;  2CGO A;  3OD4 A;  4EB6 B;  3WB2 A;  1NVP B;  2VQE O;  4UFZ A;  4X88 A;  3STL C;  1FS0 G;  3TEG A;  3QTC A;  1TAE A;  2YSU B;  1QVF U;  1OCC B;  3SJQ C;  4WFB V;  1F23 A;  4HT4 A;  2ITC C;  4TV8 A;  4UB8 Z;  2PME A;  2WA4 A;  2QR4 A;  1X2G A;  2EBO A;  5LBQ A;  3CWB H;  1SQX H;  1B76 A;  3AK3 A;  2I4M A;  3BY6 A;  3OGC C;  1RPR A;  3JSL A;  2J3L A;  1MAB G;  3OUS A;  4ZOL A;  2A9H A;  1OCZ C;  2DMX A;  1KMM A;  4XU0 A;  2IU0 A;  4MVQ A;  3OMN B;  4HA8 A;  4X65 O;  1I5X A;  1GH6 A;  3HKE B;  5CN0 A;  1VAR A;  3K79 A;  2VQF O;  4JYA B;  4XU3 A;  3CCE V;  1TUE B;  4FM2 A;  4JI0 O;  3PJS K;  4GX2 A;  1QLE B;  2X6B A;  4GKK O;  4UCU A;  4TVY A;  1N36 O;  3ZJZ A;  3ABK B;  4K87 A;  2YS8 A;  5C93 A;  3K03 A;  4JZG A;  2JJ2 G;  1AR1 B;  4RUF A;  1JFF A;  3ABL C;  5LOV B;  5KLV H;  2WA3 A;  1I7F A;  4LH7 A;  2EJG A;  1E22 A;  4J41 A;  2PMF A;  4U7N A;  2UUC O;  4AHC A;  2NR5 A;  1N8R W;  4E51 A;  4NXM B;  1QVG U;  5EIB C;  3F7V C;  3OTO O;  2D2C B;  2ZD9 A;  4RO2 A;  5D5P A;  4Z1M G;  4X64 O;  5CBH A;  3WB0 A;  4HWT A;  4B3T O;  1L8D A;  2Q9L A;  4LVM A;  4HWR A;  3PZC A;  4OPH A;  4H2X B;  4YRE A;  1Z7M A;  3RYF B;  5JH7 A;  1WPB A;  3EXA A;  4LFC O;  1VQ8 V;  1IBM O;  1V54 B;  2QM8 A;  5EBM C;  2E75 B;  3CCQ V;  1U96 A;  5LGT A;  4GLX A;  4I0X B;  4UVB A;  1R6T A;  2ARU A;  3E9I A;  2YIA A;  4YCV A;  3GVM A;  3JAM N;  1N36 B;  2OTL V;  1B8A A;  3BFR A;  5LMN B;  4H2S A;  1XDC A;  1IBK B;  1B7Y A;  1CEZ A;  1E1Q G;  3AG1 C;  4ZI7 A;  4LCU C;  3P32 A;  2IU3 A;  2AW9 A;  1KU9 A;  1XHX A;  3JD0 A;  4JYY A;  3J81 N;  1KP3 A;  4XTY A;  4TWA A;  1XMQ B;  1N9W A;  3J7A U;  1NR1 A;  4JGS A;  2L35 A;  2H3O A;  2VRZ A;  1XI1 A;  4YY3 B;  4BAY A;  3ML0 A;  1KMI Z;  4TVA B;  1US6 A;  3Q4H A;  3T1Y B;  1S3J A;  3CS5 A;  4XTW A;  1ZAU A;  1HNX B;  1B6Q A;  2LQT A;  3A5Z A;  4ZBM A;  1F7Y A;  2ADP A;  1EN4 A;  2JEX A;  4L87 A;  3K04 A;  1URF A;  4ZKI A;  3CRM A;  5FPO A;  1XEQ A;  2ARH A;  4LVJ A;  1FFX B;  1A32 A;  2BOC C;  3APQ A;  5B1B B;  1EN5 A;  3RW0 A;  1NJ2 A;  1WA8 A;  1Q90 D;  1ZL8 A;  3HKB A;  4EFE A;  4QIW F;  1K4D C;  1JX9 A;  2ZT8 A;  2ZIM A;  3MDS A;  3X2Q B;  1N34 B;  3L70 H;  4G27 B;  2DW4 A;  4LVI A;  5KHI A;  4DV5 O;  3X2Q C;  3FD9 A;  3TXQ A;  2EIM B;  2OT5 A;  3U11 A;  4WJ4 A;  3VOU A;  1VQ9 V;  3RVY A;  3SJC C;  1XNQ B;  3L9D A;  2WLN A;  4EB6 A;  1VF5 B;  4CH4 A;  1D5A A;  4TQD A;  1NJ6 A;  3ETD A;  3KFU A;  1IBL O;  4K8X A;  1XOU A;  4UV8 A;  2QEX V;  1M9N A;  2JGU A;  2YIC A;  3UKM A;  4CH6 A;  4BIO A;  1E1O A;  3O65 A;  5GTI Z;  2Q68 A;  3E35 A;  2RN9 A;  4RAI A;  1QR9 A;  3LNN A;  4C7U A;  3I7F A;  3RKY A;  4PJ0 Z;  3A7A A;  3E8H A;  4LF9 O;  5IJ9 A;  4O4H B;  1JA8 A;  1H4S A;  1VQP V;  2DKG A;  1OJH A;  5IYZ B;  2IJH A;  4UVA A;  2EJ7 A;  1JPX A;  4K3A A;  4MTG A;  4DYL A;  3LC0 A;  2IY5 A;  4FFB A;  2A06 H;  4PA3 A;  2HEP A;  1BIB A;  4XTU A;  4YJ3 A;  2E65 A;  2UU9 O;  1FXV A;  2K9P A;  2WLI A;  2JJ1 G;  4YCW A;  4J10 A;  3T4D A;  1X4T A;  2JEU A;  5LYJ B;  4JYC A;  4G85 A;  1G5H A;  3AG2 C;  2ITD C;  1KC8 W;  1HR0 O;  4GYC B;  4FLU A;  2EX3 A;  1Y4M A;  3BRC A;  1HR0 B;  4LF6 B;  1WB7 A;  3JAS B;  1GO3 F;  3SPJ A;  4A5U B;  2Q0A A;  2LO1 A;  3L2Z A;  3K0D A;  4BR6 A;  2CDY A;  2XTI A;  2IJK A;  1YSC A;  3HB3 B;  4X5O A;  2QKA A;  5KUM A;  4TUY A;  5BY1 A;  1NH2 B;  3OW2 U;  3LDC A;  4NYK A;  3K57 A;  4BWA A;  5B66 Z;  4HNA A;  4LVK A;  3FYE B;  4FZ1 A;  1TA8 A;  2H8P C;  1EZV H;  4HWO A;  4LF5 B;  1GTO A;  3CC7 V;  2FML A;  4LFB O;  3CRA A;  3C3S A;  4GUN A;  3G67 A;  2ZGW A;  3JD3 A;  5KAF Z;  2WLL B;  4LP8 A;  1EM1 A;  4JF3 A;  2CTQ A;  1VF6 C;  4O4L A;  4DV2 O;  3CHX A;  3K5L A;  3ABL B;  2CE4 A;  2QWN B;  2CJB A;  1Q8I A;  5IJ0 B;  2DJV A;  2AZ0 A;  3AK2 A;  3T1H B;  2ART A;  3G6B A;  2QTS A;  2J3M A;  2CH7 B;  3ABM B;  3SPH A;  4DV3 B;  4WF9 V;  5IY5 B;  4R8C A;  2XAF A;  1DLB A;  2P4V A;  4WFA V;  1ZLZ A;  3IJ4 A;  1M90 W;  3W3S A;  4X62 B;  4UP9 A;  4FFK A;  2ETN A;  3AEI A;  4Q20 A;  4ZI7 B;  1BT8 A;  1HC7 A;  4JI3 O;  4J9Y B;  4NXM O;  1DF5 A;  1NBM G;  2GHY A;  3L73 H;  2E10 A;  3H1I H;  1FAF A;  1ARO P;  1EIY B;  4JI4 B;  2M7W A;  3M4P A;  2CIM A;  2E3C A;  1PP9 H;  3OFN G;  4IIJ B;  1NR7 A;  4MVM A;  2HHH O;  1X2H A;  4J80 A;  5GON A;  2ZR2 A;  1THZ A;  2P5I A;  4PDV A;  2L6L A;  3VQX A;  3UFG A;  2KKW A;  5TIS Z;  5CB4 A;  1GM7 A;  4UV9 A;  1HW7 A;  2EJR A;  3IKL A;  2N74 A;  4P9P A;  4UXN A;  3T2M A;  1G8M A;  1VQL V;  2UXB B;  3OEE G;  3HXY A;  3LSU A;  4AQY O;  2IM9 A;  4U3F H;  4B7K A;  4I4T B;  1OZ0 A;  2QHU A;  3H1L H;  2RHQ B;  3FYI B;  3MD0 A;  5LHG A;  4MTO A;  1VQK V;  1N33 O;  3V8J A;  2PYJ A;  1R3L C;  2YI8 A;  1PL0 A;  3OEH G;  5B1B C;  3T4Z A;  1USY C;  2BTO A;  5JCO A;  4O2B B;  1LUV A;  4XTX A;  3SYC A;  1TUB B;  4DPG A;  4JV5 B;  3FAV B;  2NS6 A;  4PEL A;  4XEO A;  1SQF A;  2UXC O;  1SER A;  4TOI A;  3SYP A;  2UXC B;  1YFT A;  3FB8 C;  4LWS B;  4NVP A;  3IGA C;  1N4C A;  3JAR B;  4GKJ O;  1X59 A;  1DK1 A;  4X1I B;  2Q4P A;  1GAX A;  3OE7 G;  3W7T A;  3REX A;  4K0K O;  4TTV A;  1UJW B;  3G4S V;  4B7E A;  1OCC C;  3P30 A;  4JI1 B;  4O2A A;  4ZIB A;  4WI1 A;  1EQR A;  4MVR A;  5CA0 A;  1EBO A;  4YRL A;  2UXD B;  2DE0 X;  1TVK B;  3K58 A;  4P72 C;  4DV4 O;  1WQW A;  1PNK A;  2P6J A;  1W0J G;  1EVK A;  1SQP H;  3H1J H;  3ICX A;  3JAT A;  3KCX A;  4G84 A;  2YEV A;  3RWR D;  4DV3 O;  2RDC A;  1PV0 A;  1ASY A;  4X1K A;  2ZDI A;  2X6C A;  1W66 A;  1M56 C;  2Q5I A;  1SA0 A;  3SYQ A;  3S3X A;  4JI7 B;  2EIK C;  1IBL B;  1KD1 W;  2QHS A;  3RYC A;  4JI7 O;  1YB3 A;  2C8M A;  4MVZ A;  1HNW O;  2RCV A;  2XAS A;  4AH6 A;  1Q6H A;  3D36 A;  2Y0I A;  2M6Y A;  2K1E A;  2RHQ A;  4LF9 B;  2HLD G;  4DV0 O;  1SKV A;  3B40 A;  3K5M A;  3K08 A;  1KBH A;  2BCC H;  3L75 H;  1B70 B;  3ICA A;  5J9P C;  3JCU Z;  2Q7G A;  1D5N A;  4H2V A;  1ZX3 A;  4GCZ A;  4R50 A;  3UM7 A;  2YI9 A;  5L3F A;  3CME V;  1S76 D;  4EFB A;  4DR5 O;  2P7T C;  4CC5 A;  5B5E Z;  3N2G A;  1SQG A;  4JTC B;  4I55 A;  3UGQ A;  3K06 A;  2IH3 C;  2F1M A;  3ZRW A;  5IWA B;  1R73 A;  3UT5 B;  2JDI G;  5CBG A;  5DEC A;  3WFV A;  2QSA A;  4LNU A;  4JI2 O;  1H2N A;  4IIJ A;  3K3W A;  4YCU A;  1WN7 A;  2ZXF A;  4DR6 B;  3HFZ A;  3W7W A;  2HFE C;  3A0R A;  4DV7 O;  1H4V B;  2GSM B;  4QPK A;  5H5N A;  1X01 A;  4X64 B;  5LP6 A;  1ADJ A;  5J2T B;  1Q86 W;  4AIL C;  2DYS C;  4JI6 O;  1AIL A;  1SQV H;  1Y76 B;  1FXK C;  3EHB B;  3HFV A;  2QTO A;  1H2G A;  2ALY A;  2UXN A;  2E5L O;  1N32 O;  2YIB D;  4I5S A;  2ZIO A;  3K5O A;  1ADY A;  1WPY A;  1V55 B;  3ZIA G;  3TEH B;  5EZY A;  3W7X A;  4P3P A;  2GTS A;  3HRI A;  3TET A;  4LFB B;  4OX9 O;  1W2B U;  4YRG A;  3ERR A;  2B9Z A;  1RM1 B;  2ZT7 A;  3WU2 Z;  3HPL C;  4JI5 O;  5JVD A;  5IY5 C;  2Q5Z A;  2LFS A;  1KKD A;  4OPA A;  2OIG A;  4JI1 O;  1EN6 A;  2DOS A;  1AI6 A;  3JYC A;  4NTW A;  4X66 B;  4LF6 O;  5A2Q N;  1I5Y A;  4FMT A;  1K33 A;  1X55 A;  2P0L A;  1M93 A;  1YXB A;  5DM6 V;  2PI4 A;  1PD3 A;  1PYS B;  1U97 A;  1Y76 A;  4DUY B;  1F4N A;  2LW7 A;  5C52 B;  4PI0 A;  1SQQ H;  3E8G A;  5LXT A;  4YRQ A;  1Q3E A;  4PHZ A;  2LW1 A;  5CA1 B;  3GB7 C;  5LP6 B;  2BTQ A;  2XGT A;  1YJ9 V;  1SES A;  3B77 A;  4FK5 C;  2QJ1 A;  4P3O A;  3A32 A;  3ZRX A;  2FL4 A;  2CJ9 A;  1Q82 W;  4HAM A;  1K7D A;  4WBN B;  3BVO A;  3TUP A;  3CMA V;  2ZE5 A;  4CC6 A;  4WF2 A;  4Z2W A;  1ENV A;  4PA9 A;  4LF8 O;  1XL6 A;  3DTU B;  1GGM A;  3ABT A;  1JCH A;  4P71 C;  3B2E E;  5EC1 C;  1JJO A;  4TT3 G;  3SDL A;  3CCL V;  5JJN B;  5DED A;  2E74 B;  2F4V B;  3JAW A;  1EVL A;  2DTH A;  4H2W A;  4YP0 A;  3U0Z A;  3A7U A;  5CA3 A;  4KR2 A;  2WWW A;  2AHZ A;  5FLX N;  4J9Z B;  1NJ1 A;  1IZ3 A;  2ZIN A;  5IWA O;  2WPD G;  2WLH A;  3ZMT A;  2ZR3 A;  1BE3 H;  4YRJ A;  4O2D A;  1V54 C;  2A0L A;  4FZ0 A;  3WG7 C;  2CUG A;  5KUK A;  1XNR B;  2YXL A;  2BE3 A;  4HVC A;  2EWN A;  5B1N A;  1JMK C;  1RSO B;  4P73 A;  3A74 A;  3RYC B;  2Y4U A;  4UB6 Z;  1HWY A;  1K5Q A;  3FB6 C;  3O9O A;  4X8A A;  1KP2 A;  4PDL A;  2ZT6 A;  1NS1 A;  4DR2 O;  4LF8 B;  4RQE A;  2R72 A;  2GBO A;  1WU7 A;  2YEV B;  3SR2 C;  1OCO B;  5EYP B;  4DRX A;  1HXD A;  4P75 C;  2B1I A;  4FLW A;  2YC0 A;  5L3B A;  3PCO A;  5LMU O;  1BGY H;  4FLZ A;  2F4V O;  1XBL A;  3V8L A;  1NNH A;  4Z1V A;  3CC4 V;  2HR3 A;  1QR8 A;  4LBE C;  3HR0 A;  2I4N A;  1EZJ A;  3QO8 A;  1K3E A;  4H13 B;  4O2A B;  3TGU H;  2BOB C;  3MEY A;  3UH0 A;  1L0W A;  1MNG A;  5K1P A;  1T5E A;  3C90 A;  2VWJ A;  2P06 A;  3TXS A;  1XMQ O;  3HTZ A;  2XAQ A;  4XU2 A;  3JD4 A;  1SZX A;  2NNU A;  4CZZ A;  3PCO B;  3JAR A;  3NR7 A;  1X56 A;  1PNM A;  2WLK A;  4DO2 A;  3L71 H;  4KXR A;  1KMN A;  1GRJ A;  3QF7 A;  4ZHQ A;  2Y69 B;  1PM9 A;  2ODR C;  1NJ8 A;  4LH6 A;  3T1Y O;  1FJG B;  1Z2G A;  2E64 A;  3ZBH A;  4P30 A;  1GN6 A;  4I50 B;  4KR3 A;  2N05 A;  1FD9 A;  5KHJ A;  4F6R B;  3QO7 A;  1GM8 A;  4JTD B;  3B8N A;  4UVC A;  4UCV A;  3KCY A;  2ZE6 A;  2P67 A;  4I4T A;  4YRP A;  1YJN V;  2QE7 G;  5LL6 Y;  3AG4 B;  3HKD B;  4OGQ B;  2ZM6 B;  1BMF G;  2ZT5 A;  4O4J B;  2GUZ B;  2QWO B;  4YJ2 A;  4JV5 O;  1AVM A;  3ZRS A;  1QQC A;  3VQY A;  2PTM A;  2UXD O;  2DZC A;  4QGP A;  4IHJ B;  4LR3 A;  2XUM A;  3I5D A;  5KA6 A;  1VQ6 V;  1B7Y B;  1N34 O;  5KHK A;  1QHT A;  1M57 B;  5LXT B;  2ZCE A;  1N33 B;  2O57 A;  4FLV A;  3BAA A;  1HDJ A;  1V9P A;  1O9G A;  5ITZ A;  3ETG A;  1MSW D;  3AK1 A;  2XAG A;  2ZKO A;  4X1Y B;  2JRI A;  4HWP A;  1N0N A;  4YIO A;  3HRK A;  1YTF B;  3AG3 C;  1MSD A;  3ZHT A;  3JD2 A;  4YYE A;  3NET A;  2EJ9 A;  1USY A;  4R7C A;  3APO A;  3CRC A;  1GMG A;  1TGO A;  1X54 A;  4BIU A;  1HNW B;  1K5S A;  4IYI A;  5CA1 A;  4LC1 A;  3NEL A;  2E5A A;  4EEQ A;  3I55 V;  5BMV A;  4O4I B;  3P8T A;  4YY3 O;  2QGN A;  4UP8 A;  4WFH A;  1WB8 A;  2KB1 A;  4X65 B;  1PNL A;  3G71 V;  4IL6 Z;  4LFC B;  3RKW A;  2LGQ A;  3CJH A;  3FJP A;  1LUW A;  4PA4 A;  3L72 H;  1WNS A;  4DV4 B;  2ALY B;  4O4I A;  5J2U A;  4DR5 B;  5FNV A;  3STZ C;  1IBK O;  4QE9 A;  2RHS A;  3MQZ A;  3CE2 A;  4NB5 A;  4JI5 B;  2H94 A;  2PI5 A;  3H1K H;  2DZ9 A;  3WB1 A;  4YDQ A;  3IAL A;  2YXH A;  3ABK C;  3CD6 V;  2R70 A;  3RYI A;  3AG1 B;  3SPI A;  1S5H C;  3VQW A;  2YDE A;  2UUC B;  1NTM H;  3LSS A;  1ZWI C;  5ELO A;  3SJA C;  3B09 A;  4YRO A;  2CTP A;  4X1Y A;  1I94 B;  2V7Q G;  5BR8 B;  5C8Y A;  3D3I A;  4NTY A;  5ITZ B;  2ODR D;  1IDS A;  4OLF A;  2ZT9 B;  3H01 A;  1EFW A;  3H9V A;  2Q7E A;  3VBB A;  5LGN A;  1NT2 B;  2RNB A;  4J7J A;  2QA4 V;  1R6N A;  4DXW A;  3KG2 A;  1HNZ B;  2XHB A;  5EIB D;  2GUZ A;  4CS3 A;  1L1F A;  4LF5 O;  2ATK C;  4HYO A;  4R6Z A;  3DSQ A;  5GTH Z;  3JAS A;  1YJW V;  1YI2 V;  3QNE A;  2DXT A;  1K34 A;  5IT9 N;  2EIJ C;  1WYD A;  1H2M A;  4EX5 A;  5LYJ A;  3IC7 A;  2Q67 A;  1SET A;  3ASO C;  1VQZ A;  4B3R B;  4I50 A;  3THO A;  2LP7 A;  2JVD A;  4DUZ B;  3S3W A;  3U10 A;  4YRN A;  1BIA A;  4FFB B;  4H02 A;  1AR4 A;  1NZ6 A;  5C51 B;  4YJ2 B;  1WNL A;  1I94 O;  3OM3 B;  3OT7 A;  2EL9 A;  4NR1 A;  4LF7 B;  2UUB O;  5A9G A;  3V8K A;  2CGN A;  2A3Q A;  5JCO C;  4LF7 O;  1VQM V;  1PPJ H;  4XDJ A;  3SPC A;  3RGL A;  3DC5 A;  4X20 B;  3NEM A;  4TWK A;  1Q5O A;  5LA6 A;  1RIQ A;  4MSW C;  5IYD O;  1J95 A;  3KKY A;  2WLM A;  3FB7 C;  4PHC A;  4JPR A;  4JI4 O;  2ZZG A;  4XDK A;  2UXX A;  4DQ2 A;  4WCE V;  1BZK A;  4ZHQ B;  4KQE A;  1VQN V;  4CH5 A;  3QVN A;  4H2T A;  1CPY A;  4ASU G;  1KYO F;  4GT1 A;  2EIN C;  3CPW U;  5EYP A;  4DRX B;  5KX5 A;  3UQ8 A;  2CTW A;  1N32 B;  1YIJ V;  3A0B Z;  2RJZ A;  2CJA A;  3SYA A;  3CCM V;  2PZS A;  1S0V A;  2QM4 A;  3BA8 A;  3N2K A;  4PA6 A;  1JQ0 A;  1ZSP A;  3F7Y C;  2EIL C;  1M5I A;  1ZL8 B;  1VF7 A;  3CSX A;  2A79 B;  1J5E B;  4ZTZ B;  4YPF A;  3A31 A;  3JAL A;  5KNN A;  1SZT A;  5K1X A;  1RFY A;  2MK3 A;  1YFS A;  1KEC A;  1K9M W;  4LVL A;  4U7O A;  5EBW C;  1XNQ O;  2OCH A;  1Y6X A;  3I56 V;  4LWS A;  3CRQ A;  3R66 A;  4MW8 A;  1BS3 A;  4OP0 A;  1MZF A;  3OAA G;  3HKC B;  4JAA A;  3OD1 A;  4MVS A;  4JAV A;  1B3Q A;  4DV1 O;  4ICG A;  3IC9 A;  4O2B A;  4DUY O;  2ZXW C;  1RSO A;  3BAB A;  4OXS A;  3E89 A;  3CCS V;  1VQ7 V;  3RBZ A;  2KQX A;  3K0G A;  1BSM A;  1QU7 A;  4U3J B;  1JOY A;  3BEH A;  5FPR A;  3OUF A;  1AI4 A;  2LFR A;  1AR5 A;  4DR4 B;  4UCO A;  2Q0O C;  2X7R B;  3RL6 A;  5IDJ A;  1IX9 A;  4RUE A;  4DR3 O;  3L4G B;  1G6U A;  3AG2 B;  1LNQ A;  2JIZ G;  1E79 G;  2Y69 C;  5IYB O;  5GW7 A;  1CXZ B;  5B1A C;  1WP8 A;  3IFX A;  4B3R O;  2VS0 A;  4AI8 A;  1N0J A;  3LDE A;  4E4E A;  4I9Q A;  3M7M X;  1PYS A;  2Q6A A;  2P90 A;  1VQ4 V;  5CBF A;  2DWD C;  5C8Y B;  1E24 A;  1M4U A;  4YRM A; 
#chains in the Genus database with same CATH homology
 3A2F A;  3A32 A;  3MF1 A;  2CJ9 A;  3EFR A;  3U11 A;  4WBN B;  5JH7 B;  3TUP A;  4WJ4 A;  4DV0 B;  3RYF A;  4CC6 A;  4WF2 A;  4YRC A;  3HXV A;  3SJC C;  3RYI B;  1XNQ B;  1GGM A;  4EB6 A;  4H2X A;  5HGQ A;  4CH4 A;  4AQY B;  1D5A A;  4P71 C;  1WQ7 A;  4TQD A;  1NJ6 A;  3RIR A;  3B2E E;  3KFU A;  1JJO A;  4K8X A;  5JJJ B;  3HKB B;  3PN1 A;  5JJN B;  2AMC B;  2RQ6 A;  2RHS B;  2DJZ A;  2F4V B;  5KMG B;  2JGU A;  5JVD B;  3JAW A;  3BPZ A;  5J2U B;  4CH6 A;  1E1O A;  1EVL A;  2DTH A;  3U0Z A;  4H2W A;  4YP0 A;  3A7U A;  4FVM A;  1LYL A;  4P73 C;  4NCX A;  4KR2 A;  1FFX A;  4K8Z A;  4GKJ B;  1P49 A;  3LNN A;  1WLE A;  3I7F A;  3RKY A;  3M4Q A;  4FLY A;  3A7A A;  1BBU A;  5IJ9 A;  1NJ1 A;  4O4H B;  1H4S A;  2E1H A;  2ZIN A;  3FFQ A;  4UCT A;  2DKG A;  5IYZ B;  4B08 A;  3TEH A;  2DTI A;  2ZR3 A;  2DU7 A;  3HY0 A;  4YRJ A;  3L1A A;  3WQZ A;  4O2D A;  4HNA B;  3QO5 A;  3LC0 A;  1XNR B;  2YXL A;  4Q6G A;  5IJ0 A;  2DTO A;  3HY1 A;  1BBW A;  4D7T A;  2I4L A;  2IY5 A;  3RFR A;  4HVC A;  2EWN A;  4FFB A;  1JMK C;  4P73 A;  5ELN A;  3A74 A;  3RYC B;  4BW9 A;  5KMG A;  1JJC A;  2HEP A;  3V7R A;  4YRM A;  1BIB A;  4WJ3 M;  4XTU A;  4YJ3 A;  2E65 A;  1NYQ A;  2DQ3 A;  2ZT6 A;  4YCW A;  5GON B;  1H4Q A;  3HFZ B;  4LNS A;  1X4T A;  5LYJ B;  4LF8 B;  4YRR A;  4EO4 A;  4RQE A;  4G85 A;  5E3I A;  3RYH B;  2R72 A;  1G5H A;  1YGB A;  1WU7 A;  4GYC B;  1S5J A;  2CAZ C;  5EZY B;  3SR2 C;  4FLU A;  5LP6 C;  4HWS A;  2EX3 A;  3BRC A;  5KHH A;  1HR0 B;  5EYP B;  4DRX A;  4LF6 B;  3JAS B;  1HXD A;  4FLW A;  4P75 C;  3PCO A;  3BFM A;  4KL1 A;  3K59 A;  4ZOL B;  4FLZ A;  1H4T A;  2ZZE A;  2Q0A A;  2GV9 A;  3V7S A;  1EIY A;  1QF6 A;  4TUY B;  4YRI A;  4RMF A;  4NXN B;  3V8L A;  3L2Z A;  1NNH A;  4J15 A;  2I4N A;  3QO8 A;  4O2A B;  4DV2 B;  1H2S B;  3NEN A;  2XTI A;  1B04 A;  3ZED A;  4X5O A;  3MEY A;  3UH0 A;  1L0W A;  2Q5H A;  2IY5 B;  4TUY A;  5K1P A;  1HTT A;  4JI2 B;  1T5E A;  3L4G A;  3K57 A;  2VWJ A;  4BWA A;  4HNA A;  3HTZ A;  3UGT A;  4XU2 A;  4LNU B;  4LVK A;  3PCO B;  3JAR A;  3HKD A;  1TA8 A;  4ZTU B;  1X56 A;  2EAY A;  3E22 B;  4LF5 B;  4HWO A;  1JFF B;  1G5I A;  2JS5 A;  4U3J A;  2ZNJ A;  4UP7 A;  4DV5 B;  1KMN A;  2ZGW A;  3QF7 A;  4YRS A;  4ZHQ A;  2ODR C;  5D5Q A;  1NJ8 A;  4LH6 A;  4UCR A;  4O4L A;  2E5L B;  4LF4 B;  1FJG B;  4DR3 B;  3CHX A;  3K5L A;  1JJC B;  2E64 A;  1NJ5 A;  4FLT A;  4O4L B;  2CJB A;  4YRT A;  4I50 B;  1Q8I A;  5IJ0 B;  4KR3 A;  4P74 C;  5KHJ A;  3T1H B;  2ART A;  3RF1 A;  4F6R B;  3HKC A;  3HKE A;  3QO7 A;  4RDX A;  2J3M A;  3P8Y A;  2R9A A;  4UCV A;  4DV3 B;  4UCS A;  3E9H A;  4I4T A;  3BJU A;  1ASZ A;  4YRP A;  4XTV A;  3HKD B;  4DV6 B;  2ZM6 B;  3RUX A;  2ZT5 A;  4O4J B;  1EOV A;  3W3S A;  4X62 B;  4YJ2 A;  2A8E A;  4TQF A;  4UP9 A;  4YRF A;  1TVK A;  3REU A;  3JAL B;  1QQC A;  4ZI7 B;  3VQY A;  2PTM A;  2QHT A;  3K5N A;  3SGI A;  2DZC A;  1HC7 A;  4IHJ B;  2YIB A;  4LR3 A;  4DR1 B;  5C53 B;  1B7Y B;  2E10 A;  4TV9 A;  5KHK A;  1QHT A;  4FLX A;  5LXT B;  3OTO B;  2ZCE A;  1N33 B;  3N2K B;  4DV7 B;  4FLV A;  3A7R A;  3BAA A;  1EIY B;  1KOG A;  4JI4 B;  1V9P A;  4CS2 A;  2PYL A;  4JI8 B;  1O9G A;  5ITZ A;  4XU1 A;  3M4P A;  4DV1 B;  2UUB B;  3CMQ A;  4X1I A;  4X1Y B;  2E3C A;  2CIM A;  4L8J A;  2F93 B;  4YHH B;  4HWP A;  4IIJ B;  3JAT B;  3HRK A;  5KX5 B;  1Q43 A;  3RKX A;  4YYE A;  2EJF A;  3NET A;  1X2H A;  2EJ9 A;  1USY A;  2DU5 A;  1NYR A;  5GON A;  4DK1 A;  2ZR2 A;  4HBN A;  4H2U A;  1FYF A;  2P5I A;  3QG5 A;  3IAY A;  3MF2 A;  4I55 B;  3VQX A;  3EFS A;  3G1Z A;  2UUA B;  3UFG A;  1TGO A;  1X54 A;  5CA0 B;  2F66 C;  2KKW A;  4B3T B;  1O9H A;  1HNW B;  5CB4 A;  5CA1 A;  1J5W A;  3NEL A;  4TVA A;  4YRK A;  1Z5W A;  2E5A A;  1HW7 A;  4EEQ A;  5BMV A;  3IKL A;  4O4I B;  3P8T A;  3BA9 A;  2OYQ A;  4UP8 A;  1C0A A;  2UXB B;  3CB2 A;  3HXY A;  4X20 A;  5LA6 B;  1E1T A;  4X65 B;  4B3M B;  2PY5 A;  4LFC B;  3RKW A;  2IM9 A;  2OWO A;  1DGS A;  3FJP A;  4I4T B;  1G51 A;  2QHU A;  2RHQ B;  2AKW A;  4DR7 B;  1WNS A;  4DV4 B;  3V8J A;  2PYJ A;  2ALY B;  4P74 A;  2YI8 A;  2VWK A;  1TUB A;  4O4I A;  3OTF A;  3JAW B;  3JSN A;  5J2U A;  4DR5 B;  5FNV A;  1USY C;  3RAC A;  2BTO A;  2I4O A;  4CS4 A;  5JCO A;  4O2B B;  2RHS A;  2FYK A;  3MQZ A;  4JI5 B;  4XTX A;  5CB4 B;  2DZ9 A;  3WB1 A;  2DDZ A;  2P5O A;  4YDQ A;  1TUB B;  3RGB A;  4DPG A;  4JV5 B;  3IAL A;  2ZTG A;  2NS6 A;  4XEO A;  4EB6 B;  3WB2 A;  1SQF A;  4UFZ A;  2R70 A;  3RYI A;  3VQV A;  1SER A;  4TOI A;  2UXC B;  3VQW A;  1YFT A;  3TEG A;  2UUC B;  4WBN A;  11AS A;  3QTC A;  3E22 A;  4NVP A;  1TAE A;  2DEQ A;  3LSS A;  5ELO A;  3SJA C;  3JAR B;  4YRO A;  4X1Y A;  4X1I B;  1I94 B;  5BR8 B;  5C8Y A;  2G4C A;  3HXW A;  4HT4 A;  4TV8 A;  5ITZ B;  2ODR D;  5JJE B;  3REX A;  2PME A;  4OLF A;  1YFR A;  4TTV A;  1EFW A;  2Q7E A;  3VBB A;  3BHP A;  2VQF B;  2BTQ B;  1X2G A;  1NT2 B;  4JI1 B;  4O2A A;  4JI0 B;  4ZIB A;  4WI1 A;  1EQR A;  5CA0 A;  3R07 A;  1B76 A;  4YRL A;  2I4M A;  1HNZ B;  2UXD B;  2XHB A;  3JSL A;  2J3L A;  5EIB D;  1TVK B;  3K58 A;  4P72 C;  4CS3 A;  4ZOL A;  1WQW A;  4P75 A;  4UPA A;  3DSQ A;  2DVE A;  3JAS A;  1EVK A;  1KMM A;  4XU0 A;  4LFA B;  3ICX A;  3QNE A;  3JAT A;  5LOV A;  4G84 A;  2DXT A;  3RWR D;  1WYD A;  4HA8 A;  3RYH A;  1SRY A;  4EX5 A;  1ASY A;  5LYJ A;  4X1K A;  3HKE B;  1W66 A;  3A5Y A;  2UU9 B;  2Q5I A;  1SET A;  4JI6 B;  1VQZ A;  2E41 A;  4XTZ A;  1SA0 A;  4B3R B;  4JYA B;  4I50 A;  4XU3 A;  4FM2 A;  4JI7 B;  3THO A;  2V4D A;  1IBL B;  4KHP B;  2JVD A;  4DUZ B;  2QHS A;  4YRN A;  3U10 A;  5FNV B;  3RYC A;  1BIA A;  1YB3 A;  2C8M A;  3IG2 A;  4FFB B;  4H02 A;  4UCU A;  4AH6 A;  5C51 B;  4TVY A;  4YJ2 B;  1WNL A;  4K87 A;  2EL9 A;  4LF7 B;  4OX9 B;  2RHQ A;  3V8K A;  4LF9 B;  3HXX A;  1JFF A;  3ETQ A;  5LOV B;  4FM0 A;  1SKV A;  5JCO C;  3K5M A;  1QE0 A;  3RGL A;  1I7F A;  1IBM B;  4K86 A;  4LH7 A;  4X20 B;  3NEM A;  4RQF A;  1Q5O A;  5LA6 A;  1B70 B;  1E22 A;  1RIQ A;  12AS A;  2P22 C;  2EJG A;  2PMF A;  3ICA A;  3IKM B;  4AHC A;  2Q7G A;  4H2V A;  4E51 A;  4NXM B;  5BMV B;  2YI9 A;  5EIB C;  4K88 A;  5J2T A;  5D5P A;  4PHC A;  2ZZG A;  4EFB A;  2AMC A;  3WB0 A;  4TVW A;  4H2Y A;  4HWT A;  4CH3 A;  4CC5 A;  3N2G A;  4DQ2 A;  1SQG A;  4I55 A;  4K0K B;  3UGQ A;  4ZHQ B;  1L8D A;  4KQE A;  3HXU A;  4LVM A;  4CH5 A;  4HWR A;  3PZC A;  4H2T A;  4H2X B;  2F1M A;  4YRE A;  5IWA B;  3UT5 B;  1Z7M A;  2DQ0 A;  4XEM A;  3RYF B;  4D7S A;  5EYP A;  4DRX B;  5KX5 A;  3UQ8 A;  4DK0 A;  1N32 B;  1ATI A;  5JH7 A;  1WPB A;  1Z7N A;  4PG3 A;  3V7C A;  2Q7H A;  4LNU A;  3UT5 A;  2RJZ A;  4IIJ A;  2CJA A;  4YCU A;  1WN7 A;  2VQE B;  2ZXF A;  4DR6 B;  3HFZ A;  4GLX A;  2PZS A;  4GKK B;  4P72 A;  2ARU A;  1H4V B;  3E9I A;  2YIA A;  4YCV A;  1IL2 A;  2QM4 A;  2PGG A;  3N2G B;  1X01 A;  3BA8 A;  3N2K A;  1N36 B;  4X64 B;  1B8A A;  4YJ3 B;  2PUS A;  1XQ8 A;  3JAK B;  5LP6 A;  5LMN B;  1ADJ A;  4H2S A;  1M5I A;  5J2T B;  1IBK B;  1VF7 A;  1B7Y A;  4IHJ A;  3CSX A;  1J5E B;  4ZTZ B;  4FM1 A;  4AIL C;  4YPF A;  3A31 A;  3JAL A;  4ZI7 A;  5KNN A;  5K1X A;  2HHH B;  1YFS A;  2CGH A;  4TV8 B;  3HFV A;  4LVL A;  1B70 A;  2ALY A;  4P3N A;  4O4J A;  3P8V A;  4P71 A;  5JQG A;  1KU9 A;  2QHV A;  2YIB D;  1XHX A;  2AKW B;  2ZIO A;  3K5O A;  1XHZ A;  1ADY A;  3MAQ A;  1WPY A;  5KHG A;  4TWA A;  1XMQ B;  1N9W A;  3LSQ A;  4XTY A;  3TEH B;  2F95 B;  5EZY A;  4P3P A;  5IJ9 B;  2C7I A;  4F6R A;  4LFB B;  3HRI A;  4OP0 A;  3HKC B;  3OD1 A;  2ZZF A;  4YRG A;  1XI1 A;  4YY3 B;  3ERR A;  2ZT7 A;  1KMI Z;  2DXU A;  5JVD A;  1YEW A;  4O2B A;  1RSO A;  3BAB A;  4TVA B;  3T1Y B;  3HXZ A;  1SA0 B;  3ZS8 C;  4XTW A;  1ZAU A;  4PI2 A;  1HNX B;  3A5Z A;  4X1K B;  2HNI A;  4L87 A;  4U3J B;  5FPR A;  5IYZ A;  4X66 B;  4Q15 A;  1Z5V A;  4O4H A;  1X55 A;  2P0L A;  5FPO A;  1M93 A;  3SJB C;  4DR4 B;  4UCO A;  5JQG B;  3RL6 A;  4LVJ A;  1FFX B;  4B3S B;  3L4G B;  1G6U A;  2ZNI A;  1PYS B;  4DUY B;  5C52 B;  4PI0 A;  1NJ2 A;  5LXT A;  4YRQ A;  4DR2 B;  5F5W A;  3HKB A;  4EFE A;  5CA1 B;  1Q3E A;  4PHZ A;  4TV9 B;  1XMO B;  2ZT8 A;  2ZIM A;  2BTQ A;  3JAK A;  4JI3 B;  5LP6 B;  2XGT A;  2ARS A;  4I9Q A;  1SES A;  3M7M X;  1N34 B;  1PYS A;  4LVI A;  5C8Y B;  5KHI A;  5LMU B;  1E24 A;  2QJ1 A;  1M4U A;  4P3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...