2ZNJA

Crystal structure of pyrrolysyl-trna synthetase from desulfitobacterium hafniense
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
278
structure length
278
Chain Sequence
SSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolysyl-tRNA synthetase-tRNA(Pyl) structure reveals the molecular basis of orthogonality
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase
molecule keywords Putative uncharacterized protein
total genus 79
structure length 278
sequence length 278
chains with identical sequence B, C
ec nomenclature ec 6.1.1.26: Pyrrolysine--tRNA(Pyl) ligase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2znjA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2znjA02
3A5ZA 1G5HA 1B8AA 1O9HA 1BIAA 3HTZA 2J3MA 2ZXFA 4J15A 3RKYA 2ZZEA 1Z7NA 5E3IA 4UPAA 3HXWA 1VQZA 3QO7A 4XTUA 3P8YA 4YRGA 3LSSA 3UGTA 2ZIOA 1YFSA 2ALYB 4DQ2A 4XU0A 4RQFA 4YRQA 4YRIA 4H02A 1H4TA 4OLFA 2ZNJA 3QO8A 4TVYA 4TWAA 4P3OA 1X56A 2ZINA 2ODRD 4XTYA 3ZEDA 3RF1A 1NNHA 2PMEA 2E1HA 2PUSA 4HWTA 4H2UA 4P71C 3BJUA 3VQVA 3UFGA 3V7RA 3P8TA 3LSQA 1NJ2A 3A74A 4H2WA 2P5IA 4H2XA 2DTIA 4K87A 1BBUA 1YGBA 5F5WA 1EVKA 4RQEA 3IKLA 1EVLA 1HTTA 1PYSA 2DEQA 4UP8A 2QJ1A 4HVCA 3A7RA 2JVDA 2C8MA 4TVAA 4KQEA 4XTZA 3HXXA 1EQRA 4CS3A 4ZTZB 2DU5A 3HXVA 4XEOA 4Q6GA 3MF1A 4BW9A 1B7YB 4BWAA 5C51B 3RKXA 1X54A 2RHQB 3RGLA 2EWNA 2DXTA 4YRFA 1H4QA 2R72A 4TTVA 4YRLA 1L0WA 1USYC 3A31A 3A32A 2Q5IA 3UGQA 3V8KA 3DSQA 5K1XA 4TVAB 3TEHB 2QHSA 4AH6A 2PMFA 12ASA 2ZGWA 3PCOB 1X2HA 1X01A 2DKGA 1EFWA 1QF6A 4LNSA 1B70B 2YI8A 3QO5A 1YFTA 4L87A 4P3PA 4XTXA 4NCXA 5ELNA 2RQ6A 3QTCA 4YDQA 1O9GA 1B76A 4OP0A 2YI9A 2AMCA 3E9IA 2ZR3A 3HFVA 3RKWA 1X2GA 2ZT6A 3PCOA 3HXZA 2IY5A 2ZCEA 2Q7GA 3PZCA 4YREA 2HEPA 2XGTA 4P74A 4CH4A 3VQXA 1G5IA 4YROA 3A7AA 3P8VA 1WLEA 4TQDA 2QHTA 4H2SA 4EO4A 2E65A 2XTIA 3ICAA 3KFUA 1NYRA 3HXUA 4P72C 3HXYA 2I4LA 1SESA 2CJAA 4YCUA 3L4GA 4P73A 4YRTA 3A7UA 3MEYA 11ASA 3REUA 2EJFA 4RDXA 4YRNA 2YIBA 2DQ3A 2DQ0A 2ODRC 4P75A 4YRRA 3V7SA 4CH5A 3TEGA 3MF2A 3QNEA 5C53B 1ADYA 1WPYA 1E24A 3FJPA 1C0AA 5C52B 3W3SA 1IL2A 1JJCA 1Z7MA 1EIYA 1YB3A 4WF2A 4TQFA 3NEMA 1ATIA 4H2XB 2ZT7A 1E1TA 4CH6A 2R70A 2CIMA 1BIBA 3CMQA 2ARTA 3RUXA 4TVWA 4O2DA 3L1AA 4YRKA 3VQYA 4YRJA 4H2YA 1SRYA 2ZNIA 2ZZGA 4XEMA 2Q7EA 5KNNA 4G84A 3LC0A 4UP9A 2HNIA 1NJ1A 1J5WA 2G4CA 3REXA 3L4GB 4P71A 1WQ7A 4XU1A 2RHSB 1G51A 2DJZA 1E22A 3NELA 4H2TA 3IKMB 3G1ZA 1WU7A 2ALYA 4YPFA 4EX5A 2E3CA 2CGHA 4WI1A 4K86A 3TEHA 3R07A 1W66A 2RHSA 1E1OA 3NETA 4YRSA 1N9WA 3UH0A 1NJ6A 1B70A 2QHVA 3I7FA 3WQZA 4P74C 1KMNA 4RMFA 1ASZA 1B7YA 2ZR2A 1USYA 2I4OA 4CH3A 4XTWA 3IALA 3BFMA 3VBBA 2RHQA 1FYFA 2E64A 4YYEA 2Q7HA 2AMCB 1G6UA 2ZIMA 3HFZB 3RIRA 1ASYA 4G85A 4XU2A 3V8LA 2RJZA 4K88A 4HA8A 1PYSB 4YCWA 1JJCB 2ZTGA 4Q15A 2CJ9A 4WJ3M 4HWSA 2I4NA 2DVEA 3RACA 4ZIBA 2E41A 2E10A 3EFRA 2EJ9A 3A5YA 1WQWA 1NJ5A 1HXDA 5ELOA 2EAYA 1ADJA 2ARSA 1BBWA 1QE0A 2CJBA 3ERRA 3V7CA 3HRKA 3IG2A 1NYQA 3E9HA 1KMMA 4P75C 4KR2A 2E5AA 4HWPA 2IY5B 3EFSA 3BHPA 1SETA 1H4VB 5K1PA 2DZ9A 4WJ4A 1LYLA 2DZCA 2DDZA 4YCVA 4PHCA 2ZZFA 4E51A 4YP0A 1RIQA 3M4QA 2PGGA 4P73C 2DXUA 3HY1A 3RL6A 2YIAA 2P0LA 1X55A 4YRPA 2ZT5A 4XU3A 4H2VA 2I4MA 3M4PA 4XTVA 2AKWA 2Q5HA 4DPGA 1YFRA 2EL9A 4X5OA 3TUPA 4ZTUB 1H4SA 2QHUA 4CS2A 1HC7A 2ARUA 4UP7A 2ZT8A 2C7IA 3OD1A 2YIBD 2EJGA 1EIYB 1WYDA 4CS4A 2DU7A 3V8JA 4YRMA 2DTHA 4HWOA 3HFZA 3HY0A 2AKWB 4HWRA 4PG3A 1EOVA 3HRIA 5HGQA 2FYKA 3VQWA 4P3NA 3NENA 1SERA 1KOGA 4P72A 1WNLA 2J3LA 1GGMA 4YRCA 1NJ8A 4KR3A 3L2ZA 2DTOA
chains in the Genus database with same CATH superfamily
3A5ZA 1MG1A 1HNXO 2JEXA 4LF7O 4PD4F 2BOCC 4JI7O 1FFXA 4LVIA 4J15A 3RKYA 4O4IB 2ZZEA 3TK1A 5E3IA 3THOA 3T4DA 1WN7A 4BIUA 3TCUA 4UPAA 3JD2A 3QO7A 5LMUO 4XTUA 1BQZA 4X1YA 3RWRD 3K04A 4YRGA 3H1KH 4FLTA 4W4LA 1BHAA 3I55V 3SPCA 3ZN1A 1XOUA 5JVDA 3AG3B 2ZIOA 3OR7C 1FJGO 1NBMG 1VQMV 4HT4A 3B2EE 2ALYB 2QE7G 1H8HG 4DQ2A 1ZWIC 4Z2WA 5B1AC 1UPGA 3JAWA 4YRIA 2F43G 3QO8A 3IJ4A 3SJQC 1DTOA 1X56A 3AK2A 4DR6O 2KB1A 1H2MA 4DXWA 2EZOA 5L3DA 2GTSA 2UXNA 4B3SO 1I5XA 5KMGA 4O4LA 1IBKO 4JF3A 1XEQA 3OE7G 4YHHB 3ZRSA 2FKXA 5IJ0B 3D36C 5LHHA 3LSQA 1NVPB 3SYAA 3HKEA 2P5IA 3JSNA 3CEIA 4A5UB 4PI0A 3MHSC 4JYYA 4MTGA 4TSFG 1EVKA 2EINC 1YCIA 4RQEA 5KHHA 3IKLA 3OUSA 2CGOA 4B7KA 2AHZA 3EFFK 1B04A 4HVCA 4MW3A 4PV1B 4TVAA 1KB9F 3ZMZA 2OCCC 3HXXA 3OEEG 4ZHQB 3HKEB 5LGUA 1FKAO 3E35A 4LCUC 2RDCA 1IVSA 4J41A 3G80A 4YJ3A 2DXTA 1S5LZ 2A0LA 3K57A 2R72A 2WLJA 1M57B 1L0WA 2NNUA 3CCEV 3AG7A 3A31A 2NR5A 3A32A 1Q7YW 2GUZB 3UGQA 5IYBO 1TA8A 2LFRA 4WBNB 5LXTB 4DV1O 2UXBO 1VQOV 5E79Z 1E1QG 2PMFA 4O2BB 3ZX6A 1X2HA 2ZM6O 3OTOB 2DKGA 5EBLC 5F2VO 2BSKA 2HVKC 1T5EA 2XASA 5KAIZ 5IDJA 4X88A 4X62B 4YDQA 3AG4B 1ZSPA 4PDRA 4YJ2B 1AR1B 1YHQV 2Y4UA 4KP4A 2ZR3A 3HFVA 1Z5WA 4JAUA 1S72V 2LO1A 4ZBMA 1NZ6A 2ZT6A 1SQFA 3JAWB 1WA8B 1V55B 4JTAB 1WPXA 2UUAO 1H8EG 2IY5A 1NTZH 4MVMA 2Q7GA 1J5EB 1BQ0A 3PZCA 3SGIA 3FYEB 4P74A 3K5MA 1RSOB 1I7FA 3ABUA 3VQXA 3L70H 3U11A 3CX5F 1R3KC 1COWG 4AQYB 3L73H 2CDYA 2JDIG 4J80A 4TQDA 4H2SA 4EO4A 1XILA 2E65A 1K34A 2Y4TA 4JV5O 1Y4MA 4P72C 2I4LA 1KD1W 1SZTA 1SESA 5ITZA 1WB7A 3A7UA 4H33A 3MEYA 11ASA 2N05A 5H2FZ 1VARA 4IHJB 3ZRWA 3CCUV 2HG5C 2ZD9A 1EM1A 1AR5A 4P9PA 2NS6A 4CH5A 4RO2A 3MF2A 2CK3G 3QNEA 3ZJZA 1E79G 1BSMA 1ADYA 2OWOA 4JTDB 1OJHA 3EHBB 1C0AA 1ZLZA 3JALB 5EIBC 1N34O 4GKJB 1SA0B 5CB4B 1HNWO 1JJCA 3CC2V 1Z7MA 3W7SA 3HKDB 4R6ZA 1EIYA 1Q8IA 1K8AW 4OXSA 3K0DA 2UUCB 4QPKA 2HLDG 3P3NA 4TQFA 1ATIA 3GB7C 2EJ7A 1XHXA 4P30A 1SQVH 1OCOC 3JCZA 4UV9A 2ARTA 4DR6B 4DV0B 2EIJC 2WWWA 3ZN0A 2WLMA 4O2DA 3L1AA 2Z5UA 2VQFB 3CRCA 3HKCA 3LC0A 5KA6A 4EB6A 2BTQA 4TOIA 2HR3A 2G4CA 4JI2O 3L4GB 3MDSA 3J81N 3ABLB 3ZHRA 4XU1A 4NXMO 4GX2A 3DXRA 4FPPA 4UB8Z 1E22A 4H2TA 3ABKB 4UCVA 3IKMB 2YXHA 1AP5A 3T4ZA 2CGHA 1JJOA 2ADQB 4X66O 3OR6C 1K3EA 3H01A 4KFMA 3RW0A 2DOSA 5LP6B 1B70A 4B3TB 4DK1A 4JI1O 1SQQH 1ZUQA 2ETNA 3CJHA 1KP2A 3EVKA 5LMUB 3ABMB 5B1NA 2ZR2A 5B1BB 1USYA 2UUCO 4DR2O 1V54B 1V9PA 3A0BZ 5BMVB 3SPIA 2RHQA 1KP3A 2ZIMA 4MVSA 5H6QA 4W4KA 4G85A 3UO2A 1K9MW 1GM8A 3V8LA 1KQSU 1QBZA 4YY3B 1TAEA 4LC1A 4OX9O 2ZTGA 1L0NH 3STLC 4PDMA 2EJ9A 3KCYA 4PJ0Z 1Z2GA 1NKDA 2WLLB 4BIZA 2OCHA 5IE9A 5ELOA 2EAYA 4LF8B 2YEVA 2F23A 4N21A 1P84F 1D5AA 3E2EA 4O4HB 1BBWA 2C2AA 1QE0A 3V7CA 3JSLA 3LUTB 5IY5C 2VQEB 4DUYB 1NYQA 4HYOA 3AG4C 1SETA 5LP6A 1H4VB 3B40A 4WJ4A 3L71H 3T1YO 4UCTA 2DYRC 2LGWA 4JASA 4X64O 4PHCA 1X4TA 1MZFA 2GTAA 2H3OA 2UUBO 4KHPB 4IGGA 4YRPA 1L1FA 4ZHQA 1VF7A 3OMNB 1FYJA 2LW7A 4JPRA 1THZA 3UO3A 4I7ZB 2LP7A 2WLKA 2LQTA 2DJVA 3QF7A 2D3OW 4MVQA 3BAAA 1FXKC 4WFEA 4YJ3B 2PI4A 1R3IC 2XNDG 4Z1VA 1YTFB 3A8TA 3ETGA 4FLZA 3ASOC 1CP9A 2UXBB 4OX9B 3OD4A 5EZYB 1H38A 1Q81W 4O2AA 1H4SA 4QE7A 5CB4A 2B1IA 3H1LH 2QWPB 3M7MX 3B8MA 3JALA 4UP7A 2ZT8A 2YS8A 1URFA 2C7IA 5B1BC 1U96A 2LJ2A 4X62O 5EC2C 2PTMA 4J7JA 3ZMVA 3V8JA 2R9AA 4HWOA 1SKVA 2P67A 2IJKA 2XAGA 3HY0A 1N33B 3TJTA 3LSUA 4UCRA 1LR1A 3VQWA 3NENA 4NYKA 4P72A 1YEWA 4R8CA 1GGMA 4YRCA 4KR3A 1VQ5V 3L2ZA 2WPDG 3APQA 4DV7B 1B8AA 4J9ZB 3RVYA 2ZXFA 2Q0OC 3T1HO 3W7XA 4X1YB 3OFNG 3Q4HA 1NTKH 5KHIA 5EYPB 3RYFA 3HXWA 1VQZA 4LF6O 1S76D 4U3JB 1JR9A 4FFKA 4X1IB 1LUVA 1Q6HA 1JFFA 1VF6C 4QGPA 4C7UA 1BHBA 4LF7B 1HR0B 1P4RA 4P9OA 2F93B 2ZKOA 5KAFZ 4UVAA 1DGSA 4TV8A 4DV5O 4H02A 3SYQA 4OLFA 4TWAA 2FB5A 4JAAA 4X8AA 4LFBO 3SJCC 2ZINA 3H9VA 4XTYA 3ZEDA 1XMQO 1NH2D 1SA0A 2E1HA 3CCJV 1Y66A 1PD3A 1OCOB 2Y69B 3K5OA 2WLNA 4DR4O 4EFEA 1Q6IA 3ZS8C 3RYCB 1D5NA 3BJUA 3VQVA 2DWEC 4MTXA 1CEZA 4OGQB 4H2WA 4O4HA 1ENVA 5JH7A 4KHPO 3FAVB 5CBGA 1YGBA 2K9PA 4WFAV 1N0JA 1EVLA 5FL7G 2YDEA 1XBLA 3LDEA 3ZRXA 3A7RA 1SF9A 1QU7A 2JVDA 4B3MO 1H2SB 1MABG 4KQEA 3ZHSA 1EQRA 5LBQA 4QE9A 5BY1A 1VQ9V 4XEOA 4E2LA 1B7YB 3OW2U 3RKXA 3SYPA 2HJDA 2RHQB 2JRIA 1JPXA 1H4QA 1MZEA 1HNXB 5AG2A 1USYC 2W0XA 1YITV 2CH7A 2ZXWB 2Q5IA 4LVJA 2QM8A 5K1XA 4TVAB 3RN4A 2QHSA 4O2AB 5BXZA 1JQ0A 1HNZO 2PZSA 2ZGWA 4FM2A 4NXNO 4I55A 1YXBA 3L75H 5B1OA 1OCRC 3CXHF 4F4LA 1IBLB 1JOYA 4P3PA 4XTXA 2F4VB 2JS5A 1M9NA 4B08A 5ELNA 3DC6A 5LYJA 4DV7O 3QTCA 1O9GA 4MVRA 1VF5B 1S0VA 5DN6G 1Q86W 2AMCA 3E9IA 3RKWA 4UXNA 2P90A 4J7KA 2ZQMA 1GMGA 3PCOA 3W7UA 3IC9A 3LDDA 4J11A 1W2BU 5C8YA 2XGTA 2BCCH 4LWSB 2R9IA 4BW5A 4CH4A 5LA6B 3E8GA 3DTUB 1TVKA 1XNQB 1YSCA 3SDLA 3CCRV 1G5IA 3X2QC 3A7AA 3TGUH 2HHHB 5LHIA 3P8VA 1WLEA 2KSDA 2QHTA 4L8JA 5JCOA 4DR3B 1K73W 4FLUA 5CA1A 1F4NA 2EILB 4UUJC 3K9AA 1W59A 3JCUZ 3D36A 3I5DA 2EJFA 4LFCB 2DYRB 5B3SB 3U10A 2RCVA 1H2KA 4YRRA 4Q20A 1MNGA 3T1CA 3KKYA 4ZKIA 2CTWA 5JWPA 2HKOA 3W3SA 2GV9A 2GDSA 2QKCA 2XAQA 3IAYA 1HDJA 4UV8A 1EN6A 2K1EA 1I5YA 4MSWC 5J2UB 2P7TC 3W7WA 2Y0IA 4WF2A 1F7YA 3SYOA 1WP8A 2EIKC 1IBKB 1MMMA 4PDVA 4BR6A 4LF9O 1CPYA 3ABTA 3NEMA 2ZT7A 2H94A 3CMEV 2N04A 2HFEC 4CH6A 4BIOA 2R70A 3K3WA 2F1MA 4DW0A 5CBHA 3TETA 4LFBB 4X9QA 1BIBA 3X2QB 4LP8A 4U7OA 3DC5A 1P7BA 3CB2A 2M7WA 4YRKA 5CA3A 2Q68A 3N27A 1GH6A 4I9QA 4YRJA 4ASUG 4XEMA 2HHHO 4G84A 1IX9A 3J80N 4AQYO 4UP9A 2Z0AA 4WFFA 3AEIA 2Q9LA 4U3JA 4U7NA 3DXRB 4ABMA 4DUZO 3REXA 1PNKA 5D5QA 4XBFA 3P32A 3G6BA 1WQ7A 2QKSA 2PYLA 1GAXA 2UXDB 1HP8A 2RHSB 3CP1A 3RYHA 2QM7A 4DV3O 4RAIA 1N8RW 2Q0AA 3ZMSA 1SQXH 4EX5A 3CWBH 4K86A 1EN5A 1AP6A 2JGDB 1J95A 3ETQA 3K9SA 3TEHA 1AI6A 5CA0A 1ZL8B 1GN3A 3NETA 1FFTB 1K33A 1L0LH 1GN6A 1R1BA 3R65A 2ARHA 1VQLV 4MT8A 1N9WA 5IJ9A 3I7FA 3WQZA 2E5LB 1S77D 4RMFA 2ZM6B 2AZ0A 1B6QA 2EULA 2P4VA 3BPZA 2I4OA 4CH3A 3NXSA 1QLNA 1BE3H 3IALA 5IWAO 5LHGA 3RGBA 1Q3EA 3K58A 3VBBA 2YICA 4UCOA 2E64A 4YYEA 2Q8VA 4PA7A 5E1AC 4TWKA 1ASYA 4ICGA 1N34B 2QWRB 1K92A 4FVMA 3L9DA 4DW1A 4DV0O 4K88A 4HA8A 1PYSB 3ZBHA 4YCWA 1JJCB 1J5EO 3JD1A 4Q15A 4B7EA 4GKKB 2FMLA 3QG5A 4HWSA 4JI6B 4FLYA 4ZIBA 4WFGA 5FLXN 3A5YA 3OM3B 1MSWD 3E89A 4G2KA 1HXDA 1P49A 1NH2B 1GK9A 1G8MA 3F5WC 4JI0O 4QJFB 2ARSA 1B06A 3HRKA 3IG2A 5B66Z 3E9HA 1WA8A 3RVZA 1I94B 4P75C 4KR2A 4DR2B 2E5AA 3SJBC 3MAQA 1NVPD 1F23A 3CRRA 1M4UA 2DZ9A 1F4MA 1IBLO 1EFRG 2A79B 2ITCC 4YCVA 5EBMC 4E51A 5LGTA 1TVKB 5GW7A 3CPWU 1RIQA 4XDJA 4JI1B 2DXUA 4P73C 3RL6A 2OIGA 2QGNA 1AB3A 3F5TA 4FZ0A 3M99B 4AILC 3AG1B 1FS0G 3AG1C 3CHXA 4XU3A 1QR9A 2X6AA 4ZOLA 4X20B 3M4PA 2F66C 1NR1A 1Q82W 4DK0A 1OCCC 1BL8A 2L6LA 3BA8A 1VIBA 2AKWA 4J10A 2ZT9B 3QVNA 2IH3C 4YIOA 4X89A 1YZBA 2AGAA 4WBNA 5LOVB 2ILMA 2Z3YA 5L3EA 4YXWG 1WJZA 1Q6UA 2R9RB 4HNAB 1FJGB 2B5UA 1BMFG 4LVMA 2EJGA 3MQZA 4X64B 1N36O 4YIPA 4G27B 2DU7A 5CA1B 4ZI7A 3RYHB 2DTHA 2A9HA 3CCVV 2BE3A 4PA9A 4TT3G 3K0GA 1XMOB 2HJFC 2ZE7A 4JI8B 4P3NA 2Y0PA 1WNLA 2J3LA 3A0HZ 3S3XA 4I9WA 2P6JA 4X66B 2DTOA 1HR0O 1G5HA 2X7RB 1AJNA 1O9HA 5GONB 1OCZC 1BIAA 1TUBA 2GBOA 4N23A 2Y48A 3LNNA 1Y74A 1Z7NA 1DF5A 4J9YB 4NVPA 3FB8C 4PELA 3KG2A 3RFRA 2OIEA 1B3QA 2OYQA 1RP3B 3P8YA 1XNRB 5J9PC 1I0HA 3LSSA 4GZRB 2GHYA 2RMKB 4LFCO 3JASA 4K8XA 1SQBH 1VQKV 2AW9A 4IL6Z 3K5NA 1Y67A 5HFMA 5JQGB 3HKBB 5KLVH 3CCLV 4RQFA 4YRQA 1G4YB 5H6RA 1H4TA 3JASB 4TVYA 1HWYA 3BY6A 3SR2C 1LUWA 4P3OA 3FD9A 2UUBB 1SS3A 4FK5C 2VRZA 5LA6A 3RF1A 1XQ8A 1NNHA 2PMEA 1QNMA 5GTHZ 3HKCB 2PUSA 4JZGA 4YHHO 3STZC 4HWTA 2PY5A 1RM1B 4H2UA 1H2LA 2X6CA 4D7SA 1NJ2A 2ZXWC 1IZ3A 1BT8A 2PF4E 2CTQA 2DTIA 1PM9A 3TXQA 3MHHC 2ATKC 4DV6O 1KYOF 1NR7A 3ZRWB 5L3FA 1HTTA 1PYSA 2DEQA 4UP8A 4X1KA 2NLJC 2QJ1A 2UU9O 4KXRA 4P2ZA 3BABA 5DECA 1KBHA 4QIWF 4IT5A 2OCCB 4CS3A 4JZ2A 4ZTZB 2DU5A 1NU1H 2IH1C 4O4JA 1Y76A 2W0FC 4UVBA 1OCCB 1N32O 4BWAA 1YVWA 1QCEA 1AJPA 1US6A 5C51B 4LFAB 1XMQB 1AR4A 1X54A 2YEVB 2W6JG 4TV9B 4YRFA 3E86A 3CCSV 1QVFU 4TTVA 4YRLA 4FMTA 4GX1A 3WG7B 4O2BA 5IWAB 3K08A 4EFBA 1E1RG 4J7ZA 3V8KA 4PA3A 3UT5A 2JGDA 4TUYB 3TEHB 4AH6A 5L3BA 3O9OA 4MTFA 12ASA 2YSUB 1X01A 1EFWA 4GX0A 1B70B 2M6YA 3QO5A 4LBEC 3OMAB 3B4SA 4KL1A 4MTOA 2EILC 2ODMA 3K06A 1SZXA 3RYIA 2BSKB 3R66A 3ZHVA 2RQ6A 5DM6V 5JH7B 4DR3O 1B76A 2JEUA 1S5JA 2YI9A 3RT3C 2X6BA 1IXMA 1X2GA 4NXNB 3W7TA 2WLHA 1YI2V 1VF6A 5EC1C 1KU9A 3SPJA 3EXAA 4DR7B 4DR4B 1WAZA 4B3MB 3K79A 1DLBA 1JA8A 1M5IA 3ZHUA 5CBFA 2VWJA 5EYPA 3RYFB 4B3RB 2XTIA 3ICAA 1S5HC 1TGOA 3JD4A 1NYRA 3ETDA 5KUKA 5EK0A 4JYAB 4D6TH 1PPJH 3OTFA 5JJEB 3K03A 1N4CA 1WPBA 4X1IA 1M93A 4PDLA 3L4GA 4P73A 1JFFB 2CH7B 3E83A 2DN9A 4RDXA 4YRNA 2DQ0A 4TUYA 5H9CA 4P75A 1S3JA 3JARB 2IBZH 2JGUA 2N74A 5EZYA 2XAFA 3KCXA 1XREA 5C53B 1WPYA 3HB3B 3FJPA 4GYCB 3JARA 5C52B 3G71V 3K59A 4DR1B 3ZHTA 4GKJO 2CTPA 2EBOA 3JAMN 3CRAA 5KMGB 1OCZB 4YJ2A 2CAZC 2VS0A 2DW4A 4K3AA 4F6RA 2YXLA 4IHJA 4LH6A 1QLEB 2XOKG 3JAKA 3HR0A 4H2XB 1NS1A 1E1TA 1HNZB 1VQPV 1M57C 4B3TO 4JGSA 1W0KG 2CIMA 2CTRA 4X1KB 1BCCH 1FXKB 5KHGA 3CMQA 3E8BA 5DEDA 4TVWA 2EIJB 2IM9A 1VEWA 2P22C 3FB7C 3VQYA 3G4SV 2AZ2A 2ZE6A 5H5NA 2ZNIA 2ZZGA 2WAMA 5KNNA 1NJ1A 1J5WA 1G1XB 4NTYA 4PA6A 2ZDIC 4P71A 2HP8A 5IJ0A 1XMOO 3CYOA 1M1KW 1DF4A 3NELA 4PI2A 3FFQA 1WU7A 3L74H 4K0KO 4WI1A 1OHHG 1BZKA 2A3QA 3HKBA 2RHSA 2PI5A 3CMAV 5L3GA 3ZCCA 2JS3A 4E4EA 5JQGA 3BVOA 4YRSA 3M8AA 3UH0A 3S3WA 4I0XA 2QHVA 1AROP 2X0LA 1ZL8A 3AK3A 2QR4A 4P74C 2IU0A 1ASZA 2DE0X 5LP6C 5IJ9B 3Q4HB 1QR8A 1B7YA 4MVOA 3ZMUA 2UUAB 5FNVB 4UCSA 4G28B 2OTLV 4XDLA 3BFMA 1FYFA 5CMUA 2CUGA 2Q7HA 5J2TB 4GT1A 1GO3F 3RIRA 3B77A 2A7WA 4JI0B 3ML0A 3K5LA 2Q6AA 4LF4B 2YC0A 4WF9V 5LMNB 1TUEB 4UVCA 3VOUA 3BRCA 3GVMA 3APOA 1K5SA 1MA1A 2PYJA 1IXBA 4H0LB 5GTIZ 2CJ9A 1YIJV 4LR3A 3C90A 2EIMB 1PV0A 4DRXB 3BFRA 2I4NA 2DVEA 3RACA 2V1DA 1AJQA 2UU9B 2E10A 3EFRA 1NJ5A 2JJ1G 5FPOA 4HNAA 4JYCA 1PKXA 1ADJA 3N2GA 4UFZA 5ITZB 2CJBA 5IYDO 2HVJC 3C3TA 3ERRA 1GTOA 4DV3B 5IY5B 1OCRB 4DV4B 2UXCO 4FLXA 4X65B 1XL6A 2AHYA 1UJWB 1L8DA 3N2GB 5B3SC 1XDCA 3UKMA 4DR7O 3BHPA 1IBMO 3ZIAG 4HWPA 4AHCA 5K1PA 1P7GA 2LGQA 5LXTA 1LYLA 2DZCA 1ZX3A 3RBZA 1AVMA 3T1YB 3D3QA 2ZZFA 5L3CA 1WB8A 2L35A 1XI1A 2E5LO 2ZE5A 3HY1A 1QQCA 2P0LA 1K4DC 1XUQA 3H1JH 2P06A 3E8FA 2JJ2G 5B1AB 2KG7B 3GWKC 2QM4A 4CBCA 3OUFA 2V4DA 3N2KA 1YF2A 1R73A 4TV9A 2I4MA 3BCCH 4I4TB 1SQGA 2XT9A 1ORQC 3OGCC 4LF4O 1JMKC 4LF5B 2EIMC 1U97A 4LF6B 3UQ8A 2ITDC 4X5OA 3UT5B 2QTOA 1H2GA 2WLIB 3WB1A 4JYAO 4ZTUB 1PL4A 3FB5C 2GSMB 4CC6A 1HC7A 4FM1A 3FX7A 1Y6XA 2ARUA 3F7YC 2W6IG 5KX5A 4LNUA 1NJIW 2YIBD 3LNMB 4CS4A 3JATA 4YRMA 4F6RB 2ADPA 4JI5O 4PHZA 3HFZA 1OZ0A 1V55C 1FXVA 4HWRA 1EOVA 3HRIA 3CC4V 3AG3C 4MVZA 2V7QG 2UXXA 1SERA 1GKFA 1KOGA 3B8NA 1GN2A 4FZ1A 1EZJA 4UB6Z 1M56C 5IYCO 5LOVA 1NJ8A 4JI3B 2QEXV 1EN4A 1HW7A 2EZPA 3ICXA 1RFYA 2F95B 2J3MA 3HTZA 1CXZB 3LDCA 1A32A 4NTXA 3D8CA 3UCSC 1XHZA 4H13B 2B1GA 4FFBB 4B3SB 2XAJA 4R50A 2XUMA 1GRJA 3UGTA 1W0JG 1AI5A 2DWDC 1YFSA 2YUAA 2QA4V 1N36B 3U0ZA 3F7VC 2KQXA 1EBOA 1OV9A 4XU0A 5BR8B 2AXTZ 3ABKC 2QTSA 2RNBA 2YXYA 2ZNJA 4FIPC 3ZMTA 4KUMA 1HNWB 4LF8O 5C93A 4DV6B 2QWNB 1UFIA 2QWQB 3KZIZ 2QKAA 4GUNA 2ODRD 1NTMH 4DRXA 1PP9H 1K4CC 5JJJB 1LNQA 4HAMA 5EBWC 1R3LC 3ZRVA 4P71C 1NI8A 4JI5B 3UFGA 3V7RA 3P8TA 4DV2O 1KKCA 3A74A 3JAKB 4H2XA 2P4KA 3IFXA 1ZTEA 4BAYA 1VQ8V 1XL4A 1BBUA 4K87A 2G38A 5F5WA 1K7DA 2H8PC 3ASOB 4JI3O 3OT7A 4O4IA 2C8MA 4K35A 4FJCC 3A2FA 4XTZA 4LNUB 3ABLC 4NKGB 3HXVA 4DR5O 4Q6GA 1JVMA 3MF1A 4BW9A 1YJWV 5EIBD 3G67A 3RGLA 3UM7A 1Y76B 2EWNA 1BGYH 2NN4A 1KUQA 3IC7A 4JAVA 1XNQO 1DK1A 5FPRA 1VQ7V 1GN4A 1PNMA 5BR8O 3A0RA 3G6EV 3DSQA 2QDOA 4IIJB 2O57A 1V54C 1FAFA 5IYZA 4RWUA 3PCOB 4I0XB 1FD9A 1QF6A 4LNSA 2YI8A 5LMNO 4GCZA 3CJHB 3JD0A 1YFTA 5TISZ 4L87A 3ASNB 3JATB 2FTKA 4NCXA 4MS2A 2VQFO 2F4VO 4QPJA 4PA4A 4IYIA 4OP0A 3PN1A 1Q43A 2D2CB 4IIJA 1MOFA 2IY5B 1N32B 4MW8A 4YY3O 1AILA 3HXZA 2ZCEA 3OTOO 4OPAA 4YREA 1VMGA 2HEPA 1YTFD 4CZZA 1KMIZ 4X65O 1Q90D 1KC8W 1RM1C 4H37A 3SPHA 1K5QA 4NB5A 4YROA 1GM9A 4JI7B 1VQ6V 3BA9A 3MD0A 3KFUA 2IJIA 2WLLA 3CCQV 4JI4O 3HXUA 3HXYA 2EINB 3OAAG 3ABMC 2CJAA 1SC5B 4YCUA 4YRTA 2KKWA 1XNRO 4RUFA 3REUA 1BS3A 5BZBA 2DQ3A 2YIBA 3B09A 3FYIB 4I50A 3SJAC 3CCMV 2ODRC 2WA3A 1QVGU 1VQNV 3HPLC 3L72H 1H2NA 3V7SA 3J7AU 1NQTA 1YJ9V 3TEGA 1RPRA 5GONA 3AG2C 4B3RO 2QWOB 3AG2B 2Y69C 1E24A 2Q5ZA 3E8HA 3CC7V 3IGAC 4OPHA 4JV5B 1I94O 1IL2A 2EJRA 4FM0A 3AK1A 4CC5A 4LFAO 1YB3A 1Q5OA 5A9GA 2EX3A 4ZI7B 3P30A 1R6KA 5JVDB 1FPOA 1K97A 4U3FH 4LVKA 3E22B 2XAHA 4ZOLB 2RN9A 5JJNB 2B9ZA 3ZHQA 5IYZB 4NR1A 3RUXA 3I56V 5IT9N 1YDXA 2MK3A 4GLXA 1F51A 4H2YA 1SRYA 2IU3A 4DYLA 2Q7EA 3SYCA 2HNIA 4O4JB 1VQ4V 4WFBV 2IJHA 1SQPH 3BEHA 3RYCA 1KECA 2MW2B 1M56B 1IURA 4LH7A 1VP7A 2LW1A 4IYHA 2E76B 1G51A 2DJZA 1FXKA 3GWOA 2VQEO 4DUYO 4JTCB 1I08A 3G1ZA 1KKDA 2ALYA 4YPFA 2E3CA 5BMVA 1MSDA 2IW5A 3R07A 4LWSA 1W66A 4TV8B 2GUZA 2CE4A 3NR7A 1E1OA 2OTJV 3WFVA 2DYSB 3OGIB 2Q4PA 4RUEA 2QSAA 1NJ6A 1TUBB 3ASNC 4DO2A 2BTQB 1YJNV 4DV2B 4FLWA 4JI8O 4UCUA 4HZ3A 4MVUA 1KMNA 4JI2B 2Q73A 3TXSA 5B5EZ 3WG7C 1M90W 4NXMB 2YIDA 2OT5A 4LVLA 3JD3A 1QHTA 5KX5B 4XTWA 3SPGA 2FYUH 4FLVA 4EKWA 2BOBC 4I50B 2DMXA 2XTAA 2AMCB 1G6UA 3HFZB 3ETEA 4DV5B 4X20A 1FXHA 1Z5VA 4EEQA 3WB2A 4JI4B 4XU2A 2RJZA 3H1IH 2UXDO 3OMIB 4GKKO 5LGNA 2VWKA 4R7CA 1WNSA 1WP7A 4EB6B 4WJ3M 3HKDA 2WLIA 3FKSG 4AI8A 4Z1MG 2JIZG 2E41A 4O4LB 5KHJA 4QNHB 1Y74B 1WQWA 4D7TA 5A2QN 2EIKB 2JK5C 3WU2Z 4DR5B 3FB6C 2E74B 3PJSK 1R6NA 1JJ2U 2DYSC 1KMMA 3N2KB 1AI4A 3CRMA 1JCHA 3EFSA 1ZAUA 4NTWA 4WCEV 5LL6Y 2FL4A 5CN0A 2WA4A 4J42A 5C8YB 2BTOA 2DDZA 2Q67A 3JYCA 4LF9B 3T1HB 4YP0A 4I55B 3M4QA 2PGGA 2YIAA 4F6EA 1X55A 3CD6V 4H44B 5D5PA 2ZT5A 4DR1O 5KUMA 1D2DA 3CXCU 4I4TA 3CRQA 1JX9A 3P3PA 4H2VA 2ZE8A 3D3IA 5LYJB 1N0NA 1RPOA 4JI6O 5HFLA 1ROPA 4K0KB 4XTVA 1PL0A 3T2MA 2KG7A 3CSXA 4XDKA 5CA0B 4FFBA 1R6TA 2LFSA 2Q5HA 3CS5A 1R3JC 3FAVA 1GM7A 1N33O 4DPGA 1YFRA 1PNLA 4DUZB 2EL9A 2IJJA 2E75B 3OEHG 3TUPA 1QLEC 1RSOA 2QHUA 4CS2A 4JYBA 4GX5A 3WB0A 5FNVA 4HBNA 2A06H 3OD1A 3C3SA 1FFXB 4WFHA 3DGEA 2WSSG 1EIYB 1EZVH 3RYIB 5J2UA 1WYDA 5KA5A 4DV1B 1AI7A 3CE2A 5J2TA 3E22A 4K8ZA 2AKWB 4PG3A 4LF5O 5HGQA 2CGNA 1X59A 2FYKA 2P5OA 4DV4O 5KHKA 2UXCB 2ZDIA 4I5SA 2XHBA 1IDSA 1IBMB 2Q69A 5JCOC 2A8EA 1NT2B 3H1HH 3O65A
chains in the Genus database with same CATH topology
3A5ZA 1G5HA 4DV7B 1B8AA 3ICXA 1O9HA 5GONB 1BIAA 1TUBA 1FFXA 2F95B 2J3MA 3HTZA 2ZXFA 4J15A 4LVIA 3RKYA 4O4IB 3LNNA 4X1YB 2ZZEA 1Z7NA 5KHIA 5EYPB 3RYFA 5E3IA 3THOA 1WN7A 4UPAA 3HXWA 1VQZA 4NVPA 1XHZA 3QO7A 4XTUA 4U3JB 3RFRA 4X1YA 3RWRD 2OYQA 3P8YA 4YRGA 1XNRB 4FLTA 4FFBB 4B3SB 3LSSA 4X1IB 5JVDA 1JFFA 3UGTA 2ZIOA 1YFSA 4LF7B 3JASA 1N36B 3B2EE 3U0ZA 4K8XA 1HR0B 2ALYB 4DQ2A 4HT4A 2F93B 3K5NA 4XU0A 5JQGB 3HKBB 5BR8B 1DGSA 3JAWA 4RQFA 4TV8A 4YRQA 4YRIA 4H02A 1H4TA 4OLFA 2ZNJA 3QO8A 3JASB 4TVYA 4TWAA 1HNWB 4P3OA 3SR2C 4DV6B 1X56A 3SJCC 2UUBB 2ZINA 2ODRD 5LA6A 4XTYA 3ZEDA 3RF1A 4DRXA 1XQ8A 1NNHA 2PMEA 2E1HA 1SA0A 5JJJB 3HKCB 2PUSA 4HWTA 5KMGA 2PY5A 3K5OA 4O4LA 4H2UA 4EFEA 4YHHB 3ZS8C 4P71C 3RYCB 5IJ0B 3BJUA 3VQVA 4JI5B 3UFGA 4D7SA 3V7RA 3P8TA 3LSQA 3HKEA 1NJ2A 3A74A 4H2WA 2P5IA 3JAKB 4H2XA 3JSNA 4O4HA 4PI0A 3L2ZA 2DTIA 5JH7A 4K87A 1BBUA 1YGBA 5F5WA 1EVKA 4RQEA 5KHHA 3IKLA 1EVLA 1HTTA 1PYSA 2DEQA 4UP8A 4X1KA 1B04A 2QJ1A 4HVCA 4O4IA 3A7RA 2JVDA 2C8MA 1H2SB 3BABA 4TVAA 4KQEA 3A2FA 4XTZA 4LNUB 4H2SA 3HXXA 1EQRA 4CS3A 4ZTZB 2DU5A 3HXVA 4ZHQB 4XEOA 3HKEB 4O4JA 4Q6GA 3MF1A 4BW9A 1B7YB 4BWAA 4RDXA 5C51B 5EIBD 1XMQB 4LFAB 1X54A 3RKXA 4YJ3A 2RHQB 4TV9B 3RGLA 2EWNA 2DXTA 4YRFA 1H4QA 3K57A 2R72A 1HNXB 4TTVA 4YRLA 1L0WA 5FPRA 1USYC 4O2BA 5IWAB 3A31A 3A32A 4EFBA 2Q5IA 3UGQA 3V8KA 3DSQA 4LVJA 3UT5A 4IIJB 5K1XA 4TVAB 4TUYB 2QHSA 1TA8A 4O2AB 4WBNB 5LXTB 3TEHB 4AH6A 5IYZA 2PMFA 2PZSA 4O2BB 4FM2A 12ASA 2ZGWA 1X2HA 3PCOB 4I55A 3OTOB 1X01A 2DKGA 1EFWA 1QF6A 4LNSA 1B70B 2YI8A 1T5EA 3QO5A 1YFTA 1IBLB 4KL1A 4L87A 3JATB 4P3PA 4XTXA 2F4VB 2JS5A 4NCXA 5ELNA 4B08A 3RYIA 5LYJA 2RQ6A 3QTCA 4X62B 4YDQA 5JH7B 4YJ2B 1O9GA 1B76A 4OP0A 1S5JA 1Q43A 3PN1A 2YI9A 2AMCA 3E9IA 2ZR3A 3HFVA 1Z5WA 4IIJA 1X2GA 3RKWA 4NXNB 2ZT6A 1SQFA 3JAWB 1N32B 3PCOA 3HXZA 2IY5A 2ZCEA 2Q7GA 1J5EB 3PZCA 5C8YA 2HEPA 3SGIA 2XGTA 1KU9A 4YREA 4P74A 3K5MA 4CH4A 1I7FA 5LA6B 4DR7B 3VQXA 4DR4B 1KMIZ 3U11A 1TVKA 1XNQB 4B3MB 1G5IA 4YROA 1M5IA 3A7AA 4AQYB 4JI7B 2HHHB 2VWJA 3P8VA 1WLEA 4TQDA 5EYPA 3RYFB 2QHTA 4L8JA 5JCOA 4B3RB 2E65A 2XTIA 3BA9A 4DR3B 3ICAA 4EO4A 1TGOA 3KFUA 4FLUA 1NYRA 3HXUA 4P72C 3HXYA 4JYAB 2I4LA 5CA1A 3OTFA 1SESA 5ITZA 5JJEB 2CJAA 4X1IA 1WPBA 3L4GA 4P73A 1M93A 4YCUA 4YRTA 2KKWA 3A7UA 3MEYA 1JFFB 11ASA 3REUA 4X66B 4IHJB 2EJFA 4LFCB 2YIBA 2DQ3A 4TUYA 4I50A 3SJAC 2DQ0A 2ODRC 4YRNA 4P75A 3U10A 4YRRA 3JARB 3V7SA 2NS6A 4CH5A 2JGUA 3TEGA 3MF2A 5EZYA 3QNEA 5GONA 5C53B 1ADYA 2OWOA 1WPYA 1E24A 3FJPA 1C0AA 3JALB 4GYCB 5EIBC 4GKJB 3JARA 5C52B 1SA0B 3K59A 3W3SA 4JV5B 5CB4B 2GV9A 4DR1B 1IL2A 1JJCA 3IAYA 4FM0A 1Z7MA 3HKDB 1EIYA 1Q8IA 5KMGB 4YJ2A 4CC5A 5J2UB 1YB3A 2CAZC 1Q5OA 2UUCB 2EX3A 4F6RA 4ZI7B 4WF2A 2YXLA 1IBKB 5JVDB 4IHJA 4TQFA 4LH6A 3NEMA 3JAKA 1ATIA 4H2XB 4LVKA 3E22B 2ZT7A 1E1TA 1HNZB 1XHXA 4ZOLB 5JJNB 4CH6A 2R70A 2F1MA 2CIMA 1BIBA 4LFBB 4X1KB 5IYZB 5KHGA 3CMQA 2ARTA 4DR6B 3RUXA 4DV0B 4TVWA 3CB2A 2IM9A 4O2DA 3L1AA 4GLXA 4YRKA 2P22C 3VQYA 2VQFB 4I9QA 4YRJA 4H2YA 1SRYA 2ZNIA 2ZZGA 4XEMA 2Q7EA 5KNNA 3HKCA 3LC0A 4G84A 4UP9A 2HNIA 4O4JB 1NJ1A 1J5WA 4EB6A 2BTQA 4TOIA 4U3JA 3RYCA 2G4CA 3REXA 5D5QA 4LH7A 3L4GB 4P71A 1WQ7A 5IJ0A 2PYLA 2UXDB 4XU1A 2RHSB 3RYHA 1G51A 2DJZA 1E22A 3NELA 4PI2A 3IKMB 4UCVA 3G1ZA 4H2TA 3FFQA 1WU7A 2ALYA 2Q0AA 4YPFA 4EX5A 2E3CA 2CGHA 4WI1A 5BMVA 1JJOA 4K86A 3TEHA 3ETQA 3HKBA 3R07A 1W66A 2RHSA 5CA0A 4TV8B 1E1OA 3NETA 4YRSA 5JQGA 5LP6B 5IJ9A 1N9WA 1B70A 1TUBB 1NJ6A 3UH0A 2QHVA 2BTQB 3I7FA 3WQZA 4B3TB 4DV2B 4DK1A 4FLWA 2E5LB 4UCUA 4P74C 1KMNA 4RMFA 4JI2B 2ZM6B 1ASZA 5LMUB 5LP6C 5IJ9B 1B7YA 4NXMB 2UUAB 2ZR2A 1USYA 3BPZA 5FNVB 4LVLA 2I4OA 4CH3A 4UCSA 1QHTA 5KX5B 4XTWA 1V9PA 3IALA 4FLVA 3RGBA 1Q3EA 5BMVB 3K58A 3BFMA 3VBBA 2RHQA 4I50B 4UCOA 1FYFA 2E64A 4YYEA 2Q7HA 2AMCB 1G6UA 2ZIMA 5J2TB 3HFZB 3RIRA 1ASYA 1N34B 4DV5B 4X20A 4JI0B 1Z5VA 4EEQA 3WB2A 4JI4B 4G85A 3K5LA 4XU2A 4FVMA 3V8LA 2RJZA 4LF4B 5LMNB 4YY3B 4K88A 1TAEA 4HA8A 1PYSB 3BRCA 2VWKA 4YCWA 1JJCB 1WNSA 2PYJA 4EB6B 2ZTGA 4Q15A 2CJ9A 4GKKB 4WJ3M 3HKDA 4LR3A 4DRXB 3QG5A 4HWSA 4JI6B 2I4NA 2DVEA 4FLYA 3RACA 4ZIBA 2E41A 2UU9B 4O4LB 2E10A 5KHJA 3EFRA 2EJ9A 3A5YA 1WQWA 1NJ5A 5FPOA 1HXDA 4HNAA 4D7TA 1P49A 5ELOA 2EAYA 4LF8B 1ADJA 1D5AA 3N2GA 4UFZA 4O4HB 2ARSA 5ITZB 1BBWA 4DR5B 1QE0A 2CJBA 3JSLA 3ERRA 3HRKA 3IG2A 4DV3B 3V7CA 2VQEB 4DUYB 1NYQA 3E9HA 1I94B 1KMMA 3N2KB 4DV4B 4FLXA 4P75C 4KR2A 4DR2B 2E5AA 4X65B 3SJBC 1L8DA 3N2GB 4HWPA 3MAQA 3EFSA 2IY5B 3BHPA 1ZAUA 1SETA 4AHCA 5LP6A 1M4UA 5K1PA 1H4VB 2DZ9A 5LXTA 4WJ4A 1LYLA 4UCTA 2DZCA 5C8YB 2BTOA 2DDZA 3T1YB 4YCVA 4PHCA 2ZZFA 4E51A 1X4TA 1TVKB 4LF9B 3T1HB 1XI1A 4I55B 1RIQA 4YP0A 3M4QA 2PGGA 4JI1B 1QQCA 2DXUA 3HY1A 4P73C 3RL6A 2YIAA 4KHPB 2P0LA 1X55A 4YRPA 4ZHQA 5D5PA 2ZT5A 1VF7A 4I4TA 2QM4A 4AILC 3CHXA 4H2VA 5LYJB 2V4DA 4XU3A 3N2KA 4TV9A 2I4MA 4ZOLA 3QF7A 3BAAA 4X20B 4K0KB 3M4PA 2F66C 4XTVA 4I4TB 1SQGA 3CSXA 4DK0A 4YJ3B 5CA0B 4FFBA 3BA8A 2AKWA 2Q5HA 4FLZA 2UXBB 1JMKC 4LF5B 4DPGA 1YFRA 4DUZB 2EL9A 4LF6B 3UQ8A 4OX9B 5EZYB 3UT5B 4X5OA 3TUPA 3WB1A 4O2AA 4WBNA 4ZTUB 1RSOA 5CB4A 1H4SA 2QHUA 5LOVB 4CS2A 3M7MX 3JALA 4CC6A 1HC7A 4FM1A 2ARUA 3WB0A 5FNVA 4UP7A 4HBNA 4HNAB 2ZT8A 1FJGB 5KX5A 2C7IA 4LNUA 1FFXB 3OD1A 4LVMA 2YIBD 2EJGA 1EIYB 3MQZA 3RYIB 5J2UA 1WYDA 4X64B 4CS4A 2PTMA 2DU7A 3V8JA 3JATA 5CA1B 4YRMA 2R9AA 3RYHB 4F6RB 1SKVA 4ZI7A 4DV1B 2DTHA 4HWOA 4PHZA 5J2TA 3E22A 3HFZA 3HY0A 4K8ZA 2AKWB 4HWRA 1EOVA 3HRIA 4PG3A 1N33B 1XMOB 5HGQA 4UCRA 4JI8B 2FYKA 3VQWA 4P3NA 3NENA 2P5OA 2UXCB 5KHKA 1SERA 1KOGA 2XHBA 4P72A 1YEWA 1WNLA 2J3LA 1IBMB 1GGMA 4YRCA 5LOVA 1NJ8A 4KR3A 4JI3B 5JCOC 2A8EA 1NT2B 1HW7A 2DTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A5Z A;  1G5H A;  1B8A A;  1O9H A;  1BIA A;  3HTZ A;  2J3M A;  2ZXF A;  4J15 A;  3RKY A;  2ZZE A;  1Z7N A;  5E3I A;  4UPA A;  3HXW A;  1VQZ A;  3QO7 A;  4XTU A;  3P8Y A;  4YRG A;  3LSS A;  3UGT A;  2ZIO A;  1YFS A;  2ALY B;  4DQ2 A;  4XU0 A;  4RQF A;  4YRQ A;  4YRI A;  4H02 A;  1H4T A;  4OLF A;  2ZNJ A;  3QO8 A;  4TVY A;  4TWA A;  4P3O A;  1X56 A;  2ZIN A;  2ODR D;  4XTY A;  3ZED A;  3RF1 A;  1NNH A;  2PME A;  2E1H A;  2PUS A;  4HWT A;  4H2U A;  4P71 C;  3BJU A;  3VQV A;  3UFG A;  3V7R A;  3P8T A;  3LSQ A;  1NJ2 A;  3A74 A;  4H2W A;  2P5I A;  4H2X A;  2DTI A;  4K87 A;  1BBU A;  1YGB A;  5F5W A;  1EVK A;  4RQE A;  3IKL A;  1EVL A;  1HTT A;  1PYS A;  2DEQ A;  4UP8 A;  2QJ1 A;  4HVC A;  3A7R A;  2JVD A;  2C8M A;  4TVA A;  4KQE A;  4XTZ A;  3HXX A;  1EQR A;  4CS3 A;  4ZTZ B;  2DU5 A;  3HXV A;  4XEO A;  4Q6G A;  3MF1 A;  4BW9 A;  1B7Y B;  4BWA A;  5C51 B;  3RKX A;  1X54 A;  2RHQ B;  3RGL A;  2EWN A;  2DXT A;  4YRF A;  1H4Q A;  2R72 A;  4TTV A;  4YRL A;  1L0W A;  1USY C;  3A31 A;  3A32 A;  2Q5I A;  3UGQ A;  3V8K A;  3DSQ A;  5K1X A;  4TVA B;  3TEH B;  2QHS A;  4AH6 A;  2PMF A;  12AS A;  2ZGW A;  3PCO B;  1X2H A;  1X01 A;  2DKG A;  1EFW A;  1QF6 A;  4LNS A;  1B70 B;  2YI8 A;  3QO5 A;  1YFT A;  4L87 A;  4P3P A;  4XTX A;  4NCX A;  5ELN A;  2RQ6 A;  3QTC A;  4YDQ A;  1O9G A;  1B76 A;  4OP0 A;  2YI9 A;  2AMC A;  3E9I A;  2ZR3 A;  3HFV A;  3RKW A;  1X2G A;  2ZT6 A;  3PCO A;  3HXZ A;  2IY5 A;  2ZCE A;  2Q7G A;  3PZC A;  4YRE A;  2HEP A;  2XGT A;  4P74 A;  4CH4 A;  3VQX A;  1G5I A;  4YRO A;  3A7A A;  3P8V A;  1WLE A;  4TQD A;  2QHT A;  4H2S A;  4EO4 A;  2E65 A;  2XTI A;  3ICA A;  3KFU A;  1NYR A;  3HXU A;  4P72 C;  3HXY A;  2I4L A;  1SES A;  2CJA A;  4YCU A;  3L4G A;  4P73 A;  4YRT A;  3A7U A;  3MEY A;  11AS A;  3REU A;  2EJF A;  4RDX A;  4YRN A;  2YIB A;  2DQ3 A;  2DQ0 A;  2ODR C;  4P75 A;  4YRR A;  3V7S A;  4CH5 A;  3TEG A;  3MF2 A;  3QNE A;  5C53 B;  1ADY A;  1WPY A;  1E24 A;  3FJP A;  1C0A A;  5C52 B;  3W3S A;  1IL2 A;  1JJC A;  1Z7M A;  1EIY A;  1YB3 A;  4WF2 A;  4TQF A;  3NEM A;  1ATI A;  4H2X B;  2ZT7 A;  1E1T A;  4CH6 A;  2R70 A;  2CIM A;  1BIB A;  3CMQ A;  2ART A;  3RUX A;  4TVW A;  4O2D A;  3L1A A;  4YRK A;  3VQY A;  4YRJ A;  4H2Y A;  1SRY A;  2ZNI A;  2ZZG A;  4XEM A;  2Q7E A;  5KNN A;  4G84 A;  3LC0 A;  4UP9 A;  2HNI A;  1NJ1 A;  1J5W A;  2G4C A;  3REX A;  3L4G B;  4P71 A;  1WQ7 A;  4XU1 A;  2RHS B;  1G51 A;  2DJZ A;  1E22 A;  3NEL A;  4H2T A;  3IKM B;  3G1Z A;  1WU7 A;  2ALY A;  4YPF A;  4EX5 A;  2E3C A;  2CGH A;  4WI1 A;  4K86 A;  3TEH A;  3R07 A;  1W66 A;  2RHS A;  1E1O A;  3NET A;  4YRS A;  1N9W A;  3UH0 A;  1NJ6 A;  1B70 A;  2QHV A;  3I7F A;  3WQZ A;  4P74 C;  1KMN A;  4RMF A;  1ASZ A;  1B7Y A;  2ZR2 A;  1USY A;  2I4O A;  4CH3 A;  4XTW A;  3IAL A;  3BFM A;  3VBB A;  2RHQ A;  1FYF A;  2E64 A;  4YYE A;  2Q7H A;  2AMC B;  1G6U A;  2ZIM A;  3HFZ B;  3RIR A;  1ASY A;  4G85 A;  4XU2 A;  3V8L A;  2RJZ A;  4K88 A;  4HA8 A;  1PYS B;  4YCW A;  1JJC B;  2ZTG A;  4Q15 A;  2CJ9 A;  4WJ3 M;  4HWS A;  2I4N A;  2DVE A;  3RAC A;  4ZIB A;  2E41 A;  2E10 A;  3EFR A;  2EJ9 A;  3A5Y A;  1WQW A;  1NJ5 A;  1HXD A;  5ELO A;  2EAY A;  1ADJ A;  2ARS A;  1BBW A;  1QE0 A;  2CJB A;  3ERR A;  3V7C A;  3HRK A;  3IG2 A;  1NYQ A;  3E9H A;  1KMM A;  4P75 C;  4KR2 A;  2E5A A;  4HWP A;  2IY5 B;  3EFS A;  3BHP A;  1SET A;  1H4V B;  5K1P A;  2DZ9 A;  4WJ4 A;  1LYL A;  2DZC A;  2DDZ A;  4YCV A;  4PHC A;  2ZZF A;  4E51 A;  4YP0 A;  1RIQ A;  3M4Q A;  2PGG A;  4P73 C;  2DXU A;  3HY1 A;  3RL6 A;  2YIA A;  2P0L A;  1X55 A;  4YRP A;  2ZT5 A;  4XU3 A;  4H2V A;  2I4M A;  3M4P A;  4XTV A;  2AKW A;  2Q5H A;  4DPG A;  1YFR A;  2EL9 A;  4X5O A;  3TUP A;  4ZTU B;  1H4S A;  2QHU A;  4CS2 A;  1HC7 A;  2ARU A;  4UP7 A;  2ZT8 A;  2C7I A;  3OD1 A;  2YIB D;  2EJG A;  1EIY B;  1WYD A;  4CS4 A;  2DU7 A;  3V8J A;  4YRM A;  2DTH A;  4HWO A;  3HFZ A;  3HY0 A;  2AKW B;  4HWR A;  4PG3 A;  1EOV A;  3HRI A;  5HGQ A;  2FYK A;  3VQW A;  4P3N A;  3NEN A;  1SER A;  1KOG A;  4P72 A;  1WNL A;  2J3L A;  1GGM A;  4YRC A;  1NJ8 A;  4KR3 A;  3L2Z A;  2DTO A; 
#chains in the Genus database with same CATH topology
 3A5Z A;  1MG1 A;  1HNX O;  2JEX A;  4LF7 O;  4PD4 F;  2BOC C;  4JI7 O;  1FFX A;  4LVI A;  4J15 A;  3RKY A;  4O4I B;  2ZZE A;  3TK1 A;  5E3I A;  3THO A;  3T4D A;  1WN7 A;  4BIU A;  3TCU A;  4UPA A;  3JD2 A;  3QO7 A;  5LMU O;  4XTU A;  1BQZ A;  4X1Y A;  3RWR D;  3K04 A;  4YRG A;  3H1K H;  4FLT A;  4W4L A;  1BHA A;  3I55 V;  3SPC A;  3ZN1 A;  1XOU A;  5JVD A;  3AG3 B;  2ZIO A;  3OR7 C;  1FJG O;  1NBM G;  1VQM V;  4HT4 A;  3B2E E;  2ALY B;  2QE7 G;  1H8H G;  4DQ2 A;  1ZWI C;  4Z2W A;  5B1A C;  1UPG A;  3JAW A;  4YRI A;  2F43 G;  3QO8 A;  3IJ4 A;  3SJQ C;  1DTO A;  1X56 A;  3AK2 A;  4DR6 O;  2KB1 A;  1H2M A;  4DXW A;  2EZO A;  5L3D A;  2GTS A;  2UXN A;  4B3S O;  1I5X A;  5KMG A;  4O4L A;  1IBK O;  4JF3 A;  1XEQ A;  3OE7 G;  4YHH B;  3ZRS A;  2FKX A;  5IJ0 B;  3D36 C;  5LHH A;  3LSQ A;  1NVP B;  3SYA A;  3HKE A;  2P5I A;  3JSN A;  3CEI A;  4A5U B;  4PI0 A;  3MHS C;  4JYY A;  4MTG A;  4TSF G;  1EVK A;  2EIN C;  1YCI A;  4RQE A;  5KHH A;  3IKL A;  3OUS A;  2CGO A;  4B7K A;  2AHZ A;  3EFF K;  1B04 A;  4HVC A;  4MW3 A;  4PV1 B;  4TVA A;  1KB9 F;  3ZMZ A;  2OCC C;  3HXX A;  3OEE G;  4ZHQ B;  3HKE B;  5LGU A;  1FKA O;  3E35 A;  4LCU C;  2RDC A;  1IVS A;  4J41 A;  3G80 A;  4YJ3 A;  2DXT A;  1S5L Z;  2A0L A;  3K57 A;  2R72 A;  2WLJ A;  1M57 B;  1L0W A;  2NNU A;  3CCE V;  3AG7 A;  3A31 A;  2NR5 A;  3A32 A;  1Q7Y W;  2GUZ B;  3UGQ A;  5IYB O;  1TA8 A;  2LFR A;  4WBN B;  5LXT B;  4DV1 O;  2UXB O;  1VQO V;  5E79 Z;  1E1Q G;  2PMF A;  4O2B B;  3ZX6 A;  1X2H A;  2ZM6 O;  3OTO B;  2DKG A;  5EBL C;  5F2V O;  2BSK A;  2HVK C;  1T5E A;  2XAS A;  5KAI Z;  5IDJ A;  4X88 A;  4X62 B;  4YDQ A;  3AG4 B;  1ZSP A;  4PDR A;  4YJ2 B;  1AR1 B;  1YHQ V;  2Y4U A;  4KP4 A;  2ZR3 A;  3HFV A;  1Z5W A;  4JAU A;  1S72 V;  2LO1 A;  4ZBM A;  1NZ6 A;  2ZT6 A;  1SQF A;  3JAW B;  1WA8 B;  1V55 B;  4JTA B;  1WPX A;  2UUA O;  1H8E G;  2IY5 A;  1NTZ H;  4MVM A;  2Q7G A;  1J5E B;  1BQ0 A;  3PZC A;  3SGI A;  3FYE B;  4P74 A;  3K5M A;  1RSO B;  1I7F A;  3ABU A;  3VQX A;  3L70 H;  3U11 A;  3CX5 F;  1R3K C;  1COW G;  4AQY B;  3L73 H;  2CDY A;  2JDI G;  4J80 A;  4TQD A;  4H2S A;  4EO4 A;  1XIL A;  2E65 A;  1K34 A;  2Y4T A;  4JV5 O;  1Y4M A;  4P72 C;  2I4L A;  1KD1 W;  1SZT A;  1SES A;  5ITZ A;  1WB7 A;  3A7U A;  4H33 A;  3MEY A;  11AS A;  2N05 A;  5H2F Z;  1VAR A;  4IHJ B;  3ZRW A;  3CCU V;  2HG5 C;  2ZD9 A;  1EM1 A;  1AR5 A;  4P9P A;  2NS6 A;  4CH5 A;  4RO2 A;  3MF2 A;  2CK3 G;  3QNE A;  3ZJZ A;  1E79 G;  1BSM A;  1ADY A;  2OWO A;  4JTD B;  1OJH A;  3EHB B;  1C0A A;  1ZLZ A;  3JAL B;  5EIB C;  1N34 O;  4GKJ B;  1SA0 B;  5CB4 B;  1HNW O;  1JJC A;  3CC2 V;  1Z7M A;  3W7S A;  3HKD B;  4R6Z A;  1EIY A;  1Q8I A;  1K8A W;  4OXS A;  3K0D A;  2UUC B;  4QPK A;  2HLD G;  3P3N A;  4TQF A;  1ATI A;  3GB7 C;  2EJ7 A;  1XHX A;  4P30 A;  1SQV H;  1OCO C;  3JCZ A;  4UV9 A;  2ART A;  4DR6 B;  4DV0 B;  2EIJ C;  2WWW A;  3ZN0 A;  2WLM A;  4O2D A;  3L1A A;  2Z5U A;  2VQF B;  3CRC A;  3HKC A;  3LC0 A;  5KA6 A;  4EB6 A;  2BTQ A;  4TOI A;  2HR3 A;  2G4C A;  4JI2 O;  3L4G B;  3MDS A;  3J81 N;  3ABL B;  3ZHR A;  4XU1 A;  4NXM O;  4GX2 A;  3DXR A;  4FPP A;  4UB8 Z;  1E22 A;  4H2T A;  3ABK B;  4UCV A;  3IKM B;  2YXH A;  1AP5 A;  3T4Z A;  2CGH A;  1JJO A;  2ADQ B;  4X66 O;  3OR6 C;  1K3E A;  3H01 A;  4KFM A;  3RW0 A;  2DOS A;  5LP6 B;  1B70 A;  4B3T B;  4DK1 A;  4JI1 O;  1SQQ H;  1ZUQ A;  2ETN A;  3CJH A;  1KP2 A;  3EVK A;  5LMU B;  3ABM B;  5B1N A;  2ZR2 A;  5B1B B;  1USY A;  2UUC O;  4DR2 O;  1V54 B;  1V9P A;  3A0B Z;  5BMV B;  3SPI A;  2RHQ A;  1KP3 A;  2ZIM A;  4MVS A;  5H6Q A;  4W4K A;  4G85 A;  3UO2 A;  1K9M W;  1GM8 A;  3V8L A;  1KQS U;  1QBZ A;  4YY3 B;  1TAE A;  4LC1 A;  4OX9 O;  2ZTG A;  1L0N H;  3STL C;  4PDM A;  2EJ9 A;  3KCY A;  4PJ0 Z;  1Z2G A;  1NKD A;  2WLL B;  4BIZ A;  2OCH A;  5IE9 A;  5ELO A;  2EAY A;  4LF8 B;  2YEV A;  2F23 A;  4N21 A;  1P84 F;  1D5A A;  3E2E A;  4O4H B;  1BBW A;  2C2A A;  1QE0 A;  3V7C A;  3JSL A;  3LUT B;  5IY5 C;  2VQE B;  4DUY B;  1NYQ A;  4HYO A;  3AG4 C;  1SET A;  5LP6 A;  1H4V B;  3B40 A;  4WJ4 A;  3L71 H;  3T1Y O;  4UCT A;  2DYR C;  2LGW A;  4JAS A;  4X64 O;  4PHC A;  1X4T A;  1MZF A;  2GTA A;  2H3O A;  2UUB O;  4KHP B;  4IGG A;  4YRP A;  1L1F A;  4ZHQ A;  1VF7 A;  3OMN B;  1FYJ A;  2LW7 A;  4JPR A;  1THZ A;  3UO3 A;  4I7Z B;  2LP7 A;  2WLK A;  2LQT A;  2DJV A;  3QF7 A;  2D3O W;  4MVQ A;  3BAA A;  1FXK C;  4WFE A;  4YJ3 B;  2PI4 A;  1R3I C;  2XND G;  4Z1V A;  1YTF B;  3A8T A;  3ETG A;  4FLZ A;  3ASO C;  1CP9 A;  2UXB B;  4OX9 B;  3OD4 A;  5EZY B;  1H38 A;  1Q81 W;  4O2A A;  1H4S A;  4QE7 A;  5CB4 A;  2B1I A;  3H1L H;  2QWP B;  3M7M X;  3B8M A;  3JAL A;  4UP7 A;  2ZT8 A;  2YS8 A;  1URF A;  2C7I A;  5B1B C;  1U96 A;  2LJ2 A;  4X62 O;  5EC2 C;  2PTM A;  4J7J A;  3ZMV A;  3V8J A;  2R9A A;  4HWO A;  1SKV A;  2P67 A;  2IJK A;  2XAG A;  3HY0 A;  1N33 B;  3TJT A;  3LSU A;  4UCR A;  1LR1 A;  3VQW A;  3NEN A;  4NYK A;  4P72 A;  1YEW A;  4R8C A;  1GGM A;  4YRC A;  4KR3 A;  1VQ5 V;  3L2Z A;  2WPD G;  3APQ A;  4DV7 B;  1B8A A;  4J9Z B;  3RVY A;  2ZXF A;  2Q0O C;  3T1H O;  3W7X A;  4X1Y B;  3OFN G;  3Q4H A;  1NTK H;  5KHI A;  5EYP B;  3RYF A;  3HXW A;  1VQZ A;  4LF6 O;  1S76 D;  4U3J B;  1JR9 A;  4FFK A;  4X1I B;  1LUV A;  1Q6H A;  1JFF A;  1VF6 C;  4QGP A;  4C7U A;  1BHB A;  4LF7 B;  1HR0 B;  1P4R A;  4P9O A;  2F93 B;  2ZKO A;  5KAF Z;  4UVA A;  1DGS A;  4TV8 A;  4DV5 O;  4H02 A;  3SYQ A;  4OLF A;  4TWA A;  2FB5 A;  4JAA A;  4X8A A;  4LFB O;  3SJC C;  2ZIN A;  3H9V A;  4XTY A;  3ZED A;  1XMQ O;  1NH2 D;  1SA0 A;  2E1H A;  3CCJ V;  1Y66 A;  1PD3 A;  1OCO B;  2Y69 B;  3K5O A;  2WLN A;  4DR4 O;  4EFE A;  1Q6I A;  3ZS8 C;  3RYC B;  1D5N A;  3BJU A;  3VQV A;  2DWE C;  4MTX A;  1CEZ A;  4OGQ B;  4H2W A;  4O4H A;  1ENV A;  5JH7 A;  4KHP O;  3FAV B;  5CBG A;  1YGB A;  2K9P A;  4WFA V;  1N0J A;  1EVL A;  5FL7 G;  2YDE A;  1XBL A;  3LDE A;  3ZRX A;  3A7R A;  1SF9 A;  1QU7 A;  2JVD A;  4B3M O;  1H2S B;  1MAB G;  4KQE A;  3ZHS A;  1EQR A;  5LBQ A;  4QE9 A;  5BY1 A;  1VQ9 V;  4XEO A;  4E2L A;  1B7Y B;  3OW2 U;  3RKX A;  3SYP A;  2HJD A;  2RHQ B;  2JRI A;  1JPX A;  1H4Q A;  1MZE A;  1HNX B;  5AG2 A;  1USY C;  2W0X A;  1YIT V;  2CH7 A;  2ZXW B;  2Q5I A;  4LVJ A;  2QM8 A;  5K1X A;  4TVA B;  3RN4 A;  2QHS A;  4O2A B;  5BXZ A;  1JQ0 A;  1HNZ O;  2PZS A;  2ZGW A;  4FM2 A;  4NXN O;  4I55 A;  1YXB A;  3L75 H;  5B1O A;  1OCR C;  3CXH F;  4F4L A;  1IBL B;  1JOY A;  4P3P A;  4XTX A;  2F4V B;  2JS5 A;  1M9N A;  4B08 A;  5ELN A;  3DC6 A;  5LYJ A;  4DV7 O;  3QTC A;  1O9G A;  4MVR A;  1VF5 B;  1S0V A;  5DN6 G;  1Q86 W;  2AMC A;  3E9I A;  3RKW A;  4UXN A;  2P90 A;  4J7K A;  2ZQM A;  1GMG A;  3PCO A;  3W7U A;  3IC9 A;  3LDD A;  4J11 A;  1W2B U;  5C8Y A;  2XGT A;  2BCC H;  4LWS B;  2R9I A;  4BW5 A;  4CH4 A;  5LA6 B;  3E8G A;  3DTU B;  1TVK A;  1XNQ B;  1YSC A;  3SDL A;  3CCR V;  1G5I A;  3X2Q C;  3A7A A;  3TGU H;  2HHH B;  5LHI A;  3P8V A;  1WLE A;  2KSD A;  2QHT A;  4L8J A;  5JCO A;  4DR3 B;  1K73 W;  4FLU A;  5CA1 A;  1F4N A;  2EIL B;  4UUJ C;  3K9A A;  1W59 A;  3JCU Z;  3D36 A;  3I5D A;  2EJF A;  4LFC B;  2DYR B;  5B3S B;  3U10 A;  2RCV A;  1H2K A;  4YRR A;  4Q20 A;  1MNG A;  3T1C A;  3KKY A;  4ZKI A;  2CTW A;  5JWP A;  2HKO A;  3W3S A;  2GV9 A;  2GDS A;  2QKC A;  2XAQ A;  3IAY A;  1HDJ A;  4UV8 A;  1EN6 A;  2K1E A;  1I5Y A;  4MSW C;  5J2U B;  2P7T C;  3W7W A;  2Y0I A;  4WF2 A;  1F7Y A;  3SYO A;  1WP8 A;  2EIK C;  1IBK B;  1MMM A;  4PDV A;  4BR6 A;  4LF9 O;  1CPY A;  3ABT A;  3NEM A;  2ZT7 A;  2H94 A;  3CME V;  2N04 A;  2HFE C;  4CH6 A;  4BIO A;  2R70 A;  3K3W A;  2F1M A;  4DW0 A;  5CBH A;  3TET A;  4LFB B;  4X9Q A;  1BIB A;  3X2Q B;  4LP8 A;  4U7O A;  3DC5 A;  1P7B A;  3CB2 A;  2M7W A;  4YRK A;  5CA3 A;  2Q68 A;  3N27 A;  1GH6 A;  4I9Q A;  4YRJ A;  4ASU G;  4XEM A;  2HHH O;  4G84 A;  1IX9 A;  3J80 N;  4AQY O;  4UP9 A;  2Z0A A;  4WFF A;  3AEI A;  2Q9L A;  4U3J A;  4U7N A;  3DXR B;  4ABM A;  4DUZ O;  3REX A;  1PNK A;  5D5Q A;  4XBF A;  3P32 A;  3G6B A;  1WQ7 A;  2QKS A;  2PYL A;  1GAX A;  2UXD B;  1HP8 A;  2RHS B;  3CP1 A;  3RYH A;  2QM7 A;  4DV3 O;  4RAI A;  1N8R W;  2Q0A A;  3ZMS A;  1SQX H;  4EX5 A;  3CWB H;  4K86 A;  1EN5 A;  1AP6 A;  2JGD B;  1J95 A;  3ETQ A;  3K9S A;  3TEH A;  1AI6 A;  5CA0 A;  1ZL8 B;  1GN3 A;  3NET A;  1FFT B;  1K33 A;  1L0L H;  1GN6 A;  1R1B A;  3R65 A;  2ARH A;  1VQL V;  4MT8 A;  1N9W A;  5IJ9 A;  3I7F A;  3WQZ A;  2E5L B;  1S77 D;  4RMF A;  2ZM6 B;  2AZ0 A;  1B6Q A;  2EUL A;  2P4V A;  3BPZ A;  2I4O A;  4CH3 A;  3NXS A;  1QLN A;  1BE3 H;  3IAL A;  5IWA O;  5LHG A;  3RGB A;  1Q3E A;  3K58 A;  3VBB A;  2YIC A;  4UCO A;  2E64 A;  4YYE A;  2Q8V A;  4PA7 A;  5E1A C;  4TWK A;  1ASY A;  4ICG A;  1N34 B;  2QWR B;  1K92 A;  4FVM A;  3L9D A;  4DW1 A;  4DV0 O;  4K88 A;  4HA8 A;  1PYS B;  3ZBH A;  4YCW A;  1JJC B;  1J5E O;  3JD1 A;  4Q15 A;  4B7E A;  4GKK B;  2FML A;  3QG5 A;  4HWS A;  4JI6 B;  4FLY A;  4ZIB A;  4WFG A;  5FLX N;  3A5Y A;  3OM3 B;  1MSW D;  3E89 A;  4G2K A;  1HXD A;  1P49 A;  1NH2 B;  1GK9 A;  1G8M A;  3F5W C;  4JI0 O;  4QJF B;  2ARS A;  1B06 A;  3HRK A;  3IG2 A;  5B66 Z;  3E9H A;  1WA8 A;  3RVZ A;  1I94 B;  4P75 C;  4KR2 A;  4DR2 B;  2E5A A;  3SJB C;  3MAQ A;  1NVP D;  1F23 A;  3CRR A;  1M4U A;  2DZ9 A;  1F4M A;  1IBL O;  1EFR G;  2A79 B;  2ITC C;  4YCV A;  5EBM C;  4E51 A;  5LGT A;  1TVK B;  5GW7 A;  3CPW U;  1RIQ A;  4XDJ A;  4JI1 B;  2DXU A;  4P73 C;  3RL6 A;  2OIG A;  2QGN A;  1AB3 A;  3F5T A;  4FZ0 A;  3M99 B;  4AIL C;  3AG1 B;  1FS0 G;  3AG1 C;  3CHX A;  4XU3 A;  1QR9 A;  2X6A A;  4ZOL A;  4X20 B;  3M4P A;  2F66 C;  1NR1 A;  1Q82 W;  4DK0 A;  1OCC C;  1BL8 A;  2L6L A;  3BA8 A;  1VIB A;  2AKW A;  4J10 A;  2ZT9 B;  3QVN A;  2IH3 C;  4YIO A;  4X89 A;  1YZB A;  2AGA A;  4WBN A;  5LOV B;  2ILM A;  2Z3Y A;  5L3E A;  4YXW G;  1WJZ A;  1Q6U A;  2R9R B;  4HNA B;  1FJG B;  2B5U A;  1BMF G;  4LVM A;  2EJG A;  3MQZ A;  4X64 B;  1N36 O;  4YIP A;  4G27 B;  2DU7 A;  5CA1 B;  4ZI7 A;  3RYH B;  2DTH A;  2A9H A;  3CCV V;  2BE3 A;  4PA9 A;  4TT3 G;  3K0G A;  1XMO B;  2HJF C;  2ZE7 A;  4JI8 B;  4P3N A;  2Y0P A;  1WNL A;  2J3L A;  3A0H Z;  3S3X A;  4I9W A;  2P6J A;  4X66 B;  2DTO A;  1HR0 O;  1G5H A;  2X7R B;  1AJN A;  1O9H A;  5GON B;  1OCZ C;  1BIA A;  1TUB A;  2GBO A;  4N23 A;  2Y48 A;  3LNN A;  1Y74 A;  1Z7N A;  1DF5 A;  4J9Y B;  4NVP A;  3FB8 C;  4PEL A;  3KG2 A;  3RFR A;  2OIE A;  1B3Q A;  2OYQ A;  1RP3 B;  3P8Y A;  1XNR B;  5J9P C;  1I0H A;  3LSS A;  4GZR B;  2GHY A;  2RMK B;  4LFC O;  3JAS A;  4K8X A;  1SQB H;  1VQK V;  2AW9 A;  4IL6 Z;  3K5N A;  1Y67 A;  5HFM A;  5JQG B;  3HKB B;  5KLV H;  3CCL V;  4RQF A;  4YRQ A;  1G4Y B;  5H6R A;  1H4T A;  3JAS B;  4TVY A;  1HWY A;  3BY6 A;  3SR2 C;  1LUW A;  4P3O A;  3FD9 A;  2UUB B;  1SS3 A;  4FK5 C;  2VRZ A;  5LA6 A;  3RF1 A;  1XQ8 A;  1NNH A;  2PME A;  1QNM A;  5GTH Z;  3HKC B;  2PUS A;  4JZG A;  4YHH O;  3STZ C;  4HWT A;  2PY5 A;  1RM1 B;  4H2U A;  1H2L A;  2X6C A;  4D7S A;  1NJ2 A;  2ZXW C;  1IZ3 A;  1BT8 A;  2PF4 E;  2CTQ A;  2DTI A;  1PM9 A;  3TXQ A;  3MHH C;  2ATK C;  4DV6 O;  1KYO F;  1NR7 A;  3ZRW B;  5L3F A;  1HTT A;  1PYS A;  2DEQ A;  4UP8 A;  4X1K A;  2NLJ C;  2QJ1 A;  2UU9 O;  4KXR A;  4P2Z A;  3BAB A;  5DEC A;  1KBH A;  4QIW F;  4IT5 A;  2OCC B;  4CS3 A;  4JZ2 A;  4ZTZ B;  2DU5 A;  1NU1 H;  2IH1 C;  4O4J A;  1Y76 A;  2W0F C;  4UVB A;  1OCC B;  1N32 O;  4BWA A;  1YVW A;  1QCE A;  1AJP A;  1US6 A;  5C51 B;  4LFA B;  1XMQ B;  1AR4 A;  1X54 A;  2YEV B;  2W6J G;  4TV9 B;  4YRF A;  3E86 A;  3CCS V;  1QVF U;  4TTV A;  4YRL A;  4FMT A;  4GX1 A;  3WG7 B;  4O2B A;  5IWA B;  3K08 A;  4EFB A;  1E1R G;  4J7Z A;  3V8K A;  4PA3 A;  3UT5 A;  2JGD A;  4TUY B;  3TEH B;  4AH6 A;  5L3B A;  3O9O A;  4MTF A;  12AS A;  2YSU B;  1X01 A;  1EFW A;  4GX0 A;  1B70 B;  2M6Y A;  3QO5 A;  4LBE C;  3OMA B;  3B4S A;  4KL1 A;  4MTO A;  2EIL C;  2ODM A;  3K06 A;  1SZX A;  3RYI A;  2BSK B;  3R66 A;  3ZHV A;  2RQ6 A;  5DM6 V;  5JH7 B;  4DR3 O;  1B76 A;  2JEU A;  1S5J A;  2YI9 A;  3RT3 C;  2X6B A;  1IXM A;  1X2G A;  4NXN B;  3W7T A;  2WLH A;  1YI2 V;  1VF6 A;  5EC1 C;  1KU9 A;  3SPJ A;  3EXA A;  4DR7 B;  4DR4 B;  1WAZ A;  4B3M B;  3K79 A;  1DLB A;  1JA8 A;  1M5I A;  3ZHU A;  5CBF A;  2VWJ A;  5EYP A;  3RYF B;  4B3R B;  2XTI A;  3ICA A;  1S5H C;  1TGO A;  3JD4 A;  1NYR A;  3ETD A;  5KUK A;  5EK0 A;  4JYA B;  4D6T H;  1PPJ H;  3OTF A;  5JJE B;  3K03 A;  1N4C A;  1WPB A;  4X1I A;  1M93 A;  4PDL A;  3L4G A;  4P73 A;  1JFF B;  2CH7 B;  3E83 A;  2DN9 A;  4RDX A;  4YRN A;  2DQ0 A;  4TUY A;  5H9C A;  4P75 A;  1S3J A;  3JAR B;  2IBZ H;  2JGU A;  2N74 A;  5EZY A;  2XAF A;  3KCX A;  1XRE A;  5C53 B;  1WPY A;  3HB3 B;  3FJP A;  4GYC B;  3JAR A;  5C52 B;  3G71 V;  3K59 A;  4DR1 B;  3ZHT A;  4GKJ O;  2CTP A;  2EBO A;  3JAM N;  3CRA A;  5KMG B;  1OCZ B;  4YJ2 A;  2CAZ C;  2VS0 A;  2DW4 A;  4K3A A;  4F6R A;  2YXL A;  4IHJ A;  4LH6 A;  1QLE B;  2XOK G;  3JAK A;  3HR0 A;  4H2X B;  1NS1 A;  1E1T A;  1HNZ B;  1VQP V;  1M57 C;  4B3T O;  4JGS A;  1W0K G;  2CIM A;  2CTR A;  4X1K B;  1BCC H;  1FXK B;  5KHG A;  3CMQ A;  3E8B A;  5DED A;  4TVW A;  2EIJ B;  2IM9 A;  1VEW A;  2P22 C;  3FB7 C;  3VQY A;  3G4S V;  2AZ2 A;  2ZE6 A;  5H5N A;  2ZNI A;  2ZZG A;  2WAM A;  5KNN A;  1NJ1 A;  1J5W A;  1G1X B;  4NTY A;  4PA6 A;  2ZDI C;  4P71 A;  2HP8 A;  5IJ0 A;  1XMO O;  3CYO A;  1M1K W;  1DF4 A;  3NEL A;  4PI2 A;  3FFQ A;  1WU7 A;  3L74 H;  4K0K O;  4WI1 A;  1OHH G;  1BZK A;  2A3Q A;  3HKB A;  2RHS A;  2PI5 A;  3CMA V;  5L3G A;  3ZCC A;  2JS3 A;  4E4E A;  5JQG A;  3BVO A;  4YRS A;  3M8A A;  3UH0 A;  3S3W A;  4I0X A;  2QHV A;  1ARO P;  2X0L A;  1ZL8 A;  3AK3 A;  2QR4 A;  4P74 C;  2IU0 A;  1ASZ A;  2DE0 X;  5LP6 C;  5IJ9 B;  3Q4H B;  1QR8 A;  1B7Y A;  4MVO A;  3ZMU A;  2UUA B;  5FNV B;  4UCS A;  4G28 B;  2OTL V;  4XDL A;  3BFM A;  1FYF A;  5CMU A;  2CUG A;  2Q7H A;  5J2T B;  4GT1 A;  1GO3 F;  3RIR A;  3B77 A;  2A7W A;  4JI0 B;  3ML0 A;  3K5L A;  2Q6A A;  4LF4 B;  2YC0 A;  4WF9 V;  5LMN B;  1TUE B;  4UVC A;  3VOU A;  3BRC A;  3GVM A;  3APO A;  1K5S A;  1MA1 A;  2PYJ A;  1IXB A;  4H0L B;  5GTI Z;  2CJ9 A;  1YIJ V;  4LR3 A;  3C90 A;  2EIM B;  1PV0 A;  4DRX B;  3BFR A;  2I4N A;  2DVE A;  3RAC A;  2V1D A;  1AJQ A;  2UU9 B;  2E10 A;  3EFR A;  1NJ5 A;  2JJ1 G;  5FPO A;  4HNA A;  4JYC A;  1PKX A;  1ADJ A;  3N2G A;  4UFZ A;  5ITZ B;  2CJB A;  5IYD O;  2HVJ C;  3C3T A;  3ERR A;  1GTO A;  4DV3 B;  5IY5 B;  1OCR B;  4DV4 B;  2UXC O;  4FLX A;  4X65 B;  1XL6 A;  2AHY A;  1UJW B;  1L8D A;  3N2G B;  5B3S C;  1XDC A;  3UKM A;  4DR7 O;  3BHP A;  1IBM O;  3ZIA G;  4HWP A;  4AHC A;  5K1P A;  1P7G A;  2LGQ A;  5LXT A;  1LYL A;  2DZC A;  1ZX3 A;  3RBZ A;  1AVM A;  3T1Y B;  3D3Q A;  2ZZF A;  5L3C A;  1WB8 A;  2L35 A;  1XI1 A;  2E5L O;  2ZE5 A;  3HY1 A;  1QQC A;  2P0L A;  1K4D C;  1XUQ A;  3H1J H;  2P06 A;  3E8F A;  2JJ2 G;  5B1A B;  2KG7 B;  3GWK C;  2QM4 A;  4CBC A;  3OUF A;  2V4D A;  3N2K A;  1YF2 A;  1R73 A;  4TV9 A;  2I4M A;  3BCC H;  4I4T B;  1SQG A;  2XT9 A;  1ORQ C;  3OGC C;  4LF4 O;  1JMK C;  4LF5 B;  2EIM C;  1U97 A;  4LF6 B;  3UQ8 A;  2ITD C;  4X5O A;  3UT5 B;  2QTO A;  1H2G A;  2WLI B;  3WB1 A;  4JYA O;  4ZTU B;  1PL4 A;  3FB5 C;  2GSM B;  4CC6 A;  1HC7 A;  4FM1 A;  3FX7 A;  1Y6X A;  2ARU A;  3F7Y C;  2W6I G;  5KX5 A;  4LNU A;  1NJI W;  2YIB D;  3LNM B;  4CS4 A;  3JAT A;  4YRM A;  4F6R B;  2ADP A;  4JI5 O;  4PHZ A;  3HFZ A;  1OZ0 A;  1V55 C;  1FXV A;  4HWR A;  1EOV A;  3HRI A;  3CC4 V;  3AG3 C;  4MVZ A;  2V7Q G;  2UXX A;  1SER A;  1GKF A;  1KOG A;  3B8N A;  1GN2 A;  4FZ1 A;  1EZJ A;  4UB6 Z;  1M56 C;  5IYC O;  5LOV A;  1NJ8 A;  4JI3 B;  2QEX V;  1EN4 A;  1HW7 A;  2EZP A;  3ICX A;  1RFY A;  2F95 B;  2J3M A;  3HTZ A;  1CXZ B;  3LDC A;  1A32 A;  4NTX A;  3D8C A;  3UCS C;  1XHZ A;  4H13 B;  2B1G A;  4FFB B;  4B3S B;  2XAJ A;  4R50 A;  2XUM A;  1GRJ A;  3UGT A;  1W0J G;  1AI5 A;  2DWD C;  1YFS A;  2YUA A;  2QA4 V;  1N36 B;  3U0Z A;  3F7V C;  2KQX A;  1EBO A;  1OV9 A;  4XU0 A;  5BR8 B;  2AXT Z;  3ABK C;  2QTS A;  2RNB A;  2YXY A;  2ZNJ A;  4FIP C;  3ZMT A;  4KUM A;  1HNW B;  4LF8 O;  5C93 A;  4DV6 B;  2QWN B;  1UFI A;  2QWQ B;  3KZI Z;  2QKA A;  4GUN A;  2ODR D;  1NTM H;  4DRX A;  1PP9 H;  1K4C C;  5JJJ B;  1LNQ A;  4HAM A;  5EBW C;  1R3L C;  3ZRV A;  4P71 C;  1NI8 A;  4JI5 B;  3UFG A;  3V7R A;  3P8T A;  4DV2 O;  1KKC A;  3A74 A;  3JAK B;  4H2X A;  2P4K A;  3IFX A;  1ZTE A;  4BAY A;  1VQ8 V;  1XL4 A;  1BBU A;  4K87 A;  2G38 A;  5F5W A;  1K7D A;  2H8P C;  3ASO B;  4JI3 O;  3OT7 A;  4O4I A;  2C8M A;  4K35 A;  4FJC C;  3A2F A;  4XTZ A;  4LNU B;  3ABL C;  4NKG B;  3HXV A;  4DR5 O;  4Q6G A;  1JVM A;  3MF1 A;  4BW9 A;  1YJW V;  5EIB D;  3G67 A;  3RGL A;  3UM7 A;  1Y76 B;  2EWN A;  1BGY H;  2NN4 A;  1KUQ A;  3IC7 A;  4JAV A;  1XNQ O;  1DK1 A;  5FPR A;  1VQ7 V;  1GN4 A;  1PNM A;  5BR8 O;  3A0R A;  3G6E V;  3DSQ A;  2QDO A;  4IIJ B;  2O57 A;  1V54 C;  1FAF A;  5IYZ A;  4RWU A;  3PCO B;  4I0X B;  1FD9 A;  1QF6 A;  4LNS A;  2YI8 A;  5LMN O;  4GCZ A;  3CJH B;  3JD0 A;  1YFT A;  5TIS Z;  4L87 A;  3ASN B;  3JAT B;  2FTK A;  4NCX A;  4MS2 A;  2VQF O;  2F4V O;  4QPJ A;  4PA4 A;  4IYI A;  4OP0 A;  3PN1 A;  1Q43 A;  2D2C B;  4IIJ A;  1MOF A;  2IY5 B;  1N32 B;  4MW8 A;  4YY3 O;  1AIL A;  3HXZ A;  2ZCE A;  3OTO O;  4OPA A;  4YRE A;  1VMG A;  2HEP A;  1YTF D;  4CZZ A;  1KMI Z;  4X65 O;  1Q90 D;  1KC8 W;  1RM1 C;  4H37 A;  3SPH A;  1K5Q A;  4NB5 A;  4YRO A;  1GM9 A;  4JI7 B;  1VQ6 V;  3BA9 A;  3MD0 A;  3KFU A;  2IJI A;  2WLL A;  3CCQ V;  4JI4 O;  3HXU A;  3HXY A;  2EIN B;  3OAA G;  3ABM C;  2CJA A;  1SC5 B;  4YCU A;  4YRT A;  2KKW A;  1XNR O;  4RUF A;  3REU A;  1BS3 A;  5BZB A;  2DQ3 A;  2YIB A;  3B09 A;  3FYI B;  4I50 A;  3SJA C;  3CCM V;  2ODR C;  2WA3 A;  1QVG U;  1VQN V;  3HPL C;  3L72 H;  1H2N A;  3V7S A;  3J7A U;  1NQT A;  1YJ9 V;  3TEG A;  1RPR A;  5GON A;  3AG2 C;  4B3R O;  2QWO B;  3AG2 B;  2Y69 C;  1E24 A;  2Q5Z A;  3E8H A;  3CC7 V;  3IGA C;  4OPH A;  4JV5 B;  1I94 O;  1IL2 A;  2EJR A;  4FM0 A;  3AK1 A;  4CC5 A;  4LFA O;  1YB3 A;  1Q5O A;  5A9G A;  2EX3 A;  4ZI7 B;  3P30 A;  1R6K A;  5JVD B;  1FPO A;  1K97 A;  4U3F H;  4LVK A;  3E22 B;  2XAH A;  4ZOL B;  2RN9 A;  5JJN B;  2B9Z A;  3ZHQ A;  5IYZ B;  4NR1 A;  3RUX A;  3I56 V;  5IT9 N;  1YDX A;  2MK3 A;  4GLX A;  1F51 A;  4H2Y A;  1SRY A;  2IU3 A;  4DYL A;  2Q7E A;  3SYC A;  2HNI A;  4O4J B;  1VQ4 V;  4WFB V;  2IJH A;  1SQP H;  3BEH A;  3RYC A;  1KEC A;  2MW2 B;  1M56 B;  1IUR A;  4LH7 A;  1VP7 A;  2LW1 A;  4IYH A;  2E76 B;  1G51 A;  2DJZ A;  1FXK A;  3GWO A;  2VQE O;  4DUY O;  4JTC B;  1I08 A;  3G1Z A;  1KKD A;  2ALY A;  4YPF A;  2E3C A;  5BMV A;  1MSD A;  2IW5 A;  3R07 A;  4LWS A;  1W66 A;  4TV8 B;  2GUZ A;  2CE4 A;  3NR7 A;  1E1O A;  2OTJ V;  3WFV A;  2DYS B;  3OGI B;  2Q4P A;  4RUE A;  2QSA A;  1NJ6 A;  1TUB B;  3ASN C;  4DO2 A;  2BTQ B;  1YJN V;  4DV2 B;  4FLW A;  4JI8 O;  4UCU A;  4HZ3 A;  4MVU A;  1KMN A;  4JI2 B;  2Q73 A;  3TXS A;  5B5E Z;  3WG7 C;  1M90 W;  4NXM B;  2YID A;  2OT5 A;  4LVL A;  3JD3 A;  1QHT A;  5KX5 B;  4XTW A;  3SPG A;  2FYU H;  4FLV A;  4EKW A;  2BOB C;  4I50 B;  2DMX A;  2XTA A;  2AMC B;  1G6U A;  3HFZ B;  3ETE A;  4DV5 B;  4X20 A;  1FXH A;  1Z5V A;  4EEQ A;  3WB2 A;  4JI4 B;  4XU2 A;  2RJZ A;  3H1I H;  2UXD O;  3OMI B;  4GKK O;  5LGN A;  2VWK A;  4R7C A;  1WNS A;  1WP7 A;  4EB6 B;  4WJ3 M;  3HKD A;  2WLI A;  3FKS G;  4AI8 A;  4Z1M G;  2JIZ G;  2E41 A;  4O4L B;  5KHJ A;  4QNH B;  1Y74 B;  1WQW A;  4D7T A;  5A2Q N;  2EIK B;  2JK5 C;  3WU2 Z;  4DR5 B;  3FB6 C;  2E74 B;  3PJS K;  1R6N A;  1JJ2 U;  2DYS C;  1KMM A;  3N2K B;  1AI4 A;  3CRM A;  1JCH A;  3EFS A;  1ZAU A;  4NTW A;  4WCE V;  5LL6 Y;  2FL4 A;  5CN0 A;  2WA4 A;  4J42 A;  5C8Y B;  2BTO A;  2DDZ A;  2Q67 A;  3JYC A;  4LF9 B;  3T1H B;  4YP0 A;  4I55 B;  3M4Q A;  2PGG A;  2YIA A;  4F6E A;  1X55 A;  3CD6 V;  4H44 B;  5D5P A;  2ZT5 A;  4DR1 O;  5KUM A;  1D2D A;  3CXC U;  4I4T A;  3CRQ A;  1JX9 A;  3P3P A;  4H2V A;  2ZE8 A;  3D3I A;  5LYJ B;  1N0N A;  1RPO A;  4JI6 O;  5HFL A;  1ROP A;  4K0K B;  4XTV A;  1PL0 A;  3T2M A;  2KG7 A;  3CSX A;  4XDK A;  5CA0 B;  4FFB A;  1R6T A;  2LFS A;  2Q5H A;  3CS5 A;  1R3J C;  3FAV A;  1GM7 A;  1N33 O;  4DPG A;  1YFR A;  1PNL A;  4DUZ B;  2EL9 A;  2IJJ A;  2E75 B;  3OEH G;  3TUP A;  1QLE C;  1RSO A;  2QHU A;  4CS2 A;  4JYB A;  4GX5 A;  3WB0 A;  5FNV A;  4HBN A;  2A06 H;  3OD1 A;  3C3S A;  1FFX B;  4WFH A;  3DGE A;  2WSS G;  1EIY B;  1EZV H;  3RYI B;  5J2U A;  1WYD A;  5KA5 A;  4DV1 B;  1AI7 A;  3CE2 A;  5J2T A;  3E22 A;  4K8Z A;  2AKW B;  4PG3 A;  4LF5 O;  5HGQ A;  2CGN A;  1X59 A;  2FYK A;  2P5O A;  4DV4 O;  5KHK A;  2UXC B;  2ZDI A;  4I5S A;  2XHB A;  1IDS A;  1IBM B;  2Q69 A;  5JCO C;  2A8E A;  1NT2 B;  3H1H H;  3O65 A; 
#chains in the Genus database with same CATH homology
 3A5Z A;  1G5H A;  4DV7 B;  1B8A A;  3ICX A;  1O9H A;  5GON B;  1BIA A;  1TUB A;  1FFX A;  2F95 B;  2J3M A;  3HTZ A;  2ZXF A;  4J15 A;  4LVI A;  3RKY A;  4O4I B;  3LNN A;  4X1Y B;  2ZZE A;  1Z7N A;  5KHI A;  5EYP B;  3RYF A;  5E3I A;  3THO A;  1WN7 A;  4UPA A;  3HXW A;  1VQZ A;  4NVP A;  1XHZ A;  3QO7 A;  4XTU A;  4U3J B;  3RFR A;  4X1Y A;  3RWR D;  2OYQ A;  3P8Y A;  4YRG A;  1XNR B;  4FLT A;  4FFB B;  4B3S B;  3LSS A;  4X1I B;  5JVD A;  1JFF A;  3UGT A;  2ZIO A;  1YFS A;  4LF7 B;  3JAS A;  1N36 B;  3B2E E;  3U0Z A;  4K8X A;  1HR0 B;  2ALY B;  4DQ2 A;  4HT4 A;  2F93 B;  3K5N A;  4XU0 A;  5JQG B;  3HKB B;  5BR8 B;  1DGS A;  3JAW A;  4RQF A;  4TV8 A;  4YRQ A;  4YRI A;  4H02 A;  1H4T A;  4OLF A;  2ZNJ A;  3QO8 A;  3JAS B;  4TVY A;  4TWA A;  1HNW B;  4P3O A;  3SR2 C;  4DV6 B;  1X56 A;  3SJC C;  2UUB B;  2ZIN A;  2ODR D;  5LA6 A;  4XTY A;  3ZED A;  3RF1 A;  4DRX A;  1XQ8 A;  1NNH A;  2PME A;  2E1H A;  1SA0 A;  5JJJ B;  3HKC B;  2PUS A;  4HWT A;  5KMG A;  2PY5 A;  3K5O A;  4O4L A;  4H2U A;  4EFE A;  4YHH B;  3ZS8 C;  4P71 C;  3RYC B;  5IJ0 B;  3BJU A;  3VQV A;  4JI5 B;  3UFG A;  4D7S A;  3V7R A;  3P8T A;  3LSQ A;  3HKE A;  1NJ2 A;  3A74 A;  4H2W A;  2P5I A;  3JAK B;  4H2X A;  3JSN A;  4O4H A;  4PI0 A;  3L2Z A;  2DTI A;  5JH7 A;  4K87 A;  1BBU A;  1YGB A;  5F5W A;  1EVK A;  4RQE A;  5KHH A;  3IKL A;  1EVL A;  1HTT A;  1PYS A;  2DEQ A;  4UP8 A;  4X1K A;  1B04 A;  2QJ1 A;  4HVC A;  4O4I A;  3A7R A;  2JVD A;  2C8M A;  1H2S B;  3BAB A;  4TVA A;  4KQE A;  3A2F A;  4XTZ A;  4LNU B;  4H2S A;  3HXX A;  1EQR A;  4CS3 A;  4ZTZ B;  2DU5 A;  3HXV A;  4ZHQ B;  4XEO A;  3HKE B;  4O4J A;  4Q6G A;  3MF1 A;  4BW9 A;  1B7Y B;  4BWA A;  4RDX A;  5C51 B;  5EIB D;  1XMQ B;  4LFA B;  1X54 A;  3RKX A;  4YJ3 A;  2RHQ B;  4TV9 B;  3RGL A;  2EWN A;  2DXT A;  4YRF A;  1H4Q A;  3K57 A;  2R72 A;  1HNX B;  4TTV A;  4YRL A;  1L0W A;  5FPR A;  1USY C;  4O2B A;  5IWA B;  3A31 A;  3A32 A;  4EFB A;  2Q5I A;  3UGQ A;  3V8K A;  3DSQ A;  4LVJ A;  3UT5 A;  4IIJ B;  5K1X A;  4TVA B;  4TUY B;  2QHS A;  1TA8 A;  4O2A B;  4WBN B;  5LXT B;  3TEH B;  4AH6 A;  5IYZ A;  2PMF A;  2PZS A;  4O2B B;  4FM2 A;  12AS A;  2ZGW A;  1X2H A;  3PCO B;  4I55 A;  3OTO B;  1X01 A;  2DKG A;  1EFW A;  1QF6 A;  4LNS A;  1B70 B;  2YI8 A;  1T5E A;  3QO5 A;  1YFT A;  1IBL B;  4KL1 A;  4L87 A;  3JAT B;  4P3P A;  4XTX A;  2F4V B;  2JS5 A;  4NCX A;  5ELN A;  4B08 A;  3RYI A;  5LYJ A;  2RQ6 A;  3QTC A;  4X62 B;  4YDQ A;  5JH7 B;  4YJ2 B;  1O9G A;  1B76 A;  4OP0 A;  1S5J A;  1Q43 A;  3PN1 A;  2YI9 A;  2AMC A;  3E9I A;  2ZR3 A;  3HFV A;  1Z5W A;  4IIJ A;  1X2G A;  3RKW A;  4NXN B;  2ZT6 A;  1SQF A;  3JAW B;  1N32 B;  3PCO A;  3HXZ A;  2IY5 A;  2ZCE A;  2Q7G A;  1J5E B;  3PZC A;  5C8Y A;  2HEP A;  3SGI A;  2XGT A;  1KU9 A;  4YRE A;  4P74 A;  3K5M A;  4CH4 A;  1I7F A;  5LA6 B;  4DR7 B;  3VQX A;  4DR4 B;  1KMI Z;  3U11 A;  1TVK A;  1XNQ B;  4B3M B;  1G5I A;  4YRO A;  1M5I A;  3A7A A;  4AQY B;  4JI7 B;  2HHH B;  2VWJ A;  3P8V A;  1WLE A;  4TQD A;  5EYP A;  3RYF B;  2QHT A;  4L8J A;  5JCO A;  4B3R B;  2E65 A;  2XTI A;  3BA9 A;  4DR3 B;  3ICA A;  4EO4 A;  1TGO A;  3KFU A;  4FLU A;  1NYR A;  3HXU A;  4P72 C;  3HXY A;  4JYA B;  2I4L A;  5CA1 A;  3OTF A;  1SES A;  5ITZ A;  5JJE B;  2CJA A;  4X1I A;  1WPB A;  3L4G A;  4P73 A;  1M93 A;  4YCU A;  4YRT A;  2KKW A;  3A7U A;  3MEY A;  1JFF B;  11AS A;  3REU A;  4X66 B;  4IHJ B;  2EJF A;  4LFC B;  2YIB A;  2DQ3 A;  4TUY A;  4I50 A;  3SJA C;  2DQ0 A;  2ODR C;  4YRN A;  4P75 A;  3U10 A;  4YRR A;  3JAR B;  3V7S A;  2NS6 A;  4CH5 A;  2JGU A;  3TEG A;  3MF2 A;  5EZY A;  3QNE A;  5GON A;  5C53 B;  1ADY A;  2OWO A;  1WPY A;  1E24 A;  3FJP A;  1C0A A;  3JAL B;  4GYC B;  5EIB C;  4GKJ B;  3JAR A;  5C52 B;  1SA0 B;  3K59 A;  3W3S A;  4JV5 B;  5CB4 B;  2GV9 A;  4DR1 B;  1IL2 A;  1JJC A;  3IAY A;  4FM0 A;  1Z7M A;  3HKD B;  1EIY A;  1Q8I A;  5KMG B;  4YJ2 A;  4CC5 A;  5J2U B;  1YB3 A;  2CAZ C;  1Q5O A;  2UUC B;  2EX3 A;  4F6R A;  4ZI7 B;  4WF2 A;  2YXL A;  1IBK B;  5JVD B;  4IHJ A;  4TQF A;  4LH6 A;  3NEM A;  3JAK A;  1ATI A;  4H2X B;  4LVK A;  3E22 B;  2ZT7 A;  1E1T A;  1HNZ B;  1XHX A;  4ZOL B;  5JJN B;  4CH6 A;  2R70 A;  2F1M A;  2CIM A;  1BIB A;  4LFB B;  4X1K B;  5IYZ B;  5KHG A;  3CMQ A;  2ART A;  4DR6 B;  3RUX A;  4DV0 B;  4TVW A;  3CB2 A;  2IM9 A;  4O2D A;  3L1A A;  4GLX A;  4YRK A;  2P22 C;  3VQY A;  2VQF B;  4I9Q A;  4YRJ A;  4H2Y A;  1SRY A;  2ZNI A;  2ZZG A;  4XEM A;  2Q7E A;  5KNN A;  3HKC A;  3LC0 A;  4G84 A;  4UP9 A;  2HNI A;  4O4J B;  1NJ1 A;  1J5W A;  4EB6 A;  2BTQ A;  4TOI A;  4U3J A;  3RYC A;  2G4C A;  3REX A;  5D5Q A;  4LH7 A;  3L4G B;  4P71 A;  1WQ7 A;  5IJ0 A;  2PYL A;  2UXD B;  4XU1 A;  2RHS B;  3RYH A;  1G51 A;  2DJZ A;  1E22 A;  3NEL A;  4PI2 A;  3IKM B;  4UCV A;  3G1Z A;  4H2T A;  3FFQ A;  1WU7 A;  2ALY A;  2Q0A A;  4YPF A;  4EX5 A;  2E3C A;  2CGH A;  4WI1 A;  5BMV A;  1JJO A;  4K86 A;  3TEH A;  3ETQ A;  3HKB A;  3R07 A;  1W66 A;  2RHS A;  5CA0 A;  4TV8 B;  1E1O A;  3NET A;  4YRS A;  5JQG A;  5LP6 B;  5IJ9 A;  1N9W A;  1B70 A;  1TUB B;  1NJ6 A;  3UH0 A;  2QHV A;  2BTQ B;  3I7F A;  3WQZ A;  4B3T B;  4DV2 B;  4DK1 A;  4FLW A;  2E5L B;  4UCU A;  4P74 C;  1KMN A;  4RMF A;  4JI2 B;  2ZM6 B;  1ASZ A;  5LMU B;  5LP6 C;  5IJ9 B;  1B7Y A;  4NXM B;  2UUA B;  2ZR2 A;  1USY A;  3BPZ A;  5FNV B;  4LVL A;  2I4O A;  4CH3 A;  4UCS A;  1QHT A;  5KX5 B;  4XTW A;  1V9P A;  3IAL A;  4FLV A;  3RGB A;  1Q3E A;  5BMV B;  3K58 A;  3BFM A;  3VBB A;  2RHQ A;  4I50 B;  4UCO A;  1FYF A;  2E64 A;  4YYE A;  2Q7H A;  2AMC B;  1G6U A;  2ZIM A;  5J2T B;  3HFZ B;  3RIR A;  1ASY A;  1N34 B;  4DV5 B;  4X20 A;  4JI0 B;  1Z5V A;  4EEQ A;  3WB2 A;  4JI4 B;  4G85 A;  3K5L A;  4XU2 A;  4FVM A;  3V8L A;  2RJZ A;  4LF4 B;  5LMN B;  4YY3 B;  4K88 A;  1TAE A;  4HA8 A;  1PYS B;  3BRC A;  2VWK A;  4YCW A;  1JJC B;  1WNS A;  2PYJ A;  4EB6 B;  2ZTG A;  4Q15 A;  2CJ9 A;  4GKK B;  4WJ3 M;  3HKD A;  4LR3 A;  4DRX B;  3QG5 A;  4HWS A;  4JI6 B;  2I4N A;  2DVE A;  4FLY A;  3RAC A;  4ZIB A;  2E41 A;  2UU9 B;  4O4L B;  2E10 A;  5KHJ A;  3EFR A;  2EJ9 A;  3A5Y A;  1WQW A;  1NJ5 A;  5FPO A;  1HXD A;  4HNA A;  4D7T A;  1P49 A;  5ELO A;  2EAY A;  4LF8 B;  1ADJ A;  1D5A A;  3N2G A;  4UFZ A;  4O4H B;  2ARS A;  5ITZ B;  1BBW A;  4DR5 B;  1QE0 A;  2CJB A;  3JSL A;  3ERR A;  3HRK A;  3IG2 A;  4DV3 B;  3V7C A;  2VQE B;  4DUY B;  1NYQ A;  3E9H A;  1I94 B;  1KMM A;  3N2K B;  4DV4 B;  4FLX A;  4P75 C;  4KR2 A;  4DR2 B;  2E5A A;  4X65 B;  3SJB C;  1L8D A;  3N2G B;  4HWP A;  3MAQ A;  3EFS A;  2IY5 B;  3BHP A;  1ZAU A;  1SET A;  4AHC A;  5LP6 A;  1M4U A;  5K1P A;  1H4V B;  2DZ9 A;  5LXT A;  4WJ4 A;  1LYL A;  4UCT A;  2DZC A;  5C8Y B;  2BTO A;  2DDZ A;  3T1Y B;  4YCV A;  4PHC A;  2ZZF A;  4E51 A;  1X4T A;  1TVK B;  4LF9 B;  3T1H B;  1XI1 A;  4I55 B;  1RIQ A;  4YP0 A;  3M4Q A;  2PGG A;  4JI1 B;  1QQC A;  2DXU A;  3HY1 A;  4P73 C;  3RL6 A;  2YIA A;  4KHP B;  2P0L A;  1X55 A;  4YRP A;  4ZHQ A;  5D5P A;  2ZT5 A;  1VF7 A;  4I4T A;  2QM4 A;  4AIL C;  3CHX A;  4H2V A;  5LYJ B;  2V4D A;  4XU3 A;  3N2K A;  4TV9 A;  2I4M A;  4ZOL A;  3QF7 A;  3BAA A;  4X20 B;  4K0K B;  3M4P A;  2F66 C;  4XTV A;  4I4T B;  1SQG A;  3CSX A;  4DK0 A;  4YJ3 B;  5CA0 B;  4FFB A;  3BA8 A;  2AKW A;  2Q5H A;  4FLZ A;  2UXB B;  1JMK C;  4LF5 B;  4DPG A;  1YFR A;  4DUZ B;  2EL9 A;  4LF6 B;  3UQ8 A;  4OX9 B;  5EZY B;  3UT5 B;  4X5O A;  3TUP A;  3WB1 A;  4O2A A;  4WBN A;  4ZTU B;  1RSO A;  5CB4 A;  1H4S A;  2QHU A;  5LOV B;  4CS2 A;  3M7M X;  3JAL A;  4CC6 A;  1HC7 A;  4FM1 A;  2ARU A;  3WB0 A;  5FNV A;  4UP7 A;  4HBN A;  4HNA B;  2ZT8 A;  1FJG B;  5KX5 A;  2C7I A;  4LNU A;  1FFX B;  3OD1 A;  4LVM A;  2YIB D;  2EJG A;  1EIY B;  3MQZ A;  3RYI B;  5J2U A;  1WYD A;  4X64 B;  4CS4 A;  2PTM A;  2DU7 A;  3V8J A;  3JAT A;  5CA1 B;  4YRM A;  2R9A A;  3RYH B;  4F6R B;  1SKV A;  4ZI7 A;  4DV1 B;  2DTH A;  4HWO A;  4PHZ A;  5J2T A;  3E22 A;  3HFZ A;  3HY0 A;  4K8Z A;  2AKW B;  4HWR A;  1EOV A;  3HRI A;  4PG3 A;  1N33 B;  1XMO B;  5HGQ A;  4UCR A;  4JI8 B;  2FYK A;  3VQW A;  4P3N A;  3NEN A;  2P5O A;  2UXC B;  5KHK A;  1SER A;  1KOG A;  2XHB A;  4P72 A;  1YEW A;  1WNL A;  2J3L A;  1IBM B;  1GGM A;  4YRC A;  5LOV A;  1NJ8 A;  4KR3 A;  4JI3 B;  5JCO C;  2A8E A;  1NT2 B;  1HW7 A;  2DTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...