1YFRA

Crystal structure of alanyl-trna synthetase in complex with atp and magnesium
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
total genus 137
structure length 448
sequence length 457
chains with identical sequence B
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yfrA01
1EOVA 1EVLA 2P5IA 2ZR3A 3LSQA 4HWRA 2ARTA 3E9IA 2E65A 4XU1A 4RQEA 1EIYB 2DTOA 4YRRA 2ZINA 1FYFA 1QE0A 4J15A 2AKWA 1VQZA 2J3MA 2EL9A 4YCWA 4YRKA 4KQEA 3EFSA 4YRJA 1SRYA 4YRGA 5KNNA 3HXWA 4TVWA 5C53B 1ADYA 1EIYA 3HRIA 2DZCA 2QHSA 3IKLA 3RIRA 4OLFA 3UFGA 1RIQA 3EFRA 3TEHB 3A32A 4CH3A 1NYQA 3HFZB 1NYRA 1N9WA 1X55A 3HY1A 1B70B 1WYDA 4H2YA 4P74A 3V7RA 3M4QA 3QO7A 1W66A 3RKWA 3NELA 4YCUA 3RF1A 3RACA 2CGHA 5C52B 4YRSA 4TWAA 4P71A 3BFMA 4YP0A 1B8AA 1ATIA 1QF6A 1ASZA 3A74A 3BJUA 2DVEA 4L87A 1BIAA 1H4VB 1Z7MA 4G85A 2ZIOA 3HRKA 1X01A 1B7YB 4XTUA 2CJAA 4O2DA 3V8JA 3VQVA 3L1AA 2RHQA 3MF1A 2RHQB 3HXZA 3A31A 4XU2A 4DPGA 1B76A 1WPYA 4P3PA 3E9HA 2ZR2A 3UGQA 2I4NA 4YRMA 3L2ZA 3G1ZA 2DQ0A 2J3LA 2ODRD 4H2WA 3HFZA 3A7UA 3KFUA 2DJZA 3IALA 2DU5A 1B70A 4XEOA 4Q6GA 3A7AA 4UP9A 1SERA 4E51A 2CJBA 3V8LA 4X5OA 1E1TA 3DSQA 4RDXA 4YRIA 3ERRA 2DKGA 4P75A 3IKMB 3HXVA 4YDQA 1G5HA 4H2VA 4HA8A 3I7FA 4XTWA 4BW9A 3HXUA 3QO8A 3VQXA 3QNEA 4RMFA 4XTXA 2EJGA 1JJCA 1JJCB 1WU7A 1C0AA 1H4QA 3MF2A 1SETA 2ZIMA 4HWTA 5HGQA 1NJ6A 1NNHA 4TVAA 2ZT6A 2ZT8A 3UH0A 3WQZA 2ZNJA 4YCVA 4P72A 4RQFA 2I4LA 4CS4A 4AH6A 4K86A 5F5WA 3VBBA 4YRQA 2QHUA 3NEMA 1B7YA 4XTYA 3REUA 5ELOA 2RHSA 3P8VA 3A5YA 2E41A 1E1OA 1USYC 4WJ4A 4TTVA 4WF2A 3R07A 2ZZGA 2P0LA 2AMCB 11ASA 3A7RA 4EX5A 4TQFA 3NENA 4TQDA 2C8MA 4HWSA 4P72C 1H4TA 3HXYA 4H2XB 4YRTA 3PZCA 4ZIBA 4CH4A 4H2UA 4CS3A 1NJ5A 1YFRA 4P73A 4YPFA 4H02A 3L4GA 2DXTA 1WLEA 3HY0A 4YYEA 1PYSA 1KMMA 1WQ7A 2C7IA 1YGBA 2ZZFA 4HWPA 3QO5A 2ZT7A 3LSSA 3A5ZA 2Q7GA 3RL6A 2ARSA 4XTVA 5ELNA 4WJ3M 1Z7NA 3HXXA 1H4SA 2PMEA 2E10A 3UGTA 1HC7A 12ASA 2G4CA 1E22A 2Q5IA 2ALYB 4CH5A 1BIBA 3REXA 1KOGA 1PYSB 4UP8A 2QHVA 4UP7A 3P8YA 4H2SA 1L0WA 2Q7HA 3RKYA 4XTZA 3RKXA 1HTTA 1BBWA 2DTIA 2XGTA 2ARUA 2Q5HA 3IG2A 2ZTGA 2ZXFA 3PCOA 4CS2A 1X54A 1YFSA 1G51A 2QHTA 4YROA 3FJPA 2E1HA 2E3CA 2PMFA 2AKWB 4Q15A 4HWOA 1ASYA 4H2TA 4DQ2A 3CMQA 5C51B 4NCXA 3V8KA 1E24A 4P73C 4YREA 1SESA 2AMCA 2ZZEA 1NJ1A 3ICAA 3HTZA 1G5IA 3TEGA 1LYLA 4LNSA 3M4PA 2E64A 4ZTUB 1USYA 2RHSB 4YRPA 3HFVA 2DXUA 1X56A 2DQ3A 4P75C 4YRFA 3V7SA 5K1XA 1YFTA 4P3OA 3TEHA 2DZ9A 3TUPA 4PG3A 1NJ8A 3RUXA 2IY5B 2EJFA 2IY5A 4XU0A 1WQWA 4YRLA 2CIMA 3W3SA 4TVAB 1WNLA 2I4OA 3P8TA 1EFWA 4EO4A 4UPAA 2DTHA 2ZT5A 2ZNIA 3NETA 3V7CA 2EWNA 1EVKA 2ZCEA 2XTIA 1EQRA 3MEYA 4G84A 1J5WA 4OP0A 3QTCA 2I4MA 1KMNA 4YRCA 4H2XA 4P74C 4XU3A 2Q7EA 4PHCA 2DDZA 4WI1A 3VQYA 2EJ9A 1NJ2A 1IL2A 2ODRC 3VQWA 3L4GB 1YB3A 2HNIA 1X2HA 5E3IA 3PCOB 2CJ9A 3OD1A 4KR3A 4HVCA 2DEQA 1HXDA 5K1PA 4TVYA 1ADJA 1GGMA 2ZGWA 2DU7A 4P71C 4XEMA 2FYKA 4ZTZB 4YRNA 2EAYA 4P3NA 4BWAA 3LC0A 4K87A 4K88A 3RGLA 4CH6A 2ALYA 2E5AA 4KR2A 1X2GA 1BBUA
chains in the Genus database with same CATH superfamily
1EOVA 1EVLA 2P5IA 2ZR3A 3LSQA 4HWRA 2ARTA 3E9IA 2E65A 4XU1A 4RQEA 1EIYB 2DTOA 4YRRA 2ZINA 1FYFA 1QE0A 4J15A 2AKWA 1VQZA 2J3MA 2EL9A 4YCWA 4YRKA 4KQEA 3EFSA 4YRJA 1SRYA 4YRGA 5KNNA 3HXWA 4TVWA 5C53B 1ADYA 1EIYA 4LVIA 3HRIA 2DZCA 2QHSA 3IKLA 3RIRA 4OLFA 3UFGA 1RIQA 3EFRA 3TEHB 3A32A 4CH3A 1NYQA 3HFZB 1NYRA 1N9WA 1X55A 3HY1A 1B70B 1WYDA 4H2YA 4P74A 3V7RA 3M4QA 3QO7A 1W66A 3RKWA 3NELA 4YCUA 3RF1A 3RACA 2CGHA 5C52B 4YRSA 4TWAA 4P71A 3BFMA 4YP0A 1B8AA 1ATIA 1QF6A 1ASZA 3A74A 3BJUA 2DVEA 4L87A 1BIAA 1H4VB 1Z7MA 4G85A 2ZIOA 3HRKA 1X01A 1B7YB 4XTUA 2CJAA 4O2DA 3V8JA 3VQVA 3L1AA 2RHQA 3MF1A 2RHQB 3HXZA 3A31A 4XU2A 4DPGA 1B76A 1WPYA 4P3PA 3E9HA 2ZR2A 3UGQA 2I4NA 4YRMA 3L2ZA 3G1ZA 2DQ0A 2J3LA 2ODRD 4H2WA 3HFZA 3A7UA 3KFUA 2DJZA 3IALA 2DU5A 1B70A 4XEOA 4Q6GA 3A7AA 4UP9A 1SERA 4E51A 2CJBA 3V8LA 4X5OA 1E1TA 3DSQA 4RDXA 4YRIA 4LVMA 3ERRA 2DKGA 4P75A 3IKMB 3HXVA 4YDQA 1G5HA 4H2VA 4HA8A 3I7FA 4XTWA 4BW9A 3HXUA 3QO8A 3VQXA 3QNEA 4RMFA 4XTXA 2EJGA 1JJCA 1JJCB 1WU7A 1C0AA 1H4QA 3MF2A 1SETA 2ZIMA 4HWTA 5HGQA 1NJ6A 1NNHA 4TVAA 2ZT6A 2ZT8A 3UH0A 3WQZA 2ZNJA 4YCVA 4P72A 4RQFA 2I4LA 4CS4A 4AH6A 4K86A 5F5WA 3VBBA 4YRQA 2QHUA 3NEMA 1B7YA 4XTYA 3REUA 5ELOA 2RHSA 3P8VA 3A5YA 2E41A 1E1OA 1USYC 4WJ4A 2NS6A 4TTVA 4WF2A 3R07A 2ZZGA 2P0LA 2AMCB 11ASA 3A7RA 4EX5A 4TQFA 3NENA 4TQDA 2C8MA 4HWSA 4P72C 1H4TA 3HXYA 4H2XB 4YRTA 3PZCA 4ZIBA 4CH4A 4H2UA 4CS3A 1NJ5A 1YFRA 4P73A 4YPFA 4H02A 3L4GA 2DXTA 1WLEA 3HY0A 4YYEA 1PYSA 1KMMA 1WQ7A 2C7IA 1YGBA 4HT4A 2ZZFA 3MQZA 4HWPA 3QO5A 2ZT7A 2A8EA 3LSSA 3A5ZA 2Q7GA 3RL6A 2ARSA 4XTVA 5ELNA 4WJ3M 1Z7NA 3HXXA 1H4SA 2PMEA 2E10A 3UGTA 1HC7A 12ASA 2G4CA 1E22A 2Q5IA 2ALYB 4CH5A 1BIBA 3REXA 1KOGA 1PYSB 4UP8A 2QHVA 4UP7A 3P8YA 4H2SA 1L0WA 2Q7HA 3RKYA 4XTZA 3RKXA 1HTTA 1BBWA 2DTIA 2XGTA 2ARUA 2Q5HA 3IG2A 2ZTGA 2ZXFA 3PCOA 4CS2A 1X54A 1YFSA 1G51A 2QHTA 4YROA 3FJPA 2E1HA 2E3CA 2PMFA 2AKWB 4Q15A 4HWOA 1ASYA 4H2TA 4DQ2A 3CMQA 5C51B 4NCXA 3V8KA 1E24A 4P73C 4YREA 1SESA 2AMCA 2ZZEA 1NJ1A 3ICAA 3HTZA 1G5IA 4LVLA 3TEGA 1LYLA 4LNSA 3M4PA 2E64A 4ZTUB 1USYA 2RHSB 4YRPA 4LVJA 3HFVA 2DXUA 1X56A 2DQ3A 4P75C 4YRFA 3V7SA 5K1XA 1YFTA 4P3OA 3TEHA 2DZ9A 3TUPA 4PG3A 1NJ8A 3RUXA 2IY5B 2EJFA 2IY5A 4XU0A 1WQWA 4YRLA 2CIMA 3W3SA 4TVAB 1WNLA 2I4OA 3P8TA 1EFWA 4EO4A 4UPAA 2DTHA 2ZT5A 2ZNIA 3NETA 3V7CA 2EWNA 1EVKA 2ZCEA 2XTIA 1EQRA 3MEYA 4G84A 1J5WA 4OP0A 3QTCA 2I4MA 4LVKA 1KMNA 4YRCA 4H2XA 4P74C 4XU3A 2Q7EA 4PHCA 2DDZA 4WI1A 3VQYA 2EJ9A 1NJ2A 1IL2A 2ODRC 3VQWA 3L4GB 1YB3A 2HNIA 1X2HA 5E3IA 3PCOB 2CJ9A 3OD1A 4KR3A 4HVCA 2DEQA 1HXDA 5K1PA 4TVYA 1ADJA 1GGMA 2ZGWA 2DU7A 4P71C 4XEMA 2FYKA 4ZTZB 4YRNA 2EAYA 4P3NA 4BWAA 3LC0A 4K87A 4K88A 3RGLA 4CH6A 2ALYA 2E5AA 4KR2A 1X2GA 1BBUA
chains in the Genus database with same CATH topology
1EOVA 1EVLA 2P5IA 2ZR3A 3LSQA 4HWRA 2ARTA 3E9IA 2E65A 4XU1A 4RQEA 1EIYB 2DTOA 4YRRA 2ZINA 1FYFA 1QE0A 4J15A 2AKWA 1VQZA 2J3MA 2EL9A 4YCWA 4YRKA 4KQEA 3EFSA 4YRJA 1SRYA 4YRGA 5KNNA 3HXWA 4TVWA 5C53B 1ADYA 1EIYA 4LVIA 3HRIA 2DZCA 2QHSA 3IKLA 3RIRA 4OLFA 3UFGA 1RIQA 3EFRA 3TEHB 3A32A 4CH3A 1NYQA 3HFZB 1NYRA 1N9WA 1X55A 3HY1A 1B70B 1WYDA 4H2YA 4P74A 3V7RA 3M4QA 3QO7A 1W66A 3RKWA 3NELA 4YCUA 3RF1A 3RACA 2CGHA 5C52B 4YRSA 4TWAA 4P71A 3BFMA 4YP0A 1B8AA 1ATIA 1QF6A 1ASZA 3A74A 3BJUA 2DVEA 4L87A 1BIAA 1H4VB 1Z7MA 4G85A 2ZIOA 3HRKA 1X01A 1B7YB 4XTUA 2CJAA 4O2DA 3V8JA 3VQVA 3L1AA 2RHQA 3MF1A 2RHQB 3HXZA 3A31A 4XU2A 4DPGA 1B76A 1WPYA 4P3PA 3E9HA 2ZR2A 3UGQA 2I4NA 4YRMA 3L2ZA 3G1ZA 2DQ0A 2J3LA 2ODRD 4H2WA 3HFZA 3A7UA 3KFUA 2DJZA 3IALA 2DU5A 1B70A 4XEOA 4Q6GA 3A7AA 4UP9A 1SERA 4E51A 2CJBA 3V8LA 4X5OA 1E1TA 3DSQA 4RDXA 4YRIA 4LVMA 3ERRA 2DKGA 4P75A 3IKMB 3HXVA 4YDQA 1G5HA 4H2VA 4HA8A 3I7FA 4XTWA 4BW9A 3HXUA 3QO8A 3VQXA 3QNEA 4RMFA 4XTXA 2EJGA 1JJCA 1JJCB 1WU7A 1C0AA 1H4QA 3MF2A 1SETA 2ZIMA 4HWTA 5HGQA 1NJ6A 1NNHA 4TVAA 2ZT6A 2ZT8A 3UH0A 3WQZA 2ZNJA 4YCVA 4P72A 4RQFA 2I4LA 4CS4A 4AH6A 4K86A 5F5WA 3VBBA 4YRQA 2QHUA 3NEMA 1B7YA 4XTYA 3REUA 5ELOA 2RHSA 3P8VA 3A5YA 2E41A 1E1OA 1USYC 4WJ4A 2NS6A 4TTVA 4WF2A 3R07A 2ZZGA 2P0LA 2AMCB 11ASA 3A7RA 4EX5A 4TQFA 3NENA 4TQDA 2C8MA 4HWSA 4P72C 1H4TA 3HXYA 4H2XB 4YRTA 3PZCA 4ZIBA 4CH4A 4H2UA 4CS3A 1NJ5A 1YFRA 4P73A 4YPFA 4H02A 3L4GA 2DXTA 1WLEA 3HY0A 4YYEA 1PYSA 1KMMA 1WQ7A 2C7IA 1YGBA 4HT4A 2ZZFA 3MQZA 4HWPA 3QO5A 2ZT7A 2A8EA 3LSSA 3A5ZA 2Q7GA 3RL6A 2ARSA 4XTVA 5ELNA 4WJ3M 1Z7NA 3HXXA 1H4SA 2PMEA 2E10A 3UGTA 1HC7A 12ASA 2G4CA 1E22A 2Q5IA 2ALYB 4CH5A 1BIBA 3REXA 1KOGA 1PYSB 4UP8A 2QHVA 4UP7A 3P8YA 4H2SA 1L0WA 2Q7HA 3RKYA 4XTZA 3RKXA 1HTTA 1BBWA 2DTIA 2XGTA 2ARUA 2Q5HA 3IG2A 2ZTGA 2ZXFA 3PCOA 4CS2A 1X54A 1YFSA 1G51A 2QHTA 4YROA 3FJPA 2E1HA 2E3CA 2PMFA 2AKWB 4Q15A 4HWOA 1ASYA 4H2TA 4DQ2A 3CMQA 5C51B 4NCXA 3V8KA 1E24A 4P73C 4YREA 1SESA 2AMCA 2ZZEA 1NJ1A 3ICAA 3HTZA 1G5IA 4LVLA 3TEGA 1LYLA 4LNSA 3M4PA 2E64A 4ZTUB 1USYA 2RHSB 4YRPA 4LVJA 3HFVA 2DXUA 1X56A 2DQ3A 4P75C 4YRFA 3V7SA 5K1XA 1YFTA 4P3OA 3TEHA 2DZ9A 3TUPA 4PG3A 1NJ8A 3RUXA 2IY5B 2EJFA 2IY5A 4XU0A 1WQWA 4YRLA 2CIMA 3W3SA 4TVAB 1WNLA 2I4OA 3P8TA 1EFWA 4EO4A 4UPAA 2DTHA 2ZT5A 2ZNIA 3NETA 3V7CA 2EWNA 1EVKA 2ZCEA 2XTIA 1EQRA 3MEYA 4G84A 1J5WA 4OP0A 3QTCA 2I4MA 4LVKA 1KMNA 4YRCA 4H2XA 4P74C 4XU3A 2Q7EA 4PHCA 2DDZA 4WI1A 3VQYA 2EJ9A 1NJ2A 1IL2A 2ODRC 3VQWA 3L4GB 1YB3A 2HNIA 1X2HA 5E3IA 3PCOB 2CJ9A 3OD1A 4KR3A 4HVCA 2DEQA 1HXDA 5K1PA 4TVYA 1ADJA 1GGMA 2ZGWA 2DU7A 4P71C 4XEMA 2FYKA 4ZTZB 4YRNA 2EAYA 4P3NA 4BWAA 3LC0A 4K87A 4K88A 3RGLA 4CH6A 2ALYA 2E5AA 4KR2A 1X2GA 1BBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOV A;  1EVL A;  2P5I A;  2ZR3 A;  3LSQ A;  4HWR A;  2ART A;  3E9I A;  2E65 A;  4XU1 A;  4RQE A;  1EIY B;  2DTO A;  4YRR A;  2ZIN A;  1FYF A;  1QE0 A;  4J15 A;  2AKW A;  1VQZ A;  2J3M A;  2EL9 A;  4YCW A;  4YRK A;  4KQE A;  3EFS A;  4YRJ A;  1SRY A;  4YRG A;  5KNN A;  3HXW A;  4TVW A;  5C53 B;  1ADY A;  1EIY A;  3HRI A;  2DZC A;  2QHS A;  3IKL A;  3RIR A;  4OLF A;  3UFG A;  1RIQ A;  3EFR A;  3TEH B;  3A32 A;  4CH3 A;  1NYQ A;  3HFZ B;  1NYR A;  1N9W A;  1X55 A;  3HY1 A;  1B70 B;  1WYD A;  4H2Y A;  4P74 A;  3V7R A;  3M4Q A;  3QO7 A;  1W66 A;  3RKW A;  3NEL A;  4YCU A;  3RF1 A;  3RAC A;  2CGH A;  5C52 B;  4YRS A;  4TWA A;  4P71 A;  3BFM A;  4YP0 A;  1B8A A;  1ATI A;  1QF6 A;  1ASZ A;  3A74 A;  3BJU A;  2DVE A;  4L87 A;  1BIA A;  1H4V B;  1Z7M A;  4G85 A;  2ZIO A;  3HRK A;  1X01 A;  1B7Y B;  4XTU A;  2CJA A;  4O2D A;  3V8J A;  3VQV A;  3L1A A;  2RHQ A;  3MF1 A;  2RHQ B;  3HXZ A;  3A31 A;  4XU2 A;  4DPG A;  1B76 A;  1WPY A;  4P3P A;  3E9H A;  2ZR2 A;  3UGQ A;  2I4N A;  4YRM A;  3L2Z A;  3G1Z A;  2DQ0 A;  2J3L A;  2ODR D;  4H2W A;  3HFZ A;  3A7U A;  3KFU A;  2DJZ A;  3IAL A;  2DU5 A;  1B70 A;  4XEO A;  4Q6G A;  3A7A A;  4UP9 A;  1SER A;  4E51 A;  2CJB A;  3V8L A;  4X5O A;  1E1T A;  3DSQ A;  4RDX A;  4YRI A;  3ERR A;  2DKG A;  4P75 A;  3IKM B;  3HXV A;  4YDQ A;  1G5H A;  4H2V A;  4HA8 A;  3I7F A;  4XTW A;  4BW9 A;  3HXU A;  3QO8 A;  3VQX A;  3QNE A;  4RMF A;  4XTX A;  2EJG A;  1JJC A;  1JJC B;  1WU7 A;  1C0A A;  1H4Q A;  3MF2 A;  1SET A;  2ZIM A;  4HWT A;  5HGQ A;  1NJ6 A;  1NNH A;  4TVA A;  2ZT6 A;  2ZT8 A;  3UH0 A;  3WQZ A;  2ZNJ A;  4YCV A;  4P72 A;  4RQF A;  2I4L A;  4CS4 A;  4AH6 A;  4K86 A;  5F5W A;  3VBB A;  4YRQ A;  2QHU A;  3NEM A;  1B7Y A;  4XTY A;  3REU A;  5ELO A;  2RHS A;  3P8V A;  3A5Y A;  2E41 A;  1E1O A;  1USY C;  4WJ4 A;  4TTV A;  4WF2 A;  3R07 A;  2ZZG A;  2P0L A;  2AMC B;  11AS A;  3A7R A;  4EX5 A;  4TQF A;  3NEN A;  4TQD A;  2C8M A;  4HWS A;  4P72 C;  1H4T A;  3HXY A;  4H2X B;  4YRT A;  3PZC A;  4ZIB A;  4CH4 A;  4H2U A;  4CS3 A;  1NJ5 A;  1YFR A;  4P73 A;  4YPF A;  4H02 A;  3L4G A;  2DXT A;  1WLE A;  3HY0 A;  4YYE A;  1PYS A;  1KMM A;  1WQ7 A;  2C7I A;  1YGB A;  2ZZF A;  4HWP A;  3QO5 A;  2ZT7 A;  3LSS A;  3A5Z A;  2Q7G A;  3RL6 A;  2ARS A;  4XTV A;  5ELN A;  4WJ3 M;  1Z7N A;  3HXX A;  1H4S A;  2PME A;  2E10 A;  3UGT A;  1HC7 A;  12AS A;  2G4C A;  1E22 A;  2Q5I A;  2ALY B;  4CH5 A;  1BIB A;  3REX A;  1KOG A;  1PYS B;  4UP8 A;  2QHV A;  4UP7 A;  3P8Y A;  4H2S A;  1L0W A;  2Q7H A;  3RKY A;  4XTZ A;  3RKX A;  1HTT A;  1BBW A;  2DTI A;  2XGT A;  2ARU A;  2Q5H A;  3IG2 A;  2ZTG A;  2ZXF A;  3PCO A;  4CS2 A;  1X54 A;  1YFS A;  1G51 A;  2QHT A;  4YRO A;  3FJP A;  2E1H A;  2E3C A;  2PMF A;  2AKW B;  4Q15 A;  4HWO A;  1ASY A;  4H2T A;  4DQ2 A;  3CMQ A;  5C51 B;  4NCX A;  3V8K A;  1E24 A;  4P73 C;  4YRE A;  1SES A;  2AMC A;  2ZZE A;  1NJ1 A;  3ICA A;  3HTZ A;  1G5I A;  3TEG A;  1LYL A;  4LNS A;  3M4P A;  2E64 A;  4ZTU B;  1USY A;  2RHS B;  4YRP A;  3HFV A;  2DXU A;  1X56 A;  2DQ3 A;  4P75 C;  4YRF A;  3V7S A;  5K1X A;  1YFT A;  4P3O A;  3TEH A;  2DZ9 A;  3TUP A;  4PG3 A;  1NJ8 A;  3RUX A;  2IY5 B;  2EJF A;  2IY5 A;  4XU0 A;  1WQW A;  4YRL A;  2CIM A;  3W3S A;  4TVA B;  1WNL A;  2I4O A;  3P8T A;  1EFW A;  4EO4 A;  4UPA A;  2DTH A;  2ZT5 A;  2ZNI A;  3NET A;  3V7C A;  2EWN A;  1EVK A;  2ZCE A;  2XTI A;  1EQR A;  3MEY A;  4G84 A;  1J5W A;  4OP0 A;  3QTC A;  2I4M A;  1KMN A;  4YRC A;  4H2X A;  4P74 C;  4XU3 A;  2Q7E A;  4PHC A;  2DDZ A;  4WI1 A;  3VQY A;  2EJ9 A;  1NJ2 A;  1IL2 A;  2ODR C;  3VQW A;  3L4G B;  1YB3 A;  2HNI A;  1X2H A;  5E3I A;  3PCO B;  2CJ9 A;  3OD1 A;  4KR3 A;  4HVC A;  2DEQ A;  1HXD A;  5K1P A;  4TVY A;  1ADJ A;  1GGM A;  2ZGW A;  2DU7 A;  4P71 C;  4XEM A;  2FYK A;  4ZTZ B;  4YRN A;  2EAY A;  4P3N A;  4BWA A;  3LC0 A;  4K87 A;  4K88 A;  3RGL A;  4CH6 A;  2ALY A;  2E5A A;  4KR2 A;  1X2G A;  1BBU A; 
#chains in the Genus database with same CATH topology
 1EOV A;  1EVL A;  2P5I A;  2ZR3 A;  3LSQ A;  4HWR A;  2ART A;  3E9I A;  2E65 A;  4XU1 A;  4RQE A;  1EIY B;  2DTO A;  4YRR A;  2ZIN A;  1FYF A;  1QE0 A;  4J15 A;  2AKW A;  1VQZ A;  2J3M A;  2EL9 A;  4YCW A;  4YRK A;  4KQE A;  3EFS A;  4YRJ A;  1SRY A;  4YRG A;  5KNN A;  3HXW A;  4TVW A;  5C53 B;  1ADY A;  1EIY A;  4LVI A;  3HRI A;  2DZC A;  2QHS A;  3IKL A;  3RIR A;  4OLF A;  3UFG A;  1RIQ A;  3EFR A;  3TEH B;  3A32 A;  4CH3 A;  1NYQ A;  3HFZ B;  1NYR A;  1N9W A;  1X55 A;  3HY1 A;  1B70 B;  1WYD A;  4H2Y A;  4P74 A;  3V7R A;  3M4Q A;  3QO7 A;  1W66 A;  3RKW A;  3NEL A;  4YCU A;  3RF1 A;  3RAC A;  2CGH A;  5C52 B;  4YRS A;  4TWA A;  4P71 A;  3BFM A;  4YP0 A;  1B8A A;  1ATI A;  1QF6 A;  1ASZ A;  3A74 A;  3BJU A;  2DVE A;  4L87 A;  1BIA A;  1H4V B;  1Z7M A;  4G85 A;  2ZIO A;  3HRK A;  1X01 A;  1B7Y B;  4XTU A;  2CJA A;  4O2D A;  3V8J A;  3VQV A;  3L1A A;  2RHQ A;  3MF1 A;  2RHQ B;  3HXZ A;  3A31 A;  4XU2 A;  4DPG A;  1B76 A;  1WPY A;  4P3P A;  3E9H A;  2ZR2 A;  3UGQ A;  2I4N A;  4YRM A;  3L2Z A;  3G1Z A;  2DQ0 A;  2J3L A;  2ODR D;  4H2W A;  3HFZ A;  3A7U A;  3KFU A;  2DJZ A;  3IAL A;  2DU5 A;  1B70 A;  4XEO A;  4Q6G A;  3A7A A;  4UP9 A;  1SER A;  4E51 A;  2CJB A;  3V8L A;  4X5O A;  1E1T A;  3DSQ A;  4RDX A;  4YRI A;  4LVM A;  3ERR A;  2DKG A;  4P75 A;  3IKM B;  3HXV A;  4YDQ A;  1G5H A;  4H2V A;  4HA8 A;  3I7F A;  4XTW A;  4BW9 A;  3HXU A;  3QO8 A;  3VQX A;  3QNE A;  4RMF A;  4XTX A;  2EJG A;  1JJC A;  1JJC B;  1WU7 A;  1C0A A;  1H4Q A;  3MF2 A;  1SET A;  2ZIM A;  4HWT A;  5HGQ A;  1NJ6 A;  1NNH A;  4TVA A;  2ZT6 A;  2ZT8 A;  3UH0 A;  3WQZ A;  2ZNJ A;  4YCV A;  4P72 A;  4RQF A;  2I4L A;  4CS4 A;  4AH6 A;  4K86 A;  5F5W A;  3VBB A;  4YRQ A;  2QHU A;  3NEM A;  1B7Y A;  4XTY A;  3REU A;  5ELO A;  2RHS A;  3P8V A;  3A5Y A;  2E41 A;  1E1O A;  1USY C;  4WJ4 A;  2NS6 A;  4TTV A;  4WF2 A;  3R07 A;  2ZZG A;  2P0L A;  2AMC B;  11AS A;  3A7R A;  4EX5 A;  4TQF A;  3NEN A;  4TQD A;  2C8M A;  4HWS A;  4P72 C;  1H4T A;  3HXY A;  4H2X B;  4YRT A;  3PZC A;  4ZIB A;  4CH4 A;  4H2U A;  4CS3 A;  1NJ5 A;  1YFR A;  4P73 A;  4YPF A;  4H02 A;  3L4G A;  2DXT A;  1WLE A;  3HY0 A;  4YYE A;  1PYS A;  1KMM A;  1WQ7 A;  2C7I A;  1YGB A;  4HT4 A;  2ZZF A;  3MQZ A;  4HWP A;  3QO5 A;  2ZT7 A;  2A8E A;  3LSS A;  3A5Z A;  2Q7G A;  3RL6 A;  2ARS A;  4XTV A;  5ELN A;  4WJ3 M;  1Z7N A;  3HXX A;  1H4S A;  2PME A;  2E10 A;  3UGT A;  1HC7 A;  12AS A;  2G4C A;  1E22 A;  2Q5I A;  2ALY B;  4CH5 A;  1BIB A;  3REX A;  1KOG A;  1PYS B;  4UP8 A;  2QHV A;  4UP7 A;  3P8Y A;  4H2S A;  1L0W A;  2Q7H A;  3RKY A;  4XTZ A;  3RKX A;  1HTT A;  1BBW A;  2DTI A;  2XGT A;  2ARU A;  2Q5H A;  3IG2 A;  2ZTG A;  2ZXF A;  3PCO A;  4CS2 A;  1X54 A;  1YFS A;  1G51 A;  2QHT A;  4YRO A;  3FJP A;  2E1H A;  2E3C A;  2PMF A;  2AKW B;  4Q15 A;  4HWO A;  1ASY A;  4H2T A;  4DQ2 A;  3CMQ A;  5C51 B;  4NCX A;  3V8K A;  1E24 A;  4P73 C;  4YRE A;  1SES A;  2AMC A;  2ZZE A;  1NJ1 A;  3ICA A;  3HTZ A;  1G5I A;  4LVL A;  3TEG A;  1LYL A;  4LNS A;  3M4P A;  2E64 A;  4ZTU B;  1USY A;  2RHS B;  4YRP A;  4LVJ A;  3HFV A;  2DXU A;  1X56 A;  2DQ3 A;  4P75 C;  4YRF A;  3V7S A;  5K1X A;  1YFT A;  4P3O A;  3TEH A;  2DZ9 A;  3TUP A;  4PG3 A;  1NJ8 A;  3RUX A;  2IY5 B;  2EJF A;  2IY5 A;  4XU0 A;  1WQW A;  4YRL A;  2CIM A;  3W3S A;  4TVA B;  1WNL A;  2I4O A;  3P8T A;  1EFW A;  4EO4 A;  4UPA A;  2DTH A;  2ZT5 A;  2ZNI A;  3NET A;  3V7C A;  2EWN A;  1EVK A;  2ZCE A;  2XTI A;  1EQR A;  3MEY A;  4G84 A;  1J5W A;  4OP0 A;  3QTC A;  2I4M A;  4LVK A;  1KMN A;  4YRC A;  4H2X A;  4P74 C;  4XU3 A;  2Q7E A;  4PHC A;  2DDZ A;  4WI1 A;  3VQY A;  2EJ9 A;  1NJ2 A;  1IL2 A;  2ODR C;  3VQW A;  3L4G B;  1YB3 A;  2HNI A;  1X2H A;  5E3I A;  3PCO B;  2CJ9 A;  3OD1 A;  4KR3 A;  4HVC A;  2DEQ A;  1HXD A;  5K1P A;  4TVY A;  1ADJ A;  1GGM A;  2ZGW A;  2DU7 A;  4P71 C;  4XEM A;  2FYK A;  4ZTZ B;  4YRN A;  2EAY A;  4P3N A;  4BWA A;  3LC0 A;  4K87 A;  4K88 A;  3RGL A;  4CH6 A;  2ALY A;  2E5A A;  4KR2 A;  1X2G A;  1BBU A; 
#chains in the Genus database with same CATH homology
 1EOV A;  1EVL A;  2P5I A;  2ZR3 A;  3LSQ A;  4HWR A;  2ART A;  3E9I A;  2E65 A;  4XU1 A;  4RQE A;  1EIY B;  2DTO A;  4YRR A;  2ZIN A;  1FYF A;  1QE0 A;  4J15 A;  2AKW A;  1VQZ A;  2J3M A;  2EL9 A;  4YCW A;  4YRK A;  4KQE A;  3EFS A;  4YRJ A;  1SRY A;  4YRG A;  5KNN A;  3HXW A;  4TVW A;  5C53 B;  1ADY A;  1EIY A;  4LVI A;  3HRI A;  2DZC A;  2QHS A;  3IKL A;  3RIR A;  4OLF A;  3UFG A;  1RIQ A;  3EFR A;  3TEH B;  3A32 A;  4CH3 A;  1NYQ A;  3HFZ B;  1NYR A;  1N9W A;  1X55 A;  3HY1 A;  1B70 B;  1WYD A;  4H2Y A;  4P74 A;  3V7R A;  3M4Q A;  3QO7 A;  1W66 A;  3RKW A;  3NEL A;  4YCU A;  3RF1 A;  3RAC A;  2CGH A;  5C52 B;  4YRS A;  4TWA A;  4P71 A;  3BFM A;  4YP0 A;  1B8A A;  1ATI A;  1QF6 A;  1ASZ A;  3A74 A;  3BJU A;  2DVE A;  4L87 A;  1BIA A;  1H4V B;  1Z7M A;  4G85 A;  2ZIO A;  3HRK A;  1X01 A;  1B7Y B;  4XTU A;  2CJA A;  4O2D A;  3V8J A;  3VQV A;  3L1A A;  2RHQ A;  3MF1 A;  2RHQ B;  3HXZ A;  3A31 A;  4XU2 A;  4DPG A;  1B76 A;  1WPY A;  4P3P A;  3E9H A;  2ZR2 A;  3UGQ A;  2I4N A;  4YRM A;  3L2Z A;  3G1Z A;  2DQ0 A;  2J3L A;  2ODR D;  4H2W A;  3HFZ A;  3A7U A;  3KFU A;  2DJZ A;  3IAL A;  2DU5 A;  1B70 A;  4XEO A;  4Q6G A;  3A7A A;  4UP9 A;  1SER A;  4E51 A;  2CJB A;  3V8L A;  4X5O A;  1E1T A;  3DSQ A;  4RDX A;  4YRI A;  4LVM A;  3ERR A;  2DKG A;  4P75 A;  3IKM B;  3HXV A;  4YDQ A;  1G5H A;  4H2V A;  4HA8 A;  3I7F A;  4XTW A;  4BW9 A;  3HXU A;  3QO8 A;  3VQX A;  3QNE A;  4RMF A;  4XTX A;  2EJG A;  1JJC A;  1JJC B;  1WU7 A;  1C0A A;  1H4Q A;  3MF2 A;  1SET A;  2ZIM A;  4HWT A;  5HGQ A;  1NJ6 A;  1NNH A;  4TVA A;  2ZT6 A;  2ZT8 A;  3UH0 A;  3WQZ A;  2ZNJ A;  4YCV A;  4P72 A;  4RQF A;  2I4L A;  4CS4 A;  4AH6 A;  4K86 A;  5F5W A;  3VBB A;  4YRQ A;  2QHU A;  3NEM A;  1B7Y A;  4XTY A;  3REU A;  5ELO A;  2RHS A;  3P8V A;  3A5Y A;  2E41 A;  1E1O A;  1USY C;  4WJ4 A;  2NS6 A;  4TTV A;  4WF2 A;  3R07 A;  2ZZG A;  2P0L A;  2AMC B;  11AS A;  3A7R A;  4EX5 A;  4TQF A;  3NEN A;  4TQD A;  2C8M A;  4HWS A;  4P72 C;  1H4T A;  3HXY A;  4H2X B;  4YRT A;  3PZC A;  4ZIB A;  4CH4 A;  4H2U A;  4CS3 A;  1NJ5 A;  1YFR A;  4P73 A;  4YPF A;  4H02 A;  3L4G A;  2DXT A;  1WLE A;  3HY0 A;  4YYE A;  1PYS A;  1KMM A;  1WQ7 A;  2C7I A;  1YGB A;  4HT4 A;  2ZZF A;  3MQZ A;  4HWP A;  3QO5 A;  2ZT7 A;  2A8E A;  3LSS A;  3A5Z A;  2Q7G A;  3RL6 A;  2ARS A;  4XTV A;  5ELN A;  4WJ3 M;  1Z7N A;  3HXX A;  1H4S A;  2PME A;  2E10 A;  3UGT A;  1HC7 A;  12AS A;  2G4C A;  1E22 A;  2Q5I A;  2ALY B;  4CH5 A;  1BIB A;  3REX A;  1KOG A;  1PYS B;  4UP8 A;  2QHV A;  4UP7 A;  3P8Y A;  4H2S A;  1L0W A;  2Q7H A;  3RKY A;  4XTZ A;  3RKX A;  1HTT A;  1BBW A;  2DTI A;  2XGT A;  2ARU A;  2Q5H A;  3IG2 A;  2ZTG A;  2ZXF A;  3PCO A;  4CS2 A;  1X54 A;  1YFS A;  1G51 A;  2QHT A;  4YRO A;  3FJP A;  2E1H A;  2E3C A;  2PMF A;  2AKW B;  4Q15 A;  4HWO A;  1ASY A;  4H2T A;  4DQ2 A;  3CMQ A;  5C51 B;  4NCX A;  3V8K A;  1E24 A;  4P73 C;  4YRE A;  1SES A;  2AMC A;  2ZZE A;  1NJ1 A;  3ICA A;  3HTZ A;  1G5I A;  4LVL A;  3TEG A;  1LYL A;  4LNS A;  3M4P A;  2E64 A;  4ZTU B;  1USY A;  2RHS B;  4YRP A;  4LVJ A;  3HFV A;  2DXU A;  1X56 A;  2DQ3 A;  4P75 C;  4YRF A;  3V7S A;  5K1X A;  1YFT A;  4P3O A;  3TEH A;  2DZ9 A;  3TUP A;  4PG3 A;  1NJ8 A;  3RUX A;  2IY5 B;  2EJF A;  2IY5 A;  4XU0 A;  1WQW A;  4YRL A;  2CIM A;  3W3S A;  4TVA B;  1WNL A;  2I4O A;  3P8T A;  1EFW A;  4EO4 A;  4UPA A;  2DTH A;  2ZT5 A;  2ZNI A;  3NET A;  3V7C A;  2EWN A;  1EVK A;  2ZCE A;  2XTI A;  1EQR A;  3MEY A;  4G84 A;  1J5W A;  4OP0 A;  3QTC A;  2I4M A;  4LVK A;  1KMN A;  4YRC A;  4H2X A;  4P74 C;  4XU3 A;  2Q7E A;  4PHC A;  2DDZ A;  4WI1 A;  3VQY A;  2EJ9 A;  1NJ2 A;  1IL2 A;  2ODR C;  3VQW A;  3L4G B;  1YB3 A;  2HNI A;  1X2H A;  5E3I A;  3PCO B;  2CJ9 A;  3OD1 A;  4KR3 A;  4HVC A;  2DEQ A;  1HXD A;  5K1P A;  4TVY A;  1ADJ A;  1GGM A;  2ZGW A;  2DU7 A;  4P71 C;  4XEM A;  2FYK A;  4ZTZ B;  4YRN A;  2EAY A;  4P3N A;  4BWA A;  3LC0 A;  4K87 A;  4K88 A;  3RGL A;  4CH6 A;  2ALY A;  2E5A A;  4KR2 A;  1X2G A;  1BBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...