1YFRA

Crystal structure of alanyl-trna synthetase in complex with atp and magnesium
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
457
structure length
448
Chain Sequence
b'SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
molecule tags Ligase
source organism Aquifex aeolicus
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
total genus 137
structure length 448
sequence length 457
chains with identical sequence B
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yfrA01
1NYQA 2ZR2A 3PZCA 4YRNA 3A5YA 2ZTGA 3V7SA 4RQEA 1NJ6A 3HFZA 4ZTUB 3L1AA 4P3NA 4RDXA 4XU1A 11ASA 2DTHA 4YRTA 1VQZA 3L4GB 3R07A 3WQZA 1WU7A 3HFZB 2I4LA 1ASZA 3MEYA 4P3PA 2AMCA 1YGBA 2ZZFA 2G4CA 4CH6A 4CH4A 1X55A 1SETA 2PMFA 2EL9A 3PCOB 4YRKA 2E41A 2E5AA 2ODRD 2ZINA 2XGTA 4YRGA 1BBWA 3HRKA 4E51A 2QHTA 2I4MA 4G84A 3RKYA 3UFGA 4EX5A 2ARUA 2ZZEA 4BW9A 4L87A 1L0WA 3A7RA 3QTCA 2QHVA 4BWAA 1KMNA 4XTUA 2RHQB 4HWSA 1KMMA 4YRPA 5F5WA 3BFMA 3QO8A 3A7AA 1X54A 2ZT8A 1WNLA 3KFUA 2ZGWA 4XEMA 1E1OA 2CJAA 2CIMA 2I4OA 2Q5HA 2ALYB 2FYKA 3CMQA 2C7IA 2ZXFA 3REXA 4P72C 3G1ZA 1EQRA 3V7CA 1WLEA 4HWOA 2AMCB 3MF2A 1NJ8A 1X01A 2DVEA 4UP7A 4YRLA 3IKLA 3PCOA 3P8YA 3A7UA 1EVKA 2HNIA 4AH6A 1B70B 1HXDA 1QE0A 2ARTA 4YROA 2E3CA 4WJ3M 1H4SA 2ZIOA 4P75C 4TTVA 4TQFA 4YYEA 2RHQA 3HXYA 3UGQA 2DTIA 4YRCA 1ADYA 3HXZA 2CJBA 1NJ1A 4UPAA 4P74C 3TUPA 4K88A 4XU2A 2Q7HA 3ICAA 1SERA 2DXTA 4P3OA 3V7RA 1Z7NA 4Q6GA 1E22A 1PYSA 1YFTA 3HXVA 3VQYA 4YRIA 3A31A 4H02A 1B7YA 4HWTA 3HFVA 1LYLA 2Q7GA 5ELNA 3HXXA 4YCUA 4YREA 4H2YA 3E9IA 4RMFA 1G51A 5HGQA 3A74A 5C51B 4H2WA 4YCVA 3LSQA 5E3IA 4KR2A 3LSSA 3VQVA 2ZZGA 2DKGA 2DU7A 2E64A 4CS3A 1KOGA 5K1XA 3HTZA 1YFRA 3FJPA 4YRRA 1X2GA 2EJFA 2J3MA 3IG2A 3NETA 2IY5B 4OP0A 2PMEA 3REUA 2E65A 3QO7A 1WQWA 5KNNA 4K87A 3I7FA 3TEGA 1EIYB 2RHSA 2Q5IA 3E9HA 4P71C 2ZNJA 4UP9A 4PHCA 1G5IA 1EVLA 1B7YB 2RHSB 3BJUA 4YPFA 4TVAB 4J15A 1EIYA 4P74A 4CS2A 3IALA 3MF1A 1HTTA 4CH3A 4XU3A 1YB3A 1QF6A 4YRQA 2DQ3A 4XTZA 5C53B 3M4QA 1HC7A 2ZIMA 3A32A 2I4NA 1USYA 2ZT7A 1NYRA 1EFWA 1WYDA 4TWAA 4HA8A 3EFSA 4X5OA 2P0LA 2CJ9A 2EJGA 2ZT5A 2ZNIA 3QNEA 3VQWA 1JJCA 4TQDA 4K86A 1X2HA 2ZCEA 4KQEA 1YFSA 3RIRA 3NEMA 2DU5A 1E1TA 2DTOA 2DXUA 2C8MA 1H4VB 1WQ7A 2EWNA 1RIQA 3LC0A 1NJ2A 4O2DA 4H2VA 4H2XA 4YRFA 1IL2A 4XTWA 2ZR3A 2ARSA 4TVAA 2DZ9A 4P73C 2J3LA 4YP0A 4ZTZB 3TEHB 1SESA 5ELOA 2QHSA 1FYFA 3RF1A 4DPGA 1Z7MA 3HXUA 2AKWB 4HVCA 4ZIBA 3W3SA 4XTYA 1H4QA 4H2SA 3P8VA 2XTIA 2E1HA 3IKMB 1WPYA 1B76A 3A5ZA 4YRJA 1NJ5A 3L2ZA 4Q15A 3RACA 4YRSA 1NNHA 1E24A 2ODRC 2DJZA 3L4GA 4P72A 3NELA 12ASA 2IY5A 2CGHA 3ERRA 2AKWA 4YCWA 3EFRA 1G5HA 1USYC 2DQ0A 4H2TA 2EJ9A 4WJ4A 4LNSA 4P75A 3RKXA 4TVWA 3RL6A 4EO4A 1N9WA 2E10A 3HXWA 3RUXA 3HY0A 1GGMA 4G85A 4P73A 5K1PA 2DEQA 1W66A 3OD1A 4OLFA 3UGTA 4CH5A 2ALYA 1C0AA 3DSQA 4WF2A 4UP8A 2QHUA 2DZCA 3RGLA 4P71A 4RQFA 1B8AA 4H2XB 3VQXA 4XTVA 1ADJA 3V8LA 3V8KA 3NENA 1ASYA 4XTXA 1ATIA 1J5WA 1SRYA 1H4TA 4XEOA 3UH0A 4KR3A 2Q7EA 4HWPA 3TEHA 1X56A 4YRMA 1B70A 2ZT6A 3VBBA 3RKWA 3P8TA 3M4PA 4H2UA 3HRIA 1BIBA 4PG3A 1EOVA 2P5IA 4CS4A 4XU0A 5C52B 3HY1A 1PYSB 4YDQA 1JJCB 4DQ2A 2DDZA 1BBUA 4TVYA 4HWRA 3QO5A 1BIAA 4NCXA 3V8JA 4WI1A 2EAYA
chains in the Genus database with same CATH superfamily
1NYQA 2ZR2A 3PZCA 4YRNA 3A5YA 2ZTGA 3V7SA 4RQEA 1NJ6A 3HFZA 4ZTUB 3L1AA 4P3NA 4RDXA 4XU1A 11ASA 2DTHA 4YRTA 1VQZA 3L4GB 3R07A 3WQZA 1WU7A 3HFZB 2I4LA 1ASZA 3MEYA 4P3PA 2AMCA 1YGBA 2ZZFA 2G4CA 4CH6A 4CH4A 4LVKA 1X55A 1SETA 2PMFA 2EL9A 3PCOB 4YRKA 2E41A 2E5AA 2ODRD 2ZINA 2XGTA 4YRGA 1BBWA 3HRKA 4E51A 2QHTA 2I4MA 4G84A 3RKYA 3UFGA 4EX5A 2ARUA 2ZZEA 4BW9A 4L87A 1L0WA 3A7RA 3QTCA 2QHVA 4BWAA 1KMNA 4XTUA 2RHQB 4HWSA 2NS6A 1KMMA 4YRPA 5F5WA 3BFMA 3QO8A 3A7AA 1X54A 2ZT8A 1WNLA 3KFUA 2ZGWA 4XEMA 1E1OA 2CJAA 4LVMA 2CIMA 2I4OA 2Q5HA 2ALYB 2FYKA 3CMQA 2C7IA 2ZXFA 3REXA 4P72C 3G1ZA 1EQRA 3V7CA 1WLEA 4HWOA 2AMCB 3MF2A 1NJ8A 1X01A 2DVEA 4UP7A 4YRLA 3IKLA 3PCOA 3P8YA 3A7UA 1EVKA 2HNIA 4AH6A 1B70B 1HXDA 2A8EA 1QE0A 2ARTA 4YROA 2E3CA 4WJ3M 1H4SA 2ZIOA 4P75C 4TTVA 4TQFA 4YYEA 2RHQA 3HXYA 3UGQA 2DTIA 4YRCA 1ADYA 3HXZA 2CJBA 1NJ1A 4UPAA 4P74C 3TUPA 4K88A 4XU2A 2Q7HA 3ICAA 1SERA 2DXTA 4P3OA 3V7RA 1Z7NA 4Q6GA 1E22A 1PYSA 1YFTA 3HXVA 3VQYA 4YRIA 3A31A 4H02A 1B7YA 4HWTA 3HFVA 1LYLA 2Q7GA 5ELNA 3HXXA 4YCUA 4YREA 4H2YA 3E9IA 4RMFA 1G51A 5HGQA 3A74A 5C51B 4H2WA 4YCVA 3LSQA 5E3IA 4KR2A 3LSSA 3VQVA 2ZZGA 2DKGA 2DU7A 2E64A 4CS3A 1KOGA 5K1XA 3HTZA 1YFRA 3FJPA 4YRRA 1X2GA 2EJFA 2J3MA 4LVLA 3IG2A 3NETA 2IY5B 4OP0A 2PMEA 3REUA 2E65A 3QO7A 1WQWA 5KNNA 4K87A 3I7FA 3TEGA 1EIYB 2RHSA 2Q5IA 3E9HA 4P71C 2ZNJA 4UP9A 4PHCA 1G5IA 1EVLA 1B7YB 2RHSB 3BJUA 4YPFA 4TVAB 4J15A 1EIYA 4HT4A 4P74A 4CS2A 3IALA 3MF1A 1HTTA 4CH3A 4XU3A 4LVIA 1YB3A 1QF6A 4YRQA 2DQ3A 4XTZA 5C53B 3M4QA 1HC7A 2ZIMA 3A32A 2I4NA 1USYA 2ZT7A 1NYRA 1EFWA 1WYDA 4TWAA 4HA8A 3EFSA 4X5OA 2P0LA 2CJ9A 2EJGA 2ZT5A 2ZNIA 3QNEA 3VQWA 1JJCA 4TQDA 4K86A 1X2HA 2ZCEA 4KQEA 1YFSA 3RIRA 3NEMA 2DU5A 1E1TA 2DTOA 2DXUA 2C8MA 1H4VB 1WQ7A 2EWNA 1RIQA 3LC0A 1NJ2A 4O2DA 4H2VA 4H2XA 4YRFA 1IL2A 4XTWA 2ZR3A 2ARSA 4TVAA 2DZ9A 4P73C 2J3LA 4YP0A 4ZTZB 3TEHB 1SESA 5ELOA 2QHSA 1FYFA 3RF1A 4DPGA 1Z7MA 3HXUA 2AKWB 4HVCA 4ZIBA 3W3SA 4XTYA 1H4QA 4H2SA 3P8VA 2XTIA 2E1HA 3IKMB 1WPYA 1B76A 3A5ZA 4YRJA 1NJ5A 3L2ZA 4Q15A 3RACA 4YRSA 1NNHA 1E24A 2ODRC 2DJZA 3MQZA 3L4GA 4P72A 3NELA 12ASA 2IY5A 2CGHA 4LVJA 3ERRA 2AKWA 4YCWA 3EFRA 1G5HA 1USYC 2DQ0A 4H2TA 2EJ9A 4WJ4A 4LNSA 4P75A 3RKXA 4TVWA 3RL6A 4EO4A 1N9WA 2E10A 3HXWA 3RUXA 3HY0A 1GGMA 4G85A 4P73A 5K1PA 2DEQA 1W66A 3OD1A 4OLFA 3UGTA 4CH5A 2ALYA 1C0AA 3DSQA 4WF2A 4UP8A 2QHUA 2DZCA 3RGLA 4P71A 4RQFA 1B8AA 4H2XB 3VQXA 4XTVA 1ADJA 3V8LA 3V8KA 3NENA 1ASYA 4XTXA 1ATIA 1J5WA 1SRYA 1H4TA 4XEOA 3UH0A 4KR3A 2Q7EA 4HWPA 3TEHA 1X56A 4YRMA 1B70A 2ZT6A 3VBBA 3RKWA 3P8TA 3M4PA 4H2UA 3HRIA 1BIBA 4PG3A 1EOVA 2P5IA 4CS4A 4XU0A 5C52B 3HY1A 1PYSB 4YDQA 1JJCB 4DQ2A 2DDZA 1BBUA 4TVYA 4HWRA 3QO5A 1BIAA 4NCXA 3V8JA 4WI1A 2EAYA
chains in the Genus database with same CATH topology
1NYQA 2ZR2A 3PZCA 4YRNA 3A5YA 2ZTGA 3V7SA 4RQEA 1NJ6A 3HFZA 4ZTUB 3L1AA 4P3NA 4RDXA 4XU1A 11ASA 2DTHA 4YRTA 1VQZA 3L4GB 3R07A 3WQZA 1WU7A 3HFZB 2I4LA 1ASZA 3MEYA 4P3PA 2AMCA 1YGBA 2ZZFA 2G4CA 4CH6A 4CH4A 4LVKA 1X55A 1SETA 2PMFA 2EL9A 3PCOB 4YRKA 2E41A 2E5AA 2ODRD 2ZINA 2XGTA 4YRGA 1BBWA 3HRKA 4E51A 2QHTA 2I4MA 4G84A 3RKYA 3UFGA 4EX5A 2ARUA 2ZZEA 4BW9A 4L87A 1L0WA 3A7RA 3QTCA 2QHVA 4BWAA 1KMNA 4XTUA 2RHQB 4HWSA 2NS6A 1KMMA 4YRPA 5F5WA 3BFMA 3QO8A 3A7AA 1X54A 2ZT8A 1WNLA 3KFUA 2ZGWA 4XEMA 1E1OA 2CJAA 4LVMA 2CIMA 2I4OA 2Q5HA 2ALYB 2FYKA 3CMQA 2C7IA 2ZXFA 3REXA 4P72C 3G1ZA 1EQRA 3V7CA 1WLEA 4HWOA 2AMCB 3MF2A 1NJ8A 1X01A 2DVEA 4UP7A 4YRLA 3IKLA 3PCOA 3P8YA 3A7UA 1EVKA 2HNIA 4AH6A 1B70B 1HXDA 2A8EA 1QE0A 2ARTA 4YROA 2E3CA 4WJ3M 1H4SA 2ZIOA 4P75C 4TTVA 4TQFA 4YYEA 2RHQA 3HXYA 3UGQA 2DTIA 4YRCA 1ADYA 3HXZA 2CJBA 1NJ1A 4UPAA 4P74C 3TUPA 4K88A 4XU2A 2Q7HA 3ICAA 1SERA 2DXTA 4P3OA 3V7RA 1Z7NA 4Q6GA 1E22A 1PYSA 1YFTA 3HXVA 3VQYA 4YRIA 3A31A 4H02A 1B7YA 4HWTA 3HFVA 1LYLA 2Q7GA 5ELNA 3HXXA 4YCUA 4YREA 4H2YA 3E9IA 4RMFA 1G51A 5HGQA 3A74A 5C51B 4H2WA 4YCVA 3LSQA 5E3IA 4KR2A 3LSSA 3VQVA 2ZZGA 2DKGA 2DU7A 2E64A 4CS3A 1KOGA 5K1XA 3HTZA 1YFRA 3FJPA 4YRRA 1X2GA 2EJFA 2J3MA 4LVLA 3IG2A 3NETA 2IY5B 4OP0A 2PMEA 3REUA 2E65A 3QO7A 1WQWA 5KNNA 4K87A 3I7FA 3TEGA 1EIYB 2RHSA 2Q5IA 3E9HA 4P71C 2ZNJA 4UP9A 4PHCA 1G5IA 1EVLA 1B7YB 2RHSB 3BJUA 4YPFA 4TVAB 4J15A 1EIYA 4HT4A 4P74A 4CS2A 3IALA 3MF1A 1HTTA 4CH3A 4XU3A 4LVIA 1YB3A 1QF6A 4YRQA 2DQ3A 4XTZA 5C53B 3M4QA 1HC7A 2ZIMA 3A32A 2I4NA 1USYA 2ZT7A 1NYRA 1EFWA 1WYDA 4TWAA 4HA8A 3EFSA 4X5OA 2P0LA 2CJ9A 2EJGA 2ZT5A 2ZNIA 3QNEA 3VQWA 1JJCA 4TQDA 4K86A 1X2HA 2ZCEA 4KQEA 1YFSA 3RIRA 3NEMA 2DU5A 1E1TA 2DTOA 2DXUA 2C8MA 1H4VB 1WQ7A 2EWNA 1RIQA 3LC0A 1NJ2A 4O2DA 4H2VA 4H2XA 4YRFA 1IL2A 4XTWA 2ZR3A 2ARSA 4TVAA 2DZ9A 4P73C 2J3LA 4YP0A 4ZTZB 3TEHB 1SESA 5ELOA 2QHSA 1FYFA 3RF1A 4DPGA 1Z7MA 3HXUA 2AKWB 4HVCA 4ZIBA 3W3SA 4XTYA 1H4QA 4H2SA 3P8VA 2XTIA 2E1HA 3IKMB 1WPYA 1B76A 3A5ZA 4YRJA 1NJ5A 3L2ZA 4Q15A 3RACA 4YRSA 1NNHA 1E24A 2ODRC 2DJZA 3MQZA 3L4GA 4P72A 3NELA 12ASA 2IY5A 2CGHA 4LVJA 3ERRA 2AKWA 4YCWA 3EFRA 1G5HA 1USYC 2DQ0A 4H2TA 2EJ9A 4WJ4A 4LNSA 4P75A 3RKXA 4TVWA 3RL6A 4EO4A 1N9WA 2E10A 3HXWA 3RUXA 3HY0A 1GGMA 4G85A 4P73A 5K1PA 2DEQA 1W66A 3OD1A 4OLFA 3UGTA 4CH5A 2ALYA 1C0AA 3DSQA 4WF2A 4UP8A 2QHUA 2DZCA 3RGLA 4P71A 4RQFA 1B8AA 4H2XB 3VQXA 4XTVA 1ADJA 3V8LA 3V8KA 3NENA 1ASYA 4XTXA 1ATIA 1J5WA 1SRYA 1H4TA 4XEOA 3UH0A 4KR3A 2Q7EA 4HWPA 3TEHA 1X56A 4YRMA 1B70A 2ZT6A 3VBBA 3RKWA 3P8TA 3M4PA 4H2UA 3HRIA 1BIBA 4PG3A 1EOVA 2P5IA 4CS4A 4XU0A 5C52B 3HY1A 1PYSB 4YDQA 1JJCB 4DQ2A 2DDZA 1BBUA 4TVYA 4HWRA 3QO5A 1BIAA 4NCXA 3V8JA 4WI1A 2EAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYQ A;  2ZR2 A;  3PZC A;  4YRN A;  3A5Y A;  2ZTG A;  3V7S A;  4RQE A;  1NJ6 A;  3HFZ A;  4ZTU B;  3L1A A;  4P3N A;  4RDX A;  4XU1 A;  11AS A;  2DTH A;  4YRT A;  1VQZ A;  3L4G B;  3R07 A;  3WQZ A;  1WU7 A;  3HFZ B;  2I4L A;  1ASZ A;  3MEY A;  4P3P A;  2AMC A;  1YGB A;  2ZZF A;  2G4C A;  4CH6 A;  4CH4 A;  1X55 A;  1SET A;  2PMF A;  2EL9 A;  3PCO B;  4YRK A;  2E41 A;  2E5A A;  2ODR D;  2ZIN A;  2XGT A;  4YRG A;  1BBW A;  3HRK A;  4E51 A;  2QHT A;  2I4M A;  4G84 A;  3RKY A;  3UFG A;  4EX5 A;  2ARU A;  2ZZE A;  4BW9 A;  4L87 A;  1L0W A;  3A7R A;  3QTC A;  2QHV A;  4BWA A;  1KMN A;  4XTU A;  2RHQ B;  4HWS A;  1KMM A;  4YRP A;  5F5W A;  3BFM A;  3QO8 A;  3A7A A;  1X54 A;  2ZT8 A;  1WNL A;  3KFU A;  2ZGW A;  4XEM A;  1E1O A;  2CJA A;  2CIM A;  2I4O A;  2Q5H A;  2ALY B;  2FYK A;  3CMQ A;  2C7I A;  2ZXF A;  3REX A;  4P72 C;  3G1Z A;  1EQR A;  3V7C A;  1WLE A;  4HWO A;  2AMC B;  3MF2 A;  1NJ8 A;  1X01 A;  2DVE A;  4UP7 A;  4YRL A;  3IKL A;  3PCO A;  3P8Y A;  3A7U A;  1EVK A;  2HNI A;  4AH6 A;  1B70 B;  1HXD A;  1QE0 A;  2ART A;  4YRO A;  2E3C A;  4WJ3 M;  1H4S A;  2ZIO A;  4P75 C;  4TTV A;  4TQF A;  4YYE A;  2RHQ A;  3HXY A;  3UGQ A;  2DTI A;  4YRC A;  1ADY A;  3HXZ A;  2CJB A;  1NJ1 A;  4UPA A;  4P74 C;  3TUP A;  4K88 A;  4XU2 A;  2Q7H A;  3ICA A;  1SER A;  2DXT A;  4P3O A;  3V7R A;  1Z7N A;  4Q6G A;  1E22 A;  1PYS A;  1YFT A;  3HXV A;  3VQY A;  4YRI A;  3A31 A;  4H02 A;  1B7Y A;  4HWT A;  3HFV A;  1LYL A;  2Q7G A;  5ELN A;  3HXX A;  4YCU A;  4YRE A;  4H2Y A;  3E9I A;  4RMF A;  1G51 A;  5HGQ A;  3A74 A;  5C51 B;  4H2W A;  4YCV A;  3LSQ A;  5E3I A;  4KR2 A;  3LSS A;  3VQV A;  2ZZG A;  2DKG A;  2DU7 A;  2E64 A;  4CS3 A;  1KOG A;  5K1X A;  3HTZ A;  1YFR A;  3FJP A;  4YRR A;  1X2G A;  2EJF A;  2J3M A;  3IG2 A;  3NET A;  2IY5 B;  4OP0 A;  2PME A;  3REU A;  2E65 A;  3QO7 A;  1WQW A;  5KNN A;  4K87 A;  3I7F A;  3TEG A;  1EIY B;  2RHS A;  2Q5I A;  3E9H A;  4P71 C;  2ZNJ A;  4UP9 A;  4PHC A;  1G5I A;  1EVL A;  1B7Y B;  2RHS B;  3BJU A;  4YPF A;  4TVA B;  4J15 A;  1EIY A;  4P74 A;  4CS2 A;  3IAL A;  3MF1 A;  1HTT A;  4CH3 A;  4XU3 A;  1YB3 A;  1QF6 A;  4YRQ A;  2DQ3 A;  4XTZ A;  5C53 B;  3M4Q A;  1HC7 A;  2ZIM A;  3A32 A;  2I4N A;  1USY A;  2ZT7 A;  1NYR A;  1EFW A;  1WYD A;  4TWA A;  4HA8 A;  3EFS A;  4X5O A;  2P0L A;  2CJ9 A;  2EJG A;  2ZT5 A;  2ZNI A;  3QNE A;  3VQW A;  1JJC A;  4TQD A;  4K86 A;  1X2H A;  2ZCE A;  4KQE A;  1YFS A;  3RIR A;  3NEM A;  2DU5 A;  1E1T A;  2DTO A;  2DXU A;  2C8M A;  1H4V B;  1WQ7 A;  2EWN A;  1RIQ A;  3LC0 A;  1NJ2 A;  4O2D A;  4H2V A;  4H2X A;  4YRF A;  1IL2 A;  4XTW A;  2ZR3 A;  2ARS A;  4TVA A;  2DZ9 A;  4P73 C;  2J3L A;  4YP0 A;  4ZTZ B;  3TEH B;  1SES A;  5ELO A;  2QHS A;  1FYF A;  3RF1 A;  4DPG A;  1Z7M A;  3HXU A;  2AKW B;  4HVC A;  4ZIB A;  3W3S A;  4XTY A;  1H4Q A;  4H2S A;  3P8V A;  2XTI A;  2E1H A;  3IKM B;  1WPY A;  1B76 A;  3A5Z A;  4YRJ A;  1NJ5 A;  3L2Z A;  4Q15 A;  3RAC A;  4YRS A;  1NNH A;  1E24 A;  2ODR C;  2DJZ A;  3L4G A;  4P72 A;  3NEL A;  12AS A;  2IY5 A;  2CGH A;  3ERR A;  2AKW A;  4YCW A;  3EFR A;  1G5H A;  1USY C;  2DQ0 A;  4H2T A;  2EJ9 A;  4WJ4 A;  4LNS A;  4P75 A;  3RKX A;  4TVW A;  3RL6 A;  4EO4 A;  1N9W A;  2E10 A;  3HXW A;  3RUX A;  3HY0 A;  1GGM A;  4G85 A;  4P73 A;  5K1P A;  2DEQ A;  1W66 A;  3OD1 A;  4OLF A;  3UGT A;  4CH5 A;  2ALY A;  1C0A A;  3DSQ A;  4WF2 A;  4UP8 A;  2QHU A;  2DZC A;  3RGL A;  4P71 A;  4RQF A;  1B8A A;  4H2X B;  3VQX A;  4XTV A;  1ADJ A;  3V8L A;  3V8K A;  3NEN A;  1ASY A;  4XTX A;  1ATI A;  1J5W A;  1SRY A;  1H4T A;  4XEO A;  3UH0 A;  4KR3 A;  2Q7E A;  4HWP A;  3TEH A;  1X56 A;  4YRM A;  1B70 A;  2ZT6 A;  3VBB A;  3RKW A;  3P8T A;  3M4P A;  4H2U A;  3HRI A;  1BIB A;  4PG3 A;  1EOV A;  2P5I A;  4CS4 A;  4XU0 A;  5C52 B;  3HY1 A;  1PYS B;  4YDQ A;  1JJC B;  4DQ2 A;  2DDZ A;  1BBU A;  4TVY A;  4HWR A;  3QO5 A;  1BIA A;  4NCX A;  3V8J A;  4WI1 A;  2EAY A; 
#chains in the Genus database with same CATH topology
 1NYQ A;  2ZR2 A;  3PZC A;  4YRN A;  3A5Y A;  2ZTG A;  3V7S A;  4RQE A;  1NJ6 A;  3HFZ A;  4ZTU B;  3L1A A;  4P3N A;  4RDX A;  4XU1 A;  11AS A;  2DTH A;  4YRT A;  1VQZ A;  3L4G B;  3R07 A;  3WQZ A;  1WU7 A;  3HFZ B;  2I4L A;  1ASZ A;  3MEY A;  4P3P A;  2AMC A;  1YGB A;  2ZZF A;  2G4C A;  4CH6 A;  4CH4 A;  4LVK A;  1X55 A;  1SET A;  2PMF A;  2EL9 A;  3PCO B;  4YRK A;  2E41 A;  2E5A A;  2ODR D;  2ZIN A;  2XGT A;  4YRG A;  1BBW A;  3HRK A;  4E51 A;  2QHT A;  2I4M A;  4G84 A;  3RKY A;  3UFG A;  4EX5 A;  2ARU A;  2ZZE A;  4BW9 A;  4L87 A;  1L0W A;  3A7R A;  3QTC A;  2QHV A;  4BWA A;  1KMN A;  4XTU A;  2RHQ B;  4HWS A;  2NS6 A;  1KMM A;  4YRP A;  5F5W A;  3BFM A;  3QO8 A;  3A7A A;  1X54 A;  2ZT8 A;  1WNL A;  3KFU A;  2ZGW A;  4XEM A;  1E1O A;  2CJA A;  4LVM A;  2CIM A;  2I4O A;  2Q5H A;  2ALY B;  2FYK A;  3CMQ A;  2C7I A;  2ZXF A;  3REX A;  4P72 C;  3G1Z A;  1EQR A;  3V7C A;  1WLE A;  4HWO A;  2AMC B;  3MF2 A;  1NJ8 A;  1X01 A;  2DVE A;  4UP7 A;  4YRL A;  3IKL A;  3PCO A;  3P8Y A;  3A7U A;  1EVK A;  2HNI A;  4AH6 A;  1B70 B;  1HXD A;  2A8E A;  1QE0 A;  2ART A;  4YRO A;  2E3C A;  4WJ3 M;  1H4S A;  2ZIO A;  4P75 C;  4TTV A;  4TQF A;  4YYE A;  2RHQ A;  3HXY A;  3UGQ A;  2DTI A;  4YRC A;  1ADY A;  3HXZ A;  2CJB A;  1NJ1 A;  4UPA A;  4P74 C;  3TUP A;  4K88 A;  4XU2 A;  2Q7H A;  3ICA A;  1SER A;  2DXT A;  4P3O A;  3V7R A;  1Z7N A;  4Q6G A;  1E22 A;  1PYS A;  1YFT A;  3HXV A;  3VQY A;  4YRI A;  3A31 A;  4H02 A;  1B7Y A;  4HWT A;  3HFV A;  1LYL A;  2Q7G A;  5ELN A;  3HXX A;  4YCU A;  4YRE A;  4H2Y A;  3E9I A;  4RMF A;  1G51 A;  5HGQ A;  3A74 A;  5C51 B;  4H2W A;  4YCV A;  3LSQ A;  5E3I A;  4KR2 A;  3LSS A;  3VQV A;  2ZZG A;  2DKG A;  2DU7 A;  2E64 A;  4CS3 A;  1KOG A;  5K1X A;  3HTZ A;  1YFR A;  3FJP A;  4YRR A;  1X2G A;  2EJF A;  2J3M A;  4LVL A;  3IG2 A;  3NET A;  2IY5 B;  4OP0 A;  2PME A;  3REU A;  2E65 A;  3QO7 A;  1WQW A;  5KNN A;  4K87 A;  3I7F A;  3TEG A;  1EIY B;  2RHS A;  2Q5I A;  3E9H A;  4P71 C;  2ZNJ A;  4UP9 A;  4PHC A;  1G5I A;  1EVL A;  1B7Y B;  2RHS B;  3BJU A;  4YPF A;  4TVA B;  4J15 A;  1EIY A;  4HT4 A;  4P74 A;  4CS2 A;  3IAL A;  3MF1 A;  1HTT A;  4CH3 A;  4XU3 A;  4LVI A;  1YB3 A;  1QF6 A;  4YRQ A;  2DQ3 A;  4XTZ A;  5C53 B;  3M4Q A;  1HC7 A;  2ZIM A;  3A32 A;  2I4N A;  1USY A;  2ZT7 A;  1NYR A;  1EFW A;  1WYD A;  4TWA A;  4HA8 A;  3EFS A;  4X5O A;  2P0L A;  2CJ9 A;  2EJG A;  2ZT5 A;  2ZNI A;  3QNE A;  3VQW A;  1JJC A;  4TQD A;  4K86 A;  1X2H A;  2ZCE A;  4KQE A;  1YFS A;  3RIR A;  3NEM A;  2DU5 A;  1E1T A;  2DTO A;  2DXU A;  2C8M A;  1H4V B;  1WQ7 A;  2EWN A;  1RIQ A;  3LC0 A;  1NJ2 A;  4O2D A;  4H2V A;  4H2X A;  4YRF A;  1IL2 A;  4XTW A;  2ZR3 A;  2ARS A;  4TVA A;  2DZ9 A;  4P73 C;  2J3L A;  4YP0 A;  4ZTZ B;  3TEH B;  1SES A;  5ELO A;  2QHS A;  1FYF A;  3RF1 A;  4DPG A;  1Z7M A;  3HXU A;  2AKW B;  4HVC A;  4ZIB A;  3W3S A;  4XTY A;  1H4Q A;  4H2S A;  3P8V A;  2XTI A;  2E1H A;  3IKM B;  1WPY A;  1B76 A;  3A5Z A;  4YRJ A;  1NJ5 A;  3L2Z A;  4Q15 A;  3RAC A;  4YRS A;  1NNH A;  1E24 A;  2ODR C;  2DJZ A;  3MQZ A;  3L4G A;  4P72 A;  3NEL A;  12AS A;  2IY5 A;  2CGH A;  4LVJ A;  3ERR A;  2AKW A;  4YCW A;  3EFR A;  1G5H A;  1USY C;  2DQ0 A;  4H2T A;  2EJ9 A;  4WJ4 A;  4LNS A;  4P75 A;  3RKX A;  4TVW A;  3RL6 A;  4EO4 A;  1N9W A;  2E10 A;  3HXW A;  3RUX A;  3HY0 A;  1GGM A;  4G85 A;  4P73 A;  5K1P A;  2DEQ A;  1W66 A;  3OD1 A;  4OLF A;  3UGT A;  4CH5 A;  2ALY A;  1C0A A;  3DSQ A;  4WF2 A;  4UP8 A;  2QHU A;  2DZC A;  3RGL A;  4P71 A;  4RQF A;  1B8A A;  4H2X B;  3VQX A;  4XTV A;  1ADJ A;  3V8L A;  3V8K A;  3NEN A;  1ASY A;  4XTX A;  1ATI A;  1J5W A;  1SRY A;  1H4T A;  4XEO A;  3UH0 A;  4KR3 A;  2Q7E A;  4HWP A;  3TEH A;  1X56 A;  4YRM A;  1B70 A;  2ZT6 A;  3VBB A;  3RKW A;  3P8T A;  3M4P A;  4H2U A;  3HRI A;  1BIB A;  4PG3 A;  1EOV A;  2P5I A;  4CS4 A;  4XU0 A;  5C52 B;  3HY1 A;  1PYS B;  4YDQ A;  1JJC B;  4DQ2 A;  2DDZ A;  1BBU A;  4TVY A;  4HWR A;  3QO5 A;  1BIA A;  4NCX A;  3V8J A;  4WI1 A;  2EAY A; 
#chains in the Genus database with same CATH homology
 1NYQ A;  2ZR2 A;  3PZC A;  4YRN A;  3A5Y A;  2ZTG A;  3V7S A;  4RQE A;  1NJ6 A;  3HFZ A;  4ZTU B;  3L1A A;  4P3N A;  4RDX A;  4XU1 A;  11AS A;  2DTH A;  4YRT A;  1VQZ A;  3L4G B;  3R07 A;  3WQZ A;  1WU7 A;  3HFZ B;  2I4L A;  1ASZ A;  3MEY A;  4P3P A;  2AMC A;  1YGB A;  2ZZF A;  2G4C A;  4CH6 A;  4CH4 A;  4LVK A;  1X55 A;  1SET A;  2PMF A;  2EL9 A;  3PCO B;  4YRK A;  2E41 A;  2E5A A;  2ODR D;  2ZIN A;  2XGT A;  4YRG A;  1BBW A;  3HRK A;  4E51 A;  2QHT A;  2I4M A;  4G84 A;  3RKY A;  3UFG A;  4EX5 A;  2ARU A;  2ZZE A;  4BW9 A;  4L87 A;  1L0W A;  3A7R A;  3QTC A;  2QHV A;  4BWA A;  1KMN A;  4XTU A;  2RHQ B;  4HWS A;  2NS6 A;  1KMM A;  4YRP A;  5F5W A;  3BFM A;  3QO8 A;  3A7A A;  1X54 A;  2ZT8 A;  1WNL A;  3KFU A;  2ZGW A;  4XEM A;  1E1O A;  2CJA A;  4LVM A;  2CIM A;  2I4O A;  2Q5H A;  2ALY B;  2FYK A;  3CMQ A;  2C7I A;  2ZXF A;  3REX A;  4P72 C;  3G1Z A;  1EQR A;  3V7C A;  1WLE A;  4HWO A;  2AMC B;  3MF2 A;  1NJ8 A;  1X01 A;  2DVE A;  4UP7 A;  4YRL A;  3IKL A;  3PCO A;  3P8Y A;  3A7U A;  1EVK A;  2HNI A;  4AH6 A;  1B70 B;  1HXD A;  2A8E A;  1QE0 A;  2ART A;  4YRO A;  2E3C A;  4WJ3 M;  1H4S A;  2ZIO A;  4P75 C;  4TTV A;  4TQF A;  4YYE A;  2RHQ A;  3HXY A;  3UGQ A;  2DTI A;  4YRC A;  1ADY A;  3HXZ A;  2CJB A;  1NJ1 A;  4UPA A;  4P74 C;  3TUP A;  4K88 A;  4XU2 A;  2Q7H A;  3ICA A;  1SER A;  2DXT A;  4P3O A;  3V7R A;  1Z7N A;  4Q6G A;  1E22 A;  1PYS A;  1YFT A;  3HXV A;  3VQY A;  4YRI A;  3A31 A;  4H02 A;  1B7Y A;  4HWT A;  3HFV A;  1LYL A;  2Q7G A;  5ELN A;  3HXX A;  4YCU A;  4YRE A;  4H2Y A;  3E9I A;  4RMF A;  1G51 A;  5HGQ A;  3A74 A;  5C51 B;  4H2W A;  4YCV A;  3LSQ A;  5E3I A;  4KR2 A;  3LSS A;  3VQV A;  2ZZG A;  2DKG A;  2DU7 A;  2E64 A;  4CS3 A;  1KOG A;  5K1X A;  3HTZ A;  1YFR A;  3FJP A;  4YRR A;  1X2G A;  2EJF A;  2J3M A;  4LVL A;  3IG2 A;  3NET A;  2IY5 B;  4OP0 A;  2PME A;  3REU A;  2E65 A;  3QO7 A;  1WQW A;  5KNN A;  4K87 A;  3I7F A;  3TEG A;  1EIY B;  2RHS A;  2Q5I A;  3E9H A;  4P71 C;  2ZNJ A;  4UP9 A;  4PHC A;  1G5I A;  1EVL A;  1B7Y B;  2RHS B;  3BJU A;  4YPF A;  4TVA B;  4J15 A;  1EIY A;  4HT4 A;  4P74 A;  4CS2 A;  3IAL A;  3MF1 A;  1HTT A;  4CH3 A;  4XU3 A;  4LVI A;  1YB3 A;  1QF6 A;  4YRQ A;  2DQ3 A;  4XTZ A;  5C53 B;  3M4Q A;  1HC7 A;  2ZIM A;  3A32 A;  2I4N A;  1USY A;  2ZT7 A;  1NYR A;  1EFW A;  1WYD A;  4TWA A;  4HA8 A;  3EFS A;  4X5O A;  2P0L A;  2CJ9 A;  2EJG A;  2ZT5 A;  2ZNI A;  3QNE A;  3VQW A;  1JJC A;  4TQD A;  4K86 A;  1X2H A;  2ZCE A;  4KQE A;  1YFS A;  3RIR A;  3NEM A;  2DU5 A;  1E1T A;  2DTO A;  2DXU A;  2C8M A;  1H4V B;  1WQ7 A;  2EWN A;  1RIQ A;  3LC0 A;  1NJ2 A;  4O2D A;  4H2V A;  4H2X A;  4YRF A;  1IL2 A;  4XTW A;  2ZR3 A;  2ARS A;  4TVA A;  2DZ9 A;  4P73 C;  2J3L A;  4YP0 A;  4ZTZ B;  3TEH B;  1SES A;  5ELO A;  2QHS A;  1FYF A;  3RF1 A;  4DPG A;  1Z7M A;  3HXU A;  2AKW B;  4HVC A;  4ZIB A;  3W3S A;  4XTY A;  1H4Q A;  4H2S A;  3P8V A;  2XTI A;  2E1H A;  3IKM B;  1WPY A;  1B76 A;  3A5Z A;  4YRJ A;  1NJ5 A;  3L2Z A;  4Q15 A;  3RAC A;  4YRS A;  1NNH A;  1E24 A;  2ODR C;  2DJZ A;  3MQZ A;  3L4G A;  4P72 A;  3NEL A;  12AS A;  2IY5 A;  2CGH A;  4LVJ A;  3ERR A;  2AKW A;  4YCW A;  3EFR A;  1G5H A;  1USY C;  2DQ0 A;  4H2T A;  2EJ9 A;  4WJ4 A;  4LNS A;  4P75 A;  3RKX A;  4TVW A;  3RL6 A;  4EO4 A;  1N9W A;  2E10 A;  3HXW A;  3RUX A;  3HY0 A;  1GGM A;  4G85 A;  4P73 A;  5K1P A;  2DEQ A;  1W66 A;  3OD1 A;  4OLF A;  3UGT A;  4CH5 A;  2ALY A;  1C0A A;  3DSQ A;  4WF2 A;  4UP8 A;  2QHU A;  2DZC A;  3RGL A;  4P71 A;  4RQF A;  1B8A A;  4H2X B;  3VQX A;  4XTV A;  1ADJ A;  3V8L A;  3V8K A;  3NEN A;  1ASY A;  4XTX A;  1ATI A;  1J5W A;  1SRY A;  1H4T A;  4XEO A;  3UH0 A;  4KR3 A;  2Q7E A;  4HWP A;  3TEH A;  1X56 A;  4YRM A;  1B70 A;  2ZT6 A;  3VBB A;  3RKW A;  3P8T A;  3M4P A;  4H2U A;  3HRI A;  1BIB A;  4PG3 A;  1EOV A;  2P5I A;  4CS4 A;  4XU0 A;  5C52 B;  3HY1 A;  1PYS B;  4YDQ A;  1JJC B;  4DQ2 A;  2DDZ A;  1BBU A;  4TVY A;  4HWR A;  3QO5 A;  1BIA A;  4NCX A;  3V8J A;  4WI1 A;  2EAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...