1YFRA

Crystal structure of alanyl-trna synthetase in complex with atp and magnesium
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 137
structure length 448
sequence length 457
chains with identical sequence B
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yfrA01
1WU7A 4P73A 2ZZFA 3HY1A 1E24A 1YFSA 2ZT8A 4CH5A 3A5ZA 1HTTA 4KQEA 2ZT5A 2PMEA 2Q7HA 4TQDA 3VQVA 3REUA 1BIAA 2QHTA 3MEYA 1C0AA 4P74C 3IKLA 4YDQA 1X2GA 3TEHB 1EIYB 4H2SA 2EJFA 4TVWA 1EVLA 1USYA 4BW9A 2AMCB 3V8JA 3QO8A 4TVYA 3RGLA 4CH6A 3A31A 4KR3A 2DZ9A 4XTYA 4YRGA 1Z7MA 1NJ1A 3PCOB 1WNLA 2ALYA 1J5WA 2Q5IA 2J3MA 3V7CA 3EFRA 4P73C 3HXXA 2ZT6A 4WF2A 4XU3A 1G5HA 1ADJA 5K1PA 4WJ4A 2ZGWA 3L4GA 2P0LA 2ZR3A 1SETA 2RHSA 3VQWA 4RMFA 3ICAA 2ODRD 3UFGA 4YCUA 2AMCA 4K87A 3UH0A 3E9HA 1E22A 2CGHA 4KR2A 4HWTA 5ELOA 1USYC 4XU1A 4RQFA 4XU2A 2J3LA 3PCOA 3HFVA 4X5OA 2EL9A 1KMNA 1NJ6A 2QHVA 3ERRA 3RUXA 4HVCA 2ZIMA 3LC0A 3HRKA 2DQ0A 4TVAA 3W3SA 3QO5A 3RACA 4HWOA 4P3PA 3A7UA 4PG3A 4UP9A 2DZCA 2E3CA 4UPAA 4YRMA 2QHSA 4YCWA 2XTIA 2ZNIA 1E1TA 4XTXA 2ZINA 2FYKA 2CJ9A 4O2DA 1ATIA 5HGQA 5C51B 2ALYB 4P72A 3TUPA 4DPGA 1L0WA 3HFZA 4P3NA 1ASYA 1QE0A 4RQEA 2C7IA 1KOGA 3HXYA 1BBWA 3M4PA 1PYSB 1EVKA 1IL2A 1EFWA 1YFTA 2Q7EA 1H4VB 3RKYA 3VBBA 3L4GB 4H2YA 3HXUA 2RHSB 4WI1A 3A5YA 3MF2A 1SERA 2ZIOA 1WPYA 3UGQA 3RF1A 1X54A 4HWRA 4YRTA 1YGBA 3A7RA 2ZTGA 2DJZA 4OP0A 2I4LA 4YRFA 2DDZA 1NJ8A 2QHUA 3A74A 2DXTA 1WLEA 3QO7A 4P72C 3RIRA 4TVAB 1X56A 1PYSA 4YPFA 5F5WA 4YP0A 4NCXA 2ZT7A 3LSQA 3R07A 4K88A 3A7AA 2ZXFA 3FJPA 5C52B 2DVEA 4OLFA 4UP7A 3M4QA 2EAYA 4EX5A 1X01A 4K86A 1BBUA 3CMQA 3TEGA 3DSQA 3P8TA 3V7SA 1JJCA 3HFZB 4YRNA 2XGTA 3QNEA 3RKXA 4YRIA 5ELNA 3OD1A 3V8LA 2E41A 3IALA 1Z7NA 2PMFA 4EO4A 2ARTA 3EFSA 4G84A 2E5AA 2P5IA 3HXVA 3HTZA 3IG2A 3VQYA 4YREA 3RKWA 3G1ZA 4HA8A 1E1OA 1LYLA 4CS2A 2ARSA 2ZZGA 4YRSA 1NJ5A 1FYFA 3L2ZA 4ZTZB 4L87A 4E51A 3MF1A 1B7YA 1SRYA 2RHQA 2HNIA 1HXDA 4XEMA 1YFRA 4LNSA 1G5IA 2E1HA 2E64A 2DKGA 4XEOA 4TWAA 1H4SA 2DEQA 4YRPA 3NELA 4H2XA 4P75A 1X55A 1G51A 4UP8A 3PZCA 5K1XA 1NNHA 2E10A 4Q15A 2DTIA 12ASA 1WQWA 1ADYA 4YRLA 2IY5A 4CS3A 2EJ9A 2ODRC 4G85A 1JJCB 4XTVA 2E65A 4Q6GA 1NYQA 4WJ3M 1H4TA 1WQ7A 4ZIBA 1B8AA 3E9IA 4ZTUB 1ASZA 3P8VA 4H2UA 4YRCA 3HY0A 1B70B 3VQXA 4H2TA 3A32A 4AH6A 1GGMA 4H2VA 1NYRA 4XTUA 2CJAA 2DTOA 3QTCA 4XU0A 3NENA 4HWSA 4HWPA 4YRKA 3UGTA 1RIQA 5E3IA 1QF6A 4CS4A 4P71A 2DU5A 1W66A 4P75C 2CIMA 3V8KA 1BIBA 1VQZA 2AKWB 1SESA 1HC7A 1B7YB 2CJBA 1EQRA 1N9WA 2ARUA 2RHQB 1X2HA 3IKMB 2C8MA 2G4CA 3L1AA 1H4QA 4YRJA 3TEHA 4H2WA 1EIYA 4XTZA 2EJGA 4XTWA 1YB3A 4YCVA 3V7RA 1B70A 1NJ2A 4H2XB 4CH4A 2Q5HA 3HXZA 2I4MA 2DTHA 3KFUA 1B76A 3LSSA 2DXUA 2ZZEA 3NEMA 4H02A 1KMMA 4YYEA 11ASA 2EWNA 3P8YA 5C53B 3NETA 3I7FA 3WQZA 4P74A 2I4NA 4J15A 4CH3A 2IY5B 2DQ3A 1WYDA 3BFMA 2AKWA 3HRIA 4BWAA 3BJUA 4RDXA 2ZR2A 2ZNJA 4P3OA 4PHCA 4P71C 4TTVA 4YROA 2I4OA 2Q7GA 2DU7A 3RL6A 1EOVA 4YRQA 3HXWA 5KNNA 3REXA 4TQFA 2ZCEA 4DQ2A 4YRRA
chains in the Genus database with same CATH superfamily
1WU7A 4P73A 2ZZFA 3HY1A 1E24A 1YFSA 2ZT8A 4CH5A 3A5ZA 1HTTA 4KQEA 2ZT5A 2PMEA 2Q7HA 4TQDA 3VQVA 3REUA 1BIAA 2QHTA 3MEYA 1C0AA 4P74C 3IKLA 4YDQA 1X2GA 3TEHB 1EIYB 4H2SA 2EJFA 4TVWA 1EVLA 1USYA 4BW9A 2AMCB 3V8JA 3QO8A 4TVYA 3RGLA 4CH6A 3A31A 4KR3A 2DZ9A 4XTYA 4YRGA 1Z7MA 1NJ1A 3PCOB 1WNLA 2ALYA 1J5WA 2Q5IA 2J3MA 3V7CA 3EFRA 4P73C 3HXXA 2ZT6A 4WF2A 4XU3A 1G5HA 1ADJA 5K1PA 4WJ4A 2ZGWA 3L4GA 2P0LA 2ZR3A 1SETA 2RHSA 3VQWA 4RMFA 3ICAA 2ODRD 3UFGA 4YCUA 2AMCA 4K87A 3UH0A 3E9HA 1E22A 2CGHA 4KR2A 4HWTA 5ELOA 1USYC 4XU1A 4RQFA 4XU2A 2J3LA 3PCOA 3HFVA 4X5OA 2EL9A 1KMNA 1NJ6A 2QHVA 3ERRA 3RUXA 4HVCA 2ZIMA 3LC0A 3HRKA 2DQ0A 4TVAA 3W3SA 3QO5A 3RACA 4HWOA 4P3PA 3A7UA 2NS6A 4PG3A 4UP9A 2DZCA 2E3CA 4UPAA 4YRMA 2QHSA 4YCWA 2XTIA 2ZNIA 1E1TA 4XTXA 2ZINA 2FYKA 2CJ9A 4O2DA 1ATIA 5HGQA 5C51B 2ALYB 4P72A 3TUPA 4DPGA 1L0WA 3HFZA 4P3NA 1ASYA 1QE0A 4RQEA 2C7IA 1KOGA 3HXYA 1BBWA 3M4PA 1PYSB 1EVKA 1IL2A 1EFWA 1YFTA 2Q7EA 1H4VB 3RKYA 3VBBA 3L4GB 4H2YA 3HXUA 2RHSB 4WI1A 3A5YA 3MF2A 1SERA 2ZIOA 1WPYA 3UGQA 3RF1A 1X54A 4HWRA 4YRTA 1YGBA 3A7RA 2ZTGA 2DJZA 4LVKA 4OP0A 2I4LA 4YRFA 2DDZA 1NJ8A 2QHUA 3A74A 2DXTA 1WLEA 3QO7A 4P72C 3RIRA 4TVAB 1X56A 1PYSA 4YPFA 5F5WA 4YP0A 4NCXA 2ZT7A 3LSQA 3R07A 4K88A 3A7AA 2ZXFA 3FJPA 5C52B 2DVEA 4OLFA 4UP7A 3M4QA 2EAYA 4EX5A 1X01A 4K86A 1BBUA 3CMQA 4LVMA 3TEGA 3DSQA 3P8TA 3V7SA 1JJCA 3HFZB 4YRNA 2XGTA 3QNEA 3RKXA 4YRIA 5ELNA 3OD1A 3V8LA 2E41A 3IALA 1Z7NA 2PMFA 4EO4A 2ARTA 3EFSA 4G84A 2E5AA 2P5IA 3HXVA 3HTZA 3IG2A 3VQYA 4YREA 3RKWA 3G1ZA 4HA8A 1E1OA 1LYLA 4CS2A 2ARSA 2ZZGA 4YRSA 1NJ5A 1FYFA 4LVIA 3L2ZA 4ZTZB 4L87A 4E51A 3MF1A 1B7YA 2A8EA 1SRYA 2RHQA 2HNIA 1HXDA 4XEMA 1YFRA 4LNSA 1G5IA 2E1HA 2E64A 2DKGA 4XEOA 4TWAA 1H4SA 4HT4A 2DEQA 4YRPA 3NELA 4H2XA 4P75A 1X55A 1G51A 4UP8A 3PZCA 5K1XA 1NNHA 2E10A 4Q15A 2DTIA 12ASA 1WQWA 1ADYA 4YRLA 2IY5A 4CS3A 2EJ9A 2ODRC 4G85A 1JJCB 4XTVA 2E65A 4Q6GA 1NYQA 4WJ3M 1H4TA 1WQ7A 4ZIBA 1B8AA 3E9IA 4ZTUB 1ASZA 3P8VA 4H2UA 4YRCA 3HY0A 1B70B 3VQXA 4H2TA 3A32A 4AH6A 1GGMA 4H2VA 1NYRA 4XTUA 2CJAA 2DTOA 3QTCA 4XU0A 3NENA 4HWSA 4HWPA 4YRKA 3UGTA 1RIQA 5E3IA 1QF6A 4CS4A 4P71A 2DU5A 1W66A 4P75C 4LVJA 2CIMA 3V8KA 1BIBA 1VQZA 2AKWB 1SESA 1HC7A 1B7YB 2CJBA 1EQRA 1N9WA 2ARUA 2RHQB 1X2HA 3IKMB 2C8MA 2G4CA 3L1AA 1H4QA 4YRJA 3TEHA 4H2WA 1EIYA 4XTZA 2EJGA 4XTWA 3MQZA 1YB3A 4YCVA 3V7RA 1B70A 1NJ2A 4H2XB 4CH4A 2Q5HA 3HXZA 2I4MA 2DTHA 3KFUA 1B76A 3LSSA 2DXUA 2ZZEA 3NEMA 4H02A 1KMMA 4YYEA 11ASA 2EWNA 3P8YA 5C53B 3NETA 3I7FA 3WQZA 4P74A 2I4NA 4J15A 4CH3A 2IY5B 2DQ3A 1WYDA 3BFMA 2AKWA 3HRIA 4BWAA 3BJUA 4RDXA 2ZR2A 2ZNJA 4P3OA 4PHCA 4P71C 4TTVA 4YROA 2I4OA 2Q7GA 2DU7A 3RL6A 1EOVA 4LVLA 4YRQA 3HXWA 5KNNA 3REXA 4TQFA 2ZCEA 4DQ2A 4YRRA
chains in the Genus database with same CATH topology
1WU7A 4P73A 2ZZFA 3HY1A 1E24A 1YFSA 2ZT8A 4CH5A 3A5ZA 1HTTA 4KQEA 2ZT5A 2PMEA 2Q7HA 4TQDA 3VQVA 3REUA 1BIAA 2QHTA 3MEYA 1C0AA 4P74C 3IKLA 4YDQA 1X2GA 3TEHB 1EIYB 4H2SA 2EJFA 4TVWA 1EVLA 1USYA 4BW9A 2AMCB 3V8JA 3QO8A 4TVYA 3RGLA 4CH6A 3A31A 4KR3A 2DZ9A 4XTYA 4YRGA 1Z7MA 1NJ1A 3PCOB 1WNLA 2ALYA 1J5WA 2Q5IA 2J3MA 3V7CA 3EFRA 4P73C 3HXXA 2ZT6A 4WF2A 4XU3A 1G5HA 1ADJA 5K1PA 4WJ4A 2ZGWA 3L4GA 2P0LA 2ZR3A 1SETA 2RHSA 3VQWA 4RMFA 3ICAA 2ODRD 3UFGA 4YCUA 2AMCA 4K87A 3UH0A 3E9HA 1E22A 2CGHA 4KR2A 4HWTA 5ELOA 1USYC 4XU1A 4RQFA 4XU2A 2J3LA 3PCOA 3HFVA 4X5OA 2EL9A 1KMNA 1NJ6A 2QHVA 3ERRA 3RUXA 4HVCA 2ZIMA 3LC0A 3HRKA 2DQ0A 4TVAA 3W3SA 3QO5A 3RACA 4HWOA 4P3PA 3A7UA 2NS6A 4PG3A 4UP9A 2DZCA 2E3CA 4UPAA 4YRMA 2QHSA 4YCWA 2XTIA 2ZNIA 1E1TA 4XTXA 2ZINA 2FYKA 2CJ9A 4O2DA 1ATIA 5HGQA 5C51B 2ALYB 4P72A 3TUPA 4DPGA 1L0WA 3HFZA 4P3NA 1ASYA 1QE0A 4RQEA 2C7IA 1KOGA 3HXYA 1BBWA 3M4PA 1PYSB 1EVKA 1IL2A 1EFWA 1YFTA 2Q7EA 1H4VB 3RKYA 3VBBA 3L4GB 4H2YA 3HXUA 2RHSB 4WI1A 3A5YA 3MF2A 1SERA 2ZIOA 1WPYA 3UGQA 3RF1A 1X54A 4HWRA 4YRTA 1YGBA 3A7RA 2ZTGA 2DJZA 4LVKA 4OP0A 2I4LA 4YRFA 2DDZA 1NJ8A 2QHUA 3A74A 2DXTA 1WLEA 3QO7A 4P72C 3RIRA 4TVAB 1X56A 1PYSA 4YPFA 5F5WA 4YP0A 4NCXA 2ZT7A 3LSQA 3R07A 4K88A 3A7AA 2ZXFA 3FJPA 5C52B 2DVEA 4OLFA 4UP7A 3M4QA 2EAYA 4EX5A 1X01A 4K86A 1BBUA 3CMQA 4LVMA 3TEGA 3DSQA 3P8TA 3V7SA 1JJCA 3HFZB 4YRNA 2XGTA 3QNEA 3RKXA 4YRIA 5ELNA 3OD1A 3V8LA 2E41A 3IALA 1Z7NA 2PMFA 4EO4A 2ARTA 3EFSA 4G84A 2E5AA 2P5IA 3HXVA 3HTZA 3IG2A 3VQYA 4YREA 3RKWA 3G1ZA 4HA8A 1E1OA 1LYLA 4CS2A 2ARSA 2ZZGA 4YRSA 1NJ5A 1FYFA 4LVIA 3L2ZA 4ZTZB 4L87A 4E51A 3MF1A 1B7YA 2A8EA 1SRYA 2RHQA 2HNIA 1HXDA 4XEMA 1YFRA 4LNSA 1G5IA 2E1HA 2E64A 2DKGA 4XEOA 4TWAA 1H4SA 4HT4A 2DEQA 4YRPA 3NELA 4H2XA 4P75A 1X55A 1G51A 4UP8A 3PZCA 5K1XA 1NNHA 2E10A 4Q15A 2DTIA 12ASA 1WQWA 1ADYA 4YRLA 2IY5A 4CS3A 2EJ9A 2ODRC 4G85A 1JJCB 4XTVA 2E65A 4Q6GA 1NYQA 4WJ3M 1H4TA 1WQ7A 4ZIBA 1B8AA 3E9IA 4ZTUB 1ASZA 3P8VA 4H2UA 4YRCA 3HY0A 1B70B 3VQXA 4H2TA 3A32A 4AH6A 1GGMA 4H2VA 1NYRA 4XTUA 2CJAA 2DTOA 3QTCA 4XU0A 3NENA 4HWSA 4HWPA 4YRKA 3UGTA 1RIQA 5E3IA 1QF6A 4CS4A 4P71A 2DU5A 1W66A 4P75C 4LVJA 2CIMA 3V8KA 1BIBA 1VQZA 2AKWB 1SESA 1HC7A 1B7YB 2CJBA 1EQRA 1N9WA 2ARUA 2RHQB 1X2HA 3IKMB 2C8MA 2G4CA 3L1AA 1H4QA 4YRJA 3TEHA 4H2WA 1EIYA 4XTZA 2EJGA 4XTWA 3MQZA 1YB3A 4YCVA 3V7RA 1B70A 1NJ2A 4H2XB 4CH4A 2Q5HA 3HXZA 2I4MA 2DTHA 3KFUA 1B76A 3LSSA 2DXUA 2ZZEA 3NEMA 4H02A 1KMMA 4YYEA 11ASA 2EWNA 3P8YA 5C53B 3NETA 3I7FA 3WQZA 4P74A 2I4NA 4J15A 4CH3A 2IY5B 2DQ3A 1WYDA 3BFMA 2AKWA 3HRIA 4BWAA 3BJUA 4RDXA 2ZR2A 2ZNJA 4P3OA 4PHCA 4P71C 4TTVA 4YROA 2I4OA 2Q7GA 2DU7A 3RL6A 1EOVA 4LVLA 4YRQA 3HXWA 5KNNA 3REXA 4TQFA 2ZCEA 4DQ2A 4YRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WU7 A;  4P73 A;  2ZZF A;  3HY1 A;  1E24 A;  1YFS A;  2ZT8 A;  4CH5 A;  3A5Z A;  1HTT A;  4KQE A;  2ZT5 A;  2PME A;  2Q7H A;  4TQD A;  3VQV A;  3REU A;  1BIA A;  2QHT A;  3MEY A;  1C0A A;  4P74 C;  3IKL A;  4YDQ A;  1X2G A;  3TEH B;  1EIY B;  4H2S A;  2EJF A;  4TVW A;  1EVL A;  1USY A;  4BW9 A;  2AMC B;  3V8J A;  3QO8 A;  4TVY A;  3RGL A;  4CH6 A;  3A31 A;  4KR3 A;  2DZ9 A;  4XTY A;  4YRG A;  1Z7M A;  1NJ1 A;  3PCO B;  1WNL A;  2ALY A;  1J5W A;  2Q5I A;  2J3M A;  3V7C A;  3EFR A;  4P73 C;  3HXX A;  2ZT6 A;  4WF2 A;  4XU3 A;  1G5H A;  1ADJ A;  5K1P A;  4WJ4 A;  2ZGW A;  3L4G A;  2P0L A;  2ZR3 A;  1SET A;  2RHS A;  3VQW A;  4RMF A;  3ICA A;  2ODR D;  3UFG A;  4YCU A;  2AMC A;  4K87 A;  3UH0 A;  3E9H A;  1E22 A;  2CGH A;  4KR2 A;  4HWT A;  5ELO A;  1USY C;  4XU1 A;  4RQF A;  4XU2 A;  2J3L A;  3PCO A;  3HFV A;  4X5O A;  2EL9 A;  1KMN A;  1NJ6 A;  2QHV A;  3ERR A;  3RUX A;  4HVC A;  2ZIM A;  3LC0 A;  3HRK A;  2DQ0 A;  4TVA A;  3W3S A;  3QO5 A;  3RAC A;  4HWO A;  4P3P A;  3A7U A;  4PG3 A;  4UP9 A;  2DZC A;  2E3C A;  4UPA A;  4YRM A;  2QHS A;  4YCW A;  2XTI A;  2ZNI A;  1E1T A;  4XTX A;  2ZIN A;  2FYK A;  2CJ9 A;  4O2D A;  1ATI A;  5HGQ A;  5C51 B;  2ALY B;  4P72 A;  3TUP A;  4DPG A;  1L0W A;  3HFZ A;  4P3N A;  1ASY A;  1QE0 A;  4RQE A;  2C7I A;  1KOG A;  3HXY A;  1BBW A;  3M4P A;  1PYS B;  1EVK A;  1IL2 A;  1EFW A;  1YFT A;  2Q7E A;  1H4V B;  3RKY A;  3VBB A;  3L4G B;  4H2Y A;  3HXU A;  2RHS B;  4WI1 A;  3A5Y A;  3MF2 A;  1SER A;  2ZIO A;  1WPY A;  3UGQ A;  3RF1 A;  1X54 A;  4HWR A;  4YRT A;  1YGB A;  3A7R A;  2ZTG A;  2DJZ A;  4OP0 A;  2I4L A;  4YRF A;  2DDZ A;  1NJ8 A;  2QHU A;  3A74 A;  2DXT A;  1WLE A;  3QO7 A;  4P72 C;  3RIR A;  4TVA B;  1X56 A;  1PYS A;  4YPF A;  5F5W A;  4YP0 A;  4NCX A;  2ZT7 A;  3LSQ A;  3R07 A;  4K88 A;  3A7A A;  2ZXF A;  3FJP A;  5C52 B;  2DVE A;  4OLF A;  4UP7 A;  3M4Q A;  2EAY A;  4EX5 A;  1X01 A;  4K86 A;  1BBU A;  3CMQ A;  3TEG A;  3DSQ A;  3P8T A;  3V7S A;  1JJC A;  3HFZ B;  4YRN A;  2XGT A;  3QNE A;  3RKX A;  4YRI A;  5ELN A;  3OD1 A;  3V8L A;  2E41 A;  3IAL A;  1Z7N A;  2PMF A;  4EO4 A;  2ART A;  3EFS A;  4G84 A;  2E5A A;  2P5I A;  3HXV A;  3HTZ A;  3IG2 A;  3VQY A;  4YRE A;  3RKW A;  3G1Z A;  4HA8 A;  1E1O A;  1LYL A;  4CS2 A;  2ARS A;  2ZZG A;  4YRS A;  1NJ5 A;  1FYF A;  3L2Z A;  4ZTZ B;  4L87 A;  4E51 A;  3MF1 A;  1B7Y A;  1SRY A;  2RHQ A;  2HNI A;  1HXD A;  4XEM A;  1YFR A;  4LNS A;  1G5I A;  2E1H A;  2E64 A;  2DKG A;  4XEO A;  4TWA A;  1H4S A;  2DEQ A;  4YRP A;  3NEL A;  4H2X A;  4P75 A;  1X55 A;  1G51 A;  4UP8 A;  3PZC A;  5K1X A;  1NNH A;  2E10 A;  4Q15 A;  2DTI A;  12AS A;  1WQW A;  1ADY A;  4YRL A;  2IY5 A;  4CS3 A;  2EJ9 A;  2ODR C;  4G85 A;  1JJC B;  4XTV A;  2E65 A;  4Q6G A;  1NYQ A;  4WJ3 M;  1H4T A;  1WQ7 A;  4ZIB A;  1B8A A;  3E9I A;  4ZTU B;  1ASZ A;  3P8V A;  4H2U A;  4YRC A;  3HY0 A;  1B70 B;  3VQX A;  4H2T A;  3A32 A;  4AH6 A;  1GGM A;  4H2V A;  1NYR A;  4XTU A;  2CJA A;  2DTO A;  3QTC A;  4XU0 A;  3NEN A;  4HWS A;  4HWP A;  4YRK A;  3UGT A;  1RIQ A;  5E3I A;  1QF6 A;  4CS4 A;  4P71 A;  2DU5 A;  1W66 A;  4P75 C;  2CIM A;  3V8K A;  1BIB A;  1VQZ A;  2AKW B;  1SES A;  1HC7 A;  1B7Y B;  2CJB A;  1EQR A;  1N9W A;  2ARU A;  2RHQ B;  1X2H A;  3IKM B;  2C8M A;  2G4C A;  3L1A A;  1H4Q A;  4YRJ A;  3TEH A;  4H2W A;  1EIY A;  4XTZ A;  2EJG A;  4XTW A;  1YB3 A;  4YCV A;  3V7R A;  1B70 A;  1NJ2 A;  4H2X B;  4CH4 A;  2Q5H A;  3HXZ A;  2I4M A;  2DTH A;  3KFU A;  1B76 A;  3LSS A;  2DXU A;  2ZZE A;  3NEM A;  4H02 A;  1KMM A;  4YYE A;  11AS A;  2EWN A;  3P8Y A;  5C53 B;  3NET A;  3I7F A;  3WQZ A;  4P74 A;  2I4N A;  4J15 A;  4CH3 A;  2IY5 B;  2DQ3 A;  1WYD A;  3BFM A;  2AKW A;  3HRI A;  4BWA A;  3BJU A;  4RDX A;  2ZR2 A;  2ZNJ A;  4P3O A;  4PHC A;  4P71 C;  4TTV A;  4YRO A;  2I4O A;  2Q7G A;  2DU7 A;  3RL6 A;  1EOV A;  4YRQ A;  3HXW A;  5KNN A;  3REX A;  4TQF A;  2ZCE A;  4DQ2 A;  4YRR A; 
#chains in the Genus database with same CATH topology
 1WU7 A;  4P73 A;  2ZZF A;  3HY1 A;  1E24 A;  1YFS A;  2ZT8 A;  4CH5 A;  3A5Z A;  1HTT A;  4KQE A;  2ZT5 A;  2PME A;  2Q7H A;  4TQD A;  3VQV A;  3REU A;  1BIA A;  2QHT A;  3MEY A;  1C0A A;  4P74 C;  3IKL A;  4YDQ A;  1X2G A;  3TEH B;  1EIY B;  4H2S A;  2EJF A;  4TVW A;  1EVL A;  1USY A;  4BW9 A;  2AMC B;  3V8J A;  3QO8 A;  4TVY A;  3RGL A;  4CH6 A;  3A31 A;  4KR3 A;  2DZ9 A;  4XTY A;  4YRG A;  1Z7M A;  1NJ1 A;  3PCO B;  1WNL A;  2ALY A;  1J5W A;  2Q5I A;  2J3M A;  3V7C A;  3EFR A;  4P73 C;  3HXX A;  2ZT6 A;  4WF2 A;  4XU3 A;  1G5H A;  1ADJ A;  5K1P A;  4WJ4 A;  2ZGW A;  3L4G A;  2P0L A;  2ZR3 A;  1SET A;  2RHS A;  3VQW A;  4RMF A;  3ICA A;  2ODR D;  3UFG A;  4YCU A;  2AMC A;  4K87 A;  3UH0 A;  3E9H A;  1E22 A;  2CGH A;  4KR2 A;  4HWT A;  5ELO A;  1USY C;  4XU1 A;  4RQF A;  4XU2 A;  2J3L A;  3PCO A;  3HFV A;  4X5O A;  2EL9 A;  1KMN A;  1NJ6 A;  2QHV A;  3ERR A;  3RUX A;  4HVC A;  2ZIM A;  3LC0 A;  3HRK A;  2DQ0 A;  4TVA A;  3W3S A;  3QO5 A;  3RAC A;  4HWO A;  4P3P A;  3A7U A;  2NS6 A;  4PG3 A;  4UP9 A;  2DZC A;  2E3C A;  4UPA A;  4YRM A;  2QHS A;  4YCW A;  2XTI A;  2ZNI A;  1E1T A;  4XTX A;  2ZIN A;  2FYK A;  2CJ9 A;  4O2D A;  1ATI A;  5HGQ A;  5C51 B;  2ALY B;  4P72 A;  3TUP A;  4DPG A;  1L0W A;  3HFZ A;  4P3N A;  1ASY A;  1QE0 A;  4RQE A;  2C7I A;  1KOG A;  3HXY A;  1BBW A;  3M4P A;  1PYS B;  1EVK A;  1IL2 A;  1EFW A;  1YFT A;  2Q7E A;  1H4V B;  3RKY A;  3VBB A;  3L4G B;  4H2Y A;  3HXU A;  2RHS B;  4WI1 A;  3A5Y A;  3MF2 A;  1SER A;  2ZIO A;  1WPY A;  3UGQ A;  3RF1 A;  1X54 A;  4HWR A;  4YRT A;  1YGB A;  3A7R A;  2ZTG A;  2DJZ A;  4LVK A;  4OP0 A;  2I4L A;  4YRF A;  2DDZ A;  1NJ8 A;  2QHU A;  3A74 A;  2DXT A;  1WLE A;  3QO7 A;  4P72 C;  3RIR A;  4TVA B;  1X56 A;  1PYS A;  4YPF A;  5F5W A;  4YP0 A;  4NCX A;  2ZT7 A;  3LSQ A;  3R07 A;  4K88 A;  3A7A A;  2ZXF A;  3FJP A;  5C52 B;  2DVE A;  4OLF A;  4UP7 A;  3M4Q A;  2EAY A;  4EX5 A;  1X01 A;  4K86 A;  1BBU A;  3CMQ A;  4LVM A;  3TEG A;  3DSQ A;  3P8T A;  3V7S A;  1JJC A;  3HFZ B;  4YRN A;  2XGT A;  3QNE A;  3RKX A;  4YRI A;  5ELN A;  3OD1 A;  3V8L A;  2E41 A;  3IAL A;  1Z7N A;  2PMF A;  4EO4 A;  2ART A;  3EFS A;  4G84 A;  2E5A A;  2P5I A;  3HXV A;  3HTZ A;  3IG2 A;  3VQY A;  4YRE A;  3RKW A;  3G1Z A;  4HA8 A;  1E1O A;  1LYL A;  4CS2 A;  2ARS A;  2ZZG A;  4YRS A;  1NJ5 A;  1FYF A;  4LVI A;  3L2Z A;  4ZTZ B;  4L87 A;  4E51 A;  3MF1 A;  1B7Y A;  2A8E A;  1SRY A;  2RHQ A;  2HNI A;  1HXD A;  4XEM A;  1YFR A;  4LNS A;  1G5I A;  2E1H A;  2E64 A;  2DKG A;  4XEO A;  4TWA A;  1H4S A;  4HT4 A;  2DEQ A;  4YRP A;  3NEL A;  4H2X A;  4P75 A;  1X55 A;  1G51 A;  4UP8 A;  3PZC A;  5K1X A;  1NNH A;  2E10 A;  4Q15 A;  2DTI A;  12AS A;  1WQW A;  1ADY A;  4YRL A;  2IY5 A;  4CS3 A;  2EJ9 A;  2ODR C;  4G85 A;  1JJC B;  4XTV A;  2E65 A;  4Q6G A;  1NYQ A;  4WJ3 M;  1H4T A;  1WQ7 A;  4ZIB A;  1B8A A;  3E9I A;  4ZTU B;  1ASZ A;  3P8V A;  4H2U A;  4YRC A;  3HY0 A;  1B70 B;  3VQX A;  4H2T A;  3A32 A;  4AH6 A;  1GGM A;  4H2V A;  1NYR A;  4XTU A;  2CJA A;  2DTO A;  3QTC A;  4XU0 A;  3NEN A;  4HWS A;  4HWP A;  4YRK A;  3UGT A;  1RIQ A;  5E3I A;  1QF6 A;  4CS4 A;  4P71 A;  2DU5 A;  1W66 A;  4P75 C;  4LVJ A;  2CIM A;  3V8K A;  1BIB A;  1VQZ A;  2AKW B;  1SES A;  1HC7 A;  1B7Y B;  2CJB A;  1EQR A;  1N9W A;  2ARU A;  2RHQ B;  1X2H A;  3IKM B;  2C8M A;  2G4C A;  3L1A A;  1H4Q A;  4YRJ A;  3TEH A;  4H2W A;  1EIY A;  4XTZ A;  2EJG A;  4XTW A;  3MQZ A;  1YB3 A;  4YCV A;  3V7R A;  1B70 A;  1NJ2 A;  4H2X B;  4CH4 A;  2Q5H A;  3HXZ A;  2I4M A;  2DTH A;  3KFU A;  1B76 A;  3LSS A;  2DXU A;  2ZZE A;  3NEM A;  4H02 A;  1KMM A;  4YYE A;  11AS A;  2EWN A;  3P8Y A;  5C53 B;  3NET A;  3I7F A;  3WQZ A;  4P74 A;  2I4N A;  4J15 A;  4CH3 A;  2IY5 B;  2DQ3 A;  1WYD A;  3BFM A;  2AKW A;  3HRI A;  4BWA A;  3BJU A;  4RDX A;  2ZR2 A;  2ZNJ A;  4P3O A;  4PHC A;  4P71 C;  4TTV A;  4YRO A;  2I4O A;  2Q7G A;  2DU7 A;  3RL6 A;  1EOV A;  4LVL A;  4YRQ A;  3HXW A;  5KNN A;  3REX A;  4TQF A;  2ZCE A;  4DQ2 A;  4YRR A; 
#chains in the Genus database with same CATH homology
 1WU7 A;  4P73 A;  2ZZF A;  3HY1 A;  1E24 A;  1YFS A;  2ZT8 A;  4CH5 A;  3A5Z A;  1HTT A;  4KQE A;  2ZT5 A;  2PME A;  2Q7H A;  4TQD A;  3VQV A;  3REU A;  1BIA A;  2QHT A;  3MEY A;  1C0A A;  4P74 C;  3IKL A;  4YDQ A;  1X2G A;  3TEH B;  1EIY B;  4H2S A;  2EJF A;  4TVW A;  1EVL A;  1USY A;  4BW9 A;  2AMC B;  3V8J A;  3QO8 A;  4TVY A;  3RGL A;  4CH6 A;  3A31 A;  4KR3 A;  2DZ9 A;  4XTY A;  4YRG A;  1Z7M A;  1NJ1 A;  3PCO B;  1WNL A;  2ALY A;  1J5W A;  2Q5I A;  2J3M A;  3V7C A;  3EFR A;  4P73 C;  3HXX A;  2ZT6 A;  4WF2 A;  4XU3 A;  1G5H A;  1ADJ A;  5K1P A;  4WJ4 A;  2ZGW A;  3L4G A;  2P0L A;  2ZR3 A;  1SET A;  2RHS A;  3VQW A;  4RMF A;  3ICA A;  2ODR D;  3UFG A;  4YCU A;  2AMC A;  4K87 A;  3UH0 A;  3E9H A;  1E22 A;  2CGH A;  4KR2 A;  4HWT A;  5ELO A;  1USY C;  4XU1 A;  4RQF A;  4XU2 A;  2J3L A;  3PCO A;  3HFV A;  4X5O A;  2EL9 A;  1KMN A;  1NJ6 A;  2QHV A;  3ERR A;  3RUX A;  4HVC A;  2ZIM A;  3LC0 A;  3HRK A;  2DQ0 A;  4TVA A;  3W3S A;  3QO5 A;  3RAC A;  4HWO A;  4P3P A;  3A7U A;  2NS6 A;  4PG3 A;  4UP9 A;  2DZC A;  2E3C A;  4UPA A;  4YRM A;  2QHS A;  4YCW A;  2XTI A;  2ZNI A;  1E1T A;  4XTX A;  2ZIN A;  2FYK A;  2CJ9 A;  4O2D A;  1ATI A;  5HGQ A;  5C51 B;  2ALY B;  4P72 A;  3TUP A;  4DPG A;  1L0W A;  3HFZ A;  4P3N A;  1ASY A;  1QE0 A;  4RQE A;  2C7I A;  1KOG A;  3HXY A;  1BBW A;  3M4P A;  1PYS B;  1EVK A;  1IL2 A;  1EFW A;  1YFT A;  2Q7E A;  1H4V B;  3RKY A;  3VBB A;  3L4G B;  4H2Y A;  3HXU A;  2RHS B;  4WI1 A;  3A5Y A;  3MF2 A;  1SER A;  2ZIO A;  1WPY A;  3UGQ A;  3RF1 A;  1X54 A;  4HWR A;  4YRT A;  1YGB A;  3A7R A;  2ZTG A;  2DJZ A;  4LVK A;  4OP0 A;  2I4L A;  4YRF A;  2DDZ A;  1NJ8 A;  2QHU A;  3A74 A;  2DXT A;  1WLE A;  3QO7 A;  4P72 C;  3RIR A;  4TVA B;  1X56 A;  1PYS A;  4YPF A;  5F5W A;  4YP0 A;  4NCX A;  2ZT7 A;  3LSQ A;  3R07 A;  4K88 A;  3A7A A;  2ZXF A;  3FJP A;  5C52 B;  2DVE A;  4OLF A;  4UP7 A;  3M4Q A;  2EAY A;  4EX5 A;  1X01 A;  4K86 A;  1BBU A;  3CMQ A;  4LVM A;  3TEG A;  3DSQ A;  3P8T A;  3V7S A;  1JJC A;  3HFZ B;  4YRN A;  2XGT A;  3QNE A;  3RKX A;  4YRI A;  5ELN A;  3OD1 A;  3V8L A;  2E41 A;  3IAL A;  1Z7N A;  2PMF A;  4EO4 A;  2ART A;  3EFS A;  4G84 A;  2E5A A;  2P5I A;  3HXV A;  3HTZ A;  3IG2 A;  3VQY A;  4YRE A;  3RKW A;  3G1Z A;  4HA8 A;  1E1O A;  1LYL A;  4CS2 A;  2ARS A;  2ZZG A;  4YRS A;  1NJ5 A;  1FYF A;  4LVI A;  3L2Z A;  4ZTZ B;  4L87 A;  4E51 A;  3MF1 A;  1B7Y A;  2A8E A;  1SRY A;  2RHQ A;  2HNI A;  1HXD A;  4XEM A;  1YFR A;  4LNS A;  1G5I A;  2E1H A;  2E64 A;  2DKG A;  4XEO A;  4TWA A;  1H4S A;  4HT4 A;  2DEQ A;  4YRP A;  3NEL A;  4H2X A;  4P75 A;  1X55 A;  1G51 A;  4UP8 A;  3PZC A;  5K1X A;  1NNH A;  2E10 A;  4Q15 A;  2DTI A;  12AS A;  1WQW A;  1ADY A;  4YRL A;  2IY5 A;  4CS3 A;  2EJ9 A;  2ODR C;  4G85 A;  1JJC B;  4XTV A;  2E65 A;  4Q6G A;  1NYQ A;  4WJ3 M;  1H4T A;  1WQ7 A;  4ZIB A;  1B8A A;  3E9I A;  4ZTU B;  1ASZ A;  3P8V A;  4H2U A;  4YRC A;  3HY0 A;  1B70 B;  3VQX A;  4H2T A;  3A32 A;  4AH6 A;  1GGM A;  4H2V A;  1NYR A;  4XTU A;  2CJA A;  2DTO A;  3QTC A;  4XU0 A;  3NEN A;  4HWS A;  4HWP A;  4YRK A;  3UGT A;  1RIQ A;  5E3I A;  1QF6 A;  4CS4 A;  4P71 A;  2DU5 A;  1W66 A;  4P75 C;  4LVJ A;  2CIM A;  3V8K A;  1BIB A;  1VQZ A;  2AKW B;  1SES A;  1HC7 A;  1B7Y B;  2CJB A;  1EQR A;  1N9W A;  2ARU A;  2RHQ B;  1X2H A;  3IKM B;  2C8M A;  2G4C A;  3L1A A;  1H4Q A;  4YRJ A;  3TEH A;  4H2W A;  1EIY A;  4XTZ A;  2EJG A;  4XTW A;  3MQZ A;  1YB3 A;  4YCV A;  3V7R A;  1B70 A;  1NJ2 A;  4H2X B;  4CH4 A;  2Q5H A;  3HXZ A;  2I4M A;  2DTH A;  3KFU A;  1B76 A;  3LSS A;  2DXU A;  2ZZE A;  3NEM A;  4H02 A;  1KMM A;  4YYE A;  11AS A;  2EWN A;  3P8Y A;  5C53 B;  3NET A;  3I7F A;  3WQZ A;  4P74 A;  2I4N A;  4J15 A;  4CH3 A;  2IY5 B;  2DQ3 A;  1WYD A;  3BFM A;  2AKW A;  3HRI A;  4BWA A;  3BJU A;  4RDX A;  2ZR2 A;  2ZNJ A;  4P3O A;  4PHC A;  4P71 C;  4TTV A;  4YRO A;  2I4O A;  2Q7G A;  2DU7 A;  3RL6 A;  1EOV A;  4LVL A;  4YRQ A;  3HXW A;  5KNN A;  3REX A;  4TQF A;  2ZCE A;  4DQ2 A;  4YRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...