1YFRA

Crystal structure of alanyl-trna synthetase in complex with atp and magnesium
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 137
structure length 448
sequence length 457
chains with identical sequence B
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yfrA01
3HRKA 4P75A 3NEMA 4YRPA 4J15A 4BWAA 5ELNA 3A7AA 3BJUA 1NJ5A 4TVAA 2E5AA 2HNIA 1PYSB 4H2XA 1E1TA 4YRKA 3W3SA 3MF1A 4AH6A 1Z7NA 2E64A 4P72A 2CGHA 3P8VA 2ZT6A 1ADYA 2Q7HA 2ARSA 1QF6A 3IKMB 3HXYA 5C51B 3RIRA 4WJ3M 2EJFA 4TWAA 1NJ6A 2DU7A 3V7CA 3WQZA 2Q7GA 4HVCA 4P3PA 2RHSB 2AMCA 4H2YA 5K1XA 4H2UA 3L4GB 4K88A 2Q7EA 4EX5A 2DZCA 2ODRC 2DTOA 2Q5HA 5HGQA 2DEQA 3A5ZA 4PG3A 3RGLA 4XTXA 3QNEA 3OD1A 3IKLA 2E3CA 2DTHA 4HA8A 4ZTUB 2DDZA 4YRJA 4XU2A 3QTCA 4YRIA 3HFVA 3FJPA 3A32A 2ALYB 2ZT5A 4P71A 3PCOB 3MF2A 2ZIOA 4P73A 1GGMA 4DQ2A 4YRFA 3A5YA 3PZCA 2ZNJA 2P5IA 4YPFA 2E65A 3I7FA 3LSQA 3HFZA 1NNHA 3CMQA 3RL6A 3QO8A 3A7UA 1VQZA 4UP7A 4BW9A 2PMEA 1ASZA 2I4OA 3KFUA 4NCXA 4TVWA 2AKWB 2DVEA 1YFSA 2I4NA 1HTTA 1W66A 1SETA 4OP0A 3HXWA 2DJZA 1HXDA 4XU3A 3VQXA 3DSQA 3RKWA 3EFSA 4XTWA 3UFGA 1C0AA 1WQWA 2ARTA 3A7RA 2ZR3A 4TVYA 3M4QA 2ZCEA 3MEYA 3RUXA 5F5WA 4CS4A 1EFWA 1USYC 3IALA 1B76A 1WQ7A 3L2ZA 4L87A 4O2DA 3HXVA 3IG2A 1ADJA 4YRQA 3TEHB 1EQRA 3QO7A 4XTYA 3UGQA 3V7SA 1B7YB 4DPGA 4P3OA 4Q15A 2XGTA 1SERA 3NELA 3HRIA 4H2TA 3BFMA 4CH5A 1H4SA 2E1HA 2I4LA 1JJCB 1BBUA 1H4QA 2ZZGA 1G51A 1ASYA 1G5HA 4P74C 4YP0A 3ICAA 1J5WA 4HWSA 1YB3A 4XU1A 2C7IA 2ZXFA 2RHQB 4XTVA 4RDXA 4WI1A 4TTVA 3V8LA 2DKGA 1PYSA 1EIYB 1BIAA 2P0LA 4K86A 2ZNIA 3HTZA 4LNSA 2DTIA 4CH4A 4H2WA 2CJAA 1IL2A 4YROA 4G85A 3UH0A 1B70B 1WYDA 4CS2A 4RQEA 11ASA 4H2VA 2IY5B 3HXZA 2RHSA 1SESA 1YFRA 3A31A 3L4GA 3ERRA 3HXXA 2QHTA 3RF1A 1EOVA 3TUPA 2EJGA 1WLEA 4RMFA 4YRCA 2ZTGA 3V7RA 1RIQA 2EAYA 2CJBA 4UP9A 2DQ0A 1USYA 1E1OA 4XTUA 1HC7A 4KR2A 3A74A 4RQFA 4H2SA 2ALYA 3PCOA 3VBBA 1B8AA 4HWOA 4OLFA 3R07A 4EO4A 2ZINA 2ZR2A 2CJ9A 4YCUA 3HXUA 4YRLA 3REXA 5C52B 1ATIA 2DXUA 1E24A 3RACA 1WU7A 4P74A 1X01A 4CH6A 1BIBA 4P73C 2AKWA 3P8TA 4G84A 4YRTA 4TVAB 2EJ9A 1WPYA 2FYKA 4H2XB 3VQWA 2ODRD 2DXTA 2G4CA 1KOGA 1N9WA 3P8YA 2QHUA 5E3IA 4WF2A 3G1ZA 4XTZA 2J3MA 5ELOA 1KMMA 1BBWA 3TEHA 1B7YA 1LYLA 4CS3A 4YREA 2CIMA 4H02A 2EL9A 5C53B 1NYRA 1Z7MA 1H4VB 2AMCB 1X2GA 3HY1A 2ZT8A 4HWPA 1JJCA 1X56A 2J3LA 4YRRA 2QHVA 1H4TA 4YRGA 3VQYA 4WJ4A 2DZ9A 4P75C 5KNNA 4K87A 2E41A 3VQVA 3V8KA 3L1AA 4TQDA 1E22A 1QE0A 1L0WA 2EWNA 2RHQA 1SRYA 2QHSA 1YFTA 4YDQA 3UGTA 3V8JA 1EIYA 4P72C 2ZZEA 1NJ2A 2XTIA 2C8MA 5K1PA 4KR3A 2I4MA 4YRNA 3HFZB 3REUA 4ZTZB 1YGBA 1B70A 2PMFA 4PHCA 1X55A 1EVLA 1NJ1A 2ZGWA 1X54A 3LC0A 4KQEA 4YCWA 3TEGA 1NYQA 4XEOA 2IY5A 2E10A 1FYFA 4Q6GA 12ASA 4UP8A 3QO5A 2DQ3A 4YCVA 2ZIMA 1G5IA 4ZIBA 2Q5IA 4UPAA 3E9IA 4E51A 3NENA 4XEMA 3M4PA 4HWRA 1KMNA 3E9HA 4XU0A 4X5OA 1X2HA 4YYEA 4P71C 3HY0A 4YRMA 4YRSA 2DU5A 2ARUA 2ZZFA 4TQFA 1WNLA 3RKXA 3RKYA 4HWTA 4CH3A 3LSSA 3NETA 2ZT7A 1EVKA 3EFRA 4P3NA 1NJ8A
chains in the Genus database with same CATH superfamily
3HRKA 4P75A 3NEMA 4YRPA 4J15A 4BWAA 5ELNA 3A7AA 3BJUA 1NJ5A 4TVAA 2E5AA 2HNIA 1PYSB 4H2XA 1E1TA 4YRKA 3W3SA 3MF1A 4AH6A 1Z7NA 2E64A 4P72A 2CGHA 3P8VA 2ZT6A 1ADYA 2Q7HA 2ARSA 1QF6A 3IKMB 3HXYA 5C51B 3RIRA 4WJ3M 2EJFA 4TWAA 1NJ6A 2DU7A 3V7CA 3WQZA 2Q7GA 4HVCA 4P3PA 2RHSB 2AMCA 4H2YA 5K1XA 4H2UA 3L4GB 4K88A 2Q7EA 4EX5A 2DZCA 2ODRC 2DTOA 2Q5HA 5HGQA 2DEQA 4HT4A 3A5ZA 4PG3A 3RGLA 4XTXA 3QNEA 3OD1A 3IKLA 2E3CA 2DTHA 4HA8A 4ZTUB 2DDZA 4YRJA 4XU2A 3QTCA 4YRIA 3HFVA 3FJPA 3A32A 2ALYB 2ZT5A 4P71A 3PCOB 3MF2A 2ZIOA 4P73A 1GGMA 4DQ2A 4YRFA 3A5YA 3PZCA 2ZNJA 2P5IA 4YPFA 2E65A 3I7FA 3LSQA 3HFZA 1NNHA 3CMQA 3RL6A 4LVMA 3QO8A 3A7UA 1VQZA 4UP7A 4BW9A 2PMEA 1ASZA 2I4OA 3KFUA 4NCXA 4LVJA 4TVWA 2AKWB 2DVEA 1YFSA 2I4NA 1HTTA 1W66A 1SETA 4OP0A 3HXWA 2DJZA 2NS6A 1HXDA 4XU3A 3VQXA 3DSQA 3RKWA 3EFSA 4XTWA 3UFGA 1C0AA 1WQWA 2ARTA 3A7RA 2ZR3A 4TVYA 3M4QA 2ZCEA 3MEYA 3MQZA 3RUXA 5F5WA 4CS4A 1EFWA 1USYC 3IALA 1B76A 1WQ7A 3L2ZA 4L87A 4O2DA 3HXVA 3IG2A 1ADJA 4YRQA 3TEHB 1EQRA 3QO7A 4XTYA 3UGQA 3V7SA 1B7YB 4DPGA 4P3OA 4Q15A 2XGTA 1SERA 3NELA 3HRIA 4H2TA 3BFMA 4CH5A 1H4SA 2E1HA 2I4LA 1JJCB 1BBUA 1H4QA 2ZZGA 1G51A 1ASYA 1G5HA 4P74C 4YP0A 3ICAA 1J5WA 4HWSA 1YB3A 4XU1A 2C7IA 2ZXFA 2RHQB 4XTVA 4RDXA 4WI1A 4TTVA 3V8LA 2DKGA 1PYSA 1EIYB 1BIAA 2P0LA 4K86A 2ZNIA 3HTZA 4LNSA 2DTIA 4CH4A 4H2WA 2CJAA 1IL2A 4YROA 4G85A 3UH0A 1B70B 1WYDA 4CS2A 4RQEA 11ASA 4H2VA 2IY5B 3HXZA 2RHSA 1SESA 1YFRA 3A31A 3L4GA 3ERRA 3HXXA 2QHTA 3RF1A 1EOVA 3TUPA 2EJGA 1WLEA 4RMFA 4YRCA 2ZTGA 3V7RA 1RIQA 2EAYA 2CJBA 4UP9A 2DQ0A 1USYA 1E1OA 4XTUA 1HC7A 4KR2A 3A74A 4RQFA 4H2SA 2ALYA 3PCOA 3VBBA 1B8AA 4HWOA 4OLFA 3R07A 4EO4A 2ZINA 2ZR2A 2CJ9A 4YCUA 3HXUA 4YRLA 3REXA 5C52B 1ATIA 4LVKA 2DXUA 1E24A 3RACA 1WU7A 4P74A 1X01A 4CH6A 1BIBA 4P73C 2AKWA 3P8TA 4G84A 4YRTA 4TVAB 2EJ9A 1WPYA 2FYKA 4H2XB 3VQWA 2ODRD 2DXTA 2G4CA 1KOGA 1N9WA 3P8YA 2QHUA 5E3IA 4WF2A 2A8EA 3G1ZA 4XTZA 2J3MA 5ELOA 1KMMA 1BBWA 3TEHA 1B7YA 1LYLA 4CS3A 4YREA 2CIMA 4H02A 2EL9A 5C53B 1NYRA 1Z7MA 1H4VB 2AMCB 1X2GA 3HY1A 2ZT8A 4HWPA 1JJCA 4LVIA 1X56A 2J3LA 4YRRA 2QHVA 1H4TA 4YRGA 3VQYA 4WJ4A 2DZ9A 4P75C 5KNNA 4K87A 2E41A 3VQVA 4LVLA 3V8KA 3L1AA 4TQDA 1E22A 1QE0A 1L0WA 2EWNA 2RHQA 1SRYA 2QHSA 1YFTA 4YDQA 3UGTA 3V8JA 1EIYA 4P72C 2ZZEA 1NJ2A 2XTIA 2C8MA 5K1PA 4KR3A 2I4MA 4YRNA 3HFZB 3REUA 4ZTZB 1YGBA 1B70A 2PMFA 4PHCA 1X55A 1EVLA 1NJ1A 2ZGWA 1X54A 3LC0A 4KQEA 4YCWA 3TEGA 1NYQA 4XEOA 2IY5A 2E10A 1FYFA 4Q6GA 12ASA 4UP8A 3QO5A 2DQ3A 4YCVA 2ZIMA 1G5IA 4ZIBA 2Q5IA 4UPAA 3E9IA 4E51A 3NENA 4XEMA 3M4PA 4HWRA 1KMNA 3E9HA 4XU0A 4X5OA 1X2HA 4YYEA 4P71C 3HY0A 4YRMA 4YRSA 2DU5A 2ARUA 2ZZFA 4TQFA 1WNLA 3RKXA 3RKYA 4HWTA 4CH3A 3LSSA 3NETA 2ZT7A 1EVKA 3EFRA 4P3NA 1NJ8A
chains in the Genus database with same CATH topology
3HRKA 4P75A 3NEMA 4YRPA 4J15A 4BWAA 5ELNA 3A7AA 3BJUA 1NJ5A 4TVAA 2E5AA 2HNIA 1PYSB 4H2XA 1E1TA 4YRKA 3W3SA 3MF1A 4AH6A 1Z7NA 2E64A 4P72A 2CGHA 3P8VA 2ZT6A 1ADYA 2Q7HA 2ARSA 1QF6A 3IKMB 3HXYA 5C51B 3RIRA 4WJ3M 2EJFA 4TWAA 1NJ6A 2DU7A 3V7CA 3WQZA 2Q7GA 4HVCA 4P3PA 2RHSB 2AMCA 4H2YA 5K1XA 4H2UA 3L4GB 4K88A 2Q7EA 4EX5A 2DZCA 2ODRC 2DTOA 2Q5HA 5HGQA 2DEQA 4HT4A 3A5ZA 4PG3A 3RGLA 4XTXA 3QNEA 3OD1A 3IKLA 2E3CA 2DTHA 4HA8A 4ZTUB 2DDZA 4YRJA 4XU2A 3QTCA 4YRIA 3HFVA 3FJPA 3A32A 2ALYB 2ZT5A 4P71A 3PCOB 3MF2A 2ZIOA 4P73A 1GGMA 4DQ2A 4YRFA 3A5YA 3PZCA 2ZNJA 2P5IA 4YPFA 2E65A 3I7FA 3LSQA 3HFZA 1NNHA 3CMQA 3RL6A 4LVMA 3QO8A 3A7UA 1VQZA 4UP7A 4BW9A 2PMEA 1ASZA 2I4OA 3KFUA 4NCXA 4LVJA 4TVWA 2AKWB 2DVEA 1YFSA 2I4NA 1HTTA 1W66A 1SETA 4OP0A 3HXWA 2DJZA 2NS6A 1HXDA 4XU3A 3VQXA 3DSQA 3RKWA 3EFSA 4XTWA 3UFGA 1C0AA 1WQWA 2ARTA 3A7RA 2ZR3A 4TVYA 3M4QA 2ZCEA 3MEYA 3MQZA 3RUXA 5F5WA 4CS4A 1EFWA 1USYC 3IALA 1B76A 1WQ7A 3L2ZA 4L87A 4O2DA 3HXVA 3IG2A 1ADJA 4YRQA 3TEHB 1EQRA 3QO7A 4XTYA 3UGQA 3V7SA 1B7YB 4DPGA 4P3OA 4Q15A 2XGTA 1SERA 3NELA 3HRIA 4H2TA 3BFMA 4CH5A 1H4SA 2E1HA 2I4LA 1JJCB 1BBUA 1H4QA 2ZZGA 1G51A 1ASYA 1G5HA 4P74C 4YP0A 3ICAA 1J5WA 4HWSA 1YB3A 4XU1A 2C7IA 2ZXFA 2RHQB 4XTVA 4RDXA 4WI1A 4TTVA 3V8LA 2DKGA 1PYSA 1EIYB 1BIAA 2P0LA 4K86A 2ZNIA 3HTZA 4LNSA 2DTIA 4CH4A 4H2WA 2CJAA 1IL2A 4YROA 4G85A 3UH0A 1B70B 1WYDA 4CS2A 4RQEA 11ASA 4H2VA 2IY5B 3HXZA 2RHSA 1SESA 1YFRA 3A31A 3L4GA 3ERRA 3HXXA 2QHTA 3RF1A 1EOVA 3TUPA 2EJGA 1WLEA 4RMFA 4YRCA 2ZTGA 3V7RA 1RIQA 2EAYA 2CJBA 4UP9A 2DQ0A 1USYA 1E1OA 4XTUA 1HC7A 4KR2A 3A74A 4RQFA 4H2SA 2ALYA 3PCOA 3VBBA 1B8AA 4HWOA 4OLFA 3R07A 4EO4A 2ZINA 2ZR2A 2CJ9A 4YCUA 3HXUA 4YRLA 3REXA 5C52B 1ATIA 4LVKA 2DXUA 1E24A 3RACA 1WU7A 4P74A 1X01A 4CH6A 1BIBA 4P73C 2AKWA 3P8TA 4G84A 4YRTA 4TVAB 2EJ9A 1WPYA 2FYKA 4H2XB 3VQWA 2ODRD 2DXTA 2G4CA 1KOGA 1N9WA 3P8YA 2QHUA 5E3IA 4WF2A 2A8EA 3G1ZA 4XTZA 2J3MA 5ELOA 1KMMA 1BBWA 3TEHA 1B7YA 1LYLA 4CS3A 4YREA 2CIMA 4H02A 2EL9A 5C53B 1NYRA 1Z7MA 1H4VB 2AMCB 1X2GA 3HY1A 2ZT8A 4HWPA 1JJCA 4LVIA 1X56A 2J3LA 4YRRA 2QHVA 1H4TA 4YRGA 3VQYA 4WJ4A 2DZ9A 4P75C 5KNNA 4K87A 2E41A 3VQVA 4LVLA 3V8KA 3L1AA 4TQDA 1E22A 1QE0A 1L0WA 2EWNA 2RHQA 1SRYA 2QHSA 1YFTA 4YDQA 3UGTA 3V8JA 1EIYA 4P72C 2ZZEA 1NJ2A 2XTIA 2C8MA 5K1PA 4KR3A 2I4MA 4YRNA 3HFZB 3REUA 4ZTZB 1YGBA 1B70A 2PMFA 4PHCA 1X55A 1EVLA 1NJ1A 2ZGWA 1X54A 3LC0A 4KQEA 4YCWA 3TEGA 1NYQA 4XEOA 2IY5A 2E10A 1FYFA 4Q6GA 12ASA 4UP8A 3QO5A 2DQ3A 4YCVA 2ZIMA 1G5IA 4ZIBA 2Q5IA 4UPAA 3E9IA 4E51A 3NENA 4XEMA 3M4PA 4HWRA 1KMNA 3E9HA 4XU0A 4X5OA 1X2HA 4YYEA 4P71C 3HY0A 4YRMA 4YRSA 2DU5A 2ARUA 2ZZFA 4TQFA 1WNLA 3RKXA 3RKYA 4HWTA 4CH3A 3LSSA 3NETA 2ZT7A 1EVKA 3EFRA 4P3NA 1NJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRK A;  4P75 A;  3NEM A;  4YRP A;  4J15 A;  4BWA A;  5ELN A;  3A7A A;  3BJU A;  1NJ5 A;  4TVA A;  2E5A A;  2HNI A;  1PYS B;  4H2X A;  1E1T A;  4YRK A;  3W3S A;  3MF1 A;  4AH6 A;  1Z7N A;  2E64 A;  4P72 A;  2CGH A;  3P8V A;  2ZT6 A;  1ADY A;  2Q7H A;  2ARS A;  1QF6 A;  3IKM B;  3HXY A;  5C51 B;  3RIR A;  4WJ3 M;  2EJF A;  4TWA A;  1NJ6 A;  2DU7 A;  3V7C A;  3WQZ A;  2Q7G A;  4HVC A;  4P3P A;  2RHS B;  2AMC A;  4H2Y A;  5K1X A;  4H2U A;  3L4G B;  4K88 A;  2Q7E A;  4EX5 A;  2DZC A;  2ODR C;  2DTO A;  2Q5H A;  5HGQ A;  2DEQ A;  3A5Z A;  4PG3 A;  3RGL A;  4XTX A;  3QNE A;  3OD1 A;  3IKL A;  2E3C A;  2DTH A;  4HA8 A;  4ZTU B;  2DDZ A;  4YRJ A;  4XU2 A;  3QTC A;  4YRI A;  3HFV A;  3FJP A;  3A32 A;  2ALY B;  2ZT5 A;  4P71 A;  3PCO B;  3MF2 A;  2ZIO A;  4P73 A;  1GGM A;  4DQ2 A;  4YRF A;  3A5Y A;  3PZC A;  2ZNJ A;  2P5I A;  4YPF A;  2E65 A;  3I7F A;  3LSQ A;  3HFZ A;  1NNH A;  3CMQ A;  3RL6 A;  3QO8 A;  3A7U A;  1VQZ A;  4UP7 A;  4BW9 A;  2PME A;  1ASZ A;  2I4O A;  3KFU A;  4NCX A;  4TVW A;  2AKW B;  2DVE A;  1YFS A;  2I4N A;  1HTT A;  1W66 A;  1SET A;  4OP0 A;  3HXW A;  2DJZ A;  1HXD A;  4XU3 A;  3VQX A;  3DSQ A;  3RKW A;  3EFS A;  4XTW A;  3UFG A;  1C0A A;  1WQW A;  2ART A;  3A7R A;  2ZR3 A;  4TVY A;  3M4Q A;  2ZCE A;  3MEY A;  3RUX A;  5F5W A;  4CS4 A;  1EFW A;  1USY C;  3IAL A;  1B76 A;  1WQ7 A;  3L2Z A;  4L87 A;  4O2D A;  3HXV A;  3IG2 A;  1ADJ A;  4YRQ A;  3TEH B;  1EQR A;  3QO7 A;  4XTY A;  3UGQ A;  3V7S A;  1B7Y B;  4DPG A;  4P3O A;  4Q15 A;  2XGT A;  1SER A;  3NEL A;  3HRI A;  4H2T A;  3BFM A;  4CH5 A;  1H4S A;  2E1H A;  2I4L A;  1JJC B;  1BBU A;  1H4Q A;  2ZZG A;  1G51 A;  1ASY A;  1G5H A;  4P74 C;  4YP0 A;  3ICA A;  1J5W A;  4HWS A;  1YB3 A;  4XU1 A;  2C7I A;  2ZXF A;  2RHQ B;  4XTV A;  4RDX A;  4WI1 A;  4TTV A;  3V8L A;  2DKG A;  1PYS A;  1EIY B;  1BIA A;  2P0L A;  4K86 A;  2ZNI A;  3HTZ A;  4LNS A;  2DTI A;  4CH4 A;  4H2W A;  2CJA A;  1IL2 A;  4YRO A;  4G85 A;  3UH0 A;  1B70 B;  1WYD A;  4CS2 A;  4RQE A;  11AS A;  4H2V A;  2IY5 B;  3HXZ A;  2RHS A;  1SES A;  1YFR A;  3A31 A;  3L4G A;  3ERR A;  3HXX A;  2QHT A;  3RF1 A;  1EOV A;  3TUP A;  2EJG A;  1WLE A;  4RMF A;  4YRC A;  2ZTG A;  3V7R A;  1RIQ A;  2EAY A;  2CJB A;  4UP9 A;  2DQ0 A;  1USY A;  1E1O A;  4XTU A;  1HC7 A;  4KR2 A;  3A74 A;  4RQF A;  4H2S A;  2ALY A;  3PCO A;  3VBB A;  1B8A A;  4HWO A;  4OLF A;  3R07 A;  4EO4 A;  2ZIN A;  2ZR2 A;  2CJ9 A;  4YCU A;  3HXU A;  4YRL A;  3REX A;  5C52 B;  1ATI A;  2DXU A;  1E24 A;  3RAC A;  1WU7 A;  4P74 A;  1X01 A;  4CH6 A;  1BIB A;  4P73 C;  2AKW A;  3P8T A;  4G84 A;  4YRT A;  4TVA B;  2EJ9 A;  1WPY A;  2FYK A;  4H2X B;  3VQW A;  2ODR D;  2DXT A;  2G4C A;  1KOG A;  1N9W A;  3P8Y A;  2QHU A;  5E3I A;  4WF2 A;  3G1Z A;  4XTZ A;  2J3M A;  5ELO A;  1KMM A;  1BBW A;  3TEH A;  1B7Y A;  1LYL A;  4CS3 A;  4YRE A;  2CIM A;  4H02 A;  2EL9 A;  5C53 B;  1NYR A;  1Z7M A;  1H4V B;  2AMC B;  1X2G A;  3HY1 A;  2ZT8 A;  4HWP A;  1JJC A;  1X56 A;  2J3L A;  4YRR A;  2QHV A;  1H4T A;  4YRG A;  3VQY A;  4WJ4 A;  2DZ9 A;  4P75 C;  5KNN A;  4K87 A;  2E41 A;  3VQV A;  3V8K A;  3L1A A;  4TQD A;  1E22 A;  1QE0 A;  1L0W A;  2EWN A;  2RHQ A;  1SRY A;  2QHS A;  1YFT A;  4YDQ A;  3UGT A;  3V8J A;  1EIY A;  4P72 C;  2ZZE A;  1NJ2 A;  2XTI A;  2C8M A;  5K1P A;  4KR3 A;  2I4M A;  4YRN A;  3HFZ B;  3REU A;  4ZTZ B;  1YGB A;  1B70 A;  2PMF A;  4PHC A;  1X55 A;  1EVL A;  1NJ1 A;  2ZGW A;  1X54 A;  3LC0 A;  4KQE A;  4YCW A;  3TEG A;  1NYQ A;  4XEO A;  2IY5 A;  2E10 A;  1FYF A;  4Q6G A;  12AS A;  4UP8 A;  3QO5 A;  2DQ3 A;  4YCV A;  2ZIM A;  1G5I A;  4ZIB A;  2Q5I A;  4UPA A;  3E9I A;  4E51 A;  3NEN A;  4XEM A;  3M4P A;  4HWR A;  1KMN A;  3E9H A;  4XU0 A;  4X5O A;  1X2H A;  4YYE A;  4P71 C;  3HY0 A;  4YRM A;  4YRS A;  2DU5 A;  2ARU A;  2ZZF A;  4TQF A;  1WNL A;  3RKX A;  3RKY A;  4HWT A;  4CH3 A;  3LSS A;  3NET A;  2ZT7 A;  1EVK A;  3EFR A;  4P3N A;  1NJ8 A; 
#chains in the Genus database with same CATH topology
 3HRK A;  4P75 A;  3NEM A;  4YRP A;  4J15 A;  4BWA A;  5ELN A;  3A7A A;  3BJU A;  1NJ5 A;  4TVA A;  2E5A A;  2HNI A;  1PYS B;  4H2X A;  1E1T A;  4YRK A;  3W3S A;  3MF1 A;  4AH6 A;  1Z7N A;  2E64 A;  4P72 A;  2CGH A;  3P8V A;  2ZT6 A;  1ADY A;  2Q7H A;  2ARS A;  1QF6 A;  3IKM B;  3HXY A;  5C51 B;  3RIR A;  4WJ3 M;  2EJF A;  4TWA A;  1NJ6 A;  2DU7 A;  3V7C A;  3WQZ A;  2Q7G A;  4HVC A;  4P3P A;  2RHS B;  2AMC A;  4H2Y A;  5K1X A;  4H2U A;  3L4G B;  4K88 A;  2Q7E A;  4EX5 A;  2DZC A;  2ODR C;  2DTO A;  2Q5H A;  5HGQ A;  2DEQ A;  4HT4 A;  3A5Z A;  4PG3 A;  3RGL A;  4XTX A;  3QNE A;  3OD1 A;  3IKL A;  2E3C A;  2DTH A;  4HA8 A;  4ZTU B;  2DDZ A;  4YRJ A;  4XU2 A;  3QTC A;  4YRI A;  3HFV A;  3FJP A;  3A32 A;  2ALY B;  2ZT5 A;  4P71 A;  3PCO B;  3MF2 A;  2ZIO A;  4P73 A;  1GGM A;  4DQ2 A;  4YRF A;  3A5Y A;  3PZC A;  2ZNJ A;  2P5I A;  4YPF A;  2E65 A;  3I7F A;  3LSQ A;  3HFZ A;  1NNH A;  3CMQ A;  3RL6 A;  4LVM A;  3QO8 A;  3A7U A;  1VQZ A;  4UP7 A;  4BW9 A;  2PME A;  1ASZ A;  2I4O A;  3KFU A;  4NCX A;  4LVJ A;  4TVW A;  2AKW B;  2DVE A;  1YFS A;  2I4N A;  1HTT A;  1W66 A;  1SET A;  4OP0 A;  3HXW A;  2DJZ A;  2NS6 A;  1HXD A;  4XU3 A;  3VQX A;  3DSQ A;  3RKW A;  3EFS A;  4XTW A;  3UFG A;  1C0A A;  1WQW A;  2ART A;  3A7R A;  2ZR3 A;  4TVY A;  3M4Q A;  2ZCE A;  3MEY A;  3MQZ A;  3RUX A;  5F5W A;  4CS4 A;  1EFW A;  1USY C;  3IAL A;  1B76 A;  1WQ7 A;  3L2Z A;  4L87 A;  4O2D A;  3HXV A;  3IG2 A;  1ADJ A;  4YRQ A;  3TEH B;  1EQR A;  3QO7 A;  4XTY A;  3UGQ A;  3V7S A;  1B7Y B;  4DPG A;  4P3O A;  4Q15 A;  2XGT A;  1SER A;  3NEL A;  3HRI A;  4H2T A;  3BFM A;  4CH5 A;  1H4S A;  2E1H A;  2I4L A;  1JJC B;  1BBU A;  1H4Q A;  2ZZG A;  1G51 A;  1ASY A;  1G5H A;  4P74 C;  4YP0 A;  3ICA A;  1J5W A;  4HWS A;  1YB3 A;  4XU1 A;  2C7I A;  2ZXF A;  2RHQ B;  4XTV A;  4RDX A;  4WI1 A;  4TTV A;  3V8L A;  2DKG A;  1PYS A;  1EIY B;  1BIA A;  2P0L A;  4K86 A;  2ZNI A;  3HTZ A;  4LNS A;  2DTI A;  4CH4 A;  4H2W A;  2CJA A;  1IL2 A;  4YRO A;  4G85 A;  3UH0 A;  1B70 B;  1WYD A;  4CS2 A;  4RQE A;  11AS A;  4H2V A;  2IY5 B;  3HXZ A;  2RHS A;  1SES A;  1YFR A;  3A31 A;  3L4G A;  3ERR A;  3HXX A;  2QHT A;  3RF1 A;  1EOV A;  3TUP A;  2EJG A;  1WLE A;  4RMF A;  4YRC A;  2ZTG A;  3V7R A;  1RIQ A;  2EAY A;  2CJB A;  4UP9 A;  2DQ0 A;  1USY A;  1E1O A;  4XTU A;  1HC7 A;  4KR2 A;  3A74 A;  4RQF A;  4H2S A;  2ALY A;  3PCO A;  3VBB A;  1B8A A;  4HWO A;  4OLF A;  3R07 A;  4EO4 A;  2ZIN A;  2ZR2 A;  2CJ9 A;  4YCU A;  3HXU A;  4YRL A;  3REX A;  5C52 B;  1ATI A;  4LVK A;  2DXU A;  1E24 A;  3RAC A;  1WU7 A;  4P74 A;  1X01 A;  4CH6 A;  1BIB A;  4P73 C;  2AKW A;  3P8T A;  4G84 A;  4YRT A;  4TVA B;  2EJ9 A;  1WPY A;  2FYK A;  4H2X B;  3VQW A;  2ODR D;  2DXT A;  2G4C A;  1KOG A;  1N9W A;  3P8Y A;  2QHU A;  5E3I A;  4WF2 A;  2A8E A;  3G1Z A;  4XTZ A;  2J3M A;  5ELO A;  1KMM A;  1BBW A;  3TEH A;  1B7Y A;  1LYL A;  4CS3 A;  4YRE A;  2CIM A;  4H02 A;  2EL9 A;  5C53 B;  1NYR A;  1Z7M A;  1H4V B;  2AMC B;  1X2G A;  3HY1 A;  2ZT8 A;  4HWP A;  1JJC A;  4LVI A;  1X56 A;  2J3L A;  4YRR A;  2QHV A;  1H4T A;  4YRG A;  3VQY A;  4WJ4 A;  2DZ9 A;  4P75 C;  5KNN A;  4K87 A;  2E41 A;  3VQV A;  4LVL A;  3V8K A;  3L1A A;  4TQD A;  1E22 A;  1QE0 A;  1L0W A;  2EWN A;  2RHQ A;  1SRY A;  2QHS A;  1YFT A;  4YDQ A;  3UGT A;  3V8J A;  1EIY A;  4P72 C;  2ZZE A;  1NJ2 A;  2XTI A;  2C8M A;  5K1P A;  4KR3 A;  2I4M A;  4YRN A;  3HFZ B;  3REU A;  4ZTZ B;  1YGB A;  1B70 A;  2PMF A;  4PHC A;  1X55 A;  1EVL A;  1NJ1 A;  2ZGW A;  1X54 A;  3LC0 A;  4KQE A;  4YCW A;  3TEG A;  1NYQ A;  4XEO A;  2IY5 A;  2E10 A;  1FYF A;  4Q6G A;  12AS A;  4UP8 A;  3QO5 A;  2DQ3 A;  4YCV A;  2ZIM A;  1G5I A;  4ZIB A;  2Q5I A;  4UPA A;  3E9I A;  4E51 A;  3NEN A;  4XEM A;  3M4P A;  4HWR A;  1KMN A;  3E9H A;  4XU0 A;  4X5O A;  1X2H A;  4YYE A;  4P71 C;  3HY0 A;  4YRM A;  4YRS A;  2DU5 A;  2ARU A;  2ZZF A;  4TQF A;  1WNL A;  3RKX A;  3RKY A;  4HWT A;  4CH3 A;  3LSS A;  3NET A;  2ZT7 A;  1EVK A;  3EFR A;  4P3N A;  1NJ8 A; 
#chains in the Genus database with same CATH homology
 3HRK A;  4P75 A;  3NEM A;  4YRP A;  4J15 A;  4BWA A;  5ELN A;  3A7A A;  3BJU A;  1NJ5 A;  4TVA A;  2E5A A;  2HNI A;  1PYS B;  4H2X A;  1E1T A;  4YRK A;  3W3S A;  3MF1 A;  4AH6 A;  1Z7N A;  2E64 A;  4P72 A;  2CGH A;  3P8V A;  2ZT6 A;  1ADY A;  2Q7H A;  2ARS A;  1QF6 A;  3IKM B;  3HXY A;  5C51 B;  3RIR A;  4WJ3 M;  2EJF A;  4TWA A;  1NJ6 A;  2DU7 A;  3V7C A;  3WQZ A;  2Q7G A;  4HVC A;  4P3P A;  2RHS B;  2AMC A;  4H2Y A;  5K1X A;  4H2U A;  3L4G B;  4K88 A;  2Q7E A;  4EX5 A;  2DZC A;  2ODR C;  2DTO A;  2Q5H A;  5HGQ A;  2DEQ A;  4HT4 A;  3A5Z A;  4PG3 A;  3RGL A;  4XTX A;  3QNE A;  3OD1 A;  3IKL A;  2E3C A;  2DTH A;  4HA8 A;  4ZTU B;  2DDZ A;  4YRJ A;  4XU2 A;  3QTC A;  4YRI A;  3HFV A;  3FJP A;  3A32 A;  2ALY B;  2ZT5 A;  4P71 A;  3PCO B;  3MF2 A;  2ZIO A;  4P73 A;  1GGM A;  4DQ2 A;  4YRF A;  3A5Y A;  3PZC A;  2ZNJ A;  2P5I A;  4YPF A;  2E65 A;  3I7F A;  3LSQ A;  3HFZ A;  1NNH A;  3CMQ A;  3RL6 A;  4LVM A;  3QO8 A;  3A7U A;  1VQZ A;  4UP7 A;  4BW9 A;  2PME A;  1ASZ A;  2I4O A;  3KFU A;  4NCX A;  4LVJ A;  4TVW A;  2AKW B;  2DVE A;  1YFS A;  2I4N A;  1HTT A;  1W66 A;  1SET A;  4OP0 A;  3HXW A;  2DJZ A;  2NS6 A;  1HXD A;  4XU3 A;  3VQX A;  3DSQ A;  3RKW A;  3EFS A;  4XTW A;  3UFG A;  1C0A A;  1WQW A;  2ART A;  3A7R A;  2ZR3 A;  4TVY A;  3M4Q A;  2ZCE A;  3MEY A;  3MQZ A;  3RUX A;  5F5W A;  4CS4 A;  1EFW A;  1USY C;  3IAL A;  1B76 A;  1WQ7 A;  3L2Z A;  4L87 A;  4O2D A;  3HXV A;  3IG2 A;  1ADJ A;  4YRQ A;  3TEH B;  1EQR A;  3QO7 A;  4XTY A;  3UGQ A;  3V7S A;  1B7Y B;  4DPG A;  4P3O A;  4Q15 A;  2XGT A;  1SER A;  3NEL A;  3HRI A;  4H2T A;  3BFM A;  4CH5 A;  1H4S A;  2E1H A;  2I4L A;  1JJC B;  1BBU A;  1H4Q A;  2ZZG A;  1G51 A;  1ASY A;  1G5H A;  4P74 C;  4YP0 A;  3ICA A;  1J5W A;  4HWS A;  1YB3 A;  4XU1 A;  2C7I A;  2ZXF A;  2RHQ B;  4XTV A;  4RDX A;  4WI1 A;  4TTV A;  3V8L A;  2DKG A;  1PYS A;  1EIY B;  1BIA A;  2P0L A;  4K86 A;  2ZNI A;  3HTZ A;  4LNS A;  2DTI A;  4CH4 A;  4H2W A;  2CJA A;  1IL2 A;  4YRO A;  4G85 A;  3UH0 A;  1B70 B;  1WYD A;  4CS2 A;  4RQE A;  11AS A;  4H2V A;  2IY5 B;  3HXZ A;  2RHS A;  1SES A;  1YFR A;  3A31 A;  3L4G A;  3ERR A;  3HXX A;  2QHT A;  3RF1 A;  1EOV A;  3TUP A;  2EJG A;  1WLE A;  4RMF A;  4YRC A;  2ZTG A;  3V7R A;  1RIQ A;  2EAY A;  2CJB A;  4UP9 A;  2DQ0 A;  1USY A;  1E1O A;  4XTU A;  1HC7 A;  4KR2 A;  3A74 A;  4RQF A;  4H2S A;  2ALY A;  3PCO A;  3VBB A;  1B8A A;  4HWO A;  4OLF A;  3R07 A;  4EO4 A;  2ZIN A;  2ZR2 A;  2CJ9 A;  4YCU A;  3HXU A;  4YRL A;  3REX A;  5C52 B;  1ATI A;  4LVK A;  2DXU A;  1E24 A;  3RAC A;  1WU7 A;  4P74 A;  1X01 A;  4CH6 A;  1BIB A;  4P73 C;  2AKW A;  3P8T A;  4G84 A;  4YRT A;  4TVA B;  2EJ9 A;  1WPY A;  2FYK A;  4H2X B;  3VQW A;  2ODR D;  2DXT A;  2G4C A;  1KOG A;  1N9W A;  3P8Y A;  2QHU A;  5E3I A;  4WF2 A;  2A8E A;  3G1Z A;  4XTZ A;  2J3M A;  5ELO A;  1KMM A;  1BBW A;  3TEH A;  1B7Y A;  1LYL A;  4CS3 A;  4YRE A;  2CIM A;  4H02 A;  2EL9 A;  5C53 B;  1NYR A;  1Z7M A;  1H4V B;  2AMC B;  1X2G A;  3HY1 A;  2ZT8 A;  4HWP A;  1JJC A;  4LVI A;  1X56 A;  2J3L A;  4YRR A;  2QHV A;  1H4T A;  4YRG A;  3VQY A;  4WJ4 A;  2DZ9 A;  4P75 C;  5KNN A;  4K87 A;  2E41 A;  3VQV A;  4LVL A;  3V8K A;  3L1A A;  4TQD A;  1E22 A;  1QE0 A;  1L0W A;  2EWN A;  2RHQ A;  1SRY A;  2QHS A;  1YFT A;  4YDQ A;  3UGT A;  3V8J A;  1EIY A;  4P72 C;  2ZZE A;  1NJ2 A;  2XTI A;  2C8M A;  5K1P A;  4KR3 A;  2I4M A;  4YRN A;  3HFZ B;  3REU A;  4ZTZ B;  1YGB A;  1B70 A;  2PMF A;  4PHC A;  1X55 A;  1EVL A;  1NJ1 A;  2ZGW A;  1X54 A;  3LC0 A;  4KQE A;  4YCW A;  3TEG A;  1NYQ A;  4XEO A;  2IY5 A;  2E10 A;  1FYF A;  4Q6G A;  12AS A;  4UP8 A;  3QO5 A;  2DQ3 A;  4YCV A;  2ZIM A;  1G5I A;  4ZIB A;  2Q5I A;  4UPA A;  3E9I A;  4E51 A;  3NEN A;  4XEM A;  3M4P A;  4HWR A;  1KMN A;  3E9H A;  4XU0 A;  4X5O A;  1X2H A;  4YYE A;  4P71 C;  3HY0 A;  4YRM A;  4YRS A;  2DU5 A;  2ARU A;  2ZZF A;  4TQF A;  1WNL A;  3RKX A;  3RKY A;  4HWT A;  4CH3 A;  3LSS A;  3NET A;  2ZT7 A;  1EVK A;  3EFR A;  4P3N A;  1NJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...