1YFRA

Crystal structure of alanyl-trna synthetase in complex with atp and magnesium
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
457
structure length
448
Chain Sequence
b'SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 137
structure length 448
sequence length 457
chains with identical sequence B
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1yfrA01
1BBWA 1N9WA 1YFTA 4WJ3M 5KNNA 2EAYA 1SESA 3W3SA 3IKLA 2DZ9A 3RKXA 4XTXA 4X5OA 3NELA 2ARUA 2QHTA 2I4NA 3BFMA 3L4GB 2DDZA 2ZT5A 4YPFA 2DTOA 2RHQB 2AKWB 2I4LA 12ASA 1WLEA 1YB3A 3RF1A 1SERA 2E10A 3HFZA 1EVKA 3MEYA 4YP0A 4CH6A 2EJGA 1WPYA 3OD1A 5K1XA 3IALA 5ELNA 2E65A 3MF1A 2DKGA 4XU0A 4UP8A 4EX5A 3G1ZA 4HA8A 4XTYA 3TUPA 3VQXA 3HFZB 3A7AA 4TVAA 3RUXA 1SETA 4H2XA 1E22A 4H02A 4TVWA 1L0WA 4CS4A 1NJ8A 4BW9A 1RIQA 3E9IA 1JJCA 3HXUA 3P8VA 1NJ2A 4TQFA 1Z7MA 2QHUA 2ZT7A 4LNSA 1E1OA 4AH6A 3V8LA 4TVAB 2RHSA 4H2XB 3I7FA 4YRFA 2Q7EA 1E24A 2CJBA 3V7CA 2ZZEA 2I4OA 4YCVA 4HWSA 4P71A 4O2DA 3M4QA 3EFRA 3TEGA 3M4PA 2RHSB 2ZNIA 1ADJA 4P3PA 2DU5A 4KQEA 1NNHA 2P0LA 3A5ZA 3HY1A 3RACA 3PZCA 1C0AA 4YCWA 2ZCEA 4YRRA 3VQVA 2E41A 2QHVA 4Q15A 2ZGWA 3RKWA 1HC7A 4WF2A 4G85A 1PYSB 4CH4A 4K86A 1GGMA 1J5WA 4HWPA 2ODRC 1H4SA 4H2TA 4K87A 3L4GA 4TQDA 3MF2A 2XGTA 1B7YB 1USYC 1QF6A 3EFSA 2RHQA 3PCOB 3RKYA 3LC0A 1NJ5A 2AKWA 4YRPA 2DQ3A 1WQWA 2J3LA 2ARSA 2Q7GA 1VQZA 2E64A 1ADYA 4H2WA 1X56A 2ARTA 4ZIBA 1BIBA 3QO7A 4CS2A 4E51A 2HNIA 2ODRD 3FJPA 4P3OA 4YRKA 4PHCA 2PMEA 3HTZA 3QO5A 4NCXA 3REUA 1ATIA 4H2SA 4RQEA 3V7SA 3P8YA 4YRSA 1H4TA 3V8JA 4P73A 4PG3A 4XTUA 2J3MA 4UPAA 4WJ4A 4P74C 3UFGA 1IL2A 1NJ1A 3KFUA 4J15A 1HXDA 1WYDA 2ZR2A 4HWTA 4HVCA 1X55A 4YDQA 3RIRA 1X01A 4TWAA 4OP0A 3A32A 3QNEA 1KMMA 2Q5IA 2EJFA 1EQRA 2ALYA 4YRGA 4YRJA 1KMNA 5F5WA 1ASYA 4YRNA 4YRLA 3HRIA 4K88A 4RMFA 2DXTA 4P3NA 2DVEA 2IY5A 3QTCA 2ZTGA 1USYA 3NEMA 1ASZA 4RDXA 2CJAA 3HRKA 1B70B 4WI1A 4YRTA 4DQ2A 2ALYB 1PYSA 3UGQA 3QO8A 3HXVA 2XTIA 1EVLA 4H2YA 2DTHA 4YROA 1EIYA 2IY5B 3P8TA 1B7YA 1G5HA 4G84A 2ZXFA 3PCOA 2ZZFA 4XTZA 3A7UA 3RGLA 2PMFA 1YGBA 3E9HA 1QE0A 3A5YA 5C52B 1SRYA 2CJ9A 1EIYB 2ZINA 3A74A 2DU7A 4XTWA 4Q6GA 3ICAA 2DQ0A 2Q7HA 1B76A 1EOVA 1NJ6A 1NYRA 2ZNJA 3DSQA 3NETA 3NENA 4YRCA 3VQYA 1HTTA 5C51B 2DZCA 2AMCB 2ZIMA 3UH0A 4YRQA 3REXA 4UP9A 2I4MA 3RL6A 3HXWA 1X2HA 4L87A 4YCUA 3VQWA 4CS3A 2E5AA 1YFRA 3R07A 2C8MA 4HWRA 4KR2A 1WQ7A 5ELOA 4CH3A 3A31A 2ZIOA 1KOGA 2E1HA 4P75C 1W66A 2ZT8A 4BWAA 4P72C 1WNLA 2EL9A 3V8KA 4H2VA 3IKMB 4YRMA 1EFWA 3HY0A 3TEHA 3WQZA 3HXYA 3VBBA 2CIMA 1B70A 4XU3A 4CH5A 11ASA 3L2ZA 1Z7NA 1H4VB 4TVYA 2DXUA 1NYQA 1X2GA 1LYLA 2ZZGA 3TEHB 2QHSA 4XEMA 4XTVA 2CGHA 4YYEA 3LSSA 2DJZA 2Q5HA 2C7IA 1G5IA 2FYKA 2G4CA 3IG2A 4EO4A 3A7RA 4OLFA 4HWOA 1JJCB 3ERRA 4P73C 2EJ9A 3BJUA 3V7RA 2E3CA 5C53B 4ZTZB 4XEOA 3UGTA 4YRIA 3LSQA 1X54A 1FYFA 1G51A 2DTIA 2ZR3A 4XU2A 4DPGA 3CMQA 4RQFA 4H2UA 5K1PA 4KR3A 3HXZA 2AMCA 1BBUA 4TTVA 1YFSA 4ZTUB 1E1TA 3L1AA 4XU1A 4UP7A 3HXXA 2P5IA 1WU7A 3HFVA 4P75A 4YREA 2DEQA 5E3IA 4P72A 1B8AA 5HGQA 4P74A 1H4QA 2EWNA 1BIAA 4P71C 2ZT6A
chains in the Genus database with same CATH superfamily
1BBWA 1N9WA 1YFTA 4WJ3M 5KNNA 2EAYA 1SESA 3W3SA 3IKLA 2DZ9A 3RKXA 4XTXA 4X5OA 3NELA 2ARUA 2QHTA 2I4NA 3BFMA 3L4GB 2DDZA 2ZT5A 4YPFA 2DTOA 2RHQB 2AKWB 2I4LA 12ASA 1WLEA 1YB3A 3RF1A 1SERA 2E10A 3HFZA 1EVKA 3MEYA 4YP0A 4CH6A 2EJGA 1WPYA 3OD1A 5K1XA 3IALA 4LVIA 5ELNA 2E65A 3MF1A 2DKGA 4XU0A 4UP8A 4EX5A 3G1ZA 4HA8A 4XTYA 3TUPA 3VQXA 3HFZB 3A7AA 4TVAA 3RUXA 1SETA 4H2XA 1E22A 4H02A 4TVWA 1L0WA 4CS4A 1NJ8A 4BW9A 1RIQA 3E9IA 1JJCA 3HXUA 3P8VA 1NJ2A 4TQFA 1Z7MA 2QHUA 2ZT7A 4LNSA 1E1OA 4AH6A 3V8LA 4TVAB 2RHSA 4H2XB 3I7FA 4YRFA 2Q7EA 1E24A 2CJBA 3V7CA 2ZZEA 2I4OA 4YCVA 4HWSA 4P71A 4O2DA 3M4QA 3EFRA 3TEGA 3M4PA 2RHSB 2ZNIA 1ADJA 4P3PA 2DU5A 4KQEA 1NNHA 2P0LA 3A5ZA 3HY1A 3RACA 3PZCA 1C0AA 4YCWA 2ZCEA 4YRRA 3VQVA 2E41A 2QHVA 4Q15A 2ZGWA 3RKWA 1HC7A 4WF2A 4G85A 1PYSB 4CH4A 4K86A 1GGMA 1J5WA 4HWPA 2ODRC 1H4SA 4H2TA 4K87A 3L4GA 4TQDA 3MF2A 2XGTA 1B7YB 1USYC 1QF6A 3EFSA 2RHQA 3PCOB 3RKYA 3LC0A 1NJ5A 2AKWA 4YRPA 2DQ3A 1WQWA 2J3LA 2ARSA 2Q7GA 1VQZA 2E64A 1ADYA 4H2WA 1X56A 2ARTA 4ZIBA 1BIBA 3QO7A 4CS2A 4E51A 2HNIA 2ODRD 3FJPA 2A8EA 4P3OA 4YRKA 4PHCA 4LVJA 2PMEA 3HTZA 3QO5A 4NCXA 4LVKA 3REUA 1ATIA 4H2SA 4RQEA 3V7SA 3P8YA 4YRSA 1H4TA 3V8JA 4P73A 4PG3A 4XTUA 2J3MA 4UPAA 4WJ4A 4P74C 3UFGA 1IL2A 1NJ1A 3KFUA 4J15A 1HXDA 1WYDA 2ZR2A 4HWTA 4HVCA 1X55A 4YDQA 3RIRA 1X01A 4TWAA 4OP0A 3A32A 3QNEA 1KMMA 2Q5IA 2EJFA 1EQRA 2ALYA 4YRGA 4YRJA 1KMNA 5F5WA 1ASYA 4YRNA 4YRLA 4LVMA 3HRIA 4K88A 4RMFA 2DXTA 4P3NA 2DVEA 2IY5A 3QTCA 2ZTGA 1USYA 3NEMA 1ASZA 4RDXA 2CJAA 3HRKA 1B70B 4WI1A 4YRTA 4DQ2A 2ALYB 1PYSA 3UGQA 3QO8A 3HXVA 2XTIA 1EVLA 4H2YA 2DTHA 4YROA 1EIYA 2IY5B 3P8TA 1B7YA 1G5HA 4G84A 2ZXFA 3PCOA 2ZZFA 4XTZA 3A7UA 3RGLA 2PMFA 1YGBA 4LVLA 3E9HA 1QE0A 3A5YA 5C52B 1SRYA 4HT4A 2CJ9A 1EIYB 2ZINA 3A74A 2DU7A 4XTWA 4Q6GA 3ICAA 2DQ0A 2Q7HA 1B76A 1EOVA 1NJ6A 1NYRA 2ZNJA 3DSQA 3NETA 3NENA 4YRCA 3VQYA 1HTTA 5C51B 2DZCA 2AMCB 2ZIMA 3UH0A 4YRQA 3REXA 4UP9A 2I4MA 3RL6A 3HXWA 1X2HA 4L87A 4YCUA 3VQWA 4CS3A 2E5AA 1YFRA 3R07A 2C8MA 4HWRA 4KR2A 1WQ7A 5ELOA 4CH3A 3A31A 2ZIOA 1KOGA 2E1HA 4P75C 1W66A 2ZT8A 4BWAA 4P72C 1WNLA 2EL9A 3V8KA 4H2VA 3IKMB 4YRMA 1EFWA 3HY0A 3TEHA 3WQZA 3HXYA 3VBBA 2CIMA 1B70A 4XU3A 4CH5A 11ASA 3L2ZA 1Z7NA 1H4VB 4TVYA 2DXUA 1NYQA 1X2GA 1LYLA 2ZZGA 3TEHB 2QHSA 4XEMA 4XTVA 2CGHA 4YYEA 3LSSA 2DJZA 2Q5HA 2C7IA 1G5IA 2FYKA 2G4CA 3IG2A 4EO4A 3A7RA 4OLFA 4HWOA 1JJCB 3ERRA 4P73C 2EJ9A 2NS6A 3MQZA 3BJUA 3V7RA 2E3CA 5C53B 4ZTZB 4XEOA 3UGTA 4YRIA 3LSQA 1X54A 1FYFA 1G51A 2DTIA 2ZR3A 4XU2A 4DPGA 3CMQA 4RQFA 4H2UA 5K1PA 4KR3A 3HXZA 2AMCA 1BBUA 4TTVA 1YFSA 4ZTUB 1E1TA 3L1AA 4XU1A 4UP7A 3HXXA 2P5IA 1WU7A 3HFVA 4P75A 4YREA 2DEQA 5E3IA 4P72A 1B8AA 5HGQA 4P74A 1H4QA 2EWNA 1BIAA 4P71C 2ZT6A
chains in the Genus database with same CATH topology
1BBWA 1N9WA 1YFTA 4WJ3M 5KNNA 2EAYA 1SESA 3W3SA 3IKLA 2DZ9A 3RKXA 4XTXA 4X5OA 3NELA 2ARUA 2QHTA 2I4NA 3BFMA 3L4GB 2DDZA 2ZT5A 4YPFA 2DTOA 2RHQB 2AKWB 2I4LA 12ASA 1WLEA 1YB3A 3RF1A 1SERA 2E10A 3HFZA 1EVKA 3MEYA 4YP0A 4CH6A 2EJGA 1WPYA 3OD1A 5K1XA 3IALA 4LVIA 5ELNA 2E65A 3MF1A 2DKGA 4XU0A 4UP8A 4EX5A 3G1ZA 4HA8A 4XTYA 3TUPA 3VQXA 3HFZB 3A7AA 4TVAA 3RUXA 1SETA 4H2XA 1E22A 4H02A 4TVWA 1L0WA 4CS4A 1NJ8A 4BW9A 1RIQA 3E9IA 1JJCA 3HXUA 3P8VA 1NJ2A 4TQFA 1Z7MA 2QHUA 2ZT7A 4LNSA 1E1OA 4AH6A 3V8LA 4TVAB 2RHSA 4H2XB 3I7FA 4YRFA 2Q7EA 1E24A 2CJBA 3V7CA 2ZZEA 2I4OA 4YCVA 4HWSA 4P71A 4O2DA 3M4QA 3EFRA 3TEGA 3M4PA 2RHSB 2ZNIA 1ADJA 4P3PA 2DU5A 4KQEA 1NNHA 2P0LA 3A5ZA 3HY1A 3RACA 3PZCA 1C0AA 4YCWA 2ZCEA 4YRRA 3VQVA 2E41A 2QHVA 4Q15A 2ZGWA 3RKWA 1HC7A 4WF2A 4G85A 1PYSB 4CH4A 4K86A 1GGMA 1J5WA 4HWPA 2ODRC 1H4SA 4H2TA 4K87A 3L4GA 4TQDA 3MF2A 2XGTA 1B7YB 1USYC 1QF6A 3EFSA 2RHQA 3PCOB 3RKYA 3LC0A 1NJ5A 2AKWA 4YRPA 2DQ3A 1WQWA 2J3LA 2ARSA 2Q7GA 1VQZA 2E64A 1ADYA 4H2WA 1X56A 2ARTA 4ZIBA 1BIBA 3QO7A 4CS2A 4E51A 2HNIA 2ODRD 3FJPA 2A8EA 4P3OA 4YRKA 4PHCA 4LVJA 2PMEA 3HTZA 3QO5A 4NCXA 4LVKA 3REUA 1ATIA 4H2SA 4RQEA 3V7SA 3P8YA 4YRSA 1H4TA 3V8JA 4P73A 4PG3A 4XTUA 2J3MA 4UPAA 4WJ4A 4P74C 3UFGA 1IL2A 1NJ1A 3KFUA 4J15A 1HXDA 1WYDA 2ZR2A 4HWTA 4HVCA 1X55A 4YDQA 3RIRA 1X01A 4TWAA 4OP0A 3A32A 3QNEA 1KMMA 2Q5IA 2EJFA 1EQRA 2ALYA 4YRGA 4YRJA 1KMNA 5F5WA 1ASYA 4YRNA 4YRLA 4LVMA 3HRIA 4K88A 4RMFA 2DXTA 4P3NA 2DVEA 2IY5A 3QTCA 2ZTGA 1USYA 3NEMA 1ASZA 4RDXA 2CJAA 3HRKA 1B70B 4WI1A 4YRTA 4DQ2A 2ALYB 1PYSA 3UGQA 3QO8A 3HXVA 2XTIA 1EVLA 4H2YA 2DTHA 4YROA 1EIYA 2IY5B 3P8TA 1B7YA 1G5HA 4G84A 2ZXFA 3PCOA 2ZZFA 4XTZA 3A7UA 3RGLA 2PMFA 1YGBA 4LVLA 3E9HA 1QE0A 3A5YA 5C52B 1SRYA 4HT4A 2CJ9A 1EIYB 2ZINA 3A74A 2DU7A 4XTWA 4Q6GA 3ICAA 2DQ0A 2Q7HA 1B76A 1EOVA 1NJ6A 1NYRA 2ZNJA 3DSQA 3NETA 3NENA 4YRCA 3VQYA 1HTTA 5C51B 2DZCA 2AMCB 2ZIMA 3UH0A 4YRQA 3REXA 4UP9A 2I4MA 3RL6A 3HXWA 1X2HA 4L87A 4YCUA 3VQWA 4CS3A 2E5AA 1YFRA 3R07A 2C8MA 4HWRA 4KR2A 1WQ7A 5ELOA 4CH3A 3A31A 2ZIOA 1KOGA 2E1HA 4P75C 1W66A 2ZT8A 4BWAA 4P72C 1WNLA 2EL9A 3V8KA 4H2VA 3IKMB 4YRMA 1EFWA 3HY0A 3TEHA 3WQZA 3HXYA 3VBBA 2CIMA 1B70A 4XU3A 4CH5A 11ASA 3L2ZA 1Z7NA 1H4VB 4TVYA 2DXUA 1NYQA 1X2GA 1LYLA 2ZZGA 3TEHB 2QHSA 4XEMA 4XTVA 2CGHA 4YYEA 3LSSA 2DJZA 2Q5HA 2C7IA 1G5IA 2FYKA 2G4CA 3IG2A 4EO4A 3A7RA 4OLFA 4HWOA 1JJCB 3ERRA 4P73C 2EJ9A 2NS6A 3MQZA 3BJUA 3V7RA 2E3CA 5C53B 4ZTZB 4XEOA 3UGTA 4YRIA 3LSQA 1X54A 1FYFA 1G51A 2DTIA 2ZR3A 4XU2A 4DPGA 3CMQA 4RQFA 4H2UA 5K1PA 4KR3A 3HXZA 2AMCA 1BBUA 4TTVA 1YFSA 4ZTUB 1E1TA 3L1AA 4XU1A 4UP7A 3HXXA 2P5IA 1WU7A 3HFVA 4P75A 4YREA 2DEQA 5E3IA 4P72A 1B8AA 5HGQA 4P74A 1H4QA 2EWNA 1BIAA 4P71C 2ZT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBW A;  1N9W A;  1YFT A;  4WJ3 M;  5KNN A;  2EAY A;  1SES A;  3W3S A;  3IKL A;  2DZ9 A;  3RKX A;  4XTX A;  4X5O A;  3NEL A;  2ARU A;  2QHT A;  2I4N A;  3BFM A;  3L4G B;  2DDZ A;  2ZT5 A;  4YPF A;  2DTO A;  2RHQ B;  2AKW B;  2I4L A;  12AS A;  1WLE A;  1YB3 A;  3RF1 A;  1SER A;  2E10 A;  3HFZ A;  1EVK A;  3MEY A;  4YP0 A;  4CH6 A;  2EJG A;  1WPY A;  3OD1 A;  5K1X A;  3IAL A;  5ELN A;  2E65 A;  3MF1 A;  2DKG A;  4XU0 A;  4UP8 A;  4EX5 A;  3G1Z A;  4HA8 A;  4XTY A;  3TUP A;  3VQX A;  3HFZ B;  3A7A A;  4TVA A;  3RUX A;  1SET A;  4H2X A;  1E22 A;  4H02 A;  4TVW A;  1L0W A;  4CS4 A;  1NJ8 A;  4BW9 A;  1RIQ A;  3E9I A;  1JJC A;  3HXU A;  3P8V A;  1NJ2 A;  4TQF A;  1Z7M A;  2QHU A;  2ZT7 A;  4LNS A;  1E1O A;  4AH6 A;  3V8L A;  4TVA B;  2RHS A;  4H2X B;  3I7F A;  4YRF A;  2Q7E A;  1E24 A;  2CJB A;  3V7C A;  2ZZE A;  2I4O A;  4YCV A;  4HWS A;  4P71 A;  4O2D A;  3M4Q A;  3EFR A;  3TEG A;  3M4P A;  2RHS B;  2ZNI A;  1ADJ A;  4P3P A;  2DU5 A;  4KQE A;  1NNH A;  2P0L A;  3A5Z A;  3HY1 A;  3RAC A;  3PZC A;  1C0A A;  4YCW A;  2ZCE A;  4YRR A;  3VQV A;  2E41 A;  2QHV A;  4Q15 A;  2ZGW A;  3RKW A;  1HC7 A;  4WF2 A;  4G85 A;  1PYS B;  4CH4 A;  4K86 A;  1GGM A;  1J5W A;  4HWP A;  2ODR C;  1H4S A;  4H2T A;  4K87 A;  3L4G A;  4TQD A;  3MF2 A;  2XGT A;  1B7Y B;  1USY C;  1QF6 A;  3EFS A;  2RHQ A;  3PCO B;  3RKY A;  3LC0 A;  1NJ5 A;  2AKW A;  4YRP A;  2DQ3 A;  1WQW A;  2J3L A;  2ARS A;  2Q7G A;  1VQZ A;  2E64 A;  1ADY A;  4H2W A;  1X56 A;  2ART A;  4ZIB A;  1BIB A;  3QO7 A;  4CS2 A;  4E51 A;  2HNI A;  2ODR D;  3FJP A;  4P3O A;  4YRK A;  4PHC A;  2PME A;  3HTZ A;  3QO5 A;  4NCX A;  3REU A;  1ATI A;  4H2S A;  4RQE A;  3V7S A;  3P8Y A;  4YRS A;  1H4T A;  3V8J A;  4P73 A;  4PG3 A;  4XTU A;  2J3M A;  4UPA A;  4WJ4 A;  4P74 C;  3UFG A;  1IL2 A;  1NJ1 A;  3KFU A;  4J15 A;  1HXD A;  1WYD A;  2ZR2 A;  4HWT A;  4HVC A;  1X55 A;  4YDQ A;  3RIR A;  1X01 A;  4TWA A;  4OP0 A;  3A32 A;  3QNE A;  1KMM A;  2Q5I A;  2EJF A;  1EQR A;  2ALY A;  4YRG A;  4YRJ A;  1KMN A;  5F5W A;  1ASY A;  4YRN A;  4YRL A;  3HRI A;  4K88 A;  4RMF A;  2DXT A;  4P3N A;  2DVE A;  2IY5 A;  3QTC A;  2ZTG A;  1USY A;  3NEM A;  1ASZ A;  4RDX A;  2CJA A;  3HRK A;  1B70 B;  4WI1 A;  4YRT A;  4DQ2 A;  2ALY B;  1PYS A;  3UGQ A;  3QO8 A;  3HXV A;  2XTI A;  1EVL A;  4H2Y A;  2DTH A;  4YRO A;  1EIY A;  2IY5 B;  3P8T A;  1B7Y A;  1G5H A;  4G84 A;  2ZXF A;  3PCO A;  2ZZF A;  4XTZ A;  3A7U A;  3RGL A;  2PMF A;  1YGB A;  3E9H A;  1QE0 A;  3A5Y A;  5C52 B;  1SRY A;  2CJ9 A;  1EIY B;  2ZIN A;  3A74 A;  2DU7 A;  4XTW A;  4Q6G A;  3ICA A;  2DQ0 A;  2Q7H A;  1B76 A;  1EOV A;  1NJ6 A;  1NYR A;  2ZNJ A;  3DSQ A;  3NET A;  3NEN A;  4YRC A;  3VQY A;  1HTT A;  5C51 B;  2DZC A;  2AMC B;  2ZIM A;  3UH0 A;  4YRQ A;  3REX A;  4UP9 A;  2I4M A;  3RL6 A;  3HXW A;  1X2H A;  4L87 A;  4YCU A;  3VQW A;  4CS3 A;  2E5A A;  1YFR A;  3R07 A;  2C8M A;  4HWR A;  4KR2 A;  1WQ7 A;  5ELO A;  4CH3 A;  3A31 A;  2ZIO A;  1KOG A;  2E1H A;  4P75 C;  1W66 A;  2ZT8 A;  4BWA A;  4P72 C;  1WNL A;  2EL9 A;  3V8K A;  4H2V A;  3IKM B;  4YRM A;  1EFW A;  3HY0 A;  3TEH A;  3WQZ A;  3HXY A;  3VBB A;  2CIM A;  1B70 A;  4XU3 A;  4CH5 A;  11AS A;  3L2Z A;  1Z7N A;  1H4V B;  4TVY A;  2DXU A;  1NYQ A;  1X2G A;  1LYL A;  2ZZG A;  3TEH B;  2QHS A;  4XEM A;  4XTV A;  2CGH A;  4YYE A;  3LSS A;  2DJZ A;  2Q5H A;  2C7I A;  1G5I A;  2FYK A;  2G4C A;  3IG2 A;  4EO4 A;  3A7R A;  4OLF A;  4HWO A;  1JJC B;  3ERR A;  4P73 C;  2EJ9 A;  3BJU A;  3V7R A;  2E3C A;  5C53 B;  4ZTZ B;  4XEO A;  3UGT A;  4YRI A;  3LSQ A;  1X54 A;  1FYF A;  1G51 A;  2DTI A;  2ZR3 A;  4XU2 A;  4DPG A;  3CMQ A;  4RQF A;  4H2U A;  5K1P A;  4KR3 A;  3HXZ A;  2AMC A;  1BBU A;  4TTV A;  1YFS A;  4ZTU B;  1E1T A;  3L1A A;  4XU1 A;  4UP7 A;  3HXX A;  2P5I A;  1WU7 A;  3HFV A;  4P75 A;  4YRE A;  2DEQ A;  5E3I A;  4P72 A;  1B8A A;  5HGQ A;  4P74 A;  1H4Q A;  2EWN A;  1BIA A;  4P71 C;  2ZT6 A; 
#chains in the Genus database with same CATH topology
 1BBW A;  1N9W A;  1YFT A;  4WJ3 M;  5KNN A;  2EAY A;  1SES A;  3W3S A;  3IKL A;  2DZ9 A;  3RKX A;  4XTX A;  4X5O A;  3NEL A;  2ARU A;  2QHT A;  2I4N A;  3BFM A;  3L4G B;  2DDZ A;  2ZT5 A;  4YPF A;  2DTO A;  2RHQ B;  2AKW B;  2I4L A;  12AS A;  1WLE A;  1YB3 A;  3RF1 A;  1SER A;  2E10 A;  3HFZ A;  1EVK A;  3MEY A;  4YP0 A;  4CH6 A;  2EJG A;  1WPY A;  3OD1 A;  5K1X A;  3IAL A;  4LVI A;  5ELN A;  2E65 A;  3MF1 A;  2DKG A;  4XU0 A;  4UP8 A;  4EX5 A;  3G1Z A;  4HA8 A;  4XTY A;  3TUP A;  3VQX A;  3HFZ B;  3A7A A;  4TVA A;  3RUX A;  1SET A;  4H2X A;  1E22 A;  4H02 A;  4TVW A;  1L0W A;  4CS4 A;  1NJ8 A;  4BW9 A;  1RIQ A;  3E9I A;  1JJC A;  3HXU A;  3P8V A;  1NJ2 A;  4TQF A;  1Z7M A;  2QHU A;  2ZT7 A;  4LNS A;  1E1O A;  4AH6 A;  3V8L A;  4TVA B;  2RHS A;  4H2X B;  3I7F A;  4YRF A;  2Q7E A;  1E24 A;  2CJB A;  3V7C A;  2ZZE A;  2I4O A;  4YCV A;  4HWS A;  4P71 A;  4O2D A;  3M4Q A;  3EFR A;  3TEG A;  3M4P A;  2RHS B;  2ZNI A;  1ADJ A;  4P3P A;  2DU5 A;  4KQE A;  1NNH A;  2P0L A;  3A5Z A;  3HY1 A;  3RAC A;  3PZC A;  1C0A A;  4YCW A;  2ZCE A;  4YRR A;  3VQV A;  2E41 A;  2QHV A;  4Q15 A;  2ZGW A;  3RKW A;  1HC7 A;  4WF2 A;  4G85 A;  1PYS B;  4CH4 A;  4K86 A;  1GGM A;  1J5W A;  4HWP A;  2ODR C;  1H4S A;  4H2T A;  4K87 A;  3L4G A;  4TQD A;  3MF2 A;  2XGT A;  1B7Y B;  1USY C;  1QF6 A;  3EFS A;  2RHQ A;  3PCO B;  3RKY A;  3LC0 A;  1NJ5 A;  2AKW A;  4YRP A;  2DQ3 A;  1WQW A;  2J3L A;  2ARS A;  2Q7G A;  1VQZ A;  2E64 A;  1ADY A;  4H2W A;  1X56 A;  2ART A;  4ZIB A;  1BIB A;  3QO7 A;  4CS2 A;  4E51 A;  2HNI A;  2ODR D;  3FJP A;  2A8E A;  4P3O A;  4YRK A;  4PHC A;  4LVJ A;  2PME A;  3HTZ A;  3QO5 A;  4NCX A;  4LVK A;  3REU A;  1ATI A;  4H2S A;  4RQE A;  3V7S A;  3P8Y A;  4YRS A;  1H4T A;  3V8J A;  4P73 A;  4PG3 A;  4XTU A;  2J3M A;  4UPA A;  4WJ4 A;  4P74 C;  3UFG A;  1IL2 A;  1NJ1 A;  3KFU A;  4J15 A;  1HXD A;  1WYD A;  2ZR2 A;  4HWT A;  4HVC A;  1X55 A;  4YDQ A;  3RIR A;  1X01 A;  4TWA A;  4OP0 A;  3A32 A;  3QNE A;  1KMM A;  2Q5I A;  2EJF A;  1EQR A;  2ALY A;  4YRG A;  4YRJ A;  1KMN A;  5F5W A;  1ASY A;  4YRN A;  4YRL A;  4LVM A;  3HRI A;  4K88 A;  4RMF A;  2DXT A;  4P3N A;  2DVE A;  2IY5 A;  3QTC A;  2ZTG A;  1USY A;  3NEM A;  1ASZ A;  4RDX A;  2CJA A;  3HRK A;  1B70 B;  4WI1 A;  4YRT A;  4DQ2 A;  2ALY B;  1PYS A;  3UGQ A;  3QO8 A;  3HXV A;  2XTI A;  1EVL A;  4H2Y A;  2DTH A;  4YRO A;  1EIY A;  2IY5 B;  3P8T A;  1B7Y A;  1G5H A;  4G84 A;  2ZXF A;  3PCO A;  2ZZF A;  4XTZ A;  3A7U A;  3RGL A;  2PMF A;  1YGB A;  4LVL A;  3E9H A;  1QE0 A;  3A5Y A;  5C52 B;  1SRY A;  4HT4 A;  2CJ9 A;  1EIY B;  2ZIN A;  3A74 A;  2DU7 A;  4XTW A;  4Q6G A;  3ICA A;  2DQ0 A;  2Q7H A;  1B76 A;  1EOV A;  1NJ6 A;  1NYR A;  2ZNJ A;  3DSQ A;  3NET A;  3NEN A;  4YRC A;  3VQY A;  1HTT A;  5C51 B;  2DZC A;  2AMC B;  2ZIM A;  3UH0 A;  4YRQ A;  3REX A;  4UP9 A;  2I4M A;  3RL6 A;  3HXW A;  1X2H A;  4L87 A;  4YCU A;  3VQW A;  4CS3 A;  2E5A A;  1YFR A;  3R07 A;  2C8M A;  4HWR A;  4KR2 A;  1WQ7 A;  5ELO A;  4CH3 A;  3A31 A;  2ZIO A;  1KOG A;  2E1H A;  4P75 C;  1W66 A;  2ZT8 A;  4BWA A;  4P72 C;  1WNL A;  2EL9 A;  3V8K A;  4H2V A;  3IKM B;  4YRM A;  1EFW A;  3HY0 A;  3TEH A;  3WQZ A;  3HXY A;  3VBB A;  2CIM A;  1B70 A;  4XU3 A;  4CH5 A;  11AS A;  3L2Z A;  1Z7N A;  1H4V B;  4TVY A;  2DXU A;  1NYQ A;  1X2G A;  1LYL A;  2ZZG A;  3TEH B;  2QHS A;  4XEM A;  4XTV A;  2CGH A;  4YYE A;  3LSS A;  2DJZ A;  2Q5H A;  2C7I A;  1G5I A;  2FYK A;  2G4C A;  3IG2 A;  4EO4 A;  3A7R A;  4OLF A;  4HWO A;  1JJC B;  3ERR A;  4P73 C;  2EJ9 A;  2NS6 A;  3MQZ A;  3BJU A;  3V7R A;  2E3C A;  5C53 B;  4ZTZ B;  4XEO A;  3UGT A;  4YRI A;  3LSQ A;  1X54 A;  1FYF A;  1G51 A;  2DTI A;  2ZR3 A;  4XU2 A;  4DPG A;  3CMQ A;  4RQF A;  4H2U A;  5K1P A;  4KR3 A;  3HXZ A;  2AMC A;  1BBU A;  4TTV A;  1YFS A;  4ZTU B;  1E1T A;  3L1A A;  4XU1 A;  4UP7 A;  3HXX A;  2P5I A;  1WU7 A;  3HFV A;  4P75 A;  4YRE A;  2DEQ A;  5E3I A;  4P72 A;  1B8A A;  5HGQ A;  4P74 A;  1H4Q A;  2EWN A;  1BIA A;  4P71 C;  2ZT6 A; 
#chains in the Genus database with same CATH homology
 1BBW A;  1N9W A;  1YFT A;  4WJ3 M;  5KNN A;  2EAY A;  1SES A;  3W3S A;  3IKL A;  2DZ9 A;  3RKX A;  4XTX A;  4X5O A;  3NEL A;  2ARU A;  2QHT A;  2I4N A;  3BFM A;  3L4G B;  2DDZ A;  2ZT5 A;  4YPF A;  2DTO A;  2RHQ B;  2AKW B;  2I4L A;  12AS A;  1WLE A;  1YB3 A;  3RF1 A;  1SER A;  2E10 A;  3HFZ A;  1EVK A;  3MEY A;  4YP0 A;  4CH6 A;  2EJG A;  1WPY A;  3OD1 A;  5K1X A;  3IAL A;  4LVI A;  5ELN A;  2E65 A;  3MF1 A;  2DKG A;  4XU0 A;  4UP8 A;  4EX5 A;  3G1Z A;  4HA8 A;  4XTY A;  3TUP A;  3VQX A;  3HFZ B;  3A7A A;  4TVA A;  3RUX A;  1SET A;  4H2X A;  1E22 A;  4H02 A;  4TVW A;  1L0W A;  4CS4 A;  1NJ8 A;  4BW9 A;  1RIQ A;  3E9I A;  1JJC A;  3HXU A;  3P8V A;  1NJ2 A;  4TQF A;  1Z7M A;  2QHU A;  2ZT7 A;  4LNS A;  1E1O A;  4AH6 A;  3V8L A;  4TVA B;  2RHS A;  4H2X B;  3I7F A;  4YRF A;  2Q7E A;  1E24 A;  2CJB A;  3V7C A;  2ZZE A;  2I4O A;  4YCV A;  4HWS A;  4P71 A;  4O2D A;  3M4Q A;  3EFR A;  3TEG A;  3M4P A;  2RHS B;  2ZNI A;  1ADJ A;  4P3P A;  2DU5 A;  4KQE A;  1NNH A;  2P0L A;  3A5Z A;  3HY1 A;  3RAC A;  3PZC A;  1C0A A;  4YCW A;  2ZCE A;  4YRR A;  3VQV A;  2E41 A;  2QHV A;  4Q15 A;  2ZGW A;  3RKW A;  1HC7 A;  4WF2 A;  4G85 A;  1PYS B;  4CH4 A;  4K86 A;  1GGM A;  1J5W A;  4HWP A;  2ODR C;  1H4S A;  4H2T A;  4K87 A;  3L4G A;  4TQD A;  3MF2 A;  2XGT A;  1B7Y B;  1USY C;  1QF6 A;  3EFS A;  2RHQ A;  3PCO B;  3RKY A;  3LC0 A;  1NJ5 A;  2AKW A;  4YRP A;  2DQ3 A;  1WQW A;  2J3L A;  2ARS A;  2Q7G A;  1VQZ A;  2E64 A;  1ADY A;  4H2W A;  1X56 A;  2ART A;  4ZIB A;  1BIB A;  3QO7 A;  4CS2 A;  4E51 A;  2HNI A;  2ODR D;  3FJP A;  2A8E A;  4P3O A;  4YRK A;  4PHC A;  4LVJ A;  2PME A;  3HTZ A;  3QO5 A;  4NCX A;  4LVK A;  3REU A;  1ATI A;  4H2S A;  4RQE A;  3V7S A;  3P8Y A;  4YRS A;  1H4T A;  3V8J A;  4P73 A;  4PG3 A;  4XTU A;  2J3M A;  4UPA A;  4WJ4 A;  4P74 C;  3UFG A;  1IL2 A;  1NJ1 A;  3KFU A;  4J15 A;  1HXD A;  1WYD A;  2ZR2 A;  4HWT A;  4HVC A;  1X55 A;  4YDQ A;  3RIR A;  1X01 A;  4TWA A;  4OP0 A;  3A32 A;  3QNE A;  1KMM A;  2Q5I A;  2EJF A;  1EQR A;  2ALY A;  4YRG A;  4YRJ A;  1KMN A;  5F5W A;  1ASY A;  4YRN A;  4YRL A;  4LVM A;  3HRI A;  4K88 A;  4RMF A;  2DXT A;  4P3N A;  2DVE A;  2IY5 A;  3QTC A;  2ZTG A;  1USY A;  3NEM A;  1ASZ A;  4RDX A;  2CJA A;  3HRK A;  1B70 B;  4WI1 A;  4YRT A;  4DQ2 A;  2ALY B;  1PYS A;  3UGQ A;  3QO8 A;  3HXV A;  2XTI A;  1EVL A;  4H2Y A;  2DTH A;  4YRO A;  1EIY A;  2IY5 B;  3P8T A;  1B7Y A;  1G5H A;  4G84 A;  2ZXF A;  3PCO A;  2ZZF A;  4XTZ A;  3A7U A;  3RGL A;  2PMF A;  1YGB A;  4LVL A;  3E9H A;  1QE0 A;  3A5Y A;  5C52 B;  1SRY A;  4HT4 A;  2CJ9 A;  1EIY B;  2ZIN A;  3A74 A;  2DU7 A;  4XTW A;  4Q6G A;  3ICA A;  2DQ0 A;  2Q7H A;  1B76 A;  1EOV A;  1NJ6 A;  1NYR A;  2ZNJ A;  3DSQ A;  3NET A;  3NEN A;  4YRC A;  3VQY A;  1HTT A;  5C51 B;  2DZC A;  2AMC B;  2ZIM A;  3UH0 A;  4YRQ A;  3REX A;  4UP9 A;  2I4M A;  3RL6 A;  3HXW A;  1X2H A;  4L87 A;  4YCU A;  3VQW A;  4CS3 A;  2E5A A;  1YFR A;  3R07 A;  2C8M A;  4HWR A;  4KR2 A;  1WQ7 A;  5ELO A;  4CH3 A;  3A31 A;  2ZIO A;  1KOG A;  2E1H A;  4P75 C;  1W66 A;  2ZT8 A;  4BWA A;  4P72 C;  1WNL A;  2EL9 A;  3V8K A;  4H2V A;  3IKM B;  4YRM A;  1EFW A;  3HY0 A;  3TEH A;  3WQZ A;  3HXY A;  3VBB A;  2CIM A;  1B70 A;  4XU3 A;  4CH5 A;  11AS A;  3L2Z A;  1Z7N A;  1H4V B;  4TVY A;  2DXU A;  1NYQ A;  1X2G A;  1LYL A;  2ZZG A;  3TEH B;  2QHS A;  4XEM A;  4XTV A;  2CGH A;  4YYE A;  3LSS A;  2DJZ A;  2Q5H A;  2C7I A;  1G5I A;  2FYK A;  2G4C A;  3IG2 A;  4EO4 A;  3A7R A;  4OLF A;  4HWO A;  1JJC B;  3ERR A;  4P73 C;  2EJ9 A;  2NS6 A;  3MQZ A;  3BJU A;  3V7R A;  2E3C A;  5C53 B;  4ZTZ B;  4XEO A;  3UGT A;  4YRI A;  3LSQ A;  1X54 A;  1FYF A;  1G51 A;  2DTI A;  2ZR3 A;  4XU2 A;  4DPG A;  3CMQ A;  4RQF A;  4H2U A;  5K1P A;  4KR3 A;  3HXZ A;  2AMC A;  1BBU A;  4TTV A;  1YFS A;  4ZTU B;  1E1T A;  3L1A A;  4XU1 A;  4UP7 A;  3HXX A;  2P5I A;  1WU7 A;  3HFV A;  4P75 A;  4YRE A;  2DEQ A;  5E3I A;  4P72 A;  1B8A A;  5HGQ A;  4P74 A;  1H4Q A;  2EWN A;  1BIA A;  4P71 C;  2ZT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...