2EJ9A

Crystal structure of biotin protein ligase from methanococcus jannaschii
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
237
structure length
237
Chain Sequence
b'MEIIHLSEIDSTNDYAKELAKEGKRNFIVLADKQNNGKGRWGRVWYSDEGGLYFSMVLDSKLYNPKVINLLVPICIIEVLKNYVDKELGLKFPNDIMVKVNDNYKKLGGILTELTDDYMIIGIGINVNNQIRNEIREIAISLKEITGKELDKVEILSNFLKTFESYLEKLKNKEIDDYEILKKYKKYSITIGKQVKILLSNNEIITGKVYDIDFDGIVLGTEKGIERIPSGICIHVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative biotin ligase
publication title Crystal Structure Of Biotin Protein Ligase From Methanococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
total genus 74
structure length 237
sequence length 237
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ej9A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ej9A01
3PZCA 4M7DC 3LSSA 4BWAA 5GANd 3JB9D 1KQ2A 3G1ZA 3JCMd 2ALYA 2RHSB 3HXXA 4UP7A 4X5OA 4P74C 2ZT8A 1I8FA 4H2XB 4M77A 5LJ5d 2DTOA 2P5IA 1EVKA 1G5HA 4X9CA 2CIMA 1EOVA 4F7UF 4G84A 4YDQA 4RQEA 5GAN4 1JRIA 1PYSB 4M7DE 4M75B 4XU3A 4HWRA 3HY0A 1NNHA 1QE0A 4NL3A 5GAMj 3HRKA 3M4GA 2AKWB 4C92F 2DU5A 3RESA 4KR3A 1X55A 4HWTA 4OP0A 4F7UA 2I4OA 2CJ9A 4YRFA 5GMKh 2DZ9A 4M75G 3JCMh 5GAN2 1JJCB 3A7AA 4XTVA 3R07A 2ZXFA 4C92A 1G5IA 4YRPA 2IY5A 1Z7MA 2AMCB 3LC0A 4XU1A 2EWNA 4PJOA 5LJ3d 4WJ3M 2I4LA 4M78B 5GANf 5GAOp 4WI1A 3RKWA 1GGMA 4V2SA 5ELNA 3NENA 4N0AC 1D3BB 5LJ5f 3SWNC 1N9RA 4WF2A 2K57A 3HFZA 4NL2A 3E9HA 1YCYA 4JRKA 4H2TA 4M78G 4YRJA 4PJOD 5HGQA 1NJ8A 2I4MA 5GAN5 3A7RA 4DQ2A 1KMMA 2ALYB 4CS4A 4C8QB 3FJPA 4EMKA 2I4NA 4TWAA 2PMEA 4CH5A 4HWOA 4M77B 5LJ3h 1YGBA 5K1PA 1X56A 2RHQA 4KR2A 4P71C 5GAOq 3NETA 1H641 4EO4A 4G85A 4XEMA 4J5YA 1YFRA 2DQ0A 2QHTA 3FB9A 4C8QG 2J3MA 2RA2A 3P8VA 1WU7A 1H4SA 3RL6A 2E41A 4M77G 3RGLA 3DSQA 1WPYA 11ASA 1ASZA 3W3SA 4M7AB 4PNOA 1G51A 2ODRD 4YRTA 2YHTA 3JB9F 4P3OA 1ADYA 1HK9A 4CS2A 2DVEA 3JCMW 2DZCA 1EIYB 2P0LA 3V7RA 2C7IA 1EVLA 1WQWA 5ELOA 4C92B 2QHVA 3V8LA 3VU3C 5GAOm 1H4QA 4CS3A 3TUPA 4M75C 1M8VA 3JCMQ 2E5AA 4HWPA 2E64A 3PGGA 4M7AG 1I5LA 1B7YA 1USYC 1HC7A 3RF1A 3JCMg 2CGHA 5C52B 3QSUA 5GAOr 2ARSA 5LJ5g 4C92G 4E51A 3PCOA 4TVYA 1LYLA 3I7FA 2DKGA 2J3LA 2ZTGA 2DU7A 4X9DA 3HFVA 2VXFA 4M75E 3HXZA 3M4QA 4YRNA 2JN0A 3QNEA 2EAYA 2CJBA 1X01A 4EMKB 2Q5HA 5GAMh 4BW9A 4HVCA 5GANe 3VBBA 4M78C 1BIAA 4XTZA 3A7UA 3JCMe 3M4PA 2VXEA 2EJ9A 3JCMb 3JB9H 4M7DD 3RACA 1Y96A 5LJ5e 4YCUA 4YPFA 1E24A 1NJ1A 1BBUA 1N9SA 1LOJA 2DJZA 2ZR3A 4M78E 5LJ3g 3VQWA 1B70A 4YYEA 2ZIOA 4PJOF 1EQRA 2ZGWA 3QHSA 3A31A 3QO7A 4HWSA 4K88A 4C8QC 2ZIMA 3JCMP 4HT9A 1E1TA 1SERA 4XTXA 1I4K1 4J6WA 4M77C 2DXUA 2RM4A 4H2SA 2ZNIA 5F5WA 3KFUA 1U1TA 3TEHA 2Q7GA 4YP0A 2EJGA 3SB2A 3V8JA 4N0AA 4XU0A 4C8QE 3JCMf 3HXYA 5LJ3e 4OLFA 3GIBA 1WQ7A 4M77E 4P75C 1NYQA 4YRRA 4M7AC 1TH7A 4H2VA 2XGTA 2RB6A 5GAN3 3FIFA 2E65A 3HXVA 3UFGA 3JB9G 3HY1A 2EL9A 4CH3A 1WNLA 3A5ZA 4TVAA 4C92C 1ADJA 3BJUA 3AHUA 1YFSA 3L2ZA 2HNIA 5GAN8 5GANj 1E1OA 2Q7EA 1X2HA 1YB3A 3L4GA 4H02A 4M7AE 4RDXA 2ZT5A 3NELA 3HRIA 4XTWA 3HXWA 3VQXA 4C92E 3QUIA 2I2LA 4YRGA 3UGQA 1N9WA 4MMKA 2G4CA 1J5WA 5E3IA 4UP9A 5LJ3f 4XQ3A 2ARTA 4M75F 4UPAA 2RHSA 3BDUA 4P73C 1LJOA 4F7UB 2FB7A 4ZTUB 2VC8A 3MF2A 3QO8A 4EMKC 4TVWA 4H2XA 4PG3A 3UGTA 4TQFA 1ATIA 3IKLA 4JLIA 1U1SA 4RQFA 1IL2A 4NOYA 3A74A 4P72A 4PHCA 1PYSA 5GAMd 1EFWA 2IY5B 4M75A 2Y90A 3E9IA 4PJOB 1USYA 2QTXA 4HT8A 4F7UG 5GAOl 3RUXA 4M7DF 1B76A 1M5Q1 4YCVA 4YRQA 4WJ4A 4LNSA 4MMLA 3EFRA 2ZZGA 3HFZB 3INZA 2FYKA 3QTCA 1RIQA 1JJCA 3HTZA 4M75D 4PJOG 4P3NA 3HSBA 4M7DA 4NCXA 1L0WA 3EFSA 3REUA 2DDZA 5GMKm 2AMCA 2QHUA 1B8AA 1SETA 2XTIA 5GMKl 1H4TA 4P74A 3A32A 1VQZA 2DTIA 4Q15A 4JRIA 5GMKe 4QVCA 3UH0A 4KQEA 4RMFA 1D3BA 4C8QF 1MGQA 2RHQB 2YLBA 3P8TA 2DEQA 3BY7A 4ZTZB 4K87A 4XTUA 1NJ2A 4CH6A 4K86A 3RKXA 4A53A 5GAMf 3RKYA 3V8KA 4M78D 3LSQA 4H2WA 4YCWA 3IALA 3IKMB 3NEMA 1FYFA 3ERRA 4C8QA 3JB9I 5DY9A 5C53B 2Q7HA 2DXTA 5CAIA 4L87A 3TEGA 4J6XA 2ZR2A 3QO5A 4M7AF 2ZINA 4YRSA 4A54A 5GAOn 1JBMA 4EX5A 4C8QD 1B34A 1B7YB 4YRLA 4P75A 1BIBA 4M77D 4HA8A 4XEOA 3SWNA 4TTVA 4M7AA 5C51B 4YROA 5GANh 4AH6A 3VQYA 1BBWA 4P3PA 3PCOB 2E1HA 3QO3A 1EIYA 3CMQA 3P8YA 3RERA 4M7DB 5LJ5h 2ARUA 2PMFA 5I21A 3BFMA 4PJOC 1LNXA 4M7AD 5GMKj 4F7UE 1X2GA 4DPGA 4YRCA 4YRMA 1HXDA 4H2YA 4CH4A 3JCMV 4P71A 3REXA 3JCMc 4M7DG 1KMNA 4TQDA 1NJ5A 4YRIA 1Y96B 4C92D 5LJ5j 4Y91A 2ZZFA 5KNNA 4O2DA 3HFNA 1Z7NA 4J15A 2CJAA 5GAMg 3JCMJ 1I81A 2Q5IA 5GAN7 4PJOE 4EMHA 3RIRA 4P73A 5K1XA 1B70B 1E22A 3MEYA 4H2UA 2YLCA 4EMGA 1YFTA 1KOGA 1KQ1A 3V7SA 2DQ3A 3MF1A 3L1AA 5GMKi 2E10A 1WYDA 1WLEA 2ODRC 1ASYA 3TEHB 3JCMX 4ZIBA 3BW1A 3V7CA 1QF6A 1B34B 4XTYA 5GAMe 2ZNJA 2AKWA 1H4VB 4UP8A 5LJ3j 1HTTA 3SWNB 4M78F 2ZZEA 2DTHA 4QVDA 3A5YA 2EJFA 4JUVA 2ZT7A 4YRKA 3OD1A 3WQZA 5GAN6 4P72C 4TVAB 4YREA 3HXUA 2ZCEA 3IG2A 4M78A 5GANg 1NYRA 3ICAA 3HFOA 1SRYA 2RD1A 4J6YA 3L4GB 4RCBA 1NJ6A 2QHSA 4XU2A 12ASA 4RCCA 2E3CA 1W66A 4M77F 2ZT6A 3JB9J 2C8MA 4Q6GA 1X54A 1C0AA 3VQVA 1SESA
chains in the Genus database with same CATH superfamily
4FT2A 4PFZA 4M7DC 2DXCA 1TUDA 2CZ7B 1OU8A 3SDZA 3HXXA 1DJ7B 5IT9E 4LUEA 4II1A 3FLGA 4H2XB 4M77A 5LJ5d 1EVKA 1M2OA 1NG2A 4F7UF 1W2BP 4G84A 1VQKA 2CDTA 4RQEA 1QVGP 1JRIA 1YI2T 1Q81C 1NNHA 1VUBA 1GFCA 2K6DA 2AKWB 3L2VA 4HWTA 2D8HA 1X2QA 2JS0A 2LCSA 2PNIA 5GMKh 4HCBA 4RTYA 3JCMh 1GCQC 3WVEB 3A7AA 3G1JA 4DEYA 2ZXFA 2JOYA 2MWOA 4XU1A 3I5RA 4WJ3M 2I4LA 3IQLA 5GAOp 1WXUA 2RJFA 3MP1A 4HKEA 2DYBA 1Q7YC 2KR3A 1RACB 1OPKA 3FC3A 2E5QA 1V29B 2CT3A 4BDYA 3MEWA 2LJ3A 5LJ5f 4RTWA 1Y07A 3SWNC 1N9RA 2EYQA 2K57A 3E9HA 1YCYA 4JRKA 4DEXA 1M1KC 5GAN5 4Z02A 3A7RA 4C8QB 1M3AA 4CH5A 4HWOA 5LJ3h 4FL6A 2NLUA 2L0AA 5D6YA 2CP6A 4J9FA 4JJNK 1YITT 1YGBA 1X56A 4OMOA 2RHQA 1WFWA 2HMAA 2A37A 1SRMA 1MMGA 3OA6A 3CCEA 2KGTA 2L2PA 1NZ9A 2CUBA 1YFNA 2J3MA 2FZGB 2X35A 4KH1B 2XK0A 1KFZA 3OYAA 2XD0A 4M77G 3HHTB 4OF1A 3DSQA 11ASA 1KQSA 4PNOA 1G51A 2DIGA 2RMOA 3DKMA 3OYJA 2VGNA 2F2VA 3QDFA 3V7RA 1G3TA 1EFNA 1EVLA 5ELOA 1X6GA 1EIFA 4OGEA 3VS6A 3CXCA 1VIEA 1YJWQ 1N5ZA 4E7LA 2OTJA 4M7AG 1B7YA 2X4WA 3Q1JA 4BI3A 2DL5A 5FLXE 4TVYA 1FMVA 2CT4A 4AMCA 2JUFA 4X9DA 1SKUB 3UDCA 2J6OA 2VXFA 1R77A 2GGRA 3GOXA 4B9WA 2JN0A 1M2VB 3QNEA 4OMFB 3TSZA 3LWHA 3CCLA 2CUDA 1GBRA 4X34A 4LVIA 2CJBA 1X01A 3OMGA 4BW9A 4HVCA 3ME9A 4LVKA 4KRTA 4XTZA 3OSSC 2BE9B 3GF5A 1VQPT 2XI9A 2EYXA 4J7IA 3CD6Q 3I9QA 4GBQA 3JCMb 3RACA 1VQ8T 3OY9A 3G7ZA 2R57A 4YPFA 1WIEA 2A0FB 2KRMA 2NUTB 4IUTA 1NJ1A 1N9SA 2DJZA 3G71T 1X27A 2QDYB 2H3EB 2KROA 3P8HA 3VS4A 2RHIA 1YJNA 1EQRA 4HVUA 3QO7A 2DFUA 3GLXA 2FZKB 2ZIMA 1KJWA 4FCYA 1Y7XA 3CC4Q 3H0FA 1YBYA 3KFUA 1NE8A 2O9VA 2JM8A 4FYXB 2KDSA 3TVTA 2LP5A 1VQNA 1OZ2A 2YUNA 3HXYA 4C8QE 1T3SA 2JTEA 1RAHB 5FRMA 2D9TA 1JJ2P 4P75C 1W2BA 4YRRA 3EHQA 3HTRA 2CH4W 4JZ3A 2D6FA 1TH7A 2XGTA 2AK5A 3FIFA 2E65A 3HXVA 3OS5A 2KEAA 4CH3A 3PIPA 4TVAA 4C92C 1VYVA 2DNUA 3GNFB 5KYUA 1ADJA 4E7SA 2ZPGB 2BUDA 5GANj 2Q7EA 1UGVA 5HY6A 3OS2A 2P0QA 3JRZA 1NLOC 2H8HA 3H41A 3NELA 1YHQT 3HRIA 4XTWA 1QVPA 1RLQC 2EYWA 3QUIA 4R55A 2DBKA 2G4CA 3NGPA 2D0NA 2DX1A 1M3CA 4XQ3A 1IHWA 1D0XA 2EQUA 2L3PA 3BDUA 2LDMA 4FSSA 1LJOA 1H8KA 2DE0X 4GLMA 3M5AA 2EKOA 3IKLA 4DBRA 4LDUA 2BZXA 1IL2A 2QGGA 2O01E 1PYSA 2X4XA 4M75A 1Z9ZA 1BU1A 3BDLA 4M7DF 2HD0A 3RUXA 3QJ6A 1M5Q1 2R5AA 4WJ4A 3VS1A 4MMLA 4ELZC 5KYWA 2F5KA 1JQQA 3A8OB 4C5HA 1AEYA 2EPDA 1VQOA 3HTZA 1JJCA 3QTCA 4M75D 4MZPA 4PJOG 4E7JA 4P3NA 4NCXA 3ASKA 2AMCA 3M57A 2QHUA 1ZUUA 3P8BB 3CCUT 4K11A 1NLPC 2QI2A 1H3HA 2B8AA 2MMPA 5KE3A 3PVQA 2DTIA 2ENMA 2LTOA 5KYYA 2WSFE 4KH0B 5CR2A 2EVRA 2RO0A 2X9HA 4RMFA 3CC7Q 1X75C 2RHQB 2BZYA 1KHIA 2YLBA 3TCJA 2XG8D 3BY7A 4AG2C 4ZTZB 3EG2A 4K87A 1NJ2A 4K86A 3RKXA 4R56A 2COZA 2LVMA 1UHCA 4E47A 4M78D 1K73R 3LSQA 4YCWA 3LYIA 4VUBA 3CMAQ 3CPWS 2V8IA 3JB9I 3UWNA 2DXTA 5CAIA 4L87A 4C0GA 3QKJA 3TEGA 4DOVA 1RUWA 1GRIA 2ZR2A 2L8DA 2O88A 2VGMA 4M7AF 2ZINA 2AIRB 4BE1A 5D7UA 2RPNA 3MPUB 4C5EA 1G3SA 4ORZA 1JBMA 2M1HA 1B7YB 1JB0E 2DETA 2W0ZA 2F2WA 2ED0A 2CP3A 2BZ8A 1GFDA 2BE7D 5FU7C 4TTVA 4YROA 3E9FA 1M90U 3NMZC 3M58A 4TVRA 5FROA 3MEVA 5LJ5h 4Y92A 1NJIU 1UDLA 5I21A 1YIJQ 3OYBA 2EQIA 3CCJT 2LQ8A 3NFCA 3CC2Q 4FW2A 5GMKj 3HP9A 3A8HB 2DMOA 2CKKA 4YRCA 2H3JA 3REXA 1M27C 1YCSB 4YRIA 4ZN3A 3L2WA 2P0KA 4J15A 4FSXA 2RJCA 2CP7A 3TU4K 5GAMg 1I81A 5GAN7 2MPXC 1RAIB 4RG8A 3RR6A 4L59A 1Y0MA 4EMGA 2LT1A 4QVZA 2ECZA 4HCKA 1G2BA 3L1AA 3NHNA 1VYTA 2L89A 2E10A 5EC7A 1VQ6T 4PLIA 1O9SA 1VQKT 4J9CA 4ZIBA 3BW1A 2GQIA 3CD6A 3V7CA 2RQUA 4PJJA 1B34B 5GAMe 3NTKA 2AKWA 3GBQA 1YWOA 2EGAA 3L2UA 2HQXA 4UP8A 5LJ3j 5CQXA 2LZ6B 2AHJB 3H6ZA 4O6JA 3QIIA 3E2UA 1VQ4T 2ZT7A 4Q5WA 3OD1A 1ZHIA 1G8XA 1K73C 3CC4A 1VQ5Q 3C12A 3M56A 3VUZA 4P72C 4TVAB 1X69A 2FRWA 5KYUB 3CCVA 2D8JA 3IG2A 5GANg 3ICAA 2AKKA 1SRYA 4JS5A 1OX9A 1UG1A 1WZOA 3TEEA 4XU2A 1M3BA 1JEGA 2R5MA 4KBMB 3OYDA 12ASA 1YJ9Q 2ZPHB 4RCCA 3LH5A 2E3CA 1C0AA 2C8MA 1WJSA 1QVFS 2K2MA 2PQWA 3H8ZA 3KFVA 2WACA 4N4HA 4C0ZA 3LSSA 4LVMA 4KGVB 4JRQA 2CSQA 3G1ZA 2JTFA 4X5OA 2J06A 4P74C 3RBBB 1I8FA 1AT1B 5L8RE 1G5HA 3PIOA 4PFPA 4X9CA 4DBHA 2J7IA 4BY6C 5GAN4 1PYSB 2RH2A 4M75B 1ZA1B 4XU3A 2QA4Q 3SFMA 3CCET 1ZSZA 3CCRA 9ATCB 3T9NA 3S6WA 1G3WA 2VYTA 1UGRB 4C92F 3OS0A 1C1AA 1X55A 2XKOC 1R0CB 3EG3A 1GBQA 2PVGB 3RMSA 5KYWB 2FO0A 1Q86R 3PNWC 4PJMA 1JJCB 4J9GA 1EZZB 4GY5A 2E12A 2IY5A 2AMCB 2ZAEA 3WVDB 2EWNA 4RTTA 2RK1A 2FPFA 4M78B 2F1LA 1UB4A 2IPOB 2OTJT 2DL3A 3M53A 1RI9A 1QW1A 1VQLQ 1QLYA 1CSKA 4LXCA 3HPWA 3HFZA 4OMMA 4NL2A 2KI7A 2G3RA 3MCAB 1M2VA 2DO3A 1WA7A 4DQ2A 1KMMA 2X3WD 2I4NA 2PMEA 3EAEA 1AWWA 1QCFA 1HSQA 2FPEA 2DAQA 1BKBA 1WHGA 3EH1A 3F70A 4BB7A 4BI4A 1JXMA 3CC7A 3NETA 1H641 2GTOA 4J5YA 1YFRA 2DQ0A 3FB9A 4C8QG 2XU8A 1M1KR 3VV0A 2IIMA 3CMEQ 1WJRA 2E41A 1O75A 3RGLA 2DD5A 3RMQA 1ASZA 1YJNT 3CMAA 2W10A 4LVJA 3JB9F 2KNBB 2DVEA 2GFAA 2XHCA 2DZCA 1T0HA 1ZX6A 4A4HA 3JCMW 2P0LA 3M0PA 2C7IA 4HCZA 1LPLA 1WQWA 1MMAA 2HQHA 3V8LA 5A2QE 1AWOA 2DF6A 5GAOm 3A8MB 4CS3A 3UPUA 4HWPA 2E64A 3PGGA 3X25B 3A98A 2ZPBB 2A7YA 1VQNT 3JCMg 3RF1A 2CGHA 1ZLMA 1K4US 3QSUA 3META 1I07A 2M02A 4E51A 3PCOA 1K8AU 4E7IA 3I7FA 2DKGA 3HFVA 2GF7A 4M75E 3M4QA 4YRNA 5CVIA 3CPWP 5CKDA 2QAZA 1QKWA 5I2MA 3DB4A 2RHUA 4EMKB 2Q5HA 3TQ7P 2K5LA 3VBBA 1BIAA 1YIJA 1OPLA 3JCMe 1Q86C 1GL5A 4LD9K 1YI2Q 3CC2A 1T0JA 4KUIA 2K9GA 3JB9H 4M7DD 4YCUA 1E24A 1BBUA 2EYZA 1LOJA 2EQMA 4PL6A 3S3NA 4M78E 5LJ3g 4LDWA 1WXBA 2VKNA 4KULA 1ZUYA 3E19A 3A31A 1MUZA 1GCQA 3QWXX 1E1TA 1VQMQ 4XTXA 2X51A 1I4K1 2P84A 4M77C 1NYGA 5FW9A 2RM4A 2SRCA 4H2SA 5F5WA 2ZNIA 2KT8A 2EQKA 1I5OB 2LQKA 4MZTA 3VS5A 3SD4A 3EGXA 2K3BA 3SB2A 5CKBA 3V8JA 4O5VA 2RI2A 4XU0A 1WYXA 3QYHB 5LJ3e 5FWCA 4OLFA 1QWFA 4C0FA 3A1PA 2A36A 1ZA2B 2XICA 2E3IA 3OB9A 2EIFA 1D1BA 5IHNA 1ACMB 1UE9A 4M7AC 1Q82U 7AT1B 3URGA 3EHRA 3UFGA 1VQOT 2MWPA 5FU6C 1KSWA 1UTIA 1N8RU 2GBQA 1IXDA 1SPKA 2RQWA 1UFFA 1BBZA 1NJIR 2DRMA 4E7ZA 1YNZA 4CRIA 3VRZA 4IIMA 2I2LA 4YRGA 3UGQA 2PUOB 1N9WA 1ZSZB 3S3OA 1J5WA 5E3IA 4JDSA 4QKUA 1W6XA 2J05A 1NPRA 2XDPA 4UPAA 3LWIA 2RHSA 2OTLQ 3MJXA 4ZTUB 3CCMQ 2VC8A 3QO8A 2Z0WA 1X43A 4PG3A 3JAME 2QGFB 3EG1A 4JLIA 1U1SA 2YDLA 3OS1A 4NOYA 3A74A 4X1VA 4LDYA 5GAMd 2IY5B 1D1AA 2C0TA 2KT1A 3G6EQ 4HT8A 3QZ5B 2ROLA 1SHFA 2QA4A 1B76A 1RABB 4DBFA 2LRQA 5DLQE 3TREA 4B6MA 1C6VX 2F5TX 3VJPA 1KD1U 3L2RA 3HFZB 3VKIA 1SSFA 1RIQA 4ESRA 3HSBA 1L0WA 3H0HA 1NM7A 4JJDA 3REBB 3OW2S 3ER0A 1H3ZA 1SETA 3C0CA 1VQPQ 2FL7A 2FRYA 1Z9QA 4Q15A 4J7FA 2CYZB 3DB3A 2LX7A 3X26B 1BI0A 1NPPA 5ECAA 4C8QF 5KE2A 4FW1A 1MGQA 3G71Q 2QK0A 1QCOA 1VQLA 4XTUA 2QQ9A 4CH6A 5GAMf 4A53A 5IXFA 3V8KA 4KGZB 4C5IA 1NYFA 3EFOB 1FYFA 1B7TA 1PWTA 1K0SA 2YWWA 5C53B 1HJDA 1UUEA 2LMJA 1LVKA 4J6XA 3OYYA 4ZGJB 2QQRA 3QO5A 2GFUA 4A54A 2X4YA 2MOXA 6AT1B 1XJWB 3CCSQ 5IXBA 1B34A 1JU5C 1PSEA 2RQTA 4YRLA 1Q81U 4P75A 3CCQT 5CKFA 3CMEA 2YUPA 1RLPC 1Q95G 4P3PA 3PCOB 4FU6A 1NJIC 2E1HA 1EIYA 3NTIA 3CMQA 1QVGA 3RERA 4M7DB 2P4TA 1ABOA 2ARUA 2PMFA 3N5BB 2ZPIB 1FYNA 4UC4A 3CC4T 4WCIA 2QQBA 2HQEA 4ZN1A 3VRYA 3CCVT 4PJOC 1OV3A 2D1XA 2VASA 2KQWA 4L5GA 4YRMA 3ZEHA 1HXDA 3OYGA 2LCLA 1Q7YU 3JCMV 4P71A 4RG2A 3JCMc 4WTOB 3KUFA 2LC4A 4TQDA 2B86A 2V8JA 4C92D 4QQ6A 4O2DA 2RK2A 1Z7NA 2AZVA 2A08A 2CJAA 5I22A 5C0MA 3M0UA 4J9EA 4LNPA 3HRTA 1WHHA 3RIRA 1U06A 2RI5A 2JT4A 1PKSA 2JZ2A 2DL8A 3MEYA 3OYNA 4H2UA 4ATOA 1KOGA 4C0DC 3CEYA 1WXTA 2YRCA 2V26A 3HRUA 3MF1A 1UGQB 1KQSS 3NPFA 2WSCE 4BUGA 2ODRC 1YI2A 2QQSA 3EGXB 2ABLA 1RAGB 1VYUA 4PJNA 3CCRT 3EG9B 1HTTA 8ATCB 4AFUC 5KH6A 3SWNB 3SEMA 1WJQA 2DTHA 4RMOA 4QVDA 3A5YA 3CCUQ 2NS6A 2EFIA 4JUVA 1E6HA 2L5QA 1VQMA 3I56Q 4J9HA 2ZCEA 4M78A 1K9MR 1TOVA 1U8RA 2DD4A 3QDRB 4BI8B 4RCBA 2HSEB 3QYGB 4XK8E 1Y71A 4AT1B 2QXFA 1TTHB 4M77F 1W66A 4Q6GA 1OULA 2RNAA 4D8DA 3VQVA 1SESA 2RF0A 1IGQA 2OAWA 4JJBA 3S3MA 1WGSA 4BWAA 2KYBA 3JB9D 3J81E 4F17A 3JCMd 4LDXA 2RHSB 4UP7A 4RTVA 2DM1A 4XAXB 1VA7A 2CH4A 3CPFA 3OSVA 4Z88A 2DTOA 2P5IA 4FYVB 1EOVA 2IVWA 2DJQA 4YDQA 1IO6A 1RAFB 1ZBJA 4M7DE 3P8DA 3CC7T 1S72T 4HWRA 4BE2A 2LQWA 2LJ0A 3CBMA 1QE0A 1UJ0A 2MIOA 5GJWB 3M4GA 2DU5A 2RN8A 3EH2A 3RESA 4CC3A 4F7UA 5GJVB 2I4OA 2CJ9A 2EGEA 4BD3A 4YRFA 1M9SA 2DZ9A 2K2VA 3RNJA 2OTLA 3CMAT 4M75G 3UATA 5GAN2 3CCMA 3G4SQ 5CKEA 5D6WA 1MMDA 3CCJQ 3THKA 2NWMA 1G5IA 2KRNA 3OYIA 1MV0B 5LJ3d 4C5GA 4WI1A 4E7HA 2QASA 3G6EA 3M59A 2EGCA 5ELNA 1YJWA 4N0AC 4PK4A 4ZGDB 1PRLC 4H2TA 4M78G 4YRJA 2EYYA 1NJ8A 2I4MA 5HGQA 1V1CA 2O2OA 2PVOB 4J9DA 3I55Q 2ALYB 4P5NA 3FJPA 4EMKA 5J3BA 1VQ6Q 1QMCA 1JJ2A 4PKCC 3OYLA 2JVVA 4ME7A 5K1PA 1YIJT 2YUOA 2XMFA 1BI3A 3CC2T 2AKLA 2DPPB 4EO4A 5J26A 4F04B 3G71A 4XEMA 3OBWA 3P8VA 1K9MC 1H4SA 1KK7A 3E1SA 3RL6A 1VQ4Q 2DYIA 1RI0A 2OAUA 2DIQA 1WPYA 3W3SA 2V1QA 5IAYA 1K0XA 2O4XA 2MI6A 4QQDA 4ZTFA 1ADYA 1HK9A 2COWA 4P3OA 4CS2A 3UA6A 5HKCA 1EIYB 2E4HA 3VS7A 2HDAA 2PZ1A 2ATCB 4C92B 2DRKA 1QQJA 1JO8A 3VU3C 5A0DA 3TUPA 1M8VA 4FYWB 3JCMQ 2E5AA 5DLOA 1USYC 3CCSA 4LD6A 1SG5A 4RUGA 5GAOr 4CC4B 2HEQA 1LYLA 1QWEA 2FEIA 2ZTGA 2DU7A 1SSHA 1W4SA 1WDXA 2E3HA 2LNVA 3HXZA 2GQVA 3VS2A 3GPLA 1MNDA 2EAYA 3X28B 1BB9A 4LVLA 5GAMh 2RJDA 5GANe 1I1JA 2WSEE 2VB6A 2V8KA 1AZEA 3A7UA 2RQVA 3NTHA 1C0MA 3ZBDA 3CCEQ 2VXEA 2EJ9A 1SEMA 1Y96A 3I5SA 3QBYA 2XDDA 2DL4A 3QXEB 3EGUA 2ZR3A 2L3SA 1E7OA 3VQWA 3M0QA 5I2SA 1B70A 4YYEA 2DA9A 2ZIOA 4PJOF 2ZGWA 4CC2A 1TXQA 3UT1A 4HWSA 4K88A 4Z8AA 4C8QC 2O31A 3JCMP 4HT9A 4LDVA 2C0IA 4J6WA 2DXUA 2YSQA 2PUKB 2OTJQ 3TEHA 3VS3A 5CQYA 3OYHA 4YP0A 2EJGA 4A4GA 2QA4T 2QEXQ 1M4ZA 1WHKA 2Y4YA 4J83A 5FRNA 1VQ9Q 5FWBA 1RAAB 4ZGEB 4H2VA 3QWYA 2RB6A 1FMWA 5GAN3 1PSFA 1AOJA 4OMPA 3WXMB 2V1RA 2PVDB 1FXXA 2ZPFB 2EL9A 1WNLA 1FX7A 3CCLT 3BJUA 3I56A 1YFSA 2HNIA 1G83A 1YB3A 4H02A 1D09B 1U5SA 2ZZDA 1KQSP 3HRSA 2GNCA 2MAMA 1M1GA 2VWFA 3VQXA 4C92E 5IHKA 4MMKA 3PT9A 4MDWA 4UP9A 2G6FX 2L3RA 3PFSA 5HK0A 1KG1A 5AYFA 2ARTA 4M75F 5FU7B 2DVJA 3EFOA 1I0CA 2NYSA 2LCCA 4OMQA 1AWXA 4P73C 4F7UB 3VS0A 1VQ7Q 1D1CA 2QYZA 3UGTA 4TQFA 1MNEA 1G5VA 3C95A 2JNGA 2Y4XA 2QG9B 3GNGA 2RHYA 4YTLA 3EG0A 4JZ4A 2DERA 1PHTA 2E6ZA 1PCXA 3OMCA 2BIVA 3LLRA 1IHVA 4LNSA 2RHZA 4ZTJA 2M51A 4E7KA 4CC7A 2CSIA 2ZZGA 4E6RA 3INZA 4JLGA 4QW2A 1PG5B 3VYGA 1AHJB 4M7DA 1ARKA 1QCNA 3EFSA 3REUA 5GMKm 4QT7A 1K76A 2NUPA 1ZSGA 3A5ZB 4E2FB 3G4SA 1H4TA 3CQTA 4OGCA 1K73U 3A32A 1P92A 1VQZA 4IKFA 5GMKe 4A4KA 4QVCA 3SHWA 1XOVA 4KQEA 1D3BA 2P4RA 1V76A 2K5FA 3P8TA 1R0BG 2DEQA 4OB0B 2EBPA 1MHNA 5IN1A 3I35A 3IALA 3UA7A 3M9QA 3I55A 5DY9A 2O4XB 1X6OA 2K7AA 1MV3A 1PD1A 1GXIE 1BCOA 1PNJA 3PVLA 1VQ6A 2ZCFB 2CZ0B 1AWJA 5GAOn 3MHXA 4EX5A 2SEMA 5KCHA 2YUQA 1UGSB 2DLPA 3EG9A 1BIBA 4M77D 5J39A 4HA8A 2O9SA 3CBOA 3SWNA 1VQOQ 4M7AA 5C51B 1VQ4A 4IUVA 1BBWA 5KYXB 5DM7R 1AVZC 4J9BA 1ZUKA 1BI1A 3J7AF 5C6SA 3P8YA 1PM3A 4RTXA 1VQMT 1TG0A 1JXOA 2ESWA 3MKDA 1YITQ 1J3TA 5D6XA 1VQ5A 2YT6A 4M7AD 3MQZA 4QQGA 4EPCA 3VUBA 1M90R 4F7UE 1PD0A 3FDRA 4DPGA 4H2YA 4RTUA 4BY6B 4M7DG 2AZSA 2KXCA 1BK2A 1KMNA 1NJ5A 4FIBA 1Y96B 4R0KA 5LJ5j 1W70A 4Y91A 5KNNA 3HFNA 1RAEB 3ZFJA 1KC8U 2EW3A 3X20B 2Q5IA 1PKTA 1ZBXA 4A4EA 1YJ9A 3OBYA 5AT1B 4EMHA 2IG0A 1B70B 1E22A 4KGXB 2P0PA 3JV3A 2YLCA 1WLPB 1YFTA 2KRSA 1FWZA 4OB3B 5KYNA 3V7SA 3A8LB 1BI2A 4JPBW 2LX9A 1HD3A 3FRNA 2LQNA 1ASYA 4ELYC 3JCMX 3TEHB 2CREA 3OYKA 3JSCA 4M4ZA 1T3LA 2GTJA 2ZZEA 4PJLA 4KT0E 4EIKA 3J80E 3O5ZA 1QVFP 2OTLT 3MEUA 4AG1C 2EJFA 3CCMT 1OX8A 1OZ3A 4RTZA 2C0OA 3WQZA 5A0LA 3OYCA 4OVAA 1NYRA 2ZPEB 4J6YA 3LX7A 1VQ8Q 3G6ET 1K1ZA 1BCMA 1YJWT 4LN2A 4FYYB 3L2QA 2QEXA 3X24B 2I0NA 3JB9J 1X54A 4JS4A 1VQ9A 1VOMA 3PZCA 5GANd 1NEGA 2JW4A 1KQ2A 3LW5E 2ALYA 4DOWA 2ZT8A 2RHXA 3BE3A 2CIMA 4D8KA 2J6KA 4IURA 4HXJA 1Q86U 1BYMA 1UHFA 2HCKA 4A4FA 3CPWA 3HY0A 5HCKA 3CCQQ 4BACA 4NL3A 2HL3A 3CD6T 5GAMj 3HRKA 4OB1B 2CZ6B 2GCXA 4J8OA 4KR3A 1OU9A 4JJCA 1M90C 4OP0A 2K5IA 1KIKA 2KMTA 2KSSA 3R6NA 1XQHA 1VQ7A 2M0YA 4XTVA 3R07A 3CCVQ 3MP8A 1X2KA 4C92A 4YRPA 5IH2A 1Z7MA 3LC0A 2NUPB 5L23A 4PJOA 1W1FA 2A8EA 5GANf 2JM9A 2K3XA 1U3OA 3RKWA 1GGMA 2XDBA 3EGDA 1YHQQ 2YRVA 4V2SA 3NENA 2A28A 3CCST 1D3BB 2DILA 3L42A 4DBQA 2X4JA 4WF2A 4PFOA 3AT1B 1PRMC 1K9AA 4DA4A 4PJOD 1KHCA 4MDXA 2L3QA 2MCNA 4FM4B 3ZL7C 5A0GA 2KY9A 4CS4A 1M1KU 2JTMA 1AD5A 2CP0A 2FZCB 4TWAA 4HCCA 4M77B 1N27A 2E6NA 3OQ5A 4KR2A 3CCRQ 4P71C 5GAOq 5CO7A 1SHGA 4G85A 2QHTA 4BE0A 1H92A 4B9XA 2RA2A 1WU7A 2PTKA 2XIDA 4NS5A 1OYXA 3CXCS 2CP2A 3LH0A 4M7AB 2ODRD 8AT1B 4YRTA 3KXTA 2YHTA 4OMLA 5HK3A 1XTDA 5FU6B 3O8VA 3REAB 2QHVA 4N4GA 1YWPA 1FMKA 1H4QA 1OI1A 4M75C 1I5LA 1HC7A 5C52B 1S1NA 4IUQA 3C4SA 2ARSA 3HL8A 2JS2A 5LJ5g 4C92G 3ULRB 5IHIA 2J3LA 2JMAA 3MEAA 3I56T 3A8GB 4M78C 2OI3A 1YITA 1K8AR 3M4PA 1S72Q 5KCOA 1QVFA 4MZMA 3VYHB 5LJ5e 3DLLA 1LCKA 4BDZA 4OMNA 2R58A 2HSPA 2HBWA 1NEBA 1D0ZA 2K3YA 2DEUA 2LJ1A 4HT4A 3QHSA 2HZYA 2E70A 2KVQG 3FEOA 1D0YA 1B3QA 4AFQC 1SERA 5EG2A 2OJ2A 1U1TA 1Y57A 1W2BS 2Q7GA 1RL2A 2X3XD 1UEBA 1QVGS 4J9IA 4N0AA 2KK4A 3JCMf 3M54A 3GIBA 3GP8A 1WHMA 2KE9A 1WQ7A 4M77E 4PLLA 1NYQA 2HKQB 4IIOA 2KAFA 1PC0A 4L6V5 2FHDA 2K4YA 2KBTA 2OX7A 3PMTA 1WI7A 2DK3A 3JB9G 1VIFA 2QQAA 3HY1A 3A5ZA 1M1FA 3G4ST 2YRDA 3AHUA 2FVUA 3L2ZA 5GAN8 1QP3A 1E1OA 1X2HA 3L4GA 1Q82R 4M7AE 2ZT5A 4RDXA 2HBPA 1VQPA 1VQKQ 5CCAA 1IZ6A 4LE9A 1VQ8A 2CP5A 4ANJA 1GCPA 1IGUA 2M9UA 3HXWA 2JMCA 3HKSA 2MF2A 3QZ9B 1N6AA 5LJ3f 2MYSA 1N8RR 4LUDA 2K79A 5LL6S 1QP2A 2FB7A 3MF2A 3I55T 4EMKC 3M0SA 4H2XA 4TVWA 1M30A 3TSWA 2LT4A 1ATIA 1KC8R 3LGLA 4RQFA 1UJYA 1M8MA 4P72A 4PHCA 1YN8A 3OW2P 1EFWA 3E9IA 2Y90A 1F1BB 2HAXA 1SRLA 4PJOB 1USYA 2QTXA 3CBPA 4F7UG 5GAOl 3CCQA 3EGDB 4YCVA 4YRQA 1CKBA 3U23A 2BTTA 1K8AC 3EFRA 4CI0C 1AZGB 1E6GA 5KYXA 2FYKA 2COYA 4D6WA 1WX6A 2HL5C 3M0RA 1OEBA 3OYEA 1QKXA 1TU0B 4N4IA 2DDZA 1A0NB 3QJYA 3R6OA 2BKDN 3PTAA 1B8AA 2XTIA 5GMKl 4P74A 4C0DB 1TUGB 1KD1R 1VQ5T 2VVKA 4JRIA 2ED1A 3UH0A 5CKHA 1TUCA 3MO8A 3OYMA 1YHQA 3PE0A 5CIUA 3KBGA 4IUPA 1EX4A 4F16A 2YXYA 3RKYA 3D7SB 3C94A 4H2WA 2RJEA 2LNHB 1YJ9T 3IKMB 3NEMA 4OB2B 2KYMA 3PMIA 3ERRA 4C8QA 3FJ5A 4FT4A 4Y28E 3DLMA 2DL7A 1HYOA 3UF4A 2Q7HA 4A63B 1X6BA 1YP5A 2QDLA 2RQRA 1SF9A 4YRSA 2JXBA 1NBEB 1TS9A 4C8QD 3OYFA 1ZSZC 1ABQA 1Q82C 1TWBA 1OQKA 4XEOA 4AH6A 2AT1B 3QG1A 5GANh 3VQYA 1UECA 1MMNA 3LGFA 2QTVA 2ROTA 3MP6A 3QO3A 4Z89A 2DBMA 4HVWA 3CCLQ 3CCUA 1N8RC 1Q81R 3BFMA 4JRPA 2E5KA 3M55A 1LNXA 2M0OA 1UGPB 5KYYB 1X2GA 4IUUA 4GLKA 2VV5A 4CH4A 1G3YA 1KC8C 3M4YA 1JJ2S 2QEXT 2VUBA 2ZZFA 1XNIA 4F14A 2J6FA 4AFZC 1VQLT 1RADB 2C06A 3JCMJ 1VQ9T 4PJOE 1YJNQ 2CS7A 3CXCP 4P73A 5K1XA 1B07A 1Q7YR 1WHJA 5CK9A 2FPDA 1IREB 1KQ1A 2DQ3A 2KXDA 2CZ1B 5GMKi 1WYDA 1WLEA 1S72A 1VQNQ 1CKAA 2NUTA 2A3LA 2F69A 1R8OB 2FG0A 2F2XA 1QF6A 4XTYA 2ZNJA 3QPHA 1TSFA 1H4VB 5I11A 1KD1C 1OOTA 1ZQ1A 2HKNA 2JJ9A 3H0IA 5M9OA 3E9GA 1K9MU 4M78F 3CMET 2M16A 4KUDK 2DXBA 4YRKA 1VQ7T 2MK5A 2D0QB 1IRXA 2RI3A 5GAN6 4YREA 3HXUA 2PU9B 3CCJA 4RKUE 3H9NA 4ZNXA 3HFOA 2RD1A 2EKHA 3RDVA 3L4GB 2QHSA 1NJ6A 4AFSC 1WHLA 3M0TA 3OW2A 2ZT6A 2NUZA 2EQJA 4HVVA 4EDUA 1IB8A
chains in the Genus database with same CATH topology
4FT2A 4M7DC 2DXCA 2CZ7B 3SDZA 3HXXA 1DJ7B 5IT9E 4II1A 3FLGA 4H2XB 4M77A 5LJ5d 1EVKA 4F7UF 4G84A 1VQKA 4RQEA 1JRIA 1YI2T 1Q81C 1NNHA 1VUBA 2AKWB 3L2VA 4HWTA 5GMKh 4HCBA 3JCMh 3WVEB 3A7AA 2ZXFA 2JOYA 2MWOA 4XU1A 4WJ3M 2I4LA 5GAOp 2RJFA 3MP1A 4HKEA 1Q7YC 3FC3A 2E5QA 1V29B 4BDYA 3MEWA 5LJ5f 1Y07A 3SWNC 1N9RA 2EYQA 2K57A 3E9HA 1YCYA 4JRKA 1M1KC 5GAN5 4Z02A 3A7RA 4C8QB 4CH5A 4HWOA 5LJ3h 4FL6A 2NLUA 5D6YA 4JJNK 1YGBA 1YITT 1X56A 2RHQA 3OA6A 3CCEA 1NZ9A 2J3MA 2X35A 2XK0A 3OYAA 2XD0A 4M77G 3HHTB 4OF1A 3DSQA 11ASA 1KQSA 4PNOA 1G51A 2DIGA 3OYJA 3DKMA 2VGNA 3V7RA 1G3TA 1EVLA 5ELOA 1EIFA 4OGEA 3CXCA 1VIEA 4E7LA 2OTJA 4M7AG 1B7YA 2X4WA 3Q1JA 4BI3A 5FLXE 4TVYA 2JUFA 4X9DA 3UDCA 2VXFA 3GOXA 4B9WA 2JN0A 3QNEA 4OMFB 3CCLA 3LWHA 4X34A 4LVIA 2CJBA 1X01A 3OMGA 4BW9A 4HVCA 3ME9A 4LVKA 4XTZA 3OSSC 3GF5A 1VQPT 2XI9A 4J7IA 3JCMb 3RACA 1VQ8T 3OY9A 3G7ZA 2R57A 4YPFA 1NJ1A 4IUTA 1N9SA 2DJZA 3G71T 2QDYB 3P8HA 2RHIA 1YJNA 1EQRA 3QO7A 3GLXA 2ZIMA 1Y7XA 1YBYA 3KFUA 1NE8A 2KDSA 1VQNA 1OZ2A 3HXYA 4C8QE 5FRMA 2D9TA 4P75C 1W2BA 4YRRA 2D6FA 1TH7A 2XGTA 3FIFA 2E65A 3HXVA 3OS5A 4CH3A 3PIPA 4TVAA 4C92C 3GNFB 1ADJA 2ZPGB 2BUDA 5GANj 2Q7EA 5HY6A 3OS2A 2P0QA 3JRZA 3NELA 1YHQT 3HRIA 4XTWA 1QVPA 3QUIA 4R55A 2G4CA 4XQ3A 2EQUA 3BDUA 2LDMA 1LJOA 3M5AA 2EKOA 3IKLA 4LDUA 1IL2A 2O01E 1PYSA 2X4XA 4M75A 3BDLA 4M7DF 2HD0A 3RUXA 3QJ6A 1M5Q1 2R5AA 4WJ4A 4MMLA 4ELZC 2F5KA 3A8OB 4C5HA 3QTCA 1VQOA 3HTZA 1JJCA 4P3NA 4M75D 4MZPA 4PJOG 4E7JA 4NCXA 3ASKA 2AMCA 3M57A 2QHUA 3P8BB 3CCUT 2QI2A 2B8AA 2MMPA 5KE3A 2DTIA 2LTOA 2WSFE 5CR2A 2RO0A 4RMFA 1X75C 2RHQB 1KHIA 2YLBA 3TCJA 2XG8D 3BY7A 4ZTZB 4K87A 1NJ2A 4K86A 4R56A 3RKXA 2LVMA 4E47A 4M78D 3LSQA 4YCWA 3LYIA 4VUBA 3CPWS 2V8IA 3JB9I 3UWNA 2DXTA 5CAIA 4L87A 4C0GA 3QKJA 3TEGA 4DOVA 2ZR2A 2L8DA 2VGMA 4M7AF 2ZINA 4BE1A 4C5EA 1G3SA 1JBMA 2M1HA 1B7YB 1JB0E 5FU7C 4TTVA 4YROA 3E9FA 1M90U 3M58A 4TVRA 5FROA 3MEVA 5LJ5h 1NJIU 5I21A 3OYBA 3CCJT 2LQ8A 3NFCA 5GMKj 3HP9A 3A8HB 2CKKA 4YRCA 2H3JA 3REXA 4YRIA 4ZN3A 3L2WA 2P0KA 4J15A 4FSXA 2RJCA 3TU4K 5GAMg 1I81A 5GAN7 4RG8A 4L59A 4EMGA 2LT1A 4QVZA 3L1AA 2L89A 2E10A 1VQ6T 4PLIA 1O9SA 1VQKT 4ZIBA 3BW1A 3CD6A 3V7CA 1B34B 5GAMe 3NTKA 2AKWA 3L2UA 2HQXA 4UP8A 5LJ3j 5CQXA 4O6JA 2AHJB 3H6ZA 3QIIA 1VQ4T 2ZT7A 4Q5WA 3OD1A 1ZHIA 1K73C 3CC4A 3C12A 3M56A 3VUZA 4P72C 4TVAB 3CCVA 3IG2A 5GANg 3ICAA 1SRYA 4JS5A 3TEEA 4XU2A 2R5MA 4KBMB 3OYDA 12ASA 2ZPHB 4RCCA 2E3CA 1C0AA 2C8MA 1WJSA 1QVFS 2PQWA 3H8ZA 3LSSA 2WACA 4N4HA 4C0ZA 4LVMA 4JRQA 3G1ZA 2JTFA 4X5OA 4P74C 1I8FA 5L8RE 1G5HA 3PIOA 4X9CA 4BY6C 5GAN4 1PYSB 2RH2A 4M75B 4XU3A 3SFMA 3CCET 3CCRA 3T9NA 3S6WA 1G3WA 2VYTA 1UGRB 4C92F 3OS0A 1X55A 2XKOC 2PVGB 3RMSA 3PNWC 1JJCB 4GY5A 2E12A 2IY5A 2AMCB 3WVDB 2EWNA 2RK1A 4M78B 1UB4A 2OTJT 3M53A 1QW1A 3HPWA 3HFZA 4NL2A 2G3RA 3MCAB 2DO3A 4DQ2A 1KMMA 2I4NA 2PMEA 3EAEA 2DAQA 1BKBA 3F70A 4BB7A 4BI4A 3CC7A 3NETA 1H641 4J5YA 1YFRA 2DQ0A 3FB9A 4C8QG 2XU8A 3VV0A 1WJRA 2E41A 1O75A 3RGLA 2DD5A 3RMQA 1ASZA 1YJNT 3CMAA 4LVJA 3JB9F 2DVEA 2GFAA 2XHCA 2DZCA 4A4HA 3JCMW 2P0LA 2C7IA 4HCZA 1WQWA 3V8LA 5A2QE 5GAOm 3A8MB 4CS3A 3UPUA 4HWPA 2E64A 3PGGA 3X25B 2ZPBB 2A7YA 1VQNT 3JCMg 3RF1A 2CGHA 3QSUA 3META 4E51A 3PCOA 1K8AU 4E7IA 3I7FA 2DKGA 3HFVA 2GF7A 4M75E 3M4QA 4YRNA 5CVIA 5CKDA 5I2MA 3DB4A 2RHUA 4EMKB 2Q5HA 2K5LA 3VBBA 1BIAA 1YIJA 3JCMe 1Q86C 4LD9K 3CC2A 4KUIA 3JB9H 4M7DD 4YCUA 1E24A 1BBUA 1LOJA 2EQMA 4PL6A 3S3NA 4M78E 5LJ3g 4LDWA 4KULA 3E19A 3A31A 1E1TA 4XTXA 1I4K1 4M77C 2RM4A 4H2SA 2ZNIA 5F5WA 4MZTA 2EQKA 2LQKA 3SD4A 3SB2A 5CKBA 3V8JA 4O5VA 2RI2A 4XU0A 3QYHB 5LJ3e 4OLFA 4C0FA 2XICA 3OB9A 2EIFA 4M7AC 1Q82U 3URGA 3UFGA 1VQOT 2MWPA 5FU6C 1N8RU 4CRIA 2I2LA 4YRGA 3UGQA 2PUOB 1N9WA 3S3OA 1J5WA 5E3IA 4JDSA 1NPRA 2XDPA 4UPAA 3LWIA 2RHSA 4ZTUB 2VC8A 3QO8A 4PG3A 3JAME 4JLIA 1U1SA 3OS1A 4NOYA 3A74A 4LDYA 5GAMd 2IY5B 4HT8A 3QZ5B 2QA4A 1B76A 2LRQA 5DLQE 3TREA 2F5TX 3VJPA 1KD1U 3L2RA 3HFZB 3VKIA 1SSFA 1RIQA 3HSBA 1L0WA 3OW2S 3ER0A 1H3ZA 1SETA 2FL7A 4Q15A 4J7FA 2CYZB 3DB3A 3X26B 1BI0A 1NPPA 4C8QF 5KE2A 1MGQA 1VQLA 4XTUA 2QQ9A 4CH6A 5GAMf 4A53A 3V8KA 4C5IA 1FYFA 5C53B 4J6XA 3OYYA 4ZGJB 2QQRA 3QO5A 2GFUA 4A54A 2X4YA 1B34A 1PSEA 4YRLA 1Q81U 4P75A 3CCQT 5CKFA 3CMEA 4P3PA 3PCOB 4FU6A 1NJIC 2E1HA 1EIYA 3NTIA 3CMQA 1QVGA 3RERA 4M7DB 2P4TA 2ARUA 2PMFA 3N5BB 2ZPIB 4UC4A 3CC4T 2QQBA 2HQEA 4ZN1A 3CCVT 4PJOC 2KQWA 4L5GA 4YRMA 3ZEHA 1HXDA 3OYGA 2LCLA 1Q7YU 3JCMV 4P71A 4RG2A 3JCMc 3KUFA 2LC4A 4TQDA 2V8JA 4C92D 4QQ6A 4O2DA 2RK2A 1Z7NA 2CJAA 5C0MA 3HRTA 3RIRA 2RI5A 2JZ2A 3MEYA 3OYNA 4H2UA 4ATOA 1KOGA 4C0DC 3CEYA 3HRUA 3MF1A 1UGQB 1KQSS 2WSCE 4BUGA 2ODRC 1YI2A 2QQSA 3CCRT 1HTTA 5KH6A 3SWNB 1WJQA 2DTHA 4RMOA 4QVDA 3A5YA 2NS6A 2EFIA 4JUVA 2L5QA 1VQMA 2ZCEA 4M78A 1U8RA 2DD4A 3QDRB 4BI8B 4RCBA 3QYGB 4XK8E 1Y71A 2QXFA 1W66A 4M77F 4Q6GA 3VQVA 1SESA 3S3MA 1WGSA 4BWAA 3JB9D 3J81E 3JCMd 4LDXA 2RHSB 4UP7A 4XAXB 3CPFA 3OSVA 2DTOA 2P5IA 1EOVA 2IVWA 4YDQA 4M7DE 3P8DA 3CC7T 1S72T 4HWRA 4BE2A 3CBMA 1QE0A 3M4GA 2DU5A 3RESA 4F7UA 2I4OA 2CJ9A 4BD3A 4YRFA 1M9SA 2DZ9A 2K2VA 2OTLA 3CMAT 4M75G 5GAN2 3CCMA 5CKEA 5D6WA 1G5IA 3OYIA 5LJ3d 4C5GA 4WI1A 4E7HA 3G6EA 3M59A 5ELNA 1YJWA 4N0AC 4ZGDB 4H2TA 4M78G 4YRJA 5HGQA 1NJ8A 2I4MA 2PVOB 2ALYB 4P5NA 3FJPA 4EMKA 5J3BA 1JJ2A 4PKCC 3OYLA 2JVVA 4ME7A 5K1PA 1YIJT 1BI3A 3CC2T 2DPPB 4EO4A 5J26A 3G71A 4XEMA 3OBWA 3P8VA 1K9MC 1H4SA 3E1SA 3RL6A 1RI0A 2OAUA 2DIQA 1WPYA 3W3SA 5IAYA 2O4XA 2MI6A 4QQDA 4ZTFA 1ADYA 1HK9A 4P3OA 4CS2A 5HKCA 1EIYB 4C92B 3VU3C 5A0DA 3TUPA 1M8VA 3JCMQ 2E5AA 5DLOA 1USYC 3CCSA 4LD6A 5GAOr 1LYLA 2ZTGA 2DU7A 1W4SA 3HXZA 2LNVA 2GQVA 3GPLA 2EAYA 3X28B 4LVLA 5GAMh 2RJDA 5GANe 2WSEE 2V8KA 3A7UA 3NTHA 3ZBDA 2VXEA 2EJ9A 1Y96A 3QBYA 2XDDA 3QXEB 2ZR3A 3VQWA 5I2SA 1B70A 4YYEA 2ZIOA 4PJOF 2ZGWA 4HWSA 3UT1A 4K88A 4C8QC 3JCMP 4HT9A 4LDVA 4J6WA 2DXUA 2PUKB 3TEHA 5CQYA 3OYHA 4YP0A 2EJGA 4A4GA 2QA4T 1M4ZA 2Y4YA 4J83A 5FRNA 4ZGEB 4H2VA 2RB6A 5GAN3 1PSFA 3WXMB 2PVDB 1FXXA 2ZPFB 2EL9A 1WNLA 1FX7A 3CCLT 3BJUA 3I56A 1YFSA 2HNIA 1YB3A 4H02A 2ZZDA 3HRSA 2MAMA 1M1GA 3VQXA 4C92E 4MMKA 3PT9A 4MDWA 4UP9A 2L3RA 3PFSA 5HK0A 1KG1A 5AYFA 2ARTA 4M75F 5FU7B 2LCCA 4P73C 4F7UB 3UGTA 4TQFA 1G5VA 3C95A 2JNGA 2Y4XA 3GNGA 2RHYA 4YTLA 2E6ZA 3OMCA 2BIVA 3LLRA 4LNSA 2RHZA 4ZTJA 4E7KA 2ZZGA 3INZA 4JLGA 4QW2A 3VYGA 1AHJB 4M7DA 3EFSA 3REUA 5GMKm 3A5ZB 3G4SA 1H4TA 4OGCA 1K73U 3A32A 1P92A 1VQZA 4IKFA 5GMKe 4A4KA 4QVCA 1XOVA 4KQEA 1D3BA 2K5FA 3P8TA 2DEQA 4OB0B 1MHNA 5IN1A 3IALA 3M9QA 3I55A 5DY9A 2O4XB 1X6OA 1GXIE 1VQ6A 2ZCFB 2CZ0B 5GAOn 3MHXA 4EX5A 5KCHA 1UGSB 1BIBA 4M77D 5J39A 4HA8A 3CBOA 3SWNA 4M7AA 5C51B 1VQ4A 4IUVA 1BBWA 5DM7R 1BI1A 3J7AF 5C6SA 3P8YA 1VQMT 5D6XA 1VQ5A 4M7AD 3MQZA 4QQGA 4EPCA 3VUBA 4F7UE 3FDRA 4DPGA 4H2YA 4BY6B 4M7DG 1KMNA 1NJ5A 4FIBA 1Y96B 5LJ5j 4Y91A 5KNNA 3HFNA 3ZFJA 1KC8U 3X20B 2Q5IA 1YJ9A 1ZBXA 4A4EA 3OBYA 4EMHA 2IG0A 1B70B 1E22A 2P0PA 2YLCA 1YFTA 1FWZA 4OB3B 3V7SA 3A8LB 1BI2A 2LX9A 3FRNA 1ASYA 4ELYC 3JCMX 3TEHB 3OYKA 3JSCA 2ZZEA 4KT0E 3J80E 2OTLT 3MEUA 2EJFA 3CCMT 1OZ3A 3WQZA 5A0LA 3OYCA 4OVAA 1NYRA 2ZPEB 4J6YA 3LX7A 3G6ET 1YJWT 2QEXA 3L2QA 3X24B 3JB9J 1X54A 4JS4A 1VQ9A 3PZCA 5GANd 1KQ2A 3LW5E 2ALYA 4DOWA 2ZT8A 2RHXA 2CIMA 1BYMA 4IURA 1Q86U 4A4FA 3CPWA 3HY0A 4BACA 4NL3A 3CD6T 5GAMj 3HRKA 4OB1B 2CZ6B 2GCXA 4J8OA 4KR3A 1M90C 4OP0A 2K5IA 2KMTA 2KSSA 1XQHA 1VQ7A 4XTVA 3R07A 3MP8A 4C92A 4YRPA 1Z7MA 3LC0A 4PJOA 2A8EA 5GANf 2K3XA 3RKWA 1GGMA 2XDBA 2YRVA 4V2SA 3NENA 3CCST 1D3BB 3L42A 2X4JA 4WF2A 4DA4A 4PJOD 1KHCA 4MDXA 4FM4B 5A0GA 2KY9A 4CS4A 1M1KU 2JTMA 4TWAA 4HCCA 4M77B 1N27A 2E6NA 3OQ5A 4KR2A 4P71C 5GAOq 5CO7A 4G85A 2QHTA 4BE0A 4B9XA 2RA2A 1WU7A 2XIDA 4NS5A 1OYXA 3CXCS 3LH0A 4M7AB 2ODRD 4YRTA 3KXTA 2YHTA 5HK3A 1XTDA 5FU6B 3O8VA 2QHVA 4N4GA 1H4QA 1OI1A 4M75C 1I5LA 1HC7A 5C52B 4IUQA 3C4SA 2ARSA 3HL8A 5LJ5g 4C92G 2J3LA 3MEAA 3I56T 3A8GB 4M78C 1YITA 3M4PA 5KCOA 1QVFA 4MZMA 3VYHB 5LJ5e 3DLLA 4BDZA 2R58A 2K3YA 4HT4A 3QHSA 2KVQG 2E70A 3FEOA 1SERA 5EG2A 1U1TA 1W2BS 2Q7GA 1RL2A 1QVGS 1UEBA 4N0AA 2KK4A 3JCMf 3M54A 3GIBA 3GP8A 1WQ7A 4M77E 4PLLA 1NYQA 2KAFA 4L6V5 2FHDA 2K4YA 3PMTA 2DK3A 3JB9G 2QQAA 1VIFA 3HY1A 3A5ZA 1M1FA 3G4ST 3AHUA 2FVUA 3L2ZA 5GAN8 1QP3A 1E1OA 1X2HA 3L4GA 4M7AE 4RDXA 2ZT5A 2HBPA 1VQPA 5CCAA 1IZ6A 1VQ8A 2M9UA 3HXWA 3HKSA 2MF2A 3QZ9B 1N6AA 5LJ3f 5LL6S 1QP2A 2FB7A 3MF2A 3I55T 4EMKC 4TVWA 4H2XA 1ATIA 2LT4A 3LGLA 4RQFA 4P72A 4PHCA 1EFWA 3E9IA 2Y90A 2HAXA 4PJOB 1USYA 2QTXA 3CBPA 4F7UG 5GAOl 3CCQA 4YCVA 4YRQA 1K8AC 3EFRA 4CI0C 2FYKA 4D6WA 3OYEA 4N4IA 2DDZA 3QJYA 3R6OA 2BKDN 3PTAA 1B8AA 2XTIA 5GMKl 4P74A 4C0DB 1VQ5T 4JRIA 3UH0A 5CKHA 3MO8A 3OYMA 1YHQA 5CIUA 3KBGA 4IUPA 3RKYA 3C94A 4H2WA 2RJEA 1YJ9T 3IKMB 3NEMA 4OB2B 3PMIA 3ERRA 4C8QA 4FT4A 4Y28E 3DLMA 2Q7HA 4YRSA 4C8QD 3OYFA 1Q82C 4XEOA 4AH6A 5GANh 3QG1A 3VQYA 3LGFA 3MP6A 3QO3A 3CCUA 1N8RC 3BFMA 4JRPA 3M55A 1LNXA 2M0OA 1UGPB 1X2GA 4IUUA 4GLKA 2VV5A 4CH4A 1G3YA 1KC8C 3M4YA 1JJ2S 2QEXT 2VUBA 2ZZFA 1XNIA 1VQLT 2C06A 3JCMJ 1VQ9T 4PJOE 2CS7A 4P73A 5K1XA 5CK9A 1IREB 1KQ1A 2DQ3A 2CZ1B 5GMKi 1WYDA 1WLEA 1S72A 2A3LA 2F69A 1R8OB 1QF6A 4XTYA 2ZNJA 3QPHA 1H4VB 1KD1C 1ZQ1A 5M9OA 3E9GA 1K9MU 4M78F 3CMET 2M16A 4KUDK 2DXBA 4YRKA 1VQ7T 2D0QB 2RI3A 5GAN6 4YREA 3HXUA 2PU9B 3CCJA 4RKUE 3HFOA 2RD1A 3L4GB 2QHSA 1NJ6A 3OW2A 2ZT6A 2EQJA 4EDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZC A;  4M7D C;  3LSS A;  4BWA A;  5GAN d;  3JB9 D;  1KQ2 A;  3G1Z A;  3JCM d;  2ALY A;  2RHS B;  3HXX A;  4UP7 A;  4X5O A;  4P74 C;  2ZT8 A;  1I8F A;  4H2X B;  4M77 A;  5LJ5 d;  2DTO A;  2P5I A;  1EVK A;  1G5H A;  4X9C A;  2CIM A;  1EOV A;  4F7U F;  4G84 A;  4YDQ A;  4RQE A;  5GAN 4;  1JRI A;  1PYS B;  4M7D E;  4M75 B;  4XU3 A;  4HWR A;  3HY0 A;  1NNH A;  1QE0 A;  4NL3 A;  5GAM j;  3HRK A;  3M4G A;  2AKW B;  4C92 F;  2DU5 A;  3RES A;  4KR3 A;  1X55 A;  4HWT A;  4OP0 A;  4F7U A;  2I4O A;  2CJ9 A;  4YRF A;  5GMK h;  2DZ9 A;  4M75 G;  3JCM h;  5GAN 2;  1JJC B;  3A7A A;  4XTV A;  3R07 A;  2ZXF A;  4C92 A;  1G5I A;  4YRP A;  2IY5 A;  1Z7M A;  2AMC B;  3LC0 A;  4XU1 A;  2EWN A;  4PJO A;  5LJ3 d;  4WJ3 M;  2I4L A;  4M78 B;  5GAN f;  5GAO p;  4WI1 A;  3RKW A;  1GGM A;  4V2S A;  5ELN A;  3NEN A;  4N0A C;  1D3B B;  5LJ5 f;  3SWN C;  1N9R A;  4WF2 A;  2K57 A;  3HFZ A;  4NL2 A;  3E9H A;  1YCY A;  4JRK A;  4H2T A;  4M78 G;  4YRJ A;  4PJO D;  5HGQ A;  1NJ8 A;  2I4M A;  5GAN 5;  3A7R A;  4DQ2 A;  1KMM A;  2ALY B;  4CS4 A;  4C8Q B;  3FJP A;  4EMK A;  2I4N A;  4TWA A;  2PME A;  4CH5 A;  4HWO A;  4M77 B;  5LJ3 h;  1YGB A;  5K1P A;  1X56 A;  2RHQ A;  4KR2 A;  4P71 C;  5GAO q;  3NET A;  1H64 1;  4EO4 A;  4G85 A;  4XEM A;  4J5Y A;  1YFR A;  2DQ0 A;  2QHT A;  3FB9 A;  4C8Q G;  2J3M A;  2RA2 A;  3P8V A;  1WU7 A;  1H4S A;  3RL6 A;  2E41 A;  4M77 G;  3RGL A;  3DSQ A;  1WPY A;  11AS A;  1ASZ A;  3W3S A;  4M7A B;  4PNO A;  1G51 A;  2ODR D;  4YRT A;  2YHT A;  3JB9 F;  4P3O A;  1ADY A;  1HK9 A;  4CS2 A;  2DVE A;  3JCM W;  2DZC A;  1EIY B;  2P0L A;  3V7R A;  2C7I A;  1EVL A;  1WQW A;  5ELO A;  4C92 B;  2QHV A;  3V8L A;  3VU3 C;  5GAO m;  1H4Q A;  4CS3 A;  3TUP A;  4M75 C;  1M8V A;  3JCM Q;  2E5A A;  4HWP A;  2E64 A;  3PGG A;  4M7A G;  1I5L A;  1B7Y A;  1USY C;  1HC7 A;  3RF1 A;  3JCM g;  2CGH A;  5C52 B;  3QSU A;  5GAO r;  2ARS A;  5LJ5 g;  4C92 G;  4E51 A;  3PCO A;  4TVY A;  1LYL A;  3I7F A;  2DKG A;  2J3L A;  2ZTG A;  2DU7 A;  4X9D A;  3HFV A;  2VXF A;  4M75 E;  3HXZ A;  3M4Q A;  4YRN A;  2JN0 A;  3QNE A;  2EAY A;  2CJB A;  1X01 A;  4EMK B;  2Q5H A;  5GAM h;  4BW9 A;  4HVC A;  5GAN e;  3VBB A;  4M78 C;  1BIA A;  4XTZ A;  3A7U A;  3JCM e;  3M4P A;  2VXE A;  2EJ9 A;  3JCM b;  3JB9 H;  4M7D D;  3RAC A;  1Y96 A;  5LJ5 e;  4YCU A;  4YPF A;  1E24 A;  1NJ1 A;  1BBU A;  1N9S A;  1LOJ A;  2DJZ A;  2ZR3 A;  4M78 E;  5LJ3 g;  3VQW A;  1B70 A;  4YYE A;  2ZIO A;  4PJO F;  1EQR A;  2ZGW A;  3QHS A;  3A31 A;  3QO7 A;  4HWS A;  4K88 A;  4C8Q C;  2ZIM A;  3JCM P;  4HT9 A;  1E1T A;  1SER A;  4XTX A;  1I4K 1;  4J6W A;  4M77 C;  2DXU A;  2RM4 A;  4H2S A;  2ZNI A;  5F5W A;  3KFU A;  1U1T A;  3TEH A;  2Q7G A;  4YP0 A;  2EJG A;  3SB2 A;  3V8J A;  4N0A A;  4XU0 A;  4C8Q E;  3JCM f;  3HXY A;  5LJ3 e;  4OLF A;  3GIB A;  1WQ7 A;  4M77 E;  4P75 C;  1NYQ A;  4YRR A;  4M7A C;  1TH7 A;  4H2V A;  2XGT A;  2RB6 A;  5GAN 3;  3FIF A;  2E65 A;  3HXV A;  3UFG A;  3JB9 G;  3HY1 A;  2EL9 A;  4CH3 A;  1WNL A;  3A5Z A;  4TVA A;  4C92 C;  1ADJ A;  3BJU A;  3AHU A;  1YFS A;  3L2Z A;  2HNI A;  5GAN 8;  5GAN j;  1E1O A;  2Q7E A;  1X2H A;  1YB3 A;  3L4G A;  4H02 A;  4M7A E;  4RDX A;  2ZT5 A;  3NEL A;  3HRI A;  4XTW A;  3HXW A;  3VQX A;  4C92 E;  3QUI A;  2I2L A;  4YRG A;  3UGQ A;  1N9W A;  4MMK A;  2G4C A;  1J5W A;  5E3I A;  4UP9 A;  5LJ3 f;  4XQ3 A;  2ART A;  4M75 F;  4UPA A;  2RHS A;  3BDU A;  4P73 C;  1LJO A;  4F7U B;  2FB7 A;  4ZTU B;  2VC8 A;  3MF2 A;  3QO8 A;  4EMK C;  4TVW A;  4H2X A;  4PG3 A;  3UGT A;  4TQF A;  1ATI A;  3IKL A;  4JLI A;  1U1S A;  4RQF A;  1IL2 A;  4NOY A;  3A74 A;  4P72 A;  4PHC A;  1PYS A;  5GAM d;  1EFW A;  2IY5 B;  4M75 A;  2Y90 A;  3E9I A;  4PJO B;  1USY A;  2QTX A;  4HT8 A;  4F7U G;  5GAO l;  3RUX A;  4M7D F;  1B76 A;  1M5Q 1;  4YCV A;  4YRQ A;  4WJ4 A;  4LNS A;  4MML A;  3EFR A;  2ZZG A;  3HFZ B;  3INZ A;  2FYK A;  3QTC A;  1RIQ A;  1JJC A;  3HTZ A;  4M75 D;  4PJO G;  4P3N A;  3HSB A;  4M7D A;  4NCX A;  1L0W A;  3EFS A;  3REU A;  2DDZ A;  5GMK m;  2AMC A;  2QHU A;  1B8A A;  1SET A;  2XTI A;  5GMK l;  1H4T A;  4P74 A;  3A32 A;  1VQZ A;  2DTI A;  4Q15 A;  4JRI A;  5GMK e;  4QVC A;  3UH0 A;  4KQE A;  4RMF A;  1D3B A;  4C8Q F;  1MGQ A;  2RHQ B;  2YLB A;  3P8T A;  2DEQ A;  3BY7 A;  4ZTZ B;  4K87 A;  4XTU A;  1NJ2 A;  4CH6 A;  4K86 A;  3RKX A;  4A53 A;  5GAM f;  3RKY A;  3V8K A;  4M78 D;  3LSQ A;  4H2W A;  4YCW A;  3IAL A;  3IKM B;  3NEM A;  1FYF A;  3ERR A;  4C8Q A;  3JB9 I;  5DY9 A;  5C53 B;  2Q7H A;  2DXT A;  5CAI A;  4L87 A;  3TEG A;  4J6X A;  2ZR2 A;  3QO5 A;  4M7A F;  2ZIN A;  4YRS A;  4A54 A;  5GAO n;  1JBM A;  4EX5 A;  4C8Q D;  1B34 A;  1B7Y B;  4YRL A;  4P75 A;  1BIB A;  4M77 D;  4HA8 A;  4XEO A;  3SWN A;  4TTV A;  4M7A A;  5C51 B;  4YRO A;  5GAN h;  4AH6 A;  3VQY A;  1BBW A;  4P3P A;  3PCO B;  2E1H A;  3QO3 A;  1EIY A;  3CMQ A;  3P8Y A;  3RER A;  4M7D B;  5LJ5 h;  2ARU A;  2PMF A;  5I21 A;  3BFM A;  4PJO C;  1LNX A;  4M7A D;  5GMK j;  4F7U E;  1X2G A;  4DPG A;  4YRC A;  4YRM A;  1HXD A;  4H2Y A;  4CH4 A;  3JCM V;  4P71 A;  3REX A;  3JCM c;  4M7D G;  1KMN A;  4TQD A;  1NJ5 A;  4YRI A;  1Y96 B;  4C92 D;  5LJ5 j;  4Y91 A;  2ZZF A;  5KNN A;  4O2D A;  3HFN A;  1Z7N A;  4J15 A;  2CJA A;  5GAM g;  3JCM J;  1I81 A;  2Q5I A;  5GAN 7;  4PJO E;  4EMH A;  3RIR A;  4P73 A;  5K1X A;  1B70 B;  1E22 A;  3MEY A;  4H2U A;  2YLC A;  4EMG A;  1YFT A;  1KOG A;  1KQ1 A;  3V7S A;  2DQ3 A;  3MF1 A;  3L1A A;  5GMK i;  2E10 A;  1WYD A;  1WLE A;  2ODR C;  1ASY A;  3TEH B;  3JCM X;  4ZIB A;  3BW1 A;  3V7C A;  1QF6 A;  1B34 B;  4XTY A;  5GAM e;  2ZNJ A;  2AKW A;  1H4V B;  4UP8 A;  5LJ3 j;  1HTT A;  3SWN B;  4M78 F;  2ZZE A;  2DTH A;  4QVD A;  3A5Y A;  2EJF A;  4JUV A;  2ZT7 A;  4YRK A;  3OD1 A;  3WQZ A;  5GAN 6;  4P72 C;  4TVA B;  4YRE A;  3HXU A;  2ZCE A;  3IG2 A;  4M78 A;  5GAN g;  1NYR A;  3ICA A;  3HFO A;  1SRY A;  2RD1 A;  4J6Y A;  3L4G B;  4RCB A;  1NJ6 A;  2QHS A;  4XU2 A;  12AS A;  4RCC A;  2E3C A;  1W66 A;  4M77 F;  2ZT6 A;  3JB9 J;  2C8M A;  4Q6G A;  1X54 A;  1C0A A;  3VQV A;  1SES A; 
#chains in the Genus database with same CATH topology
 4FT2 A;  4PFZ A;  4M7D C;  2DXC A;  1TUD A;  2CZ7 B;  1OU8 A;  3SDZ A;  3HXX A;  1DJ7 B;  5IT9 E;  4LUE A;  4II1 A;  3FLG A;  4H2X B;  4M77 A;  5LJ5 d;  1EVK A;  1M2O A;  1NG2 A;  4F7U F;  1W2B P;  4G84 A;  1VQK A;  2CDT A;  4RQE A;  1QVG P;  1JRI A;  1YI2 T;  1Q81 C;  1NNH A;  1VUB A;  1GFC A;  2K6D A;  2AKW B;  3L2V A;  4HWT A;  2D8H A;  1X2Q A;  2JS0 A;  2LCS A;  2PNI A;  5GMK h;  4HCB A;  4RTY A;  3JCM h;  1GCQ C;  3WVE B;  3A7A A;  3G1J A;  4DEY A;  2ZXF A;  2JOY A;  2MWO A;  4XU1 A;  3I5R A;  4WJ3 M;  2I4L A;  3IQL A;  5GAO p;  1WXU A;  2RJF A;  3MP1 A;  4HKE A;  2DYB A;  1Q7Y C;  2KR3 A;  1RAC B;  1OPK A;  3FC3 A;  2E5Q A;  1V29 B;  2CT3 A;  4BDY A;  3MEW A;  2LJ3 A;  5LJ5 f;  4RTW A;  1Y07 A;  3SWN C;  1N9R A;  2EYQ A;  2K57 A;  3E9H A;  1YCY A;  4JRK A;  4DEX A;  1M1K C;  5GAN 5;  4Z02 A;  3A7R A;  4C8Q B;  1M3A A;  4CH5 A;  4HWO A;  5LJ3 h;  4FL6 A;  2NLU A;  2L0A A;  5D6Y A;  2CP6 A;  4J9F A;  4JJN K;  1YIT T;  1YGB A;  1X56 A;  4OMO A;  2RHQ A;  1WFW A;  2HMA A;  2A37 A;  1SRM A;  1MMG A;  3OA6 A;  3CCE A;  2KGT A;  2L2P A;  1NZ9 A;  2CUB A;  1YFN A;  2J3M A;  2FZG B;  2X35 A;  4KH1 B;  2XK0 A;  1KFZ A;  3OYA A;  2XD0 A;  4M77 G;  3HHT B;  4OF1 A;  3DSQ A;  11AS A;  1KQS A;  4PNO A;  1G51 A;  2DIG A;  2RMO A;  3DKM A;  3OYJ A;  2VGN A;  2F2V A;  3QDF A;  3V7R A;  1G3T A;  1EFN A;  1EVL A;  5ELO A;  1X6G A;  1EIF A;  4OGE A;  3VS6 A;  3CXC A;  1VIE A;  1YJW Q;  1N5Z A;  4E7L A;  2OTJ A;  4M7A G;  1B7Y A;  2X4W A;  3Q1J A;  4BI3 A;  2DL5 A;  5FLX E;  4TVY A;  1FMV A;  2CT4 A;  4AMC A;  2JUF A;  4X9D A;  1SKU B;  3UDC A;  2J6O A;  2VXF A;  1R77 A;  2GGR A;  3GOX A;  4B9W A;  2JN0 A;  1M2V B;  3QNE A;  4OMF B;  3TSZ A;  3LWH A;  3CCL A;  2CUD A;  1GBR A;  4X34 A;  4LVI A;  2CJB A;  1X01 A;  3OMG A;  4BW9 A;  4HVC A;  3ME9 A;  4LVK A;  4KRT A;  4XTZ A;  3OSS C;  2BE9 B;  3GF5 A;  1VQP T;  2XI9 A;  2EYX A;  4J7I A;  3CD6 Q;  3I9Q A;  4GBQ A;  3JCM b;  3RAC A;  1VQ8 T;  3OY9 A;  3G7Z A;  2R57 A;  4YPF A;  1WIE A;  2A0F B;  2KRM A;  2NUT B;  4IUT A;  1NJ1 A;  1N9S A;  2DJZ A;  3G71 T;  1X27 A;  2QDY B;  2H3E B;  2KRO A;  3P8H A;  3VS4 A;  2RHI A;  1YJN A;  1EQR A;  4HVU A;  3QO7 A;  2DFU A;  3GLX A;  2FZK B;  2ZIM A;  1KJW A;  4FCY A;  1Y7X A;  3CC4 Q;  3H0F A;  1YBY A;  3KFU A;  1NE8 A;  2O9V A;  2JM8 A;  4FYX B;  2KDS A;  3TVT A;  2LP5 A;  1VQN A;  1OZ2 A;  2YUN A;  3HXY A;  4C8Q E;  1T3S A;  2JTE A;  1RAH B;  5FRM A;  2D9T A;  1JJ2 P;  4P75 C;  1W2B A;  4YRR A;  3EHQ A;  3HTR A;  2CH4 W;  4JZ3 A;  2D6F A;  1TH7 A;  2XGT A;  2AK5 A;  3FIF A;  2E65 A;  3HXV A;  3OS5 A;  2KEA A;  4CH3 A;  3PIP A;  4TVA A;  4C92 C;  1VYV A;  2DNU A;  3GNF B;  5KYU A;  1ADJ A;  4E7S A;  2ZPG B;  2BUD A;  5GAN j;  2Q7E A;  1UGV A;  5HY6 A;  3OS2 A;  2P0Q A;  3JRZ A;  1NLO C;  2H8H A;  3H41 A;  3NEL A;  1YHQ T;  3HRI A;  4XTW A;  1QVP A;  1RLQ C;  2EYW A;  3QUI A;  4R55 A;  2DBK A;  2G4C A;  3NGP A;  2D0N A;  2DX1 A;  1M3C A;  4XQ3 A;  1IHW A;  1D0X A;  2EQU A;  2L3P A;  3BDU A;  2LDM A;  4FSS A;  1LJO A;  1H8K A;  2DE0 X;  4GLM A;  3M5A A;  2EKO A;  3IKL A;  4DBR A;  4LDU A;  2BZX A;  1IL2 A;  2QGG A;  2O01 E;  1PYS A;  2X4X A;  4M75 A;  1Z9Z A;  1BU1 A;  3BDL A;  4M7D F;  2HD0 A;  3RUX A;  3QJ6 A;  1M5Q 1;  2R5A A;  4WJ4 A;  3VS1 A;  4MML A;  4ELZ C;  5KYW A;  2F5K A;  1JQQ A;  3A8O B;  4C5H A;  1AEY A;  2EPD A;  1VQO A;  3HTZ A;  1JJC A;  3QTC A;  4M75 D;  4MZP A;  4PJO G;  4E7J A;  4P3N A;  4NCX A;  3ASK A;  2AMC A;  3M57 A;  2QHU A;  1ZUU A;  3P8B B;  3CCU T;  4K11 A;  1NLP C;  2QI2 A;  1H3H A;  2B8A A;  2MMP A;  5KE3 A;  3PVQ A;  2DTI A;  2ENM A;  2LTO A;  5KYY A;  2WSF E;  4KH0 B;  5CR2 A;  2EVR A;  2RO0 A;  2X9H A;  4RMF A;  3CC7 Q;  1X75 C;  2RHQ B;  2BZY A;  1KHI A;  2YLB A;  3TCJ A;  2XG8 D;  3BY7 A;  4AG2 C;  4ZTZ B;  3EG2 A;  4K87 A;  1NJ2 A;  4K86 A;  3RKX A;  4R56 A;  2COZ A;  2LVM A;  1UHC A;  4E47 A;  4M78 D;  1K73 R;  3LSQ A;  4YCW A;  3LYI A;  4VUB A;  3CMA Q;  3CPW S;  2V8I A;  3JB9 I;  3UWN A;  2DXT A;  5CAI A;  4L87 A;  4C0G A;  3QKJ A;  3TEG A;  4DOV A;  1RUW A;  1GRI A;  2ZR2 A;  2L8D A;  2O88 A;  2VGM A;  4M7A F;  2ZIN A;  2AIR B;  4BE1 A;  5D7U A;  2RPN A;  3MPU B;  4C5E A;  1G3S A;  4ORZ A;  1JBM A;  2M1H A;  1B7Y B;  1JB0 E;  2DET A;  2W0Z A;  2F2W A;  2ED0 A;  2CP3 A;  2BZ8 A;  1GFD A;  2BE7 D;  5FU7 C;  4TTV A;  4YRO A;  3E9F A;  1M90 U;  3NMZ C;  3M58 A;  4TVR A;  5FRO A;  3MEV A;  5LJ5 h;  4Y92 A;  1NJI U;  1UDL A;  5I21 A;  1YIJ Q;  3OYB A;  2EQI A;  3CCJ T;  2LQ8 A;  3NFC A;  3CC2 Q;  4FW2 A;  5GMK j;  3HP9 A;  3A8H B;  2DMO A;  2CKK A;  4YRC A;  2H3J A;  3REX A;  1M27 C;  1YCS B;  4YRI A;  4ZN3 A;  3L2W A;  2P0K A;  4J15 A;  4FSX A;  2RJC A;  2CP7 A;  3TU4 K;  5GAM g;  1I81 A;  5GAN 7;  2MPX C;  1RAI B;  4RG8 A;  3RR6 A;  4L59 A;  1Y0M A;  4EMG A;  2LT1 A;  4QVZ A;  2ECZ A;  4HCK A;  1G2B A;  3L1A A;  3NHN A;  1VYT A;  2L89 A;  2E10 A;  5EC7 A;  1VQ6 T;  4PLI A;  1O9S A;  1VQK T;  4J9C A;  4ZIB A;  3BW1 A;  2GQI A;  3CD6 A;  3V7C A;  2RQU A;  4PJJ A;  1B34 B;  5GAM e;  3NTK A;  2AKW A;  3GBQ A;  1YWO A;  2EGA A;  3L2U A;  2HQX A;  4UP8 A;  5LJ3 j;  5CQX A;  2LZ6 B;  2AHJ B;  3H6Z A;  4O6J A;  3QII A;  3E2U A;  1VQ4 T;  2ZT7 A;  4Q5W A;  3OD1 A;  1ZHI A;  1G8X A;  1K73 C;  3CC4 A;  1VQ5 Q;  3C12 A;  3M56 A;  3VUZ A;  4P72 C;  4TVA B;  1X69 A;  2FRW A;  5KYU B;  3CCV A;  2D8J A;  3IG2 A;  5GAN g;  3ICA A;  2AKK A;  1SRY A;  4JS5 A;  1OX9 A;  1UG1 A;  1WZO A;  3TEE A;  4XU2 A;  1M3B A;  1JEG A;  2R5M A;  4KBM B;  3OYD A;  12AS A;  1YJ9 Q;  2ZPH B;  4RCC A;  3LH5 A;  2E3C A;  1C0A A;  2C8M A;  1WJS A;  1QVF S;  2K2M A;  2PQW A;  3H8Z A;  3KFV A;  2WAC A;  4N4H A;  4C0Z A;  3LSS A;  4LVM A;  4KGV B;  4JRQ A;  2CSQ A;  3G1Z A;  2JTF A;  4X5O A;  2J06 A;  4P74 C;  3RBB B;  1I8F A;  1AT1 B;  5L8R E;  1G5H A;  3PIO A;  4PFP A;  4X9C A;  4DBH A;  2J7I A;  4BY6 C;  5GAN 4;  1PYS B;  2RH2 A;  4M75 B;  1ZA1 B;  4XU3 A;  2QA4 Q;  3SFM A;  3CCE T;  1ZSZ A;  3CCR A;  9ATC B;  3T9N A;  3S6W A;  1G3W A;  2VYT A;  1UGR B;  4C92 F;  3OS0 A;  1C1A A;  1X55 A;  2XKO C;  1R0C B;  3EG3 A;  1GBQ A;  2PVG B;  3RMS A;  5KYW B;  2FO0 A;  1Q86 R;  3PNW C;  4PJM A;  1JJC B;  4J9G A;  1EZZ B;  4GY5 A;  2E12 A;  2IY5 A;  2AMC B;  2ZAE A;  3WVD B;  2EWN A;  4RTT A;  2RK1 A;  2FPF A;  4M78 B;  2F1L A;  1UB4 A;  2IPO B;  2OTJ T;  2DL3 A;  3M53 A;  1RI9 A;  1QW1 A;  1VQL Q;  1QLY A;  1CSK A;  4LXC A;  3HPW A;  3HFZ A;  4OMM A;  4NL2 A;  2KI7 A;  2G3R A;  3MCA B;  1M2V A;  2DO3 A;  1WA7 A;  4DQ2 A;  1KMM A;  2X3W D;  2I4N A;  2PME A;  3EAE A;  1AWW A;  1QCF A;  1HSQ A;  2FPE A;  2DAQ A;  1BKB A;  1WHG A;  3EH1 A;  3F70 A;  4BB7 A;  4BI4 A;  1JXM A;  3CC7 A;  3NET A;  1H64 1;  2GTO A;  4J5Y A;  1YFR A;  2DQ0 A;  3FB9 A;  4C8Q G;  2XU8 A;  1M1K R;  3VV0 A;  2IIM A;  3CME Q;  1WJR A;  2E41 A;  1O75 A;  3RGL A;  2DD5 A;  3RMQ A;  1ASZ A;  1YJN T;  3CMA A;  2W10 A;  4LVJ A;  3JB9 F;  2KNB B;  2DVE A;  2GFA A;  2XHC A;  2DZC A;  1T0H A;  1ZX6 A;  4A4H A;  3JCM W;  2P0L A;  3M0P A;  2C7I A;  4HCZ A;  1LPL A;  1WQW A;  1MMA A;  2HQH A;  3V8L A;  5A2Q E;  1AWO A;  2DF6 A;  5GAO m;  3A8M B;  4CS3 A;  3UPU A;  4HWP A;  2E64 A;  3PGG A;  3X25 B;  3A98 A;  2ZPB B;  2A7Y A;  1VQN T;  3JCM g;  3RF1 A;  2CGH A;  1ZLM A;  1K4U S;  3QSU A;  3MET A;  1I07 A;  2M02 A;  4E51 A;  3PCO A;  1K8A U;  4E7I A;  3I7F A;  2DKG A;  3HFV A;  2GF7 A;  4M75 E;  3M4Q A;  4YRN A;  5CVI A;  3CPW P;  5CKD A;  2QAZ A;  1QKW A;  5I2M A;  3DB4 A;  2RHU A;  4EMK B;  2Q5H A;  3TQ7 P;  2K5L A;  3VBB A;  1BIA A;  1YIJ A;  1OPL A;  3JCM e;  1Q86 C;  1GL5 A;  4LD9 K;  1YI2 Q;  3CC2 A;  1T0J A;  4KUI A;  2K9G A;  3JB9 H;  4M7D D;  4YCU A;  1E24 A;  1BBU A;  2EYZ A;  1LOJ A;  2EQM A;  4PL6 A;  3S3N A;  4M78 E;  5LJ3 g;  4LDW A;  1WXB A;  2VKN A;  4KUL A;  1ZUY A;  3E19 A;  3A31 A;  1MUZ A;  1GCQ A;  3QWX X;  1E1T A;  1VQM Q;  4XTX A;  2X51 A;  1I4K 1;  2P84 A;  4M77 C;  1NYG A;  5FW9 A;  2RM4 A;  2SRC A;  4H2S A;  5F5W A;  2ZNI A;  2KT8 A;  2EQK A;  1I5O B;  2LQK A;  4MZT A;  3VS5 A;  3SD4 A;  3EGX A;  2K3B A;  3SB2 A;  5CKB A;  3V8J A;  4O5V A;  2RI2 A;  4XU0 A;  1WYX A;  3QYH B;  5LJ3 e;  5FWC A;  4OLF A;  1QWF A;  4C0F A;  3A1P A;  2A36 A;  1ZA2 B;  2XIC A;  2E3I A;  3OB9 A;  2EIF A;  1D1B A;  5IHN A;  1ACM B;  1UE9 A;  4M7A C;  1Q82 U;  7AT1 B;  3URG A;  3EHR A;  3UFG A;  1VQO T;  2MWP A;  5FU6 C;  1KSW A;  1UTI A;  1N8R U;  2GBQ A;  1IXD A;  1SPK A;  2RQW A;  1UFF A;  1BBZ A;  1NJI R;  2DRM A;  4E7Z A;  1YNZ A;  4CRI A;  3VRZ A;  4IIM A;  2I2L A;  4YRG A;  3UGQ A;  2PUO B;  1N9W A;  1ZSZ B;  3S3O A;  1J5W A;  5E3I A;  4JDS A;  4QKU A;  1W6X A;  2J05 A;  1NPR A;  2XDP A;  4UPA A;  3LWI A;  2RHS A;  2OTL Q;  3MJX A;  4ZTU B;  3CCM Q;  2VC8 A;  3QO8 A;  2Z0W A;  1X43 A;  4PG3 A;  3JAM E;  2QGF B;  3EG1 A;  4JLI A;  1U1S A;  2YDL A;  3OS1 A;  4NOY A;  3A74 A;  4X1V A;  4LDY A;  5GAM d;  2IY5 B;  1D1A A;  2C0T A;  2KT1 A;  3G6E Q;  4HT8 A;  3QZ5 B;  2ROL A;  1SHF A;  2QA4 A;  1B76 A;  1RAB B;  4DBF A;  2LRQ A;  5DLQ E;  3TRE A;  4B6M A;  1C6V X;  2F5T X;  3VJP A;  1KD1 U;  3L2R A;  3HFZ B;  3VKI A;  1SSF A;  1RIQ A;  4ESR A;  3HSB A;  1L0W A;  3H0H A;  1NM7 A;  4JJD A;  3REB B;  3OW2 S;  3ER0 A;  1H3Z A;  1SET A;  3C0C A;  1VQP Q;  2FL7 A;  2FRY A;  1Z9Q A;  4Q15 A;  4J7F A;  2CYZ B;  3DB3 A;  2LX7 A;  3X26 B;  1BI0 A;  1NPP A;  5ECA A;  4C8Q F;  5KE2 A;  4FW1 A;  1MGQ A;  3G71 Q;  2QK0 A;  1QCO A;  1VQL A;  4XTU A;  2QQ9 A;  4CH6 A;  5GAM f;  4A53 A;  5IXF A;  3V8K A;  4KGZ B;  4C5I A;  1NYF A;  3EFO B;  1FYF A;  1B7T A;  1PWT A;  1K0S A;  2YWW A;  5C53 B;  1HJD A;  1UUE A;  2LMJ A;  1LVK A;  4J6X A;  3OYY A;  4ZGJ B;  2QQR A;  3QO5 A;  2GFU A;  4A54 A;  2X4Y A;  2MOX A;  6AT1 B;  1XJW B;  3CCS Q;  5IXB A;  1B34 A;  1JU5 C;  1PSE A;  2RQT A;  4YRL A;  1Q81 U;  4P75 A;  3CCQ T;  5CKF A;  3CME A;  2YUP A;  1RLP C;  1Q95 G;  4P3P A;  3PCO B;  4FU6 A;  1NJI C;  2E1H A;  1EIY A;  3NTI A;  3CMQ A;  1QVG A;  3RER A;  4M7D B;  2P4T A;  1ABO A;  2ARU A;  2PMF A;  3N5B B;  2ZPI B;  1FYN A;  4UC4 A;  3CC4 T;  4WCI A;  2QQB A;  2HQE A;  4ZN1 A;  3VRY A;  3CCV T;  4PJO C;  1OV3 A;  2D1X A;  2VAS A;  2KQW A;  4L5G A;  4YRM A;  3ZEH A;  1HXD A;  3OYG A;  2LCL A;  1Q7Y U;  3JCM V;  4P71 A;  4RG2 A;  3JCM c;  4WTO B;  3KUF A;  2LC4 A;  4TQD A;  2B86 A;  2V8J A;  4C92 D;  4QQ6 A;  4O2D A;  2RK2 A;  1Z7N A;  2AZV A;  2A08 A;  2CJA A;  5I22 A;  5C0M A;  3M0U A;  4J9E A;  4LNP A;  3HRT A;  1WHH A;  3RIR A;  1U06 A;  2RI5 A;  2JT4 A;  1PKS A;  2JZ2 A;  2DL8 A;  3MEY A;  3OYN A;  4H2U A;  4ATO A;  1KOG A;  4C0D C;  3CEY A;  1WXT A;  2YRC A;  2V26 A;  3HRU A;  3MF1 A;  1UGQ B;  1KQS S;  3NPF A;  2WSC E;  4BUG A;  2ODR C;  1YI2 A;  2QQS A;  3EGX B;  2ABL A;  1RAG B;  1VYU A;  4PJN A;  3CCR T;  3EG9 B;  1HTT A;  8ATC B;  4AFU C;  5KH6 A;  3SWN B;  3SEM A;  1WJQ A;  2DTH A;  4RMO A;  4QVD A;  3A5Y A;  3CCU Q;  2NS6 A;  2EFI A;  4JUV A;  1E6H A;  2L5Q A;  1VQM A;  3I56 Q;  4J9H A;  2ZCE A;  4M78 A;  1K9M R;  1TOV A;  1U8R A;  2DD4 A;  3QDR B;  4BI8 B;  4RCB A;  2HSE B;  3QYG B;  4XK8 E;  1Y71 A;  4AT1 B;  2QXF A;  1TTH B;  4M77 F;  1W66 A;  4Q6G A;  1OUL A;  2RNA A;  4D8D A;  3VQV A;  1SES A;  2RF0 A;  1IGQ A;  2OAW A;  4JJB A;  3S3M A;  1WGS A;  4BWA A;  2KYB A;  3JB9 D;  3J81 E;  4F17 A;  3JCM d;  4LDX A;  2RHS B;  4UP7 A;  4RTV A;  2DM1 A;  4XAX B;  1VA7 A;  2CH4 A;  3CPF A;  3OSV A;  4Z88 A;  2DTO A;  2P5I A;  4FYV B;  1EOV A;  2IVW A;  2DJQ A;  4YDQ A;  1IO6 A;  1RAF B;  1ZBJ A;  4M7D E;  3P8D A;  3CC7 T;  1S72 T;  4HWR A;  4BE2 A;  2LQW A;  2LJ0 A;  3CBM A;  1QE0 A;  1UJ0 A;  2MIO A;  5GJW B;  3M4G A;  2DU5 A;  2RN8 A;  3EH2 A;  3RES A;  4CC3 A;  4F7U A;  5GJV B;  2I4O A;  2CJ9 A;  2EGE A;  4BD3 A;  4YRF A;  1M9S A;  2DZ9 A;  2K2V A;  3RNJ A;  2OTL A;  3CMA T;  4M75 G;  3UAT A;  5GAN 2;  3CCM A;  3G4S Q;  5CKE A;  5D6W A;  1MMD A;  3CCJ Q;  3THK A;  2NWM A;  1G5I A;  2KRN A;  3OYI A;  1MV0 B;  5LJ3 d;  4C5G A;  4WI1 A;  4E7H A;  2QAS A;  3G6E A;  3M59 A;  2EGC A;  5ELN A;  1YJW A;  4N0A C;  4PK4 A;  4ZGD B;  1PRL C;  4H2T A;  4M78 G;  4YRJ A;  2EYY A;  1NJ8 A;  2I4M A;  5HGQ A;  1V1C A;  2O2O A;  2PVO B;  4J9D A;  3I55 Q;  2ALY B;  4P5N A;  3FJP A;  4EMK A;  5J3B A;  1VQ6 Q;  1QMC A;  1JJ2 A;  4PKC C;  3OYL A;  2JVV A;  4ME7 A;  5K1P A;  1YIJ T;  2YUO A;  2XMF A;  1BI3 A;  3CC2 T;  2AKL A;  2DPP B;  4EO4 A;  5J26 A;  4F04 B;  3G71 A;  4XEM A;  3OBW A;  3P8V A;  1K9M C;  1H4S A;  1KK7 A;  3E1S A;  3RL6 A;  1VQ4 Q;  2DYI A;  1RI0 A;  2OAU A;  2DIQ A;  1WPY A;  3W3S A;  2V1Q A;  5IAY A;  1K0X A;  2O4X A;  2MI6 A;  4QQD A;  4ZTF A;  1ADY A;  1HK9 A;  2COW A;  4P3O A;  4CS2 A;  3UA6 A;  5HKC A;  1EIY B;  2E4H A;  3VS7 A;  2HDA A;  2PZ1 A;  2ATC B;  4C92 B;  2DRK A;  1QQJ A;  1JO8 A;  3VU3 C;  5A0D A;  3TUP A;  1M8V A;  4FYW B;  3JCM Q;  2E5A A;  5DLO A;  1USY C;  3CCS A;  4LD6 A;  1SG5 A;  4RUG A;  5GAO r;  4CC4 B;  2HEQ A;  1LYL A;  1QWE A;  2FEI A;  2ZTG A;  2DU7 A;  1SSH A;  1W4S A;  1WDX A;  2E3H A;  2LNV A;  3HXZ A;  2GQV A;  3VS2 A;  3GPL A;  1MND A;  2EAY A;  3X28 B;  1BB9 A;  4LVL A;  5GAM h;  2RJD A;  5GAN e;  1I1J A;  2WSE E;  2VB6 A;  2V8K A;  1AZE A;  3A7U A;  2RQV A;  3NTH A;  1C0M A;  3ZBD A;  3CCE Q;  2VXE A;  2EJ9 A;  1SEM A;  1Y96 A;  3I5S A;  3QBY A;  2XDD A;  2DL4 A;  3QXE B;  3EGU A;  2ZR3 A;  2L3S A;  1E7O A;  3VQW A;  3M0Q A;  5I2S A;  1B70 A;  4YYE A;  2DA9 A;  2ZIO A;  4PJO F;  2ZGW A;  4CC2 A;  1TXQ A;  3UT1 A;  4HWS A;  4K88 A;  4Z8A A;  4C8Q C;  2O31 A;  3JCM P;  4HT9 A;  4LDV A;  2C0I A;  4J6W A;  2DXU A;  2YSQ A;  2PUK B;  2OTJ Q;  3TEH A;  3VS3 A;  5CQY A;  3OYH A;  4YP0 A;  2EJG A;  4A4G A;  2QA4 T;  2QEX Q;  1M4Z A;  1WHK A;  2Y4Y A;  4J83 A;  5FRN A;  1VQ9 Q;  5FWB A;  1RAA B;  4ZGE B;  4H2V A;  3QWY A;  2RB6 A;  1FMW A;  5GAN 3;  1PSF A;  1AOJ A;  4OMP A;  3WXM B;  2V1R A;  2PVD B;  1FXX A;  2ZPF B;  2EL9 A;  1WNL A;  1FX7 A;  3CCL T;  3BJU A;  3I56 A;  1YFS A;  2HNI A;  1G83 A;  1YB3 A;  4H02 A;  1D09 B;  1U5S A;  2ZZD A;  1KQS P;  3HRS A;  2GNC A;  2MAM A;  1M1G A;  2VWF A;  3VQX A;  4C92 E;  5IHK A;  4MMK A;  3PT9 A;  4MDW A;  4UP9 A;  2G6F X;  2L3R A;  3PFS A;  5HK0 A;  1KG1 A;  5AYF A;  2ART A;  4M75 F;  5FU7 B;  2DVJ A;  3EFO A;  1I0C A;  2NYS A;  2LCC A;  4OMQ A;  1AWX A;  4P73 C;  4F7U B;  3VS0 A;  1VQ7 Q;  1D1C A;  2QYZ A;  3UGT A;  4TQF A;  1MNE A;  1G5V A;  3C95 A;  2JNG A;  2Y4X A;  2QG9 B;  3GNG A;  2RHY A;  4YTL A;  3EG0 A;  4JZ4 A;  2DER A;  1PHT A;  2E6Z A;  1PCX A;  3OMC A;  2BIV A;  3LLR A;  1IHV A;  4LNS A;  2RHZ A;  4ZTJ A;  2M51 A;  4E7K A;  4CC7 A;  2CSI A;  2ZZG A;  4E6R A;  3INZ A;  4JLG A;  4QW2 A;  1PG5 B;  3VYG A;  1AHJ B;  4M7D A;  1ARK A;  1QCN A;  3EFS A;  3REU A;  5GMK m;  4QT7 A;  1K76 A;  2NUP A;  1ZSG A;  3A5Z B;  4E2F B;  3G4S A;  1H4T A;  3CQT A;  4OGC A;  1K73 U;  3A32 A;  1P92 A;  1VQZ A;  4IKF A;  5GMK e;  4A4K A;  4QVC A;  3SHW A;  1XOV A;  4KQE A;  1D3B A;  2P4R A;  1V76 A;  2K5F A;  3P8T A;  1R0B G;  2DEQ A;  4OB0 B;  2EBP A;  1MHN A;  5IN1 A;  3I35 A;  3IAL A;  3UA7 A;  3M9Q A;  3I55 A;  5DY9 A;  2O4X B;  1X6O A;  2K7A A;  1MV3 A;  1PD1 A;  1GXI E;  1BCO A;  1PNJ A;  3PVL A;  1VQ6 A;  2ZCF B;  2CZ0 B;  1AWJ A;  5GAO n;  3MHX A;  4EX5 A;  2SEM A;  5KCH A;  2YUQ A;  1UGS B;  2DLP A;  3EG9 A;  1BIB A;  4M77 D;  5J39 A;  4HA8 A;  2O9S A;  3CBO A;  3SWN A;  1VQO Q;  4M7A A;  5C51 B;  1VQ4 A;  4IUV A;  1BBW A;  5KYX B;  5DM7 R;  1AVZ C;  4J9B A;  1ZUK A;  1BI1 A;  3J7A F;  5C6S A;  3P8Y A;  1PM3 A;  4RTX A;  1VQM T;  1TG0 A;  1JXO A;  2ESW A;  3MKD A;  1YIT Q;  1J3T A;  5D6X A;  1VQ5 A;  2YT6 A;  4M7A D;  3MQZ A;  4QQG A;  4EPC A;  3VUB A;  1M90 R;  4F7U E;  1PD0 A;  3FDR A;  4DPG A;  4H2Y A;  4RTU A;  4BY6 B;  4M7D G;  2AZS A;  2KXC A;  1BK2 A;  1KMN A;  1NJ5 A;  4FIB A;  1Y96 B;  4R0K A;  5LJ5 j;  1W70 A;  4Y91 A;  5KNN A;  3HFN A;  1RAE B;  3ZFJ A;  1KC8 U;  2EW3 A;  3X20 B;  2Q5I A;  1PKT A;  1ZBX A;  4A4E A;  1YJ9 A;  3OBY A;  5AT1 B;  4EMH A;  2IG0 A;  1B70 B;  1E22 A;  4KGX B;  2P0P A;  3JV3 A;  2YLC A;  1WLP B;  1YFT A;  2KRS A;  1FWZ A;  4OB3 B;  5KYN A;  3V7S A;  3A8L B;  1BI2 A;  4JPB W;  2LX9 A;  1HD3 A;  3FRN A;  2LQN A;  1ASY A;  4ELY C;  3JCM X;  3TEH B;  2CRE A;  3OYK A;  3JSC A;  4M4Z A;  1T3L A;  2GTJ A;  2ZZE A;  4PJL A;  4KT0 E;  4EIK A;  3J80 E;  3O5Z A;  1QVF P;  2OTL T;  3MEU A;  4AG1 C;  2EJF A;  3CCM T;  1OX8 A;  1OZ3 A;  4RTZ A;  2C0O A;  3WQZ A;  5A0L A;  3OYC A;  4OVA A;  1NYR A;  2ZPE B;  4J6Y A;  3LX7 A;  1VQ8 Q;  3G6E T;  1K1Z A;  1BCM A;  1YJW T;  4LN2 A;  4FYY B;  3L2Q A;  2QEX A;  3X24 B;  2I0N A;  3JB9 J;  1X54 A;  4JS4 A;  1VQ9 A;  1VOM A;  3PZC A;  5GAN d;  1NEG A;  2JW4 A;  1KQ2 A;  3LW5 E;  2ALY A;  4DOW A;  2ZT8 A;  2RHX A;  3BE3 A;  2CIM A;  4D8K A;  2J6K A;  4IUR A;  4HXJ A;  1Q86 U;  1BYM A;  1UHF A;  2HCK A;  4A4F A;  3CPW A;  3HY0 A;  5HCK A;  3CCQ Q;  4BAC A;  4NL3 A;  2HL3 A;  3CD6 T;  5GAM j;  3HRK A;  4OB1 B;  2CZ6 B;  2GCX A;  4J8O A;  4KR3 A;  1OU9 A;  4JJC A;  1M90 C;  4OP0 A;  2K5I A;  1KIK A;  2KMT A;  2KSS A;  3R6N A;  1XQH A;  1VQ7 A;  2M0Y A;  4XTV A;  3R07 A;  3CCV Q;  3MP8 A;  1X2K A;  4C92 A;  4YRP A;  5IH2 A;  1Z7M A;  3LC0 A;  2NUP B;  5L23 A;  4PJO A;  1W1F A;  2A8E A;  5GAN f;  2JM9 A;  2K3X A;  1U3O A;  3RKW A;  1GGM A;  2XDB A;  3EGD A;  1YHQ Q;  2YRV A;  4V2S A;  3NEN A;  2A28 A;  3CCS T;  1D3B B;  2DIL A;  3L42 A;  4DBQ A;  2X4J A;  4WF2 A;  4PFO A;  3AT1 B;  1PRM C;  1K9A A;  4DA4 A;  4PJO D;  1KHC A;  4MDX A;  2L3Q A;  2MCN A;  4FM4 B;  3ZL7 C;  5A0G A;  2KY9 A;  4CS4 A;  1M1K U;  2JTM A;  1AD5 A;  2CP0 A;  2FZC B;  4TWA A;  4HCC A;  4M77 B;  1N27 A;  2E6N A;  3OQ5 A;  4KR2 A;  3CCR Q;  4P71 C;  5GAO q;  5CO7 A;  1SHG A;  4G85 A;  2QHT A;  4BE0 A;  1H92 A;  4B9X A;  2RA2 A;  1WU7 A;  2PTK A;  2XID A;  4NS5 A;  1OYX A;  3CXC S;  2CP2 A;  3LH0 A;  4M7A B;  2ODR D;  8AT1 B;  4YRT A;  3KXT A;  2YHT A;  4OML A;  5HK3 A;  1XTD A;  5FU6 B;  3O8V A;  3REA B;  2QHV A;  4N4G A;  1YWP A;  1FMK A;  1H4Q A;  1OI1 A;  4M75 C;  1I5L A;  1HC7 A;  5C52 B;  1S1N A;  4IUQ A;  3C4S A;  2ARS A;  3HL8 A;  2JS2 A;  5LJ5 g;  4C92 G;  3ULR B;  5IHI A;  2J3L A;  2JMA A;  3MEA A;  3I56 T;  3A8G B;  4M78 C;  2OI3 A;  1YIT A;  1K8A R;  3M4P A;  1S72 Q;  5KCO A;  1QVF A;  4MZM A;  3VYH B;  5LJ5 e;  3DLL A;  1LCK A;  4BDZ A;  4OMN A;  2R58 A;  2HSP A;  2HBW A;  1NEB A;  1D0Z A;  2K3Y A;  2DEU A;  2LJ1 A;  4HT4 A;  3QHS A;  2HZY A;  2E70 A;  2KVQ G;  3FEO A;  1D0Y A;  1B3Q A;  4AFQ C;  1SER A;  5EG2 A;  2OJ2 A;  1U1T A;  1Y57 A;  1W2B S;  2Q7G A;  1RL2 A;  2X3X D;  1UEB A;  1QVG S;  4J9I A;  4N0A A;  2KK4 A;  3JCM f;  3M54 A;  3GIB A;  3GP8 A;  1WHM A;  2KE9 A;  1WQ7 A;  4M77 E;  4PLL A;  1NYQ A;  2HKQ B;  4IIO A;  2KAF A;  1PC0 A;  4L6V 5;  2FHD A;  2K4Y A;  2KBT A;  2OX7 A;  3PMT A;  1WI7 A;  2DK3 A;  3JB9 G;  1VIF A;  2QQA A;  3HY1 A;  3A5Z A;  1M1F A;  3G4S T;  2YRD A;  3AHU A;  2FVU A;  3L2Z A;  5GAN 8;  1QP3 A;  1E1O A;  1X2H A;  3L4G A;  1Q82 R;  4M7A E;  2ZT5 A;  4RDX A;  2HBP A;  1VQP A;  1VQK Q;  5CCA A;  1IZ6 A;  4LE9 A;  1VQ8 A;  2CP5 A;  4ANJ A;  1GCP A;  1IGU A;  2M9U A;  3HXW A;  2JMC A;  3HKS A;  2MF2 A;  3QZ9 B;  1N6A A;  5LJ3 f;  2MYS A;  1N8R R;  4LUD A;  2K79 A;  5LL6 S;  1QP2 A;  2FB7 A;  3MF2 A;  3I55 T;  4EMK C;  3M0S A;  4H2X A;  4TVW A;  1M30 A;  3TSW A;  2LT4 A;  1ATI A;  1KC8 R;  3LGL A;  4RQF A;  1UJY A;  1M8M A;  4P72 A;  4PHC A;  1YN8 A;  3OW2 P;  1EFW A;  3E9I A;  2Y90 A;  1F1B B;  2HAX A;  1SRL A;  4PJO B;  1USY A;  2QTX A;  3CBP A;  4F7U G;  5GAO l;  3CCQ A;  3EGD B;  4YCV A;  4YRQ A;  1CKB A;  3U23 A;  2BTT A;  1K8A C;  3EFR A;  4CI0 C;  1AZG B;  1E6G A;  5KYX A;  2FYK A;  2COY A;  4D6W A;  1WX6 A;  2HL5 C;  3M0R A;  1OEB A;  3OYE A;  1QKX A;  1TU0 B;  4N4I A;  2DDZ A;  1A0N B;  3QJY A;  3R6O A;  2BKD N;  3PTA A;  1B8A A;  2XTI A;  5GMK l;  4P74 A;  4C0D B;  1TUG B;  1KD1 R;  1VQ5 T;  2VVK A;  4JRI A;  2ED1 A;  3UH0 A;  5CKH A;  1TUC A;  3MO8 A;  3OYM A;  1YHQ A;  3PE0 A;  5CIU A;  3KBG A;  4IUP A;  1EX4 A;  4F16 A;  2YXY A;  3RKY A;  3D7S B;  3C94 A;  4H2W A;  2RJE A;  2LNH B;  1YJ9 T;  3IKM B;  3NEM A;  4OB2 B;  2KYM A;  3PMI A;  3ERR A;  4C8Q A;  3FJ5 A;  4FT4 A;  4Y28 E;  3DLM A;  2DL7 A;  1HYO A;  3UF4 A;  2Q7H A;  4A63 B;  1X6B A;  1YP5 A;  2QDL A;  2RQR A;  1SF9 A;  4YRS A;  2JXB A;  1NBE B;  1TS9 A;  4C8Q D;  3OYF A;  1ZSZ C;  1ABQ A;  1Q82 C;  1TWB A;  1OQK A;  4XEO A;  4AH6 A;  2AT1 B;  3QG1 A;  5GAN h;  3VQY A;  1UEC A;  1MMN A;  3LGF A;  2QTV A;  2ROT A;  3MP6 A;  3QO3 A;  4Z89 A;  2DBM A;  4HVW A;  3CCL Q;  3CCU A;  1N8R C;  1Q81 R;  3BFM A;  4JRP A;  2E5K A;  3M55 A;  1LNX A;  2M0O A;  1UGP B;  5KYY B;  1X2G A;  4IUU A;  4GLK A;  2VV5 A;  4CH4 A;  1G3Y A;  1KC8 C;  3M4Y A;  1JJ2 S;  2QEX T;  2VUB A;  2ZZF A;  1XNI A;  4F14 A;  2J6F A;  4AFZ C;  1VQL T;  1RAD B;  2C06 A;  3JCM J;  1VQ9 T;  4PJO E;  1YJN Q;  2CS7 A;  3CXC P;  4P73 A;  5K1X A;  1B07 A;  1Q7Y R;  1WHJ A;  5CK9 A;  2FPD A;  1IRE B;  1KQ1 A;  2DQ3 A;  2KXD A;  2CZ1 B;  5GMK i;  1WYD A;  1WLE A;  1S72 A;  1VQN Q;  1CKA A;  2NUT A;  2A3L A;  2F69 A;  1R8O B;  2FG0 A;  2F2X A;  1QF6 A;  4XTY A;  2ZNJ A;  3QPH A;  1TSF A;  1H4V B;  5I11 A;  1KD1 C;  1OOT A;  1ZQ1 A;  2HKN A;  2JJ9 A;  3H0I A;  5M9O A;  3E9G A;  1K9M U;  4M78 F;  3CME T;  2M16 A;  4KUD K;  2DXB A;  4YRK A;  1VQ7 T;  2MK5 A;  2D0Q B;  1IRX A;  2RI3 A;  5GAN 6;  4YRE A;  3HXU A;  2PU9 B;  3CCJ A;  4RKU E;  3H9N A;  4ZNX A;  3HFO A;  2RD1 A;  2EKH A;  3RDV A;  3L4G B;  2QHS A;  1NJ6 A;  4AFS C;  1WHL A;  3M0T A;  3OW2 A;  2ZT6 A;  2NUZ A;  2EQJ A;  4HVV A;  4EDU A;  1IB8 A; 
#chains in the Genus database with same CATH homology
 4FT2 A;  4M7D C;  2DXC A;  2CZ7 B;  3SDZ A;  3HXX A;  1DJ7 B;  5IT9 E;  4II1 A;  3FLG A;  4H2X B;  4M77 A;  5LJ5 d;  1EVK A;  4F7U F;  4G84 A;  1VQK A;  4RQE A;  1JRI A;  1YI2 T;  1Q81 C;  1NNH A;  1VUB A;  2AKW B;  3L2V A;  4HWT A;  5GMK h;  4HCB A;  3JCM h;  3WVE B;  3A7A A;  2ZXF A;  2JOY A;  2MWO A;  4XU1 A;  4WJ3 M;  2I4L A;  5GAO p;  2RJF A;  3MP1 A;  4HKE A;  1Q7Y C;  3FC3 A;  2E5Q A;  1V29 B;  4BDY A;  3MEW A;  5LJ5 f;  1Y07 A;  3SWN C;  1N9R A;  2EYQ A;  2K57 A;  3E9H A;  1YCY A;  4JRK A;  1M1K C;  5GAN 5;  4Z02 A;  3A7R A;  4C8Q B;  4CH5 A;  4HWO A;  5LJ3 h;  4FL6 A;  2NLU A;  5D6Y A;  4JJN K;  1YGB A;  1YIT T;  1X56 A;  2RHQ A;  3OA6 A;  3CCE A;  1NZ9 A;  2J3M A;  2X35 A;  2XK0 A;  3OYA A;  2XD0 A;  4M77 G;  3HHT B;  4OF1 A;  3DSQ A;  11AS A;  1KQS A;  4PNO A;  1G51 A;  2DIG A;  3OYJ A;  3DKM A;  2VGN A;  3V7R A;  1G3T A;  1EVL A;  5ELO A;  1EIF A;  4OGE A;  3CXC A;  1VIE A;  4E7L A;  2OTJ A;  4M7A G;  1B7Y A;  2X4W A;  3Q1J A;  4BI3 A;  5FLX E;  4TVY A;  2JUF A;  4X9D A;  3UDC A;  2VXF A;  3GOX A;  4B9W A;  2JN0 A;  3QNE A;  4OMF B;  3CCL A;  3LWH A;  4X34 A;  4LVI A;  2CJB A;  1X01 A;  3OMG A;  4BW9 A;  4HVC A;  3ME9 A;  4LVK A;  4XTZ A;  3OSS C;  3GF5 A;  1VQP T;  2XI9 A;  4J7I A;  3JCM b;  3RAC A;  1VQ8 T;  3OY9 A;  3G7Z A;  2R57 A;  4YPF A;  1NJ1 A;  4IUT A;  1N9S A;  2DJZ A;  3G71 T;  2QDY B;  3P8H A;  2RHI A;  1YJN A;  1EQR A;  3QO7 A;  3GLX A;  2ZIM A;  1Y7X A;  1YBY A;  3KFU A;  1NE8 A;  2KDS A;  1VQN A;  1OZ2 A;  3HXY A;  4C8Q E;  5FRM A;  2D9T A;  4P75 C;  1W2B A;  4YRR A;  2D6F A;  1TH7 A;  2XGT A;  3FIF A;  2E65 A;  3HXV A;  3OS5 A;  4CH3 A;  3PIP A;  4TVA A;  4C92 C;  3GNF B;  1ADJ A;  2ZPG B;  2BUD A;  5GAN j;  2Q7E A;  5HY6 A;  3OS2 A;  2P0Q A;  3JRZ A;  3NEL A;  1YHQ T;  3HRI A;  4XTW A;  1QVP A;  3QUI A;  4R55 A;  2G4C A;  4XQ3 A;  2EQU A;  3BDU A;  2LDM A;  1LJO A;  3M5A A;  2EKO A;  3IKL A;  4LDU A;  1IL2 A;  2O01 E;  1PYS A;  2X4X A;  4M75 A;  3BDL A;  4M7D F;  2HD0 A;  3RUX A;  3QJ6 A;  1M5Q 1;  2R5A A;  4WJ4 A;  4MML A;  4ELZ C;  2F5K A;  3A8O B;  4C5H A;  3QTC A;  1VQO A;  3HTZ A;  1JJC A;  4P3N A;  4M75 D;  4MZP A;  4PJO G;  4E7J A;  4NCX A;  3ASK A;  2AMC A;  3M57 A;  2QHU A;  3P8B B;  3CCU T;  2QI2 A;  2B8A A;  2MMP A;  5KE3 A;  2DTI A;  2LTO A;  2WSF E;  5CR2 A;  2RO0 A;  4RMF A;  1X75 C;  2RHQ B;  1KHI A;  2YLB A;  3TCJ A;  2XG8 D;  3BY7 A;  4ZTZ B;  4K87 A;  1NJ2 A;  4K86 A;  4R56 A;  3RKX A;  2LVM A;  4E47 A;  4M78 D;  3LSQ A;  4YCW A;  3LYI A;  4VUB A;  3CPW S;  2V8I A;  3JB9 I;  3UWN A;  2DXT A;  5CAI A;  4L87 A;  4C0G A;  3QKJ A;  3TEG A;  4DOV A;  2ZR2 A;  2L8D A;  2VGM A;  4M7A F;  2ZIN A;  4BE1 A;  4C5E A;  1G3S A;  1JBM A;  2M1H A;  1B7Y B;  1JB0 E;  5FU7 C;  4TTV A;  4YRO A;  3E9F A;  1M90 U;  3M58 A;  4TVR A;  5FRO A;  3MEV A;  5LJ5 h;  1NJI U;  5I21 A;  3OYB A;  3CCJ T;  2LQ8 A;  3NFC A;  5GMK j;  3HP9 A;  3A8H B;  2CKK A;  4YRC A;  2H3J A;  3REX A;  4YRI A;  4ZN3 A;  3L2W A;  2P0K A;  4J15 A;  4FSX A;  2RJC A;  3TU4 K;  5GAM g;  1I81 A;  5GAN 7;  4RG8 A;  4L59 A;  4EMG A;  2LT1 A;  4QVZ A;  3L1A A;  2L89 A;  2E10 A;  1VQ6 T;  4PLI A;  1O9S A;  1VQK T;  4ZIB A;  3BW1 A;  3CD6 A;  3V7C A;  1B34 B;  5GAM e;  3NTK A;  2AKW A;  3L2U A;  2HQX A;  4UP8 A;  5LJ3 j;  5CQX A;  4O6J A;  2AHJ B;  3H6Z A;  3QII A;  1VQ4 T;  2ZT7 A;  4Q5W A;  3OD1 A;  1ZHI A;  1K73 C;  3CC4 A;  3C12 A;  3M56 A;  3VUZ A;  4P72 C;  4TVA B;  3CCV A;  3IG2 A;  5GAN g;  3ICA A;  1SRY A;  4JS5 A;  3TEE A;  4XU2 A;  2R5M A;  4KBM B;  3OYD A;  12AS A;  2ZPH B;  4RCC A;  2E3C A;  1C0A A;  2C8M A;  1WJS A;  1QVF S;  2PQW A;  3H8Z A;  3LSS A;  2WAC A;  4N4H A;  4C0Z A;  4LVM A;  4JRQ A;  3G1Z A;  2JTF A;  4X5O A;  4P74 C;  1I8F A;  5L8R E;  1G5H A;  3PIO A;  4X9C A;  4BY6 C;  5GAN 4;  1PYS B;  2RH2 A;  4M75 B;  4XU3 A;  3SFM A;  3CCE T;  3CCR A;  3T9N A;  3S6W A;  1G3W A;  2VYT A;  1UGR B;  4C92 F;  3OS0 A;  1X55 A;  2XKO C;  2PVG B;  3RMS A;  3PNW C;  1JJC B;  4GY5 A;  2E12 A;  2IY5 A;  2AMC B;  3WVD B;  2EWN A;  2RK1 A;  4M78 B;  1UB4 A;  2OTJ T;  3M53 A;  1QW1 A;  3HPW A;  3HFZ A;  4NL2 A;  2G3R A;  3MCA B;  2DO3 A;  4DQ2 A;  1KMM A;  2I4N A;  2PME A;  3EAE A;  2DAQ A;  1BKB A;  3F70 A;  4BB7 A;  4BI4 A;  3CC7 A;  3NET A;  1H64 1;  4J5Y A;  1YFR A;  2DQ0 A;  3FB9 A;  4C8Q G;  2XU8 A;  3VV0 A;  1WJR A;  2E41 A;  1O75 A;  3RGL A;  2DD5 A;  3RMQ A;  1ASZ A;  1YJN T;  3CMA A;  4LVJ A;  3JB9 F;  2DVE A;  2GFA A;  2XHC A;  2DZC A;  4A4H A;  3JCM W;  2P0L A;  2C7I A;  4HCZ A;  1WQW A;  3V8L A;  5A2Q E;  5GAO m;  3A8M B;  4CS3 A;  3UPU A;  4HWP A;  2E64 A;  3PGG A;  3X25 B;  2ZPB B;  2A7Y A;  1VQN T;  3JCM g;  3RF1 A;  2CGH A;  3QSU A;  3MET A;  4E51 A;  3PCO A;  1K8A U;  4E7I A;  3I7F A;  2DKG A;  3HFV A;  2GF7 A;  4M75 E;  3M4Q A;  4YRN A;  5CVI A;  5CKD A;  5I2M A;  3DB4 A;  2RHU A;  4EMK B;  2Q5H A;  2K5L A;  3VBB A;  1BIA A;  1YIJ A;  3JCM e;  1Q86 C;  4LD9 K;  3CC2 A;  4KUI A;  3JB9 H;  4M7D D;  4YCU A;  1E24 A;  1BBU A;  1LOJ A;  2EQM A;  4PL6 A;  3S3N A;  4M78 E;  5LJ3 g;  4LDW A;  4KUL A;  3E19 A;  3A31 A;  1E1T A;  4XTX A;  1I4K 1;  4M77 C;  2RM4 A;  4H2S A;  2ZNI A;  5F5W A;  4MZT A;  2EQK A;  2LQK A;  3SD4 A;  3SB2 A;  5CKB A;  3V8J A;  4O5V A;  2RI2 A;  4XU0 A;  3QYH B;  5LJ3 e;  4OLF A;  4C0F A;  2XIC A;  3OB9 A;  2EIF A;  4M7A C;  1Q82 U;  3URG A;  3UFG A;  1VQO T;  2MWP A;  5FU6 C;  1N8R U;  4CRI A;  2I2L A;  4YRG A;  3UGQ A;  2PUO B;  1N9W A;  3S3O A;  1J5W A;  5E3I A;  4JDS A;  1NPR A;  2XDP A;  4UPA A;  3LWI A;  2RHS A;  4ZTU B;  2VC8 A;  3QO8 A;  4PG3 A;  3JAM E;  4JLI A;  1U1S A;  3OS1 A;  4NOY A;  3A74 A;  4LDY A;  5GAM d;  2IY5 B;  4HT8 A;  3QZ5 B;  2QA4 A;  1B76 A;  2LRQ A;  5DLQ E;  3TRE A;  2F5T X;  3VJP A;  1KD1 U;  3L2R A;  3HFZ B;  3VKI A;  1SSF A;  1RIQ A;  3HSB A;  1L0W A;  3OW2 S;  3ER0 A;  1H3Z A;  1SET A;  2FL7 A;  4Q15 A;  4J7F A;  2CYZ B;  3DB3 A;  3X26 B;  1BI0 A;  1NPP A;  4C8Q F;  5KE2 A;  1MGQ A;  1VQL A;  4XTU A;  2QQ9 A;  4CH6 A;  5GAM f;  4A53 A;  3V8K A;  4C5I A;  1FYF A;  5C53 B;  4J6X A;  3OYY A;  4ZGJ B;  2QQR A;  3QO5 A;  2GFU A;  4A54 A;  2X4Y A;  1B34 A;  1PSE A;  4YRL A;  1Q81 U;  4P75 A;  3CCQ T;  5CKF A;  3CME A;  4P3P A;  3PCO B;  4FU6 A;  1NJI C;  2E1H A;  1EIY A;  3NTI A;  3CMQ A;  1QVG A;  3RER A;  4M7D B;  2P4T A;  2ARU A;  2PMF A;  3N5B B;  2ZPI B;  4UC4 A;  3CC4 T;  2QQB A;  2HQE A;  4ZN1 A;  3CCV T;  4PJO C;  2KQW A;  4L5G A;  4YRM A;  3ZEH A;  1HXD A;  3OYG A;  2LCL A;  1Q7Y U;  3JCM V;  4P71 A;  4RG2 A;  3JCM c;  3KUF A;  2LC4 A;  4TQD A;  2V8J A;  4C92 D;  4QQ6 A;  4O2D A;  2RK2 A;  1Z7N A;  2CJA A;  5C0M A;  3HRT A;  3RIR A;  2RI5 A;  2JZ2 A;  3MEY A;  3OYN A;  4H2U A;  4ATO A;  1KOG A;  4C0D C;  3CEY A;  3HRU A;  3MF1 A;  1UGQ B;  1KQS S;  2WSC E;  4BUG A;  2ODR C;  1YI2 A;  2QQS A;  3CCR T;  1HTT A;  5KH6 A;  3SWN B;  1WJQ A;  2DTH A;  4RMO A;  4QVD A;  3A5Y A;  2NS6 A;  2EFI A;  4JUV A;  2L5Q A;  1VQM A;  2ZCE A;  4M78 A;  1U8R A;  2DD4 A;  3QDR B;  4BI8 B;  4RCB A;  3QYG B;  4XK8 E;  1Y71 A;  2QXF A;  1W66 A;  4M77 F;  4Q6G A;  3VQV A;  1SES A;  3S3M A;  1WGS A;  4BWA A;  3JB9 D;  3J81 E;  3JCM d;  4LDX A;  2RHS B;  4UP7 A;  4XAX B;  3CPF A;  3OSV A;  2DTO A;  2P5I A;  1EOV A;  2IVW A;  4YDQ A;  4M7D E;  3P8D A;  3CC7 T;  1S72 T;  4HWR A;  4BE2 A;  3CBM A;  1QE0 A;  3M4G A;  2DU5 A;  3RES A;  4F7U A;  2I4O A;  2CJ9 A;  4BD3 A;  4YRF A;  1M9S A;  2DZ9 A;  2K2V A;  2OTL A;  3CMA T;  4M75 G;  5GAN 2;  3CCM A;  5CKE A;  5D6W A;  1G5I A;  3OYI A;  5LJ3 d;  4C5G A;  4WI1 A;  4E7H A;  3G6E A;  3M59 A;  5ELN A;  1YJW A;  4N0A C;  4ZGD B;  4H2T A;  4M78 G;  4YRJ A;  5HGQ A;  1NJ8 A;  2I4M A;  2PVO B;  2ALY B;  4P5N A;  3FJP A;  4EMK A;  5J3B A;  1JJ2 A;  4PKC C;  3OYL A;  2JVV A;  4ME7 A;  5K1P A;  1YIJ T;  1BI3 A;  3CC2 T;  2DPP B;  4EO4 A;  5J26 A;  3G71 A;  4XEM A;  3OBW A;  3P8V A;  1K9M C;  1H4S A;  3E1S A;  3RL6 A;  1RI0 A;  2OAU A;  2DIQ A;  1WPY A;  3W3S A;  5IAY A;  2O4X A;  2MI6 A;  4QQD A;  4ZTF A;  1ADY A;  1HK9 A;  4P3O A;  4CS2 A;  5HKC A;  1EIY B;  4C92 B;  3VU3 C;  5A0D A;  3TUP A;  1M8V A;  3JCM Q;  2E5A A;  5DLO A;  1USY C;  3CCS A;  4LD6 A;  5GAO r;  1LYL A;  2ZTG A;  2DU7 A;  1W4S A;  3HXZ A;  2LNV A;  2GQV A;  3GPL A;  2EAY A;  3X28 B;  4LVL A;  5GAM h;  2RJD A;  5GAN e;  2WSE E;  2V8K A;  3A7U A;  3NTH A;  3ZBD A;  2VXE A;  2EJ9 A;  1Y96 A;  3QBY A;  2XDD A;  3QXE B;  2ZR3 A;  3VQW A;  5I2S A;  1B70 A;  4YYE A;  2ZIO A;  4PJO F;  2ZGW A;  4HWS A;  3UT1 A;  4K88 A;  4C8Q C;  3JCM P;  4HT9 A;  4LDV A;  4J6W A;  2DXU A;  2PUK B;  3TEH A;  5CQY A;  3OYH A;  4YP0 A;  2EJG A;  4A4G A;  2QA4 T;  1M4Z A;  2Y4Y A;  4J83 A;  5FRN A;  4ZGE B;  4H2V A;  2RB6 A;  5GAN 3;  1PSF A;  3WXM B;  2PVD B;  1FXX A;  2ZPF B;  2EL9 A;  1WNL A;  1FX7 A;  3CCL T;  3BJU A;  3I56 A;  1YFS A;  2HNI A;  1YB3 A;  4H02 A;  2ZZD A;  3HRS A;  2MAM A;  1M1G A;  3VQX A;  4C92 E;  4MMK A;  3PT9 A;  4MDW A;  4UP9 A;  2L3R A;  3PFS A;  5HK0 A;  1KG1 A;  5AYF A;  2ART A;  4M75 F;  5FU7 B;  2LCC A;  4P73 C;  4F7U B;  3UGT A;  4TQF A;  1G5V A;  3C95 A;  2JNG A;  2Y4X A;  3GNG A;  2RHY A;  4YTL A;  2E6Z A;  3OMC A;  2BIV A;  3LLR A;  4LNS A;  2RHZ A;  4ZTJ A;  4E7K A;  2ZZG A;  3INZ A;  4JLG A;  4QW2 A;  3VYG A;  1AHJ B;  4M7D A;  3EFS A;  3REU A;  5GMK m;  3A5Z B;  3G4S A;  1H4T A;  4OGC A;  1K73 U;  3A32 A;  1P92 A;  1VQZ A;  4IKF A;  5GMK e;  4A4K A;  4QVC A;  1XOV A;  4KQE A;  1D3B A;  2K5F A;  3P8T A;  2DEQ A;  4OB0 B;  1MHN A;  5IN1 A;  3IAL A;  3M9Q A;  3I55 A;  5DY9 A;  2O4X B;  1X6O A;  1GXI E;  1VQ6 A;  2ZCF B;  2CZ0 B;  5GAO n;  3MHX A;  4EX5 A;  5KCH A;  1UGS B;  1BIB A;  4M77 D;  5J39 A;  4HA8 A;  3CBO A;  3SWN A;  4M7A A;  5C51 B;  1VQ4 A;  4IUV A;  1BBW A;  5DM7 R;  1BI1 A;  3J7A F;  5C6S A;  3P8Y A;  1VQM T;  5D6X A;  1VQ5 A;  4M7A D;  3MQZ A;  4QQG A;  4EPC A;  3VUB A;  4F7U E;  3FDR A;  4DPG A;  4H2Y A;  4BY6 B;  4M7D G;  1KMN A;  1NJ5 A;  4FIB A;  1Y96 B;  5LJ5 j;  4Y91 A;  5KNN A;  3HFN A;  3ZFJ A;  1KC8 U;  3X20 B;  2Q5I A;  1YJ9 A;  1ZBX A;  4A4E A;  3OBY A;  4EMH A;  2IG0 A;  1B70 B;  1E22 A;  2P0P A;  2YLC A;  1YFT A;  1FWZ A;  4OB3 B;  3V7S A;  3A8L B;  1BI2 A;  2LX9 A;  3FRN A;  1ASY A;  4ELY C;  3JCM X;  3TEH B;  3OYK A;  3JSC A;  2ZZE A;  4KT0 E;  3J80 E;  2OTL T;  3MEU A;  2EJF A;  3CCM T;  1OZ3 A;  3WQZ A;  5A0L A;  3OYC A;  4OVA A;  1NYR A;  2ZPE B;  4J6Y A;  3LX7 A;  3G6E T;  1YJW T;  2QEX A;  3L2Q A;  3X24 B;  3JB9 J;  1X54 A;  4JS4 A;  1VQ9 A;  3PZC A;  5GAN d;  1KQ2 A;  3LW5 E;  2ALY A;  4DOW A;  2ZT8 A;  2RHX A;  2CIM A;  1BYM A;  4IUR A;  1Q86 U;  4A4F A;  3CPW A;  3HY0 A;  4BAC A;  4NL3 A;  3CD6 T;  5GAM j;  3HRK A;  4OB1 B;  2CZ6 B;  2GCX A;  4J8O A;  4KR3 A;  1M90 C;  4OP0 A;  2K5I A;  2KMT A;  2KSS A;  1XQH A;  1VQ7 A;  4XTV A;  3R07 A;  3MP8 A;  4C92 A;  4YRP A;  1Z7M A;  3LC0 A;  4PJO A;  2A8E A;  5GAN f;  2K3X A;  3RKW A;  1GGM A;  2XDB A;  2YRV A;  4V2S A;  3NEN A;  3CCS T;  1D3B B;  3L42 A;  2X4J A;  4WF2 A;  4DA4 A;  4PJO D;  1KHC A;  4MDX A;  4FM4 B;  5A0G A;  2KY9 A;  4CS4 A;  1M1K U;  2JTM A;  4TWA A;  4HCC A;  4M77 B;  1N27 A;  2E6N A;  3OQ5 A;  4KR2 A;  4P71 C;  5GAO q;  5CO7 A;  4G85 A;  2QHT A;  4BE0 A;  4B9X A;  2RA2 A;  1WU7 A;  2XID A;  4NS5 A;  1OYX A;  3CXC S;  3LH0 A;  4M7A B;  2ODR D;  4YRT A;  3KXT A;  2YHT A;  5HK3 A;  1XTD A;  5FU6 B;  3O8V A;  2QHV A;  4N4G A;  1H4Q A;  1OI1 A;  4M75 C;  1I5L A;  1HC7 A;  5C52 B;  4IUQ A;  3C4S A;  2ARS A;  3HL8 A;  5LJ5 g;  4C92 G;  2J3L A;  3MEA A;  3I56 T;  3A8G B;  4M78 C;  1YIT A;  3M4P A;  5KCO A;  1QVF A;  4MZM A;  3VYH B;  5LJ5 e;  3DLL A;  4BDZ A;  2R58 A;  2K3Y A;  4HT4 A;  3QHS A;  2KVQ G;  2E70 A;  3FEO A;  1SER A;  5EG2 A;  1U1T A;  1W2B S;  2Q7G A;  1RL2 A;  1QVG S;  1UEB A;  4N0A A;  2KK4 A;  3JCM f;  3M54 A;  3GIB A;  3GP8 A;  1WQ7 A;  4M77 E;  4PLL A;  1NYQ A;  2KAF A;  4L6V 5;  2FHD A;  2K4Y A;  3PMT A;  2DK3 A;  3JB9 G;  2QQA A;  1VIF A;  3HY1 A;  3A5Z A;  1M1F A;  3G4S T;  3AHU A;  2FVU A;  3L2Z A;  5GAN 8;  1QP3 A;  1E1O A;  1X2H A;  3L4G A;  4M7A E;  4RDX A;  2ZT5 A;  2HBP A;  1VQP A;  5CCA A;  1IZ6 A;  1VQ8 A;  2M9U A;  3HXW A;  3HKS A;  2MF2 A;  3QZ9 B;  1N6A A;  5LJ3 f;  5LL6 S;  1QP2 A;  2FB7 A;  3MF2 A;  3I55 T;  4EMK C;  4TVW A;  4H2X A;  1ATI A;  2LT4 A;  3LGL A;  4RQF A;  4P72 A;  4PHC A;  1EFW A;  3E9I A;  2Y90 A;  2HAX A;  4PJO B;  1USY A;  2QTX A;  3CBP A;  4F7U G;  5GAO l;  3CCQ A;  4YCV A;  4YRQ A;  1K8A C;  3EFR A;  4CI0 C;  2FYK A;  4D6W A;  3OYE A;  4N4I A;  2DDZ A;  3QJY A;  3R6O A;  2BKD N;  3PTA A;  1B8A A;  2XTI A;  5GMK l;  4P74 A;  4C0D B;  1VQ5 T;  4JRI A;  3UH0 A;  5CKH A;  3MO8 A;  3OYM A;  1YHQ A;  5CIU A;  3KBG A;  4IUP A;  3RKY A;  3C94 A;  4H2W A;  2RJE A;  1YJ9 T;  3IKM B;  3NEM A;  4OB2 B;  3PMI A;  3ERR A;  4C8Q A;  4FT4 A;  4Y28 E;  3DLM A;  2Q7H A;  4YRS A;  4C8Q D;  3OYF A;  1Q82 C;  4XEO A;  4AH6 A;  5GAN h;  3QG1 A;  3VQY A;  3LGF A;  3MP6 A;  3QO3 A;  3CCU A;  1N8R C;  3BFM A;  4JRP A;  3M55 A;  1LNX A;  2M0O A;  1UGP B;  1X2G A;  4IUU A;  4GLK A;  2VV5 A;  4CH4 A;  1G3Y A;  1KC8 C;  3M4Y A;  1JJ2 S;  2QEX T;  2VUB A;  2ZZF A;  1XNI A;  1VQL T;  2C06 A;  3JCM J;  1VQ9 T;  4PJO E;  2CS7 A;  4P73 A;  5K1X A;  5CK9 A;  1IRE B;  1KQ1 A;  2DQ3 A;  2CZ1 B;  5GMK i;  1WYD A;  1WLE A;  1S72 A;  2A3L A;  2F69 A;  1R8O B;  1QF6 A;  4XTY A;  2ZNJ A;  3QPH A;  1H4V B;  1KD1 C;  1ZQ1 A;  5M9O A;  3E9G A;  1K9M U;  4M78 F;  3CME T;  2M16 A;  4KUD K;  2DXB A;  4YRK A;  1VQ7 T;  2D0Q B;  2RI3 A;  5GAN 6;  4YRE A;  3HXU A;  2PU9 B;  3CCJ A;  4RKU E;  3HFO A;  2RD1 A;  3L4G B;  2QHS A;  1NJ6 A;  3OW2 A;  2ZT6 A;  2EQJ A;  4EDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...