2EJ9A

Crystal structure of biotin protein ligase from methanococcus jannaschii
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
237
structure length
237
Chain Sequence
MEIIHLSEIDSTNDYAKELAKEGKRNFIVLADKQNNGKGRWGRVWYSDEGGLYFSMVLDSKLYNPKVINLLVPICIIEVLKNYVDKELGLKFPNDIMVKVNDNYKKLGGILTELTDDYMIIGIGINVNNQIRNEIREIAISLKEITGKELDKVEILSNFLKTFESYLEKLKNKEIDDYEILKKYKKYSITIGKQVKILLSNNEIITGKVYDIDFDGIVLGTEKGIERIPSGICIHVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Putative biotin ligase
publication title Crystal Structure Of Biotin Protein Ligase From Methanococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
total genus 74
structure length 237
sequence length 237
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ej9A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ej9A01
3HXUA 1X01A 2CIMA 3JB9G 3P8TA 2EL9A 4PJOG 3QTCA 2RHSA 2EWNA 5C53B 4KR3A 1WYDA 4ZTZB 2E41A 4Y91A 4BWAA 2RA2A 2DDZA 2E65A 4XTUA 2ZXFA 4PJOC 3A32A 2EJFA 3V8KA 3A5YA 3TUPA 3SB2A 1E1OA 3PCOA 3G1ZA 1USYC 3VBBA 1HXDA 5F5WA 2ARTA 2E1HA 1WPYA 2ZNJA 4C8QE 3NENA 1B76A 2P5IA 3HFZA 3JCMg 3SWNB 4EMKA 5GMKl 2RB6A 5LJ5e 5LJ5h 1NJ6A 3HFOA 5GANe 5GANh 1NJ5A 2XTIA 1BIAA 1B34B 3FIFA 1NJ8A 4UP8A 5LJ3j 3JB9F 4J6WA 4PJOF 4H02A 1KOGA 4QVCA 2HNIA 1EQRA 4RCBA 4YYEA 1M5Q1 3MF1A 4EMGA 2PMEA 4M78E 1ASYA 3BDUA 4J5YA 3HRKA 3FJPA 3AHUA 4F7UA 1I8FA 5C51B 4WI1A 4CH6A 2ARUA 2I4OA 5GANf 4RQFA 4H2TA 2RHQB 2ZT5A 5LJ3f 3W3SA 4TVAB 1NYRA 2Q5IA 3L4GB 3UFGA 3VQVA 4EO4A 3PZCA 4ZTUB 4M7AD 2DEQA 2PMFA 1WQWA 3V7SA 2DTIA 3FB9A 1BIBA 4M7AB 1IL2A 3A7AA 2DXUA 3EFRA 3MF2A 2AKWA 4JLIA 4YREA 2ODRC 1U1SA 1YCYA 4YCVA 4HWPA 1ADJA 4J15A 1E24A 1D3BA 2I4MA 3QUIA 4F7UF 4XU1A 3JCMd 1KMMA 3BW1A 2ZINA 2K57A 4YRNA 2E64A 4J6YA 3RESA 3JCMc 2ZT8A 4KQEA 4YRQA 3PGGA 5GMKe 5GMKh 3ICAA 1YFTA 2QHTA 2DZCA 1YGBA 5LJ5g 2I2LA 5GANg 4RDXA 4H2YA 4H2VA 3NEMA 1EVKA 3JCMf 4DPGA 5GAMe 5GAMh 4G85A 1WQ7A 4HVCA 4JUVA 2RHSB 2DKGA 4RMFA 2ZT6A 5GAN8 3JB9D 3QO5A 2C8MA 4HWSA 4PJOD 1N9WA 2VXEA 4P3OA 4PJOB 1G5HA 2ZIOA 4HWOA 2CGHA 4XQ3A 3HFNA 1E22A 2ZZGA 2QHVA 3HXVA 4PJOA 3VQXA 4H2WA 3PCOB 5KNNA 3RUXA 2ZT7A 3IKMB 3V8JA 4TTVA 4M75G 4MMLA 3HTZA 1USYA 4YP0A 3RERA 3JCMJ 3HXYA 4EX5A 2YHTA 3A31A 4P73C 5GAOn 2ZZEA 1QE0A 5ELNA 4NCXA 4CS3A 3L2ZA 2DTOA 3HFZB 4E51A 3TEGA 4XU3A 3P8YA 4EMKB 3A7UA 2DU7A 1U1TA 2RD1A 4M75A 2IY5A 3HFVA 4M75C 5GAOl 4DQ2A 4G84A 4YRRA 1WNLA 1N9SA 3A74A 1X2GA 2EJGA 4M77E 5LJ5j 4P3NA 1VQZA 3LSQA 5GANj 1ATIA 1M8VA 1KQ1A 2YLBA 4UPAA 3BJUA 4YCUA 4V2SA 5GANd 3RKXA 2ARSA 5K1PA 1B70B 5LJ3d 4XTZA 4F7UB 3HXWA 2FYKA 1B70A 4K88A 4YRCA 4M7AE 4P72C 4YRTA 1E1TA 2QTXA 3M4GA 1W66A 5GAMg 4J6XA 5LJ5f 3SWNC 4A53A 1WU7A 3HY0A 1H4QA 2Y90A 3QO8A 4M75F 4C8QG 2AMCA 3DSQA 3CMQA 4OP0A 2QHUA 3A5ZA 4CH3A 3L1AA 1BBUA 4CH5A 4XU2A 3JCMW 2DQ0A 1KMNA 4M77G 3JCMb 3JCMV 5GAN2 1EIYB 1I4K1 1Z7NA 4MMKA 1X2HA 2AKWB 11ASA 1I5LA 4C8QA 4C92E 4M7DE 3V7CA 4TWAA 1EIYA 1H4SA 4C8QC 3HXZA 3QHSA 1H4VB 2ZNIA 4ZIBA 2ZTGA 1PYSB 1Y96A 1D3BB 1EOVA 3E9HA 4P74A 4YRPA 4M78G 4M77C 2E5AA 4P74C 5GAOr 4A54A 4M7AG 1PYSA 5GAOq 4L87A 2DJZA 5K1XA 3EFSA 1GGMA 1JJCB 4KR2A 3QO3A 5HGQA 4P75A 1MGQA 3JB9J 1SRYA 2Q7GA 4P75C 1ASZA 2ZGWA 2ZIMA 4M78A 1JJCA 4M78C 3I7FA 4YRJA 4PNOA 4NL2A 1G51A 4M7AC 4O2DA 5GMKj 5ELOA 2ZCEA 4K87A 3VQWA 4RCCA 3RIRA 3JCMQ 4C8QF 4M7DG 4C92G 4P3PA 3JB9I 4CH4A 2J3MA 5GAMj 4YROA 1QF6A 1X56A 4M77F 3TEHA 4NOYA 2Q7HA 4XEMA 5GAN6 3OD1A 2DTHA 2YLCA 3M4QA 2E3CA 4YRSA 2ALYA 2DXTA 5GAOp 1C0AA 1B7YA 4UP7A 1J5WA 4M7DC 4C92C 3E9IA 1LYLA 3REXA 1X54A 3UGQA 1ADYA 1NJ2A 4M78F 4YRFA 4M7AF 4QVDA 1NJ1A 2ZR2A 5GAMf 4H2XA 4HA8A 3RACA 4M75D 4P73A 2VC8A 1X55A 5GAOm 1H4TA 4CS4A 5GMKm 4M75B 3WQZA 4XTWA 2IY5B 1NYQA 5DY9A 3JCMP 4YRLA 5GAN5 2ZR3A 5I21A 3VQYA 3JB9H 1LNXA 4F7UE 4TVWA 4YRIA 4X5OA 1G5IA 3REUA 2DZ9A 5GMKi 4CS2A 1YFRA 1SETA 3UGTA 4HWRA 4M7DF 4C92F 4LNSA 2XGTA 3IALA 3JCMX 2QHSA 1KQ2A 5LJ5d 1JRIA 1EVLA 2CJBA 3IG2A 1YB3A 1BBWA 4PG3A 1RIQA 1YFSA 3HSBA 1WLEA 4XEOA 3V7RA 3IKLA 2G4CA 2I4NA 3QNEA 3A7RA 3RGLA 4P72A 4EMKC 4K86A 1N9RA 3KFUA 1NNHA 2AMCB 3SWNA 5LJ3e 5LJ3h 4TQDA 5GAN4 3RF1A 4F7UG 4XU0A 3RKWA 4EMHA 1B34A 1SESA 4H2SA 4C8QD 2Q7EA 4HT9A 12ASA 3MEYA 3INZA 4P71A 4BW9A 4P71C 2P0LA 4C8QB 2ODRD 1HTTA 1H641 3LC0A 4M77D 2J3LA 3RKYA 5GAN7 2FB7A 4H2UA 2I4LA 1Y96B 4YRKA 4XTVA 5GAN3 3NELA 4M77B 1FYFA 4WJ4A 2ZZFA 4HT8A 3QO7A 1HC7A 4M77A 4YRGA 4XTYA 4YDQA 4N0AA 4WF2A 4N0AC 1L0WA 4M78D 2VXFA 2EAYA 2RHQA 2EJ9A 4X9CA 4TVAA 1I81A 2JN0A 4M78B 2DVEA 2RM4A 3L4GA 4PHCA 1TH7A 4Q15A 1EFWA 1B8AA 4AH6A 4X9DA 4JRKA 3NETA 3P8VA 4M7AA 3UH0A 4YCWA 3JCMe 3JCMh 1HK9A 3BY7A 4OLFA 1LJOA 4PJOE 3ERRA 3QSUA 3M4PA 2E10A 2DU5A 3BFMA 4HWTA 3TEHB 1JBMA 4UP9A 3HRIA 4M7DD 4C92D 3V8LA 2ALYB 2DQ3A 3GIBA 1B7YB 3RL6A 4M7DB 4XTXA 4C92B 5CAIA 2Q5HA 3LSSA 3HY1A 4TQFA 4YPFA 4WJ3M 5GAMd 4YRMA 5C52B 4M7DA 4C92A 4NL3A 4M75E 5E3IA 4JRIA 3HXXA 4RQEA 5LJ3g 4TVYA 4H2XB 3VU3C 2C7IA 3R07A 4Q6GA 2CJ9A 1Z7MA 2CJAA 1LOJA 1SERA
chains in the Genus database with same CATH superfamily
2EGAA 1MV3A 2QDYB 4OB0B 2NUTA 4PJOG 2DYBA 1ZA1B 4JJBA 1AWOA 1ZUUA 4J9GA 4FM4B 2COYA 2QQRA 2X3WD 4KR3A 4ZTZB 1TXQA 3WVDB 2CZ0B 2KR3A 4DOVA 4Y91A 2LVMA 2KBTA 3OYIA 1BI1A 4PJNA 1VQOT 3A5YA 2KRNA 1E1OA 3PCOA 3I9QA 2YXYA 2W10A 4EDUA 2E1HA 3G7ZA 5KYXA 1RI0A 1SHGA 3G4SA 3UA7A 2ZNJA 4C8QE 3HFZA 1PRLC 1KG1A 3E9GA 1XJWB 3ZBDA 2XHCA 1YBYA 4EMKA 5GMKl 2RB6A 4Y28E 5LJ5e 2JTFA 5GANe 4KGVB 2V1QA 2PU9B 4FYVB 4DOWA 4O6JA 2FL7A 4J6WA 4H02A 2VKNA 4YYEA 2NWMA 3MF1A 2OAUA 2DETA 3P8BB 2PMEA 3G6EQ 3M53A 3FJPA 3HRUA 1RAGB 2QGFB 5C51B 4WI1A 1PHTA 2K3XA 2ARUA 2Y4XA 3ASKA 2E3HA 4J9DA 3A1PA 1JQQA 2FPEA 1NYRA 3P8DA 2EBPA 3S3MA 3OYDA 1QVGA 4LE9A 3VRZA 2OTJA 4PFZA 4M7AD 2DEQA 2O9VA 1VQNT 1GCQA 2HDAA 2HKQB 3EFOA 2KMTA 2E12A 1ZBJA 3A7AA 1EIFA 2CP5A 2EYQA 1AWWA 5D6XA 2RHXA 4E7KA 5KCOA 4C5EA 1UGSB 5I2SA 1U1SA 1K8AC 2KQWA 4J15A 1X2QA 3OBYA 1E24A 2I4MA 4F7UF 1K0XA 5HK0A 4XU1A 3TU4K 3LYIA 3CC2A 1KMMA 2YWWA 3I56Q 1W1FA 2AK5A 2KROA 3NHNA 4DBFA 2GBQA 5FLXE 4YRQA 3PGGA 4P5NA 3CCLQ 2KRMA 2PNIA 2P0QA 1A0NB 5KYUA 1VQMQ 1BU1A 1M3CA 2H8HA 4RDXA 4ELYC 2XDPA 3VS4A 5KYYB 1VQ6T 1D0ZA 2V8IA 5GAMe 2O4XB 1WQ7A 4JUVA 1X69A 3OSVA 3OYBA 3RMSA 3J81E 3GLXA 3QO5A 2C8MA 2RQUA 1KD1U 2M16A 1N5ZA 4P3OA 3HPWA 1VQOA 5CKHA 4HWOA 1MMAA 2ROTA 2CGHA 3GNFB 4OMOA 2G3RA 3HXVA 4FU6A 1R8OB 1PNJA 1QQJA 2H3JA 1GL5A 2YDLA 4TTVA 4MMLA 3CCQQ 4EX5A 1Q82R 2YHTA 1WJRA 1UUEA 2P0PA 4RTWA 2O88A 3N5BB 1IO6A 4XU3A 2GF7A 2PTKA 1U1TA 2RD1A 3NFCA 1OEBA 4FYYB 4M75C 2DERA 2JOYA 2MPXC 1UE9A 4G84A 4YRRA 4M77E 2BE7D 3THKA 4BD3A 2LMJA 2QA4T 3CCMQ 1KQ1A 3BJUA 1ZSZC 4FT2A 2GQVA 4J83A 3FC3A 2BE9B 2QQAA 1QWEA 2YUOA 3HXWA 3SDZA 3CMEQ 2QAZA 1NLPC 1W66A 1VQ8T 2SEMA 1QKWA 3QJ6A 1TUDA 4M75F 3M5AA 1VQNA 2AMCA 1VQPT 3R6NA 3L1AA 1KQSP 4E7ZA 4R55A 4CH5A 3A8OB 3JCMb 1RAEB 5GAN2 3HHTB 1EIYB 1ZQ1A 4JZ3A 2FPFA 1DJ7B 4C8QA 4C92E 2VB6A 1EIYA 2CREA 2HL3A 2DRKA 2ZTGA 1Y96A 2ESWA 2DA9A 4YRPA 1K8AU 2E5AA 4JRPA 4P74C 4OMQA 1E6GA 1NZ9A 3EFSA 4FYXB 4KR2A 4GY5A 3QO3A 1VQLT 1LVKA 2VGMA 3CC4Q 3QZ5B 1K9MC 3JB9J 4P75C 2ZIMA 3CMAQ 4M78C 5A0GA 2EYZA 1VQ6A 4O2DA 4OB2B 2R5AA 3PT9A 3C0CA 1J3TA 4FIBA 4LD9K 2DXBA 8ATCB 2FHDA 3JB9I 4HCZA 2J3MA 4N4GA 3FEOA 1X56A 4NOYA 2MCNA 3M4QA 1M1GA 2RQWA 1GFDA 5GAOp 3OY9A 1KC8U 1C0AA 2FZCB 2FG0A 2LX7A 4UP7A 1J5WA 1JJ2P 1OI1A 4M7DC 2O9SA 3MHXA 3REXA 3UGQA 3VYHB 1YJNQ 1QCNA 4M78F 4YRFA 1M1KR 1BYMA 5IT9E 1VA7A 2ZR2A 4JPBW 4H2XA 4HA8A 3S3NA 1NBEB 2K5FA 3RACA 4M75D 1V1CA 2VC8A 1Y57A 3PNWC 1H4TA 1YI2Q 3SFMA 3S3OA 1QVGS 3WQZA 1QCFA 4XTWA 3LGFA 4NS5A 5DY9A 1U5SA 3JCMP 2EQJA 2HCKA 2XD0A 1W6XA 3JB9H 1G5IA 1W2BP 2K6DA 4F14A 2QA4A 2DZ9A 2OJ2A 4CS2A 3UDCA 3UGTA 4M7DF 4LNSA 2LJ3A 1VQKT 1VIEA 1YHQQ 3IALA 2YRVA 5FU6B 2EPDA 5LJ5d 3IG2A 1YB3A 1BBWA 4K11A 3UF4A 1RIQA 1BI3A 1NG2A 4BI4A 1WLEA 3V7RA 3PIOA 2I4NA 3NMZC 1VQ8A 1S1NA 1NJIR 4EMKC 4K86A 1VQPA 4X34A 4EPCA 2NUPA 3META 3SWNA 5LJ3h 2CZ1B 1R77A 2DXCA 3QKJA 3RKWA 5FRNA 1X43A 3EG0A 4EMHA 1B34A 1AZEA 1S72T 4XAXB 4OMMA 2Q7EA 8AT1B 3MEYA 2KAFA 4E47A 4BW9A 4P71C 1VQ4A 1KQSS 1HTTA 3OYAA 5GAN7 4H2UA 2I4LA 4YRKA 5GAN3 4M77B 3PTAA 3G71Q 1UJ0A 1PSFA 4ZTJA 2PUKB 4M77A 2Y4YA 4YDQA 1VQ7Q 1VQLA 3VUZA 2K4YA 2BIVA 1OOTA 4N0AC 3TEEA 3TSZA 2C0TA 4M78D 2VXFA 4OB1B 1V29B 2EAYA 3VS0A 4X9CA 2OTLQ 5FW9A 3VS5A 3OS2A 3M0QA 3CCRQ 2DVEA 2RM4A 3L4GA 4PHCA 1GCQC 1B07A 2VASA 1TH7A 4X9DA 2DFUA 3VS1A 3NETA 5ECAA 1YIJT 4YCWA 3TQ7P 2IVWA 1UG1A 3JCMh 4DBQA 4IURA 3BY7A 1D09B 4OLFA 1LJOA 3OMGA 5D7UA 2E10A 2LT1A 3HKSA 1T3LA 3OW2P 2V1RA 1U06A 2DD4A 3HRIA 4M7DD 3LW5E 2ALYB 1PC0A 1AVZC 1PD0A 3SHWA 4WJ3M 4C92B 4VUBA 4TQFA 5GAMd 1QCOA 4EIKA 1M2VA 2M02A 4YRMA 5C52B 4C92A 4FW2A 2DAQA 5E3IA 3HXXA 1JJ2S 5KYNA 3VS3A 4TVYA 3GF5A 4Q6GA 2CJ9A 1OX9A 4RG2A 5FRMA 1G3YA 2DRMA 4JJCA 3EG1A 1JU5C 3OYJA 3A8GB 1X01A 2KDSA 2CIMA 5HK3A 2CP3A 2EL9A 1ZUKA 3ER0A 3I5RA 1GBRA 2RPNA 2KY9A 2EWNA 5IHIA 2XG8D 2YUNA 4C5IA 1IHVA 1VQKA 2E41A 1QW1A 1K73C 4BWAA 2RA2A 2DDZA 1YCSB 2E65A 4PFOA 1IREB 2K9GA 2QQ9A 2EJFA 1WYXA 3X28B 1UECA 1W2BS 3SB2A 2GTOA 4PJJA 1ZSZB 3CBMA 2C06A 1GXIE 1Q81C 2QYZA 1M3BA 4KGZB 1WPYA 5C6SA 1U3OA 3J7AF 1VYUA 3LWHA 2JS0A 3NENA 1B76A 2A28A 1AHJB 2B8AA 2BZ8A 2DL8A 1VQ9T 3HFOA 1QKXA 4OGCA 3FLGA 3OYNA 1S72A 1VQ5Q 3FIFA 1CKAA 4QVZA 1BB9A 1NJ8A 3CCVT 4B6MA 4HKEA 5LJ3j 1NPPA 3LH5A 2CP7A 3I5SA 1KD1R 2HAXA 4RCBA 2MF2A 4EMGA 1HSQA 1ABQA 4J5YA 2RQVA 2CZ7B 1QP2A 4BUGA 1BI2A 2GCXA 4JJDA 2YRCA 5HKCA 1Q86C 4CH6A 4WCIA 2ZAEA 1G3TA 2ZPIB 4H2TA 5C0MA 5CVIA 1H8KA 5LJ3f 1SSHA 1SF9A 4TVAB 4LDVA 2RI2A 3PFSA 3DB3A 2LQNA 3UFGA 4ZTUB 2CZ6B 4QW2A 2PMFA 1YIJA 3NTIA 1BIBA 3CXCP 2LC4A 3EFRA 2XICA 4JLIA 2JJ9A 2QQSA 2YSQA 3JRZA 4YREA 1YCYA 4HWPA 2VGNA 1ADJA 2K5LA 1D3BA 3QUIA 3OYEA 3F70A 4C0FA 3JCMd 3MO8A 3RDVA 3BW1A 2ZINA 1NLOC 4YRNA 3CD6T 2ENMA 4CC7A 2V8KA 3MPUB 1FX7A 2CUDA 4C0DC 1AWXA 5GMKh 3QDRB 4RG8A 2A37A 2JM9A 1OULA 2GFAA 5LJ5g 2E6ZA 2EGCA 2I2LA 5GANg 4CC2A 4H2YA 1EVKA 1AOJA 3JCMf 2JTEA 2LQ8A 1NJIU 4BI8B 3KXTA 3DLLA 1GBQA 2NUTB 2RNAA 2MYSA 1D1CA 3CC7T 1UJYA 3TVTA 4DA4A 4JRQA 1N8RU 1RAAB 2CP0A 4J9CA 2J6KA 4DBRA 5FWCA 4OMFB 3CCUQ 1TSFA 1N9WA 2D8HA 2VXEA 5D6YA 2ZIOA 2P0KA 3OYFA 1K8AR 2ZZGA 2QHVA 1K73U 2P4TA 4AT1B 3QBYA 3PCOB 3RUXA 2M0YA 3V8JA 2AZSA 3OYHA 4KBMB 4M75G 1D0XA 1USYA 4YP0A 5KYXB 3HXYA 2ATCB 2FRYA 3A31A 1Q81U 5ELNA 4F17A 3CCJT 3CCST 5FWBA 4CS3A 4QQGA 2OI3A 2DTOA 3HFZB 2F1LA 3TEGA 3MEWA 1VQ9A 3P8YA 3LLRA 4EMKB 3A7UA 2J6FA 2DU7A 4OMNA 3M54A 1Y07A 5EC7A 2K7AA 5GAOl 2CT4A 1R0CB 3CCVA 1WGSA 3UT1A 2B86A 1N9SA 2EJGA 4IUVA 4HCCA 5KYWB 1VQZA 4J8OA 1ATIA 4JLGA 1KC8R 4UPAA 5KYWA 2BUDA 2HSEB 2IG0A 5FU6C 4YCUA 3RKXA 1RL2A 1NPRA 4AG2C 3RNJA 3SD4A 4XTZA 2X51A 3URGA 4MZPA 4QT7A 5EG2A 4GLKA 4M7AE 1IB8A 4YRTA 1E1TA 2F2WA 5GJWB 1VUBA 5KH6A 1AWJA 5GAMg 3SWNC 2CT3A 1Q86U 1H4QA 2Y90A 3M56A 1MHNA 2JUFA 3DSQA 4L59A 3CMQA 3A8HB 1D1BA 4DEYA 2QHUA 3A5ZA 3M59A 1NYGA 2EW3A 3EFOB 4F16A 2KT1A 1AT1B 4J9BA 1X2HA 2EQUA 3NPFA 1X6BA 1I5LA 1ZX6A 4TWAA 4AFQC 3CXCS 2ZNIA 1Z9QA 5I2MA 4M78G 4M77C 1FMVA 1K9AA 5GAOr 4FT4A 3H0FA 4N4HA 5LL6S 2X3XD 4FL6A 2L3PA 3CD6A 5GAOq 5CCAA 2D0QB 2G6FX 1D1AA 1GGMA 2W0ZA 5HGQA 2L2PA 3CBOA 2JZ2A 2RJDA 1RABB 3EHRA 1MGQA 3PMTA 1SRYA 2ZPBB 1ASZA 5CKFA 4LDWA 5KYUB 1JB0E 3I7FA 4QQDA 4YRJA 2PZ1A 1G51A 2KVQG 3CPFA 5CKBA 4HVVA 5GMKj 1C1AA 3M4YA 3CC7A 2ZCEA 3X25B 4RCCA 4BY6B 2K3BA 2L3RA 1V76A 3RIRA 4M7DG 4L6V5 2WSFE 3EGXB 4DEXA 1KQSA 2DVJA 1YN8A 4YROA 3LX7A 2NUZA 1WHKA 2F2VA 4M77F 3TEHA 2M1HA 5GAN6 3EGXA 3OD1A 2LZ6B 3D7SB 1I5OB 2ZCFB 4MDXA 2NS6A 5IAYA 2RQRA 4C92C 3FDRA 2A08A 1LYLA 1GCPA 5A0DA 1X54A 2KYBA 1Q7YC 1ADYA 3RBBB 1B7TA 4OF1A 3RR6A 1YJWQ 2EQMA 3CCJA 3CCSA 1M2OA 2NLUA 1OPLA 2L3SA 4P73A 1X55A 2RHYA 3MEVA 2DNUA 2EYXA 3Q1JA 1HJDA 4B9WA 1NYQA 1R0BG 2L5QA 1LNXA 4F7UE 4TVWA 3UA6A 3WXMB 4CRIA 4X5OA 2PVGB 6AT1B 5GMKi 4C0GA 1SETA 4C92F 3VS6A 2XGTA 2HKNA 4BE2A 2C0OA 5A0LA 3JCMX 3KBGA 2C0IA 2WACA 3I55T 3OS5A 4PG3A 3HRSA 4E2FB 4IUTA 4RTTA 4JJNK 1JJ2A 4XEOA 2G4CA 1WHGA 4P72A 1WFWA 3CCET 4ANJA 2AMCB 5LJ3e 2CSIA 2NYSA 2JVVA 1SESA 2QEXT 3OQ5A 1X75C 4HT9A 4CI0C 4BE1A 1I1JA 1TTHB 2P0LA 2RI3A 4C8QB 2COWA 2D0NA 1X27A 5J26A 3LC0A 4M77D 3NTKA 2RQTA 1UHCA 1Y96B 2DK3A 1UFFA 2DL7A 2LT4A 1WJQA 1W2BA 3MCAB 5FROA 4KH1B 3UATA 4JDSA 2XK0A 3G4SQ 1HC7A 1YFNA 3E1SA 1BKBA 4YRGA 2LCSA 1YJ9T 2KXCA 4F04B 2RHQA 2EJ9A 1M9SA 4II1A 3QIIA 4D6WA 4LN2A 1I81A 3QYHB 4C0DB 1YITT 3OBWA 4LVMA 3VS7A 2A36A 4Q15A 1B8AA 1M27C 5L23A 4YTLA 4AH6A 4JRKA 1TG0A 2DEUA 4M7AA 1LCKA 2RHIA 1TUCA 3NTHA 3QPHA 3JCMe 1SHFA 4KT0E 3QSUA 4PJOE 3EHQA 3ERRA 3M4PA 2DU5A 2CP2A 3OYYA 2RK1A 1PCXA 2XIDA 3OYGA 4C92D 1VYVA 2FZGB 2BTTA 3V8LA 3GIBA 2XI9A 2E70A 1QVFP 4XTXA 3HY1A 2MOXA 5IH2A 1UGRB 4NL3A 1YP5A 2J7IA 4M75E 2OTJQ 3H6ZA 5DM7R 1QLYA 4C5HA 4RQEA 1WXUA 2D6FA 4MDWA 2D9TA 4H2XB 2KSSA 1Z7MA 1T0HA 1M90C 2CJAA 2CP6A 3JSCA 3BE3A 4ZGEB 1ABOA 1OU9A 3OS1A 2DD5A 2X4JA 1OPKA 4HT4A 2RHSA 4ATOA 1SG5A 2LP5A 4N4IA 3MEAA 2VV5A 2DPPB 2EFIA 3CC2Q 1WYDA 2KGTA 2WSCE 5D6WA 2FVUA 1G3SA 2FO0A 2ZXFA 4XTUA 1W70A 3A32A 3VS2A 1WA7A 3I35A 3OW2A 3TUPA 5L8RE 3I55A 2A0FB 2RF0A 2OAWA 4RKUE 3L2VA 1KFZA 1USYC 1RAHB 3VBBA 5F5WA 2F5KA 2CS7A 1N6AA 2JMAA 3HP9A 3G6ET 1XOVA 3CCEA 2SRCA 5KE3A 1Y0MA 4Z02A 2A3LA 2P5IA 3GBQA 2NUPB 3SWNB 3J80E 1OU8A 2P4RA 1MMDA 4C5GA 1NJ6A 2XTIA 1E6HA 2QEXA 1N8RR 3HL8A 1B34B 1SERA 1VQOQ 4LUDA 4UP8A 2CUBA 4A4GA 3JB9F 1GRIA 3M55A 1M4ZA 3S6WA 1M5Q1 1Q95G 2ECZA 4PK4A 4M78E 1ASYA 3OYCA 3BDLA 2KI7A 3HRKA 1K73R 3AHUA 4F7UA 2HD0A 1WJSA 1YJ9A 1B3QA 2F5TX 1KJWA 2I4OA 5GANf 1FWZA 2ZT5A 1YITA 4B9XA 1Q81R 3L4GB 2EQIA 3I56T 2PUOB 3PZCA 3TSWA 4R0KA 1WQWA 4BI3A 2RJEA 2EQKA 2XDDA 3CCLT 1K9MU 3M58A 2JNGA 5CKEA 1K76A 1VQMT 3MF2A 2AKWA 1PM3A 3QWYA 1NYFA 4BDYA 1YNZA 2K3YA 2ODRC 4YCVA 1IHWA 2DL3A 2CKKA 2LJ0A 4M4ZA 1BK2A 3LGLA 4IUQA 3L2QA 2KYMA 2DL5A 1M2VB 2HQXA 2K57A 3C4SA 1RLQC 1RLPC 4PL6A 2E64A 5AYFA 3RESA 3JCMc 3CPWP 1VQNQ 4KQEA 4OMLA 5GMKe 4KUDK 4E6RA 2EKHA 1YFTA 2QHTA 1WX6A 2DZCA 1YGBA 1Q86R 1IGUA 4IUPA 4H2VA 2ZPEB 4ZN1A 4E7LA 2MIOA 3VJPA 2LNVA 2HBPA 1EZZB 1KK7A 3CCQT 1M90U 1SEMA 2KRSA 4BY6C 5FU7B 1XNIA 2X4XA 2RK2A 2AKKA 2DKGA 1WXTA 2ZT6A 3E19A 4A4KA 3MKDA 1NEGA 5GAN8 3JB9D 3X20B 3CXCA 3LH0A 2GGRA 4PJOB 1G5HA 5I11A 1K0SA 1MMNA 4XQ3A 5HCKA 4X1VA 4PJOA 3VQXA 3EGUA 1HYOA 1UGVA 2K2VA 2GFUA 3IKMB 3CCMT 1VQ6Q 3MJXA 1QMCA 3G6EA 3JCMJ 4P73C 2CH4A 2IIMA 5GAOn 3VUBA 1K1ZA 2LNHB 4E51A 3CMET 5CR2A 4M75A 2RI5A 2IY5A 4DQ2A 2LJ1A 1E7OA 1WNLA 4C0ZA 1KIKA 1OV3A 2MK5A 4P3NA 4ZNXA 2VWFA 3LSQA 2DL4A 4AMCA 1OX8A 3X26B 1WHJA 3E2UA 5KE2A 1FYNA 1B70B 5LJ3d 2KE9A 3QXEB 5CK9A 1M30A 3MQZA 2QG9B 2FYKA 1B70A 4YRCA 1M1FA 4P72C 3M57A 1XTDA 4J9FA 3PE0A 4J6XA 3I56A 4A53A 4HVUA 1WU7A 3HY0A 3QO8A 2J05A 2O01E 1C0MA 2KNBB 1BBUA 2DM1A 3CCLA 2QA4Q 3CC4T 3JCMW 1KMNA 4M77G 1VQMA 1UB4A 3OS0A 3CMAT 1Z7NA 2A8EA 3HRTA 1UTIA 11ASA 2XKOC 2EIFA 1H4SA 4C8QC 1NM7A 2R58A 4ZIBA 1WHHA 1MNEA 1PYSB 1D3BB 3QDFA 1FMWA 1EOVA 3E9HA 3QJYA 1AEYA 4P74A 4A54A 1VQ8Q 1PYSA 2DYIA 3L42A 4L87A 2DJZA 2IPOB 2BZYA 2M51A 3OW2S 1VQPQ 1UHFA 1JJCB 2DJQA 2FPDA 1FXXA 4J7IA 4P75A 2Q7GA 3DLMA 4M78A 1JJCA 2WSEE 4M7AC 1O9SA 1XQHA 1YJNT 3CCQA 4LVJA 1VQ4Q 3CQTA 4K87A 4C8QF 4C92G 1PD1A 4LDUA 4FW1A 3KFVA 3VKIA 4A4HA 2DIGA 3REBB 1QF6A 1YI2T 2DTHA 2YLCA 2ZPGB 2E3CA 4YRSA 1VQLQ 1B7YA 4IIMA 3JAME 1PG5B 1AZGB 3OSSC 1W4SA 5I22A 2YRDA 2D1XA 3CCMA 1TU0B 1YHQT 4ME7A 1WHMA 4M7AF 4QVDA 2AKLA 1MV0B 2X9HA 3CMEA 4RTVA 3OYMA 1KD1C 4PLIA 3ZL7C 2E5QA 4A4FA 2F2XA 2O2OA 1EFNA 4YRLA 5GAN5 5I21A 2RN8A 2ZPHB 3REUA 3VYGA 3DKMA 4ELZC 1IGQA 4MZMA 2PVOB 3DB4A 5IHNA 2XU8A 2ABLA 1KHCA 1KQ2A 2X4WA 2CJBA 4FSSA 3HSBA 1ZUYA 3QNEA 3RGLA 3A7RA 3G71T 2AZVA 1Q7YR 4J9EA 1WXBA 4LVKA 2M9UA 1VQ7T 4TQDA 3MP1A 3A5ZB 3CC4A 5GAN4 2I0NA 3RF1A 2HSPA 2QASA 1VQKQ 2OTLT 4XU0A 3CMAA 3M0UA 3CCRT 1BCMA 4C8QD 3EH2A 4P71A 3INZA 1RAFB 4JS5A 5HY6A 3CBPA 1H641 3O5ZA 1BI0A 2FB7A 1JEGA 1VYTA 3A98A 3NGPA 3GPLA 2KT8A 1ARKA 4WJ4A 4D8KA 2K79A 3GOXA 2K5IA 3QO7A 4LDXA 1PWTA 3PIPA 4XTYA 4N0AA 2GTJA 4WF2A 1M3AA 2M0OA 3EGDB 2L3QA 5DLOA 2JN0A 1S72Q 4RTXA 3EGDA 1YJNA 1EFWA 4KULA 3UPUA 1PSEA 4ZTFA 3X24B 4FSXA 2DIQA 2JS2A 2MWOA 1YI2A 2YUQA 4HWTA 3TEHB 1JBMA 1YWPA 4Z88A 1PKSA 3OMCA 2HEQA 1TS9A 3C12A 4IKFA 3LSSA 1G8XA 1KHIA 1YHQA 1MNDA 1G2BA 2COZA 2XDBA 2HQHA 2PQWA 1YIJQ 5LJ3g 2R57A 3PMIA 3R07A 1F1BB 4AFZC 1LOJA 5KYYA 3HXUA 3EG2A 2O4XA 1NE8A 3JB9G 3P8TA 3QTCA 1KC8C 3OA6A 1K9MR 9ATCB 5FU7C 3LWIA 2BZXA 3G1JA 5C53B 4RMOA 3E9FA 1QP3A 4PJMA 3OB9A 4ESRA 1EX4A 1Y7XA 1M8MA 1VQ5T 4PJOC 3V8KA 2CH4W 1BBZA 2DBKA 1ZSGA 2RHZA 1MMGA 3G1ZA 1QVGP 1HXDA 2OX7A 2ARTA 1QVFA 4OVAA 4L5GA 3G71A 4DBHA 1LPLA 2QTVA 1VQ7A 4KH0B 1X6GA 3JCMg 4ZN3A 1UGQB 5LJ5h 1NEBA 1VIFA 2D8JA 2OTLA 1M90R 5GANh 1NJ5A 3CCRA 1BIAA 3L2WA 1IZ6A 4KUIA 2LQWA 3M9QA 3M0TA 3REAB 3FRNA 4ZGDB 4E7HA 4PJOF 3P8HA 1N27A 1KOGA 4QVCA 2HNIA 1EQRA 1JXMA 2BKDN 2MMPA 3JV3A 2PVDB 1SSFA 4RTYA 4RUGA 3BDUA 3TREA 3H9NA 1FMKA 1P92A 1I8FA 4J9IA 2AIRB 4RQFA 2KK4A 2QQBA 3L2RA 4QQ6A 1VQ9Q 1RAIB 2RHQB 2XMFA 1RACB 3W3SA 4PJLA 2Q5IA 3CCVQ 3VQVA 4EO4A 3GP8A 5IXFA 2ROLA 3EAEA 3V7SA 3ZEHA 4LVLA 2DTIA 3FB9A 2HZYA 4M7AB 1IL2A 2DXUA 1VQ4T 1Y71A 1KSWA 2VVKA 1WHLA 4PKCC 3TCJA 4JS4A 2L8DA 5J39A 3UWNA 2DILA 4LDYA 2YUPA 4Q5WA 1QWFA 4J9HA 4HVWA 1OZ3A 2LCLA 1OZ2A 1ZLMA 3ME9A 1X6OA 4QKUA 2DX1A 3CCUT 1Q82C 2L0AA 4J6YA 4A4EA 2ZT8A 3ICAA 2QXFA 3ZFJA 5AT1B 4FCYA 3WVEB 5KCHA 3T9NA 5GJVB 3A8MB 2CYZB 3NEMA 3AT1B 4DPGA 3MP8A 1Q7YU 5GAMh 3QZ9B 4O5VA 4G85A 4A63B 4HVCA 4PLLA 2RHUA 1UGPB 2ED1A 3EG9B 2RHSB 4RMFA 4HCBA 1H92A 2GNCA 4HWSA 4PJOD 3EG9A 1WI7A 3EH1A 3CD6Q 2F69A 1VQ5A 4LVIA 3U23A 4CC3A 2X35A 3HFNA 2L89A 1E22A 4HXJA 2VYTA 4H2WA 1OQKA 5KNNA 2ZT7A 2GQIA 3RMQA 3HTZA 1RI9A 1T0JA 5IXBA 3RERA 3CC7Q 1JO8A 2YT6A 2ZZEA 2E3IA 1QE0A 4NCXA 3CPWA 3L2ZA 4HCKA 1WDXA 3PVQA 4BACA 2HBWA 3OYKA 3HFVA 4E7JA 1I0CA 4D8DA 4KRTA 3A74A 1X2GA 1WZOA 5LJ5j 5GANj 3PVLA 1QVPA 1M8VA 2YLBA 1H3HA 4V2SA 5GANd 2ARSA 5K1PA 2JW4A 4FYWB 3M0SA 2RJCA 4Z89A 3CCJQ 3CCSQ 4F7UB 2CSQA 2FRWA 1SRLA 4K88A 2QTXA 3M4GA 4Z8AA 1SPKA 2KEAA 3QG1A 2RMOA 5LJ5f 4C8QG 1JXOA 4OP0A 4CH3A 1HD3A 1T3SA 3OYLA 3H0IA 2LDMA 4XU2A 4UC4A 3CEYA 2DQ0A 3JCMV 1I4K1 2LRQA 4MMKA 2AKWB 4LXCA 2HQEA 2LQKA 4M7DE 2DF6A 3V7CA 2QGGA 3HXZA 3QHSA 1H4VB 1OYXA 1ZA2B 1MUZA 3M0RA 2V26A 1G83A 2E6NA 4E7SA 2ZPFB 2MI6A 4KGXB 2X4YA 4LD6A 4LNPA 2AHJB 1M1KC 4M7AG 3CCUA 2JM8A 2DMOA 1U8RA 5K1XA 2EYWA 2FEIA 2DBMA 1IXDA 1Q82U 2V8JA 1UEBA 2ZGWA 1QVFS 4PNOA 4NL2A 3C94A 3M0PA 5ELOA 5CQYA 1YJWT 3VQWA 1X2KA 3JCMQ 4P3PA 3QWXX 4AG1C 1I07A 2DLPA 4CH4A 2A7YA 2KXDA 5GAMj 1AD5A 4GBQA 3H41A 2Q7HA 4XEMA 1TUGB 2ALYA 2DXTA 3O8VA 4E7IA 2AT1B 2JTMA 4OGEA 1CKBA 3EG3A 3VRYA 3E9IA 4WTOB 1RADB 3QYGB 1PKTA 1NJ2A 1NJIC 5DLQE 2RO0A 5CIUA 1SRMA 4BDZA 1NJ1A 1N8RC 3ULRB 5GAMf 1D0YA 2J06A 2Z0WA 2EKOA 4XK8E 3IQLA 2JMCA 4IUUA 5GAOm 4J7FA 4OB3B 4CS4A 4Y92A 4BE0A 5GMKm 4M75B 2IY5B 2FZKB 3HTRA 2ZR3A 3VQYA 1Z9ZA 4YRIA 1GFCA 2MWPA 1YFRA 4HWRA 2E4HA 3GNGA 5J3BA 2QHSA 1WIEA 1EVLA 1JRIA 1C6VX 2HL5C 3KUFA 1ZSZA 4BB7A 4AFUC 5IHKA 1YFSA 1G5VA 3IKLA 2EVRA 2HMAA 3G4ST 1N9RA 2DO3A 3KFUA 1NNHA 2E5KA 2R5MA 2CDTA 4GLMA 2EYYA 1VOMA 1PRMC 2LTOA 1UDLA 2MAMA 4CC4B 1ZHIA 4F7UG 7AT1B 3L2UA 4H2SA 1SKUB 1H3ZA 12ASA 3H8ZA 2RJFA 1ACMB 5CKDA 3I55Q 5A2QE 3H0HA 4OMPA 2ODRD 2J3LA 3RKYA 1ZBXA 4XTVA 3NELA 1FYFA 2ZZFA 3C95A 4HT8A 2JXBA 2LX9A 3MP6A 3CCEQ 5CO7A 4MZTA 2LCCA 1K4US 1RUWA 3MEUA 4RTUA 1L0WA 1M1KU 1WLPB 2QK0A 4TVAA 2EGEA 2QI2A 4M78B 2QEXQ 3FJ5A 5IN1A 2P84A 2RH2A 2OTJT 3P8VA 1YWOA 1YJWA 3UH0A 3CPWS 1G3WA 1HK9A 1BCOA 4PFPA 3A8LB 1O75A 1TWBA 1TOVA 3BFMA 4UP9A 3R6OA 2J6OA 2DQ3A 1YJ9Q 1B7YB 3RL6A 4M7DB 5CAIA 2Q5HA 4TVRA 4YPFA 4ORZA 2K2MA 1YITQ 3CC2T 4R56A 5M9OA 2H3EB 4IIOA 2ZZDA 4M7DA 5CQXA 2DE0X 4ZGJB 3VV0A 4JZ4A 4RTZA 4JRIA 1IRXA 2VUBA 3SEMA 2O31A 2ED0A 3VU3C 2C7IA 2JT4A 2QDLA 4LUEA 1CSKA 4AFSC
chains in the Genus database with same CATH topology
2QDYB 4OB0B 4PJOG 4FM4B 2QQRA 4KR3A 4ZTZB 3WVDB 2CZ0B 4DOVA 4Y91A 2LVMA 3OYIA 1BI1A 1VQOT 3A5YA 1E1OA 3PCOA 4EDUA 2E1HA 3G7ZA 1RI0A 3G4SA 2ZNJA 4C8QE 3HFZA 1KG1A 3E9GA 3ZBDA 2XHCA 1YBYA 4EMKA 5GMKl 2RB6A 4Y28E 5LJ5e 2JTFA 5GANe 2PU9B 4DOWA 4O6JA 2FL7A 4J6WA 4H02A 4YYEA 3MF1A 2OAUA 3P8BB 2PMEA 3M53A 3FJPA 3HRUA 5C51B 4WI1A 2K3XA 2ARUA 2Y4XA 3ASKA 1NYRA 3P8DA 3S3MA 3OYDA 1QVGA 2OTJA 4M7AD 2DEQA 1VQNT 2KMTA 2E12A 3A7AA 1EIFA 2EYQA 5D6XA 2RHXA 4E7KA 5KCOA 4C5EA 1UGSB 5I2SA 1U1SA 1K8AC 2KQWA 4J15A 3OBYA 1E24A 2I4MA 4F7UF 5HK0A 4XU1A 3TU4K 3LYIA 3CC2A 1KMMA 5FLXE 4YRQA 3PGGA 4P5NA 2P0QA 4RDXA 4ELYC 2XDPA 1VQ6T 2V8IA 5GAMe 2O4XB 1WQ7A 4JUVA 3OSVA 3OYBA 3RMSA 3J81E 3GLXA 3QO5A 2C8MA 1KD1U 2M16A 4P3OA 3HPWA 1VQOA 5CKHA 4HWOA 2CGHA 3GNFB 2G3RA 3HXVA 4FU6A 1R8OB 2H3JA 4TTVA 4MMLA 4EX5A 2YHTA 1WJRA 2P0PA 3N5BB 4XU3A 2GF7A 1U1TA 2RD1A 3NFCA 4M75C 2JOYA 4G84A 4YRRA 4M77E 4BD3A 2QA4T 1KQ1A 3BJUA 4FT2A 2GQVA 4J83A 3FC3A 2QQAA 3HXWA 3SDZA 1W66A 1VQ8T 3QJ6A 4M75F 3M5AA 1VQNA 2AMCA 1VQPT 3L1AA 4R55A 4CH5A 3A8OB 3JCMb 5GAN2 3HHTB 1EIYB 1ZQ1A 1DJ7B 4C8QA 4C92E 1EIYA 2ZTGA 1Y96A 4YRPA 1K8AU 2E5AA 4JRPA 4P74C 1NZ9A 3EFSA 4KR2A 3QO3A 4GY5A 1VQLT 2VGMA 3QZ5B 1K9MC 3JB9J 4P75C 2ZIMA 4M78C 5A0GA 4O2DA 1VQ6A 4OB2B 2R5AA 3PT9A 4FIBA 4LD9K 2DXBA 2FHDA 3JB9I 4HCZA 2J3MA 4N4GA 3FEOA 1X56A 4NOYA 3M4QA 1M1GA 5GAOp 3OY9A 1KC8U 1C0AA 4UP7A 1J5WA 1OI1A 4M7DC 3MHXA 3REXA 3UGQA 3VYHB 4M78F 4YRFA 1BYMA 5IT9E 2ZR2A 4H2XA 4HA8A 3S3NA 2K5FA 3RACA 4M75D 2VC8A 3PNWC 1H4TA 3SFMA 3S3OA 1QVGS 3WQZA 4XTWA 3LGFA 4NS5A 5DY9A 3JCMP 2EQJA 2XD0A 3JB9H 1G5IA 2QA4A 2DZ9A 4CS2A 3UDCA 3UGTA 4M7DF 4LNSA 1VQKT 1VIEA 3IALA 2YRVA 5FU6B 5LJ5d 3IG2A 1YB3A 1BBWA 1RIQA 1BI3A 4BI4A 1WLEA 3V7RA 3PIOA 2I4NA 1VQ8A 4EMKC 4K86A 1VQPA 4X34A 4EPCA 3META 3SWNA 5LJ3h 2CZ1B 2DXCA 3QKJA 3RKWA 5FRNA 4EMHA 1B34A 1S72T 4XAXB 2Q7EA 3MEYA 2KAFA 4E47A 4BW9A 4P71C 1VQ4A 1KQSS 1HTTA 3OYAA 5GAN7 4H2UA 2I4LA 4YRKA 5GAN3 4M77B 3PTAA 1PSFA 4ZTJA 2PUKB 4M77A 2Y4YA 4YDQA 1VQLA 3VUZA 2K4YA 2BIVA 4N0AC 3TEEA 4M78D 2VXFA 4OB1B 1V29B 2EAYA 4X9CA 3OS2A 2DVEA 2RM4A 3L4GA 4PHCA 1TH7A 4X9DA 3NETA 1YIJT 4YCWA 2IVWA 3JCMh 4IURA 3BY7A 4OLFA 1LJOA 3OMGA 2E10A 2LT1A 3HKSA 2DD4A 3HRIA 4M7DD 3LW5E 2ALYB 4WJ3M 4C92B 4VUBA 4TQFA 5GAMd 4YRMA 5C52B 4C92A 2DAQA 5E3IA 3HXXA 1JJ2S 4TVYA 3GF5A 4Q6GA 2CJ9A 4RG2A 5FRMA 1G3YA 3OYJA 3A8GB 1X01A 2KDSA 2CIMA 5HK3A 2EL9A 3ER0A 2KY9A 2EWNA 2XG8D 4C5IA 1VQKA 2E41A 1QW1A 1K73C 4BWAA 2RA2A 2DDZA 2E65A 1IREB 2QQ9A 2EJFA 3X28B 1W2BS 3SB2A 3CBMA 2C06A 1GXIE 1Q81C 1WPYA 5C6SA 3J7AF 3LWHA 3NENA 1B76A 1AHJB 2B8AA 1VQ9T 3HFOA 4OGCA 3FLGA 3OYNA 1S72A 3FIFA 4QVZA 1NJ8A 3CCVT 4HKEA 5LJ3j 1NPPA 2HAXA 4RCBA 2MF2A 4EMGA 4J5YA 2CZ7B 1QP2A 4BUGA 1BI2A 2GCXA 5HKCA 1Q86C 4CH6A 1G3TA 2ZPIB 4H2TA 5C0MA 5CVIA 5LJ3f 4TVAB 4LDVA 2RI2A 3PFSA 3DB3A 3UFGA 4ZTUB 2CZ6B 4QW2A 2PMFA 1YIJA 3NTIA 1BIBA 2LC4A 3EFRA 2XICA 4JLIA 2QQSA 3JRZA 4YREA 1YCYA 4HWPA 2VGNA 1ADJA 2K5LA 1D3BA 3QUIA 3OYEA 3F70A 4C0FA 3JCMd 3MO8A 3BW1A 2ZINA 4YRNA 3CD6T 2V8KA 1FX7A 4C0DC 5GMKh 3QDRB 4RG8A 2GFAA 5LJ5g 2E6ZA 2I2LA 5GANg 4H2YA 1EVKA 3JCMf 2LQ8A 1NJIU 4BI8B 3KXTA 3DLLA 3CC7T 4DA4A 4JRQA 1N8RU 4OMFB 1N9WA 2VXEA 5D6YA 2ZIOA 2P0KA 3OYFA 2ZZGA 2QHVA 1K73U 2P4TA 3QBYA 3PCOB 3RUXA 3V8JA 3OYHA 4KBMB 4M75G 1USYA 4YP0A 3HXYA 3A31A 1Q81U 5ELNA 3CCJT 3CCST 4CS3A 4QQGA 2DTOA 3HFZB 3TEGA 3MEWA 1VQ9A 3P8YA 3LLRA 4EMKB 3A7UA 2DU7A 3M54A 1Y07A 5GAOl 3CCVA 1WGSA 3UT1A 1N9SA 2EJGA 4IUVA 4HCCA 1VQZA 4J8OA 1ATIA 4JLGA 4UPAA 2BUDA 2IG0A 5FU6C 4YCUA 3RKXA 1RL2A 1NPRA 3SD4A 4XTZA 3URGA 4MZPA 5EG2A 4GLKA 4M7AE 4YRTA 1E1TA 1VUBA 5KH6A 5GAMg 3SWNC 1Q86U 1H4QA 2Y90A 3M56A 1MHNA 2JUFA 3DSQA 4L59A 3CMQA 3A8HB 2QHUA 3A5ZA 3M59A 1X2HA 2EQUA 1I5LA 4TWAA 3CXCS 2ZNIA 5I2MA 4M78G 4M77C 5GAOr 4FT4A 5LL6S 4N4HA 4FL6A 3CD6A 5GAOq 5CCAA 2D0QB 1GGMA 5HGQA 3CBOA 2JZ2A 2RJDA 1MGQA 3PMTA 1SRYA 2ZPBB 1ASZA 5CKFA 4LDWA 1JB0E 3I7FA 4QQDA 4YRJA 1G51A 2KVQG 3CPFA 5CKBA 5GMKj 3M4YA 3CC7A 2ZCEA 3X25B 4RCCA 4BY6B 2L3RA 3RIRA 4M7DG 4L6V5 2WSFE 1KQSA 4YROA 3LX7A 3TEHA 4M77F 2M1HA 5GAN6 3OD1A 2ZCFB 4MDXA 2NS6A 5IAYA 4C92C 3FDRA 1LYLA 5A0DA 1X54A 1Q7YC 1ADYA 4OF1A 2EQMA 3CCJA 3CCSA 2NLUA 4P73A 1X55A 2RHYA 3MEVA 3Q1JA 4B9WA 1NYQA 2L5QA 1LNXA 4F7UE 4TVWA 3WXMB 4CRIA 4X5OA 2PVGB 5GMKi 4C0GA 1SETA 4C92F 2XGTA 4BE2A 5A0LA 3JCMX 3KBGA 2WACA 3I55T 3OS5A 4PG3A 3HRSA 4IUTA 4JJNK 1JJ2A 4XEOA 2G4CA 4P72A 3CCET 2AMCB 5LJ3e 2JVVA 1SESA 2QEXT 3OQ5A 1X75C 4HT9A 4CI0C 4BE1A 2P0LA 2RI3A 4C8QB 5J26A 3LC0A 4M77D 3NTKA 2DK3A 1Y96B 2LT4A 1WJQA 1W2BA 3MCAB 5FROA 4JDSA 2XK0A 1HC7A 3E1SA 1BKBA 4YRGA 1YJ9T 2RHQA 2EJ9A 1M9SA 4II1A 3QIIA 4D6WA 1I81A 3QYHB 4C0DB 1YITT 3OBWA 4LVMA 4Q15A 1B8AA 4AH6A 4YTLA 4JRKA 4M7AA 2RHIA 3NTHA 3QPHA 3JCMe 4KT0E 4PJOE 3QSUA 3ERRA 3M4PA 2DU5A 3OYYA 2RK1A 2XIDA 3OYGA 4C92D 3V8LA 3GIBA 2XI9A 2E70A 4XTXA 3HY1A 1UGRB 4NL3A 4M75E 3H6ZA 5DM7R 4C5HA 4RQEA 2D6FA 4MDWA 2D9TA 4H2XB 2KSSA 1Z7MA 1M90C 2CJAA 3JSCA 4ZGEB 3OS1A 2DD5A 2X4JA 4HT4A 2RHSA 4ATOA 4N4IA 3MEAA 2VV5A 2DPPB 2EFIA 1WYDA 2WSCE 5D6WA 2FVUA 1G3SA 2ZXFA 4XTUA 3A32A 3OW2A 3TUPA 5L8RE 3I55A 3L2VA 1USYC 4RKUE 3VBBA 5F5WA 2F5KA 2CS7A 1N6AA 3HP9A 3G6ET 1XOVA 3CCEA 5KE3A 4Z02A 2A3LA 2P5IA 3SWNB 3J80E 4C5GA 1NJ6A 2XTIA 2QEXA 3HL8A 1B34B 4UP8A 4A4GA 3JB9F 3M55A 1M4ZA 3S6WA 1M5Q1 4M78E 1ASYA 3OYCA 3BDLA 3HRKA 3AHUA 4F7UA 2HD0A 1WJSA 1YJ9A 2F5TX 2I4OA 5GANf 1FWZA 2ZT5A 1YITA 4B9XA 3L4GB 3I56T 2PUOB 3PZCA 1WQWA 4BI3A 2RJEA 2EQKA 2XDDA 3CCLT 1K9MU 3M58A 2JNGA 5CKEA 1VQMT 3MF2A 2AKWA 4BDYA 2K3YA 2ODRC 4YCVA 2CKKA 3LGLA 4IUQA 3L2QA 3C4SA 2HQXA 2K57A 4PL6A 2E64A 5AYFA 3RESA 3JCMc 4KQEA 5GMKe 4KUDK 1YFTA 2QHTA 2DZCA 1YGBA 4IUPA 4H2VA 2ZPEB 4ZN1A 4E7LA 3VJPA 2LNVA 2HBPA 3CCQT 1M90U 4BY6C 5FU7B 1XNIA 2X4XA 2RK2A 2DKGA 2ZT6A 3E19A 4A4KA 5GAN8 3JB9D 3X20B 3CXCA 3LH0A 4PJOB 1G5HA 4XQ3A 4PJOA 3VQXA 2K2VA 2GFUA 3IKMB 3CCMT 3G6EA 3JCMJ 4P73C 5GAOn 3VUBA 4E51A 3CMET 5CR2A 4M75A 2RI5A 2IY5A 4DQ2A 1WNLA 4C0ZA 4P3NA 3LSQA 3X26B 5KE2A 1B70B 5LJ3d 3QXEB 5CK9A 3MQZA 2FYKA 1B70A 4YRCA 1M1FA 4P72C 3M57A 1XTDA 4J6XA 3I56A 4A53A 1WU7A 3HY0A 3QO8A 2O01E 1BBUA 3CCLA 3CC4T 3JCMW 1KMNA 4M77G 1VQMA 1UB4A 3OS0A 3CMAT 1Z7NA 2A8EA 3HRTA 11ASA 2XKOC 2EIFA 1H4SA 4C8QC 2R58A 4ZIBA 1PYSB 1D3BB 1EOVA 3E9HA 3QJYA 4P74A 4A54A 1PYSA 3L42A 4L87A 2DJZA 3OW2S 1JJCB 4J7IA 1FXXA 4P75A 2Q7GA 3DLMA 4M78A 1JJCA 2WSEE 4M7AC 1O9SA 1XQHA 1YJNT 3CCQA 4LVJA 4K87A 4C8QF 4C92G 4LDUA 3VKIA 4A4HA 2DIGA 1QF6A 1YI2T 2DTHA 2YLCA 2ZPGB 2E3CA 4YRSA 1B7YA 3JAME 3OSSC 1W4SA 3CCMA 1YHQT 4ME7A 4M7AF 4QVDA 3CMEA 3OYMA 1KD1C 4PLIA 2E5QA 4A4FA 4YRLA 5GAN5 5I21A 2ZPHB 3REUA 3VYGA 3DKMA 4ELZC 4MZMA 2PVOB 3DB4A 2XU8A 1KHCA 1KQ2A 2X4WA 2CJBA 3HSBA 3QNEA 3RGLA 3A7RA 3G71T 4LVKA 2M9UA 1VQ7T 4TQDA 3MP1A 3A5ZB 3CC4A 5GAN4 3RF1A 2OTLT 4XU0A 3CMAA 3CCRT 4C8QD 4P71A 3INZA 4JS5A 5HY6A 3CBPA 1H641 1BI0A 2FB7A 3GPLA 4WJ4A 3GOXA 2K5IA 3QO7A 4LDXA 3PIPA 4XTYA 4N0AA 4WF2A 2M0OA 5DLOA 2JN0A 1YJNA 1EFWA 4KULA 3UPUA 1PSEA 4ZTFA 3X24B 4FSXA 2DIQA 2MWOA 1YI2A 4HWTA 3TEHB 1JBMA 3OMCA 3C12A 4IKFA 3LSSA 1KHIA 1YHQA 2XDBA 2PQWA 5LJ3g 2R57A 3PMIA 3R07A 1LOJA 3HXUA 2O4XA 1NE8A 3JB9G 3P8TA 3QTCA 1KC8C 3OA6A 5FU7C 3LWIA 5C53B 4RMOA 3E9FA 1QP3A 3OB9A 1Y7XA 1VQ5T 4PJOC 3V8KA 2RHZA 3G1ZA 1HXDA 2ARTA 1QVFA 4OVAA 4L5GA 3G71A 1VQ7A 3JCMg 4ZN3A 1UGQB 5LJ5h 1VIFA 2OTLA 5GANh 1NJ5A 3CCRA 1BIAA 3L2WA 1IZ6A 4KUIA 3M9QA 3FRNA 4ZGDB 4E7HA 4PJOF 3P8HA 1N27A 1KOGA 4QVCA 2HNIA 1EQRA 2BKDN 2MMPA 2PVDB 1SSFA 3TREA 3BDUA 1P92A 1I8FA 4RQFA 2KK4A 2QQBA 3L2RA 4QQ6A 2RHQB 3W3SA 2Q5IA 3VQVA 4EO4A 3GP8A 3EAEA 3V7SA 3ZEHA 4LVLA 2DTIA 3FB9A 4M7AB 1IL2A 2DXUA 1VQ4T 1Y71A 4PKCC 3TCJA 4JS4A 2L8DA 5J39A 3UWNA 4LDYA 4Q5WA 1OZ3A 2LCLA 1OZ2A 3ME9A 1X6OA 3CCUT 1Q82C 4J6YA 4A4EA 2ZT8A 3ICAA 2QXFA 3ZFJA 3WVEB 5KCHA 3T9NA 3A8MB 2CYZB 3NEMA 4DPGA 3MP8A 1Q7YU 5GAMh 3QZ9B 4O5VA 4G85A 4HVCA 4PLLA 2RHUA 1UGPB 2RHSB 4RMFA 4HCBA 4HWSA 4PJOD 2F69A 1VQ5A 4LVIA 2X35A 3HFNA 2L89A 1E22A 2VYTA 4H2WA 5KNNA 2ZT7A 3RMQA 3HTZA 3RERA 2ZZEA 1QE0A 4NCXA 3CPWA 3L2ZA 4BACA 3OYKA 3HFVA 4E7JA 3A74A 1X2GA 5LJ5j 5GANj 1QVPA 1M8VA 2YLBA 4V2SA 5GANd 2ARSA 5K1PA 2RJCA 4F7UB 4K88A 2QTXA 3M4GA 3QG1A 5LJ5f 4C8QG 4OP0A 4CH3A 3OYLA 2LDMA 4XU2A 4UC4A 3CEYA 2DQ0A 3JCMV 1I4K1 2LRQA 4MMKA 2AKWB 2HQEA 2LQKA 4M7DE 3V7CA 3HXZA 3QHSA 1H4VB 1OYXA 2E6NA 2ZPFB 2MI6A 2X4YA 4LD6A 2AHJB 1M1KC 4M7AG 3CCUA 1U8RA 5K1XA 1Q82U 2V8JA 1UEBA 2ZGWA 1QVFS 4PNOA 4NL2A 3C94A 5ELOA 5CQYA 1YJWT 3VQWA 3JCMQ 4P3PA 4CH4A 2A7YA 5GAMj 4XEMA 2Q7HA 2ALYA 2DXTA 3O8VA 4E7IA 2JTMA 4OGEA 3E9IA 3QYGB 1NJ2A 1NJIC 5DLQE 2RO0A 5CIUA 4BDZA 1NJ1A 1N8RC 5GAMf 2EKOA 4XK8E 4IUUA 5GAOm 4J7FA 4OB3B 4CS4A 4BE0A 5GMKm 4M75B 2IY5B 2ZR3A 3VQYA 4YRIA 2MWPA 1YFRA 4HWRA 3GNGA 5J3BA 2QHSA 1EVLA 1JRIA 3KUFA 4BB7A 1YFSA 1G5VA 3IKLA 3G4ST 1N9RA 2DO3A 3KFUA 1NNHA 2R5MA 2LTOA 2MAMA 1ZHIA 4F7UG 3L2UA 4H2SA 1H3ZA 12ASA 3H8ZA 2RJFA 5CKDA 5A2QE 2ODRD 2J3LA 3RKYA 1ZBXA 4XTVA 3NELA 1FYFA 2ZZFA 3C95A 4HT8A 2LX9A 3MP6A 5CO7A 4MZTA 2LCCA 3MEUA 1L0WA 1M1KU 4TVAA 2QI2A 4M78B 5IN1A 2RH2A 2OTJT 3P8VA 1YJWA 3UH0A 3CPWS 1G3WA 1HK9A 3A8LB 1O75A 3BFMA 4UP9A 3R6OA 2DQ3A 1B7YB 3RL6A 4M7DB 5CAIA 2Q5HA 4TVRA 4YPFA 3CC2T 4R56A 5M9OA 4M7DA 2ZZDA 5CQXA 4ZGJB 3VV0A 4JRIA 2VUBA 3VU3C 2C7IA 1SERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXU A;  1X01 A;  2CIM A;  3JB9 G;  3P8T A;  2EL9 A;  4PJO G;  3QTC A;  2RHS A;  2EWN A;  5C53 B;  4KR3 A;  1WYD A;  4ZTZ B;  2E41 A;  4Y91 A;  4BWA A;  2RA2 A;  2DDZ A;  2E65 A;  4XTU A;  2ZXF A;  4PJO C;  3A32 A;  2EJF A;  3V8K A;  3A5Y A;  3TUP A;  3SB2 A;  1E1O A;  3PCO A;  3G1Z A;  1USY C;  3VBB A;  1HXD A;  5F5W A;  2ART A;  2E1H A;  1WPY A;  2ZNJ A;  4C8Q E;  3NEN A;  1B76 A;  2P5I A;  3HFZ A;  3JCM g;  3SWN B;  4EMK A;  5GMK l;  2RB6 A;  5LJ5 e;  5LJ5 h;  1NJ6 A;  3HFO A;  5GAN e;  5GAN h;  1NJ5 A;  2XTI A;  1BIA A;  1B34 B;  3FIF A;  1NJ8 A;  4UP8 A;  5LJ3 j;  3JB9 F;  4J6W A;  4PJO F;  4H02 A;  1KOG A;  4QVC A;  2HNI A;  1EQR A;  4RCB A;  4YYE A;  1M5Q 1;  3MF1 A;  4EMG A;  2PME A;  4M78 E;  1ASY A;  3BDU A;  4J5Y A;  3HRK A;  3FJP A;  3AHU A;  4F7U A;  1I8F A;  5C51 B;  4WI1 A;  4CH6 A;  2ARU A;  2I4O A;  5GAN f;  4RQF A;  4H2T A;  2RHQ B;  2ZT5 A;  5LJ3 f;  3W3S A;  4TVA B;  1NYR A;  2Q5I A;  3L4G B;  3UFG A;  3VQV A;  4EO4 A;  3PZC A;  4ZTU B;  4M7A D;  2DEQ A;  2PMF A;  1WQW A;  3V7S A;  2DTI A;  3FB9 A;  1BIB A;  4M7A B;  1IL2 A;  3A7A A;  2DXU A;  3EFR A;  3MF2 A;  2AKW A;  4JLI A;  4YRE A;  2ODR C;  1U1S A;  1YCY A;  4YCV A;  4HWP A;  1ADJ A;  4J15 A;  1E24 A;  1D3B A;  2I4M A;  3QUI A;  4F7U F;  4XU1 A;  3JCM d;  1KMM A;  3BW1 A;  2ZIN A;  2K57 A;  4YRN A;  2E64 A;  4J6Y A;  3RES A;  3JCM c;  2ZT8 A;  4KQE A;  4YRQ A;  3PGG A;  5GMK e;  5GMK h;  3ICA A;  1YFT A;  2QHT A;  2DZC A;  1YGB A;  5LJ5 g;  2I2L A;  5GAN g;  4RDX A;  4H2Y A;  4H2V A;  3NEM A;  1EVK A;  3JCM f;  4DPG A;  5GAM e;  5GAM h;  4G85 A;  1WQ7 A;  4HVC A;  4JUV A;  2RHS B;  2DKG A;  4RMF A;  2ZT6 A;  5GAN 8;  3JB9 D;  3QO5 A;  2C8M A;  4HWS A;  4PJO D;  1N9W A;  2VXE A;  4P3O A;  4PJO B;  1G5H A;  2ZIO A;  4HWO A;  2CGH A;  4XQ3 A;  3HFN A;  1E22 A;  2ZZG A;  2QHV A;  3HXV A;  4PJO A;  3VQX A;  4H2W A;  3PCO B;  5KNN A;  3RUX A;  2ZT7 A;  3IKM B;  3V8J A;  4TTV A;  4M75 G;  4MML A;  3HTZ A;  1USY A;  4YP0 A;  3RER A;  3JCM J;  3HXY A;  4EX5 A;  2YHT A;  3A31 A;  4P73 C;  5GAO n;  2ZZE A;  1QE0 A;  5ELN A;  4NCX A;  4CS3 A;  3L2Z A;  2DTO A;  3HFZ B;  4E51 A;  3TEG A;  4XU3 A;  3P8Y A;  4EMK B;  3A7U A;  2DU7 A;  1U1T A;  2RD1 A;  4M75 A;  2IY5 A;  3HFV A;  4M75 C;  5GAO l;  4DQ2 A;  4G84 A;  4YRR A;  1WNL A;  1N9S A;  3A74 A;  1X2G A;  2EJG A;  4M77 E;  5LJ5 j;  4P3N A;  1VQZ A;  3LSQ A;  5GAN j;  1ATI A;  1M8V A;  1KQ1 A;  2YLB A;  4UPA A;  3BJU A;  4YCU A;  4V2S A;  5GAN d;  3RKX A;  2ARS A;  5K1P A;  1B70 B;  5LJ3 d;  4XTZ A;  4F7U B;  3HXW A;  2FYK A;  1B70 A;  4K88 A;  4YRC A;  4M7A E;  4P72 C;  4YRT A;  1E1T A;  2QTX A;  3M4G A;  1W66 A;  5GAM g;  4J6X A;  5LJ5 f;  3SWN C;  4A53 A;  1WU7 A;  3HY0 A;  1H4Q A;  2Y90 A;  3QO8 A;  4M75 F;  4C8Q G;  2AMC A;  3DSQ A;  3CMQ A;  4OP0 A;  2QHU A;  3A5Z A;  4CH3 A;  3L1A A;  1BBU A;  4CH5 A;  4XU2 A;  3JCM W;  2DQ0 A;  1KMN A;  4M77 G;  3JCM b;  3JCM V;  5GAN 2;  1EIY B;  1I4K 1;  1Z7N A;  4MMK A;  1X2H A;  2AKW B;  11AS A;  1I5L A;  4C8Q A;  4C92 E;  4M7D E;  3V7C A;  4TWA A;  1EIY A;  1H4S A;  4C8Q C;  3HXZ A;  3QHS A;  1H4V B;  2ZNI A;  4ZIB A;  2ZTG A;  1PYS B;  1Y96 A;  1D3B B;  1EOV A;  3E9H A;  4P74 A;  4YRP A;  4M78 G;  4M77 C;  2E5A A;  4P74 C;  5GAO r;  4A54 A;  4M7A G;  1PYS A;  5GAO q;  4L87 A;  2DJZ A;  5K1X A;  3EFS A;  1GGM A;  1JJC B;  4KR2 A;  3QO3 A;  5HGQ A;  4P75 A;  1MGQ A;  3JB9 J;  1SRY A;  2Q7G A;  4P75 C;  1ASZ A;  2ZGW A;  2ZIM A;  4M78 A;  1JJC A;  4M78 C;  3I7F A;  4YRJ A;  4PNO A;  4NL2 A;  1G51 A;  4M7A C;  4O2D A;  5GMK j;  5ELO A;  2ZCE A;  4K87 A;  3VQW A;  4RCC A;  3RIR A;  3JCM Q;  4C8Q F;  4M7D G;  4C92 G;  4P3P A;  3JB9 I;  4CH4 A;  2J3M A;  5GAM j;  4YRO A;  1QF6 A;  1X56 A;  4M77 F;  3TEH A;  4NOY A;  2Q7H A;  4XEM A;  5GAN 6;  3OD1 A;  2DTH A;  2YLC A;  3M4Q A;  2E3C A;  4YRS A;  2ALY A;  2DXT A;  5GAO p;  1C0A A;  1B7Y A;  4UP7 A;  1J5W A;  4M7D C;  4C92 C;  3E9I A;  1LYL A;  3REX A;  1X54 A;  3UGQ A;  1ADY A;  1NJ2 A;  4M78 F;  4YRF A;  4M7A F;  4QVD A;  1NJ1 A;  2ZR2 A;  5GAM f;  4H2X A;  4HA8 A;  3RAC A;  4M75 D;  4P73 A;  2VC8 A;  1X55 A;  5GAO m;  1H4T A;  4CS4 A;  5GMK m;  4M75 B;  3WQZ A;  4XTW A;  2IY5 B;  1NYQ A;  5DY9 A;  3JCM P;  4YRL A;  5GAN 5;  2ZR3 A;  5I21 A;  3VQY A;  3JB9 H;  1LNX A;  4F7U E;  4TVW A;  4YRI A;  4X5O A;  1G5I A;  3REU A;  2DZ9 A;  5GMK i;  4CS2 A;  1YFR A;  1SET A;  3UGT A;  4HWR A;  4M7D F;  4C92 F;  4LNS A;  2XGT A;  3IAL A;  3JCM X;  2QHS A;  1KQ2 A;  5LJ5 d;  1JRI A;  1EVL A;  2CJB A;  3IG2 A;  1YB3 A;  1BBW A;  4PG3 A;  1RIQ A;  1YFS A;  3HSB A;  1WLE A;  4XEO A;  3V7R A;  3IKL A;  2G4C A;  2I4N A;  3QNE A;  3A7R A;  3RGL A;  4P72 A;  4EMK C;  4K86 A;  1N9R A;  3KFU A;  1NNH A;  2AMC B;  3SWN A;  5LJ3 e;  5LJ3 h;  4TQD A;  5GAN 4;  3RF1 A;  4F7U G;  4XU0 A;  3RKW A;  4EMH A;  1B34 A;  1SES A;  4H2S A;  4C8Q D;  2Q7E A;  4HT9 A;  12AS A;  3MEY A;  3INZ A;  4P71 A;  4BW9 A;  4P71 C;  2P0L A;  4C8Q B;  2ODR D;  1HTT A;  1H64 1;  3LC0 A;  4M77 D;  2J3L A;  3RKY A;  5GAN 7;  2FB7 A;  4H2U A;  2I4L A;  1Y96 B;  4YRK A;  4XTV A;  5GAN 3;  3NEL A;  4M77 B;  1FYF A;  4WJ4 A;  2ZZF A;  4HT8 A;  3QO7 A;  1HC7 A;  4M77 A;  4YRG A;  4XTY A;  4YDQ A;  4N0A A;  4WF2 A;  4N0A C;  1L0W A;  4M78 D;  2VXF A;  2EAY A;  2RHQ A;  2EJ9 A;  4X9C A;  4TVA A;  1I81 A;  2JN0 A;  4M78 B;  2DVE A;  2RM4 A;  3L4G A;  4PHC A;  1TH7 A;  4Q15 A;  1EFW A;  1B8A A;  4AH6 A;  4X9D A;  4JRK A;  3NET A;  3P8V A;  4M7A A;  3UH0 A;  4YCW A;  3JCM e;  3JCM h;  1HK9 A;  3BY7 A;  4OLF A;  1LJO A;  4PJO E;  3ERR A;  3QSU A;  3M4P A;  2E10 A;  2DU5 A;  3BFM A;  4HWT A;  3TEH B;  1JBM A;  4UP9 A;  3HRI A;  4M7D D;  4C92 D;  3V8L A;  2ALY B;  2DQ3 A;  3GIB A;  1B7Y B;  3RL6 A;  4M7D B;  4XTX A;  4C92 B;  5CAI A;  2Q5H A;  3LSS A;  3HY1 A;  4TQF A;  4YPF A;  4WJ3 M;  5GAM d;  4YRM A;  5C52 B;  4M7D A;  4C92 A;  4NL3 A;  4M75 E;  5E3I A;  4JRI A;  3HXX A;  4RQE A;  5LJ3 g;  4TVY A;  4H2X B;  3VU3 C;  2C7I A;  3R07 A;  4Q6G A;  2CJ9 A;  1Z7M A;  2CJA A;  1LOJ A;  1SER A; 
#chains in the Genus database with same CATH topology
 2EGA A;  1MV3 A;  2QDY B;  4OB0 B;  2NUT A;  4PJO G;  2DYB A;  1ZA1 B;  4JJB A;  1AWO A;  1ZUU A;  4J9G A;  4FM4 B;  2COY A;  2QQR A;  2X3W D;  4KR3 A;  4ZTZ B;  1TXQ A;  3WVD B;  2CZ0 B;  2KR3 A;  4DOV A;  4Y91 A;  2LVM A;  2KBT A;  3OYI A;  1BI1 A;  4PJN A;  1VQO T;  3A5Y A;  2KRN A;  1E1O A;  3PCO A;  3I9Q A;  2YXY A;  2W10 A;  4EDU A;  2E1H A;  3G7Z A;  5KYX A;  1RI0 A;  1SHG A;  3G4S A;  3UA7 A;  2ZNJ A;  4C8Q E;  3HFZ A;  1PRL C;  1KG1 A;  3E9G A;  1XJW B;  3ZBD A;  2XHC A;  1YBY A;  4EMK A;  5GMK l;  2RB6 A;  4Y28 E;  5LJ5 e;  2JTF A;  5GAN e;  4KGV B;  2V1Q A;  2PU9 B;  4FYV B;  4DOW A;  4O6J A;  2FL7 A;  4J6W A;  4H02 A;  2VKN A;  4YYE A;  2NWM A;  3MF1 A;  2OAU A;  2DET A;  3P8B B;  2PME A;  3G6E Q;  3M53 A;  3FJP A;  3HRU A;  1RAG B;  2QGF B;  5C51 B;  4WI1 A;  1PHT A;  2K3X A;  2ARU A;  2Y4X A;  3ASK A;  2E3H A;  4J9D A;  3A1P A;  1JQQ A;  2FPE A;  1NYR A;  3P8D A;  2EBP A;  3S3M A;  3OYD A;  1QVG A;  4LE9 A;  3VRZ A;  2OTJ A;  4PFZ A;  4M7A D;  2DEQ A;  2O9V A;  1VQN T;  1GCQ A;  2HDA A;  2HKQ B;  3EFO A;  2KMT A;  2E12 A;  1ZBJ A;  3A7A A;  1EIF A;  2CP5 A;  2EYQ A;  1AWW A;  5D6X A;  2RHX A;  4E7K A;  5KCO A;  4C5E A;  1UGS B;  5I2S A;  1U1S A;  1K8A C;  2KQW A;  4J15 A;  1X2Q A;  3OBY A;  1E24 A;  2I4M A;  4F7U F;  1K0X A;  5HK0 A;  4XU1 A;  3TU4 K;  3LYI A;  3CC2 A;  1KMM A;  2YWW A;  3I56 Q;  1W1F A;  2AK5 A;  2KRO A;  3NHN A;  4DBF A;  2GBQ A;  5FLX E;  4YRQ A;  3PGG A;  4P5N A;  3CCL Q;  2KRM A;  2PNI A;  2P0Q A;  1A0N B;  5KYU A;  1VQM Q;  1BU1 A;  1M3C A;  2H8H A;  4RDX A;  4ELY C;  2XDP A;  3VS4 A;  5KYY B;  1VQ6 T;  1D0Z A;  2V8I A;  5GAM e;  2O4X B;  1WQ7 A;  4JUV A;  1X69 A;  3OSV A;  3OYB A;  3RMS A;  3J81 E;  3GLX A;  3QO5 A;  2C8M A;  2RQU A;  1KD1 U;  2M16 A;  1N5Z A;  4P3O A;  3HPW A;  1VQO A;  5CKH A;  4HWO A;  1MMA A;  2ROT A;  2CGH A;  3GNF B;  4OMO A;  2G3R A;  3HXV A;  4FU6 A;  1R8O B;  1PNJ A;  1QQJ A;  2H3J A;  1GL5 A;  2YDL A;  4TTV A;  4MML A;  3CCQ Q;  4EX5 A;  1Q82 R;  2YHT A;  1WJR A;  1UUE A;  2P0P A;  4RTW A;  2O88 A;  3N5B B;  1IO6 A;  4XU3 A;  2GF7 A;  2PTK A;  1U1T A;  2RD1 A;  3NFC A;  1OEB A;  4FYY B;  4M75 C;  2DER A;  2JOY A;  2MPX C;  1UE9 A;  4G84 A;  4YRR A;  4M77 E;  2BE7 D;  3THK A;  4BD3 A;  2LMJ A;  2QA4 T;  3CCM Q;  1KQ1 A;  3BJU A;  1ZSZ C;  4FT2 A;  2GQV A;  4J83 A;  3FC3 A;  2BE9 B;  2QQA A;  1QWE A;  2YUO A;  3HXW A;  3SDZ A;  3CME Q;  2QAZ A;  1NLP C;  1W66 A;  1VQ8 T;  2SEM A;  1QKW A;  3QJ6 A;  1TUD A;  4M75 F;  3M5A A;  1VQN A;  2AMC A;  1VQP T;  3R6N A;  3L1A A;  1KQS P;  4E7Z A;  4R55 A;  4CH5 A;  3A8O B;  3JCM b;  1RAE B;  5GAN 2;  3HHT B;  1EIY B;  1ZQ1 A;  4JZ3 A;  2FPF A;  1DJ7 B;  4C8Q A;  4C92 E;  2VB6 A;  1EIY A;  2CRE A;  2HL3 A;  2DRK A;  2ZTG A;  1Y96 A;  2ESW A;  2DA9 A;  4YRP A;  1K8A U;  2E5A A;  4JRP A;  4P74 C;  4OMQ A;  1E6G A;  1NZ9 A;  3EFS A;  4FYX B;  4KR2 A;  4GY5 A;  3QO3 A;  1VQL T;  1LVK A;  2VGM A;  3CC4 Q;  3QZ5 B;  1K9M C;  3JB9 J;  4P75 C;  2ZIM A;  3CMA Q;  4M78 C;  5A0G A;  2EYZ A;  1VQ6 A;  4O2D A;  4OB2 B;  2R5A A;  3PT9 A;  3C0C A;  1J3T A;  4FIB A;  4LD9 K;  2DXB A;  8ATC B;  2FHD A;  3JB9 I;  4HCZ A;  2J3M A;  4N4G A;  3FEO A;  1X56 A;  4NOY A;  2MCN A;  3M4Q A;  1M1G A;  2RQW A;  1GFD A;  5GAO p;  3OY9 A;  1KC8 U;  1C0A A;  2FZC B;  2FG0 A;  2LX7 A;  4UP7 A;  1J5W A;  1JJ2 P;  1OI1 A;  4M7D C;  2O9S A;  3MHX A;  3REX A;  3UGQ A;  3VYH B;  1YJN Q;  1QCN A;  4M78 F;  4YRF A;  1M1K R;  1BYM A;  5IT9 E;  1VA7 A;  2ZR2 A;  4JPB W;  4H2X A;  4HA8 A;  3S3N A;  1NBE B;  2K5F A;  3RAC A;  4M75 D;  1V1C A;  2VC8 A;  1Y57 A;  3PNW C;  1H4T A;  1YI2 Q;  3SFM A;  3S3O A;  1QVG S;  3WQZ A;  1QCF A;  4XTW A;  3LGF A;  4NS5 A;  5DY9 A;  1U5S A;  3JCM P;  2EQJ A;  2HCK A;  2XD0 A;  1W6X A;  3JB9 H;  1G5I A;  1W2B P;  2K6D A;  4F14 A;  2QA4 A;  2DZ9 A;  2OJ2 A;  4CS2 A;  3UDC A;  3UGT A;  4M7D F;  4LNS A;  2LJ3 A;  1VQK T;  1VIE A;  1YHQ Q;  3IAL A;  2YRV A;  5FU6 B;  2EPD A;  5LJ5 d;  3IG2 A;  1YB3 A;  1BBW A;  4K11 A;  3UF4 A;  1RIQ A;  1BI3 A;  1NG2 A;  4BI4 A;  1WLE A;  3V7R A;  3PIO A;  2I4N A;  3NMZ C;  1VQ8 A;  1S1N A;  1NJI R;  4EMK C;  4K86 A;  1VQP A;  4X34 A;  4EPC A;  2NUP A;  3MET A;  3SWN A;  5LJ3 h;  2CZ1 B;  1R77 A;  2DXC A;  3QKJ A;  3RKW A;  5FRN A;  1X43 A;  3EG0 A;  4EMH A;  1B34 A;  1AZE A;  1S72 T;  4XAX B;  4OMM A;  2Q7E A;  8AT1 B;  3MEY A;  2KAF A;  4E47 A;  4BW9 A;  4P71 C;  1VQ4 A;  1KQS S;  1HTT A;  3OYA A;  5GAN 7;  4H2U A;  2I4L A;  4YRK A;  5GAN 3;  4M77 B;  3PTA A;  3G71 Q;  1UJ0 A;  1PSF A;  4ZTJ A;  2PUK B;  4M77 A;  2Y4Y A;  4YDQ A;  1VQ7 Q;  1VQL A;  3VUZ A;  2K4Y A;  2BIV A;  1OOT A;  4N0A C;  3TEE A;  3TSZ A;  2C0T A;  4M78 D;  2VXF A;  4OB1 B;  1V29 B;  2EAY A;  3VS0 A;  4X9C A;  2OTL Q;  5FW9 A;  3VS5 A;  3OS2 A;  3M0Q A;  3CCR Q;  2DVE A;  2RM4 A;  3L4G A;  4PHC A;  1GCQ C;  1B07 A;  2VAS A;  1TH7 A;  4X9D A;  2DFU A;  3VS1 A;  3NET A;  5ECA A;  1YIJ T;  4YCW A;  3TQ7 P;  2IVW A;  1UG1 A;  3JCM h;  4DBQ A;  4IUR A;  3BY7 A;  1D09 B;  4OLF A;  1LJO A;  3OMG A;  5D7U A;  2E10 A;  2LT1 A;  3HKS A;  1T3L A;  3OW2 P;  2V1R A;  1U06 A;  2DD4 A;  3HRI A;  4M7D D;  3LW5 E;  2ALY B;  1PC0 A;  1AVZ C;  1PD0 A;  3SHW A;  4WJ3 M;  4C92 B;  4VUB A;  4TQF A;  5GAM d;  1QCO A;  4EIK A;  1M2V A;  2M02 A;  4YRM A;  5C52 B;  4C92 A;  4FW2 A;  2DAQ A;  5E3I A;  3HXX A;  1JJ2 S;  5KYN A;  3VS3 A;  4TVY A;  3GF5 A;  4Q6G A;  2CJ9 A;  1OX9 A;  4RG2 A;  5FRM A;  1G3Y A;  2DRM A;  4JJC A;  3EG1 A;  1JU5 C;  3OYJ A;  3A8G B;  1X01 A;  2KDS A;  2CIM A;  5HK3 A;  2CP3 A;  2EL9 A;  1ZUK A;  3ER0 A;  3I5R A;  1GBR A;  2RPN A;  2KY9 A;  2EWN A;  5IHI A;  2XG8 D;  2YUN A;  4C5I A;  1IHV A;  1VQK A;  2E41 A;  1QW1 A;  1K73 C;  4BWA A;  2RA2 A;  2DDZ A;  1YCS B;  2E65 A;  4PFO A;  1IRE B;  2K9G A;  2QQ9 A;  2EJF A;  1WYX A;  3X28 B;  1UEC A;  1W2B S;  3SB2 A;  2GTO A;  4PJJ A;  1ZSZ B;  3CBM A;  2C06 A;  1GXI E;  1Q81 C;  2QYZ A;  1M3B A;  4KGZ B;  1WPY A;  5C6S A;  1U3O A;  3J7A F;  1VYU A;  3LWH A;  2JS0 A;  3NEN A;  1B76 A;  2A28 A;  1AHJ B;  2B8A A;  2BZ8 A;  2DL8 A;  1VQ9 T;  3HFO A;  1QKX A;  4OGC A;  3FLG A;  3OYN A;  1S72 A;  1VQ5 Q;  3FIF A;  1CKA A;  4QVZ A;  1BB9 A;  1NJ8 A;  3CCV T;  4B6M A;  4HKE A;  5LJ3 j;  1NPP A;  3LH5 A;  2CP7 A;  3I5S A;  1KD1 R;  2HAX A;  4RCB A;  2MF2 A;  4EMG A;  1HSQ A;  1ABQ A;  4J5Y A;  2RQV A;  2CZ7 B;  1QP2 A;  4BUG A;  1BI2 A;  2GCX A;  4JJD A;  2YRC A;  5HKC A;  1Q86 C;  4CH6 A;  4WCI A;  2ZAE A;  1G3T A;  2ZPI B;  4H2T A;  5C0M A;  5CVI A;  1H8K A;  5LJ3 f;  1SSH A;  1SF9 A;  4TVA B;  4LDV A;  2RI2 A;  3PFS A;  3DB3 A;  2LQN A;  3UFG A;  4ZTU B;  2CZ6 B;  4QW2 A;  2PMF A;  1YIJ A;  3NTI A;  1BIB A;  3CXC P;  2LC4 A;  3EFR A;  2XIC A;  4JLI A;  2JJ9 A;  2QQS A;  2YSQ A;  3JRZ A;  4YRE A;  1YCY A;  4HWP A;  2VGN A;  1ADJ A;  2K5L A;  1D3B A;  3QUI A;  3OYE A;  3F70 A;  4C0F A;  3JCM d;  3MO8 A;  3RDV A;  3BW1 A;  2ZIN A;  1NLO C;  4YRN A;  3CD6 T;  2ENM A;  4CC7 A;  2V8K A;  3MPU B;  1FX7 A;  2CUD A;  4C0D C;  1AWX A;  5GMK h;  3QDR B;  4RG8 A;  2A37 A;  2JM9 A;  1OUL A;  2GFA A;  5LJ5 g;  2E6Z A;  2EGC A;  2I2L A;  5GAN g;  4CC2 A;  4H2Y A;  1EVK A;  1AOJ A;  3JCM f;  2JTE A;  2LQ8 A;  1NJI U;  4BI8 B;  3KXT A;  3DLL A;  1GBQ A;  2NUT B;  2RNA A;  2MYS A;  1D1C A;  3CC7 T;  1UJY A;  3TVT A;  4DA4 A;  4JRQ A;  1N8R U;  1RAA B;  2CP0 A;  4J9C A;  2J6K A;  4DBR A;  5FWC A;  4OMF B;  3CCU Q;  1TSF A;  1N9W A;  2D8H A;  2VXE A;  5D6Y A;  2ZIO A;  2P0K A;  3OYF A;  1K8A R;  2ZZG A;  2QHV A;  1K73 U;  2P4T A;  4AT1 B;  3QBY A;  3PCO B;  3RUX A;  2M0Y A;  3V8J A;  2AZS A;  3OYH A;  4KBM B;  4M75 G;  1D0X A;  1USY A;  4YP0 A;  5KYX B;  3HXY A;  2ATC B;  2FRY A;  3A31 A;  1Q81 U;  5ELN A;  4F17 A;  3CCJ T;  3CCS T;  5FWB A;  4CS3 A;  4QQG A;  2OI3 A;  2DTO A;  3HFZ B;  2F1L A;  3TEG A;  3MEW A;  1VQ9 A;  3P8Y A;  3LLR A;  4EMK B;  3A7U A;  2J6F A;  2DU7 A;  4OMN A;  3M54 A;  1Y07 A;  5EC7 A;  2K7A A;  5GAO l;  2CT4 A;  1R0C B;  3CCV A;  1WGS A;  3UT1 A;  2B86 A;  1N9S A;  2EJG A;  4IUV A;  4HCC A;  5KYW B;  1VQZ A;  4J8O A;  1ATI A;  4JLG A;  1KC8 R;  4UPA A;  5KYW A;  2BUD A;  2HSE B;  2IG0 A;  5FU6 C;  4YCU A;  3RKX A;  1RL2 A;  1NPR A;  4AG2 C;  3RNJ A;  3SD4 A;  4XTZ A;  2X51 A;  3URG A;  4MZP A;  4QT7 A;  5EG2 A;  4GLK A;  4M7A E;  1IB8 A;  4YRT A;  1E1T A;  2F2W A;  5GJW B;  1VUB A;  5KH6 A;  1AWJ A;  5GAM g;  3SWN C;  2CT3 A;  1Q86 U;  1H4Q A;  2Y90 A;  3M56 A;  1MHN A;  2JUF A;  3DSQ A;  4L59 A;  3CMQ A;  3A8H B;  1D1B A;  4DEY A;  2QHU A;  3A5Z A;  3M59 A;  1NYG A;  2EW3 A;  3EFO B;  4F16 A;  2KT1 A;  1AT1 B;  4J9B A;  1X2H A;  2EQU A;  3NPF A;  1X6B A;  1I5L A;  1ZX6 A;  4TWA A;  4AFQ C;  3CXC S;  2ZNI A;  1Z9Q A;  5I2M A;  4M78 G;  4M77 C;  1FMV A;  1K9A A;  5GAO r;  4FT4 A;  3H0F A;  4N4H A;  5LL6 S;  2X3X D;  4FL6 A;  2L3P A;  3CD6 A;  5GAO q;  5CCA A;  2D0Q B;  2G6F X;  1D1A A;  1GGM A;  2W0Z A;  5HGQ A;  2L2P A;  3CBO A;  2JZ2 A;  2RJD A;  1RAB B;  3EHR A;  1MGQ A;  3PMT A;  1SRY A;  2ZPB B;  1ASZ A;  5CKF A;  4LDW A;  5KYU B;  1JB0 E;  3I7F A;  4QQD A;  4YRJ A;  2PZ1 A;  1G51 A;  2KVQ G;  3CPF A;  5CKB A;  4HVV A;  5GMK j;  1C1A A;  3M4Y A;  3CC7 A;  2ZCE A;  3X25 B;  4RCC A;  4BY6 B;  2K3B A;  2L3R A;  1V76 A;  3RIR A;  4M7D G;  4L6V 5;  2WSF E;  3EGX B;  4DEX A;  1KQS A;  2DVJ A;  1YN8 A;  4YRO A;  3LX7 A;  2NUZ A;  1WHK A;  2F2V A;  4M77 F;  3TEH A;  2M1H A;  5GAN 6;  3EGX A;  3OD1 A;  2LZ6 B;  3D7S B;  1I5O B;  2ZCF B;  4MDX A;  2NS6 A;  5IAY A;  2RQR A;  4C92 C;  3FDR A;  2A08 A;  1LYL A;  1GCP A;  5A0D A;  1X54 A;  2KYB A;  1Q7Y C;  1ADY A;  3RBB B;  1B7T A;  4OF1 A;  3RR6 A;  1YJW Q;  2EQM A;  3CCJ A;  3CCS A;  1M2O A;  2NLU A;  1OPL A;  2L3S A;  4P73 A;  1X55 A;  2RHY A;  3MEV A;  2DNU A;  2EYX A;  3Q1J A;  1HJD A;  4B9W A;  1NYQ A;  1R0B G;  2L5Q A;  1LNX A;  4F7U E;  4TVW A;  3UA6 A;  3WXM B;  4CRI A;  4X5O A;  2PVG B;  6AT1 B;  5GMK i;  4C0G A;  1SET A;  4C92 F;  3VS6 A;  2XGT A;  2HKN A;  4BE2 A;  2C0O A;  5A0L A;  3JCM X;  3KBG A;  2C0I A;  2WAC A;  3I55 T;  3OS5 A;  4PG3 A;  3HRS A;  4E2F B;  4IUT A;  4RTT A;  4JJN K;  1JJ2 A;  4XEO A;  2G4C A;  1WHG A;  4P72 A;  1WFW A;  3CCE T;  4ANJ A;  2AMC B;  5LJ3 e;  2CSI A;  2NYS A;  2JVV A;  1SES A;  2QEX T;  3OQ5 A;  1X75 C;  4HT9 A;  4CI0 C;  4BE1 A;  1I1J A;  1TTH B;  2P0L A;  2RI3 A;  4C8Q B;  2COW A;  2D0N A;  1X27 A;  5J26 A;  3LC0 A;  4M77 D;  3NTK A;  2RQT A;  1UHC A;  1Y96 B;  2DK3 A;  1UFF A;  2DL7 A;  2LT4 A;  1WJQ A;  1W2B A;  3MCA B;  5FRO A;  4KH1 B;  3UAT A;  4JDS A;  2XK0 A;  3G4S Q;  1HC7 A;  1YFN A;  3E1S A;  1BKB A;  4YRG A;  2LCS A;  1YJ9 T;  2KXC A;  4F04 B;  2RHQ A;  2EJ9 A;  1M9S A;  4II1 A;  3QII A;  4D6W A;  4LN2 A;  1I81 A;  3QYH B;  4C0D B;  1YIT T;  3OBW A;  4LVM A;  3VS7 A;  2A36 A;  4Q15 A;  1B8A A;  1M27 C;  5L23 A;  4YTL A;  4AH6 A;  4JRK A;  1TG0 A;  2DEU A;  4M7A A;  1LCK A;  2RHI A;  1TUC A;  3NTH A;  3QPH A;  3JCM e;  1SHF A;  4KT0 E;  3QSU A;  4PJO E;  3EHQ A;  3ERR A;  3M4P A;  2DU5 A;  2CP2 A;  3OYY A;  2RK1 A;  1PCX A;  2XID A;  3OYG A;  4C92 D;  1VYV A;  2FZG B;  2BTT A;  3V8L A;  3GIB A;  2XI9 A;  2E70 A;  1QVF P;  4XTX A;  3HY1 A;  2MOX A;  5IH2 A;  1UGR B;  4NL3 A;  1YP5 A;  2J7I A;  4M75 E;  2OTJ Q;  3H6Z A;  5DM7 R;  1QLY A;  4C5H A;  4RQE A;  1WXU A;  2D6F A;  4MDW A;  2D9T A;  4H2X B;  2KSS A;  1Z7M A;  1T0H A;  1M90 C;  2CJA A;  2CP6 A;  3JSC A;  3BE3 A;  4ZGE B;  1ABO A;  1OU9 A;  3OS1 A;  2DD5 A;  2X4J A;  1OPK A;  4HT4 A;  2RHS A;  4ATO A;  1SG5 A;  2LP5 A;  4N4I A;  3MEA A;  2VV5 A;  2DPP B;  2EFI A;  3CC2 Q;  1WYD A;  2KGT A;  2WSC E;  5D6W A;  2FVU A;  1G3S A;  2FO0 A;  2ZXF A;  4XTU A;  1W70 A;  3A32 A;  3VS2 A;  1WA7 A;  3I35 A;  3OW2 A;  3TUP A;  5L8R E;  3I55 A;  2A0F B;  2RF0 A;  2OAW A;  4RKU E;  3L2V A;  1KFZ A;  1USY C;  1RAH B;  3VBB A;  5F5W A;  2F5K A;  2CS7 A;  1N6A A;  2JMA A;  3HP9 A;  3G6E T;  1XOV A;  3CCE A;  2SRC A;  5KE3 A;  1Y0M A;  4Z02 A;  2A3L A;  2P5I A;  3GBQ A;  2NUP B;  3SWN B;  3J80 E;  1OU8 A;  2P4R A;  1MMD A;  4C5G A;  1NJ6 A;  2XTI A;  1E6H A;  2QEX A;  1N8R R;  3HL8 A;  1B34 B;  1SER A;  1VQO Q;  4LUD A;  4UP8 A;  2CUB A;  4A4G A;  3JB9 F;  1GRI A;  3M55 A;  1M4Z A;  3S6W A;  1M5Q 1;  1Q95 G;  2ECZ A;  4PK4 A;  4M78 E;  1ASY A;  3OYC A;  3BDL A;  2KI7 A;  3HRK A;  1K73 R;  3AHU A;  4F7U A;  2HD0 A;  1WJS A;  1YJ9 A;  1B3Q A;  2F5T X;  1KJW A;  2I4O A;  5GAN f;  1FWZ A;  2ZT5 A;  1YIT A;  4B9X A;  1Q81 R;  3L4G B;  2EQI A;  3I56 T;  2PUO B;  3PZC A;  3TSW A;  4R0K A;  1WQW A;  4BI3 A;  2RJE A;  2EQK A;  2XDD A;  3CCL T;  1K9M U;  3M58 A;  2JNG A;  5CKE A;  1K76 A;  1VQM T;  3MF2 A;  2AKW A;  1PM3 A;  3QWY A;  1NYF A;  4BDY A;  1YNZ A;  2K3Y A;  2ODR C;  4YCV A;  1IHW A;  2DL3 A;  2CKK A;  2LJ0 A;  4M4Z A;  1BK2 A;  3LGL A;  4IUQ A;  3L2Q A;  2KYM A;  2DL5 A;  1M2V B;  2HQX A;  2K57 A;  3C4S A;  1RLQ C;  1RLP C;  4PL6 A;  2E64 A;  5AYF A;  3RES A;  3JCM c;  3CPW P;  1VQN Q;  4KQE A;  4OML A;  5GMK e;  4KUD K;  4E6R A;  2EKH A;  1YFT A;  2QHT A;  1WX6 A;  2DZC A;  1YGB A;  1Q86 R;  1IGU A;  4IUP A;  4H2V A;  2ZPE B;  4ZN1 A;  4E7L A;  2MIO A;  3VJP A;  2LNV A;  2HBP A;  1EZZ B;  1KK7 A;  3CCQ T;  1M90 U;  1SEM A;  2KRS A;  4BY6 C;  5FU7 B;  1XNI A;  2X4X A;  2RK2 A;  2AKK A;  2DKG A;  1WXT A;  2ZT6 A;  3E19 A;  4A4K A;  3MKD A;  1NEG A;  5GAN 8;  3JB9 D;  3X20 B;  3CXC A;  3LH0 A;  2GGR A;  4PJO B;  1G5H A;  5I11 A;  1K0S A;  1MMN A;  4XQ3 A;  5HCK A;  4X1V A;  4PJO A;  3VQX A;  3EGU A;  1HYO A;  1UGV A;  2K2V A;  2GFU A;  3IKM B;  3CCM T;  1VQ6 Q;  3MJX A;  1QMC A;  3G6E A;  3JCM J;  4P73 C;  2CH4 A;  2IIM A;  5GAO n;  3VUB A;  1K1Z A;  2LNH B;  4E51 A;  3CME T;  5CR2 A;  4M75 A;  2RI5 A;  2IY5 A;  4DQ2 A;  2LJ1 A;  1E7O A;  1WNL A;  4C0Z A;  1KIK A;  1OV3 A;  2MK5 A;  4P3N A;  4ZNX A;  2VWF A;  3LSQ A;  2DL4 A;  4AMC A;  1OX8 A;  3X26 B;  1WHJ A;  3E2U A;  5KE2 A;  1FYN A;  1B70 B;  5LJ3 d;  2KE9 A;  3QXE B;  5CK9 A;  1M30 A;  3MQZ A;  2QG9 B;  2FYK A;  1B70 A;  4YRC A;  1M1F A;  4P72 C;  3M57 A;  1XTD A;  4J9F A;  3PE0 A;  4J6X A;  3I56 A;  4A53 A;  4HVU A;  1WU7 A;  3HY0 A;  3QO8 A;  2J05 A;  2O01 E;  1C0M A;  2KNB B;  1BBU A;  2DM1 A;  3CCL A;  2QA4 Q;  3CC4 T;  3JCM W;  1KMN A;  4M77 G;  1VQM A;  1UB4 A;  3OS0 A;  3CMA T;  1Z7N A;  2A8E A;  3HRT A;  1UTI A;  11AS A;  2XKO C;  2EIF A;  1H4S A;  4C8Q C;  1NM7 A;  2R58 A;  4ZIB A;  1WHH A;  1MNE A;  1PYS B;  1D3B B;  3QDF A;  1FMW A;  1EOV A;  3E9H A;  3QJY A;  1AEY A;  4P74 A;  4A54 A;  1VQ8 Q;  1PYS A;  2DYI A;  3L42 A;  4L87 A;  2DJZ A;  2IPO B;  2BZY A;  2M51 A;  3OW2 S;  1VQP Q;  1UHF A;  1JJC B;  2DJQ A;  2FPD A;  1FXX A;  4J7I A;  4P75 A;  2Q7G A;  3DLM A;  4M78 A;  1JJC A;  2WSE E;  4M7A C;  1O9S A;  1XQH A;  1YJN T;  3CCQ A;  4LVJ A;  1VQ4 Q;  3CQT A;  4K87 A;  4C8Q F;  4C92 G;  1PD1 A;  4LDU A;  4FW1 A;  3KFV A;  3VKI A;  4A4H A;  2DIG A;  3REB B;  1QF6 A;  1YI2 T;  2DTH A;  2YLC A;  2ZPG B;  2E3C A;  4YRS A;  1VQL Q;  1B7Y A;  4IIM A;  3JAM E;  1PG5 B;  1AZG B;  3OSS C;  1W4S A;  5I22 A;  2YRD A;  2D1X A;  3CCM A;  1TU0 B;  1YHQ T;  4ME7 A;  1WHM A;  4M7A F;  4QVD A;  2AKL A;  1MV0 B;  2X9H A;  3CME A;  4RTV A;  3OYM A;  1KD1 C;  4PLI A;  3ZL7 C;  2E5Q A;  4A4F A;  2F2X A;  2O2O A;  1EFN A;  4YRL A;  5GAN 5;  5I21 A;  2RN8 A;  2ZPH B;  3REU A;  3VYG A;  3DKM A;  4ELZ C;  1IGQ A;  4MZM A;  2PVO B;  3DB4 A;  5IHN A;  2XU8 A;  2ABL A;  1KHC A;  1KQ2 A;  2X4W A;  2CJB A;  4FSS A;  3HSB A;  1ZUY A;  3QNE A;  3RGL A;  3A7R A;  3G71 T;  2AZV A;  1Q7Y R;  4J9E A;  1WXB A;  4LVK A;  2M9U A;  1VQ7 T;  4TQD A;  3MP1 A;  3A5Z B;  3CC4 A;  5GAN 4;  2I0N A;  3RF1 A;  2HSP A;  2QAS A;  1VQK Q;  2OTL T;  4XU0 A;  3CMA A;  3M0U A;  3CCR T;  1BCM A;  4C8Q D;  3EH2 A;  4P71 A;  3INZ A;  1RAF B;  4JS5 A;  5HY6 A;  3CBP A;  1H64 1;  3O5Z A;  1BI0 A;  2FB7 A;  1JEG A;  1VYT A;  3A98 A;  3NGP A;  3GPL A;  2KT8 A;  1ARK A;  4WJ4 A;  4D8K A;  2K79 A;  3GOX A;  2K5I A;  3QO7 A;  4LDX A;  1PWT A;  3PIP A;  4XTY A;  4N0A A;  2GTJ A;  4WF2 A;  1M3A A;  2M0O A;  3EGD B;  2L3Q A;  5DLO A;  2JN0 A;  1S72 Q;  4RTX A;  3EGD A;  1YJN A;  1EFW A;  4KUL A;  3UPU A;  1PSE A;  4ZTF A;  3X24 B;  4FSX A;  2DIQ A;  2JS2 A;  2MWO A;  1YI2 A;  2YUQ A;  4HWT A;  3TEH B;  1JBM A;  1YWP A;  4Z88 A;  1PKS A;  3OMC A;  2HEQ A;  1TS9 A;  3C12 A;  4IKF A;  3LSS A;  1G8X A;  1KHI A;  1YHQ A;  1MND A;  1G2B A;  2COZ A;  2XDB A;  2HQH A;  2PQW A;  1YIJ Q;  5LJ3 g;  2R57 A;  3PMI A;  3R07 A;  1F1B B;  4AFZ C;  1LOJ A;  5KYY A;  3HXU A;  3EG2 A;  2O4X A;  1NE8 A;  3JB9 G;  3P8T A;  3QTC A;  1KC8 C;  3OA6 A;  1K9M R;  9ATC B;  5FU7 C;  3LWI A;  2BZX A;  3G1J A;  5C53 B;  4RMO A;  3E9F A;  1QP3 A;  4PJM A;  3OB9 A;  4ESR A;  1EX4 A;  1Y7X A;  1M8M A;  1VQ5 T;  4PJO C;  3V8K A;  2CH4 W;  1BBZ A;  2DBK A;  1ZSG A;  2RHZ A;  1MMG A;  3G1Z A;  1QVG P;  1HXD A;  2OX7 A;  2ART A;  1QVF A;  4OVA A;  4L5G A;  3G71 A;  4DBH A;  1LPL A;  2QTV A;  1VQ7 A;  4KH0 B;  1X6G A;  3JCM g;  4ZN3 A;  1UGQ B;  5LJ5 h;  1NEB A;  1VIF A;  2D8J A;  2OTL A;  1M90 R;  5GAN h;  1NJ5 A;  3CCR A;  1BIA A;  3L2W A;  1IZ6 A;  4KUI A;  2LQW A;  3M9Q A;  3M0T A;  3REA B;  3FRN A;  4ZGD B;  4E7H A;  4PJO F;  3P8H A;  1N27 A;  1KOG A;  4QVC A;  2HNI A;  1EQR A;  1JXM A;  2BKD N;  2MMP A;  3JV3 A;  2PVD B;  1SSF A;  4RTY A;  4RUG A;  3BDU A;  3TRE A;  3H9N A;  1FMK A;  1P92 A;  1I8F A;  4J9I A;  2AIR B;  4RQF A;  2KK4 A;  2QQB A;  3L2R A;  4QQ6 A;  1VQ9 Q;  1RAI B;  2RHQ B;  2XMF A;  1RAC B;  3W3S A;  4PJL A;  2Q5I A;  3CCV Q;  3VQV A;  4EO4 A;  3GP8 A;  5IXF A;  2ROL A;  3EAE A;  3V7S A;  3ZEH A;  4LVL A;  2DTI A;  3FB9 A;  2HZY A;  4M7A B;  1IL2 A;  2DXU A;  1VQ4 T;  1Y71 A;  1KSW A;  2VVK A;  1WHL A;  4PKC C;  3TCJ A;  4JS4 A;  2L8D A;  5J39 A;  3UWN A;  2DIL A;  4LDY A;  2YUP A;  4Q5W A;  1QWF A;  4J9H A;  4HVW A;  1OZ3 A;  2LCL A;  1OZ2 A;  1ZLM A;  3ME9 A;  1X6O A;  4QKU A;  2DX1 A;  3CCU T;  1Q82 C;  2L0A A;  4J6Y A;  4A4E A;  2ZT8 A;  3ICA A;  2QXF A;  3ZFJ A;  5AT1 B;  4FCY A;  3WVE B;  5KCH A;  3T9N A;  5GJV B;  3A8M B;  2CYZ B;  3NEM A;  3AT1 B;  4DPG A;  3MP8 A;  1Q7Y U;  5GAM h;  3QZ9 B;  4O5V A;  4G85 A;  4A63 B;  4HVC A;  4PLL A;  2RHU A;  1UGP B;  2ED1 A;  3EG9 B;  2RHS B;  4RMF A;  4HCB A;  1H92 A;  2GNC A;  4HWS A;  4PJO D;  3EG9 A;  1WI7 A;  3EH1 A;  3CD6 Q;  2F69 A;  1VQ5 A;  4LVI A;  3U23 A;  4CC3 A;  2X35 A;  3HFN A;  2L89 A;  1E22 A;  4HXJ A;  2VYT A;  4H2W A;  1OQK A;  5KNN A;  2ZT7 A;  2GQI A;  3RMQ A;  3HTZ A;  1RI9 A;  1T0J A;  5IXB A;  3RER A;  3CC7 Q;  1JO8 A;  2YT6 A;  2ZZE A;  2E3I A;  1QE0 A;  4NCX A;  3CPW A;  3L2Z A;  4HCK A;  1WDX A;  3PVQ A;  4BAC A;  2HBW A;  3OYK A;  3HFV A;  4E7J A;  1I0C A;  4D8D A;  4KRT A;  3A74 A;  1X2G A;  1WZO A;  5LJ5 j;  5GAN j;  3PVL A;  1QVP A;  1M8V A;  2YLB A;  1H3H A;  4V2S A;  5GAN d;  2ARS A;  5K1P A;  2JW4 A;  4FYW B;  3M0S A;  2RJC A;  4Z89 A;  3CCJ Q;  3CCS Q;  4F7U B;  2CSQ A;  2FRW A;  1SRL A;  4K88 A;  2QTX A;  3M4G A;  4Z8A A;  1SPK A;  2KEA A;  3QG1 A;  2RMO A;  5LJ5 f;  4C8Q G;  1JXO A;  4OP0 A;  4CH3 A;  1HD3 A;  1T3S A;  3OYL A;  3H0I A;  2LDM A;  4XU2 A;  4UC4 A;  3CEY A;  2DQ0 A;  3JCM V;  1I4K 1;  2LRQ A;  4MMK A;  2AKW B;  4LXC A;  2HQE A;  2LQK A;  4M7D E;  2DF6 A;  3V7C A;  2QGG A;  3HXZ A;  3QHS A;  1H4V B;  1OYX A;  1ZA2 B;  1MUZ A;  3M0R A;  2V26 A;  1G83 A;  2E6N A;  4E7S A;  2ZPF B;  2MI6 A;  4KGX B;  2X4Y A;  4LD6 A;  4LNP A;  2AHJ B;  1M1K C;  4M7A G;  3CCU A;  2JM8 A;  2DMO A;  1U8R A;  5K1X A;  2EYW A;  2FEI A;  2DBM A;  1IXD A;  1Q82 U;  2V8J A;  1UEB A;  2ZGW A;  1QVF S;  4PNO A;  4NL2 A;  3C94 A;  3M0P A;  5ELO A;  5CQY A;  1YJW T;  3VQW A;  1X2K A;  3JCM Q;  4P3P A;  3QWX X;  4AG1 C;  1I07 A;  2DLP A;  4CH4 A;  2A7Y A;  2KXD A;  5GAM j;  1AD5 A;  4GBQ A;  3H41 A;  2Q7H A;  4XEM A;  1TUG B;  2ALY A;  2DXT A;  3O8V A;  4E7I A;  2AT1 B;  2JTM A;  4OGE A;  1CKB A;  3EG3 A;  3VRY A;  3E9I A;  4WTO B;  1RAD B;  3QYG B;  1PKT A;  1NJ2 A;  1NJI C;  5DLQ E;  2RO0 A;  5CIU A;  1SRM A;  4BDZ A;  1NJ1 A;  1N8R C;  3ULR B;  5GAM f;  1D0Y A;  2J06 A;  2Z0W A;  2EKO A;  4XK8 E;  3IQL A;  2JMC A;  4IUU A;  5GAO m;  4J7F A;  4OB3 B;  4CS4 A;  4Y92 A;  4BE0 A;  5GMK m;  4M75 B;  2IY5 B;  2FZK B;  3HTR A;  2ZR3 A;  3VQY A;  1Z9Z A;  4YRI A;  1GFC A;  2MWP A;  1YFR A;  4HWR A;  2E4H A;  3GNG A;  5J3B A;  2QHS A;  1WIE A;  1EVL A;  1JRI A;  1C6V X;  2HL5 C;  3KUF A;  1ZSZ A;  4BB7 A;  4AFU C;  5IHK A;  1YFS A;  1G5V A;  3IKL A;  2EVR A;  2HMA A;  3G4S T;  1N9R A;  2DO3 A;  3KFU A;  1NNH A;  2E5K A;  2R5M A;  2CDT A;  4GLM A;  2EYY A;  1VOM A;  1PRM C;  2LTO A;  1UDL A;  2MAM A;  4CC4 B;  1ZHI A;  4F7U G;  7AT1 B;  3L2U A;  4H2S A;  1SKU B;  1H3Z A;  12AS A;  3H8Z A;  2RJF A;  1ACM B;  5CKD A;  3I55 Q;  5A2Q E;  3H0H A;  4OMP A;  2ODR D;  2J3L A;  3RKY A;  1ZBX A;  4XTV A;  3NEL A;  1FYF A;  2ZZF A;  3C95 A;  4HT8 A;  2JXB A;  2LX9 A;  3MP6 A;  3CCE Q;  5CO7 A;  4MZT A;  2LCC A;  1K4U S;  1RUW A;  3MEU A;  4RTU A;  1L0W A;  1M1K U;  1WLP B;  2QK0 A;  4TVA A;  2EGE A;  2QI2 A;  4M78 B;  2QEX Q;  3FJ5 A;  5IN1 A;  2P84 A;  2RH2 A;  2OTJ T;  3P8V A;  1YWO A;  1YJW A;  3UH0 A;  3CPW S;  1G3W A;  1HK9 A;  1BCO A;  4PFP A;  3A8L B;  1O75 A;  1TWB A;  1TOV A;  3BFM A;  4UP9 A;  3R6O A;  2J6O A;  2DQ3 A;  1YJ9 Q;  1B7Y B;  3RL6 A;  4M7D B;  5CAI A;  2Q5H A;  4TVR A;  4YPF A;  4ORZ A;  2K2M A;  1YIT Q;  3CC2 T;  4R56 A;  5M9O A;  2H3E B;  4IIO A;  2ZZD A;  4M7D A;  5CQX A;  2DE0 X;  4ZGJ B;  3VV0 A;  4JZ4 A;  4RTZ A;  4JRI A;  1IRX A;  2VUB A;  3SEM A;  2O31 A;  2ED0 A;  3VU3 C;  2C7I A;  2JT4 A;  2QDL A;  4LUE A;  1CSK A;  4AFS C; 
#chains in the Genus database with same CATH homology
 2QDY B;  4OB0 B;  4PJO G;  4FM4 B;  2QQR A;  4KR3 A;  4ZTZ B;  3WVD B;  2CZ0 B;  4DOV A;  4Y91 A;  2LVM A;  3OYI A;  1BI1 A;  1VQO T;  3A5Y A;  1E1O A;  3PCO A;  4EDU A;  2E1H A;  3G7Z A;  1RI0 A;  3G4S A;  2ZNJ A;  4C8Q E;  3HFZ A;  1KG1 A;  3E9G A;  3ZBD A;  2XHC A;  1YBY A;  4EMK A;  5GMK l;  2RB6 A;  4Y28 E;  5LJ5 e;  2JTF A;  5GAN e;  2PU9 B;  4DOW A;  4O6J A;  2FL7 A;  4J6W A;  4H02 A;  4YYE A;  3MF1 A;  2OAU A;  3P8B B;  2PME A;  3M53 A;  3FJP A;  3HRU A;  5C51 B;  4WI1 A;  2K3X A;  2ARU A;  2Y4X A;  3ASK A;  1NYR A;  3P8D A;  3S3M A;  3OYD A;  1QVG A;  2OTJ A;  4M7A D;  2DEQ A;  1VQN T;  2KMT A;  2E12 A;  3A7A A;  1EIF A;  2EYQ A;  5D6X A;  2RHX A;  4E7K A;  5KCO A;  4C5E A;  1UGS B;  5I2S A;  1U1S A;  1K8A C;  2KQW A;  4J15 A;  3OBY A;  1E24 A;  2I4M A;  4F7U F;  5HK0 A;  4XU1 A;  3TU4 K;  3LYI A;  3CC2 A;  1KMM A;  5FLX E;  4YRQ A;  3PGG A;  4P5N A;  2P0Q A;  4RDX A;  4ELY C;  2XDP A;  1VQ6 T;  2V8I A;  5GAM e;  2O4X B;  1WQ7 A;  4JUV A;  3OSV A;  3OYB A;  3RMS A;  3J81 E;  3GLX A;  3QO5 A;  2C8M A;  1KD1 U;  2M16 A;  4P3O A;  3HPW A;  1VQO A;  5CKH A;  4HWO A;  2CGH A;  3GNF B;  2G3R A;  3HXV A;  4FU6 A;  1R8O B;  2H3J A;  4TTV A;  4MML A;  4EX5 A;  2YHT A;  1WJR A;  2P0P A;  3N5B B;  4XU3 A;  2GF7 A;  1U1T A;  2RD1 A;  3NFC A;  4M75 C;  2JOY A;  4G84 A;  4YRR A;  4M77 E;  4BD3 A;  2QA4 T;  1KQ1 A;  3BJU A;  4FT2 A;  2GQV A;  4J83 A;  3FC3 A;  2QQA A;  3HXW A;  3SDZ A;  1W66 A;  1VQ8 T;  3QJ6 A;  4M75 F;  3M5A A;  1VQN A;  2AMC A;  1VQP T;  3L1A A;  4R55 A;  4CH5 A;  3A8O B;  3JCM b;  5GAN 2;  3HHT B;  1EIY B;  1ZQ1 A;  1DJ7 B;  4C8Q A;  4C92 E;  1EIY A;  2ZTG A;  1Y96 A;  4YRP A;  1K8A U;  2E5A A;  4JRP A;  4P74 C;  1NZ9 A;  3EFS A;  4KR2 A;  3QO3 A;  4GY5 A;  1VQL T;  2VGM A;  3QZ5 B;  1K9M C;  3JB9 J;  4P75 C;  2ZIM A;  4M78 C;  5A0G A;  4O2D A;  1VQ6 A;  4OB2 B;  2R5A A;  3PT9 A;  4FIB A;  4LD9 K;  2DXB A;  2FHD A;  3JB9 I;  4HCZ A;  2J3M A;  4N4G A;  3FEO A;  1X56 A;  4NOY A;  3M4Q A;  1M1G A;  5GAO p;  3OY9 A;  1KC8 U;  1C0A A;  4UP7 A;  1J5W A;  1OI1 A;  4M7D C;  3MHX A;  3REX A;  3UGQ A;  3VYH B;  4M78 F;  4YRF A;  1BYM A;  5IT9 E;  2ZR2 A;  4H2X A;  4HA8 A;  3S3N A;  2K5F A;  3RAC A;  4M75 D;  2VC8 A;  3PNW C;  1H4T A;  3SFM A;  3S3O A;  1QVG S;  3WQZ A;  4XTW A;  3LGF A;  4NS5 A;  5DY9 A;  3JCM P;  2EQJ A;  2XD0 A;  3JB9 H;  1G5I A;  2QA4 A;  2DZ9 A;  4CS2 A;  3UDC A;  3UGT A;  4M7D F;  4LNS A;  1VQK T;  1VIE A;  3IAL A;  2YRV A;  5FU6 B;  5LJ5 d;  3IG2 A;  1YB3 A;  1BBW A;  1RIQ A;  1BI3 A;  4BI4 A;  1WLE A;  3V7R A;  3PIO A;  2I4N A;  1VQ8 A;  4EMK C;  4K86 A;  1VQP A;  4X34 A;  4EPC A;  3MET A;  3SWN A;  5LJ3 h;  2CZ1 B;  2DXC A;  3QKJ A;  3RKW A;  5FRN A;  4EMH A;  1B34 A;  1S72 T;  4XAX B;  2Q7E A;  3MEY A;  2KAF A;  4E47 A;  4BW9 A;  4P71 C;  1VQ4 A;  1KQS S;  1HTT A;  3OYA A;  5GAN 7;  4H2U A;  2I4L A;  4YRK A;  5GAN 3;  4M77 B;  3PTA A;  1PSF A;  4ZTJ A;  2PUK B;  4M77 A;  2Y4Y A;  4YDQ A;  1VQL A;  3VUZ A;  2K4Y A;  2BIV A;  4N0A C;  3TEE A;  4M78 D;  2VXF A;  4OB1 B;  1V29 B;  2EAY A;  4X9C A;  3OS2 A;  2DVE A;  2RM4 A;  3L4G A;  4PHC A;  1TH7 A;  4X9D A;  3NET A;  1YIJ T;  4YCW A;  2IVW A;  3JCM h;  4IUR A;  3BY7 A;  4OLF A;  1LJO A;  3OMG A;  2E10 A;  2LT1 A;  3HKS A;  2DD4 A;  3HRI A;  4M7D D;  3LW5 E;  2ALY B;  4WJ3 M;  4C92 B;  4VUB A;  4TQF A;  5GAM d;  4YRM A;  5C52 B;  4C92 A;  2DAQ A;  5E3I A;  3HXX A;  1JJ2 S;  4TVY A;  3GF5 A;  4Q6G A;  2CJ9 A;  4RG2 A;  5FRM A;  1G3Y A;  3OYJ A;  3A8G B;  1X01 A;  2KDS A;  2CIM A;  5HK3 A;  2EL9 A;  3ER0 A;  2KY9 A;  2EWN A;  2XG8 D;  4C5I A;  1VQK A;  2E41 A;  1QW1 A;  1K73 C;  4BWA A;  2RA2 A;  2DDZ A;  2E65 A;  1IRE B;  2QQ9 A;  2EJF A;  3X28 B;  1W2B S;  3SB2 A;  3CBM A;  2C06 A;  1GXI E;  1Q81 C;  1WPY A;  5C6S A;  3J7A F;  3LWH A;  3NEN A;  1B76 A;  1AHJ B;  2B8A A;  1VQ9 T;  3HFO A;  4OGC A;  3FLG A;  3OYN A;  1S72 A;  3FIF A;  4QVZ A;  1NJ8 A;  3CCV T;  4HKE A;  5LJ3 j;  1NPP A;  2HAX A;  4RCB A;  2MF2 A;  4EMG A;  4J5Y A;  2CZ7 B;  1QP2 A;  4BUG A;  1BI2 A;  2GCX A;  5HKC A;  1Q86 C;  4CH6 A;  1G3T A;  2ZPI B;  4H2T A;  5C0M A;  5CVI A;  5LJ3 f;  4TVA B;  4LDV A;  2RI2 A;  3PFS A;  3DB3 A;  3UFG A;  4ZTU B;  2CZ6 B;  4QW2 A;  2PMF A;  1YIJ A;  3NTI A;  1BIB A;  2LC4 A;  3EFR A;  2XIC A;  4JLI A;  2QQS A;  3JRZ A;  4YRE A;  1YCY A;  4HWP A;  2VGN A;  1ADJ A;  2K5L A;  1D3B A;  3QUI A;  3OYE A;  3F70 A;  4C0F A;  3JCM d;  3MO8 A;  3BW1 A;  2ZIN A;  4YRN A;  3CD6 T;  2V8K A;  1FX7 A;  4C0D C;  5GMK h;  3QDR B;  4RG8 A;  2GFA A;  5LJ5 g;  2E6Z A;  2I2L A;  5GAN g;  4H2Y A;  1EVK A;  3JCM f;  2LQ8 A;  1NJI U;  4BI8 B;  3KXT A;  3DLL A;  3CC7 T;  4DA4 A;  4JRQ A;  1N8R U;  4OMF B;  1N9W A;  2VXE A;  5D6Y A;  2ZIO A;  2P0K A;  3OYF A;  2ZZG A;  2QHV A;  1K73 U;  2P4T A;  3QBY A;  3PCO B;  3RUX A;  3V8J A;  3OYH A;  4KBM B;  4M75 G;  1USY A;  4YP0 A;  3HXY A;  3A31 A;  1Q81 U;  5ELN A;  3CCJ T;  3CCS T;  4CS3 A;  4QQG A;  2DTO A;  3HFZ B;  3TEG A;  3MEW A;  1VQ9 A;  3P8Y A;  3LLR A;  4EMK B;  3A7U A;  2DU7 A;  3M54 A;  1Y07 A;  5GAO l;  3CCV A;  1WGS A;  3UT1 A;  1N9S A;  2EJG A;  4IUV A;  4HCC A;  1VQZ A;  4J8O A;  1ATI A;  4JLG A;  4UPA A;  2BUD A;  2IG0 A;  5FU6 C;  4YCU A;  3RKX A;  1RL2 A;  1NPR A;  3SD4 A;  4XTZ A;  3URG A;  4MZP A;  5EG2 A;  4GLK A;  4M7A E;  4YRT A;  1E1T A;  1VUB A;  5KH6 A;  5GAM g;  3SWN C;  1Q86 U;  1H4Q A;  2Y90 A;  3M56 A;  1MHN A;  2JUF A;  3DSQ A;  4L59 A;  3CMQ A;  3A8H B;  2QHU A;  3A5Z A;  3M59 A;  1X2H A;  2EQU A;  1I5L A;  4TWA A;  3CXC S;  2ZNI A;  5I2M A;  4M78 G;  4M77 C;  5GAO r;  4FT4 A;  5LL6 S;  4N4H A;  4FL6 A;  3CD6 A;  5GAO q;  5CCA A;  2D0Q B;  1GGM A;  5HGQ A;  3CBO A;  2JZ2 A;  2RJD A;  1MGQ A;  3PMT A;  1SRY A;  2ZPB B;  1ASZ A;  5CKF A;  4LDW A;  1JB0 E;  3I7F A;  4QQD A;  4YRJ A;  1G51 A;  2KVQ G;  3CPF A;  5CKB A;  5GMK j;  3M4Y A;  3CC7 A;  2ZCE A;  3X25 B;  4RCC A;  4BY6 B;  2L3R A;  3RIR A;  4M7D G;  4L6V 5;  2WSF E;  1KQS A;  4YRO A;  3LX7 A;  3TEH A;  4M77 F;  2M1H A;  5GAN 6;  3OD1 A;  2ZCF B;  4MDX A;  2NS6 A;  5IAY A;  4C92 C;  3FDR A;  1LYL A;  5A0D A;  1X54 A;  1Q7Y C;  1ADY A;  4OF1 A;  2EQM A;  3CCJ A;  3CCS A;  2NLU A;  4P73 A;  1X55 A;  2RHY A;  3MEV A;  3Q1J A;  4B9W A;  1NYQ A;  2L5Q A;  1LNX A;  4F7U E;  4TVW A;  3WXM B;  4CRI A;  4X5O A;  2PVG B;  5GMK i;  4C0G A;  1SET A;  4C92 F;  2XGT A;  4BE2 A;  5A0L A;  3JCM X;  3KBG A;  2WAC A;  3I55 T;  3OS5 A;  4PG3 A;  3HRS A;  4IUT A;  4JJN K;  1JJ2 A;  4XEO A;  2G4C A;  4P72 A;  3CCE T;  2AMC B;  5LJ3 e;  2JVV A;  1SES A;  2QEX T;  3OQ5 A;  1X75 C;  4HT9 A;  4CI0 C;  4BE1 A;  2P0L A;  2RI3 A;  4C8Q B;  5J26 A;  3LC0 A;  4M77 D;  3NTK A;  2DK3 A;  1Y96 B;  2LT4 A;  1WJQ A;  1W2B A;  3MCA B;  5FRO A;  4JDS A;  2XK0 A;  1HC7 A;  3E1S A;  1BKB A;  4YRG A;  1YJ9 T;  2RHQ A;  2EJ9 A;  1M9S A;  4II1 A;  3QII A;  4D6W A;  1I81 A;  3QYH B;  4C0D B;  1YIT T;  3OBW A;  4LVM A;  4Q15 A;  1B8A A;  4AH6 A;  4YTL A;  4JRK A;  4M7A A;  2RHI A;  3NTH A;  3QPH A;  3JCM e;  4KT0 E;  4PJO E;  3QSU A;  3ERR A;  3M4P A;  2DU5 A;  3OYY A;  2RK1 A;  2XID A;  3OYG A;  4C92 D;  3V8L A;  3GIB A;  2XI9 A;  2E70 A;  4XTX A;  3HY1 A;  1UGR B;  4NL3 A;  4M75 E;  3H6Z A;  5DM7 R;  4C5H A;  4RQE A;  2D6F A;  4MDW A;  2D9T A;  4H2X B;  2KSS A;  1Z7M A;  1M90 C;  2CJA A;  3JSC A;  4ZGE B;  3OS1 A;  2DD5 A;  2X4J A;  4HT4 A;  2RHS A;  4ATO A;  4N4I A;  3MEA A;  2VV5 A;  2DPP B;  2EFI A;  1WYD A;  2WSC E;  5D6W A;  2FVU A;  1G3S A;  2ZXF A;  4XTU A;  3A32 A;  3OW2 A;  3TUP A;  5L8R E;  3I55 A;  3L2V A;  1USY C;  4RKU E;  3VBB A;  5F5W A;  2F5K A;  2CS7 A;  1N6A A;  3HP9 A;  3G6E T;  1XOV A;  3CCE A;  5KE3 A;  4Z02 A;  2A3L A;  2P5I A;  3SWN B;  3J80 E;  4C5G A;  1NJ6 A;  2XTI A;  2QEX A;  3HL8 A;  1B34 B;  4UP8 A;  4A4G A;  3JB9 F;  3M55 A;  1M4Z A;  3S6W A;  1M5Q 1;  4M78 E;  1ASY A;  3OYC A;  3BDL A;  3HRK A;  3AHU A;  4F7U A;  2HD0 A;  1WJS A;  1YJ9 A;  2F5T X;  2I4O A;  5GAN f;  1FWZ A;  2ZT5 A;  1YIT A;  4B9X A;  3L4G B;  3I56 T;  2PUO B;  3PZC A;  1WQW A;  4BI3 A;  2RJE A;  2EQK A;  2XDD A;  3CCL T;  1K9M U;  3M58 A;  2JNG A;  5CKE A;  1VQM T;  3MF2 A;  2AKW A;  4BDY A;  2K3Y A;  2ODR C;  4YCV A;  2CKK A;  3LGL A;  4IUQ A;  3L2Q A;  3C4S A;  2HQX A;  2K57 A;  4PL6 A;  2E64 A;  5AYF A;  3RES A;  3JCM c;  4KQE A;  5GMK e;  4KUD K;  1YFT A;  2QHT A;  2DZC A;  1YGB A;  4IUP A;  4H2V A;  2ZPE B;  4ZN1 A;  4E7L A;  3VJP A;  2LNV A;  2HBP A;  3CCQ T;  1M90 U;  4BY6 C;  5FU7 B;  1XNI A;  2X4X A;  2RK2 A;  2DKG A;  2ZT6 A;  3E19 A;  4A4K A;  5GAN 8;  3JB9 D;  3X20 B;  3CXC A;  3LH0 A;  4PJO B;  1G5H A;  4XQ3 A;  4PJO A;  3VQX A;  2K2V A;  2GFU A;  3IKM B;  3CCM T;  3G6E A;  3JCM J;  4P73 C;  5GAO n;  3VUB A;  4E51 A;  3CME T;  5CR2 A;  4M75 A;  2RI5 A;  2IY5 A;  4DQ2 A;  1WNL A;  4C0Z A;  4P3N A;  3LSQ A;  3X26 B;  5KE2 A;  1B70 B;  5LJ3 d;  3QXE B;  5CK9 A;  3MQZ A;  2FYK A;  1B70 A;  4YRC A;  1M1F A;  4P72 C;  3M57 A;  1XTD A;  4J6X A;  3I56 A;  4A53 A;  1WU7 A;  3HY0 A;  3QO8 A;  2O01 E;  1BBU A;  3CCL A;  3CC4 T;  3JCM W;  1KMN A;  4M77 G;  1VQM A;  1UB4 A;  3OS0 A;  3CMA T;  1Z7N A;  2A8E A;  3HRT A;  11AS A;  2XKO C;  2EIF A;  1H4S A;  4C8Q C;  2R58 A;  4ZIB A;  1PYS B;  1D3B B;  1EOV A;  3E9H A;  3QJY A;  4P74 A;  4A54 A;  1PYS A;  3L42 A;  4L87 A;  2DJZ A;  3OW2 S;  1JJC B;  4J7I A;  1FXX A;  4P75 A;  2Q7G A;  3DLM A;  4M78 A;  1JJC A;  2WSE E;  4M7A C;  1O9S A;  1XQH A;  1YJN T;  3CCQ A;  4LVJ A;  4K87 A;  4C8Q F;  4C92 G;  4LDU A;  3VKI A;  4A4H A;  2DIG A;  1QF6 A;  1YI2 T;  2DTH A;  2YLC A;  2ZPG B;  2E3C A;  4YRS A;  1B7Y A;  3JAM E;  3OSS C;  1W4S A;  3CCM A;  1YHQ T;  4ME7 A;  4M7A F;  4QVD A;  3CME A;  3OYM A;  1KD1 C;  4PLI A;  2E5Q A;  4A4F A;  4YRL A;  5GAN 5;  5I21 A;  2ZPH B;  3REU A;  3VYG A;  3DKM A;  4ELZ C;  4MZM A;  2PVO B;  3DB4 A;  2XU8 A;  1KHC A;  1KQ2 A;  2X4W A;  2CJB A;  3HSB A;  3QNE A;  3RGL A;  3A7R A;  3G71 T;  4LVK A;  2M9U A;  1VQ7 T;  4TQD A;  3MP1 A;  3A5Z B;  3CC4 A;  5GAN 4;  3RF1 A;  2OTL T;  4XU0 A;  3CMA A;  3CCR T;  4C8Q D;  4P71 A;  3INZ A;  4JS5 A;  5HY6 A;  3CBP A;  1H64 1;  1BI0 A;  2FB7 A;  3GPL A;  4WJ4 A;  3GOX A;  2K5I A;  3QO7 A;  4LDX A;  3PIP A;  4XTY A;  4N0A A;  4WF2 A;  2M0O A;  5DLO A;  2JN0 A;  1YJN A;  1EFW A;  4KUL A;  3UPU A;  1PSE A;  4ZTF A;  3X24 B;  4FSX A;  2DIQ A;  2MWO A;  1YI2 A;  4HWT A;  3TEH B;  1JBM A;  3OMC A;  3C12 A;  4IKF A;  3LSS A;  1KHI A;  1YHQ A;  2XDB A;  2PQW A;  5LJ3 g;  2R57 A;  3PMI A;  3R07 A;  1LOJ A;  3HXU A;  2O4X A;  1NE8 A;  3JB9 G;  3P8T A;  3QTC A;  1KC8 C;  3OA6 A;  5FU7 C;  3LWI A;  5C53 B;  4RMO A;  3E9F A;  1QP3 A;  3OB9 A;  1Y7X A;  1VQ5 T;  4PJO C;  3V8K A;  2RHZ A;  3G1Z A;  1HXD A;  2ART A;  1QVF A;  4OVA A;  4L5G A;  3G71 A;  1VQ7 A;  3JCM g;  4ZN3 A;  1UGQ B;  5LJ5 h;  1VIF A;  2OTL A;  5GAN h;  1NJ5 A;  3CCR A;  1BIA A;  3L2W A;  1IZ6 A;  4KUI A;  3M9Q A;  3FRN A;  4ZGD B;  4E7H A;  4PJO F;  3P8H A;  1N27 A;  1KOG A;  4QVC A;  2HNI A;  1EQR A;  2BKD N;  2MMP A;  2PVD B;  1SSF A;  3TRE A;  3BDU A;  1P92 A;  1I8F A;  4RQF A;  2KK4 A;  2QQB A;  3L2R A;  4QQ6 A;  2RHQ B;  3W3S A;  2Q5I A;  3VQV A;  4EO4 A;  3GP8 A;  3EAE A;  3V7S A;  3ZEH A;  4LVL A;  2DTI A;  3FB9 A;  4M7A B;  1IL2 A;  2DXU A;  1VQ4 T;  1Y71 A;  4PKC C;  3TCJ A;  4JS4 A;  2L8D A;  5J39 A;  3UWN A;  4LDY A;  4Q5W A;  1OZ3 A;  2LCL A;  1OZ2 A;  3ME9 A;  1X6O A;  3CCU T;  1Q82 C;  4J6Y A;  4A4E A;  2ZT8 A;  3ICA A;  2QXF A;  3ZFJ A;  3WVE B;  5KCH A;  3T9N A;  3A8M B;  2CYZ B;  3NEM A;  4DPG A;  3MP8 A;  1Q7Y U;  5GAM h;  3QZ9 B;  4O5V A;  4G85 A;  4HVC A;  4PLL A;  2RHU A;  1UGP B;  2RHS B;  4RMF A;  4HCB A;  4HWS A;  4PJO D;  2F69 A;  1VQ5 A;  4LVI A;  2X35 A;  3HFN A;  2L89 A;  1E22 A;  2VYT A;  4H2W A;  5KNN A;  2ZT7 A;  3RMQ A;  3HTZ A;  3RER A;  2ZZE A;  1QE0 A;  4NCX A;  3CPW A;  3L2Z A;  4BAC A;  3OYK A;  3HFV A;  4E7J A;  3A74 A;  1X2G A;  5LJ5 j;  5GAN j;  1QVP A;  1M8V A;  2YLB A;  4V2S A;  5GAN d;  2ARS A;  5K1P A;  2RJC A;  4F7U B;  4K88 A;  2QTX A;  3M4G A;  3QG1 A;  5LJ5 f;  4C8Q G;  4OP0 A;  4CH3 A;  3OYL A;  2LDM A;  4XU2 A;  4UC4 A;  3CEY A;  2DQ0 A;  3JCM V;  1I4K 1;  2LRQ A;  4MMK A;  2AKW B;  2HQE A;  2LQK A;  4M7D E;  3V7C A;  3HXZ A;  3QHS A;  1H4V B;  1OYX A;  2E6N A;  2ZPF B;  2MI6 A;  2X4Y A;  4LD6 A;  2AHJ B;  1M1K C;  4M7A G;  3CCU A;  1U8R A;  5K1X A;  1Q82 U;  2V8J A;  1UEB A;  2ZGW A;  1QVF S;  4PNO A;  4NL2 A;  3C94 A;  5ELO A;  5CQY A;  1YJW T;  3VQW A;  3JCM Q;  4P3P A;  4CH4 A;  2A7Y A;  5GAM j;  4XEM A;  2Q7H A;  2ALY A;  2DXT A;  3O8V A;  4E7I A;  2JTM A;  4OGE A;  3E9I A;  3QYG B;  1NJ2 A;  1NJI C;  5DLQ E;  2RO0 A;  5CIU A;  4BDZ A;  1NJ1 A;  1N8R C;  5GAM f;  2EKO A;  4XK8 E;  4IUU A;  5GAO m;  4J7F A;  4OB3 B;  4CS4 A;  4BE0 A;  5GMK m;  4M75 B;  2IY5 B;  2ZR3 A;  3VQY A;  4YRI A;  2MWP A;  1YFR A;  4HWR A;  3GNG A;  5J3B A;  2QHS A;  1EVL A;  1JRI A;  3KUF A;  4BB7 A;  1YFS A;  1G5V A;  3IKL A;  3G4S T;  1N9R A;  2DO3 A;  3KFU A;  1NNH A;  2R5M A;  2LTO A;  2MAM A;  1ZHI A;  4F7U G;  3L2U A;  4H2S A;  1H3Z A;  12AS A;  3H8Z A;  2RJF A;  5CKD A;  5A2Q E;  2ODR D;  2J3L A;  3RKY A;  1ZBX A;  4XTV A;  3NEL A;  1FYF A;  2ZZF A;  3C95 A;  4HT8 A;  2LX9 A;  3MP6 A;  5CO7 A;  4MZT A;  2LCC A;  3MEU A;  1L0W A;  1M1K U;  4TVA A;  2QI2 A;  4M78 B;  5IN1 A;  2RH2 A;  2OTJ T;  3P8V A;  1YJW A;  3UH0 A;  3CPW S;  1G3W A;  1HK9 A;  3A8L B;  1O75 A;  3BFM A;  4UP9 A;  3R6O A;  2DQ3 A;  1B7Y B;  3RL6 A;  4M7D B;  5CAI A;  2Q5H A;  4TVR A;  4YPF A;  3CC2 T;  4R56 A;  5M9O A;  4M7D A;  2ZZD A;  5CQX A;  4ZGJ B;  3VV0 A;  4JRI A;  2VUB A;  3VU3 C;  2C7I A;  1SER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...