2EJ9A

Crystal structure of biotin protein ligase from methanococcus jannaschii
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
237
structure length
237
Chain Sequence
MEIIHLSEIDSTNDYAKELAKEGKRNFIVLADKQNNGKGRWGRVWYSDEGGLYFSMVLDSKLYNPKVINLLVPICIIEVLKNYVDKELGLKFPNDIMVKVNDNYKKLGGILTELTDDYMIIGIGINVNNQIRNEIREIAISLKEITGKELDKVEILSNFLKTFESYLEKLKNKEIDDYEILKKYKKYSITIGKQVKILLSNNEIITGKVYDIDFDGIVLGTEKGIERIPSGICIHVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Biotin Protein Ligase From Methanococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
molecule keywords Putative biotin ligase
total genus 74
structure length 237
sequence length 237
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ej9A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ej9A01
1YGBA 2IY5B 1KOGA 5GANe 2DJZA 3VQYA 1D3BA 2ARSA 5GAMj 1I4K1 3M4QA 4M77C 5GAOr 4YRMA 4RCBA 3QO5A 4YPFA 3TEHB 3E9HA 3RACA 3JCMf 4YRQA 4M7DC 2AMCA 4L87A 3SWNB 5I21A 2DZ9A 4WJ4A 3HXXA 3LSSA 1LNXA 3JB9J 2ALYB 3G1ZA 1X54A 1NJ5A 4H2YA 1H4QA 4ZTZB 1YCYA 4PJOE 2I4MA 5LJ5d 1FYFA 2EWNA 4EMGA 5LJ3j 3UH0A 1NJ1A 3RL6A 3RIRA 4F7UB 2Q7GA 4M78C 5HGQA 2DKGA 2CIMA 5GANh 1EVLA 4UP7A 5K1XA 1KQ1A 3JCMe 4M7AG 5GAOq 3TUPA 5E3IA 4XU0A 5CAIA 1JJCB 1X55A 3IKLA 2EJ9A 3RF1A 3MF1A 1TH7A 1E1OA 5ELOA 3HXYA 5C51B 4M75G 4M7AF 2ZNIA 1D3BB 4H2VA 1BBWA 1J5WA 2ZTGA 3A7UA 1YFTA 1B34A 4A53A 4YCWA 2FYKA 4C8QB 3RGLA 3NEMA 2QHVA 1MGQA 4EMKB 5GANg 4YRRA 2ZT5A 4P72C 4M7AD 4YRGA 2Q5IA 1B8AA 4X9DA 2E10A 3QSUA 3HFZB 4C92C 3HXZA 4CS4A 3JCMc 4P74A 2I2LA 1USYA 3OD1A 3HY1A 1Y96B 1WYDA 3JCMh 3BY7A 2DVEA 4YRCA 5GAN4 1G5HA 4XQ3A 5GMKj 4WJ3M 3L2ZA 4M77F 4XTYA 4F7UG 3EFSA 4H2SA 2Q7HA 2Q7EA 3RESA 2ZIOA 3HFOA 4M75A 4C8QE 2EJGA 1YB3A 4M7DF 4PJOA 5GANj 3V8LA 5GAOl 3QO7A 2ZIMA 3BJUA 4M7AC 1X01A 4UPAA 3V7RA 1HC7A 4PJOB 5LJ5j 3HTZA 3BW1A 4C92D 3SB2A 4OP0A 4M78A 4P3OA 4C92E 1N9SA 5GAN2 1JBMA 4RQFA 3JCMg 2PMEA 5GAOm 4KR2A 1SETA 2ALYA 2YHTA 3MF2A 4K86A 5C53B 1EVKA 3A74A 4PNOA 3HXVA 2DQ3A 2K57A 4N0AA 3QHSA 3BDUA 3A7RA 1E24A 5DY9A 1NJ8A 4P73A 5KNNA 4H2WA 4AH6A 3P8VA 4P71C 4M77D 3QO3A 5GAMh 2DDZA 3IG2A 1NYRA 4RMFA 4NL2A 3NENA 5GMKi 2ZT7A 4C8QF 4G84A 1NJ6A 2VXFA 4TQFA 3M4PA 4ZIBA 2ZT8A 3I7FA 4CH5A 4EMKC 3UFGA 3VBBA 4Q15A 4RQEA 4HWRA 3QO8A 2QHTA 1LJOA 5LJ5g 4JUVA 2C8MA 1IL2A 3JB9I 4M77A 2J3LA 3TEGA 1B70B 4C8QD 2QHUA 1HXDA 4M7DE 1B34B 4M78D 2ZZGA 4HWPA 4YP0A 2RHQB 4WF2A 1NYQA 2I4NA 4JLIA 2P0LA 5GAMe 4CH3A 3HFNA 2CJ9A 4TVWA 4HWTA 4CS3A 1E1TA 3VU3C 4UP8A 2CGHA 2XTIA 4YRPA 1Y96A 3SWNA 2DQ0A 5GAOp 2CJBA 1NJ2A 1N9RA 2RM4A 3PZCA 3ERRA 2EJFA 4EX5A 3NELA 1KMNA 4C8QG 2E65A 2DXTA 3VQVA 1QF6A 4A54A 4J5YA 4EO4A 3PGGA 1I8FA 1M5Q1 3A32A 1H641 4BWAA 5LJ3e 4YCVA 3QNEA 3REXA 4YRJA 5GAMf 2JN0A 1WU7A 1U1TA 4QVCA 2Q5HA 1L0WA 3PCOA 4TQDA 1WQWA 4TVAA 4UP9A 4XTXA 4HA8A 1KMMA 12ASA 3HXWA 2I4LA 3JCMW 1B70A 1Z7NA 4XTUA 1ASZA 2ZR3A 4J6WA 3RKYA 1BIAA 4X9CA 3JCMV 2FB7A 4C8QC 3M4GA 1X2HA 1SESA 4O2DA 2ARTA 2DTHA 2P5IA 1RIQA 4C92A 4TWAA 3JCMd 3LC0A 4PHCA 2ZZFA 4M7AE 4HT8A 5GAMg 4TTVA 5GMKh 1EFWA 1NNHA 3MEYA 5C52B 1YFSA 1WNLA 4P73C 3QTCA 1EIYB 1VQZA 4K88A 2EAYA 4G85A 4M78E 1WLEA 2RD1A 5LJ5f 3P8TA 1SRYA 3FB9A 4PJOG 4J6YA 5LJ5h 3FJPA 4XU3A 3SWNC 1ATIA 4JRKA 4M77B 1HTTA 4KR3A 4MMKA 1EOVA 3JCMX 3LSQA 4XU2A 4M75B 1WQ7A 5LJ3g 1Z7MA 3CMQA 1H4TA 2DU5A 3FIFA 3HFVA 1G5IA 2YLBA 2RHQA 4X5OA 2EL9A 1BIBA 4MMLA 4H02A 4XTWA 4M75F 1U1SA 4M7DA 4M78B 4PJOF 4OLFA 2Y90A 4PG3A 4CH6A 4M77E 2ZCEA 3VQWA 4YRSA 1B7YA 4EMHA 5GMKm 4WI1A 3A5YA 4M78F 2DTOA 2RHSB 1EQRA 1ADYA 2QTXA 1PYSB 3L4GB 2E41A 2ZR2A 4M75E 1GGMA 3E9IA 3NETA 5GANf 4Q6GA 2E3CA 3VQXA 3IALA 5GMKe 4DPGA 4H2XB 11ASA 1ADJA 3HRIA 3P8YA 4K87A 4YRNA 4XEMA 4BW9A 3AHUA 4NOYA 3PCOB 5K1PA 4QVDA 4TVAB 4M7AB 2ZXFA 3WQZA 5GANd 5GMKl 4CH4A 1JRIA 3DSQA 4PJOC 1N9WA 1I5LA 3W3SA 5F5WA 3QUIA 1KQ2A 1LOJA 2DXUA 3JCMQ 5GAN8 4NL3A 2IY5A 1I81A 4C92F 3V7CA 2CJAA 2ZZEA 3JCMb 2AKWB 4F7UE 5LJ3f 4P3PA 4J6XA 3V7SA 1HK9A 4C92B 4YROA 1C0AA 2E1HA 2AKWA 4M7DB 3HFZA 4HWOA 4Y91A 2DEQA 3R07A 4HWSA 3A7AA 4C92G 4JRIA 3JCMJ 3JCMP 1SERA 3RKWA 4HT9A 4YRTA 4DQ2A 5LJ3d 2ODRD 2ZNJA 2DZCA 4RCCA 2C7IA 2RHSA 4N0AC 3A5ZA 4P74C 3ICAA 2I4OA 1PYSA 2QHSA 3UGQA 1G51A 4P72A 4P3NA 1LYLA 4M75C 4HVCA 2YLCA 1WPYA 4F7UA 3JB9H 2ZT6A 2J3MA 3A31A 4YREA 4H2XA 2VC8A 1X56A 4LNSA 1B76A 3RERA 4YRKA 3RUXA 5GAN3 2G4CA 4F7UF 3L1AA 4P75A 4YRIA 2E64A 2E5AA 3HRKA 2XGTA 4NCXA 4YRLA 4J15A 3JB9D 1YFRA 4V2SA 4M7DD 3HY0A 1JJCA 4XU1A 5GAN7 3HXUA 3TEHA 4M78G 5LJ5e 5GAN5 2AMCB 4YDQA 3GIBA 2ZGWA 1B7YB 4PJOD 5ELNA 4TVYA 4E51A 4M75D 1USYC 4C8QA 4YYEA 4EMKA 4XEOA 3L4GA 5LJ3h 3JB9F 2VXEA 4YRFA 3KFUA 4CS2A 1M8VA 2RB6A 1ASYA 3IKMB 3RKXA 1QE0A 1W66A 2DU7A 4M7DG 3INZA 3JB9G 5GAOn 4XTVA 3V8JA 4P71A 3V8KA 1H4SA 3REUA 4P75C 2ZINA 2ODRC 1H4VB 4KQEA 4RDXA 3UGTA 4XTZA 1EIYA 1BBUA 4M77G 5GAMd 2PMFA 3HSBA 4H2TA 4ZTUB 2DTIA 2ARUA 4M7AA 1E22A 2RA2A 2HNIA 4H2UA 1X2GA 3BFMA 4YCUA 5GAN6 3EFRA
chains in the Genus database with same CATH superfamily
2PQWA 1KOGA 4QQ6A 2CH4W 4AFZC 2DD4A 1W2BP 1AD5A 4FYXB 4ELZC 1VYTA 3R6NA 4XK8E 4OMFB 3CCET 2EQJA 4E47A 2ALYB 1FX7A 3HXXA 3LSSA 1VQ6T 4FYYB 4AT1B 1ABOA 4ZTZB 3VS0A 1YCYA 2I4MA 2RQRA 2EBPA 1FYFA 1FMWA 1IREB 4J9IA 3RL6A 3VKIA 1LCKA 2QEXA 3QDRB 4M78C 5HGQA 2JM9A 2CIMA 2LX9A 2LCLA 3CD6A 1EVLA 1Q81C 5KYUB 3E9GA 1UGPB 2A0FB 3JCMe 1AZEA 4M7AG 4FW1A 3OW2P 4ZTJA 4XU0A 1JJCB 1G83A 2EJ9A 2J6FA 3MF1A 1RUWA 2MK5A 1W2BS 2QA4T 1G2BA 4M75G 2CSIA 3UWNA 1MMGA 3A7UA 3M0RA 2BKDN 4A53A 3C4SA 3ER0A 1BBZA 2X4YA 2VVKA 4DBRA 2YSQA 4M7AD 1VQ8T 4X9DA 4LXCA 3QSUA 2XDDA 4C92C 3HY1A 3HPWA 2CUBA 2Z0WA 4JS4A 9ATCB 3BY7A 3M0PA 5GAN4 5GMKj 1M4ZA 2AK5A 4XTYA 3EFSA 4F7UG 4OMPA 2NUPA 2KGTA 2Q7HA 3CCSQ 3PVLA 3HFOA 1KD1U 2VGMA 4C8QE 2LX7A 2FPFA 4PKCC 2E3IA 3OS0A 3V8LA 3QO7A 3BJUA 3ZBDA 1X01A 1Q95G 4PJOB 5FRMA 4OP0A 4M78A 3JRZA 5GAN2 2QQBA 3CC7Q 3JCMg 3HKSA 1VQ7T 2PMEA 1TUDA 1UUEA 4F14A 5GAOm 4KR2A 5D6WA 2ALYA 4K86A 2KT8A 3HXVA 3HRUA 5FW9A 2DQ3A 2K57A 2F1LA 2AT1B 5KNNA 4H2WA 4JLGA 4Z88A 2XICA 5I2SA 1OULA 1JO8A 3QO3A 1ZSGA 1S72A 2CZ1B 1K73U 3CCMQ 3H0FA 2ZT7A 3CMAA 5ECAA 1NJ6A 4TQFA 3JSCA 1CKBA 4D6WA 3SFMA 4CH5A 3LGFA 1SRMA 4HWRA 2DA9A 4LE9A 1F1BB 4J83A 1OEBA 1NLOC 3CCRA 4XAXB 4BB7A 3UPUA 4QW2A 2IPOB 2EVRA 3RMQA 1B70B 2QHUA 4M7DE 2DL4A 4M78D 3UT1A 1KQSP 4VUBA 2OTLA 1NYQA 3T9NA 3TSWA 4JLIA 1YIJQ 1WJQA 2P0LA 2CKKA 4JPBW 3NPFA 1M2VB 4WCIA 4CH3A 1Q86R 4E7SA 2EPDA 5M9OA 2DVJA 2CP3A 3ZEHA 5CQXA 1VIFA 2LMJA 1QVFP 2DQ0A 4JDSA 4OB3B 2CUDA 3M53A 3ERRA 2EJFA 1M1GA 2LJ1A 1QCFA 1TUCA 2BZ8A 1QF6A 1MV3A 2BUDA 1QCNA 4HVWA 5LJ3e 4YCVA 4HCCA 4BUGA 3L2RA 2EYYA 2DFUA 3X24B 3S3NA 1ZSZC 1L0WA 1VQLA 3PCOA 4TQDA 1GL5A 1WQWA 4TVAA 4UP9A 1YJNT 2LCCA 2CT3A 2DERA 2I4LA 2MF2A 1ASZA 1EFNA 2DETA 3RKYA 3EG3A 3M5AA 2ARTA 1RIQA 3VS2A 2ZZFA 4DBQA 1EFWA 3OMCA 3X26B 2QEXT 4LDUA 1SG5A 2DIGA 2HL5C 4BY6B 1WNLA 4P73C 1VQMQ 3QTCA 3MEVA 4JJCA 2B86A 1VQZA 3MP6A 1ARKA 3A5ZB 1ZQ1A 5FRNA 1W1FA 2PU9B 4M78E 1WLEA 2X4XA 2RI3A 2HD0A 4FW2A 3P8TA 1PNJA 1O75A 1YN8A 4J6YA 3PE0A 3LSQA 2M1HA 4FSXA 2D8JA 3EFOB 4AMCA 3CMQA 2DU5A 1NM7A 1IHWA 2LTOA 2K6DA 4H02A 1JU5C 2MPXC 2XU8A 4XTWA 3EGDB 1YITQ 2HSPA 1YJ9T 2GTJA 4PJOF 3KUFA 1U3OA 1WHGA 1WJRA 4PG3A 4MZMA 4OMNA 1HJDA 4EIKA 4AFUC 1X43A 1PRMC 4KUDK 2DXBA 3OYJA 2OTJT 3LLRA 3C12A 5KCOA 2QXFA 2OX7A 4WI1A 3A5YA 4DA4A 3EAEA 1CKAA 5C6SA 1ADYA 2O31A 1E6GA 2QTXA 2EQUA 2M0OA 3CBOA 3PTAA 1S72Q 4M75E 5A0DA 3NETA 5GANf 3OYMA 2DYIA 1PC0A 3GNFB 2C0TA 2HL3A 5GMKe 4H2XB 11ASA 3HRIA 1D1CA 3P8YA 4XEMA 4BDYA 2EGCA 5KE3A 2OTLT 3PCOB 1AOJA 4QVDA 2XI9A 1CSKA 4ME7A 4II1A 2FRWA 5D6XA 1N9WA 2MWPA 5F5WA 5CIUA 1Z9ZA 1LOJA 1MNEA 3LW5E 5GAN8 1N27A 3PT9A 2ZZEA 3JCMb 1VQLT 2D8HA 2JUFA 4F7UE 4FT2A 4J6XA 2AKWB 3V7SA 2CP5A 4C92B 1C0AA 4M7DB 1KFZA 1VQ5Q 3HFZA 2CP6A 4F16A 4HWOA 4Y91A 1UE9A 2LDMA 3NTIA 3JCMJ 3A8GB 4HT9A 2OAWA 3A8MB 3X28B 1I0CA 3EG0A 3A5ZA 2MMPA 2BZXA 3L42A 3ICAA 2XDBA 1P92A 2RJFA 2I4OA 1T0JA 2L0AA 1LYLA 1YI2A 1EX4A 4J9GA 1Q86C 1WX6A 2K3YA 3G7ZA 3A31A 4H2XA 1X2KA 3EFOA 3G4SQ 2FG0A 1YP5A 3EH1A 1OQKA 4KRTA 2E64A 4JRQA 3HRKA 4NCXA 1M27C 4FL6A 3SDZA 4M7DD 3HY0A 2RHYA 2O01E 5GAN7 3TEHA 4KT0E 2O9VA 1VQ6Q 1JXOA 3CCRQ 1ZBJA 3G6EQ 4TVYA 1VQNA 4E51A 3EG1A 1PKSA 2E3HA 1USYC 1WHKA 2W10A 1WHMA 4EMKA 5CKBA 4OMQA 2Y4XA 4HT4A 2LT4A 1M8VA 4KUIA 2PZ1A 1G3YA 4E7HA 1QE0A 4M7DG 3VS4A 3V8JA 5FU7C 3HP9A 4OMLA 1H4SA 4IIOA 2ENMA 1RAIB 4RDXA 1RABB 2V8JA 1RAGB 1IO6A 2COWA 2ARUA 5KH6A 1YJWQ 1YJWA 2OTLQ 4E7JA 2DM1A 4KBMB 4BE2A 3EFRA 4B6MA 1NE8A 3ULRB 1QVFS 1YGBA 2IY5B 3VQYA 3OB9A 2ARSA 4BI4A 1X69A 2IG0A 1M2VA 4LD9K 1RLQC 2ESWA 2RI5A 3QO5A 3TEHB 3NHNA 2QQRA 1QKWA 2AMCA 3RNJA 3PMTA 3SWNB 4WJ4A 1LVKA 4H2YA 3HTRA 3CMAT 3OS5A 3CC2A 3VRYA 3OYGA 5DLQE 3WXMB 4EMGA 2RF0A 3CCMT 4F7UB 2EKHA 1OU8A 3M55A 2KDSA 5KYWB 2ZPBB 5GANh 2D0NA 1KC8R 3I55T 1YNZA 1PWTA 1KD1R 1KQ1A 1BK2A 1UGRB 1GCQC 2LQ8A 2FEIA 4E2FB 1NEBA 4HXJA 1D1BA 1ZSZA 1XQHA 2HQEA 4RTTA 3RR6A 1D0XA 4JRPA 2OTJA 2KNBB 1QVGA 2P84A 2ZNIA 1D3BB 3MQZA 2ZTGA 1K8AC 1YFTA 2R5MA 2D6FA 4GY5A 1KD1C 1Y0MA 2FYKA 4C8QB 2DIQA 3NEMA 3OYLA 2ZT5A 2KMTA 3NMZC 2COYA 3EH2A 2Q5IA 1OYXA 2E10A 2KXDA 2YDLA 4CS4A 3JCMc 2KRMA 1MMAA 2DMOA 1Y96B 3THKA 1WYDA 2CZ6B 1K73R 1SSHA 1M1KR 2J7IA 2CDTA 4YRCA 2NUPB 2EFIA 1O9SA 4WJ3M 4H2SA 5L23A 2LJ0A 3CCLA 1YJNA 4M75A 1TS9A 2QI2A 3A1PA 1YB3A 5CKDA 4Z02A 4R56A 2NUZA 2ZIMA 3META 2KVQG 2V26A 3V7RA 1VQNT 3EGDA 3HTZA 1YJWT 2YUQA 3OYCA 1N9SA 2J6OA 4RQFA 2MIOA 4ORZA 2O9SA 4J9DA 1W4SA 3G71Q 3MCAB 3MF2A 5C53B 1OZ2A 3A74A 4PNOA 2QTVA 3A8OB 2KXCA 3RDVA 2A7YA 1M2OA 3CPWP 5IT9E 1UEBA 2DX1A 3EGUA 4NL2A 3NENA 4N4GA 1NJIR 3TVTA 2FHDA 1WXUA 3URGA 2RJDA 1GRIA 4OB1B 3I7FA 2PUKB 1TG0A 1VQMT 4Q15A 3VBBA 2RK2A 1VYUA 1VUBA 4JUVA 2C8MA 5L8RE 3JB9I 4M77A 4FYVB 1TU0B 4C8QD 4KULA 4GBQA 1H3HA 4HWPA 2D0QB 4YP0A 2RHQB 2DO3A 4WF2A 1SEMA 1WZOA 1YJ9Q 1ZUYA 5GAMe 5KYNA 3CCEQ 3HFNA 2CJ9A 4JZ4A 4HWTA 1E1TA 3VU3C 1QQJA 1X6BA 2PVDB 3M0TA 1Y96A 2FPEA 1XOVA 4A4FA 3ZFJA 2NYSA 3GBQA 1NJ2A 4JJNK 1N9RA 2RMOA 3M4YA 5EC7A 2F5KA 3NELA 1Y57A 2E65A 4A63B 3VQVA 4QVZA 2EYZA 1HD3A 2XDPA 1K1ZA 4EO4A 3PGGA 1I8FA 1M5Q1 3DKMA 3QBYA 3OYBA 1B07A 1OZ3A 3REXA 4IKFA 4M4ZA 4MZPA 2L89A 2BTTA 4QVCA 4L59A 1YIJT 4FCYA 3QDFA 2KYMA 3M0UA 2JJ9A 4XTXA 1Y07A 2OJ2A 1X6GA 2DL7A 4D8DA 1RLPC 1MUZA 3HXWA 3EHRA 4ZNXA 1AZGB 1ZUKA 4XTUA 3SEMA 4J6WA 4X9CA 4RKUE 3JCMV 1K4US 2KAFA 2P5IA 4OMMA 4TWAA 2VB6A 3I56Q 4PHCA 1RACB 3OBYA 5CKFA 3G71T 3EHQA 2RNAA 2K9GA 1SKUB 2F2VA 1EIYB 4K88A 1BKBA 1J3TA 2DL5A 4LVMA 3P8HA 1MHNA 2RD1A 5IXFA 2GBQA 3OA6A 2ZZDA 5LJ5f 2KK4A 2KQWA 4PJOG 5LJ5h 4MZTA 3SWNC 4OB2B 1OI1A 4JRKA 2KRNA 4O6JA 3CCVQ 2L3PA 4MMKA 4FIBA 1Z7MA 3FIFA 4Z89A 2YLBA 3S6WA 4Y92A 1NG2A 3CC4Q 3G6ET 2DNUA 1FXXA 1OU9A 1N8RC 4Y28E 3GPLA 2LJ3A 4JJBA 3X20B 1NEGA 4A4EA 3CC4T 4IUUA 4M77E 2ZCEA 3N5BB 3PNWC 3NGPA 5CKEA 4BY6C 4YRSA 5KYXA 2MYSA 2A3LA 4ZN3A 4PK4A 1W6XA 5HCKA 1PYSB 1BI3A 3L4GB 1WYXA 1KG1A 2QGFB 4AG1C 3E9IA 1WXTA 1Q7YC 4Q6GA 3H0HA 4DPGA 5AYFA 1ADJA 1D0ZA 4YRNA 1KC8U 5CO7A 2CSQA 2ED0A 1K9AA 2QK0A 4J9BA 4BI8B 4M7AB 3GNGA 2ZXFA 1Q7YR 1ACMB 1VQPA 1VQKQ 3QPHA 4CH4A 1D1AA 2KI7A 3DSQA 3CPFA 4OGEA 3OYNA 4WTOB 1I5LA 3QUIA 1KQ2A 4ATOA 4IUQA 2WACA 1I81A 2MOXA 1VQLQ 2CJAA 4RMOA 2JM8A 1HK9A 1T3SA 3VYHB 2AKWA 2DEQA 4ELYC 4HWSA 4C92G 3JCMP 1YHQA 1SERA 2K5FA 2D9TA 2LCSA 4IUVA 3E2UA 4HVVA 5FLXE 2C7IA 1YFNA 3CBPA 4P74C 3REAB 1VQ5A 1PYSA 3UGQA 2WSFE 1WFWA 1E6HA 3CCJT 1VQ9A 1G51A 4P72A 4P3NA 1K9MR 1WPYA 3JB9H 1M9SA 3FLGA 2J3MA 3M56A 1QLYA 2VC8A 3OYFA 3VS1A 2GFUA 4LNSA 4YRKA 1Q7YU 3VUZA 3L1AA 2E6NA 4YRIA 3CPWS 2JZ2A 2CZ0B 3I55Q 2HBWA 1FYNA 2A36A 5IXBA 2VGNA 4V2SA 1I07A 1JJCA 1ZBXA 1KSWA 2WSCE 3G71A 4M78G 4E7ZA 5GAN5 1KQSA 4YDQA 3GIBA 2ZGWA 2LQWA 1K0XA 1W70A 5C0MA 3MKDA 2XD0A 2MI6A 1BI0A 2F2XA 5EG2A 1V1CA 1E7OA 3L4GA 5KYYA 2VXEA 3KFUA 4HKEA 4CS2A 4MDWA 2JTFA 1N8RU 3RKXA 4KGZB 2GTOA 3INZA 2ZCFB 3JB9G 2FVUA 1QW1A 2G3RA 2NLUA 5GAOn 2EKOA 3M54A 2XIDA 1ZA2B 4C5EA 2A37A 4OGCA 1NJIU 1G5VA 2ODRC 2OI3A 2WSEE 1N5ZA 4XTZA 5GAMd 4H2TA 4ZTUB 2GFAA 2K3BA 2ZPFB 4ZGDB 4ZGEB 1VQOQ 1YIJA 4PFPA 2HKQB 5IH2A 2VASA 3HRSA 2RA2A 2X4JA 4C0DB 2RHUA 1X75C 3BFMA 4J7IA 4LN2A 5GAN6 3OW2A 2DE0X 3OW2S 2NS6A 2DJZA 4E6RA 1JJ2S 1I4K1 3M4QA 3G4SA 4M77C 8AT1B 2AIRB 5GAOr 4DEYA 4YTLA 4MDXA 3FJ5A 2GQVA 2J05A 3QXEB 4LVKA 4RCBA 3U23A 2RQVA 2CZ7B 4N4HA 3OSVA 4YRQA 4M7DC 4L87A 1OV3A 2DZ9A 1OX8A 3I56T 5A0GA 1H4QA 2O4XB 2RHXA 3VS3A 3NTHA 4F17A 3A8LB 1D09B 3G1JA 4AG2C 5LJ5d 2HSEB 3NFCA 2R58A 2EWNA 1I5OB 2HZYA 4HCKA 5LJ3j 1C1AA 2K2MA 1M1KU 5FU6C 5FWBA 3RIRA 4D8KA 4LVJA 4LUEA 1G3TA 2EIFA 2Q7GA 1VQ8A 2DKGA 4KH0B 2EQKA 2W0ZA 4UP7A 3FEOA 5J39A 1VQOT 5HK0A 5K1XA 5KYWA 3G6EA 3CCJA 1UECA 3VV0A 4E7KA 2JNGA 3CC7T 4B9XA 3TUPA 3CCUA 1X55A 3RF1A 1D0YA 4RTZA 1VQ4A 1TH7A 1E1OA 8ATCB 5ELOA 5C51B 3HRTA 1PKTA 4M7AF 1PHTA 3E19A 3HL8A 1SPKA 2QG9B 4Z8AA 1BBWA 1AWJA 1J5WA 1VQKT 4L6V5 3CC2T 4YCWA 3CXCA 3RGLA 2QHVA 1MGQA 1VQ5T 1B7TA 2YRDA 3TEEA 1H8KA 3JV3A 2C0IA 3HFZB 3PFSA 2I2LA 3I55A 2JXBA 3OD1A 1JQQA 2O4XA 3CCUQ 3JCMh 1UGVA 2V8IA 1G5HA 3C0CA 4XQ3A 3L2ZA 1AWXA 3QZ5B 4JZ3A 1VQPT 4UC4A 3M59A 2DILA 1OX9A 2EJGA 2GF7A 2JW4A 1IGUA 5GANj 2EGEA 5GAOl 1M1KC 4LVIA 4A4GA 1HC7A 4C0GA 2IVWA 4PL6A 1XTDA 3BW1A 3TU4K 1M8MA 5D7UA 3SB2A 4P3OA 1JXMA 2JMAA 1QWFA 4BD3A 3CMEA 4X1VA 2DYBA 3CD6Q 4QT7A 3OYDA 3OYKA 2QGGA 3TREA 1X2QA 1H3ZA 4N0AA 3L2QA 1K8AR 3BDUA 3A7RA 5DY9A 1NJ8A 1X27A 4P73A 1UTIA 3MEAA 3P8VA 3O5ZA 2L3SA 4P71C 2DDZA 3LH0A 2K7AA 1YI2T 2RJEA 2LP5A 2M0YA 1SF9A 3S3OA 1VQ8Q 1NYRA 4X34A 4RMFA 5GMKi 2JOYA 5KYUA 4C8QF 3PMIA 1U8RA 3H0IA 4ZIBA 1SHGA 2L3RA 2ZT8A 4LNPA 1UJYA 3CMEQ 1KQSS 1BI1A 3UFGA 2E12A 3M0QA 5CQYA 3QO8A 2QHTA 5LJ5g 1V76A 2RK1A 3OQ5A 1MMNA 1NPPA 1UGSB 2A8EA 1V29B 1WA7A 1IL2A 2KT1A 1RAEB 2RQTA 2J3LA 3TEGA 2ZAEA 1UGQB 1HXDA 1JJ2A 2EYWA 4PFOA 3OMGA 1NLPC 2I4NA 2O88A 5KE2A 1T0HA 1N6AA 2DEUA 1TUGB 1JEGA 4TVWA 1VQ7Q 4CS3A 1AWWA 1SSFA 2L5QA 4UP8A 2CGHA 3SWNA 5GAOp 2CJBA 2RM4A 2GGRA 1IXDA 4ZGJB 4EX5A 7AT1B 3MJXA 4C8QG 2KR3A 3CC7A 2D1XA 4A54A 3D7SB 3A32A 1TXQA 2LT1A 2H3JA 3BE3A 4BWAA 2P4RA 2RN8A 3J7AF 1GBRA 2EGAA 1U06A 1WHHA 4YRJA 2DPPB 5GAMf 2V8KA 2JN0A 2Q5HA 2E5KA 1Q82U 1TSFA 3WVDB 1GXIE 1QVPA 1W2BA 4HA8A 1KMMA 5KCHA 1B70A 1Z7NA 1RL2A 3H8ZA 3KFVA 1BIAA 5CVIA 3SD4A 4KGVB 1AWOA 1NYFA 2XK0A 3LYIA 4QQDA 1UHCA 1S1NA 4O2DA 2HKNA 4C92A 3PIOA 1U5SA 2HQHA 3LC0A 1QVFA 3TQ7P 4HT8A 3I5SA 4IUTA 4TTVA 3RMSA 1VOMA 1NNHA 3MEYA 2ZPIB 2H3EB 4RG8A 1YFSA 2CP0A 3UATA 2K4YA 4GLKA 3L2UA 2MWOA 4LDXA 4LDWA 1SRYA 3CCUT 2L3QA 4LDVA 2P0PA 3SHWA 4XU3A 4CRIA 4AFQC 1ATIA 1IHVA 1QCOA 2LC4A 3E1SA 2ZPHB 4XU2A 4CC4B 4M75B 1WQ7A 5LJ3g 1QP3A 1H4TA 1Q82R 2EQIA 3HFVA 4O5VA 1WHJA 1H92A 4X5OA 1ZX6A 4Q5WA 2EL9A 2K5LA 2FRYA 2RHZA 4ZTFA 1BIBA 3UF4A 4BACA 4M75F 1YITT 2DL8A 1NZ9A 4FSSA 2KSSA 1QVGP 4M7DA 4PJNA 3VQWA 3VUBA 1B7YA 2DD5A 2CYZB 6AT1B 2DTOA 2M51A 1AHJB 3CMAQ 3QKJA 2F5TX 1VQMA 1QVGS 1NYGA 1VYVA 2DJQA 2NUTB 4C0ZA 3VQXA 3IALA 1VQ6A 4JJDA 1IZ6A 3MP8A 5AT1B 2R5AA 4K87A 3C95A 1K9MU 3AHUA 2GCXA 2H8HA 3ZL7C 4NOYA 4CI0C 1G3SA 5K1PA 4ZN1A 3QIIA 2RQUA 2DL3A 1QMCA 4TVAB 4RTVA 3WQZA 2RJCA 3ASKA 2LVMA 2PUOB 3CMET 2JTEA 1JRIA 4PJOC 2MAMA 3W3SA 2OAUA 3EG9A 1M3AA 2DXUA 3JCMQ 3CCVA 3M0SA 2IY5A 1PG5B 2RH2A 4CC2A 5LJ3f 2GQIA 3I56A 4FT4A 4YROA 2E1HA 2YRVA 3H9NA 1B3QA 2LZ6B 3IQLA 4ESRA 3MHXA 3R07A 4JRIA 3CC2Q 3RKWA 4AFSC 3GLXA 4YRTA 3CQTA 2DZCA 3DLMA 4RCCA 1N8RR 2YXYA 3UA6A 4PFZA 3OY9A 4P5NA 5IHNA 3CCQA 1AEYA 1X6OA 3PIPA 1M30A 3QWYA 4M75C 2FZGB 4BE0A 2YLCA 2K5IA 4F7UA 1YWPA 2ECZA 1UB4A 1M3BA 4YREA 3FDRA 1X56A 1B76A 3RUXA 4DBHA 4F7UF 1FMVA 4P75A 1VQPQ 1T3LA 1VQKA 4YRLA 1YFRA 2KROA 4DEXA 5D6YA 2HCKA 2BE9B 4XU1A 2FZKB 1KJWA 4A4HA 5LJ5e 5A2QE 3P8DA 2AMCB 2DK3A 1B7YB 1AVZC 3TSZA 3VS7A 3OS1A 2EQMA 1ABQA 2CS7A 2M16A 4HVUA 4M75D 4BE1A 2X9HA 4C8QA 2KYBA 4YYEA 4XEOA 1BYMA 4YRFA 3CXCS 2KY9A 3QG1A 2PNIA 1ASYA 2DBMA 3IKMB 2QQSA 1W66A 5KYYB 2JTMA 1WXBA 3EGXB 4RTXA 4XTVA 4P71A 2LRQA 3V8KA 2YUPA 1BI2A 3C94A 4QKUA 1RAHB 3LWHA 3CCJQ 1H4VB 2QQ9A 2SRCA 3UGTA 1EIYA 1BBUA 4M77G 4C0FA 1Q81R 2FL7A 4RTYA 4CC7A 1OOTA 1TWBA 4A4KA 2J06A 4YCUA 4L5GA 1EIFA 1RI9A 1A0NB 5GANe 2C0OA 1IB8A 1D3BA 3CD6T 2QA4Q 5GAMj 1SHFA 2RI2A 2HBPA 4YRMA 2M9UA 2ED1A 3CCRT 1NBEB 4ANJA 4YPFA 2KRSA 1VQ9Q 3E9HA 3RACA 3JCMf 4LUDA 1K9MC 3I5RA 5I21A 5FU6B 1LNXA 3JB9J 3G1ZA 1X54A 1NJ5A 1MNDA 2CREA 2A08A 4JS5A 4PJOE 2YUNA 1HYOA 1M90C 3J80E 4DBFA 3CBMA 2I0NA 4LDYA 2QDYB 4OF1A 4DOWA 2RQWA 3UH0A 4HCZA 1NJ1A 5J3BA 3OBWA 3GOXA 1RAAB 4NS5A 2HQXA 1WI7A 1JB0E 3AT1B 1R0BG 1VQNQ 4FM4B 4J9EA 2AKKA 5GAOq 1NJIC 3L2VA 5E3IA 5CR2A 5CAIA 3IKLA 4IUPA 3MEWA 2QQAA 3HXYA 2VUBA 3CCLT 2LQKA 4H2VA 2QASA 1B34A 4OB0B 4R55A 1WJSA 1YWOA 2AZVA 3QYHB 4F04B 3A8HB 2K3XA 4EMKB 5GANg 2ABLA 4YRRA 3CCQT 2DRKA 4P72C 4R0KA 4YRGA 2X35A 3DB3A 3NTKA 1B8AA 2F2WA 4PLLA 1WGSA 3HXZA 4P74A 3UA7A 1PSFA 1K76A 1USYA 3VYGA 2RHIA 1M90R 1UDLA 3OYAA 2DVEA 4M77F 2R57A 1VQ4T 1OPLA 2EW3A 4EDUA 2Q7EA 4K11A 1EZZB 2RO0A 3RESA 2ZIOA 3KBGA 4PJLA 3VS5A 3HHTB 4BDZA 2JVVA 4M7DF 4PJOA 5LL6S 2MCNA 2LNHB 1ZLMA 2L8DA 4OVAA 4M7AC 4UPAA 1K73C 1YBYA 2ZPGB 5LJ5j 5HKCA 4C92D 1PD1A 2DF6A 1LPLA 1Q82C 4C92E 1JBMA 1YCSB 4PJJA 1ZSZB 1BB9A 3M58A 3JAME 1YHQT 1SETA 1R8OB 1VA7A 4EPCA 2AKLA 2KEAA 2YHTA 2XKOC 1EVKA 1OPKA 1Y7XA 3S3MA 3E9FA 2FZCB 5J26A 1R77A 3QHSA 1E24A 3RBBB 1VQ9T 2QAZA 4AH6A 4M77D 5GAMh 5GJWB 3A98A 3IG2A 2KE9A 2EYXA 3LH5A 4G84A 2VXFA 4J9FA 3M4PA 2M02A 2LNVA 1WLPB 1KC8C 4EMKC 4C5GA 1I1JA 1PRLC 4RQEA 2V1RA 2P0QA 5I11A 1LJOA 2X3XD 2JMCA 1UG1A 3MP1A 3CCST 1YHQQ 4DOVA 3EG2A 2XG8D 1Z9QA 2YRCA 1B34B 2BIVA 4BI3A 4CC3A 3CCLQ 2ZZGA 2PTKA 3MO8A 3QZ9B 4IIMA 3OS2A 1PD0A 2K2VA 3VJPA 2PVOB 2HDAA 2HMAA 3WVEB 3L2WA 4C5IA 3CPWA 1RAFB 2XTIA 1TTHB 4YRPA 5KYXB 3M57A 2CP2A 3PZCA 1VQOA 1G8XA 4KGXB 1KMNA 2DXTA 3QYGB 2DLPA 4J5YA 1ZHIA 1H641 1MMDA 3OYYA 4PJMA 2P4TA 2K79A 3QNEA 3MEUA 5CCAA 3G4ST 3CCVT 1WU7A 1U1TA 1KHIA 1GCQA 1GCPA 2QDLA 3TCJA 2L2PA 2O2OA 3DLLA 12ASA 1RI0A 3JCMW 2BZYA 1M3CA 2ZR3A 2VV5A 2FB7A 1AT1B 4C8QC 4J8OA 2LQNA 3M4GA 4FU6A 1X2HA 1SESA 2DTHA 2NWMA 3JCMd 3PVQA 5CKHA 4M7AE 4RTUA 5GAMg 5GMKh 1M1FA 3EGXA 1YJ9A 2B8AA 3FC3A 2E6ZA 1HSQA 3QJYA 3F70A 2OTJQ 5C52B 4HCBA 1YI2Q 3MPUB 2EAYA 1BCMA 4G85A 3DB4A 4B9WA 1VQ4Q 3BDLA 3FB9A 1WIEA 2KBTA 3M9QA 3FJPA 3QJ6A 2E70A 4M77B 1HTTA 4C0DC 4KR3A 1EOVA 1UFFA 3JCMX 3I9QA 4KH1B 4TVRA 2SEMA 1G5IA 3CEYA 2RHQA 1QKXA 2E5QA 3P8BB 1ZA1B 4MMLA 3OYIA 3LGLA 1K0SA 1ZUUA 1QWEA 1XJWB 1U1SA 3LX7A 4M78B 2FO0A 5A0LA 4OLFA 4J9CA 2YUOA 2Y90A 4CH6A 2E4HA 4RUGA 3CXCP 2IIMA 4EMHA 3H6ZA 5GMKm 1UHFA 4M78F 2ROTA 2RHSB 1EQRA 2J6KA 3OYEA 1G3WA 2QYZA 2DAQA 3ME9A 2VKNA 2NUTA 4RG2A 4LVLA 1UJ0A 2E41A 2FPDA 5FWCA 5DLOA 2ZR2A 2XHCA 1GGMA 4OMOA 3OYHA 4PLIA 5IN1A 2E3CA 4QQGA 5IHKA 5HK3A 4BW9A 4GLMA 5IAYA 3UDCA 1YJNQ 1YITA 2GNCA 2Y4YA 3X25B 1BCOA 4LD6A 3CCMA 3CC4A 3EG9B 1KHCA 5GANd 2DBKA 5GMKl 1WDXA 2AZSA 2X4WA 2CP7A 5DM7R 1IGQA 3CCEA 2XMFA 4NL3A 1PSEA 2COZA 4C92F 3V7CA 3VS6A 1FMKA 4P3PA 2VWFA 2JS0A 2QEXQ 1Q86U 3CCQQ 2YWWA 2A28A 3A7AA 2CH4A 3QWXX 1C0MA 2EYQA 4DQ2A 2YT6A 5LJ3d 2ODRD 2ZNJA 1MV0B 3I35A 2RHSA 4N0AC 1XNIA 2G6FX 1M90U 1GFDA 2RPNA 1PM3A 3GF5A 2QHSA 1Y71A 2VYTA 3KXTA 2JT4A 3Q1JA 1FWZA 3REBB 2F69A 4HVCA 1BU1A 2C06A 5I22A 1S72T 3CCSA 1KIKA 2P0KA 1GBQA 2ZT6A 2DRMA 1IRXA 1Q81U 4N4IA 2DXCA 5IHIA 1WHLA 2QA4A 2BE7D 3RERA 5GAN3 3LWIA 2HEQA 2G4CA 3OSSC 1DJ7B 2E5AA 2XGTA 4J15A 3JB9D 5HY6A 5FROA 4IURA 1KK7A 5I2MA 1QP2A 1JJ2P 3HXUA 3VRZA 1GFCA 1NPRA 3FRNA 4RTWA 2CT4A 3J81E 4PJOD 2HAXA 1RADB 5ELNA 4E7LA 3GP8A 1K8AU 4E7IA 2JS2A 5LJ3h 3JB9F 1SRLA 1VIEA 3H41A 1TOVA 2AHJB 2ZPEB 2RB6A 2DU7A 5CK9A 3REUA 2ROLA 4P75C 4FYWB 2ZINA 4J7FA 4KQEA 2V1QA 2X51A 2PMFA 4C5HA 3HSBA 2DTIA 4M7AA 1E22A 2ATCB 1C6VX 1PCXA 5GJVB 3R6OA 2HNIA 5FU7B 2PVGB 1R0CB 4H2UA 1X2GA 2X3WD 1VQ7A 3O8VA 4J9HA
chains in the Genus database with same CATH topology
2PQWA 1KOGA 4QQ6A 2DD4A 4ELZC 4XK8E 4OMFB 3CCET 2EQJA 4E47A 2ALYB 1FX7A 3HXXA 3LSSA 1VQ6T 4ZTZB 1YCYA 2I4MA 1FYFA 1IREB 3RL6A 3VKIA 2QEXA 3QDRB 4M78C 5HGQA 2CIMA 2LX9A 2LCLA 3CD6A 1EVLA 1Q81C 3E9GA 1UGPB 3JCMe 4M7AG 4ZTJA 4XU0A 1JJCB 2EJ9A 3MF1A 1W2BS 2QA4T 4M75G 3UWNA 3A7UA 2BKDN 4A53A 3C4SA 3ER0A 2X4YA 4M7AD 1VQ8T 4X9DA 3QSUA 2XDDA 4C92C 3HY1A 3HPWA 4JS4A 3BY7A 5GAN4 5GMKj 1M4ZA 4XTYA 4F7UG 3EFSA 2Q7HA 3HFOA 1KD1U 2VGMA 4C8QE 4PKCC 3OS0A 3V8LA 3QO7A 3BJUA 3ZBDA 1X01A 4PJOB 5FRMA 4OP0A 4M78A 3JRZA 5GAN2 2QQBA 3JCMg 3HKSA 1VQ7T 2PMEA 5GAOm 4KR2A 5D6WA 2ALYA 4K86A 3HXVA 3HRUA 2DQ3A 2K57A 5KNNA 4H2WA 4JLGA 2XICA 5I2SA 3QO3A 1S72A 2CZ1B 1K73U 2ZT7A 3CMAA 1NJ6A 4TQFA 3JSCA 4D6WA 3SFMA 4CH5A 3LGFA 4HWRA 4J83A 3CCRA 4XAXB 4BB7A 3UPUA 4QW2A 3RMQA 1B70B 2QHUA 4M7DE 4M78D 3UT1A 4VUBA 2OTLA 1NYQA 3T9NA 4JLIA 1WJQA 2P0LA 2CKKA 4CH3A 5M9OA 3ZEHA 5CQXA 1VIFA 2DQ0A 4JDSA 4OB3B 3M53A 3ERRA 2EJFA 1M1GA 1QF6A 2BUDA 5LJ3e 4YCVA 4HCCA 4BUGA 3L2RA 3X24B 3S3NA 1L0WA 1VQLA 3PCOA 4TQDA 1WQWA 4TVAA 4UP9A 1YJNT 2LCCA 2I4LA 2MF2A 1ASZA 3RKYA 3M5AA 2ARTA 1RIQA 2ZZFA 1EFWA 3OMCA 3X26B 2QEXT 4LDUA 2DIGA 4BY6B 1WNLA 4P73C 3QTCA 3MEVA 1VQZA 3MP6A 3A5ZB 1ZQ1A 5FRNA 2PU9B 4M78E 1WLEA 2X4XA 2RI3A 2HD0A 3P8TA 1O75A 4J6YA 3LSQA 2M1HA 4FSXA 3CMQA 2DU5A 2LTOA 4H02A 4XTWA 2XU8A 1YJ9T 4PJOF 3KUFA 1WJRA 4PG3A 4MZMA 4KUDK 2DXBA 3OYJA 2OTJT 3LLRA 3C12A 4WI1A 2QXFA 5KCOA 3A5YA 4DA4A 3EAEA 5C6SA 1ADYA 2QTXA 2EQUA 2M0OA 3CBOA 3PTAA 4M75E 5A0DA 3NETA 5GANf 3OYMA 3GNFB 5GMKe 4H2XB 11ASA 3HRIA 3P8YA 4XEMA 4BDYA 5KE3A 2OTLT 3PCOB 4QVDA 2XI9A 4ME7A 4II1A 5D6XA 1N9WA 2MWPA 5F5WA 5CIUA 3LW5E 1LOJA 5GAN8 1N27A 3PT9A 2ZZEA 2AKWB 3JCMb 1VQLT 4F7UE 2JUFA 4FT2A 4J6XA 3V7SA 4C92B 1C0AA 4M7DB 3HFZA 4HWOA 4Y91A 2LDMA 3NTIA 3JCMJ 3A8GB 4HT9A 3A8MB 3X28B 3A5ZA 2MMPA 3L42A 3ICAA 2XDBA 1P92A 2RJFA 2I4OA 1LYLA 1YI2A 1Q86C 2K3YA 3G7ZA 3A31A 4H2XA 2E64A 4JRQA 3HRKA 4NCXA 4FL6A 3SDZA 4M7DD 3HY0A 2RHYA 2O01E 5GAN7 3TEHA 4KT0E 4TVYA 1VQNA 4E51A 1USYC 4EMKA 5CKBA 2Y4XA 4HT4A 2LT4A 1M8VA 4KUIA 1G3YA 4E7HA 1QE0A 4M7DG 3V8JA 5FU7C 3HP9A 1H4SA 4RDXA 2V8JA 2ARUA 5KH6A 1YJWA 4E7JA 4KBMB 4BE2A 3EFRA 1NE8A 1QVFS 1YGBA 2IY5B 3VQYA 3OB9A 2ARSA 4BI4A 2IG0A 4LD9K 2RI5A 3QO5A 3TEHB 2QQRA 2AMCA 3PMTA 3SWNB 4WJ4A 4H2YA 3CMAT 3OS5A 3CC2A 3OYGA 5DLQE 3WXMB 4EMGA 3CCMT 4F7UB 3M55A 2KDSA 2ZPBB 5GANh 3I55T 1KQ1A 1UGRB 2LQ8A 1XQHA 2HQEA 4JRPA 2OTJA 1QVGA 2ZNIA 1D3BB 3MQZA 2ZTGA 1K8AC 1YFTA 2R5MA 2D6FA 4GY5A 1KD1C 2FYKA 4C8QB 2DIQA 3NEMA 3OYLA 2ZT5A 2KMTA 2Q5IA 1OYXA 2E10A 4CS4A 3JCMc 1Y96B 1WYDA 2CZ6B 4YRCA 2EFIA 1O9SA 4WJ3M 4H2SA 3CCLA 1YJNA 4M75A 2QI2A 1YB3A 5CKDA 4Z02A 4R56A 2ZIMA 3META 2KVQG 3V7RA 1VQNT 3HTZA 1YJWT 3OYCA 1N9SA 4RQFA 1W4SA 3MCAB 3MF2A 5C53B 1OZ2A 3A74A 4PNOA 3A8OB 2A7YA 5IT9E 1UEBA 4NL2A 3NENA 4N4GA 2FHDA 3URGA 2RJDA 4OB1B 3I7FA 2PUKB 1VQMT 4Q15A 3VBBA 2RK2A 1VUBA 4JUVA 2C8MA 5L8RE 3JB9I 4M77A 4C8QD 4KULA 4HWPA 2D0QB 4YP0A 2RHQB 2DO3A 4WF2A 5GAMe 3HFNA 2CJ9A 4HWTA 1E1TA 3VU3C 2PVDB 1Y96A 1XOVA 4A4FA 3ZFJA 1NJ2A 4JJNK 1N9RA 3M4YA 2F5KA 3NELA 2E65A 3VQVA 4QVZA 2XDPA 4EO4A 3PGGA 1I8FA 1M5Q1 3DKMA 3QBYA 3OYBA 1OZ3A 3REXA 4IKFA 4MZPA 2L89A 4QVCA 4L59A 1YIJT 4XTXA 1Y07A 3HXWA 4XTUA 4J6WA 4X9CA 4RKUE 3JCMV 2KAFA 2P5IA 4TWAA 4PHCA 3OBYA 5CKFA 3G71T 1EIYB 4K88A 1BKBA 4LVMA 3P8HA 1MHNA 2RD1A 3OA6A 2ZZDA 5LJ5f 2KK4A 2KQWA 4PJOG 5LJ5h 4MZTA 3SWNC 4OB2B 1OI1A 4JRKA 4O6JA 4MMKA 4FIBA 1Z7MA 3FIFA 2YLBA 3S6WA 3G6ET 1N8RC 1FXXA 4Y28E 3GPLA 3X20B 4A4EA 3CC4T 4IUUA 4M77E 2ZCEA 3N5BB 3PNWC 5CKEA 4BY6C 4YRSA 2A3LA 4ZN3A 1PYSB 1BI3A 3L4GB 1KG1A 3E9IA 1Q7YC 4Q6GA 4DPGA 5AYFA 1ADJA 4YRNA 1KC8U 5CO7A 4BI8B 4M7AB 3GNGA 2ZXFA 1VQPA 3QPHA 4CH4A 3DSQA 3CPFA 4OGEA 3OYNA 1I5LA 3QUIA 1KQ2A 4ATOA 4IUQA 2WACA 1I81A 2CJAA 4RMOA 1HK9A 3VYHB 2AKWA 4HWSA 2DEQA 4ELYC 4C92G 3JCMP 1YHQA 1SERA 2K5FA 2D9TA 4IUVA 5FLXE 2C7IA 3CBPA 4P74C 1VQ5A 1PYSA 3UGQA 2WSFE 3CCJT 1VQ9A 1G51A 4P72A 4P3NA 1WPYA 3JB9H 1M9SA 3FLGA 2J3MA 3M56A 2VC8A 3OYFA 2GFUA 4LNSA 4YRKA 1Q7YU 3VUZA 3L1AA 2E6NA 4YRIA 3CPWS 2JZ2A 2CZ0B 2VGNA 4V2SA 1JJCA 1ZBXA 2WSCE 3G71A 4M78G 5GAN5 1KQSA 4YDQA 3GIBA 2ZGWA 5C0MA 2XD0A 2MI6A 1BI0A 5EG2A 3L4GA 2VXEA 3KFUA 4HKEA 4CS2A 2JTFA 4MDWA 1N8RU 3RKXA 3INZA 2ZCFB 3JB9G 2FVUA 5GAOn 1QW1A 2G3RA 2NLUA 2EKOA 3M54A 2XIDA 4C5EA 1NJIU 4OGCA 1G5VA 2ODRC 2WSEE 4XTZA 4H2TA 5GAMd 4ZTUB 2GFAA 2ZPFB 4ZGDB 4ZGEB 1YIJA 3HRSA 2RA2A 2X4JA 4C0DB 2RHUA 1X75C 3BFMA 4J7IA 5GAN6 3OW2A 3OW2S 2NS6A 2DJZA 1JJ2S 1I4K1 3M4QA 3G4SA 4M77C 5GAOr 4YTLA 4MDXA 2GQVA 4LVKA 3QXEB 4RCBA 2CZ7B 4N4HA 3OSVA 4YRQA 4M7DC 4L87A 2DZ9A 3I56T 5A0GA 1H4QA 2O4XB 2RHXA 3NTHA 3A8LB 5LJ5d 3NFCA 2R58A 2EWNA 5LJ3j 1M1KU 5FU6C 3RIRA 4LVJA 1G3TA 2EIFA 2Q7GA 1VQ8A 2DKGA 2EQKA 4UP7A 3FEOA 5J39A 1VQOT 5HK0A 5K1XA 3G6EA 3CCJA 3VV0A 4E7KA 2JNGA 3CC7T 4B9XA 3TUPA 3CCUA 1X55A 3RF1A 1VQ4A 1TH7A 1E1OA 5ELOA 5C51B 3HRTA 4M7AF 3E19A 3HL8A 1BBWA 1J5WA 1VQKT 4L6V5 3CC2T 4YCWA 3CXCA 3RGLA 2QHVA 1MGQA 1VQ5T 3TEEA 3HFZB 3PFSA 2I2LA 3I55A 3OD1A 2O4XA 3JCMh 2V8IA 1G5HA 4XQ3A 3L2ZA 3QZ5B 1VQPT 4UC4A 3M59A 2GF7A 2EJGA 5GANj 5GAOl 1M1KC 4LVIA 4A4GA 1HC7A 4C0GA 2IVWA 4PL6A 1XTDA 3BW1A 3TU4K 3SB2A 4P3OA 4BD3A 3CMEA 3OYDA 3OYKA 3TREA 1H3ZA 4N0AA 3L2QA 3BDUA 3A7RA 5DY9A 1NJ8A 4P73A 3MEAA 3P8VA 4P71C 2DDZA 3LH0A 1YI2T 2RJEA 1NYRA 4RMFA 3S3OA 4X34A 5GMKi 2JOYA 4C8QF 3PMIA 1U8RA 4ZIBA 2L3RA 2ZT8A 1KQSS 1BI1A 3UFGA 2E12A 5CQYA 3QO8A 2QHTA 5LJ5g 2RK1A 3OQ5A 1NPPA 2A8EA 1UGSB 1V29B 1IL2A 2J3LA 3TEGA 1UGQB 1HXDA 1JJ2A 3OMGA 2I4NA 5KE2A 1N6AA 4TVWA 4CS3A 1SSFA 2L5QA 4UP8A 2CGHA 3SWNA 5GAOp 2CJBA 2RM4A 4ZGJB 4EX5A 4C8QG 3CC7A 4A54A 3A32A 2LT1A 2H3JA 4BWAA 3J7AF 4YRJA 2DPPB 5GAMf 2V8KA 2JN0A 2Q5HA 1Q82U 3WVDB 1GXIE 1QVPA 1W2BA 4HA8A 1KMMA 5KCHA 1B70A 1Z7NA 1RL2A 3H8ZA 1BIAA 5CVIA 3SD4A 2XK0A 3LYIA 4QQDA 4O2DA 4C92A 3PIOA 3LC0A 1QVFA 4HT8A 4IUTA 4TTVA 3RMSA 1NNHA 3MEYA 2ZPIB 4RG8A 1YFSA 2K4YA 4GLKA 3L2UA 2MWOA 4LDXA 4LDWA 1SRYA 3CCUT 4LDVA 2P0PA 4XU3A 4CRIA 1ATIA 2LC4A 3E1SA 2ZPHB 4XU2A 4M75B 1WQ7A 5LJ3g 1QP3A 1H4TA 3HFVA 4O5VA 4X5OA 2EL9A 4Q5WA 2K5LA 2RHZA 4ZTFA 1BIBA 4BACA 4M75F 1YITT 1NZ9A 2KSSA 4M7DA 3VQWA 1B7YA 3VUBA 2DD5A 2CYZB 2DTOA 1AHJB 3QKJA 2F5TX 1VQMA 1QVGS 4C0ZA 3VQXA 3IALA 1VQ6A 1IZ6A 3MP8A 2R5AA 4K87A 3C95A 1K9MU 3AHUA 2GCXA 4NOYA 4CI0C 1G3SA 5K1PA 4ZN1A 3QIIA 4TVAB 3WQZA 2RJCA 3ASKA 2LVMA 2PUOB 3CMET 1JRIA 4PJOC 2MAMA 3W3SA 2OAUA 2DXUA 3JCMQ 3CCVA 2IY5A 2RH2A 5LJ3f 3I56A 4FT4A 4YROA 2E1HA 2YRVA 3R07A 3MHXA 4JRIA 3RKWA 4YRTA 3GLXA 2DZCA 3DLMA 4RCCA 3OY9A 4P5NA 3CCQA 1X6OA 3PIPA 4M75C 4BE0A 2YLCA 2K5IA 4F7UA 1UB4A 4YREA 3FDRA 1X56A 1B76A 3RUXA 4F7UF 4P75A 1VQKA 4YRLA 1YFRA 5D6YA 4XU1A 4A4HA 5LJ5e 5A2QE 3P8DA 2AMCB 2DK3A 1B7YB 3OS1A 2EQMA 2CS7A 2M16A 4M75D 4BE1A 4C8QA 4YYEA 4XEOA 1BYMA 4YRFA 3CXCS 2KY9A 3QG1A 1ASYA 3IKMB 2QQSA 1W66A 2JTMA 4XTVA 4P71A 2LRQA 3V8KA 1BI2A 3C94A 3LWHA 1H4VB 2QQ9A 3UGTA 1EIYA 1BBUA 4M77G 4C0FA 2FL7A 4A4KA 4YCUA 4L5GA 1EIFA 5GANe 1D3BA 3CD6T 5GAMj 2RI2A 2HBPA 4YRMA 2M9UA 3CCRT 4YPFA 3E9HA 3RACA 3JCMf 1K9MC 5I21A 5FU6B 1LNXA 3JB9J 3G1ZA 1X54A 1NJ5A 4JS5A 4PJOE 1M90C 3J80E 3CBMA 4LDYA 2QDYB 4OF1A 4DOWA 3UH0A 4HCZA 1NJ1A 5J3BA 3OBWA 3GOXA 4NS5A 2HQXA 1JB0E 4FM4B 5GAOq 1NJIC 3L2VA 5E3IA 5CR2A 5CAIA 3IKLA 4IUPA 3MEWA 2QQAA 3HXYA 2VUBA 3CCLT 2LQKA 4H2VA 1B34A 4OB0B 4R55A 1WJSA 3QYHB 3A8HB 2K3XA 4EMKB 5GANg 4YRRA 3CCQT 4P72C 4YRGA 2X35A 3DB3A 3NTKA 1B8AA 4PLLA 1WGSA 3HXZA 4P74A 1PSFA 1USYA 3VYGA 2RHIA 3OYAA 2DVEA 4M77F 2R57A 1VQ4T 4EDUA 2Q7EA 2RO0A 3RESA 2ZIOA 3KBGA 3HHTB 4BDZA 2JVVA 4M7DF 4PJOA 5LL6S 4OVAA 2L8DA 4M7AC 4UPAA 1K73C 1YBYA 2ZPGB 5LJ5j 5HKCA 4C92D 1Q82C 4C92E 1JBMA 3M58A 3JAME 1YHQT 1SETA 1R8OB 4EPCA 2YHTA 2XKOC 1EVKA 1Y7XA 3S3MA 3E9FA 5J26A 3QHSA 1E24A 1VQ9T 4AH6A 4M77D 5GAMh 3IG2A 4G84A 2VXFA 3M4PA 2LNVA 1KC8C 4EMKC 4C5GA 4RQEA 2P0QA 1LJOA 3MP1A 3CCST 4DOVA 2XG8D 1B34B 2BIVA 4BI3A 2ZZGA 3MO8A 3QZ9B 3OS2A 2K2VA 3VJPA 2PVOB 3WVEB 3L2WA 4C5IA 3CPWA 2XTIA 4YRPA 3M57A 3PZCA 1VQOA 1KMNA 2DXTA 3QYGB 4J5YA 1ZHIA 1H641 3OYYA 2P4TA 3QNEA 3MEUA 5CCAA 3G4ST 3CCVT 1WU7A 1U1TA 1KHIA 3TCJA 3DLLA 12ASA 1RI0A 3JCMW 2ZR3A 2VV5A 2FB7A 4C8QC 4J8OA 3M4GA 4FU6A 1X2HA 1SESA 2DTHA 3JCMd 5CKHA 4M7AE 5GAMg 5GMKh 1M1FA 1YJ9A 2B8AA 3FC3A 2E6ZA 3QJYA 3F70A 5C52B 4HCBA 2EAYA 4G85A 3DB4A 4B9WA 3BDLA 3FB9A 3M9QA 3FJPA 3QJ6A 2E70A 4M77B 1HTTA 4C0DC 4KR3A 1EOVA 3JCMX 4TVRA 1G5IA 3CEYA 2RHQA 2E5QA 3P8BB 4MMLA 3OYIA 3LGLA 1U1SA 3LX7A 4M78B 5A0LA 4OLFA 2Y90A 4CH6A 4EMHA 3H6ZA 5GMKm 4M78F 2RHSB 1EQRA 3OYEA 1G3WA 2DAQA 3ME9A 4RG2A 4LVLA 2E41A 5DLOA 2ZR2A 2XHCA 1GGMA 3OYHA 4PLIA 5IN1A 2E3CA 4QQGA 5HK3A 4BW9A 5IAYA 3UDCA 1YITA 2Y4YA 3X25B 4LD6A 3CCMA 3CC4A 1KHCA 5GANd 5GMKl 2X4WA 5DM7R 3CCEA 4NL3A 1PSEA 4C92F 3V7CA 4P3PA 1Q86U 3A7AA 2EYQA 4DQ2A 5LJ3d 2ODRD 2ZNJA 2RHSA 4N0AC 1XNIA 1M90U 3GF5A 2QHSA 1Y71A 2VYTA 3KXTA 3Q1JA 1FWZA 2F69A 4HVCA 2C06A 1S72T 3CCSA 2ZT6A 2P0KA 1Q81U 4N4IA 2DXCA 2QA4A 3RERA 5GAN3 3LWIA 2G4CA 3OSSC 1DJ7B 2E5AA 2XGTA 4J15A 3JB9D 5HY6A 5FROA 4IURA 1QP2A 5I2MA 3HXUA 1NPRA 3FRNA 3J81E 4PJOD 2HAXA 5ELNA 4E7LA 3GP8A 1K8AU 4E7IA 5LJ3h 3JB9F 1VIEA 2AHJB 2ZPEB 2RB6A 2DU7A 5CK9A 3REUA 4P75C 2ZINA 4J7FA 4KQEA 2PMFA 4C5HA 3HSBA 2DTIA 4M7AA 1E22A 3R6OA 2HNIA 5FU7B 2PVGB 4H2UA 1X2GA 1VQ7A 3O8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YGB A;  2IY5 B;  1KOG A;  5GAN e;  2DJZ A;  3VQY A;  1D3B A;  2ARS A;  5GAM j;  1I4K 1;  3M4Q A;  4M77 C;  5GAO r;  4YRM A;  4RCB A;  3QO5 A;  4YPF A;  3TEH B;  3E9H A;  3RAC A;  3JCM f;  4YRQ A;  4M7D C;  2AMC A;  4L87 A;  3SWN B;  5I21 A;  2DZ9 A;  4WJ4 A;  3HXX A;  3LSS A;  1LNX A;  3JB9 J;  2ALY B;  3G1Z A;  1X54 A;  1NJ5 A;  4H2Y A;  1H4Q A;  4ZTZ B;  1YCY A;  4PJO E;  2I4M A;  5LJ5 d;  1FYF A;  2EWN A;  4EMG A;  5LJ3 j;  3UH0 A;  1NJ1 A;  3RL6 A;  3RIR A;  4F7U B;  2Q7G A;  4M78 C;  5HGQ A;  2DKG A;  2CIM A;  5GAN h;  1EVL A;  4UP7 A;  5K1X A;  1KQ1 A;  3JCM e;  4M7A G;  5GAO q;  3TUP A;  5E3I A;  4XU0 A;  5CAI A;  1JJC B;  1X55 A;  3IKL A;  2EJ9 A;  3RF1 A;  3MF1 A;  1TH7 A;  1E1O A;  5ELO A;  3HXY A;  5C51 B;  4M75 G;  4M7A F;  2ZNI A;  1D3B B;  4H2V A;  1BBW A;  1J5W A;  2ZTG A;  3A7U A;  1YFT A;  1B34 A;  4A53 A;  4YCW A;  2FYK A;  4C8Q B;  3RGL A;  3NEM A;  2QHV A;  1MGQ A;  4EMK B;  5GAN g;  4YRR A;  2ZT5 A;  4P72 C;  4M7A D;  4YRG A;  2Q5I A;  1B8A A;  4X9D A;  2E10 A;  3QSU A;  3HFZ B;  4C92 C;  3HXZ A;  4CS4 A;  3JCM c;  4P74 A;  2I2L A;  1USY A;  3OD1 A;  3HY1 A;  1Y96 B;  1WYD A;  3JCM h;  3BY7 A;  2DVE A;  4YRC A;  5GAN 4;  1G5H A;  4XQ3 A;  5GMK j;  4WJ3 M;  3L2Z A;  4M77 F;  4XTY A;  4F7U G;  3EFS A;  4H2S A;  2Q7H A;  2Q7E A;  3RES A;  2ZIO A;  3HFO A;  4M75 A;  4C8Q E;  2EJG A;  1YB3 A;  4M7D F;  4PJO A;  5GAN j;  3V8L A;  5GAO l;  3QO7 A;  2ZIM A;  3BJU A;  4M7A C;  1X01 A;  4UPA A;  3V7R A;  1HC7 A;  4PJO B;  5LJ5 j;  3HTZ A;  3BW1 A;  4C92 D;  3SB2 A;  4OP0 A;  4M78 A;  4P3O A;  4C92 E;  1N9S A;  5GAN 2;  1JBM A;  4RQF A;  3JCM g;  2PME A;  5GAO m;  4KR2 A;  1SET A;  2ALY A;  2YHT A;  3MF2 A;  4K86 A;  5C53 B;  1EVK A;  3A74 A;  4PNO A;  3HXV A;  2DQ3 A;  2K57 A;  4N0A A;  3QHS A;  3BDU A;  3A7R A;  1E24 A;  5DY9 A;  1NJ8 A;  4P73 A;  5KNN A;  4H2W A;  4AH6 A;  3P8V A;  4P71 C;  4M77 D;  3QO3 A;  5GAM h;  2DDZ A;  3IG2 A;  1NYR A;  4RMF A;  4NL2 A;  3NEN A;  5GMK i;  2ZT7 A;  4C8Q F;  4G84 A;  1NJ6 A;  2VXF A;  4TQF A;  3M4P A;  4ZIB A;  2ZT8 A;  3I7F A;  4CH5 A;  4EMK C;  3UFG A;  3VBB A;  4Q15 A;  4RQE A;  4HWR A;  3QO8 A;  2QHT A;  1LJO A;  5LJ5 g;  4JUV A;  2C8M A;  1IL2 A;  3JB9 I;  4M77 A;  2J3L A;  3TEG A;  1B70 B;  4C8Q D;  2QHU A;  1HXD A;  4M7D E;  1B34 B;  4M78 D;  2ZZG A;  4HWP A;  4YP0 A;  2RHQ B;  4WF2 A;  1NYQ A;  2I4N A;  4JLI A;  2P0L A;  5GAM e;  4CH3 A;  3HFN A;  2CJ9 A;  4TVW A;  4HWT A;  4CS3 A;  1E1T A;  3VU3 C;  4UP8 A;  2CGH A;  2XTI A;  4YRP A;  1Y96 A;  3SWN A;  2DQ0 A;  5GAO p;  2CJB A;  1NJ2 A;  1N9R A;  2RM4 A;  3PZC A;  3ERR A;  2EJF A;  4EX5 A;  3NEL A;  1KMN A;  4C8Q G;  2E65 A;  2DXT A;  3VQV A;  1QF6 A;  4A54 A;  4J5Y A;  4EO4 A;  3PGG A;  1I8F A;  1M5Q 1;  3A32 A;  1H64 1;  4BWA A;  5LJ3 e;  4YCV A;  3QNE A;  3REX A;  4YRJ A;  5GAM f;  2JN0 A;  1WU7 A;  1U1T A;  4QVC A;  2Q5H A;  1L0W A;  3PCO A;  4TQD A;  1WQW A;  4TVA A;  4UP9 A;  4XTX A;  4HA8 A;  1KMM A;  12AS A;  3HXW A;  2I4L A;  3JCM W;  1B70 A;  1Z7N A;  4XTU A;  1ASZ A;  2ZR3 A;  4J6W A;  3RKY A;  1BIA A;  4X9C A;  3JCM V;  2FB7 A;  4C8Q C;  3M4G A;  1X2H A;  1SES A;  4O2D A;  2ART A;  2DTH A;  2P5I A;  1RIQ A;  4C92 A;  4TWA A;  3JCM d;  3LC0 A;  4PHC A;  2ZZF A;  4M7A E;  4HT8 A;  5GAM g;  4TTV A;  5GMK h;  1EFW A;  1NNH A;  3MEY A;  5C52 B;  1YFS A;  1WNL A;  4P73 C;  3QTC A;  1EIY B;  1VQZ A;  4K88 A;  2EAY A;  4G85 A;  4M78 E;  1WLE A;  2RD1 A;  5LJ5 f;  3P8T A;  1SRY A;  3FB9 A;  4PJO G;  4J6Y A;  5LJ5 h;  3FJP A;  4XU3 A;  3SWN C;  1ATI A;  4JRK A;  4M77 B;  1HTT A;  4KR3 A;  4MMK A;  1EOV A;  3JCM X;  3LSQ A;  4XU2 A;  4M75 B;  1WQ7 A;  5LJ3 g;  1Z7M A;  3CMQ A;  1H4T A;  2DU5 A;  3FIF A;  3HFV A;  1G5I A;  2YLB A;  2RHQ A;  4X5O A;  2EL9 A;  1BIB A;  4MML A;  4H02 A;  4XTW A;  4M75 F;  1U1S A;  4M7D A;  4M78 B;  4PJO F;  4OLF A;  2Y90 A;  4PG3 A;  4CH6 A;  4M77 E;  2ZCE A;  3VQW A;  4YRS A;  1B7Y A;  4EMH A;  5GMK m;  4WI1 A;  3A5Y A;  4M78 F;  2DTO A;  2RHS B;  1EQR A;  1ADY A;  2QTX A;  1PYS B;  3L4G B;  2E41 A;  2ZR2 A;  4M75 E;  1GGM A;  3E9I A;  3NET A;  5GAN f;  4Q6G A;  2E3C A;  3VQX A;  3IAL A;  5GMK e;  4DPG A;  4H2X B;  11AS A;  1ADJ A;  3HRI A;  3P8Y A;  4K87 A;  4YRN A;  4XEM A;  4BW9 A;  3AHU A;  4NOY A;  3PCO B;  5K1P A;  4QVD A;  4TVA B;  4M7A B;  2ZXF A;  3WQZ A;  5GAN d;  5GMK l;  4CH4 A;  1JRI A;  3DSQ A;  4PJO C;  1N9W A;  1I5L A;  3W3S A;  5F5W A;  3QUI A;  1KQ2 A;  1LOJ A;  2DXU A;  3JCM Q;  5GAN 8;  4NL3 A;  2IY5 A;  1I81 A;  4C92 F;  3V7C A;  2CJA A;  2ZZE A;  3JCM b;  2AKW B;  4F7U E;  5LJ3 f;  4P3P A;  4J6X A;  3V7S A;  1HK9 A;  4C92 B;  4YRO A;  1C0A A;  2E1H A;  2AKW A;  4M7D B;  3HFZ A;  4HWO A;  4Y91 A;  2DEQ A;  3R07 A;  4HWS A;  3A7A A;  4C92 G;  4JRI A;  3JCM J;  3JCM P;  1SER A;  3RKW A;  4HT9 A;  4YRT A;  4DQ2 A;  5LJ3 d;  2ODR D;  2ZNJ A;  2DZC A;  4RCC A;  2C7I A;  2RHS A;  4N0A C;  3A5Z A;  4P74 C;  3ICA A;  2I4O A;  1PYS A;  2QHS A;  3UGQ A;  1G51 A;  4P72 A;  4P3N A;  1LYL A;  4M75 C;  4HVC A;  2YLC A;  1WPY A;  4F7U A;  3JB9 H;  2ZT6 A;  2J3M A;  3A31 A;  4YRE A;  4H2X A;  2VC8 A;  1X56 A;  4LNS A;  1B76 A;  3RER A;  4YRK A;  3RUX A;  5GAN 3;  2G4C A;  4F7U F;  3L1A A;  4P75 A;  4YRI A;  2E64 A;  2E5A A;  3HRK A;  2XGT A;  4NCX A;  4YRL A;  4J15 A;  3JB9 D;  1YFR A;  4V2S A;  4M7D D;  3HY0 A;  1JJC A;  4XU1 A;  5GAN 7;  3HXU A;  3TEH A;  4M78 G;  5LJ5 e;  5GAN 5;  2AMC B;  4YDQ A;  3GIB A;  2ZGW A;  1B7Y B;  4PJO D;  5ELN A;  4TVY A;  4E51 A;  4M75 D;  1USY C;  4C8Q A;  4YYE A;  4EMK A;  4XEO A;  3L4G A;  5LJ3 h;  3JB9 F;  2VXE A;  4YRF A;  3KFU A;  4CS2 A;  1M8V A;  2RB6 A;  1ASY A;  3IKM B;  3RKX A;  1QE0 A;  1W66 A;  2DU7 A;  4M7D G;  3INZ A;  3JB9 G;  5GAO n;  4XTV A;  3V8J A;  4P71 A;  3V8K A;  1H4S A;  3REU A;  4P75 C;  2ZIN A;  2ODR C;  1H4V B;  4KQE A;  4RDX A;  3UGT A;  4XTZ A;  1EIY A;  1BBU A;  4M77 G;  5GAM d;  2PMF A;  3HSB A;  4H2T A;  4ZTU B;  2DTI A;  2ARU A;  4M7A A;  1E22 A;  2RA2 A;  2HNI A;  4H2U A;  1X2G A;  3BFM A;  4YCU A;  5GAN 6;  3EFR A; 
#chains in the Genus database with same CATH topology
 2PQW A;  1KOG A;  4QQ6 A;  2CH4 W;  4AFZ C;  2DD4 A;  1W2B P;  1AD5 A;  4FYX B;  4ELZ C;  1VYT A;  3R6N A;  4XK8 E;  4OMF B;  3CCE T;  2EQJ A;  4E47 A;  2ALY B;  1FX7 A;  3HXX A;  3LSS A;  1VQ6 T;  4FYY B;  4AT1 B;  1ABO A;  4ZTZ B;  3VS0 A;  1YCY A;  2I4M A;  2RQR A;  2EBP A;  1FYF A;  1FMW A;  1IRE B;  4J9I A;  3RL6 A;  3VKI A;  1LCK A;  2QEX A;  3QDR B;  4M78 C;  5HGQ A;  2JM9 A;  2CIM A;  2LX9 A;  2LCL A;  3CD6 A;  1EVL A;  1Q81 C;  5KYU B;  3E9G A;  1UGP B;  2A0F B;  3JCM e;  1AZE A;  4M7A G;  4FW1 A;  3OW2 P;  4ZTJ A;  4XU0 A;  1JJC B;  1G83 A;  2EJ9 A;  2J6F A;  3MF1 A;  1RUW A;  2MK5 A;  1W2B S;  2QA4 T;  1G2B A;  4M75 G;  2CSI A;  3UWN A;  1MMG A;  3A7U A;  3M0R A;  2BKD N;  4A53 A;  3C4S A;  3ER0 A;  1BBZ A;  2X4Y A;  2VVK A;  4DBR A;  2YSQ A;  4M7A D;  1VQ8 T;  4X9D A;  4LXC A;  3QSU A;  2XDD A;  4C92 C;  3HY1 A;  3HPW A;  2CUB A;  2Z0W A;  4JS4 A;  9ATC B;  3BY7 A;  3M0P A;  5GAN 4;  5GMK j;  1M4Z A;  2AK5 A;  4XTY A;  3EFS A;  4F7U G;  4OMP A;  2NUP A;  2KGT A;  2Q7H A;  3CCS Q;  3PVL A;  3HFO A;  1KD1 U;  2VGM A;  4C8Q E;  2LX7 A;  2FPF A;  4PKC C;  2E3I A;  3OS0 A;  3V8L A;  3QO7 A;  3BJU A;  3ZBD A;  1X01 A;  1Q95 G;  4PJO B;  5FRM A;  4OP0 A;  4M78 A;  3JRZ A;  5GAN 2;  2QQB A;  3CC7 Q;  3JCM g;  3HKS A;  1VQ7 T;  2PME A;  1TUD A;  1UUE A;  4F14 A;  5GAO m;  4KR2 A;  5D6W A;  2ALY A;  4K86 A;  2KT8 A;  3HXV A;  3HRU A;  5FW9 A;  2DQ3 A;  2K57 A;  2F1L A;  2AT1 B;  5KNN A;  4H2W A;  4JLG A;  4Z88 A;  2XIC A;  5I2S A;  1OUL A;  1JO8 A;  3QO3 A;  1ZSG A;  1S72 A;  2CZ1 B;  1K73 U;  3CCM Q;  3H0F A;  2ZT7 A;  3CMA A;  5ECA A;  1NJ6 A;  4TQF A;  3JSC A;  1CKB A;  4D6W A;  3SFM A;  4CH5 A;  3LGF A;  1SRM A;  4HWR A;  2DA9 A;  4LE9 A;  1F1B B;  4J83 A;  1OEB A;  1NLO C;  3CCR A;  4XAX B;  4BB7 A;  3UPU A;  4QW2 A;  2IPO B;  2EVR A;  3RMQ A;  1B70 B;  2QHU A;  4M7D E;  2DL4 A;  4M78 D;  3UT1 A;  1KQS P;  4VUB A;  2OTL A;  1NYQ A;  3T9N A;  3TSW A;  4JLI A;  1YIJ Q;  1WJQ A;  2P0L A;  2CKK A;  4JPB W;  3NPF A;  1M2V B;  4WCI A;  4CH3 A;  1Q86 R;  4E7S A;  2EPD A;  5M9O A;  2DVJ A;  2CP3 A;  3ZEH A;  5CQX A;  1VIF A;  2LMJ A;  1QVF P;  2DQ0 A;  4JDS A;  4OB3 B;  2CUD A;  3M53 A;  3ERR A;  2EJF A;  1M1G A;  2LJ1 A;  1QCF A;  1TUC A;  2BZ8 A;  1QF6 A;  1MV3 A;  2BUD A;  1QCN A;  4HVW A;  5LJ3 e;  4YCV A;  4HCC A;  4BUG A;  3L2R A;  2EYY A;  2DFU A;  3X24 B;  3S3N A;  1ZSZ C;  1L0W A;  1VQL A;  3PCO A;  4TQD A;  1GL5 A;  1WQW A;  4TVA A;  4UP9 A;  1YJN T;  2LCC A;  2CT3 A;  2DER A;  2I4L A;  2MF2 A;  1ASZ A;  1EFN A;  2DET A;  3RKY A;  3EG3 A;  3M5A A;  2ART A;  1RIQ A;  3VS2 A;  2ZZF A;  4DBQ A;  1EFW A;  3OMC A;  3X26 B;  2QEX T;  4LDU A;  1SG5 A;  2DIG A;  2HL5 C;  4BY6 B;  1WNL A;  4P73 C;  1VQM Q;  3QTC A;  3MEV A;  4JJC A;  2B86 A;  1VQZ A;  3MP6 A;  1ARK A;  3A5Z B;  1ZQ1 A;  5FRN A;  1W1F A;  2PU9 B;  4M78 E;  1WLE A;  2X4X A;  2RI3 A;  2HD0 A;  4FW2 A;  3P8T A;  1PNJ A;  1O75 A;  1YN8 A;  4J6Y A;  3PE0 A;  3LSQ A;  2M1H A;  4FSX A;  2D8J A;  3EFO B;  4AMC A;  3CMQ A;  2DU5 A;  1NM7 A;  1IHW A;  2LTO A;  2K6D A;  4H02 A;  1JU5 C;  2MPX C;  2XU8 A;  4XTW A;  3EGD B;  1YIT Q;  2HSP A;  1YJ9 T;  2GTJ A;  4PJO F;  3KUF A;  1U3O A;  1WHG A;  1WJR A;  4PG3 A;  4MZM A;  4OMN A;  1HJD A;  4EIK A;  4AFU C;  1X43 A;  1PRM C;  4KUD K;  2DXB A;  3OYJ A;  2OTJ T;  3LLR A;  3C12 A;  5KCO A;  2QXF A;  2OX7 A;  4WI1 A;  3A5Y A;  4DA4 A;  3EAE A;  1CKA A;  5C6S A;  1ADY A;  2O31 A;  1E6G A;  2QTX A;  2EQU A;  2M0O A;  3CBO A;  3PTA A;  1S72 Q;  4M75 E;  5A0D A;  3NET A;  5GAN f;  3OYM A;  2DYI A;  1PC0 A;  3GNF B;  2C0T A;  2HL3 A;  5GMK e;  4H2X B;  11AS A;  3HRI A;  1D1C A;  3P8Y A;  4XEM A;  4BDY A;  2EGC A;  5KE3 A;  2OTL T;  3PCO B;  1AOJ A;  4QVD A;  2XI9 A;  1CSK A;  4ME7 A;  4II1 A;  2FRW A;  5D6X A;  1N9W A;  2MWP A;  5F5W A;  5CIU A;  1Z9Z A;  1LOJ A;  1MNE A;  3LW5 E;  5GAN 8;  1N27 A;  3PT9 A;  2ZZE A;  3JCM b;  1VQL T;  2D8H A;  2JUF A;  4F7U E;  4FT2 A;  4J6X A;  2AKW B;  3V7S A;  2CP5 A;  4C92 B;  1C0A A;  4M7D B;  1KFZ A;  1VQ5 Q;  3HFZ A;  2CP6 A;  4F16 A;  4HWO A;  4Y91 A;  1UE9 A;  2LDM A;  3NTI A;  3JCM J;  3A8G B;  4HT9 A;  2OAW A;  3A8M B;  3X28 B;  1I0C A;  3EG0 A;  3A5Z A;  2MMP A;  2BZX A;  3L42 A;  3ICA A;  2XDB A;  1P92 A;  2RJF A;  2I4O A;  1T0J A;  2L0A A;  1LYL A;  1YI2 A;  1EX4 A;  4J9G A;  1Q86 C;  1WX6 A;  2K3Y A;  3G7Z A;  3A31 A;  4H2X A;  1X2K A;  3EFO A;  3G4S Q;  2FG0 A;  1YP5 A;  3EH1 A;  1OQK A;  4KRT A;  2E64 A;  4JRQ A;  3HRK A;  4NCX A;  1M27 C;  4FL6 A;  3SDZ A;  4M7D D;  3HY0 A;  2RHY A;  2O01 E;  5GAN 7;  3TEH A;  4KT0 E;  2O9V A;  1VQ6 Q;  1JXO A;  3CCR Q;  1ZBJ A;  3G6E Q;  4TVY A;  1VQN A;  4E51 A;  3EG1 A;  1PKS A;  2E3H A;  1USY C;  1WHK A;  2W10 A;  1WHM A;  4EMK A;  5CKB A;  4OMQ A;  2Y4X A;  4HT4 A;  2LT4 A;  1M8V A;  4KUI A;  2PZ1 A;  1G3Y A;  4E7H A;  1QE0 A;  4M7D G;  3VS4 A;  3V8J A;  5FU7 C;  3HP9 A;  4OML A;  1H4S A;  4IIO A;  2ENM A;  1RAI B;  4RDX A;  1RAB B;  2V8J A;  1RAG B;  1IO6 A;  2COW A;  2ARU A;  5KH6 A;  1YJW Q;  1YJW A;  2OTL Q;  4E7J A;  2DM1 A;  4KBM B;  4BE2 A;  3EFR A;  4B6M A;  1NE8 A;  3ULR B;  1QVF S;  1YGB A;  2IY5 B;  3VQY A;  3OB9 A;  2ARS A;  4BI4 A;  1X69 A;  2IG0 A;  1M2V A;  4LD9 K;  1RLQ C;  2ESW A;  2RI5 A;  3QO5 A;  3TEH B;  3NHN A;  2QQR A;  1QKW A;  2AMC A;  3RNJ A;  3PMT A;  3SWN B;  4WJ4 A;  1LVK A;  4H2Y A;  3HTR A;  3CMA T;  3OS5 A;  3CC2 A;  3VRY A;  3OYG A;  5DLQ E;  3WXM B;  4EMG A;  2RF0 A;  3CCM T;  4F7U B;  2EKH A;  1OU8 A;  3M55 A;  2KDS A;  5KYW B;  2ZPB B;  5GAN h;  2D0N A;  1KC8 R;  3I55 T;  1YNZ A;  1PWT A;  1KD1 R;  1KQ1 A;  1BK2 A;  1UGR B;  1GCQ C;  2LQ8 A;  2FEI A;  4E2F B;  1NEB A;  4HXJ A;  1D1B A;  1ZSZ A;  1XQH A;  2HQE A;  4RTT A;  3RR6 A;  1D0X A;  4JRP A;  2OTJ A;  2KNB B;  1QVG A;  2P84 A;  2ZNI A;  1D3B B;  3MQZ A;  2ZTG A;  1K8A C;  1YFT A;  2R5M A;  2D6F A;  4GY5 A;  1KD1 C;  1Y0M A;  2FYK A;  4C8Q B;  2DIQ A;  3NEM A;  3OYL A;  2ZT5 A;  2KMT A;  3NMZ C;  2COY A;  3EH2 A;  2Q5I A;  1OYX A;  2E10 A;  2KXD A;  2YDL A;  4CS4 A;  3JCM c;  2KRM A;  1MMA A;  2DMO A;  1Y96 B;  3THK A;  1WYD A;  2CZ6 B;  1K73 R;  1SSH A;  1M1K R;  2J7I A;  2CDT A;  4YRC A;  2NUP B;  2EFI A;  1O9S A;  4WJ3 M;  4H2S A;  5L23 A;  2LJ0 A;  3CCL A;  1YJN A;  4M75 A;  1TS9 A;  2QI2 A;  3A1P A;  1YB3 A;  5CKD A;  4Z02 A;  4R56 A;  2NUZ A;  2ZIM A;  3MET A;  2KVQ G;  2V26 A;  3V7R A;  1VQN T;  3EGD A;  3HTZ A;  1YJW T;  2YUQ A;  3OYC A;  1N9S A;  2J6O A;  4RQF A;  2MIO A;  4ORZ A;  2O9S A;  4J9D A;  1W4S A;  3G71 Q;  3MCA B;  3MF2 A;  5C53 B;  1OZ2 A;  3A74 A;  4PNO A;  2QTV A;  3A8O B;  2KXC A;  3RDV A;  2A7Y A;  1M2O A;  3CPW P;  5IT9 E;  1UEB A;  2DX1 A;  3EGU A;  4NL2 A;  3NEN A;  4N4G A;  1NJI R;  3TVT A;  2FHD A;  1WXU A;  3URG A;  2RJD A;  1GRI A;  4OB1 B;  3I7F A;  2PUK B;  1TG0 A;  1VQM T;  4Q15 A;  3VBB A;  2RK2 A;  1VYU A;  1VUB A;  4JUV A;  2C8M A;  5L8R E;  3JB9 I;  4M77 A;  4FYV B;  1TU0 B;  4C8Q D;  4KUL A;  4GBQ A;  1H3H A;  4HWP A;  2D0Q B;  4YP0 A;  2RHQ B;  2DO3 A;  4WF2 A;  1SEM A;  1WZO A;  1YJ9 Q;  1ZUY A;  5GAM e;  5KYN A;  3CCE Q;  3HFN A;  2CJ9 A;  4JZ4 A;  4HWT A;  1E1T A;  3VU3 C;  1QQJ A;  1X6B A;  2PVD B;  3M0T A;  1Y96 A;  2FPE A;  1XOV A;  4A4F A;  3ZFJ A;  2NYS A;  3GBQ A;  1NJ2 A;  4JJN K;  1N9R A;  2RMO A;  3M4Y A;  5EC7 A;  2F5K A;  3NEL A;  1Y57 A;  2E65 A;  4A63 B;  3VQV A;  4QVZ A;  2EYZ A;  1HD3 A;  2XDP A;  1K1Z A;  4EO4 A;  3PGG A;  1I8F A;  1M5Q 1;  3DKM A;  3QBY A;  3OYB A;  1B07 A;  1OZ3 A;  3REX A;  4IKF A;  4M4Z A;  4MZP A;  2L89 A;  2BTT A;  4QVC A;  4L59 A;  1YIJ T;  4FCY A;  3QDF A;  2KYM A;  3M0U A;  2JJ9 A;  4XTX A;  1Y07 A;  2OJ2 A;  1X6G A;  2DL7 A;  4D8D A;  1RLP C;  1MUZ A;  3HXW A;  3EHR A;  4ZNX A;  1AZG B;  1ZUK A;  4XTU A;  3SEM A;  4J6W A;  4X9C A;  4RKU E;  3JCM V;  1K4U S;  2KAF A;  2P5I A;  4OMM A;  4TWA A;  2VB6 A;  3I56 Q;  4PHC A;  1RAC B;  3OBY A;  5CKF A;  3G71 T;  3EHQ A;  2RNA A;  2K9G A;  1SKU B;  2F2V A;  1EIY B;  4K88 A;  1BKB A;  1J3T A;  2DL5 A;  4LVM A;  3P8H A;  1MHN A;  2RD1 A;  5IXF A;  2GBQ A;  3OA6 A;  2ZZD A;  5LJ5 f;  2KK4 A;  2KQW A;  4PJO G;  5LJ5 h;  4MZT A;  3SWN C;  4OB2 B;  1OI1 A;  4JRK A;  2KRN A;  4O6J A;  3CCV Q;  2L3P A;  4MMK A;  4FIB A;  1Z7M A;  3FIF A;  4Z89 A;  2YLB A;  3S6W A;  4Y92 A;  1NG2 A;  3CC4 Q;  3G6E T;  2DNU A;  1FXX A;  1OU9 A;  1N8R C;  4Y28 E;  3GPL A;  2LJ3 A;  4JJB A;  3X20 B;  1NEG A;  4A4E A;  3CC4 T;  4IUU A;  4M77 E;  2ZCE A;  3N5B B;  3PNW C;  3NGP A;  5CKE A;  4BY6 C;  4YRS A;  5KYX A;  2MYS A;  2A3L A;  4ZN3 A;  4PK4 A;  1W6X A;  5HCK A;  1PYS B;  1BI3 A;  3L4G B;  1WYX A;  1KG1 A;  2QGF B;  4AG1 C;  3E9I A;  1WXT A;  1Q7Y C;  4Q6G A;  3H0H A;  4DPG A;  5AYF A;  1ADJ A;  1D0Z A;  4YRN A;  1KC8 U;  5CO7 A;  2CSQ A;  2ED0 A;  1K9A A;  2QK0 A;  4J9B A;  4BI8 B;  4M7A B;  3GNG A;  2ZXF A;  1Q7Y R;  1ACM B;  1VQP A;  1VQK Q;  3QPH A;  4CH4 A;  1D1A A;  2KI7 A;  3DSQ A;  3CPF A;  4OGE A;  3OYN A;  4WTO B;  1I5L A;  3QUI A;  1KQ2 A;  4ATO A;  4IUQ A;  2WAC A;  1I81 A;  2MOX A;  1VQL Q;  2CJA A;  4RMO A;  2JM8 A;  1HK9 A;  1T3S A;  3VYH B;  2AKW A;  2DEQ A;  4ELY C;  4HWS A;  4C92 G;  3JCM P;  1YHQ A;  1SER A;  2K5F A;  2D9T A;  2LCS A;  4IUV A;  3E2U A;  4HVV A;  5FLX E;  2C7I A;  1YFN A;  3CBP A;  4P74 C;  3REA B;  1VQ5 A;  1PYS A;  3UGQ A;  2WSF E;  1WFW A;  1E6H A;  3CCJ T;  1VQ9 A;  1G51 A;  4P72 A;  4P3N A;  1K9M R;  1WPY A;  3JB9 H;  1M9S A;  3FLG A;  2J3M A;  3M56 A;  1QLY A;  2VC8 A;  3OYF A;  3VS1 A;  2GFU A;  4LNS A;  4YRK A;  1Q7Y U;  3VUZ A;  3L1A A;  2E6N A;  4YRI A;  3CPW S;  2JZ2 A;  2CZ0 B;  3I55 Q;  2HBW A;  1FYN A;  2A36 A;  5IXB A;  2VGN A;  4V2S A;  1I07 A;  1JJC A;  1ZBX A;  1KSW A;  2WSC E;  3G71 A;  4M78 G;  4E7Z A;  5GAN 5;  1KQS A;  4YDQ A;  3GIB A;  2ZGW A;  2LQW A;  1K0X A;  1W70 A;  5C0M A;  3MKD A;  2XD0 A;  2MI6 A;  1BI0 A;  2F2X A;  5EG2 A;  1V1C A;  1E7O A;  3L4G A;  5KYY A;  2VXE A;  3KFU A;  4HKE A;  4CS2 A;  4MDW A;  2JTF A;  1N8R U;  3RKX A;  4KGZ B;  2GTO A;  3INZ A;  2ZCF B;  3JB9 G;  2FVU A;  1QW1 A;  2G3R A;  2NLU A;  5GAO n;  2EKO A;  3M54 A;  2XID A;  1ZA2 B;  4C5E A;  2A37 A;  4OGC A;  1NJI U;  1G5V A;  2ODR C;  2OI3 A;  2WSE E;  1N5Z A;  4XTZ A;  5GAM d;  4H2T A;  4ZTU B;  2GFA A;  2K3B A;  2ZPF B;  4ZGD B;  4ZGE B;  1VQO Q;  1YIJ A;  4PFP A;  2HKQ B;  5IH2 A;  2VAS A;  3HRS A;  2RA2 A;  2X4J A;  4C0D B;  2RHU A;  1X75 C;  3BFM A;  4J7I A;  4LN2 A;  5GAN 6;  3OW2 A;  2DE0 X;  3OW2 S;  2NS6 A;  2DJZ A;  4E6R A;  1JJ2 S;  1I4K 1;  3M4Q A;  3G4S A;  4M77 C;  8AT1 B;  2AIR B;  5GAO r;  4DEY A;  4YTL A;  4MDX A;  3FJ5 A;  2GQV A;  2J05 A;  3QXE B;  4LVK A;  4RCB A;  3U23 A;  2RQV A;  2CZ7 B;  4N4H A;  3OSV A;  4YRQ A;  4M7D C;  4L87 A;  1OV3 A;  2DZ9 A;  1OX8 A;  3I56 T;  5A0G A;  1H4Q A;  2O4X B;  2RHX A;  3VS3 A;  3NTH A;  4F17 A;  3A8L B;  1D09 B;  3G1J A;  4AG2 C;  5LJ5 d;  2HSE B;  3NFC A;  2R58 A;  2EWN A;  1I5O B;  2HZY A;  4HCK A;  5LJ3 j;  1C1A A;  2K2M A;  1M1K U;  5FU6 C;  5FWB A;  3RIR A;  4D8K A;  4LVJ A;  4LUE A;  1G3T A;  2EIF A;  2Q7G A;  1VQ8 A;  2DKG A;  4KH0 B;  2EQK A;  2W0Z A;  4UP7 A;  3FEO A;  5J39 A;  1VQO T;  5HK0 A;  5K1X A;  5KYW A;  3G6E A;  3CCJ A;  1UEC A;  3VV0 A;  4E7K A;  2JNG A;  3CC7 T;  4B9X A;  3TUP A;  3CCU A;  1X55 A;  3RF1 A;  1D0Y A;  4RTZ A;  1VQ4 A;  1TH7 A;  1E1O A;  8ATC B;  5ELO A;  5C51 B;  3HRT A;  1PKT A;  4M7A F;  1PHT A;  3E19 A;  3HL8 A;  1SPK A;  2QG9 B;  4Z8A A;  1BBW A;  1AWJ A;  1J5W A;  1VQK T;  4L6V 5;  3CC2 T;  4YCW A;  3CXC A;  3RGL A;  2QHV A;  1MGQ A;  1VQ5 T;  1B7T A;  2YRD A;  3TEE A;  1H8K A;  3JV3 A;  2C0I A;  3HFZ B;  3PFS A;  2I2L A;  3I55 A;  2JXB A;  3OD1 A;  1JQQ A;  2O4X A;  3CCU Q;  3JCM h;  1UGV A;  2V8I A;  1G5H A;  3C0C A;  4XQ3 A;  3L2Z A;  1AWX A;  3QZ5 B;  4JZ3 A;  1VQP T;  4UC4 A;  3M59 A;  2DIL A;  1OX9 A;  2EJG A;  2GF7 A;  2JW4 A;  1IGU A;  5GAN j;  2EGE A;  5GAO l;  1M1K C;  4LVI A;  4A4G A;  1HC7 A;  4C0G A;  2IVW A;  4PL6 A;  1XTD A;  3BW1 A;  3TU4 K;  1M8M A;  5D7U A;  3SB2 A;  4P3O A;  1JXM A;  2JMA A;  1QWF A;  4BD3 A;  3CME A;  4X1V A;  2DYB A;  3CD6 Q;  4QT7 A;  3OYD A;  3OYK A;  2QGG A;  3TRE A;  1X2Q A;  1H3Z A;  4N0A A;  3L2Q A;  1K8A R;  3BDU A;  3A7R A;  5DY9 A;  1NJ8 A;  1X27 A;  4P73 A;  1UTI A;  3MEA A;  3P8V A;  3O5Z A;  2L3S A;  4P71 C;  2DDZ A;  3LH0 A;  2K7A A;  1YI2 T;  2RJE A;  2LP5 A;  2M0Y A;  1SF9 A;  3S3O A;  1VQ8 Q;  1NYR A;  4X34 A;  4RMF A;  5GMK i;  2JOY A;  5KYU A;  4C8Q F;  3PMI A;  1U8R A;  3H0I A;  4ZIB A;  1SHG A;  2L3R A;  2ZT8 A;  4LNP A;  1UJY A;  3CME Q;  1KQS S;  1BI1 A;  3UFG A;  2E12 A;  3M0Q A;  5CQY A;  3QO8 A;  2QHT A;  5LJ5 g;  1V76 A;  2RK1 A;  3OQ5 A;  1MMN A;  1NPP A;  1UGS B;  2A8E A;  1V29 B;  1WA7 A;  1IL2 A;  2KT1 A;  1RAE B;  2RQT A;  2J3L A;  3TEG A;  2ZAE A;  1UGQ B;  1HXD A;  1JJ2 A;  2EYW A;  4PFO A;  3OMG A;  1NLP C;  2I4N A;  2O88 A;  5KE2 A;  1T0H A;  1N6A A;  2DEU A;  1TUG B;  1JEG A;  4TVW A;  1VQ7 Q;  4CS3 A;  1AWW A;  1SSF A;  2L5Q A;  4UP8 A;  2CGH A;  3SWN A;  5GAO p;  2CJB A;  2RM4 A;  2GGR A;  1IXD A;  4ZGJ B;  4EX5 A;  7AT1 B;  3MJX A;  4C8Q G;  2KR3 A;  3CC7 A;  2D1X A;  4A54 A;  3D7S B;  3A32 A;  1TXQ A;  2LT1 A;  2H3J A;  3BE3 A;  4BWA A;  2P4R A;  2RN8 A;  3J7A F;  1GBR A;  2EGA A;  1U06 A;  1WHH A;  4YRJ A;  2DPP B;  5GAM f;  2V8K A;  2JN0 A;  2Q5H A;  2E5K A;  1Q82 U;  1TSF A;  3WVD B;  1GXI E;  1QVP A;  1W2B A;  4HA8 A;  1KMM A;  5KCH A;  1B70 A;  1Z7N A;  1RL2 A;  3H8Z A;  3KFV A;  1BIA A;  5CVI A;  3SD4 A;  4KGV B;  1AWO A;  1NYF A;  2XK0 A;  3LYI A;  4QQD A;  1UHC A;  1S1N A;  4O2D A;  2HKN A;  4C92 A;  3PIO A;  1U5S A;  2HQH A;  3LC0 A;  1QVF A;  3TQ7 P;  4HT8 A;  3I5S A;  4IUT A;  4TTV A;  3RMS A;  1VOM A;  1NNH A;  3MEY A;  2ZPI B;  2H3E B;  4RG8 A;  1YFS A;  2CP0 A;  3UAT A;  2K4Y A;  4GLK A;  3L2U A;  2MWO A;  4LDX A;  4LDW A;  1SRY A;  3CCU T;  2L3Q A;  4LDV A;  2P0P A;  3SHW A;  4XU3 A;  4CRI A;  4AFQ C;  1ATI A;  1IHV A;  1QCO A;  2LC4 A;  3E1S A;  2ZPH B;  4XU2 A;  4CC4 B;  4M75 B;  1WQ7 A;  5LJ3 g;  1QP3 A;  1H4T A;  1Q82 R;  2EQI A;  3HFV A;  4O5V A;  1WHJ A;  1H92 A;  4X5O A;  1ZX6 A;  4Q5W A;  2EL9 A;  2K5L A;  2FRY A;  2RHZ A;  4ZTF A;  1BIB A;  3UF4 A;  4BAC A;  4M75 F;  1YIT T;  2DL8 A;  1NZ9 A;  4FSS A;  2KSS A;  1QVG P;  4M7D A;  4PJN A;  3VQW A;  3VUB A;  1B7Y A;  2DD5 A;  2CYZ B;  6AT1 B;  2DTO A;  2M51 A;  1AHJ B;  3CMA Q;  3QKJ A;  2F5T X;  1VQM A;  1QVG S;  1NYG A;  1VYV A;  2DJQ A;  2NUT B;  4C0Z A;  3VQX A;  3IAL A;  1VQ6 A;  4JJD A;  1IZ6 A;  3MP8 A;  5AT1 B;  2R5A A;  4K87 A;  3C95 A;  1K9M U;  3AHU A;  2GCX A;  2H8H A;  3ZL7 C;  4NOY A;  4CI0 C;  1G3S A;  5K1P A;  4ZN1 A;  3QII A;  2RQU A;  2DL3 A;  1QMC A;  4TVA B;  4RTV A;  3WQZ A;  2RJC A;  3ASK A;  2LVM A;  2PUO B;  3CME T;  2JTE A;  1JRI A;  4PJO C;  2MAM A;  3W3S A;  2OAU A;  3EG9 A;  1M3A A;  2DXU A;  3JCM Q;  3CCV A;  3M0S A;  2IY5 A;  1PG5 B;  2RH2 A;  4CC2 A;  5LJ3 f;  2GQI A;  3I56 A;  4FT4 A;  4YRO A;  2E1H A;  2YRV A;  3H9N A;  1B3Q A;  2LZ6 B;  3IQL A;  4ESR A;  3MHX A;  3R07 A;  4JRI A;  3CC2 Q;  3RKW A;  4AFS C;  3GLX A;  4YRT A;  3CQT A;  2DZC A;  3DLM A;  4RCC A;  1N8R R;  2YXY A;  3UA6 A;  4PFZ A;  3OY9 A;  4P5N A;  5IHN A;  3CCQ A;  1AEY A;  1X6O A;  3PIP A;  1M30 A;  3QWY A;  4M75 C;  2FZG B;  4BE0 A;  2YLC A;  2K5I A;  4F7U A;  1YWP A;  2ECZ A;  1UB4 A;  1M3B A;  4YRE A;  3FDR A;  1X56 A;  1B76 A;  3RUX A;  4DBH A;  4F7U F;  1FMV A;  4P75 A;  1VQP Q;  1T3L A;  1VQK A;  4YRL A;  1YFR A;  2KRO A;  4DEX A;  5D6Y A;  2HCK A;  2BE9 B;  4XU1 A;  2FZK B;  1KJW A;  4A4H A;  5LJ5 e;  5A2Q E;  3P8D A;  2AMC B;  2DK3 A;  1B7Y B;  1AVZ C;  3TSZ A;  3VS7 A;  3OS1 A;  2EQM A;  1ABQ A;  2CS7 A;  2M16 A;  4HVU A;  4M75 D;  4BE1 A;  2X9H A;  4C8Q A;  2KYB A;  4YYE A;  4XEO A;  1BYM A;  4YRF A;  3CXC S;  2KY9 A;  3QG1 A;  2PNI A;  1ASY A;  2DBM A;  3IKM B;  2QQS A;  1W66 A;  5KYY B;  2JTM A;  1WXB A;  3EGX B;  4RTX A;  4XTV A;  4P71 A;  2LRQ A;  3V8K A;  2YUP A;  1BI2 A;  3C94 A;  4QKU A;  1RAH B;  3LWH A;  3CCJ Q;  1H4V B;  2QQ9 A;  2SRC A;  3UGT A;  1EIY A;  1BBU A;  4M77 G;  4C0F A;  1Q81 R;  2FL7 A;  4RTY A;  4CC7 A;  1OOT A;  1TWB A;  4A4K A;  2J06 A;  4YCU A;  4L5G A;  1EIF A;  1RI9 A;  1A0N B;  5GAN e;  2C0O A;  1IB8 A;  1D3B A;  3CD6 T;  2QA4 Q;  5GAM j;  1SHF A;  2RI2 A;  2HBP A;  4YRM A;  2M9U A;  2ED1 A;  3CCR T;  1NBE B;  4ANJ A;  4YPF A;  2KRS A;  1VQ9 Q;  3E9H A;  3RAC A;  3JCM f;  4LUD A;  1K9M C;  3I5R A;  5I21 A;  5FU6 B;  1LNX A;  3JB9 J;  3G1Z A;  1X54 A;  1NJ5 A;  1MND A;  2CRE A;  2A08 A;  4JS5 A;  4PJO E;  2YUN A;  1HYO A;  1M90 C;  3J80 E;  4DBF A;  3CBM A;  2I0N A;  4LDY A;  2QDY B;  4OF1 A;  4DOW A;  2RQW A;  3UH0 A;  4HCZ A;  1NJ1 A;  5J3B A;  3OBW A;  3GOX A;  1RAA B;  4NS5 A;  2HQX A;  1WI7 A;  1JB0 E;  3AT1 B;  1R0B G;  1VQN Q;  4FM4 B;  4J9E A;  2AKK A;  5GAO q;  1NJI C;  3L2V A;  5E3I A;  5CR2 A;  5CAI A;  3IKL A;  4IUP A;  3MEW A;  2QQA A;  3HXY A;  2VUB A;  3CCL T;  2LQK A;  4H2V A;  2QAS A;  1B34 A;  4OB0 B;  4R55 A;  1WJS A;  1YWO A;  2AZV A;  3QYH B;  4F04 B;  3A8H B;  2K3X A;  4EMK B;  5GAN g;  2ABL A;  4YRR A;  3CCQ T;  2DRK A;  4P72 C;  4R0K A;  4YRG A;  2X35 A;  3DB3 A;  3NTK A;  1B8A A;  2F2W A;  4PLL A;  1WGS A;  3HXZ A;  4P74 A;  3UA7 A;  1PSF A;  1K76 A;  1USY A;  3VYG A;  2RHI A;  1M90 R;  1UDL A;  3OYA A;  2DVE A;  4M77 F;  2R57 A;  1VQ4 T;  1OPL A;  2EW3 A;  4EDU A;  2Q7E A;  4K11 A;  1EZZ B;  2RO0 A;  3RES A;  2ZIO A;  3KBG A;  4PJL A;  3VS5 A;  3HHT B;  4BDZ A;  2JVV A;  4M7D F;  4PJO A;  5LL6 S;  2MCN A;  2LNH B;  1ZLM A;  2L8D A;  4OVA A;  4M7A C;  4UPA A;  1K73 C;  1YBY A;  2ZPG B;  5LJ5 j;  5HKC A;  4C92 D;  1PD1 A;  2DF6 A;  1LPL A;  1Q82 C;  4C92 E;  1JBM A;  1YCS B;  4PJJ A;  1ZSZ B;  1BB9 A;  3M58 A;  3JAM E;  1YHQ T;  1SET A;  1R8O B;  1VA7 A;  4EPC A;  2AKL A;  2KEA A;  2YHT A;  2XKO C;  1EVK A;  1OPK A;  1Y7X A;  3S3M A;  3E9F A;  2FZC B;  5J26 A;  1R77 A;  3QHS A;  1E24 A;  3RBB B;  1VQ9 T;  2QAZ A;  4AH6 A;  4M77 D;  5GAM h;  5GJW B;  3A98 A;  3IG2 A;  2KE9 A;  2EYX A;  3LH5 A;  4G84 A;  2VXF A;  4J9F A;  3M4P A;  2M02 A;  2LNV A;  1WLP B;  1KC8 C;  4EMK C;  4C5G A;  1I1J A;  1PRL C;  4RQE A;  2V1R A;  2P0Q A;  5I11 A;  1LJO A;  2X3X D;  2JMC A;  1UG1 A;  3MP1 A;  3CCS T;  1YHQ Q;  4DOV A;  3EG2 A;  2XG8 D;  1Z9Q A;  2YRC A;  1B34 B;  2BIV A;  4BI3 A;  4CC3 A;  3CCL Q;  2ZZG A;  2PTK A;  3MO8 A;  3QZ9 B;  4IIM A;  3OS2 A;  1PD0 A;  2K2V A;  3VJP A;  2PVO B;  2HDA A;  2HMA A;  3WVE B;  3L2W A;  4C5I A;  3CPW A;  1RAF B;  2XTI A;  1TTH B;  4YRP A;  5KYX B;  3M57 A;  2CP2 A;  3PZC A;  1VQO A;  1G8X A;  4KGX B;  1KMN A;  2DXT A;  3QYG B;  2DLP A;  4J5Y A;  1ZHI A;  1H64 1;  1MMD A;  3OYY A;  4PJM A;  2P4T A;  2K79 A;  3QNE A;  3MEU A;  5CCA A;  3G4S T;  3CCV T;  1WU7 A;  1U1T A;  1KHI A;  1GCQ A;  1GCP A;  2QDL A;  3TCJ A;  2L2P A;  2O2O A;  3DLL A;  12AS A;  1RI0 A;  3JCM W;  2BZY A;  1M3C A;  2ZR3 A;  2VV5 A;  2FB7 A;  1AT1 B;  4C8Q C;  4J8O A;  2LQN A;  3M4G A;  4FU6 A;  1X2H A;  1SES A;  2DTH A;  2NWM A;  3JCM d;  3PVQ A;  5CKH A;  4M7A E;  4RTU A;  5GAM g;  5GMK h;  1M1F A;  3EGX A;  1YJ9 A;  2B8A A;  3FC3 A;  2E6Z A;  1HSQ A;  3QJY A;  3F70 A;  2OTJ Q;  5C52 B;  4HCB A;  1YI2 Q;  3MPU B;  2EAY A;  1BCM A;  4G85 A;  3DB4 A;  4B9W A;  1VQ4 Q;  3BDL A;  3FB9 A;  1WIE A;  2KBT A;  3M9Q A;  3FJP A;  3QJ6 A;  2E70 A;  4M77 B;  1HTT A;  4C0D C;  4KR3 A;  1EOV A;  1UFF A;  3JCM X;  3I9Q A;  4KH1 B;  4TVR A;  2SEM A;  1G5I A;  3CEY A;  2RHQ A;  1QKX A;  2E5Q A;  3P8B B;  1ZA1 B;  4MML A;  3OYI A;  3LGL A;  1K0S A;  1ZUU A;  1QWE A;  1XJW B;  1U1S A;  3LX7 A;  4M78 B;  2FO0 A;  5A0L A;  4OLF A;  4J9C A;  2YUO A;  2Y90 A;  4CH6 A;  2E4H A;  4RUG A;  3CXC P;  2IIM A;  4EMH A;  3H6Z A;  5GMK m;  1UHF A;  4M78 F;  2ROT A;  2RHS B;  1EQR A;  2J6K A;  3OYE A;  1G3W A;  2QYZ A;  2DAQ A;  3ME9 A;  2VKN A;  2NUT A;  4RG2 A;  4LVL A;  1UJ0 A;  2E41 A;  2FPD A;  5FWC A;  5DLO A;  2ZR2 A;  2XHC A;  1GGM A;  4OMO A;  3OYH A;  4PLI A;  5IN1 A;  2E3C A;  4QQG A;  5IHK A;  5HK3 A;  4BW9 A;  4GLM A;  5IAY A;  3UDC A;  1YJN Q;  1YIT A;  2GNC A;  2Y4Y A;  3X25 B;  1BCO A;  4LD6 A;  3CCM A;  3CC4 A;  3EG9 B;  1KHC A;  5GAN d;  2DBK A;  5GMK l;  1WDX A;  2AZS A;  2X4W A;  2CP7 A;  5DM7 R;  1IGQ A;  3CCE A;  2XMF A;  4NL3 A;  1PSE A;  2COZ A;  4C92 F;  3V7C A;  3VS6 A;  1FMK A;  4P3P A;  2VWF A;  2JS0 A;  2QEX Q;  1Q86 U;  3CCQ Q;  2YWW A;  2A28 A;  3A7A A;  2CH4 A;  3QWX X;  1C0M A;  2EYQ A;  4DQ2 A;  2YT6 A;  5LJ3 d;  2ODR D;  2ZNJ A;  1MV0 B;  3I35 A;  2RHS A;  4N0A C;  1XNI A;  2G6F X;  1M90 U;  1GFD A;  2RPN A;  1PM3 A;  3GF5 A;  2QHS A;  1Y71 A;  2VYT A;  3KXT A;  2JT4 A;  3Q1J A;  1FWZ A;  3REB B;  2F69 A;  4HVC A;  1BU1 A;  2C06 A;  5I22 A;  1S72 T;  3CCS A;  1KIK A;  2P0K A;  1GBQ A;  2ZT6 A;  2DRM A;  1IRX A;  1Q81 U;  4N4I A;  2DXC A;  5IHI A;  1WHL A;  2QA4 A;  2BE7 D;  3RER A;  5GAN 3;  3LWI A;  2HEQ A;  2G4C A;  3OSS C;  1DJ7 B;  2E5A A;  2XGT A;  4J15 A;  3JB9 D;  5HY6 A;  5FRO A;  4IUR A;  1KK7 A;  5I2M A;  1QP2 A;  1JJ2 P;  3HXU A;  3VRZ A;  1GFC A;  1NPR A;  3FRN A;  4RTW A;  2CT4 A;  3J81 E;  4PJO D;  2HAX A;  1RAD B;  5ELN A;  4E7L A;  3GP8 A;  1K8A U;  4E7I A;  2JS2 A;  5LJ3 h;  3JB9 F;  1SRL A;  1VIE A;  3H41 A;  1TOV A;  2AHJ B;  2ZPE B;  2RB6 A;  2DU7 A;  5CK9 A;  3REU A;  2ROL A;  4P75 C;  4FYW B;  2ZIN A;  4J7F A;  4KQE A;  2V1Q A;  2X51 A;  2PMF A;  4C5H A;  3HSB A;  2DTI A;  4M7A A;  1E22 A;  2ATC B;  1C6V X;  1PCX A;  5GJV B;  3R6O A;  2HNI A;  5FU7 B;  2PVG B;  1R0C B;  4H2U A;  1X2G A;  2X3W D;  1VQ7 A;  3O8V A;  4J9H A; 
#chains in the Genus database with same CATH homology
 2PQW A;  1KOG A;  4QQ6 A;  2DD4 A;  4ELZ C;  4XK8 E;  4OMF B;  3CCE T;  2EQJ A;  4E47 A;  2ALY B;  1FX7 A;  3HXX A;  3LSS A;  1VQ6 T;  4ZTZ B;  1YCY A;  2I4M A;  1FYF A;  1IRE B;  3RL6 A;  3VKI A;  2QEX A;  3QDR B;  4M78 C;  5HGQ A;  2CIM A;  2LX9 A;  2LCL A;  3CD6 A;  1EVL A;  1Q81 C;  3E9G A;  1UGP B;  3JCM e;  4M7A G;  4ZTJ A;  4XU0 A;  1JJC B;  2EJ9 A;  3MF1 A;  1W2B S;  2QA4 T;  4M75 G;  3UWN A;  3A7U A;  2BKD N;  4A53 A;  3C4S A;  3ER0 A;  2X4Y A;  4M7A D;  1VQ8 T;  4X9D A;  3QSU A;  2XDD A;  4C92 C;  3HY1 A;  3HPW A;  4JS4 A;  3BY7 A;  5GAN 4;  5GMK j;  1M4Z A;  4XTY A;  4F7U G;  3EFS A;  2Q7H A;  3HFO A;  1KD1 U;  2VGM A;  4C8Q E;  4PKC C;  3OS0 A;  3V8L A;  3QO7 A;  3BJU A;  3ZBD A;  1X01 A;  4PJO B;  5FRM A;  4OP0 A;  4M78 A;  3JRZ A;  5GAN 2;  2QQB A;  3JCM g;  3HKS A;  1VQ7 T;  2PME A;  5GAO m;  4KR2 A;  5D6W A;  2ALY A;  4K86 A;  3HXV A;  3HRU A;  2DQ3 A;  2K57 A;  5KNN A;  4H2W A;  4JLG A;  2XIC A;  5I2S A;  3QO3 A;  1S72 A;  2CZ1 B;  1K73 U;  2ZT7 A;  3CMA A;  1NJ6 A;  4TQF A;  3JSC A;  4D6W A;  3SFM A;  4CH5 A;  3LGF A;  4HWR A;  4J83 A;  3CCR A;  4XAX B;  4BB7 A;  3UPU A;  4QW2 A;  3RMQ A;  1B70 B;  2QHU A;  4M7D E;  4M78 D;  3UT1 A;  4VUB A;  2OTL A;  1NYQ A;  3T9N A;  4JLI A;  1WJQ A;  2P0L A;  2CKK A;  4CH3 A;  5M9O A;  3ZEH A;  5CQX A;  1VIF A;  2DQ0 A;  4JDS A;  4OB3 B;  3M53 A;  3ERR A;  2EJF A;  1M1G A;  1QF6 A;  2BUD A;  5LJ3 e;  4YCV A;  4HCC A;  4BUG A;  3L2R A;  3X24 B;  3S3N A;  1L0W A;  1VQL A;  3PCO A;  4TQD A;  1WQW A;  4TVA A;  4UP9 A;  1YJN T;  2LCC A;  2I4L A;  2MF2 A;  1ASZ A;  3RKY A;  3M5A A;  2ART A;  1RIQ A;  2ZZF A;  1EFW A;  3OMC A;  3X26 B;  2QEX T;  4LDU A;  2DIG A;  4BY6 B;  1WNL A;  4P73 C;  3QTC A;  3MEV A;  1VQZ A;  3MP6 A;  3A5Z B;  1ZQ1 A;  5FRN A;  2PU9 B;  4M78 E;  1WLE A;  2X4X A;  2RI3 A;  2HD0 A;  3P8T A;  1O75 A;  4J6Y A;  3LSQ A;  2M1H A;  4FSX A;  3CMQ A;  2DU5 A;  2LTO A;  4H02 A;  4XTW A;  2XU8 A;  1YJ9 T;  4PJO F;  3KUF A;  1WJR A;  4PG3 A;  4MZM A;  4KUD K;  2DXB A;  3OYJ A;  2OTJ T;  3LLR A;  3C12 A;  4WI1 A;  2QXF A;  5KCO A;  3A5Y A;  4DA4 A;  3EAE A;  5C6S A;  1ADY A;  2QTX A;  2EQU A;  2M0O A;  3CBO A;  3PTA A;  4M75 E;  5A0D A;  3NET A;  5GAN f;  3OYM A;  3GNF B;  5GMK e;  4H2X B;  11AS A;  3HRI A;  3P8Y A;  4XEM A;  4BDY A;  5KE3 A;  2OTL T;  3PCO B;  4QVD A;  2XI9 A;  4ME7 A;  4II1 A;  5D6X A;  1N9W A;  2MWP A;  5F5W A;  5CIU A;  3LW5 E;  1LOJ A;  5GAN 8;  1N27 A;  3PT9 A;  2ZZE A;  2AKW B;  3JCM b;  1VQL T;  4F7U E;  2JUF A;  4FT2 A;  4J6X A;  3V7S A;  4C92 B;  1C0A A;  4M7D B;  3HFZ A;  4HWO A;  4Y91 A;  2LDM A;  3NTI A;  3JCM J;  3A8G B;  4HT9 A;  3A8M B;  3X28 B;  3A5Z A;  2MMP A;  3L42 A;  3ICA A;  2XDB A;  1P92 A;  2RJF A;  2I4O A;  1LYL A;  1YI2 A;  1Q86 C;  2K3Y A;  3G7Z A;  3A31 A;  4H2X A;  2E64 A;  4JRQ A;  3HRK A;  4NCX A;  4FL6 A;  3SDZ A;  4M7D D;  3HY0 A;  2RHY A;  2O01 E;  5GAN 7;  3TEH A;  4KT0 E;  4TVY A;  1VQN A;  4E51 A;  1USY C;  4EMK A;  5CKB A;  2Y4X A;  4HT4 A;  2LT4 A;  1M8V A;  4KUI A;  1G3Y A;  4E7H A;  1QE0 A;  4M7D G;  3V8J A;  5FU7 C;  3HP9 A;  1H4S A;  4RDX A;  2V8J A;  2ARU A;  5KH6 A;  1YJW A;  4E7J A;  4KBM B;  4BE2 A;  3EFR A;  1NE8 A;  1QVF S;  1YGB A;  2IY5 B;  3VQY A;  3OB9 A;  2ARS A;  4BI4 A;  2IG0 A;  4LD9 K;  2RI5 A;  3QO5 A;  3TEH B;  2QQR A;  2AMC A;  3PMT A;  3SWN B;  4WJ4 A;  4H2Y A;  3CMA T;  3OS5 A;  3CC2 A;  3OYG A;  5DLQ E;  3WXM B;  4EMG A;  3CCM T;  4F7U B;  3M55 A;  2KDS A;  2ZPB B;  5GAN h;  3I55 T;  1KQ1 A;  1UGR B;  2LQ8 A;  1XQH A;  2HQE A;  4JRP A;  2OTJ A;  1QVG A;  2ZNI A;  1D3B B;  3MQZ A;  2ZTG A;  1K8A C;  1YFT A;  2R5M A;  2D6F A;  4GY5 A;  1KD1 C;  2FYK A;  4C8Q B;  2DIQ A;  3NEM A;  3OYL A;  2ZT5 A;  2KMT A;  2Q5I A;  1OYX A;  2E10 A;  4CS4 A;  3JCM c;  1Y96 B;  1WYD A;  2CZ6 B;  4YRC A;  2EFI A;  1O9S A;  4WJ3 M;  4H2S A;  3CCL A;  1YJN A;  4M75 A;  2QI2 A;  1YB3 A;  5CKD A;  4Z02 A;  4R56 A;  2ZIM A;  3MET A;  2KVQ G;  3V7R A;  1VQN T;  3HTZ A;  1YJW T;  3OYC A;  1N9S A;  4RQF A;  1W4S A;  3MCA B;  3MF2 A;  5C53 B;  1OZ2 A;  3A74 A;  4PNO A;  3A8O B;  2A7Y A;  5IT9 E;  1UEB A;  4NL2 A;  3NEN A;  4N4G A;  2FHD A;  3URG A;  2RJD A;  4OB1 B;  3I7F A;  2PUK B;  1VQM T;  4Q15 A;  3VBB A;  2RK2 A;  1VUB A;  4JUV A;  2C8M A;  5L8R E;  3JB9 I;  4M77 A;  4C8Q D;  4KUL A;  4HWP A;  2D0Q B;  4YP0 A;  2RHQ B;  2DO3 A;  4WF2 A;  5GAM e;  3HFN A;  2CJ9 A;  4HWT A;  1E1T A;  3VU3 C;  2PVD B;  1Y96 A;  1XOV A;  4A4F A;  3ZFJ A;  1NJ2 A;  4JJN K;  1N9R A;  3M4Y A;  2F5K A;  3NEL A;  2E65 A;  3VQV A;  4QVZ A;  2XDP A;  4EO4 A;  3PGG A;  1I8F A;  1M5Q 1;  3DKM A;  3QBY A;  3OYB A;  1OZ3 A;  3REX A;  4IKF A;  4MZP A;  2L89 A;  4QVC A;  4L59 A;  1YIJ T;  4XTX A;  1Y07 A;  3HXW A;  4XTU A;  4J6W A;  4X9C A;  4RKU E;  3JCM V;  2KAF A;  2P5I A;  4TWA A;  4PHC A;  3OBY A;  5CKF A;  3G71 T;  1EIY B;  4K88 A;  1BKB A;  4LVM A;  3P8H A;  1MHN A;  2RD1 A;  3OA6 A;  2ZZD A;  5LJ5 f;  2KK4 A;  2KQW A;  4PJO G;  5LJ5 h;  4MZT A;  3SWN C;  4OB2 B;  1OI1 A;  4JRK A;  4O6J A;  4MMK A;  4FIB A;  1Z7M A;  3FIF A;  2YLB A;  3S6W A;  3G6E T;  1N8R C;  1FXX A;  4Y28 E;  3GPL A;  3X20 B;  4A4E A;  3CC4 T;  4IUU A;  4M77 E;  2ZCE A;  3N5B B;  3PNW C;  5CKE A;  4BY6 C;  4YRS A;  2A3L A;  4ZN3 A;  1PYS B;  1BI3 A;  3L4G B;  1KG1 A;  3E9I A;  1Q7Y C;  4Q6G A;  4DPG A;  5AYF A;  1ADJ A;  4YRN A;  1KC8 U;  5CO7 A;  4BI8 B;  4M7A B;  3GNG A;  2ZXF A;  1VQP A;  3QPH A;  4CH4 A;  3DSQ A;  3CPF A;  4OGE A;  3OYN A;  1I5L A;  3QUI A;  1KQ2 A;  4ATO A;  4IUQ A;  2WAC A;  1I81 A;  2CJA A;  4RMO A;  1HK9 A;  3VYH B;  2AKW A;  4HWS A;  2DEQ A;  4ELY C;  4C92 G;  3JCM P;  1YHQ A;  1SER A;  2K5F A;  2D9T A;  4IUV A;  5FLX E;  2C7I A;  3CBP A;  4P74 C;  1VQ5 A;  1PYS A;  3UGQ A;  2WSF E;  3CCJ T;  1VQ9 A;  1G51 A;  4P72 A;  4P3N A;  1WPY A;  3JB9 H;  1M9S A;  3FLG A;  2J3M A;  3M56 A;  2VC8 A;  3OYF A;  2GFU A;  4LNS A;  4YRK A;  1Q7Y U;  3VUZ A;  3L1A A;  2E6N A;  4YRI A;  3CPW S;  2JZ2 A;  2CZ0 B;  2VGN A;  4V2S A;  1JJC A;  1ZBX A;  2WSC E;  3G71 A;  4M78 G;  5GAN 5;  1KQS A;  4YDQ A;  3GIB A;  2ZGW A;  5C0M A;  2XD0 A;  2MI6 A;  1BI0 A;  5EG2 A;  3L4G A;  2VXE A;  3KFU A;  4HKE A;  4CS2 A;  2JTF A;  4MDW A;  1N8R U;  3RKX A;  3INZ A;  2ZCF B;  3JB9 G;  2FVU A;  5GAO n;  1QW1 A;  2G3R A;  2NLU A;  2EKO A;  3M54 A;  2XID A;  4C5E A;  1NJI U;  4OGC A;  1G5V A;  2ODR C;  2WSE E;  4XTZ A;  4H2T A;  5GAM d;  4ZTU B;  2GFA A;  2ZPF B;  4ZGD B;  4ZGE B;  1YIJ A;  3HRS A;  2RA2 A;  2X4J A;  4C0D B;  2RHU A;  1X75 C;  3BFM A;  4J7I A;  5GAN 6;  3OW2 A;  3OW2 S;  2NS6 A;  2DJZ A;  1JJ2 S;  1I4K 1;  3M4Q A;  3G4S A;  4M77 C;  5GAO r;  4YTL A;  4MDX A;  2GQV A;  4LVK A;  3QXE B;  4RCB A;  2CZ7 B;  4N4H A;  3OSV A;  4YRQ A;  4M7D C;  4L87 A;  2DZ9 A;  3I56 T;  5A0G A;  1H4Q A;  2O4X B;  2RHX A;  3NTH A;  3A8L B;  5LJ5 d;  3NFC A;  2R58 A;  2EWN A;  5LJ3 j;  1M1K U;  5FU6 C;  3RIR A;  4LVJ A;  1G3T A;  2EIF A;  2Q7G A;  1VQ8 A;  2DKG A;  2EQK A;  4UP7 A;  3FEO A;  5J39 A;  1VQO T;  5HK0 A;  5K1X A;  3G6E A;  3CCJ A;  3VV0 A;  4E7K A;  2JNG A;  3CC7 T;  4B9X A;  3TUP A;  3CCU A;  1X55 A;  3RF1 A;  1VQ4 A;  1TH7 A;  1E1O A;  5ELO A;  5C51 B;  3HRT A;  4M7A F;  3E19 A;  3HL8 A;  1BBW A;  1J5W A;  1VQK T;  4L6V 5;  3CC2 T;  4YCW A;  3CXC A;  3RGL A;  2QHV A;  1MGQ A;  1VQ5 T;  3TEE A;  3HFZ B;  3PFS A;  2I2L A;  3I55 A;  3OD1 A;  2O4X A;  3JCM h;  2V8I A;  1G5H A;  4XQ3 A;  3L2Z A;  3QZ5 B;  1VQP T;  4UC4 A;  3M59 A;  2GF7 A;  2EJG A;  5GAN j;  5GAO l;  1M1K C;  4LVI A;  4A4G A;  1HC7 A;  4C0G A;  2IVW A;  4PL6 A;  1XTD A;  3BW1 A;  3TU4 K;  3SB2 A;  4P3O A;  4BD3 A;  3CME A;  3OYD A;  3OYK A;  3TRE A;  1H3Z A;  4N0A A;  3L2Q A;  3BDU A;  3A7R A;  5DY9 A;  1NJ8 A;  4P73 A;  3MEA A;  3P8V A;  4P71 C;  2DDZ A;  3LH0 A;  1YI2 T;  2RJE A;  1NYR A;  4RMF A;  3S3O A;  4X34 A;  5GMK i;  2JOY A;  4C8Q F;  3PMI A;  1U8R A;  4ZIB A;  2L3R A;  2ZT8 A;  1KQS S;  1BI1 A;  3UFG A;  2E12 A;  5CQY A;  3QO8 A;  2QHT A;  5LJ5 g;  2RK1 A;  3OQ5 A;  1NPP A;  2A8E A;  1UGS B;  1V29 B;  1IL2 A;  2J3L A;  3TEG A;  1UGQ B;  1HXD A;  1JJ2 A;  3OMG A;  2I4N A;  5KE2 A;  1N6A A;  4TVW A;  4CS3 A;  1SSF A;  2L5Q A;  4UP8 A;  2CGH A;  3SWN A;  5GAO p;  2CJB A;  2RM4 A;  4ZGJ B;  4EX5 A;  4C8Q G;  3CC7 A;  4A54 A;  3A32 A;  2LT1 A;  2H3J A;  4BWA A;  3J7A F;  4YRJ A;  2DPP B;  5GAM f;  2V8K A;  2JN0 A;  2Q5H A;  1Q82 U;  3WVD B;  1GXI E;  1QVP A;  1W2B A;  4HA8 A;  1KMM A;  5KCH A;  1B70 A;  1Z7N A;  1RL2 A;  3H8Z A;  1BIA A;  5CVI A;  3SD4 A;  2XK0 A;  3LYI A;  4QQD A;  4O2D A;  4C92 A;  3PIO A;  3LC0 A;  1QVF A;  4HT8 A;  4IUT A;  4TTV A;  3RMS A;  1NNH A;  3MEY A;  2ZPI B;  4RG8 A;  1YFS A;  2K4Y A;  4GLK A;  3L2U A;  2MWO A;  4LDX A;  4LDW A;  1SRY A;  3CCU T;  4LDV A;  2P0P A;  4XU3 A;  4CRI A;  1ATI A;  2LC4 A;  3E1S A;  2ZPH B;  4XU2 A;  4M75 B;  1WQ7 A;  5LJ3 g;  1QP3 A;  1H4T A;  3HFV A;  4O5V A;  4X5O A;  2EL9 A;  4Q5W A;  2K5L A;  2RHZ A;  4ZTF A;  1BIB A;  4BAC A;  4M75 F;  1YIT T;  1NZ9 A;  2KSS A;  4M7D A;  3VQW A;  1B7Y A;  3VUB A;  2DD5 A;  2CYZ B;  2DTO A;  1AHJ B;  3QKJ A;  2F5T X;  1VQM A;  1QVG S;  4C0Z A;  3VQX A;  3IAL A;  1VQ6 A;  1IZ6 A;  3MP8 A;  2R5A A;  4K87 A;  3C95 A;  1K9M U;  3AHU A;  2GCX A;  4NOY A;  4CI0 C;  1G3S A;  5K1P A;  4ZN1 A;  3QII A;  4TVA B;  3WQZ A;  2RJC A;  3ASK A;  2LVM A;  2PUO B;  3CME T;  1JRI A;  4PJO C;  2MAM A;  3W3S A;  2OAU A;  2DXU A;  3JCM Q;  3CCV A;  2IY5 A;  2RH2 A;  5LJ3 f;  3I56 A;  4FT4 A;  4YRO A;  2E1H A;  2YRV A;  3R07 A;  3MHX A;  4JRI A;  3RKW A;  4YRT A;  3GLX A;  2DZC A;  3DLM A;  4RCC A;  3OY9 A;  4P5N A;  3CCQ A;  1X6O A;  3PIP A;  4M75 C;  4BE0 A;  2YLC A;  2K5I A;  4F7U A;  1UB4 A;  4YRE A;  3FDR A;  1X56 A;  1B76 A;  3RUX A;  4F7U F;  4P75 A;  1VQK A;  4YRL A;  1YFR A;  5D6Y A;  4XU1 A;  4A4H A;  5LJ5 e;  5A2Q E;  3P8D A;  2AMC B;  2DK3 A;  1B7Y B;  3OS1 A;  2EQM A;  2CS7 A;  2M16 A;  4M75 D;  4BE1 A;  4C8Q A;  4YYE A;  4XEO A;  1BYM A;  4YRF A;  3CXC S;  2KY9 A;  3QG1 A;  1ASY A;  3IKM B;  2QQS A;  1W66 A;  2JTM A;  4XTV A;  4P71 A;  2LRQ A;  3V8K A;  1BI2 A;  3C94 A;  3LWH A;  1H4V B;  2QQ9 A;  3UGT A;  1EIY A;  1BBU A;  4M77 G;  4C0F A;  2FL7 A;  4A4K A;  4YCU A;  4L5G A;  1EIF A;  5GAN e;  1D3B A;  3CD6 T;  5GAM j;  2RI2 A;  2HBP A;  4YRM A;  2M9U A;  3CCR T;  4YPF A;  3E9H A;  3RAC A;  3JCM f;  1K9M C;  5I21 A;  5FU6 B;  1LNX A;  3JB9 J;  3G1Z A;  1X54 A;  1NJ5 A;  4JS5 A;  4PJO E;  1M90 C;  3J80 E;  3CBM A;  4LDY A;  2QDY B;  4OF1 A;  4DOW A;  3UH0 A;  4HCZ A;  1NJ1 A;  5J3B A;  3OBW A;  3GOX A;  4NS5 A;  2HQX A;  1JB0 E;  4FM4 B;  5GAO q;  1NJI C;  3L2V A;  5E3I A;  5CR2 A;  5CAI A;  3IKL A;  4IUP A;  3MEW A;  2QQA A;  3HXY A;  2VUB A;  3CCL T;  2LQK A;  4H2V A;  1B34 A;  4OB0 B;  4R55 A;  1WJS A;  3QYH B;  3A8H B;  2K3X A;  4EMK B;  5GAN g;  4YRR A;  3CCQ T;  4P72 C;  4YRG A;  2X35 A;  3DB3 A;  3NTK A;  1B8A A;  4PLL A;  1WGS A;  3HXZ A;  4P74 A;  1PSF A;  1USY A;  3VYG A;  2RHI A;  3OYA A;  2DVE A;  4M77 F;  2R57 A;  1VQ4 T;  4EDU A;  2Q7E A;  2RO0 A;  3RES A;  2ZIO A;  3KBG A;  3HHT B;  4BDZ A;  2JVV A;  4M7D F;  4PJO A;  5LL6 S;  4OVA A;  2L8D A;  4M7A C;  4UPA A;  1K73 C;  1YBY A;  2ZPG B;  5LJ5 j;  5HKC A;  4C92 D;  1Q82 C;  4C92 E;  1JBM A;  3M58 A;  3JAM E;  1YHQ T;  1SET A;  1R8O B;  4EPC A;  2YHT A;  2XKO C;  1EVK A;  1Y7X A;  3S3M A;  3E9F A;  5J26 A;  3QHS A;  1E24 A;  1VQ9 T;  4AH6 A;  4M77 D;  5GAM h;  3IG2 A;  4G84 A;  2VXF A;  3M4P A;  2LNV A;  1KC8 C;  4EMK C;  4C5G A;  4RQE A;  2P0Q A;  1LJO A;  3MP1 A;  3CCS T;  4DOV A;  2XG8 D;  1B34 B;  2BIV A;  4BI3 A;  2ZZG A;  3MO8 A;  3QZ9 B;  3OS2 A;  2K2V A;  3VJP A;  2PVO B;  3WVE B;  3L2W A;  4C5I A;  3CPW A;  2XTI A;  4YRP A;  3M57 A;  3PZC A;  1VQO A;  1KMN A;  2DXT A;  3QYG B;  4J5Y A;  1ZHI A;  1H64 1;  3OYY A;  2P4T A;  3QNE A;  3MEU A;  5CCA A;  3G4S T;  3CCV T;  1WU7 A;  1U1T A;  1KHI A;  3TCJ A;  3DLL A;  12AS A;  1RI0 A;  3JCM W;  2ZR3 A;  2VV5 A;  2FB7 A;  4C8Q C;  4J8O A;  3M4G A;  4FU6 A;  1X2H A;  1SES A;  2DTH A;  3JCM d;  5CKH A;  4M7A E;  5GAM g;  5GMK h;  1M1F A;  1YJ9 A;  2B8A A;  3FC3 A;  2E6Z A;  3QJY A;  3F70 A;  5C52 B;  4HCB A;  2EAY A;  4G85 A;  3DB4 A;  4B9W A;  3BDL A;  3FB9 A;  3M9Q A;  3FJP A;  3QJ6 A;  2E70 A;  4M77 B;  1HTT A;  4C0D C;  4KR3 A;  1EOV A;  3JCM X;  4TVR A;  1G5I A;  3CEY A;  2RHQ A;  2E5Q A;  3P8B B;  4MML A;  3OYI A;  3LGL A;  1U1S A;  3LX7 A;  4M78 B;  5A0L A;  4OLF A;  2Y90 A;  4CH6 A;  4EMH A;  3H6Z A;  5GMK m;  4M78 F;  2RHS B;  1EQR A;  3OYE A;  1G3W A;  2DAQ A;  3ME9 A;  4RG2 A;  4LVL A;  2E41 A;  5DLO A;  2ZR2 A;  2XHC A;  1GGM A;  3OYH A;  4PLI A;  5IN1 A;  2E3C A;  4QQG A;  5HK3 A;  4BW9 A;  5IAY A;  3UDC A;  1YIT A;  2Y4Y A;  3X25 B;  4LD6 A;  3CCM A;  3CC4 A;  1KHC A;  5GAN d;  5GMK l;  2X4W A;  5DM7 R;  3CCE A;  4NL3 A;  1PSE A;  4C92 F;  3V7C A;  4P3P A;  1Q86 U;  3A7A A;  2EYQ A;  4DQ2 A;  5LJ3 d;  2ODR D;  2ZNJ A;  2RHS A;  4N0A C;  1XNI A;  1M90 U;  3GF5 A;  2QHS A;  1Y71 A;  2VYT A;  3KXT A;  3Q1J A;  1FWZ A;  2F69 A;  4HVC A;  2C06 A;  1S72 T;  3CCS A;  2ZT6 A;  2P0K A;  1Q81 U;  4N4I A;  2DXC A;  2QA4 A;  3RER A;  5GAN 3;  3LWI A;  2G4C A;  3OSS C;  1DJ7 B;  2E5A A;  2XGT A;  4J15 A;  3JB9 D;  5HY6 A;  5FRO A;  4IUR A;  1QP2 A;  5I2M A;  3HXU A;  1NPR A;  3FRN A;  3J81 E;  4PJO D;  2HAX A;  5ELN A;  4E7L A;  3GP8 A;  1K8A U;  4E7I A;  5LJ3 h;  3JB9 F;  1VIE A;  2AHJ B;  2ZPE B;  2RB6 A;  2DU7 A;  5CK9 A;  3REU A;  4P75 C;  2ZIN A;  4J7F A;  4KQE A;  2PMF A;  4C5H A;  3HSB A;  2DTI A;  4M7A A;  1E22 A;  3R6O A;  2HNI A;  5FU7 B;  2PVG B;  4H2U A;  1X2G A;  1VQ7 A;  3O8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...