2EJ9A

Crystal structure of biotin protein ligase from methanococcus jannaschii
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
237
structure length
237
Chain Sequence
MEIIHLSEIDSTNDYAKELAKEGKRNFIVLADKQNNGKGRWGRVWYSDEGGLYFSMVLDSKLYNPKVINLLVPICIIEVLKNYVDKELGLKFPNDIMVKVNDNYKKLGGILTELTDDYMIIGIGINVNNQIRNEIREIAISLKEITGKELDKVEILSNFLKTFESYLEKLKNKEIDDYEILKKYKKYSITIGKQVKILLSNNEIITGKVYDIDFDGIVLGTEKGIERIPSGICIHVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative biotin ligase
publication title Crystal Structure Of Biotin Protein Ligase From Methanococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
total genus 74
structure length 237
sequence length 237
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ej9A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ej9A01
3VBBA 2ZT7A 5C51B 4WI1A 2J3LA 2DQ0A 2ZR2A 2ARTA 1X56A 4HA8A 1B8AA 4C92C 4L87A 2QTXA 4QVDA 3LC0A 1G5IA 4XEMA 5K1PA 4YCVA 1NNHA 1NYRA 4N0AA 3TEGA 4C92B 1USYA 2ZT5A 4A54A 5ELOA 1M8VA 5HGQA 5C52B 5GAMh 4F7UA 3R07A 4P74C 4WJ3M 3SWNA 5GAOr 2EJ9A 4YRMA 1I8FA 4Q6GA 3RESA 2CGHA 5E3IA 3TEHB 1YCYA 3IG2A 1PYSA 2RHSB 1U1TA 4H2VA 2K57A 3NELA 3M4GA 4YP0A 1U1SA 4PJOE 1X55A 4P71A 3L4GB 2ZR3A 2ZZGA 1NYQA 3PCOB 1YFSA 4XU2A 4KR3A 5KNNA 3P8VA 1I81A 3ICAA 1Y96B 3RUXA 4XQ3A 4C92A 3DSQA 1RIQA 1H4SA 3INZA 4TVWA 4X5OA 3LSQA 2I4NA 5LJ5d 1ASYA 1G51A 3RF1A 4M7AC 1D3BB 4M78D 1EVLA 5GAN6 2QHUA 3A7RA 4YRCA 5GANh 4M77G 4P74A 3RL6A 3V8JA 3HFZB 2EL9A 4YRPA 1MGQA 4M7AB 2ODRD 3OD1A 4YYEA 1HTTA 4RQFA 2DZCA 5LJ3h 1B7YB 4TVAA 5K1XA 1C0AA 4YCUA 4M78G 4H2XA 4C8QB 1E1TA 2RHSA 1BIAA 3REXA 4ZTUB 4H2TA 1QF6A 3HXYA 4M75B 4M7DE 4XU1A 4J15A 2ZNIA 4P75C 2ODRC 5GAN2 2DQ3A 2PMFA 3L4GA 2DKGA 4CH3A 3QO7A 2EAYA 3V7SA 2AKWA 2G4CA 4CH5A 1KOGA 3RKYA 1I5LA 5GMKm 4UPAA 3JCMh 4TWAA 1D3BA 4YRGA 2QHSA 4ZTZB 4J5YA 4YRFA 3REUA 3JB9G 2VXEA 3HFZA 4M7AA 3RKWA 4M78F 1B7YA 4JRIA 5GANf 3E9HA 4PJOD 3RGLA 1H4TA 1X2HA 2YHTA 3VQXA 3UGQA 4F7UB 2ZINA 4M77E 4J6YA 2ZT6A 5GAMg 2Q7EA 4XTWA 5LJ5j 4H2WA 3JB9H 4HT8A 4P75A 2QHTA 2C7IA 3EFSA 4P71C 5GAN5 3VU3C 1HC7A 2Y90A 4V2SA 3HSBA 2XTIA 4OLFA 4JRKA 2DU5A 4OP0A 5DY9A 2CIMA 2DXTA 3A5ZA 4DQ2A 2ALYA 3A5YA 4M7DD 2Q5IA 3QHSA 4YRNA 4YRSA 4YRTA 4YROA 3IKMB 3RERA 3HFOA 5GAOl 4PJOF 4M7DG 5GAOq 1Z7NA 4YDQA 4NOYA 11ASA 2E1HA 1QE0A 1YFTA 4TVAB 5GANg 2DTIA 2DJZA 4H2XB 5LJ3g 4NCXA 4PJOA 1WYDA 1JJCA 1N9RA 4EO4A 1G5HA 5LJ5e 3QNEA 1EOVA 5F5WA 4G85A 3EFRA 1EVKA 3IALA 4YRRA 1SRYA 3JCMb 1GGMA 1E1OA 3FIFA 1ADJA 4F7UE 2AKWB 1X2GA 4XTXA 3V7CA 1SERA 4MMLA 3UH0A 4X9CA 4K88A 2ZCEA 4M77D 3A7UA 1KMMA 4JUVA 2I4OA 3RKXA 4M7DF 5I21A 1I4K1 2VXFA 3JCMg 3BY7A 2Q5HA 5GAMf 4HVCA 1WQ7A 4K86A 2ZIOA 2DTOA 3JCMJ 4P72C 4UP8A 1H641 1VQZA 5GAN4 2DEQA 3QUIA 3SB2A 1ADYA 3QTCA 3JCMc 5GANd 4M78C 4J6XA 4CS3A 4YPFA 3HRKA 3VQYA 1JRIA 4M78B 2C8MA 3M4PA 4C92E 4XEOA 5GAOn 3PGGA 4KQEA 4HWSA 4C8QG 2CJ9A 1JBMA 4M75G 1X01A 3A31A 4K87A 4LNSA 2PMEA 1HK9A 3JB9D 2ZIMA 4H02A 4E51A 5CAIA 1NJ6A 2RA2A 1N9WA 1SESA 3QO8A 5GMKe 1WU7A 4M77F 1HXDA 1NJ5A 4UP7A 4P73C 2E10A 1SETA 2FYKA 1Z7MA 2ALYB 3G1ZA 1ATIA 3NETA 4YRIA 4KR2A 4CS4A 4P72A 4A53A 5LJ3f 2DXUA 4M77A 4PNOA 3ERRA 4P3PA 3JCMX 1NJ2A 4M78A 2DVEA 3JB9I 4X9DA 2P0LA 4PJOC 3BJUA 3UGTA 1EIYA 4XU0A 2RM4A 4F7UG 2I4MA 5GMKi 4MMKA 3HXUA 4PJOB 1YFRA 2Q7GA 3UFGA 3HFNA 1JJCB 4M7AE 4TVYA 3HXVA 3HRIA 5GMKl 1E24A 4TTVA 3FB9A 1B34B 3JCMf 3JB9F 4C8QE 3HXWA 3HY0A 1KMNA 4AH6A 4M75E 2I4LA 4XTYA 2CJBA 2Q7HA 5GAMe 4RMFA 3HXZA 4P73A 2VC8A 1E22A 4C92D 3TUPA 1IL2A 1WQWA 12ASA 2XGTA 2RHQB 1ASZA 4RQEA 2J3MA 2ARUA 3JCMV 2E5AA 1N9SA 3NEMA 4UP9A 4BW9A 4EMKC 1NJ8A 4EMHA 1KQ2A 1WPYA 2ZT8A 4O2DA 3WQZA 1B76A 3GIBA 4NL3A 4J6WA 1B70B 4JLIA 4M7DC 3BFMA 4XU3A 4C92G 2ZXFA 4F7UF 5GAMd 3LSSA 4EMKB 3P8YA 3P8TA 4HWTA 5C53B 4M7DB 2QHVA 3BW1A 4H2UA 4RCBA 4XTVA 5LJ5g 1H4VB 4TQDA 4YREA 1BIBA 3MEYA 3JCMQ 3E9IA 3HTZA 4XTZA 1B34A 1J5WA 2I2LA 5GMKj 2IY5A 4G84A 4YRQA 3JB9J 3QO3A 5GAN7 5GAOp 4RCCA 3RIRA 1LOJA 4P3OA 4PG3A 3VQVA 4HT9A 3MF2A 3M4QA 1H4QA 5ELNA 5GANe 1X54A 2RHQA 5LJ3e 1L0WA 4C92F 2ARSA 3PZCA 1B70A 3RACA 2RB6A 4M77C 4EMKA 4M7AD 1WLEA 5LJ5h 2CJAA 3HY1A 1WNLA 1YGBA 3VQWA 4M7DA 3A7AA 4M77B 4RDXA 1NJ1A 4C8QD 3HFVA 2ZTGA 1LJOA 1EFWA 1LNXA 3JCMP 2ZZEA 5LJ3d 2DDZA 4M7AG 4M75D 4CH6A 1LYLA 1M5Q1 3I7FA 4TQFA 2E3CA 1EIYB 4C8QC 3JCMe 2ZNJA 2E41A 4HWPA 3QSUA 3TEHA 4M75C 5GAMj 3A74A 4HWOA 4Y91A 3FJPA 4BWAA 4DPGA 2EWNA 3W3SA 3V8LA 3JCMd 3MF1A 4ZIBA 1FYFA 3PCOA 4CH4A 2YLCA 5GAN8 3KFUA 3CMQA 3A32A 2AMCB 1W66A 3IKLA 1Y96A 1TH7A 5LJ5f 2DZ9A 4EMGA 2ZGWA 4M7AF 2DTHA 4WF2A 3AHUA 3V8KA 4Q15A 3HXXA 1KQ1A 4C8QF 3L1AA 4QVCA 4YRLA 1EQRA 5GAN3 4YRKA 2YLBA 4P3NA 5GMKh 4M75F 4N0AC 1BBWA 1USYC 2FB7A 4HWRA 4NL2A 2E64A 2E65A 3JCMW 4XTUA 3QO5A 4H2SA 3NENA 3V7RA 4PHCA 2EJFA 3SWNC 4C8QA 2RD1A 4YRJA 5GAOm 4M75A 3BDUA 1BBUA 4EX5A 2HNIA 3SWNB 5GANj 2IY5B 2P5IA 3L2ZA 1YB3A 4PJOG 5LJ3j 4WJ4A 2JN0A 4M78E 4YCWA 4CS2A 2AMCA 4H2YA 2DU7A 1PYSB 2ZZFA 2EJGA
chains in the Genus database with same CATH superfamily
2V1RA 2HQEA 5DLOA 2EYZA 5C51B 2LRQA 2J3LA 1ZSZC 2EGEA 3OYLA 5I11A 2M0YA 1WXUA 2DXCA 2EQUA 2QTXA 3VV0A 2L3SA 3OS5A 3LC0A 3CC4Q 4XEMA 2GCXA 3G71A 1WLPB 1NNHA 4C92B 1NJIR 3OMCA 3H6ZA 4F7UA 3R07A 3RBBB 3SWNA 5GAOr 1QLYA 2AKLA 4CC2A 1K9AA 1I8FA 4Q6GA 3JSCA 2IG0A 2JVVA 5IN1A 3OBYA 4ZGDB 2H8HA 1SSHA 1R77A 1YCYA 3G4SA 1AWWA 4DOWA 1U1TA 3UATA 3M4GA 2ROTA 1M30A 5DM7R 1IREB 2AKKA 3PFSA 4P71A 2X3XD 4LUDA 4JZ4A 2VUBA 2CT4A 5AT1B 4C0DC 3I55Q 4MZMA 2B8AA 4XU2A 5KNNA 1W2BP 3P8VA 4BY6C 2OTLT 2B86A 2W10A 2D8HA 4OB2B 2LT4A 2VWFA 1EVLA 4M78D 5GAN6 3EAEA 3QYGB 3HFZB 4YRPA 2ODRD 2LX7A 1HTTA 4RQFA 2XIDA 2DA9A 2SEMA 3CCVA 1PRMC 1U5SA 2RNAA 4M78G 4C8QB 4EPCA 1BIAA 4OMPA 3REXA 1QF6A 3REBB 3HXYA 2HDAA 1H8KA 2ZPIB 4ZGJB 4C5GA 5KE2A 1WYXA 2PMFA 3NTKA 4B9WA 3A98A 2V8IA 2EAYA 1Q7YR 1G8XA 1QKXA 2G4CA 1U06A 3EG3A 2IPOB 4BE1A 1VQOA 4UC4A 4UPAA 3VS1A 1UGSB 3QXEB 1D3BA 4LVJA 1FYNA 1AD5A 3TCJA 2QHSA 4ZTZB 2CP2A 4J5YA 4HCKA 2JXBA 4YRFA 2J6FA 3M0PA 1R0BG 4JRIA 4FT4A 2DIGA 4PJMA 2O2OA 1ABOA 4JS5A 3E9HA 2D0QB 2OTLA 2L5QA 4KH1B 1H4TA 4F7UB 4ORZA 4AFUC 2A0FB 2ZINA 1VQ8Q 4BI4A 3H8ZA 5GAMg 4XTWA 1N8RR 1K1ZA 4PJJA 5IAYA 2C7IA 5J26A 1WJRA 3ZBDA 1X75C 2XDPA 4JZ3A 3LWIA 4V2SA 2XTIA 5CIUA 3JV3A 3OYDA 4OP0A 5DY9A 4BUGA 2RQRA 1QVFP 1ZBXA 1Q82C 4DQ2A 3OYFA 3CCLT 3A5YA 1GL5A 4LVIA 5GJWB 2Q5IA 2RHIA 3UWNA 4JJNK 4YRSA 4YRTA 1JJ2A 3RERA 4MDWA 4PJOF 2K79A 3J81E 1VQLT 1JXMA 3M9QA 1YFTA 3CBPA 1OOTA 3THKA 3I56A 2J6OA 4A4KA 5LJ3g 3FRNA 4EO4A 3HRSA 3CCET 2ATCB 1QCNA 3QNEA 3NTIA 2KNBB 4DA4A 1Q7YU 4G85A 3EFRA 2KDSA 4LUEA 3OS0A 2DX1A 2BZ8A 4XTXA 1RAIB 4AMCA 4R55A 2KXCA 4AT1B 3OW2A 1WJQA 3A7UA 4LDWA 8AT1B 5KH6A 2KAFA 2QDYB 3TREA 3EG0A 1I4K1 1U3OA 2QG9B 4R0KA 1RLPC 3CC2Q 2RHYA 1D09B 1M2VB 3JCMJ 2LX9A 1H641 1KK7A 3EH2A 2DEQA 3QUIA 4LN2A 1RADB 2D8JA 3M59A 4J83A 1PCXA 4CS3A 2XD0A 1HSQA 3HRKA 1YJWT 1WHHA 1VUBA 4XEOA 3CCMQ 3PGGA 2O88A 4HWSA 3LWHA 2RK1A 2ABLA 2J7IA 1SPKA 2E6ZA 1X2KA 4M75G 2XI9A 4K87A 1K0SA 2PMEA 1HK9A 4FM4B 1OZ2A 2RA2A 3QO8A 4N4HA 1VQ5Q 3QJ6A 2EQIA 1Q86C 3J7AF 4LXCA 3CC4T 1GRIA 3IQLA 4YTLA 3UF4A 1WHJA 4YRIA 4IUPA 4KR2A 2KQWA 2DXUA 1M9SA 1N6AA 1UHCA 4OB1B 4XK8E 2DRMA 5D6XA 2COZA 1YCSB 3JB9I 1WX6A 4ME7A 2FRYA 2COYA 2RM4A 3MQZA 4HVVA 5CCAA 4A4HA 3UFGA 4M7AE 2O4XB 2RPNA 4A4GA 3HRIA 3HXVA 4TTVA 4HKEA 2PQWA 1MUZA 1YJWA 1B34B 2GFAA 3MP8A 1DJ7B 1KMNA 3G6ET 2M51A 2Z0WA 2I4LA 1PD1A 4XTYA 4J9BA 2CJBA 2Q7HA 1YIJQ 4RMFA 3HXZA 2G3RA 5FW9A 3EGXA 3EH1A 4F04B 1X6BA 1M3BA 12ASA 3OA6A 1NEGA 1ASZA 3NEMA 2DL7A 1NJ8A 1KQ2A 1WPYA 4O2DA 1B07A 4NL3A 2HD0A 1VYTA 4JLIA 4M7DC 3X26B 4HT4A 5CR2A 4F7UF 3P8HA 4EMKB 3HTRA 4O6JA 3CC4A 1BI1A 1TS9A 3P8TA 4HWTA 2EYYA 5C53B 3EG2A 2OTJQ 2QHVA 1SF9A 1H4VB 2HL5C 1BIBA 5KYYB 3CXCS 3S3NA 3JCMQ 4HCZA 1D1AA 4OB0B 1K4US 1J5WA 4QQDA 3QKJA 2DF6A 2KRSA 5CVIA 3QO3A 3C4SA 4J9GA 5GAOp 4K11A 2RHXA 1D1CA 3R6OA 4D8KA 1OPLA 3MF2A 6AT1B 3S3MA 4E7HA 2KVQG 1QWEA 2MYSA 3G6EA 2QQSA 2EGAA 3GLXA 3S6WA 4M77C 3NFCA 4HVWA 4CRIA 3VQWA 4M7DA 1RAHB 2MIOA 2LQWA 1UGRB 3VRZA 1PRLC 5KYUA 4BDYA 2KY9A 3META 2DDZA 2J6KA 2CZ6B 4CH6A 2PNIA 2VV5A 1RI9A 1IRXA 3J80E 1M5Q1 4QKUA 1O75A 2NUPB 2MWOA 3VUBA 1VQ6Q 3D7SB 1BBZA 1HYOA 4J9EA 1WDXA 2E41A 2FG0A 1YJ9T 3QSUA 3TEHA 1NLOC 2LC4A 1ZLMA 3M58A 4MDXA 1YITQ 5GAMj 4HWOA 1EZZB 4Y91A 5CKDA 4C5HA 2YSQA 2EWNA 4PFOA 3W3SA 1WHLA 3MF1A 4OGCA 4CH4A 1JB0E 3OYYA 2LT1A 3EGXB 2AMCB 3IKLA 4C5IA 1W4SA 4Q15A 2YDLA 1M90R 2LCLA 1KQ1A 4YRLA 2YLBA 4P3NA 4M75F 2K3BA 3P8BB 3MEVA 1USYC 2XDBA 4NL2A 2C0IA 3OW2S 2E65A 3JCMW 4XTUA 3QO5A 1TUGB 2BZXA 3CPWP 5C6SA 1IB8A 3X28B 2RD1A 3FDRA 3CC7Q 3CD6T 9ATCB 4EDUA 5LJ3j 1UGPB 1MHNA 4QT7A 1VQ4Q 2QXFA 4M78E 1GBQA 4BB7A 2ROLA 4PLLA 4B6MA 2E12A 2ZT7A 2K6DA 4WTOB 4J8OA 3CC2T 3A8LB 2HZYA 4HA8A 4C92C 1KJWA 1KD1R 4QVDA 1KC8U 1K73R 1NYRA 1USYA 1KQSP 5HGQA 5GAMh 3FC3A 4F17A 2F5TX 1BI2A 4YRMA 2R5AA 1LPLA 1X6GA 3TEHB 4II1A 2LCCA 1PYSA 2RQTA 4KH0B 4H2VA 2VVKA 3NELA 3CD6A 1VQNQ 1Q7YC 3H41A 5FU6C 3L4GB 1T0JA 1WXTA 2ZR3A 2ZZGA 1QW1A 1YJNQ 4ELZC 1WZOA 1BKBA 4KR3A 4ZGEB 3A1PA 1M90U 3I35A 5CQXA 5FWBA 4C92A 3DSQA 1H4SA 4TVWA 3CCQQ 2I4NA 3LSQA 1AZEA 2KRNA 3G1JA 1G51A 2LP5A 4Z8AA 3CC2A 2QGFB 3SEMA 4YRCA 3RL6A 4M77G 5L8RE 4D6WA 2MF2A 2XG8D 4E7SA 4MZTA 1YNZA 4M7AB 4F14A 2KSSA 2EGCA 5LJ3h 3ULRB 4QVZA 2P84A 1OEBA 2Y4YA 4ZTUB 3M0RA 2XMFA 4XU1A 3C0CA 3CCMA 4J15A 2ZNIA 2LJ1A 1OULA 1VQ7T 2ODRC 5HK0A 4FYWB 2DQ3A 3HRTA 2DKGA 2ZPBB 2WSCE 5D6WA 2R5MA 1QWFA 2JT4A 3V7SA 4DOVA 2AKWA 2L3RA 2ZCFB 1TSFA 1H3HA 4CH5A 2YRDA 1KOGA 1XJWB 4ANJA 2SRCA 2K5FA 1I5LA 2CH4A 5GMKm 3CEYA 2XICA 2EYQA 1VIFA 2C0OA 2DL4A 4FYXB 3OYIA 4YRGA 3FJ5A 1KD1U 2PUOB 3JB9G 3A5ZB 3HFZA 2GNCA 3RKWA 1YBYA 1QCOA 4A4FA 2DEUA 2OAUA 4PJOD 2JTFA 2LQKA 2YRCA 1X2HA 1RAFB 3ZEHA 2ZT6A 2DBMA 3EHRA 3JB9H 4H2WA 1PG5B 1FWZA 3H9NA 1UGVA 2CP7A 1FMWA 1X27A 1UEBA 1V29B 2KROA 2XKOC 4P71C 5GAN5 2AZVA 2XK0A 3VU3C 2NWMA 3QDFA 1HC7A 2Y90A 1K9MU 1AZGB 3MO8A 3PVQA 3VS2A 2KYBA 1VQ7A 2IVWA 1Y7XA 2PVDB 3QZ9B 3CCVT 4OMLA 1FX7A 3NMZC 2MI6A 3QHSA 4YRNA 4P5NA 1RL2A 3HP9A 4YROA 1BCOA 3BE3A 3HFOA 1H92A 1SEMA 1TUDA 5GAOq 3CCJT 3RMSA 1VQ6T 1Z7NA 3OSSC 4NOYA 4E47A 1VQPT 2AHJB 2DTIA 2ED1A 3C94A 1VQOT 2DD4A 2L0AA 3VYGA 1WYDA 1N9RA 3OB9A 2LDMA 5DLQE 4IIMA 5IHIA 2DBKA 1S1NA 2AK5A 1GCQC 1VQMQ 1GGMA 1ADJA 1O9SA 3M0UA 1X2GA 4JJDA 5FU6B 2AKWB 3PVLA 4CI0C 1SERA 2KXDA 4K88A 2ZCEA 3RDVA 1G83A 1KMMA 4JUVA 3RKXA 1ABQA 1WHMA 1NM7A 1VYVA 3UA6A 4M7DF 3NHNA 3VS4A 1KHCA 1YP5A 5GAMf 2GFUA 4HVCA 2ZIOA 2WACA 3HPWA 4UP8A 2Y4XA 5GAN4 3SB2A 3CCUQ 2DM1A 1UUEA 2VGMA 1FMVA 1JEGA 1GFDA 3QTCA 3L2QA 1T3LA 3I5RA 3CMEQ 2DAQA 4KGZB 1VQKT 3OYMA 5HKCA 1JRIA 2R57A 1VA7A 4M78B 3UPUA 3PE0A 5GAOn 3EGDB 1QKWA 3CCJA 3CCRQ 2A7YA 4RTXA 1XQHA 1VQ6A 4KQEA 2JTMA 4C8QG 1YFNA 1VQPA 2CJ9A 3H0FA 1VYUA 5AYFA 1X01A 1GCQA 1JU5C 3LGFA 2F2XA 3CXCA 2ZIMA 1V1CA 4E51A 1NJ6A 1SESA 1PKTA 2RI5A 3VS7A 1WU7A 4M77F 1PM3A 2JS0A 4UP7A 1M2VA 2E10A 1SETA 1Z7MA 1NJIU 3U23A 5HY6A 3I56T 2CP0A 1SKUB 4LVMA 5FU7C 4CS4A 4C0GA 4A53A 1ACMB 5LJ3f 4AG2C 2C06A 3TVTA 4BD3A 3ERRA 1BYMA 3SDZA 3JCMX 1NJ2A 4MZPA 1AWOA 2P0LA 1BI3A 3UGTA 2DERA 3OYGA 3A8OB 1EX4A 4QQGA 4F7UG 5GMKi 4TVYA 2KT1A 5GMKl 4E6RA 1VQKA 3HXWA 3JB9F 3CCSQ 1YJNT 1MV3A 1MMDA 2EKOA 4OMMA 4E7LA 2D9TA 1VQ4A 3EFOB 3E9GA 5KCOA 5C0MA 3HRUA 1BI0A 1E22A 4XAXB 1IL2A 4VUBA 4QQ6A 2OI3A 2RHQB 2CUDA 2RJEA 4Q5WA 1ARKA 4RTTA 4EMKC 3WQZA 1F1BB 5KYWB 1B70B 3CMAT 3BFMA 2ZXFA 3TEEA 1RAGB 5GAMd 3LSSA 2V8KA 1KC8C 5LJ5g 5CQYA 3MEYA 2VKNA 1XTDA 1V76A 2O4XA 4ZTFA 2QYZA 2DFUA 1B34A 2QDLA 2XHCA 1RACB 3MEWA 2GGRA 2DO3A 2JM9A 2DJQA 1M1KR 1T0HA 3RIRA 1LOJA 4C5EA 2RI2A 1FMKA 5KE3A 1KHIA 5GANe 1X54A 1JJ2P 3LX7A 4C92F 1UJ0A 1RI0A 1YJNA 3PZCA 1RAEB 4L5GA 1ZQ1A 2WSFE 3GPLA 4EMKA 3HY1A 1UHFA 2O9VA 4KBMB 4JS4A 1SRLA 1K76A 1YI2Q 3A7AA 2ZTGA 5KYYA 3CCQA 1LJOA 1EFWA 1LNXA 1SHGA 5LJ3d 1N8RU 4M75D 1TUCA 1OYXA 4JRQA 1PKSA 3VS5A 3A8HB 4IURA 2E3CA 3CMAA 2JM8A 3JRZA 3JCMe 2ZPHB 5CKHA 2ZNJA 4HWPA 2CS7A 2FPDA 3H0IA 2QA4Q 5FRMA 2O31A 4OMQA 2GQVA 3P8DA 2QQ9A 2LVMA 2A28A 1D0XA 1FYFA 3I5SA 3VRYA 1W2BS 2YLCA 3KFUA 3CMQA 2J06A 2M0OA 3URGA 3SD4A 1Y96A 2DZ9A 1MMAA 2RH2A 3V8KA 3WXMB 5FU7B 3AHUA 3HXXA 1VQ9Q 2ENMA 2PU9B 1IGUA 3RNJA 4C8QF 2DE0X 1WXBA 2EQKA 1KFZA 4YRKA 3OS1A 1K8AR 2NUPA 4N0AC 4LD6A 3PNWC 2BE7D 2KT8A 2K3XA 2BZYA 3V7RA 4DBHA 4PHCA 2EJFA 2F2WA 5IHKA 5IXBA 4EIKA 3HL8A 5IXFA 2K4YA 1BBUA 2HNIA 3I55T 1SHFA 2RQVA 2P5IA 1M1KU 2PVGB 3SHWA 3LYIA 2A08A 1NLPC 1MMNA 4TVRA 1IZ6A 3EG1A 2AMCA 4H2YA 3G7ZA 4FIBA 2R58A 2ZZFA 2EJGA 3TSZA 2GTJA 3MPUB 2CP3A 1RLQC 3VBBA 2CP6A 4WI1A 1K9MC 2DQ0A 2ZR2A 2ARTA 2K5IA 2L3PA 1X56A 1OV3A 1B8AA 2KGTA 4L87A 1WHKA 3QJYA 4BE2A 2MPXC 4L6V5 1G5IA 3TEGA 2FVUA 4N0AA 2L8DA 2BTTA 2I0NA 5C52B 1M8VA 3E19A 4WJ3M 2DL3A 2ZPFB 2VB6A 4JPBW 2AT1B 2OAWA 4RTWA 2YXYA 2CSQA 1W70A 3HHTB 3M5AA 2X35A 2ESWA 2YT6A 2M16A 2BUDA 5E3IA 1ZA1B 4OMOA 3E1SA 3IG2A 1N5ZA 3VJPA 2RHSB 4HCCA 2X4XA 2HKQB 3G4SQ 2K57A 2EYXA 2H3JA 4YP0A 3EHQA 4PJOE 1YHQQ 1X55A 2CREA 3I55A 1QVFS 1IO6A 2FZCB 1NZ9A 1S72Q 3GBQA 2RN8A 1C1AA 3ICAA 1Y96B 4JLGA 4XQ3A 1Q82R 4X5OA 1PSFA 4DEXA 1ASYA 5I2MA 1VQ8T 1K8AU 4M7AC 1EFNA 3CBOA 1EIFA 2QHUA 4QW2A 3GNFB 5GJVB 3V8JA 2EL9A 1MGQA 4YYEA 3F70A 3CCUA 3LGLA 2DZCA 1E6HA 1B7YB 4TVAA 2JMCA 5K1XA 2QASA 4KGXB 4H2XA 3CMEA 4J9HA 1E1TA 4OMFB 4X34A 2CKKA 2X4JA 2FZGB 4H2TA 4Z02A 3KUFA 3CCRA 4BI8B 3L4GA 4ZN1A 4CH3A 1CSKA 2K3YA 2GTOA 3QO7A 4FCYA 3VUZA 1QVGP 2X3WD 3RKYA 2KE9A 2LNHB 4TWAA 1VIEA 3T9NA 2W0ZA 3REUA 2VXEA 4M7AA 3PTAA 1NJIC 1PSEA 5GANf 2DIQA 3VS3A 3FEOA 3RGLA 3MCAB 2YHTA 4O5VA 3VQXA 4IIOA 2OTLQ 3UGQA 1VQ8A 2QQRA 5CK9A 3GNGA 1AVZC 1WIEA 1LVKA 5LJ5j 4HT8A 2QHTA 3MJXA 3EFSA 4LNPA 2HQHA 1KQSA 1UB4A 3HSBA 4LVKA 4LVLA 2COWA 2PZ1A 4JRKA 1UGQB 2DU5A 1SRMA 3I9QA 2RF0A 3A5ZA 2E70A 1Q82U 3LH0A 2ALYA 1Q86R 3WVDB 2RHZA 4M7DD 4J9DA 1AHJB 2JTEA 3ASKA 5IT9E 2EW3A 2C0TA 3CCMT 1NYFA 4GY5A 5HCKA 3X20B 2K2VA 3CBMA 2QEXQ 4IKFA 3GP8A 4M7DG 2NYSA 3M0TA 2XU8A 4YDQA 4E7KA 4BE0A 2V8JA 4FW1A 1X2QA 3FLGA 2YUNA 4TVAB 5GANg 1IHVA 4H2XB 2QA4T 4PJOA 2M02A 1NG2A 2KR3A 1VQ5T 4PLIA 5LJ5e 1EOVA 4WCIA 1PNJA 2YUQA 4IUQA 4BACA 1XNIA 1ZUYA 4CC3A 3JCMb 2P4TA 3FIFA 4F7UE 1LCKA 2CZ7B 4D8DA 3V7CA 1Y57A 3OYCA 3S3OA 4MMLA 4KUDK 2JJ9A 4GBQA 2D6FA 4X9CA 1GXIE 1IHWA 4M77D 3EG9B 5J3BA 2QK0A 4GLMA 5KYXB 4RTZA 1X43A 4LDYA 3JCMg 4AFQC 1D0ZA 2VASA 2QGGA 2K7AA 3BY7A 1WQ7A 2E5KA 4K86A 2BE9B 2CUBA 2DTOA 4P72C 3OYJA 3X25B 3KXTA 1VQZA 2RJFA 1YI2A 1ADYA 1PC0A 3CCLQ 3JCMc 5GANd 2V1QA 4M78C 1WJSA 4J6XA 4YPFA 1N8RC 4FU6A 3VQYA 4RKUE 5L23A 2C8MA 4B9XA 2X4YA 2P0QA 2RHUA 1YIJT 2FPFA 3H0HA 3CPFA 1VQLQ 2O9SA 3PT9A 1JBMA 2LTOA 3A31A 1GFCA 2CYZB 1XOVA 3JB9D 2QA4A 4H02A 1QCFA 1N9WA 4HVUA 1VQ5A 5GMKe 2DYBA 1KIKA 3REAB 4IUVA 3CCEQ 4LE9A 2L89A 1Q86U 4P73C 1K73U 2FYKA 4F16A 2DLPA 2OTJT 3NTHA 2ALYB 1ATIA 3NETA 1PD0A 2LZ6B 4P72A 4OF1A 1M1FA 4PNOA 5CO7A 3VYHB 2NLUA 4PFPA 4M78A 2EIFA 1JQQA 3EGDA 2EPDA 4X9DA 3M0SA 2P0KA 3BJUA 1EIYA 5D7UA 2LNVA 3VKIA 4MMKA 5I2SA 4PJOB 1YFRA 2Q7GA 1G3YA 2KYMA 5M9OA 1E24A 4E7IA 1KSWA 4JJBA 4OVAA 3HY0A 2YUPA 2OX7A 1SSFA 3VS0A 2YUOA 1S72T 1M1KC 1ZSGA 1C6VX 2KBTA 1YIJA 4M75E 5A0GA 1TU0B 3MKDA 2K5LA 3QWYA 4OMNA 4P73A 2M9UA 2HSPA 1G3TA 4FYVB 4C92D 1YN8A 1UFFA 2DL5A 4RQEA 3GOXA 4UP9A 1N9SA 2CT3A 4BW9A 3LH5A 1Z9ZA 4XU3A 4C92G 3OSVA 3ER0A 1NEBA 2OTJA 1NPRA 1W2BA 5LL6S 1YITT 2DRKA 4H2UA 3BW1A 3CPWS 4XTVA 2OJ2A 2DYIA 4YREA 3VS6A 1NBEB 4LDVA 4N4GA 3A8GB 3HTZA 2KRMA 4XTZA 2NUTB 3OMGA 2BIVA 2A37A 4J7IA 2I2LA 2IY5A 1UTIA 4YRQA 1QP3A 1TTHB 1N27A 3EFOA 1TWBA 5GAN7 3JB9J 4RCCA 3E9FA 7AT1B 4PG3A 5KYNA 4P3OA 3A8MB 3QG1A 4X1VA 2K9GA 3M4QA 1QP2A 3L2WA 2HBPA 2RHQA 2P4RA 1QQJA 3O5ZA 4RUGA 1YHQA 1AEYA 4AFZC 3DLMA 1L0WA 2ARSA 5KYWA 1B70A 1W6XA 4KRTA 2HCKA 2RB6A 4J9FA 1S72A 3G6EQ 1WLEA 2EFIA 1CKBA 1ZSZA 2DPPB 3HFVA 4C8QD 1WA7A 3HKSA 2LQNA 3PIPA 3CC7T 1KQSS 1ZHIA 3JCMP 2JOYA 1K8AC 1LYLA 4PJNA 1VQ4T 3I7FA 4TQFA 1PWTA 1EIYB 4Z88A 3N5BB 2LMJA 2RK2A 1M4ZA 5EG2A 1YITA 2JNGA 4M75C 4RTYA 1BK2A 2PVOB 3NGPA 4BWAA 3QIIA 3MEAA 4ZIBA 2E6NA 3PCOA 2MK5A 5A0LA 1W66A 3LLRA 2PUKB 1G5VA 5LJ5f 4EMGA 4M7AF 2DTHA 1R0CB 2QEXT 4C0FA 3OYNA 2DVJA 3OBWA 4QVCA 3BDLA 1QVFA 8ATCB 1G3WA 1HJDA 1BU1A 3OYBA 4JRPA 3GF5A 2EKHA 4H2SA 3NENA 2F5KA 3CC7A 1VQNT 4E7ZA 3CXCP 4YRJA 2FEIA 5GAOm 2LJ0A 4M75A 4IUTA 1D1BA 4RTUA 3SWNB 5GANj 2KEAA 1AT1B 5FRNA 2IY5B 4Y92A 2HKNA 5I22A 3JAME 4YCWA 2QI2A 4CS2A 1B7TA 2YRVA 3CCQT 1QMCA 1TOVA 3MP6A 1MMGA 1YJ9Q 3KFVA 2RMOA 2E4HA 4ZN3A 4OGEA 2MAMA 4A63B 1ZSZB 3MP1A 2E3IA 1H3ZA 4YCVA 5K1PA 2F1LA 2HBWA 2RJDA 3PMTA 2RQUA 2ZT5A 4A54A 5ELOA 4P74C 2QEXA 2YWWA 4KUIA 2EJ9A 3R6NA 3RESA 2EQMA 2CGHA 1Q81R 3QZ5B 3C95A 1VQNA 1U1SA 1ZA2B 3CD6Q 3QPHA 1UDLA 3RMQA 1NYQA 1M2OA 1ZUUA 3PCOB 1YFSA 5EC7A 1I81A 1M90C 2CDTA 2VGNA 3RUXA 4C0DB 2JMAA 2M1HA 1M1GA 1I5OB 3M54A 5CKBA 1RIQA 3INZA 1OX8A 5LJ5d 3NPFA 4BY6B 2J05A 2MWPA 3RF1A 1D3BB 1MV0B 2LJ3A 2CZ1B 4AG1C 3A7RA 1NYGA 2L3QA 3E2UA 5GANh 1A0NB 4P74A 1FXXA 3PIOA 3OD1A 2HSEB 1C0AA 1M8MA 3QDRB 4YCUA 1G3SA 2F69A 4JDSA 3CCLA 3OW2P 1R8OB 3OY9A 1ZUKA 2RHSA 4AFSC 4M75B 4M7DE 1UECA 2DMOA 4C0ZA 3DLLA 4P75C 5GAN2 1E7OA 1VQLA 4DBRA 2CSIA 4HXJA 2A36A 1D0YA 2RO0A 3JCMh 2FO0A 1OX9A 2GBQA 3CCEA 2LQ8A 1KD1C 3QYHB 1Y0MA 1K73C 1UE9A 1TG0A 4M78F 1B7YA 1B3QA 5FWCA 2AIRB 2PTKA 4JJCA 5A0DA 3DKMA 1J3TA 2DK3A 4M77E 2QQBA 1VQMT 4FT2A 4J6YA 3M57A 2Q7EA 5J39A 1RABB 1Q81U 1G2BA 5CKEA 4P75A 1T3SA 2X9HA 3MEUA 2CP5A 2XDDA 4N4IA 1Y71A 3RR6A 2FRWA 4OLFA 2E3HA 3OYEA 2QAZA 2CIMA 3L2VA 2DXTA 3CCUT 1VQ7Q 1W1FA 2H3EB 3CQTA 1M3AA 3CMET 3G71Q 2EYWA 1ZBJA 3IKMB 3CCRT 5GAOl 1M27C 1AWJA 3OYAA 2WSEE 11ASA 1YWOA 2E1HA 1QE0A 2D1XA 1JO8A 4LDXA 1UG1A 2JW4A 2NS6A 2DJZA 4NCXA 3ME9A 1JJCA 3M56A 2JZ2A 1G5HA 5F5WA 1JXOA 3O8VA 4FSSA 1X6OA 4GLKA 1VQMA 1EVKA 4E2FB 1E6GA 3IALA 2ZZDA 4YRRA 1SRYA 1E1OA 1ZX6A 1YWPA 3UH0A 1WFWA 3M53A 3M0QA 3OYKA 2CH4W 2ECZA 1Z9QA 4IUUA 2I4OA 4RG8A 5I21A 5A2QE 2ZPEB 2VXFA 4LD9K 2KMTA 2Q5HA 1OI1A 1QVGA 4FYYB 1HD3A 3UT1A 3TSWA 4J9IA 4KT0E 1CKAA 2EVRA 3MHXA 2P0PA 3CCVQ 2F2VA 3CCST 2EBPA 4PFZA 1KC8R 3M4PA 4C92E 1MNDA 3DB3A 1WGSA 2O01E 3CCJQ 1K0XA 2CZ0B 1VQPQ 3CPWA 4LNSA 3EG9A 4CC7A 3TQ7P 3L2UA 5CAIA 1JJ2S 5FLXE 3M4YA 5KYXA 1VQOQ 3L2RA 1U8RA 1Q95G 2K2MA 4J9CA 4ATOA 1HXDA 1NJ5A 4PK4A 1I1JA 2EQJA 2HQXA 3G1ZA 4R56A 4RG2A 2A3LA 1VOMA 4M77A 1MNEA 1NPPA 1GBRA 2ZPGB 4P3PA 2QQAA 2DVEA 4PJOC 4J7FA 4XU0A 2NUZA 1M3CA 2I4MA 3X24B 3HXUA 1C0MA 3AT1B 3HFNA 1JJCB 5D6YA 4BI3A 3CCSA 2DETA 1OPKA 2E5QA 5FROA 3FB9A 2DXBA 3SFMA 3JCMf 1AWXA 4C8QE 2AZSA 1VQKQ 2VYTA 4AH6A 4FW2A 4Y28E 4A4EA 1SG5A 5ECAA 1YI2T 2ZAEA 4LDUA 5GAMe 2FL7A 2VC8A 1YJ9A 3OYHA 3TUPA 3WVEB 2LCSA 1WQWA 2XGTA 4PKCC 2J3MA 2ARUA 3JCMV 2E5AA 5IHNA 1TXQA 4EMHA 2ZT8A 2FHDA 3GIBA 1B76A 4J6WA 2MCNA 3KBGA 2MMPA 1GCPA 3P8YA 1RAAB 4DBQA 2HEQA 3QWXX 4M7DB 3C12A 1NE8A 4RCBA 4TQDA 3I56Q 5KYUB 3E9IA 2HL3A 1P92A 2X4WA 5HK3A 2MOXA 1I0CA 5GMKj 4G84A 4KGVB 1RUWA 3EGUA 1BB9A 1X69A 2RI3A 3DB4A 4BDZA 3VQVA 4HT9A 1PHTA 1VQ9T 4CC4B 5IH2A 5KCHA 1H4QA 3UA7A 5ELNA 1Y07A 3OS2A 5LJ3e 4NS5A 2IIMA 2A8EA 3RACA 2D0NA 1OU9A 4M7AD 1K9MR 2CJAA 5LJ5h 1WNLA 2DNUA 3PMIA 1YGBA 4M77B 4RDXA 2DL8A 1NJ1A 2FPEA 2JS2A 4KULA 2ZZEA 2NUTA 4M7AG 2RQWA 1UJYA 4RMOA 2L2PA 3M55A 4ELYC 3UDCA 4C8QC 3CMAQ 2DILA 4ESRA 4DBFA 2HMAA 4PJLA 2DD5A 3A74A 3ZFJA 3Q1JA 4M4ZA 1WI7A 3FJPA 4E7JA 1OZ3A 2RJCA 4DPGA 1I07A 2QTVA 3V8LA 4DEYA 4PL6A 2GQIA 3JCMd 4RTVA 5GAN8 2JUFA 3A32A 3G71T 1TH7A 4L59A 2HAXA 1QVPA 2ZGWA 4FL6A 1VQ9A 4WF2A 1AOJA 4OB3B 4HCBA 4ZNXA 2V26A 1IXDA 3L1AA 2G6FX 3TU4K 1EQRA 5GAN3 3QBYA 5GMKh 2KI7A 2GF7A 2X51A 1BBWA 1WHGA 2FB7A 4HWRA 1OQKA 2E64A 2FZKB 3G4ST 4C8QA 3SWNC 1YHQT 4ZTJA 4FSXA 1OU8A 3L42A 3BDUA 4EX5A 2BKDN 3L2ZA 1YJWQ 1QVGS 1YB3A 4PJOG 1Q81C 1KG1A 4WJ4A 2JN0A 3LW5E 2KK4A 3OQ5A 3ZL7C 5CKFA 4Z89A 2DU7A 1IGQA 1PYSB 2ED0A 1BCMA
chains in the Genus database with same CATH topology
2HQEA 5DLOA 5C51B 2LRQA 2J3LA 3OYLA 2DXCA 2EQUA 2QTXA 3VV0A 3OS5A 3LC0A 4XEMA 2GCXA 3G71A 1NNHA 4C92B 3OMCA 3H6ZA 4F7UA 3R07A 3SWNA 5GAOr 1I8FA 4Q6GA 3JSCA 2IG0A 2JVVA 5IN1A 3OBYA 4ZGDB 1YCYA 3G4SA 4DOWA 1U1TA 3M4GA 5DM7R 1IREB 3PFSA 4P71A 2VUBA 4C0DC 4MZMA 2B8AA 4XU2A 5KNNA 3P8VA 4BY6C 2OTLT 4OB2B 2LT4A 1EVLA 4M78D 5GAN6 3EAEA 3QYGB 3HFZB 4YRPA 2ODRD 1HTTA 4RQFA 2XIDA 3CCVA 4M78G 4C8QB 4EPCA 1BIAA 3REXA 1QF6A 3HXYA 2ZPIB 4ZGJB 4C5GA 5KE2A 2PMFA 3NTKA 4B9WA 2V8IA 2EAYA 2G4CA 4BE1A 1VQOA 4UC4A 4UPAA 1UGSB 3QXEB 1D3BA 4LVJA 3TCJA 2QHSA 4ZTZB 4J5YA 4YRFA 4JRIA 4FT4A 2DIGA 3E9HA 4JS5A 2D0QB 2OTLA 2L5QA 1H4TA 4F7UB 2ZINA 4BI4A 3H8ZA 5GAMg 4XTWA 5IAYA 2C7IA 5J26A 1WJRA 3ZBDA 1X75C 2XDPA 3LWIA 4V2SA 2XTIA 5CIUA 3OYDA 4OP0A 5DY9A 4BUGA 1ZBXA 1Q82C 4DQ2A 3OYFA 3CCLT 3A5YA 4LVIA 2Q5IA 2RHIA 3UWNA 4JJNK 4YRSA 4YRTA 1JJ2A 3RERA 4MDWA 4PJOF 3J81E 1VQLT 3M9QA 1YFTA 3CBPA 3I56A 4A4KA 5LJ3g 3FRNA 4EO4A 3HRSA 3CCET 3QNEA 3NTIA 4DA4A 1Q7YU 4G85A 3EFRA 2KDSA 3OS0A 4XTXA 4R55A 3OW2A 1WJQA 3A7UA 4LDWA 5KH6A 2KAFA 2QDYB 3TREA 1I4K1 2RHYA 3JCMJ 2LX9A 1H641 2DEQA 3QUIA 4J83A 3M59A 4CS3A 2XD0A 3HRKA 1YJWT 1VUBA 4XEOA 3PGGA 4HWSA 3LWHA 2RK1A 2E6ZA 4M75G 2XI9A 4K87A 2PMEA 1HK9A 4FM4B 1OZ2A 2RA2A 3QO8A 4N4HA 3QJ6A 1Q86C 3J7AF 3CC4T 4YTLA 4YRIA 4KR2A 4IUPA 2KQWA 2DXUA 1M9SA 1N6AA 4OB1B 4XK8E 5D6XA 3JB9I 4ME7A 2RM4A 3MQZA 5CCAA 4A4HA 3UFGA 4M7AE 2O4XB 4A4GA 3HRIA 3HXVA 4TTVA 4HKEA 2PQWA 1YJWA 1B34B 2GFAA 3MP8A 1DJ7B 1KMNA 3G6ET 2I4LA 4XTYA 2CJBA 2Q7HA 4RMFA 3HXZA 2G3RA 12ASA 3OA6A 1ASZA 3NEMA 1NJ8A 1KQ2A 1WPYA 4O2DA 4NL3A 2HD0A 4JLIA 4M7DC 3X26B 4HT4A 5CR2A 4F7UF 3P8HA 4EMKB 4O6JA 3CC4A 3P8TA 1BI1A 4HWTA 5C53B 2QHVA 1H4VB 1BIBA 3CXCS 3S3NA 3JCMQ 4HCZA 4OB0B 1J5WA 4QQDA 3QKJA 5CVIA 3QO3A 3C4SA 5GAOp 2RHXA 3R6OA 3MF2A 3S3MA 4E7HA 2KVQG 3G6EA 2QQSA 3GLXA 3S6WA 4M77C 3NFCA 4CRIA 3VQWA 4M7DA 1UGRB 4BDYA 2KY9A 3META 2DDZA 2CZ6B 4CH6A 2VV5A 3J80E 1M5Q1 1O75A 2MWOA 3VUBA 2E41A 1YJ9T 3QSUA 3TEHA 2LC4A 4MDXA 3M58A 5GAMj 4HWOA 4Y91A 5CKDA 4C5HA 2EWNA 3W3SA 3MF1A 4OGCA 4CH4A 1JB0E 3OYYA 2LT1A 2AMCB 3IKLA 4C5IA 1W4SA 4Q15A 2LCLA 1KQ1A 4YRLA 2YLBA 4P3NA 4M75F 3P8BB 3MEVA 1USYC 2XDBA 4NL2A 3OW2S 2E65A 3JCMW 4XTUA 3QO5A 5C6SA 3X28B 2RD1A 3FDRA 3CD6T 4EDUA 5LJ3j 1UGPB 1MHNA 2QXFA 4M78E 4BB7A 4PLLA 2E12A 2ZT7A 4J8OA 3CC2T 3A8LB 4HA8A 4C92C 4QVDA 1KC8U 1NYRA 1USYA 5HGQA 5GAMh 3FC3A 2F5TX 1BI2A 4YRMA 2R5AA 3TEHB 4II1A 2LCCA 1PYSA 4H2VA 3NELA 3CD6A 1Q7YC 5FU6C 3L4GB 2ZR3A 2ZZGA 1QW1A 4ELZC 1BKBA 4KR3A 4ZGEB 1M90U 5CQXA 4C92A 3DSQA 1H4SA 4TVWA 3LSQA 2I4NA 1G51A 3CC2A 4YRCA 3RL6A 4M77G 5L8RE 4D6WA 2MF2A 2XG8D 4MZTA 4M7AB 2KSSA 5LJ3h 4QVZA 2Y4YA 4ZTUB 4XU1A 3CCMA 4J15A 2ZNIA 1VQ7T 2ODRC 5HK0A 2DQ3A 3HRTA 2DKGA 2ZPBB 2WSCE 5D6WA 2R5MA 3V7SA 4DOVA 2AKWA 2L3RA 2ZCFB 4CH5A 1KOGA 2K5FA 1I5LA 5GMKm 3CEYA 2XICA 2EYQA 1VIFA 3OYIA 4YRGA 1KD1U 2PUOB 3JB9G 3A5ZB 3HFZA 3RKWA 1YBYA 4A4FA 2OAUA 4PJOD 2JTFA 2LQKA 1X2HA 3ZEHA 2ZT6A 4H2WA 3JB9H 1FWZA 1UEBA 1V29B 2XKOC 4P71C 5GAN5 2XK0A 3VU3C 1HC7A 2Y90A 1K9MU 3MO8A 1VQ7A 2IVWA 1Y7XA 2PVDB 3QZ9B 3CCVT 1FX7A 2MI6A 3QHSA 4YRNA 4P5NA 1RL2A 3HP9A 4YROA 3HFOA 5GAOq 3CCJT 3RMSA 1VQ6T 1Z7NA 3OSSC 4NOYA 4E47A 1VQPT 2AHJB 2DTIA 3C94A 1VQOT 2DD4A 3VYGA 1WYDA 1N9RA 3OB9A 2LDMA 5DLQE 1GGMA 1ADJA 1O9SA 2AKWB 1X2GA 5FU6B 1SERA 4CI0C 4K88A 2ZCEA 1KMMA 4JUVA 3RKXA 4M7DF 1KHCA 5GAMf 2GFUA 4HVCA 2ZIOA 2WACA 3HPWA 4UP8A 2Y4XA 5GAN4 3SB2A 3QTCA 2VGMA 3L2QA 2DAQA 1VQKT 3OYMA 5HKCA 1JRIA 2R57A 4M78B 3UPUA 5GAOn 3CCJA 4KQEA 2A7YA 1XQHA 1VQ6A 2JTMA 4C8QG 1VQPA 2CJ9A 5AYFA 1X01A 3LGFA 3CXCA 2ZIMA 4E51A 1NJ6A 1SESA 2RI5A 1WU7A 4M77F 4UP7A 2E10A 1SETA 1Z7MA 1NJIU 5HY6A 3I56T 4LVMA 5FU7C 4CS4A 4C0GA 4A53A 5LJ3f 2C06A 4BD3A 3ERRA 1BYMA 3SDZA 3JCMX 1NJ2A 4MZPA 2P0LA 1BI3A 3UGTA 3OYGA 3A8OB 4QQGA 4F7UG 5GMKi 4TVYA 5GMKl 1VQKA 3HXWA 3JB9F 1YJNT 2EKOA 4E7LA 2D9TA 1VQ4A 3E9GA 5KCOA 5C0MA 3HRUA 1BI0A 1E22A 4XAXB 1IL2A 4VUBA 4QQ6A 2RHQB 2RJEA 4Q5WA 4EMKC 3WQZA 1B70B 3CMAT 3BFMA 2ZXFA 3TEEA 5GAMd 3LSSA 2V8KA 1KC8C 5LJ5g 5CQYA 3MEYA 1XTDA 2O4XA 4ZTFA 1B34A 2XHCA 3MEWA 2DO3A 3RIRA 1LOJA 4C5EA 2RI2A 5KE3A 1KHIA 5GANe 1X54A 3LX7A 4C92F 1RI0A 1YJNA 3PZCA 4L5GA 1ZQ1A 2WSFE 3GPLA 4EMKA 3HY1A 4KBMB 4JS4A 3A7AA 2ZTGA 3CCQA 1LJOA 1EFWA 1LNXA 5LJ3d 1N8RU 4M75D 1OYXA 4JRQA 3A8HB 4IURA 2E3CA 3CMAA 3JRZA 3JCMe 2ZPHB 5CKHA 2ZNJA 4HWPA 2CS7A 5FRMA 2GQVA 3P8DA 2QQ9A 2LVMA 1FYFA 1W2BS 2YLCA 3KFUA 3CMQA 2M0OA 3URGA 3SD4A 1Y96A 2DZ9A 3AHUA 2RH2A 3V8KA 3WXMB 5FU7B 3HXXA 2PU9B 4C8QF 2EQKA 4YRKA 3OS1A 4N0AC 4LD6A 3PNWC 2K3XA 3V7RA 4PHCA 2EJFA 3HL8A 2K4YA 1BBUA 2HNIA 3I55T 2P5IA 1M1KU 2PVGB 3LYIA 4TVRA 1IZ6A 2AMCA 4H2YA 3G7ZA 4FIBA 2R58A 2ZZFA 2EJGA 3VBBA 4WI1A 1K9MC 2DQ0A 2ZR2A 2ARTA 2K5IA 1X56A 1B8AA 4L87A 4BE2A 3QJYA 4L6V5 1G5IA 3TEGA 2FVUA 4N0AA 2L8DA 5C52B 1M8VA 3E19A 4WJ3M 2ZPFB 3HHTB 3M5AA 2X35A 2M16A 2BUDA 5E3IA 3E1SA 3IG2A 3VJPA 2RHSB 4HCCA 2X4XA 2K57A 2H3JA 4YP0A 4PJOE 1X55A 3I55A 1QVFS 1NZ9A 3ICAA 1Y96B 4JLGA 4XQ3A 4X5OA 1PSFA 1ASYA 5I2MA 1VQ8T 1K8AU 4M7AC 3CBOA 1EIFA 2QHUA 4QW2A 3GNFB 3V8JA 2EL9A 1MGQA 4YYEA 3F70A 3CCUA 3LGLA 2DZCA 5K1XA 1B7YB 4TVAA 4H2XA 3CMEA 1E1TA 4OMFB 4X34A 2CKKA 2X4JA 4H2TA 4Z02A 3KUFA 3CCRA 4BI8B 3L4GA 4ZN1A 4CH3A 2K3YA 3QO7A 3VUZA 3RKYA 4TWAA 1VIEA 3T9NA 3REUA 2VXEA 4M7AA 3PTAA 1NJIC 1PSEA 5GANf 2DIQA 3FEOA 3RGLA 3MCAB 2YHTA 4O5VA 3VQXA 3UGQA 1VQ8A 2QQRA 5CK9A 3GNGA 5LJ5j 4HT8A 2QHTA 3EFSA 1KQSA 1UB4A 3HSBA 4LVKA 4LVLA 4JRKA 2DU5A 1UGQB 3A5ZA 2E70A 1Q82U 3LH0A 2ALYA 3WVDB 2RHZA 4M7DD 1AHJB 3ASKA 5IT9E 3CCMT 4GY5A 3X20B 2K2VA 3CBMA 4IKFA 3GP8A 4M7DG 2XU8A 4YDQA 4E7KA 4BE0A 2V8JA 3FLGA 4TVAB 5GANg 4H2XB 2QA4T 4PJOA 1VQ5T 4PLIA 5LJ5e 1EOVA 4IUQA 4BACA 1XNIA 3JCMb 2P4TA 3FIFA 4F7UE 2CZ7B 3V7CA 3OYCA 3S3OA 4KUDK 4MMLA 1GXIE 2D6FA 4X9CA 4M77D 5J3BA 4LDYA 3JCMg 3BY7A 1WQ7A 4K86A 2DTOA 4P72C 3OYJA 3X25B 3KXTA 1VQZA 2RJFA 1YI2A 1ADYA 3JCMc 5GANd 4M78C 1WJSA 4J6XA 4YPFA 1N8RC 4FU6A 3VQYA 4RKUE 2C8MA 4B9XA 2X4YA 2P0QA 2RHUA 1YIJT 3CPFA 3PT9A 1JBMA 2LTOA 3A31A 2CYZB 1XOVA 3JB9D 2QA4A 4H02A 1N9WA 1VQ5A 5GMKe 4IUVA 2L89A 1Q86U 4P73C 1K73U 2FYKA 2OTJT 3NTHA 2ALYB 1ATIA 3NETA 4P72A 4OF1A 1M1FA 4PNOA 5CO7A 3VYHB 2NLUA 4M78A 2EIFA 4X9DA 2P0KA 3BJUA 1EIYA 2LNVA 3VKIA 4MMKA 5I2SA 4PJOB 1YFRA 2Q7GA 1G3YA 5M9OA 1E24A 4E7IA 4OVAA 3HY0A 1SSFA 1M1KC 1S72T 1YIJA 4M75E 5A0GA 2K5LA 4P73A 2M9UA 1G3TA 4C92D 4RQEA 3GOXA 4UP9A 1N9SA 4BW9A 4XU3A 4C92G 3OSVA 3ER0A 2OTJA 1NPRA 1W2BA 5LL6S 1YITT 4H2UA 3BW1A 3CPWS 4XTVA 4YREA 4LDVA 4N4GA 3A8GB 3HTZA 4XTZA 3OMGA 2BIVA 4J7IA 2I2LA 2IY5A 4YRQA 1QP3A 1N27A 3JB9J 5GAN7 4RCCA 3E9FA 4PG3A 4P3OA 3A8MB 3QG1A 3M4QA 1QP2A 3L2WA 2HBPA 2RHQA 1YHQA 3DLMA 1L0WA 2ARSA 1B70A 1S72A 2RB6A 1WLEA 2EFIA 2DPPB 3HFVA 4C8QD 3HKSA 3CC7T 3PIPA 1KQSS 1ZHIA 3JCMP 2JOYA 1K8AC 1LYLA 1VQ4T 3I7FA 4TQFA 1EIYB 3N5BB 2RK2A 1M4ZA 5EG2A 1YITA 2JNGA 4M75C 2PVOB 4BWAA 3QIIA 3MEAA 4ZIBA 2E6NA 3PCOA 5A0LA 1W66A 3LLRA 2PUKB 1G5VA 5LJ5f 4EMGA 4M7AF 2DTHA 2QEXT 4C0FA 3OYNA 3OBWA 4QVCA 3BDLA 1QVFA 1G3WA 3OYBA 4JRPA 3GF5A 4H2SA 3NENA 2F5KA 3CC7A 1VQNT 4YRJA 5GAOm 4M75A 4IUTA 3SWNB 5GANj 2IY5B 5FRNA 3JAME 4YCWA 2QI2A 4CS2A 2YRVA 3CCQT 3MP6A 4ZN3A 4OGEA 2MAMA 3MP1A 1H3ZA 4YCVA 5K1PA 2RJDA 3PMTA 2ZT5A 4A54A 5ELOA 4P74C 2QEXA 4KUIA 2EJ9A 3RESA 2EQMA 2CGHA 3QZ5B 3C95A 1VQNA 1U1SA 3QPHA 3RMQA 1NYQA 3PCOB 1YFSA 1I81A 1M90C 2VGNA 3RUXA 4C0DB 2M1HA 1M1GA 3M54A 5CKBA 1RIQA 3INZA 5LJ5d 4BY6B 2MWPA 3RF1A 1D3BB 2CZ1B 3A7RA 5GANh 4P74A 1FXXA 3PIOA 3OD1A 1C0AA 3QDRB 4YCUA 1G3SA 2F69A 4JDSA 3CCLA 1R8OB 3OY9A 2RHSA 4M75B 4M7DE 4C0ZA 3DLLA 4P75C 5GAN2 1VQLA 2RO0A 3JCMh 3CCEA 2LQ8A 1KD1C 3QYHB 1K73C 4M78F 1B7YA 5A0DA 3DKMA 2DK3A 4M77E 2QQBA 1VQMT 4FT2A 4J6YA 3M57A 2Q7EA 5J39A 1Q81U 5CKEA 4P75A 3MEUA 2XDDA 4N4IA 1Y71A 4OLFA 3OYEA 2CIMA 3L2VA 2DXTA 3CCUT 3CMET 3IKMB 3CCRT 5GAOl 3OYAA 2WSEE 11ASA 2E1HA 1QE0A 4LDXA 2NS6A 2DJZA 4NCXA 3ME9A 1JJCA 3M56A 2JZ2A 1G5HA 5F5WA 3O8VA 1X6OA 4GLKA 1VQMA 1EVKA 3IALA 4YRRA 2ZZDA 1SRYA 1E1OA 3UH0A 3M53A 3OYKA 4IUUA 2I4OA 4RG8A 5I21A 5A2QE 2ZPEB 2VXFA 4LD9K 2KMTA 2Q5HA 1OI1A 1QVGA 3UT1A 4KT0E 3MHXA 2P0PA 3CCST 3M4PA 4C92E 3DB3A 1WGSA 2O01E 2CZ0B 3CPWA 4LNSA 3L2UA 5CAIA 1JJ2S 5FLXE 3M4YA 3L2RA 1U8RA 4ATOA 1HXDA 1NJ5A 2EQJA 2HQXA 3G1ZA 4R56A 4RG2A 2A3LA 4M77A 1NPPA 2ZPGB 4P3PA 2QQAA 2DVEA 4PJOC 4J7FA 4XU0A 2I4MA 3X24B 3HXUA 3HFNA 1JJCB 5D6YA 4BI3A 3CCSA 2E5QA 5FROA 3FB9A 2DXBA 3SFMA 3JCMf 4C8QE 2VYTA 4AH6A 4Y28E 4A4EA 1YI2T 4LDUA 5GAMe 2FL7A 2VC8A 1YJ9A 3OYHA 3TUPA 3WVEB 1WQWA 2XGTA 4PKCC 2J3MA 2ARUA 3JCMV 2E5AA 4EMHA 2ZT8A 2FHDA 3GIBA 1B76A 4J6WA 3KBGA 2MMPA 3P8YA 4M7DB 3C12A 1NE8A 4RCBA 4TQDA 3E9IA 1P92A 2X4WA 5HK3A 5GMKj 4G84A 2RI3A 3DB4A 4BDZA 3VQVA 4HT9A 1VQ9T 1H4QA 5KCHA 5ELNA 1Y07A 3OS2A 5LJ3e 4NS5A 2A8EA 3RACA 4M7AD 2CJAA 5LJ5h 1WNLA 3PMIA 1YGBA 4M77B 4RDXA 1NJ1A 4KULA 2ZZEA 4M7AG 4RMOA 3M55A 4ELYC 3UDCA 4C8QC 2DD5A 3A74A 3ZFJA 3Q1JA 3FJPA 4E7JA 1OZ3A 2RJCA 4DPGA 3V8LA 4PL6A 3JCMd 5GAN8 2JUFA 3A32A 3G71T 1TH7A 4L59A 2HAXA 1QVPA 2ZGWA 4FL6A 1VQ9A 4WF2A 4OB3B 4HCBA 3L1AA 3TU4K 1EQRA 5GAN3 3QBYA 5GMKh 2GF7A 1BBWA 2FB7A 4HWRA 2E64A 3G4ST 4C8QA 3SWNC 1YHQT 4ZTJA 4FSXA 3L42A 3BDUA 4EX5A 2BKDN 3L2ZA 1QVGS 1YB3A 4PJOG 1Q81C 1KG1A 4WJ4A 2JN0A 3LW5E 2KK4A 3OQ5A 5CKFA 2DU7A 1PYSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VBB A;  2ZT7 A;  5C51 B;  4WI1 A;  2J3L A;  2DQ0 A;  2ZR2 A;  2ART A;  1X56 A;  4HA8 A;  1B8A A;  4C92 C;  4L87 A;  2QTX A;  4QVD A;  3LC0 A;  1G5I A;  4XEM A;  5K1P A;  4YCV A;  1NNH A;  1NYR A;  4N0A A;  3TEG A;  4C92 B;  1USY A;  2ZT5 A;  4A54 A;  5ELO A;  1M8V A;  5HGQ A;  5C52 B;  5GAM h;  4F7U A;  3R07 A;  4P74 C;  4WJ3 M;  3SWN A;  5GAO r;  2EJ9 A;  4YRM A;  1I8F A;  4Q6G A;  3RES A;  2CGH A;  5E3I A;  3TEH B;  1YCY A;  3IG2 A;  1PYS A;  2RHS B;  1U1T A;  4H2V A;  2K57 A;  3NEL A;  3M4G A;  4YP0 A;  1U1S A;  4PJO E;  1X55 A;  4P71 A;  3L4G B;  2ZR3 A;  2ZZG A;  1NYQ A;  3PCO B;  1YFS A;  4XU2 A;  4KR3 A;  5KNN A;  3P8V A;  1I81 A;  3ICA A;  1Y96 B;  3RUX A;  4XQ3 A;  4C92 A;  3DSQ A;  1RIQ A;  1H4S A;  3INZ A;  4TVW A;  4X5O A;  3LSQ A;  2I4N A;  5LJ5 d;  1ASY A;  1G51 A;  3RF1 A;  4M7A C;  1D3B B;  4M78 D;  1EVL A;  5GAN 6;  2QHU A;  3A7R A;  4YRC A;  5GAN h;  4M77 G;  4P74 A;  3RL6 A;  3V8J A;  3HFZ B;  2EL9 A;  4YRP A;  1MGQ A;  4M7A B;  2ODR D;  3OD1 A;  4YYE A;  1HTT A;  4RQF A;  2DZC A;  5LJ3 h;  1B7Y B;  4TVA A;  5K1X A;  1C0A A;  4YCU A;  4M78 G;  4H2X A;  4C8Q B;  1E1T A;  2RHS A;  1BIA A;  3REX A;  4ZTU B;  4H2T A;  1QF6 A;  3HXY A;  4M75 B;  4M7D E;  4XU1 A;  4J15 A;  2ZNI A;  4P75 C;  2ODR C;  5GAN 2;  2DQ3 A;  2PMF A;  3L4G A;  2DKG A;  4CH3 A;  3QO7 A;  2EAY A;  3V7S A;  2AKW A;  2G4C A;  4CH5 A;  1KOG A;  3RKY A;  1I5L A;  5GMK m;  4UPA A;  3JCM h;  4TWA A;  1D3B A;  4YRG A;  2QHS A;  4ZTZ B;  4J5Y A;  4YRF A;  3REU A;  3JB9 G;  2VXE A;  3HFZ A;  4M7A A;  3RKW A;  4M78 F;  1B7Y A;  4JRI A;  5GAN f;  3E9H A;  4PJO D;  3RGL A;  1H4T A;  1X2H A;  2YHT A;  3VQX A;  3UGQ A;  4F7U B;  2ZIN A;  4M77 E;  4J6Y A;  2ZT6 A;  5GAM g;  2Q7E A;  4XTW A;  5LJ5 j;  4H2W A;  3JB9 H;  4HT8 A;  4P75 A;  2QHT A;  2C7I A;  3EFS A;  4P71 C;  5GAN 5;  3VU3 C;  1HC7 A;  2Y90 A;  4V2S A;  3HSB A;  2XTI A;  4OLF A;  4JRK A;  2DU5 A;  4OP0 A;  5DY9 A;  2CIM A;  2DXT A;  3A5Z A;  4DQ2 A;  2ALY A;  3A5Y A;  4M7D D;  2Q5I A;  3QHS A;  4YRN A;  4YRS A;  4YRT A;  4YRO A;  3IKM B;  3RER A;  3HFO A;  5GAO l;  4PJO F;  4M7D G;  5GAO q;  1Z7N A;  4YDQ A;  4NOY A;  11AS A;  2E1H A;  1QE0 A;  1YFT A;  4TVA B;  5GAN g;  2DTI A;  2DJZ A;  4H2X B;  5LJ3 g;  4NCX A;  4PJO A;  1WYD A;  1JJC A;  1N9R A;  4EO4 A;  1G5H A;  5LJ5 e;  3QNE A;  1EOV A;  5F5W A;  4G85 A;  3EFR A;  1EVK A;  3IAL A;  4YRR A;  1SRY A;  3JCM b;  1GGM A;  1E1O A;  3FIF A;  1ADJ A;  4F7U E;  2AKW B;  1X2G A;  4XTX A;  3V7C A;  1SER A;  4MML A;  3UH0 A;  4X9C A;  4K88 A;  2ZCE A;  4M77 D;  3A7U A;  1KMM A;  4JUV A;  2I4O A;  3RKX A;  4M7D F;  5I21 A;  1I4K 1;  2VXF A;  3JCM g;  3BY7 A;  2Q5H A;  5GAM f;  4HVC A;  1WQ7 A;  4K86 A;  2ZIO A;  2DTO A;  3JCM J;  4P72 C;  4UP8 A;  1H64 1;  1VQZ A;  5GAN 4;  2DEQ A;  3QUI A;  3SB2 A;  1ADY A;  3QTC A;  3JCM c;  5GAN d;  4M78 C;  4J6X A;  4CS3 A;  4YPF A;  3HRK A;  3VQY A;  1JRI A;  4M78 B;  2C8M A;  3M4P A;  4C92 E;  4XEO A;  5GAO n;  3PGG A;  4KQE A;  4HWS A;  4C8Q G;  2CJ9 A;  1JBM A;  4M75 G;  1X01 A;  3A31 A;  4K87 A;  4LNS A;  2PME A;  1HK9 A;  3JB9 D;  2ZIM A;  4H02 A;  4E51 A;  5CAI A;  1NJ6 A;  2RA2 A;  1N9W A;  1SES A;  3QO8 A;  5GMK e;  1WU7 A;  4M77 F;  1HXD A;  1NJ5 A;  4UP7 A;  4P73 C;  2E10 A;  1SET A;  2FYK A;  1Z7M A;  2ALY B;  3G1Z A;  1ATI A;  3NET A;  4YRI A;  4KR2 A;  4CS4 A;  4P72 A;  4A53 A;  5LJ3 f;  2DXU A;  4M77 A;  4PNO A;  3ERR A;  4P3P A;  3JCM X;  1NJ2 A;  4M78 A;  2DVE A;  3JB9 I;  4X9D A;  2P0L A;  4PJO C;  3BJU A;  3UGT A;  1EIY A;  4XU0 A;  2RM4 A;  4F7U G;  2I4M A;  5GMK i;  4MMK A;  3HXU A;  4PJO B;  1YFR A;  2Q7G A;  3UFG A;  3HFN A;  1JJC B;  4M7A E;  4TVY A;  3HXV A;  3HRI A;  5GMK l;  1E24 A;  4TTV A;  3FB9 A;  1B34 B;  3JCM f;  3JB9 F;  4C8Q E;  3HXW A;  3HY0 A;  1KMN A;  4AH6 A;  4M75 E;  2I4L A;  4XTY A;  2CJB A;  2Q7H A;  5GAM e;  4RMF A;  3HXZ A;  4P73 A;  2VC8 A;  1E22 A;  4C92 D;  3TUP A;  1IL2 A;  1WQW A;  12AS A;  2XGT A;  2RHQ B;  1ASZ A;  4RQE A;  2J3M A;  2ARU A;  3JCM V;  2E5A A;  1N9S A;  3NEM A;  4UP9 A;  4BW9 A;  4EMK C;  1NJ8 A;  4EMH A;  1KQ2 A;  1WPY A;  2ZT8 A;  4O2D A;  3WQZ A;  1B76 A;  3GIB A;  4NL3 A;  4J6W A;  1B70 B;  4JLI A;  4M7D C;  3BFM A;  4XU3 A;  4C92 G;  2ZXF A;  4F7U F;  5GAM d;  3LSS A;  4EMK B;  3P8Y A;  3P8T A;  4HWT A;  5C53 B;  4M7D B;  2QHV A;  3BW1 A;  4H2U A;  4RCB A;  4XTV A;  5LJ5 g;  1H4V B;  4TQD A;  4YRE A;  1BIB A;  3MEY A;  3JCM Q;  3E9I A;  3HTZ A;  4XTZ A;  1B34 A;  1J5W A;  2I2L A;  5GMK j;  2IY5 A;  4G84 A;  4YRQ A;  3JB9 J;  3QO3 A;  5GAN 7;  5GAO p;  4RCC A;  3RIR A;  1LOJ A;  4P3O A;  4PG3 A;  3VQV A;  4HT9 A;  3MF2 A;  3M4Q A;  1H4Q A;  5ELN A;  5GAN e;  1X54 A;  2RHQ A;  5LJ3 e;  1L0W A;  4C92 F;  2ARS A;  3PZC A;  1B70 A;  3RAC A;  2RB6 A;  4M77 C;  4EMK A;  4M7A D;  1WLE A;  5LJ5 h;  2CJA A;  3HY1 A;  1WNL A;  1YGB A;  3VQW A;  4M7D A;  3A7A A;  4M77 B;  4RDX A;  1NJ1 A;  4C8Q D;  3HFV A;  2ZTG A;  1LJO A;  1EFW A;  1LNX A;  3JCM P;  2ZZE A;  5LJ3 d;  2DDZ A;  4M7A G;  4M75 D;  4CH6 A;  1LYL A;  1M5Q 1;  3I7F A;  4TQF A;  2E3C A;  1EIY B;  4C8Q C;  3JCM e;  2ZNJ A;  2E41 A;  4HWP A;  3QSU A;  3TEH A;  4M75 C;  5GAM j;  3A74 A;  4HWO A;  4Y91 A;  3FJP A;  4BWA A;  4DPG A;  2EWN A;  3W3S A;  3V8L A;  3JCM d;  3MF1 A;  4ZIB A;  1FYF A;  3PCO A;  4CH4 A;  2YLC A;  5GAN 8;  3KFU A;  3CMQ A;  3A32 A;  2AMC B;  1W66 A;  3IKL A;  1Y96 A;  1TH7 A;  5LJ5 f;  2DZ9 A;  4EMG A;  2ZGW A;  4M7A F;  2DTH A;  4WF2 A;  3AHU A;  3V8K A;  4Q15 A;  3HXX A;  1KQ1 A;  4C8Q F;  3L1A A;  4QVC A;  4YRL A;  1EQR A;  5GAN 3;  4YRK A;  2YLB A;  4P3N A;  5GMK h;  4M75 F;  4N0A C;  1BBW A;  1USY C;  2FB7 A;  4HWR A;  4NL2 A;  2E64 A;  2E65 A;  3JCM W;  4XTU A;  3QO5 A;  4H2S A;  3NEN A;  3V7R A;  4PHC A;  2EJF A;  3SWN C;  4C8Q A;  2RD1 A;  4YRJ A;  5GAO m;  4M75 A;  3BDU A;  1BBU A;  4EX5 A;  2HNI A;  3SWN B;  5GAN j;  2IY5 B;  2P5I A;  3L2Z A;  1YB3 A;  4PJO G;  5LJ3 j;  4WJ4 A;  2JN0 A;  4M78 E;  4YCW A;  4CS2 A;  2AMC A;  4H2Y A;  2DU7 A;  1PYS B;  2ZZF A;  2EJG A; 
#chains in the Genus database with same CATH topology
 2V1R A;  2HQE A;  5DLO A;  2EYZ A;  5C51 B;  2LRQ A;  2J3L A;  1ZSZ C;  2EGE A;  3OYL A;  5I11 A;  2M0Y A;  1WXU A;  2DXC A;  2EQU A;  2QTX A;  3VV0 A;  2L3S A;  3OS5 A;  3LC0 A;  3CC4 Q;  4XEM A;  2GCX A;  3G71 A;  1WLP B;  1NNH A;  4C92 B;  1NJI R;  3OMC A;  3H6Z A;  4F7U A;  3R07 A;  3RBB B;  3SWN A;  5GAO r;  1QLY A;  2AKL A;  4CC2 A;  1K9A A;  1I8F A;  4Q6G A;  3JSC A;  2IG0 A;  2JVV A;  5IN1 A;  3OBY A;  4ZGD B;  2H8H A;  1SSH A;  1R77 A;  1YCY A;  3G4S A;  1AWW A;  4DOW A;  1U1T A;  3UAT A;  3M4G A;  2ROT A;  1M30 A;  5DM7 R;  1IRE B;  2AKK A;  3PFS A;  4P71 A;  2X3X D;  4LUD A;  4JZ4 A;  2VUB A;  2CT4 A;  5AT1 B;  4C0D C;  3I55 Q;  4MZM A;  2B8A A;  4XU2 A;  5KNN A;  1W2B P;  3P8V A;  4BY6 C;  2OTL T;  2B86 A;  2W10 A;  2D8H A;  4OB2 B;  2LT4 A;  2VWF A;  1EVL A;  4M78 D;  5GAN 6;  3EAE A;  3QYG B;  3HFZ B;  4YRP A;  2ODR D;  2LX7 A;  1HTT A;  4RQF A;  2XID A;  2DA9 A;  2SEM A;  3CCV A;  1PRM C;  1U5S A;  2RNA A;  4M78 G;  4C8Q B;  4EPC A;  1BIA A;  4OMP A;  3REX A;  1QF6 A;  3REB B;  3HXY A;  2HDA A;  1H8K A;  2ZPI B;  4ZGJ B;  4C5G A;  5KE2 A;  1WYX A;  2PMF A;  3NTK A;  4B9W A;  3A98 A;  2V8I A;  2EAY A;  1Q7Y R;  1G8X A;  1QKX A;  2G4C A;  1U06 A;  3EG3 A;  2IPO B;  4BE1 A;  1VQO A;  4UC4 A;  4UPA A;  3VS1 A;  1UGS B;  3QXE B;  1D3B A;  4LVJ A;  1FYN A;  1AD5 A;  3TCJ A;  2QHS A;  4ZTZ B;  2CP2 A;  4J5Y A;  4HCK A;  2JXB A;  4YRF A;  2J6F A;  3M0P A;  1R0B G;  4JRI A;  4FT4 A;  2DIG A;  4PJM A;  2O2O A;  1ABO A;  4JS5 A;  3E9H A;  2D0Q B;  2OTL A;  2L5Q A;  4KH1 B;  1H4T A;  4F7U B;  4ORZ A;  4AFU C;  2A0F B;  2ZIN A;  1VQ8 Q;  4BI4 A;  3H8Z A;  5GAM g;  4XTW A;  1N8R R;  1K1Z A;  4PJJ A;  5IAY A;  2C7I A;  5J26 A;  1WJR A;  3ZBD A;  1X75 C;  2XDP A;  4JZ3 A;  3LWI A;  4V2S A;  2XTI A;  5CIU A;  3JV3 A;  3OYD A;  4OP0 A;  5DY9 A;  4BUG A;  2RQR A;  1QVF P;  1ZBX A;  1Q82 C;  4DQ2 A;  3OYF A;  3CCL T;  3A5Y A;  1GL5 A;  4LVI A;  5GJW B;  2Q5I A;  2RHI A;  3UWN A;  4JJN K;  4YRS A;  4YRT A;  1JJ2 A;  3RER A;  4MDW A;  4PJO F;  2K79 A;  3J81 E;  1VQL T;  1JXM A;  3M9Q A;  1YFT A;  3CBP A;  1OOT A;  3THK A;  3I56 A;  2J6O A;  4A4K A;  5LJ3 g;  3FRN A;  4EO4 A;  3HRS A;  3CCE T;  2ATC B;  1QCN A;  3QNE A;  3NTI A;  2KNB B;  4DA4 A;  1Q7Y U;  4G85 A;  3EFR A;  2KDS A;  4LUE A;  3OS0 A;  2DX1 A;  2BZ8 A;  4XTX A;  1RAI B;  4AMC A;  4R55 A;  2KXC A;  4AT1 B;  3OW2 A;  1WJQ A;  3A7U A;  4LDW A;  8AT1 B;  5KH6 A;  2KAF A;  2QDY B;  3TRE A;  3EG0 A;  1I4K 1;  1U3O A;  2QG9 B;  4R0K A;  1RLP C;  3CC2 Q;  2RHY A;  1D09 B;  1M2V B;  3JCM J;  2LX9 A;  1H64 1;  1KK7 A;  3EH2 A;  2DEQ A;  3QUI A;  4LN2 A;  1RAD B;  2D8J A;  3M59 A;  4J83 A;  1PCX A;  4CS3 A;  2XD0 A;  1HSQ A;  3HRK A;  1YJW T;  1WHH A;  1VUB A;  4XEO A;  3CCM Q;  3PGG A;  2O88 A;  4HWS A;  3LWH A;  2RK1 A;  2ABL A;  2J7I A;  1SPK A;  2E6Z A;  1X2K A;  4M75 G;  2XI9 A;  4K87 A;  1K0S A;  2PME A;  1HK9 A;  4FM4 B;  1OZ2 A;  2RA2 A;  3QO8 A;  4N4H A;  1VQ5 Q;  3QJ6 A;  2EQI A;  1Q86 C;  3J7A F;  4LXC A;  3CC4 T;  1GRI A;  3IQL A;  4YTL A;  3UF4 A;  1WHJ A;  4YRI A;  4IUP A;  4KR2 A;  2KQW A;  2DXU A;  1M9S A;  1N6A A;  1UHC A;  4OB1 B;  4XK8 E;  2DRM A;  5D6X A;  2COZ A;  1YCS B;  3JB9 I;  1WX6 A;  4ME7 A;  2FRY A;  2COY A;  2RM4 A;  3MQZ A;  4HVV A;  5CCA A;  4A4H A;  3UFG A;  4M7A E;  2O4X B;  2RPN A;  4A4G A;  3HRI A;  3HXV A;  4TTV A;  4HKE A;  2PQW A;  1MUZ A;  1YJW A;  1B34 B;  2GFA A;  3MP8 A;  1DJ7 B;  1KMN A;  3G6E T;  2M51 A;  2Z0W A;  2I4L A;  1PD1 A;  4XTY A;  4J9B A;  2CJB A;  2Q7H A;  1YIJ Q;  4RMF A;  3HXZ A;  2G3R A;  5FW9 A;  3EGX A;  3EH1 A;  4F04 B;  1X6B A;  1M3B A;  12AS A;  3OA6 A;  1NEG A;  1ASZ A;  3NEM A;  2DL7 A;  1NJ8 A;  1KQ2 A;  1WPY A;  4O2D A;  1B07 A;  4NL3 A;  2HD0 A;  1VYT A;  4JLI A;  4M7D C;  3X26 B;  4HT4 A;  5CR2 A;  4F7U F;  3P8H A;  4EMK B;  3HTR A;  4O6J A;  3CC4 A;  1BI1 A;  1TS9 A;  3P8T A;  4HWT A;  2EYY A;  5C53 B;  3EG2 A;  2OTJ Q;  2QHV A;  1SF9 A;  1H4V B;  2HL5 C;  1BIB A;  5KYY B;  3CXC S;  3S3N A;  3JCM Q;  4HCZ A;  1D1A A;  4OB0 B;  1K4U S;  1J5W A;  4QQD A;  3QKJ A;  2DF6 A;  2KRS A;  5CVI A;  3QO3 A;  3C4S A;  4J9G A;  5GAO p;  4K11 A;  2RHX A;  1D1C A;  3R6O A;  4D8K A;  1OPL A;  3MF2 A;  6AT1 B;  3S3M A;  4E7H A;  2KVQ G;  1QWE A;  2MYS A;  3G6E A;  2QQS A;  2EGA A;  3GLX A;  3S6W A;  4M77 C;  3NFC A;  4HVW A;  4CRI A;  3VQW A;  4M7D A;  1RAH B;  2MIO A;  2LQW A;  1UGR B;  3VRZ A;  1PRL C;  5KYU A;  4BDY A;  2KY9 A;  3MET A;  2DDZ A;  2J6K A;  2CZ6 B;  4CH6 A;  2PNI A;  2VV5 A;  1RI9 A;  1IRX A;  3J80 E;  1M5Q 1;  4QKU A;  1O75 A;  2NUP B;  2MWO A;  3VUB A;  1VQ6 Q;  3D7S B;  1BBZ A;  1HYO A;  4J9E A;  1WDX A;  2E41 A;  2FG0 A;  1YJ9 T;  3QSU A;  3TEH A;  1NLO C;  2LC4 A;  1ZLM A;  3M58 A;  4MDX A;  1YIT Q;  5GAM j;  4HWO A;  1EZZ B;  4Y91 A;  5CKD A;  4C5H A;  2YSQ A;  2EWN A;  4PFO A;  3W3S A;  1WHL A;  3MF1 A;  4OGC A;  4CH4 A;  1JB0 E;  3OYY A;  2LT1 A;  3EGX B;  2AMC B;  3IKL A;  4C5I A;  1W4S A;  4Q15 A;  2YDL A;  1M90 R;  2LCL A;  1KQ1 A;  4YRL A;  2YLB A;  4P3N A;  4M75 F;  2K3B A;  3P8B B;  3MEV A;  1USY C;  2XDB A;  4NL2 A;  2C0I A;  3OW2 S;  2E65 A;  3JCM W;  4XTU A;  3QO5 A;  1TUG B;  2BZX A;  3CPW P;  5C6S A;  1IB8 A;  3X28 B;  2RD1 A;  3FDR A;  3CC7 Q;  3CD6 T;  9ATC B;  4EDU A;  5LJ3 j;  1UGP B;  1MHN A;  4QT7 A;  1VQ4 Q;  2QXF A;  4M78 E;  1GBQ A;  4BB7 A;  2ROL A;  4PLL A;  4B6M A;  2E12 A;  2ZT7 A;  2K6D A;  4WTO B;  4J8O A;  3CC2 T;  3A8L B;  2HZY A;  4HA8 A;  4C92 C;  1KJW A;  1KD1 R;  4QVD A;  1KC8 U;  1K73 R;  1NYR A;  1USY A;  1KQS P;  5HGQ A;  5GAM h;  3FC3 A;  4F17 A;  2F5T X;  1BI2 A;  4YRM A;  2R5A A;  1LPL A;  1X6G A;  3TEH B;  4II1 A;  2LCC A;  1PYS A;  2RQT A;  4KH0 B;  4H2V A;  2VVK A;  3NEL A;  3CD6 A;  1VQN Q;  1Q7Y C;  3H41 A;  5FU6 C;  3L4G B;  1T0J A;  1WXT A;  2ZR3 A;  2ZZG A;  1QW1 A;  1YJN Q;  4ELZ C;  1WZO A;  1BKB A;  4KR3 A;  4ZGE B;  3A1P A;  1M90 U;  3I35 A;  5CQX A;  5FWB A;  4C92 A;  3DSQ A;  1H4S A;  4TVW A;  3CCQ Q;  2I4N A;  3LSQ A;  1AZE A;  2KRN A;  3G1J A;  1G51 A;  2LP5 A;  4Z8A A;  3CC2 A;  2QGF B;  3SEM A;  4YRC A;  3RL6 A;  4M77 G;  5L8R E;  4D6W A;  2MF2 A;  2XG8 D;  4E7S A;  4MZT A;  1YNZ A;  4M7A B;  4F14 A;  2KSS A;  2EGC A;  5LJ3 h;  3ULR B;  4QVZ A;  2P84 A;  1OEB A;  2Y4Y A;  4ZTU B;  3M0R A;  2XMF A;  4XU1 A;  3C0C A;  3CCM A;  4J15 A;  2ZNI A;  2LJ1 A;  1OUL A;  1VQ7 T;  2ODR C;  5HK0 A;  4FYW B;  2DQ3 A;  3HRT A;  2DKG A;  2ZPB B;  2WSC E;  5D6W A;  2R5M A;  1QWF A;  2JT4 A;  3V7S A;  4DOV A;  2AKW A;  2L3R A;  2ZCF B;  1TSF A;  1H3H A;  4CH5 A;  2YRD A;  1KOG A;  1XJW B;  4ANJ A;  2SRC A;  2K5F A;  1I5L A;  2CH4 A;  5GMK m;  3CEY A;  2XIC A;  2EYQ A;  1VIF A;  2C0O A;  2DL4 A;  4FYX B;  3OYI A;  4YRG A;  3FJ5 A;  1KD1 U;  2PUO B;  3JB9 G;  3A5Z B;  3HFZ A;  2GNC A;  3RKW A;  1YBY A;  1QCO A;  4A4F A;  2DEU A;  2OAU A;  4PJO D;  2JTF A;  2LQK A;  2YRC A;  1X2H A;  1RAF B;  3ZEH A;  2ZT6 A;  2DBM A;  3EHR A;  3JB9 H;  4H2W A;  1PG5 B;  1FWZ A;  3H9N A;  1UGV A;  2CP7 A;  1FMW A;  1X27 A;  1UEB A;  1V29 B;  2KRO A;  2XKO C;  4P71 C;  5GAN 5;  2AZV A;  2XK0 A;  3VU3 C;  2NWM A;  3QDF A;  1HC7 A;  2Y90 A;  1K9M U;  1AZG B;  3MO8 A;  3PVQ A;  3VS2 A;  2KYB A;  1VQ7 A;  2IVW A;  1Y7X A;  2PVD B;  3QZ9 B;  3CCV T;  4OML A;  1FX7 A;  3NMZ C;  2MI6 A;  3QHS A;  4YRN A;  4P5N A;  1RL2 A;  3HP9 A;  4YRO A;  1BCO A;  3BE3 A;  3HFO A;  1H92 A;  1SEM A;  1TUD A;  5GAO q;  3CCJ T;  3RMS A;  1VQ6 T;  1Z7N A;  3OSS C;  4NOY A;  4E47 A;  1VQP T;  2AHJ B;  2DTI A;  2ED1 A;  3C94 A;  1VQO T;  2DD4 A;  2L0A A;  3VYG A;  1WYD A;  1N9R A;  3OB9 A;  2LDM A;  5DLQ E;  4IIM A;  5IHI A;  2DBK A;  1S1N A;  2AK5 A;  1GCQ C;  1VQM Q;  1GGM A;  1ADJ A;  1O9S A;  3M0U A;  1X2G A;  4JJD A;  5FU6 B;  2AKW B;  3PVL A;  4CI0 C;  1SER A;  2KXD A;  4K88 A;  2ZCE A;  3RDV A;  1G83 A;  1KMM A;  4JUV A;  3RKX A;  1ABQ A;  1WHM A;  1NM7 A;  1VYV A;  3UA6 A;  4M7D F;  3NHN A;  3VS4 A;  1KHC A;  1YP5 A;  5GAM f;  2GFU A;  4HVC A;  2ZIO A;  2WAC A;  3HPW A;  4UP8 A;  2Y4X A;  5GAN 4;  3SB2 A;  3CCU Q;  2DM1 A;  1UUE A;  2VGM A;  1FMV A;  1JEG A;  1GFD A;  3QTC A;  3L2Q A;  1T3L A;  3I5R A;  3CME Q;  2DAQ A;  4KGZ B;  1VQK T;  3OYM A;  5HKC A;  1JRI A;  2R57 A;  1VA7 A;  4M78 B;  3UPU A;  3PE0 A;  5GAO n;  3EGD B;  1QKW A;  3CCJ A;  3CCR Q;  2A7Y A;  4RTX A;  1XQH A;  1VQ6 A;  4KQE A;  2JTM A;  4C8Q G;  1YFN A;  1VQP A;  2CJ9 A;  3H0F A;  1VYU A;  5AYF A;  1X01 A;  1GCQ A;  1JU5 C;  3LGF A;  2F2X A;  3CXC A;  2ZIM A;  1V1C A;  4E51 A;  1NJ6 A;  1SES A;  1PKT A;  2RI5 A;  3VS7 A;  1WU7 A;  4M77 F;  1PM3 A;  2JS0 A;  4UP7 A;  1M2V A;  2E10 A;  1SET A;  1Z7M A;  1NJI U;  3U23 A;  5HY6 A;  3I56 T;  2CP0 A;  1SKU B;  4LVM A;  5FU7 C;  4CS4 A;  4C0G A;  4A53 A;  1ACM B;  5LJ3 f;  4AG2 C;  2C06 A;  3TVT A;  4BD3 A;  3ERR A;  1BYM A;  3SDZ A;  3JCM X;  1NJ2 A;  4MZP A;  1AWO A;  2P0L A;  1BI3 A;  3UGT A;  2DER A;  3OYG A;  3A8O B;  1EX4 A;  4QQG A;  4F7U G;  5GMK i;  4TVY A;  2KT1 A;  5GMK l;  4E6R A;  1VQK A;  3HXW A;  3JB9 F;  3CCS Q;  1YJN T;  1MV3 A;  1MMD A;  2EKO A;  4OMM A;  4E7L A;  2D9T A;  1VQ4 A;  3EFO B;  3E9G A;  5KCO A;  5C0M A;  3HRU A;  1BI0 A;  1E22 A;  4XAX B;  1IL2 A;  4VUB A;  4QQ6 A;  2OI3 A;  2RHQ B;  2CUD A;  2RJE A;  4Q5W A;  1ARK A;  4RTT A;  4EMK C;  3WQZ A;  1F1B B;  5KYW B;  1B70 B;  3CMA T;  3BFM A;  2ZXF A;  3TEE A;  1RAG B;  5GAM d;  3LSS A;  2V8K A;  1KC8 C;  5LJ5 g;  5CQY A;  3MEY A;  2VKN A;  1XTD A;  1V76 A;  2O4X A;  4ZTF A;  2QYZ A;  2DFU A;  1B34 A;  2QDL A;  2XHC A;  1RAC B;  3MEW A;  2GGR A;  2DO3 A;  2JM9 A;  2DJQ A;  1M1K R;  1T0H A;  3RIR A;  1LOJ A;  4C5E A;  2RI2 A;  1FMK A;  5KE3 A;  1KHI A;  5GAN e;  1X54 A;  1JJ2 P;  3LX7 A;  4C92 F;  1UJ0 A;  1RI0 A;  1YJN A;  3PZC A;  1RAE B;  4L5G A;  1ZQ1 A;  2WSF E;  3GPL A;  4EMK A;  3HY1 A;  1UHF A;  2O9V A;  4KBM B;  4JS4 A;  1SRL A;  1K76 A;  1YI2 Q;  3A7A A;  2ZTG A;  5KYY A;  3CCQ A;  1LJO A;  1EFW A;  1LNX A;  1SHG A;  5LJ3 d;  1N8R U;  4M75 D;  1TUC A;  1OYX A;  4JRQ A;  1PKS A;  3VS5 A;  3A8H B;  4IUR A;  2E3C A;  3CMA A;  2JM8 A;  3JRZ A;  3JCM e;  2ZPH B;  5CKH A;  2ZNJ A;  4HWP A;  2CS7 A;  2FPD A;  3H0I A;  2QA4 Q;  5FRM A;  2O31 A;  4OMQ A;  2GQV A;  3P8D A;  2QQ9 A;  2LVM A;  2A28 A;  1D0X A;  1FYF A;  3I5S A;  3VRY A;  1W2B S;  2YLC A;  3KFU A;  3CMQ A;  2J06 A;  2M0O A;  3URG A;  3SD4 A;  1Y96 A;  2DZ9 A;  1MMA A;  2RH2 A;  3V8K A;  3WXM B;  5FU7 B;  3AHU A;  3HXX A;  1VQ9 Q;  2ENM A;  2PU9 B;  1IGU A;  3RNJ A;  4C8Q F;  2DE0 X;  1WXB A;  2EQK A;  1KFZ A;  4YRK A;  3OS1 A;  1K8A R;  2NUP A;  4N0A C;  4LD6 A;  3PNW C;  2BE7 D;  2KT8 A;  2K3X A;  2BZY A;  3V7R A;  4DBH A;  4PHC A;  2EJF A;  2F2W A;  5IHK A;  5IXB A;  4EIK A;  3HL8 A;  5IXF A;  2K4Y A;  1BBU A;  2HNI A;  3I55 T;  1SHF A;  2RQV A;  2P5I A;  1M1K U;  2PVG B;  3SHW A;  3LYI A;  2A08 A;  1NLP C;  1MMN A;  4TVR A;  1IZ6 A;  3EG1 A;  2AMC A;  4H2Y A;  3G7Z A;  4FIB A;  2R58 A;  2ZZF A;  2EJG A;  3TSZ A;  2GTJ A;  3MPU B;  2CP3 A;  1RLQ C;  3VBB A;  2CP6 A;  4WI1 A;  1K9M C;  2DQ0 A;  2ZR2 A;  2ART A;  2K5I A;  2L3P A;  1X56 A;  1OV3 A;  1B8A A;  2KGT A;  4L87 A;  1WHK A;  3QJY A;  4BE2 A;  2MPX C;  4L6V 5;  1G5I A;  3TEG A;  2FVU A;  4N0A A;  2L8D A;  2BTT A;  2I0N A;  5C52 B;  1M8V A;  3E19 A;  4WJ3 M;  2DL3 A;  2ZPF B;  2VB6 A;  4JPB W;  2AT1 B;  2OAW A;  4RTW A;  2YXY A;  2CSQ A;  1W70 A;  3HHT B;  3M5A A;  2X35 A;  2ESW A;  2YT6 A;  2M16 A;  2BUD A;  5E3I A;  1ZA1 B;  4OMO A;  3E1S A;  3IG2 A;  1N5Z A;  3VJP A;  2RHS B;  4HCC A;  2X4X A;  2HKQ B;  3G4S Q;  2K57 A;  2EYX A;  2H3J A;  4YP0 A;  3EHQ A;  4PJO E;  1YHQ Q;  1X55 A;  2CRE A;  3I55 A;  1QVF S;  1IO6 A;  2FZC B;  1NZ9 A;  1S72 Q;  3GBQ A;  2RN8 A;  1C1A A;  3ICA A;  1Y96 B;  4JLG A;  4XQ3 A;  1Q82 R;  4X5O A;  1PSF A;  4DEX A;  1ASY A;  5I2M A;  1VQ8 T;  1K8A U;  4M7A C;  1EFN A;  3CBO A;  1EIF A;  2QHU A;  4QW2 A;  3GNF B;  5GJV B;  3V8J A;  2EL9 A;  1MGQ A;  4YYE A;  3F70 A;  3CCU A;  3LGL A;  2DZC A;  1E6H A;  1B7Y B;  4TVA A;  2JMC A;  5K1X A;  2QAS A;  4KGX B;  4H2X A;  3CME A;  4J9H A;  1E1T A;  4OMF B;  4X34 A;  2CKK A;  2X4J A;  2FZG B;  4H2T A;  4Z02 A;  3KUF A;  3CCR A;  4BI8 B;  3L4G A;  4ZN1 A;  4CH3 A;  1CSK A;  2K3Y A;  2GTO A;  3QO7 A;  4FCY A;  3VUZ A;  1QVG P;  2X3W D;  3RKY A;  2KE9 A;  2LNH B;  4TWA A;  1VIE A;  3T9N A;  2W0Z A;  3REU A;  2VXE A;  4M7A A;  3PTA A;  1NJI C;  1PSE A;  5GAN f;  2DIQ A;  3VS3 A;  3FEO A;  3RGL A;  3MCA B;  2YHT A;  4O5V A;  3VQX A;  4IIO A;  2OTL Q;  3UGQ A;  1VQ8 A;  2QQR A;  5CK9 A;  3GNG A;  1AVZ C;  1WIE A;  1LVK A;  5LJ5 j;  4HT8 A;  2QHT A;  3MJX A;  3EFS A;  4LNP A;  2HQH A;  1KQS A;  1UB4 A;  3HSB A;  4LVK A;  4LVL A;  2COW A;  2PZ1 A;  4JRK A;  1UGQ B;  2DU5 A;  1SRM A;  3I9Q A;  2RF0 A;  3A5Z A;  2E70 A;  1Q82 U;  3LH0 A;  2ALY A;  1Q86 R;  3WVD B;  2RHZ A;  4M7D D;  4J9D A;  1AHJ B;  2JTE A;  3ASK A;  5IT9 E;  2EW3 A;  2C0T A;  3CCM T;  1NYF A;  4GY5 A;  5HCK A;  3X20 B;  2K2V A;  3CBM A;  2QEX Q;  4IKF A;  3GP8 A;  4M7D G;  2NYS A;  3M0T A;  2XU8 A;  4YDQ A;  4E7K A;  4BE0 A;  2V8J A;  4FW1 A;  1X2Q A;  3FLG A;  2YUN A;  4TVA B;  5GAN g;  1IHV A;  4H2X B;  2QA4 T;  4PJO A;  2M02 A;  1NG2 A;  2KR3 A;  1VQ5 T;  4PLI A;  5LJ5 e;  1EOV A;  4WCI A;  1PNJ A;  2YUQ A;  4IUQ A;  4BAC A;  1XNI A;  1ZUY A;  4CC3 A;  3JCM b;  2P4T A;  3FIF A;  4F7U E;  1LCK A;  2CZ7 B;  4D8D A;  3V7C A;  1Y57 A;  3OYC A;  3S3O A;  4MML A;  4KUD K;  2JJ9 A;  4GBQ A;  2D6F A;  4X9C A;  1GXI E;  1IHW A;  4M77 D;  3EG9 B;  5J3B A;  2QK0 A;  4GLM A;  5KYX B;  4RTZ A;  1X43 A;  4LDY A;  3JCM g;  4AFQ C;  1D0Z A;  2VAS A;  2QGG A;  2K7A A;  3BY7 A;  1WQ7 A;  2E5K A;  4K86 A;  2BE9 B;  2CUB A;  2DTO A;  4P72 C;  3OYJ A;  3X25 B;  3KXT A;  1VQZ A;  2RJF A;  1YI2 A;  1ADY A;  1PC0 A;  3CCL Q;  3JCM c;  5GAN d;  2V1Q A;  4M78 C;  1WJS A;  4J6X A;  4YPF A;  1N8R C;  4FU6 A;  3VQY A;  4RKU E;  5L23 A;  2C8M A;  4B9X A;  2X4Y A;  2P0Q A;  2RHU A;  1YIJ T;  2FPF A;  3H0H A;  3CPF A;  1VQL Q;  2O9S A;  3PT9 A;  1JBM A;  2LTO A;  3A31 A;  1GFC A;  2CYZ B;  1XOV A;  3JB9 D;  2QA4 A;  4H02 A;  1QCF A;  1N9W A;  4HVU A;  1VQ5 A;  5GMK e;  2DYB A;  1KIK A;  3REA B;  4IUV A;  3CCE Q;  4LE9 A;  2L89 A;  1Q86 U;  4P73 C;  1K73 U;  2FYK A;  4F16 A;  2DLP A;  2OTJ T;  3NTH A;  2ALY B;  1ATI A;  3NET A;  1PD0 A;  2LZ6 B;  4P72 A;  4OF1 A;  1M1F A;  4PNO A;  5CO7 A;  3VYH B;  2NLU A;  4PFP A;  4M78 A;  2EIF A;  1JQQ A;  3EGD A;  2EPD A;  4X9D A;  3M0S A;  2P0K A;  3BJU A;  1EIY A;  5D7U A;  2LNV A;  3VKI A;  4MMK A;  5I2S A;  4PJO B;  1YFR A;  2Q7G A;  1G3Y A;  2KYM A;  5M9O A;  1E24 A;  4E7I A;  1KSW A;  4JJB A;  4OVA A;  3HY0 A;  2YUP A;  2OX7 A;  1SSF A;  3VS0 A;  2YUO A;  1S72 T;  1M1K C;  1ZSG A;  1C6V X;  2KBT A;  1YIJ A;  4M75 E;  5A0G A;  1TU0 B;  3MKD A;  2K5L A;  3QWY A;  4OMN A;  4P73 A;  2M9U A;  2HSP A;  1G3T A;  4FYV B;  4C92 D;  1YN8 A;  1UFF A;  2DL5 A;  4RQE A;  3GOX A;  4UP9 A;  1N9S A;  2CT3 A;  4BW9 A;  3LH5 A;  1Z9Z A;  4XU3 A;  4C92 G;  3OSV A;  3ER0 A;  1NEB A;  2OTJ A;  1NPR A;  1W2B A;  5LL6 S;  1YIT T;  2DRK A;  4H2U A;  3BW1 A;  3CPW S;  4XTV A;  2OJ2 A;  2DYI A;  4YRE A;  3VS6 A;  1NBE B;  4LDV A;  4N4G A;  3A8G B;  3HTZ A;  2KRM A;  4XTZ A;  2NUT B;  3OMG A;  2BIV A;  2A37 A;  4J7I A;  2I2L A;  2IY5 A;  1UTI A;  4YRQ A;  1QP3 A;  1TTH B;  1N27 A;  3EFO A;  1TWB A;  5GAN 7;  3JB9 J;  4RCC A;  3E9F A;  7AT1 B;  4PG3 A;  5KYN A;  4P3O A;  3A8M B;  3QG1 A;  4X1V A;  2K9G A;  3M4Q A;  1QP2 A;  3L2W A;  2HBP A;  2RHQ A;  2P4R A;  1QQJ A;  3O5Z A;  4RUG A;  1YHQ A;  1AEY A;  4AFZ C;  3DLM A;  1L0W A;  2ARS A;  5KYW A;  1B70 A;  1W6X A;  4KRT A;  2HCK A;  2RB6 A;  4J9F A;  1S72 A;  3G6E Q;  1WLE A;  2EFI A;  1CKB A;  1ZSZ A;  2DPP B;  3HFV A;  4C8Q D;  1WA7 A;  3HKS A;  2LQN A;  3PIP A;  3CC7 T;  1KQS S;  1ZHI A;  3JCM P;  2JOY A;  1K8A C;  1LYL A;  4PJN A;  1VQ4 T;  3I7F A;  4TQF A;  1PWT A;  1EIY B;  4Z88 A;  3N5B B;  2LMJ A;  2RK2 A;  1M4Z A;  5EG2 A;  1YIT A;  2JNG A;  4M75 C;  4RTY A;  1BK2 A;  2PVO B;  3NGP A;  4BWA A;  3QII A;  3MEA A;  4ZIB A;  2E6N A;  3PCO A;  2MK5 A;  5A0L A;  1W66 A;  3LLR A;  2PUK B;  1G5V A;  5LJ5 f;  4EMG A;  4M7A F;  2DTH A;  1R0C B;  2QEX T;  4C0F A;  3OYN A;  2DVJ A;  3OBW A;  4QVC A;  3BDL A;  1QVF A;  8ATC B;  1G3W A;  1HJD A;  1BU1 A;  3OYB A;  4JRP A;  3GF5 A;  2EKH A;  4H2S A;  3NEN A;  2F5K A;  3CC7 A;  1VQN T;  4E7Z A;  3CXC P;  4YRJ A;  2FEI A;  5GAO m;  2LJ0 A;  4M75 A;  4IUT A;  1D1B A;  4RTU A;  3SWN B;  5GAN j;  2KEA A;  1AT1 B;  5FRN A;  2IY5 B;  4Y92 A;  2HKN A;  5I22 A;  3JAM E;  4YCW A;  2QI2 A;  4CS2 A;  1B7T A;  2YRV A;  3CCQ T;  1QMC A;  1TOV A;  3MP6 A;  1MMG A;  1YJ9 Q;  3KFV A;  2RMO A;  2E4H A;  4ZN3 A;  4OGE A;  2MAM A;  4A63 B;  1ZSZ B;  3MP1 A;  2E3I A;  1H3Z A;  4YCV A;  5K1P A;  2F1L A;  2HBW A;  2RJD A;  3PMT A;  2RQU A;  2ZT5 A;  4A54 A;  5ELO A;  4P74 C;  2QEX A;  2YWW A;  4KUI A;  2EJ9 A;  3R6N A;  3RES A;  2EQM A;  2CGH A;  1Q81 R;  3QZ5 B;  3C95 A;  1VQN A;  1U1S A;  1ZA2 B;  3CD6 Q;  3QPH A;  1UDL A;  3RMQ A;  1NYQ A;  1M2O A;  1ZUU A;  3PCO B;  1YFS A;  5EC7 A;  1I81 A;  1M90 C;  2CDT A;  2VGN A;  3RUX A;  4C0D B;  2JMA A;  2M1H A;  1M1G A;  1I5O B;  3M54 A;  5CKB A;  1RIQ A;  3INZ A;  1OX8 A;  5LJ5 d;  3NPF A;  4BY6 B;  2J05 A;  2MWP A;  3RF1 A;  1D3B B;  1MV0 B;  2LJ3 A;  2CZ1 B;  4AG1 C;  3A7R A;  1NYG A;  2L3Q A;  3E2U A;  5GAN h;  1A0N B;  4P74 A;  1FXX A;  3PIO A;  3OD1 A;  2HSE B;  1C0A A;  1M8M A;  3QDR B;  4YCU A;  1G3S A;  2F69 A;  4JDS A;  3CCL A;  3OW2 P;  1R8O B;  3OY9 A;  1ZUK A;  2RHS A;  4AFS C;  4M75 B;  4M7D E;  1UEC A;  2DMO A;  4C0Z A;  3DLL A;  4P75 C;  5GAN 2;  1E7O A;  1VQL A;  4DBR A;  2CSI A;  4HXJ A;  2A36 A;  1D0Y A;  2RO0 A;  3JCM h;  2FO0 A;  1OX9 A;  2GBQ A;  3CCE A;  2LQ8 A;  1KD1 C;  3QYH B;  1Y0M A;  1K73 C;  1UE9 A;  1TG0 A;  4M78 F;  1B7Y A;  1B3Q A;  5FWC A;  2AIR B;  2PTK A;  4JJC A;  5A0D A;  3DKM A;  1J3T A;  2DK3 A;  4M77 E;  2QQB A;  1VQM T;  4FT2 A;  4J6Y A;  3M57 A;  2Q7E A;  5J39 A;  1RAB B;  1Q81 U;  1G2B A;  5CKE A;  4P75 A;  1T3S A;  2X9H A;  3MEU A;  2CP5 A;  2XDD A;  4N4I A;  1Y71 A;  3RR6 A;  2FRW A;  4OLF A;  2E3H A;  3OYE A;  2QAZ A;  2CIM A;  3L2V A;  2DXT A;  3CCU T;  1VQ7 Q;  1W1F A;  2H3E B;  3CQT A;  1M3A A;  3CME T;  3G71 Q;  2EYW A;  1ZBJ A;  3IKM B;  3CCR T;  5GAO l;  1M27 C;  1AWJ A;  3OYA A;  2WSE E;  11AS A;  1YWO A;  2E1H A;  1QE0 A;  2D1X A;  1JO8 A;  4LDX A;  1UG1 A;  2JW4 A;  2NS6 A;  2DJZ A;  4NCX A;  3ME9 A;  1JJC A;  3M56 A;  2JZ2 A;  1G5H A;  5F5W A;  1JXO A;  3O8V A;  4FSS A;  1X6O A;  4GLK A;  1VQM A;  1EVK A;  4E2F B;  1E6G A;  3IAL A;  2ZZD A;  4YRR A;  1SRY A;  1E1O A;  1ZX6 A;  1YWP A;  3UH0 A;  1WFW A;  3M53 A;  3M0Q A;  3OYK A;  2CH4 W;  2ECZ A;  1Z9Q A;  4IUU A;  2I4O A;  4RG8 A;  5I21 A;  5A2Q E;  2ZPE B;  2VXF A;  4LD9 K;  2KMT A;  2Q5H A;  1OI1 A;  1QVG A;  4FYY B;  1HD3 A;  3UT1 A;  3TSW A;  4J9I A;  4KT0 E;  1CKA A;  2EVR A;  3MHX A;  2P0P A;  3CCV Q;  2F2V A;  3CCS T;  2EBP A;  4PFZ A;  1KC8 R;  3M4P A;  4C92 E;  1MND A;  3DB3 A;  1WGS A;  2O01 E;  3CCJ Q;  1K0X A;  2CZ0 B;  1VQP Q;  3CPW A;  4LNS A;  3EG9 A;  4CC7 A;  3TQ7 P;  3L2U A;  5CAI A;  1JJ2 S;  5FLX E;  3M4Y A;  5KYX A;  1VQO Q;  3L2R A;  1U8R A;  1Q95 G;  2K2M A;  4J9C A;  4ATO A;  1HXD A;  1NJ5 A;  4PK4 A;  1I1J A;  2EQJ A;  2HQX A;  3G1Z A;  4R56 A;  4RG2 A;  2A3L A;  1VOM A;  4M77 A;  1MNE A;  1NPP A;  1GBR A;  2ZPG B;  4P3P A;  2QQA A;  2DVE A;  4PJO C;  4J7F A;  4XU0 A;  2NUZ A;  1M3C A;  2I4M A;  3X24 B;  3HXU A;  1C0M A;  3AT1 B;  3HFN A;  1JJC B;  5D6Y A;  4BI3 A;  3CCS A;  2DET A;  1OPK A;  2E5Q A;  5FRO A;  3FB9 A;  2DXB A;  3SFM A;  3JCM f;  1AWX A;  4C8Q E;  2AZS A;  1VQK Q;  2VYT A;  4AH6 A;  4FW2 A;  4Y28 E;  4A4E A;  1SG5 A;  5ECA A;  1YI2 T;  2ZAE A;  4LDU A;  5GAM e;  2FL7 A;  2VC8 A;  1YJ9 A;  3OYH A;  3TUP A;  3WVE B;  2LCS A;  1WQW A;  2XGT A;  4PKC C;  2J3M A;  2ARU A;  3JCM V;  2E5A A;  5IHN A;  1TXQ A;  4EMH A;  2ZT8 A;  2FHD A;  3GIB A;  1B76 A;  4J6W A;  2MCN A;  3KBG A;  2MMP A;  1GCP A;  3P8Y A;  1RAA B;  4DBQ A;  2HEQ A;  3QWX X;  4M7D B;  3C12 A;  1NE8 A;  4RCB A;  4TQD A;  3I56 Q;  5KYU B;  3E9I A;  2HL3 A;  1P92 A;  2X4W A;  5HK3 A;  2MOX A;  1I0C A;  5GMK j;  4G84 A;  4KGV B;  1RUW A;  3EGU A;  1BB9 A;  1X69 A;  2RI3 A;  3DB4 A;  4BDZ A;  3VQV A;  4HT9 A;  1PHT A;  1VQ9 T;  4CC4 B;  5IH2 A;  5KCH A;  1H4Q A;  3UA7 A;  5ELN A;  1Y07 A;  3OS2 A;  5LJ3 e;  4NS5 A;  2IIM A;  2A8E A;  3RAC A;  2D0N A;  1OU9 A;  4M7A D;  1K9M R;  2CJA A;  5LJ5 h;  1WNL A;  2DNU A;  3PMI A;  1YGB A;  4M77 B;  4RDX A;  2DL8 A;  1NJ1 A;  2FPE A;  2JS2 A;  4KUL A;  2ZZE A;  2NUT A;  4M7A G;  2RQW A;  1UJY A;  4RMO A;  2L2P A;  3M55 A;  4ELY C;  3UDC A;  4C8Q C;  3CMA Q;  2DIL A;  4ESR A;  4DBF A;  2HMA A;  4PJL A;  2DD5 A;  3A74 A;  3ZFJ A;  3Q1J A;  4M4Z A;  1WI7 A;  3FJP A;  4E7J A;  1OZ3 A;  2RJC A;  4DPG A;  1I07 A;  2QTV A;  3V8L A;  4DEY A;  4PL6 A;  2GQI A;  3JCM d;  4RTV A;  5GAN 8;  2JUF A;  3A32 A;  3G71 T;  1TH7 A;  4L59 A;  2HAX A;  1QVP A;  2ZGW A;  4FL6 A;  1VQ9 A;  4WF2 A;  1AOJ A;  4OB3 B;  4HCB A;  4ZNX A;  2V26 A;  1IXD A;  3L1A A;  2G6F X;  3TU4 K;  1EQR A;  5GAN 3;  3QBY A;  5GMK h;  2KI7 A;  2GF7 A;  2X51 A;  1BBW A;  1WHG A;  2FB7 A;  4HWR A;  1OQK A;  2E64 A;  2FZK B;  3G4S T;  4C8Q A;  3SWN C;  1YHQ T;  4ZTJ A;  4FSX A;  1OU8 A;  3L42 A;  3BDU A;  4EX5 A;  2BKD N;  3L2Z A;  1YJW Q;  1QVG S;  1YB3 A;  4PJO G;  1Q81 C;  1KG1 A;  4WJ4 A;  2JN0 A;  3LW5 E;  2KK4 A;  3OQ5 A;  3ZL7 C;  5CKF A;  4Z89 A;  2DU7 A;  1IGQ A;  1PYS B;  2ED0 A;  1BCM A; 
#chains in the Genus database with same CATH homology
 2HQE A;  5DLO A;  5C51 B;  2LRQ A;  2J3L A;  3OYL A;  2DXC A;  2EQU A;  2QTX A;  3VV0 A;  3OS5 A;  3LC0 A;  4XEM A;  2GCX A;  3G71 A;  1NNH A;  4C92 B;  3OMC A;  3H6Z A;  4F7U A;  3R07 A;  3SWN A;  5GAO r;  1I8F A;  4Q6G A;  3JSC A;  2IG0 A;  2JVV A;  5IN1 A;  3OBY A;  4ZGD B;  1YCY A;  3G4S A;  4DOW A;  1U1T A;  3M4G A;  5DM7 R;  1IRE B;  3PFS A;  4P71 A;  2VUB A;  4C0D C;  4MZM A;  2B8A A;  4XU2 A;  5KNN A;  3P8V A;  4BY6 C;  2OTL T;  4OB2 B;  2LT4 A;  1EVL A;  4M78 D;  5GAN 6;  3EAE A;  3QYG B;  3HFZ B;  4YRP A;  2ODR D;  1HTT A;  4RQF A;  2XID A;  3CCV A;  4M78 G;  4C8Q B;  4EPC A;  1BIA A;  3REX A;  1QF6 A;  3HXY A;  2ZPI B;  4ZGJ B;  4C5G A;  5KE2 A;  2PMF A;  3NTK A;  4B9W A;  2V8I A;  2EAY A;  2G4C A;  4BE1 A;  1VQO A;  4UC4 A;  4UPA A;  1UGS B;  3QXE B;  1D3B A;  4LVJ A;  3TCJ A;  2QHS A;  4ZTZ B;  4J5Y A;  4YRF A;  4JRI A;  4FT4 A;  2DIG A;  3E9H A;  4JS5 A;  2D0Q B;  2OTL A;  2L5Q A;  1H4T A;  4F7U B;  2ZIN A;  4BI4 A;  3H8Z A;  5GAM g;  4XTW A;  5IAY A;  2C7I A;  5J26 A;  1WJR A;  3ZBD A;  1X75 C;  2XDP A;  3LWI A;  4V2S A;  2XTI A;  5CIU A;  3OYD A;  4OP0 A;  5DY9 A;  4BUG A;  1ZBX A;  1Q82 C;  4DQ2 A;  3OYF A;  3CCL T;  3A5Y A;  4LVI A;  2Q5I A;  2RHI A;  3UWN A;  4JJN K;  4YRS A;  4YRT A;  1JJ2 A;  3RER A;  4MDW A;  4PJO F;  3J81 E;  1VQL T;  3M9Q A;  1YFT A;  3CBP A;  3I56 A;  4A4K A;  5LJ3 g;  3FRN A;  4EO4 A;  3HRS A;  3CCE T;  3QNE A;  3NTI A;  4DA4 A;  1Q7Y U;  4G85 A;  3EFR A;  2KDS A;  3OS0 A;  4XTX A;  4R55 A;  3OW2 A;  1WJQ A;  3A7U A;  4LDW A;  5KH6 A;  2KAF A;  2QDY B;  3TRE A;  1I4K 1;  2RHY A;  3JCM J;  2LX9 A;  1H64 1;  2DEQ A;  3QUI A;  4J83 A;  3M59 A;  4CS3 A;  2XD0 A;  3HRK A;  1YJW T;  1VUB A;  4XEO A;  3PGG A;  4HWS A;  3LWH A;  2RK1 A;  2E6Z A;  4M75 G;  2XI9 A;  4K87 A;  2PME A;  1HK9 A;  4FM4 B;  1OZ2 A;  2RA2 A;  3QO8 A;  4N4H A;  3QJ6 A;  1Q86 C;  3J7A F;  3CC4 T;  4YTL A;  4YRI A;  4KR2 A;  4IUP A;  2KQW A;  2DXU A;  1M9S A;  1N6A A;  4OB1 B;  4XK8 E;  5D6X A;  3JB9 I;  4ME7 A;  2RM4 A;  3MQZ A;  5CCA A;  4A4H A;  3UFG A;  4M7A E;  2O4X B;  4A4G A;  3HRI A;  3HXV A;  4TTV A;  4HKE A;  2PQW A;  1YJW A;  1B34 B;  2GFA A;  3MP8 A;  1DJ7 B;  1KMN A;  3G6E T;  2I4L A;  4XTY A;  2CJB A;  2Q7H A;  4RMF A;  3HXZ A;  2G3R A;  12AS A;  3OA6 A;  1ASZ A;  3NEM A;  1NJ8 A;  1KQ2 A;  1WPY A;  4O2D A;  4NL3 A;  2HD0 A;  4JLI A;  4M7D C;  3X26 B;  4HT4 A;  5CR2 A;  4F7U F;  3P8H A;  4EMK B;  4O6J A;  3CC4 A;  3P8T A;  1BI1 A;  4HWT A;  5C53 B;  2QHV A;  1H4V B;  1BIB A;  3CXC S;  3S3N A;  3JCM Q;  4HCZ A;  4OB0 B;  1J5W A;  4QQD A;  3QKJ A;  5CVI A;  3QO3 A;  3C4S A;  5GAO p;  2RHX A;  3R6O A;  3MF2 A;  3S3M A;  4E7H A;  2KVQ G;  3G6E A;  2QQS A;  3GLX A;  3S6W A;  4M77 C;  3NFC A;  4CRI A;  3VQW A;  4M7D A;  1UGR B;  4BDY A;  2KY9 A;  3MET A;  2DDZ A;  2CZ6 B;  4CH6 A;  2VV5 A;  3J80 E;  1M5Q 1;  1O75 A;  2MWO A;  3VUB A;  2E41 A;  1YJ9 T;  3QSU A;  3TEH A;  2LC4 A;  4MDX A;  3M58 A;  5GAM j;  4HWO A;  4Y91 A;  5CKD A;  4C5H A;  2EWN A;  3W3S A;  3MF1 A;  4OGC A;  4CH4 A;  1JB0 E;  3OYY A;  2LT1 A;  2AMC B;  3IKL A;  4C5I A;  1W4S A;  4Q15 A;  2LCL A;  1KQ1 A;  4YRL A;  2YLB A;  4P3N A;  4M75 F;  3P8B B;  3MEV A;  1USY C;  2XDB A;  4NL2 A;  3OW2 S;  2E65 A;  3JCM W;  4XTU A;  3QO5 A;  5C6S A;  3X28 B;  2RD1 A;  3FDR A;  3CD6 T;  4EDU A;  5LJ3 j;  1UGP B;  1MHN A;  2QXF A;  4M78 E;  4BB7 A;  4PLL A;  2E12 A;  2ZT7 A;  4J8O A;  3CC2 T;  3A8L B;  4HA8 A;  4C92 C;  4QVD A;  1KC8 U;  1NYR A;  1USY A;  5HGQ A;  5GAM h;  3FC3 A;  2F5T X;  1BI2 A;  4YRM A;  2R5A A;  3TEH B;  4II1 A;  2LCC A;  1PYS A;  4H2V A;  3NEL A;  3CD6 A;  1Q7Y C;  5FU6 C;  3L4G B;  2ZR3 A;  2ZZG A;  1QW1 A;  4ELZ C;  1BKB A;  4KR3 A;  4ZGE B;  1M90 U;  5CQX A;  4C92 A;  3DSQ A;  1H4S A;  4TVW A;  3LSQ A;  2I4N A;  1G51 A;  3CC2 A;  4YRC A;  3RL6 A;  4M77 G;  5L8R E;  4D6W A;  2MF2 A;  2XG8 D;  4MZT A;  4M7A B;  2KSS A;  5LJ3 h;  4QVZ A;  2Y4Y A;  4ZTU B;  4XU1 A;  3CCM A;  4J15 A;  2ZNI A;  1VQ7 T;  2ODR C;  5HK0 A;  2DQ3 A;  3HRT A;  2DKG A;  2ZPB B;  2WSC E;  5D6W A;  2R5M A;  3V7S A;  4DOV A;  2AKW A;  2L3R A;  2ZCF B;  4CH5 A;  1KOG A;  2K5F A;  1I5L A;  5GMK m;  3CEY A;  2XIC A;  2EYQ A;  1VIF A;  3OYI A;  4YRG A;  1KD1 U;  2PUO B;  3JB9 G;  3A5Z B;  3HFZ A;  3RKW A;  1YBY A;  4A4F A;  2OAU A;  4PJO D;  2JTF A;  2LQK A;  1X2H A;  3ZEH A;  2ZT6 A;  4H2W A;  3JB9 H;  1FWZ A;  1UEB A;  1V29 B;  2XKO C;  4P71 C;  5GAN 5;  2XK0 A;  3VU3 C;  1HC7 A;  2Y90 A;  1K9M U;  3MO8 A;  1VQ7 A;  2IVW A;  1Y7X A;  2PVD B;  3QZ9 B;  3CCV T;  1FX7 A;  2MI6 A;  3QHS A;  4YRN A;  4P5N A;  1RL2 A;  3HP9 A;  4YRO A;  3HFO A;  5GAO q;  3CCJ T;  3RMS A;  1VQ6 T;  1Z7N A;  3OSS C;  4NOY A;  4E47 A;  1VQP T;  2AHJ B;  2DTI A;  3C94 A;  1VQO T;  2DD4 A;  3VYG A;  1WYD A;  1N9R A;  3OB9 A;  2LDM A;  5DLQ E;  1GGM A;  1ADJ A;  1O9S A;  2AKW B;  1X2G A;  5FU6 B;  1SER A;  4CI0 C;  4K88 A;  2ZCE A;  1KMM A;  4JUV A;  3RKX A;  4M7D F;  1KHC A;  5GAM f;  2GFU A;  4HVC A;  2ZIO A;  2WAC A;  3HPW A;  4UP8 A;  2Y4X A;  5GAN 4;  3SB2 A;  3QTC A;  2VGM A;  3L2Q A;  2DAQ A;  1VQK T;  3OYM A;  5HKC A;  1JRI A;  2R57 A;  4M78 B;  3UPU A;  5GAO n;  3CCJ A;  4KQE A;  2A7Y A;  1XQH A;  1VQ6 A;  2JTM A;  4C8Q G;  1VQP A;  2CJ9 A;  5AYF A;  1X01 A;  3LGF A;  3CXC A;  2ZIM A;  4E51 A;  1NJ6 A;  1SES A;  2RI5 A;  1WU7 A;  4M77 F;  4UP7 A;  2E10 A;  1SET A;  1Z7M A;  1NJI U;  5HY6 A;  3I56 T;  4LVM A;  5FU7 C;  4CS4 A;  4C0G A;  4A53 A;  5LJ3 f;  2C06 A;  4BD3 A;  3ERR A;  1BYM A;  3SDZ A;  3JCM X;  1NJ2 A;  4MZP A;  2P0L A;  1BI3 A;  3UGT A;  3OYG A;  3A8O B;  4QQG A;  4F7U G;  5GMK i;  4TVY A;  5GMK l;  1VQK A;  3HXW A;  3JB9 F;  1YJN T;  2EKO A;  4E7L A;  2D9T A;  1VQ4 A;  3E9G A;  5KCO A;  5C0M A;  3HRU A;  1BI0 A;  1E22 A;  4XAX B;  1IL2 A;  4VUB A;  4QQ6 A;  2RHQ B;  2RJE A;  4Q5W A;  4EMK C;  3WQZ A;  1B70 B;  3CMA T;  3BFM A;  2ZXF A;  3TEE A;  5GAM d;  3LSS A;  2V8K A;  1KC8 C;  5LJ5 g;  5CQY A;  3MEY A;  1XTD A;  2O4X A;  4ZTF A;  1B34 A;  2XHC A;  3MEW A;  2DO3 A;  3RIR A;  1LOJ A;  4C5E A;  2RI2 A;  5KE3 A;  1KHI A;  5GAN e;  1X54 A;  3LX7 A;  4C92 F;  1RI0 A;  1YJN A;  3PZC A;  4L5G A;  1ZQ1 A;  2WSF E;  3GPL A;  4EMK A;  3HY1 A;  4KBM B;  4JS4 A;  3A7A A;  2ZTG A;  3CCQ A;  1LJO A;  1EFW A;  1LNX A;  5LJ3 d;  1N8R U;  4M75 D;  1OYX A;  4JRQ A;  3A8H B;  4IUR A;  2E3C A;  3CMA A;  3JRZ A;  3JCM e;  2ZPH B;  5CKH A;  2ZNJ A;  4HWP A;  2CS7 A;  5FRM A;  2GQV A;  3P8D A;  2QQ9 A;  2LVM A;  1FYF A;  1W2B S;  2YLC A;  3KFU A;  3CMQ A;  2M0O A;  3URG A;  3SD4 A;  1Y96 A;  2DZ9 A;  3AHU A;  2RH2 A;  3V8K A;  3WXM B;  5FU7 B;  3HXX A;  2PU9 B;  4C8Q F;  2EQK A;  4YRK A;  3OS1 A;  4N0A C;  4LD6 A;  3PNW C;  2K3X A;  3V7R A;  4PHC A;  2EJF A;  3HL8 A;  2K4Y A;  1BBU A;  2HNI A;  3I55 T;  2P5I A;  1M1K U;  2PVG B;  3LYI A;  4TVR A;  1IZ6 A;  2AMC A;  4H2Y A;  3G7Z A;  4FIB A;  2R58 A;  2ZZF A;  2EJG A;  3VBB A;  4WI1 A;  1K9M C;  2DQ0 A;  2ZR2 A;  2ART A;  2K5I A;  1X56 A;  1B8A A;  4L87 A;  4BE2 A;  3QJY A;  4L6V 5;  1G5I A;  3TEG A;  2FVU A;  4N0A A;  2L8D A;  5C52 B;  1M8V A;  3E19 A;  4WJ3 M;  2ZPF B;  3HHT B;  3M5A A;  2X35 A;  2M16 A;  2BUD A;  5E3I A;  3E1S A;  3IG2 A;  3VJP A;  2RHS B;  4HCC A;  2X4X A;  2K57 A;  2H3J A;  4YP0 A;  4PJO E;  1X55 A;  3I55 A;  1QVF S;  1NZ9 A;  3ICA A;  1Y96 B;  4JLG A;  4XQ3 A;  4X5O A;  1PSF A;  1ASY A;  5I2M A;  1VQ8 T;  1K8A U;  4M7A C;  3CBO A;  1EIF A;  2QHU A;  4QW2 A;  3GNF B;  3V8J A;  2EL9 A;  1MGQ A;  4YYE A;  3F70 A;  3CCU A;  3LGL A;  2DZC A;  5K1X A;  1B7Y B;  4TVA A;  4H2X A;  3CME A;  1E1T A;  4OMF B;  4X34 A;  2CKK A;  2X4J A;  4H2T A;  4Z02 A;  3KUF A;  3CCR A;  4BI8 B;  3L4G A;  4ZN1 A;  4CH3 A;  2K3Y A;  3QO7 A;  3VUZ A;  3RKY A;  4TWA A;  1VIE A;  3T9N A;  3REU A;  2VXE A;  4M7A A;  3PTA A;  1NJI C;  1PSE A;  5GAN f;  2DIQ A;  3FEO A;  3RGL A;  3MCA B;  2YHT A;  4O5V A;  3VQX A;  3UGQ A;  1VQ8 A;  2QQR A;  5CK9 A;  3GNG A;  5LJ5 j;  4HT8 A;  2QHT A;  3EFS A;  1KQS A;  1UB4 A;  3HSB A;  4LVK A;  4LVL A;  4JRK A;  2DU5 A;  1UGQ B;  3A5Z A;  2E70 A;  1Q82 U;  3LH0 A;  2ALY A;  3WVD B;  2RHZ A;  4M7D D;  1AHJ B;  3ASK A;  5IT9 E;  3CCM T;  4GY5 A;  3X20 B;  2K2V A;  3CBM A;  4IKF A;  3GP8 A;  4M7D G;  2XU8 A;  4YDQ A;  4E7K A;  4BE0 A;  2V8J A;  3FLG A;  4TVA B;  5GAN g;  4H2X B;  2QA4 T;  4PJO A;  1VQ5 T;  4PLI A;  5LJ5 e;  1EOV A;  4IUQ A;  4BAC A;  1XNI A;  3JCM b;  2P4T A;  3FIF A;  4F7U E;  2CZ7 B;  3V7C A;  3OYC A;  3S3O A;  4KUD K;  4MML A;  1GXI E;  2D6F A;  4X9C A;  4M77 D;  5J3B A;  4LDY A;  3JCM g;  3BY7 A;  1WQ7 A;  4K86 A;  2DTO A;  4P72 C;  3OYJ A;  3X25 B;  3KXT A;  1VQZ A;  2RJF A;  1YI2 A;  1ADY A;  3JCM c;  5GAN d;  4M78 C;  1WJS A;  4J6X A;  4YPF A;  1N8R C;  4FU6 A;  3VQY A;  4RKU E;  2C8M A;  4B9X A;  2X4Y A;  2P0Q A;  2RHU A;  1YIJ T;  3CPF A;  3PT9 A;  1JBM A;  2LTO A;  3A31 A;  2CYZ B;  1XOV A;  3JB9 D;  2QA4 A;  4H02 A;  1N9W A;  1VQ5 A;  5GMK e;  4IUV A;  2L89 A;  1Q86 U;  4P73 C;  1K73 U;  2FYK A;  2OTJ T;  3NTH A;  2ALY B;  1ATI A;  3NET A;  4P72 A;  4OF1 A;  1M1F A;  4PNO A;  5CO7 A;  3VYH B;  2NLU A;  4M78 A;  2EIF A;  4X9D A;  2P0K A;  3BJU A;  1EIY A;  2LNV A;  3VKI A;  4MMK A;  5I2S A;  4PJO B;  1YFR A;  2Q7G A;  1G3Y A;  5M9O A;  1E24 A;  4E7I A;  4OVA A;  3HY0 A;  1SSF A;  1M1K C;  1S72 T;  1YIJ A;  4M75 E;  5A0G A;  2K5L A;  4P73 A;  2M9U A;  1G3T A;  4C92 D;  4RQE A;  3GOX A;  4UP9 A;  1N9S A;  4BW9 A;  4XU3 A;  4C92 G;  3OSV A;  3ER0 A;  2OTJ A;  1NPR A;  1W2B A;  5LL6 S;  1YIT T;  4H2U A;  3BW1 A;  3CPW S;  4XTV A;  4YRE A;  4LDV A;  4N4G A;  3A8G B;  3HTZ A;  4XTZ A;  3OMG A;  2BIV A;  4J7I A;  2I2L A;  2IY5 A;  4YRQ A;  1QP3 A;  1N27 A;  3JB9 J;  5GAN 7;  4RCC A;  3E9F A;  4PG3 A;  4P3O A;  3A8M B;  3QG1 A;  3M4Q A;  1QP2 A;  3L2W A;  2HBP A;  2RHQ A;  1YHQ A;  3DLM A;  1L0W A;  2ARS A;  1B70 A;  1S72 A;  2RB6 A;  1WLE A;  2EFI A;  2DPP B;  3HFV A;  4C8Q D;  3HKS A;  3CC7 T;  3PIP A;  1KQS S;  1ZHI A;  3JCM P;  2JOY A;  1K8A C;  1LYL A;  1VQ4 T;  3I7F A;  4TQF A;  1EIY B;  3N5B B;  2RK2 A;  1M4Z A;  5EG2 A;  1YIT A;  2JNG A;  4M75 C;  2PVO B;  4BWA A;  3QII A;  3MEA A;  4ZIB A;  2E6N A;  3PCO A;  5A0L A;  1W66 A;  3LLR A;  2PUK B;  1G5V A;  5LJ5 f;  4EMG A;  4M7A F;  2DTH A;  2QEX T;  4C0F A;  3OYN A;  3OBW A;  4QVC A;  3BDL A;  1QVF A;  1G3W A;  3OYB A;  4JRP A;  3GF5 A;  4H2S A;  3NEN A;  2F5K A;  3CC7 A;  1VQN T;  4YRJ A;  5GAO m;  4M75 A;  4IUT A;  3SWN B;  5GAN j;  2IY5 B;  5FRN A;  3JAM E;  4YCW A;  2QI2 A;  4CS2 A;  2YRV A;  3CCQ T;  3MP6 A;  4ZN3 A;  4OGE A;  2MAM A;  3MP1 A;  1H3Z A;  4YCV A;  5K1P A;  2RJD A;  3PMT A;  2ZT5 A;  4A54 A;  5ELO A;  4P74 C;  2QEX A;  4KUI A;  2EJ9 A;  3RES A;  2EQM A;  2CGH A;  3QZ5 B;  3C95 A;  1VQN A;  1U1S A;  3QPH A;  3RMQ A;  1NYQ A;  3PCO B;  1YFS A;  1I81 A;  1M90 C;  2VGN A;  3RUX A;  4C0D B;  2M1H A;  1M1G A;  3M54 A;  5CKB A;  1RIQ A;  3INZ A;  5LJ5 d;  4BY6 B;  2MWP A;  3RF1 A;  1D3B B;  2CZ1 B;  3A7R A;  5GAN h;  4P74 A;  1FXX A;  3PIO A;  3OD1 A;  1C0A A;  3QDR B;  4YCU A;  1G3S A;  2F69 A;  4JDS A;  3CCL A;  1R8O B;  3OY9 A;  2RHS A;  4M75 B;  4M7D E;  4C0Z A;  3DLL A;  4P75 C;  5GAN 2;  1VQL A;  2RO0 A;  3JCM h;  3CCE A;  2LQ8 A;  1KD1 C;  3QYH B;  1K73 C;  4M78 F;  1B7Y A;  5A0D A;  3DKM A;  2DK3 A;  4M77 E;  2QQB A;  1VQM T;  4FT2 A;  4J6Y A;  3M57 A;  2Q7E A;  5J39 A;  1Q81 U;  5CKE A;  4P75 A;  3MEU A;  2XDD A;  4N4I A;  1Y71 A;  4OLF A;  3OYE A;  2CIM A;  3L2V A;  2DXT A;  3CCU T;  3CME T;  3IKM B;  3CCR T;  5GAO l;  3OYA A;  2WSE E;  11AS A;  2E1H A;  1QE0 A;  4LDX A;  2NS6 A;  2DJZ A;  4NCX A;  3ME9 A;  1JJC A;  3M56 A;  2JZ2 A;  1G5H A;  5F5W A;  3O8V A;  1X6O A;  4GLK A;  1VQM A;  1EVK A;  3IAL A;  4YRR A;  2ZZD A;  1SRY A;  1E1O A;  3UH0 A;  3M53 A;  3OYK A;  4IUU A;  2I4O A;  4RG8 A;  5I21 A;  5A2Q E;  2ZPE B;  2VXF A;  4LD9 K;  2KMT A;  2Q5H A;  1OI1 A;  1QVG A;  3UT1 A;  4KT0 E;  3MHX A;  2P0P A;  3CCS T;  3M4P A;  4C92 E;  3DB3 A;  1WGS A;  2O01 E;  2CZ0 B;  3CPW A;  4LNS A;  3L2U A;  5CAI A;  1JJ2 S;  5FLX E;  3M4Y A;  3L2R A;  1U8R A;  4ATO A;  1HXD A;  1NJ5 A;  2EQJ A;  2HQX A;  3G1Z A;  4R56 A;  4RG2 A;  2A3L A;  4M77 A;  1NPP A;  2ZPG B;  4P3P A;  2QQA A;  2DVE A;  4PJO C;  4J7F A;  4XU0 A;  2I4M A;  3X24 B;  3HXU A;  3HFN A;  1JJC B;  5D6Y A;  4BI3 A;  3CCS A;  2E5Q A;  5FRO A;  3FB9 A;  2DXB A;  3SFM A;  3JCM f;  4C8Q E;  2VYT A;  4AH6 A;  4Y28 E;  4A4E A;  1YI2 T;  4LDU A;  5GAM e;  2FL7 A;  2VC8 A;  1YJ9 A;  3OYH A;  3TUP A;  3WVE B;  1WQW A;  2XGT A;  4PKC C;  2J3M A;  2ARU A;  3JCM V;  2E5A A;  4EMH A;  2ZT8 A;  2FHD A;  3GIB A;  1B76 A;  4J6W A;  3KBG A;  2MMP A;  3P8Y A;  4M7D B;  3C12 A;  1NE8 A;  4RCB A;  4TQD A;  3E9I A;  1P92 A;  2X4W A;  5HK3 A;  5GMK j;  4G84 A;  2RI3 A;  3DB4 A;  4BDZ A;  3VQV A;  4HT9 A;  1VQ9 T;  1H4Q A;  5KCH A;  5ELN A;  1Y07 A;  3OS2 A;  5LJ3 e;  4NS5 A;  2A8E A;  3RAC A;  4M7A D;  2CJA A;  5LJ5 h;  1WNL A;  3PMI A;  1YGB A;  4M77 B;  4RDX A;  1NJ1 A;  4KUL A;  2ZZE A;  4M7A G;  4RMO A;  3M55 A;  4ELY C;  3UDC A;  4C8Q C;  2DD5 A;  3A74 A;  3ZFJ A;  3Q1J A;  3FJP A;  4E7J A;  1OZ3 A;  2RJC A;  4DPG A;  3V8L A;  4PL6 A;  3JCM d;  5GAN 8;  2JUF A;  3A32 A;  3G71 T;  1TH7 A;  4L59 A;  2HAX A;  1QVP A;  2ZGW A;  4FL6 A;  1VQ9 A;  4WF2 A;  4OB3 B;  4HCB A;  3L1A A;  3TU4 K;  1EQR A;  5GAN 3;  3QBY A;  5GMK h;  2GF7 A;  1BBW A;  2FB7 A;  4HWR A;  2E64 A;  3G4S T;  4C8Q A;  3SWN C;  1YHQ T;  4ZTJ A;  4FSX A;  3L42 A;  3BDU A;  4EX5 A;  2BKD N;  3L2Z A;  1QVG S;  1YB3 A;  4PJO G;  1Q81 C;  1KG1 A;  4WJ4 A;  2JN0 A;  3LW5 E;  2KK4 A;  3OQ5 A;  5CKF A;  2DU7 A;  1PYS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...