2EJ9A

Crystal structure of biotin protein ligase from methanococcus jannaschii
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
237
structure length
237
Chain Sequence
MEIIHLSEIDSTNDYAKELAKEGKRNFIVLADKQNNGKGRWGRVWYSDEGGLYFSMVLDSKLYNPKVINLLVPICIIEVLKNYVDKELGLKFPNDIMVKVNDNYKKLGGILTELTDDYMIIGIGINVNNQIRNEIREIAISLKEITGKELDKVEILSNFLKTFESYLEKLKNKEIDDYEILKKYKKYSITIGKQVKILLSNNEIITGKVYDIDFDGIVLGTEKGIERIPSGICIHVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative biotin ligase
publication title Crystal Structure Of Biotin Protein Ligase From Methanococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
total genus 74
structure length 237
sequence length 237
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ej9A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ej9A01
4M75B 4C8QF 1LNXA 5GAN7 4XU1A 2DU7A 1U1TA 3LC0A 4JLIA 4YRQA 3QO5A 3RL6A 2DDZA 3GIBA 4M77E 5GAN4 2CJBA 4YRSA 4M77F 2I2LA 2Q7HA 4QVDA 4K87A 2C7IA 1X54A 4G84A 2ZINA 1HK9A 1G5HA 2E3CA 3M4PA 5GMKl 5GANh 4PJOC 2DU5A 3BJUA 4C92C 2EJ9A 3UGQA 4C8QD 2HNIA 4M7AE 1ASYA 4EMKA 1ADJA 3EFSA 4K86A 4YRTA 5LJ3g 2ZTGA 4H2UA 4CH5A 3RERA 1BIAA 3V7SA 4TVAA 3E9HA 2YLCA 5GAN3 1HXDA 5C51B 3V8LA 5GANd 3TEHA 4YRFA 4M7DE 1VQZA 2RHQA 2AMCB 4M7DF 1Z7MA 2E1HA 3NEMA 3RF1A 2ZZEA 4RMFA 5E3IA 4EMKC 1NYRA 4C8QA 4F7UG 2RD1A 3RUXA 4L87A 4H2SA 3MF2A 2ZIMA 4X9DA 4HA8A 3L4GB 1WLEA 2ARTA 4M7AD 3L2ZA 3JB9D 2YLBA 5LJ3h 4YDQA 1FYFA 4ZIBA 5GANf 4YRIA 4KQEA 1D3BA 4M77A 4XTVA 1I5LA 3HXZA 1MGQA 4H2WA 4C8QC 4M7DD 5LJ3e 1H4TA 3RKWA 5GAOm 2RB6A 1N9SA 4X9CA 3HY0A 3HXVA 3PCOB 3M4GA 3A74A 2DZ9A 1I4K1 5LJ3d 5GMKi 4PJOF 4CH3A 2EJFA 1KMNA 1YFSA 4C92F 4F7UE 5LJ3j 4J6YA 4PJOB 4P71A 4M77C 4J6WA 5GAN8 1I8FA 1JBMA 4H2XB 4C92B 1USYA 4YPFA 4CH4A 2ZT6A 2AMCA 3P8TA 2ZT5A 1NJ1A 2CJ9A 3AHUA 2I4LA 2P0LA 1YGBA 4M7DA 5C52B 1B7YB 3QSUA 5LJ3f 4P73A 2DJZA 4M7AC 2CIMA 3W3SA 1X2HA 4P72A 2E5AA 3JCMQ 4KR3A 4P71C 4EMHA 1SESA 3HFZB 2FB7A 1E24A 4M75G 2DTOA 1J5WA 4EMKB 4EMGA 1WNLA 2J3MA 3JCMW 5GMKe 2DEQA 2DTHA 4M7DC 1ATIA 1L0WA 3HRIA 4P73C 3P8YA 3A7RA 3TEHB 4DQ2A 4HT9A 4P72C 4XTYA 4Y91A 5GAN5 4ZTZB 5GMKj 4PG3A 1PYSA 2ODRC 4TVWA 4PJOA 4H2XA 4C92A 4C8QB 4YCVA 3M4QA 2ARSA 4YRKA 3QO7A 5LJ5e 4MMKA 1B7YA 4H2VA 2ZCEA 2EJGA 4J6XA 3QTCA 1H641 2J3LA 2ARUA 1D3BB 1YFTA 4XU3A 3HFOA 1EVLA 4M77B 1EFWA 5LJ5j 1WYDA 5DY9A 3JCMe 1QE0A 3BDUA 3HFZA 4YP0A 3SB2A 3R07A 4O2DA 2E10A 3LSSA 4M7AF 2E65A 4H02A 1JJCA 1LJOA 4Q6GA 2G4CA 3JB9F 2ZZFA 1NJ8A 1NYQA 3DSQA 4M7AB 4YRMA 1M8VA 1EQRA 1X2GA 4YRJA 3I7FA 4YCUA 4YRNA 4QVCA 3VQXA 1SERA 3IALA 3PGGA 2ZXFA 3QO8A 1SRYA 5GAOq 3VU3C 3CMQA 4HVCA 4M78G 3VQVA 4M7DB 5GAOl 3L1AA 3IKMB 1Y96A 3HXWA 1B76A 3RGLA 4XU2A 3ICAA 2Q5IA 3JCMV 4PNOA 4Q15A 1GGMA 4HWRA 1EOVA 3EFRA 4WI1A 5HGQA 2ZIOA 4P75A 3RIRA 3A32A 5GMKm 4YCWA 4XTUA 4HWTA 2QHVA 4P74A 1LYLA 5ELOA 4P3PA 3HTZA 4UP7A 4JRIA 5GAMe 4UP9A 4PHCA 4YRPA 4HWPA 2E64A 1X01A 3BY7A 4M78E 4M7AA 4NL3A 1PYSB 3RKYA 1E1OA 2DKGA 2DQ3A 4P75C 2EWNA 4F7UF 3E9IA 5C53B 5F5WA 1ASZA 3HFVA 3JCMJ 4WF2A 3UFGA 3JCMX 3NETA 5GAMj 4F7UB 4CH6A 1KQ1A 4P74C 4YRCA 2QHSA 4J15A 4J5YA 1BBWA 3PZCA 2IY5A 2VXEA 2K57A 5LJ5g 1RIQA 3NENA 5GMKh 5KNNA 4XTXA 2EAYA 4MMLA 3V7RA 2RHSA 4XEMA 3JCMb 3QUIA 2QHTA 2AKWA 4M78D 1YB3A 3FB9A 3JCMP 3OD1A 5ELNA 4XTWA 4OLFA 4TTVA 3HXYA 3JCMg 3A5ZA 1JJCB 3IG2A 2ALYB 2ZNJA 4C8QG 4JRKA 3V8JA 4HWOA 2ZZGA 2ZR3A 2DXTA 12ASA 3VQWA 5LJ5h 3LSQA 2ZR2A 2ZGWA 1H4SA 2XTIA 1WQWA 1X56A 4M77G 3RACA 3BFMA 2Q7GA 4X5OA 1Y96B 4F7UA 4NL2A 3SWNA 4XTZA 4EX5A 3JCMh 4M75E 4YRGA 4NCXA 5LJ5d 2Y90A 2P5IA 1QF6A 1TH7A 4M75F 1JRIA 1M5Q1 3A5YA 1EIYA 5GAOr 4WJ3M 2DQ0A 4CS2A 1B70B 1NJ6A 4K88A 4YREA 5K1PA 1KQ2A 2VC8A 4BW9A 1YCYA 4M78C 2CGHA 3TUPA 4TVYA 3JCMd 3HRKA 3SWNC 2ALYA 2RM4A 4M7DG 2FYKA 2EL9A 4RQFA 5GAN6 1G5IA 3HXUA 4TWAA 1Z7NA 5GAOp 5LJ5f 11ASA 5K1XA 2ZT8A 5GAMg 4CS4A 4AH6A 4M75D 1H4VB 4JUVA 2DTIA 3UGTA 1NJ5A 2CJAA 1H4QA 1NJ2A 4YRLA 4LNSA 2YHTA 2Q7EA 1I81A 3JCMc 1BIBA 2IY5B 1SETA 3JCMf 1B34A 2PMFA 4YYEA 4EO4A 4RQEA 4RDXA 1HTTA 5GANe 4P3NA 1WU7A 2RHSB 4CS3A 4BWAA 4DPGA 2E41A 4M77D 1G51A 1HC7A 2AKWB 2PMEA 5GAMh 1WQ7A 4M75A 1B70A 4H2TA 4PJOG 4YRRA 3INZA 4G85A 5GANj 2ZNIA 3REXA 4C92G 3A7AA 3TEGA 2Q5HA 1B8AA 2DVEA 3BW1A 4RCBA 3A31A 2I4MA 2QHUA 3MEYA 1ADYA 3G1ZA 5GAMd 4M78F 4NOYA 4YROA 3VBBA 3RESA 2RA2A 1W66A 4M75C 3HSBA 4M78B 2I4OA 3VQYA 4HWSA 1YFRA 4TQFA 3HY1A 3SWNB 4E51A 5I21A 2XGTA 4XEOA 2QTXA 3QO3A 3V8KA 4UP8A 4N0AA 1KMMA 3V7CA 3JB9I 1NNHA 5GAOn 3IKLA 1WPYA 3UH0A 4PJOE 2C8MA 4V2SA 4WJ4A 4C92E 1EIYB 4P3OA 3HFNA 1BBUA 1E1TA 5GAMf 4OP0A 4HT8A 2ODRD 1X55A 4RCCA 2VXFA 3JB9J 3JB9H 2DXUA 2I4NA 1EVKA 1C0AA 3MF1A 4A54A 3WQZA 1N9WA 3ERRA 4TQDA 4N0AC 3A7UA 2DZCA 4XQ3A 3L4GA 1IL2A 3HXXA 1N9RA 3FJPA 5GAN2 4PJOD 3QHSA 5CAIA 4C92D 1USYC 1LOJA 2JN0A 4M78A 1B34B 4ZTUB 3RKXA 4H2YA 3NELA 2ZT7A 4KR2A 4TVAB 1U1SA 3PCOA 3QNEA 3KFUA 4A53A 4UPAA 4XU0A 1E22A 1KOGA 3FIFA 5GANg 4M7AG 3P8VA 4C8QE 3REUA 3JB9G 2RHQB
chains in the Genus database with same CATH superfamily
1EFNA 5GAN7 1U1TA 2K3XA 2DBMA 3G71Q 1VIEA 1F1BB 1K8AC 1VQNT 2CKKA 2F5KA 3GIBA 4M77E 2HQXA 3E2UA 2L0AA 2X4WA 4KRTA 5KYNA 3QPHA 3L2VA 2NYSA 1YIJT 2E3CA 4ORZA 3M4PA 5GMKl 1BK2A 1RADB 2KXCA 2DU5A 2ENMA 4RTZA 2MWPA 1M3CA 4EMKA 1VQKQ 3EFSA 1NJIC 2KROA 1PHTA 4K86A 1MNDA 1YI2Q 5LJ3g 5CQXA 1T3SA 3E9HA 3I55T 3CCST 1M90R 1VYUA 2E3IA 1QVGP 3MJXA 4HCCA 3CMAA 2JM9A 2L3QA 4Z02A 1WI7A 1MMNA 1V76A 3MKDA 4AT1B 2ZZEA 4RMFA 3M53A 1GCPA 5E3IA 4H2SA 2L5QA 4X9DA 1DJ7B 2ARTA 3PE0A 1I0CA 2DVJA 2LJ0A 1SHFA 2YLBA 4IURA 4YDQA 2L3SA 1K1ZA 1C1AA 1K73U 1TTHB 2K9GA 3CBPA 2QK0A 3HXZA 1C0MA 3H0FA 3BDLA 2XHCA 1K9MR 4LDYA 1H4TA 2O4XB 1TUGB 4PFOA 3A74A 5LJ3d 4LE9A 3H9NA 4JLGA 4R55A 1ZSZA 1WXBA 4C92F 3U23A 1BI1A 3HPWA 1SSHA 4J6YA 2KRSA 3CCVA 4J6WA 3CCJT 1I8FA 4LD6A 4CH4A 4C92B 1USYA 1SRLA 4DA4A 1NJ1A 1PSFA 2I4LA 4M7DA 5C52B 1VQ8T 4J9GA 3QSUA 2MF2A 1YHQQ 4FT2A 4P73A 2H8HA 1KQSA 3EHRA 1T0JA 2E5AA 4P71C 4EMHA 5J26A 3QZ9B 3HFZB 1RAFB 4M75G 3EGUA 3VS7A 2FZKB 1X43A 4XK8E 2KE9A 3WVEB 1I5OB 1PG5B 3OS2A 3M57A 2YDLA 5DLOA 1JO8A 4IUVA 1L0WA 5AYFA 1Y07A 2AZVA 4E2FB 4LDUA 2BE9B 2CP7A 2NUPA 2L3PA 3A7RA 4HT9A 5A2QE 4L5GA 4HXJA 3OYYA 1VQMQ 2ODRC 4PJLA 4PJOA 2MI6A 4H2XA 3OS0A 4C8QB 3G4SA 2RMOA 2BZ8A 4YCVA 5CKEA 5L8RE 2QA4A 2YUQA 2P0KA 3EGDA 4C5HA 3X25B 1JXOA 3THKA 5L23A 2LQKA 1B7YA 1BBZA 2CH4A 4H2VA 5CKBA 2WACA 4J6XA 2JOYA 1VQKT 2J3LA 1D3BB 1YFTA 3QXEB 1YI2T 1EVLA 4M77B 1I07A 2B86A 1EFWA 5LJ5j 1NYFA 2DAQA 3BDUA 4YP0A 3TU4K 1G3TA 1OPLA 2FZCB 4H02A 3LWHA 1QQJA 2LVMA 1YWOA 4K11A 1HJDA 2RQUA 4YCUA 1RAGB 3VQXA 3RDVA 1NPPA 1H92A 1SERA 2JT4A 1UEBA 1SPKA 3UT1A 2DEUA 1QVFP 3CMQA 3QWYA 3G4SQ 4HVCA 2QA4Q 3L1AA 3IKMB 4LUDA 3EG3A 3KBGA 3MEUA 3JCMV 1PNJA 4PK4A 2LCCA 3H0IA 2YT6A 1QVGS 4P75A 5IXFA 1S1NA 1WHKA 1IHWA 2CH4W 2PVOB 4YCWA 3L2WA 2VWFA 4E7SA 9ATCB 2EGCA 5I11A 1D0ZA 2BTTA 1GRIA 1M3BA 5ELOA 1PD0A 5LL6S 4P3PA 1CSKA 2D1XA 2ED0A 3OS1A 4RG2A 1NE8A 2HQHA 4M7AA 4NL3A 1OEBA 5KE3A 4BUGA 3C0CA 2DXBA 2EWNA 2CDTA 1YHQT 1AVZC 3HFVA 4DBQA 3TREA 2LNVA 3JCMX 5KYXA 3X26B 4KBMB 1QLYA 3EGXB 3QJ6A 1YJNA 2RJFA 2K3YA 3LH0A 2CP0A 1YJWA 2VXEA 2PU9B 4FYXB 2DBKA 4AFUC 5GMKh 1G3WA 4XEMA 2MAMA 4PFPA 2M16A 1XJWB 4CC2A 1U5SA 1ZUYA 4LVLA 2QHTA 2AKWA 4M78D 1VIFA 5ELNA 3M9QA 3JV3A 4OLFA 4KGXB 3CCLA 4BY6B 1VQMT 2LQWA 1QW1A 12ASA 3CCRA 5CK9A 5FWBA 4PL6A 4BE0A 4F17A 1Q81U 1UGPB 2XTIA 2P4RA 1X56A 2LX9A 2RHZA 3SDZA 3RACA 3BFMA 2DFUA 3FEOA 4A4HA 2GBQA 4NL2A 2ROTA 3SWNA 4XTZA 1YJNQ 2DE0X 3M0TA 1M1KC 4Q5WA 2P5IA 4M75F 2JM8A 1JRIA 3A5YA 5FU7C 4WJ3M 1R8OB 1AZEA 4YREA 2YUOA 2DPPB 1KQ2A 4M78C 2CGHA 3E19A 1MMAA 2PVGB 4TVYA 2X4YA 4RG8A 3MEVA 5KYYB 2JNGA 3GBQA 1Q86U 1G3SA 1RAAB 2GQVA 1WHGA 3G4ST 1PM3A 1QCNA 1RLQC 3S3MA 2PUKB 4AH6A 4M75D 1QWFA 4B6MA 4JZ4A 3PFSA 2EYXA 1M27C 2Q7EA 2XDBA 1BIBA 1B34A 2X4XA 1IGQA 4BI3A 2CSQA 3MO8A 2QYZA 2KDSA 4P3NA 2A8EA 1K73R 2QEXA 5GJWB 4PJJA 2VGNA 1G51A 3ER0A 2NUTB 3NFCA 2XKOC 1KC8C 1RL2A 1VQOA 4ELZC 2FEIA 4YRRA 4G85A 1QVFS 3A7AA 2L2PA 1X27A 1KK7A 2LTOA 1B8AA 2DD5A 3MCAB 3OW2S 4ELYC 5A0GA 1X2QA 4E47A 3C4SA 2EGEA 5HY6A 2H3JA 2K5LA 4NOYA 2RA2A 2COZA 4M75C 4CC3A 2PZ1A 1N27A 1YFRA 2RI3A 2EIFA 4E51A 3V8KA 1C6VX 4E7KA 1MV0B 4N0AA 3IKLA 1RAIB 1D1BA 2YRCA 3HFNA 4VUBA 2V1RA 4HT8A 3OYJA 3CCEA 1XQHA 2EPDA 2K3BA 1VQ6A 1VQOQ 2V1QA 2DK3A 1NYGA 1K4US 3VS2A 4A54A 3P8DA 3CCMA 2X51A 4TQDA 1WLPB 4BE1A 4IUQA 1BCMA 2DL4A 1QCOA 2DZCA 2OX7A 4XQ3A 3CBMA 5FLXE 3M58A 2VKNA 4LXCA 3CEYA 4Z89A 3J7AF 4PJOD 1CKAA 5CAIA 1USYC 2LRQA 1LCKA 2JN0A 1FMKA 4ZTUB 2FHDA 4H2YA 5FWCA 2DL7A 2WSFE 1QVGA 4A53A 4UPAA 3P8VA 2SRCA 2ESWA 3CCEQ 1H8KA 2DILA 1Q7YC 2DU7A 3VS6A 3M0UA 1S72A 1Z9QA 5HK0A 4KUDK 4YRQA 4LDXA 4MDWA 4FYVB 2I2LA 3OYIA 4DBFA 1VQ5A 4C0DB 3L2QA 3PNWC 4G84A 2ZINA 2MYSA 1Q82C 1G5HA 3I56Q 3E9GA 5D6WA 5GANh 4PJOC 5FRNA 3PMIA 2VUBA 3PMTA 1WYXA 2DA9A 2HNIA 1OZ2A 2DM1A 1UHCA 2F5TX 2GQIA 1GL5A 4AG1C 4N4HA 4H2UA 3QG1A 4RTUA 4C5EA 2C0OA 3GPLA 4AMCA 4PLLA 1P92A 1HXDA 2QI2A 1OU9A 3EH1A 1BU1A 1YNZA 4ATOA 1AWWA 1IO6A 4JJNK 4GLKA 2AMCB 1Z7MA 3LGLA 2M0OA 3H0HA 1ACMB 1NYRA 4C8QA 3E9FA 2DYIA 4F7UG 4L87A 2YRDA 1X6OA 4QQDA 3FDRA 4M7AD 1MUZA 3L2ZA 4Y92A 4ZN3A 3JB9D 1KFZA 1VQ5Q 4ZIBA 4RTXA 3VS4A 5GANf 2MCNA 3CC4A 4KQEA 1D3BA 4M77A 4WTOB 4ZGEB 1I5LA 3LX7A 3OYHA 1E6HA 4GLMA 3X24B 1MGQA 2ATCB 5LJ3e 1OI1A 3QDRB 4X9CA 1AT1B 3M4GA 2EYZA 1WIEA 1I4K1 3M55A 4ZNXA 1VQOT 2DIGA 3HRSA 4CH3A 1BKBA 1KMNA 2LQ8A 4F7UE 4OGCA 2ED1A 2KVQG 4YPFA 4QKUA 1V1CA 2ZT5A 2A37A 1HD3A 2CJ9A 2O9VA 2P0LA 1YGBA 2DMOA 5KH6A 1M30A 5KCHA 4IIOA 1W2BS 5A0LA 4M7AC 2CIMA 1Q81R 1M4ZA 3A8OB 1NG2A 4E7IA 3I5SA 3CXCA 3CC4Q 3A8LB 4J7FA 1K76A 1YITT 2FB7A 4JRPA 2ZZDA 2DTOA 2JMCA 4LUEA 2GNCA 4BDYA 1E24A 1O75A 2K4YA 3HP9A 4EMGA 3A1PA 2GFUA 2PVDB 5GMKe 4IUUA 5KYWA 4QQ6A 1M90C 4L6V5 1X75C 3HRIA 2RH2A 2K2VA 1D0YA 2P0QA 4P72C 4XTYA 4Y91A 8ATCB 5GAN5 2RJCA 4PG3A 2KMTA 3REAB 4ZTZB 2K5FA 4TVWA 5CO7A 2RJDA 3OW2A 3M4QA 1Q86R 2ARSA 4YRKA 3I56T 4MMKA 1Y71A 4DEYA 1ZA2B 2EJGA 2M1HA 4J9HA 5I2SA 2RQTA 3HFOA 2QQAA 4FM4B 4RKUE 1WYDA 2JS2A 4AFQC 1QE0A 3RR6A 4DEXA 3CC2A 3LSSA 3NTHA 1WDXA 2FRWA 2VGMA 4R56A 1EQRA 2E5QA 1KG1A 2XU8A 3CCQA 5D7UA 3IALA 3C94A 3QO8A 5GAOq 4OMQA 1EX4A 1VQ5T 2C0TA 4M78G 3VQVA 2EQKA 4OB3B 2J05A 1B76A 4FCYA 5FU6C 4BB7A 2DERA 2QQ9A 1EOVA 4BI4A 4PLIA 3H6ZA 4WI1A 2HSPA 4RTYA 3CCUA 1AZGB 1VA7A 5J39A 3S3OA 5GMKm 2D0QB 1B7TA 2F2XA 3CC2Q 1ZBJA 3PVQA 3HTZA 4E6RA 4UP7A 4J9EA 4UP9A 4HT4A 4ZTFA 2E64A 3BY7A 4M78E 1PYSB 3RKYA 4F7UF 3CMAQ 3E9IA 5F5WA 2BIVA 3JCMJ 4WF2A 2LCSA 4F7UB 4P74C 5IHIA 4B9XA 3CC4T 1AOJA 3L2RA 1WHMA 3H41A 3LLRA 3PIOA 3J80E 3JSCA 1M9SA 4IUPA 5I2MA 3CPWA 1M2VB 3JCMb 3J81E 2QQRA 2JXBA 2DNUA 3NMZC 1YB3A 3FB9A 2NUTA 3UPUA 4XTWA 2RO0A 3MQZA 4TTVA 3HXYA 1JJCB 3IG2A 2R5MA 2ALYB 3G1JA 1YWPA 3VS3A 1AWOA 1JXMA 2XD0A 2K2MA 2OTJA 1WFWA 3G71T 3CC7A 3VQWA 1BI2A 2ZR2A 1VQ7A 1R77A 1Y7XA 2E6ZA 3CCVQ 4TVRA 3URGA 5CKDA 3HTRA 4JS4A 1WJQA 1H3HA 2K6DA 2Q7GA 4X5OA 1Y96B 3DB4A 2G3RA 4EX5A 3JCMh 4M75E 1VQLA 1QF6A 1HSQA 3VS1A 3AT1B 2VASA 3L42A 1VQ9A 2CZ6B 2NWMA 2A28A 3KFVA 5GAOr 3CD6A 2DQ0A 1NJ6A 4K88A 4BACA 2LJ1A 4BW9A 2YRVA 3CXCP 1Y57A 2CZ0B 4C0ZA 1WXUA 2E12A 5J3BA 1YP5A 2L89A 3OYNA 4M7DG 2FYKA 1ARKA 2JJ9A 1VQ4A 1TXQA 4MDXA 5GAN6 1G5IA 1ZLMA 2PUOB 11ASA 5GAOp 2I0NA 3L2UA 5K1XA 5IN1A 1GFCA 2A08A 2HEQA 6AT1B 4LDVA 4JUVA 3UGTA 1NJ5A 1NJ2A 2MPXC 2F69A 4YRLA 3EG9B 2AT1B 1W2BA 1I81A 3JCMc 3JRZA 3JCMf 2QGFB 3OW2P 4YYEA 3O5ZA 2CP2A 4RDXA 1YN8A 5GANe 4F04B 2OJ2A 2EKOA 1U8RA 4BWAA 3EFOA 2E41A 4M77D 1PWTA 5GAMh 1B3QA 1B70A 1FXXA 5KYUB 2DETA 4H2TA 4PJOG 3REXA 1BI0A 4J83A 3TEGA 2HBWA 2RN8A 3VRYA 2BE7D 2X35A 3CMAT 1JJ2A 2LZ6B 3HRUA 3BW1A 1VQ4Q 2GTJA 2I4MA 5FU7B 3JAME 1ADYA 1PRLC 1VYTA 2Z0WA 8AT1B 4M78F 2D6FA 4YROA 5EC7A 3RESA 3WVDB 3UDCA 7AT1B 1W66A 4M78B 2I4OA 1NLPC 3T9NA 1GXIE 2AZSA 1YBYA 3MPUB 3HRTA 3ZBDA 1FMWA 1LPLA 1KMMA 1FMVA 3V7CA 4O6JA 3UH0A 2ZCFB 1WPYA 5CR2A 4PJOE 4WJ4A 2WSEE 4R0KA 1M3AA 4FSSA 4JJDA 4JZ3A 5GAMf 1E1TA 4E7LA 3JB9H 3NGPA 1EVKA 3MF1A 1C0AA 4HCBA 2IG0A 4QT7A 3CCVT 3A7UA 3GLXA 1LVKA 2DRMA 3M4YA 1GBRA 1IL2A 4KGVB 1N9RA 3FJPA 3M59A 1FWZA 5GAN2 2V8KA 1AD5A 3OYEA 1WJSA 2K5IA 2OTLA 1OV3A 4IKFA 1X69A 2ZT7A 2DL5A 1YJWQ 1TU0B 3KFUA 5CCAA 1G5VA 3OQ5A 2XICA 3FIFA 5GANg 4M7AG 1PCXA 3JB9G 4M75B 3CBOA 3CPWP 1KD1U 1OU8A 3LC0A 2ZPGB 4JLIA 2HAXA 3CCLQ 2RHIA 4C5IA 1WHLA 5GAN4 3F70A 4YRSA 1BB9A 2Q7HA 2QA4T 4QVDA 4K87A 2DYBA 3CCRQ 2C7IA 1X54A 2LJ3A 4F16A 3VUZA 2COWA 2JS0A 3BJUA 3UGQA 3M0PA 1QKWA 4RTWA 1UB4A 4M7AE 1ASYA 1VYVA 3CXCS 1ADJA 4MZMA 2KSSA 2ROLA 3VRZA 2EYWA 2YSQA 2ZTGA 4CH5A 1N8RU 1JQQA 2W0ZA 2HMAA 3V7SA 4M4ZA 4TVAA 2BZXA 2YLCA 5GAN3 1ZSGA 2JUFA 2RQRA 1M1GA 1MV3A 2ABLA 3QBYA 5I22A 5C51B 3V8LA 5GANd 1Q95G 4YRFA 3RMQA 1VQZA 3EG1A 2RHQA 4M7DF 3GNFB 3RF1A 1T0HA 4A4EA 5C0MA 2D0NA 3SHWA 4EMKC 1NBEB 1I1JA 2X3XD 2EYQA 3LW5E 4KGZB 1M1KR 4DOWA 1ABOA 4LNPA 1FYFA 4Y28E 2IVWA 1NEBA 4YRIA 4RTTA 2G6FX 3I35A 4XTVA 2LC4A 2M02A 4OVAA 4M7DD 2VYTA 5GAOm 1XNIA 1N9SA 3HXVA 2DD4A 2CT3A 2DZ9A 5GMKi 1W2BP 2MOXA 3NTIA 1QCFA 1K8AU 4PJOF 5IHNA 2QEXQ 3G6EA 3VV0A 1K0SA 5LJ3j 1EIFA 3M0QA 1Y0MA 1PRMC 4PJOB 2LP5A 4P71A 4H2XB 1JBMA 2FG0A 2KNBB 1ZHIA 3G7ZA 1UUEA 3OYAA 3VJPA 3MHXA 3AHUA 1SSFA 1B7YB 4CRIA 1NJIU 1X2HA 2O9SA 1ZSZC 2X3WD 1JJ2P 1D0XA 3RMSA 1RACB 3JCMQ 2DF6A 1YJNT 4KR3A 1OPKA 1YJWT 1SESA 2ZPFB 3UA7A 1MHNA 3PTAA 1J5WA 2FRYA 1KC8R 4ME7A 3ZFJA 1WNLA 2VV5A 4RTVA 4DOVA 1BI3A 2R5AA 3JCMW 4M7DC 1UJ0A 2O4XA 2RK2A 1U3OA 4AFSC 1M2OA 4P73C 5HKCA 3UA6A 2GTOA 3TEHB 3G6EQ 3CCLT 4FIBA 5GMKj 1PYSA 1VQNA 3EG2A 3VYGA 4ZTJA 1VQ6Q 4C92A 1KIKA 2KYBA 3UF4A 3CCRT 3EH2A 2LX7A 2CREA 2JZ2A 3CCMQ 3QO7A 1YIJA 1W70A 5FW9A 4OMNA 1WJRA 2EW3A 1O9SA 2NUZA 3OMCA 3Q1JA 2ZCEA 3QTCA 2CT4A 3OYFA 4PJMA 3VS5A 2ARUA 2BUDA 1M2VA 2M0YA 2EQJA 2XDDA 1QP3A 5DY9A 2AHJB 2FL7A 4IIMA 2YXYA 2DXCA 4OB0B 1W4SA 3JCMe 3SB2A 3I55A 3CPWS 3CCSA 3HFZA 1G83A 2KR3A 2E10A 4M7AF 1JJCA 1LJOA 4Q6GA 1IRXA 3JB9F 2G4CA 4HVWA 1UHFA 2ZZFA 1NJ8A 1NYQA 3DSQA 4LVKA 4M7AB 4YRMA 1KHIA 2DJQA 3I7FA 1PKSA 3M56A 5CKFA 4QVCA 3PGGA 2ZXFA 2IIMA 5KYXB 3VU3C 4ESRA 4CC4B 2X9HA 1S72Q 2KBTA 1TSFA 1ZUKA 1Y96A 2LCLA 3BE3A 3QZ5B 3ICAA 2Q5IA 1Q81C 4PNOA 4Q15A 4HWRA 5HGQA 2ECZA 2ZIOA 1TS9A 4JJBA 1UE9A 2HKQB 4OF1A 3A32A 1J3TA 4XTUA 4HWTA 2LT1A 3I55Q 2QEXT 3MEAA 1PKTA 1LYLA 2BZYA 3C12A 4C0FA 3CCJA 5GAMe 4PHCA 4RUGA 4HWPA 2QQBA 1X01A 2R58A 1IB8A 4LVJA 4FT4A 4P75C 2DQ3A 1VQ8A 5C53B 2JTMA 5AT1B 1IGUA 3UFGA 2MIOA 2RHXA 3NETA 1Q86C 1KQ1A 3VS0A 1AWJA 1MNEA 2KEAA 4YRCA 2QHSA 4J15A 2J6FA 3OYGA 3PZCA 1E6GA 4HCZA 1ABQA 2GFAA 4A4GA 4E7HA 4KT0E 5KNNA 3NENA 2EAYA 4MMLA 3V7RA 4JJCA 3DKMA 2RI2A 2RHYA 4PKCC 4J9DA 3JCMP 3OD1A 1AHJB 1SHGA 1TOVA 1D1AA 2E6NA 3JCMg 2L8DA 4BD3A 4X34A 4HWOA 4C8QG 3CCET 1KJWA 5FU6B 4KUIA 3FLGA 1G3YA 3VKIA 2DXTA 2ZR3A 1VQ6T 3CCJQ 2GF7A 5HCKA 4JRQA 2W10A 4L59A 3CCMT 5LJ5h 3LSQA 2QXFA 1JJ2S 4QVZA 2MWOA 4HVUA 1KD1R 3DLMA 4M77G 1UFFA 2KT1A 3IQLA 1AEYA 1VQKA 1RI0A 1D1CA 2QDYB 3EGXA 2EYYA 2YWWA 3OYLA 4J9FA 1K9AA 4NCXA 3M0RA 4OMFB 1M5Q1 1PSEA 4CS2A 4LD9K 2DO3A 5IH2A 1K9MC 2VC8A 2J6KA 1NM7A 1YCYA 1QP2A 2DL8A 3DLLA 1GCQA 3JCMd 1N8RR 3HRKA 3SWNC 2KRNA 2LNHB 1WHJA 1A0NB 2RM4A 2NS6A 3HHTB 3QWXX 2EL9A 3RNJA 2KY9A 3HXUA 4Z8AA 4TWAA 1PC0A 5LJ5f 1S72T 5IAYA 4FSXA 2ZT8A 3A98A 4QW2A 5GAMg 4CS4A 4J8OA 1G8XA 4FYYB 1H4VB 2CSIA 1Z9ZA 2DTIA 1TUCA 2A36A 4KULA 1H4QA 1SG5A 1R0BG 1OQKA 1OX8A 2YHTA 4OMOA 3CQTA 2YUNA 3OY9A 2IY5B 2QTVA 2M51A 3RBBB 2F2VA 1W1FA 1OULA 4EDUA 1HTTA 3HKSA 3OS5A 2RHSB 2EVRA 2JMAA 4DPGA 1HC7A 2PMEA 1WQ7A 3P8BB 4M75A 2QAZA 4FU6A 3H8ZA 3INZA 3A5ZB 2CP6A 5GANj 3OBWA 3C95A 2HSEB 1KHCA 4DBRA 1K8AR 4JDSA 5KYYA 3S3NA 2DVEA 3PT9A 4RCBA 3A31A 1YHQA 2LQNA 2QHUA 1KSWA 5GAMd 3G1ZA 1M1KU 5D6YA 3CCQQ 1YFNA 4KH1B 3VQYA 2FZGB 4TQFA 5DLQE 2ZPIB 2XGTA 4XEOA 4UP8A 1WGSA 1NJIR 2J7IA 2J06A 2L3RA 1EIYB 4P3OA 1QKXA 2OAUA 1X6BA 1BBUA 2ODRD 1VQMA 2XI9A 3CCUQ 2VXFA 1IZ6A 2DXUA 3WQZA 2WSCE 1N9WA 4N0AC 3TSZA 3UWNA 1V29B 1E7OA 3HXXA 1OX9A 3I5RA 4Z88A 4C92D 2HZYA 2HCKA 4FW1A 4D8DA 5DM7R 2HKNA 2SEMA 3RKXA 2HBPA 1KC8U 1BYMA 3NELA 1NZ9A 1QVPA 4OMMA 1UGSB 2FPEA 3QNEA 2V26A 1IXDA 1TUDA 1E22A 1KOGA 2QGGA 4XAXB 2E5KA 4C8QF 1ZUUA 1LNXA 4E7ZA 4N4IA 4O5VA 4XU1A 2O01E 3NTKA 2XK0A 4II1A 4AG2C 3R6NA 3QO5A 3RL6A 2DDZA 1ZX6A 2CJBA 2OTJQ 4M77F 5IHKA 3CC7Q 3EHQA 1N6AA 2Y4YA 1HK9A 4EIKA 1VQ7Q 4N4GA 1H3ZA 3TQ7P 1UGVA 3O8VA 2K7AA 2VB6A 4C92C 2EJ9A 4C8QD 4YRTA 3LH5A 2KK4A 4JPBW 5C6SA 3RERA 1BIAA 4ZGJB 2BKDN 1GBQA 2DX1A 3EG0A 1VQLQ 2KAFA 3CC2T 4FYWB 3TEHA 1VQ9Q 2RF0A 2E70A 3CD6Q 4M7DE 3LYIA 1BCOA 2RI5A 3SD4A 2E1HA 3NEMA 2D9TA 3QJYA 1RI9A 1R0CB 2LMJA 4C5GA 2RD1A 3RUXA 3CCQT 3UATA 3OYDA 2ZIMA 3MF2A 4HA8A 3L4GB 1WLEA 5ECAA 3LGFA 2XMFA 5LJ3h 3GF5A 3KXTA 5IXBA 2CUBA 2XDPA 1WA7A 1K0XA 1D09B 3D7SB 4OMPA 4C8QC 4H2WA 5KYWB 3MP8A 3RKWA 3SEMA 2RB6A 3CCUT 3HY0A 1Q7YU 3PCOB 2MMPA 3OA6A 1XOVA 2DL3A 3NPFA 4CI0C 2EJFA 3META 2RNAA 1YFSA 2QASA 2JTEA 2O31A 4M77C 5GAN8 2CZ7B 2ZT6A 2ZAEA 2AMCA 2RJEA 4UC4A 3P8TA 2FVUA 1Q82U 1AWXA 1YJ9A 5LJ3f 5CIUA 2RQWA 2DJZA 3W3SA 2RHUA 4P72A 2H3EB 4A63B 3TSWA 2CP5A 2OI3A 3OB9A 1MMGA 3TEEA 1XTDA 3A8HB 4EMKB 1MMDA 2J3MA 2DEQA 2DTHA 1G2BA 4ZGDB 1VQPA 5D6XA 1ATIA 2XG8D 1K73C 3FJ5A 3TVTA 2QDLA 5FRMA 3P8YA 1UGQB 4E7JA 4LDWA 5CQYA 2KYMA 4DQ2A 4OB2B 2A3LA 1RAHB 2E3HA 2XIDA 2OTJT 3A8GB 1TWBA 3CC7T 2LT4A 3A8MB 1FX7A 3R6OA 3QIIA 1NLOC 5GJVB 2DRKA 5LJ5e 1VQ7T 1N5ZA 1YJ9Q 1UECA 3E1SA 3P8HA 3FRNA 4J9IA 1H641 3QKJA 2FPDA 4XU3A 4OGEA 1YCSB 1WHHA 2A7YA 1KQSP 2O88A 1VQLT 2K79A 2OTLQ 5KCOA 3R07A 4O2DA 4J9BA 3FC3A 1VQ9T 1X2KA 3CD6T 2GGRA 2E65A 1VQPQ 1WXTA 1SEMA 1M8VA 1ZSZB 1X2GA 2F2WA 4YRJA 4YRNA 4YTLA 3KUFA 4F14A 2J6OA 3M54A 1VQ4T 1SRYA 4FW2A 4ZN1A 4DBHA 1GCQC 3QDFA 4M7DB 5GAOl 2EQUA 1VOMA 3ZL7C 3M0SA 2OAWA 3HXWA 4BY6C 3RGLA 4XU2A 5FROA 1GGMA 2VVKA 2AIRB 3OBYA 3QYGB 4WCIA 3EFRA 4B9WA 1M90U 2JW4A 2PQWA 3RIRA 4BI8B 3N5BB 2RK1A 2AK5A 2QHVA 2EKHA 4P74A 3X20B 1FYNA 1B07A 2CS7A 4J7IA 4NS5A 2QQSA 4OMLA 4PJNA 4JRIA 1UDLA 4AFZC 2NUPB 1SRMA 4YRPA 4KH0B 2D8HA 2EQMA 2HDAA 1RAEB 2CP3A 1E1OA 2DKGA 4A4KA 3MP1A 2M9UA 1ASZA 4IUTA 4MZPA 5GAMj 5CVIA 1WZOA 4CH6A 3EGDB 2F1LA 2DIQA 4BE2A 1T3LA 4J5YA 1K9MU 1BBWA 2IY5A 4FL6A 5A0DA 1YITA 3TCJA 1TG0A 2K57A 5LJ5g 5CKHA 2C06A 4EPCA 2GCXA 1RIQA 1WX6A 4XTXA 1JEGA 1VUBA 2HD0A 2RHSA 1ZBXA 3HL8A 5EG2A 3MP6A 3CMEA 3QUIA 3PVLA 5M9OA 1SKUB 3PIPA 4MZTA 3VUBA 1OZ3A 3A5ZA 3OYKA 3ZEHA 4GBQA 4QQGA 2ZNJA 1OYXA 4JRKA 3V8JA 2ZZGA 1EZZB 2LDMA 3DB3A 2P4TA 3QYHB 2C0IA 4X1VA 1UGRB 3I56A 1YJ9T 2ZGWA 1H4SA 1QWEA 1IHVA 1WQWA 1RLPC 1PD1A 4F7UA 2AKLA 1NPRA 1ZA1B 3OYBA 2ZPBB 3NHNA 2HQEA 3M5AA 4D8KA 1YITQ 2OTLT 3EFOB 4YRGA 5LJ5d 2Y90A 1TH7A 2KI7A 1EIYA 2YUPA 1VQPT 1B70B 3CMEQ 2KXDA 5K1PA 3X28B 2IPOB 3VYHB 2JTFA 2A0FB 3TUPA 2NLUA 5KE2A 3OSSC 1M1FA 2ALYA 4A4FA 4RQFA 1Z7NA 2X4JA 3CPFA 2QG9B 1VQNQ 2CJAA 4GY5A 3WXMB 4LNSA 1KQSS 2ZPHB 1CKBA 4OB1B 2HL5C 1SETA 1X6GA 1YIJQ 2PMFA 4EO4A 3I9QA 4RQEA 1RUWA 1WU7A 4CS3A 1QMCA 1JU5C 4PFZA 2AKWB 2FPFA 2FO0A 1OOTA 4J9CA 3ME9A 2MK5A 2KQWA 3CCSQ 2ZNIA 4JS5A 2P0PA 4C92G 1Q7YR 3MEWA 3REBB 2Q5HA 1RABB 4HVVA 3SFMA 1U06A 3ULRB 4CC7A 3LWIA 4LVIA 1UG1A 3MEYA 4P5NA 2RPNA 1KD1C 2EFIA 3EAEA 3VBBA 4C0GA 2E4HA 2PNIA 2RQVA 3HSBA 1Q82R 4HWSA 2EGAA 3GNGA 3EG9A 3HY1A 3SWNB 1W6XA 5I21A 2QTXA 3QO3A 1ZQ1A 2PTKA 4RMOA 4LVMA 1NNHA 3JB9I 5GAOn 1HYOA 2Y4XA 2C8MA 4V2SA 4C92E 4C0DC 4OP0A 3OSVA 1X55A 4RCCA 3GOXA 3OYMA 3JB9J 2V8JA 4HKEA 3G71A 1N8RC 5KYUA 2I4NA 3G6ET 2R57A 2EQIA 5IT9E 3ERRA 2B8AA 1UTIA 3GP8A 2HL3A 3L4GA 2KGTA 1SF9A 1M8MA 2O2OA 4HCKA 1NEGA 4D6WA 3OYCA 3QHSA 1VQ8Q 1UJYA 2COYA 1LOJA 1JB0E 2P84A 4M78A 2KT8A 1B34B 3CMET 3OMGA 2CZ1B 1YI2A 4KR2A 4BDZA 2EBPA 4TVAB 2D8JA 2DLPA 3S6WA 1U1SA 3PCOA 2AKKA 1IREB 2CUDA 4LN2A 4ANJA 2V8IA 4XU0A 2ZPEB 2CYZB 2JVVA 1GFDA 3ASKA 2KRMA 5HK3A 1QVFA 4C8QE 3REUA 2RHQB
chains in the Genus database with same CATH topology
5GAN7 1U1TA 2K3XA 1VIEA 1K8AC 1VQNT 2CKKA 2F5KA 3GIBA 4M77E 2HQXA 2X4WA 3QPHA 3L2VA 1YIJT 2E3CA 3M4PA 5GMKl 2DU5A 2MWPA 4EMKA 3EFSA 1NJIC 4K86A 5LJ3g 5CQXA 3E9HA 3I55T 3CCST 4HCCA 3CMAA 4Z02A 2ZZEA 4RMFA 3M53A 5E3IA 4H2SA 2L5QA 4X9DA 1DJ7B 2ARTA 2YLBA 4IURA 4YDQA 1K73U 3CBPA 3HXZA 3BDLA 2XHCA 4LDYA 1H4TA 2O4XB 3A74A 5LJ3d 4JLGA 4R55A 4C92F 1BI1A 3HPWA 4J6YA 3CCVA 4J6WA 3CCJT 1I8FA 4LD6A 4CH4A 4C92B 1USYA 4DA4A 1NJ1A 1PSFA 2I4LA 4M7DA 5C52B 1VQ8T 3QSUA 2MF2A 4FT2A 4P73A 1KQSA 2E5AA 4P71C 4EMHA 5J26A 3QZ9B 3HFZB 4M75G 4XK8E 3WVEB 3OS2A 3M57A 5DLOA 4IUVA 1L0WA 5AYFA 1Y07A 4LDUA 3A7RA 4HT9A 5A2QE 4L5GA 3OYYA 2ODRC 4PJOA 2MI6A 4H2XA 3OS0A 4C8QB 3G4SA 4YCVA 5CKEA 5L8RE 2QA4A 2P0KA 4C5HA 3X25B 2LQKA 1B7YA 4H2VA 5CKBA 2WACA 4J6XA 2JOYA 2J3LA 1VQKT 1D3BB 1YFTA 3QXEB 1YI2T 1EVLA 4M77B 1EFWA 5LJ5j 2DAQA 3BDUA 4YP0A 3TU4K 1G3TA 4H02A 3LWHA 2LVMA 4YCUA 3VQXA 1NPPA 1SERA 1UEBA 3UT1A 3CMQA 4HVCA 3L1AA 3IKMB 3KBGA 3MEUA 3JCMV 2LCCA 1QVGS 4P75A 2PVOB 4YCWA 3L2WA 5ELOA 5LL6S 4P3PA 3OS1A 4RG2A 1NE8A 4M7AA 4NL3A 5KE3A 4BUGA 2DXBA 2EWNA 1YHQT 3HFVA 3TREA 2LNVA 3JCMX 3X26B 4KBMB 3QJ6A 1YJNA 2RJFA 2K3YA 3LH0A 1YJWA 2VXEA 2PU9B 5GMKh 1G3WA 4XEMA 2MAMA 2M16A 4LVLA 2QHTA 2AKWA 4M78D 1VIFA 5ELNA 3M9QA 4OLFA 3CCLA 4BY6B 1VQMT 1QW1A 12ASA 3CCRA 5CK9A 4PL6A 4BE0A 1Q81U 1UGPB 2XTIA 1X56A 2LX9A 2RHZA 3SDZA 3RACA 3BFMA 3FEOA 4A4HA 4NL2A 3SWNA 4XTZA 1M1KC 4Q5WA 2P5IA 4M75F 1JRIA 3A5YA 5FU7C 4WJ3M 1R8OB 4YREA 2DPPB 1KQ2A 4M78C 2CGHA 3E19A 2PVGB 4TVYA 2X4YA 4RG8A 3MEVA 2JNGA 1Q86U 1G3SA 2GQVA 3G4ST 3S3MA 2PUKB 4AH6A 4M75D 3PFSA 2Q7EA 2XDBA 1BIBA 1B34A 2X4XA 4BI3A 3MO8A 2KDSA 4P3NA 2A8EA 2QEXA 2VGNA 1G51A 3ER0A 1KC8C 3NFCA 2XKOC 1RL2A 1VQOA 4ELZC 4YRRA 4G85A 1QVFS 3A7AA 2LTOA 1B8AA 2DD5A 3MCAB 3OW2S 4ELYC 5A0GA 4E47A 3C4SA 5HY6A 2H3JA 2K5LA 4NOYA 2RA2A 4M75C 1N27A 1YFRA 2RI3A 2EIFA 4E51A 3V8KA 4E7KA 4N0AA 3IKLA 3HFNA 4VUBA 4HT8A 3OYJA 3CCEA 1XQHA 1VQ6A 2DK3A 4A54A 3P8DA 3CCMA 4TQDA 4BE1A 4IUQA 2DZCA 4XQ3A 3CBMA 5FLXE 3M58A 3CEYA 3J7AF 4PJOD 5CAIA 1USYC 2LRQA 2JN0A 4ZTUB 2FHDA 4H2YA 2WSFE 1QVGA 4A53A 4UPAA 3P8VA 2DU7A 1Q7YC 1S72A 5HK0A 4KUDK 4YRQA 4LDXA 4MDWA 2I2LA 3OYIA 1VQ5A 4C0DB 3L2QA 3PNWC 4G84A 2ZINA 1Q82C 1G5HA 3E9GA 5D6WA 5GANh 4PJOC 5FRNA 3PMIA 2VUBA 3PMTA 2HNIA 1OZ2A 2F5TX 4N4HA 4H2UA 3QG1A 4C5EA 3GPLA 4PLLA 1P92A 1HXDA 2QI2A 4ATOA 4JJNK 4GLKA 2AMCB 1Z7MA 3LGLA 2M0OA 1NYRA 4C8QA 3E9FA 4F7UG 4L87A 1X6OA 4QQDA 3FDRA 4M7AD 3L2ZA 4ZN3A 3JB9D 4ZIBA 5GANf 3CC4A 4KQEA 1D3BA 4M77A 4ZGEB 1I5LA 3LX7A 3OYHA 3X24B 1MGQA 5LJ3e 1OI1A 3QDRB 4X9CA 3M4GA 1I4K1 3M55A 1VQOT 2DIGA 3HRSA 4CH3A 1BKBA 1KMNA 2LQ8A 4F7UE 4OGCA 2KVQG 4YPFA 2ZT5A 2CJ9A 2P0LA 1YGBA 5KH6A 5KCHA 1W2BS 5A0LA 4M7AC 2CIMA 1M4ZA 3A8OB 4E7IA 3CXCA 3A8LB 4J7FA 1YITT 4BDYA 1E24A 2FB7A 2ZZDA 2DTOA 4JRPA 1O75A 2K4YA 3HP9A 4EMGA 2GFUA 2PVDB 5GMKe 4IUUA 4QQ6A 1M90C 4L6V5 1X75C 3HRIA 2RH2A 2K2VA 2P0QA 4P72C 4XTYA 4Y91A 5GAN5 4ZTZB 2RJCA 4PG3A 2KMTA 2K5FA 4TVWA 5CO7A 2RJDA 3OW2A 3M4QA 2ARSA 4YRKA 3I56T 4MMKA 1Y71A 2EJGA 2M1HA 5I2SA 3HFOA 2QQAA 4FM4B 4RKUE 1WYDA 1QE0A 3CC2A 3LSSA 3NTHA 2VGMA 4R56A 1EQRA 2E5QA 1KG1A 2XU8A 3CCQA 3IALA 3C94A 3QO8A 5GAOq 1VQ5T 4M78G 3VQVA 2EQKA 4OB3B 1B76A 5FU6C 4BB7A 2QQ9A 1EOVA 4BI4A 4PLIA 3H6ZA 4WI1A 3CCUA 5J39A 3S3OA 5GMKm 2D0QB 3HTZA 4UP7A 4UP9A 4HT4A 4ZTFA 2E64A 3BY7A 4M78E 1PYSB 3RKYA 4F7UF 3E9IA 5F5WA 2BIVA 3JCMJ 4WF2A 4F7UB 4P74C 4B9XA 3CC4T 3L2RA 3LLRA 3PIOA 3J80E 3JSCA 1M9SA 4IUPA 5I2MA 3CPWA 3JCMb 3J81E 2QQRA 1YB3A 3FB9A 3UPUA 4XTWA 2RO0A 3MQZA 4TTVA 3HXYA 1JJCB 3IG2A 2R5MA 2ALYB 2XD0A 2OTJA 3G71T 3CC7A 3VQWA 1BI2A 2ZR2A 1VQ7A 1Y7XA 2E6ZA 4TVRA 3URGA 5CKDA 4JS4A 1WJQA 2Q7GA 4X5OA 1Y96B 3DB4A 2G3RA 4EX5A 3JCMh 4M75E 1VQLA 1QF6A 3L42A 1VQ9A 2CZ6B 5GAOr 2DQ0A 3CD6A 1NJ6A 4K88A 4BACA 4BW9A 2YRVA 2CZ0B 4C0ZA 2E12A 5J3BA 2L89A 3OYNA 4M7DG 2FYKA 1VQ4A 4MDXA 5GAN6 1G5IA 2PUOB 11ASA 5GAOp 3L2UA 5K1XA 5IN1A 4LDVA 4JUVA 3UGTA 1NJ5A 1NJ2A 2F69A 4YRLA 1W2BA 1I81A 3JCMc 3JRZA 3JCMf 4YYEA 4RDXA 5GANe 2EKOA 1U8RA 4BWAA 2E41A 4M77D 5GAMh 1B70A 1FXXA 4H2TA 4PJOG 3REXA 1BI0A 4J83A 3TEGA 2X35A 3CMAT 1JJ2A 3HRUA 3BW1A 2I4MA 5FU7B 3JAME 1ADYA 2D6FA 4M78F 4YROA 3RESA 3WVDB 3UDCA 1W66A 4M78B 2I4OA 3T9NA 1GXIE 1YBYA 3HRTA 3ZBDA 1KMMA 3V7CA 4O6JA 3UH0A 2ZCFB 1WPYA 5CR2A 4PJOE 4WJ4A 2WSEE 5GAMf 1E1TA 4E7LA 3JB9H 1EVKA 1C0AA 3MF1A 4HCBA 2IG0A 3CCVT 3A7UA 3GLXA 3M4YA 1IL2A 1N9RA 3FJPA 3M59A 1FWZA 5GAN2 2V8KA 3OYEA 1WJSA 2K5IA 2OTLA 4IKFA 2ZT7A 3KFUA 5CCAA 1G5VA 3OQ5A 2XICA 3FIFA 5GANg 4M7AG 3JB9G 4M75B 3CBOA 1KD1U 3LC0A 2ZPGB 4JLIA 2HAXA 2RHIA 4C5IA 5GAN4 3F70A 4YRSA 2Q7HA 2QA4T 4QVDA 4K87A 2C7IA 1X54A 3VUZA 3BJUA 3UGQA 1UB4A 4M7AE 1ASYA 3CXCS 1ADJA 4MZMA 2KSSA 4CH5A 2ZTGA 1N8RU 3V7SA 4TVAA 2YLCA 5GAN3 2JUFA 1M1GA 3QBYA 5C51B 3V8LA 5GANd 4YRFA 3RMQA 1VQZA 2RHQA 4M7DF 3GNFB 3RF1A 4A4EA 5C0MA 4EMKC 2EYQA 3LW5E 4DOWA 1FYFA 4Y28E 2IVWA 4YRIA 4XTVA 2LC4A 4OVAA 4M7DD 2VYTA 5GAOm 1XNIA 1N9SA 3HXVA 2DD4A 2DZ9A 5GMKi 3NTIA 1K8AU 4PJOF 3G6EA 3VV0A 5LJ3j 1EIFA 4PJOB 4P71A 4H2XB 1JBMA 1ZHIA 3G7ZA 3OYAA 3VJPA 3MHXA 3AHUA 1SSFA 1B7YB 4CRIA 1NJIU 1X2HA 3RMSA 3JCMQ 1YJNT 4KR3A 1YJWT 1SESA 2ZPFB 1MHNA 3PTAA 1J5WA 4ME7A 3ZFJA 1WNLA 2VV5A 4DOVA 1BI3A 2R5AA 3JCMW 4M7DC 2O4XA 2RK2A 4P73C 5HKCA 3TEHB 3CCLT 4FIBA 5GMKj 1PYSA 1VQNA 3VYGA 4ZTJA 4C92A 3CCRT 2JZ2A 3QO7A 1YIJA 1WJRA 1O9SA 3OMCA 3Q1JA 2ZCEA 3QTCA 3OYFA 2ARUA 2BUDA 2EQJA 2XDDA 1QP3A 5DY9A 2AHJB 2FL7A 3JCMe 2DXCA 4OB0B 1W4SA 3I55A 3SB2A 3CPWS 3CCSA 3HFZA 2E10A 4M7AF 1JJCA 1LJOA 4Q6GA 2G4CA 3JB9F 2ZZFA 1NJ8A 1NYQA 3DSQA 4LVKA 4M7AB 4YRMA 1KHIA 3I7FA 3M56A 5CKFA 4QVCA 3PGGA 2ZXFA 3VU3C 1Y96A 2LCLA 3QZ5B 3ICAA 2Q5IA 1Q81C 4PNOA 4Q15A 4HWRA 5HGQA 2ZIOA 4OF1A 3A32A 4XTUA 4HWTA 2LT1A 2QEXT 3MEAA 1LYLA 3C12A 4C0FA 3CCJA 5GAMe 4PHCA 4HWPA 2QQBA 1X01A 2R58A 4LVJA 4FT4A 4P75C 2DQ3A 1VQ8A 5C53B 2JTMA 3UFGA 2RHXA 3NETA 1Q86C 1KQ1A 4YRCA 2QHSA 4J15A 3OYGA 3PZCA 4HCZA 2GFAA 4A4GA 4E7HA 4KT0E 5KNNA 3NENA 2EAYA 4MMLA 3V7RA 3DKMA 2RI2A 2RHYA 4PKCC 3JCMP 3OD1A 1AHJB 2E6NA 3JCMg 2L8DA 4BD3A 4X34A 4HWOA 4C8QG 3CCET 5FU6B 4KUIA 3FLGA 1G3YA 3VKIA 2DXTA 2ZR3A 1VQ6T 2GF7A 4JRQA 4L59A 3CCMT 5LJ5h 3LSQA 2QXFA 1JJ2S 4QVZA 2MWOA 3DLMA 4M77G 1VQKA 1RI0A 2QDYB 3OYLA 4NCXA 4OMFB 1M5Q1 1PSEA 4CS2A 4LD9K 2DO3A 1K9MC 2VC8A 1YCYA 1QP2A 3DLLA 3JCMd 3HRKA 3SWNC 2RM4A 2NS6A 3HHTB 2EL9A 2KY9A 3HXUA 4TWAA 5LJ5f 1S72T 5IAYA 4FSXA 2ZT8A 4QW2A 5GAMg 4CS4A 4J8OA 1H4VB 2DTIA 4KULA 1H4QA 2YHTA 3OY9A 2IY5B 4EDUA 1HTTA 3HKSA 3OS5A 2RHSB 4DPGA 1HC7A 2PMEA 1WQ7A 3P8BB 4M75A 4FU6A 3H8ZA 3INZA 3A5ZB 5GANj 3OBWA 3C95A 1KHCA 4JDSA 3S3NA 2DVEA 3PT9A 4RCBA 3A31A 1YHQA 2QHUA 3G1ZA 5GAMd 1M1KU 5D6YA 3VQYA 4TQFA 5DLQE 2ZPIB 2XGTA 4XEOA 4UP8A 1WGSA 2L3RA 1EIYB 4P3OA 2OAUA 1BBUA 2ODRD 1VQMA 2XI9A 2VXFA 1IZ6A 2DXUA 3WQZA 2WSCE 1N9WA 4N0AC 3UWNA 1V29B 3HXXA 4C92D 5DM7R 3RKXA 2HBPA 1KC8U 1BYMA 3NELA 1NZ9A 1QVPA 1UGSB 3QNEA 1E22A 1KOGA 4XAXB 4C8QF 1LNXA 4N4IA 4O5VA 4XU1A 2O01E 3NTKA 2XK0A 4II1A 3QO5A 3RL6A 2DDZA 2CJBA 4M77F 1N6AA 2Y4YA 1HK9A 4N4GA 1H3ZA 3O8VA 4C92C 2EJ9A 4C8QD 4YRTA 2KK4A 5C6SA 3RERA 1BIAA 4ZGJB 2BKDN 2KAFA 3CC2T 3TEHA 2E70A 4M7DE 3LYIA 2RI5A 3SD4A 2E1HA 3NEMA 2D9TA 3QJYA 4C5GA 3CCQT 2RD1A 3RUXA 3OYDA 3MF2A 2ZIMA 4HA8A 3L4GB 1WLEA 3LGFA 5LJ3h 3GF5A 3KXTA 2XDPA 4H2WA 4C8QC 3MP8A 3RKWA 2RB6A 3CCUT 3HY0A 1Q7YU 3PCOB 2MMPA 3OA6A 1XOVA 4CI0C 2EJFA 3META 1YFSA 4M77C 5GAN8 2CZ7B 2ZT6A 2AMCA 2RJEA 4UC4A 3P8TA 2FVUA 1Q82U 1YJ9A 5LJ3f 5CIUA 2DJZA 3W3SA 2RHUA 4P72A 3OB9A 3TEEA 1XTDA 3A8HB 4EMKB 2J3MA 2DEQA 2DTHA 4ZGDB 1VQPA 5D6XA 1ATIA 2XG8D 1K73C 5FRMA 3P8YA 1UGQB 4E7JA 4LDWA 5CQYA 4DQ2A 4OB2B 2A3LA 2XIDA 2OTJT 3A8GB 3CC7T 2LT4A 3A8MB 1FX7A 3R6OA 3QIIA 5LJ5e 1VQ7T 3P8HA 3E1SA 3FRNA 1H641 3QKJA 4XU3A 4OGEA 2A7YA 1VQLT 5KCOA 3R07A 4O2DA 3FC3A 1VQ9T 3CD6T 2E65A 1M8VA 1X2GA 4YRJA 4YRNA 4YTLA 3KUFA 1VQ4T 3M54A 1SRYA 4ZN1A 4M7DB 5GAOl 2EQUA 3HXWA 4BY6C 3RGLA 4XU2A 5FROA 1GGMA 3QYGB 3OBYA 3EFRA 4B9WA 1M90U 4BI8B 2PQWA 3RIRA 3N5BB 2RK1A 2QHVA 4P74A 3X20B 2CS7A 4J7IA 4NS5A 2QQSA 4JRIA 4YRPA 2EQMA 1E1OA 2DKGA 4A4KA 3MP1A 2M9UA 1ASZA 4IUTA 4MZPA 5GAMj 5CVIA 4CH6A 2DIQA 4BE2A 4J5YA 1K9MU 1BBWA 2IY5A 4FL6A 5A0DA 1YITA 3TCJA 2K57A 5LJ5g 5CKHA 2C06A 4EPCA 2GCXA 1RIQA 4XTXA 2RHSA 1VUBA 2HD0A 1ZBXA 3HL8A 5EG2A 3MP6A 3CMEA 3QUIA 5M9OA 3PIPA 4MZTA 3VUBA 1OZ3A 3A5ZA 3OYKA 3ZEHA 4QQGA 2ZNJA 1OYXA 4JRKA 3V8JA 2ZZGA 2LDMA 3DB3A 2P4TA 3QYHB 1UGRB 3I56A 1YJ9T 2ZGWA 1H4SA 1WQWA 4F7UA 1NPRA 3OYBA 2ZPBB 2HQEA 3M5AA 2OTLT 4YRGA 5LJ5d 2Y90A 1TH7A 1EIYA 1VQPT 1B70B 5K1PA 3X28B 3VYHB 2JTFA 3TUPA 2NLUA 5KE2A 3OSSC 1M1FA 2ALYA 4A4FA 4RQFA 1Z7NA 2X4JA 3CPFA 2CJAA 4GY5A 3WXMB 4LNSA 1KQSS 2ZPHB 4OB1B 1SETA 2PMFA 4EO4A 4RQEA 1WU7A 4CS3A 2AKWB 3ME9A 2KQWA 2ZNIA 4JS5A 2P0PA 4C92G 3MEWA 2Q5HA 3SFMA 3LWIA 4LVIA 3MEYA 4P5NA 1KD1C 2EFIA 3EAEA 3VBBA 4C0GA 3HSBA 4HWSA 3GNGA 3HY1A 3SWNB 5I21A 2QTXA 3QO3A 1ZQ1A 4RMOA 4LVMA 1NNHA 3JB9I 5GAOn 2Y4XA 2C8MA 4V2SA 4C92E 4C0DC 4OP0A 3OSVA 1X55A 4RCCA 3GOXA 3OYMA 3JB9J 2V8JA 4HKEA 3G71A 1N8RC 2I4NA 3G6ET 2R57A 5IT9E 3ERRA 2B8AA 3GP8A 3L4GA 4D6WA 3OYCA 3QHSA 1LOJA 1JB0E 4M78A 1B34B 3CMET 3OMGA 2CZ1B 1YI2A 4KR2A 4BDZA 4TVAB 3S6WA 1U1SA 3PCOA 1IREB 2V8IA 4XU0A 2ZPEB 2CYZB 2JVVA 3ASKA 5HK3A 1QVFA 4C8QE 3REUA 2RHQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 B;  4C8Q F;  1LNX A;  5GAN 7;  4XU1 A;  2DU7 A;  1U1T A;  3LC0 A;  4JLI A;  4YRQ A;  3QO5 A;  3RL6 A;  2DDZ A;  3GIB A;  4M77 E;  5GAN 4;  2CJB A;  4YRS A;  4M77 F;  2I2L A;  2Q7H A;  4QVD A;  4K87 A;  2C7I A;  1X54 A;  4G84 A;  2ZIN A;  1HK9 A;  1G5H A;  2E3C A;  3M4P A;  5GMK l;  5GAN h;  4PJO C;  2DU5 A;  3BJU A;  4C92 C;  2EJ9 A;  3UGQ A;  4C8Q D;  2HNI A;  4M7A E;  1ASY A;  4EMK A;  1ADJ A;  3EFS A;  4K86 A;  4YRT A;  5LJ3 g;  2ZTG A;  4H2U A;  4CH5 A;  3RER A;  1BIA A;  3V7S A;  4TVA A;  3E9H A;  2YLC A;  5GAN 3;  1HXD A;  5C51 B;  3V8L A;  5GAN d;  3TEH A;  4YRF A;  4M7D E;  1VQZ A;  2RHQ A;  2AMC B;  4M7D F;  1Z7M A;  2E1H A;  3NEM A;  3RF1 A;  2ZZE A;  4RMF A;  5E3I A;  4EMK C;  1NYR A;  4C8Q A;  4F7U G;  2RD1 A;  3RUX A;  4L87 A;  4H2S A;  3MF2 A;  2ZIM A;  4X9D A;  4HA8 A;  3L4G B;  1WLE A;  2ART A;  4M7A D;  3L2Z A;  3JB9 D;  2YLB A;  5LJ3 h;  4YDQ A;  1FYF A;  4ZIB A;  5GAN f;  4YRI A;  4KQE A;  1D3B A;  4M77 A;  4XTV A;  1I5L A;  3HXZ A;  1MGQ A;  4H2W A;  4C8Q C;  4M7D D;  5LJ3 e;  1H4T A;  3RKW A;  5GAO m;  2RB6 A;  1N9S A;  4X9C A;  3HY0 A;  3HXV A;  3PCO B;  3M4G A;  3A74 A;  2DZ9 A;  1I4K 1;  5LJ3 d;  5GMK i;  4PJO F;  4CH3 A;  2EJF A;  1KMN A;  1YFS A;  4C92 F;  4F7U E;  5LJ3 j;  4J6Y A;  4PJO B;  4P71 A;  4M77 C;  4J6W A;  5GAN 8;  1I8F A;  1JBM A;  4H2X B;  4C92 B;  1USY A;  4YPF A;  4CH4 A;  2ZT6 A;  2AMC A;  3P8T A;  2ZT5 A;  1NJ1 A;  2CJ9 A;  3AHU A;  2I4L A;  2P0L A;  1YGB A;  4M7D A;  5C52 B;  1B7Y B;  3QSU A;  5LJ3 f;  4P73 A;  2DJZ A;  4M7A C;  2CIM A;  3W3S A;  1X2H A;  4P72 A;  2E5A A;  3JCM Q;  4KR3 A;  4P71 C;  4EMH A;  1SES A;  3HFZ B;  2FB7 A;  1E24 A;  4M75 G;  2DTO A;  1J5W A;  4EMK B;  4EMG A;  1WNL A;  2J3M A;  3JCM W;  5GMK e;  2DEQ A;  2DTH A;  4M7D C;  1ATI A;  1L0W A;  3HRI A;  4P73 C;  3P8Y A;  3A7R A;  3TEH B;  4DQ2 A;  4HT9 A;  4P72 C;  4XTY A;  4Y91 A;  5GAN 5;  4ZTZ B;  5GMK j;  4PG3 A;  1PYS A;  2ODR C;  4TVW A;  4PJO A;  4H2X A;  4C92 A;  4C8Q B;  4YCV A;  3M4Q A;  2ARS A;  4YRK A;  3QO7 A;  5LJ5 e;  4MMK A;  1B7Y A;  4H2V A;  2ZCE A;  2EJG A;  4J6X A;  3QTC A;  1H64 1;  2J3L A;  2ARU A;  1D3B B;  1YFT A;  4XU3 A;  3HFO A;  1EVL A;  4M77 B;  1EFW A;  5LJ5 j;  1WYD A;  5DY9 A;  3JCM e;  1QE0 A;  3BDU A;  3HFZ A;  4YP0 A;  3SB2 A;  3R07 A;  4O2D A;  2E10 A;  3LSS A;  4M7A F;  2E65 A;  4H02 A;  1JJC A;  1LJO A;  4Q6G A;  2G4C A;  3JB9 F;  2ZZF A;  1NJ8 A;  1NYQ A;  3DSQ A;  4M7A B;  4YRM A;  1M8V A;  1EQR A;  1X2G A;  4YRJ A;  3I7F A;  4YCU A;  4YRN A;  4QVC A;  3VQX A;  1SER A;  3IAL A;  3PGG A;  2ZXF A;  3QO8 A;  1SRY A;  5GAO q;  3VU3 C;  3CMQ A;  4HVC A;  4M78 G;  3VQV A;  4M7D B;  5GAO l;  3L1A A;  3IKM B;  1Y96 A;  3HXW A;  1B76 A;  3RGL A;  4XU2 A;  3ICA A;  2Q5I A;  3JCM V;  4PNO A;  4Q15 A;  1GGM A;  4HWR A;  1EOV A;  3EFR A;  4WI1 A;  5HGQ A;  2ZIO A;  4P75 A;  3RIR A;  3A32 A;  5GMK m;  4YCW A;  4XTU A;  4HWT A;  2QHV A;  4P74 A;  1LYL A;  5ELO A;  4P3P A;  3HTZ A;  4UP7 A;  4JRI A;  5GAM e;  4UP9 A;  4PHC A;  4YRP A;  4HWP A;  2E64 A;  1X01 A;  3BY7 A;  4M78 E;  4M7A A;  4NL3 A;  1PYS B;  3RKY A;  1E1O A;  2DKG A;  2DQ3 A;  4P75 C;  2EWN A;  4F7U F;  3E9I A;  5C53 B;  5F5W A;  1ASZ A;  3HFV A;  3JCM J;  4WF2 A;  3UFG A;  3JCM X;  3NET A;  5GAM j;  4F7U B;  4CH6 A;  1KQ1 A;  4P74 C;  4YRC A;  2QHS A;  4J15 A;  4J5Y A;  1BBW A;  3PZC A;  2IY5 A;  2VXE A;  2K57 A;  5LJ5 g;  1RIQ A;  3NEN A;  5GMK h;  5KNN A;  4XTX A;  2EAY A;  4MML A;  3V7R A;  2RHS A;  4XEM A;  3JCM b;  3QUI A;  2QHT A;  2AKW A;  4M78 D;  1YB3 A;  3FB9 A;  3JCM P;  3OD1 A;  5ELN A;  4XTW A;  4OLF A;  4TTV A;  3HXY A;  3JCM g;  3A5Z A;  1JJC B;  3IG2 A;  2ALY B;  2ZNJ A;  4C8Q G;  4JRK A;  3V8J A;  4HWO A;  2ZZG A;  2ZR3 A;  2DXT A;  12AS A;  3VQW A;  5LJ5 h;  3LSQ A;  2ZR2 A;  2ZGW A;  1H4S A;  2XTI A;  1WQW A;  1X56 A;  4M77 G;  3RAC A;  3BFM A;  2Q7G A;  4X5O A;  1Y96 B;  4F7U A;  4NL2 A;  3SWN A;  4XTZ A;  4EX5 A;  3JCM h;  4M75 E;  4YRG A;  4NCX A;  5LJ5 d;  2Y90 A;  2P5I A;  1QF6 A;  1TH7 A;  4M75 F;  1JRI A;  1M5Q 1;  3A5Y A;  1EIY A;  5GAO r;  4WJ3 M;  2DQ0 A;  4CS2 A;  1B70 B;  1NJ6 A;  4K88 A;  4YRE A;  5K1P A;  1KQ2 A;  2VC8 A;  4BW9 A;  1YCY A;  4M78 C;  2CGH A;  3TUP A;  4TVY A;  3JCM d;  3HRK A;  3SWN C;  2ALY A;  2RM4 A;  4M7D G;  2FYK A;  2EL9 A;  4RQF A;  5GAN 6;  1G5I A;  3HXU A;  4TWA A;  1Z7N A;  5GAO p;  5LJ5 f;  11AS A;  5K1X A;  2ZT8 A;  5GAM g;  4CS4 A;  4AH6 A;  4M75 D;  1H4V B;  4JUV A;  2DTI A;  3UGT A;  1NJ5 A;  2CJA A;  1H4Q A;  1NJ2 A;  4YRL A;  4LNS A;  2YHT A;  2Q7E A;  1I81 A;  3JCM c;  1BIB A;  2IY5 B;  1SET A;  3JCM f;  1B34 A;  2PMF A;  4YYE A;  4EO4 A;  4RQE A;  4RDX A;  1HTT A;  5GAN e;  4P3N A;  1WU7 A;  2RHS B;  4CS3 A;  4BWA A;  4DPG A;  2E41 A;  4M77 D;  1G51 A;  1HC7 A;  2AKW B;  2PME A;  5GAM h;  1WQ7 A;  4M75 A;  1B70 A;  4H2T A;  4PJO G;  4YRR A;  3INZ A;  4G85 A;  5GAN j;  2ZNI A;  3REX A;  4C92 G;  3A7A A;  3TEG A;  2Q5H A;  1B8A A;  2DVE A;  3BW1 A;  4RCB A;  3A31 A;  2I4M A;  2QHU A;  3MEY A;  1ADY A;  3G1Z A;  5GAM d;  4M78 F;  4NOY A;  4YRO A;  3VBB A;  3RES A;  2RA2 A;  1W66 A;  4M75 C;  3HSB A;  4M78 B;  2I4O A;  3VQY A;  4HWS A;  1YFR A;  4TQF A;  3HY1 A;  3SWN B;  4E51 A;  5I21 A;  2XGT A;  4XEO A;  2QTX A;  3QO3 A;  3V8K A;  4UP8 A;  4N0A A;  1KMM A;  3V7C A;  3JB9 I;  1NNH A;  5GAO n;  3IKL A;  1WPY A;  3UH0 A;  4PJO E;  2C8M A;  4V2S A;  4WJ4 A;  4C92 E;  1EIY B;  4P3O A;  3HFN A;  1BBU A;  1E1T A;  5GAM f;  4OP0 A;  4HT8 A;  2ODR D;  1X55 A;  4RCC A;  2VXF A;  3JB9 J;  3JB9 H;  2DXU A;  2I4N A;  1EVK A;  1C0A A;  3MF1 A;  4A54 A;  3WQZ A;  1N9W A;  3ERR A;  4TQD A;  4N0A C;  3A7U A;  2DZC A;  4XQ3 A;  3L4G A;  1IL2 A;  3HXX A;  1N9R A;  3FJP A;  5GAN 2;  4PJO D;  3QHS A;  5CAI A;  4C92 D;  1USY C;  1LOJ A;  2JN0 A;  4M78 A;  1B34 B;  4ZTU B;  3RKX A;  4H2Y A;  3NEL A;  2ZT7 A;  4KR2 A;  4TVA B;  1U1S A;  3PCO A;  3QNE A;  3KFU A;  4A53 A;  4UPA A;  4XU0 A;  1E22 A;  1KOG A;  3FIF A;  5GAN g;  4M7A G;  3P8V A;  4C8Q E;  3REU A;  3JB9 G;  2RHQ B; 
#chains in the Genus database with same CATH topology
 1EFN A;  5GAN 7;  1U1T A;  2K3X A;  2DBM A;  3G71 Q;  1VIE A;  1F1B B;  1K8A C;  1VQN T;  2CKK A;  2F5K A;  3GIB A;  4M77 E;  2HQX A;  3E2U A;  2L0A A;  2X4W A;  4KRT A;  5KYN A;  3QPH A;  3L2V A;  2NYS A;  1YIJ T;  2E3C A;  4ORZ A;  3M4P A;  5GMK l;  1BK2 A;  1RAD B;  2KXC A;  2DU5 A;  2ENM A;  4RTZ A;  2MWP A;  1M3C A;  4EMK A;  1VQK Q;  3EFS A;  1NJI C;  2KRO A;  1PHT A;  4K86 A;  1MND A;  1YI2 Q;  5LJ3 g;  5CQX A;  1T3S A;  3E9H A;  3I55 T;  3CCS T;  1M90 R;  1VYU A;  2E3I A;  1QVG P;  3MJX A;  4HCC A;  3CMA A;  2JM9 A;  2L3Q A;  4Z02 A;  1WI7 A;  1MMN A;  1V76 A;  3MKD A;  4AT1 B;  2ZZE A;  4RMF A;  3M53 A;  1GCP A;  5E3I A;  4H2S A;  2L5Q A;  4X9D A;  1DJ7 B;  2ART A;  3PE0 A;  1I0C A;  2DVJ A;  2LJ0 A;  1SHF A;  2YLB A;  4IUR A;  4YDQ A;  2L3S A;  1K1Z A;  1C1A A;  1K73 U;  1TTH B;  2K9G A;  3CBP A;  2QK0 A;  3HXZ A;  1C0M A;  3H0F A;  3BDL A;  2XHC A;  1K9M R;  4LDY A;  1H4T A;  2O4X B;  1TUG B;  4PFO A;  3A74 A;  5LJ3 d;  4LE9 A;  3H9N A;  4JLG A;  4R55 A;  1ZSZ A;  1WXB A;  4C92 F;  3U23 A;  1BI1 A;  3HPW A;  1SSH A;  4J6Y A;  2KRS A;  3CCV A;  4J6W A;  3CCJ T;  1I8F A;  4LD6 A;  4CH4 A;  4C92 B;  1USY A;  1SRL A;  4DA4 A;  1NJ1 A;  1PSF A;  2I4L A;  4M7D A;  5C52 B;  1VQ8 T;  4J9G A;  3QSU A;  2MF2 A;  1YHQ Q;  4FT2 A;  4P73 A;  2H8H A;  1KQS A;  3EHR A;  1T0J A;  2E5A A;  4P71 C;  4EMH A;  5J26 A;  3QZ9 B;  3HFZ B;  1RAF B;  4M75 G;  3EGU A;  3VS7 A;  2FZK B;  1X43 A;  4XK8 E;  2KE9 A;  3WVE B;  1I5O B;  1PG5 B;  3OS2 A;  3M57 A;  2YDL A;  5DLO A;  1JO8 A;  4IUV A;  1L0W A;  5AYF A;  1Y07 A;  2AZV A;  4E2F B;  4LDU A;  2BE9 B;  2CP7 A;  2NUP A;  2L3P A;  3A7R A;  4HT9 A;  5A2Q E;  4L5G A;  4HXJ A;  3OYY A;  1VQM Q;  2ODR C;  4PJL A;  4PJO A;  2MI6 A;  4H2X A;  3OS0 A;  4C8Q B;  3G4S A;  2RMO A;  2BZ8 A;  4YCV A;  5CKE A;  5L8R E;  2QA4 A;  2YUQ A;  2P0K A;  3EGD A;  4C5H A;  3X25 B;  1JXO A;  3THK A;  5L23 A;  2LQK A;  1B7Y A;  1BBZ A;  2CH4 A;  4H2V A;  5CKB A;  2WAC A;  4J6X A;  2JOY A;  1VQK T;  2J3L A;  1D3B B;  1YFT A;  3QXE B;  1YI2 T;  1EVL A;  4M77 B;  1I07 A;  2B86 A;  1EFW A;  5LJ5 j;  1NYF A;  2DAQ A;  3BDU A;  4YP0 A;  3TU4 K;  1G3T A;  1OPL A;  2FZC B;  4H02 A;  3LWH A;  1QQJ A;  2LVM A;  1YWO A;  4K11 A;  1HJD A;  2RQU A;  4YCU A;  1RAG B;  3VQX A;  3RDV A;  1NPP A;  1H92 A;  1SER A;  2JT4 A;  1UEB A;  1SPK A;  3UT1 A;  2DEU A;  1QVF P;  3CMQ A;  3QWY A;  3G4S Q;  4HVC A;  2QA4 Q;  3L1A A;  3IKM B;  4LUD A;  3EG3 A;  3KBG A;  3MEU A;  3JCM V;  1PNJ A;  4PK4 A;  2LCC A;  3H0I A;  2YT6 A;  1QVG S;  4P75 A;  5IXF A;  1S1N A;  1WHK A;  1IHW A;  2CH4 W;  2PVO B;  4YCW A;  3L2W A;  2VWF A;  4E7S A;  9ATC B;  2EGC A;  5I11 A;  1D0Z A;  2BTT A;  1GRI A;  1M3B A;  5ELO A;  1PD0 A;  5LL6 S;  4P3P A;  1CSK A;  2D1X A;  2ED0 A;  3OS1 A;  4RG2 A;  1NE8 A;  2HQH A;  4M7A A;  4NL3 A;  1OEB A;  5KE3 A;  4BUG A;  3C0C A;  2DXB A;  2EWN A;  2CDT A;  1YHQ T;  1AVZ C;  3HFV A;  4DBQ A;  3TRE A;  2LNV A;  3JCM X;  5KYX A;  3X26 B;  4KBM B;  1QLY A;  3EGX B;  3QJ6 A;  1YJN A;  2RJF A;  2K3Y A;  3LH0 A;  2CP0 A;  1YJW A;  2VXE A;  2PU9 B;  4FYX B;  2DBK A;  4AFU C;  5GMK h;  1G3W A;  4XEM A;  2MAM A;  4PFP A;  2M16 A;  1XJW B;  4CC2 A;  1U5S A;  1ZUY A;  4LVL A;  2QHT A;  2AKW A;  4M78 D;  1VIF A;  5ELN A;  3M9Q A;  3JV3 A;  4OLF A;  4KGX B;  3CCL A;  4BY6 B;  1VQM T;  2LQW A;  1QW1 A;  12AS A;  3CCR A;  5CK9 A;  5FWB A;  4PL6 A;  4BE0 A;  4F17 A;  1Q81 U;  1UGP B;  2XTI A;  2P4R A;  1X56 A;  2LX9 A;  2RHZ A;  3SDZ A;  3RAC A;  3BFM A;  2DFU A;  3FEO A;  4A4H A;  2GBQ A;  4NL2 A;  2ROT A;  3SWN A;  4XTZ A;  1YJN Q;  2DE0 X;  3M0T A;  1M1K C;  4Q5W A;  2P5I A;  4M75 F;  2JM8 A;  1JRI A;  3A5Y A;  5FU7 C;  4WJ3 M;  1R8O B;  1AZE A;  4YRE A;  2YUO A;  2DPP B;  1KQ2 A;  4M78 C;  2CGH A;  3E19 A;  1MMA A;  2PVG B;  4TVY A;  2X4Y A;  4RG8 A;  3MEV A;  5KYY B;  2JNG A;  3GBQ A;  1Q86 U;  1G3S A;  1RAA B;  2GQV A;  1WHG A;  3G4S T;  1PM3 A;  1QCN A;  1RLQ C;  3S3M A;  2PUK B;  4AH6 A;  4M75 D;  1QWF A;  4B6M A;  4JZ4 A;  3PFS A;  2EYX A;  1M27 C;  2Q7E A;  2XDB A;  1BIB A;  1B34 A;  2X4X A;  1IGQ A;  4BI3 A;  2CSQ A;  3MO8 A;  2QYZ A;  2KDS A;  4P3N A;  2A8E A;  1K73 R;  2QEX A;  5GJW B;  4PJJ A;  2VGN A;  1G51 A;  3ER0 A;  2NUT B;  3NFC A;  2XKO C;  1KC8 C;  1RL2 A;  1VQO A;  4ELZ C;  2FEI A;  4YRR A;  4G85 A;  1QVF S;  3A7A A;  2L2P A;  1X27 A;  1KK7 A;  2LTO A;  1B8A A;  2DD5 A;  3MCA B;  3OW2 S;  4ELY C;  5A0G A;  1X2Q A;  4E47 A;  3C4S A;  2EGE A;  5HY6 A;  2H3J A;  2K5L A;  4NOY A;  2RA2 A;  2COZ A;  4M75 C;  4CC3 A;  2PZ1 A;  1N27 A;  1YFR A;  2RI3 A;  2EIF A;  4E51 A;  3V8K A;  1C6V X;  4E7K A;  1MV0 B;  4N0A A;  3IKL A;  1RAI B;  1D1B A;  2YRC A;  3HFN A;  4VUB A;  2V1R A;  4HT8 A;  3OYJ A;  3CCE A;  1XQH A;  2EPD A;  2K3B A;  1VQ6 A;  1VQO Q;  2V1Q A;  2DK3 A;  1NYG A;  1K4U S;  3VS2 A;  4A54 A;  3P8D A;  3CCM A;  2X51 A;  4TQD A;  1WLP B;  4BE1 A;  4IUQ A;  1BCM A;  2DL4 A;  1QCO A;  2DZC A;  2OX7 A;  4XQ3 A;  3CBM A;  5FLX E;  3M58 A;  2VKN A;  4LXC A;  3CEY A;  4Z89 A;  3J7A F;  4PJO D;  1CKA A;  5CAI A;  1USY C;  2LRQ A;  1LCK A;  2JN0 A;  1FMK A;  4ZTU B;  2FHD A;  4H2Y A;  5FWC A;  2DL7 A;  2WSF E;  1QVG A;  4A53 A;  4UPA A;  3P8V A;  2SRC A;  2ESW A;  3CCE Q;  1H8K A;  2DIL A;  1Q7Y C;  2DU7 A;  3VS6 A;  3M0U A;  1S72 A;  1Z9Q A;  5HK0 A;  4KUD K;  4YRQ A;  4LDX A;  4MDW A;  4FYV B;  2I2L A;  3OYI A;  4DBF A;  1VQ5 A;  4C0D B;  3L2Q A;  3PNW C;  4G84 A;  2ZIN A;  2MYS A;  1Q82 C;  1G5H A;  3I56 Q;  3E9G A;  5D6W A;  5GAN h;  4PJO C;  5FRN A;  3PMI A;  2VUB A;  3PMT A;  1WYX A;  2DA9 A;  2HNI A;  1OZ2 A;  2DM1 A;  1UHC A;  2F5T X;  2GQI A;  1GL5 A;  4AG1 C;  4N4H A;  4H2U A;  3QG1 A;  4RTU A;  4C5E A;  2C0O A;  3GPL A;  4AMC A;  4PLL A;  1P92 A;  1HXD A;  2QI2 A;  1OU9 A;  3EH1 A;  1BU1 A;  1YNZ A;  4ATO A;  1AWW A;  1IO6 A;  4JJN K;  4GLK A;  2AMC B;  1Z7M A;  3LGL A;  2M0O A;  3H0H A;  1ACM B;  1NYR A;  4C8Q A;  3E9F A;  2DYI A;  4F7U G;  4L87 A;  2YRD A;  1X6O A;  4QQD A;  3FDR A;  4M7A D;  1MUZ A;  3L2Z A;  4Y92 A;  4ZN3 A;  3JB9 D;  1KFZ A;  1VQ5 Q;  4ZIB A;  4RTX A;  3VS4 A;  5GAN f;  2MCN A;  3CC4 A;  4KQE A;  1D3B A;  4M77 A;  4WTO B;  4ZGE B;  1I5L A;  3LX7 A;  3OYH A;  1E6H A;  4GLM A;  3X24 B;  1MGQ A;  2ATC B;  5LJ3 e;  1OI1 A;  3QDR B;  4X9C A;  1AT1 B;  3M4G A;  2EYZ A;  1WIE A;  1I4K 1;  3M55 A;  4ZNX A;  1VQO T;  2DIG A;  3HRS A;  4CH3 A;  1BKB A;  1KMN A;  2LQ8 A;  4F7U E;  4OGC A;  2ED1 A;  2KVQ G;  4YPF A;  4QKU A;  1V1C A;  2ZT5 A;  2A37 A;  1HD3 A;  2CJ9 A;  2O9V A;  2P0L A;  1YGB A;  2DMO A;  5KH6 A;  1M30 A;  5KCH A;  4IIO A;  1W2B S;  5A0L A;  4M7A C;  2CIM A;  1Q81 R;  1M4Z A;  3A8O B;  1NG2 A;  4E7I A;  3I5S A;  3CXC A;  3CC4 Q;  3A8L B;  4J7F A;  1K76 A;  1YIT T;  2FB7 A;  4JRP A;  2ZZD A;  2DTO A;  2JMC A;  4LUE A;  2GNC A;  4BDY A;  1E24 A;  1O75 A;  2K4Y A;  3HP9 A;  4EMG A;  3A1P A;  2GFU A;  2PVD B;  5GMK e;  4IUU A;  5KYW A;  4QQ6 A;  1M90 C;  4L6V 5;  1X75 C;  3HRI A;  2RH2 A;  2K2V A;  1D0Y A;  2P0Q A;  4P72 C;  4XTY A;  4Y91 A;  8ATC B;  5GAN 5;  2RJC A;  4PG3 A;  2KMT A;  3REA B;  4ZTZ B;  2K5F A;  4TVW A;  5CO7 A;  2RJD A;  3OW2 A;  3M4Q A;  1Q86 R;  2ARS A;  4YRK A;  3I56 T;  4MMK A;  1Y71 A;  4DEY A;  1ZA2 B;  2EJG A;  2M1H A;  4J9H A;  5I2S A;  2RQT A;  3HFO A;  2QQA A;  4FM4 B;  4RKU E;  1WYD A;  2JS2 A;  4AFQ C;  1QE0 A;  3RR6 A;  4DEX A;  3CC2 A;  3LSS A;  3NTH A;  1WDX A;  2FRW A;  2VGM A;  4R56 A;  1EQR A;  2E5Q A;  1KG1 A;  2XU8 A;  3CCQ A;  5D7U A;  3IAL A;  3C94 A;  3QO8 A;  5GAO q;  4OMQ A;  1EX4 A;  1VQ5 T;  2C0T A;  4M78 G;  3VQV A;  2EQK A;  4OB3 B;  2J05 A;  1B76 A;  4FCY A;  5FU6 C;  4BB7 A;  2DER A;  2QQ9 A;  1EOV A;  4BI4 A;  4PLI A;  3H6Z A;  4WI1 A;  2HSP A;  4RTY A;  3CCU A;  1AZG B;  1VA7 A;  5J39 A;  3S3O A;  5GMK m;  2D0Q B;  1B7T A;  2F2X A;  3CC2 Q;  1ZBJ A;  3PVQ A;  3HTZ A;  4E6R A;  4UP7 A;  4J9E A;  4UP9 A;  4HT4 A;  4ZTF A;  2E64 A;  3BY7 A;  4M78 E;  1PYS B;  3RKY A;  4F7U F;  3CMA Q;  3E9I A;  5F5W A;  2BIV A;  3JCM J;  4WF2 A;  2LCS A;  4F7U B;  4P74 C;  5IHI A;  4B9X A;  3CC4 T;  1AOJ A;  3L2R A;  1WHM A;  3H41 A;  3LLR A;  3PIO A;  3J80 E;  3JSC A;  1M9S A;  4IUP A;  5I2M A;  3CPW A;  1M2V B;  3JCM b;  3J81 E;  2QQR A;  2JXB A;  2DNU A;  3NMZ C;  1YB3 A;  3FB9 A;  2NUT A;  3UPU A;  4XTW A;  2RO0 A;  3MQZ A;  4TTV A;  3HXY A;  1JJC B;  3IG2 A;  2R5M A;  2ALY B;  3G1J A;  1YWP A;  3VS3 A;  1AWO A;  1JXM A;  2XD0 A;  2K2M A;  2OTJ A;  1WFW A;  3G71 T;  3CC7 A;  3VQW A;  1BI2 A;  2ZR2 A;  1VQ7 A;  1R77 A;  1Y7X A;  2E6Z A;  3CCV Q;  4TVR A;  3URG A;  5CKD A;  3HTR A;  4JS4 A;  1WJQ A;  1H3H A;  2K6D A;  2Q7G A;  4X5O A;  1Y96 B;  3DB4 A;  2G3R A;  4EX5 A;  3JCM h;  4M75 E;  1VQL A;  1QF6 A;  1HSQ A;  3VS1 A;  3AT1 B;  2VAS A;  3L42 A;  1VQ9 A;  2CZ6 B;  2NWM A;  2A28 A;  3KFV A;  5GAO r;  3CD6 A;  2DQ0 A;  1NJ6 A;  4K88 A;  4BAC A;  2LJ1 A;  4BW9 A;  2YRV A;  3CXC P;  1Y57 A;  2CZ0 B;  4C0Z A;  1WXU A;  2E12 A;  5J3B A;  1YP5 A;  2L89 A;  3OYN A;  4M7D G;  2FYK A;  1ARK A;  2JJ9 A;  1VQ4 A;  1TXQ A;  4MDX A;  5GAN 6;  1G5I A;  1ZLM A;  2PUO B;  11AS A;  5GAO p;  2I0N A;  3L2U A;  5K1X A;  5IN1 A;  1GFC A;  2A08 A;  2HEQ A;  6AT1 B;  4LDV A;  4JUV A;  3UGT A;  1NJ5 A;  1NJ2 A;  2MPX C;  2F69 A;  4YRL A;  3EG9 B;  2AT1 B;  1W2B A;  1I81 A;  3JCM c;  3JRZ A;  3JCM f;  2QGF B;  3OW2 P;  4YYE A;  3O5Z A;  2CP2 A;  4RDX A;  1YN8 A;  5GAN e;  4F04 B;  2OJ2 A;  2EKO A;  1U8R A;  4BWA A;  3EFO A;  2E41 A;  4M77 D;  1PWT A;  5GAM h;  1B3Q A;  1B70 A;  1FXX A;  5KYU B;  2DET A;  4H2T A;  4PJO G;  3REX A;  1BI0 A;  4J83 A;  3TEG A;  2HBW A;  2RN8 A;  3VRY A;  2BE7 D;  2X35 A;  3CMA T;  1JJ2 A;  2LZ6 B;  3HRU A;  3BW1 A;  1VQ4 Q;  2GTJ A;  2I4M A;  5FU7 B;  3JAM E;  1ADY A;  1PRL C;  1VYT A;  2Z0W A;  8AT1 B;  4M78 F;  2D6F A;  4YRO A;  5EC7 A;  3RES A;  3WVD B;  3UDC A;  7AT1 B;  1W66 A;  4M78 B;  2I4O A;  1NLP C;  3T9N A;  1GXI E;  2AZS A;  1YBY A;  3MPU B;  3HRT A;  3ZBD A;  1FMW A;  1LPL A;  1KMM A;  1FMV A;  3V7C A;  4O6J A;  3UH0 A;  2ZCF B;  1WPY A;  5CR2 A;  4PJO E;  4WJ4 A;  2WSE E;  4R0K A;  1M3A A;  4FSS A;  4JJD A;  4JZ3 A;  5GAM f;  1E1T A;  4E7L A;  3JB9 H;  3NGP A;  1EVK A;  3MF1 A;  1C0A A;  4HCB A;  2IG0 A;  4QT7 A;  3CCV T;  3A7U A;  3GLX A;  1LVK A;  2DRM A;  3M4Y A;  1GBR A;  1IL2 A;  4KGV B;  1N9R A;  3FJP A;  3M59 A;  1FWZ A;  5GAN 2;  2V8K A;  1AD5 A;  3OYE A;  1WJS A;  2K5I A;  2OTL A;  1OV3 A;  4IKF A;  1X69 A;  2ZT7 A;  2DL5 A;  1YJW Q;  1TU0 B;  3KFU A;  5CCA A;  1G5V A;  3OQ5 A;  2XIC A;  3FIF A;  5GAN g;  4M7A G;  1PCX A;  3JB9 G;  4M75 B;  3CBO A;  3CPW P;  1KD1 U;  1OU8 A;  3LC0 A;  2ZPG B;  4JLI A;  2HAX A;  3CCL Q;  2RHI A;  4C5I A;  1WHL A;  5GAN 4;  3F70 A;  4YRS A;  1BB9 A;  2Q7H A;  2QA4 T;  4QVD A;  4K87 A;  2DYB A;  3CCR Q;  2C7I A;  1X54 A;  2LJ3 A;  4F16 A;  3VUZ A;  2COW A;  2JS0 A;  3BJU A;  3UGQ A;  3M0P A;  1QKW A;  4RTW A;  1UB4 A;  4M7A E;  1ASY A;  1VYV A;  3CXC S;  1ADJ A;  4MZM A;  2KSS A;  2ROL A;  3VRZ A;  2EYW A;  2YSQ A;  2ZTG A;  4CH5 A;  1N8R U;  1JQQ A;  2W0Z A;  2HMA A;  3V7S A;  4M4Z A;  4TVA A;  2BZX A;  2YLC A;  5GAN 3;  1ZSG A;  2JUF A;  2RQR A;  1M1G A;  1MV3 A;  2ABL A;  3QBY A;  5I22 A;  5C51 B;  3V8L A;  5GAN d;  1Q95 G;  4YRF A;  3RMQ A;  1VQZ A;  3EG1 A;  2RHQ A;  4M7D F;  3GNF B;  3RF1 A;  1T0H A;  4A4E A;  5C0M A;  2D0N A;  3SHW A;  4EMK C;  1NBE B;  1I1J A;  2X3X D;  2EYQ A;  3LW5 E;  4KGZ B;  1M1K R;  4DOW A;  1ABO A;  4LNP A;  1FYF A;  4Y28 E;  2IVW A;  1NEB A;  4YRI A;  4RTT A;  2G6F X;  3I35 A;  4XTV A;  2LC4 A;  2M02 A;  4OVA A;  4M7D D;  2VYT A;  5GAO m;  1XNI A;  1N9S A;  3HXV A;  2DD4 A;  2CT3 A;  2DZ9 A;  5GMK i;  1W2B P;  2MOX A;  3NTI A;  1QCF A;  1K8A U;  4PJO F;  5IHN A;  2QEX Q;  3G6E A;  3VV0 A;  1K0S A;  5LJ3 j;  1EIF A;  3M0Q A;  1Y0M A;  1PRM C;  4PJO B;  2LP5 A;  4P71 A;  4H2X B;  1JBM A;  2FG0 A;  2KNB B;  1ZHI A;  3G7Z A;  1UUE A;  3OYA A;  3VJP A;  3MHX A;  3AHU A;  1SSF A;  1B7Y B;  4CRI A;  1NJI U;  1X2H A;  2O9S A;  1ZSZ C;  2X3W D;  1JJ2 P;  1D0X A;  3RMS A;  1RAC B;  3JCM Q;  2DF6 A;  1YJN T;  4KR3 A;  1OPK A;  1YJW T;  1SES A;  2ZPF B;  3UA7 A;  1MHN A;  3PTA A;  1J5W A;  2FRY A;  1KC8 R;  4ME7 A;  3ZFJ A;  1WNL A;  2VV5 A;  4RTV A;  4DOV A;  1BI3 A;  2R5A A;  3JCM W;  4M7D C;  1UJ0 A;  2O4X A;  2RK2 A;  1U3O A;  4AFS C;  1M2O A;  4P73 C;  5HKC A;  3UA6 A;  2GTO A;  3TEH B;  3G6E Q;  3CCL T;  4FIB A;  5GMK j;  1PYS A;  1VQN A;  3EG2 A;  3VYG A;  4ZTJ A;  1VQ6 Q;  4C92 A;  1KIK A;  2KYB A;  3UF4 A;  3CCR T;  3EH2 A;  2LX7 A;  2CRE A;  2JZ2 A;  3CCM Q;  3QO7 A;  1YIJ A;  1W70 A;  5FW9 A;  4OMN A;  1WJR A;  2EW3 A;  1O9S A;  2NUZ A;  3OMC A;  3Q1J A;  2ZCE A;  3QTC A;  2CT4 A;  3OYF A;  4PJM A;  3VS5 A;  2ARU A;  2BUD A;  1M2V A;  2M0Y A;  2EQJ A;  2XDD A;  1QP3 A;  5DY9 A;  2AHJ B;  2FL7 A;  4IIM A;  2YXY A;  2DXC A;  4OB0 B;  1W4S A;  3JCM e;  3SB2 A;  3I55 A;  3CPW S;  3CCS A;  3HFZ A;  1G83 A;  2KR3 A;  2E10 A;  4M7A F;  1JJC A;  1LJO A;  4Q6G A;  1IRX A;  3JB9 F;  2G4C A;  4HVW A;  1UHF A;  2ZZF A;  1NJ8 A;  1NYQ A;  3DSQ A;  4LVK A;  4M7A B;  4YRM A;  1KHI A;  2DJQ A;  3I7F A;  1PKS A;  3M56 A;  5CKF A;  4QVC A;  3PGG A;  2ZXF A;  2IIM A;  5KYX B;  3VU3 C;  4ESR A;  4CC4 B;  2X9H A;  1S72 Q;  2KBT A;  1TSF A;  1ZUK A;  1Y96 A;  2LCL A;  3BE3 A;  3QZ5 B;  3ICA A;  2Q5I A;  1Q81 C;  4PNO A;  4Q15 A;  4HWR A;  5HGQ A;  2ECZ A;  2ZIO A;  1TS9 A;  4JJB A;  1UE9 A;  2HKQ B;  4OF1 A;  3A32 A;  1J3T A;  4XTU A;  4HWT A;  2LT1 A;  3I55 Q;  2QEX T;  3MEA A;  1PKT A;  1LYL A;  2BZY A;  3C12 A;  4C0F A;  3CCJ A;  5GAM e;  4PHC A;  4RUG A;  4HWP A;  2QQB A;  1X01 A;  2R58 A;  1IB8 A;  4LVJ A;  4FT4 A;  4P75 C;  2DQ3 A;  1VQ8 A;  5C53 B;  2JTM A;  5AT1 B;  1IGU A;  3UFG A;  2MIO A;  2RHX A;  3NET A;  1Q86 C;  1KQ1 A;  3VS0 A;  1AWJ A;  1MNE A;  2KEA A;  4YRC A;  2QHS A;  4J15 A;  2J6F A;  3OYG A;  3PZC A;  1E6G A;  4HCZ A;  1ABQ A;  2GFA A;  4A4G A;  4E7H A;  4KT0 E;  5KNN A;  3NEN A;  2EAY A;  4MML A;  3V7R A;  4JJC A;  3DKM A;  2RI2 A;  2RHY A;  4PKC C;  4J9D A;  3JCM P;  3OD1 A;  1AHJ B;  1SHG A;  1TOV A;  1D1A A;  2E6N A;  3JCM g;  2L8D A;  4BD3 A;  4X34 A;  4HWO A;  4C8Q G;  3CCE T;  1KJW A;  5FU6 B;  4KUI A;  3FLG A;  1G3Y A;  3VKI A;  2DXT A;  2ZR3 A;  1VQ6 T;  3CCJ Q;  2GF7 A;  5HCK A;  4JRQ A;  2W10 A;  4L59 A;  3CCM T;  5LJ5 h;  3LSQ A;  2QXF A;  1JJ2 S;  4QVZ A;  2MWO A;  4HVU A;  1KD1 R;  3DLM A;  4M77 G;  1UFF A;  2KT1 A;  3IQL A;  1AEY A;  1VQK A;  1RI0 A;  1D1C A;  2QDY B;  3EGX A;  2EYY A;  2YWW A;  3OYL A;  4J9F A;  1K9A A;  4NCX A;  3M0R A;  4OMF B;  1M5Q 1;  1PSE A;  4CS2 A;  4LD9 K;  2DO3 A;  5IH2 A;  1K9M C;  2VC8 A;  2J6K A;  1NM7 A;  1YCY A;  1QP2 A;  2DL8 A;  3DLL A;  1GCQ A;  3JCM d;  1N8R R;  3HRK A;  3SWN C;  2KRN A;  2LNH B;  1WHJ A;  1A0N B;  2RM4 A;  2NS6 A;  3HHT B;  3QWX X;  2EL9 A;  3RNJ A;  2KY9 A;  3HXU A;  4Z8A A;  4TWA A;  1PC0 A;  5LJ5 f;  1S72 T;  5IAY A;  4FSX A;  2ZT8 A;  3A98 A;  4QW2 A;  5GAM g;  4CS4 A;  4J8O A;  1G8X A;  4FYY B;  1H4V B;  2CSI A;  1Z9Z A;  2DTI A;  1TUC A;  2A36 A;  4KUL A;  1H4Q A;  1SG5 A;  1R0B G;  1OQK A;  1OX8 A;  2YHT A;  4OMO A;  3CQT A;  2YUN A;  3OY9 A;  2IY5 B;  2QTV A;  2M51 A;  3RBB B;  2F2V A;  1W1F A;  1OUL A;  4EDU A;  1HTT A;  3HKS A;  3OS5 A;  2RHS B;  2EVR A;  2JMA A;  4DPG A;  1HC7 A;  2PME A;  1WQ7 A;  3P8B B;  4M75 A;  2QAZ A;  4FU6 A;  3H8Z A;  3INZ A;  3A5Z B;  2CP6 A;  5GAN j;  3OBW A;  3C95 A;  2HSE B;  1KHC A;  4DBR A;  1K8A R;  4JDS A;  5KYY A;  3S3N A;  2DVE A;  3PT9 A;  4RCB A;  3A31 A;  1YHQ A;  2LQN A;  2QHU A;  1KSW A;  5GAM d;  3G1Z A;  1M1K U;  5D6Y A;  3CCQ Q;  1YFN A;  4KH1 B;  3VQY A;  2FZG B;  4TQF A;  5DLQ E;  2ZPI B;  2XGT A;  4XEO A;  4UP8 A;  1WGS A;  1NJI R;  2J7I A;  2J06 A;  2L3R A;  1EIY B;  4P3O A;  1QKX A;  2OAU A;  1X6B A;  1BBU A;  2ODR D;  1VQM A;  2XI9 A;  3CCU Q;  2VXF A;  1IZ6 A;  2DXU A;  3WQZ A;  2WSC E;  1N9W A;  4N0A C;  3TSZ A;  3UWN A;  1V29 B;  1E7O A;  3HXX A;  1OX9 A;  3I5R A;  4Z88 A;  4C92 D;  2HZY A;  2HCK A;  4FW1 A;  4D8D A;  5DM7 R;  2HKN A;  2SEM A;  3RKX A;  2HBP A;  1KC8 U;  1BYM A;  3NEL A;  1NZ9 A;  1QVP A;  4OMM A;  1UGS B;  2FPE A;  3QNE A;  2V26 A;  1IXD A;  1TUD A;  1E22 A;  1KOG A;  2QGG A;  4XAX B;  2E5K A;  4C8Q F;  1ZUU A;  1LNX A;  4E7Z A;  4N4I A;  4O5V A;  4XU1 A;  2O01 E;  3NTK A;  2XK0 A;  4II1 A;  4AG2 C;  3R6N A;  3QO5 A;  3RL6 A;  2DDZ A;  1ZX6 A;  2CJB A;  2OTJ Q;  4M77 F;  5IHK A;  3CC7 Q;  3EHQ A;  1N6A A;  2Y4Y A;  1HK9 A;  4EIK A;  1VQ7 Q;  4N4G A;  1H3Z A;  3TQ7 P;  1UGV A;  3O8V A;  2K7A A;  2VB6 A;  4C92 C;  2EJ9 A;  4C8Q D;  4YRT A;  3LH5 A;  2KK4 A;  4JPB W;  5C6S A;  3RER A;  1BIA A;  4ZGJ B;  2BKD N;  1GBQ A;  2DX1 A;  3EG0 A;  1VQL Q;  2KAF A;  3CC2 T;  4FYW B;  3TEH A;  1VQ9 Q;  2RF0 A;  2E70 A;  3CD6 Q;  4M7D E;  3LYI A;  1BCO A;  2RI5 A;  3SD4 A;  2E1H A;  3NEM A;  2D9T A;  3QJY A;  1RI9 A;  1R0C B;  2LMJ A;  4C5G A;  2RD1 A;  3RUX A;  3CCQ T;  3UAT A;  3OYD A;  2ZIM A;  3MF2 A;  4HA8 A;  3L4G B;  1WLE A;  5ECA A;  3LGF A;  2XMF A;  5LJ3 h;  3GF5 A;  3KXT A;  5IXB A;  2CUB A;  2XDP A;  1WA7 A;  1K0X A;  1D09 B;  3D7S B;  4OMP A;  4C8Q C;  4H2W A;  5KYW B;  3MP8 A;  3RKW A;  3SEM A;  2RB6 A;  3CCU T;  3HY0 A;  1Q7Y U;  3PCO B;  2MMP A;  3OA6 A;  1XOV A;  2DL3 A;  3NPF A;  4CI0 C;  2EJF A;  3MET A;  2RNA A;  1YFS A;  2QAS A;  2JTE A;  2O31 A;  4M77 C;  5GAN 8;  2CZ7 B;  2ZT6 A;  2ZAE A;  2AMC A;  2RJE A;  4UC4 A;  3P8T A;  2FVU A;  1Q82 U;  1AWX A;  1YJ9 A;  5LJ3 f;  5CIU A;  2RQW A;  2DJZ A;  3W3S A;  2RHU A;  4P72 A;  2H3E B;  4A63 B;  3TSW A;  2CP5 A;  2OI3 A;  3OB9 A;  1MMG A;  3TEE A;  1XTD A;  3A8H B;  4EMK B;  1MMD A;  2J3M A;  2DEQ A;  2DTH A;  1G2B A;  4ZGD B;  1VQP A;  5D6X A;  1ATI A;  2XG8 D;  1K73 C;  3FJ5 A;  3TVT A;  2QDL A;  5FRM A;  3P8Y A;  1UGQ B;  4E7J A;  4LDW A;  5CQY A;  2KYM A;  4DQ2 A;  4OB2 B;  2A3L A;  1RAH B;  2E3H A;  2XID A;  2OTJ T;  3A8G B;  1TWB A;  3CC7 T;  2LT4 A;  3A8M B;  1FX7 A;  3R6O A;  3QII A;  1NLO C;  5GJV B;  2DRK A;  5LJ5 e;  1VQ7 T;  1N5Z A;  1YJ9 Q;  1UEC A;  3E1S A;  3P8H A;  3FRN A;  4J9I A;  1H64 1;  3QKJ A;  2FPD A;  4XU3 A;  4OGE A;  1YCS B;  1WHH A;  2A7Y A;  1KQS P;  2O88 A;  1VQL T;  2K79 A;  2OTL Q;  5KCO A;  3R07 A;  4O2D A;  4J9B A;  3FC3 A;  1VQ9 T;  1X2K A;  3CD6 T;  2GGR A;  2E65 A;  1VQP Q;  1WXT A;  1SEM A;  1M8V A;  1ZSZ B;  1X2G A;  2F2W A;  4YRJ A;  4YRN A;  4YTL A;  3KUF A;  4F14 A;  2J6O A;  3M54 A;  1VQ4 T;  1SRY A;  4FW2 A;  4ZN1 A;  4DBH A;  1GCQ C;  3QDF A;  4M7D B;  5GAO l;  2EQU A;  1VOM A;  3ZL7 C;  3M0S A;  2OAW A;  3HXW A;  4BY6 C;  3RGL A;  4XU2 A;  5FRO A;  1GGM A;  2VVK A;  2AIR B;  3OBY A;  3QYG B;  4WCI A;  3EFR A;  4B9W A;  1M90 U;  2JW4 A;  2PQW A;  3RIR A;  4BI8 B;  3N5B B;  2RK1 A;  2AK5 A;  2QHV A;  2EKH A;  4P74 A;  3X20 B;  1FYN A;  1B07 A;  2CS7 A;  4J7I A;  4NS5 A;  2QQS A;  4OML A;  4PJN A;  4JRI A;  1UDL A;  4AFZ C;  2NUP B;  1SRM A;  4YRP A;  4KH0 B;  2D8H A;  2EQM A;  2HDA A;  1RAE B;  2CP3 A;  1E1O A;  2DKG A;  4A4K A;  3MP1 A;  2M9U A;  1ASZ A;  4IUT A;  4MZP A;  5GAM j;  5CVI A;  1WZO A;  4CH6 A;  3EGD B;  2F1L A;  2DIQ A;  4BE2 A;  1T3L A;  4J5Y A;  1K9M U;  1BBW A;  2IY5 A;  4FL6 A;  5A0D A;  1YIT A;  3TCJ A;  1TG0 A;  2K57 A;  5LJ5 g;  5CKH A;  2C06 A;  4EPC A;  2GCX A;  1RIQ A;  1WX6 A;  4XTX A;  1JEG A;  1VUB A;  2HD0 A;  2RHS A;  1ZBX A;  3HL8 A;  5EG2 A;  3MP6 A;  3CME A;  3QUI A;  3PVL A;  5M9O A;  1SKU B;  3PIP A;  4MZT A;  3VUB A;  1OZ3 A;  3A5Z A;  3OYK A;  3ZEH A;  4GBQ A;  4QQG A;  2ZNJ A;  1OYX A;  4JRK A;  3V8J A;  2ZZG A;  1EZZ B;  2LDM A;  3DB3 A;  2P4T A;  3QYH B;  2C0I A;  4X1V A;  1UGR B;  3I56 A;  1YJ9 T;  2ZGW A;  1H4S A;  1QWE A;  1IHV A;  1WQW A;  1RLP C;  1PD1 A;  4F7U A;  2AKL A;  1NPR A;  1ZA1 B;  3OYB A;  2ZPB B;  3NHN A;  2HQE A;  3M5A A;  4D8K A;  1YIT Q;  2OTL T;  3EFO B;  4YRG A;  5LJ5 d;  2Y90 A;  1TH7 A;  2KI7 A;  1EIY A;  2YUP A;  1VQP T;  1B70 B;  3CME Q;  2KXD A;  5K1P A;  3X28 B;  2IPO B;  3VYH B;  2JTF A;  2A0F B;  3TUP A;  2NLU A;  5KE2 A;  3OSS C;  1M1F A;  2ALY A;  4A4F A;  4RQF A;  1Z7N A;  2X4J A;  3CPF A;  2QG9 B;  1VQN Q;  2CJA A;  4GY5 A;  3WXM B;  4LNS A;  1KQS S;  2ZPH B;  1CKB A;  4OB1 B;  2HL5 C;  1SET A;  1X6G A;  1YIJ Q;  2PMF A;  4EO4 A;  3I9Q A;  4RQE A;  1RUW A;  1WU7 A;  4CS3 A;  1QMC A;  1JU5 C;  4PFZ A;  2AKW B;  2FPF A;  2FO0 A;  1OOT A;  4J9C A;  3ME9 A;  2MK5 A;  2KQW A;  3CCS Q;  2ZNI A;  4JS5 A;  2P0P A;  4C92 G;  1Q7Y R;  3MEW A;  3REB B;  2Q5H A;  1RAB B;  4HVV A;  3SFM A;  1U06 A;  3ULR B;  4CC7 A;  3LWI A;  4LVI A;  1UG1 A;  3MEY A;  4P5N A;  2RPN A;  1KD1 C;  2EFI A;  3EAE A;  3VBB A;  4C0G A;  2E4H A;  2PNI A;  2RQV A;  3HSB A;  1Q82 R;  4HWS A;  2EGA A;  3GNG A;  3EG9 A;  3HY1 A;  3SWN B;  1W6X A;  5I21 A;  2QTX A;  3QO3 A;  1ZQ1 A;  2PTK A;  4RMO A;  4LVM A;  1NNH A;  3JB9 I;  5GAO n;  1HYO A;  2Y4X A;  2C8M A;  4V2S A;  4C92 E;  4C0D C;  4OP0 A;  3OSV A;  1X55 A;  4RCC A;  3GOX A;  3OYM A;  3JB9 J;  2V8J A;  4HKE A;  3G71 A;  1N8R C;  5KYU A;  2I4N A;  3G6E T;  2R57 A;  2EQI A;  5IT9 E;  3ERR A;  2B8A A;  1UTI A;  3GP8 A;  2HL3 A;  3L4G A;  2KGT A;  1SF9 A;  1M8M A;  2O2O A;  4HCK A;  1NEG A;  4D6W A;  3OYC A;  3QHS A;  1VQ8 Q;  1UJY A;  2COY A;  1LOJ A;  1JB0 E;  2P84 A;  4M78 A;  2KT8 A;  1B34 B;  3CME T;  3OMG A;  2CZ1 B;  1YI2 A;  4KR2 A;  4BDZ A;  2EBP A;  4TVA B;  2D8J A;  2DLP A;  3S6W A;  1U1S A;  3PCO A;  2AKK A;  1IRE B;  2CUD A;  4LN2 A;  4ANJ A;  2V8I A;  4XU0 A;  2ZPE B;  2CYZ B;  2JVV A;  1GFD A;  3ASK A;  2KRM A;  5HK3 A;  1QVF A;  4C8Q E;  3REU A;  2RHQ B; 
#chains in the Genus database with same CATH homology
 5GAN 7;  1U1T A;  2K3X A;  1VIE A;  1K8A C;  1VQN T;  2CKK A;  2F5K A;  3GIB A;  4M77 E;  2HQX A;  2X4W A;  3QPH A;  3L2V A;  1YIJ T;  2E3C A;  3M4P A;  5GMK l;  2DU5 A;  2MWP A;  4EMK A;  3EFS A;  1NJI C;  4K86 A;  5LJ3 g;  5CQX A;  3E9H A;  3I55 T;  3CCS T;  4HCC A;  3CMA A;  4Z02 A;  2ZZE A;  4RMF A;  3M53 A;  5E3I A;  4H2S A;  2L5Q A;  4X9D A;  1DJ7 B;  2ART A;  2YLB A;  4IUR A;  4YDQ A;  1K73 U;  3CBP A;  3HXZ A;  3BDL A;  2XHC A;  4LDY A;  1H4T A;  2O4X B;  3A74 A;  5LJ3 d;  4JLG A;  4R55 A;  4C92 F;  1BI1 A;  3HPW A;  4J6Y A;  3CCV A;  4J6W A;  3CCJ T;  1I8F A;  4LD6 A;  4CH4 A;  4C92 B;  1USY A;  4DA4 A;  1NJ1 A;  1PSF A;  2I4L A;  4M7D A;  5C52 B;  1VQ8 T;  3QSU A;  2MF2 A;  4FT2 A;  4P73 A;  1KQS A;  2E5A A;  4P71 C;  4EMH A;  5J26 A;  3QZ9 B;  3HFZ B;  4M75 G;  4XK8 E;  3WVE B;  3OS2 A;  3M57 A;  5DLO A;  4IUV A;  1L0W A;  5AYF A;  1Y07 A;  4LDU A;  3A7R A;  4HT9 A;  5A2Q E;  4L5G A;  3OYY A;  2ODR C;  4PJO A;  2MI6 A;  4H2X A;  3OS0 A;  4C8Q B;  3G4S A;  4YCV A;  5CKE A;  5L8R E;  2QA4 A;  2P0K A;  4C5H A;  3X25 B;  2LQK A;  1B7Y A;  4H2V A;  5CKB A;  2WAC A;  4J6X A;  2JOY A;  2J3L A;  1VQK T;  1D3B B;  1YFT A;  3QXE B;  1YI2 T;  1EVL A;  4M77 B;  1EFW A;  5LJ5 j;  2DAQ A;  3BDU A;  4YP0 A;  3TU4 K;  1G3T A;  4H02 A;  3LWH A;  2LVM A;  4YCU A;  3VQX A;  1NPP A;  1SER A;  1UEB A;  3UT1 A;  3CMQ A;  4HVC A;  3L1A A;  3IKM B;  3KBG A;  3MEU A;  3JCM V;  2LCC A;  1QVG S;  4P75 A;  2PVO B;  4YCW A;  3L2W A;  5ELO A;  5LL6 S;  4P3P A;  3OS1 A;  4RG2 A;  1NE8 A;  4M7A A;  4NL3 A;  5KE3 A;  4BUG A;  2DXB A;  2EWN A;  1YHQ T;  3HFV A;  3TRE A;  2LNV A;  3JCM X;  3X26 B;  4KBM B;  3QJ6 A;  1YJN A;  2RJF A;  2K3Y A;  3LH0 A;  1YJW A;  2VXE A;  2PU9 B;  5GMK h;  1G3W A;  4XEM A;  2MAM A;  2M16 A;  4LVL A;  2QHT A;  2AKW A;  4M78 D;  1VIF A;  5ELN A;  3M9Q A;  4OLF A;  3CCL A;  4BY6 B;  1VQM T;  1QW1 A;  12AS A;  3CCR A;  5CK9 A;  4PL6 A;  4BE0 A;  1Q81 U;  1UGP B;  2XTI A;  1X56 A;  2LX9 A;  2RHZ A;  3SDZ A;  3RAC A;  3BFM A;  3FEO A;  4A4H A;  4NL2 A;  3SWN A;  4XTZ A;  1M1K C;  4Q5W A;  2P5I A;  4M75 F;  1JRI A;  3A5Y A;  5FU7 C;  4WJ3 M;  1R8O B;  4YRE A;  2DPP B;  1KQ2 A;  4M78 C;  2CGH A;  3E19 A;  2PVG B;  4TVY A;  2X4Y A;  4RG8 A;  3MEV A;  2JNG A;  1Q86 U;  1G3S A;  2GQV A;  3G4S T;  3S3M A;  2PUK B;  4AH6 A;  4M75 D;  3PFS A;  2Q7E A;  2XDB A;  1BIB A;  1B34 A;  2X4X A;  4BI3 A;  3MO8 A;  2KDS A;  4P3N A;  2A8E A;  2QEX A;  2VGN A;  1G51 A;  3ER0 A;  1KC8 C;  3NFC A;  2XKO C;  1RL2 A;  1VQO A;  4ELZ C;  4YRR A;  4G85 A;  1QVF S;  3A7A A;  2LTO A;  1B8A A;  2DD5 A;  3MCA B;  3OW2 S;  4ELY C;  5A0G A;  4E47 A;  3C4S A;  5HY6 A;  2H3J A;  2K5L A;  4NOY A;  2RA2 A;  4M75 C;  1N27 A;  1YFR A;  2RI3 A;  2EIF A;  4E51 A;  3V8K A;  4E7K A;  4N0A A;  3IKL A;  3HFN A;  4VUB A;  4HT8 A;  3OYJ A;  3CCE A;  1XQH A;  1VQ6 A;  2DK3 A;  4A54 A;  3P8D A;  3CCM A;  4TQD A;  4BE1 A;  4IUQ A;  2DZC A;  4XQ3 A;  3CBM A;  5FLX E;  3M58 A;  3CEY A;  3J7A F;  4PJO D;  5CAI A;  1USY C;  2LRQ A;  2JN0 A;  4ZTU B;  2FHD A;  4H2Y A;  2WSF E;  1QVG A;  4A53 A;  4UPA A;  3P8V A;  2DU7 A;  1Q7Y C;  1S72 A;  5HK0 A;  4KUD K;  4YRQ A;  4LDX A;  4MDW A;  2I2L A;  3OYI A;  1VQ5 A;  4C0D B;  3L2Q A;  3PNW C;  4G84 A;  2ZIN A;  1Q82 C;  1G5H A;  3E9G A;  5D6W A;  5GAN h;  4PJO C;  5FRN A;  3PMI A;  2VUB A;  3PMT A;  2HNI A;  1OZ2 A;  2F5T X;  4N4H A;  4H2U A;  3QG1 A;  4C5E A;  3GPL A;  4PLL A;  1P92 A;  1HXD A;  2QI2 A;  4ATO A;  4JJN K;  4GLK A;  2AMC B;  1Z7M A;  3LGL A;  2M0O A;  1NYR A;  4C8Q A;  3E9F A;  4F7U G;  4L87 A;  1X6O A;  4QQD A;  3FDR A;  4M7A D;  3L2Z A;  4ZN3 A;  3JB9 D;  4ZIB A;  5GAN f;  3CC4 A;  4KQE A;  1D3B A;  4M77 A;  4ZGE B;  1I5L A;  3LX7 A;  3OYH A;  3X24 B;  1MGQ A;  5LJ3 e;  1OI1 A;  3QDR B;  4X9C A;  3M4G A;  1I4K 1;  3M55 A;  1VQO T;  2DIG A;  3HRS A;  4CH3 A;  1BKB A;  1KMN A;  2LQ8 A;  4F7U E;  4OGC A;  2KVQ G;  4YPF A;  2ZT5 A;  2CJ9 A;  2P0L A;  1YGB A;  5KH6 A;  5KCH A;  1W2B S;  5A0L A;  4M7A C;  2CIM A;  1M4Z A;  3A8O B;  4E7I A;  3CXC A;  3A8L B;  4J7F A;  1YIT T;  4BDY A;  1E24 A;  2FB7 A;  2ZZD A;  2DTO A;  4JRP A;  1O75 A;  2K4Y A;  3HP9 A;  4EMG A;  2GFU A;  2PVD B;  5GMK e;  4IUU A;  4QQ6 A;  1M90 C;  4L6V 5;  1X75 C;  3HRI A;  2RH2 A;  2K2V A;  2P0Q A;  4P72 C;  4XTY A;  4Y91 A;  5GAN 5;  4ZTZ B;  2RJC A;  4PG3 A;  2KMT A;  2K5F A;  4TVW A;  5CO7 A;  2RJD A;  3OW2 A;  3M4Q A;  2ARS A;  4YRK A;  3I56 T;  4MMK A;  1Y71 A;  2EJG A;  2M1H A;  5I2S A;  3HFO A;  2QQA A;  4FM4 B;  4RKU E;  1WYD A;  1QE0 A;  3CC2 A;  3LSS A;  3NTH A;  2VGM A;  4R56 A;  1EQR A;  2E5Q A;  1KG1 A;  2XU8 A;  3CCQ A;  3IAL A;  3C94 A;  3QO8 A;  5GAO q;  1VQ5 T;  4M78 G;  3VQV A;  2EQK A;  4OB3 B;  1B76 A;  5FU6 C;  4BB7 A;  2QQ9 A;  1EOV A;  4BI4 A;  4PLI A;  3H6Z A;  4WI1 A;  3CCU A;  5J39 A;  3S3O A;  5GMK m;  2D0Q B;  3HTZ A;  4UP7 A;  4UP9 A;  4HT4 A;  4ZTF A;  2E64 A;  3BY7 A;  4M78 E;  1PYS B;  3RKY A;  4F7U F;  3E9I A;  5F5W A;  2BIV A;  3JCM J;  4WF2 A;  4F7U B;  4P74 C;  4B9X A;  3CC4 T;  3L2R A;  3LLR A;  3PIO A;  3J80 E;  3JSC A;  1M9S A;  4IUP A;  5I2M A;  3CPW A;  3JCM b;  3J81 E;  2QQR A;  1YB3 A;  3FB9 A;  3UPU A;  4XTW A;  2RO0 A;  3MQZ A;  4TTV A;  3HXY A;  1JJC B;  3IG2 A;  2R5M A;  2ALY B;  2XD0 A;  2OTJ A;  3G71 T;  3CC7 A;  3VQW A;  1BI2 A;  2ZR2 A;  1VQ7 A;  1Y7X A;  2E6Z A;  4TVR A;  3URG A;  5CKD A;  4JS4 A;  1WJQ A;  2Q7G A;  4X5O A;  1Y96 B;  3DB4 A;  2G3R A;  4EX5 A;  3JCM h;  4M75 E;  1VQL A;  1QF6 A;  3L42 A;  1VQ9 A;  2CZ6 B;  5GAO r;  2DQ0 A;  3CD6 A;  1NJ6 A;  4K88 A;  4BAC A;  4BW9 A;  2YRV A;  2CZ0 B;  4C0Z A;  2E12 A;  5J3B A;  2L89 A;  3OYN A;  4M7D G;  2FYK A;  1VQ4 A;  4MDX A;  5GAN 6;  1G5I A;  2PUO B;  11AS A;  5GAO p;  3L2U A;  5K1X A;  5IN1 A;  4LDV A;  4JUV A;  3UGT A;  1NJ5 A;  1NJ2 A;  2F69 A;  4YRL A;  1W2B A;  1I81 A;  3JCM c;  3JRZ A;  3JCM f;  4YYE A;  4RDX A;  5GAN e;  2EKO A;  1U8R A;  4BWA A;  2E41 A;  4M77 D;  5GAM h;  1B70 A;  1FXX A;  4H2T A;  4PJO G;  3REX A;  1BI0 A;  4J83 A;  3TEG A;  2X35 A;  3CMA T;  1JJ2 A;  3HRU A;  3BW1 A;  2I4M A;  5FU7 B;  3JAM E;  1ADY A;  2D6F A;  4M78 F;  4YRO A;  3RES A;  3WVD B;  3UDC A;  1W66 A;  4M78 B;  2I4O A;  3T9N A;  1GXI E;  1YBY A;  3HRT A;  3ZBD A;  1KMM A;  3V7C A;  4O6J A;  3UH0 A;  2ZCF B;  1WPY A;  5CR2 A;  4PJO E;  4WJ4 A;  2WSE E;  5GAM f;  1E1T A;  4E7L A;  3JB9 H;  1EVK A;  1C0A A;  3MF1 A;  4HCB A;  2IG0 A;  3CCV T;  3A7U A;  3GLX A;  3M4Y A;  1IL2 A;  1N9R A;  3FJP A;  3M59 A;  1FWZ A;  5GAN 2;  2V8K A;  3OYE A;  1WJS A;  2K5I A;  2OTL A;  4IKF A;  2ZT7 A;  3KFU A;  5CCA A;  1G5V A;  3OQ5 A;  2XIC A;  3FIF A;  5GAN g;  4M7A G;  3JB9 G;  4M75 B;  3CBO A;  1KD1 U;  3LC0 A;  2ZPG B;  4JLI A;  2HAX A;  2RHI A;  4C5I A;  5GAN 4;  3F70 A;  4YRS A;  2Q7H A;  2QA4 T;  4QVD A;  4K87 A;  2C7I A;  1X54 A;  3VUZ A;  3BJU A;  3UGQ A;  1UB4 A;  4M7A E;  1ASY A;  3CXC S;  1ADJ A;  4MZM A;  2KSS A;  4CH5 A;  2ZTG A;  1N8R U;  3V7S A;  4TVA A;  2YLC A;  5GAN 3;  2JUF A;  1M1G A;  3QBY A;  5C51 B;  3V8L A;  5GAN d;  4YRF A;  3RMQ A;  1VQZ A;  2RHQ A;  4M7D F;  3GNF B;  3RF1 A;  4A4E A;  5C0M A;  4EMK C;  2EYQ A;  3LW5 E;  4DOW A;  1FYF A;  4Y28 E;  2IVW A;  4YRI A;  4XTV A;  2LC4 A;  4OVA A;  4M7D D;  2VYT A;  5GAO m;  1XNI A;  1N9S A;  3HXV A;  2DD4 A;  2DZ9 A;  5GMK i;  3NTI A;  1K8A U;  4PJO F;  3G6E A;  3VV0 A;  5LJ3 j;  1EIF A;  4PJO B;  4P71 A;  4H2X B;  1JBM A;  1ZHI A;  3G7Z A;  3OYA A;  3VJP A;  3MHX A;  3AHU A;  1SSF A;  1B7Y B;  4CRI A;  1NJI U;  1X2H A;  3RMS A;  3JCM Q;  1YJN T;  4KR3 A;  1YJW T;  1SES A;  2ZPF B;  1MHN A;  3PTA A;  1J5W A;  4ME7 A;  3ZFJ A;  1WNL A;  2VV5 A;  4DOV A;  1BI3 A;  2R5A A;  3JCM W;  4M7D C;  2O4X A;  2RK2 A;  4P73 C;  5HKC A;  3TEH B;  3CCL T;  4FIB A;  5GMK j;  1PYS A;  1VQN A;  3VYG A;  4ZTJ A;  4C92 A;  3CCR T;  2JZ2 A;  3QO7 A;  1YIJ A;  1WJR A;  1O9S A;  3OMC A;  3Q1J A;  2ZCE A;  3QTC A;  3OYF A;  2ARU A;  2BUD A;  2EQJ A;  2XDD A;  1QP3 A;  5DY9 A;  2AHJ B;  2FL7 A;  3JCM e;  2DXC A;  4OB0 B;  1W4S A;  3I55 A;  3SB2 A;  3CPW S;  3CCS A;  3HFZ A;  2E10 A;  4M7A F;  1JJC A;  1LJO A;  4Q6G A;  2G4C A;  3JB9 F;  2ZZF A;  1NJ8 A;  1NYQ A;  3DSQ A;  4LVK A;  4M7A B;  4YRM A;  1KHI A;  3I7F A;  3M56 A;  5CKF A;  4QVC A;  3PGG A;  2ZXF A;  3VU3 C;  1Y96 A;  2LCL A;  3QZ5 B;  3ICA A;  2Q5I A;  1Q81 C;  4PNO A;  4Q15 A;  4HWR A;  5HGQ A;  2ZIO A;  4OF1 A;  3A32 A;  4XTU A;  4HWT A;  2LT1 A;  2QEX T;  3MEA A;  1LYL A;  3C12 A;  4C0F A;  3CCJ A;  5GAM e;  4PHC A;  4HWP A;  2QQB A;  1X01 A;  2R58 A;  4LVJ A;  4FT4 A;  4P75 C;  2DQ3 A;  1VQ8 A;  5C53 B;  2JTM A;  3UFG A;  2RHX A;  3NET A;  1Q86 C;  1KQ1 A;  4YRC A;  2QHS A;  4J15 A;  3OYG A;  3PZC A;  4HCZ A;  2GFA A;  4A4G A;  4E7H A;  4KT0 E;  5KNN A;  3NEN A;  2EAY A;  4MML A;  3V7R A;  3DKM A;  2RI2 A;  2RHY A;  4PKC C;  3JCM P;  3OD1 A;  1AHJ B;  2E6N A;  3JCM g;  2L8D A;  4BD3 A;  4X34 A;  4HWO A;  4C8Q G;  3CCE T;  5FU6 B;  4KUI A;  3FLG A;  1G3Y A;  3VKI A;  2DXT A;  2ZR3 A;  1VQ6 T;  2GF7 A;  4JRQ A;  4L59 A;  3CCM T;  5LJ5 h;  3LSQ A;  2QXF A;  1JJ2 S;  4QVZ A;  2MWO A;  3DLM A;  4M77 G;  1VQK A;  1RI0 A;  2QDY B;  3OYL A;  4NCX A;  4OMF B;  1M5Q 1;  1PSE A;  4CS2 A;  4LD9 K;  2DO3 A;  1K9M C;  2VC8 A;  1YCY A;  1QP2 A;  3DLL A;  3JCM d;  3HRK A;  3SWN C;  2RM4 A;  2NS6 A;  3HHT B;  2EL9 A;  2KY9 A;  3HXU A;  4TWA A;  5LJ5 f;  1S72 T;  5IAY A;  4FSX A;  2ZT8 A;  4QW2 A;  5GAM g;  4CS4 A;  4J8O A;  1H4V B;  2DTI A;  4KUL A;  1H4Q A;  2YHT A;  3OY9 A;  2IY5 B;  4EDU A;  1HTT A;  3HKS A;  3OS5 A;  2RHS B;  4DPG A;  1HC7 A;  2PME A;  1WQ7 A;  3P8B B;  4M75 A;  4FU6 A;  3H8Z A;  3INZ A;  3A5Z B;  5GAN j;  3OBW A;  3C95 A;  1KHC A;  4JDS A;  3S3N A;  2DVE A;  3PT9 A;  4RCB A;  3A31 A;  1YHQ A;  2QHU A;  3G1Z A;  5GAM d;  1M1K U;  5D6Y A;  3VQY A;  4TQF A;  5DLQ E;  2ZPI B;  2XGT A;  4XEO A;  4UP8 A;  1WGS A;  2L3R A;  1EIY B;  4P3O A;  2OAU A;  1BBU A;  2ODR D;  1VQM A;  2XI9 A;  2VXF A;  1IZ6 A;  2DXU A;  3WQZ A;  2WSC E;  1N9W A;  4N0A C;  3UWN A;  1V29 B;  3HXX A;  4C92 D;  5DM7 R;  3RKX A;  2HBP A;  1KC8 U;  1BYM A;  3NEL A;  1NZ9 A;  1QVP A;  1UGS B;  3QNE A;  1E22 A;  1KOG A;  4XAX B;  4C8Q F;  1LNX A;  4N4I A;  4O5V A;  4XU1 A;  2O01 E;  3NTK A;  2XK0 A;  4II1 A;  3QO5 A;  3RL6 A;  2DDZ A;  2CJB A;  4M77 F;  1N6A A;  2Y4Y A;  1HK9 A;  4N4G A;  1H3Z A;  3O8V A;  4C92 C;  2EJ9 A;  4C8Q D;  4YRT A;  2KK4 A;  5C6S A;  3RER A;  1BIA A;  4ZGJ B;  2BKD N;  2KAF A;  3CC2 T;  3TEH A;  2E70 A;  4M7D E;  3LYI A;  2RI5 A;  3SD4 A;  2E1H A;  3NEM A;  2D9T A;  3QJY A;  4C5G A;  3CCQ T;  2RD1 A;  3RUX A;  3OYD A;  3MF2 A;  2ZIM A;  4HA8 A;  3L4G B;  1WLE A;  3LGF A;  5LJ3 h;  3GF5 A;  3KXT A;  2XDP A;  4H2W A;  4C8Q C;  3MP8 A;  3RKW A;  2RB6 A;  3CCU T;  3HY0 A;  1Q7Y U;  3PCO B;  2MMP A;  3OA6 A;  1XOV A;  4CI0 C;  2EJF A;  3MET A;  1YFS A;  4M77 C;  5GAN 8;  2CZ7 B;  2ZT6 A;  2AMC A;  2RJE A;  4UC4 A;  3P8T A;  2FVU A;  1Q82 U;  1YJ9 A;  5LJ3 f;  5CIU A;  2DJZ A;  3W3S A;  2RHU A;  4P72 A;  3OB9 A;  3TEE A;  1XTD A;  3A8H B;  4EMK B;  2J3M A;  2DEQ A;  2DTH A;  4ZGD B;  1VQP A;  5D6X A;  1ATI A;  2XG8 D;  1K73 C;  5FRM A;  3P8Y A;  1UGQ B;  4E7J A;  4LDW A;  5CQY A;  4DQ2 A;  4OB2 B;  2A3L A;  2XID A;  2OTJ T;  3A8G B;  3CC7 T;  2LT4 A;  3A8M B;  1FX7 A;  3R6O A;  3QII A;  5LJ5 e;  1VQ7 T;  3P8H A;  3E1S A;  3FRN A;  1H64 1;  3QKJ A;  4XU3 A;  4OGE A;  2A7Y A;  1VQL T;  5KCO A;  3R07 A;  4O2D A;  3FC3 A;  1VQ9 T;  3CD6 T;  2E65 A;  1M8V A;  1X2G A;  4YRJ A;  4YRN A;  4YTL A;  3KUF A;  1VQ4 T;  3M54 A;  1SRY A;  4ZN1 A;  4M7D B;  5GAO l;  2EQU A;  3HXW A;  4BY6 C;  3RGL A;  4XU2 A;  5FRO A;  1GGM A;  3QYG B;  3OBY A;  3EFR A;  4B9W A;  1M90 U;  4BI8 B;  2PQW A;  3RIR A;  3N5B B;  2RK1 A;  2QHV A;  4P74 A;  3X20 B;  2CS7 A;  4J7I A;  4NS5 A;  2QQS A;  4JRI A;  4YRP A;  2EQM A;  1E1O A;  2DKG A;  4A4K A;  3MP1 A;  2M9U A;  1ASZ A;  4IUT A;  4MZP A;  5GAM j;  5CVI A;  4CH6 A;  2DIQ A;  4BE2 A;  4J5Y A;  1K9M U;  1BBW A;  2IY5 A;  4FL6 A;  5A0D A;  1YIT A;  3TCJ A;  2K57 A;  5LJ5 g;  5CKH A;  2C06 A;  4EPC A;  2GCX A;  1RIQ A;  4XTX A;  2RHS A;  1VUB A;  2HD0 A;  1ZBX A;  3HL8 A;  5EG2 A;  3MP6 A;  3CME A;  3QUI A;  5M9O A;  3PIP A;  4MZT A;  3VUB A;  1OZ3 A;  3A5Z A;  3OYK A;  3ZEH A;  4QQG A;  2ZNJ A;  1OYX A;  4JRK A;  3V8J A;  2ZZG A;  2LDM A;  3DB3 A;  2P4T A;  3QYH B;  1UGR B;  3I56 A;  1YJ9 T;  2ZGW A;  1H4S A;  1WQW A;  4F7U A;  1NPR A;  3OYB A;  2ZPB B;  2HQE A;  3M5A A;  2OTL T;  4YRG A;  5LJ5 d;  2Y90 A;  1TH7 A;  1EIY A;  1VQP T;  1B70 B;  5K1P A;  3X28 B;  3VYH B;  2JTF A;  3TUP A;  2NLU A;  5KE2 A;  3OSS C;  1M1F A;  2ALY A;  4A4F A;  4RQF A;  1Z7N A;  2X4J A;  3CPF A;  2CJA A;  4GY5 A;  3WXM B;  4LNS A;  1KQS S;  2ZPH B;  4OB1 B;  1SET A;  2PMF A;  4EO4 A;  4RQE A;  1WU7 A;  4CS3 A;  2AKW B;  3ME9 A;  2KQW A;  2ZNI A;  4JS5 A;  2P0P A;  4C92 G;  3MEW A;  2Q5H A;  3SFM A;  3LWI A;  4LVI A;  3MEY A;  4P5N A;  1KD1 C;  2EFI A;  3EAE A;  3VBB A;  4C0G A;  3HSB A;  4HWS A;  3GNG A;  3HY1 A;  3SWN B;  5I21 A;  2QTX A;  3QO3 A;  1ZQ1 A;  4RMO A;  4LVM A;  1NNH A;  3JB9 I;  5GAO n;  2Y4X A;  2C8M A;  4V2S A;  4C92 E;  4C0D C;  4OP0 A;  3OSV A;  1X55 A;  4RCC A;  3GOX A;  3OYM A;  3JB9 J;  2V8J A;  4HKE A;  3G71 A;  1N8R C;  2I4N A;  3G6E T;  2R57 A;  5IT9 E;  3ERR A;  2B8A A;  3GP8 A;  3L4G A;  4D6W A;  3OYC A;  3QHS A;  1LOJ A;  1JB0 E;  4M78 A;  1B34 B;  3CME T;  3OMG A;  2CZ1 B;  1YI2 A;  4KR2 A;  4BDZ A;  4TVA B;  3S6W A;  1U1S A;  3PCO A;  1IRE B;  2V8I A;  4XU0 A;  2ZPE B;  2CYZ B;  2JVV A;  3ASK A;  5HK3 A;  1QVF A;  4C8Q E;  3REU A;  2RHQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...