4XU1A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 82 that incorporates a morpholine in place of the ribose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
b'DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
molecule tags Ligase/ligase inhibitor
source organism Mycobacterium tuberculosis
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
total genus 98
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu1A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu1A01
5K1XA 3QTCA 1WU7A 4QVDA 1G51A 1VQZA 2DXTA 3JCMQ 4WI1A 4UP7A 4HT9A 3IG2A 4C92G 3HRKA 2ZIOA 2K57A 4G85A 4PHCA 2DTHA 3RERA 3SWNA 3W3SA 2I4MA 1KQ2A 3QO5A 2VXEA 3NETA 4YYEA 4HWPA 2ZZEA 1I5LA 3REXA 4P74C 5KNNA 2RHQB 1EQRA 2E65A 2EWNA 4H2YA 4PJOF 4F7UB 1IL2A 2DVEA 4M77F 3FJPA 2VC8A 3M4PA 4P71A 3IKLA 4CH3A 1EVKA 1I4K1 3GIBA 1H4SA 4CH5A 2J3LA 2ODRD 3BW1A 3DSQA 4PJOD 3JB9G 4H2SA 5C51B 3UH0A 3CMQA 1N9RA 4YDQA 1EOVA 2DKGA 1YGBA 3NELA 5E3IA 4ZTUB 2HNIA 1HTTA 4C92C 2C7IA 3M4GA 3V7CA 1NYQA 4NOYA 4H2VA 3QO8A 4M7DA 1W66A 3I7FA 1WPYA 2QTXA 1L0WA 4F7UG 4N0AA 2ARSA 1BBWA 5GAMf 2AMCB 1NJ8A 2ZZFA 2RHSB 2IY5B 4WJ3M 4EMKB 2I2LA 4C8QG 4PJOG 3JCMc 5LJ3j 4M7AG 4XTWA 1WNLA 1JJCB 2YLCA 5LJ5g 4YRKA 1B7YB 2RB6A 1RIQA 2DQ3A 3HXYA 3RKYA 3JB9F 4M78C 5GAMe 2EAYA 2FYKA 5GAOq 4M7AF 3A32A 4A53A 4M78E 2QHTA 2ZZGA 2AMCA 3QHSA 3UFGA 5GANh 1D3BB 4RCBA 1KOGA 2Q7EA 1NJ2A 3A74A 4C8QB 3TEHA 2QHUA 3JB9H 2ZGWA 3RKWA 3IKMB 3JCMb 1JBMA 4ZTZB 1X2GA 3JCMh 4MMLA 1B76A 4J6YA 4JUVA 2QHVA 3OD1A 2DTIA 3FIFA 4TQFA 5GANf 2DXUA 4P73C 1B34B 2ZCEA 4MMKA 1H4QA 4WJ4A 1KMNA 3V7RA 3G1ZA 3V8LA 4BW9A 3INZA 3WQZA 5GAN2 3A5YA 4M78F 4C92E 1Z7MA 4YRNA 3R07A 4M77G 4P74A 4HA8A 4M75E 1ADYA 3TUPA 1JRIA 4JRIA 4RCCA 3JCMg 2I4OA 4YRQA 4RMFA 4HWRA 2VXFA 2E5AA 5GMKh 4X9DA 3SB2A 3HFVA 3HXVA 5DY9A 2YLBA 3UGQA 2DEQA 2FB7A 5ELOA 4K86A 5GANe 12ASA 3HXXA 1USYA 4OP0A 2YHTA 3A7AA 4E51A 1NJ1A 4X9CA 1D3BA 3HFZA 1GGMA 2ZR3A 1N9SA 4H2XA 4PJOC 5GAN6 2J3MA 4Q6GA 4C92F 4UP8A 4XEOA 3LSQA 3HFNA 3JCMX 2P0LA 5GMKm 2EJ9A 3MF1A 4M7DB 2CJ9A 1SERA 2DZ9A 2ALYB 1YFRA 1NJ5A 4XTXA 1Y96B 4P72A 4Y91A 5LJ3g 1H4VB 1B7YA 4YCUA 4YRSA 2P5IA 5GAOl 4F7UE 4C92A 4XQ3A 3MEYA 4EX5A 3PCOB 4EMHA 3LC0A 2RA2A 3NENA 5F5WA 3HY0A 4YRJA 2ZT7A 4EO4A 5LJ3f 1NYRA 4QVCA 1KMMA 5LJ5d 3FB9A 1E1OA 1B70B 3RESA 2ALYA 4A54A 2Q5IA 4TVYA 1PYSA 3VQWA 4C92B 2ZNJA 3JCMd 3L2ZA 3E9IA 2E1HA 4P3NA 2Y90A 5C52B 4M7AA 2ZNIA 3A7RA 4C8QA 4M77D 3TEHB 4F7UF 4M7DF 3IALA 3JCMJ 4M78A 4XU3A 3ICAA 1WYDA 2CJAA 2I4LA 4AH6A 4H2WA 1KQ1A 4CS4A 4Q15A 1EVLA 4P71C 2ZXFA 1BIAA 5LJ5h 4M7DG 3JCMf 5C53B 1B34A 3E9HA 5GAMj 5HGQA 4RQFA 4M7AE 1MGQA 1SRYA 2QHSA 1WLEA 3HTZA 3RL6A 4M78B 2ZTGA 3RF1A 4TVAB 3QO7A 3RIRA 2ZINA 4YPFA 4YRIA 4G84A 4H2UA 1N9WA 4P72C 4K88A 3BDUA 1X2HA 4M7DE 3HY1A 3BJUA 5GMKj 5GMKi 2CGHA 1BBUA 4TVWA 1QE0A 3HSBA 2E3CA 3LSSA 3EFRA 5ELNA 4CH6A 3JB9J 1ASZA 1E1TA 4TQDA 4HWOA 4NCXA 1HC7A 3MF2A 1QF6A 4P75C 4M77A 4WF2A 1WQ7A 4KQEA 4P73A 3HXZA 3TEGA 4DPGA 3UGTA 4F7UA 4M7AD 4YRPA 4KR2A 2RD1A 4C8QD 11ASA 4TVAA 4J5YA 1USYC 2DU5A 5LJ5e 4PG3A 5GAN8 4H02A 3L4GB 4XU0A 3A5ZA 4M75B 5GANj 2XGTA 2Q7HA 4XU2A 2DZCA 3SWNC 3JCMV 5GAMd 3VQVA 3JCMP 2ARUA 3QUIA 4M77E 3V8JA 5GMKl 3PZCA 3NEMA 1I81A 2CJBA 1HK9A 2AKWA 2JN0A 3BFMA 4BWAA 1WQWA 4YRLA 4ZIBA 3HXWA 4YRFA 3A31A 4JRKA 4J6WA 3JCMe 4UPAA 5GAN7 2RHSA 2ARTA 5K1PA 2ZIMA 4PNOA 4KR3A 4JLIA 3VQXA 4OLFA 4V2SA 2DQ0A 4XEMA 1B8AA 1ASYA 4YRGA 1PYSB 2EL9A 1X01A 4NL2A 2AKWB 4CS3A 2IY5A 3BY7A 5GANd 5GAN3 3VBBA 4XTYA 1M8VA 5GAN4 5LJ5j 1FYFA 1EIYA 3ERRA 4M7DC 3V8KA 4YP0A 2EJGA 4YRTA 4J6XA 1SESA 4PJOB 3RGLA 4YCVA 3REUA 4XTVA 2RM4A 4P3OA 4M77C 2C8MA 1U1SA 3HFOA 1X55A 4K87A 1E22A 3V7SA 1ADJA 4M75A 3JCMW 5GAOp 4YROA 4XTZA 1LNXA 1H641 1U1TA 3VQYA 4N0AC 5GAN5 4CH4A 4CS2A 3SWNB 2ZT5A 2Q5HA 4J15A 4EMKC 2CIMA 4HT8A 1HXDA 1YCYA 4HWTA 4M75C 1X54A 4H2XB 2ZT8A 4X5OA 2Q7GA 1BIBA 2ODRC 4M78D 4O2DA 4PJOA 3RKXA 4TWAA 1EFWA 4C8QF 1TH7A 1JJCA 4P3PA 1LOJA 2DDZA 1M5Q1 2EJFA 3KFUA 2ZR2A 4DQ2A 3PCOA 5CAIA 1EIYB 4M7AB 4YRMA 5LJ3e 3P8TA 1SETA 3PGGA 1J5WA 4YRRA 1NNHA 4M75G 2E64A 4XU1A 2G4CA 4TTVA 1B70A 1G5HA 2DU7A 3HFZB 1G5IA 1YFSA 4UP9A 3AHUA 1Z7NA 1I8FA 4C8QC 3EFSA 4M7AC 1YB3A 1ATIA 4C92D 4M75F 2DTOA 5GAOn 4HVCA 5GANg 4C8QE 4YCWA 4M75D 1YFTA 3JB9I 2RHQA 2E10A 1NJ6A 3QO3A 1C0AA 1Y96A 4PJOE 4HWSA 1H4TA 4RQEA 4NL3A 4P75A 3QNEA 2PMFA 4H2TA 4M7DD 2PMEA 5I21A 4M78G 3HXUA 5GAOm 4XTUA 5LJ3h 2I4NA 4EMGA 1E24A 3RUXA 4M77B 3QSUA 5GAMg 5GMKe 3A7UA 5LJ5f 3HRIA 4YRCA 2E41A 2XTIA 5LJ3d 1LJOA 1LYLA 4L87A 5GAMh 4LNSA 2DJZA 3L1AA 1X56A 3L4GA 3M4QA 5GAOr 3P8YA 4EMKA 3JB9D 3VU3C 4RDXA 3P8VA 4YREA 2ZT6A 3RACA
chains in the Genus database with same CATH superfamily
5K1XA 3QTCA 1WU7A 2LCLA 1VQZA 4LD6A 2PNIA 2FRYA 1T0HA 4C92G 3HRKA 2ZIOA 4GLKA 3THKA 2DRKA 4OB2B 4E7KA 2DTHA 5HY6A 3RDVA 4JS5A 2GFAA 4AG1C 3HP9A 3MQZA 2R57A 4JJCA 1VQOT 2VXEA 1YJWA 3OS1A 4P5NA 4P74C 4PJLA 2P0PA 1M1KC 3QWYA 4H2YA 4RTUA 4PJOF 1Q95G 1HJDA 1KHCA 2DVEA 1QQJA 3FJPA 4A4HA 4QQGA 2PVDB 2VC8A 3IKLA 2NUPB 3VYGA 3GIBA 1H4SA 4KRTA 1WLPB 4J9DA 5C51B 3CCJT 1NEGA 3UH0A 3CMQA 1MNEA 4PLLA 1EOVA 4ZTUB 1HTTA 3O8VA 4NOYA 2A8EA 1VQMQ 2FL7A 2YT6A 4M7DA 5GJWB 1TWBA 1RLPC 1WPYA 1OU9A 2QTXA 5GAMf 3M0PA 1RLQC 4WJ3M 1E6GA 4EMKB 4C8QG 4M7AG 5KYUB 2OTLA 3OYNA 4QKUA 1P92A 2RB6A 1RIQA 1JU5C 3QZ9B 5GAMe 2EAYA 2DO3A 1SSHA 1WHKA 2AZSA 2RN8A 2QHTA 2XDDA 1YIJQ 1KOGA 3TEHA 3JB9H 1V29B 4RTXA 3IKMB 1H3ZA 3JCMb 1H3HA 2LDMA 1WFWA 4ZTZB 2YDLA 5FLXE 1G3YA 4C0ZA 1K73C 2P4RA 4QVZA 2DTIA 2ZCFB 3EFOB 5GANf 1ZHIA 2EQUA 4MMKA 4VUBA 3SDZA 3VS1A 1ARKA 5CIUA 3FLGA 4R56A 3V8LA 3INZA 3WQZA 5IHKA 1AZGB 3M53A 2IVWA 4C92E 1H8KA 1WXUA 4BI8B 3R07A 2RQWA 4P74A 2JZ2A 2HKNA 3VJPA 5M9OA 1ADYA 2L3RA 4RCCA 2I4OA 2VXFA 1G3WA 2E5AA 2RI5A 4KUIA 3HFVA 3HXVA 1D0ZA 1WZOA 1YN8A 5ELOA 2DM1A 2ATCB 4OP0A 9ATCB 2QI2A 5IXBA 2BZXA 3A7AA 4E51A 3F70A 4X9CA 1D3BA 1Q7YR 1GGMA 2FVUA 4PJOC 2OTLT 1WI7A 4UP8A 4Q6GA 4C92F 1PSEA 4KBMB 1BU1A 3JRZA 2O01E 1D1AA 1W1FA 5CKFA 1KQSA 2CJ9A 2MAMA 1VQOA 1YFRA 4BDYA 4XTXA 4XAXB 2DPPB 3QBYA 3CCVT 4P72A 4YCUA 4YRSA 3LGFA 1OZ2A 1K0XA 2EKHA 3PCOB 4EMHA 3LC0A 3M0QA 1YJWT 3SFMA 4JJBA 4EO4A 1K9AA 1XJWB 2J6FA 2R5MA 3MP8A 3CCEQ 1NYRA 4QVCA 1OX9A 2XDPA 1UJ0A 2NWMA 1B70B 3RESA 4A54A 1S72Q 2Q5IA 2BE9B 1OPLA 2QK0A 2QEXQ 1KSWA 3S3MA 1YJ9A 1Z9ZA 4OB3B 3VUBA 2RQVA 1OX8A 2J7IA 2QASA 3PFSA 1NEBA 3VQWA 1OQKA 2JM8A 2E1HA 2Y90A 4OVAA 1WHHA 1QCNA 3TEHB 3HKSA 4M77D 5KYWA 3IALA 4DA4A 3M0RA 1UGRB 2CJAA 2LJ3A 1YP5A 1MV0B 2CT3A 2MK5A 3SD4A 2V1QA 1YI2A 1XOVA 2NUTB 5C53B 1Q82C 5GAMj 1U8RA 4NS5A 1X6BA 1OOTA 2KQWA 2P84A 2YWWA 4F04B 2MPXC 1RI0A 2QHSA 2CP7A 3HTZA 5KYYB 3RF1A 3UA7A 4YPFA 3X20B 4YRIA 1MMGA 2X35A 4H2UA 2SEMA 2FZKB 1PWTA 5KH6A 1N9WA 4BI3A 2EGAA 3M57A 5KE3A 1WXBA 3OSSC 3M0SA 5D6XA 5GMKj 2HBPA 3LSSA 3HSBA 5ELNA 1ASZA 1VQKQ 4HCBA 5KCOA 2CKKA 3MF2A 3UPUA 1NPRA 4AFSC 3CPWP 1WQ7A 3TEGA 4M7AD 2LT1A 2RD1A 3H0FA 2DL4A 1M1KR 1HSQA 2VASA 4DEXA 5GAN8 4D8KA 3I55A 1M2OA 2BUDA 2L3PA 2O31A 2L2PA 3LYIA 2R5AA 4JPBW 1PCXA 2ZPFB 4HCCA 2E6ZA 3CCQT 2CJBA 2AKWA 1SG5A 4E47A 2DYIA 2QTVA 4BWAA 1VQ5A 5CQXA 1RL2A 1W4SA 1KC8R 3HXWA 1BCOA 4FYXB 4JRKA 4UPAA 5GAN7 3CBOA 3G71A 1NE8A 3TEEA 2XU8A 1OV3A 4JLIA 2HEQA 1VIFA 3VQXA 4V2SA 1VQ4A 2MI6A 2DQ0A 5IXFA 1FYNA 1ASYA 5GJVB 2XD0A 5FRMA 4AFQC 3PMIA 1BBZA 2QGGA 2RJFA 3BY7A 2E12A 5AT1B 1RI9A 1PRMC 1D09B 2J05A 4ZTFA 5LJ5j 2DETA 2XI9A 2E3HA 1K4US 2EJGA 2JTFA 4WCIA 4YRTA 4J6XA 2HDAA 4Z88A 2NUTA 2QEXA 4YCVA 4B9XA 4M77C 3ZL7C 2PUKB 2BE7D 2EYWA 2CSQA 4A4GA 1E22A 3A98A 2RPNA 1Y71A 1Y7XA 4A4KA 1AEYA 1M1KU 5GAOp 2DAQA 3G6ET 4CH4A 1N8RU 2Q5HA 3UF4A 3GBQA 4HT8A 3C4SA 1HXDA 1YCYA 3LLRA 4LE9A 1JQQA 3CXCA 2RJDA 5HKCA 3L2RA 1ZBJA 1RAAB 2ODRC 3RKXA 2D0NA 1JJCA 2K4YA 2K79A 4P3PA 4OGCA 2PUOB 1RAGB 1VQ7A 2X9HA 1QLYA 4AT1B 4YRMA 1VQ5T 5LJ3e 1VQ9A 4BDZA 2RMOA 4WTOB 2DYBA 1J5WA 4Y28E 3I56T 2ZPIB 1NNHA 1ZUYA 2L8DA 3A8GB 1G5HA 2EPDA 1YFSA 2FPEA 1Z7NA 4C8QC 3EFSA 3GNFB 4M7AC 2VYTA 4C92D 1QVPA 4XK8E 4HVCA 2L89A 1C0MA 1YFTA 1QCOA 1DJ7B 1SEMA 2RHQA 1AHJB 1I5OB 3QWXX 1NJ6A 4AMCA 1XQHA 3OYHA 2M51A 2MMPA 3UA6A 2DRMA 2KGTA 4P75A 3CCUA 5J3BA 2RK2A 4IUVA 2NS6A 3M5AA 3CCUQ 1YJNQ 4M7DD 4ZN3A 5I21A 1KG1A 2CSIA 2WSFE 3VV0A 4LVLA 3A8OB 4XTUA 3TU4K 5DM7R 2BZYA 4EMGA 1G83A 4E7IA 3RUXA 4DOVA 1EZZB 3G6EA 5GMKe 2AZVA 5LJ3d 1LJOA 4L87A 3CC2Q 2DJZA 2ZAEA 3OYAA 1X56A 3L4GA 2B86A 1X6OA 3OB9A 3P8YA 3VU3C 2PVOB 4YREA 4N4IA 1VQ8Q 1ZUUA 5A2QE 1U5SA 4WI1A 1WHMA 1VQ9Q 2L3SA 2EYYA 1GFCA 2HMAA 2GBQA 2QEXT 1OU8A 1W70A 1W2BS 3SWNA 4Z8AA 2NLUA 3CCST 3EAEA 1ZA1B 3VS2A 5KYUA 3EGXA 2C0IA 3HTRA 3A1PA 4FW2A 1AWJA 3GPLA 2D8HA 3MJXA 2RHQB 2OX7A 5FWCA 1M3BA 2E65A 2RH2A 1YI2T 4Y92A 1JJ2A 2RI3A 2FZGB 2JNGA 1QVFP 2DL5A 3JV3A 1EVKA 2GNCA 3ASKA 4CH5A 2ODRD 1BCMA 4LVIA 4YDQA 4C0FA 2BZ8A 4JRPA 2C7IA 3V7CA 1WJQA 1UHFA 1YITT 2K6DA 3I7FA 1KQSP 2EQIA 5KYWB 4LDWA 5CKDA 2CUBA 1TG0A 4F7UG 1BBWA 2VGNA 2ZZFA 2D8JA 2RHSB 1SRMA 2D0QB 1JXOA 1MUZA 3JCMc 3L2UA 5LJ3j 1WNLA 1G3TA 1VQPT 1JJCB 2YLCA 3ER0A 1VQ4Q 2AKLA 2QQAA 3HXYA 2LT4A 1QVGP 4F16A 3EGXB 2YXYA 3NFCA 2EW3A 4M78E 1AOJA 2ZZGA 1N8RR 2M9UA 1IB8A 3QHSA 1YNZA 3QKJA 1D3BB 4RCBA 3CCQA 2V8JA 4LDVA 5EC7A 2QHUA 3RKWA 3CCLQ 2ESWA 5IT9E 2QA4Q 1PRLC 2RHXA 3JCMh 4OMOA 4RG8A 5A0GA 1IGUA 2QHVA 2WSCE 1PM3A 3WVDB 3DKMA 2ZCEA 4GBQA 1H4QA 3EGDB 3U23A 4B6MA 3WVEB 2J6OA 3G1ZA 2XHCA 4BW9A 5GAN2 2B8AA 3A5YA 1WHGA 1C6VX 3CCRQ 2GF7A 2XMFA 1E6HA 5KCHA 1KD1C 2CP6A 2CP0A 4M75E 2F5KA 3TUPA 4IUQA 1NLOC 1YIJT 3JCMg 4PKCC 1PC0A 1RACB 1Q86R 3LGLA 4X9DA 3N5BB 1AWWA 2P0KA 3URGA 2LRQA 3AT1B 2LVMA 1UTIA 1USYA 1VYVA 1NJ1A 2CZ0B 1VQMT 3VYHB 4L59A 2K3YA 3VRZA 1FMWA 1N9SA 3EGUA 4H2XA 4FSSA 4HKEA 5GAN6 2J3MA 2EQMA 4XEOA 5GMKm 1RAHB 1BI0A 1YBYA 3HRSA 4LN2A 3EG2A 2W10A 1SERA 3NGPA 2DX1A 3QDRB 1AWXA 1Q82R 2A08A 1Y96B 4Z89A 1K0SA 2YUQA 3X25B 4OB0B 5GAOl 2Y4YA 4XQ3A 1YITA 4EX5A 3CCMT 4AG2C 1MMAA 1VQ7T 2RA2A 4ORZA 4ZGJB 2GTJA 3EH2A 5IHNA 1NZ9A 2QDYB 1KMMA 3QYGB 1Y0MA 2F2XA 4QQ6A 2M0OA 1E1OA 3M9QA 1NM7A 1MV3A 4AFZC 3VS4A 4LNPA 1JO8A 4FSXA 2PVGB 4TVYA 3OYGA 3FRNA 2RO0A 2DF6A 1X6GA 3E9IA 1T0JA 3LWIA 1GCQC 4LXCA 3OYBA 4JRQA 3MHXA 2A28A 2F2VA 3CC7Q 1RADB 3CMAT 2DBKA 3MPUB 4M7DF 3JCMJ 2I4LA 1VIEA 4K11A 1ZUKA 5LJ5h 1B34A 1K9MC 1VQ6T 1KHIA 1YWPA 1NYGA 2VGMA 4A63B 2NUPA 1MGQA 1SHGA 4JS4A 2H8HA 5FU6C 3KXTA 1SRYA 1WLEA 4M78B 4FT4A 5FW9A 4PJNA 4G84A 4P72C 1M9SA 2KXDA 4M7DE 4L6V5 5KYXA 2YRVA 3REAB 1QVGA 1NG2A 2K7AA 2E3CA 5FU7C 1W2BA 1E1TA 3I56A 4TQDA 2HSEB 1SPKA 4P75C 3I56Q 2AKKA 3LX7A 3A5ZB 3RMQA 3CC4Q 1EIFA 2FZCB 4Z02A 1VQ8T 1BK2A 3HHTB 4F7UA 4YRPA 1N6AA 3E19A 2KXCA 1M2VB 3ZFJA 3FDRA 2FG0A 4TVAA 4J5YA 3EG0A 1NBEB 3RR6A 1JJ2S 2JS2A 4H02A 3REBB 4M75B 2LJ0A 1UGVA 3OSVA 1UHCA 3PE0A 2BKDN 3OY9A 2DZCA 1YHQA 1JJ2P 3VQVA 4BB7A 3JCMP 1BB9A 3QZ5B 2GGRA 3CC2T 3FC3A 3QUIA 3PZCA 3NEMA 1Z9QA 2A3LA 3BFMA 3QDFA 3WXMB 4E7LA 2DILA 4YRFA 2RI2A 2O9SA 2O4XA 3G4SQ 1NJIU 1MMNA 1D0YA 4KR3A 4CC3A 1IHVA 4XEMA 3S3OA 2O4XB 4YRGA 1PYSB 4NL2A 1IHWA 2AKWB 2LQNA 5GANd 1UGQB 3VBBA 2CP2A 1VOMA 1EIYA 1FYFA 3CCLA 1YIJA 3V8KA 1K73R 3CCQQ 1HYOA 3MEWA 5I2SA 1SESA 4R55A 1JXMA 4LDUA 2ECZA 3PNWC 2RM4A 2JM9A 3IQLA 1VQ5Q 2CYZB 3NTIA 2VUBA 1X55A 2XG8D 4FM4B 1V76A 4M75A 3GLXA 4A4FA 1WHLA 1H641 4J9FA 1OPKA 2JJ9A 2MWPA 3M0UA 5D6YA 2FRWA 3EGDA 2CIMA 2F5TX 5LL6S 2E5KA 2EBPA 4D6WA 1VQKT 2ZT8A 4X5OA 1M8MA 1BIBA 2E70A 4ZNXA 2K5LA 4PJOA 4TWAA 4C8QF 1YJWQ 4DBQA 1Q7YC 2GQIA 2ZPHB 1X69A 5HK3A 2DDZA 1M5Q1 3MO8A 2ZR2A 4DQ2A 2D9TA 3PCOA 5CAIA 5FWBA 2L3QA 2KNBB 5FU7B 4X1VA 3P8TA 3PGGA 4E7ZA 4J9CA 2A7YA 3UATA 1RABB 4M75G 2G4CA 1B70A 2DU7A 3NMZC 3M54A 1G2BA 2EYXA 4LUEA 4UP9A 1I8FA 3OMCA 2MIOA 3OBWA 1H92A 1S1NA 4MZTA 4YCWA 1TU0B 2LQ8A 1W2BP 2OAUA 1VQLT 3CCUT 1Q81C 4FCYA 1OEBA 1WX6A 3QO3A 1C0AA 4PJOE 1M4ZA 2EKOA 1H4TA 1R0BG 4NL3A 4X34A 1SKUB 3EG9B 1CKAA 1XNIA 3CQTA 2CDTA 2V1RA 5EG2A 1QVFS 3HL8A 4M78G 1PKSA 3CPWA 5LJ3h 1E24A 2Z0WA 2X51A 4M77B 5GAMg 7AT1B 2CP5A 3LWHA 4PJJA 3CC4A 3CPFA 4ZGDB 2ROLA 2CUDA 3QJ6A 1VYTA 4ANJA 3P8VA 2HL3A 3RACA 2A36A 4L5GA 2M02A 3VKIA 4BY6C 1WGSA 2QQSA 2QG9B 3OYMA 1YITQ 4HT9A 3CCET 3IG2A 4FT2A 4G85A 3MP1A 2KRSA 3G71T 3RERA 2E6NA 3W3SA 1ZX6A 2CZ7B 4HCZA 2DXBA 2I4MA 1KQ2A 4ME7A 3G6EQ 2QXFA 2HKQB 2YUPA 1I5LA 1SF9A 3REXA 2MWOA 3P8DA 3NTHA 2DE0X 2KE9A 2EWNA 2BIVA 2KI7A 1BI2A 4C5EA 3S3NA 3CCJA 4M77F 3EG9A 1QCFA 3NPFA 4P71A 4CH3A 1I4K1 4HVVA 1VQ6Q 4AFUC 3PIPA 1RAFB 3BW1A 4PJOD 1ZSGA 3QJYA 3PVQA 1YGBA 2DKGA 2XICA 3NELA 4JZ3A 2R58A 2HNIA 4ATOA 5E3IA 4MDWA 4GLMA 4F14A 5HCKA 4ELYC 2DERA 1L0WA 4N0AA 3I5RA 1EFNA 3TCJA 2CZ1B 3CCLT 1QW1A 3TQ7P 2JXBA 2GQVA 5C6SA 2I2LA 1VQKA 1D1CA 4KUDK 4XTWA 5A0LA 1MHNA 2DL3A 1QP2A 5LJ5g 2VV5A 3OW2A 4YRKA 4OMMA 2RQRA 1WA7A 2K5IA 2KROA 4FYVB 1PNJA 1N8RC 3RKYA 1RAIB 3JB9F 4M78C 3R6NA 1YCSB 2FYKA 4BI4A 4IURA 1K8AC 3BE3A 4M7AF 3A32A 1Q86C 3OYDA 1VQPQ 3OYEA 3C0CA 2AMCA 2XK0A 5IH2A 2ED1A 2Q7EA 1K9MU 4C8QB 2O9VA 3TVTA 3OYIA 1I0CA 1IRXA 4OMNA 1VQNA 3MCAB 4MMLA 4JZ4A 5CKBA 4J6YA 4E7HA 4JUVA 1AWOA 3OD1A 4OMFB 1LVKA 3L2WA 4TQFA 2DXUA 4P73C 2KYMA 3OYLA 3MKDA 4C0DB 4WJ4A 3E9FA 2IG0A 3V7RA 2KEAA 2MCNA 2AIRB 1NJIC 1ABOA 4M78F 4YRNA 4E6RA 1B7TA 4HA8A 4KH1B 1PHTA 2XDBA 1JRIA 2DJQA 4JRIA 2M16A 4ZN1A 3CCVQ 2J06A 3QG1A 3VS7A 4EIKA 2X4WA 3I5SA 5KYYA 3CCRT 3UGQA 2DK3A 2DEQA 2XIDA 2FB7A 2LMJA 3VS6A 3I55Q 1VQ7Q 4K86A 3HXXA 2YHTA 2RNAA 4BE2A 3HRTA 5C0MA 3OS2A 3HFZA 1KK7A 1UG1A 1PG5B 2JOYA 3P8HA 1T3LA 1X2QA 3LH0A 3HFNA 2P0LA 4JJDA 2CREA 3S6WA 4B9WA 2ALYB 2HZYA 1YFNA 2WSEE 2JMAA 2LCSA 1E7OA 1H4VB 1PSFA 3OYFA 3I9QA 2JS0A 4F7UE 4BY6B 2F1LA 3MEYA 3JSCA 5IAYA 3NENA 2LQWA 5F5WA 3ZEHA 3HY0A 4YRJA 4OMPA 3C12A 5LJ3f 3CCVA 5IHIA 2DD4A 3CBPA 3E1SA 2KYBA 1GRIA 3CCMQ 2K3XA 1NLPC 2FPFA 4C92B 2RJCA 3JCMd 3RBBB 4P3NA 2ZNIA 2F2WA 3A7RA 4OMQA 4C8QA 2RK1A 3H9NA 2NUZA 2RQTA 1M3AA 3ICAA 4M78A 1WYDA 3C94A 4H2WA 1QKXA 4Q15A 1EVLA 4DBRA 3CMET 5KE2A 2ZXFA 3CPWS 4RMOA 4J7IA 4IUUA 4RTTA 3P8BB 5AYFA 5KYXB 3E9HA 1LPLA 3CD6Q 5HGQA 3VS0A 2JMCA 4M7AE 3OYCA 1GCPA 3GP8A 2COWA 1KJWA 1LCKA 2ZTGA 4TVAB 3RIRA 2ZINA 2KDSA 1M2VA 2LX7A 1YJNA 3CC4T 3BDUA 4FW1A 3GF5A 3TSWA 1RAEB 3HY1A 4K88A 2EYZA 3QIIA 2DBMA 2EGEA 2CGHA 4DBHA 3CCJQ 1BBUA 1M90C 2LZ6B 4TVWA 3CXCS 3EFRA 2X4XA 2Y4XA 3X26B 2E5QA 5I22A 1HC7A 1WXTA 1QF6A 4F17A 2RF0A 3M59A 3J81E 4M77A 3CMAA 1C1AA 3HXZA 4DPGA 1M30A 3UGTA 1UGPB 3CCEA 3M56A 1VQNT 3CD6A 8AT1B 5FROA 1VQMA 1R8OB 4XU0A 1YHQQ 5GANj 2XGTA 4XU2A 1UE9A 3KUFA 3SWNC 3JCMV 4PK4A 2ARUA 2DD5A 4M77E 3V8JA 3RNJA 3EG3A 1G8XA 2COYA 1Y07A 2KBTA 2KMTA 1ZSZB 2EFIA 1ABQA 3G7ZA 2JN0A 1G5VA 2DMOA 1GXIE 1IO6A 4YRLA 4FYYB 2LCCA 4ZIBA 2KK4A 1KIKA 3A31A 3JCMe 4J6WA 1YI2Q 5K1PA 4DEYA 5CVIA 2F69A 1K8AU 2ZIMA 3CCRA 4PNOA 3X24B 4OLFA 1B8AA 2O88A 2X3WD 1FXXA 4CC4B 4CS3A 1TUDA 2KRNA 1X75C 2DEUA 4XTYA 1Q81R 5CK9A 2EVRA 1NYFA 1VQ4T 1M8VA 4PJMA 3VRYA 2PQWA 2WACA 1UGSB 3ERRA 4M7DC 4C5IA 3DLLA 2YUNA 1KC8C 2ED0A 2KAFA 3M4YA 4O5VA 1IZ6A 4RTZA 4PJOB 1M3CA 2QQRA 3GOXA 1BKBA 4XTVA 4QT7A 1WYXA 2EIFA 5CCAA 5I11A 1UB4A 1U1SA 3HFOA 2H3EB 4D8DA 4K87A 1ZSZC 3FEOA 4LUDA 1ADJA 2LJ1A 1OYXA 4YROA 4XTZA 1VQOQ 1UUEA 1U1TA 4J9EA 4ZGEB 4CS2A 1IGQA 3OYYA 4J15A 2FO0A 2QGFB 2QDLA 5KYNA 1X54A 4H2XB 2QAZA 2OTJQ 4R0KA 3C95A 2Q7GA 1AD5A 4M78D 1GFDA 1TH7A 2NYSA 2YRDA 3CMEA 4HVUA 1PD1A 1LOJA 4KH0B 1O75A 1GBRA 2EJFA 3KFUA 3H41A 3FJ5A 2JTMA 1EIYB 2JVVA 4M7AB 3L42A 2DXCA 2JTEA 2W0ZA 4YRRA 4XU1A 4TTVA 1A0NB 4OB1B 3HFZB 2VB6A 3PT9A 3T9NA 2ENMA 4CC7A 5A0DA 3CMAQ 3CC7T 1TXQA 4PFPA 2DTOA 1ZQ1A 2ZPEB 2LP5A 1YHQT 3DB4A 4C8QE 2RQUA 4M75D 3MEAA 1EX4A 2KRMA 3VUZA 2E10A 2GCXA 3CCSA 4LDYA 4O6JA 3D7SB 4RQEA 2K9GA 2K2VA 3Q1JA 4H2TA 2HSPA 3EHRA 1ZA2B 5GAOm 1K73U 2HQEA 3OS0A 2YUOA 2MF2A 2E4HA 4YRCA 2E41A 5D6WA 2OAWA 2XTIA 1VYUA 1TS9A 3EH1A 5GAMh 1UDLA 4LNSA 3L1AA 2OJ2A 4J9IA 1N5ZA 5GAOr 4C0DC 1BI1A 4KGZB 2DNUA 4QVDA 1G51A 2DXTA 2EQJA 4RTWA 4YTLA 4E7SA 3JCMQ 5L23A 2QYZA 4UP7A 2K57A 2DIGA 4PHCA 1FX7A 3OBYA 2AK5A 2C06A 1PD0A 4BD3A 1JB0E 1QP3A 2SRCA 3QO5A 1YJ9Q 2LQKA 3A8MB 3NETA 4YYEA 4C0GA 4HWPA 2ZZEA 5KNNA 4J8OA 1EQRA 2A0FB 1AT1B 3LH5A 1UECA 4F7UB 3E2UA 4LDXA 1IL2A 1TUCA 3ULRB 4TVRA 2HBWA 2X4YA 3M4PA 3G4ST 3QXEB 3VS3A 1VQLA 2J3LA 3A8LB 1UFFA 2RHIA 3DSQA 4DOWA 3JB9G 4H2SA 4IUTA 2VKNA 1N9RA 4GY5A 1Q7YU 2ZZDA 4C92C 5FU6B 3M4GA 1NYQA 4H2VA 2QQBA 3QO8A 4BACA 2DFUA 1W66A 3X28B 4PFOA 2KT1A 4J9GA 3H8ZA 2ARSA 3META 2AMCB 4RUGA 1NJ8A 1D1BA 2RJEA 2IY5B 3M55A 2FEIA 2L5QA 1MMDA 3DLMA 2RHUA 2ROTA 4PJOG 2JT4A 2AHJB 3DB3A 1ZSZA 1WHJA 3CEYA 1VQLQ 3RMSA 1B7YB 1VUBA 3EHQA 2DQ3A 2CH4W 3CBMA 2LC4A 1VQPA 1Q81U 3EG1A 5GAOq 2ZPGB 2LNVA 4A53A 1T3SA 4E2FB 3UFGA 5GANh 2DL7A 1NJ2A 3A74A 2GFUA 2ZGWA 2RHYA 3LW5E 1GCQA 1JBMA 2HD0A 1K9MR 1X2GA 2KY9A 3OQ5A 4CI0C 3CC7A 1X43A 1B76A 2X3XD 3L2VA 5CO7A 3FIFA 1B34B 1OULA 4HVWA 4C5GA 4FU6A 4OMLA 3QYHB 1KMNA 3ZBDA 3I35A 1AZEA 3PVLA 1KFZA 5L8RE 3E9GA 3M0TA 1Z7MA 4LVKA 4N4HA 4M77G 4LVJA 4BUGA 8ATCB 1TSFA 4C5HA 2ABLA 4N4GA 4J9HA 1Q86U 4LD9K 3OW2P 1QMCA 4YRQA 4RMFA 4HWRA 1U06A 2VVKA 3UWNA 4HCKA 2P0QA 5GMKh 2FHDA 3SB2A 5CKEA 2YLBA 5DY9A 1YJ9T 3R6OA 4QQDA 1QVGS 1M90R 5GANe 1F1BB 12ASA 1ZLMA 3OYJA 1KC8U 2KSSA 4J83A 5J26A 2CH4A 2M1HA 4FL6A 2ZR3A 2RHZA 3MEVA 4Q5WA 3J7AF 1QWEA 3LSQA 3JCMX 2EJ9A 3MF1A 3G4SA 1OZ3A 2DA9A 1WDXA 2FPDA 4M7DB 2LTOA 2ZPBB 2DZ9A 2KT8A 3M58A 3HPWA 5J39A 1NJ5A 4Y91A 5LJ3g 1B7YA 4BE1A 2P5IA 2OTLQ 1IREB 4C92A 4BE0A 3BDLA 1KD1R 1N27A 2G3RA 1VA7A 2ZT7A 1HD3A 2M0YA 5LJ5d 4KT0E 3FB9A 3I55T 3CCMA 5CKHA 2ALYA 1UEBA 1PYSA 2K5FA 5IN1A 2ZNJA 1D0XA 3L2ZA 1CSKA 1QWFA 5C52B 4M7AA 1O9SA 2HL5C 1K1ZA 2L0AA 2C0OA 4CRIA 4F7UF 4QW2A 5DLQE 4XU3A 2MYSA 1WJSA 4AH6A 5DLOA 1KQ1A 1SSFA 4CS4A 2V8KA 4P71C 3J80E 6AT1B 3TSZA 1BIAA 3ME9A 2K2MA 1JEGA 3JCMf 4M7DG 2VWFA 3EFOA 1M27C 2PU9B 1WIEA 4RQFA 2CT4A 1I1JA 2MOXA 4CC2A 4KGXB 4JJNK 3RL6A 1YWOA 3QO7A 4KGVB 4E7JA 1SRLA 4PFZA 1S72T 1X2HA 2KVQG 3PIOA 2HCKA 3BJUA 5GMKi 2OI3A 4OGEA 4RG2A 1ACMB 1QE0A 4J7FA 4JLGA 1BYMA 3G71Q 4CH6A 3JB9J 1V1CA 4HWOA 4NCXA 1K76A 2C0TA 1M1FA 1U3OA 3H6ZA 2DLPA 4WF2A 5FRNA 4KQEA 4P73A 3CMEQ 4PL6A 2JUFA 5ECAA 4EDUA 4KR2A 4C8QD 4ESRA 11ASA 4J9BA 1GL5A 1USYC 3SEMA 2OTJA 5LJ5e 4PG3A 2DU5A 3L4GB 3A5ZA 5CQYA 2Q7HA 2QA4T 3OA6A 5GAMd 2HQXA 4ELZC 1VQNQ 2CZ6B 5GMKl 1TTHB 1I81A 4KULA 1HK9A 4FYWB 3VS5A 2XKOC 5CR2A 1M90U 4MDXA 2CP3A 1WQWA 3CC2A 1MNDA 2RHSA 2ARTA 4PLIA 4RTYA 3GNGA 3H0HA 3O5ZA 2QQ9A 2YRCA 2COZA 1NJIR 1K8AR 2EL9A 1QKWA 1X01A 1M1GA 2CS7A 2E3IA 2IY5A 4RKUE 5GAN3 1QVFA 1FMVA 4JDSA 5GAN4 1VQ8A 4HXJA 2PZ1A 1FWZA 2I0NA 3A8HB 4YP0A 1WJRA 4IUPA 3CD6T 3MEUA 1S72A 4FIBA 2P4TA 2DL8A 3RGLA 3KBGA 3REUA 4ZTJA 4HT4A 4P3OA 2D6FA 2C8MA 4IKFA 2K3BA 4IIOA 2HQHA 3MP6A 3V7SA 2EYQA 1VQ6A 4LVMA 3JCMW 3VQYA 1LNXA 4N0AC 5GAN5 2AT1B 2EGCA 3SWNB 4II1A 2ZT5A 1AVZC 4EMKC 4EPCA 3H0IA 3UT1A 1R77A 4HWTA 4M75C 2G6FX 1NPPA 2BTTA 1B3QA 2YSQA 1UJYA 4O2DA 3G1JA 3CCSQ 1EFWA 3OYKA 1OI1A 1TOVA 2O2OA 2DIQA 1IXDA 1RUWA 2V8IA 1KQSS 1X2KA 2D1XA 5D7UA 1G3SA 4IIMA 3SHWA 1Y57A 1SETA 1BI3A 1B07A 2H3JA 3PTAA 3UDCA 1I07A 1CKBA 3CXCP 1SHFA 3QPHA 2E64A 2GTOA 1VQ9T 1G5IA 2IIMA 3AHUA 3NHNA 1YB3A 2EQKA 1ATIA 4M75F 5GAOn 2OTJT 1KD1U 1J3TA 2KR3A 5GANg 5HK0A 2A37A 3L2QA 3OS5A 1Q82U 1XTDA 3JB9I 2HAXA 1YJNT 3OMGA 4MZMA 1Y96A 2LX9A 2PTKA 4DBFA 4HWSA 3TREA 3QNEA 2PMFA 2X4JA 1TUGB 1PKTA 4M4ZA 3NTKA 3OW2S 5I2MA 3PMTA 2IPOB 2PMEA 2V26A 1FMKA 4UC4A 3HXUA 2QA4A 2I4NA 2JW4A 4RTVA 3QSUA 2J6KA 1R0CB 4MZPA 3A7UA 5LJ5f 3HRIA 1X27A 1GBQA 2LNHB 4OF1A 1LYLA 1W6XA 3KFVA 4A4EA 3M4QA 3HRUA 1ZBXA 4EMKA 3JB9D 4RDXA 2ZT6A 3JAME 2DVJA
chains in the Genus database with same CATH topology
5K1XA 3QTCA 1WU7A 2LCLA 1VQZA 4LD6A 4C92G 3HRKA 2ZIOA 4GLKA 4OB2B 4E7KA 2DTHA 5HY6A 4JS5A 2GFAA 3HP9A 3MQZA 2R57A 1VQOT 2VXEA 1YJWA 3OS1A 4P5NA 4P74C 2P0PA 1M1KC 4H2YA 4PJOF 1KHCA 2DVEA 4A4HA 3FJPA 4QQGA 2PVDB 2VC8A 3IKLA 3VYGA 3GIBA 1H4SA 5C51B 3CCJT 3UH0A 3CMQA 4PLLA 1EOVA 4ZTUB 1HTTA 3O8VA 4NOYA 2A8EA 2FL7A 4M7DA 1WPYA 2QTXA 5GAMf 4WJ3M 4EMKB 4C8QG 4M7AG 2OTLA 3OYNA 1P92A 2RB6A 1RIQA 3QZ9B 5GAMe 2EAYA 2DO3A 2QHTA 2XDDA 1KOGA 3TEHA 3JB9H 1V29B 3IKMB 1H3ZA 3JCMb 2LDMA 4ZTZB 5FLXE 1G3YA 4C0ZA 1K73C 4QVZA 2DTIA 2ZCFB 5GANf 1ZHIA 2EQUA 4MMKA 4VUBA 3SDZA 5CIUA 3FLGA 4R56A 3V8LA 3INZA 3WQZA 3M53A 2IVWA 4C92E 3R07A 4BI8B 4P74A 2JZ2A 3VJPA 5M9OA 1ADYA 2L3RA 4RCCA 2I4OA 2VXFA 1G3WA 2E5AA 2RI5A 4KUIA 3HFVA 3HXVA 5ELOA 4OP0A 2QI2A 3A7AA 4E51A 3F70A 4X9CA 1D3BA 1GGMA 2FVUA 4PJOC 2OTLT 4UP8A 4Q6GA 4C92F 1PSEA 4KBMB 3JRZA 2O01E 5CKFA 1KQSA 2CJ9A 2MAMA 1VQOA 1YFRA 4BDYA 4XTXA 4XAXB 2DPPB 3QBYA 3CCVT 4YCUA 4P72A 4YRSA 3LGFA 1OZ2A 3PCOB 4EMHA 3LC0A 1YJWT 3SFMA 4EO4A 2R5MA 3MP8A 1NYRA 4QVCA 2XDPA 1B70B 3RESA 4A54A 2Q5IA 1YJ9A 3S3MA 4OB3B 3VUBA 3PFSA 3VQWA 2E1HA 2Y90A 4OVAA 3TEHB 3HKSA 4M77D 3IALA 4DA4A 1UGRB 2CJAA 3SD4A 1YI2A 1XOVA 5C53B 1Q82C 5GAMj 1U8RA 4NS5A 2KQWA 1RI0A 2QHSA 3HTZA 3RF1A 4YPFA 3X20B 4YRIA 2X35A 4H2UA 1N9WA 5KH6A 4BI3A 3M57A 5KE3A 3OSSC 5D6XA 5GMKj 2HBPA 3LSSA 3HSBA 5ELNA 1ASZA 4HCBA 5KCOA 2CKKA 3MF2A 3UPUA 1NPRA 1WQ7A 3TEGA 4M7AD 2LT1A 2RD1A 5GAN8 3I55A 2BUDA 3LYIA 2R5AA 2ZPFB 4HCCA 2E6ZA 3CCQT 2CJBA 2AKWA 4E47A 4BWAA 1VQ5A 5CQXA 1RL2A 1W4SA 3HXWA 4JRKA 4UPAA 5GAN7 3CBOA 3G71A 1NE8A 3TEEA 2XU8A 4JLIA 1VIFA 3VQXA 4V2SA 1VQ4A 2MI6A 2DQ0A 1ASYA 2XD0A 5FRMA 3PMIA 2RJFA 3BY7A 2E12A 4ZTFA 5LJ5j 2XI9A 2EJGA 2JTFA 4YRTA 4J6XA 2QEXA 4YCVA 4B9XA 4M77C 2PUKB 4A4GA 1E22A 4A4KA 1Y71A 1Y7XA 1M1KU 5GAOp 2DAQA 3G6ET 4CH4A 1N8RU 2Q5HA 4HT8A 3C4SA 1HXDA 1YCYA 3LLRA 3CXCA 2RJDA 5HKCA 3L2RA 2ODRC 3RKXA 1JJCA 2K4YA 4P3PA 4OGCA 2PUOB 1VQ7A 4YRMA 1VQ5T 5LJ3e 1VQ9A 4BDZA 1J5WA 4Y28E 3I56T 2ZPIB 1NNHA 2L8DA 3A8GB 1G5HA 1YFSA 1Z7NA 4C8QC 3EFSA 3GNFB 4M7AC 2VYTA 4C92D 1QVPA 4XK8E 4HVCA 2L89A 1YFTA 1DJ7B 2RHQA 1AHJB 1NJ6A 1XQHA 3OYHA 2MMPA 4P75A 3CCUA 5J3BA 2RK2A 4IUVA 2NS6A 3M5AA 4M7DD 4ZN3A 5I21A 1KG1A 2WSFE 3VV0A 4LVLA 3A8OB 4XTUA 3TU4K 5DM7R 4EMGA 4E7IA 3RUXA 4DOVA 3G6EA 5GMKe 5LJ3d 1LJOA 4L87A 2DJZA 3OYAA 1X56A 3L4GA 1X6OA 3OB9A 3P8YA 3VU3C 2PVOB 4YREA 4N4IA 5A2QE 4WI1A 2QEXT 1W2BS 3SWNA 2NLUA 3CCST 3EAEA 3GPLA 2RHQB 2E65A 2RH2A 1YI2T 1JJ2A 2RI3A 2JNGA 1EVKA 3ASKA 4CH5A 2ODRD 4LVIA 4YDQA 4C0FA 4JRPA 2C7IA 3V7CA 1WJQA 1YITT 3I7FA 4LDWA 5CKDA 4F7UG 1BBWA 2VGNA 2ZZFA 2RHSB 2D0QB 3JCMc 3L2UA 5LJ3j 1WNLA 1G3TA 1VQPT 1JJCB 2YLCA 3ER0A 2QQAA 3HXYA 2LT4A 3NFCA 4M78E 2ZZGA 2M9UA 3QHSA 3QKJA 1D3BB 4RCBA 3CCQA 2V8JA 4LDVA 2QHUA 3RKWA 5IT9E 2RHXA 3JCMh 4RG8A 5A0GA 2QHVA 2WSCE 3WVDB 3DKMA 2ZCEA 1H4QA 3WVEB 3G1ZA 2XHCA 4BW9A 5GAN2 2B8AA 3A5YA 2GF7A 5KCHA 1KD1C 4M75E 2F5KA 3TUPA 4IUQA 1YIJT 3JCMg 4PKCC 3LGLA 4X9DA 3N5BB 2P0KA 3URGA 2LRQA 2LVMA 1USYA 1NJ1A 2CZ0B 1VQMT 3VYHB 4L59A 2K3YA 1N9SA 4H2XA 4HKEA 5GAN6 2J3MA 2EQMA 4XEOA 5GMKm 1BI0A 1YBYA 3HRSA 1SERA 3QDRB 1Y96B 3X25B 4OB0B 5GAOl 2Y4YA 4XQ3A 1YITA 4EX5A 3CCMT 1VQ7T 2RA2A 4ZGJB 1NZ9A 2QDYB 1KMMA 3QYGB 4QQ6A 2M0OA 1E1OA 3M9QA 4FSXA 2PVGB 4TVYA 3OYGA 3FRNA 2RO0A 3E9IA 3LWIA 3OYBA 4JRQA 3MHXA 3CMAT 4M7DF 3JCMJ 2I4LA 1VIEA 5LJ5h 1B34A 1K9MC 1VQ6T 1KHIA 2VGMA 1MGQA 4JS4A 5FU6C 3KXTA 1SRYA 1WLEA 4M78B 4FT4A 4G84A 4P72C 1M9SA 4M7DE 4L6V5 2YRVA 1QVGA 2E3CA 5FU7C 1W2BA 1E1TA 3I56A 4TQDA 4P75C 3LX7A 3A5ZB 3RMQA 1EIFA 4Z02A 1VQ8T 3HHTB 4F7UA 4YRPA 1N6AA 3E19A 3ZFJA 3FDRA 4TVAA 4J5YA 1JJ2S 4H02A 4M75B 3OSVA 2BKDN 3OY9A 2DZCA 1YHQA 3VQVA 4BB7A 3JCMP 3QZ5B 3CC2T 3FC3A 3QUIA 3PZCA 3NEMA 2A3LA 3BFMA 3WXMB 4E7LA 4YRFA 2RI2A 2O4XA 1NJIU 4KR3A 4XEMA 3S3OA 2O4XB 4YRGA 1PYSB 4NL2A 2AKWB 5GANd 1UGQB 3VBBA 1EIYA 1FYFA 3CCLA 1YIJA 3V8KA 3MEWA 5I2SA 1SESA 4R55A 4LDUA 3PNWC 2RM4A 2CYZB 3NTIA 2VUBA 1X55A 2XG8D 4FM4B 4M75A 3GLXA 4A4FA 1H641 2MWPA 5D6YA 2CIMA 2F5TX 5LL6S 4D6WA 1VQKT 2ZT8A 4X5OA 2E70A 1BIBA 2K5LA 4PJOA 4TWAA 4C8QF 1Q7YC 2ZPHB 5HK3A 2DDZA 1M5Q1 3MO8A 2ZR2A 4DQ2A 2D9TA 3PCOA 5CAIA 5FU7B 3P8TA 3PGGA 2A7YA 4M75G 2G4CA 1B70A 2DU7A 3M54A 4UP9A 1I8FA 3OMCA 3OBWA 4MZTA 4YCWA 2LQ8A 2OAUA 1VQLT 3CCUT 1Q81C 3QO3A 1C0AA 4PJOE 1M4ZA 2EKOA 1H4TA 4NL3A 4X34A 1XNIA 5EG2A 1QVFS 3HL8A 4M78G 3CPWA 5LJ3h 1E24A 4M77B 5GAMg 3LWHA 3CC4A 3CPFA 4ZGDB 3QJ6A 3P8VA 3RACA 4L5GA 3VKIA 4BY6C 1WGSA 2QQSA 3OYMA 4HT9A 3CCET 3IG2A 4FT2A 4G85A 3MP1A 3G71T 3RERA 2E6NA 3W3SA 2CZ7B 4HCZA 2DXBA 2I4MA 1KQ2A 4ME7A 2QXFA 1I5LA 3REXA 2MWOA 3P8DA 3NTHA 2EWNA 2BIVA 1BI2A 4C5EA 3S3NA 3CCJA 4M77F 4P71A 4CH3A 1I4K1 3PIPA 3BW1A 4PJOD 3QJYA 1YGBA 2DKGA 2XICA 3NELA 4ATOA 2R58A 2HNIA 5E3IA 4MDWA 4ELYC 1L0WA 4N0AA 3TCJA 2CZ1B 3CCLT 1QW1A 2GQVA 5C6SA 2I2LA 1VQKA 4KUDK 4XTWA 5A0LA 1MHNA 1QP2A 5LJ5g 2VV5A 3OW2A 4YRKA 2K5IA 1N8RC 3RKYA 3JB9F 4M78C 2FYKA 4BI4A 4IURA 1K8AC 4M7AF 3A32A 1Q86C 3OYDA 3OYEA 2AMCA 2XK0A 2Q7EA 1K9MU 4C8QB 3OYIA 1VQNA 3MCAB 4MMLA 5CKBA 4J6YA 4E7HA 4JUVA 3OD1A 4OMFB 3L2WA 4TQFA 2DXUA 4P73C 3OYLA 4C0DB 4WJ4A 3E9FA 2IG0A 3V7RA 1NJIC 4M78F 4YRNA 4HA8A 2XDBA 1JRIA 4JRIA 2M16A 4ZN1A 3QG1A 2X4WA 3CCRT 3UGQA 2DK3A 2DEQA 2XIDA 2FB7A 4K86A 3HXXA 2YHTA 4BE2A 3HRTA 5C0MA 3OS2A 3HFZA 3P8HA 2JOYA 3LH0A 3HFNA 2P0LA 4B9WA 3S6WA 2ALYB 2WSEE 1H4VB 1PSFA 3OYFA 4F7UE 4BY6B 3MEYA 3JSCA 5IAYA 3NENA 5F5WA 3ZEHA 3HY0A 4YRJA 3C12A 5LJ3f 3CCVA 2DD4A 3CBPA 3E1SA 2K3XA 4C92B 2RJCA 3JCMd 4P3NA 2ZNIA 3A7RA 4C8QA 2RK1A 3ICAA 4M78A 1WYDA 3C94A 4H2WA 4Q15A 1EVLA 3CMET 5KE2A 2ZXFA 3CPWS 4RMOA 4J7IA 4IUUA 3P8BB 5AYFA 3E9HA 5HGQA 4M7AE 3OYCA 3GP8A 2ZTGA 4TVAB 3RIRA 2ZINA 2KDSA 4K88A 3CC4T 3BDUA 1YJNA 3GF5A 3HY1A 3QIIA 2CGHA 1BBUA 1M90C 4TVWA 3CXCS 3EFRA 2X4XA 2Y4XA 3X26B 2E5QA 1HC7A 1QF6A 3M59A 3J81E 4M77A 3CMAA 3HXZA 4DPGA 3UGTA 1UGPB 3CCEA 3M56A 1VQNT 3CD6A 5FROA 1VQMA 1R8OB 4XU0A 5GANj 2XGTA 4XU2A 3KUFA 3SWNC 3JCMV 2ARUA 2DD5A 4M77E 3V8JA 1Y07A 2KMTA 2EFIA 3G7ZA 2JN0A 1G5VA 1GXIE 4YRLA 4ZIBA 2LCCA 2KK4A 3A31A 3JCMe 4J6WA 5K1PA 5CVIA 2F69A 1K8AU 2ZIMA 3CCRA 4PNOA 3X24B 4OLFA 1B8AA 1FXXA 4CS3A 1X75C 4XTYA 5CK9A 1VQ4T 1M8VA 2PQWA 2WACA 1UGSB 3ERRA 4M7DC 4C5IA 3DLLA 1KC8C 2KAFA 3M4YA 4O5VA 1IZ6A 4PJOB 2QQRA 3GOXA 1BKBA 4XTVA 2EIFA 5CCAA 1UB4A 1U1SA 3HFOA 4K87A 3FEOA 1ADJA 1OYXA 4YROA 4XTZA 4CS2A 1U1TA 4ZGEB 3OYYA 4J15A 1X54A 4H2XB 3C95A 2Q7GA 4M78D 1TH7A 3CMEA 1LOJA 1O75A 2EJFA 3KFUA 2JTMA 1EIYB 2JVVA 4M7AB 3L42A 2DXCA 4YRRA 4XU1A 4TTVA 4OB1B 3HFZB 3PT9A 3T9NA 5A0DA 3CC7T 2DTOA 1ZQ1A 2ZPEB 1YHQT 3DB4A 4C8QE 4M75D 3MEAA 3VUZA 2E10A 2GCXA 3CCSA 4LDYA 4O6JA 4RQEA 2K2VA 3Q1JA 4H2TA 5GAOm 1K73U 2HQEA 3OS0A 2MF2A 4YRCA 2E41A 5D6WA 2XTIA 5GAMh 4LNSA 3L1AA 5GAOr 4C0DC 1BI1A 4QVDA 1G51A 2DXTA 2EQJA 4YTLA 3JCMQ 4UP7A 2K57A 2DIGA 4PHCA 1FX7A 3OBYA 2C06A 4BD3A 1JB0E 1QP3A 3QO5A 2LQKA 3A8MB 3NETA 4YYEA 4C0GA 4HWPA 2ZZEA 5KNNA 4J8OA 1EQRA 4F7UB 4LDXA 1IL2A 4TVRA 2X4YA 3M4PA 3G4ST 3QXEB 1VQLA 2J3LA 3A8LB 2RHIA 3DSQA 4DOWA 3JB9G 4H2SA 4IUTA 1N9RA 4GY5A 1Q7YU 2ZZDA 4C92C 5FU6B 3M4GA 1NYQA 4H2VA 2QQBA 3QO8A 4BACA 1W66A 3X28B 3H8ZA 2ARSA 3META 2AMCB 1NJ8A 2RJEA 2IY5B 3M55A 2L5QA 3DLMA 4PJOG 2RHUA 2AHJB 3DB3A 3CEYA 3RMSA 1B7YB 1VUBA 2DQ3A 3CBMA 2LC4A 1VQPA 1Q81U 5GAOq 2ZPGB 2LNVA 4A53A 3UFGA 5GANh 1NJ2A 3A74A 2GFUA 2ZGWA 2RHYA 3LW5E 1JBMA 2HD0A 1X2GA 2KY9A 3OQ5A 4CI0C 3CC7A 1B76A 3L2VA 5CO7A 3FIFA 1B34B 4C5GA 4FU6A 3QYHB 1KMNA 3ZBDA 5L8RE 3E9GA 1Z7MA 4LVKA 4N4HA 4M77G 4LVJA 4BUGA 4C5HA 4N4GA 1Q86U 4LD9K 4YRQA 4RMFA 4HWRA 3UWNA 2P0QA 5GMKh 2FHDA 3SB2A 5CKEA 2YLBA 5DY9A 1YJ9T 3R6OA 4QQDA 1QVGS 5GANe 12ASA 3OYJA 1KC8U 2KSSA 4J83A 5J26A 2M1HA 4FL6A 2ZR3A 2RHZA 3MEVA 4Q5WA 3J7AF 3LSQA 3JCMX 2EJ9A 3MF1A 3G4SA 1OZ3A 4M7DB 2LTOA 2ZPBB 2DZ9A 3M58A 3HPWA 5J39A 1NJ5A 4Y91A 5LJ3g 1B7YA 4BE1A 2P5IA 1IREB 4C92A 4BE0A 3BDLA 1N27A 2G3RA 2ZT7A 5LJ5d 3FB9A 4KT0E 3I55T 3CCMA 5CKHA 2ALYA 1UEBA 1PYSA 2K5FA 5IN1A 2ZNJA 3L2ZA 5C52B 4M7AA 1O9SA 4CRIA 4F7UF 4QW2A 5DLQE 4XU3A 1WJSA 4AH6A 5DLOA 1KQ1A 1SSFA 4CS4A 2V8KA 4P71C 3J80E 1BIAA 3ME9A 3JCMf 4M7DG 2PU9B 4RQFA 4JJNK 3RL6A 3QO7A 4E7JA 1S72T 1X2HA 2KVQG 3PIOA 3BJUA 5GMKi 4OGEA 4RG2A 1QE0A 4J7FA 4JLGA 1BYMA 4CH6A 3JB9J 4HWOA 4NCXA 1M1FA 3H6ZA 4WF2A 5FRNA 4KQEA 4P73A 4PL6A 2JUFA 4EDUA 4KR2A 4C8QD 11ASA 1USYC 2OTJA 2DU5A 5LJ5e 4PG3A 3L4GB 3A5ZA 5CQYA 2Q7HA 2QA4T 3OA6A 5GAMd 2HQXA 4ELZC 2CZ6B 5GMKl 1I81A 4KULA 1HK9A 2XKOC 5CR2A 1M90U 4MDXA 1WQWA 3CC2A 2RHSA 2ARTA 4PLIA 3GNGA 2QQ9A 2EL9A 1X01A 1M1GA 2CS7A 2IY5A 4RKUE 5GAN3 1QVFA 4JDSA 5GAN4 1VQ8A 1FWZA 3A8HB 4YP0A 1WJRA 4IUPA 3CD6T 3MEUA 1S72A 4FIBA 2P4TA 3RGLA 3KBGA 3REUA 4HT4A 4P3OA 2D6FA 2C8MA 4IKFA 3MP6A 3V7SA 2EYQA 1VQ6A 4LVMA 3JCMW 3VQYA 1LNXA 4N0AC 5GAN5 3SWNB 4II1A 2ZT5A 4EMKC 4EPCA 3UT1A 4HWTA 4M75C 1NPPA 4O2DA 1EFWA 3OYKA 1OI1A 2DIQA 2V8IA 1KQSS 1G3SA 1SETA 1BI3A 2H3JA 3PTAA 3UDCA 3QPHA 2E64A 1VQ9T 1G5IA 3AHUA 1YB3A 2EQKA 1ATIA 4M75F 5GAOn 2OTJT 1KD1U 5GANg 5HK0A 3L2QA 3OS5A 1Q82U 1XTDA 3JB9I 2HAXA 1YJNT 3OMGA 4MZMA 1Y96A 2LX9A 4HWSA 3TREA 3QNEA 2PMFA 2X4JA 3NTKA 3OW2S 5I2MA 3PMTA 2PMEA 4UC4A 3HXUA 2QA4A 2I4NA 3QSUA 4MZPA 3A7UA 5LJ5f 3HRIA 4OF1A 1LYLA 4A4EA 3M4QA 3HRUA 1ZBXA 4EMKA 3JB9D 4RDXA 2ZT6A 3JAME 4ZTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K1X A;  3QTC A;  1WU7 A;  4QVD A;  1G51 A;  1VQZ A;  2DXT A;  3JCM Q;  4WI1 A;  4UP7 A;  4HT9 A;  3IG2 A;  4C92 G;  3HRK A;  2ZIO A;  2K57 A;  4G85 A;  4PHC A;  2DTH A;  3RER A;  3SWN A;  3W3S A;  2I4M A;  1KQ2 A;  3QO5 A;  2VXE A;  3NET A;  4YYE A;  4HWP A;  2ZZE A;  1I5L A;  3REX A;  4P74 C;  5KNN A;  2RHQ B;  1EQR A;  2E65 A;  2EWN A;  4H2Y A;  4PJO F;  4F7U B;  1IL2 A;  2DVE A;  4M77 F;  3FJP A;  2VC8 A;  3M4P A;  4P71 A;  3IKL A;  4CH3 A;  1EVK A;  1I4K 1;  3GIB A;  1H4S A;  4CH5 A;  2J3L A;  2ODR D;  3BW1 A;  3DSQ A;  4PJO D;  3JB9 G;  4H2S A;  5C51 B;  3UH0 A;  3CMQ A;  1N9R A;  4YDQ A;  1EOV A;  2DKG A;  1YGB A;  3NEL A;  5E3I A;  4ZTU B;  2HNI A;  1HTT A;  4C92 C;  2C7I A;  3M4G A;  3V7C A;  1NYQ A;  4NOY A;  4H2V A;  3QO8 A;  4M7D A;  1W66 A;  3I7F A;  1WPY A;  2QTX A;  1L0W A;  4F7U G;  4N0A A;  2ARS A;  1BBW A;  5GAM f;  2AMC B;  1NJ8 A;  2ZZF A;  2RHS B;  2IY5 B;  4WJ3 M;  4EMK B;  2I2L A;  4C8Q G;  4PJO G;  3JCM c;  5LJ3 j;  4M7A G;  4XTW A;  1WNL A;  1JJC B;  2YLC A;  5LJ5 g;  4YRK A;  1B7Y B;  2RB6 A;  1RIQ A;  2DQ3 A;  3HXY A;  3RKY A;  3JB9 F;  4M78 C;  5GAM e;  2EAY A;  2FYK A;  5GAO q;  4M7A F;  3A32 A;  4A53 A;  4M78 E;  2QHT A;  2ZZG A;  2AMC A;  3QHS A;  3UFG A;  5GAN h;  1D3B B;  4RCB A;  1KOG A;  2Q7E A;  1NJ2 A;  3A74 A;  4C8Q B;  3TEH A;  2QHU A;  3JB9 H;  2ZGW A;  3RKW A;  3IKM B;  3JCM b;  1JBM A;  4ZTZ B;  1X2G A;  3JCM h;  4MML A;  1B76 A;  4J6Y A;  4JUV A;  2QHV A;  3OD1 A;  2DTI A;  3FIF A;  4TQF A;  5GAN f;  2DXU A;  4P73 C;  1B34 B;  2ZCE A;  4MMK A;  1H4Q A;  4WJ4 A;  1KMN A;  3V7R A;  3G1Z A;  3V8L A;  4BW9 A;  3INZ A;  3WQZ A;  5GAN 2;  3A5Y A;  4M78 F;  4C92 E;  1Z7M A;  4YRN A;  3R07 A;  4M77 G;  4P74 A;  4HA8 A;  4M75 E;  1ADY A;  3TUP A;  1JRI A;  4JRI A;  4RCC A;  3JCM g;  2I4O A;  4YRQ A;  4RMF A;  4HWR A;  2VXF A;  2E5A A;  5GMK h;  4X9D A;  3SB2 A;  3HFV A;  3HXV A;  5DY9 A;  2YLB A;  3UGQ A;  2DEQ A;  2FB7 A;  5ELO A;  4K86 A;  5GAN e;  12AS A;  3HXX A;  1USY A;  4OP0 A;  2YHT A;  3A7A A;  4E51 A;  1NJ1 A;  4X9C A;  1D3B A;  3HFZ A;  1GGM A;  2ZR3 A;  1N9S A;  4H2X A;  4PJO C;  5GAN 6;  2J3M A;  4Q6G A;  4C92 F;  4UP8 A;  4XEO A;  3LSQ A;  3HFN A;  3JCM X;  2P0L A;  5GMK m;  2EJ9 A;  3MF1 A;  4M7D B;  2CJ9 A;  1SER A;  2DZ9 A;  2ALY B;  1YFR A;  1NJ5 A;  4XTX A;  1Y96 B;  4P72 A;  4Y91 A;  5LJ3 g;  1H4V B;  1B7Y A;  4YCU A;  4YRS A;  2P5I A;  5GAO l;  4F7U E;  4C92 A;  4XQ3 A;  3MEY A;  4EX5 A;  3PCO B;  4EMH A;  3LC0 A;  2RA2 A;  3NEN A;  5F5W A;  3HY0 A;  4YRJ A;  2ZT7 A;  4EO4 A;  5LJ3 f;  1NYR A;  4QVC A;  1KMM A;  5LJ5 d;  3FB9 A;  1E1O A;  1B70 B;  3RES A;  2ALY A;  4A54 A;  2Q5I A;  4TVY A;  1PYS A;  3VQW A;  4C92 B;  2ZNJ A;  3JCM d;  3L2Z A;  3E9I A;  2E1H A;  4P3N A;  2Y90 A;  5C52 B;  4M7A A;  2ZNI A;  3A7R A;  4C8Q A;  4M77 D;  3TEH B;  4F7U F;  4M7D F;  3IAL A;  3JCM J;  4M78 A;  4XU3 A;  3ICA A;  1WYD A;  2CJA A;  2I4L A;  4AH6 A;  4H2W A;  1KQ1 A;  4CS4 A;  4Q15 A;  1EVL A;  4P71 C;  2ZXF A;  1BIA A;  5LJ5 h;  4M7D G;  3JCM f;  5C53 B;  1B34 A;  3E9H A;  5GAM j;  5HGQ A;  4RQF A;  4M7A E;  1MGQ A;  1SRY A;  2QHS A;  1WLE A;  3HTZ A;  3RL6 A;  4M78 B;  2ZTG A;  3RF1 A;  4TVA B;  3QO7 A;  3RIR A;  2ZIN A;  4YPF A;  4YRI A;  4G84 A;  4H2U A;  1N9W A;  4P72 C;  4K88 A;  3BDU A;  1X2H A;  4M7D E;  3HY1 A;  3BJU A;  5GMK j;  5GMK i;  2CGH A;  1BBU A;  4TVW A;  1QE0 A;  3HSB A;  2E3C A;  3LSS A;  3EFR A;  5ELN A;  4CH6 A;  3JB9 J;  1ASZ A;  1E1T A;  4TQD A;  4HWO A;  4NCX A;  1HC7 A;  3MF2 A;  1QF6 A;  4P75 C;  4M77 A;  4WF2 A;  1WQ7 A;  4KQE A;  4P73 A;  3HXZ A;  3TEG A;  4DPG A;  3UGT A;  4F7U A;  4M7A D;  4YRP A;  4KR2 A;  2RD1 A;  4C8Q D;  11AS A;  4TVA A;  4J5Y A;  1USY C;  2DU5 A;  5LJ5 e;  4PG3 A;  5GAN 8;  4H02 A;  3L4G B;  4XU0 A;  3A5Z A;  4M75 B;  5GAN j;  2XGT A;  2Q7H A;  4XU2 A;  2DZC A;  3SWN C;  3JCM V;  5GAM d;  3VQV A;  3JCM P;  2ARU A;  3QUI A;  4M77 E;  3V8J A;  5GMK l;  3PZC A;  3NEM A;  1I81 A;  2CJB A;  1HK9 A;  2AKW A;  2JN0 A;  3BFM A;  4BWA A;  1WQW A;  4YRL A;  4ZIB A;  3HXW A;  4YRF A;  3A31 A;  4JRK A;  4J6W A;  3JCM e;  4UPA A;  5GAN 7;  2RHS A;  2ART A;  5K1P A;  2ZIM A;  4PNO A;  4KR3 A;  4JLI A;  3VQX A;  4OLF A;  4V2S A;  2DQ0 A;  4XEM A;  1B8A A;  1ASY A;  4YRG A;  1PYS B;  2EL9 A;  1X01 A;  4NL2 A;  2AKW B;  4CS3 A;  2IY5 A;  3BY7 A;  5GAN d;  5GAN 3;  3VBB A;  4XTY A;  1M8V A;  5GAN 4;  5LJ5 j;  1FYF A;  1EIY A;  3ERR A;  4M7D C;  3V8K A;  4YP0 A;  2EJG A;  4YRT A;  4J6X A;  1SES A;  4PJO B;  3RGL A;  4YCV A;  3REU A;  4XTV A;  2RM4 A;  4P3O A;  4M77 C;  2C8M A;  1U1S A;  3HFO A;  1X55 A;  4K87 A;  1E22 A;  3V7S A;  1ADJ A;  4M75 A;  3JCM W;  5GAO p;  4YRO A;  4XTZ A;  1LNX A;  1H64 1;  1U1T A;  3VQY A;  4N0A C;  5GAN 5;  4CH4 A;  4CS2 A;  3SWN B;  2ZT5 A;  2Q5H A;  4J15 A;  4EMK C;  2CIM A;  4HT8 A;  1HXD A;  1YCY A;  4HWT A;  4M75 C;  1X54 A;  4H2X B;  2ZT8 A;  4X5O A;  2Q7G A;  1BIB A;  2ODR C;  4M78 D;  4O2D A;  4PJO A;  3RKX A;  4TWA A;  1EFW A;  4C8Q F;  1TH7 A;  1JJC A;  4P3P A;  1LOJ A;  2DDZ A;  1M5Q 1;  2EJF A;  3KFU A;  2ZR2 A;  4DQ2 A;  3PCO A;  5CAI A;  1EIY B;  4M7A B;  4YRM A;  5LJ3 e;  3P8T A;  1SET A;  3PGG A;  1J5W A;  4YRR A;  1NNH A;  4M75 G;  2E64 A;  4XU1 A;  2G4C A;  4TTV A;  1B70 A;  1G5H A;  2DU7 A;  3HFZ B;  1G5I A;  1YFS A;  4UP9 A;  3AHU A;  1Z7N A;  1I8F A;  4C8Q C;  3EFS A;  4M7A C;  1YB3 A;  1ATI A;  4C92 D;  4M75 F;  2DTO A;  5GAO n;  4HVC A;  5GAN g;  4C8Q E;  4YCW A;  4M75 D;  1YFT A;  3JB9 I;  2RHQ A;  2E10 A;  1NJ6 A;  3QO3 A;  1C0A A;  1Y96 A;  4PJO E;  4HWS A;  1H4T A;  4RQE A;  4NL3 A;  4P75 A;  3QNE A;  2PMF A;  4H2T A;  4M7D D;  2PME A;  5I21 A;  4M78 G;  3HXU A;  5GAO m;  4XTU A;  5LJ3 h;  2I4N A;  4EMG A;  1E24 A;  3RUX A;  4M77 B;  3QSU A;  5GAM g;  5GMK e;  3A7U A;  5LJ5 f;  3HRI A;  4YRC A;  2E41 A;  2XTI A;  5LJ3 d;  1LJO A;  1LYL A;  4L87 A;  5GAM h;  4LNS A;  2DJZ A;  3L1A A;  1X56 A;  3L4G A;  3M4Q A;  5GAO r;  3P8Y A;  4EMK A;  3JB9 D;  3VU3 C;  4RDX A;  3P8V A;  4YRE A;  2ZT6 A;  3RAC A; 
#chains in the Genus database with same CATH topology
 5K1X A;  3QTC A;  1WU7 A;  2LCL A;  1VQZ A;  4LD6 A;  2PNI A;  2FRY A;  1T0H A;  4C92 G;  3HRK A;  2ZIO A;  4GLK A;  3THK A;  2DRK A;  4OB2 B;  4E7K A;  2DTH A;  5HY6 A;  3RDV A;  4JS5 A;  2GFA A;  4AG1 C;  3HP9 A;  3MQZ A;  2R57 A;  4JJC A;  1VQO T;  2VXE A;  1YJW A;  3OS1 A;  4P5N A;  4P74 C;  4PJL A;  2P0P A;  1M1K C;  3QWY A;  4H2Y A;  4RTU A;  4PJO F;  1Q95 G;  1HJD A;  1KHC A;  2DVE A;  1QQJ A;  3FJP A;  4A4H A;  4QQG A;  2PVD B;  2VC8 A;  3IKL A;  2NUP B;  3VYG A;  3GIB A;  1H4S A;  4KRT A;  1WLP B;  4J9D A;  5C51 B;  3CCJ T;  1NEG A;  3UH0 A;  3CMQ A;  1MNE A;  4PLL A;  1EOV A;  4ZTU B;  1HTT A;  3O8V A;  4NOY A;  2A8E A;  1VQM Q;  2FL7 A;  2YT6 A;  4M7D A;  5GJW B;  1TWB A;  1RLP C;  1WPY A;  1OU9 A;  2QTX A;  5GAM f;  3M0P A;  1RLQ C;  4WJ3 M;  1E6G A;  4EMK B;  4C8Q G;  4M7A G;  5KYU B;  2OTL A;  3OYN A;  4QKU A;  1P92 A;  2RB6 A;  1RIQ A;  1JU5 C;  3QZ9 B;  5GAM e;  2EAY A;  2DO3 A;  1SSH A;  1WHK A;  2AZS A;  2RN8 A;  2QHT A;  2XDD A;  1YIJ Q;  1KOG A;  3TEH A;  3JB9 H;  1V29 B;  4RTX A;  3IKM B;  1H3Z A;  3JCM b;  1H3H A;  2LDM A;  1WFW A;  4ZTZ B;  2YDL A;  5FLX E;  1G3Y A;  4C0Z A;  1K73 C;  2P4R A;  4QVZ A;  2DTI A;  2ZCF B;  3EFO B;  5GAN f;  1ZHI A;  2EQU A;  4MMK A;  4VUB A;  3SDZ A;  3VS1 A;  1ARK A;  5CIU A;  3FLG A;  4R56 A;  3V8L A;  3INZ A;  3WQZ A;  5IHK A;  1AZG B;  3M53 A;  2IVW A;  4C92 E;  1H8K A;  1WXU A;  4BI8 B;  3R07 A;  2RQW A;  4P74 A;  2JZ2 A;  2HKN A;  3VJP A;  5M9O A;  1ADY A;  2L3R A;  4RCC A;  2I4O A;  2VXF A;  1G3W A;  2E5A A;  2RI5 A;  4KUI A;  3HFV A;  3HXV A;  1D0Z A;  1WZO A;  1YN8 A;  5ELO A;  2DM1 A;  2ATC B;  4OP0 A;  9ATC B;  2QI2 A;  5IXB A;  2BZX A;  3A7A A;  4E51 A;  3F70 A;  4X9C A;  1D3B A;  1Q7Y R;  1GGM A;  2FVU A;  4PJO C;  2OTL T;  1WI7 A;  4UP8 A;  4Q6G A;  4C92 F;  1PSE A;  4KBM B;  1BU1 A;  3JRZ A;  2O01 E;  1D1A A;  1W1F A;  5CKF A;  1KQS A;  2CJ9 A;  2MAM A;  1VQO A;  1YFR A;  4BDY A;  4XTX A;  4XAX B;  2DPP B;  3QBY A;  3CCV T;  4P72 A;  4YCU A;  4YRS A;  3LGF A;  1OZ2 A;  1K0X A;  2EKH A;  3PCO B;  4EMH A;  3LC0 A;  3M0Q A;  1YJW T;  3SFM A;  4JJB A;  4EO4 A;  1K9A A;  1XJW B;  2J6F A;  2R5M A;  3MP8 A;  3CCE Q;  1NYR A;  4QVC A;  1OX9 A;  2XDP A;  1UJ0 A;  2NWM A;  1B70 B;  3RES A;  4A54 A;  1S72 Q;  2Q5I A;  2BE9 B;  1OPL A;  2QK0 A;  2QEX Q;  1KSW A;  3S3M A;  1YJ9 A;  1Z9Z A;  4OB3 B;  3VUB A;  2RQV A;  1OX8 A;  2J7I A;  2QAS A;  3PFS A;  1NEB A;  3VQW A;  1OQK A;  2JM8 A;  2E1H A;  2Y90 A;  4OVA A;  1WHH A;  1QCN A;  3TEH B;  3HKS A;  4M77 D;  5KYW A;  3IAL A;  4DA4 A;  3M0R A;  1UGR B;  2CJA A;  2LJ3 A;  1YP5 A;  1MV0 B;  2CT3 A;  2MK5 A;  3SD4 A;  2V1Q A;  1YI2 A;  1XOV A;  2NUT B;  5C53 B;  1Q82 C;  5GAM j;  1U8R A;  4NS5 A;  1X6B A;  1OOT A;  2KQW A;  2P84 A;  2YWW A;  4F04 B;  2MPX C;  1RI0 A;  2QHS A;  2CP7 A;  3HTZ A;  5KYY B;  3RF1 A;  3UA7 A;  4YPF A;  3X20 B;  4YRI A;  1MMG A;  2X35 A;  4H2U A;  2SEM A;  2FZK B;  1PWT A;  5KH6 A;  1N9W A;  4BI3 A;  2EGA A;  3M57 A;  5KE3 A;  1WXB A;  3OSS C;  3M0S A;  5D6X A;  5GMK j;  2HBP A;  3LSS A;  3HSB A;  5ELN A;  1ASZ A;  1VQK Q;  4HCB A;  5KCO A;  2CKK A;  3MF2 A;  3UPU A;  1NPR A;  4AFS C;  3CPW P;  1WQ7 A;  3TEG A;  4M7A D;  2LT1 A;  2RD1 A;  3H0F A;  2DL4 A;  1M1K R;  1HSQ A;  2VAS A;  4DEX A;  5GAN 8;  4D8K A;  3I55 A;  1M2O A;  2BUD A;  2L3P A;  2O31 A;  2L2P A;  3LYI A;  2R5A A;  4JPB W;  1PCX A;  2ZPF B;  4HCC A;  2E6Z A;  3CCQ T;  2CJB A;  2AKW A;  1SG5 A;  4E47 A;  2DYI A;  2QTV A;  4BWA A;  1VQ5 A;  5CQX A;  1RL2 A;  1W4S A;  1KC8 R;  3HXW A;  1BCO A;  4FYX B;  4JRK A;  4UPA A;  5GAN 7;  3CBO A;  3G71 A;  1NE8 A;  3TEE A;  2XU8 A;  1OV3 A;  4JLI A;  2HEQ A;  1VIF A;  3VQX A;  4V2S A;  1VQ4 A;  2MI6 A;  2DQ0 A;  5IXF A;  1FYN A;  1ASY A;  5GJV B;  2XD0 A;  5FRM A;  4AFQ C;  3PMI A;  1BBZ A;  2QGG A;  2RJF A;  3BY7 A;  2E12 A;  5AT1 B;  1RI9 A;  1PRM C;  1D09 B;  2J05 A;  4ZTF A;  5LJ5 j;  2DET A;  2XI9 A;  2E3H A;  1K4U S;  2EJG A;  2JTF A;  4WCI A;  4YRT A;  4J6X A;  2HDA A;  4Z88 A;  2NUT A;  2QEX A;  4YCV A;  4B9X A;  4M77 C;  3ZL7 C;  2PUK B;  2BE7 D;  2EYW A;  2CSQ A;  4A4G A;  1E22 A;  3A98 A;  2RPN A;  1Y71 A;  1Y7X A;  4A4K A;  1AEY A;  1M1K U;  5GAO p;  2DAQ A;  3G6E T;  4CH4 A;  1N8R U;  2Q5H A;  3UF4 A;  3GBQ A;  4HT8 A;  3C4S A;  1HXD A;  1YCY A;  3LLR A;  4LE9 A;  1JQQ A;  3CXC A;  2RJD A;  5HKC A;  3L2R A;  1ZBJ A;  1RAA B;  2ODR C;  3RKX A;  2D0N A;  1JJC A;  2K4Y A;  2K79 A;  4P3P A;  4OGC A;  2PUO B;  1RAG B;  1VQ7 A;  2X9H A;  1QLY A;  4AT1 B;  4YRM A;  1VQ5 T;  5LJ3 e;  1VQ9 A;  4BDZ A;  2RMO A;  4WTO B;  2DYB A;  1J5W A;  4Y28 E;  3I56 T;  2ZPI B;  1NNH A;  1ZUY A;  2L8D A;  3A8G B;  1G5H A;  2EPD A;  1YFS A;  2FPE A;  1Z7N A;  4C8Q C;  3EFS A;  3GNF B;  4M7A C;  2VYT A;  4C92 D;  1QVP A;  4XK8 E;  4HVC A;  2L89 A;  1C0M A;  1YFT A;  1QCO A;  1DJ7 B;  1SEM A;  2RHQ A;  1AHJ B;  1I5O B;  3QWX X;  1NJ6 A;  4AMC A;  1XQH A;  3OYH A;  2M51 A;  2MMP A;  3UA6 A;  2DRM A;  2KGT A;  4P75 A;  3CCU A;  5J3B A;  2RK2 A;  4IUV A;  2NS6 A;  3M5A A;  3CCU Q;  1YJN Q;  4M7D D;  4ZN3 A;  5I21 A;  1KG1 A;  2CSI A;  2WSF E;  3VV0 A;  4LVL A;  3A8O B;  4XTU A;  3TU4 K;  5DM7 R;  2BZY A;  4EMG A;  1G83 A;  4E7I A;  3RUX A;  4DOV A;  1EZZ B;  3G6E A;  5GMK e;  2AZV A;  5LJ3 d;  1LJO A;  4L87 A;  3CC2 Q;  2DJZ A;  2ZAE A;  3OYA A;  1X56 A;  3L4G A;  2B86 A;  1X6O A;  3OB9 A;  3P8Y A;  3VU3 C;  2PVO B;  4YRE A;  4N4I A;  1VQ8 Q;  1ZUU A;  5A2Q E;  1U5S A;  4WI1 A;  1WHM A;  1VQ9 Q;  2L3S A;  2EYY A;  1GFC A;  2HMA A;  2GBQ A;  2QEX T;  1OU8 A;  1W70 A;  1W2B S;  3SWN A;  4Z8A A;  2NLU A;  3CCS T;  3EAE A;  1ZA1 B;  3VS2 A;  5KYU A;  3EGX A;  2C0I A;  3HTR A;  3A1P A;  4FW2 A;  1AWJ A;  3GPL A;  2D8H A;  3MJX A;  2RHQ B;  2OX7 A;  5FWC A;  1M3B A;  2E65 A;  2RH2 A;  1YI2 T;  4Y92 A;  1JJ2 A;  2RI3 A;  2FZG B;  2JNG A;  1QVF P;  2DL5 A;  3JV3 A;  1EVK A;  2GNC A;  3ASK A;  4CH5 A;  2ODR D;  1BCM A;  4LVI A;  4YDQ A;  4C0F A;  2BZ8 A;  4JRP A;  2C7I A;  3V7C A;  1WJQ A;  1UHF A;  1YIT T;  2K6D A;  3I7F A;  1KQS P;  2EQI A;  5KYW B;  4LDW A;  5CKD A;  2CUB A;  1TG0 A;  4F7U G;  1BBW A;  2VGN A;  2ZZF A;  2D8J A;  2RHS B;  1SRM A;  2D0Q B;  1JXO A;  1MUZ A;  3JCM c;  3L2U A;  5LJ3 j;  1WNL A;  1G3T A;  1VQP T;  1JJC B;  2YLC A;  3ER0 A;  1VQ4 Q;  2AKL A;  2QQA A;  3HXY A;  2LT4 A;  1QVG P;  4F16 A;  3EGX B;  2YXY A;  3NFC A;  2EW3 A;  4M78 E;  1AOJ A;  2ZZG A;  1N8R R;  2M9U A;  1IB8 A;  3QHS A;  1YNZ A;  3QKJ A;  1D3B B;  4RCB A;  3CCQ A;  2V8J A;  4LDV A;  5EC7 A;  2QHU A;  3RKW A;  3CCL Q;  2ESW A;  5IT9 E;  2QA4 Q;  1PRL C;  2RHX A;  3JCM h;  4OMO A;  4RG8 A;  5A0G A;  1IGU A;  2QHV A;  2WSC E;  1PM3 A;  3WVD B;  3DKM A;  2ZCE A;  4GBQ A;  1H4Q A;  3EGD B;  3U23 A;  4B6M A;  3WVE B;  2J6O A;  3G1Z A;  2XHC A;  4BW9 A;  5GAN 2;  2B8A A;  3A5Y A;  1WHG A;  1C6V X;  3CCR Q;  2GF7 A;  2XMF A;  1E6H A;  5KCH A;  1KD1 C;  2CP6 A;  2CP0 A;  4M75 E;  2F5K A;  3TUP A;  4IUQ A;  1NLO C;  1YIJ T;  3JCM g;  4PKC C;  1PC0 A;  1RAC B;  1Q86 R;  3LGL A;  4X9D A;  3N5B B;  1AWW A;  2P0K A;  3URG A;  2LRQ A;  3AT1 B;  2LVM A;  1UTI A;  1USY A;  1VYV A;  1NJ1 A;  2CZ0 B;  1VQM T;  3VYH B;  4L59 A;  2K3Y A;  3VRZ A;  1FMW A;  1N9S A;  3EGU A;  4H2X A;  4FSS A;  4HKE A;  5GAN 6;  2J3M A;  2EQM A;  4XEO A;  5GMK m;  1RAH B;  1BI0 A;  1YBY A;  3HRS A;  4LN2 A;  3EG2 A;  2W10 A;  1SER A;  3NGP A;  2DX1 A;  3QDR B;  1AWX A;  1Q82 R;  2A08 A;  1Y96 B;  4Z89 A;  1K0S A;  2YUQ A;  3X25 B;  4OB0 B;  5GAO l;  2Y4Y A;  4XQ3 A;  1YIT A;  4EX5 A;  3CCM T;  4AG2 C;  1MMA A;  1VQ7 T;  2RA2 A;  4ORZ A;  4ZGJ B;  2GTJ A;  3EH2 A;  5IHN A;  1NZ9 A;  2QDY B;  1KMM A;  3QYG B;  1Y0M A;  2F2X A;  4QQ6 A;  2M0O A;  1E1O A;  3M9Q A;  1NM7 A;  1MV3 A;  4AFZ C;  3VS4 A;  4LNP A;  1JO8 A;  4FSX A;  2PVG B;  4TVY A;  3OYG A;  3FRN A;  2RO0 A;  2DF6 A;  1X6G A;  3E9I A;  1T0J A;  3LWI A;  1GCQ C;  4LXC A;  3OYB A;  4JRQ A;  3MHX A;  2A28 A;  2F2V A;  3CC7 Q;  1RAD B;  3CMA T;  2DBK A;  3MPU B;  4M7D F;  3JCM J;  2I4L A;  1VIE A;  4K11 A;  1ZUK A;  5LJ5 h;  1B34 A;  1K9M C;  1VQ6 T;  1KHI A;  1YWP A;  1NYG A;  2VGM A;  4A63 B;  2NUP A;  1MGQ A;  1SHG A;  4JS4 A;  2H8H A;  5FU6 C;  3KXT A;  1SRY A;  1WLE A;  4M78 B;  4FT4 A;  5FW9 A;  4PJN A;  4G84 A;  4P72 C;  1M9S A;  2KXD A;  4M7D E;  4L6V 5;  5KYX A;  2YRV A;  3REA B;  1QVG A;  1NG2 A;  2K7A A;  2E3C A;  5FU7 C;  1W2B A;  1E1T A;  3I56 A;  4TQD A;  2HSE B;  1SPK A;  4P75 C;  3I56 Q;  2AKK A;  3LX7 A;  3A5Z B;  3RMQ A;  3CC4 Q;  1EIF A;  2FZC B;  4Z02 A;  1VQ8 T;  1BK2 A;  3HHT B;  4F7U A;  4YRP A;  1N6A A;  3E19 A;  2KXC A;  1M2V B;  3ZFJ A;  3FDR A;  2FG0 A;  4TVA A;  4J5Y A;  3EG0 A;  1NBE B;  3RR6 A;  1JJ2 S;  2JS2 A;  4H02 A;  3REB B;  4M75 B;  2LJ0 A;  1UGV A;  3OSV A;  1UHC A;  3PE0 A;  2BKD N;  3OY9 A;  2DZC A;  1YHQ A;  1JJ2 P;  3VQV A;  4BB7 A;  3JCM P;  1BB9 A;  3QZ5 B;  2GGR A;  3CC2 T;  3FC3 A;  3QUI A;  3PZC A;  3NEM A;  1Z9Q A;  2A3L A;  3BFM A;  3QDF A;  3WXM B;  4E7L A;  2DIL A;  4YRF A;  2RI2 A;  2O9S A;  2O4X A;  3G4S Q;  1NJI U;  1MMN A;  1D0Y A;  4KR3 A;  4CC3 A;  1IHV A;  4XEM A;  3S3O A;  2O4X B;  4YRG A;  1PYS B;  4NL2 A;  1IHW A;  2AKW B;  2LQN A;  5GAN d;  1UGQ B;  3VBB A;  2CP2 A;  1VOM A;  1EIY A;  1FYF A;  3CCL A;  1YIJ A;  3V8K A;  1K73 R;  3CCQ Q;  1HYO A;  3MEW A;  5I2S A;  1SES A;  4R55 A;  1JXM A;  4LDU A;  2ECZ A;  3PNW C;  2RM4 A;  2JM9 A;  3IQL A;  1VQ5 Q;  2CYZ B;  3NTI A;  2VUB A;  1X55 A;  2XG8 D;  4FM4 B;  1V76 A;  4M75 A;  3GLX A;  4A4F A;  1WHL A;  1H64 1;  4J9F A;  1OPK A;  2JJ9 A;  2MWP A;  3M0U A;  5D6Y A;  2FRW A;  3EGD A;  2CIM A;  2F5T X;  5LL6 S;  2E5K A;  2EBP A;  4D6W A;  1VQK T;  2ZT8 A;  4X5O A;  1M8M A;  1BIB A;  2E70 A;  4ZNX A;  2K5L A;  4PJO A;  4TWA A;  4C8Q F;  1YJW Q;  4DBQ A;  1Q7Y C;  2GQI A;  2ZPH B;  1X69 A;  5HK3 A;  2DDZ A;  1M5Q 1;  3MO8 A;  2ZR2 A;  4DQ2 A;  2D9T A;  3PCO A;  5CAI A;  5FWB A;  2L3Q A;  2KNB B;  5FU7 B;  4X1V A;  3P8T A;  3PGG A;  4E7Z A;  4J9C A;  2A7Y A;  3UAT A;  1RAB B;  4M75 G;  2G4C A;  1B70 A;  2DU7 A;  3NMZ C;  3M54 A;  1G2B A;  2EYX A;  4LUE A;  4UP9 A;  1I8F A;  3OMC A;  2MIO A;  3OBW A;  1H92 A;  1S1N A;  4MZT A;  4YCW A;  1TU0 B;  2LQ8 A;  1W2B P;  2OAU A;  1VQL T;  3CCU T;  1Q81 C;  4FCY A;  1OEB A;  1WX6 A;  3QO3 A;  1C0A A;  4PJO E;  1M4Z A;  2EKO A;  1H4T A;  1R0B G;  4NL3 A;  4X34 A;  1SKU B;  3EG9 B;  1CKA A;  1XNI A;  3CQT A;  2CDT A;  2V1R A;  5EG2 A;  1QVF S;  3HL8 A;  4M78 G;  1PKS A;  3CPW A;  5LJ3 h;  1E24 A;  2Z0W A;  2X51 A;  4M77 B;  5GAM g;  7AT1 B;  2CP5 A;  3LWH A;  4PJJ A;  3CC4 A;  3CPF A;  4ZGD B;  2ROL A;  2CUD A;  3QJ6 A;  1VYT A;  4ANJ A;  3P8V A;  2HL3 A;  3RAC A;  2A36 A;  4L5G A;  2M02 A;  3VKI A;  4BY6 C;  1WGS A;  2QQS A;  2QG9 B;  3OYM A;  1YIT Q;  4HT9 A;  3CCE T;  3IG2 A;  4FT2 A;  4G85 A;  3MP1 A;  2KRS A;  3G71 T;  3RER A;  2E6N A;  3W3S A;  1ZX6 A;  2CZ7 B;  4HCZ A;  2DXB A;  2I4M A;  1KQ2 A;  4ME7 A;  3G6E Q;  2QXF A;  2HKQ B;  2YUP A;  1I5L A;  1SF9 A;  3REX A;  2MWO A;  3P8D A;  3NTH A;  2DE0 X;  2KE9 A;  2EWN A;  2BIV A;  2KI7 A;  1BI2 A;  4C5E A;  3S3N A;  3CCJ A;  4M77 F;  3EG9 A;  1QCF A;  3NPF A;  4P71 A;  4CH3 A;  1I4K 1;  4HVV A;  1VQ6 Q;  4AFU C;  3PIP A;  1RAF B;  3BW1 A;  4PJO D;  1ZSG A;  3QJY A;  3PVQ A;  1YGB A;  2DKG A;  2XIC A;  3NEL A;  4JZ3 A;  2R58 A;  2HNI A;  4ATO A;  5E3I A;  4MDW A;  4GLM A;  4F14 A;  5HCK A;  4ELY C;  2DER A;  1L0W A;  4N0A A;  3I5R A;  1EFN A;  3TCJ A;  2CZ1 B;  3CCL T;  1QW1 A;  3TQ7 P;  2JXB A;  2GQV A;  5C6S A;  2I2L A;  1VQK A;  1D1C A;  4KUD K;  4XTW A;  5A0L A;  1MHN A;  2DL3 A;  1QP2 A;  5LJ5 g;  2VV5 A;  3OW2 A;  4YRK A;  4OMM A;  2RQR A;  1WA7 A;  2K5I A;  2KRO A;  4FYV B;  1PNJ A;  1N8R C;  3RKY A;  1RAI B;  3JB9 F;  4M78 C;  3R6N A;  1YCS B;  2FYK A;  4BI4 A;  4IUR A;  1K8A C;  3BE3 A;  4M7A F;  3A32 A;  1Q86 C;  3OYD A;  1VQP Q;  3OYE A;  3C0C A;  2AMC A;  2XK0 A;  5IH2 A;  2ED1 A;  2Q7E A;  1K9M U;  4C8Q B;  2O9V A;  3TVT A;  3OYI A;  1I0C A;  1IRX A;  4OMN A;  1VQN A;  3MCA B;  4MML A;  4JZ4 A;  5CKB A;  4J6Y A;  4E7H A;  4JUV A;  1AWO A;  3OD1 A;  4OMF B;  1LVK A;  3L2W A;  4TQF A;  2DXU A;  4P73 C;  2KYM A;  3OYL A;  3MKD A;  4C0D B;  4WJ4 A;  3E9F A;  2IG0 A;  3V7R A;  2KEA A;  2MCN A;  2AIR B;  1NJI C;  1ABO A;  4M78 F;  4YRN A;  4E6R A;  1B7T A;  4HA8 A;  4KH1 B;  1PHT A;  2XDB A;  1JRI A;  2DJQ A;  4JRI A;  2M16 A;  4ZN1 A;  3CCV Q;  2J06 A;  3QG1 A;  3VS7 A;  4EIK A;  2X4W A;  3I5S A;  5KYY A;  3CCR T;  3UGQ A;  2DK3 A;  2DEQ A;  2XID A;  2FB7 A;  2LMJ A;  3VS6 A;  3I55 Q;  1VQ7 Q;  4K86 A;  3HXX A;  2YHT A;  2RNA A;  4BE2 A;  3HRT A;  5C0M A;  3OS2 A;  3HFZ A;  1KK7 A;  1UG1 A;  1PG5 B;  2JOY A;  3P8H A;  1T3L A;  1X2Q A;  3LH0 A;  3HFN A;  2P0L A;  4JJD A;  2CRE A;  3S6W A;  4B9W A;  2ALY B;  2HZY A;  1YFN A;  2WSE E;  2JMA A;  2LCS A;  1E7O A;  1H4V B;  1PSF A;  3OYF A;  3I9Q A;  2JS0 A;  4F7U E;  4BY6 B;  2F1L A;  3MEY A;  3JSC A;  5IAY A;  3NEN A;  2LQW A;  5F5W A;  3ZEH A;  3HY0 A;  4YRJ A;  4OMP A;  3C12 A;  5LJ3 f;  3CCV A;  5IHI A;  2DD4 A;  3CBP A;  3E1S A;  2KYB A;  1GRI A;  3CCM Q;  2K3X A;  1NLP C;  2FPF A;  4C92 B;  2RJC A;  3JCM d;  3RBB B;  4P3N A;  2ZNI A;  2F2W A;  3A7R A;  4OMQ A;  4C8Q A;  2RK1 A;  3H9N A;  2NUZ A;  2RQT A;  1M3A A;  3ICA A;  4M78 A;  1WYD A;  3C94 A;  4H2W A;  1QKX A;  4Q15 A;  1EVL A;  4DBR A;  3CME T;  5KE2 A;  2ZXF A;  3CPW S;  4RMO A;  4J7I A;  4IUU A;  4RTT A;  3P8B B;  5AYF A;  5KYX B;  3E9H A;  1LPL A;  3CD6 Q;  5HGQ A;  3VS0 A;  2JMC A;  4M7A E;  3OYC A;  1GCP A;  3GP8 A;  2COW A;  1KJW A;  1LCK A;  2ZTG A;  4TVA B;  3RIR A;  2ZIN A;  2KDS A;  1M2V A;  2LX7 A;  1YJN A;  3CC4 T;  3BDU A;  4FW1 A;  3GF5 A;  3TSW A;  1RAE B;  3HY1 A;  4K88 A;  2EYZ A;  3QII A;  2DBM A;  2EGE A;  2CGH A;  4DBH A;  3CCJ Q;  1BBU A;  1M90 C;  2LZ6 B;  4TVW A;  3CXC S;  3EFR A;  2X4X A;  2Y4X A;  3X26 B;  2E5Q A;  5I22 A;  1HC7 A;  1WXT A;  1QF6 A;  4F17 A;  2RF0 A;  3M59 A;  3J81 E;  4M77 A;  3CMA A;  1C1A A;  3HXZ A;  4DPG A;  1M30 A;  3UGT A;  1UGP B;  3CCE A;  3M56 A;  1VQN T;  3CD6 A;  8AT1 B;  5FRO A;  1VQM A;  1R8O B;  4XU0 A;  1YHQ Q;  5GAN j;  2XGT A;  4XU2 A;  1UE9 A;  3KUF A;  3SWN C;  3JCM V;  4PK4 A;  2ARU A;  2DD5 A;  4M77 E;  3V8J A;  3RNJ A;  3EG3 A;  1G8X A;  2COY A;  1Y07 A;  2KBT A;  2KMT A;  1ZSZ B;  2EFI A;  1ABQ A;  3G7Z A;  2JN0 A;  1G5V A;  2DMO A;  1GXI E;  1IO6 A;  4YRL A;  4FYY B;  2LCC A;  4ZIB A;  2KK4 A;  1KIK A;  3A31 A;  3JCM e;  4J6W A;  1YI2 Q;  5K1P A;  4DEY A;  5CVI A;  2F69 A;  1K8A U;  2ZIM A;  3CCR A;  4PNO A;  3X24 B;  4OLF A;  1B8A A;  2O88 A;  2X3W D;  1FXX A;  4CC4 B;  4CS3 A;  1TUD A;  2KRN A;  1X75 C;  2DEU A;  4XTY A;  1Q81 R;  5CK9 A;  2EVR A;  1NYF A;  1VQ4 T;  1M8V A;  4PJM A;  3VRY A;  2PQW A;  2WAC A;  1UGS B;  3ERR A;  4M7D C;  4C5I A;  3DLL A;  2YUN A;  1KC8 C;  2ED0 A;  2KAF A;  3M4Y A;  4O5V A;  1IZ6 A;  4RTZ A;  4PJO B;  1M3C A;  2QQR A;  3GOX A;  1BKB A;  4XTV A;  4QT7 A;  1WYX A;  2EIF A;  5CCA A;  5I11 A;  1UB4 A;  1U1S A;  3HFO A;  2H3E B;  4D8D A;  4K87 A;  1ZSZ C;  3FEO A;  4LUD A;  1ADJ A;  2LJ1 A;  1OYX A;  4YRO A;  4XTZ A;  1VQO Q;  1UUE A;  1U1T A;  4J9E A;  4ZGE B;  4CS2 A;  1IGQ A;  3OYY A;  4J15 A;  2FO0 A;  2QGF B;  2QDL A;  5KYN A;  1X54 A;  4H2X B;  2QAZ A;  2OTJ Q;  4R0K A;  3C95 A;  2Q7G A;  1AD5 A;  4M78 D;  1GFD A;  1TH7 A;  2NYS A;  2YRD A;  3CME A;  4HVU A;  1PD1 A;  1LOJ A;  4KH0 B;  1O75 A;  1GBR A;  2EJF A;  3KFU A;  3H41 A;  3FJ5 A;  2JTM A;  1EIY B;  2JVV A;  4M7A B;  3L42 A;  2DXC A;  2JTE A;  2W0Z A;  4YRR A;  4XU1 A;  4TTV A;  1A0N B;  4OB1 B;  3HFZ B;  2VB6 A;  3PT9 A;  3T9N A;  2ENM A;  4CC7 A;  5A0D A;  3CMA Q;  3CC7 T;  1TXQ A;  4PFP A;  2DTO A;  1ZQ1 A;  2ZPE B;  2LP5 A;  1YHQ T;  3DB4 A;  4C8Q E;  2RQU A;  4M75 D;  3MEA A;  1EX4 A;  2KRM A;  3VUZ A;  2E10 A;  2GCX A;  3CCS A;  4LDY A;  4O6J A;  3D7S B;  4RQE A;  2K9G A;  2K2V A;  3Q1J A;  4H2T A;  2HSP A;  3EHR A;  1ZA2 B;  5GAO m;  1K73 U;  2HQE A;  3OS0 A;  2YUO A;  2MF2 A;  2E4H A;  4YRC A;  2E41 A;  5D6W A;  2OAW A;  2XTI A;  1VYU A;  1TS9 A;  3EH1 A;  5GAM h;  1UDL A;  4LNS A;  3L1A A;  2OJ2 A;  4J9I A;  1N5Z A;  5GAO r;  4C0D C;  1BI1 A;  4KGZ B;  2DNU A;  4QVD A;  1G51 A;  2DXT A;  2EQJ A;  4RTW A;  4YTL A;  4E7S A;  3JCM Q;  5L23 A;  2QYZ A;  4UP7 A;  2K57 A;  2DIG A;  4PHC A;  1FX7 A;  3OBY A;  2AK5 A;  2C06 A;  1PD0 A;  4BD3 A;  1JB0 E;  1QP3 A;  2SRC A;  3QO5 A;  1YJ9 Q;  2LQK A;  3A8M B;  3NET A;  4YYE A;  4C0G A;  4HWP A;  2ZZE A;  5KNN A;  4J8O A;  1EQR A;  2A0F B;  1AT1 B;  3LH5 A;  1UEC A;  4F7U B;  3E2U A;  4LDX A;  1IL2 A;  1TUC A;  3ULR B;  4TVR A;  2HBW A;  2X4Y A;  3M4P A;  3G4S T;  3QXE B;  3VS3 A;  1VQL A;  2J3L A;  3A8L B;  1UFF A;  2RHI A;  3DSQ A;  4DOW A;  3JB9 G;  4H2S A;  4IUT A;  2VKN A;  1N9R A;  4GY5 A;  1Q7Y U;  2ZZD A;  4C92 C;  5FU6 B;  3M4G A;  1NYQ A;  4H2V A;  2QQB A;  3QO8 A;  4BAC A;  2DFU A;  1W66 A;  3X28 B;  4PFO A;  2KT1 A;  4J9G A;  3H8Z A;  2ARS A;  3MET A;  2AMC B;  4RUG A;  1NJ8 A;  1D1B A;  2RJE A;  2IY5 B;  3M55 A;  2FEI A;  2L5Q A;  1MMD A;  3DLM A;  2RHU A;  2ROT A;  4PJO G;  2JT4 A;  2AHJ B;  3DB3 A;  1ZSZ A;  1WHJ A;  3CEY A;  1VQL Q;  3RMS A;  1B7Y B;  1VUB A;  3EHQ A;  2DQ3 A;  2CH4 W;  3CBM A;  2LC4 A;  1VQP A;  1Q81 U;  3EG1 A;  5GAO q;  2ZPG B;  2LNV A;  4A53 A;  1T3S A;  4E2F B;  3UFG A;  5GAN h;  2DL7 A;  1NJ2 A;  3A74 A;  2GFU A;  2ZGW A;  2RHY A;  3LW5 E;  1GCQ A;  1JBM A;  2HD0 A;  1K9M R;  1X2G A;  2KY9 A;  3OQ5 A;  4CI0 C;  3CC7 A;  1X43 A;  1B76 A;  2X3X D;  3L2V A;  5CO7 A;  3FIF A;  1B34 B;  1OUL A;  4HVW A;  4C5G A;  4FU6 A;  4OML A;  3QYH B;  1KMN A;  3ZBD A;  3I35 A;  1AZE A;  3PVL A;  1KFZ A;  5L8R E;  3E9G A;  3M0T A;  1Z7M A;  4LVK A;  4N4H A;  4M77 G;  4LVJ A;  4BUG A;  8ATC B;  1TSF A;  4C5H A;  2ABL A;  4N4G A;  4J9H A;  1Q86 U;  4LD9 K;  3OW2 P;  1QMC A;  4YRQ A;  4RMF A;  4HWR A;  1U06 A;  2VVK A;  3UWN A;  4HCK A;  2P0Q A;  5GMK h;  2FHD A;  3SB2 A;  5CKE A;  2YLB A;  5DY9 A;  1YJ9 T;  3R6O A;  4QQD A;  1QVG S;  1M90 R;  5GAN e;  1F1B B;  12AS A;  1ZLM A;  3OYJ A;  1KC8 U;  2KSS A;  4J83 A;  5J26 A;  2CH4 A;  2M1H A;  4FL6 A;  2ZR3 A;  2RHZ A;  3MEV A;  4Q5W A;  3J7A F;  1QWE A;  3LSQ A;  3JCM X;  2EJ9 A;  3MF1 A;  3G4S A;  1OZ3 A;  2DA9 A;  1WDX A;  2FPD A;  4M7D B;  2LTO A;  2ZPB B;  2DZ9 A;  2KT8 A;  3M58 A;  3HPW A;  5J39 A;  1NJ5 A;  4Y91 A;  5LJ3 g;  1B7Y A;  4BE1 A;  2P5I A;  2OTL Q;  1IRE B;  4C92 A;  4BE0 A;  3BDL A;  1KD1 R;  1N27 A;  2G3R A;  1VA7 A;  2ZT7 A;  1HD3 A;  2M0Y A;  5LJ5 d;  4KT0 E;  3FB9 A;  3I55 T;  3CCM A;  5CKH A;  2ALY A;  1UEB A;  1PYS A;  2K5F A;  5IN1 A;  2ZNJ A;  1D0X A;  3L2Z A;  1CSK A;  1QWF A;  5C52 B;  4M7A A;  1O9S A;  2HL5 C;  1K1Z A;  2L0A A;  2C0O A;  4CRI A;  4F7U F;  4QW2 A;  5DLQ E;  4XU3 A;  2MYS A;  1WJS A;  4AH6 A;  5DLO A;  1KQ1 A;  1SSF A;  4CS4 A;  2V8K A;  4P71 C;  3J80 E;  6AT1 B;  3TSZ A;  1BIA A;  3ME9 A;  2K2M A;  1JEG A;  3JCM f;  4M7D G;  2VWF A;  3EFO A;  1M27 C;  2PU9 B;  1WIE A;  4RQF A;  2CT4 A;  1I1J A;  2MOX A;  4CC2 A;  4KGX B;  4JJN K;  3RL6 A;  1YWO A;  3QO7 A;  4KGV B;  4E7J A;  1SRL A;  4PFZ A;  1S72 T;  1X2H A;  2KVQ G;  3PIO A;  2HCK A;  3BJU A;  5GMK i;  2OI3 A;  4OGE A;  4RG2 A;  1ACM B;  1QE0 A;  4J7F A;  4JLG A;  1BYM A;  3G71 Q;  4CH6 A;  3JB9 J;  1V1C A;  4HWO A;  4NCX A;  1K76 A;  2C0T A;  1M1F A;  1U3O A;  3H6Z A;  2DLP A;  4WF2 A;  5FRN A;  4KQE A;  4P73 A;  3CME Q;  4PL6 A;  2JUF A;  5ECA A;  4EDU A;  4KR2 A;  4C8Q D;  4ESR A;  11AS A;  4J9B A;  1GL5 A;  1USY C;  3SEM A;  2OTJ A;  5LJ5 e;  4PG3 A;  2DU5 A;  3L4G B;  3A5Z A;  5CQY A;  2Q7H A;  2QA4 T;  3OA6 A;  5GAM d;  2HQX A;  4ELZ C;  1VQN Q;  2CZ6 B;  5GMK l;  1TTH B;  1I81 A;  4KUL A;  1HK9 A;  4FYW B;  3VS5 A;  2XKO C;  5CR2 A;  1M90 U;  4MDX A;  2CP3 A;  1WQW A;  3CC2 A;  1MND A;  2RHS A;  2ART A;  4PLI A;  4RTY A;  3GNG A;  3H0H A;  3O5Z A;  2QQ9 A;  2YRC A;  2COZ A;  1NJI R;  1K8A R;  2EL9 A;  1QKW A;  1X01 A;  1M1G A;  2CS7 A;  2E3I A;  2IY5 A;  4RKU E;  5GAN 3;  1QVF A;  1FMV A;  4JDS A;  5GAN 4;  1VQ8 A;  4HXJ A;  2PZ1 A;  1FWZ A;  2I0N A;  3A8H B;  4YP0 A;  1WJR A;  4IUP A;  3CD6 T;  3MEU A;  1S72 A;  4FIB A;  2P4T A;  2DL8 A;  3RGL A;  3KBG A;  3REU A;  4ZTJ A;  4HT4 A;  4P3O A;  2D6F A;  2C8M A;  4IKF A;  2K3B A;  4IIO A;  2HQH A;  3MP6 A;  3V7S A;  2EYQ A;  1VQ6 A;  4LVM A;  3JCM W;  3VQY A;  1LNX A;  4N0A C;  5GAN 5;  2AT1 B;  2EGC A;  3SWN B;  4II1 A;  2ZT5 A;  1AVZ C;  4EMK C;  4EPC A;  3H0I A;  3UT1 A;  1R77 A;  4HWT A;  4M75 C;  2G6F X;  1NPP A;  2BTT A;  1B3Q A;  2YSQ A;  1UJY A;  4O2D A;  3G1J A;  3CCS Q;  1EFW A;  3OYK A;  1OI1 A;  1TOV A;  2O2O A;  2DIQ A;  1IXD A;  1RUW A;  2V8I A;  1KQS S;  1X2K A;  2D1X A;  5D7U A;  1G3S A;  4IIM A;  3SHW A;  1Y57 A;  1SET A;  1BI3 A;  1B07 A;  2H3J A;  3PTA A;  3UDC A;  1I07 A;  1CKB A;  3CXC P;  1SHF A;  3QPH A;  2E64 A;  2GTO A;  1VQ9 T;  1G5I A;  2IIM A;  3AHU A;  3NHN A;  1YB3 A;  2EQK A;  1ATI A;  4M75 F;  5GAO n;  2OTJ T;  1KD1 U;  1J3T A;  2KR3 A;  5GAN g;  5HK0 A;  2A37 A;  3L2Q A;  3OS5 A;  1Q82 U;  1XTD A;  3JB9 I;  2HAX A;  1YJN T;  3OMG A;  4MZM A;  1Y96 A;  2LX9 A;  2PTK A;  4DBF A;  4HWS A;  3TRE A;  3QNE A;  2PMF A;  2X4J A;  1TUG B;  1PKT A;  4M4Z A;  3NTK A;  3OW2 S;  5I2M A;  3PMT A;  2IPO B;  2PME A;  2V26 A;  1FMK A;  4UC4 A;  3HXU A;  2QA4 A;  2I4N A;  2JW4 A;  4RTV A;  3QSU A;  2J6K A;  1R0C B;  4MZP A;  3A7U A;  5LJ5 f;  3HRI A;  1X27 A;  1GBQ A;  2LNH B;  4OF1 A;  1LYL A;  1W6X A;  3KFV A;  4A4E A;  3M4Q A;  3HRU A;  1ZBX A;  4EMK A;  3JB9 D;  4RDX A;  2ZT6 A;  3JAM E;  2DVJ A; 
#chains in the Genus database with same CATH homology
 5K1X A;  3QTC A;  1WU7 A;  2LCL A;  1VQZ A;  4LD6 A;  4C92 G;  3HRK A;  2ZIO A;  4GLK A;  4OB2 B;  4E7K A;  2DTH A;  5HY6 A;  4JS5 A;  2GFA A;  3HP9 A;  3MQZ A;  2R57 A;  1VQO T;  2VXE A;  1YJW A;  3OS1 A;  4P5N A;  4P74 C;  2P0P A;  1M1K C;  4H2Y A;  4PJO F;  1KHC A;  2DVE A;  4A4H A;  3FJP A;  4QQG A;  2PVD B;  2VC8 A;  3IKL A;  3VYG A;  3GIB A;  1H4S A;  5C51 B;  3CCJ T;  3UH0 A;  3CMQ A;  4PLL A;  1EOV A;  4ZTU B;  1HTT A;  3O8V A;  4NOY A;  2A8E A;  2FL7 A;  4M7D A;  1WPY A;  2QTX A;  5GAM f;  4WJ3 M;  4EMK B;  4C8Q G;  4M7A G;  2OTL A;  3OYN A;  1P92 A;  2RB6 A;  1RIQ A;  3QZ9 B;  5GAM e;  2EAY A;  2DO3 A;  2QHT A;  2XDD A;  1KOG A;  3TEH A;  3JB9 H;  1V29 B;  3IKM B;  1H3Z A;  3JCM b;  2LDM A;  4ZTZ B;  5FLX E;  1G3Y A;  4C0Z A;  1K73 C;  4QVZ A;  2DTI A;  2ZCF B;  5GAN f;  1ZHI A;  2EQU A;  4MMK A;  4VUB A;  3SDZ A;  5CIU A;  3FLG A;  4R56 A;  3V8L A;  3INZ A;  3WQZ A;  3M53 A;  2IVW A;  4C92 E;  3R07 A;  4BI8 B;  4P74 A;  2JZ2 A;  3VJP A;  5M9O A;  1ADY A;  2L3R A;  4RCC A;  2I4O A;  2VXF A;  1G3W A;  2E5A A;  2RI5 A;  4KUI A;  3HFV A;  3HXV A;  5ELO A;  4OP0 A;  2QI2 A;  3A7A A;  4E51 A;  3F70 A;  4X9C A;  1D3B A;  1GGM A;  2FVU A;  4PJO C;  2OTL T;  4UP8 A;  4Q6G A;  4C92 F;  1PSE A;  4KBM B;  3JRZ A;  2O01 E;  5CKF A;  1KQS A;  2CJ9 A;  2MAM A;  1VQO A;  1YFR A;  4BDY A;  4XTX A;  4XAX B;  2DPP B;  3QBY A;  3CCV T;  4YCU A;  4P72 A;  4YRS A;  3LGF A;  1OZ2 A;  3PCO B;  4EMH A;  3LC0 A;  1YJW T;  3SFM A;  4EO4 A;  2R5M A;  3MP8 A;  1NYR A;  4QVC A;  2XDP A;  1B70 B;  3RES A;  4A54 A;  2Q5I A;  1YJ9 A;  3S3M A;  4OB3 B;  3VUB A;  3PFS A;  3VQW A;  2E1H A;  2Y90 A;  4OVA A;  3TEH B;  3HKS A;  4M77 D;  3IAL A;  4DA4 A;  1UGR B;  2CJA A;  3SD4 A;  1YI2 A;  1XOV A;  5C53 B;  1Q82 C;  5GAM j;  1U8R A;  4NS5 A;  2KQW A;  1RI0 A;  2QHS A;  3HTZ A;  3RF1 A;  4YPF A;  3X20 B;  4YRI A;  2X35 A;  4H2U A;  1N9W A;  5KH6 A;  4BI3 A;  3M57 A;  5KE3 A;  3OSS C;  5D6X A;  5GMK j;  2HBP A;  3LSS A;  3HSB A;  5ELN A;  1ASZ A;  4HCB A;  5KCO A;  2CKK A;  3MF2 A;  3UPU A;  1NPR A;  1WQ7 A;  3TEG A;  4M7A D;  2LT1 A;  2RD1 A;  5GAN 8;  3I55 A;  2BUD A;  3LYI A;  2R5A A;  2ZPF B;  4HCC A;  2E6Z A;  3CCQ T;  2CJB A;  2AKW A;  4E47 A;  4BWA A;  1VQ5 A;  5CQX A;  1RL2 A;  1W4S A;  3HXW A;  4JRK A;  4UPA A;  5GAN 7;  3CBO A;  3G71 A;  1NE8 A;  3TEE A;  2XU8 A;  4JLI A;  1VIF A;  3VQX A;  4V2S A;  1VQ4 A;  2MI6 A;  2DQ0 A;  1ASY A;  2XD0 A;  5FRM A;  3PMI A;  2RJF A;  3BY7 A;  2E12 A;  4ZTF A;  5LJ5 j;  2XI9 A;  2EJG A;  2JTF A;  4YRT A;  4J6X A;  2QEX A;  4YCV A;  4B9X A;  4M77 C;  2PUK B;  4A4G A;  1E22 A;  4A4K A;  1Y71 A;  1Y7X A;  1M1K U;  5GAO p;  2DAQ A;  3G6E T;  4CH4 A;  1N8R U;  2Q5H A;  4HT8 A;  3C4S A;  1HXD A;  1YCY A;  3LLR A;  3CXC A;  2RJD A;  5HKC A;  3L2R A;  2ODR C;  3RKX A;  1JJC A;  2K4Y A;  4P3P A;  4OGC A;  2PUO B;  1VQ7 A;  4YRM A;  1VQ5 T;  5LJ3 e;  1VQ9 A;  4BDZ A;  1J5W A;  4Y28 E;  3I56 T;  2ZPI B;  1NNH A;  2L8D A;  3A8G B;  1G5H A;  1YFS A;  1Z7N A;  4C8Q C;  3EFS A;  3GNF B;  4M7A C;  2VYT A;  4C92 D;  1QVP A;  4XK8 E;  4HVC A;  2L89 A;  1YFT A;  1DJ7 B;  2RHQ A;  1AHJ B;  1NJ6 A;  1XQH A;  3OYH A;  2MMP A;  4P75 A;  3CCU A;  5J3B A;  2RK2 A;  4IUV A;  2NS6 A;  3M5A A;  4M7D D;  4ZN3 A;  5I21 A;  1KG1 A;  2WSF E;  3VV0 A;  4LVL A;  3A8O B;  4XTU A;  3TU4 K;  5DM7 R;  4EMG A;  4E7I A;  3RUX A;  4DOV A;  3G6E A;  5GMK e;  5LJ3 d;  1LJO A;  4L87 A;  2DJZ A;  3OYA A;  1X56 A;  3L4G A;  1X6O A;  3OB9 A;  3P8Y A;  3VU3 C;  2PVO B;  4YRE A;  4N4I A;  5A2Q E;  4WI1 A;  2QEX T;  1W2B S;  3SWN A;  2NLU A;  3CCS T;  3EAE A;  3GPL A;  2RHQ B;  2E65 A;  2RH2 A;  1YI2 T;  1JJ2 A;  2RI3 A;  2JNG A;  1EVK A;  3ASK A;  4CH5 A;  2ODR D;  4LVI A;  4YDQ A;  4C0F A;  4JRP A;  2C7I A;  3V7C A;  1WJQ A;  1YIT T;  3I7F A;  4LDW A;  5CKD A;  4F7U G;  1BBW A;  2VGN A;  2ZZF A;  2RHS B;  2D0Q B;  3JCM c;  3L2U A;  5LJ3 j;  1WNL A;  1G3T A;  1VQP T;  1JJC B;  2YLC A;  3ER0 A;  2QQA A;  3HXY A;  2LT4 A;  3NFC A;  4M78 E;  2ZZG A;  2M9U A;  3QHS A;  3QKJ A;  1D3B B;  4RCB A;  3CCQ A;  2V8J A;  4LDV A;  2QHU A;  3RKW A;  5IT9 E;  2RHX A;  3JCM h;  4RG8 A;  5A0G A;  2QHV A;  2WSC E;  3WVD B;  3DKM A;  2ZCE A;  1H4Q A;  3WVE B;  3G1Z A;  2XHC A;  4BW9 A;  5GAN 2;  2B8A A;  3A5Y A;  2GF7 A;  5KCH A;  1KD1 C;  4M75 E;  2F5K A;  3TUP A;  4IUQ A;  1YIJ T;  3JCM g;  4PKC C;  3LGL A;  4X9D A;  3N5B B;  2P0K A;  3URG A;  2LRQ A;  2LVM A;  1USY A;  1NJ1 A;  2CZ0 B;  1VQM T;  3VYH B;  4L59 A;  2K3Y A;  1N9S A;  4H2X A;  4HKE A;  5GAN 6;  2J3M A;  2EQM A;  4XEO A;  5GMK m;  1BI0 A;  1YBY A;  3HRS A;  1SER A;  3QDR B;  1Y96 B;  3X25 B;  4OB0 B;  5GAO l;  2Y4Y A;  4XQ3 A;  1YIT A;  4EX5 A;  3CCM T;  1VQ7 T;  2RA2 A;  4ZGJ B;  1NZ9 A;  2QDY B;  1KMM A;  3QYG B;  4QQ6 A;  2M0O A;  1E1O A;  3M9Q A;  4FSX A;  2PVG B;  4TVY A;  3OYG A;  3FRN A;  2RO0 A;  3E9I A;  3LWI A;  3OYB A;  4JRQ A;  3MHX A;  3CMA T;  4M7D F;  3JCM J;  2I4L A;  1VIE A;  5LJ5 h;  1B34 A;  1K9M C;  1VQ6 T;  1KHI A;  2VGM A;  1MGQ A;  4JS4 A;  5FU6 C;  3KXT A;  1SRY A;  1WLE A;  4M78 B;  4FT4 A;  4G84 A;  4P72 C;  1M9S A;  4M7D E;  4L6V 5;  2YRV A;  1QVG A;  2E3C A;  5FU7 C;  1W2B A;  1E1T A;  3I56 A;  4TQD A;  4P75 C;  3LX7 A;  3A5Z B;  3RMQ A;  1EIF A;  4Z02 A;  1VQ8 T;  3HHT B;  4F7U A;  4YRP A;  1N6A A;  3E19 A;  3ZFJ A;  3FDR A;  4TVA A;  4J5Y A;  1JJ2 S;  4H02 A;  4M75 B;  3OSV A;  2BKD N;  3OY9 A;  2DZC A;  1YHQ A;  3VQV A;  4BB7 A;  3JCM P;  3QZ5 B;  3CC2 T;  3FC3 A;  3QUI A;  3PZC A;  3NEM A;  2A3L A;  3BFM A;  3WXM B;  4E7L A;  4YRF A;  2RI2 A;  2O4X A;  1NJI U;  4KR3 A;  4XEM A;  3S3O A;  2O4X B;  4YRG A;  1PYS B;  4NL2 A;  2AKW B;  5GAN d;  1UGQ B;  3VBB A;  1EIY A;  1FYF A;  3CCL A;  1YIJ A;  3V8K A;  3MEW A;  5I2S A;  1SES A;  4R55 A;  4LDU A;  3PNW C;  2RM4 A;  2CYZ B;  3NTI A;  2VUB A;  1X55 A;  2XG8 D;  4FM4 B;  4M75 A;  3GLX A;  4A4F A;  1H64 1;  2MWP A;  5D6Y A;  2CIM A;  2F5T X;  5LL6 S;  4D6W A;  1VQK T;  2ZT8 A;  4X5O A;  2E70 A;  1BIB A;  2K5L A;  4PJO A;  4TWA A;  4C8Q F;  1Q7Y C;  2ZPH B;  5HK3 A;  2DDZ A;  1M5Q 1;  3MO8 A;  2ZR2 A;  4DQ2 A;  2D9T A;  3PCO A;  5CAI A;  5FU7 B;  3P8T A;  3PGG A;  2A7Y A;  4M75 G;  2G4C A;  1B70 A;  2DU7 A;  3M54 A;  4UP9 A;  1I8F A;  3OMC A;  3OBW A;  4MZT A;  4YCW A;  2LQ8 A;  2OAU A;  1VQL T;  3CCU T;  1Q81 C;  3QO3 A;  1C0A A;  4PJO E;  1M4Z A;  2EKO A;  1H4T A;  4NL3 A;  4X34 A;  1XNI A;  5EG2 A;  1QVF S;  3HL8 A;  4M78 G;  3CPW A;  5LJ3 h;  1E24 A;  4M77 B;  5GAM g;  3LWH A;  3CC4 A;  3CPF A;  4ZGD B;  3QJ6 A;  3P8V A;  3RAC A;  4L5G A;  3VKI A;  4BY6 C;  1WGS A;  2QQS A;  3OYM A;  4HT9 A;  3CCE T;  3IG2 A;  4FT2 A;  4G85 A;  3MP1 A;  3G71 T;  3RER A;  2E6N A;  3W3S A;  2CZ7 B;  4HCZ A;  2DXB A;  2I4M A;  1KQ2 A;  4ME7 A;  2QXF A;  1I5L A;  3REX A;  2MWO A;  3P8D A;  3NTH A;  2EWN A;  2BIV A;  1BI2 A;  4C5E A;  3S3N A;  3CCJ A;  4M77 F;  4P71 A;  4CH3 A;  1I4K 1;  3PIP A;  3BW1 A;  4PJO D;  3QJY A;  1YGB A;  2DKG A;  2XIC A;  3NEL A;  4ATO A;  2R58 A;  2HNI A;  5E3I A;  4MDW A;  4ELY C;  1L0W A;  4N0A A;  3TCJ A;  2CZ1 B;  3CCL T;  1QW1 A;  2GQV A;  5C6S A;  2I2L A;  1VQK A;  4KUD K;  4XTW A;  5A0L A;  1MHN A;  1QP2 A;  5LJ5 g;  2VV5 A;  3OW2 A;  4YRK A;  2K5I A;  1N8R C;  3RKY A;  3JB9 F;  4M78 C;  2FYK A;  4BI4 A;  4IUR A;  1K8A C;  4M7A F;  3A32 A;  1Q86 C;  3OYD A;  3OYE A;  2AMC A;  2XK0 A;  2Q7E A;  1K9M U;  4C8Q B;  3OYI A;  1VQN A;  3MCA B;  4MML A;  5CKB A;  4J6Y A;  4E7H A;  4JUV A;  3OD1 A;  4OMF B;  3L2W A;  4TQF A;  2DXU A;  4P73 C;  3OYL A;  4C0D B;  4WJ4 A;  3E9F A;  2IG0 A;  3V7R A;  1NJI C;  4M78 F;  4YRN A;  4HA8 A;  2XDB A;  1JRI A;  4JRI A;  2M16 A;  4ZN1 A;  3QG1 A;  2X4W A;  3CCR T;  3UGQ A;  2DK3 A;  2DEQ A;  2XID A;  2FB7 A;  4K86 A;  3HXX A;  2YHT A;  4BE2 A;  3HRT A;  5C0M A;  3OS2 A;  3HFZ A;  3P8H A;  2JOY A;  3LH0 A;  3HFN A;  2P0L A;  4B9W A;  3S6W A;  2ALY B;  2WSE E;  1H4V B;  1PSF A;  3OYF A;  4F7U E;  4BY6 B;  3MEY A;  3JSC A;  5IAY A;  3NEN A;  5F5W A;  3ZEH A;  3HY0 A;  4YRJ A;  3C12 A;  5LJ3 f;  3CCV A;  2DD4 A;  3CBP A;  3E1S A;  2K3X A;  4C92 B;  2RJC A;  3JCM d;  4P3N A;  2ZNI A;  3A7R A;  4C8Q A;  2RK1 A;  3ICA A;  4M78 A;  1WYD A;  3C94 A;  4H2W A;  4Q15 A;  1EVL A;  3CME T;  5KE2 A;  2ZXF A;  3CPW S;  4RMO A;  4J7I A;  4IUU A;  3P8B B;  5AYF A;  3E9H A;  5HGQ A;  4M7A E;  3OYC A;  3GP8 A;  2ZTG A;  4TVA B;  3RIR A;  2ZIN A;  2KDS A;  4K88 A;  3CC4 T;  3BDU A;  1YJN A;  3GF5 A;  3HY1 A;  3QII A;  2CGH A;  1BBU A;  1M90 C;  4TVW A;  3CXC S;  3EFR A;  2X4X A;  2Y4X A;  3X26 B;  2E5Q A;  1HC7 A;  1QF6 A;  3M59 A;  3J81 E;  4M77 A;  3CMA A;  3HXZ A;  4DPG A;  3UGT A;  1UGP B;  3CCE A;  3M56 A;  1VQN T;  3CD6 A;  5FRO A;  1VQM A;  1R8O B;  4XU0 A;  5GAN j;  2XGT A;  4XU2 A;  3KUF A;  3SWN C;  3JCM V;  2ARU A;  2DD5 A;  4M77 E;  3V8J A;  1Y07 A;  2KMT A;  2EFI A;  3G7Z A;  2JN0 A;  1G5V A;  1GXI E;  4YRL A;  4ZIB A;  2LCC A;  2KK4 A;  3A31 A;  3JCM e;  4J6W A;  5K1P A;  5CVI A;  2F69 A;  1K8A U;  2ZIM A;  3CCR A;  4PNO A;  3X24 B;  4OLF A;  1B8A A;  1FXX A;  4CS3 A;  1X75 C;  4XTY A;  5CK9 A;  1VQ4 T;  1M8V A;  2PQW A;  2WAC A;  1UGS B;  3ERR A;  4M7D C;  4C5I A;  3DLL A;  1KC8 C;  2KAF A;  3M4Y A;  4O5V A;  1IZ6 A;  4PJO B;  2QQR A;  3GOX A;  1BKB A;  4XTV A;  2EIF A;  5CCA A;  1UB4 A;  1U1S A;  3HFO A;  4K87 A;  3FEO A;  1ADJ A;  1OYX A;  4YRO A;  4XTZ A;  4CS2 A;  1U1T A;  4ZGE B;  3OYY A;  4J15 A;  1X54 A;  4H2X B;  3C95 A;  2Q7G A;  4M78 D;  1TH7 A;  3CME A;  1LOJ A;  1O75 A;  2EJF A;  3KFU A;  2JTM A;  1EIY B;  2JVV A;  4M7A B;  3L42 A;  2DXC A;  4YRR A;  4XU1 A;  4TTV A;  4OB1 B;  3HFZ B;  3PT9 A;  3T9N A;  5A0D A;  3CC7 T;  2DTO A;  1ZQ1 A;  2ZPE B;  1YHQ T;  3DB4 A;  4C8Q E;  4M75 D;  3MEA A;  3VUZ A;  2E10 A;  2GCX A;  3CCS A;  4LDY A;  4O6J A;  4RQE A;  2K2V A;  3Q1J A;  4H2T A;  5GAO m;  1K73 U;  2HQE A;  3OS0 A;  2MF2 A;  4YRC A;  2E41 A;  5D6W A;  2XTI A;  5GAM h;  4LNS A;  3L1A A;  5GAO r;  4C0D C;  1BI1 A;  4QVD A;  1G51 A;  2DXT A;  2EQJ A;  4YTL A;  3JCM Q;  4UP7 A;  2K57 A;  2DIG A;  4PHC A;  1FX7 A;  3OBY A;  2C06 A;  4BD3 A;  1JB0 E;  1QP3 A;  3QO5 A;  2LQK A;  3A8M B;  3NET A;  4YYE A;  4C0G A;  4HWP A;  2ZZE A;  5KNN A;  4J8O A;  1EQR A;  4F7U B;  4LDX A;  1IL2 A;  4TVR A;  2X4Y A;  3M4P A;  3G4S T;  3QXE B;  1VQL A;  2J3L A;  3A8L B;  2RHI A;  3DSQ A;  4DOW A;  3JB9 G;  4H2S A;  4IUT A;  1N9R A;  4GY5 A;  1Q7Y U;  2ZZD A;  4C92 C;  5FU6 B;  3M4G A;  1NYQ A;  4H2V A;  2QQB A;  3QO8 A;  4BAC A;  1W66 A;  3X28 B;  3H8Z A;  2ARS A;  3MET A;  2AMC B;  1NJ8 A;  2RJE A;  2IY5 B;  3M55 A;  2L5Q A;  3DLM A;  4PJO G;  2RHU A;  2AHJ B;  3DB3 A;  3CEY A;  3RMS A;  1B7Y B;  1VUB A;  2DQ3 A;  3CBM A;  2LC4 A;  1VQP A;  1Q81 U;  5GAO q;  2ZPG B;  2LNV A;  4A53 A;  3UFG A;  5GAN h;  1NJ2 A;  3A74 A;  2GFU A;  2ZGW A;  2RHY A;  3LW5 E;  1JBM A;  2HD0 A;  1X2G A;  2KY9 A;  3OQ5 A;  4CI0 C;  3CC7 A;  1B76 A;  3L2V A;  5CO7 A;  3FIF A;  1B34 B;  4C5G A;  4FU6 A;  3QYH B;  1KMN A;  3ZBD A;  5L8R E;  3E9G A;  1Z7M A;  4LVK A;  4N4H A;  4M77 G;  4LVJ A;  4BUG A;  4C5H A;  4N4G A;  1Q86 U;  4LD9 K;  4YRQ A;  4RMF A;  4HWR A;  3UWN A;  2P0Q A;  5GMK h;  2FHD A;  3SB2 A;  5CKE A;  2YLB A;  5DY9 A;  1YJ9 T;  3R6O A;  4QQD A;  1QVG S;  5GAN e;  12AS A;  3OYJ A;  1KC8 U;  2KSS A;  4J83 A;  5J26 A;  2M1H A;  4FL6 A;  2ZR3 A;  2RHZ A;  3MEV A;  4Q5W A;  3J7A F;  3LSQ A;  3JCM X;  2EJ9 A;  3MF1 A;  3G4S A;  1OZ3 A;  4M7D B;  2LTO A;  2ZPB B;  2DZ9 A;  3M58 A;  3HPW A;  5J39 A;  1NJ5 A;  4Y91 A;  5LJ3 g;  1B7Y A;  4BE1 A;  2P5I A;  1IRE B;  4C92 A;  4BE0 A;  3BDL A;  1N27 A;  2G3R A;  2ZT7 A;  5LJ5 d;  3FB9 A;  4KT0 E;  3I55 T;  3CCM A;  5CKH A;  2ALY A;  1UEB A;  1PYS A;  2K5F A;  5IN1 A;  2ZNJ A;  3L2Z A;  5C52 B;  4M7A A;  1O9S A;  4CRI A;  4F7U F;  4QW2 A;  5DLQ E;  4XU3 A;  1WJS A;  4AH6 A;  5DLO A;  1KQ1 A;  1SSF A;  4CS4 A;  2V8K A;  4P71 C;  3J80 E;  1BIA A;  3ME9 A;  3JCM f;  4M7D G;  2PU9 B;  4RQF A;  4JJN K;  3RL6 A;  3QO7 A;  4E7J A;  1S72 T;  1X2H A;  2KVQ G;  3PIO A;  3BJU A;  5GMK i;  4OGE A;  4RG2 A;  1QE0 A;  4J7F A;  4JLG A;  1BYM A;  4CH6 A;  3JB9 J;  4HWO A;  4NCX A;  1M1F A;  3H6Z A;  4WF2 A;  5FRN A;  4KQE A;  4P73 A;  4PL6 A;  2JUF A;  4EDU A;  4KR2 A;  4C8Q D;  11AS A;  1USY C;  2OTJ A;  2DU5 A;  5LJ5 e;  4PG3 A;  3L4G B;  3A5Z A;  5CQY A;  2Q7H A;  2QA4 T;  3OA6 A;  5GAM d;  2HQX A;  4ELZ C;  2CZ6 B;  5GMK l;  1I81 A;  4KUL A;  1HK9 A;  2XKO C;  5CR2 A;  1M90 U;  4MDX A;  1WQW A;  3CC2 A;  2RHS A;  2ART A;  4PLI A;  3GNG A;  2QQ9 A;  2EL9 A;  1X01 A;  1M1G A;  2CS7 A;  2IY5 A;  4RKU E;  5GAN 3;  1QVF A;  4JDS A;  5GAN 4;  1VQ8 A;  1FWZ A;  3A8H B;  4YP0 A;  1WJR A;  4IUP A;  3CD6 T;  3MEU A;  1S72 A;  4FIB A;  2P4T A;  3RGL A;  3KBG A;  3REU A;  4HT4 A;  4P3O A;  2D6F A;  2C8M A;  4IKF A;  3MP6 A;  3V7S A;  2EYQ A;  1VQ6 A;  4LVM A;  3JCM W;  3VQY A;  1LNX A;  4N0A C;  5GAN 5;  3SWN B;  4II1 A;  2ZT5 A;  4EMK C;  4EPC A;  3UT1 A;  4HWT A;  4M75 C;  1NPP A;  4O2D A;  1EFW A;  3OYK A;  1OI1 A;  2DIQ A;  2V8I A;  1KQS S;  1G3S A;  1SET A;  1BI3 A;  2H3J A;  3PTA A;  3UDC A;  3QPH A;  2E64 A;  1VQ9 T;  1G5I A;  3AHU A;  1YB3 A;  2EQK A;  1ATI A;  4M75 F;  5GAO n;  2OTJ T;  1KD1 U;  5GAN g;  5HK0 A;  3L2Q A;  3OS5 A;  1Q82 U;  1XTD A;  3JB9 I;  2HAX A;  1YJN T;  3OMG A;  4MZM A;  1Y96 A;  2LX9 A;  4HWS A;  3TRE A;  3QNE A;  2PMF A;  2X4J A;  3NTK A;  3OW2 S;  5I2M A;  3PMT A;  2PME A;  4UC4 A;  3HXU A;  2QA4 A;  2I4N A;  3QSU A;  4MZP A;  3A7U A;  5LJ5 f;  3HRI A;  4OF1 A;  1LYL A;  4A4E A;  3M4Q A;  3HRU A;  1ZBX A;  4EMK A;  3JB9 D;  4RDX A;  2ZT6 A;  3JAM E;  4ZTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...