4XU1A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 82 that incorporates a morpholine in place of the ribose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 98
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu1A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu1A01
1E1TA 4M77G 3PCOB 1QE0A 1WYDA 5C52B 2FYKA 4YRTA 3IKLA 5K1PA 3L1AA 1G5IA 1NJ1A 4TQDA 2C7IA 3CMQA 1HXDA 1E24A 4M75G 1NJ6A 3HFZB 1QF6A 4M75D 4XTZA 3SWNA 1HK9A 4YDQA 4YCUA 4PHCA 4P72A 4G84A 3NENA 3E9IA 3HXZA 4AH6A 1B7YB 5LJ3e 2ZT8A 2E64A 4MMLA 1LOJA 3RIRA 1W66A 5E3IA 3BY7A 3M4GA 1Y96A 3V7CA 4BWAA 2EJFA 2QHVA 4HT9A 4H2XA 4M78D 4M7AC 3UGQA 3MF2A 2RHSB 1X2HA 1H4TA 3PCOA 4PJOG 5GANf 4TWAA 4UP8A 5GANe 1I81A 3KFUA 2DU7A 3V8KA 4P73A 4C8QF 4C92A 2QHUA 1D3BA 2HNIA 4YRKA 2RA2A 1YCYA 1EQRA 4PJOE 2Q7EA 5CAIA 3OD1A 2RD1A 4H2TA 4EX5A 3FJPA 4M77A 3SB2A 5LJ3d 1KQ2A 2ODRC 2RM4A 4CS2A 4PJOF 1I4K1 4MMKA 4P74A 5GAOl 3VQXA 4KR3A 5GAN6 4P71A 2VXEA 3QO3A 4Y91A 3E9HA 3RESA 3EFRA 4P3OA 1BBWA 2VXFA 4P72C 4G85A 3QNEA 1EFWA 5LJ5d 3WQZA 3NETA 1TH7A 1NYQA 1SETA 1I8FA 3M4QA 3UH0A 4RCBA 1D3BB 1E22A 4M7DD 4M7AA 4M7DG 1G5HA 3BW1A 2ZT5A 3RACA 2P0LA 1X55A 3A5ZA 4XEOA 2XTIA 3ERRA 2E65A 4QVDA 4CH3A 1B70B 1B70A 3AHUA 3INZA 5LJ5f 3MF1A 5LJ5e 2K57A 5KNNA 3A7AA 2ZR3A 3HRKA 2EJ9A 1H4QA 5GAMe 1H4SA 4M7DF 5GMKm 3RKWA 4C8QB 5GAOp 4M7AE 4EMKC 4DQ2A 3FB9A 4N0AC 3REUA 3JCMX 5GAN5 3QHSA 3RERA 4M7DA 4EMHA 1HTTA 1BIAA 3MEYA 2I4OA 4M78E 1WNLA 4F7UG 3V8LA 3A7UA 3HXXA 4EMGA 4CS4A 4XTWA 1SERA 2ZCEA 1EOVA 2AKWB 2YLCA 2DZCA 3QTCA 1USYC 2AKWA 3PZCA 5GMKh 4M78G 1Y96B 4J6XA 4F7UE 5F5WA 5GAMf 3DSQA 5GANd 5GAOm 4PJOD 2ZZGA 2ALYB 2RHSA 4H02A 3HFOA 3QO7A 1USYA 2VC8A 2DVEA 3REXA 1MGQA 4Q6GA 4ZIBA 2ZT6A 3BJUA 1H4VB 2JN0A 1NJ2A 1YFRA 2DXUA 3TEHB 4KR2A 4OLFA 3TEGA 3HY0A 2DXTA 4M78C 4M7AD 3A74A 2ZT7A 3JCMe 1Z7MA 3P8YA 3A7RA 4WJ4A 4XU2A 4HWPA 4A53A 1BBUA 3PGGA 5DY9A 5HGQA 4RQEA 1B34B 3V7SA 3BDUA 4TVYA 3QUIA 4PNOA 4M78A 4XQ3A 4E51A 4M7DC 4UP9A 3JCMW 1X56A 4WI1A 4P75C 3JCMd 1YFTA 4TVWA 3IALA 4XU1A 4F7UF 2ZIOA 1L0WA 1EIYB 1ASYA 2DZ9A 4J6WA 1G51A 3G1ZA 4WJ3M 2CJ9A 2YLBA 2PMFA 4V2SA 1B7YA 3LSSA 1FYFA 4J5YA 4YCVA 3L2ZA 3EFSA 5LJ5h 2ARUA 4WF2A 4C92D 4EMKB 4C92B 4M7AF 5GANg 1KQ1A 4C92G 1KMNA 1NNHA 4JUVA 4YYEA 1B34A 5GMKj 2AMCA 3JCMJ 4PJOA 3JCMf 3HXWA 4NL3A 1PYSA 3IG2A 4YRRA 2DJZA 4HT8A 2ZGWA 1RIQA 4F7UB 2FB7A 4O2DA 1B8AA 4PJOC 2Q7HA 3W3SA 1JBMA 2Y90A 4YREA 4H2XB 3BFMA 1X01A 2J3MA 3IKMB 5GAN3 2ZZFA 4P74C 4RCCA 4TVAB 2QTXA 4X5OA 1JJCA 2I4NA 2Q5IA 2EAYA 4YP0A 2EL9A 3A31A 4M7AB 3HXVA 4L87A 1EVLA 2AMCB 2E5AA 3UGTA 4C92C 3HXYA 3HTZA 1NJ5A 4P3NA 1EVKA 2E10A 1KMMA 4M77F 1H641 5GMKl 3UFGA 4HA8A 3JB9H 1ADYA 4RDXA 1X2GA 3HY1A 3RKXA 5C53B 2E1HA 2QHTA 1X54A 2Q7GA 1VQZA 4H2VA 2CIMA 4NOYA 3HFVA 2IY5A 5GAMg 2YHTA 3GIBA 2E3CA 4XU3A 3RKYA 5ELNA 3JCMP 5GAN7 1U1SA 2I4LA 3V8JA 1E1OA 4H2YA 4UPAA 4J15A 2RHQA 1ADJA 4XTXA 4BW9A 3LSQA 4CH6A 2I4MA 4YCWA 5GMKi 3VQWA 2ZR2A 5GAN2 2C8MA 4Q15A 4RQFA 4LNSA 4M75C 5C51B 4ZTZB 1Z7NA 2G4CA 3P8VA 4X9DA 2ZZEA 4EMKA 3HSBA 2XGTA 4N0AA 2DTOA 2ZTGA 4XTUA 1NJ8A 4M77C 3RF1A 3TUPA 4C8QC 5GAOr 5LJ5g 4M75A 4YRQA 2I2LA 5K1XA 4J6YA 1M8VA 4XEMA 4P3PA 4TQFA 3R07A 1YGBA 3JB9D 5LJ3h 1PYSB 3A5YA 4H2SA 5ELOA 1B76A 3JB9G 1KOGA 4P71C 3LC0A 2P5IA 2ODRD 4KQEA 4C8QA 1EIYA 2EWNA 3JB9F 2CGHA 4M75E 3VBBA 2ALYA 1N9RA 4HVCA 4HWTA 4C8QD 4DPGA 1BIBA 4M7DB 1ASZA 1LNXA 4K87A 1YFSA 3QSUA 4YROA 1WPYA 5LJ3g 3NEMA 2J3LA 3VQVA 4PG3A 4YRMA 2DTIA 4M78F 3JCMc 4JLIA 4HWRA 5GANj 2DTHA 3QO8A 5LJ5j 1JJCB 4M78B 4JRKA 4X9CA 3A32A 2DU5A 4YRNA 4M75B 1WQWA 3ICAA 5GAOn 3L4GA 4M7DE 3JCMQ 4PJOB 3HXUA 2RHQB 1ATIA 3JCMh 4CH5A 4M75F 1N9WA 3VQYA 3TEHA 2DQ3A 3FIFA 3V7RA 3RL6A 1SESA 5GAN8 4YPFA 4QVCA 4UP7A 4YRGA 4NL2A 11ASA 4H2WA 1GGMA 3VU3C 5GANh 1J5WA 2DQ0A 5GAMh 1I5LA 4A54A 3JCMg 4M77D 3HRIA 4HWOA 1LJOA 5GAMj 3HFZA 2ZINA 4JRIA 4CH4A 1WQ7A 1YB3A 5GMKe 5GAMd 1C0AA 4YRFA 2Q5HA 4RMFA 5GAOq 3L4GB 1WU7A 2PMEA 1IL2A 4YRPA 1JRIA 4F7UA 3M4PA 3SWNC 1SRYA 4YRJA 3JB9J 2QHSA 4HWSA 3JCMV 2ZNJA 2IY5B 3JCMb 2DKGA 2RB6A 4XTVA 2EJGA 4CS3A 3NELA 5GAN4 4P75A 3RGLA 4YRLA 4XU0A 2CJAA 4ZTUB 3HFNA 3SWNB 1HC7A 3JB9I 2ZNIA 4YRIA 2ZXFA 1WLEA 1N9SA 3RUXA 2DEQA 2ZIMA 3QO5A 4K88A 4NCXA 4OP0A 4M77B 4TTVA 12ASA 2DDZA 5I21A 2ARTA 2CJBA 4C8QE 4YRCA 4M77E 4P73C 1M5Q1 1NYRA 4TVAA 3I7FA 4EO4A 4YRSA 3P8TA 4K86A 4XTYA 4C92E 1U1TA 5LJ3j 1LYLA 2E41A 4C92F 5LJ3f 4H2UA 2ARSA 4C8QG 4M7AG
chains in the Genus database with same CATH superfamily
1RAEB 1LCKA 2I0NA 4F17A 2E5QA 3L1AA 2HZYA 4OMFB 3G6EA 2ZZDA 2EGEA 3OYJA 3CBMA 1JO8A 3X28B 3JRZA 2M0OA 4M75D 4E7SA 4LE9A 4AG1C 2YWWA 4Y92A 2CREA 2BE7D 3M53A 1PKTA 2A8EA 4G84A 4CRIA 3E19A 3QYHB 3EHRA 2ZT8A 2E64A 1T3LA 3CD6A 3I5SA 3BY7A 4RUGA 2ZCFB 1YJNT 3OYYA 4QKUA 4PJLA 2MK5A 2ZPIB 3CCQA 4OGCA 4HT9A 4M78D 3UGQA 2RJCA 2DVJA 2QK0A 2LJ3A 1N5ZA 2YRCA 2NUTA 4WCIA 3QWYA 4DOVA 2DU7A 2FEIA 3REAB 1SSHA 1QCFA 3P8BB 2RA2A 1Q86U 3CXCS 4PJOE 4BACA 1PSEA 2JTFA 5CAIA 5IHIA 2MWPA 2DMOA 3FJPA 4M77A 3SB2A 4E47A 3LYIA 2ODRC 4JZ4A 4ZGEB 2RM4A 1VUBA 4PJOF 3HTRA 4L6V5 4P74A 3M0SA 1C0MA 3VYHB 1G5VA 2CZ0B 1SG5A 1KHCA 5DLOA 3VQXA 3EG9A 1VIEA 4KR3A 5GAN6 2L3RA 3QO3A 3CCUQ 2A08A 4TVRA 1UJYA 1BBWA 2VXFA 4G85A 3OYLA 1UECA 4BI8B 2GQIA 5KH6A 3CC2A 2DAQA 1EFWA 1K4US 2J6KA 3META 3WQZA 3CC7Q 3L2UA 2DIGA 3G71A 2KXDA 1X69A 1NYQA 1I8FA 1SETA 3M4QA 1G3SA 1GBQA 4RCBA 3RACA 1N27A 5AT1B 1Z9QA 5IAYA 2NWMA 2L5QA 2VYTA 3URGA 4JS5A 3H8ZA 3CCEA 1VQ6T 3INZA 3AHUA 3J80E 3MF1A 5KNNA 2K57A 2QDLA 1VA7A 2DFUA 2RHYA 3HRKA 2EJ9A 2C06A 2DBMA 2F5KA 2O01E 4M7DF 1D0XA 4J9CA 2OTLQ 3RKWA 3SHWA 4LDYA 3LGLA 4M7AE 4N0AC 3CCET 3JCMX 4BB7A 4AFUC 1YITT 1BIAA 1PM3A 3MEYA 3VRZA 1AZEA 1AOJA 4EMGA 2GNCA 2AKWB 2DBKA 4IIOA 1Q7YC 1USYC 3PZCA 4M78G 1VQ5T 1Y96B 5A0GA 1QVGS 4F7UE 5F5WA 2L3PA 3LGFA 2FZGB 2CP5A 4ME7A 5GAOm 3QJ6A 2RHSA 3QO7A 3CC2T 2M16A 1BCMA 2E3IA 2F2XA 1H4VB 1OPKA 1WHLA 1IO6A 1JJ2A 3TEHB 3CCMA 1KC8C 1RI9A 4FYVB 2DXTA 2R57A 1X6BA 1Z7MA 2HMAA 2FPFA 4C0GA 2J6OA 1PRMC 3FJ5A 4HWPA 4A53A 5DY9A 5HGQA 4ZTJA 4RQEA 3PIOA 4TVYA 2YUPA 3QUIA 4PJNA 3GBQA 1M8MA 4RTWA 4P75C 5FU7B 3AT1B 4FCYA 1L0WA 3M56A 2DZ9A 2DRKA 3OYDA 2JTEA 1XJWB 5IHKA 1BI2A 2CJ9A 3PMIA 4LUEA 4B6MA 2YLBA 2DF6A 1M3CA 4V2SA 2PMFA 1B7YA 3MEWA 2F2WA 3NTKA 3EFSA 1GCPA 4C0DB 4C92D 2EQKA 5GANg 3EGUA 1KMNA 2F69A 4R55A 1VQ9Q 3JCMf 3ASKA 3HXWA 4B9XA 1PYSA 4YRRA 1TUCA 2DJZA 4HT8A 4IUTA 2K2MA 4O2DA 1RI0A 1B8AA 4PJOC 2BKDN 3RDVA 3C4SA 5I11A 1YP5A 4OGEA 1EFNA 3W3SA 4IUQA 1JBMA 4A63B 2J3MA 4J9EA 3IQLA 4HCCA 5CR2A 2YT6A 1S72Q 4P74C 1RAHB 4KT0E 2KVQG 4TVAB 1SPKA 2K9GA 3ER0A 3OYGA 2QTXA 1TWBA 3TU4K 1JJCA 3CCSQ 2NUZA 2NYSA 4IUPA 2EQMA 1O9SA 2DJQA 5GJVB 3A5ZB 2E3HA 2PNIA 3HXYA 3HTZA 2E70A 4IUUA 1MV0B 5I22A 4HKEA 1RUWA 4Y28E 1ADYA 3UA6A 3RKXA 2E1HA 3G71T 5AYFA 1G3TA 2CSQA 1PNJA 2JS0A 2QQBA 4DOWA 3TVTA 1VQZA 3S3OA 4OB1B 1Y71A 1A0NB 2E3CA 3JCMP 5GAN7 2LP5A 3A8LB 3HL8A 4H2YA 2DL5A 1BU1A 4J9HA 1YI2T 2JVVA 1B07A 1M27C 4J15A 4BW9A 1KJWA 3LSQA 1VQ9T 4MZMA 2C8MA 2RHXA 4LNSA 2FO0A 5I2MA 2XU8A 4X9DA 2YUNA 1VQ7A 2K6DA 4GBQA 2XGTA 2RQUA 1OEBA 4LN2A 2DTOA 3JAME 1NJ8A 1Q81C 2K5LA 5LJ5g 4M75A 5CKBA 3MHXA 4MZPA 2I2LA 4J6YA 1K76A 2KRMA 3MP8A 1OQKA 1YJWT 3R07A 3VS7A 1WJSA 1W4SA 3OB9A 1KOGA 1UUEA 4P71C 5KYWB 1X27A 1NJIU 2MPXC 4JJNK 2CGHA 2GTJA 2ALYA 1N9RA 2GFUA 1CSKA 4C8QD 3M55A 2KXCA 4HWTA 2A3LA 4K87A 1YFSA 3QSUA 2XICA 5LJ3g 2OTJT 3NGPA 3EFOA 3M0RA 2J3LA 3VJPA 3EG2A 4PG3A 2DTIA 3BE3A 2HSEB 2DTHA 4R56A 2KROA 3QO8A 4M78B 3G6ET 1VQKT 2ED0A 2EKHA 2IIMA 1WQWA 3M58A 3ICAA 4LVLA 1ZSZC 1PKSA 2PQWA 2XK0A 3FRNA 1OX9A 3A1PA 2NUPA 1ATIA 2CYZB 4QQDA 2DPPB 5DLQE 1BBZA 5HCKA 3KFVA 4EIKA 3VQYA 1X6GA 3TEHA 4A4KA 4CC7A 4VUBA 4RTYA 5FWBA 3DLLA 3RL6A 1ZHIA 3SDZA 2VGMA 5GAN8 4QVCA 4UP7A 4NL2A 1VQ5A 2QA4T 3WVEB 5GANh 2DQ0A 2F5TX 2CUDA 3OSSC 4HWOA 3HRIA 2DL8A 2D0NA 2LCCA 3CCLA 1E7OA 2DNUA 2L3QA 2NUPB 1WHGA 3A8OB 1ZBXA 2KK4A 2MOXA 3L4GB 3EHQA 3LX7A 5A0LA 1QWFA 4QVZA 4HWSA 1T0HA 5KYXB 3JCMb 1FYNA 2EBPA 2VVKA 2J05A 1IHVA 3CPWP 2YUQA 3EGDA 4DEYA 3CC2Q 3M54A 3NELA 4P75A 2CZ7B 2CKKA 4YRLA 2K79A 4ZTUB 1HC7A 1RADB 4BDYA 1HJDA 4BE1A 1KIKA 1N9SA 3RUXA 1KFZA 3G6EQ 2LT4A 4OP0A 4DBQA 12ASA 5I21A 2ARTA 1WXTA 4NS5A 1VQLT 2CJBA 4M77E 1M1KC 1NYRA 4WTOB 3OYBA 4EO4A 2O9VA 1H92A 4QQGA 3M59A 1PG5B 1LYLA 2FPEA 2K3XA 2O4XA 4FYXB 1E1TA 2RK1A 3PCOB 2FYKA 3DB4A 3IKLA 1FWZA 3OYFA 1G5IA 1NEBA 4A4EA 2LNVA 2M9UA 4AG2C 1MV3A 4D8DA 3E2UA 3HFZB 4A4FA 4XTZA 2LMJA 1HK9A 4BY6C 1IGQA 4LVJA 2CZ1B 4OMOA 1K73R 2MF2A 2CP7A 4JLGA 3RIRA 4J7FA 1OULA 1D0YA 4D6WA 2DILA 1NM7A 4BWAA 3VRYA 1KC8U 2JM9A 1QVGA 1VQPT 4TWAA 2EYYA 4UP8A 2CH4W 2LJ0A 3OYHA 1PC0A 1FXXA 2QHUA 1WGSA 1D3BA 1QWEA 3CCEQ 4YRKA 2IPOB 4J9FA 1YCYA 3CCUT 5D6YA 2QASA 3H9NA 1EQRA 2Q7EA 2D8JA 4H2TA 1UGSB 1XTDA 3J81E 1I4K1 4MMKA 4LDVA 3L2WA 5GAOl 1BKBA 4OMMA 3X26B 5CKHA 1GRIA 2ROLA 3MO8A 3OYCA 2FPDA 4P3OA 4OMPA 4RTXA 3TQ7P 3QNEA 2OX7A 5KCOA 1W2BA 1XQHA 1TH7A 2RO0A 2J6FA 2QA4Q 5HK0A 1KG1A 1OX8A 4E6RA 4M7DD 4M7DG 2CT4A 1G83A 3BW1A 3X20B 1SHGA 1WZOA 2YSQA 1BB9A 1ZSZA 3ERRA 4HXJA 4Q5WA 1B70B 2JTMA 1MMGA 4BE0A 1YI2Q 2D0QB 1YCSB 1BI3A 5LJ5f 1UFFA 3PFSA 4RTTA 3E9GA 1VQ7Q 2EQUA 2JT4A 5FW9A 3TSZA 1RAFB 4KGVB 1ZA2B 2HEQA 3P8DA 1TU0B 4EMKC 1I1JA 1WFWA 3FB9A 3REUA 1M3BA 1ARKA 2HQXA 3QHSA 1I0CA 4X1VA 1BYMA 3RERA 4EMHA 4PFPA 1HTTA 1PSFA 1X6OA 4LUDA 3PT9A 4M78E 1WNLA 3V8LA 3HXXA 3J7AF 4JRPA 4CS4A 1SERA 1EOVA 2YLCA 2DZCA 3VS1A 5FWCA 3TCJA 4E7HA 4PLLA 3O5ZA 4J6XA 3PNWC 4JJBA 4PJOD 1NE8A 3CCQT 4H02A 3HFOA 1USYA 1K8AU 2VC8A 3LH0A 4HVVA 1D0ZA 2ZT6A 3BJUA 2JJ9A 2ZPBB 2ABLA 3O8VA 4L5GA 2HBWA 3ZFJA 4M78C 3A74A 3P8YA 3A7RA 4WJ4A 3CCVT 4FYYB 3GLXA 4R0KA 8ATCB 3CMEQ 3PGGA 1B34B 3PVLA 3V7SA 3OYKA 3THKA 1N8RR 4MZTA 4E7JA 4CC2A 2DD5A 5I2SA 4PLIA 1Q81U 4UP9A 4ELZC 3CMAQ 1YFTA 2DERA 4F7UF 2CZ6B 2RPNA 2JS2A 3CBPA 3MQZA 4J6WA 2P0PA 2RQWA 1NJIR 2DRMA 3OS0A 2J06A 4WJ3M 1OU8A 5KE2A 4LXCA 2RQRA 1PHTA 2RQVA 4WF2A 4EMKB 4C92B 4M7AF 1KQ1A 1H3HA 1MMNA 2KEAA 1ZUKA 2RN8A 3WVDB 4E7KA 5J39A 4RTUA 3CEYA 1TOVA 1IXDA 4M4ZA 2RJDA 4OVAA 4XK8E 2OTLA 3CQTA 2EQIA 4F7UB 2FB7A 1WHJA 2F1LA 1Y0MA 1H3ZA 2DLPA 4ZNXA 3HRTA 4J9GA 3MKDA 2Y90A 5HKCA 3L2QA 3MEVA 2EYZA 2FL7A 1X01A 3BFMA 1RLPC 3CCJQ 3IKMB 1OYXA 4Z8AA 3GOXA 1GL5A 3CMET 2SRCA 2I4NA 4J83A 2Q5IA 2EKOA 1M4ZA 2RJEA 5KYWA 4M7AB 2WSCE 3A31A 3HXVA 2AHJB 4L87A 3M4YA 4N4GA 2BZXA 4OB3B 4LVMA 4MDWA 1M9SA 1EVKA 2E10A 2X3WD 4E7ZA 3UFGA 4QQ6A 3KUFA 1X2KA 2E12A 1NPRA 3EGDB 1PD0A 3MJXA 3OYIA 4OMQA 1K9AA 2GF7A 5KYXA 2EFIA 3HFVA 5C6SA 3GIBA 4XU3A 3RKYA 3OMGA 1WYXA 2JZ2A 3V8JA 1E1OA 2HBPA 3VS0A 2DETA 2EYXA 4UPAA 1WDXA 4P5NA 2I4MA 3VQWA 2HDAA 3SEMA 5GAN2 1U8RA 2LC4A 1D1CA 2HD0A 4IKFA 2RMOA 2IVWA 4HCBA 4Q15A 4RQFA 1K8AR 2CS7A 4GY5A 4ZTZB 3P8VA 1UHFA 5FRNA 3JSCA 2ZZEA 3C95A 1R0BG 4N0AA 1QVGP 2R58A 2ZTGA 5GAOr 4E2FB 5D7UA 1VYUA 4OMNA 1QKXA 4YRQA 1NLOC 1M8VA 1VQOT 1I07A 5LJ3h 5CKEA 1PYSB 4H2SA 1Q82C 2V8KA 2YUOA 2P5IA 4KQEA 2EWNA 3JV3A 1VQ9A 2HL5C 4ZN1A 4IUVA 1BIBA 1ASZA 2PTKA 1U06A 3I5RA 1D1BA 1C6VX 4YROA 2BIVA 1SEMA 1ZSGA 4LVKA 1VQ4A 1M1GA 4YRMA 4LDXA 3S3MA 3MEAA 2OTLT 2JUFA 1IGUA 2XIDA 3HPWA 4RG8A 2DXBA 5J26A 5GANj 2ECZA 1JJCB 2G6FX 4X9CA 2DU5A 4RG2A 4YRNA 1MMDA 2DYIA 4M75B 2AKLA 4M7DE 1VQNA 1AWWA 3PMTA 3RMSA 3QBYA 2W0ZA 2RHQB 4KH1B 2KRNA 2DIQA 3L42A 4CH5A 5KYUA 5CQYA 1B3QA 2EVRA 2Y4XA 3G7ZA 2M51A 2LQNA 1T0JA 1OU9A 2LQKA 4C0ZA 1IHWA 3CPWS 1AWXA 5KYNA 1PWTA 3P8HA 5KE3A 3CC4T 4YRGA 2M0YA 2LT1A 1GGMA 4H2WA 1J5WA 4A54A 4M77D 1LVKA 4KRTA 1KD1C 2H8HA 5GAMj 2NS6A 3HFZA 1SRLA 1KC8R 2FVUA 2L0AA 2P84A 1KSWA 1JXOA 2OAWA 1K9MC 1M2OA 5GAOq 2A28A 2KRSA 3CCRA 1IL2A 4FSXA 3HKSA 3CCST 1WU7A 4BUGA 5KYYA 3A8MB 3QDFA 3SWNC 1SRYA 4YRJA 2QHSA 3JCMV 9ATCB 2IY5B 3UWNA 1KQSA 2HAXA 4XTVA 2EGAA 2K3BA 4K11A 1VQ8T 4F04B 2CJAA 4X34A 3SWNB 3FDRA 3JB9I 1K73C 3G4ST 4PJMA 3VS3A 2LZ6B 2ZIMA 3OW2P 4M77B 4TTVA 3OW2S 2FZCB 2VASA 4C8QE 4P73C 1M5Q1 1WXUA 1Q81R 2V1QA 2LQ8A 3P8TA 1NBEB 1WHMA 2GGRA 4XTYA 3CMAA 4C92E 4FT4A 4D8KA 2AZSA 2E41A 2KE9A 1JQQA 2V1RA 5LJ3f 2OAUA 4H2UA 3ZL7C 3N5BB 4M77G 1QE0A 5C52B 4MDXA 4YRTA 3CCSA 2ZPHB 4C0FA 3CMQA 1HXDA 2VB6A 2RF0A 4KGXB 4M75G 3X24B 2MMPA 1QF6A 4YDQA 1G3WA 3H6ZA 4P72A 1SSFA 2HKQB 3E9IA 3NENA 5CCAA 2JW4A 4AH6A 5J3BA 1G2BA 1B7YB 5LJ3e 1Q86C 1JJ2S 4LD9K 4MMLA 1LOJA 1AWOA 1W66A 3ULRB 3GP8A 1VQMT 4C5HA 4ELYC 3M4GA 1GFDA 3V7CA 2EJFA 2QHVA 4H2XA 1GFCA 4M7AC 2E4HA 3MF2A 1X2HA 3FLGA 3RNJA 3PCOA 2E6ZA 5GANf 1I81A 2WSEE 5CVIA 1VQNT 1W1FA 1YIJQ 3V8KA 4DBHA 4BDZA 3M0PA 1Q7YU 3CBOA 4GLKA 1YWOA 3VV0A 5CO7A 2K5IA 3CCJA 3OD1A 4EX5A 2X9HA 5LJ3d 4J7IA 4CS2A 1VQ4T 1OV3A 2OJ2A 1YJ9Q 1AD5A 4J9IA 2V8JA 3QZ9B 4P71A 4LVIA 4Y91A 2PVGB 2P0KA 1UEBA 3RESA 3CMAT 2EW3A 4P72C 4OMLA 1FMVA 2JMCA 5M9OA 2VKNA 2VGNA 2HKNA 3R6NA 5LJ5d 4HCZA 3TSWA 2GBQA 1VQOA 5CIUA 4JJCA 1KK7A 1D3BB 2JM8A 1E22A 4AFQC 1QP3A 3ME9A 4GLMA 1VQ8A 2ZT5A 4N4HA 2P0LA 3REBB 1X55A 4RTVA 2ATCB 3A5ZA 1RAGB 3SD4A 1V1CA 2QI2A 5FU6C 4CH3A 4LD6A 1TS9A 2RQTA 3QJYA 4J9BA 2ENMA 1FMKA 2CSIA 2QTVA 4FL6A 1AZGB 3T9NA 5LJ5e 1HYOA 5GAMe 4PL6A 3I35A 1X43A 2HQEA 2JNGA 5D6WA 4DQ2A 1RL2A 2HL3A 2QDYB 2B86A 1Z9ZA 2LCLA 4M7DA 2PU9B 2I4OA 3VS2A 3I56Q 1VQPQ 5A0DA 3RR6A 1B7TA 1VQLQ 1K1ZA 2C0OA 2AK5A 4DEXA 2CP3A 3QXEB 2AKWA 3QTCA 2JMAA 1TSFA 2QXFA 4KGZB 3SFMA 3LWHA 3DSQA 2XKOC 1VQ4Q 5GANd 2ZZGA 4UC4A 2ALYB 3CMEA 1SRMA 3MEUA 4JJDA 2PVOB 1QVPA 4JRQA 2RJFA 3MP6A 2LX7A 3CD6T 1MGQA 1AHJB 2VUBA 4ZIBA 4B9WA 1YFRA 1JEGA 1YI2A 4KR2A 5C0MA 1WX6A 4QW2A 3TEGA 3HY0A 2LJ1A 1KD1U 2KI7A 1UDLA 1I5OB 4XU2A 3PVQA 1ZLMA 1AVZC 2KYBA 2BZ8A 1K9MU 3A98A 2K2VA 4PNOA 1PCXA 4M78A 4XQ3A 4E51A 1M90C 4M7DC 3JCMW 6AT1B 3JCMd 4XU1A 2LTOA 1EIYB 1UGPB 5IHNA 1ASYA 3CXCP 2DL3A 1V76A 3M9QA 2QA4A 1G51A 2P4TA 4ANJA 1MNEA 3LSSA 1FYFA 4J5YA 4YCVA 3L2ZA 4FU6A 2V8IA 2ARUA 3H0IA 2E6NA 3H0FA 1VQMQ 1UB4A 4C92G 5GJWB 1UTIA 1ZBJA 1B34A 2KQWA 2PZ1A 2AMCA 3JCMJ 4IURA 1X75C 2LDMA 2GFAA 3IG2A 2C0TA 1XOVA 1ZUYA 1YWPA 2ZGWA 1WJQA 1RIQA 4O5VA 2KY9A 3OYNA 3S3NA 5KYUB 2EYQA 2WACA 2YDLA 4YREA 1N8RU 4H2XB 1HSQA 2ZPEB 3GNFB 2DE0X 5GAN3 2RH2A 3NTHA 2ZZFA 2P0QA 2RK2A 2R5AA 2Y4YA 4RCCA 1BI1A 1W6XA 2EAYA 4YP0A 2Z0WA 2EL9A 2DL4A 2NLUA 3GPLA 3OYMA 2W10A 1GXIE 1EVLA 2E5AA 4HCKA 1U5SA 2PUOB 5IT9E 1OZ3A 2RHIA 1NJ5A 4P3NA 4C92F 1S72T 4M77F 5GMKl 2KDSA 4HA8A 1YJNA 3JB9H 4RDXA 3NFCA 3S6WA 2D9TA 5C53B 3UATA 2XG8D 1X54A 2Q7GA 2MIOA 1OPLA 2ZAEA 4NOYA 2IY5A 5GAMg 2OTJQ 3OBWA 4BY6B 2ZPFB 5ELNA 1NEGA 2D6FA 4F16A 2I4LA 2A36A 5L23A 4PFOA 2KNBB 4PJJA 1ADJA 4CH6A 3RMQA 3I55T 1ACMB 3QDRB 2OI3A 2DD4A 2DX1A 5A2QE 2P4RA 5C51B 1VQNQ 4A4HA 4AFSC 3CCJT 2XDPA 1IZ6A 4ZGJB 2O2OA 4EMKA 1YNZA 2MI6A 3TUPA 3NTIA 4C8QC 3VS5A 1YJ9T 3LLRA 3L2RA 1M1KU 5CKDA 1E6HA 1M3AA 4P3PA 2C0IA 2GQVA 1DJ7B 1Q95G 2MAMA 3JB9D 1NYGA 3A5YA 5CK9A 5ELOA 1YITA 4HT4A 1B76A 3JB9G 2KAFA 3M57A 2H3JA 2X4YA 3JB9F 1EIYA 3VBBA 4HVCA 4L59A 1SKUB 4DPGA 4ZTFA 1LNXA 3OBYA 2LX9A 4ATOA 1KD1R 2MCNA 2RHUA 1VIFA 4JLIA 4FSSA 1F1BB 5EG2A 3A32A 2MYSA 2QQRA 1M30A 1UE9A 1R0CB 2BE9B 4A4GA 1M2VA 2H3EB 1NPPA 1QMCA 4ZN3A 4PJOB 3CC4Q 8AT1B 3JCMh 2QGGA 4DBFA 4YTLA 1QVFS 1D09B 1UGVA 1N9WA 3L2VA 3FIFA 5FROA 3LH5A 1SESA 4YPFA 3HP9A 1V29B 2A37A 1TXQA 2K7AA 1YJWQ 1I5LA 1OOTA 3JCMg 1Y07A 2NUTB 1J3TA 3C0CA 2CH4A 4CH4A 1TUDA 1WQ7A 1W2BP 4II1A 4CC3A 2PMEA 4Z02A 1RABB 4YRPA 5CKFA 1JRIA 1NLPC 1EX4A 3G4SQ 3JB9J 2ZNJA 3CCRT 1G3YA 2EJGA 2L3SA 2KSSA 2QEXQ 3CCMT 1M90U 1QQJA 3MP1A 4BE2A 3CD6Q 3EG9B 2LCSA 4XU0A 3TREA 3HFNA 1MHNA 3M5AA 1NJIC 1S1NA 1N6AA 1QVFP 1PRLC 1WLEA 3QO5A 4YRIA 2D1XA 4K88A 3H41A 4C5GA 3PE0A 3G1JA 1H8KA 1WLPB 2DDZA 4PK4A 4J9DA 1QKWA 4YRCA 1JJ2P 2DA9A 4KULA 1E6GA 4TVAA 3I7FA 4YRSA 2DO3A 4K86A 1YN8A 5LJ3j 4C8QG 5EC7A 1BI0A 2M1HA 2RHZA 1WYDA 2EPDA 5K1PA 4OB2B 1NJ1A 4TQDA 3EAEA 1YHQQ 2C7IA 2GCXA 4N4IA 2KMTA 1QCOA 1E24A 2DM1A 2AT1B 1NJ6A 2M02A 3SWNA 4YCUA 4HVWA 4PHCA 1QP2A 3CXCA 2RI5A 3HXZA 2JXBA 1VQ6A 1VQPA 3CC7A 1VQOQ 1YIJT 5E3IA 4Z89A 1JXMA 1YHQT 2R5MA 1Y96A 3I55Q 1BK2A 3A8HB 1YJ9A 2RHSB 2DK3A 1H4TA 7AT1B 4PJOG 4AFZC 5GANe 3KFUA 4P73A 3GF5A 3DLMA 2QQSA 1K0XA 4C8QF 4C92A 4ZGDB 2B8AA 2HNIA 1VQKA 4RTZA 1M2VB 3OMCA 2QEXT 3CCMQ 2RD1A 1TUGB 4JPBW 1KQ2A 3G71Q 3CCVA 1BCOA 3I56T 3EFOB 3VYGA 2XD0A 3HHTB 1W2BS 2AIRB 2VXEA 3E9FA 1JB0E 3E9HA 1GCQC 3EFRA 1VOMA 3M0TA 3I56A 2KBTA 2WSFE 2QGFB 1ZA1B 4FIBA 2CP6A 1SHFA 3NETA 2K3YA 4RMOA 2XHCA 1R8OB 4ESRA 3BDLA 3UDCA 1YFNA 3UH0A 2BUDA 4O6JA 3VUBA 3PTAA 3CCQQ 4EPCA 4M7AA 1G5HA 3GNGA 1VQ7T 2XI9A 2DXCA 2QQAA 2L89A 4XEOA 4EDUA 3CPWA 2XTIA 2E65A 4QVDA 1AT1B 4IIMA 3LW5E 4XAXB 1B70A 1G8XA 4KUDK 1UGQB 2AZVA 1WA7A 3QG1A 4AT1B 5DM7R 3A7AA 3UT1A 1RAAB 2CDTA 2ZR3A 2FZKB 5FRMA 1H4QA 1H4SA 3F70A 5GMKm 2O31A 1AWJA 4C8QB 1XNIA 5GAOp 2X35A 2X4WA 2ZPGB 5GAN5 2FHDA 5ECAA 1GCQA 2CT3A 4KH0B 4JDSA 1WHKA 3EG0A 1Y7XA 4F7UG 3A7UA 3I9QA 3VS4A 2E5KA 4XTWA 1M90R 2COZA 2ZCEA 1QLYA 2PUKB 1KQSP 5GMKh 1WIEA 3CCRQ 5GAMf 3UPUA 3QPHA 2X3XD 2ROTA 5D6XA 2RI2A 3CPFA 1JU5C 5KCHA 1YIJA 1VQMA 2DVEA 3REXA 5IXFA 4Q6GA 2FG0A 4F14A 1YJNQ 3NMZC 2JN0A 3C94A 1NJ2A 2O4XB 2DXUA 4OLFA 4C0DC 2KR3A 3OQ5A 1RACB 3OS2A 3OY9A 4M7AD 2ZT7A 3JCMe 2DL7A 2OTJA 1T3SA 3QZ5B 1K9MR 1BBUA 1UG1A 3CCUA 3A8GB 2X4JA 4PKCC 1QCNA 3BDUA 2IG0A 3OS5A 1X56A 4WI1A 1Q7YR 4TVWA 2GTOA 1AEYA 3IALA 2ZIOA 5FU6B 3LWIA 3OA6A 1S72A 2LNHB 2O9SA 2G3RA 2HCKA 3CCLQ 3G1ZA 4ORZA 2EGCA 4BI4A 2LVMA 3EGXA 1WJRA 2LQWA 1M1KR 4OF1A 3Q1JA 3RBBB 3G4SA 1M1FA 5LJ5h 1GBRA 3OYEA 4FYWB 3OYAA 4RKUE 1IREB 1YITQ 2X4XA 2YRDA 4JUVA 1NNHA 2BZYA 4DA4A 2X51A 4YYEA 1MUZA 2EQJA 2YXYA 5GMKj 1ZX6A 4PJOA 3E1SA 4LDUA 1RAIB 3EG1A 4NL3A 5CQXA 1ABOA 1MMAA 4LDWA 1P92A 4KBMB 2COYA 5KYYB 4CI0C 2XDBA 3EH1A 1N8RC 2CP2A 3HRSA 3HRUA 2RI3A 1WXBA 3DB3A 2Q7HA 1MNDA 1C1AA 2SEMA 4BD3A 1VQLA 1Y57A 1QVFA 1K8AC 2K5FA 4C5EA 4FW1A 3CC4A 4X5OA 2HQHA 1QW1A 2EIFA 3EH2A 1YBYA 2AMCB 2BTTA 3UGTA 3NPFA 1LPLA 4C92C 1KMMA 1H641 3OS1A 2A0FB 4CC4B 1X2GA 3HY1A 1KQSS 1ABQA 4FT2A 1VYVA 2QHTA 3UA7A 2CP0A 4H2VA 2CIMA 2YHTA 1ZSZB 2ESWA 2A7YA 2FRWA 1U1SA 3I55A 1X2QA 1O75A 1VQ8Q 3CCLT 3M0UA 2QG9B 2RHQA 2ED1A 4XTXA 2AKKA 1FMWA 3OW2A 4YCWA 5GMKi 2ZR2A 3H0HA 1IB8A 1Q82U 2DEUA 1HD3A 1PD1A 3QIIA 4M75C 3X25B 4FW2A 1Z7NA 2G4CA 2HSPA 2J7IA 3HSBA 1R77A 4XTUA 1CKBA 3RF1A 4M77C 1UJ0A 3VKIA 4Z88A 4FM4B 4OB0B 1SF9A 3MPUB 5K1XA 4XEMA 3QYGB 5HK3A 1UGRB 2FRYA 2JOYA 4TQFA 1YGBA 1U3OA 2KGTA 3FEOA 3QKJA 2ODRD 4C8QA 4PFZA 4E7IA 4M75E 2RNAA 5IH2A 1NZ9A 4M7DB 4KUIA 1W70A 4LNPA 1WPYA 3NEMA 3VQVA 3EG3A 3D7SB 4DBRA 5IXBA 4M78F 3JCMc 4C5IA 3WXMB 4HWRA 1EZZB 5LJ5j 2COWA 4JRKA 3VS6A 2QYZA 3M0QA 1YJWA 3OSVA 2QEXA 5GAOn 2KYMA 3L4GA 3JCMQ 2DYBA 1UHCA 2K4YA 2XDDA 1ZQ1A 3HXUA 1D1AA 2D8HA 4M75F 3ZEHA 5FU7C 4BI3A 2DQ3A 3V7RA 2KT8A 2VWFA 1Q82R 3ZBDA 11ASA 3VU3C 2V26A 4E7LA 5GAMh 1CKAA 1IRXA 2KT1A 3CC7T 1LJOA 5LL6S 2ZINA 2VV5A 1NG2A 4JRIA 5FLXE 2F2VA 3U23A 1YB3A 5IN1A 2XMFA 2LRQA 5GMKe 3CCVQ 1K73U 5GAMd 1ZUUA 4YRFA 1C0AA 3UF4A 2Q5HA 2O88A 4RMFA 3QWXX 3VUZA 1KHIA 1NYFA 4HVUA 3EGXB 2CUBA 4F7UA 3M4PA 2L2PA 1FX7A 5L8RE 2QQ9A 2PVDB 1VQ5Q 2DKGA 2RB6A 1TTHB 1WI7A 1K0SA 3FC3A 2EYWA 1VQ6Q 1WHHA 4CS3A 3PIPA 5GAN4 3C12A 1Q86R 3RGLA 2QAZA 3DKMA 4JS4A 2ZNIA 5HY6A 2ZXFA 1YHQA 1OI1A 1RLQC 2MWOA 2DEQA 1OZ2A 3TEEA 4NCXA 3NHNA 3KBGA 1VYTA 1TG0A 4QT7A 4JZ3A 3MCAB 3KXTA 2YRVA 3R6OA 1VQKQ 1U1TA 2L8DA 4J8OA 4AMCA 2ARSA 3LC0A 4M7AG 1EIFA
chains in the Genus database with same CATH topology
2E5QA 3L1AA 4OMFB 3G6EA 2ZZDA 3OYJA 3CBMA 3X28B 3JRZA 2M0OA 4M75D 3M53A 2A8EA 4G84A 4CRIA 3E19A 3QYHB 2ZT8A 2E64A 3CD6A 3BY7A 2ZCFB 1YJNT 3OYYA 2ZPIB 3CCQA 4OGCA 4HT9A 4M78D 3UGQA 2RJCA 4DOVA 2DU7A 3P8BB 2RA2A 1Q86U 3CXCS 4PJOE 4BACA 1PSEA 2JTFA 5CAIA 2MWPA 4E47A 3FJPA 4M77A 3SB2A 3LYIA 2ODRC 4ZGEB 2RM4A 1VUBA 4PJOF 4L6V5 4P74A 3VYHB 1G5VA 2CZ0B 1KHCA 5DLOA 3VQXA 4KR3A 1VIEA 5GAN6 2L3RA 3QO3A 4TVRA 1BBWA 2VXFA 4G85A 3OYLA 4BI8B 5KH6A 3CC2A 2DAQA 1EFWA 3META 3WQZA 3L2UA 2DIGA 3G71A 1NYQA 1SETA 1I8FA 3M4QA 1G3SA 4RCBA 3RACA 1N27A 5IAYA 2L5QA 2VYTA 3URGA 4JS5A 3H8ZA 3CCEA 1VQ6T 3INZA 3AHUA 3J80E 3MF1A 5KNNA 2K57A 2RHYA 3HRKA 2EJ9A 2C06A 2F5KA 2O01E 4M7DF 4LDYA 3RKWA 3LGLA 4M7AE 4N0AC 3CCET 3JCMX 4BB7A 1YITT 1BIAA 3MEYA 4EMGA 2AKWB 1Q7YC 1USYC 3PZCA 4M78G 1VQ5T 1Y96B 5A0GA 1QVGS 4F7UE 5F5WA 3LGFA 4ME7A 5GAOm 3QJ6A 2RHSA 3QO7A 3CC2T 2M16A 1H4VB 1JJ2A 3TEHB 3CCMA 1KC8C 2DXTA 2R57A 1Z7MA 4C0GA 4HWPA 4A53A 5DY9A 5HGQA 4ZTJA 4RQEA 3PIOA 4TVYA 3QUIA 4P75C 5FU7B 1L0WA 3M56A 2DZ9A 3OYDA 1BI2A 2CJ9A 3PMIA 2YLBA 2PMFA 4V2SA 1B7YA 3MEWA 3NTKA 3EFSA 4C0DB 4C92D 2EQKA 5GANg 1KMNA 2F69A 4R55A 3JCMf 3ASKA 3HXWA 4B9XA 1PYSA 4YRRA 2DJZA 4HT8A 4IUTA 4O2DA 1RI0A 1B8AA 4PJOC 2BKDN 3C4SA 4OGEA 3W3SA 4IUQA 1JBMA 2J3MA 4HCCA 5CR2A 4P74C 4KT0E 2KVQG 4TVAB 3ER0A 3OYGA 2QTXA 3TU4K 1JJCA 4IUPA 2EQMA 1O9SA 3A5ZB 3HXYA 3HTZA 2E70A 4IUUA 4HKEA 4Y28E 1ADYA 3RKXA 2E1HA 3G71T 5AYFA 1G3TA 2QQBA 4DOWA 1VQZA 3S3OA 4OB1B 1Y71A 2E3CA 3JCMP 5GAN7 3A8LB 3HL8A 4H2YA 1YI2T 2JVVA 4J15A 4BW9A 3LSQA 1VQ9T 4MZMA 2C8MA 2RHXA 4LNSA 5I2MA 2XU8A 4X9DA 1VQ7A 2XGTA 2DTOA 3JAME 1NJ8A 1Q81C 2K5LA 5LJ5g 4M75A 5CKBA 3MHXA 4MZPA 2I2LA 4J6YA 3MP8A 1YJWT 3R07A 1WJSA 1W4SA 3OB9A 1KOGA 4P71C 1NJIU 4JJNK 2CGHA 2ALYA 1N9RA 2GFUA 4C8QD 4HWTA 3M55A 2A3LA 4K87A 1YFSA 3QSUA 2XICA 5LJ3g 2OTJT 2J3LA 3VJPA 4PG3A 2DTIA 2DTHA 4R56A 3QO8A 4M78B 3G6ET 1VQKT 1WQWA 3M58A 3ICAA 4LVLA 2PQWA 2XK0A 3FRNA 1ATIA 2CYZB 4QQDA 2DPPB 5DLQE 3VQYA 3TEHA 4A4KA 4VUBA 3DLLA 3RL6A 1ZHIA 3SDZA 2VGMA 5GAN8 4QVCA 4UP7A 4NL2A 1VQ5A 2QA4T 3WVEB 5GANh 2DQ0A 2F5TX 3OSSC 4HWOA 3HRIA 2LCCA 3CCLA 3A8OB 1ZBXA 2KK4A 3L4GB 3LX7A 5A0LA 4QVZA 4HWSA 3JCMb 3M54A 3NELA 4P75A 2CZ7B 2CKKA 4YRLA 4ZTUB 1HC7A 4BDYA 4BE1A 1N9SA 3RUXA 2LT4A 4OP0A 12ASA 5I21A 2ARTA 4NS5A 2CJBA 1VQLT 4M77E 1M1KC 1NYRA 3OYBA 4EO4A 4QQGA 3M59A 1LYLA 2K3XA 2O4XA 1E1TA 2RK1A 3PCOB 2FYKA 3DB4A 3IKLA 1FWZA 3OYFA 1G5IA 4A4EA 2LNVA 2M9UA 3HFZB 4A4FA 4XTZA 1HK9A 4BY6C 4LVJA 2CZ1B 2MF2A 4JLGA 3RIRA 4J7FA 4D6WA 4BWAA 1KC8U 1QVGA 1VQPT 4TWAA 4UP8A 3OYHA 1FXXA 2QHUA 1WGSA 1D3BA 4YRKA 1EQRA 1YCYA 5D6YA 3CCUT 2Q7EA 4H2TA 1UGSB 1XTDA 3J81E 1I4K1 4MMKA 4LDVA 3L2WA 5GAOl 1BKBA 3X26B 5CKHA 3MO8A 3OYCA 4P3OA 3QNEA 5KCOA 1W2BA 1XQHA 1TH7A 2RO0A 5HK0A 1KG1A 4M7DD 4M7DG 3BW1A 3X20B 3ERRA 4Q5WA 1B70B 2JTMA 4BE0A 2D0QB 1BI3A 5LJ5f 3PFSA 3E9GA 2EQUA 3P8DA 4EMKC 3FB9A 3REUA 2HQXA 3QHSA 1BYMA 3RERA 4EMHA 1HTTA 1PSFA 1X6OA 3PT9A 4M78E 1WNLA 3V8LA 3HXXA 3J7AF 4JRPA 4CS4A 1SERA 1EOVA 2YLCA 2DZCA 3TCJA 4E7HA 4PLLA 4J6XA 3PNWC 4PJOD 1NE8A 3CCQT 4H02A 3HFOA 1USYA 1K8AU 2VC8A 3LH0A 2ZT6A 3BJUA 2ZPBB 3O8VA 4L5GA 3ZFJA 4M78C 3A74A 3P8YA 3A7RA 4WJ4A 3CCVT 3GLXA 3PGGA 1B34B 3V7SA 3OYKA 4MZTA 4E7JA 2DD5A 5I2SA 4PLIA 1Q81U 4UP9A 4ELZC 1YFTA 4F7UF 2CZ6B 3CBPA 3MQZA 4J6WA 2P0PA 3OS0A 4WJ3M 5KE2A 4WF2A 4EMKB 4C92B 4M7AF 1KQ1A 3WVDB 4E7KA 5J39A 3CEYA 2RJDA 4OVAA 4XK8E 2OTLA 4F7UB 2FB7A 1H3ZA 3HRTA 5HKCA 2Y90A 3L2QA 3MEVA 2FL7A 3BFMA 1X01A 3IKMB 1OYXA 3GOXA 3CMET 2I4NA 4J83A 2Q5IA 2EKOA 1M4ZA 2RJEA 3A31A 4M7AB 2WSCE 3HXVA 2AHJB 4L87A 3M4YA 4N4GA 4OB3B 4LVMA 4MDWA 1M9SA 1EVKA 2E10A 3UFGA 4QQ6A 3KUFA 2E12A 1NPRA 3OYIA 2GF7A 3HFVA 2EFIA 5C6SA 3GIBA 4XU3A 3RKYA 3OMGA 2JZ2A 3V8JA 1E1OA 2HBPA 4UPAA 4P5NA 2I4MA 3VQWA 5GAN2 1U8RA 2LC4A 2HD0A 4IKFA 2IVWA 4HCBA 4Q15A 4RQFA 2CS7A 4GY5A 4ZTZB 3P8VA 5FRNA 3JSCA 2ZZEA 3C95A 4N0AA 2R58A 2ZTGA 5GAOr 4YRQA 1M8VA 1VQOT 5LJ3h 5CKEA 1PYSB 4H2SA 1Q82C 2V8KA 2P5IA 4KQEA 2EWNA 1VQ9A 4ZN1A 4IUVA 1BIBA 1ASZA 4YROA 2BIVA 4LVKA 1VQ4A 1M1GA 4YRMA 4LDXA 3S3MA 3MEAA 2OTLT 2JUFA 2XIDA 3HPWA 4RG8A 2DXBA 5J26A 5GANj 1JJCB 4X9CA 2DU5A 4RG2A 4YRNA 4M75B 4M7DE 1VQNA 3PMTA 3RMSA 3QBYA 2RHQB 2DIQA 3L42A 4CH5A 5CQYA 2Y4XA 3G7ZA 2LQKA 4C0ZA 3CPWS 3P8HA 5KE3A 3CC4T 4YRGA 4H2WA 2LT1A 1GGMA 1J5WA 4A54A 4M77D 1KD1C 5GAMj 2NS6A 3HFZA 2FVUA 1K9MC 5GAOq 3CCRA 1IL2A 4FSXA 3HKSA 3CCST 1WU7A 4BUGA 3A8MB 3SWNC 1SRYA 4YRJA 2QHSA 3JCMV 2IY5B 3UWNA 1KQSA 2HAXA 4XTVA 1VQ8T 2CJAA 4X34A 3SWNB 3FDRA 3JB9I 1K73C 3G4ST 2ZIMA 4M77B 4TTVA 3OW2S 4C8QE 4P73C 1M5Q1 2LQ8A 3P8TA 4XTYA 3CMAA 4C92E 4FT4A 2E41A 5LJ3f 4H2UA 2OAUA 3N5BB 4M77G 1QE0A 5C52B 4MDXA 4YRTA 3CCSA 2ZPHB 4C0FA 3CMQA 1HXDA 4M75G 3X24B 2MMPA 1QF6A 4YDQA 1G3WA 3H6ZA 4P72A 1SSFA 3NENA 3E9IA 5CCAA 4AH6A 5J3BA 1B7YB 5LJ3e 1Q86C 1JJ2S 4LD9K 4MMLA 1LOJA 1W66A 3GP8A 1VQMT 4C5HA 4ELYC 3M4GA 3V7CA 2EJFA 2QHVA 4H2XA 4M7AC 3MF2A 1X2HA 3FLGA 3PCOA 2E6ZA 5GANf 1I81A 2WSEE 5CVIA 1VQNT 3V8KA 4BDZA 1Q7YU 3CBOA 4GLKA 3VV0A 5CO7A 2K5IA 3CCJA 3OD1A 4EX5A 5LJ3d 4J7IA 4CS2A 1VQ4T 2V8JA 3QZ9B 4P71A 4LVIA 4Y91A 2PVGB 2P0KA 1UEBA 3RESA 3CMAT 4P72C 5M9OA 2VGNA 5LJ5d 4HCZA 1VQOA 5CIUA 1D3BB 1E22A 1QP3A 3ME9A 1VQ8A 2ZT5A 4N4HA 2P0LA 1X55A 3A5ZA 3SD4A 2QI2A 5FU6C 4CH3A 4LD6A 3QJYA 4FL6A 3T9NA 5LJ5e 5GAMe 4PL6A 2HQEA 2JNGA 5D6WA 4DQ2A 1RL2A 2QDYB 2LCLA 4M7DA 2PU9B 2I4OA 5A0DA 3QXEB 3QTCA 2AKWA 2QXFA 3SFMA 3LWHA 3DSQA 2XKOC 5GANd 2ZZGA 4UC4A 2ALYB 3CMEA 3MEUA 2PVOB 1QVPA 4JRQA 2RJFA 3MP6A 3CD6T 1MGQA 1AHJB 2VUBA 4ZIBA 4B9WA 1YFRA 1YI2A 4KR2A 5C0MA 4QW2A 3TEGA 3HY0A 1KD1U 4XU2A 1K9MU 2K2VA 4PNOA 4M78A 4XQ3A 4E51A 1M90C 4M7DC 3JCMW 3JCMd 4XU1A 2LTOA 1EIYB 1UGPB 1ASYA 3M9QA 2QA4A 1G51A 2P4TA 3LSSA 1FYFA 4J5YA 4YCVA 3L2ZA 4FU6A 2V8IA 2ARUA 2E6NA 1UB4A 4C92G 1B34A 2KQWA 2AMCA 3JCMJ 4IURA 1X75C 2LDMA 2GFAA 3IG2A 1XOVA 2ZGWA 1WJQA 1RIQA 4O5VA 2KY9A 3OYNA 3S3NA 2EYQA 2WACA 4YREA 1N8RU 4H2XB 2ZPEB 3GNFB 5GAN3 2RH2A 3NTHA 2ZZFA 2P0QA 2Y4YA 2R5AA 2RK2A 4RCCA 1BI1A 2EAYA 4YP0A 2EL9A 2NLUA 3GPLA 3OYMA 1GXIE 1EVLA 2E5AA 2PUOB 5IT9E 1OZ3A 2RHIA 1NJ5A 4P3NA 1S72T 4M77F 5GMKl 2KDSA 4HA8A 1YJNA 3JB9H 4RDXA 3NFCA 3S6WA 2D9TA 5C53B 2XG8D 1X54A 2Q7GA 4NOYA 2IY5A 5GAMg 3OBWA 4BY6B 2ZPFB 5ELNA 2D6FA 2I4LA 1ADJA 4CH6A 3RMQA 3I55T 3QDRB 5A2QE 2DD4A 5C51B 4A4HA 3CCJT 2XDPA 1IZ6A 4ZGJB 4EMKA 2MI6A 3TUPA 3NTIA 4C8QC 1YJ9T 3LLRA 3L2RA 1M1KU 5CKDA 4P3PA 2GQVA 1DJ7B 2MAMA 3JB9D 3A5YA 5CK9A 5ELOA 1YITA 4HT4A 1B76A 3JB9G 2KAFA 3M57A 2H3JA 2X4YA 3JB9F 1EIYA 3VBBA 4HVCA 4L59A 4DPGA 4ZTFA 1LNXA 3OBYA 2LX9A 4ATOA 2RHUA 1VIFA 4JLIA 5EG2A 3A32A 2QQRA 4A4GA 4ZN3A 1NPPA 4PJOB 3JCMh 4YTLA 1QVFS 1N9WA 3L2VA 3FIFA 5FROA 1SESA 4YPFA 3HP9A 1V29B 1I5LA 3JCMg 1Y07A 4CH4A 1WQ7A 4II1A 2PMEA 4Z02A 4YRPA 5CKFA 1JRIA 3JB9J 2ZNJA 3CCRT 1G3YA 2EJGA 2KSSA 3CCMT 1M90U 4BE2A 3MP1A 4XU0A 3TREA 3HFNA 1MHNA 3M5AA 1NJIC 1N6AA 4YRIA 1WLEA 3QO5A 4K88A 4C5GA 2DDZA 4YRCA 4KULA 4TVAA 3I7FA 4YRSA 2DO3A 4K86A 5LJ3j 4C8QG 1BI0A 2M1HA 2RHZA 1WYDA 5K1PA 4OB2B 1NJ1A 4TQDA 3EAEA 2C7IA 2GCXA 4N4IA 2KMTA 1E24A 1NJ6A 3SWNA 4YCUA 4PHCA 1QP2A 3CXCA 2RI5A 3HXZA 1VQ6A 1VQPA 3CC7A 1YIJT 5E3IA 1YHQT 2R5MA 1Y96A 3A8HB 1YJ9A 2RHSB 2DK3A 1H4TA 4PJOG 5GANe 3KFUA 4P73A 3GF5A 3DLMA 2QQSA 4C8QF 4C92A 4ZGDB 2B8AA 2HNIA 1VQKA 3OMCA 2QEXT 2RD1A 1KQ2A 3CCVA 3I56T 2XD0A 3VYGA 3HHTB 1W2BS 2VXEA 3E9FA 1JB0E 3E9HA 3EFRA 3I56A 2WSFE 4FIBA 3NETA 2K3YA 4RMOA 2XHCA 1R8OB 3BDLA 3UDCA 3UH0A 2BUDA 4O6JA 3VUBA 3PTAA 4EPCA 4M7AA 1G5HA 3GNGA 1VQ7T 2XI9A 2DXCA 2QQAA 2L89A 4XEOA 4EDUA 3CPWA 2XTIA 2E65A 4QVDA 3LW5E 4XAXB 1B70A 4KUDK 1UGQB 3QG1A 5DM7R 3A7AA 3UT1A 2ZR3A 5FRMA 1H4QA 1H4SA 3F70A 5GMKm 4C8QB 1XNIA 5GAOp 2X35A 2X4WA 2ZPGB 5GAN5 2FHDA 4JDSA 1Y7XA 4F7UG 3A7UA 4XTWA 2ZCEA 2PUKB 5GMKh 5GAMf 3UPUA 3QPHA 5D6XA 2RI2A 3CPFA 5KCHA 1YIJA 1VQMA 2DVEA 3REXA 4Q6GA 2JN0A 3C94A 1NJ2A 2O4XB 2DXUA 4OLFA 4C0DC 3OQ5A 3OS2A 3OY9A 4M7AD 2ZT7A 3JCMe 2OTJA 3QZ5B 1BBUA 3CCUA 3A8GB 2X4JA 4PKCC 3BDUA 2IG0A 3OS5A 1X56A 4WI1A 4TVWA 3IALA 2ZIOA 5FU6B 3LWIA 3OA6A 1S72A 2G3RA 3G1ZA 4BI4A 2LVMA 1WJRA 4OF1A 3Q1JA 3G4SA 1M1FA 5LJ5h 3OYEA 3OYAA 4RKUE 1IREB 1NNHA 2X4XA 4JUVA 4DA4A 4YYEA 2EQJA 5GMKj 4PJOA 3E1SA 4LDUA 4NL3A 5CQXA 4LDWA 1P92A 4KBMB 2XDBA 4CI0C 1N8RC 3HRSA 3HRUA 2RI3A 3DB3A 2Q7HA 4BD3A 1VQLA 1QVFA 1K8AC 2K5FA 4C5EA 3CC4A 4X5OA 1QW1A 2EIFA 1YBYA 2AMCB 3UGTA 4C92C 1KMMA 1H641 3OS1A 1X2GA 3HY1A 1KQSS 4FT2A 2QHTA 4H2VA 2CIMA 2YHTA 2A7YA 1U1SA 3I55A 1O75A 3CCLT 2RHQA 4XTXA 3OW2A 4YCWA 5GMKi 2ZR2A 1Q82U 3QIIA 4M75C 3X25B 1Z7NA 2G4CA 3HSBA 4XTUA 3RF1A 4M77C 3VKIA 4FM4B 4OB0B 5K1XA 4XEMA 3QYGB 5HK3A 1UGRB 4TQFA 2JOYA 1YGBA 3FEOA 3QKJA 2ODRD 4C8QA 4E7IA 4M75E 1NZ9A 4M7DB 4KUIA 1WPYA 3NEMA 3VQVA 4M78F 3JCMc 4C5IA 3WXMB 4HWRA 5LJ5j 4JRKA 1YJWA 3OSVA 2QEXA 5GAOn 3L4GA 3JCMQ 2K4YA 2XDDA 1ZQ1A 3HXUA 4M75F 3ZEHA 5FU7C 4BI3A 2DQ3A 3V7RA 11ASA 3ZBDA 3VU3C 4E7LA 5GAMh 3CC7T 1LJOA 5LL6S 2ZINA 2VV5A 4JRIA 5FLXE 1YB3A 2LRQA 5IN1A 1K73U 5GMKe 5GAMd 1C0AA 4YRFA 2Q5HA 4RMFA 3VUZA 1KHIA 4F7UA 3M4PA 1FX7A 5L8RE 2QQ9A 2PVDB 2DKGA 2RB6A 3FC3A 4CS3A 3PIPA 5GAN4 3C12A 3RGLA 3DKMA 4JS4A 2ZNIA 5HY6A 2ZXFA 1YHQA 1OI1A 2MWOA 2DEQA 1OZ2A 3TEEA 4NCXA 3KBGA 3MCAB 3KXTA 2YRVA 3R6OA 1U1TA 2L8DA 4J8OA 4C92F 2ARSA 3LC0A 4M7AG 1EIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1T A;  4M77 G;  3PCO B;  1QE0 A;  1WYD A;  5C52 B;  2FYK A;  4YRT A;  3IKL A;  5K1P A;  3L1A A;  1G5I A;  1NJ1 A;  4TQD A;  2C7I A;  3CMQ A;  1HXD A;  1E24 A;  4M75 G;  1NJ6 A;  3HFZ B;  1QF6 A;  4M75 D;  4XTZ A;  3SWN A;  1HK9 A;  4YDQ A;  4YCU A;  4PHC A;  4P72 A;  4G84 A;  3NEN A;  3E9I A;  3HXZ A;  4AH6 A;  1B7Y B;  5LJ3 e;  2ZT8 A;  2E64 A;  4MML A;  1LOJ A;  3RIR A;  1W66 A;  5E3I A;  3BY7 A;  3M4G A;  1Y96 A;  3V7C A;  4BWA A;  2EJF A;  2QHV A;  4HT9 A;  4H2X A;  4M78 D;  4M7A C;  3UGQ A;  3MF2 A;  2RHS B;  1X2H A;  1H4T A;  3PCO A;  4PJO G;  5GAN f;  4TWA A;  4UP8 A;  5GAN e;  1I81 A;  3KFU A;  2DU7 A;  3V8K A;  4P73 A;  4C8Q F;  4C92 A;  2QHU A;  1D3B A;  2HNI A;  4YRK A;  2RA2 A;  1YCY A;  1EQR A;  4PJO E;  2Q7E A;  5CAI A;  3OD1 A;  2RD1 A;  4H2T A;  4EX5 A;  3FJP A;  4M77 A;  3SB2 A;  5LJ3 d;  1KQ2 A;  2ODR C;  2RM4 A;  4CS2 A;  4PJO F;  1I4K 1;  4MMK A;  4P74 A;  5GAO l;  3VQX A;  4KR3 A;  5GAN 6;  4P71 A;  2VXE A;  3QO3 A;  4Y91 A;  3E9H A;  3RES A;  3EFR A;  4P3O A;  1BBW A;  2VXF A;  4P72 C;  4G85 A;  3QNE A;  1EFW A;  5LJ5 d;  3WQZ A;  3NET A;  1TH7 A;  1NYQ A;  1SET A;  1I8F A;  3M4Q A;  3UH0 A;  4RCB A;  1D3B B;  1E22 A;  4M7D D;  4M7A A;  4M7D G;  1G5H A;  3BW1 A;  2ZT5 A;  3RAC A;  2P0L A;  1X55 A;  3A5Z A;  4XEO A;  2XTI A;  3ERR A;  2E65 A;  4QVD A;  4CH3 A;  1B70 B;  1B70 A;  3AHU A;  3INZ A;  5LJ5 f;  3MF1 A;  5LJ5 e;  2K57 A;  5KNN A;  3A7A A;  2ZR3 A;  3HRK A;  2EJ9 A;  1H4Q A;  5GAM e;  1H4S A;  4M7D F;  5GMK m;  3RKW A;  4C8Q B;  5GAO p;  4M7A E;  4EMK C;  4DQ2 A;  3FB9 A;  4N0A C;  3REU A;  3JCM X;  5GAN 5;  3QHS A;  3RER A;  4M7D A;  4EMH A;  1HTT A;  1BIA A;  3MEY A;  2I4O A;  4M78 E;  1WNL A;  4F7U G;  3V8L A;  3A7U A;  3HXX A;  4EMG A;  4CS4 A;  4XTW A;  1SER A;  2ZCE A;  1EOV A;  2AKW B;  2YLC A;  2DZC A;  3QTC A;  1USY C;  2AKW A;  3PZC A;  5GMK h;  4M78 G;  1Y96 B;  4J6X A;  4F7U E;  5F5W A;  5GAM f;  3DSQ A;  5GAN d;  5GAO m;  4PJO D;  2ZZG A;  2ALY B;  2RHS A;  4H02 A;  3HFO A;  3QO7 A;  1USY A;  2VC8 A;  2DVE A;  3REX A;  1MGQ A;  4Q6G A;  4ZIB A;  2ZT6 A;  3BJU A;  1H4V B;  2JN0 A;  1NJ2 A;  1YFR A;  2DXU A;  3TEH B;  4KR2 A;  4OLF A;  3TEG A;  3HY0 A;  2DXT A;  4M78 C;  4M7A D;  3A74 A;  2ZT7 A;  3JCM e;  1Z7M A;  3P8Y A;  3A7R A;  4WJ4 A;  4XU2 A;  4HWP A;  4A53 A;  1BBU A;  3PGG A;  5DY9 A;  5HGQ A;  4RQE A;  1B34 B;  3V7S A;  3BDU A;  4TVY A;  3QUI A;  4PNO A;  4M78 A;  4XQ3 A;  4E51 A;  4M7D C;  4UP9 A;  3JCM W;  1X56 A;  4WI1 A;  4P75 C;  3JCM d;  1YFT A;  4TVW A;  3IAL A;  4XU1 A;  4F7U F;  2ZIO A;  1L0W A;  1EIY B;  1ASY A;  2DZ9 A;  4J6W A;  1G51 A;  3G1Z A;  4WJ3 M;  2CJ9 A;  2YLB A;  2PMF A;  4V2S A;  1B7Y A;  3LSS A;  1FYF A;  4J5Y A;  4YCV A;  3L2Z A;  3EFS A;  5LJ5 h;  2ARU A;  4WF2 A;  4C92 D;  4EMK B;  4C92 B;  4M7A F;  5GAN g;  1KQ1 A;  4C92 G;  1KMN A;  1NNH A;  4JUV A;  4YYE A;  1B34 A;  5GMK j;  2AMC A;  3JCM J;  4PJO A;  3JCM f;  3HXW A;  4NL3 A;  1PYS A;  3IG2 A;  4YRR A;  2DJZ A;  4HT8 A;  2ZGW A;  1RIQ A;  4F7U B;  2FB7 A;  4O2D A;  1B8A A;  4PJO C;  2Q7H A;  3W3S A;  1JBM A;  2Y90 A;  4YRE A;  4H2X B;  3BFM A;  1X01 A;  2J3M A;  3IKM B;  5GAN 3;  2ZZF A;  4P74 C;  4RCC A;  4TVA B;  2QTX A;  4X5O A;  1JJC A;  2I4N A;  2Q5I A;  2EAY A;  4YP0 A;  2EL9 A;  3A31 A;  4M7A B;  3HXV A;  4L87 A;  1EVL A;  2AMC B;  2E5A A;  3UGT A;  4C92 C;  3HXY A;  3HTZ A;  1NJ5 A;  4P3N A;  1EVK A;  2E10 A;  1KMM A;  4M77 F;  1H64 1;  5GMK l;  3UFG A;  4HA8 A;  3JB9 H;  1ADY A;  4RDX A;  1X2G A;  3HY1 A;  3RKX A;  5C53 B;  2E1H A;  2QHT A;  1X54 A;  2Q7G A;  1VQZ A;  4H2V A;  2CIM A;  4NOY A;  3HFV A;  2IY5 A;  5GAM g;  2YHT A;  3GIB A;  2E3C A;  4XU3 A;  3RKY A;  5ELN A;  3JCM P;  5GAN 7;  1U1S A;  2I4L A;  3V8J A;  1E1O A;  4H2Y A;  4UPA A;  4J15 A;  2RHQ A;  1ADJ A;  4XTX A;  4BW9 A;  3LSQ A;  4CH6 A;  2I4M A;  4YCW A;  5GMK i;  3VQW A;  2ZR2 A;  5GAN 2;  2C8M A;  4Q15 A;  4RQF A;  4LNS A;  4M75 C;  5C51 B;  4ZTZ B;  1Z7N A;  2G4C A;  3P8V A;  4X9D A;  2ZZE A;  4EMK A;  3HSB A;  2XGT A;  4N0A A;  2DTO A;  2ZTG A;  4XTU A;  1NJ8 A;  4M77 C;  3RF1 A;  3TUP A;  4C8Q C;  5GAO r;  5LJ5 g;  4M75 A;  4YRQ A;  2I2L A;  5K1X A;  4J6Y A;  1M8V A;  4XEM A;  4P3P A;  4TQF A;  3R07 A;  1YGB A;  3JB9 D;  5LJ3 h;  1PYS B;  3A5Y A;  4H2S A;  5ELO A;  1B76 A;  3JB9 G;  1KOG A;  4P71 C;  3LC0 A;  2P5I A;  2ODR D;  4KQE A;  4C8Q A;  1EIY A;  2EWN A;  3JB9 F;  2CGH A;  4M75 E;  3VBB A;  2ALY A;  1N9R A;  4HVC A;  4HWT A;  4C8Q D;  4DPG A;  1BIB A;  4M7D B;  1ASZ A;  1LNX A;  4K87 A;  1YFS A;  3QSU A;  4YRO A;  1WPY A;  5LJ3 g;  3NEM A;  2J3L A;  3VQV A;  4PG3 A;  4YRM A;  2DTI A;  4M78 F;  3JCM c;  4JLI A;  4HWR A;  5GAN j;  2DTH A;  3QO8 A;  5LJ5 j;  1JJC B;  4M78 B;  4JRK A;  4X9C A;  3A32 A;  2DU5 A;  4YRN A;  4M75 B;  1WQW A;  3ICA A;  5GAO n;  3L4G A;  4M7D E;  3JCM Q;  4PJO B;  3HXU A;  2RHQ B;  1ATI A;  3JCM h;  4CH5 A;  4M75 F;  1N9W A;  3VQY A;  3TEH A;  2DQ3 A;  3FIF A;  3V7R A;  3RL6 A;  1SES A;  5GAN 8;  4YPF A;  4QVC A;  4UP7 A;  4YRG A;  4NL2 A;  11AS A;  4H2W A;  1GGM A;  3VU3 C;  5GAN h;  1J5W A;  2DQ0 A;  5GAM h;  1I5L A;  4A54 A;  3JCM g;  4M77 D;  3HRI A;  4HWO A;  1LJO A;  5GAM j;  3HFZ A;  2ZIN A;  4JRI A;  4CH4 A;  1WQ7 A;  1YB3 A;  5GMK e;  5GAM d;  1C0A A;  4YRF A;  2Q5H A;  4RMF A;  5GAO q;  3L4G B;  1WU7 A;  2PME A;  1IL2 A;  4YRP A;  1JRI A;  4F7U A;  3M4P A;  3SWN C;  1SRY A;  4YRJ A;  3JB9 J;  2QHS A;  4HWS A;  3JCM V;  2ZNJ A;  2IY5 B;  3JCM b;  2DKG A;  2RB6 A;  4XTV A;  2EJG A;  4CS3 A;  3NEL A;  5GAN 4;  4P75 A;  3RGL A;  4YRL A;  4XU0 A;  2CJA A;  4ZTU B;  3HFN A;  3SWN B;  1HC7 A;  3JB9 I;  2ZNI A;  4YRI A;  2ZXF A;  1WLE A;  1N9S A;  3RUX A;  2DEQ A;  2ZIM A;  3QO5 A;  4K88 A;  4NCX A;  4OP0 A;  4M77 B;  4TTV A;  12AS A;  2DDZ A;  5I21 A;  2ART A;  2CJB A;  4C8Q E;  4YRC A;  4M77 E;  4P73 C;  1M5Q 1;  1NYR A;  4TVA A;  3I7F A;  4EO4 A;  4YRS A;  3P8T A;  4K86 A;  4XTY A;  4C92 E;  1U1T A;  5LJ3 j;  1LYL A;  2E41 A;  4C92 F;  5LJ3 f;  4H2U A;  2ARS A;  4C8Q G;  4M7A G; 
#chains in the Genus database with same CATH topology
 1RAE B;  1LCK A;  2I0N A;  4F17 A;  2E5Q A;  3L1A A;  2HZY A;  4OMF B;  3G6E A;  2ZZD A;  2EGE A;  3OYJ A;  3CBM A;  1JO8 A;  3X28 B;  3JRZ A;  2M0O A;  4M75 D;  4E7S A;  4LE9 A;  4AG1 C;  2YWW A;  4Y92 A;  2CRE A;  2BE7 D;  3M53 A;  1PKT A;  2A8E A;  4G84 A;  4CRI A;  3E19 A;  3QYH B;  3EHR A;  2ZT8 A;  2E64 A;  1T3L A;  3CD6 A;  3I5S A;  3BY7 A;  4RUG A;  2ZCF B;  1YJN T;  3OYY A;  4QKU A;  4PJL A;  2MK5 A;  2ZPI B;  3CCQ A;  4OGC A;  4HT9 A;  4M78 D;  3UGQ A;  2RJC A;  2DVJ A;  2QK0 A;  2LJ3 A;  1N5Z A;  2YRC A;  2NUT A;  4WCI A;  3QWY A;  4DOV A;  2DU7 A;  2FEI A;  3REA B;  1SSH A;  1QCF A;  3P8B B;  2RA2 A;  1Q86 U;  3CXC S;  4PJO E;  4BAC A;  1PSE A;  2JTF A;  5CAI A;  5IHI A;  2MWP A;  2DMO A;  3FJP A;  4M77 A;  3SB2 A;  4E47 A;  3LYI A;  2ODR C;  4JZ4 A;  4ZGE B;  2RM4 A;  1VUB A;  4PJO F;  3HTR A;  4L6V 5;  4P74 A;  3M0S A;  1C0M A;  3VYH B;  1G5V A;  2CZ0 B;  1SG5 A;  1KHC A;  5DLO A;  3VQX A;  3EG9 A;  1VIE A;  4KR3 A;  5GAN 6;  2L3R A;  3QO3 A;  3CCU Q;  2A08 A;  4TVR A;  1UJY A;  1BBW A;  2VXF A;  4G85 A;  3OYL A;  1UEC A;  4BI8 B;  2GQI A;  5KH6 A;  3CC2 A;  2DAQ A;  1EFW A;  1K4U S;  2J6K A;  3MET A;  3WQZ A;  3CC7 Q;  3L2U A;  2DIG A;  3G71 A;  2KXD A;  1X69 A;  1NYQ A;  1I8F A;  1SET A;  3M4Q A;  1G3S A;  1GBQ A;  4RCB A;  3RAC A;  1N27 A;  5AT1 B;  1Z9Q A;  5IAY A;  2NWM A;  2L5Q A;  2VYT A;  3URG A;  4JS5 A;  3H8Z A;  3CCE A;  1VQ6 T;  3INZ A;  3AHU A;  3J80 E;  3MF1 A;  5KNN A;  2K57 A;  2QDL A;  1VA7 A;  2DFU A;  2RHY A;  3HRK A;  2EJ9 A;  2C06 A;  2DBM A;  2F5K A;  2O01 E;  4M7D F;  1D0X A;  4J9C A;  2OTL Q;  3RKW A;  3SHW A;  4LDY A;  3LGL A;  4M7A E;  4N0A C;  3CCE T;  3JCM X;  4BB7 A;  4AFU C;  1YIT T;  1BIA A;  1PM3 A;  3MEY A;  3VRZ A;  1AZE A;  1AOJ A;  4EMG A;  2GNC A;  2AKW B;  2DBK A;  4IIO A;  1Q7Y C;  1USY C;  3PZC A;  4M78 G;  1VQ5 T;  1Y96 B;  5A0G A;  1QVG S;  4F7U E;  5F5W A;  2L3P A;  3LGF A;  2FZG B;  2CP5 A;  4ME7 A;  5GAO m;  3QJ6 A;  2RHS A;  3QO7 A;  3CC2 T;  2M16 A;  1BCM A;  2E3I A;  2F2X A;  1H4V B;  1OPK A;  1WHL A;  1IO6 A;  1JJ2 A;  3TEH B;  3CCM A;  1KC8 C;  1RI9 A;  4FYV B;  2DXT A;  2R57 A;  1X6B A;  1Z7M A;  2HMA A;  2FPF A;  4C0G A;  2J6O A;  1PRM C;  3FJ5 A;  4HWP A;  4A53 A;  5DY9 A;  5HGQ A;  4ZTJ A;  4RQE A;  3PIO A;  4TVY A;  2YUP A;  3QUI A;  4PJN A;  3GBQ A;  1M8M A;  4RTW A;  4P75 C;  5FU7 B;  3AT1 B;  4FCY A;  1L0W A;  3M56 A;  2DZ9 A;  2DRK A;  3OYD A;  2JTE A;  1XJW B;  5IHK A;  1BI2 A;  2CJ9 A;  3PMI A;  4LUE A;  4B6M A;  2YLB A;  2DF6 A;  1M3C A;  4V2S A;  2PMF A;  1B7Y A;  3MEW A;  2F2W A;  3NTK A;  3EFS A;  1GCP A;  4C0D B;  4C92 D;  2EQK A;  5GAN g;  3EGU A;  1KMN A;  2F69 A;  4R55 A;  1VQ9 Q;  3JCM f;  3ASK A;  3HXW A;  4B9X A;  1PYS A;  4YRR A;  1TUC A;  2DJZ A;  4HT8 A;  4IUT A;  2K2M A;  4O2D A;  1RI0 A;  1B8A A;  4PJO C;  2BKD N;  3RDV A;  3C4S A;  5I11 A;  1YP5 A;  4OGE A;  1EFN A;  3W3S A;  4IUQ A;  1JBM A;  4A63 B;  2J3M A;  4J9E A;  3IQL A;  4HCC A;  5CR2 A;  2YT6 A;  1S72 Q;  4P74 C;  1RAH B;  4KT0 E;  2KVQ G;  4TVA B;  1SPK A;  2K9G A;  3ER0 A;  3OYG A;  2QTX A;  1TWB A;  3TU4 K;  1JJC A;  3CCS Q;  2NUZ A;  2NYS A;  4IUP A;  2EQM A;  1O9S A;  2DJQ A;  5GJV B;  3A5Z B;  2E3H A;  2PNI A;  3HXY A;  3HTZ A;  2E70 A;  4IUU A;  1MV0 B;  5I22 A;  4HKE A;  1RUW A;  4Y28 E;  1ADY A;  3UA6 A;  3RKX A;  2E1H A;  3G71 T;  5AYF A;  1G3T A;  2CSQ A;  1PNJ A;  2JS0 A;  2QQB A;  4DOW A;  3TVT A;  1VQZ A;  3S3O A;  4OB1 B;  1Y71 A;  1A0N B;  2E3C A;  3JCM P;  5GAN 7;  2LP5 A;  3A8L B;  3HL8 A;  4H2Y A;  2DL5 A;  1BU1 A;  4J9H A;  1YI2 T;  2JVV A;  1B07 A;  1M27 C;  4J15 A;  4BW9 A;  1KJW A;  3LSQ A;  1VQ9 T;  4MZM A;  2C8M A;  2RHX A;  4LNS A;  2FO0 A;  5I2M A;  2XU8 A;  4X9D A;  2YUN A;  1VQ7 A;  2K6D A;  4GBQ A;  2XGT A;  2RQU A;  1OEB A;  4LN2 A;  2DTO A;  3JAM E;  1NJ8 A;  1Q81 C;  2K5L A;  5LJ5 g;  4M75 A;  5CKB A;  3MHX A;  4MZP A;  2I2L A;  4J6Y A;  1K76 A;  2KRM A;  3MP8 A;  1OQK A;  1YJW T;  3R07 A;  3VS7 A;  1WJS A;  1W4S A;  3OB9 A;  1KOG A;  1UUE A;  4P71 C;  5KYW B;  1X27 A;  1NJI U;  2MPX C;  4JJN K;  2CGH A;  2GTJ A;  2ALY A;  1N9R A;  2GFU A;  1CSK A;  4C8Q D;  3M55 A;  2KXC A;  4HWT A;  2A3L A;  4K87 A;  1YFS A;  3QSU A;  2XIC A;  5LJ3 g;  2OTJ T;  3NGP A;  3EFO A;  3M0R A;  2J3L A;  3VJP A;  3EG2 A;  4PG3 A;  2DTI A;  3BE3 A;  2HSE B;  2DTH A;  4R56 A;  2KRO A;  3QO8 A;  4M78 B;  3G6E T;  1VQK T;  2ED0 A;  2EKH A;  2IIM A;  1WQW A;  3M58 A;  3ICA A;  4LVL A;  1ZSZ C;  1PKS A;  2PQW A;  2XK0 A;  3FRN A;  1OX9 A;  3A1P A;  2NUP A;  1ATI A;  2CYZ B;  4QQD A;  2DPP B;  5DLQ E;  1BBZ A;  5HCK A;  3KFV A;  4EIK A;  3VQY A;  1X6G A;  3TEH A;  4A4K A;  4CC7 A;  4VUB A;  4RTY A;  5FWB A;  3DLL A;  3RL6 A;  1ZHI A;  3SDZ A;  2VGM A;  5GAN 8;  4QVC A;  4UP7 A;  4NL2 A;  1VQ5 A;  2QA4 T;  3WVE B;  5GAN h;  2DQ0 A;  2F5T X;  2CUD A;  3OSS C;  4HWO A;  3HRI A;  2DL8 A;  2D0N A;  2LCC A;  3CCL A;  1E7O A;  2DNU A;  2L3Q A;  2NUP B;  1WHG A;  3A8O B;  1ZBX A;  2KK4 A;  2MOX A;  3L4G B;  3EHQ A;  3LX7 A;  5A0L A;  1QWF A;  4QVZ A;  4HWS A;  1T0H A;  5KYX B;  3JCM b;  1FYN A;  2EBP A;  2VVK A;  2J05 A;  1IHV A;  3CPW P;  2YUQ A;  3EGD A;  4DEY A;  3CC2 Q;  3M54 A;  3NEL A;  4P75 A;  2CZ7 B;  2CKK A;  4YRL A;  2K79 A;  4ZTU B;  1HC7 A;  1RAD B;  4BDY A;  1HJD A;  4BE1 A;  1KIK A;  1N9S A;  3RUX A;  1KFZ A;  3G6E Q;  2LT4 A;  4OP0 A;  4DBQ A;  12AS A;  5I21 A;  2ART A;  1WXT A;  4NS5 A;  1VQL T;  2CJB A;  4M77 E;  1M1K C;  1NYR A;  4WTO B;  3OYB A;  4EO4 A;  2O9V A;  1H92 A;  4QQG A;  3M59 A;  1PG5 B;  1LYL A;  2FPE A;  2K3X A;  2O4X A;  4FYX B;  1E1T A;  2RK1 A;  3PCO B;  2FYK A;  3DB4 A;  3IKL A;  1FWZ A;  3OYF A;  1G5I A;  1NEB A;  4A4E A;  2LNV A;  2M9U A;  4AG2 C;  1MV3 A;  4D8D A;  3E2U A;  3HFZ B;  4A4F A;  4XTZ A;  2LMJ A;  1HK9 A;  4BY6 C;  1IGQ A;  4LVJ A;  2CZ1 B;  4OMO A;  1K73 R;  2MF2 A;  2CP7 A;  4JLG A;  3RIR A;  4J7F A;  1OUL A;  1D0Y A;  4D6W A;  2DIL A;  1NM7 A;  4BWA A;  3VRY A;  1KC8 U;  2JM9 A;  1QVG A;  1VQP T;  4TWA A;  2EYY A;  4UP8 A;  2CH4 W;  2LJ0 A;  3OYH A;  1PC0 A;  1FXX A;  2QHU A;  1WGS A;  1D3B A;  1QWE A;  3CCE Q;  4YRK A;  2IPO B;  4J9F A;  1YCY A;  3CCU T;  5D6Y A;  2QAS A;  3H9N A;  1EQR A;  2Q7E A;  2D8J A;  4H2T A;  1UGS B;  1XTD A;  3J81 E;  1I4K 1;  4MMK A;  4LDV A;  3L2W A;  5GAO l;  1BKB A;  4OMM A;  3X26 B;  5CKH A;  1GRI A;  2ROL A;  3MO8 A;  3OYC A;  2FPD A;  4P3O A;  4OMP A;  4RTX A;  3TQ7 P;  3QNE A;  2OX7 A;  5KCO A;  1W2B A;  1XQH A;  1TH7 A;  2RO0 A;  2J6F A;  2QA4 Q;  5HK0 A;  1KG1 A;  1OX8 A;  4E6R A;  4M7D D;  4M7D G;  2CT4 A;  1G83 A;  3BW1 A;  3X20 B;  1SHG A;  1WZO A;  2YSQ A;  1BB9 A;  1ZSZ A;  3ERR A;  4HXJ A;  4Q5W A;  1B70 B;  2JTM A;  1MMG A;  4BE0 A;  1YI2 Q;  2D0Q B;  1YCS B;  1BI3 A;  5LJ5 f;  1UFF A;  3PFS A;  4RTT A;  3E9G A;  1VQ7 Q;  2EQU A;  2JT4 A;  5FW9 A;  3TSZ A;  1RAF B;  4KGV B;  1ZA2 B;  2HEQ A;  3P8D A;  1TU0 B;  4EMK C;  1I1J A;  1WFW A;  3FB9 A;  3REU A;  1M3B A;  1ARK A;  2HQX A;  3QHS A;  1I0C A;  4X1V A;  1BYM A;  3RER A;  4EMH A;  4PFP A;  1HTT A;  1PSF A;  1X6O A;  4LUD A;  3PT9 A;  4M78 E;  1WNL A;  3V8L A;  3HXX A;  3J7A F;  4JRP A;  4CS4 A;  1SER A;  1EOV A;  2YLC A;  2DZC A;  3VS1 A;  5FWC A;  3TCJ A;  4E7H A;  4PLL A;  3O5Z A;  4J6X A;  3PNW C;  4JJB A;  4PJO D;  1NE8 A;  3CCQ T;  4H02 A;  3HFO A;  1USY A;  1K8A U;  2VC8 A;  3LH0 A;  4HVV A;  1D0Z A;  2ZT6 A;  3BJU A;  2JJ9 A;  2ZPB B;  2ABL A;  3O8V A;  4L5G A;  2HBW A;  3ZFJ A;  4M78 C;  3A74 A;  3P8Y A;  3A7R A;  4WJ4 A;  3CCV T;  4FYY B;  3GLX A;  4R0K A;  8ATC B;  3CME Q;  3PGG A;  1B34 B;  3PVL A;  3V7S A;  3OYK A;  3THK A;  1N8R R;  4MZT A;  4E7J A;  4CC2 A;  2DD5 A;  5I2S A;  4PLI A;  1Q81 U;  4UP9 A;  4ELZ C;  3CMA Q;  1YFT A;  2DER A;  4F7U F;  2CZ6 B;  2RPN A;  2JS2 A;  3CBP A;  3MQZ A;  4J6W A;  2P0P A;  2RQW A;  1NJI R;  2DRM A;  3OS0 A;  2J06 A;  4WJ3 M;  1OU8 A;  5KE2 A;  4LXC A;  2RQR A;  1PHT A;  2RQV A;  4WF2 A;  4EMK B;  4C92 B;  4M7A F;  1KQ1 A;  1H3H A;  1MMN A;  2KEA A;  1ZUK A;  2RN8 A;  3WVD B;  4E7K A;  5J39 A;  4RTU A;  3CEY A;  1TOV A;  1IXD A;  4M4Z A;  2RJD A;  4OVA A;  4XK8 E;  2OTL A;  3CQT A;  2EQI A;  4F7U B;  2FB7 A;  1WHJ A;  2F1L A;  1Y0M A;  1H3Z A;  2DLP A;  4ZNX A;  3HRT A;  4J9G A;  3MKD A;  2Y90 A;  5HKC A;  3L2Q A;  3MEV A;  2EYZ A;  2FL7 A;  1X01 A;  3BFM A;  1RLP C;  3CCJ Q;  3IKM B;  1OYX A;  4Z8A A;  3GOX A;  1GL5 A;  3CME T;  2SRC A;  2I4N A;  4J83 A;  2Q5I A;  2EKO A;  1M4Z A;  2RJE A;  5KYW A;  4M7A B;  2WSC E;  3A31 A;  3HXV A;  2AHJ B;  4L87 A;  3M4Y A;  4N4G A;  2BZX A;  4OB3 B;  4LVM A;  4MDW A;  1M9S A;  1EVK A;  2E10 A;  2X3W D;  4E7Z A;  3UFG A;  4QQ6 A;  3KUF A;  1X2K A;  2E12 A;  1NPR A;  3EGD B;  1PD0 A;  3MJX A;  3OYI A;  4OMQ A;  1K9A A;  2GF7 A;  5KYX A;  2EFI A;  3HFV A;  5C6S A;  3GIB A;  4XU3 A;  3RKY A;  3OMG A;  1WYX A;  2JZ2 A;  3V8J A;  1E1O A;  2HBP A;  3VS0 A;  2DET A;  2EYX A;  4UPA A;  1WDX A;  4P5N A;  2I4M A;  3VQW A;  2HDA A;  3SEM A;  5GAN 2;  1U8R A;  2LC4 A;  1D1C A;  2HD0 A;  4IKF A;  2RMO A;  2IVW A;  4HCB A;  4Q15 A;  4RQF A;  1K8A R;  2CS7 A;  4GY5 A;  4ZTZ B;  3P8V A;  1UHF A;  5FRN A;  3JSC A;  2ZZE A;  3C95 A;  1R0B G;  4N0A A;  1QVG P;  2R58 A;  2ZTG A;  5GAO r;  4E2F B;  5D7U A;  1VYU A;  4OMN A;  1QKX A;  4YRQ A;  1NLO C;  1M8V A;  1VQO T;  1I07 A;  5LJ3 h;  5CKE A;  1PYS B;  4H2S A;  1Q82 C;  2V8K A;  2YUO A;  2P5I A;  4KQE A;  2EWN A;  3JV3 A;  1VQ9 A;  2HL5 C;  4ZN1 A;  4IUV A;  1BIB A;  1ASZ A;  2PTK A;  1U06 A;  3I5R A;  1D1B A;  1C6V X;  4YRO A;  2BIV A;  1SEM A;  1ZSG A;  4LVK A;  1VQ4 A;  1M1G A;  4YRM A;  4LDX A;  3S3M A;  3MEA A;  2OTL T;  2JUF A;  1IGU A;  2XID A;  3HPW A;  4RG8 A;  2DXB A;  5J26 A;  5GAN j;  2ECZ A;  1JJC B;  2G6F X;  4X9C A;  2DU5 A;  4RG2 A;  4YRN A;  1MMD A;  2DYI A;  4M75 B;  2AKL A;  4M7D E;  1VQN A;  1AWW A;  3PMT A;  3RMS A;  3QBY A;  2W0Z A;  2RHQ B;  4KH1 B;  2KRN A;  2DIQ A;  3L42 A;  4CH5 A;  5KYU A;  5CQY A;  1B3Q A;  2EVR A;  2Y4X A;  3G7Z A;  2M51 A;  2LQN A;  1T0J A;  1OU9 A;  2LQK A;  4C0Z A;  1IHW A;  3CPW S;  1AWX A;  5KYN A;  1PWT A;  3P8H A;  5KE3 A;  3CC4 T;  4YRG A;  2M0Y A;  2LT1 A;  1GGM A;  4H2W A;  1J5W A;  4A54 A;  4M77 D;  1LVK A;  4KRT A;  1KD1 C;  2H8H A;  5GAM j;  2NS6 A;  3HFZ A;  1SRL A;  1KC8 R;  2FVU A;  2L0A A;  2P84 A;  1KSW A;  1JXO A;  2OAW A;  1K9M C;  1M2O A;  5GAO q;  2A28 A;  2KRS A;  3CCR A;  1IL2 A;  4FSX A;  3HKS A;  3CCS T;  1WU7 A;  4BUG A;  5KYY A;  3A8M B;  3QDF A;  3SWN C;  1SRY A;  4YRJ A;  2QHS A;  3JCM V;  9ATC B;  2IY5 B;  3UWN A;  1KQS A;  2HAX A;  4XTV A;  2EGA A;  2K3B A;  4K11 A;  1VQ8 T;  4F04 B;  2CJA A;  4X34 A;  3SWN B;  3FDR A;  3JB9 I;  1K73 C;  3G4S T;  4PJM A;  3VS3 A;  2LZ6 B;  2ZIM A;  3OW2 P;  4M77 B;  4TTV A;  3OW2 S;  2FZC B;  2VAS A;  4C8Q E;  4P73 C;  1M5Q 1;  1WXU A;  1Q81 R;  2V1Q A;  2LQ8 A;  3P8T A;  1NBE B;  1WHM A;  2GGR A;  4XTY A;  3CMA A;  4C92 E;  4FT4 A;  4D8K A;  2AZS A;  2E41 A;  2KE9 A;  1JQQ A;  2V1R A;  5LJ3 f;  2OAU A;  4H2U A;  3ZL7 C;  3N5B B;  4M77 G;  1QE0 A;  5C52 B;  4MDX A;  4YRT A;  3CCS A;  2ZPH B;  4C0F A;  3CMQ A;  1HXD A;  2VB6 A;  2RF0 A;  4KGX B;  4M75 G;  3X24 B;  2MMP A;  1QF6 A;  4YDQ A;  1G3W A;  3H6Z A;  4P72 A;  1SSF A;  2HKQ B;  3E9I A;  3NEN A;  5CCA A;  2JW4 A;  4AH6 A;  5J3B A;  1G2B A;  1B7Y B;  5LJ3 e;  1Q86 C;  1JJ2 S;  4LD9 K;  4MML A;  1LOJ A;  1AWO A;  1W66 A;  3ULR B;  3GP8 A;  1VQM T;  4C5H A;  4ELY C;  3M4G A;  1GFD A;  3V7C A;  2EJF A;  2QHV A;  4H2X A;  1GFC A;  4M7A C;  2E4H A;  3MF2 A;  1X2H A;  3FLG A;  3RNJ A;  3PCO A;  2E6Z A;  5GAN f;  1I81 A;  2WSE E;  5CVI A;  1VQN T;  1W1F A;  1YIJ Q;  3V8K A;  4DBH A;  4BDZ A;  3M0P A;  1Q7Y U;  3CBO A;  4GLK A;  1YWO A;  3VV0 A;  5CO7 A;  2K5I A;  3CCJ A;  3OD1 A;  4EX5 A;  2X9H A;  5LJ3 d;  4J7I A;  4CS2 A;  1VQ4 T;  1OV3 A;  2OJ2 A;  1YJ9 Q;  1AD5 A;  4J9I A;  2V8J A;  3QZ9 B;  4P71 A;  4LVI A;  4Y91 A;  2PVG B;  2P0K A;  1UEB A;  3RES A;  3CMA T;  2EW3 A;  4P72 C;  4OML A;  1FMV A;  2JMC A;  5M9O A;  2VKN A;  2VGN A;  2HKN A;  3R6N A;  5LJ5 d;  4HCZ A;  3TSW A;  2GBQ A;  1VQO A;  5CIU A;  4JJC A;  1KK7 A;  1D3B B;  2JM8 A;  1E22 A;  4AFQ C;  1QP3 A;  3ME9 A;  4GLM A;  1VQ8 A;  2ZT5 A;  4N4H A;  2P0L A;  3REB B;  1X55 A;  4RTV A;  2ATC B;  3A5Z A;  1RAG B;  3SD4 A;  1V1C A;  2QI2 A;  5FU6 C;  4CH3 A;  4LD6 A;  1TS9 A;  2RQT A;  3QJY A;  4J9B A;  2ENM A;  1FMK A;  2CSI A;  2QTV A;  4FL6 A;  1AZG B;  3T9N A;  5LJ5 e;  1HYO A;  5GAM e;  4PL6 A;  3I35 A;  1X43 A;  2HQE A;  2JNG A;  5D6W A;  4DQ2 A;  1RL2 A;  2HL3 A;  2QDY B;  2B86 A;  1Z9Z A;  2LCL A;  4M7D A;  2PU9 B;  2I4O A;  3VS2 A;  3I56 Q;  1VQP Q;  5A0D A;  3RR6 A;  1B7T A;  1VQL Q;  1K1Z A;  2C0O A;  2AK5 A;  4DEX A;  2CP3 A;  3QXE B;  2AKW A;  3QTC A;  2JMA A;  1TSF A;  2QXF A;  4KGZ B;  3SFM A;  3LWH A;  3DSQ A;  2XKO C;  1VQ4 Q;  5GAN d;  2ZZG A;  4UC4 A;  2ALY B;  3CME A;  1SRM A;  3MEU A;  4JJD A;  2PVO B;  1QVP A;  4JRQ A;  2RJF A;  3MP6 A;  2LX7 A;  3CD6 T;  1MGQ A;  1AHJ B;  2VUB A;  4ZIB A;  4B9W A;  1YFR A;  1JEG A;  1YI2 A;  4KR2 A;  5C0M A;  1WX6 A;  4QW2 A;  3TEG A;  3HY0 A;  2LJ1 A;  1KD1 U;  2KI7 A;  1UDL A;  1I5O B;  4XU2 A;  3PVQ A;  1ZLM A;  1AVZ C;  2KYB A;  2BZ8 A;  1K9M U;  3A98 A;  2K2V A;  4PNO A;  1PCX A;  4M78 A;  4XQ3 A;  4E51 A;  1M90 C;  4M7D C;  3JCM W;  6AT1 B;  3JCM d;  4XU1 A;  2LTO A;  1EIY B;  1UGP B;  5IHN A;  1ASY A;  3CXC P;  2DL3 A;  1V76 A;  3M9Q A;  2QA4 A;  1G51 A;  2P4T A;  4ANJ A;  1MNE A;  3LSS A;  1FYF A;  4J5Y A;  4YCV A;  3L2Z A;  4FU6 A;  2V8I A;  2ARU A;  3H0I A;  2E6N A;  3H0F A;  1VQM Q;  1UB4 A;  4C92 G;  5GJW B;  1UTI A;  1ZBJ A;  1B34 A;  2KQW A;  2PZ1 A;  2AMC A;  3JCM J;  4IUR A;  1X75 C;  2LDM A;  2GFA A;  3IG2 A;  2C0T A;  1XOV A;  1ZUY A;  1YWP A;  2ZGW A;  1WJQ A;  1RIQ A;  4O5V A;  2KY9 A;  3OYN A;  3S3N A;  5KYU B;  2EYQ A;  2WAC A;  2YDL A;  4YRE A;  1N8R U;  4H2X B;  1HSQ A;  2ZPE B;  3GNF B;  2DE0 X;  5GAN 3;  2RH2 A;  3NTH A;  2ZZF A;  2P0Q A;  2RK2 A;  2R5A A;  2Y4Y A;  4RCC A;  1BI1 A;  1W6X A;  2EAY A;  4YP0 A;  2Z0W A;  2EL9 A;  2DL4 A;  2NLU A;  3GPL A;  3OYM A;  2W10 A;  1GXI E;  1EVL A;  2E5A A;  4HCK A;  1U5S A;  2PUO B;  5IT9 E;  1OZ3 A;  2RHI A;  1NJ5 A;  4P3N A;  4C92 F;  1S72 T;  4M77 F;  5GMK l;  2KDS A;  4HA8 A;  1YJN A;  3JB9 H;  4RDX A;  3NFC A;  3S6W A;  2D9T A;  5C53 B;  3UAT A;  2XG8 D;  1X54 A;  2Q7G A;  2MIO A;  1OPL A;  2ZAE A;  4NOY A;  2IY5 A;  5GAM g;  2OTJ Q;  3OBW A;  4BY6 B;  2ZPF B;  5ELN A;  1NEG A;  2D6F A;  4F16 A;  2I4L A;  2A36 A;  5L23 A;  4PFO A;  2KNB B;  4PJJ A;  1ADJ A;  4CH6 A;  3RMQ A;  3I55 T;  1ACM B;  3QDR B;  2OI3 A;  2DD4 A;  2DX1 A;  5A2Q E;  2P4R A;  5C51 B;  1VQN Q;  4A4H A;  4AFS C;  3CCJ T;  2XDP A;  1IZ6 A;  4ZGJ B;  2O2O A;  4EMK A;  1YNZ A;  2MI6 A;  3TUP A;  3NTI A;  4C8Q C;  3VS5 A;  1YJ9 T;  3LLR A;  3L2R A;  1M1K U;  5CKD A;  1E6H A;  1M3A A;  4P3P A;  2C0I A;  2GQV A;  1DJ7 B;  1Q95 G;  2MAM A;  3JB9 D;  1NYG A;  3A5Y A;  5CK9 A;  5ELO A;  1YIT A;  4HT4 A;  1B76 A;  3JB9 G;  2KAF A;  3M57 A;  2H3J A;  2X4Y A;  3JB9 F;  1EIY A;  3VBB A;  4HVC A;  4L59 A;  1SKU B;  4DPG A;  4ZTF A;  1LNX A;  3OBY A;  2LX9 A;  4ATO A;  1KD1 R;  2MCN A;  2RHU A;  1VIF A;  4JLI A;  4FSS A;  1F1B B;  5EG2 A;  3A32 A;  2MYS A;  2QQR A;  1M30 A;  1UE9 A;  1R0C B;  2BE9 B;  4A4G A;  1M2V A;  2H3E B;  1NPP A;  1QMC A;  4ZN3 A;  4PJO B;  3CC4 Q;  8AT1 B;  3JCM h;  2QGG A;  4DBF A;  4YTL A;  1QVF S;  1D09 B;  1UGV A;  1N9W A;  3L2V A;  3FIF A;  5FRO A;  3LH5 A;  1SES A;  4YPF A;  3HP9 A;  1V29 B;  2A37 A;  1TXQ A;  2K7A A;  1YJW Q;  1I5L A;  1OOT A;  3JCM g;  1Y07 A;  2NUT B;  1J3T A;  3C0C A;  2CH4 A;  4CH4 A;  1TUD A;  1WQ7 A;  1W2B P;  4II1 A;  4CC3 A;  2PME A;  4Z02 A;  1RAB B;  4YRP A;  5CKF A;  1JRI A;  1NLP C;  1EX4 A;  3G4S Q;  3JB9 J;  2ZNJ A;  3CCR T;  1G3Y A;  2EJG A;  2L3S A;  2KSS A;  2QEX Q;  3CCM T;  1M90 U;  1QQJ A;  3MP1 A;  4BE2 A;  3CD6 Q;  3EG9 B;  2LCS A;  4XU0 A;  3TRE A;  3HFN A;  1MHN A;  3M5A A;  1NJI C;  1S1N A;  1N6A A;  1QVF P;  1PRL C;  1WLE A;  3QO5 A;  4YRI A;  2D1X A;  4K88 A;  3H41 A;  4C5G A;  3PE0 A;  3G1J A;  1H8K A;  1WLP B;  2DDZ A;  4PK4 A;  4J9D A;  1QKW A;  4YRC A;  1JJ2 P;  2DA9 A;  4KUL A;  1E6G A;  4TVA A;  3I7F A;  4YRS A;  2DO3 A;  4K86 A;  1YN8 A;  5LJ3 j;  4C8Q G;  5EC7 A;  1BI0 A;  2M1H A;  2RHZ A;  1WYD A;  2EPD A;  5K1P A;  4OB2 B;  1NJ1 A;  4TQD A;  3EAE A;  1YHQ Q;  2C7I A;  2GCX A;  4N4I A;  2KMT A;  1QCO A;  1E24 A;  2DM1 A;  2AT1 B;  1NJ6 A;  2M02 A;  3SWN A;  4YCU A;  4HVW A;  4PHC A;  1QP2 A;  3CXC A;  2RI5 A;  3HXZ A;  2JXB A;  1VQ6 A;  1VQP A;  3CC7 A;  1VQO Q;  1YIJ T;  5E3I A;  4Z89 A;  1JXM A;  1YHQ T;  2R5M A;  1Y96 A;  3I55 Q;  1BK2 A;  3A8H B;  1YJ9 A;  2RHS B;  2DK3 A;  1H4T A;  7AT1 B;  4PJO G;  4AFZ C;  5GAN e;  3KFU A;  4P73 A;  3GF5 A;  3DLM A;  2QQS A;  1K0X A;  4C8Q F;  4C92 A;  4ZGD B;  2B8A A;  2HNI A;  1VQK A;  4RTZ A;  1M2V B;  3OMC A;  2QEX T;  3CCM Q;  2RD1 A;  1TUG B;  4JPB W;  1KQ2 A;  3G71 Q;  3CCV A;  1BCO A;  3I56 T;  3EFO B;  3VYG A;  2XD0 A;  3HHT B;  1W2B S;  2AIR B;  2VXE A;  3E9F A;  1JB0 E;  3E9H A;  1GCQ C;  3EFR A;  1VOM A;  3M0T A;  3I56 A;  2KBT A;  2WSF E;  2QGF B;  1ZA1 B;  4FIB A;  2CP6 A;  1SHF A;  3NET A;  2K3Y A;  4RMO A;  2XHC A;  1R8O B;  4ESR A;  3BDL A;  3UDC A;  1YFN A;  3UH0 A;  2BUD A;  4O6J A;  3VUB A;  3PTA A;  3CCQ Q;  4EPC A;  4M7A A;  1G5H A;  3GNG A;  1VQ7 T;  2XI9 A;  2DXC A;  2QQA A;  2L89 A;  4XEO A;  4EDU A;  3CPW A;  2XTI A;  2E65 A;  4QVD A;  1AT1 B;  4IIM A;  3LW5 E;  4XAX B;  1B70 A;  1G8X A;  4KUD K;  1UGQ B;  2AZV A;  1WA7 A;  3QG1 A;  4AT1 B;  5DM7 R;  3A7A A;  3UT1 A;  1RAA B;  2CDT A;  2ZR3 A;  2FZK B;  5FRM A;  1H4Q A;  1H4S A;  3F70 A;  5GMK m;  2O31 A;  1AWJ A;  4C8Q B;  1XNI A;  5GAO p;  2X35 A;  2X4W A;  2ZPG B;  5GAN 5;  2FHD A;  5ECA A;  1GCQ A;  2CT3 A;  4KH0 B;  4JDS A;  1WHK A;  3EG0 A;  1Y7X A;  4F7U G;  3A7U A;  3I9Q A;  3VS4 A;  2E5K A;  4XTW A;  1M90 R;  2COZ A;  2ZCE A;  1QLY A;  2PUK B;  1KQS P;  5GMK h;  1WIE A;  3CCR Q;  5GAM f;  3UPU A;  3QPH A;  2X3X D;  2ROT A;  5D6X A;  2RI2 A;  3CPF A;  1JU5 C;  5KCH A;  1YIJ A;  1VQM A;  2DVE A;  3REX A;  5IXF A;  4Q6G A;  2FG0 A;  4F14 A;  1YJN Q;  3NMZ C;  2JN0 A;  3C94 A;  1NJ2 A;  2O4X B;  2DXU A;  4OLF A;  4C0D C;  2KR3 A;  3OQ5 A;  1RAC B;  3OS2 A;  3OY9 A;  4M7A D;  2ZT7 A;  3JCM e;  2DL7 A;  2OTJ A;  1T3S A;  3QZ5 B;  1K9M R;  1BBU A;  1UG1 A;  3CCU A;  3A8G B;  2X4J A;  4PKC C;  1QCN A;  3BDU A;  2IG0 A;  3OS5 A;  1X56 A;  4WI1 A;  1Q7Y R;  4TVW A;  2GTO A;  1AEY A;  3IAL A;  2ZIO A;  5FU6 B;  3LWI A;  3OA6 A;  1S72 A;  2LNH B;  2O9S A;  2G3R A;  2HCK A;  3CCL Q;  3G1Z A;  4ORZ A;  2EGC A;  4BI4 A;  2LVM A;  3EGX A;  1WJR A;  2LQW A;  1M1K R;  4OF1 A;  3Q1J A;  3RBB B;  3G4S A;  1M1F A;  5LJ5 h;  1GBR A;  3OYE A;  4FYW B;  3OYA A;  4RKU E;  1IRE B;  1YIT Q;  2X4X A;  2YRD A;  4JUV A;  1NNH A;  2BZY A;  4DA4 A;  2X51 A;  4YYE A;  1MUZ A;  2EQJ A;  2YXY A;  5GMK j;  1ZX6 A;  4PJO A;  3E1S A;  4LDU A;  1RAI B;  3EG1 A;  4NL3 A;  5CQX A;  1ABO A;  1MMA A;  4LDW A;  1P92 A;  4KBM B;  2COY A;  5KYY B;  4CI0 C;  2XDB A;  3EH1 A;  1N8R C;  2CP2 A;  3HRS A;  3HRU A;  2RI3 A;  1WXB A;  3DB3 A;  2Q7H A;  1MND A;  1C1A A;  2SEM A;  4BD3 A;  1VQL A;  1Y57 A;  1QVF A;  1K8A C;  2K5F A;  4C5E A;  4FW1 A;  3CC4 A;  4X5O A;  2HQH A;  1QW1 A;  2EIF A;  3EH2 A;  1YBY A;  2AMC B;  2BTT A;  3UGT A;  3NPF A;  1LPL A;  4C92 C;  1KMM A;  1H64 1;  3OS1 A;  2A0F B;  4CC4 B;  1X2G A;  3HY1 A;  1KQS S;  1ABQ A;  4FT2 A;  1VYV A;  2QHT A;  3UA7 A;  2CP0 A;  4H2V A;  2CIM A;  2YHT A;  1ZSZ B;  2ESW A;  2A7Y A;  2FRW A;  1U1S A;  3I55 A;  1X2Q A;  1O75 A;  1VQ8 Q;  3CCL T;  3M0U A;  2QG9 B;  2RHQ A;  2ED1 A;  4XTX A;  2AKK A;  1FMW A;  3OW2 A;  4YCW A;  5GMK i;  2ZR2 A;  3H0H A;  1IB8 A;  1Q82 U;  2DEU A;  1HD3 A;  1PD1 A;  3QII A;  4M75 C;  3X25 B;  4FW2 A;  1Z7N A;  2G4C A;  2HSP A;  2J7I A;  3HSB A;  1R77 A;  4XTU A;  1CKB A;  3RF1 A;  4M77 C;  1UJ0 A;  3VKI A;  4Z88 A;  4FM4 B;  4OB0 B;  1SF9 A;  3MPU B;  5K1X A;  4XEM A;  3QYG B;  5HK3 A;  1UGR B;  2FRY A;  2JOY A;  4TQF A;  1YGB A;  1U3O A;  2KGT A;  3FEO A;  3QKJ A;  2ODR D;  4C8Q A;  4PFZ A;  4E7I A;  4M75 E;  2RNA A;  5IH2 A;  1NZ9 A;  4M7D B;  4KUI A;  1W70 A;  4LNP A;  1WPY A;  3NEM A;  3VQV A;  3EG3 A;  3D7S B;  4DBR A;  5IXB A;  4M78 F;  3JCM c;  4C5I A;  3WXM B;  4HWR A;  1EZZ B;  5LJ5 j;  2COW A;  4JRK A;  3VS6 A;  2QYZ A;  3M0Q A;  1YJW A;  3OSV A;  2QEX A;  5GAO n;  2KYM A;  3L4G A;  3JCM Q;  2DYB A;  1UHC A;  2K4Y A;  2XDD A;  1ZQ1 A;  3HXU A;  1D1A A;  2D8H A;  4M75 F;  3ZEH A;  5FU7 C;  4BI3 A;  2DQ3 A;  3V7R A;  2KT8 A;  2VWF A;  1Q82 R;  3ZBD A;  11AS A;  3VU3 C;  2V26 A;  4E7L A;  5GAM h;  1CKA A;  1IRX A;  2KT1 A;  3CC7 T;  1LJO A;  5LL6 S;  2ZIN A;  2VV5 A;  1NG2 A;  4JRI A;  5FLX E;  2F2V A;  3U23 A;  1YB3 A;  5IN1 A;  2XMF A;  2LRQ A;  5GMK e;  3CCV Q;  1K73 U;  5GAM d;  1ZUU A;  4YRF A;  1C0A A;  3UF4 A;  2Q5H A;  2O88 A;  4RMF A;  3QWX X;  3VUZ A;  1KHI A;  1NYF A;  4HVU A;  3EGX B;  2CUB A;  4F7U A;  3M4P A;  2L2P A;  1FX7 A;  5L8R E;  2QQ9 A;  2PVD B;  1VQ5 Q;  2DKG A;  2RB6 A;  1TTH B;  1WI7 A;  1K0S A;  3FC3 A;  2EYW A;  1VQ6 Q;  1WHH A;  4CS3 A;  3PIP A;  5GAN 4;  3C12 A;  1Q86 R;  3RGL A;  2QAZ A;  3DKM A;  4JS4 A;  2ZNI A;  5HY6 A;  2ZXF A;  1YHQ A;  1OI1 A;  1RLQ C;  2MWO A;  2DEQ A;  1OZ2 A;  3TEE A;  4NCX A;  3NHN A;  3KBG A;  1VYT A;  1TG0 A;  4QT7 A;  4JZ3 A;  3MCA B;  3KXT A;  2YRV A;  3R6O A;  1VQK Q;  1U1T A;  2L8D A;  4J8O A;  4AMC A;  2ARS A;  3LC0 A;  4M7A G;  1EIF A; 
#chains in the Genus database with same CATH homology
 2E5Q A;  3L1A A;  4OMF B;  3G6E A;  2ZZD A;  3OYJ A;  3CBM A;  3X28 B;  3JRZ A;  2M0O A;  4M75 D;  3M53 A;  2A8E A;  4G84 A;  4CRI A;  3E19 A;  3QYH B;  2ZT8 A;  2E64 A;  3CD6 A;  3BY7 A;  2ZCF B;  1YJN T;  3OYY A;  2ZPI B;  3CCQ A;  4OGC A;  4HT9 A;  4M78 D;  3UGQ A;  2RJC A;  4DOV A;  2DU7 A;  3P8B B;  2RA2 A;  1Q86 U;  3CXC S;  4PJO E;  4BAC A;  1PSE A;  2JTF A;  5CAI A;  2MWP A;  4E47 A;  3FJP A;  4M77 A;  3SB2 A;  3LYI A;  2ODR C;  4ZGE B;  2RM4 A;  1VUB A;  4PJO F;  4L6V 5;  4P74 A;  3VYH B;  1G5V A;  2CZ0 B;  1KHC A;  5DLO A;  3VQX A;  4KR3 A;  1VIE A;  5GAN 6;  2L3R A;  3QO3 A;  4TVR A;  1BBW A;  2VXF A;  4G85 A;  3OYL A;  4BI8 B;  5KH6 A;  3CC2 A;  2DAQ A;  1EFW A;  3MET A;  3WQZ A;  3L2U A;  2DIG A;  3G71 A;  1NYQ A;  1SET A;  1I8F A;  3M4Q A;  1G3S A;  4RCB A;  3RAC A;  1N27 A;  5IAY A;  2L5Q A;  2VYT A;  3URG A;  4JS5 A;  3H8Z A;  3CCE A;  1VQ6 T;  3INZ A;  3AHU A;  3J80 E;  3MF1 A;  5KNN A;  2K57 A;  2RHY A;  3HRK A;  2EJ9 A;  2C06 A;  2F5K A;  2O01 E;  4M7D F;  4LDY A;  3RKW A;  3LGL A;  4M7A E;  4N0A C;  3CCE T;  3JCM X;  4BB7 A;  1YIT T;  1BIA A;  3MEY A;  4EMG A;  2AKW B;  1Q7Y C;  1USY C;  3PZC A;  4M78 G;  1VQ5 T;  1Y96 B;  5A0G A;  1QVG S;  4F7U E;  5F5W A;  3LGF A;  4ME7 A;  5GAO m;  3QJ6 A;  2RHS A;  3QO7 A;  3CC2 T;  2M16 A;  1H4V B;  1JJ2 A;  3TEH B;  3CCM A;  1KC8 C;  2DXT A;  2R57 A;  1Z7M A;  4C0G A;  4HWP A;  4A53 A;  5DY9 A;  5HGQ A;  4ZTJ A;  4RQE A;  3PIO A;  4TVY A;  3QUI A;  4P75 C;  5FU7 B;  1L0W A;  3M56 A;  2DZ9 A;  3OYD A;  1BI2 A;  2CJ9 A;  3PMI A;  2YLB A;  2PMF A;  4V2S A;  1B7Y A;  3MEW A;  3NTK A;  3EFS A;  4C0D B;  4C92 D;  2EQK A;  5GAN g;  1KMN A;  2F69 A;  4R55 A;  3JCM f;  3ASK A;  3HXW A;  4B9X A;  1PYS A;  4YRR A;  2DJZ A;  4HT8 A;  4IUT A;  4O2D A;  1RI0 A;  1B8A A;  4PJO C;  2BKD N;  3C4S A;  4OGE A;  3W3S A;  4IUQ A;  1JBM A;  2J3M A;  4HCC A;  5CR2 A;  4P74 C;  4KT0 E;  2KVQ G;  4TVA B;  3ER0 A;  3OYG A;  2QTX A;  3TU4 K;  1JJC A;  4IUP A;  2EQM A;  1O9S A;  3A5Z B;  3HXY A;  3HTZ A;  2E70 A;  4IUU A;  4HKE A;  4Y28 E;  1ADY A;  3RKX A;  2E1H A;  3G71 T;  5AYF A;  1G3T A;  2QQB A;  4DOW A;  1VQZ A;  3S3O A;  4OB1 B;  1Y71 A;  2E3C A;  3JCM P;  5GAN 7;  3A8L B;  3HL8 A;  4H2Y A;  1YI2 T;  2JVV A;  4J15 A;  4BW9 A;  3LSQ A;  1VQ9 T;  4MZM A;  2C8M A;  2RHX A;  4LNS A;  5I2M A;  2XU8 A;  4X9D A;  1VQ7 A;  2XGT A;  2DTO A;  3JAM E;  1NJ8 A;  1Q81 C;  2K5L A;  5LJ5 g;  4M75 A;  5CKB A;  3MHX A;  4MZP A;  2I2L A;  4J6Y A;  3MP8 A;  1YJW T;  3R07 A;  1WJS A;  1W4S A;  3OB9 A;  1KOG A;  4P71 C;  1NJI U;  4JJN K;  2CGH A;  2ALY A;  1N9R A;  2GFU A;  4C8Q D;  4HWT A;  3M55 A;  2A3L A;  4K87 A;  1YFS A;  3QSU A;  2XIC A;  5LJ3 g;  2OTJ T;  2J3L A;  3VJP A;  4PG3 A;  2DTI A;  2DTH A;  4R56 A;  3QO8 A;  4M78 B;  3G6E T;  1VQK T;  1WQW A;  3M58 A;  3ICA A;  4LVL A;  2PQW A;  2XK0 A;  3FRN A;  1ATI A;  2CYZ B;  4QQD A;  2DPP B;  5DLQ E;  3VQY A;  3TEH A;  4A4K A;  4VUB A;  3DLL A;  3RL6 A;  1ZHI A;  3SDZ A;  2VGM A;  5GAN 8;  4QVC A;  4UP7 A;  4NL2 A;  1VQ5 A;  2QA4 T;  3WVE B;  5GAN h;  2DQ0 A;  2F5T X;  3OSS C;  4HWO A;  3HRI A;  2LCC A;  3CCL A;  3A8O B;  1ZBX A;  2KK4 A;  3L4G B;  3LX7 A;  5A0L A;  4QVZ A;  4HWS A;  3JCM b;  3M54 A;  3NEL A;  4P75 A;  2CZ7 B;  2CKK A;  4YRL A;  4ZTU B;  1HC7 A;  4BDY A;  4BE1 A;  1N9S A;  3RUX A;  2LT4 A;  4OP0 A;  12AS A;  5I21 A;  2ART A;  4NS5 A;  2CJB A;  1VQL T;  4M77 E;  1M1K C;  1NYR A;  3OYB A;  4EO4 A;  4QQG A;  3M59 A;  1LYL A;  2K3X A;  2O4X A;  1E1T A;  2RK1 A;  3PCO B;  2FYK A;  3DB4 A;  3IKL A;  1FWZ A;  3OYF A;  1G5I A;  4A4E A;  2LNV A;  2M9U A;  3HFZ B;  4A4F A;  4XTZ A;  1HK9 A;  4BY6 C;  4LVJ A;  2CZ1 B;  2MF2 A;  4JLG A;  3RIR A;  4J7F A;  4D6W A;  4BWA A;  1KC8 U;  1QVG A;  1VQP T;  4TWA A;  4UP8 A;  3OYH A;  1FXX A;  2QHU A;  1WGS A;  1D3B A;  4YRK A;  1EQR A;  1YCY A;  5D6Y A;  3CCU T;  2Q7E A;  4H2T A;  1UGS B;  1XTD A;  3J81 E;  1I4K 1;  4MMK A;  4LDV A;  3L2W A;  5GAO l;  1BKB A;  3X26 B;  5CKH A;  3MO8 A;  3OYC A;  4P3O A;  3QNE A;  5KCO A;  1W2B A;  1XQH A;  1TH7 A;  2RO0 A;  5HK0 A;  1KG1 A;  4M7D D;  4M7D G;  3BW1 A;  3X20 B;  3ERR A;  4Q5W A;  1B70 B;  2JTM A;  4BE0 A;  2D0Q B;  1BI3 A;  5LJ5 f;  3PFS A;  3E9G A;  2EQU A;  3P8D A;  4EMK C;  3FB9 A;  3REU A;  2HQX A;  3QHS A;  1BYM A;  3RER A;  4EMH A;  1HTT A;  1PSF A;  1X6O A;  3PT9 A;  4M78 E;  1WNL A;  3V8L A;  3HXX A;  3J7A F;  4JRP A;  4CS4 A;  1SER A;  1EOV A;  2YLC A;  2DZC A;  3TCJ A;  4E7H A;  4PLL A;  4J6X A;  3PNW C;  4PJO D;  1NE8 A;  3CCQ T;  4H02 A;  3HFO A;  1USY A;  1K8A U;  2VC8 A;  3LH0 A;  2ZT6 A;  3BJU A;  2ZPB B;  3O8V A;  4L5G A;  3ZFJ A;  4M78 C;  3A74 A;  3P8Y A;  3A7R A;  4WJ4 A;  3CCV T;  3GLX A;  3PGG A;  1B34 B;  3V7S A;  3OYK A;  4MZT A;  4E7J A;  2DD5 A;  5I2S A;  4PLI A;  1Q81 U;  4UP9 A;  4ELZ C;  1YFT A;  4F7U F;  2CZ6 B;  3CBP A;  3MQZ A;  4J6W A;  2P0P A;  3OS0 A;  4WJ3 M;  5KE2 A;  4WF2 A;  4EMK B;  4C92 B;  4M7A F;  1KQ1 A;  3WVD B;  4E7K A;  5J39 A;  3CEY A;  2RJD A;  4OVA A;  4XK8 E;  2OTL A;  4F7U B;  2FB7 A;  1H3Z A;  3HRT A;  5HKC A;  2Y90 A;  3L2Q A;  3MEV A;  2FL7 A;  3BFM A;  1X01 A;  3IKM B;  1OYX A;  3GOX A;  3CME T;  2I4N A;  4J83 A;  2Q5I A;  2EKO A;  1M4Z A;  2RJE A;  3A31 A;  4M7A B;  2WSC E;  3HXV A;  2AHJ B;  4L87 A;  3M4Y A;  4N4G A;  4OB3 B;  4LVM A;  4MDW A;  1M9S A;  1EVK A;  2E10 A;  3UFG A;  4QQ6 A;  3KUF A;  2E12 A;  1NPR A;  3OYI A;  2GF7 A;  3HFV A;  2EFI A;  5C6S A;  3GIB A;  4XU3 A;  3RKY A;  3OMG A;  2JZ2 A;  3V8J A;  1E1O A;  2HBP A;  4UPA A;  4P5N A;  2I4M A;  3VQW A;  5GAN 2;  1U8R A;  2LC4 A;  2HD0 A;  4IKF A;  2IVW A;  4HCB A;  4Q15 A;  4RQF A;  2CS7 A;  4GY5 A;  4ZTZ B;  3P8V A;  5FRN A;  3JSC A;  2ZZE A;  3C95 A;  4N0A A;  2R58 A;  2ZTG A;  5GAO r;  4YRQ A;  1M8V A;  1VQO T;  5LJ3 h;  5CKE A;  1PYS B;  4H2S A;  1Q82 C;  2V8K A;  2P5I A;  4KQE A;  2EWN A;  1VQ9 A;  4ZN1 A;  4IUV A;  1BIB A;  1ASZ A;  4YRO A;  2BIV A;  4LVK A;  1VQ4 A;  1M1G A;  4YRM A;  4LDX A;  3S3M A;  3MEA A;  2OTL T;  2JUF A;  2XID A;  3HPW A;  4RG8 A;  2DXB A;  5J26 A;  5GAN j;  1JJC B;  4X9C A;  2DU5 A;  4RG2 A;  4YRN A;  4M75 B;  4M7D E;  1VQN A;  3PMT A;  3RMS A;  3QBY A;  2RHQ B;  2DIQ A;  3L42 A;  4CH5 A;  5CQY A;  2Y4X A;  3G7Z A;  2LQK A;  4C0Z A;  3CPW S;  3P8H A;  5KE3 A;  3CC4 T;  4YRG A;  4H2W A;  2LT1 A;  1GGM A;  1J5W A;  4A54 A;  4M77 D;  1KD1 C;  5GAM j;  2NS6 A;  3HFZ A;  2FVU A;  1K9M C;  5GAO q;  3CCR A;  1IL2 A;  4FSX A;  3HKS A;  3CCS T;  1WU7 A;  4BUG A;  3A8M B;  3SWN C;  1SRY A;  4YRJ A;  2QHS A;  3JCM V;  2IY5 B;  3UWN A;  1KQS A;  2HAX A;  4XTV A;  1VQ8 T;  2CJA A;  4X34 A;  3SWN B;  3FDR A;  3JB9 I;  1K73 C;  3G4S T;  2ZIM A;  4M77 B;  4TTV A;  3OW2 S;  4C8Q E;  4P73 C;  1M5Q 1;  2LQ8 A;  3P8T A;  4XTY A;  3CMA A;  4C92 E;  4FT4 A;  2E41 A;  5LJ3 f;  4H2U A;  2OAU A;  3N5B B;  4M77 G;  1QE0 A;  5C52 B;  4MDX A;  4YRT A;  3CCS A;  2ZPH B;  4C0F A;  3CMQ A;  1HXD A;  4M75 G;  3X24 B;  2MMP A;  1QF6 A;  4YDQ A;  1G3W A;  3H6Z A;  4P72 A;  1SSF A;  3NEN A;  3E9I A;  5CCA A;  4AH6 A;  5J3B A;  1B7Y B;  5LJ3 e;  1Q86 C;  1JJ2 S;  4LD9 K;  4MML A;  1LOJ A;  1W66 A;  3GP8 A;  1VQM T;  4C5H A;  4ELY C;  3M4G A;  3V7C A;  2EJF A;  2QHV A;  4H2X A;  4M7A C;  3MF2 A;  1X2H A;  3FLG A;  3PCO A;  2E6Z A;  5GAN f;  1I81 A;  2WSE E;  5CVI A;  1VQN T;  3V8K A;  4BDZ A;  1Q7Y U;  3CBO A;  4GLK A;  3VV0 A;  5CO7 A;  2K5I A;  3CCJ A;  3OD1 A;  4EX5 A;  5LJ3 d;  4J7I A;  4CS2 A;  1VQ4 T;  2V8J A;  3QZ9 B;  4P71 A;  4LVI A;  4Y91 A;  2PVG B;  2P0K A;  1UEB A;  3RES A;  3CMA T;  4P72 C;  5M9O A;  2VGN A;  5LJ5 d;  4HCZ A;  1VQO A;  5CIU A;  1D3B B;  1E22 A;  1QP3 A;  3ME9 A;  1VQ8 A;  2ZT5 A;  4N4H A;  2P0L A;  1X55 A;  3A5Z A;  3SD4 A;  2QI2 A;  5FU6 C;  4CH3 A;  4LD6 A;  3QJY A;  4FL6 A;  3T9N A;  5LJ5 e;  5GAM e;  4PL6 A;  2HQE A;  2JNG A;  5D6W A;  4DQ2 A;  1RL2 A;  2QDY B;  2LCL A;  4M7D A;  2PU9 B;  2I4O A;  5A0D A;  3QXE B;  3QTC A;  2AKW A;  2QXF A;  3SFM A;  3LWH A;  3DSQ A;  2XKO C;  5GAN d;  2ZZG A;  4UC4 A;  2ALY B;  3CME A;  3MEU A;  2PVO B;  1QVP A;  4JRQ A;  2RJF A;  3MP6 A;  3CD6 T;  1MGQ A;  1AHJ B;  2VUB A;  4ZIB A;  4B9W A;  1YFR A;  1YI2 A;  4KR2 A;  5C0M A;  4QW2 A;  3TEG A;  3HY0 A;  1KD1 U;  4XU2 A;  1K9M U;  2K2V A;  4PNO A;  4M78 A;  4XQ3 A;  4E51 A;  1M90 C;  4M7D C;  3JCM W;  3JCM d;  4XU1 A;  2LTO A;  1EIY B;  1UGP B;  1ASY A;  3M9Q A;  2QA4 A;  1G51 A;  2P4T A;  3LSS A;  1FYF A;  4J5Y A;  4YCV A;  3L2Z A;  4FU6 A;  2V8I A;  2ARU A;  2E6N A;  1UB4 A;  4C92 G;  1B34 A;  2KQW A;  2AMC A;  3JCM J;  4IUR A;  1X75 C;  2LDM A;  2GFA A;  3IG2 A;  1XOV A;  2ZGW A;  1WJQ A;  1RIQ A;  4O5V A;  2KY9 A;  3OYN A;  3S3N A;  2EYQ A;  2WAC A;  4YRE A;  1N8R U;  4H2X B;  2ZPE B;  3GNF B;  5GAN 3;  2RH2 A;  3NTH A;  2ZZF A;  2P0Q A;  2Y4Y A;  2R5A A;  2RK2 A;  4RCC A;  1BI1 A;  2EAY A;  4YP0 A;  2EL9 A;  2NLU A;  3GPL A;  3OYM A;  1GXI E;  1EVL A;  2E5A A;  2PUO B;  5IT9 E;  1OZ3 A;  2RHI A;  1NJ5 A;  4P3N A;  1S72 T;  4M77 F;  5GMK l;  2KDS A;  4HA8 A;  1YJN A;  3JB9 H;  4RDX A;  3NFC A;  3S6W A;  2D9T A;  5C53 B;  2XG8 D;  1X54 A;  2Q7G A;  4NOY A;  2IY5 A;  5GAM g;  3OBW A;  4BY6 B;  2ZPF B;  5ELN A;  2D6F A;  2I4L A;  1ADJ A;  4CH6 A;  3RMQ A;  3I55 T;  3QDR B;  5A2Q E;  2DD4 A;  5C51 B;  4A4H A;  3CCJ T;  2XDP A;  1IZ6 A;  4ZGJ B;  4EMK A;  2MI6 A;  3TUP A;  3NTI A;  4C8Q C;  1YJ9 T;  3LLR A;  3L2R A;  1M1K U;  5CKD A;  4P3P A;  2GQV A;  1DJ7 B;  2MAM A;  3JB9 D;  3A5Y A;  5CK9 A;  5ELO A;  1YIT A;  4HT4 A;  1B76 A;  3JB9 G;  2KAF A;  3M57 A;  2H3J A;  2X4Y A;  3JB9 F;  1EIY A;  3VBB A;  4HVC A;  4L59 A;  4DPG A;  4ZTF A;  1LNX A;  3OBY A;  2LX9 A;  4ATO A;  2RHU A;  1VIF A;  4JLI A;  5EG2 A;  3A32 A;  2QQR A;  4A4G A;  4ZN3 A;  1NPP A;  4PJO B;  3JCM h;  4YTL A;  1QVF S;  1N9W A;  3L2V A;  3FIF A;  5FRO A;  1SES A;  4YPF A;  3HP9 A;  1V29 B;  1I5L A;  3JCM g;  1Y07 A;  4CH4 A;  1WQ7 A;  4II1 A;  2PME A;  4Z02 A;  4YRP A;  5CKF A;  1JRI A;  3JB9 J;  2ZNJ A;  3CCR T;  1G3Y A;  2EJG A;  2KSS A;  3CCM T;  1M90 U;  4BE2 A;  3MP1 A;  4XU0 A;  3TRE A;  3HFN A;  1MHN A;  3M5A A;  1NJI C;  1N6A A;  4YRI A;  1WLE A;  3QO5 A;  4K88 A;  4C5G A;  2DDZ A;  4YRC A;  4KUL A;  4TVA A;  3I7F A;  4YRS A;  2DO3 A;  4K86 A;  5LJ3 j;  4C8Q G;  1BI0 A;  2M1H A;  2RHZ A;  1WYD A;  5K1P A;  4OB2 B;  1NJ1 A;  4TQD A;  3EAE A;  2C7I A;  2GCX A;  4N4I A;  2KMT A;  1E24 A;  1NJ6 A;  3SWN A;  4YCU A;  4PHC A;  1QP2 A;  3CXC A;  2RI5 A;  3HXZ A;  1VQ6 A;  1VQP A;  3CC7 A;  1YIJ T;  5E3I A;  1YHQ T;  2R5M A;  1Y96 A;  3A8H B;  1YJ9 A;  2RHS B;  2DK3 A;  1H4T A;  4PJO G;  5GAN e;  3KFU A;  4P73 A;  3GF5 A;  3DLM A;  2QQS A;  4C8Q F;  4C92 A;  4ZGD B;  2B8A A;  2HNI A;  1VQK A;  3OMC A;  2QEX T;  2RD1 A;  1KQ2 A;  3CCV A;  3I56 T;  2XD0 A;  3VYG A;  3HHT B;  1W2B S;  2VXE A;  3E9F A;  1JB0 E;  3E9H A;  3EFR A;  3I56 A;  2WSF E;  4FIB A;  3NET A;  2K3Y A;  4RMO A;  2XHC A;  1R8O B;  3BDL A;  3UDC A;  3UH0 A;  2BUD A;  4O6J A;  3VUB A;  3PTA A;  4EPC A;  4M7A A;  1G5H A;  3GNG A;  1VQ7 T;  2XI9 A;  2DXC A;  2QQA A;  2L89 A;  4XEO A;  4EDU A;  3CPW A;  2XTI A;  2E65 A;  4QVD A;  3LW5 E;  4XAX B;  1B70 A;  4KUD K;  1UGQ B;  3QG1 A;  5DM7 R;  3A7A A;  3UT1 A;  2ZR3 A;  5FRM A;  1H4Q A;  1H4S A;  3F70 A;  5GMK m;  4C8Q B;  1XNI A;  5GAO p;  2X35 A;  2X4W A;  2ZPG B;  5GAN 5;  2FHD A;  4JDS A;  1Y7X A;  4F7U G;  3A7U A;  4XTW A;  2ZCE A;  2PUK B;  5GMK h;  5GAM f;  3UPU A;  3QPH A;  5D6X A;  2RI2 A;  3CPF A;  5KCH A;  1YIJ A;  1VQM A;  2DVE A;  3REX A;  4Q6G A;  2JN0 A;  3C94 A;  1NJ2 A;  2O4X B;  2DXU A;  4OLF A;  4C0D C;  3OQ5 A;  3OS2 A;  3OY9 A;  4M7A D;  2ZT7 A;  3JCM e;  2OTJ A;  3QZ5 B;  1BBU A;  3CCU A;  3A8G B;  2X4J A;  4PKC C;  3BDU A;  2IG0 A;  3OS5 A;  1X56 A;  4WI1 A;  4TVW A;  3IAL A;  2ZIO A;  5FU6 B;  3LWI A;  3OA6 A;  1S72 A;  2G3R A;  3G1Z A;  4BI4 A;  2LVM A;  1WJR A;  4OF1 A;  3Q1J A;  3G4S A;  1M1F A;  5LJ5 h;  3OYE A;  3OYA A;  4RKU E;  1IRE B;  1NNH A;  2X4X A;  4JUV A;  4DA4 A;  4YYE A;  2EQJ A;  5GMK j;  4PJO A;  3E1S A;  4LDU A;  4NL3 A;  5CQX A;  4LDW A;  1P92 A;  4KBM B;  2XDB A;  4CI0 C;  1N8R C;  3HRS A;  3HRU A;  2RI3 A;  3DB3 A;  2Q7H A;  4BD3 A;  1VQL A;  1QVF A;  1K8A C;  2K5F A;  4C5E A;  3CC4 A;  4X5O A;  1QW1 A;  2EIF A;  1YBY A;  2AMC B;  3UGT A;  4C92 C;  1KMM A;  1H64 1;  3OS1 A;  1X2G A;  3HY1 A;  1KQS S;  4FT2 A;  2QHT A;  4H2V A;  2CIM A;  2YHT A;  2A7Y A;  1U1S A;  3I55 A;  1O75 A;  3CCL T;  2RHQ A;  4XTX A;  3OW2 A;  4YCW A;  5GMK i;  2ZR2 A;  1Q82 U;  3QII A;  4M75 C;  3X25 B;  1Z7N A;  2G4C A;  3HSB A;  4XTU A;  3RF1 A;  4M77 C;  3VKI A;  4FM4 B;  4OB0 B;  5K1X A;  4XEM A;  3QYG B;  5HK3 A;  1UGR B;  4TQF A;  2JOY A;  1YGB A;  3FEO A;  3QKJ A;  2ODR D;  4C8Q A;  4E7I A;  4M75 E;  1NZ9 A;  4M7D B;  4KUI A;  1WPY A;  3NEM A;  3VQV A;  4M78 F;  3JCM c;  4C5I A;  3WXM B;  4HWR A;  5LJ5 j;  4JRK A;  1YJW A;  3OSV A;  2QEX A;  5GAO n;  3L4G A;  3JCM Q;  2K4Y A;  2XDD A;  1ZQ1 A;  3HXU A;  4M75 F;  3ZEH A;  5FU7 C;  4BI3 A;  2DQ3 A;  3V7R A;  11AS A;  3ZBD A;  3VU3 C;  4E7L A;  5GAM h;  3CC7 T;  1LJO A;  5LL6 S;  2ZIN A;  2VV5 A;  4JRI A;  5FLX E;  1YB3 A;  2LRQ A;  5IN1 A;  1K73 U;  5GMK e;  5GAM d;  1C0A A;  4YRF A;  2Q5H A;  4RMF A;  3VUZ A;  1KHI A;  4F7U A;  3M4P A;  1FX7 A;  5L8R E;  2QQ9 A;  2PVD B;  2DKG A;  2RB6 A;  3FC3 A;  4CS3 A;  3PIP A;  5GAN 4;  3C12 A;  3RGL A;  3DKM A;  4JS4 A;  2ZNI A;  5HY6 A;  2ZXF A;  1YHQ A;  1OI1 A;  2MWO A;  2DEQ A;  1OZ2 A;  3TEE A;  4NCX A;  3KBG A;  3MCA B;  3KXT A;  2YRV A;  3R6O A;  1U1T A;  2L8D A;  4J8O A;  4C92 F;  2ARS A;  3LC0 A;  4M7A G;  1EIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...