4XU1A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 82 that incorporates a morpholine in place of the ribose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 98
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu1A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu1A01
5GANh 5LJ3f 2AMCB 4UP8A 4H2XB 2ZT8A 4YP0A 1B34A 4KR3A 3FB9A 5LJ3h 1WLEA 3RGLA 1WYDA 2RB6A 4M7DE 4G85A 4HWTA 4EMKA 1LYLA 4HWPA 11ASA 3HY0A 3RKWA 2ZTGA 12ASA 2ZR2A 5GAN7 1YFTA 3HXXA 5LJ3g 4HWSA 3RESA 1KMMA 3JCMW 2CGHA 5GAOm 4M7AE 2EJGA 5GMKe 2I4NA 3JCMb 2E1HA 4M7DB 5GAMg 3R07A 4YRTA 4RQFA 5LJ5g 2ZNJA 1X2GA 3NETA 2Q7HA 5GANf 1J5WA 5CAIA 5GAN8 1SESA 4Q6GA 1N9WA 4WJ3M 5GMKl 3REXA 1YGBA 5F5WA 5LJ3e 4M7DC 2ZT5A 3HFVA 4TVYA 4Q15A 3VQXA 2QHUA 5GANe 3L4GB 3P8VA 4JUVA 4M78E 4C8QD 3WQZA 2RHQA 4YRKA 2QHTA 2ZINA 2K57A 2ZR3A 3P8YA 4P75C 3RF1A 4AH6A 3IALA 3FIFA 3JB9D 1E24A 3QO5A 4XTWA 1B7YA 1EQRA 4YROA 3RKXA 2FB7A 3LC0A 3JCMQ 1G5HA 4MMKA 3IG2A 5GMKh 2Q5IA 4CH6A 4XTZA 1D3BB 4XEOA 3TUPA 3RUXA 2I4LA 1I5LA 4PNOA 2E64A 2ZT7A 1BBWA 3JCMX 3OD1A 4Y91A 1BIBA 4P73A 3FJPA 4MMLA 2DZCA 3EFSA 2DQ0A 4P71A 4NOYA 1L0WA 4HWOA 2Q5HA 1Y96A 1M5Q1 5GMKi 2P0LA 4BWAA 4M7DF 3UH0A 4YRJA 2DXTA 5E3IA 4A54A 1H4QA 3VU3C 5GAOq 3IKMB 3L4GA 4M77G 2IY5A 3VBBA 1WNLA 4XU3A 1B8AA 2ALYB 3A31A 3A7RA 3HRIA 3IKLA 4YRGA 4YRIA 4WF2A 3JB9F 4TVWA 5GAMe 4EMKC 4HT8A 1EVLA 2ZIOA 3E9HA 2CIMA 3BDUA 2VXFA 3JCMe 1I81A 4BW9A 4E51A 1Z7MA 5GAOn 3HFOA 4M7AG 3NELA 4YREA 3MF1A 1B7YB 3INZA 4OP0A 2PMEA 3HFZB 2FYKA 4XU2A 5C51B 2EJ9A 1QE0A 2ARSA 2J3MA 4YCWA 1N9SA 3EFRA 2DTIA 4C8QG 2EL9A 4NL2A 1G5IA 3A74A 4JRKA 1X2HA 3L2ZA 4M7AB 3AHUA 3QUIA 1X55A 4N0AA 4P72C 2E10A 1TH7A 3QSUA 4M75C 1WU7A 1FYFA 4XQ3A 4H2UA 1JBMA 3HXWA 4P3NA 2DQ3A 3NENA 2ZXFA 1Y96B 1JJCB 3M4QA 4M77C 2ARUA 3PCOA 4KR2A 4F7UA 4JLIA 4C8QB 3W3SA 3RIRA 3CMQA 1IL2A 1ADJA 1E22A 3VQWA 5GAMd 1G51A 1EIYB 4ZIBA 2HNIA 2CJ9A 1USYA 3JB9I 3HY1A 2ZGWA 1NJ8A 5ELOA 3HTZA 4M7AF 1NJ5A 4QVCA 4X5OA 3V8JA 1H4VB 3QHSA 1VQZA 4TQDA 1BBUA 4TQFA 3VQVA 4M78C 3JCMh 2RHSB 3MF2A 4PG3A 4YRLA 4YYEA 3TEGA 4NL3A 2EJFA 1WQWA 4OLFA 3HXVA 3HFZA 2EAYA 4C8QF 2AKWA 4YRCA 4XTXA 5I21A 4XTVA 3GIBA 3REUA 5GAOl 4YRPA 3HFNA 1NJ2A 5GAMj 4P3PA 4ZTUB 1X54A 1H4SA 4M77A 4CH5A 1KQ2A 3V8KA 2E65A 4M77E 4HWRA 1ASZA 3HXYA 1KMNA 4TVAB 3RERA 4CS2A 1MGQA 4RDXA 3BY7A 1WQ7A 4C92G 5GAN6 1Z7NA 4EX5A 2XTIA 5KNNA 3BW1A 1RIQA 3RL6A 3JB9H 1SERA 2RHQB 1B70B 4H2TA 1W66A 4PJOB 2VC8A 1E1TA 3JCMf 4C8QE 5GAN2 4K87A 4H2VA 2ARTA 5K1PA 5GAN3 4PJOG 4M7AD 1BIAA 4UPAA 3ICAA 2YLBA 3JCMJ 1N9RA 3SWNB 2RA2A 2ZZFA 4X9CA 1D3BA 5GMKm 2VXEA 5LJ5d 4PJOE 3JB9G 3M4PA 4C92B 3NEMA 4A53A 2ODRD 4J6WA 4HVCA 1X01A 5LJ5h 4P71C 4PJOF 2I4OA 2YHTA 4RQEA 2XGTA 1ASYA 4RCBA 3LSSA 2I4MA 4XU0A 4C92C 4J5YA 4DPGA 5GAN4 1E1OA 2DDZA 2P5IA 3KFUA 2IY5B 1HK9A 4XTUA 3SWNC 3V7RA 2ALYA 2ZZGA 4H2XA 4TTVA 3V7SA 4UP7A 1B34B 2RM4A 4XU1A 1U1SA 4J6XA 2ZZEA 5GMKj 1PYSA 5HGQA 1ADYA 4JRIA 4M75D 4PJOA 1KQ1A 2CJAA 2PMFA 4PJOC 2DKGA 4J6YA 5C53B 1USYC 1QF6A 2J3LA 5GAMf 5LJ5f 1X56A 3A5ZA 4H2SA 1JRIA 1YCYA 2ZT6A 2DJZA 2ZIMA 4KQEA 4CH3A 4C92A 4M7DA 4P74C 4M7AA 2JN0A 5ELNA 3JCMP 3PZCA 4C92E 5GAOp 2E5AA 3BJUA 1WPYA 2I2LA 4K86A 2DTOA 3A7AA 4M75A 5GAOr 2Q7EA 4N0AC 4M78D 1JJCA 4C92F 3HRKA 4DQ2A 3I7FA 4XTYA 3PCOB 4F7UB 1C0AA 2DEQA 3V8LA 4EO4A 4CS3A 4G84A 3JCMc 3A32A 4LNSA 4HT9A 2DTHA 4YCUA 4P3OA 1NNHA 5GANd 5DY9A 3ERRA 2Y90A 1EOVA 2E3CA 4M78B 1I8FA 3HXZA 1PYSB 5LJ5e 1YB3A 4YRQA 4M7DD 3DSQA 2ZNIA 4YRMA 2RHSA 1B76A 4PJOD 4M75E 1LNXA 4F7UF 2AKWB 1NJ1A 3QO3A 1HXDA 4YRRA 4C8QC 4YCVA 1M8VA 3JCMd 4UP9A 4QVDA 4M77B 1SETA 1H4TA 1HTTA 4M75G 3UGTA 4M78F 3VQYA 4TWAA 3V7CA 1NJ6A 1LJOA 5GANj 3LSQA 4M77D 4WJ4A 4K88A 3TEHB 3L1AA 4M75B 4P73C 4X9DA 4TVAA 3HSBA 1SRYA 2QHSA 2QTXA 4M7AC 4P74A 1EFWA 1NYRA 4L87A 3QO7A 2DZ9A 4J15A 3RKYA 4NCXA 4PHCA 2DVEA 4H2WA 4F7UG 1ATIA 2AMCA 4YRFA 4YRNA 2CJBA 1HC7A 1B70A 4O2DA 4M78A 3UFGA 2YLCA 3QNEA 3A7UA 2DU5A 1LOJA 5GAMh 5LJ3d 3HXUA 4HA8A 4F7UE 2ODRC 3MEYA 1KOGA 4P75A 5K1XA 4EMKB 4M78G 2EWNA 2RD1A 4EMHA 4WI1A 2DU7A 5LJ3j 3SWNA 1GGMA 2DXUA 4YRSA 4H02A 2Q7GA 4C92D 3P8TA 4RCCA 3JCMV 1YFRA 1I4K1 2E41A 3QTCA 1U1TA 2C8MA 5LJ5j 4H2YA 3G1ZA 3SB2A 4CH4A 5GAN5 2C7IA 3QO8A 1NYQA 1YFSA 1EVKA 4V2SA 5GANg 3PGGA 3TEHA 4RMFA 3M4GA 3JCMg 3RACA 4P72A 5C52B 2QHVA 2ZCEA 4M77F 4C8QA 3E9IA 4EMGA 2G4CA 4YDQA 3JB9J 4YPFA 4ZTZB 4M7DG 3A5YA 1H641 4CS4A 3UGQA 4XEMA 3BFMA 1EIYA 4M75F
chains in the Genus database with same CATH superfamily
2RI5A 3CCEQ 3G4ST 1GCPA 3DB4A 2HZYA 2QEXQ 4KR3A 3VJPA 2EKOA 5IXFA 1HD3A 4Z02A 4EIKA 1G3TA 4ZNXA 1VQ6A 1YJNT 5EG2A 3EG2A 1Q7YR 1OU9A 5FU7C 4EMKA 1LYLA 2RO0A 11ASA 3HY0A 1C6VX 2YUQA 3UDCA 4B9XA 2ZR2A 5GJVB 5IH2A 5GAN7 4ZTJA 2KROA 3EFOA 1W4SA 1PSEA 2LX9A 2BZ8A 1M1FA 2AZVA 4M7AE 4RTWA 1WHJA 4M7DB 1KQSA 2HSEB 2ECZA 2ZNJA 1W70A 2FRYA 1I5OB 2Q7HA 3WVDB 5GANf 5CAIA 3CCLQ 1SESA 1N9WA 3REXA 3UPUA 5A2QE 5LJ3e 4IUUA 2KMTA 1VQ4Q 1GRIA 2K5IA 3CC2T 2QHUA 2D1XA 2QDLA 2KI7A 3P8VA 1IB8A 2CS7A 4QQ6A 2COYA 3WQZA 4KH1B 1X69A 2RHQA 2JTEA 5FRMA 4MDWA 1FMKA 1X2KA 1IGQA 3LH0A 1VQ5A 1M30A 2A7YA 4J9CA 5FROA 3NTIA 4HVVA 1ABQA 1TOVA 2SRCA 4AH6A 3FIFA 1BI1A 5J26A 3A1PA 1B7YA 4A4EA 2V1RA 3LC0A 2L89A 3C95A 2Q5IA 3ULRB 3IG2A 4CH6A 3TUPA 3WVEB 1YFNA 2X3XD 1I5LA 2E64A 2ENMA 4KT0E 2CZ1B 4J8OA 4ESRA 1EZZB 4CC2A 2PVDB 2V1QA 4B9WA 3CCJQ 5D6XA 3META 1H92A 4M7DF 2YT6A 2O01E 5I11A 3MO8A 2CKKA 4YRJA 2DXTA 3CCEA 3VU3C 4M77G 4KUIA 3OYKA 2ZPBB 1ZBXA 3VBBA 3A7RA 2XIDA 4YRGA 1X2QA 4TVWA 1YJWT 8AT1B 3MKDA 2CIMA 3VUZA 1YIJA 2DL8A 4BW9A 4E51A 2KT8A 3A8OB 3F70A 1UGQB 2DLPA 1VQKA 4QW2A 5EC7A 2FYKA 1YIJT 4DBRA 2V26A 4LXCA 4RTUA 1TTHB 3EFRA 2OTLT 4C8QG 4F16A 2EBPA 3NTHA 3ZL7C 1H3ZA 1X2HA 2GFAA 4AFSC 1EFNA 2VWFA 1BYMA 2LQKA 2D8JA 1UFFA 2JNGA 4M75C 1IHWA 3LYIA 1FYFA 1WYXA 2C0TA 4H2UA 4ORZA 3CD6Q 1VQPQ 1FXXA 1OQKA 4CC3A 2DAQA 1BCMA 2FEIA 3M4QA 1MV0B 1T3LA 2MK5A 4F7UA 1Y57A 3CXCS 4JLIA 3W3SA 2I0NA 2JTMA 4FU6A 4EPCA 1ADJA 1WHGA 1E22A 1QVFP 3JSCA 2E5QA 1K76A 3S6WA 3L2VA 2CJ9A 1NZ9A 1AWJA 1NYGA 2FPDA 3X26B 1QWFA 3HY1A 2RMOA 1NJ8A 5ELOA 4M7AF 1NJ5A 4PL6A 1H4VB 2FVUA 4JLGA 2ROLA 3OYLA 2YUPA 1AHJB 1OEBA 3QG1A 1BBUA 4M78C 4NL3A 3CD6A 2F2VA 2EJFA 2KYBA 4M4ZA 2OX7A 2QGFB 3I35A 1NM7A 3MEAA 4XTXA 1YJ9Q 2AKWA 4YRCA 1PD1A 1BKBA 3VYHB 5GAOl 3OYAA 3HFNA 4C0DB 2W10A 1AOJA 1H4SA 2DXBA 2MWOA 2HCKA 2E65A 1M4ZA 1MMAA 1VQ8A 4TVAB 4DBFA 2EQJA 1QVFA 1GBQA 1IHVA 3G71A 1WQ7A 3BW1A 2LP5A 3JB9H 2JTFA 1KIKA 3REBB 2RHQB 2COWA 1TS9A 2E4HA 2XHCA 4C5GA 3EG3A 5HK3A 5GAN2 4H2VA 4RTZA 1MMNA 5L8RE 1SSHA 1BIAA 2MPXC 1VQNA 3JCMJ 1ZX6A 1YJNA 4OB0B 1YN8A 1PHTA 5LJ5d 1IGUA 2XICA 2D0QB 1X6OA 2VV5A 3NEMA 3M54A 1VQPA 3MCAB 2EYWA 1HJDA 1UEBA 2VB6A 2ODRD 2O31A 4HVCA 2DBMA 2KR3A 3QYHB 3UA7A 5LJ5h 3P8DA 4JJCA 4PJOF 4UC4A 3EG1A 1X43A 3GP8A 2XGTA 2M1HA 1PG5B 2H3JA 3OSSC 3MP8A 2DM1A 5KH6A 1Y07A 4J5YA 4LDVA 5GAN4 5IN1A 2EVRA 1N8RC 1ZBJA 1E1OA 1HK9A 1W6XA 2RQRA 2KE9A 1U06A 4H2XA 5CK9A 2AK5A 2EQIA 2NLUA 4XU1A 3PVLA 4PJOA 3IQLA 1WA7A 2CJAA 4R0KA 4PJOC 4J6YA 2DJQA 1Y7XA 1TSFA 2VGNA 1USYC 2OTLA 2J3LA 4C5EA 1QF6A 3EHRA 3A5ZA 1QMCA 2A36A 4FM4B 4H2SA 1VUBA 4RKUE 1ZSZA 4WCIA 1VQ5Q 4CI0C 1YCSB 2M9UA 3CXCA 2C0OA 4L6V5 4OF1A 1UB4A 4E7ZA 1SHGA 1OX8A 1UE9A 3JCMP 4P5NA 3PZCA 4FYXB 1WPYA 2I2LA 4K86A 1UDLA 5GAOr 2MF2A 2LDMA 1K4US 1RADB 2HBWA 2K5LA 1VA7A 1WDXA 2KEAA 3CCVA 4F7UB 1G3SA 1C0AA 3PMTA 3V8LA 4A4KA 1O75A 3OA6A 1XOVA 5GANd 3P8HA 4M78B 3RMQA 5LJ5e 1OU8A 4N4HA 3RNJA 2L3QA 1RAGB 1VQ9T 2X3WD 3OS5A 1VQLA 4E2FB 1ZA2B 1B76A 2LNHB 4PJOD 3URGA 1K73U 4M75E 2AKWB 2XDDA 5CIUA 3QO3A 2KK4A 1QVGA 4YCVA 2DRMA 5KE3A 3DB3A 3G1JA 3UGTA 1KC8C 4TWAA 2PVOB 1NJ6A 1NLPC 1M2VB 4K88A 4WJ4A 3TEHB 3L1AA 1LPLA 4TVAA 1SRYA 1M1GA 4B6MA 3GNGA 2LCCA 1EFWA 2NUPB 4BE1A 2DA9A 1M3CA 2HDAA 3RKYA 4PHCA 2FPFA 1SRMA 1SPKA 2J6FA 3EAEA 4E7HA 1MNEA 2XU8A 2HAXA 3LGLA 2CJBA 1HC7A 1D1BA 1DJ7B 1NJIC 4O2DA 2XI9A 1K9MU 4FYVB 1UHCA 4HA8A 2ODRC 2QQSA 3VS2A 4M78G 4EMHA 3NFCA 1YHQA 4XAXB 5LJ3j 3RDVA 1GGMA 2DXUA 4DA4A 3LX7A 3PIOA 2F1LA 4C92D 4RCCA 1YFRA 2O4XB 1AWOA 3CMAA 2E41A 4H2YA 1U1TA 5LJ5j 4IIMA 3EHQA 3GLXA 4PLLA 1NYQA 1YFSA 2OJ2A 5GANg 1M1KC 3M4GA 4J7FA 2CP6A 2QHVA 2QGGA 1K9AA 2RI2A 4C8QA 1K73C 2M16A 3A5YA 3PFSA 4CS4A 5FWCA 2LT4A 4D6WA 5DLQE 3VS3A 5LJ3f 2AMCB 4UP8A 2VGMA 4BE0A 4H2XB 4L5GA 2K4YA 3RGLA 2OAWA 1KQSS 1WYDA 4PJMA 4G85A 1PWTA 3R6NA 4FCYA 4N4IA 1GFCA 3GBQA 3RKWA 2J6KA 3HXXA 4RTXA 3A5ZB 4HWSA 3NMZC 1KMMA 2CGHA 2EJGA 3JCMb 5GAMg 2HBPA 4RQFA 2M0YA 1WIEA 1NPRA 3CBMA 3NETA 1J5WA 5GAN8 5GMKl 5I2SA 1YGBA 4PKCC 2EIFA 2DL5A 3O8VA 2JVVA 2LJ1A 1R0BG 4JRQA 1K0XA 4LD6A 2KXDA 4JUVA 4M78E 3HHTB 3NGPA 2L3RA 1Q95G 1NJIU 3THKA 1Y0MA 2JMAA 2EYQA 2KRNA 3HRUA 1OYXA 5FU7B 2ZINA 4P75C 2X4JA 2HMAA 4OB3B 1PD0A 1WHMA 4XTWA 1H3HA 1KSWA 1OX9A 3RKXA 2FB7A 3OY9A 5KCHA 3JCMQ 2NUTB 3EFOB 4LVLA 3KXTA 1GFDA 1D3BB 2EKHA 4OB2B 3CPWP 1VQNT 2LQWA 2I4LA 4LDWA 3TU4K 1VQKT 3ZEHA 4PNOA 3PTAA 2KY9A 3G71Q 3CMET 2ZT7A 3JCMX 4E6RA 1BIBA 4MMLA 2DZCA 2LRQA 4P71A 2P0QA 3C12A 3CCSA 1Y96A 2WSFE 1RUWA 1Q86C 2E3IA 4A54A 4X1VA 3IKMB 1KC8R 8ATCB 4KGXB 2IY5A 4J9DA 2ALYB 4XU3A 5DM7R 3A31A 3IKLA 4YRIA 1B7TA 4HT8A 2ZIOA 3E9HA 3O5ZA 3JCMe 1IXDA 3I55Q 2LX7A 3HFOA 4OB1B 1P92A 2RN8A 5KYYA 4IUQA 3J81E 4BE2A 1B7YB 5CR2A 4K11A 1G5VA 1E7OA 2JOYA 1YI2A 4R55A 1K1ZA 2J3MA 4A4GA 3CMAQ 4E7JA 2EL9A 3A74A 1NJIR 2E5KA 3PE0A 3EGXB 4AG2C 3L2ZA 4BI3A 3QUIA 1X55A 4N0AA 4ZGEB 4P72C 2RK1A 3TQ7P 1VQ7Q 1WU7A 3CCQA 3EGUA 1YNZA 2DL4A 2HL5C 1QP2A 4LE9A 4M77C 3M5AA 2ARUA 2AHJB 4KR2A 3UT1A 4C8QB 4RTVA 2KDSA 3RIRA 1ZSZC 1WI7A 1OZ3A 1OPKA 2BIVA 1QQJA 2BE7D 1KQSP 1I1JA 2CSIA 5GAMd 4ZN1A 2HD0A 2HNIA 3QDFA 3ZBDA 2CT4A 3VS1A 4KULA 5CQXA 1K8AC 1UGVA 1RAEB 2QQBA 3QHSA 1H8KA 3M0PA 1VQZA 1NEGA 2YDLA 1W2BS 2X35A 2F5KA 4TQFA 3VQVA 3JCMh 2RHSB 4PG3A 4TVRA 4KGZB 4IUTA 2G3RA 3OYYA 4IURA 1YJWQ 3FEOA 3CQTA 4A63B 3GIBA 2DERA 1QVGS 3REUA 4YRPA 2QASA 1IZ6A 2CREA 3P8BB 3QYGB 3CCMQ 4M77A 3HRTA 1OZ2A 1Q7YU 4GLKA 5C6SA 2EGCA 2BUDA 1PNJA 2PUKB 2R57A 3RERA 1BI0A 1M3AA 3DLMA 2DMOA 2DNUA 3CCMT 3BY7A 3VKIA 4LVIA 4OMFB 1M90R 4F04B 3VS0A 5LL6S 1RIQA 4HVWA 2PNIA 1VOMA 1QKXA 4KH0B 1SERA 3I55A 1B70B 5AYFA 4FYYB 3CC7Q 1OULA 2XDPA 1MUZA 1W66A 4DBHA 4ELZC 1E1TA 3JCMf 2COZA 3PT9A 3CCUA 4QQDA 2ARTA 1JQQA 2B86A 3H0HA 3G6ET 1ZA1B 1IRXA 1TG0A 1BI2A 2RA2A 2L3PA 1Q7YC 1WFWA 1UGPB 3TVTA 1D3BA 1YHQT 3SD4A 4KRTA 4PJOE 4C92B 2DXCA 2RJCA 5M9OA 2P4RA 3JRZA 1XJWB 4CC7A 1X01A 2QDYB 3DKMA 1N8RR 2PQWA 3MJXA 1MMGA 1ASYA 3SHWA 2K3BA 2O2OA 4RCBA 1WHHA 5IHIA 1Z9QA 2F2XA 2IY5B 4XTUA 4II1A 3V7RA 2KQWA 2ALYA 5FLXE 5CKEA 1ZUKA 3M55A 1B34B 1JJ2A 3RBBB 4J6XA 2ZZEA 4NS5A 3LGFA 1KQ1A 3VYGA 5KYYB 3UA6A 4FSSA 2BTTA 5GAMf 3C4SA 4PFOA 3VS6A 3M0UA 2ZT6A 3CBPA 2ZIMA 4OMPA 4P74C 3EGXA 1QP3A 5ELNA 2LTOA 3CEYA 1K9MR 1SSFA 2E5AA 2QQ9A 2XMFA 4J9BA 2F69A 2Q7EA 3OYDA 1UGSB 4C92F 4DQ2A 4QKUA 5FW9A 1ZSGA 4OMMA 2RQTA 4XEMA 3GOXA 1TUCA 4EO4A 1R0CB 1ABOA 2J7IA 4YTLA 2QK0A 1BBZA 1W2BP 2K3YA 5HY6A 2H8HA 3ERRA 2Y90A 2A28A 1TUGB 1YB3A 4JJBA 4YRQA 3L42A 3DSQA 1EIFA 2ZNIA 4YRMA 2RHSA 2P4TA 5D6YA 3UATA 1YJWA 1G2BA 1XTDA 4F7UF 1RAAB 2JZ2A 2GBQA 1ZSZB 2EW3A 4C8QC 3VS4A 3JCMd 3S3NA 2EQMA 2WSCE 4M77B 4HCBA 1SKUB 1PM3A 4C0ZA 1HTTA 2L3SA 4M78F 3LSQA 3E9FA 1RAFB 2QYZA 3U23A 3CCJA 4FYWB 1I07A 3L2RA 1NYRA 2DZ9A 3VRYA 2DVEA 4H2WA 4F7UG 2O9SA 1VQ4A 4YRFA 3J80E 4YRNA 1G8XA 3N5BB 1B70A 4LUEA 4M78A 4LUDA 2P0PA 4E7LA 3CD6T 3HXUA 4FW1A 3OBWA 4F7UE 1YWOA 2X4YA 2Y4YA 4Z89A 2RD1A 3OQ5A 1FMVA 3X20B 5J3BA 2OTJQ 4D8DA 5IT9E 1M90C 3G6EQ 1FX7A 1PCXA 5IXBA 4YRSA 2GGRA 1VQLT 2Q7GA 5D7UA 4JZ4A 4AFQC 3G1ZA 3SB2A 1RLPC 3OYFA 3OYGA 3OW2P 2R5MA 2OTLQ 2RF0A 3QWYA 1EVKA 3JAME 2CP2A 1GBRA 3PGGA 3TEHA 3QJYA 3H8ZA 2O88A 1VQOT 2M51A 3RACA 2VUBA 3LH5A 3FJ5A 5FU6B 1N6AA 3I5SA 4E7SA 4M77F 1RAIB 4EMGA 2LNVA 4YDQA 3I55T 4M7DG 2DD5A 1EIYA 5GANh 4E7IA 3H0FA 3H9NA 1RLQC 3CC4A 4YP0A 1B34A 1RAHB 1N27A 3FB9A 2JT4A 1WLEA 1S1NA 2RNAA 1N8RU 4AFZC 1VIFA 2G6FX 2RJFA 4M7DE 4RUGA 4LNPA 5KYXB 2ZTGA 2JS0A 3I5RA 1D0ZA 1YFTA 1NBEB 1VQ6T 5LJ3g 3PVQA 3A8MB 2HKNA 3M0RA 2O4XA 5GMKe 1BB9A 3OYIA 2DRKA 2E1HA 1QCOA 4YRTA 5LJ5g 2MI6A 2XG8D 4JJDA 4WJ3M 5A0DA 2KYMA 3LWHA 3LW5E 2ESWA 5F5WA 2ZT5A 3VV0A 1WHKA 4TVYA 4BI4A 3VQXA 1WXUA 5GANe 2GQVA 2JJ9A 3L4GB 2LCSA 3WXMB 4PFPA 1VYTA 1CKAA 2MCNA 1UJYA 4C8QD 2L0AA 1GXIE 1JB0E 2CH4A 4J9GA 4Q5WA 3UWNA 2QHTA 4DOWA 2ZR3A 3P8YA 2FRWA 3EGDA 2JMCA 1Y71A 2OTJT 1MMDA 3E9GA 3HP9A 1E24A 1YI2T 1JU5C 4YROA 3S3OA 2IPOB 3OS0A 1G5HA 2CP3A 5GMKh 3CCLT 2MMPA 3R6OA 1KC8U 2CYZB 1UGRB 3RUXA 2LQ8A 3OMCA 4MZMA 4JRPA 4ELYC 5FU6C 2D0NA 1YIJQ 4ATOA 1BBWA 1R8OB 5CKHA 1MNDA 3E2UA 4Y91A 4P73A 2FHDA 3FJPA 4BD3A 1JJ2S 3EFSA 2D8HA 3QBYA 1RI9A 2YWWA 4J9EA 4N4GA 4O6JA 2AKLA 4NOYA 2QA4A 5KCOA 1L0WA 4HWOA 5CO7A 2Q5HA 2JW4A 2YUNA 4KBMB 5GMKi 2NWMA 2P0LA 1BK2A 5E3IA 5GAOq 1VQ5T 4MZPA 3ER0A 2KSSA 3ZFJA 1KD1R 3LWIA 4ZGDB 1WNLA 2RH2A 1B8AA 3HRIA 4WF2A 5HCKA 1JEGA 2DYBA 2BZYA 1B3QA 5GAMe 2DX1A 4OMLA 4OVAA 3PNWC 2V8KA 2QG9B 2A37A 2LJ3A 2CZ6B 3MEUA 3NPFA 3HFZB 2NUTA 4ZN3A 1GCQA 5C51B 3OW2S 1K73R 2ARSA 3HPWA 4YCWA 2DTIA 2L2PA 2Z0WA 4R56A 1ZLMA 1G5IA 1QKWA 2V8IA 2M0OA 3QZ5B 1QVFS 3TEEA 1KHCA 2XKOC 3M56A 4XQ3A 2P84A 1JBMA 4P3NA 1NEBA 3CMAT 3NENA 1OPLA 1X27A 2K6DA 2K3XA 1AWWA 2ZXFA 1Y96B 2DETA 2C06A 1JJCB 1YJ9A 2IG0A 3I56T 3NHNA 2K2VA 3EH2A 3CMQA 2YSQA 4J9FA 1G51A 1EIYB 5KYWA 4ZIBA 1USYA 1IREB 1UECA 3JB9I 4E47A 5D6WA 3V8JA 1QLYA 5CCAA 2MYSA 1Z9ZA 3L2QA 1M3BA 2JS2A 2GQIA 3TEGA 4OLFA 4FL6A 4XK8E 4J9HA 4C8QF 2QI2A 2YRVA 4HCCA 1YBYA 2GCXA 1ZUUA 4XTVA 1UG1A 3QKJA 2ABLA 1VQOA 5GAMj 1NJ2A 4P3PA 4ZTUB 2X4XA 1WHLA 1CKBA 4A4FA 5CVIA 4PFZA 2KRMA 3V8KA 3M4YA 4BI8B 4M77E 1ASZA 3CCMA 3HXYA 1KMNA 1B07A 2MIOA 3FRNA 2RI3A 1M8MA 4RDXA 1K8AR 1QCNA 1AZGB 2L8DA 5GAN6 1Z7NA 4EX5A 4FW2A 4KUDK 1WXBA 1YJ9T 2XTIA 1GCQC 4JPBW 3RL6A 2BE9B 2C0IA 3MP1A 4IUVA 4BB7A 3A8HB 4H2TA 1EX4A 2KRSA 4C8QE 3OBYA 4PJOG 4M7AD 4UPAA 3HTRA 3ICAA 2ZZDA 1S72T 3CC4Q 1K8AU 1KJWA 2QEXA 2CZ7B 3Q1JA 4QT7A 2ZZFA 4C5HA 3KBGA 3M59A 3EH1A 3SFMA 3CCRT 4LVMA 5CKFA 3CBOA 2FZKB 2LCLA 2YRCA 4GY5A 2AIRB 4FSXA 4J6WA 3SDZA 5IHKA 2DD4A 4P71C 1ARKA 4RQEA 2VKNA 3HL8A 3LSSA 5HK0A 2I4MA 2EGAA 4J9IA 2LQNA 1VQMA 4PJJA 2K5FA 3QZ9B 4DPGA 4PJNA 1JO8A 2IVWA 4AMCA 2HKQB 4ZGJB 2KVQG 2DDZA 2P5IA 1VQ7A 1V29B 2DL3A 2QTVA 3JV3A 1JXOA 2DIQA 1U1SA 4JJNK 3OYHA 5GMKj 1VIEA 1PYSA 1ADYA 1XQHA 4JRIA 3OYCA 2DEUA 1KK7A 3D7SB 4X34A 1PKTA 1FWZA 5LJ5f 2J6OA 4RG8A 2BKDN 1AT1B 4HXJA 1JRIA 1YCYA 2ZPIB 3CCSQ 1VQ9Q 1BU1A 1YP5A 4C92A 3L2UA 2EYZA 2JN0A 4ANJA 2DVJA 4F14A 5GAOp 3BJUA 7AT1B 4LVJA 2KAFA 2DTOA 4ME7A 3A7AA 4O5VA 4M75A 2HQXA 2R58A 1SG5A 2E12A 2E3HA 4N0AC 4M78D 1JJCA 4JS4A 2DBKA 4MZTA 5I2MA 4A4HA 3HRKA 3I7FA 4CS3A 2ED1A 4G84A 3JCMc 1AD5A 3M9QA 4LNSA 2DTHA 4Y28E 3X24B 2CDTA 5DY9A 4HKEA 3CPWS 2EQKA 2E3CA 3QPHA 3HXZA 3RR6A 2PU9B 1T3SA 1VYUA 4F17A 4M7DD 1TUDA 3CXCP 2KBTA 1V76A 1M1KR 5KYUA 2PVGB 3TREA 2ROTA 2LT1A 1IO6A 1X75C 1M27C 3H6ZA 3DLLA 5CQYA 1NJ1A 4QVZA 1D09B 1OOTA 2KNBB 1D1CA 1HXDA 4YRRA 3CCJT 1M8VA 4BDYA 2A8EA 4Y92A 3OB9A 4UP9A 2DPPB 4CC4B 1YITA 3TSWA 1H4TA 4M75G 1F1BB 4M77D 4P73C 4X9DA 3G4SQ 2QHSA 3H0IA 2QTXA 2RHIA 4PLIA 3CCQT 4L87A 4P74A 3QO7A 1PKSA 5DLOA 4NCXA 5L23A 1SHFA 2P0KA 4FT4A 1NG2A 1ATIA 1N5ZA 2YRDA 1D0YA 2RQUA 3GNFB 2D9TA 2EYXA 3QDRB 4LDXA 1Q81C 2YLCA 4AFUC 1OI1A 3QNEA 2DU5A 5LJ3d 3MEYA 4LN2A 4P75A 5K1XA 4EMKB 2VVKA 4BUGA 4WI1A 2LZ6B 1C0MA 2NUZA 3I56Q 5AT1B 1U8RA 2K2MA 3MEWA 1VQ9A 1YI2Q 4H02A 3UF4A 2LC4A 1VQPT 3P8TA 1X6BA 2WSEE 3JCMV 1JJ2P 1W2BA 3QTCA 4CH4A 1Q86U 2F5TX 4OMNA 3QO8A 1FMWA 4V2SA 1K0SA 4P72A 1VQ7T 2ZCEA 1ZQ1A 4OMQA 1R77A 5CKBA 2G4CA 2ZPHB 4JDSA 4Z88A 4YPFA 1H641 3TSZA 3BFMA 2DQ0A 3GF5A 4RTTA 4WTOB 5J39A 2ZT8A 5LJ3h 1QVGP 1S72A 2VASA 2RB6A 4HWTA 2OAUA 3FLGA 1GL5A 4QQGA 2E70A 4HCZA 4HWPA 2E6NA 1QCFA 2NYSA 1VQ6Q 12ASA 2GTJA 3SEMA 3M0TA 1J3TA 1AZEA 1T0HA 1FYNA 2FZCB 4HCKA 3RESA 4GLMA 3JCMW 2D6FA 5GAOm 4C0GA 2I4NA 3R07A 2R5AA 2CH4W 1X2GA 1VQNQ 3CCRQ 4BACA 3OSVA 1YJNQ 4Q6GA 2RHYA 4GBQA 2JXBA 4M7DC 3HFVA 1UUEA 3X28B 4Q15A 1XNIA 1G83A 1VQOQ 1E6HA 3EG9A 3QJ6A 3CCUT 1WXTA 4CRIA 3HKSA 4IIOA 3S3MA 4YRKA 6AT1B 2DILA 2K79A 2K57A 1VQMQ 3RF1A 4J83A 3A98A 3CC4T 2IIMA 1YWPA 3IALA 3JB9D 3CCRA 2B8AA 5KYXA 5KYUB 1EQRA 3QO5A 3I9QA 1TU0B 4IKFA 4MMKA 2CP7A 4DBQA 5KYNA 3M53A 1VQ8Q 4XTZA 4XEOA 2RHXA 2A3LA 1QW1A 1WJRA 2ZCFB 2NS6A 1G3YA 2XD0A 4J7IA 1D1AA 1VYVA 3FDRA 4MDXA 3OD1A 2A0FB 4DEYA 3A8GB 1T0JA 3CMEA 1M1KU 2LJ0A 2CUBA 2KXCA 3L2WA 1M5Q1 4BWAA 5A0LA 2AT1B 3UH0A 3QXEB 3OYBA 3L4GA 3T9NA 1TWBA 2WACA 3OYEA 3OW2A 2QAZA 1H4QA 1LVKA 3OYJA 3JB9F 3MPUB 2RQWA 3CCET 4EMKC 1EVLA 4IUPA 3BDUA 2VXFA 3EGDB 1I81A 2PUOB 1KD1C 1Z7MA 5GAOn 4M7AG 3NELA 4YREA 3MF1A 3REAB 3E19A 1KFZA 3INZA 3VS7A 1K9MC 2DE0X 4OP0A 2PMEA 1YHQQ 2Y4XA 2J05A 2YXYA 4XU2A 1M2OA 2CT3A 2EJ9A 1QE0A 1VQKQ 1N9SA 1NE8A 2QA4T 5IAYA 4NL2A 2AZSA 4JRKA 1VQ8T 1WLPB 4M7AB 3AHUA 1MV3A 3VRZA 2E10A 3PMIA 1TH7A 3HRSA 4BDZA 4AT1B 3QSUA 1RABB 4OGCA 5HKCA 3HXWA 1BCOA 2DQ3A 2O9VA 1U3OA 3AT1B 1TXQA 1D0XA 2HQHA 4OMOA 3OMGA 1NLOC 3PCOA 3ASKA 1WGSA 2OI3A 1IL2A 4LVKA 1AWXA 3VQWA 2F2WA 3EG0A 2AKKA 2ZGWA 3CPWA 3MQZA 3HTZA 4QVCA 2CUDA 4X5OA 2L5QA 2RPNA 2CSQA 2DL7A 4TQDA 3MEVA 1RI0A 3CCQQ 3MF2A 4YYEA 4YRLA 1WQWA 3HXVA 2FG0A 1NPPA 3OS2A 3HFZA 2EAYA 3M0SA 5I21A 4KGVB 2DF6A 2QXFA 1X54A 2RK2A 2GFUA 4C0FA 4CH5A 2KGTA 3I56A 2QEXT 1KQ2A 2EYYA 1WX6A 4BY6C 4HWRA 2JM9A 4LDYA 4CS2A 2EGEA 1MGQA 2ED0A 3BE3A 4EDUA 1I0CA 1A0NB 4C92G 1QWEA 3EG9B 5KNNA 2XK0A 3M58A 5KYWB 2V8JA 1QVPA 3CC2A 1UJ0A 1E6GA 3E1SA 1WZOA 3M0QA 4PJOB 2VC8A 2RQVA 4K87A 2YUOA 2FL7A 1O9SA 2E6ZA 5K1PA 5GAN3 2DFUA 5FWBA 2QA4Q 2YLBA 2RHUA 1N9RA 1LCKA 2X9HA 3SWNB 3PIPA 4X9CA 2A08A 3G6EA 5GMKm 2DK3A 2J06A 2VXEA 3JB9G 3M4PA 2XDBA 4A53A 3X25B 2HQEA 3NTKA 2RHZA 3CC2Q 2I4OA 3CC7A 2YHTA 2ZPEB 1AEYA 1BI3A 4XU0A 4C92C 2EPDA 4FIBA 4HVUA 2CP5A 4HT4A 1ACMB 3KUFA 4FT2A 3KFUA 5ECAA 3SWNC 2K9GA 5I22A 3CCST 2SEMA 2ZZGA 1OV3A 1PC0A 1NYFA 4TTVA 1W1FA 2HSPA 3V7SA 4AG1C 4UP7A 4RMOA 2RM4A 2CZ0B 4PJLA 5HGQA 2MAMA 2ZPGB 4M75D 3J7AF 4L59A 2PMFA 2DKGA 5C53B 2BZXA 2PZ1A 3FC3A 3OYMA 1X56A 2MWPA 2KT1A 1KD1U 4RG2A 2GNCA 2OTJA 4DEXA 4Z8AA 2H3EB 2DJZA 1S72Q 4KQEA 4CH3A 1C1AA 4M7DA 3MP6A 4M7AA 1CSKA 1VQMT 1PRLC 5GJWB 1Q86R 3CCLA 4C92E 1M2VA 3CCVT 3ME9A 4BY6B 2GF7A 5C0MA 4DOVA 2NUPA 4XTYA 4C5IA 4C0DC 3PCOB 1PRMC 2DEQA 3MHXA 2X4WA 1Q81U 2ATCB 2VYTA 3A32A 4HT9A 4ZTFA 4YCUA 3CCVQ 4P3OA 1NNHA 1G3WA 1EOVA 1WJSA 1I8FA 1VQLQ 1PSFA 2EQUA 1PYSB 3VS5A 2LMJA 2EFIA 1Q82U 1Q82C 2MOXA 1V1CA 1UTIA 5KE2A 1LNXA 2K7AA 4RTYA 1RL2A 1Q81R 4PK4A 1YITT 5CKDA 1ZHIA 2JM8A 4QVDA 2FZGB 1SETA 3VQYA 3V7CA 2ZPFB 2ZAEA 1LJOA 5GANj 3C0CA 3RMSA 4M75B 1YITQ 3HSBA 2W0ZA 4JZ3A 4M7AC 1KHIA 1UHFA 2QQAA 1AVZC 1M90U 5FRNA 4J15A 3G4SA 1WJQA 2DYIA 3M57A 1HSQA 4VUBA 2QQRA 4E7KA 2AMCA 1SRLA 2HL3A 1MHNA 1X6GA 3G71T 3QWXX 3CMEQ 2CP0A 3UFGA 4OGEA 3A7UA 2M02A 1LOJA 5GAMh 2FO0A 1KOGA 3TCJA 4D8KA 2EWNA 5IHNA 3CCUQ 2DU7A 1KG1A 2RJEA 3SWNA 2FPEA 1ZUYA 1M9SA 1U5SA 2GTOA 2RJDA 1SF9A 1I4K1 2C8MA 2PTKA 5GAN5 3CC7T 2X51A 1RACB 2C7IA 3H41A 3BDLA 1Q82R 4RMFA 4JS5A 3C94A 3CPFA 2DIGA 3JCMg 3OS1A 1VQ4T 5C52B 4LD9K 3KFVA 2HEQA 5A0GA 9ATCB 2JUFA 2LVMA 3LLRA 4LDUA 3E9IA 3A8LB 3VUBA 1SEMA 3GPLA 3JB9J 4ZTZB 1JXMA 1HYOA 3G7ZA 3QIIA 3UGQA 3OYNA 4M75F 2DO3A
chains in the Genus database with same CATH topology
2RI5A 3G4ST 3DB4A 4KR3A 3VJPA 2EKOA 4Z02A 1G3TA 1VQ6A 1YJNT 5EG2A 5FU7C 4EMKA 1LYLA 2RO0A 11ASA 3HY0A 3UDCA 4B9XA 2ZR2A 5GAN7 4ZTJA 1W4SA 1PSEA 2LX9A 1M1FA 4M7AE 4M7DB 1KQSA 2ZNJA 2Q7HA 3WVDB 5GANf 5CAIA 1SESA 1N9WA 3REXA 3UPUA 5A2QE 5LJ3e 4IUUA 2KMTA 2K5IA 3CC2T 2QHUA 3P8VA 2CS7A 4QQ6A 3WQZA 2RHQA 5FRMA 4MDWA 3LH0A 1VQ5A 2A7YA 5FROA 3NTIA 4AH6A 3FIFA 1BI1A 5J26A 1B7YA 4A4EA 3LC0A 2L89A 3C95A 2Q5IA 3IG2A 4CH6A 3TUPA 3WVEB 1I5LA 2E64A 4KT0E 2CZ1B 4J8OA 2PVDB 4B9WA 5D6XA 3META 4M7DF 2O01E 3MO8A 2CKKA 4YRJA 2DXTA 3CCEA 3VU3C 4M77G 4KUIA 3OYKA 2ZPBB 1ZBXA 3VBBA 3A7RA 2XIDA 4YRGA 4TVWA 1YJWT 2CIMA 3VUZA 1YIJA 4BW9A 4E51A 3A8OB 3F70A 1UGQB 1VQKA 4QW2A 2FYKA 1YIJT 3EFRA 2OTLT 4C8QG 3NTHA 1H3ZA 1X2HA 2GFAA 1BYMA 2LQKA 2JNGA 4M75C 3LYIA 1FYFA 4H2UA 1FXXA 2DAQA 3M4QA 4F7UA 3CXCS 4JLIA 3W3SA 2JTMA 4FU6A 4EPCA 1ADJA 1E22A 3JSCA 2E5QA 3S6WA 3L2VA 2CJ9A 1NZ9A 3X26B 3HY1A 1NJ8A 5ELOA 4M7AF 1NJ5A 4PL6A 1H4VB 2FVUA 4JLGA 3OYLA 1AHJB 3QG1A 1BBUA 4M78C 4NL3A 3CD6A 2EJFA 4YRCA 3MEAA 2AKWA 4XTXA 1BKBA 3VYHB 5GAOl 3OYAA 3HFNA 4C0DB 1H4SA 2DXBA 2MWOA 2E65A 1M4ZA 1VQ8A 4TVAB 2EQJA 1QVFA 3G71A 1WQ7A 3BW1A 3JB9H 2JTFA 2RHQB 2XHCA 4C5GA 5HK3A 5GAN2 4H2VA 5L8RE 1BIAA 1VQNA 3JCMJ 1YJNA 4OB0B 5LJ5d 2XICA 2D0QB 1X6OA 2VV5A 3NEMA 3M54A 1VQPA 3MCAB 1UEBA 2ODRD 4HVCA 3QYHB 5LJ5h 3P8DA 4PJOF 4UC4A 2XGTA 3GP8A 2M1HA 3OSSC 2H3JA 3MP8A 5KH6A 1Y07A 4J5YA 4LDVA 5GAN4 5IN1A 1N8RC 1E1OA 1HK9A 4H2XA 5CK9A 2NLUA 4XU1A 4PJOA 2CJAA 4PJOC 4J6YA 1Y7XA 2VGNA 1USYC 2OTLA 2J3LA 4C5EA 1QF6A 3A5ZA 4FM4B 4H2SA 1VUBA 4RKUE 4CI0C 2M9UA 3CXCA 4L6V5 4OF1A 1UB4A 3JCMP 4P5NA 3PZCA 1WPYA 2I2LA 4K86A 5GAOr 2MF2A 2LDMA 2K5LA 3CCVA 4F7UB 1G3SA 1C0AA 3PMTA 3V8LA 4A4KA 1O75A 3OA6A 1XOVA 5GANd 3P8HA 4M78B 3RMQA 5LJ5e 4N4HA 1VQ9T 3OS5A 1VQLA 1B76A 4PJOD 3URGA 1K73U 4M75E 2AKWB 2XDDA 5CIUA 3QO3A 2KK4A 1QVGA 4YCVA 5KE3A 3DB3A 3UGTA 1KC8C 4TWAA 2PVOB 1NJ6A 4WJ4A 4K88A 3TEHB 3L1AA 4TVAA 1SRYA 1M1GA 3GNGA 2LCCA 1EFWA 4BE1A 3RKYA 4PHCA 3EAEA 4E7HA 2XU8A 2HAXA 3LGLA 2CJBA 1HC7A 1DJ7B 1NJIC 4O2DA 2XI9A 1K9MU 4HA8A 2ODRC 2QQSA 4M78G 4EMHA 3NFCA 1YHQA 4XAXB 5LJ3j 1GGMA 2DXUA 4DA4A 3LX7A 3PIOA 4C92D 4RCCA 1YFRA 2O4XB 3CMAA 2E41A 4H2YA 1U1TA 5LJ5j 3GLXA 4PLLA 1NYQA 1YFSA 5GANg 1M1KC 3M4GA 4J7FA 2QHVA 2RI2A 4C8QA 1K73C 2M16A 3A5YA 3PFSA 4CS4A 2LT4A 4D6WA 5DLQE 5LJ3f 2AMCB 4UP8A 2VGMA 4BE0A 4H2XB 4L5GA 2K4YA 3RGLA 1KQSS 1WYDA 4G85A 4N4IA 3RKWA 3HXXA 3A5ZB 4HWSA 1KMMA 2CGHA 2EJGA 3JCMb 5GAMg 2HBPA 4RQFA 1NPRA 3CBMA 3NETA 1J5WA 5GAN8 5GMKl 5I2SA 1YGBA 4PKCC 2EIFA 3O8VA 2JVVA 4JRQA 4LD6A 4JUVA 4M78E 3HHTB 2L3RA 1NJIU 2EYQA 3HRUA 5FU7B 1OYXA 2ZINA 4P75C 2X4JA 4OB3B 4XTWA 3RKXA 3OY9A 2FB7A 5KCHA 3JCMQ 4LVLA 3KXTA 1D3BB 4OB2B 1VQNT 2I4LA 4LDWA 3TU4K 1VQKT 3ZEHA 4PNOA 3PTAA 2KY9A 3CMET 2ZT7A 3JCMX 1BIBA 4MMLA 2DZCA 2LRQA 4P71A 2P0QA 3C12A 3CCSA 1Y96A 2WSFE 1Q86C 4A54A 3IKMB 2IY5A 2ALYB 4XU3A 5DM7R 3A31A 3IKLA 4YRIA 4HT8A 2ZIOA 3E9HA 3JCMe 3HFOA 4OB1B 1P92A 4IUQA 3J81E 4BE2A 1B7YB 5CR2A 1G5VA 2JOYA 1YI2A 4R55A 2J3MA 4A4GA 4E7JA 2EL9A 3A74A 3L2ZA 4BI3A 3QUIA 1X55A 4N0AA 4ZGEB 4P72C 2RK1A 1WU7A 3CCQA 1QP2A 4M77C 3M5AA 2ARUA 2AHJB 4KR2A 3UT1A 4C8QB 2KDSA 3RIRA 1OZ3A 2BIVA 5GAMd 4ZN1A 2HD0A 2HNIA 3ZBDA 4KULA 5CQXA 1K8AC 2QQBA 3QHSA 1VQZA 1W2BS 2X35A 2F5KA 4TQFA 3VQVA 3JCMh 2RHSB 4PG3A 4TVRA 4IUTA 2G3RA 3OYYA 4IURA 3FEOA 3GIBA 1QVGS 3REUA 4YRPA 1IZ6A 3P8BB 3QYGB 4M77A 3HRTA 1OZ2A 1Q7YU 4GLKA 5C6SA 2BUDA 2PUKB 2R57A 3RERA 1BI0A 3DLMA 3CCMT 3BY7A 3VKIA 4LVIA 4OMFB 5LL6S 1RIQA 1SERA 3I55A 1B70B 5AYFA 2XDPA 1W66A 4ELZC 1E1TA 3JCMf 3PT9A 3CCUA 4QQDA 2ARTA 3G6ET 1BI2A 2RA2A 1Q7YC 1UGPB 1YHQT 1D3BA 3SD4A 4PJOE 4C92B 2DXCA 2RJCA 5M9OA 3JRZA 1X01A 2QDYB 3DKMA 2PQWA 1ASYA 4RCBA 2IY5B 4M75F 4XTUA 4II1A 3V7RA 2KQWA 2ALYA 5FLXE 5CKEA 3M55A 1B34B 1JJ2A 4J6XA 2ZZEA 4NS5A 3LGFA 1KQ1A 3VYGA 5GAMf 3C4SA 2ZT6A 3CBPA 2ZIMA 4P74C 1QP3A 5ELNA 2LTOA 3CEYA 1SSFA 2E5AA 2QQ9A 2F69A 2Q7EA 3OYDA 1UGSB 4C92F 4DQ2A 3GOXA 4EO4A 4YTLA 2K3YA 5HY6A 3ERRA 2Y90A 1YB3A 4YRQA 3L42A 3DSQA 1EIFA 2ZNIA 4YRMA 2RHSA 2P4TA 5D6YA 1YJWA 1XTDA 4F7UF 2JZ2A 4C8QC 3JCMd 3S3NA 2EQMA 2WSCE 4M77B 4HCBA 4C0ZA 1HTTA 4M78F 3LSQA 3E9FA 3CCJA 3L2RA 1NYRA 2DZ9A 2DVEA 4H2WA 4F7UG 1VQ4A 4YRFA 3J80E 4YRNA 3N5BB 1B70A 4M78A 2P0PA 4E7LA 3CD6T 3HXUA 3OBWA 4F7UE 2X4YA 2Y4YA 2RD1A 3OQ5A 3X20B 5J3BA 5IT9E 1M90C 1FX7A 4YRSA 1VQLT 2Q7GA 3G1ZA 3SB2A 3OYFA 3OYGA 2R5MA 1EVKA 3JAME 3PGGA 3TEHA 3QJYA 3H8ZA 1VQOT 3RACA 2VUBA 5FU6B 1N6AA 4M77F 4EMGA 2LNVA 4YDQA 3I55T 4M7DG 2DD5A 1EIYA 5GANh 4E7IA 3CC4A 4YP0A 1B34A 1N27A 3FB9A 1WLEA 1N8RU 1VIFA 2RJFA 4M7DE 2ZTGA 1YFTA 1VQ6T 5LJ3g 3A8MB 2O4XA 5GMKe 3OYIA 2E1HA 4YRTA 5LJ5g 2MI6A 2XG8D 4WJ3M 5A0DA 3LWHA 3LW5E 5F5WA 2ZT5A 3VV0A 4TVYA 4BI4A 3VQXA 5GANe 2GQVA 3L4GB 3WXMB 4C8QD 1GXIE 1JB0E 4Q5WA 3UWNA 2QHTA 4DOWA 2ZR3A 3P8YA 1Y71A 2OTJT 3E9GA 3HP9A 1E24A 1YI2T 4YROA 3S3OA 3OS0A 1G5HA 5GMKh 3CCLT 2MMPA 3R6OA 1KC8U 2CYZB 1UGRB 3RUXA 2LQ8A 3OMCA 4MZMA 4JRPA 4ELYC 5FU6C 4ATOA 1BBWA 1R8OB 5CKHA 4Y91A 4P73A 2FHDA 3FJPA 4BD3A 2C06A 3EFSA 3QBYA 1JJ2S 4N4GA 4O6JA 4NOYA 2QA4A 5KCOA 1L0WA 4HWOA 5CO7A 2Q5HA 4KBMB 5GMKi 2P0LA 5E3IA 5GAOq 1VQ5T 4MZPA 3ER0A 2KSSA 3ZFJA 3LWIA 4ZGDB 1WNLA 2RH2A 1B8AA 3HRIA 4WF2A 5GAMe 4OVAA 3PNWC 2V8KA 2CZ6B 3MEUA 3HFZB 4ZN3A 5C51B 3OW2S 2ARSA 3HPWA 4YCWA 2DTIA 4R56A 1G5IA 2V8IA 2M0OA 3QZ5B 1QVFS 3TEEA 1KHCA 2XKOC 3M56A 4XQ3A 4P3NA 1JBMA 3CMAT 3NENA 2ZXFA 2K3XA 1Y96B 1JJCB 1YJ9A 2IG0A 3I56T 2K2VA 3CMQA 1G51A 1EIYB 4ZIBA 1USYA 1IREB 3JB9I 4E47A 5D6WA 3V8JA 5CCAA 3L2QA 3TEGA 4OLFA 4FL6A 4XK8E 4C8QF 2QI2A 2YRVA 4HCCA 1YBYA 2GCXA 4XTVA 3QKJA 1VQOA 1NJ2A 5GAMj 4P3PA 4ZTUB 2X4XA 4A4FA 5CVIA 3V8KA 3M4YA 4BI8B 4M77E 1ASZA 3CCMA 3HXYA 1KMNA 3FRNA 2RI3A 4RDXA 2L8DA 5GAN6 1Z7NA 4EX5A 4KUDK 1YJ9T 2XTIA 3RL6A 3MP1A 4IUVA 4BB7A 3A8HB 4H2TA 4C8QE 3OBYA 4PJOG 4M7AD 4UPAA 3ICAA 2ZZDA 1S72T 1K8AU 2QEXA 2CZ7B 3Q1JA 2ZZFA 4C5HA 3KBGA 3M59A 3SFMA 3CCRT 4LVMA 5CKFA 3CBOA 2LCLA 4GY5A 4FSXA 4J6WA 3SDZA 4P71C 2DD4A 4RQEA 3HL8A 3LSSA 5HK0A 2I4MA 1VQMA 2K5FA 3QZ9B 3OYNA 4DPGA 2IVWA 4ZGJB 2KVQG 2DDZA 2P5IA 1VQ7A 1V29B 2DIQA 1U1SA 4JJNK 3OYHA 5GMKj 1VIEA 1PYSA 1ADYA 1XQHA 4JRIA 3OYCA 4X34A 1FWZA 5LJ5f 4RG8A 2BKDN 1JRIA 2ZPIB 1YCYA 4C92A 3L2UA 2JN0A 5GAOp 3BJUA 4LVJA 2KAFA 2DTOA 3A7AA 4ME7A 4O5VA 4M75A 2HQXA 2R58A 2E12A 4N0AC 4M78D 1JJCA 4JS4A 4MZTA 5I2MA 4A4HA 3I7FA 3HRKA 4CS3A 4G84A 3JCMc 4LNSA 3M9QA 2DTHA 4Y28E 3X24B 5DY9A 4HKEA 3CPWS 2EQKA 2E3CA 3QPHA 3HXZA 2PU9B 4M7DD 2PVGB 3TREA 2LT1A 1X75C 3H6ZA 3DLLA 5CQYA 1NJ1A 4QVZA 1HXDA 4YRRA 3CCJT 1M8VA 4BDYA 2A8EA 4UP9A 3OB9A 2DPPB 1YITA 1H4TA 4M75G 4M77D 4P73C 4X9DA 2QHSA 2QTXA 2RHIA 4PLIA 3CCQT 4L87A 4P74A 3QO7A 5DLOA 4NCXA 2P0KA 4FT4A 1ATIA 3GNFB 2D9TA 3QDRB 4LDXA 1Q81C 2YLCA 3QNEA 1OI1A 2DU5A 5LJ3d 3MEYA 4P75A 5K1XA 4EMKB 4BUGA 4WI1A 1U8RA 3MEWA 1VQ9A 4H02A 2LC4A 1VQPT 3P8TA 2WSEE 3JCMV 1W2BA 3QTCA 4CH4A 1Q86U 2F5TX 3QO8A 4V2SA 4P72A 1VQ7T 2ZCEA 1ZQ1A 5CKBA 2G4CA 2ZPHB 4JDSA 4YPFA 1H641 2DQ0A 3BFMA 3GF5A 5J39A 2ZT8A 5LJ3h 1S72A 2RB6A 4HWTA 2OAUA 3FLGA 4QQGA 2E70A 4HCZA 4HWPA 2E6NA 12ASA 3RESA 3JCMW 2D6FA 5GAOm 4C0GA 2I4NA 3R07A 2R5AA 1X2GA 4BACA 3OSVA 4Q6GA 2RHYA 4M7DC 3HFVA 3X28B 4Q15A 1XNIA 3QJ6A 3CCUT 4CRIA 3HKSA 3S3MA 4YRKA 2K57A 3RF1A 4J83A 3CC4T 3IALA 3JB9D 3CCRA 2B8AA 3QO5A 1EQRA 4IKFA 4MMKA 3M53A 4XTZA 4XEOA 2RHXA 2A3LA 2ZCFB 1QW1A 1WJRA 2NS6A 1G3YA 2XD0A 4J7IA 3FDRA 4MDXA 3OD1A 3A8GB 3CMEA 1M1KU 3L2WA 1M5Q1 4BWAA 5A0LA 3UH0A 3QXEB 3OYBA 3L4GA 3T9NA 2WACA 3OYEA 3OW2A 1H4QA 3OYJA 3JB9F 3CCET 4EMKC 1EVLA 4IUPA 3BDUA 2VXFA 1I81A 2PUOB 1KD1C 1Z7MA 5GAOn 4M7AG 3NELA 4YREA 3MF1A 3E19A 3INZA 1K9MC 4OP0A 2PMEA 2Y4XA 4XU2A 2EJ9A 1QE0A 1N9SA 1NE8A 2QA4T 5IAYA 4NL2A 4JRKA 1VQ8T 4M7AB 3AHUA 2E10A 3PMIA 1TH7A 3HRSA 4BDZA 3QSUA 4OGCA 5HKCA 3HXWA 2DQ3A 3OMGA 3PCOA 3ASKA 1WGSA 1IL2A 4LVKA 3VQWA 2ZGWA 3CPWA 3MQZA 3HTZA 4QVCA 4X5OA 2L5QA 4TQDA 3MEVA 1RI0A 3MF2A 4YYEA 4YRLA 1WQWA 3HXVA 3OS2A 1NPPA 3HFZA 2EAYA 5I21A 2QXFA 1X54A 2RK2A 2GFUA 4C0FA 4CH5A 1KQ2A 3I56A 2QEXT 4BY6C 4HWRA 4LDYA 4CS2A 1MGQA 4EDUA 4C92G 5KNNA 2XK0A 3M58A 2V8JA 1QVPA 3CC2A 3E1SA 4PJOB 2VC8A 4K87A 2FL7A 1O9SA 2E6ZA 5K1PA 5GAN3 2YLBA 2RHUA 1N9RA 3SWNB 3PIPA 4X9CA 3G6EA 5GMKm 2DK3A 2VXEA 3JB9G 3M4PA 2XDBA 4A53A 3X25B 2HQEA 3NTKA 2RHZA 2I4OA 3CC7A 2YHTA 2ZPEB 1BI3A 4XU0A 4C92C 4FIBA 4HT4A 3KUFA 4FT2A 3KFUA 3SWNC 3CCST 2ZZGA 4TTVA 3V7SA 4UP7A 4RMOA 2RM4A 2CZ0B 5HGQA 2MAMA 2ZPGB 4M75D 3J7AF 4L59A 2PMFA 2DKGA 5C53B 3FC3A 3OYMA 1X56A 2MWPA 1KD1U 4RG2A 2OTJA 2DJZA 4KQEA 4CH3A 4M7DA 3MP6A 4M7AA 1VQMT 3CCLA 4C92E 3CCVT 3ME9A 4BY6B 2GF7A 5C0MA 4DOVA 4XTYA 4C5IA 4C0DC 3PCOB 2DEQA 3MHXA 2X4WA 1Q81U 2VYTA 3A32A 4HT9A 4ZTFA 4P3OA 1NNHA 1G3WA 1EOVA 1WJSA 1I8FA 1PSFA 2EQUA 1PYSB 2EFIA 1Q82U 1Q82C 5KE2A 1LNXA 1RL2A 1YITT 5CKDA 1ZHIA 4QVDA 1SETA 3VQYA 3V7CA 2ZPFB 1LJOA 5GANj 3RMSA 4M75B 3HSBA 4M7AC 1KHIA 2QQAA 1M90U 5FRNA 4J15A 3G4SA 1WJQA 3M57A 4VUBA 2QQRA 4E7KA 2AMCA 1MHNA 3G71T 3UFGA 4OGEA 3A7UA 1LOJA 5GAMh 1KOGA 3TCJA 2EWNA 2DU7A 1KG1A 2RJEA 3SWNA 1M9SA 2RJDA 1I4K1 2C8MA 5GAN5 3CC7T 2C7IA 3BDLA 4RMFA 4JS5A 3C94A 3CPFA 2DIGA 3JCMg 3OS1A 1VQ4T 5C52B 4LD9K 5A0GA 2JUFA 2LVMA 3LLRA 4LDUA 3E9IA 3A8LB 3VUBA 3GPLA 3JB9J 4ZTZB 3G7ZA 3QIIA 3UGQA 4XEMA 4YCUA 2DO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN h;  5LJ3 f;  2AMC B;  4UP8 A;  4H2X B;  2ZT8 A;  4YP0 A;  1B34 A;  4KR3 A;  3FB9 A;  5LJ3 h;  1WLE A;  3RGL A;  1WYD A;  2RB6 A;  4M7D E;  4G85 A;  4HWT A;  4EMK A;  1LYL A;  4HWP A;  11AS A;  3HY0 A;  3RKW A;  2ZTG A;  12AS A;  2ZR2 A;  5GAN 7;  1YFT A;  3HXX A;  5LJ3 g;  4HWS A;  3RES A;  1KMM A;  3JCM W;  2CGH A;  5GAO m;  4M7A E;  2EJG A;  5GMK e;  2I4N A;  3JCM b;  2E1H A;  4M7D B;  5GAM g;  3R07 A;  4YRT A;  4RQF A;  5LJ5 g;  2ZNJ A;  1X2G A;  3NET A;  2Q7H A;  5GAN f;  1J5W A;  5CAI A;  5GAN 8;  1SES A;  4Q6G A;  1N9W A;  4WJ3 M;  5GMK l;  3REX A;  1YGB A;  5F5W A;  5LJ3 e;  4M7D C;  2ZT5 A;  3HFV A;  4TVY A;  4Q15 A;  3VQX A;  2QHU A;  5GAN e;  3L4G B;  3P8V A;  4JUV A;  4M78 E;  4C8Q D;  3WQZ A;  2RHQ A;  4YRK A;  2QHT A;  2ZIN A;  2K57 A;  2ZR3 A;  3P8Y A;  4P75 C;  3RF1 A;  4AH6 A;  3IAL A;  3FIF A;  3JB9 D;  1E24 A;  3QO5 A;  4XTW A;  1B7Y A;  1EQR A;  4YRO A;  3RKX A;  2FB7 A;  3LC0 A;  3JCM Q;  1G5H A;  4MMK A;  3IG2 A;  5GMK h;  2Q5I A;  4CH6 A;  4XTZ A;  1D3B B;  4XEO A;  3TUP A;  3RUX A;  2I4L A;  1I5L A;  4PNO A;  2E64 A;  2ZT7 A;  1BBW A;  3JCM X;  3OD1 A;  4Y91 A;  1BIB A;  4P73 A;  3FJP A;  4MML A;  2DZC A;  3EFS A;  2DQ0 A;  4P71 A;  4NOY A;  1L0W A;  4HWO A;  2Q5H A;  1Y96 A;  1M5Q 1;  5GMK i;  2P0L A;  4BWA A;  4M7D F;  3UH0 A;  4YRJ A;  2DXT A;  5E3I A;  4A54 A;  1H4Q A;  3VU3 C;  5GAO q;  3IKM B;  3L4G A;  4M77 G;  2IY5 A;  3VBB A;  1WNL A;  4XU3 A;  1B8A A;  2ALY B;  3A31 A;  3A7R A;  3HRI A;  3IKL A;  4YRG A;  4YRI A;  4WF2 A;  3JB9 F;  4TVW A;  5GAM e;  4EMK C;  4HT8 A;  1EVL A;  2ZIO A;  3E9H A;  2CIM A;  3BDU A;  2VXF A;  3JCM e;  1I81 A;  4BW9 A;  4E51 A;  1Z7M A;  5GAO n;  3HFO A;  4M7A G;  3NEL A;  4YRE A;  3MF1 A;  1B7Y B;  3INZ A;  4OP0 A;  2PME A;  3HFZ B;  2FYK A;  4XU2 A;  5C51 B;  2EJ9 A;  1QE0 A;  2ARS A;  2J3M A;  4YCW A;  1N9S A;  3EFR A;  2DTI A;  4C8Q G;  2EL9 A;  4NL2 A;  1G5I A;  3A74 A;  4JRK A;  1X2H A;  3L2Z A;  4M7A B;  3AHU A;  3QUI A;  1X55 A;  4N0A A;  4P72 C;  2E10 A;  1TH7 A;  3QSU A;  4M75 C;  1WU7 A;  1FYF A;  4XQ3 A;  4H2U A;  1JBM A;  3HXW A;  4P3N A;  2DQ3 A;  3NEN A;  2ZXF A;  1Y96 B;  1JJC B;  3M4Q A;  4M77 C;  2ARU A;  3PCO A;  4KR2 A;  4F7U A;  4JLI A;  4C8Q B;  3W3S A;  3RIR A;  3CMQ A;  1IL2 A;  1ADJ A;  1E22 A;  3VQW A;  5GAM d;  1G51 A;  1EIY B;  4ZIB A;  2HNI A;  2CJ9 A;  1USY A;  3JB9 I;  3HY1 A;  2ZGW A;  1NJ8 A;  5ELO A;  3HTZ A;  4M7A F;  1NJ5 A;  4QVC A;  4X5O A;  3V8J A;  1H4V B;  3QHS A;  1VQZ A;  4TQD A;  1BBU A;  4TQF A;  3VQV A;  4M78 C;  3JCM h;  2RHS B;  3MF2 A;  4PG3 A;  4YRL A;  4YYE A;  3TEG A;  4NL3 A;  2EJF A;  1WQW A;  4OLF A;  3HXV A;  3HFZ A;  2EAY A;  4C8Q F;  2AKW A;  4YRC A;  4XTX A;  5I21 A;  4XTV A;  3GIB A;  3REU A;  5GAO l;  4YRP A;  3HFN A;  1NJ2 A;  5GAM j;  4P3P A;  4ZTU B;  1X54 A;  1H4S A;  4M77 A;  4CH5 A;  1KQ2 A;  3V8K A;  2E65 A;  4M77 E;  4HWR A;  1ASZ A;  3HXY A;  1KMN A;  4TVA B;  3RER A;  4CS2 A;  1MGQ A;  4RDX A;  3BY7 A;  1WQ7 A;  4C92 G;  5GAN 6;  1Z7N A;  4EX5 A;  2XTI A;  5KNN A;  3BW1 A;  1RIQ A;  3RL6 A;  3JB9 H;  1SER A;  2RHQ B;  1B70 B;  4H2T A;  1W66 A;  4PJO B;  2VC8 A;  1E1T A;  3JCM f;  4C8Q E;  5GAN 2;  4K87 A;  4H2V A;  2ART A;  5K1P A;  5GAN 3;  4PJO G;  4M7A D;  1BIA A;  4UPA A;  3ICA A;  2YLB A;  3JCM J;  1N9R A;  3SWN B;  2RA2 A;  2ZZF A;  4X9C A;  1D3B A;  5GMK m;  2VXE A;  5LJ5 d;  4PJO E;  3JB9 G;  3M4P A;  4C92 B;  3NEM A;  4A53 A;  2ODR D;  4J6W A;  4HVC A;  1X01 A;  5LJ5 h;  4P71 C;  4PJO F;  2I4O A;  2YHT A;  4RQE A;  2XGT A;  1ASY A;  4RCB A;  3LSS A;  2I4M A;  4XU0 A;  4C92 C;  4J5Y A;  4DPG A;  5GAN 4;  1E1O A;  2DDZ A;  2P5I A;  3KFU A;  2IY5 B;  1HK9 A;  4XTU A;  3SWN C;  3V7R A;  2ALY A;  2ZZG A;  4H2X A;  4TTV A;  3V7S A;  4UP7 A;  1B34 B;  2RM4 A;  4XU1 A;  1U1S A;  4J6X A;  2ZZE A;  5GMK j;  1PYS A;  5HGQ A;  1ADY A;  4JRI A;  4M75 D;  4PJO A;  1KQ1 A;  2CJA A;  2PMF A;  4PJO C;  2DKG A;  4J6Y A;  5C53 B;  1USY C;  1QF6 A;  2J3L A;  5GAM f;  5LJ5 f;  1X56 A;  3A5Z A;  4H2S A;  1JRI A;  1YCY A;  2ZT6 A;  2DJZ A;  2ZIM A;  4KQE A;  4CH3 A;  4C92 A;  4M7D A;  4P74 C;  4M7A A;  2JN0 A;  5ELN A;  3JCM P;  3PZC A;  4C92 E;  5GAO p;  2E5A A;  3BJU A;  1WPY A;  2I2L A;  4K86 A;  2DTO A;  3A7A A;  4M75 A;  5GAO r;  2Q7E A;  4N0A C;  4M78 D;  1JJC A;  4C92 F;  3HRK A;  4DQ2 A;  3I7F A;  4XTY A;  3PCO B;  4F7U B;  1C0A A;  2DEQ A;  3V8L A;  4EO4 A;  4CS3 A;  4G84 A;  3JCM c;  3A32 A;  4LNS A;  4HT9 A;  2DTH A;  4YCU A;  4P3O A;  1NNH A;  5GAN d;  5DY9 A;  3ERR A;  2Y90 A;  1EOV A;  2E3C A;  4M78 B;  1I8F A;  3HXZ A;  1PYS B;  5LJ5 e;  1YB3 A;  4YRQ A;  4M7D D;  3DSQ A;  2ZNI A;  4YRM A;  2RHS A;  1B76 A;  4PJO D;  4M75 E;  1LNX A;  4F7U F;  2AKW B;  1NJ1 A;  3QO3 A;  1HXD A;  4YRR A;  4C8Q C;  4YCV A;  1M8V A;  3JCM d;  4UP9 A;  4QVD A;  4M77 B;  1SET A;  1H4T A;  1HTT A;  4M75 G;  3UGT A;  4M78 F;  3VQY A;  4TWA A;  3V7C A;  1NJ6 A;  1LJO A;  5GAN j;  3LSQ A;  4M77 D;  4WJ4 A;  4K88 A;  3TEH B;  3L1A A;  4M75 B;  4P73 C;  4X9D A;  4TVA A;  3HSB A;  1SRY A;  2QHS A;  2QTX A;  4M7A C;  4P74 A;  1EFW A;  1NYR A;  4L87 A;  3QO7 A;  2DZ9 A;  4J15 A;  3RKY A;  4NCX A;  4PHC A;  2DVE A;  4H2W A;  4F7U G;  1ATI A;  2AMC A;  4YRF A;  4YRN A;  2CJB A;  1HC7 A;  1B70 A;  4O2D A;  4M78 A;  3UFG A;  2YLC A;  3QNE A;  3A7U A;  2DU5 A;  1LOJ A;  5GAM h;  5LJ3 d;  3HXU A;  4HA8 A;  4F7U E;  2ODR C;  3MEY A;  1KOG A;  4P75 A;  5K1X A;  4EMK B;  4M78 G;  2EWN A;  2RD1 A;  4EMH A;  4WI1 A;  2DU7 A;  5LJ3 j;  3SWN A;  1GGM A;  2DXU A;  4YRS A;  4H02 A;  2Q7G A;  4C92 D;  3P8T A;  4RCC A;  3JCM V;  1YFR A;  1I4K 1;  2E41 A;  3QTC A;  1U1T A;  2C8M A;  5LJ5 j;  4H2Y A;  3G1Z A;  3SB2 A;  4CH4 A;  5GAN 5;  2C7I A;  3QO8 A;  1NYQ A;  1YFS A;  1EVK A;  4V2S A;  5GAN g;  3PGG A;  3TEH A;  4RMF A;  3M4G A;  3JCM g;  3RAC A;  4P72 A;  5C52 B;  2QHV A;  2ZCE A;  4M77 F;  4C8Q A;  3E9I A;  4EMG A;  2G4C A;  4YDQ A;  3JB9 J;  4YPF A;  4ZTZ B;  4M7D G;  3A5Y A;  1H64 1;  4CS4 A;  3UGQ A;  4XEM A;  3BFM A;  1EIY A;  4M75 F; 
#chains in the Genus database with same CATH topology
 2RI5 A;  3CCE Q;  3G4S T;  1GCP A;  3DB4 A;  2HZY A;  2QEX Q;  4KR3 A;  3VJP A;  2EKO A;  5IXF A;  1HD3 A;  4Z02 A;  4EIK A;  1G3T A;  4ZNX A;  1VQ6 A;  1YJN T;  5EG2 A;  3EG2 A;  1Q7Y R;  1OU9 A;  5FU7 C;  4EMK A;  1LYL A;  2RO0 A;  11AS A;  3HY0 A;  1C6V X;  2YUQ A;  3UDC A;  4B9X A;  2ZR2 A;  5GJV B;  5IH2 A;  5GAN 7;  4ZTJ A;  2KRO A;  3EFO A;  1W4S A;  1PSE A;  2LX9 A;  2BZ8 A;  1M1F A;  2AZV A;  4M7A E;  4RTW A;  1WHJ A;  4M7D B;  1KQS A;  2HSE B;  2ECZ A;  2ZNJ A;  1W70 A;  2FRY A;  1I5O B;  2Q7H A;  3WVD B;  5GAN f;  5CAI A;  3CCL Q;  1SES A;  1N9W A;  3REX A;  3UPU A;  5A2Q E;  5LJ3 e;  4IUU A;  2KMT A;  1VQ4 Q;  1GRI A;  2K5I A;  3CC2 T;  2QHU A;  2D1X A;  2QDL A;  2KI7 A;  3P8V A;  1IB8 A;  2CS7 A;  4QQ6 A;  2COY A;  3WQZ A;  4KH1 B;  1X69 A;  2RHQ A;  2JTE A;  5FRM A;  4MDW A;  1FMK A;  1X2K A;  1IGQ A;  3LH0 A;  1VQ5 A;  1M30 A;  2A7Y A;  4J9C A;  5FRO A;  3NTI A;  4HVV A;  1ABQ A;  1TOV A;  2SRC A;  4AH6 A;  3FIF A;  1BI1 A;  5J26 A;  3A1P A;  1B7Y A;  4A4E A;  2V1R A;  3LC0 A;  2L89 A;  3C95 A;  2Q5I A;  3ULR B;  3IG2 A;  4CH6 A;  3TUP A;  3WVE B;  1YFN A;  2X3X D;  1I5L A;  2E64 A;  2ENM A;  4KT0 E;  2CZ1 B;  4J8O A;  4ESR A;  1EZZ B;  4CC2 A;  2PVD B;  2V1Q A;  4B9W A;  3CCJ Q;  5D6X A;  3MET A;  1H92 A;  4M7D F;  2YT6 A;  2O01 E;  5I11 A;  3MO8 A;  2CKK A;  4YRJ A;  2DXT A;  3CCE A;  3VU3 C;  4M77 G;  4KUI A;  3OYK A;  2ZPB B;  1ZBX A;  3VBB A;  3A7R A;  2XID A;  4YRG A;  1X2Q A;  4TVW A;  1YJW T;  8AT1 B;  3MKD A;  2CIM A;  3VUZ A;  1YIJ A;  2DL8 A;  4BW9 A;  4E51 A;  2KT8 A;  3A8O B;  3F70 A;  1UGQ B;  2DLP A;  1VQK A;  4QW2 A;  5EC7 A;  2FYK A;  1YIJ T;  4DBR A;  2V26 A;  4LXC A;  4RTU A;  1TTH B;  3EFR A;  2OTL T;  4C8Q G;  4F16 A;  2EBP A;  3NTH A;  3ZL7 C;  1H3Z A;  1X2H A;  2GFA A;  4AFS C;  1EFN A;  2VWF A;  1BYM A;  2LQK A;  2D8J A;  1UFF A;  2JNG A;  4M75 C;  1IHW A;  3LYI A;  1FYF A;  1WYX A;  2C0T A;  4H2U A;  4ORZ A;  3CD6 Q;  1VQP Q;  1FXX A;  1OQK A;  4CC3 A;  2DAQ A;  1BCM A;  2FEI A;  3M4Q A;  1MV0 B;  1T3L A;  2MK5 A;  4F7U A;  1Y57 A;  3CXC S;  4JLI A;  3W3S A;  2I0N A;  2JTM A;  4FU6 A;  4EPC A;  1ADJ A;  1WHG A;  1E22 A;  1QVF P;  3JSC A;  2E5Q A;  1K76 A;  3S6W A;  3L2V A;  2CJ9 A;  1NZ9 A;  1AWJ A;  1NYG A;  2FPD A;  3X26 B;  1QWF A;  3HY1 A;  2RMO A;  1NJ8 A;  5ELO A;  4M7A F;  1NJ5 A;  4PL6 A;  1H4V B;  2FVU A;  4JLG A;  2ROL A;  3OYL A;  2YUP A;  1AHJ B;  1OEB A;  3QG1 A;  1BBU A;  4M78 C;  4NL3 A;  3CD6 A;  2F2V A;  2EJF A;  2KYB A;  4M4Z A;  2OX7 A;  2QGF B;  3I35 A;  1NM7 A;  3MEA A;  4XTX A;  1YJ9 Q;  2AKW A;  4YRC A;  1PD1 A;  1BKB A;  3VYH B;  5GAO l;  3OYA A;  3HFN A;  4C0D B;  2W10 A;  1AOJ A;  1H4S A;  2DXB A;  2MWO A;  2HCK A;  2E65 A;  1M4Z A;  1MMA A;  1VQ8 A;  4TVA B;  4DBF A;  2EQJ A;  1QVF A;  1GBQ A;  1IHV A;  3G71 A;  1WQ7 A;  3BW1 A;  2LP5 A;  3JB9 H;  2JTF A;  1KIK A;  3REB B;  2RHQ B;  2COW A;  1TS9 A;  2E4H A;  2XHC A;  4C5G A;  3EG3 A;  5HK3 A;  5GAN 2;  4H2V A;  4RTZ A;  1MMN A;  5L8R E;  1SSH A;  1BIA A;  2MPX C;  1VQN A;  3JCM J;  1ZX6 A;  1YJN A;  4OB0 B;  1YN8 A;  1PHT A;  5LJ5 d;  1IGU A;  2XIC A;  2D0Q B;  1X6O A;  2VV5 A;  3NEM A;  3M54 A;  1VQP A;  3MCA B;  2EYW A;  1HJD A;  1UEB A;  2VB6 A;  2ODR D;  2O31 A;  4HVC A;  2DBM A;  2KR3 A;  3QYH B;  3UA7 A;  5LJ5 h;  3P8D A;  4JJC A;  4PJO F;  4UC4 A;  3EG1 A;  1X43 A;  3GP8 A;  2XGT A;  2M1H A;  1PG5 B;  2H3J A;  3OSS C;  3MP8 A;  2DM1 A;  5KH6 A;  1Y07 A;  4J5Y A;  4LDV A;  5GAN 4;  5IN1 A;  2EVR A;  1N8R C;  1ZBJ A;  1E1O A;  1HK9 A;  1W6X A;  2RQR A;  2KE9 A;  1U06 A;  4H2X A;  5CK9 A;  2AK5 A;  2EQI A;  2NLU A;  4XU1 A;  3PVL A;  4PJO A;  3IQL A;  1WA7 A;  2CJA A;  4R0K A;  4PJO C;  4J6Y A;  2DJQ A;  1Y7X A;  1TSF A;  2VGN A;  1USY C;  2OTL A;  2J3L A;  4C5E A;  1QF6 A;  3EHR A;  3A5Z A;  1QMC A;  2A36 A;  4FM4 B;  4H2S A;  1VUB A;  4RKU E;  1ZSZ A;  4WCI A;  1VQ5 Q;  4CI0 C;  1YCS B;  2M9U A;  3CXC A;  2C0O A;  4L6V 5;  4OF1 A;  1UB4 A;  4E7Z A;  1SHG A;  1OX8 A;  1UE9 A;  3JCM P;  4P5N A;  3PZC A;  4FYX B;  1WPY A;  2I2L A;  4K86 A;  1UDL A;  5GAO r;  2MF2 A;  2LDM A;  1K4U S;  1RAD B;  2HBW A;  2K5L A;  1VA7 A;  1WDX A;  2KEA A;  3CCV A;  4F7U B;  1G3S A;  1C0A A;  3PMT A;  3V8L A;  4A4K A;  1O75 A;  3OA6 A;  1XOV A;  5GAN d;  3P8H A;  4M78 B;  3RMQ A;  5LJ5 e;  1OU8 A;  4N4H A;  3RNJ A;  2L3Q A;  1RAG B;  1VQ9 T;  2X3W D;  3OS5 A;  1VQL A;  4E2F B;  1ZA2 B;  1B76 A;  2LNH B;  4PJO D;  3URG A;  1K73 U;  4M75 E;  2AKW B;  2XDD A;  5CIU A;  3QO3 A;  2KK4 A;  1QVG A;  4YCV A;  2DRM A;  5KE3 A;  3DB3 A;  3G1J A;  3UGT A;  1KC8 C;  4TWA A;  2PVO B;  1NJ6 A;  1NLP C;  1M2V B;  4K88 A;  4WJ4 A;  3TEH B;  3L1A A;  1LPL A;  4TVA A;  1SRY A;  1M1G A;  4B6M A;  3GNG A;  2LCC A;  1EFW A;  2NUP B;  4BE1 A;  2DA9 A;  1M3C A;  2HDA A;  3RKY A;  4PHC A;  2FPF A;  1SRM A;  1SPK A;  2J6F A;  3EAE A;  4E7H A;  1MNE A;  2XU8 A;  2HAX A;  3LGL A;  2CJB A;  1HC7 A;  1D1B A;  1DJ7 B;  1NJI C;  4O2D A;  2XI9 A;  1K9M U;  4FYV B;  1UHC A;  4HA8 A;  2ODR C;  2QQS A;  3VS2 A;  4M78 G;  4EMH A;  3NFC A;  1YHQ A;  4XAX B;  5LJ3 j;  3RDV A;  1GGM A;  2DXU A;  4DA4 A;  3LX7 A;  3PIO A;  2F1L A;  4C92 D;  4RCC A;  1YFR A;  2O4X B;  1AWO A;  3CMA A;  2E41 A;  4H2Y A;  1U1T A;  5LJ5 j;  4IIM A;  3EHQ A;  3GLX A;  4PLL A;  1NYQ A;  1YFS A;  2OJ2 A;  5GAN g;  1M1K C;  3M4G A;  4J7F A;  2CP6 A;  2QHV A;  2QGG A;  1K9A A;  2RI2 A;  4C8Q A;  1K73 C;  2M16 A;  3A5Y A;  3PFS A;  4CS4 A;  5FWC A;  2LT4 A;  4D6W A;  5DLQ E;  3VS3 A;  5LJ3 f;  2AMC B;  4UP8 A;  2VGM A;  4BE0 A;  4H2X B;  4L5G A;  2K4Y A;  3RGL A;  2OAW A;  1KQS S;  1WYD A;  4PJM A;  4G85 A;  1PWT A;  3R6N A;  4FCY A;  4N4I A;  1GFC A;  3GBQ A;  3RKW A;  2J6K A;  3HXX A;  4RTX A;  3A5Z B;  4HWS A;  3NMZ C;  1KMM A;  2CGH A;  2EJG A;  3JCM b;  5GAM g;  2HBP A;  4RQF A;  2M0Y A;  1WIE A;  1NPR A;  3CBM A;  3NET A;  1J5W A;  5GAN 8;  5GMK l;  5I2S A;  1YGB A;  4PKC C;  2EIF A;  2DL5 A;  3O8V A;  2JVV A;  2LJ1 A;  1R0B G;  4JRQ A;  1K0X A;  4LD6 A;  2KXD A;  4JUV A;  4M78 E;  3HHT B;  3NGP A;  2L3R A;  1Q95 G;  1NJI U;  3THK A;  1Y0M A;  2JMA A;  2EYQ A;  2KRN A;  3HRU A;  1OYX A;  5FU7 B;  2ZIN A;  4P75 C;  2X4J A;  2HMA A;  4OB3 B;  1PD0 A;  1WHM A;  4XTW A;  1H3H A;  1KSW A;  1OX9 A;  3RKX A;  2FB7 A;  3OY9 A;  5KCH A;  3JCM Q;  2NUT B;  3EFO B;  4LVL A;  3KXT A;  1GFD A;  1D3B B;  2EKH A;  4OB2 B;  3CPW P;  1VQN T;  2LQW A;  2I4L A;  4LDW A;  3TU4 K;  1VQK T;  3ZEH A;  4PNO A;  3PTA A;  2KY9 A;  3G71 Q;  3CME T;  2ZT7 A;  3JCM X;  4E6R A;  1BIB A;  4MML A;  2DZC A;  2LRQ A;  4P71 A;  2P0Q A;  3C12 A;  3CCS A;  1Y96 A;  2WSF E;  1RUW A;  1Q86 C;  2E3I A;  4A54 A;  4X1V A;  3IKM B;  1KC8 R;  8ATC B;  4KGX B;  2IY5 A;  4J9D A;  2ALY B;  4XU3 A;  5DM7 R;  3A31 A;  3IKL A;  4YRI A;  1B7T A;  4HT8 A;  2ZIO A;  3E9H A;  3O5Z A;  3JCM e;  1IXD A;  3I55 Q;  2LX7 A;  3HFO A;  4OB1 B;  1P92 A;  2RN8 A;  5KYY A;  4IUQ A;  3J81 E;  4BE2 A;  1B7Y B;  5CR2 A;  4K11 A;  1G5V A;  1E7O A;  2JOY A;  1YI2 A;  4R55 A;  1K1Z A;  2J3M A;  4A4G A;  3CMA Q;  4E7J A;  2EL9 A;  3A74 A;  1NJI R;  2E5K A;  3PE0 A;  3EGX B;  4AG2 C;  3L2Z A;  4BI3 A;  3QUI A;  1X55 A;  4N0A A;  4ZGE B;  4P72 C;  2RK1 A;  3TQ7 P;  1VQ7 Q;  1WU7 A;  3CCQ A;  3EGU A;  1YNZ A;  2DL4 A;  2HL5 C;  1QP2 A;  4LE9 A;  4M77 C;  3M5A A;  2ARU A;  2AHJ B;  4KR2 A;  3UT1 A;  4C8Q B;  4RTV A;  2KDS A;  3RIR A;  1ZSZ C;  1WI7 A;  1OZ3 A;  1OPK A;  2BIV A;  1QQJ A;  2BE7 D;  1KQS P;  1I1J A;  2CSI A;  5GAM d;  4ZN1 A;  2HD0 A;  2HNI A;  3QDF A;  3ZBD A;  2CT4 A;  3VS1 A;  4KUL A;  5CQX A;  1K8A C;  1UGV A;  1RAE B;  2QQB A;  3QHS A;  1H8K A;  3M0P A;  1VQZ A;  1NEG A;  2YDL A;  1W2B S;  2X35 A;  2F5K A;  4TQF A;  3VQV A;  3JCM h;  2RHS B;  4PG3 A;  4TVR A;  4KGZ B;  4IUT A;  2G3R A;  3OYY A;  4IUR A;  1YJW Q;  3FEO A;  3CQT A;  4A63 B;  3GIB A;  2DER A;  1QVG S;  3REU A;  4YRP A;  2QAS A;  1IZ6 A;  2CRE A;  3P8B B;  3QYG B;  3CCM Q;  4M77 A;  3HRT A;  1OZ2 A;  1Q7Y U;  4GLK A;  5C6S A;  2EGC A;  2BUD A;  1PNJ A;  2PUK B;  2R57 A;  3RER A;  1BI0 A;  1M3A A;  3DLM A;  2DMO A;  2DNU A;  3CCM T;  3BY7 A;  3VKI A;  4LVI A;  4OMF B;  1M90 R;  4F04 B;  3VS0 A;  5LL6 S;  1RIQ A;  4HVW A;  2PNI A;  1VOM A;  1QKX A;  4KH0 B;  1SER A;  3I55 A;  1B70 B;  5AYF A;  4FYY B;  3CC7 Q;  1OUL A;  2XDP A;  1MUZ A;  1W66 A;  4DBH A;  4ELZ C;  1E1T A;  3JCM f;  2COZ A;  3PT9 A;  3CCU A;  4QQD A;  2ART A;  1JQQ A;  2B86 A;  3H0H A;  3G6E T;  1ZA1 B;  1IRX A;  1TG0 A;  1BI2 A;  2RA2 A;  2L3P A;  1Q7Y C;  1WFW A;  1UGP B;  3TVT A;  1D3B A;  1YHQ T;  3SD4 A;  4KRT A;  4PJO E;  4C92 B;  2DXC A;  2RJC A;  5M9O A;  2P4R A;  3JRZ A;  1XJW B;  4CC7 A;  1X01 A;  2QDY B;  3DKM A;  1N8R R;  2PQW A;  3MJX A;  1MMG A;  1ASY A;  3SHW A;  2K3B A;  2O2O A;  4RCB A;  1WHH A;  5IHI A;  1Z9Q A;  2F2X A;  2IY5 B;  4XTU A;  4II1 A;  3V7R A;  2KQW A;  2ALY A;  5FLX E;  5CKE A;  1ZUK A;  3M55 A;  1B34 B;  1JJ2 A;  3RBB B;  4J6X A;  2ZZE A;  4NS5 A;  3LGF A;  1KQ1 A;  3VYG A;  5KYY B;  3UA6 A;  4FSS A;  2BTT A;  5GAM f;  3C4S A;  4PFO A;  3VS6 A;  3M0U A;  2ZT6 A;  3CBP A;  2ZIM A;  4OMP A;  4P74 C;  3EGX A;  1QP3 A;  5ELN A;  2LTO A;  3CEY A;  1K9M R;  1SSF A;  2E5A A;  2QQ9 A;  2XMF A;  4J9B A;  2F69 A;  2Q7E A;  3OYD A;  1UGS B;  4C92 F;  4DQ2 A;  4QKU A;  5FW9 A;  1ZSG A;  4OMM A;  2RQT A;  4XEM A;  3GOX A;  1TUC A;  4EO4 A;  1R0C B;  1ABO A;  2J7I A;  4YTL A;  2QK0 A;  1BBZ A;  1W2B P;  2K3Y A;  5HY6 A;  2H8H A;  3ERR A;  2Y90 A;  2A28 A;  1TUG B;  1YB3 A;  4JJB A;  4YRQ A;  3L42 A;  3DSQ A;  1EIF A;  2ZNI A;  4YRM A;  2RHS A;  2P4T A;  5D6Y A;  3UAT A;  1YJW A;  1G2B A;  1XTD A;  4F7U F;  1RAA B;  2JZ2 A;  2GBQ A;  1ZSZ B;  2EW3 A;  4C8Q C;  3VS4 A;  3JCM d;  3S3N A;  2EQM A;  2WSC E;  4M77 B;  4HCB A;  1SKU B;  1PM3 A;  4C0Z A;  1HTT A;  2L3S A;  4M78 F;  3LSQ A;  3E9F A;  1RAF B;  2QYZ A;  3U23 A;  3CCJ A;  4FYW B;  1I07 A;  3L2R A;  1NYR A;  2DZ9 A;  3VRY A;  2DVE A;  4H2W A;  4F7U G;  2O9S A;  1VQ4 A;  4YRF A;  3J80 E;  4YRN A;  1G8X A;  3N5B B;  1B70 A;  4LUE A;  4M78 A;  4LUD A;  2P0P A;  4E7L A;  3CD6 T;  3HXU A;  4FW1 A;  3OBW A;  4F7U E;  1YWO A;  2X4Y A;  2Y4Y A;  4Z89 A;  2RD1 A;  3OQ5 A;  1FMV A;  3X20 B;  5J3B A;  2OTJ Q;  4D8D A;  5IT9 E;  1M90 C;  3G6E Q;  1FX7 A;  1PCX A;  5IXB A;  4YRS A;  2GGR A;  1VQL T;  2Q7G A;  5D7U A;  4JZ4 A;  4AFQ C;  3G1Z A;  3SB2 A;  1RLP C;  3OYF A;  3OYG A;  3OW2 P;  2R5M A;  2OTL Q;  2RF0 A;  3QWY A;  1EVK A;  3JAM E;  2CP2 A;  1GBR A;  3PGG A;  3TEH A;  3QJY A;  3H8Z A;  2O88 A;  1VQO T;  2M51 A;  3RAC A;  2VUB A;  3LH5 A;  3FJ5 A;  5FU6 B;  1N6A A;  3I5S A;  4E7S A;  4M77 F;  1RAI B;  4EMG A;  2LNV A;  4YDQ A;  3I55 T;  4M7D G;  2DD5 A;  1EIY A;  5GAN h;  4E7I A;  3H0F A;  3H9N A;  1RLQ C;  3CC4 A;  4YP0 A;  1B34 A;  1RAH B;  1N27 A;  3FB9 A;  2JT4 A;  1WLE A;  1S1N A;  2RNA A;  1N8R U;  4AFZ C;  1VIF A;  2G6F X;  2RJF A;  4M7D E;  4RUG A;  4LNP A;  5KYX B;  2ZTG A;  2JS0 A;  3I5R A;  1D0Z A;  1YFT A;  1NBE B;  1VQ6 T;  5LJ3 g;  3PVQ A;  3A8M B;  2HKN A;  3M0R A;  2O4X A;  5GMK e;  1BB9 A;  3OYI A;  2DRK A;  2E1H A;  1QCO A;  4YRT A;  5LJ5 g;  2MI6 A;  2XG8 D;  4JJD A;  4WJ3 M;  5A0D A;  2KYM A;  3LWH A;  3LW5 E;  2ESW A;  5F5W A;  2ZT5 A;  3VV0 A;  1WHK A;  4TVY A;  4BI4 A;  3VQX A;  1WXU A;  5GAN e;  2GQV A;  2JJ9 A;  3L4G B;  2LCS A;  3WXM B;  4PFP A;  1VYT A;  1CKA A;  2MCN A;  1UJY A;  4C8Q D;  2L0A A;  1GXI E;  1JB0 E;  2CH4 A;  4J9G A;  4Q5W A;  3UWN A;  2QHT A;  4DOW A;  2ZR3 A;  3P8Y A;  2FRW A;  3EGD A;  2JMC A;  1Y71 A;  2OTJ T;  1MMD A;  3E9G A;  3HP9 A;  1E24 A;  1YI2 T;  1JU5 C;  4YRO A;  3S3O A;  2IPO B;  3OS0 A;  1G5H A;  2CP3 A;  5GMK h;  3CCL T;  2MMP A;  3R6O A;  1KC8 U;  2CYZ B;  1UGR B;  3RUX A;  2LQ8 A;  3OMC A;  4MZM A;  4JRP A;  4ELY C;  5FU6 C;  2D0N A;  1YIJ Q;  4ATO A;  1BBW A;  1R8O B;  5CKH A;  1MND A;  3E2U A;  4Y91 A;  4P73 A;  2FHD A;  3FJP A;  4BD3 A;  1JJ2 S;  3EFS A;  2D8H A;  3QBY A;  1RI9 A;  2YWW A;  4J9E A;  4N4G A;  4O6J A;  2AKL A;  4NOY A;  2QA4 A;  5KCO A;  1L0W A;  4HWO A;  5CO7 A;  2Q5H A;  2JW4 A;  2YUN A;  4KBM B;  5GMK i;  2NWM A;  2P0L A;  1BK2 A;  5E3I A;  5GAO q;  1VQ5 T;  4MZP A;  3ER0 A;  2KSS A;  3ZFJ A;  1KD1 R;  3LWI A;  4ZGD B;  1WNL A;  2RH2 A;  1B8A A;  3HRI A;  4WF2 A;  5HCK A;  1JEG A;  2DYB A;  2BZY A;  1B3Q A;  5GAM e;  2DX1 A;  4OML A;  4OVA A;  3PNW C;  2V8K A;  2QG9 B;  2A37 A;  2LJ3 A;  2CZ6 B;  3MEU A;  3NPF A;  3HFZ B;  2NUT A;  4ZN3 A;  1GCQ A;  5C51 B;  3OW2 S;  1K73 R;  2ARS A;  3HPW A;  4YCW A;  2DTI A;  2L2P A;  2Z0W A;  4R56 A;  1ZLM A;  1G5I A;  1QKW A;  2V8I A;  2M0O A;  3QZ5 B;  1QVF S;  3TEE A;  1KHC A;  2XKO C;  3M56 A;  4XQ3 A;  2P84 A;  1JBM A;  4P3N A;  1NEB A;  3CMA T;  3NEN A;  1OPL A;  1X27 A;  2K6D A;  2K3X A;  1AWW A;  2ZXF A;  1Y96 B;  2DET A;  2C06 A;  1JJC B;  1YJ9 A;  2IG0 A;  3I56 T;  3NHN A;  2K2V A;  3EH2 A;  3CMQ A;  2YSQ A;  4J9F A;  1G51 A;  1EIY B;  5KYW A;  4ZIB A;  1USY A;  1IRE B;  1UEC A;  3JB9 I;  4E47 A;  5D6W A;  3V8J A;  1QLY A;  5CCA A;  2MYS A;  1Z9Z A;  3L2Q A;  1M3B A;  2JS2 A;  2GQI A;  3TEG A;  4OLF A;  4FL6 A;  4XK8 E;  4J9H A;  4C8Q F;  2QI2 A;  2YRV A;  4HCC A;  1YBY A;  2GCX A;  1ZUU A;  4XTV A;  1UG1 A;  3QKJ A;  2ABL A;  1VQO A;  5GAM j;  1NJ2 A;  4P3P A;  4ZTU B;  2X4X A;  1WHL A;  1CKB A;  4A4F A;  5CVI A;  4PFZ A;  2KRM A;  3V8K A;  3M4Y A;  4BI8 B;  4M77 E;  1ASZ A;  3CCM A;  3HXY A;  1KMN A;  1B07 A;  2MIO A;  3FRN A;  2RI3 A;  1M8M A;  4RDX A;  1K8A R;  1QCN A;  1AZG B;  2L8D A;  5GAN 6;  1Z7N A;  4EX5 A;  4FW2 A;  4KUD K;  1WXB A;  1YJ9 T;  2XTI A;  1GCQ C;  4JPB W;  3RL6 A;  2BE9 B;  2C0I A;  3MP1 A;  4IUV A;  4BB7 A;  3A8H B;  4H2T A;  1EX4 A;  2KRS A;  4C8Q E;  3OBY A;  4PJO G;  4M7A D;  4UPA A;  3HTR A;  3ICA A;  2ZZD A;  1S72 T;  3CC4 Q;  1K8A U;  1KJW A;  2QEX A;  2CZ7 B;  3Q1J A;  4QT7 A;  2ZZF A;  4C5H A;  3KBG A;  3M59 A;  3EH1 A;  3SFM A;  3CCR T;  4LVM A;  5CKF A;  3CBO A;  2FZK B;  2LCL A;  2YRC A;  4GY5 A;  2AIR B;  4FSX A;  4J6W A;  3SDZ A;  5IHK A;  2DD4 A;  4P71 C;  1ARK A;  4RQE A;  2VKN A;  3HL8 A;  3LSS A;  5HK0 A;  2I4M A;  2EGA A;  4J9I A;  2LQN A;  1VQM A;  4PJJ A;  2K5F A;  3QZ9 B;  4DPG A;  4PJN A;  1JO8 A;  2IVW A;  4AMC A;  2HKQ B;  4ZGJ B;  2KVQ G;  2DDZ A;  2P5I A;  1VQ7 A;  1V29 B;  2DL3 A;  2QTV A;  3JV3 A;  1JXO A;  2DIQ A;  1U1S A;  4JJN K;  3OYH A;  5GMK j;  1VIE A;  1PYS A;  1ADY A;  1XQH A;  4JRI A;  3OYC A;  2DEU A;  1KK7 A;  3D7S B;  4X34 A;  1PKT A;  1FWZ A;  5LJ5 f;  2J6O A;  4RG8 A;  2BKD N;  1AT1 B;  4HXJ A;  1JRI A;  1YCY A;  2ZPI B;  3CCS Q;  1VQ9 Q;  1BU1 A;  1YP5 A;  4C92 A;  3L2U A;  2EYZ A;  2JN0 A;  4ANJ A;  2DVJ A;  4F14 A;  5GAO p;  3BJU A;  7AT1 B;  4LVJ A;  2KAF A;  2DTO A;  4ME7 A;  3A7A A;  4O5V A;  4M75 A;  2HQX A;  2R58 A;  1SG5 A;  2E12 A;  2E3H A;  4N0A C;  4M78 D;  1JJC A;  4JS4 A;  2DBK A;  4MZT A;  5I2M A;  4A4H A;  3HRK A;  3I7F A;  4CS3 A;  2ED1 A;  4G84 A;  3JCM c;  1AD5 A;  3M9Q A;  4LNS A;  2DTH A;  4Y28 E;  3X24 B;  2CDT A;  5DY9 A;  4HKE A;  3CPW S;  2EQK A;  2E3C A;  3QPH A;  3HXZ A;  3RR6 A;  2PU9 B;  1T3S A;  1VYU A;  4F17 A;  4M7D D;  1TUD A;  3CXC P;  2KBT A;  1V76 A;  1M1K R;  5KYU A;  2PVG B;  3TRE A;  2ROT A;  2LT1 A;  1IO6 A;  1X75 C;  1M27 C;  3H6Z A;  3DLL A;  5CQY A;  1NJ1 A;  4QVZ A;  1D09 B;  1OOT A;  2KNB B;  1D1C A;  1HXD A;  4YRR A;  3CCJ T;  1M8V A;  4BDY A;  2A8E A;  4Y92 A;  3OB9 A;  4UP9 A;  2DPP B;  4CC4 B;  1YIT A;  3TSW A;  1H4T A;  4M75 G;  1F1B B;  4M77 D;  4P73 C;  4X9D A;  3G4S Q;  2QHS A;  3H0I A;  2QTX A;  2RHI A;  4PLI A;  3CCQ T;  4L87 A;  4P74 A;  3QO7 A;  1PKS A;  5DLO A;  4NCX A;  5L23 A;  1SHF A;  2P0K A;  4FT4 A;  1NG2 A;  1ATI A;  1N5Z A;  2YRD A;  1D0Y A;  2RQU A;  3GNF B;  2D9T A;  2EYX A;  3QDR B;  4LDX A;  1Q81 C;  2YLC A;  4AFU C;  1OI1 A;  3QNE A;  2DU5 A;  5LJ3 d;  3MEY A;  4LN2 A;  4P75 A;  5K1X A;  4EMK B;  2VVK A;  4BUG A;  4WI1 A;  2LZ6 B;  1C0M A;  2NUZ A;  3I56 Q;  5AT1 B;  1U8R A;  2K2M A;  3MEW A;  1VQ9 A;  1YI2 Q;  4H02 A;  3UF4 A;  2LC4 A;  1VQP T;  3P8T A;  1X6B A;  2WSE E;  3JCM V;  1JJ2 P;  1W2B A;  3QTC A;  4CH4 A;  1Q86 U;  2F5T X;  4OMN A;  3QO8 A;  1FMW A;  4V2S A;  1K0S A;  4P72 A;  1VQ7 T;  2ZCE A;  1ZQ1 A;  4OMQ A;  1R77 A;  5CKB A;  2G4C A;  2ZPH B;  4JDS A;  4Z88 A;  4YPF A;  1H64 1;  3TSZ A;  3BFM A;  2DQ0 A;  3GF5 A;  4RTT A;  4WTO B;  5J39 A;  2ZT8 A;  5LJ3 h;  1QVG P;  1S72 A;  2VAS A;  2RB6 A;  4HWT A;  2OAU A;  3FLG A;  1GL5 A;  4QQG A;  2E70 A;  4HCZ A;  4HWP A;  2E6N A;  1QCF A;  2NYS A;  1VQ6 Q;  12AS A;  2GTJ A;  3SEM A;  3M0T A;  1J3T A;  1AZE A;  1T0H A;  1FYN A;  2FZC B;  4HCK A;  3RES A;  4GLM A;  3JCM W;  2D6F A;  5GAO m;  4C0G A;  2I4N A;  3R07 A;  2R5A A;  2CH4 W;  1X2G A;  1VQN Q;  3CCR Q;  4BAC A;  3OSV A;  1YJN Q;  4Q6G A;  2RHY A;  4GBQ A;  2JXB A;  4M7D C;  3HFV A;  1UUE A;  3X28 B;  4Q15 A;  1XNI A;  1G83 A;  1VQO Q;  1E6H A;  3EG9 A;  3QJ6 A;  3CCU T;  1WXT A;  4CRI A;  3HKS A;  4IIO A;  3S3M A;  4YRK A;  6AT1 B;  2DIL A;  2K79 A;  2K57 A;  1VQM Q;  3RF1 A;  4J83 A;  3A98 A;  3CC4 T;  2IIM A;  1YWP A;  3IAL A;  3JB9 D;  3CCR A;  2B8A A;  5KYX A;  5KYU B;  1EQR A;  3QO5 A;  3I9Q A;  1TU0 B;  4IKF A;  4MMK A;  2CP7 A;  4DBQ A;  5KYN A;  3M53 A;  1VQ8 Q;  4XTZ A;  4XEO A;  2RHX A;  2A3L A;  1QW1 A;  1WJR A;  2ZCF B;  2NS6 A;  1G3Y A;  2XD0 A;  4J7I A;  1D1A A;  1VYV A;  3FDR A;  4MDX A;  3OD1 A;  2A0F B;  4DEY A;  3A8G B;  1T0J A;  3CME A;  1M1K U;  2LJ0 A;  2CUB A;  2KXC A;  3L2W A;  1M5Q 1;  4BWA A;  5A0L A;  2AT1 B;  3UH0 A;  3QXE B;  3OYB A;  3L4G A;  3T9N A;  1TWB A;  2WAC A;  3OYE A;  3OW2 A;  2QAZ A;  1H4Q A;  1LVK A;  3OYJ A;  3JB9 F;  3MPU B;  2RQW A;  3CCE T;  4EMK C;  1EVL A;  4IUP A;  3BDU A;  2VXF A;  3EGD B;  1I81 A;  2PUO B;  1KD1 C;  1Z7M A;  5GAO n;  4M7A G;  3NEL A;  4YRE A;  3MF1 A;  3REA B;  3E19 A;  1KFZ A;  3INZ A;  3VS7 A;  1K9M C;  2DE0 X;  4OP0 A;  2PME A;  1YHQ Q;  2Y4X A;  2J05 A;  2YXY A;  4XU2 A;  1M2O A;  2CT3 A;  2EJ9 A;  1QE0 A;  1VQK Q;  1N9S A;  1NE8 A;  2QA4 T;  5IAY A;  4NL2 A;  2AZS A;  4JRK A;  1VQ8 T;  1WLP B;  4M7A B;  3AHU A;  1MV3 A;  3VRZ A;  2E10 A;  3PMI A;  1TH7 A;  3HRS A;  4BDZ A;  4AT1 B;  3QSU A;  1RAB B;  4OGC A;  5HKC A;  3HXW A;  1BCO A;  2DQ3 A;  2O9V A;  1U3O A;  3AT1 B;  1TXQ A;  1D0X A;  2HQH A;  4OMO A;  3OMG A;  1NLO C;  3PCO A;  3ASK A;  1WGS A;  2OI3 A;  1IL2 A;  4LVK A;  1AWX A;  3VQW A;  2F2W A;  3EG0 A;  2AKK A;  2ZGW A;  3CPW A;  3MQZ A;  3HTZ A;  4QVC A;  2CUD A;  4X5O A;  2L5Q A;  2RPN A;  2CSQ A;  2DL7 A;  4TQD A;  3MEV A;  1RI0 A;  3CCQ Q;  3MF2 A;  4YYE A;  4YRL A;  1WQW A;  3HXV A;  2FG0 A;  1NPP A;  3OS2 A;  3HFZ A;  2EAY A;  3M0S A;  5I21 A;  4KGV B;  2DF6 A;  2QXF A;  1X54 A;  2RK2 A;  2GFU A;  4C0F A;  4CH5 A;  2KGT A;  3I56 A;  2QEX T;  1KQ2 A;  2EYY A;  1WX6 A;  4BY6 C;  4HWR A;  2JM9 A;  4LDY A;  4CS2 A;  2EGE A;  1MGQ A;  2ED0 A;  3BE3 A;  4EDU A;  1I0C A;  1A0N B;  4C92 G;  1QWE A;  3EG9 B;  5KNN A;  2XK0 A;  3M58 A;  5KYW B;  2V8J A;  1QVP A;  3CC2 A;  1UJ0 A;  1E6G A;  3E1S A;  1WZO A;  3M0Q A;  4PJO B;  2VC8 A;  2RQV A;  4K87 A;  2YUO A;  2FL7 A;  1O9S A;  2E6Z A;  5K1P A;  5GAN 3;  2DFU A;  5FWB A;  2QA4 Q;  2YLB A;  2RHU A;  1N9R A;  1LCK A;  2X9H A;  3SWN B;  3PIP A;  4X9C A;  2A08 A;  3G6E A;  5GMK m;  2DK3 A;  2J06 A;  2VXE A;  3JB9 G;  3M4P A;  2XDB A;  4A53 A;  3X25 B;  2HQE A;  3NTK A;  2RHZ A;  3CC2 Q;  2I4O A;  3CC7 A;  2YHT A;  2ZPE B;  1AEY A;  1BI3 A;  4XU0 A;  4C92 C;  2EPD A;  4FIB A;  4HVU A;  2CP5 A;  4HT4 A;  1ACM B;  3KUF A;  4FT2 A;  3KFU A;  5ECA A;  3SWN C;  2K9G A;  5I22 A;  3CCS T;  2SEM A;  2ZZG A;  1OV3 A;  1PC0 A;  1NYF A;  4TTV A;  1W1F A;  2HSP A;  3V7S A;  4AG1 C;  4UP7 A;  4RMO A;  2RM4 A;  2CZ0 B;  4PJL A;  5HGQ A;  2MAM A;  2ZPG B;  4M75 D;  3J7A F;  4L59 A;  2PMF A;  2DKG A;  5C53 B;  2BZX A;  2PZ1 A;  3FC3 A;  3OYM A;  1X56 A;  2MWP A;  2KT1 A;  1KD1 U;  4RG2 A;  2GNC A;  2OTJ A;  4DEX A;  4Z8A A;  2H3E B;  2DJZ A;  1S72 Q;  4KQE A;  4CH3 A;  1C1A A;  4M7D A;  3MP6 A;  4M7A A;  1CSK A;  1VQM T;  1PRL C;  5GJW B;  1Q86 R;  3CCL A;  4C92 E;  1M2V A;  3CCV T;  3ME9 A;  4BY6 B;  2GF7 A;  5C0M A;  4DOV A;  2NUP A;  4XTY A;  4C5I A;  4C0D C;  3PCO B;  1PRM C;  2DEQ A;  3MHX A;  2X4W A;  1Q81 U;  2ATC B;  2VYT A;  3A32 A;  4HT9 A;  4ZTF A;  4YCU A;  3CCV Q;  4P3O A;  1NNH A;  1G3W A;  1EOV A;  1WJS A;  1I8F A;  1VQL Q;  1PSF A;  2EQU A;  1PYS B;  3VS5 A;  2LMJ A;  2EFI A;  1Q82 U;  1Q82 C;  2MOX A;  1V1C A;  1UTI A;  5KE2 A;  1LNX A;  2K7A A;  4RTY A;  1RL2 A;  1Q81 R;  4PK4 A;  1YIT T;  5CKD A;  1ZHI A;  2JM8 A;  4QVD A;  2FZG B;  1SET A;  3VQY A;  3V7C A;  2ZPF B;  2ZAE A;  1LJO A;  5GAN j;  3C0C A;  3RMS A;  4M75 B;  1YIT Q;  3HSB A;  2W0Z A;  4JZ3 A;  4M7A C;  1KHI A;  1UHF A;  2QQA A;  1AVZ C;  1M90 U;  5FRN A;  4J15 A;  3G4S A;  1WJQ A;  2DYI A;  3M57 A;  1HSQ A;  4VUB A;  2QQR A;  4E7K A;  2AMC A;  1SRL A;  2HL3 A;  1MHN A;  1X6G A;  3G71 T;  3QWX X;  3CME Q;  2CP0 A;  3UFG A;  4OGE A;  3A7U A;  2M02 A;  1LOJ A;  5GAM h;  2FO0 A;  1KOG A;  3TCJ A;  4D8K A;  2EWN A;  5IHN A;  3CCU Q;  2DU7 A;  1KG1 A;  2RJE A;  3SWN A;  2FPE A;  1ZUY A;  1M9S A;  1U5S A;  2GTO A;  2RJD A;  1SF9 A;  1I4K 1;  2C8M A;  2PTK A;  5GAN 5;  3CC7 T;  2X51 A;  1RAC B;  2C7I A;  3H41 A;  3BDL A;  1Q82 R;  4RMF A;  4JS5 A;  3C94 A;  3CPF A;  2DIG A;  3JCM g;  3OS1 A;  1VQ4 T;  5C52 B;  4LD9 K;  3KFV A;  2HEQ A;  5A0G A;  9ATC B;  2JUF A;  2LVM A;  3LLR A;  4LDU A;  3E9I A;  3A8L B;  3VUB A;  1SEM A;  3GPL A;  3JB9 J;  4ZTZ B;  1JXM A;  1HYO A;  3G7Z A;  3QII A;  3UGQ A;  3OYN A;  4M75 F;  2DO3 A; 
#chains in the Genus database with same CATH homology
 2RI5 A;  3G4S T;  3DB4 A;  4KR3 A;  3VJP A;  2EKO A;  4Z02 A;  1G3T A;  1VQ6 A;  1YJN T;  5EG2 A;  5FU7 C;  4EMK A;  1LYL A;  2RO0 A;  11AS A;  3HY0 A;  3UDC A;  4B9X A;  2ZR2 A;  5GAN 7;  4ZTJ A;  1W4S A;  1PSE A;  2LX9 A;  1M1F A;  4M7A E;  4M7D B;  1KQS A;  2ZNJ A;  2Q7H A;  3WVD B;  5GAN f;  5CAI A;  1SES A;  1N9W A;  3REX A;  3UPU A;  5A2Q E;  5LJ3 e;  4IUU A;  2KMT A;  2K5I A;  3CC2 T;  2QHU A;  3P8V A;  2CS7 A;  4QQ6 A;  3WQZ A;  2RHQ A;  5FRM A;  4MDW A;  3LH0 A;  1VQ5 A;  2A7Y A;  5FRO A;  3NTI A;  4AH6 A;  3FIF A;  1BI1 A;  5J26 A;  1B7Y A;  4A4E A;  3LC0 A;  2L89 A;  3C95 A;  2Q5I A;  3IG2 A;  4CH6 A;  3TUP A;  3WVE B;  1I5L A;  2E64 A;  4KT0 E;  2CZ1 B;  4J8O A;  2PVD B;  4B9W A;  5D6X A;  3MET A;  4M7D F;  2O01 E;  3MO8 A;  2CKK A;  4YRJ A;  2DXT A;  3CCE A;  3VU3 C;  4M77 G;  4KUI A;  3OYK A;  2ZPB B;  1ZBX A;  3VBB A;  3A7R A;  2XID A;  4YRG A;  4TVW A;  1YJW T;  2CIM A;  3VUZ A;  1YIJ A;  4BW9 A;  4E51 A;  3A8O B;  3F70 A;  1UGQ B;  1VQK A;  4QW2 A;  2FYK A;  1YIJ T;  3EFR A;  2OTL T;  4C8Q G;  3NTH A;  1H3Z A;  1X2H A;  2GFA A;  1BYM A;  2LQK A;  2JNG A;  4M75 C;  3LYI A;  1FYF A;  4H2U A;  1FXX A;  2DAQ A;  3M4Q A;  4F7U A;  3CXC S;  4JLI A;  3W3S A;  2JTM A;  4FU6 A;  4EPC A;  1ADJ A;  1E22 A;  3JSC A;  2E5Q A;  3S6W A;  3L2V A;  2CJ9 A;  1NZ9 A;  3X26 B;  3HY1 A;  1NJ8 A;  5ELO A;  4M7A F;  1NJ5 A;  4PL6 A;  1H4V B;  2FVU A;  4JLG A;  3OYL A;  1AHJ B;  3QG1 A;  1BBU A;  4M78 C;  4NL3 A;  3CD6 A;  2EJF A;  4YRC A;  3MEA A;  2AKW A;  4XTX A;  1BKB A;  3VYH B;  5GAO l;  3OYA A;  3HFN A;  4C0D B;  1H4S A;  2DXB A;  2MWO A;  2E65 A;  1M4Z A;  1VQ8 A;  4TVA B;  2EQJ A;  1QVF A;  3G71 A;  1WQ7 A;  3BW1 A;  3JB9 H;  2JTF A;  2RHQ B;  2XHC A;  4C5G A;  5HK3 A;  5GAN 2;  4H2V A;  5L8R E;  1BIA A;  1VQN A;  3JCM J;  1YJN A;  4OB0 B;  5LJ5 d;  2XIC A;  2D0Q B;  1X6O A;  2VV5 A;  3NEM A;  3M54 A;  1VQP A;  3MCA B;  1UEB A;  2ODR D;  4HVC A;  3QYH B;  5LJ5 h;  3P8D A;  4PJO F;  4UC4 A;  2XGT A;  3GP8 A;  2M1H A;  3OSS C;  2H3J A;  3MP8 A;  5KH6 A;  1Y07 A;  4J5Y A;  4LDV A;  5GAN 4;  5IN1 A;  1N8R C;  1E1O A;  1HK9 A;  4H2X A;  5CK9 A;  2NLU A;  4XU1 A;  4PJO A;  2CJA A;  4PJO C;  4J6Y A;  1Y7X A;  2VGN A;  1USY C;  2OTL A;  2J3L A;  4C5E A;  1QF6 A;  3A5Z A;  4FM4 B;  4H2S A;  1VUB A;  4RKU E;  4CI0 C;  2M9U A;  3CXC A;  4L6V 5;  4OF1 A;  1UB4 A;  3JCM P;  4P5N A;  3PZC A;  1WPY A;  2I2L A;  4K86 A;  5GAO r;  2MF2 A;  2LDM A;  2K5L A;  3CCV A;  4F7U B;  1G3S A;  1C0A A;  3PMT A;  3V8L A;  4A4K A;  1O75 A;  3OA6 A;  1XOV A;  5GAN d;  3P8H A;  4M78 B;  3RMQ A;  5LJ5 e;  4N4H A;  1VQ9 T;  3OS5 A;  1VQL A;  1B76 A;  4PJO D;  3URG A;  1K73 U;  4M75 E;  2AKW B;  2XDD A;  5CIU A;  3QO3 A;  2KK4 A;  1QVG A;  4YCV A;  5KE3 A;  3DB3 A;  3UGT A;  1KC8 C;  4TWA A;  2PVO B;  1NJ6 A;  4WJ4 A;  4K88 A;  3TEH B;  3L1A A;  4TVA A;  1SRY A;  1M1G A;  3GNG A;  2LCC A;  1EFW A;  4BE1 A;  3RKY A;  4PHC A;  3EAE A;  4E7H A;  2XU8 A;  2HAX A;  3LGL A;  2CJB A;  1HC7 A;  1DJ7 B;  1NJI C;  4O2D A;  2XI9 A;  1K9M U;  4HA8 A;  2ODR C;  2QQS A;  4M78 G;  4EMH A;  3NFC A;  1YHQ A;  4XAX B;  5LJ3 j;  1GGM A;  2DXU A;  4DA4 A;  3LX7 A;  3PIO A;  4C92 D;  4RCC A;  1YFR A;  2O4X B;  3CMA A;  2E41 A;  4H2Y A;  1U1T A;  5LJ5 j;  3GLX A;  4PLL A;  1NYQ A;  1YFS A;  5GAN g;  1M1K C;  3M4G A;  4J7F A;  2QHV A;  2RI2 A;  4C8Q A;  1K73 C;  2M16 A;  3A5Y A;  3PFS A;  4CS4 A;  2LT4 A;  4D6W A;  5DLQ E;  5LJ3 f;  2AMC B;  4UP8 A;  2VGM A;  4BE0 A;  4H2X B;  4L5G A;  2K4Y A;  3RGL A;  1KQS S;  1WYD A;  4G85 A;  4N4I A;  3RKW A;  3HXX A;  3A5Z B;  4HWS A;  1KMM A;  2CGH A;  2EJG A;  3JCM b;  5GAM g;  2HBP A;  4RQF A;  1NPR A;  3CBM A;  3NET A;  1J5W A;  5GAN 8;  5GMK l;  5I2S A;  1YGB A;  4PKC C;  2EIF A;  3O8V A;  2JVV A;  4JRQ A;  4LD6 A;  4JUV A;  4M78 E;  3HHT B;  2L3R A;  1NJI U;  2EYQ A;  3HRU A;  5FU7 B;  1OYX A;  2ZIN A;  4P75 C;  2X4J A;  4OB3 B;  4XTW A;  3RKX A;  3OY9 A;  2FB7 A;  5KCH A;  3JCM Q;  4LVL A;  3KXT A;  1D3B B;  4OB2 B;  1VQN T;  2I4L A;  4LDW A;  3TU4 K;  1VQK T;  3ZEH A;  4PNO A;  3PTA A;  2KY9 A;  3CME T;  2ZT7 A;  3JCM X;  1BIB A;  4MML A;  2DZC A;  2LRQ A;  4P71 A;  2P0Q A;  3C12 A;  3CCS A;  1Y96 A;  2WSF E;  1Q86 C;  4A54 A;  3IKM B;  2IY5 A;  2ALY B;  4XU3 A;  5DM7 R;  3A31 A;  3IKL A;  4YRI A;  4HT8 A;  2ZIO A;  3E9H A;  3JCM e;  3HFO A;  4OB1 B;  1P92 A;  4IUQ A;  3J81 E;  4BE2 A;  1B7Y B;  5CR2 A;  1G5V A;  2JOY A;  1YI2 A;  4R55 A;  2J3M A;  4A4G A;  4E7J A;  2EL9 A;  3A74 A;  3L2Z A;  4BI3 A;  3QUI A;  1X55 A;  4N0A A;  4ZGE B;  4P72 C;  2RK1 A;  1WU7 A;  3CCQ A;  1QP2 A;  4M77 C;  3M5A A;  2ARU A;  2AHJ B;  4KR2 A;  3UT1 A;  4C8Q B;  2KDS A;  3RIR A;  1OZ3 A;  2BIV A;  5GAM d;  4ZN1 A;  2HD0 A;  2HNI A;  3ZBD A;  4KUL A;  5CQX A;  1K8A C;  2QQB A;  3QHS A;  1VQZ A;  1W2B S;  2X35 A;  2F5K A;  4TQF A;  3VQV A;  3JCM h;  2RHS B;  4PG3 A;  4TVR A;  4IUT A;  2G3R A;  3OYY A;  4IUR A;  3FEO A;  3GIB A;  1QVG S;  3REU A;  4YRP A;  1IZ6 A;  3P8B B;  3QYG B;  4M77 A;  3HRT A;  1OZ2 A;  1Q7Y U;  4GLK A;  5C6S A;  2BUD A;  2PUK B;  2R57 A;  3RER A;  1BI0 A;  3DLM A;  3CCM T;  3BY7 A;  3VKI A;  4LVI A;  4OMF B;  5LL6 S;  1RIQ A;  1SER A;  3I55 A;  1B70 B;  5AYF A;  2XDP A;  1W66 A;  4ELZ C;  1E1T A;  3JCM f;  3PT9 A;  3CCU A;  4QQD A;  2ART A;  3G6E T;  1BI2 A;  2RA2 A;  1Q7Y C;  1UGP B;  1YHQ T;  1D3B A;  3SD4 A;  4PJO E;  4C92 B;  2DXC A;  2RJC A;  5M9O A;  3JRZ A;  1X01 A;  2QDY B;  3DKM A;  2PQW A;  1ASY A;  4RCB A;  2IY5 B;  4M75 F;  4XTU A;  4II1 A;  3V7R A;  2KQW A;  2ALY A;  5FLX E;  5CKE A;  3M55 A;  1B34 B;  1JJ2 A;  4J6X A;  2ZZE A;  4NS5 A;  3LGF A;  1KQ1 A;  3VYG A;  5GAM f;  3C4S A;  2ZT6 A;  3CBP A;  2ZIM A;  4P74 C;  1QP3 A;  5ELN A;  2LTO A;  3CEY A;  1SSF A;  2E5A A;  2QQ9 A;  2F69 A;  2Q7E A;  3OYD A;  1UGS B;  4C92 F;  4DQ2 A;  3GOX A;  4EO4 A;  4YTL A;  2K3Y A;  5HY6 A;  3ERR A;  2Y90 A;  1YB3 A;  4YRQ A;  3L42 A;  3DSQ A;  1EIF A;  2ZNI A;  4YRM A;  2RHS A;  2P4T A;  5D6Y A;  1YJW A;  1XTD A;  4F7U F;  2JZ2 A;  4C8Q C;  3JCM d;  3S3N A;  2EQM A;  2WSC E;  4M77 B;  4HCB A;  4C0Z A;  1HTT A;  4M78 F;  3LSQ A;  3E9F A;  3CCJ A;  3L2R A;  1NYR A;  2DZ9 A;  2DVE A;  4H2W A;  4F7U G;  1VQ4 A;  4YRF A;  3J80 E;  4YRN A;  3N5B B;  1B70 A;  4M78 A;  2P0P A;  4E7L A;  3CD6 T;  3HXU A;  3OBW A;  4F7U E;  2X4Y A;  2Y4Y A;  2RD1 A;  3OQ5 A;  3X20 B;  5J3B A;  5IT9 E;  1M90 C;  1FX7 A;  4YRS A;  1VQL T;  2Q7G A;  3G1Z A;  3SB2 A;  3OYF A;  3OYG A;  2R5M A;  1EVK A;  3JAM E;  3PGG A;  3TEH A;  3QJY A;  3H8Z A;  1VQO T;  3RAC A;  2VUB A;  5FU6 B;  1N6A A;  4M77 F;  4EMG A;  2LNV A;  4YDQ A;  3I55 T;  4M7D G;  2DD5 A;  1EIY A;  5GAN h;  4E7I A;  3CC4 A;  4YP0 A;  1B34 A;  1N27 A;  3FB9 A;  1WLE A;  1N8R U;  1VIF A;  2RJF A;  4M7D E;  2ZTG A;  1YFT A;  1VQ6 T;  5LJ3 g;  3A8M B;  2O4X A;  5GMK e;  3OYI A;  2E1H A;  4YRT A;  5LJ5 g;  2MI6 A;  2XG8 D;  4WJ3 M;  5A0D A;  3LWH A;  3LW5 E;  5F5W A;  2ZT5 A;  3VV0 A;  4TVY A;  4BI4 A;  3VQX A;  5GAN e;  2GQV A;  3L4G B;  3WXM B;  4C8Q D;  1GXI E;  1JB0 E;  4Q5W A;  3UWN A;  2QHT A;  4DOW A;  2ZR3 A;  3P8Y A;  1Y71 A;  2OTJ T;  3E9G A;  3HP9 A;  1E24 A;  1YI2 T;  4YRO A;  3S3O A;  3OS0 A;  1G5H A;  5GMK h;  3CCL T;  2MMP A;  3R6O A;  1KC8 U;  2CYZ B;  1UGR B;  3RUX A;  2LQ8 A;  3OMC A;  4MZM A;  4JRP A;  4ELY C;  5FU6 C;  4ATO A;  1BBW A;  1R8O B;  5CKH A;  4Y91 A;  4P73 A;  2FHD A;  3FJP A;  4BD3 A;  2C06 A;  3EFS A;  3QBY A;  1JJ2 S;  4N4G A;  4O6J A;  4NOY A;  2QA4 A;  5KCO A;  1L0W A;  4HWO A;  5CO7 A;  2Q5H A;  4KBM B;  5GMK i;  2P0L A;  5E3I A;  5GAO q;  1VQ5 T;  4MZP A;  3ER0 A;  2KSS A;  3ZFJ A;  3LWI A;  4ZGD B;  1WNL A;  2RH2 A;  1B8A A;  3HRI A;  4WF2 A;  5GAM e;  4OVA A;  3PNW C;  2V8K A;  2CZ6 B;  3MEU A;  3HFZ B;  4ZN3 A;  5C51 B;  3OW2 S;  2ARS A;  3HPW A;  4YCW A;  2DTI A;  4R56 A;  1G5I A;  2V8I A;  2M0O A;  3QZ5 B;  1QVF S;  3TEE A;  1KHC A;  2XKO C;  3M56 A;  4XQ3 A;  4P3N A;  1JBM A;  3CMA T;  3NEN A;  2ZXF A;  2K3X A;  1Y96 B;  1JJC B;  1YJ9 A;  2IG0 A;  3I56 T;  2K2V A;  3CMQ A;  1G51 A;  1EIY B;  4ZIB A;  1USY A;  1IRE B;  3JB9 I;  4E47 A;  5D6W A;  3V8J A;  5CCA A;  3L2Q A;  3TEG A;  4OLF A;  4FL6 A;  4XK8 E;  4C8Q F;  2QI2 A;  2YRV A;  4HCC A;  1YBY A;  2GCX A;  4XTV A;  3QKJ A;  1VQO A;  1NJ2 A;  5GAM j;  4P3P A;  4ZTU B;  2X4X A;  4A4F A;  5CVI A;  3V8K A;  3M4Y A;  4BI8 B;  4M77 E;  1ASZ A;  3CCM A;  3HXY A;  1KMN A;  3FRN A;  2RI3 A;  4RDX A;  2L8D A;  5GAN 6;  1Z7N A;  4EX5 A;  4KUD K;  1YJ9 T;  2XTI A;  3RL6 A;  3MP1 A;  4IUV A;  4BB7 A;  3A8H B;  4H2T A;  4C8Q E;  3OBY A;  4PJO G;  4M7A D;  4UPA A;  3ICA A;  2ZZD A;  1S72 T;  1K8A U;  2QEX A;  2CZ7 B;  3Q1J A;  2ZZF A;  4C5H A;  3KBG A;  3M59 A;  3SFM A;  3CCR T;  4LVM A;  5CKF A;  3CBO A;  2LCL A;  4GY5 A;  4FSX A;  4J6W A;  3SDZ A;  4P71 C;  2DD4 A;  4RQE A;  3HL8 A;  3LSS A;  5HK0 A;  2I4M A;  1VQM A;  2K5F A;  3QZ9 B;  3OYN A;  4DPG A;  2IVW A;  4ZGJ B;  2KVQ G;  2DDZ A;  2P5I A;  1VQ7 A;  1V29 B;  2DIQ A;  1U1S A;  4JJN K;  3OYH A;  5GMK j;  1VIE A;  1PYS A;  1ADY A;  1XQH A;  4JRI A;  3OYC A;  4X34 A;  1FWZ A;  5LJ5 f;  4RG8 A;  2BKD N;  1JRI A;  2ZPI B;  1YCY A;  4C92 A;  3L2U A;  2JN0 A;  5GAO p;  3BJU A;  4LVJ A;  2KAF A;  2DTO A;  3A7A A;  4ME7 A;  4O5V A;  4M75 A;  2HQX A;  2R58 A;  2E12 A;  4N0A C;  4M78 D;  1JJC A;  4JS4 A;  4MZT A;  5I2M A;  4A4H A;  3I7F A;  3HRK A;  4CS3 A;  4G84 A;  3JCM c;  4LNS A;  3M9Q A;  2DTH A;  4Y28 E;  3X24 B;  5DY9 A;  4HKE A;  3CPW S;  2EQK A;  2E3C A;  3QPH A;  3HXZ A;  2PU9 B;  4M7D D;  2PVG B;  3TRE A;  2LT1 A;  1X75 C;  3H6Z A;  3DLL A;  5CQY A;  1NJ1 A;  4QVZ A;  1HXD A;  4YRR A;  3CCJ T;  1M8V A;  4BDY A;  2A8E A;  4UP9 A;  3OB9 A;  2DPP B;  1YIT A;  1H4T A;  4M75 G;  4M77 D;  4P73 C;  4X9D A;  2QHS A;  2QTX A;  2RHI A;  4PLI A;  3CCQ T;  4L87 A;  4P74 A;  3QO7 A;  5DLO A;  4NCX A;  2P0K A;  4FT4 A;  1ATI A;  3GNF B;  2D9T A;  3QDR B;  4LDX A;  1Q81 C;  2YLC A;  3QNE A;  1OI1 A;  2DU5 A;  5LJ3 d;  3MEY A;  4P75 A;  5K1X A;  4EMK B;  4BUG A;  4WI1 A;  1U8R A;  3MEW A;  1VQ9 A;  4H02 A;  2LC4 A;  1VQP T;  3P8T A;  2WSE E;  3JCM V;  1W2B A;  3QTC A;  4CH4 A;  1Q86 U;  2F5T X;  3QO8 A;  4V2S A;  4P72 A;  1VQ7 T;  2ZCE A;  1ZQ1 A;  5CKB A;  2G4C A;  2ZPH B;  4JDS A;  4YPF A;  1H64 1;  2DQ0 A;  3BFM A;  3GF5 A;  5J39 A;  2ZT8 A;  5LJ3 h;  1S72 A;  2RB6 A;  4HWT A;  2OAU A;  3FLG A;  4QQG A;  2E70 A;  4HCZ A;  4HWP A;  2E6N A;  12AS A;  3RES A;  3JCM W;  2D6F A;  5GAO m;  4C0G A;  2I4N A;  3R07 A;  2R5A A;  1X2G A;  4BAC A;  3OSV A;  4Q6G A;  2RHY A;  4M7D C;  3HFV A;  3X28 B;  4Q15 A;  1XNI A;  3QJ6 A;  3CCU T;  4CRI A;  3HKS A;  3S3M A;  4YRK A;  2K57 A;  3RF1 A;  4J83 A;  3CC4 T;  3IAL A;  3JB9 D;  3CCR A;  2B8A A;  3QO5 A;  1EQR A;  4IKF A;  4MMK A;  3M53 A;  4XTZ A;  4XEO A;  2RHX A;  2A3L A;  2ZCF B;  1QW1 A;  1WJR A;  2NS6 A;  1G3Y A;  2XD0 A;  4J7I A;  3FDR A;  4MDX A;  3OD1 A;  3A8G B;  3CME A;  1M1K U;  3L2W A;  1M5Q 1;  4BWA A;  5A0L A;  3UH0 A;  3QXE B;  3OYB A;  3L4G A;  3T9N A;  2WAC A;  3OYE A;  3OW2 A;  1H4Q A;  3OYJ A;  3JB9 F;  3CCE T;  4EMK C;  1EVL A;  4IUP A;  3BDU A;  2VXF A;  1I81 A;  2PUO B;  1KD1 C;  1Z7M A;  5GAO n;  4M7A G;  3NEL A;  4YRE A;  3MF1 A;  3E19 A;  3INZ A;  1K9M C;  4OP0 A;  2PME A;  2Y4X A;  4XU2 A;  2EJ9 A;  1QE0 A;  1N9S A;  1NE8 A;  2QA4 T;  5IAY A;  4NL2 A;  4JRK A;  1VQ8 T;  4M7A B;  3AHU A;  2E10 A;  3PMI A;  1TH7 A;  3HRS A;  4BDZ A;  3QSU A;  4OGC A;  5HKC A;  3HXW A;  2DQ3 A;  3OMG A;  3PCO A;  3ASK A;  1WGS A;  1IL2 A;  4LVK A;  3VQW A;  2ZGW A;  3CPW A;  3MQZ A;  3HTZ A;  4QVC A;  4X5O A;  2L5Q A;  4TQD A;  3MEV A;  1RI0 A;  3MF2 A;  4YYE A;  4YRL A;  1WQW A;  3HXV A;  3OS2 A;  1NPP A;  3HFZ A;  2EAY A;  5I21 A;  2QXF A;  1X54 A;  2RK2 A;  2GFU A;  4C0F A;  4CH5 A;  1KQ2 A;  3I56 A;  2QEX T;  4BY6 C;  4HWR A;  4LDY A;  4CS2 A;  1MGQ A;  4EDU A;  4C92 G;  5KNN A;  2XK0 A;  3M58 A;  2V8J A;  1QVP A;  3CC2 A;  3E1S A;  4PJO B;  2VC8 A;  4K87 A;  2FL7 A;  1O9S A;  2E6Z A;  5K1P A;  5GAN 3;  2YLB A;  2RHU A;  1N9R A;  3SWN B;  3PIP A;  4X9C A;  3G6E A;  5GMK m;  2DK3 A;  2VXE A;  3JB9 G;  3M4P A;  2XDB A;  4A53 A;  3X25 B;  2HQE A;  3NTK A;  2RHZ A;  2I4O A;  3CC7 A;  2YHT A;  2ZPE B;  1BI3 A;  4XU0 A;  4C92 C;  4FIB A;  4HT4 A;  3KUF A;  4FT2 A;  3KFU A;  3SWN C;  3CCS T;  2ZZG A;  4TTV A;  3V7S A;  4UP7 A;  4RMO A;  2RM4 A;  2CZ0 B;  5HGQ A;  2MAM A;  2ZPG B;  4M75 D;  3J7A F;  4L59 A;  2PMF A;  2DKG A;  5C53 B;  3FC3 A;  3OYM A;  1X56 A;  2MWP A;  1KD1 U;  4RG2 A;  2OTJ A;  2DJZ A;  4KQE A;  4CH3 A;  4M7D A;  3MP6 A;  4M7A A;  1VQM T;  3CCL A;  4C92 E;  3CCV T;  3ME9 A;  4BY6 B;  2GF7 A;  5C0M A;  4DOV A;  4XTY A;  4C5I A;  4C0D C;  3PCO B;  2DEQ A;  3MHX A;  2X4W A;  1Q81 U;  2VYT A;  3A32 A;  4HT9 A;  4ZTF A;  4P3O A;  1NNH A;  1G3W A;  1EOV A;  1WJS A;  1I8F A;  1PSF A;  2EQU A;  1PYS B;  2EFI A;  1Q82 U;  1Q82 C;  5KE2 A;  1LNX A;  1RL2 A;  1YIT T;  5CKD A;  1ZHI A;  4QVD A;  1SET A;  3VQY A;  3V7C A;  2ZPF B;  1LJO A;  5GAN j;  3RMS A;  4M75 B;  3HSB A;  4M7A C;  1KHI A;  2QQA A;  1M90 U;  5FRN A;  4J15 A;  3G4S A;  1WJQ A;  3M57 A;  4VUB A;  2QQR A;  4E7K A;  2AMC A;  1MHN A;  3G71 T;  3UFG A;  4OGE A;  3A7U A;  1LOJ A;  5GAM h;  1KOG A;  3TCJ A;  2EWN A;  2DU7 A;  1KG1 A;  2RJE A;  3SWN A;  1M9S A;  2RJD A;  1I4K 1;  2C8M A;  5GAN 5;  3CC7 T;  2C7I A;  3BDL A;  4RMF A;  4JS5 A;  3C94 A;  3CPF A;  2DIG A;  3JCM g;  3OS1 A;  1VQ4 T;  5C52 B;  4LD9 K;  5A0G A;  2JUF A;  2LVM A;  3LLR A;  4LDU A;  3E9I A;  3A8L B;  3VUB A;  3GPL A;  3JB9 J;  4ZTZ B;  3G7Z A;  3QII A;  3UGQ A;  4XEM A;  4YCU A;  2DO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...