4XU1A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 82 that incorporates a morpholine in place of the ribose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 98
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu1A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu1A01
3A7AA 3JCMP 3VQVA 4C92C 2C7IA 4P71A 1I5LA 2DTOA 4MMLA 3NELA 4XEOA 5GANf 1ADJA 4C92E 1JRIA 1MGQA 1E1OA 4P73C 4YDQA 2AMCB 1NNHA 3VQWA 4M7DE 4JUVA 2E3CA 1Z7NA 4BW9A 4XU0A 3HXVA 1I4K1 1YB3A 4CH3A 3INZA 2Q7GA 2DVEA 3MEYA 3PGGA 4WI1A 3VU3C 3AHUA 3UGQA 4M7AB 4H2VA 1NJ2A 4YRPA 3LC0A 4ZTUB 4C92F 4L87A 4XTWA 1NYRA 4YRNA 3E9IA 5GMKl 2RHQA 4C92G 4C92D 2DXTA 4M7DF 3BFMA 1WPYA 4PJOC 2ZTGA 5LJ3d 4XTUA 4M7DG 4YRFA 1YFTA 2DDZA 2ZIMA 1HXDA 2QTXA 4G84A 4YCVA 1ADYA 3M4PA 4M75A 4M7DA 1B70B 1B7YB 1KOGA 2CJBA 5LJ3e 1X2GA 1NJ8A 5GAOp 4HWOA 5CAIA 2E64A 2ARTA 1B34B 5GAN4 4LNSA 4HWTA 4TVAB 1E24A 3RKWA 3JB9D 2PMEA 3RUXA 3HXYA 5LJ5j 2RHSB 4P3OA 1X2HA 3BY7A 4H2WA 1KQ1A 2ZZFA 4WJ4A 3HXXA 4JRIA 4PJOG 3UGTA 4PJOD 4XTYA 4WF2A 5LJ5f 2EL9A 3IALA 1LYLA 3V8KA 3MF2A 1ASZA 2RB6A 2AMCA 4O2DA 5K1PA 3HY1A 5GMKh 4YRQA 3JCMJ 4P71C 3A74A 5KNNA 4X9DA 4C8QB 4M77B 4Q15A 4X5OA 4H2XB 4J5YA 4M7AA 2Q5HA 5GAMh 1LNXA 5GAN5 4V2SA 3M4GA 5GAMg 2ZXFA 1SRYA 2K57A 4YP0A 2Q5IA 4H2SA 5GAMd 2IY5B 2VXEA 1SESA 1H4SA 2ZT8A 3JCMh 5GMKm 3P8VA 2RA2A 4WJ3M 3JCMg 4OLFA 1HK9A 2AKWB 4YRSA 1KMNA 2DKGA 1N9RA 2DTIA 2FB7A 4XQ3A 1B70A 1B7YA 3HFVA 4HWRA 3JCMd 2I4OA 3QTCA 2QHUA 4NCXA 4G85A 4BWAA 1EFWA 2ZINA 2DEQA 3QO8A 1SERA 5C52B 4YCUA 5I21A 1B34A 3P8TA 2HNIA 3HRKA 1HTTA 4ZTZB 2DTHA 1E1TA 4TVAA 3G1ZA 1G51A 4M75C 4M7DC 3HFZB 1PYSB 4K88A 2E1HA 5LJ3j 2XTIA 3DSQA 3IKLA 2RHSA 4M78B 4M75E 2DXUA 1ASYA 3P8YA 3JCMX 2ARSA 3RGLA 4F7UB 2DU7A 2DQ3A 2ZCEA 1X54A 5LJ3f 1GGMA 4YCWA 3M4QA 3JCMc 3FB9A 1ATIA 4MMKA 2ZZEA 1KQ2A 4TQDA 1J5WA 3A5YA 3JCMW 1M8VA 1N9SA 1EIYB 1KMMA 2JN0A 2E41A 4M75F 4H2UA 3IKMB 4C8QA 4M77A 4RQEA 4M75G 2G4CA 3MF1A 4M75D 1WLEA 4M7DD 1X56A 5DY9A 2PMFA 4H2XA 3WQZA 2I2LA 5GANh 4K86A 3GIBA 5ELNA 4EMGA 4NL3A 5GANg 4YRRA 4HA8A 5GAOn 3TUPA 4YRCA 4TWAA 1E22A 4UP7A 1C0AA 5GANd 4YRKA 4JLIA 4QVCA 5F5WA 1HC7A 2IY5A 2DZCA 3L4GB 3ICAA 4J6WA 1U1TA 1U1SA 3CMQA 4M7AC 4J6YA 2AKWA 2ZZGA 1BBWA 4NL2A 3PCOB 3RIRA 3NENA 2ZIOA 3W3SA 4M7AE 1WQWA 3RERA 3A7UA 2DQ0A 3A5ZA 5GAN8 3QO7A 3QNEA 1LJOA 5GAOr 2XGTA 3HSBA 3FJPA 2QHTA 3R07A 1YCYA 5ELOA 1JBMA 5GAMj 3REXA 1H4TA 1X01A 1PYSA 3HFZA 2QHVA 2ODRC 1Z7MA 3RKXA 4M78A 4XTXA 1B8AA 4EMKB 3QUIA 1G5HA 4TQFA 4P72A 1NJ6A 4M7AF 4RCBA 4A54A 2Y90A 3HRIA 12ASA 3SWNB 4M7AG 5GAN7 4M7AD 1H641 2CJ9A 2FYKA 2YLBA 2ZR2A 1JJCB 3JB9J 3HXZA 4YRMA 1EIYA 3NEMA 3V8LA 3L2ZA 4TVYA 5C53B 3ERRA 3RESA 4YRJA 1I81A 4PNOA 2ZR3A 4RQFA 5LJ5h 2EJFA 3EFRA 1BBUA 2ODRD 5LJ5g 1WYDA 1D3BB 5GAMe 1RIQA 5E3IA 4J6XA 4RDXA 1M5Q1 4XU3A 4C92B 5GAOl 1EOVA 4XU2A 3A31A 3FIFA 5GMKi 4H02A 2I4LA 4P75A 4M7DB 3L4GA 4CH6A 4M77C 3JCMe 4HVCA 3TEHB 3PCOA 4OP0A 4Q6GA 4C8QE 4M77E 2ZNJA 2I4NA 4P3NA 2EJ9A 3IG2A 2QHSA 1Y96B 1EVLA 5GAOq 4N0AA 4HT8A 2ALYB 3BDUA 1X55A 2VXFA 1NJ5A 4YRLA 3JCMb 1USYA 3JB9I 3QSUA 3HTZA 3HFNA 4EMKA 3OD1A 3SB2A 4C8QF 4P3PA 4P74A 4M77F 4PJOB 3A7RA 1EVKA 2VC8A 4C8QG 5HGQA 2DZ9A 4M77G 4C8QD 4HT9A 4M77D 4YPFA 4ZIBA 4TTVA 4KQEA 3JCMV 5GAN2 2P5IA 3SWNA 4XEMA 4H2YA 4TVWA 1VQZA 4H2TA 4KR2A 1IL2A 4M78C 4XU1A 4UP9A 1JJCA 3QO5A 2E10A 1EQRA 3HFOA 4P72C 3BJUA 4RMFA 4M78E 2E5AA 2DJZA 1W66A 2RM4A 4UP8A 1BIBA 3RF1A 4F7UE 5LJ3h 5GAN6 5C51B 4CS3A 1YFRA 5LJ3g 5GANe 2CIMA 1D3BA 2I4MA 4CH4A 5GMKj 3REUA 3KFUA 3V7CA 4YRIA 3HY0A 1NYQA 4C92A 2P0LA 3LSSA 4YYEA 3QHSA 1SETA 3UFGA 4PJOE 4NOYA 1FYFA 2RD1A 5GAOm 2J3LA 3V7SA 4DPGA 2CGHA 3VBBA 4P73A 11ASA 4M78F 5GAN3 3RKYA 3TEHA 2ZGWA 4M78G 3RACA 4M78D 4F7UF 2CJAA 2Q7EA 3BW1A 4CH5A 3JB9F 4CS2A 4F7UG 4EMHA 3PZCA 1H4VB 4E51A 1TH7A 1L0WA 4P75C 1G5IA 4UPAA 3JB9G 3VQYA 1Y96A 4PG3A 3LSQA 1QE0A 4F7UA 5GAMf 4K87A 2ZNIA 3V7RA 4X9CA 2ALYA 4HWPA 3HXUA 3HXWA 3A32A 4PJOF 1YFSA 3RL6A 2ARUA 1YGBA 2C8MA 3JCMf 3VQXA 4QVDA 3QO3A 4RCCA 3JB9H 3NETA 4PJOA 1N9WA 5GMKe 4YRTA 2DU5A 4N0AC 1B76A 4PHCA 4DQ2A 4YREA 4XTZA 1H4QA 4EO4A 1USYC 5K1XA 2EAYA 2RHQB 4EMKC 4P74C 3UH0A 4CS4A 3L1AA 5LJ5d 2Q7HA 1WQ7A 1LOJA 2J3MA 4M75B 3SWNC 4C8QC 4YROA 3I7FA 4Y91A 1WU7A 4JRKA 5LJ5e 3JCMQ 2ZT5A 2YLCA 4XTVA 2EWNA 1QF6A 3TEGA 4KR3A 4AH6A 4J15A 2ZT7A 2E65A 4EX5A 2EJGA 1NJ1A 2YHTA 4A53A 4HWSA 1I8FA 3E9HA 4YRGA 1BIAA 5GANj 3EFSA 2ZT6A 3V8JA 1WNLA
chains in the Genus database with same CATH superfamily
3REBB 3VQVA 1I5LA 2DBKA 2DTOA 4MMLA 3NELA 4E47A 1WYXA 4LVMA 2KT8A 3SHWA 4A63B 2K2MA 1UG1A 2EW3A 1ADJA 4RTYA 4C92E 4X34A 1E1OA 1LVKA 1MMNA 3EH1A 4GLMA 1NNHA 2A37A 1UTIA 1TG0A 3MCAB 1S72A 4JUVA 1M1KR 2E3CA 1Z7NA 1TWBA 2M0OA 3LW5E 3QYHB 2HCKA 1YB3A 2QXFA 3I55A 2MIOA 3MP8A 3DB4A 2QQ9A 3UGQA 2KAFA 1NJ2A 5KYWB 4YRPA 3LC0A 3NMZC 4L87A 5AYFA 2C0IA 3DLLA 3LWIA 4M7DF 3IQLA 1M9SA 4PJOC 2ZTGA 2RHYA 2VGMA 1G3SA 5LJ3d 4MZTA 4OMNA 2O9SA 4G84A 1WFWA 4YCVA 2LX7A 1B7YB 1KOGA 5LJ3e 4FYYB 2ZPIB 4A4EA 1KK7A 2ARTA 1YIJA 3CC7Q 2I0NA 1OPKA 3U23A 3M0SA 4RTXA 1WXBA 2OTJA 3RKWA 5I11A 4JZ3A 2HSEB 4KBMB 1X2HA 3A1PA 4H2WA 2PNIA 2FVUA 1RLPC 2D1XA 3H6ZA 3M54A 1M90C 4J9FA 3UGTA 4JRIA 4PJOG 4PJOD 4XTYA 3VS2A 1R0CB 2P0KA 1QVGP 2FZCB 3IALA 4C5HA 3QZ5B 2D0QB 2AMCA 4O2DA 3X24B 5K1PA 2BUDA 4DBHA 1QVFP 3JCMJ 4P71C 4IUPA 3A74A 2LCSA 4MDWA 4X9DA 1M2VA 1TOVA 4Q15A 3CPWS 1RI0A 4OMQA 4H2XB 3PMTA 4L6V5 2Q5HA 2KNBB 5GAN5 4V2SA 2OJ2A 3QDFA 4RUGA 1VQ9Q 1OEBA 2QK0A 4RG2A 5GAMd 2IY5B 1PSFA 2VXEA 1BI3A 1H4SA 2ZPFB 5IHNA 5GMKm 3M0PA 3JCMg 1AT1B 2AKWB 1D0ZA 2DKGA 2V8JA 3ZBDA 3CD6Q 4QKUA 4NCXA 3EGXB 3OYCA 3OBYA 2ZINA 2K5LA 3QO8A 1M27C 3A5ZB 2X9HA 5I21A 1QP2A 2HNIA 3HRKA 1HTTA 4ZTZB 3SDZA 2EQUA 2W10A 3CMEQ 4M7DC 3HKSA 1JJ2P 5LJ3j 4KGZB 2XTIA 3DSQA 4BI4A 2PZ1A 4M78B 4FW1A 1KC8R 1NEGA 4M75E 2G3RA 3P8YA 2FPDA 2HL5C 4J9BA 4J9IA 4E6RA 5A0LA 3JCMc 1VQ5T 1YN8A 2M16A 4J7FA 3G6EA 2ZZEA 2V8IA 2XKOC 1GFCA 3JCMW 3CPFA 3TEEA 3MO8A 1N9SA 4JDSA 2O01E 2JN0A 1ZA1B 4C0DB 4R56A 4AFQC 4BY6C 1H3HA 1WHMA 4H2UA 2RJEA 5L8RE 2KYBA 1H92A 1VQ6Q 1T0HA 1VQ7A 3OYJA 4M7DD 3RDVA 1X56A 2PMFA 2C0OA 5GANg 2JT4A 4YRRA 5GAOn 1Z9ZA 1AWWA 1ZA2B 3S6WA 5F5WA 2IG0A 2KGTA 3EGUA 1UGVA 2HL3A 3PTAA 3CMQA 2QDLA 4M7AC 4J6YA 1Z9QA 1GXIE 3NTHA 1QKXA 2KSSA 4PKCC 5IHIA 2QQAA 2RF0A 2PVDB 1KG1A 1K9AA 1S72Q 1WQWA 3QO7A 2L8DA 2DO3A 3QNEA 3A98A 2XGTA 2M0YA 2YUOA 5ELOA 3H8ZA 4C0ZA 5GAMj 1X01A 1PYSA 3HFZA 4OB3B 2QHVA 1X2QA 1SG5A 1TS9A 2J6KA 2EGCA 3OS5A 4EMKB 2EQIA 2CZ7B 2QI2A 5IH2A 1BCOA 4PFPA 1QVPA 5M9OA 2RHZA 3MEVA 3MEAA 4A54A 3HRIA 4M7AG 3L42A 4M7AD 3EGDB 2ZR2A 2DFUA 2LQKA 2CP0A 3M5AA 3M57A 3VS0A 3HXZA 4KGXB 2DAQA 3V8LA 1K1ZA 1YIJQ 4ZNXA 3L2UA 5CQYA 1I81A 2QA4A 5E3IA 1D3BB 4PL6A 3THKA 2EPDA 4BDZA 3PMIA 1M5Q1 2R5AA 2KYMA 1YJ9A 3CCQA 3A31A 3UWNA 2I4LA 2RHXA 4M7DB 5CR2A 2OI3A 1G83A 2LP5A 4HVCA 1G3TA 3TEHB 1R0BG 3GF5A 1M90U 4Q6GA 3QWXX 2RQTA 1IRXA 2DD5A 2EJ9A 2EFIA 2DNUA 1CKBA 1I5OB 5FU7C 1Y96B 1AD5A 1IZ6A 4PFZA 4II1A 1VQPA 1ZSGA 4HT8A 3H0IA 1KD1C 2JOYA 2SRCA 3CCMT 2KQWA 1NJIC 3EG3A 1SHFA 2EGAA 4BY6B 3OD1A 4P3PA 2L2PA 1OZ3A 3A8LB 1WZOA 4IUUA 2XHCA 4C8QG 2F2VA 4C8QD 2BZXA 1VQOA 1MUZA 2F5TX 2NLUA 3JCMV 4KQEA 1M4ZA 4OMLA 3S3MA 2EYXA 1C0MA 4RTUA 1JJCA 3QO5A 4AG1C 3HFOA 4M78E 2DJZA 3G1JA 4ZN1A 2PVOB 3VS5A 3HPWA 2M02A 3ME9A 2VKNA 4E7KA 3J80E 2MPXC 3D7SB 3OYNA 3HL8A 3E2UA 4CH4A 1ZQ1A 2VGNA 1EX4A 2EGEA 4YYEA 2GQVA 1SETA 4PJOE 1K8AR 3V7SA 2CGHA 1YBYA 4CRIA 5GAN3 3RKYA 3UDCA 1UDLA 1UE9A 4LN2A 4AFUC 3G6EQ 3RACA 2Q7EA 3BW1A 2EKOA 3PZCA 4E51A 4HVVA 1TH7A 4P75C 3VQYA 4ME7A 8ATCB 1ABQA 5KYYB 4BDYA 1BCMA 1PC0A 5GAMf 4J83A 2ALYA 2COYA 5A2QE 3ASKA 1VQ7Q 3HXUA 2E3IA 2HQHA 1OX9A 1F1BB 1JU5C 3NETA 4FL6A 2KVQG 4PJOA 1A0NB 4B6MA 1N9WA 4YRTA 2JJ9A 4HVUA 2DU5A 4N0AC 4C0FA 4Z88A 3TSZA 4AFZC 2DL3A 1YI2T 1RABB 1USYC 2RMOA 5K1XA 1AWXA 3CC4A 2KI7A 1KC8C 3CCLA 1H8KA 2DLPA 3UH0A 3L1AA 1OULA 2RK1A 1CSKA 5KCHA 2DBMA 2O31A 5IXBA 1MMGA 4YROA 2COZA 1Y7XA 3I7FA 4JRKA 1JXOA 3JCMQ 2ZT5A 3PIPA 4CC3A 2EWNA 1QF6A 4ZTFA 4J15A 4FW2A 2EJGA 4VUBA 2OTLA 2FRYA 3OYGA 1B07A 2ROTA 1UHCA 1I8FA 3CC4T 2A3LA 1W2BP 3DKMA 3EFSA 3X20B 2EQMA 1YJNT 4P71A 5I22A 2K9GA 2RJCA 4Q5WA 1OOTA 2QEXA 2DL4A 2O2OA 1NYGA 1FMWA 2AMCB 1N8RU 4M7DE 3I56T 2LNHB 3JV3A 2QA4Q 4BW9A 3MP1A 4JS4A 2H3EB 3HXVA 1JXMA 3QJ6A 3CCQQ 2CZ6B 5KE3A 1M2VB 3WXMB 1AHJB 2CP2A 1M1KU 3PIOA 3MJXA 2ED0A 4XTWA 1NYRA 1YITT 2V1QA 5GMKl 3BFMA 1ABOA 4FSXA 4YRFA 2KBTA 2QTXA 4OGEA 1VQPQ 1PD1A 4FU6A 4M7DA 1PNJA 1X2GA 1UEBA 2MF2A 1NJ8A 5GAOp 4HWOA 1XOVA 4OB1B 2E64A 2NUPA 4JZ4A 3OYAA 3NPFA 3LH0A 1O75A 3QKJA 1V76A 1QQJA 1LPLA 2ZPEB 2DIGA 2DPPB 1VQMA 3KBGA 4E7IA 3NFCA 1VQOQ 2MCNA 4ZTJA 3HXYA 1WXTA 2FG0A 1T3SA 2NUTA 2XDPA 3EG2A 1W2BA 1YWOA 7AT1B 5CO7A 1X69A 4HCBA 1VYVA 4WF2A 3CXCA 5LJ5f 1QWFA 2VVKA 1XJWB 4RTWA 1BK2A 1GCQC 1G2BA 2E6ZA 4CC2A 2DMOA 5KNNA 1BKBA 3I35A 1SKUB 3L2WA 1ZUYA 1BU1A 2JZ2A 1YP5A 1ZBJA 4X5OA 4M7AA 4BE0A 5GAMh 1LNXA 1E6GA 1VYTA 4KH1B 2CUDA 3VV0A 3GBQA 2K57A 4KUDK 3O5ZA 5EC7A 2PUKB 2XMFA 2JVVA 2RN8A 2ZT8A 5KYUA 3P8VA 2WSEE 2C06A 1P92A 3J81E 4OLFA 1AVZC 4YRSA 1KMNA 4J9EA 1N9RA 2FB7A 2YXYA 3MEUA 4XQ3A 2KT1A 4EPCA 1B70A 3JCMd 2LCCA 2I4OA 3OA6A 3QTCA 4QVZA 2DEQA 1SERA 4YCUA 3P8TA 2RK2A 2DTHA 1E1TA 4GY5A 4R0KA 1PKSA 3HFZB 9ATCB 1PYSB 2E1HA 5KYYA 4K88A 3IKLA 2RHSA 2YUPA 1TXQA 3OMGA 2DXUA 4DEYA 1B7TA 1RL2A 3RGLA 3JCMX 2DU7A 2DQ3A 3CC4Q 3CCLQ 4L59A 2IVWA 1GGMA 2DXCA 2ZPBB 3M4QA 1ATIA 3E9FA 1RUWA 1KC8U 4IIOA 4TQDA 2E5KA 3QDRB 1YCSB 5J26A 2F2XA 3EAEA 2CT4A 3OS1A 2PQWA 1M30A 2LT1A 3C12A 1MV0B 3G7ZA 3IKMB 2OTLQ 1NEBA 2L89A 2R5MA 4C8QA 4E7HA 4ZGDB 1WLEA 2DEUA 4PJJA 3LGLA 1KQSS 2I2LA 4K86A 4F04B 3CCRT 2XDDA 2AZSA 1XTDA 2CKKA 2CT3A 1IHVA 1M3AA 2K3YA 2ZPGB 1PCXA 4TWAA 3H9NA 1E22A 5GANd 4QVCA 1I1JA 2DZCA 3ICAA 1U1TA 1WJRA 4PLLA 3RMQA 1U1SA 4FSSA 2QEXQ 2ZZGA 1BBWA 2MYSA 1OYXA 2F1LA 2D0NA 1WX6A 3RERA 3MP6A 1X43A 3A7UA 3P8BB 5GAN8 5D7UA 2LQWA 1U3OA 4OB2B 4OMPA 3PFSA 4GBQA 4AG2C 5D6XA 1JBMA 2JNGA 1GBQA 1H4TA 4E7JA 3P8HA 4DBRA 1Z7MA 3MQZA 3UT1A 4XTXA 1B8AA 1M2OA 3QUIA 2LJ3A 3RBBB 4DOVA 2AKKA 4M7AF 4RCBA 1QCNA 2EYQA 4JPBW 2Y90A 4RTZA 12ASA 3KFVA 2ROLA 3DLMA 3OYDA 2FYKA 1K0SA 4JJCA 4D8DA 1JJCB 3M53A 3VS7A 1M8MA 1SRMA 1WJQA 1K73U 1HJDA 2CP7A 3O8VA 2RI2A 4KH0B 2YUNA 5C53B 1X6OA 1VQMQ 3ERRA 4PNOA 2ZR3A 5LJ5h 1IO6A 1G3YA 3EFRA 4LVLA 3GNGA 1WYDA 5GAMe 3KUFA 5GJVB 1Q82U 4FT4A 1EOVA 3CQTA 3FIFA 4E7LA 4P75A 3L4GA 3E1SA 4M77C 1VQ5A 2L3SA 4FYVB 3VUZA 1OZ2A 2AK5A 1Y71A 4OP0A 2A0FB 2J7IA 5FU6C 2I4NA 3OMCA 1QMCA 2RHIA 5IN1A 4P3NA 2V1RA 1BI0A 2HKNA 1YFNA 4IIMA 4XAXB 3OYBA 1VUBA 4Z89A 4N0AA 2ALYB 3JSCA 3BDUA 2HEQA 4IUTA 3PNWC 1LCKA 1IGQA 4YRLA 1USYA 4LDVA 2YDLA 1QVGA 1T3LA 4J9HA 3SB2A 4C8QF 3OYEA 3LWHA 1VA7A 3OYLA 4PJOB 1PRMC 4LDUA 4M77G 5DLOA 1QCOA 4M77D 1QVFA 4H2YA 4TVWA 3CCEA 1VQZA 4H2TA 4KR2A 3AT1B 4XU1A 4UP9A 2FZKB 5HKCA 1WHJA 1EQRA 3QYGB 2DF6A 3M0QA 3G4ST 3L2QA 2RM4A 1BIBA 2XI9A 1WA7A 2LZ6B 5CVIA 3TQ7P 5C51B 4CS3A 2LDMA 2F69A 5LJ3g 3L2RA 2HAXA 1YFRA 2LMJA 1V1CA 2XU8A 2KRNA 2M51A 4YRIA 1OPLA 1WHHA 5FRNA 3CCET 2P0LA 1BYMA 2K7AA 2YUQA 3LSSA 3UFGA 3CCRQ 1PRLC 1FYFA 5GAOm 2ZPHB 2ZGWA 3A8OB 2OAUA 4CS2A 1W4SA 4F7UG 3I5RA 1I0CA 1L0WA 1K8AU 1G5IA 3JB9G 4UPAA 3OW2S 1JJ2A 4PG3A 2YRVA 2ZNIA 1KQSP 1K73R 1HYOA 5EG2A 4BI3A 2Z0WA 1X6BA 2FO0A 3A32A 2CP6A 4RTVA 1QW1A 1YGBA 1D09B 3JCMf 4RCCA 2CDTA 1PHTA 2RQWA 1N8RC 1B76A 4PHCA 1SEMA 1Q82R 4LXCA 3CCUT 1H4QA 2KDSA 3NHNA 4LD9K 1H3ZA 4F17A 2OAWA 4A4HA 3H0FA 2EAYA 4QQDA 2WSFE 3QJYA 3L2VA 5LJ5d 1KHCA 1M1KC 2Y4XA 1LOJA 1IHWA 3SWNC 3HRUA 4OGCA 1MNDA 1K9MR 4C8QC 3CCMA 2FPFA 5FW9A 5LJ5e 2JS0A 4XTVA 5DM7R 2X51A 2LTOA 4RG8A 3VS1A 1TTHB 2DIQA 2NUPB 3LYIA 4FYXB 3TEGA 4KR3A 1R77A 4ZN3A 3CCVT 4AH6A 5FROA 2ZT7A 1FX7A 3JRZA 2YHTA 4A53A 3FJ5A 4IKFA 1FWZA 4ORZA 3TU4K 2ESWA 3CPWP 4YRGA 3S3NA 2NUTB 3VS3A 3CMAT 3V8JA 3A7AA 1GCQA 4C92C 1Y0MA 2C7IA 3MEWA 5CCAA 2X4XA 2VYTA 1NZ9A 4IURA 4XEOA 5GANf 4KUIA 2RH2A 3CC2A 1JRIA 2HD0A 4P73C 4YDQA 2HQEA 4HVWA 3QXEB 2X4YA 2P0QA 2P4RA 2LCLA 1MHNA 1PKTA 1PSEA 1I4K1 2CSQA 2CSIA 4CH3A 1X75C 3INZA 2DVEA 4QT7A 2Q7GA 2RQVA 4C5GA 1JB0E 5CIUA 1KSWA 1VQ5Q 3AHUA 4M7AB 5C6SA 4H2VA 2GCXA 4LDWA 4ZTUB 3CC2T 2BZYA 1IB8A 1YWPA 1FXXA 1NG2A 1I07A 1M1FA 4GLKA 3E9IA 1WHGA 4C92G 2PTKA 2DXTA 4J9DA 4C92D 2RPNA 5HK3A 1NLOC 4XTUA 5KYUB 2DDZA 5DLQE 1HXDA 1TUGB 1UJYA 2WACA 1VQLT 4ZGJB 4CC4B 2JW4A 1B70B 1SF9A 3G4SQ 1OQKA 3ZFJA 2RO0A 1MMAA 3SEMA 2CZ0B 1NE8A 1YHQA 2J05A 1IGUA 1RAGB 2P0PA 2QG9B 4LE9A 4HWTA 3FDRA 2YSQA 3EFOA 1YI2A 4FT2A 2EQJA 5LJ5j 2RHSB 4B9WA 4JS5A 2J6OA 3BY7A 3PE0A 4EDUA 3CCEQ 1KQ1A 8AT1B 3TCJA 1G8XA 3HXXA 5KYNA 5CKBA 2EL9A 2J06A 4ELZC 1LYLA 2MMPA 1YHQT 4M4ZA 2DX1A 4O5VA 1VIEA 1Q81R 2KK4A 4LUEA 5GMKh 2P84A 3HRTA 3M58A 4YRQA 2HBWA 4BE1A 3VS6A 4A4FA 3C95A 4C8QB 1NPRA 3VKIA 2O4XA 5HY6A 4J5YA 3UA6A 4FCYA 1G3WA 1YJNA 2EKHA 1GCPA 2GTJA 4RTTA 4YP0A 2Q5IA 2XICA 4OMMA 3OW2P 2L5QA 4HCKA 5FU7B 1M1GA 1RAHB 2F5KA 3JCMh 2DRMA 4WJ3M 1HK9A 3I56A 1UGSB 3M55A 2DTIA 4HWRA 3EG0A 2DYBA 4G85A 1ZHIA 1K76A 5C52B 1B34A 2RJDA 1FMKA 4LDXA 4TVAA 3G1ZA 4M75C 3I9QA 4OMFB 4KULA 2JTMA 1B3QA 1GRIA 1YITA 2RJFA 2L3PA 3CCVQ 2E4HA 1MNEA 1SHGA 2ARSA 2DYIA 1ZSZC 2D8JA 1X54A 4XK8E 2AIRB 2EVRA 4JJBA 3FB9A 1S1NA 2KEAA 3JAME 2QGFB 3P8DA 1KQ2A 3CCMQ 1J5WA 3EHQA 3A5YA 1M8VA 2HSPA 2E12A 2E41A 1W6XA 2RHUA 2F2WA 4M77A 4OB0B 4M75G 2G4CA 4IUVA 2RI3A 4M75D 3MF1A 3WQZA 5GANh 1HD3A 2LQNA 5ELNA 4FM4B 1K73C 3C0CA 3PT9A 4B9XA 4BD3A 4HA8A 3TUPA 4YRCA 4ANJA 4UP7A 3REAB 4YRKA 1ZLMA 2X4WA 3CC7T 1HC7A 2DERA 1N6AA 3M56A 3L4GB 4DA4A 1UJ0A 4J6WA 2J6FA 2MWOA 5D6YA 3CC2Q 1Q82C 5CKFA 2GNCA 2QYZA 2PVGB 3NENA 5KYXA 4M7AE 1VQ4T 4J7IA 1RADB 3M0RA 2QHTA 4J9GA 4PK4A 5C0MA 4JLGA 5FRMA 4P5NA 2K79A 3RKXA 2QQSA 2RQRA 1TUCA 1G5HA 1YNZA 2ZZDA 4TQFA 1NJ6A 2BIVA 4BACA 2E6NA 2FPEA 2BE9B 1BI1A 3OYMA 1WHLA 1SPKA 1QCFA 5GAN7 1H641 2X3WD 2CJ9A 3X28B 2MI6A 1SRLA 4LDYA 2LT4A 3RMSA 2VB6A 1Q86R 3VRYA 2A8EA 4YRMA 2ECZA 1EIYA 2X3XD 3C94A 1XQHA 1BBZA 1ACMB 2OX7A 3RNJA 4BB7A 2JM9A 3RR6A 1VQ8A 3M0UA 5J39A 1YHQQ 3L2ZA 2A7YA 4TVYA 4YRJA 3RESA 3QPHA 1YI2Q 2EJFA 1EZZB 3CD6T 1RIQA 1U06A 2X35A 2LQ8A 4WCIA 4RDXA 5GAOl 4NS5A 2LC4A 2MK5A 2RNAA 4H02A 3M59A 4A4GA 2RI5A 3JCMe 2KR3A 1J3TA 1VQ8T 3PCOA 4C8QE 1M3CA 2NYSA 4HCZA 2DE0X 2QHSA 4BUGA 3VS4A 3EH2A 3WVEB 1GFDA 3CCRA 2WSCE 4DOWA 1NJ5A 1C1AA 5ECAA 3LLRA 3JCMb 1K8AC 2PUOB 1YJNQ 3HRSA 2HKQB 4M77F 3A7RA 1G5VA 3TVTA 5HGQA 2DZ9A 4YPFA 4HT9A 3ZEHA 1UGRB 1VQ6T 2HDAA 3SWNA 1M3BA 3I56Q 1Q7YU 4M78C 1PD0A 2GF7A 3HP9A 1SSFA 1VQKA 4DEXA 4P72C 3BJUA 4RMFA 2E5AA 4UP8A 1RAAB 4C5IA 3RF1A 5GAN6 1OX8A 3VRZA 5GANe 1K0XA 1VOMA 3N5BB 4OF1A 1YITQ 2I4MA 1AEYA 5GMKj 2L3QA 1Q81C 2QQBA 1S72T 3HY0A 1NYQA 4C0DC 5CKEA 4C92A 1KD1R 3VYHB 2QDYB 4ESRA 2AZVA 3QHSA 1PWTA 3T9NA 4DBQA 4NOYA 2RD1A 3I55T 1NJIR 1VQKT 2J3LA 4KRTA 1AZGB 3VBBA 4P73A 3ER0A 3C4SA 3OS2A 2XIDA 1TU0B 2FRWA 2QTVA 3FRNA 4M78G 2A36A 4M78D 2DL7A 4F7UF 1U8RA 4CH5A 3JB9F 5A0DA 4EMHA 1H4VB 1N27A 3CCJA 1UUEA 4TVRA 4QQ6A 3QZ9B 3LSQA 4K87A 2KRSA 3GLXA 3V7RA 2BE7D 1YFSA 2JUFA 2GFAA 1VQ4Q 2AT1B 3CBOA 2D9TA 2DL5A 5D6WA 4HKEA 4AFSC 1U5SA 4EIKA 2JTFA 3JB9H 1WXUA 2D8HA 1YIJT 1X2KA 2JMAA 4DQ2A 4YREA 3OYKA 4XTZA 1QP3A 3CBPA 3CCJT 1UGPB 2OTJT 3SD4A 2M9UA 1X27A 3PVQA 1QKWA 2A28A 4J9CA 4AMCA 2GQIA 1AWJA 1PM3A 3CBMA 4EMKC 4P74C 1NM7A 4FYWB 1NPPA 1WQ7A 1D0XA 2IPOB 2J3MA 4E7ZA 3J7AF 2GGRA 3WVDB 2RQUA 2YLCA 3M9QA 2EBPA 1GL5A 3KXTA 4C5EA 1UECA 2E65A 4EX5A 1OU9A 2H3JA 1NJ1A 3GPLA 1K9MU 1ZUUA 3EFOB 4JJDA 4ATOA 3A8MB 3E9HA 5GANj 1O9SA 1JEGA 5CQXA 1WNLA 1XNIA 3JCMP 2VUBA 1FMVA 3G4SA 3LGFA 1KFZA 1Q7YR 3E9GA 4KGVB 1VQ8Q 1RAEB 2KY9A 2CH4W 1C6VX 1MGQA 4Y28E 1WIEA 3VQWA 1W70A 2HZYA 4FIBA 1RAFB 2AKLA 4XU0A 3FLGA 4PJMA 4JRPA 3MEYA 1D1AA 2GFUA 2AHJB 1PG5B 2O4XB 1AZEA 4LVKA 3PGGA 4WI1A 3VU3C 4RKUE 3GP8A 2MWPA 4BI8B 1RACB 4C92F 1WI7A 2XD0A 4YRNA 3H0HA 2RHQA 3VUBA 3OYIA 5I2MA 3BE3A 1WPYA 4O6JA 4M7DG 1EFNA 4RMOA 3OY9A 5FLXE 1YFTA 1ZBXA 2ZIMA 4C0GA 1ADYA 3M4PA 2K5FA 4M75A 3MKDA 2CJBA 3UA7A 2QGGA 1DJ7B 5KE2A 3G6ET 1JQQA 3QG1A 5CAIA 2LNVA 2W0ZA 1Q86C 1B34B 5GAN4 4LNSA 1ZSZA 2CH4A 2XDBA 3M0TA 2LJ1A 4TVAB 3CCUA 1E24A 2DL8A 4E2FB 3JB9D 4PJLA 3OS0A 4JRQA 2PMEA 3RUXA 3R6OA 1VQ7T 4P3OA 3META 2YRCA 3EG9A 2ZZFA 4X1VA 4LUDA 2L0AA 4N4IA 4WJ4A 1RLQC 1VYUA 3I55Q 1VQKQ 3A8GB 2P4TA 3R6NA 2GTOA 3OSVA 1KJWA 2B86A 2H8HA 3V8KA 3MF2A 1ASZA 2RB6A 2DA9A 5HCKA 2DXBA 2KRMA 3HY1A 3CCVA 2CP5A 2E3HA 2KXDA 3I5SA 4M77B 4LVJA 1W2BS 2K3XA 1Q81U 2R58A 4BE2A 3DB3A 3CMAA 1OU8A 2JMCA 5KYWA 3CXCS 3H41A 3M4GA 4L5GA 5GAMg 2ZXFA 4HXJA 5FU6B 1SRYA 4H2SA 2G6FX 1VIFA 1KIKA 1SSHA 1SESA 3URGA 4Z02A 3CCJQ 1RI9A 1QWEA 2MOXA 2OTJQ 2ED1A 2RA2A 4Y92A 4HT4A 2JS2A 3QWYA 1R8OB 4MDXA 1B7YA 1ARKA 3HFVA 3OYHA 2QHUA 2K2VA 4BWAA 1EFWA 5KYXB 4F16A 5IT9E 3MHXA 2XG8D 2ZCFB 4IUQA 4R55A 2QQRA 2JTEA 1G51A 1JO8A 1ZX6A 1YJWA 5CKDA 4D8KA 3HTRA 2KXCA 3QIIA 3OSSC 2FL7A 2QA4T 1ASYA 2E70A 4F7UB 1V29B 3G71A 1KQSA 3NTIA 1YJ9T 2ZCEA 5LJ3f 3CCQT 2PU9B 1VQLA 3PVLA 4YCWA 3OQ5A 1VQNA 4MMKA 1BI2A 1MV3A 2VV5A 1UB4A 1IXDA 1EIYB 4WTOB 1KMMA 1YJWT 4OMOA 4CC7A 4M75F 4QQGA 4RQEA 3OBWA 3TSWA 3G71T 1VQPT 5DY9A 4H2XA 4LD6A 3GIBA 4EMGA 4NL3A 3MPUB 4OVAA 4D6WA 1C0AA 2NWMA 1VQNT 1OV3A 4JLIA 4N4HA 2IY5A 2DETA 4AT1B 2NUZA 4KT0E 2EYYA 1WLPB 5IHKA 3ZL7C 3CEYA 1VQOT 2XK0A 2AKWA 3PCOB 4NL2A 3RIRA 2ZIOA 2Y4YA 2K3BA 4JJNK 2DD4A 4LNPA 3SFMA 3EGXA 4F14A 2O88A 1CKAA 3W3SA 4UC4A 2DQ0A 5KCOA 3A5ZA 3CPWA 1LJOA 5GAOr 3HSBA 3FJPA 3R07A 1YCYA 2ZAEA 2DVJA 3REXA 2M1HA 3E19A 5J3BA 4Z8AA 2ODRC 2LX9A 2VWFA 3NGPA 4M78A 1T0JA 1W1FA 2K6DA 5FWCA 3FC3A 1E6HA 2GBQA 4QW2A 2ATCB 3CCSA 4P72A 1WJSA 1Y07A 2IIMA 1UFFA 5AT1B 1BB9A 2LRQA 4LVIA 3SWNB 3GOXA 3LH5A 1HSQA 2BTTA 5IXFA 2YLBA 3JB9J 2X4JA 3A8HB 4E7SA 2JXBA 3NEMA 4DBFA 3BDLA 3M4YA 1RAIB 1WHKA 1Q7YC 2DJQA 2KE9A 3CCUQ 3CCST 4J8OA 2A08A 4RQFA 1X6GA 3VJPA 1Q86U 4MZMA 1BBUA 2ODRD 5LJ5g 2R57A 2DILA 1M90R 4J6XA 2DK3A 4XU3A 4C92B 2B8AA 1AOJA 4XU2A 5GMKi 1TUDA 4CH6A 1K4US 1NBEB 2KMTA 4PFOA 2JM8A 4M77E 4N4GA 2ZNJA 1UGQB 3IG2A 1EIFA 3TREA 2YRDA 3CCLT 2QASA 1EVLA 3NTKA 3Q1JA 5GAOq 2V26A 1X55A 2VXFA 3CXCP 5KH6A 3CMAQ 1D1BA 1AWOA 1FYNA 5HK0A 3X25B 5I2SA 3JB9I 3CC7A 3QSUA 3FEOA 3HTZA 3HFNA 4EMKA 2BKDN 2CS7A 4P74A 1UHFA 1EVKA 2VC8A 4MZPA 2OTLT 2FZGB 2K4YA 1N5ZA 4ZIBA 4TTVA 5GAN2 2P5IA 2LVMA 1NYFA 4XEMA 5L23A 2ABLA 3EGDA 1IL2A 1YJ9Q 4YTLA 2E10A 1VQ4A 3UATA 2MAMA 5LL6S 4ELYC 1W66A 1E7OA 2E5QA 2CYZB 2VASA 4F7UE 2QEXT 2EQKA 1QVGS 5LJ3h 2QAZA 3F70A 5FWBA 3OW2A 2HBPA 1YJWQ 2CIMA 1D3BA 4CI0C 3REUA 3KFUA 3V7CA 1QVFS 3G71Q 4A4KA 4K11A 2COWA 3OYFA 1D1CA 1VQLQ 4DPGA 11ASA 3GNFB 4M78F 3OB9A 3TEHA 1VQNQ 1VQ9A 2CJAA 2LJ0A 2D6FA 1KD1U 2K5IA 2EYZA 1K9MC 1ZUKA 2DRKA 2FHDA 3HHTB 2C0TA 2YWWA 1NJIU 1Y96A 1OI1A 2CUBA 1QE0A 4F7UA 5IAYA 1WGSA 4X9CA 4HWPA 5CK9A 4PJNA 3QBYA 3CD6A 3HXWA 4PJOF 3RL6A 2ARUA 2DM1A 1WDXA 1Q95G 2C8MA 3VQXA 4QVDA 3VYGA 3QO3A 2EYWA 5GMKe 1VQ9T 3CMEA 2CZ1B 2HQXA 1MMDA 1VQMT 3S3OA 1GBRA 4ZGEB 6AT1B 1JJ2S 4EO4A 2KROA 3LX7A 1D0YA 2RHQB 2L3RA 2V8KA 2CP3A 3UF4A 3UPUA 5GJWB 2CREA 4CS4A 3X26B 2YT6A 2Q7HA 3OYYA 3ULRB 1Y57A 5CKHA 1NLPC 2NS6A 4M75B 2HMAA 2EIFA 4Y91A 2BZ8A 1WU7A 2SEMA 3CMET 1KHIA 1TSFA 5A0GA 4PLIA 1IREB 1ZSZB 3CCSQ 4HWSA 1VQ6A 2ENMA 3EG1A 2FEIA 1QLYA 1BIAA 2O9VA 3EHRA 4HCCA 2ZT6A 3EG9B 1N8RR
chains in the Genus database with same CATH topology
3VQVA 1I5LA 2DTOA 4MMLA 3NELA 4E47A 4LVMA 1ADJA 4C92E 4X34A 1E1OA 1NNHA 3MCAB 1S72A 4JUVA 2E3CA 1Z7NA 2M0OA 3LW5E 3QYHB 1YB3A 2QXFA 3I55A 3MP8A 3DB4A 2QQ9A 3UGQA 2KAFA 1NJ2A 4YRPA 3LC0A 4L87A 5AYFA 3DLLA 3LWIA 4M7DF 1M9SA 4PJOC 2ZTGA 2RHYA 2VGMA 1G3SA 5LJ3d 4MZTA 4G84A 4YCVA 1B7YB 1KOGA 5LJ3e 2ZPIB 4A4EA 2ARTA 1YIJA 2OTJA 3RKWA 4KBMB 1X2HA 4H2WA 2FVUA 3H6ZA 3M54A 1M90C 3UGTA 4JRIA 4PJOG 4PJOD 4XTYA 2P0KA 3IALA 4C5HA 3QZ5B 2D0QB 2AMCA 4O2DA 3X24B 5K1PA 2BUDA 3JCMJ 4P71C 4IUPA 3A74A 4MDWA 4X9DA 4Q15A 3CPWS 1RI0A 4H2XB 3PMTA 4L6V5 2Q5HA 5GAN5 4V2SA 4RG2A 5GAMd 2IY5B 1PSFA 2VXEA 1BI3A 1H4SA 2ZPFB 5GMKm 3JCMg 2AKWB 2DKGA 2V8JA 3ZBDA 4NCXA 3OYCA 3OBYA 2ZINA 2K5LA 3QO8A 3A5ZB 5I21A 1QP2A 2HNIA 3HRKA 1HTTA 4ZTZB 3SDZA 2EQUA 4M7DC 3HKSA 5LJ3j 2XTIA 3DSQA 4BI4A 4M78B 4M75E 2G3RA 3P8YA 5A0LA 3JCMc 1VQ5T 2M16A 4J7FA 3G6EA 2ZZEA 2V8IA 2XKOC 3JCMW 3CPFA 3TEEA 3MO8A 1N9SA 4JDSA 2O01E 2JN0A 4C0DB 4R56A 4BY6C 4H2UA 2RJEA 5L8RE 1VQ7A 3OYJA 4M7DD 1X56A 2PMFA 5GANg 4YRRA 5GAOn 3S6WA 5F5WA 2IG0A 3PTAA 3CMQA 4M7AC 4J6YA 1GXIE 3NTHA 2KSSA 4PKCC 2QQAA 2PVDB 1KG1A 1WQWA 3QO7A 2L8DA 2DO3A 3QNEA 2XGTA 5ELOA 3H8ZA 4C0ZA 5GAMj 1X01A 1PYSA 3HFZA 4OB3B 2QHVA 3OS5A 4EMKB 2CZ7B 2QI2A 1QVPA 5M9OA 2RHZA 3MEVA 3MEAA 4A54A 3HRIA 4M7AG 3L42A 4M7AD 2ZR2A 2LQKA 3M5AA 3M57A 3HXZA 2DAQA 3V8LA 3L2UA 5CQYA 1I81A 2QA4A 5E3IA 1D3BB 4PL6A 4BDZA 3PMIA 1YJ9A 1M5Q1 2R5AA 3CCQA 3A31A 3UWNA 2I4LA 2RHXA 4M7DB 5CR2A 4HVCA 1G3TA 3TEHB 3GF5A 1M90U 4Q6GA 2DD5A 2EJ9A 2EFIA 5FU7C 1Y96B 1IZ6A 4II1A 1VQPA 4HT8A 1KD1C 2JOYA 3CCMT 2KQWA 1NJIC 4BY6B 3OD1A 4P3PA 1OZ3A 3A8LB 4IUUA 2XHCA 4C8QG 4C8QD 1VQOA 2F5TX 2NLUA 3JCMV 4KQEA 1M4ZA 3S3MA 1JJCA 3QO5A 3HFOA 4M78E 2DJZA 4ZN1A 2PVOB 3HPWA 3ME9A 4E7KA 3J80E 3OYNA 3HL8A 4CH4A 1ZQ1A 2VGNA 4YYEA 2GQVA 1SETA 4PJOE 3V7SA 2CGHA 1YBYA 4CRIA 5GAN3 3RKYA 3UDCA 3RACA 2Q7EA 3BW1A 2EKOA 3PZCA 4E51A 1TH7A 4P75C 3VQYA 4ME7A 4BDYA 5GAMf 4J83A 2ALYA 5A2QE 3ASKA 3HXUA 3NETA 4FL6A 2KVQG 4PJOA 1N9WA 4YRTA 2DU5A 4N0AC 4C0FA 1YI2T 1USYC 5K1XA 3CC4A 1KC8C 3CCLA 3UH0A 3L1AA 2RK1A 5KCHA 4YROA 3I7FA 1Y7XA 4JRKA 3JCMQ 2ZT5A 3PIPA 2EWNA 1QF6A 4ZTFA 4J15A 2EJGA 4VUBA 2OTLA 3OYGA 1I8FA 3CC4T 2A3LA 3DKMA 3EFSA 3X20B 2EQMA 1YJNT 4P71A 2RJCA 4Q5WA 2QEXA 2AMCB 1N8RU 4M7DE 3I56T 4BW9A 3MP1A 4JS4A 3HXVA 3QJ6A 2CZ6B 5KE3A 3WXMB 1AHJB 1M1KU 3PIOA 4XTWA 1NYRA 1YITT 5GMKl 3BFMA 4FSXA 4YRFA 2QTXA 4OGEA 4FU6A 4M7DA 1X2GA 1UEBA 2MF2A 1NJ8A 5GAOp 4HWOA 1XOVA 4OB1B 2E64A 3OYAA 3LH0A 1O75A 3QKJA 2ZPEB 2DIGA 2DPPB 1VQMA 3KBGA 4E7IA 3NFCA 4ZTJA 3HXYA 2XDPA 1W2BA 5CO7A 4HCBA 4WF2A 3CXCA 5LJ5f 2E6ZA 5KNNA 1BKBA 3L2WA 2JZ2A 4X5OA 4M7AA 4BE0A 5GAMh 1LNXA 3VV0A 2K57A 4KUDK 2PUKB 2JVVA 2ZT8A 3P8VA 2WSEE 2C06A 1P92A 3J81E 4OLFA 4YRSA 1KMNA 1N9RA 2FB7A 3MEUA 4XQ3A 4EPCA 1B70A 3JCMd 2LCCA 2I4OA 3OA6A 3QTCA 4QVZA 2DEQA 1SERA 4YCUA 3P8TA 2RK2A 2DTHA 1E1TA 4GY5A 3HFZB 1PYSB 4K88A 2E1HA 3IKLA 2RHSA 3OMGA 2DXUA 1RL2A 3RGLA 3JCMX 2DU7A 2DQ3A 4L59A 2IVWA 1GGMA 2DXCA 2ZPBB 3M4QA 1ATIA 3E9FA 1KC8U 4TQDA 3QDRB 5J26A 3EAEA 3OS1A 2PQWA 2LT1A 3C12A 3G7ZA 3IKMB 2L89A 2R5MA 4C8QA 4E7HA 1WLEA 4ZGDB 1KQSS 3LGLA 2I2LA 4K86A 3CCRT 2XDDA 1XTDA 2CKKA 2K3YA 2ZPGB 4TWAA 1E22A 5GANd 4QVCA 2DZCA 3ICAA 1U1TA 1WJRA 4PLLA 3RMQA 1U1SA 2ZZGA 1BBWA 1OYXA 3RERA 3MP6A 3A7UA 3P8BB 5GAN8 4OB2B 3PFSA 5D6XA 1JBMA 2JNGA 1H4TA 4E7JA 3P8HA 1Z7MA 3MQZA 3UT1A 4XTXA 1B8AA 3QUIA 4DOVA 4M7AF 4RCBA 2EYQA 2Y90A 12ASA 3DLMA 3OYDA 2FYKA 1JJCB 3M53A 1WJQA 1K73U 3O8VA 2RI2A 5C53B 1X6OA 3ERRA 4PNOA 2ZR3A 5LJ5h 1G3YA 3EFRA 4LVLA 3GNGA 1WYDA 5GAMe 3KUFA 1Q82U 4FT4A 1EOVA 3FIFA 4E7LA 4P75A 3L4GA 3E1SA 4M77C 1VQ5A 3VUZA 1OZ2A 1Y71A 4OP0A 5FU6C 2I4NA 3OMCA 2RHIA 5IN1A 4P3NA 1BI0A 4XAXB 3OYBA 1VUBA 4N0AA 2ALYB 3JSCA 3BDUA 4IUTA 3PNWC 4YRLA 1USYA 4LDVA 1QVGA 3SB2A 4C8QF 3OYEA 3LWHA 3OYLA 4PJOB 4LDUA 4M77G 5DLOA 4M77D 1QVFA 4H2YA 4TVWA 3CCEA 1VQZA 4H2TA 4KR2A 4XU1A 4UP9A 5HKCA 1EQRA 3QYGB 3G4ST 3L2QA 2RM4A 1BIBA 2XI9A 5CVIA 5C51B 4CS3A 2LDMA 2F69A 5LJ3g 3L2RA 2HAXA 1YFRA 2XU8A 4YRIA 5FRNA 3CCET 2P0LA 1BYMA 3LSSA 3UFGA 1FYFA 5GAOm 2ZPHB 2ZGWA 3A8OB 2OAUA 4CS2A 1W4SA 4F7UG 1L0WA 1K8AU 1G5IA 3JB9G 4UPAA 3OW2S 1JJ2A 4PG3A 2YRVA 2ZNIA 5EG2A 4BI3A 3A32A 1QW1A 1YGBA 3JCMf 4RCCA 1N8RC 1B76A 4PHCA 3CCUT 1H4QA 2KDSA 4LD9K 1H3ZA 4A4HA 2EAYA 4QQDA 2WSFE 3QJYA 3L2VA 5LJ5d 1KHCA 1M1KC 2Y4XA 1LOJA 3SWNC 3HRUA 4OGCA 4C8QC 3CCMA 5LJ5e 4XTVA 5DM7R 2LTOA 4RG8A 2DIQA 3LYIA 3TEGA 4KR3A 4ZN3A 3CCVT 4AH6A 5FROA 2ZT7A 1FX7A 3JRZA 2YHTA 4A53A 4IKFA 1FWZA 3TU4K 4YRGA 3S3NA 3CMAT 3V8JA 3A7AA 4C92C 2C7IA 3MEWA 5CCAA 2X4XA 2VYTA 1NZ9A 4IURA 4XEOA 5GANf 4KUIA 2RH2A 3CC2A 1JRIA 2HD0A 4P73C 4YDQA 2HQEA 3QXEB 2X4YA 2P0QA 2LCLA 1MHNA 1PSEA 1I4K1 4CH3A 1X75C 3INZA 2DVEA 2Q7GA 4C5GA 1JB0E 5CIUA 3AHUA 4M7AB 5C6SA 4H2VA 2GCXA 4LDWA 4ZTUB 3CC2T 1FXXA 4GLKA 1M1FA 3E9IA 4C92G 4C92D 2DXTA 5HK3A 4XTUA 2DDZA 5DLQE 1HXDA 2WACA 1VQLT 4ZGJB 1B70B 3ZFJA 2RO0A 2CZ0B 1NE8A 1YHQA 2P0PA 4HWTA 3FDRA 1YI2A 4FT2A 2EQJA 5LJ5j 2RHSB 4B9WA 4JS5A 3BY7A 4EDUA 1KQ1A 3TCJA 3HXXA 5CKBA 2EL9A 4ELZC 1LYLA 2MMPA 1YHQT 4O5VA 1VIEA 2KK4A 5GMKh 3M58A 3HRTA 4YRQA 4BE1A 4A4FA 3C95A 4C8QB 1NPRA 3VKIA 2O4XA 5HY6A 4J5YA 1G3WA 1YJNA 4YP0A 2Q5IA 2XICA 2L5QA 5FU7B 1M1GA 2F5KA 3JCMh 4WJ3M 1HK9A 3I56A 1UGSB 3M55A 2DTIA 4HWRA 4G85A 1ZHIA 5C52B 1B34A 2RJDA 4LDXA 4TVAA 3G1ZA 4M75C 4OMFB 4KULA 2JTMA 1YITA 2RJFA 2ARSA 1X54A 4XK8E 3FB9A 3JAME 1KQ2A 3P8DA 1J5WA 3A5YA 1M8VA 2E12A 2E41A 2RHUA 4M77A 4OB0B 4M75G 2G4CA 4IUVA 2RI3A 4M75D 3MF1A 3WQZA 5GANh 5ELNA 4FM4B 1K73C 3PT9A 4B9XA 4BD3A 4HA8A 3TUPA 4YRCA 4UP7A 4YRKA 2X4WA 3CC7T 1HC7A 1N6AA 3M56A 3L4GB 4DA4A 4J6WA 2MWOA 5D6YA 1Q82C 5CKFA 2PVGB 3NENA 4M7AE 1VQ4T 4J7IA 2QHTA 5C0MA 4JLGA 5FRMA 4P5NA 3RKXA 2QQSA 1G5HA 2ZZDA 4TQFA 1NJ6A 2BIVA 4BACA 2E6NA 1BI1A 3OYMA 5GAN7 1H641 2CJ9A 3X28B 2MI6A 4LDYA 2LT4A 3RMSA 2A8EA 4YRMA 1EIYA 3C94A 1XQHA 4BB7A 1VQ8A 5J39A 3L2ZA 2A7YA 4TVYA 4YRJA 3RESA 3QPHA 2EJFA 3CD6T 1RIQA 2X35A 2LQ8A 4RDXA 5GAOl 4NS5A 2LC4A 4H02A 3M59A 4A4GA 2RI5A 3JCMe 1VQ8T 3PCOA 4C8QE 4HCZA 2QHSA 4BUGA 3WVEB 3CCRA 2WSCE 4DOWA 1NJ5A 3LLRA 3JCMb 1K8AC 2PUOB 3HRSA 4M77F 3A7RA 1G5VA 5HGQA 2DZ9A 4YPFA 4HT9A 3ZEHA 1UGRB 1VQ6T 3SWNA 1Q7YU 4M78C 2GF7A 3HP9A 1SSFA 1VQKA 4P72C 3BJUA 4RMFA 2E5AA 4UP8A 4C5IA 3RF1A 5GAN6 5GANe 3N5BB 4OF1A 2I4MA 5GMKj 1Q81C 2QQBA 1S72T 3HY0A 1NYQA 4C0DC 5CKEA 4C92A 3VYHB 2QDYB 3QHSA 3T9NA 4NOYA 2RD1A 3I55T 2J3LA 1VQKT 3VBBA 4P73A 3ER0A 3C4SA 3OS2A 2XIDA 3FRNA 4M78G 4M78D 4F7UF 1U8RA 4CH5A 3JB9F 5A0DA 4EMHA 1H4VB 1N27A 3CCJA 4TVRA 4QQ6A 3QZ9B 3LSQA 4K87A 3GLXA 3V7RA 1YFSA 2JUFA 2GFAA 3CBOA 2D9TA 5D6WA 4HKEA 2JTFA 3JB9H 1YIJT 4DQ2A 4YREA 3OYKA 4XTZA 1QP3A 3CBPA 3CCJT 1UGPB 2OTJT 3SD4A 2M9UA 4EMKC 3CBMA 4P74C 1NPPA 1WQ7A 2J3MA 3J7AF 3WVDB 2YLCA 3M9QA 3KXTA 4C5EA 2E65A 4EX5A 1NJ1A 2H3JA 3GPLA 1K9MU 4ATOA 3A8MB 3E9HA 5GANj 1O9SA 5CQXA 1WNLA 1XNIA 3JCMP 2VUBA 3G4SA 3LGFA 3E9GA 2KY9A 1MGQA 4Y28E 3VQWA 4FIBA 4XU0A 3FLGA 4JRPA 3MEYA 2GFUA 2AHJB 2O4XB 4LVKA 3PGGA 4WI1A 3VU3C 4RKUE 3GP8A 2MWPA 4BI8B 4C92F 2XD0A 4YRNA 2RHQA 3VUBA 3OYIA 5I2MA 1WPYA 4O6JA 4M7DG 4RMOA 3OY9A 5FLXE 1YFTA 1ZBXA 2ZIMA 4C0GA 1ADYA 3M4PA 2K5FA 4M75A 2CJBA 1DJ7B 5KE2A 3G6ET 3QG1A 5CAIA 2LNVA 1Q86C 1B34B 5GAN4 4LNSA 2XDBA 4TVAB 3CCUA 1E24A 3JB9D 3OS0A 4JRQA 2PMEA 3RUXA 3R6OA 1VQ7T 4P3OA 3META 2ZZFA 4WJ4A 4N4IA 3A8GB 2P4TA 3OSVA 3V8KA 3MF2A 1ASZA 2RB6A 2DXBA 3HY1A 3CCVA 4M77B 4LVJA 1W2BS 2K3XA 1Q81U 2R58A 4BE2A 3DB3A 3CMAA 3CXCS 3M4GA 4L5GA 5GAMg 2ZXFA 5FU6B 1SRYA 4H2SA 1VIFA 1SESA 3URGA 4Z02A 2RA2A 4HT4A 1R8OB 4MDXA 1B7YA 3HFVA 3OYHA 2QHUA 2K2VA 4BWAA 1EFWA 5IT9E 3MHXA 2XG8D 2ZCFB 4IUQA 4R55A 2QQRA 1G51A 1YJWA 5CKDA 3QIIA 3OSSC 2FL7A 2QA4T 1ASYA 2E70A 4F7UB 1V29B 3G71A 1KQSA 3NTIA 1YJ9T 2ZCEA 5LJ3f 3CCQT 2PU9B 1VQLA 4YCWA 3OQ5A 1VQNA 4MMKA 1BI2A 2VV5A 1UB4A 1EIYB 1KMMA 1YJWT 4M75F 4QQGA 4RQEA 3OBWA 3G71T 1VQPT 5DY9A 4H2XA 4LD6A 3GIBA 4EMGA 4NL3A 4OVAA 4D6WA 1C0AA 1VQNT 4JLIA 4N4HA 2IY5A 4KT0E 3CEYA 1VQOT 2XK0A 2AKWA 3PCOB 4NL2A 3RIRA 2ZIOA 2Y4YA 4JJNK 2DD4A 3SFMA 3W3SA 4UC4A 2DQ0A 5KCOA 3A5ZA 3CPWA 1LJOA 5GAOr 3HSBA 3FJPA 3R07A 1YCYA 3REXA 2M1HA 3E19A 5J3BA 2ODRC 2LX9A 4M78A 3FC3A 4QW2A 3CCSA 4P72A 1WJSA 1Y07A 2LRQA 4LVIA 3SWNB 3GOXA 2YLBA 3JB9J 2X4JA 3A8HB 3NEMA 3BDLA 3M4YA 1Q7YC 3CCST 4J8OA 4RQFA 3VJPA 1Q86U 4MZMA 1BBUA 2ODRD 5LJ5g 2R57A 4J6XA 2DK3A 4XU3A 4C92B 2B8AA 4XU2A 5GMKi 4CH6A 2KMTA 4M77E 4N4GA 2ZNJA 1UGQB 3IG2A 1EIFA 3TREA 3CCLT 1EVLA 3NTKA 3Q1JA 5GAOq 1X55A 2VXFA 5KH6A 5HK0A 3X25B 5I2SA 3JB9I 3CC7A 3QSUA 3FEOA 3HTZA 3HFNA 4EMKA 2BKDN 2CS7A 4P74A 1EVKA 2VC8A 2OTLT 4MZPA 2K4YA 4ZIBA 4TTVA 5GAN2 2P5IA 2LVMA 4XEMA 1IL2A 4YTLA 2E10A 1VQ4A 2MAMA 5LL6S 4ELYC 1W66A 2E5QA 2CYZB 4F7UE 2QEXT 2EQKA 1QVGS 5LJ3h 3F70A 3OW2A 2HBPA 2CIMA 1D3BA 4CI0C 3REUA 3KFUA 3V7CA 1QVFS 4A4KA 3OYFA 4DPGA 11ASA 3GNFB 4M78F 3OB9A 3TEHA 1VQ9A 2CJAA 2D6FA 1KD1U 2K5IA 1K9MC 2FHDA 3HHTB 1NJIU 1Y96A 1OI1A 1QE0A 4F7UA 5IAYA 1WGSA 4X9CA 4HWPA 5CK9A 3QBYA 3CD6A 3HXWA 4PJOF 3RL6A 2ARUA 2C8MA 3VQXA 4QVDA 3VYGA 3QO3A 5GMKe 1VQ9T 3CMEA 2CZ1B 2HQXA 1VQMT 3S3OA 4ZGEB 1JJ2S 4EO4A 3LX7A 2RHQB 2L3RA 2V8KA 3UPUA 4CS4A 3X26B 2Q7HA 3OYYA 5CKHA 2NS6A 4M75B 2EIFA 4Y91A 1WU7A 3CMET 1KHIA 5A0GA 4PLIA 1IREB 4HWSA 1VQ6A 1BIAA 4HCCA 2ZT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A7A A;  3JCM P;  3VQV A;  4C92 C;  2C7I A;  4P71 A;  1I5L A;  2DTO A;  4MML A;  3NEL A;  4XEO A;  5GAN f;  1ADJ A;  4C92 E;  1JRI A;  1MGQ A;  1E1O A;  4P73 C;  4YDQ A;  2AMC B;  1NNH A;  3VQW A;  4M7D E;  4JUV A;  2E3C A;  1Z7N A;  4BW9 A;  4XU0 A;  3HXV A;  1I4K 1;  1YB3 A;  4CH3 A;  3INZ A;  2Q7G A;  2DVE A;  3MEY A;  3PGG A;  4WI1 A;  3VU3 C;  3AHU A;  3UGQ A;  4M7A B;  4H2V A;  1NJ2 A;  4YRP A;  3LC0 A;  4ZTU B;  4C92 F;  4L87 A;  4XTW A;  1NYR A;  4YRN A;  3E9I A;  5GMK l;  2RHQ A;  4C92 G;  4C92 D;  2DXT A;  4M7D F;  3BFM A;  1WPY A;  4PJO C;  2ZTG A;  5LJ3 d;  4XTU A;  4M7D G;  4YRF A;  1YFT A;  2DDZ A;  2ZIM A;  1HXD A;  2QTX A;  4G84 A;  4YCV A;  1ADY A;  3M4P A;  4M75 A;  4M7D A;  1B70 B;  1B7Y B;  1KOG A;  2CJB A;  5LJ3 e;  1X2G A;  1NJ8 A;  5GAO p;  4HWO A;  5CAI A;  2E64 A;  2ART A;  1B34 B;  5GAN 4;  4LNS A;  4HWT A;  4TVA B;  1E24 A;  3RKW A;  3JB9 D;  2PME A;  3RUX A;  3HXY A;  5LJ5 j;  2RHS B;  4P3O A;  1X2H A;  3BY7 A;  4H2W A;  1KQ1 A;  2ZZF A;  4WJ4 A;  3HXX A;  4JRI A;  4PJO G;  3UGT A;  4PJO D;  4XTY A;  4WF2 A;  5LJ5 f;  2EL9 A;  3IAL A;  1LYL A;  3V8K A;  3MF2 A;  1ASZ A;  2RB6 A;  2AMC A;  4O2D A;  5K1P A;  3HY1 A;  5GMK h;  4YRQ A;  3JCM J;  4P71 C;  3A74 A;  5KNN A;  4X9D A;  4C8Q B;  4M77 B;  4Q15 A;  4X5O A;  4H2X B;  4J5Y A;  4M7A A;  2Q5H A;  5GAM h;  1LNX A;  5GAN 5;  4V2S A;  3M4G A;  5GAM g;  2ZXF A;  1SRY A;  2K57 A;  4YP0 A;  2Q5I A;  4H2S A;  5GAM d;  2IY5 B;  2VXE A;  1SES A;  1H4S A;  2ZT8 A;  3JCM h;  5GMK m;  3P8V A;  2RA2 A;  4WJ3 M;  3JCM g;  4OLF A;  1HK9 A;  2AKW B;  4YRS A;  1KMN A;  2DKG A;  1N9R A;  2DTI A;  2FB7 A;  4XQ3 A;  1B70 A;  1B7Y A;  3HFV A;  4HWR A;  3JCM d;  2I4O A;  3QTC A;  2QHU A;  4NCX A;  4G85 A;  4BWA A;  1EFW A;  2ZIN A;  2DEQ A;  3QO8 A;  1SER A;  5C52 B;  4YCU A;  5I21 A;  1B34 A;  3P8T A;  2HNI A;  3HRK A;  1HTT A;  4ZTZ B;  2DTH A;  1E1T A;  4TVA A;  3G1Z A;  1G51 A;  4M75 C;  4M7D C;  3HFZ B;  1PYS B;  4K88 A;  2E1H A;  5LJ3 j;  2XTI A;  3DSQ A;  3IKL A;  2RHS A;  4M78 B;  4M75 E;  2DXU A;  1ASY A;  3P8Y A;  3JCM X;  2ARS A;  3RGL A;  4F7U B;  2DU7 A;  2DQ3 A;  2ZCE A;  1X54 A;  5LJ3 f;  1GGM A;  4YCW A;  3M4Q A;  3JCM c;  3FB9 A;  1ATI A;  4MMK A;  2ZZE A;  1KQ2 A;  4TQD A;  1J5W A;  3A5Y A;  3JCM W;  1M8V A;  1N9S A;  1EIY B;  1KMM A;  2JN0 A;  2E41 A;  4M75 F;  4H2U A;  3IKM B;  4C8Q A;  4M77 A;  4RQE A;  4M75 G;  2G4C A;  3MF1 A;  4M75 D;  1WLE A;  4M7D D;  1X56 A;  5DY9 A;  2PMF A;  4H2X A;  3WQZ A;  2I2L A;  5GAN h;  4K86 A;  3GIB A;  5ELN A;  4EMG A;  4NL3 A;  5GAN g;  4YRR A;  4HA8 A;  5GAO n;  3TUP A;  4YRC A;  4TWA A;  1E22 A;  4UP7 A;  1C0A A;  5GAN d;  4YRK A;  4JLI A;  4QVC A;  5F5W A;  1HC7 A;  2IY5 A;  2DZC A;  3L4G B;  3ICA A;  4J6W A;  1U1T A;  1U1S A;  3CMQ A;  4M7A C;  4J6Y A;  2AKW A;  2ZZG A;  1BBW A;  4NL2 A;  3PCO B;  3RIR A;  3NEN A;  2ZIO A;  3W3S A;  4M7A E;  1WQW A;  3RER A;  3A7U A;  2DQ0 A;  3A5Z A;  5GAN 8;  3QO7 A;  3QNE A;  1LJO A;  5GAO r;  2XGT A;  3HSB A;  3FJP A;  2QHT A;  3R07 A;  1YCY A;  5ELO A;  1JBM A;  5GAM j;  3REX A;  1H4T A;  1X01 A;  1PYS A;  3HFZ A;  2QHV A;  2ODR C;  1Z7M A;  3RKX A;  4M78 A;  4XTX A;  1B8A A;  4EMK B;  3QUI A;  1G5H A;  4TQF A;  4P72 A;  1NJ6 A;  4M7A F;  4RCB A;  4A54 A;  2Y90 A;  3HRI A;  12AS A;  3SWN B;  4M7A G;  5GAN 7;  4M7A D;  1H64 1;  2CJ9 A;  2FYK A;  2YLB A;  2ZR2 A;  1JJC B;  3JB9 J;  3HXZ A;  4YRM A;  1EIY A;  3NEM A;  3V8L A;  3L2Z A;  4TVY A;  5C53 B;  3ERR A;  3RES A;  4YRJ A;  1I81 A;  4PNO A;  2ZR3 A;  4RQF A;  5LJ5 h;  2EJF A;  3EFR A;  1BBU A;  2ODR D;  5LJ5 g;  1WYD A;  1D3B B;  5GAM e;  1RIQ A;  5E3I A;  4J6X A;  4RDX A;  1M5Q 1;  4XU3 A;  4C92 B;  5GAO l;  1EOV A;  4XU2 A;  3A31 A;  3FIF A;  5GMK i;  4H02 A;  2I4L A;  4P75 A;  4M7D B;  3L4G A;  4CH6 A;  4M77 C;  3JCM e;  4HVC A;  3TEH B;  3PCO A;  4OP0 A;  4Q6G A;  4C8Q E;  4M77 E;  2ZNJ A;  2I4N A;  4P3N A;  2EJ9 A;  3IG2 A;  2QHS A;  1Y96 B;  1EVL A;  5GAO q;  4N0A A;  4HT8 A;  2ALY B;  3BDU A;  1X55 A;  2VXF A;  1NJ5 A;  4YRL A;  3JCM b;  1USY A;  3JB9 I;  3QSU A;  3HTZ A;  3HFN A;  4EMK A;  3OD1 A;  3SB2 A;  4C8Q F;  4P3P A;  4P74 A;  4M77 F;  4PJO B;  3A7R A;  1EVK A;  2VC8 A;  4C8Q G;  5HGQ A;  2DZ9 A;  4M77 G;  4C8Q D;  4HT9 A;  4M77 D;  4YPF A;  4ZIB A;  4TTV A;  4KQE A;  3JCM V;  5GAN 2;  2P5I A;  3SWN A;  4XEM A;  4H2Y A;  4TVW A;  1VQZ A;  4H2T A;  4KR2 A;  1IL2 A;  4M78 C;  4XU1 A;  4UP9 A;  1JJC A;  3QO5 A;  2E10 A;  1EQR A;  3HFO A;  4P72 C;  3BJU A;  4RMF A;  4M78 E;  2E5A A;  2DJZ A;  1W66 A;  2RM4 A;  4UP8 A;  1BIB A;  3RF1 A;  4F7U E;  5LJ3 h;  5GAN 6;  5C51 B;  4CS3 A;  1YFR A;  5LJ3 g;  5GAN e;  2CIM A;  1D3B A;  2I4M A;  4CH4 A;  5GMK j;  3REU A;  3KFU A;  3V7C A;  4YRI A;  3HY0 A;  1NYQ A;  4C92 A;  2P0L A;  3LSS A;  4YYE A;  3QHS A;  1SET A;  3UFG A;  4PJO E;  4NOY A;  1FYF A;  2RD1 A;  5GAO m;  2J3L A;  3V7S A;  4DPG A;  2CGH A;  3VBB A;  4P73 A;  11AS A;  4M78 F;  5GAN 3;  3RKY A;  3TEH A;  2ZGW A;  4M78 G;  3RAC A;  4M78 D;  4F7U F;  2CJA A;  2Q7E A;  3BW1 A;  4CH5 A;  3JB9 F;  4CS2 A;  4F7U G;  4EMH A;  3PZC A;  1H4V B;  4E51 A;  1TH7 A;  1L0W A;  4P75 C;  1G5I A;  4UPA A;  3JB9 G;  3VQY A;  1Y96 A;  4PG3 A;  3LSQ A;  1QE0 A;  4F7U A;  5GAM f;  4K87 A;  2ZNI A;  3V7R A;  4X9C A;  2ALY A;  4HWP A;  3HXU A;  3HXW A;  3A32 A;  4PJO F;  1YFS A;  3RL6 A;  2ARU A;  1YGB A;  2C8M A;  3JCM f;  3VQX A;  4QVD A;  3QO3 A;  4RCC A;  3JB9 H;  3NET A;  4PJO A;  1N9W A;  5GMK e;  4YRT A;  2DU5 A;  4N0A C;  1B76 A;  4PHC A;  4DQ2 A;  4YRE A;  4XTZ A;  1H4Q A;  4EO4 A;  1USY C;  5K1X A;  2EAY A;  2RHQ B;  4EMK C;  4P74 C;  3UH0 A;  4CS4 A;  3L1A A;  5LJ5 d;  2Q7H A;  1WQ7 A;  1LOJ A;  2J3M A;  4M75 B;  3SWN C;  4C8Q C;  4YRO A;  3I7F A;  4Y91 A;  1WU7 A;  4JRK A;  5LJ5 e;  3JCM Q;  2ZT5 A;  2YLC A;  4XTV A;  2EWN A;  1QF6 A;  3TEG A;  4KR3 A;  4AH6 A;  4J15 A;  2ZT7 A;  2E65 A;  4EX5 A;  2EJG A;  1NJ1 A;  2YHT A;  4A53 A;  4HWS A;  1I8F A;  3E9H A;  4YRG A;  1BIA A;  5GAN j;  3EFS A;  2ZT6 A;  3V8J A;  1WNL A; 
#chains in the Genus database with same CATH topology
 3REB B;  3VQV A;  1I5L A;  2DBK A;  2DTO A;  4MML A;  3NEL A;  4E47 A;  1WYX A;  4LVM A;  2KT8 A;  3SHW A;  4A63 B;  2K2M A;  1UG1 A;  2EW3 A;  1ADJ A;  4RTY A;  4C92 E;  4X34 A;  1E1O A;  1LVK A;  1MMN A;  3EH1 A;  4GLM A;  1NNH A;  2A37 A;  1UTI A;  1TG0 A;  3MCA B;  1S72 A;  4JUV A;  1M1K R;  2E3C A;  1Z7N A;  1TWB A;  2M0O A;  3LW5 E;  3QYH B;  2HCK A;  1YB3 A;  2QXF A;  3I55 A;  2MIO A;  3MP8 A;  3DB4 A;  2QQ9 A;  3UGQ A;  2KAF A;  1NJ2 A;  5KYW B;  4YRP A;  3LC0 A;  3NMZ C;  4L87 A;  5AYF A;  2C0I A;  3DLL A;  3LWI A;  4M7D F;  3IQL A;  1M9S A;  4PJO C;  2ZTG A;  2RHY A;  2VGM A;  1G3S A;  5LJ3 d;  4MZT A;  4OMN A;  2O9S A;  4G84 A;  1WFW A;  4YCV A;  2LX7 A;  1B7Y B;  1KOG A;  5LJ3 e;  4FYY B;  2ZPI B;  4A4E A;  1KK7 A;  2ART A;  1YIJ A;  3CC7 Q;  2I0N A;  1OPK A;  3U23 A;  3M0S A;  4RTX A;  1WXB A;  2OTJ A;  3RKW A;  5I11 A;  4JZ3 A;  2HSE B;  4KBM B;  1X2H A;  3A1P A;  4H2W A;  2PNI A;  2FVU A;  1RLP C;  2D1X A;  3H6Z A;  3M54 A;  1M90 C;  4J9F A;  3UGT A;  4JRI A;  4PJO G;  4PJO D;  4XTY A;  3VS2 A;  1R0C B;  2P0K A;  1QVG P;  2FZC B;  3IAL A;  4C5H A;  3QZ5 B;  2D0Q B;  2AMC A;  4O2D A;  3X24 B;  5K1P A;  2BUD A;  4DBH A;  1QVF P;  3JCM J;  4P71 C;  4IUP A;  3A74 A;  2LCS A;  4MDW A;  4X9D A;  1M2V A;  1TOV A;  4Q15 A;  3CPW S;  1RI0 A;  4OMQ A;  4H2X B;  3PMT A;  4L6V 5;  2Q5H A;  2KNB B;  5GAN 5;  4V2S A;  2OJ2 A;  3QDF A;  4RUG A;  1VQ9 Q;  1OEB A;  2QK0 A;  4RG2 A;  5GAM d;  2IY5 B;  1PSF A;  2VXE A;  1BI3 A;  1H4S A;  2ZPF B;  5IHN A;  5GMK m;  3M0P A;  3JCM g;  1AT1 B;  2AKW B;  1D0Z A;  2DKG A;  2V8J A;  3ZBD A;  3CD6 Q;  4QKU A;  4NCX A;  3EGX B;  3OYC A;  3OBY A;  2ZIN A;  2K5L A;  3QO8 A;  1M27 C;  3A5Z B;  2X9H A;  5I21 A;  1QP2 A;  2HNI A;  3HRK A;  1HTT A;  4ZTZ B;  3SDZ A;  2EQU A;  2W10 A;  3CME Q;  4M7D C;  3HKS A;  1JJ2 P;  5LJ3 j;  4KGZ B;  2XTI A;  3DSQ A;  4BI4 A;  2PZ1 A;  4M78 B;  4FW1 A;  1KC8 R;  1NEG A;  4M75 E;  2G3R A;  3P8Y A;  2FPD A;  2HL5 C;  4J9B A;  4J9I A;  4E6R A;  5A0L A;  3JCM c;  1VQ5 T;  1YN8 A;  2M16 A;  4J7F A;  3G6E A;  2ZZE A;  2V8I A;  2XKO C;  1GFC A;  3JCM W;  3CPF A;  3TEE A;  3MO8 A;  1N9S A;  4JDS A;  2O01 E;  2JN0 A;  1ZA1 B;  4C0D B;  4R56 A;  4AFQ C;  4BY6 C;  1H3H A;  1WHM A;  4H2U A;  2RJE A;  5L8R E;  2KYB A;  1H92 A;  1VQ6 Q;  1T0H A;  1VQ7 A;  3OYJ A;  4M7D D;  3RDV A;  1X56 A;  2PMF A;  2C0O A;  5GAN g;  2JT4 A;  4YRR A;  5GAO n;  1Z9Z A;  1AWW A;  1ZA2 B;  3S6W A;  5F5W A;  2IG0 A;  2KGT A;  3EGU A;  1UGV A;  2HL3 A;  3PTA A;  3CMQ A;  2QDL A;  4M7A C;  4J6Y A;  1Z9Q A;  1GXI E;  3NTH A;  1QKX A;  2KSS A;  4PKC C;  5IHI A;  2QQA A;  2RF0 A;  2PVD B;  1KG1 A;  1K9A A;  1S72 Q;  1WQW A;  3QO7 A;  2L8D A;  2DO3 A;  3QNE A;  3A98 A;  2XGT A;  2M0Y A;  2YUO A;  5ELO A;  3H8Z A;  4C0Z A;  5GAM j;  1X01 A;  1PYS A;  3HFZ A;  4OB3 B;  2QHV A;  1X2Q A;  1SG5 A;  1TS9 A;  2J6K A;  2EGC A;  3OS5 A;  4EMK B;  2EQI A;  2CZ7 B;  2QI2 A;  5IH2 A;  1BCO A;  4PFP A;  1QVP A;  5M9O A;  2RHZ A;  3MEV A;  3MEA A;  4A54 A;  3HRI A;  4M7A G;  3L42 A;  4M7A D;  3EGD B;  2ZR2 A;  2DFU A;  2LQK A;  2CP0 A;  3M5A A;  3M57 A;  3VS0 A;  3HXZ A;  4KGX B;  2DAQ A;  3V8L A;  1K1Z A;  1YIJ Q;  4ZNX A;  3L2U A;  5CQY A;  1I81 A;  2QA4 A;  5E3I A;  1D3B B;  4PL6 A;  3THK A;  2EPD A;  4BDZ A;  3PMI A;  1M5Q 1;  2R5A A;  2KYM A;  1YJ9 A;  3CCQ A;  3A31 A;  3UWN A;  2I4L A;  2RHX A;  4M7D B;  5CR2 A;  2OI3 A;  1G83 A;  2LP5 A;  4HVC A;  1G3T A;  3TEH B;  1R0B G;  3GF5 A;  1M90 U;  4Q6G A;  3QWX X;  2RQT A;  1IRX A;  2DD5 A;  2EJ9 A;  2EFI A;  2DNU A;  1CKB A;  1I5O B;  5FU7 C;  1Y96 B;  1AD5 A;  1IZ6 A;  4PFZ A;  4II1 A;  1VQP A;  1ZSG A;  4HT8 A;  3H0I A;  1KD1 C;  2JOY A;  2SRC A;  3CCM T;  2KQW A;  1NJI C;  3EG3 A;  1SHF A;  2EGA A;  4BY6 B;  3OD1 A;  4P3P A;  2L2P A;  1OZ3 A;  3A8L B;  1WZO A;  4IUU A;  2XHC A;  4C8Q G;  2F2V A;  4C8Q D;  2BZX A;  1VQO A;  1MUZ A;  2F5T X;  2NLU A;  3JCM V;  4KQE A;  1M4Z A;  4OML A;  3S3M A;  2EYX A;  1C0M A;  4RTU A;  1JJC A;  3QO5 A;  4AG1 C;  3HFO A;  4M78 E;  2DJZ A;  3G1J A;  4ZN1 A;  2PVO B;  3VS5 A;  3HPW A;  2M02 A;  3ME9 A;  2VKN A;  4E7K A;  3J80 E;  2MPX C;  3D7S B;  3OYN A;  3HL8 A;  3E2U A;  4CH4 A;  1ZQ1 A;  2VGN A;  1EX4 A;  2EGE A;  4YYE A;  2GQV A;  1SET A;  4PJO E;  1K8A R;  3V7S A;  2CGH A;  1YBY A;  4CRI A;  5GAN 3;  3RKY A;  3UDC A;  1UDL A;  1UE9 A;  4LN2 A;  4AFU C;  3G6E Q;  3RAC A;  2Q7E A;  3BW1 A;  2EKO A;  3PZC A;  4E51 A;  4HVV A;  1TH7 A;  4P75 C;  3VQY A;  4ME7 A;  8ATC B;  1ABQ A;  5KYY B;  4BDY A;  1BCM A;  1PC0 A;  5GAM f;  4J83 A;  2ALY A;  2COY A;  5A2Q E;  3ASK A;  1VQ7 Q;  3HXU A;  2E3I A;  2HQH A;  1OX9 A;  1F1B B;  1JU5 C;  3NET A;  4FL6 A;  2KVQ G;  4PJO A;  1A0N B;  4B6M A;  1N9W A;  4YRT A;  2JJ9 A;  4HVU A;  2DU5 A;  4N0A C;  4C0F A;  4Z88 A;  3TSZ A;  4AFZ C;  2DL3 A;  1YI2 T;  1RAB B;  1USY C;  2RMO A;  5K1X A;  1AWX A;  3CC4 A;  2KI7 A;  1KC8 C;  3CCL A;  1H8K A;  2DLP A;  3UH0 A;  3L1A A;  1OUL A;  2RK1 A;  1CSK A;  5KCH A;  2DBM A;  2O31 A;  5IXB A;  1MMG A;  4YRO A;  2COZ A;  1Y7X A;  3I7F A;  4JRK A;  1JXO A;  3JCM Q;  2ZT5 A;  3PIP A;  4CC3 A;  2EWN A;  1QF6 A;  4ZTF A;  4J15 A;  4FW2 A;  2EJG A;  4VUB A;  2OTL A;  2FRY A;  3OYG A;  1B07 A;  2ROT A;  1UHC A;  1I8F A;  3CC4 T;  2A3L A;  1W2B P;  3DKM A;  3EFS A;  3X20 B;  2EQM A;  1YJN T;  4P71 A;  5I22 A;  2K9G A;  2RJC A;  4Q5W A;  1OOT A;  2QEX A;  2DL4 A;  2O2O A;  1NYG A;  1FMW A;  2AMC B;  1N8R U;  4M7D E;  3I56 T;  2LNH B;  3JV3 A;  2QA4 Q;  4BW9 A;  3MP1 A;  4JS4 A;  2H3E B;  3HXV A;  1JXM A;  3QJ6 A;  3CCQ Q;  2CZ6 B;  5KE3 A;  1M2V B;  3WXM B;  1AHJ B;  2CP2 A;  1M1K U;  3PIO A;  3MJX A;  2ED0 A;  4XTW A;  1NYR A;  1YIT T;  2V1Q A;  5GMK l;  3BFM A;  1ABO A;  4FSX A;  4YRF A;  2KBT A;  2QTX A;  4OGE A;  1VQP Q;  1PD1 A;  4FU6 A;  4M7D A;  1PNJ A;  1X2G A;  1UEB A;  2MF2 A;  1NJ8 A;  5GAO p;  4HWO A;  1XOV A;  4OB1 B;  2E64 A;  2NUP A;  4JZ4 A;  3OYA A;  3NPF A;  3LH0 A;  1O75 A;  3QKJ A;  1V76 A;  1QQJ A;  1LPL A;  2ZPE B;  2DIG A;  2DPP B;  1VQM A;  3KBG A;  4E7I A;  3NFC A;  1VQO Q;  2MCN A;  4ZTJ A;  3HXY A;  1WXT A;  2FG0 A;  1T3S A;  2NUT A;  2XDP A;  3EG2 A;  1W2B A;  1YWO A;  7AT1 B;  5CO7 A;  1X69 A;  4HCB A;  1VYV A;  4WF2 A;  3CXC A;  5LJ5 f;  1QWF A;  2VVK A;  1XJW B;  4RTW A;  1BK2 A;  1GCQ C;  1G2B A;  2E6Z A;  4CC2 A;  2DMO A;  5KNN A;  1BKB A;  3I35 A;  1SKU B;  3L2W A;  1ZUY A;  1BU1 A;  2JZ2 A;  1YP5 A;  1ZBJ A;  4X5O A;  4M7A A;  4BE0 A;  5GAM h;  1LNX A;  1E6G A;  1VYT A;  4KH1 B;  2CUD A;  3VV0 A;  3GBQ A;  2K57 A;  4KUD K;  3O5Z A;  5EC7 A;  2PUK B;  2XMF A;  2JVV A;  2RN8 A;  2ZT8 A;  5KYU A;  3P8V A;  2WSE E;  2C06 A;  1P92 A;  3J81 E;  4OLF A;  1AVZ C;  4YRS A;  1KMN A;  4J9E A;  1N9R A;  2FB7 A;  2YXY A;  3MEU A;  4XQ3 A;  2KT1 A;  4EPC A;  1B70 A;  3JCM d;  2LCC A;  2I4O A;  3OA6 A;  3QTC A;  4QVZ A;  2DEQ A;  1SER A;  4YCU A;  3P8T A;  2RK2 A;  2DTH A;  1E1T A;  4GY5 A;  4R0K A;  1PKS A;  3HFZ B;  9ATC B;  1PYS B;  2E1H A;  5KYY A;  4K88 A;  3IKL A;  2RHS A;  2YUP A;  1TXQ A;  3OMG A;  2DXU A;  4DEY A;  1B7T A;  1RL2 A;  3RGL A;  3JCM X;  2DU7 A;  2DQ3 A;  3CC4 Q;  3CCL Q;  4L59 A;  2IVW A;  1GGM A;  2DXC A;  2ZPB B;  3M4Q A;  1ATI A;  3E9F A;  1RUW A;  1KC8 U;  4IIO A;  4TQD A;  2E5K A;  3QDR B;  1YCS B;  5J26 A;  2F2X A;  3EAE A;  2CT4 A;  3OS1 A;  2PQW A;  1M30 A;  2LT1 A;  3C12 A;  1MV0 B;  3G7Z A;  3IKM B;  2OTL Q;  1NEB A;  2L89 A;  2R5M A;  4C8Q A;  4E7H A;  4ZGD B;  1WLE A;  2DEU A;  4PJJ A;  3LGL A;  1KQS S;  2I2L A;  4K86 A;  4F04 B;  3CCR T;  2XDD A;  2AZS A;  1XTD A;  2CKK A;  2CT3 A;  1IHV A;  1M3A A;  2K3Y A;  2ZPG B;  1PCX A;  4TWA A;  3H9N A;  1E22 A;  5GAN d;  4QVC A;  1I1J A;  2DZC A;  3ICA A;  1U1T A;  1WJR A;  4PLL A;  3RMQ A;  1U1S A;  4FSS A;  2QEX Q;  2ZZG A;  1BBW A;  2MYS A;  1OYX A;  2F1L A;  2D0N A;  1WX6 A;  3RER A;  3MP6 A;  1X43 A;  3A7U A;  3P8B B;  5GAN 8;  5D7U A;  2LQW A;  1U3O A;  4OB2 B;  4OMP A;  3PFS A;  4GBQ A;  4AG2 C;  5D6X A;  1JBM A;  2JNG A;  1GBQ A;  1H4T A;  4E7J A;  3P8H A;  4DBR A;  1Z7M A;  3MQZ A;  3UT1 A;  4XTX A;  1B8A A;  1M2O A;  3QUI A;  2LJ3 A;  3RBB B;  4DOV A;  2AKK A;  4M7A F;  4RCB A;  1QCN A;  2EYQ A;  4JPB W;  2Y90 A;  4RTZ A;  12AS A;  3KFV A;  2ROL A;  3DLM A;  3OYD A;  2FYK A;  1K0S A;  4JJC A;  4D8D A;  1JJC B;  3M53 A;  3VS7 A;  1M8M A;  1SRM A;  1WJQ A;  1K73 U;  1HJD A;  2CP7 A;  3O8V A;  2RI2 A;  4KH0 B;  2YUN A;  5C53 B;  1X6O A;  1VQM Q;  3ERR A;  4PNO A;  2ZR3 A;  5LJ5 h;  1IO6 A;  1G3Y A;  3EFR A;  4LVL A;  3GNG A;  1WYD A;  5GAM e;  3KUF A;  5GJV B;  1Q82 U;  4FT4 A;  1EOV A;  3CQT A;  3FIF A;  4E7L A;  4P75 A;  3L4G A;  3E1S A;  4M77 C;  1VQ5 A;  2L3S A;  4FYV B;  3VUZ A;  1OZ2 A;  2AK5 A;  1Y71 A;  4OP0 A;  2A0F B;  2J7I A;  5FU6 C;  2I4N A;  3OMC A;  1QMC A;  2RHI A;  5IN1 A;  4P3N A;  2V1R A;  1BI0 A;  2HKN A;  1YFN A;  4IIM A;  4XAX B;  3OYB A;  1VUB A;  4Z89 A;  4N0A A;  2ALY B;  3JSC A;  3BDU A;  2HEQ A;  4IUT A;  3PNW C;  1LCK A;  1IGQ A;  4YRL A;  1USY A;  4LDV A;  2YDL A;  1QVG A;  1T3L A;  4J9H A;  3SB2 A;  4C8Q F;  3OYE A;  3LWH A;  1VA7 A;  3OYL A;  4PJO B;  1PRM C;  4LDU A;  4M77 G;  5DLO A;  1QCO A;  4M77 D;  1QVF A;  4H2Y A;  4TVW A;  3CCE A;  1VQZ A;  4H2T A;  4KR2 A;  3AT1 B;  4XU1 A;  4UP9 A;  2FZK B;  5HKC A;  1WHJ A;  1EQR A;  3QYG B;  2DF6 A;  3M0Q A;  3G4S T;  3L2Q A;  2RM4 A;  1BIB A;  2XI9 A;  1WA7 A;  2LZ6 B;  5CVI A;  3TQ7 P;  5C51 B;  4CS3 A;  2LDM A;  2F69 A;  5LJ3 g;  3L2R A;  2HAX A;  1YFR A;  2LMJ A;  1V1C A;  2XU8 A;  2KRN A;  2M51 A;  4YRI A;  1OPL A;  1WHH A;  5FRN A;  3CCE T;  2P0L A;  1BYM A;  2K7A A;  2YUQ A;  3LSS A;  3UFG A;  3CCR Q;  1PRL C;  1FYF A;  5GAO m;  2ZPH B;  2ZGW A;  3A8O B;  2OAU A;  4CS2 A;  1W4S A;  4F7U G;  3I5R A;  1I0C A;  1L0W A;  1K8A U;  1G5I A;  3JB9 G;  4UPA A;  3OW2 S;  1JJ2 A;  4PG3 A;  2YRV A;  2ZNI A;  1KQS P;  1K73 R;  1HYO A;  5EG2 A;  4BI3 A;  2Z0W A;  1X6B A;  2FO0 A;  3A32 A;  2CP6 A;  4RTV A;  1QW1 A;  1YGB A;  1D09 B;  3JCM f;  4RCC A;  2CDT A;  1PHT A;  2RQW A;  1N8R C;  1B76 A;  4PHC A;  1SEM A;  1Q82 R;  4LXC A;  3CCU T;  1H4Q A;  2KDS A;  3NHN A;  4LD9 K;  1H3Z A;  4F17 A;  2OAW A;  4A4H A;  3H0F A;  2EAY A;  4QQD A;  2WSF E;  3QJY A;  3L2V A;  5LJ5 d;  1KHC A;  1M1K C;  2Y4X A;  1LOJ A;  1IHW A;  3SWN C;  3HRU A;  4OGC A;  1MND A;  1K9M R;  4C8Q C;  3CCM A;  2FPF A;  5FW9 A;  5LJ5 e;  2JS0 A;  4XTV A;  5DM7 R;  2X51 A;  2LTO A;  4RG8 A;  3VS1 A;  1TTH B;  2DIQ A;  2NUP B;  3LYI A;  4FYX B;  3TEG A;  4KR3 A;  1R77 A;  4ZN3 A;  3CCV T;  4AH6 A;  5FRO A;  2ZT7 A;  1FX7 A;  3JRZ A;  2YHT A;  4A53 A;  3FJ5 A;  4IKF A;  1FWZ A;  4ORZ A;  3TU4 K;  2ESW A;  3CPW P;  4YRG A;  3S3N A;  2NUT B;  3VS3 A;  3CMA T;  3V8J A;  3A7A A;  1GCQ A;  4C92 C;  1Y0M A;  2C7I A;  3MEW A;  5CCA A;  2X4X A;  2VYT A;  1NZ9 A;  4IUR A;  4XEO A;  5GAN f;  4KUI A;  2RH2 A;  3CC2 A;  1JRI A;  2HD0 A;  4P73 C;  4YDQ A;  2HQE A;  4HVW A;  3QXE B;  2X4Y A;  2P0Q A;  2P4R A;  2LCL A;  1MHN A;  1PKT A;  1PSE A;  1I4K 1;  2CSQ A;  2CSI A;  4CH3 A;  1X75 C;  3INZ A;  2DVE A;  4QT7 A;  2Q7G A;  2RQV A;  4C5G A;  1JB0 E;  5CIU A;  1KSW A;  1VQ5 Q;  3AHU A;  4M7A B;  5C6S A;  4H2V A;  2GCX A;  4LDW A;  4ZTU B;  3CC2 T;  2BZY A;  1IB8 A;  1YWP A;  1FXX A;  1NG2 A;  1I07 A;  1M1F A;  4GLK A;  3E9I A;  1WHG A;  4C92 G;  2PTK A;  2DXT A;  4J9D A;  4C92 D;  2RPN A;  5HK3 A;  1NLO C;  4XTU A;  5KYU B;  2DDZ A;  5DLQ E;  1HXD A;  1TUG B;  1UJY A;  2WAC A;  1VQL T;  4ZGJ B;  4CC4 B;  2JW4 A;  1B70 B;  1SF9 A;  3G4S Q;  1OQK A;  3ZFJ A;  2RO0 A;  1MMA A;  3SEM A;  2CZ0 B;  1NE8 A;  1YHQ A;  2J05 A;  1IGU A;  1RAG B;  2P0P A;  2QG9 B;  4LE9 A;  4HWT A;  3FDR A;  2YSQ A;  3EFO A;  1YI2 A;  4FT2 A;  2EQJ A;  5LJ5 j;  2RHS B;  4B9W A;  4JS5 A;  2J6O A;  3BY7 A;  3PE0 A;  4EDU A;  3CCE Q;  1KQ1 A;  8AT1 B;  3TCJ A;  1G8X A;  3HXX A;  5KYN A;  5CKB A;  2EL9 A;  2J06 A;  4ELZ C;  1LYL A;  2MMP A;  1YHQ T;  4M4Z A;  2DX1 A;  4O5V A;  1VIE A;  1Q81 R;  2KK4 A;  4LUE A;  5GMK h;  2P84 A;  3HRT A;  3M58 A;  4YRQ A;  2HBW A;  4BE1 A;  3VS6 A;  4A4F A;  3C95 A;  4C8Q B;  1NPR A;  3VKI A;  2O4X A;  5HY6 A;  4J5Y A;  3UA6 A;  4FCY A;  1G3W A;  1YJN A;  2EKH A;  1GCP A;  2GTJ A;  4RTT A;  4YP0 A;  2Q5I A;  2XIC A;  4OMM A;  3OW2 P;  2L5Q A;  4HCK A;  5FU7 B;  1M1G A;  1RAH B;  2F5K A;  3JCM h;  2DRM A;  4WJ3 M;  1HK9 A;  3I56 A;  1UGS B;  3M55 A;  2DTI A;  4HWR A;  3EG0 A;  2DYB A;  4G85 A;  1ZHI A;  1K76 A;  5C52 B;  1B34 A;  2RJD A;  1FMK A;  4LDX A;  4TVA A;  3G1Z A;  4M75 C;  3I9Q A;  4OMF B;  4KUL A;  2JTM A;  1B3Q A;  1GRI A;  1YIT A;  2RJF A;  2L3P A;  3CCV Q;  2E4H A;  1MNE A;  1SHG A;  2ARS A;  2DYI A;  1ZSZ C;  2D8J A;  1X54 A;  4XK8 E;  2AIR B;  2EVR A;  4JJB A;  3FB9 A;  1S1N A;  2KEA A;  3JAM E;  2QGF B;  3P8D A;  1KQ2 A;  3CCM Q;  1J5W A;  3EHQ A;  3A5Y A;  1M8V A;  2HSP A;  2E12 A;  2E41 A;  1W6X A;  2RHU A;  2F2W A;  4M77 A;  4OB0 B;  4M75 G;  2G4C A;  4IUV A;  2RI3 A;  4M75 D;  3MF1 A;  3WQZ A;  5GAN h;  1HD3 A;  2LQN A;  5ELN A;  4FM4 B;  1K73 C;  3C0C A;  3PT9 A;  4B9X A;  4BD3 A;  4HA8 A;  3TUP A;  4YRC A;  4ANJ A;  4UP7 A;  3REA B;  4YRK A;  1ZLM A;  2X4W A;  3CC7 T;  1HC7 A;  2DER A;  1N6A A;  3M56 A;  3L4G B;  4DA4 A;  1UJ0 A;  4J6W A;  2J6F A;  2MWO A;  5D6Y A;  3CC2 Q;  1Q82 C;  5CKF A;  2GNC A;  2QYZ A;  2PVG B;  3NEN A;  5KYX A;  4M7A E;  1VQ4 T;  4J7I A;  1RAD B;  3M0R A;  2QHT A;  4J9G A;  4PK4 A;  5C0M A;  4JLG A;  5FRM A;  4P5N A;  2K79 A;  3RKX A;  2QQS A;  2RQR A;  1TUC A;  1G5H A;  1YNZ A;  2ZZD A;  4TQF A;  1NJ6 A;  2BIV A;  4BAC A;  2E6N A;  2FPE A;  2BE9 B;  1BI1 A;  3OYM A;  1WHL A;  1SPK A;  1QCF A;  5GAN 7;  1H64 1;  2X3W D;  2CJ9 A;  3X28 B;  2MI6 A;  1SRL A;  4LDY A;  2LT4 A;  3RMS A;  2VB6 A;  1Q86 R;  3VRY A;  2A8E A;  4YRM A;  2ECZ A;  1EIY A;  2X3X D;  3C94 A;  1XQH A;  1BBZ A;  1ACM B;  2OX7 A;  3RNJ A;  4BB7 A;  2JM9 A;  3RR6 A;  1VQ8 A;  3M0U A;  5J39 A;  1YHQ Q;  3L2Z A;  2A7Y A;  4TVY A;  4YRJ A;  3RES A;  3QPH A;  1YI2 Q;  2EJF A;  1EZZ B;  3CD6 T;  1RIQ A;  1U06 A;  2X35 A;  2LQ8 A;  4WCI A;  4RDX A;  5GAO l;  4NS5 A;  2LC4 A;  2MK5 A;  2RNA A;  4H02 A;  3M59 A;  4A4G A;  2RI5 A;  3JCM e;  2KR3 A;  1J3T A;  1VQ8 T;  3PCO A;  4C8Q E;  1M3C A;  2NYS A;  4HCZ A;  2DE0 X;  2QHS A;  4BUG A;  3VS4 A;  3EH2 A;  3WVE B;  1GFD A;  3CCR A;  2WSC E;  4DOW A;  1NJ5 A;  1C1A A;  5ECA A;  3LLR A;  3JCM b;  1K8A C;  2PUO B;  1YJN Q;  3HRS A;  2HKQ B;  4M77 F;  3A7R A;  1G5V A;  3TVT A;  5HGQ A;  2DZ9 A;  4YPF A;  4HT9 A;  3ZEH A;  1UGR B;  1VQ6 T;  2HDA A;  3SWN A;  1M3B A;  3I56 Q;  1Q7Y U;  4M78 C;  1PD0 A;  2GF7 A;  3HP9 A;  1SSF A;  1VQK A;  4DEX A;  4P72 C;  3BJU A;  4RMF A;  2E5A A;  4UP8 A;  1RAA B;  4C5I A;  3RF1 A;  5GAN 6;  1OX8 A;  3VRZ A;  5GAN e;  1K0X A;  1VOM A;  3N5B B;  4OF1 A;  1YIT Q;  2I4M A;  1AEY A;  5GMK j;  2L3Q A;  1Q81 C;  2QQB A;  1S72 T;  3HY0 A;  1NYQ A;  4C0D C;  5CKE A;  4C92 A;  1KD1 R;  3VYH B;  2QDY B;  4ESR A;  2AZV A;  3QHS A;  1PWT A;  3T9N A;  4DBQ A;  4NOY A;  2RD1 A;  3I55 T;  1NJI R;  1VQK T;  2J3L A;  4KRT A;  1AZG B;  3VBB A;  4P73 A;  3ER0 A;  3C4S A;  3OS2 A;  2XID A;  1TU0 B;  2FRW A;  2QTV A;  3FRN A;  4M78 G;  2A36 A;  4M78 D;  2DL7 A;  4F7U F;  1U8R A;  4CH5 A;  3JB9 F;  5A0D A;  4EMH A;  1H4V B;  1N27 A;  3CCJ A;  1UUE A;  4TVR A;  4QQ6 A;  3QZ9 B;  3LSQ A;  4K87 A;  2KRS A;  3GLX A;  3V7R A;  2BE7 D;  1YFS A;  2JUF A;  2GFA A;  1VQ4 Q;  2AT1 B;  3CBO A;  2D9T A;  2DL5 A;  5D6W A;  4HKE A;  4AFS C;  1U5S A;  4EIK A;  2JTF A;  3JB9 H;  1WXU A;  2D8H A;  1YIJ T;  1X2K A;  2JMA A;  4DQ2 A;  4YRE A;  3OYK A;  4XTZ A;  1QP3 A;  3CBP A;  3CCJ T;  1UGP B;  2OTJ T;  3SD4 A;  2M9U A;  1X27 A;  3PVQ A;  1QKW A;  2A28 A;  4J9C A;  4AMC A;  2GQI A;  1AWJ A;  1PM3 A;  3CBM A;  4EMK C;  4P74 C;  1NM7 A;  4FYW B;  1NPP A;  1WQ7 A;  1D0X A;  2IPO B;  2J3M A;  4E7Z A;  3J7A F;  2GGR A;  3WVD B;  2RQU A;  2YLC A;  3M9Q A;  2EBP A;  1GL5 A;  3KXT A;  4C5E A;  1UEC A;  2E65 A;  4EX5 A;  1OU9 A;  2H3J A;  1NJ1 A;  3GPL A;  1K9M U;  1ZUU A;  3EFO B;  4JJD A;  4ATO A;  3A8M B;  3E9H A;  5GAN j;  1O9S A;  1JEG A;  5CQX A;  1WNL A;  1XNI A;  3JCM P;  2VUB A;  1FMV A;  3G4S A;  3LGF A;  1KFZ A;  1Q7Y R;  3E9G A;  4KGV B;  1VQ8 Q;  1RAE B;  2KY9 A;  2CH4 W;  1C6V X;  1MGQ A;  4Y28 E;  1WIE A;  3VQW A;  1W70 A;  2HZY A;  4FIB A;  1RAF B;  2AKL A;  4XU0 A;  3FLG A;  4PJM A;  4JRP A;  3MEY A;  1D1A A;  2GFU A;  2AHJ B;  1PG5 B;  2O4X B;  1AZE A;  4LVK A;  3PGG A;  4WI1 A;  3VU3 C;  4RKU E;  3GP8 A;  2MWP A;  4BI8 B;  1RAC B;  4C92 F;  1WI7 A;  2XD0 A;  4YRN A;  3H0H A;  2RHQ A;  3VUB A;  3OYI A;  5I2M A;  3BE3 A;  1WPY A;  4O6J A;  4M7D G;  1EFN A;  4RMO A;  3OY9 A;  5FLX E;  1YFT A;  1ZBX A;  2ZIM A;  4C0G A;  1ADY A;  3M4P A;  2K5F A;  4M75 A;  3MKD A;  2CJB A;  3UA7 A;  2QGG A;  1DJ7 B;  5KE2 A;  3G6E T;  1JQQ A;  3QG1 A;  5CAI A;  2LNV A;  2W0Z A;  1Q86 C;  1B34 B;  5GAN 4;  4LNS A;  1ZSZ A;  2CH4 A;  2XDB A;  3M0T A;  2LJ1 A;  4TVA B;  3CCU A;  1E24 A;  2DL8 A;  4E2F B;  3JB9 D;  4PJL A;  3OS0 A;  4JRQ A;  2PME A;  3RUX A;  3R6O A;  1VQ7 T;  4P3O A;  3MET A;  2YRC A;  3EG9 A;  2ZZF A;  4X1V A;  4LUD A;  2L0A A;  4N4I A;  4WJ4 A;  1RLQ C;  1VYU A;  3I55 Q;  1VQK Q;  3A8G B;  2P4T A;  3R6N A;  2GTO A;  3OSV A;  1KJW A;  2B86 A;  2H8H A;  3V8K A;  3MF2 A;  1ASZ A;  2RB6 A;  2DA9 A;  5HCK A;  2DXB A;  2KRM A;  3HY1 A;  3CCV A;  2CP5 A;  2E3H A;  2KXD A;  3I5S A;  4M77 B;  4LVJ A;  1W2B S;  2K3X A;  1Q81 U;  2R58 A;  4BE2 A;  3DB3 A;  3CMA A;  1OU8 A;  2JMC A;  5KYW A;  3CXC S;  3H41 A;  3M4G A;  4L5G A;  5GAM g;  2ZXF A;  4HXJ A;  5FU6 B;  1SRY A;  4H2S A;  2G6F X;  1VIF A;  1KIK A;  1SSH A;  1SES A;  3URG A;  4Z02 A;  3CCJ Q;  1RI9 A;  1QWE A;  2MOX A;  2OTJ Q;  2ED1 A;  2RA2 A;  4Y92 A;  4HT4 A;  2JS2 A;  3QWY A;  1R8O B;  4MDX A;  1B7Y A;  1ARK A;  3HFV A;  3OYH A;  2QHU A;  2K2V A;  4BWA A;  1EFW A;  5KYX B;  4F16 A;  5IT9 E;  3MHX A;  2XG8 D;  2ZCF B;  4IUQ A;  4R55 A;  2QQR A;  2JTE A;  1G51 A;  1JO8 A;  1ZX6 A;  1YJW A;  5CKD A;  4D8K A;  3HTR A;  2KXC A;  3QII A;  3OSS C;  2FL7 A;  2QA4 T;  1ASY A;  2E70 A;  4F7U B;  1V29 B;  3G71 A;  1KQS A;  3NTI A;  1YJ9 T;  2ZCE A;  5LJ3 f;  3CCQ T;  2PU9 B;  1VQL A;  3PVL A;  4YCW A;  3OQ5 A;  1VQN A;  4MMK A;  1BI2 A;  1MV3 A;  2VV5 A;  1UB4 A;  1IXD A;  1EIY B;  4WTO B;  1KMM A;  1YJW T;  4OMO A;  4CC7 A;  4M75 F;  4QQG A;  4RQE A;  3OBW A;  3TSW A;  3G71 T;  1VQP T;  5DY9 A;  4H2X A;  4LD6 A;  3GIB A;  4EMG A;  4NL3 A;  3MPU B;  4OVA A;  4D6W A;  1C0A A;  2NWM A;  1VQN T;  1OV3 A;  4JLI A;  4N4H A;  2IY5 A;  2DET A;  4AT1 B;  2NUZ A;  4KT0 E;  2EYY A;  1WLP B;  5IHK A;  3ZL7 C;  3CEY A;  1VQO T;  2XK0 A;  2AKW A;  3PCO B;  4NL2 A;  3RIR A;  2ZIO A;  2Y4Y A;  2K3B A;  4JJN K;  2DD4 A;  4LNP A;  3SFM A;  3EGX A;  4F14 A;  2O88 A;  1CKA A;  3W3S A;  4UC4 A;  2DQ0 A;  5KCO A;  3A5Z A;  3CPW A;  1LJO A;  5GAO r;  3HSB A;  3FJP A;  3R07 A;  1YCY A;  2ZAE A;  2DVJ A;  3REX A;  2M1H A;  3E19 A;  5J3B A;  4Z8A A;  2ODR C;  2LX9 A;  2VWF A;  3NGP A;  4M78 A;  1T0J A;  1W1F A;  2K6D A;  5FWC A;  3FC3 A;  1E6H A;  2GBQ A;  4QW2 A;  2ATC B;  3CCS A;  4P72 A;  1WJS A;  1Y07 A;  2IIM A;  1UFF A;  5AT1 B;  1BB9 A;  2LRQ A;  4LVI A;  3SWN B;  3GOX A;  3LH5 A;  1HSQ A;  2BTT A;  5IXF A;  2YLB A;  3JB9 J;  2X4J A;  3A8H B;  4E7S A;  2JXB A;  3NEM A;  4DBF A;  3BDL A;  3M4Y A;  1RAI B;  1WHK A;  1Q7Y C;  2DJQ A;  2KE9 A;  3CCU Q;  3CCS T;  4J8O A;  2A08 A;  4RQF A;  1X6G A;  3VJP A;  1Q86 U;  4MZM A;  1BBU A;  2ODR D;  5LJ5 g;  2R57 A;  2DIL A;  1M90 R;  4J6X A;  2DK3 A;  4XU3 A;  4C92 B;  2B8A A;  1AOJ A;  4XU2 A;  5GMK i;  1TUD A;  4CH6 A;  1K4U S;  1NBE B;  2KMT A;  4PFO A;  2JM8 A;  4M77 E;  4N4G A;  2ZNJ A;  1UGQ B;  3IG2 A;  1EIF A;  3TRE A;  2YRD A;  3CCL T;  2QAS A;  1EVL A;  3NTK A;  3Q1J A;  5GAO q;  2V26 A;  1X55 A;  2VXF A;  3CXC P;  5KH6 A;  3CMA Q;  1D1B A;  1AWO A;  1FYN A;  5HK0 A;  3X25 B;  5I2S A;  3JB9 I;  3CC7 A;  3QSU A;  3FEO A;  3HTZ A;  3HFN A;  4EMK A;  2BKD N;  2CS7 A;  4P74 A;  1UHF A;  1EVK A;  2VC8 A;  4MZP A;  2OTL T;  2FZG B;  2K4Y A;  1N5Z A;  4ZIB A;  4TTV A;  5GAN 2;  2P5I A;  2LVM A;  1NYF A;  4XEM A;  5L23 A;  2ABL A;  3EGD A;  1IL2 A;  1YJ9 Q;  4YTL A;  2E10 A;  1VQ4 A;  3UAT A;  2MAM A;  5LL6 S;  4ELY C;  1W66 A;  1E7O A;  2E5Q A;  2CYZ B;  2VAS A;  4F7U E;  2QEX T;  2EQK A;  1QVG S;  5LJ3 h;  2QAZ A;  3F70 A;  5FWB A;  3OW2 A;  2HBP A;  1YJW Q;  2CIM A;  1D3B A;  4CI0 C;  3REU A;  3KFU A;  3V7C A;  1QVF S;  3G71 Q;  4A4K A;  4K11 A;  2COW A;  3OYF A;  1D1C A;  1VQL Q;  4DPG A;  11AS A;  3GNF B;  4M78 F;  3OB9 A;  3TEH A;  1VQN Q;  1VQ9 A;  2CJA A;  2LJ0 A;  2D6F A;  1KD1 U;  2K5I A;  2EYZ A;  1K9M C;  1ZUK A;  2DRK A;  2FHD A;  3HHT B;  2C0T A;  2YWW A;  1NJI U;  1Y96 A;  1OI1 A;  2CUB A;  1QE0 A;  4F7U A;  5IAY A;  1WGS A;  4X9C A;  4HWP A;  5CK9 A;  4PJN A;  3QBY A;  3CD6 A;  3HXW A;  4PJO F;  3RL6 A;  2ARU A;  2DM1 A;  1WDX A;  1Q95 G;  2C8M A;  3VQX A;  4QVD A;  3VYG A;  3QO3 A;  2EYW A;  5GMK e;  1VQ9 T;  3CME A;  2CZ1 B;  2HQX A;  1MMD A;  1VQM T;  3S3O A;  1GBR A;  4ZGE B;  6AT1 B;  1JJ2 S;  4EO4 A;  2KRO A;  3LX7 A;  1D0Y A;  2RHQ B;  2L3R A;  2V8K A;  2CP3 A;  3UF4 A;  3UPU A;  5GJW B;  2CRE A;  4CS4 A;  3X26 B;  2YT6 A;  2Q7H A;  3OYY A;  3ULR B;  1Y57 A;  5CKH A;  1NLP C;  2NS6 A;  4M75 B;  2HMA A;  2EIF A;  4Y91 A;  2BZ8 A;  1WU7 A;  2SEM A;  3CME T;  1KHI A;  1TSF A;  5A0G A;  4PLI A;  1IRE B;  1ZSZ B;  3CCS Q;  4HWS A;  1VQ6 A;  2ENM A;  3EG1 A;  2FEI A;  1QLY A;  1BIA A;  2O9V A;  3EHR A;  4HCC A;  2ZT6 A;  3EG9 B;  1N8R R; 
#chains in the Genus database with same CATH homology
 3VQV A;  1I5L A;  2DTO A;  4MML A;  3NEL A;  4E47 A;  4LVM A;  1ADJ A;  4C92 E;  4X34 A;  1E1O A;  1NNH A;  3MCA B;  1S72 A;  4JUV A;  2E3C A;  1Z7N A;  2M0O A;  3LW5 E;  3QYH B;  1YB3 A;  2QXF A;  3I55 A;  3MP8 A;  3DB4 A;  2QQ9 A;  3UGQ A;  2KAF A;  1NJ2 A;  4YRP A;  3LC0 A;  4L87 A;  5AYF A;  3DLL A;  3LWI A;  4M7D F;  1M9S A;  4PJO C;  2ZTG A;  2RHY A;  2VGM A;  1G3S A;  5LJ3 d;  4MZT A;  4G84 A;  4YCV A;  1B7Y B;  1KOG A;  5LJ3 e;  2ZPI B;  4A4E A;  2ART A;  1YIJ A;  2OTJ A;  3RKW A;  4KBM B;  1X2H A;  4H2W A;  2FVU A;  3H6Z A;  3M54 A;  1M90 C;  3UGT A;  4JRI A;  4PJO G;  4PJO D;  4XTY A;  2P0K A;  3IAL A;  4C5H A;  3QZ5 B;  2D0Q B;  2AMC A;  4O2D A;  3X24 B;  5K1P A;  2BUD A;  3JCM J;  4P71 C;  4IUP A;  3A74 A;  4MDW A;  4X9D A;  4Q15 A;  3CPW S;  1RI0 A;  4H2X B;  3PMT A;  4L6V 5;  2Q5H A;  5GAN 5;  4V2S A;  4RG2 A;  5GAM d;  2IY5 B;  1PSF A;  2VXE A;  1BI3 A;  1H4S A;  2ZPF B;  5GMK m;  3JCM g;  2AKW B;  2DKG A;  2V8J A;  3ZBD A;  4NCX A;  3OYC A;  3OBY A;  2ZIN A;  2K5L A;  3QO8 A;  3A5Z B;  5I21 A;  1QP2 A;  2HNI A;  3HRK A;  1HTT A;  4ZTZ B;  3SDZ A;  2EQU A;  4M7D C;  3HKS A;  5LJ3 j;  2XTI A;  3DSQ A;  4BI4 A;  4M78 B;  4M75 E;  2G3R A;  3P8Y A;  5A0L A;  3JCM c;  1VQ5 T;  2M16 A;  4J7F A;  3G6E A;  2ZZE A;  2V8I A;  2XKO C;  3JCM W;  3CPF A;  3TEE A;  3MO8 A;  1N9S A;  4JDS A;  2O01 E;  2JN0 A;  4C0D B;  4R56 A;  4BY6 C;  4H2U A;  2RJE A;  5L8R E;  1VQ7 A;  3OYJ A;  4M7D D;  1X56 A;  2PMF A;  5GAN g;  4YRR A;  5GAO n;  3S6W A;  5F5W A;  2IG0 A;  3PTA A;  3CMQ A;  4M7A C;  4J6Y A;  1GXI E;  3NTH A;  2KSS A;  4PKC C;  2QQA A;  2PVD B;  1KG1 A;  1WQW A;  3QO7 A;  2L8D A;  2DO3 A;  3QNE A;  2XGT A;  5ELO A;  3H8Z A;  4C0Z A;  5GAM j;  1X01 A;  1PYS A;  3HFZ A;  4OB3 B;  2QHV A;  3OS5 A;  4EMK B;  2CZ7 B;  2QI2 A;  1QVP A;  5M9O A;  2RHZ A;  3MEV A;  3MEA A;  4A54 A;  3HRI A;  4M7A G;  3L42 A;  4M7A D;  2ZR2 A;  2LQK A;  3M5A A;  3M57 A;  3HXZ A;  2DAQ A;  3V8L A;  3L2U A;  5CQY A;  1I81 A;  2QA4 A;  5E3I A;  1D3B B;  4PL6 A;  4BDZ A;  3PMI A;  1YJ9 A;  1M5Q 1;  2R5A A;  3CCQ A;  3A31 A;  3UWN A;  2I4L A;  2RHX A;  4M7D B;  5CR2 A;  4HVC A;  1G3T A;  3TEH B;  3GF5 A;  1M90 U;  4Q6G A;  2DD5 A;  2EJ9 A;  2EFI A;  5FU7 C;  1Y96 B;  1IZ6 A;  4II1 A;  1VQP A;  4HT8 A;  1KD1 C;  2JOY A;  3CCM T;  2KQW A;  1NJI C;  4BY6 B;  3OD1 A;  4P3P A;  1OZ3 A;  3A8L B;  4IUU A;  2XHC A;  4C8Q G;  4C8Q D;  1VQO A;  2F5T X;  2NLU A;  3JCM V;  4KQE A;  1M4Z A;  3S3M A;  1JJC A;  3QO5 A;  3HFO A;  4M78 E;  2DJZ A;  4ZN1 A;  2PVO B;  3HPW A;  3ME9 A;  4E7K A;  3J80 E;  3OYN A;  3HL8 A;  4CH4 A;  1ZQ1 A;  2VGN A;  4YYE A;  2GQV A;  1SET A;  4PJO E;  3V7S A;  2CGH A;  1YBY A;  4CRI A;  5GAN 3;  3RKY A;  3UDC A;  3RAC A;  2Q7E A;  3BW1 A;  2EKO A;  3PZC A;  4E51 A;  1TH7 A;  4P75 C;  3VQY A;  4ME7 A;  4BDY A;  5GAM f;  4J83 A;  2ALY A;  5A2Q E;  3ASK A;  3HXU A;  3NET A;  4FL6 A;  2KVQ G;  4PJO A;  1N9W A;  4YRT A;  2DU5 A;  4N0A C;  4C0F A;  1YI2 T;  1USY C;  5K1X A;  3CC4 A;  1KC8 C;  3CCL A;  3UH0 A;  3L1A A;  2RK1 A;  5KCH A;  4YRO A;  3I7F A;  1Y7X A;  4JRK A;  3JCM Q;  2ZT5 A;  3PIP A;  2EWN A;  1QF6 A;  4ZTF A;  4J15 A;  2EJG A;  4VUB A;  2OTL A;  3OYG A;  1I8F A;  3CC4 T;  2A3L A;  3DKM A;  3EFS A;  3X20 B;  2EQM A;  1YJN T;  4P71 A;  2RJC A;  4Q5W A;  2QEX A;  2AMC B;  1N8R U;  4M7D E;  3I56 T;  4BW9 A;  3MP1 A;  4JS4 A;  3HXV A;  3QJ6 A;  2CZ6 B;  5KE3 A;  3WXM B;  1AHJ B;  1M1K U;  3PIO A;  4XTW A;  1NYR A;  1YIT T;  5GMK l;  3BFM A;  4FSX A;  4YRF A;  2QTX A;  4OGE A;  4FU6 A;  4M7D A;  1X2G A;  1UEB A;  2MF2 A;  1NJ8 A;  5GAO p;  4HWO A;  1XOV A;  4OB1 B;  2E64 A;  3OYA A;  3LH0 A;  1O75 A;  3QKJ A;  2ZPE B;  2DIG A;  2DPP B;  1VQM A;  3KBG A;  4E7I A;  3NFC A;  4ZTJ A;  3HXY A;  2XDP A;  1W2B A;  5CO7 A;  4HCB A;  4WF2 A;  3CXC A;  5LJ5 f;  2E6Z A;  5KNN A;  1BKB A;  3L2W A;  2JZ2 A;  4X5O A;  4M7A A;  4BE0 A;  5GAM h;  1LNX A;  3VV0 A;  2K57 A;  4KUD K;  2PUK B;  2JVV A;  2ZT8 A;  3P8V A;  2WSE E;  2C06 A;  1P92 A;  3J81 E;  4OLF A;  4YRS A;  1KMN A;  1N9R A;  2FB7 A;  3MEU A;  4XQ3 A;  4EPC A;  1B70 A;  3JCM d;  2LCC A;  2I4O A;  3OA6 A;  3QTC A;  4QVZ A;  2DEQ A;  1SER A;  4YCU A;  3P8T A;  2RK2 A;  2DTH A;  1E1T A;  4GY5 A;  3HFZ B;  1PYS B;  4K88 A;  2E1H A;  3IKL A;  2RHS A;  3OMG A;  2DXU A;  1RL2 A;  3RGL A;  3JCM X;  2DU7 A;  2DQ3 A;  4L59 A;  2IVW A;  1GGM A;  2DXC A;  2ZPB B;  3M4Q A;  1ATI A;  3E9F A;  1KC8 U;  4TQD A;  3QDR B;  5J26 A;  3EAE A;  3OS1 A;  2PQW A;  2LT1 A;  3C12 A;  3G7Z A;  3IKM B;  2L89 A;  2R5M A;  4C8Q A;  4E7H A;  1WLE A;  4ZGD B;  1KQS S;  3LGL A;  2I2L A;  4K86 A;  3CCR T;  2XDD A;  1XTD A;  2CKK A;  2K3Y A;  2ZPG B;  4TWA A;  1E22 A;  5GAN d;  4QVC A;  2DZC A;  3ICA A;  1U1T A;  1WJR A;  4PLL A;  3RMQ A;  1U1S A;  2ZZG A;  1BBW A;  1OYX A;  3RER A;  3MP6 A;  3A7U A;  3P8B B;  5GAN 8;  4OB2 B;  3PFS A;  5D6X A;  1JBM A;  2JNG A;  1H4T A;  4E7J A;  3P8H A;  1Z7M A;  3MQZ A;  3UT1 A;  4XTX A;  1B8A A;  3QUI A;  4DOV A;  4M7A F;  4RCB A;  2EYQ A;  2Y90 A;  12AS A;  3DLM A;  3OYD A;  2FYK A;  1JJC B;  3M53 A;  1WJQ A;  1K73 U;  3O8V A;  2RI2 A;  5C53 B;  1X6O A;  3ERR A;  4PNO A;  2ZR3 A;  5LJ5 h;  1G3Y A;  3EFR A;  4LVL A;  3GNG A;  1WYD A;  5GAM e;  3KUF A;  1Q82 U;  4FT4 A;  1EOV A;  3FIF A;  4E7L A;  4P75 A;  3L4G A;  3E1S A;  4M77 C;  1VQ5 A;  3VUZ A;  1OZ2 A;  1Y71 A;  4OP0 A;  5FU6 C;  2I4N A;  3OMC A;  2RHI A;  5IN1 A;  4P3N A;  1BI0 A;  4XAX B;  3OYB A;  1VUB A;  4N0A A;  2ALY B;  3JSC A;  3BDU A;  4IUT A;  3PNW C;  4YRL A;  1USY A;  4LDV A;  1QVG A;  3SB2 A;  4C8Q F;  3OYE A;  3LWH A;  3OYL A;  4PJO B;  4LDU A;  4M77 G;  5DLO A;  4M77 D;  1QVF A;  4H2Y A;  4TVW A;  3CCE A;  1VQZ A;  4H2T A;  4KR2 A;  4XU1 A;  4UP9 A;  5HKC A;  1EQR A;  3QYG B;  3G4S T;  3L2Q A;  2RM4 A;  1BIB A;  2XI9 A;  5CVI A;  5C51 B;  4CS3 A;  2LDM A;  2F69 A;  5LJ3 g;  3L2R A;  2HAX A;  1YFR A;  2XU8 A;  4YRI A;  5FRN A;  3CCE T;  2P0L A;  1BYM A;  3LSS A;  3UFG A;  1FYF A;  5GAO m;  2ZPH B;  2ZGW A;  3A8O B;  2OAU A;  4CS2 A;  1W4S A;  4F7U G;  1L0W A;  1K8A U;  1G5I A;  3JB9 G;  4UPA A;  3OW2 S;  1JJ2 A;  4PG3 A;  2YRV A;  2ZNI A;  5EG2 A;  4BI3 A;  3A32 A;  1QW1 A;  1YGB A;  3JCM f;  4RCC A;  1N8R C;  1B76 A;  4PHC A;  3CCU T;  1H4Q A;  2KDS A;  4LD9 K;  1H3Z A;  4A4H A;  2EAY A;  4QQD A;  2WSF E;  3QJY A;  3L2V A;  5LJ5 d;  1KHC A;  1M1K C;  2Y4X A;  1LOJ A;  3SWN C;  3HRU A;  4OGC A;  4C8Q C;  3CCM A;  5LJ5 e;  4XTV A;  5DM7 R;  2LTO A;  4RG8 A;  2DIQ A;  3LYI A;  3TEG A;  4KR3 A;  4ZN3 A;  3CCV T;  4AH6 A;  5FRO A;  2ZT7 A;  1FX7 A;  3JRZ A;  2YHT A;  4A53 A;  4IKF A;  1FWZ A;  3TU4 K;  4YRG A;  3S3N A;  3CMA T;  3V8J A;  3A7A A;  4C92 C;  2C7I A;  3MEW A;  5CCA A;  2X4X A;  2VYT A;  1NZ9 A;  4IUR A;  4XEO A;  5GAN f;  4KUI A;  2RH2 A;  3CC2 A;  1JRI A;  2HD0 A;  4P73 C;  4YDQ A;  2HQE A;  3QXE B;  2X4Y A;  2P0Q A;  2LCL A;  1MHN A;  1PSE A;  1I4K 1;  4CH3 A;  1X75 C;  3INZ A;  2DVE A;  2Q7G A;  4C5G A;  1JB0 E;  5CIU A;  3AHU A;  4M7A B;  5C6S A;  4H2V A;  2GCX A;  4LDW A;  4ZTU B;  3CC2 T;  1FXX A;  4GLK A;  1M1F A;  3E9I A;  4C92 G;  4C92 D;  2DXT A;  5HK3 A;  4XTU A;  2DDZ A;  5DLQ E;  1HXD A;  2WAC A;  1VQL T;  4ZGJ B;  1B70 B;  3ZFJ A;  2RO0 A;  2CZ0 B;  1NE8 A;  1YHQ A;  2P0P A;  4HWT A;  3FDR A;  1YI2 A;  4FT2 A;  2EQJ A;  5LJ5 j;  2RHS B;  4B9W A;  4JS5 A;  3BY7 A;  4EDU A;  1KQ1 A;  3TCJ A;  3HXX A;  5CKB A;  2EL9 A;  4ELZ C;  1LYL A;  2MMP A;  1YHQ T;  4O5V A;  1VIE A;  2KK4 A;  5GMK h;  3M58 A;  3HRT A;  4YRQ A;  4BE1 A;  4A4F A;  3C95 A;  4C8Q B;  1NPR A;  3VKI A;  2O4X A;  5HY6 A;  4J5Y A;  1G3W A;  1YJN A;  4YP0 A;  2Q5I A;  2XIC A;  2L5Q A;  5FU7 B;  1M1G A;  2F5K A;  3JCM h;  4WJ3 M;  1HK9 A;  3I56 A;  1UGS B;  3M55 A;  2DTI A;  4HWR A;  4G85 A;  1ZHI A;  5C52 B;  1B34 A;  2RJD A;  4LDX A;  4TVA A;  3G1Z A;  4M75 C;  4OMF B;  4KUL A;  2JTM A;  1YIT A;  2RJF A;  2ARS A;  1X54 A;  4XK8 E;  3FB9 A;  3JAM E;  1KQ2 A;  3P8D A;  1J5W A;  3A5Y A;  1M8V A;  2E12 A;  2E41 A;  2RHU A;  4M77 A;  4OB0 B;  4M75 G;  2G4C A;  4IUV A;  2RI3 A;  4M75 D;  3MF1 A;  3WQZ A;  5GAN h;  5ELN A;  4FM4 B;  1K73 C;  3PT9 A;  4B9X A;  4BD3 A;  4HA8 A;  3TUP A;  4YRC A;  4UP7 A;  4YRK A;  2X4W A;  3CC7 T;  1HC7 A;  1N6A A;  3M56 A;  3L4G B;  4DA4 A;  4J6W A;  2MWO A;  5D6Y A;  1Q82 C;  5CKF A;  2PVG B;  3NEN A;  4M7A E;  1VQ4 T;  4J7I A;  2QHT A;  5C0M A;  4JLG A;  5FRM A;  4P5N A;  3RKX A;  2QQS A;  1G5H A;  2ZZD A;  4TQF A;  1NJ6 A;  2BIV A;  4BAC A;  2E6N A;  1BI1 A;  3OYM A;  5GAN 7;  1H64 1;  2CJ9 A;  3X28 B;  2MI6 A;  4LDY A;  2LT4 A;  3RMS A;  2A8E A;  4YRM A;  1EIY A;  3C94 A;  1XQH A;  4BB7 A;  1VQ8 A;  5J39 A;  3L2Z A;  2A7Y A;  4TVY A;  4YRJ A;  3RES A;  3QPH A;  2EJF A;  3CD6 T;  1RIQ A;  2X35 A;  2LQ8 A;  4RDX A;  5GAO l;  4NS5 A;  2LC4 A;  4H02 A;  3M59 A;  4A4G A;  2RI5 A;  3JCM e;  1VQ8 T;  3PCO A;  4C8Q E;  4HCZ A;  2QHS A;  4BUG A;  3WVE B;  3CCR A;  2WSC E;  4DOW A;  1NJ5 A;  3LLR A;  3JCM b;  1K8A C;  2PUO B;  3HRS A;  4M77 F;  3A7R A;  1G5V A;  5HGQ A;  2DZ9 A;  4YPF A;  4HT9 A;  3ZEH A;  1UGR B;  1VQ6 T;  3SWN A;  1Q7Y U;  4M78 C;  2GF7 A;  3HP9 A;  1SSF A;  1VQK A;  4P72 C;  3BJU A;  4RMF A;  2E5A A;  4UP8 A;  4C5I A;  3RF1 A;  5GAN 6;  5GAN e;  3N5B B;  4OF1 A;  2I4M A;  5GMK j;  1Q81 C;  2QQB A;  1S72 T;  3HY0 A;  1NYQ A;  4C0D C;  5CKE A;  4C92 A;  3VYH B;  2QDY B;  3QHS A;  3T9N A;  4NOY A;  2RD1 A;  3I55 T;  2J3L A;  1VQK T;  3VBB A;  4P73 A;  3ER0 A;  3C4S A;  3OS2 A;  2XID A;  3FRN A;  4M78 G;  4M78 D;  4F7U F;  1U8R A;  4CH5 A;  3JB9 F;  5A0D A;  4EMH A;  1H4V B;  1N27 A;  3CCJ A;  4TVR A;  4QQ6 A;  3QZ9 B;  3LSQ A;  4K87 A;  3GLX A;  3V7R A;  1YFS A;  2JUF A;  2GFA A;  3CBO A;  2D9T A;  5D6W A;  4HKE A;  2JTF A;  3JB9 H;  1YIJ T;  4DQ2 A;  4YRE A;  3OYK A;  4XTZ A;  1QP3 A;  3CBP A;  3CCJ T;  1UGP B;  2OTJ T;  3SD4 A;  2M9U A;  4EMK C;  3CBM A;  4P74 C;  1NPP A;  1WQ7 A;  2J3M A;  3J7A F;  3WVD B;  2YLC A;  3M9Q A;  3KXT A;  4C5E A;  2E65 A;  4EX5 A;  1NJ1 A;  2H3J A;  3GPL A;  1K9M U;  4ATO A;  3A8M B;  3E9H A;  5GAN j;  1O9S A;  5CQX A;  1WNL A;  1XNI A;  3JCM P;  2VUB A;  3G4S A;  3LGF A;  3E9G A;  2KY9 A;  1MGQ A;  4Y28 E;  3VQW A;  4FIB A;  4XU0 A;  3FLG A;  4JRP A;  3MEY A;  2GFU A;  2AHJ B;  2O4X B;  4LVK A;  3PGG A;  4WI1 A;  3VU3 C;  4RKU E;  3GP8 A;  2MWP A;  4BI8 B;  4C92 F;  2XD0 A;  4YRN A;  2RHQ A;  3VUB A;  3OYI A;  5I2M A;  1WPY A;  4O6J A;  4M7D G;  4RMO A;  3OY9 A;  5FLX E;  1YFT A;  1ZBX A;  2ZIM A;  4C0G A;  1ADY A;  3M4P A;  2K5F A;  4M75 A;  2CJB A;  1DJ7 B;  5KE2 A;  3G6E T;  3QG1 A;  5CAI A;  2LNV A;  1Q86 C;  1B34 B;  5GAN 4;  4LNS A;  2XDB A;  4TVA B;  3CCU A;  1E24 A;  3JB9 D;  3OS0 A;  4JRQ A;  2PME A;  3RUX A;  3R6O A;  1VQ7 T;  4P3O A;  3MET A;  2ZZF A;  4WJ4 A;  4N4I A;  3A8G B;  2P4T A;  3OSV A;  3V8K A;  3MF2 A;  1ASZ A;  2RB6 A;  2DXB A;  3HY1 A;  3CCV A;  4M77 B;  4LVJ A;  1W2B S;  2K3X A;  1Q81 U;  2R58 A;  4BE2 A;  3DB3 A;  3CMA A;  3CXC S;  3M4G A;  4L5G A;  5GAM g;  2ZXF A;  5FU6 B;  1SRY A;  4H2S A;  1VIF A;  1SES A;  3URG A;  4Z02 A;  2RA2 A;  4HT4 A;  1R8O B;  4MDX A;  1B7Y A;  3HFV A;  3OYH A;  2QHU A;  2K2V A;  4BWA A;  1EFW A;  5IT9 E;  3MHX A;  2XG8 D;  2ZCF B;  4IUQ A;  4R55 A;  2QQR A;  1G51 A;  1YJW A;  5CKD A;  3QII A;  3OSS C;  2FL7 A;  2QA4 T;  1ASY A;  2E70 A;  4F7U B;  1V29 B;  3G71 A;  1KQS A;  3NTI A;  1YJ9 T;  2ZCE A;  5LJ3 f;  3CCQ T;  2PU9 B;  1VQL A;  4YCW A;  3OQ5 A;  1VQN A;  4MMK A;  1BI2 A;  2VV5 A;  1UB4 A;  1EIY B;  1KMM A;  1YJW T;  4M75 F;  4QQG A;  4RQE A;  3OBW A;  3G71 T;  1VQP T;  5DY9 A;  4H2X A;  4LD6 A;  3GIB A;  4EMG A;  4NL3 A;  4OVA A;  4D6W A;  1C0A A;  1VQN T;  4JLI A;  4N4H A;  2IY5 A;  4KT0 E;  3CEY A;  1VQO T;  2XK0 A;  2AKW A;  3PCO B;  4NL2 A;  3RIR A;  2ZIO A;  2Y4Y A;  4JJN K;  2DD4 A;  3SFM A;  3W3S A;  4UC4 A;  2DQ0 A;  5KCO A;  3A5Z A;  3CPW A;  1LJO A;  5GAO r;  3HSB A;  3FJP A;  3R07 A;  1YCY A;  3REX A;  2M1H A;  3E19 A;  5J3B A;  2ODR C;  2LX9 A;  4M78 A;  3FC3 A;  4QW2 A;  3CCS A;  4P72 A;  1WJS A;  1Y07 A;  2LRQ A;  4LVI A;  3SWN B;  3GOX A;  2YLB A;  3JB9 J;  2X4J A;  3A8H B;  3NEM A;  3BDL A;  3M4Y A;  1Q7Y C;  3CCS T;  4J8O A;  4RQF A;  3VJP A;  1Q86 U;  4MZM A;  1BBU A;  2ODR D;  5LJ5 g;  2R57 A;  4J6X A;  2DK3 A;  4XU3 A;  4C92 B;  2B8A A;  4XU2 A;  5GMK i;  4CH6 A;  2KMT A;  4M77 E;  4N4G A;  2ZNJ A;  1UGQ B;  3IG2 A;  1EIF A;  3TRE A;  3CCL T;  1EVL A;  3NTK A;  3Q1J A;  5GAO q;  1X55 A;  2VXF A;  5KH6 A;  5HK0 A;  3X25 B;  5I2S A;  3JB9 I;  3CC7 A;  3QSU A;  3FEO A;  3HTZ A;  3HFN A;  4EMK A;  2BKD N;  2CS7 A;  4P74 A;  1EVK A;  2VC8 A;  2OTL T;  4MZP A;  2K4Y A;  4ZIB A;  4TTV A;  5GAN 2;  2P5I A;  2LVM A;  4XEM A;  1IL2 A;  4YTL A;  2E10 A;  1VQ4 A;  2MAM A;  5LL6 S;  4ELY C;  1W66 A;  2E5Q A;  2CYZ B;  4F7U E;  2QEX T;  2EQK A;  1QVG S;  5LJ3 h;  3F70 A;  3OW2 A;  2HBP A;  2CIM A;  1D3B A;  4CI0 C;  3REU A;  3KFU A;  3V7C A;  1QVF S;  4A4K A;  3OYF A;  4DPG A;  11AS A;  3GNF B;  4M78 F;  3OB9 A;  3TEH A;  1VQ9 A;  2CJA A;  2D6F A;  1KD1 U;  2K5I A;  1K9M C;  2FHD A;  3HHT B;  1NJI U;  1Y96 A;  1OI1 A;  1QE0 A;  4F7U A;  5IAY A;  1WGS A;  4X9C A;  4HWP A;  5CK9 A;  3QBY A;  3CD6 A;  3HXW A;  4PJO F;  3RL6 A;  2ARU A;  2C8M A;  3VQX A;  4QVD A;  3VYG A;  3QO3 A;  5GMK e;  1VQ9 T;  3CME A;  2CZ1 B;  2HQX A;  1VQM T;  3S3O A;  4ZGE B;  1JJ2 S;  4EO4 A;  3LX7 A;  2RHQ B;  2L3R A;  2V8K A;  3UPU A;  4CS4 A;  3X26 B;  2Q7H A;  3OYY A;  5CKH A;  2NS6 A;  4M75 B;  2EIF A;  4Y91 A;  1WU7 A;  3CME T;  1KHI A;  5A0G A;  4PLI A;  1IRE B;  4HWS A;  1VQ6 A;  1BIA A;  4HCC A;  2ZT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...