4XU1A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 82 that incorporates a morpholine in place of the ribose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
b'DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 98
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu1A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu1A01
4E51A 3RKYA 5KNNA 4JLIA 3QO3A 3W3SA 1RIQA 3AHUA 3A7AA 2ZGWA 4YROA 1LOJA 1G5HA 3RESA 4F7UB 5LJ3g 4C92G 3VQYA 2DTIA 3RKWA 4YCVA 3JCMQ 4M75B 1NJ8A 3P8VA 4NOYA 2DU7A 1JRIA 2DZCA 5GAN4 2E5AA 4H2WA 4YDQA 4TVWA 4YRCA 4F7UA 3HY1A 3REUA 4M78B 4J6WA 2RM4A 3V8JA 1QF6A 1G51A 2VC8A 2YLCA 2ZNIA 4M78A 2VXFA 2QTXA 5GMKi 4H2SA 5CAIA 3E9IA 5GAOq 4M7DG 2AMCA 5K1PA 1HC7A 1SRYA 4P71C 4P3OA 3EFRA 4XTVA 4PJOG 5C52B 1EIYB 3HRKA 3JCMb 4V2SA 3A5YA 2JN0A 5GAMh 4H2VA 2EWNA 1NYRA 4J6YA 1BBUA 4HWTA 2DVEA 3RUXA 2ZINA 4WJ3M 1NNHA 3CMQA 3IKMB 2C7IA 4X5OA 1EIYA 2FB7A 1KMNA 1B34B 2ZCEA 4M7AE 3V7SA 4M7DE 1ATIA 5LJ3d 1D3BB 1EVLA 1ASYA 5LJ3j 2DJZA 4H02A 4P73C 4PJOE 4WJ4A 1B34A 5GAN6 3A7RA 4EMKC 4UP9A 1WPYA 3JB9H 1GGMA 3JB9J 3TEHB 4Y91A 5GAMg 4HT9A 3UGQA 4P71A 4F7UF 2Q7GA 4KR3A 3JCMc 5E3IA 4PHCA 5GAOr 4M75F 4Q15A 2DZ9A 4C8QG 2DTOA 3JCMh 5GAOm 3TEHA 4WF2A 3PGGA 1YCYA 4MMKA 5DY9A 5GANf 5ELNA 1WQ7A 2QHSA 4RQEA 1PYSB 4HWSA 1WNLA 4A54A 4EMKB 1LYLA 4M7AF 4P74C 4M7DF 3JCMV 2CJAA 2Q5HA 3TEGA 3QO8A 3A74A 4P73A 1PYSA 5LJ5f 3RIRA 3HXWA 4EMKA 4C8QE 12ASA 1X56A 1B8AA 1NJ2A 3VU3C 5GAN2 2PMFA 1L0WA 1YFRA 2QHTA 2EJ9A 1G5IA 4M7AC 4M7DC 3LSSA 1WYDA 3HFZB 1E1OA 3JCMg 3SB2A 3V8KA 4TQDA 4XTUA 4PJOC 3A31A 5GAN8 4YRTA 4YRNA 4NL2A 4HA8A 2VXEA 1JJCB 1TH7A 4JRKA 4M7AD 2I4MA 4M7DD 4RQFA 3QO7A 2YLBA 3NELA 4P72A 5HGQA 3HFZA 2ALYB 1H4QA 3V7CA 4X9DA 3JCMP 2ODRD 5GAOn 1N9RA 5GAMj 4PJOD 4M77G 4CS4A 4QVCA 1JJCA 5GAMe 5GAN3 1NJ6A 1E24A 2ZZFA 5C51B 2ZZGA 2EAYA 2ZT6A 4M75A 4M7AB 1M5Q1 4A53A 4M7DB 2AKWB 1X54A 3ICAA 4DPGA 2ZT7A 2ZZEA 2ZIOA 1ASZA 1I8FA 1X2GA 2E41A 4C92E 4PJOB 1N9SA 4EMHA 4XEMA 1LJOA 4M7AA 2Y90A 1KQ2A 4M7DA 1KMMA 3V8LA 3JB9G 2Q5IA 2DXUA 1I81A 4M77E 1QE0A 2CJ9A 4RCBA 3V7RA 2Q7EA 1EFWA 1HK9A 4DQ2A 4EMGA 2DU5A 2RA2A 4C8QC 5F5WA 4YRRA 1B76A 1Y96B 2E10A 4M78G 3R07A 1KOGA 1X01A 4CS2A 4C8QD 3JCMe 3HFOA 2K57A 3FJPA 1Y96A 3MF2A 3FB9A 1WU7A 2ZT8A 1BBWA 5GMKh 3ERRA 3BW1A 1SETA 4C92F 3SWNC 4K86A 2DXTA 4XU2A 5GAOp 1D3BA 1WLEA 3GIBA 4M78E 2J3LA 4M77F 4HWPA 2DQ3A 5GANj 1NYQA 1VQZA 5GANe 4YRIA 4C92C 3RL6A 3RERA 1KQ1A 3M4PA 2HNIA 3TUPA 2XTIA 2Q7HA 3UH0A 5LJ3f 3RGLA 1YFTA 4M77C 3SWNB 3LSQA 2FYKA 4C92D 1H4VB 3MF1A 1E22A 2P5IA 4YYEA 1ADJA 5LJ5e 4YRGA 4LNSA 4YREA 4UP8A 1NJ1A 4XTWA 4CS3A 3HXYA 3PCOB 4PJOF 4M77D 2CIMA 3SWNA 2G4CA 1LNXA 2E3CA 4KQEA 3P8TA 4H2UA 3M4GA 2ZNJA 4C92B 4NL3A 3WQZA 5GANh 1HTTA 3JCMJ 5ELOA 4P75C 4OLFA 2DTHA 2PMEA 1EQRA 3NETA 3PCOA 4EX5A 2I4NA 1I4K1 2ODRC 4M77B 1Z7NA 2CJBA 4C92A 3I7FA 1EVKA 1HXDA 4L87A 5GMKm 3DSQA 3JB9D 2ARSA 4CH4A 4H2TA 4N0AC 5LJ5h 4HWRA 2I4LA 3QHSA 4M78C 4EO4A 2RD1A 5GAMd 4BW9A 4M77A 3JB9I 2ZR2A 3VQWA 4YRSA 4KR2A 4P74A 4YRFA 1USYC 3IALA 4TVYA 3A32A 1B70B 2ALYA 4XQ3A 4M78D 4XEOA 5GANg 1BIBA 4XTYA 2RHSB 4O2DA 4TVAB 4C8QF 3RKXA 2I4OA 3JCMW 3REXA 5GMKj 3LC0A 4ZIBA 4PG3A 4YRKA 1J5WA 1B70A 4YRPA 3UFGA 2CGHA 5GMKe 3OD1A 4YCWA 2E65A 2AKWA 2DDZA 4P75A 1E1TA 3HTZA 3PZCA 4HVCA 4PNOA 4F7UG 2ZT5A 2ZTGA 1H641 5LJ5g 2RHSA 1W66A 4RMFA 4TVAA 4XU0A 4PJOA 4K87A 2ZR3A 3QUIA 4M75G 1SERA 3BDUA 2AMCB 4G85A 5GAN5 2RB6A 2DKGA 5GAMf 3IG2A 4N0AA 4H2XB 3QNEA 2EJGA 3VBBA 4YP0A 4ZTUB 2XGTA 1YFSA 1JBMA 4J5YA 4QVDA 3JCMd 4H2YA 4M7AG 1H4SA 1BIAA 2EL9A 4Q6GA 1USYA 3HFVA 4HT8A 3NEMA 4H2XA 4BWAA 4TTVA 3G1ZA 4F7UE 4YCUA 2J3MA 4TWAA 4CH6A 5GAN7 3VQVA 2RHQB 4XU1A 4OP0A 4M75E 4TQFA 3RF1A 3L1AA 4UP7A 4J6XA 1U1SA 3EFSA 3VQXA 4XU3A 5GAOl 2DQ0A 5C53B 4CH5A 3INZA 4XTXA 5K1XA 4ZTZB 4C8QB 2C8MA 1H4TA 4X9CA 2RHQA 1YGBA 1ADYA 5GANd 3HXVA 3L4GB 4NCXA 3UGTA 2IY5B 3JCMX 3HRIA 4YRMA 1Z7MA 3HXZA 3P8YA 5LJ3e 4RCCA 4YRJA 4C8QA 3HXUA 2P0LA 3MEYA 3JCMf 1MGQA 1YB3A 3BY7A 1B7YB 3BFMA 1FYFA 4G84A 3HXXA 4XTZA 3L4GA 1EOVA 2IY5A 3E9HA 3QSUA 3IKLA 4HWOA 5LJ5d 4YRLA 5LJ5j 3QO5A 3FIFA 2YHTA 1B7YA 3JB9F 3A5ZA 1C0AA 11ASA 2ARUA 3QTCA 4J15A 4YPFA 3M4QA 3NENA 2DEQA 4P3NA 4MMLA 2I2LA 2QHUA 1M8VA 4P3PA 1I5LA 4AH6A 3A7UA 2EJFA 2E1HA 5GMKl 4P72C 4CH3A 1IL2A 2QHVA 2E64A 5LJ3h 4JRIA 4M78F 1SESA 2ZIMA 5I21A 1WQWA 4JUVA 1X55A 3BJUA 4WI1A 3KFUA 4UPAA 4YRQA 1U1TA 4M75C 4RDXA 3HSBA 2ZXFA 3HFNA 1X2HA 1NJ5A 2ARTA 3L2ZA 4K88A 1N9WA 3RACA 3HY0A 4M75D
chains in the Genus database with same CATH superfamily
5KNNA 3QO3A 2JJ9A 1RIQA 4GLMA 2F5KA 3OW2P 2FRYA 3A8GB 5L23A 2D1XA 4C92G 4F16A 2JM8A 4YCVA 3S6WA 3JCMQ 1NJ8A 2YXYA 2DU7A 3OSSC 3CD6T 2E5AA 2CH4W 4R0KA 4PL6A 2HZYA 2RQTA 1M8MA 4M78B 1Q86U 3VS2A 3LWHA 4Z88A 2LX9A 2OI3A 1KD1U 1QF6A 1Z9QA 1WX6A 1VQ5Q 2YLCA 1MUZA 4M78A 3M57A 3MP1A 2QTXA 1AZGB 1Q7YR 2BIVA 2LQWA 2J05A 2HQEA 2Z0WA 5CAIA 3E9IA 1KC8R 8AT1B 4MZPA 1UJYA 1SRYA 2DLPA 2NUTB 1VQ6Q 1AWOA 2QDYB 3OW2A 1WXUA 4XTVA 2XK0A 4FT4A 5EG2A 3META 1EIYB 2LQKA 4O6JA 2KDSA 4V2SA 5GAMh 4H2VA 2Y4YA 1TG0A 2PVDB 3CC7T 3KBGA 2NUTA 3CMQA 6AT1B 4LVLA 2NLUA 4RTXA 2MK5A 1EIYA 2FB7A 1KMNA 1PHTA 1ATIA 2CDTA 5CKFA 1EVLA 1ASYA 1WLPB 1FXXA 2DJZA 2XDBA 3TEEA 4LD6A 4P73C 4FSXA 1ZA1B 3A8OB 2OAWA 1ZA2B 1OULA 3A1PA 4IUUA 1M27C 1WPYA 2E4HA 2JTEA 2YRDA 1T0JA 2H3JA 4KUDK 2YUPA 4Y91A 4HT9A 2K4YA 1WI7A 3CCQT 2C06A 2OTLT 4FL6A 4OMQA 3NHNA 1S72A 5I2SA 3PTAA 2LX7A 1YJNA 3M9QA 3E2UA 3HP9A 4N4IA 4E7KA 1YCYA 5DY9A 5ELNA 3UF4A 1G5VA 2HKQB 2QHSA 2L8DA 1D1CA 1WHHA 4HWSA 4DEYA 2A36A 4OB0B 2M0OA 3JCMV 4CC3A 3ASKA 2Q5HA 4MDWA 5CR2A 1JXOA 1K76A 3TEGA 2GTOA 2BZYA 2KVQG 3I56A 4BY6B 3CD6Q 2C0TA 2PMFA 3VU3C 1YFRA 1JJ2P 4M7AC 2RQWA 4M7DC 2X3XD 1VQLQ 3HFZB 2QQAA 3I5SA 1IZ6A 4EPCA 1WJSA 1U3OA 2P0PA 4PJOC 2V8JA 1KHCA 4C5GA 2H8HA 1TH7A 3GOXA 2I4MA 2CZ0B 2R57A 3QO7A 4QQ6A 3NELA 2YSQA 5HGQA 1ABOA 3HFZA 1D09B 4GY5A 4QKUA 3V7CA 4X9DA 1T3LA 5GAOn 5ECAA 5GAMj 3L2VA 4M77G 1PG5B 1BB9A 1PCXA 5C51B 5GAN3 1YHQA 1E24A 4LDVA 2E12A 4J8OA 2FO0A 3M54A 5J26A 3S3OA 4E7HA 1M5Q1 4R55A 2W0ZA 1SRMA 2O9SA 3ICAA 3CCST 2ZT7A 1IREB 2ZZEA 5AYFA 1MHNA 2F1LA 2FRWA 1M1FA 3AT1B 3PNWC 2DRMA 3CBOA 4XEMA 1QP2A 1KQ2A 1JJ2A 2ATCB 1I0CA 2DXUA 1YJ9Q 1AD5A 2EYXA 2Q7EA 1QKXA 1VIEA 4FYVB 4QT7A 2DU5A 3PFSA 3HRTA 4C8QC 2D0NA 1WA7A 5F5WA 2DETA 2EKHA 2L0AA 2GQIA 1QCNA 4N4HA 4HCBA 2EGCA 2E10A 2JTFA 2M16A 3D7SB 1RI0A 1AWWA 1MMDA 4FYXB 1YI2A 2KXDA 2O4XB 3CCMA 4RMOA 2VGNA 3FB9A 1M2OA 2ZT8A 2GCXA 2DL4A 2LNVA 3G71Q 3CQTA 3EG3A 3BW1A 2F69A 3CCET 1PWTA 2XD0A 1W1FA 1R0CB 2F2WA 5GAOp 2O4XA 1D3BA 1P92A 1QCFA 5CCAA 1QCOA 4M77F 3A98A 3QZ9B 4B9XA 3OYLA 1VQZA 5GANe 4A4KA 2KR3A 3OW2S 1YJNT 2YUOA 4C92C 3RL6A 3TUPA 2BTTA 1VQ8A 1NPPA 4PJMA 3TSZA 1ARKA 3G4ST 3RGLA 1ACMB 1TWBA 2F2VA 3G7ZA 2QGFB 4P5NA 2F2XA 3OS0A 4YYEA 4YRGA 2ZPGB 4OMPA 4XTWA 5IHIA 1OV3A 4CS3A 2LMJA 3PCOB 4FYWB 1W2BP 2XI9A 4A63B 3OBWA 1YBYA 3JSCA 4H2UA 2FZGB 3G6EA 5CIUA 1GBRA 1E6HA 3WQZA 5ELOA 2EYYA 2FPEA 3QBYA 2DTHA 3E19A 1EQRA 2PMEA 3PCOA 4DOVA 1VQOT 4M77B 4LVJA 2CJBA 3M0QA 2LVMA 3GLXA 3I7FA 2DD4A 2K79A 2LP5A 2AHJB 1M90R 3QHSA 1OOTA 2EYWA 4EO4A 2CUBA 5GAMd 2EQKA 4M77A 1UUEA 4MDXA 2ZR2A 3VQWA 3H0HA 4YRSA 3N5BB 2QQ9A 3M0SA 2LRQA 1BCOA 3L2QA 1BU1A 1USYC 2E5QA 2WSEE 2MOXA 4LE9A 4XQ3A 2EVRA 1UGPB 4XEOA 2K6DA 1BIBA 4KGZB 1W2BA 5IT9E 4FYYB 1M3BA 3REXA 3JCMW 3I55A 4PG3A 1J5WA 3NTKA 3WXMB 4YRPA 4EDUA 1SSFA 3UFGA 1M3AA 2AKWA 4L59A 4YCWA 2D0QB 1E1TA 2LCCA 3OA6A 4FT2A 1G8XA 3CMEQ 4PJJA 2IIMA 2RJEA 4XU0A 1FX7A 1VQKT 3QUIA 1SERA 5FWBA 2K5LA 5GAN5 2CSQA 1ZSZC 4N0AA 5CO7A 2RHYA 4H2XB 3M0RA 2ABLA 4FCYA 4ZTUB 1TTHB 3CBPA 4J5YA 1YITA 1BK2A 1WHJA 1YI2T 1H4SA 1WJQA 2NUZA 4BE1A 1C0MA 3HFVA 1N8RC 1OPLA 2DMOA 4H2XA 1NYGA 4TTVA 1WHGA 1S72Q 3RNJA 2A08A 3CCVQ 4LN2A 4J6XA 2EKOA 2RNAA 3SD4A 4CH5A 5K1XA 1VQ5A 5FU7C 2VB6A 1JJ2S 1ZUKA 1YGBA 1ADYA 1T0HA 2KSSA 3L2UA 1Z7MA 1MMNA 3I56Q 4JJBA 3OMGA 2JMCA 1ZUYA 4YRJA 3MEYA 4RTYA 1YB3A 1B7YB 2XICA 1V29B 4FW2A 3WVEB 4XTZA 2KAFA 3OYBA 1Q82R 1X75C 3QO5A 1PC0A 3CC4A 1B7TA 1B7YA 4TVRA 2MMPA 2ARUA 3M4QA 1OI1A 4MMLA 2I2LA 2QHUA 4BB7A 3J7AF 2HSPA 1HD3A 2E1HA 2EYQA 2RHZA 3MO8A 2E6NA 1IHVA 3ME9A 2LQ8A 5CKBA 1YHQQ 2V8IA 4PJNA 1RABB 4E7SA 4OMOA 2DEUA 1X55A 4WI1A 3KFUA 3H6ZA 4LD9K 4M75C 1NJIR 4RDXA 3HSBA 1VQ9T 3RBBB 3CCJT 3HHTB 3L2ZA 2L3PA 2M0YA 3RACA 1SSHA 1Y0MA 1RAHB 3M4YA 3RKYA 1BI2A 2MWPA 2X4JA 3BDLA 4JLIA 1UGVA 3TSWA 1AVZC 2DL3A 3T9NA 2JT4A 4ZGEB 4YROA 3QIIA 1LOJA 4C0DC 3RESA 5LJ3g 1AHJB 3P8VA 4NOYA 4JS5A 1KHIA 4LDUA 5GAN4 2A0FB 4YRCA 4HCKA 5EC7A 4PLIA 3CCMQ 4J9IA 2E3HA 1EIFA 4LNPA 4J6WA 1VA7A 2JZ2A 1VQLA 1PSFA 1G51A 1X69A 3X28B 1IB8A 4KBMB 5KCHA 4IUVA 3GBQA 1OU9A 2VXFA 1ZSGA 2FHDA 3QJ6A 2CP3A 4H2SA 5GAOq 4M7DG 2XHCA 2DVJA 5K1PA 1GL5A 2K7AA 1M1KC 4XAXB 2KYMA 1JXMA 3MHXA 4F17A 4PJOG 1H92A 1VQ8Q 4LVIA 1RUWA 1W2BS 5KYWB 4OB3B 5A0GA 2OX7A 1VQ5T 3PVQA 4HWTA 1NNHA 2HEQA 3CEYA 1D1BA 2ZCEA 4J9CA 2HBPA 3V7SA 5LJ3d 5KYWA 2G6FX 1N8RU 1VQ6T 1YJ9A 1LVKA 3MEUA 4KGVB 3G6EQ 1UB4A 1VIFA 4WJ4A 2QK0A 1M3CA 3A7RA 2G3RA 3SFMA 2DIGA 3E1SA 2K2MA 2CT3A 2GNCA 1EZZB 4C0FA 2IG0A 4Q5WA 1DJ7B 3PT9A 2QYZA 5FU6C 3VRYA 5DM7R 2L89A 4CC7A 2EGEA 4C8QG 4OMNA 2SEMA 3MCAB 1PKTA 4QQDA 1VQPA 2VGMA 1WQ7A 3HL8A 3NTHA 3M53A 4RQEA 3QDFA 9ATCB 4B9WA 4A54A 1LYLA 2K5FA 2KXCA 4M7DF 4M7AF 1RAEB 2RJCA 1HJDA 3OYJA 2AZVA 4P73A 5KYNA 2LJ0A 4AFQC 4J9GA 3I55Q 3HXWA 3JRZA 3EAEA 2XDPA 3CCUA 2E5KA 1X56A 2EJ9A 2DXBA 3OMCA 2FPDA 3P8BB 1R77A 1UHFA 2KNBB 4TQDA 3X26B 4KT0E 5GAN8 4NL2A 1FYNA 1RADB 1JJCB 5KYUB 5CQYA 1YITQ 1UFFA 2ALYB 1X27A 3REBB 3UATA 4D8DA 3GNGA 1JJCA 1K9MR 2ZZFA 5KYUA 1VQLT 5I22A 2EAYA 2ZT6A 4GBQA 4M7AB 1HYOA 4M7DB 2JS2A 1YP5A 5KYXB 2YUNA 4PJOB 4OB1B 1J3TA 3MEWA 3OY9A 2J7IA 4M7AA 4M7DA 4OMLA 3OQ5A 1ZBJA 3V8LA 2MYSA 4PFPA 2COWA 1AEYA 2GGRA 3VS7A 4WTOB 4M77E 2CJ9A 2CP7A 4RCBA 3V7RA 4DBQA 5AT1B 3MJXA 3O8VA 3PIPA 1MNEA 4DQ2A 4EMGA 1OZ3A 2RA2A 1Q81C 1K8AC 3EG2A 1B76A 5IH2A 3OSVA 2PTKA 3R07A 3R6OA 3CC4Q 1FMVA 1Q86R 1K0SA 1OEBA 3OS2A 1KD1R 3A8HB 1YJ9T 3I5RA 4O5VA 3QKJA 1M1KU 2GBQA 3RDVA 3CMEA 4IKFA 4HVUA 1SETA 1IGUA 4C92F 2R58A 1KG1A 2YWWA 1TUGB 1SRLA 5J39A 2DFUA 4IIOA 2KBTA 4DOWA 1WLEA 2J3LA 2BUDA 2CP6A 1IXDA 2GFAA 1ZQ1A 3VS3A 2DQ3A 5GANj 1VQ4Q 1QLYA 1XOVA 3KFVA 4J7IA 1WXTA 3G71T 3RERA 1C6VX 1KQ1A 2XTIA 1ZHIA 4KRTA 1RAAB 3URGA 3CCVA 5LJ3f 2KGTA 2YT6A 1YIJA 3OYIA 3LSQA 2KMTA 1H4VB 5LJ5e 1UE9A 1LCKA 2JM9A 5HKCA 5IHKA 5KH6A 1UJ0A 4ANJA 1X6OA 4M77D 2CIMA 1LNXA 4KQEA 1MV0B 3M4GA 2ZNJA 4C92B 5IXFA 2ZPBB 1RAFB 3JCMJ 4JZ3A 1NYFA 2HDAA 3NETA 2YDLA 2I4NA 4E7LA 2QQSA 3OYNA 2JW4A 3VUBA 3HPWA 4ELZC 4C92A 1ZLMA 2R5MA 5GMKm 3DSQA 3PE0A 2COYA 4H2TA 4CH4A 4HWRA 2JXBA 4M78C 2RD1A 4KR2A 1X6GA 2ZPIB 1CKBA 2XMFA 4P74A 2QA4A 3LYIA 1NBEB 5CKHA 3A32A 2HMAA 5GANg 3TCJA 4XTYA 3RMSA 2I4OA 4ZIBA 1M2VB 4FM4B 4YRKA 2DX1A 4ZTJA 1YCSB 2CGHA 5IN1A 2VASA 2E65A 2DDZA 1RLQC 4F7UG 2CP0A 2ZT5A 3A8MB 4ZN1A 2ZTGA 4E47A 2KE9A 4ATOA 1GBQA 1AT1B 1W66A 4DBFA 4RMFA 1W70A 4M75G 3BDUA 2AMCB 4G85A 2M1HA 2DKGA 2L3RA 4HVVA 1ZUUA 4QQGA 3VBBA 4YP0A 5C0MA 3VV0A 2QI2A 1K73C 1X6BA 1BI3A 2L2PA 4A4FA 1USYA 1CSKA 3VUZA 2FVUA 4HT4A 1BCMA 2COZA 3CMET 2QASA 2X3WD 3HRUA 5DLQE 2J3MA 2P4RA 4GLKA 3VQVA 3QJYA 1VQPQ 2RHQB 3QWXX 4AG2C 3VQXA 1Q81U 5GAOl 2DQ0A 1K8AU 1SKUB 4ZTZB 1ZSZB 3FRNA 1VYVA 1WHMA 2NUPB 2RHQA 4II1A 1XTDA 2CKKA 4B6MA 5GANd 3HXVA 3L4GB 4BACA 4ZTFA 5KE2A 1S72T 4FU6A 2QDLA 3CCUQ 3ULRB 1MGQA 3CCVT 3HXXA 3F70A 1YIJT 3L4GA 1MV3A 2B8AA 2PUOB 3E9HA 2QAZA 4OMMA 1MMAA 3FIFA 5HK0A 1SEMA 4HXJA 2LTOA 3ER0A 1C0AA 2HQXA 4J15A 4ELYC 3I56T 2DEQA 5LL6S 4C0GA 1HSQA 1VYTA 1M8VA 2RJDA 5D6WA 1I5LA 1NE8A 2X35A 2EJFA 3A7UA 5DLOA 3THKA 1PNJA 4IIMA 2LT1A 4EIKA 3OYFA 2E64A 5LJ3h 1E7OA 3NMZC 1SESA 4E7ZA 2CZ7B 3BJUA 1WHLA 2RHUA 4UPAA 1Y7XA 4YRQA 5KCOA 1G83A 4DA4A 3I35A 2DERA 2ZXFA 2X4YA 2E3IA 1PKSA 4LUEA 3REAB 3FDRA 3UT1A 1AWXA 1NJ5A 2QQRA 4K88A 3CCRA 3EH1A 3HY0A 2JVVA 1YHQT 4JLGA 4ZN3A 4E51A 1JQQA 2XDDA 3CC2A 2ZPEB 3AHUA 5D6XA 3A7AA 3LGFA 5CQXA 1SF9A 2ZGWA 2QEXQ 2CREA 3GP8A 1M30A 4F7UB 2O9VA 2V8KA 2DD5A 2DTIA 3RKWA 2DE0X 5HK3A 4M75B 4FIBA 2CT4A 1JRIA 2DZCA 2FEIA 5D6YA 2A37A 4YDQA 1TXQA 2KT1A 2EGAA 4F7UA 3HY1A 3REUA 1QVFA 3MQZA 2O31A 1QKWA 3V8JA 3S3MA 3CPFA 3OYCA 2JS0A 1Y57A 2OAUA 4MZTA 2VC8A 2DXCA 4C0DB 5KYYB 1UDLA 3EG0A 2VUBA 2EQUA 4IURA 1Y71A 1TUDA 3PMTA 8ATCB 4LVMA 1RI9A 3CCMT 1T3SA 4A4EA 2EFIA 4AG1C 2DL5A 3VS5A 1K4US 4P71C 4P3OA 3EFRA 5KYYA 3JCMb 2YRVA 4AFSC 2JN0A 2V1RA 4PJLA 4JRQA 1NYRA 1YIJQ 3QDRB 3O5ZA 5GJWB 3RUXA 2ZINA 2PU9B 3IKMB 1VQ7A 2RN8A 2C7IA 2RQVA 1B34B 1K73U 2DYBA 4M7AE 4M7DE 4E6RA 5LJ3j 2BE9B 1ZX6A 4H02A 1VQ8T 1EFNA 4PJOE 3KXTA 3LH0A 2K9GA 3MEVA 4BDZA 1B34A 3C95A 5GAN6 1RL2A 1V1CA 4EMKC 1VUBA 4UP9A 4BI8B 3FLGA 1GGMA 1VQNQ 3JB9J 3TEHB 3DB4A 2SRCA 3UGQA 4OB2B 5IXBA 4KR3A 3TREA 4JJDA 2D8HA 1TU0B 2OTJA 2KI7A 2FL7A 1YWOA 3G6ET 2DTOA 5GAOm 1QMCA 1VOMA 1C1AA 1D0ZA 2DIQA 4OGEA 3TEHA 2EIFA 3PGGA 4MMKA 5GANf 2C0IA 1PM3A 3MKDA 2QA4Q 3UDCA 1PYSB 1KK7A 1Q95G 3TQ7P 2B86A 2CJAA 2X4XA 3LW5E 5CK9A 1KIKA 3QO8A 4WCIA 1JEGA 1VQ4A 3A74A 2LJ1A 3DLMA 1MNDA 3HKSA 1PYSA 2CP5A 2VWFA 1GRIA 1QW1A 4VUBA 1UECA 4C8QE 12ASA 2NS6A 4C5EA 1GCQC 4J9HA 3L42A 1B8AA 1NJ2A 5GAN2 2QHTA 4C5IA 5I11A 1Q7YC 2DRKA 3LSSA 2ZCFB 1SHFA 1WYDA 1E1OA 3JCMg 3SB2A 1KC8C 1CKAA 4XTUA 2KQWA 4HA8A 4M7AD 4RQFA 4M7DD 2YLBA 2MCNA 3I55T 4P72A 1UGRB 2O88A 2JUFA 3EGXB 1N9RA 3CPWP 4PJOD 3Q1JA 4J83A 1D0YA 2VYTA 2ZZGA 3CMAQ 2DPPB 4YTLA 4A53A 1X54A 4DPGA 4JDSA 3EGXA 4PFOA 1TUCA 5L8RE 1I5OB 1I8FA 1X2GA 1TS9A 3M0TA 4C92E 1K0XA 1YITT 4EMHA 2Y90A 1KMMA 1Z9ZA 2CZ6B 3JB9G 2Q5IA 1IO6A 2AKLA 2PVOB 2RI5A 1PRMC 5A0DA 2LJ3A 1YJWA 2XIDA 4JS4A 1FWZA 1YNZA 2LCSA 4AFUC 5FLXE 2LQNA 1GXIE 1QVPA 4M78G 1X01A 4FW1A 3CPWA 3VRZA 3MP8A 5FWCA 4CS2A 2V1QA 5IHNA 2GQVA 4C8QD 3JCMe 2JNGA 1QVFS 3HFOA 1G3YA 3LWIA 3H9NA 4ZNXA 1WJRA 2QTVA 4JZ4A 2DBMA 3SWNC 3FJ5A 4XU2A 3M56A 3OYHA 2HL5C 3CC4T 4CI0C 2MI6A 4R56A 1KFZA 4Y92A 2RQUA 3M0PA 3C94A 4YRIA 1ABQA 1IGQA 4JPBW 3CCLQ 3OYYA 3CCRQ 4C5HA 4X1VA 1VQMQ 3CC2Q 1YFTA 2X9HA 4C92D 1K9AA 1N8RR 2KYBA 1VQ4T 3UA6A 1NJ1A 1NEBA 3VKIA 2DO3A 2OTLA 4PJOF 1FMKA 3X20B 1NLOC 2G4CA 2K3YA 2RK1A 2WSCE 3P8TA 4KGXB 1YN8A 1UGSB 1IRXA 1QWFA 5GANh 1HTTA 1O75A 2CYZB 4P75C 4IUTA 2A28A 2LC4A 2ODRC 1Z7NA 3ZBDA 2PVGB 1EVKA 1HXDA 4XK8E 2ARSA 3E9FA 3HTRA 1OQKA 2I4LA 2RI2A 3MEAA 3QYHB 4E7IA 3OYKA 1PRLC 4OMFB 3P8HA 1KJWA 3OBYA 1Q7YU 4YRFA 2A8EA 4D6WA 3IALA 1JB0E 2LCLA 2ALYA 1KC8U 4D8KA 2J6KA 2RHSB 4TVAB 2RMOA 4J9BA 4C8QF 2ED1A 1VQ7Q 1UHCA 2E6ZA 3EG9B 3LC0A 1SG5A 2RI3A 4PK4A 4ESRA 5GMKe 3OD1A 3PZCA 3GNFB 4HVCA 5KYXA 3GF5A 1H641 1YJWT 5LJ5g 2H3EB 2RHSA 4TVAA 4K87A 4PJOA 2ZAEA 3EG9A 2L3SA 3KUFA 3IG2A 2QEXA 3CCSA 3QNEA 3TU4K 1JBMA 2WSFE 4QVDA 1RACB 3J81E 4H2YA 2KRMA 1KQSA 2EL9A 2XKOC 4E7JA 2CH4A 4DBRA 2OTJQ 4BWAA 5FRMA 1NG2A 1UG1A 4F7UE 4YCUA 2ECZA 4XU1A 4OP0A 2GF7A 2M51A 4M75E 4JRPA 1GFDA 3L1AA 3RF1A 1UEBA 4UP7A 2X51A 1U1SA 3EFSA 4HCCA 4XU3A 5FW9A 3VS1A 5C53B 3INZA 4C8QB 1V76A 2QXFA 1NLPC 1H4TA 2BZ8A 4MZMA 1RAIB 3JCMX 2F5TX 3ZFJA 4BE2A 2DYIA 3P8YA 4LDWA 4RCCA 3H0IA 4C8QA 3SDZA 3JCMf 1VQPT 3BFMA 4G84A 1XQHA 3CCEA 3IKLA 1M90C 3CPWS 5LJ5d 1FMWA 5KE3A 3RMQA 1M1KR 2DJQA 2OJ2A 4CC2A 3U23A 2YUQA 4RTVA 1WIEA 3C4SA 4J9FA 5J3BA 3NENA 2LNHB 4P3NA 2DL8A 3CCUT 4AH6A 1YFNA 4DBHA 4F04B 1EX4A 4LDXA 4CH3A 1IL2A 2HBWA 2ESWA 4L5GA 4JRIA 2GTJA 2P84A 3DLLA 3G4SA 1PD0A 5I21A 1WQWA 2PZ1A 3M59A 4AFZC 4OGCA 1OX9A 2J6FA 1VQNA 2PUKB 2E70A 5FROA 4Z8AA 2CP2A 3NPFA 4E2FB 2ARTA 2ENMA 2RO0A 4PLLA 3VS4A 4M75D 2BE7D 2D9TA 2A3LA 2NWMA 2DL7A 4HCZA 3W3SA 1YJWQ 1QQJA 4LXCA 1RAGB 1NM7A 2EPDA 3LGLA 1G5HA 1VQOA 3VQYA 1M1GA 4HVWA 3EG1A 2P0KA 3EGDB 3M58A 4J9EA 1PSEA 1WFWA 4H2WA 4LDYA 4TVWA 3RR6A 2IVWA 1NEGA 2RH2A 3UPUA 2ED0A 4FSSA 1QP3A 1S1NA 2WACA 2RM4A 3SHWA 3EGDA 4HKEA 1O9SA 2QEXT 1M2VA 4JJCA 2FG0A 3BE3A 2K2VA 4OF1A 2ZNIA 3OB9A 1ZBXA 2P0QA 3CC7Q 4AT1B 2ROTA 5GMKi 1H3ZA 3P8DA 3A8LB 2AMCA 1Q82C 4IUQA 1BI0A 3PMIA 1HC7A 3M5AA 5C6SA 2ZZDA 3CBMA 4RTTA 3CMAA 2I0NA 5C52B 3HRKA 1VQKA 3A5YA 2CUDA 3DKMA 3QZ5B 2EWNA 1N5ZA 4J6YA 4KULA 5I2MA 1BBUA 1AWJA 2DVEA 3R6NA 1XNIA 4WJ3M 1OU8A 4X5OA 2C0OA 4ORZA 5CKEA 3LLRA 1QWEA 3DB3A 4BD3A 1WDXA 3CCQQ 1D3BB 2K5IA 4PKCC 2OTLQ 3EFOB 2BKDN 2K3XA 2PQWA 5IAYA 1ZSZA 1NJIC 2HCKA 2NUPA 5M9OA 1WZOA 1RLPC 7AT1B 4IUPA 2RHIA 2O01E 2VKNA 3EFOA 2EYZA 5HCKA 3JB9H 1KQSS 5GAMg 4P71A 4BY6C 5FU7B 3TVTA 4F7UF 3I9QA 3JCMc 3GPLA 2J06A 2Q7GA 2FPFA 4PHCA 2XG8D 3VYGA 5E3IA 1R0BG 3C12A 1Q81R 5GAOr 4M75F 1GFCA 3JV3A 4Q15A 1BI1A 2DZ9A 4BI3A 2KRSA 1K8AR 3JCMh 2EQIA 1IHWA 2O2OA 2AT1B 1E6GA 2K3BA 4WF2A 1OZ2A 2HSEB 2EQMA 1WHKA 1WNLA 1M90U 2DA9A 4EMKB 2EQJA 1QVFP 1H8KA 1VQNT 4P74C 1I1JA 1G3WA 1N27A 2ZPHB 1QVGP 5LJ5f 3RIRA 2RHXA 2MF2A 4EMKA 1B3QA 3CCLA 5A2QE 4PFZA 4A4HA 1L0WA 1GCPA 1G5IA 3M0UA 2QA4T 1VQMA 3SEMA 3OYMA 4A4GA 2EW3A 1M9SA 1A0NB 3V8KA 2R5AA 4Y28E 3CCSQ 3A31A 1D1AA 1MMGA 1W6XA 1BYMA 1R8OB 2VXEA 2LZ6B 4JRKA 4YRTA 4YRNA 2KK4A 2XU8A 3CXCP 2EBPA 1VQ9A 3VS6A 1WGSA 4OVAA 3CCJA 1H4QA 2KT8A 2RK2A 3JCMP 2ODRD 1XJWB 2MIOA 5A0LA 4CS4A 4QVCA 1BBZA 5GAMe 1NJ6A 3FC3A 2DF6A 2FZCB 4M75A 2JTMA 2AKWB 1AZEA 1QVGA 2ZPFB 2DNUA 4J9DA 2M9UA 2ZIOA 1ASZA 2E41A 4RKUE 1G3TA 1GCQA 2HL3A 1N9SA 1F1BB 1LJOA 3JAME 4CC4B 2NYSA 2MWOA 4QW2A 1NZ9A 1I81A 1QE0A 1TOVA 3H0FA 3CMAT 4UC4A 2L5QA 3LH5A 1EFWA 1HK9A 1WXBA 3OYGA 2CSIA 1OX8A 1VYUA 4KUIA 3CCEQ 3QWYA 3CXCA 4NS5A 4YRRA 4LVKA 1Y96B 2YRCA 3EGUA 1KOGA 4F14A 4BI4A 3NTIA 2DAQA 1U5SA 2K57A 3FJPA 1Q82U 5D7UA 4CRIA 1Y96A 3MF2A 1WU7A 3PIOA 2JMAA 1YJNQ 1BBWA 3H41A 5GMKh 3ERRA 1JU5C 2FZKB 3ZEHA 4K86A 2DXTA 3G4SQ 2QGGA 3J80E 3L2RA 5HY6A 3GIBA 2BZXA 4M78E 4HWPA 3EH2A 1NYQA 1PD1A 2J6OA 4N4GA 4LUDA 2DBKA 3M4PA 1VQ6A 2HNIA 3UWNA 2AIRB 1NJIU 3X25B 2Q7HA 3UH0A 1K73R 5GJVB 1X43A 4M77C 3SWNB 2P4TA 2DK3A 2FYKA 3UA7A 3MF1A 2HQHA 2KRNA 3E9GA 2LDMA 1E22A 2P5IA 1ADJA 2RJFA 4LNSA 1VQOQ 1K9MC 4YREA 4UP8A 3OYEA 4X34A 3HXYA 3CCLT 3SWNA 4RUGA 3CCRT 2HAXA 2E3CA 1W4SA 2MAMA 5FU6B 1VQMT 4NL3A 3CC2T 1UGQB 4RTUA 4OLFA 3OYDA 4EX5A 4ME7A 1TSFA 3S3NA 1I4K1 4KH1B 1UTIA 2IPOB 4K11A 1G2BA 4L87A 2QQBA 1OPKA 3JB9D 1I07A 2V26A 4N0AC 2W10A 5LJ5h 4M4ZA 2QG9B 4RG8A 3NGPA 3M55A 4RTWA 4BW9A 3JB9I 1K1ZA 2MPXC 1Q86C 1NPRA 2RF0A 1KSWA 4TVYA 1M4ZA 2A7YA 1KD1C 1VQKQ 1B70B 3PVLA 1AOJA 3EHQA 3QPHA 3QXEB 4M78D 4KH0B 2CZ1B 4RTZA 4O2DA 1JO8A 1OYXA 3RKXA 2AKKA 5GMKj 1B70A 1YI2Q 4P75A 3CD6A 2X4WA 2M02A 3HTZA 4J7FA 3MPUB 4PNOA 1LPLA 4Z89A 2AK5A 4BE0A 4JJNK 2ZR3A 1U06A 3H8ZA 2RB6A 1X2QA 2GFUA 5GAMf 2EJGA 2XGTA 1VQ7T 1YFSA 3JCMd 3VJPA 4RG2A 2HD0A 4M7AG 1BIAA 2VV5A 4Q6GA 4HT8A 3NEMA 4ZGDB 1U8RA 3G1ZA 4TWAA 4CH6A 1N6AA 5GAN7 1QVGS 1G3SA 3LX7A 4TQFA 2DM1A 3HRSA 2JOYA 2L3QA 4XTXA 3OS1A 2C8MA 3CC7A 4X9CA 4BDYA 3UGTA 4NCXA 2IY5B 3HRIA 4YRMA 2OTJT 1H3HA 1YWPA 3HXZA 5LJ3e 2LT4A 2D6FA 3HXUA 2P0LA 3BY7A 2KROA 3A5ZB 3CXCS 1FYFA 4L6V5 3VYHB 1SPKA 4Z02A 3FEOA 1EOVA 2IY5A 3QSUA 3VS0A 1SHGA 4HWOA 3C0CA 1B07A 3L2WA 4YRLA 5LJ5j 2PNIA 5CVIA 2RPNA 4BUGA 1D0XA 2YHTA 3JB9F 3A5ZA 3G1JA 2D8JA 4C0ZA 11ASA 3QTCA 4YPFA 3CCQA 1VQ9Q 2RQRA 4P3PA 1X2KA 2AZSA 3CCJQ 3ZL7C 2DILA 2VVKA 3MP6A 2ROLA 3G71A 5GMKl 4P72C 2QHVA 3WVDB 2CS7A 4M78F 4DEXA 3EHRA 2KY9A 2ZIMA 3IQLA 4JUVA 4QVZA 2KEAA 1BKBA 2Y4XA 3X24B 4ZGJB 1U1TA 4AMCA 3OS5A 5FRNA 2HKNA 1K9MU 3NFCA 3QG1A 1Y07A 5CKDA 3HFNA 3OYAA 1WYXA 1X2HA 1N9WA 3QYGB 1KQSP
chains in the Genus database with same CATH topology
5KNNA 3QO3A 1RIQA 2F5KA 3A8GB 4C92G 4YCVA 3S6WA 3JCMQ 1NJ8A 2DU7A 3OSSC 3CD6T 2E5AA 4PL6A 4M78B 1Q86U 3LWHA 2LX9A 1KD1U 1QF6A 2YLCA 4M78A 3M57A 3MP1A 2QTXA 2BIVA 2HQEA 5CAIA 3E9IA 4MZPA 1SRYA 2QDYB 3OW2A 4XTVA 2XK0A 4FT4A 5EG2A 3META 1EIYB 2LQKA 4O6JA 2KDSA 4V2SA 5GAMh 4H2VA 2Y4YA 2PVDB 3CC7T 3KBGA 3CMQA 4LVLA 2NLUA 1EIYA 2FB7A 1KMNA 1ATIA 5CKFA 1EVLA 1ASYA 1FXXA 2DJZA 2XDBA 3TEEA 4LD6A 4P73C 4FSXA 3A8OB 4IUUA 1WPYA 2H3JA 4KUDK 4Y91A 4HT9A 2K4YA 3CCQT 2C06A 2OTLT 4FL6A 1S72A 5I2SA 3PTAA 1YJNA 3M9QA 3HP9A 4N4IA 4E7KA 1YCYA 5DY9A 5ELNA 1G5VA 2QHSA 2L8DA 4HWSA 4OB0B 3JCMV 2M0OA 3ASKA 2Q5HA 4MDWA 5CR2A 3TEGA 2KVQG 3I56A 4BY6B 2PMFA 3VU3C 1YFRA 4M7AC 4M7DC 3HFZB 2QQAA 1IZ6A 4EPCA 1WJSA 2P0PA 4PJOC 2V8JA 1KHCA 4C5GA 1TH7A 3GOXA 2I4MA 2CZ0B 2R57A 3QO7A 4QQ6A 3NELA 5HGQA 3HFZA 4GY5A 3V7CA 4X9DA 5GAOn 5GAMj 3L2VA 4M77G 5C51B 5GAN3 1YHQA 1E24A 4LDVA 2E12A 4J8OA 3S3OA 3M54A 5J26A 4E7HA 1M5Q1 4R55A 3ICAA 3CCST 2ZT7A 1IREB 2ZZEA 5AYFA 1MHNA 1M1FA 3PNWC 3CBOA 4XEMA 1QP2A 1KQ2A 1JJ2A 2DXUA 2Q7EA 1VIEA 2DU5A 3PFSA 3HRTA 4C8QC 5F5WA 4N4HA 4HCBA 2E10A 2JTFA 2M16A 1RI0A 1YI2A 2O4XB 3CCMA 4RMOA 2VGNA 3FB9A 2ZT8A 2GCXA 2LNVA 3BW1A 2F69A 3CCET 2XD0A 5GAOp 2O4XA 1D3BA 1P92A 5CCAA 4M77F 3QZ9B 4B9XA 3OYLA 1VQZA 5GANe 4A4KA 3OW2S 1YJNT 4C92C 3RL6A 3TUPA 1VQ8A 1NPPA 3G4ST 3RGLA 3G7ZA 4P5NA 3OS0A 4YYEA 4YRGA 2ZPGB 4XTWA 4CS3A 3PCOB 2XI9A 3OBWA 1YBYA 3JSCA 4H2UA 3G6EA 5CIUA 3WQZA 5ELOA 3QBYA 2DTHA 3E19A 1EQRA 2PMEA 3PCOA 4DOVA 1VQOT 4M77B 4LVJA 2CJBA 2LVMA 3GLXA 3I7FA 2DD4A 2AHJB 3QHSA 4EO4A 5GAMd 2EQKA 4M77A 4MDXA 2ZR2A 3VQWA 4YRSA 3N5BB 2QQ9A 2LRQA 3L2QA 1USYC 2E5QA 2WSEE 4XQ3A 1UGPB 4XEOA 1BIBA 1W2BA 5IT9E 3REXA 3JCMW 3I55A 4PG3A 1J5WA 3NTKA 3WXMB 4YRPA 4EDUA 1SSFA 3UFGA 4YCWA 2AKWA 4L59A 2D0QB 1E1TA 2LCCA 3OA6A 4FT2A 2RJEA 4XU0A 1FX7A 1VQKT 3QUIA 1SERA 2K5LA 5GAN5 4N0AA 5CO7A 2RHYA 4H2XB 4ZTUB 3CBPA 4J5YA 1YITA 1YI2T 1H4SA 1WJQA 4BE1A 3HFVA 1N8RC 4H2XA 4TTVA 4J6XA 2EKOA 3SD4A 4CH5A 5K1XA 1VQ5A 5FU7C 1JJ2S 1YGBA 1ADYA 2KSSA 3L2UA 1Z7MA 3OMGA 4YRJA 3MEYA 1YB3A 1B7YB 2XICA 1V29B 3WVEB 4XTZA 2KAFA 3OYBA 1X75C 3QO5A 3CC4A 1B7YA 4TVRA 2MMPA 2ARUA 3M4QA 1OI1A 4MMLA 2I2LA 2QHUA 4BB7A 3J7AF 2E1HA 2EYQA 2RHZA 3MO8A 2E6NA 3ME9A 2LQ8A 5CKBA 2V8IA 1X55A 4WI1A 3KFUA 3H6ZA 4LD9K 4M75C 4RDXA 3HSBA 1VQ9T 3CCJT 3HHTB 3L2ZA 3RACA 3M4YA 3RKYA 1BI2A 2MWPA 2X4JA 3BDLA 4JLIA 3T9NA 4ZGEB 4YROA 3QIIA 1LOJA 4C0DC 3RESA 5LJ3g 1AHJB 3P8VA 4NOYA 4JS5A 1KHIA 4LDUA 5GAN4 4YRCA 4PLIA 1EIFA 4J6WA 2JZ2A 1VQLA 1PSFA 1G51A 3X28B 4KBMB 5KCHA 4IUVA 2VXFA 2FHDA 3QJ6A 4H2SA 5GAOq 4M7DG 2XHCA 5K1PA 1M1KC 4XAXB 3MHXA 4PJOG 4LVIA 1W2BS 4OB3B 5A0GA 1VQ5T 4HWTA 1NNHA 3CEYA 2ZCEA 2HBPA 3V7SA 5LJ3d 1N8RU 1VQ6T 1YJ9A 3MEUA 1UB4A 1VIFA 4WJ4A 3A7RA 2G3RA 3SFMA 2DIGA 3E1SA 4C0FA 2IG0A 4Q5WA 1DJ7B 3PT9A 5FU6C 5DM7R 2L89A 4C8QG 3MCAB 4QQDA 1VQPA 2VGMA 1WQ7A 3HL8A 3NTHA 3M53A 4RQEA 4B9WA 4A54A 1LYLA 2K5FA 4M7AF 4M7DF 2RJCA 3OYJA 4P73A 3HXWA 3JRZA 3EAEA 2XDPA 3CCUA 1X56A 2EJ9A 2DXBA 3OMCA 3P8BB 4TQDA 3X26B 4KT0E 5GAN8 4NL2A 1JJCB 5CQYA 2ALYB 3GNGA 1JJCA 2ZZFA 1VQLT 2EAYA 2ZT6A 4M7AB 4M7DB 4PJOB 4OB1B 3MEWA 3OY9A 4M7AA 4M7DA 3V8LA 3OQ5A 4M77E 2CJ9A 4RCBA 3V7RA 3O8VA 3PIPA 4DQ2A 4EMGA 1OZ3A 2RA2A 1Q81C 1K8AC 1B76A 3OSVA 3R07A 3R6OA 3OS2A 3A8HB 1YJ9T 4O5VA 3QKJA 1M1KU 4IKFA 3CMEA 1SETA 4C92F 2R58A 1KG1A 5J39A 4DOWA 1WLEA 2J3LA 2BUDA 2GFAA 1ZQ1A 2DQ3A 5GANj 1XOVA 4J7IA 3G71T 3RERA 1KQ1A 2XTIA 1ZHIA 3URGA 3CCVA 5LJ3f 1YIJA 3OYIA 3LSQA 2KMTA 1H4VB 5LJ5e 5HKCA 5KH6A 1X6OA 4M77D 2CIMA 1LNXA 4KQEA 3M4GA 2ZNJA 4C92B 2ZPBB 3JCMJ 3NETA 2I4NA 4E7LA 2QQSA 3OYNA 3VUBA 3HPWA 4ELZC 4C92A 2R5MA 5GMKm 3DSQA 4CH4A 4H2TA 4HWRA 4M78C 2RD1A 4KR2A 2ZPIB 4P74A 2QA4A 3LYIA 5CKHA 3A32A 5GANg 3TCJA 4XTYA 3RMSA 2I4OA 4ZIBA 4FM4B 4YRKA 4ZTJA 2CGHA 5IN1A 2E65A 2DDZA 4F7UG 2ZT5A 2ZTGA 3A8MB 4ZN1A 4E47A 4ATOA 1W66A 4RMFA 4M75G 3BDUA 2AMCB 4G85A 2M1HA 2DKGA 2L3RA 4QQGA 3VBBA 4YP0A 5C0MA 3VV0A 2QI2A 1K73C 1BI3A 4A4FA 1USYA 3VUZA 2FVUA 4HT4A 3CMET 3HRUA 5DLQE 2J3MA 4GLKA 3VQVA 3QJYA 2RHQB 3VQXA 1Q81U 5GAOl 2DQ0A 1K8AU 4ZTZB 3FRNA 2RHQA 4II1A 1XTDA 2CKKA 5GANd 3HXVA 3L4GB 4BACA 4ZTFA 5KE2A 1S72T 4FU6A 1MGQA 3CCVT 3HXXA 3F70A 1YIJT 3L4GA 2B8AA 2PUOB 3E9HA 3FIFA 5HK0A 2LTOA 3ER0A 1C0AA 2HQXA 4J15A 4ELYC 3I56T 2DEQA 5LL6S 4C0GA 1M8VA 2RJDA 5D6WA 1I5LA 1NE8A 2X35A 2EJFA 3A7UA 5DLOA 2LT1A 3OYFA 2E64A 5LJ3h 1SESA 2CZ7B 3BJUA 2RHUA 4UPAA 1Y7XA 4YRQA 5KCOA 4DA4A 2ZXFA 2X4YA 3UT1A 3FDRA 1NJ5A 2QQRA 4K88A 3CCRA 3HY0A 2JVVA 1YHQT 4JLGA 4ZN3A 4E51A 3CC2A 2XDDA 2ZPEB 3AHUA 5D6XA 3A7AA 3LGFA 5CQXA 2ZGWA 3GP8A 4F7UB 2V8KA 2DD5A 2DTIA 3RKWA 5HK3A 4M75B 4FIBA 1JRIA 2DZCA 5D6YA 4YDQA 4F7UA 3HY1A 3REUA 1QVFA 3MQZA 3V8JA 3S3MA 3CPFA 3OYCA 2OAUA 4MZTA 2VC8A 2DXCA 4C0DB 2VUBA 2EQUA 4IURA 1Y71A 3PMTA 4LVMA 3CCMT 4A4EA 2EFIA 4P71C 4P3OA 3EFRA 3JCMb 2YRVA 2JN0A 4JRQA 1NYRA 3QDRB 3RUXA 2ZINA 2PU9B 3IKMB 1VQ7A 2C7IA 1B34B 1K73U 4M7AE 4M7DE 5LJ3j 4H02A 1VQ8T 4PJOE 3KXTA 3LH0A 3MEVA 4BDZA 1B34A 3C95A 5GAN6 1RL2A 4EMKC 1VUBA 4UP9A 4BI8B 3FLGA 1GGMA 3JB9J 3TEHB 3DB4A 3UGQA 4OB2B 4KR3A 3TREA 2OTJA 2FL7A 3G6ET 2DTOA 5GAOm 3TEHA 4OGEA 2DIQA 2EIFA 3PGGA 4MMKA 5GANf 3UDCA 1PYSB 2CJAA 2X4XA 3LW5E 5CK9A 3QO8A 3A74A 1VQ4A 3DLMA 3HKSA 1PYSA 1QW1A 4VUBA 4C8QE 12ASA 2NS6A 4C5EA 3L42A 1B8AA 1NJ2A 5GAN2 2QHTA 4C5IA 1Q7YC 3LSSA 2ZCFB 1WYDA 1E1OA 3JCMg 3SB2A 1KC8C 4XTUA 2KQWA 4HA8A 4M7AD 4RQFA 4M7DD 2YLBA 3I55T 4P72A 1UGRB 2JUFA 1N9RA 4PJOD 3Q1JA 4J83A 2VYTA 2ZZGA 2DPPB 4YTLA 4A53A 1X54A 4DPGA 4JDSA 5L8RE 1I8FA 1X2GA 4C92E 1YITT 4EMHA 2Y90A 1KMMA 2CZ6B 3JB9G 2Q5IA 2PVOB 2RI5A 5A0DA 1YJWA 2XIDA 4JS4A 1FWZA 5FLXE 1GXIE 1QVPA 4M78G 1X01A 3CPWA 3MP8A 4CS2A 2GQVA 4C8QD 3JCMe 2JNGA 1QVFS 3HFOA 1G3YA 3LWIA 1WJRA 3SWNC 4XU2A 3M56A 3OYHA 3CC4T 4CI0C 2MI6A 4R56A 3C94A 4YRIA 3OYYA 4C5HA 1YFTA 4C92D 1VQ4T 1NJ1A 3VKIA 2DO3A 2OTLA 4PJOF 3X20B 2G4CA 2K3YA 2RK1A 2WSCE 3P8TA 1UGSB 5GANh 1HTTA 1O75A 2CYZB 4P75C 4IUTA 2LC4A 2ODRC 1Z7NA 3ZBDA 2PVGB 1EVKA 1HXDA 4XK8E 2ARSA 3E9FA 2I4LA 2RI2A 3MEAA 3QYHB 4E7IA 3OYKA 4OMFB 3P8HA 3OBYA 1Q7YU 4YRFA 2A8EA 4D6WA 3IALA 1JB0E 2LCLA 2ALYA 1KC8U 2RHSB 4TVAB 4C8QF 2E6ZA 3LC0A 2RI3A 5GMKe 3OD1A 3PZCA 3GNFB 4HVCA 3GF5A 1H641 1YJWT 5LJ5g 2RHSA 4TVAA 4K87A 4PJOA 3KUFA 3IG2A 2QEXA 3CCSA 3QNEA 3TU4K 1JBMA 2WSFE 4QVDA 3J81E 4H2YA 1KQSA 2EL9A 2XKOC 4E7JA 4BWAA 5FRMA 4F7UE 4YCUA 4XU1A 4OP0A 2GF7A 4M75E 4JRPA 3RF1A 3L1AA 1UEBA 4UP7A 1U1SA 3EFSA 4HCCA 4XU3A 5C53B 3INZA 4C8QB 2QXFA 1H4TA 4MZMA 3JCMX 2F5TX 3ZFJA 4BE2A 3P8YA 4LDWA 4RCCA 4C8QA 3SDZA 3JCMf 1VQPT 3BFMA 4G84A 1XQHA 3CCEA 3IKLA 1M90C 3CPWS 5LJ5d 5KE3A 3RMQA 3C4SA 5J3BA 3NENA 4P3NA 3CCUT 4AH6A 4LDXA 1IL2A 4CH3A 4L5GA 4JRIA 3DLLA 3G4SA 5I21A 1WQWA 3M59A 4OGCA 1VQNA 2PUKB 2E70A 5FROA 2ARTA 2RO0A 4PLLA 4M75D 2D9TA 2A3LA 4HCZA 3W3SA 3LGLA 1G5HA 1VQOA 3VQYA 1M1GA 2P0KA 3M58A 1PSEA 4H2WA 4LDYA 4TVWA 2IVWA 2RH2A 3UPUA 1QP3A 2WACA 2RM4A 4HKEA 1O9SA 2QEXT 2K2VA 4OF1A 2ZNIA 3OB9A 1ZBXA 2P0QA 5GMKi 1H3ZA 3P8DA 3A8LB 2AMCA 1Q82C 4IUQA 1BI0A 3PMIA 1HC7A 3M5AA 5C6SA 2ZZDA 3CBMA 3CMAA 5C52B 3HRKA 1VQKA 3A5YA 3DKMA 3QZ5B 2EWNA 4J6YA 4KULA 5I2MA 1BBUA 2DVEA 1XNIA 4WJ3M 4X5OA 5CKEA 3LLRA 3DB3A 4BD3A 1D3BB 2K5IA 4PKCC 2BKDN 2K3XA 2PQWA 5IAYA 1NJIC 5M9OA 4IUPA 2RHIA 2O01E 3JB9H 1KQSS 5GAMg 4P71A 4BY6C 5FU7B 4F7UF 3GPLA 2Q7GA 3JCMc 5E3IA 4PHCA 2XG8D 3VYGA 3C12A 5GAOr 4M75F 4Q15A 1BI1A 2DZ9A 4BI3A 3JCMh 4WF2A 1OZ2A 2EQMA 1WNLA 1M90U 4EMKB 4P74C 2EQJA 1VQNT 1G3WA 1N27A 2ZPHB 5LJ5f 3RIRA 2RHXA 2MF2A 4EMKA 3CCLA 5A2QE 4A4HA 1L0WA 1G5IA 2QA4T 1VQMA 3OYMA 4A4GA 1M9SA 3V8KA 2R5AA 4Y28E 3A31A 4YRTA 1BYMA 4YRNA 1R8OB 2VXEA 4JRKA 2KK4A 2XU8A 1VQ9A 1WGSA 4OVAA 3CCJA 1H4QA 2RK2A 3JCMP 2ODRD 5A0LA 4CS4A 4QVCA 5GAMe 1NJ6A 3FC3A 4M75A 2JTMA 2AKWB 1QVGA 2ZPFB 2M9UA 2ZIOA 1ASZA 2E41A 4RKUE 1G3TA 1N9SA 1LJOA 3JAME 2MWOA 4QW2A 1NZ9A 1I81A 1QE0A 3CMAT 4UC4A 2L5QA 1EFWA 1HK9A 3OYGA 4KUIA 3CXCA 4NS5A 4YRRA 4LVKA 1Y96B 1KOGA 4BI4A 3NTIA 2DAQA 1Q82U 2K57A 3FJPA 4CRIA 1Y96A 3MF2A 1WU7A 3PIOA 1BBWA 5GMKh 3ERRA 3ZEHA 4K86A 2DXTA 3J80E 3L2RA 5HY6A 3GIBA 4M78E 4HWPA 1NYQA 4N4GA 3M4PA 1VQ6A 2HNIA 3UWNA 1NJIU 3X25B 2Q7HA 3UH0A 4M77C 3SWNB 2P4TA 2DK3A 2FYKA 3MF1A 3E9GA 2LDMA 1E22A 2P5IA 1ADJA 2RJFA 4LNSA 1K9MC 4YREA 4UP8A 3OYEA 4X34A 3HXYA 3CCLT 3SWNA 3CCRT 2HAXA 2E3CA 1W4SA 2MAMA 5FU6B 1VQMT 4NL3A 3CC2T 1UGQB 4OLFA 3OYDA 4EX5A 4ME7A 3S3NA 1I4K1 4L87A 2QQBA 3JB9D 4N0AC 5LJ5h 4RG8A 3M55A 4BW9A 3JB9I 1Q86C 1NPRA 4TVYA 1M4ZA 2A7YA 1KD1C 1B70B 3QXEB 3QPHA 4M78D 2CZ1B 4O2DA 1OYXA 3RKXA 5GMKj 1B70A 4P75A 3CD6A 2X4WA 3HTZA 4J7FA 4PNOA 4BE0A 4JJNK 2ZR3A 3H8ZA 2RB6A 2GFUA 5GAMf 2EJGA 2XGTA 1VQ7T 1YFSA 3JCMd 3VJPA 4RG2A 2HD0A 4M7AG 1BIAA 2VV5A 4Q6GA 4HT8A 3NEMA 4ZGDB 1U8RA 3G1ZA 4TWAA 4CH6A 1N6AA 5GAN7 1QVGS 1G3SA 3LX7A 4TQFA 3HRSA 2JOYA 4XTXA 3OS1A 2C8MA 3CC7A 4X9CA 4BDYA 3UGTA 4NCXA 2IY5B 3HRIA 4YRMA 2OTJT 3HXZA 5LJ3e 2LT4A 2D6FA 3HXUA 2P0LA 3BY7A 3A5ZB 3CXCS 1FYFA 4L6V5 3VYHB 4Z02A 3FEOA 1EOVA 2IY5A 3QSUA 4HWOA 3L2WA 4YRLA 5LJ5j 5CVIA 4BUGA 2YHTA 3JB9F 3A5ZA 4C0ZA 11ASA 3QTCA 4YPFA 3CCQA 4P3PA 3G71A 3MP6A 5GMKl 4P72C 2QHVA 3WVDB 2CS7A 4M78F 2KY9A 2ZIMA 4JUVA 4QVZA 1BKBA 2Y4XA 3X24B 4ZGJB 1U1TA 3OS5A 5FRNA 1K9MU 3NFCA 3QG1A 1Y07A 5CKDA 3HFNA 3OYAA 1X2HA 1N9WA 3QYGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E51 A;  3RKY A;  5KNN A;  4JLI A;  3QO3 A;  3W3S A;  1RIQ A;  3AHU A;  3A7A A;  2ZGW A;  4YRO A;  1LOJ A;  1G5H A;  3RES A;  4F7U B;  5LJ3 g;  4C92 G;  3VQY A;  2DTI A;  3RKW A;  4YCV A;  3JCM Q;  4M75 B;  1NJ8 A;  3P8V A;  4NOY A;  2DU7 A;  1JRI A;  2DZC A;  5GAN 4;  2E5A A;  4H2W A;  4YDQ A;  4TVW A;  4YRC A;  4F7U A;  3HY1 A;  3REU A;  4M78 B;  4J6W A;  2RM4 A;  3V8J A;  1QF6 A;  1G51 A;  2VC8 A;  2YLC A;  2ZNI A;  4M78 A;  2VXF A;  2QTX A;  5GMK i;  4H2S A;  5CAI A;  3E9I A;  5GAO q;  4M7D G;  2AMC A;  5K1P A;  1HC7 A;  1SRY A;  4P71 C;  4P3O A;  3EFR A;  4XTV A;  4PJO G;  5C52 B;  1EIY B;  3HRK A;  3JCM b;  4V2S A;  3A5Y A;  2JN0 A;  5GAM h;  4H2V A;  2EWN A;  1NYR A;  4J6Y A;  1BBU A;  4HWT A;  2DVE A;  3RUX A;  2ZIN A;  4WJ3 M;  1NNH A;  3CMQ A;  3IKM B;  2C7I A;  4X5O A;  1EIY A;  2FB7 A;  1KMN A;  1B34 B;  2ZCE A;  4M7A E;  3V7S A;  4M7D E;  1ATI A;  5LJ3 d;  1D3B B;  1EVL A;  1ASY A;  5LJ3 j;  2DJZ A;  4H02 A;  4P73 C;  4PJO E;  4WJ4 A;  1B34 A;  5GAN 6;  3A7R A;  4EMK C;  4UP9 A;  1WPY A;  3JB9 H;  1GGM A;  3JB9 J;  3TEH B;  4Y91 A;  5GAM g;  4HT9 A;  3UGQ A;  4P71 A;  4F7U F;  2Q7G A;  4KR3 A;  3JCM c;  5E3I A;  4PHC A;  5GAO r;  4M75 F;  4Q15 A;  2DZ9 A;  4C8Q G;  2DTO A;  3JCM h;  5GAO m;  3TEH A;  4WF2 A;  3PGG A;  1YCY A;  4MMK A;  5DY9 A;  5GAN f;  5ELN A;  1WQ7 A;  2QHS A;  4RQE A;  1PYS B;  4HWS A;  1WNL A;  4A54 A;  4EMK B;  1LYL A;  4M7A F;  4P74 C;  4M7D F;  3JCM V;  2CJA A;  2Q5H A;  3TEG A;  3QO8 A;  3A74 A;  4P73 A;  1PYS A;  5LJ5 f;  3RIR A;  3HXW A;  4EMK A;  4C8Q E;  12AS A;  1X56 A;  1B8A A;  1NJ2 A;  3VU3 C;  5GAN 2;  2PMF A;  1L0W A;  1YFR A;  2QHT A;  2EJ9 A;  1G5I A;  4M7A C;  4M7D C;  3LSS A;  1WYD A;  3HFZ B;  1E1O A;  3JCM g;  3SB2 A;  3V8K A;  4TQD A;  4XTU A;  4PJO C;  3A31 A;  5GAN 8;  4YRT A;  4YRN A;  4NL2 A;  4HA8 A;  2VXE A;  1JJC B;  1TH7 A;  4JRK A;  4M7A D;  2I4M A;  4M7D D;  4RQF A;  3QO7 A;  2YLB A;  3NEL A;  4P72 A;  5HGQ A;  3HFZ A;  2ALY B;  1H4Q A;  3V7C A;  4X9D A;  3JCM P;  2ODR D;  5GAO n;  1N9R A;  5GAM j;  4PJO D;  4M77 G;  4CS4 A;  4QVC A;  1JJC A;  5GAM e;  5GAN 3;  1NJ6 A;  1E24 A;  2ZZF A;  5C51 B;  2ZZG A;  2EAY A;  2ZT6 A;  4M75 A;  4M7A B;  1M5Q 1;  4A53 A;  4M7D B;  2AKW B;  1X54 A;  3ICA A;  4DPG A;  2ZT7 A;  2ZZE A;  2ZIO A;  1ASZ A;  1I8F A;  1X2G A;  2E41 A;  4C92 E;  4PJO B;  1N9S A;  4EMH A;  4XEM A;  1LJO A;  4M7A A;  2Y90 A;  1KQ2 A;  4M7D A;  1KMM A;  3V8L A;  3JB9 G;  2Q5I A;  2DXU A;  1I81 A;  4M77 E;  1QE0 A;  2CJ9 A;  4RCB A;  3V7R A;  2Q7E A;  1EFW A;  1HK9 A;  4DQ2 A;  4EMG A;  2DU5 A;  2RA2 A;  4C8Q C;  5F5W A;  4YRR A;  1B76 A;  1Y96 B;  2E10 A;  4M78 G;  3R07 A;  1KOG A;  1X01 A;  4CS2 A;  4C8Q D;  3JCM e;  3HFO A;  2K57 A;  3FJP A;  1Y96 A;  3MF2 A;  3FB9 A;  1WU7 A;  2ZT8 A;  1BBW A;  5GMK h;  3ERR A;  3BW1 A;  1SET A;  4C92 F;  3SWN C;  4K86 A;  2DXT A;  4XU2 A;  5GAO p;  1D3B A;  1WLE A;  3GIB A;  4M78 E;  2J3L A;  4M77 F;  4HWP A;  2DQ3 A;  5GAN j;  1NYQ A;  1VQZ A;  5GAN e;  4YRI A;  4C92 C;  3RL6 A;  3RER A;  1KQ1 A;  3M4P A;  2HNI A;  3TUP A;  2XTI A;  2Q7H A;  3UH0 A;  5LJ3 f;  3RGL A;  1YFT A;  4M77 C;  3SWN B;  3LSQ A;  2FYK A;  4C92 D;  1H4V B;  3MF1 A;  1E22 A;  2P5I A;  4YYE A;  1ADJ A;  5LJ5 e;  4YRG A;  4LNS A;  4YRE A;  4UP8 A;  1NJ1 A;  4XTW A;  4CS3 A;  3HXY A;  3PCO B;  4PJO F;  4M77 D;  2CIM A;  3SWN A;  2G4C A;  1LNX A;  2E3C A;  4KQE A;  3P8T A;  4H2U A;  3M4G A;  2ZNJ A;  4C92 B;  4NL3 A;  3WQZ A;  5GAN h;  1HTT A;  3JCM J;  5ELO A;  4P75 C;  4OLF A;  2DTH A;  2PME A;  1EQR A;  3NET A;  3PCO A;  4EX5 A;  2I4N A;  1I4K 1;  2ODR C;  4M77 B;  1Z7N A;  2CJB A;  4C92 A;  3I7F A;  1EVK A;  1HXD A;  4L87 A;  5GMK m;  3DSQ A;  3JB9 D;  2ARS A;  4CH4 A;  4H2T A;  4N0A C;  5LJ5 h;  4HWR A;  2I4L A;  3QHS A;  4M78 C;  4EO4 A;  2RD1 A;  5GAM d;  4BW9 A;  4M77 A;  3JB9 I;  2ZR2 A;  3VQW A;  4YRS A;  4KR2 A;  4P74 A;  4YRF A;  1USY C;  3IAL A;  4TVY A;  3A32 A;  1B70 B;  2ALY A;  4XQ3 A;  4M78 D;  4XEO A;  5GAN g;  1BIB A;  4XTY A;  2RHS B;  4O2D A;  4TVA B;  4C8Q F;  3RKX A;  2I4O A;  3JCM W;  3REX A;  5GMK j;  3LC0 A;  4ZIB A;  4PG3 A;  4YRK A;  1J5W A;  1B70 A;  4YRP A;  3UFG A;  2CGH A;  5GMK e;  3OD1 A;  4YCW A;  2E65 A;  2AKW A;  2DDZ A;  4P75 A;  1E1T A;  3HTZ A;  3PZC A;  4HVC A;  4PNO A;  4F7U G;  2ZT5 A;  2ZTG A;  1H64 1;  5LJ5 g;  2RHS A;  1W66 A;  4RMF A;  4TVA A;  4XU0 A;  4PJO A;  4K87 A;  2ZR3 A;  3QUI A;  4M75 G;  1SER A;  3BDU A;  2AMC B;  4G85 A;  5GAN 5;  2RB6 A;  2DKG A;  5GAM f;  3IG2 A;  4N0A A;  4H2X B;  3QNE A;  2EJG A;  3VBB A;  4YP0 A;  4ZTU B;  2XGT A;  1YFS A;  1JBM A;  4J5Y A;  4QVD A;  3JCM d;  4H2Y A;  4M7A G;  1H4S A;  1BIA A;  2EL9 A;  4Q6G A;  1USY A;  3HFV A;  4HT8 A;  3NEM A;  4H2X A;  4BWA A;  4TTV A;  3G1Z A;  4F7U E;  4YCU A;  2J3M A;  4TWA A;  4CH6 A;  5GAN 7;  3VQV A;  2RHQ B;  4XU1 A;  4OP0 A;  4M75 E;  4TQF A;  3RF1 A;  3L1A A;  4UP7 A;  4J6X A;  1U1S A;  3EFS A;  3VQX A;  4XU3 A;  5GAO l;  2DQ0 A;  5C53 B;  4CH5 A;  3INZ A;  4XTX A;  5K1X A;  4ZTZ B;  4C8Q B;  2C8M A;  1H4T A;  4X9C A;  2RHQ A;  1YGB A;  1ADY A;  5GAN d;  3HXV A;  3L4G B;  4NCX A;  3UGT A;  2IY5 B;  3JCM X;  3HRI A;  4YRM A;  1Z7M A;  3HXZ A;  3P8Y A;  5LJ3 e;  4RCC A;  4YRJ A;  4C8Q A;  3HXU A;  2P0L A;  3MEY A;  3JCM f;  1MGQ A;  1YB3 A;  3BY7 A;  1B7Y B;  3BFM A;  1FYF A;  4G84 A;  3HXX A;  4XTZ A;  3L4G A;  1EOV A;  2IY5 A;  3E9H A;  3QSU A;  3IKL A;  4HWO A;  5LJ5 d;  4YRL A;  5LJ5 j;  3QO5 A;  3FIF A;  2YHT A;  1B7Y A;  3JB9 F;  3A5Z A;  1C0A A;  11AS A;  2ARU A;  3QTC A;  4J15 A;  4YPF A;  3M4Q A;  3NEN A;  2DEQ A;  4P3N A;  4MML A;  2I2L A;  2QHU A;  1M8V A;  4P3P A;  1I5L A;  4AH6 A;  3A7U A;  2EJF A;  2E1H A;  5GMK l;  4P72 C;  4CH3 A;  1IL2 A;  2QHV A;  2E64 A;  5LJ3 h;  4JRI A;  4M78 F;  1SES A;  2ZIM A;  5I21 A;  1WQW A;  4JUV A;  1X55 A;  3BJU A;  4WI1 A;  3KFU A;  4UPA A;  4YRQ A;  1U1T A;  4M75 C;  4RDX A;  3HSB A;  2ZXF A;  3HFN A;  1X2H A;  1NJ5 A;  2ART A;  3L2Z A;  4K88 A;  1N9W A;  3RAC A;  3HY0 A;  4M75 D; 
#chains in the Genus database with same CATH topology
 5KNN A;  3QO3 A;  2JJ9 A;  1RIQ A;  4GLM A;  2F5K A;  3OW2 P;  2FRY A;  3A8G B;  5L23 A;  2D1X A;  4C92 G;  4F16 A;  2JM8 A;  4YCV A;  3S6W A;  3JCM Q;  1NJ8 A;  2YXY A;  2DU7 A;  3OSS C;  3CD6 T;  2E5A A;  2CH4 W;  4R0K A;  4PL6 A;  2HZY A;  2RQT A;  1M8M A;  4M78 B;  1Q86 U;  3VS2 A;  3LWH A;  4Z88 A;  2LX9 A;  2OI3 A;  1KD1 U;  1QF6 A;  1Z9Q A;  1WX6 A;  1VQ5 Q;  2YLC A;  1MUZ A;  4M78 A;  3M57 A;  3MP1 A;  2QTX A;  1AZG B;  1Q7Y R;  2BIV A;  2LQW A;  2J05 A;  2HQE A;  2Z0W A;  5CAI A;  3E9I A;  1KC8 R;  8AT1 B;  4MZP A;  1UJY A;  1SRY A;  2DLP A;  2NUT B;  1VQ6 Q;  1AWO A;  2QDY B;  3OW2 A;  1WXU A;  4XTV A;  2XK0 A;  4FT4 A;  5EG2 A;  3MET A;  1EIY B;  2LQK A;  4O6J A;  2KDS A;  4V2S A;  5GAM h;  4H2V A;  2Y4Y A;  1TG0 A;  2PVD B;  3CC7 T;  3KBG A;  2NUT A;  3CMQ A;  6AT1 B;  4LVL A;  2NLU A;  4RTX A;  2MK5 A;  1EIY A;  2FB7 A;  1KMN A;  1PHT A;  1ATI A;  2CDT A;  5CKF A;  1EVL A;  1ASY A;  1WLP B;  1FXX A;  2DJZ A;  2XDB A;  3TEE A;  4LD6 A;  4P73 C;  4FSX A;  1ZA1 B;  3A8O B;  2OAW A;  1ZA2 B;  1OUL A;  3A1P A;  4IUU A;  1M27 C;  1WPY A;  2E4H A;  2JTE A;  2YRD A;  1T0J A;  2H3J A;  4KUD K;  2YUP A;  4Y91 A;  4HT9 A;  2K4Y A;  1WI7 A;  3CCQ T;  2C06 A;  2OTL T;  4FL6 A;  4OMQ A;  3NHN A;  1S72 A;  5I2S A;  3PTA A;  2LX7 A;  1YJN A;  3M9Q A;  3E2U A;  3HP9 A;  4N4I A;  4E7K A;  1YCY A;  5DY9 A;  5ELN A;  3UF4 A;  1G5V A;  2HKQ B;  2QHS A;  2L8D A;  1D1C A;  1WHH A;  4HWS A;  4DEY A;  2A36 A;  4OB0 B;  2M0O A;  3JCM V;  4CC3 A;  3ASK A;  2Q5H A;  4MDW A;  5CR2 A;  1JXO A;  1K76 A;  3TEG A;  2GTO A;  2BZY A;  2KVQ G;  3I56 A;  4BY6 B;  3CD6 Q;  2C0T A;  2PMF A;  3VU3 C;  1YFR A;  1JJ2 P;  4M7A C;  2RQW A;  4M7D C;  2X3X D;  1VQL Q;  3HFZ B;  2QQA A;  3I5S A;  1IZ6 A;  4EPC A;  1WJS A;  1U3O A;  2P0P A;  4PJO C;  2V8J A;  1KHC A;  4C5G A;  2H8H A;  1TH7 A;  3GOX A;  2I4M A;  2CZ0 B;  2R57 A;  3QO7 A;  4QQ6 A;  3NEL A;  2YSQ A;  5HGQ A;  1ABO A;  3HFZ A;  1D09 B;  4GY5 A;  4QKU A;  3V7C A;  4X9D A;  1T3L A;  5GAO n;  5ECA A;  5GAM j;  3L2V A;  4M77 G;  1PG5 B;  1BB9 A;  1PCX A;  5C51 B;  5GAN 3;  1YHQ A;  1E24 A;  4LDV A;  2E12 A;  4J8O A;  2FO0 A;  3M54 A;  5J26 A;  3S3O A;  4E7H A;  1M5Q 1;  4R55 A;  2W0Z A;  1SRM A;  2O9S A;  3ICA A;  3CCS T;  2ZT7 A;  1IRE B;  2ZZE A;  5AYF A;  1MHN A;  2F1L A;  2FRW A;  1M1F A;  3AT1 B;  3PNW C;  2DRM A;  3CBO A;  4XEM A;  1QP2 A;  1KQ2 A;  1JJ2 A;  2ATC B;  1I0C A;  2DXU A;  1YJ9 Q;  1AD5 A;  2EYX A;  2Q7E A;  1QKX A;  1VIE A;  4FYV B;  4QT7 A;  2DU5 A;  3PFS A;  3HRT A;  4C8Q C;  2D0N A;  1WA7 A;  5F5W A;  2DET A;  2EKH A;  2L0A A;  2GQI A;  1QCN A;  4N4H A;  4HCB A;  2EGC A;  2E10 A;  2JTF A;  2M16 A;  3D7S B;  1RI0 A;  1AWW A;  1MMD A;  4FYX B;  1YI2 A;  2KXD A;  2O4X B;  3CCM A;  4RMO A;  2VGN A;  3FB9 A;  1M2O A;  2ZT8 A;  2GCX A;  2DL4 A;  2LNV A;  3G71 Q;  3CQT A;  3EG3 A;  3BW1 A;  2F69 A;  3CCE T;  1PWT A;  2XD0 A;  1W1F A;  1R0C B;  2F2W A;  5GAO p;  2O4X A;  1D3B A;  1P92 A;  1QCF A;  5CCA A;  1QCO A;  4M77 F;  3A98 A;  3QZ9 B;  4B9X A;  3OYL A;  1VQZ A;  5GAN e;  4A4K A;  2KR3 A;  3OW2 S;  1YJN T;  2YUO A;  4C92 C;  3RL6 A;  3TUP A;  2BTT A;  1VQ8 A;  1NPP A;  4PJM A;  3TSZ A;  1ARK A;  3G4S T;  3RGL A;  1ACM B;  1TWB A;  2F2V A;  3G7Z A;  2QGF B;  4P5N A;  2F2X A;  3OS0 A;  4YYE A;  4YRG A;  2ZPG B;  4OMP A;  4XTW A;  5IHI A;  1OV3 A;  4CS3 A;  2LMJ A;  3PCO B;  4FYW B;  1W2B P;  2XI9 A;  4A63 B;  3OBW A;  1YBY A;  3JSC A;  4H2U A;  2FZG B;  3G6E A;  5CIU A;  1GBR A;  1E6H A;  3WQZ A;  5ELO A;  2EYY A;  2FPE A;  3QBY A;  2DTH A;  3E19 A;  1EQR A;  2PME A;  3PCO A;  4DOV A;  1VQO T;  4M77 B;  4LVJ A;  2CJB A;  3M0Q A;  2LVM A;  3GLX A;  3I7F A;  2DD4 A;  2K79 A;  2LP5 A;  2AHJ B;  1M90 R;  3QHS A;  1OOT A;  2EYW A;  4EO4 A;  2CUB A;  5GAM d;  2EQK A;  4M77 A;  1UUE A;  4MDX A;  2ZR2 A;  3VQW A;  3H0H A;  4YRS A;  3N5B B;  2QQ9 A;  3M0S A;  2LRQ A;  1BCO A;  3L2Q A;  1BU1 A;  1USY C;  2E5Q A;  2WSE E;  2MOX A;  4LE9 A;  4XQ3 A;  2EVR A;  1UGP B;  4XEO A;  2K6D A;  1BIB A;  4KGZ B;  1W2B A;  5IT9 E;  4FYY B;  1M3B A;  3REX A;  3JCM W;  3I55 A;  4PG3 A;  1J5W A;  3NTK A;  3WXM B;  4YRP A;  4EDU A;  1SSF A;  3UFG A;  1M3A A;  2AKW A;  4L59 A;  4YCW A;  2D0Q B;  1E1T A;  2LCC A;  3OA6 A;  4FT2 A;  1G8X A;  3CME Q;  4PJJ A;  2IIM A;  2RJE A;  4XU0 A;  1FX7 A;  1VQK T;  3QUI A;  1SER A;  5FWB A;  2K5L A;  5GAN 5;  2CSQ A;  1ZSZ C;  4N0A A;  5CO7 A;  2RHY A;  4H2X B;  3M0R A;  2ABL A;  4FCY A;  4ZTU B;  1TTH B;  3CBP A;  4J5Y A;  1YIT A;  1BK2 A;  1WHJ A;  1YI2 T;  1H4S A;  1WJQ A;  2NUZ A;  4BE1 A;  1C0M A;  3HFV A;  1N8R C;  1OPL A;  2DMO A;  4H2X A;  1NYG A;  4TTV A;  1WHG A;  1S72 Q;  3RNJ A;  2A08 A;  3CCV Q;  4LN2 A;  4J6X A;  2EKO A;  2RNA A;  3SD4 A;  4CH5 A;  5K1X A;  1VQ5 A;  5FU7 C;  2VB6 A;  1JJ2 S;  1ZUK A;  1YGB A;  1ADY A;  1T0H A;  2KSS A;  3L2U A;  1Z7M A;  1MMN A;  3I56 Q;  4JJB A;  3OMG A;  2JMC A;  1ZUY A;  4YRJ A;  3MEY A;  4RTY A;  1YB3 A;  1B7Y B;  2XIC A;  1V29 B;  4FW2 A;  3WVE B;  4XTZ A;  2KAF A;  3OYB A;  1Q82 R;  1X75 C;  3QO5 A;  1PC0 A;  3CC4 A;  1B7T A;  1B7Y A;  4TVR A;  2MMP A;  2ARU A;  3M4Q A;  1OI1 A;  4MML A;  2I2L A;  2QHU A;  4BB7 A;  3J7A F;  2HSP A;  1HD3 A;  2E1H A;  2EYQ A;  2RHZ A;  3MO8 A;  2E6N A;  1IHV A;  3ME9 A;  2LQ8 A;  5CKB A;  1YHQ Q;  2V8I A;  4PJN A;  1RAB B;  4E7S A;  4OMO A;  2DEU A;  1X55 A;  4WI1 A;  3KFU A;  3H6Z A;  4LD9 K;  4M75 C;  1NJI R;  4RDX A;  3HSB A;  1VQ9 T;  3RBB B;  3CCJ T;  3HHT B;  3L2Z A;  2L3P A;  2M0Y A;  3RAC A;  1SSH A;  1Y0M A;  1RAH B;  3M4Y A;  3RKY A;  1BI2 A;  2MWP A;  2X4J A;  3BDL A;  4JLI A;  1UGV A;  3TSW A;  1AVZ C;  2DL3 A;  3T9N A;  2JT4 A;  4ZGE B;  4YRO A;  3QII A;  1LOJ A;  4C0D C;  3RES A;  5LJ3 g;  1AHJ B;  3P8V A;  4NOY A;  4JS5 A;  1KHI A;  4LDU A;  5GAN 4;  2A0F B;  4YRC A;  4HCK A;  5EC7 A;  4PLI A;  3CCM Q;  4J9I A;  2E3H A;  1EIF A;  4LNP A;  4J6W A;  1VA7 A;  2JZ2 A;  1VQL A;  1PSF A;  1G51 A;  1X69 A;  3X28 B;  1IB8 A;  4KBM B;  5KCH A;  4IUV A;  3GBQ A;  1OU9 A;  2VXF A;  1ZSG A;  2FHD A;  3QJ6 A;  2CP3 A;  4H2S A;  5GAO q;  4M7D G;  2XHC A;  2DVJ A;  5K1P A;  1GL5 A;  2K7A A;  1M1K C;  4XAX B;  2KYM A;  1JXM A;  3MHX A;  4F17 A;  4PJO G;  1H92 A;  1VQ8 Q;  4LVI A;  1RUW A;  1W2B S;  5KYW B;  4OB3 B;  5A0G A;  2OX7 A;  1VQ5 T;  3PVQ A;  4HWT A;  1NNH A;  2HEQ A;  3CEY A;  1D1B A;  2ZCE A;  4J9C A;  2HBP A;  3V7S A;  5LJ3 d;  5KYW A;  2G6F X;  1N8R U;  1VQ6 T;  1YJ9 A;  1LVK A;  3MEU A;  4KGV B;  3G6E Q;  1UB4 A;  1VIF A;  4WJ4 A;  2QK0 A;  1M3C A;  3A7R A;  2G3R A;  3SFM A;  2DIG A;  3E1S A;  2K2M A;  2CT3 A;  2GNC A;  1EZZ B;  4C0F A;  2IG0 A;  4Q5W A;  1DJ7 B;  3PT9 A;  2QYZ A;  5FU6 C;  3VRY A;  5DM7 R;  2L89 A;  4CC7 A;  2EGE A;  4C8Q G;  4OMN A;  2SEM A;  3MCA B;  1PKT A;  4QQD A;  1VQP A;  2VGM A;  1WQ7 A;  3HL8 A;  3NTH A;  3M53 A;  4RQE A;  3QDF A;  9ATC B;  4B9W A;  4A54 A;  1LYL A;  2K5F A;  2KXC A;  4M7D F;  4M7A F;  1RAE B;  2RJC A;  1HJD A;  3OYJ A;  2AZV A;  4P73 A;  5KYN A;  2LJ0 A;  4AFQ C;  4J9G A;  3I55 Q;  3HXW A;  3JRZ A;  3EAE A;  2XDP A;  3CCU A;  2E5K A;  1X56 A;  2EJ9 A;  2DXB A;  3OMC A;  2FPD A;  3P8B B;  1R77 A;  1UHF A;  2KNB B;  4TQD A;  3X26 B;  4KT0 E;  5GAN 8;  4NL2 A;  1FYN A;  1RAD B;  1JJC B;  5KYU B;  5CQY A;  1YIT Q;  1UFF A;  2ALY B;  1X27 A;  3REB B;  3UAT A;  4D8D A;  3GNG A;  1JJC A;  1K9M R;  2ZZF A;  5KYU A;  1VQL T;  5I22 A;  2EAY A;  2ZT6 A;  4GBQ A;  4M7A B;  1HYO A;  4M7D B;  2JS2 A;  1YP5 A;  5KYX B;  2YUN A;  4PJO B;  4OB1 B;  1J3T A;  3MEW A;  3OY9 A;  2J7I A;  4M7A A;  4M7D A;  4OML A;  3OQ5 A;  1ZBJ A;  3V8L A;  2MYS A;  4PFP A;  2COW A;  1AEY A;  2GGR A;  3VS7 A;  4WTO B;  4M77 E;  2CJ9 A;  2CP7 A;  4RCB A;  3V7R A;  4DBQ A;  5AT1 B;  3MJX A;  3O8V A;  3PIP A;  1MNE A;  4DQ2 A;  4EMG A;  1OZ3 A;  2RA2 A;  1Q81 C;  1K8A C;  3EG2 A;  1B76 A;  5IH2 A;  3OSV A;  2PTK A;  3R07 A;  3R6O A;  3CC4 Q;  1FMV A;  1Q86 R;  1K0S A;  1OEB A;  3OS2 A;  1KD1 R;  3A8H B;  1YJ9 T;  3I5R A;  4O5V A;  3QKJ A;  1M1K U;  2GBQ A;  3RDV A;  3CME A;  4IKF A;  4HVU A;  1SET A;  1IGU A;  4C92 F;  2R58 A;  1KG1 A;  2YWW A;  1TUG B;  1SRL A;  5J39 A;  2DFU A;  4IIO A;  2KBT A;  4DOW A;  1WLE A;  2J3L A;  2BUD A;  2CP6 A;  1IXD A;  2GFA A;  1ZQ1 A;  3VS3 A;  2DQ3 A;  5GAN j;  1VQ4 Q;  1QLY A;  1XOV A;  3KFV A;  4J7I A;  1WXT A;  3G71 T;  3RER A;  1C6V X;  1KQ1 A;  2XTI A;  1ZHI A;  4KRT A;  1RAA B;  3URG A;  3CCV A;  5LJ3 f;  2KGT A;  2YT6 A;  1YIJ A;  3OYI A;  3LSQ A;  2KMT A;  1H4V B;  5LJ5 e;  1UE9 A;  1LCK A;  2JM9 A;  5HKC A;  5IHK A;  5KH6 A;  1UJ0 A;  4ANJ A;  1X6O A;  4M77 D;  2CIM A;  1LNX A;  4KQE A;  1MV0 B;  3M4G A;  2ZNJ A;  4C92 B;  5IXF A;  2ZPB B;  1RAF B;  3JCM J;  4JZ3 A;  1NYF A;  2HDA A;  3NET A;  2YDL A;  2I4N A;  4E7L A;  2QQS A;  3OYN A;  2JW4 A;  3VUB A;  3HPW A;  4ELZ C;  4C92 A;  1ZLM A;  2R5M A;  5GMK m;  3DSQ A;  3PE0 A;  2COY A;  4H2T A;  4CH4 A;  4HWR A;  2JXB A;  4M78 C;  2RD1 A;  4KR2 A;  1X6G A;  2ZPI B;  1CKB A;  2XMF A;  4P74 A;  2QA4 A;  3LYI A;  1NBE B;  5CKH A;  3A32 A;  2HMA A;  5GAN g;  3TCJ A;  4XTY A;  3RMS A;  2I4O A;  4ZIB A;  1M2V B;  4FM4 B;  4YRK A;  2DX1 A;  4ZTJ A;  1YCS B;  2CGH A;  5IN1 A;  2VAS A;  2E65 A;  2DDZ A;  1RLQ C;  4F7U G;  2CP0 A;  2ZT5 A;  3A8M B;  4ZN1 A;  2ZTG A;  4E47 A;  2KE9 A;  4ATO A;  1GBQ A;  1AT1 B;  1W66 A;  4DBF A;  4RMF A;  1W70 A;  4M75 G;  3BDU A;  2AMC B;  4G85 A;  2M1H A;  2DKG A;  2L3R A;  4HVV A;  1ZUU A;  4QQG A;  3VBB A;  4YP0 A;  5C0M A;  3VV0 A;  2QI2 A;  1K73 C;  1X6B A;  1BI3 A;  2L2P A;  4A4F A;  1USY A;  1CSK A;  3VUZ A;  2FVU A;  4HT4 A;  1BCM A;  2COZ A;  3CME T;  2QAS A;  2X3W D;  3HRU A;  5DLQ E;  2J3M A;  2P4R A;  4GLK A;  3VQV A;  3QJY A;  1VQP Q;  2RHQ B;  3QWX X;  4AG2 C;  3VQX A;  1Q81 U;  5GAO l;  2DQ0 A;  1K8A U;  1SKU B;  4ZTZ B;  1ZSZ B;  3FRN A;  1VYV A;  1WHM A;  2NUP B;  2RHQ A;  4II1 A;  1XTD A;  2CKK A;  4B6M A;  5GAN d;  3HXV A;  3L4G B;  4BAC A;  4ZTF A;  5KE2 A;  1S72 T;  4FU6 A;  2QDL A;  3CCU Q;  3ULR B;  1MGQ A;  3CCV T;  3HXX A;  3F70 A;  1YIJ T;  3L4G A;  1MV3 A;  2B8A A;  2PUO B;  3E9H A;  2QAZ A;  4OMM A;  1MMA A;  3FIF A;  5HK0 A;  1SEM A;  4HXJ A;  2LTO A;  3ER0 A;  1C0A A;  2HQX A;  4J15 A;  4ELY C;  3I56 T;  2DEQ A;  5LL6 S;  4C0G A;  1HSQ A;  1VYT A;  1M8V A;  2RJD A;  5D6W A;  1I5L A;  1NE8 A;  2X35 A;  2EJF A;  3A7U A;  5DLO A;  3THK A;  1PNJ A;  4IIM A;  2LT1 A;  4EIK A;  3OYF A;  2E64 A;  5LJ3 h;  1E7O A;  3NMZ C;  1SES A;  4E7Z A;  2CZ7 B;  3BJU A;  1WHL A;  2RHU A;  4UPA A;  1Y7X A;  4YRQ A;  5KCO A;  1G83 A;  4DA4 A;  3I35 A;  2DER A;  2ZXF A;  2X4Y A;  2E3I A;  1PKS A;  4LUE A;  3REA B;  3FDR A;  3UT1 A;  1AWX A;  1NJ5 A;  2QQR A;  4K88 A;  3CCR A;  3EH1 A;  3HY0 A;  2JVV A;  1YHQ T;  4JLG A;  4ZN3 A;  4E51 A;  1JQQ A;  2XDD A;  3CC2 A;  2ZPE B;  3AHU A;  5D6X A;  3A7A A;  3LGF A;  5CQX A;  1SF9 A;  2ZGW A;  2QEX Q;  2CRE A;  3GP8 A;  1M30 A;  4F7U B;  2O9V A;  2V8K A;  2DD5 A;  2DTI A;  3RKW A;  2DE0 X;  5HK3 A;  4M75 B;  4FIB A;  2CT4 A;  1JRI A;  2DZC A;  2FEI A;  5D6Y A;  2A37 A;  4YDQ A;  1TXQ A;  2KT1 A;  2EGA A;  4F7U A;  3HY1 A;  3REU A;  1QVF A;  3MQZ A;  2O31 A;  1QKW A;  3V8J A;  3S3M A;  3CPF A;  3OYC A;  2JS0 A;  1Y57 A;  2OAU A;  4MZT A;  2VC8 A;  2DXC A;  4C0D B;  5KYY B;  1UDL A;  3EG0 A;  2VUB A;  2EQU A;  4IUR A;  1Y71 A;  1TUD A;  3PMT A;  8ATC B;  4LVM A;  1RI9 A;  3CCM T;  1T3S A;  4A4E A;  2EFI A;  4AG1 C;  2DL5 A;  3VS5 A;  1K4U S;  4P71 C;  4P3O A;  3EFR A;  5KYY A;  3JCM b;  2YRV A;  4AFS C;  2JN0 A;  2V1R A;  4PJL A;  4JRQ A;  1NYR A;  1YIJ Q;  3QDR B;  3O5Z A;  5GJW B;  3RUX A;  2ZIN A;  2PU9 B;  3IKM B;  1VQ7 A;  2RN8 A;  2C7I A;  2RQV A;  1B34 B;  1K73 U;  2DYB A;  4M7A E;  4M7D E;  4E6R A;  5LJ3 j;  2BE9 B;  1ZX6 A;  4H02 A;  1VQ8 T;  1EFN A;  4PJO E;  3KXT A;  3LH0 A;  2K9G A;  3MEV A;  4BDZ A;  1B34 A;  3C95 A;  5GAN 6;  1RL2 A;  1V1C A;  4EMK C;  1VUB A;  4UP9 A;  4BI8 B;  3FLG A;  1GGM A;  1VQN Q;  3JB9 J;  3TEH B;  3DB4 A;  2SRC A;  3UGQ A;  4OB2 B;  5IXB A;  4KR3 A;  3TRE A;  4JJD A;  2D8H A;  1TU0 B;  2OTJ A;  2KI7 A;  2FL7 A;  1YWO A;  3G6E T;  2DTO A;  5GAO m;  1QMC A;  1VOM A;  1C1A A;  1D0Z A;  2DIQ A;  4OGE A;  3TEH A;  2EIF A;  3PGG A;  4MMK A;  5GAN f;  2C0I A;  1PM3 A;  3MKD A;  2QA4 Q;  3UDC A;  1PYS B;  1KK7 A;  1Q95 G;  3TQ7 P;  2B86 A;  2CJA A;  2X4X A;  3LW5 E;  5CK9 A;  1KIK A;  3QO8 A;  4WCI A;  1JEG A;  1VQ4 A;  3A74 A;  2LJ1 A;  3DLM A;  1MND A;  3HKS A;  1PYS A;  2CP5 A;  2VWF A;  1GRI A;  1QW1 A;  4VUB A;  1UEC A;  4C8Q E;  12AS A;  2NS6 A;  4C5E A;  1GCQ C;  4J9H A;  3L42 A;  1B8A A;  1NJ2 A;  5GAN 2;  2QHT A;  4C5I A;  5I11 A;  1Q7Y C;  2DRK A;  3LSS A;  2ZCF B;  1SHF A;  1WYD A;  1E1O A;  3JCM g;  3SB2 A;  1KC8 C;  1CKA A;  4XTU A;  2KQW A;  4HA8 A;  4M7A D;  4RQF A;  4M7D D;  2YLB A;  2MCN A;  3I55 T;  4P72 A;  1UGR B;  2O88 A;  2JUF A;  3EGX B;  1N9R A;  3CPW P;  4PJO D;  3Q1J A;  4J83 A;  1D0Y A;  2VYT A;  2ZZG A;  3CMA Q;  2DPP B;  4YTL A;  4A53 A;  1X54 A;  4DPG A;  4JDS A;  3EGX A;  4PFO A;  1TUC A;  5L8R E;  1I5O B;  1I8F A;  1X2G A;  1TS9 A;  3M0T A;  4C92 E;  1K0X A;  1YIT T;  4EMH A;  2Y90 A;  1KMM A;  1Z9Z A;  2CZ6 B;  3JB9 G;  2Q5I A;  1IO6 A;  2AKL A;  2PVO B;  2RI5 A;  1PRM C;  5A0D A;  2LJ3 A;  1YJW A;  2XID A;  4JS4 A;  1FWZ A;  1YNZ A;  2LCS A;  4AFU C;  5FLX E;  2LQN A;  1GXI E;  1QVP A;  4M78 G;  1X01 A;  4FW1 A;  3CPW A;  3VRZ A;  3MP8 A;  5FWC A;  4CS2 A;  2V1Q A;  5IHN A;  2GQV A;  4C8Q D;  3JCM e;  2JNG A;  1QVF S;  3HFO A;  1G3Y A;  3LWI A;  3H9N A;  4ZNX A;  1WJR A;  2QTV A;  4JZ4 A;  2DBM A;  3SWN C;  3FJ5 A;  4XU2 A;  3M56 A;  3OYH A;  2HL5 C;  3CC4 T;  4CI0 C;  2MI6 A;  4R56 A;  1KFZ A;  4Y92 A;  2RQU A;  3M0P A;  3C94 A;  4YRI A;  1ABQ A;  1IGQ A;  4JPB W;  3CCL Q;  3OYY A;  3CCR Q;  4C5H A;  4X1V A;  1VQM Q;  3CC2 Q;  1YFT A;  2X9H A;  4C92 D;  1K9A A;  1N8R R;  2KYB A;  1VQ4 T;  3UA6 A;  1NJ1 A;  1NEB A;  3VKI A;  2DO3 A;  2OTL A;  4PJO F;  1FMK A;  3X20 B;  1NLO C;  2G4C A;  2K3Y A;  2RK1 A;  2WSC E;  3P8T A;  4KGX B;  1YN8 A;  1UGS B;  1IRX A;  1QWF A;  5GAN h;  1HTT A;  1O75 A;  2CYZ B;  4P75 C;  4IUT A;  2A28 A;  2LC4 A;  2ODR C;  1Z7N A;  3ZBD A;  2PVG B;  1EVK A;  1HXD A;  4XK8 E;  2ARS A;  3E9F A;  3HTR A;  1OQK A;  2I4L A;  2RI2 A;  3MEA A;  3QYH B;  4E7I A;  3OYK A;  1PRL C;  4OMF B;  3P8H A;  1KJW A;  3OBY A;  1Q7Y U;  4YRF A;  2A8E A;  4D6W A;  3IAL A;  1JB0 E;  2LCL A;  2ALY A;  1KC8 U;  4D8K A;  2J6K A;  2RHS B;  4TVA B;  2RMO A;  4J9B A;  4C8Q F;  2ED1 A;  1VQ7 Q;  1UHC A;  2E6Z A;  3EG9 B;  3LC0 A;  1SG5 A;  2RI3 A;  4PK4 A;  4ESR A;  5GMK e;  3OD1 A;  3PZC A;  3GNF B;  4HVC A;  5KYX A;  3GF5 A;  1H64 1;  1YJW T;  5LJ5 g;  2H3E B;  2RHS A;  4TVA A;  4K87 A;  4PJO A;  2ZAE A;  3EG9 A;  2L3S A;  3KUF A;  3IG2 A;  2QEX A;  3CCS A;  3QNE A;  3TU4 K;  1JBM A;  2WSF E;  4QVD A;  1RAC B;  3J81 E;  4H2Y A;  2KRM A;  1KQS A;  2EL9 A;  2XKO C;  4E7J A;  2CH4 A;  4DBR A;  2OTJ Q;  4BWA A;  5FRM A;  1NG2 A;  1UG1 A;  4F7U E;  4YCU A;  2ECZ A;  4XU1 A;  4OP0 A;  2GF7 A;  2M51 A;  4M75 E;  4JRP A;  1GFD A;  3L1A A;  3RF1 A;  1UEB A;  4UP7 A;  2X51 A;  1U1S A;  3EFS A;  4HCC A;  4XU3 A;  5FW9 A;  3VS1 A;  5C53 B;  3INZ A;  4C8Q B;  1V76 A;  2QXF A;  1NLP C;  1H4T A;  2BZ8 A;  4MZM A;  1RAI B;  3JCM X;  2F5T X;  3ZFJ A;  4BE2 A;  2DYI A;  3P8Y A;  4LDW A;  4RCC A;  3H0I A;  4C8Q A;  3SDZ A;  3JCM f;  1VQP T;  3BFM A;  4G84 A;  1XQH A;  3CCE A;  3IKL A;  1M90 C;  3CPW S;  5LJ5 d;  1FMW A;  5KE3 A;  3RMQ A;  1M1K R;  2DJQ A;  2OJ2 A;  4CC2 A;  3U23 A;  2YUQ A;  4RTV A;  1WIE A;  3C4S A;  4J9F A;  5J3B A;  3NEN A;  2LNH B;  4P3N A;  2DL8 A;  3CCU T;  4AH6 A;  1YFN A;  4DBH A;  4F04 B;  1EX4 A;  4LDX A;  4CH3 A;  1IL2 A;  2HBW A;  2ESW A;  4L5G A;  4JRI A;  2GTJ A;  2P84 A;  3DLL A;  3G4S A;  1PD0 A;  5I21 A;  1WQW A;  2PZ1 A;  3M59 A;  4AFZ C;  4OGC A;  1OX9 A;  2J6F A;  1VQN A;  2PUK B;  2E70 A;  5FRO A;  4Z8A A;  2CP2 A;  3NPF A;  4E2F B;  2ART A;  2ENM A;  2RO0 A;  4PLL A;  3VS4 A;  4M75 D;  2BE7 D;  2D9T A;  2A3L A;  2NWM A;  2DL7 A;  4HCZ A;  3W3S A;  1YJW Q;  1QQJ A;  4LXC A;  1RAG B;  1NM7 A;  2EPD A;  3LGL A;  1G5H A;  1VQO A;  3VQY A;  1M1G A;  4HVW A;  3EG1 A;  2P0K A;  3EGD B;  3M58 A;  4J9E A;  1PSE A;  1WFW A;  4H2W A;  4LDY A;  4TVW A;  3RR6 A;  2IVW A;  1NEG A;  2RH2 A;  3UPU A;  2ED0 A;  4FSS A;  1QP3 A;  1S1N A;  2WAC A;  2RM4 A;  3SHW A;  3EGD A;  4HKE A;  1O9S A;  2QEX T;  1M2V A;  4JJC A;  2FG0 A;  3BE3 A;  2K2V A;  4OF1 A;  2ZNI A;  3OB9 A;  1ZBX A;  2P0Q A;  3CC7 Q;  4AT1 B;  2ROT A;  5GMK i;  1H3Z A;  3P8D A;  3A8L B;  2AMC A;  1Q82 C;  4IUQ A;  1BI0 A;  3PMI A;  1HC7 A;  3M5A A;  5C6S A;  2ZZD A;  3CBM A;  4RTT A;  3CMA A;  2I0N A;  5C52 B;  3HRK A;  1VQK A;  3A5Y A;  2CUD A;  3DKM A;  3QZ5 B;  2EWN A;  1N5Z A;  4J6Y A;  4KUL A;  5I2M A;  1BBU A;  1AWJ A;  2DVE A;  3R6N A;  1XNI A;  4WJ3 M;  1OU8 A;  4X5O A;  2C0O A;  4ORZ A;  5CKE A;  3LLR A;  1QWE A;  3DB3 A;  4BD3 A;  1WDX A;  3CCQ Q;  1D3B B;  2K5I A;  4PKC C;  2OTL Q;  3EFO B;  2BKD N;  2K3X A;  2PQW A;  5IAY A;  1ZSZ A;  1NJI C;  2HCK A;  2NUP A;  5M9O A;  1WZO A;  1RLP C;  7AT1 B;  4IUP A;  2RHI A;  2O01 E;  2VKN A;  3EFO A;  2EYZ A;  5HCK A;  3JB9 H;  1KQS S;  5GAM g;  4P71 A;  4BY6 C;  5FU7 B;  3TVT A;  4F7U F;  3I9Q A;  3JCM c;  3GPL A;  2J06 A;  2Q7G A;  2FPF A;  4PHC A;  2XG8 D;  3VYG A;  5E3I A;  1R0B G;  3C12 A;  1Q81 R;  5GAO r;  4M75 F;  1GFC A;  3JV3 A;  4Q15 A;  1BI1 A;  2DZ9 A;  4BI3 A;  2KRS A;  1K8A R;  3JCM h;  2EQI A;  1IHW A;  2O2O A;  2AT1 B;  1E6G A;  2K3B A;  4WF2 A;  1OZ2 A;  2HSE B;  2EQM A;  1WHK A;  1WNL A;  1M90 U;  2DA9 A;  4EMK B;  2EQJ A;  1QVF P;  1H8K A;  1VQN T;  4P74 C;  1I1J A;  1G3W A;  1N27 A;  2ZPH B;  1QVG P;  5LJ5 f;  3RIR A;  2RHX A;  2MF2 A;  4EMK A;  1B3Q A;  3CCL A;  5A2Q E;  4PFZ A;  4A4H A;  1L0W A;  1GCP A;  1G5I A;  3M0U A;  2QA4 T;  1VQM A;  3SEM A;  3OYM A;  4A4G A;  2EW3 A;  1M9S A;  1A0N B;  3V8K A;  2R5A A;  4Y28 E;  3CCS Q;  3A31 A;  1D1A A;  1MMG A;  1W6X A;  1BYM A;  1R8O B;  2VXE A;  2LZ6 B;  4JRK A;  4YRT A;  4YRN A;  2KK4 A;  2XU8 A;  3CXC P;  2EBP A;  1VQ9 A;  3VS6 A;  1WGS A;  4OVA A;  3CCJ A;  1H4Q A;  2KT8 A;  2RK2 A;  3JCM P;  2ODR D;  1XJW B;  2MIO A;  5A0L A;  4CS4 A;  4QVC A;  1BBZ A;  5GAM e;  1NJ6 A;  3FC3 A;  2DF6 A;  2FZC B;  4M75 A;  2JTM A;  2AKW B;  1AZE A;  1QVG A;  2ZPF B;  2DNU A;  4J9D A;  2M9U A;  2ZIO A;  1ASZ A;  2E41 A;  4RKU E;  1G3T A;  1GCQ A;  2HL3 A;  1N9S A;  1F1B B;  1LJO A;  3JAM E;  4CC4 B;  2NYS A;  2MWO A;  4QW2 A;  1NZ9 A;  1I81 A;  1QE0 A;  1TOV A;  3H0F A;  3CMA T;  4UC4 A;  2L5Q A;  3LH5 A;  1EFW A;  1HK9 A;  1WXB A;  3OYG A;  2CSI A;  1OX8 A;  1VYU A;  4KUI A;  3CCE Q;  3QWY A;  3CXC A;  4NS5 A;  4YRR A;  4LVK A;  1Y96 B;  2YRC A;  3EGU A;  1KOG A;  4F14 A;  4BI4 A;  3NTI A;  2DAQ A;  1U5S A;  2K57 A;  3FJP A;  1Q82 U;  5D7U A;  4CRI A;  1Y96 A;  3MF2 A;  1WU7 A;  3PIO A;  2JMA A;  1YJN Q;  1BBW A;  3H41 A;  5GMK h;  3ERR A;  1JU5 C;  2FZK B;  3ZEH A;  4K86 A;  2DXT A;  3G4S Q;  2QGG A;  3J80 E;  3L2R A;  5HY6 A;  3GIB A;  2BZX A;  4M78 E;  4HWP A;  3EH2 A;  1NYQ A;  1PD1 A;  2J6O A;  4N4G A;  4LUD A;  2DBK A;  3M4P A;  1VQ6 A;  2HNI A;  3UWN A;  2AIR B;  1NJI U;  3X25 B;  2Q7H A;  3UH0 A;  1K73 R;  5GJV B;  1X43 A;  4M77 C;  3SWN B;  2P4T A;  2DK3 A;  2FYK A;  3UA7 A;  3MF1 A;  2HQH A;  2KRN A;  3E9G A;  2LDM A;  1E22 A;  2P5I A;  1ADJ A;  2RJF A;  4LNS A;  1VQO Q;  1K9M C;  4YRE A;  4UP8 A;  3OYE A;  4X34 A;  3HXY A;  3CCL T;  3SWN A;  4RUG A;  3CCR T;  2HAX A;  2E3C A;  1W4S A;  2MAM A;  5FU6 B;  1VQM T;  4NL3 A;  3CC2 T;  1UGQ B;  4RTU A;  4OLF A;  3OYD A;  4EX5 A;  4ME7 A;  1TSF A;  3S3N A;  1I4K 1;  4KH1 B;  1UTI A;  2IPO B;  4K11 A;  1G2B A;  4L87 A;  2QQB A;  1OPK A;  3JB9 D;  1I07 A;  2V26 A;  4N0A C;  2W10 A;  5LJ5 h;  4M4Z A;  2QG9 B;  4RG8 A;  3NGP A;  3M55 A;  4RTW A;  4BW9 A;  3JB9 I;  1K1Z A;  2MPX C;  1Q86 C;  1NPR A;  2RF0 A;  1KSW A;  4TVY A;  1M4Z A;  2A7Y A;  1KD1 C;  1VQK Q;  1B70 B;  3PVL A;  1AOJ A;  3EHQ A;  3QPH A;  3QXE B;  4M78 D;  4KH0 B;  2CZ1 B;  4RTZ A;  4O2D A;  1JO8 A;  1OYX A;  3RKX A;  2AKK A;  5GMK j;  1B70 A;  1YI2 Q;  4P75 A;  3CD6 A;  2X4W A;  2M02 A;  3HTZ A;  4J7F A;  3MPU B;  4PNO A;  1LPL A;  4Z89 A;  2AK5 A;  4BE0 A;  4JJN K;  2ZR3 A;  1U06 A;  3H8Z A;  2RB6 A;  1X2Q A;  2GFU A;  5GAM f;  2EJG A;  2XGT A;  1VQ7 T;  1YFS A;  3JCM d;  3VJP A;  4RG2 A;  2HD0 A;  4M7A G;  1BIA A;  2VV5 A;  4Q6G A;  4HT8 A;  3NEM A;  4ZGD B;  1U8R A;  3G1Z A;  4TWA A;  4CH6 A;  1N6A A;  5GAN 7;  1QVG S;  1G3S A;  3LX7 A;  4TQF A;  2DM1 A;  3HRS A;  2JOY A;  2L3Q A;  4XTX A;  3OS1 A;  2C8M A;  3CC7 A;  4X9C A;  4BDY A;  3UGT A;  4NCX A;  2IY5 B;  3HRI A;  4YRM A;  2OTJ T;  1H3H A;  1YWP A;  3HXZ A;  5LJ3 e;  2LT4 A;  2D6F A;  3HXU A;  2P0L A;  3BY7 A;  2KRO A;  3A5Z B;  3CXC S;  1FYF A;  4L6V 5;  3VYH B;  1SPK A;  4Z02 A;  3FEO A;  1EOV A;  2IY5 A;  3QSU A;  3VS0 A;  1SHG A;  4HWO A;  3C0C A;  1B07 A;  3L2W A;  4YRL A;  5LJ5 j;  2PNI A;  5CVI A;  2RPN A;  4BUG A;  1D0X A;  2YHT A;  3JB9 F;  3A5Z A;  3G1J A;  2D8J A;  4C0Z A;  11AS A;  3QTC A;  4YPF A;  3CCQ A;  1VQ9 Q;  2RQR A;  4P3P A;  1X2K A;  2AZS A;  3CCJ Q;  3ZL7 C;  2DIL A;  2VVK A;  3MP6 A;  2ROL A;  3G71 A;  5GMK l;  4P72 C;  2QHV A;  3WVD B;  2CS7 A;  4M78 F;  4DEX A;  3EHR A;  2KY9 A;  2ZIM A;  3IQL A;  4JUV A;  4QVZ A;  2KEA A;  1BKB A;  2Y4X A;  3X24 B;  4ZGJ B;  1U1T A;  4AMC A;  3OS5 A;  5FRN A;  2HKN A;  1K9M U;  3NFC A;  3QG1 A;  1Y07 A;  5CKD A;  3HFN A;  3OYA A;  1WYX A;  1X2H A;  1N9W A;  3QYG B;  1KQS P; 
#chains in the Genus database with same CATH homology
 5KNN A;  3QO3 A;  1RIQ A;  2F5K A;  3A8G B;  4C92 G;  4YCV A;  3S6W A;  3JCM Q;  1NJ8 A;  2DU7 A;  3OSS C;  3CD6 T;  2E5A A;  4PL6 A;  4M78 B;  1Q86 U;  3LWH A;  2LX9 A;  1KD1 U;  1QF6 A;  2YLC A;  4M78 A;  3M57 A;  3MP1 A;  2QTX A;  2BIV A;  2HQE A;  5CAI A;  3E9I A;  4MZP A;  1SRY A;  2QDY B;  3OW2 A;  4XTV A;  2XK0 A;  4FT4 A;  5EG2 A;  3MET A;  1EIY B;  2LQK A;  4O6J A;  2KDS A;  4V2S A;  5GAM h;  4H2V A;  2Y4Y A;  2PVD B;  3CC7 T;  3KBG A;  3CMQ A;  4LVL A;  2NLU A;  1EIY A;  2FB7 A;  1KMN A;  1ATI A;  5CKF A;  1EVL A;  1ASY A;  1FXX A;  2DJZ A;  2XDB A;  3TEE A;  4LD6 A;  4P73 C;  4FSX A;  3A8O B;  4IUU A;  1WPY A;  2H3J A;  4KUD K;  4Y91 A;  4HT9 A;  2K4Y A;  3CCQ T;  2C06 A;  2OTL T;  4FL6 A;  1S72 A;  5I2S A;  3PTA A;  1YJN A;  3M9Q A;  3HP9 A;  4N4I A;  4E7K A;  1YCY A;  5DY9 A;  5ELN A;  1G5V A;  2QHS A;  2L8D A;  4HWS A;  4OB0 B;  3JCM V;  2M0O A;  3ASK A;  2Q5H A;  4MDW A;  5CR2 A;  3TEG A;  2KVQ G;  3I56 A;  4BY6 B;  2PMF A;  3VU3 C;  1YFR A;  4M7A C;  4M7D C;  3HFZ B;  2QQA A;  1IZ6 A;  4EPC A;  1WJS A;  2P0P A;  4PJO C;  2V8J A;  1KHC A;  4C5G A;  1TH7 A;  3GOX A;  2I4M A;  2CZ0 B;  2R57 A;  3QO7 A;  4QQ6 A;  3NEL A;  5HGQ A;  3HFZ A;  4GY5 A;  3V7C A;  4X9D A;  5GAO n;  5GAM j;  3L2V A;  4M77 G;  5C51 B;  5GAN 3;  1YHQ A;  1E24 A;  4LDV A;  2E12 A;  4J8O A;  3S3O A;  3M54 A;  5J26 A;  4E7H A;  1M5Q 1;  4R55 A;  3ICA A;  3CCS T;  2ZT7 A;  1IRE B;  2ZZE A;  5AYF A;  1MHN A;  1M1F A;  3PNW C;  3CBO A;  4XEM A;  1QP2 A;  1KQ2 A;  1JJ2 A;  2DXU A;  2Q7E A;  1VIE A;  2DU5 A;  3PFS A;  3HRT A;  4C8Q C;  5F5W A;  4N4H A;  4HCB A;  2E10 A;  2JTF A;  2M16 A;  1RI0 A;  1YI2 A;  2O4X B;  3CCM A;  4RMO A;  2VGN A;  3FB9 A;  2ZT8 A;  2GCX A;  2LNV A;  3BW1 A;  2F69 A;  3CCE T;  2XD0 A;  5GAO p;  2O4X A;  1D3B A;  1P92 A;  5CCA A;  4M77 F;  3QZ9 B;  4B9X A;  3OYL A;  1VQZ A;  5GAN e;  4A4K A;  3OW2 S;  1YJN T;  4C92 C;  3RL6 A;  3TUP A;  1VQ8 A;  1NPP A;  3G4S T;  3RGL A;  3G7Z A;  4P5N A;  3OS0 A;  4YYE A;  4YRG A;  2ZPG B;  4XTW A;  4CS3 A;  3PCO B;  2XI9 A;  3OBW A;  1YBY A;  3JSC A;  4H2U A;  3G6E A;  5CIU A;  3WQZ A;  5ELO A;  3QBY A;  2DTH A;  3E19 A;  1EQR A;  2PME A;  3PCO A;  4DOV A;  1VQO T;  4M77 B;  4LVJ A;  2CJB A;  2LVM A;  3GLX A;  3I7F A;  2DD4 A;  2AHJ B;  3QHS A;  4EO4 A;  5GAM d;  2EQK A;  4M77 A;  4MDX A;  2ZR2 A;  3VQW A;  4YRS A;  3N5B B;  2QQ9 A;  2LRQ A;  3L2Q A;  1USY C;  2E5Q A;  2WSE E;  4XQ3 A;  1UGP B;  4XEO A;  1BIB A;  1W2B A;  5IT9 E;  3REX A;  3JCM W;  3I55 A;  4PG3 A;  1J5W A;  3NTK A;  3WXM B;  4YRP A;  4EDU A;  1SSF A;  3UFG A;  4YCW A;  2AKW A;  4L59 A;  2D0Q B;  1E1T A;  2LCC A;  3OA6 A;  4FT2 A;  2RJE A;  4XU0 A;  1FX7 A;  1VQK T;  3QUI A;  1SER A;  2K5L A;  5GAN 5;  4N0A A;  5CO7 A;  2RHY A;  4H2X B;  4ZTU B;  3CBP A;  4J5Y A;  1YIT A;  1YI2 T;  1H4S A;  1WJQ A;  4BE1 A;  3HFV A;  1N8R C;  4H2X A;  4TTV A;  4J6X A;  2EKO A;  3SD4 A;  4CH5 A;  5K1X A;  1VQ5 A;  5FU7 C;  1JJ2 S;  1YGB A;  1ADY A;  2KSS A;  3L2U A;  1Z7M A;  3OMG A;  4YRJ A;  3MEY A;  1YB3 A;  1B7Y B;  2XIC A;  1V29 B;  3WVE B;  4XTZ A;  2KAF A;  3OYB A;  1X75 C;  3QO5 A;  3CC4 A;  1B7Y A;  4TVR A;  2MMP A;  2ARU A;  3M4Q A;  1OI1 A;  4MML A;  2I2L A;  2QHU A;  4BB7 A;  3J7A F;  2E1H A;  2EYQ A;  2RHZ A;  3MO8 A;  2E6N A;  3ME9 A;  2LQ8 A;  5CKB A;  2V8I A;  1X55 A;  4WI1 A;  3KFU A;  3H6Z A;  4LD9 K;  4M75 C;  4RDX A;  3HSB A;  1VQ9 T;  3CCJ T;  3HHT B;  3L2Z A;  3RAC A;  3M4Y A;  3RKY A;  1BI2 A;  2MWP A;  2X4J A;  3BDL A;  4JLI A;  3T9N A;  4ZGE B;  4YRO A;  3QII A;  1LOJ A;  4C0D C;  3RES A;  5LJ3 g;  1AHJ B;  3P8V A;  4NOY A;  4JS5 A;  1KHI A;  4LDU A;  5GAN 4;  4YRC A;  4PLI A;  1EIF A;  4J6W A;  2JZ2 A;  1VQL A;  1PSF A;  1G51 A;  3X28 B;  4KBM B;  5KCH A;  4IUV A;  2VXF A;  2FHD A;  3QJ6 A;  4H2S A;  5GAO q;  4M7D G;  2XHC A;  5K1P A;  1M1K C;  4XAX B;  3MHX A;  4PJO G;  4LVI A;  1W2B S;  4OB3 B;  5A0G A;  1VQ5 T;  4HWT A;  1NNH A;  3CEY A;  2ZCE A;  2HBP A;  3V7S A;  5LJ3 d;  1N8R U;  1VQ6 T;  1YJ9 A;  3MEU A;  1UB4 A;  1VIF A;  4WJ4 A;  3A7R A;  2G3R A;  3SFM A;  2DIG A;  3E1S A;  4C0F A;  2IG0 A;  4Q5W A;  1DJ7 B;  3PT9 A;  5FU6 C;  5DM7 R;  2L89 A;  4C8Q G;  3MCA B;  4QQD A;  1VQP A;  2VGM A;  1WQ7 A;  3HL8 A;  3NTH A;  3M53 A;  4RQE A;  4B9W A;  4A54 A;  1LYL A;  2K5F A;  4M7A F;  4M7D F;  2RJC A;  3OYJ A;  4P73 A;  3HXW A;  3JRZ A;  3EAE A;  2XDP A;  3CCU A;  1X56 A;  2EJ9 A;  2DXB A;  3OMC A;  3P8B B;  4TQD A;  3X26 B;  4KT0 E;  5GAN 8;  4NL2 A;  1JJC B;  5CQY A;  2ALY B;  3GNG A;  1JJC A;  2ZZF A;  1VQL T;  2EAY A;  2ZT6 A;  4M7A B;  4M7D B;  4PJO B;  4OB1 B;  3MEW A;  3OY9 A;  4M7A A;  4M7D A;  3V8L A;  3OQ5 A;  4M77 E;  2CJ9 A;  4RCB A;  3V7R A;  3O8V A;  3PIP A;  4DQ2 A;  4EMG A;  1OZ3 A;  2RA2 A;  1Q81 C;  1K8A C;  1B76 A;  3OSV A;  3R07 A;  3R6O A;  3OS2 A;  3A8H B;  1YJ9 T;  4O5V A;  3QKJ A;  1M1K U;  4IKF A;  3CME A;  1SET A;  4C92 F;  2R58 A;  1KG1 A;  5J39 A;  4DOW A;  1WLE A;  2J3L A;  2BUD A;  2GFA A;  1ZQ1 A;  2DQ3 A;  5GAN j;  1XOV A;  4J7I A;  3G71 T;  3RER A;  1KQ1 A;  2XTI A;  1ZHI A;  3URG A;  3CCV A;  5LJ3 f;  1YIJ A;  3OYI A;  3LSQ A;  2KMT A;  1H4V B;  5LJ5 e;  5HKC A;  5KH6 A;  1X6O A;  4M77 D;  2CIM A;  1LNX A;  4KQE A;  3M4G A;  2ZNJ A;  4C92 B;  2ZPB B;  3JCM J;  3NET A;  2I4N A;  4E7L A;  2QQS A;  3OYN A;  3VUB A;  3HPW A;  4ELZ C;  4C92 A;  2R5M A;  5GMK m;  3DSQ A;  4CH4 A;  4H2T A;  4HWR A;  4M78 C;  2RD1 A;  4KR2 A;  2ZPI B;  4P74 A;  2QA4 A;  3LYI A;  5CKH A;  3A32 A;  5GAN g;  3TCJ A;  4XTY A;  3RMS A;  2I4O A;  4ZIB A;  4FM4 B;  4YRK A;  4ZTJ A;  2CGH A;  5IN1 A;  2E65 A;  2DDZ A;  4F7U G;  2ZT5 A;  2ZTG A;  3A8M B;  4ZN1 A;  4E47 A;  4ATO A;  1W66 A;  4RMF A;  4M75 G;  3BDU A;  2AMC B;  4G85 A;  2M1H A;  2DKG A;  2L3R A;  4QQG A;  3VBB A;  4YP0 A;  5C0M A;  3VV0 A;  2QI2 A;  1K73 C;  1BI3 A;  4A4F A;  1USY A;  3VUZ A;  2FVU A;  4HT4 A;  3CME T;  3HRU A;  5DLQ E;  2J3M A;  4GLK A;  3VQV A;  3QJY A;  2RHQ B;  3VQX A;  1Q81 U;  5GAO l;  2DQ0 A;  1K8A U;  4ZTZ B;  3FRN A;  2RHQ A;  4II1 A;  1XTD A;  2CKK A;  5GAN d;  3HXV A;  3L4G B;  4BAC A;  4ZTF A;  5KE2 A;  1S72 T;  4FU6 A;  1MGQ A;  3CCV T;  3HXX A;  3F70 A;  1YIJ T;  3L4G A;  2B8A A;  2PUO B;  3E9H A;  3FIF A;  5HK0 A;  2LTO A;  3ER0 A;  1C0A A;  2HQX A;  4J15 A;  4ELY C;  3I56 T;  2DEQ A;  5LL6 S;  4C0G A;  1M8V A;  2RJD A;  5D6W A;  1I5L A;  1NE8 A;  2X35 A;  2EJF A;  3A7U A;  5DLO A;  2LT1 A;  3OYF A;  2E64 A;  5LJ3 h;  1SES A;  2CZ7 B;  3BJU A;  2RHU A;  4UPA A;  1Y7X A;  4YRQ A;  5KCO A;  4DA4 A;  2ZXF A;  2X4Y A;  3UT1 A;  3FDR A;  1NJ5 A;  2QQR A;  4K88 A;  3CCR A;  3HY0 A;  2JVV A;  1YHQ T;  4JLG A;  4ZN3 A;  4E51 A;  3CC2 A;  2XDD A;  2ZPE B;  3AHU A;  5D6X A;  3A7A A;  3LGF A;  5CQX A;  2ZGW A;  3GP8 A;  4F7U B;  2V8K A;  2DD5 A;  2DTI A;  3RKW A;  5HK3 A;  4M75 B;  4FIB A;  1JRI A;  2DZC A;  5D6Y A;  4YDQ A;  4F7U A;  3HY1 A;  3REU A;  1QVF A;  3MQZ A;  3V8J A;  3S3M A;  3CPF A;  3OYC A;  2OAU A;  4MZT A;  2VC8 A;  2DXC A;  4C0D B;  2VUB A;  2EQU A;  4IUR A;  1Y71 A;  3PMT A;  4LVM A;  3CCM T;  4A4E A;  2EFI A;  4P71 C;  4P3O A;  3EFR A;  3JCM b;  2YRV A;  2JN0 A;  4JRQ A;  1NYR A;  3QDR B;  3RUX A;  2ZIN A;  2PU9 B;  3IKM B;  1VQ7 A;  2C7I A;  1B34 B;  1K73 U;  4M7A E;  4M7D E;  5LJ3 j;  4H02 A;  1VQ8 T;  4PJO E;  3KXT A;  3LH0 A;  3MEV A;  4BDZ A;  1B34 A;  3C95 A;  5GAN 6;  1RL2 A;  4EMK C;  1VUB A;  4UP9 A;  4BI8 B;  3FLG A;  1GGM A;  3JB9 J;  3TEH B;  3DB4 A;  3UGQ A;  4OB2 B;  4KR3 A;  3TRE A;  2OTJ A;  2FL7 A;  3G6E T;  2DTO A;  5GAO m;  3TEH A;  4OGE A;  2DIQ A;  2EIF A;  3PGG A;  4MMK A;  5GAN f;  3UDC A;  1PYS B;  2CJA A;  2X4X A;  3LW5 E;  5CK9 A;  3QO8 A;  3A74 A;  1VQ4 A;  3DLM A;  3HKS A;  1PYS A;  1QW1 A;  4VUB A;  4C8Q E;  12AS A;  2NS6 A;  4C5E A;  3L42 A;  1B8A A;  1NJ2 A;  5GAN 2;  2QHT A;  4C5I A;  1Q7Y C;  3LSS A;  2ZCF B;  1WYD A;  1E1O A;  3JCM g;  3SB2 A;  1KC8 C;  4XTU A;  2KQW A;  4HA8 A;  4M7A D;  4RQF A;  4M7D D;  2YLB A;  3I55 T;  4P72 A;  1UGR B;  2JUF A;  1N9R A;  4PJO D;  3Q1J A;  4J83 A;  2VYT A;  2ZZG A;  2DPP B;  4YTL A;  4A53 A;  1X54 A;  4DPG A;  4JDS A;  5L8R E;  1I8F A;  1X2G A;  4C92 E;  1YIT T;  4EMH A;  2Y90 A;  1KMM A;  2CZ6 B;  3JB9 G;  2Q5I A;  2PVO B;  2RI5 A;  5A0D A;  1YJW A;  2XID A;  4JS4 A;  1FWZ A;  5FLX E;  1GXI E;  1QVP A;  4M78 G;  1X01 A;  3CPW A;  3MP8 A;  4CS2 A;  2GQV A;  4C8Q D;  3JCM e;  2JNG A;  1QVF S;  3HFO A;  1G3Y A;  3LWI A;  1WJR A;  3SWN C;  4XU2 A;  3M56 A;  3OYH A;  3CC4 T;  4CI0 C;  2MI6 A;  4R56 A;  3C94 A;  4YRI A;  3OYY A;  4C5H A;  1YFT A;  4C92 D;  1VQ4 T;  1NJ1 A;  3VKI A;  2DO3 A;  2OTL A;  4PJO F;  3X20 B;  2G4C A;  2K3Y A;  2RK1 A;  2WSC E;  3P8T A;  1UGS B;  5GAN h;  1HTT A;  1O75 A;  2CYZ B;  4P75 C;  4IUT A;  2LC4 A;  2ODR C;  1Z7N A;  3ZBD A;  2PVG B;  1EVK A;  1HXD A;  4XK8 E;  2ARS A;  3E9F A;  2I4L A;  2RI2 A;  3MEA A;  3QYH B;  4E7I A;  3OYK A;  4OMF B;  3P8H A;  3OBY A;  1Q7Y U;  4YRF A;  2A8E A;  4D6W A;  3IAL A;  1JB0 E;  2LCL A;  2ALY A;  1KC8 U;  2RHS B;  4TVA B;  4C8Q F;  2E6Z A;  3LC0 A;  2RI3 A;  5GMK e;  3OD1 A;  3PZC A;  3GNF B;  4HVC A;  3GF5 A;  1H64 1;  1YJW T;  5LJ5 g;  2RHS A;  4TVA A;  4K87 A;  4PJO A;  3KUF A;  3IG2 A;  2QEX A;  3CCS A;  3QNE A;  3TU4 K;  1JBM A;  2WSF E;  4QVD A;  3J81 E;  4H2Y A;  1KQS A;  2EL9 A;  2XKO C;  4E7J A;  4BWA A;  5FRM A;  4F7U E;  4YCU A;  4XU1 A;  4OP0 A;  2GF7 A;  4M75 E;  4JRP A;  3RF1 A;  3L1A A;  1UEB A;  4UP7 A;  1U1S A;  3EFS A;  4HCC A;  4XU3 A;  5C53 B;  3INZ A;  4C8Q B;  2QXF A;  1H4T A;  4MZM A;  3JCM X;  2F5T X;  3ZFJ A;  4BE2 A;  3P8Y A;  4LDW A;  4RCC A;  4C8Q A;  3SDZ A;  3JCM f;  1VQP T;  3BFM A;  4G84 A;  1XQH A;  3CCE A;  3IKL A;  1M90 C;  3CPW S;  5LJ5 d;  5KE3 A;  3RMQ A;  3C4S A;  5J3B A;  3NEN A;  4P3N A;  3CCU T;  4AH6 A;  4LDX A;  1IL2 A;  4CH3 A;  4L5G A;  4JRI A;  3DLL A;  3G4S A;  5I21 A;  1WQW A;  3M59 A;  4OGC A;  1VQN A;  2PUK B;  2E70 A;  5FRO A;  2ART A;  2RO0 A;  4PLL A;  4M75 D;  2D9T A;  2A3L A;  4HCZ A;  3W3S A;  3LGL A;  1G5H A;  1VQO A;  3VQY A;  1M1G A;  2P0K A;  3M58 A;  1PSE A;  4H2W A;  4LDY A;  4TVW A;  2IVW A;  2RH2 A;  3UPU A;  1QP3 A;  2WAC A;  2RM4 A;  4HKE A;  1O9S A;  2QEX T;  2K2V A;  4OF1 A;  2ZNI A;  3OB9 A;  1ZBX A;  2P0Q A;  5GMK i;  1H3Z A;  3P8D A;  3A8L B;  2AMC A;  1Q82 C;  4IUQ A;  1BI0 A;  3PMI A;  1HC7 A;  3M5A A;  5C6S A;  2ZZD A;  3CBM A;  3CMA A;  5C52 B;  3HRK A;  1VQK A;  3A5Y A;  3DKM A;  3QZ5 B;  2EWN A;  4J6Y A;  4KUL A;  5I2M A;  1BBU A;  2DVE A;  1XNI A;  4WJ3 M;  4X5O A;  5CKE A;  3LLR A;  3DB3 A;  4BD3 A;  1D3B B;  2K5I A;  4PKC C;  2BKD N;  2K3X A;  2PQW A;  5IAY A;  1NJI C;  5M9O A;  4IUP A;  2RHI A;  2O01 E;  3JB9 H;  1KQS S;  5GAM g;  4P71 A;  4BY6 C;  5FU7 B;  4F7U F;  3GPL A;  2Q7G A;  3JCM c;  5E3I A;  4PHC A;  2XG8 D;  3VYG A;  3C12 A;  5GAO r;  4M75 F;  4Q15 A;  1BI1 A;  2DZ9 A;  4BI3 A;  3JCM h;  4WF2 A;  1OZ2 A;  2EQM A;  1WNL A;  1M90 U;  4EMK B;  4P74 C;  2EQJ A;  1VQN T;  1G3W A;  1N27 A;  2ZPH B;  5LJ5 f;  3RIR A;  2RHX A;  2MF2 A;  4EMK A;  3CCL A;  5A2Q E;  4A4H A;  1L0W A;  1G5I A;  2QA4 T;  1VQM A;  3OYM A;  4A4G A;  1M9S A;  3V8K A;  2R5A A;  4Y28 E;  3A31 A;  4YRT A;  1BYM A;  4YRN A;  1R8O B;  2VXE A;  4JRK A;  2KK4 A;  2XU8 A;  1VQ9 A;  1WGS A;  4OVA A;  3CCJ A;  1H4Q A;  2RK2 A;  3JCM P;  2ODR D;  5A0L A;  4CS4 A;  4QVC A;  5GAM e;  1NJ6 A;  3FC3 A;  4M75 A;  2JTM A;  2AKW B;  1QVG A;  2ZPF B;  2M9U A;  2ZIO A;  1ASZ A;  2E41 A;  4RKU E;  1G3T A;  1N9S A;  1LJO A;  3JAM E;  2MWO A;  4QW2 A;  1NZ9 A;  1I81 A;  1QE0 A;  3CMA T;  4UC4 A;  2L5Q A;  1EFW A;  1HK9 A;  3OYG A;  4KUI A;  3CXC A;  4NS5 A;  4YRR A;  4LVK A;  1Y96 B;  1KOG A;  4BI4 A;  3NTI A;  2DAQ A;  1Q82 U;  2K57 A;  3FJP A;  4CRI A;  1Y96 A;  3MF2 A;  1WU7 A;  3PIO A;  1BBW A;  5GMK h;  3ERR A;  3ZEH A;  4K86 A;  2DXT A;  3J80 E;  3L2R A;  5HY6 A;  3GIB A;  4M78 E;  4HWP A;  1NYQ A;  4N4G A;  3M4P A;  1VQ6 A;  2HNI A;  3UWN A;  1NJI U;  3X25 B;  2Q7H A;  3UH0 A;  4M77 C;  3SWN B;  2P4T A;  2DK3 A;  2FYK A;  3MF1 A;  3E9G A;  2LDM A;  1E22 A;  2P5I A;  1ADJ A;  2RJF A;  4LNS A;  1K9M C;  4YRE A;  4UP8 A;  3OYE A;  4X34 A;  3HXY A;  3CCL T;  3SWN A;  3CCR T;  2HAX A;  2E3C A;  1W4S A;  2MAM A;  5FU6 B;  1VQM T;  4NL3 A;  3CC2 T;  1UGQ B;  4OLF A;  3OYD A;  4EX5 A;  4ME7 A;  3S3N A;  1I4K 1;  4L87 A;  2QQB A;  3JB9 D;  4N0A C;  5LJ5 h;  4RG8 A;  3M55 A;  4BW9 A;  3JB9 I;  1Q86 C;  1NPR A;  4TVY A;  1M4Z A;  2A7Y A;  1KD1 C;  1B70 B;  3QXE B;  3QPH A;  4M78 D;  2CZ1 B;  4O2D A;  1OYX A;  3RKX A;  5GMK j;  1B70 A;  4P75 A;  3CD6 A;  2X4W A;  3HTZ A;  4J7F A;  4PNO A;  4BE0 A;  4JJN K;  2ZR3 A;  3H8Z A;  2RB6 A;  2GFU A;  5GAM f;  2EJG A;  2XGT A;  1VQ7 T;  1YFS A;  3JCM d;  3VJP A;  4RG2 A;  2HD0 A;  4M7A G;  1BIA A;  2VV5 A;  4Q6G A;  4HT8 A;  3NEM A;  4ZGD B;  1U8R A;  3G1Z A;  4TWA A;  4CH6 A;  1N6A A;  5GAN 7;  1QVG S;  1G3S A;  3LX7 A;  4TQF A;  3HRS A;  2JOY A;  4XTX A;  3OS1 A;  2C8M A;  3CC7 A;  4X9C A;  4BDY A;  3UGT A;  4NCX A;  2IY5 B;  3HRI A;  4YRM A;  2OTJ T;  3HXZ A;  5LJ3 e;  2LT4 A;  2D6F A;  3HXU A;  2P0L A;  3BY7 A;  3A5Z B;  3CXC S;  1FYF A;  4L6V 5;  3VYH B;  4Z02 A;  3FEO A;  1EOV A;  2IY5 A;  3QSU A;  4HWO A;  3L2W A;  4YRL A;  5LJ5 j;  5CVI A;  4BUG A;  2YHT A;  3JB9 F;  3A5Z A;  4C0Z A;  11AS A;  3QTC A;  4YPF A;  3CCQ A;  4P3P A;  3G71 A;  3MP6 A;  5GMK l;  4P72 C;  2QHV A;  3WVD B;  2CS7 A;  4M78 F;  2KY9 A;  2ZIM A;  4JUV A;  4QVZ A;  1BKB A;  2Y4X A;  3X24 B;  4ZGJ B;  1U1T A;  3OS5 A;  5FRN A;  1K9M U;  3NFC A;  3QG1 A;  1Y07 A;  5CKD A;  3HFN A;  3OYA A;  1X2H A;  1N9W A;  3QYG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...