4XU1A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 82 that incorporates a morpholine in place of the ribose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 98
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu1A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu1A01
3HRIA 4BW9A 4C92B 5GAN7 1EVLA 2I4LA 3JB9G 4HT8A 3RUXA 3HFVA 4UP8A 1JJCB 2ARTA 2EAYA 4J6WA 4WJ4A 4M78A 4J6YA 1L0WA 2DXUA 4M77G 4X9CA 3A7RA 1NJ8A 3VQWA 4HVCA 4XU3A 4A54A 4RMFA 4M7DG 5GANh 1I5LA 2Q7HA 3OD1A 4F7UB 4C8QF 5GANf 3TEGA 4OLFA 1EIYA 4RCCA 1B70B 1X2GA 3JCMh 1ADYA 4M75F 3UH0A 1NYQA 3JCMf 4C8QC 2FYKA 2DTOA 1WQ7A 1NYRA 1WQWA 4XTZA 5GAOm 2IY5B 1LYLA 4YRMA 4YRKA 2Q5HA 4AH6A 2ALYA 4ZIBA 4XU1A 4M7AC 4CH5A 3QSUA 2ZXFA 2DVEA 2FB7A 2DTIA 4HT9A 4ZTUB 4KQEA 2DTHA 3JB9J 3RL6A 4M7AA 1B7YA 4HWOA 2DU7A 3WQZA 1WPYA 3NELA 2VXEA 3HXYA 4H2YA 12ASA 3L4GA 4JRIA 4C92F 4QVDA 4YRTA 4M78B 4M78D 1LJOA 4EMKC 2Q7GA 2EJGA 3VQVA 3M4PA 2Q7EA 3SWNB 2RHQA 1C0AA 4P75C 1H4TA 2VXFA 2ZIMA 3IG2A 4EMKA 3HFZB 1ATIA 5C53B 2CGHA 4K86A 3FJPA 4CS4A 4X5OA 4XTUA 1LNXA 3HXWA 3HY0A 4NL3A 1E1OA 5LJ5h 3V7SA 3HTZA 2ZT8A 4P75A 1EIYB 4F7UF 4KR3A 4E51A 2DJZA 3JB9D 1SRYA 2ODRC 1KMMA 4C8QE 5LJ5f 3V7RA 5GAMe 1USYC 1M8VA 1U1SA 4XTYA 1BBWA 4M7AE 3INZA 4RCBA 1SETA 1USYA 2ALYB 4M7DB 5LJ3h 4EMHA 2ARUA 4G84A 4WF2A 4M78G 5GMKh 3W3SA 1G5IA 5LJ3f 4P73C 4PJOF 4P72A 4HWPA 4YP0A 4YCUA 1ASZA 4M7AD 3R07A 3SB2A 5GMKi 3VBBA 4PNOA 5GANg 5GAN4 4PJOC 3L2ZA 2ZR2A 1B76A 2QHTA 4Y91A 2E3CA 4V2SA 4J6XA 2QHVA 2PMEA 3JCMg 4LNSA 5GAMj 1H4SA 4CS2A 4WI1A 4UPAA 2RHQB 5E3IA 1N9RA 4XTVA 2ZGWA 1GGMA 5GAMd 4UP9A 4TVAA 3TEHB 2CJ9A 5LJ5d 2CJBA 4RDXA 4C8QG 4ZTZB 1X56A 4L87A 3VQXA 3EFSA 1YB3A 2E64A 4J15A 1Z7NA 4M7AG 1ASYA 5GANe 1B34A 1H4VB 1QE0A 3JCMb 4M77F 4HWSA 1U1TA 4H2TA 4H2XA 3JCMe 4CH3A 3UFGA 4M7DF 2DQ3A 1YCYA 4C8QA 3JB9H 3JCMV 3QO3A 4M75C 4HA8A 2I4MA 4PHCA 4MMKA 2P5IA 3MF2A 1ADJA 5K1PA 4PJOE 1X01A 4TQFA 1E22A 3QO7A 5GAOl 2YLBA 4M75A 5GAMg 3RESA 3QO8A 3JCMX 4DQ2A 5LJ5g 3HXUA 1NJ2A 1WU7A 3QUIA 3PCOA 2EJ9A 3NENA 3E9IA 3VU3C 5GANj 4TWAA 1SESA 1HC7A 2J3MA 2DZ9A 3QHSA 3A7AA 1NJ1A 4XQ3A 2XGTA 4JRKA 4CH4A 3REUA 3HFOA 1I8FA 2JN0A 2ZCEA 5GANd 2E1HA 4C92C 2RHSA 2I4NA 4XEOA 3ERRA 1LOJA 3HXVA 4RQEA 2CIMA 2RM4A 1WYDA 1TH7A 1N9WA 3JCMd 2HNIA 3L1AA 1B34B 2CJAA 3A31A 3AHUA 2XTIA 4DPGA 5LJ5e 4NL2A 5GAN8 3P8VA 4OP0A 1D3BA 4H2XB 2AMCA 3M4GA 3QO5A 4M75E 1HTTA 4TQDA 4M77E 5I21A 4C8QB 3LC0A 4C8QD 3HSBA 3VQYA 2VC8A 4TVWA 4F7UA 3V8KA 2RD1A 2AKWA 5GAN3 4N0AC 4RQFA 5GMKl 1H4QA 4J5YA 2ARSA 3NETA 5ELOA 2ZZFA 4M7AB 3JCMW 1B7YB 5LJ3e 2DKGA 1YFTA 4P3PA 4M75D 5GMKe 4YRLA 4P73A 4EO4A 3UGTA 3A74A 4XEMA 2ZTGA 1NNHA 4YRSA 2RB6A 2YHTA 3A7UA 3NEMA 3PZCA 4YRNA 3HFNA 3L4GB 3FIFA 3PCOB 4NCXA 2ZT5A 1X55A 1Y96A 2P0LA 3GIBA 1VQZA 2EWNA 3RKWA 2ZNIA 4P71C 5GAN2 3A32A 4M78F 4QVCA 4PJOA 4C92E 4TTVA 5LJ5j 4H2SA 3V8LA 4A53A 4CS3A 4HWRA 11ASA 3KFUA 1KQ2A 1I81A 3V7CA 1EVKA 2RHSB 4EMKB 4JUVA 4YRGA 5C51B 2ZIOA 4YPFA 4G85A 5HGQA 4C92D 1YFRA 4CH6A 5CAIA 3RKYA 3SWNC 4YRCA 3JB9F 5LJ3j 4JLIA 4P3OA 4F7UE 2E10A 4M75G 3QNEA 3REXA 3UGQA 5GMKj 4XU2A 1HK9A 2ODRD 1D3BB 2AMCB 3SWNA 3P8TA 3JCMQ 5LJ3d 5GAOr 3PGGA 4K88A 3EFRA 4Q15A 4O2DA 3HFZA 2K57A 3MEYA 3P8YA 1BIAA 1G5HA 2AKWB 3IKLA 4YRIA 1X2HA 3TUPA 3BDUA 1JBMA 1NJ5A 1I4K1 2ZNJA 4M77C 3RKXA 1W66A 1SERA 3RIRA 3LSSA 2DU5A 4M7AF 2C8MA 2E5AA 4H2WA 4BWAA 4M7DC 1PYSA 2DDZA 5F5WA 2E65A 1HXDA 4M77A 4X9DA 1B8AA 1WLEA 1QF6A 1Y96B 4C92G 4YRRA 3V8JA 3RACA 4M7DA 2E41A 5KNNA 3A5YA 1MGQA 4PJOB 4NOYA 4PJOD 1Z7MA 3I7FA 4YCWA 4UP7A 4YREA 4YRPA 3JCMc 2I4OA 3HY1A 2EL9A 4PG3A 2J3LA 2DXTA 4M78E 4YROA 4TVAB 5GAN6 2QHUA 5LJ3g 3JCMJ 2G4CA 3E9HA 4MMLA 2ZZGA 1X54A 2ZZEA 4F7UG 2QTXA 3HXXA 4EMGA 1NJ6A 3HRKA 4YRFA 3DSQA 1JRIA 4P74C 3CMQA 4C92A 2DZCA 1EOVA 2QHSA 3LSQA 4HWTA 1BBUA 3G1ZA 3IKMB 4EX5A 1JJCA 3ICAA 5C52B 3M4QA 2Y90A 4Q6GA 1KQ1A 1N9SA 4H2UA 4P74A 3RF1A 1BIBA 3JB9I 3RGLA 2ZT7A 5GAOn 3HXZA 3JCMP 4H2VA 4K87A 5K1XA 1KOGA 3BFMA 3MF1A 1FYFA 4XTWA 2RA2A 2DEQA 3TEHA 3BY7A 5GAMh 4YDQA 2ZR3A 1G51A 3A5ZA 2C7IA 4PJOG 1YFSA 4P3NA 5GAMf 3BJUA 1WNLA 4M7DE 1M5Q1 4H02A 1RIQA 3QTCA 5GAN5 2ZINA 2DQ0A 1E1TA 4KR2A 4M75B 1B70A 1PYSB 5GMKm 1YGBA 1IL2A 2EJFA 4M77B 5GAOq 4M77D 4N0AA 4YRQA 3FB9A 4P72C 4M7DD 5ELNA 2IY5A 1J5WA 2Q5IA 4XU0A 2I2LA 3RERA 4YRJA 1H641 5DY9A 4YCVA 1EQRA 1EFWA 2PMFA 3IALA 5GAOp 2ZT6A 4P71A 4TVYA 1E24A 3BW1A 2YLCA 4M78C 4YYEA 1KMNA 4WJ3M 4XTXA
chains in the Genus database with same CATH superfamily
2EYYA 2MWPA 1EVLA 2I4LA 4KUDK 4UP8A 1VQLT 1JJCB 2KRNA 1KHCA 1HSQA 4AT1B 5I2SA 2LNVA 4WJ4A 2HL5C 2RI5A 2KGTA 4X9CA 4DBHA 2PZ1A 1WXBA 4J8OA 4BDZA 4LD6A 3P8DA 3KBGA 4HCZA 4A54A 1VIFA 5CKDA 4M7DG 3A5ZB 2X3XD 3VV0A 1I5LA 4LDXA 4BI8B 5GANf 2GBQA 2P4TA 3OYGA 4OMMA 4J9BA 5CKHA 4RCCA 3PMIA 2G3RA 4IURA 2RHYA 3JCMh 1ADYA 3A1PA 5C0MA 4FYWB 4MZTA 1WQWA 3CC4T 5GAOm 4YRMA 3UDCA 4ZTJA 1GBRA 2ALYA 1V29B 3MKDA 2K5LA 3QSUA 1BCMA 1OZ2A 2HL3A 3CEYA 2DTIA 3VS2A 3RL6A 4F16A 4N4IA 4HWOA 4AG1C 1NPPA 1M1FA 2KI7A 2DERA 4H2YA 2ZPIB 3ZFJA 4LVLA 4OMQA 3H0HA 3I56A 2EQKA 4MZMA 5HK0A 3UA6A 2AKKA 4M78B 1ZQ1A 4M78D 5HK3A 1VQ9Q 3OS2A 1RAGB 2Q7GA 3N5BB 2Q7EA 3REAB 3CMEA 2I0NA 2LTOA 1PKSA 2K2VA 4PLLA 1C6VX 3OW2A 3SFMA 4AFUC 1AHJB 4K86A 4XTUA 4B9WA 3HY0A 5LJ5h 3V7SA 2FHDA 4P75A 4PFOA 2L3RA 2LNHB 1O75A 3MP1A 1SRYA 2DLPA 2RHXA 4C8QE 4BDYA 2CP5A 3JV3A 3D7SB 4FT4A 2RI3A 5ECAA 3A8GB 4XTYA 1UHCA 2HSEB 2P0PA 3CPFA 1YJWA 1USYA 3URGA 2GTOA 1C0MA 2BZXA 4WF2A 1UTIA 4J9DA 2YUPA 3JRZA 3CCLQ 4M78G 1ARKA 3QWYA 2QEXQ 2OTLA 2L89A 1ASZA 2ZCFB 4Z88A 1W1FA 1G2BA 1O9SA 3SB2A 1MMDA 3PVQA 2GNCA 4PNOA 5GANg 5GAN4 2QG9B 5A2QE 3H0FA 1YJNT 3OW2P 3A8HB 5KYNA 1YITA 2QHTA 2HBPA 3LW5E 3EG9B 2E3CA 3UT1A 4E7KA 1KC8C 1YHQA 4CS2A 1YCSB 4UPAA 4PFZA 2JS2A 1TS9A 2M51A 4XTVA 4X34A 2O01E 4TVAA 1VQPT 2X35A 5LJ5d 2CJBA 5FRMA 1I07A 4PJMA 4C8QG 4ZTZB 3CCJA 1Q86R 1X56A 3VQXA 3L2RA 8ATCB 2RK2A 5CR2A 4JRQA 5CVIA 3VS4A 2O9VA 3CMAT 1B34A 1WJSA 3CCMT 4KGZB 5HCKA 2QDYB 3DB3A 4ZNXA 4PJJA 3RR6A 1QLYA 5IXBA 3I55Q 4H2XA 3H41A 5D7UA 3ZL7C 4AFZC 1NPRA 2NUPA 1KJWA 1TUCA 2D6FA 4ZGJB 2PVGB 2V8KA 3RBBB 5CK9A 1AOJA 1RI0A 3OYMA 3MF2A 4E7JA 4TQFA 1WZOA 2BTTA 5GAOl 4M75A 4IUUA 1V1CA 3HP9A 1H8KA 3J81E 1BBZA 1MNEA 4D8DA 3NENA 1SEMA 2BZ8A 4LDUA 2J3MA 2DZ9A 4FYYB 4BUGA 2RO0A 3GLXA 1UGQB 1RAFB 5GANd 2DD5A 2KQWA 1N5ZA 3I35A 1YI2Q 2HZYA 2R58A 1PD1A 1K4US 3OYEA 2JZ2A 1VOMA 2WSCE 2RJFA 4Z8AA 1Y07A 2PVOB 2D8JA 4NL2A 2ROLA 3QWXX 1MV0B 3M4GA 4C0ZA 1K73U 1HTTA 4FT2A 4TQDA 2SEMA 1V76A 2EGCA 3HSBA 2H3EB 4TVWA 3P8BB 4F7UA 4J9IA 1QKWA 4N0AC 1ZSZA 1OX9A 3ER0A 1R77A 4J5YA 4C0GA 2ARSA 4JS5A 1RUWA 5KYXB 5LJ3e 3EGDB 3P8HA 3JAME 3A74A 2MK5A 1VQ6T 1NNHA 2ZTGA 2RJEA 5KCHA 2YHTA 3NEMA 3VYGA 4YRNA 3HFNA 3C4SA 1GCQC 2MYSA 2ZT5A 1Y96A 2PUKB 5I2MA 1VQZA 2GF7A 5GAN2 1SKUB 1NJIU 4Y92A 2DNUA 2K3YA 3PE0A 2ESWA 2ZPEB 1K73R 1VQKA 1EVKA 4JJNK 1ABQA 2BE7D 1UG1A 1YJ9Q 2CH4W 4YPFA 4G85A 3OY9A 1YFRA 3CCRA 2DYIA 3UWNA 5GJVB 4YRCA 1VQ4Q 3ASKA 5LJ3j 3REXA 3UGQA 4KGVB 3G4SQ 1HK9A 3KFVA 2E3HA 1D1BA 3OYNA 1E6GA 3OYJA 2EKOA 3CCUA 4F04B 3BE3A 3BDLA 2VWFA 4RKUE 2AKWB 2XDDA 1K9MC 1WYXA 1I4K1 1NG2A 2HBWA 3VS3A 5FRNA 4RTXA 3PNWC 3LSSA 2DU5A 1Q7YU 5KYUA 5F5WA 1KK7A 1Y71A 3PTAA 4X9DA 1VQLA 2OTJQ 4BI3A 4OVAA 4RTTA 3RACA 4M7DA 2E41A 2XI9A 3O5ZA 4PJOB 4NOYA 1Q81R 4PJOD 2XK0A 4AFQC 4KRTA 4PG3A 3PIOA 2PVDB 4J9FA 1HD3A 5FROA 4Z02A 4TVAB 2CP7A 5LJ3g 4JRPA 3HXXA 1NJ6A 1JRIA 2KBTA 2FEIA 3O8VA 4QQDA 3LSQA 3OQ5A 4HWTA 3IKMB 3GPLA 1JJCA 1W2BS 3CC4A 1QCFA 2DILA 4BE0A 1KQ1A 4Q6GA 3CCVQ 4FCYA 1K76A 3HRUA 1WIEA 1RABB 2PNIA 2RQUA 2KEAA 1FX7A 1E7OA 2DEUA 3BFMA 1VQ7A 2NUPB 2RJCA 5GAMh 1G51A 3A5ZA 3CC7T 3OYAA 4PJOG 1YFSA 3VKIA 1QWEA 3CCQT 2VGNA 4EPCA 1B3QA 1M5Q1 2DMOA 5GAN5 2CP6A 1E1TA 4PJLA 4KR2A 2KR3A 4M75B 1PNJA 4OB1B 2EJFA 5CQYA 4M77B 4OGEA 5GAOq 4M77D 4N0AA 1PRMC 4YRQA 2ED1A 3HL8A 3CD6A 4P72C 3VYHB 2XG8D 2JJ9A 4A63B 2L3SA 3HHTB 2Q5IA 1NBEB 1KSWA 2I2LA 3RERA 1H641 4RG8A 4IUQA 3MJXA 1I5OB 1K8AU 1M3CA 2JOYA 1JU5C 3PVLA 2HEQA 5GAOp 2ZT6A 4EIKA 3DKMA 1TSFA 2DBKA 2HQEA 4FSXA 1KMNA 4XTXA 1GFCA 3JB9G 4HT8A 2F2XA 1ZA1B 4MDWA 5CO7A 2RF0A 4J6WA 4M78A 1L0WA 1OEBA 4RTZA 4M77G 3G71Q 2C0OA 4LVJA 3A7RA 1G83A 2E6ZA 2MAMA 4HVCA 2BZYA 2HQHA 3M59A 4XU3A 4RMFA 2IIMA 2LCLA 1M90U 5M9OA 1UB4A 2EKHA 3QJYA 4F7UB 2X3WD 4JJCA 2X4WA 2X4XA 1YIJQ 1KD1C 2ZAEA 1YJNA 1NZ9A 4LXCA 3GNGA 4OB2B 4M75F 2YXYA 3JCMf 1WQ7A 4PLIA 4XTZA 4E47A 2IY5B 1LYLA 4PK4A 2L8DA 4GBQA 2M1HA 2Q5HA 4ZIBA 1N8RU 3UA7A 4BACA 2DIQA 3KXTA 3M0QA 4IUVA 2FB7A 4HT9A 3NGPA 5DLOA 3JB9J 3HRSA 2JTEA 3CMEQ 1VQ9T 1BI3A 1M90R 1KFZA 2HCKA 1VQ5Q 2DE0X 3EG1A 12ASA 1TG0A 3CCMA 3C95A 2XD0A 4QVDA 2VUBA 1C1AA 4ZN3A 3SHWA 2YRDA 3VQVA 1AWJA 2J6OA 1C0AA 2NYSA 4E7ZA 2DO3A 2K5IA 1H4TA 4P75C 3PFSA 3UF4A 4EMKA 1G3SA 2JTMA 2KT1A 2CZ7B 1YJWQ 4X5OA 1E1OA 1X6GA 2ZZDA 3HTZA 2IPOB 2FRYA 1EIYB 4F7UF 4A4FA 1GFDA 4ATOA 3QIIA 3I9QA 1KMMA 2V1QA 3THKA 5LJ5f 1NLPC 2PU9B 2DD4A 2OTLQ 2PUOB 1W2BA 3CCLT 1USYC 1M8VA 2QEXT 2DXBA 2WSEE 4M7AE 2O2OA 1QVFS 4M7DB 2NWMA 4G84A 1YITQ 1DJ7B 5GMKh 3W3SA 1UGRB 4ZTFA 1ZLMA 4JLGA 4HWPA 4P72A 4YP0A 1S1NA 1AT1B 1YHQQ 2XDPA 4M7AD 2FZCB 4ELYC 2QA4A 2D8HA 5CIUA 2CZ1B 3MPUB 1SPKA 2OI3A 2QYZA 2CP0A 2XICA 1G3WA 2M16A 2VB6A 2X9HA 4PJOC 2J05A 3L2ZA 2L3PA 2ZR2A 2GQVA 3CCJQ 4V2SA 3EHRA 3M4YA 2PMEA 3JCMg 4LNSA 1EZZB 2LRQA 1KC8R 1G8XA 4CRIA 3S6WA 4WI1A 1U8RA 2RHQB 4HVUA 1W2BP 2YUQA 2ZGWA 4DOWA 3FRNA 1D09B 1M3BA 1VUBA 2CJ9A 1KHIA 1RAEB 1WXUA 4DA4A 4RDXA 2DL5A 4N4HA 1BI2A 2MWOA 4X1VA 5CKEA 2E64A 3REBB 3I55T 4PFPA 1Z7NA 4M7AG 5L8RE 5GANe 2OAWA 3PIPA 1H4VB 3M0TA 3JCMb 4IUPA 2Y4XA 1NEGA 4HWSA 1UJ0A 5FW9A 2NUTB 4QQ6A 4CH3A 2COWA 4M7DF 1AEYA 3JB9H 3H9NA 3JCMV 3QO3A 3CC2A 4M4ZA 2NS6A 4M75C 1ZUYA 1M1KC 1X01A 5FU7B 2K5FA 3MEUA 5KYXA 1NYGA 3EGDA 1IREB 1OU9A 2H8HA 5A0DA 3RESA 3NTKA 3VS6A 3EG2A 3JCMX 4DQ2A 5LJ5g 3EGXA 4O6JA 1M1GA 3QUIA 1D1AA 1QP3A 3E9IA 1IB8A 3VU3C 5GANj 2XDBA 4GLKA 2KROA 1YI2T 2MCNA 2VKNA 2XGTA 4CH4A 3REUA 5I22A 1IRXA 1JQQA 3WVEB 2E1HA 3T9NA 4N4GA 1WHHA 3CCEA 4XEOA 1WI7A 3ERRA 1LOJA 1UECA 2EQIA 3HXVA 1N9WA 5KE3A 1GL5A 3JCMd 2HNIA 1S72A 2CJAA 3CBOA 2XTIA 1IHVA 2DA9A 2LMJA 2QGFB 4OMPA 2YDLA 2KAFA 3QO5A 2CSQA 1UFFA 2AHJB 2L5QA 1ZSZC 1N8RC 4BD3A 4C8QB 4C8QD 1Q86U 2RD1A 3CCSQ 2AKWA 4RQFA 4C5GA 1H4QA 3NETA 2CS7A 3JCMW 4KULA 3LX7A 2RQWA 2XIDA 2A7YA 3OYCA 2RB6A 3PZCA 3DB4A 3OBYA 1LCKA 1MV3A 5IH2A 3FIFA 3QJ6A 1QVGS 1QVFA 3PCOB 4NCXA 1X55A 1WGSA 2LQ8A 2R5MA 3GIBA 2GGRA 2DYBA 2EVRA 3CCRQ 1YJ9T 3A32A 4C0DB 4M78F 4PJOA 1XOVA 4C92E 1ZHIA 4TTVA 4CS3A 3RDVA 11ASA 3CC7A 2VYTA 1VQ4T 1I81A 1QKXA 2RHSB 4EMKB 2D0QB 4JUVA 4YRGA 2DBMA 3G4ST 5C51B 3M55A 1BI0A 3G6EA 4C92D 3GOXA 1AZGB 1QW1A 4HKEA 5IHIA 4D8KA 5KCOA 1G3YA 2JUFA 2ATCB 4CC7A 1RAAB 2QQRA 2XHCA 3I5RA 3KUFA 1QP2A 2ODRD 2O88A 2AMCB 4LVIA 3SWNA 1VQMA 4KGXB 2D1XA 4Q15A 4WCIA 2K79A 1H3HA 3LLRA 5D6XA 1QVFP 1WHMA 1R0CB 1BIAA 2WACA 1G5HA 1LPLA 2OTJT 1X2HA 4YRIA 3TUPA 3BDUA 1VYUA 4ZGDB 1K9MR 2EYWA 2LP5A 2ZPGB 3RIRA 2JM8A 1VQOQ 2K7AA 4IIMA 1M9SA 4BWAA 4M7DC 2DDZA 4M77A 3E1SA 3EGUA 4TVRA 3EG0A 4EDUA 4C92G 2BIVA 4YRRA 3EAEA 3OYBA 2M0YA 3A5YA 5D6WA 3CXCS 1MGQA 1Z7MA 3I7FA 4YCWA 4UP7A 1JO8A 2LT4A 4YREA 2EL9A 3SD4A 2VASA 1VQ8A 2DXTA 2QQAA 3ME9A 1M2VB 5GAN6 4JPBW 3CPWS 2KYBA 2DK3A 1ABOA 2ECZA 2F2WA 5EG2A 2G4CA 4PKCC 4MMLA 3CCVT 1VQ7Q 2ZZGA 4EMGA 2CZ0B 2YT6A 1EOVA 2QHSA 2LDMA 3ICAA 5C52B 2O4XA 2Y90A 3EH1A 2IVWA 2E3IA 3META 4LDVA 2HSPA 2LQWA 2ZT7A 3JCMP 3FJ5A 4F14A 1FYFA 2COYA 2DEQA 4DOVA 1VA7A 3BY7A 3CD6Q 5I11A 2ZR3A 4E6RA 1X6OA 2J6KA 3ZBDA 5L23A 1VQNA 5GAMf 1ACMB 1WNLA 1ZBXA 1YBYA 3TSWA 1VYTA 2JS0A 3UPUA 5GMKm 1IL2A 2IG0A 3EGXB 3FB9A 4O5VA 3EHQA 1EIFA 1SHGA 2C0IA 3TCJA 2IY5A 4R0KA 1EFNA 2C0TA 3WVDB 5FU7C 5HKCA 2CT4A 5DY9A 2HDAA 3TU4K 3OS0A 1Q82U 2KRMA 3BW1A 4FW2A 3OYDA 5LL6S 3G71T 4M78C 2K3XA 4YYEA 2R5AA 1QVGA 4BW9A 5GAN7 2MIOA 5IN1A 3X25B 3RUXA 4LVMA 2YUNA 2RHUA 3R6NA 2EAYA 2A0FB 4J6YA 1X6BA 1Q81U 2JW4A 2DRKA 1BK2A 1XQHA 1ZUUA 2K3BA 1NJ8A 1YIJT 3VQWA 2KE9A 4FYXB 2X51A 3S3MA 1QMCA 4QVZA 2Q7HA 3G1JA 2GFAA 1YNZA 3M56A 2E5QA 2CZ6B 8AT1B 3LGFA 1EIYA 1Y7XA 1KD1R 1B70B 1I0CA 1TU0B 1X2GA 3QXEB 1M3AA 3U23A 1Q82R 2W10A 3S3OA 4C8QC 1P92A 2FYKA 3VS0A 1K1ZA 4YRKA 1KQSS 3OYIA 3CMET 3LYIA 2M02A 4XU1A 1QVGP 3LWIA 4CH5A 2ZXFA 4J9EA 1VQ5T 2DJQA 4RTVA 1WHLA 1FMWA 1M8MA 4J9GA 2P84A 4M7AA 1B7YA 4CC3A 4FSSA 5A0LA 1WPYA 2PTKA 3NELA 2VXEA 2J6FA 3GF5A 5DM7R 1FWZA 3L42A 4C0DC 3L4GA 3X24B 4BE1A 4YRTA 3MEVA 1IGQA 2HQXA 5IT9E 1ZA2B 1YJWT 1NEBA 4EMKC 2EJGA 1T3SA 1JJ2S 3M9QA 2A37A 3M4PA 3SWNB 2RHQA 5FLXE 2VXFA 2OTLT 2ZIMA 2DPPB 2DL4A 2LX7A 2CGHA 2QDLA 3FJPA 4CS4A 1LNXA 3HXWA 3VS7A 2ZT8A 1WHGA 4E51A 4JZ3A 1BB9A 3JB9D 2ODRC 3V7RA 1Y57A 1YITT 1RAHB 1YP5A 1U1SA 3VRYA 4NS5A 2QA4Q 4L5GA 1YHQT 3INZA 4RCBA 1SETA 2GCXA 1CKAA 4ESRA 2E4HA 2FG0A 1YI2A 5LJ3h 4EMHA 2NUTA 3QPHA 1G5IA 3R6OA 4PJOF 4J7IA 5C6SA 2RH2A 3CCJT 5A0GA 1T0HA 4CC2A 3R07A 1ZUKA 5AT1B 4LD9K 3FLGA 3VBBA 2P0QA 5J26A 3HRTA 1X43A 2OAUA 3H0IA 3OSSC 4KT0E 2LVMA 2CP2A 1K0XA 3A8LB 1XTDA 3HKSA 9ATCB 2GQIA 2O4XB 3DLMA 1ZSGA 4BY6B 4BB7A 5E3IA 1N9RA 1K73C 1W70A 1GGMA 2GTJA 5GAMd 3M0PA 4RTYA 4QQGA 4IKFA 1YB3A 2HD0A 3CC2Q 4L59A 4QT7A 1WJRA 5KYYB 3E9GA 3LWHA 2A08A 4UC4A 5HY6A 4M77F 2K6DA 1YJ9A 4H2TA 2KMTA 2EGAA 4MZPA 1UGPB 3JCMe 3M0SA 2DQ3A 1NJIC 2JTFA 4C8QA 3I56Q 4Z89A 4HA8A 3GP8A 4PHCA 4MMKA 2CDTA 1VQPA 1ZX6A 1H92A 1ADJA 5K1PA 4LUEA 4D6WA 3OS1A 5KYWB 1UGVA 1TWBA 3CMAA 2DL7A 3CCEQ 3NHNA 2RHZA 2DX1A 3MCAB 5IXFA 2CYZB 3NTHA 1KQSA 3LGLA 1NJ2A 3PCOA 3L2UA 2EJ9A 3OYYA 2L3QA 4IIOA 2DL3A 1SESA 3HPWA 2LJ0A 4FM4B 1S72Q 1XNIA 4BI4A 2RK1A 4JRKA 2L2PA 3HFOA 3OBWA 1UDLA 3GNFB 2A28A 2JN0A 5CKBA 2FPDA 1G5VA 2RHSA 2E6NA 1PC0A 1FMVA 4RQEA 3NFCA 2X4JA 2CIMA 1VYVA 2RM4A 2L0AA 4J9CA 1TH7A 2A8EA 3VJPA 1UJYA 3L1AA 1Q7YC 1D0ZA 1K0SA 3A31A 3OMGA 1B7TA 4OMLA 1KC8U 4DPGA 5LJ5e 1JJ2A 3CCST 2AIRB 2KNBB 2EGEA 3P8VA 2J06A 2CREA 2AMCA 1PSEA 4K11A 3SEMA 3OYHA 2NLUA 2VC8A 1KQSP 3QZ5B 4RMOA 3E9FA 4IUTA 1AWWA 4FU6A 1W6XA 2EQMA 1WA7A 2ZZFA 1M27C 4M7AB 1B7YB 3MP6A 2DKGA 2DFUA 1YFTA 4P3PA 5FU6B 3CCRT 4XEMA 4YRSA 3A7UA 2QTVA 4JDSA 3RMSA 3L4GB 1D0YA 1U3OA 1UEBA 2QQ9A 1WDXA 4ORZA 2P0LA 3G6EQ 1OI1A 3RKWA 2ZNIA 1PSFA 4C5EA 3TEEA 4JJDA 4QVCA 2D9TA 5LJ5j 4H2SA 3V8LA 1OULA 3MHXA 3KFUA 5CCAA 1KQ2A 1JJ2P 4C0FA 2Y4YA 1M2VA 1VQMQ 1SF9A 3WXMB 2QAZA 4FL6A 2ZIOA 1IZ6A 2EQUA 4AG2C 2F5KA 3H8ZA 3RKYA 3SWNC 3FC3A 1VQ6A 4JLIA 4P3OA 3PT9A 2BUDA 3QNEA 3Q1JA 3OYFA 4XU2A 1LVKA 2LQNA 3TVTA 1D3BB 2HKQB 2PQWA 4OMNA 2X4YA 4YTLA 3JCMQ 2DRMA 1TXQA 1VQOT 3PGGA 4HCCA 2RQRA 1Q95G 3HFZA 1TTHB 2K57A 3IKLA 1J3TA 1U06A 1G3TA 4KBMB 1NJ5A 1K8AC 4OB3B 2LCSA 2ZNJA 4M77C 2K4YA 3RKXA 2YWWA 3G71A 4M7AF 2C8MA 1VQ8Q 2AKLA 3M54A 2AZSA 4J83A 4LUDA 1UUEA 4LE9A 1HXDA 4Q5WA 4A4HA 3A8MB 6AT1B 1B8AA 1QF6A 5GJWB 2DIGA 2KSSA 5KNNA 2ZPHB 1PWTA 1YIJA 2EFIA 4YRPA 4RTWA 1XJWB 3JCMc 1VQ7T 3UATA 2J3LA 4M78E 3QYHB 4YROA 2K9GA 2DAQA 1M90C 2HMAA 2QHUA 2OJ2A 3C0CA 5IAYA 1YN8A 2MI6A 2QTXA 2FZGB 3HRKA 3DSQA 1OU8A 1YWOA 2LJ1A 4BY6C 4ANJA 3CMQA 4ZGEB 2VV5A 3CQTA 1N6AA 3EFOB 1VQNQ 3CD6T 3ZEHA 1SRMA 1BBUA 2A36A 1MMAA 3M4QA 3RF1A 4P74A 1PHTA 2LJ3A 2CKKA 2QK0A 1T0JA 1RLPC 5GAOn 4H2VA 4XK8E 4K87A 5K1XA 3QBYA 2QI2A 1KOGA 2YSQA 4E7IA 1VQ5A 2KXCA 2RA2A 4XTWA 2MMPA 3TEHA 1JXOA 4YDQA 1Z9ZA 1QCNA 3M5AA 5CKFA 1BI1A 2NUZA 4LN2A 4P3NA 1X27A 2RQTA 3BJUA 4DBQA 1MHNA 3QTCA 2ZINA 1UHFA 1B70A 1PYSB 1OQKA 3PMTA 2YRCA 4WTOB 1VQKQ 4AMCA 2LQKA 1J5WA 2YUOA 1Y0MA 1BCOA 2E70A 2VGMA 2DXCA 4YCVA 2DF6A 1EFWA 1K9MU 3E19A 1WHJA 3CCQA 1E24A 3CCUQ 2AZVA 2YLCA 2EYQA 4WJ3M 1M4ZA 3HRIA 4C92B 2A3LA 3SDZA 3HFVA 2ARTA 3A98A 3FEOA 2YRVA 2RMOA 2Z0WA 2RQVA 2QQBA 3OMCA 2DXUA 1E6HA 2F1LA 2WSFE 2DVJA 4E7SA 1VQLQ 5GANh 1KIKA 2M0OA 4E2FB 2CSIA 1RADB 1A0NB 3OD1A 4C8QF 3TEGA 2JMCA 4OLFA 3C94A 2P4RA 1FMKA 4A4KA 1WHKA 3UH0A 2KK4A 1NYQA 1U5SA 2GFUA 3MP8A 2DTOA 1NYRA 1X75C 4AH6A 2KY9A 4M7AC 3CBPA 5FU6C 1X2QA 2DVEA 3OA6A 2DETA 3X20B 1QWFA 4ZTUB 4KQEA 3CC4Q 2DTHA 3EG3A 1HJDA 1NE8A 2ROTA 1GXIE 2DU7A 4RTUA 3WQZA 1Z9QA 2MF2A 1H3ZA 3HXYA 1WX6A 3EH2A 4JRIA 4CI0C 4HCKA 1OZ3A 4C92F 2O31A 2JXBA 2QGGA 4AFSC 2K2MA 1LJOA 1M2OA 2BKDN 4FYVB 1PD0A 1OV3A 4MDXA 3L2WA 2EYXA 1FXXA 2LC4A 1GRIA 2EPDA 3IG2A 1EX4A 2J7IA 3HFZB 1ATIA 5C53B 1BU1A 1B07A 2QA4T 5D6YA 1ZBJA 4NL3A 4KR3A 2V8IA 2DJZA 3HTRA 1AD5A 1VQ9A 2KRSA 1M30A 2AT1B 4E7LA 1R0BG 5GAMe 5KYYA 2V8JA 1OX8A 1PM3A 3RMQA 4HT4A 3J7AF 3OS5A 3TSZA 1BBWA 4L6V5 2D0NA 3M57A 3OB9A 4KH1B 2ALYB 2LT1A 3CBMA 2ARUA 2G6FX 4PJNA 1OPLA 1RACB 2MPXC 1SSHA 5LJ3f 4P73C 3NTIA 4KH0B 1R8OB 4YCUA 1D1CA 3MEWA 1FYNA 1KD1U 4LVKA 5GMKi 4DBFA 4J9HA 2XKOC 7AT1B 2F5TX 5KYWA 4OMFB 1MMGA 4PL6A 3MQZA 1IO6A 1B76A 3CCLA 4Y91A 1GBQA 1T3LA 1UE9A 1BKBA 2QEXA 4GY5A 3CCSA 2ENMA 2CT3A 4J6XA 3C12A 2QHVA 1RAIB 5GAMj 2LX9A 1H4SA 4R56A 2W0ZA 1YJNQ 2FL7A 4CC4B 3QG1A 4KUIA 3CC2T 2C06A 1SHFA 4UP9A 3TEHB 1X69A 2RN8A 4B9XA 1Q86C 2SRCA 3AT1B 4II1A 2M9UA 4L87A 1PKTA 3VUZA 3DLLA 3EFSA 4OGCA 4E7HA 4HVVA 4J15A 2MOXA 1ASYA 2OX7A 1VQPQ 4R55A 4JZ4A 1QE0A 3I56T 1JB0E 3OYLA 3F70A 2CP3A 3MEAA 2KXDA 3VS5A 1U1TA 4LDYA 3H6ZA 3QZ9B 3CMAQ 3UFGA 4A4GA 1YCYA 2HAXA 1TOVA 4DBRA 1NJIR 3CCMQ 4LDWA 3QDRB 2I4MA 3CCET 1OYXA 2P5IA 4PJOE 2KVQG 1E22A 3RNJA 3QO7A 2YLBA 1BYMA 4LNPA 1S72T 5GAMg 3I55A 3QO8A 2F2VA 3A8OB 4JJBA 3HXUA 1WU7A 1WJQA 2ABLA 2EBPA 3FDRA 5EC7A 4VUBA 4HXJA 3CXCA 4TWAA 1W4SA 1HC7A 4HCBA 2RI2A 1VQOA 3QHSA 3A7AA 5KH6A 4XQ3A 1NJ1A 3MO8A 3G7ZA 3M0UA 1JXMA 5DLQE 1I8FA 3I5SA 2ZCEA 4RUGA 3LH5A 2BE9B 1AZEA 4C92C 1QCOA 5AYFA 3CPWA 2I4NA 3VUBA 3NPFA 2EYZA 2B8AA 3QYGB 2CH4A 1WYDA 4C5HA 5J3BA 3ULRB 2O9SA 1RL2A 1OOTA 4FIBA 1B34B 4DEXA 4JS4A 1Q7YR 3AHUA 2FVUA 1PG5B 2EW3A 5GAN8 1GCPA 1YWPA 2JT4A 4OP0A 1D3BA 4H2XB 1TUDA 2RJDA 3NMZC 4M75E 2QQSA 3QKJA 5J39A 1IXDA 4M77E 1SG5A 4FW1A 5I21A 2RHIA 3QDFA 5FWBA 3LC0A 3VQYA 2FZKB 3VRZA 4OF1A 3V8KA 5GAN3 5GMKl 3CXCP 1YFNA 5ELOA 2JMAA 3G6ET 1NYFA 1CSKA 1I1JA 4M75D 5GMKe 1RI9A 4P73A 4YRLA 3UGTA 4EO4A 1CKBA 4DEYA 3CPWP 2CUBA 2DM1A 4J7FA 2EWNA 1VQMT 4P71C 2E12A 4P5NA 2FPFA 1RLQC 3OYKA 1VQ6Q 1GCQA 4A53A 4C5IA 2P0KA 4HWRA 1SSFA 2CUDA 3V7CA 1M1KU 3E2UA 5FWCA 3J80E 2JNGA 4GLMA 2B86A 5CQXA 4B6MA 1SRLA 5HGQA 2FO0A 4CH6A 2RNAA 5CAIA 1MMNA 2E5KA 3JB9F 2DL8A 2E10A 3EFOA 4F7UE 4M75G 3LH0A 3TREA 1MUZA 5GMKj 3S3NA 3P8TA 3IQLA 2LZ6B 5LJ3d 5GAOr 5IHNA 4K88A 1VQ8T 3EFRA 4ZN1A 1AWOA 4O2DA 4ELZC 3MEYA 3P8YA 1ZSZB 1VQ4A 1JBMA 2XMFA 2VVKA 1K8AR 4QW2A 2COZA 1W66A 1Q82C 1SERA 2JVVA 3M53A 3G4SA 3VS1A 1M1KR 2E5AA 4H2WA 2LCCA 4OB0B 1PYSA 2E65A 1WLPB 4F17A 3M58A 2ZPFB 4HVWA 1WLEA 2KT8A 1Y96B 3V8JA 2HKNA 1Q81C 3GBQA 1AVZC 2I4OA 3HY1A 1K9AA 1VIEA 2ZPBB 1N27A 2KDSA 1VQNT 1F1BB 4Y28E 5KE2A 3OW2S 2OTJA 1PCXA 3JCMJ 3E9HA 1D0XA 3OSVA 1X54A 2ZZEA 4F7UG 4YRFA 2ED0A 2EIFA 4P74C 1WXTA 1HYOA 4C92A 2DZCA 3EG9A 3G1ZA 4EX5A 2KYMA 4XAXB 1AWXA 1KG1A 1N9SA 1JEGA 4H2UA 2F69A 1BIBA 1MNDA 4A4EA 3JB9I 3RGLA 3HXZA 1IHWA 3MF1A 1PRLC 3L2QA 1N8RR 2C7IA 1VQKT 2EQJA 3L2VA 1NLOC 4M7DE 3TQ7P 2QASA 4H02A 1RIQA 2FRWA 2DQ0A 4BE2A 1X2KA 3CCVA 4RG2A 5KYUB 1QQJA 1YGBA 1UGSB 4OMOA 1NM7A 2V1RA 1QVPA 3M0RA 2H3JA 3CC7Q 1WFWA 5IHKA 3CCQQ 1IGUA 4M7DD 5ELNA 4XU0A 2FPEA 3JSCA 1OPKA 3CCUT 4YRJA 3X28B 2R57A 4QKUA 2QXFA 4ME7A 3X26B 1EQRA 2RPNA 2PMFA 3IALA 1TUGB 2AK5A 4P71A 4TVYA 2XU8A 2JM9A 2V26A
chains in the Genus database with same CATH topology
2MWPA 1EVLA 2I4LA 4KUDK 4UP8A 1VQLT 1JJCB 1KHCA 5I2SA 2LNVA 4WJ4A 2RI5A 4X9CA 4J8OA 4BDZA 4LD6A 3P8DA 3KBGA 4HCZA 4A54A 1VIFA 5CKDA 4M7DG 3A5ZB 3VV0A 1I5LA 4LDXA 4BI8B 5GANf 2P4TA 3OYGA 5CKHA 4RCCA 3PMIA 2G3RA 4IURA 2RHYA 3JCMh 1ADYA 5C0MA 4MZTA 1WQWA 3CC4T 5GAOm 4YRMA 3UDCA 4ZTJA 2ALYA 1V29B 2K5LA 3QSUA 1OZ2A 3CEYA 2DTIA 3RL6A 4N4IA 4HWOA 1NPPA 1M1FA 4H2YA 2ZPIB 3ZFJA 4LVLA 3I56A 2EQKA 4MZMA 5HK0A 4M78B 1ZQ1A 4M78D 5HK3A 3OS2A 2Q7GA 3N5BB 2Q7EA 3CMEA 2LTOA 2K2VA 4PLLA 3OW2A 3SFMA 1AHJB 4K86A 4XTUA 4B9WA 3HY0A 5LJ5h 3V7SA 2FHDA 4P75A 2L3RA 1O75A 3MP1A 1SRYA 2RHXA 4C8QE 4BDYA 4FT4A 2RI3A 3A8GB 4XTYA 2P0PA 3CPFA 1YJWA 1USYA 3URGA 4WF2A 3JRZA 4M78G 2OTLA 2L89A 1ASZA 2ZCFB 1O9SA 3SB2A 4PNOA 5GANg 5GAN4 5A2QE 1YJNT 3A8HB 1YITA 2QHTA 2HBPA 3LW5E 2E3CA 3UT1A 4E7KA 1KC8C 1YHQA 4CS2A 4UPAA 4XTVA 4X34A 2O01E 4TVAA 1VQPT 2X35A 5LJ5d 2CJBA 5FRMA 4C8QG 4ZTZB 3CCJA 1X56A 3VQXA 3L2RA 2RK2A 5CR2A 4JRQA 5CVIA 3CMAT 1B34A 1WJSA 3CCMT 2QDYB 3DB3A 4H2XA 1NPRA 2D6FA 4ZGJB 2PVGB 2V8KA 5CK9A 1RI0A 3OYMA 3MF2A 4E7JA 4TQFA 5GAOl 4M75A 4IUUA 3HP9A 3J81E 3NENA 4LDUA 2J3MA 2DZ9A 4BUGA 2RO0A 3GLXA 1UGQB 5GANd 2DD5A 2KQWA 2R58A 3OYEA 2JZ2A 2WSCE 2RJFA 1Y07A 2PVOB 4NL2A 3M4GA 4C0ZA 1K73U 1HTTA 4FT2A 4TQDA 3HSBA 4TVWA 3P8BB 4F7UA 4N0AC 3ER0A 4C0GA 4J5YA 2ARSA 4JS5A 5LJ3e 3P8HA 3JAME 3A74A 1VQ6T 1NNHA 2ZTGA 2RJEA 5KCHA 2YHTA 3NEMA 3VYGA 4YRNA 3HFNA 3C4SA 2ZT5A 1Y96A 2PUKB 5I2MA 1VQZA 2GF7A 5GAN2 1NJIU 2K3YA 2ZPEB 1EVKA 1VQKA 4JJNK 4YPFA 4G85A 3OY9A 1YFRA 3CCRA 3UWNA 4YRCA 3ASKA 5LJ3j 3REXA 3UGQA 1HK9A 3OYNA 3OYJA 2EKOA 3CCUA 3BDLA 4RKUE 2AKWB 2XDDA 1K9MC 1I4K1 5FRNA 3PNWC 3LSSA 2DU5A 1Q7YU 5F5WA 1Y71A 3PTAA 4X9DA 1VQLA 4BI3A 4OVAA 3RACA 4M7DA 2E41A 2XI9A 4PJOB 4NOYA 4PJOD 2XK0A 4PG3A 3PIOA 2PVDB 5FROA 4Z02A 4TVAB 5LJ3g 4JRPA 3HXXA 1NJ6A 1JRIA 3O8VA 4QQDA 3LSQA 3OQ5A 4HWTA 3IKMB 3GPLA 1JJCA 1W2BS 3CC4A 4BE0A 1KQ1A 4Q6GA 3HRUA 1FX7A 3BFMA 1VQ7A 2RJCA 5GAMh 1G51A 3A5ZA 3CC7T 3OYAA 4PJOG 1YFSA 3VKIA 3CCQT 2VGNA 4EPCA 1M5Q1 5GAN5 1E1TA 4KR2A 4M75B 4OB1B 2EJFA 5CQYA 4M77B 4OGEA 5GAOq 4M77D 4N0AA 4YRQA 3HL8A 3CD6A 4P72C 3VYHB 2XG8D 3HHTB 2Q5IA 2I2LA 3RERA 1H641 4RG8A 4IUQA 1K8AU 2JOYA 5GAOp 2ZT6A 3DKMA 2HQEA 4FSXA 1KMNA 4XTXA 3JB9G 4HT8A 4MDWA 5CO7A 4J6WA 4M78A 1L0WA 4M77G 4LVJA 3A7RA 2E6ZA 2MAMA 4HVCA 3M59A 4XU3A 4RMFA 2LCLA 1M90U 5M9OA 1UB4A 3QJYA 4F7UB 2X4WA 2X4XA 1KD1C 1YJNA 1NZ9A 3GNGA 4OB2B 4M75F 3JCMf 1WQ7A 4PLIA 4XTZA 4E47A 2IY5B 1LYLA 2L8DA 2M1HA 2Q5HA 4ZIBA 1N8RU 4BACA 2DIQA 3KXTA 4IUVA 2FB7A 4HT9A 5DLOA 3JB9J 3HRSA 1VQ9T 1BI3A 12ASA 3CCMA 3C95A 2XD0A 4QVDA 2VUBA 4ZN3A 3VQVA 1C0AA 4P75C 2DO3A 2K5IA 1H4TA 3PFSA 4EMKA 1G3SA 2JTMA 2CZ7B 4X5OA 1E1OA 2ZZDA 3HTZA 1EIYB 4F7UF 4A4FA 4ATOA 3QIIA 1KMMA 5LJ5f 2PU9B 2DD4A 2PUOB 1W2BA 3CCLT 1USYC 1M8VA 2QEXT 2DXBA 2WSEE 4M7AE 1QVFS 4M7DB 4G84A 1DJ7B 5GMKh 3W3SA 1UGRB 4ZTFA 4JLGA 4HWPA 4P72A 4YP0A 2XDPA 4M7AD 4ELYC 2QA4A 5CIUA 2CZ1B 2XICA 1G3WA 2M16A 4PJOC 3L2ZA 2ZR2A 2GQVA 4V2SA 3M4YA 2PMEA 3JCMg 4LNSA 2LRQA 4CRIA 3S6WA 4WI1A 1U8RA 2RHQB 2ZGWA 4DOWA 3FRNA 1VUBA 2CJ9A 1KHIA 4DA4A 4RDXA 4N4HA 1BI2A 2MWOA 5CKEA 2E64A 3I55T 1Z7NA 4M7AG 5L8RE 5GANe 3PIPA 1H4VB 3JCMb 4IUPA 2Y4XA 4HWSA 4QQ6A 4CH3A 4M7DF 3JB9H 3CC2A 3JCMV 3QO3A 2NS6A 4M75C 1M1KC 1X01A 5FU7B 2K5FA 3MEUA 1IREB 5A0DA 3RESA 3NTKA 3JCMX 4DQ2A 5LJ5g 4O6JA 1M1GA 3QUIA 1QP3A 3E9IA 3VU3C 5GANj 2XDBA 4GLKA 1YI2T 2XGTA 4CH4A 3REUA 3WVEB 2E1HA 3T9NA 4N4GA 3CCEA 4XEOA 3ERRA 1LOJA 3HXVA 1N9WA 5KE3A 3JCMd 2HNIA 1S72A 2CJAA 3CBOA 2XTIA 2KAFA 3QO5A 2AHJB 2L5QA 1N8RC 4BD3A 4C8QB 4C8QD 1Q86U 2RD1A 2AKWA 4RQFA 4C5GA 1H4QA 3NETA 2CS7A 3JCMW 4KULA 3LX7A 2XIDA 2A7YA 3OYCA 2RB6A 3PZCA 3DB4A 3OBYA 3PCOB 3FIFA 3QJ6A 1QVGS 1QVFA 4NCXA 1X55A 1WGSA 2LQ8A 2R5MA 3GIBA 1YJ9T 3A32A 4C0DB 4M78F 4PJOA 1XOVA 4C92E 1ZHIA 4TTVA 4CS3A 11ASA 3CC7A 2VYTA 1VQ4T 1I81A 2RHSB 4EMKB 2D0QB 4JUVA 4YRGA 3G4ST 5C51B 3M55A 1BI0A 3G6EA 4C92D 3GOXA 1QW1A 4HKEA 5KCOA 1G3YA 2JUFA 2QQRA 2XHCA 3KUFA 1QP2A 2ODRD 2AMCB 4LVIA 3SWNA 1VQMA 4Q15A 3LLRA 5D6XA 1BIAA 2WACA 1G5HA 3TUPA 2OTJT 1X2HA 4YRIA 3BDUA 4ZGDB 2ZPGB 3RIRA 1M9SA 4BWAA 4M7DC 2DDZA 4M77A 3E1SA 4TVRA 4EDUA 4C92G 2BIVA 4YRRA 3EAEA 3OYBA 3A5YA 5D6WA 3CXCS 1MGQA 1Z7MA 3I7FA 4YCWA 4UP7A 4YREA 2LT4A 2EL9A 3SD4A 1VQ8A 2DXTA 2QQAA 3ME9A 5GAN6 3CPWS 2DK3A 5EG2A 2G4CA 4PKCC 4MMLA 3CCVT 2ZZGA 4EMGA 2CZ0B 1EOVA 2QHSA 2LDMA 3ICAA 5C52B 2O4XA 2Y90A 2IVWA 3META 4LDVA 2ZT7A 3JCMP 1FYFA 2DEQA 4DOVA 3BY7A 2ZR3A 1X6OA 3ZBDA 1VQNA 5GAMf 1WNLA 1ZBXA 1YBYA 3UPUA 5GMKm 1IL2A 2IG0A 3FB9A 4O5VA 1EIFA 3TCJA 2IY5A 3WVDB 5FU7C 5HKCA 5DY9A 3TU4K 3OS0A 1Q82U 3BW1A 3OYDA 5LL6S 3G71T 4M78C 2K3XA 4YYEA 2R5AA 1QVGA 4BW9A 5GAN7 5IN1A 3X25B 3RUXA 4LVMA 2RHUA 2EAYA 4J6YA 1Q81U 1XQHA 1NJ8A 1YIJT 3VQWA 3S3MA 4QVZA 2Q7HA 2GFAA 3M56A 2E5QA 2CZ6B 3LGFA 1EIYA 1Y7XA 1B70B 1X2GA 3QXEB 3S3OA 4C8QC 1P92A 2FYKA 4YRKA 1KQSS 3OYIA 3CMET 3LYIA 4XU1A 3LWIA 4CH5A 2ZXFA 1VQ5T 4M7AA 1B7YA 5A0LA 1WPYA 3NELA 2VXEA 3GF5A 5DM7R 1FWZA 3L42A 4C0DC 3L4GA 3X24B 4BE1A 4YRTA 3MEVA 2HQXA 5IT9E 1YJWT 4EMKC 2EJGA 1JJ2S 3M9QA 3M4PA 3SWNB 2RHQA 5FLXE 2VXFA 2OTLT 2ZIMA 2DPPB 2CGHA 4CS4A 3FJPA 1LNXA 3HXWA 2ZT8A 4E51A 3JB9D 2ODRC 3V7RA 1YITT 1U1SA 4NS5A 4L5GA 1YHQT 3INZA 4RCBA 1SETA 2GCXA 1YI2A 5LJ3h 4EMHA 3QPHA 1G5IA 3R6OA 4PJOF 4J7IA 5C6SA 2RH2A 3CCJT 5A0GA 3R07A 4LD9K 3FLGA 3VBBA 2P0QA 5J26A 3HRTA 2OAUA 3OSSC 4KT0E 2LVMA 3A8LB 1XTDA 3HKSA 2O4XB 3DLMA 4BY6B 4BB7A 5E3IA 1N9RA 1K73C 1GGMA 5GAMd 4QQGA 4IKFA 1YB3A 2HD0A 4L59A 1WJRA 3E9GA 3LWHA 4UC4A 5HY6A 4M77F 1YJ9A 4H2TA 2KMTA 4MZPA 1UGPB 3JCMe 2DQ3A 1NJIC 2JTFA 4C8QA 3GP8A 4HA8A 4PHCA 4MMKA 1VQPA 1ADJA 5K1PA 4D6WA 3OS1A 3CMAA 2RHZA 3MCAB 1NJ2A 1KQSA 2CYZB 3NTHA 3LGLA 3PCOA 3L2UA 2EJ9A 3OYYA 1SESA 3HPWA 4FM4B 1XNIA 4BI4A 2RK1A 4JRKA 3HFOA 3OBWA 3GNFB 2JN0A 5CKBA 1G5VA 2RHSA 2E6NA 4RQEA 3NFCA 2X4JA 2CIMA 2RM4A 1TH7A 2A8EA 3VJPA 3L1AA 1Q7YC 3A31A 3OMGA 1KC8U 4DPGA 5LJ5e 1JJ2A 3CCST 3P8VA 2AMCA 1PSEA 3OYHA 2NLUA 2VC8A 3QZ5B 4RMOA 3E9FA 4IUTA 4FU6A 2EQMA 2ZZFA 4M7AB 1B7YB 3MP6A 2DKGA 1YFTA 4P3PA 5FU6B 3CCRT 4XEMA 4YRSA 3A7UA 4JDSA 3RMSA 3L4GB 1UEBA 2QQ9A 2P0LA 1OI1A 3RKWA 2ZNIA 1PSFA 4C5EA 3TEEA 4QVCA 2D9TA 5LJ5j 4H2SA 3V8LA 3MHXA 3KFUA 5CCAA 1KQ2A 4C0FA 2Y4YA 3WXMB 4FL6A 2ZIOA 1IZ6A 2EQUA 2F5KA 3H8ZA 3RKYA 3SWNC 3FC3A 1VQ6A 4JLIA 4P3OA 3PT9A 2BUDA 3QNEA 3Q1JA 3OYFA 4XU2A 1D3BB 2PQWA 2X4YA 4YTLA 3JCMQ 1VQOT 3PGGA 4HCCA 3HFZA 2K57A 3IKLA 1G3TA 4KBMB 1NJ5A 1K8AC 4OB3B 2ZNJA 4M77C 2K4YA 3RKXA 3G71A 4M7AF 2C8MA 3M54A 4J83A 1HXDA 4Q5WA 4A4HA 3A8MB 1B8AA 1QF6A 2DIGA 2KSSA 5KNNA 2ZPHB 1YIJA 2EFIA 4YRPA 1VQ7T 3JCMc 2J3LA 4M78E 3QYHB 4YROA 1M90C 2DAQA 2QHUA 5IAYA 2MI6A 2QTXA 3HRKA 3DSQA 3CMQA 4BY6C 4ZGEB 2VV5A 1BBUA 1N6AA 3CD6T 3ZEHA 3M4QA 3RF1A 4P74A 2CKKA 5GAOn 4H2VA 4XK8E 4K87A 5K1XA 3QBYA 2QI2A 1KOGA 4E7IA 1VQ5A 4XTWA 2RA2A 3TEHA 2MMPA 4YDQA 3M5AA 5CKFA 1BI1A 4P3NA 3BJUA 1MHNA 3QTCA 2ZINA 1B70A 1PYSB 3PMTA 2LQKA 1J5WA 2E70A 2VGMA 2DXCA 4YCVA 1EFWA 1K9MU 3E19A 3CCQA 1E24A 2YLCA 2EYQA 4WJ3M 1M4ZA 3HRIA 4C92B 2A3LA 3SDZA 3HFVA 2ARTA 3FEOA 2YRVA 2QQBA 3OMCA 2DXUA 2WSFE 5GANh 2M0OA 3OD1A 4C8QF 3TEGA 4OLFA 3C94A 4A4KA 3UH0A 2KK4A 1NYQA 2GFUA 3MP8A 2DTOA 1NYRA 1X75C 4AH6A 2KY9A 4M7AC 3CBPA 5FU6C 2DVEA 3OA6A 3X20B 4ZTUB 4KQEA 2DTHA 1NE8A 1GXIE 2DU7A 3WQZA 2MF2A 1H3ZA 3HXYA 4JRIA 4CI0C 1OZ3A 4C92F 1LJOA 2BKDN 4MDXA 3L2WA 1FXXA 2LC4A 3IG2A 3HFZB 1ATIA 5C53B 2QA4T 5D6YA 4NL3A 4KR3A 2V8IA 2DJZA 1VQ9A 4E7LA 5GAMe 2V8JA 3RMQA 4HT4A 3J7AF 3OS5A 1BBWA 4L6V5 3M57A 3OB9A 2ALYB 2LT1A 3CBMA 2ARUA 5LJ3f 4P73C 3NTIA 1R8OB 4YCUA 3MEWA 1KD1U 4LVKA 5GMKi 2XKOC 2F5TX 4OMFB 4PL6A 3MQZA 1B76A 3CCLA 4Y91A 2QEXA 1BKBA 4GY5A 3CCSA 4J6XA 2QHVA 3C12A 5GAMj 2LX9A 1H4SA 4R56A 2FL7A 3QG1A 4KUIA 3CC2T 2C06A 4UP9A 3TEHB 4B9XA 1Q86C 4II1A 2M9UA 4L87A 3VUZA 3DLLA 3EFSA 4OGCA 4E7HA 4J15A 1ASYA 4R55A 1QE0A 3I56T 1JB0E 3OYLA 3F70A 3MEAA 1U1TA 4LDYA 3H6ZA 3QZ9B 3UFGA 4A4GA 1YCYA 2HAXA 4LDWA 3QDRB 2I4MA 3CCET 1OYXA 2P5IA 4PJOE 2KVQG 1E22A 3QO7A 2YLBA 1BYMA 1S72T 5GAMg 3I55A 3QO8A 3A8OB 3HXUA 1WU7A 1WJQA 3FDRA 4VUBA 3CXCA 4TWAA 1W4SA 1HC7A 4HCBA 2RI2A 1VQOA 3QHSA 3A7AA 5KH6A 4XQ3A 1NJ1A 3MO8A 3G7ZA 5DLQE 1I8FA 2ZCEA 4C92C 5AYFA 3CPWA 2I4NA 3VUBA 2B8AA 3QYGB 1WYDA 4C5HA 5J3BA 4FIBA 1RL2A 1B34B 4JS4A 3AHUA 2FVUA 5GAN8 4OP0A 1D3BA 4H2XB 2RJDA 4M75E 2QQSA 3QKJA 5J39A 4M77E 5I21A 2RHIA 3LC0A 3VQYA 4OF1A 3V8KA 5GAN3 5GMKl 5ELOA 3G6ET 4M75D 5GMKe 4YRLA 4P73A 4EO4A 3UGTA 4J7FA 2EWNA 1VQMT 4P71C 2E12A 4P5NA 3OYKA 4A53A 4C5IA 2P0KA 4HWRA 1SSFA 3V7CA 1M1KU 3J80E 2JNGA 5CQXA 5HGQA 4CH6A 5CAIA 3JB9F 4F7UE 2E10A 4M75G 3LH0A 3TREA 5GMKj 3S3NA 3P8TA 5LJ3d 5GAOr 4K88A 1VQ8T 3EFRA 4ZN1A 4O2DA 4ELZC 3MEYA 3P8YA 1VQ4A 1JBMA 4QW2A 1W66A 1Q82C 1SERA 2JVVA 3M53A 3G4SA 2E5AA 4H2WA 2LCCA 4OB0B 1PYSA 2E65A 3M58A 2ZPFB 1WLEA 1Y96B 3V8JA 1Q81C 2I4OA 3HY1A 1VIEA 2ZPBB 1N27A 2KDSA 1VQNT 4Y28E 5KE2A 3OW2S 2OTJA 3JCMJ 3E9HA 3OSVA 1X54A 2ZZEA 4F7UG 4YRFA 2EIFA 4P74C 4C92A 2DZCA 3G1ZA 4EX5A 4XAXB 1KG1A 1N9SA 4H2UA 2F69A 1BIBA 4A4EA 3JB9I 3RGLA 3HXZA 3MF1A 3L2QA 2C7IA 1VQKT 2EQJA 3L2VA 4M7DE 4H02A 1RIQA 2DQ0A 4BE2A 3CCVA 4RG2A 1YGBA 1UGSB 1QVPA 2H3JA 4M7DD 5ELNA 4XU0A 3JSCA 3CCUT 4YRJA 3X28B 2R57A 2QXFA 4ME7A 3X26B 1EQRA 2PMFA 3IALA 4P71A 4TVYA 2XU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRI A;  4BW9 A;  4C92 B;  5GAN 7;  1EVL A;  2I4L A;  3JB9 G;  4HT8 A;  3RUX A;  3HFV A;  4UP8 A;  1JJC B;  2ART A;  2EAY A;  4J6W A;  4WJ4 A;  4M78 A;  4J6Y A;  1L0W A;  2DXU A;  4M77 G;  4X9C A;  3A7R A;  1NJ8 A;  3VQW A;  4HVC A;  4XU3 A;  4A54 A;  4RMF A;  4M7D G;  5GAN h;  1I5L A;  2Q7H A;  3OD1 A;  4F7U B;  4C8Q F;  5GAN f;  3TEG A;  4OLF A;  1EIY A;  4RCC A;  1B70 B;  1X2G A;  3JCM h;  1ADY A;  4M75 F;  3UH0 A;  1NYQ A;  3JCM f;  4C8Q C;  2FYK A;  2DTO A;  1WQ7 A;  1NYR A;  1WQW A;  4XTZ A;  5GAO m;  2IY5 B;  1LYL A;  4YRM A;  4YRK A;  2Q5H A;  4AH6 A;  2ALY A;  4ZIB A;  4XU1 A;  4M7A C;  4CH5 A;  3QSU A;  2ZXF A;  2DVE A;  2FB7 A;  2DTI A;  4HT9 A;  4ZTU B;  4KQE A;  2DTH A;  3JB9 J;  3RL6 A;  4M7A A;  1B7Y A;  4HWO A;  2DU7 A;  3WQZ A;  1WPY A;  3NEL A;  2VXE A;  3HXY A;  4H2Y A;  12AS A;  3L4G A;  4JRI A;  4C92 F;  4QVD A;  4YRT A;  4M78 B;  4M78 D;  1LJO A;  4EMK C;  2Q7G A;  2EJG A;  3VQV A;  3M4P A;  2Q7E A;  3SWN B;  2RHQ A;  1C0A A;  4P75 C;  1H4T A;  2VXF A;  2ZIM A;  3IG2 A;  4EMK A;  3HFZ B;  1ATI A;  5C53 B;  2CGH A;  4K86 A;  3FJP A;  4CS4 A;  4X5O A;  4XTU A;  1LNX A;  3HXW A;  3HY0 A;  4NL3 A;  1E1O A;  5LJ5 h;  3V7S A;  3HTZ A;  2ZT8 A;  4P75 A;  1EIY B;  4F7U F;  4KR3 A;  4E51 A;  2DJZ A;  3JB9 D;  1SRY A;  2ODR C;  1KMM A;  4C8Q E;  5LJ5 f;  3V7R A;  5GAM e;  1USY C;  1M8V A;  1U1S A;  4XTY A;  1BBW A;  4M7A E;  3INZ A;  4RCB A;  1SET A;  1USY A;  2ALY B;  4M7D B;  5LJ3 h;  4EMH A;  2ARU A;  4G84 A;  4WF2 A;  4M78 G;  5GMK h;  3W3S A;  1G5I A;  5LJ3 f;  4P73 C;  4PJO F;  4P72 A;  4HWP A;  4YP0 A;  4YCU A;  1ASZ A;  4M7A D;  3R07 A;  3SB2 A;  5GMK i;  3VBB A;  4PNO A;  5GAN g;  5GAN 4;  4PJO C;  3L2Z A;  2ZR2 A;  1B76 A;  2QHT A;  4Y91 A;  2E3C A;  4V2S A;  4J6X A;  2QHV A;  2PME A;  3JCM g;  4LNS A;  5GAM j;  1H4S A;  4CS2 A;  4WI1 A;  4UPA A;  2RHQ B;  5E3I A;  1N9R A;  4XTV A;  2ZGW A;  1GGM A;  5GAM d;  4UP9 A;  4TVA A;  3TEH B;  2CJ9 A;  5LJ5 d;  2CJB A;  4RDX A;  4C8Q G;  4ZTZ B;  1X56 A;  4L87 A;  3VQX A;  3EFS A;  1YB3 A;  2E64 A;  4J15 A;  1Z7N A;  4M7A G;  1ASY A;  5GAN e;  1B34 A;  1H4V B;  1QE0 A;  3JCM b;  4M77 F;  4HWS A;  1U1T A;  4H2T A;  4H2X A;  3JCM e;  4CH3 A;  3UFG A;  4M7D F;  2DQ3 A;  1YCY A;  4C8Q A;  3JB9 H;  3JCM V;  3QO3 A;  4M75 C;  4HA8 A;  2I4M A;  4PHC A;  4MMK A;  2P5I A;  3MF2 A;  1ADJ A;  5K1P A;  4PJO E;  1X01 A;  4TQF A;  1E22 A;  3QO7 A;  5GAO l;  2YLB A;  4M75 A;  5GAM g;  3RES A;  3QO8 A;  3JCM X;  4DQ2 A;  5LJ5 g;  3HXU A;  1NJ2 A;  1WU7 A;  3QUI A;  3PCO A;  2EJ9 A;  3NEN A;  3E9I A;  3VU3 C;  5GAN j;  4TWA A;  1SES A;  1HC7 A;  2J3M A;  2DZ9 A;  3QHS A;  3A7A A;  1NJ1 A;  4XQ3 A;  2XGT A;  4JRK A;  4CH4 A;  3REU A;  3HFO A;  1I8F A;  2JN0 A;  2ZCE A;  5GAN d;  2E1H A;  4C92 C;  2RHS A;  2I4N A;  4XEO A;  3ERR A;  1LOJ A;  3HXV A;  4RQE A;  2CIM A;  2RM4 A;  1WYD A;  1TH7 A;  1N9W A;  3JCM d;  2HNI A;  3L1A A;  1B34 B;  2CJA A;  3A31 A;  3AHU A;  2XTI A;  4DPG A;  5LJ5 e;  4NL2 A;  5GAN 8;  3P8V A;  4OP0 A;  1D3B A;  4H2X B;  2AMC A;  3M4G A;  3QO5 A;  4M75 E;  1HTT A;  4TQD A;  4M77 E;  5I21 A;  4C8Q B;  3LC0 A;  4C8Q D;  3HSB A;  3VQY A;  2VC8 A;  4TVW A;  4F7U A;  3V8K A;  2RD1 A;  2AKW A;  5GAN 3;  4N0A C;  4RQF A;  5GMK l;  1H4Q A;  4J5Y A;  2ARS A;  3NET A;  5ELO A;  2ZZF A;  4M7A B;  3JCM W;  1B7Y B;  5LJ3 e;  2DKG A;  1YFT A;  4P3P A;  4M75 D;  5GMK e;  4YRL A;  4P73 A;  4EO4 A;  3UGT A;  3A74 A;  4XEM A;  2ZTG A;  1NNH A;  4YRS A;  2RB6 A;  2YHT A;  3A7U A;  3NEM A;  3PZC A;  4YRN A;  3HFN A;  3L4G B;  3FIF A;  3PCO B;  4NCX A;  2ZT5 A;  1X55 A;  1Y96 A;  2P0L A;  3GIB A;  1VQZ A;  2EWN A;  3RKW A;  2ZNI A;  4P71 C;  5GAN 2;  3A32 A;  4M78 F;  4QVC A;  4PJO A;  4C92 E;  4TTV A;  5LJ5 j;  4H2S A;  3V8L A;  4A53 A;  4CS3 A;  4HWR A;  11AS A;  3KFU A;  1KQ2 A;  1I81 A;  3V7C A;  1EVK A;  2RHS B;  4EMK B;  4JUV A;  4YRG A;  5C51 B;  2ZIO A;  4YPF A;  4G85 A;  5HGQ A;  4C92 D;  1YFR A;  4CH6 A;  5CAI A;  3RKY A;  3SWN C;  4YRC A;  3JB9 F;  5LJ3 j;  4JLI A;  4P3O A;  4F7U E;  2E10 A;  4M75 G;  3QNE A;  3REX A;  3UGQ A;  5GMK j;  4XU2 A;  1HK9 A;  2ODR D;  1D3B B;  2AMC B;  3SWN A;  3P8T A;  3JCM Q;  5LJ3 d;  5GAO r;  3PGG A;  4K88 A;  3EFR A;  4Q15 A;  4O2D A;  3HFZ A;  2K57 A;  3MEY A;  3P8Y A;  1BIA A;  1G5H A;  2AKW B;  3IKL A;  4YRI A;  1X2H A;  3TUP A;  3BDU A;  1JBM A;  1NJ5 A;  1I4K 1;  2ZNJ A;  4M77 C;  3RKX A;  1W66 A;  1SER A;  3RIR A;  3LSS A;  2DU5 A;  4M7A F;  2C8M A;  2E5A A;  4H2W A;  4BWA A;  4M7D C;  1PYS A;  2DDZ A;  5F5W A;  2E65 A;  1HXD A;  4M77 A;  4X9D A;  1B8A A;  1WLE A;  1QF6 A;  1Y96 B;  4C92 G;  4YRR A;  3V8J A;  3RAC A;  4M7D A;  2E41 A;  5KNN A;  3A5Y A;  1MGQ A;  4PJO B;  4NOY A;  4PJO D;  1Z7M A;  3I7F A;  4YCW A;  4UP7 A;  4YRE A;  4YRP A;  3JCM c;  2I4O A;  3HY1 A;  2EL9 A;  4PG3 A;  2J3L A;  2DXT A;  4M78 E;  4YRO A;  4TVA B;  5GAN 6;  2QHU A;  5LJ3 g;  3JCM J;  2G4C A;  3E9H A;  4MML A;  2ZZG A;  1X54 A;  2ZZE A;  4F7U G;  2QTX A;  3HXX A;  4EMG A;  1NJ6 A;  3HRK A;  4YRF A;  3DSQ A;  1JRI A;  4P74 C;  3CMQ A;  4C92 A;  2DZC A;  1EOV A;  2QHS A;  3LSQ A;  4HWT A;  1BBU A;  3G1Z A;  3IKM B;  4EX5 A;  1JJC A;  3ICA A;  5C52 B;  3M4Q A;  2Y90 A;  4Q6G A;  1KQ1 A;  1N9S A;  4H2U A;  4P74 A;  3RF1 A;  1BIB A;  3JB9 I;  3RGL A;  2ZT7 A;  5GAO n;  3HXZ A;  3JCM P;  4H2V A;  4K87 A;  5K1X A;  1KOG A;  3BFM A;  3MF1 A;  1FYF A;  4XTW A;  2RA2 A;  2DEQ A;  3TEH A;  3BY7 A;  5GAM h;  4YDQ A;  2ZR3 A;  1G51 A;  3A5Z A;  2C7I A;  4PJO G;  1YFS A;  4P3N A;  5GAM f;  3BJU A;  1WNL A;  4M7D E;  1M5Q 1;  4H02 A;  1RIQ A;  3QTC A;  5GAN 5;  2ZIN A;  2DQ0 A;  1E1T A;  4KR2 A;  4M75 B;  1B70 A;  1PYS B;  5GMK m;  1YGB A;  1IL2 A;  2EJF A;  4M77 B;  5GAO q;  4M77 D;  4N0A A;  4YRQ A;  3FB9 A;  4P72 C;  4M7D D;  5ELN A;  2IY5 A;  1J5W A;  2Q5I A;  4XU0 A;  2I2L A;  3RER A;  4YRJ A;  1H64 1;  5DY9 A;  4YCV A;  1EQR A;  1EFW A;  2PMF A;  3IAL A;  5GAO p;  2ZT6 A;  4P71 A;  4TVY A;  1E24 A;  3BW1 A;  2YLC A;  4M78 C;  4YYE A;  1KMN A;  4WJ3 M;  4XTX A; 
#chains in the Genus database with same CATH topology
 2EYY A;  2MWP A;  1EVL A;  2I4L A;  4KUD K;  4UP8 A;  1VQL T;  1JJC B;  2KRN A;  1KHC A;  1HSQ A;  4AT1 B;  5I2S A;  2LNV A;  4WJ4 A;  2HL5 C;  2RI5 A;  2KGT A;  4X9C A;  4DBH A;  2PZ1 A;  1WXB A;  4J8O A;  4BDZ A;  4LD6 A;  3P8D A;  3KBG A;  4HCZ A;  4A54 A;  1VIF A;  5CKD A;  4M7D G;  3A5Z B;  2X3X D;  3VV0 A;  1I5L A;  4LDX A;  4BI8 B;  5GAN f;  2GBQ A;  2P4T A;  3OYG A;  4OMM A;  4J9B A;  5CKH A;  4RCC A;  3PMI A;  2G3R A;  4IUR A;  2RHY A;  3JCM h;  1ADY A;  3A1P A;  5C0M A;  4FYW B;  4MZT A;  1WQW A;  3CC4 T;  5GAO m;  4YRM A;  3UDC A;  4ZTJ A;  1GBR A;  2ALY A;  1V29 B;  3MKD A;  2K5L A;  3QSU A;  1BCM A;  1OZ2 A;  2HL3 A;  3CEY A;  2DTI A;  3VS2 A;  3RL6 A;  4F16 A;  4N4I A;  4HWO A;  4AG1 C;  1NPP A;  1M1F A;  2KI7 A;  2DER A;  4H2Y A;  2ZPI B;  3ZFJ A;  4LVL A;  4OMQ A;  3H0H A;  3I56 A;  2EQK A;  4MZM A;  5HK0 A;  3UA6 A;  2AKK A;  4M78 B;  1ZQ1 A;  4M78 D;  5HK3 A;  1VQ9 Q;  3OS2 A;  1RAG B;  2Q7G A;  3N5B B;  2Q7E A;  3REA B;  3CME A;  2I0N A;  2LTO A;  1PKS A;  2K2V A;  4PLL A;  1C6V X;  3OW2 A;  3SFM A;  4AFU C;  1AHJ B;  4K86 A;  4XTU A;  4B9W A;  3HY0 A;  5LJ5 h;  3V7S A;  2FHD A;  4P75 A;  4PFO A;  2L3R A;  2LNH B;  1O75 A;  3MP1 A;  1SRY A;  2DLP A;  2RHX A;  4C8Q E;  4BDY A;  2CP5 A;  3JV3 A;  3D7S B;  4FT4 A;  2RI3 A;  5ECA A;  3A8G B;  4XTY A;  1UHC A;  2HSE B;  2P0P A;  3CPF A;  1YJW A;  1USY A;  3URG A;  2GTO A;  1C0M A;  2BZX A;  4WF2 A;  1UTI A;  4J9D A;  2YUP A;  3JRZ A;  3CCL Q;  4M78 G;  1ARK A;  3QWY A;  2QEX Q;  2OTL A;  2L89 A;  1ASZ A;  2ZCF B;  4Z88 A;  1W1F A;  1G2B A;  1O9S A;  3SB2 A;  1MMD A;  3PVQ A;  2GNC A;  4PNO A;  5GAN g;  5GAN 4;  2QG9 B;  5A2Q E;  3H0F A;  1YJN T;  3OW2 P;  3A8H B;  5KYN A;  1YIT A;  2QHT A;  2HBP A;  3LW5 E;  3EG9 B;  2E3C A;  3UT1 A;  4E7K A;  1KC8 C;  1YHQ A;  4CS2 A;  1YCS B;  4UPA A;  4PFZ A;  2JS2 A;  1TS9 A;  2M51 A;  4XTV A;  4X34 A;  2O01 E;  4TVA A;  1VQP T;  2X35 A;  5LJ5 d;  2CJB A;  5FRM A;  1I07 A;  4PJM A;  4C8Q G;  4ZTZ B;  3CCJ A;  1Q86 R;  1X56 A;  3VQX A;  3L2R A;  8ATC B;  2RK2 A;  5CR2 A;  4JRQ A;  5CVI A;  3VS4 A;  2O9V A;  3CMA T;  1B34 A;  1WJS A;  3CCM T;  4KGZ B;  5HCK A;  2QDY B;  3DB3 A;  4ZNX A;  4PJJ A;  3RR6 A;  1QLY A;  5IXB A;  3I55 Q;  4H2X A;  3H41 A;  5D7U A;  3ZL7 C;  4AFZ C;  1NPR A;  2NUP A;  1KJW A;  1TUC A;  2D6F A;  4ZGJ B;  2PVG B;  2V8K A;  3RBB B;  5CK9 A;  1AOJ A;  1RI0 A;  3OYM A;  3MF2 A;  4E7J A;  4TQF A;  1WZO A;  2BTT A;  5GAO l;  4M75 A;  4IUU A;  1V1C A;  3HP9 A;  1H8K A;  3J81 E;  1BBZ A;  1MNE A;  4D8D A;  3NEN A;  1SEM A;  2BZ8 A;  4LDU A;  2J3M A;  2DZ9 A;  4FYY B;  4BUG A;  2RO0 A;  3GLX A;  1UGQ B;  1RAF B;  5GAN d;  2DD5 A;  2KQW A;  1N5Z A;  3I35 A;  1YI2 Q;  2HZY A;  2R58 A;  1PD1 A;  1K4U S;  3OYE A;  2JZ2 A;  1VOM A;  2WSC E;  2RJF A;  4Z8A A;  1Y07 A;  2PVO B;  2D8J A;  4NL2 A;  2ROL A;  3QWX X;  1MV0 B;  3M4G A;  4C0Z A;  1K73 U;  1HTT A;  4FT2 A;  4TQD A;  2SEM A;  1V76 A;  2EGC A;  3HSB A;  2H3E B;  4TVW A;  3P8B B;  4F7U A;  4J9I A;  1QKW A;  4N0A C;  1ZSZ A;  1OX9 A;  3ER0 A;  1R77 A;  4J5Y A;  4C0G A;  2ARS A;  4JS5 A;  1RUW A;  5KYX B;  5LJ3 e;  3EGD B;  3P8H A;  3JAM E;  3A74 A;  2MK5 A;  1VQ6 T;  1NNH A;  2ZTG A;  2RJE A;  5KCH A;  2YHT A;  3NEM A;  3VYG A;  4YRN A;  3HFN A;  3C4S A;  1GCQ C;  2MYS A;  2ZT5 A;  1Y96 A;  2PUK B;  5I2M A;  1VQZ A;  2GF7 A;  5GAN 2;  1SKU B;  1NJI U;  4Y92 A;  2DNU A;  2K3Y A;  3PE0 A;  2ESW A;  2ZPE B;  1K73 R;  1VQK A;  1EVK A;  4JJN K;  1ABQ A;  2BE7 D;  1UG1 A;  1YJ9 Q;  2CH4 W;  4YPF A;  4G85 A;  3OY9 A;  1YFR A;  3CCR A;  2DYI A;  3UWN A;  5GJV B;  4YRC A;  1VQ4 Q;  3ASK A;  5LJ3 j;  3REX A;  3UGQ A;  4KGV B;  3G4S Q;  1HK9 A;  3KFV A;  2E3H A;  1D1B A;  3OYN A;  1E6G A;  3OYJ A;  2EKO A;  3CCU A;  4F04 B;  3BE3 A;  3BDL A;  2VWF A;  4RKU E;  2AKW B;  2XDD A;  1K9M C;  1WYX A;  1I4K 1;  1NG2 A;  2HBW A;  3VS3 A;  5FRN A;  4RTX A;  3PNW C;  3LSS A;  2DU5 A;  1Q7Y U;  5KYU A;  5F5W A;  1KK7 A;  1Y71 A;  3PTA A;  4X9D A;  1VQL A;  2OTJ Q;  4BI3 A;  4OVA A;  4RTT A;  3RAC A;  4M7D A;  2E41 A;  2XI9 A;  3O5Z A;  4PJO B;  4NOY A;  1Q81 R;  4PJO D;  2XK0 A;  4AFQ C;  4KRT A;  4PG3 A;  3PIO A;  2PVD B;  4J9F A;  1HD3 A;  5FRO A;  4Z02 A;  4TVA B;  2CP7 A;  5LJ3 g;  4JRP A;  3HXX A;  1NJ6 A;  1JRI A;  2KBT A;  2FEI A;  3O8V A;  4QQD A;  3LSQ A;  3OQ5 A;  4HWT A;  3IKM B;  3GPL A;  1JJC A;  1W2B S;  3CC4 A;  1QCF A;  2DIL A;  4BE0 A;  1KQ1 A;  4Q6G A;  3CCV Q;  4FCY A;  1K76 A;  3HRU A;  1WIE A;  1RAB B;  2PNI A;  2RQU A;  2KEA A;  1FX7 A;  1E7O A;  2DEU A;  3BFM A;  1VQ7 A;  2NUP B;  2RJC A;  5GAM h;  1G51 A;  3A5Z A;  3CC7 T;  3OYA A;  4PJO G;  1YFS A;  3VKI A;  1QWE A;  3CCQ T;  2VGN A;  4EPC A;  1B3Q A;  1M5Q 1;  2DMO A;  5GAN 5;  2CP6 A;  1E1T A;  4PJL A;  4KR2 A;  2KR3 A;  4M75 B;  1PNJ A;  4OB1 B;  2EJF A;  5CQY A;  4M77 B;  4OGE A;  5GAO q;  4M77 D;  4N0A A;  1PRM C;  4YRQ A;  2ED1 A;  3HL8 A;  3CD6 A;  4P72 C;  3VYH B;  2XG8 D;  2JJ9 A;  4A63 B;  2L3S A;  3HHT B;  2Q5I A;  1NBE B;  1KSW A;  2I2L A;  3RER A;  1H64 1;  4RG8 A;  4IUQ A;  3MJX A;  1I5O B;  1K8A U;  1M3C A;  2JOY A;  1JU5 C;  3PVL A;  2HEQ A;  5GAO p;  2ZT6 A;  4EIK A;  3DKM A;  1TSF A;  2DBK A;  2HQE A;  4FSX A;  1KMN A;  4XTX A;  1GFC A;  3JB9 G;  4HT8 A;  2F2X A;  1ZA1 B;  4MDW A;  5CO7 A;  2RF0 A;  4J6W A;  4M78 A;  1L0W A;  1OEB A;  4RTZ A;  4M77 G;  3G71 Q;  2C0O A;  4LVJ A;  3A7R A;  1G83 A;  2E6Z A;  2MAM A;  4HVC A;  2BZY A;  2HQH A;  3M59 A;  4XU3 A;  4RMF A;  2IIM A;  2LCL A;  1M90 U;  5M9O A;  1UB4 A;  2EKH A;  3QJY A;  4F7U B;  2X3W D;  4JJC A;  2X4W A;  2X4X A;  1YIJ Q;  1KD1 C;  2ZAE A;  1YJN A;  1NZ9 A;  4LXC A;  3GNG A;  4OB2 B;  4M75 F;  2YXY A;  3JCM f;  1WQ7 A;  4PLI A;  4XTZ A;  4E47 A;  2IY5 B;  1LYL A;  4PK4 A;  2L8D A;  4GBQ A;  2M1H A;  2Q5H A;  4ZIB A;  1N8R U;  3UA7 A;  4BAC A;  2DIQ A;  3KXT A;  3M0Q A;  4IUV A;  2FB7 A;  4HT9 A;  3NGP A;  5DLO A;  3JB9 J;  3HRS A;  2JTE A;  3CME Q;  1VQ9 T;  1BI3 A;  1M90 R;  1KFZ A;  2HCK A;  1VQ5 Q;  2DE0 X;  3EG1 A;  12AS A;  1TG0 A;  3CCM A;  3C95 A;  2XD0 A;  4QVD A;  2VUB A;  1C1A A;  4ZN3 A;  3SHW A;  2YRD A;  3VQV A;  1AWJ A;  2J6O A;  1C0A A;  2NYS A;  4E7Z A;  2DO3 A;  2K5I A;  1H4T A;  4P75 C;  3PFS A;  3UF4 A;  4EMK A;  1G3S A;  2JTM A;  2KT1 A;  2CZ7 B;  1YJW Q;  4X5O A;  1E1O A;  1X6G A;  2ZZD A;  3HTZ A;  2IPO B;  2FRY A;  1EIY B;  4F7U F;  4A4F A;  1GFD A;  4ATO A;  3QII A;  3I9Q A;  1KMM A;  2V1Q A;  3THK A;  5LJ5 f;  1NLP C;  2PU9 B;  2DD4 A;  2OTL Q;  2PUO B;  1W2B A;  3CCL T;  1USY C;  1M8V A;  2QEX T;  2DXB A;  2WSE E;  4M7A E;  2O2O A;  1QVF S;  4M7D B;  2NWM A;  4G84 A;  1YIT Q;  1DJ7 B;  5GMK h;  3W3S A;  1UGR B;  4ZTF A;  1ZLM A;  4JLG A;  4HWP A;  4P72 A;  4YP0 A;  1S1N A;  1AT1 B;  1YHQ Q;  2XDP A;  4M7A D;  2FZC B;  4ELY C;  2QA4 A;  2D8H A;  5CIU A;  2CZ1 B;  3MPU B;  1SPK A;  2OI3 A;  2QYZ A;  2CP0 A;  2XIC A;  1G3W A;  2M16 A;  2VB6 A;  2X9H A;  4PJO C;  2J05 A;  3L2Z A;  2L3P A;  2ZR2 A;  2GQV A;  3CCJ Q;  4V2S A;  3EHR A;  3M4Y A;  2PME A;  3JCM g;  4LNS A;  1EZZ B;  2LRQ A;  1KC8 R;  1G8X A;  4CRI A;  3S6W A;  4WI1 A;  1U8R A;  2RHQ B;  4HVU A;  1W2B P;  2YUQ A;  2ZGW A;  4DOW A;  3FRN A;  1D09 B;  1M3B A;  1VUB A;  2CJ9 A;  1KHI A;  1RAE B;  1WXU A;  4DA4 A;  4RDX A;  2DL5 A;  4N4H A;  1BI2 A;  2MWO A;  4X1V A;  5CKE A;  2E64 A;  3REB B;  3I55 T;  4PFP A;  1Z7N A;  4M7A G;  5L8R E;  5GAN e;  2OAW A;  3PIP A;  1H4V B;  3M0T A;  3JCM b;  4IUP A;  2Y4X A;  1NEG A;  4HWS A;  1UJ0 A;  5FW9 A;  2NUT B;  4QQ6 A;  4CH3 A;  2COW A;  4M7D F;  1AEY A;  3JB9 H;  3H9N A;  3JCM V;  3QO3 A;  3CC2 A;  4M4Z A;  2NS6 A;  4M75 C;  1ZUY A;  1M1K C;  1X01 A;  5FU7 B;  2K5F A;  3MEU A;  5KYX A;  1NYG A;  3EGD A;  1IRE B;  1OU9 A;  2H8H A;  5A0D A;  3RES A;  3NTK A;  3VS6 A;  3EG2 A;  3JCM X;  4DQ2 A;  5LJ5 g;  3EGX A;  4O6J A;  1M1G A;  3QUI A;  1D1A A;  1QP3 A;  3E9I A;  1IB8 A;  3VU3 C;  5GAN j;  2XDB A;  4GLK A;  2KRO A;  1YI2 T;  2MCN A;  2VKN A;  2XGT A;  4CH4 A;  3REU A;  5I22 A;  1IRX A;  1JQQ A;  3WVE B;  2E1H A;  3T9N A;  4N4G A;  1WHH A;  3CCE A;  4XEO A;  1WI7 A;  3ERR A;  1LOJ A;  1UEC A;  2EQI A;  3HXV A;  1N9W A;  5KE3 A;  1GL5 A;  3JCM d;  2HNI A;  1S72 A;  2CJA A;  3CBO A;  2XTI A;  1IHV A;  2DA9 A;  2LMJ A;  2QGF B;  4OMP A;  2YDL A;  2KAF A;  3QO5 A;  2CSQ A;  1UFF A;  2AHJ B;  2L5Q A;  1ZSZ C;  1N8R C;  4BD3 A;  4C8Q B;  4C8Q D;  1Q86 U;  2RD1 A;  3CCS Q;  2AKW A;  4RQF A;  4C5G A;  1H4Q A;  3NET A;  2CS7 A;  3JCM W;  4KUL A;  3LX7 A;  2RQW A;  2XID A;  2A7Y A;  3OYC A;  2RB6 A;  3PZC A;  3DB4 A;  3OBY A;  1LCK A;  1MV3 A;  5IH2 A;  3FIF A;  3QJ6 A;  1QVG S;  1QVF A;  3PCO B;  4NCX A;  1X55 A;  1WGS A;  2LQ8 A;  2R5M A;  3GIB A;  2GGR A;  2DYB A;  2EVR A;  3CCR Q;  1YJ9 T;  3A32 A;  4C0D B;  4M78 F;  4PJO A;  1XOV A;  4C92 E;  1ZHI A;  4TTV A;  4CS3 A;  3RDV A;  11AS A;  3CC7 A;  2VYT A;  1VQ4 T;  1I81 A;  1QKX A;  2RHS B;  4EMK B;  2D0Q B;  4JUV A;  4YRG A;  2DBM A;  3G4S T;  5C51 B;  3M55 A;  1BI0 A;  3G6E A;  4C92 D;  3GOX A;  1AZG B;  1QW1 A;  4HKE A;  5IHI A;  4D8K A;  5KCO A;  1G3Y A;  2JUF A;  2ATC B;  4CC7 A;  1RAA B;  2QQR A;  2XHC A;  3I5R A;  3KUF A;  1QP2 A;  2ODR D;  2O88 A;  2AMC B;  4LVI A;  3SWN A;  1VQM A;  4KGX B;  2D1X A;  4Q15 A;  4WCI A;  2K79 A;  1H3H A;  3LLR A;  5D6X A;  1QVF P;  1WHM A;  1R0C B;  1BIA A;  2WAC A;  1G5H A;  1LPL A;  2OTJ T;  1X2H A;  4YRI A;  3TUP A;  3BDU A;  1VYU A;  4ZGD B;  1K9M R;  2EYW A;  2LP5 A;  2ZPG B;  3RIR A;  2JM8 A;  1VQO Q;  2K7A A;  4IIM A;  1M9S A;  4BWA A;  4M7D C;  2DDZ A;  4M77 A;  3E1S A;  3EGU A;  4TVR A;  3EG0 A;  4EDU A;  4C92 G;  2BIV A;  4YRR A;  3EAE A;  3OYB A;  2M0Y A;  3A5Y A;  5D6W A;  3CXC S;  1MGQ A;  1Z7M A;  3I7F A;  4YCW A;  4UP7 A;  1JO8 A;  2LT4 A;  4YRE A;  2EL9 A;  3SD4 A;  2VAS A;  1VQ8 A;  2DXT A;  2QQA A;  3ME9 A;  1M2V B;  5GAN 6;  4JPB W;  3CPW S;  2KYB A;  2DK3 A;  1ABO A;  2ECZ A;  2F2W A;  5EG2 A;  2G4C A;  4PKC C;  4MML A;  3CCV T;  1VQ7 Q;  2ZZG A;  4EMG A;  2CZ0 B;  2YT6 A;  1EOV A;  2QHS A;  2LDM A;  3ICA A;  5C52 B;  2O4X A;  2Y90 A;  3EH1 A;  2IVW A;  2E3I A;  3MET A;  4LDV A;  2HSP A;  2LQW A;  2ZT7 A;  3JCM P;  3FJ5 A;  4F14 A;  1FYF A;  2COY A;  2DEQ A;  4DOV A;  1VA7 A;  3BY7 A;  3CD6 Q;  5I11 A;  2ZR3 A;  4E6R A;  1X6O A;  2J6K A;  3ZBD A;  5L23 A;  1VQN A;  5GAM f;  1ACM B;  1WNL A;  1ZBX A;  1YBY A;  3TSW A;  1VYT A;  2JS0 A;  3UPU A;  5GMK m;  1IL2 A;  2IG0 A;  3EGX B;  3FB9 A;  4O5V A;  3EHQ A;  1EIF A;  1SHG A;  2C0I A;  3TCJ A;  2IY5 A;  4R0K A;  1EFN A;  2C0T A;  3WVD B;  5FU7 C;  5HKC A;  2CT4 A;  5DY9 A;  2HDA A;  3TU4 K;  3OS0 A;  1Q82 U;  2KRM A;  3BW1 A;  4FW2 A;  3OYD A;  5LL6 S;  3G71 T;  4M78 C;  2K3X A;  4YYE A;  2R5A A;  1QVG A;  4BW9 A;  5GAN 7;  2MIO A;  5IN1 A;  3X25 B;  3RUX A;  4LVM A;  2YUN A;  2RHU A;  3R6N A;  2EAY A;  2A0F B;  4J6Y A;  1X6B A;  1Q81 U;  2JW4 A;  2DRK A;  1BK2 A;  1XQH A;  1ZUU A;  2K3B A;  1NJ8 A;  1YIJ T;  3VQW A;  2KE9 A;  4FYX B;  2X51 A;  3S3M A;  1QMC A;  4QVZ A;  2Q7H A;  3G1J A;  2GFA A;  1YNZ A;  3M56 A;  2E5Q A;  2CZ6 B;  8AT1 B;  3LGF A;  1EIY A;  1Y7X A;  1KD1 R;  1B70 B;  1I0C A;  1TU0 B;  1X2G A;  3QXE B;  1M3A A;  3U23 A;  1Q82 R;  2W10 A;  3S3O A;  4C8Q C;  1P92 A;  2FYK A;  3VS0 A;  1K1Z A;  4YRK A;  1KQS S;  3OYI A;  3CME T;  3LYI A;  2M02 A;  4XU1 A;  1QVG P;  3LWI A;  4CH5 A;  2ZXF A;  4J9E A;  1VQ5 T;  2DJQ A;  4RTV A;  1WHL A;  1FMW A;  1M8M A;  4J9G A;  2P84 A;  4M7A A;  1B7Y A;  4CC3 A;  4FSS A;  5A0L A;  1WPY A;  2PTK A;  3NEL A;  2VXE A;  2J6F A;  3GF5 A;  5DM7 R;  1FWZ A;  3L42 A;  4C0D C;  3L4G A;  3X24 B;  4BE1 A;  4YRT A;  3MEV A;  1IGQ A;  2HQX A;  5IT9 E;  1ZA2 B;  1YJW T;  1NEB A;  4EMK C;  2EJG A;  1T3S A;  1JJ2 S;  3M9Q A;  2A37 A;  3M4P A;  3SWN B;  2RHQ A;  5FLX E;  2VXF A;  2OTL T;  2ZIM A;  2DPP B;  2DL4 A;  2LX7 A;  2CGH A;  2QDL A;  3FJP A;  4CS4 A;  1LNX A;  3HXW A;  3VS7 A;  2ZT8 A;  1WHG A;  4E51 A;  4JZ3 A;  1BB9 A;  3JB9 D;  2ODR C;  3V7R A;  1Y57 A;  1YIT T;  1RAH B;  1YP5 A;  1U1S A;  3VRY A;  4NS5 A;  2QA4 Q;  4L5G A;  1YHQ T;  3INZ A;  4RCB A;  1SET A;  2GCX A;  1CKA A;  4ESR A;  2E4H A;  2FG0 A;  1YI2 A;  5LJ3 h;  4EMH A;  2NUT A;  3QPH A;  1G5I A;  3R6O A;  4PJO F;  4J7I A;  5C6S A;  2RH2 A;  3CCJ T;  5A0G A;  1T0H A;  4CC2 A;  3R07 A;  1ZUK A;  5AT1 B;  4LD9 K;  3FLG A;  3VBB A;  2P0Q A;  5J26 A;  3HRT A;  1X43 A;  2OAU A;  3H0I A;  3OSS C;  4KT0 E;  2LVM A;  2CP2 A;  1K0X A;  3A8L B;  1XTD A;  3HKS A;  9ATC B;  2GQI A;  2O4X B;  3DLM A;  1ZSG A;  4BY6 B;  4BB7 A;  5E3I A;  1N9R A;  1K73 C;  1W70 A;  1GGM A;  2GTJ A;  5GAM d;  3M0P A;  4RTY A;  4QQG A;  4IKF A;  1YB3 A;  2HD0 A;  3CC2 Q;  4L59 A;  4QT7 A;  1WJR A;  5KYY B;  3E9G A;  3LWH A;  2A08 A;  4UC4 A;  5HY6 A;  4M77 F;  2K6D A;  1YJ9 A;  4H2T A;  2KMT A;  2EGA A;  4MZP A;  1UGP B;  3JCM e;  3M0S A;  2DQ3 A;  1NJI C;  2JTF A;  4C8Q A;  3I56 Q;  4Z89 A;  4HA8 A;  3GP8 A;  4PHC A;  4MMK A;  2CDT A;  1VQP A;  1ZX6 A;  1H92 A;  1ADJ A;  5K1P A;  4LUE A;  4D6W A;  3OS1 A;  5KYW B;  1UGV A;  1TWB A;  3CMA A;  2DL7 A;  3CCE Q;  3NHN A;  2RHZ A;  2DX1 A;  3MCA B;  5IXF A;  2CYZ B;  3NTH A;  1KQS A;  3LGL A;  1NJ2 A;  3PCO A;  3L2U A;  2EJ9 A;  3OYY A;  2L3Q A;  4IIO A;  2DL3 A;  1SES A;  3HPW A;  2LJ0 A;  4FM4 B;  1S72 Q;  1XNI A;  4BI4 A;  2RK1 A;  4JRK A;  2L2P A;  3HFO A;  3OBW A;  1UDL A;  3GNF B;  2A28 A;  2JN0 A;  5CKB A;  2FPD A;  1G5V A;  2RHS A;  2E6N A;  1PC0 A;  1FMV A;  4RQE A;  3NFC A;  2X4J A;  2CIM A;  1VYV A;  2RM4 A;  2L0A A;  4J9C A;  1TH7 A;  2A8E A;  3VJP A;  1UJY A;  3L1A A;  1Q7Y C;  1D0Z A;  1K0S A;  3A31 A;  3OMG A;  1B7T A;  4OML A;  1KC8 U;  4DPG A;  5LJ5 e;  1JJ2 A;  3CCS T;  2AIR B;  2KNB B;  2EGE A;  3P8V A;  2J06 A;  2CRE A;  2AMC A;  1PSE A;  4K11 A;  3SEM A;  3OYH A;  2NLU A;  2VC8 A;  1KQS P;  3QZ5 B;  4RMO A;  3E9F A;  4IUT A;  1AWW A;  4FU6 A;  1W6X A;  2EQM A;  1WA7 A;  2ZZF A;  1M27 C;  4M7A B;  1B7Y B;  3MP6 A;  2DKG A;  2DFU A;  1YFT A;  4P3P A;  5FU6 B;  3CCR T;  4XEM A;  4YRS A;  3A7U A;  2QTV A;  4JDS A;  3RMS A;  3L4G B;  1D0Y A;  1U3O A;  1UEB A;  2QQ9 A;  1WDX A;  4ORZ A;  2P0L A;  3G6E Q;  1OI1 A;  3RKW A;  2ZNI A;  1PSF A;  4C5E A;  3TEE A;  4JJD A;  4QVC A;  2D9T A;  5LJ5 j;  4H2S A;  3V8L A;  1OUL A;  3MHX A;  3KFU A;  5CCA A;  1KQ2 A;  1JJ2 P;  4C0F A;  2Y4Y A;  1M2V A;  1VQM Q;  1SF9 A;  3WXM B;  2QAZ A;  4FL6 A;  2ZIO A;  1IZ6 A;  2EQU A;  4AG2 C;  2F5K A;  3H8Z A;  3RKY A;  3SWN C;  3FC3 A;  1VQ6 A;  4JLI A;  4P3O A;  3PT9 A;  2BUD A;  3QNE A;  3Q1J A;  3OYF A;  4XU2 A;  1LVK A;  2LQN A;  3TVT A;  1D3B B;  2HKQ B;  2PQW A;  4OMN A;  2X4Y A;  4YTL A;  3JCM Q;  2DRM A;  1TXQ A;  1VQO T;  3PGG A;  4HCC A;  2RQR A;  1Q95 G;  3HFZ A;  1TTH B;  2K57 A;  3IKL A;  1J3T A;  1U06 A;  1G3T A;  4KBM B;  1NJ5 A;  1K8A C;  4OB3 B;  2LCS A;  2ZNJ A;  4M77 C;  2K4Y A;  3RKX A;  2YWW A;  3G71 A;  4M7A F;  2C8M A;  1VQ8 Q;  2AKL A;  3M54 A;  2AZS A;  4J83 A;  4LUD A;  1UUE A;  4LE9 A;  1HXD A;  4Q5W A;  4A4H A;  3A8M B;  6AT1 B;  1B8A A;  1QF6 A;  5GJW B;  2DIG A;  2KSS A;  5KNN A;  2ZPH B;  1PWT A;  1YIJ A;  2EFI A;  4YRP A;  4RTW A;  1XJW B;  3JCM c;  1VQ7 T;  3UAT A;  2J3L A;  4M78 E;  3QYH B;  4YRO A;  2K9G A;  2DAQ A;  1M90 C;  2HMA A;  2QHU A;  2OJ2 A;  3C0C A;  5IAY A;  1YN8 A;  2MI6 A;  2QTX A;  2FZG B;  3HRK A;  3DSQ A;  1OU8 A;  1YWO A;  2LJ1 A;  4BY6 C;  4ANJ A;  3CMQ A;  4ZGE B;  2VV5 A;  3CQT A;  1N6A A;  3EFO B;  1VQN Q;  3CD6 T;  3ZEH A;  1SRM A;  1BBU A;  2A36 A;  1MMA A;  3M4Q A;  3RF1 A;  4P74 A;  1PHT A;  2LJ3 A;  2CKK A;  2QK0 A;  1T0J A;  1RLP C;  5GAO n;  4H2V A;  4XK8 E;  4K87 A;  5K1X A;  3QBY A;  2QI2 A;  1KOG A;  2YSQ A;  4E7I A;  1VQ5 A;  2KXC A;  2RA2 A;  4XTW A;  2MMP A;  3TEH A;  1JXO A;  4YDQ A;  1Z9Z A;  1QCN A;  3M5A A;  5CKF A;  1BI1 A;  2NUZ A;  4LN2 A;  4P3N A;  1X27 A;  2RQT A;  3BJU A;  4DBQ A;  1MHN A;  3QTC A;  2ZIN A;  1UHF A;  1B70 A;  1PYS B;  1OQK A;  3PMT A;  2YRC A;  4WTO B;  1VQK Q;  4AMC A;  2LQK A;  1J5W A;  2YUO A;  1Y0M A;  1BCO A;  2E70 A;  2VGM A;  2DXC A;  4YCV A;  2DF6 A;  1EFW A;  1K9M U;  3E19 A;  1WHJ A;  3CCQ A;  1E24 A;  3CCU Q;  2AZV A;  2YLC A;  2EYQ A;  4WJ3 M;  1M4Z A;  3HRI A;  4C92 B;  2A3L A;  3SDZ A;  3HFV A;  2ART A;  3A98 A;  3FEO A;  2YRV A;  2RMO A;  2Z0W A;  2RQV A;  2QQB A;  3OMC A;  2DXU A;  1E6H A;  2F1L A;  2WSF E;  2DVJ A;  4E7S A;  1VQL Q;  5GAN h;  1KIK A;  2M0O A;  4E2F B;  2CSI A;  1RAD B;  1A0N B;  3OD1 A;  4C8Q F;  3TEG A;  2JMC A;  4OLF A;  3C94 A;  2P4R A;  1FMK A;  4A4K A;  1WHK A;  3UH0 A;  2KK4 A;  1NYQ A;  1U5S A;  2GFU A;  3MP8 A;  2DTO A;  1NYR A;  1X75 C;  4AH6 A;  2KY9 A;  4M7A C;  3CBP A;  5FU6 C;  1X2Q A;  2DVE A;  3OA6 A;  2DET A;  3X20 B;  1QWF A;  4ZTU B;  4KQE A;  3CC4 Q;  2DTH A;  3EG3 A;  1HJD A;  1NE8 A;  2ROT A;  1GXI E;  2DU7 A;  4RTU A;  3WQZ A;  1Z9Q A;  2MF2 A;  1H3Z A;  3HXY A;  1WX6 A;  3EH2 A;  4JRI A;  4CI0 C;  4HCK A;  1OZ3 A;  4C92 F;  2O31 A;  2JXB A;  2QGG A;  4AFS C;  2K2M A;  1LJO A;  1M2O A;  2BKD N;  4FYV B;  1PD0 A;  1OV3 A;  4MDX A;  3L2W A;  2EYX A;  1FXX A;  2LC4 A;  1GRI A;  2EPD A;  3IG2 A;  1EX4 A;  2J7I A;  3HFZ B;  1ATI A;  5C53 B;  1BU1 A;  1B07 A;  2QA4 T;  5D6Y A;  1ZBJ A;  4NL3 A;  4KR3 A;  2V8I A;  2DJZ A;  3HTR A;  1AD5 A;  1VQ9 A;  2KRS A;  1M30 A;  2AT1 B;  4E7L A;  1R0B G;  5GAM e;  5KYY A;  2V8J A;  1OX8 A;  1PM3 A;  3RMQ A;  4HT4 A;  3J7A F;  3OS5 A;  3TSZ A;  1BBW A;  4L6V 5;  2D0N A;  3M57 A;  3OB9 A;  4KH1 B;  2ALY B;  2LT1 A;  3CBM A;  2ARU A;  2G6F X;  4PJN A;  1OPL A;  1RAC B;  2MPX C;  1SSH A;  5LJ3 f;  4P73 C;  3NTI A;  4KH0 B;  1R8O B;  4YCU A;  1D1C A;  3MEW A;  1FYN A;  1KD1 U;  4LVK A;  5GMK i;  4DBF A;  4J9H A;  2XKO C;  7AT1 B;  2F5T X;  5KYW A;  4OMF B;  1MMG A;  4PL6 A;  3MQZ A;  1IO6 A;  1B76 A;  3CCL A;  4Y91 A;  1GBQ A;  1T3L A;  1UE9 A;  1BKB A;  2QEX A;  4GY5 A;  3CCS A;  2ENM A;  2CT3 A;  4J6X A;  3C12 A;  2QHV A;  1RAI B;  5GAM j;  2LX9 A;  1H4S A;  4R56 A;  2W0Z A;  1YJN Q;  2FL7 A;  4CC4 B;  3QG1 A;  4KUI A;  3CC2 T;  2C06 A;  1SHF A;  4UP9 A;  3TEH B;  1X69 A;  2RN8 A;  4B9X A;  1Q86 C;  2SRC A;  3AT1 B;  4II1 A;  2M9U A;  4L87 A;  1PKT A;  3VUZ A;  3DLL A;  3EFS A;  4OGC A;  4E7H A;  4HVV A;  4J15 A;  2MOX A;  1ASY A;  2OX7 A;  1VQP Q;  4R55 A;  4JZ4 A;  1QE0 A;  3I56 T;  1JB0 E;  3OYL A;  3F70 A;  2CP3 A;  3MEA A;  2KXD A;  3VS5 A;  1U1T A;  4LDY A;  3H6Z A;  3QZ9 B;  3CMA Q;  3UFG A;  4A4G A;  1YCY A;  2HAX A;  1TOV A;  4DBR A;  1NJI R;  3CCM Q;  4LDW A;  3QDR B;  2I4M A;  3CCE T;  1OYX A;  2P5I A;  4PJO E;  2KVQ G;  1E22 A;  3RNJ A;  3QO7 A;  2YLB A;  1BYM A;  4LNP A;  1S72 T;  5GAM g;  3I55 A;  3QO8 A;  2F2V A;  3A8O B;  4JJB A;  3HXU A;  1WU7 A;  1WJQ A;  2ABL A;  2EBP A;  3FDR A;  5EC7 A;  4VUB A;  4HXJ A;  3CXC A;  4TWA A;  1W4S A;  1HC7 A;  4HCB A;  2RI2 A;  1VQO A;  3QHS A;  3A7A A;  5KH6 A;  4XQ3 A;  1NJ1 A;  3MO8 A;  3G7Z A;  3M0U A;  1JXM A;  5DLQ E;  1I8F A;  3I5S A;  2ZCE A;  4RUG A;  3LH5 A;  2BE9 B;  1AZE A;  4C92 C;  1QCO A;  5AYF A;  3CPW A;  2I4N A;  3VUB A;  3NPF A;  2EYZ A;  2B8A A;  3QYG B;  2CH4 A;  1WYD A;  4C5H A;  5J3B A;  3ULR B;  2O9S A;  1RL2 A;  1OOT A;  4FIB A;  1B34 B;  4DEX A;  4JS4 A;  1Q7Y R;  3AHU A;  2FVU A;  1PG5 B;  2EW3 A;  5GAN 8;  1GCP A;  1YWP A;  2JT4 A;  4OP0 A;  1D3B A;  4H2X B;  1TUD A;  2RJD A;  3NMZ C;  4M75 E;  2QQS A;  3QKJ A;  5J39 A;  1IXD A;  4M77 E;  1SG5 A;  4FW1 A;  5I21 A;  2RHI A;  3QDF A;  5FWB A;  3LC0 A;  3VQY A;  2FZK B;  3VRZ A;  4OF1 A;  3V8K A;  5GAN 3;  5GMK l;  3CXC P;  1YFN A;  5ELO A;  2JMA A;  3G6E T;  1NYF A;  1CSK A;  1I1J A;  4M75 D;  5GMK e;  1RI9 A;  4P73 A;  4YRL A;  3UGT A;  4EO4 A;  1CKB A;  4DEY A;  3CPW P;  2CUB A;  2DM1 A;  4J7F A;  2EWN A;  1VQM T;  4P71 C;  2E12 A;  4P5N A;  2FPF A;  1RLQ C;  3OYK A;  1VQ6 Q;  1GCQ A;  4A53 A;  4C5I A;  2P0K A;  4HWR A;  1SSF A;  2CUD A;  3V7C A;  1M1K U;  3E2U A;  5FWC A;  3J80 E;  2JNG A;  4GLM A;  2B86 A;  5CQX A;  4B6M A;  1SRL A;  5HGQ A;  2FO0 A;  4CH6 A;  2RNA A;  5CAI A;  1MMN A;  2E5K A;  3JB9 F;  2DL8 A;  2E10 A;  3EFO A;  4F7U E;  4M75 G;  3LH0 A;  3TRE A;  1MUZ A;  5GMK j;  3S3N A;  3P8T A;  3IQL A;  2LZ6 B;  5LJ3 d;  5GAO r;  5IHN A;  4K88 A;  1VQ8 T;  3EFR A;  4ZN1 A;  1AWO A;  4O2D A;  4ELZ C;  3MEY A;  3P8Y A;  1ZSZ B;  1VQ4 A;  1JBM A;  2XMF A;  2VVK A;  1K8A R;  4QW2 A;  2COZ A;  1W66 A;  1Q82 C;  1SER A;  2JVV A;  3M53 A;  3G4S A;  3VS1 A;  1M1K R;  2E5A A;  4H2W A;  2LCC A;  4OB0 B;  1PYS A;  2E65 A;  1WLP B;  4F17 A;  3M58 A;  2ZPF B;  4HVW A;  1WLE A;  2KT8 A;  1Y96 B;  3V8J A;  2HKN A;  1Q81 C;  3GBQ A;  1AVZ C;  2I4O A;  3HY1 A;  1K9A A;  1VIE A;  2ZPB B;  1N27 A;  2KDS A;  1VQN T;  1F1B B;  4Y28 E;  5KE2 A;  3OW2 S;  2OTJ A;  1PCX A;  3JCM J;  3E9H A;  1D0X A;  3OSV A;  1X54 A;  2ZZE A;  4F7U G;  4YRF A;  2ED0 A;  2EIF A;  4P74 C;  1WXT A;  1HYO A;  4C92 A;  2DZC A;  3EG9 A;  3G1Z A;  4EX5 A;  2KYM A;  4XAX B;  1AWX A;  1KG1 A;  1N9S A;  1JEG A;  4H2U A;  2F69 A;  1BIB A;  1MND A;  4A4E A;  3JB9 I;  3RGL A;  3HXZ A;  1IHW A;  3MF1 A;  1PRL C;  3L2Q A;  1N8R R;  2C7I A;  1VQK T;  2EQJ A;  3L2V A;  1NLO C;  4M7D E;  3TQ7 P;  2QAS A;  4H02 A;  1RIQ A;  2FRW A;  2DQ0 A;  4BE2 A;  1X2K A;  3CCV A;  4RG2 A;  5KYU B;  1QQJ A;  1YGB A;  1UGS B;  4OMO A;  1NM7 A;  2V1R A;  1QVP A;  3M0R A;  2H3J A;  3CC7 Q;  1WFW A;  5IHK A;  3CCQ Q;  1IGU A;  4M7D D;  5ELN A;  4XU0 A;  2FPE A;  3JSC A;  1OPK A;  3CCU T;  4YRJ A;  3X28 B;  2R57 A;  4QKU A;  2QXF A;  4ME7 A;  3X26 B;  1EQR A;  2RPN A;  2PMF A;  3IAL A;  1TUG B;  2AK5 A;  4P71 A;  4TVY A;  2XU8 A;  2JM9 A;  2V26 A; 
#chains in the Genus database with same CATH homology
 2MWP A;  1EVL A;  2I4L A;  4KUD K;  4UP8 A;  1VQL T;  1JJC B;  1KHC A;  5I2S A;  2LNV A;  4WJ4 A;  2RI5 A;  4X9C A;  4J8O A;  4BDZ A;  4LD6 A;  3P8D A;  3KBG A;  4HCZ A;  4A54 A;  1VIF A;  5CKD A;  4M7D G;  3A5Z B;  3VV0 A;  1I5L A;  4LDX A;  4BI8 B;  5GAN f;  2P4T A;  3OYG A;  5CKH A;  4RCC A;  3PMI A;  2G3R A;  4IUR A;  2RHY A;  3JCM h;  1ADY A;  5C0M A;  4MZT A;  1WQW A;  3CC4 T;  5GAO m;  4YRM A;  3UDC A;  4ZTJ A;  2ALY A;  1V29 B;  2K5L A;  3QSU A;  1OZ2 A;  3CEY A;  2DTI A;  3RL6 A;  4N4I A;  4HWO A;  1NPP A;  1M1F A;  4H2Y A;  2ZPI B;  3ZFJ A;  4LVL A;  3I56 A;  2EQK A;  4MZM A;  5HK0 A;  4M78 B;  1ZQ1 A;  4M78 D;  5HK3 A;  3OS2 A;  2Q7G A;  3N5B B;  2Q7E A;  3CME A;  2LTO A;  2K2V A;  4PLL A;  3OW2 A;  3SFM A;  1AHJ B;  4K86 A;  4XTU A;  4B9W A;  3HY0 A;  5LJ5 h;  3V7S A;  2FHD A;  4P75 A;  2L3R A;  1O75 A;  3MP1 A;  1SRY A;  2RHX A;  4C8Q E;  4BDY A;  4FT4 A;  2RI3 A;  3A8G B;  4XTY A;  2P0P A;  3CPF A;  1YJW A;  1USY A;  3URG A;  4WF2 A;  3JRZ A;  4M78 G;  2OTL A;  2L89 A;  1ASZ A;  2ZCF B;  1O9S A;  3SB2 A;  4PNO A;  5GAN g;  5GAN 4;  5A2Q E;  1YJN T;  3A8H B;  1YIT A;  2QHT A;  2HBP A;  3LW5 E;  2E3C A;  3UT1 A;  4E7K A;  1KC8 C;  1YHQ A;  4CS2 A;  4UPA A;  4XTV A;  4X34 A;  2O01 E;  4TVA A;  1VQP T;  2X35 A;  5LJ5 d;  2CJB A;  5FRM A;  4C8Q G;  4ZTZ B;  3CCJ A;  1X56 A;  3VQX A;  3L2R A;  2RK2 A;  5CR2 A;  4JRQ A;  5CVI A;  3CMA T;  1B34 A;  1WJS A;  3CCM T;  2QDY B;  3DB3 A;  4H2X A;  1NPR A;  2D6F A;  4ZGJ B;  2PVG B;  2V8K A;  5CK9 A;  1RI0 A;  3OYM A;  3MF2 A;  4E7J A;  4TQF A;  5GAO l;  4M75 A;  4IUU A;  3HP9 A;  3J81 E;  3NEN A;  4LDU A;  2J3M A;  2DZ9 A;  4BUG A;  2RO0 A;  3GLX A;  1UGQ B;  5GAN d;  2DD5 A;  2KQW A;  2R58 A;  3OYE A;  2JZ2 A;  2WSC E;  2RJF A;  1Y07 A;  2PVO B;  4NL2 A;  3M4G A;  4C0Z A;  1K73 U;  1HTT A;  4FT2 A;  4TQD A;  3HSB A;  4TVW A;  3P8B B;  4F7U A;  4N0A C;  3ER0 A;  4C0G A;  4J5Y A;  2ARS A;  4JS5 A;  5LJ3 e;  3P8H A;  3JAM E;  3A74 A;  1VQ6 T;  1NNH A;  2ZTG A;  2RJE A;  5KCH A;  2YHT A;  3NEM A;  3VYG A;  4YRN A;  3HFN A;  3C4S A;  2ZT5 A;  1Y96 A;  2PUK B;  5I2M A;  1VQZ A;  2GF7 A;  5GAN 2;  1NJI U;  2K3Y A;  2ZPE B;  1EVK A;  1VQK A;  4JJN K;  4YPF A;  4G85 A;  3OY9 A;  1YFR A;  3CCR A;  3UWN A;  4YRC A;  3ASK A;  5LJ3 j;  3REX A;  3UGQ A;  1HK9 A;  3OYN A;  3OYJ A;  2EKO A;  3CCU A;  3BDL A;  4RKU E;  2AKW B;  2XDD A;  1K9M C;  1I4K 1;  5FRN A;  3PNW C;  3LSS A;  2DU5 A;  1Q7Y U;  5F5W A;  1Y71 A;  3PTA A;  4X9D A;  1VQL A;  4BI3 A;  4OVA A;  3RAC A;  4M7D A;  2E41 A;  2XI9 A;  4PJO B;  4NOY A;  4PJO D;  2XK0 A;  4PG3 A;  3PIO A;  2PVD B;  5FRO A;  4Z02 A;  4TVA B;  5LJ3 g;  4JRP A;  3HXX A;  1NJ6 A;  1JRI A;  3O8V A;  4QQD A;  3LSQ A;  3OQ5 A;  4HWT A;  3IKM B;  3GPL A;  1JJC A;  1W2B S;  3CC4 A;  4BE0 A;  1KQ1 A;  4Q6G A;  3HRU A;  1FX7 A;  3BFM A;  1VQ7 A;  2RJC A;  5GAM h;  1G51 A;  3A5Z A;  3CC7 T;  3OYA A;  4PJO G;  1YFS A;  3VKI A;  3CCQ T;  2VGN A;  4EPC A;  1M5Q 1;  5GAN 5;  1E1T A;  4KR2 A;  4M75 B;  4OB1 B;  2EJF A;  5CQY A;  4M77 B;  4OGE A;  5GAO q;  4M77 D;  4N0A A;  4YRQ A;  3HL8 A;  3CD6 A;  4P72 C;  3VYH B;  2XG8 D;  3HHT B;  2Q5I A;  2I2L A;  3RER A;  1H64 1;  4RG8 A;  4IUQ A;  1K8A U;  2JOY A;  5GAO p;  2ZT6 A;  3DKM A;  2HQE A;  4FSX A;  1KMN A;  4XTX A;  3JB9 G;  4HT8 A;  4MDW A;  5CO7 A;  4J6W A;  4M78 A;  1L0W A;  4M77 G;  4LVJ A;  3A7R A;  2E6Z A;  2MAM A;  4HVC A;  3M59 A;  4XU3 A;  4RMF A;  2LCL A;  1M90 U;  5M9O A;  1UB4 A;  3QJY A;  4F7U B;  2X4W A;  2X4X A;  1KD1 C;  1YJN A;  1NZ9 A;  3GNG A;  4OB2 B;  4M75 F;  3JCM f;  1WQ7 A;  4PLI A;  4XTZ A;  4E47 A;  2IY5 B;  1LYL A;  2L8D A;  2M1H A;  2Q5H A;  4ZIB A;  1N8R U;  4BAC A;  2DIQ A;  3KXT A;  4IUV A;  2FB7 A;  4HT9 A;  5DLO A;  3JB9 J;  3HRS A;  1VQ9 T;  1BI3 A;  12AS A;  3CCM A;  3C95 A;  2XD0 A;  4QVD A;  2VUB A;  4ZN3 A;  3VQV A;  1C0A A;  4P75 C;  2DO3 A;  2K5I A;  1H4T A;  3PFS A;  4EMK A;  1G3S A;  2JTM A;  2CZ7 B;  4X5O A;  1E1O A;  2ZZD A;  3HTZ A;  1EIY B;  4F7U F;  4A4F A;  4ATO A;  3QII A;  1KMM A;  5LJ5 f;  2PU9 B;  2DD4 A;  2PUO B;  1W2B A;  3CCL T;  1USY C;  1M8V A;  2QEX T;  2DXB A;  2WSE E;  4M7A E;  1QVF S;  4M7D B;  4G84 A;  1DJ7 B;  5GMK h;  3W3S A;  1UGR B;  4ZTF A;  4JLG A;  4HWP A;  4P72 A;  4YP0 A;  2XDP A;  4M7A D;  4ELY C;  2QA4 A;  5CIU A;  2CZ1 B;  2XIC A;  1G3W A;  2M16 A;  4PJO C;  3L2Z A;  2ZR2 A;  2GQV A;  4V2S A;  3M4Y A;  2PME A;  3JCM g;  4LNS A;  2LRQ A;  4CRI A;  3S6W A;  4WI1 A;  1U8R A;  2RHQ B;  2ZGW A;  4DOW A;  3FRN A;  1VUB A;  2CJ9 A;  1KHI A;  4DA4 A;  4RDX A;  4N4H A;  1BI2 A;  2MWO A;  5CKE A;  2E64 A;  3I55 T;  1Z7N A;  4M7A G;  5L8R E;  5GAN e;  3PIP A;  1H4V B;  3JCM b;  4IUP A;  2Y4X A;  4HWS A;  4QQ6 A;  4CH3 A;  4M7D F;  3JB9 H;  3CC2 A;  3JCM V;  3QO3 A;  2NS6 A;  4M75 C;  1M1K C;  1X01 A;  5FU7 B;  2K5F A;  3MEU A;  1IRE B;  5A0D A;  3RES A;  3NTK A;  3JCM X;  4DQ2 A;  5LJ5 g;  4O6J A;  1M1G A;  3QUI A;  1QP3 A;  3E9I A;  3VU3 C;  5GAN j;  2XDB A;  4GLK A;  1YI2 T;  2XGT A;  4CH4 A;  3REU A;  3WVE B;  2E1H A;  3T9N A;  4N4G A;  3CCE A;  4XEO A;  3ERR A;  1LOJ A;  3HXV A;  1N9W A;  5KE3 A;  3JCM d;  2HNI A;  1S72 A;  2CJA A;  3CBO A;  2XTI A;  2KAF A;  3QO5 A;  2AHJ B;  2L5Q A;  1N8R C;  4BD3 A;  4C8Q B;  4C8Q D;  1Q86 U;  2RD1 A;  2AKW A;  4RQF A;  4C5G A;  1H4Q A;  3NET A;  2CS7 A;  3JCM W;  4KUL A;  3LX7 A;  2XID A;  2A7Y A;  3OYC A;  2RB6 A;  3PZC A;  3DB4 A;  3OBY A;  3PCO B;  3FIF A;  3QJ6 A;  1QVG S;  1QVF A;  4NCX A;  1X55 A;  1WGS A;  2LQ8 A;  2R5M A;  3GIB A;  1YJ9 T;  3A32 A;  4C0D B;  4M78 F;  4PJO A;  1XOV A;  4C92 E;  1ZHI A;  4TTV A;  4CS3 A;  11AS A;  3CC7 A;  2VYT A;  1VQ4 T;  1I81 A;  2RHS B;  4EMK B;  2D0Q B;  4JUV A;  4YRG A;  3G4S T;  5C51 B;  3M55 A;  1BI0 A;  3G6E A;  4C92 D;  3GOX A;  1QW1 A;  4HKE A;  5KCO A;  1G3Y A;  2JUF A;  2QQR A;  2XHC A;  3KUF A;  1QP2 A;  2ODR D;  2AMC B;  4LVI A;  3SWN A;  1VQM A;  4Q15 A;  3LLR A;  5D6X A;  1BIA A;  2WAC A;  1G5H A;  3TUP A;  2OTJ T;  1X2H A;  4YRI A;  3BDU A;  4ZGD B;  2ZPG B;  3RIR A;  1M9S A;  4BWA A;  4M7D C;  2DDZ A;  4M77 A;  3E1S A;  4TVR A;  4EDU A;  4C92 G;  2BIV A;  4YRR A;  3EAE A;  3OYB A;  3A5Y A;  5D6W A;  3CXC S;  1MGQ A;  1Z7M A;  3I7F A;  4YCW A;  4UP7 A;  4YRE A;  2LT4 A;  2EL9 A;  3SD4 A;  1VQ8 A;  2DXT A;  2QQA A;  3ME9 A;  5GAN 6;  3CPW S;  2DK3 A;  5EG2 A;  2G4C A;  4PKC C;  4MML A;  3CCV T;  2ZZG A;  4EMG A;  2CZ0 B;  1EOV A;  2QHS A;  2LDM A;  3ICA A;  5C52 B;  2O4X A;  2Y90 A;  2IVW A;  3MET A;  4LDV A;  2ZT7 A;  3JCM P;  1FYF A;  2DEQ A;  4DOV A;  3BY7 A;  2ZR3 A;  1X6O A;  3ZBD A;  1VQN A;  5GAM f;  1WNL A;  1ZBX A;  1YBY A;  3UPU A;  5GMK m;  1IL2 A;  2IG0 A;  3FB9 A;  4O5V A;  1EIF A;  3TCJ A;  2IY5 A;  3WVD B;  5FU7 C;  5HKC A;  5DY9 A;  3TU4 K;  3OS0 A;  1Q82 U;  3BW1 A;  3OYD A;  5LL6 S;  3G71 T;  4M78 C;  2K3X A;  4YYE A;  2R5A A;  1QVG A;  4BW9 A;  5GAN 7;  5IN1 A;  3X25 B;  3RUX A;  4LVM A;  2RHU A;  2EAY A;  4J6Y A;  1Q81 U;  1XQH A;  1NJ8 A;  1YIJ T;  3VQW A;  3S3M A;  4QVZ A;  2Q7H A;  2GFA A;  3M56 A;  2E5Q A;  2CZ6 B;  3LGF A;  1EIY A;  1Y7X A;  1B70 B;  1X2G A;  3QXE B;  3S3O A;  4C8Q C;  1P92 A;  2FYK A;  4YRK A;  1KQS S;  3OYI A;  3CME T;  3LYI A;  4XU1 A;  3LWI A;  4CH5 A;  2ZXF A;  1VQ5 T;  4M7A A;  1B7Y A;  5A0L A;  1WPY A;  3NEL A;  2VXE A;  3GF5 A;  5DM7 R;  1FWZ A;  3L42 A;  4C0D C;  3L4G A;  3X24 B;  4BE1 A;  4YRT A;  3MEV A;  2HQX A;  5IT9 E;  1YJW T;  4EMK C;  2EJG A;  1JJ2 S;  3M9Q A;  3M4P A;  3SWN B;  2RHQ A;  5FLX E;  2VXF A;  2OTL T;  2ZIM A;  2DPP B;  2CGH A;  4CS4 A;  3FJP A;  1LNX A;  3HXW A;  2ZT8 A;  4E51 A;  3JB9 D;  2ODR C;  3V7R A;  1YIT T;  1U1S A;  4NS5 A;  4L5G A;  1YHQ T;  3INZ A;  4RCB A;  1SET A;  2GCX A;  1YI2 A;  5LJ3 h;  4EMH A;  3QPH A;  1G5I A;  3R6O A;  4PJO F;  4J7I A;  5C6S A;  2RH2 A;  3CCJ T;  5A0G A;  3R07 A;  4LD9 K;  3FLG A;  3VBB A;  2P0Q A;  5J26 A;  3HRT A;  2OAU A;  3OSS C;  4KT0 E;  2LVM A;  3A8L B;  1XTD A;  3HKS A;  2O4X B;  3DLM A;  4BY6 B;  4BB7 A;  5E3I A;  1N9R A;  1K73 C;  1GGM A;  5GAM d;  4QQG A;  4IKF A;  1YB3 A;  2HD0 A;  4L59 A;  1WJR A;  3E9G A;  3LWH A;  4UC4 A;  5HY6 A;  4M77 F;  1YJ9 A;  4H2T A;  2KMT A;  4MZP A;  1UGP B;  3JCM e;  2DQ3 A;  1NJI C;  2JTF A;  4C8Q A;  3GP8 A;  4HA8 A;  4PHC A;  4MMK A;  1VQP A;  1ADJ A;  5K1P A;  4D6W A;  3OS1 A;  3CMA A;  2RHZ A;  3MCA B;  1NJ2 A;  1KQS A;  2CYZ B;  3NTH A;  3LGL A;  3PCO A;  3L2U A;  2EJ9 A;  3OYY A;  1SES A;  3HPW A;  4FM4 B;  1XNI A;  4BI4 A;  2RK1 A;  4JRK A;  3HFO A;  3OBW A;  3GNF B;  2JN0 A;  5CKB A;  1G5V A;  2RHS A;  2E6N A;  4RQE A;  3NFC A;  2X4J A;  2CIM A;  2RM4 A;  1TH7 A;  2A8E A;  3VJP A;  3L1A A;  1Q7Y C;  3A31 A;  3OMG A;  1KC8 U;  4DPG A;  5LJ5 e;  1JJ2 A;  3CCS T;  3P8V A;  2AMC A;  1PSE A;  3OYH A;  2NLU A;  2VC8 A;  3QZ5 B;  4RMO A;  3E9F A;  4IUT A;  4FU6 A;  2EQM A;  2ZZF A;  4M7A B;  1B7Y B;  3MP6 A;  2DKG A;  1YFT A;  4P3P A;  5FU6 B;  3CCR T;  4XEM A;  4YRS A;  3A7U A;  4JDS A;  3RMS A;  3L4G B;  1UEB A;  2QQ9 A;  2P0L A;  1OI1 A;  3RKW A;  2ZNI A;  1PSF A;  4C5E A;  3TEE A;  4QVC A;  2D9T A;  5LJ5 j;  4H2S A;  3V8L A;  3MHX A;  3KFU A;  5CCA A;  1KQ2 A;  4C0F A;  2Y4Y A;  3WXM B;  4FL6 A;  2ZIO A;  1IZ6 A;  2EQU A;  2F5K A;  3H8Z A;  3RKY A;  3SWN C;  3FC3 A;  1VQ6 A;  4JLI A;  4P3O A;  3PT9 A;  2BUD A;  3QNE A;  3Q1J A;  3OYF A;  4XU2 A;  1D3B B;  2PQW A;  2X4Y A;  4YTL A;  3JCM Q;  1VQO T;  3PGG A;  4HCC A;  3HFZ A;  2K57 A;  3IKL A;  1G3T A;  4KBM B;  1NJ5 A;  1K8A C;  4OB3 B;  2ZNJ A;  4M77 C;  2K4Y A;  3RKX A;  3G71 A;  4M7A F;  2C8M A;  3M54 A;  4J83 A;  1HXD A;  4Q5W A;  4A4H A;  3A8M B;  1B8A A;  1QF6 A;  2DIG A;  2KSS A;  5KNN A;  2ZPH B;  1YIJ A;  2EFI A;  4YRP A;  1VQ7 T;  3JCM c;  2J3L A;  4M78 E;  3QYH B;  4YRO A;  1M90 C;  2DAQ A;  2QHU A;  5IAY A;  2MI6 A;  2QTX A;  3HRK A;  3DSQ A;  3CMQ A;  4BY6 C;  4ZGE B;  2VV5 A;  1BBU A;  1N6A A;  3CD6 T;  3ZEH A;  3M4Q A;  3RF1 A;  4P74 A;  2CKK A;  5GAO n;  4H2V A;  4XK8 E;  4K87 A;  5K1X A;  3QBY A;  2QI2 A;  1KOG A;  4E7I A;  1VQ5 A;  4XTW A;  2RA2 A;  3TEH A;  2MMP A;  4YDQ A;  3M5A A;  5CKF A;  1BI1 A;  4P3N A;  3BJU A;  1MHN A;  3QTC A;  2ZIN A;  1B70 A;  1PYS B;  3PMT A;  2LQK A;  1J5W A;  2E70 A;  2VGM A;  2DXC A;  4YCV A;  1EFW A;  1K9M U;  3E19 A;  3CCQ A;  1E24 A;  2YLC A;  2EYQ A;  4WJ3 M;  1M4Z A;  3HRI A;  4C92 B;  2A3L A;  3SDZ A;  3HFV A;  2ART A;  3FEO A;  2YRV A;  2QQB A;  3OMC A;  2DXU A;  2WSF E;  5GAN h;  2M0O A;  3OD1 A;  4C8Q F;  3TEG A;  4OLF A;  3C94 A;  4A4K A;  3UH0 A;  2KK4 A;  1NYQ A;  2GFU A;  3MP8 A;  2DTO A;  1NYR A;  1X75 C;  4AH6 A;  2KY9 A;  4M7A C;  3CBP A;  5FU6 C;  2DVE A;  3OA6 A;  3X20 B;  4ZTU B;  4KQE A;  2DTH A;  1NE8 A;  1GXI E;  2DU7 A;  3WQZ A;  2MF2 A;  1H3Z A;  3HXY A;  4JRI A;  4CI0 C;  1OZ3 A;  4C92 F;  1LJO A;  2BKD N;  4MDX A;  3L2W A;  1FXX A;  2LC4 A;  3IG2 A;  3HFZ B;  1ATI A;  5C53 B;  2QA4 T;  5D6Y A;  4NL3 A;  4KR3 A;  2V8I A;  2DJZ A;  1VQ9 A;  4E7L A;  5GAM e;  2V8J A;  3RMQ A;  4HT4 A;  3J7A F;  3OS5 A;  1BBW A;  4L6V 5;  3M57 A;  3OB9 A;  2ALY B;  2LT1 A;  3CBM A;  2ARU A;  5LJ3 f;  4P73 C;  3NTI A;  1R8O B;  4YCU A;  3MEW A;  1KD1 U;  4LVK A;  5GMK i;  2XKO C;  2F5T X;  4OMF B;  4PL6 A;  3MQZ A;  1B76 A;  3CCL A;  4Y91 A;  2QEX A;  1BKB A;  4GY5 A;  3CCS A;  4J6X A;  2QHV A;  3C12 A;  5GAM j;  2LX9 A;  1H4S A;  4R56 A;  2FL7 A;  3QG1 A;  4KUI A;  3CC2 T;  2C06 A;  4UP9 A;  3TEH B;  4B9X A;  1Q86 C;  4II1 A;  2M9U A;  4L87 A;  3VUZ A;  3DLL A;  3EFS A;  4OGC A;  4E7H A;  4J15 A;  1ASY A;  4R55 A;  1QE0 A;  3I56 T;  1JB0 E;  3OYL A;  3F70 A;  3MEA A;  1U1T A;  4LDY A;  3H6Z A;  3QZ9 B;  3UFG A;  4A4G A;  1YCY A;  2HAX A;  4LDW A;  3QDR B;  2I4M A;  3CCE T;  1OYX A;  2P5I A;  4PJO E;  2KVQ G;  1E22 A;  3QO7 A;  2YLB A;  1BYM A;  1S72 T;  5GAM g;  3I55 A;  3QO8 A;  3A8O B;  3HXU A;  1WU7 A;  1WJQ A;  3FDR A;  4VUB A;  3CXC A;  4TWA A;  1W4S A;  1HC7 A;  4HCB A;  2RI2 A;  1VQO A;  3QHS A;  3A7A A;  5KH6 A;  4XQ3 A;  1NJ1 A;  3MO8 A;  3G7Z A;  5DLQ E;  1I8F A;  2ZCE A;  4C92 C;  5AYF A;  3CPW A;  2I4N A;  3VUB A;  2B8A A;  3QYG B;  1WYD A;  4C5H A;  5J3B A;  4FIB A;  1RL2 A;  1B34 B;  4JS4 A;  3AHU A;  2FVU A;  5GAN 8;  4OP0 A;  1D3B A;  4H2X B;  2RJD A;  4M75 E;  2QQS A;  3QKJ A;  5J39 A;  4M77 E;  5I21 A;  2RHI A;  3LC0 A;  3VQY A;  4OF1 A;  3V8K A;  5GAN 3;  5GMK l;  5ELO A;  3G6E T;  4M75 D;  5GMK e;  4YRL A;  4P73 A;  4EO4 A;  3UGT A;  4J7F A;  2EWN A;  1VQM T;  4P71 C;  2E12 A;  4P5N A;  3OYK A;  4A53 A;  4C5I A;  2P0K A;  4HWR A;  1SSF A;  3V7C A;  1M1K U;  3J80 E;  2JNG A;  5CQX A;  5HGQ A;  4CH6 A;  5CAI A;  3JB9 F;  4F7U E;  2E10 A;  4M75 G;  3LH0 A;  3TRE A;  5GMK j;  3S3N A;  3P8T A;  5LJ3 d;  5GAO r;  4K88 A;  1VQ8 T;  3EFR A;  4ZN1 A;  4O2D A;  4ELZ C;  3MEY A;  3P8Y A;  1VQ4 A;  1JBM A;  4QW2 A;  1W66 A;  1Q82 C;  1SER A;  2JVV A;  3M53 A;  3G4S A;  2E5A A;  4H2W A;  2LCC A;  4OB0 B;  1PYS A;  2E65 A;  3M58 A;  2ZPF B;  1WLE A;  1Y96 B;  3V8J A;  1Q81 C;  2I4O A;  3HY1 A;  1VIE A;  2ZPB B;  1N27 A;  2KDS A;  1VQN T;  4Y28 E;  5KE2 A;  3OW2 S;  2OTJ A;  3JCM J;  3E9H A;  3OSV A;  1X54 A;  2ZZE A;  4F7U G;  4YRF A;  2EIF A;  4P74 C;  4C92 A;  2DZC A;  3G1Z A;  4EX5 A;  4XAX B;  1KG1 A;  1N9S A;  4H2U A;  2F69 A;  1BIB A;  4A4E A;  3JB9 I;  3RGL A;  3HXZ A;  3MF1 A;  3L2Q A;  2C7I A;  1VQK T;  2EQJ A;  3L2V A;  4M7D E;  4H02 A;  1RIQ A;  2DQ0 A;  4BE2 A;  3CCV A;  4RG2 A;  1YGB A;  1UGS B;  1QVP A;  2H3J A;  4M7D D;  5ELN A;  4XU0 A;  3JSC A;  3CCU T;  4YRJ A;  3X28 B;  2R57 A;  2QXF A;  4ME7 A;  3X26 B;  1EQR A;  2PMF A;  3IAL A;  4P71 A;  4TVY A;  2XU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...