4ZTZB

Structural basis for processivity and antiviral drug toxicity in human mitochondrial dna replicase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
418
structure length
363
Chain Sequence
ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for processivity and antiviral drug toxicity in human mitochondrial DNA replicase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords DNA polymerase subunit gamma-1
total genus 88
structure length 363
sequence length 418
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ztzB01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4ztzB02
4BWAA 3REUA 2DXTA 4WI1A 4CH4A 4TQDA 2ZT5A 1WU7A 1BIAA 2E65A 1KMNA 1SERA 4RQFA 3ERRA 3HY0A 1H4SA 11ASA 2ZT7A 4X5OA 4YRKA 4XTWA 1USYC 4HWOA 4P71C 4WF2A 3HXXA 4H2TA 1EQRA 4P73C 2P0LA 3I7FA 1B8AA 3HTZA 4UP9A 4H2YA 2E5AA 4EO4A 4HVCA 4HA8A 3LSSA 4YRGA 2QHVA 1SRYA 1B76A 2Q5HA 3L4GB 4HWPA 5KNNA 1X56A 1HC7A 4YRRA 4CS2A 2DEQA 3A74A 4YRNA 1NJ1A 4KR3A 3M4PA 2DKGA 4YRCA 3MF1A 4H2VA 1EVLA 2DXUA 1C0AA 4P75C 4YRQA 2ZZFA 2ZCEA 3FJPA 4WJ3M 4BW9A 4WJ4A 2QHTA 3TEHA 3R07A 3E9IA 4XTUA 4DQ2A 4YRFA 3RKYA 1NNHA 3CMQA 3HFVA 1ASYA 3ICAA 4TVAA 3RL6A 4XEOA 2AKWA 3HRIA 2ZGWA 4UP8A 4HWRA 2ZR2A 5ELNA 1ATIA 4E51A 2Q7EA 3MEYA 2HNIA 4RDXA 1NJ6A 2XGTA 1B70B 1JJCB 2EJFA 4HWTA 4G84A 4H2WA 2I4LA 4LNSA 2ZIOA 4YRMA 3G1ZA 1PYSA 3HFZB 1ADJA 4HWSA 4NCXA 2DZCA 4YYEA 2ZZEA 2RHSB 3HXUA 3RKXA 4EX5A 1B7YA 3V7SA 3QO8A 1KMMA 1NJ5A 3UH0A 4TVAB 4P71A 1VQZA 4TVYA 2J3MA 1YGBA 1IL2A 5F5WA 5HGQA 4L87A 4K87A 4K86A 4YCWA 2Q7HA 1E1TA 3A7UA 4XU0A 2ZT6A 1QF6A 4G85A 2E41A 4YRIA 4P3NA 2XTIA 3IALA 3RIRA 4XTVA 4Q15A 4P3PA 3UGQA 2ARTA 1EFWA 2AMCA 1W66A 3QTCA 3IG2A 3A7RA 1NYQA 2DU5A 1X54A 2I4NA 2Q7GA 3V8JA 2E64A 2IY5B 4P3OA 4PHCA 2RHQB 2ARSA 3QO7A 4P74C 4ZIBA 2IY5A 1WNLA 2ZNJA 3HXWA 1HTTA 1G5HA 2E1HA 2Q5IA 2DQ0A 4YRPA 1KOGA 3HXVA 4YRJA 3HXZA 2DVEA 3A32A 4DPGA 4OP0A 4CH6A 4P73A 4XU3A 2I4MA 3BJUA 3HXYA 4ZTUB 1B70A 1JJCA 4P75A 1WYDA 2AMCB 2PMEA 3M4QA 1H4TA 2ALYA 2ZINA 4YREA 3LSQA 1E22A 3NEMA 1Z7MA 2EAYA 1WQ7A 2DDZA 1NJ8A 4CH5A 3EFRA 4CS4A 3RGLA 1X2HA 1H4VB 3HRKA 1E24A 1HXDA 2DTOA 2C8MA 4TQFA 2EJ9A 3A5YA 3E9HA 3MF2A 2DTHA 2ZZGA 5ELOA 4YP0A 2DTIA 2E3CA 4YCVA 4AH6A 1EOVA 3RKWA 1PYSB 1WPYA 3L4GA 3TUPA 4P72C 1SETA 1QE0A 2ALYB 3QNEA 3V8LA 3IKLA 3IKMB 1H4QA 2DQ3A 1B7YB 2ARUA 2ZT8A 3P8YA 3V8KA 1E1OA 2DU7A 1NYRA 2J3LA 4K88A 2I4OA 3V7CA 4YPFA 4RQEA 4H2XA 2C7IA 4YCUA 2CJAA 2DZ9A 3L1AA 1BIBA 2ZIMA 2ZNIA 1NJ2A 2DJZA 3VQXA 1YFSA 3L2ZA 2FYKA 2ZTGA 1V95A 2ZXFA 4YRLA 3RUXA 1J5WA 4H02A 4XU2A 1EVKA 3P8VA 1ASZA 3A7AA 5C52B 3UGTA 1N9WA 3W3SA 1YFTA 5K1XA 3BFMA 4Q6GA 1ADYA 4XU1A 4H2UA 2E10A 4H2SA 2LW7A 3A31A 1SESA 2QHUA 3OD1A 4RMFA 5C53B 2RHQA 3PZCA 5E3IA 4TVWA 1X2GA 3UFGA 1Z7NA 4TWAA 3TEGA 3HY1A 3VQYA 1G5IA 2EL9A 4P74A 4H2XB 1L0WA 1GGMA 4CS3A 4XTXA 2EWNA 2EJGA 1WLEA 4XTYA 4O2DA 1FYFA 2CGHA 4YRSA 3NENA 3RACA 2QHSA 3KFUA 2CIMA 1X55A 3REXA 1YB3A 3NELA 3DSQA 3NETA 1LYLA 1G51A 2ZR3A 3A5ZA 2CJBA 4YDQA 3EFSA 3TEHB 1BBWA 5C51B 3PCOA 2G4CA 2P5IA 4PG3A 4P72A 3VQWA 3VQVA 4ZTZB 4KR2A 5K1PA 3HFZA 2CJ9A 2PMFA 1WQWA 1BBUA 3P8TA 3LC0A 3PCOB 4KQEA 1EIYB 1USYA 4J15A 1RIQA 2RHSA 4YRTA 3RF1A 4UPAA 3QO5A 4OLFA 3WQZA 2AKWB 2ODRD 4UP7A 4CH3A 4YROA 1X01A 4TTVA 4XEMA 1EIYA 12ASA 2ODRC 3VBBA 4XTZA 1YFRA 3V7RA
chains in the Genus database with same CATH superfamily
4BWAA 5EUBA 1N3YA 1M0EA 2YN4A 5BT8A 4Q4HA 2ZWIA 3Q3GE 4C2AA 1RLOA 3LQFA 1JJVA 2XADA 4O5OA 3IUSA 4RMGA 4YONB 3ZCUA 5JI2E 2F3RA 2W2MA 3LPMA 3W2HA 3DHEA 4DV0B 1CD5A 3SR0A 4PYKA 1J5EB 4G63A 4N8SA 3DH0A 2ZPAA 4XD7D 5FRDA 1XKXA 4IDPA 3T7DA 3QV1A 4ENSA 4RTOA 4N41A 3QOFA 4UEKA 3URMA 4YMTA 5AMXA 1G9XA 3HA2A 1H2XA 1O7JA 2WSYB 3LP5A 3MT8A 4HDQB 2Z5LA 2QJOA 1CIJA 4PZ0A 5A3JA 3Q2IA 3V9AA 4C03A 4MPRA 2VQSA 3B78A 1CP3A 5GJCA 3MCUA 5GZ1A 1H2YA 2GUWA 5TT0A 2O2JA 2VCEA 4YRKA 1GUAA 1YCGA 2BHTA 2C3PA 3AILA 4S0XA 4Y9TA 3VR4H 3CSSA 1JSCA 3SOPA 1XLUA 2BKVA 4HMPA 3BBPA 2DKOA 4MRMB 3ADBA 1DC7A 4KIGA 4H2TA 1EB9A 4CIVA 3QVGA 3M4JA 4IIFA 1ZJJA 3FGZA 2QZZA 3CEPB 3QTBA 4MYUA 1O9HA 1RKQA 3ZJVA 3WIOA 3MAGA 2Y1FA 3MGBA 2GPWA 1QB7A 3B6JA 3EBOA 4GGMX 2CHVA 4M38A 3PKJA 1CSEE 1CUSA 3PUXA 1J99A 1ZJZA 1C3JA 1W4ZA 1U3FA 1GLNA 5E8RA 1E7MA 3W1EA 4EMTA 5L3QA 3W9UA 2COKA 1OWPA 2O9JA 1DC3A 3AHCA 2IYEA 1N2OA 1CX9B 3VR4A 3F67A 3HNOA 4QULA 2EDCA 2QTCA 4WLFA 1FVHA 5B30A 1GTMA 3C7AA 3GLIE 3GLQA 1CY4A 1ORWA 2HQSA 3KB8A 4MKFA 3OWXA 1SIUA 1S2DA 1T8SA 2QVBA 3N53A 3PTZA 4MSUA 3U7QA 5CU7A 4D9FA 1JDZA 1PG0A 4X61A 2WWVD 3UB4A 2P40A 3FDZA 1U1GA 4YRNA 4IJKA 2MCFA 3WBJA 4HRAA 5KVVA 4KR3A 3UJ6A 1C1YA 2PUWA 2GM3A 3GJRA 3L7AA 2PQ6A 2XITA 5A4JA 2A0FA 2V5AA 1JQDA 3IESA 4OGWA 4HNVA 4UHFA 3ZK7A 3GFBA 1T34A 2W48A 2WHRA 2X40A 3OU6A 3B89A 3R3JA 1ZRHA 2DQKA 2ES4A 1C0AA 1DX9A 4CYMA 9GPBA 2NZVG 2GF2A 1NHWA 4MRRA 2ZE5A 4JBNA 1E2DA 2VJMB 3NWBA 4OQXA 4WJ4A 3IMKA 1MOSA 3T5GA 5FBVB 3GPDG 4A5SA 4WNYA 2WIAA 1C7EA 1YDGA 3OICA 2OG1A 4CKBB 4HLQB 1V41E 1M7HA 3DUFA 3R24A 3UUFA 4BJ5A 4WBNA 5EIEA 4FGLA 1EG7A 3MOSA 4I4CA 4MP8A 5JHGB 2PIAA 3RJTA 3HXPA 1KTVA 3GPCA 4J9UE 2PU5A 1KFCB 5D86A 5BYKA 3HA5A 2PUGA 5EIHA 3VV2A 4U2DA 1JALA 1MJ5A 1II8B 5AVYA 5IKXA 2C8JA 3IQEA 3KSAC 2O8DA 1JU4A 2QY9A 1H9AA 4N3BA 1CIVA 1FSFA 2H2DA 3G0CA 1IZ9A 3I39X 3N7AA 4JC4A 4LZJA 1Q1AA 1RJDA 2EDAA 4YMLA 3SMVA 1M8JA 3UWPA 2HTEA 4QTXA 1U5BA 3D8SA 1Z4JA 2N0SA 3HKBA 1KMQA 3ZCTA 1UBGA 3NC1C 4C0KA 1JUDA 5B6PA 5LQMA 5FO1A 4AUMA 1RYDA 3IYLW 2QRQA 4DIMA 4MUGA 2EKZA 2WDZA 1PL8A 1I0ZA 4GI1A 3M3DA 1WMEA 5M29A 2OSVA 1ZEMA 3SF8A 4R4JA 3ITKA 1E1NA 2PMWB 4N01A 2C0QA 2DETA 3CX4A 4CEHA 5LJIA 2NU9A 4FHGA 3U4QB 1ESCA 1L8QA 4HR7A 4UBKA 2EZ4A 4H7JA 2I80A 4YAEA 3T1HB 1OB5A 3DV0A 1QPZA 3KRTA 2DR2A 2UUCB 2B21A 5TJHA 1I7QB 4RU1A 3THOA 4TKVA 3RTBA 2QR2A 5K3BA 3ICQB 1Q7CA 1I0LA 1VPTA 3PHBE 3LX6A 1N0WA 3H8VA 3IP8A 3TG2A 4ED9A 1HL7A 1OIVA 3ENWA 2ZS8A 5K4GA 4EECA 1AKNA 1C7ZA 1QCYA 1TA9A 1YJXA 3FW1A 5CGZA 1CV2A 1T3LA 3HFZB 1U2RA 2ORVA 3CSUA 3GFSA 4UD6A 1ADJA 2WWTA 4FC6A 4RGYA 2J41A 2XW6A 3FJYA 4YYEA 3IGFA 3LXXA 1KYWA 1ZOLA 4HH1A 3LQ2A 4DG8A 3KT3A 2G76A 3RKXA 2Z3WA 2JK0A 4FD2A 4M9XA 1NURA 4U1RA 2E6KA 1WDKA 2RMKA 2P9EA 3L49A 2QN7A 4GWGA 2OO5C 4HDMB 4AQDA 4CMJA 3JQ7B 4BPBA 4JHLA 4UHDA 3SS7X 3FWPA 2ZFUA 2MHCA 3DMHA 2YVKA 1U3CA 1L5YA 4NCHA 4EFDA 2C2GA 3D0OA 2X0JA 3STWA 1M6VB 1NNUA 2YWXA 2O59A 2FLVA 4NR0A 4A7PA 3C3JA 1F3OA 2H0QA 2P2DA 2WSIA 1USKA 5GJVC 4ZOQI 1QAOA 1FYEA 2RHHA 3FIJA 3Q7RA 4RKQA 3JQ8A 3LT5A 1TE2A 2HJWA 4MVJP 5I8WA 2XZDA 1ZZGA 2XE6A 4PGHA 2HA0A 3B3AA 5IPFA 1G8YA 3AO0B 3WFJA 3FI9A 4QM6A 3CONA 1O8BA 5TB5A 4P2BA 4U9UA 4NFSA 3WI7A 2FZCA 3I01A 2FWIA 2IEDA 2B8JA 5EKSA 4TTAA 3AVXA 3LZDA 1PUXA 2Y68A 4M22A 1JIXA 1SOVA 1YMUA 5AKLA 3EZGA 1J23A 1W66A 1OE0A 2AH5A 5CBKA 3C24A 3IG2A 3ZQKA 3A7RA 4CE6A 4OQQA 1W85A 4LJ4A 1CUDA 4A8JB 3HGTA 3K92A 2X2FA 3WOVA 4R9RA 1B6SA 3KLOA 4WN9A 3SEZA 2OOKA 1QRRA 4HPJB 3L7JA 3RBAA 4FHFA 2Z1MA 1YZYA 1V96A 3G49A 2BYTA 1J8YF 3Q85A 2TMKA 4RCVA 1H2BA 2RIRA 4XIGS 4ZVQA 5JO9A 1ZVQA 1G9SA 5LA6A 4BC0A 4BTVA 4AURA 2VH5R 1GDHA 1FFGA 2HIHA 1XAJA 4PO8A 1EWYA 4M1MA 1X19A 2QQ0A 3ZI7A 4ZIBA 4B47A 2PS3A 2FFJA 3KM0A 1GPKA 1E9DA 2XVXA 3H2ZA 1L5MA 4MZXA 3NIWA 1AKVA 3PICA 2A0YA 1DAEA 1T6YA 4H1HA 1AQ6A 4OIMA 4TWZA 4YI3A 4LHEA 1M8PA 2WOJA 3AFIA 4TXJA 3BGDA 4ZRMA 3UXMA 1QB8A 3R9XA 1LBSA 2O3SA 2VP6A 4HRVA 2Q0QA 4F2PA 3MIIA 5DJ5A 2BC9A 1K8RA 2YWCA 3FHLA 2XT0A 3H1TA 4DPLA 2DPHA 1V8PA 1MBZA 4RHCA 5FA5A 3IPYA 4Q05A 1E92A 2FWMX 3DAOA 1O58A 5HA5A 1SBHA 4XU3A 3HXYA 2CCJA 5JT1A 3PHHA 4ZGGA 1VP3A 5AVXA 2XMSA 2AS0A 3B36A 3DZCA 5LB4A 3SC6A 2CL7X 2B98A 2JIRA 4MVJA 4K6MA 1UP7A 1K6XA 4XM2A 3U7FB 1O1YA 1A3CA 3BOSA 3KZ1E 4ZOCA 4YPVA 3NEMA 3I9JA 5BQOA 2HCRA 3OPYA 1PVVA 3QPDA 2EAYA 1WNFA 2C29D 2QRGA 3CB4A 4LS3A 4V39A 4WFKA 1Y89A 3ZHQA 4CKCA 5ICGA 3PDWA 2O3RA 3AF5A 3E53A 4Z0HO 5C5CA 4C05A 2Q4BA 1MABA 4L57A 3U19A 3U4HA 2XRZA 4FB4A 3EVFA 4CDMA 2QVGA 1RKBA 3DE4X 1B26A 1T5OA 3MFYA 2IPOA 5G0TA 1AN9A 5JSHA 2MMGA 3D6UA 1AJEA 2ZJ0A 2Y2UA 3HHPA 1GTG1 4KAFA 4MQFB 5CK4A 4PHTA 2BFEA 1SFRA 1ZINA 2EZUA 3NDIA 2DTOA 3ZI0A 5M3BA 4C89A 4D46A 2PL5A 2HPZA 4YMSA 2B20A 5MN4A 2OB1A 1HZZC 1S89A 2XPCA 3AC0A 4H4CA 1P1KA 2D1YA 3BH6A 5BNFA 5KI6A 3CVUA 2QG4A 2IHTA 1N5MA 4RL4A 2I7TA 2GWRA 2X8AA 5DN9A 5JZBA 2PL1A 2R47A 3W3AA 1RIIA 3FAZA 4YIKA 5DX0A 1JHXA 5LYJA 3O92A 3ZLBA 4MUNA 2PWYA 2CNDA 4FIDA 3ZY3A 3RK4A 2ONYA 1E4VA 2DTIA 4EKYA 1PVOA 3AJDA 4B9EA 2I6GA 1S1CA 4BPRA 1HLDA 1IUPA 3AFMA 1A9QA 1F8FA 3TN7A 3OSUA 2HU8A 3RW9A 1PX0A 4NG5A 5CMLA 1IL0A 2SKCA 3QKUA 3FYDA 1H4QA 1JDVA 4JCCA 3UICA 1P9OA 3V00A 2CSXA 3H9QA 4BKQA 2E4VA 4HBGA 3RODA 3L8GA 1N9ZA 4M0FA 3ROFA 4Z2AA 5CJJA 3OO0A 5ETJA 1WU8A 3QNWA 2O4CA 1ZU4A 3AY0A 1ZYUA 5FKJA 3GXBA 3N7TA 3VR2A 4DYHA 1N4AA 1NT2A 3CJQA 4JVLA 3DKKA 3HYRA 1V1MB 1XN4A 1ZGHA 3ELYA 4V0MA 2F7SA 3ZDBA 2YV5A 1VMAA 4CUKA 1R4ZA 3UF0A 1KR2A 2QXUA 2ZUUA 5DHRA 5DO9A 3EPLA 3M6XA 3PBKA 4C0QC 1CNEA 3O8CA 3ZDEA 2I55A 3FUUA 3LC1O 3O7MA 3QVGB 2G63A 2FN9A 2Y2VA 5CB8A 5BSMA 4MUBA 3ZW9A 4NFYA 3RIGA 2PUTA 2WF7A 5CNIA 1O6BA 1Z75A 1TU0A 3FNHA 1F51E 1ADGA 2CHFA 3ZWOA 1X77A 3T95A 1LLDA 1ZM3A 4Q7LA 3FMVA 1R4MA 4ZQFA 5TGDA 3DZJA 3RDPA 3B52X 4GX2A 4IHAA 2QVXX 3I9NA 1KP3A 4PHHA 2VPYA 3OCUA 4ZODA 5BRNA 3RIHA 4YJHB 2A30A 3ZTTA 5DHQA 4Q4AB 2BGLA 4K2HA 3H97A 3L6OO 4QTUB 1R8SA 3TQOA 2DUNA 3O38A 2PCLA 4L02A 4DVJA 1GGNA 5LOVB 1E0AA 3ZDYB 1PT9A 3R8XA 2HBZA 2WJIA 4RF3A 4TS4A 3O4GA 2FQ1A 4WKPA 3HXQA 2ZRBA 4QEZA 2ATIA 4JJZA 5C53B 1G8KA 1KY4A 2B0JA 3DDZX 2RHDA 2VDMB 3FPJA 1DP4A 4J49A 1YJCA 3MUEA 4JL6A 2O8VA 3FNEA 1E59A 4O1HA 4ZQHA 2RKBA 4DUYB 3CPJB 1QGUB 1NY6A 3E9RA 4NYIQ 2GJ4A 3VDQA 4WEQA 3ZX5A 3SAJA 3LL7A 1EP2B 1EXVA 4NCIA 3EMDA 2CLLB 4AXBA 1DBVO 2QM0A 3DVAA 2KBFA 1PJCA 3KTAA 3R44A 3WGGA 4DCTA 1U8ZA 3KLPX 4MQFA 5C8YA 1BHJA 3MGKA 3AGQA 1OBHA 2H1VA 4XTXA 4R1PA 1DQPA 2EWNA 4WKNA 5TNXA 2XLCA 2PLWA 5FPHA 5JFGA 1NR1A 3ZHVA 5IAOA 2O50A 4AJ2A 1XJCA 5TRTA 1I8TA 3NU1A 4B46A 4Y2HA 4DMCA 3L0YA 4I81A 2NXJA 4UZSA 4ZI7F 2IXEA 4KP7A 4NZNA 4BNZA 1DG1G 4ZMRA 2WTXA 5IRCD 1HYHA 4LC0A 4IR7A 1IQUA 2FP4B 4FUTA 3RUCA 2EZTA 3FNIA 3GLVA 3IQWA 4RDHA 4BAZA 5LYYA 3DZKA 3G2JA 5ALLA 3I6BA 2RD2A 1Z39A 3N0TA 5LL6P 3IXMA 3KQTA 1Z26A 2NO9A 3KWMA 5J1TB 3I04M 4ALMA 2YW9A 4DIFA 3FH0A 1XK6A 5LP6A 5EXTA 1QWOA 5JRDS 2BMAA 2P35A 5EJ7A 4LQDA 1CQIA 4PLPA 2PFGA 1ZMRA 4WGGA 5JY1A 1VE3A 3H2HA 4V3BA 1KYIA 5CCEA 3BDIA 3LOUA 2NAPA 1PI3A 2FPWA 3EDRA 3IAM6 4KN8A 2GN4A 1GU0A 2G8LA 2ZRLA 4YDQA 3EZ6A 1H2FA 1RKXA 3CNOA 2V3WA 3EULA 2J7PA 2PT6A 2ZWAA 3K8QA 1ZM9A 1ID1A 3OWHA 4O08A 4BVBA 1RI3A 4PG3A 2VHWA 3A3KA 2OCXA 3TRFA 1GYQA 4BV8A 5GJBA 1G9TA 1DEXA 1BW9B 3VQWA 1YZUA 4B1FA 1L9XA 1E5LA 4MJ3A 4ARCA 4NV3A 1UZMA 5F9MA 3RVSA 4JP5A 4EB0A 5T57A 1Y33E 4ZK6A 1W52X 4B3MB 3PCOB 5CVDA 1GCUA 4J15A 1TZBA 4S1OA 1N6OA 4YRTA 2HT6A 2DFVA 2EAUA 1AX9A 2H7VA 5CLHA 2AR9A 3KDPA 1JYSA 5JD3A 3U9LA 3V4FA 4D9CA 1GP2A 5T4EA 1J8FA 1KI6A 1F0KA 2UYQA 5FBQB 1RKUA 1X3SA 1VB5A 4OMUA 2BMWA 1EE2A 1IJBA 1WKVA 1V39A 4N0QA 2CL5A 3TQCA 1A8SA 3PLNA 4X54A 2Z98A 4UKDA 4MR7B 1RLMA 1R4MB 5EKUA 4BVAA 2J32A 5K0JA 2M6KA 4OO3A 1Z68A 4MVCA 3R7NA 1QQ7A 2W6CX 5E7MA 4DIEA 2AC7A 4LGYA 1HT2E 1NVDA 5CNKA 3BS4A 4X71A 2R6JA 3SQWA 3IVGA 2HN9A 5A4DA 3N5KA 4LVOA 1WU7A 4UXHA 3PWKA 4PCAA 3CLVA 5J4VA 5KYGA 4MI6A 1QMGA 1YQ9A 2ZAGA 1IPFA 4IIVA 1CW2B 3U60B 1PJLA 1KI9A 2C31A 1ZBQA 3KQHA 1JQEA 4KQ6A 1HK7A 2HF8A 5T6MA 3FJ1A 4AYXA 5HM8A 2DLDA 1O6CA 1JA1A 5B3AA 3BGOS 4X5OA 3WRYA 3NYIA 1YD7A 4DAEA 4X1YB 3BTSA 3FRJA 4KE9A 1NG9A 3GAAA 1SN7A 1Y5MA 5A6SB 2Q1TA 4ETNA 2Z30A 3RYIA 4KQIA 3UGJA 2IIBA 4ZN6A 2F9LA 2Y1EA 2VYVD 4PX9A 2BTOA 3ORHA 3IL2A 4WAUA 2XR1A 1RI1A 1QGUA 4IO1A 2TRSB 1OI3A 4P73C 3A58B 4I2NA 4RIIA 1YC2A 2PWBA 1C7JA 3F4LA 4MWDA 4ARUA 1M72A 1E2HA 5DW0A 2E5AA 4WCFA 3T1QA 4P5DA 1V5GA 2PZMA 5DXJA 4LUCA 4HA8A 1NXVA 3LA8A 5DM0A 3ADCA 2F8TA 4QPNA 4RY9A 3LVRE 4EQ6A 1HSOA 4B33A 2AFHB 2VRNA 1W94A 3CE9A 4Y2SA 4AP9A 5KTMA 2EFHB 5DSZA 3FMGA 3LPLA 2X1MA 1VB3A 2W11A 1LSUA 5A4FS 2ONCA 1DV2A 1ZGJA 5BVHA 3NHZA 3LAWA 5C8VA 5JAOA 3EB9A 4LXGA 4H2DA 1XDSA 1PW5A 2OCIA 1FFWA 4KMSA 5HFNA 1JIQA 1YQWA 2YYZA 4DDHA 2I3BA 3MVEA 2RHCA 3JAKB 2WZQA 2PKEA 3ST7A 1LS1A 2JCSA 1DDGA 3ZBPA 3T1TA 1HUQA 3H5NA 4RFLA 4PZEA 3WJ2A 2DWOA 5B1IA 4LW8A 4MAAA 1PVDA 3UJ9A 1W88B 4UTOA 2VF5X 5TEWA 1PT8A 3QFRA 4D0LB 5AUOB 1K75A 3GELA 2ZATA 1H93A 4RANA 3KJFA 3NOQA 5ESDA 3FMIA 4IDOA 2QJFA 1G1AA 4OLHA 2QP4A 2QTTA 3LPDA 4JLPA 4RKWA 5EPOA 1KZHA 3O3OB 2IIPA 4W1PA 3S1SA 1PT5A 4L6IA 3RNLA 3T1YB 3MG9A 5F3WB 1Z2EA 3GRCA 4KPYA 1JXOA 3IO5A 4U7JA 4I2VA 1U0OC 1VCNA 4FILA 1PCXA 2X7HA 2Z3VA 3ZEIA 5I7WA 1N9GB 1SBYA 3ZWAA 4BX2A 1TAGA 4ZVSA 4H1UA 3VZBA 4EKNB 3PXGA 5F76A 4JBHA 1YI0A 3UYKA 1JILA 1P5FA 1OI7A 1B93A 1D7OA 4NH4A 1E9SA 2SBTA 3EN0A 1Y3HA 2J3EA 1M0WA 4TM8A 1PBTA 2FG5A 4DLPA 2J9RA 1E5VA 3FTPA 3DDNA 3OSZA 2B4QA 2BP7A 3GI1A 3V4LA 1MOZA 1U8YA 2WJ3A 1T9AA 5C5IA 4C6TB 4H0CA 4U5XA 1ZJ5A 1NQAO 2ZXEA 3DJYA 4F3CA 1FOEB 1L5QA 1CXZA 4ZT2A 1BCSB 1H2EA 5DLQC 4DUGA 2I9KA 3AKEA 3IP9A 1V48A 1Z4IA 4MR8B 3TX6A 3KSBC 1IATA 3ILVA 5IJZA 5LDGA 1J33A 1CP2A 1U9IC 5CAEB 4FJ2A 2NZUG 3VVLA 4ITUA 3RASA 2PEYA 1POXA 3PGJA 4FSXA 4G01B 1ZWLA 3OAAA 3QU4A 4FE4A 4YAJA 1ZCAA 2PEZA 2A86A 2OPBA 2Q62A 4M7PA 1UDBA 1R7RA 3DL0A 3HKBB 3PJFA 3OMLA 4G4JA 1Z6QA 4A92A 4AY5A 1V3QE 3DAPA 4OHRA 2RARA 4OQNA 1SVLA 3W4JA 1ZSVA 2EP7A 3AH8A 3OIGA 4ZEMA 1R10A 4TM7A 1OLXA 3A4NA 1GTVA 2ZRJA 1F8UA 1L4YA 3H84A 3NTRA 3OZFA 3PNBA 4TLLB 2CUNA 5G4KA 4U3JB 5JYBA 3ZHYA 2BEWA 3KKOA 4LN1A 4MV8A 1W0KA 4MITA 1YZ3A 1Y3FE 3M9LA 4M1KA 2AI3A 4X6XA 1XEXB 3VM6A 4KH1A 3JWHA 4I4TB 2I0FA 3U1TA 1ICEA 3AUSA 2ZSIA 1JB9A 1LKZA 3CF2A 1IMOA 1J7JA 2DPLA 5EOVA 1IBKB 2ZR7A 3PUJA 2FFAA 3WA6A 3IOBA 3RSHA 1QUEA 4QXMA 3R9KA 1I7NA 5J47A 2GXQA 3FAKA 4FK8A 1EVYA 4C0BA 2JIPA 4ERNA 4TL7A 1JR4A 1VRCA 3P0RA 2IH4A 3E22B 3EA5A 5GONB 5E6SA 3GGGA 1LBIA 4P9NA 5KWVA 3TEMA 1OHHD 3P52A 2NWQA 3QUAA 2HH9A 1ZGCA 1CJCA 3IILA 5ESRA 3HZHA 4P71A 1UINA 4XXHA 3JVDA 1ORHA 5AHWA 4YJFB 1CERA 5E6RB 4QARA 3WLKX 1MUUA 4F92B 2PLAA 1TTQB 1YQXA 3LV8A 4FNMA 2P3OA 4GXRA 3IPAA 1TCVA 2QM8A 1R18A 3KC2A 1DLJA 4MH0R 3NBYC 1UZAA 2WEKA 1JJFA 5KZMB 4E5KA 1NAHA 2YTZA 4KYUA 4R0NA 4H6PA 3K0AB 1G2QA 5IDYA 6ABPA 1G18A 3TBKA 3NC4A 4G5OA 5FHQA 4CFYA 3E9YA 1W5TA 1RPAA 1S2OA 4QFCA 4DRXB 1E32A 3CX6A 3AM5A 1ADCA 4FGWA 2FEPA 5AOCA 1QO0D 3SZLA 3C5CA 5CDGA 3FTEA 2GYUA 3RT9A 2FA9A 2OFPA 2CXHA 3K3PA 1UPFA 3LDHA 2YUIA 3GRYA 4X1OA 4MW1A 5B3JC 4LSWA 5EZ5A 4QOJA 3HFGA 5FNVA 4EMUA 1X7DA 3VDNB 4ZAYA 5I51A 5IJ9A 4TV8B 1U7TA 4IFTA 1LV7A 2OBBA 5DN6D 4ENPA 4ZZ1A 1UUFA 4PYOA 5BQPA 4DL9A 2XUKA 4DY6A 5HIAA 4XDHA 1T6XA 4XFJA 2ZAOA 3PD0A 3R8CA 1QG0A 4K6FA 3RI3A 3JXEA 3BWMA 4TYMA 2YQ5A 5JLJA 2WKPA 1ECJA 1CRZA 4PHGA 3EY4A 4N0EA 1Y7TA 3DEKA 4TL8A 4MP6A 3VVMA 1KC1A 1EVJA 5A04A 3LQQA 2GLTA 3ZHUA 3L8DA 5JC8A 4EGSA 5FPKA 4XQCA 3RC8A 2E9SA 4D3FA 1N77A 4OI2A 4WK4B 2OPHA 2IYPA 3PC8A 5EP3A 4CGYA 1HTTA 1DCMA 4B3CA 4DA7A 1WPGA 5BN4A 2P0EA 4FW9A 3O9ZA 2AFIB 4M1ZA 4H27A 3W0LB 5BVGB 3PHGA 4KL8S 4B6SA 3GGSA 3HXVA 4RENA 1NXQA 4IG4A 4OM8A 3ZHZA 2ZE8A 2PGAA 4DLRA 4PO3X 1K4KA 3P4XA 1E1MA 4LBWA 4WKOA 4REMA 3HSKA 1ZOIA 3QE3A 5F52A 3ESXA 3SXPA 3WNQA 4R2HA 3AB3A 2UVPB 2AYZA 3OOJA 4HDNA 4Q6BA 2ACWA 1AKUA 5FT9A 3FPSA 1MGOA 1OXMA 2CMFA 4MV6A 4TTPA 1RXVA 3ITNA 1O96A 1R5BA 1RT9A 2DG2A 2FZWA 2W2QA 2ZRPA 3N6VA 4DB4A 1I9CA 2VJYA 3P2EA 2PSEA 4G0XA 4C87A 1IHXA 1Q12A 1KNXA 1XLVA 1MRSA 4P7BA 3F0TA 4R2MA 3I8OA 1UBEA 3IE0A 4CVNA 1W1WA 2AMCB 2AOUA 4X8MA 2IV7A 1XT6A 2DLNA 3GWGA 3EXG1 3TOZA 3ZNQA 4DB2A 1N33B 3W1VA 4CM8A 4MICA 3WY9A 4B40A 1H5UA 3SZRA 2OZEA 3TE6A 1ZR2A 3BD7A 1RAGA 5CLGA 4GQIA 4HDCA 3EIHA 2O2EA 5BYBA 4LGMA 2PKQP 3AP1A 2OESA 3V33A 3X1YA 5K2MA 4E14A 1H9BA 4UUOA 2ZWPA 3TF5A 1L4EA 5TX7A 4OHZA 4KAAA 4ZT7A 3RRBA 2R86A 1QFYA 2HFKA 2RBGA 4WOPA 5G41A 1RLJA 3TE7A 3UWDA 4W99A 4X1KA 1B3BA 4I1RA 4NE7A 1KIMA 1JR2A 5EJIA 5LZ7A 1S4MA 2E3JA 3A2MA 4OHVA 2EFJA 4PC7A 1E2IA 3FKSA 1ESNA 1NUPA 3BCSA 3G02A 4JJGA 1L5HA 3U5TA 1TJNA 3N8IA 4J1QA 4OI4A 4CLRA 1L4GA 1OH5A 1BMQA 1BN7A 3N86A 4FT2A 2VDLB 1EQUA 2I3GA 3JWGA 5E6RA 1ZI6A 3FCXA 3GZTB 3BRWD 2FPMA 5F7JA 5C81A 1K0FA 3AWIA 1EZ1A 1NE7A 5JVDB 4DLBA 3DDWA 5HNKA 4DXAA 3OFJA 4AJKA 3QY9A 1YB7A 4P4SB 1MJHA 3CG4A 5J4HA 2ACVA 2CNBA 2X9LA 5TMEA 2J5BA 2XT6A 2H8GA 1MIOA 4I4TF 3G13A 1WKBA 3UK1A 1LPBB 1E0DA 2R3SA 5DP2A 5JQGF 5AW4A 1Z45A 4AZTA 2XCUA 4OQMA 4UFOA 2IY8A 3TUPA 4MYCA 1XJWA 2CVQA 4B7XA 4DRXA 3FKJA 3L1JA 3P94A 4MK4A 3CEMA 1X1DA 3LH5A 4HNSA 2G07A 4PRZA 4RH0A 2F00A 4WBSA 2MMCA 5D6OA 2WIDA 1X3LA 4AMGA 1VCIA 4H7HA 2P3LA 2P9JA 2NVWA 2VJOA 4H16A 4JUAA 1UKVY 1KDPA 3BTVA 1GHTA 4KNWA 1JU9A 2PA3A 3P8YA 3L43A 1OPRA 2XNSA 2R6FA 4Y9DA 1IQRA 2TMGA 3PR2B 4Q24A 5DB4A 2W4MA 5GPBA 4EKDA 4EOGA 1MJNA 3KCQA 3VH3A 5D7NA 4ADSG 1UFRA 5DIFA 3T3IA 3GYGA 5DX8A 4GG1A 1LK7A 2Q7XA 1PR6A 4AG5A 1DEHA 4YAGA 3WLPA 4ZHQB 1DJOA 1GQYA 3AEKA 4PX2A 1Z0UA 5DM1A 1C29B 4LV8B 3DWFA 1EIWA 1GLVA 3NV9A 2BJHA 3R0ZA 2CNNA 5JSUA 1MA3A 3ODPA 1FXUA 3V4RA 1IULA 3NAZA 3U40A 4JEMA 1P18A 2YOFA 4BJ6A 3T3EA 2I3AA 4DLZA 4KVFA 1IZ7A 1U3GA 4INPA 2C78A 5H3CA 1UKBA 1OYWA 3RS7A 1AH2A 1DMRA 4QPDA 2FUG1 3TNYA 1H66A 4EFLA 1OWNA 4AX4A 4C0WA 3QA3E 3HB5X 5I7VA 2BUBA 2CEAA 2Q6KA 4QYSA 5G2OA 4FCWA 3VR5H 1HDYA 4RSHA 1YFTA 2OLJA 5KQMA 1SK9A 3TW6A 4F9EA 1Y4ZA 4CR7A 1BOFA 3EQ6A 4MHOA 3SP1A 1P17A 3UYLA 5DGCA 3I30X 4CI0B 1VIDA 3Q4GA 4LG1A 4ZDWA 4F86A 3N0XA 3COYA 1HTBA 4DCSA 5CBPA 4EA8A 5JCJD 5FLXA 1KQ3A 1XQXA 1AKTA 3T5DA 4MMYB 3K31A 3UW1A 4EUSA 1X2GA 1SVUA 1VE6A 1YI8A 3E7FA 3ZHCA 2BGRA 4D9KA 2A33A 3PNYA 3LGXA 1BXKA 1WM1A 4L4ZA 3TLEA 4N7RA 1Y9AA 2CJPA 5DM70 1XKQA 3NIBA 3AJ8A 3NIFB 5ARDA 5G4LA 1Z12A 1CS4C 1SWVA 4PZLA 4Q16A 1M2NA 4EBBA 3NHWA 4N40A 1NUAA 3OBIA 5AK0A 4QREA 5EJEA 3QPCA 1N36B 5BMVA 4ZVOA 5DU2A 2WP8J 5DMXA 3HYCA 2PKXA 3CLSC 3JALA 5A9SA 4JVMA 4KLRA 3FCYA 3L05A 4DUZB 4CLRB 1WRBA 4V0NA 3RHFA 2XUIA 3MB8A 2B36A 2Z4SA 4AC9A 4GDFA 1K86A 3AX6A 1GFIA 1LF0A 3DB2A 1JKFA 2HV9A 3L7KA 3KTAB 4XVHA 3ZE6A 1AK1A 1SQFA 5E95A 2QBYA 3AG6A 2P77A 1C7FA 5ADHA 5TVKA 4YC7A 4O4LB 1RI5A 3TUZC 3EXEA 3RGGA 1UOPA 3FPEA 4BLUA 4MA4A 3RAJA 1U81A 3D7LA 3GA5A 3VR6A 5AW8A 2GZAA 3TEFA 1ZD1A 3PLAE 3I3SR 4IRMA 3EAGA 2XCLA 2J33A 3IIMA 1II9A 4ENRA 3KPJA 1TD1A 3BKXA 4R8VA 1YUNA 3HCBA 4RETA 3JSXA 3SBDA 1UC9A 4QUHA 3T06B 1SVMA 3D5TA 5LR6A 2XCOA 4ZQBA 2XUGA 1P0IA 2WJ6A 3VH1A 3U17A 1LPAB 2ADOA 4FKMA 3WL7A 3FOAA 3KFVA 1P2UA 4P7FA 2F3PA 1HYEA 2PSSA 3DXYA 1S2NA 5C9ZA 3ITDA 3TEHB 4RAOA 3SC2B 5KQRA 3CQ9A 1D6MA 2HLNA 3V32A 1LC3A 1G6Q1 1ZC3A 1QYRA 3K2IA 3WKBA 4DV3B 1JNXX 1XZFA 1XPOA 1Z4NA 3TGLA 3KQKA 2BDUA 4P72A 1X2EA 1Z6YA 2I65A 1CKEA 1YIDA 2PPVA 3AVQA 4GR4A 4IDGA 4ZTZB 1KJQA 2BBSA 1NX6A 3VNVA 2DY0A 1A5TA 4I9GA 3SJCA 3ZTWA 4CF3A 4KK3A 3TPZA 1MDFA 4L8FA 3BXZA 3D64A 2XQKA 3A8TA 3G3EA 1UPXA 3BHIA 2Q49A 1TUGA 4KUGA 4X0EA 3WK7A 3H9BA 2AMYA 4B3IA 3FPHA 4PLFA 3JWPA 2BE9A 2JHPA 3D3WA 1ZJYA 4IJWA 1P7ZA 2ZG6A 3R0VA 3LBNA 3AYXB 2QVLA 1V45E 3G2KA 4LTMA 5C7IO 5EHZA 1DRVA 1VPDA 4ZJZA 4QXOA 1STOA 3DZDA 1L7NA 1ZNZA 2B8TA 5DM60 4URVR 3LKZA 5B6IA 4HSGA 3SQMA 3S1AA 2H29A 3UMMA 1YGPA 3UAGA 2G4VA 2WJVA 4C5CA 1PUIA 4QYWA 3P9XA 2KMLA 5AI9A 1UBLS 3C6XA 5DBGA 1GCGA 2NG1A 4EG8A 1U63A 1PJBA 4GDMA 2ZYUX 4J3NA 1VPWA 3TRDA 2B92A 2G6TA 2PXCA 1TFRA 2GAOA 3OQVA 3SN6A 3U3XA 2YY6A 2IYLD 3C3KA 1TJ3A 1P7YA 2DJIA 3F6RA 4KMOA 5F4BA 1Q7BA 2I7XA 4RABA 3FX2A 3IAEA 1E3QA 4NMXB 1JWBB 1Y9EA 5JISA 2FLKA 4FYIA 3RUAA 5B12A 1GARA 2PKQO 3LQ4A 3QKRB 1BH2A 1LS6A 2WU1A 1QE5A 4PFQA 4Y6LA 4Z9XA 4D4IA 8ATCA 4YP7A 4FR2A 5C4GB 1QIIA 2Q9UA 1XTSA 4RFSB 2IJGX 3DQQA 4S1WA 1L4UA 4HWOA 4ARZB 3TSAA 5I47A 4I99A 1CR1A 3UMVA 5IT9A 2HNBA 2TMDA 2XRFA 1F2TB 4OMCA 1XL1A 5IKOA 4DIUA 4C76A 1F14A 1GAWA 2FSGA 1DSSG 4YFVA 2MYNA 4C4YA 1JDBB 4Y98A 2G1AA 1GGKA 2I1VB 4LJ7A 1J97A 5AM3A 2IS4A 4L08A 1BVRA 2BFPA 2QRHA 3F8SA 2CJWB 2HB6A 3T5TA 5IS2A 3CTPA 2H57A 1FNSA 2I4RA 5B1DA 3SEQA 4E5DA 2H85A 4XSGA 4NK4A 2FZEA 3OT4A 2B4YA 5B37A 1PNQA 4OKIA 4WVFA 2ZAYA 2P2CA 5BORA 2AKAB 5HRCA 4M83A 4F4FA 5KNNA 2ECFA 3IAFA 4ZK2A 3COVA 1E9EA 1SU7A 4QUIA 3RC9A 2WE7A 2HMVA 2Q2NA 4IRXA 1JWLA 3IPLA 1H05A 1WABA 3IDOA 3RD5A 2IU6A 3UHPA 1IJKA 1NVGA 3L8YA 3MD0A 1JBEA 1N6HA 1OY1A 2GA8A 2QD4A 5IBQA 1SUWA 3UXHA 3WYDA 2HXGA 4ARSA 1JQ3A 1OILA 1XELA 3IEPA 2Z5GA 1ZD5A 1E4EA 3P0FA 4Z3DA 3UT5A 2VXBA 4QJ5A 1ATZA 1U9IA 3LY7A 4Q7MB 3T7IA 1D07A 5AKEA 3AUTA 3B38A 2EG5A 1BMDA 5DKFA 3KYDA 2EXXA 3ES9A 1EUDB 1XTKA 2C03A 3QPWA 4Q47A 4XYMA 4ZYUA 4LF5B 1U2DC 5K3FA 4FMDB 3VYRB 1WZUA 1YS1X 3MT0A 4R2XA 1Y1LA 4R0MA 4W5OA 1NVXQ 1ENOA 2FQWA 2G5TA 4CIWA 1A27A 2D4HA 2NPIA 3Q5GA 3OQPA 2EF1A 3CXUA 3FDIA 4C20A 1NXTA 4MRMA 2FZKA 1U4OA 2C2HA 4BRZA 5CEJA 3VHQA 4C1NA 1GITA 2H1WA 2VLIA 1SUDA 1O03A 1U7HA 4LMPA 4ND3A 4A26A 4D8WA 3TCKA 4UOQA 4MEBA 1NZDA 5C2JB 4HNQA 4J0FA 1NDQA 1QOPB 3GNLA 2G1PA 2L82A 3ZNPA 3Q3CA 5IABA 3DPSA 4OYLA 4W5TA 2OHJA 4IIYA 4B45A 3O4IA 4K9RA 1E2LA 1RAFA 3PNQA 4OHOA 4HS4A 3JQ9A 3NBUA 3RUHA 3QM1A 2VZ9A 1GUBA 4X7MA 2CY0A 1NL3A 5AK5A 4EGJA 3H5TA 5LP6B 1LRJA 1T2VA 1CQPA 3WHIA 4HWRA 3PFNA 3T7CA 1I5RA 2HNIA 2O57A 1FP4B 5THKA 1Y6QA 5TJ9A 3BMCA 4TKMA 3GGPA 4Q9HA 5GQSA 4R01A 4POOA 1XDBA 1EWKA 4LVLA 1J09A 1T24A 5JVDA 5JZSA 1YFJA 2O6HA 4LJRA 4RK7A 3W5DA 4RZXA 1EUCA 1FVOA 5E0OA 1OLSA 5F21A 1R6XA 1RD4A 5A7GA 2B82A 1BX0A 1Z08A 3NHJA 1C30A 5CEEA 4OLAA 4CUZA 3I45A 2Q2WA 2OK8A 1HT1E 4LA4A 4NAUA 4HX2A 4PQYA 1UM9A 1RRGA 3E70C 2IT1A 2OA0A 5HJ7A 1IEQA 2BEWB 2RHSB 1S2MA 5CGQB 2DT8A 4JBYA 4IVPA 1SCIA 4RK6A 2H6EA 1XZKA 4HTFB 1U6KA 4LEIA 5B3JA 1YHYA 2Q28A 5J2TB 4NARA 1A9TA 3DT8A 4WIAA 4HCJA 5LC1A 1RWBA 1KMMA 5EZYB 5CDFE 4PBTA 4FHDA 2GAIA 2IX3A 3FOFC 1XTTA 3I73A 4J7AA 1SCKA 4FU0A 3U7JA 3TFQA 2EFYA 2RHMA 1U3VA 1W96A 1HY3A 4KVZA 4RHXA 3WWOA 2Q0XA 1SCUA 2C0PA 4FDUA 3STYA 1JHYA 4YALA 4IIJA 4BNIA 2D59A 4KFUA 3DVLA 2HLHA 3DE1X 4K9NA 4OKSA 5TGTA 4A0HA 1PDOA 4M9UA 4WXYB 3VHRA 1YVPA 3NX4A 2FKAA 1SH7A 1OPXA 1E2MA 3FSEA 3DWEX 3MAJA 4TUYF 3K6RA 4PNEA 1QC5A 1SBTA 5E6UB 4IXMA 3JD1A 4IL5A 1ID8A 2D1RA 1V9SA 1ZL2A 2HKIA 2UKDA 3AI3A 4KKXB 3F2IA 2NXNA 2PR7A 3ID6C 5IVKA 1Q0RA 4P3PA 2RAUA 4LVNA 2J3QA 4AWBA 4O02B 3LJKA 5ANRB 4F6RB 3JYPA 4BMNA 1Q20A 5KREA 3LBAA 2YIVX 3AMVA 2GT1A 3OQJA 3OZUA 3PR3A 4KBGA 4OHXA 2PX8A 1TIBA 3FKSD 3L18A 1QPBA 4Q66C 1SVIA 2Z9CA 1YL7A 2AEEA 2GYYA 3AF1A 4QAJA 1OT3A 3CF0A 5DISB 4I5FA 2C99A 3U3JA 3VAYA 3WWEA 1DARA 4KNVA 1B42A 3CB2A 4FFPA 4RPHA 4J3JA 5GY7A 5K3SA 1G7SA 3RVMA 2BGJA 4D6PA 4GFDA 4TXMA 4HDOB 3EGCA 5DYYA 4RVUA 4RZSA 4WQMA 1JG3A 1OWLA 4G89A 4CU2A 4WLUA 3B13B 3BEDA 4LC9A 4RDIA 3O0TA 1WMFA 4AJ9A 5C5DA 1CIPA 3HXWA 1RYBA 1OI4A 2GILA 4BVFA 1MHPA 2JLWA 4MV9A 3DE2X 4Q4CA 3T7RA 5LIPA 1UXHA 3DT9A 1SIOA 4FGZA 2C7OA 2IHYA 4BFLA 3B20A 4IAOA 3F3KA 3S8EA 2JEZA 4RUKA 3H87A 3FLMA 1XDDA 3E84A 3QE4A 2JRCA 2G28A 4YMVA 2GBFA 1I3MA 4D99A 4C78A 1U9JA 3AL0C 1RWOA 3N5CA 3W8NA 1VTKA 3C0KA 4ZI7A 5AVZA 2HRBA 2Z8XA 4M86A 1KU0A 1AXRA 1W29A 2HNKA 3PQ8A 2I4MA 4MRSA 3WGYA 2EP5A 1G21B 1G0OA 2C5EA 4FZ5A 3QVXA 1M8KA 1LF5A 5JRZA 5BW4A 5HUQA 4BL5A 3N2GB 1WYDA 3ESDA 3GLRA 2UYHA 3DMTC 3V97A 1O6FA 3TNJA 3QOXA 4GBMA 1IJFA 1Z82A 1J0XO 2ORWA 2VSNA 2WSBA 2CT8A 1T4GA 1WHSB 1CUWA 3HNPA 5ALPA 2PLFA 4OOFA 3P4UA 3HCEA 2WD9A 3P9KA 3R41A 2FGKA 1EB8A 5BRAA 1XZHA 1N5DA 2ZTUA 2CNWA 1UM9B 2IZZA 3KELA 3VNUA 3BXPA 3CH4B 3ZLTA 2GESA 3C1OA 2PZFA 1VP9A 3EUWA 3LQ1A 1FEZA 3CRW1 3EBPA 5BSFA 4BLWA 3KB6A 4BGUA 1IEWA 1R8YA 4KQXA 5FUQA 2TMYA 1BE6A 2O06A 1NHGA 1IY8A 2AR0A 2P9QA 5ERYA 3HO8A 1MC8A 5KAPA 1T6BY 1KVUA 5CX1A 2WJAA 4XWYA 2PWZA 1X2HA 4KWTA 3FGNA 4HUQB 1X15A 1Q95A 1JFTA 3EA0A 3TQHA 1FYXA 2FQQA 2R65A 2GZ3A 1A7KA 2CNWD 3ABQB 3DOHA 4X1KB 1QNFA 3U4DA 4M98A 1HE8B 3UHFA 4OH1A 3A5YA 5DRTA 1KOLA 2CWWA 2I87A 3O8RA 1L4BA 3H5OA 3M1LA 2FMXA 5HGJA 2GEJA 2PT7A 3IO3A 3DBOB 2F8LA 1GPJA 4JZKA 2VTBB 1XTPA 4BMDA 3Q8MA 3AETB 4YFYA 4HZUA 3HFRA 3V8VA 4DMKA 1SC4A 1XD2A 2FN3A 4UW9A 1XQYA 2YJ6A 2YDXA 1YRBA 3RVNA 4BO9A 4BQPA 1XTZA 1TZJA 3SIXA 5KHAA 4E94A 2JFHA 4JI4B 4CQLB 3S1AB 2V6GA 4GLOA 1KYZA 5DNWA 3OIUA 4P4SA 3ZOZA 6CHYA 4XIFA 3R5HA 2PMKA 3FYUA 1R0BA 1TTPB 3JATA 3EVAA 5HDQA 1YZNA 4QUBA 2X9QA 4KMMA 1JAYA 4LZZA 2EU8A 2NTNA 3M4YA 4Z8YA 1H3FA 3R6DA 3SHVA 1KTIA 1P9LA 3LDUA 4PGMA 4UNQA 3E03A 3GT3A 1BE1A 4LJ6A 5I7OA 4NZZA 5AW1A 5KQPA 4AS2A 2YXLA 1CJTC 2AK2A 2GLXA 3N1UA 3PP8A 3FMFA 3O1LA 1QX4A 1SCNE 3B5IA 3BTUA 4X64B 4B6PA 1FFEA 1F2DA 4EFKA 1DO0A 4F2DA 1TLFA 4IHKA 4D56A 3T8YA 1ISIA 1I4LD 3SX4A 4N65A 4A6EA 1OFIA 1U2TA 1IBRA 4RQEA 3KJIA 2HA4A 1GT91 3E8SA 4IZHA 4WZAE 5KNCH 2HA5A 2IHKA 1OA1A 5FEUA 5BWNA 2P9BA 2JFYA 4RVSA 5CP8A 1R8JA 2AE1A 3UB3A 4P34A 2XBLA 1UKZA 4NL4H 4O33A 4F6LA 1MA0A 3TH5A 3BN3A 5CT5A 3E58A 4Q7KA 3L7YA 4NPHA 5B6JA 4HGQA 5KNDH 3OPVA 4HHEA 3HM9A 3B1XA 5DASA 4GC5A 4Z8XA 2BTQB 5ER9A 4Q3AA 4QLOA 3HE3A 1KIFA 5BUSA 1DJQA 1P81A 5EIBC 3OQIB 3S3TA 3TQFA 4EL5A 1ECLA 3V8QA 2AZDA 2VP3A 5AXAA 4N7MA 3C3YA 3KLMX 3K9LA 5FJJA 2H1IA 5HQJA 3TSWA 3VI4B 1F0NA 1GOTA 3NV7A 1OZAA 4NYMQ 2C4VA 3TQSA 1SG0A 1HFEL 3FZQA 1YKGA 1ZUHA 1OTYA 2WJZB 3QK7A 5JVDF 2YW2A 3LWZA 2QYOA 3OOWA 2BRUC 1UEJA 4XQGA 4B71A 4MIKA 3IS3A 3GLHA 1HDOA 3PZCA 3PX7A 4X45A 2ODWA 3RC7A 4JODA 5KO2A 1L3CA 3V1UA 4NE9A 2BW0A 4W9NA 1PHPA 1DCFA 3J7TA 3F7NA 3W4IA 4AFNA 2X2EA 4A1FA 3JWIA 3PK0A 4AZ3B 5C46F 4RTQA 1DRWA 4RS3A 4UM7A 1LV8A 2HSJA 2ZDHA 4URXR 3MUFA 4S0ZA 4FLFA 4JJ7A 4WKCA 5DGIA 1KS9A 4IUDS 4LF9B 4OSOA 4EB8A 2C3YA 2VPPA 1HL3A 4GMKA 1DO8A 1SHUX 1XU7A 2B78A 3RU2A 3U7GA 3QEKA 4OUDB 3OC0A 2QMUA 4LBYA 2PD4A 2J0UB 2YY5A 4HUQA 2WNSA 4CMBA 1CUIA 1I0IA 3KCNA 3M0EA 4CRWB 4CTMA 3W2TA 1GN9A 4L5YA 1PSDA 4Z49A 2VDPB 2A0KA 1JEDA 4BO6A 1VLJA 3L4SO 4MW7A 3ICPA 4ICIA 3UBMA 2AI1A 5SY6A 3STVA 1WULS 5A6VA 3AEQB 4OX9B 1HKHA 1PR3A 4XARA 3B3JA 4GMXA 5BR8B 5JZMA 2AMJA 2Q3LA 1Y5NA 4Y8VA 4R2KA 5KJFA 1EFCA 5HP4A 5BURA 5L4SA 4XDYA 5EG5A 1V8DA 4RULA 3IR5A 5KTOA 3F73A 3H83A 2MJLA 3KAPA 2O05A 4DADA 4B2YA 1H3EA 3V42A 2ODTX 3LFUA 2W2VA 2IU0A 3OEEA 5JMWA 4FXPA 1G51A 2XKKA 1VBMA 1JEQB 1M1NB 2H08A 1PHRA 3S8YA 3UAVA 2GBPA 4PY2A 3SQNA 1T1IA 4LE1A 1EK0A 4WESB 4W1RA 2OO3A 5J2UB 4P92A 1QWSA 4GPEA 1DBQA 2O3QA 2P5IA 1NR5A 4MUHA 1W47A 2NN3C 4QU9A 4Y9SA 2OYRA 1X1CA 4PPFA 4HATA 4NONA 2E5WA 2PX2A 3AF2A 2OQIA 1FSPA 3NBMA 3D6NB 2HRDA 4CGZA 1NQWA 3SC2A 2ZBGA 4N1AA 1P7VA 2FVYA 3LLMA 3G0OA 2OT3B 2NVUB 3FSGA 1RM0A 2VOJA 3LC0A 3LDAA 3KQSA 4GMGA 4QU5A 1UAGA 3OKPA 5J4KA 4RAQA 2RHSA 1PX2A 2QQGA 4Y2RA 5D3QA 1BROA 3TK1A 1MO6A 5CXQA 2OHFA 1WTAA 3FOWA 4PS0A 4PZDA 1G7TA 2AZTA 2B2CA 4UEOA 4ZVTA 5FPSA 1CE8A 3DPUA 3GRVA 2ZJ5A 1QBKC 4FDTA 1JEEA 1RR6A 4MWOA 4PS1A 1OV6A 4TTVA 3GVXA 5KKAA 3JYLA 3WYBA 2JK1A 4QICA 1B41A 1RTTA 3MWFA 3ZLJA 1M2VA 1U2GA 3VBBA 3WTBA 3LRXA 1G5QA 4DDVA 2PSHA 4B74A 1N2IA 1MMFB 3IJPA 3DLAA 5C80A 4M46A 3PWZA 2R5WA 2VPWA 2V7EA 4XD2A 4DNXA 3HVKA 2C4HA 3KZKA 2Q5LA 1L0BA 1FSGA 3CR8A 4KO4S 1U9CA 3FOCA 1MOQA 3IAHA 3Q3HA 1UK6A 4IV0A 2AIRA 3RGWS 1XX6A 4FQ8A 1XVVA 3QU5A 1BIAA 2LE0A 2XMBA 4O4IA 1M34A 2AVNA 3AERA 3FDXA 3L04A 5KC8A 1R0KA 2CFOA 3DAHA 2O8EB 3RRMA 3V4OA 4YJKA 3IPCA 4P4NA 4YMUA 1T3ZA 1N78A 1JLHA 2G9VA 1PDVA 2VQDA 3JRWA 4DIOA 3KYJB 3LUBA 1USYC 1IONA 5F4ZA 5FL7A 5SZIA 4OJNA 5TEVA 4P71C 4WF2A 1C2TA 4A73A 4BEWA 1XFAA 2Z2YA 4PZPA 3NCHA 3AV3A 4KKVA 5JJLA 1YULA 2OM6A 4IH4A 2JLZA 1JS1X 3DT6A 2WKQA 3M3HA 3NQ41 4RMJA 3TTTA 2P0LA 4MI9A 1DPGA 4OFZA 4QU8A 5GTDA 3RTDA 4L4YA 1UR5A 4JLWA 5J40A 3AEUB 5EPEA 3EAFA 3FWYA 4GU5A 1EAYA 4PX3A 5ECDA 1W4CA 1M7BA 5MFZA 1H1LB 1PZMA 5LQJA 1T43A 3UN1A 1EFKA 4ZZ0A 3GRKA 2II6A 4FS8A 4IDBA 5E1OA 4YXWD 3AINA 4BV3A 4BNNA 1N7HA 1YB5A 1G55A 3BGIA 2JFXA 2ZRMA 3DXZA 3EGIA 2A0UA 2QAGA 3EXFB 4PZAA 4XJVA 3U7EB 3WP0A 3AHDA 2KS6A 3FN4A 1HC7A 4YRRA 2KM1A 5FTKA 4JEHA 1WR8A 2BCEA 2YXDA 4I14A 5CXUA 4BECA 3ABOB 2DEQA 3BJEA 3MAAC 5F7OA 3N28A 1TOAA 1T10A 3D8BA 2CXTA 3PDHA 1QM5A 3EDQA 1CYDA 3HXKA 4LNHA 4D3SA 3GC6A 3VC3A 5M34A 3L84A 4RK1A 4Q34A 3TVYA 1E1YA 3NIDB 2D1SA 3ORSA 1YIOA 2W6PA 1SVKA 2IW3A 2ZZFA 1ZJ4A 2OZLA 2ZB8A 4RTKA 1B14A 2NTJA 4ID9A 2IYAA 3PFHA 4E2WA 521PA 1F17A 1FFXB 1JLKA 1EDOA 4FR5A 1QHFA 1P4RA 4R2LA 4FFBB 4YJ3B 3I0ZA 1J8QA 3F74A 1II8A 1UDRA 2P3QA 1WB9A 2R7LA 3R07A 1K7FB 3LFHA 2ZREA 1EUDA 2QXYA 3GMSA 4GICA 4QBFA 1UOQA 5EPUA 2FN8A 1NVUQ 3WKEA 3I61A 3WGVA 3IQDB 3UM9A 3CF6R 3PENA 1K5PA 4KGDA 4OTZA 3G9ZA 3MW8A 4RXTA 3JAWB 1EHIA 3A4MA 1V5WA 2GBIA 1NJGA 3WK8A 1ASYA 4DMGA 5KYXB 3C6ZA 3BWVA 3CLRD 3H0KA 4KIFA 4P3YA 1R4AA 4KGVA 3IQFA 4QQ8A 1I14A 4L95C 3ZY5A 4XEOA 3T4PA 1DAMA 3IERA 3BULA 7ADHA 1VCOA 1XK7A 4JBWA 2HF9A 5KB3A 2FZLA 5DDIP 3ZBTA 3DBHB 4WX2B 2I2BA 1TZKA 4NE2A 2IZ7A 3GJSA 2XOKA 4BNVA 2Z57A 4QUGA 1TZCA 1WW3A 4QNRA 4TYWA 1F1JA 3NTVA 4P7GA 3WL4A 4H0FA 1RYZA 5FL7D 1IOLA 4D41A 4DA8A 3BILA 3RYHA 2X77A 4YPOA 1HNZB 4OB8A 4JP2A 4YWHA 1CK4A 3M5WA 3T0GA 2ZI3A 4KAXA 4ZCSA 2BKUA 4HWTA 5E4TA 4G84A 2BOVA 3X1MA 4OQDA 4D98A 3W78A 2V98A 4EG5A 1H1TA 3DC7A 3R3XA 3WK4A 1IK4A 5CHEA 5EXPA 5KBYA 4EI9A 3NHSA 2LTAA 2WD8A 2Y99A 1G7RA 3MSXA 4TMKA 1L5KA 3V7NA 4CR8A 2HUPA 2CXQA 1HRKA 2GEVA 3T9FA 1C4WA 4PR3A 2VT6A 5CDTA 4ESVA 2H5JA 5FOWA 2QUHA 2Q8QA 4I1IA 5JSQA 4LRQA 4D8YA 5IJ0A 1MAUA 3FHJA 2ZZEA 3N58A 3GARA 4TV9A 4CHGA 4W6QA 2J46A 3BT7A 3HEBA 2WUWE 1RXCA 1L1QA 2YWJA 2BMEA 2DPXA 4ITVA 5CYFA 3WLNA 4PINA 1DJMA 2BP7B 2QM3A 4O4JB 1FFHA 1W93A 1NJ5A 5LUBA 3L6BA 1X13A 4OREX 1MB9A 4EJ0A 3ED1A 2DB3A 1RAAA 4HXGA 1Z17A 3MD9A 4L51A 2FHSA 4OYHA 4R5MA 4RKEA 2B30A 4X63A 3RV3A 5AKIA 4Z1MD 2VCHA 2VTVA 4JI2B 1PRYA 1RC1A 1IL2A 1PV4A 2REQA 3HPRA 5IC4A 1FZQA 1QRTA 1F4PA 2B8EA 4EA7A 1JIJA 1TEHA 4IJQA 3L1IA 1KPIA 3R3ZA 3O31A 2PWPA 3WA7A 3GD5A 4RHFA 2QNRA 1Z22A 4AJ1A 1CZUA 2JLSA 1SKYB 1ZCFA 4N7BA 5EQTA 3KO8A 3QLTA 3P32A 1WAMA 2IZ1A 5KVAA 1XXHA 3PYMA 3VU8A 5I7RA 1A98A 2ZYAA 3VU1A 2HQBA 4DA9A 4Q3BA 8GPBA 2BDTA 4C21A 1F60A 3EZYA 5CVCA 4O25A 4RA9A 4XTVA 5IEBA 3ZOKA 3KYBA 1RPTA 1NBME 3N75A 2VDQB 1CQZA 4XYLA 3AUFA 4UCWA 2HMAA 2DXIA 2IPAB 3COSA 4IH1A 3VHXA 2AN1A 4DLKA 2B61A 3DG9A 3QXHA 3ER9A 4KFTA 2GPTA 2A92A 4HB3A 1MFPA 3HWWA 2CLMB 4HVAA 4UVEA 2AZMA 2XNJA 1AZLA 1ZHFA 1CUCA 1AGRA 1G16A 1NRWA 1Q0SA 2IDMA 3KT8A 1IXZA 4AIIA 4BEVA 2H1LA 3EXAA 4EPWA 2FMUA 2E64A 2HF7A 3K6SB 2WYHA 3OZDA 3UXYA 1P3Y1 2HTFA 3OM1A 2ZUSA 4P5PA 2A67A 3JARA 4AY4A 5T3UA 3IBYA 4IOKA 4QPCA 4OBXA 1L1RA 2WK1A 3ZDFA 4MRNA 4P80A 1D8AA 3D2CA 1MAHA 4Y6GB 3BF7A 3U1VA 1Z5WA 4CMIA 1P4HA 1VZ2A 5CT9A 1C4OA 2GUGA 3A04A 2P65A 3O3NB 5ALVA 2VHCA 2O48X 1R0WA 2YHIB 4UDYX 4CKZA 3A4YA 2G7MC 8AT1A 4ATNA 4JH0A 2IYXA 4LVKA 1FTQA 4OUDA 1ZA1A 4XYEA 2E4ZA 2ZJYA 5ALFA 2ZEJA 1M1YA 3UTCA 4G0UA 5SV2A 2XXAA 1J0DA 1P1FA 1YL5A 2BMDA 5E9WA 4UTRA 3R7FA 2DCUA 2JLRA 3SR3A 5FPQA 5H81A 5KTRA 2GM4A 3RANA 2I54A 5DNEA 2HPAA 1HYQA 2WINI 5DTQA 3VNRA 4AJLA 2C3MA 4JYZA 1C9MA 4P75A 4EYGA 3V1NA 4DR5B 1D2EA 1KQFA 4MP3A 3P7MA 2VHVA 3UJNA 2I4TA 3EDYA 3GPBA 2QPTA 1UP4A 1Z0DA 3RB8A 4JJEA 1QHXA 1EINA 1HOXA 5JBIA 2W2KB 1E22A 3BRWA 2OAEA 4GM1A 4KRYA 2DTXA 3OM0A 3GA0A 4UBNA 4RK0A 1PE0A 2C54A 3I2KA 4XPIA 3CMCO 3MELA 3QBVA 3N74A 2PTGA 1WQ7A 1R9NA 2XA9A 1W75A 2DWQA 4CI9A 3LKBA 4WK2B 3O21A 3QPAA 1JEQA 1TZ2A 3KG2A 1Q74A 3S0JA 3R6WA 4NCKA 4TMYA 2YBDA 4JL5A 1V6AA 2FUNB 4WESA 3EW7A 3FTNA 4O6VA 5DM4A 2VDKB 3SKXA 4D74A 2V8OA 1T9ZA 3Q1LA 1TQ4A 3MIZA 4RH3A 1TA4A 1XAIA 2XF8A 4QM7A 5ENVA 3JD3A 4OQ4A 5IN4A 4LDPA 4U6SA 2W2XA 1V7PC 5H3HA 4CKWA 3AUYA 2WLTA 3O73A 2C8MA 1E62A 1FYWA 4KWCA 3LOQA 1WBJB 3OKFA 4P7KA 5EZYF 2IKSA 2YQZA 3MWEB 1WL8A 4IMIB 3NVMB 4GKKB 1DS6A 3T54A 1T6ZA 1WUJS 2XDQB 3C2QA 4PPQA 1TT5B 3BORA 5FCDA 4L7VA 5AXBA 4ZEXA 4DJAA 2DULA 1E3LA 3W6UA 2H31A 2HMSA 2EWVA 4J1NA 3NC0C 1NA5A 2DH5A 5JDIA 5ELOA 2GD6A 3K94A 4D57A 4PG5A 3THXB 3E2PA 4MAFA 3T9DA 3RUFA 3SLRA 4EABA 1U3UA 2WHEA 5ECYA 2VA8A 3H5IA 1SPXA 2X5XA 4EI8A 3IIEA 3ZJ4A 1OKKD 2HV8A 3A2LA 1E3IA 1R6UA 3CLRC 3O93A 4HDSB 1HA3A 5LQRA 2FSHA 4OHWA 3V8LA 4O4HB 3GROA 2DQ3A 1OX5A 3KQOA 3I1IA 4D4JA 2H4XA 1YZGA 3QH4A 2AOWA 3PNKA 3VZQA 5IBRA 3FVRA 3T38A 4A6PA 4I19A 1K4YA 4RNDB 3N70A 1OFVA 1XAGA 4KOEC 2X3FA 2DQ4A 5F2EA 5JWRA 2H4WA 1QH8B 3OHSX 5CLJA 1ZLXA 2WSSA 2R8EA 3GGOA 4UVHA 3AEYA 3Q98A 5EZ6B 1I33A 3ZLVA 3GLIA 2RGAA 3WB9A 1SQSA 1TO1E 1YT5A 3DDOA 2QSYA 1CULC 3ZY2A 2CF5A 3KOMA 2BGUA 4EFNA 4W7SA 2GN9A 4H7DA 5CD9A 1YNOA 3ZV3A 4D9MA 2ZNIA 5E9AA 2GD1O 3CPEA 1N5KA 1O54A 3BFPA 1ZD9A 4MUFA 5DN6A 5FTMA 4GOMD 3SM3A 1X7YA 2VBIA 1KMHB 3B1FA 1WE2A 1B43A 3MS2A 1VYVA 1NKTA 3K30A 2QZPA 2HA7A 5FTWA 3MTGA 2WSSD 1BQ3A 4D80A 4UMDA 3ZGVA 2FYTA 1EI9A 1RW4A 3EX7C 4R31A 4RF2A 2W71A 1YCDA 4HEHA 4XRRA 2GPNA 3GJ6A 3EXHB 2F9MA 1HDZA 5JXGA 5DH9A 1QH0A 4QDJA 2C9CA 4GS5A 4BNWA 3ONNA 3AVOA 5A5VA 5H3LA 3AI2A 3EWAA 2YBEA 4YA6A 2MSNA 2RCYA 4XR9A 4TYNA 1AHIA 3LYHA 1RQLA 2RHWA 5E3IA 4PC6A 5T41A 1VJDA 2VEDA 1LQ2A 3AUXA 4C07A 1UJBA 1ECGA 1IHDA 1A4UA 2FWRA 1A1VA 10MHA 3PLRA 5IBCA 1A7AA 4IH9A 3INNA 4W6ZA 3A6HA 2AB0A 2GETA 2COEA 2OZLB 4R84A 4QDUA 2TYSB 3HWRA 1USGA 4FDVA 4NCNA 4P74A 4Z4IA 2W8BB 1AC5A 4LCJA 1Z4KA 1MX5A 4JC8A 4FFDA 4G24A 5P21A 3Q6MA 1D2HA 4GOND 4XJSA 4ZV9A 3MMXA 1KRHA 5HILA 4E2ZA 1UF9A 1WZ2A 2QEQA 4M8KA 5KNDA 4KNYA 3ZN2A 5B4VA 5B7NA 5L3SB 1F4VA 1YQUA 2NUTB 2QXTA 1JA9A 1JZTA 1GFSA 3UOAB 4IV8A 5K0TA 3KX2A 4IUCS 4W4TA 3ESBA 5JAQA 3SYKA 1JLRA 2ZBVA 4L9RA 3UG6A 4MB0A 5KNBH 4R1SA 2H8KA 1T91A 1KWGA 2DTDA 2IKQA 4YRSA 2IXGA 1WWKA 3NO4A 4GVLA 4M9SA 4OQYA 1ZWKA 3SSNA 3WIVA 4CWAA 4EL0A 1XQVA 1LSSA 3MUNA 4KZPA 1KAGA 1UMCA 3OC6A 2C84A 2B4KA 5IAAA 4JI7B 4I9NA 4JQCA 3FUXA 2E1PA 2H4HA 2M32A 3TXAA 2JDIA 1WA5A 3G2LA 3OLYA 3QKIA 3F1KA 2Q4TA 2QQFA 5HWSA 3WS7A 4PSUA 4DBLE 4E08A 3LI2A 1F20A 3Q5EA 5AO9A 1B15A 4I46A 5IT5A 4KTVE 2BFCA 3L1HA 4O4HA 5J5AA 3EEYA 5EJ9A 4X95A 3N07A 2WKSA 1YVEI 3EJWA 4W8HA 1IZZA 3FYTA 5IVDA 1I80A 3RU7A 5ALHA 5C51B 2CV0A 3PCOA 1NUSA 4IS2A 3NHYA 2HNAA 1E2PA 1TECE 1EXNA 4L75A 4LK2A 3MS7A 4M6WA 4EVIA 4UFPA 4RHUA 7YASA 4F3KA 3D7KA 2R1VA 4YCAA 4QC2A 1O5IA 2GO7A 4NHOA 4OI0A 3ZJUA 1XAHA 4W5JA 2PZEA 1USYA 2Q6LA 2FPGA 2ZIVB 4ZI3A 2R8XA 4HNTA 1JHPA 1QOQB 1IZYA 2R8RA 3P2MA 4JR2A 1LPSA 5DEOA 2YXEA 1KR5A 5F9HA 2AJBA 1Q7EA 1C80A 1TCAA 1WP9A 2YWRA 2Z5FA 2LR0A 3QA9A 3ZS8A 1U8TA 5KS2A 4AJIA 1BNCA 2QJWA 2XDAA 2HBQA 4P83A 2A1TR 3ZCVA 1MLDA 1TU4A 1D6NA 3PWSA 4MKGA 8ABPA 3BG5A 1VKNA 1BWRA 3L4GB 2PRIA 2VEOA 3BHNA 2AGVA 3TD2A 1DG3A 1JAHA 2IU4A 2FRDA 3PI7A 3TNDA 1QRSA 4EEZA 1VE9A 2ZIXA 1C1XA 4F7DA 1YQDA 1RPNA 5KOJB 2MIIA 3OCZA 5EINA 3OJLA 4C0AC 2X5KO 2IHUA 1N2CE 3T1OA 3FNRA 4JB2A 2QNBA 4XQ0A 4LJKA 4ESOA 4NBSA 1GCAA 1JEYA 2XUJA 3IVRA 1WQ3A 1KMNA 1THMA 2QG6A 5DLDA 2G1JA 4RQFA 2FFBA 4ZO4A 4I4LA 1H4SA 2F1IA 11ASA 1QYIA 1TA0A 4QUDA 5CT4A 1PLJA 5CW1A 1AV6A 1PTKA 4E2YA 3I9V1 4CCYB 121PA 4JI3B 3ZCSA 5JD5A 4TKUB 3BMQA 1J42A 2ZT7A 4Y2VA 1TU3A 1HFJA 1PZEA 1D4ZA 2FKNA 3B2NA 2VZEA 3GOHA 5BR7A 3ZDDA 1Y1TA 2XUFA 3BX1A 3X1KA 1L5LA 3IT2A 1PS9A 4LI0A 4MI3A 3PF9A 1KY3A 1I1HA 3IP3A 2BPOA 2FDRA 3KR1A 4KE7A 1I3NA 2VTDA 3CPSA 5K0EA 2VT3A 5GADl 1OBFO 2QZ9A 3BWEA 1F8GA 2OG2A 1F1BA 1RSZA 1U3DA 1YMQA 3FPLA 2XB4A 1L5SA 3IV7A 1US8A 3L7NA 3OIYA 3RWMB 3DW1X 4RVDA 3NTXA 3WBFA 2I67A 4HVCA 1ZXLA 1YB2A 1XGKA 2CHGA 2H3EA 4I4IA 1N1MA 3FUVA 4ND2A 3ETJA 4C4ZA 1C9JA 1R64A 2OL4A 3W6PA 2VWPA 3BFXA 3FTQA 3OECA 3WTCA 2PUAA 1NRIA 4YRGA 1TRKA 4OHMA 1Z7WA 3OZWA 4NAHA 2BI8A 4HNAA 5DK4A 3LO5A 3CISA 2WUGA 2GCEA 3OEED 5G3ZA 1J07A 2AOTA 1QV7A 5EKDA 1TPZA 1LX7A 1N8TA 4ER7A 2EFDB 1DAHA 2XJ9A 1JPNA 2OR3A 5HIJA 4BNHA 1KP9A 3H2YA 4DARA 4KYVA 3I6YA 1A8UA 4O8ZA 4HDAA 3VZPA 1PFYA 3DOUA 5HSGA 1PGOA 5EVJA 2MINA 4K6KA 2OCGA 3AVYA 3HUEA 2X8JA 2FF7A 2VNIA 3CZPA 4NPAA 4RJKA 3QWAA 4YP9A 3MT9A 5CFPA 3AL2A 1ZVVA 3OPXA 3RTGA 2VQEB 3VJKA 4ROSA 5EQJB 3WYGA 2XXAB 5DNUA 3T12A 2IYTA 1U6IA 1VL5A 3F6BX 4FDMA 1RJEA 5DHFA 2ID8A 3GZNB 3PC3A 2GLUA 1KH2A 3AT1A 3QHQA 1XC7A 2BH2A 3B1JA 4X60A 2A78A 2KPOA 1D3AA 4ZOLF 3RHTA 2VYCA 1UFKA 2JGJA 4GKBA 4N5DA 4BJ1A 3OY2A 2OORC 4OAQA 4B4OA 2F1JA 4GQAA 1XJ0A 1IQ0A 4AAYA 1TJ4A 2ZUTA 1QHSA 2JL1A 3HJHA 2P5UA 4C0HA 2D1FA 4B09A 3CUKA 1SC1A 4QUJA 1YHZA 5AWFC 2C4UA 4P0PB 3P1JA 2ENWA 3BMOA 2XQGA 3TTUA 1PLLA 3DYVA 2HEGA 4IMRA 3D1JA 4PHFA 3ZXSA 1O77A 1E6KA 4CKEA 1U8FO 4Z86A 1GWNA 2XBMA 3Q0IA 1R4NB 1DO2A 2E4WA 2GMWA 5CLLA 1U8AA 1ZD2P 2ZQ5A 4G23A 5FBZA 5HKKA 5JD4A 2CLDX 3WNBA 2Z6VA 2J9XB 3HFSA 3IVCA 2XV1A 3OEWA 3H86A 4K1LA 4N3CA 1OFHA 4DCJA 1GUDA 3SJAA 2CYCA 3P9QA 2X8WA 1P2DA 2VXYA 1ATIA 4TWBA 2I91A 1UM8A 2HJHA 4DBZA 1QFMA 3M6IA 2A9QA 1JSRA 4EVRA 4RQAA 3VR1A 1XIVA 3B5JA 2QX8A 1JJCB 4HQ6A 5ECGC 2PG3A 5J2UA 1NUHA 4WVLA 4ASUD 5JAPA 5FUWA 1XBTA 4LHZA 5F23A 3H9CA 4H2WA 4HX5A 2CJYA 1PJSA 2IEZA 3QF7A 1TCBA 2NTEA 2WM8A 5HIMA 1D4FA 1DXOA 1XCLA 1BEZA 1JHOA 2B5OA 1HSZA 1WQ4A 5THXA 3TGWA 1Y5RA 3Q9UA 4ZAGA 3E22A 1QP8A 3IULA 3ZCPA 2ZVJA 2I8AA 1LI5A 2RGYA 3F7MA 1JU3A 1MQ8B 2AW3A 3QTLA 3GIWA 1Z7EA 4ZIRA 1BXRB 1XEWY 3MPUA 1P80A 1EVQA 4QO7A 2WWRA 3U3MA 5ELLA 1M73E 1BQ4A 2HO5A 3V7SA 3X2FA 4AZSA 4LJAA 3LLUA 3P96A 4LZPA 5IULC 4HQOA 2P7IA 1FFBA 4EY7A 2P5SA 4NEQA 3MM4A 3GLHE 5DNCA 1E3SA 4KOAA 2ZUEA 4NEGA 2Q45A 1VQZA 5A1JA 3AP3A 3M6FA 3AHEA 5EEHA 1CUEA 1YBHA 4BNDA 1MKYA 5CH5A 2BD0A 3K1AA 1T9CA 2QU7A 1Y3BE 4QECA 3U62A 3MMNA 3I5MA 1U3WA 3O4HA 2VUUA 1WY5A 3LKVA 1PSZA 2QY6A 3IBFA 4IHJF 1PN3A 2Q9CA 4HVTA 3TKYA 4DMFA 2QSJA 4HTAA 4OGLA 3AUKA 2NZYA 2YFYA 3G5TA 4L8YA 3HBMA 4QATA 2OQVA 3ZZTA 3U6KA 4OP2A 1TEZA 2NU7A 4UTZA 4YRIA 1FXSA 1H85A 1ZUD1 4MMZB 4OVKA 4P08A 4YP5A 2VNSA 4GI2A 2IYFA 2ZRFA 3NHMA 3PTLA 4C2UA 4C9BA 5HUJA 4JXKA 3TIVA 2A8EA 3CLTC 4G1BA 4F9TA 5AUNB 4TRMA 2ARTA 2OP0A 2J3KA 3HNRA 1MZVA 4F5EA 2J08A 1Z74A 3I92A 2G0TA 1NKVA 1ZN9A 4EJ2A 1FDOA 1FLAA 2Z83A 2V3VA 3AXSA 1C1DA 4M54A 3QWBA 4DILA 1EDZA 2IZOA 2YHBA 5AJTA 3VKVA 4JT8A 5K1ZA 2FSIA 5LDHA 1YBFA 2GO1A 2Q7GA 2VLBA 4DNOA 3VR6D 1B1CA 3PUVA 2D1TA 1DEAA 3F97A 4N49A 3W05A 1LNSA 4DDMA 3W5JA 4X24A 4KR0A 4DJFC 4BQEA 3ZUPA 2C9MA 1CETA 1BOOA 2AHRA 4MW6A 1QX3A 3FTFA 2HDHA 4NMMA 1W9HA 1WF3A 5DEIA 5F1OA 4NBTA 4NI5A 2XECA 2AFIA 2QZSA 3MXOA 2B2NA 1UDWA 3T0FA 3TLKA 4GWKA 3OQHA 4AB1A 5JNTA 3QY0A 4AO8A 5JV5A 1CTQA 4KU4A 2BUCA 1EQAA 4RM3A 4M53A 3NNDA 1EM6A 5A3RA 4J8PA 4BQOA 1ORTA 1Q1QA 1HZJA 1G5HA 3E05A 1OYVA 4MXDA 3IMCA 3NANA 2I1QA 3IR7A 3GT7A 4R83A 1J20A 3BA1A 3HKEB 3RJ5A 1KOGA 1GQSA 3PHCA 4OQLA 4YBRA 3EGDB 2N75A 3T3MB 2GZ1A 3U48A 1FU8A 3GAFA 1C3LA 1Q77A 2EBHX 2GN6A 4H4DA 4O2AB 1Y4DE 3UMCA 5LLTA 2O5RA 4PC1A 1DG9A 1Q1GA 1O4WA 4RXUA 1HZZA 4TV8F 1U0JA 1AKRA 5JQGB 5COAA 1WCIA 2AHOA 1A97A 1XWIA 3VGJA 3WJAA 1FJXA 1DGQA 1JJCA 4DVGA 3DE6X 3SR4A 1BWSA 1J0BA 3EHDA 1EXDA 3B6KA 1DKOA 5THQA 1C8BA 1HEYA 3AIOA 3CKKA 3KAQA 2E7ZA 4IXTA 2ALYA 4IZ6A 4Q01A 1TC1A 4U7WA 4URWR 5AI5A 3WNVA 5A5FA 3HUTA 5CPFA 5TQ2A 3V4SA 4XLZA 3C3CA 1P45A 4XYBA 2E4UA 2PH1A 5EZSA 1TUEA 5DHTA 5KNCD 1U7OA 1GRVA 4HPWA 4F8JA 4MV3A 2F8SA 1UBNA 4WZBA 4DV6B 1HURA 3K1YA 3FYHA 4MLDA 1TK2A 2AJLI 3EFRA 2VPQA 1TKBA 4KXUA 5G40A 4EYOA 1HH4A 1OWOA 1J1UA 4YN3A 3IP7A 1HDXA 1AO3A 3I2JA 1W0KD 2RIPA 3JTMA 3WQRA 2NZ2A 5JJ5A 2AN3A 4H08A 4AXXA 2A5JA 3HRKA 5ILOA 2NU8A 2WY2D 4XOUA 5DM2A 3PVCA 2H4YA 4MWZA 1C9NA 2PJRA 3A6GA 3KR0A 2C2WA 3LUDA 4FINA 4U02A 5CLIA 4PG7A 3RVDA 1RHRA 3UT0A 2P4SA 4XH9B 1KO1A 4TUYB 3A9WA 4FS3A 3R6GA 4LJ5A 2OD2A 2YCLA 5A03A 1A7UA 1CY7A 2V7TA 2ORYA 2YRWA 4LGCA 1F4LA 4B6QA 1QG6A 1D1QA 1V3TA 5A9RA 4BO7A 2VF2A 4M0UA 2J3IA 4GR9A 5K0GA 4ZO6A 1FFYA 3EGVA 4JJ8A 1L7PA 1E0SA 4H1WA 3SZOA 1NNLA 4MKXA 5C18A 4BO0A 2Q29A 3CIFA 3QU9A 4ABTA 5MF6A 3L4GA 1RBZA 1J2TA 1SNYA 2QW8A 1UCFA 3P0JA 1SETA 2WFAA 4KXMA 4BKRA 4PG8A 4QODA 1FS4A 2WG2A 3LDFA 1ZN8A 4UDOA 3D3JA 1UJNA 4HAZA 1JE0A 3ZVLA 5LZ9A 5CNJA 2QTRA 3THXA 3AKDA 4Y1RB 1UBHS 2RJOA 2FEOA 4OXNA 1L7VC 1B7GO 4UTXA 1KC3A 4CM9A 4D9IA 4P32A 3C70A 4I1OA 2GCPA 1LI7A 3VDMA 4KQ9A 2UUBB 3Q7TA 3RG8A 1HX7A 1ZX1A 1IY1A 4JLVA 1NYRA 3B3GA 3ZTYA 4RQUA 3C97A 1KAHA 2CK3A 3L5KA 3L7IA 3D6MA 4HUJA 4KACA 1N92A 4J75A 3H1PA 3HDYA 4ZCQA 1KY5A 2GK3A 3GFQA 2DBQA 4DM4A 5K8TA 1RHKA 3NFYA 4DA0A 1RJWA 5JAZA 3NM4A 2C7IA 3PPIA 4UJ3A 5JMPA 4CODB 1GAJA 1BIFA 1YUBA 3Q9LA 1D6SA 2ZYGA 3GLFE 3L1AA 2XTMA 1BIBA 2ZIMA 1V7QA 2DUWA 2IODA 2J5XA 2QRPA 5C1IA 3EPKA 2O19A 2R7KA 3HJRA 3E5MA 5JPCA 4EIWA 3HJBA 4GKAA 1UT5A 2PM8A 2OXFA 1MF7A 3RS3A 2ZXFA 1ZH2A 3G5MA 1JI3A 3AR7A 2OORA 3A3OA 3STTA 2N9UA 3X1WA 4XU2A 3CH5A 4XB6B 4EG4A 5FOQA 1A71A 3PQDA 5KOHB 3S2UA 3BAFA 4DJJA 4G07A 1ZC4A 4BIIA 4XWOA 2B34A 1TIKA 2C88A 1KEZA 3HPQA 1DEKA 3MILA 2ZIFA 1ADYA 2F1HA 3QOWA 3O4JA 1IE3A 1LWOA 1UBTS 2ANCA 3LUAA 3P2KA 4P93A 5ERXA 3VKUA 1ZVJA 4ROTA 1ENZA 3EARA 5P8WA 1ZSNA 1DTWB 1T6NA 2MSLA 7MDHA 3VPFA 5F3RA 2HR1A 3MS4A 4XVQA 4AUKA 3KOXA 1OH6A 2X5JO 1JKXA 3CUTA 5TQ2B 2MR6A 5IUKC 3ONWA 4L8GA 4B4DA 4CIDA 2JLYA 1KDZA 4WJLA 1QIKA 4TWAA 1HEUA 4OHPA 3KXPA 1KKMA 1NASA 4QXAA 4RD4A 3IAM1 4YDHB 1OASA 2GPBA 3T61A 2BR4A 4WK6A 4PQFA 1PW7A 1B6GA 4Z6KA 1XD9A 3BE4A 3EG9A 4UBOA 4YXFA 5B5SA 1CUUA 3M34A 2C9BA 3JU3A 3WLHA 4EAAA 5EWLB 1WDTA 3IE2A 5HPYB 1QQBA 1F2UA 4CS3A 1JJBA 2PH3A 3UJHA 4CMEA 4NZPA 1TUBA 2PZ8A 4DOMA 4YGXB 2MTBA 1U7WA 2NYAA 1T1EA 4JA2A 4JP3A 2POCA 3HY3A 1JSXA 3EIEA 3N7UA 4OQEA 2QRKA 4UNRA 3JSAA 2QV7A 3WL8A 4OJQA 1NFFA 4G9GA 2JGAA 4JUCA 1HNXB 1YO6A 1VE5A 1XROA 2Q0SA 4HGPA 2PX0A