4ZTZB

Structural basis for processivity and antiviral drug toxicity in human mitochondrial dna replicase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
418
structure length
363
Chain Sequence
ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for processivity and antiviral drug toxicity in human mitochondrial DNA replicase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords DNA polymerase subunit gamma-1
total genus 88
structure length 363
sequence length 418
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ztzB01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4ztzB02
2CJBA 4P74A 1KMNA 1EIYB 1ADJA 3RKWA 4H2WA 1SESA 3UFGA 1EVLA 2I4NA 2DTIA 4CS2A 2EJFA 4TVYA 4WF2A 4TTVA 4YRNA 2Q7HA 4HWSA 2AMCA 2E3CA 3TEHA 4XEOA 1EOVA 1IL2A 2ZT8A 3UH0A 2RHQB 3A7RA 4CH5A 3PCOA 4H02A 1YFSA 1J5WA 3VQWA 2CGHA 4ZTUB 1E1OA 2XTIA 1X01A 1H4QA 4YRKA 3V8KA 1L0WA 3LSSA 1YFTA 4P73C 1X2HA 4TVAA 1NJ6A 2DJZA 4H2YA 3V8LA 2J3MA 4NCXA 4YYEA 4K86A 1BIBA 4CS3A 2DU5A 3UGTA 1BIAA 5C53B 1LYLA 3P8YA 3VQXA 1KOGA 2E64A 3IALA 2I4MA 3A7UA 1ASZA 4YRMA 2AKWB 4RQEA 2Q7EA 3HY1A 4P74C 3W3SA 4YCUA 4XTUA 3NEMA 2IY5B 3I7FA 4WJ4A 2C7IA 3HXUA 2DQ0A 1HTTA 3L4GA 2DZ9A 3P8VA 4H2XA 4XTXA 4OLFA 1NNHA 2PMFA 2ZT5A 3MF1A 4BW9A 4P3PA 3RKXA 2RHSA 1H4TA 4XU0A 1B7YA 1QF6A 2I4LA 1WPYA 4DQ2A 3TEGA 2EAYA 4TVAB 1WLEA 1ASYA 4CH4A 4YRGA 2Q5HA 4XTVA 3HFZB 3V7SA 3NETA 3QO7A 2DVEA 4H2SA 4PHCA 4YPFA 4UP9A 3WQZA 2DKGA 4H2VA 2RHQA 3CMQA 4P72C 2ZGWA 5F5WA 3A31A 2G4CA 3RIRA 3A5YA 4XEMA 1QE0A 4K88A 4H2XB 2C8MA 2E10A 5KNNA 5E3IA 2PMEA 1YB3A 3IKLA 4PG3A 1Z7MA 3HTZA 3ICAA 1NYRA 4XU3A 2HNIA 3REUA 1X56A 4RQFA 3MF2A 3DSQA 2ARTA 3R07A 1WNLA 4TQFA 3VQYA 3V8JA 3HXZA 2AKWA 4HWTA 12ASA 1NJ1A 2CJAA 1JJCA 4YRSA 2DXUA 3RGLA 1B8AA 1EVKA 3RACA 3QO5A 1KMMA 1Z7NA 4O2DA 3VQVA 1PYSA 2E5AA 4P75C 1YFRA 4P71A 4X5OA 3NENA 3RKYA 4EO4A 3QO8A 2DDZA 4HWRA 3E9IA 4XTYA 3G1ZA 4P72A 5HGQA 3TEHB 2AMCB 1E24A 4HWOA 1NYQA 4XTZA 3V7RA 2DXTA 4WI1A 3HFZA 1X54A 2ZCEA 4UP7A 4YRJA 1E1TA 3ERRA 1JJCB 2DEQA 5C51B 5C52B 2QHTA 1USYC 3HXVA 3EFSA 3QTCA 2ZZGA 3NELA 1ATIA 3LSQA 2DTHA 4HWPA 1HXDA 3A7AA 3RUXA 1WU7A 1RIQA 2ZTGA 3TUPA 1N9WA 3L4GB 11ASA 4XU1A 3HRKA 4P3NA 4LNSA 3A32A 4ZTZB 2EJGA 3PZCA 4ZIBA 2DZCA 1NJ8A 1BBUA 3BJUA 4XU2A 1X2GA 1EQRA 4G85A 4CH3A 2ZZFA 1G5HA 1SRYA 3IG2A 4WJ3M 4Q6GA 4HVCA 2LW7A 4AH6A 4YRRA 3MEYA 5K1XA 1SETA 4YROA 1FYFA 4YRLA 2DU7A 2DQ3A 5ELNA 2ODRD 1YGBA 4CH6A 1G51A 3PCOB 1X55A 2ZR3A 3KFUA 1GGMA 1W66A 3HXYA 4DPGA 2ZZEA 1C0AA 3RL6A 3BFMA 2ZR2A 3A74A 2ODRC 2DTOA 2ZIMA 4UP8A 1WYDA 4J15A 1NJ5A 4KQEA 3IKMB 2FYKA 3HXWA 3RF1A 2ALYA 4TQDA 1B70B 4P73A 2ZT7A 2Q7GA 3M4PA 4RMFA 2QHVA 2ZNJA 4OP0A 1B70A 4Q15A 4E51A 2ALYB 3P8TA 5K1PA 3OD1A 4TWAA 1EFWA 3HRIA 2ARSA 5ELOA 2ZT6A 4YDQA 2I4OA 1NJ2A 3VBBA 4YRFA 2XGTA 2E1HA 2ZNIA 4YCVA 1VQZA 4K87A 4KR3A 3A5ZA 1V95A 2ZIOA 4P75A 4YCWA 4P71C 3QNEA 1WQWA 1WQ7A 2E65A 4YRCA 2ARUA 3L2ZA 1B76A 4YRIA 4G84A 4KR2A 2E41A 2EL9A 4RDXA 3REXA 2ZXFA 3L1AA 1H4VB 4YRQA 4YRTA 1B7YB 2Q5IA 3EFRA 4YREA 4UPAA 2CIMA 2P0LA 2EWNA 3HY0A 1EIYA 4H2TA 4L87A 2RHSB 4EX5A 3E9HA 3LC0A 1USYA 2CJ9A 4HA8A 3M4QA 3UGQA 4YP0A 1H4SA 2P5IA 2J3LA 1BBWA 4YRPA 2QHUA 4XTWA 1PYSB 1G5IA 2IY5A 1E22A 2QHSA 3HFVA 3FJPA 4H2UA 4P3OA 4CS4A 3V7CA 1ADYA 3HXXA 1SERA 4BWAA 2ZINA 4TVWA 1HC7A 2EJ9A
chains in the Genus database with same CATH superfamily
1MO6A 4P74A 1CUHA 2PFKA 4MUGA 1N4AA 4B47A 4U6QA 4D4GA 3P9XA 1D2EA 1F6WA 5IAJA 1EIYB 4UD2A 3VUFA 4ALIA 4D26A 4AJLA 4PU0A 2QX6A 2DJIA 1W2WB 4PF1A 4AROA 1E5XA 2XZPA 2B4YA 1JJAA 4LC9A 4MAFA 4O2AF 4NYJR 5JRJA 4CL2A 2BWJA 1YZUA 5KTYA 2HQSA 2IIPA 2DTIA 2J67A 2QG9A 2EJFA 4P53A 2I9KA 4GBMA 1ZEMA 4A8JA 2OCPA 1TO1E 3IOCA 1FNCA 1AV6A 3M5CA 2H9IA 2ZB7A 4GOMD 3RJ9A 3NHBA 3WYAA 2F4NA 3VUEA 5BNWA 1CZKA 3QI2A 2FV8A 2V97A 3KQVA 1W5EA 3LP8A 3WLEA 2MSCB 2PT5A 3LTEA 4E5MA 3ZHSA 3MLEA 2YBDA 1E2UA 3BH6A 3K0CA 4CM1A 4YR7A 1NRJB 1V9SA 1X7DA 2HIHA 1RPJA 2H3HA 2HTEA 2O5VA 3DBLA 3MXTA 3KKEA 3RSLA 4YMIA 2BZSA 3A04A 4YIKA 3DOFA 3DZBA 5IDQA 3TXYA 4H6WA 1SXJA 3O03A 5JWHA 1WY5A 4JOCA 1JBEA 1OZHA 4H7HA 1ZC3A 1PS0A 3WLTA 5M5BA 1JLMA 1G38A 1Q20A 1GPKA 3AERA 1UXHA 4LWQA 2Q0XA 2D2FA 5SZHB 3I05A 1NZJA 5AHWA 1VE9A 3RM3A 3NV7A 3LHDA 5H8WA 3IB6A 5I51A 4P08A 2F62A 3ROTA 1JIJA 1G1AA 2HQ1A 4ZO4A 4PLFA 4FQ5A 2FUCA 3GP5A 3K4PA 5E8RA 3OQVA 3PXXA 2GCGA 5IT4A 1WSWA 3IAEA 4W1SA 4D4IA 3ZX4A 2L42A 1ZJJA 2ETVA 3V8LA 1LNQA 3CVJA 3MQ4A 5K99A 4K3UA 1YGPA 4EKIA 1G7RA 3G2NA 4YBRA 3ROQA 1R5NA 2VJYA 2NO7A 2ZAOA 2C88A 4GM4A 3QG1A 1GSHA 4F6RA 4JC8A 1TC2A 1L7RA 2JNWA 3F3YA 3IFSA 4WZBE 1UMBA 1VYUA 3KCQA 4C78A 4E5NA 2PGJA 4OA8A 4KZPA 6NULA 1CV2A 1QO0D 2Z1NA 4N01A 1TFUA 4Q4HB 3N2KA 3VPCA 1R3UA 1Q84A 4Q66C 2VBIA 5MN5A 3JQRA 4KN6A 4ZAWA 3QMVA 3JVDA 4HRYA 4FD3A 4YJ2B 4P2GA 3DDNA 4K9PA 3F6RA 3SDZA 4AXBA 5I7FA 4K26A 1FU4A 3QVGB 2E21A 2FUKA 3HBJA 2JGDA 3LBHA 1KU0A 2DX7A 4L95C 3ZS9A 2WU0A 4OHUA 4DYVA 3CVYA 1FC0A 4BB6A 5FWYA 1JS1X 1F5SA 3P9QA 4D56A 1N8KA 4Z9AA 1Y0BA 5A4KA 5AK0A 2JIQA 4LYYA 4LG1A 5CIWA 1H5UA 4FFPA 2HBQA 3QJ5A 5UKDA 3E82A 1GLGA 2EOAA 4F1KA 3K9BA 4ZCIA 3A0UA 3A2MA 4A8TA 1GPLA 1P9OA 2C59A 4M8IA 4TYPA 3CH7A 3S8MA 4Z3OA 2V7UA 3OZUA 3HWSA 3F73A 2COEA 1G64A 2AN1A 4M0DA 4GUDA 4O33A 3RYCA 4PFSA 1T36A 1BCSA 1IY9A 3CUTA 3U3ZA 3G02A 4KMOA 2JFYA 1E4EB 2C0CA 4G9EA 3Q2IA 4KV9A 4O2BF 1XXLA 1E94E 3QPDA 1C9EA 2BFWA 1F0YA 3JWIA 4TVAB 1O4WA 1Z6XA 1IN7A 5CG2A 2HWKA 3I4CA 2QL5A 4JXKA 4YRGA 2Q5HA 2FLKA 3OJOA 4CLOA 1ES9A 1DB3A 4K1XA 1Q3TA 3UQZA 1LFDB 2AWOA 2PS9A 3MRSA 3T7KA 4PGGA 1P2VA 3ZD9A 4RTRA 3IDZA 4H2SA 2ANCA 2ENWA 1PK8A 4PHCA 1BWQA 1MEJA 5DT2A 4TLLB 4OG2A 1U2SA 4BO4A 4TM8A 4WNAA 2DKGA 4LFCB 2KSQA 1H8ED 3R76A 5ELLA 1S1CA 4EKDA 2OUIA 1EAYA 1OA1A 1E1NA 2YYSA 2DUMA 3BJRA 2CJWA 2RH5A 4UHCA 3BF7A 1Q77A 4HFMA 3VYVA 5KOHB 5F5WA 3WBKA 1TIKA 2EGGA 1IJEA 1TK3A 2G4CA 4TVBA 3LGXA 1Q0SA 5K2MA 2LDBA 4U8GA 2G9NA 1T8TA 4EARA 3CO5A 5DX0A 4FOTA 5HKKD 5LLDA 3I58A 1T8RA 4L08A 3OO0A 2V7PA 3EDMA 3C3MA 3M1IA 5CDYA 3TJRA 1V3TA 3HDGA 3TXXA 5FLYA 4BFUA 1O4VA 2Y6VA 2HBYA 5IVHA 3I3OA 1FFYA 3K0KA 1OGYA 2AG0A 1RS0A 2M6KA 2FPKA 3EXAA 4NYMR 3UW3A 1Y3CE 4G1EB 4C2BA 1Z0AA 5A4IS 4TTJA 1YA6A 1JEYA 1SC6A 1FY2A 2OD9A 4IDPA 3TFOA 3G3EA 821PA 1X56A 4L4YA 2JFWA 4UBKA 1Q22A 1P1BA 4OI2A 1A7AA 5K3EA 1M8FA 4QDZA 3THSA 2G72A 4KPGA 3M7IA 5EQFA 1FQOA 3T5TA 4GG1A 3CQ9A 1SU8A 5EZYA 4Q7QA 3P96A 1EBFA 3GFRA 3C3AA 2YNMC 4IYRA 4C6HA 2W71A 4DV7B 2BD0A 4UU1A 2DHEA 1ZHHA 1IN5A 2FCAA 3DONA 4W63A 5JT1A 4DBLE 1PZGA 1YE3A 4RPJA 2FZCA 4TTPA 2ZI3A 2O54A 1QGZA 3S28A 5BNTA 2GJ4A 4AC9A 3K9GA 1XCMA 5JZOA 5FFNA 2E4YA 5AVSA 5H9VA 3RWMB 4E31A 1TC1A 3PDCA 3R8CA 2G5CA 1PJ4A 1PYSA 3JQAB 1W76A 3KB2A 4HXEB 4B3MB 1RRGA 3G2LA 2O50A 1KO1A 1A9XA 1QPBA 1T1SA 1Y5LA 3ZWQA 1PHRA 5IPFA 4L50A 1JWBB 4XYGA 2FUG6 5CBPB 1NW9B 5HF6A 1ACLA 1ZMOA 3TTVA 1XCGB 5A5VA 1JQAA 2QN6A 2ZWMA 3HHPA 4WE3A 3C98A 4XIYA 3UJ8A 3TK1A 3VDRA 3EAGA 1AGNA 3PFGA 4MIYA 5BWCA 4RM3A 2FJ0A 2PZAA 3GBSA 4P4NA 4EDFA 4AYXA 1SXJB 1V1JA 4IEFB 4MUFA 3ZDDA 1QLHA 5H70A 1TCBA 2PT7A 4H1VA 4UUBA 2XQKA 4P7KA 3ZU6A 4RW0A 4PW0A 2HHLA 1SVUA 2QP9X 1WSDA 1KDVA 3CKKA 3BHIA 4RTJA 1ECFA 4JAVC 4LAFA 4M0CA 4C7MA 1JA0A 2R7LA 1OW3B 1GVNB 1Z38A 2QT1A 3MCTA 2AXNA 2DXTA 4MPJA 4WGGA 1H2YA 3HFZA 2EHDA 1X54A 2CHQA 1YTUA 4OUKX 2CMHA 1WB5A 3DG9A 1MABB 1UDWA 2A1TR 3H1EA 2HMTA 4XA8A 4TWJA 3T7JA 3ANMA 3MS7A 3ZDEA 4YRJA 4MUEA 5CDFA 1R0LA 4G4IA 3Q2KA 4IUDS 2HQRA 4Y9UA 3V33A 4Z4FA 3VNVA 1AU9A 2I7XA 2ILTA 2PUHA 4HZGA 5KNBH 3REOA 2DEQA 4HNAB 3EDRA 3PJEA 3DZGA 1ZL2A 1WLYA 1L5VA 1NDUA 4I1IA 1B8VA 2NUPA 1N5RA 3LSQA 3R6LA 4MQMA 4F92B 1F14A 5KQGA 1R88A 1CK4A 2YNMD 1WPRA 4EHLA 3F47A 3D3EA 1ZD8A 1K4YA 4YQFA 2AW5A 1R10A 4N8EA 3I30X 3U4CA 3C7CB 3VNRA 3L6CA 1FSFA 1LPNA 5IAOA 1OXVA 3UMJA 2YXEA 2CHVA 1AHNA 3CH5A 3MTBA 2P27A 4P5PA 2FI1A 1XBTA 4TL9A 2QZZA 4ZGGA 1VMEA 2VUIB 2WEKA 1QC5A 3AKZA 3NUGA 1DLIA 2J4DA 2OECA 2ZRIA 5JALA 1GNSA 4ZRDA 4D7AA 2A1UA 5DGTA 4REQA 4LNSA 2B1IA 4IZ6A 1PKXA 1GZVA 1ZM9A 1TIBA 1YDFA 4IIBA 4CR7A 3X1KA 3LVQE 3AL2A 3HB4X 5IEBA 4BB0A 5HKBA 4KXFB 1QZTA 2ZAGA 1HORA 1ZLYA 1VZ3A 1EDZA 1SKYE 4EX7A 2ATIA 1TX4B 1W35A 2C0PA 2LR0A 2ONZA 4C7KA 1DC3A 1PR4A 1XN1A 3IDFA 4XLTA 3ITKA 4NOKA 3ZVRA 2WF6A 3ZH2A 1SCUA 4E4RA 3I5UA 5JFTA 1V5GA 2A78A 4QJ5A 1N32B 3GLHA 4FLMA 5GIPE 1ZPDA 3F96A 1V1RB 1XL0A 3FVVA 3DCNA 1PFUA 4RS4A 3EEIA 5EEGA 3RSOA 1OC2A 3NVMB 4DLWA 4BLPA 1ZVVA 3DNFA 1PL8A 1RC8A 5JU6A 1ZM4A 3L92A 4DCPA 1W30A 5ITZA 3EY4A 3MCWA 1UP6A 1W34A 4RVOA 1RADA 1VKRA 5ELNA 2FSSA 3Q2OA 4BNVA 5HA5A 4KSCA 4E1VA 1JFLA 2JASA 2XRYA 3PFCA 3T5BA 2RHRA 5DM0A 3D2AA 3U37A 1HDYA 3AQIA 5ALTA 1BAPA 2ACKA 3SFZA 1T8PA 2PANA 5EKXA 4QNNA 1A96A 5JZBA 1ZCBA 2AOUA 4TGLA 4HYEA 4B45A 1OH5A 5A4DA 1UUFA 1T3GA 2Q0SA 3EAQA 4ZDJA 3OLYA 1VG9B 2VF5X 1X80A 3QUQA 3L06A 4LECA 3WSVA 1QFXA 5A71A 3K1AA 2R1VB 2ODRC 4FUTA 3NVDA 1JFFA 5IUKC 4B7UA 4JJFA 4D9FA 2O8CA 3H5WA 2FZWA 4L51A 3ZVNA 3BXZA 4G5YA 1Y3HA 2ONCA 3JQ7B 3UMCA 3VYWA 3GLGE 1KA9H 1GRNA 1TMOA 4ZOLB 1QIDA 4X7BA 1RZRD 2HLHA 2ZRAA 4NHEA 4JFAA 3ZY4A 2JDID 5LQAA 1DLJA 3NHYA 4I5FA 5E6UA 3PNBA 2NTNA 4UTXA 4FMDB 2J0QA 5FIUA 1RWMA 1RKUA 1BZYA 2AD1A 2HRBA 1W29A 2ZYDA 2GPTA 4RAQA 3ZW9A 2PWAA 2YV4A 4YXFA 3BUSA 1XCBA 3GGCA 3OPYI 5JSKA 4DCSA 3SMQA 4B2YA 2C7BA 3AP3A 5EE3A 3T9CA 4BX9A 4Y67A 1HYHA 1XGKA 4D0NA 5TB5A 1DAHA 2QTVB 2BGIA 1KQGA 4OM8A 2P6UA 3ILXA 4BGVA 2RARA 1IY8A 3A3NA 3AVOA 5AK6A 2FZGA 3T41A 5K8TA 2AF4C 4EJSB 2PX0A 2GZSA 3BXPA 3OD1A 4DWOA 4MLZA 3TW6A 5DNVA 2YOGA 3DPUA 4KUGA 4UMFA 1I3OA 1OZFA 1QYWA 1QIIA 2YXPX 1I36A 2QLMA 4IH4A 4XGQA 4Q3CA 5GONB 4IQ0A 1G6Q1 3VBBA 4POOA 3QI7A 4F2PA 1FLNA 1HDCA 3C8HA 2YYAA 5EHZA 4YCVA 2JAPA 1H5QA 2PUTA 1DQRA 1EP3B 3EVGA 1SKBA 4GU5A 2OGUA 2Q6TA 3R5SA 4MO2A 4MVJE 4AG6A 4B6OA 4F91B 5KWVA 1CDDA 2EWWA 4BO9A 3OJXA 1UANA 4GL4A 2VF8A 3QNEA 1MX5A 4MR8A 1T9CA 3TX2A 3F2VA 1LZLA 1ABEA 1HFWA 1RYFA 4WY2A 8ATCA 5BT8A 4Z2YA 1UCFA 1EM8B 2AOTB 2W8BB 3NC4A 4WOKA 4EPTA 3REFA 4YRIA 2YN0A 1CUGA 3R4VA 1PDVA 4UEOA 4DHEA 1JP7A 1P31A 3NTOA 3AY7A 2QNIA 4Y0VA 2LBPA 2IYAA 2J0UA 4LXIA 4LJSA 4JD5A 2FN7A 3KETA 5FPYA 1LSOA 3R23A 3LVFO 1PNQA 2OOKA 3ZTYA 1P77A 4BX8A 3HYSA 1H4VB 2WTEA 5DOZA 3VHQA 1CNFA 1GP2A 621PA 3FPHA 3LPMA 3MOIA 4R3WA 4TYMA 4WX2B 5FPSA 1C50A 2QX8A 4FBLA 4OGFA 3VH3A 3A05A 4BUCA 1ZOLA 3BF8A 4NF2A 3VXKA 3TCXB 3MAGA 5DNAA 5GTDA 2C7QA 1E3EA 2EDCA 2FSUA 5FA6A 4EB6A 2Q5IA 3IOBA 1GCAA 3RIXA 4UPAA 5WRFA 1UAYA 3ZK8A 5K8VA 4G1UC 2W2LD 3GEBA 3LUAA 3TLYA 1FFGA 3HV2A 4RMJA 4XFJA 5TJHA 3FMIA 3NBKA 4UU8A 1FXWF 3LC0A 2OCDA 3ZNNA 4DNFA 1USYA 5BUCA 1UJ4A 3MJEA 1OOEA 4PBRA 3I2YX 1KJWA 4GQAA 5KKNB 3L0DA 3AETB 1YL6A 3MWEB 1ND5A 1C1DB 2AC4A 4ZVQA 1F3OA 3A6DA 4HADA 1F20A 2IEAA 3I9OA 2XBMA 2BM1A 4F5YA 2OGTA 1QO7A 2YNMA 3EBPA 2XWQA 4YP7A 5DASA 3GCWA 1RPNA 1AF4A 1Q0ZA 2WVGA 2ZSDA 5K3FB 3STVA 3T94A 3KDAA 3ONFA 1VL1A 3O21A 1NR1A 3X1MA 2IY5A 4F9FA 2ZRPA 4X71A 4J0IA 3NM6B 8LDHA 5KOJA 4HDRB 3VR5A 2HK9A 4DPLA 4JC4A 1RYDA 1J2RA 1ZSVA 4HH4A 5IVPA 4OP3A 2ATCA 2H1VA 2B4KA 2HQBA 2KHZA 5JSHA 1TCCA 1AZWA 3BWDD 3H8VA 4V0MA 3CFYA 4ZYWA 1KP9A 4I0WB 3R3HA 2JDIA 4BE9A 1OWPA 5H9WA 1E7MA 2P6NA 4HQKA 1CFJA 4LJ6A 2VHYA 1M33A 3TWOA 2B35A 3OQNA 1U9CA 4MQEB 4KREA 4CQLB 5BN4A 2FP3A 1Q44A 2EKBA 1Q3KA 1EQ2A 1H2FA 2MSEB 1II9A 3TSAA 3ZGVA 3LUDA 5HK9A 3H3FA 3QM1A 3K0AA 4BASA 4UKDA 2XMPA 4DR2B 1ZL0A 5C35A 3GEHA 3U61B 1P0IA 1HL3A 3MPUA 4QXAA 9ATCA 3B60A 4LX8A 1TJNA 2B30A 2WFLA 1G3MA 4G89A 4HMPA 2AOXA 5EJGA 2H92A 4Q3KA 4YI3A 3GMIA 4EG3A 3PNPA 3QU7A 2WJAA 3FYTA 3K30A 1HWYA 4LS3A 1WM1A 1HFKA 3NGXA 3LT0A 3SE0A 4M9SA 2QNRA 3KKLA 4GGPA 4GZ3A 1X3SA 2I4IA 4EITA 2YS7A 3WBBA 1C41A 3ZWCA 3EEQA 1E6CA 2FDCA 1FF9A 5CX4A 1Y1QA 3RYTC 2P5TB 3PT9A 2QMEA 2OXTA 4Y2GA 3OX2A 4JCCA 5D5HA 1C4KA 1CW2B 1M76A 1ZNWA 1MA0A 3I73A 1I3NA 3H7AA 4HLUA 4RNCA 4RESA 4M0LA 2E0IA 3A7RA 1JHQA 1AKTA 1Z0ZA 3NIFB 3H9QA 4TKMA 3C3CA 1JFSA 3MA0A 4URHA 3SXPA 4ANFA 2WM9B 1JHRA 2FFQA 4EY5A 5C2JB 1AZTA 3TD9A 1EWTA 4NENB 1JI3A 4XSVA 4JYZA 4Z1MA 1R0XA 5TQVA 1IEWA 3QMWA 4BV2A 1X01A 2F4VB 1Y5RA 4XWOA 5CLHA 3H7IA 4E6EA 4WL0A 5LP6B 3JTMA 4D41A 1T2NA 3I9V1 1BS1A 5JH7A 4RVNA 4U00A 1KVSA 1AMNA 1FTNA 1U0LA 1DX6A 1WXHA 2ADMA 3QKWA 2YV3A 1Q92A 1GJRA 2RB4A 2VZLA 4C87A 2QU8A 1O77A 4WK4B 5I8WA 3PS9A 2O0KA 5DHSA 4EABA 5HQTA 2X7JA 4JHLA 3RYFA 1P5HA 2BSXA 3PZBA 4AO8A 1YC2A 2QAGC 2YVLA 1UAGA 2I4MA 2CXTA 3AJ8A 1D4OA 3G8CA 1D9XA 5CX1B 1TLTA 3F49S 3VMMA 3UAOA 1YI8A 1VB5A 3QVUA 4JBYA 4HVLA 4C0KA 4G24A 2FQXA 5EP4A 4PSUA 4EHNA 3W3SA 4MI6A 3BCRA 4FHCA 3SZGA 4OLBA 2Q2NA 3P2YA 1EGQA 3Q1KA 2Y0PA 3RBAA 4LOHA 4QM6A 1SBQA 2GBLC 4D6XA 1NTOA 1X7ZA 2WIDA 4N8DA 4BEJA 1J97A 3DEFA 4D80A 1DP4A 4J7XA 3F4KA 3V5NA 2H2IA 1N3IA 2QRQA 3E3LA 4Y6QA 4OOFA 3EGWA 1QTIA 5DXFA 1HFEL 1JHUA 1KJZA 1J5PA 4OLFA 1PTJC 1ZW1A 4TM7A 4QZVA 1JTVA 1RQLA 2HNAA 4NATA 3OHSX 3VPHA 2HCBA 3R7NA 4KN5A 1BMFA 1TM2A 2PL1A 3D8SA 1ZP6A 1NVDA 1H6CA 4NEHB 1TZCA 2P9CA 3ME5A 3S3TA 1HE1C 4MVJH 4CCWA 4L0QA 4N7RA 2I62A 4F5EA 1J8YF 4MW5A 4WKGA 3UJBA 2D5AA 3D0RA 2JBWA 3VR6H 2IYEA 1G3IA 1UMKA 2XW6A 3L0PA 5HFJA 4C5AA 1GAEO 2FN3A 1XCOA 1FDWA 1UBNA 2PSFA 3DOCA 2LTAA 4UFPA 1A4IA 4IXTA 1WIWA 3K0SA 3OQJA 2OHHA 4TTTS 4ZANA 2QP4A 5AXAA 1GQSA 5FTKA 4CH4A 4RD4A 4B5KA 1XP5A 4IHJB 2EFEB 4XEHA 5DKFA 3TBFA 5I7EA 3VU1A 2AMJA 2YQ5A 3FH0A 4E08A 3CONA 1RABA 4ZDIA 3FOFC 3HFZB 1E60A 3V7SA 4AKHA 1NQXA 3DE0X 4E5KA 4L72A 2QYSA 2YOHA 1W5TA 2CKDA 4R69A 3GH1A 4BC0A 4YPFA 3IBTA 2WJJA 1Y6JA 3M6FA 3O3OB 2P9GA 3PF9A 3Q88A 3TW0A 1CRPA 4I4NA 4KIFA 2P0YA 4JWKA 4K9MA 3M9LA 1V6AA 4N5DA 4B9AA 3GAAA 1KNXA 1MJFA 4R4JA 1HEUA 2YXDA 5TQ0B 3MWDA 3PXEA 5CVJA 2XTNA 5LBTA 4WASA 2YHAA 3ZGZA 1HTBA 1WABA 2XYRA 3GFBA 3QFSA 3ZE1B 4BL5A 3BD8A 2R8RA 3QPUA 1UFVA 2WOOA 4DILA 3H6HA 2C8MA 4C7OB 2K5UA 4E88A 2M6RA 1N7IA 2YY5A 2XA1A 2XNDD 2XHEA 4GXRA 4QDUA 1KFCB 3ZYZA 1XCPA 1P7PA 2FUEA 2XUIA 1XHEA 5I8ZA 4IZHA 1O89A 3SR4A 5EWMB 2JFQA 4EHIA 4TV8A 3I0NA 4N9QA 1FP4B 4ZIRB 3RFTA 2O3TA 3PDWA 1X1RA 4HQNA 1N0WA 1OFIA 2Z95A 1MIOB 2XZLA 4M7WA 3PDJA 4MQFB 1W6UA 3WO0A 5H4GA 1DX4A 1E6KA 3P2JA 2RK6A 1Z0IA 13PKA 4KZKA 2NUBA 2QGZA 4QHYA 3WNDA 4AZ3A 5A7FA 3RT1A 4L8VA 2O7VA 2IHTA 3R9XA 5J47A 1A8PA 4IIHA 1MEOA 1ESEA 2WG2A 2QZSA 3SDBA 5TXGA 4IOLA 1OBHA 3ZTWA 4BKMA 1NLUA 1PR0A 1I13A 2GJ9A 4XRRA 1J9GA 2Y93A 3JATA 3PF8A 4KJXA 4F9EA 5JC1A 1G0OA 2IOHA 3BJMA 5KSOA 1WBBA 1ZHFA 3EMVA 4WOCA 3ZDAA 1XAJA 3IUYA 1PV1A 2ZRCA 2IYTA 4RVUA 1F6DA 1Q16A 2O05A 2WWTA 3BJIC 4AVYA 1OFTA 3I28A 3KEQA 4JI8B 1T4DA 3ETNA 3QU5A 4MCAA 4D8WA 1FIUA 1QXSA 1MGPA 4JUCA 4PQEA 5FV7A 4MVYA 1T2CA 1Z0DA 2HDOA 2H9YA 3LY9A 4QIHA 3FHTA 2PRJA 4HBGA 4PRLA 3OTHA 4ILEA 1B74A 1J2EA 4JSRA 4F11A 2H06A 4MUKA 4GKVA 4XFDA 3QLVA 4HDSA 3T1TA 4Y2PA 2KBEA 1SU6A 1OWNA 2SKCA 3LT1A 3L4BC 3P26A 4H27A 5CVDA 5D3MB 3IR6A 3IE1A 4EO4A 1NQUA 1UOOA 1Y9JA 4G5HA 4EP1A 5BSWA 4DDUA 3OPXA 5DIFA 1G6OA 1Z74A 1XPUA 2Q5OA 3OU2A 5EJIA 3M4ZA 2UYGA 1QV7A 3LOPA 1PVDA 2JZOA 4HD8A 1Z56C 2CYBA 1E2EA 3SQMA 4BNZA 4YCMA 9ABPA 1XMJA 2V0NA 4NFHA 1MC4A 3G1ZA 3UHAA 5J1SB 3ERCA 2A9QA 4FGWA 1TM1E 4B83A 2ZWAA 4ZO7A 3UWSA 2YV1A 2HF9A 2BYTA 4L85A 1FZQA 2G71A 3N2GA 3SLGA 4D79A 3UWMA 1ELOA 2VNSA 2X9VA 4CUJA 2CUZA 3V8QA 3VAAA 1W1UA 1S2GA 5J4LA 1RXCA 2NQTA 3FPGA 2ISCA 2X5XA 4OH1A 3W3AH 4EPYA 1KYIA 5K8IA 3GGDA 4EO9A 3WK8A 2A8YA 5F7OA 4G0UA 1TU3A 1NQWA 1NSFA 1UBOS 1M2VB 3P9RA 3D1VA 5FOVA 4ZDWA 4ZT5A 2IKSA 3CX7A 3TCNA 5IABA 5G0WA 4OAQA 1ECLA 3RYCB 2HWUA 4KFCA 1NM5C 1IZZA 3BMCA 3RHTA 3HCOA 4F85A 4HP8A 1XEAA 4EX6A 3KUCA 2VPIA 4CIAA 3EARA 1NZDA 3DLPX 3OF2A 5DULA 4GSKA 4DIOA 2VSNA 2CLFB 4JBNA 3L7MA 4NH0A 5BN1A 2X2EA 2IUSA 2DKOA 2XQFA 2NP7A 1ZJ4A 2WJYA 2ZR7A 1K6JA 5CFOA 3QUBA 1I24A 1ZVQA 3WKEA 1I7SB 1RNLA 2QORA 3PDIB 1DV1A 1B2RA 3LUKA 5AKKA 2TRSB 4RK1A 2PU7A 1TYCA 1EVZA 1YHYA 1Z7WA 5JI2E 1FA9A 2Y1OA 2Q1YA 3ZE7A 1Y6FA 4CTOA 3NYQA 3PVCA 3KPUA 4JYMA 3PWKA 1UKCA 3O1IC 3OCZA 3H83A 1LBTA 2WICA 1Z17A 1NBOA 1PNVA 2MYNA 3G5AA 3IVAA 1BDBA 1WVIA 2BRUC 2F1HA 1I7PA 4NFSA 5BQPA 3VOSA 3DTVA 4ND6A 2OG1A 2JFNA 1FP1D 1TI7A 1YAJA 3HSYA 3KSRA 1FX0A 3BJUA 1WUJS 1O6BA 4Z0HO 2G1PA 2Z83A 2YHSA 5GVRA 2YZ7A 1ZK4A 1Y4ZA 3EZXA 2P2YA 3FNQA 3VPSA 3DBVO 1T25A 4DPMA 4H7EA 1PVVA 1T0BA 3JV7A 3GJ7A 3KZMA 5F76A 4CI0B 4CT5A 4E11A 1N9ZA 1KOFA 3HFJA 3PFBA 1PD0A 2V5VA 2VAPA 1U0FA 3PCXA 1YDHA 4NCIA 3TDNA 3H18A 3UJAA 4RD3A 4ZI7A 1FDOA 1SRYA 4WLNA 4JLMA 4ALLA 4DMCA 3RABA 4RF5A 4F8JA 4YRDA 1A8SA 5EE1A 2XBUA 4DUYB 3B1VA 4IJWA 3M49A 1AK2A 4MULA 3JW8A 4PO1A 2RDMA 4QDOA 1FFBA 5D1HA 3TNFA 1TTTA 4RJTA 4IMPA 1DT5A 1RJWA 1XRLA 1Q7TA 1XZHA 2E4VA 2R47A 2W6ZA 2ZJ7A 2HPHA 3PFKA 3PJFA 2AXEA 4JQCA 4IV5A 4OCZA 5L45A 1GITA 1T0HB 3VNQA 1YGBA 1GRCA 4QULA 2EG5A 4GBJA 1JR4A 1XYVA 4Y6SA 4K46A 1JHVA 1UMDB 1PR5A 2GPAA 2P4UA 3ASVA 3FCAA 3L4SO 2J0UB 4QEKA 4AQDA 2I66A 4JLNA 3QFTA 2V4ZA 3H2SA 4BJHB 4C08A 1J0BA 4M0PA 2IKQA 4TLDA 1KDZA 3ZBTA 3TN7A 1U63A 3AFNA 1ABFA 4OPMA 4TKLA 4V38A 2MCFA 2GNPA 4YAFA 2C5SA 1G18A 4PC2A 4QPDA 1EVQA 1Q7EA 4K9OA 3DC7A 4P7BA 3WKCA 2HIGA 1M1XB 1FQKA 4C07A 2VTDA 1BD4A 1IYZA 2XGJA 4PBSA 4MV8A 3A27A 1GLVA 1AUOA 1RXSA 3JAWA 4CN8A 5CYPA 4Q00A 4XGIA 2PZEA 1WF3A 5BN3B 1D04A 4X91A 1JALA 3EX7C 2H51A 3UAGA 1SPXA 1LC3A 3IMGA 1LJLA 1NJ5A 4KQEA 4IX1A 4K03A 1AK1A 4LV5B 4M1EA 1JBKA 4AZ0A 3UJHA 4OX9Y 1R8QA 1DC6A 1LEHA 1K86A 1EJ6A 2QAGA 1U3WA 1N1MA 2Q9UA 4LDPA 3TLAA 3U5TA 4KO3S 5ALZA 3E7XA 3IAM1 5F9FA 4C03A 4QUJA 3L0OA 1AM4D 1TM5E 4H15A 5C5CA 3CTMA 4QKQA 4AKTA 2PUAA 1A5BB 4PYNA 2QHVA 2WJ6A 2Q9CA 3RC2A 1GUYA 2HU5A 3O8BA 3RIYA 2ODPA 1DG1G 1WDTA 1MJGA 3DO5A 3LH5A 1WB9A 1ZIXA 2JAHA 1U8YA 3ESQA 2FPRA 2A1TS 1E3TA 4M6WA 3FLAA 3REQA 2NZXA 1L5LA 1NQAO 1CNMA 2J07A 1EFVA 4OFWA 2WYHA 2Q27A 2W70A 4C6RA 1GU1A 2AMYA 5C9ZA 5KJCA 3FETA 5BXQC 4F9GA 1QCZA 2OHOA 1IZ9A 1FFSA 2PGIA 3D59A 3N7AA 4RLHA 1T4MA 1QSGA 5LYYA 2VYNA 1MAUA 1VE5A 3L46A 3PTAA 4YAWA 2PVPA 3AETA 1J39A 4NL4H 4CEHA 4ZVLA 4BFZA 1L5OA 1JN0A 1QH1B 3IUBA 5P8WA 4TLEA 2X8JB 2VSXA 4CKWB 2ZSFA 3AIOA 3KOOA 4M88A 2RMKA 1GEEA 2GYUA 4PWYA 2ZCVA 3ND6A 2NZVG 4D02A 4M46A 1Z73A 4B3GA 1VPTA 2YHIA 3EWIA 3FKSA 3KOYA 3OFKA 3HM2A 1PBNA 5CTJA 2YVKA 3D3JA 1Y9DA 4NULA 2DWPA 2AFIB 1N9GA 2RCYA 4V0KA 1J1ZA 2GN0A 3LRTA 2Z2ZA 4X8HA 2UYOA 1Z2NX 4LISA 4R68A 3OX3A 4FDLA 2DFTA 2IJGX 2NU7B 3CISA 5GY7A 5MGNA 2OPHA 5CDTA 3QRWA 2J8ZA 1E5QA 1PJBA 1GWNA 2ZI4A 4HZUB 3RUAA 4BQNA 3G9XA 2WK1A 3K7EA 1TVCA 1E61A 4JQYA 1M2OA 4A9AA 5F2OA 1WNTA 3RRMA 3HXLA 1YJAA 1P9RA 3L7AA 1NI5A 2X1VA 3RC7A 1R6UA 3ZHYA 4DNXA 4LV8B 1AOXA 3JQEA 4Q4LA 1ZD5A 2Y9PB 2XUOA 2IHYA 1IXYA 2Q3FA 2BDUA 4OI0A 1V1RA 4CKZA 3N6VA 3Q7QA 6GPBA 2M1XA 4XGRA 3TJMA 3M1LA 2P0LA 1S3GA 3CT6A 4NC9A 4RZSA 1BTOA 1GRRA 3C16C 5GONF 5JRDS 4IYJA 1NPYA 4B6QA 4V02A 3OOHA 4EX5A 3NRBA 4IEIA 4ZHSA 1KSGA 1ZNZA 1UFKA 1WDLA 3DMTC 4M99A 3GLIE 4YP0A 1HMYA 3PD7A 3EVZA 2WYWA 3F6SA 2X0DA 4PS1A 3AEXA 4ACAA 2I8CA 2PXCA 4YRAA 5JO0A 3D8UA 5LD2B 3WYEA 1U3FA 1HNXB 2W58A 2F1RA 2A9PA 2YXLA 3MMXA 3D7KA 3ESRA 1U0EA 1N0UA 2QRGA 3IPCA 3VC3A 4AJ4A 5DYTA 2I22A 1V7ZA 2WI8A 2HFJA 1ZH8A 1S2MA 3BK7A 1Q1AA 3QVMA 4MGYR 1GGHA 4EW1A 2UAGA 2VP9A 5I7VA 3U7QA 1U80A 5K7SA 4DV6B 2EFGA 2E5WA 2WE7A 3N8KA 4RK5A 4LIPD 3W4JA 1RQRA 3FVWA 5CM8B 1JQJC 2WIJA 2ZVJA 2WW8A 3NEAA 5ITWA 1JAHA 4V1CA 4PG4A 1FDSA 1HI9A 1OBFO 1SC9A 3QELA 2BGTA 2C31A 2A5LA 2W98A 4N5NA 4UNSA 2HDHA 4X61A 5FPQA 4ZVKA 1DG3A 5T4FA 4FM9A 4X1YA 2QLLA 3OJCA 2EZ4A 1WETA 4G2NA 2ZR9A 3D5TA 1YBMA 2PV7A 3MWFA 5FEUA 4DHWA 4DUZB 4O8CA 2X7XA 1ZJ5A 1U90A 1MO2A 1UDAA 4LGYA 3SF0A 1TQ6A 2A1IA 4J3FA 1QB7A 1OX4B 4Y9RA 3ZY3A 2RG7A 1O9BA 4DCMA 4YRNA 4XSGA 1CUFA 4IJQA 4CMBA 5COAA 1N3YA 4RA9A 4LTMA 4ZJYA 4EI8A 3DTNA 2EJBA 4AD8A 1XOIA 2GJSA 1A4UA 3FDIA 5DM2A 4MP8A 5JWRA 4RQUA 6LDHA 3T7TA 4ZKDA 1O94C 1JMVA 1HT3A 4ALJA 1W0JD 2NAFA 4NCJA 2VDMB 4DIFA 2ZT8A 1NN1A 4JWTA 1NHGA 1T9AA 2CUKA 4N3NA 1TPZA 2GAJA 2HGZA 4Q1DA 4AT1A 2YBEA 4LRSB 5BSMA 4HPWA 5IXJA 3K70D 1X2EA 4I6EA 4XUDA 1B0AA 4DYDA 1JHYA 2C3MA 5HF5A 3UF0A 4C0AC 3OOWA 1YIDA 2XVMA 4MVJP 3FOZA 4R8KA 1ODSA 3G17A 2I65A 4DNQA 2O7SA 4XCVA 4IIXA 1OVMA 3RVMA 1GQQA 2ZUTA 3ONVA 3SLKA 1XQ6A 2I1LA 4J4BA 4AK9A 4B80A 2XUDA 4CCAA 1T3ZA 3NZEA 1V6SA 2WA2A 4E33A 1XNQB 1ZUD1 1J5XA 1EK0A 1YQUA 3E5NA 4P73C 4HDMB 1F4LA 4X63A 1ICEA 4GL2A 4EJFA 1BH2A 4WKPA 4Y9SA 2P5UA 2I2WA 4MLPA 3ZHOA 1DXQA 2BFEA 1DVRA 1E5TA 1RFLA 4KXYA 4QRHA 1PDWA 4PYOA 2HCTA 4Q4AB 4UDYX 1YJ5A 2NVWA 4LY9A 3VQXA 2GEDA 2E5LB 3E8SA 4UAJA 5L6LB 2DBVO 1KDTA 3B1WA 2AKAB 4IRUB 4A3SA 1BIFA 4JU9A 1VJCA 1MO3A 4N48A 2IS6A 4MRRA 1LX6A 3OLQA 4RX1A 3WRWA 2GSDA 4RORA 5DNDA 2Q5LA 3O7MA 1A2QA 1SXHA 5L7YA 4KWHA 1FX0B 4YCUA 1GILA 4WY8A 1FTQA 2IXDA 4MQFA 5SY4A 2PMKA 3NDPA 1CUEA 1PQPA 3PNYA 4TLBA 3V55A 3JRNA 4R5HA 3WNBA 5DN6D 1XEFA 2IW1A 2JS7A 1XTSA 3A3PA 3I7FA 3AR3A 4KR6A 3HXUA 1BHQ1 2F55A 1QGYA 5DU2A 1A04A 3HA3A 5BY2A 1ISIA 2Y1CA 2QAIA 4UEJA 4GOOD 1AC5A 1VOTA 3QEBZ 2DFDA 1QOPB 4JDPA 5LA6B 3WKDA 5A5GA 2BMFA 4X1KA 3WLKX 4E7OA 2AOVA 2IUTA 3EW9A 4DWJA 1VXRA 2WC1A 1O97D 2DM6A 2WD8A 3FGPA 2Y1KA 2A0YA 2GCIA 3DF9A 3HR4A 4P3PA 2EBHX 4V3BA 5ANRB 5IULC 3JQDA 5IARA 4RHUA 2ZYWX 5BVHB 3IAXA 3RUDA 3X2FA 1KMHA 4B6PA 3KLPX 1MCZA 1ZICA 1UT8A 2KS6A 4GVXA 4IUBS 2ZPTX 1D2MA 2G63A 2JAXA 5AXBA 2X77A 4DRYA 3VPGA 3UYLA 4OP2A 1W36C 4IRMA 1U8UA 2QRNA 1XMSA 1I7QB 1N1DA 1X8LA 5HEKA 5JYDA 4HH3C 5CITA 4E70A 1JL3A 4N65A 4LNAA 3I45A 4U63A 2J3DA 4LHYA 4QODA 3LY8A 4KKVA 4OQ4A 3FNBA 2OBNA 3QEMA 1EG7A 1AKUA 2H5EA 3C8ZA 5JCOC 3I72A 4R9VA 1XL1A 1TUBB 4JGIA 2JH8A 5BRNA 3KYDA 1U6KA 3ZD7A 3VKGA 4GI2A 5LL6P 3E8XA 1QHEA 1CQJA 3AC0A 5BR4A 2O2GA 4O4HA 5L8VA 3FPSA 1C0PA 2RHQA 2VXBA 2I6SA 3OFJA 4TVKA 1G8PA 2RGNA 4FHGA 3S2SA 4EDHA 4LF8B 2YY7A 1EGVB 1N5KA 2XTAA 1U7PA 3H16A 1ETUA 3A5YA 2DHRA 3PWSA 3H5RA 3BWXA 4RWZA 4XASA 4UE6A 3L6RA 4ZT6A 4QECA 4H2XB 3L1UA 1HK7A 4FW8A 1KIFA 2A58A 3I04M 2G28A 1N6KA 1P6QA 4ZOBA 3UHJA 2Q49A 3W4IA 3CZMA 2IBSA 2ZKLA 2V0GA 1IZ0A 3GBPA 3P7MA 1YB3A 4PZAA 5F51A 3F6YA 4RZXA 3HTZA 2HSWA 5IXSA 3ICAA 1FDTA 3UMBA 4FE7A 3QXGA 4B17A 4B82A 2HNBA 5EQTA 5HBRA 2HNIA 3CLUD 3REUA 1X86B 1VYVA 1WXWA 4OXRA 3ZWYA 1AKRA 1ZCFA 2PG3A 4P33A 5F33A 4X3PA 1FXWA 3FUWA 3LCVB 4YJ2A 5GM2A 3LA8A 2FEPA 3LK7A 1S8AA 3EDOA 4I2NA 4KXLA 1U3CA 2J9GA 3QQPA 4MVXA 1XB2A 4GE0A 4PX5A 3WGJA 4AX8A 1EUCA 2JH9A 2OM6A 3VX4A 5KYXB 4ND4A 5C5EA 3I4FA 5I9NA 4TQFA 3JZFA 3GFFA 3AONB 3DD1A 3ECCA 4GAEA 1I4WA 4Z9YA 4M8NE 1OSNA 4D4HA 1NJ1A 3C4VA 3JD1A 3ZQUA 1C9KA 1XHFA 1L8LA 4GXTA 3WSTA 1E1RD 1XZAA 4LXYA 4MVJI 6Q21A 1VKOA 3RGLA 3OX1A 3TFWA 4XH9B 5DSXA 2GPNA 4W8OA 3G5LA 3VNUA 1XAIA 1Z7NA 2W2QA 4EHJA 2W0SA 4ER7A 4JYPA 2G08A 1PEDA 2FQ1A 2YJ6A 2P68A 4KQ9A 4OHBA 1VLLA 3MRVA 3B53X 3IA2A 4P71A 1XEWX 3WI7A 1AH2A 1CY7A 2HXGA 3KPVA 4C0QC 2WD7B 4U9UA 5M04A 2PRKA 4A73A 3U80A 1G3UA 2D0IA 1Z08A 4P0TA 5L3QB 3ZDBA 1NWCA 1WUIS 3HBNA 4MHOA 2CV0A 2PCLA 2IP1A 4R6XA 1U2GC 5CH5A 4TV8F 3MJFA 5IJWA 3VR2A 3EA0A 4Z4CA 1LRJA 3K3PA 3LRPA 4C29A 2NU8B 4EG1A 1L5HB 3V8EA 1BYIA 3UIEA 4QJBA 4F4IA 1OB2A 4MR7A 1G5FA 2G1AA 2HR1A 4GBGA 2EX0A 1ZNYA 2IBMA 3JQBA 5CXUA 1GZSA 5FOTA 5KAPA 4DUPA 3TG8A 4HAZA 4O4HF 3U7RA 3W5IA 3O8LA 1SVSA 4V2IA 4RUKA 4TSRA 4XTRA 1WZ2A 1VBFA 4AM8A 4NE2A 4RD1A 1FK8A 3N28A 3SYNA 4P38A 3ICCA 2JA1A 3R5TA 4AZVA 4OI4A 1SXGA 2VH1A 1A2OA 4JLPA 4PPGA 5EXDA 2QTRA 421PA 1DT3A 1NA5A 3LWZA 1IY2A 4BMDA 4OFBA 1OLSB 5IAGA 3ZGOA 5K8LA 1USYC 2LD4A 2PVCA 2PGOA 3CSUA 3OUTA 4HATA 4UXJA 1UKEA 1XEWY 1VLVA 4Q9HA 2F3QA 3VR3A 3IIIA 1D8TA 4B73A 4HN9A 2O2SA 3WBFA 1NC3A 3DHNA 4PANA 5AW9A 3A7AA 2XIJA 4XX0A 2W4MA 4HV4A 4FR0A 4IY1A 1I33A 5AWFC 4PNEA 1WU7A 1E6MA 2DB3A 3FCYA 1GG5A 3U4QB 1D0IA 4GMDA 4V0SA 2ZR8A 2RKOA 3LBIA 1M0TA 1YA8A 4WUVA 221PA 2P2LA 1WBJB 4F4FA 1GNRA 2G17A 5ECYA 1IXSB 3U1BA 3A11A 5A06A 2BKUA 4YPOA 2B9EA 5D3QA 4FCCA 3RWBA 4HXYA 4JP1A 2J59A 4HQLA 2D5LA 3NUQA 4UHBA 1LSUA 3QF4B 3WIOA 4AMUA 5EJ5A 1IBRA 3QZUA 2DZCA 1CIVA 1JW9B 1LXCA 3CUKA 2QKYA 2QJWA 4PICA 4BU0A 4CL8A 4CM9A 3R20A 3R5XA 5BYAA 2R7MA 1P4GA 3UJNA 1P9WA 4XQEA 4G1CA 1GIAA 1NULA 1XKTA 4G85A 1HEIA 3BGWA 5TS2A 2A84A 1NVMB 2Q4RA 3EQ6A 3I6BA 4QPPA 2IOQA 2NU9A 1EP2B 5HG0A 3RHFA 4Q4AA 4AJKA 2OHVA 4K9DA 4B75A 3CVVA 4CMKA 4JI3B 4D98A 5JQGA 5K3BA 1O94A 3LHFA 5F2NA 4TL6A 5IX8A 2PPVA 5JBIA 3H11A 4MQ5A 5C8VA 5TQJA 5JHHB 4YWHA 5K3DA 3B8EA 1KAEA 5GM1A 5HUJA 3BFPA 1J4AA 1OV6A 4TT3D 3FDFA 2HUNA 3AR8A 4C0JA 2GVDC 2B0CA 3PTZA 4B3SB 3KQOA 2PL3A 1YS4A 2OBYA 3BB4A 3CLSC 3KHKA 4MS3B 4G4SP 1FRNA 1KI6A 1WQ1R 4MWOA 1MB4A 1LDEA 1T5HX 1HT2E 3PICA 4O4JA 5L3RA 4E4TA 1CUBA 4AY5A 5E9JA 1DMRA 1I7NA 4P83A 1T2UA 3ROZA 3MT9A 4IXMA 4F2HA 5DI3B 4LNHA 3IHKA 1KEEB 3LKVA 5J43A 1EXVA 1OXTA 1IXZA 1PSDA 1WAMA 2LUOA 1P8AA 3KKOA 5FYQA 4EVIA 4DJ5X 4LJLA 3F74A 4LYDA 2WIBA 3N3AC 1GTRA 3CV3A 1RYYA 2J3QA 2FRDC 5HKLA 1UPCA 4G67A 3IKVA 1VLMA 1W2HA 2IK8A 3BMQB 2G8NA 3OT5A 5K0GA 3KR2A 4QE3A 1O95C 1LWNA 2CK3A 1CRZA 1EINA 4EJMA 5CT9A 4LFAB 1IB6A 4X6LA 3KVVA 3C0KA 2CHGA 4GRAA 4A0GA 1XO1A 5CVEA 4BFCA 4C4AA 4EB0A 3PEVA 4UDNA 3U9SA 1R6XA 3DV0A 1CSEE 1LV8A 2AQKA 1AKNA 4O4IB 1ZI9A 1JFTA 3HKBB 5F98A 1TYAE 5CJJA 4ETNA 1MX1A 5A2QA 1EFCA 2FMIA 3TZKA 2GRJA 3K0AB 3BWYA 4HJRA 3EQ7A 1ONNA 2R8PA 3UC9A 4BKPA 1UOEA 2IPLA 4DXHA 4EY4A 1U5BA 3OOYA 1Y1RA 2H1WA 3QWHA 1HOXA 3I0MA 4RVCA 5EZ5A 2VKTA 1SOWA 1YQGA 2JJ2A 3OHPA 6AT1A 1C3JA 5LU9A 1ZD9A 3CSSA 4LGMA 4DA8A 4NR0A 1PIWA 1GCOA 3GW8A 3A9TA 3PB3A 3KZOA 3S5UA 3K05A 2VT2A 4BJ5A 4CTNA 2WWYA 2E18A 3R74A 3VSCA 5HIJA 1ZD2P 3DGEC 3EULA 3FJYA 5ELOA 2O1WA 4NMXB 1YXMA 3ZE8A 1VCNA 2UV8A 3KZNA 3KVNA 2Y05A 4HDRA 1DJNA 3M1YA 1WSBA 2QD3A 3HB0A 1X19A 4WCFB 1HE3A 4BO1A 1P5RA 3ZE2B 1QP7A 1WW3A 4NJOA 4R6WA 5HQ3A 1NAIA 4X44A 4MI1A 2JEZA 1KI3A 1EHYA 3D0OA 3BSFA 3MFQA 2PKQO 3K1AB 5ERXA 4Q9NA 1FS4A 2J9RA 3LAWA 3TRJA 3C3JA 1C8VB 2OLKA 4ESVA 1OILA 2G9RA 4CUKA 1DMSA 4XPZA 4KOAA 2Z1DA 5FAXA 1IQRA 2O1XA 1YJBA 2QXTA 4UHEA 3ENKA 1S2NA 2Z8XA 4QOGA 4WNCA 4CVNA 3FIJA 1YKGA 1OY1A 2HMUA 1ULAA 1U3VA 1E58A 2PS1A 3DL2A 3L01A 4G84A 1ONSA 5DGDA 5C3UA 1ZZEA 3D4OA 3RU3A 4CI9A 2GK4A 1H6BA 4FMCF 3E9YA 2AHOA 5IAKA 5JATA 1ISMA 3WMFA 1OI7A 1GAXA 3KYJB 1RRPA 4PYIA 4RDXA 3OJEA 1XLTA 3FGZA 3LSYA 4K9SA 4PZDA 2BH2A 5ALSA 1LDMA 3KLBA 2ZXFA 4YMSA 5AJVB 3ZZ1A 3EXHA 3NQ41 3L1AA 1ZIOA 2H3EA 3QLJA 3R3JA 1RVV1 4CG3A 5A9SB 4W5TA 4M3NA 2M1ZA 4W6ZA 1ZITA 4F5DA 5IHXA 2R5NA 5JJCA 1CEEA 1U7HA 1V8DA 5KC8A 4AUEA 1WZUA 4YT4A 2I91A 1IIBA 3FZYA 1TGVA 2E9SA 3CNHA 2IY8A 3BT7A 4YREA 4O1IA 1BQ4A 1W85B 2FPGB 2VYND 3E22B 5FFFA 5KTTA 4MRSA 3UG6A 4D4JA 3U3MA 1ZR4A 4P22A 1CZUA 3IP9A 4H2TA 4MWGA 4Y2VA 4A6XA 4ZO9A 2ZPAA 3KQTA 4E6PA 4FXPA 3ZKWA 4JB0A 3WZMA 1CUZA 4J03A 3W5UA 4X64B 3GU3A 4C7XA 5EHNA 5HTKA 2XUPA 2CF5A 4Y6OA 1IHUA 2GGSA 3COJA 2VZ0A 4JIGA 5JV5A 3F3KA 4B3CA 2F90A 4M37A 4X8LA 1DPGA 3HUUA 3SQNA 3DW3X 4XTWA 2JJ1A 5AVZA 2C98A 3T3MB 1NKVA 2QHSA 4RTSA 3LO8A 5G3ZA 4H2UA 2N9UA 4NU0A 1QM5A 5L51A 3UPUA 3EUWA 1VGQA 4C3VA 4CG1A 1QGDA 4JL6A 5AJZA 3KZXA 1EWRA 2GD0A 2IU4A 3BCUA 3R44A 3AXSA 4KLZA 5MN6A 1E2PA 5KSPA 1XLWA 3B51X 1UJCA 1KE1A 3ZZUA 2D4AA 4UTOA 5BUQA 1DBSA 4V0ME 4H2WA 1VIYA 3SVZA 1SESA 1A8IA 3DMGA 4G23A 1R9JA 1ISHA 2ECKA 1E0SA 3MAAC 1SUBA 4MUIA 5EIHA 2XE8A 2XKBA 3LCCA 2WQ7A 3WV4A 1PGNA 2QRHA 1JPNA 4R5MA 5AR1A 5GVSA 3E18A 1UBHS 3MBOA 4U6SA 3DP9A 3NANA 3OD5A 4OMCA 4NRDA 4QICA 1PZFA 1EEHA 4OK6A 1WMAA 4HBZA 2XNHA 3KU4A 3FHLA 3WWYA 3W2GA 4EWLA 5JW6A 4PRYA 3KTOA 1U0SY 1NVVQ 3R7WA 4JVOA 1IBCA 5K4HA 5DHUA 4TLAA 1S2DA 3AVYA 1L5FA 4Q9LA 5K0TA 2PZGA 3CF4A 3D7LA 3HFSA 3Q98A 1BCRA 1JEEA 3UJDA 2CW5A 3P32A 5LQCA 1VE3A 3NDRA 2XYVA 3W8FA 1EVYA 2J4FA 1SK9A 4LZNA 1JG2A 4FYIA 4PIMA 1IBMB 3MUFA 2X0FA 5K3AA 2PBZA 4WBSA 3KHSA 1Q1ZA 3KXDA 4FK8A 4MARA 1LF0A 1NWHA 1GUZA 5KHOC 4R7GA 1NMYA 2VPXA 1ENYA 3PGKA 4TYWA 3BE4A 2A3RA 3AHDA 3MS2A 4JLJA 5CFNA 2VSFA 1K5DA 3ZQJA 4J0EA 1GKIA 1EP9A 1CDOA 1QDLB 2VYVD 3ZIUA 1CDEA 3V1TC 2AN3A 2O20A 5LXTB 3I09A 4NV1A 2FUG1 1RYMA 3V8MA 1H85A 1KEPA 4MV7A 4RQAA 1TLFA 3TLJA 2V3WA 2JLWA 3TTYA 2I55A 1JA9A 3FZEA 3L9WA 3QOXA 1WUTA 3EGEA 2A9VA 1BMQA 2ZWOA 4P1ZA 3VU9A 2WSBA 2ZM5A 3UB3A 4MGKR 5JSFA 3HKEA 5EUBA 1SU7A 3P9KA 3BA1A 3DBOB 3L8CA 3QX8A 4YP1A 3UJPA 5AW6A 1GN9A 4OB6A 4Q3BA 5F1PA 4E15A 4ETMA 1PJRA 4CMAA 4M1SA 4W5RA 2FMTA 1BVHA 2C78A 4X8MA 5B3AA 3NIBA 3NWPA 3WL7A 1THMA 2PKYX 2HJVA 4RHCA 1KOLA 2JD0A 1JHZA 1J0DA 2Z57A 3W2HA 3ZJYA 2L82A 1SHTX 2G4VA 3C7DB 3EISA 4LK2A 3QKSA 3IVCA 1UFRA 1X8KA 1WPGA 4ZI7F 1N6PA 2Y8EA 2AN9A 1ENOA 2OHJA 3PCRB 4J4TA 4CW7A 1D2CA 2DQ0A 3B6MA 2XE6A 5JSZA 5CP8A 2B5OA 3W90A 2IS2A 3LQ4A 1SCQA 1RBYA 2CE7A 4K81B 2CNWD 2PUCA 3A1UA 2RAUA 4QVKA 2R11A 1N77A 3UJ3X 2IYLD 2GAFA 4NXMB 1W94A 3ZU5A 3O38A 4Z7QB 2WHXA 1USWA 4BN4A 5LP6F 1Z34A 2QE7A 5KOHA 4QU5A 5K3CA 4B4WA 3LLUA 1FBNA 1K3UB 1XTUA 2IDKA 1JDJA 3U7EB 4BQSA 1LK7A 3WDKA 2WDZA 3KDSE 4MKIA 3IDSA 3D6AA 3CMMA 4FB4A 4LJRA 3SZRA 1QGAA 1C7QA 5F4ZA 2C96A 3CNNA 3HXOA 1R2QA 4L2IB 3D2LA 1L7EA 3PIIA 3TEGA 2DYKA 3BG5A 1PR9A 3QBTA 2WYIA 4FHEA 1L4KA 2QPAA 1G8HA 2N47A 2CZQA 3TW8B 4R7ZA 1E2QA 1RIIA 2ZBFA 4FYHA 2QD1A 1YRBA 4RPHA 3WJAA 10MHA 4JQOA 3ROGA 2X2FA 1COZA 1O95A 2ONYA 3LIIA 1VMIA 3AGQA 3O1LA 4AJIA 5C32A 2FG5A 1RYHA 3FF4A 4HLNA 4HQ0A 4AKSA 3VHLB 5CHEA 4YB8A 5G1PA 1Y6QA 4G97A 4IXNA 1E4EA 1J0CA 3LIPA 4HJXA 5HX7A 3FA2A 4KQWA 5L4LA 2CLIB 2C4UA 2QP3A 4BS9A 9LDTA 3S4YA 4NZ9A 2H2AA 2HJRA 1DADA 5FP0A 4ROTA 1UODA 2PH1A 4C20A 2C5AA 2BEUA 2V74B 4CM8B 1SC1A 2WNHA 1FMCA 1RJ9B 1QHGA 1W0KD 1YBAA 3WGLA 3A31A 5DN6A 2CB9A 1FRVA 2O0MA 3KALA 3N7UA 3S1SA 3IP3A 3JWPA 3KPYA 4HEQA 2W90A 4UUMA 4Y1RB 4YCNA 3KQNA 4OBXA 2ZI7A 3DGFC 3R0QA 1CCWA 3FGOA 4CTKA 3N1UA 4UM7A 4A92A 1D07A 3BE8A 2WF7A 4I3FA 4UM9B 4RTKA 3ST7A 1SA0B 3B13B 2OCLA 2WD9A 4RZ2A 3BZUA 3QHAA 4ON9A 2V7TA 4PZYA 4CMJA 2ZEJA 3GFTA 3ISJA 4R0NA 4DAEA 1Y1TA 1QKJA 1U1EA 4LE1A 2G77B 3GRPA 4NVRA 2H1SA 2ZIXB 2NSJA 4ND8B 1JKXA 3DBIA 2OXRA 1JQBA 4I19A 4J29A 4LXTA 3BFVA 4OLJA 4WERA 2HSZA 3T35A 1OI4A 1PR6A 2EERA 5EMLA 2IW3A 1YIAA 2VP5A 2HWWA 4JLDA 2IXBA 4MS1B 4ASUD 3U16A 5IHPA 3PQ5A 3SIRA 5C7OO 5HZMA 3OIUA 3PENA 3PKIA 1JH8A 3F8SA 4RK7A 3RVKA 1T6NA 4O2BA 5BN5A 2DFLA 2X4DA 3TEFA 1E66A 2F8MA 4B84A 4YT2A 2OCXA 12ASA 5IFLA 5T6BA 3GX1A 3M2TA 4MITA 2RJOA 1JJCA 4J0JA 3R9IA 2LKDA 2WFAA 3RV4A 1NT4A 4J0CA 3HCPA 3FFTA 3OY2A 2F1JA 3LW8A 4LRTB 2C92A 3KTAA 1FS6A 3NOVA 4HN2A 3FJOA 4I1SA 4W8GA 5M3BA 2IZOA 1TD1A 1WEHA 4OK5A 2DBQA 3C14C 1UFOA 1DKPA 2FMFA 1Y82A 2Y27A 3FNFA 3IAHA 2IYOA 3SEFA 4Z3DA 4EHAA 3W6NA 1VIDA 3DEYX 2QT0A 4C14A 2QXUA 4IQ4A 5TIIA 5K0JA 1IVYA 3SC2B 3GELA 2CDRA 4M8KA 3ZNOA 4ZU3A 4P3XA 1T2AA 4ZD6A 4ZVRA 5C1BA 5HE8A 3EC7A 1NIPA 1ZX1A 1IN8A 4BOYA 4AF6A 4D6PA 5A4FS 1HSZA 3SJZA 1QMPA 4F12A 3WS7A 1SO8A 3PXGA 1RJGA 4HWRA 4HQOA 3W5BA 2OCBA 2CSUA 4OHRA 2NP6A 3AOEA 3CMCO 2AUMA 2HBZA 4FGSA 1OB5A 3S2FA 3O8CA 2GN6A 1XI2A 4OHYA 4FDUA 3O2QB 5JI3E 4N76A 3HYCA 2C3OA 1YCFA 4XUEA 1QTRA 5SZJA 1M83A 2F9LA 3BFJA 3CEJA 1R8XA 1E2MA 4Q7KA 3AOEC 2AOWA 2JFFA 4TKVB 4L0MA 4YJ3B 3EQ8A 1DL5A 3GGPA 4XVRA 3RTAA 3DSRA 1WE2A 3ZX5A 4Q1CA 4U6NA 4DIKA 4UM5A 3K2BA 2PLWA 3CTPA 5G02A 2HA5A 1OBVA 1N8NA 1PJ8A 4HZIA 4OGLA 2PUBA 5J2TF 3GYBA 4FYMA 4W6QA 3ERRA 5IZCC 1JJCB 5K0SA 1DUVG 3N6RA 1F9AA 2A33A 2X8LA 1CJMA 2QR5A 5P21A 4ERXA 3JD3A 2VO1A 3SC3A 5BQXA 4ZZIA 1NW5A 2GF0A 2Z30A 3DMRA 2DKFA 2VPZA 4QPZA 3VZCA 4MW9A 3N8DA 1Q95A 3GJTA 3OU6A 3PRKE 3AIMA 4LYEA 1CYDA 1HXDA 1WZIA 4L78A 5IXYA 3I5YA 4DM4A 2XMBA 3SBDA 3PJDA 1H65A 5KQRA 2ECQA 1KC3A 4FNAA 4KWEA 1MUUA 1GZ4A 2CL7X 5CA1A 5JDIA 1FTGA 4HGQA 3G0DA 3MHTA 5CNMA 1ENZA 3L4GB 1GQYA 11ASA 1LPMA 1UBFA 3IURA 3KKPA 3P9IA 4WCFA 3UTCA 2HXYA 1R6BX 1XZGA 1Z82A 2HPZA 1FZTA 3W05A 4HDOB 1G2PA 3SC6A 4P3NA 2X76A 1GPMA 1Y8AA 3U4QA 1YR2A 4L16A 2P4HX 3A32A 1GPWB 1ZONA 3D54D 3U3RA 1SG6A 2XDAA 3PDIA 5HVNA 2A5FA 2RIPA 3SF8B 1L8QA 2OVFA 3WQRA 2Y1EA 2P1RA 3G9TA 4XU2A 1RC0A 3L8ZA 1YRLA 4MZXA 5IH3A 3UW1A 3ZS8A 5E8JA 4N47A 3JR7A 1F2DA 4AZWA 1ULZA 1AN9A 2JHFA 2EZ9A 2HU8A 4TXJA 4MLDA 1I6LA 2ID8A 2QROA 2R1ZA 4H31A 4WLVA 2OAP1 3TR0A 1UPXA 1SEVA 4U7PB 1VHDA 3DPSA 1ZOSA 4XQ9A 5THQA 4A6EA 4A2QA 2R1TB 3F6PA 4I5GA 4QBKA 1H66A 1VRVA 2UZ0A 5EE9A 3ORQA 4AN0A 1L7NA 3ZPXA 1DAFA 3LJKA 5I8PA 1B41A 4J0QA 1MRZA 1KBZA 2P6MA 1TU4A 2HY7A 4MGEA 2ZE6A 3PUJA 1GFWA 2QVGA 3PX3A 2WT9A 4YJFB 2CYAA 4MVJG 1P5JA 4EVRA 2ODRD 1CKEA 1N2JA 1K7EB 2W2LA 4X41A 4OYLA 1L1FA 4LVUA 1N78A 3RW9A 2YINC 3KQUA 1X55A 1WP9A 1Z8NA 3H65A 2I6XA 3WHPA 1GRQA 2MSDB 2NGRA 3D8TA 5TV2A 5TGZA 3RANA 1E3QA 2OFXA 1BGXT 1JSLA 4QDKA 3SHFA 3W78A 3A1SA 1RRKA 2X6RA 3RSSA 2JLYA 2OAEA 4MTLA 3ADOA 3TD6A 4FN4A 4Q34A 4BX3A 3RYIA 3N70A 3GGJA 1GPDG 5FI0B 2IODA 1VB3A 4I6GA 2ZR2A 4L74A 4C1NA 1P5ZB 1DC7A 4HAXA 5MF6A 3QE9Y 1O0CA 3A1DA 1E59A 1JYSA 5DI3A 2XPCA 4UZEA 4I8XA 2HBRA 3L6EA 4IGKA 1J07A 2CXNA 2A0WA 3I5XA 4BLRA 3ZV7A 2E6UX 3ND9A 1FUEA 2YL2A 4NYJQ 3WLHA 3WLAA 2F3TA 4WZAB 3AUKA 4LVJA 1CBUA 1QUEA 2ETXA 5EZSA 1SR8A 1JQLB 3DVQX 4RKFA 1E2BA 3E9DA 5LPNA 4QOJA 5AI4A 4DZZA 4U9HS 4KCGA 1RI4A 3P27A 4JL5A 4MYTA 3MILA 4DIDA 1G3QA 1IWOA 5MFZA 4PN7A 1V4VA 2VT6A 2Z9DA 2WT4A 1HE4A 3DL4A 5LOVB 4AKIA 1HPLA 1L7AA 2CXUA 1KP3A 3KKNA 2A8EA 2G4LA 2NXJA 3W3AA 4G1MB 4IDOA 2KBFA 4PLWA 3W2EA 3WMRA 4C0WA 5DP1A 4CV1A 1V1MA 4E5UA 3AZPA 1XDGA 3FD8A 1P4HA 1XZDA 2OO5C 3BKWA 1JKJA 4RIFA 3VHRA 3VNAA 2PH7A 3NHKA 4XI9A 1JNYA 4QVIA 2C8JA 2WJPA 1S3FA 2B25A 1Z5WA 2NM0A 3DBHB 1LK5A 1T34A 1DNPA 2RH8A 3UV3A 5DJ5A 2ZJFA 4JGGA 3EGCA 1UP7A 2E1HA 1I2MA 4H3KB 5CB6A 3K4QA 4ABYA 2OZEA 1PFYA 3IIJA 4R8SA 4RETA 2ZVQX 1SA0A 5GINE 1Y1KE 3STTA 2O5CA 1RD4A 2A9KA 2PWZA 3C87A 1CJCA 2GMWA 3FUCA 121PA 2EKZA 3F5MA 3AO0B 4JJZA 4KC0A 5AFSA 1P2GA 1SJ9A 3NNNA 5FL7D 3B5IA 5B4VA 1SB9A 4L15A 5IZ4A 3T3OA 4MW0A 2V4UA 3IS3A 3A1FA 2ZJ8A 5CT8A 1QH8B 3RRXA 2Z5LA 4R2LA 5KU1A 1GARA 3GJZA 3ODGA 4G41A 3IRVA 2QL6A 4LF6B 4RMIA 2QUHA 2VUSA 3NOOA 1L7XA 4PR0A 2PQMA 2XNJA 4WNYA 5BSFA 1HYBA 3DZKA 3QPBA 2WHRA 1OX5A 2BC9A 2ZRFA 1Z7GA 5HJ5A 2YW2A 5G1NA 4QELA 1VE1A 2M98A 3GLIA 1P74A 3HDQA 3P2EA 1LU9A 1L4BA 5CW1A 3HP1A 3MNFA 2IV3A 2O2EA 1QWSA 2VT3A 3A0RB 3TZ6A 2RC5A 3E1KA 4C2AA 4QTYA 4GR5A 1GGEA 3KC2A 1DTWB 2D8AA 2DCUA 1JDSA 2FR8A 2ZROA 1AMUA 5LMNB 4YASA 1B7YB 1IDOA 2LRHA 3X1XA 2PD6A 4L5CA 4D9HA 2IXFA 3DXYA 2QVZX 3HNOA 5A4MS 1FP2A 2EWNA 4BNJA 2WQZA 3T5AA 3QEKA 2ATEA 1C1XB 3ZUGA 2WAXA 3FYUC 1NN5A 2W22A 1ZA1A 3LXRA 4DMGA 3EIFA 2GDZA 3LWBA 1N9KA 3M4QA 2P3OA 3RAGA 1YDMA 1IQPA 4Z2AA 4XD7A 1VFPA 4AWXA 3KQLA 1M6EX 3ASYA 4LYAA 4OJYA 4U7TB 4ZOCA 2VQEB 2EBFX 1OAOC 5AO9A 3VDMA 1E3DA 2BP7B 4U5XA 1Y8QB 2E5FA 5KTKA 3H87A 4OJQA 1PT8A 2QX7A 1BC5A 3SAJA 2NV0A 1Z4LA 3BJZA 3FJPA 1ZNXA 4BV9A 1P19A 1V4NA 3S7TA 1X7ZB 5K1ZA 4UQLA 2C82A 3HXXA 1K2VN 3MK31 4C0SA 2CLDX 2HMWA 4X7PA 8AT1A 3H6KA 4BGUA 5HCNA 1MEEA 1XDWA 5AW7A 3GN1A 3LPAA 4IGIA 4ZI3A 5JS6A 4YDRA 1JPVA 1GGJA 3L7DA 3CVWA 3L7YA 1KK2A 4Y9TA 1OXBB 2LCFA 2CXXA 4B3HA 3BRQA 4OBEA 1KMNA 1RRMA 1W87A 1Y6GA 4CKXA 1XWIA 4FZ5A 5C37A 1J06A 1BQ3A 2JGNA 2BFEB 2FSIA 4TZ0A 1MC5A 5E6UB 3ISTA 2C07A 1GT91 3V9AA 4TVYA 2ERXA 2R6GA 3F9RA 3HKDA 3NHMA 1Q5PA 2XVZA 1KQOA 1CUUA 1K88A 1XZCA 4II7A 5FBVB 1YQTA 2XOEA 2WIKA 2FN4A 3INGA 5B5SA 2AI2A 2ZLBA 4XYBA 2X0EA 2Q7HA 4BUJA 2WTBA 4E7PA 3GPLA 4YVFA 4YN3A 4KSYA 1J56A 1JFFB 4BNMA 5I7AA 3BFXA 4HH1A 3TQQA 5IKPA 3SIPA 2IYQA 3EXIB 3F5QA 3ZHBA 1E6WA 2KW5A 4KRFA 1E77A 1DCTA 4KE6A 4RTPA 3D43A 5KHAA 1SWVA 5H68A 3JQGB 2BKVA 5AW2A 3WKAA 1RHUA 1KI7A 3P9YA 1L5RA 5HRUA 2BUAA 5F4BA 1EHCA 1YJXA 2G9VA 4M54A 4RHYA 1F8FA 2EEPA 4FJ0A 2VBGA 4P5DA 1WBDA 5H1YA 2W2KA 4DLXA 3GDWA 5CXSA 1BCRB 5AKEA 5K0BA 4ZQFA 1SKAA 3O94A 2ZYTX 3WHLA 3ZV6A 4C4PA 4EGCB 4ZVMA 2BHNA 2CF6A 5JANA 2FGKA 1L4UA 4YRKA 1TZ2A 5EN4A 3T3NA 2Q5QA 2HUPA 3HA5A 2IVFA 5C1PA 4ZJUA 1ECCA 1WU8A 2O6LA 1XFDA 3KXLA 4DNOA 1K97A 3OZVA 1YFTA 1J2YA 3TQRA 3PFWO 1S2OA 1ZSYA 3KJGA 4QPJC 5TEVA 1C3OB 4WMLA 2W00A 4RSRA 5ULLA 3ZVKA 1ADBA 1Q21A 1V6CA 4CLXA 4FBMA 2AFVA 2DU5A 4WCFC 3TB6A 3GRYA 2CVQA 1IHOA 2XMDA 4RQTA 3WY9A 1GZHB 2HHCA 2ZIVB 3NKFA 3A7UA 4L5IA 4L5BA 4UATA 1YZTA 5DHQA 3FMPB 4XJSA 3RF6A 4CMEA 1RXVA 3DYIA 4TWZA 1RQXA 3WQHA 2IYXA 1EFPB 1A4RA 2LVBA 5ALVA 4TMYA 2GVNA 4GUAA 5CBKA 4WXYB 3C6KA 3ZIAA 3WKBA 4UBMA 5KTNA 4K7JA 5TS3A 4BN0A 4J0FA 4H7IA 2Q6VA 2XXAA 2JBHA 4KK4A 5AK5A 3FMGA 3PC7A 1XPOA 3B1JA 4R01A 2XCLA 5EEHA 1SCIA 4L4RA 4EUFA 4MB2A 3C5HA 4HWGA 1WWKA 1N5JA 2OKGA 4WACA 3BL6A 5TGDA 2Z0MA 5ITVA 5KWIA 4IVQA 3OZCA 2GZ3A 4YQYA 3JS5A 1PRYA 1W8IA 1WNFA 4HAIA 4S1PA 5ARCA 3RVPA 2CJYA 3TZQA 1IPEA 4BNGA 4C6TB 5L6MB 1IMOA 3T3DA 4XQCA 4QUKA 2NSHA 3FB4A 3UKDA 2J0SA 3PXAA 3BIXA 4BNDA 3O2JA 2NWQA 3RUIA 1GSOA 1K08A 3T0FA 4II3A 2ONKA 1H1DA 1US8B 1XU9A 3EVFA 3IVGA 3H9JA 3NO4A 3ZCSA 3IIKA 3OMLA 5BMVA 2H11A 2VJNA 4K9KA 4YFVA 4HDAA 4ERNA 2XCTB 1STOA 3SEQA 4M49A 4GR4A 3LY7A 2PY6A 1GGKA 2Q29A 1S4MA 3C3KA 2ZQZA 1Y7PA 3L7BA 4CPDA 3O8OB 1DJLA 3U44A 4KO1S 4UBIA 3GR6A 2FRVA 1MLDA 3JWGA 3RODA 4DQVA 2OD2A 2CNKA 3CKMA 3PVZA 3NU1A 1W0JA 2C94A 1M6WA 4WECA 1TD9A 3IPLA 4RIHA 4D96A 1MB2A 1WZCA 3TQCA 3LT5A 3QO7A 2C3YA 3NASA 4QDTA 5M34A 4FYXA 3NWBA 3U44B 1LA2A 5DNWA 1E1CB 2FK8A 1PNTA 4RMGA 4ID9A 5AOBA 4FSXA 1B1CA 3GYGA 1A97A 4IKOA 2RHGB 1Z6AA 2Z1MA 4BC1A 4UVIA 1I6WA 2NN3C 2FFHA 3KT8A 1MTOA 2B6NA 2WHYA 3NBZC 2WWVD 1XTRA 5K09A 3B6KA 2HF8A 1XZNA 3ZHUA 1GL7A 4PC6A 4Y6LA 2YJNA 1N6IA 3Q8XB 3UA3A 4UMEA 2XXJA 3JYNA 4B7AA 3QX7A 3HYLA 1OZAA 1NQTA 4HAUA 2XA2A 1D1QA 4R3UC 5KNNA 2HPVA 1T1JA 2FW9A 2BTQB 2Q2OA 2CXRA 4OI1A 2JI9A 5FYDA 3QUSA 1X1SA 3WLQA 4YMVA 5JWOA 5A5DA 4INAA 4IGEA 3DOJA 2HW8A 4C21A 1K0UA 4RAOA 4A6DA 1WB6A 3L40A 4RV4A 3U4GA 4DN6A 2V9CA 4UCQA 1AA9A 4D9GA 2PMBA 3U48A 1K4MA 2OYSA 2YIJA 3AF5A 3GUZA 1SZDA 3JY6A 3M82A 4H1WA 2FPWA 1W4BA 3MQZA 2LZ0A 4WFKA 2HCJB 1UFQA 1USUA 2OFOA 2PBFA 4HWTA 1CY8A 1UZNA 4YJKA 3ABOB 5FL3A 2J31A 3H1PA 2DUNA 2ZB2A 3BEDA 1Y1LA 4H0FA 2PX5A 2EP8A 2D5CA 4ZVUA 3OTWA 4JR0A 3QW2A 4OD0A 2DUUA 5TNXA 5HOEA 3ZWOA 1I30A 4R8LA 2Z2IA 3E03A 4CUZA 5LBUA 4HNUA 2JCVA 1ZH4A 2RHHA 3HKBA 3M3HA 5B3JC 4UFNA 3TTSA 5K20A 1LSJA 1TYEB 3CX4A 3UAXA 1BJTA 4RA6B 2PZLA 1SMKA 3N2EA 2CT8A 4RANA 1Y8QA 1E2FA 5IJ0B 4TMTA 1N4DA 1AKEA 3AIKA 3AR6A 4C22A 1PJAA 2OILA 4LSZA 4HLCA 1RQPA 2XYQA 3RAPR 2R1UA 3VOTA 3C3WA 2V6JA 4C4XA 4EB3A 2WP0A 3Q15C 4MKZA 1JJVA 4CKYA 2VYVA 2WUWE 3K2EA 3NDJA 1L4YA 1B3RA 4Q24A 2ECOA 1G20A 1W96A 4KH1A 1BYUA 3IQFA 5AVQA 1VPDA 2GASA 5FOQA 4C7VA 3I62A 2QDXA 2YWEA 2AR9A 4TWIA 4BEBA 4U2FA 1PYGA 1ESZA 5CPBA 4DPKA 2AMCB 3O75A 4I1PA 3K35A 1TM3E 5FD8A 1FSSA 2Y1FA 4CLOB 1FFAA 3OAAD 4DW8A 1OE0A 4OFXA 1P1FA 1VJ5A 1X7XA 2GCOA 3NYIA 3FPAA 2XOKA 1HMPA 3QYPA 4JYCA 3RD5A 3TAHA 2O8DB 4N49A 4UEWA 4EUKA 3H13A 1GAQA 2K2WA 5KNDA 1OAOA 3FWHA 1JLKA 2GN2A 4WKOA 3AJRA 4Z49A 3C4JA 1OZ0A 2P9JA 1DWUA 1LI7A 3SSOA 1P75A 3DS8A 1K6MA 1SUFA 3G2JA 1K7SN 2NO1A 2VLBA 3OFND 4FKMA 4LCEA 5EIBD 4JOBA 3R7FA 4MDEA 3N2YA 4DQKA 1PV4A 4H7JA 1NDHA 4MW1A 1L4GA 3HVUA 2C58A 3ENQA 1AQLA 3IAAA 4JK3A 4R54A 4WVFA 1ZGAA 1VJRA 2W2MA 1F8YA 4PYRA 4WZBB 1QTQA 1KY4A 2JCYA 2Y1GA 2WOJA 1GSAA 4RH1A 5K3SA 3DTVB 5KVQA 3ZZTA 1GEGA 1JZSA 5F1OA 2FP4A 1ZD1A 1AKWA 3HN7A 5J4HA 4IKEA 4K0RA 5EKTA 2Q4EA 2WJVA 3RVRA 1XTIA 721PA 2SCUB 2AG5A 5ED0A 5BUSA 4FGLA 4OO3A 5IANA 1ZN9A 4B8WA 1HFJA 1JYEA 2V6GA 3GLFA 3IAS1 3HUFA 5LQJA 4GPEA 3NRJA 3DFZA 3KAQA 1V8OA 1UPBA 2W43A 3H5VA 3Q9LA 2QD5A 3EJ6A 5FNVB 1B8PA 5IYZF 4DWVA 3IX7A 3PZCA 4FMDF 4B3BA 4E5SA 4NX2A 3FCXA 1HGXA 3MUNA 3LQQA 2R97A 4H4DA 1NMXA 3ILYA 3ADKA 3D8RA 2C7VA 1FLVA 2XMZA 3IDOA 5FJIA 1QDUA 4EG5A 1L3CA 3OF5A 5DHRA 5I9LA 4BVHA 5CDSA 2H1RA 1ETHA 1Q0HA 2EQBA 3HEBA 2XD4A 2O4CA 2V55B 4OXQA 4LTDA 5G4KA 2Y1DA 4ND7A 3B85A 3WRYC 3ZWPA 5B4UA 4Z51A 4X1IB 1N2GA 4HVCA 4EUEA 4ZCSA 3SYLA 5EJMA 5I4CA 3V1YA 4P98A 1XKLA 2P3QA 3NBUA 5KVSA 3R7BA 5ADWA 3RASA 4YRRA 3X0DA 3FLEA 3M4NA 1G6HA 2MSKA 1OHHA 4YROA 3B3AA 3E3OA 3QOWA 4GKBA 3T3IA 3WISA 5TSDA 1PUIA 2Q6IA 2V98A 3UT0A 2DU7A 2TMKA 2SBTA 3K09C 1PZXA 2O2JA 1YOVA 2ODTX 3N9IA 4FSHA 4UUQA 2D0OB 4MVJA 2QVYX 1SM4A 3LDAA 1P4RA 3U4MA 2R4UA 1G7TA 2E49A 2CV2A 2VJMB 3QIAA 4NJMA 5I4BA 2ZSUA 3EYAA 1EX7A 1HM5A 2I1WA 4U2EA 4OB8A 4ZEVA 4XQGA 3MT0A 3HMKA 3LQ1A 3OPQA 5E4TA 1KWKA 1TAUA 3L7JA 3RRZA 1H3NA 2BM8A 3RL6A 4NCNA 2BFMA 2VRCA 4UBLA 4ZV7A 5C0OE 1SFRA 2OT3B 4DT1A 4AJ9A 2AMVA 1R66A 3ZY5A 3A74A 1DE0A 1QLJA 5IH7A 1NATA 3PLNA 4I4LA 2DULA 4DEXA 1Q0TA 3PEEA 2EFHB 1FQJA 3PEWA 3W8NA 2WWGA 5JD3A 3SYKA 1JAYA 2Q6KA 2Q9AA 1OWOA 4LOJA 3KWFA 3QKIA 4TS9A 2WTAA 3DM9B 3TRHA 2I4RA 1JB1A 4H2DA 1QJ4A 1JQDA 1GPH1 4BKUA 3FWNA 5ICMA 4IJMA 1P62B 4PNPA 5CDFE 2HFKA 1G8MA 4CQJA 4ZI7B 1E7QA 4KQHA 2Y2VA 3U19A 4JVMA 4DSTA 2P90A 3M4YA 4OLHA 4X95A 3CW2A 4E30A 1CVRA 1OIVA 4R05A 3T99A 4HMQA 3ZDZB 2B7LA 2HRZA 4H60A 4WOPA 4ARUA 1YRYE 1GSIA 1L6IA 2XTJA 1EBUA 3B3JA 3MG9A 4QBFA 4URWR 3X2EA 4ALKA 4DG9A 4HQRA 2MINA 4HEJA 4Q01A 1SNYA 4CZ2A 2COUA 2MR5A 2VPWA 2WV9A 3HP4A 3SJAA 2V65A 1NDQA 1N5MA 4M53A 2AJLI 3CRVA 3DMDA 1Z6YA 4QRDA 4MQ4A 3D3NA 1ESDA 2YXBA 2I2FA 3HUEA 4IHAA 2DU8A 3IEPA 1E32A 2HMVA 3GA0A 3H75A 3NIWA 4TQUS 5FUBA 3LGAA 1YZFA 2XF2A 4Q1BA 2F00A 1O9GA 5FWAA 2OWEA 1U1IA 1X1EA 3F9IA 4F1WA 1FYXA 2QRZA 1IVSA 4JBGA 2WSIA 5AI8A 4TS1A 3HY3A 4V0NA 1RJ9A 2FJUA 4KMSA 4Q9IA 4YRCA 4B3IA 5LMCA 3TI7A 1TYDE 3VJKA 5I3CA 2X9GA 4L4UA 4UVEA 3H6GA 4JJAA 2HA3A 4J6EA 1ZI8A 5IAEA 2JJMA