4ZTZB

Structural basis for processivity and antiviral drug toxicity in human mitochondrial dna replicase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
418
structure length
363
Chain Sequence
b'ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase subunit gamma-1
publication title Structural basis for processivity and antiviral drug toxicity in human mitochondrial DNA replicase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 88
structure length 363
sequence length 418
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ztzB01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4ztzB02
2ZXFA 3BJUA 2Q7EA 4H2WA 3REXA 1H4QA 3R07A 1G51A 1FYFA 1X54A 4CS3A 1SETA 3P8YA 4E51A 3RKYA 2P5IA 2ZT7A 3HFZB 3UFGA 4YRIA 1C0AA 4Q15A 5KNNA 4YRKA 4Q6GA 2ZT6A 4RQFA 1NJ5A 4J15A 1JJCB 4UP8A 3A5ZA 3IKLA 1WLEA 2DVEA 1HTTA 3PCOB 4TVAA 3VQWA 5C52B 3A7UA 3HRIA 4PHCA 1V95A 5HGQA 3A74A 4H2XB 3HRKA 3HXYA 3EFSA 1X55A 3NENA 3QNEA 3NEMA 1ASZA 3P8VA 1B7YA 2ODRC 3M4PA 1J5WA 4YRCA 5K1PA 3RGLA 2ZR3A 4O2DA 2ZZFA 3HXZA 3L1AA 4TTVA 4YRLA 4PG3A 3MF1A 3UH0A 2ALYA 1WU7A 4H2SA 4XEOA 3VQYA 1YFTA 4P74C 4P71A 4YDQA 4YRQA 4H02A 3NELA 3W3SA 3WQZA 4P72C 5K1XA 4P75C 4TVWA 2ZNIA 1USYC 1HC7A 2ARUA 1E1OA 3HXWA 2ODRD 1X2HA 4UP9A 3MEYA 2ARSA 1RIQA 4HWPA 1QE0A 4XTWA 3V8LA 4BW9A 4DQ2A 2ZTGA 3IALA 3NETA 4K86A 1KMMA 4OP0A 2ARTA 4YPFA 1NYQA 2AKWB 1QF6A 2ZT8A 4CS2A 3V7SA 3G1ZA 2DJZA 2CJBA 3OD1A 1EIYB 4P73C 1H4SA 2DXUA 1BBWA 2RHSA 2ZIMA 3IG2A 4ZTZB 3TEHB 2IY5B 4YRJA 4LNSA 4P3OA 1BIAA 4HWSA 4YRNA 2DQ0A 1E22A 1B70A 1EVLA 3IKMB 2DZ9A 4P74A 4H2UA 1EVKA 1W66A 3LSQA 2DDZA 4YRGA 4P72A 2G4CA 1LYLA 4P75A 1NJ8A 3E9HA 1PYSA 3A7AA 3RKWA 1USYA 4RMFA 1H4VB 1NJ2A 4KQEA 1WYDA 3CMQA 2C7IA 1YFRA 2XGTA 3BFMA 4ZIBA 1IL2A 3HFZA 1X56A 2DQ3A 4TVAB 3LSSA 3HFVA 1EFWA 1BBUA 1WQ7A 2I4LA 3TUPA 3A7RA 2E10A 4HVCA 5C51B 4KR2A 2DXTA 1B7YB 3MF2A 4YCWA 1KOGA 3VBBA 4YRSA 4P73A 1JJCA 3ICAA 4KR3A 4HWOA 4YRMA 3HXXA 3PCOA 1N9WA 1Z7NA 1SRYA 2QHVA 2ALYB 2EWNA 2AMCA 3KFUA 2EAYA 4HWRA 1H4TA 2QHSA 4YROA 1X2GA 4YREA 4YP0A 2ZT5A 2DTOA 4BWAA 4CS4A 3PZCA 3QO5A 3RUXA 1E24A 2DTHA 4XTUA 2DU7A 2Q7HA 2ZZGA 4H2TA 2RHQA 3A31A 1SERA 2E5AA 5F5WA 4RQEA 3RL6A 1NYRA 5C53B 4XTYA 3V7CA 12ASA 3HTZA 4CH4A 4EX5A 1HXDA 2PMFA 2LW7A 1NJ1A 2ZNJA 2E3CA 4EO4A 1EOVA 4OLFA 1ATIA 3E9IA 1X01A 2CJ9A 2AKWA 2Q5IA 1SESA 2ZCEA 2ZIOA 3REUA 11ASA 3RACA 4WJ3M 3V8KA 4K88A 4CH5A 1YGBA 1B8AA 1B70B 3V7RA 3RF1A 2I4OA 4UP7A 3VQXA 3TEHA 2IY5A 3A5YA 1ADYA 3L4GA 2Q7GA 2QHUA 1BIBA 1PYSB 1B76A 1Z7MA 1EQRA 2DKGA 4XU0A 4HWTA 4P3NA 1WPYA 1VQZA 3RKXA 3HXUA 2EJFA 3QTCA 3M4QA 3QO8A 2E65A 1G5IA 2ZINA 3DSQA 3ERRA 3P8TA 2DTIA 4WF2A 2DZCA 4AH6A 2Q5HA 2DEQA 4XTZA 4DPGA 3UGTA 2C8MA 4K87A 4TQDA 2ZGWA 2QHTA 3HY0A 2P0LA 3V8JA 1KMNA 2CIMA 3VQVA 4H2XA 4WI1A 4TVYA 2AMCB 4CH6A 4XU2A 4H2YA 1E1TA 1WNLA 3HXVA 4XTVA 4X5OA 4XEMA 2CJAA 3QO7A 2J3MA 1GGMA 2RHQB 1ADJA 2EJGA 3FJPA 2EJ9A 4YCVA 2CGHA 2E41A 5ELOA 4YRRA 2PMEA 3EFRA 4CH3A 3UGQA 1ASYA 4P3PA 4YCUA 4YRPA 2DU5A 4XTXA 4L87A 3RIRA 4G85A 3TEGA 2I4NA 3HY1A 4TWAA 1G5HA 4WJ4A 4G84A 4H2VA 5E3IA 1NNHA 3LC0A 2EL9A 4UPAA 2RHSB 4YRFA 1WQWA 2E64A 4XU1A 4NCXA 3L2ZA 2FYKA 2XTIA 4TQFA 4ZTUB 1YB3A 3A32A 2ZZEA 2I4MA 1EIYA 4YYEA 4RDXA 2ZR2A 2HNIA 3I7FA 4HA8A 1NJ6A 1L0WA 4YRTA 4XU3A 2J3LA 1YFSA 3L4GB 2E1HA 4P71C 5ELNA
chains in the Genus database with same CATH superfamily
3LGXA 3GLFB 2IYZA 3ZLBA 5JCPA 3O1HB 3O3MB 2ZQYA 3AUFA 2VWGA 4RM2A 1E6EA 2CNLA 1ISGA 1V1MB 3LZDA 3LPCA 1KFKB 3KBBA 4PZ9A 3L6RA 4GRAA 3S1AA 1BEUB 2C7GA 4M37A 4UEQA 5L3SA 3EW7A 5KWIA 3ESZA 1UZNA 4HDSA 3UGJA 2Q9BA 4Z9BA 3T1QA 3SR3A 3MFQA 1YQEA 4B17A 2PKQO 2VP4A 2P9FA 3ZZNA 2J9RA 2PSFA 1ZD2P 2WF5A 2QD3A 4ED9A 4F4CA 4YRKA 1N2GA 1Q15A 3UJ7A 3RARA 4EY7A 3NVMB 1MVLA 2QM7A 2ZUCA 3C39A 3OQ1A 4I8DA 4PV7A 4B9EA 5K8UA 1SBHA 2NADA 2UAGA 3FOFC 1XCJA 3VO1A 2Q3MA 2PV0A 1AV7A 1O08A 5TE9A 4EG1A 3G2QA 4DHEA 1FNCA 1E4OA 3DMGA 1NJ5A 1QXSA 1XMJA 3IOEA 4PNPA 3BB4A 2EG5A 4FR2A 2WVAA 4MS1B 4TTIA 1LPSA 3ZI4A 3EGWA 1M9NA 2X42A 4BZQA 1YZNA 3OTIA 5C52B 3HEAA 4PC2A 3A7UA 2VRCD 4TGLA 1XVVA 1ZNYA 2RC5A 4A6EA 5HUQA 3W4KA 5KC8A 3VH4A 2IU4A 4WLVA 2HF8A 4Z4EA 3TNLA 2O2XA 6LDHA 2R4QA 3HRKA 1IPFA 1EE2A 1K9VF 1P74A 2GS9A 2P0YA 2ZQ5A 1UMCB 3WL8A 3G6WA 1PSZA 4F3TA 4Q93A 1T15A 1Y8QA 2NPFA 1KO7A 4WBNF 1B7YA 1QKKA 4OHCA 3TLBA 3W5VA 1CRPA 5CDGA 4B3IA 5JRDS 4RUKA 3HABA 1VSBA 5EMHA 1J5WA 1K6IA 1U2DA 3JQCA 2Y1OA 3FI0A 2YJ3A 2PEZA 2XXAA 2ODWA 4JYAB 1E6LA 1Z13A 1MNAA 1QCDA 5NLLA 5CHYA 3CHYA 4O4HF 1DV2A 3JYHA 5FP0A 4MB6A 3H3FA 3MGBA 2MINA 3DD1A 2HBQA 1B93A 4YCDA 4CM5A 1MTZA 1EE1A 1EB8A 1SBYA 2LCIA 1DAOA 2HF2A 2P6NA 3OKFA 3R8XA 2YICA 4GOLD 1LW7A 4F5YA 1M2FA 1XNHA 2OOKA 2H4YA 2RD2A 4AY2A 3RYIA 1QO7A 5EPOA 1USUA 3FGZA 1I5EA 1NZDA 2KMLA 1FX1A 2XUAA 5LQRA 2WFZA 4UD6A 2P91A 1VE9A 1ZESA 2V7VA 4W7SA 1BO6A 2VYQA 4QXMA 1OXTA 1YH3A 2D2EA 4P72C 4CBVA 1KAOA 2OCKA 3QIAA 1E3QA 4O29A 2VNJA 1EFAA 2UXBB 4LCBA 3GLHB 4KQKA 5IEBA 4MS4B 2HT6A 2WABA 3B5IA 3AGPA 4Y7DA 2JFHA 4XQ9A 5KNBD 5FI3A 4NRDA 2RSLA 4C05A 3CVJA 5SY6A 3ZVLA 3JQRA 4D44A 3PDUA 3OAAA 3FSGD 4UTXA 5DI9A 3WWYA 3BWYA 4LQCA 2XB6A 1TEVA 1HE3A 2PAAA 3KBOA 1MXHA 2QRLA 3LP8A 3INGA 4W9NA 4OAPA 1JLLB 4X85A 3GEIA 3LW8A 4BRZA 1LBQA 3DE5X 2X3YA 3OIGA 1YRWA 3N0VA 3R9IA 5CA0B 1GSAA 2X0NA 3BSSA 1HH4A 3G1ZA 1PHRA 4FSHA 5E6SA 1H2RS 1JAYA 1LC0A 4B71A 4A2WA 1TM4E 3EQ8A 1VLHA 1SQ5A 5J4LA 2ARKA 1KORA 3LC2O 4E88A 2R96A 1YBFA 3UBMA 3EW9A 1L7MA 2VK1A 3CG0A 1AHNA 4BVLA 1GARA 4DZRA 4MYHA 1KQOA 5K09A 3IULA 2I22A 5F21A 2X5OA 2WJJA 1S2GA 1WNFA 4M87A 4OQPA 1ENZA 5E3HA 2OC9A 4OBXA 4RPLA 2ILVA 3DW1X 4B83A 2QRGA 3I6MA 3QEJA 2ZR9A 3H9EO 2P69A 3WK9A 2CZCA 1HEUA 3FYTA 4RDCA 5KSPA 2HPVA 2L18A 3X2SA 3EWNA 3FH0A 4ZALA 1XX6A 4C06A 2M6LA 3OVMA 2Z8YA 2DZ9A 2R7KA 3KZ1E 3PYMA 1YL7A 2AHOA 4C20A 5IS2A 1ODTC 3IJEB 2NUTB 4RTOA 5HYVA 1EVKA 4K6HA 4PPFA 1GQSA 1PK8A 3ICVA 1UP6A 4HAWA 3T3MB 3ZOZA 2XGJA 3LRPA 3UFXA 5J4YA 3HJBA 4X00A 3UT6A 2R0QC 4R81A 1K7SN 1NJ8A 1QBKC 1PYSA 1EGVB 1DQSA 1HZZC 1M5RA 3IAM6 1MEJA 4G9EA 5DLEA 2I9KA 3GDOA 3MTIA 4TRJA 5IT5A 4NYJR 4P4LA 4JL6A 2N3ZA 3M5CA 1T2NA 4D8WA 2YFQA 2VOEA 1ZJJA 1QGAA 2ZYVX 3WGTA 2AWOA 1ZMOA 4HAXA 5DO9A 1E2NA 1NMSA 3P9YA 2Z9CA 4MRSA 5E2AA 1R9GA 4OQFA 3WIVA 1PJCA 2P5UA 1OBHA 1EFKA 2PANA 4H31A 1G3QA 1YC2A 3E7PA 2UZ4A 3HFVA 1N5DA 2DCUA 2BDEA 2R00A 4Z8YA 5H82A 5LXTF 3X1WA 4ZICA 3T9CA 3QHQA 4FGUA 1EBBA 2P5SA 3D6FA 3CRVA 1G63A 3W34A 2ETVA 4H59A 4HVCA 3D8TA 3SBEA 5L3VA 4LF4B 3ZHYA 5CD9A 3KUDA 3MF2A 4INAA 3L7IA 4J0IA 4W4TA 3LBFA 4C78A 4J0EA 4BO8A 1PQUA 1DADA 1QYDA 4DA6A 3D9QX 3HBFA 3NJRA 3S5UA 3NATA 4MRMA 1X80A 3VSCA 4KL8S 2CVPA 3UG6A 4W1PA 3SQDA 3LP5A 2CLKB 3UJ3X 2F43B 3WGGA 3WYEA 2AK2A 5PNTA 4LJ8A 1WSWA 4LJ9A 5MDHA 3QXCA 3D8BA 2QHVA 3HUTA 5ADVA 2F1JA 4U7FA 4QUKA 3RFTA 1EUCB 1FP4A 2BFEB 4O1MA 2XY4A 4M36A 2VTVA 1IZ8A 1UK9A 4GSKA 3DVAB 2Q2NA 3WA7A 2V96A 1IM2A 2ZYWX 4X3PA 1IG0A 1UZAA 2FF5A 1H4TA 4I5GA 5AICA 1AXEA 1DIOB 5KHLB 1ZR4A 3TLKA 4YP0A 4BAUA 2WJIA 4N0MA 1K4YA 4MVWA 4B0OA 1OZGA 1BVRA 4YJHA 3TRFA 1A4RA 1MF7A 4R2JA 1K5DA 3AONB 3A36A 4I5EA 3K2EA 2FP4B 1TVEA 1WVMA 1R8SA 2ZSKA 3G17A 2XDQB 1FDWA 4GI3A 4TXMA 1QYWA 3D7KA 1RXEA 1XZPA 2NO5A 4Z8XA 4E08A 4RTQA 4EZIA 1CF4A 2IXDA 1MKYA 2W83A 3HM2A 3WBBA 4DY6A 4ESOA 4L6AA 1NXQA 4EQ6A 1BXKA 1ECCA 5CYGA 5KX5B 1EIWA 3N2IA 2QS9A 4MTCA 3LPLA 4WAUA 2NU7B 2WJAA 2Z09A 5JWRA 3FVWA 3G2NA 4M4SA 1Z37A 4XI9A 1NF3A 1U7UA 2JB9A 1MB3A 2FKNA 5EMKA 5ALRA 4B3SB 1ESNA 2AOTB 5EJ8A 3T5MA 5JW6A 1G2IA 1P1IA 4BNIA 2UYHA 1HLFA 1UWKA 1YB5A 4NBKA 1RYFA 3F6YA 2CUKA 3CW8X 3K9HA 3KQOA 5DHQA 3CKMA 4N54A 4CTKA 1IHUA 4EG6A 4M0DA 2B7CA 5KNCH 5CT6A 2W71A 4V0MA 4JB8A 2OSBA 1A0OA 4ZHQA 1WA5A 4YJ2F 3IJPA 4KNVA 3RVQA 4XWAA 3TTUA 4G0UA 2WQZA 3PPWA 1UWLA 3R23A 2BFFA 4J2HA 4PTZA 2BFPA 2E37A 2W6MA 2BSXA 1J7KA 2DP4E 3H1BA 1UDXA 4HTFB 5B1DA 4HCJA 3WWDA 4WBSA 3BGDA 4OI4A 2Y0EA 1KPIA 2I1VB 5KQGA 2DSNA 5AXDA 2R48A 5DULA 1I2BA 4RK6A 5U4QA 4Z4QA 4QD3A 5L4NA 4EYQA 1PDWA 5A7FA 1ZM9A 1E2PA 5HFNA 4BCDA 3HDJA 1A7UA 3OJLA 4YAJA 4DRXB 5DX1A 2QRQA 2DX7A 3DP9A 1NWCA 4C3VA 5IKMA 2AZDA 4M9ZA 1VKOA 2Z3ZA 5HF9A 3WAGA 1EFRD 1P62B 2AH5A 2G9ZA 3IVCA 1W5EA 4IIEA 3TTYA 4XUGB 1W8IA 3BDVA 1QRTA 3AEZA 3LVBA 1D03A 4DPKA 1NI4B 1XMVA 4E5DA 5B12A 5ED4A 1QH0A 4RK4A 1OMOA 2LRHA 4QTUB 1L9XA 3F4LA 6NULA 1ELOA 4CQLB 1HA3A 2Z2YA 4GH5A 4C01A 1WPYA 2FMUA 2OHJA 2Q49A 3ES9A 3UXYA 2QTWB 1VLZA 4PR0A 5IBCA 2WSBA 3Q3EA 1KO1A 4CMBA 1ZH6A 4MX8A 4DUGD 4FB5A 5CFPA 3QX3A 2B5VA 1BXRA 1OX6A 2HN9A 3ZY3A 1XMXA 1MRSA 4OBBA 4DR6B 3P8TA 1JHXA 2DTIA 4GLLA 4PO9A 2RGEA 3OEYA 3SC6A 1X14A 1M0EA 1EINA 1K92A 4NMMA 4IFIA 4TRMA 4PIMA 4KR6A 4TYWA 2NZ2A 2VJCA 2H9IA 4L3OA 3ADBA 2NAPA 5ENZA 4M88A 5AIAA 1Y3AA 3V33A 1JDBC 4BQOA 4HP8A 4AMGA 4RHFA 4BU0A 4X54A 1BXZA 2HU2A 1VP3A 3NRCA 3GX1A 3PTZA 4MB0A 3ZN2A 5KIAA 3DC2A 4CG0A 2BBWA 4GX1A 4Q1FA 1BMQA 3G2JA 2ZIZA 3H6HA 4LJYA 5AI5A 2UZ1B 5EJ6A 5IASA 1JLKA 3EDOA 3INRA 1C3VA 5K0JA 1COWA 2QL7A 1KNXA 2GAFA 1QQ6A 1SB9A 3RKRA 3HDHA 4PZLA 3UAOA 1QUFA 1X7ZB 2J0UA 3KZMA 5D86A 4DGQA 9MHTA 2DFTA 2VCYA 1DBWA 3U61B 4FUQA 2WILA 3E3AA 3CUTA 3CX7A 2Q62A 4K9KA 4M8IA 3UWOA 3BHIA 2Z4SA 3ZK7A 1JI0A 2W6PA 1UANA 5C7LO 4EY6A 2R85A 4DDUA 1WV0A 3OCVA 4E07A 1VCMA 3ZKWA 1VKRA 1J9EA 3CF4A 1BMDA 2CUTA 5K6AC 3FPHA 4XOUA 5EE0A 1OE0A 2RH5A 5G53C 4Z54A 1G98A 4KIWA 1BH2A 3SZMA 4R0NA 4Q9LA 3GLSA 2AN1A 2DLNA 4M1MA 5DK4A 4PF1A 3CNHA 4AKEA 2IUEA 2XGMA 2IODA 3DKKA 4F2DA 1NUAA 3CR8A 4G2NA 2Z4RA 1TOAA 4TL7A 2EJGA 3RWMB 1I94B 3QYFA 4DDHA 1W5BA 3HCAA 3PC6A 3H16A 4K9RA 4P2GA 5CIWA 4RZHA 3B1YA 4CQMD 4AUEA 1P1FA 2B2NA 1J1ZA 1L5VA 3IELA 3WKEA 4EEZA 2HY7A 1QOZA 2PMEA 3NYRA 4ZOCA 3OECA 1ZM3A 3G59A 3OCJA 4OQNA 3V1NA 1AKWA 1MXFA 3CUEF 3LLMA 3A26A 5COBA 4DSNA 5AVQA 3LT5A 2VHZA 3MAGA 2GZ2A 1E1QA 5T3UA 1PL8A 1VMEA 3O2JA 3KB8A 4XFDA 1U28A 4LJRA 4F6RB 1Z6YA 4ARIA 1VFNA 4I99A 1Q0SA 5K5EA 3RIRA 4TTRA 2QORA 1Z4LA 2YYYA 2WA2A 4M1OA 5FADA 3HPRA 1SCDA 3H75A 3O8OB 3ILXA 1UMBB 3D4IA 4KRGA 3PCXA 5G3YA 5EIFA 4MGYR 1XTQA 1YS6A 1O97D 4WUTA 3MINB 4JI2B 3RUPA 1J9ZA 1QG6A 3GXBA 3PTLA 4F5EA 1LF0A 2PLRA 2PMKA 2F9MA 5DHTA 1A7JA 5I7RA 5MN6A 3IILA 2O2ZA 4MV5A 3NG1A 2HEGA 2P30A 3E9NA 5B4TA 3L43A 4YLGA 1KHHA 4CLRA 1HXHA 2WJ4A 4OK5A 3L2ZA 4LG1A 2FYKA 1T13A 4RVFA 5K3DA 1Q7CA 4TMVA 3D8HA 2RHDA 5BSMA 1IQRA 4LRWA 5IVPA 5EZ6B 2JGJA 3AOEC 2ZU6A 1YNOA 4PBRA 4Q9IA 4PNEA 1OFVA 1MA0A 1LRKA 2QT0A 2FHSA 2RH4A 3A1DA 3N6VA 1F20A 5IJAA 3T1VA 3BBPA 4F96A 2ZZNA 4GC5A 2ZP1A 1JEYA 4HQ0A 4D4KA 2ZVQX 4N0EA 4EKDA 1S8OA 3KVOA 1AGPA 1LX6A 4FT2A 1QGZA 2BMDA 2FF7A 3AHFA 1UEXC 2A78A 5AI9A 5EXXA 1SCBA 2GJKA 3DDOA 5JD6A 4LRUA 3LAWA 1D07A 1TQ8A 4IGFA 4H1UA 1NTRA 1U7HA 3N2LA 1ZM2A 1Y3IA 3BYZA 4PFQA 5JH7B 3BTUA 2FYTA 2EQBA 2HA0A 3MAJA 3EZXA 3L6CA 5EWJB 4ALLA 3QX8A 4CGYA 1BW9B 3B1KA 3QVUA 4RCYA 1OIVA 3R76A 4MV0A 3I73A 1TTTA 2WWRA 1NE2A 2FQQA 2WG2A 4TZTA 3MW8A 3NANA 2B99A 1YR6A 1H4QA 3OA0A 3MCAA 1R4MA 4BNUA 1ORWA 1LWOA 2XWBF 3IIIA 2BONA 5AOAA 2NXNA 5KTYA 4RZ2A 3WQSB 1W0JD 1EIZA 3HV2A 2FN4A 4EFNA 4A0QA 1YZQA 1HQYE 1KVRA 2J30A 1YJ5A 4V0RA 3KKOA 1GQQA 3KWJA 4P7FA 4UARA 5EQFA 4QDUA 4IRMA 2HV8A 4Q6GA 2O8VA 2W43A 5IZCA 2VDKB 2JANA 2I6QA 1WXGA 1EP1B 5KYYA 4CM3A 2CJYA 3G49A 1IJBA 3KCQA 4MRAA 2CSUA 2VL7A 2OBYA 3FNGA 3P9RA 4QTXA 4R1NA 4C89A 2R8PA 2WHQA 4MWCA 3P97A 4L0MA 1U5CA 1EGHA 4I50B 4PLFA 3A1SA 2CL7X 1F1JA 1OHHA 1GSHA 3PEWA 1HTTA 3ADDA 1IMJA 3HMKA 3OX1A 5J43A 3PC4A 1WUJS 3ZY4A 1OGJA 2E4UA 2VPZA 2E4XA 4H60A 2ZS7A 3N87A 4MLZA 4LHSA 5IDXA 5JYBA 2DHQA 5CDFA 2Q3LA 1J9GA 3ZJ4A 4QXRA 1KMHB 1FX0B 1YBAA 1W2WB 1ZVJA 4W1SA 1JR6A 4XM0A 4ONEA 4JBHA 3UW1A 1GNQA 3QGMA 3BGOS 2Q4RA 3F78A 3IPLA 2X0IA 2NMVA 5A1JA 1QIGA 1MRZA 3WQQA 5KYGA 1OILA 2ZZFA 4R1OA 2GCNA 1UUFA 4DJFC 3C87A 1FDRA 3AU9A 5KNCD 3E7DA 3KEFA 1HEYA 4NONA 5M3BA 3IPCA 4URUR 2WJGA 3SMVA 4BYGA 4BRWA 3DVLA 4TMFA 5LQUA 3C8HA 1YDEA 1R5OA 3NOQA 5FD8A 4AJIA 1GTMA 3K1AA 3M89A 4P4SA 1OUMA 2ZAOA 4YMWA 5E0KB 3Q15C 3EVZA 3IBYA 1ZG3A 3L0DA 1J5EB 3IKVA 5BV2P 5AVYA 5FWXB 3F6RA 3TECE 2XKJE 1NRJB 1EFDN 3ZZ1A 4Z7NB 1W5SA 3BG5A 1YRHA 3NELA 1L8XA 1TAGA 2J33A 4E03A 3N2ZB 4ZQCB 5TQ0A 3FYSA 2ZYUX 1I6KA 2P8JA 4MWBA 4PGFA 5C8VA 1C0IA 1EX1A 4B09A 1SKYB 3X1JA 3WVNA 4AX4A 2J85A 4PYQA 5FA8A 4Q24A 4KXVA 3AIIA 3AHEA 4NNJA 1OLUA 1EK5A 4UC0A 1MAAA 4Y9RA 3UC9A 1ENPA 1EHIA 3MMSA 4FGKA 2IWHA 3CUKA 3PXXA 2E55A 5B36A 2FOXA 4LGYA 4OAQA 5LA6F 1SUCA 1JDNA 1WZIA 4GNRA 4QXQA 1VRVA 1RIQA 2A0WA 2HU8A 4HWPA 2NIPA 2XCIA 2X4DA 3L46A 3QFTA 3VGJA 5IZ4A 1BVHA 3ZEIA 1D4OA 4RDIA 4CEHA 1XDUA 4MWTA 4X94A 2RK6A 1NP6A 3DOIA 3QE4A 5JNUA 4PQFA 3ZDZB 2XQFA 3ON5A 5TVGA 1MEEA 3IMKA 2AN9A 1QGDA 2Y4OA 3O75A 4GI2A 9LDBA 3A11A 4HDQB 3GGCA 5CT4A 1LLDA 3PDCA 5CIQA 1BNCA 3ETGA 3QPWA 5E3JA 4EB6A 3GAMA 3AEQB 3C1TA 1MO5A 2P4HX 4H6VA 3C6QA 3N8IA 2A7XA 2AR9A 2WNIA 2BLLA 1YTLA 5D3MB 4HYTA 5E2IA 3H1AA 4S1VA 4BPRA 3GUUA 1N5MA 4LS3A 1LTQA 4PSCA 4ZT2A 1LDNA 1HYQA 2QD2A 3JQEA 4HDKB 5F5XA 1A8HA 2ZUSA 1QC5A 2Q4EA 4UZSA 4X3OA 5DHSA 2HRRA 5GAJA 4BFSA 1NN0A 2JLRA 3K96A 4II7A 5TIIA 4F6LA 5F3RA 1RQXA 1G66A 2UVPA 5FQOA 4QPCA 1GNRA 1Q0ZA 5FO1A 3GRUA 4HQNA 2X0FA 1AH2A 1FQOA 1PJBA 5K1ZA 1OXXK 2XVYA 4GOND 1V2GA 2C1ZA 3TEMA 2H7CA 4D9GA 1QANA 4NYIQ 2KI5A 1P4RA 2WIKA 1UKYA 2MSLA 3NKFA 3T1OA 4I9NA 4PQEA 4RLFA 3ZBPA 5A5EA 3S1AB 4DLZA 5L3SB 3V7UA 5E6RB 1SVNA 2I80A 3R0IA 4GXTA 3TOXA 3ZHUA 4D3XA 4UNPA 4K9LA 1T3TA 2YRXA 621PA 3A6PC 1NBHA 4HDSB 2IOFA 4KYTA 3UMMA 5JAOA 4INOA 4QYWA 2JA2A 1U0LA 4LVUA 2G4CA 4H7HA 4OQZA 4TWJA 5TARA 3BCSA 3A7AA 1YRQA 2QTMA 1XU7A 4JLWA 3RKWA 1XAIA 1USYA 3VOAA 4BVAA 2CL0X 1JH8A 5B4VA 3C14C 1ZIXA 1PF7E 3VBCA 3HLKA 2K87A 5DWQA 4E13A 4LFCB 3CZ9A 2V74B 4O08A 5F3WB 1LDMA 2D0OB 3ER6A 1ZUNA 2GT1A 1YFRA 1ISMA 1O95A 4N5LA 2Z2ZA 4QJ5A 3STVA 5A3JA 4Z53A 2PX5A 1IL2A 3C4JA 3NHKA 2QMUA 5JXJA 1YZKA 3GG2A 4UUBA 1EP2B 3U9LA 3KXIA 3SC4A 3ZY5A 2EFHB 1FS4A 4ZCIA 4CHGA 4QU9A 4JT2A 2A4MA 1AD2A 1ONPA 1PZGA 1KS9A 3VI3B 4JJ8A 1WLSA 3IGFA 3BE5A 1TT5B 2BAGA 3RRZA 1L1FA 1ND5A 5I7SA 3RFFA 3VC1A 1Y8QB 2ZITA 2XD4A 5DBEX 4O0LA 4X91A 2RHGB 2R4TA 3EPPA 3QH4A 1B7YB 3IQGX 1QV9A 1W5TA 4LXGA 1T5OA 4PLGA 4GZ6A 4XB1A 5E9JA 1W34A 1D4FA 3H2KA 1DNPA 721PA 2HJHA 5FTNA 3ROMA 4K05A 2QMHA 5ALDA 4HWOA 4JVSB 5IG2A 2XXAB 1JWBB 4FX2A 2YYAA 1M1YA 4KXWA 4LNAA 4GI7A 1BD3A 2LP4Y 3NAQA 3NBAA 1E61A 4CM4A 3NYWA 3DMTC 5HG0A 3W8EA 3SWWA 4X84A 2MINB 5GONF 4DJEC 1Z0SA 2OG2A 4GMXA 4F12A 1H85A 1V11A 1J2RA 1F3OA 1Z7BA 5LSAA 4NMHA 1GQYA 4Y1RA 4KOEC 1RAGA 4XB2A 3JRNA 1VHDA 1T0HB 1Z5GA 3DD5A 3OC6A 3RYIB 4F93B 3RVOA 3RU7A 1V8FA 2H1VA 1RTKA 4D4JA 4QYIA 2VTEA 2FK7A 3FLMA 4KVZA 2G71A 5JIBA 1DXHA 3CNBA 4LVOA 3FPLA 2HHCA 2ZUVA 1JP7A 1NU6A 3R09A 2ZWOA 3AETB 1SUIA 3UF0A 3HHPA 4EWLA 3UICA 5F1YA 1U2RA 3ICCA 4Z1MD 4GLFA 3ZBQA 3DR3A 1YBHA 1G5RA 2NTEA 5LOVF 2PH7A 3OZIA 4ZAXA 1JHQA 4CNBA 4ZCTA 2G0AA 5DYNA 1O95C 4LY6A 5GWXA 3AG5A 2EWWA 1CIJA 1M2HA 2FN7A 3M2PA 5DB4A 5ALVA 2V65A 3IODA 5CTAA 4YP1A 2E4VA 1U99A 2R97A 3DJYA 4RKYA 1QIEA 5L4SA 3NGLA 2V7UA 1CR0A 3ESAA 3H8SA 1WTAA 3NDJA 5JSUA 8ABPA 3Q3JB 3VJLA 1GAEO 2PKWA 1IWPB 2FGKA 5CVTA 1KFEB 3QENA 4E3ZA 4IIBA 2YXBA 3PUYA 2IF2A 3C5HA 3H0EA 2P9CA 4OU5A 5E6SB 5EJ9A 4BDSA 1FQWA 4IKPA 3FZQA 3FFXA 4IJWA 3F7MA 3FM9A 4S1PA 4XKJA 3GFFA 2CL6X 2EV9A 1KAQA 2C4HA 2AMYA 3T6KA 3U7JA 4Q9HA 1LLUA 1B26A 3QI2A 1LLCA 3M4YA 2AFIE 4M60A 1GZVA 1SOVA 1KETA 3NORA 4FGWA 2C4VA 5LM3A 3B1FA 2E3CA 1T6YA 4QICA 4YWJA 1O5TA 3BQNB 3SYNA 1SKUA 3U4QA 4MCAA 4M3NA 3SYLA 1X01A 3H2HA 1QIHA 1XDGA 4AJNA 1N75A 1G7RA 5FO0A 1RAAA 4QQ8A 5BW6B 5L6LB 2RHLA 4MYUA 2AJCA 1K8XB 2FEOA 4LBZA 4KYIB 4CM9A 4G37A 2ZIOA 2X6QA 4JUAA 5AH0A 1XDZA 2JFFA 3N28A 4YNBA 1OPXA 2BUCA 2R7LA 5JCJA 4WJ3M 1ZQ1A 5DGDA 1Q16A 4LMPA 3ZWQA 2OO3A 3UFBA 3FTCA 3MFYA 4QOIA 3F6BX 2D0IA 3OE1A 2O3RA 3IUMA 2AE1A 4I14A 3KQLA 1P7CA 4V0ME 4HLQB 1J90A 2GETA 2QG4A 4O6VA 3FSJX 3SEFA 2NPOA 1RIFA 3WGMA 3H4IA 3BMCA 3E58A 3F7TA 1WPGA 1ODLA 2FPRA 4I8IA 3NDPA 1QGUA 4EENA 5LUAA 1XZHA 4TZKA 1U0RA 3MQ2A 4XGNA 4MULA 3QLVA 3KAQA 1PYSB 2O7QA 2FZLA 2VATA 1G8FA 3RAEC 2VQEB 5EIXA 2XQGA 2EZTA 2H48A 3AF2A 3NIBA 4HJXA 3CRW1 3SDSA 4AO7A 4DNOA 4UPVA 6AT1A 3VSDA 3THWA 1K4KA 1UBMS 2VF4X 3IOCA 4IHJF 4F4HA 3T7TA 4G5OA 3ECAA 3GVPA 1Y8CA 3DCYA 1E18A 2Z2KA 4XIGS 4K6OA 4HFNA 4ZDJA 1PWHA 3GU3A 3DSQA 1OSNA 1RQGA 1W35A 3L84A 1ZHOA 4N48A 4RTKA 1RAIA 3KSRA 1QR2A 4DFDA 4L07A 1XGKA 1WDMA 3QW4B 1P0FA 1DAGA 2WU3A 2D0DA 2RJOA 4JC4A 1J06A 1CY0A 1NV9A 1P45A 4WY2A 2JH3A 3FWYA 1KFCB 3E03A 3UAZA 5IVHA 2PX3A 1SZPA 1YKSA 3PEYA 2EJTA 4DPGA 2XUIA 4QU5A 5BMVA 1B42A 3E81A 1KR2A 1PFVA 1K27A 1EWTA 1TB4A 3DTTA 4IQGA 5DGHA 3QE0A 2A8EA 4AN0A 4YCMA 2CHGA 3OQOA 1AXRA 1MC4A 3TSCA 1VPEA 3MGGA 4JCOA 4UZFA 3LX8A 4CV3A 1X80B 5JXWA 3KXKA 2V4ZA 2ZGWA 1F2VA 4R2XA 2QHTA 2NX2A 4BLTA 1GNPA 4N3CA 4DNFA 1HRDA 1M72A 5A62A 1Y98A 5SZHB 3QE9Y 5FYDA 3LF2A 2CIMA 1JG4A 2ZYGA 4LWOA 5H59A 3D2LA 4DCOA 4KQ1A 3SF8A 2IYNA 3TWOA 1FP4B 2GUGA 3IQIX 1B15A 1AGRA 3QXXA 4X65B 3EVEA 3W4JA 1ZRSA 1TJNA 5DYIA 2IU3A 1Y48E 2IHKA 2QJWA 4IIYA 2ZJYA 4XU2A 3WB0A 1SMKA 2JPDA 1RC8A 2I03A 2AHRA 5AKZA 4JY7A 3P4XA 5GZ6A 4YJHB 3X44A 5TPWA 3EDQA 3VM6A 5HGJA 1VJTA 1KDZA 1T5BA 3GLTA 4EA9A 1MB2A 2NSDA 4YASA 3BGVA 3IXLA 1GA6A 2NV6A 4QSMA 5ER9A 4O4IA 1NNUA 3ZQ6A 3LJKA 2H8GA 2QAGA 2O9JA 1ADJA 3KFXA 4UOEA 5JI3E 3LCMA 3I6YA 2Y66A 2VRCA 2X77A 1Z36A 2DQSA 3GFGA 1CK4A 3MWJA 4KKVA 3UA4A 2AFIB 3ZJ5A 1NPYA 1JG6A 1A9ZA 1RM5A 1YZYA 2GYUA 2OKCA 2BT4A 3GMTA 3I0NA 3JRXA 4BZPA 5KJEA 2JFOA 1GGKA 3E9MA 3EHDA 1NATA 1IQUA 4L1KA 3LUDA 2J9XB 2HBZA 1U8YA 1EDOA 2WT9A 2NVOA 1JHVA 4NJEA 4Y2XA 5CYFA 2BJVA 3C3KA 4ZEWA 3MT0A 3O82A 2JIOA 3JQPA 4AJ1A 1OAKA 1SOWA 4J49A 3IRVA 2IW3A 1HDCA 5BNWA 1SXJE 1EK1A 2VJMB 2B4RO 2COEA 4MJ7A 2PQ6A 4G07A 1NR5A 1TAQA 2WR8A 5DYWA 1UXJA 4OYYA 3BGIA 3NHAA 4KMMA 4HF7A 5LZ4A 2CDRA 4KNWA 1CT9A 5CVCA 3S2ZA 3SM3A 4GM0A 1KBQA 2IRWA 1IXSB 4AJLA 1W2HA 1X77A 3V48A 4DWOA 4LYAA 4P93A 3MBIA 3BD6A 5I9LA 5K8CA 2DPLA 4NYJQ 4WD3A 1QX3A 3ZWAA 3HCPA 4GL2A 5K0ZA 2LKCA 2BFFB 1OWLA 2QL9A 3DQPA 3FNQA 4UMFA 3RK4A 4LDAA 2LD4A 3M1IA 2HA4A 3Q40A 3RASA 2XF2A 5CNIA 3PEUA 1WMFA 3KELA 1R0XA 5BWCA 4JI8B 4JLUA 3L0BA 4FI3F 2G77B 4LEIA 1O3YA 4JHXA 5BQ5A 1XB2A 2NVBA 2GILA 4JBNA 3LRXA 3HCFA 2H59A 1GUAA 1VJGA 3I09A 3PP8A 2KLBA 3W9UA 3OQHA 1LS6A 3QVGB 5KNBA 5LP1A 4J8PA 2H0AA 2O7VA 1DIBA 1F0YA 1XU4A 1M6EX 3DG9A 3FSGA 2GK3A 4X6LA 3RAJA 4D4MA 3RADC 2GBLA 1K8YB 1OU0A 1BDBA 2IHUA 5CA0F 4LNHA 4MKRA 3TTXA 1DO8A 3ORHA 4D9CA 2JLQA 3EWSA 1WB4A 2XV1A 1RPJA 3ANSA 3I5XA 2Q7EA 4BE7B 1T1SA 1CIVA 3KG2A 1LV8A 4IJVA 4M22A 5AKYA 3R7FA 3PHHA 1HQDA 5GJBA 4JUDX 1TVCA 2CFRA 3OZ7A 4I3FA 4UM8B 1SG6A 5JXIA 4CS3A 1BXRB 2Z3VA 2AR0A 4RWEA 4ZVKA 3NC0C 1NNI1 3CQ9A 4U5QA 4BU1A 1KYWA 4CTOA 2P5IA 4K0KB 1GZUA 1T1IA 1W85B 1MZPA 4EHIA 1XK7A 3FYUC 1NF8A 5HM8A 3FN4A 4TROA 2A57A 4Q15A 3TDKA 3R9WA 4YO7A 1NDQA 2DHCA 1T9GS 4PGAA 5T6BA 4B84A 4CMIA 2XAUA 2A35A 2RKBA 3CH5A 1AO3A 3HNOA 2LNDA 2Q4OA 1UKBA 1IG3A 3UMCA 3NHLA 4LECA 1N34B 1QQ5A 4U6SA 4XIYA 1Z7GA 2G5TA 5D5PA 3LQKA 4HSGA 5E1OA 4NEGA 2DLCX 1IK6A 2JAXA 3E0QA 1ZJYA 3AJRA 4GBJA 3B6EA 3MCZA 2ZVPX 4BJ1A 4G41A 2B8NA 2RI0A 1NPDA 2BTOA 3FLEA 2O7NA 5AUNB 2O0LA 4B3JA 5JAUA 4WNCA 1Y6QA 4GYWA 1K06A 3HRIA 2QN6A 2RCYA 5FXMA 2J0UB 1R6TA 5EJGA 3EZNA 4FX5A 5JG7A 2OMKA 1XXLA 2AN5A 2QRVA 3QKIA 4B75A 3ENNA 1PT6A 5ALKA 3ZLJA 4DLUA 3VNUA 1MGPA 1P9LA 1QBGA 3C1AA 3DAFA 4CM1A 2F55A 4MI9A 2CD9A 2HA2A 2Y93A 2GVNA 2HCBA 4FJ2A 1TU0A 1LWNA 1KJJA 3WLHA 4UM5A 1XJ5A 5FWNA 1MB4A 2GBLC 3C3WA 3S27A 3HXZA 3GRKA 2X8BA 5CFQA 2Y71A 5KYUB 1LBTA 4C04A 1YJQA 3HU1A 1NZJA 1SXJB 3Q7IA 4G4SO 4U7WA 4YH1A 3E9EA 3ZDEA 1D1SA 3UWMA 3OSZA 1CZNA 4H2SA 4IDGA 2C83A 2P4QA 4I19A 5CDFE 1DEXA 4US2R 2NTVA 1NULA 4X20B 1NUPA 3WI7A 4YPOA 1QONA 3IRUA 5JJKA 1JMVA 1JQDA 3CEHA 3IEPA 3RVMA 1EA7A 1QR6A 4DCMA 4KPEC 4X6YA 2ATVA 4HDAA 4YRQA 3FTNA 4UAGA 2I33A 4DV2B 3UJAA 1Y37A 3WBKA 1RPZA 5THXA 2JIQA 2MSCB 2XUDA 2E21A 5CFLA 2XCTB 1HURA 1JPNA 1ZX1A 3DKIA 5WRFA 1HT1E 4OL0A 3SD7A 5D2CA 3WYBA 4BZZA 1GJRA 1TCVA 2WKRA 3AY6A 4J16A 4V0NA 1AMUA 1NQWA 4YMTA 5INTA 3IB3A 4D97A 1NN3A 4KQHA 4BATA 4C5BA 1E8NA 1M0TA 2CBXA 2PVPA 3MUOA 3U7EB 5C46F 1DIAA 1A8IA 4DSOA 1Z4IA 4N5NA 1CULC 2KBFA 4WN9A 2X2PA 4RMHA 3GZNA 2DQ4A 3LVFO 3MGAA 5EY5B 1T9ZA 3TPCA 5LQMA 5IAAA 3B8EA 3NETA 1DRJA 1LLQA 3VH1A 1JR3D 2ARTA 3HCCA 3DL7A 5LDGA 2EX4A 5KQLA 4X8MA 3H1TA 3ZZTA 2FSSA 4II2A 3C8ZA 3L2OB 1B14A 2YNMC 1CNEA 4FMBB 2ICAA 4ECAA 2IBSA 1RJGA 1B0AA 1N8SA 4R2IA 3JD0A 1YHNA 3T99A 3WSTA 1FLAA 5F2EA 4ERNA 3BCHA 4X90A 3ZE1B 3AR7A 1IZ9A 4P83A 1IULA 2TMGA 5F52A 3V1MA 5T8KA 4QUJA 4WESA 3RRMA 4L02A 2NWQA 1WDTA 1STOA 2GBIA 1IRIA 5TQVA 5AVWA 2IHNA 2GHQA 4O02B 3ISVA 4ZFNA 2ZPUA 2I55A 2Y1EA 2P79A 4MEBA 2A5JA 4QOSA 4Z0PA 4EMBA 4Q7EA 2IUFA 2JFXA 4DR3B 1B6SA 1SM4A 1QCZA 5AW5A 3JQGA 4NC9A 3AB8A 4M0LA 4ER7A 3C7KA 4FOLA 3CB2A 4IICA 2CZQA 1PBNA 1W73A 1KTIA 4D9NA 1EWKA 3IS3A 3PUXA 1GQOA 2CVFA 3W6OA 2IXEA 4LZWA 4M1KA 1VIDA 4RESA 3QQ5A 1ZQ9A 2VDNB 4H35A 4I4CA 1R4MB 3PVCA 1A1SA 4OTZA 2Q8NA 2GFHA 2XZOA 2GAIA 4GOOD 4KE7A 3VDXA 4H2UA 1KPGA 3NXSA 4NCHA 1L5HA 4B6EA 2ZBGA 3RLFA 4F9FA 3Q5GA 2J6BA 1V41E 3HQ4O 1YB1A 4AQ7A 1PVDA 4XVQA 1WU8A 4EF6A 1E2LA 2IYWA 1CF9A 1ZW1A 2H2GA 3PHBE 4JX9A 3P5SA 4MR7A 4JLVA 3AEUA 4RETA 4XD7D 4K7JA 4G0OA 2JHAA 2KS6A 2O4CA 2REBA 4GHWA 4C4AA 1G59A 2I2DA 3G0OA 1PJZA 1E66A 3G5UA 3TD6A 3UMFA 1WYDA 4ISBA 5KSOA 3F2VA 2POQX 5BSRA 1YBMA 4DZTA 2UKDA 1QV7A 2PCLA 2DLDA 4OHBA 1Z6PA 3S2IA 3ESBA 3LY9A 1HYBA 1SIBE 3LZ6A 4HH1A 3RTCA 2WIBA 2Z2XA 3S44A 1NNEA 3GT0A 1VE7A 3AKEA 1AZWA 3E9RA 2Z8ZA 2YFHA 4HB4A 4GLJA 3A3KA 4J0KA 4CXMA 3GRPA 3RRJA 1EFRA 2ODTX 3EVFA 1A7KA 3A7RA 1OZHA 1RJEA 2E10A 1JAHA 4ENTA 2IP2A 2HYDA 3CLHA 2EYQA 5KCMA 4ENUA 4K8OA 3B9RA 4U7HA 2E7ZA 3L0PA 1NW6A 1LBIA 5IMSA 2NXJA 3L4BA 4P73A 3DO5A 3HMQA 4HB2A 1D6SA 1CERA 1N6HA 3EGOA 2VXYA 3M6FA 3RT7A 4B4KA 3HXXA 3KQTA 3HCEA 1B8NA 1U2PA 1VA5A 3LOUA 3MLAA 3Q72A 1WXFA 2AXNA 2BI7A 5FJJA 1URPA 2O07A 3AJ8A 3MQ4A 5B6JA 5KTPA 4KK3A 3KQNA 1RC1A 1YCGA 1SCAA 1YUBA 2QG6A 2QRUA 3C4QA 4FMDF 1FMFA 3K1AB 1A04A 2C31A 1W0CA 3CA8A 4P4SB 4RIIA 2VHEA 5FTLA 3AEKB 3VPXA 4G1VA 3ANXA 5HHTA 2FN9A 1ZCFA 1ZA1A 3K09C 4TLLB 2FPKA 4LK2A 5CLFA 3TL2A 3HDQA 2QHSA 2FRDA 4FCVA 1W5AA 4BKPA 1RADA 2Q50A 1FJGB 4A8PA 5B37A 4GMDA 3I5MA 4X60A 5TQ0B 2ISQA 3KPYA 1M1YE 4DA7A 1H42A 2DTOA 4JP2A 5JU6A 3DE4X 3AUKA 1F6BA 3DT6A 1Z7WA 1E24A 4MWGA 4ZVTA 1U98A 4CLDA 4NL4H 2YUIA 6GPBA 1OLUB 2CUZA 1JQ3A 4JB3A 3OMLA 2VWPA 4FFNA 3RT1A 1CCWA 1AB6A 2WV7A 4WOBA 5F12A 3WA6A 2JD2A 1NASA 1VL6A 2QNIA 3RQSA 3AXTA 4IPTA 1O0CA 3HXMA 3E48A 4OGLA 1IC6A 2GFIA 2HCFA 3EEIA 3R3XA 5JC1A 1R4ZA 1FUIA 1Y4ZA 3CJQA 3GH3A 4R5MA 4CEHB 4A5SA 1T0PA 3TIVA 3KT6A 2K7ZA 2N9UA 4PPYA 3TOVA 1E2BA 3W90A 1GEEA 1NXWA 3T0IA 2OWEA 2C4TA 3AM4A 3D6AA 1BKDR 1XUOA 1U4OA 4L5YA 4GOJA 5IU6A 3HYTA 3F8WA 2CV0A 2IZ7A 2B92A 3H11A 2PR2A 3ABOB 1OXVA 4RGYA 1JL3A 2J32A 4RABA 4Y6OA 2BL4A 5ELLA 5DSZA 4R6WA 1RPTA 4CMKA 5TMDA 3RAFC 4JZYA 3FFWA 2W4MA 4OJNA 2OXTA 1W59A 3QEAZ 1OFTA 1NDHA 1VIAA 3A3NA 3FBTA 3H7AA 3O2QB 2R44A 4QGBA 1T0BA 4UJ5A 5A4IS 1OWPA 4H7JA 3HRHA 4N9QA 1QC5B 4GE3A 4LXHA 1JW9B 2AOUB 1GPBA 2ZIGA 3AJDA 1PQ4A 2PYZA 3P94A 1SD1A 4MSUA 3SDBA 4CQMA 4A2PA 3L41A 3DL2A 1LV7A 1SC3A 2D4HA 3MUNA 2UVPB 1LUAA 1QK5A 2C4UA 2G88A 4XRRA 5JY1A 2VT6A 1R9NA 3N53A 2FFHA 2IT1A 3HCWA 3RR2A 2YWGA 2QUIA 3DYBA 3ILSA 1QLHA 2D1TA 4URVR 3C74A 1MZVA 4DMGA 3HLYA 4URZR 2O3TA 4WDQA 4DIOA 4Z4FA 1M0WA 4R1LA 7REQA 5C5EA 1JB9A 5JBIA 5ICFA 4AXXA 2PU7A 2PGJA 2B4TO 3FVQA 3TW8A 4BX0A 3TRDA 4F4IA 4ZVUA 4Y18A 4E09A 5U9CA 4KQWA 3JQ8A 4WCFA 1NJGA 1BIBA 4D8UA 1QQBA 1JIUA 1LVUA 2E1RA 2VG8A 2PUFA 1A5AB 2DFLA 4R9NA 4RGBA 5G40A 1GPKA 3LX6A 4G09A 5CVUA 1QRUA 5DN6D 4DM7A 4Q47A 4EHLA 4PSVA 2GDZA 3JATA 1P5HA 1XZAA 1ZUNB 3KQQA 4EJSA 5F73A 3T7AA 5IXYA 3SYRA 4BTVA 3LD9A 4J1QA 2QE7D 4FLFA 4JI7B 3NALA 4XUCA 1JFRA 1E32A 2H1WA 4E5MA 2GJSA 3BX1A 2CXSA 3A58B 4N8DA 5J9FA 3GNLA 3AT1A 2AUNA 1NVFA 3KYDA 3UK2A 4ZGGA 2QU8A 2YVUA 5BN4B 3WADA 5JH7F 1GUDA 1VBKA 1WXIA 2I7DA 2AXQA 3IQHX 4IZHA 5DHPA 3T52A 2FDCA 2DEQA 3PGA1 4KSYA 2DG2A 1ZIDA 4Z86A 3BK1A 5BPFA 4H3HB 2J5RA 2J6HA 5JDCC 1ISPA 4YAOA 1NMYA 1YWGO 2DMRA 4D0NA 1FDTA 1Q0HA 2XSZD 5I45A 4Q03A 5HKLA 3WV4A 4A91A 1TC1A 3I53A 3ZWOA 1LU9A 4MUJA 4PIVA 3RIXA 1Z6GA 1KEKA 2BF7A 3LXXA 1F51E 1JA0A 1S8FA 1M1YB 2QZ9A 1BOOA 2ZIEA 2H2AA 2VZ9A 3VO2A 4YCLA 4RZIA 4HX5A 3TBFA 1U3WA 4KN5A 5JNLA 4EG5A 3T9DA 4MV3A 5A03A 1RWWA 2P3LA 3OU6A 2O05A 4Y1RB 2C5SA 3DWEX 3T3HA 3AY3A 3ZNOA 4GR5A 1NUQA 1UT5A 2ZFUA 3WL4A 2P7HA 1WJGA 3KOUA 1RFLA 1E2QA 4UVIA 2QMEA 2Y9MB 1OR8A 4XYGA 2ENUA 3LUJA 5GTDA 1KOJA 1T29A 2WPDD 3P4YA 5HM6A 2BGGA 2ZKLA 3W2TA 1WNLA 1DBSA 1O97C 1PG2A 4G1UC 4BKMA 5AESA 1QHNA 1FVHA 4LXUA 3CCBA 5DNUA 2HYIC 2XUFA 1P81A 3KU4A 1DFIA 4KQJA 1V8DA 1L4BA 4QOHA 4RAOA 3U7QA 2FV8A 1QJCA 4IXTA 4AF7A 2I87A 2HNBA 5K3AA 3STWA 4DW8A 4E6EA 3TZEA 1KJ8A 1RW4A 1BFKA 1M2GA 4CKWA 1DEAA 1Y5IA 4JGBA 1NBMD 1DKMA 1P1KA 5F1PA 5FWDA 3F67A 3U39A 2H52A 3SNKA 4HH3C 4JHLA 4C21A 1A95A 3NM4A 3Q3HA 1EI9A 2IXTA 3V8PA 1G3IA 4IYRA 1ASYA 3KT0A 2QRJA 3MJDA 1Q11A 4LMBA 4CZ2A 3Q1LA 4QUIA 4EG4A 3C6YA 3VJRA 5M7EA 2X2EA 4HLUC 1KRWA 1L3IA 1ZD5A 4U7PB 4BNMA 1QORA 4XDZA 5J1SB 1T5TA 1T6NA 4F4UA 4TV8A 4ETIA 1CUEA 1UKAA 1A9OA 1H1TA 5ALZA 4F3RA 1GT6A 2REOA 5KNCA 1P3JA 3JVIA 4LDJA 1KWKA 1J0DA 2HMYB 5EJMA 3WGYA 3P32A 1N33B 1OB2A 4JXKA 1SVOA 1OXKB 3R1IA 3QMVA 3RV3A 2VJQA 5KNDH 4O2BF 1MOSA 1B2LA 4XU1A 4Q3OA 1P3DA 2WWXA 1UMKA 4B6SA 3L1JA 3B52X 3OFND 2WT8A 3UYLA 5KJ1A 4OYHA 4EG7A 3I62A 4HBZA 1IOZA 1X1DA 3PIIA 1DTEA 2NM0A 5DJ5A 4EYSA 1VE3A 4J2OA 3OLVA 1C3OA 5F7JA 1RKBA 1WZCA 2RB4A 4UM9B 1LQ2A 2B4QA 3L0CA 3WAJA 4C76A 4WA8A 2QF7A 2NU8A 2VP9A 1RYZA 1PW7A 3E23A 2GJ4A 3KYCB 3NEJA 3PRKE 3MB8A 4JMPA 5DFAA 3IMEA 5BQOA 3T4UA 4RANA 1AUXA 2DFVA 3BDAA 1D2CA 3H5RA 4L16A 5IJXA 4ZV4A 1W25A 4RKWA 1DX9A 1EX9A 1L0WA 4ME6A 4RVDA 5CB0A 1E7MA 1HFKA 1R6UA 2ONCA 1XCPA 3HB1A 3HP7A 1U3UA 3GDGA 1N5OX 3KOYA 4OEHA 4K6FA 4EI2A 2A30A 4MV4A 1QMGA 3BMCB 2FX5A 4JQCA 1N2OA 5AW0A 1SVWA 1QGUB 2NU6A 3LVQE 2EL7A 5JS2A 2QPAA 3GNQA 5DGIA 3SJAA 3BD9A 3EJ6A 2P27A 2GZDA 1QU2A 1GFZA 4AF8A 1VYTA 3THWB 4IIXA 3UXEA 1IIRA 1ACJA 1T8UA 3DBOB 1E77A 4MR8B 4BNDA 3FFBA 4FSDA 3MRSA 1MV8A 4HAUA 1M34A 4C43A 1TF7A 4AJJA 2V58A 4YQYA 2PUGA 1TECE 1Z2AA 3Q8KA 1XYVA 2WJZB 3DDHA 5JYCA 4YRIA 4QVKA 4B3TB 1SU8A 4NS1A 3KR1A 4RJLA 5FL3A 3IVRA 5HIJA 5KWVA 2WTAA 3IA7A 5A9SB 5IUJC 4FWTA 1GGVA 4YTEA 5G0TA 5BMVB 4CDRA 2DWQA 1Y8AA 3I05A 3K1ZA 1ORDA 1Z5NA 3E18A 3P9CA 3MTQA 2OCBA 3LSTA 4MH0R 4RCZA 4DNQA 2P75A 1AY0A 3LFHA 4U5XA 1KGDA 3SEAA 5K51A 2DWCA 2VPIA 1CR6A 3IPAA 4HAYA 1MO6A 2C7RA 4UP8A 2QBYA 4AP5A 3ZQUA 1HORA 3HSKA 3WLRA 3HJCA 4TKZA 4HDNA 3RYHB 3UPTA 2F8MA 3VQWA 4C0WA 1DMRA 2H3HA 3HKEB 2AEJA 4LFBB 2O19A 3TFWA 1DHRA 3DV2A 2IE8A 3A9TA 4KHPB 1U7OA 4JQSA 1J0CA 2REQA 4OQYA 3ND6A 2JDID 3VU9A 4OP1A 1NW3A 3EFSA 3SF8B 1REQA 3QXJA 1ZFNA 3W5BA 1YB2A 4R7TA 1ZK4A 3ORRA 4C87A 1EQUA 3FJOA 2A5FA 1ZNQO 3GJ5A 1UZUA 1YZGA 5HE9A 4PG4A 3ZLTA 2BSQA 3R9XA 1TF5A 4JJEA 4KTTE 4U7JA 2OGSA 1K3FA 4JI6B 1NIPA 4BE9A 4COOA 1TYEB 1Y9EA 3N86A 4FQ5A 3JWHA 5TPWB 1KEUA 1E2JA 4R1UA 3EPKA 1YRAA 3AVQA 4YR9A 3WLTA 3NO4A 1C50A 1BE1A 3KWLA 4O4IB 4WADA 2A9VA 5EXDA 3DBVO 2QAGB 4MUFA 2OA0A 3VQYA 1XR3A 4D57A 4JNKA 4UDOA 1QFXA 3I42A 2NSLA 2ZI7A 3IBTA 4DWJA 2I3DA 4RHUA 1KO4A 1LY1A 1RHQA 3T1NA 1ZKDA 5MFZA 1GXSA 2QUKA 4YACA 4ZZ1A 3PXEA 1HG1A 4NOLA 1IUKA 4OLHA 4QFMA 4Q4JB 2PD3A 3ZK8A 4D79A 3AV0B 8ADHA 1O89A 4NJEB 4CEJA 3WO0A 3E1GA 4Q1DA 4P75C 1WKVA 3ZR4B 3T15A 1D2MA 4NENA 1T2UA 4GXRA 3OTWA 5EIBC 3KKQA 1HC7A 1B0UA 1MMFB 5B1SA 1ZI6A 2GBFA 5FH9A 4X1KA 3RJTA 3PRJA 2VN8A 5EE9A 3S8MA 4X7PA 1TT7A 4B79A 1SUSA 4I4IA 2PFKA 5BQFA 2X7JA 3LUBA 4LF9B 1NSFA 4BQPA 1PAUA 1L5NA 4FQ7A 1LJUA 3R41A 5A0VA 4XTWA 3LBNA 1RZ3A 5ABPA 1O4WA 4JLNA 3Q8WA 4GBED 4DQKA 4KUEA 1BXGB 1UDWA 2ZSDA 2Y9PB 1NY6A 2EKBA 1K4MA 1KH1A 1KZGB 2NV0A 3DFKA 2VZ8A 1AM4D 4MUGA 4FBMA 2AW5A 1EHCA 3TX6A 4Y3UA 2R62A 5IC6A 2V3VA 3W5DA 3B48A 5FBZA 3S2EA 3GJ3A 3PG5A 1A96A 4PN7A 2WV9A 3QPDA 3E22A 3JXEA 2TMKA 1U4NA 3SVLA 3IERA 4AP9A 4AIIA 1R0ZA 2Z0MA 4PLYA 2IY7A 2WKQA 3GH1A 1BBWA 1UC5B 3AX6A 3TI9A 4EITA 5HZMA 1W4ZA 2DERA 1OFIA 4JKIA 4ZAZA 2W00A 1NW8A 4IEIA 1RMQA 3DA8A 2XB9A 2O3QA 3K9QO 3EF0A 4OMDA 3QHAA 3D1VA 4X1OA 5FB3A 1B73A 4YCBA 3RUDA 2XT0A 4WFKA 1L0BA 3AKDA 1XJQA 3A4TA 5C8DA 3OZXA 4OU4A 1U3DA 3R20A 2IHBA 2Y1DA 3WGQA 1S2NA 4US0R 1KE1A 5ICSA 5A0FA 3SR0A 2BBTA 5FPHA 3A28A 4JS0A 1O7JA 1KQGA 4J91A 5I51A 1U80A 3G7UA 3X1DA 1RLIA 4EQZA 5F9MA 2R5FA 4EP1A 3IAHA 3NC1C 1E3SA 2GYVA 4X1IA 3EG5A 4AS2A 4BXOB 2FSVC 1KSHA 2IBTA 2IYRA 2P6RA 1MX3A 3SVTA 3CMCO 3FR8A 4CMIB 4HEA1 2I8AA 2R6JA 1PG5A 1M33A 1M75A 4B2LA 1M2OA 1UKVY 3SAJA 3UVEA 4CKBB 2CJWA 2OUIA 3ZTYA 1G8SA 2R60A 1PJ8A 3VKGA 3QYAA 1VI6A 1VECA 5EFOA 1I3MA 1LA2A 2FPGA 2FUNB 2O2YA 4OH1A 4WFQA 4FHEA 4LYFA 4B73A 2YJ4A 3F5MA 1NFRA 3A10A 3BSWA 3O4RA 2O6LA 5LQSA 2ZCVA 3PPYA 1JAZA 1EK0A 1KZ6A 2COUA 3R4VA 5A3RA 3TLZA 2A0KA 2D5IA 1JHRA 3HP4A 2Q0HA 1WPQA 5ULLA 4URWR 5A4FS 1FFBA 2C2ZA 3B78A 3GB9A 4CU5A 2I4IA 5JZOA 1TKAA 5JXHA 3FOBA 4ZYXA 4D9MA 3BE4A 1JZTA 2KE5A 2QRVB 1Y6GA 1HDXA 3JQFA 3LDGA 3MTDA 1FRFS 3W5AA 4WKPA 4KR2A 3KYIB 1P0IA 1TD9A 2GN1A 3MWDA 2IV3A 1ZI9A 2ORWA 5IBQA 3R2JA 5HKBA 5CB4B 3IX7A 4UD2A 2AIRA 3DONA 3QLUC 3UJHA 3ZY2A 4CL0A 3VKUA 4CMHA 1DJMA 1K6JA 1QTNA 2BKXA 1ZA2A 3BTSA 4K40A 5G4KA 4B4OA 3N3AC 4EUHA 5CITA 3ZD6A 1O9BA 5K0LA 5A9TA 4M7WA 1L4KA 4BWVA 1FYEA 5I8PA 3TL3A 4RO0A 2C2WA 5KNDD 1SRQA 4LZOA 3VR1A 4C4OA 2X19A 3Q9SA 2RGXA 3PPIA 4IDAA 4LZJA 2ZK7A 5JLAA 3SBDA 1QVWA 3P2JA 1XLTC 4EI7A 5KO2A 2RGUA 2OCGA 4ON9A 5B58C 5KNLA 4PHTA 3N05A 2HHHB 2GK4A 3X2EA 1APBA 1A9QA 2EVWX 4RSRA 4QBTA 5ALLA 5C1PA 3G0DA 2YJNA 5CUQA 2QTZA 4LOKA 4TKMA 2XAAA 5DI3A 4ZQGA 2J3JA 3KVVA 4P6VF 4JR0A 4DMHA 3K6SB 2QD5A 3MD9A 4BB5A 2XNSA 5FTJA 4MRVA 2VJAA 4CS4A 2ZWMA 4KGZA 2PLFA 2GAOA 5GIPE 4W6QA 2JJ8A 2QRPA 2IYQA 4NJMA 2IX9A 1Q6ZA 3JQ9A 2JATA 5G0SA 4HNRA 3DYIA 4PPGA 2O20A 3H9GA 2XE7A 5FOTA 1Q0TA 2XMPA 3OPYA 3VR2D 3K6KA 3V46A 3MN1A 3DWGA 4WN9B 1T3SA 4LVCA 5E9AA 5JPIA 3GZNB 3AVOA 1HK7A 3DPSA 4V39A 4YB8A 3VAYA 4AKTA 2ACVA 3BGWA 1S2LA 5BNFA 1QTIA 4IKOA 4DKJA 4PM4A 3ED5A 2XA9A 1FXWF 1MEOA 2I99A 3D6VA 5DNDA 1AQLA 5LBTA 1SVLA 2WDPA 4KLZA 3WXMA 4COKA 4EG0A 1XMQB 3JTMA 5L8VA 4JJAA 2BM8A 3BERA 1AC5A 4A0GA 1W36C 2IH4A 4B7ZA 3DOUA 3RSGA 1GCIA 2C04A 4U3JA 1ULTA 3P7MA 4TTAA 1I4DD 4WESB 1W9MA 1HUQA 3IEXA 4ZI7B 1P29A 4UPEA 1N2BA 1UJCA 2Q29A 2ZNJA 2FWAA 4D45A 5KHOC 4OM8A 1ZLYA 3T4XA 4Y6LA 4XIFA 3VNAA 5BV0A 3QX9A 1YI1A 2YIJA 3FKSD 3KQSA 1XA4A 4ZVSA 4EHBA 3W0LB 3HJUA 4O4JA 2VYFA 4HGOA 1JXAA 3U56A 2EATA 3RUHA 4BV3A 3QWHA 1KC1A 1PZFA 1Q0QA 3JQGB 1Y1TA 2LIVA 2OTCA 4KH0A 2Q2VA 4G1EB 5H9WA 3RACA 4EPXA 4UEJA 4ND3A 5FV4A 4FZVA 3RIYA 3UKDA 2O8FA 4HD8A 4Q3KA 4K88A 5J4VA 1V5FA 3KDPA 2GSWA 5JQGA 4DMCA 1LD3A 1G64A 3G8YA 3QA3E 5HP4A 1LW6E 4KO1S 4QM7A 4XDYA 4HZIA 4FC6A 4PRZA 3CM0A 1RR6A 2P9TA 3H9BA 3SEQA 2JLYA 1A9XA 2N46A 2Z56A 3GGDA 3QW2A 4ZHQF 2O06A 1Q0RA 2H7YA 3BJIC 3DEKA 4M38A 3P26A 3TVDA 3IVXA 4HQ6A 4IXWA 1E6CA 1CJSA 1KVUA 5D6OA 2OLEA 3QELA 3EIQA 4MR7B 4NULA 1MNQA 1YVUA 1XFDA 2V7WA 4CDMA 3AEUB 3RS2A 2FEXA 4H77A 1IBKB 2QX7A 1VQZA 1QDUA 2PX4A 4G4GA 4OXIA 3UAXA 3PQEA 1T2CA 1GG5A 3IOYA 2VHUA 3C15C 4XWOA 2RGRA 4W8HA 2P8SA 3QTCA 2E18A 1D2GA 2GN2A 2WHEA 4EKEA 1CEYA 4Y0AA 3R5FA 3LDHA 1CZKA 1SPBS 1NURA 2VF8A 4MUNA 2FSFA 3OY7A 5U1PA 1CS0B 3BAFA 3LUKA 3FUCA 4TLCA 3SHOA 2YXNA 4HOYA 1F8GA 1JBKA 4PCAA 5JNSA 3WMRA 2O2GA 3OQBA 5CPBA 2ETXA 2EQ5A 3HXLA 1IUOA 3PGLA 4LMRA 3OBBA 2JLBA 3HACA 3NC4A 1DAEA 2OC4A 5DHAA 4BWYA 4KBFA 4DCVA 5ILOA 3ZHCA 4NXMB 1XKTA 2GN4A 3K2BA 4RZ3A 4A15A 2CEAA 2XLCA 3WNCA 3THXA 5K0GA 1XP8A 1UAYA 4GX0A 4ZO6A 5JD5A 1H6AA 2CYBA 4NBSA 4KXMA 2H3EA 3LCRA 3HJGA 3RVNA 4KVFA 3TQRA 4WOKA 1MB0A 4OMUA 3WL5A 4Q1VA 1T0IA 5FWAA 5K0TA 4C7MA 1SY7A 3HO1A 1KMNA 5FQNA 5DVZA 5HZHA 1JA9A 2ASVA 4RZSA 5CT9A 4ZMBA 3DAGA 3NIWA 1WO8A 2AJ8A 2C9ZA 2W58A 2YIMA 1E9DA 2ATEA 5AKJA 5YASA 4ENSA 1UOOA 2YBDA 4HS9A 4YJ3B 4YYZA 4RV9A 4P35A 4RY8A 2IPLA 3C8DA 3MTBA 4OG2A 3ADCA 1RLOA 5JFTA 3ZJYA 4RPIA 4EG3A 3GRRA 3WL7A 1C9KA 4BZWA 2G17A 1XTTA 4YALA 1CHDA 1LI5A 1KVQA 3NT4A 1G8KA 1PR4A 3QXGA 5TJHA 2YH2A 4EPTA 2QIOA 3TAUA 1Y1SA 2VF7A 4ZJUA 3DV0A 1CUUA 4DMLA 4WEOA 4EBFA 5BN5A 2WZQA 5IUNC 3A9VA 2FZEA 1S0UA 1QP4A 3E7FA 4D3SA 1S4QA 1OWMA 4DCTA 1W4LA 1BS1A 2OGZA 4EAQA 4AKHA 4B44A 4HWGA 1QKIA 4DIMA 3SSOA 3W3ZB 4Y8VA 4ZKDA 3A2MA 4DE5A 4GXNA 5KVAA 2G7ZA 5K0BA 3ENQA 3UIEA 1CW2B 2IYXA 3HP1A 2UVQA 3P71T 5JRZA 2OKGA 1ACMA 3PNPA 3HCOA 4FEGA 4PAWA 1FFCA 3U7FB 1Z5WA 5BVHA 1Z2DA 2GI4A 2CNWD 3H11B 3TEGA 4ZVOA 4WXEA 3HGMA 3QWAA 4AK9A 5ITSA 1NRXA 1YGYA 2XB4A 4HVLA 2I34A 3WP0A 4PFJA 4NE7A 4Q3LA 4R31A 3OZTA 3U49A 1F4VA 2FEWB 1TXGA 2AMJA 3EXHC 1PNOA 3K9GA 4LXQA 5KSYA 2PKQP 1UBHS 3HBNA 1WQWA 2AX4A 4W82A 5U4XA 3CU5A 4BVFA 4UHDA 2EW8A 3E5MA 2CHFA 2XTAA 2YN4A 3BRCA 4UXJA 3TZHA 3ZWPA 4EOGA 3F0TA 4CG2A 1SHLA 3EIWA 2OCLA 3GJTA 4QJIA 4QTYA 3EVTA 4YMIA 4EB3A 1T9AA 2HBYA 3RSZA 3LLCA 1KP3A 3OF3A 4ZAGA 3ZGXA 2OYSA 1SO8A 2H57A 4GGPA 3ULKA 2G28A 3BSFA 3OPXA 2G09A 3AY7A 4FR0A 3GDWA 3NBQA 2GASA 2ZROA 2HF7A 5C4IA 1W93A 1W76A 5A6SA 2BBOA 2HNIA 4UAVA 3QU4A 4QODA 1IDN1 2H17A 3COZA 3OTHA 3THRA 1WVGA 1YOVA 7REQB 3RRYA 1FS5A 3OTOB 2GR9A 3DE2X 1K86A 4JC0A 4Z0TA 4AURA 1C9EA 1Y89A 2PUEA 3TW8B 5JS8A 4D1YA 1V6CA 3JQ8B 2J59A 4LY3A 4WCFB 3SZLA 1CP3A 1UBTS 1TRKA 2Y6UA 4Z7JA 3TBKA 3IR5A 4K9PA 3QX7A 4ZI7F 3NFRA 4A1OA 1JR3A 2C4KA 1IVYA 2J0SA 4RAQA 2J3DA 1GKKA 3ECCA 4EECA 1EM8A 2Q07A 1JYSA 4PFSA 1AVTA 3B2QA 4Q9NA 5A6VA 2QN7A 3JATB 4GS5A 2J5XA 1Y1KE 4V24A 2GTHA 2I7XA 1AK2A 2XE8A 2AJDA 3MOIA 2ODBA 3PX2A 4RYDA 1MV5A 3KJXA 5DCUA 1W88A 4MKHA 5EPUA 5I7WA 4Q5IA 5CGZA 5G41A 3ZVKA 2C1EA 5HA5A 5JV5A 2PKXA 4M54A 1EG7A 1QIJA 3CN7A 1SBTA 3BJMA 2I54A 3G1WA 4OYRA 1C0AA 2DECA 4XUEA 4ARZA 3VR6H 3ILHA 4KWCA 2PJRA 4DR7B 3BREA 2A7QA 4EW2A 4DQLA 4BQFA 2C0PA 1NLZA 3VOTA 4ICIA 3KWMA 1NBWB 5B2EA 3IAUA 4QPJC 4I4TB 4WV3A 3GUYA 1SUEA 2QUHA 1M34E 4D56A 5KTSA 3W8DA 4B6QA 4DUYB 2HWYA 2AK3A 2JI8A 1PUXA 4IUYA 2EFGA 3D3QA 2W2OA 5G0UA 1RQ2A 1IRXA 2I2XB 3V2IA 2FP3A 3M1YA 1CR2A 3JALA 2GLTA 4FZRA 1BA3A 1K8RA 4FZ3A 2FZKA 4WY5A 5A1TA 4OCZA 3CLVA 3DBIA 3I30X 3R5HA 2EAUA 3IQFA 5IHXA 4PANA 1Z2CA 5I3CA 1L7QA 4AY4A 2PX6A 3K5IA 1DKLA 2O3SA 2ONKA 3FBWA 5BSWA 3AHDA 1THMA 1XA3A 4LNUA 1UJ4A 3SKYA 4KV7A 3V42A 2BMVA 4MA4A 3NX4A 1JBQA 4BLQA 3CLRD 3DAOA 3I39X 5HUJA 3SC2A 2EJBA 2J7PD 5EKUA 4A23A 1WB5A 1KH3A 2I6FA 3QRWA 4WOJA 3H04A 5BWBA 1ODFA 3EXG2 2XMGA 1II8B 1XRMA 3OZCA 4XD7A 1RCUA 4C7VA 2JJMA 2VYND 4EPVA 2HJWA 1ZD8A 2WWTA 4M89A 3MXOA 4N6GA 3WHPA 1ICIA 2BDUA 2CHVA 4EF4A 4PG3A 4LZAA 1KXJA 1Y1LA 4P7KA 4BGDA 1KWGA 3O73A 4P0TA 4LXTA 3SY8A 3COSA 1OFHA 5ESXA 1TM3E 2P1RA 2O52A 3D4BA 1GM5A 5AP9A 4HGYA 5BRNA 2F3RA 3GPLA 1YFTA 5JS6A 1KKUA 1Y3HA 3FGPA 5EYPA 1TM2A 2ZATA 3B8HA 4XM1A 4CN8A 4ER3A 2JZNA 1UOQA 1D6MA 3VTKA 1H6BA 2OHIA 2ZBFA 4FGZA 5AMXA 1LQTA 1ZXLA 2XZDA 4BO1A 2OQIA 1DWQA 1N2CA 1C1DA 1KI6A 3BIJA 3BA6A 2CVHA 2PY6A 4YK7A 3DLCA 1VCIA 1F5SA 2EGHA 5AWFC 2PXAA 3PXCX 2QTVB 1X1QA 2PEYA 4ITVA 4QARA 3UK6A 2XMRA 1YFLA 5F9FA 3ZCRA 4JITA 1Q21A 5CEJA 2ET6A 1ZXXA 2ANBA 2R2GA 2RI6A 1U0OC 2AQIA 3CZQA 3DMNA 3S68A 2IPXA 4U2DA 1MH1A 3AQ4A 3EASA 1T2AA 3U13A 4HGQA 3AB7A 2QNBA 3U3OA 1M2VA 1L7PA 4LYGA 3VVMA 3IALA 2ECFA 1VL2A 2QYSA 3DLAA 3ERCA 1P7VA 4YPFA 4HNQA 2QPOA 4MOWA 1S4MA 1C81A 1AS3A 1IATA 3U19A 3LX4A 3KETA 3U26A 3BWDD 1O6FA 1DAMA 1RACA 3UMRA 3EWAA 1JG2A 1TJPB 5HIMA 4XJSA 2OFFA 4BNNA 2ZR7A 1PU2A 4E31A 3NLLA 1OYVA 4ZV9A 1QHYA 2EF0A 4RZUA 3V8EA 5EJ5A 4JDPA 2XZLA 7ADHA 3CPHA 1RBQA 2CMGA 2EBHX 3PYLA 2B2CA 1RI5A 2G72A 5B4UA 2DTDA 3S8YA 2R7NA 2XADA 1Q91A 1BWQA 3TD2A 4IGEA 3FSRA 4BV9A 4JVOA 4F2HA 4D4GA 2BFBB 5CBPB 4WLUA 3ASVA 1KI9A 2XUKA 3ET5A 1QYRA 5BYBA 3P1JA 1EUYA 2B6NA 2D6FA 4I8XA 1ZK1A 1CZLA 3BCRA 1T9HA 2BMWA 3FX2A 4R9RA 3RC7A 5I4KA 4EI8A 5EC8A 2QI9C 2ZRAA 2D8MA 4Q7KA 2PX8A 4BNDB 1JEDA 1OB5A 4D3FA 2JHGA 1FFDA 1GKLA 2PGXA 4TL9A 5SICE 1KDVA 4F4FA 4JGIA 4V0QA 1DOHA 3IKMB 3HKBB 4YDSA 3BB1A 5EKSA 1JE1A 4L7VA 1XOIA 3OCXA 4P74A 1JYEA 1O6CA 2A86A 2H65A 3PSHA 1BCSA 1BSVA 1XAHA 2CMKA 1PJQA 4PO8A 1GPLA 2HIAA 1KEVA 3MTGA 4Q12A 1YJCA 3OF2A 2W22A 4ID9A 4P7BA 1D09A 4OP3A 4H1TA 2DDZA 1RYYA 3I2GA 2BR4A 3RC2A 4WE3A 3IO5A 1VLVA 1DRVA 1NFFA 5EP4A 1KQFA 3C1UA 4OHYA 1O9GA 1E79D 4AJ4A 3CFYA 1YCDA 1TTHA 3EH1A 1JJFA 4M0EA 5KOYA 4WY8A 1WMSA 2PS9A 5JFOA 4RTPA 2ZJ2A 4KO2S 4XYLA 2OGTA 3AK4A 3QKWA 3CMQA 3RU9A 1UFKA 3O4IA 3TPFA 4QUAA 3ZDYB 5IAOA 1U9JA 1GPUA 3HU5A 1DTWA 4DBLC 821PA 4ZIBA 4FXPA 3CUVA 2QBYB 2OAP1 4EVQA 3HKDA 1ISSA 1K6MA 1X74A 1Y6JA 2DZDA 4ROSA 2B9EA 2G4LA 2ZIFA 4TXHA 3VYRB 2HLHA 1XO1A 1K5PA 4D43A 2B5OA 2R5WA 4UPDA 3WMWA 2DFNA 4HVTA 1E7RA 1G3MA 3ANNA 2AG0A 1I36A 4YAUA 5B3AA 2REQB 1WULS 3H3XA 4GMGA 1JALA 1R6XA 1X87A 1YONA 4XX1A 5C35A 3A27A 1QOQB 3EZ6A 3CSDA 3R8FA 1VZ3A 5I7OA 4RXUA 3R3VA 1REQB 3ZTWA 1L7AA 2C0QA 2YW2A 5C8YA 3IT2A 4DLYA 1GPYA 3SF0A 1P2TA 4BAGA 2YDYA 2K2WA 1J2JA 4OYLA 2PUHA 4J4HA 4UTNA 3R9XB 4MMYB 1L5ZA 2R8XA 1GL7A 2SBTA 3WDSA 4YEDA 3GFVA 2WQ6A 2I65A 4FVTA 3DAHA 4G4IA 2E3JA 1I14A 2ID8A 4JQZA 1Y9JA 1QH8A 4XFJA 5ADHA 5DN6A 4P4TA 1SXQA 2ZWIA 7MDHA 3T7CA 4IIFA 2QUBA 1J23A 3BQMB 4LJ6A 1WB6A 3R40A 1XQ6A 4RLQA 5JPDA 4QATA 4DLPA 2QE7A 5L95A 2P78A 3IQZA 4YAGA 4D26A 2P1ZA 4P7GA 1GHTA 2Z6QA 1D6NA 3GHHA 3L79A 4S2UA 3NH6A 4KSBA 1W4CA 3HA5A 1SKBA 1TVMA 3L0YA 1QNLA 3RS4A 5LNK6 1TCCA 4WLOA 1SHTX 3TMAA 2BZGA 2WIJA 4X97A 1ZAKA 1RZUA 4PZDA 3SG0A 4CEJB 3KQHA 4JQYA 2OE2A 4CETA 1FPMA 3AUYA 3TDNA 3HB4X 4Q0MA 4NENB 2XSZA 3L8CA 2ZRDA 1RCFA 1JIIA 4HN4B 5G1OA 3O90A 2R1TA 4KIFA 4UBLA 3U17A 2DTHA 4PG7A 3DHVA 1XFAA 2HRBA 2GVZC 2PNFA 1E2MA 4M9CA 1QUEA 4X1KB 3EYWA 4R5HA 1AT1A 3DGFC 3QJ5A 1SCIA 4V0SA 1C9NA 5A4JA 3A6LA 2Q6IA 4BB6A 1M1NA 3K8OE 4D81A 4E32A 5L4LA 1WDWB 2G1AA 1XCBA 4NU8X 2NUBA 4JMLA 3Q9LA 1JU3A 4G0ZA 4IP0A 2QGNA 1MJFA 3NTUA 3RPEA 2VPWA 1NYRA 3W8FA 4QEZA 4AY5A 2AOWA 5AJWA 1JEEA 3DZKA 4ZU1X 1BGWA 4ZEOA 2PTHA 3U80A 3V8RA 2AFRA 4LX0A 3ZKAA 2I8CA 3ZOKA 5JNTA 2Y77A 1NYLA 4JJKA 2G9RA 3ID6C 2P3SA 3DS8A 3O0DA 2H9YA 2X8WA 4Z9FA 1LPOA 1KSGA 3VZRA 4D8TA 1GTG1 1L9KA 2NZWA 1YI0A 2WPDA 3EVCA 3VR6D 1O96A 1P5ZB 3LUHA 1V5GA 4REQA 1H8HD 5CFOA 2B83A 1Y82A 1H6DA 2GPJA 2VAMA 4MQFA 4ZRNA 3L6UA 2AOVA 1CUCA 5SZIA 3TIGA 4UE6A 4UQOA 2GVDC 1HNZB 3D6UA 2QOEA 1T9GR 2CLDX 3MSCA 2X0KA 2PXHA 2HAEA 1N0WA 4H1HA 3TKYA 2HJRA 1CVIA 5FLYA 3SX0A 3ZCXA 1XZFA 4F8EA 2QRZA 1NVKA 2AKWA 3JQDA 2DHEA 2Q5IA 2CXOA 1NBMA 1FOEB 4DSUA 4OHKA 4BEVA 1UT8A 1G5PA 3R9KA 5DXJA 2FAXA 1T1JA 3DOJA 1ZYUA 1IHXA 3BKXA 4OV6B 1C7JA 1CJKC 4S24A 4R3WA 1HDYA 1TC2A 4J1SA 5JEDA 4KQ9A 1RI3A 4OKNA 3SBXA 4RV4A 3TXYA 1UR5A 3ST7A 1Q92A 4NPCA 3LA6A 3UMBA 3PFCA 3VQXA 2PGLA 1GAXA 4IRXA 3TEJA 3JSAA 5TRTA 1Z8DA 2PSSA 4X1IB 2EHDA 4EMSA 2OHFA 1NQ5A 2PHZA 1G21A 3ODPA 3TEHA 2VCEA 4D8XA 3BVPA 4YIHA 2WWIA 4ER6A 1RKVA 1XF1A 2MSDB 2QSUA 4ER5A 5AW7A 1ABEA 5D00A 4AICA 1ODSA 4QQFA 1VDMA 4YGXB 1UOEA 1UBEA 2YYSA 5C5DA 4DLTA 3HYCA 1M2OB 3QTLA 4ZODA 1DBRA 3OFNA 3AVUA 4UNNA 3C43A 3HJNA 3TZQA 3LQ2A 3ME5A 2QN3A 3K92A 4RJ2A 5BURA 1HDZA 2IYUA 1PV2A 2EOAA 3EUEA 4MKFA 3KSAC 2BWJA 2FPGB 4H27A 3C5VA 4J76A 3AV3A 3H84A 5EQJB 1CUVA 1B00A 1FA9A 5KYNA 3R0ZA 3OZEA 4YT5A 1I9CA 4MHSA 2BZ1A 4QDJA 4A8TA 4Z7OB 5CX1B 3U62A 4DCPA 2YASA 5HW0A 3BS4A 4K9QA 3LQQA 1CQXA 1MAHA 1CDOA 1ULZA 1H0KA 2HRCA 2MIIA 3IDOA 3PZBA 1E1LA 4JP3A 4Q02A 4RJKA 1QB8A 2IZ6A 4I3HA 1V0JA 2BLNA 1H2FA 3A1UA 2X6RA 3PKJA 4JBLA 3I5YA 3MWDB 4S1NA 1HYEA 4R1MA 1ANKA 5IWAB 4NNPA 4K8RB 3LF1A 4TLDA 3S1SA 2VHWA 2AJLI 2DPHA 1N8NA 1JTFA 4DQDA 1Z0ZA 3DAYA 1TPYA 3L1KA 5FPTA 1J2TA 1SBIA 3RREA 3OCCA 3I3SR 1KK2A 2YJ6A 2ZYRA 2PMWB 3OP1A 3T3NA 2VNSA 4EK9A 4QL3A 1TKBA 1IHDA 4G2TA 3W1VA 1DCTA 4OH7A 1C3JA 1VI2A 3U3MA 1AU9A 4RQBA 1GPH1 4EAAA 3LBAA 1RTTA 3V1TC 4D6XA 3J81A 2DETA 3RYFA 2QHXA 3H13A 3NUGA 2OBNA 3EZYA 4HFJA 1ZJ4A 1L6RA 4NVRA 2G5CA 1AKRA 3KE9A 4YI5A 2D1YA 4RIGA 2D00A 1C8KA 4OVKA 2BGJA 1TNDA 3NYIA 1GQFA 3L1IA 2AL7A 2JAHA 4EUKA 1YR1A 4X62B 1JZQA 1DGQA 2PL9A 3BXGA 4JC5A 4H2YA 5DI3B 4WJLA 2PT9A 2EEZA 2X9QA 4FHZA 1B8PA 1P7PA 3VPCA 5IAEA 3OOJA 2OV3A 4CV2A 2ODAA 4BQEA 1L8QA 4PN3A 4BMPB 2IU6A 4DKXA 4LZLA 2XH8A 5KINB 5FOWA 1A8UA 1NI3A 2E4WA 2KPOA 3RI3A 5D5QA 2FR8A 4DANA 2EKLA 1BH6A 3B6MA 2BGIA 4D9KA 3KVNA 1FSSA 2ZCUA 2NV2B 2JKVA 3DZJA 2V4UA 1XIVA 3I1YA 3L92A 5IN5A 1L5GB 3TIIA 3ZXIA 5BSVA 1XI2A 2E82A 4ML3A 5IJ0A 2O8BA 4IR7A 4MARA 5I9TA 5DNCA 2JDIA 4YDRA 1AUQA 1G16A 3HGQA 2EJWA 3QKRA 3COWA 4CH3A 1HSOA 1PZMA 4LVIA 3Q2KA 3M4XA 5HZKA 5JRJA 3UHOA 5B5SA 1O58A 1E59A 2JLVA 2HDHA 2VOJA 4TTPA 3OZSA 4EFMA 3G0HA 1TZCA 3T8YA 2HA5A 2XQVA 4HT3B 3L0IB 2FX2A 1TEXA 3PEEA 1MA3A 4J7CA 4MVJH 4G85A 4O4IF 1UBLS 4TWAA 3GJ0A 1QIFA 1Z6AA 3PUZA 1LI4A 4US1R 3HBLA 5KAPA 1I2DA 1U8ZA 3NBFA 4FXOA 3EIHA 1D0SA 1EVIA 1XQXA 4J0JA 4DBZA 4YRFA 4RD3A 3EIUA 4KQ6A 1GNVA 2C42A 1KY4A 3H99A 1H2YA 3JZFA 5CBPA 1XEXA 4S2EA 1JFVA 4JELA 5IF3A 5CLHA 4O4JB 4JJIA 4DEVA 1TJ3A 1UIMA 1M8FA 1UMDA 3D6NB 2YHSA 5FFFA 4LYHA 1DQRA 4ND1A 2DCMA