4ZTZB

Structural basis for processivity and antiviral drug toxicity in human mitochondrial dna replicase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
418
structure length
363
Chain Sequence
ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA polymerase subunit gamma-1
publication title Structural basis for processivity and antiviral drug toxicity in human mitochondrial DNA replicase
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 363
sequence length 418
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ztzB01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4ztzB02
2RHQB 2DKGA 3DSQA 3HXZA 2ZT6A 2HNIA 4J15A 2ZZEA 1WQWA 1EFWA 1X54A 1E22A 4YRIA 4L87A 3RUXA 2IY5B 1SESA 3HXVA 3MEYA 2P5IA 1G5IA 2ZZGA 4RQFA 3A5YA 3KFUA 4XTYA 1SRYA 2ALYA 1VQZA 2Q5IA 2ZR3A 4P75A 2XTIA 4H2XA 4YYEA 4WI1A 3OD1A 2ZXFA 2CIMA 4TQFA 2DQ0A 4YRCA 3HFZB 1USYC 3UGTA 1KMNA 1G51A 4RMFA 2C7IA 2ARUA 2DVEA 1H4QA 4YP0A 4H2UA 1YFSA 4TVAB 4HWPA 3ERRA 2FYKA 2ZT7A 1JJCA 3REXA 4YRTA 4HVCA 4XU0A 2DXTA 3PCOA 4KR3A 3A31A 3RKXA 3L4GB 2EJ9A 3M4PA 3QNEA 4P72C 2DTHA 3VBBA 1HTTA 4YCVA 4OP0A 1ATIA 1SETA 4Q6GA 2J3MA 1ASZA 3HXYA 1B8AA 4YRQA 4LNSA 4UPAA 2RHSB 4WF2A 2ZNIA 1USYA 4G85A 4YROA 4YRPA 3RACA 2DXUA 2CJ9A 4P71C 1YB3A 4RDXA 1B7YB 3HFVA 4RQEA 2E10A 3RL6A 1ADYA 4HA8A 2DU5A 4YRSA 4H2YA 3L1AA 4Q15A 2J3LA 3TEHB 5ELOA 2ZINA 4EO4A 5ELNA 2ARTA 2ODRC 4O2DA 4P72A 4CH3A 3LSQA 1BBUA 1V95A 1B70B 1EQRA 2DZ9A 11ASA 4DQ2A 4H2VA 2DU7A 3A5ZA 4XTUA 3M4QA 4HWSA 3MF1A 4X5OA 5K1XA 4P71A 1EOVA 2QHSA 5C51B 3A7RA 4E51A 2QHTA 4TTVA 1EIYA 4YRJA 2ODRD 3IALA 4YCUA 3NEMA 3FJPA 2ZNJA 3V8LA 3UGQA 4XU2A 3R07A 4HWOA 3CMQA 2P0LA 3E9HA 2EL9A 3G1ZA 4K88A 5F5WA 1L0WA 3EFRA 1N9WA 3IG2A 2ALYB 1KOGA 3TEGA 1YFTA 4NCXA 3VQVA 3P8YA 4XTVA 5C52B 4H2XB 4XTXA 12ASA 3UFGA 3HXWA 3VQYA 2ZGWA 1X56A 4P74C 1GGMA 3RKWA 2DDZA 3NENA 3EFSA 4BWAA 2E1HA 1PYSB 1RIQA 4H2SA 2EWNA 4OLFA 1EVKA 2CJBA 2E41A 1X01A 3WQZA 4YREA 1IL2A 3TUPA 3HY1A 2ARSA 4TWAA 1NNHA 1WLEA 4AH6A 2AKWA 3VQWA 4XU1A 1QF6A 4XTZA 1YFRA 4P3NA 4PG3A 3BJUA 2Q7HA 3V7CA 2Q7GA 3REUA 3RF1A 2PMEA 4HWTA 1WQ7A 4TVWA 1BBWA 3QTCA 4CS4A 4YPFA 2ZR2A 2ZCEA 1KMMA 4CH4A 2ZT8A 1J5WA 3MF2A 4YRLA 4P74A 2RHQA 3RKYA 1NJ5A 2G4CA 3E9IA 4YRFA 3HRIA 4P73C 4DPGA 2DJZA 2AMCB 1B70A 3V7SA 2ZT5A 4YRRA 3IKLA 4TQDA 2IY5A 4XU3A 1Z7MA 1C0AA 4CS2A 1WPYA 2PMFA 3RIRA 2C8MA 4ZIBA 3RGLA 3A7UA 1WNLA 2DQ3A 2CGHA 3IKMB 3ICAA 4UP9A 4UP7A 3A7AA 2DTIA 4YRGA 2LW7A 4H2WA 4P3PA 4G84A 4YRKA 5K1PA 4CH5A 2Q5HA 4K87A 4K86A 2E65A 1H4SA 1WU7A 3PZCA 1NJ2A 3HFZA 3HXUA 2Q7EA 2I4LA 3HTZA 3LC0A 3NELA 2I4NA 1E1TA 2ZIOA 2E64A 1G5HA 4YRNA 5C53B 4WJ3M 4CS3A 2QHUA 4YRMA 2E3CA 1EIYB 3V8JA 3A74A 4P73A 2DZCA 3L2ZA 3QO8A 4TVAA 1NJ1A 4XEOA 1E1OA 3QO7A 2CJAA 2I4OA 4UP8A 3L4GA 2EJFA 3V8KA 5E3IA 3A32A 4KQEA 3HY0A 1LYLA 1PYSA 4ZTZB 3HXXA 2I4MA 1X55A 4H2TA 1QE0A 2EAYA 3V7RA 3BFMA 3UH0A 3I7FA 3LSSA 1NJ8A 3VQXA 2RHSA 1JJCB 2QHVA 2ZTGA 1HC7A 4YCWA 1X2HA 3PCOB 4P3OA 1WYDA 1YGBA 2XGTA 2DEQA 1H4VB 1B7YA 1X2GA 2ZZFA 1ASYA 4HWRA 5HGQA 2ZIMA 1EVLA 2E5AA 3HRKA 5KNNA 1NYRA 1E24A 1ADJA 3TEHA 3NETA 4WJ4A 2AKWB 4ZTUB 4TVYA 1Z7NA 3P8VA 4XTWA 2EJGA 1BIAA 4P75C 4EX5A 4PHCA 1NYQA 2DTOA 2AMCA 1FYFA 4XEMA 1NJ6A 1B76A 4H02A 1W66A 4YDQA 1BIBA 3QO5A 3W3SA 1SERA 4KR2A 1HXDA 3P8TA 1H4TA 4CH6A 4BW9A
chains in the Genus database with same CATH superfamily
4FHGA 4NIMA 2P2LA 2F4NA 5C4GB 2PHZA 5FWYB 3PJRA 1I2CA 4YXWA 2G25A 3U4MA 1P5HA 2HNIA 1NLMA 4PLTA 2NVBA 4TYPA 2HCRA 3W4JA 4L95C 2NP6A 1DQZA 5CVEA 3GPIA 2H18A 3F8WA 4X94A 1ES9A 4C5AA 4DUGD 5JCXA 1L4BA 4D3SA 4J94A 4MV5A 2W58A 4KWTA 3TGWA 2CNNA 3WV5A 3ZE0B 3KJFA 3IVXA 4QDTA 3WK8A 5J4KA 2Q46A 4YRIA 2Q21A 1KJNA 2CNDA 4XSVA 4D8VA 3CEAA 2VOJA 1WZIA 1F0PA 2FCAA 5EWLA 4AIIA 1KPGA 2GDZA 4DQLA 3DO6A 3V8NA 1MO4A 5HEKA 4EAQA 5IWCA 4AX4A 4AN4A 2VYQA 2ZRGA 1JHXA 3A7DA 4UNSA 1W47A 2W5UA 1KKUA 2YY5A 3EZLA 4G1CA 4YIKA 5DHPA 3VZSA 5FFMA 1M5RA 4ZQEA 1G19A 1U8UA 4ZWNA 1GXSB 1XRLA 4PFQA 3I64A 1B16A 2G8NA 2QMHA 3R6GA 2VQDA 1HXHA 4PZAA 2GN0A 2JGMA 4YQZA 1PJ2A 2J33A 1ESNA 1S7CA 2R48A 2ZR3A 2HO5A 2FUG6 3DLTA 5EMNA 2R8PA 3EZ6A 4UCFA 3V7UA 3R7SA 3USCS 3ZE1B 5ECGC 4RLFA 4ZDIA 5GZ1A 4BJHB 2HK7A 2J0UB 3FYUA 1QGUB 4ND3A 4MLDA 4AU1A 4ZI2A 5JRZA 2Z1NA 3TKYA 1R88A 1DKRA 1U65A 2IP1A 3EGDA 1FUEA 1YR7A 2LKDA 2YFHA 3R40A 4GS5A 2WTMA 3VRHA 5AVRA 4DIDA 3PZBA 1O95C 1K7SN 4F91B 5IG2A 2W4MA 4BNVA 4LV6A 4M89A 1V37A 1XQ9A 3Q5EA 3VSEA 3OFJA 4JIGA 3A27A 4PR0A 4XR4A 4OP1A 4DJ5X 3U61B 5TJHA 1KMNA 3ABOB 1ISSA 3A14A 4X66B 5LD2C 4JEIA 3LQFA 2B5VA 5JCJA 1WB5A 5EJAA 3ZTWA 1CB0A 3D0OA 4LMPA 4OK5A 1UJ2A 1SXQA 3FUVA 4OHVA 4LG1A 5BPFA 1AV6A 1X8KA 2F4VB 4LXTA 3RYFB 3CBQA 3ZU4A 1KOFA 4J49A 1WUIS 3QXGA 2REQB 4C29A 2WY2D 2YRXA 4CQMB 1LY1A 1N5RA 3DEAA 3H5WA 4NTZA 5TRTA 4YRTA 3B7GA 4BNJA 4HVCA 1ZUHA 2D1FA 1ZCAA 3ZGNA 1AK1A 1RKVA 3JQ7B 3BGOS 3PFIA 3T9EA 4F3YA 3HEMA 3OCJA 4FFPA 3ZQ4A 3RASA 4ZZ3A 2ODTX 1R12A 3I1IA 2HT6A 2HSWA 3H4MA 4I5EA 2HV8A 5DWDA 4JEMA 3UXEA 4DV6B 3LHSA 4Z3KA 2GEFA 3CURA 1JPNA 2PD3A 4G5OA 4B6GA 4NENA 4E5UA 4OAPA 4ARBA 5CEFA 1HH4A 1C2YA 2LUOA 3LUJA 4PE5B 1OTYA 2ZCVA 4DR1B 3LXRA 3WGOA 5EXEA 3HGTA 1SETA 1X77A 2VJMB 2WYVA 3EZNA 4HDRA 1P2VA 4URXR 4ECAA 1XNGA 4TKUB 4A1FA 5KJFA 2B4AA 2JCYA 3PKIA 1TNDA 4BXOB 1TLTA 4IHAA 4RZSA 5AHRA 1KAQA 3QXJA 5CXQA 4PSDA 4P4LA 4V2IA 4G0OA 3K20A 3DDCA 4PZEA 4NBRA 4PRYA 4E70A 1CWUA 1N2CA 3G68A 3RANA 3RVDA 3OEED 3C16C 4XJVA 2O0KA 1CERA 2QRKA 1VMEA 2FK7A 3DXXA 2NZ2A 2V9PA 3VPBA 3LF1A 2FSIA 3I9OA 1YGYA 5AKLA 4JJ7A 5LZ5A 4GBED 4W1PA 1U81A 5CLHA 2CE7A 3AW9A 1FXWA 2PGNA 4JJIA 5TGZA 2WG1A 3A9RA 2CL6X 1Z0KA 2VPTA 3AY6A 4O2AB 1TYAE 3N86A 3RIMA 3SVLA 4XD7A 3SX0A 3MXTA 5IM5A 2I78A 3MNFA 3LHFA 4XJTA 1TZMA 4M8IA 2I1QA 3L6CA 1JBEA 3H13A 2BZGA 2RH9B 5DNEA 4D43A 1DDGA 5J4HA 3DD5A 4WN9A 4XIJA 1LVHA 4EUNA 3CJRA 4GUAA 2AE2A 2IIQA 3L0PA 4G0YA 5CU7A 1JEDA 2Q7DA 5JFTA 4GEGA 2W9XA 3I8XA 1WSAA 3BWVA 1H3EA 3AJEA 5JS1A 4P4TA 2PZKA 1U9ZA 3IUPA 3WB9A 1HLPA 2ZRIA 4BQNA 2G6BA 4DREA 4F11A 4L08A 5L7WA 4TL8A 1SKAA 3NW9A 2Q7XA 1C1YA 1BBUA 4B09A 4BFWA 3VSCA 2Y1GA 3G2KA 3KPUA 4MWOA 2W6ID 4XASA 3TTUA 4B4UA 2W48A 4M1OA 1YI1A 5FEMA 1OBVA 4C7JA 4AS1A 2DZ9A 1L7BA 1TW3A 3KQQA 1SVOA 3ZHSA 4C7XA 2H11A 2OBLA 4HOYA 3B1FA 4L2IB 3M4JA 4FLEA 4PQGA 2XA9A 4GT1A 3TO5A 2EDAA 3Q9LA 4XIFA 2IZ6A 4C89A 3FW1A 3TIGA 1KEZA 5MGNA 4RKEA 5D3QA 1NPYA 2ACVA 2ONCA 3UUFA 4AJHA 1JLKA 4GH5A 2O7VA 2X5NA 1I3CA 1ZH2A 1ZGAA 2B4KA 1NXTA 2YBDA 2ZRDA 2FWNA 4YFVA 2CE2X 5C3UA 3U4DA 4H1VA 4NK4A 1CB7A 4KMOA 5AHXA 1I4DD 2H31A 4BCBA 5A7HA 3A05A 1T13A 4YDRA 1QUEA 4ZIRA 2FRDA 5JHHB 1AKNA 4YCUA 4IYJA 4WXMA 4DCSA 4GOND 3ISTA 5CA0F 5JO0A 5LLSA 2B8JA 3WJ1A 1VA5A 3U31A 3EXHA 1CZOA 3KZNA 4BAUA 4BV9A 1AQNA 2Q07A 4OIMA 4M7WA 3HJNA 1UMDB 1SU4A 1Y42X 3ADPA 4MR9B 4FEAA 1ORIA 3VU9B 1M1NA 3Q72A 5G53C 1P80A 1TAHA 1RWVA 4II2A 4A91A 2C92A 5K20A 3DYVA 1CULC 4YI5A 1G8KA 4XX0A 1G0NA 5HUJA 3TH5A 2WE7A 4GWLA 4LK2A 3F8TA 2PSJA 4H2DA 3L7DA 4F12A 3CMMA 1TTTA 4E08A 1JP7A 1XGKA 4EYEA 4D8YA 1XJ0A 4XTVA 3N05A 4KPEC 1BZYA 4LCJA 1M6NA 4H2XB 4LK3A 3CEPB 4TMZA 5AM3A 2Z09A 1D7AA 2XOKD 3I9V6 1E4OA 3NO4A 1J7KA 3KUDA 4O0LA 1WAMA 1KEPA 4XOUA 5ES3A 3G6KA 3NASA 2EJUA 5FPPA 4X6UA 1GTL1 4FDUA 3V4PB 4CPDA 1GFSA 2I76A 3NYWA 5JSFA 3IV6A 2F17A 2LP4Y 5DYIA 5MN6A 3QZUA 1N1DA 1RZUA 3NHRA 1KRWA 1GV0A 5ALZA 1CZUA 2CHUA 2QSUA 2QTNA 1HF3A 1RHQA 2C0PA 1G17A 2N1BA 2NSDA 5BR7A 4KH1A 5I4IA 1U1DA 1XI2A 1ZMRA 5C1DA 2JA2A 1XZBA 1JKJA 3H7AA 4MWCA 5AJXA 3OEHA 4Y2SA 5DGTA 2PL1A 4BMCA 2XVYA 3KALA 3VHXB 5BVGB 2IHBA 4DQ0A 4KBFA 3KEGA 5ADVA 1QIMA 3MM4A 2R84A 4LRSB 1QV7A 3A1FA 3IUJA 3UQYS 2ARSA 1I4OA 2B37A 4P92A 2I4IA 4K6GA 4BN4A 4ZYLA 2AJBA 3JQCA 4UCQA 3TCNA 3H9EO 2XDQA 4PSCA 4NBUA 3WC4A 4Q1BA 5CFPA 1LLCA 5HCIA 2PM8A 4HVAA 1YDWA 3KZKA 2JEOA 5K3EA 5LJIA 5FHRA 3L1IA 1TO1E 2BTQA 1CUHA 1GADO 2NS6A 1Y3CE 3FPKA 4NFHA 4CMKA 3DDSA 1UBJS 1XPJA 4MA5A 4XIGS 1YR6A 2NXCA 1A71A 1QKJA 4KUHA 2Q9BA 3IDQA 1F8YA 4JJKA 3UG6A 2DUJA 4QFCA 3A3OA 2QG4A 1BKSB 1QIHA 3ZS8A 4YPOA 3RROA 2C04A 3I5XA 3ZWBA 1OB5A 1BBWA 3M7IA 1JB9A 5DMHA 5EHZA 1CQJB 4XE5A 1E0JA 5DOZA 2JKYA 3KR1A 4DLRA 1JAIA 4IOKA 4QUBA 4RWZA 1QG6A 3FSJX 4KO3S 1E6WA 1WZEA 4HLUC 3Q0EA 4KCGA 3LCRA 2WLTA 4RYDA 2J4FA 2JJ1A 2VBGA 3ROMA 1Y6GA 3LCVB 4ZI7F 3NIDB 4C7BA 4OHWA 4PYIA 5L7TA 3H5RA 3IB3A 2ZSBA 3H2HA 5B3JC 4ZV9A 3SK0A 3UMFA 3OX3A 2DQSA 2Z6QA 3PGVA 4BBZA 1XMOB 3SX4A 1C9KA 5JNUA 1V7PC 2R1ZA 2FN7A 1K2VN 5GONA 5K0SA 1V47A 3UJNA 4HGNA 5FBKA 3FPLA 2F1KA 4LF9B 3UFXA 4B47A 1VCOA 4HFJA 1GRRA 2J0EA 1J24A 1IBCA 4MYSA 2HQ1A 1V9LA 3L4KA 1FFHA 2GPTA 1X0VA 4HNAB 1UP7A 1O54A 1SVIA 4HPWA 2GZSA 3WRVA 2IVFA 3IDFA 2PXAA 3N8HA 3C0KA 4UZSA 3HWWA 5JSZA 4EZIA 4LBYA 1TVCA 4HFNA 2QJTA 3X1DA 1MDFA 2DQ3A 4V0OA 3U7QB 4KMRA 2IH5A 3VMFA 1KJIA 2LD4A 1LWNA 4D92A 1H3FA 4DEVA 4XLTA 2ZE7A 1EQUA 1ZOIA 2ZYAA 4FEYA 3KV1A 2OYCA 1C0LA 1KERA 5B7PA 2ZXUA 4QDOA 4YCAA 3GRUA 1T24A 1ZD1A 1UMBA 2PWZA 1P1BA 5IANA 2QNBA 4CH5A 2O2CA 2IU6A 1QQ6A 4FCWA 2GRJA 2V6GA 4Y0VA 4YFYA 3VVCA 4EI9A 3AW8A 4K86A 1AMOA 1F4LA 1OREA 1P4AA 3ANSA 2NGRA 3FIUA 4EUKA 3PQDA 3WLRA 3TIVA 3QVTA 1RYNA 5EEHA 3MAJA 5J4YA 2XTZA 4JV5B 1JGTA 1RJ9B 3WNQA 1YZGA 4KH0A 2FGKA 3B1XA 4RXTA 4QUDA 4CMAA 4CQMD 1QQBA 2QAGB 3CNNA 2ZYHA 3LC0A 1N2HA 2YYZA 1EXDA 3BVPA 1PL7A 1PT9A 5FPKA 4IWXA 1DIAA 3N6RA 1XMXA 3LCMA 4RE6A 1M8GA 3FCSB 4XJSA 4NCIA 1LPPA 1T36B 1W9MA 5D3KA 5ANRB 4EQ6B 1W5SA 3GGJA 3OM9A 4WJ3M 4IRMA 1NR1A 3KOMA 5CNKA 4KN8A 1GPMA 2QHUA 1ADBA 2C57A 3G82C 1W48A 4HQNA 4KPUB 1TKCA 5CFZA 4W5OA 2D0OB 4J90A 5G1NA 5K0BA 3KAQA 3QPUA 5KB3A 4KXWA 4O5OA 3QWBA 2XCLA 4QUGA 4D9HA 1E3DA 1QV9A 4GI7A 2GHIA 3IMCA 5DKFA 2ZBUA 4CIWA 1ZG3A 1QAQA 3L7AA 4ZYZA 4TN1A 2CV2A 1JQBA 4F3NA 3RJMA 4HHEA 2G1KA 4FYJA 4E5KA 4EPWA 1C9YA 3V32A 2VQEB 1E98A 5IJZA 5G40A 2BHSA 1PV1A 2G77B 2VDQB 3VO9A 4J4BA 3W2FA 4DIOA 5IVPA 3D6VA 1H2AS 4J2OA 3TQQA 1H42A 3GRCA 4M8NE 1RI5A 2IP4A 1LSJA 2XSZA 4EB6B 2B0CA 4WKPA 2HA2A 3H1PA 2CXRA 4ZA2A 4OMFG 4KXLA 3A6FA 1QVWA 2YHAA 4F2HA 1C9EA 1BVRA 4MA4A 2KWIA 5DCWA 4OIFA 3KZOA 4B17A 1B8NA 2HHCA 4CCYA 1TB4A 2EKQA 5TMPA 1NXWA 5FADA 1UKEA 1CQPA 2O3TA 5JNLA 1L5RA 3NXSA 3ZCUA 3DFZA 1HT1E 2Q5JA 3W5DA 1CG6A 5M2QA 1C8LA 3CQ9A 3PI7A 4J2HA 2BRUC 2VOEA 2O07A 2UVQA 1ISIA 2G70A 2VJQA 3JWHA 2ZIFA 4ZEMA 1XV5A 1YQGA 1Y1KE 2ZTGA 3MWDA 2OY0A 3IL2A 3T5TA 3MGBA 1Q77A 1TVEA 3C39A 3MWEB 3NRJA 1Z63A 1U0SY 3OI7A 2OCXA 4RHTA 4XWKA 1OR8A 2Q6LA 4OFXA 3HN2A 4QLAA 1J4AA 2DFTA 2DYKA 3DBOB 4W7HA 3W2HA 3B53X 4C4RA 3WYDA 1DQSA 4D4MA 3R8FA 1P7WA 3TQRA 5HGQA 2HCBA 1GLNA 2C2BA 2CDBA 2UVPB 2R4QA 3FTDA 1NVTA 2AT1A 1M2JA 4BEVA 4Z1MD 2Q29A 2WT9A 3GEPA 1LPBB 1IZ7A 5CNIA 5HIKA 2PU7A 4N8SA 5DXFA 5F4BA 4YT2A 5JJKA 1EZ1A 3HUDA 4YC7A 1H05A 2YN2A 5CPBA 2RCYA 5CT8A 1TT5A 1W4CA 2J5QA 2ZW9A 4Q9DA 1Q19A 1P4JA 1X80A 4OHPA 1RHJA 3PEVA 1OILA 1YDEA 2VTBB 1IXRC 4P7GA 4K9LA 1PGNA 4R2XA 4RM2A 5BWNA 4E5MA 2QL6A 3LG2A 4KK3A 3D3QA 4KZKA 4LC9A 2GR9A 1CDEA 2OVBA 4UXHA 5HF5A 2WTNA 3ILYA 3Q40A 2ZSFA 1FYFA 4KJXA 2R8RA 3ZW8A 1S2NA 2QRQA 4Y9DA 4W5WA 4M37A 1YCFA 1WXIA 5JANA 1PP4A 2W70A 4I50A 5KTRA 3H2SA 3T9CA 2XQGA 3ONVA 5BQ3A 1KEEA 1I30A 3BFKA 3STUA 3PQ2A 4B8YA 1IXSB 1E2HA 2NLOA 5BUQA 1JFFB 4ER0A 2SNIE 2H7VA 3CH7A 5CM2Z 5CG1A 1CY7A 1T5OA 4H18A 4D8UA 2PVSA 5A5DA 1PTJC 3ZD7A 5AM4A 1WQ1R 3L8GA 4TYQA 5DASA 3WA6A 4A0GA 4BMXA 1BXZA 2G80A 2D2XA 3P5BA 3UK6A 1WF6A 3K6KA 2DKGA 4Q16A 4UZFA 5K01A 2HJHA 4G0NA 2EFGA 3G59A 3E27A 3O83A 3PDCA 5IN5A 4WKGA 3W6UA 1J2YA 1JQDA 3GUYA 2H2GA 4MV7A 4RV5A 4DM7A 4QXRA 2QMZA 5IBCA 2OQVA 4RJJA 4O4IF 2Q0QA 4ND8B 4ENWA 3EPPA 1XZCA 3V55A 4BQOA 3CXRA 5HS4A 1IY2A 1BDJA 3SNKA 5E8JA 2R6JA 4P4UA 4RL6A 5FLYA 1NMEA 1SR8A 1SURA 4JI3B 3W5IA 2C2GA 2RHTA 4JBLA 2LV8A 4Q21A 1NONA 1DJNA 2F62A 3KAJA 3W7AA 4A2WA 2VP2A 1AU9A 4TWBA 3F2IA 2CYBA 3S68A 4CM9D 3KBOA 3FWPA 3OA0A 5I3CA 5KYYA 3GL9A 3JYOA 2HGZA 4N0QA 1CS0B 1BSVA 5IZ4A 4OXXA 2WVGA 4C0KA 4E14A 4UE2A 5IABA 1ZO8A 2BFMA 3SEAA 4QXMA 4WK0B 2GK6A 3AJRA 2FHSA 1QZUA 2PT9A 1JG4A 1BU5A 2QYHA 3TQCA 1TC1A 3HWX1 3DC7A 1DX9A 4P75A 3ND8A 2HWWA 3OWHA 2WB4A 4EBBA 5JS8A 2P78A 3RBAA 2W6PA 1WCV1 3BMQB 1Z5ZA 3C1OA 2HRRA 3O75A 1YH3A 5B5SA 4MRRA 3HG7A 2QK4A 4W8GA 2D1TA 2JK1A 1O96A 4YXFA 3VTKA 2JFBA 2AR7A 3GX1A 1NM5C 3VDQA 5CP8A 2HDOA 4OQFA 2EKZA 4CEJA 1Z25A 2RGRA 3RUDA 4JOBA 4NULA 2GN9A 4I9GA 2G5CA 3DCIA 2SCUB 1DC5A 2CNOA 3W9SA 4BZQA 3NTOA 4N48A 3UTDA 5KNBH 4RY2A 2CEAA 2F2TA 2OBNA 4GBGA 3TRDA 2VBFA 3L06A 1LZLA 1Z39A 1T1JA 1Q21A 1Z6AA 3H04A 3MILA 3RODA 4ZYYA 3D3WA 2O6LA 3BH0A 2JFGA 4ITVA 3FF4A 3B12A 2ARUA 5JZOA 3BA1A 1U90A 3LGSA 4HGQA 4PZYA 3TZQA 5B6IA 2Z83A 1EG2A 1THGA 2HJVA 1UFOA 1MD9A 4IQGA 3DE2X 4RA9B 4WTOA 1U0OC 4HDMA 4KUGA 5L51A 4H2UA 3RWBA 5ES4B 5GTDA 3OIDA 4R1PA 4F85A 5MHTA 3R20A 3OPNA 3QMWA 4IDFA 4AURA 1JJCA 4X54A 1JEYB 1PT7A 1V9CA 2GTHA 1P9NA 1QCYA 2IYUA 2PPLA 3PUVA 1WWKA 2H65A 2V6BA 1DL5A 3A7EA 5DTEA 5LYYA 4D4IA 4EY4A 4YUYA 2PFSA 2RJ3A 5CYGA 3I0ZA 1J70A 4LPKA 5EHXA 1XALA 2Y66A 2VC2B 1XLWA 4PLPA 5TJ9A 1T9GR 5F35A 3C3BA 4E03A 1OLSB 5A3VA 5FBVB 2PKCA 1UJMA 2UZ0A 1MR3F 4HAZA 1U0JA 1Y1LA 1W5EA 2ADFA 2H4WA 2QE6A 2HCTA 5LR6A 1JIJA 4M83A 5K99A 1K2WA 4J3JA 5G02A 1IMOA 4C0BA 1ATIA 5SYMA 1ZX1A 3PDUA 2J7PA 4DXHA 3AJ9A 3G2QA 2FEKA 1B8AA 2CSXA 1BO6A 3E3MA 5DWQA 1NY6A 2VHEA 1O8BA 5CM8B 2XYRA 4NE2A 4E1AA 3RACA 2XQIA 2OHIA 1UC4B 3ZG6A 1FP6A 2VJDA 3SVTA 3ANTA 3LP6A 4ACBA 1IH8A 1E3WA 5ECYA 3QLVC 3JQFC 2TSYB 4Q7MB 5H5JA 1U0RA 4JS0A 4QBGB 4KFCA 3HFVA 4WZAA 3PUYA 4IXTA 1WBBA 3KB6A 4MUXA 1EUZA 3HO6A 1IJBA 3QPAA 5CDSA 4MB0A 7MHTA 4P7KA 1FU8A 1UBKS 2OWEA 3L1UA 4JBGA 4UNQA 1RJGA 3IRVA 3T7AA 5BOSB 2GI4A 2JKVA 2DHDA 3OCUA 1QZXA 3LX6A 3FZYA 2VA8A 1Q1ZA 1QWOA 2YRFA 1D2AA 3EDQA 1GDHA 3AEXA 4TL9A 4GVPA 3JASB 5I7AA 3KYDB 4AZ0A 2C9CA 1FJ2A 2R1VB 3EGWA 2VRWA 2YWHA 3FFBA 2IPOA 3NQ41 4TSFA 4A03A 2J5KA 5J1TB 4ER7A 5AJYA 1CJCA 4MW2A 2P6NA 2GAIA 5ELMA 3JYNA 2P91A 3HVUA 1E6CA 1U4SA 1GRVA 2PL5A 1KEVA 3TDNA 1OT3A 1DQRA 3EGXA 1MKYA 5H1YA 5IJWA 4CH3A 2QJRA 4IIFA 3ASYA 3HUEA 3LSQA 4BP3A 8ADHA 3QVUA 2O59A 2FV8A 3FNEA 4Q9LA 5LUAA 1TJPB 2WIFA 1B70B 4IDPA 1H5NA 4MR7A 4KWCA 3M2TA 4DSOA 4EA6A 5IUNC 3HCCA 1SG9A 2PKYX 4RY0A 1WHTA 2GWHA 1QK3A 5JQGA 5EXDA 4Z1OA 1CEYA 1A7KA 4WK6A 2GZ3A 3GLHB 4TT8A 2PT7A 3WR5A 2JAQA 2N47A 2PGDA 5HIIA 1U2RA 4J4HA 4J1NA 1CPYA 4TKLA 2ORYA 3N28A 4Z7NB 2A0UA 1RQLA 4JOSA 2OLKA 4ZDJA 4IYRA 2JPDA 4OKNA 1UBGA 2FPXA 3VPSA 5UKDA 3I8SA 2D0PB 3EVDA 3STTA 3QOWA 3GBVA 5BSGA 1AHNA 4QYSA 2CVHA 4Q6WA 4E51A 4EEXA 3I1YA 2IHNA 2BGGA 3CVOA 1T1EA 1JU3A 1WX1A 2FPKA 3OHMA 4LJYA 4NYMR 5K09A 2PUCA 4IWNA 5DVZA 2E6KA 1CUJA 2NU8B 1YGPA 3I6QA 4YJFA 5EE1A 3IERA 2ODRD 2V7GA 4LI0A 4F84A 5KDOA 3RREA 5I7UA 3WV4A 4F60A 1YRWA 4A2QA 3FTNA 5EWLB 1ECPA 3GBSA 1LGYA 2EEZA 4EJ6A 4HNUA 3QHPA 4DIMA 1A0OA 4CRWB 2H8GA 2GEUA 3GXBA 5B1DA 2ZDHA 2KBFA 4BX2A 1QHFA 2XTAA 3O93A 3VNBA 1T5LA 3I9V1 2CJYA 4CMJA 2GAOA 4RCYA 1XDWA 4ZCSA 5CGZA 5CFQA 2HDHA 3THOA 3UAZA 1SHTX 3EARA 2ZVDA 3NBZC 5E38A 3OOYA 3EZ9A 2PS1A 4C4YA 5P8WA 2OCIA 1KJ8A 2ODAA 1B6GA 3FR7A 4QM7A 3P4UA 3ZIDA 3IS3A 1JIVA 1DQPA 5AK5A 2FY8A 2IPAB 3HRHA 3EGDB 1G64A 2D3WA 3K8YA 4IW3B 3S6JA 4DLLA 4E2ZA 4OOFA 3ZGYA 2W2QA 4I1SA 3AUKA 1RYDA 1DTSA 3BXGA 2B61A 4L0CA 4RGQA 1IM5A 5FT9A 2JLZA 4W8HA 1JW9B 3QQ5A 3TRHA 2UYYA 1EBUA 2VUIB 1MB2A 2J9XB 2OGZA 4BRUA 3HCAA 5JADA 2ZQYA 2WMYA 1TD9A 3KYIB 3B8HA 1SHJA 3V1NA 1N1EA 4CL3A 1RIQA 3RUCA 4EI8A 2ORIA 2XWJI 3D1JA 3CE6A 1NF9A 4M9CA 1DBPA 3L92A 3EWSA 2CNLA 3U9LA 2ZS9A 4DA7A 2TECE 3HY4A 5ALFA 5MN5A 2O19A 1NF2A 4DNQA 1QG4A 1YZVA 2BIFA 3PGXA 4QDJA 1A2OA 1A9QA 1M72A 1U7WA 2V7QD 3KKOA 4R68A 4ATNA 2O2EA 2IZOA 3EB9A 1VKHA 3RM3A 4AKSA 4XVCA 1VPEA 4BEBA 4Q3CA 1YO6A 1ZD9A 3CVYA 2GLTA 3AXSA 1O57A 3HFSA 1I3MA 1KETA 1HL7A 5JJLA 1HE8B 3D3EA 3B52X 4YH1A 3UENA 4C7MA 2VKTA 2ZS7A 2JI8A 2G17A 2GJ9A 4RIHA 2QW8A 4GX1A 3D6HA 4FC6A 3SHFA 2P9EA 4COOA 4L02A 4NFYA 3U39A 3ROXA 4R9UC 3LT5A 2FWMX 3KJGA 5E3HA 3I6MA 4PLZA 5FA5A 4BX9A 4NENB 3KUXA 4TVWA 5EP1A 4K0KB 5K3CA 1KQNA 5HVNA 4D45A 2CT8A 2O2GA 5HQJA 1POWA 4YPFA 3U81A 4EJSA 4LVUA 3SXJA 4XGQA 1EFRA 1T8PA 1E3EA 4KBGA 1KZ6A 1CJSA 3QOFA 4DDMA 2GA8A 4MINA 4TZTA 4AF7A 2HZ7A 1ZRMA 3FUTA 4Z86A 5FO1A 4BMZA 2OZKA 1KDOA 3E5HA 2NXJA 1CR6A 4BMDA 1CE8B 1G9SA 2ZTHA 2M6LA 1RHUA 2A78A 1IN7A 4OHOA 2RHQA 1M34E 4PO9A 3U5TA 1XZEA 1ZISA 2ZPAA 3FDJA 3ISVA 4NNPA 1EU1A 1JQ5A 4NC9A 5CA1A 3WLKX 1VE1A 2OD9A 3H0KA 3JATB 4FJ0A 4PRZA 4UQLA 5M34A 2WJZB 2G36A 5THQA 4PN3A 2NO6A 3TMAA 1W30A 2MTBA 4DSZA 3WLMA 4P73C 1WXQA 1NG1A 3NOOA 1QX3A 4D96A 4Q9AA 3LRXA 1Q1QA 1WXFA 1S9DA 2BBSA 2AEEA 2FMIA 2BF4A 3AHEA 3OECA 4IHJA 3IKJA 4ZTBA 1P61B 1PSWA 1RQGA 3V6LA 3RNOA 3STXA 3VC7A 1YE8A 3CSDA 3B89A 1GU0A 1VP3A 4J16A 4REMA 3DYIA 3PPYA 2X2EA 2V6MA 5DLEA 1NC3A 5F1PA 3IIMA 4INZA 3GT0A 5LZ7A 1YRLA 1TCCA 2C8MA 3DH0A 3DVSX 1PBNA 3M6XA 2O1SA 3TLKA 2X42A 2JFNA 5AM2A 1U2ZA 4X65B 3STHA 3T5BA 1JX6A 4ND2A 3F5MA 3R3XA 4WN9B 4JUBA 3I53A 1HSOA 5K0ZA 3Q9SA 2VK8A 1PU2A 3EIOA 3PX2A 5DXAA 3TQSA 5ISMA 4UP9A 7ADHA 2C1ZA 2RKBA 2DAPA 4CNQA 4E4TA 5CAEB 3DF9A 5C7OO 2R0QC 3PNPA 4LYGA 2O05A 1KP3A 3BQNB 4KG7A 3BB3A 1H4SA 3HDHA 1WU7A 5AI4A 4H7IA 3LBHA 1HI9A 3TQOA 1O0CA 4DB2A 4HZUA 3G23A 4KGXA 1LLFA 3FFAA 1XNJA 3IQEA 1KO8A 4PPGA 3HXUA 2A1UA 1K63A 1YB6A 3FCAA 4PRKA 4WKBA 4WZZA 5T57A 2EWVA 2X8AA 3AERA 4UARA 2ZSAA 3W3ZB 5DEOA 2V96A 3H1BA 3GFOA 2B1RA 5A05A 1PYOA 2Q9AA 1QFXA 4R40A 4BNUA 1EP2B 2IK8A 4YBZA 1EUCB 2DTDA 4R05A 4YMSA 4WV3A 2F55A 2FJPA 1U8XX 1CR4A 3IPRA 4F92B 1LDNA 5BUZA 1CK4A 5ALMA 4IV5A 2YWBA 4O4LF 5C2JB 4R16A 3W2EA 1W93A 1RLJA 4ZIRB 1L7PA 4NAVA 3R2JA 1NVAA 1NJ1A 5AJUA 4S04A 1P2FA 4J0KA 4MGEA 3UMYA 2BP7A 3S29A 3PVSA 5IJ0A 4X6YA 3EXHB 5K8VA 1T10A 3PEFA 3HBAA 4MUGA 3ASUA 3HV0A 4WIAA 3QO7A 1D0IA 5EKUA 3UAGA 1PQUA 2IBMA 1QFSA 1X3SA 3CLTC 5BYBA 1X1EA 5LYJF 4D8WA 2DOKA 1F6DA 2ZWMA 1VMAA 2E89A 3QUCA 3GAZA 1M1NB 2AJCA 2C78A 4A0QA 1OA0A 1R0BA 1ULAA 5CGQB 1A9SA 3P97A 2AD5A 2YJNA 3RYTC 1T5BA 4BFLA 5K2OA 4DUZB 1OH5A 5KKNB 3GLTA 4AXBA 1I24A 2ZSIA 5BXQC 1NUUA 3JZDA 2FR0A 3LNCA 3MIZA 3UMRA 4EVSA 4GLLA 4WCDA 1F5NA 4QU8A 4RMIA 1KSGA 2CXXA 3N53A 1GTJ1 2EAYA 1M6YA 1TUIA 5FV7A 2F9MA 4AKIA 2Z5FA 5EMLA 3ESZA 3GLUA 3N6VA 5TT0A 5DM70 2QRJA 1I5RA 3CNQS 2JFUA 2RKWA 4QOJA 1G2PA 5AWFC 2P6OA 4MQBA 3ILXA 2YIJA 3HB9A 1WB6A 2J4DA 3HA5A 1T5SA 3P5SA 4RPKA 4Y18A 2NVWA 2L82A 2OORC 3E4DA 4B84A 5T3UA 3OIGA 5AUNB 1Y6ZA 4M53A 3QVXA 2ID8A 4X7BA 4WGGA 1RXVA 4N3AA 4XQEA 1H4VB 1ISMA 2AH5A 2PJZA 1JKJB 2GUWA 4MVJI 4ZOLF 5EUMA 3PENA 1YZLA 3LVQE 4H1TA 2I8LA 1ZZEA 4HPXB 1QP4A 1WIWA 4TTTS 1OZHA 1TJNA 1WUTA 4QEKA 2X3YA 4AZWA 3QWHA 4AMGA 4AWBA 2H1IA 5B4TA 4X93A 3SC2B 4RGBA 3WBJA 3WSTA 3EQ6A 2H48A 1U63A 2XDQB 4NI5A 4OGKA 1IJKA 2WK1A 3E3NA 1A4RA 1E2UA 4R5MA 4I4TA 2F8LA 3TTXA 2PXHA 1EFVA 2GD1O 2JGFA 4WJ4A 3AEKB 1CV2A 3LZDA 5J2TB 1IBSA 4BVLA 2RI0A 2BTQB 5LU8A 4F9FA 1IUKA 4NBNA 5HIJA 2FN4A 2HLPA 3BD6A 1WSDA 3K09C 3DBVO 4N41A 2D1SA 2HF7A 2WJJA 1O3YA 3UF0A 1QOZA 4YXWD 2KB0A 2F64A 4H27A 4LX8A 3U7JA 2PKXA 4GLFA 3BHNA 2PNFA 3UW3A 3SZMA 2UVDA 2R6HA 2BGKA 3P27A 5CURA 3K4PA 3X2SA 3LQ4A 1A7JA 3I9MA 3IP1A 2BGJA 3NBAA 5G0TA 3ZU5A 4B8ZA 1Q15A 1HYHA 2H54A 1QOPB 4FHFA 4D6YA 3EIWA 4HQOA 3D4NA 4V0MA 2PSSA 1AQYA 1Q17A 4B5KA 3DSQA 1Z6QA 1UXJA 4ZQHA 4EMUA 2EVWX 2R1UA 2WHEA 5T4EA 3RPEA 3WFIA 1XZHA 1WQWA 2JJ2A 4YASA 3UMJA 3WHPA 4ADSG 5K8IA 1JQKA 1V6CA 3C1TA 3JD1A 4ZVLA 3W3AA 1NUPA 2PBRA 3T7TA 4HDNB 1I9CA 3GRRA 3DVAA 4JLKA 4OFWA 1RRKA 4YJDA 1EXNA 1F0NA 1TI7A 1JTEA 3OPQA 4JYCA 1QB8A 2CEKA 1R0RE 3BIWA 5ALGA 3ITNA 3HA7A 3QTBA 5FNVF 4FWTA 3LU1A 1QVZA 1QPBA 2JFQA 2W71A 1L5QA 2Q6OA 3Q5GA 3MGKA 1JI3A 3TVTA 5B2FA 6ADHA 3RHSA 3A9CA 2XITA 3RC7A 3G8BA 3GPDG 5IM4A 1SKBA 5H80A 5DO9A 3H99A 2F7SA 1MQ8B 4GP6A 5HUQA 5F9FA 1LU9A 1TUBA 3H7IA 2WQ7A 4XYEA 2VJAA 1UZUA 3NHFA 1C2TA 3UVEA 1VQZA 4GKKB 5DBEX 3RVJA 4WFIA 1N25A 1PS9A 2B2XA 1I6KA 2EFHB 2QDKA 1XAIA 3UJ8A 3SMVA 1UMBB 3ZHVA 1V5WA 4CFYA 4M1TA 5JCJD 4OO3A 5IVKA 4B83A 2DECA 3K0HA 2VTEA 1FW6A 4RF5A 4CF5A 3I1JA 2ZB4A 4LVMA 3HBFA 4QGAA 3IQXA 3C5EA 4R8RA 4CWAA 1G4HA 4G1UC 1NHGA 3R3YA 4QFMA 3EXEB 2PTGA 3QHQA 1WLYA 1UOOA 4Q02A 4DV0B 1T3HA 3I8OA 4PR3A 1R18A 4BB9A 3ZI0A 2CBXA 2K2QB 5WRFA 4XFJA 3OQHA 5T4BA 4MPJA 5L8VA 3KAKA 3OY2A 2Q3BA 4CM5A 2QPLA 2RGEA 2OG1A 3THWB 3AF4A 4L6CA 4YAKA 2DLCX 4Q05A 4EP1A 5JH7F 3T7KA 5LOVB 3VAAA 4B6PA 1ZUNA 2D7CA 4ZT2A 4IUBS 2R5WA 4UUQA 3H4VA 3JAKA 1YQWA 2WFLA 1EXVA 4RVDA 3VUEA 1ECFA 3WMGA 4COKA 4QJ4A 4RTKA 2PX3A 5I7HA 1ZKMA 4KR3A 3B9QA 5FFFA 2PLAA 2ID7A 3VJRA 1RKUA 1ACLA 1NLUA 3M4PA 2DVMA 2G5GX 2QTTA 1FDRA 1WXDA 3GDFA 3QE2A 4JUDX 4NRDA 5L95A 3QIAA 5EJ4A 3GQVA 1VZ2A 2WJ3A 1BXGA 1PIWA 3EE6A 4YJKA 4EHKA 1RLIA 1AB6A 2PVCA 4AUEA 3AKYA 1EDZA 1NBEA 2NYVA 3A4YA 3BIOA 1PNRA 3E18A 1I6WA 4JLBA 4RABA 4B2PA 5A3JA 5CB8A 1GQSA 2VK2A 4YCVA 3GFPA 2XWBF 4CCYB 1E4EA 4D7AA 1A5BB 1ZJYA 3SIRA 2PNJA 4DAEA 1AOXA 1U0GA 5EJ5A 4A0SA 1KMHA 1X1CA 2W11A 5C7YA 3FKJA 2ENWA 3QHAA 1ST3A 3D5EA 3H9CA 3MWDB 4LRYA 4UE3S 1W87A 4RJKA 4QQFA 4G85A 5A1TA 4XD7D 3T1HB 3R6LA 3G8YA 5HFNA 1TA0A 2OO7A 1XNQB 4QJ5A 1B1CA 4U4AA 3GEIA 3SF8A 5ADWA 3UM9A 2KM1A 2F3RA 3OLVA 1ORVA 5F98A 2C0QA 2NQTA 3AM3A 1E77A 4RHUA 3ITDA 3T7IA 3WO0A 4BN0A 1OQAA 3ICOA 5B6JA 3PNOA 3T3OA 2QMUA 1MLDA 3VAZA 2B7BA 2GPBA 1I1NA 2PKQP 1K8XB 2QI9F 5CH5A 2POCA 3BWMA 4LWZA 1SIOA 2QUAA 2VSXA 5G0VA 5A4MS 2VTDA 4HEJA 3EAFA 1KSJA 4L5IA 5KUTA 2XGJA 4U7PB 4A0FA 1NT4A 1TT5B 2J5RA 4P34A 4XIYA 2AHOA 3HP7A 3WMWA 1X80B 4QXAA 5EWJA 2X1VA 1QMPA 3SQMA 1WHSA 3D6AA 1Y81A 3IBGA 5F76A 3U7IA 1UPCA 3NKVA 2BMEA 2JGEA 3Q88A 4LJ9A 1JPVA 3AR6A 3LFUA 3DP9A 2JGRA 4MJXA 1TQ4A 2DB3A 2P75A 1UR5A 1Y3BE 2CF6A 5FLXA 5KTOA 1JVNA 1S8AA 2H2HA 4FGUA 4EGAA 4G1VA 5KDDA 2OHVA 5IEJA 4P7BA 1ID8A 4CLDA 4I50B 1E58A 1I7PA 1ZJZA 2VK1A 3H9UA 3TX2A 2C7VA 5IKEA 2C5EA 5KTPA 1BGWA 2WINI 3FKQA 4FFBA 2RHOA 1U8YA 3BERA 4ND4A 1GZ6A 1SZCA 2WP8J 4GMXA 4UTXA 3ROZA 4RCZA 3UTCA 3V4FA 1TPZA 5D01A 1W1UA 1QGYA 2NUPB 1AGNA 3AXTA 2X0DA 4GOXA 4K9PA 3LKVA 2I5PO 4EO7A 3M4QA 4EELA 4YCCA 1X0XA 1IRXA 4ICIA 1KNXA 2NNWB 4JUFA 5K1XA 4JQZA 3MAAC 3MJCA 3PJFA 3LK7A 3AFMA 3GQBA 3OQNA 1SOMA 4L5JA 2QSJA 3KKQA 4GGOA 5IUJC 1G8SA 3DMNA 3O4RA 1JKXA 1QIKA 2PZLA 4BIIA 1N92A 2O8NA 3C98A 3LPCA 4LF8B 1OXUA 5KMGA 5IDQA 2QENA 1OC4A 1E2QA 4NEQA 4D6PA 2IOHA 3ZU6A 1I80A 2DX7A 3IIEA 1QTQA 3EEQA 1Z34A 3ST7A 4XUGB 2I1WA 2PA3A 4LVJA 2AZDA 4EZBA 5I47A 4Y98A 5U4XA 1Y1RA 1RWNA 2X9VA 3EC7A 4MGKR 2BR5A 2QRUA 3C6QA 2I6GA 4HB3A 3SXUA 1DRVA 1BXRA 2VT2A 1M3SA 3V1LA 1JKFA 3KTFA 4PM4A 2P4SA 2QZJA 1A82A 3B9PA 3OETA 4ZRMA 4EM6A 5IASA 5JNSA 1VG0B 2J4CA 1Z4MA 2ZJ5A 3PHHA 4L6IA 4GFDA 1IOVA 1KAHA 1PR0A 4OYRA 3ZD8A 1Z5GA 3N2EA 5KHLB 2WWYA 1Q0TA 1UT5A 2UZIR 1ECJA 1YT5A 2BV3A 2ZYIA 4KPFC 3OEHD 4QNNA 2AC4A 2D7JA 3H86A 1DT3A 3GN2A 3IIIA 3ACBA 3TSWA 3T8YA 3RYHA 1N6OA 4V0KA 1ICIA 1X56A 3O1LA 3FOEC 3MUOA 3W1WA 4CEJB 1QHXA 3HJGA 4IOJA 2WTBA 3M89A 4U7FA 4ZYXA 1GNTA 4TRJA 5BNZA 1U9JA 3QEOA 1NDQA 4FC7A 3SQNA 5LQJA 2UXBB 1J49A 3OICA 5AOBA 4X44A 1ZI8A 3A3NA 3SZUA 1JLRA 3KOOA 2HO4A 4WBNA 1EI9A 1PWEA 2WHYA 2J0VA 3E6AA 1W0KA 3WLAA 4EKNB 2VCYA 4YREA 2C4NA 2KLHA 1VG8A 1PFVA 4HDMB 3RUHA 1L4GA 5JE8A 1E9CA 1PLKA 1E92A 3PI6A 3F46A 1ACJA 1Z0SA 4JVLA 2HHLA 4DA4A 1YCHA 4G4GA 4JNCA 3DAFA 1A77A 1NNHA 4WJZA 2QRHA 4G0XA 1NFQA 3HNPA 4GXTA 4JODA 3RSZA 3TUIC 3GLKA 1VHJA 2LDXA 1MNAA 1REQB 1PL6A 2OV6A 3PEEA 2CLKB 1ZJJA 1S3IA 3GARA 3O2JA 1P2UA 2ZR7A 4XFDA 3BHIA 2JJ1D 3NRBA 3VA7A 3PEYA 2Z43A 1PSDA 1S2OA 1W4AA 3VX4A 1M2VA 4L9WA 4RZHA 4BEWA 5K0JA 1QYXA 2VP0A 5CCXA 3G9TA 4KR0A 4EKYA 4HAXA 4C6RA 1B8PA 1NN0A 3KYCA 5AQ1A 3H18A 3AEUB 1TEXA 1MTZA 2ZRBA 3Q7QA 4CKBB 3WRXC 4A0HA 3VNRA 2QN3A 3RBZA 3GFSA 3DE5X 1QDLB 4PAGA 3PHJA 1VJTA 1W6UA 2OOSA 4KFRA 2A5JA 4P22A 4BMNA 3OTQA 1HR0B 3EVTA 3NATA 2QP3A 4UDNA 4DNFA 4IX1A 4LY9A 2A9FA 5AESA 2O2DA 2GBLA 2NUBA 3L7NA 1L4UA 2X9QA 4HFRA 4P0PB 1F20A 4LZPA 4RDHA 1VL6A 2YJ5A 3CLVA 3O3OB 3T4XA 1E3WB 2AN1A 1I1OA 5KDLA 4UE6A 4QHSA 3E9DA 2VPIA 5BN3B 3WGQA 2AMCB 1Z3CA 4KYVA 4RVNA 1E59A 3UNXA 5CFRA 2CDNA 3AF6A 2BEWA 1TK2A 5ILQA 4KBYA 3LPDA 4FMCB 1Z7MA 1L5YA 1VGQA 1G9XA 1RVDA 1HTBA 4BWGA 3D1VA 4TV8F 3IPYA 3ZE7A 1A9TA 1G98A 1U8AA 2HADA 2HV9A 1ZAKA 1HT2E 2ICAA 3ZXYA 3L04A 4LF5B 4B2LA 4FIZA 2WTUA 3BCHA 4AZ0B 4BVJA 4OM8A 2IOYA 2CCGA 3AVYA 5MGBA 1RZVA 4XQ9A 2H51A 2VJYA 1CUFA 3SOPA 4UM5A 2FDRA 2BT4A 5I4BA 2GJ8A 4DCTA 6AT1A 5LLDA 2LR0A 4KC0A 3EGXB 4K40A 2OFXA 2YOHA 3DQZA 5DM1A 1JT9A 3UK1A 2VI5A 2AMJA 1T25A 1L4FA 1R3UA 2W43A 4DNXA 1PBTA 2PUWA 1IN4A 4I9FA 5HG0A 2P2SA 4MR7B 2FW8A 3UV7A 1T43A 4EQZA 3CW9A 4GNRA 4CMEA 2E4YA 2X3FA 3VBCA 1S8OA 5KWEA 1WHTB 4L16A 1SZJG 1XAGA 1Z5WA 2JCBA 3D7KA 3HDYA 2H1CA 3SHQA 5JQGB 3CH6A 4MUEA 4RXMA 1VL2A 4JLDA 1VSQA 1QK4A 3WA7A 5AFSA 3R3HA 2ZZNA 1O6ZA 4P1ZA 5HM8A 2UYGA 1F2UB 2W6CX 2IY9A 5JFGA 1OTXA 1C1DA 1UBSB 1O94A 5CX4A 4E2XA 5C53B 5CMLA 4K6KA 3WISA 1NR5A 3L4EA 4NBVA 4Q4AB 4AO6A 1YB5A 2QTCA 4G0VA 3HCWA 1IMJA 3GG2A 4V38A 1DC7A 3MIIA 3CN7A 3LDUA 2XSZD 4NJOA 2DZCA 3TZ6A 2OAGA 2VL7A 2ORVA 1V5IA 4YJFB 1G3QA 4PNEA 4RDIA 1CY0A 1J07A 4IFIA 2PWBA 4LX0A 2LTAA 5CVJA 3ZEIA 1ZHFA 1A50B 4KLAA 3ZWQA 4JA2A 3PGLA 1UOQA 1C3JA 1QBGA 1IOLA 4S3MA 5EE0A 2W6OA 2AI2A 3LW7A 1EJ0A 4J76A 3I2JA 4BNNA 2C8VA 1BA3A 2BFDA 3QY0A 3UJCA 1X7ZA 4BUCA 2ARKA 2C4MA 1LB1B 4FYVA 3A4IA 4CUKA 2UDPA 1Y3HA 1MORA 3EHDA 1IBKB 3I9KA 1FJXA 2UUAB 3IQIX 2FLKA 3AY7A 4RESA 1BD4A 1OAOC 3A4LA 2XTJA 1XFDA 3CG0A 3ORRA 4A6XA 4CG1A 5B4VA 1X55A 4R8LA 3H17A 4U6QA 5ITVA 3HXMA 2YHSA 5JD4A 2O2JA 5BSKA 5JTTA 2G9VA 2LNDA 4KYTA 2CJWA 2I6FA 2B4TO 2I4RA 2JI7A 4ZZ0A 3AU8A 3NWPA 4BWVA 2QHXA 1FLDA 1GGNA 2QJOA 4L07A 3O92A 2B82A 4LQ4A 4CGYA 3O31A 4OFBA 2R4TA 3SWWA 2J1LA 5DHFA 2E48A 3ZDEA 1FEZA 4KO2S 5JLJA 2VHZA 3R0IA 1HC7A 5EZQA 3P9SA 4HN2A 3Q8MA 1WYDA 1OA1A 1XO1A 1IHDA 4IDAA 4KJZA 3ZDRA 4OAOA 5FTJA 1Q0QA 1G8MA 2FR1A 3O7MA 3P9IA 5JRDS 1AC5A 1UQTA 1GTZA 3K1ZA 3MHTA 5IVDA 1F0KA 4PLFA 4BTLA 1P7PA 3G5LA 5EXXA 4LJ4A 1SUEA 2ZTVA 3DGFC 2X4LA 2AYYA 3E61A 2H85A 1NAIA 4OXKA 1RQNA 1XLTC 2VHCA 4YJ3B 1Y48E 1WL8A 4Z8YA 1Y4AE 3GFGA 3GMDA 2ZIMA 4J29A 4U5QA 4CV0A 2ZQZA 5LQSA 5KTMA 1GM5A 3KBBA 3FD8A 5DMXA 4EFMA 5JZVA 1IYZA 3LBIA 3SXPA 2BGRA 3KKZA 3NIWA 1CETA 3EVEA 3I62A 3WKBA 1Z38A 3UPDA 3KXLA 5DFAA 1WXXA 3RF7A 3M33A 3COYA 1YL5A 3KO8A 1U3UA 1RDFA 4GPD1 4X90A 3OKFA 3MJSA 3P8VA 4E5NA 3OPYA 1C7EA 3D2LA 4ZCLA 3VFDA 1TK9A 2HQRA 3EW9A 1V3UA 4RH1A 4OHMA 2ZREA 2L18A 1CY2A 1PR1A 3OQIA 3R5TA 4XTCS 4YT5A 5CA0A 4EG3A 3AV3A 4D0GA 5JIBA 4L0DA 5GV8A 4XEMA 3H3XA 1DGQA 2G40A 3GUVA 4XGNA 3W6PA 1LQUA 4BNIA 4EJSB 2R2GA 4HXEB 4Q9IA 2HU2A 4LPSA 3HZRA 2NP7A 1PZHA 3VKFA 1JEAA 1MOZA 2P8JA 3BILA 3LGAA 4KIGA 4ZAFA 3W0LB 4KREA 2YJGA 2YZKA 5I7OA 5JMOA 1UEXC 5HYVA 2CMHA 3CHYA 2QX6A 4CH6A 1LDEA 2NT4A 3ZXIA 1C3LA 3ZQUA 1E8MA 1RM5A 2RHQB 3HB5X 5FQNA 2AQ8A 4IICA 3O8DA 3SX2A 4RO0A 4WNIA 2QI9C 2XKJE 2AR0A 4MHOA 1WVGA 4HNVA 1JU4A 1XCGB 3HU2A 3BRCA 3KQVA 4ANFA 4FOOA 1X54A 3F6SA 4QG7A 4R8VA 2QR2A 3I4LA 4IHJB 2M98A 3KQWA 1BMFA 4MPPA 4Q24A 1GWNA 1R3DA 2B3TA 2BMJA 4U39A 4BVKA 4XLLA 3D8UA 2YZNA 4F2DA 1LXCA 4Q1AA 1XDZA 1C81A 2AB0A 3HXQA 1FFYA 3JV7A 5JDIC 2P9ZA 1D09A 3D0RA 3RSHA 1U2DC 3K1AA 1KIFA 2TMKA 1KNQA 3PFWO 4GKJB 4AMYA 1Q16A 4TSRA 4DIFA 5TARA 1VI6A 4EDFA 3NDPA 3ODGA 5B4UA 1RQRA 2OHGA 1KJJA 1TLLA 4MCJA 3TL2A 2RHWA 3MK31 1HNNA 3ELDA 4WJKB 1ZRSA 3GN1A 2QTLA 3AG5A 1VE6A 2R6DA 4C7OB 1AGPA 1AKEA 4RQAA 2CHQA 5TY0A 4YYEA 5BW5A 3EXFA 3QP9A 1B14A 3CSUA 3ENVA 3HDJA 4ZQCB 4NZ9A 3MGCA 2AXEA 4HZUB 4OB7A 4BNZA 2A9JA 4BKQA 1MN6A 1SELA 1NVVR 4QBHA 5AMXA 1ZHOA 4DANA 1IL0A 4JQYA 5FI1B 4CFSA 3DBLA 5CDGA 2ISSD 3RWOA 1E6LA 2DF8A 4JU8A 3GJ6A 3DFFA 2O8VA 2AX4A 3AERB 4NYIQ 1SNYA 1RKXA 5AXCA 3M6MD 1N3LA 4JR1A 1ENPA 3WLIA 4DOMA 1WCIB 1M5UA 3DUWA 2EGGA 4LOKA 2ATCA 2J87A 1YVRA 3S0JA 1M2HA 2OR3A 1Q6ZA 1VJ5A 2B1JA 4ZGWA 3OZ7A 4L7VA 2PR7A 4GMDA 3SQDA 1SD2A 1FX1A 2FWJA 2XUDA 4R1MA 2NN3C 3FGNA 5B1HA 2Q2OA 2DT5A 3SHVA 1AKVA 1WV0A 3M0EA 1ZK1A 4A8TA 4HDOB 2F00A 5LP1A 2HF8A 3RK4A 1G38A 1F4PA 3VH1A 4I1UA 1NWCA 5EE5B 2JJMA 2WWRA 2BP7B 2Z8ZA 2EATA 3I3SR 1PGOA 4P0QB 4N5DA 5IJ0B 1NC1A 4BNWA 1FDTA 2QX9A 1RBQA 3PEUA 2J7PD 1DG9A 4LRXA 1USUA 3NRCA 2PVPA 4JCCA 4XM1A 4JHLA 3DE7X 2VPPA 4QPPA 5EXTA 4BFYA 4AZ3B 2OV3A 2NPIA 4OB6A 4TTAA 5HBRA 3TD9A 2RGWA 3B1KA 1KE1A 3W4IA 1W88A 3IBYA 5DNAA 3VZQA 4WLUA 1H1TA 3SKVA 1UWVA 1ZNYA 2BGNA 4I19A 1DG1G 2XIQA 4QHYA 4ZO9A 3SOZA 3VBBA 5GVSA 1YMUA 3BRQA 2R87A 1OYWA 4JJ8A 3ZHBA 1HQCA 3A06A 1D4ZA 4ESHA 1X7GA 1XCMA 1QVRA 5FX2A 3TYXA 4NV1A 1VGRA 1W7AA 1SUFA 2B21A 3GAMA 3R6DA 4HN9A 3Q3EA 2NV2B 4IJQA 3FZNA 4G0QA 3HXYA 1GSHA 5K4AA 1L4EA 1W59A 3OD5A 2W4IA 1GNLA 1Y7IA 2ZIWB 2R97A 3CEMA 1YR1A 1WZUA 4YP9A 3AYXB 4Q93A 5FA8A 5K3BA 1Z0DA 1EWKA 5KNLA 5B3AA 5K3FA 2ZBVA 4P71C 2HHAA 5CX1B 5ARBA 3UWDA 3TNJA 4KWEA 4Q9JA 3RSOA 4TSFD 2CXPA 1SK8A 5E3JA 1L1EA 4NOJA 3S7ZA 4QVGA 3IVRA 1T9DA 3NZEA 2GKSA 3LWNA 3UHFA 3KTDA 4PCAA 5I9TA 4HA8A 2IX9A 3IQDB 3LUDA 3S2ZA 2YWEA 2PAAA 3CRMA 4BO2A 4GGMX 5COBA 1M0EA 2QW0X 4MLPA 3OFSA 3UXMA 4AJOA 2B20A 2PZEA 4BCCA 2IUFA 2YTZA 3DUFA 3CEJA 2XW6A 4MV9A 4K2HA 2I99A 2PFGA 2Y1XA 4RVOA 3SI7A 2ODPA 1D2CA 3BMCB 2C20A 3NM4A 3UW1A 4I4TB 2WAOA 5L3SA 2HXGA 3RHTA 1EFVB 4CLHA 3BTVA 2P3LA 2ZAOA 3RRMA 4DBZA 4YUZA 2FSFA 3DEJA 3NVMB 2DH5A 4RULA 4ESOA 3GLGA 4FDLA 5BV7A 2FE4A 2E2WA 4BVHA 3LC1O 2O0LA 4ND7A 1QYRA 1ZS9A 2D59A 4W9NC 4WECA 5ICMA 4P72A 3H5LA 3OBIA 2IYEA 1LFDB 3I34X 3AG6A 3I2HA 1CUIA 3PNMA 4GI1A 1NMYA 3EF3A 2QRZA 2D5BA 2YICA 4X3OA 4OHZA 1K4YA 3DZJA 3JZMA 3NIFB 4ZC8A 3S1LA 1RM4A 5KQRA 4ZAGA 1YA4A 1AZWA 1JQAA 3MUEA 4JL5A 2G1AA 3K72B 4PQYA 4QGBA 2JGLA 4G63A 4S24A 3RIEA 1PFKA 1RRPA 3Q12A 4N49A 2YFYA 2A92A 2YMQA 4YGYA 5DBGA 1FMJA 3QWIA 4TYWA 1R00A 4MW7A 1K75A 3B38A 3F9CA 1JH9A 2DU7A 1XYYA 4IBOA 3WICA 3ESAA 1ODKA 4Q39A 1FRFS 1Y33E 3PUXA 1I2ZA 1RWXA 3D6JA 2NUAB 4AMVA 3ZCSA 2OZEA 4M1QA 3CF0A 1YFKA 1TYDE 3RS2A 3TM4A 3E9CA 1X39A 1K0UA 1EB8A 1SRRA 2A5FA 2C3OA 2OZLA 1O0SA 3BK1A 3INRA 3BXPA 4Q1VA 4DQDA 3URMA 2R6FA 1FYVA 4CTJA 3VYSB 1L6IA 1P0QA 2JL1A 1V48A 4BO1A 5BR1A 1NVMB 5HTKA 5BY2A 3QM1A 3SYNA 1SIBE 3BC1A 3GLQA 3IEUA 5AXAA 1E2DA 2VDNB 2H16A 3ZE8A 2B1QA 1EXMA 3VAYA 2VZ9A 4M54A 1EFDN 4IMJB 1OIWA 1F5SA 3FNQA 4JGGA 2GF0A 4Y9TA 1XZ8A 1Z0IA 2CFCA 5LDGA 3OIYA 3LUBA 5DLDA 3Q8WA 4UZEA 4DDHA 4EYQA 2PJDA 2QAIA 2FFAA 2PZGA 5CM9C 3CPJB 4K88A 4GO1A 1WVIA 3LPMA 1TUBB 3V97A 3WFJA 4AG5A 3KUKA 4DRXA 2CFIA 4FR5A 3EW7A 3BH6A 3MS4A 4QYMA 4F6LA 5JVDA 4JI4B 1Y6JA 2C59A 4JLOA 1KP2A 4G01B 4AXXA 3CKYA 4IGKA 1QQ7A 2PMCA 4BJ6A 4MK4A 3E9QA 3CX7A 1NMZA 2BMWA 4JLAA 3KKPA 4ISCA 3OLZA 1B74A 1ZH4A 5JJCA 1NKTA 5L9AA 2RSLA 5GGYA 2FXVA 5CG2A 2ZBFA 5G1PA 4MQMA 5H16A 1GIAA 1E1RA 4DRZA 3I2KA 2YWJA 3QNMA 2AX3A 3SG0A 5AKEA 5J58A 1XWIA 1OWOA 2C82A 1CZKA 1ZMOA 4M9QA 1GSAA 3MAGA 2P6PA 3CZ9A 4N18A 4TQAA 4TXHA 3EFSA 2QVLA 4RS4A 1W19A 2EJWA 4N8DA 2MMGA 4P5PA 5ALWA 2PAFA 1NNI1 3QXCA 5YASA 4E88A 1MABB 2FETA 4BLWA 1JE0A 3RGGA 1CDZA 1WV1A 2DEUA 1LCIA 2XF8A 4O33A 2O3UA 2H2IA 2UYHA 4KE9A 3HYTA 4U5XA 1QP7A 3Q4GA 5GINE 2HQSA 4DABA 2GASA 4TYNA 5EUBA 2Y77A 5HZHA 2B1GA 2GJAA 3E9NA 4UEWA 5JPIA 4C4AA 3TGPA 2VDOB 3ZWKA 1F6WA 1ZUNB 3C41J 2CXOA 4MW9A 3DE4X 3LBAA 4OMCA 1YOVB 5MN4A 3JAKB 2WFLB 1EFRD 3E81A 2E9SA 2W98A 4F5WA 2YMLA 2VIIA 4J7AA 2WWWA 1XUOA 5L3QA 4LXGA 3BAZA 1I33A 3ETCA 1Y4ZA 4WEQA 1XL0A 1P1IA 4G0PA 3ANNA 4MOWA 4W5TA 5KWJA 2H1FA 1BXGB 3EAGA 2A0YA 2R7NA 2Y1OA 3Q3CA 4NATA 2PMEA 1U0LA 1WDWB 2MOKA 2QN6A 2XH8A 3BKXA 4N6GA 1V4VA 1G42A 5EP2A 5TQ2A 2PH5A 3N75A 4S2EA 4BOYA 5J2UA 2XJ9A 4YAWA 5KNBD 4FXOA 4J2TA 4MAAA 4ZOEA 5TEVA 2OENG 4DWOA 6ABPA 3JVUA 1GL6A 1XD2A 1K68A 3QVGA 1K6IA 1ZSYA 3HCDA 3QELA 5A0FA 3V4ZA 2OQIA 2P6RA 4AN1A 1DMRA 1XMSA 4XDGA 3SJZA 2XI4A 3KZMA 3NUGA 4ARAA 2RIRA 1FX0A 3C2QA 1GCOA 2J3EA 3HXLA 2PJUA 3QBJA 5AVOA 9GPBA 4FM9A 2XDYA 4AS2A 3R24A 3S2GA 3IOCA 1YJ8A 3CPEA 1WMSA 4U2DA 2VSNA 1O7JA 1KRHA 4IDNA 2DT8A 2IS2A 4XI9A 1P9WA 3DAGA 1RXUA 3SF8B 4AF8A 1UWKA 1L5KA 4XTRA 4EYKA 4YYZA 1Z4PX 1KKMA 1OXBB 1WZNA 1XDGA 2ZIUB 2VF2A 3C5CA 3DZKA 1O0BA 1Z28A 4TQDA 3PXDA 5KQMA 3WMFA 5TVKA 4JP1A 4MZDA 4OQPA 4MYHA 4NOKA 1JXQA 2B34A 2WJHA 4TTQA 4WBSA 2CCKA 3CIOA 4HH1A 5AKGA 4B75A 1EFTA 4LZJA 1RAAA 1RTKA 1D1QA 2DP4E 1OFTA 2BLNA 4ZVKA 4D9JA 1M2WA 2F3SA 3HY6A 3L18A 3H2IA 2ZRJA 2NZYA 3AILA 2P77A 2HMAA 4DR6B 3WJAA 3AC0A 3HB1A 9ATCA 3MGGA 2H1WA 4YUXA 1TEHA 2C4VA 3BWEA 4YRGA 4Q6BA 5K0TA 3JSAA 2IV3A 1U7OA 4GR9A 3P9PA 5ALKA 4YV1A 1QFMA 3VOSA 1WTAA 1ZGHA 4C4OA 4K87A 1MEEA 2XB4A 1DIOB 3OESA 4ZODA 3CKMA 5E1MA 1B43A 2CVFA 2REXB 4N65A 4OHCA 2Y9MB 4PAMA 3PZCA 2A30A 2ZJYA 2WT8A 4JELA 4FFBB 1FIUA 1SBNE 1V39A 4P36A 1TAGA 3L7YA 1OLXA 3DP7A 1A8IA 3H83A 3Q1LA 1DCTA 4IV0A 5FUWA 1N2EA 5EE3A 2CZCA 4X7PA 3WQSB 3ZU3A 4M0LA 3RJZA 3W5AA 1BS1A 2AW5A 2WJ6A 3R7LA 3SBXA 4D9EA 4BB0A 1EXWA 3ORQA 3NHLA 5ELLA 3L46A 1MJNA 2AN3A 1K3FA 1WM1A 3GLHE 2UU9B 2JBWA 4OFZA 2BE9A 4BQIA 3PEWA 3GQBB 3G2LA 3KB8A 5GM1A 1XMVA 2Y93A 1LNZA 4MRMA 1OIXA 4JYAB 2CUNA 1KHHA 1FZQA 3BAFA 1F14A 3KSUA 4GM1A 3IUBA 2JH9A 5EP3A 2YQZA 1YQXA 3R74A 3L2ZA 5PGMA 2PZFA 2VUTA 2X22A 5K8LA 2P9YA 1QK5A 4GLOA 1MQSA 1MB0A 2ZVJA 3OUTA 5M04A 1K92A 2X6TA 3ELWA 1BRMA 5HP4A 3DQQA 5LQAA 4QQNA 1UANA 1D6MA 4PLWA 4LMRA 2I4OA 2AG8A 1XTZA 3AZPA 3L6BA 3SXUB 4YRZA 4L8GA 4IIHA 3W8DA 1BXRB 4PSAA 1E3LA 3IUMA 1R9JA 1LEHA 2P3OA 3HY3A 2BC9A 4ZT3A 1XKXA 1QH1B 5BN5A 5FH9A 4BVBA 4Y2HA 2CKDA 2IELA 4YAFA 3A0RB 1UP4A 1MC8A 2H6EA 1T3TA 1XLVA 4NK5A 3MTJA 3TR5A 1OIVA 2AXPA 1V3VA 2XZPA 4M1SA 5ALTA 1J1IA 5ALHA 4CKXA 1C4KA 2C29D 4H35A 3ZBUA 2DHCA 5JXIA 4KXVA 1U1FA 2X7HA 3O5AA 2BEVA 4HF7A 4ZAWA 2QD1A 8ATCA 4OHBA 1RR6A 2JLVA 3DR3A 3FI0A 2I71A 3PGMA 4D98A 4YV2A 2VQFB 9LDTA 1CIJA 4FW9A 4WQMA 4GIBA 4QDXA 5DSXA 4FIDA 1CR2A 3OEYA 4OH1A 5LMCA 2A0XA 1GVNB 1E1LA 2IXGA 4Y6GB 4KOEC 1E32A 1JQLB 2W2OA 1TA9A 1P0MA 1SQSA 2D1YA 4RTPA 2N75A 4YECA 3DFMA 4WBNB 1Z36A 3D8HA 3ZNPA 3FHLA 3KYBA 2F3QA 2H5LA 3TF5A 2Q28A 1W46A 2VH5R 3PC2A 2IIBA 4WA8A 4C4TA 4L4ZA 2P62A 2BMVA 4ZAYA 4FE7A 2GO1A 2GM5A 3K3PA 4HLDA 2PH3A 2X19A 2XYGA 3QWFA 1CJVC 3KQMA 3Q9NA 5I4CA 2BEKA 3WWZA 1BX0A 1T5TA 1I0IA 2E1RA 5AVZA 5AW4A 1K0FA 1Z2EA 2P40A 1JEOA 2PH7A 1S96A 2PQ2A 3B70A 3AR7A 3D02A 4LWQA 4MWSA 5E1OA 1MRSA 2ZWAA 2I3BA 3IAEA 4ZO4A 5DTMA 2PS9A 3BFJA 1NRIA 2BPOA 1BE8A 3E0XA 3LDGA 1E2FA 2CMFA 5KTTA 1E1CB 1X87A 3PXCX 4YQFA 1M2VB 1WULS 4IILA 1C0EA 3A6EA 4OMUA 4PNHA 3QLJA 1WKBA 2B1IA 3KYCB 3N8IA 5JMWA 1PR9A 1UJ4A 2JJ2D 3BDVA 3FWNA 3H1GA 1U94A 3H2YA 2W2VA 2HA3A 4PTLA 1F6BA 2JI6A 2O57A 2V4ZA 3VQTA 2HRZA 3W3AD 4EG1A 1A97A 1VCMA 4GLBA 5J59A 2Y1CA 3W3SA 1DMSA 3A25A 3MERA 4UC0A 5LP6C 4X20B 2IX3A 4Y2QA 2OMKA 4AW9A 3EY9A 1CUZA 4D9BA 1K1EA 3ONNA 2X5OA 2XUKA 4K28A 5FB3A 5FTWA 1EHIA 4BW9A 2GCEA 4BLPA 4PPFA 1O6BA 3VKVA 1L4LA 1SVSA 1YC5A 3DS8A 5GOTA 2E55A 2MSLA 5C8DA 1UK7A 3S81A 2VHVA 3D5QA 1P1JA 4WXRA 4G5FA 4HWKA 2ZZEA 1R27A 4KKVA 4TRMA 4WGFA 2XE6A 5ALEA 3SKYA 5BN4A 3ZQ6A 5BUCA 3IEPA 2WPDA 4I1PA 2HLDA 2JASA 1GL7A 1D4FA 1TGVA 3IDZA 3LSTA 4MW4A 2QRPA 5GQSA 3UXYA 1A9OA 1BMTA 2BEWB 2BUCA 3AU9A 4DCMA 4BLVA 4ZEVA 2CVPA 4R1SA 3S28A 4ZT5A 4AQYB 1DARA 4GF5A 2P6MA 1ZD5A 4ZALA 2YIVX 4BNLA 2ZIGA 3QKSA 4WLNA 4EDHA 2FMUA 4BKMA 2IEGA 4FUQA 3R4VA 3OT1A 5K2MA 4MQ5A 5I5EA 3QVSA 4A5SA 1TUEA 3N8KA 2KLBA 3AGQA 1P6QA 3DKRA 1AKTA 1QLJA 4UVEA 3LGXA 3D8RA 3PPXA 3ZY6A 5EZ6B 1Z13A 4G3XA 4YPVA 4CTNA 2XTIA 1AIPA 2YIMA 3CUTA 3NWBA 1JECA 5IXJA 5C8ZA 1T8SA 2JI4A 4J91A 16PKA 2PWPA 3V1KA 1DB3A 1TDJA 1OASA 4B79A 4TQFA 4YRCA 2PWYA 3I09A 4EENA 2ZBEA 3U3ZA 1TUGA 2HK9A 4EHLA 1ZA2A 1Z74A 2QR3A 4YAOA 1GUFA 1MOSA 1Y89A 1ZSVA 2J6CA 3DMTA 4HG2A 2QX7A 4JR2A 3TI7A 3UICA 1GTVA 2R7MA 1MRZA 2PUEA 1QO0A 3K9GA 5DW3A 5D84A 2NPOA 1BN6A 3LY8A 4G5XA 4BDSA 2X1HA 4XYLA 721PA 3DKKA 4DS3A 1UDWA 4IUCS 4BVEA 1C9JA 1C1DB 2DWUA 1CUGA 3JQRA 4I8XA 3S2SA 3QRWA 1NW5A 4K8OA 2KYRA 3P2YA 1SMKA 4HSEA 1ISRA 1ADFA 2Y3IA 3UKDA 4Z6KA 2GZDA 1ZONA 4OQQA 1UKCA 2H5IA 3IR7A 4KVZA 4GD3Q 1NBWB 1QP8A 3PYMA 4D9IA 1Z0FA 4AULA 4HDAA 4PG4A 5LQUA 1E0DA 1I8TA 3P2EA 2WILA 1CQIA 2RGGA 4CG0A 3SC6A 1VIDA 2NTYC 4NPCA 1SUPA 4W5QA 4CEIA 1N9GA 3QE4A 4JI1B 4FX2A 4UVDA 5SY9A 5EN4A 4ALKA 2OC4A 3PCOA 4IMRA 2ZIEA 1KPHA 1U6IA 2BFDB 5EPUA 1X7ZB 2F6RA 1DEXA 1XCOA 2Y67A 3ZUGA 3C85A 2ZYUX 3FBGA 3L05A 2QL9A 1AVTA 3PL1A 3QIVA 4LN1A 3HFRA 4B3BA 3ZDAA 2H1LA 4KN6A 1V25A 4W5HA 5DYYA 2RCNA 4JEUA 3QOXA 3UEOA 4OVKA 5JZMA 3DCNA 3QE9Y 4E21A 5JTUA 1EJ6A 1L1FA 1P0CA 3ELUA 3OM8A 2C4HA 2CJWB 4TTJA 3B8EA 5I7SA 5K4GA 1IZYA 3WBBA 1T15A 4OP0A 2IRWA 3SDBA 4CCSA 4KOAA 1OLOA 1TL7C 2YNMA 3IPLA 1P1KA 2Z8YA 1R74A 3A3PA 3CKKA 3LA6A 3QA3E 4WDRA 4ZXPA 3ZWYA 3DE0X 4UOQA 2DCMA 4DIUA 2QAGC 3WDLA 3JWIA 1JBQA 1K88A 1UFRA 4KK4A 4LNSA 2O48X 4ZYVA 3O4JA 3N2ZB 3LUCA 2L69A 2JK0A 3PNLA 1ZIYA 5JXJA 4TN5A 1TIPA 1DP4A 1GU7A 1YB3A 1GV1A 1TZ2A 2J09A 3NXKA 2DU8A 1C0KA 2YWXA 2Z30A 4RQEA 4PYNA 5F5NA 1KWKA 2DU5A 1MJGA 4RETA 4UTRA 4IVQA 3KCNA 3R8XA 2I65A 2XRMA 4DG9A 5CYPA 4OHRA 4TUYA 3V9PA 3I2GA 4XYGA 2H4XA 3OZRA 2N1MA 4DMLA 4F71A 5IVHA 4ACAA 4Q15A 4FFWA 2QIPA 4DKJA 1H2FA 3HVRA 2YWFA 2J85A 2Q27A 3FNBA 7GPBA 1DBQA 3N0XA 4J1SA 4DJEC 1GZ3A 2XVZA 1ZDMA 1PGQA 4YY3B 3LQ2A 4K6HA 3ZPXA 1GSOA 1S0UA 1QR2A 4DV7B 1A95A 4BNXA 2ODRC 1QYIA 4JYZA 4C20A 4IIBA 5CA0B 4J8PA 4JU9A 3VR5A 3Q0IA 4TYYA 1JVSA 2WVAA 4B2IA 3AVPA 2IS1A 3WIOA 2DRIA 5IFKA 2IYLD 1PG5A 1Q91A 3DTVA 3E58A 3HSKA 2AFIA 3PL5A 1TTPB 4ON9A 5LYJA 2G9NA 4DLWA 1R6AA 3CVUA 1UJ5A 4RDCA 1IZ9A 3DB1A 5FBQB 3CV3A 3TQTA 1SN7A 4NYJQ 3F9RA 1PEYA 1W1IA 1LI7A 4KXQA 3DPUA 3IUQA 4G81A 4ZAXA 3WWYA 4H2VA 1R8YA 4AYXA 3EAQA 4V1CI 3AFOA 3AEYA 2IXFA 1R8QA 3SFTA 4DDWA 4W6ZA 3M6VA 821PA 4PC2A 1CUBA 4D2IA 4YMIA 1R4AA 1G1MA 1K9VF 1HQKA 3CUEF 1A72A 3SIWA 4HWSA 3D3JA 3GEEA 4JLPA 5HSGA 1IPEA 1GYPA 1R4NA 2Q2VA 4DUYB 2D06A 4DDVA 1YTLA 1ZINA 1Q57A 2VYNA 1JR3E 5H82A 1B0ZA 5CFMA 2AC2A 1EIYA 5F23A 1AQJA 5IC6A 4YR9A 3ABZA 2ZWOA 4TS9A 5BOVA 1YBHA 2G1UA 2VJBA 1UAAA 4OHUA 4PYKA 5TQJA 4CQMA 2PJRA 3UC5A 2R8YA 4B40A 5BQ5A 4DY6A 4UMEA 3GP8A 3CPSA 3G2PA 3V8LA 2ZLBA 1EAMA 3RSFA 4ZCIA 2Z2IA 4Q12A 1BRTA 3K1AB 3L8DA 3L8HA 3CCBA 4JN6B 1FXWF 3WS7A 4AX8A 1YKFA 4CM4B 4QVKA 1ENOA 2CXHA 2FI1A 3REQA 4F97A 3GA0A 4DQKA 1D04A 4PG8A 1KIAA 1YQUA 3E8XA 1XK6A 2O4UX 4ES6A 4HRYA 4QJIA 1KEKA 1Z75A 3CNOA 2OFPA 2V9ZA 3CB4A 1QCZA 5D87A 3GIDA 5JAQA 1EDBA 4MTLA 3MWLA 1XPRA 5C52B 3MFQA 5DM4A 5JAMA 1M2KA 4JX9A 3UOGA 1U9IA 2RG1A 3DKIA 1JIIA 4G09A 1W0KD 5HHTA 1EWQA 2DPLA 4BX8A 2WUGA 1L8AA 2RKOA 4A1OA 3EIEA 3TJZA 4Z7JA 3QU2A 4MW0A 3PLAE 3PRKE 1B7GO 3NHJA 3DBLB 5EAIA 2UXDB 3MS7A 3LVRE 1Y9ZA 4TVSA 4UASA 4ZRDA 5JXWA 1E1MA 1IJFA 2AEFA 4YACA 2C4UA 1TTQB 2H1VA 1V8FA 2XRYA 4G0ZA 3HQ4O 4BP1A 1MNQA 2Y0CA 5KTSA 1CYEA 3EGCA 4BN5A 4JT8A 4TPKA 3A1TA 5CLQA 1OH8A 4B82A 3EA5A 1HO3A 3F78A 1FSZA 1X01A 4LOJA 2IPNA 3JYQA 4A8JB 1SOUA 3I42A 2LCFA 3LF2A 4CF4A 2VNAA 5IJAA 1NA5A 4FOSA 4A26A 3HY1A 3D59A 2P5YA 3V2HA 3REFA 3GUUA 2D2FA 3LM8A 3PITA 2HC9A 2JFZA 1XA4A 3GT4A 3GVCA 1OXMA 1Y1TA 4HP8A 4OXNA 4F04A 2QZZA 4IH9A 4KLZA 4PZZA 1EUDA 1KZ4A 4X60A 2WFAA 3ON5A 4XXHA 1E3QA 3H2JA 1YA8A 5H9WA 3UGKA 4EYOA 2Q0SA 4R71A 5K0NA 2BSQA 5HDQA 2P0YA 5E0OA 3I61A 1Z26A 3MYYA 1PX2A 1D5CA 2YXEA 3EQ7A 3BJUA 2Q49A 3B6JA 5DP2A 2JEZA 4C7VA 2H17A 3RNLA 2GXSA 2H4ZA 2B35A 1NI3A 2Y1DA 4ALIA 2XD9A 1YL7A 3E53A 4ERNA 1Z6ZA 5ERYA 1KYXA 3Q11A 2O5EA 2YY7A 2JIDA 4Z5XA 1ZU5A 3ZW9A 1QKKA 2IZ7A 2P5SA 5JU6A 3QWAA 1YR3A 3JALA 1U3FA 2WKWA 5NLLA 5BSHA 4IHKA 4U0JA 2QQ5A 4MRAA 1W73A 4QOEA 1D1TA 3WKDA 3CR7A 4Z0HO 3EZGA 4P74A 2XMGA 1IN1A 2AWOA 1NIJA 3GY0A 2HPVA 4A36A 1SY7A 4MA0A 2OO5A 2GJ4A 4URFA 1R4MA 5DCLA 5K3FB 4BPRA 4H7HA 4TOIA 2K87A 3BFPA 2ZULA 2YYAA 1U0NA 3KSMA 3SJBA 4CV1A 3EXIA 4B3MB 1WR8A 4EUFA 1E2KA 1FJGB 2XT0A 3OZTA 5HMMA 4DCJA 1N6LA 1RE1A 4CDRA 4JUCA 1JIKA 5IDXA 4ESVA 3GLIB 4E4YA 4JLNA 5EMHA 2WV7A 4NV0A 2VHYA 3DLAA 1VC2A 5DIZA 2VTKA 1DTWA 3MT8A 3DUFB 1NMXA 1PQ4A 4BGUA 3D1LA 1BJRE 4QXOA 3HVIA 2B92A 3TOXA 3KEQA 1GAXA 1RZRA 2QP9X 5K8TA 1ODIA 1WQ3A 3LD9A 3WB1A 5BW4A 5L3SB 3HVHA 3MCVA 3RBXA 2I2BA 3F4KA 1WNLA 4LGMA 2WU0A 2WSSA 4B46A 5IRCD 3INNA 3GLGB 1YZFA 4EHBA 2Z57A 1XEXA 3EGEA 1O58A 5ENDA 5HCUA 2VSOA 1S4MA 5ALNA 4ZGBA 5J2TF 4YWJA 5EJ9A 2P2DA 2X9LA 1BW9B 3OO1A 1O94D 2O5RA 4OM7A 3L0DA 4ZU3A 3RU7A 1FSFA 4X1OA 2JDIA 3TNFA 5FWAA 5A04A 4PFJA 5FPSA 3WXMA 3RVLA 1GUDA 1HMYA 2FWAA 2Y0PA 1RHKA 3FOBA 4J1TA 4TTSA 3SJCA 3TZBA 5CITA 2BFCA 5F9MA 3GJZA 3EX7C 3E9RA 3P9CA 5CDYA 2XB6A 5TPWA 3WX0A 4IMPA 3I3OA 1NI4A 4GR4A 4ETWA 4LVKA 1U28C 1ZCFA 4HAOA 5AI8A 5HFJA 5JROA 1BJKA 4Q4LA 3BREA 2F8MA 3NT2A 4RH3A 1NHWA 4DRYA 1I6LA 3DMRA 3L43A 4MIKA 1OYVA 4BGEA 5DI9A 4ZKEA 3TBHA 4O2BA 1O89A 4BQEA 4E11A 1C9NA 2W6QA 1XK7A 4ZVTA 1RPJA 2BGTA 2OZLB 4R8SA 1W36B 1S5PA 1FTWA 2JBAA 3W90A 1KAMA 4NS1A 4F21A 1EFPA 3LK6A 1NSYA 1OUMA 3RU9A 3RAGA 4G0MA 3LTNC 2DH6A 5D2CA 2D8AA 1HQDA 4Y2VA 4FFSA 4UBJA 1JWLA 3CC8A 5BR4A 3I5UA 2QV0A 4DIEA 5K9ZA 4LFBB 3BJMA 3U16A 1ELOA 1CDDA 2ODQA 4DJAA 3ROGA 3H6GA 1Z2OX 5JASA 1UZAA 3FLMA 4N8EA 4WXEA 5F1OA 3PXAA 5HA5A 1WMAA 4BFTA 1GKIA 4BATA 5JC8A 3CRQA 1PYSA 3EVAA 2QV7A 3TS1A 4MUIA 4AK9A 4IL5A 1L7MA 4H6VA 4QUIA 2NZUG 1GGJA 2R9VA 2QG9A 3OLWA 3JZFA 2XNHA 3THXB