3L2ZA

Crystal structure of hydrated biotin protein ligase from m. tuberculosis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
258
structure length
240
Chain Sequence
RPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTTARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural ordering of disordered ligand-binding loops of biotin protein ligase into active conformations as a consequence of dehydration.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords BirA bifunctional protein
total genus 71
structure length 240
sequence length 258
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2zA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3l2zA01
2P0LA 2VXEA 2QHVA 2AMCB 3VQVA 3ERRA 5GMKi 3AHUA 3P8VA 3TUPA 2ARSA 3HXWA 4XTWA 2ZT8A 2J3LA 2I4NA 2QHUA 2CJBA 3SWNA 1D3BB 1USYC 4CH3A 1NJ6A 5GANd 3HXUA 1ASYA 5C53B 4PJOE 4XU0A 5GAOq 4M77B 4X9CA 2ZZEA 5ELNA 5K1PA 3EFRA 2ZIOA 1H4TA 4RQEA 1YFRA 1I4K1 4PG3A 1E22A 2DVEA 1JJCA 3TEHA 1NNHA 2RHSB 4YYEA 2JN0A 3HXZA 3MEYA 2RHQB 4E51A 4XTVA 4EMKA 4TVYA 4MMLA 3JB9G 2DKGA 3RESA 4BW9A 2I4MA 2E64A 2EJFA 4M75E 1HXDA 5GAN7 4EMHA 1USYA 4RMFA 1QE0A 5LJ5d 4YPFA 1N9SA 4J5YA 3JCMg 3M4QA 4PNOA 4F7UA 4Q15A 4YCVA 2EWNA 3V8LA 3JCMf 4PJOA 4CS2A 4HWSA 4M78B 1G51A 5GANh 3IALA 3ICAA 5GAOp 1SERA 1NYQA 4M78E 4M7DB 2J3MA 2Q7EA 5LJ5h 4ZTUB 5GAMe 2FB7A 4C8QF 1D3BA 4UPAA 3BW1A 4YRIA 1I81A 5LJ5j 2DQ3A 4AH6A 5LJ5e 4YRSA 4M7AF 1X55A 4TVAA 2AMCA 1KQ2A 3QUIA 4M77F 4YDQA 3KFUA 1C0AA 3VQYA 4OLFA 3SWNC 3A5YA 4CH4A 3JCMb 5C51B 3VQXA 2ALYA 3OD1A 1WQWA 1KMMA 4RCCA 2C7IA 2E3CA 2DTOA 3JCMV 3HFOA 3RF1A 4EO4A 2G4CA 5C52B 1JBMA 3LSSA 5LJ3f 2C8MA 5GMKh 3HFZB 4P3OA 4H2WA 3FB9A 5LJ3d 1H641 4M75G 5ELOA 5I21A 4YP0A 3CMQA 4M75C 3JCMh 5GAN2 1NJ2A 4M77E 5GANj 2EJ9A 5E3IA 1VQZA 4EMKB 5GANf 4V2SA 4J6WA 3QO7A 4CS3A 2PMEA 2Q7HA 3HXYA 2I4OA 1BIBA 1NJ5A 2QHTA 4M78G 5GAN6 1WNLA 1NYRA 3A31A 2YHTA 1G5IA 2DXUA 3QTCA 4M77D 3QNEA 1B8AA 2ZINA 2ZZGA 4G84A 4EX5A 4KR3A 1B34B 4YRRA 1ASZA 4N0AA 2ZIMA 2RM4A 3JCMX 5GAMd 4J15A 3WQZA 3JCMW 5DY9A 4LNSA 4XU1A 3UFGA 4WJ4A 1SRYA 3JCMd 3JB9I 1Y96B 4H2SA 4HWTA 3RACA 2ZCEA 5GAN4 5GAN5 5GAMg 1LNXA 4M7DF 1X01A 2ZGWA 1HK9A 3L1AA 4K88A 2P5IA 3HFNA 1H4QA 2IY5A 3RKWA 1EQRA 4HWRA 2Q5IA 4XTYA 3R07A 2ODRD 3PCOB 3JB9J 1B70B 3JCMJ 4PJOC 3A7RA 4XTUA 1YB3A 4K86A 2XTIA 4K87A 4ZTZB 3RIRA 4M7AE 3BJUA 3NELA 3V8KA 4P75A 1I8FA 5LJ3j 4XU2A 4P73C 4M75F 3FIFA 5GMKe 4N0AC 5GMKl 2Q7GA 4M7DC 1U1TA 1QF6A 1JJCB 1PYSA 4C8QA 4YRPA 2K57A 4PJOB 4M78C 12ASA 3P8TA 3UH0A 2DZ9A 1IL2A 1N9RA 2IY5B 3NETA 2DTHA 1LYLA 4A54A 1YFTA 4YCUA 2RB6A 3MF1A 4L87A 4HA8A 3V7SA 4F7UF 2ZNJA 1EFWA 3RERA 4P75C 4C92E 4M75D 2DDZA 1J5WA 4UP7A 1FYFA 4QVDA 2DU5A 2E10A 3INZA 1E1OA 2YLBA 3G1ZA 2YLCA 1ADJA 5GAOl 4TQDA 3PCOA 1EVLA 5GAOr 1X56A 3HXXA 4XTZA 4NCXA 2I4LA 3IG2A 3RGLA 3W3SA 2DXTA 1X2GA 4M7DD 4M7AG 4X9DA 4DPGA 2EL9A 3PGGA 3A7UA 3REXA 5GMKm 3BDUA 1HTTA 3IKLA 4TVAB 3EFSA 2CJAA 3JB9F 1ADYA 4XEMA 1PYSB 3JB9H 3V8JA 4QVCA 2RA2A 2ZR2A 4P73A 1WLEA 4EMKC 1WPYA 2DQ0A 3HRKA 4H2XB 1BIAA 1B70A 4HT9A 4P72C 4P3PA 4PJOF 4M75B 4P3NA 1BBWA 4P74A 4MMKA 4EMGA 3HFZA 4XU3A 3P8YA 4KR2A 1B7YA 3UGQA 2DTIA 4UP9A 3NENA 4M77A 2E1HA 2AKWA 4CS4A 1GGMA 3JCMQ 3L4GA 3HRIA 2FYKA 4JLIA 3SWNB 3E9HA 4NL3A 4UP8A 1KMNA 5GAOm 2E65A 2VC8A 4J6YA 4X5OA 3A32A 2DEQA 1WU7A 2XGTA 1JRIA 4C92F 5LJ5f 4C92A 3IKMB 2ZT5A 4P72A 1L0WA 3BFMA 4J6XA 3HXVA 4TVWA 4Q6GA 5GAMh 4YRKA 5GAOn 3L2ZA 4F7UB 1ATIA 4CH5A 4M75A 3BY7A 1B7YB 3UGTA 2PMFA 4HVCA 5CAIA 3NEMA 2Q5HA 4Y91A 4M7AC 4YRNA 3HY1A 4YRLA 4RDXA 3V7CA 2DZCA 4WF2A 1NJ1A 3HFVA 5GMKj 5KNNA 4M7AD 2RHQA 4H2XA 1B34A 4O2DA 1EIYA 1KQ1A 1RIQA 2ZT6A 1YFSA 4YCWA 4H2UA 2ZZFA 4C8QD 2ARTA 4M7DA 4F7UG 3SB2A 1SETA 2AKWB 2EAYA 2E5AA 4XQ3A 3E9IA 11ASA 3A5ZA 4M78A 4XEOA 2QTXA 1WYDA 4M77C 3MF2A 2CJ9A 4YREA 1Z7NA 2ZNIA 3HSBA 5GAMj 1KOGA 3M4PA 5K1XA 4F7UE 1X2HA 5GAMf 1BBUA 5LJ3h 4P74C 3QO8A 5GAN3 4YROA 1NJ8A 4G85A 4RQFA 3RL6A 1E1TA 2EJGA 3JCMP 4HWOA 4TWAA 4C92C 3VU3C 4XTXA 1TH7A 3M4GA 3REUA 4TQFA 4H2TA 2ZXFA 4C8QB 4JRIA 2E41A 2ALYB 3LSQA 2ZTGA 4TTVA 4A53A 4BWAA 5LJ3g 1M5Q1 4HT8A 3VBBA 4H2YA 4C92D 4C8QE 3TEGA 3A7AA 1I5LA 1EIYB 1HC7A 1N9WA 1WQ7A 2DJZA 2CGHA 3RKYA 4YRCA 1M8VA 5GANe 4WI1A 3LC0A 3QSUA 4M7AB 5GANg 3RUXA 2ARUA 4JUVA 4YRFA 2Y90A 2VXFA 1LJOA 1LOJA 1B76A 4CH6A 2RHSA 3QO5A 4M7DE 3A74A 1MGQA 3RKXA 4YRTA 3FJPA 5GAN8 4KQEA 2RD1A 2I2LA 4M78F 5F5WA 4PJOD 2ZR3A 4M77G 2ZT7A 3QO3A 2ODRC 4WJ3M 1X54A 4DQ2A 3I7FA 1SESA 2HNIA 2CIMA 4NL2A 4OP0A 4HWPA 3PZCA 1U1SA 1YGBA 5LJ3e 1H4VB 5HGQA 4YRQA 3QHSA 3JB9D 4M7DG 1G5HA 4M78D 4H02A 1W66A 3VQWA 3TEHB 3V7RA 3JCMc 4C92G 4YRJA 5LJ5g 1E24A 1EOVA 3L4GB 1YCYA 4ZIBA 2DU7A 4H2VA 3DSQA 4YRMA 4YRGA 1H4SA 4PHCA 4NOYA 4C8QG 2QHSA 4PJOG 4C8QC 1Z7MA 1EVKA 3HTZA 3GIBA 4P71A 4C92B 4RCBA 4JRKA 4P71C 1Y96A 4M7AA 3JCMe 3HY0A
chains in the Genus database with same CATH superfamily
1YWPA 3VQVA 4LE9A 4EDUA 2QHVA 1C0MA 3ERRA 2CDTA 2ZT8A 3UPUA 4HT4A 1LVKA 1WHGA 2L3PA 3M5AA 1U5SA 3HXUA 1Y0MA 4HCKA 5C53B 1UUEA 2VUBA 1AVZC 5GAOq 3CC4Q 4X9CA 1OQKA 2G6FX 1YFRA 3OMCA 3ZL7C 1I4K1 4VUBA 1N8RU 4Y28E 3TEHA 3L2VA 2CH4A 2JN0A 4FU6A 1WXBA 2MIOA 4FYXB 1VUBA 3TSZA 4XTVA 1OV3A 2X4JA 2DBMA 1Q7YU 1M9SA 2O9SA 2OTLT 4M75E 1HXDA 2QA4A 1I07A 1TTHB 2ZZDA 4EMHA 1USYA 4YPFA 1QE0A 3NHNA 2VGMA 3JCMg 2A08A 4PNOA 1X6GA 4YCVA 1VYVA 2YRCA 5CK9A 1Y07A 1TXQA 3A1PA 1RAEB 2LZ6B 3IALA 5HKCA 3ICAA 2HBWA 3CCVA 2DF6A 2FB7A 3X25B 4C8QF 5I2MA 5DLQE 1UG1A 5LJ5j 1WHKA 4AH6A 4CC4B 4BI8B 2OAUA 4TVAA 4J9GA 2CP3A 4HCCA 2NYSA 1RADB 4M77F 1A0NB 2DL4A 1C0AA 9ATCB 2O2OA 1BCMA 4RTVA 3OS0A 1YJWT 3OD1A 2GFAA 5M9OA 2W10A 4EO4A 2G4CA 2DRKA 4FW1A 2MOXA 5GMKh 3CCSA 5IXFA 1YJ9A 4KGXB 4A4EA 1H641 1W6XA 2PVDB 2X3WD 4C0DC 5GANj 2JMCA 3H0HA 2EQMA 1V76A 5FWBA 3CMEQ 2AHJB 3M0UA 1K9MU 2DL5A 3PIOA 4ELYC 2DX1A 1G83A 2COYA 2JVVA 2DK3A 2MCNA 3L42A 4JLGA 4GLKA 3MJXA 3HKSA 5C6SA 2E12A 3CMEA 1KD1U 2L3RA 2JW4A 1KG1A 4Y92A 2ZZGA 2EFIA 2QTVA 4QT7A 3SDZA 3PMIA 1ASZA 4N0AA 3WQZA 4J15A 3VV0A 2B86A 1QVGA 3JCMW 3CC7Q 1EIFA 4A4KA 1SRYA 3JB9I 1LPLA 3CCUA 3RACA 2M16A 2FPEA 5GAN4 1AEYA 2E5KA 4ZN1A 2YUOA 5GAMg 2LX9A 3L1AA 3CPWA 1K73R 3HFNA 1F1BB 1EQRA 2DPPB 4KGZB 2Q5IA 2J06A 3JB9J 5CVIA 3A7RA 3JV3A 1RAGB 4N4IA 4FCYA 4K87A 2CYZB 3EG0A 3BJUA 3NTIA 3CCET 3EFOA 1KC8C 1G3TA 2E5QA 1AWJA 2LCSA 3FIFA 5HY6A 1UTIA 2XG8D 3NGPA 1U1TA 1QF6A 1JJCB 2FZGB 2QQSA 1ZSZA 3VS5A 1VQ4A 2K57A 4M78C 4E7HA 3H9NA 1WXTA 1IL2A 1YFNA 2DVJA 1M1KR 3Q1JA 1LYLA 3EG9A 1K8AC 3MF1A 4L87A 3FRNA 4HA8A 4OF1A 3EGDB 2H8HA 4F7UF 4JJCA 4C92E 3MO8A 4M75D 1X6OA 3X20B 3LLRA 1FYFA 2K4YA 3NFCA 1YHQA 3OS1A 4OB1B 3OSVA 2D0QB 2IG0A 1PRMC 2K3YA 4LUEA 4TQDA 3PCOA 1EVLA 3PTAA 4JJDA 1U06A 3OS5A 5GAOr 3HXXA 1MUZA 4X34A 5IN1A 1KQSS 2FHDA 4FSXA 4M7DD 1VQMT 2KNBB 3REXA 5GMKm 3BDUA 2YSQA 3FDRA 1VQ6A 2CJAA 4AFUC 4LDUA 2DXCA 4RTZA 2CP0A 2VVKA 2ZR2A 3RMSA 4P73A 2B8AA 1K9MR 1GFCA 3MKDA 1VQ9Q 2DQ0A 2QASA 2OX7A 2ZPHB 4PJOF 4OMQA 2C0TA 1QP2A 4EMGA 4J9EA 3P8YA 4LVJA 1X2KA 2LT4A 3RNJA 3CBOA 5KYWA 2QGFB 4C5IA 1Q86U 2AKWA 1PG5B 3L4GA 3OS2A 1K0SA 3SWNB 3E9HA 1AT1B 4NL3A 3MHXA 2E65A 2GNCA 1JJ2S 3HHTB 4LXCA 1I5OB 2DEQA 1PSEA 4KULA 1AOJA 1XOVA 1JRIA 4C92F 5LJ5f 3OSSC 2LQKA 1XNIA 2O9VA 1W2BP 1VQPA 3BFMA 4J6XA 3EGXA 5GAOn 1BB9A 4F7UB 1ATIA 1YP5A 4CH5A 2KY9A 4HVWA 3NEMA 1WYXA 1RAFB 4YRNA 2CSIA 2P0KA 4GY5A 1M3AA 5HK0A 3G7ZA 2QYZA 2MMPA 2HQHA 3V7CA 1FYNA 2DZCA 3HFVA 4AFZC 4BI3A 3PE0A 1VQOT 5KNNA 2RHQA 2CP6A 3EHRA 3PVLA 4O2DA 2ZT6A 3R6OA 1GXIE 5KCOA 2E4HA 2VASA 1OU9A 1YJWA 1TUGB 2PZ1A 2V8KA 4BI4A 5KYWB 3E9IA 11ASA 3J80E 2EYXA 5CO7A 2KRNA 3RMQA 1VOMA 1YJNQ 2H3JA 2X51A 2D9TA 2LVMA 1GCQA 4YREA 2WSFE 4IIOA 1VQOQ 1KOGA 4AT1B 2J6OA 2K7AA 5GAMf 5HCKA 2AT1B 2X35A 4P74C 3QO8A 1KQSP 3S3MA 2LQNA 3VS1A 4G85A 2HBPA 3G4SQ 3VRZA 2EJGA 4TWAA 1SKUB 1NPRA 3QDFA 3DB4A 1M90R 3VU3C 2KDSA 5GJWB 2RHYA 1X43A 1SRMA 4JRIA 2ALYB 5IHKA 2KROA 3LSQA 2AK5A 4TTVA 2JT4A 4A53A 1MV3A 4RTYA 3QPHA 2ZPFB 4RTXA 2JJ9A 5LJ3g 1M5Q1 1YJ9T 3C94A 1FX7A 4H2YA 3TEGA 3G6ET 1N9WA 1YI2A 2CGHA 4YRCA 4C5HA 2KRMA 5GANe 3RDVA 4CC7A 1YWOA 3LC0A 2DIQA 3UA6A 2XHCA 4AFSC 2LC4A 3WXMB 2EYWA 4PJMA 2NUPB 2V1RA 3UDCA 3CPWP 2ARUA 1WXUA 2Y90A 2M51A 1B76A 2QEXA 1D1CA 4A4HA 2ROLA 4M7DE 1UE9A 2CP7A 1Q82C 2RI2A 2JTFA 2LJ0A 5A0GA 1VQLQ 4KQEA 1VQKQ 2QQAA 2EPDA 1ZBXA 2I2LA 2A3LA 4M78F 5F5WA 2EVRA 4DQ2A 2KYBA 3I5SA 2K6DA 1YJNT 3BE3A 4J83A 4OP0A 3OBWA 4OMFB 2ATCB 2RO0A 4YRQA 3QHSA 3JB9D 1SSFA 4M78D 1W66A 1G3YA 2RPNA 4C92G 4YRJA 1E24A 2FRWA 3L4GB 1YCYA 4H2VA 2DJQA 3DSQA 4YRGA 1AWOA 3NTHA 3G71T 4PHCA 3SHWA 4C8QG 4C8QC 1Z7MA 4PFPA 1YN8A 2HQEA 1SHFA 2YDLA 4C92B 2VGNA 4RCBA 1Y96A 3I55Q 1KC8R 1ZQ1A 5GMKi 1M1FA 2HCKA 3TUPA 1ZHIA 2ARSA 1KHIA 3HXWA 5GJVB 4XTWA 2DERA 4CRIA 1VQ7Q 3OYEA 2QHUA 2CJBA 2KE9A 4ZGDB 3WVDB 4PJOE 3A8OB 2ZZEA 3I55A 2VYTA 4D6WA 2HD0A 2CSQA 2RHUA 2A37A 4ELZC 1PHTA 1E22A 1UJYA 2DVEA 4ZNXA 2FPFA 4FYVB 1N8RR 3HXZA 3MEYA 1AWXA 4EMKA 2EQIA 3CCSQ 3RESA 4BW9A 2I4MA 1VQ4T 2E64A 4OGCA 2EJFA 1KSWA 2OTJQ 3GOXA 4BB7A 4RMFA 2PUOB 5LJ5d 3M4QA 2L89A 3V8LA 2KQWA 4ESRA 2F69A 4M78B 1OPLA 4D8DA 1WJQA 2J05A 4DOWA 1W2BS 1K0XA 2LJ3A 5D7UA 2SEMA 2P4TA 2QG9B 4RG2A 5GAOp 1QMCA 1GCQC 4M78E 2KK4A 5LJ5h 4ZTUB 4BD3A 2KGTA 3R6NA 4IURA 1D3BA 3BW1A 1JJ2P 1I81A 3QZ9B 1ABQA 2X4XA 1GBRA 1PSFA 5FROA 2A0FB 1AD5A 5KYUB 1BK2A 3QUIA 4J9FA 1NBEB 2XMFA 2O4XA 1B7TA 4OB3B 1XQHA 3NPFA 4CH4A 3KFVA 1NJIR 3SD4A 4RCCA 1MNDA 2E3CA 3VYHB 1NJIC 2RJDA 3JCMV 3RF1A 2GFUA 5C52B 2C8MA 1UEBA 5AT1B 4H2WA 2CUDA 2X4WA 2LTOA 4M75G 5ELOA 4YP0A 3CMQA 2NUPA 4M75C 1NJ2A 4M77E 1RABB 2EJ9A 5E3IA 3CC7T 4EMKB 4C0FA 3CXCS 4V2SA 4HXJA 1D0YA 4J6WA 5IXBA 1N8RC 3QO7A 2PMEA 1VYUA 4KH0B 2PUKB 3OMGA 2DEUA 3MQZA 3THKA 2HSEB 3OYHA 3CC7A 5GAN6 4OMLA 1WNLA 1VQ7A 3A31A 5FRMA 2EKOA 4Z88A 3EGXB 1QWFA 4HVUA 1C6VX 2LQWA 2YHTA 1G5IA 3JSCA 2DXUA 1OZ3A 3MP6A 2KAFA 5LL6S 2ZINA 2PVGB 4HCBA 1VQNT 4KR3A 1B34B 1EZZB 1WA7A 1UHCA 2FZKB 4YRRA 2ZIMA 2RM4A 3M56A 2KEAA 5DY9A 4CC2A 2RF0A 1KQSA 4LNSA 3UFGA 4HWTA 2L8DA 1Y96B 3EGDA 1HSQA 2ZCEA 1NYGA 4LDWA 2ZGWA 1OX9A 4KUIA 4K88A 1H4QA 2KXDA 2RJCA 2AZVA 1V29B 1G5VA 3G1JA 3PCOB 2BZXA 2X3XD 4PJOC 4XTUA 1YJWQ 4OGEA 3VS7A 4K86A 4J9IA 2AZSA 1Q7YR 2IVWA 1RAAB 4J9HA 2BIVA 3RIRA 4BUGA 1RAIB 5FRNA 4QW2A 3KXTA 2BE9B 2YUNA 3QXEB 5GMKe 5GMKl 2Q7GA 3TVTA 1T3LA 1Q95G 1WI7A 1PYSA 3OYMA 4ZN3A 1VQ5T 3QG1A 1VQOA 3VKIA 5FWCA 5IHIA 1M30A 1W4SA 2DTHA 4ME7A 3S3OA 2K5IA 3QBYA 1LCKA 1K9MC 2XDPA 4PJJA 4II1A 4PK4A 4DBFA 1W70A 2ZNJA 2RJEA 1EFWA 3RERA 2DAQA 4P75C 3FJ5A 2RNAA 3TCJA 3I55T 1J5WA 2MWOA 5IT9E 3D7SB 1G3WA 2WSCE 3INZA 4LNPA 5KE3A 4J8OA 1E1OA 2YLBA 2BZYA 4MZPA 3ULRB 1TWBA 1VQ9A 1X56A 4PL6A 2HAXA 2DYIA 1JXOA 4LDVA 2I4LA 1Q81U 2K2VA 3CCMQ 1WHJA 2DXTA 5DM7R 4DPGA 3PGGA 1CSKA 3IKLA 5J26A 1PC0A 1VQKA 2ESWA 3JB9H 3V8JA 4QVCA 4Z89A 1M1KU 2RA2A 1UDLA 1K8AR 3I35A 3M58A 3OYKA 1VIEA 4BE2A 5ECAA 2DL3A 4H2XB 1B70A 3OYJA 2EGCA 4P3PA 5CQXA 4HCZA 1ZSZC 4P74A 4MMKA 3IQLA 4QVZA 1PD1A 3TREA 2E3HA 2RJFA 4BACA 4KR2A 2KRSA 1M2OA 2DTIA 4Z02A 4UP9A 2ZCFB 1KK7A 1BI2A 4HKEA 4M77A 3NENA 1WZOA 2EQKA 2O31A 4CS4A 2NWMA 2FYKA 2D8HA 4JLIA 4UP8A 1KMNA 1OPKA 4DEXA 5IHNA 4X5OA 3C95A 1WU7A 4OMPA 1S72A 2H3EB 4XK8E 1XTDA 2V8JA 3CD6T 3IKMB 1M1GA 3MEAA 2QQBA 3OYAA 1UGRB 1Y7XA 1YHQQ 1WHLA 3UGTA 1B7YB 2DLPA 4J7IA 3VS2A 5CAIA 3TEEA 1OX8A 4Y91A 4M7AC 1OI1A 1KIKA 4J9DA 4RDXA 2AKLA 4WF2A 2DE0X 1M3BA 4DBHA 3I56T 4H2XA 1SSHA 1EIYA 1NYFA 3REBB 5KYNA 4R0KA 4OB0B 3I9QA 2O01E 2BZ8A 1NZ9A 1ZA2B 4YTLA 3SB2A 1UHFA 2AKWB 2ZPGB 2MAMA 4OB2B 2A28A 1H3HA 1JXMA 4M78A 4XEOA 2QTXA 2QEXQ 3DLLA 1WYDA 4M77C 2LQ8A 1YNZA 4ZGJB 2KVQG 4J9CA 1IO6A 1J3TA 1Z7NA 1EFNA 1K76A 1NE8A 3H6ZA 4NS5A 5GAMj 2DNUA 3OW2P 3L2WA 1CKAA 1X2HA 1K1ZA 3C4SA 1BBUA 5LJ3h 4E7LA 2OAWA 4RQFA 2JMAA 3CMAA 4XTXA 3ZBDA 3CC2A 1OULA 4C0ZA 1VQ8T 3QYGB 2VB6A 2RQWA 4E47A 3A8LB 3HPWA 2YT6A 1QVPA 2D1XA 1C1AA 5I11A 1NM7A 4FIBA 4C8QE 3A7AA 1EIYB 1WQ7A 3RKYA 2RHXA 3E9GA 2M9UA 3QSUA 3RUXA 2FPDA 4JUVA 4HVVA 1IXDA 4CH6A 1VQPQ 4JS5A 1M90U 2ZPBB 2CP2A 3DKMA 2ODRC 4WJ3M 2JS2A 4C5GA 3GPLA 2P4RA 5HK3A 4HWPA 1KFZA 4EIKA 4KUDK 4FL6A 1HJDA 3PZCA 4LUDA 1UECA 5HGQA 2KYMA 3OYBA 4PJLA 4H02A 3HRSA 3VQWA 3I5RA 5LJ5g 1EOVA 2DU7A 1ZBJA 1H4SA 4FT2A 4L59A 1RACB 4PJOG 2WACA 2F2VA 3HTZA 3J81E 5FW9A 2CP5A 2CH4W 4JRKA 1H3ZA 4P71C 3LX7A 4M4ZA 4ORZA 3JCMe 4RQEA 2LCLA 3CCVT 2LMJA 2AMCB 4ANJA 3AHUA 3P8VA 1TSFA 4PJNA 3H8ZA 2J3LA 3MEVA 3OYGA 2I4NA 5FU7C 3X26B 3HTRA 1USYC 1G8XA 3OYNA 3MEUA 1NJ6A 1R0CB 5GANd 4CH3A 1ASYA 2ECZA 4XU0A 4M77B 1QVGP 3EFRA 2ZIOA 4CC3A 3JRZA 1JJ2A 1JJCA 1BI3A 1K73U 1VQLT 1NNHA 4YYEA 2ZPIB 1X75C 4KH1B 4IUPA 4J9BA 3OBYA 2RHQB 4TVYA 4LN2A 3JB9G 1YBYA 3CCMA 1VQ8A 4WTOB 5GAN7 4RTTA 2NUZA 2L3SA 1N9SA 2IIMA 4Q15A 1IRXA 3G6EQ 1YHQT 3JCMf 4PJOA 4CS2A 2YXYA 3CBPA 4HWSA 2JOYA 2FEIA 1G51A 1YJ9Q 4AG1C 5GANh 1SERA 3CD6Q 2ENMA 4M7DB 3M59A 1VQLA 3M0QA 3P8DA 2G3RA 4IIMA 4UPAA 1ZUYA 1PWTA 3OY9A 1MMNA 3CPWS 3E1SA 3ZEHA 4M7AF 3FEOA 1D1AA 2AMCA 1NLPC 2AKKA 2HEQA 3VQYA 5EG2A 3T9NA 1OZ2A 2HDAA 3A5YA 1DJ7B 2R5AA 4BY6B 2JXBA 3JCMb 3VQXA 1N6AA 3CCJA 2ALYA 1WQWA 2D0NA 3OYYA 1IREB 1KMMA 1KC8U 2LCCA 4JJNK 3GF5A 4RTWA 1RI0A 1IGUA 5FU6C 5LJ3f 2Y4XA 3P8BB 3HFZB 2HZYA 3CMET 1M3CA 3FB9A 3LGFA 5LJ3d 4Z8AA 2CZ1B 2L3QA 2GQVA 4J7FA 2BE7D 1VQ5Q 3CCQT 2QA4Q 3GBQA 4CS3A 2GQIA 1NG2A 2Q7HA 3HXYA 2I4OA 2X4YA 1BIBA 1NJ5A 1Y57A 2DA9A 1GFDA 1K4US 2QHTA 4M78G 1QKWA 1YI2T 1ZUUA 1NYRA 2JS0A 2NUTB 3OYCA 5D6XA 1VQNA 2O88A 4LVMA 1T3SA 4UC4A 2KR3A 4ZGEB 5GAMd 3AT1B 1VQ9T 1S1NA 1BYMA 1AWWA 2RQUA 2EGAA 2W0ZA 4WJ4A 3CCQQ 3CCJT 2MF2A 2CUBA 4O5VA 1G2BA 1E6GA 1LNXA 3A8HB 4M7DF 1X01A 1VQMQ 1HK9A 2IY5A 2P5IA 4JDSA 3RKWA 3CCMT 1BKBA 3NTKA 4HWRA 4QQDA 3M4YA 3LH5A 3R07A 6AT1B 2ODRD 3LW5E 1B70B 2EGEA 2RI5A 1YB3A 3SFMA 1GCPA 4M7AE 1YI2Q 3NELA 3V8KA 3FC3A 1I8FA 5LJ3j 4XU2A 4JPBW 4M75F 2K3XA 3E2UA 2JZ2A 1QLYA 4M7DC 1WLPB 3CD6A 2QA4T 4F16A 3L2UA 2C0IA 1UGQB 3CCUQ 4YRPA 2LJ1A 4PJOB 1MMGA 3P8TA 2DZ9A 3CCRQ 1PNJA 1N9RA 1SF9A 1Y71A 1R0BG 5CKFA 3CC2Q 3NETA 2PVOB 4A54A 4YCUA 2RB6A 2RK1A 1TU0B 3V7SA 1P92A 3PNWC 3H0IA 1ACMB 3HP9A 2QAZA 4QVDA 2E10A 3TSWA 3PIPA 2SRCA 3CCEQ 1KD1C 2K2MA 2E3IA 2YLCA 1ADJA 5GAOl 1X69A 2DFUA 2K5FA 4NCXA 1PRLC 5L23A 1I0CA 5KCHA 1QVGS 4BE1A 3IG2A 3RGLA 3FLGA 1H92A 4FYYB 1GRIA 2RHIA 4X9DA 3UT1A 2EL9A 1HTTA 4TVAB 3EFSA 3CXCP 3JB9F 2CS7A 2CKKA 3S6WA 2RK2A 2AIRB 3GP8A 3LGLA 1W2BA 2Z0WA 1CKBA 1VQNQ 4M75B 4P3NA 1VQ4Q 3HFZA 3VYGA 2KI7A 2ZPEB 4XU3A 1ABOA 3MP8A 2XDDA 3CCLT 3G4ST 2QK0A 1B7YA 2E1HA 2QQRA 5CIUA 4FM4B 3KUFA 3JCMQ 2R57A 1D1BA 1UB4A 4LD9K 1VQ6Q 4J6YA 3A32A 2GTOA 3ER0A 2EYQA 4RTUA 1ARKA 1VQ7T 4C92A 2FZCB 1VA7A 3REAB 2ZT5A 2P0QA 2ZAEA 1Z9ZA 4P72A 1WDXA 1R77A 3CCVQ 3HXVA 1WHMA 4X1VA 4TVWA 1JEGA 4YRKA 1R8OB 1OEBA 5A0DA 2DYBA 1M8MA 2PMFA 4HVCA 2Q5HA 3CXCA 4B6MA 2HQXA 2QXFA 2HL5C 1YITT 3UWNA 5CKDA 2MK5A 3OW2A 3H0FA 3HY1A 2DL7A 1UFFA 4YRLA 2LNHB 3MP1A 5GMKj 2L2PA 3G4SA 3O5ZA 4D8KA 1B34A 2FRYA 1Q82U 4KBMB 1KQ1A 1VYTA 1RUWA 2WSEE 1Q81R 4PFOA 1YFSA 3HRTA 4A4FA 2K5LA 4H2UA 2ZZFA 1NLOC 4C8QD 1MNEA 4F7UG 1YIJQ 3N5BB 1SETA 2X9HA 4F14A 5CCAA 2EAYA 1M1KC 2JTMA 1UGSB 3G6EA 3PFSA 1HYOA 3A5ZA 2JM9A 1V1CA 2NLUA 3HRUA 3LWHA 4EPCA 2P84A 4MDWA 3MF2A 1QVFP 3L2RA 1H8KA 2M02A 1YIJA 2ZNIA 2XDBA 5FU7B 2C0OA 5K1XA 2OTLQ 3TU4K 5KYYB 4FT4A 2A36A 4YROA 1VQPT 1AZGB 3VS4A 1NJ8A 3DLMA 3RR6A 3RL6A 4HWOA 1EX4A 4JZ3A 4C92C 3EG2A 3A98A 4TQFA 2BTTA 4H2TA 4C8QB 5A0LA 2E41A 2RMOA 4L5GA 2K9GA 1RLPC 1M4ZA 3CEYA 3UA7A 2VV5A 2F1LA 3S3NA 4C92D 1JB0E 1WGSA 1I5LA 1GL5A 2EIFA 1QKXA 3O8VA 2DJZA 1M8VA 4WI1A 1MV0B 1QWEA 5C0MA 2K79A 1S72Q 2EQJA 2DETA 1W1FA 3LH0A 3MPUB 2BKDN 4ATOA 2E6ZA 1LOJA 5D6YA 1Q7YC 2RHSA 3QO5A 3URGA 2I0NA 3A74A 3E19A 4OMMA 2NUTA 1MGQA 3RKXA 4YRTA 1VIFA 3FJPA 5GAN8 3OA6A 4PLLA 1JU5C 2QQ9A 4LDXA 1NEBA 2QDLA 4F17A 4PJOD 2ZR3A 2ZT7A 4IUUA 3QO3A 1RL2A 1X54A 3I7FA 1TG0A 1SESA 3M55A 3EHQA 2CIMA 4NL2A 4WCIA 3GLXA 2F5KA 1ZSGA 4N4HA 5LJ3e 1H4VB 3E9FA 4E7ZA 1G5HA 3TEHB 5J3BA 5CKBA 3JCMc 3VS0A 4ZIBA 2CT4A 1QP3A 4YRMA 3UATA 1MMAA 2RQRA 3SEMA 4C0GA 4DBRA 2PTKA 2QHSA 3EG3A 4P71A 5A2QE 2RQTA 4MZMA 4M7AA 1RIQA 2GBQA 3HY0A 1IB8A 2P0LA 1NEGA 2VXEA 2QGGA 2OTJA 3KBGA 1D0XA 2CT3A 8AT1B 5KYXB 2E6NA 1FMVA 4FYWB 4FW2A 3PMTA 1SG5A 3SWNA 1D3BB 2EQUA 1PM3A 1D0ZA 1QQJA 4LDYA 1N27A 1BU1A 4LVIA 4A4GA 4IKFA 5ELNA 5K1PA 2GCXA 1O75A 1Z9QA 1H4TA 3VRYA 3MEWA 4PG3A 1NPPA 2EBPA 2RHSB 1UJ0A 3META 1VQ6T 2DBKA 2YUQA 4QQ6A 2JTEA 2KXCA 4PFZA 4E51A 4KGVB 4MMLA 2DKGA 3DB3A 2DD5A 1SHGA 2COWA 3G71A 5KYYA 1T0JA 8ATCB 4AFQC 1M90C 1VQ5A 1TOVA 4J5YA 3OYIA 4F7UA 2EWNA 3CBMA 3I56A 1ZA1B 2F2WA 1RLQC 2ED0A 4K11A 1NYQA 3QZ5B 1SPKA 3A8GB 2ABLA 1OOTA 1XJWB 4R56A 2J3MA 4O6JA 2Q7EA 3EH2A 5EC7A 5GAMe 3CCJQ 3QWYA 2CZ0B 2HSPA 2XKOC 3X24B 4YRIA 2HMAA 2DIGA 5FLXE 2DQ3A 5LJ5e 4YRSA 4OMNA 2PNIA 4RG8A 1X55A 3TQ7P 1KQ2A 3CQTA 4YDQA 3KFUA 3PT9A 1TUDA 3ZFJA 4OLFA 3SWNC 1GBQA 1X6BA 2FG0A 5C51B 5IH2A 2MYSA 4E7KA 1SRLA 3BDLA 2C7IA 2DTOA 3HFOA 1UGPB 4L6V5 2JM8A 4MDXA 1FMWA 1JBMA 1JO8A 3LSSA 4P3OA 2V1QA 1YCSB 3JAME 4BDYA 1ZSZB 2HKQB 5I21A 3JCMh 5GAN2 2NS6A 2PQWA 1ZLMA 2R58A 1IHVA 1FXXA 1VQZA 3CC2T 5GANf 1PKSA 5I22A 3RBBB 1G3SA 1IGQA 2FVUA 2RH2A 2RI3A 1K8AU 2FO0A 3CMAT 1QW1A 3OYLA 3CCUT 2KMTA 3WVEB 1MHNA 3VUBA 2D6FA 2MI6A 7AT1B 2DD4A 3A8MB 2E70A 2EYYA 4GBQA 3QDRB 3M57A 1O9SA 1VQMA 2A7YA 2J7IA 4M77D 3QTCA 3QNEA 3M0PA 4DOVA 1B8AA 2M1HA 4G84A 4EX5A 3M0RA 1QVFS 2XK0A 1I1JA 3JCMX 1Q81C 2DILA 4FSSA 4XU1A 4OMOA 5CKHA 2CZ6B 3EG1A 3JCMd 4H2SA 1UGVA 3M53A 5FU6B 1X2QA 1PCXA 4GLMA 1M27C 5GAN5 3H41A 3U23A 3F70A 3MCAB 2M0OA 4BY6C 1T0HA 2XD0A 2XI9A 2K3BA 1WHHA 3A5ZB 4XTYA 2GTJA 3JCMJ 2XTIA 4ZTZB 3UF4A 3VUZA 4P75A 1IZ6A 4P73C 1NJIU 1OYXA 3QIIA 4N0AC 3CPFA 1Q86C 2LNVA 4C8QA 3HL8A 1QVFA 4QKUA 12ASA 3UH0A 2L0AA 4KRTA 2IY5B 1HD3A 1WX6A 1YFTA 2J6KA 3C12A 5CKEA 1YITA 1QCOA 4RKUE 2BUDA 2F2XA 2KSSA 4BE0A 2DDZA 4UP7A 5AYFA 2XU8A 1MMDA 2DU5A 4B9XA 4C5EA 3G1ZA 3OQ5A 4QQGA 5CQYA 1IHWA 4XTZA 5KH6A 3L2QA 5KE2A 4N4GA 3C0CA 1FMKA 3W3SA 1S72T 3CCQA 2DM1A 4RUGA 1X2GA 2LRQA 2VKNA 3QYHB 4M7AG 1WIEA 3A7UA 2CREA 2A8EA 4E7IA 1ZUKA 2F5TX 1ADYA 4XEMA 1AHJB 3CCRT 4LVKA 1PYSB 3CCLA 4JJBA 3VJPA 1WLEA 2LDMA 2Y4YA 4EMKC 1WPYA 2DXBA 3HRKA 2J6FA 1BIAA 3EGUA 4HT9A 4C0DB 4P72C 4PKCC 1BBWA 2OJ2A 2EYZA 5J39A 4Q5WA 3LWIA 4DEYA 4JRPA 1PKTA 1KD1R 2OTJT 4E2FB 3UGQA 2LT1A 3ME9A 4F04B 1BI1A 4E7SA 2IPOB 4R55A 3CCST 4AG2C 1GGMA 1X27A 3HRIA 1TUCA 2LX7A 3QJ6A 2COZA 1BI0A 5GAOm 3M54A 2VC8A 4BDZA 2C06A 2XGTA 2JNGA 5KYXA 1OU8A 2ED1A 5DLOA 1U8RA 3J7AF 1ZX6A 3QKJA 1VQ8Q 2HL3A 1L0WA 4Q6GA 5GAMh 3L2ZA 1BBZA 3ASKA 3CCEA 3CCRA 4M75A 3BY7A 3GNGA 2M0YA 1SEMA 4CI0C 2YRDA 1K9AA 2L5QA 1AZEA 1KJWA 1NJ1A 4E6RA 2MPXC 4M7AD 2EW3A 4JRQA 3CMAQ 2KT1A 2YUPA 4TVRA 1TS9A 2JUFA 4YCWA 3G71Q 4JS4A 3P8HA 1BCOA 4AMCA 2ARTA 4M7DA 2ROTA 2OTLA 2OI3A 2V8IA 1WFWA 2RHZA 4P5NA 5CR2A 2E5AA 4XQ3A 4RMOA 2D8JA 4LD6A 2QDYB 1YIJT 1M2VB 4A63B 2DRMA 2FL7A 1VQKT 5IAYA 1QCFA 4E7JA 3CC4A 3OYFA 2CZ7B 2CJ9A 1N5ZA 4ZTFA 3HSBA 4LVLA 1U3OA 2KT8A 3EFOB 3M4PA 4F7UE 2R5MA 5GAN3 5KYUA 3LYIA 1YITQ 1RI9A 3X28B 3CCLQ 1E1TA 2DO3A 3OW2S 3JCMP 4IUTA 3M0SA 1TH7A 3M4GA 3REUA 2VWFA 2ZXFA 3EG9B 5D6WA 3PVQA 2QI2A 1KHCA 3OB9A 2ZTGA 2P0PA 3M0TA 1B07A 2XICA 3CC4T 4BWAA 1FWZA 1E7OA 4OVAA 4KT0E 4HT8A 3VBBA 1D09B 2EKHA 1HC7A 4B9WA 1JQQA 2RN8A 4MZTA 1PD0A 1K73C 3GNFB 4M7AB 5GANg 2MWPA 4YRFA 4ZTJA 4DBQA 1QCNA 4IUVA 2VXFA 3QJYA 1LJOA 4JZ4A 1M2VA 1YJNA 1Q86R 2LP5A 2KBTA 5L8RE 5I2SA 2RD1A 1E6HA 2GGRA 4M77G 1RAHB 2XIDA 2RQVA 3EAEA 3VS6A 2DMOA 4DA4A 2DL8A 2HNIA 2QEXT 2PU9B 1B3QA 4PLIA 4XAXB 1U1SA 1WJSA 1YGBA 4M7DG 3M9QA 3V7RA 2GF7A 3QWXX 2YWWA 3OYDA 4IUQA 2HKNA 4NOYA 3NMZC 3I56Q 2V26A 1EVKA 3GIBA 2O4XB 2YRVA 1WJRA 3VS3A 3EH1A 1Q82R
chains in the Genus database with same CATH topology
3VQVA 4EDUA 2QHVA 3ERRA 2ZT8A 3UPUA 4HT4A 3M5AA 3HXUA 5C53B 2VUBA 5GAOq 4X9CA 1YFRA 3OMCA 1I4K1 4VUBA 1N8RU 4Y28E 3TEHA 3L2VA 2JN0A 4FU6A 1VUBA 4XTVA 2X4JA 1Q7YU 1M9SA 2OTLT 4M75E 1HXDA 2QA4A 2ZZDA 4EMHA 1USYA 4YPFA 1QE0A 2VGMA 3JCMg 4PNOA 4YCVA 5CK9A 1Y07A 3IALA 5HKCA 3ICAA 3CCVA 2FB7A 3X25B 4C8QF 5I2MA 5DLQE 5LJ5j 4AH6A 4BI8B 2OAUA 4TVAA 4HCCA 4M77F 1C0AA 3OS0A 1YJWT 3OD1A 2GFAA 5M9OA 4EO4A 2G4CA 5GMKh 3CCSA 1YJ9A 4A4EA 1H641 2PVDB 4C0DC 5GANj 2EQMA 2AHJB 1K9MU 3PIOA 4ELYC 2JVVA 2DK3A 3L42A 4JLGA 4GLKA 3HKSA 5C6SA 2E12A 3CMEA 1KD1U 2L3RA 1KG1A 2ZZGA 2EFIA 3SDZA 3PMIA 1ASZA 4N0AA 3WQZA 4J15A 3VV0A 1QVGA 3JCMW 1EIFA 4A4KA 1SRYA 3JB9I 3CCUA 3RACA 2M16A 5GAN4 4ZN1A 5GAMg 2LX9A 3L1AA 3CPWA 3HFNA 1EQRA 2DPPB 2Q5IA 3JB9J 5CVIA 3A7RA 4N4IA 4K87A 2CYZB 3BJUA 3NTIA 3CCET 1KC8C 1G3TA 2E5QA 3FIFA 5HY6A 2XG8D 1U1TA 1QF6A 1JJCB 2QQSA 1VQ4A 2K57A 4M78C 4E7HA 1IL2A 3Q1JA 1LYLA 1K8AC 3MF1A 4L87A 3FRNA 4HA8A 4OF1A 4F7UF 4C92E 3MO8A 4M75D 1X6OA 3X20B 3LLRA 1FYFA 2K4YA 3NFCA 1YHQA 3OS1A 4OB1B 3OSVA 2D0QB 2IG0A 2K3YA 4TQDA 3PCOA 1EVLA 3PTAA 3OS5A 5GAOr 3HXXA 4X34A 5IN1A 1KQSS 2FHDA 4FSXA 4M7DD 1VQMT 3REXA 5GMKm 3BDUA 3FDRA 1VQ6A 2CJAA 4LDUA 2DXCA 2ZR2A 3RMSA 4P73A 2B8AA 2DQ0A 2ZPHB 4PJOF 1QP2A 4EMGA 3P8YA 4LVJA 2LT4A 3CBOA 4C5IA 1Q86U 2AKWA 3L4GA 3OS2A 3SWNB 3E9HA 4NL3A 3MHXA 2E65A 1JJ2S 3HHTB 2DEQA 1PSEA 4KULA 1XOVA 1JRIA 4C92F 5LJ5f 3OSSC 2LQKA 1XNIA 1VQPA 3BFMA 4J6XA 5GAOn 4F7UB 1ATIA 4CH5A 2KY9A 3NEMA 4YRNA 2P0KA 4GY5A 5HK0A 3G7ZA 2MMPA 3V7CA 2DZCA 3HFVA 4BI3A 1VQOT 5KNNA 2RHQA 4O2DA 2ZT6A 3R6OA 1GXIE 5KCOA 1YJWA 2V8KA 4BI4A 3E9IA 11ASA 3J80E 5CO7A 3RMQA 2H3JA 2D9TA 2LVMA 4YREA 2WSFE 1KOGA 5GAMf 2X35A 4P74C 3QO8A 3S3MA 4G85A 2HBPA 2EJGA 4TWAA 1NPRA 3DB4A 3VU3C 2KDSA 2RHYA 4JRIA 2ALYB 3LSQA 4TTVA 4A53A 3QPHA 2ZPFB 5LJ3g 1M5Q1 1YJ9T 3C94A 1FX7A 4H2YA 3TEGA 3G6ET 1N9WA 1YI2A 2CGHA 4YRCA 4C5HA 5GANe 3LC0A 2DIQA 2XHCA 2LC4A 3WXMB 3UDCA 2ARUA 2Y90A 1B76A 2QEXA 4A4HA 4M7DE 1Q82C 2RI2A 2JTFA 5A0GA 4KQEA 2QQAA 1ZBXA 2I2LA 2A3LA 4M78F 5F5WA 4DQ2A 1YJNT 4J83A 4OP0A 3OBWA 4OMFB 2RO0A 4YRQA 3QHSA 3JB9D 1SSFA 4M78D 1W66A 1G3YA 4C92G 4YRJA 1E24A 3L4GB 1YCYA 4H2VA 3DSQA 4YRGA 3NTHA 3G71T 4PHCA 4C8QG 4C8QC 1Z7MA 2HQEA 4C92B 2VGNA 4RCBA 1Y96A 1ZQ1A 5GMKi 1M1FA 3TUPA 1ZHIA 2ARSA 1KHIA 3HXWA 4XTWA 4CRIA 3OYEA 2QHUA 2CJBA 4ZGDB 3WVDB 4PJOE 3A8OB 2ZZEA 3I55A 2VYTA 4D6WA 2HD0A 2RHUA 4ELZC 1E22A 2DVEA 3HXZA 3MEYA 4EMKA 3RESA 4BW9A 2I4MA 1VQ4T 2E64A 4OGCA 2EJFA 3GOXA 4BB7A 4RMFA 2PUOB 5LJ5d 3M4QA 2L89A 3V8LA 2KQWA 2F69A 4M78B 4DOWA 1W2BS 1WJQA 2P4TA 4RG2A 5GAOp 4M78E 2KK4A 5LJ5h 4ZTUB 4BD3A 4IURA 1D3BA 3BW1A 1I81A 3QZ9B 2X4XA 1PSFA 5FROA 3QUIA 2O4XA 4OB3B 1XQHA 4CH4A 3SD4A 4RCCA 2E3CA 3VYHB 1NJIC 2RJDA 3JCMV 3RF1A 2GFUA 5C52B 2C8MA 1UEBA 4H2WA 2X4WA 2LTOA 4M75G 5ELOA 4YP0A 3CMQA 4M75C 1NJ2A 4M77E 2EJ9A 5E3IA 3CC7T 4EMKB 4C0FA 3CXCS 4V2SA 4J6WA 1N8RC 3QO7A 2PMEA 2PUKB 3OMGA 3MQZA 3OYHA 3CC7A 5GAN6 1WNLA 1VQ7A 3A31A 5FRMA 2EKOA 2YHTA 1G5IA 3JSCA 2DXUA 1OZ3A 3MP6A 2KAFA 5LL6S 2ZINA 2PVGB 4HCBA 1VQNT 4KR3A 1B34B 4YRRA 2ZIMA 2RM4A 3M56A 5DY9A 4LNSA 1KQSA 3UFGA 4HWTA 2L8DA 1Y96B 2ZCEA 4LDWA 2ZGWA 4KUIA 4K88A 1H4QA 2RJCA 1V29B 1G5VA 3PCOB 4PJOC 4XTUA 4OGEA 4K86A 2IVWA 2BIVA 3RIRA 4BUGA 5FRNA 4QW2A 3KXTA 3QXEB 5GMKe 5GMKl 2Q7GA 1PYSA 3OYMA 4ZN3A 1VQ5T 3QG1A 1VQOA 3VKIA 4ME7A 1W4SA 2DTHA 3S3OA 2K5IA 3QBYA 1K9MC 2XDPA 4II1A 2ZNJA 2RJEA 1EFWA 3RERA 2DAQA 4P75C 3I55T 3TCJA 1J5WA 2MWOA 5IT9E 1G3WA 2WSCE 3INZA 5KE3A 4J8OA 1E1OA 2YLBA 4MZPA 1VQ9A 1X56A 4PL6A 2HAXA 4LDVA 2I4LA 1Q81U 2K2VA 2DXTA 5DM7R 4DPGA 3PGGA 3IKLA 5J26A 1VQKA 3JB9H 3V8JA 4QVCA 1M1KU 2RA2A 3OYKA 3M58A 1VIEA 4BE2A 4H2XB 1B70A 3OYJA 4P3PA 5CQXA 4HCZA 4P74A 4MMKA 4QVZA 3TREA 2RJFA 4BACA 4KR2A 2DTIA 4Z02A 4UP9A 2ZCFB 4HKEA 1BI2A 4M77A 3NENA 2EQKA 4CS4A 2FYKA 4JLIA 4UP8A 1KMNA 4X5OA 3C95A 1WU7A 1S72A 4XK8E 1XTDA 2V8JA 3CD6T 3IKMB 1M1GA 3MEAA 2QQBA 3OYAA 1UGRB 1Y7XA 3UGTA 1B7YB 4J7IA 5CAIA 3TEEA 4Y91A 4M7AC 1OI1A 4RDXA 4WF2A 3I56T 4H2XA 1EIYA 4OB0B 2O01E 1NZ9A 4YTLA 3SB2A 2AKWB 2ZPGB 2MAMA 4OB2B 4M78A 4XEOA 2QTXA 3DLLA 1WYDA 4M77C 2LQ8A 4ZGJB 2KVQG 1Z7NA 1NE8A 4NS5A 3H6ZA 5GAMj 3L2WA 1X2HA 3C4SA 1BBUA 5LJ3h 4E7LA 4RQFA 3CMAA 4XTXA 3ZBDA 3CC2A 4C0ZA 1VQ8T 3QYGB 4E47A 3A8LB 3HPWA 1QVPA 4FIBA 4C8QE 3A7AA 1EIYB 1WQ7A 3RKYA 2RHXA 3E9GA 2M9UA 3QSUA 3RUXA 4JUVA 4CH6A 4JS5A 1M90U 2ZPBB 3DKMA 2ODRC 4WJ3M 4C5GA 3GPLA 5HK3A 4HWPA 3PZCA 4KUDK 4FL6A 5HGQA 3OYBA 4H02A 3HRSA 3VQWA 5LJ5g 1EOVA 2DU7A 1H4SA 4FT2A 4L59A 4PJOG 2WACA 3HTZA 3J81E 4JRKA 4P71C 1H3ZA 3LX7A 4RQEA 3JCMe 2LCLA 3CCVT 2AMCB 3AHUA 3P8VA 3H8ZA 2J3LA 3MEVA 3OYGA 2I4NA 5FU7C 3X26B 1USYC 3OYNA 3MEUA 1NJ6A 5GANd 4CH3A 1ASYA 4XU0A 4M77B 3EFRA 2ZIOA 3JRZA 1JJ2A 1JJCA 1BI3A 1K73U 1VQLT 1NNHA 4YYEA 2ZPIB 1X75C 4IUPA 3OBYA 2RHQB 4TVYA 3JB9G 1YBYA 3CCMA 1VQ8A 5GAN7 1N9SA 4Q15A 1YHQT 3JCMf 4PJOA 4CS2A 3CBPA 4HWSA 2JOYA 1G51A 5GANh 1SERA 4M7DB 3M59A 1VQLA 3P8DA 2G3RA 4UPAA 3OY9A 3CPWS 3E1SA 3ZEHA 4M7AF 3FEOA 2AMCA 3VQYA 5EG2A 3T9NA 1OZ2A 3A5YA 1DJ7B 2R5AA 4BY6B 3JCMb 3VQXA 1N6AA 3CCJA 2ALYA 1WQWA 3OYYA 1IREB 1KMMA 1KC8U 4JJNK 2LCCA 3GF5A 1RI0A 5FU6C 5LJ3f 2Y4XA 3P8BB 3HFZB 3CMET 3FB9A 3LGFA 5LJ3d 2CZ1B 2GQVA 4J7FA 3CCQT 4CS3A 2Q7HA 3HXYA 2I4OA 2X4YA 1BIBA 1NJ5A 2QHTA 4M78G 1YI2T 1NYRA 3OYCA 5D6XA 1VQNA 4LVMA 4UC4A 4ZGEB 5GAMd 1VQ9T 1BYMA 4WJ4A 3CCJT 2MF2A 4O5VA 1LNXA 3A8HB 4M7DF 1X01A 1HK9A 2IY5A 2P5IA 4JDSA 3RKWA 3CCMT 1BKBA 3NTKA 4HWRA 4QQDA 3M4YA 3R07A 2ODRD 3LW5E 1B70B 2RI5A 1YB3A 3SFMA 4M7AE 3NELA 3V8KA 3FC3A 1I8FA 5LJ3j 4XU2A 4M75F 2K3XA 2JZ2A 4M7DC 3CD6A 2QA4T 3L2UA 1UGQB 4YRPA 4PJOB 3P8TA 2DZ9A 1N9RA 1Y71A 5CKFA 3NETA 2PVOB 4A54A 4YCUA 2RB6A 2RK1A 3V7SA 1P92A 3PNWC 3HP9A 4QVDA 2E10A 3PIPA 1KD1C 2YLCA 1ADJA 5GAOl 2K5FA 4NCXA 5KCHA 1QVGS 3IG2A 4BE1A 3RGLA 3FLGA 2RHIA 4X9DA 3UT1A 2EL9A 1HTTA 4TVAB 3EFSA 3JB9F 2CS7A 2CKKA 3S6WA 2RK2A 3GP8A 3LGLA 1W2BA 4M75B 4P3NA 3HFZA 3VYGA 2ZPEB 4XU3A 3MP8A 2XDDA 3CCLT 3G4ST 1B7YA 2E1HA 2QQRA 5CIUA 4FM4B 3KUFA 3JCMQ 2R57A 1UB4A 4LD9K 4J6YA 3A32A 3ER0A 2EYQA 1VQ7T 4C92A 2ZT5A 2P0QA 4P72A 3HXVA 4TVWA 4YRKA 1R8OB 5A0DA 2PMFA 4HVCA 2Q5HA 3CXCA 2HQXA 2QXFA 1YITT 3UWNA 5CKDA 3OW2A 3HY1A 4YRLA 3MP1A 5GMKj 3G4SA 1B34A 1Q82U 4KBMB 1KQ1A 1YFSA 2WSEE 3HRTA 4A4FA 2K5LA 4H2UA 2ZZFA 4C8QD 4F7UG 3N5BB 1SETA 5CCAA 2EAYA 1M1KC 2JTMA 1UGSB 3G6EA 3PFSA 3A5ZA 2NLUA 3HRUA 3LWHA 4EPCA 4MDWA 3MF2A 3L2RA 1YIJA 2ZNIA 2XDBA 5FU7B 5K1XA 3TU4K 4FT4A 4YROA 1VQPT 1NJ8A 3DLMA 3RL6A 4HWOA 4C92C 4TQFA 4H2TA 4C8QB 5A0LA 2E41A 4L5GA 1M4ZA 3CEYA 2VV5A 3S3NA 4C92D 1JB0E 1WGSA 1I5LA 2EIFA 3O8VA 2DJZA 1M8VA 4WI1A 5C0MA 2EQJA 3LH0A 2BKDN 4ATOA 2E6ZA 1LOJA 5D6YA 1Q7YC 2RHSA 3QO5A 3URGA 3A74A 3E19A 1MGQA 3RKXA 4YRTA 1VIFA 3FJPA 5GAN8 3OA6A 4PLLA 2QQ9A 4LDXA 4PJOD 2ZR3A 2ZT7A 4IUUA 3QO3A 1RL2A 1X54A 3I7FA 1SESA 3M55A 2CIMA 4NL2A 3GLXA 2F5KA 4N4HA 5LJ3e 1H4VB 3E9FA 1G5HA 3TEHB 5J3BA 5CKBA 3JCMc 4ZIBA 1QP3A 4YRMA 4C0GA 2QHSA 4P71A 5A2QE 4MZMA 1RIQA 4M7AA 3HY0A 2P0LA 2VXEA 2OTJA 3KBGA 2E6NA 3PMTA 3SWNA 1D3BB 2EQUA 4LDYA 1N27A 4LVIA 4A4GA 4IKFA 5ELNA 5K1PA 2GCXA 1O75A 1H4TA 3MEWA 4PG3A 1NPPA 2RHSB 3META 1VQ6T 4QQ6A 4E51A 4MMLA 2DKGA 3DB3A 2DD5A 3G71A 1M90C 1VQ5A 4J5YA 3OYIA 4F7UA 2EWNA 3CBMA 3I56A 1NYQA 3QZ5B 3A8GB 2J3MA 2Q7EA 4R56A 4O6JA 5GAMe 2CZ0B 2XKOC 3X24B 4YRIA 2DIGA 5FLXE 2DQ3A 5LJ5e 4YRSA 4RG8A 1X55A 1KQ2A 4YDQA 3KFUA 3PT9A 3ZFJA 4OLFA 3SWNC 5C51B 4E7KA 3BDLA 2C7IA 2DTOA 3HFOA 1UGPB 4L6V5 4MDXA 1JBMA 3LSSA 4P3OA 3JAME 4BDYA 5I21A 3JCMh 5GAN2 2NS6A 2PQWA 2R58A 1FXXA 1VQZA 3CC2T 5GANf 1G3SA 2FVUA 2RI3A 2RH2A 1K8AU 3CMAT 1QW1A 3OYLA 3CCUT 2KMTA 3WVEB 1MHNA 3VUBA 2D6FA 2MI6A 2DD4A 3A8MB 2E70A 3QDRB 3M57A 1O9SA 1VQMA 2A7YA 3QTCA 4M77D 3QNEA 4DOVA 1B8AA 2M1HA 4G84A 4EX5A 1QVFS 2XK0A 3JCMX 1Q81C 4XU1A 5CKHA 2CZ6B 3JCMd 4H2SA 3M53A 5FU6B 5GAN5 3F70A 3MCAB 2M0OA 4BY6C 2XD0A 2XI9A 3A5ZB 4XTYA 3JCMJ 2XTIA 4ZTZB 3VUZA 4P75A 1IZ6A 4P73C 1NJIU 1OYXA 3QIIA 4N0AC 3CPFA 1Q86C 2LNVA 4C8QA 3HL8A 1QVFA 12ASA 3UH0A 2IY5B 1YFTA 3C12A 5CKEA 1YITA 4RKUE 2BUDA 2KSSA 4BE0A 2DDZA 4UP7A 5AYFA 2XU8A 2DU5A 4B9XA 4C5EA 3G1ZA 3OQ5A 4QQGA 5CQYA 4XTZA 5KH6A 3L2QA 5KE2A 4N4GA 3W3SA 1S72T 3CCQA 1X2GA 2LRQA 3QYHB 4M7AG 3A7UA 2A8EA 4E7IA 2F5TX 1ADYA 4XEMA 1AHJB 3CCRT 4LVKA 1PYSB 3CCLA 3VJPA 1WLEA 2LDMA 2Y4YA 4EMKC 1WPYA 2DXBA 3HRKA 1BIAA 4HT9A 4C0DB 4P72C 4PKCC 1BBWA 5J39A 4Q5WA 3LWIA 4JRPA 2OTJT 3UGQA 2LT1A 3ME9A 1BI1A 4R55A 3CCST 1GGMA 3HRIA 3QJ6A 1BI0A 5GAOm 3M54A 2VC8A 4BDZA 2C06A 2XGTA 2JNGA 5DLOA 1U8RA 3J7AF 3QKJA 1L0WA 4Q6GA 5GAMh 3L2ZA 3ASKA 3CCEA 3CCRA 4M75A 3BY7A 3GNGA 4CI0C 2L5QA 1NJ1A 4M7AD 4JRQA 4TVRA 2JUFA 4YCWA 4JS4A 3P8HA 2ARTA 4M7DA 2OTLA 2V8IA 2RHZA 4P5NA 2E5AA 5CR2A 4XQ3A 4RMOA 4LD6A 2QDYB 1YIJT 2FL7A 1VQKT 5IAYA 4E7JA 3CC4A 3OYFA 2CZ7B 2CJ9A 4ZTFA 3HSBA 4LVLA 3M4PA 4F7UE 2R5MA 5GAN3 3LYIA 3X28B 1E1TA 2DO3A 3OW2S 3JCMP 4IUTA 1TH7A 3M4GA 3REUA 2ZXFA 5D6WA 2QI2A 1KHCA 3OB9A 2ZTGA 2P0PA 2XICA 3CC4T 4BWAA 1FWZA 4OVAA 4KT0E 4HT8A 3VBBA 1HC7A 4B9WA 4MZTA 1K73C 3GNFB 4M7AB 5GANg 2MWPA 4YRFA 4ZTJA 4IUVA 2VXFA 3QJYA 1LJOA 1YJNA 5L8RE 5I2SA 2RD1A 4M77G 2XIDA 3EAEA 4DA4A 2HNIA 2QEXT 2PU9B 4PLIA 4XAXB 1U1SA 1WJSA 1YGBA 4M7DG 3M9QA 3V7RA 2GF7A 3OYDA 4IUQA 4NOYA 1EVKA 3GIBA 2O4XB 2YRVA 1WJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0L A;  2VXE A;  2QHV A;  2AMC B;  3VQV A;  3ERR A;  5GMK i;  3AHU A;  3P8V A;  3TUP A;  2ARS A;  3HXW A;  4XTW A;  2ZT8 A;  2J3L A;  2I4N A;  2QHU A;  2CJB A;  3SWN A;  1D3B B;  1USY C;  4CH3 A;  1NJ6 A;  5GAN d;  3HXU A;  1ASY A;  5C53 B;  4PJO E;  4XU0 A;  5GAO q;  4M77 B;  4X9C A;  2ZZE A;  5ELN A;  5K1P A;  3EFR A;  2ZIO A;  1H4T A;  4RQE A;  1YFR A;  1I4K 1;  4PG3 A;  1E22 A;  2DVE A;  1JJC A;  3TEH A;  1NNH A;  2RHS B;  4YYE A;  2JN0 A;  3HXZ A;  3MEY A;  2RHQ B;  4E51 A;  4XTV A;  4EMK A;  4TVY A;  4MML A;  3JB9 G;  2DKG A;  3RES A;  4BW9 A;  2I4M A;  2E64 A;  2EJF A;  4M75 E;  1HXD A;  5GAN 7;  4EMH A;  1USY A;  4RMF A;  1QE0 A;  5LJ5 d;  4YPF A;  1N9S A;  4J5Y A;  3JCM g;  3M4Q A;  4PNO A;  4F7U A;  4Q15 A;  4YCV A;  2EWN A;  3V8L A;  3JCM f;  4PJO A;  4CS2 A;  4HWS A;  4M78 B;  1G51 A;  5GAN h;  3IAL A;  3ICA A;  5GAO p;  1SER A;  1NYQ A;  4M78 E;  4M7D B;  2J3M A;  2Q7E A;  5LJ5 h;  4ZTU B;  5GAM e;  2FB7 A;  4C8Q F;  1D3B A;  4UPA A;  3BW1 A;  4YRI A;  1I81 A;  5LJ5 j;  2DQ3 A;  4AH6 A;  5LJ5 e;  4YRS A;  4M7A F;  1X55 A;  4TVA A;  2AMC A;  1KQ2 A;  3QUI A;  4M77 F;  4YDQ A;  3KFU A;  1C0A A;  3VQY A;  4OLF A;  3SWN C;  3A5Y A;  4CH4 A;  3JCM b;  5C51 B;  3VQX A;  2ALY A;  3OD1 A;  1WQW A;  1KMM A;  4RCC A;  2C7I A;  2E3C A;  2DTO A;  3JCM V;  3HFO A;  3RF1 A;  4EO4 A;  2G4C A;  5C52 B;  1JBM A;  3LSS A;  5LJ3 f;  2C8M A;  5GMK h;  3HFZ B;  4P3O A;  4H2W A;  3FB9 A;  5LJ3 d;  1H64 1;  4M75 G;  5ELO A;  5I21 A;  4YP0 A;  3CMQ A;  4M75 C;  3JCM h;  5GAN 2;  1NJ2 A;  4M77 E;  5GAN j;  2EJ9 A;  5E3I A;  1VQZ A;  4EMK B;  5GAN f;  4V2S A;  4J6W A;  3QO7 A;  4CS3 A;  2PME A;  2Q7H A;  3HXY A;  2I4O A;  1BIB A;  1NJ5 A;  2QHT A;  4M78 G;  5GAN 6;  1WNL A;  1NYR A;  3A31 A;  2YHT A;  1G5I A;  2DXU A;  3QTC A;  4M77 D;  3QNE A;  1B8A A;  2ZIN A;  2ZZG A;  4G84 A;  4EX5 A;  4KR3 A;  1B34 B;  4YRR A;  1ASZ A;  4N0A A;  2ZIM A;  2RM4 A;  3JCM X;  5GAM d;  4J15 A;  3WQZ A;  3JCM W;  5DY9 A;  4LNS A;  4XU1 A;  3UFG A;  4WJ4 A;  1SRY A;  3JCM d;  3JB9 I;  1Y96 B;  4H2S A;  4HWT A;  3RAC A;  2ZCE A;  5GAN 4;  5GAN 5;  5GAM g;  1LNX A;  4M7D F;  1X01 A;  2ZGW A;  1HK9 A;  3L1A A;  4K88 A;  2P5I A;  3HFN A;  1H4Q A;  2IY5 A;  3RKW A;  1EQR A;  4HWR A;  2Q5I A;  4XTY A;  3R07 A;  2ODR D;  3PCO B;  3JB9 J;  1B70 B;  3JCM J;  4PJO C;  3A7R A;  4XTU A;  1YB3 A;  4K86 A;  2XTI A;  4K87 A;  4ZTZ B;  3RIR A;  4M7A E;  3BJU A;  3NEL A;  3V8K A;  4P75 A;  1I8F A;  5LJ3 j;  4XU2 A;  4P73 C;  4M75 F;  3FIF A;  5GMK e;  4N0A C;  5GMK l;  2Q7G A;  4M7D C;  1U1T A;  1QF6 A;  1JJC B;  1PYS A;  4C8Q A;  4YRP A;  2K57 A;  4PJO B;  4M78 C;  12AS A;  3P8T A;  3UH0 A;  2DZ9 A;  1IL2 A;  1N9R A;  2IY5 B;  3NET A;  2DTH A;  1LYL A;  4A54 A;  1YFT A;  4YCU A;  2RB6 A;  3MF1 A;  4L87 A;  4HA8 A;  3V7S A;  4F7U F;  2ZNJ A;  1EFW A;  3RER A;  4P75 C;  4C92 E;  4M75 D;  2DDZ A;  1J5W A;  4UP7 A;  1FYF A;  4QVD A;  2DU5 A;  2E10 A;  3INZ A;  1E1O A;  2YLB A;  3G1Z A;  2YLC A;  1ADJ A;  5GAO l;  4TQD A;  3PCO A;  1EVL A;  5GAO r;  1X56 A;  3HXX A;  4XTZ A;  4NCX A;  2I4L A;  3IG2 A;  3RGL A;  3W3S A;  2DXT A;  1X2G A;  4M7D D;  4M7A G;  4X9D A;  4DPG A;  2EL9 A;  3PGG A;  3A7U A;  3REX A;  5GMK m;  3BDU A;  1HTT A;  3IKL A;  4TVA B;  3EFS A;  2CJA A;  3JB9 F;  1ADY A;  4XEM A;  1PYS B;  3JB9 H;  3V8J A;  4QVC A;  2RA2 A;  2ZR2 A;  4P73 A;  1WLE A;  4EMK C;  1WPY A;  2DQ0 A;  3HRK A;  4H2X B;  1BIA A;  1B70 A;  4HT9 A;  4P72 C;  4P3P A;  4PJO F;  4M75 B;  4P3N A;  1BBW A;  4P74 A;  4MMK A;  4EMG A;  3HFZ A;  4XU3 A;  3P8Y A;  4KR2 A;  1B7Y A;  3UGQ A;  2DTI A;  4UP9 A;  3NEN A;  4M77 A;  2E1H A;  2AKW A;  4CS4 A;  1GGM A;  3JCM Q;  3L4G A;  3HRI A;  2FYK A;  4JLI A;  3SWN B;  3E9H A;  4NL3 A;  4UP8 A;  1KMN A;  5GAO m;  2E65 A;  2VC8 A;  4J6Y A;  4X5O A;  3A32 A;  2DEQ A;  1WU7 A;  2XGT A;  1JRI A;  4C92 F;  5LJ5 f;  4C92 A;  3IKM B;  2ZT5 A;  4P72 A;  1L0W A;  3BFM A;  4J6X A;  3HXV A;  4TVW A;  4Q6G A;  5GAM h;  4YRK A;  5GAO n;  3L2Z A;  4F7U B;  1ATI A;  4CH5 A;  4M75 A;  3BY7 A;  1B7Y B;  3UGT A;  2PMF A;  4HVC A;  5CAI A;  3NEM A;  2Q5H A;  4Y91 A;  4M7A C;  4YRN A;  3HY1 A;  4YRL A;  4RDX A;  3V7C A;  2DZC A;  4WF2 A;  1NJ1 A;  3HFV A;  5GMK j;  5KNN A;  4M7A D;  2RHQ A;  4H2X A;  1B34 A;  4O2D A;  1EIY A;  1KQ1 A;  1RIQ A;  2ZT6 A;  1YFS A;  4YCW A;  4H2U A;  2ZZF A;  4C8Q D;  2ART A;  4M7D A;  4F7U G;  3SB2 A;  1SET A;  2AKW B;  2EAY A;  2E5A A;  4XQ3 A;  3E9I A;  11AS A;  3A5Z A;  4M78 A;  4XEO A;  2QTX A;  1WYD A;  4M77 C;  3MF2 A;  2CJ9 A;  4YRE A;  1Z7N A;  2ZNI A;  3HSB A;  5GAM j;  1KOG A;  3M4P A;  5K1X A;  4F7U E;  1X2H A;  5GAM f;  1BBU A;  5LJ3 h;  4P74 C;  3QO8 A;  5GAN 3;  4YRO A;  1NJ8 A;  4G85 A;  4RQF A;  3RL6 A;  1E1T A;  2EJG A;  3JCM P;  4HWO A;  4TWA A;  4C92 C;  3VU3 C;  4XTX A;  1TH7 A;  3M4G A;  3REU A;  4TQF A;  4H2T A;  2ZXF A;  4C8Q B;  4JRI A;  2E41 A;  2ALY B;  3LSQ A;  2ZTG A;  4TTV A;  4A53 A;  4BWA A;  5LJ3 g;  1M5Q 1;  4HT8 A;  3VBB A;  4H2Y A;  4C92 D;  4C8Q E;  3TEG A;  3A7A A;  1I5L A;  1EIY B;  1HC7 A;  1N9W A;  1WQ7 A;  2DJZ A;  2CGH A;  3RKY A;  4YRC A;  1M8V A;  5GAN e;  4WI1 A;  3LC0 A;  3QSU A;  4M7A B;  5GAN g;  3RUX A;  2ARU A;  4JUV A;  4YRF A;  2Y90 A;  2VXF A;  1LJO A;  1LOJ A;  1B76 A;  4CH6 A;  2RHS A;  3QO5 A;  4M7D E;  3A74 A;  1MGQ A;  3RKX A;  4YRT A;  3FJP A;  5GAN 8;  4KQE A;  2RD1 A;  2I2L A;  4M78 F;  5F5W A;  4PJO D;  2ZR3 A;  4M77 G;  2ZT7 A;  3QO3 A;  2ODR C;  4WJ3 M;  1X54 A;  4DQ2 A;  3I7F A;  1SES A;  2HNI A;  2CIM A;  4NL2 A;  4OP0 A;  4HWP A;  3PZC A;  1U1S A;  1YGB A;  5LJ3 e;  1H4V B;  5HGQ A;  4YRQ A;  3QHS A;  3JB9 D;  4M7D G;  1G5H A;  4M78 D;  4H02 A;  1W66 A;  3VQW A;  3TEH B;  3V7R A;  3JCM c;  4C92 G;  4YRJ A;  5LJ5 g;  1E24 A;  1EOV A;  3L4G B;  1YCY A;  4ZIB A;  2DU7 A;  4H2V A;  3DSQ A;  4YRM A;  4YRG A;  1H4S A;  4PHC A;  4NOY A;  4C8Q G;  2QHS A;  4PJO G;  4C8Q C;  1Z7M A;  1EVK A;  3HTZ A;  3GIB A;  4P71 A;  4C92 B;  4RCB A;  4JRK A;  4P71 C;  1Y96 A;  4M7A A;  3JCM e;  3HY0 A; 
#chains in the Genus database with same CATH topology
 1YWP A;  3VQV A;  4LE9 A;  4EDU A;  2QHV A;  1C0M A;  3ERR A;  2CDT A;  2ZT8 A;  3UPU A;  4HT4 A;  1LVK A;  1WHG A;  2L3P A;  3M5A A;  1U5S A;  3HXU A;  1Y0M A;  4HCK A;  5C53 B;  1UUE A;  2VUB A;  1AVZ C;  5GAO q;  3CC4 Q;  4X9C A;  1OQK A;  2G6F X;  1YFR A;  3OMC A;  3ZL7 C;  1I4K 1;  4VUB A;  1N8R U;  4Y28 E;  3TEH A;  3L2V A;  2CH4 A;  2JN0 A;  4FU6 A;  1WXB A;  2MIO A;  4FYX B;  1VUB A;  3TSZ A;  4XTV A;  1OV3 A;  2X4J A;  2DBM A;  1Q7Y U;  1M9S A;  2O9S A;  2OTL T;  4M75 E;  1HXD A;  2QA4 A;  1I07 A;  1TTH B;  2ZZD A;  4EMH A;  1USY A;  4YPF A;  1QE0 A;  3NHN A;  2VGM A;  3JCM g;  2A08 A;  4PNO A;  1X6G A;  4YCV A;  1VYV A;  2YRC A;  5CK9 A;  1Y07 A;  1TXQ A;  3A1P A;  1RAE B;  2LZ6 B;  3IAL A;  5HKC A;  3ICA A;  2HBW A;  3CCV A;  2DF6 A;  2FB7 A;  3X25 B;  4C8Q F;  5I2M A;  5DLQ E;  1UG1 A;  5LJ5 j;  1WHK A;  4AH6 A;  4CC4 B;  4BI8 B;  2OAU A;  4TVA A;  4J9G A;  2CP3 A;  4HCC A;  2NYS A;  1RAD B;  4M77 F;  1A0N B;  2DL4 A;  1C0A A;  9ATC B;  2O2O A;  1BCM A;  4RTV A;  3OS0 A;  1YJW T;  3OD1 A;  2GFA A;  5M9O A;  2W10 A;  4EO4 A;  2G4C A;  2DRK A;  4FW1 A;  2MOX A;  5GMK h;  3CCS A;  5IXF A;  1YJ9 A;  4KGX B;  4A4E A;  1H64 1;  1W6X A;  2PVD B;  2X3W D;  4C0D C;  5GAN j;  2JMC A;  3H0H A;  2EQM A;  1V76 A;  5FWB A;  3CME Q;  2AHJ B;  3M0U A;  1K9M U;  2DL5 A;  3PIO A;  4ELY C;  2DX1 A;  1G83 A;  2COY A;  2JVV A;  2DK3 A;  2MCN A;  3L42 A;  4JLG A;  4GLK A;  3MJX A;  3HKS A;  5C6S A;  2E12 A;  3CME A;  1KD1 U;  2L3R A;  2JW4 A;  1KG1 A;  4Y92 A;  2ZZG A;  2EFI A;  2QTV A;  4QT7 A;  3SDZ A;  3PMI A;  1ASZ A;  4N0A A;  3WQZ A;  4J15 A;  3VV0 A;  2B86 A;  1QVG A;  3JCM W;  3CC7 Q;  1EIF A;  4A4K A;  1SRY A;  3JB9 I;  1LPL A;  3CCU A;  3RAC A;  2M16 A;  2FPE A;  5GAN 4;  1AEY A;  2E5K A;  4ZN1 A;  2YUO A;  5GAM g;  2LX9 A;  3L1A A;  3CPW A;  1K73 R;  3HFN A;  1F1B B;  1EQR A;  2DPP B;  4KGZ B;  2Q5I A;  2J06 A;  3JB9 J;  5CVI A;  3A7R A;  3JV3 A;  1RAG B;  4N4I A;  4FCY A;  4K87 A;  2CYZ B;  3EG0 A;  3BJU A;  3NTI A;  3CCE T;  3EFO A;  1KC8 C;  1G3T A;  2E5Q A;  1AWJ A;  2LCS A;  3FIF A;  5HY6 A;  1UTI A;  2XG8 D;  3NGP A;  1U1T A;  1QF6 A;  1JJC B;  2FZG B;  2QQS A;  1ZSZ A;  3VS5 A;  1VQ4 A;  2K57 A;  4M78 C;  4E7H A;  3H9N A;  1WXT A;  1IL2 A;  1YFN A;  2DVJ A;  1M1K R;  3Q1J A;  1LYL A;  3EG9 A;  1K8A C;  3MF1 A;  4L87 A;  3FRN A;  4HA8 A;  4OF1 A;  3EGD B;  2H8H A;  4F7U F;  4JJC A;  4C92 E;  3MO8 A;  4M75 D;  1X6O A;  3X20 B;  3LLR A;  1FYF A;  2K4Y A;  3NFC A;  1YHQ A;  3OS1 A;  4OB1 B;  3OSV A;  2D0Q B;  2IG0 A;  1PRM C;  2K3Y A;  4LUE A;  4TQD A;  3PCO A;  1EVL A;  3PTA A;  4JJD A;  1U06 A;  3OS5 A;  5GAO r;  3HXX A;  1MUZ A;  4X34 A;  5IN1 A;  1KQS S;  2FHD A;  4FSX A;  4M7D D;  1VQM T;  2KNB B;  3REX A;  5GMK m;  3BDU A;  2YSQ A;  3FDR A;  1VQ6 A;  2CJA A;  4AFU C;  4LDU A;  2DXC A;  4RTZ A;  2CP0 A;  2VVK A;  2ZR2 A;  3RMS A;  4P73 A;  2B8A A;  1K9M R;  1GFC A;  3MKD A;  1VQ9 Q;  2DQ0 A;  2QAS A;  2OX7 A;  2ZPH B;  4PJO F;  4OMQ A;  2C0T A;  1QP2 A;  4EMG A;  4J9E A;  3P8Y A;  4LVJ A;  1X2K A;  2LT4 A;  3RNJ A;  3CBO A;  5KYW A;  2QGF B;  4C5I A;  1Q86 U;  2AKW A;  1PG5 B;  3L4G A;  3OS2 A;  1K0S A;  3SWN B;  3E9H A;  1AT1 B;  4NL3 A;  3MHX A;  2E65 A;  2GNC A;  1JJ2 S;  3HHT B;  4LXC A;  1I5O B;  2DEQ A;  1PSE A;  4KUL A;  1AOJ A;  1XOV A;  1JRI A;  4C92 F;  5LJ5 f;  3OSS C;  2LQK A;  1XNI A;  2O9V A;  1W2B P;  1VQP A;  3BFM A;  4J6X A;  3EGX A;  5GAO n;  1BB9 A;  4F7U B;  1ATI A;  1YP5 A;  4CH5 A;  2KY9 A;  4HVW A;  3NEM A;  1WYX A;  1RAF B;  4YRN A;  2CSI A;  2P0K A;  4GY5 A;  1M3A A;  5HK0 A;  3G7Z A;  2QYZ A;  2MMP A;  2HQH A;  3V7C A;  1FYN A;  2DZC A;  3HFV A;  4AFZ C;  4BI3 A;  3PE0 A;  1VQO T;  5KNN A;  2RHQ A;  2CP6 A;  3EHR A;  3PVL A;  4O2D A;  2ZT6 A;  3R6O A;  1GXI E;  5KCO A;  2E4H A;  2VAS A;  1OU9 A;  1YJW A;  1TUG B;  2PZ1 A;  2V8K A;  4BI4 A;  5KYW B;  3E9I A;  11AS A;  3J80 E;  2EYX A;  5CO7 A;  2KRN A;  3RMQ A;  1VOM A;  1YJN Q;  2H3J A;  2X51 A;  2D9T A;  2LVM A;  1GCQ A;  4YRE A;  2WSF E;  4IIO A;  1VQO Q;  1KOG A;  4AT1 B;  2J6O A;  2K7A A;  5GAM f;  5HCK A;  2AT1 B;  2X35 A;  4P74 C;  3QO8 A;  1KQS P;  3S3M A;  2LQN A;  3VS1 A;  4G85 A;  2HBP A;  3G4S Q;  3VRZ A;  2EJG A;  4TWA A;  1SKU B;  1NPR A;  3QDF A;  3DB4 A;  1M90 R;  3VU3 C;  2KDS A;  5GJW B;  2RHY A;  1X43 A;  1SRM A;  4JRI A;  2ALY B;  5IHK A;  2KRO A;  3LSQ A;  2AK5 A;  4TTV A;  2JT4 A;  4A53 A;  1MV3 A;  4RTY A;  3QPH A;  2ZPF B;  4RTX A;  2JJ9 A;  5LJ3 g;  1M5Q 1;  1YJ9 T;  3C94 A;  1FX7 A;  4H2Y A;  3TEG A;  3G6E T;  1N9W A;  1YI2 A;  2CGH A;  4YRC A;  4C5H A;  2KRM A;  5GAN e;  3RDV A;  4CC7 A;  1YWO A;  3LC0 A;  2DIQ A;  3UA6 A;  2XHC A;  4AFS C;  2LC4 A;  3WXM B;  2EYW A;  4PJM A;  2NUP B;  2V1R A;  3UDC A;  3CPW P;  2ARU A;  1WXU A;  2Y90 A;  2M51 A;  1B76 A;  2QEX A;  1D1C A;  4A4H A;  2ROL A;  4M7D E;  1UE9 A;  2CP7 A;  1Q82 C;  2RI2 A;  2JTF A;  2LJ0 A;  5A0G A;  1VQL Q;  4KQE A;  1VQK Q;  2QQA A;  2EPD A;  1ZBX A;  2I2L A;  2A3L A;  4M78 F;  5F5W A;  2EVR A;  4DQ2 A;  2KYB A;  3I5S A;  2K6D A;  1YJN T;  3BE3 A;  4J83 A;  4OP0 A;  3OBW A;  4OMF B;  2ATC B;  2RO0 A;  4YRQ A;  3QHS A;  3JB9 D;  1SSF A;  4M78 D;  1W66 A;  1G3Y A;  2RPN A;  4C92 G;  4YRJ A;  1E24 A;  2FRW A;  3L4G B;  1YCY A;  4H2V A;  2DJQ A;  3DSQ A;  4YRG A;  1AWO A;  3NTH A;  3G71 T;  4PHC A;  3SHW A;  4C8Q G;  4C8Q C;  1Z7M A;  4PFP A;  1YN8 A;  2HQE A;  1SHF A;  2YDL A;  4C92 B;  2VGN A;  4RCB A;  1Y96 A;  3I55 Q;  1KC8 R;  1ZQ1 A;  5GMK i;  1M1F A;  2HCK A;  3TUP A;  1ZHI A;  2ARS A;  1KHI A;  3HXW A;  5GJV B;  4XTW A;  2DER A;  4CRI A;  1VQ7 Q;  3OYE A;  2QHU A;  2CJB A;  2KE9 A;  4ZGD B;  3WVD B;  4PJO E;  3A8O B;  2ZZE A;  3I55 A;  2VYT A;  4D6W A;  2HD0 A;  2CSQ A;  2RHU A;  2A37 A;  4ELZ C;  1PHT A;  1E22 A;  1UJY A;  2DVE A;  4ZNX A;  2FPF A;  4FYV B;  1N8R R;  3HXZ A;  3MEY A;  1AWX A;  4EMK A;  2EQI A;  3CCS Q;  3RES A;  4BW9 A;  2I4M A;  1VQ4 T;  2E64 A;  4OGC A;  2EJF A;  1KSW A;  2OTJ Q;  3GOX A;  4BB7 A;  4RMF A;  2PUO B;  5LJ5 d;  3M4Q A;  2L89 A;  3V8L A;  2KQW A;  4ESR A;  2F69 A;  4M78 B;  1OPL A;  4D8D A;  1WJQ A;  2J05 A;  4DOW A;  1W2B S;  1K0X A;  2LJ3 A;  5D7U A;  2SEM A;  2P4T A;  2QG9 B;  4RG2 A;  5GAO p;  1QMC A;  1GCQ C;  4M78 E;  2KK4 A;  5LJ5 h;  4ZTU B;  4BD3 A;  2KGT A;  3R6N A;  4IUR A;  1D3B A;  3BW1 A;  1JJ2 P;  1I81 A;  3QZ9 B;  1ABQ A;  2X4X A;  1GBR A;  1PSF A;  5FRO A;  2A0F B;  1AD5 A;  5KYU B;  1BK2 A;  3QUI A;  4J9F A;  1NBE B;  2XMF A;  2O4X A;  1B7T A;  4OB3 B;  1XQH A;  3NPF A;  4CH4 A;  3KFV A;  1NJI R;  3SD4 A;  4RCC A;  1MND A;  2E3C A;  3VYH B;  1NJI C;  2RJD A;  3JCM V;  3RF1 A;  2GFU A;  5C52 B;  2C8M A;  1UEB A;  5AT1 B;  4H2W A;  2CUD A;  2X4W A;  2LTO A;  4M75 G;  5ELO A;  4YP0 A;  3CMQ A;  2NUP A;  4M75 C;  1NJ2 A;  4M77 E;  1RAB B;  2EJ9 A;  5E3I A;  3CC7 T;  4EMK B;  4C0F A;  3CXC S;  4V2S A;  4HXJ A;  1D0Y A;  4J6W A;  5IXB A;  1N8R C;  3QO7 A;  2PME A;  1VYU A;  4KH0 B;  2PUK B;  3OMG A;  2DEU A;  3MQZ A;  3THK A;  2HSE B;  3OYH A;  3CC7 A;  5GAN 6;  4OML A;  1WNL A;  1VQ7 A;  3A31 A;  5FRM A;  2EKO A;  4Z88 A;  3EGX B;  1QWF A;  4HVU A;  1C6V X;  2LQW A;  2YHT A;  1G5I A;  3JSC A;  2DXU A;  1OZ3 A;  3MP6 A;  2KAF A;  5LL6 S;  2ZIN A;  2PVG B;  4HCB A;  1VQN T;  4KR3 A;  1B34 B;  1EZZ B;  1WA7 A;  1UHC A;  2FZK B;  4YRR A;  2ZIM A;  2RM4 A;  3M56 A;  2KEA A;  5DY9 A;  4CC2 A;  2RF0 A;  1KQS A;  4LNS A;  3UFG A;  4HWT A;  2L8D A;  1Y96 B;  3EGD A;  1HSQ A;  2ZCE A;  1NYG A;  4LDW A;  2ZGW A;  1OX9 A;  4KUI A;  4K88 A;  1H4Q A;  2KXD A;  2RJC A;  2AZV A;  1V29 B;  1G5V A;  3G1J A;  3PCO B;  2BZX A;  2X3X D;  4PJO C;  4XTU A;  1YJW Q;  4OGE A;  3VS7 A;  4K86 A;  4J9I A;  2AZS A;  1Q7Y R;  2IVW A;  1RAA B;  4J9H A;  2BIV A;  3RIR A;  4BUG A;  1RAI B;  5FRN A;  4QW2 A;  3KXT A;  2BE9 B;  2YUN A;  3QXE B;  5GMK e;  5GMK l;  2Q7G A;  3TVT A;  1T3L A;  1Q95 G;  1WI7 A;  1PYS A;  3OYM A;  4ZN3 A;  1VQ5 T;  3QG1 A;  1VQO A;  3VKI A;  5FWC A;  5IHI A;  1M30 A;  1W4S A;  2DTH A;  4ME7 A;  3S3O A;  2K5I A;  3QBY A;  1LCK A;  1K9M C;  2XDP A;  4PJJ A;  4II1 A;  4PK4 A;  4DBF A;  1W70 A;  2ZNJ A;  2RJE A;  1EFW A;  3RER A;  2DAQ A;  4P75 C;  3FJ5 A;  2RNA A;  3TCJ A;  3I55 T;  1J5W A;  2MWO A;  5IT9 E;  3D7S B;  1G3W A;  2WSC E;  3INZ A;  4LNP A;  5KE3 A;  4J8O A;  1E1O A;  2YLB A;  2BZY A;  4MZP A;  3ULR B;  1TWB A;  1VQ9 A;  1X56 A;  4PL6 A;  2HAX A;  2DYI A;  1JXO A;  4LDV A;  2I4L A;  1Q81 U;  2K2V A;  3CCM Q;  1WHJ A;  2DXT A;  5DM7 R;  4DPG A;  3PGG A;  1CSK A;  3IKL A;  5J26 A;  1PC0 A;  1VQK A;  2ESW A;  3JB9 H;  3V8J A;  4QVC A;  4Z89 A;  1M1K U;  2RA2 A;  1UDL A;  1K8A R;  3I35 A;  3M58 A;  3OYK A;  1VIE A;  4BE2 A;  5ECA A;  2DL3 A;  4H2X B;  1B70 A;  3OYJ A;  2EGC A;  4P3P A;  5CQX A;  4HCZ A;  1ZSZ C;  4P74 A;  4MMK A;  3IQL A;  4QVZ A;  1PD1 A;  3TRE A;  2E3H A;  2RJF A;  4BAC A;  4KR2 A;  2KRS A;  1M2O A;  2DTI A;  4Z02 A;  4UP9 A;  2ZCF B;  1KK7 A;  1BI2 A;  4HKE A;  4M77 A;  3NEN A;  1WZO A;  2EQK A;  2O31 A;  4CS4 A;  2NWM A;  2FYK A;  2D8H A;  4JLI A;  4UP8 A;  1KMN A;  1OPK A;  4DEX A;  5IHN A;  4X5O A;  3C95 A;  1WU7 A;  4OMP A;  1S72 A;  2H3E B;  4XK8 E;  1XTD A;  2V8J A;  3CD6 T;  3IKM B;  1M1G A;  3MEA A;  2QQB A;  3OYA A;  1UGR B;  1Y7X A;  1YHQ Q;  1WHL A;  3UGT A;  1B7Y B;  2DLP A;  4J7I A;  3VS2 A;  5CAI A;  3TEE A;  1OX8 A;  4Y91 A;  4M7A C;  1OI1 A;  1KIK A;  4J9D A;  4RDX A;  2AKL A;  4WF2 A;  2DE0 X;  1M3B A;  4DBH A;  3I56 T;  4H2X A;  1SSH A;  1EIY A;  1NYF A;  3REB B;  5KYN A;  4R0K A;  4OB0 B;  3I9Q A;  2O01 E;  2BZ8 A;  1NZ9 A;  1ZA2 B;  4YTL A;  3SB2 A;  1UHF A;  2AKW B;  2ZPG B;  2MAM A;  4OB2 B;  2A28 A;  1H3H A;  1JXM A;  4M78 A;  4XEO A;  2QTX A;  2QEX Q;  3DLL A;  1WYD A;  4M77 C;  2LQ8 A;  1YNZ A;  4ZGJ B;  2KVQ G;  4J9C A;  1IO6 A;  1J3T A;  1Z7N A;  1EFN A;  1K76 A;  1NE8 A;  3H6Z A;  4NS5 A;  5GAM j;  2DNU A;  3OW2 P;  3L2W A;  1CKA A;  1X2H A;  1K1Z A;  3C4S A;  1BBU A;  5LJ3 h;  4E7L A;  2OAW A;  4RQF A;  2JMA A;  3CMA A;  4XTX A;  3ZBD A;  3CC2 A;  1OUL A;  4C0Z A;  1VQ8 T;  3QYG B;  2VB6 A;  2RQW A;  4E47 A;  3A8L B;  3HPW A;  2YT6 A;  1QVP A;  2D1X A;  1C1A A;  5I11 A;  1NM7 A;  4FIB A;  4C8Q E;  3A7A A;  1EIY B;  1WQ7 A;  3RKY A;  2RHX A;  3E9G A;  2M9U A;  3QSU A;  3RUX A;  2FPD A;  4JUV A;  4HVV A;  1IXD A;  4CH6 A;  1VQP Q;  4JS5 A;  1M90 U;  2ZPB B;  2CP2 A;  3DKM A;  2ODR C;  4WJ3 M;  2JS2 A;  4C5G A;  3GPL A;  2P4R A;  5HK3 A;  4HWP A;  1KFZ A;  4EIK A;  4KUD K;  4FL6 A;  1HJD A;  3PZC A;  4LUD A;  1UEC A;  5HGQ A;  2KYM A;  3OYB A;  4PJL A;  4H02 A;  3HRS A;  3VQW A;  3I5R A;  5LJ5 g;  1EOV A;  2DU7 A;  1ZBJ A;  1H4S A;  4FT2 A;  4L59 A;  1RAC B;  4PJO G;  2WAC A;  2F2V A;  3HTZ A;  3J81 E;  5FW9 A;  2CP5 A;  2CH4 W;  4JRK A;  1H3Z A;  4P71 C;  3LX7 A;  4M4Z A;  4ORZ A;  3JCM e;  4RQE A;  2LCL A;  3CCV T;  2LMJ A;  2AMC B;  4ANJ A;  3AHU A;  3P8V A;  1TSF A;  4PJN A;  3H8Z A;  2J3L A;  3MEV A;  3OYG A;  2I4N A;  5FU7 C;  3X26 B;  3HTR A;  1USY C;  1G8X A;  3OYN A;  3MEU A;  1NJ6 A;  1R0C B;  5GAN d;  4CH3 A;  1ASY A;  2ECZ A;  4XU0 A;  4M77 B;  1QVG P;  3EFR A;  2ZIO A;  4CC3 A;  3JRZ A;  1JJ2 A;  1JJC A;  1BI3 A;  1K73 U;  1VQL T;  1NNH A;  4YYE A;  2ZPI B;  1X75 C;  4KH1 B;  4IUP A;  4J9B A;  3OBY A;  2RHQ B;  4TVY A;  4LN2 A;  3JB9 G;  1YBY A;  3CCM A;  1VQ8 A;  4WTO B;  5GAN 7;  4RTT A;  2NUZ A;  2L3S A;  1N9S A;  2IIM A;  4Q15 A;  1IRX A;  3G6E Q;  1YHQ T;  3JCM f;  4PJO A;  4CS2 A;  2YXY A;  3CBP A;  4HWS A;  2JOY A;  2FEI A;  1G51 A;  1YJ9 Q;  4AG1 C;  5GAN h;  1SER A;  3CD6 Q;  2ENM A;  4M7D B;  3M59 A;  1VQL A;  3M0Q A;  3P8D A;  2G3R A;  4IIM A;  4UPA A;  1ZUY A;  1PWT A;  3OY9 A;  1MMN A;  3CPW S;  3E1S A;  3ZEH A;  4M7A F;  3FEO A;  1D1A A;  2AMC A;  1NLP C;  2AKK A;  2HEQ A;  3VQY A;  5EG2 A;  3T9N A;  1OZ2 A;  2HDA A;  3A5Y A;  1DJ7 B;  2R5A A;  4BY6 B;  2JXB A;  3JCM b;  3VQX A;  1N6A A;  3CCJ A;  2ALY A;  1WQW A;  2D0N A;  3OYY A;  1IRE B;  1KMM A;  1KC8 U;  2LCC A;  4JJN K;  3GF5 A;  4RTW A;  1RI0 A;  1IGU A;  5FU6 C;  5LJ3 f;  2Y4X A;  3P8B B;  3HFZ B;  2HZY A;  3CME T;  1M3C A;  3FB9 A;  3LGF A;  5LJ3 d;  4Z8A A;  2CZ1 B;  2L3Q A;  2GQV A;  4J7F A;  2BE7 D;  1VQ5 Q;  3CCQ T;  2QA4 Q;  3GBQ A;  4CS3 A;  2GQI A;  1NG2 A;  2Q7H A;  3HXY A;  2I4O A;  2X4Y A;  1BIB A;  1NJ5 A;  1Y57 A;  2DA9 A;  1GFD A;  1K4U S;  2QHT A;  4M78 G;  1QKW A;  1YI2 T;  1ZUU A;  1NYR A;  2JS0 A;  2NUT B;  3OYC A;  5D6X A;  1VQN A;  2O88 A;  4LVM A;  1T3S A;  4UC4 A;  2KR3 A;  4ZGE B;  5GAM d;  3AT1 B;  1VQ9 T;  1S1N A;  1BYM A;  1AWW A;  2RQU A;  2EGA A;  2W0Z A;  4WJ4 A;  3CCQ Q;  3CCJ T;  2MF2 A;  2CUB A;  4O5V A;  1G2B A;  1E6G A;  1LNX A;  3A8H B;  4M7D F;  1X01 A;  1VQM Q;  1HK9 A;  2IY5 A;  2P5I A;  4JDS A;  3RKW A;  3CCM T;  1BKB A;  3NTK A;  4HWR A;  4QQD A;  3M4Y A;  3LH5 A;  3R07 A;  6AT1 B;  2ODR D;  3LW5 E;  1B70 B;  2EGE A;  2RI5 A;  1YB3 A;  3SFM A;  1GCP A;  4M7A E;  1YI2 Q;  3NEL A;  3V8K A;  3FC3 A;  1I8F A;  5LJ3 j;  4XU2 A;  4JPB W;  4M75 F;  2K3X A;  3E2U A;  2JZ2 A;  1QLY A;  4M7D C;  1WLP B;  3CD6 A;  2QA4 T;  4F16 A;  3L2U A;  2C0I A;  1UGQ B;  3CCU Q;  4YRP A;  2LJ1 A;  4PJO B;  1MMG A;  3P8T A;  2DZ9 A;  3CCR Q;  1PNJ A;  1N9R A;  1SF9 A;  1Y71 A;  1R0B G;  5CKF A;  3CC2 Q;  3NET A;  2PVO B;  4A54 A;  4YCU A;  2RB6 A;  2RK1 A;  1TU0 B;  3V7S A;  1P92 A;  3PNW C;  3H0I A;  1ACM B;  3HP9 A;  2QAZ A;  4QVD A;  2E10 A;  3TSW A;  3PIP A;  2SRC A;  3CCE Q;  1KD1 C;  2K2M A;  2E3I A;  2YLC A;  1ADJ A;  5GAO l;  1X69 A;  2DFU A;  2K5F A;  4NCX A;  1PRL C;  5L23 A;  1I0C A;  5KCH A;  1QVG S;  4BE1 A;  3IG2 A;  3RGL A;  3FLG A;  1H92 A;  4FYY B;  1GRI A;  2RHI A;  4X9D A;  3UT1 A;  2EL9 A;  1HTT A;  4TVA B;  3EFS A;  3CXC P;  3JB9 F;  2CS7 A;  2CKK A;  3S6W A;  2RK2 A;  2AIR B;  3GP8 A;  3LGL A;  1W2B A;  2Z0W A;  1CKB A;  1VQN Q;  4M75 B;  4P3N A;  1VQ4 Q;  3HFZ A;  3VYG A;  2KI7 A;  2ZPE B;  4XU3 A;  1ABO A;  3MP8 A;  2XDD A;  3CCL T;  3G4S T;  2QK0 A;  1B7Y A;  2E1H A;  2QQR A;  5CIU A;  4FM4 B;  3KUF A;  3JCM Q;  2R57 A;  1D1B A;  1UB4 A;  4LD9 K;  1VQ6 Q;  4J6Y A;  3A32 A;  2GTO A;  3ER0 A;  2EYQ A;  4RTU A;  1ARK A;  1VQ7 T;  4C92 A;  2FZC B;  1VA7 A;  3REA B;  2ZT5 A;  2P0Q A;  2ZAE A;  1Z9Z A;  4P72 A;  1WDX A;  1R77 A;  3CCV Q;  3HXV A;  1WHM A;  4X1V A;  4TVW A;  1JEG A;  4YRK A;  1R8O B;  1OEB A;  5A0D A;  2DYB A;  1M8M A;  2PMF A;  4HVC A;  2Q5H A;  3CXC A;  4B6M A;  2HQX A;  2QXF A;  2HL5 C;  1YIT T;  3UWN A;  5CKD A;  2MK5 A;  3OW2 A;  3H0F A;  3HY1 A;  2DL7 A;  1UFF A;  4YRL A;  2LNH B;  3MP1 A;  5GMK j;  2L2P A;  3G4S A;  3O5Z A;  4D8K A;  1B34 A;  2FRY A;  1Q82 U;  4KBM B;  1KQ1 A;  1VYT A;  1RUW A;  2WSE E;  1Q81 R;  4PFO A;  1YFS A;  3HRT A;  4A4F A;  2K5L A;  4H2U A;  2ZZF A;  1NLO C;  4C8Q D;  1MNE A;  4F7U G;  1YIJ Q;  3N5B B;  1SET A;  2X9H A;  4F14 A;  5CCA A;  2EAY A;  1M1K C;  2JTM A;  1UGS B;  3G6E A;  3PFS A;  1HYO A;  3A5Z A;  2JM9 A;  1V1C A;  2NLU A;  3HRU A;  3LWH A;  4EPC A;  2P84 A;  4MDW A;  3MF2 A;  1QVF P;  3L2R A;  1H8K A;  2M02 A;  1YIJ A;  2ZNI A;  2XDB A;  5FU7 B;  2C0O A;  5K1X A;  2OTL Q;  3TU4 K;  5KYY B;  4FT4 A;  2A36 A;  4YRO A;  1VQP T;  1AZG B;  3VS4 A;  1NJ8 A;  3DLM A;  3RR6 A;  3RL6 A;  4HWO A;  1EX4 A;  4JZ3 A;  4C92 C;  3EG2 A;  3A98 A;  4TQF A;  2BTT A;  4H2T A;  4C8Q B;  5A0L A;  2E41 A;  2RMO A;  4L5G A;  2K9G A;  1RLP C;  1M4Z A;  3CEY A;  3UA7 A;  2VV5 A;  2F1L A;  3S3N A;  4C92 D;  1JB0 E;  1WGS A;  1I5L A;  1GL5 A;  2EIF A;  1QKX A;  3O8V A;  2DJZ A;  1M8V A;  4WI1 A;  1MV0 B;  1QWE A;  5C0M A;  2K79 A;  1S72 Q;  2EQJ A;  2DET A;  1W1F A;  3LH0 A;  3MPU B;  2BKD N;  4ATO A;  2E6Z A;  1LOJ A;  5D6Y A;  1Q7Y C;  2RHS A;  3QO5 A;  3URG A;  2I0N A;  3A74 A;  3E19 A;  4OMM A;  2NUT A;  1MGQ A;  3RKX A;  4YRT A;  1VIF A;  3FJP A;  5GAN 8;  3OA6 A;  4PLL A;  1JU5 C;  2QQ9 A;  4LDX A;  1NEB A;  2QDL A;  4F17 A;  4PJO D;  2ZR3 A;  2ZT7 A;  4IUU A;  3QO3 A;  1RL2 A;  1X54 A;  3I7F A;  1TG0 A;  1SES A;  3M55 A;  3EHQ A;  2CIM A;  4NL2 A;  4WCI A;  3GLX A;  2F5K A;  1ZSG A;  4N4H A;  5LJ3 e;  1H4V B;  3E9F A;  4E7Z A;  1G5H A;  3TEH B;  5J3B A;  5CKB A;  3JCM c;  3VS0 A;  4ZIB A;  2CT4 A;  1QP3 A;  4YRM A;  3UAT A;  1MMA A;  2RQR A;  3SEM A;  4C0G A;  4DBR A;  2PTK A;  2QHS A;  3EG3 A;  4P71 A;  5A2Q E;  2RQT A;  4MZM A;  4M7A A;  1RIQ A;  2GBQ A;  3HY0 A;  1IB8 A;  2P0L A;  1NEG A;  2VXE A;  2QGG A;  2OTJ A;  3KBG A;  1D0X A;  2CT3 A;  8AT1 B;  5KYX B;  2E6N A;  1FMV A;  4FYW B;  4FW2 A;  3PMT A;  1SG5 A;  3SWN A;  1D3B B;  2EQU A;  1PM3 A;  1D0Z A;  1QQJ A;  4LDY A;  1N27 A;  1BU1 A;  4LVI A;  4A4G A;  4IKF A;  5ELN A;  5K1P A;  2GCX A;  1O75 A;  1Z9Q A;  1H4T A;  3VRY A;  3MEW A;  4PG3 A;  1NPP A;  2EBP A;  2RHS B;  1UJ0 A;  3MET A;  1VQ6 T;  2DBK A;  2YUQ A;  4QQ6 A;  2JTE A;  2KXC A;  4PFZ A;  4E51 A;  4KGV B;  4MML A;  2DKG A;  3DB3 A;  2DD5 A;  1SHG A;  2COW A;  3G71 A;  5KYY A;  1T0J A;  8ATC B;  4AFQ C;  1M90 C;  1VQ5 A;  1TOV A;  4J5Y A;  3OYI A;  4F7U A;  2EWN A;  3CBM A;  3I56 A;  1ZA1 B;  2F2W A;  1RLQ C;  2ED0 A;  4K11 A;  1NYQ A;  3QZ5 B;  1SPK A;  3A8G B;  2ABL A;  1OOT A;  1XJW B;  4R56 A;  2J3M A;  4O6J A;  2Q7E A;  3EH2 A;  5EC7 A;  5GAM e;  3CCJ Q;  3QWY A;  2CZ0 B;  2HSP A;  2XKO C;  3X24 B;  4YRI A;  2HMA A;  2DIG A;  5FLX E;  2DQ3 A;  5LJ5 e;  4YRS A;  4OMN A;  2PNI A;  4RG8 A;  1X55 A;  3TQ7 P;  1KQ2 A;  3CQT A;  4YDQ A;  3KFU A;  3PT9 A;  1TUD A;  3ZFJ A;  4OLF A;  3SWN C;  1GBQ A;  1X6B A;  2FG0 A;  5C51 B;  5IH2 A;  2MYS A;  4E7K A;  1SRL A;  3BDL A;  2C7I A;  2DTO A;  3HFO A;  1UGP B;  4L6V 5;  2JM8 A;  4MDX A;  1FMW A;  1JBM A;  1JO8 A;  3LSS A;  4P3O A;  2V1Q A;  1YCS B;  3JAM E;  4BDY A;  1ZSZ B;  2HKQ B;  5I21 A;  3JCM h;  5GAN 2;  2NS6 A;  2PQW A;  1ZLM A;  2R58 A;  1IHV A;  1FXX A;  1VQZ A;  3CC2 T;  5GAN f;  1PKS A;  5I22 A;  3RBB B;  1G3S A;  1IGQ A;  2FVU A;  2RH2 A;  2RI3 A;  1K8A U;  2FO0 A;  3CMA T;  1QW1 A;  3OYL A;  3CCU T;  2KMT A;  3WVE B;  1MHN A;  3VUB A;  2D6F A;  2MI6 A;  7AT1 B;  2DD4 A;  3A8M B;  2E70 A;  2EYY A;  4GBQ A;  3QDR B;  3M57 A;  1O9S A;  1VQM A;  2A7Y A;  2J7I A;  4M77 D;  3QTC A;  3QNE A;  3M0P A;  4DOV A;  1B8A A;  2M1H A;  4G84 A;  4EX5 A;  3M0R A;  1QVF S;  2XK0 A;  1I1J A;  3JCM X;  1Q81 C;  2DIL A;  4FSS A;  4XU1 A;  4OMO A;  5CKH A;  2CZ6 B;  3EG1 A;  3JCM d;  4H2S A;  1UGV A;  3M53 A;  5FU6 B;  1X2Q A;  1PCX A;  4GLM A;  1M27 C;  5GAN 5;  3H41 A;  3U23 A;  3F70 A;  3MCA B;  2M0O A;  4BY6 C;  1T0H A;  2XD0 A;  2XI9 A;  2K3B A;  1WHH A;  3A5Z B;  4XTY A;  2GTJ A;  3JCM J;  2XTI A;  4ZTZ B;  3UF4 A;  3VUZ A;  4P75 A;  1IZ6 A;  4P73 C;  1NJI U;  1OYX A;  3QII A;  4N0A C;  3CPF A;  1Q86 C;  2LNV A;  4C8Q A;  3HL8 A;  1QVF A;  4QKU A;  12AS A;  3UH0 A;  2L0A A;  4KRT A;  2IY5 B;  1HD3 A;  1WX6 A;  1YFT A;  2J6K A;  3C12 A;  5CKE A;  1YIT A;  1QCO A;  4RKU E;  2BUD A;  2F2X A;  2KSS A;  4BE0 A;  2DDZ A;  4UP7 A;  5AYF A;  2XU8 A;  1MMD A;  2DU5 A;  4B9X A;  4C5E A;  3G1Z A;  3OQ5 A;  4QQG A;  5CQY A;  1IHW A;  4XTZ A;  5KH6 A;  3L2Q A;  5KE2 A;  4N4G A;  3C0C A;  1FMK A;  3W3S A;  1S72 T;  3CCQ A;  2DM1 A;  4RUG A;  1X2G A;  2LRQ A;  2VKN A;  3QYH B;  4M7A G;  1WIE A;  3A7U A;  2CRE A;  2A8E A;  4E7I A;  1ZUK A;  2F5T X;  1ADY A;  4XEM A;  1AHJ B;  3CCR T;  4LVK A;  1PYS B;  3CCL A;  4JJB A;  3VJP A;  1WLE A;  2LDM A;  2Y4Y A;  4EMK C;  1WPY A;  2DXB A;  3HRK A;  2J6F A;  1BIA A;  3EGU A;  4HT9 A;  4C0D B;  4P72 C;  4PKC C;  1BBW A;  2OJ2 A;  2EYZ A;  5J39 A;  4Q5W A;  3LWI A;  4DEY A;  4JRP A;  1PKT A;  1KD1 R;  2OTJ T;  4E2F B;  3UGQ A;  2LT1 A;  3ME9 A;  4F04 B;  1BI1 A;  4E7S A;  2IPO B;  4R55 A;  3CCS T;  4AG2 C;  1GGM A;  1X27 A;  3HRI A;  1TUC A;  2LX7 A;  3QJ6 A;  2COZ A;  1BI0 A;  5GAO m;  3M54 A;  2VC8 A;  4BDZ A;  2C06 A;  2XGT A;  2JNG A;  5KYX A;  1OU8 A;  2ED1 A;  5DLO A;  1U8R A;  3J7A F;  1ZX6 A;  3QKJ A;  1VQ8 Q;  2HL3 A;  1L0W A;  4Q6G A;  5GAM h;  3L2Z A;  1BBZ A;  3ASK A;  3CCE A;  3CCR A;  4M75 A;  3BY7 A;  3GNG A;  2M0Y A;  1SEM A;  4CI0 C;  2YRD A;  1K9A A;  2L5Q A;  1AZE A;  1KJW A;  1NJ1 A;  4E6R A;  2MPX C;  4M7A D;  2EW3 A;  4JRQ A;  3CMA Q;  2KT1 A;  2YUP A;  4TVR A;  1TS9 A;  2JUF A;  4YCW A;  3G71 Q;  4JS4 A;  3P8H A;  1BCO A;  4AMC A;  2ART A;  4M7D A;  2ROT A;  2OTL A;  2OI3 A;  2V8I A;  1WFW A;  2RHZ A;  4P5N A;  5CR2 A;  2E5A A;  4XQ3 A;  4RMO A;  2D8J A;  4LD6 A;  2QDY B;  1YIJ T;  1M2V B;  4A63 B;  2DRM A;  2FL7 A;  1VQK T;  5IAY A;  1QCF A;  4E7J A;  3CC4 A;  3OYF A;  2CZ7 B;  2CJ9 A;  1N5Z A;  4ZTF A;  3HSB A;  4LVL A;  1U3O A;  2KT8 A;  3EFO B;  3M4P A;  4F7U E;  2R5M A;  5GAN 3;  5KYU A;  3LYI A;  1YIT Q;  1RI9 A;  3X28 B;  3CCL Q;  1E1T A;  2DO3 A;  3OW2 S;  3JCM P;  4IUT A;  3M0S A;  1TH7 A;  3M4G A;  3REU A;  2VWF A;  2ZXF A;  3EG9 B;  5D6W A;  3PVQ A;  2QI2 A;  1KHC A;  3OB9 A;  2ZTG A;  2P0P A;  3M0T A;  1B07 A;  2XIC A;  3CC4 T;  4BWA A;  1FWZ A;  1E7O A;  4OVA A;  4KT0 E;  4HT8 A;  3VBB A;  1D09 B;  2EKH A;  1HC7 A;  4B9W A;  1JQQ A;  2RN8 A;  4MZT A;  1PD0 A;  1K73 C;  3GNF B;  4M7A B;  5GAN g;  2MWP A;  4YRF A;  4ZTJ A;  4DBQ A;  1QCN A;  4IUV A;  2VXF A;  3QJY A;  1LJO A;  4JZ4 A;  1M2V A;  1YJN A;  1Q86 R;  2LP5 A;  2KBT A;  5L8R E;  5I2S A;  2RD1 A;  1E6H A;  2GGR A;  4M77 G;  1RAH B;  2XID A;  2RQV A;  3EAE A;  3VS6 A;  2DMO A;  4DA4 A;  2DL8 A;  2HNI A;  2QEX T;  2PU9 B;  1B3Q A;  4PLI A;  4XAX B;  1U1S A;  1WJS A;  1YGB A;  4M7D G;  3M9Q A;  3V7R A;  2GF7 A;  3QWX X;  2YWW A;  3OYD A;  4IUQ A;  2HKN A;  4NOY A;  3NMZ C;  3I56 Q;  2V26 A;  1EVK A;  3GIB A;  2O4X B;  2YRV A;  1WJR A;  3VS3 A;  3EH1 A;  1Q82 R; 
#chains in the Genus database with same CATH homology
 3VQV A;  4EDU A;  2QHV A;  3ERR A;  2ZT8 A;  3UPU A;  4HT4 A;  3M5A A;  3HXU A;  5C53 B;  2VUB A;  5GAO q;  4X9C A;  1YFR A;  3OMC A;  1I4K 1;  4VUB A;  1N8R U;  4Y28 E;  3TEH A;  3L2V A;  2JN0 A;  4FU6 A;  1VUB A;  4XTV A;  2X4J A;  1Q7Y U;  1M9S A;  2OTL T;  4M75 E;  1HXD A;  2QA4 A;  2ZZD A;  4EMH A;  1USY A;  4YPF A;  1QE0 A;  2VGM A;  3JCM g;  4PNO A;  4YCV A;  5CK9 A;  1Y07 A;  3IAL A;  5HKC A;  3ICA A;  3CCV A;  2FB7 A;  3X25 B;  4C8Q F;  5I2M A;  5DLQ E;  5LJ5 j;  4AH6 A;  4BI8 B;  2OAU A;  4TVA A;  4HCC A;  4M77 F;  1C0A A;  3OS0 A;  1YJW T;  3OD1 A;  2GFA A;  5M9O A;  4EO4 A;  2G4C A;  5GMK h;  3CCS A;  1YJ9 A;  4A4E A;  1H64 1;  2PVD B;  4C0D C;  5GAN j;  2EQM A;  2AHJ B;  1K9M U;  3PIO A;  4ELY C;  2JVV A;  2DK3 A;  3L42 A;  4JLG A;  4GLK A;  3HKS A;  5C6S A;  2E12 A;  3CME A;  1KD1 U;  2L3R A;  1KG1 A;  2ZZG A;  2EFI A;  3SDZ A;  3PMI A;  1ASZ A;  4N0A A;  3WQZ A;  4J15 A;  3VV0 A;  1QVG A;  3JCM W;  1EIF A;  4A4K A;  1SRY A;  3JB9 I;  3CCU A;  3RAC A;  2M16 A;  5GAN 4;  4ZN1 A;  5GAM g;  2LX9 A;  3L1A A;  3CPW A;  3HFN A;  1EQR A;  2DPP B;  2Q5I A;  3JB9 J;  5CVI A;  3A7R A;  4N4I A;  4K87 A;  2CYZ B;  3BJU A;  3NTI A;  3CCE T;  1KC8 C;  1G3T A;  2E5Q A;  3FIF A;  5HY6 A;  2XG8 D;  1U1T A;  1QF6 A;  1JJC B;  2QQS A;  1VQ4 A;  2K57 A;  4M78 C;  4E7H A;  1IL2 A;  3Q1J A;  1LYL A;  1K8A C;  3MF1 A;  4L87 A;  3FRN A;  4HA8 A;  4OF1 A;  4F7U F;  4C92 E;  3MO8 A;  4M75 D;  1X6O A;  3X20 B;  3LLR A;  1FYF A;  2K4Y A;  3NFC A;  1YHQ A;  3OS1 A;  4OB1 B;  3OSV A;  2D0Q B;  2IG0 A;  2K3Y A;  4TQD A;  3PCO A;  1EVL A;  3PTA A;  3OS5 A;  5GAO r;  3HXX A;  4X34 A;  5IN1 A;  1KQS S;  2FHD A;  4FSX A;  4M7D D;  1VQM T;  3REX A;  5GMK m;  3BDU A;  3FDR A;  1VQ6 A;  2CJA A;  4LDU A;  2DXC A;  2ZR2 A;  3RMS A;  4P73 A;  2B8A A;  2DQ0 A;  2ZPH B;  4PJO F;  1QP2 A;  4EMG A;  3P8Y A;  4LVJ A;  2LT4 A;  3CBO A;  4C5I A;  1Q86 U;  2AKW A;  3L4G A;  3OS2 A;  3SWN B;  3E9H A;  4NL3 A;  3MHX A;  2E65 A;  1JJ2 S;  3HHT B;  2DEQ A;  1PSE A;  4KUL A;  1XOV A;  1JRI A;  4C92 F;  5LJ5 f;  3OSS C;  2LQK A;  1XNI A;  1VQP A;  3BFM A;  4J6X A;  5GAO n;  4F7U B;  1ATI A;  4CH5 A;  2KY9 A;  3NEM A;  4YRN A;  2P0K A;  4GY5 A;  5HK0 A;  3G7Z A;  2MMP A;  3V7C A;  2DZC A;  3HFV A;  4BI3 A;  1VQO T;  5KNN A;  2RHQ A;  4O2D A;  2ZT6 A;  3R6O A;  1GXI E;  5KCO A;  1YJW A;  2V8K A;  4BI4 A;  3E9I A;  11AS A;  3J80 E;  5CO7 A;  3RMQ A;  2H3J A;  2D9T A;  2LVM A;  4YRE A;  2WSF E;  1KOG A;  5GAM f;  2X35 A;  4P74 C;  3QO8 A;  3S3M A;  4G85 A;  2HBP A;  2EJG A;  4TWA A;  1NPR A;  3DB4 A;  3VU3 C;  2KDS A;  2RHY A;  4JRI A;  2ALY B;  3LSQ A;  4TTV A;  4A53 A;  3QPH A;  2ZPF B;  5LJ3 g;  1M5Q 1;  1YJ9 T;  3C94 A;  1FX7 A;  4H2Y A;  3TEG A;  3G6E T;  1N9W A;  1YI2 A;  2CGH A;  4YRC A;  4C5H A;  5GAN e;  3LC0 A;  2DIQ A;  2XHC A;  2LC4 A;  3WXM B;  3UDC A;  2ARU A;  2Y90 A;  1B76 A;  2QEX A;  4A4H A;  4M7D E;  1Q82 C;  2RI2 A;  2JTF A;  5A0G A;  4KQE A;  2QQA A;  1ZBX A;  2I2L A;  2A3L A;  4M78 F;  5F5W A;  4DQ2 A;  1YJN T;  4J83 A;  4OP0 A;  3OBW A;  4OMF B;  2RO0 A;  4YRQ A;  3QHS A;  3JB9 D;  1SSF A;  4M78 D;  1W66 A;  1G3Y A;  4C92 G;  4YRJ A;  1E24 A;  3L4G B;  1YCY A;  4H2V A;  3DSQ A;  4YRG A;  3NTH A;  3G71 T;  4PHC A;  4C8Q G;  4C8Q C;  1Z7M A;  2HQE A;  4C92 B;  2VGN A;  4RCB A;  1Y96 A;  1ZQ1 A;  5GMK i;  1M1F A;  3TUP A;  1ZHI A;  2ARS A;  1KHI A;  3HXW A;  4XTW A;  4CRI A;  3OYE A;  2QHU A;  2CJB A;  4ZGD B;  3WVD B;  4PJO E;  3A8O B;  2ZZE A;  3I55 A;  2VYT A;  4D6W A;  2HD0 A;  2RHU A;  4ELZ C;  1E22 A;  2DVE A;  3HXZ A;  3MEY A;  4EMK A;  3RES A;  4BW9 A;  2I4M A;  1VQ4 T;  2E64 A;  4OGC A;  2EJF A;  3GOX A;  4BB7 A;  4RMF A;  2PUO B;  5LJ5 d;  3M4Q A;  2L89 A;  3V8L A;  2KQW A;  2F69 A;  4M78 B;  4DOW A;  1W2B S;  1WJQ A;  2P4T A;  4RG2 A;  5GAO p;  4M78 E;  2KK4 A;  5LJ5 h;  4ZTU B;  4BD3 A;  4IUR A;  1D3B A;  3BW1 A;  1I81 A;  3QZ9 B;  2X4X A;  1PSF A;  5FRO A;  3QUI A;  2O4X A;  4OB3 B;  1XQH A;  4CH4 A;  3SD4 A;  4RCC A;  2E3C A;  3VYH B;  1NJI C;  2RJD A;  3JCM V;  3RF1 A;  2GFU A;  5C52 B;  2C8M A;  1UEB A;  4H2W A;  2X4W A;  2LTO A;  4M75 G;  5ELO A;  4YP0 A;  3CMQ A;  4M75 C;  1NJ2 A;  4M77 E;  2EJ9 A;  5E3I A;  3CC7 T;  4EMK B;  4C0F A;  3CXC S;  4V2S A;  4J6W A;  1N8R C;  3QO7 A;  2PME A;  2PUK B;  3OMG A;  3MQZ A;  3OYH A;  3CC7 A;  5GAN 6;  1WNL A;  1VQ7 A;  3A31 A;  5FRM A;  2EKO A;  2YHT A;  1G5I A;  3JSC A;  2DXU A;  1OZ3 A;  3MP6 A;  2KAF A;  5LL6 S;  2ZIN A;  2PVG B;  4HCB A;  1VQN T;  4KR3 A;  1B34 B;  4YRR A;  2ZIM A;  2RM4 A;  3M56 A;  5DY9 A;  4LNS A;  1KQS A;  3UFG A;  4HWT A;  2L8D A;  1Y96 B;  2ZCE A;  4LDW A;  2ZGW A;  4KUI A;  4K88 A;  1H4Q A;  2RJC A;  1V29 B;  1G5V A;  3PCO B;  4PJO C;  4XTU A;  4OGE A;  4K86 A;  2IVW A;  2BIV A;  3RIR A;  4BUG A;  5FRN A;  4QW2 A;  3KXT A;  3QXE B;  5GMK e;  5GMK l;  2Q7G A;  1PYS A;  3OYM A;  4ZN3 A;  1VQ5 T;  3QG1 A;  1VQO A;  3VKI A;  4ME7 A;  1W4S A;  2DTH A;  3S3O A;  2K5I A;  3QBY A;  1K9M C;  2XDP A;  4II1 A;  2ZNJ A;  2RJE A;  1EFW A;  3RER A;  2DAQ A;  4P75 C;  3I55 T;  3TCJ A;  1J5W A;  2MWO A;  5IT9 E;  1G3W A;  2WSC E;  3INZ A;  5KE3 A;  4J8O A;  1E1O A;  2YLB A;  4MZP A;  1VQ9 A;  1X56 A;  4PL6 A;  2HAX A;  4LDV A;  2I4L A;  1Q81 U;  2K2V A;  2DXT A;  5DM7 R;  4DPG A;  3PGG A;  3IKL A;  5J26 A;  1VQK A;  3JB9 H;  3V8J A;  4QVC A;  1M1K U;  2RA2 A;  3OYK A;  3M58 A;  1VIE A;  4BE2 A;  4H2X B;  1B70 A;  3OYJ A;  4P3P A;  5CQX A;  4HCZ A;  4P74 A;  4MMK A;  4QVZ A;  3TRE A;  2RJF A;  4BAC A;  4KR2 A;  2DTI A;  4Z02 A;  4UP9 A;  2ZCF B;  4HKE A;  1BI2 A;  4M77 A;  3NEN A;  2EQK A;  4CS4 A;  2FYK A;  4JLI A;  4UP8 A;  1KMN A;  4X5O A;  3C95 A;  1WU7 A;  1S72 A;  4XK8 E;  1XTD A;  2V8J A;  3CD6 T;  3IKM B;  1M1G A;  3MEA A;  2QQB A;  3OYA A;  1UGR B;  1Y7X A;  3UGT A;  1B7Y B;  4J7I A;  5CAI A;  3TEE A;  4Y91 A;  4M7A C;  1OI1 A;  4RDX A;  4WF2 A;  3I56 T;  4H2X A;  1EIY A;  4OB0 B;  2O01 E;  1NZ9 A;  4YTL A;  3SB2 A;  2AKW B;  2ZPG B;  2MAM A;  4OB2 B;  4M78 A;  4XEO A;  2QTX A;  3DLL A;  1WYD A;  4M77 C;  2LQ8 A;  4ZGJ B;  2KVQ G;  1Z7N A;  1NE8 A;  4NS5 A;  3H6Z A;  5GAM j;  3L2W A;  1X2H A;  3C4S A;  1BBU A;  5LJ3 h;  4E7L A;  4RQF A;  3CMA A;  4XTX A;  3ZBD A;  3CC2 A;  4C0Z A;  1VQ8 T;  3QYG B;  4E47 A;  3A8L B;  3HPW A;  1QVP A;  4FIB A;  4C8Q E;  3A7A A;  1EIY B;  1WQ7 A;  3RKY A;  2RHX A;  3E9G A;  2M9U A;  3QSU A;  3RUX A;  4JUV A;  4CH6 A;  4JS5 A;  1M90 U;  2ZPB B;  3DKM A;  2ODR C;  4WJ3 M;  4C5G A;  3GPL A;  5HK3 A;  4HWP A;  3PZC A;  4KUD K;  4FL6 A;  5HGQ A;  3OYB A;  4H02 A;  3HRS A;  3VQW A;  5LJ5 g;  1EOV A;  2DU7 A;  1H4S A;  4FT2 A;  4L59 A;  4PJO G;  2WAC A;  3HTZ A;  3J81 E;  4JRK A;  4P71 C;  1H3Z A;  3LX7 A;  4RQE A;  3JCM e;  2LCL A;  3CCV T;  2AMC B;  3AHU A;  3P8V A;  3H8Z A;  2J3L A;  3MEV A;  3OYG A;  2I4N A;  5FU7 C;  3X26 B;  1USY C;  3OYN A;  3MEU A;  1NJ6 A;  5GAN d;  4CH3 A;  1ASY A;  4XU0 A;  4M77 B;  3EFR A;  2ZIO A;  3JRZ A;  1JJ2 A;  1JJC A;  1BI3 A;  1K73 U;  1VQL T;  1NNH A;  4YYE A;  2ZPI B;  1X75 C;  4IUP A;  3OBY A;  2RHQ B;  4TVY A;  3JB9 G;  1YBY A;  3CCM A;  1VQ8 A;  5GAN 7;  1N9S A;  4Q15 A;  1YHQ T;  3JCM f;  4PJO A;  4CS2 A;  3CBP A;  4HWS A;  2JOY A;  1G51 A;  5GAN h;  1SER A;  4M7D B;  3M59 A;  1VQL A;  3P8D A;  2G3R A;  4UPA A;  3OY9 A;  3CPW S;  3E1S A;  3ZEH A;  4M7A F;  3FEO A;  2AMC A;  3VQY A;  5EG2 A;  3T9N A;  1OZ2 A;  3A5Y A;  1DJ7 B;  2R5A A;  4BY6 B;  3JCM b;  3VQX A;  1N6A A;  3CCJ A;  2ALY A;  1WQW A;  3OYY A;  1IRE B;  1KMM A;  1KC8 U;  4JJN K;  2LCC A;  3GF5 A;  1RI0 A;  5FU6 C;  5LJ3 f;  2Y4X A;  3P8B B;  3HFZ B;  3CME T;  3FB9 A;  3LGF A;  5LJ3 d;  2CZ1 B;  2GQV A;  4J7F A;  3CCQ T;  4CS3 A;  2Q7H A;  3HXY A;  2I4O A;  2X4Y A;  1BIB A;  1NJ5 A;  2QHT A;  4M78 G;  1YI2 T;  1NYR A;  3OYC A;  5D6X A;  1VQN A;  4LVM A;  4UC4 A;  4ZGE B;  5GAM d;  1VQ9 T;  1BYM A;  4WJ4 A;  3CCJ T;  2MF2 A;  4O5V A;  1LNX A;  3A8H B;  4M7D F;  1X01 A;  1HK9 A;  2IY5 A;  2P5I A;  4JDS A;  3RKW A;  3CCM T;  1BKB A;  3NTK A;  4HWR A;  4QQD A;  3M4Y A;  3R07 A;  2ODR D;  3LW5 E;  1B70 B;  2RI5 A;  1YB3 A;  3SFM A;  4M7A E;  3NEL A;  3V8K A;  3FC3 A;  1I8F A;  5LJ3 j;  4XU2 A;  4M75 F;  2K3X A;  2JZ2 A;  4M7D C;  3CD6 A;  2QA4 T;  3L2U A;  1UGQ B;  4YRP A;  4PJO B;  3P8T A;  2DZ9 A;  1N9R A;  1Y71 A;  5CKF A;  3NET A;  2PVO B;  4A54 A;  4YCU A;  2RB6 A;  2RK1 A;  3V7S A;  1P92 A;  3PNW C;  3HP9 A;  4QVD A;  2E10 A;  3PIP A;  1KD1 C;  2YLC A;  1ADJ A;  5GAO l;  2K5F A;  4NCX A;  5KCH A;  1QVG S;  3IG2 A;  4BE1 A;  3RGL A;  3FLG A;  2RHI A;  4X9D A;  3UT1 A;  2EL9 A;  1HTT A;  4TVA B;  3EFS A;  3JB9 F;  2CS7 A;  2CKK A;  3S6W A;  2RK2 A;  3GP8 A;  3LGL A;  1W2B A;  4M75 B;  4P3N A;  3HFZ A;  3VYG A;  2ZPE B;  4XU3 A;  3MP8 A;  2XDD A;  3CCL T;  3G4S T;  1B7Y A;  2E1H A;  2QQR A;  5CIU A;  4FM4 B;  3KUF A;  3JCM Q;  2R57 A;  1UB4 A;  4LD9 K;  4J6Y A;  3A32 A;  3ER0 A;  2EYQ A;  1VQ7 T;  4C92 A;  2ZT5 A;  2P0Q A;  4P72 A;  3HXV A;  4TVW A;  4YRK A;  1R8O B;  5A0D A;  2PMF A;  4HVC A;  2Q5H A;  3CXC A;  2HQX A;  2QXF A;  1YIT T;  3UWN A;  5CKD A;  3OW2 A;  3HY1 A;  4YRL A;  3MP1 A;  5GMK j;  3G4S A;  1B34 A;  1Q82 U;  4KBM B;  1KQ1 A;  1YFS A;  2WSE E;  3HRT A;  4A4F A;  2K5L A;  4H2U A;  2ZZF A;  4C8Q D;  4F7U G;  3N5B B;  1SET A;  5CCA A;  2EAY A;  1M1K C;  2JTM A;  1UGS B;  3G6E A;  3PFS A;  3A5Z A;  2NLU A;  3HRU A;  3LWH A;  4EPC A;  4MDW A;  3MF2 A;  3L2R A;  1YIJ A;  2ZNI A;  2XDB A;  5FU7 B;  5K1X A;  3TU4 K;  4FT4 A;  4YRO A;  1VQP T;  1NJ8 A;  3DLM A;  3RL6 A;  4HWO A;  4C92 C;  4TQF A;  4H2T A;  4C8Q B;  5A0L A;  2E41 A;  4L5G A;  1M4Z A;  3CEY A;  2VV5 A;  3S3N A;  4C92 D;  1JB0 E;  1WGS A;  1I5L A;  2EIF A;  3O8V A;  2DJZ A;  1M8V A;  4WI1 A;  5C0M A;  2EQJ A;  3LH0 A;  2BKD N;  4ATO A;  2E6Z A;  1LOJ A;  5D6Y A;  1Q7Y C;  2RHS A;  3QO5 A;  3URG A;  3A74 A;  3E19 A;  1MGQ A;  3RKX A;  4YRT A;  1VIF A;  3FJP A;  5GAN 8;  3OA6 A;  4PLL A;  2QQ9 A;  4LDX A;  4PJO D;  2ZR3 A;  2ZT7 A;  4IUU A;  3QO3 A;  1RL2 A;  1X54 A;  3I7F A;  1SES A;  3M55 A;  2CIM A;  4NL2 A;  3GLX A;  2F5K A;  4N4H A;  5LJ3 e;  1H4V B;  3E9F A;  1G5H A;  3TEH B;  5J3B A;  5CKB A;  3JCM c;  4ZIB A;  1QP3 A;  4YRM A;  4C0G A;  2QHS A;  4P71 A;  5A2Q E;  4MZM A;  1RIQ A;  4M7A A;  3HY0 A;  2P0L A;  2VXE A;  2OTJ A;  3KBG A;  2E6N A;  3PMT A;  3SWN A;  1D3B B;  2EQU A;  4LDY A;  1N27 A;  4LVI A;  4A4G A;  4IKF A;  5ELN A;  5K1P A;  2GCX A;  1O75 A;  1H4T A;  3MEW A;  4PG3 A;  1NPP A;  2RHS B;  3MET A;  1VQ6 T;  4QQ6 A;  4E51 A;  4MML A;  2DKG A;  3DB3 A;  2DD5 A;  3G71 A;  1M90 C;  1VQ5 A;  4J5Y A;  3OYI A;  4F7U A;  2EWN A;  3CBM A;  3I56 A;  1NYQ A;  3QZ5 B;  3A8G B;  2J3M A;  2Q7E A;  4R56 A;  4O6J A;  5GAM e;  2CZ0 B;  2XKO C;  3X24 B;  4YRI A;  2DIG A;  5FLX E;  2DQ3 A;  5LJ5 e;  4YRS A;  4RG8 A;  1X55 A;  1KQ2 A;  4YDQ A;  3KFU A;  3PT9 A;  3ZFJ A;  4OLF A;  3SWN C;  5C51 B;  4E7K A;  3BDL A;  2C7I A;  2DTO A;  3HFO A;  1UGP B;  4L6V 5;  4MDX A;  1JBM A;  3LSS A;  4P3O A;  3JAM E;  4BDY A;  5I21 A;  3JCM h;  5GAN 2;  2NS6 A;  2PQW A;  2R58 A;  1FXX A;  1VQZ A;  3CC2 T;  5GAN f;  1G3S A;  2FVU A;  2RI3 A;  2RH2 A;  1K8A U;  3CMA T;  1QW1 A;  3OYL A;  3CCU T;  2KMT A;  3WVE B;  1MHN A;  3VUB A;  2D6F A;  2MI6 A;  2DD4 A;  3A8M B;  2E70 A;  3QDR B;  3M57 A;  1O9S A;  1VQM A;  2A7Y A;  3QTC A;  4M77 D;  3QNE A;  4DOV A;  1B8A A;  2M1H A;  4G84 A;  4EX5 A;  1QVF S;  2XK0 A;  3JCM X;  1Q81 C;  4XU1 A;  5CKH A;  2CZ6 B;  3JCM d;  4H2S A;  3M53 A;  5FU6 B;  5GAN 5;  3F70 A;  3MCA B;  2M0O A;  4BY6 C;  2XD0 A;  2XI9 A;  3A5Z B;  4XTY A;  3JCM J;  2XTI A;  4ZTZ B;  3VUZ A;  4P75 A;  1IZ6 A;  4P73 C;  1NJI U;  1OYX A;  3QII A;  4N0A C;  3CPF A;  1Q86 C;  2LNV A;  4C8Q A;  3HL8 A;  1QVF A;  12AS A;  3UH0 A;  2IY5 B;  1YFT A;  3C12 A;  5CKE A;  1YIT A;  4RKU E;  2BUD A;  2KSS A;  4BE0 A;  2DDZ A;  4UP7 A;  5AYF A;  2XU8 A;  2DU5 A;  4B9X A;  4C5E A;  3G1Z A;  3OQ5 A;  4QQG A;  5CQY A;  4XTZ A;  5KH6 A;  3L2Q A;  5KE2 A;  4N4G A;  3W3S A;  1S72 T;  3CCQ A;  1X2G A;  2LRQ A;  3QYH B;  4M7A G;  3A7U A;  2A8E A;  4E7I A;  2F5T X;  1ADY A;  4XEM A;  1AHJ B;  3CCR T;  4LVK A;  1PYS B;  3CCL A;  3VJP A;  1WLE A;  2LDM A;  2Y4Y A;  4EMK C;  1WPY A;  2DXB A;  3HRK A;  1BIA A;  4HT9 A;  4C0D B;  4P72 C;  4PKC C;  1BBW A;  5J39 A;  4Q5W A;  3LWI A;  4JRP A;  2OTJ T;  3UGQ A;  2LT1 A;  3ME9 A;  1BI1 A;  4R55 A;  3CCS T;  1GGM A;  3HRI A;  3QJ6 A;  1BI0 A;  5GAO m;  3M54 A;  2VC8 A;  4BDZ A;  2C06 A;  2XGT A;  2JNG A;  5DLO A;  1U8R A;  3J7A F;  3QKJ A;  1L0W A;  4Q6G A;  5GAM h;  3L2Z A;  3ASK A;  3CCE A;  3CCR A;  4M75 A;  3BY7 A;  3GNG A;  4CI0 C;  2L5Q A;  1NJ1 A;  4M7A D;  4JRQ A;  4TVR A;  2JUF A;  4YCW A;  4JS4 A;  3P8H A;  2ART A;  4M7D A;  2OTL A;  2V8I A;  2RHZ A;  4P5N A;  2E5A A;  5CR2 A;  4XQ3 A;  4RMO A;  4LD6 A;  2QDY B;  1YIJ T;  2FL7 A;  1VQK T;  5IAY A;  4E7J A;  3CC4 A;  3OYF A;  2CZ7 B;  2CJ9 A;  4ZTF A;  3HSB A;  4LVL A;  3M4P A;  4F7U E;  2R5M A;  5GAN 3;  3LYI A;  3X28 B;  1E1T A;  2DO3 A;  3OW2 S;  3JCM P;  4IUT A;  1TH7 A;  3M4G A;  3REU A;  2ZXF A;  5D6W A;  2QI2 A;  1KHC A;  3OB9 A;  2ZTG A;  2P0P A;  2XIC A;  3CC4 T;  4BWA A;  1FWZ A;  4OVA A;  4KT0 E;  4HT8 A;  3VBB A;  1HC7 A;  4B9W A;  4MZT A;  1K73 C;  3GNF B;  4M7A B;  5GAN g;  2MWP A;  4YRF A;  4ZTJ A;  4IUV A;  2VXF A;  3QJY A;  1LJO A;  1YJN A;  5L8R E;  5I2S A;  2RD1 A;  4M77 G;  2XID A;  3EAE A;  4DA4 A;  2HNI A;  2QEX T;  2PU9 B;  4PLI A;  4XAX B;  1U1S A;  1WJS A;  1YGB A;  4M7D G;  3M9Q A;  3V7R A;  2GF7 A;  3OYD A;  4IUQ A;  4NOY A;  1EVK A;  3GIB A;  2O4X B;  2YRV A;  1WJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...