3L2ZA

Crystal structure of hydrated biotin protein ligase from m. tuberculosis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
258
structure length
240
Chain Sequence
RPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTTARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BirA bifunctional protein
publication title Structural ordering of disordered ligand-binding loops of biotin protein ligase into active conformations as a consequence of dehydration.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 71
structure length 240
sequence length 258
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2zA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3l2zA01
2ODRD 4XU1A 1B70A 1GGMA 1X55A 4LNSA 1SRYA 5GAN4 4M7AE 1N9SA 1E1TA 4M7DC 1M5Q1 2ZCEA 3VBBA 4C8QA 3UGTA 2EL9A 4C8QC 3VQYA 5C52B 2DZ9A 4M7AA 3PCOB 5GAMg 2ARUA 2ZNJA 1WNLA 4M7AC 4KQEA 2FYKA 4JRIA 2CIMA 5LJ3j 3G1ZA 4H2SA 2E41A 4EO4A 4ZTUB 4Y91A 2YHTA 3TEHA 3LSQA 4M78G 3BFMA 4WJ3M 1J5WA 5LJ5e 4TTVA 4AH6A 4XTUA 2ZT8A 4YRSA 4YRGA 4UP7A 3IKLA 3CMQA 2QTXA 5LJ3d 1TH7A 2AMCB 2E1HA 2E5AA 2RHSA 2K57A 1NYQA 1VQZA 3HXUA 1L0WA 2AKWB 1KMNA 1KMMA 3MEYA 4YRPA 4JLIA 5LJ5f 3R07A 3REXA 4J6YA 3E9HA 5GMKh 2DXTA 4C92G 4P74A 3ERRA 2CJAA 4J5YA 4DPGA 2Q5IA 5GAOm 2C7IA 2DXUA 3BJUA 4YRLA 5GAN2 4F7UB 3LC0A 4G85A 4M78E 2J3MA 4P75A 1B34B 3NETA 4K86A 1H4TA 1H641 4PJOG 3JCMc 4M78A 3SWNC 4P3OA 3UFGA 2CGHA 4J6XA 5GAOp 3JB9H 3HXWA 1H4SA 2ALYB 4RQEA 1QE0A 4YCWA 4M75F 3PZCA 1RIQA 2IY5B 1U1SA 4K87A 4M7DD 2YLBA 2ARSA 4M77B 3P8YA 4H2XB 4O2DA 4YRNA 4C8QD 4C92E 2C8MA 4M7AD 3BY7A 2Q7EA 3RF1A 4P73A 2CJ9A 1Y96A 4P3NA 2ZT7A 4NCXA 4M75A 3KFUA 3NELA 4M75C 1WQ7A 2QHUA 3VQXA 5LJ5h 4YRFA 4CH4A 5DY9A 12ASA 1EVKA 1D3BA 1YGBA 3V8LA 2ZZEA 3JCMV 3P8TA 1BIBA 2DKGA 4TQDA 2ZZFA 3L4GA 4TVAA 2Q7GA 3QSUA 5GANd 3JB9D 4HWOA 4PJOA 4RDXA 1SERA 4YRRA 3JCMb 5ELNA 4PJOC 1W66A 1E22A 2DU5A 3QUIA 4XQ3A 4PNOA 4XTWA 3HTZA 1SETA 3FIFA 4MMKA 2I4OA 5GANe 3HY1A 1HXDA 3REUA 4X9DA 3PCOA 2YLCA 3M4PA 4BWAA 3L2ZA 4F7UG 4XTVA 4M7AF 1HC7A 3QNEA 2Y90A 3HXXA 5LJ5g 1LJOA 3NENA 4CS2A 5I21A 2Q7HA 4P71A 4J15A 4P71C 4YDQA 2RM4A 2CJBA 4H2YA 1B7YB 5E3IA 3LSSA 4TVWA 4YCUA 3FJPA 2ZT5A 2EAYA 5GANf 1C0AA 2ARTA 3HSBA 2AMCA 4YCVA 5GAN6 3QO3A 4E51A 4BW9A 4M78D 3JB9F 4A53A 4M77G 2ZNIA 2E3CA 2AKWA 2I4MA 1EFWA 2P5IA 3HFVA 2RHQB 4EMGA 1E1OA 3E9IA 4OLFA 3HFNA 3IKMB 3RACA 4F7UE 1WU7A 4YRKA 2P0LA 5GAMj 1WYDA 1X56A 4CH5A 4F7UA 4RCCA 3AHUA 1I8FA 2DTIA 4M75D 2PMEA 1G5HA 5LJ3e 4YPFA 1B34A 4M7DB 1YFRA 4C8QB 3JCMd 5GAMd 1Z7MA 1B8AA 3IALA 4P74C 3HRIA 3PGGA 2XGTA 4M78F 2EJFA 2JN0A 1G5IA 4M77E 3JCMX 2ALYA 4PJOD 4TVYA 1WQWA 3V7RA 4HWPA 5LJ3f 4YROA 1JBMA 2Q5HA 2IY5A 3JCMe 1ADYA 5GAN7 3TEHB 4CS3A 4Q15A 4M77A 1NJ5A 4NOYA 4P75C 4HWSA 1B76A 3UGQA 2J3LA 4EMKA 5CAIA 4M78C 4CH3A 4EMKC 3M4GA 3JCMJ 1PYSB 2E64A 3HFZB 1HTTA 2ZTGA 3IG2A 4QVDA 2ZIOA 2RA2A 3JCMf 1JJCB 1X54A 2QHTA 3HFOA 1NNHA 4WF2A 2QHSA 2RB6A 3BW1A 4P3PA 4C92A 4PJOF 5GANg 1BBUA 4P73C 4C92C 4K88A 2VXEA 3GIBA 4JRKA 3JCMQ 3W3SA 1BBWA 1EQRA 3INZA 4WJ4A 5GMKj 4H2UA 3WQZA 2EJ9A 4H2WA 3RKXA 5GMKl 4HWRA 5C51B 3SWNB 3ICAA 1Z7NA 2VC8A 4M7DG 4RCBA 5LJ3h 4YRQA 4XU0A 4C8QG 11ASA 4YRCA 5GAN5 2DTHA 1B7YA 4YRTA 3VQWA 1X2HA 2I2LA 1EIYB 4RQFA 3L1AA 2DDZA 2I4LA 3A7UA 4X5OA 3A5ZA 4X9CA 4JUVA 3HXYA 2EJGA 4DQ2A 1FYFA 3A74A 4KR3A 3A32A 1EVLA 1G51A 3UH0A 4XU2A 4YRMA 4M75B 5ELOA 2DJZA 2RHQA 3A7RA 1KQ1A 4ZTZB 1NJ6A 2G4CA 3TEGA 1SESA 4YYEA 4M77D 3SB2A 1ASYA 3V7CA 2E65A 1USYA 2ZR2A 5LJ3g 3M4QA 4NL3A 1H4VB 1USYC 4NL2A 2DQ3A 4TVAB 3I7FA 5K1XA 4N0AA 4M7DE 1YFTA 4N0AC 3HY0A 4PJOB 4C8QE 2DTOA 3QTCA 4UP9A 1HK9A 4F7UF 5LJ5j 2ZT6A 4M7DA 1NJ2A 3V8KA 1M8VA 1LNXA 5GAOn 4HA8A 1X01A 1N9RA 3JCMg 2QHVA 1E24A 5LJ5d 1B70B 3HXZA 4C92D 3A31A 1JRIA 4V2SA 2ZXFA 3JCMP 3JCMW 1KQ2A 1LOJA 3BDUA 4XU3A 5HGQA 2ZINA 4M77F 3JB9J 4G84A 4KR2A 4M7AB 4J6WA 1I4K1 3RESA 3VU3C 1PYSA 4H2VA 5GAOl 1H4QA 3HFZA 4YP0A 4WI1A 1WPYA 1JJCA 3A5YA 3RUXA 5GAMe 5GANh 1X2GA 4H2XA 3DSQA 3VQVA 4M77C 3TUPA 2RD1A 2ZIMA 3RGLA 1ASZA 5KNNA 5C53B 1MGQA 5GAOr 4CS4A 4M75G 4XTYA 4A54A 3HXVA 2ODRC 1NYRA 1LYLA 2DU7A 1U1TA 2RHSB 4C92F 1IL2A 4TWAA 4PHCA 2DVEA 4ZIBA 5GAMf 2E10A 3NEMA 4RMFA 1EOVA 2HNIA 2XTIA 4UPAA 2DQ0A 4XTZA 3RKWA 3OD1A 1KOGA 3SWNA 1QF6A 3RL6A 3P8VA 5GAN8 2ZR3A 4Q6GA 2FB7A 4TQFA 2PMFA 4XEOA 1YCYA 3EFSA 1I5LA 1EIYA 1N9WA 5F5WA 3FB9A 3MF1A 4HVCA 3RKYA 1WLEA 1ATIA 2DZCA 4M75E 1ADJA 3EFRA 4M78B 1YFSA 4EMKB 4L87A 3JB9I 4OP0A 5GAOq 3QO7A 3V8JA 1NJ1A 4H2TA 4MMLA 5GAN3 4H02A 4YREA 1I81A 4HWTA 3QO8A 5GANj 3RERA 4M7AG 2VXFA 4YRIA 3QO5A 3QHSA 3V7SA 4PJOE 4EMHA 3MF2A 3A7AA 4P72A 4P72C 4HT8A 5GMKe 1YB3A 5GMKm 2ZZGA 2DEQA 4QVCA 2I4NA 5K1PA 4YRJA 4UP8A 3JCMh 5GAMh 4C92B 1Y96B 4CH6A 4HT9A 3HRKA 2ZGWA 1NJ8A 4XTXA 3RIRA 3JB9G 4M7DF 1D3BB 4PG3A 2EWNA 4EX5A 4C8QF 4XEMA 5GMKi 1BIAA 3L4GB
chains in the Genus database with same CATH superfamily
1ZSGA 3QWYA 4RTVA 5HY6A 2DL4A 1GGMA 4R0KA 1X55A 4LNSA 1BCOA 1VQ4T 3MHXA 1N9SA 2DERA 2ZCEA 3VBBA 1S1NA 3R6OA 1YP5A 5C52B 4FIBA 1K0XA 2DZ9A 3PCOB 1MMGA 2ARUA 2ZNJA 4M7AC 4KQEA 2NLUA 2J7IA 4LDYA 1JXMA 3HPWA 2E41A 4IUPA 1XQHA 2KRNA 2F69A 1Y0MA 4J9BA 4Y91A 1RLQC 4ESRA 1M4ZA 1RAIB 3LSQA 1RAGB 2LQKA 4M78G 5GJWB 1OX8A 1QVPA 3SFMA 4WJ3M 1J5WA 2EYXA 4FU6A 2Y4YA 4J9FA 4AH6A 2RH2A 4YRGA 4KGZB 2QTXA 3PVLA 2E5AA 2V26A 3VS4A 2QQRA 2L89A 1M9SA 3TREA 1KMNA 1G3SA 5LJ5f 4Z89A 3R07A 1HYOA 1MNEA 4LVLA 1SHGA 1UGSB 1AWXA 1AHJB 1FXXA 1BI2A 2NS6A 1Z9QA 4IUQA 2C7IA 3EH1A 3VS7A 3CCUA 4Z88A 3O8VA 1K9AA 3L2VA 4M78E 1Q82U 1N6AA 4ELZC 1QKWA 4IUVA 3MEAA 2D6FA 1NLOC 2Z0WA 1H641 1H4TA 2VVKA 2HAXA 4M78A 2DE0X 1YHQQ 4J6XA 5GAOp 2KAFA 1Q7YU 2L8DA 2EVRA 1TTHB 1S72Q 4RTZA 2KGTA 2YLBA 5DM7R 2ARSA 3P8YA 3RR6A 4O2DA 1UEBA 4YRNA 2DBKA 2CKKA 2M1HA 2CUDA 2RHXA 1W70A 4M7AD 2Q7EA 4LUDA 2JS0A 3EH2A 2MOXA 4ZGEB 1YITQ 1YJWA 2CJ9A 1Y96A 3Q1JA 4NCXA 4M75A 1RUWA 1WQ7A 2QHUA 5LJ5h 3M0QA 4OMPA 4BE0A 2ZZEA 1RAAB 1VQKT 4QQGA 3P8TA 1BIBA 2DKGA 4HCBA 1N27A 3M56A 3CCRT 2WSFE 4D8DA 2QYZA 3A8OB 5CK9A 4HCCA 2Q7GA 2JTEA 2EFIA 3JCMb 4PL6A 3OYEA 1W66A 4N4IA 1E22A 2GCXA 3FJ5A 3QUIA 4RG2A 4XQ3A 1KC8R 1K8AR 2GQVA 1YJNA 4XTWA 3REUA 1D0XA 2XD0A 2YLCA 1YJ9Q 2CSIA 4XTVA 4M7AF 4KULA 4ANJA 5LJ5g 3SD4A 2L0AA 3E9FA 1LJOA 4CS2A 3C0CA 3CCVA 2C0IA 4PKCC 2CJBA 2CDTA 3EHQA 2ED1A 2P4TA 4TVWA 3FJPA 2ZT5A 2EQJA 4X1VA 3HSBA 1MHNA 2LX7A 3ZFJA 2RF0A 3OSSC 1WHGA 2DF6A 1IB8A 1TG0A 1X75C 2JNGA 2P5IA 4EMGA 2G3RA 3OYBA 2EBPA 2K6DA 3RACA 2DXBA 2RQRA 3CXCP 5GAMj 2DIGA 2J6FA 4CH5A 3AHUA 1K76A 1I8FA 2DTIA 1PG5B 2KYBA 3I56Q 3P8DA 3E19A 1B8AA 3IALA 4P74C 3PGGA 2VWFA 2XGTA 1WIEA 2JN0A 1U3OA 3JCMX 2ALYA 2M0YA 3RNJA 3V7RA 1JBMA 3CCSA 3MP1A 1BU1A 2HCKA 1AWJA 4NOYA 4P75C 4HWSA 1VQLA 2DL8A 5FWCA 2P4RA 4JLGA 3TCJA 3UGQA 1VQOA 2EYZA 4DBQA 5J39A 5CAIA 2LQ8A 2V1QA 2QAZA 4EMKC 1OPKA 3CXCA 3QYHB 1VQ9A 5KH6A 3CCET 2ZTGA 3IG2A 3M0UA 2RA2A 1JJCB 2RN8A 1X54A 2A7YA 3HHTB 2CZ0B 2JUFA 2DETA 1WJRA 2XDPA 4WF2A 2QHSA 3WVEB 3OA6A 1ZSZB 2COZA 3BW1A 2RHUA 2CYZB 2L3PA 1QW1A 3HRSA 1BBUA 4K88A 2X9HA 1X69A 4B9XA 1YN8A 1N8RR 3GBQA 3W3SA 3DB3A 5GMKj 3TVTA 2EJ9A 5DLOA 1HSQA 3RKXA 3SWNB 1T0HA 3QBYA 4OMMA 2NYSA 4UC4A 1Q81C 2MI6A 5GAN5 2K5LA 1B7YA 4YRTA 3CD6Q 1Y57A 3VQWA 1YI2Q 1R77A 3GNFB 2O9SA 3I35A 3QKJA 3VS5A 2KYMA 2HBPA 3PNWC 4HCZA 1Y71A 3CPWS 2KRSA 1F1BB 2YSQA 3EG9B 3TEEA 3A74A 2EGCA 2KE9A 1WXBA 4LVIA 2CP2A 1IREB 2QEXA 4XU2A 1IGQA 2H3JA 5KYUB 4M75B 3A98A 2RHQA 4FW1A 2DL5A 4KRTA 4ZN3A 1ASYA 2RQVA 1RAHB 2QDLA 4L59A 2ZR2A 2O4XB 4NL3A 1LCKA 3I7FA 1Q82C 1ZA2B 2HL3A 3QTCA 1M3BA 1ZHIA 5C6SA 2ZT6A 3DKMA 1AZGB 1NJ2A 2LT1A 4BI4A 2EQIA 1ZBXA 5GAOn 2CT3A 2M9UA 4HA8A 1Q7YC 4DEXA 1X01A 2QTVA 4JS4A 3CC4T 3EAEA 1B70B 3A31A 2ZXFA 3JCMP 2PZ1A 1RACB 3BDUA 4XU3A 5HGQA 2ZINA 3CC2T 2COWA 5D6WA 1ZA1B 2XIDA 5D6XA 4EDUA 1PYSA 4H2VA 5GAOl 1H4QA 3HFZA 2ZAEA 4JZ4A 1G8XA 4QQDA 3A5YA 5IT9E 2X4JA 2P0PA 1PKTA 2EGEA 4PFOA 2AK5A 1X2GA 2RQUA 1NEGA 3M54A 2ZIMA 1ASZA 2ED0A 1MGQA 2BZYA 3QDFA 2DYBA 2L2PA 2D8HA 1M2VB 1YITA 3OYAA 3OS0A 1PHTA 1KC8U 4PHCA 5EC7A 2DVEA 4ZIBA 5GAMf 2E10A 4CC3A 1WA7A 2MIOA 3CCJT 1PSFA 2A08A 1JB0E 2XTIA 3URGA 1TWBA 2DQ0A 2BTTA 2EKOA 3CMAT 4D8KA 2XICA 2AHJB 1K1ZA 3JRZA 2KK4A 3RL6A 1K9MR 3P8VA 3S3NA 3HKSA 1CKBA 3CCUQ 3E1SA 4QT7A 3MQZA 3PE0A 1N9WA 5F5WA 3MF1A 1WLEA 2DZCA 3EFRA 2SRCA 1WJSA 1RAEB 1UUEA 1VQ8Q 4FYVB 2PVDB 5GAN3 4YREA 1H92A 2L3QA 2EYWA 2VXFA 3QHSA 4MZMA 1FYNA 2LJ0A 2OTJA 4HT8A 1K0SA 1YB3A 5I11A 2I4NA 4ZN1A 1YCSB 1VQNT 5GAMh 3MP6A 2DFUA 4CH6A 8AT1B 1YJWQ 4HT9A 1YFNA 3OBWA 4KH0B 3R6NA 2LX9A 4EPCA 3RIRA 4LD9K 2H8HA 1D3BB 3NTIA 5C0MA 2EWNA 1JJ2P 4HVWA 4XEMA 4DA4A 1BIAA 4RUGA 1PWTA 4BUGA 3LX7A 1G3TA 2ABLA 3THKA 1FX7A 5A0LA 3M0SA 2DPPB 4QQ6A 4JRPA 1E1TA 1M5Q1 1ZBJA 1W4SA 2ZCFB 4OB0B 3E9GA 3GF5A 4C8QC 2EL9A 4FCYA 2AZSA 4J9DA 3UWNA 3G4SA 5GAMg 1KK7A 4ORZA 1PC0A 4ZTFA 1Q86R 1M2OA 2DJQA 2FYKA 2CIMA 1X6GA 2AT1B 1EX4A 4EO4A 4ZTUB 3TEHA 3CCVQ 3BFMA 1GBQA 5LJ5e 1JJ2A 2ZT8A 1NYGA 1UHCA 3CCMA 1K73C 3IKLA 1ABOA 3HTRA 5LJ3d 1TH7A 2DLPA 2F1LA 1QMCA 3EGXB 4DBFA 5KCOA 4DBHA 3MEYA 4JLIA 2IG0A 3E9HA 5GMKh 3H8ZA 2KSSA 4GY5A 4QKUA 1H3ZA 4P74A 2RJEA 2EYYA 4DPGA 5GAOm 2DXUA 3M57A 1Q95G 1ZLMA 1S72T 2KT1A 3BE3A 1OV3A 4P75A 3NETA 4PJOG 1VOMA 4JJDA 4AG2C 4FT2A 4PK4A 3NMZC 4LDXA 3UFGA 3JB9H 3HXWA 1VQ6A 4RTUA 1M1KR 2PUKB 1YI2A 4YCWA 4M75F 2DL7A 3UA6A 3PZCA 1UGPB 1QKXA 2DA9A 3JAME 1M1GA 4AG1C 2QQAA 4M77B 3CCSQ 4C8QD 2XDDA 3GOXA 2C8MA 1VQLQ 1V76A 4BE1A 3BY7A 1VYTA 3EG3A 4P3NA 2LRQA 2QI2A 5I2SA 1VQ9Q 2VASA 3VQXA 4YRFA 4CH4A 5DY9A 1VQKA 3U23A 2MAMA 3CCRA 2G6FX 2E12A 1VQMA 2ZZFA 3CMEQ 3QSUA 4X34A 4PJOA 2M51A 4YRRA 3CCQT 2HEQA 2QGGA 1GBRA 3L2UA 4PNOA 3L2RA 1SETA 3FIFA 1ABQA 1HXDA 4HXJA 3M4PA 1X2QA 1G2BA 4BWAA 4F7UG 1HC7A 1BKBA 2KR3A 2MYSA 4RKUE 2PU9B 2EGAA 4F16A 2JOYA 4J15A 4P71C 4GLMA 4FYYB 1M90C 2CP0A 3LH0A 2KNBB 4MZPA 5D6YA 2YRDA 1WHMA 2X3XD 2AMCA 4YCVA 1KG1A 4AFSC 5CO7A 5KYWB 3RBBB 5KYXB 4FM4B 5IH2A 1OQKA 3QPHA 2QEXQ 2AKWA 3HFVA 1KJWA 3WVDB 1M3CA 4EIKA 1PRLC 3FEOA 1AVZC 1V29B 4C0DC 4F7UE 2EIFA 1K9MU 1WU7A 5HCKA 1UFFA 1KIKA 2P0LA 1I07A 1QVFP 1X6BA 2JVVA 5IAYA 4F7UA 4RCCA 3S3MA 4IUUA 2VV5A 4YPFA 1B34A 5FRMA 2A28A 4M7DB 2CREA 4PJNA 1TU0B 2EQKA 2YRCA 1WXUA 2EJFA 1JEGA 3OYFA 3I55Q 2VYTA 2QA4T 4BB7A 4TVYA 1WQWA 1E7OA 2IY5A 1ADYA 3TEHB 3DB4A 2FPFA 3PIOA 1M30A 2RI5A 2J6OA 2J3LA 2W0ZA 2QXFA 4ZNXA 1VQ8A 4CH3A 2M16A 2FVUA 3M4GA 2K2MA 4M4ZA 2FO0A 1VQ5Q 2MPXC 4PLIA 1HTTA 2X35A 4JJNK 3HRUA 4IKFA 2QG9B 5CQXA 3HFOA 2RK2A 3G7ZA 2RPNA 9ATCB 1SRMA 1NE8A 4RTTA 4C92C 2XKOC 3VV0A 5J26A 2VXEA 5GJVB 3CBPA 3VS0A 3RDVA 3VS1A 3OY9A 2P84A 4BI8B 3JCMQ 1BBWA 1EQRA 3INZA 4IIMA 2W10A 2AIRB 2HKNA 3OYMA 3L2QA 2V8JA 1VIFA 5GMKl 1Z7NA 1M3AA 5CKDA 4RCBA 4YRQA 4FSSA 4XU0A 4C8QG 4YRCA 3CXCS 1RI9A 2DTHA 2PQWA 5IHIA 4JS5A 2I2LA 3A5ZA 4X9CA 4DQ2A 3MJXA 4KR3A 1G83A 2CZ6B 2KY9A 2OI3A 4AFUC 5I22A 2K5FA 3PVQA 2DJZA 3E2UA 2DXCA 5L23A 2O2OA 1NJ6A 4RTYA 4M77D 2DAQA 5CR2A 3G6ET 2XU8A 3A8MB 3CCLA 3M4QA 4Z8AA 2OTJQ 1H4VB 1USYC 1O75A 4N0AA 3MP8A 4BDZA 4CC7A 3TU4K 4PJOB 1MUZA 1PKSA 4C8QE 2DTOA 3HP9A 1HK9A 1VQPA 2RJDA 2DM1A 2RI2A 2NUPB 1V1CA 1M8VA 2BZXA 2H3EB 1LNXA 1QP3A 2B8AA 1VQ7T 3M4YA 1N9RA 3WXMB 4AFZC 3CC4A 3I5RA 2IVWA 5FLXE 1UGVA 2O01E 3HXZA 4C92D 1BI3A 4V2SA 3JCMW 1UJ0A 1LOJA 1U5SA 1NJIU 1GRIA 4M77F 3JB9J 4KR2A 4BACA 2K9GA 1C0MA 1VYVA 3MPUB 1SSFA 3G4SQ 3QIIA 1ZUKA 3VRZA 4L5GA 1WPYA 3M0RA 3RUXA 3A8LB 3H0HA 2LMJA 5GAMe 3DSQA 1J3TA 1OX9A 3MCAB 5KNNA 1KD1U 5GAOr 1AD5A 3CCMQ 4A54A 3SEMA 2ODRC 3H0IA 2IPOB 4C92F 2RNAA 2XI9A 2BE9B 1N5ZA 2OX7A 1E6GA 1WYXA 3I9QA 1SEMA 2ROLA 2P0QA 3CMEA 4XTZA 3CMAA 4FYXB 4A4KA 2K3YA 4BY6B 1QF6A 1D1AA 2RO0A 3TQ7P 5GAN8 2D0QB 4Q6GA 1UECA 4TQFA 2JTFA 3O5ZA 4DOVA 2LNHB 2CP5A 4R56A 4XEOA 2ESWA 1EIYA 1W6XA 2LZ6B 2PVGB 1MMNA 4HVCA 3FLGA 3C95A 2K3BA 3OS2A 1ADJA 3G1JA 3UDCA 4M78B 1NEBA 4OP0A 5ECAA 3QO7A 1YJWT 1VQ6Q 4P5NA 1NJ1A 1G5VA 4H2TA 5GANj 4M7AG 2COYA 4YRIA 4N4HA 3QO5A 1I0CA 2X51A 1RL2A 4A4EA 2PTKA 2D0NA 4P72C 5GMKe 5GMKm 4Z02A 3KUFA 1VQNA 1UDLA 3NGPA 1Y96B 3HRKA 2X4WA 2ZGWA 2KRMA 1NG2A 4XTXA 4M7DF 4HCKA 1YJNT 1VQKQ 1OU8A 3NTKA 4EX5A 2A37A 5GMKi 4BDYA 1BI0A 3ZBDA 3CCRQ 1VQMQ 2ODRD 3VRYA 3PT9A 2CP6A 2L3RA 1SRYA 3S3OA 4M7AE 1I1JA 1UB4A 1WHLA 3UGTA 4CC2A 4M7AA 2C0TA 1T0JA 3H41A 3I55A 2QK0A 2LDMA 2J06A 4JRIA 5LJ3j 4C5EA 4J9CA 3G1ZA 1G3WA 2YDLA 3LWIA 2KROA 3FDRA 2YHTA 1UGRB 2OTLA 1QVGP 2KI7A 4PJJA 2O88A 2ZPEB 3LGFA 4TTVA 4E7SA 1GL5A 3CMQA 2LJ1A 3REBB 2QASA 2DIQA 3EHRA 3PFSA 1VQ5A 5KE3A 2NUZA 2FZKB 3T9NA 2RHSA 2K57A 3G71T 1NYQA 1VQZA 3VS2A 3VS6A 4ATOA 4OGEA 1NLPC 1KMMA 1YBYA 1WHJA 2E6ZA 3NPFA 4MDWA 1AZEA 3REXA 4C5HA 4J6YA 1NBEB 2DXTA 3OS1A 4C92G 4YTLA 1ZSZC 1KQSP 2VGMA 4BY6C 3ERRA 2Q5IA 1H3HA 1K8AU 4OB2B 3UF4A 5GAN2 3LC0A 4G85A 3CCST 3MEUA 3JCMc 1C1AA 4DOWA 1VQOT 1EIFA 3HL8A 3SWNC 1E6HA 1WLPB 3VYHB 2VUBA 2CGHA 1JJ2S 1PNJA 4MZTA 1FMWA 2QQSA 1JO8A 2IIMA 1CKAA 1H4SA 1D1BA 2JXBA 4QVZA 1VQ9T 2ALYB 2BKDN 3CC7T 2NUTA 1U1SA 4KGVB 3MO8A 4WCIA 4C92E 2KXCA 2FL7A 4CI0C 1KQSA 4R55A 1Q81R 1A0NB 4LDVA 1YIJA 4C5GA 2DD5A 1PSEA 5KYYA 3M0TA 2QDYB 1NPRA 3RF1A 2OAUA 1NPPA 2ZT7A 4MDXA 4M75C 2GNCA 12ASA 1EVKA 1YGBA 3V8LA 5FU6B 4LVJA 2AKLA 2EQMA 3L4GA 1FMVA 4TVAA 2ZPIB 5GANd 3JB9D 4RDXA 3CCQA 2RQTA 2MWOA 3OYJA 2DU5A 3HTZA 3MEWA 2I4OA 3HY1A 3PCOA 1Q82R 3L2ZA 2A36A 3QNEA 1TUCA 1SG5A 5CQYA 3C94A 3OYCA 2Y90A 3OSVA 1Y7XA 4GLKA 1VQ4A 4KBMB 2QEXT 4YDQA 4E7JA 4O6JA 1KD1C 4LVKA 1B7YB 2D8JA 3X24B 5E3IA 2LTOA 3LSSA 4YCUA 1Q7YR 1SSHA 2D9TA 2CT4A 4XK8E 5FW9A 5GANf 2ARTA 2J05A 2NWMA 3QO3A 4E51A 4BW9A 2CS7A 4M78D 3VJPA 3JB9F 2LCSA 2ZNIA 1M1FA 3D7SB 1EZZB 1EFWA 3A8GB 2RHQB 1XTDA 2KDSA 4JJBA 3X28B 1E1OA 3L2WA 3IKMB 5AT1B 2X3WD 2QGFB 4RG8A 3TSWA 2HMAA 4YRKA 3CCLQ 4J9IA 4DEYA 1N8RU 4B6MA 1SRLA 4LD6A 1MV0B 4M75D 1VYUA 2CUBA 3QG1A 4AMCA 1VQPQ 1D0ZA 1TS9A 4PFZA 1YFRA 3JCMd 1Z7MA 1YHQT 3QXEB 1WI7A 2ZPFB 2GFUA 4M78F 5J3BA 2KMTA 3CC4Q 3RMQA 3H6ZA 7AT1B 1U8RA 2MF2A 5LJ3f 1M8MA 2Q5HA 3OYYA 5EG2A 2EW3A 5GAN7 2M02A 1HJDA 3DLMA 1BB9A 4IUTA 4ZGJB 2AZVA 1AT1B 4EMKA 4F14A 2JMAA 1T3SA 3JCMJ 1YITT 1PYSB 2FG0A 3HFZB 4XAXB 5A0DA 1AOJA 1QCFA 3JCMf 4OB1B 1IO6A 2QHTA 2JJ9A 1O9SA 1NNHA 1KFZA 4JZ3A 2RB6A 3ZEHA 4AT1B 1UG1A 5GANg 4P73C 4JRKA 4LDUA 2SEMA 4CRIA 3OYDA 4WJ4A 4H2UA 4PLLA 2VKNA 3WQZA 1YJ9T 4H2WA 5C51B 3CMAQ 3OBYA 5LJ3h 11ASA 4E7IA 4JPBW 4JJCA 2NUTB 2KXDA 1X2HA 2KBTA 4RQFA 1P92A 2DBMA 2DDZA 1UHFA 2I4LA 2YXYA 3HXYA 3GPLA 2EJGA 2OTJT 4ME7A 3A32A 3VYGA 1G51A 4J9GA 2CP7A 5ELOA 3QJ6A 3JSCA 3EG1A 1KQ1A 1MMDA 1SESA 4YYEA 4LDWA 3OW2P 3V7CA 1KC8C 4F17A 3G6EA 2JMCA 2R57A 5LJ3g 4TVAB 3M59A 4HVVA 2DQ3A 4Y28E 4OMNA 1YFTA 3LH5A 1HD3A 1QCNA 1VQNQ 1VUBA 1NZ9A 1RADB 2JM9A 2FZCB 1IHVA 1PCXA 3ER0A 1K73R 5I2MA 1QQJA 2PUOB 3I56T 2HQXA 4LNPA 1VQ7A 1XOVA 3JCMg 3G4ST 2E5QA 4LUEA 5LJ5d 2E3IA 2GFAA 3SHWA 3J80E 4E2FB 1JRIA 1OZ2A 2LJ3A 2ZPGB 1KQ2A 2JT4A 2MK5A 5A0GA 3HRTA 1W2BP 1Q81U 3OQ5A 3OW2A 4G84A 1X43A 3CCMT 2A3LA 3TSZA 4J6WA 1I4K1 3RESA 3VU3C 1D0YA 5KCHA 2XG8D 4YP0A 2BZ8A 4WI1A 3MKDA 4K11A 2GTJA 3CQTA 4JDSA 1JJCA 3M53A 5FROA 4H2XA 2CZ7B 3VQVA 2OTLQ 4M77C 2QQBA 1ZSZA 2YWWA 5CKHA 4J7IA 4CS4A 1TXQA 4M75G 1RI0A 4RTWA 3HXVA 1LPLA 1NYRA 1QVFA 1SHFA 3M5AA 1LYLA 2DU7A 3CCEA 1UE9A 1U1TA 3UPUA 2DK3A 4KGXB 2BUDA 3ULRB 3OYGA 1W2BA 2JS2A 2KQWA 1R0BG 4IURA 2EPDA 4O5VA 3OMGA 3QDRB 4OMQA 3RKWA 1KOGA 3SWNA 1I5OB 1VQ6T 2PVOB 1X27A 5AYFA 3CD6T 1YI2T 1I5LA 2RJFA 3FB9A 1Q86U 2HKQB 2FRWA 2L5QA 3RKYA 3EG9A 1T3LA 2XMFA 3L42A 4M75E 4LE9A 2C06A 1TOVA 4II1A 4EMKB 1OULA 4L87A 5GAOq 5KYUA 2R58A 4MMLA 5LL6S 4QW2A 1I81A 4HWTA 2ROTA 1PM3A 1ZUUA 2AKKA 1YNZA 2WSCE 3S6WA 3V7SA 1N8RC 3EGDA 3MF2A 2O4XA 1VQMT 2ZZGA 2DEQA 4QVCA 1RABB 4ZTJA 5K1PA 1JU5C 1YIJQ 4YRJA 1M90R 4UP8A 2E70A 2K4YA 1WFWA 3FRNA 3F70A 3REAB 2HSPA 4E7KA 1X2KA 4PG3A 3BDLA 4LXCA 5D7UA 1WX6A 2YUPA 1OEBA 4XU1A 1B70A 2RHZA 1QWFA 3P8BB 1FMKA 3JV3A 3KFVA 3CCQQ 5GAN4 4OGCA 4PJLA 1QWEA 2RJCA 4M7DC 4C8QA 2RHYA 3ME9A 3VQYA 2KEAA 3LLRA 1WNLA 1M1KU 2PNIA 5CVIA 4H2SA 2HSEB 3M55A 1OPLA 1WXTA 1VQ4Q 2JW4A 4HVUA 4C0GA 4BD3A 2QQ9A 3CC2A 4XTUA 4YRSA 2HDAA 2DL3A 4UP7A 5IXBA 1M2VA 2AMCB 2E1HA 2GBQA 5IN1A 3C12A 1GXIE 3G71A 1QP2A 4VUBA 4RMOA 2A0FB 3HXUA 1L0WA 2AKWB 4AFQC 2JTMA 4YRPA 4FL6A 1MV3A 2K79A 2F2XA 2LCCA 1NM7A 1TSFA 1GCQC 1VIEA 2JM8A 3A1PA 4J5YA 2CJAA 2O9VA 3AT1B 3BJUA 1M27C 4YRLA 3QWXX 3CCUT 3LYIA 4F7UB 6AT1B 4C5IA 5A2QE 3CCJA 2LNVA 2J3MA 3N5BB 5FU7B 1B34B 3M0PA 3CPFA 4K86A 2DRMA 3META 3I5SA 1KSWA 2DD4A 3EGUA 4FT4A 4P3OA 2WACA 4E7HA 1VQ8T 2F5TX 5IHKA 2FZGB 3CC7A 3QJYA 2QA4Q 4RQEA 1QE0A 2DVJA 2YRVA 1RIQA 2R5AA 2IY5B 2L3SA 1C6VX 3M9QA 4K87A 4M7DD 4H2XB 3OYKA 3QYGB 3X20B 3MEVA 2EKHA 4J9EA 1WGSA 4N4GA 3LW5E 1B7TA 4ZGDB 4F04B 2FRYA 3PTAA 1IZ6A 4P73A 1WHHA 1K73U 1ZUYA 3KFUA 3NELA 1D1CA 2V1RA 1K9MC 2GTOA 3OYLA 1Y07A 1D3BA 1FWZA 2FEIA 3JCMV 4HKEA 1QVGS 4TQDA 3GNGA 4PFPA 3DLLA 1MMAA 4HWOA 1SERA 2DX1A 2ZPHB 3J7AF 5ELNA 4PJOC 1UGQB 4J7FA 1U06A 4BE2A 2FPDA 4MMKA 4B9WA 5GANe 2KT8A 4X9DA 2K3XA 1GFDA 2E5KA 2ATCB 4KUIA 3NFCA 4OF1A 3HXXA 1KQSS 5CKEA 3NENA 5I21A 5FWBA 3FC3A 2Q7HA 4P71A 2RM4A 4OMFB 3VKIA 3CCVT 4H2YA 2X4XA 2DYIA 2HZYA 3H9NA 4LVMA 2EAYA 4J9HA 1C0AA 1TUDA 2F5KA 2WSEE 2P0KA 3A5ZB 3EGDB 5GAN6 3EGXA 3CCLT 3NTHA 4FYWB 1GFCA 2F2VA 4A53A 4E6RA 5FRNA 4TVRA 4RTXA 4M77G 2DMOA 2E3CA 2I4MA 2EQUA 2LVMA 3QZ5B 2LQWA 1ARKA 1VQPT 1KHIA 1PD1A 2V8IA 3E9IA 4OLFA 3HFNA 2D1XA 1ZX6A 2E4HA 4DBRA 3G6EQ 2CH4W 2MWPA 3CBOA 4NS5A 1WYDA 2ZZDA 1X56A 2K2VA 1Q86C 1NYFA 3KXTA 2PMEA 1G5HA 5LJ3e 2K5IA 2BIVA 2LQNA 5IXFA 3CPWP 3EFOA 5FU7C 4KUDK 4C8QB 5GAMd 3OYIA 1YHQA 1VQ7Q 2F2WA 3HRIA 3OMCA 2E6NA 1UJYA 5CKBA 1G5IA 2OJ2A 4M77E 4PJOD 2HBWA 5KYNA 3PMTA 1S72A 4HWPA 1QVGA 4KH1B 1IHWA 4YROA 3JCMe 4OB3B 2O31A 2DRKA 4CS3A 4Q15A 4WTOB 1WHKA 4M77A 1NJ5A 1B76A 1VQLT 1M90U 4M78C 1QLYA 1OU9A 1SF9A 1EFNA 5CKFA 1TUGB 1B07A 2E64A 2LC4A 2OAWA 4QVDA 3PIPA 2ZIOA 1JXOA 1JQQA 3CPWA 2ZPBB 1PD0A 4E7LA 1R0CB 3CMET 1CSKA 3CBMA 4FSXA 4A4HA 5IHNA 1W1FA 4P3PA 3LWHA 2LP5A 4C92A 4PJOF 2XK0A 3CCEQ 4JRQA 3GIBA 1WDXA 2X4YA 1BK2A 4CC4B 4A4FA 3X25B 3SDZA 1M1KC 5KE2A 1K4US 1OZ3A 2VGNA 3A8HB 1VA7A 1YJ9A 3IQLA 4PJMA 1OI1A 4HWRA 3ICAA 1MNDA 2VC8A 1DJ7B 1NJIC 4M7DG 1YWPA 3NHNA 4IIOA 3VS3A 2FPEA 4OMLA 4OMOA 2ECZA 4Q5WA 3CEYA 1EIYB 2ENMA 3L1AA 3A7UA 2J6KA 4X5OA 2GF7A 4JUVA 3EG0A 1QCOA 4E7ZA 1FYFA 3X26B 2GGRA 4Y92A 5KYWA 1OOTA 3OYNA 5KYXA 1EVLA 1BCMA 1AWOA 2RQWA 2DNUA 3UH0A 4YRMA 3A7RA 4ZTZB 2V8KA 4GBQA 2G4CA 3GLXA 3TEGA 3SB2A 3P8HA 2E65A 2DILA 1USYA 4BI3A 3PMIA 2XHCA 4NL2A 4E47A 5K1XA 4M7DE 5HK3A 4N0AC 3HY0A 1AEYA 4UP9A 4F7UF 5LJ5j 1G3YA 2HQHA 4M7DA 2A8EA 3I56A 2RI3A 3V8KA 1YJNQ 3KBGA 4J83A 2HD0A 4L6V5 2QHVA 1E24A 3I55T 3ASKA 2Y4XA 3M58A 2OTLT 3QZ9B 3VUBA 1RAFB 3ZL7C 1BYMA 1AWWA 5L8RE 4M7AB 2DEUA 1VQ5T 2QA4A 2RMOA 2JZ2A 3LGLA 2CP3A 2YUNA 2E3HA 5GANh 1D09B 2LT4A 2M0OA 1LVKA 2BE7D 1XNIA 3TUPA 2RD1A 3CC2Q 1IRXA 3RGLA 1SKUB 5C53B 3J81E 4C0DB 2R5MA 1ACMB 1GCQA 2CH4A 2VB6A 4XTYA 3OYHA 4A4GA 1R8OB 8ATCB 1IXDA 1PRMC 3UT1A 3OB9A 5CCAA 3C4SA 1H8KA 2RHSB 1IL2A 4TWAA 2YUOA 3G71Q 2I0NA 3OS5A 3NEMA 4RMFA 4C0ZA 4OVAA 2RK1A 4D6WA 5HK0A 5FU6C 1EOVA 2HNIA 3EFOB 1RLPC 4UPAA 1X6OA 1ZQ1A 3OD1A 1Z9ZA 3OW2S 4FW2A 3H0FA 2EYQA 4LN2A 5DLQE 2CZ1B 1UTIA 4A63B 2ZR3A 1SPKA 2FB7A 2GQIA 1BI1A 3CD6A 2PMFA 2RHIA 2MMPA 5HKCA 2MCNA 1WJQA 1YCYA 3EFSA 3UATA 3CCJQ 2DO3A 1BBZA 1ATIA 2XDBA 1NJIR 2B86A 3GP8A 1YFSA 1VQOQ 3UA7A 1YIJT 3JB9I 1GCPA 1YWOA 2YUQA 3EG2A 3V8JA 1QVFS 4H02A 2FHDA 3CC7Q 1KHCA 3QO8A 3RERA 2CSQA 1WZOA 2KVQG 2HL5C 4PJOE 4KT0E 2C0OA 4EMHA 5M9OA 4P72A 3A7AA 1W2BS 2K7AA 1B3QA 2LCLA 5CIUA 4C0FA 4J8OA 4ELYC 5KYYB 1KD1R 3VUZA 3JCMh 4C92B 1IGUA 1XJWB 2NUPA 1NJ8A 3JB9G 2YT6A 3RMSA 1K8AC 4C8QF 1OYXA 4HT4A 3L4GB 2HQEA
chains in the Genus database with same CATH topology
5HY6A 1GGMA 1X55A 4LNSA 1VQ4T 3MHXA 1N9SA 2ZCEA 3VBBA 3R6OA 5C52B 4FIBA 2DZ9A 3PCOB 2ARUA 2ZNJA 4M7AC 4KQEA 2NLUA 4LDYA 3HPWA 2E41A 4IUPA 1XQHA 2F69A 4Y91A 1M4ZA 3LSQA 2LQKA 4M78G 3SFMA 1QVPA 4WJ3M 1J5WA 4FU6A 2Y4YA 4AH6A 2RH2A 4YRGA 2QTXA 2E5AA 2QQRA 2L89A 1M9SA 3TREA 1KMNA 1G3SA 5LJ5f 3R07A 4LVLA 1UGSB 1AHJB 1FXXA 1BI2A 2NS6A 4IUQA 2C7IA 3CCUA 3O8VA 3L2VA 4M78E 1Q82U 1N6AA 4ELZC 4IUVA 3MEAA 2D6FA 1H4TA 1H641 2HAXA 4M78A 4J6XA 5GAOp 2KAFA 1Q7YU 2L8DA 5DM7R 2YLBA 2ARSA 3P8YA 4O2DA 1UEBA 4YRNA 2CKKA 2M1HA 2RHXA 4M7AD 2Q7EA 4ZGEB 1YJWA 2CJ9A 1Y96A 3Q1JA 4NCXA 4M75A 1WQ7A 2QHUA 5LJ5h 4BE0A 2ZZEA 1VQKT 4QQGA 3P8TA 1BIBA 2DKGA 4HCBA 1N27A 3M56A 3CCRT 2WSFE 3A8OB 5CK9A 4HCCA 2Q7GA 2EFIA 3JCMb 4PL6A 3OYEA 1W66A 4N4IA 1E22A 2GCXA 3QUIA 4RG2A 4XQ3A 2GQVA 1YJNA 4XTWA 3REUA 2XD0A 2YLCA 4XTVA 4M7AF 4KULA 5LJ5g 3SD4A 3E9FA 1LJOA 4CS2A 3CCVA 4PKCC 2CJBA 2P4TA 4TVWA 3FJPA 2ZT5A 2EQJA 3HSBA 1MHNA 3ZFJA 3OSSC 1X75C 2JNGA 2P5IA 4EMGA 2G3RA 3OYBA 3RACA 2DXBA 5GAMj 2DIGA 4CH5A 3AHUA 1I8FA 2DTIA 3P8DA 3E19A 1B8AA 3IALA 4P74C 3PGGA 2XGTA 2JN0A 3JCMX 2ALYA 3V7RA 1JBMA 3CCSA 3MP1A 4P75C 4NOYA 4HWSA 1VQLA 4JLGA 3TCJA 3UGQA 1VQOA 5J39A 5CAIA 2LQ8A 4EMKC 3CXCA 3QYHB 1VQ9A 5KH6A 3CCET 2ZTGA 3IG2A 2RA2A 1JJCB 1X54A 2A7YA 3HHTB 2CZ0B 2JUFA 1WJRA 2XDPA 4WF2A 2QHSA 3WVEB 3OA6A 3BW1A 2RHUA 2CYZB 1QW1A 3HRSA 1BBUA 4K88A 4B9XA 3W3SA 3DB3A 5GMKj 2EJ9A 5DLOA 3RKXA 3SWNB 3QBYA 4UC4A 1Q81C 2MI6A 5GAN5 2K5LA 1B7YA 4YRTA 3VQWA 3GNFB 3QKJA 2HBPA 3PNWC 4HCZA 1Y71A 3CPWS 3TEEA 3A74A 4LVIA 1IREB 2QEXA 4XU2A 2H3JA 4M75B 2RHQA 4ZN3A 1ASYA 4L59A 2ZR2A 2O4XB 4NL3A 3I7FA 1Q82C 3QTCA 1ZHIA 5C6SA 2ZT6A 3DKMA 1NJ2A 2LT1A 4BI4A 1ZBXA 5GAOn 2M9UA 4HA8A 1Q7YC 1X01A 4JS4A 3CC4T 3EAEA 1B70B 3A31A 2ZXFA 3JCMP 3BDUA 4XU3A 5HGQA 2ZINA 3CC2T 5D6WA 2XIDA 5D6XA 4EDUA 1PYSA 4H2VA 5GAOl 1H4QA 3HFZA 4QQDA 3A5YA 5IT9E 2X4JA 2P0PA 1X2GA 3M54A 2ZIMA 1ASZA 1MGQA 1YITA 3OYAA 3OS0A 1KC8U 4PHCA 2DVEA 4ZIBA 5GAMf 2E10A 3CCJT 1PSFA 1JB0E 2XTIA 3URGA 2DQ0A 2EKOA 3CMAT 2XICA 2AHJB 3JRZA 2KK4A 3RL6A 3P8VA 3S3NA 3HKSA 3E1SA 3MQZA 1N9WA 5F5WA 3MF1A 1WLEA 2DZCA 3EFRA 1WJSA 2PVDB 5GAN3 4YREA 2VXFA 3QHSA 4MZMA 2OTJA 4HT8A 1YB3A 2I4NA 4ZN1A 1VQNT 5GAMh 3MP6A 4CH6A 4HT9A 3OBWA 2LX9A 4EPCA 3RIRA 4LD9K 1D3BB 3NTIA 5C0MA 2EWNA 4XEMA 4DA4A 1BIAA 4BUGA 3LX7A 1G3TA 5A0LA 1FX7A 2DPPB 4QQ6A 4JRPA 1E1TA 1M5Q1 1W4SA 2ZCFB 4OB0B 3E9GA 3GF5A 4C8QC 2EL9A 3UWNA 3G4SA 5GAMg 4ZTFA 2FYKA 2CIMA 4EO4A 4ZTUB 3TEHA 3BFMA 5LJ5e 1JJ2A 2ZT8A 3CCMA 3IKLA 1K73C 5LJ3d 1TH7A 5KCOA 3MEYA 4JLIA 2IG0A 3E9HA 5GMKh 3H8ZA 2KSSA 4GY5A 1H3ZA 4P74A 2RJEA 4DPGA 5GAOm 2DXUA 3M57A 1S72T 4P75A 3NETA 4PJOG 4FT2A 4LDXA 3UFGA 3JB9H 3HXWA 1VQ6A 2PUKB 1YI2A 4YCWA 4M75F 3PZCA 1UGPB 3JAME 1M1GA 2QQAA 4M77B 4C8QD 2XDDA 3GOXA 2C8MA 4BE1A 3BY7A 4P3NA 2LRQA 2QI2A 5I2SA 3VQXA 4YRFA 4CH4A 5DY9A 1VQKA 2MAMA 3CCRA 2E12A 1VQMA 2ZZFA 3QSUA 4X34A 4PJOA 4YRRA 3CCQT 3L2UA 4PNOA 3L2RA 1SETA 3FIFA 1HXDA 3M4PA 4BWAA 4F7UG 1HC7A 1BKBA 4RKUE 2PU9B 2JOYA 4J15A 4P71C 1M90C 3LH0A 4MZPA 5D6YA 2AMCA 4YCVA 1KG1A 5CO7A 4FM4B 3QPHA 2AKWA 3HFVA 3WVDB 3FEOA 1V29B 4C0DC 4F7UE 2EIFA 1K9MU 1WU7A 2P0LA 2JVVA 5IAYA 4F7UA 4RCCA 3S3MA 4IUUA 2VV5A 4YPFA 1B34A 5FRMA 4M7DB 2EQKA 2EJFA 3OYFA 2VYTA 2QA4T 4BB7A 4TVYA 1WQWA 2IY5A 1ADYA 3TEHB 3DB4A 3PIOA 2RI5A 2J3LA 2QXFA 1VQ8A 4CH3A 2M16A 2FVUA 3M4GA 1HTTA 4PLIA 2X35A 4JJNK 3HRUA 4IKFA 5CQXA 3HFOA 2RK2A 3G7ZA 1NE8A 4C92C 2XKOC 3VV0A 5J26A 2VXEA 3CBPA 3OY9A 4BI8B 3JCMQ 1BBWA 1EQRA 3INZA 3OYMA 3L2QA 2V8JA 1VIFA 5GMKl 1Z7NA 5CKDA 4RCBA 4YRQA 4XU0A 4C8QG 4YRCA 3CXCS 2DTHA 2PQWA 4JS5A 2I2LA 3A5ZA 4X9CA 4DQ2A 4KR3A 2CZ6B 2KY9A 2K5FA 2DJZA 2DXCA 1NJ6A 4M77D 2DAQA 5CR2A 3G6ET 2XU8A 3A8MB 3CCLA 3M4QA 1H4VB 1USYC 1O75A 4N0AA 3MP8A 4BDZA 3TU4K 4PJOB 4C8QE 2DTOA 3HP9A 1HK9A 1VQPA 2RJDA 2RI2A 1M8VA 1LNXA 1QP3A 2B8AA 1VQ7T 3M4YA 1N9RA 3WXMB 3CC4A 2IVWA 5FLXE 2O01E 3HXZA 4C92D 1BI3A 4V2SA 3JCMW 1LOJA 1NJIU 4M77F 3JB9J 4KR2A 4BACA 1SSFA 3QIIA 4L5GA 1WPYA 3RUXA 3A8LB 5GAMe 3DSQA 3MCAB 5KNNA 1KD1U 5GAOr 4A54A 2ODRC 4C92F 2XI9A 2P0QA 3CMEA 4XTZA 3CMAA 4A4KA 2K3YA 4BY6B 1QF6A 2RO0A 5GAN8 2D0QB 4Q6GA 4TQFA 2JTFA 4DOVA 4R56A 4XEOA 1EIYA 2PVGB 4HVCA 3FLGA 3C95A 3OS2A 1ADJA 3UDCA 4M78B 4OP0A 3QO7A 1YJWT 1NJ1A 4P5NA 4H2TA 1G5VA 5GANj 4M7AG 4YRIA 4N4HA 3QO5A 1RL2A 4A4EA 4P72C 5GMKe 5GMKm 4Z02A 3KUFA 1VQNA 1Y96B 3HRKA 2X4WA 2ZGWA 4XTXA 4M7DF 1YJNT 3NTKA 4EX5A 5GMKi 4BDYA 3ZBDA 1BI0A 2ODRD 3PT9A 2L3RA 1SRYA 3S3OA 4M7AE 1UB4A 3UGTA 4M7AA 3I55A 2LDMA 4JRIA 5LJ3j 4C5EA 3G1ZA 1G3WA 3LWIA 3FDRA 2YHTA 1UGRB 2OTLA 2ZPEB 3LGFA 4TTVA 3CMQA 2DIQA 3PFSA 1VQ5A 5KE3A 3T9NA 2RHSA 2K57A 3G71T 1NYQA 1VQZA 4ATOA 4OGEA 1KMMA 1YBYA 2E6ZA 4MDWA 3REXA 4C5HA 4J6YA 2DXTA 3OS1A 4C92G 4YTLA 2VGMA 4BY6C 3ERRA 2Q5IA 1K8AU 4OB2B 5GAN2 3LC0A 4G85A 3CCST 3MEUA 3JCMc 4DOWA 1VQOT 1EIFA 3HL8A 3SWNC 1JJ2S 3VYHB 2VUBA 2CGHA 4MZTA 2QQSA 1H4SA 2ALYB 4QVZA 1VQ9T 2BKDN 3CC7T 1U1SA 3MO8A 4C92E 2FL7A 4CI0C 1KQSA 4R55A 4LDVA 1YIJA 4C5GA 2DD5A 1PSEA 2QDYB 1NPRA 3RF1A 2OAUA 1NPPA 2ZT7A 4MDXA 4M75C 12ASA 1EVKA 1YGBA 3V8LA 5FU6B 4LVJA 2EQMA 3L4GA 4TVAA 2ZPIB 5GANd 3JB9D 4RDXA 3CCQA 2MWOA 3OYJA 2DU5A 3HTZA 3MEWA 2I4OA 3HY1A 3PCOA 3L2ZA 3QNEA 5CQYA 3C94A 3OYCA 2Y90A 3OSVA 1Y7XA 4GLKA 1VQ4A 4KBMB 2QEXT 4YDQA 4E7JA 4O6JA 1KD1C 4LVKA 1B7YB 3X24B 5E3IA 2LTOA 3LSSA 4YCUA 2D9TA 4XK8E 5GANf 2ARTA 3QO3A 4E51A 4BW9A 2CS7A 4M78D 3VJPA 3JB9F 2ZNIA 1M1FA 1EFWA 3A8GB 2RHQB 1XTDA 2KDSA 3X28B 1E1OA 3L2WA 3IKMB 4RG8A 4YRKA 1N8RU 4LD6A 4M75D 3QG1A 1YFRA 3JCMd 1Z7MA 1YHQT 2ZPFB 3QXEB 4M78F 2GFUA 5J3BA 2KMTA 3RMQA 3H6ZA 1U8RA 2MF2A 5LJ3f 2Q5HA 3OYYA 5EG2A 5GAN7 3DLMA 4IUTA 4ZGJB 4EMKA 3JCMJ 1YITT 1PYSB 3HFZB 4XAXB 5A0DA 3JCMf 4OB1B 2QHTA 1O9SA 1NNHA 2RB6A 3ZEHA 5GANg 4P73C 4JRKA 4LDUA 4CRIA 3OYDA 4WJ4A 4H2UA 4PLLA 3WQZA 1YJ9T 4H2WA 5C51B 3OBYA 5LJ3h 11ASA 4E7IA 1X2HA 4RQFA 1P92A 2DDZA 2I4LA 3HXYA 3GPLA 2EJGA 2OTJT 4ME7A 3A32A 3VYGA 1G51A 5ELOA 3QJ6A 3JSCA 1KQ1A 1SESA 4YYEA 4LDWA 3V7CA 1KC8C 3G6EA 2R57A 5LJ3g 4TVAB 3M59A 2DQ3A 4Y28E 1YFTA 1VUBA 1NZ9A 3ER0A 5I2MA 2PUOB 3I56T 2HQXA 1VQ7A 1XOVA 3JCMg 3G4ST 2E5QA 5LJ5d 2GFAA 3J80E 1JRIA 1OZ2A 2ZPGB 1KQ2A 5A0GA 3HRTA 1Q81U 3OQ5A 3OW2A 4G84A 3CCMT 2A3LA 4J6WA 1I4K1 3RESA 3VU3C 5KCHA 2XG8D 4YP0A 4WI1A 4JDSA 1JJCA 3M53A 5FROA 4H2XA 2CZ7B 3VQVA 4M77C 2QQBA 5CKHA 4J7IA 4CS4A 4M75G 1RI0A 3HXVA 1NYRA 1QVFA 3M5AA 1LYLA 2DU7A 3CCEA 1U1TA 3UPUA 2DK3A 2BUDA 3OYGA 1W2BA 2KQWA 4IURA 4O5VA 3OMGA 3QDRB 3RKWA 1KOGA 3SWNA 1VQ6T 2PVOB 5AYFA 3CD6T 1YI2T 1I5LA 2RJFA 3FB9A 1Q86U 2L5QA 3RKYA 3L42A 4M75E 2C06A 4II1A 4EMKB 4L87A 5GAOq 2R58A 4MMLA 5LL6S 4QW2A 1I81A 4HWTA 2WSCE 3S6WA 3V7SA 1N8RC 3MF2A 2O4XA 1VQMT 2ZZGA 2DEQA 4QVCA 4ZTJA 5K1PA 4YRJA 4UP8A 2E70A 2K4YA 3FRNA 3F70A 4E7KA 4PG3A 3BDLA 4XU1A 1B70A 2RHZA 3P8BB 5GAN4 4OGCA 2RJCA 4M7DC 4C8QA 2RHYA 3ME9A 3VQYA 3LLRA 1WNLA 1M1KU 5CVIA 4H2SA 3M55A 4C0GA 4BD3A 2QQ9A 3CC2A 4XTUA 4YRSA 4UP7A 2AMCB 2E1HA 5IN1A 3C12A 1GXIE 3G71A 1QP2A 4VUBA 4RMOA 3HXUA 1L0WA 2AKWB 2JTMA 4YRPA 4FL6A 2LCCA 1VIEA 2CJAA 4J5YA 3BJUA 4YRLA 3CCUT 3LYIA 4F7UB 5A2QE 4C5IA 3CCJA 2LNVA 2J3MA 3N5BB 5FU7B 1B34B 4K86A 3CPFA 3META 2DD4A 4FT4A 4P3OA 2WACA 4E7HA 1VQ8T 2F5TX 3CC7A 3QJYA 4RQEA 1QE0A 2YRVA 1RIQA 2R5AA 2IY5B 3M9QA 4K87A 4M7DD 4H2XB 3OYKA 3QYGB 3X20B 3MEVA 1WGSA 4N4GA 3LW5E 4ZGDB 3PTAA 1IZ6A 4P73A 1K73U 3KFUA 3NELA 1K9MC 3OYLA 1Y07A 1D3BA 1FWZA 3JCMV 4HKEA 1QVGS 4TQDA 3GNGA 3DLLA 4HWOA 1SERA 2ZPHB 3J7AF 5ELNA 4PJOC 1UGQB 4J7FA 4BE2A 4MMKA 4B9WA 5GANe 4X9DA 2K3XA 4KUIA 3NFCA 4OF1A 3HXXA 1KQSS 5CKEA 3NENA 5I21A 3FC3A 2Q7HA 4P71A 2RM4A 4OMFB 3VKIA 3CCVT 4H2YA 2X4XA 4LVMA 2EAYA 1C0AA 2F5KA 2WSEE 2P0KA 3A5ZB 5GAN6 3CCLT 3NTHA 4A53A 5FRNA 4TVRA 4M77G 2E3CA 2I4MA 2EQUA 2LVMA 3QZ5B 1VQPT 1KHIA 2V8IA 3E9IA 4OLFA 3HFNA 2MWPA 3CBOA 4NS5A 1WYDA 2ZZDA 1X56A 2K2VA 1Q86C 3KXTA 2PMEA 1G5HA 5LJ3e 2K5IA 2BIVA 5FU7C 4KUDK 4C8QB 5GAMd 3OYIA 1YHQA 3HRIA 3OMCA 2E6NA 5CKBA 1G5IA 4M77E 4PJOD 1S72A 3PMTA 4HWPA 1QVGA 4YROA 3JCMe 4OB3B 4CS3A 4Q15A 4M77A 1NJ5A 1B76A 1VQLT 1M90U 4M78C 5CKFA 2E64A 2LC4A 4QVDA 3PIPA 2ZIOA 3CPWA 2ZPBB 4E7LA 3CMET 3CBMA 4FSXA 4A4HA 4P3PA 3LWHA 4C92A 4PJOF 2XK0A 4JRQA 3GIBA 2X4YA 4A4FA 3X25B 3SDZA 1M1KC 5KE2A 1OZ3A 2VGNA 3A8HB 1YJ9A 1OI1A 4HWRA 3ICAA 2VC8A 1DJ7B 1NJIC 4M7DG 4Q5WA 3CEYA 1EIYB 3L1AA 3A7UA 4X5OA 2GF7A 4JUVA 1FYFA 3X26B 3OYNA 1EVLA 3UH0A 4YRMA 3A7RA 4ZTZB 2V8KA 2G4CA 3GLXA 3TEGA 3SB2A 3P8HA 2E65A 1USYA 4BI3A 3PMIA 2XHCA 4NL2A 4E47A 5K1XA 4M7DE 5HK3A 4N0AC 3HY0A 4UP9A 4F7UF 5LJ5j 1G3YA 4M7DA 2A8EA 3I56A 2RI3A 3V8KA 3KBGA 4J83A 2HD0A 4L6V5 2QHVA 1E24A 3I55T 3ASKA 2Y4XA 3M58A 2OTLT 3QZ9B 3VUBA 1BYMA 5L8RE 4M7AB 1VQ5T 2QA4A 2JZ2A 3LGLA 5GANh 2LT4A 2M0OA 3TUPA 1XNIA 2RD1A 3RGLA 5C53B 3J81E 4C0DB 2R5MA 4XTYA 3OYHA 4A4GA 1R8OB 3UT1A 3OB9A 5CCAA 3C4SA 2RHSB 1IL2A 4TWAA 3OS5A 3NEMA 4RMFA 4C0ZA 4OVAA 2RK1A 4D6WA 5HK0A 5FU6C 1EOVA 2HNIA 4UPAA 1X6OA 1ZQ1A 3OD1A 3OW2S 2EYQA 5DLQE 2CZ1B 2ZR3A 2FB7A 1BI1A 3CD6A 2PMFA 2RHIA 2MMPA 5HKCA 1WJQA 1YCYA 3EFSA 2DO3A 1ATIA 2XDBA 3GP8A 1YFSA 1YIJT 3JB9I 3V8JA 1QVFS 4H02A 2FHDA 1KHCA 3QO8A 3RERA 2KVQG 4PJOE 4KT0E 4EMHA 5M9OA 4P72A 3A7AA 1W2BS 2LCLA 5CIUA 4C0FA 4J8OA 4ELYC 3VUZA 3JCMh 4C92B 1NJ8A 3JB9G 3RMSA 1K8AC 4C8QF 1OYXA 4HT4A 3L4GB 2HQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODR D;  4XU1 A;  1B70 A;  1GGM A;  1X55 A;  4LNS A;  1SRY A;  5GAN 4;  4M7A E;  1N9S A;  1E1T A;  4M7D C;  1M5Q 1;  2ZCE A;  3VBB A;  4C8Q A;  3UGT A;  2EL9 A;  4C8Q C;  3VQY A;  5C52 B;  2DZ9 A;  4M7A A;  3PCO B;  5GAM g;  2ARU A;  2ZNJ A;  1WNL A;  4M7A C;  4KQE A;  2FYK A;  4JRI A;  2CIM A;  5LJ3 j;  3G1Z A;  4H2S A;  2E41 A;  4EO4 A;  4ZTU B;  4Y91 A;  2YHT A;  3TEH A;  3LSQ A;  4M78 G;  3BFM A;  4WJ3 M;  1J5W A;  5LJ5 e;  4TTV A;  4AH6 A;  4XTU A;  2ZT8 A;  4YRS A;  4YRG A;  4UP7 A;  3IKL A;  3CMQ A;  2QTX A;  5LJ3 d;  1TH7 A;  2AMC B;  2E1H A;  2E5A A;  2RHS A;  2K57 A;  1NYQ A;  1VQZ A;  3HXU A;  1L0W A;  2AKW B;  1KMN A;  1KMM A;  3MEY A;  4YRP A;  4JLI A;  5LJ5 f;  3R07 A;  3REX A;  4J6Y A;  3E9H A;  5GMK h;  2DXT A;  4C92 G;  4P74 A;  3ERR A;  2CJA A;  4J5Y A;  4DPG A;  2Q5I A;  5GAO m;  2C7I A;  2DXU A;  3BJU A;  4YRL A;  5GAN 2;  4F7U B;  3LC0 A;  4G85 A;  4M78 E;  2J3M A;  4P75 A;  1B34 B;  3NET A;  4K86 A;  1H4T A;  1H64 1;  4PJO G;  3JCM c;  4M78 A;  3SWN C;  4P3O A;  3UFG A;  2CGH A;  4J6X A;  5GAO p;  3JB9 H;  3HXW A;  1H4S A;  2ALY B;  4RQE A;  1QE0 A;  4YCW A;  4M75 F;  3PZC A;  1RIQ A;  2IY5 B;  1U1S A;  4K87 A;  4M7D D;  2YLB A;  2ARS A;  4M77 B;  3P8Y A;  4H2X B;  4O2D A;  4YRN A;  4C8Q D;  4C92 E;  2C8M A;  4M7A D;  3BY7 A;  2Q7E A;  3RF1 A;  4P73 A;  2CJ9 A;  1Y96 A;  4P3N A;  2ZT7 A;  4NCX A;  4M75 A;  3KFU A;  3NEL A;  4M75 C;  1WQ7 A;  2QHU A;  3VQX A;  5LJ5 h;  4YRF A;  4CH4 A;  5DY9 A;  12AS A;  1EVK A;  1D3B A;  1YGB A;  3V8L A;  2ZZE A;  3JCM V;  3P8T A;  1BIB A;  2DKG A;  4TQD A;  2ZZF A;  3L4G A;  4TVA A;  2Q7G A;  3QSU A;  5GAN d;  3JB9 D;  4HWO A;  4PJO A;  4RDX A;  1SER A;  4YRR A;  3JCM b;  5ELN A;  4PJO C;  1W66 A;  1E22 A;  2DU5 A;  3QUI A;  4XQ3 A;  4PNO A;  4XTW A;  3HTZ A;  1SET A;  3FIF A;  4MMK A;  2I4O A;  5GAN e;  3HY1 A;  1HXD A;  3REU A;  4X9D A;  3PCO A;  2YLC A;  3M4P A;  4BWA A;  3L2Z A;  4F7U G;  4XTV A;  4M7A F;  1HC7 A;  3QNE A;  2Y90 A;  3HXX A;  5LJ5 g;  1LJO A;  3NEN A;  4CS2 A;  5I21 A;  2Q7H A;  4P71 A;  4J15 A;  4P71 C;  4YDQ A;  2RM4 A;  2CJB A;  4H2Y A;  1B7Y B;  5E3I A;  3LSS A;  4TVW A;  4YCU A;  3FJP A;  2ZT5 A;  2EAY A;  5GAN f;  1C0A A;  2ART A;  3HSB A;  2AMC A;  4YCV A;  5GAN 6;  3QO3 A;  4E51 A;  4BW9 A;  4M78 D;  3JB9 F;  4A53 A;  4M77 G;  2ZNI A;  2E3C A;  2AKW A;  2I4M A;  1EFW A;  2P5I A;  3HFV A;  2RHQ B;  4EMG A;  1E1O A;  3E9I A;  4OLF A;  3HFN A;  3IKM B;  3RAC A;  4F7U E;  1WU7 A;  4YRK A;  2P0L A;  5GAM j;  1WYD A;  1X56 A;  4CH5 A;  4F7U A;  4RCC A;  3AHU A;  1I8F A;  2DTI A;  4M75 D;  2PME A;  1G5H A;  5LJ3 e;  4YPF A;  1B34 A;  4M7D B;  1YFR A;  4C8Q B;  3JCM d;  5GAM d;  1Z7M A;  1B8A A;  3IAL A;  4P74 C;  3HRI A;  3PGG A;  2XGT A;  4M78 F;  2EJF A;  2JN0 A;  1G5I A;  4M77 E;  3JCM X;  2ALY A;  4PJO D;  4TVY A;  1WQW A;  3V7R A;  4HWP A;  5LJ3 f;  4YRO A;  1JBM A;  2Q5H A;  2IY5 A;  3JCM e;  1ADY A;  5GAN 7;  3TEH B;  4CS3 A;  4Q15 A;  4M77 A;  1NJ5 A;  4NOY A;  4P75 C;  4HWS A;  1B76 A;  3UGQ A;  2J3L A;  4EMK A;  5CAI A;  4M78 C;  4CH3 A;  4EMK C;  3M4G A;  3JCM J;  1PYS B;  2E64 A;  3HFZ B;  1HTT A;  2ZTG A;  3IG2 A;  4QVD A;  2ZIO A;  2RA2 A;  3JCM f;  1JJC B;  1X54 A;  2QHT A;  3HFO A;  1NNH A;  4WF2 A;  2QHS A;  2RB6 A;  3BW1 A;  4P3P A;  4C92 A;  4PJO F;  5GAN g;  1BBU A;  4P73 C;  4C92 C;  4K88 A;  2VXE A;  3GIB A;  4JRK A;  3JCM Q;  3W3S A;  1BBW A;  1EQR A;  3INZ A;  4WJ4 A;  5GMK j;  4H2U A;  3WQZ A;  2EJ9 A;  4H2W A;  3RKX A;  5GMK l;  4HWR A;  5C51 B;  3SWN B;  3ICA A;  1Z7N A;  2VC8 A;  4M7D G;  4RCB A;  5LJ3 h;  4YRQ A;  4XU0 A;  4C8Q G;  11AS A;  4YRC A;  5GAN 5;  2DTH A;  1B7Y A;  4YRT A;  3VQW A;  1X2H A;  2I2L A;  1EIY B;  4RQF A;  3L1A A;  2DDZ A;  2I4L A;  3A7U A;  4X5O A;  3A5Z A;  4X9C A;  4JUV A;  3HXY A;  2EJG A;  4DQ2 A;  1FYF A;  3A74 A;  4KR3 A;  3A32 A;  1EVL A;  1G51 A;  3UH0 A;  4XU2 A;  4YRM A;  4M75 B;  5ELO A;  2DJZ A;  2RHQ A;  3A7R A;  1KQ1 A;  4ZTZ B;  1NJ6 A;  2G4C A;  3TEG A;  1SES A;  4YYE A;  4M77 D;  3SB2 A;  1ASY A;  3V7C A;  2E65 A;  1USY A;  2ZR2 A;  5LJ3 g;  3M4Q A;  4NL3 A;  1H4V B;  1USY C;  4NL2 A;  2DQ3 A;  4TVA B;  3I7F A;  5K1X A;  4N0A A;  4M7D E;  1YFT A;  4N0A C;  3HY0 A;  4PJO B;  4C8Q E;  2DTO A;  3QTC A;  4UP9 A;  1HK9 A;  4F7U F;  5LJ5 j;  2ZT6 A;  4M7D A;  1NJ2 A;  3V8K A;  1M8V A;  1LNX A;  5GAO n;  4HA8 A;  1X01 A;  1N9R A;  3JCM g;  2QHV A;  1E24 A;  5LJ5 d;  1B70 B;  3HXZ A;  4C92 D;  3A31 A;  1JRI A;  4V2S A;  2ZXF A;  3JCM P;  3JCM W;  1KQ2 A;  1LOJ A;  3BDU A;  4XU3 A;  5HGQ A;  2ZIN A;  4M77 F;  3JB9 J;  4G84 A;  4KR2 A;  4M7A B;  4J6W A;  1I4K 1;  3RES A;  3VU3 C;  1PYS A;  4H2V A;  5GAO l;  1H4Q A;  3HFZ A;  4YP0 A;  4WI1 A;  1WPY A;  1JJC A;  3A5Y A;  3RUX A;  5GAM e;  5GAN h;  1X2G A;  4H2X A;  3DSQ A;  3VQV A;  4M77 C;  3TUP A;  2RD1 A;  2ZIM A;  3RGL A;  1ASZ A;  5KNN A;  5C53 B;  1MGQ A;  5GAO r;  4CS4 A;  4M75 G;  4XTY A;  4A54 A;  3HXV A;  2ODR C;  1NYR A;  1LYL A;  2DU7 A;  1U1T A;  2RHS B;  4C92 F;  1IL2 A;  4TWA A;  4PHC A;  2DVE A;  4ZIB A;  5GAM f;  2E10 A;  3NEM A;  4RMF A;  1EOV A;  2HNI A;  2XTI A;  4UPA A;  2DQ0 A;  4XTZ A;  3RKW A;  3OD1 A;  1KOG A;  3SWN A;  1QF6 A;  3RL6 A;  3P8V A;  5GAN 8;  2ZR3 A;  4Q6G A;  2FB7 A;  4TQF A;  2PMF A;  4XEO A;  1YCY A;  3EFS A;  1I5L A;  1EIY A;  1N9W A;  5F5W A;  3FB9 A;  3MF1 A;  4HVC A;  3RKY A;  1WLE A;  1ATI A;  2DZC A;  4M75 E;  1ADJ A;  3EFR A;  4M78 B;  1YFS A;  4EMK B;  4L87 A;  3JB9 I;  4OP0 A;  5GAO q;  3QO7 A;  3V8J A;  1NJ1 A;  4H2T A;  4MML A;  5GAN 3;  4H02 A;  4YRE A;  1I81 A;  4HWT A;  3QO8 A;  5GAN j;  3RER A;  4M7A G;  2VXF A;  4YRI A;  3QO5 A;  3QHS A;  3V7S A;  4PJO E;  4EMH A;  3MF2 A;  3A7A A;  4P72 A;  4P72 C;  4HT8 A;  5GMK e;  1YB3 A;  5GMK m;  2ZZG A;  2DEQ A;  4QVC A;  2I4N A;  5K1P A;  4YRJ A;  4UP8 A;  3JCM h;  5GAM h;  4C92 B;  1Y96 B;  4CH6 A;  4HT9 A;  3HRK A;  2ZGW A;  1NJ8 A;  4XTX A;  3RIR A;  3JB9 G;  4M7D F;  1D3B B;  4PG3 A;  2EWN A;  4EX5 A;  4C8Q F;  4XEM A;  5GMK i;  1BIA A;  3L4G B; 
#chains in the Genus database with same CATH topology
 1ZSG A;  3QWY A;  4RTV A;  5HY6 A;  2DL4 A;  1GGM A;  4R0K A;  1X55 A;  4LNS A;  1BCO A;  1VQ4 T;  3MHX A;  1N9S A;  2DER A;  2ZCE A;  3VBB A;  1S1N A;  3R6O A;  1YP5 A;  5C52 B;  4FIB A;  1K0X A;  2DZ9 A;  3PCO B;  1MMG A;  2ARU A;  2ZNJ A;  4M7A C;  4KQE A;  2NLU A;  2J7I A;  4LDY A;  1JXM A;  3HPW A;  2E41 A;  4IUP A;  1XQH A;  2KRN A;  2F69 A;  1Y0M A;  4J9B A;  4Y91 A;  1RLQ C;  4ESR A;  1M4Z A;  1RAI B;  3LSQ A;  1RAG B;  2LQK A;  4M78 G;  5GJW B;  1OX8 A;  1QVP A;  3SFM A;  4WJ3 M;  1J5W A;  2EYX A;  4FU6 A;  2Y4Y A;  4J9F A;  4AH6 A;  2RH2 A;  4YRG A;  4KGZ B;  2QTX A;  3PVL A;  2E5A A;  2V26 A;  3VS4 A;  2QQR A;  2L89 A;  1M9S A;  3TRE A;  1KMN A;  1G3S A;  5LJ5 f;  4Z89 A;  3R07 A;  1HYO A;  1MNE A;  4LVL A;  1SHG A;  1UGS B;  1AWX A;  1AHJ B;  1FXX A;  1BI2 A;  2NS6 A;  1Z9Q A;  4IUQ A;  2C7I A;  3EH1 A;  3VS7 A;  3CCU A;  4Z88 A;  3O8V A;  1K9A A;  3L2V A;  4M78 E;  1Q82 U;  1N6A A;  4ELZ C;  1QKW A;  4IUV A;  3MEA A;  2D6F A;  1NLO C;  2Z0W A;  1H64 1;  1H4T A;  2VVK A;  2HAX A;  4M78 A;  2DE0 X;  1YHQ Q;  4J6X A;  5GAO p;  2KAF A;  1Q7Y U;  2L8D A;  2EVR A;  1TTH B;  1S72 Q;  4RTZ A;  2KGT A;  2YLB A;  5DM7 R;  2ARS A;  3P8Y A;  3RR6 A;  4O2D A;  1UEB A;  4YRN A;  2DBK A;  2CKK A;  2M1H A;  2CUD A;  2RHX A;  1W70 A;  4M7A D;  2Q7E A;  4LUD A;  2JS0 A;  3EH2 A;  2MOX A;  4ZGE B;  1YIT Q;  1YJW A;  2CJ9 A;  1Y96 A;  3Q1J A;  4NCX A;  4M75 A;  1RUW A;  1WQ7 A;  2QHU A;  5LJ5 h;  3M0Q A;  4OMP A;  4BE0 A;  2ZZE A;  1RAA B;  1VQK T;  4QQG A;  3P8T A;  1BIB A;  2DKG A;  4HCB A;  1N27 A;  3M56 A;  3CCR T;  2WSF E;  4D8D A;  2QYZ A;  3A8O B;  5CK9 A;  4HCC A;  2Q7G A;  2JTE A;  2EFI A;  3JCM b;  4PL6 A;  3OYE A;  1W66 A;  4N4I A;  1E22 A;  2GCX A;  3FJ5 A;  3QUI A;  4RG2 A;  4XQ3 A;  1KC8 R;  1K8A R;  2GQV A;  1YJN A;  4XTW A;  3REU A;  1D0X A;  2XD0 A;  2YLC A;  1YJ9 Q;  2CSI A;  4XTV A;  4M7A F;  4KUL A;  4ANJ A;  5LJ5 g;  3SD4 A;  2L0A A;  3E9F A;  1LJO A;  4CS2 A;  3C0C A;  3CCV A;  2C0I A;  4PKC C;  2CJB A;  2CDT A;  3EHQ A;  2ED1 A;  2P4T A;  4TVW A;  3FJP A;  2ZT5 A;  2EQJ A;  4X1V A;  3HSB A;  1MHN A;  2LX7 A;  3ZFJ A;  2RF0 A;  3OSS C;  1WHG A;  2DF6 A;  1IB8 A;  1TG0 A;  1X75 C;  2JNG A;  2P5I A;  4EMG A;  2G3R A;  3OYB A;  2EBP A;  2K6D A;  3RAC A;  2DXB A;  2RQR A;  3CXC P;  5GAM j;  2DIG A;  2J6F A;  4CH5 A;  3AHU A;  1K76 A;  1I8F A;  2DTI A;  1PG5 B;  2KYB A;  3I56 Q;  3P8D A;  3E19 A;  1B8A A;  3IAL A;  4P74 C;  3PGG A;  2VWF A;  2XGT A;  1WIE A;  2JN0 A;  1U3O A;  3JCM X;  2ALY A;  2M0Y A;  3RNJ A;  3V7R A;  1JBM A;  3CCS A;  3MP1 A;  1BU1 A;  2HCK A;  1AWJ A;  4NOY A;  4P75 C;  4HWS A;  1VQL A;  2DL8 A;  5FWC A;  2P4R A;  4JLG A;  3TCJ A;  3UGQ A;  1VQO A;  2EYZ A;  4DBQ A;  5J39 A;  5CAI A;  2LQ8 A;  2V1Q A;  2QAZ A;  4EMK C;  1OPK A;  3CXC A;  3QYH B;  1VQ9 A;  5KH6 A;  3CCE T;  2ZTG A;  3IG2 A;  3M0U A;  2RA2 A;  1JJC B;  2RN8 A;  1X54 A;  2A7Y A;  3HHT B;  2CZ0 B;  2JUF A;  2DET A;  1WJR A;  2XDP A;  4WF2 A;  2QHS A;  3WVE B;  3OA6 A;  1ZSZ B;  2COZ A;  3BW1 A;  2RHU A;  2CYZ B;  2L3P A;  1QW1 A;  3HRS A;  1BBU A;  4K88 A;  2X9H A;  1X69 A;  4B9X A;  1YN8 A;  1N8R R;  3GBQ A;  3W3S A;  3DB3 A;  5GMK j;  3TVT A;  2EJ9 A;  5DLO A;  1HSQ A;  3RKX A;  3SWN B;  1T0H A;  3QBY A;  4OMM A;  2NYS A;  4UC4 A;  1Q81 C;  2MI6 A;  5GAN 5;  2K5L A;  1B7Y A;  4YRT A;  3CD6 Q;  1Y57 A;  3VQW A;  1YI2 Q;  1R77 A;  3GNF B;  2O9S A;  3I35 A;  3QKJ A;  3VS5 A;  2KYM A;  2HBP A;  3PNW C;  4HCZ A;  1Y71 A;  3CPW S;  2KRS A;  1F1B B;  2YSQ A;  3EG9 B;  3TEE A;  3A74 A;  2EGC A;  2KE9 A;  1WXB A;  4LVI A;  2CP2 A;  1IRE B;  2QEX A;  4XU2 A;  1IGQ A;  2H3J A;  5KYU B;  4M75 B;  3A98 A;  2RHQ A;  4FW1 A;  2DL5 A;  4KRT A;  4ZN3 A;  1ASY A;  2RQV A;  1RAH B;  2QDL A;  4L59 A;  2ZR2 A;  2O4X B;  4NL3 A;  1LCK A;  3I7F A;  1Q82 C;  1ZA2 B;  2HL3 A;  3QTC A;  1M3B A;  1ZHI A;  5C6S A;  2ZT6 A;  3DKM A;  1AZG B;  1NJ2 A;  2LT1 A;  4BI4 A;  2EQI A;  1ZBX A;  5GAO n;  2CT3 A;  2M9U A;  4HA8 A;  1Q7Y C;  4DEX A;  1X01 A;  2QTV A;  4JS4 A;  3CC4 T;  3EAE A;  1B70 B;  3A31 A;  2ZXF A;  3JCM P;  2PZ1 A;  1RAC B;  3BDU A;  4XU3 A;  5HGQ A;  2ZIN A;  3CC2 T;  2COW A;  5D6W A;  1ZA1 B;  2XID A;  5D6X A;  4EDU A;  1PYS A;  4H2V A;  5GAO l;  1H4Q A;  3HFZ A;  2ZAE A;  4JZ4 A;  1G8X A;  4QQD A;  3A5Y A;  5IT9 E;  2X4J A;  2P0P A;  1PKT A;  2EGE A;  4PFO A;  2AK5 A;  1X2G A;  2RQU A;  1NEG A;  3M54 A;  2ZIM A;  1ASZ A;  2ED0 A;  1MGQ A;  2BZY A;  3QDF A;  2DYB A;  2L2P A;  2D8H A;  1M2V B;  1YIT A;  3OYA A;  3OS0 A;  1PHT A;  1KC8 U;  4PHC A;  5EC7 A;  2DVE A;  4ZIB A;  5GAM f;  2E10 A;  4CC3 A;  1WA7 A;  2MIO A;  3CCJ T;  1PSF A;  2A08 A;  1JB0 E;  2XTI A;  3URG A;  1TWB A;  2DQ0 A;  2BTT A;  2EKO A;  3CMA T;  4D8K A;  2XIC A;  2AHJ B;  1K1Z A;  3JRZ A;  2KK4 A;  3RL6 A;  1K9M R;  3P8V A;  3S3N A;  3HKS A;  1CKB A;  3CCU Q;  3E1S A;  4QT7 A;  3MQZ A;  3PE0 A;  1N9W A;  5F5W A;  3MF1 A;  1WLE A;  2DZC A;  3EFR A;  2SRC A;  1WJS A;  1RAE B;  1UUE A;  1VQ8 Q;  4FYV B;  2PVD B;  5GAN 3;  4YRE A;  1H92 A;  2L3Q A;  2EYW A;  2VXF A;  3QHS A;  4MZM A;  1FYN A;  2LJ0 A;  2OTJ A;  4HT8 A;  1K0S A;  1YB3 A;  5I11 A;  2I4N A;  4ZN1 A;  1YCS B;  1VQN T;  5GAM h;  3MP6 A;  2DFU A;  4CH6 A;  8AT1 B;  1YJW Q;  4HT9 A;  1YFN A;  3OBW A;  4KH0 B;  3R6N A;  2LX9 A;  4EPC A;  3RIR A;  4LD9 K;  2H8H A;  1D3B B;  3NTI A;  5C0M A;  2EWN A;  1JJ2 P;  4HVW A;  4XEM A;  4DA4 A;  1BIA A;  4RUG A;  1PWT A;  4BUG A;  3LX7 A;  1G3T A;  2ABL A;  3THK A;  1FX7 A;  5A0L A;  3M0S A;  2DPP B;  4QQ6 A;  4JRP A;  1E1T A;  1M5Q 1;  1ZBJ A;  1W4S A;  2ZCF B;  4OB0 B;  3E9G A;  3GF5 A;  4C8Q C;  2EL9 A;  4FCY A;  2AZS A;  4J9D A;  3UWN A;  3G4S A;  5GAM g;  1KK7 A;  4ORZ A;  1PC0 A;  4ZTF A;  1Q86 R;  1M2O A;  2DJQ A;  2FYK A;  2CIM A;  1X6G A;  2AT1 B;  1EX4 A;  4EO4 A;  4ZTU B;  3TEH A;  3CCV Q;  3BFM A;  1GBQ A;  5LJ5 e;  1JJ2 A;  2ZT8 A;  1NYG A;  1UHC A;  3CCM A;  1K73 C;  3IKL A;  1ABO A;  3HTR A;  5LJ3 d;  1TH7 A;  2DLP A;  2F1L A;  1QMC A;  3EGX B;  4DBF A;  5KCO A;  4DBH A;  3MEY A;  4JLI A;  2IG0 A;  3E9H A;  5GMK h;  3H8Z A;  2KSS A;  4GY5 A;  4QKU A;  1H3Z A;  4P74 A;  2RJE A;  2EYY A;  4DPG A;  5GAO m;  2DXU A;  3M57 A;  1Q95 G;  1ZLM A;  1S72 T;  2KT1 A;  3BE3 A;  1OV3 A;  4P75 A;  3NET A;  4PJO G;  1VOM A;  4JJD A;  4AG2 C;  4FT2 A;  4PK4 A;  3NMZ C;  4LDX A;  3UFG A;  3JB9 H;  3HXW A;  1VQ6 A;  4RTU A;  1M1K R;  2PUK B;  1YI2 A;  4YCW A;  4M75 F;  2DL7 A;  3UA6 A;  3PZC A;  1UGP B;  1QKX A;  2DA9 A;  3JAM E;  1M1G A;  4AG1 C;  2QQA A;  4M77 B;  3CCS Q;  4C8Q D;  2XDD A;  3GOX A;  2C8M A;  1VQL Q;  1V76 A;  4BE1 A;  3BY7 A;  1VYT A;  3EG3 A;  4P3N A;  2LRQ A;  2QI2 A;  5I2S A;  1VQ9 Q;  2VAS A;  3VQX A;  4YRF A;  4CH4 A;  5DY9 A;  1VQK A;  3U23 A;  2MAM A;  3CCR A;  2G6F X;  2E12 A;  1VQM A;  2ZZF A;  3CME Q;  3QSU A;  4X34 A;  4PJO A;  2M51 A;  4YRR A;  3CCQ T;  2HEQ A;  2QGG A;  1GBR A;  3L2U A;  4PNO A;  3L2R A;  1SET A;  3FIF A;  1ABQ A;  1HXD A;  4HXJ A;  3M4P A;  1X2Q A;  1G2B A;  4BWA A;  4F7U G;  1HC7 A;  1BKB A;  2KR3 A;  2MYS A;  4RKU E;  2PU9 B;  2EGA A;  4F16 A;  2JOY A;  4J15 A;  4P71 C;  4GLM A;  4FYY B;  1M90 C;  2CP0 A;  3LH0 A;  2KNB B;  4MZP A;  5D6Y A;  2YRD A;  1WHM A;  2X3X D;  2AMC A;  4YCV A;  1KG1 A;  4AFS C;  5CO7 A;  5KYW B;  3RBB B;  5KYX B;  4FM4 B;  5IH2 A;  1OQK A;  3QPH A;  2QEX Q;  2AKW A;  3HFV A;  1KJW A;  3WVD B;  1M3C A;  4EIK A;  1PRL C;  3FEO A;  1AVZ C;  1V29 B;  4C0D C;  4F7U E;  2EIF A;  1K9M U;  1WU7 A;  5HCK A;  1UFF A;  1KIK A;  2P0L A;  1I07 A;  1QVF P;  1X6B A;  2JVV A;  5IAY A;  4F7U A;  4RCC A;  3S3M A;  4IUU A;  2VV5 A;  4YPF A;  1B34 A;  5FRM A;  2A28 A;  4M7D B;  2CRE A;  4PJN A;  1TU0 B;  2EQK A;  2YRC A;  1WXU A;  2EJF A;  1JEG A;  3OYF A;  3I55 Q;  2VYT A;  2QA4 T;  4BB7 A;  4TVY A;  1WQW A;  1E7O A;  2IY5 A;  1ADY A;  3TEH B;  3DB4 A;  2FPF A;  3PIO A;  1M30 A;  2RI5 A;  2J6O A;  2J3L A;  2W0Z A;  2QXF A;  4ZNX A;  1VQ8 A;  4CH3 A;  2M16 A;  2FVU A;  3M4G A;  2K2M A;  4M4Z A;  2FO0 A;  1VQ5 Q;  2MPX C;  4PLI A;  1HTT A;  2X35 A;  4JJN K;  3HRU A;  4IKF A;  2QG9 B;  5CQX A;  3HFO A;  2RK2 A;  3G7Z A;  2RPN A;  9ATC B;  1SRM A;  1NE8 A;  4RTT A;  4C92 C;  2XKO C;  3VV0 A;  5J26 A;  2VXE A;  5GJV B;  3CBP A;  3VS0 A;  3RDV A;  3VS1 A;  3OY9 A;  2P84 A;  4BI8 B;  3JCM Q;  1BBW A;  1EQR A;  3INZ A;  4IIM A;  2W10 A;  2AIR B;  2HKN A;  3OYM A;  3L2Q A;  2V8J A;  1VIF A;  5GMK l;  1Z7N A;  1M3A A;  5CKD A;  4RCB A;  4YRQ A;  4FSS A;  4XU0 A;  4C8Q G;  4YRC A;  3CXC S;  1RI9 A;  2DTH A;  2PQW A;  5IHI A;  4JS5 A;  2I2L A;  3A5Z A;  4X9C A;  4DQ2 A;  3MJX A;  4KR3 A;  1G83 A;  2CZ6 B;  2KY9 A;  2OI3 A;  4AFU C;  5I22 A;  2K5F A;  3PVQ A;  2DJZ A;  3E2U A;  2DXC A;  5L23 A;  2O2O A;  1NJ6 A;  4RTY A;  4M77 D;  2DAQ A;  5CR2 A;  3G6E T;  2XU8 A;  3A8M B;  3CCL A;  3M4Q A;  4Z8A A;  2OTJ Q;  1H4V B;  1USY C;  1O75 A;  4N0A A;  3MP8 A;  4BDZ A;  4CC7 A;  3TU4 K;  4PJO B;  1MUZ A;  1PKS A;  4C8Q E;  2DTO A;  3HP9 A;  1HK9 A;  1VQP A;  2RJD A;  2DM1 A;  2RI2 A;  2NUP B;  1V1C A;  1M8V A;  2BZX A;  2H3E B;  1LNX A;  1QP3 A;  2B8A A;  1VQ7 T;  3M4Y A;  1N9R A;  3WXM B;  4AFZ C;  3CC4 A;  3I5R A;  2IVW A;  5FLX E;  1UGV A;  2O01 E;  3HXZ A;  4C92 D;  1BI3 A;  4V2S A;  3JCM W;  1UJ0 A;  1LOJ A;  1U5S A;  1NJI U;  1GRI A;  4M77 F;  3JB9 J;  4KR2 A;  4BAC A;  2K9G A;  1C0M A;  1VYV A;  3MPU B;  1SSF A;  3G4S Q;  3QII A;  1ZUK A;  3VRZ A;  4L5G A;  1WPY A;  3M0R A;  3RUX A;  3A8L B;  3H0H A;  2LMJ A;  5GAM e;  3DSQ A;  1J3T A;  1OX9 A;  3MCA B;  5KNN A;  1KD1 U;  5GAO r;  1AD5 A;  3CCM Q;  4A54 A;  3SEM A;  2ODR C;  3H0I A;  2IPO B;  4C92 F;  2RNA A;  2XI9 A;  2BE9 B;  1N5Z A;  2OX7 A;  1E6G A;  1WYX A;  3I9Q A;  1SEM A;  2ROL A;  2P0Q A;  3CME A;  4XTZ A;  3CMA A;  4FYX B;  4A4K A;  2K3Y A;  4BY6 B;  1QF6 A;  1D1A A;  2RO0 A;  3TQ7 P;  5GAN 8;  2D0Q B;  4Q6G A;  1UEC A;  4TQF A;  2JTF A;  3O5Z A;  4DOV A;  2LNH B;  2CP5 A;  4R56 A;  4XEO A;  2ESW A;  1EIY A;  1W6X A;  2LZ6 B;  2PVG B;  1MMN A;  4HVC A;  3FLG A;  3C95 A;  2K3B A;  3OS2 A;  1ADJ A;  3G1J A;  3UDC A;  4M78 B;  1NEB A;  4OP0 A;  5ECA A;  3QO7 A;  1YJW T;  1VQ6 Q;  4P5N A;  1NJ1 A;  1G5V A;  4H2T A;  5GAN j;  4M7A G;  2COY A;  4YRI A;  4N4H A;  3QO5 A;  1I0C A;  2X51 A;  1RL2 A;  4A4E A;  2PTK A;  2D0N A;  4P72 C;  5GMK e;  5GMK m;  4Z02 A;  3KUF A;  1VQN A;  1UDL A;  3NGP A;  1Y96 B;  3HRK A;  2X4W A;  2ZGW A;  2KRM A;  1NG2 A;  4XTX A;  4M7D F;  4HCK A;  1YJN T;  1VQK Q;  1OU8 A;  3NTK A;  4EX5 A;  2A37 A;  5GMK i;  4BDY A;  1BI0 A;  3ZBD A;  3CCR Q;  1VQM Q;  2ODR D;  3VRY A;  3PT9 A;  2CP6 A;  2L3R A;  1SRY A;  3S3O A;  4M7A E;  1I1J A;  1UB4 A;  1WHL A;  3UGT A;  4CC2 A;  4M7A A;  2C0T A;  1T0J A;  3H41 A;  3I55 A;  2QK0 A;  2LDM A;  2J06 A;  4JRI A;  5LJ3 j;  4C5E A;  4J9C A;  3G1Z A;  1G3W A;  2YDL A;  3LWI A;  2KRO A;  3FDR A;  2YHT A;  1UGR B;  2OTL A;  1QVG P;  2KI7 A;  4PJJ A;  2O88 A;  2ZPE B;  3LGF A;  4TTV A;  4E7S A;  1GL5 A;  3CMQ A;  2LJ1 A;  3REB B;  2QAS A;  2DIQ A;  3EHR A;  3PFS A;  1VQ5 A;  5KE3 A;  2NUZ A;  2FZK B;  3T9N A;  2RHS A;  2K57 A;  3G71 T;  1NYQ A;  1VQZ A;  3VS2 A;  3VS6 A;  4ATO A;  4OGE A;  1NLP C;  1KMM A;  1YBY A;  1WHJ A;  2E6Z A;  3NPF A;  4MDW A;  1AZE A;  3REX A;  4C5H A;  4J6Y A;  1NBE B;  2DXT A;  3OS1 A;  4C92 G;  4YTL A;  1ZSZ C;  1KQS P;  2VGM A;  4BY6 C;  3ERR A;  2Q5I A;  1H3H A;  1K8A U;  4OB2 B;  3UF4 A;  5GAN 2;  3LC0 A;  4G85 A;  3CCS T;  3MEU A;  3JCM c;  1C1A A;  4DOW A;  1VQO T;  1EIF A;  3HL8 A;  3SWN C;  1E6H A;  1WLP B;  3VYH B;  2VUB A;  2CGH A;  1JJ2 S;  1PNJ A;  4MZT A;  1FMW A;  2QQS A;  1JO8 A;  2IIM A;  1CKA A;  1H4S A;  1D1B A;  2JXB A;  4QVZ A;  1VQ9 T;  2ALY B;  2BKD N;  3CC7 T;  2NUT A;  1U1S A;  4KGV B;  3MO8 A;  4WCI A;  4C92 E;  2KXC A;  2FL7 A;  4CI0 C;  1KQS A;  4R55 A;  1Q81 R;  1A0N B;  4LDV A;  1YIJ A;  4C5G A;  2DD5 A;  1PSE A;  5KYY A;  3M0T A;  2QDY B;  1NPR A;  3RF1 A;  2OAU A;  1NPP A;  2ZT7 A;  4MDX A;  4M75 C;  2GNC A;  12AS A;  1EVK A;  1YGB A;  3V8L A;  5FU6 B;  4LVJ A;  2AKL A;  2EQM A;  3L4G A;  1FMV A;  4TVA A;  2ZPI B;  5GAN d;  3JB9 D;  4RDX A;  3CCQ A;  2RQT A;  2MWO A;  3OYJ A;  2DU5 A;  3HTZ A;  3MEW A;  2I4O A;  3HY1 A;  3PCO A;  1Q82 R;  3L2Z A;  2A36 A;  3QNE A;  1TUC A;  1SG5 A;  5CQY A;  3C94 A;  3OYC A;  2Y90 A;  3OSV A;  1Y7X A;  4GLK A;  1VQ4 A;  4KBM B;  2QEX T;  4YDQ A;  4E7J A;  4O6J A;  1KD1 C;  4LVK A;  1B7Y B;  2D8J A;  3X24 B;  5E3I A;  2LTO A;  3LSS A;  4YCU A;  1Q7Y R;  1SSH A;  2D9T A;  2CT4 A;  4XK8 E;  5FW9 A;  5GAN f;  2ART A;  2J05 A;  2NWM A;  3QO3 A;  4E51 A;  4BW9 A;  2CS7 A;  4M78 D;  3VJP A;  3JB9 F;  2LCS A;  2ZNI A;  1M1F A;  3D7S B;  1EZZ B;  1EFW A;  3A8G B;  2RHQ B;  1XTD A;  2KDS A;  4JJB A;  3X28 B;  1E1O A;  3L2W A;  3IKM B;  5AT1 B;  2X3W D;  2QGF B;  4RG8 A;  3TSW A;  2HMA A;  4YRK A;  3CCL Q;  4J9I A;  4DEY A;  1N8R U;  4B6M A;  1SRL A;  4LD6 A;  1MV0 B;  4M75 D;  1VYU A;  2CUB A;  3QG1 A;  4AMC A;  1VQP Q;  1D0Z A;  1TS9 A;  4PFZ A;  1YFR A;  3JCM d;  1Z7M A;  1YHQ T;  3QXE B;  1WI7 A;  2ZPF B;  2GFU A;  4M78 F;  5J3B A;  2KMT A;  3CC4 Q;  3RMQ A;  3H6Z A;  7AT1 B;  1U8R A;  2MF2 A;  5LJ3 f;  1M8M A;  2Q5H A;  3OYY A;  5EG2 A;  2EW3 A;  5GAN 7;  2M02 A;  1HJD A;  3DLM A;  1BB9 A;  4IUT A;  4ZGJ B;  2AZV A;  1AT1 B;  4EMK A;  4F14 A;  2JMA A;  1T3S A;  3JCM J;  1YIT T;  1PYS B;  2FG0 A;  3HFZ B;  4XAX B;  5A0D A;  1AOJ A;  1QCF A;  3JCM f;  4OB1 B;  1IO6 A;  2QHT A;  2JJ9 A;  1O9S A;  1NNH A;  1KFZ A;  4JZ3 A;  2RB6 A;  3ZEH A;  4AT1 B;  1UG1 A;  5GAN g;  4P73 C;  4JRK A;  4LDU A;  2SEM A;  4CRI A;  3OYD A;  4WJ4 A;  4H2U A;  4PLL A;  2VKN A;  3WQZ A;  1YJ9 T;  4H2W A;  5C51 B;  3CMA Q;  3OBY A;  5LJ3 h;  11AS A;  4E7I A;  4JPB W;  4JJC A;  2NUT B;  2KXD A;  1X2H A;  2KBT A;  4RQF A;  1P92 A;  2DBM A;  2DDZ A;  1UHF A;  2I4L A;  2YXY A;  3HXY A;  3GPL A;  2EJG A;  2OTJ T;  4ME7 A;  3A32 A;  3VYG A;  1G51 A;  4J9G A;  2CP7 A;  5ELO A;  3QJ6 A;  3JSC A;  3EG1 A;  1KQ1 A;  1MMD A;  1SES A;  4YYE A;  4LDW A;  3OW2 P;  3V7C A;  1KC8 C;  4F17 A;  3G6E A;  2JMC A;  2R57 A;  5LJ3 g;  4TVA B;  3M59 A;  4HVV A;  2DQ3 A;  4Y28 E;  4OMN A;  1YFT A;  3LH5 A;  1HD3 A;  1QCN A;  1VQN Q;  1VUB A;  1NZ9 A;  1RAD B;  2JM9 A;  2FZC B;  1IHV A;  1PCX A;  3ER0 A;  1K73 R;  5I2M A;  1QQJ A;  2PUO B;  3I56 T;  2HQX A;  4LNP A;  1VQ7 A;  1XOV A;  3JCM g;  3G4S T;  2E5Q A;  4LUE A;  5LJ5 d;  2E3I A;  2GFA A;  3SHW A;  3J80 E;  4E2F B;  1JRI A;  1OZ2 A;  2LJ3 A;  2ZPG B;  1KQ2 A;  2JT4 A;  2MK5 A;  5A0G A;  3HRT A;  1W2B P;  1Q81 U;  3OQ5 A;  3OW2 A;  4G84 A;  1X43 A;  3CCM T;  2A3L A;  3TSZ A;  4J6W A;  1I4K 1;  3RES A;  3VU3 C;  1D0Y A;  5KCH A;  2XG8 D;  4YP0 A;  2BZ8 A;  4WI1 A;  3MKD A;  4K11 A;  2GTJ A;  3CQT A;  4JDS A;  1JJC A;  3M53 A;  5FRO A;  4H2X A;  2CZ7 B;  3VQV A;  2OTL Q;  4M77 C;  2QQB A;  1ZSZ A;  2YWW A;  5CKH A;  4J7I A;  4CS4 A;  1TXQ A;  4M75 G;  1RI0 A;  4RTW A;  3HXV A;  1LPL A;  1NYR A;  1QVF A;  1SHF A;  3M5A A;  1LYL A;  2DU7 A;  3CCE A;  1UE9 A;  1U1T A;  3UPU A;  2DK3 A;  4KGX B;  2BUD A;  3ULR B;  3OYG A;  1W2B A;  2JS2 A;  2KQW A;  1R0B G;  4IUR A;  2EPD A;  4O5V A;  3OMG A;  3QDR B;  4OMQ A;  3RKW A;  1KOG A;  3SWN A;  1I5O B;  1VQ6 T;  2PVO B;  1X27 A;  5AYF A;  3CD6 T;  1YI2 T;  1I5L A;  2RJF A;  3FB9 A;  1Q86 U;  2HKQ B;  2FRW A;  2L5Q A;  3RKY A;  3EG9 A;  1T3L A;  2XMF A;  3L42 A;  4M75 E;  4LE9 A;  2C06 A;  1TOV A;  4II1 A;  4EMK B;  1OUL A;  4L87 A;  5GAO q;  5KYU A;  2R58 A;  4MML A;  5LL6 S;  4QW2 A;  1I81 A;  4HWT A;  2ROT A;  1PM3 A;  1ZUU A;  2AKK A;  1YNZ A;  2WSC E;  3S6W A;  3V7S A;  1N8R C;  3EGD A;  3MF2 A;  2O4X A;  1VQM T;  2ZZG A;  2DEQ A;  4QVC A;  1RAB B;  4ZTJ A;  5K1P A;  1JU5 C;  1YIJ Q;  4YRJ A;  1M90 R;  4UP8 A;  2E70 A;  2K4Y A;  1WFW A;  3FRN A;  3F70 A;  3REA B;  2HSP A;  4E7K A;  1X2K A;  4PG3 A;  3BDL A;  4LXC A;  5D7U A;  1WX6 A;  2YUP A;  1OEB A;  4XU1 A;  1B70 A;  2RHZ A;  1QWF A;  3P8B B;  1FMK A;  3JV3 A;  3KFV A;  3CCQ Q;  5GAN 4;  4OGC A;  4PJL A;  1QWE A;  2RJC A;  4M7D C;  4C8Q A;  2RHY A;  3ME9 A;  3VQY A;  2KEA A;  3LLR A;  1WNL A;  1M1K U;  2PNI A;  5CVI A;  4H2S A;  2HSE B;  3M55 A;  1OPL A;  1WXT A;  1VQ4 Q;  2JW4 A;  4HVU A;  4C0G A;  4BD3 A;  2QQ9 A;  3CC2 A;  4XTU A;  4YRS A;  2HDA A;  2DL3 A;  4UP7 A;  5IXB A;  1M2V A;  2AMC B;  2E1H A;  2GBQ A;  5IN1 A;  3C12 A;  1GXI E;  3G71 A;  1QP2 A;  4VUB A;  4RMO A;  2A0F B;  3HXU A;  1L0W A;  2AKW B;  4AFQ C;  2JTM A;  4YRP A;  4FL6 A;  1MV3 A;  2K79 A;  2F2X A;  2LCC A;  1NM7 A;  1TSF A;  1GCQ C;  1VIE A;  2JM8 A;  3A1P A;  4J5Y A;  2CJA A;  2O9V A;  3AT1 B;  3BJU A;  1M27 C;  4YRL A;  3QWX X;  3CCU T;  3LYI A;  4F7U B;  6AT1 B;  4C5I A;  5A2Q E;  3CCJ A;  2LNV A;  2J3M A;  3N5B B;  5FU7 B;  1B34 B;  3M0P A;  3CPF A;  4K86 A;  2DRM A;  3MET A;  3I5S A;  1KSW A;  2DD4 A;  3EGU A;  4FT4 A;  4P3O A;  2WAC A;  4E7H A;  1VQ8 T;  2F5T X;  5IHK A;  2FZG B;  3CC7 A;  3QJY A;  2QA4 Q;  4RQE A;  1QE0 A;  2DVJ A;  2YRV A;  1RIQ A;  2R5A A;  2IY5 B;  2L3S A;  1C6V X;  3M9Q A;  4K87 A;  4M7D D;  4H2X B;  3OYK A;  3QYG B;  3X20 B;  3MEV A;  2EKH A;  4J9E A;  1WGS A;  4N4G A;  3LW5 E;  1B7T A;  4ZGD B;  4F04 B;  2FRY A;  3PTA A;  1IZ6 A;  4P73 A;  1WHH A;  1K73 U;  1ZUY A;  3KFU A;  3NEL A;  1D1C A;  2V1R A;  1K9M C;  2GTO A;  3OYL A;  1Y07 A;  1D3B A;  1FWZ A;  2FEI A;  3JCM V;  4HKE A;  1QVG S;  4TQD A;  3GNG A;  4PFP A;  3DLL A;  1MMA A;  4HWO A;  1SER A;  2DX1 A;  2ZPH B;  3J7A F;  5ELN A;  4PJO C;  1UGQ B;  4J7F A;  1U06 A;  4BE2 A;  2FPD A;  4MMK A;  4B9W A;  5GAN e;  2KT8 A;  4X9D A;  2K3X A;  1GFD A;  2E5K A;  2ATC B;  4KUI A;  3NFC A;  4OF1 A;  3HXX A;  1KQS S;  5CKE A;  3NEN A;  5I21 A;  5FWB A;  3FC3 A;  2Q7H A;  4P71 A;  2RM4 A;  4OMF B;  3VKI A;  3CCV T;  4H2Y A;  2X4X A;  2DYI A;  2HZY A;  3H9N A;  4LVM A;  2EAY A;  4J9H A;  1C0A A;  1TUD A;  2F5K A;  2WSE E;  2P0K A;  3A5Z B;  3EGD B;  5GAN 6;  3EGX A;  3CCL T;  3NTH A;  4FYW B;  1GFC A;  2F2V A;  4A53 A;  4E6R A;  5FRN A;  4TVR A;  4RTX A;  4M77 G;  2DMO A;  2E3C A;  2I4M A;  2EQU A;  2LVM A;  3QZ5 B;  2LQW A;  1ARK A;  1VQP T;  1KHI A;  1PD1 A;  2V8I A;  3E9I A;  4OLF A;  3HFN A;  2D1X A;  1ZX6 A;  2E4H A;  4DBR A;  3G6E Q;  2CH4 W;  2MWP A;  3CBO A;  4NS5 A;  1WYD A;  2ZZD A;  1X56 A;  2K2V A;  1Q86 C;  1NYF A;  3KXT A;  2PME A;  1G5H A;  5LJ3 e;  2K5I A;  2BIV A;  2LQN A;  5IXF A;  3CPW P;  3EFO A;  5FU7 C;  4KUD K;  4C8Q B;  5GAM d;  3OYI A;  1YHQ A;  1VQ7 Q;  2F2W A;  3HRI A;  3OMC A;  2E6N A;  1UJY A;  5CKB A;  1G5I A;  2OJ2 A;  4M77 E;  4PJO D;  2HBW A;  5KYN A;  3PMT A;  1S72 A;  4HWP A;  1QVG A;  4KH1 B;  1IHW A;  4YRO A;  3JCM e;  4OB3 B;  2O31 A;  2DRK A;  4CS3 A;  4Q15 A;  4WTO B;  1WHK A;  4M77 A;  1NJ5 A;  1B76 A;  1VQL T;  1M90 U;  4M78 C;  1QLY A;  1OU9 A;  1SF9 A;  1EFN A;  5CKF A;  1TUG B;  1B07 A;  2E64 A;  2LC4 A;  2OAW A;  4QVD A;  3PIP A;  2ZIO A;  1JXO A;  1JQQ A;  3CPW A;  2ZPB B;  1PD0 A;  4E7L A;  1R0C B;  3CME T;  1CSK A;  3CBM A;  4FSX A;  4A4H A;  5IHN A;  1W1F A;  4P3P A;  3LWH A;  2LP5 A;  4C92 A;  4PJO F;  2XK0 A;  3CCE Q;  4JRQ A;  3GIB A;  1WDX A;  2X4Y A;  1BK2 A;  4CC4 B;  4A4F A;  3X25 B;  3SDZ A;  1M1K C;  5KE2 A;  1K4U S;  1OZ3 A;  2VGN A;  3A8H B;  1VA7 A;  1YJ9 A;  3IQL A;  4PJM A;  1OI1 A;  4HWR A;  3ICA A;  1MND A;  2VC8 A;  1DJ7 B;  1NJI C;  4M7D G;  1YWP A;  3NHN A;  4IIO A;  3VS3 A;  2FPE A;  4OML A;  4OMO A;  2ECZ A;  4Q5W A;  3CEY A;  1EIY B;  2ENM A;  3L1A A;  3A7U A;  2J6K A;  4X5O A;  2GF7 A;  4JUV A;  3EG0 A;  1QCO A;  4E7Z A;  1FYF A;  3X26 B;  2GGR A;  4Y92 A;  5KYW A;  1OOT A;  3OYN A;  5KYX A;  1EVL A;  1BCM A;  1AWO A;  2RQW A;  2DNU A;  3UH0 A;  4YRM A;  3A7R A;  4ZTZ B;  2V8K A;  4GBQ A;  2G4C A;  3GLX A;  3TEG A;  3SB2 A;  3P8H A;  2E65 A;  2DIL A;  1USY A;  4BI3 A;  3PMI A;  2XHC A;  4NL2 A;  4E47 A;  5K1X A;  4M7D E;  5HK3 A;  4N0A C;  3HY0 A;  1AEY A;  4UP9 A;  4F7U F;  5LJ5 j;  1G3Y A;  2HQH A;  4M7D A;  2A8E A;  3I56 A;  2RI3 A;  3V8K A;  1YJN Q;  3KBG A;  4J83 A;  2HD0 A;  4L6V 5;  2QHV A;  1E24 A;  3I55 T;  3ASK A;  2Y4X A;  3M58 A;  2OTL T;  3QZ9 B;  3VUB A;  1RAF B;  3ZL7 C;  1BYM A;  1AWW A;  5L8R E;  4M7A B;  2DEU A;  1VQ5 T;  2QA4 A;  2RMO A;  2JZ2 A;  3LGL A;  2CP3 A;  2YUN A;  2E3H A;  5GAN h;  1D09 B;  2LT4 A;  2M0O A;  1LVK A;  2BE7 D;  1XNI A;  3TUP A;  2RD1 A;  3CC2 Q;  1IRX A;  3RGL A;  1SKU B;  5C53 B;  3J81 E;  4C0D B;  2R5M A;  1ACM B;  1GCQ A;  2CH4 A;  2VB6 A;  4XTY A;  3OYH A;  4A4G A;  1R8O B;  8ATC B;  1IXD A;  1PRM C;  3UT1 A;  3OB9 A;  5CCA A;  3C4S A;  1H8K A;  2RHS B;  1IL2 A;  4TWA A;  2YUO A;  3G71 Q;  2I0N A;  3OS5 A;  3NEM A;  4RMF A;  4C0Z A;  4OVA A;  2RK1 A;  4D6W A;  5HK0 A;  5FU6 C;  1EOV A;  2HNI A;  3EFO B;  1RLP C;  4UPA A;  1X6O A;  1ZQ1 A;  3OD1 A;  1Z9Z A;  3OW2 S;  4FW2 A;  3H0F A;  2EYQ A;  4LN2 A;  5DLQ E;  2CZ1 B;  1UTI A;  4A63 B;  2ZR3 A;  1SPK A;  2FB7 A;  2GQI A;  1BI1 A;  3CD6 A;  2PMF A;  2RHI A;  2MMP A;  5HKC A;  2MCN A;  1WJQ A;  1YCY A;  3EFS A;  3UAT A;  3CCJ Q;  2DO3 A;  1BBZ A;  1ATI A;  2XDB A;  1NJI R;  2B86 A;  3GP8 A;  1YFS A;  1VQO Q;  3UA7 A;  1YIJ T;  3JB9 I;  1GCP A;  1YWO A;  2YUQ A;  3EG2 A;  3V8J A;  1QVF S;  4H02 A;  2FHD A;  3CC7 Q;  1KHC A;  3QO8 A;  3RER A;  2CSQ A;  1WZO A;  2KVQ G;  2HL5 C;  4PJO E;  4KT0 E;  2C0O A;  4EMH A;  5M9O A;  4P72 A;  3A7A A;  1W2B S;  2K7A A;  1B3Q A;  2LCL A;  5CIU A;  4C0F A;  4J8O A;  4ELY C;  5KYY B;  1KD1 R;  3VUZ A;  3JCM h;  4C92 B;  1IGU A;  1XJW B;  2NUP A;  1NJ8 A;  3JB9 G;  2YT6 A;  3RMS A;  1K8A C;  4C8Q F;  1OYX A;  4HT4 A;  3L4G B;  2HQE A; 
#chains in the Genus database with same CATH homology
 5HY6 A;  1GGM A;  1X55 A;  4LNS A;  1VQ4 T;  3MHX A;  1N9S A;  2ZCE A;  3VBB A;  3R6O A;  5C52 B;  4FIB A;  2DZ9 A;  3PCO B;  2ARU A;  2ZNJ A;  4M7A C;  4KQE A;  2NLU A;  4LDY A;  3HPW A;  2E41 A;  4IUP A;  1XQH A;  2F69 A;  4Y91 A;  1M4Z A;  3LSQ A;  2LQK A;  4M78 G;  3SFM A;  1QVP A;  4WJ3 M;  1J5W A;  4FU6 A;  2Y4Y A;  4AH6 A;  2RH2 A;  4YRG A;  2QTX A;  2E5A A;  2QQR A;  2L89 A;  1M9S A;  3TRE A;  1KMN A;  1G3S A;  5LJ5 f;  3R07 A;  4LVL A;  1UGS B;  1AHJ B;  1FXX A;  1BI2 A;  2NS6 A;  4IUQ A;  2C7I A;  3CCU A;  3O8V A;  3L2V A;  4M78 E;  1Q82 U;  1N6A A;  4ELZ C;  4IUV A;  3MEA A;  2D6F A;  1H4T A;  1H64 1;  2HAX A;  4M78 A;  4J6X A;  5GAO p;  2KAF A;  1Q7Y U;  2L8D A;  5DM7 R;  2YLB A;  2ARS A;  3P8Y A;  4O2D A;  1UEB A;  4YRN A;  2CKK A;  2M1H A;  2RHX A;  4M7A D;  2Q7E A;  4ZGE B;  1YJW A;  2CJ9 A;  1Y96 A;  3Q1J A;  4NCX A;  4M75 A;  1WQ7 A;  2QHU A;  5LJ5 h;  4BE0 A;  2ZZE A;  1VQK T;  4QQG A;  3P8T A;  1BIB A;  2DKG A;  4HCB A;  1N27 A;  3M56 A;  3CCR T;  2WSF E;  3A8O B;  5CK9 A;  4HCC A;  2Q7G A;  2EFI A;  3JCM b;  4PL6 A;  3OYE A;  1W66 A;  4N4I A;  1E22 A;  2GCX A;  3QUI A;  4RG2 A;  4XQ3 A;  2GQV A;  1YJN A;  4XTW A;  3REU A;  2XD0 A;  2YLC A;  4XTV A;  4M7A F;  4KUL A;  5LJ5 g;  3SD4 A;  3E9F A;  1LJO A;  4CS2 A;  3CCV A;  4PKC C;  2CJB A;  2P4T A;  4TVW A;  3FJP A;  2ZT5 A;  2EQJ A;  3HSB A;  1MHN A;  3ZFJ A;  3OSS C;  1X75 C;  2JNG A;  2P5I A;  4EMG A;  2G3R A;  3OYB A;  3RAC A;  2DXB A;  5GAM j;  2DIG A;  4CH5 A;  3AHU A;  1I8F A;  2DTI A;  3P8D A;  3E19 A;  1B8A A;  3IAL A;  4P74 C;  3PGG A;  2XGT A;  2JN0 A;  3JCM X;  2ALY A;  3V7R A;  1JBM A;  3CCS A;  3MP1 A;  4P75 C;  4NOY A;  4HWS A;  1VQL A;  4JLG A;  3TCJ A;  3UGQ A;  1VQO A;  5J39 A;  5CAI A;  2LQ8 A;  4EMK C;  3CXC A;  3QYH B;  1VQ9 A;  5KH6 A;  3CCE T;  2ZTG A;  3IG2 A;  2RA2 A;  1JJC B;  1X54 A;  2A7Y A;  3HHT B;  2CZ0 B;  2JUF A;  1WJR A;  2XDP A;  4WF2 A;  2QHS A;  3WVE B;  3OA6 A;  3BW1 A;  2RHU A;  2CYZ B;  1QW1 A;  3HRS A;  1BBU A;  4K88 A;  4B9X A;  3W3S A;  3DB3 A;  5GMK j;  2EJ9 A;  5DLO A;  3RKX A;  3SWN B;  3QBY A;  4UC4 A;  1Q81 C;  2MI6 A;  5GAN 5;  2K5L A;  1B7Y A;  4YRT A;  3VQW A;  3GNF B;  3QKJ A;  2HBP A;  3PNW C;  4HCZ A;  1Y71 A;  3CPW S;  3TEE A;  3A74 A;  4LVI A;  1IRE B;  2QEX A;  4XU2 A;  2H3J A;  4M75 B;  2RHQ A;  4ZN3 A;  1ASY A;  4L59 A;  2ZR2 A;  2O4X B;  4NL3 A;  3I7F A;  1Q82 C;  3QTC A;  1ZHI A;  5C6S A;  2ZT6 A;  3DKM A;  1NJ2 A;  2LT1 A;  4BI4 A;  1ZBX A;  5GAO n;  2M9U A;  4HA8 A;  1Q7Y C;  1X01 A;  4JS4 A;  3CC4 T;  3EAE A;  1B70 B;  3A31 A;  2ZXF A;  3JCM P;  3BDU A;  4XU3 A;  5HGQ A;  2ZIN A;  3CC2 T;  5D6W A;  2XID A;  5D6X A;  4EDU A;  1PYS A;  4H2V A;  5GAO l;  1H4Q A;  3HFZ A;  4QQD A;  3A5Y A;  5IT9 E;  2X4J A;  2P0P A;  1X2G A;  3M54 A;  2ZIM A;  1ASZ A;  1MGQ A;  1YIT A;  3OYA A;  3OS0 A;  1KC8 U;  4PHC A;  2DVE A;  4ZIB A;  5GAM f;  2E10 A;  3CCJ T;  1PSF A;  1JB0 E;  2XTI A;  3URG A;  2DQ0 A;  2EKO A;  3CMA T;  2XIC A;  2AHJ B;  3JRZ A;  2KK4 A;  3RL6 A;  3P8V A;  3S3N A;  3HKS A;  3E1S A;  3MQZ A;  1N9W A;  5F5W A;  3MF1 A;  1WLE A;  2DZC A;  3EFR A;  1WJS A;  2PVD B;  5GAN 3;  4YRE A;  2VXF A;  3QHS A;  4MZM A;  2OTJ A;  4HT8 A;  1YB3 A;  2I4N A;  4ZN1 A;  1VQN T;  5GAM h;  3MP6 A;  4CH6 A;  4HT9 A;  3OBW A;  2LX9 A;  4EPC A;  3RIR A;  4LD9 K;  1D3B B;  3NTI A;  5C0M A;  2EWN A;  4XEM A;  4DA4 A;  1BIA A;  4BUG A;  3LX7 A;  1G3T A;  5A0L A;  1FX7 A;  2DPP B;  4QQ6 A;  4JRP A;  1E1T A;  1M5Q 1;  1W4S A;  2ZCF B;  4OB0 B;  3E9G A;  3GF5 A;  4C8Q C;  2EL9 A;  3UWN A;  3G4S A;  5GAM g;  4ZTF A;  2FYK A;  2CIM A;  4EO4 A;  4ZTU B;  3TEH A;  3BFM A;  5LJ5 e;  1JJ2 A;  2ZT8 A;  3CCM A;  3IKL A;  1K73 C;  5LJ3 d;  1TH7 A;  5KCO A;  3MEY A;  4JLI A;  2IG0 A;  3E9H A;  5GMK h;  3H8Z A;  2KSS A;  4GY5 A;  1H3Z A;  4P74 A;  2RJE A;  4DPG A;  5GAO m;  2DXU A;  3M57 A;  1S72 T;  4P75 A;  3NET A;  4PJO G;  4FT2 A;  4LDX A;  3UFG A;  3JB9 H;  3HXW A;  1VQ6 A;  2PUK B;  1YI2 A;  4YCW A;  4M75 F;  3PZC A;  1UGP B;  3JAM E;  1M1G A;  2QQA A;  4M77 B;  4C8Q D;  2XDD A;  3GOX A;  2C8M A;  4BE1 A;  3BY7 A;  4P3N A;  2LRQ A;  2QI2 A;  5I2S A;  3VQX A;  4YRF A;  4CH4 A;  5DY9 A;  1VQK A;  2MAM A;  3CCR A;  2E12 A;  1VQM A;  2ZZF A;  3QSU A;  4X34 A;  4PJO A;  4YRR A;  3CCQ T;  3L2U A;  4PNO A;  3L2R A;  1SET A;  3FIF A;  1HXD A;  3M4P A;  4BWA A;  4F7U G;  1HC7 A;  1BKB A;  4RKU E;  2PU9 B;  2JOY A;  4J15 A;  4P71 C;  1M90 C;  3LH0 A;  4MZP A;  5D6Y A;  2AMC A;  4YCV A;  1KG1 A;  5CO7 A;  4FM4 B;  3QPH A;  2AKW A;  3HFV A;  3WVD B;  3FEO A;  1V29 B;  4C0D C;  4F7U E;  2EIF A;  1K9M U;  1WU7 A;  2P0L A;  2JVV A;  5IAY A;  4F7U A;  4RCC A;  3S3M A;  4IUU A;  2VV5 A;  4YPF A;  1B34 A;  5FRM A;  4M7D B;  2EQK A;  2EJF A;  3OYF A;  2VYT A;  2QA4 T;  4BB7 A;  4TVY A;  1WQW A;  2IY5 A;  1ADY A;  3TEH B;  3DB4 A;  3PIO A;  2RI5 A;  2J3L A;  2QXF A;  1VQ8 A;  4CH3 A;  2M16 A;  2FVU A;  3M4G A;  1HTT A;  4PLI A;  2X35 A;  4JJN K;  3HRU A;  4IKF A;  5CQX A;  3HFO A;  2RK2 A;  3G7Z A;  1NE8 A;  4C92 C;  2XKO C;  3VV0 A;  5J26 A;  2VXE A;  3CBP A;  3OY9 A;  4BI8 B;  3JCM Q;  1BBW A;  1EQR A;  3INZ A;  3OYM A;  3L2Q A;  2V8J A;  1VIF A;  5GMK l;  1Z7N A;  5CKD A;  4RCB A;  4YRQ A;  4XU0 A;  4C8Q G;  4YRC A;  3CXC S;  2DTH A;  2PQW A;  4JS5 A;  2I2L A;  3A5Z A;  4X9C A;  4DQ2 A;  4KR3 A;  2CZ6 B;  2KY9 A;  2K5F A;  2DJZ A;  2DXC A;  1NJ6 A;  4M77 D;  2DAQ A;  5CR2 A;  3G6E T;  2XU8 A;  3A8M B;  3CCL A;  3M4Q A;  1H4V B;  1USY C;  1O75 A;  4N0A A;  3MP8 A;  4BDZ A;  3TU4 K;  4PJO B;  4C8Q E;  2DTO A;  3HP9 A;  1HK9 A;  1VQP A;  2RJD A;  2RI2 A;  1M8V A;  1LNX A;  1QP3 A;  2B8A A;  1VQ7 T;  3M4Y A;  1N9R A;  3WXM B;  3CC4 A;  2IVW A;  5FLX E;  2O01 E;  3HXZ A;  4C92 D;  1BI3 A;  4V2S A;  3JCM W;  1LOJ A;  1NJI U;  4M77 F;  3JB9 J;  4KR2 A;  4BAC A;  1SSF A;  3QII A;  4L5G A;  1WPY A;  3RUX A;  3A8L B;  5GAM e;  3DSQ A;  3MCA B;  5KNN A;  1KD1 U;  5GAO r;  4A54 A;  2ODR C;  4C92 F;  2XI9 A;  2P0Q A;  3CME A;  4XTZ A;  3CMA A;  4A4K A;  2K3Y A;  4BY6 B;  1QF6 A;  2RO0 A;  5GAN 8;  2D0Q B;  4Q6G A;  4TQF A;  2JTF A;  4DOV A;  4R56 A;  4XEO A;  1EIY A;  2PVG B;  4HVC A;  3FLG A;  3C95 A;  3OS2 A;  1ADJ A;  3UDC A;  4M78 B;  4OP0 A;  3QO7 A;  1YJW T;  1NJ1 A;  4P5N A;  4H2T A;  1G5V A;  5GAN j;  4M7A G;  4YRI A;  4N4H A;  3QO5 A;  1RL2 A;  4A4E A;  4P72 C;  5GMK e;  5GMK m;  4Z02 A;  3KUF A;  1VQN A;  1Y96 B;  3HRK A;  2X4W A;  2ZGW A;  4XTX A;  4M7D F;  1YJN T;  3NTK A;  4EX5 A;  5GMK i;  4BDY A;  3ZBD A;  1BI0 A;  2ODR D;  3PT9 A;  2L3R A;  1SRY A;  3S3O A;  4M7A E;  1UB4 A;  3UGT A;  4M7A A;  3I55 A;  2LDM A;  4JRI A;  5LJ3 j;  4C5E A;  3G1Z A;  1G3W A;  3LWI A;  3FDR A;  2YHT A;  1UGR B;  2OTL A;  2ZPE B;  3LGF A;  4TTV A;  3CMQ A;  2DIQ A;  3PFS A;  1VQ5 A;  5KE3 A;  3T9N A;  2RHS A;  2K57 A;  3G71 T;  1NYQ A;  1VQZ A;  4ATO A;  4OGE A;  1KMM A;  1YBY A;  2E6Z A;  4MDW A;  3REX A;  4C5H A;  4J6Y A;  2DXT A;  3OS1 A;  4C92 G;  4YTL A;  2VGM A;  4BY6 C;  3ERR A;  2Q5I A;  1K8A U;  4OB2 B;  5GAN 2;  3LC0 A;  4G85 A;  3CCS T;  3MEU A;  3JCM c;  4DOW A;  1VQO T;  1EIF A;  3HL8 A;  3SWN C;  1JJ2 S;  3VYH B;  2VUB A;  2CGH A;  4MZT A;  2QQS A;  1H4S A;  2ALY B;  4QVZ A;  1VQ9 T;  2BKD N;  3CC7 T;  1U1S A;  3MO8 A;  4C92 E;  2FL7 A;  4CI0 C;  1KQS A;  4R55 A;  4LDV A;  1YIJ A;  4C5G A;  2DD5 A;  1PSE A;  2QDY B;  1NPR A;  3RF1 A;  2OAU A;  1NPP A;  2ZT7 A;  4MDX A;  4M75 C;  12AS A;  1EVK A;  1YGB A;  3V8L A;  5FU6 B;  4LVJ A;  2EQM A;  3L4G A;  4TVA A;  2ZPI B;  5GAN d;  3JB9 D;  4RDX A;  3CCQ A;  2MWO A;  3OYJ A;  2DU5 A;  3HTZ A;  3MEW A;  2I4O A;  3HY1 A;  3PCO A;  3L2Z A;  3QNE A;  5CQY A;  3C94 A;  3OYC A;  2Y90 A;  3OSV A;  1Y7X A;  4GLK A;  1VQ4 A;  4KBM B;  2QEX T;  4YDQ A;  4E7J A;  4O6J A;  1KD1 C;  4LVK A;  1B7Y B;  3X24 B;  5E3I A;  2LTO A;  3LSS A;  4YCU A;  2D9T A;  4XK8 E;  5GAN f;  2ART A;  3QO3 A;  4E51 A;  4BW9 A;  2CS7 A;  4M78 D;  3VJP A;  3JB9 F;  2ZNI A;  1M1F A;  1EFW A;  3A8G B;  2RHQ B;  1XTD A;  2KDS A;  3X28 B;  1E1O A;  3L2W A;  3IKM B;  4RG8 A;  4YRK A;  1N8R U;  4LD6 A;  4M75 D;  3QG1 A;  1YFR A;  3JCM d;  1Z7M A;  1YHQ T;  2ZPF B;  3QXE B;  4M78 F;  2GFU A;  5J3B A;  2KMT A;  3RMQ A;  3H6Z A;  1U8R A;  2MF2 A;  5LJ3 f;  2Q5H A;  3OYY A;  5EG2 A;  5GAN 7;  3DLM A;  4IUT A;  4ZGJ B;  4EMK A;  3JCM J;  1YIT T;  1PYS B;  3HFZ B;  4XAX B;  5A0D A;  3JCM f;  4OB1 B;  2QHT A;  1O9S A;  1NNH A;  2RB6 A;  3ZEH A;  5GAN g;  4P73 C;  4JRK A;  4LDU A;  4CRI A;  3OYD A;  4WJ4 A;  4H2U A;  4PLL A;  3WQZ A;  1YJ9 T;  4H2W A;  5C51 B;  3OBY A;  5LJ3 h;  11AS A;  4E7I A;  1X2H A;  4RQF A;  1P92 A;  2DDZ A;  2I4L A;  3HXY A;  3GPL A;  2EJG A;  2OTJ T;  4ME7 A;  3A32 A;  3VYG A;  1G51 A;  5ELO A;  3QJ6 A;  3JSC A;  1KQ1 A;  1SES A;  4YYE A;  4LDW A;  3V7C A;  1KC8 C;  3G6E A;  2R57 A;  5LJ3 g;  4TVA B;  3M59 A;  2DQ3 A;  4Y28 E;  1YFT A;  1VUB A;  1NZ9 A;  3ER0 A;  5I2M A;  2PUO B;  3I56 T;  2HQX A;  1VQ7 A;  1XOV A;  3JCM g;  3G4S T;  2E5Q A;  5LJ5 d;  2GFA A;  3J80 E;  1JRI A;  1OZ2 A;  2ZPG B;  1KQ2 A;  5A0G A;  3HRT A;  1Q81 U;  3OQ5 A;  3OW2 A;  4G84 A;  3CCM T;  2A3L A;  4J6W A;  1I4K 1;  3RES A;  3VU3 C;  5KCH A;  2XG8 D;  4YP0 A;  4WI1 A;  4JDS A;  1JJC A;  3M53 A;  5FRO A;  4H2X A;  2CZ7 B;  3VQV A;  4M77 C;  2QQB A;  5CKH A;  4J7I A;  4CS4 A;  4M75 G;  1RI0 A;  3HXV A;  1NYR A;  1QVF A;  3M5A A;  1LYL A;  2DU7 A;  3CCE A;  1U1T A;  3UPU A;  2DK3 A;  2BUD A;  3OYG A;  1W2B A;  2KQW A;  4IUR A;  4O5V A;  3OMG A;  3QDR B;  3RKW A;  1KOG A;  3SWN A;  1VQ6 T;  2PVO B;  5AYF A;  3CD6 T;  1YI2 T;  1I5L A;  2RJF A;  3FB9 A;  1Q86 U;  2L5Q A;  3RKY A;  3L42 A;  4M75 E;  2C06 A;  4II1 A;  4EMK B;  4L87 A;  5GAO q;  2R58 A;  4MML A;  5LL6 S;  4QW2 A;  1I81 A;  4HWT A;  2WSC E;  3S6W A;  3V7S A;  1N8R C;  3MF2 A;  2O4X A;  1VQM T;  2ZZG A;  2DEQ A;  4QVC A;  4ZTJ A;  5K1P A;  4YRJ A;  4UP8 A;  2E70 A;  2K4Y A;  3FRN A;  3F70 A;  4E7K A;  4PG3 A;  3BDL A;  4XU1 A;  1B70 A;  2RHZ A;  3P8B B;  5GAN 4;  4OGC A;  2RJC A;  4M7D C;  4C8Q A;  2RHY A;  3ME9 A;  3VQY A;  3LLR A;  1WNL A;  1M1K U;  5CVI A;  4H2S A;  3M55 A;  4C0G A;  4BD3 A;  2QQ9 A;  3CC2 A;  4XTU A;  4YRS A;  4UP7 A;  2AMC B;  2E1H A;  5IN1 A;  3C12 A;  1GXI E;  3G71 A;  1QP2 A;  4VUB A;  4RMO A;  3HXU A;  1L0W A;  2AKW B;  2JTM A;  4YRP A;  4FL6 A;  2LCC A;  1VIE A;  2CJA A;  4J5Y A;  3BJU A;  4YRL A;  3CCU T;  3LYI A;  4F7U B;  5A2Q E;  4C5I A;  3CCJ A;  2LNV A;  2J3M A;  3N5B B;  5FU7 B;  1B34 B;  4K86 A;  3CPF A;  3MET A;  2DD4 A;  4FT4 A;  4P3O A;  2WAC A;  4E7H A;  1VQ8 T;  2F5T X;  3CC7 A;  3QJY A;  4RQE A;  1QE0 A;  2YRV A;  1RIQ A;  2R5A A;  2IY5 B;  3M9Q A;  4K87 A;  4M7D D;  4H2X B;  3OYK A;  3QYG B;  3X20 B;  3MEV A;  1WGS A;  4N4G A;  3LW5 E;  4ZGD B;  3PTA A;  1IZ6 A;  4P73 A;  1K73 U;  3KFU A;  3NEL A;  1K9M C;  3OYL A;  1Y07 A;  1D3B A;  1FWZ A;  3JCM V;  4HKE A;  1QVG S;  4TQD A;  3GNG A;  3DLL A;  4HWO A;  1SER A;  2ZPH B;  3J7A F;  5ELN A;  4PJO C;  1UGQ B;  4J7F A;  4BE2 A;  4MMK A;  4B9W A;  5GAN e;  4X9D A;  2K3X A;  4KUI A;  3NFC A;  4OF1 A;  3HXX A;  1KQS S;  5CKE A;  3NEN A;  5I21 A;  3FC3 A;  2Q7H A;  4P71 A;  2RM4 A;  4OMF B;  3VKI A;  3CCV T;  4H2Y A;  2X4X A;  4LVM A;  2EAY A;  1C0A A;  2F5K A;  2WSE E;  2P0K A;  3A5Z B;  5GAN 6;  3CCL T;  3NTH A;  4A53 A;  5FRN A;  4TVR A;  4M77 G;  2E3C A;  2I4M A;  2EQU A;  2LVM A;  3QZ5 B;  1VQP T;  1KHI A;  2V8I A;  3E9I A;  4OLF A;  3HFN A;  2MWP A;  3CBO A;  4NS5 A;  1WYD A;  2ZZD A;  1X56 A;  2K2V A;  1Q86 C;  3KXT A;  2PME A;  1G5H A;  5LJ3 e;  2K5I A;  2BIV A;  5FU7 C;  4KUD K;  4C8Q B;  5GAM d;  3OYI A;  1YHQ A;  3HRI A;  3OMC A;  2E6N A;  5CKB A;  1G5I A;  4M77 E;  4PJO D;  1S72 A;  3PMT A;  4HWP A;  1QVG A;  4YRO A;  3JCM e;  4OB3 B;  4CS3 A;  4Q15 A;  4M77 A;  1NJ5 A;  1B76 A;  1VQL T;  1M90 U;  4M78 C;  5CKF A;  2E64 A;  2LC4 A;  4QVD A;  3PIP A;  2ZIO A;  3CPW A;  2ZPB B;  4E7L A;  3CME T;  3CBM A;  4FSX A;  4A4H A;  4P3P A;  3LWH A;  4C92 A;  4PJO F;  2XK0 A;  4JRQ A;  3GIB A;  2X4Y A;  4A4F A;  3X25 B;  3SDZ A;  1M1K C;  5KE2 A;  1OZ3 A;  2VGN A;  3A8H B;  1YJ9 A;  1OI1 A;  4HWR A;  3ICA A;  2VC8 A;  1DJ7 B;  1NJI C;  4M7D G;  4Q5W A;  3CEY A;  1EIY B;  3L1A A;  3A7U A;  4X5O A;  2GF7 A;  4JUV A;  1FYF A;  3X26 B;  3OYN A;  1EVL A;  3UH0 A;  4YRM A;  3A7R A;  4ZTZ B;  2V8K A;  2G4C A;  3GLX A;  3TEG A;  3SB2 A;  3P8H A;  2E65 A;  1USY A;  4BI3 A;  3PMI A;  2XHC A;  4NL2 A;  4E47 A;  5K1X A;  4M7D E;  5HK3 A;  4N0A C;  3HY0 A;  4UP9 A;  4F7U F;  5LJ5 j;  1G3Y A;  4M7D A;  2A8E A;  3I56 A;  2RI3 A;  3V8K A;  3KBG A;  4J83 A;  2HD0 A;  4L6V 5;  2QHV A;  1E24 A;  3I55 T;  3ASK A;  2Y4X A;  3M58 A;  2OTL T;  3QZ9 B;  3VUB A;  1BYM A;  5L8R E;  4M7A B;  1VQ5 T;  2QA4 A;  2JZ2 A;  3LGL A;  5GAN h;  2LT4 A;  2M0O A;  3TUP A;  1XNI A;  2RD1 A;  3RGL A;  5C53 B;  3J81 E;  4C0D B;  2R5M A;  4XTY A;  3OYH A;  4A4G A;  1R8O B;  3UT1 A;  3OB9 A;  5CCA A;  3C4S A;  2RHS B;  1IL2 A;  4TWA A;  3OS5 A;  3NEM A;  4RMF A;  4C0Z A;  4OVA A;  2RK1 A;  4D6W A;  5HK0 A;  5FU6 C;  1EOV A;  2HNI A;  4UPA A;  1X6O A;  1ZQ1 A;  3OD1 A;  3OW2 S;  2EYQ A;  5DLQ E;  2CZ1 B;  2ZR3 A;  2FB7 A;  1BI1 A;  3CD6 A;  2PMF A;  2RHI A;  2MMP A;  5HKC A;  1WJQ A;  1YCY A;  3EFS A;  2DO3 A;  1ATI A;  2XDB A;  3GP8 A;  1YFS A;  1YIJ T;  3JB9 I;  3V8J A;  1QVF S;  4H02 A;  2FHD A;  1KHC A;  3QO8 A;  3RER A;  2KVQ G;  4PJO E;  4KT0 E;  4EMH A;  5M9O A;  4P72 A;  3A7A A;  1W2B S;  2LCL A;  5CIU A;  4C0F A;  4J8O A;  4ELY C;  3VUZ A;  3JCM h;  4C92 B;  1NJ8 A;  3JB9 G;  3RMS A;  1K8A C;  4C8Q F;  1OYX A;  4HT4 A;  3L4G B;  2HQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...