3L2ZA

Crystal structure of hydrated biotin protein ligase from m. tuberculosis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
258
structure length
240
Chain Sequence
RPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTTARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural ordering of disordered ligand-binding loops of biotin protein ligase into active conformations as a consequence of dehydration.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords BirA bifunctional protein
total genus 71
structure length 240
sequence length 258
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2zA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3l2zA01
2DU7A 1X56A 4M7DD 4LNSA 3L4GA 1RIQA 2DU5A 4J6WA 4WF2A 5GANf 4DPGA 1G5HA 4C8QA 4XEMA 2VC8A 2DXTA 3REXA 2AKWA 4EMHA 2XGTA 3MEYA 2I4LA 4M75A 5LJ5e 3V7RA 5GAMh 1U1TA 3A31A 3MF2A 4A53A 5LJ5d 1QF6A 4C8QB 3LC0A 2PMEA 4YRSA 4K86A 4WI1A 3HXZA 5ELOA 4YPFA 3V8LA 1B8AA 5GAMe 4PJOC 3QO3A 1PYSB 3RIRA 4TWAA 4H2WA 4NCXA 3HY0A 5GAMg 5GAN6 1NJ8A 2E41A 5LJ5f 3CMQA 3BW1A 4YRGA 5GAMf 4YRLA 2IY5B 5LJ5g 3JCMW 1QE0A 4P74C 1WYDA 5HGQA 4WJ4A 3VQWA 4XTYA 3RF1A 5GMKh 2ZIOA 3HFZA 4XTUA 3JCMV 5GAOl 3HFZB 4PJOF 5GAOr 3V7SA 4V2SA 1M8VA 5GAN8 2IY5A 4M75D 5LJ3e 4EMKB 1GGMA 4P72A 2ZT6A 4C8QD 3JCMg 2RHSB 5GAMd 2QTXA 1H4QA 1NNHA 4C92A 4P71C 4YCWA 4YYEA 4C8QC 5LJ5h 2ZINA 1EIYB 3VU3C 4P73A 5GANe 4YRRA 4CH5A 4CH6A 2DTHA 4UPAA 4PHCA 4RQEA 1ASZA 4O2DA 3VQXA 2E10A 4JRIA 4QVCA 2HNIA 4YRQA 5GANg 5GAN7 1X2HA 5GAOm 1I4K1 4WJ3M 2DJZA 5C51B 4QVDA 4P75C 3QSUA 4BW9A 3P8VA 4C8QG 4HVCA 2ZT5A 4M78B 4M75B 4P75A 5LJ3f 3VQVA 2I4NA 5GAOp 12ASA 2AKWB 5LJ3d 3SWNA 3VQYA 1KOGA 2DQ3A 3FB9A 1C0AA 2ARSA 4RCCA 2DVEA 3JCMc 4RQFA 3IG2A 3EFSA 4XU1A 2I4OA 1USYA 2P0LA 3L4GB 4Q6GA 2ODRD 4XTXA 3P8YA 1N9WA 4M77A 4H2UA 1SESA 3REUA 5GANd 1G51A 4YROA 4M77C 1NJ5A 1H641 4M77F 3HRKA 4BWAA 2VXEA 4N0AC 1SRYA 4F7UB 3RERA 4TTVA 3P8TA 2AMCA 5GAOq 1B7YB 4RDXA 4NL3A 2Q7GA 2FYKA 1IL2A 4TVAA 4PJOG 3JCMP 3QUIA 3RKXA 3HFNA 4M77E 5GMKi 4ZTZB 2I2LA 1D3BA 3IKLA 4M7DE 1EVLA 1H4TA 1I8FA 11ASA 1YCYA 3A7AA 3SB2A 1B70A 2ZR3A 4TQFA 4YRFA 4H2SA 4OLFA 3HTZA 2CIMA 3R07A 5K1PA 2XTIA 3JB9H 4HT8A 3HXUA 4XTZA 4YRCA 3UGQA 5GMKm 5GAN5 2ZIMA 4P72C 2C7IA 4P71A 3KFUA 1JBMA 5KNNA 4JRKA 4HWTA 2DKGA 3UGTA 4K88A 1MGQA 3RKYA 5GAN4 1EQRA 1YFRA 3FIFA 3TEGA 1BIBA 3JCMQ 1JJCB 3RUXA 4G85A 4PNOA 3A5ZA 4YCVA 4UP7A 2E5AA 2ZTGA 3A5YA 3JB9I 3HFOA 3UFGA 3LSSA 2YHTA 1W66A 5LJ3h 4PJOA 2VXFA 1Y96B 1EFWA 2QHSA 2ALYB 3V8KA 5CAIA 1FYFA 2Q7EA 4YDQA 1BIAA 3PZCA 2EAYA 1E22A 1X2GA 4M7DC 4TQDA 2DZCA 2RHQB 1B34A 4YCUA 4M75G 2ZR2A 1H4SA 1NJ2A 4M7AB 3PCOA 1X55A 3OD1A 3QTCA 2DZ9A 3M4GA 2G4CA 2QHTA 3LSQA 2E3CA 5DY9A 4KQEA 4P73C 1Z7MA 5LJ5j 4NL2A 1NYRA 3L1AA 4H2VA 3QHSA 1WNLA 2ZXFA 3RESA 4HT9A 3JB9D 1E1TA 2RM4A 4M7DF 4X5OA 4M78E 4H02A 4YREA 4YRJA 3JCMX 4JUVA 1LNXA 5C53B 2ZNIA 1X01A 4XTVA 4XU3A 3RGLA 3FJPA 1ADYA 2PMFA 4XU0A 4M78F 3JCMd 4YRNA 4H2XA 4AH6A 3RKWA 4M7DG 1YGBA 4PJOD 1Z7NA 4A54A 4M7DB 4TVYA 4UP8A 4M7AE 4L87A 1NJ6A 3VBBA 3JCMJ 4EO4A 3SWNC 3QO8A 4YRKA 2ZZGA 3QO5A 3JCMb 3PCOB 4XEOA 1J5WA 2YLCA 3A7RA 1BBWA 3TEHA 2RHQA 1HXDA 4YRMA 3HSBA 4M7AF 2DEQA 2ARUA 3WQZA 1WLEA 2P5IA 2EJGA 1ATIA 5GAMj 3JB9F 1NJ1A 2ALYA 1VQZA 3A74A 4N0AA 2FB7A 4DQ2A 2E64A 5GANh 4PJOB 5F5WA 2QHVA 3A32A 3TEHB 4C92F 3INZA 4C92C 4M78C 4X9CA 2I4MA 5GAOn 1E24A 1KMMA 1LJOA 2Q5HA 4C92D 4M7AG 4M75E 2DTOA 2JN0A 3HXWA 2QHUA 4UP9A 1JJCA 5GAN2 4M7DA 5K1XA 3BFMA 1U1SA 1H4VB 1SETA 4KR2A 1YFTA 4M77D 4EMGA 1EVKA 4H2XB 3JCMe 1X54A 4PG3A 1ADJA 3BDUA 1I5LA 4G84A 2EJFA 4M7AC 1EOVA 3ICAA 1N9RA 2J3LA 3M4QA 1LOJA 3DSQA 2J3MA 2RD1A 3PGGA 4HWSA 2RB6A 4M78G 4NOYA 4E51A 4C92G 4M7AD 3V7CA 5LJ3j 3E9IA 2ODRC 1YFSA 3NELA 3AHUA 4CH3A 3E9HA 1ASYA 2ZZEA 4X9DA 3IKMB 3GIBA 1D3BB 3QO7A 4TVAB 4Y91A 1JRIA 2RA2A 2YLBA 3HXXA 5E3IA 4OP0A 4CS3A 4J6YA 2E1HA 4YRTA 2CJ9A 4XTWA 4HWOA 4P3NA 5GANj 1WQWA 2AMCB 3UH0A 3RACA 4RMFA 4F7UA 1G5IA 1WPYA 3NEMA 4M7AA 2Q5IA 1USYC 1SERA 4F7UF 2ZGWA 1B34B 4P74A 4H2TA 3HXVA 3MF1A 4M77B 1NYQA 4ZTUB 3IALA 2CJBA 4P3OA 5GAN3 4YRIA 1TH7A 5C52B 4C8QF 1Y96A 4RCBA 4XQ3A 2ZT8A 2ZNJA 5GMKl 2C8MA 4YP0A 3HXYA 4F7UE 4Q15A 1B76A 3SWNB 3HY1A 1HK9A 4C92E 5I21A 1HTTA 3HFVA 1WU7A 4HA8A 3EFRA 4M78A 4XU2A 3NENA 4C8QE 3G1ZA 1N9SA 4M75C 4M75F 4CS2A 1E1OA 3QNEA 4CH4A 2K57A 1WQ7A 3JCMh 5ELNA 3L2ZA 4J5YA 1I81A 3W3SA 3BJUA 2Q7HA 4ZIBA 2CGHA 3I7FA 3M4PA 4F7UG 3BY7A 2DDZA 4JLIA 2DQ0A 4HWPA 1EIYA 5GMKj 3JCMf 4C92B 3JB9J 4H2YA 3JB9G 2E65A 3A7UA 2RHSA 2ZCEA 4M77G 1HC7A 1M5Q1 3V8JA 3HRIA 4P3PA 4EMKA 4YRPA 2EJ9A 2CJAA 1BBUA 4HWRA 4J6XA 1B70B 2EL9A 2ZT7A 4PJOE 3TUPA 4TVWA 3RL6A 4CS4A 2ZZFA 1LYLA 2EWNA 2Y90A 1B7YA 2ARTA 3NETA 1L0WA 4MMLA 4J15A 1KMNA 4EX5A 4MMKA 4K87A 5LJ3g 1YB3A 1PYSA 4M78D 1KQ1A 3ERRA 1KQ2A 5GMKe 4EMKC 4KR3A 2DTIA 2DXUA
chains in the Genus database with same CATH superfamily
3VKIA 3CC4A 3I55Q 1TS9A 1RIQA 1PC0A 4LDYA 1G5HA 2B86A 3OW2S 1RAFB 2KK4A 3OSSC 2F1LA 2W0ZA 4XEMA 1BI0A 2AZVA 3UA6A 2CUBA 2ZPGB 1ARKA 2AKWA 1OEBA 2ENMA 2XGTA 3MEYA 2I4LA 2CS7A 1ZUKA 5LJ5e 3V7RA 1M1FA 2GF7A 1TSFA 2RHXA 4YRSA 3L2QA 2J7IA 2EQIA 4FSSA 4K86A 2OTLT 2CDTA 3QPHA 1BYMA 1D1CA 1YJ9T 1NLOC 3QDFA 3HRUA 1TWBA 2EIFA 5CR2A 4OMNA 4PJOC 1BCMA 1SEMA 1PYSB 2QG9B 3TSZA 3VUBA 4FYVB 4H2WA 4E2FB 3CMEQ 1VQ6A 1MMDA 5IHNA 1WXTA 5GAMg 3TVTA 3EG1A 1NJ8A 4GBQA 1Q7YR 1YHQA 4ELYC 1G83A 1OOTA 1PKTA 2RQVA 3QKJA 4MZMA 4BD3A 4YRLA 5LJ5g 4YRGA 2L2PA 3JCMW 1E6HA 1MMGA 1RLQC 2DRMA 3CMAQ 1SKUB 5HGQA 3VQWA 4XTYA 3PIPA 5GMKh 2ZIOA 3JCMV 5GAOl 4BB7A 4PJOF 2LTOA 4V2SA 3WVDB 3OYMA 3TCJA 4C5EA 3ZBDA 1R0BG 4M75D 2LT4A 4P72A 2O31A 3WVEB 2QTXA 3S6WA 2OTJT 4YYEA 1IGQA 2ZINA 1EIYB 3HHTB 3KBGA 2OX7A 1UGPB 2DAQA 4P73A 3L2VA 1QP3A 2O4XA 1RAGB 2DTHA 2CT3A 4RQEA 4O2DA 4AG2C 3VQXA 1C6VX 1A0NB 1X2HA 2VKNA 1M3AA 2YUPA 1I4K1 4XK8E 3OYLA 2E6ZA 2KT8A 2EYQA 4HVCA 2ZT5A 4M75B 3RMSA 4RG2A 3UF4A 4FU6A 2AHJB 2EPDA 2I4NA 3VQVA 3LYIA 12ASA 5KH6A 2LJ3A 2RQWA 1C0AA 4LNPA 4RCCA 2DMOA 1K0XA 4RQFA 2W10A 1Q81C 2GGRA 3EFSA 2K5LA 3VYGA 5FRMA 4OMLA 1ZHIA 1SESA 2F5KA 1KQSP 1YNZA 2K3YA 4K11A 2M16A 2VXEA 2EKHA 4D6WA 4PJJA 4TTVA 3P8TA 4BY6B 4E7ZA 2ZPIB 1FMVA 2RI3A 1JJ2A 4RDXA 2EGCA 2FYKA 5HY6A 3JCMP 2MYSA 3QUIA 2J6FA 4M77E 3IKLA 2QDLA 2XG8D 1VQPT 4E47A 2RQRA 2O2OA 2DA9A 5IN1A 5IXFA 2FZGB 1NJIR 2JNGA 2LZ6B 4LVJA 2KMTA 2XI9A 2BZXA 5K1PA 3HXUA 4HT8A 4JZ4A 2ZIMA 1UFFA 2L3QA 4P71A 2CKKA 4BE0A 4CRIA 1M4ZA 1MGQA 4JZ3A 3RKYA 2KI7A 1GBRA 3TEGA 4QQGA 3JCMQ 3MHXA 2OTLQ 1S1NA 4OB2B 2KAFA 4QW2A 3A5ZA 2JT4A 5D6XA 3T9NA 3CCLA 2H3JA 2K2VA 4HXJA 4AFUC 3JB9I 2XK0A 3UFGA 2YHTA 3CC2A 3N5BB 1N5ZA 2VXFA 3I56A 3EFOB 1G8XA 4B9XA 1S72T 1FYFA 1GRIA 1KC8R 5J26A 1BIAA 1I5OB 1K1ZA 2EAYA 4C0GA 1E22A 4M7DC 4TQDA 1ZUYA 3PMIA 4M75G 2COZA 1K8AR 1X55A 5IHIA 1ABOA 2GFUA 3O8VA 3OD1A 3QTCA 1AWWA 5A0DA 4OB1B 1AZEA 2DZ9A 2E3CA 5DY9A 1Z7MA 1U3OA 1WLPB 3OYAA 2V8KA 4H2VA 3QHSA 4J8OA 3RESA 3JB9D 1E1TA 2K9GA 3CCQT 2NUTB 3OYBA 2GTOA 1D0YA 2JTFA 5A0GA 4TVRA 4YREA 2EFIA 1FXXA 4XU3A 1MV0B 3OYFA 3A1PA 1ADYA 1AD5A 3CCQQ 4M78F 2MAMA 3LW5E 2K2MA 2RN8A 3C95A 3MQZA 1YHQT 5FU6B 3URGA 5HKCA 1QCNA 4UP8A 3RNJA 4D8DA 3VBBA 5KCHA 4EO4A 1X75C 3QO8A 4YRKA 4J9DA 2K79A 4C0DB 1R77A 5CVIA 5KYUA 1VYTA 2YLCA 3TEHA 4M7AF 2ARUA 1V76A 2CT4A 2P5IA 1QVFS 2FEIA 1N6AA 3NGPA 3M0UA 1UUEA 3BE3A 4DQ2A 2ED0A 2JMCA 3EG9A 4IUTA 2ATCB 5F5WA 5FWBA 4C92F 2KROA 2I4MA 3QZ5B 2HAXA 1LJOA 1FX7A 2GQVA 4C5GA 4DEXA 1YIJA 4UP9A 4DOWA 4KGXB 1UG1A 1X69A 4Q5WA 1K0SA 3CC4T 5K1XA 2KQWA 1N8RC 1U1SA 1K9MC 2X4XA 3M0PA 4RTXA 1YFTA 4M77D 3RDVA 4EMGA 4ORZA 1X54A 2QAZA 3TQ7P 4AFZC 4KUIA 3A8HB 1DJ7B 1W70A 5FW9A 2V1RA 2LCCA 2EJFA 4Z88A 3CD6Q 2P0KA 2ROLA 2F2XA 1N9RA 3PVQA 2DM1A 1PD0A 1VQ8A 3MEAA 3VV0A 2RD1A 3PGGA 2JJ9A 1M27C 5CCAA 3QDRB 2RF0A 4LN2A 2JS0A 1NZ9A 1PRLC 4KH0B 3M0RA 4BE2A 3AHUA 4HKEA 1TUGB 3MEUA 3QO7A 3JSCA 1WHJA 2A3LA 3LH5A 5HCKA 1JRIA 3CQTA 3J80E 4L5GA 4HWOA 2AMCB 4XAXB 4C5HA 1G5IA 1NPPA 1WPYA 3QYHB 3NEMA 3G6EA 1W1FA 2VVKA 2IG0A 3CCEA 4BDYA 4P74A 1NM7A 1OZ3A 1U06A 3RR6A 3HXVA 3IALA 2CJBA 4YRIA 3CC7A 4C8QF 3G7ZA 3CC2Q 1Y96A 4RCBA 1Z9QA 2RI5A 2ZNJA 4Q15A 2X4YA 4OMFB 1OPKA 3HFVA 3OMGA 3NENA 3HPWA 1GCQC 2DXCA 5AT1B 1V1CA 3QNEA 2RQTA 2D1XA 4ZTJA 2NLUA 2E70A 2DL3A 3DLMA 4N4IA 3L2ZA 4E7JA 1RACB 3W3SA 2YUQA 1OU8A 1VQ7T 2CGHA 3OYHA 2O4XB 3SHWA 2Q7HA 5DM7R 4F7UG 3BY7A 3NMZC 2DDZA 2HD0A 1YCSB 1BB9A 4C92B 1TG0A 1LVKA 4JJNK 2RHSA 3SDZA 2HKQB 4J83A 3EGDA 1M5Q1 3V8JA 4DA4A 2ZPEB 3VS2A 2CP0A 1H3ZA 4FT4A 1HJDA 2QEXQ 1B70B 1Q86R 1YI2T 1OZ2A 3UWNA 1XTDA 2ZT7A 4PJOE 3TUPA 3PIOA 3HRSA 4CC4B 2CUDA 1VQKA 4TVWA 1B7TA 3CCQA 5CO7A 3CMEA 2XIDA 1B7YA 2ARTA 4J15A 3OYKA 3CXCP 2MWOA 1FMWA 1SSHA 4FYYB 3PFSA 2OTJA 3L42A 4K87A 1PYSA 1KSWA 3OB9A 2J06A 4M78D 1RAIB 4JLGA 1JQQA 4IKFA 2QK0A 2X4WA 2PU9B 1JXMA 1JO8A 4LNSA 2MF2A 5GANf 1JJ2P 3OA6A 2YUOA 4KULA 3OYJA 2DXTA 1FYNA 1UTIA 4EMHA 2EKOA 5EG2A 4F17A 3C94A 2HQXA 2CP3A 1Y0MA 4FW2A 4E7LA 2PMEA 1W2BP 1PNJA 4WI1A 3G71A 1QVGS 2X35A 2C06A 3LGFA 1B8AA 5GAMe 2DBKA 3QO3A 1OX9A 1K76A 1QP2A 2HSEB 1OULA 1JEGA 2P4RA 4J7IA 3BW1A 2P4TA 3M55A 4J9HA 2IY5B 2JTEA 4ME7A 2QQSA 4RTWA 1IREB 2M0OA 3HFZA 1HSQA 4JRPA 4DOVA 3V7SA 1IRXA 4R0KA 2LQ8A 1YJWQ 5IHKA 5GAN8 2NS6A 3QJYA 5LJ3e 2L5QA 3BDLA 1D09B 2SEMA 3S3MA 2ZT6A 2FRWA 3META 2RHSB 3I5RA 5GAMd 4C92A 5LJ5h 3VU3C 3M4YA 3KFVA 1ASZA 1D1AA 3I5SA 1Y71A 4JRIA 4QVCA 2HNIA 5GANg 5GAOm 1SRMA 2K7AA 1K73C 1W6XA 5FU7C 5C51B 4IUPA 4C8QG 2KT1A 4UC4A 1X6GA 2RJCA 4A4HA 1NYFA 1IHVA 1KD1R 2NUPB 3UA7A 5IH2A 5LJ3d 5KCOA 5KYYA 3VQYA 5IAYA 1S72Q 2ARSA 3A8MB 3JCMc 2CZ7B 4PJMA 4YTLA 1UEBA 2I4OA 3L4GB 2ODRD 3FDRA 3P8YA 1CKBA 4M77A 4H2UA 1RADB 1VIFA 1G51A 4YROA 4IUUA 4L6V5 1NJ5A 3HRKA 4EDUA 2KE9A 1OU9A 2PTKA 2AMCA 4A4FA 1KC8U 4NL3A 1UHFA 4O5VA 3HL8A 1C1AA 4A4EA 4C0FA 4TVAA 4PJOG 3LWIA 3CXCS 5GMKi 1QKWA 1UE9A 3EHRA 1EVLA 3ZFJA 2RJDA 1I8FA 1YCYA 4NS5A 4LVKA 3SB2A 2IPOB 3EHQA 3H41A 2FPDA 1AWOA 2DK3A 2CIMA 1VQ4A 2XTIA 4XTZA 3C0CA 4YRCA 2XU8A 5GMKm 1WJSA 2DLPA 4P72C 1Z9ZA 2YDLA 1SSFA 3OW2P 2G6FX 5KNNA 1UB4A 1WHKA 3UGTA 1VQOA 1EQRA 1YFRA 1QMCA 2I0NA 1NPRA 2BUDA 2QXFA 3CMET 4ESRA 4FYWB 2DD4A 1QKXA 4PNOA 1VQMA 2GNCA 4UP7A 2ZTGA 1JU5C 3A5YA 2L8DA 1K8AU 1W66A 3EG0A 5LJ3h 2QASA 1M3BA 4PJOA 2A37A 3REAB 2QHSA 2CP7A 5J39A 3V8KA 5KYNA 2FVUA 1VQNT 2E5KA 2K5FA 1WI7A 1KD1C 1PSFA 2DZCA 2E6NA 1YFNA 1W2BA 4M7AB 3PCOA 1M30A 2J05A 2K3XA 4FIBA 5EC7A 2G4CA 1I07A 3MKDA 2LP5A 1NYRA 1SPKA 2VYTA 1WNLA 1YJNA 5FU6C 5CKEA 1T0JA 3CXCA 4B6MA 2RM4A 3UT1A 1H8KA 2OI3A 4OMMA 4QKUA 1ACMB 2FO0A 3ZL7C 4OMQA 2OJ2A 2PVOB 5FU7B 2ESWA 3U23A 1KJWA 2K6DA 4JUVA 5C53B 4FCYA 1ZQ1A 1ZA2B 2M0YA 3MP1A 2ZNIA 5LL6S 3X25B 3VRZA 1VQNA 2YUNA 2LCLA 4AMCA 2DL4A 2QQRA 4LDWA 4RMOA 4P5NA 3QJ6A 3JCMd 4YRNA 1IO6A 2F2WA 1Q86U 4M7DG 1VQ9A 2DVJA 1Z7NA 3TREA 5KYWA 4A54A 1GFDA 2LNVA 4TVYA 2HQHA 2E5QA 4L87A 1WHGA 2HEQA 2WACA 4HT4A 3JCMJ 3SWNC 1X2KA 2ZCFB 3E19A 4KH1B 2X3XD 1EX4A 1NBEB 2EQUA 4QVZA 3PT9A 4XEOA 3A8OB 3G6ET 3CC4Q 2EQKA 3A7RA 2RJFA 3CCMQ 1HXDA 3QBYA 3WQZA 1WLEA 3NTHA 4JJDA 2EJGA 3JB9F 6AT1B 3DB4A 1RABB 1VQZA 1O9SA 4E7SA 1TUDA 1Q82C 2ABLA 2GFAA 4QQ6A 2FB7A 3HRTA 3A32A 4J9CA 4X9CA 1KMMA 2EW3A 3EG3A 2CSIA 1M1KC 3CC7Q 2DTOA 3HXWA 4BUGA 1AVZC 1JJCA 1VQLT 3P8BB 4IIMA 2JUFA 1SHFA 4E7IA 4ATOA 1VQ7A 2CH4A 4H2XB 1WHMA 4LUEA 1ADJA 1VQPQ 3CCLQ 2HKNA 1ZX6A 2VGNA 2ZAEA 3ICAA 4JS4A 3NFCA 3Q1JA 3L2UA 1MV3A 2DIGA 2RB6A 1OX8A 3GNGA 1X6OA 1VQ4Q 3M0SA 1BI3A 4C92G 1D0XA 3MPUB 1OPLA 1YFSA 2LT1A 2LC4A 3G71T 4AG1C 4X9DA 1TXQA 4PLLA 3PTAA 1VQKT 1I0CA 3CBMA 5E3IA 1NG2A 4CS3A 1SHGA 4YRTA 4KBMB 4XTWA 4P3NA 2YRDA 1WQWA 3RACA 2H3EB 2RO0A 1W4SA 1U5SA 4M7AA 1Y57A 1Q81U 1GFCA 1USYC 1SERA 1B34B 2NYSA 3OYNA 4D8KA 2ZPBB 2LX7A 7AT1B 4ZTUB 1IGUA 2VWFA 4IUVA 2R5AA 4BACA 2ZT8A 5GMKl 3CPWA 1MMAA 4F7UE 2OTJQ 1B76A 1FMKA 1HK9A 5I21A 1HTTA 2D9TA 2ROTA 3H6ZA 2C0OA 2DILA 1YP5A 4XU2A 4HA8A 4M78A 1M2OA 2O9SA 1N9SA 4M75C 3MCAB 4M75F 2HL3A 4OF1A 4CC3A 1AOJA 2JMAA 4J5YA 3HTRA 1Q7YC 2HBWA 3M4PA 1VQ5A 2HSPA 2DL7A 1EIYA 1KQSA 5GMKj 3JCMf 4PL6A 3UPUA 2QGFB 2KY9A 3JB9G 2E65A 4DBFA 2ZCEA 3RBBB 2QQBA 1RI0A 1HC7A 3A8LB 3OS0A 1WA7A 5GJWB 2BZ8A 1G5VA 4YRPA 4HWRA 4J6XA 1YN8A 4PFOA 1QWFA 2LJ0A 2OAUA 3ZEHA 1D1BA 5HK0A 2RI2A 2C0TA 3OBYA 4LD6A 3X26B 1VUBA 4CS4A 2ZZFA 2J6OA 1YJNQ 1LYLA 2EWNA 3ER0A 4QQDA 2KGTA 3VS6A 5DLOA 1KMNA 1NEBA 5L8RE 4EX5A 1BCOA 4GLKA 4MMKA 4X1VA 2V8IA 3E1SA 4CI0C 4FT2A 1B07A 5LJ3g 1YB3A 4CC7A 1N27A 2LCSA 2EBPA 1WX6A 2NWMA 1X01A 2E3IA 4KR3A 4CH5A 2JM8A 1X56A 2P0QA 2K3BA 2F5TX 4M7DD 3PNWC 4KGZB 3CCVQ 3L4GA 2DU5A 4DPGA 1PHTA 1WGSA 2Z0WA 4A63B 2XMFA 3G4ST 3I56T 1OV3A 5CK9A 2O9VA 2CZ1B 1VQ9T 1NYGA 4R56A 4OGEA 4BI3A 1BBZA 1PM3A 1U1TA 3A31A 3MF2A 2QGGA 1JXOA 4A53A 5D7UA 2OAWA 2DYIA 4Z89A 4C8QB 3LC0A 2O01E 3OY9A 1K4US 4ZN1A 2RHYA 2LMJA 1Y7XA 3V8LA 2BZYA 4R55A 1VQOQ 4RG8A 2YRCA 3E9GA 3RIRA 2B8AA 3QXEB 3HP9A 3CCEQ 2OTLA 2KXCA 4NCXA 5GAN6 5LJ5f 2DIQA 2EYWA 2BKDN 4FM4B 3S3OA 5GAMf 2IIMA 1SRLA 1QE0A 4P74C 1VQ8Q 1WYDA 3THKA 1IHWA 3SFMA 3LGLA 2ED1A 3HFZB 1PRMC 5GAOr 2COYA 2VASA 2L0AA 1AHJB 1K9MU 1M8VA 4JDSA 2IY5A 4EMKB 1GGMA 2DFUA 4C8QD 1YJWT 1NJIU 1NNHA 4YCWA 4C8QC 3GPLA 3M58A 3TSWA 3ULRB 4E7KA 4YRRA 2M1HA 4CH6A 4RTVA 4LUDA 2KDSA 4PHCA 2K4YA 2ZZDA 2E10A 2LQWA 1BI1A 4YRQA 5GAN7 1KG1A 1CKAA 1Q86C 2EYXA 4WJ3M 4RTUA 2DJZA 1TOVA 2HMAA 2LVMA 3MEWA 4QVDA 4JPBW 1LCKA 2QA4A 3P8VA 4P75C 3P8DA 1O75A 3KXTA 4P75A 5LJ3f 4BI4A 4F14A 5GAOp 1AWXA 3SWNA 5I2MA 1KOGA 1QVFA 2DQ3A 4PKCC 2KYMA 2DVEA 2A36A 2SRCA 3H8ZA 2CZ6B 3NPFA 3IG2A 3EGXA 1GCPA 4LDVA 2P0LA 1GBQA 4Q6GA 1WXBA 4LDUA 2EYZA 1YITQ 5GANd 3H0HA 2PZ1A 4Y28E 4M77C 3OBWA 3M54A 5ECAA 4M77F 4BWAA 3EH1A 4F7UB 3RERA 2YWWA 4ELZC 2BIVA 2F2VA 4GY5A 2CH4W 5GAOq 1B7YB 2Q7GA 2FL7A 1RAEB 2X4JA 1YWOA 2X9HA 2A8EA 1M1KU 2L3PA 2I2LA 5IXBA 2A28A 1ZSZA 1UJYA 2EYYA 4BDZA 4DBRA 4AT1B 1H4TA 11ASA 3A7AA 1B70A 4YRFA 2BE7D 2M9UA 4OLFA 2EQJA 2CP5A 1BI2A 5KYXA 3CCUQ 3R07A 3JB9H 1QCFA 1X43A 1EZZB 5GAN5 3QWYA 4OB3B 2KNBB 1FWZA 2C7IA 3KFUA 1JBMA 4PK4A 4B9WA 4F04B 1XNIA 2PVGB 4II1A 4N4HA 4HWTA 2DKGA 4K88A 1I1JA 2RNAA 5GAN4 5CIUA 1SF9A 2DNUA 3UATA 5A2QE 3QZ9B 3CCET 2R5MA 4OB0B 4PJNA 3TEEA 1ZUUA 3PMTA 1VQ6Q 1IZ6A 1TUCA 4ZGEB 1Q81R 3H0FA 5CKDA 3CEYA 4YCVA 2E5AA 4PJLA 1KQSS 1G3WA 3CD6A 1VQ9Q 2PUOB 5HK3A 1WHHA 2DL5A 1RLPC 2JOYA 1ZSZC 2PVDB 1Y96B 1EFWA 1WYXA 2ALYB 2JXBA 1PSEA 5D6YA 4F16A 4YDQA 1QQJA 1IXDA 1M2VA 3PZCA 1XJWB 1X2GA 3SD4A 1B34A 2RHQB 4YCUA 3EAEA 4CC2A 1H4SA 2D8HA 1AWJA 3EG2A 1YJ9A 3M59A 2QHTA 4KQEA 5L23A 4JJCA 5LJ5j 2G3RA 3L1AA 2M02A 2KVQG 2ZXFA 4HT9A 4Z8AA 3G1JA 1WDXA 3E9FA 3X28B 3CD6T 4M7DF 1VOMA 1GXIE 5A0LA 2RHIA 4X5OA 4M78E 3C12A 4ZGDB 4YRJA 3JCMX 3VS0A 3QYGB 3VYHB 4GLMA 2E3HA 4DBQA 1QLYA 1K9AA 3MP8A 4H2XA 2NUZA 4AH6A 3RKWA 2CSQA 2JVVA 4IURA 3CCJQ 2FPFA 4PJOD 1X27A 2KYBA 1HYOA 1BKBA 4M7AE 4DBHA 4J9BA 4ZGJB 4FSXA 2VGMA 3QO5A 3JCMb 2V26A 3CCRQ 1BBWA 2CREA 2RHQA 4YRMA 2MI6A 3HSBA 1M1GA 1M2VB 2DEQA 3EG9B 1PD1A 4RTYA 5GAMj 1NJ1A 2ALYA 4ZN3A 1IB8A 4AFSC 4DEYA 3A74A 4LE9A 1YIJT 5GANh 1MNEA 1R8OB 2ECZA 2QHVA 3MEVA 3OMCA 2MIOA 8AT1B 4C92C 1ZLMA 1AZGB 5KYUB 1YHQQ 5CKBA 2KEAA 5GAOn 1Q82R 3M0QA 2YSQA 3QG1A 2Q5HA 1EIFA 4C92D 4C0DC 4M75E 2KSSA 3DLLA 4L59A 5GAN2 3PE0A 2DRKA 1UECA 2QYZA 3BFMA 3VS7A 3GOXA 1SETA 4KR2A 2R58A 1EVKA 1CSKA 4RTTA 3DB3A 3QIIA 3BDUA 3G4SA 4QT7A 4G84A 2L89A 2J3LA 3M4QA 1LOJA 3DSQA 4HWSA 5CQYA 2LDMA 1M9SA 1Q95G 4ANJA 1BU1A 4KGVB 3TU4K 4E51A 4PLIA 2LNHB 4M7AD 1VQLA 3VS5A 1MNDA 3V7CA 4A4KA 5LJ3j 3E9IA 3NELA 1C0MA 2HBPA 1ZSZB 3C4SA 3E9HA 1ASYA 1M90R 1VQ8T 1D3BB 2QA4Q 1UGSB 1OQKA 2QTVA 2DPPB 5C6SA 2CJ9A 2FHDA 1QVFP 3UH0A 5M9OA 2AKKA 3CC7T 2QEXA 3MO8A 3M5AA 2Q5IA 2ZGWA 1UDLA 2JW4A 4LD9K 4J9IA 3DKMA 2XD0A 3MF1A 1ZA1B 1NYQA 3OS5A 4P3OA 5GAN3 1VIEA 5C52B 4BE1A 2V1QA 3EGXB 3WXMB 3EFOA 1PCXA 3CC2T 3SEMA 4YP0A 3HXYA 3SWNB 1OI1A 3O5ZA 3HY1A 3VRYA 4MDXA 3A5ZB 4C8QE 3G4SQ 1M8MA 2GQIA 2V8JA 1UHCA 1AT1B 3I55A 4CS2A 2X3WD 4CH4A 1WQ7A 2K57A 4KRTA 4HCZA 1XOVA 4X34A 3JCMh 3VUZA 3CCMT 5ELNA 1VA7A 3FLGA 3NHNA 4IIOA 2DYBA 3BJUA 4ZIBA 4N4GA 3I9QA 2RK1A 4HWPA 3FRNA 1U8RA 3JB9J 3UDCA 2HQEA 3A7UA 4LVIA 4FW1A 3HRIA 4EMKA 4MDWA 2EJ9A 3H0IA 2P84A 1BBUA 2CJAA 2EL9A 5FROA 5J3BA 2FRYA 3CCUA 3RL6A 2VB6A 3OYDA 4AFQC 4ZTFA 2Y90A 2MOXA 5I2SA 3A98A 1NJIC 1L0WA 3IQLA 1YI2A 3EGUA 1KK7A 3OW2A 4OMPA 2XHCA 1K9MR 1P92A 1M90U 4J9FA 2DU7A 4J7FA 2XDDA 4J6WA 4WF2A 2A08A 4EPCA 1MUZA 2XDBA 1ZSGA 4C8QA 2MPXC 2VC8A 3REXA 3D7SB 1YBYA 2CP2A 2NUPA 1QWEA 4Y92A 4M75A 5GAMh 2MWPA 4WTOB 1QW1A 2COWA 5LJ5d 3CCSQ 1QF6A 3LWHA 2HZYA 2JTMA 1YWPA 3LLRA 3HXZA 1B3QA 5ELOA 4YPFA 1T0HA 2DJQA 1RAAB 2L3SA 3CBPA 3E2UA 1Q82U 1VQKQ 4TWAA 4HVVA 3HY0A 2E41A 3CMQA 2YT6A 1EFNA 2CP6A 4HCBA 2AIRB 2A0FB 1RL2A 2BTTA 3GF5A 3ME9A 4JJBA 1MMNA 2EGAA 3VS3A 4HCCA 4WJ4A 2AKLA 3LH0A 2CYZB 3RF1A 2LQKA 4XTUA 2RHZA 1JB0E 4LXCA 3CMAT 2WSEE 2VUBA 1WJQA 1N8RU 1PKSA 1R0CB 1YITT 3GLXA 2O88A 3JCMg 2DBMA 2R57A 1H4QA 4P71C 9ATCB 2L3RA 1HD3A 2D0NA 2Y4YA 4A4GA 4FL6A 5GANe 1X2QA 4UPAA 1VQLQ 5FWCA 1MHNA 1T3SA 3GP8A 1T3LA 2DXBA 2LJ1A 2XICA 3QSUA 4BW9A 2RH2A 1E7OA 4OVAA 4M78B 2E4HA 1F1BB 5FLXE 2KRSA 2AKWB 2EQMA 2WSFE 3FB9A 3FJ5A 3G6EQ 4XU1A 4PFZA 3FC3A 1USYA 1GL5A 4XTXA 1N9WA 3REUA 3CCJA 1VQMQ 2GTJA 4BI8B 2QA4T 4HCKA 3MP6A 1H641 1UGVA 3JRZA 4N0AC 1VQ6T 1SRYA 3HKSA 5GJVB 2Y4XA 2HCKA 3KUFA 4M4ZA 3CPWP 3I55T 1UGQB 2IVWA 2M51A 1VQ7Q 2FG0A 1IL2A 3CCRA 3RKXA 3HFNA 3CCMA 4ZTZB 1D3BA 5AYFA 3X24B 2KRMA 4M7DE 2D8JA 1WHLA 2KBTA 2ZR3A 4TQFA 4H2SA 1Q7YU 2JS2A 2DEUA 3OS1A 3HTZA 2BE9B 3JAME 3EGDB 2D6FA 3UGQA 3OYEA 4MZTA 1M90C 1E6GA 4RKUE 3JV3A 1NLPC 1WIEA 1LPLA 3J81E 4EIKA 4JRKA 2AT1B 1VQMT 2DE0X 2VV5A 1NEGA 3FIFA 1S72A 1BIBA 3S3NA 3VS4A 1JJCB 4KUDK 3RUXA 3CCRT 1QCOA 4G85A 4RUGA 1VQOT 3HFOA 4PFPA 3LSSA 1PWTA 1G2BA 2A7YA 3R6OA 1KFZA 2DF6A 1M1KR 5CAIA 1WZOA 2Q7EA 1RUWA 2QQ9A 3VJPA 1ZBJA 2DX1A 1QVGA 3CCVT 2EGEA 2KR3A 2ZR2A 1NJ2A 3J7AF 3M4GA 1VQ5T 3LSQA 4P73C 1ABQA 2PUKB 5DLQE 2JZ2A 4NL2A 5KYWB 4J9GA 3CCSA 1KC8C 1D0ZA 3OYIA 2MMPA 1KHCA 2PNIA 2GBQA 3GNFB 5C0MA 3REBB 1YI2Q 4HVWA 4H02A 3M56A 1LNXA 5FRNA 1V29B 3NTIA 1YJNT 3AT1B 4OMOA 4XTVA 4VUBA 1VYVA 3OYGA 3RGLA 3FJPA 3CCVA 2PMFA 2LX9A 2JM9A 4XU0A 2HL5C 4WCIA 5CQXA 3L2WA 1YGBA 3MJXA 3CMAA 4M7DB 3VS1A 4E6RA 2GCXA 3M0TA 1QVPA 1GCQA 5IT9E 1NJ6A 2MK5A 2ZZGA 3CCST 4Z02A 2QEXT 1UGRB 2RPNA 3A8GB 3PCOB 4IUQA 2ZPFB 1J5WA 2DETA 2RK2A 1PG5B 2E12A 1TU0B 2FZCB 2DD5A 2RMOA 2HDAA 1ATIA 1VYUA 3ASKA 5CKFA 2F69A 2D0QB 2XDPA 4N0AA 3CPWS 1M3CA 4E7HA 2E64A 1J3TA 4PJOB 3TEHB 2K5IA 4J9EA 3INZA 4M78C 2X51A 4BY6C 1K73U 1E24A 1H3HA 1AEYA 3G71Q 4HVUA 4M7AG 4ZNXA 2FZKB 2EVRA 2JN0A 2QHUA 3CBOA 1N8RR 4M7DA 1VQNQ 1H4VB 1Y07A 3NTKA 3I35A 4PG3A 3JCMe 2CZ0B 5D6WA 1I5LA 2DO3A 4M7AC 1EOVA 2DL8A 5I22A 2J3MA 2WSCE 4M78G 5KYXB 3CCJT 4NOYA 3OSVA 5CKHA 3M57A 4C0ZA 1VQ5Q 2NUTA 2ODRC 4CH3A 2KRNA 1YJWA 1VQ4T 3QWXX 2ZZEA 4JS5A 2AK5A 3IKMB 3GIBA 1RI9A 3CCUT 5I11A 4RTZA 3CPFA 4TVAB 4Y91A 2RA2A 2YLBA 4JRQA 1KHIA 3HXXA 4OP0A 4J6YA 2E1HA 1YJ9Q 5GANj 1OYXA 3OYCA 3P8HA 1K73R 1G3TA 4RMFA 3LX7A 1SG5A 4F7UA 2MCNA 1BK2A 1ZBXA 3OYYA 2XKOC 2YRVA 1UJ0A 3GBQA 4F7UF 4H2TA 4M77B 1TH7A 1WFWA 2H8HA 2QDYB 1G3YA 2PQWA 4XQ3A 1WJRA 3OQ5A 1WXUA 3R6NA 2C8MA 5KYYB 4C92E 2LQNA 4OGCA 1WU7A 1KIKA 3EFRA 1W2BS 3PVLA 2FPEA 1VQPA 3G1ZA 4FYXB 1RAHB 1QVGP 1E1OA 3H9NA 3F70A 8ATCB 1K8AC 1TTHB 1I81A 2J6KA 2KXDA 5KE2A 3I7FA 2C0IA 3L2RA 2ZPHB 4JLIA 2DQ0A 1X6BA 4MZPA 2AZSA 4H2YA 3FEOA 2RHUA 1KD1U 1JJ2S 4LVMA 1H92A 4M77G 4LVLA 4P3PA 2P0PA 3EH2A 4KT0E 2YXYA 4LDXA 4O6JA 1NE8A 5KE3A 4C5IA 2RQUA 1XQHA 3NETA 2QI2A 4MMLA 1YITA 3CCLT 1YIJQ 3M9QA 3I56Q 2LRQA 3OS2A 1G3SA 2DERA 4EMKC 1KQ1A 3X20B 3ERRA 2QQAA 1KQ2A 3RMQA 5GMKe 3M53A 2RJEA 2DTIA 2DXUA
chains in the Genus database with same CATH topology
3VKIA 3CC4A 1RIQA 4LDYA 1G5HA 3OW2S 2KK4A 3OSSC 4XEMA 1BI0A 2ZPGB 2AKWA 2XGTA 3MEYA 2I4LA 2CS7A 5LJ5e 3V7RA 1M1FA 2GF7A 2RHXA 4YRSA 3L2QA 4K86A 2OTLT 3QPHA 1BYMA 1YJ9T 3HRUA 2EIFA 5CR2A 4PJOC 1PYSB 3VUBA 4H2WA 1VQ6A 5GAMg 1NJ8A 1YHQA 4ELYC 3QKJA 4MZMA 4YRGA 4BD3A 4YRLA 5LJ5g 3JCMW 5HGQA 3VQWA 4XTYA 3PIPA 5GMKh 2ZIOA 3JCMV 5GAOl 4BB7A 4PJOF 2LTOA 4V2SA 3WVDB 3OYMA 3TCJA 4C5EA 3ZBDA 4M75D 2LT4A 4P72A 3WVEB 2QTXA 3S6WA 2OTJT 4YYEA 2ZINA 1EIYB 3HHTB 3KBGA 1UGPB 2DAQA 4P73A 3L2VA 1QP3A 2O4XA 2DTHA 4RQEA 4O2DA 3VQXA 1X2HA 1I4K1 4XK8E 3OYLA 2E6ZA 2EYQA 4HVCA 2ZT5A 4M75B 3RMSA 4RG2A 4FU6A 2AHJB 2I4NA 3VQVA 3LYIA 12ASA 5KH6A 1C0AA 4RCCA 4RQFA 1Q81C 3EFSA 2K5LA 3VYGA 5FRMA 1ZHIA 1SESA 2F5KA 2K3YA 2M16A 2VXEA 4D6WA 4TTVA 3P8TA 4BY6B 2ZPIB 1JJ2A 2RI3A 4RDXA 2FYKA 5HY6A 3JCMP 3QUIA 4M77E 3IKLA 2XG8D 1VQPT 4E47A 5IN1A 2JNGA 4LVJA 2KMTA 2XI9A 5K1PA 3HXUA 4HT8A 2ZIMA 4P71A 2CKKA 4BE0A 4CRIA 1M4ZA 1MGQA 3RKYA 3TEGA 4QQGA 3JCMQ 3MHXA 4OB2B 2KAFA 4QW2A 3A5ZA 5D6XA 3T9NA 3CCLA 2H3JA 2K2VA 3JB9I 2XK0A 3UFGA 2YHTA 3CC2A 3N5BB 2VXFA 3I56A 4B9XA 1S72T 1FYFA 5J26A 1BIAA 2EAYA 1E22A 4C0GA 4M7DC 4TQDA 3PMIA 4M75G 1X55A 2GFUA 3O8VA 3OD1A 3QTCA 5A0DA 4OB1B 2DZ9A 2E3CA 5DY9A 1Z7MA 3OYAA 2V8KA 4H2VA 3QHSA 4J8OA 3RESA 3JB9D 1E1TA 3CCQT 3OYBA 2JTFA 5A0GA 4TVRA 4YREA 2EFIA 1FXXA 4XU3A 3OYFA 1ADYA 4M78F 2MAMA 3LW5E 3C95A 3MQZA 1YHQT 5FU6B 3URGA 5HKCA 4UP8A 3VBBA 5KCHA 4EO4A 1X75C 3QO8A 4YRKA 4C0DB 5CVIA 2YLCA 3TEHA 4M7AF 2ARUA 2P5IA 1QVFS 1N6AA 4DQ2A 4IUTA 5F5WA 4C92F 2I4MA 3QZ5B 2HAXA 1LJOA 1FX7A 2GQVA 4C5GA 1YIJA 4UP9A 4DOWA 4Q5WA 5K1XA 3CC4T 2KQWA 1N8RC 1U1SA 1K9MC 2X4XA 1YFTA 4M77D 4EMGA 1X54A 4KUIA 3A8HB 1DJ7B 2LCCA 2EJFA 2P0KA 1N9RA 1VQ8A 3MEAA 3VV0A 2RD1A 3PGGA 5CCAA 3QDRB 1NZ9A 4BE2A 3AHUA 4HKEA 3MEUA 3QO7A 3JSCA 2A3LA 1JRIA 3J80E 4L5GA 4HWOA 2AMCB 4XAXB 4C5HA 1G5IA 1NPPA 1WPYA 3QYHB 3NEMA 3G6EA 2IG0A 3CCEA 4BDYA 4P74A 1OZ3A 3HXVA 3IALA 2CJBA 4YRIA 3CC7A 4C8QF 3G7ZA 1Y96A 4RCBA 2RI5A 2ZNJA 4Q15A 2X4YA 4OMFB 3HFVA 3OMGA 3NENA 3HPWA 2RJEA 2DXCA 3QNEA 4ZTJA 2NLUA 2E70A 3DLMA 4N4IA 3L2ZA 4E7JA 3W3SA 1VQ7T 2Q7HA 2CGHA 3OYHA 2O4XB 5DM7R 4F7UG 3BY7A 2DDZA 2HD0A 4C92B 4JJNK 2RHSA 3SDZA 4J83A 1M5Q1 3V8JA 4DA4A 2ZPEB 1H3ZA 4FT4A 1B70B 1YI2T 1OZ2A 3UWNA 1XTDA 2ZT7A 4PJOE 3TUPA 3PIOA 3HRSA 1VQKA 4TVWA 3CCQA 5CO7A 3CMEA 2XIDA 1B7YA 2ARTA 4J15A 3OYKA 2MWOA 3PFSA 2OTJA 3L42A 4K87A 1PYSA 3OB9A 4M78D 4JLGA 4IKFA 2X4WA 2PU9B 4LNSA 2MF2A 5GANf 3OA6A 4KULA 3OYJA 2DXTA 4EMHA 2EKOA 5EG2A 3C94A 2HQXA 4E7LA 2PMEA 4WI1A 3G71A 1QVGS 2X35A 2C06A 3LGFA 1B8AA 5GAMe 3QO3A 1QP2A 4J7IA 3BW1A 2P4TA 3M55A 2IY5B 4ME7A 2QQSA 1IREB 2M0OA 3HFZA 4JRPA 4DOVA 3V7SA 2LQ8A 5GAN8 2NS6A 3QJYA 5LJ3e 2L5QA 3BDLA 3S3MA 2ZT6A 3META 2RHSB 5GAMd 4C92A 5LJ5h 3VU3C 3M4YA 1ASZA 1Y71A 4JRIA 4QVCA 2HNIA 5GANg 5GAOm 1K73C 5FU7C 5C51B 4IUPA 4C8QG 4UC4A 2RJCA 4A4HA 5LJ3d 5KCOA 3VQYA 5IAYA 2ARSA 3A8MB 3JCMc 2CZ7B 4YTLA 1UEBA 2I4OA 3L4GB 2ODRD 3FDRA 3P8YA 4M77A 4H2UA 1VIFA 1G51A 4YROA 4IUUA 4L6V5 1NJ5A 3HRKA 4EDUA 2AMCA 4A4FA 1KC8U 4NL3A 4O5VA 3HL8A 4A4EA 4C0FA 4TVAA 4PJOG 3LWIA 3CXCS 5GMKi 1EVLA 3ZFJA 2RJDA 1I8FA 1YCYA 4NS5A 4LVKA 3SB2A 2DK3A 2CIMA 1VQ4A 2XTIA 4XTZA 4YRCA 2XU8A 5GMKm 1WJSA 4P72C 1SSFA 5KNNA 1UB4A 3UGTA 1VQOA 1EQRA 1YFRA 1NPRA 2BUDA 2QXFA 3CMET 2DD4A 4PNOA 1VQMA 4UP7A 2ZTGA 3A5YA 2L8DA 1K8AU 1W66A 5LJ3h 4PJOA 2QHSA 5J39A 3V8KA 2FVUA 1VQNT 2K5FA 1KD1C 1PSFA 2DZCA 2E6NA 1W2BA 4M7AB 3PCOA 2K3XA 4FIBA 2G4CA 1NYRA 2VYTA 1WNLA 1YJNA 5FU6C 5CKEA 3CXCA 2RM4A 3UT1A 2PVOB 5FU7B 4JUVA 5C53B 1ZQ1A 3MP1A 2ZNIA 5LL6S 3X25B 1VQNA 2LCLA 2QQRA 4LDWA 4RMOA 4P5NA 3QJ6A 3JCMd 4YRNA 1Q86U 4M7DG 1VQ9A 1Z7NA 3TREA 4A54A 2LNVA 4TVYA 2E5QA 4L87A 2WACA 4HT4A 3JCMJ 3SWNC 2ZCFB 3E19A 2EQUA 4QVZA 3PT9A 4XEOA 3A8OB 3G6ET 2EQKA 3A7RA 2RJFA 1HXDA 3QBYA 3WQZA 1WLEA 3NTHA 2EJGA 3JB9F 3DB4A 1VQZA 1O9SA 1Q82C 2GFAA 4QQ6A 2FB7A 3HRTA 3A32A 4X9CA 1KMMA 1M1KC 2DTOA 3HXWA 4BUGA 1JJCA 1VQLT 3P8BB 2JUFA 4E7IA 4ATOA 1VQ7A 4H2XB 1ADJA 2VGNA 3ICAA 4JS4A 3NFCA 3Q1JA 3L2UA 2DIGA 2RB6A 3GNGA 1X6OA 1BI3A 4C92G 1YFSA 2LT1A 2LC4A 3G71T 4X9DA 4PLLA 3PTAA 1VQKT 3CBMA 5E3IA 4CS3A 4YRTA 4KBMB 4P3NA 4XTWA 1WQWA 3RACA 2RO0A 1W4SA 4M7AA 1Q81U 1USYC 1SERA 1B34B 3OYNA 2ZPBB 4ZTUB 4IUVA 2R5AA 4BACA 2ZT8A 5GMKl 3CPWA 4F7UE 1B76A 1HK9A 1HTTA 5I21A 2D9TA 3H6ZA 4HA8A 4M78A 4XU2A 1N9SA 4M75C 3MCAB 4M75F 4OF1A 4J5YA 1Q7YC 3M4PA 1VQ5A 1EIYA 1KQSA 5GMKj 3JCMf 4PL6A 3UPUA 2KY9A 3JB9G 2E65A 2ZCEA 2QQBA 1RI0A 1HC7A 3A8LB 3OS0A 1G5VA 4YRPA 4HWRA 4J6XA 2OAUA 3ZEHA 5HK0A 2RI2A 3OBYA 4LD6A 3X26B 1VUBA 4CS4A 2ZZFA 1LYLA 2EWNA 3ER0A 4QQDA 5DLOA 1KMNA 5L8RE 4EX5A 4GLKA 4MMKA 2V8IA 3E1SA 4CI0C 4FT2A 5LJ3g 1YB3A 1N27A 1X01A 4KR3A 4CH5A 1X56A 2P0QA 4M7DD 2F5TX 3PNWC 3L4GA 2DU5A 4DPGA 1WGSA 3G4ST 3I56T 5CK9A 2CZ1B 1VQ9T 4R56A 4OGEA 4BI3A 1U1TA 3A31A 3MF2A 4A53A 4C8QB 3LC0A 2O01E 3OY9A 4ZN1A 2RHYA 1Y7XA 3V8LA 4R55A 4RG8A 3E9GA 3RIRA 2B8AA 3QXEB 3HP9A 2OTLA 4NCXA 5GAN6 5LJ5f 2DIQA 4FM4B 2BKDN 3S3OA 5GAMf 1QE0A 4P74C 1WYDA 3SFMA 3LGLA 3HFZB 5GAOr 1AHJB 1K9MU 1M8VA 4JDSA 2IY5A 4EMKB 1GGMA 4C8QD 1YJWT 1NJIU 1NNHA 4YCWA 4C8QC 3GPLA 3M58A 4E7KA 4YRRA 2M1HA 4CH6A 2KDSA 4PHCA 2K4YA 2ZZDA 2E10A 1BI1A 4YRQA 5GAN7 1KG1A 1Q86C 4WJ3M 2DJZA 2QA4A 3MEWA 2LVMA 4QVDA 4P75C 3P8VA 3P8DA 1O75A 3KXTA 4P75A 5LJ3f 4BI4A 5GAOp 3SWNA 5I2MA 1KOGA 1QVFA 2DQ3A 4PKCC 2DVEA 3H8ZA 2CZ6B 3IG2A 4LDVA 2P0LA 4Q6GA 4LDUA 5GANd 4Y28E 4M77C 3OBWA 3M54A 4M77F 4BWAA 4F7UB 3RERA 4ELZC 2BIVA 4GY5A 5GAOq 1B7YB 2Q7GA 2FL7A 2X4JA 2A8EA 1M1KU 2I2LA 4BDZA 1H4TA 11ASA 3A7AA 1B70A 4YRFA 2M9UA 4OLFA 2EQJA 1BI2A 3R07A 3JB9H 5GAN5 4OB3B 1FWZA 2C7IA 3KFUA 1JBMA 4B9WA 1XNIA 2PVGB 4II1A 4N4HA 4HWTA 2DKGA 4K88A 5GAN4 5CIUA 5A2QE 3QZ9B 3CCET 2R5MA 4OB0B 3TEEA 3PMTA 1IZ6A 4ZGEB 5CKDA 3CEYA 4YCVA 2E5AA 1KQSS 1G3WA 3CD6A 2PUOB 5HK3A 2JOYA 2PVDB 1Y96B 1EFWA 2ALYB 1PSEA 5D6YA 4YDQA 3PZCA 1X2GA 3SD4A 1B34A 2RHQB 4YCUA 3EAEA 1H4SA 1YJ9A 3M59A 2QHTA 4KQEA 5LJ5j 2G3RA 3L1AA 2ZXFA 2KVQG 4HT9A 3E9FA 3X28B 3CD6T 4M7DF 1GXIE 5A0LA 2RHIA 4X5OA 4M78E 3C12A 4ZGDB 4YRJA 3JCMX 3QYGB 3VYHB 3MP8A 4H2XA 4AH6A 3RKWA 2JVVA 4IURA 4PJOD 1BKBA 4M7AE 4ZGJB 4FSXA 2VGMA 3QO5A 3JCMb 1BBWA 2RHQA 4YRMA 2MI6A 3HSBA 1M1GA 2DEQA 5GAMj 1NJ1A 2ALYA 4ZN3A 3A74A 1YIJT 5GANh 1R8OB 2QHVA 3MEVA 3OMCA 4C92C 5CKBA 5GAOn 3QG1A 2Q5HA 1EIFA 4C92D 4C0DC 4M75E 2KSSA 3DLLA 4L59A 5GAN2 3BFMA 1SETA 3GOXA 4KR2A 2R58A 1EVKA 3DB3A 3QIIA 3BDUA 3G4SA 4G84A 2L89A 2J3LA 3M4QA 1LOJA 3DSQA 4HWSA 5CQYA 2LDMA 1M9SA 3TU4K 4E51A 4PLIA 4M7AD 1VQLA 3E9IA 3V7CA 4A4KA 3NELA 5LJ3j 3C4SA 2HBPA 3E9HA 1ASYA 1VQ8T 1D3BB 1UGSB 2DPPB 5C6SA 2CJ9A 2FHDA 3UH0A 5M9OA 3CC7T 2QEXA 3MO8A 3M5AA 2Q5IA 2ZGWA 4LD9K 2XD0A 3DKMA 3MF1A 1NYQA 3OS5A 4P3OA 5GAN3 1VIEA 5C52B 4BE1A 3WXMB 3CC2T 4YP0A 3HXYA 3SWNB 1OI1A 3HY1A 4MDXA 3A5ZB 4C8QE 2V8JA 3I55A 4CS2A 4CH4A 1WQ7A 3CCMT 2K57A 4HCZA 1XOVA 4X34A 3JCMh 3VUZA 5ELNA 3FLGA 3BJUA 4ZIBA 4N4GA 2RK1A 4HWPA 3FRNA 1U8RA 3JB9J 3UDCA 3A7UA 2HQEA 4LVIA 3HRIA 4EMKA 4MDWA 2EJ9A 2CJAA 1BBUA 2EL9A 5FROA 5J3BA 3CCUA 3RL6A 3OYDA 4ZTFA 2Y90A 5I2SA 1NJIC 1L0WA 1YI2A 3OW2A 2XHCA 1P92A 1M90U 2DU7A 4J7FA 2XDDA 4J6WA 4WF2A 4EPCA 2XDBA 4C8QA 2VC8A 3REXA 1YBYA 4M75A 5GAMh 2MWPA 1QW1A 5LJ5d 1QF6A 3LWHA 2JTMA 3LLRA 3HXZA 5ELOA 4YPFA 3CBPA 1Q82U 4TWAA 3HY0A 2E41A 3CMQA 4HCBA 1RL2A 3GF5A 3ME9A 4HCCA 4WJ4A 3LH0A 2CYZB 3RF1A 2LQKA 4XTUA 2RHZA 1JB0E 3CMAT 2WSEE 2VUBA 1WJQA 1N8RU 1YITT 3GLXA 3JCMg 2R57A 1H4QA 4P71C 2L3RA 2Y4YA 4A4GA 4FL6A 5GANe 4UPAA 1MHNA 3GP8A 2DXBA 2XICA 3QSUA 4BW9A 2RH2A 4OVAA 4M78B 5FLXE 2AKWB 2EQMA 2WSFE 3FB9A 4XU1A 3FC3A 1USYA 4XTXA 1N9WA 3REUA 3CCJA 4BI8B 2QA4T 3MP6A 1H641 3JRZA 4N0AC 1VQ6T 1SRYA 3HKSA 2Y4XA 3KUFA 3I55T 1UGQB 2IVWA 1IL2A 3CCRA 3RKXA 3HFNA 3CCMA 4ZTZB 1D3BA 5AYFA 3X24B 4M7DE 2ZR3A 4TQFA 4H2SA 1Q7YU 3OS1A 3HTZA 3JAME 2D6FA 3UGQA 3OYEA 4MZTA 1M90C 4RKUE 3J81E 4JRKA 1VQMT 2VV5A 3FIFA 1S72A 1BIBA 3S3NA 1JJCB 4KUDK 3RUXA 3CCRT 4G85A 1VQOT 3HFOA 3LSSA 2A7YA 3R6OA 5CAIA 2Q7EA 2QQ9A 3VJPA 1QVGA 3CCVT 2ZR2A 1NJ2A 3J7AF 3M4GA 1VQ5T 3LSQA 4P73C 2PUKB 5DLQE 2JZ2A 4NL2A 3CCSA 1KC8C 3OYIA 2MMPA 1KHCA 3GNFB 5C0MA 4H02A 3M56A 1LNXA 5FRNA 1V29B 3NTIA 1YJNT 4XTVA 4VUBA 3OYGA 3RGLA 3FJPA 3CCVA 2PMFA 2LX9A 4XU0A 5CQXA 3L2WA 1YGBA 3CMAA 4M7DB 2GCXA 1QVPA 5IT9E 1NJ6A 2ZZGA 3CCST 4Z02A 2QEXT 1UGRB 3A8GB 3PCOB 4IUQA 2ZPFB 1J5WA 2RK2A 2E12A 2DD5A 1ATIA 3ASKA 5CKFA 2F69A 2D0QB 2XDPA 4N0AA 3CPWS 4E7HA 2E64A 4PJOB 3TEHB 2K5IA 3INZA 4M78C 4BY6C 1K73U 1E24A 4M7AG 2JN0A 2QHUA 3CBOA 4M7DA 1H4VB 1Y07A 3NTKA 4PG3A 3JCMe 2CZ0B 5D6WA 1I5LA 2DO3A 4M7AC 1EOVA 2J3MA 2WSCE 4M78G 3CCJT 4NOYA 3OSVA 5CKHA 3M57A 4C0ZA 2ODRC 4CH3A 1YJWA 1VQ4T 2ZZEA 4JS5A 3IKMB 3GIBA 3CCUT 3CPFA 4TVAB 4Y91A 2RA2A 2YLBA 4JRQA 1KHIA 3HXXA 4OP0A 4J6YA 2E1HA 5GANj 1OYXA 3OYCA 3P8HA 4RMFA 1G3TA 3LX7A 4F7UA 1ZBXA 3OYYA 2XKOC 2YRVA 4F7UF 4H2TA 4M77B 1TH7A 2QDYB 1G3YA 2PQWA 4XQ3A 1WJRA 3OQ5A 2C8MA 4C92E 4OGCA 1WU7A 3EFRA 1W2BS 1VQPA 3G1ZA 1E1OA 3F70A 1K8AC 1I81A 5KE2A 3I7FA 3L2RA 2ZPHB 4JLIA 2DQ0A 4MZPA 4H2YA 3FEOA 2RHUA 1KD1U 1JJ2S 4LVMA 4M77G 4LVLA 4P3PA 2P0PA 4KT0E 4LDXA 4O6JA 1NE8A 5KE3A 4C5IA 3NETA 1XQHA 2QI2A 4MMLA 1YITA 3CCLT 3M9QA 2LRQA 3OS2A 1G3SA 1KQ1A 3X20B 3ERRA 2QQAA 1KQ2A 3RMQA 5GMKe 3M53A 4EMKC 2DTIA 2DXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DU7 A;  1X56 A;  4M7D D;  4LNS A;  3L4G A;  1RIQ A;  2DU5 A;  4J6W A;  4WF2 A;  5GAN f;  4DPG A;  1G5H A;  4C8Q A;  4XEM A;  2VC8 A;  2DXT A;  3REX A;  2AKW A;  4EMH A;  2XGT A;  3MEY A;  2I4L A;  4M75 A;  5LJ5 e;  3V7R A;  5GAM h;  1U1T A;  3A31 A;  3MF2 A;  4A53 A;  5LJ5 d;  1QF6 A;  4C8Q B;  3LC0 A;  2PME A;  4YRS A;  4K86 A;  4WI1 A;  3HXZ A;  5ELO A;  4YPF A;  3V8L A;  1B8A A;  5GAM e;  4PJO C;  3QO3 A;  1PYS B;  3RIR A;  4TWA A;  4H2W A;  4NCX A;  3HY0 A;  5GAM g;  5GAN 6;  1NJ8 A;  2E41 A;  5LJ5 f;  3CMQ A;  3BW1 A;  4YRG A;  5GAM f;  4YRL A;  2IY5 B;  5LJ5 g;  3JCM W;  1QE0 A;  4P74 C;  1WYD A;  5HGQ A;  4WJ4 A;  3VQW A;  4XTY A;  3RF1 A;  5GMK h;  2ZIO A;  3HFZ A;  4XTU A;  3JCM V;  5GAO l;  3HFZ B;  4PJO F;  5GAO r;  3V7S A;  4V2S A;  1M8V A;  5GAN 8;  2IY5 A;  4M75 D;  5LJ3 e;  4EMK B;  1GGM A;  4P72 A;  2ZT6 A;  4C8Q D;  3JCM g;  2RHS B;  5GAM d;  2QTX A;  1H4Q A;  1NNH A;  4C92 A;  4P71 C;  4YCW A;  4YYE A;  4C8Q C;  5LJ5 h;  2ZIN A;  1EIY B;  3VU3 C;  4P73 A;  5GAN e;  4YRR A;  4CH5 A;  4CH6 A;  2DTH A;  4UPA A;  4PHC A;  4RQE A;  1ASZ A;  4O2D A;  3VQX A;  2E10 A;  4JRI A;  4QVC A;  2HNI A;  4YRQ A;  5GAN g;  5GAN 7;  1X2H A;  5GAO m;  1I4K 1;  4WJ3 M;  2DJZ A;  5C51 B;  4QVD A;  4P75 C;  3QSU A;  4BW9 A;  3P8V A;  4C8Q G;  4HVC A;  2ZT5 A;  4M78 B;  4M75 B;  4P75 A;  5LJ3 f;  3VQV A;  2I4N A;  5GAO p;  12AS A;  2AKW B;  5LJ3 d;  3SWN A;  3VQY A;  1KOG A;  2DQ3 A;  3FB9 A;  1C0A A;  2ARS A;  4RCC A;  2DVE A;  3JCM c;  4RQF A;  3IG2 A;  3EFS A;  4XU1 A;  2I4O A;  1USY A;  2P0L A;  3L4G B;  4Q6G A;  2ODR D;  4XTX A;  3P8Y A;  1N9W A;  4M77 A;  4H2U A;  1SES A;  3REU A;  5GAN d;  1G51 A;  4YRO A;  4M77 C;  1NJ5 A;  1H64 1;  4M77 F;  3HRK A;  4BWA A;  2VXE A;  4N0A C;  1SRY A;  4F7U B;  3RER A;  4TTV A;  3P8T A;  2AMC A;  5GAO q;  1B7Y B;  4RDX A;  4NL3 A;  2Q7G A;  2FYK A;  1IL2 A;  4TVA A;  4PJO G;  3JCM P;  3QUI A;  3RKX A;  3HFN A;  4M77 E;  5GMK i;  4ZTZ B;  2I2L A;  1D3B A;  3IKL A;  4M7D E;  1EVL A;  1H4T A;  1I8F A;  11AS A;  1YCY A;  3A7A A;  3SB2 A;  1B70 A;  2ZR3 A;  4TQF A;  4YRF A;  4H2S A;  4OLF A;  3HTZ A;  2CIM A;  3R07 A;  5K1P A;  2XTI A;  3JB9 H;  4HT8 A;  3HXU A;  4XTZ A;  4YRC A;  3UGQ A;  5GMK m;  5GAN 5;  2ZIM A;  4P72 C;  2C7I A;  4P71 A;  3KFU A;  1JBM A;  5KNN A;  4JRK A;  4HWT A;  2DKG A;  3UGT A;  4K88 A;  1MGQ A;  3RKY A;  5GAN 4;  1EQR A;  1YFR A;  3FIF A;  3TEG A;  1BIB A;  3JCM Q;  1JJC B;  3RUX A;  4G85 A;  4PNO A;  3A5Z A;  4YCV A;  4UP7 A;  2E5A A;  2ZTG A;  3A5Y A;  3JB9 I;  3HFO A;  3UFG A;  3LSS A;  2YHT A;  1W66 A;  5LJ3 h;  4PJO A;  2VXF A;  1Y96 B;  1EFW A;  2QHS A;  2ALY B;  3V8K A;  5CAI A;  1FYF A;  2Q7E A;  4YDQ A;  1BIA A;  3PZC A;  2EAY A;  1E22 A;  1X2G A;  4M7D C;  4TQD A;  2DZC A;  2RHQ B;  1B34 A;  4YCU A;  4M75 G;  2ZR2 A;  1H4S A;  1NJ2 A;  4M7A B;  3PCO A;  1X55 A;  3OD1 A;  3QTC A;  2DZ9 A;  3M4G A;  2G4C A;  2QHT A;  3LSQ A;  2E3C A;  5DY9 A;  4KQE A;  4P73 C;  1Z7M A;  5LJ5 j;  4NL2 A;  1NYR A;  3L1A A;  4H2V A;  3QHS A;  1WNL A;  2ZXF A;  3RES A;  4HT9 A;  3JB9 D;  1E1T A;  2RM4 A;  4M7D F;  4X5O A;  4M78 E;  4H02 A;  4YRE A;  4YRJ A;  3JCM X;  4JUV A;  1LNX A;  5C53 B;  2ZNI A;  1X01 A;  4XTV A;  4XU3 A;  3RGL A;  3FJP A;  1ADY A;  2PMF A;  4XU0 A;  4M78 F;  3JCM d;  4YRN A;  4H2X A;  4AH6 A;  3RKW A;  4M7D G;  1YGB A;  4PJO D;  1Z7N A;  4A54 A;  4M7D B;  4TVY A;  4UP8 A;  4M7A E;  4L87 A;  1NJ6 A;  3VBB A;  3JCM J;  4EO4 A;  3SWN C;  3QO8 A;  4YRK A;  2ZZG A;  3QO5 A;  3JCM b;  3PCO B;  4XEO A;  1J5W A;  2YLC A;  3A7R A;  1BBW A;  3TEH A;  2RHQ A;  1HXD A;  4YRM A;  3HSB A;  4M7A F;  2DEQ A;  2ARU A;  3WQZ A;  1WLE A;  2P5I A;  2EJG A;  1ATI A;  5GAM j;  3JB9 F;  1NJ1 A;  2ALY A;  1VQZ A;  3A74 A;  4N0A A;  2FB7 A;  4DQ2 A;  2E64 A;  5GAN h;  4PJO B;  5F5W A;  2QHV A;  3A32 A;  3TEH B;  4C92 F;  3INZ A;  4C92 C;  4M78 C;  4X9C A;  2I4M A;  5GAO n;  1E24 A;  1KMM A;  1LJO A;  2Q5H A;  4C92 D;  4M7A G;  4M75 E;  2DTO A;  2JN0 A;  3HXW A;  2QHU A;  4UP9 A;  1JJC A;  5GAN 2;  4M7D A;  5K1X A;  3BFM A;  1U1S A;  1H4V B;  1SET A;  4KR2 A;  1YFT A;  4M77 D;  4EMG A;  1EVK A;  4H2X B;  3JCM e;  1X54 A;  4PG3 A;  1ADJ A;  3BDU A;  1I5L A;  4G84 A;  2EJF A;  4M7A C;  1EOV A;  3ICA A;  1N9R A;  2J3L A;  3M4Q A;  1LOJ A;  3DSQ A;  2J3M A;  2RD1 A;  3PGG A;  4HWS A;  2RB6 A;  4M78 G;  4NOY A;  4E51 A;  4C92 G;  4M7A D;  3V7C A;  5LJ3 j;  3E9I A;  2ODR C;  1YFS A;  3NEL A;  3AHU A;  4CH3 A;  3E9H A;  1ASY A;  2ZZE A;  4X9D A;  3IKM B;  3GIB A;  1D3B B;  3QO7 A;  4TVA B;  4Y91 A;  1JRI A;  2RA2 A;  2YLB A;  3HXX A;  5E3I A;  4OP0 A;  4CS3 A;  4J6Y A;  2E1H A;  4YRT A;  2CJ9 A;  4XTW A;  4HWO A;  4P3N A;  5GAN j;  1WQW A;  2AMC B;  3UH0 A;  3RAC A;  4RMF A;  4F7U A;  1G5I A;  1WPY A;  3NEM A;  4M7A A;  2Q5I A;  1USY C;  1SER A;  4F7U F;  2ZGW A;  1B34 B;  4P74 A;  4H2T A;  3HXV A;  3MF1 A;  4M77 B;  1NYQ A;  4ZTU B;  3IAL A;  2CJB A;  4P3O A;  5GAN 3;  4YRI A;  1TH7 A;  5C52 B;  4C8Q F;  1Y96 A;  4RCB A;  4XQ3 A;  2ZT8 A;  2ZNJ A;  5GMK l;  2C8M A;  4YP0 A;  3HXY A;  4F7U E;  4Q15 A;  1B76 A;  3SWN B;  3HY1 A;  1HK9 A;  4C92 E;  5I21 A;  1HTT A;  3HFV A;  1WU7 A;  4HA8 A;  3EFR A;  4M78 A;  4XU2 A;  3NEN A;  4C8Q E;  3G1Z A;  1N9S A;  4M75 C;  4M75 F;  4CS2 A;  1E1O A;  3QNE A;  4CH4 A;  2K57 A;  1WQ7 A;  3JCM h;  5ELN A;  3L2Z A;  4J5Y A;  1I81 A;  3W3S A;  3BJU A;  2Q7H A;  4ZIB A;  2CGH A;  3I7F A;  3M4P A;  4F7U G;  3BY7 A;  2DDZ A;  4JLI A;  2DQ0 A;  4HWP A;  1EIY A;  5GMK j;  3JCM f;  4C92 B;  3JB9 J;  4H2Y A;  3JB9 G;  2E65 A;  3A7U A;  2RHS A;  2ZCE A;  4M77 G;  1HC7 A;  1M5Q 1;  3V8J A;  3HRI A;  4P3P A;  4EMK A;  4YRP A;  2EJ9 A;  2CJA A;  1BBU A;  4HWR A;  4J6X A;  1B70 B;  2EL9 A;  2ZT7 A;  4PJO E;  3TUP A;  4TVW A;  3RL6 A;  4CS4 A;  2ZZF A;  1LYL A;  2EWN A;  2Y90 A;  1B7Y A;  2ART A;  3NET A;  1L0W A;  4MML A;  4J15 A;  1KMN A;  4EX5 A;  4MMK A;  4K87 A;  5LJ3 g;  1YB3 A;  1PYS A;  4M78 D;  1KQ1 A;  3ERR A;  1KQ2 A;  5GMK e;  4EMK C;  4KR3 A;  2DTI A;  2DXU A; 
#chains in the Genus database with same CATH topology
 3VKI A;  3CC4 A;  3I55 Q;  1TS9 A;  1RIQ A;  1PC0 A;  4LDY A;  1G5H A;  2B86 A;  3OW2 S;  1RAF B;  2KK4 A;  3OSS C;  2F1L A;  2W0Z A;  4XEM A;  1BI0 A;  2AZV A;  3UA6 A;  2CUB A;  2ZPG B;  1ARK A;  2AKW A;  1OEB A;  2ENM A;  2XGT A;  3MEY A;  2I4L A;  2CS7 A;  1ZUK A;  5LJ5 e;  3V7R A;  1M1F A;  2GF7 A;  1TSF A;  2RHX A;  4YRS A;  3L2Q A;  2J7I A;  2EQI A;  4FSS A;  4K86 A;  2OTL T;  2CDT A;  3QPH A;  1BYM A;  1D1C A;  1YJ9 T;  1NLO C;  3QDF A;  3HRU A;  1TWB A;  2EIF A;  5CR2 A;  4OMN A;  4PJO C;  1BCM A;  1SEM A;  1PYS B;  2QG9 B;  3TSZ A;  3VUB A;  4FYV B;  4H2W A;  4E2F B;  3CME Q;  1VQ6 A;  1MMD A;  5IHN A;  1WXT A;  5GAM g;  3TVT A;  3EG1 A;  1NJ8 A;  4GBQ A;  1Q7Y R;  1YHQ A;  4ELY C;  1G83 A;  1OOT A;  1PKT A;  2RQV A;  3QKJ A;  4MZM A;  4BD3 A;  4YRL A;  5LJ5 g;  4YRG A;  2L2P A;  3JCM W;  1E6H A;  1MMG A;  1RLQ C;  2DRM A;  3CMA Q;  1SKU B;  5HGQ A;  3VQW A;  4XTY A;  3PIP A;  5GMK h;  2ZIO A;  3JCM V;  5GAO l;  4BB7 A;  4PJO F;  2LTO A;  4V2S A;  3WVD B;  3OYM A;  3TCJ A;  4C5E A;  3ZBD A;  1R0B G;  4M75 D;  2LT4 A;  4P72 A;  2O31 A;  3WVE B;  2QTX A;  3S6W A;  2OTJ T;  4YYE A;  1IGQ A;  2ZIN A;  1EIY B;  3HHT B;  3KBG A;  2OX7 A;  1UGP B;  2DAQ A;  4P73 A;  3L2V A;  1QP3 A;  2O4X A;  1RAG B;  2DTH A;  2CT3 A;  4RQE A;  4O2D A;  4AG2 C;  3VQX A;  1C6V X;  1A0N B;  1X2H A;  2VKN A;  1M3A A;  2YUP A;  1I4K 1;  4XK8 E;  3OYL A;  2E6Z A;  2KT8 A;  2EYQ A;  4HVC A;  2ZT5 A;  4M75 B;  3RMS A;  4RG2 A;  3UF4 A;  4FU6 A;  2AHJ B;  2EPD A;  2I4N A;  3VQV A;  3LYI A;  12AS A;  5KH6 A;  2LJ3 A;  2RQW A;  1C0A A;  4LNP A;  4RCC A;  2DMO A;  1K0X A;  4RQF A;  2W10 A;  1Q81 C;  2GGR A;  3EFS A;  2K5L A;  3VYG A;  5FRM A;  4OML A;  1ZHI A;  1SES A;  2F5K A;  1KQS P;  1YNZ A;  2K3Y A;  4K11 A;  2M16 A;  2VXE A;  2EKH A;  4D6W A;  4PJJ A;  4TTV A;  3P8T A;  4BY6 B;  4E7Z A;  2ZPI B;  1FMV A;  2RI3 A;  1JJ2 A;  4RDX A;  2EGC A;  2FYK A;  5HY6 A;  3JCM P;  2MYS A;  3QUI A;  2J6F A;  4M77 E;  3IKL A;  2QDL A;  2XG8 D;  1VQP T;  4E47 A;  2RQR A;  2O2O A;  2DA9 A;  5IN1 A;  5IXF A;  2FZG B;  1NJI R;  2JNG A;  2LZ6 B;  4LVJ A;  2KMT A;  2XI9 A;  2BZX A;  5K1P A;  3HXU A;  4HT8 A;  4JZ4 A;  2ZIM A;  1UFF A;  2L3Q A;  4P71 A;  2CKK A;  4BE0 A;  4CRI A;  1M4Z A;  1MGQ A;  4JZ3 A;  3RKY A;  2KI7 A;  1GBR A;  3TEG A;  4QQG A;  3JCM Q;  3MHX A;  2OTL Q;  1S1N A;  4OB2 B;  2KAF A;  4QW2 A;  3A5Z A;  2JT4 A;  5D6X A;  3T9N A;  3CCL A;  2H3J A;  2K2V A;  4HXJ A;  4AFU C;  3JB9 I;  2XK0 A;  3UFG A;  2YHT A;  3CC2 A;  3N5B B;  1N5Z A;  2VXF A;  3I56 A;  3EFO B;  1G8X A;  4B9X A;  1S72 T;  1FYF A;  1GRI A;  1KC8 R;  5J26 A;  1BIA A;  1I5O B;  1K1Z A;  2EAY A;  4C0G A;  1E22 A;  4M7D C;  4TQD A;  1ZUY A;  3PMI A;  4M75 G;  2COZ A;  1K8A R;  1X55 A;  5IHI A;  1ABO A;  2GFU A;  3O8V A;  3OD1 A;  3QTC A;  1AWW A;  5A0D A;  4OB1 B;  1AZE A;  2DZ9 A;  2E3C A;  5DY9 A;  1Z7M A;  1U3O A;  1WLP B;  3OYA A;  2V8K A;  4H2V A;  3QHS A;  4J8O A;  3RES A;  3JB9 D;  1E1T A;  2K9G A;  3CCQ T;  2NUT B;  3OYB A;  2GTO A;  1D0Y A;  2JTF A;  5A0G A;  4TVR A;  4YRE A;  2EFI A;  1FXX A;  4XU3 A;  1MV0 B;  3OYF A;  3A1P A;  1ADY A;  1AD5 A;  3CCQ Q;  4M78 F;  2MAM A;  3LW5 E;  2K2M A;  2RN8 A;  3C95 A;  3MQZ A;  1YHQ T;  5FU6 B;  3URG A;  5HKC A;  1QCN A;  4UP8 A;  3RNJ A;  4D8D A;  3VBB A;  5KCH A;  4EO4 A;  1X75 C;  3QO8 A;  4YRK A;  4J9D A;  2K79 A;  4C0D B;  1R77 A;  5CVI A;  5KYU A;  1VYT A;  2YLC A;  3TEH A;  4M7A F;  2ARU A;  1V76 A;  2CT4 A;  2P5I A;  1QVF S;  2FEI A;  1N6A A;  3NGP A;  3M0U A;  1UUE A;  3BE3 A;  4DQ2 A;  2ED0 A;  2JMC A;  3EG9 A;  4IUT A;  2ATC B;  5F5W A;  5FWB A;  4C92 F;  2KRO A;  2I4M A;  3QZ5 B;  2HAX A;  1LJO A;  1FX7 A;  2GQV A;  4C5G A;  4DEX A;  1YIJ A;  4UP9 A;  4DOW A;  4KGX B;  1UG1 A;  1X69 A;  4Q5W A;  1K0S A;  3CC4 T;  5K1X A;  2KQW A;  1N8R C;  1U1S A;  1K9M C;  2X4X A;  3M0P A;  4RTX A;  1YFT A;  4M77 D;  3RDV A;  4EMG A;  4ORZ A;  1X54 A;  2QAZ A;  3TQ7 P;  4AFZ C;  4KUI A;  3A8H B;  1DJ7 B;  1W70 A;  5FW9 A;  2V1R A;  2LCC A;  2EJF A;  4Z88 A;  3CD6 Q;  2P0K A;  2ROL A;  2F2X A;  1N9R A;  3PVQ A;  2DM1 A;  1PD0 A;  1VQ8 A;  3MEA A;  3VV0 A;  2RD1 A;  3PGG A;  2JJ9 A;  1M27 C;  5CCA A;  3QDR B;  2RF0 A;  4LN2 A;  2JS0 A;  1NZ9 A;  1PRL C;  4KH0 B;  3M0R A;  4BE2 A;  3AHU A;  4HKE A;  1TUG B;  3MEU A;  3QO7 A;  3JSC A;  1WHJ A;  2A3L A;  3LH5 A;  5HCK A;  1JRI A;  3CQT A;  3J80 E;  4L5G A;  4HWO A;  2AMC B;  4XAX B;  4C5H A;  1G5I A;  1NPP A;  1WPY A;  3QYH B;  3NEM A;  3G6E A;  1W1F A;  2VVK A;  2IG0 A;  3CCE A;  4BDY A;  4P74 A;  1NM7 A;  1OZ3 A;  1U06 A;  3RR6 A;  3HXV A;  3IAL A;  2CJB A;  4YRI A;  3CC7 A;  4C8Q F;  3G7Z A;  3CC2 Q;  1Y96 A;  4RCB A;  1Z9Q A;  2RI5 A;  2ZNJ A;  4Q15 A;  2X4Y A;  4OMF B;  1OPK A;  3HFV A;  3OMG A;  3NEN A;  3HPW A;  1GCQ C;  2DXC A;  5AT1 B;  1V1C A;  3QNE A;  2RQT A;  2D1X A;  4ZTJ A;  2NLU A;  2E70 A;  2DL3 A;  3DLM A;  4N4I A;  3L2Z A;  4E7J A;  1RAC B;  3W3S A;  2YUQ A;  1OU8 A;  1VQ7 T;  2CGH A;  3OYH A;  2O4X B;  3SHW A;  2Q7H A;  5DM7 R;  4F7U G;  3BY7 A;  3NMZ C;  2DDZ A;  2HD0 A;  1YCS B;  1BB9 A;  4C92 B;  1TG0 A;  1LVK A;  4JJN K;  2RHS A;  3SDZ A;  2HKQ B;  4J83 A;  3EGD A;  1M5Q 1;  3V8J A;  4DA4 A;  2ZPE B;  3VS2 A;  2CP0 A;  1H3Z A;  4FT4 A;  1HJD A;  2QEX Q;  1B70 B;  1Q86 R;  1YI2 T;  1OZ2 A;  3UWN A;  1XTD A;  2ZT7 A;  4PJO E;  3TUP A;  3PIO A;  3HRS A;  4CC4 B;  2CUD A;  1VQK A;  4TVW A;  1B7T A;  3CCQ A;  5CO7 A;  3CME A;  2XID A;  1B7Y A;  2ART A;  4J15 A;  3OYK A;  3CXC P;  2MWO A;  1FMW A;  1SSH A;  4FYY B;  3PFS A;  2OTJ A;  3L42 A;  4K87 A;  1PYS A;  1KSW A;  3OB9 A;  2J06 A;  4M78 D;  1RAI B;  4JLG A;  1JQQ A;  4IKF A;  2QK0 A;  2X4W A;  2PU9 B;  1JXM A;  1JO8 A;  4LNS A;  2MF2 A;  5GAN f;  1JJ2 P;  3OA6 A;  2YUO A;  4KUL A;  3OYJ A;  2DXT A;  1FYN A;  1UTI A;  4EMH A;  2EKO A;  5EG2 A;  4F17 A;  3C94 A;  2HQX A;  2CP3 A;  1Y0M A;  4FW2 A;  4E7L A;  2PME A;  1W2B P;  1PNJ A;  4WI1 A;  3G71 A;  1QVG S;  2X35 A;  2C06 A;  3LGF A;  1B8A A;  5GAM e;  2DBK A;  3QO3 A;  1OX9 A;  1K76 A;  1QP2 A;  2HSE B;  1OUL A;  1JEG A;  2P4R A;  4J7I A;  3BW1 A;  2P4T A;  3M55 A;  4J9H A;  2IY5 B;  2JTE A;  4ME7 A;  2QQS A;  4RTW A;  1IRE B;  2M0O A;  3HFZ A;  1HSQ A;  4JRP A;  4DOV A;  3V7S A;  1IRX A;  4R0K A;  2LQ8 A;  1YJW Q;  5IHK A;  5GAN 8;  2NS6 A;  3QJY A;  5LJ3 e;  2L5Q A;  3BDL A;  1D09 B;  2SEM A;  3S3M A;  2ZT6 A;  2FRW A;  3MET A;  2RHS B;  3I5R A;  5GAM d;  4C92 A;  5LJ5 h;  3VU3 C;  3M4Y A;  3KFV A;  1ASZ A;  1D1A A;  3I5S A;  1Y71 A;  4JRI A;  4QVC A;  2HNI A;  5GAN g;  5GAO m;  1SRM A;  2K7A A;  1K73 C;  1W6X A;  5FU7 C;  5C51 B;  4IUP A;  4C8Q G;  2KT1 A;  4UC4 A;  1X6G A;  2RJC A;  4A4H A;  1NYF A;  1IHV A;  1KD1 R;  2NUP B;  3UA7 A;  5IH2 A;  5LJ3 d;  5KCO A;  5KYY A;  3VQY A;  5IAY A;  1S72 Q;  2ARS A;  3A8M B;  3JCM c;  2CZ7 B;  4PJM A;  4YTL A;  1UEB A;  2I4O A;  3L4G B;  2ODR D;  3FDR A;  3P8Y A;  1CKB A;  4M77 A;  4H2U A;  1RAD B;  1VIF A;  1G51 A;  4YRO A;  4IUU A;  4L6V 5;  1NJ5 A;  3HRK A;  4EDU A;  2KE9 A;  1OU9 A;  2PTK A;  2AMC A;  4A4F A;  1KC8 U;  4NL3 A;  1UHF A;  4O5V A;  3HL8 A;  1C1A A;  4A4E A;  4C0F A;  4TVA A;  4PJO G;  3LWI A;  3CXC S;  5GMK i;  1QKW A;  1UE9 A;  3EHR A;  1EVL A;  3ZFJ A;  2RJD A;  1I8F A;  1YCY A;  4NS5 A;  4LVK A;  3SB2 A;  2IPO B;  3EHQ A;  3H41 A;  2FPD A;  1AWO A;  2DK3 A;  2CIM A;  1VQ4 A;  2XTI A;  4XTZ A;  3C0C A;  4YRC A;  2XU8 A;  5GMK m;  1WJS A;  2DLP A;  4P72 C;  1Z9Z A;  2YDL A;  1SSF A;  3OW2 P;  2G6F X;  5KNN A;  1UB4 A;  1WHK A;  3UGT A;  1VQO A;  1EQR A;  1YFR A;  1QMC A;  2I0N A;  1NPR A;  2BUD A;  2QXF A;  3CME T;  4ESR A;  4FYW B;  2DD4 A;  1QKX A;  4PNO A;  1VQM A;  2GNC A;  4UP7 A;  2ZTG A;  1JU5 C;  3A5Y A;  2L8D A;  1K8A U;  1W66 A;  3EG0 A;  5LJ3 h;  2QAS A;  1M3B A;  4PJO A;  2A37 A;  3REA B;  2QHS A;  2CP7 A;  5J39 A;  3V8K A;  5KYN A;  2FVU A;  1VQN T;  2E5K A;  2K5F A;  1WI7 A;  1KD1 C;  1PSF A;  2DZC A;  2E6N A;  1YFN A;  1W2B A;  4M7A B;  3PCO A;  1M30 A;  2J05 A;  2K3X A;  4FIB A;  5EC7 A;  2G4C A;  1I07 A;  3MKD A;  2LP5 A;  1NYR A;  1SPK A;  2VYT A;  1WNL A;  1YJN A;  5FU6 C;  5CKE A;  1T0J A;  3CXC A;  4B6M A;  2RM4 A;  3UT1 A;  1H8K A;  2OI3 A;  4OMM A;  4QKU A;  1ACM B;  2FO0 A;  3ZL7 C;  4OMQ A;  2OJ2 A;  2PVO B;  5FU7 B;  2ESW A;  3U23 A;  1KJW A;  2K6D A;  4JUV A;  5C53 B;  4FCY A;  1ZQ1 A;  1ZA2 B;  2M0Y A;  3MP1 A;  2ZNI A;  5LL6 S;  3X25 B;  3VRZ A;  1VQN A;  2YUN A;  2LCL A;  4AMC A;  2DL4 A;  2QQR A;  4LDW A;  4RMO A;  4P5N A;  3QJ6 A;  3JCM d;  4YRN A;  1IO6 A;  2F2W A;  1Q86 U;  4M7D G;  1VQ9 A;  2DVJ A;  1Z7N A;  3TRE A;  5KYW A;  4A54 A;  1GFD A;  2LNV A;  4TVY A;  2HQH A;  2E5Q A;  4L87 A;  1WHG A;  2HEQ A;  2WAC A;  4HT4 A;  3JCM J;  3SWN C;  1X2K A;  2ZCF B;  3E19 A;  4KH1 B;  2X3X D;  1EX4 A;  1NBE B;  2EQU A;  4QVZ A;  3PT9 A;  4XEO A;  3A8O B;  3G6E T;  3CC4 Q;  2EQK A;  3A7R A;  2RJF A;  3CCM Q;  1HXD A;  3QBY A;  3WQZ A;  1WLE A;  3NTH A;  4JJD A;  2EJG A;  3JB9 F;  6AT1 B;  3DB4 A;  1RAB B;  1VQZ A;  1O9S A;  4E7S A;  1TUD A;  1Q82 C;  2ABL A;  2GFA A;  4QQ6 A;  2FB7 A;  3HRT A;  3A32 A;  4J9C A;  4X9C A;  1KMM A;  2EW3 A;  3EG3 A;  2CSI A;  1M1K C;  3CC7 Q;  2DTO A;  3HXW A;  4BUG A;  1AVZ C;  1JJC A;  1VQL T;  3P8B B;  4IIM A;  2JUF A;  1SHF A;  4E7I A;  4ATO A;  1VQ7 A;  2CH4 A;  4H2X B;  1WHM A;  4LUE A;  1ADJ A;  1VQP Q;  3CCL Q;  2HKN A;  1ZX6 A;  2VGN A;  2ZAE A;  3ICA A;  4JS4 A;  3NFC A;  3Q1J A;  3L2U A;  1MV3 A;  2DIG A;  2RB6 A;  1OX8 A;  3GNG A;  1X6O A;  1VQ4 Q;  3M0S A;  1BI3 A;  4C92 G;  1D0X A;  3MPU B;  1OPL A;  1YFS A;  2LT1 A;  2LC4 A;  3G71 T;  4AG1 C;  4X9D A;  1TXQ A;  4PLL A;  3PTA A;  1VQK T;  1I0C A;  3CBM A;  5E3I A;  1NG2 A;  4CS3 A;  1SHG A;  4YRT A;  4KBM B;  4XTW A;  4P3N A;  2YRD A;  1WQW A;  3RAC A;  2H3E B;  2RO0 A;  1W4S A;  1U5S A;  4M7A A;  1Y57 A;  1Q81 U;  1GFC A;  1USY C;  1SER A;  1B34 B;  2NYS A;  3OYN A;  4D8K A;  2ZPB B;  2LX7 A;  7AT1 B;  4ZTU B;  1IGU A;  2VWF A;  4IUV A;  2R5A A;  4BAC A;  2ZT8 A;  5GMK l;  3CPW A;  1MMA A;  4F7U E;  2OTJ Q;  1B76 A;  1FMK A;  1HK9 A;  5I21 A;  1HTT A;  2D9T A;  2ROT A;  3H6Z A;  2C0O A;  2DIL A;  1YP5 A;  4XU2 A;  4HA8 A;  4M78 A;  1M2O A;  2O9S A;  1N9S A;  4M75 C;  3MCA B;  4M75 F;  2HL3 A;  4OF1 A;  4CC3 A;  1AOJ A;  2JMA A;  4J5Y A;  3HTR A;  1Q7Y C;  2HBW A;  3M4P A;  1VQ5 A;  2HSP A;  2DL7 A;  1EIY A;  1KQS A;  5GMK j;  3JCM f;  4PL6 A;  3UPU A;  2QGF B;  2KY9 A;  3JB9 G;  2E65 A;  4DBF A;  2ZCE A;  3RBB B;  2QQB A;  1RI0 A;  1HC7 A;  3A8L B;  3OS0 A;  1WA7 A;  5GJW B;  2BZ8 A;  1G5V A;  4YRP A;  4HWR A;  4J6X A;  1YN8 A;  4PFO A;  1QWF A;  2LJ0 A;  2OAU A;  3ZEH A;  1D1B A;  5HK0 A;  2RI2 A;  2C0T A;  3OBY A;  4LD6 A;  3X26 B;  1VUB A;  4CS4 A;  2ZZF A;  2J6O A;  1YJN Q;  1LYL A;  2EWN A;  3ER0 A;  4QQD A;  2KGT A;  3VS6 A;  5DLO A;  1KMN A;  1NEB A;  5L8R E;  4EX5 A;  1BCO A;  4GLK A;  4MMK A;  4X1V A;  2V8I A;  3E1S A;  4CI0 C;  4FT2 A;  1B07 A;  5LJ3 g;  1YB3 A;  4CC7 A;  1N27 A;  2LCS A;  2EBP A;  1WX6 A;  2NWM A;  1X01 A;  2E3I A;  4KR3 A;  4CH5 A;  2JM8 A;  1X56 A;  2P0Q A;  2K3B A;  2F5T X;  4M7D D;  3PNW C;  4KGZ B;  3CCV Q;  3L4G A;  2DU5 A;  4DPG A;  1PHT A;  1WGS A;  2Z0W A;  4A63 B;  2XMF A;  3G4S T;  3I56 T;  1OV3 A;  5CK9 A;  2O9V A;  2CZ1 B;  1VQ9 T;  1NYG A;  4R56 A;  4OGE A;  4BI3 A;  1BBZ A;  1PM3 A;  1U1T A;  3A31 A;  3MF2 A;  2QGG A;  1JXO A;  4A53 A;  5D7U A;  2OAW A;  2DYI A;  4Z89 A;  4C8Q B;  3LC0 A;  2O01 E;  3OY9 A;  1K4U S;  4ZN1 A;  2RHY A;  2LMJ A;  1Y7X A;  3V8L A;  2BZY A;  4R55 A;  1VQO Q;  4RG8 A;  2YRC A;  3E9G A;  3RIR A;  2B8A A;  3QXE B;  3HP9 A;  3CCE Q;  2OTL A;  2KXC A;  4NCX A;  5GAN 6;  5LJ5 f;  2DIQ A;  2EYW A;  2BKD N;  4FM4 B;  3S3O A;  5GAM f;  2IIM A;  1SRL A;  1QE0 A;  4P74 C;  1VQ8 Q;  1WYD A;  3THK A;  1IHW A;  3SFM A;  3LGL A;  2ED1 A;  3HFZ B;  1PRM C;  5GAO r;  2COY A;  2VAS A;  2L0A A;  1AHJ B;  1K9M U;  1M8V A;  4JDS A;  2IY5 A;  4EMK B;  1GGM A;  2DFU A;  4C8Q D;  1YJW T;  1NJI U;  1NNH A;  4YCW A;  4C8Q C;  3GPL A;  3M58 A;  3TSW A;  3ULR B;  4E7K A;  4YRR A;  2M1H A;  4CH6 A;  4RTV A;  4LUD A;  2KDS A;  4PHC A;  2K4Y A;  2ZZD A;  2E10 A;  2LQW A;  1BI1 A;  4YRQ A;  5GAN 7;  1KG1 A;  1CKA A;  1Q86 C;  2EYX A;  4WJ3 M;  4RTU A;  2DJZ A;  1TOV A;  2HMA A;  2LVM A;  3MEW A;  4QVD A;  4JPB W;  1LCK A;  2QA4 A;  3P8V A;  4P75 C;  3P8D A;  1O75 A;  3KXT A;  4P75 A;  5LJ3 f;  4BI4 A;  4F14 A;  5GAO p;  1AWX A;  3SWN A;  5I2M A;  1KOG A;  1QVF A;  2DQ3 A;  4PKC C;  2KYM A;  2DVE A;  2A36 A;  2SRC A;  3H8Z A;  2CZ6 B;  3NPF A;  3IG2 A;  3EGX A;  1GCP A;  4LDV A;  2P0L A;  1GBQ A;  4Q6G A;  1WXB A;  4LDU A;  2EYZ A;  1YIT Q;  5GAN d;  3H0H A;  2PZ1 A;  4Y28 E;  4M77 C;  3OBW A;  3M54 A;  5ECA A;  4M77 F;  4BWA A;  3EH1 A;  4F7U B;  3RER A;  2YWW A;  4ELZ C;  2BIV A;  2F2V A;  4GY5 A;  2CH4 W;  5GAO q;  1B7Y B;  2Q7G A;  2FL7 A;  1RAE B;  2X4J A;  1YWO A;  2X9H A;  2A8E A;  1M1K U;  2L3P A;  2I2L A;  5IXB A;  2A28 A;  1ZSZ A;  1UJY A;  2EYY A;  4BDZ A;  4DBR A;  4AT1 B;  1H4T A;  11AS A;  3A7A A;  1B70 A;  4YRF A;  2BE7 D;  2M9U A;  4OLF A;  2EQJ A;  2CP5 A;  1BI2 A;  5KYX A;  3CCU Q;  3R07 A;  3JB9 H;  1QCF A;  1X43 A;  1EZZ B;  5GAN 5;  3QWY A;  4OB3 B;  2KNB B;  1FWZ A;  2C7I A;  3KFU A;  1JBM A;  4PK4 A;  4B9W A;  4F04 B;  1XNI A;  2PVG B;  4II1 A;  4N4H A;  4HWT A;  2DKG A;  4K88 A;  1I1J A;  2RNA A;  5GAN 4;  5CIU A;  1SF9 A;  2DNU A;  3UAT A;  5A2Q E;  3QZ9 B;  3CCE T;  2R5M A;  4OB0 B;  4PJN A;  3TEE A;  1ZUU A;  3PMT A;  1VQ6 Q;  1IZ6 A;  1TUC A;  4ZGE B;  1Q81 R;  3H0F A;  5CKD A;  3CEY A;  4YCV A;  2E5A A;  4PJL A;  1KQS S;  1G3W A;  3CD6 A;  1VQ9 Q;  2PUO B;  5HK3 A;  1WHH A;  2DL5 A;  1RLP C;  2JOY A;  1ZSZ C;  2PVD B;  1Y96 B;  1EFW A;  1WYX A;  2ALY B;  2JXB A;  1PSE A;  5D6Y A;  4F16 A;  4YDQ A;  1QQJ A;  1IXD A;  1M2V A;  3PZC A;  1XJW B;  1X2G A;  3SD4 A;  1B34 A;  2RHQ B;  4YCU A;  3EAE A;  4CC2 A;  1H4S A;  2D8H A;  1AWJ A;  3EG2 A;  1YJ9 A;  3M59 A;  2QHT A;  4KQE A;  5L23 A;  4JJC A;  5LJ5 j;  2G3R A;  3L1A A;  2M02 A;  2KVQ G;  2ZXF A;  4HT9 A;  4Z8A A;  3G1J A;  1WDX A;  3E9F A;  3X28 B;  3CD6 T;  4M7D F;  1VOM A;  1GXI E;  5A0L A;  2RHI A;  4X5O A;  4M78 E;  3C12 A;  4ZGD B;  4YRJ A;  3JCM X;  3VS0 A;  3QYG B;  3VYH B;  4GLM A;  2E3H A;  4DBQ A;  1QLY A;  1K9A A;  3MP8 A;  4H2X A;  2NUZ A;  4AH6 A;  3RKW A;  2CSQ A;  2JVV A;  4IUR A;  3CCJ Q;  2FPF A;  4PJO D;  1X27 A;  2KYB A;  1HYO A;  1BKB A;  4M7A E;  4DBH A;  4J9B A;  4ZGJ B;  4FSX A;  2VGM A;  3QO5 A;  3JCM b;  2V26 A;  3CCR Q;  1BBW A;  2CRE A;  2RHQ A;  4YRM A;  2MI6 A;  3HSB A;  1M1G A;  1M2V B;  2DEQ A;  3EG9 B;  1PD1 A;  4RTY A;  5GAM j;  1NJ1 A;  2ALY A;  4ZN3 A;  1IB8 A;  4AFS C;  4DEY A;  3A74 A;  4LE9 A;  1YIJ T;  5GAN h;  1MNE A;  1R8O B;  2ECZ A;  2QHV A;  3MEV A;  3OMC A;  2MIO A;  8AT1 B;  4C92 C;  1ZLM A;  1AZG B;  5KYU B;  1YHQ Q;  5CKB A;  2KEA A;  5GAO n;  1Q82 R;  3M0Q A;  2YSQ A;  3QG1 A;  2Q5H A;  1EIF A;  4C92 D;  4C0D C;  4M75 E;  2KSS A;  3DLL A;  4L59 A;  5GAN 2;  3PE0 A;  2DRK A;  1UEC A;  2QYZ A;  3BFM A;  3VS7 A;  3GOX A;  1SET A;  4KR2 A;  2R58 A;  1EVK A;  1CSK A;  4RTT A;  3DB3 A;  3QII A;  3BDU A;  3G4S A;  4QT7 A;  4G84 A;  2L89 A;  2J3L A;  3M4Q A;  1LOJ A;  3DSQ A;  4HWS A;  5CQY A;  2LDM A;  1M9S A;  1Q95 G;  4ANJ A;  1BU1 A;  4KGV B;  3TU4 K;  4E51 A;  4PLI A;  2LNH B;  4M7A D;  1VQL A;  3VS5 A;  1MND A;  3V7C A;  4A4K A;  5LJ3 j;  3E9I A;  3NEL A;  1C0M A;  2HBP A;  1ZSZ B;  3C4S A;  3E9H A;  1ASY A;  1M90 R;  1VQ8 T;  1D3B B;  2QA4 Q;  1UGS B;  1OQK A;  2QTV A;  2DPP B;  5C6S A;  2CJ9 A;  2FHD A;  1QVF P;  3UH0 A;  5M9O A;  2AKK A;  3CC7 T;  2QEX A;  3MO8 A;  3M5A A;  2Q5I A;  2ZGW A;  1UDL A;  2JW4 A;  4LD9 K;  4J9I A;  3DKM A;  2XD0 A;  3MF1 A;  1ZA1 B;  1NYQ A;  3OS5 A;  4P3O A;  5GAN 3;  1VIE A;  5C52 B;  4BE1 A;  2V1Q A;  3EGX B;  3WXM B;  3EFO A;  1PCX A;  3CC2 T;  3SEM A;  4YP0 A;  3HXY A;  3SWN B;  1OI1 A;  3O5Z A;  3HY1 A;  3VRY A;  4MDX A;  3A5Z B;  4C8Q E;  3G4S Q;  1M8M A;  2GQI A;  2V8J A;  1UHC A;  1AT1 B;  3I55 A;  4CS2 A;  2X3W D;  4CH4 A;  1WQ7 A;  2K57 A;  4KRT A;  4HCZ A;  1XOV A;  4X34 A;  3JCM h;  3VUZ A;  3CCM T;  5ELN A;  1VA7 A;  3FLG A;  3NHN A;  4IIO A;  2DYB A;  3BJU A;  4ZIB A;  4N4G A;  3I9Q A;  2RK1 A;  4HWP A;  3FRN A;  1U8R A;  3JB9 J;  3UDC A;  2HQE A;  3A7U A;  4LVI A;  4FW1 A;  3HRI A;  4EMK A;  4MDW A;  2EJ9 A;  3H0I A;  2P84 A;  1BBU A;  2CJA A;  2EL9 A;  5FRO A;  5J3B A;  2FRY A;  3CCU A;  3RL6 A;  2VB6 A;  3OYD A;  4AFQ C;  4ZTF A;  2Y90 A;  2MOX A;  5I2S A;  3A98 A;  1NJI C;  1L0W A;  3IQL A;  1YI2 A;  3EGU A;  1KK7 A;  3OW2 A;  4OMP A;  2XHC A;  1K9M R;  1P92 A;  1M90 U;  4J9F A;  2DU7 A;  4J7F A;  2XDD A;  4J6W A;  4WF2 A;  2A08 A;  4EPC A;  1MUZ A;  2XDB A;  1ZSG A;  4C8Q A;  2MPX C;  2VC8 A;  3REX A;  3D7S B;  1YBY A;  2CP2 A;  2NUP A;  1QWE A;  4Y92 A;  4M75 A;  5GAM h;  2MWP A;  4WTO B;  1QW1 A;  2COW A;  5LJ5 d;  3CCS Q;  1QF6 A;  3LWH A;  2HZY A;  2JTM A;  1YWP A;  3LLR A;  3HXZ A;  1B3Q A;  5ELO A;  4YPF A;  1T0H A;  2DJQ A;  1RAA B;  2L3S A;  3CBP A;  3E2U A;  1Q82 U;  1VQK Q;  4TWA A;  4HVV A;  3HY0 A;  2E41 A;  3CMQ A;  2YT6 A;  1EFN A;  2CP6 A;  4HCB A;  2AIR B;  2A0F B;  1RL2 A;  2BTT A;  3GF5 A;  3ME9 A;  4JJB A;  1MMN A;  2EGA A;  3VS3 A;  4HCC A;  4WJ4 A;  2AKL A;  3LH0 A;  2CYZ B;  3RF1 A;  2LQK A;  4XTU A;  2RHZ A;  1JB0 E;  4LXC A;  3CMA T;  2WSE E;  2VUB A;  1WJQ A;  1N8R U;  1PKS A;  1R0C B;  1YIT T;  3GLX A;  2O88 A;  3JCM g;  2DBM A;  2R57 A;  1H4Q A;  4P71 C;  9ATC B;  2L3R A;  1HD3 A;  2D0N A;  2Y4Y A;  4A4G A;  4FL6 A;  5GAN e;  1X2Q A;  4UPA A;  1VQL Q;  5FWC A;  1MHN A;  1T3S A;  3GP8 A;  1T3L A;  2DXB A;  2LJ1 A;  2XIC A;  3QSU A;  4BW9 A;  2RH2 A;  1E7O A;  4OVA A;  4M78 B;  2E4H A;  1F1B B;  5FLX E;  2KRS A;  2AKW B;  2EQM A;  2WSF E;  3FB9 A;  3FJ5 A;  3G6E Q;  4XU1 A;  4PFZ A;  3FC3 A;  1USY A;  1GL5 A;  4XTX A;  1N9W A;  3REU A;  3CCJ A;  1VQM Q;  2GTJ A;  4BI8 B;  2QA4 T;  4HCK A;  3MP6 A;  1H64 1;  1UGV A;  3JRZ A;  4N0A C;  1VQ6 T;  1SRY A;  3HKS A;  5GJV B;  2Y4X A;  2HCK A;  3KUF A;  4M4Z A;  3CPW P;  3I55 T;  1UGQ B;  2IVW A;  2M51 A;  1VQ7 Q;  2FG0 A;  1IL2 A;  3CCR A;  3RKX A;  3HFN A;  3CCM A;  4ZTZ B;  1D3B A;  5AYF A;  3X24 B;  2KRM A;  4M7D E;  2D8J A;  1WHL A;  2KBT A;  2ZR3 A;  4TQF A;  4H2S A;  1Q7Y U;  2JS2 A;  2DEU A;  3OS1 A;  3HTZ A;  2BE9 B;  3JAM E;  3EGD B;  2D6F A;  3UGQ A;  3OYE A;  4MZT A;  1M90 C;  1E6G A;  4RKU E;  3JV3 A;  1NLP C;  1WIE A;  1LPL A;  3J81 E;  4EIK A;  4JRK A;  2AT1 B;  1VQM T;  2DE0 X;  2VV5 A;  1NEG A;  3FIF A;  1S72 A;  1BIB A;  3S3N A;  3VS4 A;  1JJC B;  4KUD K;  3RUX A;  3CCR T;  1QCO A;  4G85 A;  4RUG A;  1VQO T;  3HFO A;  4PFP A;  3LSS A;  1PWT A;  1G2B A;  2A7Y A;  3R6O A;  1KFZ A;  2DF6 A;  1M1K R;  5CAI A;  1WZO A;  2Q7E A;  1RUW A;  2QQ9 A;  3VJP A;  1ZBJ A;  2DX1 A;  1QVG A;  3CCV T;  2EGE A;  2KR3 A;  2ZR2 A;  1NJ2 A;  3J7A F;  3M4G A;  1VQ5 T;  3LSQ A;  4P73 C;  1ABQ A;  2PUK B;  5DLQ E;  2JZ2 A;  4NL2 A;  5KYW B;  4J9G A;  3CCS A;  1KC8 C;  1D0Z A;  3OYI A;  2MMP A;  1KHC A;  2PNI A;  2GBQ A;  3GNF B;  5C0M A;  3REB B;  1YI2 Q;  4HVW A;  4H02 A;  3M56 A;  1LNX A;  5FRN A;  1V29 B;  3NTI A;  1YJN T;  3AT1 B;  4OMO A;  4XTV A;  4VUB A;  1VYV A;  3OYG A;  3RGL A;  3FJP A;  3CCV A;  2PMF A;  2LX9 A;  2JM9 A;  4XU0 A;  2HL5 C;  4WCI A;  5CQX A;  3L2W A;  1YGB A;  3MJX A;  3CMA A;  4M7D B;  3VS1 A;  4E6R A;  2GCX A;  3M0T A;  1QVP A;  1GCQ A;  5IT9 E;  1NJ6 A;  2MK5 A;  2ZZG A;  3CCS T;  4Z02 A;  2QEX T;  1UGR B;  2RPN A;  3A8G B;  3PCO B;  4IUQ A;  2ZPF B;  1J5W A;  2DET A;  2RK2 A;  1PG5 B;  2E12 A;  1TU0 B;  2FZC B;  2DD5 A;  2RMO A;  2HDA A;  1ATI A;  1VYU A;  3ASK A;  5CKF A;  2F69 A;  2D0Q B;  2XDP A;  4N0A A;  3CPW S;  1M3C A;  4E7H A;  2E64 A;  1J3T A;  4PJO B;  3TEH B;  2K5I A;  4J9E A;  3INZ A;  4M78 C;  2X51 A;  4BY6 C;  1K73 U;  1E24 A;  1H3H A;  1AEY A;  3G71 Q;  4HVU A;  4M7A G;  4ZNX A;  2FZK B;  2EVR A;  2JN0 A;  2QHU A;  3CBO A;  1N8R R;  4M7D A;  1VQN Q;  1H4V B;  1Y07 A;  3NTK A;  3I35 A;  4PG3 A;  3JCM e;  2CZ0 B;  5D6W A;  1I5L A;  2DO3 A;  4M7A C;  1EOV A;  2DL8 A;  5I22 A;  2J3M A;  2WSC E;  4M78 G;  5KYX B;  3CCJ T;  4NOY A;  3OSV A;  5CKH A;  3M57 A;  4C0Z A;  1VQ5 Q;  2NUT A;  2ODR C;  4CH3 A;  2KRN A;  1YJW A;  1VQ4 T;  3QWX X;  2ZZE A;  4JS5 A;  2AK5 A;  3IKM B;  3GIB A;  1RI9 A;  3CCU T;  5I11 A;  4RTZ A;  3CPF A;  4TVA B;  4Y91 A;  2RA2 A;  2YLB A;  4JRQ A;  1KHI A;  3HXX A;  4OP0 A;  4J6Y A;  2E1H A;  1YJ9 Q;  5GAN j;  1OYX A;  3OYC A;  3P8H A;  1K73 R;  1G3T A;  4RMF A;  3LX7 A;  1SG5 A;  4F7U A;  2MCN A;  1BK2 A;  1ZBX A;  3OYY A;  2XKO C;  2YRV A;  1UJ0 A;  3GBQ A;  4F7U F;  4H2T A;  4M77 B;  1TH7 A;  1WFW A;  2H8H A;  2QDY B;  1G3Y A;  2PQW A;  4XQ3 A;  1WJR A;  3OQ5 A;  1WXU A;  3R6N A;  2C8M A;  5KYY B;  4C92 E;  2LQN A;  4OGC A;  1WU7 A;  1KIK A;  3EFR A;  1W2B S;  3PVL A;  2FPE A;  1VQP A;  3G1Z A;  4FYX B;  1RAH B;  1QVG P;  1E1O A;  3H9N A;  3F70 A;  8ATC B;  1K8A C;  1TTH B;  1I81 A;  2J6K A;  2KXD A;  5KE2 A;  3I7F A;  2C0I A;  3L2R A;  2ZPH B;  4JLI A;  2DQ0 A;  1X6B A;  4MZP A;  2AZS A;  4H2Y A;  3FEO A;  2RHU A;  1KD1 U;  1JJ2 S;  4LVM A;  1H92 A;  4M77 G;  4LVL A;  4P3P A;  2P0P A;  3EH2 A;  4KT0 E;  2YXY A;  4LDX A;  4O6J A;  1NE8 A;  5KE3 A;  4C5I A;  2RQU A;  1XQH A;  3NET A;  2QI2 A;  4MML A;  1YIT A;  3CCL T;  1YIJ Q;  3M9Q A;  3I56 Q;  2LRQ A;  3OS2 A;  1G3S A;  2DER A;  4EMK C;  1KQ1 A;  3X20 B;  3ERR A;  2QQA A;  1KQ2 A;  3RMQ A;  5GMK e;  3M53 A;  2RJE A;  2DTI A;  2DXU A; 
#chains in the Genus database with same CATH homology
 3VKI A;  3CC4 A;  1RIQ A;  4LDY A;  1G5H A;  3OW2 S;  2KK4 A;  3OSS C;  4XEM A;  1BI0 A;  2ZPG B;  2AKW A;  2XGT A;  3MEY A;  2I4L A;  2CS7 A;  5LJ5 e;  3V7R A;  1M1F A;  2GF7 A;  2RHX A;  4YRS A;  3L2Q A;  4K86 A;  2OTL T;  3QPH A;  1BYM A;  1YJ9 T;  3HRU A;  2EIF A;  5CR2 A;  4PJO C;  1PYS B;  3VUB A;  4H2W A;  1VQ6 A;  5GAM g;  1NJ8 A;  1YHQ A;  4ELY C;  3QKJ A;  4MZM A;  4YRG A;  4BD3 A;  4YRL A;  5LJ5 g;  3JCM W;  5HGQ A;  3VQW A;  4XTY A;  3PIP A;  5GMK h;  2ZIO A;  3JCM V;  5GAO l;  4BB7 A;  4PJO F;  2LTO A;  4V2S A;  3WVD B;  3OYM A;  3TCJ A;  4C5E A;  3ZBD A;  4M75 D;  2LT4 A;  4P72 A;  3WVE B;  2QTX A;  3S6W A;  2OTJ T;  4YYE A;  2ZIN A;  1EIY B;  3HHT B;  3KBG A;  1UGP B;  2DAQ A;  4P73 A;  3L2V A;  1QP3 A;  2O4X A;  2DTH A;  4RQE A;  4O2D A;  3VQX A;  1X2H A;  1I4K 1;  4XK8 E;  3OYL A;  2E6Z A;  2EYQ A;  4HVC A;  2ZT5 A;  4M75 B;  3RMS A;  4RG2 A;  4FU6 A;  2AHJ B;  2I4N A;  3VQV A;  3LYI A;  12AS A;  5KH6 A;  1C0A A;  4RCC A;  4RQF A;  1Q81 C;  3EFS A;  2K5L A;  3VYG A;  5FRM A;  1ZHI A;  1SES A;  2F5K A;  2K3Y A;  2M16 A;  2VXE A;  4D6W A;  4TTV A;  3P8T A;  4BY6 B;  2ZPI B;  1JJ2 A;  2RI3 A;  4RDX A;  2FYK A;  5HY6 A;  3JCM P;  3QUI A;  4M77 E;  3IKL A;  2XG8 D;  1VQP T;  4E47 A;  5IN1 A;  2JNG A;  4LVJ A;  2KMT A;  2XI9 A;  5K1P A;  3HXU A;  4HT8 A;  2ZIM A;  4P71 A;  2CKK A;  4BE0 A;  4CRI A;  1M4Z A;  1MGQ A;  3RKY A;  3TEG A;  4QQG A;  3JCM Q;  3MHX A;  4OB2 B;  2KAF A;  4QW2 A;  3A5Z A;  5D6X A;  3T9N A;  3CCL A;  2H3J A;  2K2V A;  3JB9 I;  2XK0 A;  3UFG A;  2YHT A;  3CC2 A;  3N5B B;  2VXF A;  3I56 A;  4B9X A;  1S72 T;  1FYF A;  5J26 A;  1BIA A;  2EAY A;  1E22 A;  4C0G A;  4M7D C;  4TQD A;  3PMI A;  4M75 G;  1X55 A;  2GFU A;  3O8V A;  3OD1 A;  3QTC A;  5A0D A;  4OB1 B;  2DZ9 A;  2E3C A;  5DY9 A;  1Z7M A;  3OYA A;  2V8K A;  4H2V A;  3QHS A;  4J8O A;  3RES A;  3JB9 D;  1E1T A;  3CCQ T;  3OYB A;  2JTF A;  5A0G A;  4TVR A;  4YRE A;  2EFI A;  1FXX A;  4XU3 A;  3OYF A;  1ADY A;  4M78 F;  2MAM A;  3LW5 E;  3C95 A;  3MQZ A;  1YHQ T;  5FU6 B;  3URG A;  5HKC A;  4UP8 A;  3VBB A;  5KCH A;  4EO4 A;  1X75 C;  3QO8 A;  4YRK A;  4C0D B;  5CVI A;  2YLC A;  3TEH A;  4M7A F;  2ARU A;  2P5I A;  1QVF S;  1N6A A;  4DQ2 A;  4IUT A;  5F5W A;  4C92 F;  2I4M A;  3QZ5 B;  2HAX A;  1LJO A;  1FX7 A;  2GQV A;  4C5G A;  1YIJ A;  4UP9 A;  4DOW A;  4Q5W A;  5K1X A;  3CC4 T;  2KQW A;  1N8R C;  1U1S A;  1K9M C;  2X4X A;  1YFT A;  4M77 D;  4EMG A;  1X54 A;  4KUI A;  3A8H B;  1DJ7 B;  2LCC A;  2EJF A;  2P0K A;  1N9R A;  1VQ8 A;  3MEA A;  3VV0 A;  2RD1 A;  3PGG A;  5CCA A;  3QDR B;  1NZ9 A;  4BE2 A;  3AHU A;  4HKE A;  3MEU A;  3QO7 A;  3JSC A;  2A3L A;  1JRI A;  3J80 E;  4L5G A;  4HWO A;  2AMC B;  4XAX B;  4C5H A;  1G5I A;  1NPP A;  1WPY A;  3QYH B;  3NEM A;  3G6E A;  2IG0 A;  3CCE A;  4BDY A;  4P74 A;  1OZ3 A;  3HXV A;  3IAL A;  2CJB A;  4YRI A;  3CC7 A;  4C8Q F;  3G7Z A;  1Y96 A;  4RCB A;  2RI5 A;  2ZNJ A;  4Q15 A;  2X4Y A;  4OMF B;  3HFV A;  3OMG A;  3NEN A;  3HPW A;  2RJE A;  2DXC A;  3QNE A;  4ZTJ A;  2NLU A;  2E70 A;  3DLM A;  4N4I A;  3L2Z A;  4E7J A;  3W3S A;  1VQ7 T;  2Q7H A;  2CGH A;  3OYH A;  2O4X B;  5DM7 R;  4F7U G;  3BY7 A;  2DDZ A;  2HD0 A;  4C92 B;  4JJN K;  2RHS A;  3SDZ A;  4J83 A;  1M5Q 1;  3V8J A;  4DA4 A;  2ZPE B;  1H3Z A;  4FT4 A;  1B70 B;  1YI2 T;  1OZ2 A;  3UWN A;  1XTD A;  2ZT7 A;  4PJO E;  3TUP A;  3PIO A;  3HRS A;  1VQK A;  4TVW A;  3CCQ A;  5CO7 A;  3CME A;  2XID A;  1B7Y A;  2ART A;  4J15 A;  3OYK A;  2MWO A;  3PFS A;  2OTJ A;  3L42 A;  4K87 A;  1PYS A;  3OB9 A;  4M78 D;  4JLG A;  4IKF A;  2X4W A;  2PU9 B;  4LNS A;  2MF2 A;  5GAN f;  3OA6 A;  4KUL A;  3OYJ A;  2DXT A;  4EMH A;  2EKO A;  5EG2 A;  3C94 A;  2HQX A;  4E7L A;  2PME A;  4WI1 A;  3G71 A;  1QVG S;  2X35 A;  2C06 A;  3LGF A;  1B8A A;  5GAM e;  3QO3 A;  1QP2 A;  4J7I A;  3BW1 A;  2P4T A;  3M55 A;  2IY5 B;  4ME7 A;  2QQS A;  1IRE B;  2M0O A;  3HFZ A;  4JRP A;  4DOV A;  3V7S A;  2LQ8 A;  5GAN 8;  2NS6 A;  3QJY A;  5LJ3 e;  2L5Q A;  3BDL A;  3S3M A;  2ZT6 A;  3MET A;  2RHS B;  5GAM d;  4C92 A;  5LJ5 h;  3VU3 C;  3M4Y A;  1ASZ A;  1Y71 A;  4JRI A;  4QVC A;  2HNI A;  5GAN g;  5GAO m;  1K73 C;  5FU7 C;  5C51 B;  4IUP A;  4C8Q G;  4UC4 A;  2RJC A;  4A4H A;  5LJ3 d;  5KCO A;  3VQY A;  5IAY A;  2ARS A;  3A8M B;  3JCM c;  2CZ7 B;  4YTL A;  1UEB A;  2I4O A;  3L4G B;  2ODR D;  3FDR A;  3P8Y A;  4M77 A;  4H2U A;  1VIF A;  1G51 A;  4YRO A;  4IUU A;  4L6V 5;  1NJ5 A;  3HRK A;  4EDU A;  2AMC A;  4A4F A;  1KC8 U;  4NL3 A;  4O5V A;  3HL8 A;  4A4E A;  4C0F A;  4TVA A;  4PJO G;  3LWI A;  3CXC S;  5GMK i;  1EVL A;  3ZFJ A;  2RJD A;  1I8F A;  1YCY A;  4NS5 A;  4LVK A;  3SB2 A;  2DK3 A;  2CIM A;  1VQ4 A;  2XTI A;  4XTZ A;  4YRC A;  2XU8 A;  5GMK m;  1WJS A;  4P72 C;  1SSF A;  5KNN A;  1UB4 A;  3UGT A;  1VQO A;  1EQR A;  1YFR A;  1NPR A;  2BUD A;  2QXF A;  3CME T;  2DD4 A;  4PNO A;  1VQM A;  4UP7 A;  2ZTG A;  3A5Y A;  2L8D A;  1K8A U;  1W66 A;  5LJ3 h;  4PJO A;  2QHS A;  5J39 A;  3V8K A;  2FVU A;  1VQN T;  2K5F A;  1KD1 C;  1PSF A;  2DZC A;  2E6N A;  1W2B A;  4M7A B;  3PCO A;  2K3X A;  4FIB A;  2G4C A;  1NYR A;  2VYT A;  1WNL A;  1YJN A;  5FU6 C;  5CKE A;  3CXC A;  2RM4 A;  3UT1 A;  2PVO B;  5FU7 B;  4JUV A;  5C53 B;  1ZQ1 A;  3MP1 A;  2ZNI A;  5LL6 S;  3X25 B;  1VQN A;  2LCL A;  2QQR A;  4LDW A;  4RMO A;  4P5N A;  3QJ6 A;  3JCM d;  4YRN A;  1Q86 U;  4M7D G;  1VQ9 A;  1Z7N A;  3TRE A;  4A54 A;  2LNV A;  4TVY A;  2E5Q A;  4L87 A;  2WAC A;  4HT4 A;  3JCM J;  3SWN C;  2ZCF B;  3E19 A;  2EQU A;  4QVZ A;  3PT9 A;  4XEO A;  3A8O B;  3G6E T;  2EQK A;  3A7R A;  2RJF A;  1HXD A;  3QBY A;  3WQZ A;  1WLE A;  3NTH A;  2EJG A;  3JB9 F;  3DB4 A;  1VQZ A;  1O9S A;  1Q82 C;  2GFA A;  4QQ6 A;  2FB7 A;  3HRT A;  3A32 A;  4X9C A;  1KMM A;  1M1K C;  2DTO A;  3HXW A;  4BUG A;  1JJC A;  1VQL T;  3P8B B;  2JUF A;  4E7I A;  4ATO A;  1VQ7 A;  4H2X B;  1ADJ A;  2VGN A;  3ICA A;  4JS4 A;  3NFC A;  3Q1J A;  3L2U A;  2DIG A;  2RB6 A;  3GNG A;  1X6O A;  1BI3 A;  4C92 G;  1YFS A;  2LT1 A;  2LC4 A;  3G71 T;  4X9D A;  4PLL A;  3PTA A;  1VQK T;  3CBM A;  5E3I A;  4CS3 A;  4YRT A;  4KBM B;  4P3N A;  4XTW A;  1WQW A;  3RAC A;  2RO0 A;  1W4S A;  4M7A A;  1Q81 U;  1USY C;  1SER A;  1B34 B;  3OYN A;  2ZPB B;  4ZTU B;  4IUV A;  2R5A A;  4BAC A;  2ZT8 A;  5GMK l;  3CPW A;  4F7U E;  1B76 A;  1HK9 A;  1HTT A;  5I21 A;  2D9T A;  3H6Z A;  4HA8 A;  4M78 A;  4XU2 A;  1N9S A;  4M75 C;  3MCA B;  4M75 F;  4OF1 A;  4J5Y A;  1Q7Y C;  3M4P A;  1VQ5 A;  1EIY A;  1KQS A;  5GMK j;  3JCM f;  4PL6 A;  3UPU A;  2KY9 A;  3JB9 G;  2E65 A;  2ZCE A;  2QQB A;  1RI0 A;  1HC7 A;  3A8L B;  3OS0 A;  1G5V A;  4YRP A;  4HWR A;  4J6X A;  2OAU A;  3ZEH A;  5HK0 A;  2RI2 A;  3OBY A;  4LD6 A;  3X26 B;  1VUB A;  4CS4 A;  2ZZF A;  1LYL A;  2EWN A;  3ER0 A;  4QQD A;  5DLO A;  1KMN A;  5L8R E;  4EX5 A;  4GLK A;  4MMK A;  2V8I A;  3E1S A;  4CI0 C;  4FT2 A;  5LJ3 g;  1YB3 A;  1N27 A;  1X01 A;  4KR3 A;  4CH5 A;  1X56 A;  2P0Q A;  4M7D D;  2F5T X;  3PNW C;  3L4G A;  2DU5 A;  4DPG A;  1WGS A;  3G4S T;  3I56 T;  5CK9 A;  2CZ1 B;  1VQ9 T;  4R56 A;  4OGE A;  4BI3 A;  1U1T A;  3A31 A;  3MF2 A;  4A53 A;  4C8Q B;  3LC0 A;  2O01 E;  3OY9 A;  4ZN1 A;  2RHY A;  1Y7X A;  3V8L A;  4R55 A;  4RG8 A;  3E9G A;  3RIR A;  2B8A A;  3QXE B;  3HP9 A;  2OTL A;  4NCX A;  5GAN 6;  5LJ5 f;  2DIQ A;  4FM4 B;  2BKD N;  3S3O A;  5GAM f;  1QE0 A;  4P74 C;  1WYD A;  3SFM A;  3LGL A;  3HFZ B;  5GAO r;  1AHJ B;  1K9M U;  1M8V A;  4JDS A;  2IY5 A;  4EMK B;  1GGM A;  4C8Q D;  1YJW T;  1NJI U;  1NNH A;  4YCW A;  4C8Q C;  3GPL A;  3M58 A;  4E7K A;  4YRR A;  2M1H A;  4CH6 A;  2KDS A;  4PHC A;  2K4Y A;  2ZZD A;  2E10 A;  1BI1 A;  4YRQ A;  5GAN 7;  1KG1 A;  1Q86 C;  4WJ3 M;  2DJZ A;  2QA4 A;  3MEW A;  2LVM A;  4QVD A;  4P75 C;  3P8V A;  3P8D A;  1O75 A;  3KXT A;  4P75 A;  5LJ3 f;  4BI4 A;  5GAO p;  3SWN A;  5I2M A;  1KOG A;  1QVF A;  2DQ3 A;  4PKC C;  2DVE A;  3H8Z A;  2CZ6 B;  3IG2 A;  4LDV A;  2P0L A;  4Q6G A;  4LDU A;  5GAN d;  4Y28 E;  4M77 C;  3OBW A;  3M54 A;  4M77 F;  4BWA A;  4F7U B;  3RER A;  4ELZ C;  2BIV A;  4GY5 A;  5GAO q;  1B7Y B;  2Q7G A;  2FL7 A;  2X4J A;  2A8E A;  1M1K U;  2I2L A;  4BDZ A;  1H4T A;  11AS A;  3A7A A;  1B70 A;  4YRF A;  2M9U A;  4OLF A;  2EQJ A;  1BI2 A;  3R07 A;  3JB9 H;  5GAN 5;  4OB3 B;  1FWZ A;  2C7I A;  3KFU A;  1JBM A;  4B9W A;  1XNI A;  2PVG B;  4II1 A;  4N4H A;  4HWT A;  2DKG A;  4K88 A;  5GAN 4;  5CIU A;  5A2Q E;  3QZ9 B;  3CCE T;  2R5M A;  4OB0 B;  3TEE A;  3PMT A;  1IZ6 A;  4ZGE B;  5CKD A;  3CEY A;  4YCV A;  2E5A A;  1KQS S;  1G3W A;  3CD6 A;  2PUO B;  5HK3 A;  2JOY A;  2PVD B;  1Y96 B;  1EFW A;  2ALY B;  1PSE A;  5D6Y A;  4YDQ A;  3PZC A;  1X2G A;  3SD4 A;  1B34 A;  2RHQ B;  4YCU A;  3EAE A;  1H4S A;  1YJ9 A;  3M59 A;  2QHT A;  4KQE A;  5LJ5 j;  2G3R A;  3L1A A;  2ZXF A;  2KVQ G;  4HT9 A;  3E9F A;  3X28 B;  3CD6 T;  4M7D F;  1GXI E;  5A0L A;  2RHI A;  4X5O A;  4M78 E;  3C12 A;  4ZGD B;  4YRJ A;  3JCM X;  3QYG B;  3VYH B;  3MP8 A;  4H2X A;  4AH6 A;  3RKW A;  2JVV A;  4IUR A;  4PJO D;  1BKB A;  4M7A E;  4ZGJ B;  4FSX A;  2VGM A;  3QO5 A;  3JCM b;  1BBW A;  2RHQ A;  4YRM A;  2MI6 A;  3HSB A;  1M1G A;  2DEQ A;  5GAM j;  1NJ1 A;  2ALY A;  4ZN3 A;  3A74 A;  1YIJ T;  5GAN h;  1R8O B;  2QHV A;  3MEV A;  3OMC A;  4C92 C;  5CKB A;  5GAO n;  3QG1 A;  2Q5H A;  1EIF A;  4C92 D;  4C0D C;  4M75 E;  2KSS A;  3DLL A;  4L59 A;  5GAN 2;  3BFM A;  1SET A;  3GOX A;  4KR2 A;  2R58 A;  1EVK A;  3DB3 A;  3QII A;  3BDU A;  3G4S A;  4G84 A;  2L89 A;  2J3L A;  3M4Q A;  1LOJ A;  3DSQ A;  4HWS A;  5CQY A;  2LDM A;  1M9S A;  3TU4 K;  4E51 A;  4PLI A;  4M7A D;  1VQL A;  3E9I A;  3V7C A;  4A4K A;  3NEL A;  5LJ3 j;  3C4S A;  2HBP A;  3E9H A;  1ASY A;  1VQ8 T;  1D3B B;  1UGS B;  2DPP B;  5C6S A;  2CJ9 A;  2FHD A;  3UH0 A;  5M9O A;  3CC7 T;  2QEX A;  3MO8 A;  3M5A A;  2Q5I A;  2ZGW A;  4LD9 K;  2XD0 A;  3DKM A;  3MF1 A;  1NYQ A;  3OS5 A;  4P3O A;  5GAN 3;  1VIE A;  5C52 B;  4BE1 A;  3WXM B;  3CC2 T;  4YP0 A;  3HXY A;  3SWN B;  1OI1 A;  3HY1 A;  4MDX A;  3A5Z B;  4C8Q E;  2V8J A;  3I55 A;  4CS2 A;  4CH4 A;  1WQ7 A;  3CCM T;  2K57 A;  4HCZ A;  1XOV A;  4X34 A;  3JCM h;  3VUZ A;  5ELN A;  3FLG A;  3BJU A;  4ZIB A;  4N4G A;  2RK1 A;  4HWP A;  3FRN A;  1U8R A;  3JB9 J;  3UDC A;  3A7U A;  2HQE A;  4LVI A;  3HRI A;  4EMK A;  4MDW A;  2EJ9 A;  2CJA A;  1BBU A;  2EL9 A;  5FRO A;  5J3B A;  3CCU A;  3RL6 A;  3OYD A;  4ZTF A;  2Y90 A;  5I2S A;  1NJI C;  1L0W A;  1YI2 A;  3OW2 A;  2XHC A;  1P92 A;  1M90 U;  2DU7 A;  4J7F A;  2XDD A;  4J6W A;  4WF2 A;  4EPC A;  2XDB A;  4C8Q A;  2VC8 A;  3REX A;  1YBY A;  4M75 A;  5GAM h;  2MWP A;  1QW1 A;  5LJ5 d;  1QF6 A;  3LWH A;  2JTM A;  3LLR A;  3HXZ A;  5ELO A;  4YPF A;  3CBP A;  1Q82 U;  4TWA A;  3HY0 A;  2E41 A;  3CMQ A;  4HCB A;  1RL2 A;  3GF5 A;  3ME9 A;  4HCC A;  4WJ4 A;  3LH0 A;  2CYZ B;  3RF1 A;  2LQK A;  4XTU A;  2RHZ A;  1JB0 E;  3CMA T;  2WSE E;  2VUB A;  1WJQ A;  1N8R U;  1YIT T;  3GLX A;  3JCM g;  2R57 A;  1H4Q A;  4P71 C;  2L3R A;  2Y4Y A;  4A4G A;  4FL6 A;  5GAN e;  4UPA A;  1MHN A;  3GP8 A;  2DXB A;  2XIC A;  3QSU A;  4BW9 A;  2RH2 A;  4OVA A;  4M78 B;  5FLX E;  2AKW B;  2EQM A;  2WSF E;  3FB9 A;  4XU1 A;  3FC3 A;  1USY A;  4XTX A;  1N9W A;  3REU A;  3CCJ A;  4BI8 B;  2QA4 T;  3MP6 A;  1H64 1;  3JRZ A;  4N0A C;  1VQ6 T;  1SRY A;  3HKS A;  2Y4X A;  3KUF A;  3I55 T;  1UGQ B;  2IVW A;  1IL2 A;  3CCR A;  3RKX A;  3HFN A;  3CCM A;  4ZTZ B;  1D3B A;  5AYF A;  3X24 B;  4M7D E;  2ZR3 A;  4TQF A;  4H2S A;  1Q7Y U;  3OS1 A;  3HTZ A;  3JAM E;  2D6F A;  3UGQ A;  3OYE A;  4MZT A;  1M90 C;  4RKU E;  3J81 E;  4JRK A;  1VQM T;  2VV5 A;  3FIF A;  1S72 A;  1BIB A;  3S3N A;  1JJC B;  4KUD K;  3RUX A;  3CCR T;  4G85 A;  1VQO T;  3HFO A;  3LSS A;  2A7Y A;  3R6O A;  5CAI A;  2Q7E A;  2QQ9 A;  3VJP A;  1QVG A;  3CCV T;  2ZR2 A;  1NJ2 A;  3J7A F;  3M4G A;  1VQ5 T;  3LSQ A;  4P73 C;  2PUK B;  5DLQ E;  2JZ2 A;  4NL2 A;  3CCS A;  1KC8 C;  3OYI A;  2MMP A;  1KHC A;  3GNF B;  5C0M A;  4H02 A;  3M56 A;  1LNX A;  5FRN A;  1V29 B;  3NTI A;  1YJN T;  4XTV A;  4VUB A;  3OYG A;  3RGL A;  3FJP A;  3CCV A;  2PMF A;  2LX9 A;  4XU0 A;  5CQX A;  3L2W A;  1YGB A;  3CMA A;  4M7D B;  2GCX A;  1QVP A;  5IT9 E;  1NJ6 A;  2ZZG A;  3CCS T;  4Z02 A;  2QEX T;  1UGR B;  3A8G B;  3PCO B;  4IUQ A;  2ZPF B;  1J5W A;  2RK2 A;  2E12 A;  2DD5 A;  1ATI A;  3ASK A;  5CKF A;  2F69 A;  2D0Q B;  2XDP A;  4N0A A;  3CPW S;  4E7H A;  2E64 A;  4PJO B;  3TEH B;  2K5I A;  3INZ A;  4M78 C;  4BY6 C;  1K73 U;  1E24 A;  4M7A G;  2JN0 A;  2QHU A;  3CBO A;  4M7D A;  1H4V B;  1Y07 A;  3NTK A;  4PG3 A;  3JCM e;  2CZ0 B;  5D6W A;  1I5L A;  2DO3 A;  4M7A C;  1EOV A;  2J3M A;  2WSC E;  4M78 G;  3CCJ T;  4NOY A;  3OSV A;  5CKH A;  3M57 A;  4C0Z A;  2ODR C;  4CH3 A;  1YJW A;  1VQ4 T;  2ZZE A;  4JS5 A;  3IKM B;  3GIB A;  3CCU T;  3CPF A;  4TVA B;  4Y91 A;  2RA2 A;  2YLB A;  4JRQ A;  1KHI A;  3HXX A;  4OP0 A;  4J6Y A;  2E1H A;  5GAN j;  1OYX A;  3OYC A;  3P8H A;  4RMF A;  1G3T A;  3LX7 A;  4F7U A;  1ZBX A;  3OYY A;  2XKO C;  2YRV A;  4F7U F;  4H2T A;  4M77 B;  1TH7 A;  2QDY B;  1G3Y A;  2PQW A;  4XQ3 A;  1WJR A;  3OQ5 A;  2C8M A;  4C92 E;  4OGC A;  1WU7 A;  3EFR A;  1W2B S;  1VQP A;  3G1Z A;  1E1O A;  3F70 A;  1K8A C;  1I81 A;  5KE2 A;  3I7F A;  3L2R A;  2ZPH B;  4JLI A;  2DQ0 A;  4MZP A;  4H2Y A;  3FEO A;  2RHU A;  1KD1 U;  1JJ2 S;  4LVM A;  4M77 G;  4LVL A;  4P3P A;  2P0P A;  4KT0 E;  4LDX A;  4O6J A;  1NE8 A;  5KE3 A;  4C5I A;  3NET A;  1XQH A;  2QI2 A;  4MML A;  1YIT A;  3CCL T;  3M9Q A;  2LRQ A;  3OS2 A;  1G3S A;  1KQ1 A;  3X20 B;  3ERR A;  2QQA A;  1KQ2 A;  3RMQ A;  5GMK e;  3M53 A;  4EMK C;  2DTI A;  2DXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...