3L2ZA

Crystal structure of hydrated biotin protein ligase from m. tuberculosis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
258
structure length
240
Chain Sequence
b'RPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTTARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BirA bifunctional protein
publication title Structural ordering of disordered ligand-binding loops of biotin protein ligase into active conformations as a consequence of dehydration.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 71
structure length 240
sequence length 258
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2zA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3l2zA01
4H2UA 4WJ4A 4PJOD 2ZZGA 2EWNA 4F7UF 5GAOq 11ASA 2DVEA 4C8QD 1PYSB 2DU5A 5LJ3e 3QO5A 3A5ZA 4HWSA 4HVCA 4TWAA 4YCVA 4H2VA 1G51A 1H4VB 4YRGA 3INZA 1WU7A 4RDXA 3JB9J 1B70A 4DPGA 4PJOG 5K1XA 4C8QG 1NYQA 1NJ5A 2PMEA 5K1PA 5LJ5e 4YRIA 3HY1A 5KNNA 5GAN6 4C92C 3HFOA 4C92B 3UH0A 4YP0A 4N0AA 3R07A 3HXZA 4F7UA 2Y90A 4PJOF 4K87A 3G1ZA 4XTXA 4C8QF 5GAOp 3JB9I 1RIQA 2DU7A 3WQZA 3M4PA 4M78G 2DTOA 3JCMW 3LSSA 4A54A 5GMKm 4H2YA 4F7UB 1LJOA 3BFMA 1JJCA 2RB6A 2ZZFA 4UP8A 4M75D 2VC8A 2Q7GA 4DQ2A 3SB2A 3FIFA 2DDZA 3JCMh 5LJ3g 3JCMX 1EIYA 2QHSA 4YCUA 4YRRA 2RD1A 4M7AD 1BBWA 5ELNA 1KOGA 2RA2A 5GAMe 3A7UA 4H2XA 4CH4A 1LNXA 4M75G 5GANf 3RF1A 4H2SA 4MMKA 3JB9D 3QSUA 5GAMf 4BW9A 5LJ5g 2DTIA 4YRQA 4CS3A 1EQRA 1JBMA 2DZCA 1SRYA 4M7AG 4JUVA 4UPAA 4XTVA 2Q5IA 3A32A 4PJOC 5I21A 4EMKA 3L4GB 1ADJA 4NCXA 4C8QC 4PJOB 4G84A 4YRFA 4YPFA 4EO4A 4M75F 4NOYA 4C8QB 3UGTA 4M77D 4EMKC 2ZZEA 5GMKe 4OP0A 4EMKB 2I4OA 4M7AF 3I7FA 5ELOA 1JRIA 4X9CA 1NNHA 3L2ZA 4XEOA 2I4NA 1QF6A 3JCMf 1WPYA 2I2LA 4M77G 2EJ9A 4P71A 4RQEA 3BDUA 2DZ9A 3JB9F 1FYFA 3FJPA 5GANg 5LJ3j 2J3MA 4YRTA 3KFUA 2YHTA 1SETA 1BBUA 5GAMg 1BIAA 3JCMP 3JCMJ 2ZCEA 3FB9A 1WLEA 4J6XA 5GAN5 2VXEA 4F7UG 4P72A 3M4QA 2EJFA 3BW1A 4EX5A 3JCMd 1X2GA 3P8YA 3BY7A 1B34B 5LJ5j 2CJAA 4M77F 4H2TA 1USYA 5LJ3h 3E9HA 4M75C 3GIBA 1ASYA 2ZGWA 4M75B 4KR3A 3ICAA 1HXDA 4M7AC 3HFNA 2ZT6A 4ZTUB 5GAOm 1H4SA 1Y96A 4M7AB 2ZIOA 5LJ5h 4XTYA 3W3SA 1LOJA 3JCMc 3QNEA 2E3CA 4E51A 4HA8A 1YGBA 1H641 3VU3C 3AHUA 1Z7MA 4P74A 4J6YA 3VBBA 1Y96B 2ARTA 3OD1A 3RKWA 4M77A 2EAYA 2Q7EA 1N9RA 1E1OA 4XEMA 1ATIA 4YYEA 4M77C 1IL2A 1B70B 2ZINA 3V7SA 1ADYA 3NELA 3NENA 4BWAA 1YCYA 1X56A 4M77B 4WF2A 3RGLA 4TVWA 4HT9A 4HWRA 4UP7A 1D3BA 2P5IA 3REUA 3QUIA 3MF1A 4AH6A 5CAIA 4N0AC 1X2HA 4QVCA 2AMCA 4CS4A 2YLBA 1I5LA 4YREA 4KQEA 4XU1A 4J6WA 4XTZA 1N9WA 2ZT8A 3VQXA 2P0LA 4M7DE 4O2DA 4CH3A 4EMGA 1EFWA 4XTUA 4V2SA 1YFRA 5GANe 4CH5A 1Z7NA 1JJCB 3P8TA 1H4QA 4TQDA 1E22A 1EOVA 4XQ3A 3V8JA 2IY5A 4L87A 3JB9H 1EIYB 3MF2A 2AKWA 4RCCA 1NYRA 1WYDA 4YCWA 2ARSA 4HT8A 5C51B 1NJ8A 3UGQA 2ODRD 4H2XB 3RIRA 1SERA 2YLCA 1NJ2A 3IG2A 4M78E 1YFSA 2ZR2A 1HTTA 3A31A 3BJUA 3JB9G 5C52B 2AKWB 5GAN3 2ALYA 1X55A 3RKXA 3HXWA 1B8AA 3NEMA 3QO7A 3L1AA 2CIMA 3V8LA 1U1TA 4M7DA 3VQYA 3JCMe 4A53A 3RESA 3TEGA 2ALYB 3A7AA 4MMLA 4QVDA 3HXUA 2ZNIA 5GAOr 3QHSA 4YRJA 2E10A 1GGMA 2E64A 2PMFA 3LC0A 4RQFA 3HXVA 4H2WA 4P71C 2QHTA 3HFZA 4YRPA 4TQFA 2I4LA 1B76A 1L0WA 2FYKA 4UP9A 3QTCA 3EFSA 2E5AA 1LYLA 4XU0A 4P72C 4OLFA 2RHSA 3V7RA 2C8MA 4WI1A 4WJ3M 1J5WA 2QTXA 4HWOA 4P73A 2DXUA 3JCMV 2QHUA 1NJ1A 2K57A 4X5OA 1USYC 4YRSA 3M4GA 1KQ2A 3IKMB 2ZTGA 4C92E 4P3OA 2DEQA 4P73C 3JCMg 3RL6A 1U1SA 4YRLA 4XTWA 1G5IA 4LNSA 1E24A 4PNOA 4P75A 1W66A 1KMMA 3HRKA 3JCMQ 4PHCA 3V8KA 4TTVA 2ODRC 1HC7A 4Q15A 2JN0A 5GANj 1B7YA 5GAN2 4P3PA 4M7DD 4P74C 5GMKl 2DJZA 5GAMj 2G4CA 1I81A 3HTZA 3REXA 3JCMb 2RHQA 3TEHA 4HWPA 3RACA 1I8FA 2CJ9A 1EVKA 2RM4A 1B7YB 5F5WA 5LJ3f 3VQVA 4M7DG 5HGQA 4C92A 5GANh 4J15A 4YRKA 1YB3A 1WQWA 2RHQB 2ZT7A 5GAMh 3TEHB 4TVYA 2XGTA 4YROA 4YDQA 3HXXA 1TH7A 4PJOE 4G85A 1D3BB 4M78D 2EJGA 5GMKj 4X9DA 12ASA 4C8QE 5LJ5f 4XU2A 5E3IA 5LJ3d 3DSQA 2AMCB 3LSQA 3PCOA 4M7DF 4XU3A 3QO8A 4Q6GA 2ZXFA 2VXFA 3V7CA 2DTHA 4ZTZB 2EL9A 2DQ0A 5GMKh 4RMFA 1C0AA 3PCOB 5LJ5d 4YRNA 4ZIBA 4RCBA 2I4MA 5C53B 1N9SA 4J5YA 3RERA 2E1HA 1EVLA 4JRKA 3PGGA 2IY5B 4H02A 1E1TA 2J3LA 3HY0A 4YRMA 4P3NA 3L4GA 4YRCA 4M78F 4HWTA 1HK9A 3MEYA 4CS2A 4PJOA 2ZNJA 1KMNA 4C8QA 2C7IA 1YFTA 2CJBA 1BIBA 4M75E 4M7DC 1ASZA 3RKYA 3A7RA 5GAN4 1M5Q1 3NETA 4PG3A 3HFVA 4EMHA 4M7DB 1VQZA 2ZT5A 5GANd 4C92D 1WQ7A 2DKGA 4M7AE 3PZCA 4CH6A 5GAMd 5GAN8 1M8VA 5GAOl 2ARUA 4M78A 2ZR3A 3A5YA 3A74A 4TVAA 1NJ6A 1QE0A 3ERRA 4C92G 1H4TA 2Q5HA 3CMQA 4K88A 4NL3A 3HFZB 2E41A 2DQ3A 1MGQA 4M78C 2QHVA 1B34A 4NL2A 2CGHA 1KQ1A 4M78B 4TVAB 2XTIA 3SWNA 2DXTA 4JRIA 3TUPA 4M77E 1G5HA 3RUXA 3P8VA 5GMKi 4K86A 2HNIA 4M75A 4Y91A 2FB7A 2RHSB 1X54A 3IALA 4C92F 3SWNC 1WNLA 5GAOn 1I4K1 3VQWA 3UFGA 2ZIMA 3E9IA 1PYSA 3SWNB 1SESA 4M7AA 3EFRA 3HXYA 3HSBA 4F7UE 4JLIA 4KR2A 2E65A 5GAN7 4P75C 3QO3A 3IKLA 1X01A 2Q7HA 5DY9A 3HRIA
chains in the Genus database with same CATH superfamily
4NS5A 3EGDA 4C0DC 2J6FA 4PK4A 3VS0A 1Y71A 3MJXA 1PYSB 3VJPA 1BI2A 2E6NA 3I5RA 4HVCA 5LL6S 4H2VA 4YRGA 5L23A 1WU7A 4Z89A 1QKXA 1PHTA 4AMCA 2HAXA 2MCNA 2B86A 1KC8C 5K1PA 2PMEA 3LW5E 5LJ5e 2ZPBB 3OBYA 4YRIA 3I55A 5KNNA 1QWFA 4JJNK 2FL7A 5EC7A 1H92A 3HFOA 1VQLQ 2RQUA 1Q7YC 3J81E 2ROTA 1QVPA 1BYMA 4F7UA 2JNGA 2Y90A 3OW2P 1X6OA 1K9AA 4XTXA 3R6OA 5GAOp 2MWPA 1GFCA 1QKWA 3JCMW 3LSSA 4A54A 4LVJA 4F7UB 3BFMA 3M0TA 2Q7GA 1KQSA 3QYGB 3FIFA 4J9DA 5LJ3g 3JCMX 3HRSA 1TUCA 1N8RU 1QVFP 2EQKA 3OYJA 4IUTA 1BBWA 3PIPA 5ELNA 2RA2A 3OS1A 4H2XA 1BCMA 5KE2A 3THKA 2KXCA 1SKUB 3A1PA 1IREB 2CT3A 3CCEQ 1SRYA 3M57A 5FU7C 1VIEA 1O75A 3CC2Q 2QQBA 3CC7A 5IT9E 2XG8D 1PRLC 1OPLA 4LVIA 4RMOA 1VQNT 1OX8A 4YRFA 4YPFA 3GNGA 3UGTA 4EMKC 2K5FA 1K8AU 3EGUA 1Z9ZA 4IUPA 1D0XA 1UGRB 1RACB 1NNHA 1IGUA 3JCMf 2FG0A 2I2LA 4M77G 3VYHB 1U06A 4OVAA 4CI0C 3KFUA 2O9SA 2J3MA 5LJ3j 2L0AA 2M51A 2CZ6B 1TU0B 2GTOA 4ELYC 4ZNXA 3TU4K 2OTLQ 3HRTA 2VXEA 5GAN5 1H3HA 2COZA 4N4GA 3BW1A 1JXMA 3KFVA 1MNEA 1X2GA 2A36A 3CD6T 1XOVA 3BY7A 4O6JA 2CJAA 4M77F 4H2TA 2KE9A 4EPCA 1VQ9Q 3UA7A 4KUDK 2XK0A 3PNWC 3GIBA 2ZGWA 2D0NA 1MNDA 1QP3A 1Y96A 1ZUYA 4BE1A 2ZIOA 3A8GB 4XTYA 5LJ5h 3W3SA 2QQAA 4E51A 3UF4A 3REBB 1GBQA 3QWXX 1I1JA 4HXJA 4R55A 1TWBA 3BDLA 4JPBW 4LUEA 4F17A 1Q86R 1X2KA 1Y96B 2QTVA 4OGCA 3RKWA 1M1KU 3OD1A 2EAYA 2Q7EA 2KT1A 4OMFB 2K5IA 2EYQA 1VQOA 2FRWA 3ER0A 4M77C 1IL2A 5FWCA 2ZINA 3OYGA 3QKJA 1TUDA 1VQKA 5IH2A 3RGLA 4TVWA 1D3BA 1PWTA 3TCJA 2P5IA 3QUIA 1SRMA 4AH6A 3CMAQ 2XU8A 5CAIA 1X2HA 3A8OB 2JZ2A 1QCOA 2GQVA 2DXCA 2L3PA 4ZN3A 2LNHB 2QA4Q 3WVDB 4WTOB 3CCQT 1N9WA 4M7DE 2ZPFB 4ZTJA 5FRNA 1V76A 3NMZC 3RR6A 1Q81U 1YFRA 4CH5A 2LQ8A 1CKAA 2VGNA 2KVQG 4JRQA 3HKSA 4TQDA 1WXUA 3H6ZA 1IB8A 1E6GA 1G3YA 2Y4XA 1EIYB 2DRMA 3MF2A 1UGPB 1RADB 4J9EA 4BUGA 3LYIA 5C51B 1AOJA 3CCUA 3UGQA 1MMAA 2W0ZA 4F04B 1VQ6T 3JSCA 2O2OA 3JB9G 2ALYA 2JTMA 2DLPA 5I2SA 2XI9A 2H8HA 2LT4A 2CT4A 4HCKA 1B8AA 4DBQA 2CIMA 2YUNA 1U1TA 2BZXA 1GCQA 2K3YA 4X34A 2E4HA 2I0NA 2LRQA 2ALYB 3A7AA 4JJDA 1SPKA 4E6RA 1D1AA 2JTFA 2ZNIA 3OYLA 1AT1B 4YRJA 1JJ2A 4RTYA 2OTJA 4OMOA 4RQFA 2RQVA 3HFZA 3C95A 3I35A 3I56T 3CBPA 4TQFA 2PZ1A 3SEMA 3ZFJA 1L0WA 2HKNA 4UP9A 5DLQE 4IUVA 3EFSA 1J3TA 1LYLA 1C6VX 1K9MU 1BK2A 3M4YA 1R0BG 3PIOA 2CS7A 3DB3A 4WJ3M 1M1FA 1WIEA 2DXUA 1W4SA 1NJ1A 4J9CA 4YRSA 3CCJT 3QZ9B 2CP0A 1TTHB 3VS1A 2QEXT 4BDZA 2JXBA 2RJCA 4YRLA 1M3BA 1E24A 1K1ZA 2PVGB 1M90U 1W66A 1KMMA 1ZSZC 2DA9A 1YHQT 4O5VA 3JCMQ 4B9WA 2FZCB 1NEGA 1UFFA 3M0QA 2EKOA 2LC4A 1HC7A 2AHJB 2KR3A 5GANj 5GMKl 2DJZA 1GL5A 3CCMA 3H9NA 1HD3A 1I81A 3JCMb 1W70A 3CCQQ 3TEHA 3CPWP 1M8MA 4LDUA 7AT1B 1K73C 2RM4A 5LJ3f 4IIOA 5HGQA 3EGXB 3OYCA 1YJ9A 1KC8R 1YB3A 2P0PA 2DJQA 2KRSA 5GAMh 2QGFB 3QIIA 3TEHB 3X20B 4LXCA 2NUPA 1TH7A 2R5AA 4GLKA 5KYUB 3OYEA 2E5KA 1RAIB 4KGXB 1Q7YR 12ASA 1GXIE 4QQ6A 2DFUA 1WFWA 2AMCB 3JV3A 2EYXA 2KXDA 3QZ5B 3PCOA 3UWNA 4HCCA 1WHJA 1VQ6Q 2CUBA 3V7CA 1CKBA 1TOVA 2PQWA 3A8HB 2KQWA 2DQ0A 1YJWT 3PCOB 2PVOB 4J7IA 5LJ5d 4YRNA 4ZIBA 1VQ5A 5C53B 2IPOB 3RERA 8ATCB 4JRKA 3H0IA 4H02A 1EX4A 3HY0A 3M59A 3CC4T 5CIUA 2RHYA 1OZ3A 2GQIA 2LMJA 2QDLA 1VQKQ 2CZ7B 3MEYA 4EIKA 1SEMA 3NGPA 5IXBA 1VQPQ 2O88A 2GFUA 3OYDA 4BY6C 1YFTA 4RTZA 1AWWA 2OJ2A 3A7RA 2CP7A 5FU7B 1MV3A 4OGEA 6AT1B 2LQKA 2H3EB 4C92D 4PFZA 4FM4B 4LDVA 3S3NA 2D8HA 3CCRT 2LZ6B 3T9NA 2EQMA 2MI6A 1AWJA 2EYZA 2LJ3A 2QGGA 1GCPA 3A98A 4FYVB 2QEXQ 3A5YA 1QE0A 4E7JA 4PKCC 3CMQA 4KGZB 1N8RC 1NPRA 2GCXA 2DQ3A 4J7FA 2OI3A 2CGHA 1KQ1A 1YHQQ 4WCIA 3OW2S 3O8VA 1PCXA 5CKDA 3TUPA 2KMTA 1G5HA 4K86A 4D8KA 2RHSB 5GAOn 2K3XA 1VYUA 4E7HA 3J80E 1YIJA 1O9SA 4ME7A 2ZIMA 3EFRA 1SHFA 5C0MA 4P75C 1ZHIA 2YDLA 1QVFS 5DY9A 4WJ4A 1K8AC 4PJOD 3A8MB 1SSHA 5GAOq 11ASA 4C8QD 4D6WA 3MQZA 2DU5A 4C5GA 1N6AA 3A5ZA 4EDUA 4YCVA 1AWXA 2JS0A 2AZSA 2KDSA 3P8DA 1H4VB 3INZA 2X4WA 1YJNT 3C0CA 3JB9J 1OULA 1B70A 4PL6A 2E70A 1CSKA 1ACMB 1PKTA 2XMFA 3MEUA 5K1XA 2K3BA 3CCEA 2J05A 2M16A 1NJ5A 1NYQA 4P5NA 2MIOA 3FLGA 2HEQA 1PC0A 4FW2A 3ULRB 1OPKA 2YT6A 4B9XA 5CKBA 2MAMA 4A63B 4ZN1A 1WDXA 1NZ9A 2DEUA 4ZTFA 4C92B 3UH0A 4YP0A 1QP2A 5GJWB 4K87A 1VQ4A 3OYBA 1H8KA 3JB9I 4J9FA 1QVFA 4M78G 5KYYB 5FU6C 1X2QA 2ZZFA 1K4US 3RDVA 4UP8A 4M75D 2VC8A 1OYXA 1U3OA 3M0UA 2MOXA 1WJSA 4YRRA 3CCMQ 3CMEQ 1M9SA 3OQ5A 5ECAA 4M7AD 1KOGA 2CSIA 2YXYA 1GRIA 3A7UA 4KUIA 2XIDA 3OS5A 3UA6A 4J83A 5GANf 2MYSA 4LDYA 1M1KC 3RF1A 4H2SA 3JB9D 3QSUA 4CS3A 4ELZC 4YRQA 4RTWA 1YJ9Q 1EQRA 2HBPA 1SG5A 1RLQC 5I11A 1NYFA 3A32A 2GNCA 5I21A 1ADJA 4HVVA 2CP2A 1RL2A 4PJOB 2HMAA 4G84A 5IHKA 2HL5C 2IG0A 4C8QB 1QCNA 4E7ZA 1LCKA 2HSEB 2HDAA 2EPDA 4J9IA 2VGMA 2X3XD 3RNJA 5IHNA 3QG1A 3I9QA 5KYXB 5ELOA 3L2ZA 4XEOA 2ZPEB 3LH5A 5FRMA 1QF6A 1IRXA 2EJ9A 4KH0B 3BDUA 1WXTA 1Q81C 5HKCA 1FYFA 3FJPA 5KCHA 2YHTA 2NWMA 5GAMg 1BIAA 3CCVQ 5A0DA 3JCMJ 3FB9A 2KRMA 4J6XA 5FLXE 1AZEA 1UUEA 3EG9A 1NEBA 4EX5A 3P8YA 2DL7A 2JTEA 1KFZA 2X3WD 3E9HA 3VUBA 5J3BA 4BE0A 4TVRA 1ASYA 2QA4A 4M75B 1X6GA 3EG9B 3QJ6A 4KR3A 2LX9A 3ICAA 2O4XA 4CRIA 2NLUA 3G7ZA 1HXDA 3HFNA 2ZT6A 1H4SA 2E3IA 2J6KA 2VWFA 1ZSZA 4M7AB 1IHWA 3G71T 2E3CA 3MEAA 1VQ7T 4OMNA 3VU3C 5A2QE 3E9FA 3EGDB 3HTRA 2DX1A 1VYVA 2CP6A 4J6YA 4C0GA 3VBBA 2ARTA 1S1NA 2C0IA 3EFOA 2HQXA 1X6BA 2VASA 1S72T 1E1OA 3GLXA 1Q82U 4XEMA 2DRKA 5DLOA 1ATIA 2L2PA 2CP3A 1WHMA 4A4FA 3TVTA 4C5EA 3V7SA 1ADYA 3NELA 1KSWA 4BWAA 1FWZA 2HCKA 2L8DA 2V26A 1K9MC 4HT9A 3REUA 3LWIA 3MF1A 2P4RA 1SSFA 1YIJQ 1ZBJA 2YLBA 1I5LA 4KQEA 3KXTA 5HY6A 2HQHA 2ZT8A 1B07A 2P0LA 1WLPB 2XDPA 5IN1A 3CD6A 2A3LA 4EMGA 1EFWA 4GY5A 5D7UA 4Q5WA 1Z7NA 3UATA 1M90C 3VYGA 1RUWA 1EIFA 4XAXB 4ESRA 3OYMA 2CZ0B 2IY5A 3FEOA 3LGFA 5CKHA 4AFZC 2AKWA 4DEXA 2P0KA 4RCCA 1NYRA 5J39A 3MP1A 1NJ8A 2ODRD 4H2XB 1SERA 2VYTA 2CSQA 1YFSA 5GJVB 4ORZA 2JVVA 1Y07A 4ZGDB 1KD1U 2AKWB 3NTKA 1UB4A 2LCSA 5GAN3 4RTXA 3ASKA 3HXWA 3NEMA 3DB4A 2AK5A 1X27A 3V8LA 1VQ4Q 3VQYA 3JCMe 4A53A 2FO0A 4PFOA 2E5QA 2EQIA 1VYTA 1UEBA 2J7IA 3QDFA 3GBQA 3OMGA 2RHZA 4MMLA 1MV0B 2SEMA 3OYFA 2RHUA 3MHXA 3HXUA 3VV0A 3OBWA 3CCST 2PMFA 2LX7A 4H2WA 3CPWS 4E7KA 4P71C 2QHTA 3CCQA 2QQ9A 3G6EQ 1B76A 2J06A 3JRZA 2FVUA 2LQWA 3QTCA 2E5AA 1D0YA 1G8XA 2ZAEA 4XU0A 1C1AA 2LP5A 3G71Q 1N8RR 2RO0A 4KULA 2C8MA 2X9HA 4WI1A 4B6MA 2QTXA 4P73A 2QHUA 5C6SA 2DO3A 3IKMB 2YRCA 4C92E 1Q95G 2DEQA 2MF2A 2M02A 3RL6A 1U1SA 2ABLA 3EG2A 4XTWA 1G5IA 1VQ6A 4PNOA 2D9TA 3ZEHA 2DETA 3TSZA 4P75A 2R57A 1OV3A 4RTTA 2CKKA 4R56A 5CQXA 2RI2A 4K11A 1JB0E 4JS5A 2F5TX 2KYBA 3CPWA 4QW2A 1BCOA 3CCLT 5GAN2 3E9GA 1WHLA 4P3PA 4LVLA 1K8AR 4L59A 4P74C 2DBMA 3HP9A 2G4CA 2RHQA 1U5SA 4HWPA 3QXEB 2YUPA 3J7AF 3PMIA 2JJ9A 4C0ZA 1VQPA 4M7DG 4AFQC 4BI3A 4FIBA 4OMLA 1M3CA 4J9HA 4YRKA 2JOYA 2RHQB 2ZT7A 2P0QA 1SHGA 2XGTA 2PVDB 4IKFA 1WJQA 1XNIA 3CBMA 2H3JA 4PJOE 1D3BB 4M78D 5GMKj 5CVIA 4C8QE 4DBFA 4XU2A 5E3IA 3DSQA 3LSQA 1VQMT 3F70A 4M7DF 4A4HA 2PNIA 1G3WA 1R0CB 1F1BB 3SHWA 3CCJA 4OB1B 3QO8A 1EFNA 2QEXA 2QQSA 1OI1A 1VQNQ 1TSFA 2DTHA 4ZTZB 4HT4A 2EL9A 2KAFA 5FU6B 4RCBA 4J9BA 2J6OA 1PD0A 2PTKA 1ABOA 1YHQA 3OYIA 1B7TA 2J3LA 4P3NA 1KQSP 4MDWA 3LWHA 3L4GA 4YRCA 2PUOB 1JEGA 1HYOA 1KK7A 3H0FA 3VUZA 4IUUA 5CR2A 1M1KR 1VQ8T 4CS2A 2K5LA 2YWWA 2HSPA 2CREA 4OB2B 2EKHA 3CPFA 2C0TA 3O5ZA 1X75C 5FROA 2CJBA 3CBOA 3H8ZA 2IIMA 4M75E 4M7DC 4IURA 1ASZA 2V8KA 1M5Q1 2CH4W 3CD6Q 4YTLA 3HHTB 4PG3A 2KK4A 4QVZA 4E7SA 5GANd 3FC3A 4FCYA 2DKGA 4E47A 4M7AE 3PZCA 4CH6A 3H0HA 4GLMA 2M0YA 1ZA2B 3H41A 4QKUA 2ARUA 2VV5A 4M78A 1VQOT 2ZR3A 1RI9A 1U8RA 2DL5A 2MPXC 4UC4A 4CC2A 1Q81R 3HFZB 3OYAA 3GNFB 1PNJA 1B34A 2EGCA 2RH2A 4ZGJB 1TG0A 4M78B 1FMVA 2A8EA 3CCLQ 4Y91A 4JRPA 2EYYA 3SWNC 2QI2A 3UFGA 3HPWA 2NYSA 1SESA 1GBRA 5CKEA 1UJ0A 3HSBA 2EQJA 4F7UE 2JS2A 2KI7A 5GAN7 2BKDN 3QO3A 2CH4A 1X01A 2Q7HA 4H2UA 5D6YA 2K9GA 2EWNA 4F7UF 3PTAA 3CMEA 2RF0A 4C0DB 5LJ3e 5CKFA 2V8JA 1G51A 2DYIA 4PJLA 2WSFE 1AZGB 2LTOA 1YBYA 2B8AA 2KNBB 4FT2A 2QK0A 4PJJA 2GTJA 1BI0A 3CCRA 2PUKB 1I07A 5KH6A 3HY1A 2ESWA 3DLLA 4CC4B 4BI8B 2RNAA 2NUTA 4FYYB 4AT1B 1UTIA 2QXFA 2RHIA 4HVWA 1NJIU 3HXZA 1V1CA 2VUBA 1K9MR 3WVEB 1Z9QA 3EHRA 2COWA 2NUPB 1RIQA 2DU7A 4Z8AA 4DOVA 4KBMB 2JM9A 2E3HA 2DD5A 3M58A 1FX7A 1LJOA 1JJCA 2RB6A 4DQ2A 1MMGA 2EGEA 2EBPA 4OMMA 1UGQB 2XHCA 2QHSA 1BKBA 3CCVA 4BDYA 3X24B 1M90R 4CH4A 3GP8A 1VOMA 5D6WA 2PU9B 3UPUA 4BW9A 5LJ5g 2FRYA 1Q82C 1JBMA 2DZCA 4J9GA 3I56Q 2Q5IA 1D0ZA 1YJNA 2XDBA 4EMKA 4A4EA 1D1CA 5KYWA 1RAHB 2IVWA 4EO4A 4VUBA 4AG1C 4M77D 4FSXA 2ZZEA 5GMKe 1AWOA 4OP0A 3PE0A 3URGA 2LT1A 4EMKB 1QWEA 4HVUA 2RQWA 3CCJQ 3RBBB 2F69A 2I4OA 3I7FA 2RJFA 4X9CA 2DPPB 2DYBA 1B3QA 1G3TA 3G4ST 1UG1A 1WPYA 4P71A 3KBGA 2DZ9A 3JAME 2LNVA 3A8LB 1WZOA 1BBUA 4ZGEB 2LVMA 3SD4A 3M9QA 1WLEA 3OYYA 1KG1A 2C06A 4JJCA 3L2RA 3M4QA 1JJ2P 3JCMd 2EFIA 3OMCA 4OB3B 4LDWA 5LJ5j 3N5BB 1SRLA 2KY9A 2LQNA 5LJ3h 2RI3A 1TXQA 3OSVA 2F2VA 3FRNA 1KD1C 1LPLA 1NM7A 3M53A 2RHXA 2XD0A 4ZTUB 1RLPC 5GAOm 3EG0A 3R6NA 2ZPHB 3JCMc 1YGBA 2KSSA 4KGVB 3TEEA 3AHUA 5CQYA 4BACA 4P74A 1YITT 2D6FA 1RABB 4C5IA 1M27C 1YI2T 4M77A 3LX7A 3A5ZB 3OW2A 1K76A 1ZSGA 2NS6A 4YYEA 3P8HA 3L2QA 1DJ7B 2RPNA 2EGAA 1B70B 4DBHA 4FW1A 1SF9A 3UT1A 1YJWQ 4M77B 4BB7A 1X43A 4WF2A 1K0XA 4HWRA 4UP7A 4N0AC 4QVCA 4CS4A 1XTDA 2AKLA 1OU8A 3CC4Q 4XU1A 4XTZA 4PLIA 2JMCA 3MPUB 3VQXA 1RAGB 4O2DA 4CH3A 3S3MA 2L3RA 1UECA 5GANe 3UDCA 3E1SA 5CO7A 5I2MA 2DD4A 3G6EA 3P8TA 1H4QA 1E22A 1EOVA 3V8JA 3Q1JA 3JB9H 1VQLT 1M2OA 1MMDA 3G71A 2M9UA 2ARSA 3ZL7C 4YCWA 3CCRQ 4HT8A 1VQ7A 1XJWB 2LJ1A 2WSEE 1UGVA 3IG2A 4M78E 2HQEA 2RMOA 1HTTA 1RAFB 4DEYA 3BJUA 5C52B 3PT9A 3RKXA 3QO7A 4M7DA 2QAZA 1G5VA 2MK5A 4JDSA 3TEGA 1RAAB 3QDRB 4QVDA 2DIQA 5GAOr 2E10A 1GGMA 3LC0A 2M0OA 2EVRA 3HXVA 4DOWA 2HKQB 1AVZC 4JZ3A 5FWBA 1NE8A 2YSQA 3CC2T 1HJDA 4RKUE 2FYKA 4ANJA 4AFUC 1N5ZA 4P72C 4OLFA 2BZYA 2Z0WA 3X28B 1J5WA 4PJMA 4HWOA 1YJNQ 2K57A 1USYC 2EYWA 5KCOA 3M4GA 3NTHA 2LCCA 5CK9A 1QVGP 3ME9A 2ED0A 3QYHB 2JUFA 2XICA 2BUDA 2GFAA 2MMPA 4FSSA 2WACA 4LNSA 1KHIA 2O4XB 1VQNA 3HRKA 2VVKA 4KRTA 4TTVA 2DF6A 2OTLT 1ZSZB 1IHVA 3NTIA 1UJYA 1QQJA 4LDXA 2JN0A 2L5QA 1NYGA 2LJ0A 5GAMj 1KQSS 4N4IA 3HTZA 3HRUA 3PFSA 1VQ9T 1BI1A 1UHFA 3RACA 4LD9K 2CJ9A 1EVKA 1K73R 2KGTA 3EFOB 1HSQA 3CCSA 4HKEA 2DERA 2E6ZA 2DM1A 5GANh 4J15A 2D1XA 1WGSA 5AYFA 2DVJA 2K4YA 4TVYA 4YROA 4N4HA 1JQQA 3C12A 2ED1A 3G1JA 2ZPGB 4RUGA 5IXFA 1FMKA 3HXXA 4YDQA 3FJ5A 1H3ZA 4G85A 2EJGA 4M4ZA 1ABQA 1UDLA 4X9DA 5LJ5f 3L2WA 3QWYA 5LJ3d 1ZUUA 3DLMA 1AHJB 2FEIA 1ZBXA 4XU3A 4XK8E 4C5HA 4Q6GA 2G3RA 2ZXFA 2VXFA 1W1FA 2AZVA 4Y92A 2QQRA 3C94A 1YNZA 4GBQA 3M54A 1N9SA 4BI4A 2E1HA 4A4GA 3CMAT 3PGGA 3M0SA 2IY5B 2Y4YA 3OS0A 3SDZA 1E1TA 3CCLA 3EAEA 5J26A 2QA4T 5EG2A 2ZNJA 1KMNA 2XKOC 1Q82R 2CZ1B 2M1HA 3HL8A 2R5MA 1BIBA 2OAWA 4DA4A 2O9VA 4BY6B 3NETA 2P4TA 3VS7A 1N27A 1NJIC 4EMHA 1Q86U 1C0MA 1UHCA 1OEBA 1VQZA 2X35A 1WA7A 2L3SA 2RQTA 1JXOA 1E7OA 1WXBA 1XQHA 2X51A 1YP5A 3MCAB 1T3SA 5GAN8 3EH2A 2V1QA 3I55T 4TVAA 3A74A 3L2VA 2ENMA 4MZPA 4C92G 1H4TA 2Q5HA 1VQMA 2BIVA 1OQKA 1YN8A 1W2BP 4K88A 1BB9A 2KROA 1VQ7Q 1JO8A 2QHVA 1OOTA 3U23A 1ZQ1A 4BD3A 2HL3A 4TVAB 4LNPA 2XTIA 1M3AA 2DXTA 3CXCP 1QCFA 2DL4A 2QYZA 4M77E 3P8VA 3RUXA 1T0HA 2HNIA 4D8DA 1T3LA 1S72Q 2FB7A 1AD5A 2V8IA 1X54A 4C92F 1WNLA 1I4K1 3E2UA 3E9IA 2OX7A 1QLYA 3I5SA 4JLIA 1G83A 1W6XA 4KR2A 3M56A 3EG1A 1NG2A 1ZUKA 2E65A 1KD1R 1VQ8A 3IKLA 1D1BA 2ZZGA 1NBEB 5D6XA 3L2UA 1E6HA 2DVEA 1FYNA 3QO5A 4OMQA 1Y7XA 4HWSA 2P84A 4TWAA 2K2MA 1OZ2A 4RTUA 5HK0A 1IZ6A 3MP6A 4AG2C 1BU1A 2EW3A 4RDXA 3CC7T 4DPGA 5L8RE 4PJOG 8AT1B 3OYHA 4C8QG 3MO8A 2AKKA 2LDMA 3I56A 1PSEA 1YFNA 1R77A 2G6FX 5HCKA 5GAN6 4C92C 2MWOA 4PFPA 2KEAA 1P92A 1FMWA 2DE0X 4N0AA 3R07A 5A0LA 2FPDA 4PJOF 3NPFA 3G1ZA 4C0FA 2F2WA 1GFDA 4C8QF 2RI5A 1WHKA 3VS2A 4JZ4A 3WQZA 4BE2A 3PVQA 3M4PA 2DTOA 3TSWA 4H2YA 5GMKm 3KUFA 2LCLA 4LD6A 2KYMA 2RN8A 4JJBA 3SB2A 1BI3A 2DDZA 3JCMh 4RTVA 1EIYA 3LLRA 4YCUA 2RD1A 1WJRA 4FT4A 1KHCA 3E19A 1UGSB 4J8OA 1JJ2S 5GAMe 2F2XA 1LNXA 3LH0A 4M75G 3CCSQ 3X26B 1V29B 4MMKA 1KIKA 2BZ8A 3SFMA 5GAMf 2DTIA 4M7AG 4JUVA 4UPAA 1RAEB 4XTVA 1X69A 1ZLMA 3I55Q 4PJOC 3L4GB 5FW9A 2YUQA 4NCXA 4C8QC 3C4SA 1PSFA 1OX9A 3OB9A 4M75F 4NOYA 5KE3A 1UE9A 2XDDA 2RJDA 1ZX6A 5A0GA 4M7AF 1JRIA 3OSSC 3META 4CC7A 3VS4A 2I4NA 3QPHA 3TREA 4RQEA 1I0CA 5I22A 3AT1B 3JB9F 5GANg 1VQKT 4YRTA 1KC8U 1SETA 2DBKA 1VQPT 2RJEA 3JCMP 2ZCEA 2V1RA 1YJWA 4F7UG 4P72A 5IAYA 1PD1A 2EJFA 2DILA 3MKDA 4QQGA 1Q7YU 1B34B 4LN2A 2BTTA 1USYA 4X1VA 3M0PA 1IGQA 4M75C 2A37A 3CC4A 3REAB 3CC7Q 1LVKA 5IHIA 1WHGA 4M7AC 4HCZA 3NFCA 4FU6A 5AT1B 3QJYA 1LOJA 2AIRB 3QNEA 2DNUA 3CCUT 4MDXA 4HA8A 1H641 4LVMA 4A4KA 1Z7MA 1NLOC 4HCBA 1PM3A 2RK2A 2ROLA 1VQMQ 1KJWA 3TQ7P 4ATOA 3GOXA 1N9RA 1IXDA 1ZA1B 4FYXB 4JS4A 2F1LA 3EGXA 2GF7A 3EG3A 3G4SA 3NENA 3VRYA 1Y57A 4OF1A 2DL8A 1YCYA 1X56A 5KYUA 2COYA 2OAUA 4L5GA 2OTJT 2AMCA 2NUTB 4YREA 5HK3A 2KT8A 4J6WA 2YRDA 1JU5C 2L3QA 1VQ8Q 3S3OA 3OYNA 4XTUA 4V2SA 1M2VA 2DIGA 4IUQA 1NPPA 3VS6A 1BBZA 3VKIA 3QBYA 2ZZDA 1JJCB 4OB0B 4F14A 4XQ3A 4E2FB 3VS5A 4L87A 1PG5B 2FHDA 1M2VB 2W10A 4RG2A 2GBQA 2JW4A 1WYDA 2K2VA 3WXMB 2FZKB 3RIRA 1QVGS 2YLCA 1NJ2A 1RI0A 1VQOQ 3D7SB 2ZR2A 1YITA 3A31A 2QASA 2JMAA 1YI2A 4LUDA 3DKMA 1X55A 2HD0A 2JT4A 3L1AA 2X4YA 1ARKA 1MUZA 3OA6A 1G3SA 2A28A 4FL6A 3CCMT 3CMET 2HZYA 3RESA 2A0FB 5KYWB 5DM7R 3PMTA 1VUBA 2VKNA 1WX6A 1NJIR 3QHSA 2E64A 2D0QB 3MEVA 1YJ9T 4Y28E 4YRPA 3GF5A 2I4LA 2GGRA 3FDRA 4L6V5 1IO6A 2YUOA 1QVGA 2HBWA 1WYXA 2RHSA 3V7RA 3CCUQ 3L42A 4JLGA 3JCMV 4X5OA 1YWOA 2CYZB 2F5KA 2ECZA 1KQ2A 2ZTGA 1VQLA 4P3OA 2KBTA 1G2BA 4RG8A 4P73C 3JCMg 2CUDA 1VIFA 9ATCB 1VQ5T 1I5OB 2CP5A 2FPEA 2CDTA 4AFSC 3CCVT 2ZCFB 4PHCA 3V8KA 2C0OA 2X4XA 4KH1B 3OY9A 1Q86C 2L89A 2ODRC 4CC3A 2K7AA 2BE9B 4Q15A 1K0SA 1B7YA 4M7DD 2BE7D 3IQLA 2OTJQ 3REXA 4Z02A 1A0NB 1WHHA 1I8FA 4IIMA 3P8BB 3CEYA 2E12A 1B7YB 5F5WA 4E7IA 3VQVA 4C92A 3CQTA 1WQWA 3CC2A 2DXBA 1M30A 3GPLA 4II1A 1T0JA 4PJNA 5KYYA 4PLLA 4DBRA 2D8JA 1M4ZA 1OU9A 2QG9B 3X25B 2K6DA 1PRMC 2K79A 1TS9A 3S6WA 4QQDA 1W2BS 3MP8A 1M1GA 1WI7A 2DMOA 2VB6A 3RMQA 3OS2A 5GMKh 4RMFA 1C0AA 2KRNA 1YCSB 4LVKA 2EIFA 2I4MA 4Z88A 3CXCS 2DL3A 2AT1B 4J5YA 3OYKA 1EVLA 1YIJT 5CCAA 3G4SQ 2OTLA 4YRMA 2R58A 4KT0E 3M5AA 1FXXA 4M78F 1VA7A 1S72A 1HK9A 4HWTA 2X4JA 2SRCA 2O31A 2JM8A 4OMPA 4PJOA 1R8OB 1QMCA 3VRZA 1VQ9A 4C8QA 2C7IA 3EH1A 3M0RA 3LGLA 3RMSA 1GCQC 3RKYA 5GAN4 1MMNA 3HFVA 3PVLA 2ATCB 5KYXA 5KYNA 4M7DB 2ZT5A 1WQ7A 1QW1A 2NUZA 3BE3A 2EQUA 1D09B 4MZTA 5GAMd 3ZBDA 3CCET 1W2BA 1TUGB 3M55A 1M8VA 5GAOl 4E7LA 1PKSA 1NLPC 1NJ6A 3ERRA 2YRVA 3CXCA 2ZPIB 1K73U 4R0KA 2DK3A 5M9OA 4NL3A 2E41A 1MGQA 4M78C 1VQ5Q 1MHNA 4MZMA 2QDYB 4NL2A 1VQ4T 2FZGB 2DAQA 1YITQ 2A08A 3SWNA 2A7YA 3NHNA 1EZZB 4JRIA 4F16A 1YI2Q 2FPFA 5GMKi 4M75A 4FYWB 3IALA 3EHQA 2RQRA 3VQWA 3CMAA 4LE9A 2O01E 2RK1A 2WSCE 1Y0MA 1PYSA 4QT7A 3SWNB 4M7AA 3HXYA 1AEYA 1YWPA 3MEWA 3VS3A 3G6ET 3HRIA
chains in the Genus database with same CATH topology
4NS5A 4C0DC 1Y71A 1PYSB 3VJPA 1BI2A 2E6NA 4HVCA 5LL6S 4H2VA 4YRGA 1WU7A 2HAXA 1KC8C 5K1PA 2PMEA 3LW5E 5LJ5e 2ZPBB 3OBYA 4YRIA 3I55A 5KNNA 4JJNK 2FL7A 3HFOA 1Q7YC 3J81E 1QVPA 1BYMA 4F7UA 2JNGA 2Y90A 1X6OA 4XTXA 3R6OA 5GAOp 2MWPA 3JCMW 3LSSA 4A54A 4LVJA 4F7UB 3BFMA 2Q7GA 1KQSA 3QYGB 3FIFA 5LJ3g 3JCMX 3HRSA 1N8RU 2EQKA 3OYJA 4IUTA 1BBWA 3PIPA 5ELNA 2RA2A 3OS1A 4H2XA 5KE2A 1IREB 1SRYA 3M57A 5FU7C 1VIEA 1O75A 2QQBA 3CC7A 5IT9E 2XG8D 4LVIA 4RMOA 1VQNT 4YRFA 4YPFA 3GNGA 3UGTA 4EMKC 2K5FA 1K8AU 4IUPA 1UGRB 1NNHA 3JCMf 2I2LA 4M77G 3VYHB 4OVAA 4CI0C 3KFUA 2J3MA 5LJ3j 2CZ6B 4ELYC 3TU4K 3HRTA 2VXEA 5GAN5 4N4GA 3BW1A 1X2GA 3CD6T 1XOVA 3BY7A 4O6JA 2CJAA 4M77F 4H2TA 4EPCA 4KUDK 2XK0A 3PNWC 3GIBA 2ZGWA 1QP3A 1Y96A 4BE1A 2ZIOA 3A8GB 4XTYA 5LJ5h 3W3SA 2QQAA 4E51A 4R55A 3BDLA 1Y96B 4OGCA 1M1KU 3RKWA 3OD1A 2EAYA 2Q7EA 4OMFB 2K5IA 2EYQA 1VQOA 3ER0A 4M77C 1IL2A 2ZINA 3OYGA 3QKJA 1VQKA 3RGLA 4TVWA 1D3BA 2P5IA 3TCJA 3QUIA 4AH6A 2XU8A 5CAIA 1X2HA 3A8OB 2JZ2A 2GQVA 2DXCA 4ZN3A 3WVDB 3CCQT 1N9WA 4M7DE 2ZPFB 4ZTJA 5FRNA 1Q81U 1YFRA 4CH5A 2LQ8A 2VGNA 2KVQG 4JRQA 3HKSA 4TQDA 3H6ZA 1G3YA 2Y4XA 1EIYB 3MF2A 1UGPB 4BUGA 3LYIA 5C51B 3CCUA 3UGQA 1VQ6T 3JSCA 3JB9G 2ALYA 2JTMA 5I2SA 2XI9A 2LT4A 1B8AA 2CIMA 1U1TA 2K3YA 4X34A 2LRQA 2ALYB 3A7AA 2JTFA 2ZNIA 3OYLA 4YRJA 1JJ2A 2OTJA 4RQFA 3HFZA 3C95A 3I56T 3CBPA 4TQFA 3ZFJA 1L0WA 4UP9A 5DLQE 4IUVA 3EFSA 1LYLA 1K9MU 3M4YA 3PIOA 2CS7A 3DB3A 4WJ3M 1M1FA 2DXUA 1W4SA 1NJ1A 4YRSA 3CCJT 3QZ9B 2QEXT 4BDZA 2RJCA 4YRLA 1E24A 2PVGB 1M90U 1W66A 1KMMA 1YHQT 4O5VA 3JCMQ 4B9WA 2EKOA 2LC4A 1HC7A 2AHJB 5GANj 5GMKl 2DJZA 3CCMA 1I81A 3JCMb 3TEHA 4LDUA 1K73C 2RM4A 5LJ3f 5HGQA 3OYCA 1YJ9A 1YB3A 2P0PA 5GAMh 3QIIA 3TEHB 3X20B 1TH7A 2R5AA 4GLKA 3OYEA 12ASA 1GXIE 4QQ6A 2AMCB 3QZ5B 3PCOA 3UWNA 4HCCA 3V7CA 2PQWA 3A8HB 2KQWA 2DQ0A 1YJWT 3PCOB 2PVOB 4J7IA 5LJ5d 4YRNA 4ZIBA 1VQ5A 5C53B 3RERA 4JRKA 4H02A 3HY0A 3M59A 3CC4T 5CIUA 2RHYA 1OZ3A 2CZ7B 3MEYA 2GFUA 3OYDA 4BY6C 1YFTA 3A7RA 5FU7B 4OGEA 2LQKA 4C92D 4FM4B 4LDVA 3S3NA 3CCRT 3T9NA 2EQMA 2MI6A 3A5YA 1QE0A 4E7JA 4PKCC 3CMQA 1N8RC 1NPRA 2GCXA 2DQ3A 4J7FA 2CGHA 1KQ1A 3OW2S 3O8VA 5CKDA 3TUPA 2KMTA 1G5HA 4K86A 2RHSB 5GAOn 2K3XA 4E7HA 3J80E 1YIJA 1O9SA 4ME7A 2ZIMA 3EFRA 5C0MA 4P75C 1ZHIA 1QVFS 5DY9A 4WJ4A 1K8AC 4PJOD 3A8MB 5GAOq 11ASA 4C8QD 4D6WA 3MQZA 2DU5A 4C5GA 1N6AA 3A5ZA 4EDUA 4YCVA 3P8DA 1H4VB 2KDSA 3INZA 2X4WA 1YJNT 3JB9J 1B70A 4PL6A 2E70A 3MEUA 5K1XA 3CCEA 2M16A 1NJ5A 1NYQA 4P5NA 3FLGA 4B9XA 5CKBA 2MAMA 4ZN1A 1NZ9A 4ZTFA 4C92B 3UH0A 4YP0A 1QP2A 4K87A 1VQ4A 3OYBA 3JB9I 1QVFA 4M78G 5FU6C 2ZZFA 4UP8A 4M75D 2VC8A 1OYXA 1WJSA 4YRRA 1M9SA 3OQ5A 4M7AD 1KOGA 3A7UA 4KUIA 2XIDA 3OS5A 4J83A 5GANf 4LDYA 1M1KC 3RF1A 4H2SA 3JB9D 3QSUA 4CS3A 4ELZC 4YRQA 1EQRA 2HBPA 3A32A 5I21A 1ADJA 1RL2A 4PJOB 4G84A 2IG0A 4C8QB 2VGMA 3QG1A 5ELOA 3L2ZA 4XEOA 2ZPEB 5FRMA 1QF6A 2EJ9A 3BDUA 1Q81C 5HKCA 1FYFA 3FJPA 5KCHA 2YHTA 5GAMg 1BIAA 5A0DA 3JCMJ 3FB9A 4J6XA 5FLXE 4EX5A 3P8YA 3E9HA 3VUBA 5J3BA 4BE0A 4TVRA 1ASYA 2QA4A 4M75B 3QJ6A 4KR3A 2LX9A 3ICAA 2O4XA 4CRIA 2NLUA 3G7ZA 1HXDA 3HFNA 2ZT6A 1H4SA 4M7AB 3G71T 2E3CA 3MEAA 1VQ7T 3VU3C 5A2QE 3E9FA 4J6YA 4C0GA 3VBBA 2ARTA 2HQXA 1S72T 1E1OA 3GLXA 1Q82U 4XEMA 1ATIA 5DLOA 4A4FA 4C5EA 3V7SA 1ADYA 3NELA 4BWAA 1FWZA 2L8DA 1K9MC 4HT9A 3REUA 3LWIA 3MF1A 1SSFA 2YLBA 1I5LA 4KQEA 3KXTA 5HY6A 2ZT8A 2P0LA 3CD6A 2XDPA 5IN1A 2A3LA 4EMGA 1EFWA 4GY5A 4Q5WA 1Z7NA 1M90C 3VYGA 1EIFA 4XAXB 3OYMA 2CZ0B 2IY5A 3FEOA 3LGFA 5CKHA 2AKWA 2P0KA 4RCCA 1NYRA 5J39A 3MP1A 1NJ8A 2ODRD 4H2XB 1SERA 2VYTA 1YFSA 2JVVA 1Y07A 4ZGDB 1KD1U 2AKWB 3NTKA 1UB4A 5GAN3 3ASKA 3HXWA 3NEMA 3DB4A 3V8LA 3VQYA 3JCMe 4A53A 2E5QA 1UEBA 3OMGA 2RHZA 4MMLA 3OYFA 2RHUA 3MHXA 3HXUA 3VV0A 3OBWA 3CCST 2PMFA 4H2WA 3CPWS 4E7KA 4P71C 2QHTA 3CCQA 2QQ9A 1B76A 3JRZA 2FVUA 3QTCA 2E5AA 4XU0A 2RO0A 4KULA 2C8MA 4WI1A 2QTXA 4P73A 2QHUA 5C6SA 2DO3A 3IKMB 4C92E 2DEQA 2MF2A 3RL6A 1U1SA 4XTWA 1G5IA 1VQ6A 4PNOA 2D9TA 3ZEHA 4P75A 2R57A 2CKKA 4R56A 5CQXA 2RI2A 1JB0E 4JS5A 2F5TX 3CPWA 4QW2A 3CCLT 5GAN2 3E9GA 4P3PA 4LVLA 4L59A 4P74C 3HP9A 2G4CA 2RHQA 4HWPA 3QXEB 3J7AF 3PMIA 4C0ZA 1VQPA 4M7DG 4BI3A 4FIBA 4YRKA 2JOYA 2RHQB 2ZT7A 2P0QA 2XGTA 2PVDB 4IKFA 1XNIA 1WJQA 3CBMA 2H3JA 4PJOE 1D3BB 4M78D 5GMKj 5CVIA 4C8QE 4XU2A 5E3IA 3DSQA 3LSQA 1VQMT 3F70A 4M7DF 4A4HA 1G3WA 3CCJA 4OB1B 3QO8A 2QEXA 2QQSA 1OI1A 2DTHA 4ZTZB 4HT4A 2EL9A 2KAFA 5FU6B 4RCBA 1YHQA 3OYIA 2J3LA 4P3NA 4MDWA 3LWHA 3L4GA 4YRCA 2PUOB 3VUZA 4IUUA 5CR2A 1VQ8T 4CS2A 2K5LA 4OB2B 3CPFA 1X75C 5FROA 2CJBA 3CBOA 3H8ZA 4M75E 4M7DC 4IURA 1ASZA 2V8KA 1M5Q1 4PG3A 4YTLA 3HHTB 2KK4A 4QVZA 5GANd 3FC3A 2DKGA 4E47A 4M7AE 3PZCA 4CH6A 2ARUA 2VV5A 4M78A 1VQOT 2ZR3A 1U8RA 4UC4A 3HFZB 3OYAA 3GNFB 1B34A 2RH2A 4ZGJB 4M78B 2A8EA 4Y91A 4JRPA 3SWNC 2QI2A 3UFGA 3HPWA 1SESA 5CKEA 3HSBA 2EQJA 4F7UE 5GAN7 2BKDN 3QO3A 1X01A 2Q7HA 4H2UA 5D6YA 2EWNA 4F7UF 3PTAA 3CMEA 4C0DB 5LJ3e 5CKFA 2V8JA 1G51A 2WSFE 2LTOA 1YBYA 2B8AA 4FT2A 1BI0A 3CCRA 2PUKB 5KH6A 3HY1A 3DLLA 4BI8B 2QXFA 2RHIA 3HXZA 1NJIU 2VUBA 3WVEB 1RIQA 2DU7A 4DOVA 4KBMB 2DD5A 3M58A 1FX7A 1LJOA 1JJCA 2RB6A 4DQ2A 1UGQB 2XHCA 2QHSA 1BKBA 3CCVA 4BDYA 3X24B 4CH4A 3GP8A 5D6WA 2PU9B 3UPUA 4BW9A 5LJ5g 1Q82C 1JBMA 2DZCA 2Q5IA 1YJNA 2XDBA 4EMKA 4A4EA 2IVWA 4EO4A 4VUBA 4M77D 4FSXA 2ZZEA 5GMKe 4OP0A 3URGA 2LT1A 4EMKB 2F69A 2I4OA 3I7FA 2RJFA 4X9CA 2DPPB 1G3TA 3G4ST 1WPYA 4P71A 3KBGA 2DZ9A 3JAME 2LNVA 3A8LB 1BBUA 4ZGEB 2LVMA 3SD4A 3M9QA 1WLEA 3OYYA 1KG1A 2C06A 3L2RA 3M4QA 3JCMd 2EFIA 3OMCA 4OB3B 4LDWA 5LJ5j 3N5BB 2KY9A 5LJ3h 2RI3A 3OSVA 3FRNA 1KD1C 3M53A 2RHXA 2XD0A 4ZTUB 5GAOm 2ZPHB 3JCMc 1YGBA 2KSSA 3TEEA 3AHUA 5CQYA 4BACA 4P74A 1YITT 2D6FA 4C5IA 1YI2T 4M77A 3LX7A 3A5ZB 3OW2A 2NS6A 4YYEA 3P8HA 3L2QA 1DJ7B 1B70B 3UT1A 4M77B 4BB7A 4WF2A 4HWRA 4UP7A 4N0AC 4QVCA 4CS4A 1XTDA 4XU1A 4XTZA 4PLIA 3VQXA 4O2DA 4CH3A 3S3MA 2L3RA 5GANe 3UDCA 3E1SA 5CO7A 5I2MA 2DD4A 3G6EA 3P8TA 1H4QA 1E22A 1EOVA 3V8JA 3Q1JA 3JB9H 1VQLT 3G71A 2M9UA 2ARSA 4YCWA 4HT8A 1VQ7A 2WSEE 3IG2A 4M78E 2HQEA 1HTTA 3BJUA 5C52B 3PT9A 3RKXA 3QO7A 4M7DA 1G5VA 4JDSA 3TEGA 3QDRB 4QVDA 2DIQA 5GAOr 2E10A 1GGMA 3LC0A 2M0OA 3HXVA 4DOWA 1NE8A 3CC2T 4RKUE 2FYKA 4P72C 4OLFA 3X28B 1J5WA 4HWOA 2K57A 1USYC 5KCOA 3M4GA 3NTHA 2LCCA 5CK9A 3ME9A 3QYHB 2JUFA 2XICA 2BUDA 2GFAA 2MMPA 2WACA 4LNSA 1KHIA 2O4XB 1VQNA 3HRKA 4TTVA 2OTLT 3NTIA 4LDXA 2JN0A 2L5QA 5GAMj 1KQSS 4N4IA 3HTZA 3HRUA 3PFSA 1VQ9T 1BI1A 3RACA 4LD9K 2CJ9A 1EVKA 3CCSA 4HKEA 2E6ZA 5GANh 4J15A 1WGSA 5AYFA 2K4YA 4TVYA 4YROA 4N4HA 3C12A 4YDQA 2ZPGB 3HXXA 1H3ZA 4G85A 2EJGA 4X9DA 5LJ5f 3L2WA 5LJ3d 3DLMA 1AHJB 1ZBXA 4XU3A 4XK8E 4C5HA 4Q6GA 2G3RA 2ZXFA 2VXFA 2QQRA 3C94A 3M54A 1N9SA 4BI4A 2E1HA 4A4GA 3CMAT 3PGGA 2IY5B 2Y4YA 3OS0A 3SDZA 1E1TA 3CCLA 3EAEA 5J26A 2QA4T 5EG2A 2ZNJA 1KMNA 2XKOC 2CZ1B 2M1HA 3HL8A 2R5MA 1BIBA 4DA4A 4BY6B 3NETA 2P4TA 1N27A 1NJIC 4EMHA 1Q86U 1VQZA 2X35A 1XQHA 3MCAB 5GAN8 3I55T 4TVAA 3A74A 3L2VA 4MZPA 4C92G 1H4TA 2Q5HA 1VQMA 2BIVA 4K88A 2QHVA 1ZQ1A 4BD3A 4TVAB 2XTIA 2DXTA 4M77E 3P8VA 3RUXA 2HNIA 2FB7A 2V8IA 1X54A 4C92F 1WNLA 1I4K1 3E9IA 4JLIA 4KR2A 3M56A 2E65A 1VQ8A 3IKLA 2ZZGA 5D6XA 3L2UA 2DVEA 3QO5A 1Y7XA 4HWSA 4TWAA 5HK0A 1OZ2A 1IZ6A 3MP6A 4RDXA 3CC7T 4DPGA 5L8RE 4PJOG 3OYHA 4C8QG 3MO8A 2LDMA 3I56A 1PSEA 5GAN6 4C92C 2MWOA 1P92A 4N0AA 3R07A 5A0LA 4PJOF 3G1ZA 4C0FA 4C8QF 2RI5A 3WQZA 4BE2A 3M4PA 2DTOA 4H2YA 5GMKm 3KUFA 2LCLA 4LD6A 3SB2A 1BI3A 2DDZA 3JCMh 1EIYA 3LLRA 4YCUA 2RD1A 1WJRA 4FT4A 1KHCA 3E19A 1UGSB 4J8OA 1JJ2S 5GAMe 1LNXA 3LH0A 4M75G 3X26B 1V29B 4MMKA 3SFMA 5GAMf 2DTIA 4M7AG 4JUVA 4UPAA 4XTVA 4PJOC 3L4GB 4NCXA 4C8QC 3C4SA 1PSFA 3OB9A 4M75F 4NOYA 5KE3A 2XDDA 2RJDA 5A0GA 4M7AF 1JRIA 3OSSC 3META 2I4NA 3QPHA 3TREA 4RQEA 3JB9F 5GANg 1VQKT 4YRTA 1KC8U 1SETA 1VQPT 2RJEA 3JCMP 2ZCEA 1YJWA 4F7UG 4P72A 5IAYA 2EJFA 4QQGA 1Q7YU 1B34B 1USYA 4M75C 3CC4A 4M7AC 4HCZA 3NFCA 4FU6A 3QJYA 1LOJA 3QNEA 3CCUT 4MDXA 4HA8A 1H641 4LVMA 4A4KA 1Z7MA 4HCBA 2RK2A 4ATOA 3GOXA 1N9RA 4JS4A 2GF7A 3G4SA 3NENA 4OF1A 1YCYA 1X56A 2OAUA 4L5GA 2OTJT 2AMCA 4YREA 5HK3A 4J6WA 3S3OA 3OYNA 4XTUA 4V2SA 2DIGA 4IUQA 1NPPA 3VKIA 3QBYA 2ZZDA 1JJCB 4OB0B 4XQ3A 4L87A 2FHDA 4RG2A 1WYDA 2K2VA 3WXMB 3RIRA 1QVGS 2YLCA 1NJ2A 1RI0A 2ZR2A 1YITA 3A31A 1YI2A 3DKMA 1X55A 2HD0A 3L1AA 2X4YA 3OA6A 1G3SA 4FL6A 3CCMT 3CMET 3RESA 5DM7R 3PMTA 1VUBA 3QHSA 2E64A 2D0QB 3MEVA 1YJ9T 4Y28E 4YRPA 3GF5A 2I4LA 3FDRA 4L6V5 1QVGA 2RHSA 3V7RA 3L42A 4JLGA 3JCMV 4X5OA 2CYZB 2F5KA 1KQ2A 2ZTGA 1VQLA 4P3OA 4RG8A 4P73C 3JCMg 1VIFA 1VQ5T 3CCVT 2ZCFB 4PHCA 3V8KA 3OY9A 2X4XA 1Q86C 2ODRC 2L89A 4Q15A 1B7YA 4M7DD 3REXA 4Z02A 1I8FA 3P8BB 3CEYA 2E12A 1B7YB 5F5WA 4E7IA 3VQVA 4C92A 1WQWA 3CC2A 2DXBA 3GPLA 4II1A 4PLLA 1M4ZA 3X25B 3S6WA 4QQDA 1W2BS 3MP8A 1M1GA 3RMQA 3OS2A 5GMKh 4RMFA 1C0AA 4LVKA 2EIFA 2I4MA 3CXCS 4J5YA 3OYKA 1EVLA 1YIJT 5CCAA 2OTLA 4YRMA 2R58A 4KT0E 3M5AA 1FXXA 4M78F 1S72A 4HWTA 1HK9A 2X4JA 4PJOA 1R8OB 1VQ9A 4C8QA 2C7IA 3LGLA 3RMSA 3RKYA 5GAN4 3HFVA 4M7DB 2ZT5A 1WQ7A 1QW1A 2EQUA 5GAMd 4MZTA 3ZBDA 3CCET 1W2BA 3M55A 1M8VA 5GAOl 4E7LA 1NJ6A 3ERRA 2YRVA 3CXCA 2ZPIB 1K73U 2DK3A 5M9OA 4NL3A 2E41A 1MGQA 4M78C 1MHNA 4MZMA 2QDYB 4NL2A 1VQ4T 2DAQA 3SWNA 2A7YA 4JRIA 5GMKi 4M75A 3IALA 3VQWA 3CMAA 2WSCE 2O01E 2RK1A 1PYSA 3SWNB 4M7AA 3HXYA 3MEWA 3G6ET 3HRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2U A;  4WJ4 A;  4PJO D;  2ZZG A;  2EWN A;  4F7U F;  5GAO q;  11AS A;  2DVE A;  4C8Q D;  1PYS B;  2DU5 A;  5LJ3 e;  3QO5 A;  3A5Z A;  4HWS A;  4HVC A;  4TWA A;  4YCV A;  4H2V A;  1G51 A;  1H4V B;  4YRG A;  3INZ A;  1WU7 A;  4RDX A;  3JB9 J;  1B70 A;  4DPG A;  4PJO G;  5K1X A;  4C8Q G;  1NYQ A;  1NJ5 A;  2PME A;  5K1P A;  5LJ5 e;  4YRI A;  3HY1 A;  5KNN A;  5GAN 6;  4C92 C;  3HFO A;  4C92 B;  3UH0 A;  4YP0 A;  4N0A A;  3R07 A;  3HXZ A;  4F7U A;  2Y90 A;  4PJO F;  4K87 A;  3G1Z A;  4XTX A;  4C8Q F;  5GAO p;  3JB9 I;  1RIQ A;  2DU7 A;  3WQZ A;  3M4P A;  4M78 G;  2DTO A;  3JCM W;  3LSS A;  4A54 A;  5GMK m;  4H2Y A;  4F7U B;  1LJO A;  3BFM A;  1JJC A;  2RB6 A;  2ZZF A;  4UP8 A;  4M75 D;  2VC8 A;  2Q7G A;  4DQ2 A;  3SB2 A;  3FIF A;  2DDZ A;  3JCM h;  5LJ3 g;  3JCM X;  1EIY A;  2QHS A;  4YCU A;  4YRR A;  2RD1 A;  4M7A D;  1BBW A;  5ELN A;  1KOG A;  2RA2 A;  5GAM e;  3A7U A;  4H2X A;  4CH4 A;  1LNX A;  4M75 G;  5GAN f;  3RF1 A;  4H2S A;  4MMK A;  3JB9 D;  3QSU A;  5GAM f;  4BW9 A;  5LJ5 g;  2DTI A;  4YRQ A;  4CS3 A;  1EQR A;  1JBM A;  2DZC A;  1SRY A;  4M7A G;  4JUV A;  4UPA A;  4XTV A;  2Q5I A;  3A32 A;  4PJO C;  5I21 A;  4EMK A;  3L4G B;  1ADJ A;  4NCX A;  4C8Q C;  4PJO B;  4G84 A;  4YRF A;  4YPF A;  4EO4 A;  4M75 F;  4NOY A;  4C8Q B;  3UGT A;  4M77 D;  4EMK C;  2ZZE A;  5GMK e;  4OP0 A;  4EMK B;  2I4O A;  4M7A F;  3I7F A;  5ELO A;  1JRI A;  4X9C A;  1NNH A;  3L2Z A;  4XEO A;  2I4N A;  1QF6 A;  3JCM f;  1WPY A;  2I2L A;  4M77 G;  2EJ9 A;  4P71 A;  4RQE A;  3BDU A;  2DZ9 A;  3JB9 F;  1FYF A;  3FJP A;  5GAN g;  5LJ3 j;  2J3M A;  4YRT A;  3KFU A;  2YHT A;  1SET A;  1BBU A;  5GAM g;  1BIA A;  3JCM P;  3JCM J;  2ZCE A;  3FB9 A;  1WLE A;  4J6X A;  5GAN 5;  2VXE A;  4F7U G;  4P72 A;  3M4Q A;  2EJF A;  3BW1 A;  4EX5 A;  3JCM d;  1X2G A;  3P8Y A;  3BY7 A;  1B34 B;  5LJ5 j;  2CJA A;  4M77 F;  4H2T A;  1USY A;  5LJ3 h;  3E9H A;  4M75 C;  3GIB A;  1ASY A;  2ZGW A;  4M75 B;  4KR3 A;  3ICA A;  1HXD A;  4M7A C;  3HFN A;  2ZT6 A;  4ZTU B;  5GAO m;  1H4S A;  1Y96 A;  4M7A B;  2ZIO A;  5LJ5 h;  4XTY A;  3W3S A;  1LOJ A;  3JCM c;  3QNE A;  2E3C A;  4E51 A;  4HA8 A;  1YGB A;  1H64 1;  3VU3 C;  3AHU A;  1Z7M A;  4P74 A;  4J6Y A;  3VBB A;  1Y96 B;  2ART A;  3OD1 A;  3RKW A;  4M77 A;  2EAY A;  2Q7E A;  1N9R A;  1E1O A;  4XEM A;  1ATI A;  4YYE A;  4M77 C;  1IL2 A;  1B70 B;  2ZIN A;  3V7S A;  1ADY A;  3NEL A;  3NEN A;  4BWA A;  1YCY A;  1X56 A;  4M77 B;  4WF2 A;  3RGL A;  4TVW A;  4HT9 A;  4HWR A;  4UP7 A;  1D3B A;  2P5I A;  3REU A;  3QUI A;  3MF1 A;  4AH6 A;  5CAI A;  4N0A C;  1X2H A;  4QVC A;  2AMC A;  4CS4 A;  2YLB A;  1I5L A;  4YRE A;  4KQE A;  4XU1 A;  4J6W A;  4XTZ A;  1N9W A;  2ZT8 A;  3VQX A;  2P0L A;  4M7D E;  4O2D A;  4CH3 A;  4EMG A;  1EFW A;  4XTU A;  4V2S A;  1YFR A;  5GAN e;  4CH5 A;  1Z7N A;  1JJC B;  3P8T A;  1H4Q A;  4TQD A;  1E22 A;  1EOV A;  4XQ3 A;  3V8J A;  2IY5 A;  4L87 A;  3JB9 H;  1EIY B;  3MF2 A;  2AKW A;  4RCC A;  1NYR A;  1WYD A;  4YCW A;  2ARS A;  4HT8 A;  5C51 B;  1NJ8 A;  3UGQ A;  2ODR D;  4H2X B;  3RIR A;  1SER A;  2YLC A;  1NJ2 A;  3IG2 A;  4M78 E;  1YFS A;  2ZR2 A;  1HTT A;  3A31 A;  3BJU A;  3JB9 G;  5C52 B;  2AKW B;  5GAN 3;  2ALY A;  1X55 A;  3RKX A;  3HXW A;  1B8A A;  3NEM A;  3QO7 A;  3L1A A;  2CIM A;  3V8L A;  1U1T A;  4M7D A;  3VQY A;  3JCM e;  4A53 A;  3RES A;  3TEG A;  2ALY B;  3A7A A;  4MML A;  4QVD A;  3HXU A;  2ZNI A;  5GAO r;  3QHS A;  4YRJ A;  2E10 A;  1GGM A;  2E64 A;  2PMF A;  3LC0 A;  4RQF A;  3HXV A;  4H2W A;  4P71 C;  2QHT A;  3HFZ A;  4YRP A;  4TQF A;  2I4L A;  1B76 A;  1L0W A;  2FYK A;  4UP9 A;  3QTC A;  3EFS A;  2E5A A;  1LYL A;  4XU0 A;  4P72 C;  4OLF A;  2RHS A;  3V7R A;  2C8M A;  4WI1 A;  4WJ3 M;  1J5W A;  2QTX A;  4HWO A;  4P73 A;  2DXU A;  3JCM V;  2QHU A;  1NJ1 A;  2K57 A;  4X5O A;  1USY C;  4YRS A;  3M4G A;  1KQ2 A;  3IKM B;  2ZTG A;  4C92 E;  4P3O A;  2DEQ A;  4P73 C;  3JCM g;  3RL6 A;  1U1S A;  4YRL A;  4XTW A;  1G5I A;  4LNS A;  1E24 A;  4PNO A;  4P75 A;  1W66 A;  1KMM A;  3HRK A;  3JCM Q;  4PHC A;  3V8K A;  4TTV A;  2ODR C;  1HC7 A;  4Q15 A;  2JN0 A;  5GAN j;  1B7Y A;  5GAN 2;  4P3P A;  4M7D D;  4P74 C;  5GMK l;  2DJZ A;  5GAM j;  2G4C A;  1I81 A;  3HTZ A;  3REX A;  3JCM b;  2RHQ A;  3TEH A;  4HWP A;  3RAC A;  1I8F A;  2CJ9 A;  1EVK A;  2RM4 A;  1B7Y B;  5F5W A;  5LJ3 f;  3VQV A;  4M7D G;  5HGQ A;  4C92 A;  5GAN h;  4J15 A;  4YRK A;  1YB3 A;  1WQW A;  2RHQ B;  2ZT7 A;  5GAM h;  3TEH B;  4TVY A;  2XGT A;  4YRO A;  4YDQ A;  3HXX A;  1TH7 A;  4PJO E;  4G85 A;  1D3B B;  4M78 D;  2EJG A;  5GMK j;  4X9D A;  12AS A;  4C8Q E;  5LJ5 f;  4XU2 A;  5E3I A;  5LJ3 d;  3DSQ A;  2AMC B;  3LSQ A;  3PCO A;  4M7D F;  4XU3 A;  3QO8 A;  4Q6G A;  2ZXF A;  2VXF A;  3V7C A;  2DTH A;  4ZTZ B;  2EL9 A;  2DQ0 A;  5GMK h;  4RMF A;  1C0A A;  3PCO B;  5LJ5 d;  4YRN A;  4ZIB A;  4RCB A;  2I4M A;  5C53 B;  1N9S A;  4J5Y A;  3RER A;  2E1H A;  1EVL A;  4JRK A;  3PGG A;  2IY5 B;  4H02 A;  1E1T A;  2J3L A;  3HY0 A;  4YRM A;  4P3N A;  3L4G A;  4YRC A;  4M78 F;  4HWT A;  1HK9 A;  3MEY A;  4CS2 A;  4PJO A;  2ZNJ A;  1KMN A;  4C8Q A;  2C7I A;  1YFT A;  2CJB A;  1BIB A;  4M75 E;  4M7D C;  1ASZ A;  3RKY A;  3A7R A;  5GAN 4;  1M5Q 1;  3NET A;  4PG3 A;  3HFV A;  4EMH A;  4M7D B;  1VQZ A;  2ZT5 A;  5GAN d;  4C92 D;  1WQ7 A;  2DKG A;  4M7A E;  3PZC A;  4CH6 A;  5GAM d;  5GAN 8;  1M8V A;  5GAO l;  2ARU A;  4M78 A;  2ZR3 A;  3A5Y A;  3A74 A;  4TVA A;  1NJ6 A;  1QE0 A;  3ERR A;  4C92 G;  1H4T A;  2Q5H A;  3CMQ A;  4K88 A;  4NL3 A;  3HFZ B;  2E41 A;  2DQ3 A;  1MGQ A;  4M78 C;  2QHV A;  1B34 A;  4NL2 A;  2CGH A;  1KQ1 A;  4M78 B;  4TVA B;  2XTI A;  3SWN A;  2DXT A;  4JRI A;  3TUP A;  4M77 E;  1G5H A;  3RUX A;  3P8V A;  5GMK i;  4K86 A;  2HNI A;  4M75 A;  4Y91 A;  2FB7 A;  2RHS B;  1X54 A;  3IAL A;  4C92 F;  3SWN C;  1WNL A;  5GAO n;  1I4K 1;  3VQW A;  3UFG A;  2ZIM A;  3E9I A;  1PYS A;  3SWN B;  1SES A;  4M7A A;  3EFR A;  3HXY A;  3HSB A;  4F7U E;  4JLI A;  4KR2 A;  2E65 A;  5GAN 7;  4P75 C;  3QO3 A;  3IKL A;  1X01 A;  2Q7H A;  5DY9 A;  3HRI A; 
#chains in the Genus database with same CATH topology
 4NS5 A;  3EGD A;  4C0D C;  2J6F A;  4PK4 A;  3VS0 A;  1Y71 A;  3MJX A;  1PYS B;  3VJP A;  1BI2 A;  2E6N A;  3I5R A;  4HVC A;  5LL6 S;  4H2V A;  4YRG A;  5L23 A;  1WU7 A;  4Z89 A;  1QKX A;  1PHT A;  4AMC A;  2HAX A;  2MCN A;  2B86 A;  1KC8 C;  5K1P A;  2PME A;  3LW5 E;  5LJ5 e;  2ZPB B;  3OBY A;  4YRI A;  3I55 A;  5KNN A;  1QWF A;  4JJN K;  2FL7 A;  5EC7 A;  1H92 A;  3HFO A;  1VQL Q;  2RQU A;  1Q7Y C;  3J81 E;  2ROT A;  1QVP A;  1BYM A;  4F7U A;  2JNG A;  2Y90 A;  3OW2 P;  1X6O A;  1K9A A;  4XTX A;  3R6O A;  5GAO p;  2MWP A;  1GFC A;  1QKW A;  3JCM W;  3LSS A;  4A54 A;  4LVJ A;  4F7U B;  3BFM A;  3M0T A;  2Q7G A;  1KQS A;  3QYG B;  3FIF A;  4J9D A;  5LJ3 g;  3JCM X;  3HRS A;  1TUC A;  1N8R U;  1QVF P;  2EQK A;  3OYJ A;  4IUT A;  1BBW A;  3PIP A;  5ELN A;  2RA2 A;  3OS1 A;  4H2X A;  1BCM A;  5KE2 A;  3THK A;  2KXC A;  1SKU B;  3A1P A;  1IRE B;  2CT3 A;  3CCE Q;  1SRY A;  3M57 A;  5FU7 C;  1VIE A;  1O75 A;  3CC2 Q;  2QQB A;  3CC7 A;  5IT9 E;  2XG8 D;  1PRL C;  1OPL A;  4LVI A;  4RMO A;  1VQN T;  1OX8 A;  4YRF A;  4YPF A;  3GNG A;  3UGT A;  4EMK C;  2K5F A;  1K8A U;  3EGU A;  1Z9Z A;  4IUP A;  1D0X A;  1UGR B;  1RAC B;  1NNH A;  1IGU A;  3JCM f;  2FG0 A;  2I2L A;  4M77 G;  3VYH B;  1U06 A;  4OVA A;  4CI0 C;  3KFU A;  2O9S A;  2J3M A;  5LJ3 j;  2L0A A;  2M51 A;  2CZ6 B;  1TU0 B;  2GTO A;  4ELY C;  4ZNX A;  3TU4 K;  2OTL Q;  3HRT A;  2VXE A;  5GAN 5;  1H3H A;  2COZ A;  4N4G A;  3BW1 A;  1JXM A;  3KFV A;  1MNE A;  1X2G A;  2A36 A;  3CD6 T;  1XOV A;  3BY7 A;  4O6J A;  2CJA A;  4M77 F;  4H2T A;  2KE9 A;  4EPC A;  1VQ9 Q;  3UA7 A;  4KUD K;  2XK0 A;  3PNW C;  3GIB A;  2ZGW A;  2D0N A;  1MND A;  1QP3 A;  1Y96 A;  1ZUY A;  4BE1 A;  2ZIO A;  3A8G B;  4XTY A;  5LJ5 h;  3W3S A;  2QQA A;  4E51 A;  3UF4 A;  3REB B;  1GBQ A;  3QWX X;  1I1J A;  4HXJ A;  4R55 A;  1TWB A;  3BDL A;  4JPB W;  4LUE A;  4F17 A;  1Q86 R;  1X2K A;  1Y96 B;  2QTV A;  4OGC A;  3RKW A;  1M1K U;  3OD1 A;  2EAY A;  2Q7E A;  2KT1 A;  4OMF B;  2K5I A;  2EYQ A;  1VQO A;  2FRW A;  3ER0 A;  4M77 C;  1IL2 A;  5FWC A;  2ZIN A;  3OYG A;  3QKJ A;  1TUD A;  1VQK A;  5IH2 A;  3RGL A;  4TVW A;  1D3B A;  1PWT A;  3TCJ A;  2P5I A;  3QUI A;  1SRM A;  4AH6 A;  3CMA Q;  2XU8 A;  5CAI A;  1X2H A;  3A8O B;  2JZ2 A;  1QCO A;  2GQV A;  2DXC A;  2L3P A;  4ZN3 A;  2LNH B;  2QA4 Q;  3WVD B;  4WTO B;  3CCQ T;  1N9W A;  4M7D E;  2ZPF B;  4ZTJ A;  5FRN A;  1V76 A;  3NMZ C;  3RR6 A;  1Q81 U;  1YFR A;  4CH5 A;  2LQ8 A;  1CKA A;  2VGN A;  2KVQ G;  4JRQ A;  3HKS A;  4TQD A;  1WXU A;  3H6Z A;  1IB8 A;  1E6G A;  1G3Y A;  2Y4X A;  1EIY B;  2DRM A;  3MF2 A;  1UGP B;  1RAD B;  4J9E A;  4BUG A;  3LYI A;  5C51 B;  1AOJ A;  3CCU A;  3UGQ A;  1MMA A;  2W0Z A;  4F04 B;  1VQ6 T;  3JSC A;  2O2O A;  3JB9 G;  2ALY A;  2JTM A;  2DLP A;  5I2S A;  2XI9 A;  2H8H A;  2LT4 A;  2CT4 A;  4HCK A;  1B8A A;  4DBQ A;  2CIM A;  2YUN A;  1U1T A;  2BZX A;  1GCQ A;  2K3Y A;  4X34 A;  2E4H A;  2I0N A;  2LRQ A;  2ALY B;  3A7A A;  4JJD A;  1SPK A;  4E6R A;  1D1A A;  2JTF A;  2ZNI A;  3OYL A;  1AT1 B;  4YRJ A;  1JJ2 A;  4RTY A;  2OTJ A;  4OMO A;  4RQF A;  2RQV A;  3HFZ A;  3C95 A;  3I35 A;  3I56 T;  3CBP A;  4TQF A;  2PZ1 A;  3SEM A;  3ZFJ A;  1L0W A;  2HKN A;  4UP9 A;  5DLQ E;  4IUV A;  3EFS A;  1J3T A;  1LYL A;  1C6V X;  1K9M U;  1BK2 A;  3M4Y A;  1R0B G;  3PIO A;  2CS7 A;  3DB3 A;  4WJ3 M;  1M1F A;  1WIE A;  2DXU A;  1W4S A;  1NJ1 A;  4J9C A;  4YRS A;  3CCJ T;  3QZ9 B;  2CP0 A;  1TTH B;  3VS1 A;  2QEX T;  4BDZ A;  2JXB A;  2RJC A;  4YRL A;  1M3B A;  1E24 A;  1K1Z A;  2PVG B;  1M90 U;  1W66 A;  1KMM A;  1ZSZ C;  2DA9 A;  1YHQ T;  4O5V A;  3JCM Q;  4B9W A;  2FZC B;  1NEG A;  1UFF A;  3M0Q A;  2EKO A;  2LC4 A;  1HC7 A;  2AHJ B;  2KR3 A;  5GAN j;  5GMK l;  2DJZ A;  1GL5 A;  3CCM A;  3H9N A;  1HD3 A;  1I81 A;  3JCM b;  1W70 A;  3CCQ Q;  3TEH A;  3CPW P;  1M8M A;  4LDU A;  7AT1 B;  1K73 C;  2RM4 A;  5LJ3 f;  4IIO A;  5HGQ A;  3EGX B;  3OYC A;  1YJ9 A;  1KC8 R;  1YB3 A;  2P0P A;  2DJQ A;  2KRS A;  5GAM h;  2QGF B;  3QII A;  3TEH B;  3X20 B;  4LXC A;  2NUP A;  1TH7 A;  2R5A A;  4GLK A;  5KYU B;  3OYE A;  2E5K A;  1RAI B;  4KGX B;  1Q7Y R;  12AS A;  1GXI E;  4QQ6 A;  2DFU A;  1WFW A;  2AMC B;  3JV3 A;  2EYX A;  2KXD A;  3QZ5 B;  3PCO A;  3UWN A;  4HCC A;  1WHJ A;  1VQ6 Q;  2CUB A;  3V7C A;  1CKB A;  1TOV A;  2PQW A;  3A8H B;  2KQW A;  2DQ0 A;  1YJW T;  3PCO B;  2PVO B;  4J7I A;  5LJ5 d;  4YRN A;  4ZIB A;  1VQ5 A;  5C53 B;  2IPO B;  3RER A;  8ATC B;  4JRK A;  3H0I A;  4H02 A;  1EX4 A;  3HY0 A;  3M59 A;  3CC4 T;  5CIU A;  2RHY A;  1OZ3 A;  2GQI A;  2LMJ A;  2QDL A;  1VQK Q;  2CZ7 B;  3MEY A;  4EIK A;  1SEM A;  3NGP A;  5IXB A;  1VQP Q;  2O88 A;  2GFU A;  3OYD A;  4BY6 C;  1YFT A;  4RTZ A;  1AWW A;  2OJ2 A;  3A7R A;  2CP7 A;  5FU7 B;  1MV3 A;  4OGE A;  6AT1 B;  2LQK A;  2H3E B;  4C92 D;  4PFZ A;  4FM4 B;  4LDV A;  3S3N A;  2D8H A;  3CCR T;  2LZ6 B;  3T9N A;  2EQM A;  2MI6 A;  1AWJ A;  2EYZ A;  2LJ3 A;  2QGG A;  1GCP A;  3A98 A;  4FYV B;  2QEX Q;  3A5Y A;  1QE0 A;  4E7J A;  4PKC C;  3CMQ A;  4KGZ B;  1N8R C;  1NPR A;  2GCX A;  2DQ3 A;  4J7F A;  2OI3 A;  2CGH A;  1KQ1 A;  1YHQ Q;  4WCI A;  3OW2 S;  3O8V A;  1PCX A;  5CKD A;  3TUP A;  2KMT A;  1G5H A;  4K86 A;  4D8K A;  2RHS B;  5GAO n;  2K3X A;  1VYU A;  4E7H A;  3J80 E;  1YIJ A;  1O9S A;  4ME7 A;  2ZIM A;  3EFR A;  1SHF A;  5C0M A;  4P75 C;  1ZHI A;  2YDL A;  1QVF S;  5DY9 A;  4WJ4 A;  1K8A C;  4PJO D;  3A8M B;  1SSH A;  5GAO q;  11AS A;  4C8Q D;  4D6W A;  3MQZ A;  2DU5 A;  4C5G A;  1N6A A;  3A5Z A;  4EDU A;  4YCV A;  1AWX A;  2JS0 A;  2AZS A;  2KDS A;  3P8D A;  1H4V B;  3INZ A;  2X4W A;  1YJN T;  3C0C A;  3JB9 J;  1OUL A;  1B70 A;  4PL6 A;  2E70 A;  1CSK A;  1ACM B;  1PKT A;  2XMF A;  3MEU A;  5K1X A;  2K3B A;  3CCE A;  2J05 A;  2M16 A;  1NJ5 A;  1NYQ A;  4P5N A;  2MIO A;  3FLG A;  2HEQ A;  1PC0 A;  4FW2 A;  3ULR B;  1OPK A;  2YT6 A;  4B9X A;  5CKB A;  2MAM A;  4A63 B;  4ZN1 A;  1WDX A;  1NZ9 A;  2DEU A;  4ZTF A;  4C92 B;  3UH0 A;  4YP0 A;  1QP2 A;  5GJW B;  4K87 A;  1VQ4 A;  3OYB A;  1H8K A;  3JB9 I;  4J9F A;  1QVF A;  4M78 G;  5KYY B;  5FU6 C;  1X2Q A;  2ZZF A;  1K4U S;  3RDV A;  4UP8 A;  4M75 D;  2VC8 A;  1OYX A;  1U3O A;  3M0U A;  2MOX A;  1WJS A;  4YRR A;  3CCM Q;  3CME Q;  1M9S A;  3OQ5 A;  5ECA A;  4M7A D;  1KOG A;  2CSI A;  2YXY A;  1GRI A;  3A7U A;  4KUI A;  2XID A;  3OS5 A;  3UA6 A;  4J83 A;  5GAN f;  2MYS A;  4LDY A;  1M1K C;  3RF1 A;  4H2S A;  3JB9 D;  3QSU A;  4CS3 A;  4ELZ C;  4YRQ A;  4RTW A;  1YJ9 Q;  1EQR A;  2HBP A;  1SG5 A;  1RLQ C;  5I11 A;  1NYF A;  3A32 A;  2GNC A;  5I21 A;  1ADJ A;  4HVV A;  2CP2 A;  1RL2 A;  4PJO B;  2HMA A;  4G84 A;  5IHK A;  2HL5 C;  2IG0 A;  4C8Q B;  1QCN A;  4E7Z A;  1LCK A;  2HSE B;  2HDA A;  2EPD A;  4J9I A;  2VGM A;  2X3X D;  3RNJ A;  5IHN A;  3QG1 A;  3I9Q A;  5KYX B;  5ELO A;  3L2Z A;  4XEO A;  2ZPE B;  3LH5 A;  5FRM A;  1QF6 A;  1IRX A;  2EJ9 A;  4KH0 B;  3BDU A;  1WXT A;  1Q81 C;  5HKC A;  1FYF A;  3FJP A;  5KCH A;  2YHT A;  2NWM A;  5GAM g;  1BIA A;  3CCV Q;  5A0D A;  3JCM J;  3FB9 A;  2KRM A;  4J6X A;  5FLX E;  1AZE A;  1UUE A;  3EG9 A;  1NEB A;  4EX5 A;  3P8Y A;  2DL7 A;  2JTE A;  1KFZ A;  2X3W D;  3E9H A;  3VUB A;  5J3B A;  4BE0 A;  4TVR A;  1ASY A;  2QA4 A;  4M75 B;  1X6G A;  3EG9 B;  3QJ6 A;  4KR3 A;  2LX9 A;  3ICA A;  2O4X A;  4CRI A;  2NLU A;  3G7Z A;  1HXD A;  3HFN A;  2ZT6 A;  1H4S A;  2E3I A;  2J6K A;  2VWF A;  1ZSZ A;  4M7A B;  1IHW A;  3G71 T;  2E3C A;  3MEA A;  1VQ7 T;  4OMN A;  3VU3 C;  5A2Q E;  3E9F A;  3EGD B;  3HTR A;  2DX1 A;  1VYV A;  2CP6 A;  4J6Y A;  4C0G A;  3VBB A;  2ART A;  1S1N A;  2C0I A;  3EFO A;  2HQX A;  1X6B A;  2VAS A;  1S72 T;  1E1O A;  3GLX A;  1Q82 U;  4XEM A;  2DRK A;  5DLO A;  1ATI A;  2L2P A;  2CP3 A;  1WHM A;  4A4F A;  3TVT A;  4C5E A;  3V7S A;  1ADY A;  3NEL A;  1KSW A;  4BWA A;  1FWZ A;  2HCK A;  2L8D A;  2V26 A;  1K9M C;  4HT9 A;  3REU A;  3LWI A;  3MF1 A;  2P4R A;  1SSF A;  1YIJ Q;  1ZBJ A;  2YLB A;  1I5L A;  4KQE A;  3KXT A;  5HY6 A;  2HQH A;  2ZT8 A;  1B07 A;  2P0L A;  1WLP B;  2XDP A;  5IN1 A;  3CD6 A;  2A3L A;  4EMG A;  1EFW A;  4GY5 A;  5D7U A;  4Q5W A;  1Z7N A;  3UAT A;  1M90 C;  3VYG A;  1RUW A;  1EIF A;  4XAX B;  4ESR A;  3OYM A;  2CZ0 B;  2IY5 A;  3FEO A;  3LGF A;  5CKH A;  4AFZ C;  2AKW A;  4DEX A;  2P0K A;  4RCC A;  1NYR A;  5J39 A;  3MP1 A;  1NJ8 A;  2ODR D;  4H2X B;  1SER A;  2VYT A;  2CSQ A;  1YFS A;  5GJV B;  4ORZ A;  2JVV A;  1Y07 A;  4ZGD B;  1KD1 U;  2AKW B;  3NTK A;  1UB4 A;  2LCS A;  5GAN 3;  4RTX A;  3ASK A;  3HXW A;  3NEM A;  3DB4 A;  2AK5 A;  1X27 A;  3V8L A;  1VQ4 Q;  3VQY A;  3JCM e;  4A53 A;  2FO0 A;  4PFO A;  2E5Q A;  2EQI A;  1VYT A;  1UEB A;  2J7I A;  3QDF A;  3GBQ A;  3OMG A;  2RHZ A;  4MML A;  1MV0 B;  2SEM A;  3OYF A;  2RHU A;  3MHX A;  3HXU A;  3VV0 A;  3OBW A;  3CCS T;  2PMF A;  2LX7 A;  4H2W A;  3CPW S;  4E7K A;  4P71 C;  2QHT A;  3CCQ A;  2QQ9 A;  3G6E Q;  1B76 A;  2J06 A;  3JRZ A;  2FVU A;  2LQW A;  3QTC A;  2E5A A;  1D0Y A;  1G8X A;  2ZAE A;  4XU0 A;  1C1A A;  2LP5 A;  3G71 Q;  1N8R R;  2RO0 A;  4KUL A;  2C8M A;  2X9H A;  4WI1 A;  4B6M A;  2QTX A;  4P73 A;  2QHU A;  5C6S A;  2DO3 A;  3IKM B;  2YRC A;  4C92 E;  1Q95 G;  2DEQ A;  2MF2 A;  2M02 A;  3RL6 A;  1U1S A;  2ABL A;  3EG2 A;  4XTW A;  1G5I A;  1VQ6 A;  4PNO A;  2D9T A;  3ZEH A;  2DET A;  3TSZ A;  4P75 A;  2R57 A;  1OV3 A;  4RTT A;  2CKK A;  4R56 A;  5CQX A;  2RI2 A;  4K11 A;  1JB0 E;  4JS5 A;  2F5T X;  2KYB A;  3CPW A;  4QW2 A;  1BCO A;  3CCL T;  5GAN 2;  3E9G A;  1WHL A;  4P3P A;  4LVL A;  1K8A R;  4L59 A;  4P74 C;  2DBM A;  3HP9 A;  2G4C A;  2RHQ A;  1U5S A;  4HWP A;  3QXE B;  2YUP A;  3J7A F;  3PMI A;  2JJ9 A;  4C0Z A;  1VQP A;  4M7D G;  4AFQ C;  4BI3 A;  4FIB A;  4OML A;  1M3C A;  4J9H A;  4YRK A;  2JOY A;  2RHQ B;  2ZT7 A;  2P0Q A;  1SHG A;  2XGT A;  2PVD B;  4IKF A;  1WJQ A;  1XNI A;  3CBM A;  2H3J A;  4PJO E;  1D3B B;  4M78 D;  5GMK j;  5CVI A;  4C8Q E;  4DBF A;  4XU2 A;  5E3I A;  3DSQ A;  3LSQ A;  1VQM T;  3F70 A;  4M7D F;  4A4H A;  2PNI A;  1G3W A;  1R0C B;  1F1B B;  3SHW A;  3CCJ A;  4OB1 B;  3QO8 A;  1EFN A;  2QEX A;  2QQS A;  1OI1 A;  1VQN Q;  1TSF A;  2DTH A;  4ZTZ B;  4HT4 A;  2EL9 A;  2KAF A;  5FU6 B;  4RCB A;  4J9B A;  2J6O A;  1PD0 A;  2PTK A;  1ABO A;  1YHQ A;  3OYI A;  1B7T A;  2J3L A;  4P3N A;  1KQS P;  4MDW A;  3LWH A;  3L4G A;  4YRC A;  2PUO B;  1JEG A;  1HYO A;  1KK7 A;  3H0F A;  3VUZ A;  4IUU A;  5CR2 A;  1M1K R;  1VQ8 T;  4CS2 A;  2K5L A;  2YWW A;  2HSP A;  2CRE A;  4OB2 B;  2EKH A;  3CPF A;  2C0T A;  3O5Z A;  1X75 C;  5FRO A;  2CJB A;  3CBO A;  3H8Z A;  2IIM A;  4M75 E;  4M7D C;  4IUR A;  1ASZ A;  2V8K A;  1M5Q 1;  2CH4 W;  3CD6 Q;  4YTL A;  3HHT B;  4PG3 A;  2KK4 A;  4QVZ A;  4E7S A;  5GAN d;  3FC3 A;  4FCY A;  2DKG A;  4E47 A;  4M7A E;  3PZC A;  4CH6 A;  3H0H A;  4GLM A;  2M0Y A;  1ZA2 B;  3H41 A;  4QKU A;  2ARU A;  2VV5 A;  4M78 A;  1VQO T;  2ZR3 A;  1RI9 A;  1U8R A;  2DL5 A;  2MPX C;  4UC4 A;  4CC2 A;  1Q81 R;  3HFZ B;  3OYA A;  3GNF B;  1PNJ A;  1B34 A;  2EGC A;  2RH2 A;  4ZGJ B;  1TG0 A;  4M78 B;  1FMV A;  2A8E A;  3CCL Q;  4Y91 A;  4JRP A;  2EYY A;  3SWN C;  2QI2 A;  3UFG A;  3HPW A;  2NYS A;  1SES A;  1GBR A;  5CKE A;  1UJ0 A;  3HSB A;  2EQJ A;  4F7U E;  2JS2 A;  2KI7 A;  5GAN 7;  2BKD N;  3QO3 A;  2CH4 A;  1X01 A;  2Q7H A;  4H2U A;  5D6Y A;  2K9G A;  2EWN A;  4F7U F;  3PTA A;  3CME A;  2RF0 A;  4C0D B;  5LJ3 e;  5CKF A;  2V8J A;  1G51 A;  2DYI A;  4PJL A;  2WSF E;  1AZG B;  2LTO A;  1YBY A;  2B8A A;  2KNB B;  4FT2 A;  2QK0 A;  4PJJ A;  2GTJ A;  1BI0 A;  3CCR A;  2PUK B;  1I07 A;  5KH6 A;  3HY1 A;  2ESW A;  3DLL A;  4CC4 B;  4BI8 B;  2RNA A;  2NUT A;  4FYY B;  4AT1 B;  1UTI A;  2QXF A;  2RHI A;  4HVW A;  1NJI U;  3HXZ A;  1V1C A;  2VUB A;  1K9M R;  3WVE B;  1Z9Q A;  3EHR A;  2COW A;  2NUP B;  1RIQ A;  2DU7 A;  4Z8A A;  4DOV A;  4KBM B;  2JM9 A;  2E3H A;  2DD5 A;  3M58 A;  1FX7 A;  1LJO A;  1JJC A;  2RB6 A;  4DQ2 A;  1MMG A;  2EGE A;  2EBP A;  4OMM A;  1UGQ B;  2XHC A;  2QHS A;  1BKB A;  3CCV A;  4BDY A;  3X24 B;  1M90 R;  4CH4 A;  3GP8 A;  1VOM A;  5D6W A;  2PU9 B;  3UPU A;  4BW9 A;  5LJ5 g;  2FRY A;  1Q82 C;  1JBM A;  2DZC A;  4J9G A;  3I56 Q;  2Q5I A;  1D0Z A;  1YJN A;  2XDB A;  4EMK A;  4A4E A;  1D1C A;  5KYW A;  1RAH B;  2IVW A;  4EO4 A;  4VUB A;  4AG1 C;  4M77 D;  4FSX A;  2ZZE A;  5GMK e;  1AWO A;  4OP0 A;  3PE0 A;  3URG A;  2LT1 A;  4EMK B;  1QWE A;  4HVU A;  2RQW A;  3CCJ Q;  3RBB B;  2F69 A;  2I4O A;  3I7F A;  2RJF A;  4X9C A;  2DPP B;  2DYB A;  1B3Q A;  1G3T A;  3G4S T;  1UG1 A;  1WPY A;  4P71 A;  3KBG A;  2DZ9 A;  3JAM E;  2LNV A;  3A8L B;  1WZO A;  1BBU A;  4ZGE B;  2LVM A;  3SD4 A;  3M9Q A;  1WLE A;  3OYY A;  1KG1 A;  2C06 A;  4JJC A;  3L2R A;  3M4Q A;  1JJ2 P;  3JCM d;  2EFI A;  3OMC A;  4OB3 B;  4LDW A;  5LJ5 j;  3N5B B;  1SRL A;  2KY9 A;  2LQN A;  5LJ3 h;  2RI3 A;  1TXQ A;  3OSV A;  2F2V A;  3FRN A;  1KD1 C;  1LPL A;  1NM7 A;  3M53 A;  2RHX A;  2XD0 A;  4ZTU B;  1RLP C;  5GAO m;  3EG0 A;  3R6N A;  2ZPH B;  3JCM c;  1YGB A;  2KSS A;  4KGV B;  3TEE A;  3AHU A;  5CQY A;  4BAC A;  4P74 A;  1YIT T;  2D6F A;  1RAB B;  4C5I A;  1M27 C;  1YI2 T;  4M77 A;  3LX7 A;  3A5Z B;  3OW2 A;  1K76 A;  1ZSG A;  2NS6 A;  4YYE A;  3P8H A;  3L2Q A;  1DJ7 B;  2RPN A;  2EGA A;  1B70 B;  4DBH A;  4FW1 A;  1SF9 A;  3UT1 A;  1YJW Q;  4M77 B;  4BB7 A;  1X43 A;  4WF2 A;  1K0X A;  4HWR A;  4UP7 A;  4N0A C;  4QVC A;  4CS4 A;  1XTD A;  2AKL A;  1OU8 A;  3CC4 Q;  4XU1 A;  4XTZ A;  4PLI A;  2JMC A;  3MPU B;  3VQX A;  1RAG B;  4O2D A;  4CH3 A;  3S3M A;  2L3R A;  1UEC A;  5GAN e;  3UDC A;  3E1S A;  5CO7 A;  5I2M A;  2DD4 A;  3G6E A;  3P8T A;  1H4Q A;  1E22 A;  1EOV A;  3V8J A;  3Q1J A;  3JB9 H;  1VQL T;  1M2O A;  1MMD A;  3G71 A;  2M9U A;  2ARS A;  3ZL7 C;  4YCW A;  3CCR Q;  4HT8 A;  1VQ7 A;  1XJW B;  2LJ1 A;  2WSE E;  1UGV A;  3IG2 A;  4M78 E;  2HQE A;  2RMO A;  1HTT A;  1RAF B;  4DEY A;  3BJU A;  5C52 B;  3PT9 A;  3RKX A;  3QO7 A;  4M7D A;  2QAZ A;  1G5V A;  2MK5 A;  4JDS A;  3TEG A;  1RAA B;  3QDR B;  4QVD A;  2DIQ A;  5GAO r;  2E10 A;  1GGM A;  3LC0 A;  2M0O A;  2EVR A;  3HXV A;  4DOW A;  2HKQ B;  1AVZ C;  4JZ3 A;  5FWB A;  1NE8 A;  2YSQ A;  3CC2 T;  1HJD A;  4RKU E;  2FYK A;  4ANJ A;  4AFU C;  1N5Z A;  4P72 C;  4OLF A;  2BZY A;  2Z0W A;  3X28 B;  1J5W A;  4PJM A;  4HWO A;  1YJN Q;  2K57 A;  1USY C;  2EYW A;  5KCO A;  3M4G A;  3NTH A;  2LCC A;  5CK9 A;  1QVG P;  3ME9 A;  2ED0 A;  3QYH B;  2JUF A;  2XIC A;  2BUD A;  2GFA A;  2MMP A;  4FSS A;  2WAC A;  4LNS A;  1KHI A;  2O4X B;  1VQN A;  3HRK A;  2VVK A;  4KRT A;  4TTV A;  2DF6 A;  2OTL T;  1ZSZ B;  1IHV A;  3NTI A;  1UJY A;  1QQJ A;  4LDX A;  2JN0 A;  2L5Q A;  1NYG A;  2LJ0 A;  5GAM j;  1KQS S;  4N4I A;  3HTZ A;  3HRU A;  3PFS A;  1VQ9 T;  1BI1 A;  1UHF A;  3RAC A;  4LD9 K;  2CJ9 A;  1EVK A;  1K73 R;  2KGT A;  3EFO B;  1HSQ A;  3CCS A;  4HKE A;  2DER A;  2E6Z A;  2DM1 A;  5GAN h;  4J15 A;  2D1X A;  1WGS A;  5AYF A;  2DVJ A;  2K4Y A;  4TVY A;  4YRO A;  4N4H A;  1JQQ A;  3C12 A;  2ED1 A;  3G1J A;  2ZPG B;  4RUG A;  5IXF A;  1FMK A;  3HXX A;  4YDQ A;  3FJ5 A;  1H3Z A;  4G85 A;  2EJG A;  4M4Z A;  1ABQ A;  1UDL A;  4X9D A;  5LJ5 f;  3L2W A;  3QWY A;  5LJ3 d;  1ZUU A;  3DLM A;  1AHJ B;  2FEI A;  1ZBX A;  4XU3 A;  4XK8 E;  4C5H A;  4Q6G A;  2G3R A;  2ZXF A;  2VXF A;  1W1F A;  2AZV A;  4Y92 A;  2QQR A;  3C94 A;  1YNZ A;  4GBQ A;  3M54 A;  1N9S A;  4BI4 A;  2E1H A;  4A4G A;  3CMA T;  3PGG A;  3M0S A;  2IY5 B;  2Y4Y A;  3OS0 A;  3SDZ A;  1E1T A;  3CCL A;  3EAE A;  5J26 A;  2QA4 T;  5EG2 A;  2ZNJ A;  1KMN A;  2XKO C;  1Q82 R;  2CZ1 B;  2M1H A;  3HL8 A;  2R5M A;  1BIB A;  2OAW A;  4DA4 A;  2O9V A;  4BY6 B;  3NET A;  2P4T A;  3VS7 A;  1N27 A;  1NJI C;  4EMH A;  1Q86 U;  1C0M A;  1UHC A;  1OEB A;  1VQZ A;  2X35 A;  1WA7 A;  2L3S A;  2RQT A;  1JXO A;  1E7O A;  1WXB A;  1XQH A;  2X51 A;  1YP5 A;  3MCA B;  1T3S A;  5GAN 8;  3EH2 A;  2V1Q A;  3I55 T;  4TVA A;  3A74 A;  3L2V A;  2ENM A;  4MZP A;  4C92 G;  1H4T A;  2Q5H A;  1VQM A;  2BIV A;  1OQK A;  1YN8 A;  1W2B P;  4K88 A;  1BB9 A;  2KRO A;  1VQ7 Q;  1JO8 A;  2QHV A;  1OOT A;  3U23 A;  1ZQ1 A;  4BD3 A;  2HL3 A;  4TVA B;  4LNP A;  2XTI A;  1M3A A;  2DXT A;  3CXC P;  1QCF A;  2DL4 A;  2QYZ A;  4M77 E;  3P8V A;  3RUX A;  1T0H A;  2HNI A;  4D8D A;  1T3L A;  1S72 Q;  2FB7 A;  1AD5 A;  2V8I A;  1X54 A;  4C92 F;  1WNL A;  1I4K 1;  3E2U A;  3E9I A;  2OX7 A;  1QLY A;  3I5S A;  4JLI A;  1G83 A;  1W6X A;  4KR2 A;  3M56 A;  3EG1 A;  1NG2 A;  1ZUK A;  2E65 A;  1KD1 R;  1VQ8 A;  3IKL A;  1D1B A;  2ZZG A;  1NBE B;  5D6X A;  3L2U A;  1E6H A;  2DVE A;  1FYN A;  3QO5 A;  4OMQ A;  1Y7X A;  4HWS A;  2P84 A;  4TWA A;  2K2M A;  1OZ2 A;  4RTU A;  5HK0 A;  1IZ6 A;  3MP6 A;  4AG2 C;  1BU1 A;  2EW3 A;  4RDX A;  3CC7 T;  4DPG A;  5L8R E;  4PJO G;  8AT1 B;  3OYH A;  4C8Q G;  3MO8 A;  2AKK A;  2LDM A;  3I56 A;  1PSE A;  1YFN A;  1R77 A;  2G6F X;  5HCK A;  5GAN 6;  4C92 C;  2MWO A;  4PFP A;  2KEA A;  1P92 A;  1FMW A;  2DE0 X;  4N0A A;  3R07 A;  5A0L A;  2FPD A;  4PJO F;  3NPF A;  3G1Z A;  4C0F A;  2F2W A;  1GFD A;  4C8Q F;  2RI5 A;  1WHK A;  3VS2 A;  4JZ4 A;  3WQZ A;  4BE2 A;  3PVQ A;  3M4P A;  2DTO A;  3TSW A;  4H2Y A;  5GMK m;  3KUF A;  2LCL A;  4LD6 A;  2KYM A;  2RN8 A;  4JJB A;  3SB2 A;  1BI3 A;  2DDZ A;  3JCM h;  4RTV A;  1EIY A;  3LLR A;  4YCU A;  2RD1 A;  1WJR A;  4FT4 A;  1KHC A;  3E19 A;  1UGS B;  4J8O A;  1JJ2 S;  5GAM e;  2F2X A;  1LNX A;  3LH0 A;  4M75 G;  3CCS Q;  3X26 B;  1V29 B;  4MMK A;  1KIK A;  2BZ8 A;  3SFM A;  5GAM f;  2DTI A;  4M7A G;  4JUV A;  4UPA A;  1RAE B;  4XTV A;  1X69 A;  1ZLM A;  3I55 Q;  4PJO C;  3L4G B;  5FW9 A;  2YUQ A;  4NCX A;  4C8Q C;  3C4S A;  1PSF A;  1OX9 A;  3OB9 A;  4M75 F;  4NOY A;  5KE3 A;  1UE9 A;  2XDD A;  2RJD A;  1ZX6 A;  5A0G A;  4M7A F;  1JRI A;  3OSS C;  3MET A;  4CC7 A;  3VS4 A;  2I4N A;  3QPH A;  3TRE A;  4RQE A;  1I0C A;  5I22 A;  3AT1 B;  3JB9 F;  5GAN g;  1VQK T;  4YRT A;  1KC8 U;  1SET A;  2DBK A;  1VQP T;  2RJE A;  3JCM P;  2ZCE A;  2V1R A;  1YJW A;  4F7U G;  4P72 A;  5IAY A;  1PD1 A;  2EJF A;  2DIL A;  3MKD A;  4QQG A;  1Q7Y U;  1B34 B;  4LN2 A;  2BTT A;  1USY A;  4X1V A;  3M0P A;  1IGQ A;  4M75 C;  2A37 A;  3CC4 A;  3REA B;  3CC7 Q;  1LVK A;  5IHI A;  1WHG A;  4M7A C;  4HCZ A;  3NFC A;  4FU6 A;  5AT1 B;  3QJY A;  1LOJ A;  2AIR B;  3QNE A;  2DNU A;  3CCU T;  4MDX A;  4HA8 A;  1H64 1;  4LVM A;  4A4K A;  1Z7M A;  1NLO C;  4HCB A;  1PM3 A;  2RK2 A;  2ROL A;  1VQM Q;  1KJW A;  3TQ7 P;  4ATO A;  3GOX A;  1N9R A;  1IXD A;  1ZA1 B;  4FYX B;  4JS4 A;  2F1L A;  3EGX A;  2GF7 A;  3EG3 A;  3G4S A;  3NEN A;  3VRY A;  1Y57 A;  4OF1 A;  2DL8 A;  1YCY A;  1X56 A;  5KYU A;  2COY A;  2OAU A;  4L5G A;  2OTJ T;  2AMC A;  2NUT B;  4YRE A;  5HK3 A;  2KT8 A;  4J6W A;  2YRD A;  1JU5 C;  2L3Q A;  1VQ8 Q;  3S3O A;  3OYN A;  4XTU A;  4V2S A;  1M2V A;  2DIG A;  4IUQ A;  1NPP A;  3VS6 A;  1BBZ A;  3VKI A;  3QBY A;  2ZZD A;  1JJC B;  4OB0 B;  4F14 A;  4XQ3 A;  4E2F B;  3VS5 A;  4L87 A;  1PG5 B;  2FHD A;  1M2V B;  2W10 A;  4RG2 A;  2GBQ A;  2JW4 A;  1WYD A;  2K2V A;  3WXM B;  2FZK B;  3RIR A;  1QVG S;  2YLC A;  1NJ2 A;  1RI0 A;  1VQO Q;  3D7S B;  2ZR2 A;  1YIT A;  3A31 A;  2QAS A;  2JMA A;  1YI2 A;  4LUD A;  3DKM A;  1X55 A;  2HD0 A;  2JT4 A;  3L1A A;  2X4Y A;  1ARK A;  1MUZ A;  3OA6 A;  1G3S A;  2A28 A;  4FL6 A;  3CCM T;  3CME T;  2HZY A;  3RES A;  2A0F B;  5KYW B;  5DM7 R;  3PMT A;  1VUB A;  2VKN A;  1WX6 A;  1NJI R;  3QHS A;  2E64 A;  2D0Q B;  3MEV A;  1YJ9 T;  4Y28 E;  4YRP A;  3GF5 A;  2I4L A;  2GGR A;  3FDR A;  4L6V 5;  1IO6 A;  2YUO A;  1QVG A;  2HBW A;  1WYX A;  2RHS A;  3V7R A;  3CCU Q;  3L42 A;  4JLG A;  3JCM V;  4X5O A;  1YWO A;  2CYZ B;  2F5K A;  2ECZ A;  1KQ2 A;  2ZTG A;  1VQL A;  4P3O A;  2KBT A;  1G2B A;  4RG8 A;  4P73 C;  3JCM g;  2CUD A;  1VIF A;  9ATC B;  1VQ5 T;  1I5O B;  2CP5 A;  2FPE A;  2CDT A;  4AFS C;  3CCV T;  2ZCF B;  4PHC A;  3V8K A;  2C0O A;  2X4X A;  4KH1 B;  3OY9 A;  1Q86 C;  2L89 A;  2ODR C;  4CC3 A;  2K7A A;  2BE9 B;  4Q15 A;  1K0S A;  1B7Y A;  4M7D D;  2BE7 D;  3IQL A;  2OTJ Q;  3REX A;  4Z02 A;  1A0N B;  1WHH A;  1I8F A;  4IIM A;  3P8B B;  3CEY A;  2E12 A;  1B7Y B;  5F5W A;  4E7I A;  3VQV A;  4C92 A;  3CQT A;  1WQW A;  3CC2 A;  2DXB A;  1M30 A;  3GPL A;  4II1 A;  1T0J A;  4PJN A;  5KYY A;  4PLL A;  4DBR A;  2D8J A;  1M4Z A;  1OU9 A;  2QG9 B;  3X25 B;  2K6D A;  1PRM C;  2K79 A;  1TS9 A;  3S6W A;  4QQD A;  1W2B S;  3MP8 A;  1M1G A;  1WI7 A;  2DMO A;  2VB6 A;  3RMQ A;  3OS2 A;  5GMK h;  4RMF A;  1C0A A;  2KRN A;  1YCS B;  4LVK A;  2EIF A;  2I4M A;  4Z88 A;  3CXC S;  2DL3 A;  2AT1 B;  4J5Y A;  3OYK A;  1EVL A;  1YIJ T;  5CCA A;  3G4S Q;  2OTL A;  4YRM A;  2R58 A;  4KT0 E;  3M5A A;  1FXX A;  4M78 F;  1VA7 A;  1S72 A;  1HK9 A;  4HWT A;  2X4J A;  2SRC A;  2O31 A;  2JM8 A;  4OMP A;  4PJO A;  1R8O B;  1QMC A;  3VRZ A;  1VQ9 A;  4C8Q A;  2C7I A;  3EH1 A;  3M0R A;  3LGL A;  3RMS A;  1GCQ C;  3RKY A;  5GAN 4;  1MMN A;  3HFV A;  3PVL A;  2ATC B;  5KYX A;  5KYN A;  4M7D B;  2ZT5 A;  1WQ7 A;  1QW1 A;  2NUZ A;  3BE3 A;  2EQU A;  1D09 B;  4MZT A;  5GAM d;  3ZBD A;  3CCE T;  1W2B A;  1TUG B;  3M55 A;  1M8V A;  5GAO l;  4E7L A;  1PKS A;  1NLP C;  1NJ6 A;  3ERR A;  2YRV A;  3CXC A;  2ZPI B;  1K73 U;  4R0K A;  2DK3 A;  5M9O A;  4NL3 A;  2E41 A;  1MGQ A;  4M78 C;  1VQ5 Q;  1MHN A;  4MZM A;  2QDY B;  4NL2 A;  1VQ4 T;  2FZG B;  2DAQ A;  1YIT Q;  2A08 A;  3SWN A;  2A7Y A;  3NHN A;  1EZZ B;  4JRI A;  4F16 A;  1YI2 Q;  2FPF A;  5GMK i;  4M75 A;  4FYW B;  3IAL A;  3EHQ A;  2RQR A;  3VQW A;  3CMA A;  4LE9 A;  2O01 E;  2RK1 A;  2WSC E;  1Y0M A;  1PYS A;  4QT7 A;  3SWN B;  4M7A A;  3HXY A;  1AEY A;  1YWP A;  3MEW A;  3VS3 A;  3G6E T;  3HRI A; 
#chains in the Genus database with same CATH homology
 4NS5 A;  4C0D C;  1Y71 A;  1PYS B;  3VJP A;  1BI2 A;  2E6N A;  4HVC A;  5LL6 S;  4H2V A;  4YRG A;  1WU7 A;  2HAX A;  1KC8 C;  5K1P A;  2PME A;  3LW5 E;  5LJ5 e;  2ZPB B;  3OBY A;  4YRI A;  3I55 A;  5KNN A;  4JJN K;  2FL7 A;  3HFO A;  1Q7Y C;  3J81 E;  1QVP A;  1BYM A;  4F7U A;  2JNG A;  2Y90 A;  1X6O A;  4XTX A;  3R6O A;  5GAO p;  2MWP A;  3JCM W;  3LSS A;  4A54 A;  4LVJ A;  4F7U B;  3BFM A;  2Q7G A;  1KQS A;  3QYG B;  3FIF A;  5LJ3 g;  3JCM X;  3HRS A;  1N8R U;  2EQK A;  3OYJ A;  4IUT A;  1BBW A;  3PIP A;  5ELN A;  2RA2 A;  3OS1 A;  4H2X A;  5KE2 A;  1IRE B;  1SRY A;  3M57 A;  5FU7 C;  1VIE A;  1O75 A;  2QQB A;  3CC7 A;  5IT9 E;  2XG8 D;  4LVI A;  4RMO A;  1VQN T;  4YRF A;  4YPF A;  3GNG A;  3UGT A;  4EMK C;  2K5F A;  1K8A U;  4IUP A;  1UGR B;  1NNH A;  3JCM f;  2I2L A;  4M77 G;  3VYH B;  4OVA A;  4CI0 C;  3KFU A;  2J3M A;  5LJ3 j;  2CZ6 B;  4ELY C;  3TU4 K;  3HRT A;  2VXE A;  5GAN 5;  4N4G A;  3BW1 A;  1X2G A;  3CD6 T;  1XOV A;  3BY7 A;  4O6J A;  2CJA A;  4M77 F;  4H2T A;  4EPC A;  4KUD K;  2XK0 A;  3PNW C;  3GIB A;  2ZGW A;  1QP3 A;  1Y96 A;  4BE1 A;  2ZIO A;  3A8G B;  4XTY A;  5LJ5 h;  3W3S A;  2QQA A;  4E51 A;  4R55 A;  3BDL A;  1Y96 B;  4OGC A;  1M1K U;  3RKW A;  3OD1 A;  2EAY A;  2Q7E A;  4OMF B;  2K5I A;  2EYQ A;  1VQO A;  3ER0 A;  4M77 C;  1IL2 A;  2ZIN A;  3OYG A;  3QKJ A;  1VQK A;  3RGL A;  4TVW A;  1D3B A;  2P5I A;  3TCJ A;  3QUI A;  4AH6 A;  2XU8 A;  5CAI A;  1X2H A;  3A8O B;  2JZ2 A;  2GQV A;  2DXC A;  4ZN3 A;  3WVD B;  3CCQ T;  1N9W A;  4M7D E;  2ZPF B;  4ZTJ A;  5FRN A;  1Q81 U;  1YFR A;  4CH5 A;  2LQ8 A;  2VGN A;  2KVQ G;  4JRQ A;  3HKS A;  4TQD A;  3H6Z A;  1G3Y A;  2Y4X A;  1EIY B;  3MF2 A;  1UGP B;  4BUG A;  3LYI A;  5C51 B;  3CCU A;  3UGQ A;  1VQ6 T;  3JSC A;  3JB9 G;  2ALY A;  2JTM A;  5I2S A;  2XI9 A;  2LT4 A;  1B8A A;  2CIM A;  1U1T A;  2K3Y A;  4X34 A;  2LRQ A;  2ALY B;  3A7A A;  2JTF A;  2ZNI A;  3OYL A;  4YRJ A;  1JJ2 A;  2OTJ A;  4RQF A;  3HFZ A;  3C95 A;  3I56 T;  3CBP A;  4TQF A;  3ZFJ A;  1L0W A;  4UP9 A;  5DLQ E;  4IUV A;  3EFS A;  1LYL A;  1K9M U;  3M4Y A;  3PIO A;  2CS7 A;  3DB3 A;  4WJ3 M;  1M1F A;  2DXU A;  1W4S A;  1NJ1 A;  4YRS A;  3CCJ T;  3QZ9 B;  2QEX T;  4BDZ A;  2RJC A;  4YRL A;  1E24 A;  2PVG B;  1M90 U;  1W66 A;  1KMM A;  1YHQ T;  4O5V A;  3JCM Q;  4B9W A;  2EKO A;  2LC4 A;  1HC7 A;  2AHJ B;  5GAN j;  5GMK l;  2DJZ A;  3CCM A;  1I81 A;  3JCM b;  3TEH A;  4LDU A;  1K73 C;  2RM4 A;  5LJ3 f;  5HGQ A;  3OYC A;  1YJ9 A;  1YB3 A;  2P0P A;  5GAM h;  3QII A;  3TEH B;  3X20 B;  1TH7 A;  2R5A A;  4GLK A;  3OYE A;  12AS A;  1GXI E;  4QQ6 A;  2AMC B;  3QZ5 B;  3PCO A;  3UWN A;  4HCC A;  3V7C A;  2PQW A;  3A8H B;  2KQW A;  2DQ0 A;  1YJW T;  3PCO B;  2PVO B;  4J7I A;  5LJ5 d;  4YRN A;  4ZIB A;  1VQ5 A;  5C53 B;  3RER A;  4JRK A;  4H02 A;  3HY0 A;  3M59 A;  3CC4 T;  5CIU A;  2RHY A;  1OZ3 A;  2CZ7 B;  3MEY A;  2GFU A;  3OYD A;  4BY6 C;  1YFT A;  3A7R A;  5FU7 B;  4OGE A;  2LQK A;  4C92 D;  4FM4 B;  4LDV A;  3S3N A;  3CCR T;  3T9N A;  2EQM A;  2MI6 A;  3A5Y A;  1QE0 A;  4E7J A;  4PKC C;  3CMQ A;  1N8R C;  1NPR A;  2GCX A;  2DQ3 A;  4J7F A;  2CGH A;  1KQ1 A;  3OW2 S;  3O8V A;  5CKD A;  3TUP A;  2KMT A;  1G5H A;  4K86 A;  2RHS B;  5GAO n;  2K3X A;  4E7H A;  3J80 E;  1YIJ A;  1O9S A;  4ME7 A;  2ZIM A;  3EFR A;  5C0M A;  4P75 C;  1ZHI A;  1QVF S;  5DY9 A;  4WJ4 A;  1K8A C;  4PJO D;  3A8M B;  5GAO q;  11AS A;  4C8Q D;  4D6W A;  3MQZ A;  2DU5 A;  4C5G A;  1N6A A;  3A5Z A;  4EDU A;  4YCV A;  3P8D A;  1H4V B;  2KDS A;  3INZ A;  2X4W A;  1YJN T;  3JB9 J;  1B70 A;  4PL6 A;  2E70 A;  3MEU A;  5K1X A;  3CCE A;  2M16 A;  1NJ5 A;  1NYQ A;  4P5N A;  3FLG A;  4B9X A;  5CKB A;  2MAM A;  4ZN1 A;  1NZ9 A;  4ZTF A;  4C92 B;  3UH0 A;  4YP0 A;  1QP2 A;  4K87 A;  1VQ4 A;  3OYB A;  3JB9 I;  1QVF A;  4M78 G;  5FU6 C;  2ZZF A;  4UP8 A;  4M75 D;  2VC8 A;  1OYX A;  1WJS A;  4YRR A;  1M9S A;  3OQ5 A;  4M7A D;  1KOG A;  3A7U A;  4KUI A;  2XID A;  3OS5 A;  4J83 A;  5GAN f;  4LDY A;  1M1K C;  3RF1 A;  4H2S A;  3JB9 D;  3QSU A;  4CS3 A;  4ELZ C;  4YRQ A;  1EQR A;  2HBP A;  3A32 A;  5I21 A;  1ADJ A;  1RL2 A;  4PJO B;  4G84 A;  2IG0 A;  4C8Q B;  2VGM A;  3QG1 A;  5ELO A;  3L2Z A;  4XEO A;  2ZPE B;  5FRM A;  1QF6 A;  2EJ9 A;  3BDU A;  1Q81 C;  5HKC A;  1FYF A;  3FJP A;  5KCH A;  2YHT A;  5GAM g;  1BIA A;  5A0D A;  3JCM J;  3FB9 A;  4J6X A;  5FLX E;  4EX5 A;  3P8Y A;  3E9H A;  3VUB A;  5J3B A;  4BE0 A;  4TVR A;  1ASY A;  2QA4 A;  4M75 B;  3QJ6 A;  4KR3 A;  2LX9 A;  3ICA A;  2O4X A;  4CRI A;  2NLU A;  3G7Z A;  1HXD A;  3HFN A;  2ZT6 A;  1H4S A;  4M7A B;  3G71 T;  2E3C A;  3MEA A;  1VQ7 T;  3VU3 C;  5A2Q E;  3E9F A;  4J6Y A;  4C0G A;  3VBB A;  2ART A;  2HQX A;  1S72 T;  1E1O A;  3GLX A;  1Q82 U;  4XEM A;  1ATI A;  5DLO A;  4A4F A;  4C5E A;  3V7S A;  1ADY A;  3NEL A;  4BWA A;  1FWZ A;  2L8D A;  1K9M C;  4HT9 A;  3REU A;  3LWI A;  3MF1 A;  1SSF A;  2YLB A;  1I5L A;  4KQE A;  3KXT A;  5HY6 A;  2ZT8 A;  2P0L A;  3CD6 A;  2XDP A;  5IN1 A;  2A3L A;  4EMG A;  1EFW A;  4GY5 A;  4Q5W A;  1Z7N A;  1M90 C;  3VYG A;  1EIF A;  4XAX B;  3OYM A;  2CZ0 B;  2IY5 A;  3FEO A;  3LGF A;  5CKH A;  2AKW A;  2P0K A;  4RCC A;  1NYR A;  5J39 A;  3MP1 A;  1NJ8 A;  2ODR D;  4H2X B;  1SER A;  2VYT A;  1YFS A;  2JVV A;  1Y07 A;  4ZGD B;  1KD1 U;  2AKW B;  3NTK A;  1UB4 A;  5GAN 3;  3ASK A;  3HXW A;  3NEM A;  3DB4 A;  3V8L A;  3VQY A;  3JCM e;  4A53 A;  2E5Q A;  1UEB A;  3OMG A;  2RHZ A;  4MML A;  3OYF A;  2RHU A;  3MHX A;  3HXU A;  3VV0 A;  3OBW A;  3CCS T;  2PMF A;  4H2W A;  3CPW S;  4E7K A;  4P71 C;  2QHT A;  3CCQ A;  2QQ9 A;  1B76 A;  3JRZ A;  2FVU A;  3QTC A;  2E5A A;  4XU0 A;  2RO0 A;  4KUL A;  2C8M A;  4WI1 A;  2QTX A;  4P73 A;  2QHU A;  5C6S A;  2DO3 A;  3IKM B;  4C92 E;  2DEQ A;  2MF2 A;  3RL6 A;  1U1S A;  4XTW A;  1G5I A;  1VQ6 A;  4PNO A;  2D9T A;  3ZEH A;  4P75 A;  2R57 A;  2CKK A;  4R56 A;  5CQX A;  2RI2 A;  1JB0 E;  4JS5 A;  2F5T X;  3CPW A;  4QW2 A;  3CCL T;  5GAN 2;  3E9G A;  4P3P A;  4LVL A;  4L59 A;  4P74 C;  3HP9 A;  2G4C A;  2RHQ A;  4HWP A;  3QXE B;  3J7A F;  3PMI A;  4C0Z A;  1VQP A;  4M7D G;  4BI3 A;  4FIB A;  4YRK A;  2JOY A;  2RHQ B;  2ZT7 A;  2P0Q A;  2XGT A;  2PVD B;  4IKF A;  1XNI A;  1WJQ A;  3CBM A;  2H3J A;  4PJO E;  1D3B B;  4M78 D;  5GMK j;  5CVI A;  4C8Q E;  4XU2 A;  5E3I A;  3DSQ A;  3LSQ A;  1VQM T;  3F70 A;  4M7D F;  4A4H A;  1G3W A;  3CCJ A;  4OB1 B;  3QO8 A;  2QEX A;  2QQS A;  1OI1 A;  2DTH A;  4ZTZ B;  4HT4 A;  2EL9 A;  2KAF A;  5FU6 B;  4RCB A;  1YHQ A;  3OYI A;  2J3L A;  4P3N A;  4MDW A;  3LWH A;  3L4G A;  4YRC A;  2PUO B;  3VUZ A;  4IUU A;  5CR2 A;  1VQ8 T;  4CS2 A;  2K5L A;  4OB2 B;  3CPF A;  1X75 C;  5FRO A;  2CJB A;  3CBO A;  3H8Z A;  4M75 E;  4M7D C;  4IUR A;  1ASZ A;  2V8K A;  1M5Q 1;  4PG3 A;  4YTL A;  3HHT B;  2KK4 A;  4QVZ A;  5GAN d;  3FC3 A;  2DKG A;  4E47 A;  4M7A E;  3PZC A;  4CH6 A;  2ARU A;  2VV5 A;  4M78 A;  1VQO T;  2ZR3 A;  1U8R A;  4UC4 A;  3HFZ B;  3OYA A;  3GNF B;  1B34 A;  2RH2 A;  4ZGJ B;  4M78 B;  2A8E A;  4Y91 A;  4JRP A;  3SWN C;  2QI2 A;  3UFG A;  3HPW A;  1SES A;  5CKE A;  3HSB A;  2EQJ A;  4F7U E;  5GAN 7;  2BKD N;  3QO3 A;  1X01 A;  2Q7H A;  4H2U A;  5D6Y A;  2EWN A;  4F7U F;  3PTA A;  3CME A;  4C0D B;  5LJ3 e;  5CKF A;  2V8J A;  1G51 A;  2WSF E;  2LTO A;  1YBY A;  2B8A A;  4FT2 A;  1BI0 A;  3CCR A;  2PUK B;  5KH6 A;  3HY1 A;  3DLL A;  4BI8 B;  2QXF A;  2RHI A;  3HXZ A;  1NJI U;  2VUB A;  3WVE B;  1RIQ A;  2DU7 A;  4DOV A;  4KBM B;  2DD5 A;  3M58 A;  1FX7 A;  1LJO A;  1JJC A;  2RB6 A;  4DQ2 A;  1UGQ B;  2XHC A;  2QHS A;  1BKB A;  3CCV A;  4BDY A;  3X24 B;  4CH4 A;  3GP8 A;  5D6W A;  2PU9 B;  3UPU A;  4BW9 A;  5LJ5 g;  1Q82 C;  1JBM A;  2DZC A;  2Q5I A;  1YJN A;  2XDB A;  4EMK A;  4A4E A;  2IVW A;  4EO4 A;  4VUB A;  4M77 D;  4FSX A;  2ZZE A;  5GMK e;  4OP0 A;  3URG A;  2LT1 A;  4EMK B;  2F69 A;  2I4O A;  3I7F A;  2RJF A;  4X9C A;  2DPP B;  1G3T A;  3G4S T;  1WPY A;  4P71 A;  3KBG A;  2DZ9 A;  3JAM E;  2LNV A;  3A8L B;  1BBU A;  4ZGE B;  2LVM A;  3SD4 A;  3M9Q A;  1WLE A;  3OYY A;  1KG1 A;  2C06 A;  3L2R A;  3M4Q A;  3JCM d;  2EFI A;  3OMC A;  4OB3 B;  4LDW A;  5LJ5 j;  3N5B B;  2KY9 A;  5LJ3 h;  2RI3 A;  3OSV A;  3FRN A;  1KD1 C;  3M53 A;  2RHX A;  2XD0 A;  4ZTU B;  5GAO m;  2ZPH B;  3JCM c;  1YGB A;  2KSS A;  3TEE A;  3AHU A;  5CQY A;  4BAC A;  4P74 A;  1YIT T;  2D6F A;  4C5I A;  1YI2 T;  4M77 A;  3LX7 A;  3A5Z B;  3OW2 A;  2NS6 A;  4YYE A;  3P8H A;  3L2Q A;  1DJ7 B;  1B70 B;  3UT1 A;  4M77 B;  4BB7 A;  4WF2 A;  4HWR A;  4UP7 A;  4N0A C;  4QVC A;  4CS4 A;  1XTD A;  4XU1 A;  4XTZ A;  4PLI A;  3VQX A;  4O2D A;  4CH3 A;  3S3M A;  2L3R A;  5GAN e;  3UDC A;  3E1S A;  5CO7 A;  5I2M A;  2DD4 A;  3G6E A;  3P8T A;  1H4Q A;  1E22 A;  1EOV A;  3V8J A;  3Q1J A;  3JB9 H;  1VQL T;  3G71 A;  2M9U A;  2ARS A;  4YCW A;  4HT8 A;  1VQ7 A;  2WSE E;  3IG2 A;  4M78 E;  2HQE A;  1HTT A;  3BJU A;  5C52 B;  3PT9 A;  3RKX A;  3QO7 A;  4M7D A;  1G5V A;  4JDS A;  3TEG A;  3QDR B;  4QVD A;  2DIQ A;  5GAO r;  2E10 A;  1GGM A;  3LC0 A;  2M0O A;  3HXV A;  4DOW A;  1NE8 A;  3CC2 T;  4RKU E;  2FYK A;  4P72 C;  4OLF A;  3X28 B;  1J5W A;  4HWO A;  2K57 A;  1USY C;  5KCO A;  3M4G A;  3NTH A;  2LCC A;  5CK9 A;  3ME9 A;  3QYH B;  2JUF A;  2XIC A;  2BUD A;  2GFA A;  2MMP A;  2WAC A;  4LNS A;  1KHI A;  2O4X B;  1VQN A;  3HRK A;  4TTV A;  2OTL T;  3NTI A;  4LDX A;  2JN0 A;  2L5Q A;  5GAM j;  1KQS S;  4N4I A;  3HTZ A;  3HRU A;  3PFS A;  1VQ9 T;  1BI1 A;  3RAC A;  4LD9 K;  2CJ9 A;  1EVK A;  3CCS A;  4HKE A;  2E6Z A;  5GAN h;  4J15 A;  1WGS A;  5AYF A;  2K4Y A;  4TVY A;  4YRO A;  4N4H A;  3C12 A;  4YDQ A;  2ZPG B;  3HXX A;  1H3Z A;  4G85 A;  2EJG A;  4X9D A;  5LJ5 f;  3L2W A;  5LJ3 d;  3DLM A;  1AHJ B;  1ZBX A;  4XU3 A;  4XK8 E;  4C5H A;  4Q6G A;  2G3R A;  2ZXF A;  2VXF A;  2QQR A;  3C94 A;  3M54 A;  1N9S A;  4BI4 A;  2E1H A;  4A4G A;  3CMA T;  3PGG A;  2IY5 B;  2Y4Y A;  3OS0 A;  3SDZ A;  1E1T A;  3CCL A;  3EAE A;  5J26 A;  2QA4 T;  5EG2 A;  2ZNJ A;  1KMN A;  2XKO C;  2CZ1 B;  2M1H A;  3HL8 A;  2R5M A;  1BIB A;  4DA4 A;  4BY6 B;  3NET A;  2P4T A;  1N27 A;  1NJI C;  4EMH A;  1Q86 U;  1VQZ A;  2X35 A;  1XQH A;  3MCA B;  5GAN 8;  3I55 T;  4TVA A;  3A74 A;  3L2V A;  4MZP A;  4C92 G;  1H4T A;  2Q5H A;  1VQM A;  2BIV A;  4K88 A;  2QHV A;  1ZQ1 A;  4BD3 A;  4TVA B;  2XTI A;  2DXT A;  4M77 E;  3P8V A;  3RUX A;  2HNI A;  2FB7 A;  2V8I A;  1X54 A;  4C92 F;  1WNL A;  1I4K 1;  3E9I A;  4JLI A;  4KR2 A;  3M56 A;  2E65 A;  1VQ8 A;  3IKL A;  2ZZG A;  5D6X A;  3L2U A;  2DVE A;  3QO5 A;  1Y7X A;  4HWS A;  4TWA A;  5HK0 A;  1OZ2 A;  1IZ6 A;  3MP6 A;  4RDX A;  3CC7 T;  4DPG A;  5L8R E;  4PJO G;  3OYH A;  4C8Q G;  3MO8 A;  2LDM A;  3I56 A;  1PSE A;  5GAN 6;  4C92 C;  2MWO A;  1P92 A;  4N0A A;  3R07 A;  5A0L A;  4PJO F;  3G1Z A;  4C0F A;  4C8Q F;  2RI5 A;  3WQZ A;  4BE2 A;  3M4P A;  2DTO A;  4H2Y A;  5GMK m;  3KUF A;  2LCL A;  4LD6 A;  3SB2 A;  1BI3 A;  2DDZ A;  3JCM h;  1EIY A;  3LLR A;  4YCU A;  2RD1 A;  1WJR A;  4FT4 A;  1KHC A;  3E19 A;  1UGS B;  4J8O A;  1JJ2 S;  5GAM e;  1LNX A;  3LH0 A;  4M75 G;  3X26 B;  1V29 B;  4MMK A;  3SFM A;  5GAM f;  2DTI A;  4M7A G;  4JUV A;  4UPA A;  4XTV A;  4PJO C;  3L4G B;  4NCX A;  4C8Q C;  3C4S A;  1PSF A;  3OB9 A;  4M75 F;  4NOY A;  5KE3 A;  2XDD A;  2RJD A;  5A0G A;  4M7A F;  1JRI A;  3OSS C;  3MET A;  2I4N A;  3QPH A;  3TRE A;  4RQE A;  3JB9 F;  5GAN g;  1VQK T;  4YRT A;  1KC8 U;  1SET A;  1VQP T;  2RJE A;  3JCM P;  2ZCE A;  1YJW A;  4F7U G;  4P72 A;  5IAY A;  2EJF A;  4QQG A;  1Q7Y U;  1B34 B;  1USY A;  4M75 C;  3CC4 A;  4M7A C;  4HCZ A;  3NFC A;  4FU6 A;  3QJY A;  1LOJ A;  3QNE A;  3CCU T;  4MDX A;  4HA8 A;  1H64 1;  4LVM A;  4A4K A;  1Z7M A;  4HCB A;  2RK2 A;  4ATO A;  3GOX A;  1N9R A;  4JS4 A;  2GF7 A;  3G4S A;  3NEN A;  4OF1 A;  1YCY A;  1X56 A;  2OAU A;  4L5G A;  2OTJ T;  2AMC A;  4YRE A;  5HK3 A;  4J6W A;  3S3O A;  3OYN A;  4XTU A;  4V2S A;  2DIG A;  4IUQ A;  1NPP A;  3VKI A;  3QBY A;  2ZZD A;  1JJC B;  4OB0 B;  4XQ3 A;  4L87 A;  2FHD A;  4RG2 A;  1WYD A;  2K2V A;  3WXM B;  3RIR A;  1QVG S;  2YLC A;  1NJ2 A;  1RI0 A;  2ZR2 A;  1YIT A;  3A31 A;  1YI2 A;  3DKM A;  1X55 A;  2HD0 A;  3L1A A;  2X4Y A;  3OA6 A;  1G3S A;  4FL6 A;  3CCM T;  3CME T;  3RES A;  5DM7 R;  3PMT A;  1VUB A;  3QHS A;  2E64 A;  2D0Q B;  3MEV A;  1YJ9 T;  4Y28 E;  4YRP A;  3GF5 A;  2I4L A;  3FDR A;  4L6V 5;  1QVG A;  2RHS A;  3V7R A;  3L42 A;  4JLG A;  3JCM V;  4X5O A;  2CYZ B;  2F5K A;  1KQ2 A;  2ZTG A;  1VQL A;  4P3O A;  4RG8 A;  4P73 C;  3JCM g;  1VIF A;  1VQ5 T;  3CCV T;  2ZCF B;  4PHC A;  3V8K A;  3OY9 A;  2X4X A;  1Q86 C;  2ODR C;  2L89 A;  4Q15 A;  1B7Y A;  4M7D D;  3REX A;  4Z02 A;  1I8F A;  3P8B B;  3CEY A;  2E12 A;  1B7Y B;  5F5W A;  4E7I A;  3VQV A;  4C92 A;  1WQW A;  3CC2 A;  2DXB A;  3GPL A;  4II1 A;  4PLL A;  1M4Z A;  3X25 B;  3S6W A;  4QQD A;  1W2B S;  3MP8 A;  1M1G A;  3RMQ A;  3OS2 A;  5GMK h;  4RMF A;  1C0A A;  4LVK A;  2EIF A;  2I4M A;  3CXC S;  4J5Y A;  3OYK A;  1EVL A;  1YIJ T;  5CCA A;  2OTL A;  4YRM A;  2R58 A;  4KT0 E;  3M5A A;  1FXX A;  4M78 F;  1S72 A;  4HWT A;  1HK9 A;  2X4J A;  4PJO A;  1R8O B;  1VQ9 A;  4C8Q A;  2C7I A;  3LGL A;  3RMS A;  3RKY A;  5GAN 4;  3HFV A;  4M7D B;  2ZT5 A;  1WQ7 A;  1QW1 A;  2EQU A;  5GAM d;  4MZT A;  3ZBD A;  3CCE T;  1W2B A;  3M55 A;  1M8V A;  5GAO l;  4E7L A;  1NJ6 A;  3ERR A;  2YRV A;  3CXC A;  2ZPI B;  1K73 U;  2DK3 A;  5M9O A;  4NL3 A;  2E41 A;  1MGQ A;  4M78 C;  1MHN A;  4MZM A;  2QDY B;  4NL2 A;  1VQ4 T;  2DAQ A;  3SWN A;  2A7Y A;  4JRI A;  5GMK i;  4M75 A;  3IAL A;  3VQW A;  3CMA A;  2WSC E;  2O01 E;  2RK1 A;  1PYS A;  3SWN B;  4M7A A;  3HXY A;  3MEW A;  3G6E T;  3HRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...