3L2ZA

Crystal structure of hydrated biotin protein ligase from m. tuberculosis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
258
structure length
240
Chain Sequence
RPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTTARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords BirA bifunctional protein
publication title Structural ordering of disordered ligand-binding loops of biotin protein ligase into active conformations as a consequence of dehydration.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 71
structure length 240
sequence length 258
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2zA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3l2zA01
1YGBA 5GANe 3DSQA 2DQ3A 2CJAA 1BBWA 4YYEA 3INZA 4E51A 4RMFA 4K88A 1MGQA 3HRIA 3QTCA 4O2DA 4M78E 4HWTA 3SWNB 1SRYA 2ZT6A 4P3NA 4BW9A 3PGGA 2FYKA 3RKYA 3MEYA 4H02A 4QVCA 1B70A 4K87A 4M77C 1Y96B 4P73A 3VBBA 1JRIA 3HXXA 1HC7A 4P71A 1X01A 3UGQA 4TWAA 3JCMd 4XTVA 4M7AG 4YRFA 5GAN8 5GANd 2E64A 2VXFA 3VQVA 5GAOl 1EQRA 2DEQA 2EWNA 4C92C 4P71C 4M77B 2DZCA 1FYFA 4XU1A 1JBMA 2DZ9A 3TUPA 4H2VA 4M75C 4EMKC 2XTIA 4M78G 1YFTA 1X2HA 2RD1A 3W3SA 3MF1A 4M7DD 2ZR3A 4PJOC 4Y91A 2EL9A 4P3PA 3KFUA 1PYSA 2CIMA 4M77E 1TH7A 1B70B 2ZT7A 3NENA 4H2YA 4TTVA 1ATIA 3A74A 3QO5A 5GMKi 2DTHA 2DXTA 4C92B 4UP7A 4UP8A 1B34B 4TVYA 5K1PA 4EMKB 5E3IA 1EOVA 1ASYA 4H2UA 3GIBA 3VQWA 2DVEA 1I4K1 3M4QA 4C92E 2PMEA 4M7DF 1G5HA 4F7UG 1BIAA 3IKLA 2Q7GA 3BDUA 2EAYA 2DXUA 1BBUA 2J3MA 1SERA 2Q7EA 2ZZGA 4DPGA 1KMMA 1KMNA 5HGQA 1LJOA 2Q5IA 4C8QF 5CAIA 4WI1A 1NJ1A 3V7CA 4L87A 4M77G 1HK9A 2DU5A 3JCMg 4XTZA 2K57A 1WYDA 5GMKh 3AHUA 1NYQA 3R07A 1YCYA 4HT9A 2YHTA 4G84A 3ICAA 2Q7HA 3QO7A 5GAMh 4XU3A 1NJ6A 3REUA 2C7IA 3QO3A 4LNSA 2ODRC 2ALYA 4X9DA 2ZTGA 3CMQA 1I8FA 4YCVA 1NNHA 4XEOA 1KQ2A 2DJZA 4XQ3A 5ELOA 3SWNC 1EFWA 4C92G 5LJ5f 1NYRA 5GAN5 4J6WA 2QHUA 5GAN3 2PMFA 5LJ3g 3E9IA 1L0WA 3JCMe 4M75G 5GAMf 1B76A 3UFGA 5GMKj 3JCMh 4PJOG 4HT8A 3JB9J 3A7RA 4WF2A 1LNXA 5GAMj 4PHCA 5GANh 1USYA 4EMGA 4YRQA 4XTUA 3JB9G 3V8JA 2Q5HA 4C8QA 4M7DC 2DTOA 3JCMP 4PNOA 2QTXA 4OP0A 1E24A 3QSUA 3IKMB 5LJ3e 2ALYB 4ZTUB 3QHSA 3ERRA 4P75A 1B7YA 4TVAB 3RL6A 4PG3A 2RB6A 1JJCA 1KOGA 3JCMJ 4YCWA 5GANf 5GAOm 4UP9A 4YDQA 4RQEA 4YRCA 3BY7A 4X5OA 4RQFA 2XGTA 3FJPA 4NL3A 5GANj 1YFSA 3HXVA 2ZINA 3IALA 4YRIA 4M7DB 1U1TA 4EMHA 3QNEA 4KR2A 1X56A 4DQ2A 4P73C 4M7AF 3PZCA 1H4QA 5GMKm 3PCOA 2ARUA 3L4GA 5GAN6 4ZTZB 3JB9H 4M7DE 4TQDA 4J5YA 4C8QB 1G51A 4H2WA 5LJ3d 3BJUA 4CH4A 1LOJA 4OLFA 1EVKA 1NJ8A 5GMKl 4H2SA 4HVCA 2YLBA 1BIBA 4M78F 4WJ4A 3RKWA 4XTWA 2VC8A 3RACA 2ZCEA 4A54A 4P74A 4CH6A 1Z7MA 4C8QD 1EVLA 4YREA 1H4VB 3RERA 4JRKA 2EJFA 1C0AA 3A7UA 1ADJA 2QHVA 4ZIBA 2E65A 3G1ZA 2DTIA 2ZGWA 2ZR2A 5C53B 1SESA 4YRJA 5GAOq 4TVWA 3BW1A 4HWPA 1D3BA 4M7AA 3HFVA 4F7UF 5LJ5g 4M7DG 4NCXA 4CS2A 1PYSB 4NOYA 5I21A 2CJ9A 5GAOr 5K1XA 1HTTA 2QHSA 1E1TA 1M8VA 1Z7NA 2EJGA 3SB2A 2IY5A 1B8AA 3LSQA 4K86A 4Q6GA 4RDXA 4XU0A 3UGTA 3V8KA 3HXWA 4CS3A 4M78A 4M77F 4M75D 2E3CA 1WPYA 4JRIA 2RHQA 4V2SA 3JB9I 3VQYA 3NETA 4PJOD 3JCMV 4YROA 5LJ5e 4J6XA 2J3LA 3JCMc 3L1AA 3BFMA 2QHTA 2YLCA 1YFRA 4XTYA 3EFRA 3JCMb 1ADYA 1J5WA 2ZZEA 4YRGA 1D3BB 3TEHA 3RIRA 3A7AA 3HFOA 2E41A 1G5IA 4HWOA 3RGLA 4M75F 5DY9A 5KNNA 4BWAA 4MMKA 4F7UA 4A53A 2P5IA 1X54A 1IL2A 4HA8A 2Y90A 2IY5B 4PJOF 2RM4A 2P0LA 3L2ZA 3A5YA 3RF1A 3A32A 3JCMX 4N0AA 4M7AD 4HWRA 1QF6A 3LSSA 3JB9F 1GGMA 4RCCA 3JCMf 1W66A 4KQEA 2I4MA 5LJ5d 3WQZA 3RKXA 1NJ2A 1I5LA 5GAOn 1USYC 5LJ3h 2ZIMA 1SETA 4M77A 4XEMA 5F5WA 2DQ0A 2ZNJA 5GAMd 4C8QC 4N0AC 2RA2A 3P8TA 4M78D 2DDZA 1RIQA 1E22A 1QE0A 1VQZA 4KR3A 3V7SA 4P75C 3HY1A 3TEHB 3LC0A 2AMCA 3HTZA 1N9RA 3IG2A 1WQWA 1M5Q1 2ODRD 1WU7A 3HXZA 3A31A 5LJ3f 4F7UB 4C92A 1U1SA 3P8YA 1B34A 5LJ3j 2RHSA 2ZXFA 2JN0A 4M75A 1N9SA 4EMKA 3V8LA 1H4TA 2CJBA 1WQ7A 2G4CA 4PJOA 3HSBA 1B7YB 3HRKA 5GAN2 4H2XA 3HXUA 4F7UE 4J6YA 1JJCB 3HFZA 2E5AA 4CH3A 11ASA 4C8QE 4YRPA 3NELA 4XU2A 1KQ1A 4G85A 4EO4A 5GAN4 5GAN7 4CS4A 5C52B 2AMCB 2ZIOA 4YRNA 4YRTA 3P8VA 4WJ3M 3JCMW 4YRLA 4XTXA 3VQXA 4M77D 3PCOB 2HNIA 3M4GA 4P74C 2I4OA 4YRKA 5ELNA 3L4GB 4YRSA 2DKGA 2RHSB 4J15A 4M75B 1X55A 1YB3A 1E1OA 2ZT8A 2ARTA 1EIYA 4AH6A 2I4LA 4PJOB 4H2XB 4HWSA 5GAMg 2C8MA 4EX5A 3EFSA 1N9WA 4P72A 3HFNA 3V7RA 3FB9A 4QVDA 3HFZB 4C92D 4P3OA 3QUIA 12ASA 1X2GA 1ASZA 1H4SA 4M7AC 4M75E 4C8QG 1I81A 4YPFA 2E10A 3VU3C 4CH5A 2AKWA 3JCMQ 1WNLA 2DU7A 4PJOE 3MF2A 2CGHA 4UPAA 3M4PA 3FIFA 1WLEA 3HY0A 4P72C 4NL2A 2VXEA 4RCBA 5GMKe 1LYLA 3RUXA 5LJ5h 3QO8A 3NEMA 3JB9D 3SWNA 2E1HA 5GAMe 5C51B 4M78C 4YRRA 1H641 5GANg 4M7AB 3I7FA 4C92F 2ARSA 3E9HA 2ZNIA 3OD1A 4JLIA 4H2TA 2I2LA 4TVAA 1EIYB 2ZZFA 2ZT5A 1Y96A 3A5ZA 3HXYA 4X9CA 3RESA 4TQFA 4YP0A 5GAOp 2FB7A 1NJ5A 4M7AE 2I4NA 4Q15A 4YCUA 4M78B 4JUVA 1HXDA 2EJ9A 4MMLA 3TEGA 2AKWB 3UH0A 5LJ5j 4M7DA 4YRMA 2RHQB 3REXA
chains in the Genus database with same CATH superfamily
5GANe 1OYXA 5GJWB 1BBWA 4E51A 1VQ5T 1HD3A 3LYIA 2DPPB 2DRMA 1KJWA 2BUDA 1SRYA 4FSXA 4WTOB 1OPKA 2OAUA 2ZT6A 4PJNA 3UA7A 3CPWS 4P3NA 1LPLA 4E7IA 3PGGA 2FYKA 3QXEB 4KULA 3RKYA 2L2PA 4H02A 4QVCA 4M77C 1YJNT 1BI1A 4BI8B 1E6GA 1Y96B 3A5ZB 2EGAA 3I9QA 2QASA 5FRNA 3HXXA 3CCUA 2A7YA 4P71A 1X01A 3M0TA 1JXOA 1M3BA 3CCMQ 1YIJQ 2GGRA 2COZA 3EG0A 5GANd 4BDZA 3OYLA 2GNCA 3X28B 1ZUUA 3S6WA 1TS9A 2K2VA 1KD1U 3C4SA 2Y4XA 3UPUA 1WJSA 2P84A 2DZCA 4JDSA 5KYXA 1NM7A 2DZ9A 1Q7YR 1JXMA 3RR6A 4EMKC 2FEIA 4E6RA 1X2HA 3W3SA 2ZR3A 1PRLC 2Z0WA 2QEXT 3TSWA 1ABQA 2MWPA 1H3ZA 3NENA 4H2YA 4TTVA 5GMKi 4FT2A 2DTHA 3QDFA 3GLXA 5CCAA 3CCQQ 4ZGEB 2LQNA 1Z9ZA 4E7SA 1B34B 4OB2B 3NFCA 4H2UA 5FWCA 4C0ZA 5KYUA 1B7TA 2KR3A 4M7DF 2M51A 4F7UG 3MEWA 1WDXA 1PSFA 1S1NA 4JJCA 3VUZA 3CCST 1VQ6A 2RK1A 3JRZA 1OU8A 4IUTA 1BBUA 5D6WA 3SEMA 3G6ET 2F69A 4RUGA 5FWBA 2FZKB 2V1QA 1K8AR 5CAIA 3G4SA 4WI1A 3V7CA 1GBRA 1HK9A 1M90R 4LDXA 2XU8A 2DU5A 1UGRB 3VKIA 5GMKh 3QYHB 1NYQA 4HT9A 1TU0B 4G84A 2Q7HA 1XJWB 1NJ6A 1U3OA 4GLMA 2C7IA 3QO3A 3SHWA 2XICA 1LCKA 4X9DA 1WHHA 2J6FA 4ZTFA 1Q7YC 2A8EA 3H9NA 1P92A 2BIVA 4JJNK 4XQ3A 1M2VB 1EFWA 1MMNA 1NYRA 5D6XA 4QQGA 4PLIA 4DBHA 3L2VA 3E9IA 3WVDB 2XK0A 1VQMT 4M75G 1FYNA 3ZEHA 1H3HA 3JCMh 4HT8A 3KBGA 1SRMA 4OMPA 3I56A 5GAMj 1VIFA 4Q5WA 4FW1A 4EMGA 3VUBA 3OYCA 3FJ5A 4PL6A 2L5QA 1BKBA 4M7DC 2KNBB 1OX8A 3JCMP 1K73U 1PWTA 4P5NA 4A4FA 2QTXA 2FPFA 3ERRA 7AT1B 3RL6A 1BCMA 3FRNA 3NGPA 5GANf 3M55A 5GAOm 3OS0A 3IQLA 4YRCA 4KGVB 4HKEA 2SRCA 2EGCA 1FMKA 2MWOA 2O2OA 1M90C 4EMHA 3QNEA 2DD4A 4DQ2A 4LUEA 1YI2Q 2CP5A 4M7AF 1H4QA 2KYBA 2XI9A 3CCMT 1SG5A 1YIJT 2CP3A 2ARUA 2JM8A 5GAN6 2VGMA 4BI4A 3HRUA 3OYHA 1QP3A 2KYMA 4C8QB 1VQKA 2ENMA 2EYZA 1BB9A 2M02A 5I2SA 1EVKA 3OY9A 4H2SA 2RHUA 1YN8A 2RQUA 1QVFS 3LH0A 3UWNA 4D8DA 2VC8A 2LQKA 2DL4A 2RHXA 4PLLA 4YREA 1H4VB 4BE1A 3JV3A 1YJ9Q 1XQHA 1C0AA 4LD6A 2ZZDA 4EDUA 2LT4A 2E65A 3A8HB 2ZGWA 3M57A 1CSKA 4LUDA 1Q82U 3N5BB 3BW1A 1LVKA 4RTUA 1QMCA 1OV3A 1BI2A 4NCXA 4CS2A 1ZBXA 5IXFA 2DVJA 1HTTA 2VV5A 1Q81C 4FSSA 1XTDA 4K86A 2CT3A 4Q6GA 4RDXA 4J7IA 3VYHB 4IKFA 5CQYA 4FYVB 3VV0A 4F04B 2RI5A 3C12A 2P0QA 3OW2P 1X2QA 4V2SA 3NETA 3JCMV 1KQSS 2CS7A 2HQXA 2AT1B 4X1VA 4AT1B 3CC4Q 3O5ZA 4XTYA 1J5WA 1AWXA 2E4HA 2XD0A 3FC3A 1D3BB 1PNJA 3RIRA 4N4GA 3X26B 3A7AA 5I22A 2MF2A 5I11A 4HWOA 4E7KA 3AT1B 1ZQ1A 3I5RA 2OI3A 5KNNA 1I1JA 1SF9A 4F7UA 1X54A 3LWHA 2QQ9A 2IY5B 4PJOF 2DK3A 3L2ZA 3A5YA 3M56A 4RTTA 3JCMX 1OULA 3A32A 2K3BA 2NYSA 3OYNA 2RJEA 4M7AD 1YITA 3I35A 1NLPC 1BBZA 2AZSA 1RLQC 1D0ZA 3G71T 3OB9A 1I5OB 2I4MA 5L23A 3EG1A 3CEYA 3RKXA 1I5LA 2KI7A 5IXBA 5LJ3h 2ZIMA 1AOJA 1OX9A 2P4RA 3VS6A 4N0AC 3P8TA 2KQWA 2DDZA 1VQZA 1QWFA 4OMFB 3KXTA 3S3OA 2MPXC 1WQWA 1ZX6A 1VQ4Q 3QPHA 1R0CB 1MNEA 3OYYA 1WHLA 4Z8AA 4D8KA 4E7ZA 4ELYC 1YWPA 1OZ2A 3P8YA 2GQVA 2JN0A 4M75A 3V8LA 3CC7A 1UB4A 2CJBA 2K5LA 1AD5A 3X25B 1YI2T 2NUTB 3CD6Q 1W6XA 1B7YB 1W2BP 3HRKA 3CCLQ 1OPLA 5KCHA 1GFCA 1IHWA 1AZEA 1WFWA 1VQ7A 3U23A 1ZA2B 2DJQA 3GPLA 3CCSA 4YRPA 2LCSA 1YHQA 2CSIA 4XU2A 8ATCB 1KQ1A 4E47A 2OTLA 4CC4B 4EO4A 4B9XA 4CS4A 3M0UA 2AMCB 3EHRA 4YRNA 2VASA 3MQZA 1BCOA 3PCOB 2HNIA 2MMPA 3R6OA 2LDMA 1E7OA 1PKTA 2MAMA 4J9BA 2I4OA 2FRWA 3L4GB 2HSPA 3P8BB 2VUBA 2RHZA 2DL3A 4LDUA 2COWA 4YRSA 4XAXB 2DKGA 2QA4Q 1YJ9T 1NJIU 2RHSB 4OVAA 2NWMA 1X55A 2XIDA 2O88A 1E1OA 2W10A 1EIYA 4H2XB 4HWSA 1BI0A 4BI3A 3EFSA 4P72A 3QUIA 1QVGA 12ASA 4Z88A 2D0NA 2LCCA 1UGPB 2E10A 3VU3C 1M2OA 2K3YA 4BY6B 3L2QA 2YUPA 3ULRB 3M4PA 4BUGA 3FIFA 2ED0A 1KD1R 1Z9QA 3HY0A 2KRSA 2RH2A 3SDZA 3RUXA 4DBRA 3MP6A 1OI1A 3EG9A 3SWNA 2E1HA 5GAMe 3I55A 1KC8U 3CCEA 1H641 2WACA 3QG1A 3L2UA 3MKDA 4OB1B 4H2TA 2VYTA 3QJ6A 3CC4T 2ZT5A 2DEUA 2IIMA 3L2WA 3HRSA 3RESA 2QGFB 4TQFA 1W4SA 3OSVA 5GAOp 1NJ5A 2EQMA 3DB4A 4M7AE 1JU5C 2I4NA 4M78B 3REBB 4MMLA 1GCPA 3TEGA 2AKWB 2YXYA 3PFSA 4FYWB 2BE7D 2PUOB 2EBPA 3DSQA 2DL5A 3BE3A 5J26A 2CJAA 2DQ3A 2QQBA 1SSHA 2CYZB 2XKOC 3HRIA 2DYIA 4QT7A 1YJNQ 1PG5B 2JW4A 1Q86R 1TUDA 3CCMA 3PE0A 5FU7B 2IVWA 1AWWA 2VVKA 2XDPA 2DILA 2W0ZA 3ER0A 4AFZC 1B70A 4K87A 2J6OA 1UG1A 1SSFA 1XNIA 2J05A 2DXCA 4P73A 3VBBA 3OSSC 3L42A 2LJ0A 3TEEA 4TWAA 2F2XA 4M7AG 3OW2A 1VQ4T 2C06A 4YRFA 1UECA 2X51A 3CMEQ 2VXFA 2K6DA 1EQRA 2DEQA 2IG0A 4C0DC 1EIFA 3P8DA 4MDWA 3CCQA 3NTIA 1WIEA 4C0GA 4PFPA 4VUBA 4M75C 2XMFA 2RD1A 2V8IA 3OYEA 3CD6T 3QJYA 3FEOA 4Y91A 1HSQA 2BE9B 2DNUA 2QXFA 3VYGA 1TH7A 2AKKA 2A08A 2KY9A 3A74A 1RAIB 1N8RC 2HKNA 4C92B 3CQTA 5K1PA 1VQPQ 3J7AF 2RHYA 5E3IA 1EOVA 1ACMB 3VQWA 3G6EQ 2DVEA 2ATCB 1GFDA 1D1CA 2PMEA 5KYYA 2X3XD 4LVIA 2H3JA 5FU6B 5FLXE 1UJ0A 3BDUA 5KYXB 2QA4T 3RMSA 2DXUA 1B07A 3UA6A 3DKMA 2J3MA 2Q7EA 4GBQA 1Y0MA 3CXCP 3KFVA 1KMMA 5HGQA 1LJOA 1X6GA 1VQLA 4L87A 2GTOA 2KDSA 4XTZA 2M0YA 1WYDA 2EW3A 3R07A 1VQ8Q 1YCYA 3A98A 5IN1A 2FVUA 3EFOB 3QO7A 2ODRC 2ALYA 2ZTGA 4MZTA 2B8AA 5ECAA 1W2BA 1WXBA 2MYSA 4L59A 4YCVA 3M54A 3REAB 5KYUB 2E5KA 1NNHA 3HL8A 5ELOA 3SWNC 1FX7A 4MDXA 4EPCA 2DIGA 1M1KU 5LJ5f 3C94A 5GAN5 3H8ZA 1VQ9Q 2QHUA 3CCJQ 5GAN3 2PMFA 5LJ3g 1WHGA 5GAMf 4OMMA 2CP0A 2NUPA 5L8RE 3UFGA 5GMKj 4PJOG 3JB9J 1SRLA 2EQIA 4ZN3A 2V8JA 1USYA 2QYZA 3V8JA 1JJ2P 1UDLA 2EYWA 2Q5HA 2D8JA 3CCRA 3CMAQ 1NEBA 2DTOA 1KG1A 4OF1A 2LT1A 3Q1JA 3QHSA 4P75A 4AFQC 4TVAB 4PJMA 4RMOA 4PG3A 1QCFA 3A8MB 2RB6A 1JJCA 1KOGA 1UUEA 1RAEB 2RF0A 4II1A 3VJPA 2JNGA 4YDQA 2GF7A 4RQEA 3D7SB 1UE9A 5KCOA 1GL5A 3CC2A 2DBMA 3M9QA 4P73C 5GMKm 3VS0A 4IUQA 1UFFA 1QCOA 2HBPA 4R56A 3JB9H 3CMET 4PFZA 4J5YA 2QG9B 3UATA 3WVEB 4DEXA 1FWZA 1JO8A 4TQDA 3QKJA 1LOJA 2R57A 1IZ6A 5GMKl 4M78F 4WJ4A 4XTWA 1U8RA 2NS6A 1ZUYA 2ZPIB 2ZCEA 2FO0A 4YTLA 4A54A 3L2RA 2YRCA 5KE3A 5M9OA 2K4YA 3NHNA 2D6FA 3M0RA 3DLLA 5CVIA 1AEYA 3A7UA 2BKDN 2BZ8A 2QHVA 1K9MR 2PQWA 2L8DA 2LRQA 2FRYA 3EGDB 1VQPT 1MMAA 4YRJA 3QDRB 5GAOq 1TXQA 2HQHA 1G3WA 3H41A 5J39A 4M7AA 3HFVA 1B3QA 2OTJA 3CBPA 2QQSA 3TVTA 1PYSB 1I0CA 2A3LA 4ANJA 1M8VA 4QQDA 2EIFA 4HCCA 3SB2A 3UGTA 1YJWQ 3HXWA 4HXJA 2PVGB 2RHQA 2M9UA 1MNDA 2CP2A 3VQYA 2VWFA 3QZ5B 2GBQA 1X2KA 3BFMA 3CPWP 2GCXA 1VQ8T 1AVZC 1RAAB 2YLCA 2WSEE 2F2VA 3X24B 1M30A 2CZ7B 1JQQA 2YDLA 2E41A 4HCKA 1G5IA 3G71Q 1V1CA 3PMIA 3RGLA 5HK3A 5DY9A 1VQ9T 4BWAA 3CCJT 4A53A 2P5IA 1IL2A 2Y90A 4RTVA 2P0LA 4OB0B 3RF1A 2YWWA 1YFNA 4N0AA 4RG8A 2YUNA 1K9MC 3LSSA 4E7LA 1WJRA 1S72A 2RI3A 1FMWA 2D0QB 2KMTA 1H8KA 2F2WA 4OMQA 1USYC 2ZPFB 1KIKA 3QIIA 4XEMA 3CMAT 2M16A 2YRVA 2RA2A 1SHGA 1K8AC 1PHTA 4TVRA 4M78D 2EPDA 3EH1A 1RIQA 4KR3A 1HJDA 2KBTA 4P75C 3HY1A 1GXIE 5DM7R 3CCLA 1BU1A 2CREA 3M5AA 1R77A 9ATCB 1WU7A 1KHCA 1J3TA 4KGZB 1KC8R 4F7UB 3OS2A 1U1SA 4L5GA 4C5HA 1B34A 2O4XA 5LJ3j 2ZXFA 3MP1A 2G4CA 4PJOA 2K7AA 3RDVA 4J6YA 1T0JA 2LC4A 2COYA 3GBQA 5DLOA 1YBYA 2P0KA 3UDCA 4LNPA 1VQNA 4LVMA 1WGSA 5D6YA 4KUDK 2BZXA 1W70A 2QAZA 4JS5A 5C52B 3PVQA 4YRTA 3P8VA 2O01E 3JCMW 4YRLA 3VQXA 2J06A 1JJ2A 5ELNA 2HD0A 2F5KA 3MPUB 3CBMA 2CZ0B 2CT4A 2QDYB 4RG2A 4M75B 2HQEA 3LLRA 1RI9A 2I4LA 2C8MA 1N9WA 3UF4A 3HFNA 3V7RA 1KHIA 4KH0B 4QVDA 4C92D 4OGEA 3OQ5A 2FPDA 3GF5A 2F5TX 4D6WA 4M7AC 3QZ9B 1PD0A 3URGA 3P8HA 2M0OA 4CH5A 3MEUA 2X4YA 1MV3A 4PKCC 2EQJA 2CGHA 2B86A 4FYYB 3MEAA 1WLEA 3M59A 1YWOA 1VA7A 1VQ5A 4RCBA 5GMKe 4PK4A 2ZPEB 3EG2A 5LJ5h 1YJWT 3QO8A 2DL8A 5C51B 2LVMA 4ORZA 2QQRA 2KE9A 1VQ6Q 3NMZC 1M1GA 2JVVA 2JTEA 1TSFA 1QKWA 1EIYB 2ZZFA 1YJNA 1NBEB 4E2FB 4X9CA 3G4SQ 2E70A 3M4YA 1FXXA 4YCUA 1K1ZA 1Q7YU 4JUVA 1V76A 1WXUA 1YGBA 2JMCA 3EH2A 3INZA 4RMFA 1M8MA 1MGQA 1PKSA 1T3SA 3OYAA 3QTCA 3OMCA 1SHFA 4M78E 3EG9B 3SWNB 1K0SA 1A0NB 2RQRA 2DIQA 1IB8A 1QVFP 2PZ1A 2HSEB 4UC4A 3MEYA 1VYTA 2QEXA 1JRIA 2L0AA 2ROTA 3I56Q 4JRPA 1F1BB 3UGQA 1QWEA 3JCMd 2CUBA 2IPOB 2E64A 3GP8A 2RJFA 2QI2A 2RJCA 3A1PA 4Y28E 3J81E 2DERA 2K3XA 3FDRA 4BE0A 1AT1B 2EWNA 3CPWA 4M77B 1K8AU 4KGXB 4KH1B 1FYFA 3PT9A 1M90U 4JRQA 2XTIA 4M78G 2D1XA 1YCSB 1YFTA 2EVRA 2DF6A 1VIEA 2FG0A 4A63B 4PJOC 3G6EA 1G2BA 1QLYA 2LMJA 2RJDA 1D1AA 4P3PA 3KFUA 1K0XA 2CIMA 1M9SA 1B70B 2ZT7A 1ATIA 3CCUT 2LX7A 3QO5A 2DXTA 4FCYA 4CC2A 2DAQA 1KQSP 4EMKB 1UHFA 1AWJA 3H0IA 2P4TA 3FLGA 1VQKQ 2EYQA 4ME7A 1RAFB 3GIBA 1FMVA 2JMAA 3G7ZA 1I4K1 2CKKA 3M4QA 1UTIA 4C92E 3HP9A 1BIAA 3IKLA 4EIKA 1N6AA 2EAYA 4R55A 1K9AA 1WX6A 4AMCA 1UGQB 1VQMA 1SERA 1RI0A 2EYXA 2K5IA 3META 2ZZGA 5HCKA 2DXBA 4K11A 1KMNA 5IH2A 2Q5IA 4C8QF 1YP5A 4BDYA 2FZGB 4JPBW 2LZ6B 1VQOQ 1PM3A 3JCMg 2ZAEA 2K57A 3GNGA 3AHUA 2FL7A 1JEGA 2YHTA 4XU3A 3REUA 2X9HA 2DYBA 1Q81U 3CMQA 2MK5A 4OB3B 5CQXA 4QKUA 4XEOA 4J8OA 4AG2C 1KQ2A 1IHVA 2HDAA 3MHXA 4NS5A 5KYYB 4C92G 3NTKA 1VQ6T 4KRTA 4RTXA 2ZPBB 1L0WA 2HL3A 3QBYA 2EGEA 3MO8A 1WHJA 2LNVA 1VYVA 4WF2A 1LNXA 3G4ST 4PHCA 5GANh 4KT0E 4LDVA 1GBQA 1YIJA 1RL2A 4XTUA 4YRQA 2QTVA 4J9EA 4OMOA 1E24A 3IKMB 1ZHIA 2CH4A 2DE0X 2NUTA 5LJ3e 2ALYB 1X6BA 4PJJA 1B7YA 2JOYA 5CKHA 3JCMJ 4YCWA 1WZOA 1M3AA 2AIRB 5KE2A 5CKEA 3BY7A 1M3CA 1KD1C 4RQFA 2XGTA 4RTZA 3F70A 4NL3A 2ZPGB 1YFSA 2ZINA 1ZA1B 2JUFA 1WHKA 2L3PA 2NUZA 2NUPB 1U1TA 5A0DA 5C0MA 4M7DB 4YRIA 1WXTA 4DBQA 4C5GA 4KR2A 2JJ9A 1N5ZA 3OS1A 3I56T 3PCOA 5J3BA 3A8GB 4JZ4A 3L4GA 5FW9A 2MCNA 5IT9E 4ZTZB 4LVLA 2ROLA 5HY6A 1G51A 4H2WA 5LJ3d 3BJUA 1QVPA 4CH4A 4IIOA 4DOWA 1O9SA 4HVCA 4OMNA 1BIBA 2RPNA 2E3IA 3HTRA 2C0TA 4DEYA 1K73R 1Z7MA 4C8QD 2QGGA 1OEBA 1Q86C 3RERA 4JRKA 1UGSB 2EJFA 2I0NA 3CC7Q 2MIOA 3MEVA 3E2UA 1ADJA 4ZIBA 2MOXA 3OYJA 3G1ZA 1NZ9A 3E1SA 1VQ7Q 1QVFA 1VQKT 5AT1B 1YHQQ 5LJ5g 4ZTJA 3E19A 1CKBA 5GJVB 3TQ7P 2OTLQ 2OAWA 4NOYA 5I21A 2GQIA 5GAOr 2L3SA 1GRIA 1RAHB 1W1FA 4FL6A 2J7IA 1B8AA 3LSQA 1C6VX 1DJ7B 4XU0A 5KYWA 3V8KA 1RADB 2LP5A 1G3YA 4M78A 4M77F 5AYFA 4M75D 2E3CA 2V1RA 2DO3A 3G71A 4ATOA 2RO0A 3SFMA 2JM9A 3JB9I 4N4IA 1VQOT 2DBKA 2RK2A 4J9IA 2KT1A 2J3LA 3MP8A 4OMLA 2KEAA 1C1AA 2QHTA 2RHIA 3JCMb 3RMQA 4YRGA 3RBBB 1X75C 3TEHA 3HRTA 2DLPA 4CI0C 3HFOA 4Y92A 1K73C 5KH6A 4OGCA 1Q82R 2RQVA 4MMKA 1KQSA 2RM4A 4LD9K 2A0FB 1CKAA 3DLMA 3I55Q 1QF6A 2D8HA 3CCEQ 2QQAA 2O9VA 3JB9F 1YI2A 2X35A 1GGMA 4RCCA 1W66A 2KRNA 3WQZA 1KK7A 4J9CA 5GAOn 2YSQA 2KAFA 1SETA 1NYGA 2KK4A 1ABOA 4WCIA 3CBOA 3VRZA 1EX4A 2C0IA 3V7SA 1BK2A 3OYGA 3IG2A 1M5Q1 2ODRD 2K5FA 3HKSA 3A31A 4X34A 4F16A 1AZGB 5LJ3f 2GFUA 4JZ3A 4C92A 5FROA 1AHJB 1YITT 1YJ9A 4HVVA 1H4TA 1N9SA 2K2MA 3MJXA 2NLUA 3GNFB 5C6SA 1RABB 1TG0A 3HSBA 4E7HA 4A4KA 2O31A 4F7UE 3ZFJA 3HFZA 1WI7A 2A37A 2E5AA 3H0FA 4CH3A 4RTWA 2RN8A 2RI2A 1RLPC 4C8QE 3NELA 3OYFA 4C5IA 2BTTA 2OX7A 3EGXA 1Q82C 2ZPHB 1M27C 1NPRA 1X69A 5GAN4 1QVGS 1Y7XA 2ZIOA 1IGQA 1MV0B 4WJ3M 4XTXA 4M77D 2L3QA 2CP7A 3M4GA 2VKNA 4YRKA 1X43A 1KFZA 4JLGA 2O4XB 4BY6C 3EFOA 3CC7T 2RNAA 1PSEA 2LQ8A 2ZT8A 1N8RU 4PJOB 3CC4A 4EX5A 4AG1C 4ZTUB 1VQ7T 2PVOB 1X2GA 3H6ZA 3CCVQ 2JT4A 4RKUE 1YHQT 1ZSZA 4DBFA 4M75E 1Q86U 1IO6A 4C8QG 1WYXA 2OTLT 2DU7A 4UPAA 2VB6A 3OYDA 4NL2A 1IXDA 1LYLA 4IIMA 1TUCA 3NEMA 3JB9D 4M78C 4QQ6A 4YRRA 5GANg 5CKDA 3I7FA 4C92F 2A28A 3VS5A 2ARSA 1Y71A 3OD1A 3M0QA 4TVAA 2H8HA 1QQJA 1Y96A 3A5ZA 4HCBA 2AK5A 4YP0A 5FU7C 1VQLQ 1NJIR 2GTJA 5A0LA 3UH0A 1VQ4A 5LJ5j 2F1LA 3REXA 4JS4A 4YYEA 4ESRA 4K88A 3OW2S 3ZBDA 4O2DA 1T0HA 3I55T 4HWTA 3A8LB 3CCET 2EKOA 2LNHB 4FU6A 5KYNA 1MHNA 1PC0A 3O8VA 5A0GA 3OYMA 3CXCA 3CD6A 4BW9A 1Y57A 3I5SA 3C0CA 3OBWA 1HC7A 6AT1B 2LQWA 5EC7A 1JB0E 1QP2A 1QVGP 4F17A 1M1FA 2PUKB 2J6KA 4XTVA 3T9NA 1VYUA 1Q81R 3TU4K 2DD5A 2X4WA 5GAN8 3CCRQ 3PTAA 2R5MA 3VQVA 5GAOl 4C92C 4P71C 4KBMB 3EGDA 4XU1A 3X20B 4LN2A 1JBMA 3DB3A 2QA4A 3CCUQ 4H2VA 3TUPA 2DL7A 3OYBA 1IREB 2LJ3A 2JS2A 3MF1A 4M7DD 1Y07A 2V8KA 1IGUA 2EL9A 2CSQA 1PYSA 1NJIC 5CKFA 2G6FX 4M77E 3CC2Q 5FU6C 1WLPB 2QK0A 4PJLA 3TSZA 3E9FA 4C0DB 4FYXB 1OQKA 4UP7A 4UP8A 4TVYA 2LCLA 3NTHA 3RNJA 3VRYA 1WA7A 2PNIA 2EKHA 4GY5A 2JXBA 1ASYA 1R8OB 2DM1A 3GOXA 4HCZA 1VQOA 1G8XA 1M2VA 1MMGA 1G5HA 2ED1A 3CCQT 1PRMC 2Q7GA 1W2BS 2CZ1B 1C0MA 4F14A 2KGTA 2JS0A 1KC8C 2WSFE 1E6HA 3S3NA 2Y4YA 3LX7A 4DPGA 5EG2A 1TOVA 3R6NA 1NJ1A 3VS2A 3CCVT 4M77G 4R0KA 5I2MA 4A4HA 2FZCB 2KROA 1ZSZC 3J80E 1D0XA 3EHQA 2DMOA 5DLQE 3ICAA 2JTFA 5GAMh 4LNSA 2KXDA 3A8OB 4J9DA 1I8FA 2M1HA 3VS3A 8AT1B 2OTJQ 2DJZA 3E9GA 1HYOA 2QDLA 1UEBA 4J9GA 4J6WA 2DRKA 1GCQA 2KXCA 3JCMe 4PFOA 2FHDA 2CP6A 1B76A 2RMOA 4ELZC 4DA4A 3A7RA 1WJQA 1VQLT 3M0PA 4XK8E 2YRDA 4BB7A 3JB9G 2CH4W 1EZZB 2OJ2A 3JSCA 1WHMA 1PD1A 2E5QA 4C8QA 1QW1A 3CMEA 3VS7A 4PNOA 4HVUA 4OP0A 3QSUA 1ZBJA 3TREA 5CKBA 4M4ZA 4LVJA 2KVQG 1UGVA 4B9WA 4UP9A 2D9TA 1K9MU 1K76A 2EQKA 4X5OA 1NYFA 3FJPA 4CC7A 3HHTB 5GANj 2HL5C 4C5EA 3HXVA 3IALA 2X4XA 2LX9A 1AWOA 2X3WD 3PNWC 1H92A 1X56A 1S72Q 4JJDA 1M1KR 4IUVA 3PZCA 3UT1A 3CPFA 3S3MA 2ZCFB 4IUPA 4FIBA 1VQPA 2YUQA 3CCRT 2RQWA 4M7DE 3THKA 2EYYA 3TCJA 1N27A 1SPKA 5CIUA 1XOVA 3VS1A 4KUIA 4ZGJB 2G3RA 4OLFA 1NJ8A 3LH5A 1MMDA 2SEMA 2YLBA 2X4JA 4LVKA 2RQTA 1K4US 3QYGB 4FW2A 3RKWA 4B6MA 3EG3A 2HMAA 3RACA 1PCXA 4J83A 3JAME 4P74A 4CH6A 1NEGA 1G5VA 1QCNA 2DFUA 1EVLA 2HKQB 3CC2T 1NLOC 3OMGA 1ZSGA 1UJYA 5IHIA 1TWBA 2DTIA 1VUBA 1VQ8A 2ZR2A 1U06A 5C53B 1SESA 1MUZA 1Q95G 4TVWA 3WXMB 4HWPA 1D3BA 1VQNQ 4F7UF 4RTYA 4M7DG 2L89A 4ZNXA 4AFSC 4QW2A 2CJ9A 4MZPA 5K1XA 2QHSA 2CZ6B 1E1TA 1VQ9A 1Z7NA 2EJGA 3QWYA 3BDLA 3CCJA 2IY5A 4CRIA 4CC3A 1UHCA 2AKLA 3EGUA 4CS3A 4BACA 1M1KC 1OOTA 1WPYA 2FPEA 3SD4A 4JRIA 4ZGDB 1G3TA 4L6V5 1T3LA 3ZL7C 4PJOD 4YROA 4ZN1A 5LJ5e 2HCKA 2PU9B 4J6XA 4J7FA 2CDTA 1R0BG 3JCMc 3VS4A 4HVWA 3L1AA 5A2QE 2H3EB 5CR2A 3CMAA 1YFRA 3EFRA 2C0OA 1VOMA 5FRMA 1ADYA 2ZZEA 1RUWA 2OTJT 2E12A 2KT8A 4FM4B 2DA9A 4M75F 2V26A 4JJBA 4A4EA 1VQ5Q 3CXCS 4HA8A 1GCQC 4Z02A 4IUUA 2JZ2A 2KRMA 5KYWB 2LJ1A 4HWRA 1N8RR 4LDWA 2XHCA 3C95A 3JCMf 4KQEA 3NPFA 5LJ5d 1NJ2A 3EAEA 4FT4A 4M77A 2GFAA 5F5WA 2DQ0A 2ZNJA 2AZVA 5GAMd 4C8QC 5HK0A 2O9SA 1RACB 5CK9A 3HPWA 1E22A 1QE0A 2PTKA 3TEHB 1SKUB 2XG8D 5IHNA 1YITQ 3LC0A 2AMCA 2P0PA 3HTZA 1N9RA 4HT4A 4IURA 1M4ZA 1G83A 5LL6S 3HXZA 2E3HA 2LTOA 2A36A 4LDYA 1BYMA 3KUFA 3M53A 4GLKA 2PVDB 1OZ3A 3OA6A 1OU9A 2RHSA 4EMKA 1S72T 1WQ7A 1JJ2S 4J9FA 4A4GA 1QKXA 4H2XA 5GAN2 2DX1A 3HXUA 1NG2A 1X6OA 1JJCB 4O6JA 3OYIA 2QEXQ 5HKCA 11ASA 4LE9A 3LGFA 4QVZA 2L3RA 2MI6A 2R58A 4AFUC 4MZMA 1V29B 1O75A 4G85A 5IAYA 1BI3A 2ESWA 5GAN7 4DOVA 3CCLT 3G1JA 5IHKA 2HZYA 3H0HA 4BE2A 5CO7A 2XDDA 3CCVA 1D0YA 2E6ZA 1YNZA 3PVLA 1YJWA 4P74C 2VGNA 4J9HA 3OBYA 3LW5E 2YT6A 3CCSQ 4J15A 1ZUKA 3M58A 3QWXX 3PIOA 1YB3A 2HEQA 2ARTA 2BZYA 4AH6A 3OYKA 5GAMg 2R5AA 2CUDA 1D09B 3FB9A 1TTHB 3HFZB 4LXCA 4P3OA 1ASZA 1H4SA 1VQNT 1NPPA 4YPFA 1I81A 4E7JA 2EQUA 3EGXB 4BD3A 2K9GA 2AKWA 3JCMQ 1RAGB 1WNLA 1EFNA 4PJOE 3MF2A 1U5SA 1NE8A 2E6NA 1I07A 4C0FA 5D7UA 4P72C 2VXEA 3PIPA 4N4HA 2ECZA 1X27A 2HBWA 2K79A 2HAXA 3MCAB 2YUOA 1SEMA 3LWIA 3ASKA 1G3SA 3PMTA 4M7AB 2JTMA 3E9HA 2ZNIA 1VQMQ 4JLIA 2I2LA 2AHJB 2DETA 3HXYA 2ABLA 1IRXA 2FB7A 3M0SA 3OS5A 1D1BA 4Q15A 2KSSA 1ZSZB 1ZLMA 1TUGB 2XDBA 2WSCE 1HXDA 3ME9A 2EJ9A 4O5VA 4Z89A 1ARKA 4M7DA 1KSWA 4YRMA 2EFIA 3LGLA 2RHQB
chains in the Genus database with same CATH topology
5GANe 1OYXA 1BBWA 4E51A 1VQ5T 3LYIA 2DPPB 2BUDA 1SRYA 4FSXA 2OAUA 2ZT6A 3CPWS 4P3NA 4E7IA 3PGGA 2FYKA 3QXEB 4KULA 3RKYA 4H02A 4QVCA 4M77C 1YJNT 1BI1A 4BI8B 1Y96B 3A5ZB 5FRNA 3HXXA 3CCUA 2A7YA 4P71A 1X01A 5GANd 4BDZA 3OYLA 3X28B 3S6WA 2K2VA 1KD1U 3C4SA 2Y4XA 3UPUA 1WJSA 2DZCA 4JDSA 2DZ9A 4EMKC 1X2HA 3W3SA 2ZR3A 2QEXT 2MWPA 1H3ZA 3NENA 4H2YA 4TTVA 5GMKi 4FT2A 2DTHA 3GLXA 5CCAA 4ZGEB 1B34B 4OB2B 3NFCA 4H2UA 4C0ZA 4M7DF 4F7UG 3MEWA 1PSFA 3VUZA 3CCST 1VQ6A 2RK1A 3JRZA 4IUTA 1BBUA 5D6WA 3G6ET 2F69A 5CAIA 3G4SA 4WI1A 3V7CA 1HK9A 4LDXA 2XU8A 2DU5A 1UGRB 3VKIA 5GMKh 3QYHB 1NYQA 4HT9A 4G84A 2Q7HA 1NJ6A 2C7IA 3QO3A 2XICA 4X9DA 4ZTFA 1Q7YC 2A8EA 1P92A 2BIVA 4JJNK 4XQ3A 1EFWA 1NYRA 5D6XA 4QQGA 4PLIA 3L2VA 3E9IA 3WVDB 2XK0A 1VQMT 4M75G 3ZEHA 3JCMh 4HT8A 3KBGA 3I56A 5GAMj 1VIFA 4Q5WA 4EMGA 3VUBA 3OYCA 4PL6A 2L5QA 1BKBA 4M7DC 3JCMP 1K73U 4P5NA 4A4FA 2QTXA 3ERRA 3RL6A 3FRNA 5GANf 3M55A 5GAOm 3OS0A 4YRCA 4HKEA 2MWOA 1M90C 4EMHA 3QNEA 2DD4A 4DQ2A 4M7AF 1H4QA 2XI9A 3CCMT 1YIJT 2ARUA 5GAN6 2VGMA 4BI4A 3HRUA 3OYHA 1QP3A 4C8QB 1VQKA 5I2SA 1EVKA 3OY9A 4H2SA 2RHUA 1QVFS 3LH0A 3UWNA 2VC8A 2LQKA 2RHXA 4PLLA 4YREA 1H4VB 4BE1A 1XQHA 1C0AA 4LD6A 2ZZDA 4EDUA 2LT4A 2E65A 3A8HB 2ZGWA 3M57A 1Q82U 3N5BB 3BW1A 1BI2A 4NCXA 4CS2A 1ZBXA 1HTTA 2VV5A 1Q81C 1XTDA 4K86A 4Q6GA 4RDXA 4J7IA 3VYHB 4IKFA 5CQYA 3VV0A 2RI5A 3C12A 2P0QA 4V2SA 3NETA 3JCMV 1KQSS 2CS7A 2HQXA 4XTYA 1J5WA 2XD0A 3FC3A 1D3BB 3RIRA 4N4GA 3X26B 3A7AA 2MF2A 4HWOA 4E7KA 1ZQ1A 5KNNA 4F7UA 1X54A 3LWHA 2QQ9A 2IY5B 4PJOF 2DK3A 3L2ZA 3A5YA 3M56A 3A32A 3JCMX 3OYNA 2RJEA 4M7AD 1YITA 3G71T 3OB9A 2I4MA 3RKXA 3CEYA 1I5LA 2ZIMA 5LJ3h 4N0AC 3P8TA 2KQWA 2DDZA 1VQZA 4OMFB 3KXTA 3S3OA 1WQWA 3QPHA 3OYYA 4ELYC 1OZ2A 3P8YA 2GQVA 2JN0A 4M75A 3V8LA 3CC7A 1UB4A 2CJBA 2K5LA 3X25B 1YI2T 1B7YB 3HRKA 5KCHA 1VQ7A 3GPLA 3CCSA 4YRPA 1YHQA 4XU2A 1KQ1A 4E47A 2OTLA 4EO4A 4B9XA 4CS4A 2AMCB 4YRNA 3MQZA 3PCOB 2HNIA 2MMPA 3R6OA 2LDMA 2MAMA 2I4OA 3L4GB 3P8BB 2VUBA 2RHZA 4LDUA 4YRSA 4XAXB 2DKGA 1YJ9T 1NJIU 2RHSB 4OVAA 1X55A 2XIDA 1E1OA 1EIYA 4H2XB 4HWSA 1BI0A 4BI3A 3EFSA 4P72A 3QUIA 1QVGA 12ASA 2LCCA 1UGPB 2E10A 3VU3C 2K3YA 4BY6B 3L2QA 3M4PA 4BUGA 3FIFA 3HY0A 2RH2A 3SDZA 3RUXA 3MP6A 1OI1A 3SWNA 2E1HA 5GAMe 3I55A 1KC8U 3CCEA 1H641 2WACA 3QG1A 3L2UA 4OB1B 4H2TA 2VYTA 3QJ6A 3CC4T 2ZT5A 3L2WA 3HRSA 3RESA 4TQFA 1W4SA 3OSVA 5GAOp 1NJ5A 2EQMA 3DB4A 4M7AE 2I4NA 4M78B 4MMLA 3TEGA 2AKWB 3PFSA 2PUOB 3DSQA 5J26A 2CJAA 2DQ3A 2QQBA 2CYZB 2XKOC 3HRIA 3CCMA 5FU7B 2IVWA 2XDPA 3ER0A 1B70A 4K87A 1SSFA 1XNIA 4P73A 2DXCA 3VBBA 3OSSC 3L42A 3TEEA 4TWAA 4M7AG 3OW2A 1VQ4T 2C06A 4YRFA 2VXFA 1EQRA 2DEQA 2IG0A 4C0DC 1EIFA 3P8DA 4MDWA 3CCQA 3NTIA 4C0GA 4VUBA 4M75C 2RD1A 2V8IA 3OYEA 3CD6T 3QJYA 3FEOA 4Y91A 2QXFA 3VYGA 1TH7A 2KY9A 3A74A 1N8RC 4C92B 5K1PA 3J7AF 2RHYA 5E3IA 1EOVA 3VQWA 2DVEA 2PMEA 4LVIA 2H3JA 5FU6B 5FLXE 3BDUA 2QA4T 3RMSA 2DXUA 3DKMA 2J3MA 2Q7EA 1KMMA 5HGQA 1LJOA 1VQLA 4L87A 2KDSA 4XTZA 1WYDA 3R07A 1YCYA 5IN1A 2FVUA 3QO7A 2ODRC 2ALYA 2ZTGA 4MZTA 2B8AA 1W2BA 4L59A 4YCVA 3M54A 1NNHA 3HL8A 5ELOA 3SWNC 1FX7A 4MDXA 4EPCA 2DIGA 1M1KU 5LJ5f 3C94A 5GAN5 3H8ZA 2QHUA 5GAN3 2PMFA 5LJ3g 5GAMf 5L8RE 3UFGA 5GMKj 4PJOG 3JB9J 1USYA 4ZN3A 2V8JA 3V8JA 2Q5HA 3CCRA 2DTOA 1KG1A 4OF1A 2LT1A 3Q1JA 3QHSA 4P75A 4TVAB 4RMOA 4PG3A 3A8MB 2RB6A 1JJCA 1KOGA 4II1A 3VJPA 2JNGA 4YDQA 2GF7A 4RQEA 5KCOA 3CC2A 3M9QA 4P73C 5GMKm 4IUQA 2HBPA 4R56A 3JB9H 3CMET 4TQDA 4J5YA 3WVEB 1FWZA 3QKJA 1LOJA 2R57A 1IZ6A 5GMKl 4M78F 4WJ4A 4XTWA 1U8RA 2NS6A 2ZPIB 2ZCEA 4A54A 4YTLA 3L2RA 5KE3A 5M9OA 2K4YA 2D6FA 3DLLA 5CVIA 3A7UA 2BKDN 2QHVA 2PQWA 2L8DA 2LRQA 1VQPT 4YRJA 3QDRB 5GAOq 1G3WA 5J39A 4M7AA 3HFVA 2OTJA 3CBPA 2QQSA 1PYSB 2A3LA 1M8VA 4QQDA 2EIFA 4HCCA 3SB2A 3UGTA 3HXWA 2PVGB 2RHQA 2M9UA 3VQYA 3QZ5B 3BFMA 1VQ8T 2GCXA 2YLCA 2WSEE 3X24B 2CZ7B 2E41A 1G5IA 3RGLA 3PMIA 5HK3A 5DY9A 1VQ9T 4BWAA 3CCJT 4A53A 2P5IA 1IL2A 2Y90A 2P0LA 4OB0B 3RF1A 4N0AA 4RG8A 1K9MC 3LSSA 4E7LA 1WJRA 1S72A 2RI3A 2D0QB 2KMTA 1USYC 2ZPFB 3QIIA 4XEMA 3CMAT 2M16A 2YRVA 2RA2A 1K8AC 4TVRA 4M78D 1RIQA 4KR3A 4P75C 3HY1A 1GXIE 5DM7R 3CCLA 3M5AA 1WU7A 1KHCA 4F7UB 3OS2A 1U1SA 4L5GA 4C5HA 1B34A 2O4XA 5LJ3j 2ZXFA 3MP1A 2G4CA 4PJOA 4J6YA 2LC4A 5DLOA 1YBYA 2P0KA 3UDCA 1VQNA 4LVMA 1WGSA 5D6YA 4KUDK 4JS5A 5C52B 4YRTA 3P8VA 2O01E 3JCMW 4YRLA 3VQXA 1JJ2A 5ELNA 2HD0A 2F5KA 3CBMA 2CZ0B 2QDYB 4RG2A 4M75B 2HQEA 3LLRA 2I4LA 2C8MA 1N9WA 3HFNA 3V7RA 1KHIA 4QVDA 4C92D 4OGEA 3OQ5A 3GF5A 2F5TX 4D6WA 4M7AC 3QZ9B 3URGA 3P8HA 2M0OA 4CH5A 3MEUA 2X4YA 4PKCC 2EQJA 2CGHA 3MEAA 1WLEA 3M59A 1VQ5A 4RCBA 5GMKe 1YJWT 2ZPEB 5LJ5h 3QO8A 5C51B 2LVMA 2QQRA 1M1GA 2JVVA 1EIYB 2ZZFA 1YJNA 4X9CA 2E70A 3M4YA 1FXXA 4YCUA 1Q7YU 4JUVA 1YGBA 3INZA 4RMFA 1MGQA 3OYAA 3QTCA 3OMCA 4M78E 3SWNB 2DIQA 4UC4A 3MEYA 2QEXA 1JRIA 4JRPA 3UGQA 3JCMd 2E64A 3GP8A 2RJFA 2QI2A 2RJCA 3J81E 4Y28E 2K3XA 3FDRA 4BE0A 2EWNA 3CPWA 4M77B 1K8AU 1FYFA 3PT9A 1M90U 4JRQA 2XTIA 4M78G 1YFTA 1VIEA 4PJOC 3G6EA 2RJDA 4P3PA 3KFUA 2CIMA 1M9SA 1B70B 2ZT7A 1ATIA 3CCUT 3QO5A 2DXTA 2DAQA 4EMKB 2P4TA 3FLGA 2EYQA 4ME7A 3GIBA 3G7ZA 1I4K1 2CKKA 3M4QA 4C92E 3HP9A 1BIAA 3IKLA 1N6AA 2EAYA 4R55A 1UGQB 1VQMA 1SERA 1RI0A 3META 2K5IA 2ZZGA 2DXBA 1KMNA 2Q5IA 4C8QF 4BDYA 3JCMg 2K57A 3GNGA 3AHUA 2FL7A 2YHTA 4XU3A 3REUA 1Q81U 3CMQA 4OB3B 5CQXA 4XEOA 4J8OA 1KQ2A 3MHXA 4NS5A 4C92G 3NTKA 1VQ6T 2ZPBB 1L0WA 3QBYA 3MO8A 2LNVA 4WF2A 1LNXA 3G4ST 4PHCA 5GANh 4KT0E 4LDVA 1YIJA 1RL2A 4XTUA 4YRQA 1E24A 3IKMB 1ZHIA 5LJ3e 2ALYB 1B7YA 2JOYA 5CKHA 3JCMJ 4YCWA 5KE2A 5CKEA 3BY7A 1KD1C 4RQFA 2XGTA 3F70A 4NL3A 2ZPGB 1YFSA 2ZINA 5A0DA 2JUFA 4M7DB 4YRIA 5C0MA 1U1TA 4KR2A 4C5GA 3OS1A 3I56T 3PCOA 5J3BA 3A8GB 3L4GA 5IT9E 4ZTZB 4LVLA 5HY6A 1G51A 4H2WA 5LJ3d 3BJUA 1QVPA 4CH4A 4DOWA 1O9SA 4HVCA 1BIBA 1Z7MA 4C8QD 1Q86C 3RERA 4JRKA 1UGSB 2EJFA 3MEVA 1ADJA 4ZIBA 3OYJA 3G1ZA 1NZ9A 3E1SA 1QVFA 1VQKT 5LJ5g 4ZTJA 3E19A 4NOYA 5I21A 5GAOr 4FL6A 1B8AA 3LSQA 1DJ7B 4XU0A 3V8KA 4M78A 1G3YA 4M77F 5AYFA 4M75D 2E3CA 2DO3A 3G71A 4ATOA 2RO0A 3SFMA 3JB9I 4N4IA 1VQOT 2RK2A 2J3LA 3MP8A 2QHTA 2RHIA 3JCMb 3RMQA 4YRGA 1X75C 3TEHA 3HRTA 4CI0C 3HFOA 1K73C 5KH6A 4OGCA 4MMKA 1KQSA 2RM4A 4LD9K 3DLMA 1QF6A 2QQAA 3JB9F 1YI2A 2X35A 1GGMA 4RCCA 1W66A 3WQZA 5GAOn 2KAFA 1SETA 2KK4A 3CBOA 3V7SA 3IG2A 3OYGA 1M5Q1 2ODRD 2K5FA 3HKSA 3A31A 4X34A 5LJ3f 2GFUA 4C92A 5FROA 1AHJB 1YITT 1YJ9A 1H4TA 1N9SA 2NLUA 3GNFB 5C6SA 3HSBA 4E7HA 4A4KA 4F7UE 3ZFJA 3HFZA 2E5AA 4CH3A 2RI2A 4C8QE 3NELA 3OYFA 4C5IA 1Q82C 2ZPHB 1NPRA 5GAN4 1QVGS 1Y7XA 2ZIOA 4WJ3M 4XTXA 4M77D 3M4GA 4YRKA 4JLGA 2O4XB 4BY6C 3CC7T 1PSEA 2LQ8A 2ZT8A 1N8RU 4PJOB 3CC4A 4EX5A 4ZTUB 1VQ7T 2PVOB 1X2GA 3H6ZA 4RKUE 1YHQT 4M75E 1Q86U 4C8QG 2OTLT 2DU7A 4UPAA 3OYDA 4NL2A 1LYLA 3NEMA 3JB9D 4M78C 4QQ6A 4YRRA 5GANg 5CKDA 3I7FA 4C92F 2ARSA 1Y71A 3OD1A 4TVAA 1Y96A 3A5ZA 4HCBA 4YP0A 5FU7C 5A0LA 3UH0A 1VQ4A 5LJ5j 3REXA 4JS4A 4YYEA 4K88A 3OW2S 3ZBDA 4O2DA 3I55T 4HWTA 3A8LB 3CCET 2EKOA 4FU6A 1MHNA 3O8VA 5A0GA 3OYMA 3CXCA 3CD6A 4BW9A 3OBWA 1HC7A 1JB0E 1QP2A 1M1FA 2PUKB 4XTVA 3T9NA 3TU4K 2DD5A 2X4WA 5GAN8 3PTAA 2R5MA 3VQVA 5GAOl 4C92C 4P71C 4KBMB 4XU1A 3X20B 1JBMA 3DB3A 2QA4A 4H2VA 3TUPA 3OYBA 1IREB 3MF1A 4M7DD 1Y07A 2V8KA 2EL9A 1PYSA 1NJIC 5CKFA 4M77E 5FU6C 3E9FA 4C0DB 4UP7A 4UP8A 4TVYA 2LCLA 3NTHA 4GY5A 1ASYA 1R8OB 3GOXA 4HCZA 1VQOA 1G5HA 3CCQT 2Q7GA 1W2BS 2CZ1B 1KC8C 2WSFE 3S3NA 2Y4YA 3LX7A 4DPGA 5EG2A 1NJ1A 3CCVT 4M77G 4A4HA 5I2MA 3J80E 5DLQE 3ICAA 2JTFA 5GAMh 4LNSA 3A8OB 1I8FA 2M1HA 2DJZA 3E9GA 1UEBA 4J6WA 3JCMe 2FHDA 1B76A 4ELZC 4DA4A 3A7RA 1WJQA 1VQLT 4XK8E 4BB7A 3JB9G 3JSCA 2E5QA 4C8QA 1QW1A 3CMEA 4PNOA 4OP0A 3QSUA 3TREA 5CKBA 4LVJA 2KVQG 4B9WA 4UP9A 2D9TA 1K9MU 2EQKA 4X5OA 3FJPA 3HHTB 5GANj 4C5EA 3HXVA 3IALA 2X4XA 2LX9A 3PNWC 1X56A 4IUVA 3PZCA 3UT1A 3CPFA 3S3MA 2ZCFB 4IUPA 4FIBA 1VQPA 3CCRT 4M7DE 3TCJA 1N27A 5CIUA 1XOVA 4KUIA 4ZGJB 2G3RA 4OLFA 1NJ8A 2YLBA 2X4JA 4LVKA 3QYGB 3RKWA 3RACA 4J83A 3JAME 4P74A 4CH6A 1G5VA 1EVLA 3CC2T 3OMGA 2DTIA 1VUBA 1VQ8A 2ZR2A 5C53B 1SESA 4TVWA 3WXMB 4HWPA 1D3BA 4F7UF 4M7DG 2L89A 4QW2A 2CJ9A 4MZPA 5K1XA 2QHSA 2CZ6B 1E1TA 1VQ9A 1Z7NA 2EJGA 3CCJA 3BDLA 2IY5A 4CRIA 4CS3A 4BACA 1M1KC 1WPYA 3SD4A 4JRIA 4ZGDB 1G3TA 4L6V5 4PJOD 4YROA 4ZN1A 5LJ5e 2PU9B 4J6XA 4J7FA 3JCMc 3L1AA 5A2QE 5CR2A 3CMAA 1YFRA 3EFRA 5FRMA 1ADYA 2ZZEA 2OTJT 2E12A 4FM4B 4M75F 4A4EA 3CXCS 4HA8A 4Z02A 4IUUA 2JZ2A 4HWRA 4LDWA 2XHCA 3C95A 3JCMf 4KQEA 5LJ5d 1NJ2A 3EAEA 4FT4A 4M77A 2GFAA 5F5WA 2DQ0A 2ZNJA 5GAMd 4C8QC 5HK0A 5CK9A 3HPWA 1E22A 1QE0A 3TEHB 4HT4A 2XG8D 3LC0A 2AMCA 2P0PA 3HTZA 1N9RA 4IURA 1M4ZA 5LL6S 3HXZA 2LTOA 4LDYA 1BYMA 3KUFA 3M53A 4GLKA 2PVDB 1OZ3A 3OA6A 2RHSA 4EMKA 1S72T 1WQ7A 1JJ2S 4A4GA 4H2XA 5GAN2 3HXUA 1X6OA 1JJCB 4O6JA 3OYIA 11ASA 5HKCA 3LGFA 4QVZA 2L3RA 2MI6A 2R58A 4MZMA 1V29B 1O75A 4G85A 5IAYA 1BI3A 5GAN7 4DOVA 3CCLT 4BE2A 5CO7A 2XDDA 3CCVA 2E6ZA 1YJWA 4P74C 2VGNA 3OBYA 3LW5E 4J15A 3M58A 3PIOA 1YB3A 2ARTA 4AH6A 3OYKA 5GAMg 2R5AA 3HFZB 3FB9A 1ASZA 4P3OA 1H4SA 1VQNT 1NPPA 4YPFA 1I81A 4E7JA 2EQUA 4BD3A 2AKWA 3JCMQ 1WNLA 4PJOE 3MF2A 1NE8A 2E6NA 4C0FA 4P72C 2VXEA 3PIPA 4N4HA 2HAXA 3MCAB 3LWIA 3ASKA 1G3SA 3PMTA 4M7AB 2JTMA 3E9HA 2ZNIA 4JLIA 2I2LA 2AHJB 3HXYA 2FB7A 3OS5A 4Q15A 2KSSA 2XDBA 2WSCE 1HXDA 3ME9A 2EJ9A 4O5VA 4M7DA 4YRMA 2EFIA 3LGLA 2RHQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YGB A;  5GAN e;  3DSQ A;  2DQ3 A;  2CJA A;  1BBW A;  4YYE A;  3INZ A;  4E51 A;  4RMF A;  4K88 A;  1MGQ A;  3HRI A;  3QTC A;  4O2D A;  4M78 E;  4HWT A;  3SWN B;  1SRY A;  2ZT6 A;  4P3N A;  4BW9 A;  3PGG A;  2FYK A;  3RKY A;  3MEY A;  4H02 A;  4QVC A;  1B70 A;  4K87 A;  4M77 C;  1Y96 B;  4P73 A;  3VBB A;  1JRI A;  3HXX A;  1HC7 A;  4P71 A;  1X01 A;  3UGQ A;  4TWA A;  3JCM d;  4XTV A;  4M7A G;  4YRF A;  5GAN 8;  5GAN d;  2E64 A;  2VXF A;  3VQV A;  5GAO l;  1EQR A;  2DEQ A;  2EWN A;  4C92 C;  4P71 C;  4M77 B;  2DZC A;  1FYF A;  4XU1 A;  1JBM A;  2DZ9 A;  3TUP A;  4H2V A;  4M75 C;  4EMK C;  2XTI A;  4M78 G;  1YFT A;  1X2H A;  2RD1 A;  3W3S A;  3MF1 A;  4M7D D;  2ZR3 A;  4PJO C;  4Y91 A;  2EL9 A;  4P3P A;  3KFU A;  1PYS A;  2CIM A;  4M77 E;  1TH7 A;  1B70 B;  2ZT7 A;  3NEN A;  4H2Y A;  4TTV A;  1ATI A;  3A74 A;  3QO5 A;  5GMK i;  2DTH A;  2DXT A;  4C92 B;  4UP7 A;  4UP8 A;  1B34 B;  4TVY A;  5K1P A;  4EMK B;  5E3I A;  1EOV A;  1ASY A;  4H2U A;  3GIB A;  3VQW A;  2DVE A;  1I4K 1;  3M4Q A;  4C92 E;  2PME A;  4M7D F;  1G5H A;  4F7U G;  1BIA A;  3IKL A;  2Q7G A;  3BDU A;  2EAY A;  2DXU A;  1BBU A;  2J3M A;  1SER A;  2Q7E A;  2ZZG A;  4DPG A;  1KMM A;  1KMN A;  5HGQ A;  1LJO A;  2Q5I A;  4C8Q F;  5CAI A;  4WI1 A;  1NJ1 A;  3V7C A;  4L87 A;  4M77 G;  1HK9 A;  2DU5 A;  3JCM g;  4XTZ A;  2K57 A;  1WYD A;  5GMK h;  3AHU A;  1NYQ A;  3R07 A;  1YCY A;  4HT9 A;  2YHT A;  4G84 A;  3ICA A;  2Q7H A;  3QO7 A;  5GAM h;  4XU3 A;  1NJ6 A;  3REU A;  2C7I A;  3QO3 A;  4LNS A;  2ODR C;  2ALY A;  4X9D A;  2ZTG A;  3CMQ A;  1I8F A;  4YCV A;  1NNH A;  4XEO A;  1KQ2 A;  2DJZ A;  4XQ3 A;  5ELO A;  3SWN C;  1EFW A;  4C92 G;  5LJ5 f;  1NYR A;  5GAN 5;  4J6W A;  2QHU A;  5GAN 3;  2PMF A;  5LJ3 g;  3E9I A;  1L0W A;  3JCM e;  4M75 G;  5GAM f;  1B76 A;  3UFG A;  5GMK j;  3JCM h;  4PJO G;  4HT8 A;  3JB9 J;  3A7R A;  4WF2 A;  1LNX A;  5GAM j;  4PHC A;  5GAN h;  1USY A;  4EMG A;  4YRQ A;  4XTU A;  3JB9 G;  3V8J A;  2Q5H A;  4C8Q A;  4M7D C;  2DTO A;  3JCM P;  4PNO A;  2QTX A;  4OP0 A;  1E24 A;  3QSU A;  3IKM B;  5LJ3 e;  2ALY B;  4ZTU B;  3QHS A;  3ERR A;  4P75 A;  1B7Y A;  4TVA B;  3RL6 A;  4PG3 A;  2RB6 A;  1JJC A;  1KOG A;  3JCM J;  4YCW A;  5GAN f;  5GAO m;  4UP9 A;  4YDQ A;  4RQE A;  4YRC A;  3BY7 A;  4X5O A;  4RQF A;  2XGT A;  3FJP A;  4NL3 A;  5GAN j;  1YFS A;  3HXV A;  2ZIN A;  3IAL A;  4YRI A;  4M7D B;  1U1T A;  4EMH A;  3QNE A;  4KR2 A;  1X56 A;  4DQ2 A;  4P73 C;  4M7A F;  3PZC A;  1H4Q A;  5GMK m;  3PCO A;  2ARU A;  3L4G A;  5GAN 6;  4ZTZ B;  3JB9 H;  4M7D E;  4TQD A;  4J5Y A;  4C8Q B;  1G51 A;  4H2W A;  5LJ3 d;  3BJU A;  4CH4 A;  1LOJ A;  4OLF A;  1EVK A;  1NJ8 A;  5GMK l;  4H2S A;  4HVC A;  2YLB A;  1BIB A;  4M78 F;  4WJ4 A;  3RKW A;  4XTW A;  2VC8 A;  3RAC A;  2ZCE A;  4A54 A;  4P74 A;  4CH6 A;  1Z7M A;  4C8Q D;  1EVL A;  4YRE A;  1H4V B;  3RER A;  4JRK A;  2EJF A;  1C0A A;  3A7U A;  1ADJ A;  2QHV A;  4ZIB A;  2E65 A;  3G1Z A;  2DTI A;  2ZGW A;  2ZR2 A;  5C53 B;  1SES A;  4YRJ A;  5GAO q;  4TVW A;  3BW1 A;  4HWP A;  1D3B A;  4M7A A;  3HFV A;  4F7U F;  5LJ5 g;  4M7D G;  4NCX A;  4CS2 A;  1PYS B;  4NOY A;  5I21 A;  2CJ9 A;  5GAO r;  5K1X A;  1HTT A;  2QHS A;  1E1T A;  1M8V A;  1Z7N A;  2EJG A;  3SB2 A;  2IY5 A;  1B8A A;  3LSQ A;  4K86 A;  4Q6G A;  4RDX A;  4XU0 A;  3UGT A;  3V8K A;  3HXW A;  4CS3 A;  4M78 A;  4M77 F;  4M75 D;  2E3C A;  1WPY A;  4JRI A;  2RHQ A;  4V2S A;  3JB9 I;  3VQY A;  3NET A;  4PJO D;  3JCM V;  4YRO A;  5LJ5 e;  4J6X A;  2J3L A;  3JCM c;  3L1A A;  3BFM A;  2QHT A;  2YLC A;  1YFR A;  4XTY A;  3EFR A;  3JCM b;  1ADY A;  1J5W A;  2ZZE A;  4YRG A;  1D3B B;  3TEH A;  3RIR A;  3A7A A;  3HFO A;  2E41 A;  1G5I A;  4HWO A;  3RGL A;  4M75 F;  5DY9 A;  5KNN A;  4BWA A;  4MMK A;  4F7U A;  4A53 A;  2P5I A;  1X54 A;  1IL2 A;  4HA8 A;  2Y90 A;  2IY5 B;  4PJO F;  2RM4 A;  2P0L A;  3L2Z A;  3A5Y A;  3RF1 A;  3A32 A;  3JCM X;  4N0A A;  4M7A D;  4HWR A;  1QF6 A;  3LSS A;  3JB9 F;  1GGM A;  4RCC A;  3JCM f;  1W66 A;  4KQE A;  2I4M A;  5LJ5 d;  3WQZ A;  3RKX A;  1NJ2 A;  1I5L A;  5GAO n;  1USY C;  5LJ3 h;  2ZIM A;  1SET A;  4M77 A;  4XEM A;  5F5W A;  2DQ0 A;  2ZNJ A;  5GAM d;  4C8Q C;  4N0A C;  2RA2 A;  3P8T A;  4M78 D;  2DDZ A;  1RIQ A;  1E22 A;  1QE0 A;  1VQZ A;  4KR3 A;  3V7S A;  4P75 C;  3HY1 A;  3TEH B;  3LC0 A;  2AMC A;  3HTZ A;  1N9R A;  3IG2 A;  1WQW A;  1M5Q 1;  2ODR D;  1WU7 A;  3HXZ A;  3A31 A;  5LJ3 f;  4F7U B;  4C92 A;  1U1S A;  3P8Y A;  1B34 A;  5LJ3 j;  2RHS A;  2ZXF A;  2JN0 A;  4M75 A;  1N9S A;  4EMK A;  3V8L A;  1H4T A;  2CJB A;  1WQ7 A;  2G4C A;  4PJO A;  3HSB A;  1B7Y B;  3HRK A;  5GAN 2;  4H2X A;  3HXU A;  4F7U E;  4J6Y A;  1JJC B;  3HFZ A;  2E5A A;  4CH3 A;  11AS A;  4C8Q E;  4YRP A;  3NEL A;  4XU2 A;  1KQ1 A;  4G85 A;  4EO4 A;  5GAN 4;  5GAN 7;  4CS4 A;  5C52 B;  2AMC B;  2ZIO A;  4YRN A;  4YRT A;  3P8V A;  4WJ3 M;  3JCM W;  4YRL A;  4XTX A;  3VQX A;  4M77 D;  3PCO B;  2HNI A;  3M4G A;  4P74 C;  2I4O A;  4YRK A;  5ELN A;  3L4G B;  4YRS A;  2DKG A;  2RHS B;  4J15 A;  4M75 B;  1X55 A;  1YB3 A;  1E1O A;  2ZT8 A;  2ART A;  1EIY A;  4AH6 A;  2I4L A;  4PJO B;  4H2X B;  4HWS A;  5GAM g;  2C8M A;  4EX5 A;  3EFS A;  1N9W A;  4P72 A;  3HFN A;  3V7R A;  3FB9 A;  4QVD A;  3HFZ B;  4C92 D;  4P3O A;  3QUI A;  12AS A;  1X2G A;  1ASZ A;  1H4S A;  4M7A C;  4M75 E;  4C8Q G;  1I81 A;  4YPF A;  2E10 A;  3VU3 C;  4CH5 A;  2AKW A;  3JCM Q;  1WNL A;  2DU7 A;  4PJO E;  3MF2 A;  2CGH A;  4UPA A;  3M4P A;  3FIF A;  1WLE A;  3HY0 A;  4P72 C;  4NL2 A;  2VXE A;  4RCB A;  5GMK e;  1LYL A;  3RUX A;  5LJ5 h;  3QO8 A;  3NEM A;  3JB9 D;  3SWN A;  2E1H A;  5GAM e;  5C51 B;  4M78 C;  4YRR A;  1H64 1;  5GAN g;  4M7A B;  3I7F A;  4C92 F;  2ARS A;  3E9H A;  2ZNI A;  3OD1 A;  4JLI A;  4H2T A;  2I2L A;  4TVA A;  1EIY B;  2ZZF A;  2ZT5 A;  1Y96 A;  3A5Z A;  3HXY A;  4X9C A;  3RES A;  4TQF A;  4YP0 A;  5GAO p;  2FB7 A;  1NJ5 A;  4M7A E;  2I4N A;  4Q15 A;  4YCU A;  4M78 B;  4JUV A;  1HXD A;  2EJ9 A;  4MML A;  3TEG A;  2AKW B;  3UH0 A;  5LJ5 j;  4M7D A;  4YRM A;  2RHQ B;  3REX A; 
#chains in the Genus database with same CATH topology
 5GAN e;  1OYX A;  5GJW B;  1BBW A;  4E51 A;  1VQ5 T;  1HD3 A;  3LYI A;  2DPP B;  2DRM A;  1KJW A;  2BUD A;  1SRY A;  4FSX A;  4WTO B;  1OPK A;  2OAU A;  2ZT6 A;  4PJN A;  3UA7 A;  3CPW S;  4P3N A;  1LPL A;  4E7I A;  3PGG A;  2FYK A;  3QXE B;  4KUL A;  3RKY A;  2L2P A;  4H02 A;  4QVC A;  4M77 C;  1YJN T;  1BI1 A;  4BI8 B;  1E6G A;  1Y96 B;  3A5Z B;  2EGA A;  3I9Q A;  2QAS A;  5FRN A;  3HXX A;  3CCU A;  2A7Y A;  4P71 A;  1X01 A;  3M0T A;  1JXO A;  1M3B A;  3CCM Q;  1YIJ Q;  2GGR A;  2COZ A;  3EG0 A;  5GAN d;  4BDZ A;  3OYL A;  2GNC A;  3X28 B;  1ZUU A;  3S6W A;  1TS9 A;  2K2V A;  1KD1 U;  3C4S A;  2Y4X A;  3UPU A;  1WJS A;  2P84 A;  2DZC A;  4JDS A;  5KYX A;  1NM7 A;  2DZ9 A;  1Q7Y R;  1JXM A;  3RR6 A;  4EMK C;  2FEI A;  4E6R A;  1X2H A;  3W3S A;  2ZR3 A;  1PRL C;  2Z0W A;  2QEX T;  3TSW A;  1ABQ A;  2MWP A;  1H3Z A;  3NEN A;  4H2Y A;  4TTV A;  5GMK i;  4FT2 A;  2DTH A;  3QDF A;  3GLX A;  5CCA A;  3CCQ Q;  4ZGE B;  2LQN A;  1Z9Z A;  4E7S A;  1B34 B;  4OB2 B;  3NFC A;  4H2U A;  5FWC A;  4C0Z A;  5KYU A;  1B7T A;  2KR3 A;  4M7D F;  2M51 A;  4F7U G;  3MEW A;  1WDX A;  1PSF A;  1S1N A;  4JJC A;  3VUZ A;  3CCS T;  1VQ6 A;  2RK1 A;  3JRZ A;  1OU8 A;  4IUT A;  1BBU A;  5D6W A;  3SEM A;  3G6E T;  2F69 A;  4RUG A;  5FWB A;  2FZK B;  2V1Q A;  1K8A R;  5CAI A;  3G4S A;  4WI1 A;  3V7C A;  1GBR A;  1HK9 A;  1M90 R;  4LDX A;  2XU8 A;  2DU5 A;  1UGR B;  3VKI A;  5GMK h;  3QYH B;  1NYQ A;  4HT9 A;  1TU0 B;  4G84 A;  2Q7H A;  1XJW B;  1NJ6 A;  1U3O A;  4GLM A;  2C7I A;  3QO3 A;  3SHW A;  2XIC A;  1LCK A;  4X9D A;  1WHH A;  2J6F A;  4ZTF A;  1Q7Y C;  2A8E A;  3H9N A;  1P92 A;  2BIV A;  4JJN K;  4XQ3 A;  1M2V B;  1EFW A;  1MMN A;  1NYR A;  5D6X A;  4QQG A;  4PLI A;  4DBH A;  3L2V A;  3E9I A;  3WVD B;  2XK0 A;  1VQM T;  4M75 G;  1FYN A;  3ZEH A;  1H3H A;  3JCM h;  4HT8 A;  3KBG A;  1SRM A;  4OMP A;  3I56 A;  5GAM j;  1VIF A;  4Q5W A;  4FW1 A;  4EMG A;  3VUB A;  3OYC A;  3FJ5 A;  4PL6 A;  2L5Q A;  1BKB A;  4M7D C;  2KNB B;  1OX8 A;  3JCM P;  1K73 U;  1PWT A;  4P5N A;  4A4F A;  2QTX A;  2FPF A;  3ERR A;  7AT1 B;  3RL6 A;  1BCM A;  3FRN A;  3NGP A;  5GAN f;  3M55 A;  5GAO m;  3OS0 A;  3IQL A;  4YRC A;  4KGV B;  4HKE A;  2SRC A;  2EGC A;  1FMK A;  2MWO A;  2O2O A;  1M90 C;  4EMH A;  3QNE A;  2DD4 A;  4DQ2 A;  4LUE A;  1YI2 Q;  2CP5 A;  4M7A F;  1H4Q A;  2KYB A;  2XI9 A;  3CCM T;  1SG5 A;  1YIJ T;  2CP3 A;  2ARU A;  2JM8 A;  5GAN 6;  2VGM A;  4BI4 A;  3HRU A;  3OYH A;  1QP3 A;  2KYM A;  4C8Q B;  1VQK A;  2ENM A;  2EYZ A;  1BB9 A;  2M02 A;  5I2S A;  1EVK A;  3OY9 A;  4H2S A;  2RHU A;  1YN8 A;  2RQU A;  1QVF S;  3LH0 A;  3UWN A;  4D8D A;  2VC8 A;  2LQK A;  2DL4 A;  2RHX A;  4PLL A;  4YRE A;  1H4V B;  4BE1 A;  3JV3 A;  1YJ9 Q;  1XQH A;  1C0A A;  4LD6 A;  2ZZD A;  4EDU A;  2LT4 A;  2E65 A;  3A8H B;  2ZGW A;  3M57 A;  1CSK A;  4LUD A;  1Q82 U;  3N5B B;  3BW1 A;  1LVK A;  4RTU A;  1QMC A;  1OV3 A;  1BI2 A;  4NCX A;  4CS2 A;  1ZBX A;  5IXF A;  2DVJ A;  1HTT A;  2VV5 A;  1Q81 C;  4FSS A;  1XTD A;  4K86 A;  2CT3 A;  4Q6G A;  4RDX A;  4J7I A;  3VYH B;  4IKF A;  5CQY A;  4FYV B;  3VV0 A;  4F04 B;  2RI5 A;  3C12 A;  2P0Q A;  3OW2 P;  1X2Q A;  4V2S A;  3NET A;  3JCM V;  1KQS S;  2CS7 A;  2HQX A;  2AT1 B;  4X1V A;  4AT1 B;  3CC4 Q;  3O5Z A;  4XTY A;  1J5W A;  1AWX A;  2E4H A;  2XD0 A;  3FC3 A;  1D3B B;  1PNJ A;  3RIR A;  4N4G A;  3X26 B;  3A7A A;  5I22 A;  2MF2 A;  5I11 A;  4HWO A;  4E7K A;  3AT1 B;  1ZQ1 A;  3I5R A;  2OI3 A;  5KNN A;  1I1J A;  1SF9 A;  4F7U A;  1X54 A;  3LWH A;  2QQ9 A;  2IY5 B;  4PJO F;  2DK3 A;  3L2Z A;  3A5Y A;  3M56 A;  4RTT A;  3JCM X;  1OUL A;  3A32 A;  2K3B A;  2NYS A;  3OYN A;  2RJE A;  4M7A D;  1YIT A;  3I35 A;  1NLP C;  1BBZ A;  2AZS A;  1RLQ C;  1D0Z A;  3G71 T;  3OB9 A;  1I5O B;  2I4M A;  5L23 A;  3EG1 A;  3CEY A;  3RKX A;  1I5L A;  2KI7 A;  5IXB A;  5LJ3 h;  2ZIM A;  1AOJ A;  1OX9 A;  2P4R A;  3VS6 A;  4N0A C;  3P8T A;  2KQW A;  2DDZ A;  1VQZ A;  1QWF A;  4OMF B;  3KXT A;  3S3O A;  2MPX C;  1WQW A;  1ZX6 A;  1VQ4 Q;  3QPH A;  1R0C B;  1MNE A;  3OYY A;  1WHL A;  4Z8A A;  4D8K A;  4E7Z A;  4ELY C;  1YWP A;  1OZ2 A;  3P8Y A;  2GQV A;  2JN0 A;  4M75 A;  3V8L A;  3CC7 A;  1UB4 A;  2CJB A;  2K5L A;  1AD5 A;  3X25 B;  1YI2 T;  2NUT B;  3CD6 Q;  1W6X A;  1B7Y B;  1W2B P;  3HRK A;  3CCL Q;  1OPL A;  5KCH A;  1GFC A;  1IHW A;  1AZE A;  1WFW A;  1VQ7 A;  3U23 A;  1ZA2 B;  2DJQ A;  3GPL A;  3CCS A;  4YRP A;  2LCS A;  1YHQ A;  2CSI A;  4XU2 A;  8ATC B;  1KQ1 A;  4E47 A;  2OTL A;  4CC4 B;  4EO4 A;  4B9X A;  4CS4 A;  3M0U A;  2AMC B;  3EHR A;  4YRN A;  2VAS A;  3MQZ A;  1BCO A;  3PCO B;  2HNI A;  2MMP A;  3R6O A;  2LDM A;  1E7O A;  1PKT A;  2MAM A;  4J9B A;  2I4O A;  2FRW A;  3L4G B;  2HSP A;  3P8B B;  2VUB A;  2RHZ A;  2DL3 A;  4LDU A;  2COW A;  4YRS A;  4XAX B;  2DKG A;  2QA4 Q;  1YJ9 T;  1NJI U;  2RHS B;  4OVA A;  2NWM A;  1X55 A;  2XID A;  2O88 A;  1E1O A;  2W10 A;  1EIY A;  4H2X B;  4HWS A;  1BI0 A;  4BI3 A;  3EFS A;  4P72 A;  3QUI A;  1QVG A;  12AS A;  4Z88 A;  2D0N A;  2LCC A;  1UGP B;  2E10 A;  3VU3 C;  1M2O A;  2K3Y A;  4BY6 B;  3L2Q A;  2YUP A;  3ULR B;  3M4P A;  4BUG A;  3FIF A;  2ED0 A;  1KD1 R;  1Z9Q A;  3HY0 A;  2KRS A;  2RH2 A;  3SDZ A;  3RUX A;  4DBR A;  3MP6 A;  1OI1 A;  3EG9 A;  3SWN A;  2E1H A;  5GAM e;  3I55 A;  1KC8 U;  3CCE A;  1H64 1;  2WAC A;  3QG1 A;  3L2U A;  3MKD A;  4OB1 B;  4H2T A;  2VYT A;  3QJ6 A;  3CC4 T;  2ZT5 A;  2DEU A;  2IIM A;  3L2W A;  3HRS A;  3RES A;  2QGF B;  4TQF A;  1W4S A;  3OSV A;  5GAO p;  1NJ5 A;  2EQM A;  3DB4 A;  4M7A E;  1JU5 C;  2I4N A;  4M78 B;  3REB B;  4MML A;  1GCP A;  3TEG A;  2AKW B;  2YXY A;  3PFS A;  4FYW B;  2BE7 D;  2PUO B;  2EBP A;  3DSQ A;  2DL5 A;  3BE3 A;  5J26 A;  2CJA A;  2DQ3 A;  2QQB A;  1SSH A;  2CYZ B;  2XKO C;  3HRI A;  2DYI A;  4QT7 A;  1YJN Q;  1PG5 B;  2JW4 A;  1Q86 R;  1TUD A;  3CCM A;  3PE0 A;  5FU7 B;  2IVW A;  1AWW A;  2VVK A;  2XDP A;  2DIL A;  2W0Z A;  3ER0 A;  4AFZ C;  1B70 A;  4K87 A;  2J6O A;  1UG1 A;  1SSF A;  1XNI A;  2J05 A;  2DXC A;  4P73 A;  3VBB A;  3OSS C;  3L42 A;  2LJ0 A;  3TEE A;  4TWA A;  2F2X A;  4M7A G;  3OW2 A;  1VQ4 T;  2C06 A;  4YRF A;  1UEC A;  2X51 A;  3CME Q;  2VXF A;  2K6D A;  1EQR A;  2DEQ A;  2IG0 A;  4C0D C;  1EIF A;  3P8D A;  4MDW A;  3CCQ A;  3NTI A;  1WIE A;  4C0G A;  4PFP A;  4VUB A;  4M75 C;  2XMF A;  2RD1 A;  2V8I A;  3OYE A;  3CD6 T;  3QJY A;  3FEO A;  4Y91 A;  1HSQ A;  2BE9 B;  2DNU A;  2QXF A;  3VYG A;  1TH7 A;  2AKK A;  2A08 A;  2KY9 A;  3A74 A;  1RAI B;  1N8R C;  2HKN A;  4C92 B;  3CQT A;  5K1P A;  1VQP Q;  3J7A F;  2RHY A;  5E3I A;  1EOV A;  1ACM B;  3VQW A;  3G6E Q;  2DVE A;  2ATC B;  1GFD A;  1D1C A;  2PME A;  5KYY A;  2X3X D;  4LVI A;  2H3J A;  5FU6 B;  5FLX E;  1UJ0 A;  3BDU A;  5KYX B;  2QA4 T;  3RMS A;  2DXU A;  1B07 A;  3UA6 A;  3DKM A;  2J3M A;  2Q7E A;  4GBQ A;  1Y0M A;  3CXC P;  3KFV A;  1KMM A;  5HGQ A;  1LJO A;  1X6G A;  1VQL A;  4L87 A;  2GTO A;  2KDS A;  4XTZ A;  2M0Y A;  1WYD A;  2EW3 A;  3R07 A;  1VQ8 Q;  1YCY A;  3A98 A;  5IN1 A;  2FVU A;  3EFO B;  3QO7 A;  2ODR C;  2ALY A;  2ZTG A;  4MZT A;  2B8A A;  5ECA A;  1W2B A;  1WXB A;  2MYS A;  4L59 A;  4YCV A;  3M54 A;  3REA B;  5KYU B;  2E5K A;  1NNH A;  3HL8 A;  5ELO A;  3SWN C;  1FX7 A;  4MDX A;  4EPC A;  2DIG A;  1M1K U;  5LJ5 f;  3C94 A;  5GAN 5;  3H8Z A;  1VQ9 Q;  2QHU A;  3CCJ Q;  5GAN 3;  2PMF A;  5LJ3 g;  1WHG A;  5GAM f;  4OMM A;  2CP0 A;  2NUP A;  5L8R E;  3UFG A;  5GMK j;  4PJO G;  3JB9 J;  1SRL A;  2EQI A;  4ZN3 A;  2V8J A;  1USY A;  2QYZ A;  3V8J A;  1JJ2 P;  1UDL A;  2EYW A;  2Q5H A;  2D8J A;  3CCR A;  3CMA Q;  1NEB A;  2DTO A;  1KG1 A;  4OF1 A;  2LT1 A;  3Q1J A;  3QHS A;  4P75 A;  4AFQ C;  4TVA B;  4PJM A;  4RMO A;  4PG3 A;  1QCF A;  3A8M B;  2RB6 A;  1JJC A;  1KOG A;  1UUE A;  1RAE B;  2RF0 A;  4II1 A;  3VJP A;  2JNG A;  4YDQ A;  2GF7 A;  4RQE A;  3D7S B;  1UE9 A;  5KCO A;  1GL5 A;  3CC2 A;  2DBM A;  3M9Q A;  4P73 C;  5GMK m;  3VS0 A;  4IUQ A;  1UFF A;  1QCO A;  2HBP A;  4R56 A;  3JB9 H;  3CME T;  4PFZ A;  4J5Y A;  2QG9 B;  3UAT A;  3WVE B;  4DEX A;  1FWZ A;  1JO8 A;  4TQD A;  3QKJ A;  1LOJ A;  2R57 A;  1IZ6 A;  5GMK l;  4M78 F;  4WJ4 A;  4XTW A;  1U8R A;  2NS6 A;  1ZUY A;  2ZPI B;  2ZCE A;  2FO0 A;  4YTL A;  4A54 A;  3L2R A;  2YRC A;  5KE3 A;  5M9O A;  2K4Y A;  3NHN A;  2D6F A;  3M0R A;  3DLL A;  5CVI A;  1AEY A;  3A7U A;  2BKD N;  2BZ8 A;  2QHV A;  1K9M R;  2PQW A;  2L8D A;  2LRQ A;  2FRY A;  3EGD B;  1VQP T;  1MMA A;  4YRJ A;  3QDR B;  5GAO q;  1TXQ A;  2HQH A;  1G3W A;  3H41 A;  5J39 A;  4M7A A;  3HFV A;  1B3Q A;  2OTJ A;  3CBP A;  2QQS A;  3TVT A;  1PYS B;  1I0C A;  2A3L A;  4ANJ A;  1M8V A;  4QQD A;  2EIF A;  4HCC A;  3SB2 A;  3UGT A;  1YJW Q;  3HXW A;  4HXJ A;  2PVG B;  2RHQ A;  2M9U A;  1MND A;  2CP2 A;  3VQY A;  2VWF A;  3QZ5 B;  2GBQ A;  1X2K A;  3BFM A;  3CPW P;  2GCX A;  1VQ8 T;  1AVZ C;  1RAA B;  2YLC A;  2WSE E;  2F2V A;  3X24 B;  1M30 A;  2CZ7 B;  1JQQ A;  2YDL A;  2E41 A;  4HCK A;  1G5I A;  3G71 Q;  1V1C A;  3PMI A;  3RGL A;  5HK3 A;  5DY9 A;  1VQ9 T;  4BWA A;  3CCJ T;  4A53 A;  2P5I A;  1IL2 A;  2Y90 A;  4RTV A;  2P0L A;  4OB0 B;  3RF1 A;  2YWW A;  1YFN A;  4N0A A;  4RG8 A;  2YUN A;  1K9M C;  3LSS A;  4E7L A;  1WJR A;  1S72 A;  2RI3 A;  1FMW A;  2D0Q B;  2KMT A;  1H8K A;  2F2W A;  4OMQ A;  1USY C;  2ZPF B;  1KIK A;  3QII A;  4XEM A;  3CMA T;  2M16 A;  2YRV A;  2RA2 A;  1SHG A;  1K8A C;  1PHT A;  4TVR A;  4M78 D;  2EPD A;  3EH1 A;  1RIQ A;  4KR3 A;  1HJD A;  2KBT A;  4P75 C;  3HY1 A;  1GXI E;  5DM7 R;  3CCL A;  1BU1 A;  2CRE A;  3M5A A;  1R77 A;  9ATC B;  1WU7 A;  1KHC A;  1J3T A;  4KGZ B;  1KC8 R;  4F7U B;  3OS2 A;  1U1S A;  4L5G A;  4C5H A;  1B34 A;  2O4X A;  5LJ3 j;  2ZXF A;  3MP1 A;  2G4C A;  4PJO A;  2K7A A;  3RDV A;  4J6Y A;  1T0J A;  2LC4 A;  2COY A;  3GBQ A;  5DLO A;  1YBY A;  2P0K A;  3UDC A;  4LNP A;  1VQN A;  4LVM A;  1WGS A;  5D6Y A;  4KUD K;  2BZX A;  1W70 A;  2QAZ A;  4JS5 A;  5C52 B;  3PVQ A;  4YRT A;  3P8V A;  2O01 E;  3JCM W;  4YRL A;  3VQX A;  2J06 A;  1JJ2 A;  5ELN A;  2HD0 A;  2F5K A;  3MPU B;  3CBM A;  2CZ0 B;  2CT4 A;  2QDY B;  4RG2 A;  4M75 B;  2HQE A;  3LLR A;  1RI9 A;  2I4L A;  2C8M A;  1N9W A;  3UF4 A;  3HFN A;  3V7R A;  1KHI A;  4KH0 B;  4QVD A;  4C92 D;  4OGE A;  3OQ5 A;  2FPD A;  3GF5 A;  2F5T X;  4D6W A;  4M7A C;  3QZ9 B;  1PD0 A;  3URG A;  3P8H A;  2M0O A;  4CH5 A;  3MEU A;  2X4Y A;  1MV3 A;  4PKC C;  2EQJ A;  2CGH A;  2B86 A;  4FYY B;  3MEA A;  1WLE A;  3M59 A;  1YWO A;  1VA7 A;  1VQ5 A;  4RCB A;  5GMK e;  4PK4 A;  2ZPE B;  3EG2 A;  5LJ5 h;  1YJW T;  3QO8 A;  2DL8 A;  5C51 B;  2LVM A;  4ORZ A;  2QQR A;  2KE9 A;  1VQ6 Q;  3NMZ C;  1M1G A;  2JVV A;  2JTE A;  1TSF A;  1QKW A;  1EIY B;  2ZZF A;  1YJN A;  1NBE B;  4E2F B;  4X9C A;  3G4S Q;  2E70 A;  3M4Y A;  1FXX A;  4YCU A;  1K1Z A;  1Q7Y U;  4JUV A;  1V76 A;  1WXU A;  1YGB A;  2JMC A;  3EH2 A;  3INZ A;  4RMF A;  1M8M A;  1MGQ A;  1PKS A;  1T3S A;  3OYA A;  3QTC A;  3OMC A;  1SHF A;  4M78 E;  3EG9 B;  3SWN B;  1K0S A;  1A0N B;  2RQR A;  2DIQ A;  1IB8 A;  1QVF P;  2PZ1 A;  2HSE B;  4UC4 A;  3MEY A;  1VYT A;  2QEX A;  1JRI A;  2L0A A;  2ROT A;  3I56 Q;  4JRP A;  1F1B B;  3UGQ A;  1QWE A;  3JCM d;  2CUB A;  2IPO B;  2E64 A;  3GP8 A;  2RJF A;  2QI2 A;  2RJC A;  3A1P A;  4Y28 E;  3J81 E;  2DER A;  2K3X A;  3FDR A;  4BE0 A;  1AT1 B;  2EWN A;  3CPW A;  4M77 B;  1K8A U;  4KGX B;  4KH1 B;  1FYF A;  3PT9 A;  1M90 U;  4JRQ A;  2XTI A;  4M78 G;  2D1X A;  1YCS B;  1YFT A;  2EVR A;  2DF6 A;  1VIE A;  2FG0 A;  4A63 B;  4PJO C;  3G6E A;  1G2B A;  1QLY A;  2LMJ A;  2RJD A;  1D1A A;  4P3P A;  3KFU A;  1K0X A;  2CIM A;  1M9S A;  1B70 B;  2ZT7 A;  1ATI A;  3CCU T;  2LX7 A;  3QO5 A;  2DXT A;  4FCY A;  4CC2 A;  2DAQ A;  1KQS P;  4EMK B;  1UHF A;  1AWJ A;  3H0I A;  2P4T A;  3FLG A;  1VQK Q;  2EYQ A;  4ME7 A;  1RAF B;  3GIB A;  1FMV A;  2JMA A;  3G7Z A;  1I4K 1;  2CKK A;  3M4Q A;  1UTI A;  4C92 E;  3HP9 A;  1BIA A;  3IKL A;  4EIK A;  1N6A A;  2EAY A;  4R55 A;  1K9A A;  1WX6 A;  4AMC A;  1UGQ B;  1VQM A;  1SER A;  1RI0 A;  2EYX A;  2K5I A;  3MET A;  2ZZG A;  5HCK A;  2DXB A;  4K11 A;  1KMN A;  5IH2 A;  2Q5I A;  4C8Q F;  1YP5 A;  4BDY A;  2FZG B;  4JPB W;  2LZ6 B;  1VQO Q;  1PM3 A;  3JCM g;  2ZAE A;  2K57 A;  3GNG A;  3AHU A;  2FL7 A;  1JEG A;  2YHT A;  4XU3 A;  3REU A;  2X9H A;  2DYB A;  1Q81 U;  3CMQ A;  2MK5 A;  4OB3 B;  5CQX A;  4QKU A;  4XEO A;  4J8O A;  4AG2 C;  1KQ2 A;  1IHV A;  2HDA A;  3MHX A;  4NS5 A;  5KYY B;  4C92 G;  3NTK A;  1VQ6 T;  4KRT A;  4RTX A;  2ZPB B;  1L0W A;  2HL3 A;  3QBY A;  2EGE A;  3MO8 A;  1WHJ A;  2LNV A;  1VYV A;  4WF2 A;  1LNX A;  3G4S T;  4PHC A;  5GAN h;  4KT0 E;  4LDV A;  1GBQ A;  1YIJ A;  1RL2 A;  4XTU A;  4YRQ A;  2QTV A;  4J9E A;  4OMO A;  1E24 A;  3IKM B;  1ZHI A;  2CH4 A;  2DE0 X;  2NUT A;  5LJ3 e;  2ALY B;  1X6B A;  4PJJ A;  1B7Y A;  2JOY A;  5CKH A;  3JCM J;  4YCW A;  1WZO A;  1M3A A;  2AIR B;  5KE2 A;  5CKE A;  3BY7 A;  1M3C A;  1KD1 C;  4RQF A;  2XGT A;  4RTZ A;  3F70 A;  4NL3 A;  2ZPG B;  1YFS A;  2ZIN A;  1ZA1 B;  2JUF A;  1WHK A;  2L3P A;  2NUZ A;  2NUP B;  1U1T A;  5A0D A;  5C0M A;  4M7D B;  4YRI A;  1WXT A;  4DBQ A;  4C5G A;  4KR2 A;  2JJ9 A;  1N5Z A;  3OS1 A;  3I56 T;  3PCO A;  5J3B A;  3A8G B;  4JZ4 A;  3L4G A;  5FW9 A;  2MCN A;  5IT9 E;  4ZTZ B;  4LVL A;  2ROL A;  5HY6 A;  1G51 A;  4H2W A;  5LJ3 d;  3BJU A;  1QVP A;  4CH4 A;  4IIO A;  4DOW A;  1O9S A;  4HVC A;  4OMN A;  1BIB A;  2RPN A;  2E3I A;  3HTR A;  2C0T A;  4DEY A;  1K73 R;  1Z7M A;  4C8Q D;  2QGG A;  1OEB A;  1Q86 C;  3RER A;  4JRK A;  1UGS B;  2EJF A;  2I0N A;  3CC7 Q;  2MIO A;  3MEV A;  3E2U A;  1ADJ A;  4ZIB A;  2MOX A;  3OYJ A;  3G1Z A;  1NZ9 A;  3E1S A;  1VQ7 Q;  1QVF A;  1VQK T;  5AT1 B;  1YHQ Q;  5LJ5 g;  4ZTJ A;  3E19 A;  1CKB A;  5GJV B;  3TQ7 P;  2OTL Q;  2OAW A;  4NOY A;  5I21 A;  2GQI A;  5GAO r;  2L3S A;  1GRI A;  1RAH B;  1W1F A;  4FL6 A;  2J7I A;  1B8A A;  3LSQ A;  1C6V X;  1DJ7 B;  4XU0 A;  5KYW A;  3V8K A;  1RAD B;  2LP5 A;  1G3Y A;  4M78 A;  4M77 F;  5AYF A;  4M75 D;  2E3C A;  2V1R A;  2DO3 A;  3G71 A;  4ATO A;  2RO0 A;  3SFM A;  2JM9 A;  3JB9 I;  4N4I A;  1VQO T;  2DBK A;  2RK2 A;  4J9I A;  2KT1 A;  2J3L A;  3MP8 A;  4OML A;  2KEA A;  1C1A A;  2QHT A;  2RHI A;  3JCM b;  3RMQ A;  4YRG A;  3RBB B;  1X75 C;  3TEH A;  3HRT A;  2DLP A;  4CI0 C;  3HFO A;  4Y92 A;  1K73 C;  5KH6 A;  4OGC A;  1Q82 R;  2RQV A;  4MMK A;  1KQS A;  2RM4 A;  4LD9 K;  2A0F B;  1CKA A;  3DLM A;  3I55 Q;  1QF6 A;  2D8H A;  3CCE Q;  2QQA A;  2O9V A;  3JB9 F;  1YI2 A;  2X35 A;  1GGM A;  4RCC A;  1W66 A;  2KRN A;  3WQZ A;  1KK7 A;  4J9C A;  5GAO n;  2YSQ A;  2KAF A;  1SET A;  1NYG A;  2KK4 A;  1ABO A;  4WCI A;  3CBO A;  3VRZ A;  1EX4 A;  2C0I A;  3V7S A;  1BK2 A;  3OYG A;  3IG2 A;  1M5Q 1;  2ODR D;  2K5F A;  3HKS A;  3A31 A;  4X34 A;  4F16 A;  1AZG B;  5LJ3 f;  2GFU A;  4JZ3 A;  4C92 A;  5FRO A;  1AHJ B;  1YIT T;  1YJ9 A;  4HVV A;  1H4T A;  1N9S A;  2K2M A;  3MJX A;  2NLU A;  3GNF B;  5C6S A;  1RAB B;  1TG0 A;  3HSB A;  4E7H A;  4A4K A;  2O31 A;  4F7U E;  3ZFJ A;  3HFZ A;  1WI7 A;  2A37 A;  2E5A A;  3H0F A;  4CH3 A;  4RTW A;  2RN8 A;  2RI2 A;  1RLP C;  4C8Q E;  3NEL A;  3OYF A;  4C5I A;  2BTT A;  2OX7 A;  3EGX A;  1Q82 C;  2ZPH B;  1M27 C;  1NPR A;  1X69 A;  5GAN 4;  1QVG S;  1Y7X A;  2ZIO A;  1IGQ A;  1MV0 B;  4WJ3 M;  4XTX A;  4M77 D;  2L3Q A;  2CP7 A;  3M4G A;  2VKN A;  4YRK A;  1X43 A;  1KFZ A;  4JLG A;  2O4X B;  4BY6 C;  3EFO A;  3CC7 T;  2RNA A;  1PSE A;  2LQ8 A;  2ZT8 A;  1N8R U;  4PJO B;  3CC4 A;  4EX5 A;  4AG1 C;  4ZTU B;  1VQ7 T;  2PVO B;  1X2G A;  3H6Z A;  3CCV Q;  2JT4 A;  4RKU E;  1YHQ T;  1ZSZ A;  4DBF A;  4M75 E;  1Q86 U;  1IO6 A;  4C8Q G;  1WYX A;  2OTL T;  2DU7 A;  4UPA A;  2VB6 A;  3OYD A;  4NL2 A;  1IXD A;  1LYL A;  4IIM A;  1TUC A;  3NEM A;  3JB9 D;  4M78 C;  4QQ6 A;  4YRR A;  5GAN g;  5CKD A;  3I7F A;  4C92 F;  2A28 A;  3VS5 A;  2ARS A;  1Y71 A;  3OD1 A;  3M0Q A;  4TVA A;  2H8H A;  1QQJ A;  1Y96 A;  3A5Z A;  4HCB A;  2AK5 A;  4YP0 A;  5FU7 C;  1VQL Q;  1NJI R;  2GTJ A;  5A0L A;  3UH0 A;  1VQ4 A;  5LJ5 j;  2F1L A;  3REX A;  4JS4 A;  4YYE A;  4ESR A;  4K88 A;  3OW2 S;  3ZBD A;  4O2D A;  1T0H A;  3I55 T;  4HWT A;  3A8L B;  3CCE T;  2EKO A;  2LNH B;  4FU6 A;  5KYN A;  1MHN A;  1PC0 A;  3O8V A;  5A0G A;  3OYM A;  3CXC A;  3CD6 A;  4BW9 A;  1Y57 A;  3I5S A;  3C0C A;  3OBW A;  1HC7 A;  6AT1 B;  2LQW A;  5EC7 A;  1JB0 E;  1QP2 A;  1QVG P;  4F17 A;  1M1F A;  2PUK B;  2J6K A;  4XTV A;  3T9N A;  1VYU A;  1Q81 R;  3TU4 K;  2DD5 A;  2X4W A;  5GAN 8;  3CCR Q;  3PTA A;  2R5M A;  3VQV A;  5GAO l;  4C92 C;  4P71 C;  4KBM B;  3EGD A;  4XU1 A;  3X20 B;  4LN2 A;  1JBM A;  3DB3 A;  2QA4 A;  3CCU Q;  4H2V A;  3TUP A;  2DL7 A;  3OYB A;  1IRE B;  2LJ3 A;  2JS2 A;  3MF1 A;  4M7D D;  1Y07 A;  2V8K A;  1IGU A;  2EL9 A;  2CSQ A;  1PYS A;  1NJI C;  5CKF A;  2G6F X;  4M77 E;  3CC2 Q;  5FU6 C;  1WLP B;  2QK0 A;  4PJL A;  3TSZ A;  3E9F A;  4C0D B;  4FYX B;  1OQK A;  4UP7 A;  4UP8 A;  4TVY A;  2LCL A;  3NTH A;  3RNJ A;  3VRY A;  1WA7 A;  2PNI A;  2EKH A;  4GY5 A;  2JXB A;  1ASY A;  1R8O B;  2DM1 A;  3GOX A;  4HCZ A;  1VQO A;  1G8X A;  1M2V A;  1MMG A;  1G5H A;  2ED1 A;  3CCQ T;  1PRM C;  2Q7G A;  1W2B S;  2CZ1 B;  1C0M A;  4F14 A;  2KGT A;  2JS0 A;  1KC8 C;  2WSF E;  1E6H A;  3S3N A;  2Y4Y A;  3LX7 A;  4DPG A;  5EG2 A;  1TOV A;  3R6N A;  1NJ1 A;  3VS2 A;  3CCV T;  4M77 G;  4R0K A;  5I2M A;  4A4H A;  2FZC B;  2KRO A;  1ZSZ C;  3J80 E;  1D0X A;  3EHQ A;  2DMO A;  5DLQ E;  3ICA A;  2JTF A;  5GAM h;  4LNS A;  2KXD A;  3A8O B;  4J9D A;  1I8F A;  2M1H A;  3VS3 A;  8AT1 B;  2OTJ Q;  2DJZ A;  3E9G A;  1HYO A;  2QDL A;  1UEB A;  4J9G A;  4J6W A;  2DRK A;  1GCQ A;  2KXC A;  3JCM e;  4PFO A;  2FHD A;  2CP6 A;  1B76 A;  2RMO A;  4ELZ C;  4DA4 A;  3A7R A;  1WJQ A;  1VQL T;  3M0P A;  4XK8 E;  2YRD A;  4BB7 A;  3JB9 G;  2CH4 W;  1EZZ B;  2OJ2 A;  3JSC A;  1WHM A;  1PD1 A;  2E5Q A;  4C8Q A;  1QW1 A;  3CME A;  3VS7 A;  4PNO A;  4HVU A;  4OP0 A;  3QSU A;  1ZBJ A;  3TRE A;  5CKB A;  4M4Z A;  4LVJ A;  2KVQ G;  1UGV A;  4B9W A;  4UP9 A;  2D9T A;  1K9M U;  1K76 A;  2EQK A;  4X5O A;  1NYF A;  3FJP A;  4CC7 A;  3HHT B;  5GAN j;  2HL5 C;  4C5E A;  3HXV A;  3IAL A;  2X4X A;  2LX9 A;  1AWO A;  2X3W D;  3PNW C;  1H92 A;  1X56 A;  1S72 Q;  4JJD A;  1M1K R;  4IUV A;  3PZC A;  3UT1 A;  3CPF A;  3S3M A;  2ZCF B;  4IUP A;  4FIB A;  1VQP A;  2YUQ A;  3CCR T;  2RQW A;  4M7D E;  3THK A;  2EYY A;  3TCJ A;  1N27 A;  1SPK A;  5CIU A;  1XOV A;  3VS1 A;  4KUI A;  4ZGJ B;  2G3R A;  4OLF A;  1NJ8 A;  3LH5 A;  1MMD A;  2SEM A;  2YLB A;  2X4J A;  4LVK A;  2RQT A;  1K4U S;  3QYG B;  4FW2 A;  3RKW A;  4B6M A;  3EG3 A;  2HMA A;  3RAC A;  1PCX A;  4J83 A;  3JAM E;  4P74 A;  4CH6 A;  1NEG A;  1G5V A;  1QCN A;  2DFU A;  1EVL A;  2HKQ B;  3CC2 T;  1NLO C;  3OMG A;  1ZSG A;  1UJY A;  5IHI A;  1TWB A;  2DTI A;  1VUB A;  1VQ8 A;  2ZR2 A;  1U06 A;  5C53 B;  1SES A;  1MUZ A;  1Q95 G;  4TVW A;  3WXM B;  4HWP A;  1D3B A;  1VQN Q;  4F7U F;  4RTY A;  4M7D G;  2L89 A;  4ZNX A;  4AFS C;  4QW2 A;  2CJ9 A;  4MZP A;  5K1X A;  2QHS A;  2CZ6 B;  1E1T A;  1VQ9 A;  1Z7N A;  2EJG A;  3QWY A;  3BDL A;  3CCJ A;  2IY5 A;  4CRI A;  4CC3 A;  1UHC A;  2AKL A;  3EGU A;  4CS3 A;  4BAC A;  1M1K C;  1OOT A;  1WPY A;  2FPE A;  3SD4 A;  4JRI A;  4ZGD B;  1G3T A;  4L6V 5;  1T3L A;  3ZL7 C;  4PJO D;  4YRO A;  4ZN1 A;  5LJ5 e;  2HCK A;  2PU9 B;  4J6X A;  4J7F A;  2CDT A;  1R0B G;  3JCM c;  3VS4 A;  4HVW A;  3L1A A;  5A2Q E;  2H3E B;  5CR2 A;  3CMA A;  1YFR A;  3EFR A;  2C0O A;  1VOM A;  5FRM A;  1ADY A;  2ZZE A;  1RUW A;  2OTJ T;  2E12 A;  2KT8 A;  4FM4 B;  2DA9 A;  4M75 F;  2V26 A;  4JJB A;  4A4E A;  1VQ5 Q;  3CXC S;  4HA8 A;  1GCQ C;  4Z02 A;  4IUU A;  2JZ2 A;  2KRM A;  5KYW B;  2LJ1 A;  4HWR A;  1N8R R;  4LDW A;  2XHC A;  3C95 A;  3JCM f;  4KQE A;  3NPF A;  5LJ5 d;  1NJ2 A;  3EAE A;  4FT4 A;  4M77 A;  2GFA A;  5F5W A;  2DQ0 A;  2ZNJ A;  2AZV A;  5GAM d;  4C8Q C;  5HK0 A;  2O9S A;  1RAC B;  5CK9 A;  3HPW A;  1E22 A;  1QE0 A;  2PTK A;  3TEH B;  1SKU B;  2XG8 D;  5IHN A;  1YIT Q;  3LC0 A;  2AMC A;  2P0P A;  3HTZ A;  1N9R A;  4HT4 A;  4IUR A;  1M4Z A;  1G83 A;  5LL6 S;  3HXZ A;  2E3H A;  2LTO A;  2A36 A;  4LDY A;  1BYM A;  3KUF A;  3M53 A;  4GLK A;  2PVD B;  1OZ3 A;  3OA6 A;  1OU9 A;  2RHS A;  4EMK A;  1S72 T;  1WQ7 A;  1JJ2 S;  4J9F A;  4A4G A;  1QKX A;  4H2X A;  5GAN 2;  2DX1 A;  3HXU A;  1NG2 A;  1X6O A;  1JJC B;  4O6J A;  3OYI A;  2QEX Q;  5HKC A;  11AS A;  4LE9 A;  3LGF A;  4QVZ A;  2L3R A;  2MI6 A;  2R58 A;  4AFU C;  4MZM A;  1V29 B;  1O75 A;  4G85 A;  5IAY A;  1BI3 A;  2ESW A;  5GAN 7;  4DOV A;  3CCL T;  3G1J A;  5IHK A;  2HZY A;  3H0H A;  4BE2 A;  5CO7 A;  2XDD A;  3CCV A;  1D0Y A;  2E6Z A;  1YNZ A;  3PVL A;  1YJW A;  4P74 C;  2VGN A;  4J9H A;  3OBY A;  3LW5 E;  2YT6 A;  3CCS Q;  4J15 A;  1ZUK A;  3M58 A;  3QWX X;  3PIO A;  1YB3 A;  2HEQ A;  2ART A;  2BZY A;  4AH6 A;  3OYK A;  5GAM g;  2R5A A;  2CUD A;  1D09 B;  3FB9 A;  1TTH B;  3HFZ B;  4LXC A;  4P3O A;  1ASZ A;  1H4S A;  1VQN T;  1NPP A;  4YPF A;  1I81 A;  4E7J A;  2EQU A;  3EGX B;  4BD3 A;  2K9G A;  2AKW A;  3JCM Q;  1RAG B;  1WNL A;  1EFN A;  4PJO E;  3MF2 A;  1U5S A;  1NE8 A;  2E6N A;  1I07 A;  4C0F A;  5D7U A;  4P72 C;  2VXE A;  3PIP A;  4N4H A;  2ECZ A;  1X27 A;  2HBW A;  2K79 A;  2HAX A;  3MCA B;  2YUO A;  1SEM A;  3LWI A;  3ASK A;  1G3S A;  3PMT A;  4M7A B;  2JTM A;  3E9H A;  2ZNI A;  1VQM Q;  4JLI A;  2I2L A;  2AHJ B;  2DET A;  3HXY A;  2ABL A;  1IRX A;  2FB7 A;  3M0S A;  3OS5 A;  1D1B A;  4Q15 A;  2KSS A;  1ZSZ B;  1ZLM A;  1TUG B;  2XDB A;  2WSC E;  1HXD A;  3ME9 A;  2EJ9 A;  4O5V A;  4Z89 A;  1ARK A;  4M7D A;  1KSW A;  4YRM A;  2EFI A;  3LGL A;  2RHQ B; 
#chains in the Genus database with same CATH homology
 5GAN e;  1OYX A;  1BBW A;  4E51 A;  1VQ5 T;  3LYI A;  2DPP B;  2BUD A;  1SRY A;  4FSX A;  2OAU A;  2ZT6 A;  3CPW S;  4P3N A;  4E7I A;  3PGG A;  2FYK A;  3QXE B;  4KUL A;  3RKY A;  4H02 A;  4QVC A;  4M77 C;  1YJN T;  1BI1 A;  4BI8 B;  1Y96 B;  3A5Z B;  5FRN A;  3HXX A;  3CCU A;  2A7Y A;  4P71 A;  1X01 A;  5GAN d;  4BDZ A;  3OYL A;  3X28 B;  3S6W A;  2K2V A;  1KD1 U;  3C4S A;  2Y4X A;  3UPU A;  1WJS A;  2DZC A;  4JDS A;  2DZ9 A;  4EMK C;  1X2H A;  3W3S A;  2ZR3 A;  2QEX T;  2MWP A;  1H3Z A;  3NEN A;  4H2Y A;  4TTV A;  5GMK i;  4FT2 A;  2DTH A;  3GLX A;  5CCA A;  4ZGE B;  1B34 B;  4OB2 B;  3NFC A;  4H2U A;  4C0Z A;  4M7D F;  4F7U G;  3MEW A;  1PSF A;  3VUZ A;  3CCS T;  1VQ6 A;  2RK1 A;  3JRZ A;  4IUT A;  1BBU A;  5D6W A;  3G6E T;  2F69 A;  5CAI A;  3G4S A;  4WI1 A;  3V7C A;  1HK9 A;  4LDX A;  2XU8 A;  2DU5 A;  1UGR B;  3VKI A;  5GMK h;  3QYH B;  1NYQ A;  4HT9 A;  4G84 A;  2Q7H A;  1NJ6 A;  2C7I A;  3QO3 A;  2XIC A;  4X9D A;  4ZTF A;  1Q7Y C;  2A8E A;  1P92 A;  2BIV A;  4JJN K;  4XQ3 A;  1EFW A;  1NYR A;  5D6X A;  4QQG A;  4PLI A;  3L2V A;  3E9I A;  3WVD B;  2XK0 A;  1VQM T;  4M75 G;  3ZEH A;  3JCM h;  4HT8 A;  3KBG A;  3I56 A;  5GAM j;  1VIF A;  4Q5W A;  4EMG A;  3VUB A;  3OYC A;  4PL6 A;  2L5Q A;  1BKB A;  4M7D C;  3JCM P;  1K73 U;  4P5N A;  4A4F A;  2QTX A;  3ERR A;  3RL6 A;  3FRN A;  5GAN f;  3M55 A;  5GAO m;  3OS0 A;  4YRC A;  4HKE A;  2MWO A;  1M90 C;  4EMH A;  3QNE A;  2DD4 A;  4DQ2 A;  4M7A F;  1H4Q A;  2XI9 A;  3CCM T;  1YIJ T;  2ARU A;  5GAN 6;  2VGM A;  4BI4 A;  3HRU A;  3OYH A;  1QP3 A;  4C8Q B;  1VQK A;  5I2S A;  1EVK A;  3OY9 A;  4H2S A;  2RHU A;  1QVF S;  3LH0 A;  3UWN A;  2VC8 A;  2LQK A;  2RHX A;  4PLL A;  4YRE A;  1H4V B;  4BE1 A;  1XQH A;  1C0A A;  4LD6 A;  2ZZD A;  4EDU A;  2LT4 A;  2E65 A;  3A8H B;  2ZGW A;  3M57 A;  1Q82 U;  3N5B B;  3BW1 A;  1BI2 A;  4NCX A;  4CS2 A;  1ZBX A;  1HTT A;  2VV5 A;  1Q81 C;  1XTD A;  4K86 A;  4Q6G A;  4RDX A;  4J7I A;  3VYH B;  4IKF A;  5CQY A;  3VV0 A;  2RI5 A;  3C12 A;  2P0Q A;  4V2S A;  3NET A;  3JCM V;  1KQS S;  2CS7 A;  2HQX A;  4XTY A;  1J5W A;  2XD0 A;  3FC3 A;  1D3B B;  3RIR A;  4N4G A;  3X26 B;  3A7A A;  2MF2 A;  4HWO A;  4E7K A;  1ZQ1 A;  5KNN A;  4F7U A;  1X54 A;  3LWH A;  2QQ9 A;  2IY5 B;  4PJO F;  2DK3 A;  3L2Z A;  3A5Y A;  3M56 A;  3A32 A;  3JCM X;  3OYN A;  2RJE A;  4M7A D;  1YIT A;  3G71 T;  3OB9 A;  2I4M A;  3RKX A;  3CEY A;  1I5L A;  2ZIM A;  5LJ3 h;  4N0A C;  3P8T A;  2KQW A;  2DDZ A;  1VQZ A;  4OMF B;  3KXT A;  3S3O A;  1WQW A;  3QPH A;  3OYY A;  4ELY C;  1OZ2 A;  3P8Y A;  2GQV A;  2JN0 A;  4M75 A;  3V8L A;  3CC7 A;  1UB4 A;  2CJB A;  2K5L A;  3X25 B;  1YI2 T;  1B7Y B;  3HRK A;  5KCH A;  1VQ7 A;  3GPL A;  3CCS A;  4YRP A;  1YHQ A;  4XU2 A;  1KQ1 A;  4E47 A;  2OTL A;  4EO4 A;  4B9X A;  4CS4 A;  2AMC B;  4YRN A;  3MQZ A;  3PCO B;  2HNI A;  2MMP A;  3R6O A;  2LDM A;  2MAM A;  2I4O A;  3L4G B;  3P8B B;  2VUB A;  2RHZ A;  4LDU A;  4YRS A;  4XAX B;  2DKG A;  1YJ9 T;  1NJI U;  2RHS B;  4OVA A;  1X55 A;  2XID A;  1E1O A;  1EIY A;  4H2X B;  4HWS A;  1BI0 A;  4BI3 A;  3EFS A;  4P72 A;  3QUI A;  1QVG A;  12AS A;  2LCC A;  1UGP B;  2E10 A;  3VU3 C;  2K3Y A;  4BY6 B;  3L2Q A;  3M4P A;  4BUG A;  3FIF A;  3HY0 A;  2RH2 A;  3SDZ A;  3RUX A;  3MP6 A;  1OI1 A;  3SWN A;  2E1H A;  5GAM e;  3I55 A;  1KC8 U;  3CCE A;  1H64 1;  2WAC A;  3QG1 A;  3L2U A;  4OB1 B;  4H2T A;  2VYT A;  3QJ6 A;  3CC4 T;  2ZT5 A;  3L2W A;  3HRS A;  3RES A;  4TQF A;  1W4S A;  3OSV A;  5GAO p;  1NJ5 A;  2EQM A;  3DB4 A;  4M7A E;  2I4N A;  4M78 B;  4MML A;  3TEG A;  2AKW B;  3PFS A;  2PUO B;  3DSQ A;  5J26 A;  2CJA A;  2DQ3 A;  2QQB A;  2CYZ B;  2XKO C;  3HRI A;  3CCM A;  5FU7 B;  2IVW A;  2XDP A;  3ER0 A;  1B70 A;  4K87 A;  1SSF A;  1XNI A;  4P73 A;  2DXC A;  3VBB A;  3OSS C;  3L42 A;  3TEE A;  4TWA A;  4M7A G;  3OW2 A;  1VQ4 T;  2C06 A;  4YRF A;  2VXF A;  1EQR A;  2DEQ A;  2IG0 A;  4C0D C;  1EIF A;  3P8D A;  4MDW A;  3CCQ A;  3NTI A;  4C0G A;  4VUB A;  4M75 C;  2RD1 A;  2V8I A;  3OYE A;  3CD6 T;  3QJY A;  3FEO A;  4Y91 A;  2QXF A;  3VYG A;  1TH7 A;  2KY9 A;  3A74 A;  1N8R C;  4C92 B;  5K1P A;  3J7A F;  2RHY A;  5E3I A;  1EOV A;  3VQW A;  2DVE A;  2PME A;  4LVI A;  2H3J A;  5FU6 B;  5FLX E;  3BDU A;  2QA4 T;  3RMS A;  2DXU A;  3DKM A;  2J3M A;  2Q7E A;  1KMM A;  5HGQ A;  1LJO A;  1VQL A;  4L87 A;  2KDS A;  4XTZ A;  1WYD A;  3R07 A;  1YCY A;  5IN1 A;  2FVU A;  3QO7 A;  2ODR C;  2ALY A;  2ZTG A;  4MZT A;  2B8A A;  1W2B A;  4L59 A;  4YCV A;  3M54 A;  1NNH A;  3HL8 A;  5ELO A;  3SWN C;  1FX7 A;  4MDX A;  4EPC A;  2DIG A;  1M1K U;  5LJ5 f;  3C94 A;  5GAN 5;  3H8Z A;  2QHU A;  5GAN 3;  2PMF A;  5LJ3 g;  5GAM f;  5L8R E;  3UFG A;  5GMK j;  4PJO G;  3JB9 J;  1USY A;  4ZN3 A;  2V8J A;  3V8J A;  2Q5H A;  3CCR A;  2DTO A;  1KG1 A;  4OF1 A;  2LT1 A;  3Q1J A;  3QHS A;  4P75 A;  4TVA B;  4RMO A;  4PG3 A;  3A8M B;  2RB6 A;  1JJC A;  1KOG A;  4II1 A;  3VJP A;  2JNG A;  4YDQ A;  2GF7 A;  4RQE A;  5KCO A;  3CC2 A;  3M9Q A;  4P73 C;  5GMK m;  4IUQ A;  2HBP A;  4R56 A;  3JB9 H;  3CME T;  4TQD A;  4J5Y A;  3WVE B;  1FWZ A;  3QKJ A;  1LOJ A;  2R57 A;  1IZ6 A;  5GMK l;  4M78 F;  4WJ4 A;  4XTW A;  1U8R A;  2NS6 A;  2ZPI B;  2ZCE A;  4A54 A;  4YTL A;  3L2R A;  5KE3 A;  5M9O A;  2K4Y A;  2D6F A;  3DLL A;  5CVI A;  3A7U A;  2BKD N;  2QHV A;  2PQW A;  2L8D A;  2LRQ A;  1VQP T;  4YRJ A;  3QDR B;  5GAO q;  1G3W A;  5J39 A;  4M7A A;  3HFV A;  2OTJ A;  3CBP A;  2QQS A;  1PYS B;  2A3L A;  1M8V A;  4QQD A;  2EIF A;  4HCC A;  3SB2 A;  3UGT A;  3HXW A;  2PVG B;  2RHQ A;  2M9U A;  3VQY A;  3QZ5 B;  3BFM A;  1VQ8 T;  2GCX A;  2YLC A;  2WSE E;  3X24 B;  2CZ7 B;  2E41 A;  1G5I A;  3RGL A;  3PMI A;  5HK3 A;  5DY9 A;  1VQ9 T;  4BWA A;  3CCJ T;  4A53 A;  2P5I A;  1IL2 A;  2Y90 A;  2P0L A;  4OB0 B;  3RF1 A;  4N0A A;  4RG8 A;  1K9M C;  3LSS A;  4E7L A;  1WJR A;  1S72 A;  2RI3 A;  2D0Q B;  2KMT A;  1USY C;  2ZPF B;  3QII A;  4XEM A;  3CMA T;  2M16 A;  2YRV A;  2RA2 A;  1K8A C;  4TVR A;  4M78 D;  1RIQ A;  4KR3 A;  4P75 C;  3HY1 A;  1GXI E;  5DM7 R;  3CCL A;  3M5A A;  1WU7 A;  1KHC A;  4F7U B;  3OS2 A;  1U1S A;  4L5G A;  4C5H A;  1B34 A;  2O4X A;  5LJ3 j;  2ZXF A;  3MP1 A;  2G4C A;  4PJO A;  4J6Y A;  2LC4 A;  5DLO A;  1YBY A;  2P0K A;  3UDC A;  1VQN A;  4LVM A;  1WGS A;  5D6Y A;  4KUD K;  4JS5 A;  5C52 B;  4YRT A;  3P8V A;  2O01 E;  3JCM W;  4YRL A;  3VQX A;  1JJ2 A;  5ELN A;  2HD0 A;  2F5K A;  3CBM A;  2CZ0 B;  2QDY B;  4RG2 A;  4M75 B;  2HQE A;  3LLR A;  2I4L A;  2C8M A;  1N9W A;  3HFN A;  3V7R A;  1KHI A;  4QVD A;  4C92 D;  4OGE A;  3OQ5 A;  3GF5 A;  2F5T X;  4D6W A;  4M7A C;  3QZ9 B;  3URG A;  3P8H A;  2M0O A;  4CH5 A;  3MEU A;  2X4Y A;  4PKC C;  2EQJ A;  2CGH A;  3MEA A;  1WLE A;  3M59 A;  1VQ5 A;  4RCB A;  5GMK e;  1YJW T;  2ZPE B;  5LJ5 h;  3QO8 A;  5C51 B;  2LVM A;  2QQR A;  1M1G A;  2JVV A;  1EIY B;  2ZZF A;  1YJN A;  4X9C A;  2E70 A;  3M4Y A;  1FXX A;  4YCU A;  1Q7Y U;  4JUV A;  1YGB A;  3INZ A;  4RMF A;  1MGQ A;  3OYA A;  3QTC A;  3OMC A;  4M78 E;  3SWN B;  2DIQ A;  4UC4 A;  3MEY A;  2QEX A;  1JRI A;  4JRP A;  3UGQ A;  3JCM d;  2E64 A;  3GP8 A;  2RJF A;  2QI2 A;  2RJC A;  3J81 E;  4Y28 E;  2K3X A;  3FDR A;  4BE0 A;  2EWN A;  3CPW A;  4M77 B;  1K8A U;  1FYF A;  3PT9 A;  1M90 U;  4JRQ A;  2XTI A;  4M78 G;  1YFT A;  1VIE A;  4PJO C;  3G6E A;  2RJD A;  4P3P A;  3KFU A;  2CIM A;  1M9S A;  1B70 B;  2ZT7 A;  1ATI A;  3CCU T;  3QO5 A;  2DXT A;  2DAQ A;  4EMK B;  2P4T A;  3FLG A;  2EYQ A;  4ME7 A;  3GIB A;  3G7Z A;  1I4K 1;  2CKK A;  3M4Q A;  4C92 E;  3HP9 A;  1BIA A;  3IKL A;  1N6A A;  2EAY A;  4R55 A;  1UGQ B;  1VQM A;  1SER A;  1RI0 A;  3MET A;  2K5I A;  2ZZG A;  2DXB A;  1KMN A;  2Q5I A;  4C8Q F;  4BDY A;  3JCM g;  2K57 A;  3GNG A;  3AHU A;  2FL7 A;  2YHT A;  4XU3 A;  3REU A;  1Q81 U;  3CMQ A;  4OB3 B;  5CQX A;  4XEO A;  4J8O A;  1KQ2 A;  3MHX A;  4NS5 A;  4C92 G;  3NTK A;  1VQ6 T;  2ZPB B;  1L0W A;  3QBY A;  3MO8 A;  2LNV A;  4WF2 A;  1LNX A;  3G4S T;  4PHC A;  5GAN h;  4KT0 E;  4LDV A;  1YIJ A;  1RL2 A;  4XTU A;  4YRQ A;  1E24 A;  3IKM B;  1ZHI A;  5LJ3 e;  2ALY B;  1B7Y A;  2JOY A;  5CKH A;  3JCM J;  4YCW A;  5KE2 A;  5CKE A;  3BY7 A;  1KD1 C;  4RQF A;  2XGT A;  3F70 A;  4NL3 A;  2ZPG B;  1YFS A;  2ZIN A;  5A0D A;  2JUF A;  4M7D B;  4YRI A;  5C0M A;  1U1T A;  4KR2 A;  4C5G A;  3OS1 A;  3I56 T;  3PCO A;  5J3B A;  3A8G B;  3L4G A;  5IT9 E;  4ZTZ B;  4LVL A;  5HY6 A;  1G51 A;  4H2W A;  5LJ3 d;  3BJU A;  1QVP A;  4CH4 A;  4DOW A;  1O9S A;  4HVC A;  1BIB A;  1Z7M A;  4C8Q D;  1Q86 C;  3RER A;  4JRK A;  1UGS B;  2EJF A;  3MEV A;  1ADJ A;  4ZIB A;  3OYJ A;  3G1Z A;  1NZ9 A;  3E1S A;  1QVF A;  1VQK T;  5LJ5 g;  4ZTJ A;  3E19 A;  4NOY A;  5I21 A;  5GAO r;  4FL6 A;  1B8A A;  3LSQ A;  1DJ7 B;  4XU0 A;  3V8K A;  4M78 A;  1G3Y A;  4M77 F;  5AYF A;  4M75 D;  2E3C A;  2DO3 A;  3G71 A;  4ATO A;  2RO0 A;  3SFM A;  3JB9 I;  4N4I A;  1VQO T;  2RK2 A;  2J3L A;  3MP8 A;  2QHT A;  2RHI A;  3JCM b;  3RMQ A;  4YRG A;  1X75 C;  3TEH A;  3HRT A;  4CI0 C;  3HFO A;  1K73 C;  5KH6 A;  4OGC A;  4MMK A;  1KQS A;  2RM4 A;  4LD9 K;  3DLM A;  1QF6 A;  2QQA A;  3JB9 F;  1YI2 A;  2X35 A;  1GGM A;  4RCC A;  1W66 A;  3WQZ A;  5GAO n;  2KAF A;  1SET A;  2KK4 A;  3CBO A;  3V7S A;  3IG2 A;  3OYG A;  1M5Q 1;  2ODR D;  2K5F A;  3HKS A;  3A31 A;  4X34 A;  5LJ3 f;  2GFU A;  4C92 A;  5FRO A;  1AHJ B;  1YIT T;  1YJ9 A;  1H4T A;  1N9S A;  2NLU A;  3GNF B;  5C6S A;  3HSB A;  4E7H A;  4A4K A;  4F7U E;  3ZFJ A;  3HFZ A;  2E5A A;  4CH3 A;  2RI2 A;  4C8Q E;  3NEL A;  3OYF A;  4C5I A;  1Q82 C;  2ZPH B;  1NPR A;  5GAN 4;  1QVG S;  1Y7X A;  2ZIO A;  4WJ3 M;  4XTX A;  4M77 D;  3M4G A;  4YRK A;  4JLG A;  2O4X B;  4BY6 C;  3CC7 T;  1PSE A;  2LQ8 A;  2ZT8 A;  1N8R U;  4PJO B;  3CC4 A;  4EX5 A;  4ZTU B;  1VQ7 T;  2PVO B;  1X2G A;  3H6Z A;  4RKU E;  1YHQ T;  4M75 E;  1Q86 U;  4C8Q G;  2OTL T;  2DU7 A;  4UPA A;  3OYD A;  4NL2 A;  1LYL A;  3NEM A;  3JB9 D;  4M78 C;  4QQ6 A;  4YRR A;  5GAN g;  5CKD A;  3I7F A;  4C92 F;  2ARS A;  1Y71 A;  3OD1 A;  4TVA A;  1Y96 A;  3A5Z A;  4HCB A;  4YP0 A;  5FU7 C;  5A0L A;  3UH0 A;  1VQ4 A;  5LJ5 j;  3REX A;  4JS4 A;  4YYE A;  4K88 A;  3OW2 S;  3ZBD A;  4O2D A;  3I55 T;  4HWT A;  3A8L B;  3CCE T;  2EKO A;  4FU6 A;  1MHN A;  3O8V A;  5A0G A;  3OYM A;  3CXC A;  3CD6 A;  4BW9 A;  3OBW A;  1HC7 A;  1JB0 E;  1QP2 A;  1M1F A;  2PUK B;  4XTV A;  3T9N A;  3TU4 K;  2DD5 A;  2X4W A;  5GAN 8;  3PTA A;  2R5M A;  3VQV A;  5GAO l;  4C92 C;  4P71 C;  4KBM B;  4XU1 A;  3X20 B;  1JBM A;  3DB3 A;  2QA4 A;  4H2V A;  3TUP A;  3OYB A;  1IRE B;  3MF1 A;  4M7D D;  1Y07 A;  2V8K A;  2EL9 A;  1PYS A;  1NJI C;  5CKF A;  4M77 E;  5FU6 C;  3E9F A;  4C0D B;  4UP7 A;  4UP8 A;  4TVY A;  2LCL A;  3NTH A;  4GY5 A;  1ASY A;  1R8O B;  3GOX A;  4HCZ A;  1VQO A;  1G5H A;  3CCQ T;  2Q7G A;  1W2B S;  2CZ1 B;  1KC8 C;  2WSF E;  3S3N A;  2Y4Y A;  3LX7 A;  4DPG A;  5EG2 A;  1NJ1 A;  3CCV T;  4M77 G;  4A4H A;  5I2M A;  3J80 E;  5DLQ E;  3ICA A;  2JTF A;  5GAM h;  4LNS A;  3A8O B;  1I8F A;  2M1H A;  2DJZ A;  3E9G A;  1UEB A;  4J6W A;  3JCM e;  2FHD A;  1B76 A;  4ELZ C;  4DA4 A;  3A7R A;  1WJQ A;  1VQL T;  4XK8 E;  4BB7 A;  3JB9 G;  3JSC A;  2E5Q A;  4C8Q A;  1QW1 A;  3CME A;  4PNO A;  4OP0 A;  3QSU A;  3TRE A;  5CKB A;  4LVJ A;  2KVQ G;  4B9W A;  4UP9 A;  2D9T A;  1K9M U;  2EQK A;  4X5O A;  3FJP A;  3HHT B;  5GAN j;  4C5E A;  3HXV A;  3IAL A;  2X4X A;  2LX9 A;  3PNW C;  1X56 A;  4IUV A;  3PZC A;  3UT1 A;  3CPF A;  3S3M A;  2ZCF B;  4IUP A;  4FIB A;  1VQP A;  3CCR T;  4M7D E;  3TCJ A;  1N27 A;  5CIU A;  1XOV A;  4KUI A;  4ZGJ B;  2G3R A;  4OLF A;  1NJ8 A;  2YLB A;  2X4J A;  4LVK A;  3QYG B;  3RKW A;  3RAC A;  4J83 A;  3JAM E;  4P74 A;  4CH6 A;  1G5V A;  1EVL A;  3CC2 T;  3OMG A;  2DTI A;  1VUB A;  1VQ8 A;  2ZR2 A;  5C53 B;  1SES A;  4TVW A;  3WXM B;  4HWP A;  1D3B A;  4F7U F;  4M7D G;  2L89 A;  4QW2 A;  2CJ9 A;  4MZP A;  5K1X A;  2QHS A;  2CZ6 B;  1E1T A;  1VQ9 A;  1Z7N A;  2EJG A;  3CCJ A;  3BDL A;  2IY5 A;  4CRI A;  4CS3 A;  4BAC A;  1M1K C;  1WPY A;  3SD4 A;  4JRI A;  4ZGD B;  1G3T A;  4L6V 5;  4PJO D;  4YRO A;  4ZN1 A;  5LJ5 e;  2PU9 B;  4J6X A;  4J7F A;  3JCM c;  3L1A A;  5A2Q E;  5CR2 A;  3CMA A;  1YFR A;  3EFR A;  5FRM A;  1ADY A;  2ZZE A;  2OTJ T;  2E12 A;  4FM4 B;  4M75 F;  4A4E A;  3CXC S;  4HA8 A;  4Z02 A;  4IUU A;  2JZ2 A;  4HWR A;  4LDW A;  2XHC A;  3C95 A;  3JCM f;  4KQE A;  5LJ5 d;  1NJ2 A;  3EAE A;  4FT4 A;  4M77 A;  2GFA A;  5F5W A;  2DQ0 A;  2ZNJ A;  5GAM d;  4C8Q C;  5HK0 A;  5CK9 A;  3HPW A;  1E22 A;  1QE0 A;  3TEH B;  4HT4 A;  2XG8 D;  3LC0 A;  2AMC A;  2P0P A;  3HTZ A;  1N9R A;  4IUR A;  1M4Z A;  5LL6 S;  3HXZ A;  2LTO A;  4LDY A;  1BYM A;  3KUF A;  3M53 A;  4GLK A;  2PVD B;  1OZ3 A;  3OA6 A;  2RHS A;  4EMK A;  1S72 T;  1WQ7 A;  1JJ2 S;  4A4G A;  4H2X A;  5GAN 2;  3HXU A;  1X6O A;  1JJC B;  4O6J A;  3OYI A;  11AS A;  5HKC A;  3LGF A;  4QVZ A;  2L3R A;  2MI6 A;  2R58 A;  4MZM A;  1V29 B;  1O75 A;  4G85 A;  5IAY A;  1BI3 A;  5GAN 7;  4DOV A;  3CCL T;  4BE2 A;  5CO7 A;  2XDD A;  3CCV A;  2E6Z A;  1YJW A;  4P74 C;  2VGN A;  3OBY A;  3LW5 E;  4J15 A;  3M58 A;  3PIO A;  1YB3 A;  2ART A;  4AH6 A;  3OYK A;  5GAM g;  2R5A A;  3HFZ B;  3FB9 A;  1ASZ A;  4P3O A;  1H4S A;  1VQN T;  1NPP A;  4YPF A;  1I81 A;  4E7J A;  2EQU A;  4BD3 A;  2AKW A;  3JCM Q;  1WNL A;  4PJO E;  3MF2 A;  1NE8 A;  2E6N A;  4C0F A;  4P72 C;  2VXE A;  3PIP A;  4N4H A;  2HAX A;  3MCA B;  3LWI A;  3ASK A;  1G3S A;  3PMT A;  4M7A B;  2JTM A;  3E9H A;  2ZNI A;  4JLI A;  2I2L A;  2AHJ B;  3HXY A;  2FB7 A;  3OS5 A;  4Q15 A;  2KSS A;  2XDB A;  2WSC E;  1HXD A;  3ME9 A;  2EJ9 A;  4O5V A;  4M7D A;  4YRM A;  2EFI A;  3LGL A;  2RHQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...