3L2ZA

Crystal structure of hydrated biotin protein ligase from m. tuberculosis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
258
structure length
240
Chain Sequence
RPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTTARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BirA bifunctional protein
publication title Structural ordering of disordered ligand-binding loops of biotin protein ligase into active conformations as a consequence of dehydration.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 71
structure length 240
sequence length 258
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2zA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3l2zA01
4M78C 2C7IA 3G1ZA 1X01A 4E51A 1M8VA 4K86A 4M78A 2DTHA 2QTXA 4HWSA 1G5IA 1C0AA 4DQ2A 3L2ZA 3L1AA 4BW9A 3RUXA 4YRFA 3QHSA 4EMGA 4ZTUB 4YRKA 1I5LA 3CMQA 2ZCEA 4UPAA 4M7AA 4RCBA 1BBUA 3JCMV 3M4GA 4M78D 4EO4A 4X9CA 2ZTGA 3V8JA 2ZT6A 3A5YA 3SWNC 4N0AC 4C92C 3SWNA 3V8KA 3QO8A 1BIAA 4XEOA 4N0AA 3VQWA 4C92A 2J3LA 4M7AD 2DQ0A 3HSBA 2ZZEA 4M77E 5GAN8 4RCCA 5LJ3f 1JJCB 3HFZA 1KQ1A 3P8TA 1PYSA 3L4GB 1YFTA 3E9IA 4M7DG 3JB9G 1EIYA 1Y96B 3JCMf 4KR2A 4H02A 3AHUA 3QO7A 2I4NA 3IALA 4M78F 1H641 4HWRA 3A74A 4M75E 3PZCA 3QNEA 1LOJA 3BY7A 3R07A 4CH4A 1J5WA 1D3BB 3QO3A 4PJOC 1WNLA 3PCOA 5KNNA 4M7AF 1LNXA 1KMNA 4PJOA 4P3OA 3TUPA 4EMHA 4TVYA 1TH7A 1USYC 4TVAB 4HT9A 4WJ4A 2CIMA 1EOVA 4C8QC 3LSQA 3QUIA 4C8QA 4C92F 2PMEA 3A7AA 3P8YA 3JCMX 4PJOD 1HC7A 5C53B 4M77G 5F5WA 5LJ5j 5GAMe 4M78B 5GMKl 1ADYA 2QHTA 3QSUA 1L0WA 1B34A 2EJGA 2DTOA 1E1OA 3BW1A 3UH0A 3WQZA 4JUVA 1NJ8A 4K88A 5GMKi 1HTTA 4XQ3A 2Q7EA 5GAMh 3JB9H 2P0LA 3IKLA 4YRIA 3OD1A 1BIBA 4XEMA 4CH6A 1JRIA 5GAOp 3JCMP 3MEYA 5GANd 5GAOr 5GAMg 2E5AA 2Q5IA 3SWNB 4UP7A 2YLCA 4YRQA 4YPFA 4C92B 2I4OA 5GAN5 4H2XB 2E1HA 3BDUA 4PJOF 2CJ9A 2YLBA 3SB2A 5LJ5h 5K1XA 3V8LA 4M75D 3PGGA 4L87A 4XU3A 2VXFA 3RESA 4M7DE 5C52B 5LJ5d 2ZZFA 4F7UA 4NCXA 4WI1A 3NELA 3HFZB 3P8VA 3M4QA 5GMKj 1PYSB 1Z7NA 4PHCA 3RKWA 4V2SA 3NENA 4XU0A 3ERRA 3HRKA 1KMMA 4C8QF 2ODRC 4J6XA 4JRIA 3RKYA 1EIYB 3RERA 4P3PA 1B7YA 2EWNA 2DJZA 1KOGA 3A5ZA 4M7AC 4Q15A 3GIBA 3M4PA 3NEMA 1NYQA 1E24A 1VQZA 4KQEA 3JCMW 4G84A 4HT8A 5GMKe 2E3CA 3RGLA 4CS3A 2HNIA 3PCOB 3HY0A 1LJOA 4YREA 4PJOB 3JB9J 4EX5A 2ODRD 2E10A 2RHSA 4P72C 4JRKA 4AH6A 2DXTA 2JN0A 4P72A 4RMFA 4RDXA 3TEHB 1WYDA 5GAOl 5GMKh 3V7CA 4J6YA 3EFSA 4MMLA 4C8QB 1QF6A 1ASZA 4NOYA 5GAMf 1X54A 2ZT8A 3HXXA 4PG3A 1H4SA 1N9RA 1Z7MA 2IY5A 2I4MA 2VXEA 2FB7A 4M7DA 3A31A 2RB6A 5CAIA 3FB9A 1B34B 4F7UF 4ZTZB 3A7RA 1G5HA 4YRGA 5GAN7 2P5IA 4YCVA 4C92G 2AKWA 4OP0A 1EFWA 4Q6GA 1JBMA 1HK9A 3RKXA 4P75C 4M7DD 3VQVA 5GAN4 3JB9D 4TWAA 4P75A 4PNOA 4YDQA 5HGQA 1RIQA 3V7SA 2ARTA 3JCMc 1YFRA 2EL9A 3VQYA 4YRNA 5GAN3 1LYLA 1M5Q1 3INZA 4JLIA 5GANj 2XTIA 1ASYA 3REXA 5E3IA 5GAN2 4H2UA 5GAN6 4CS2A 2EJ9A 1NJ6A 2QHSA 3LC0A 3NETA 1B70A 4F7UB 3RL6A 4M77A 3HRIA 1WPYA 2DTIA 5C51B 5ELNA 2I2LA 5GANe 3HFVA 1KQ2A 1B7YB 5LJ3j 4CS4A 4PJOG 4H2SA 3LSSA 3HXYA 4RQEA 4M7DF 2ZINA 2ZNJA 4M77D 4M7AB 2DVEA 4XU2A 5GANh 4M75C 2ZR3A 4M78E 2ZZGA 5LJ5e 4M75A 4C8QG 4WF2A 2C8MA 2Y90A 5GANg 5K1PA 2RHSB 3ICAA 4TQFA 4YP0A 2DQ3A 5GMKm 5I21A 4J5YA 4NL3A 4M7AE 3RF1A 3HXUA 3QTCA 1YCYA 3IKMB 1EVLA 2DEQA 1WQWA 4YCUA 5GAOn 4K87A 3VBBA 4QVDA 5LJ3h 2ARUA 2IY5B 4H2YA 2K57A 5LJ5g 2G4CA 1NNHA 2QHUA 3HXWA 4WJ3M 2RHQA 5LJ3d 4ZIBA 4C92E 1YFSA 4Y91A 2DDZA 4M77F 3JCMQ 3UGQA 4H2WA 3UFGA 1BBWA 1MGQA 12ASA 2AKWB 3BFMA 5ELOA 3JCMd 4YYEA 5DY9A 2ZT7A 4YRPA 2RM4A 1SESA 1ATIA 4YRLA 1X55A 4J6WA 4J15A 1N9SA 4F7UG 2RA2A 4TTVA 3JCMJ 4G85A 1I4K1 2E64A 4M75F 4M78G 3JCMb 1WQ7A 1YGBA 3HTZA 3A7UA 4YRCA 2AMCA 4TVWA 1SERA 4XU1A 4HWTA 1B70B 4M77B 1NYRA 5GANf 1H4VB 4PJOE 2DU5A 4M7AG 1QE0A 1EVKA 4M7DC 4P73C 1GGMA 3IG2A 1X56A 1ADJA 3W3SA 4H2VA 2CJAA 2Q5HA 4YRRA 4P73A 2DKGA 4EMKC 2CGHA 4EMKA 4XTUA 4C8QE 2ALYA 4H2XA 5GAOm 5LJ5f 3HY1A 1SETA 4CH5A 3REUA 4H2TA 3HXZA 4M75B 2Q7HA 2EJFA 3HFNA 4YRJA 3KFUA 1WU7A 4C92D 4YRTA 1G51A 1HXDA 2ZGWA 4YROA 4YRSA 4QVCA 2E41A 1IL2A 4M77C 4XTZA 1B8AA 4P3NA 1H4QA 1I8FA 3HXVA 2RHQB 3E9HA 2CJBA 3DSQA 2VC8A 2RD1A 2DU7A 3RIRA 5GAMj 4BWAA 3TEGA 2ZXFA 3QO5A 4XTWA 1WLEA 2ZT5A 1I81A 3MF1A 3TEHA 3JB9F 4F7UE 5GAOq 2ZIMA 4LNSA 2YHTA 2DXUA 1USYA 2ZNIA 1U1TA 1E1TA 1N9WA 4HVCA 4XTXA 1NJ1A 3HFOA 4OLFA 2DZCA 2ZIOA 2ARSA 3BJUA 1YB3A 2FYKA 4P71C 1JJCA 3FIFA 3A32A 2EAYA 2Q7GA 3L4GA 5LJ3e 3V7RA 4P71A 1NJ2A 1FYFA 1EQRA 4A54A 2XGTA 1Y96A 2AMCB 4C8QD 4A53A 1H4TA 3JCMe 2QHVA 4HWOA 4X5OA 4UP9A 4UP8A 4DPGA 4KR3A 1X2GA 4YCWA 4CH3A 4RQFA 5GAMd 3VQXA 4P74C 4M7DB 1D3BA 3FJPA 4HWPA 2E65A 1W66A 3VU3C 2I4LA 4P74A 4M75G 5LJ3g 4MMKA 4XTVA 1SRYA 4TQDA 4EMKB 3JB9I 3I7FA 1X2HA 4YRMA 3JCMh 1E22A 11ASA 4NL2A 2DZ9A 4XTYA 4HA8A 2PMFA 2ALYB 2ZR2A 1U1SA 3RACA 4TVAA 3JCMg 1NJ5A 4O2DA 4X9DA 3EFRA 2J3MA 3MF2A 1B76A 3UGTA
chains in the Genus database with same CATH superfamily
4KH1B 3S3OA 2JXBA 4M78A 1C0AA 2VVKA 4LN2A 5FU6B 3L2ZA 4YRKA 3CMQA 2GTJA 5KYXB 4RCBA 1G2BA 3LH0A 4EO4A 5EG2A 2IIMA 3PIPA 2O4XA 1E7OA 1RAIB 3SWNA 4R55A 1X2QA 4XEOA 4N0AA 1UUEA 3FRNA 1TXQA 4M7AD 2ZZEA 3HSBA 4M77E 2KI7A 4RG2A 1SPKA 3REAB 2H3JA 4ELYC 3CPWA 5HY6A 3EG0A 4RCCA 1KHCA 1VA7A 4C5IA 2B8AA 2PVOB 1R0CB 2GGRA 1V29B 2A0FB 4FU6A 2JUFA 2YRVA 4ORZA 2RHIA 3JB9G 4MDXA 4JRQA 3VS0A 1KQSP 3I56A 2I4NA 4M78F 1M2OA 3A74A 5IN1A 1KIKA 2XU8A 3AT1B 3G6EQ 4LNPA 2JT4A 2VGNA 2QQSA 2ZPFB 1Q86C 4CH4A 3CCEA 4PJOC 1WNLA 2BIVA 4FL6A 1SSFA 1QVFA 3PNWC 1JXOA 4P3OA 3TUPA 4TVYA 2YDLA 3M0RA 1ZBXA 1OEBA 3CC2Q 2M1HA 1BB9A 1RUWA 1EOVA 2CSIA 3LSQA 4CC3A 3QWXX 4DOVA 2X51A 4F14A 2PMEA 2SEMA 3A7AA 2KROA 3JCMX 4PJOD 3P8BB 2HKNA 4JZ4A 4RUGA 5LJ5j 4HCZA 4M78B 3RMSA 3QSUA 4QT7A 3BW1A 3X24B 3OYCA 2DA9A 2Q7EA 1YJ9Q 1H3ZA 3OD1A 1FYNA 4CH6A 3MEYA 1BI1A 4HCKA 3CCRQ 5GAOr 1YJNT 3CC2T 5FRNA 2E5AA 4PLIA 2O4XB 1N8RU 3SWNB 2E3IA 4UP7A 1EIFA 4YRQA 4YPFA 1VQ9Q 1ZSGA 2V26A 2E70A 3G7ZA 3PVQA 3BDUA 2R5MA 4M75D 2R57A 5HK0A 3ZEHA 4F7UA 3M5AA 3NELA 4E2FB 1Q7YC 4DA4A 4LDXA 2E3HA 2KRMA 1RAAB 2EWNA 4OMFB 4PFOA 3BDLA 1HD3A 3A5ZA 2EGAA 5I22A 3OA6A 4RTUA 3GIBA 2FPDA 1JU5C 1NYQA 3VUZA 1VQZA 3LGFA 1VQ9T 2CP5A 3GPLA 3ZBDA 4Z8AA 4A4GA 1NE8A 2QAZA 4LD9K 4AH6A 4P72A 4RDXA 2HSEB 3X25B 3V7CA 1VUBA 5IAYA 3M9QA 1ZA1B 2HQXA 3X28B 3HXXA 4FIBA 3T9NA 2P0QA 2I4MA 2FB7A 1JEGA 2B86A 2LQNA 1MMNA 3CXCS 2JW4A 4F7UF 2JMCA 3E2UA 1SKUB 2K2VA 2ECZA 1EFWA 4OP0A 1VQ7Q 1JBMA 1ZX6A 3RKXA 1VQ6A 4P75C 4M7DD 2DILA 2RK1A 4YDQA 3M56A 1Q82U 5HGQA 3MO8A 1X27A 1YFRA 2E4HA 4ZNXA 2RQUA 1PG5B 2RMOA 2GFUA 5GAN2 3I35A 4ZGEB 1OX9A 5GAN6 2QHSA 2LC4A 2P0PA 3OYGA 2NYSA 1PSEA 2MIOA 4N4IA 2G6FX 1N27A 4F7UB 2DE0X 3RL6A 4M77A 1WHLA 5C51B 3CQTA 4DBQA 5ELNA 1KC8U 1YCSB 2ENMA 3OYMA 5IHIA 4PFPA 4O6JA 4PJOG 3CCJQ 3HXYA 3A5ZB 1AEYA 2EIFA 2Y4XA 4Y92A 2ZINA 1Y7XA 3EHRA 4BB7A 3ZFJA 3CCMA 3C94A 2AK5A 4XU2A 2LNHB 3OSVA 2DD4A 2FZCB 4JJNK 5LJ5e 2DAQA 5K1PA 1RABB 4TQFA 3E1SA 3E9FA 4M7AE 3QTCA 1YP5A 1YCYA 2KVQG 1EVLA 2MWPA 4IKFA 4K87A 1D0XA 5AT1B 3G71T 1UGQB 5LJ3h 5L8RE 2ARUA 5LJ5g 2RHQA 2QK0A 5LJ3d 1YFSA 2DDZA 2E5QA 2DIQA 4M77F 2DL4A 3X26B 1ZSZC 1VQ8Q 2QDYB 1MGQA 2KBTA 3BFMA 3M4YA 4Z89A 4ZTJA 5I2MA 3CCLQ 1VYUA 2RM4A 2ESWA 5FROA 2DRKA 1QKWA 5KYYA 1PHTA 4IIOA 1RLPC 2FPFA 1BCOA 4M78G 3O8VA 1QCOA 1UDLA 1YGBA 2DM1A 1UECA 4TVWA 4HWTA 1ABQA 2RK2A 5D7UA 4M77B 2DJQA 4BY6C 4RG8A 4E6RA 4PJOE 1IGQA 4P73C 3C12A 1VQ8T 3NMZC 2OTLA 2PVDB 4LUDA 2VV5A 3W3SA 4YRRA 4PJLA 2YWWA 1MMAA 4EMKC 2CGHA 4KULA 2ROLA 3CCLT 2QDLA 5CO7A 4AG1C 1X6GA 3OYDA 3MCAB 4XTUA 1YITT 3UF4A 3X20B 3ASKA 1CKAA 5LJ5f 3UT1A 4X34A 1BKBA 1D0YA 2PUOB 1JJ2S 3REUA 3M0TA 2EFIA 2RHXA 4LE9A 3VS1A 1QVGP 3WVEB 4C92D 4YRTA 3OYBA 1XOVA 5L23A 2DVJA 2OTJA 4FSXA 3KUFA 2D0QB 1OQKA 5A0GA 4M77C 3RR6A 3OYNA 3OYAA 1K8AU 1H4QA 2PTKA 3CXCA 2JOYA 2LJ0A 4MZTA 3L2QA 2RHQB 2CJBA 1QWEA 2RHUA 1VQPA 2VC8A 1VQKA 3RIRA 2EQJA 2JTFA 3TEGA 4MZMA 2IVWA 3QO5A 4KBMB 2MI6A 2Z0WA 2ZT5A 2ABLA 2WSEE 2KEAA 3UA7A 3JB9F 1GBQA 1X6BA 3QWYA 4JJCA 2DXUA 1E1TA 1N9WA 4LVJA 3HP9A 4XTXA 1NJ1A 4OLFA 2DXCA 5KYYB 1H92A 3PMTA 1I07A 2FYKA 1JJCA 3FIFA 3CMEA 2Q7GA 2E5KA 2RI2A 3L4GA 4CRIA 1R0BG 1FYFA 1EQRA 3ULRB 2XIDA 1Y96A 2COZA 4OMLA 4C8QD 4A53A 3JCMe 4HWOA 2XG8D 4X5OA 2KMTA 4DPGA 3OYIA 1NZ9A 1WLPB 1G3SA 3VQXA 2YUOA 3FJPA 2JTMA 1LCKA 3VU3C 4P74A 2YUNA 2ZPHB 4TQDA 4KGZB 1UE9A 1IXDA 3JCMh 1E22A 3QG1A 3QPHA 3VS2A 1U1SA 2FZGB 4EPCA 2YRCA 3NFCA 3JCMg 4QQDA 1NJ5A 4O2DA 1S72A 3TCJA 3MF2A 2QYZA 2JZ2A 1I0CA 2M0YA 1IHWA 1W4SA 3CPWS 2EYYA 1S1NA 2C7IA 1X01A 1M8VA 4K86A 2DTHA 2K5FA 2HEQA 4HWSA 4FCYA 3OYJA 3RUXA 4YRFA 2RHYA 3QHSA 1TWBA 3I56Q 1HSQA 4JPBW 1ZA2B 2QQAA 4UPAA 4M7AA 2RI3A 1BBUA 3JCMV 3OW2A 4J9FA 4IUUA 1GCPA 3CCEQ 2XK0A 1K8AC 4YTLA 2HBPA 3GF5A 4BE0A 2FO0A 1R8OB 1BIAA 2FEIA 4IUTA 4XK8E 3P8HA 2RQTA 4Y28E 4II1A 2J3LA 4F17A 5M9OA 2DQ0A 3OY9A 2J06A 1M3CA 2MWOA 4CC4B 5I11A 1YWPA 4FYVB 1C6VX 2W10A 3UA6A 1D1AA 2F5KA 3L42A 1T0HA 1W2BP 1WDXA 1NEBA 3F70A 3R6OA 4A63B 2EYWA 1JJCB 3HFZA 2DL3A 1PYSA 4HCCA 3L4GB 2FL7A 4ATOA 3M53A 4J7FA 2KXDA 1K9MC 4LXCA 1Y96B 3JCMf 4KR2A 2QQRA 4L6V5 3CCQT 4H02A 1YJWQ 2K5LA 3AHUA 1UHCA 3IALA 3CCET 4HXJA 1TU0B 2E6NA 3NTHA 1I1JA 3BY7A 3R07A 2DXBA 4MDWA 3PCOA 4M7AF 1LNXA 4PJOA 2OAUA 1PSFA 4EMHA 4NS5A 4ME7A 1JJ2A 3QJYA 4HT9A 2JTEA 2CIMA 3H0FA 4CI0C 3Q1JA 1HC7A 4M77G 3TQ7P 2LX9A 3WVDB 1YJWT 4AG2C 2QHTA 1F1BB 1VQMA 1PKSA 4OB0B 4E7IA 2EJGA 1E1OA 2BE7D 1OX8A 1X43A 3TVTA 1HTTA 3HRSA 1XJWB 2P0LA 1AOJA 1D1CA 4XEMA 1JRIA 5GAOp 5GANd 1Q81U 2LDMA 1KD1U 2Q5IA 1PC0A 1WHGA 1MV3A 2YLCA 8AT1B 2KK4A 2O01E 2LJ3A 1OV3A 2CZ7B 4IURA 1G3YA 2I4OA 9ATCB 4H2XB 4PJOF 1YFNA 3EGUA 3SB2A 2X4JA 3V8LA 3ER0A 1PKTA 3PGGA 1KK7A 4XU3A 4F04B 3RESA 5C52B 2M0OA 4WI1A 3HFZB 5GJWB 3P8VA 1PYSB 7AT1B 3RKWA 3NENA 3HRKA 4J9EA 2HAXA 4J6XA 3RKYA 3SD4A 4P3PA 3GP8A 1B7YA 4FM4B 2XDBA 3CCVA 3PE0A 2KRNA 1K73C 1VQ4A 2MAMA 4M7AC 4Q15A 3CC4A 2FG0A 1Q95G 3QDRB 1QVFP 1K76A 3RGLA 3J81E 4HT8A 4G84A 2E3CA 3PCOB 3HY0A 4OGCA 4YREA 2VUBA 1P92A 4FW1A 4WTOB 4PJOB 4JJBA 5KYNA 3M57A 2E10A 2RQWA 2JM9A 4D8KA 2GCXA 1SHFA 1WYDA 4J6YA 3A8GB 4MMLA 1W1FA 1N5ZA 4GBQA 4PFZA 4J7IA 1AWWA 4E7KA 1WYXA 1KG1A 2HL3A 4M7DA 3S3MA 3A31A 2X35A 2KSSA 1HYOA 3FB9A 2LT1A 3MEAA 1VQNA 4ZTZB 5FWCA 3SDZA 3A7RA 1AWXA 1G5HA 1YBYA 3A8OB 3NHNA 3OBWA 4YRGA 1AVZC 4YCVA 2IPOB 3SFMA 3CCMQ 1RAGB 2EQUA 4Q6GA 2QG9B 2CYZB 2XD0A 1FMWA 4LDUA 4LD6A 4PNOA 3CCSQ 4P75A 1RIQA 2QQ9A 2CDTA 1U3OA 1NJIC 3CMAA 2MOXA 3L2UA 1KD1C 4O5VA 2EYZA 5FRMA 1C1AA 1SHGA 2GTOA 2QEXA 1UB4A 1WJQA 2DTIA 2RJCA 2K3YA 3PTAA 3FLGA 3OYEA 3CBMA 2I2LA 5EC7A 2AKKA 1JQQA 2DRMA 2SRCA 1B7YB 5LJ3j 3G6ET 4M7DF 1ZUUA 2ZNJA 3I55A 4F16A 1UTIA 3CCST 2XDDA 5KCHA 4M75C 5IXFA 1WHKA 2F69A 2Y90A 4HCBA 5I2SA 3RNJA 4LDYA 3META 4E7LA 1QMCA 2DQ3A 5GMKm 4J5YA 2XKOC 2DPPB 3R6NA 1YI2A 2L2PA 4K11A 3IKMB 2QA4A 1OYXA 1BI3A 4YCUA 1UJ0A 5GAOn 4J83A 2A36A 1G83A 2KT8A 2G4CA 1Y57A 5CCAA 2NUTA 1LVKA 1KJWA 1M90U 1MNEA 3CEYA 3JCMQ 1K9AA 3CC7A 3G4SA 1YJ9T 3UFGA 1NM7A 1MV0B 1GFCA 1TOVA 1ZSZA 1CKBA 3A98A 2CP0A 3SHWA 1VOMA 4YRPA 5CIUA 3CCRT 4ZGDB 4ANJA 2F2VA 3A1PA 1ATIA 1X55A 4J15A 1M9SA 4TTVA 4RKUE 1AZEA 2MYSA 5A0LA 4OB1B 1E6GA 2E64A 3FEOA 3OS5A 4DBFA 4C0GA 1VQLQ 2O2OA 3JV3A 2OTJQ 1H3HA 1SERA 2EQMA 1PRLC 1K0XA 3MKDA 1NYRA 1LPLA 2DU5A 4JJDA 4M7AG 1OPLA 1QE0A 1EVKA 4M7DC 3OBYA 1GGMA 1NG2A 1X56A 2HL5C 4P73A 1VQPQ 1VQKQ 4E7HA 1YN8A 4EMKA 2KXCA 2KAFA 5CVIA 3OQ5A 4GLKA 2ALYA 3NPFA 5GAOm 2D9TA 4H2TA 3HXZA 1FXXA 4LVMA 2QASA 3C95A 1VQLT 2EJFA 3HFNA 4OMQA 2OTJT 3CMEQ 1AD5A 3VS5A 3MEUA 1UGPB 1RI9A 4YROA 4YRSA 1N8RC 4FSSA 4QVCA 1WI7A 3EG9A 1IL2A 4XTZA 2AKLA 4C0DC 1X69A 2QGFB 1WHJA 1PD1A 1YHQQ 5A0DA 1KSWA 2NUTB 1RLQC 3J80E 2E12A 1VQ7T 2DYIA 1WXBA 2J6OA 2LTOA 1WLEA 1ZSZB 5A2QE 3CCUQ 1I81A 3L2WA 2HCKA 3TEHA 5GAOq 4OGEA 2ZIMA 2YHTA 1NYFA 1QQJA 1U1TA 1XQHA 3HFOA 3CMET 1VIEA 2F1LA 3MPUB 2ZIOA 2ARSA 3BJUA 4P71C 4RTYA 3A32A 1U8RA 5LJ3e 3V7RA 1NEGA 5DLOA 1NLPC 2XGTA 1M27C 2K3BA 2ROTA 3OYLA 4P5NA 2J6KA 1YHQT 5KE3A 2GFAA 2ZAEA 2C0OA 1AWJA 5FU7C 1RI0A 4UP9A 2DMOA 4BY6B 2L3PA 3EH2A 2D1XA 3CCJT 5GAMd 1D3BA 3CCUT 1D09B 2KQWA 1M1GA 1IRXA 4M75G 5LJ3g 4MMKA 4PJJA 3OW2S 4EMKB 3I7FA 4DEYA 4YRMA 1K4US 1C0MA 2O9VA 4J8OA 2DX1A 4XTYA 3VRYA 3UPUA 1YJNA 4IUPA 2VGMA 2ALYB 2PMFA 2DL7A 1FX7A 2NS6A 1TS9A 4L5GA 2P0KA 4X9DA 2ED0A 2J3MA 2FRYA 3LLRA 1KFZA 1M1KR 2LMJA 2HQEA 1B76A 1WFWA 1NPRA 1XNIA 3G1ZA 2L89A 5C0MA 4E51A 2VWFA 2QTXA 2C06A 1G5IA 2A7YA 4DQ2A 1Q82C 4BW9A 4BUGA 3M54A 5J26A 3CXCP 3EG9B 4ZTUB 1IHVA 1I5LA 2EKHA 4L59A 5CKHA 1TTHB 3RMQA 2RNAA 2ZTGA 2ZT6A 1OZ3A 3A5YA 4E7SA 1ARKA 2HKQB 2CUBA 4C92C 3V8KA 1VQ9A 3QO8A 1KC8C 5HCKA 5KCOA 1PM3A 5J3BA 1GCQA 4QKUA 2YUPA 5GAN8 1K73R 2O31A 4HVWA 4ESRA 1VQOA 2DERA 5LJ3f 3M58A 1D1BA 1KQ1A 4C0ZA 2CH4W 1YFTA 2OI3A 3E9IA 1PWTA 4M7DG 2K79A 1EIYA 1VQMQ 3BE3A 4A4EA 3EAEA 3QDFA 2MK5A 3LWHA 1MMDA 4HWRA 4M75E 4B6MA 4AMCA 5KYUA 3PZCA 5CKEA 3QNEA 2BZYA 1LOJA 1SEMA 1D3BB 3QO3A 4KUDK 4LDVA 2ZPGB 1KMNA 2YSQA 2GBQA 2RO0A 2DETA 1TH7A 2ATCB 4RTTA 1YIJQ 4WJ4A 4C8QC 3QUIA 2Y4YA 1Z9QA 3MJXA 3P8YA 2LJ1A 1MUZA 5IXBA 2AIRB 1ZLMA 5C53B 3M0SA 4Z02A 2O88A 1Q86R 2KRSA 1H8KA 3M0UA 3LW5E 3PT9A 1NJIR 1TUGB 2K3XA 3WQZA 3CCVQ 4K88A 1AHJB 1YNZA 1B07A 1VQ4Q 5IHNA 3CC4Q 1GRIA 3JB9H 4YRIA 3IKLA 1BIBA 5KH6A 2LCSA 2QQBA 2K5IA 2M9UA 1ZBJA 1ACMB 4J9HA 1YIJT 2DBKA 3PIOA 3OMCA 5CQYA 3N5BB 3UDCA 5GAN5 4PKCC 2CJ9A 1BU1A 4L87A 3HTRA 3OYFA 4M7DE 2VXFA 3LH5A 2ZZFA 1AWOA 1WA7A 3IQLA 3MP8A 2KE9A 3ERRA 2KY9A 2PUKB 2RI5A 3G71A 1VQ4T 1EIYB 4JRIA 3RERA 1VQNQ 1MMGA 3KXTA 4RMOA 2LRQA 1UGVA 4A4HA 2RJDA 2P84A 2V8KA 3E9GA 2M51A 4VUBA 1E24A 1ZUYA 1HJDA 4KQEA 5GMKe 3EG3A 2LQ8A 3RBBB 2HNIA 1BK2A 4XAXB 3JB9J 2CP7A 4EX5A 1V76A 1JJ2P 4JRKA 1Q7YR 3CMAQ 1SRLA 1VQ5A 2C0IA 2GF7A 2BKDN 1M1KU 1WGSA 1GCQC 2CUDA 2G3RA 5GMKh 3CPFA 4E7JA 1GXIE 2YRDA 1QF6A 2L8DA 1ASZA 2M02A 2MCNA 1Z7MA 2QEXQ 3EG2A 3HRUA 4PJMA 2L3SA 2RB6A 5CAIA 3I56T 2D8HA 3DLLA 1VQ8A 2LP5A 4DBRA 4GY5A 2P5IA 4IUQA 2EYXA 1IREB 4C92G 4ELZC 3I55Q 4J9IA 1GBRA 2CREA 2X3XD 1ZHIA 2YT6A 1YITA 3CMAT 3JB9D 2LNVA 3OS0A 3CD6A 3VQYA 2CT3A 4YRNA 2VB6A 2ZPEB 2LQKA 1LYLA 4JLIA 3QYGB 5E3IA 1G3WA 4HKEA 4H2UA 1YI2Q 2QEXT 4C5HA 2EJ9A 2EW3A 1NJ6A 2GQVA 4N4GA 2QA4Q 3NETA 1WHHA 2CP3A 2V8IA 2PU9B 1UEBA 3GOXA 1WPYA 3H41A 2K2MA 3ME9A 4BD3A 5GANe 3GNGA 3HFVA 2COYA 1KQ2A 2FZKB 1KQSS 2RQVA 2DLPA 3VJPA 2F2XA 4CS4A 4E7ZA 4AT1B 2KT1A 3JSCA 3G4SQ 2BUDA 1X75C 3NTIA 3DLMA 1CSKA 2DBMA 8ATCB 5D6XA 1N8RR 4M7AB 2DVEA 5GANh 1TUCA 5DLQE 2JM8A 4M75A 4C8QG 4UC4A 5GANg 4AFSC 3ICAA 5KYWA 4KH0B 4YP0A 3H0HA 5I21A 3JRZA 3S3NA 2A28A 2EQIA 2W0ZA 4NL3A 3CPWP 2HDAA 1EX4A 2DEQA 3HRTA 2LT4A 4TVRA 3VBBA 2C0TA 2ZPBB 5LL6S 1IB8A 4QVDA 2V8JA 2HBWA 4H2YA 4LVIA 3MP6A 2K57A 3EG1A 2QHUA 3KBGA 3HXWA 4WJ3M 4ZGJB 5FWBA 2DYBA 2QXFA 4ZIBA 1WXTA 4C92E 4Y91A 1FMKA 2HMAA 2PNIA 4H2WA 4HT4A 1R77A 4PL6A 3OB9A 4D8DA 12ASA 5ELOA 3HL8A 1IGUA 5DY9A 2ZT7A 1RACB 3GNFB 1O9SA 3VS7A 2EBPA 1VQ6Q 2RPNA 4YRLA 4OB3B 4J6WA 2VKNA 5CKFA 4JRPA 1N9SA 4GLMA 4OMOA 3L2RA 3I5SA 1I4K1 1WJRA 4M75F 3JCMb 1WQ7A 2V1QA 2AMCA 4XU1A 2RF0A 1T3SA 1U5SA 3QZ5B 3KFVA 2DK3A 5GANf 4WCIA 4FYXB 4DEXA 2X4WA 2M16A 2JJ9A 2XMFA 3IG2A 4H2VA 2I0NA 2Q5HA 2XHCA 4LVKA 3MP1A 4J9DA 2YXYA 1D0ZA 1SG5A 2V1RA 4BI8B 4J9BA 3VRZA 1VQ6T 1QP2A 2LCLA 4C8QE 1Q82R 1IO6A 2OJ2A 4QQ6A 3EGDA 3HY1A 3OYKA 1Q7YU 1SETA 4RTZA 3FDRA 1BBZA 4M75B 2Q7HA 5KYWB 3KFUA 1WU7A 1G51A 5FU6C 1Q81C 4DOWA 2CS7A 2ZGWA 3C4SA 2RJEA 2COWA 2FVUA 1KC8R 3CBOA 1EZZB 5HKCA 2AHJB 4BI3A 1ZQ1A 3CCQA 2RQRA 3HXVA 3E9HA 2L3QA 2NUPA 4FYYB 2JVVA 1QP3A 1O75A 2DU7A 5GAMj 3VYGA 3G1JA 3OMGA 5FW9A 1MHNA 2DNUA 5CKBA 3CCMT 4XTWA 3QZ9B 3DB3A 1M2VA 1N6AA 4ZTFA 1YJNQ 3MF1A 1K0SA 2AT1B 4LNSA 2JS0A 1USYA 2JNGA 3MEVA 1DJ7B 5J39A 3GBQA 2CZ6B 2D8JA 1QKXA 2D6FA 2EAYA 4P71A 2QGGA 2L3RA 3LGLA 1QWFA 1YJWA 4R0KA 4EIKA 1BYMA 2AMCB 4R56A 4BDZA 1H4TA 4IUVA 4JZ3A 2BE9B 4UP8A 1KQSA 1X2GA 4AFZC 2LQWA 4Q5WA 4CH3A 4RQFA 3PVLA 2XI9A 3H8ZA 4M7DB 2OTLQ 1W66A 1OZ2A 2I4LA 2EQKA 3HKSA 4X1VA 3JB9I 2PQWA 5CR2A 4NL2A 2DZ9A 2KNBB 4AFQC 4HA8A 2ZR2A 1GFDA 5IT9E 3RDVA 3EGDB 4TVAA 1NPPA 3NTKA 2H8HA 3EFRA 1VQOQ 3H6ZA 2DO3A 3UGTA 1X6OA 4M78C 1TUDA 2EKOA 1UHFA 3L1AA 2ZPIB 2F2WA 4EMGA 3H0IA 2FHDA 2OTLT 1A0NB 2ZCEA 1Y71A 4B9XA 4C0DB 2EGEA 4A4FA 2NUPB 3LWIA 3M4GA 2BTTA 4M78D 4X9CA 1TSFA 2PVGB 3V8JA 1WX6A 3SWNC 4FT2A 4N0AC 4OMPA 3MHXA 1XTDA 2JMAA 1M2VB 3VQWA 4C92A 1VQOT 1WHMA 3THKA 2QI2A 2J6FA 2ZCFB 1W6XA 3MEWA 3QBYA 2WSCE 3VKIA 1OULA 1Z9ZA 4QW2A 3P8TA 3D7SB 3LX7A 3URGA 2XICA 1K8AR 1JO8A 1UFFA 2KYMA 3PMIA 2MF2A 3QO7A 1H641 1Y0MA 2K4YA 3OSSC 4JLGA 5FU7B 1VQPT 1VQKT 2J05A 2J7IA 3QJ6A 1SRMA 2CP2A 1J5WA 5KNNA 1M3BA 4ZN3A 4OF1A 1QCNA 3L2VA 1K9MR 1USYC 1M90C 4TVAB 1SSHA 1OU9A 3OYYA 2DD5A 1QVGS 4JS4A 4ZN1A 2P4RA 4C8QA 4C92F 1S72Q 2JS2A 1M3AA 2YUQA 5F5WA 5GAMe 5GMKl 4BACA 1ADYA 1ABOA 3G71Q 1L0WA 2VYTA 2CZ1B 1B34A 2R5AA 2DTOA 3UH0A 4JUVA 1NJ8A 3PFSA 2RJFA 5GMKi 4XQ3A 4PK4A 3G6EA 5GAMh 2EVRA 3EGXA 2XDPA 1E6HA 3QYHB 5CK9A 3JCMP 3CCSA 1OPKA 5GAMg 1M8MA 1T3LA 3DB4A 5CQXA 3DKMA 3TEEA 4C92B 1VQ5Q 3CC2A 1S72T 2L5QA 2ED1A 1NLOC 3P8DA 2E1HA 2YLBA 5LJ5h 5CKDA 5K1XA 2OAWA 2NLUA 4EDUA 3JAME 2KGTA 5LJ5d 4NCXA 5KE2A 1RL2A 3M4QA 5GMKj 1Z7NA 1B3QA 4PHCA 2MMPA 2GQIA 1AZGB 4V2SA 4XU0A 1KMMA 4C8QF 2ODRC 2X4YA 2DF6A 4HVUA 2DJZA 1YWOA 2X3WD 4D6WA 1KOGA 1U06A 3M0PA 3OS2A 1QVPA 2GNCA 3M4PA 3NEMA 5ECAA 1YJ9A 3O5ZA 4KUIA 4CC2A 3JCMW 1SF9A 4CS3A 1YITQ 2A8EA 1VQ5T 1LJOA 3CCRA 4PJNA 1M4ZA 1GL5A 3CD6Q 1BI2A 2ODRD 2R58A 2RHSA 4P72C 2DXTA 2JN0A 4RMFA 1OI1A 4QVZA 3LYIA 3TEHB 4OMNA 3VS3A 5GAOl 3EFSA 1JB0E 1PD0A 4C8QB 4NOYA 5GAMf 1X54A 2ZT8A 4PG3A 1H4SA 3TSZA 1N9RA 4LUEA 2AZSA 2MPXC 2PZ1A 2VXEA 4FYWB 3WXMB 2IY5A 2AZVA 2E6ZA 2KDSA 4PLLA 3QXEB 4KGXB 2D0NA 1B34B 1UJYA 1NBEB 3GLXA 3FC3A 4E47A 2RH2A 4LDWA 5GAN7 4BE1A 4J9CA 3SEMA 2AKWA 2HQHA 2HD0A 3CD6T 3EGXB 2BZ8A 1HK9A 4M4ZA 5FLXE 3VQVA 2CP6A 5GAN4 3UWNA 2DFUA 4TWAA 1I5OB 2P4TA 3V7SA 3JCMc 2ARTA 2EL9A 4BE2A 5GAN3 5D6YA 4DBHA 1M5Q1 3INZA 5GANj 2DEUA 2XTIA 1ASYA 3REXA 2K9GA 2CT4A 1VQLA 1W2BS 4CS2A 2CH4A 1UGRB 1AT1B 5IHKA 3LC0A 5HK3A 1B70A 2CSQA 2FPEA 3HPWA 3HRIA 1VQMT 4J9GA 3A8MB 2OX7A 4H2SA 3LSSA 1UG1A 2K7AA 3OS1A 4RQEA 1Q81R 1KD1R 3OW2P 4M77D 1VQ7A 5IH2A 1G3TA 3M59A 2X4XA 2LVMA 2A37A 5C6SA 2ZR3A 4C0FA 3TU4K 4M78E 2ZZGA 4WF2A 4RTVA 1K9MU 2C8MA 3QIIA 3EFOA 2RHSB 1WJSA 4FW2A 1RAFB 4A4KA 3REBB 1Y07A 3OYHA 1QVGA 3RF1A 4KRTA 3HXUA 2VASA 1OU8A 1X2KA 2F5TX 2IG0A 4QQGA 3S6WA 1WQWA 2EGCA 2DL8A 2H3EB 2LX7A 2RN8A 1YHQA 1K1ZA 2IY5B 3VS4A 4JS5A 1NNHA 1WXUA 3CCVT 1M1FA 5GJVB 3TREA 3CCJA 3UGQA 3CC4T 2DL5A 4C5GA 3CCUA 1BBWA 3A8HB 4YYEA 2AKWB 1RAHB 2CZ0B 3JCMd 3M55A 1IZ6A 4BDYA 1ZUKA 4C5EA 5KYUB 4OMMA 3EH1A 2KR3A 1SESA 3QKJA 4KT0E 1RAEB 4F7UG 4IIMA 1BI0A 1T0JA 4AFUC 1PCXA 2LZ6B 2QTVA 2RA2A 3JCMJ 3ZL7C 2NWMA 1JXMA 2A3LA 4G85A 4BI4A 1WZOA 2WSFE 3HTZA 1J3TA 3A7UA 4YRCA 5D6WA 1M30A 1B70B 2WACA 1H4VB 1NYGA 3CCQQ 3H9NA 1VQNT 3CBPA 1VIFA 1ADJA 2CJAA 4B9WA 1EFNA 2DKGA 4KGVB 3NGPA 4JDSA 5AYFA 1G5VA 6AT1B 1QVFS 2X9HA 4H2XA 2A08A 3CCLA 2NUZA 1VYVA 4CH5A 2LCCA 2CKKA 3VUBA 3EFOB 1QLYA 4YRJA 1RADB 3VV0A 4MZPA 1K73U 3MQZA 1W70A 1B7TA 1HXDA 2ZZDA 1UGSB 2K6DA 5DM7R 2BZXA 2E41A 1OOTA 4LVLA 1BCMA 1B8AA 3EHQA 4P3NA 2RHZA 5KYXA 2EPDA 1TG0A 1I8FA 3HHTB 3I9QA 3DSQA 2RD1A 1G8XA 4Z88A 3A8LB 4BWAA 4RTWA 3I55T 2ZXFA 1FMVA 3CC7Q 2L0AA 3VS6A 1QW1A 1VYTA 1PRMC 3J7AF 3VYHB 4F7UE 3E19A 2HZYA 2ZNIA 4N4HA 2FRWA 3C0CA 3U23A 4HVCA 2DZCA 1QCFA 1YB3A 2KYBA 1YI2T 1W2BA 4FT4A 3TSWA 2QA4T 1NJ2A 2DIGA 2O9SA 4A54A 1KHIA 1Q86U 2QHVA 4HVVA 1M1KC 1M90R 4KR3A 1NJIU 4YCWA 3CC7T 4OVAA 4CC7A 3UATA 3G4ST 4P74C 4HWPA 2E65A 1SRYA 4XTVA 2EYQA 1V1CA 3FJ5A 1X2HA 1PNJA 11ASA 4RTXA 3I5RA 1YIJA 1MNDA 1WIEA 3RACA 4OB2B 2HSPA 1FWZA 3M0QA
chains in the Genus database with same CATH topology
3S3OA 4M78A 1C0AA 5FU6B 3L2ZA 4YRKA 3CMQA 4RCBA 3LH0A 4EO4A 5EG2A 3PIPA 2O4XA 3SWNA 4R55A 4XEOA 4N0AA 3FRNA 4M7AD 2ZZEA 3HSBA 4M77E 4RG2A 2H3JA 4ELYC 3CPWA 5HY6A 4RCCA 1KHCA 4C5IA 2B8AA 2PVOB 1V29B 4FU6A 2JUFA 2YRVA 2RHIA 3JB9G 4MDXA 4JRQA 3I56A 2I4NA 4M78F 3A74A 5IN1A 2XU8A 2VGNA 2QQSA 2ZPFB 1Q86C 4CH4A 3CCEA 4PJOC 1WNLA 2BIVA 4FL6A 1SSFA 1QVFA 3PNWC 4P3OA 3TUPA 4TVYA 1ZBXA 2M1HA 1EOVA 3LSQA 4DOVA 2PMEA 3A7AA 3JCMX 4PJOD 3P8BB 5LJ5j 4HCZA 4M78B 3RMSA 3QSUA 3BW1A 3X24B 3OYCA 2Q7EA 1H3ZA 3OD1A 4CH6A 3MEYA 1BI1A 5GAOr 1YJNT 3CC2T 5FRNA 2E5AA 4PLIA 2O4XB 1N8RU 3SWNB 4UP7A 1EIFA 4YRQA 4YPFA 2E70A 3G7ZA 3BDUA 2R5MA 4M75D 2R57A 5HK0A 3ZEHA 4F7UA 3M5AA 3NELA 1Q7YC 4DA4A 4LDXA 2EWNA 4OMFB 3BDLA 3A5ZA 3OA6A 3GIBA 1NYQA 3VUZA 1VQZA 3LGFA 1VQ9T 3GPLA 3ZBDA 4A4GA 1NE8A 4LD9K 4AH6A 4P72A 4RDXA 3X25B 3V7CA 1VUBA 5IAYA 3M9QA 2HQXA 3X28B 3HXXA 4FIBA 3T9NA 2P0QA 2I4MA 2FB7A 3CXCS 4F7UF 2K2VA 1EFWA 4OP0A 1JBMA 3RKXA 1VQ6A 4P75C 4M7DD 4YDQA 2RK1A 3M56A 1Q82U 5HGQA 3MO8A 1YFRA 2GFUA 5GAN2 4ZGEB 5GAN6 2QHSA 2LC4A 2P0PA 3OYGA 1PSEA 4N4IA 1N27A 4F7UB 3RL6A 4M77A 5C51B 5ELNA 1KC8U 3OYMA 4O6JA 4PJOG 3HXYA 3A5ZB 2EIFA 2Y4XA 2ZINA 1Y7XA 4BB7A 3ZFJA 3CCMA 3C94A 4XU2A 3OSVA 2DD4A 4JJNK 5LJ5e 2DAQA 5K1PA 4TQFA 3E1SA 3E9FA 4M7AE 3QTCA 1YCYA 2KVQG 1EVLA 2MWPA 4IKFA 4K87A 3G71T 1UGQB 5LJ3h 5L8RE 2ARUA 5LJ5g 2RHQA 5LJ3d 1YFSA 2DDZA 2E5QA 2DIQA 4M77F 3X26B 2QDYB 1MGQA 3BFMA 3M4YA 4ZTJA 5I2MA 2RM4A 5FROA 4M78G 3O8VA 1YGBA 4TVWA 4HWTA 2RK2A 4M77B 4BY6C 4RG8A 4PJOE 4P73C 3C12A 1VQ8T 2OTLA 2PVDB 3W3SA 2VV5A 4YRRA 4EMKC 2CGHA 4KULA 3CCLT 5CO7A 3OYDA 3MCAB 4XTUA 1YITT 3X20B 3ASKA 5LJ5f 3UT1A 4X34A 1BKBA 2PUOB 3REUA 1JJ2S 2EFIA 2RHXA 3WVEB 4C92D 4YRTA 3OYBA 1XOVA 2OTJA 4FSXA 3KUFA 2D0QB 5A0GA 4M77C 3OYNA 3OYAA 1K8AU 1H4QA 3CXCA 2JOYA 4MZTA 3L2QA 2RHQB 2CJBA 2RHUA 1VQPA 2VC8A 1VQKA 3RIRA 2EQJA 2JTFA 3TEGA 4MZMA 2IVWA 3QO5A 4KBMB 2MI6A 2ZT5A 2WSEE 3JB9F 2DXUA 1E1TA 1N9WA 4LVJA 3HP9A 4XTXA 1NJ1A 4OLFA 2DXCA 3PMTA 2FYKA 1JJCA 3FIFA 3CMEA 2Q7GA 2RI2A 3L4GA 4CRIA 1FYFA 1EQRA 2XIDA 1Y96A 4C8QD 4A53A 3JCMe 4HWOA 2XG8D 4X5OA 2KMTA 4DPGA 3OYIA 1NZ9A 1G3SA 3VQXA 3FJPA 2JTMA 3VU3C 4P74A 2ZPHB 4TQDA 3JCMh 1E22A 3QG1A 3QPHA 1U1SA 4EPCA 3NFCA 3JCMg 4QQDA 1NJ5A 4O2DA 1S72A 3TCJA 3MF2A 2JZ2A 1W4SA 3CPWS 2C7IA 1X01A 1M8VA 4K86A 2DTHA 2K5FA 4HWSA 3OYJA 3RUXA 4YRFA 2RHYA 3QHSA 2QQAA 4UPAA 4M7AA 2RI3A 1BBUA 3JCMV 3OW2A 4IUUA 2XK0A 1K8AC 4YTLA 2HBPA 3GF5A 4BE0A 1R8OB 1BIAA 4IUTA 4XK8E 3P8HA 4Y28E 4II1A 2J3LA 5M9OA 2DQ0A 3OY9A 2MWOA 2F5KA 3L42A 3F70A 3R6OA 1JJCB 3HFZA 1PYSA 4HCCA 3L4GB 2FL7A 4ATOA 3M53A 4J7FA 1K9MC 1Y96B 3JCMf 4KR2A 2QQRA 4L6V5 3CCQT 4H02A 2K5LA 3AHUA 3IALA 3CCET 2E6NA 3NTHA 3BY7A 3R07A 2DXBA 4MDWA 3PCOA 4M7AF 1LNXA 4PJOA 2OAUA 1PSFA 4EMHA 4NS5A 4ME7A 1JJ2A 3QJYA 4HT9A 2CIMA 4CI0C 3Q1JA 1HC7A 4M77G 2LX9A 3WVDB 1YJWT 2QHTA 1VQMA 4E7IA 4OB0B 2EJGA 1E1OA 1HTTA 3HRSA 2P0LA 4XEMA 1JRIA 5GAOp 5GANd 1Q81U 2LDMA 1KD1U 2Q5IA 2YLCA 2KK4A 2O01E 2CZ7B 4IURA 1G3YA 2I4OA 4H2XB 4PJOF 3SB2A 2X4JA 3V8LA 3ER0A 3PGGA 4XU3A 3RESA 5C52B 2M0OA 4WI1A 3HFZB 3P8VA 1PYSB 3RKWA 3NENA 3HRKA 2HAXA 4J6XA 3RKYA 3SD4A 4P3PA 3GP8A 1B7YA 4FM4B 2XDBA 3CCVA 1K73C 1VQ4A 2MAMA 4M7AC 4Q15A 3CC4A 3QDRB 3RGLA 3J81E 4HT8A 4G84A 2E3CA 3PCOB 3HY0A 4OGCA 4YREA 2VUBA 1P92A 4PJOB 3M57A 2E10A 2GCXA 1WYDA 4J6YA 3A8GB 4MMLA 4J7IA 4E7KA 1KG1A 4M7DA 3S3MA 3A31A 2X35A 2KSSA 3FB9A 2LT1A 3MEAA 1VQNA 4ZTZB 3A7RA 3SDZA 1G5HA 1YBYA 3A8OB 3OBWA 4YRGA 4YCVA 3SFMA 2EQUA 4Q6GA 2CYZB 2XD0A 4LDUA 4LD6A 4PNOA 4P75A 1RIQA 2QQ9A 1NJIC 3CMAA 3L2UA 1KD1C 4O5VA 5FRMA 2QEXA 1UB4A 1WJQA 2DTIA 2RJCA 2K3YA 3PTAA 3FLGA 3OYEA 3CBMA 2I2LA 1B7YB 5LJ3j 3G6ET 4M7DF 2ZNJA 3I55A 3CCST 2XDDA 5KCHA 4M75C 2F69A 2Y90A 4HCBA 5I2SA 4LDYA 3META 4E7LA 2DQ3A 5GMKm 4J5YA 2XKOC 2DPPB 1YI2A 3IKMB 2QA4A 1OYXA 1BI3A 4YCUA 5GAOn 4J83A 2G4CA 5CCAA 1M90U 3CEYA 3JCMQ 3CC7A 3G4SA 1YJ9T 3UFGA 4YRPA 5CIUA 3CCRT 4ZGDB 1ATIA 1X55A 4J15A 1M9SA 4TTVA 4RKUE 5A0LA 4OB1B 2E64A 3FEOA 3OS5A 4C0GA 1SERA 2EQMA 1NYRA 2DU5A 4M7AG 1QE0A 1EVKA 4M7DC 3OBYA 1GGMA 1X56A 4P73A 4E7HA 4EMKA 2KAFA 5CVIA 3OQ5A 4GLKA 2ALYA 5GAOm 2D9TA 4H2TA 3HXZA 1FXXA 4LVMA 3C95A 1VQLT 2EJFA 3HFNA 2OTJT 3MEUA 1UGPB 4YROA 4YRSA 1N8RC 4QVCA 1IL2A 4XTZA 4C0DC 5A0DA 3J80E 2E12A 1VQ7T 2LTOA 1WLEA 5A2QE 1I81A 3L2WA 3TEHA 5GAOq 4OGEA 2ZIMA 2YHTA 1U1TA 1XQHA 3HFOA 3CMET 1VIEA 2ZIOA 2ARSA 3BJUA 4P71C 3A32A 1U8RA 5LJ3e 3V7RA 5DLOA 2XGTA 3OYLA 4P5NA 1YHQT 5KE3A 2GFAA 5FU7C 1RI0A 4UP9A 4BY6B 3CCJT 5GAMd 1D3BA 3CCUT 2KQWA 1M1GA 4M75G 5LJ3g 4MMKA 3OW2S 4EMKB 3I7FA 4YRMA 4J8OA 4XTYA 3UPUA 1YJNA 4IUPA 2VGMA 2ALYB 2PMFA 1FX7A 2NS6A 4L5GA 2P0KA 4X9DA 2J3MA 3LLRA 2HQEA 1B76A 1NPRA 1XNIA 3G1ZA 2L89A 5C0MA 4E51A 2QTXA 2C06A 1G5IA 2A7YA 4DQ2A 1Q82C 4BW9A 4BUGA 3M54A 5J26A 4ZTUB 1I5LA 4L59A 5CKHA 3RMQA 2ZTGA 2ZT6A 1OZ3A 3A5YA 4C92C 3V8KA 1VQ9A 3QO8A 1KC8C 5KCOA 5J3BA 5GAN8 1VQOA 5LJ3f 3M58A 1KQ1A 4C0ZA 1YFTA 3E9IA 4M7DG 1EIYA 4A4EA 3EAEA 3LWHA 4HWRA 4M75E 3PZCA 5CKEA 3QNEA 1LOJA 1D3BB 3QO3A 4KUDK 4LDVA 2ZPGB 1KMNA 2RO0A 1TH7A 4WJ4A 4C8QC 3QUIA 2Y4YA 3P8YA 5C53B 4Z02A 3LW5E 3PT9A 2K3XA 3WQZA 4K88A 1AHJB 3JB9H 4YRIA 3IKLA 1BIBA 5KH6A 2QQBA 2K5IA 2M9UA 1YIJT 3PIOA 3OMCA 5CQYA 3N5BB 3UDCA 5GAN5 4PKCC 2CJ9A 4L87A 3OYFA 4M7DE 2VXFA 2ZZFA 3MP8A 3ERRA 2KY9A 2PUKB 2RI5A 3G71A 1VQ4T 1EIYB 4JRIA 3RERA 3KXTA 4RMOA 2LRQA 4A4HA 2RJDA 2V8KA 3E9GA 4VUBA 1E24A 4KQEA 5GMKe 2LQ8A 2HNIA 4XAXB 3JB9J 4EX5A 4JRKA 1VQ5A 2GF7A 2BKDN 1M1KU 1WGSA 2G3RA 5GMKh 3CPFA 4E7JA 1GXIE 1QF6A 2L8DA 1ASZA 1Z7MA 3HRUA 2RB6A 5CAIA 3I56T 3DLLA 1VQ8A 4GY5A 2P5IA 4IUQA 1IREB 4C92G 4ELZC 1ZHIA 1YITA 3CMAT 3JB9D 2LNVA 3OS0A 3CD6A 3VQYA 4YRNA 2ZPEB 2LQKA 1LYLA 4JLIA 3QYGB 5E3IA 1G3WA 4HKEA 4H2UA 2QEXT 4C5HA 2EJ9A 1NJ6A 2GQVA 4N4GA 3NETA 2V8IA 2PU9B 1UEBA 3GOXA 1WPYA 3ME9A 4BD3A 5GANe 3GNGA 3HFVA 1KQ2A 1KQSS 3VJPA 4CS4A 3JSCA 2BUDA 1X75C 3NTIA 3DLMA 5D6XA 4M7AB 2DVEA 5GANh 5DLQE 4M75A 4C8QG 4UC4A 5GANg 3ICAA 4YP0A 5I21A 3JRZA 3S3NA 4NL3A 2DEQA 3HRTA 2LT4A 4TVRA 3VBBA 2ZPBB 5LL6S 4QVDA 2V8JA 4H2YA 4LVIA 3MP6A 2K57A 2QHUA 3KBGA 3HXWA 4WJ3M 4ZGJB 2QXFA 4ZIBA 4C92E 4Y91A 4H2WA 4HT4A 4PL6A 3OB9A 12ASA 5ELOA 3HL8A 5DY9A 2ZT7A 3GNFB 1O9SA 4YRLA 4OB3B 4J6WA 5CKFA 4JRPA 1N9SA 3L2RA 1I4K1 1WJRA 4M75F 3JCMb 1WQ7A 2AMCA 4XU1A 3QZ5B 2DK3A 5GANf 2X4WA 2M16A 3IG2A 4H2VA 2Q5HA 2XHCA 4LVKA 3MP1A 4BI8B 1VQ6T 1QP2A 2LCLA 4C8QE 4QQ6A 3HY1A 3OYKA 1Q7YU 1SETA 3FDRA 4M75B 2Q7HA 3KFUA 1WU7A 1G51A 5FU6C 1Q81C 4DOWA 2CS7A 2ZGWA 3C4SA 2RJEA 2FVUA 3CBOA 5HKCA 2AHJB 4BI3A 1ZQ1A 3CCQA 3HXVA 3E9HA 2JVVA 1QP3A 1O75A 2DU7A 5GAMj 3VYGA 3OMGA 1MHNA 5CKBA 3CCMT 4XTWA 3QZ9B 3DB3A 1N6AA 4ZTFA 3MF1A 4LNSA 1USYA 2JNGA 3MEVA 1DJ7B 5J39A 2CZ6B 2D6FA 2EAYA 4P71A 2L3RA 3LGLA 1YJWA 1BYMA 2AMCB 4R56A 4BDZA 1H4TA 4IUVA 4UP8A 1KQSA 1X2GA 4Q5WA 4CH3A 4RQFA 2XI9A 3H8ZA 4M7DB 1W66A 2I4LA 1OZ2A 2EQKA 3HKSA 3JB9I 2PQWA 5CR2A 4NL2A 2DZ9A 4HA8A 2ZR2A 5IT9E 4TVAA 1NPPA 3NTKA 3EFRA 3H6ZA 2DO3A 3UGTA 1X6OA 4M78C 2EKOA 3L1AA 2ZPIB 4EMGA 2FHDA 2OTLT 2ZCEA 1Y71A 4B9XA 4C0DB 4A4FA 3LWIA 3M4GA 4M78D 4X9CA 2PVGB 3V8JA 3SWNC 4FT2A 4N0AC 3MHXA 1XTDA 3VQWA 4C92A 1VQOT 2QI2A 2ZCFB 3MEWA 3QBYA 2WSCE 3VKIA 4QW2A 3P8TA 3LX7A 3URGA 2XICA 3PMIA 2MF2A 3QO7A 1H641 2K4YA 3OSSC 4JLGA 5FU7B 1VQPT 1VQKT 3QJ6A 1J5WA 5KNNA 4ZN3A 4OF1A 3L2VA 1USYC 1M90C 4TVAB 3OYYA 2DD5A 1QVGS 4JS4A 4ZN1A 4C8QA 4C92F 5F5WA 5GAMe 5GMKl 4BACA 1ADYA 1L0WA 2VYTA 2CZ1B 1B34A 2R5AA 2DTOA 3UH0A 4JUVA 1NJ8A 3PFSA 2RJFA 5GMKi 4XQ3A 3G6EA 5GAMh 2XDPA 3QYHB 5CK9A 3JCMP 3CCSA 5GAMg 3DB4A 5CQXA 3DKMA 3TEEA 4C92B 3CC2A 1S72T 2L5QA 3P8DA 2E1HA 2YLBA 5LJ5h 5CKDA 5K1XA 2NLUA 4EDUA 3JAME 5LJ5d 4NCXA 5KE2A 1RL2A 3M4QA 5GMKj 1Z7NA 4PHCA 2MMPA 4V2SA 4XU0A 1KMMA 4C8QF 2ODRC 2X4YA 2DJZA 4D6WA 1KOGA 3OS2A 1QVPA 3M4PA 3NEMA 1YJ9A 4KUIA 3JCMW 4CS3A 2A8EA 1VQ5T 1LJOA 3CCRA 1M4ZA 1BI2A 2ODRD 2R58A 2RHSA 4P72C 2DXTA 2JN0A 4RMFA 1OI1A 4QVZA 3LYIA 3TEHB 5GAOl 3EFSA 1JB0E 4C8QB 4NOYA 5GAMf 1X54A 2ZT8A 4PG3A 1H4SA 1N9RA 3WXMB 2IY5A 2VXEA 2E6ZA 2KDSA 4PLLA 3QXEB 1B34B 3GLXA 3FC3A 4E47A 2RH2A 4LDWA 5GAN7 4BE1A 2AKWA 2HD0A 3CD6T 1HK9A 5FLXE 3VQVA 5GAN4 3UWNA 4TWAA 2P4TA 3V7SA 3JCMc 2EL9A 2ARTA 4BE2A 5GAN3 5D6YA 1M5Q1 3INZA 5GANj 1ASYA 2XTIA 3REXA 1VQLA 1W2BS 4CS2A 1UGRB 3LC0A 5HK3A 1B70A 3HPWA 3HRIA 1VQMT 3A8MB 4H2SA 3LSSA 3OS1A 4RQEA 4M77D 1VQ7A 1G3TA 3M59A 2X4XA 2LVMA 5C6SA 2ZR3A 4C0FA 3TU4K 4M78E 2ZZGA 4WF2A 1K9MU 2C8MA 3QIIA 2RHSB 1WJSA 1QVGA 4A4KA 1Y07A 3OYHA 3RF1A 3HXUA 2IG0A 2F5TX 4QQGA 3S6WA 1WQWA 1YHQA 2IY5B 4JS5A 1NNHA 3CCVT 1M1FA 3TREA 3CCJA 3UGQA 3CC4T 4C5GA 3CCUA 1BBWA 3A8HB 4YYEA 2AKWB 2CZ0B 3JCMd 3M55A 1IZ6A 4BDYA 4C5EA 1SESA 3QKJA 4KT0E 4F7UG 1BI0A 2RA2A 3JCMJ 2A3LA 4G85A 4BI4A 2WSFE 3HTZA 3A7UA 4YRCA 5D6WA 1B70B 2WACA 1H4VB 1VQNT 3CBPA 1VIFA 1ADJA 2CJAA 4B9WA 2DKGA 4JDSA 5AYFA 1G5VA 1QVFS 4H2XA 3CCLA 4CH5A 2LCCA 2CKKA 3VUBA 4YRJA 3VV0A 4MZPA 1K73U 3MQZA 1HXDA 2ZZDA 1UGSB 5DM7R 2E41A 4LVLA 1B8AA 4P3NA 2RHZA 1I8FA 3HHTB 3DSQA 2RD1A 3A8LB 4BWAA 3I55T 2ZXFA 1QW1A 3J7AF 3VYHB 4F7UE 3E19A 2ZNIA 4N4HA 4HVCA 2DZCA 1YB3A 1YI2T 1W2BA 4FT4A 2QA4T 1NJ2A 2DIGA 4A54A 1KHIA 1Q86U 2QHVA 1M1KC 4KR3A 1NJIU 4YCWA 3CC7T 4OVAA 4P74C 3G4ST 4HWPA 2E65A 1SRYA 4XTVA 2EYQA 1X2HA 11ASA 1YIJA 3RACA 4OB2B 1FWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M78 C;  2C7I A;  3G1Z A;  1X01 A;  4E51 A;  1M8V A;  4K86 A;  4M78 A;  2DTH A;  2QTX A;  4HWS A;  1G5I A;  1C0A A;  4DQ2 A;  3L2Z A;  3L1A A;  4BW9 A;  3RUX A;  4YRF A;  3QHS A;  4EMG A;  4ZTU B;  4YRK A;  1I5L A;  3CMQ A;  2ZCE A;  4UPA A;  4M7A A;  4RCB A;  1BBU A;  3JCM V;  3M4G A;  4M78 D;  4EO4 A;  4X9C A;  2ZTG A;  3V8J A;  2ZT6 A;  3A5Y A;  3SWN C;  4N0A C;  4C92 C;  3SWN A;  3V8K A;  3QO8 A;  1BIA A;  4XEO A;  4N0A A;  3VQW A;  4C92 A;  2J3L A;  4M7A D;  2DQ0 A;  3HSB A;  2ZZE A;  4M77 E;  5GAN 8;  4RCC A;  5LJ3 f;  1JJC B;  3HFZ A;  1KQ1 A;  3P8T A;  1PYS A;  3L4G B;  1YFT A;  3E9I A;  4M7D G;  3JB9 G;  1EIY A;  1Y96 B;  3JCM f;  4KR2 A;  4H02 A;  3AHU A;  3QO7 A;  2I4N A;  3IAL A;  4M78 F;  1H64 1;  4HWR A;  3A74 A;  4M75 E;  3PZC A;  3QNE A;  1LOJ A;  3BY7 A;  3R07 A;  4CH4 A;  1J5W A;  1D3B B;  3QO3 A;  4PJO C;  1WNL A;  3PCO A;  5KNN A;  4M7A F;  1LNX A;  1KMN A;  4PJO A;  4P3O A;  3TUP A;  4EMH A;  4TVY A;  1TH7 A;  1USY C;  4TVA B;  4HT9 A;  4WJ4 A;  2CIM A;  1EOV A;  4C8Q C;  3LSQ A;  3QUI A;  4C8Q A;  4C92 F;  2PME A;  3A7A A;  3P8Y A;  3JCM X;  4PJO D;  1HC7 A;  5C53 B;  4M77 G;  5F5W A;  5LJ5 j;  5GAM e;  4M78 B;  5GMK l;  1ADY A;  2QHT A;  3QSU A;  1L0W A;  1B34 A;  2EJG A;  2DTO A;  1E1O A;  3BW1 A;  3UH0 A;  3WQZ A;  4JUV A;  1NJ8 A;  4K88 A;  5GMK i;  1HTT A;  4XQ3 A;  2Q7E A;  5GAM h;  3JB9 H;  2P0L A;  3IKL A;  4YRI A;  3OD1 A;  1BIB A;  4XEM A;  4CH6 A;  1JRI A;  5GAO p;  3JCM P;  3MEY A;  5GAN d;  5GAO r;  5GAM g;  2E5A A;  2Q5I A;  3SWN B;  4UP7 A;  2YLC A;  4YRQ A;  4YPF A;  4C92 B;  2I4O A;  5GAN 5;  4H2X B;  2E1H A;  3BDU A;  4PJO F;  2CJ9 A;  2YLB A;  3SB2 A;  5LJ5 h;  5K1X A;  3V8L A;  4M75 D;  3PGG A;  4L87 A;  4XU3 A;  2VXF A;  3RES A;  4M7D E;  5C52 B;  5LJ5 d;  2ZZF A;  4F7U A;  4NCX A;  4WI1 A;  3NEL A;  3HFZ B;  3P8V A;  3M4Q A;  5GMK j;  1PYS B;  1Z7N A;  4PHC A;  3RKW A;  4V2S A;  3NEN A;  4XU0 A;  3ERR A;  3HRK A;  1KMM A;  4C8Q F;  2ODR C;  4J6X A;  4JRI A;  3RKY A;  1EIY B;  3RER A;  4P3P A;  1B7Y A;  2EWN A;  2DJZ A;  1KOG A;  3A5Z A;  4M7A C;  4Q15 A;  3GIB A;  3M4P A;  3NEM A;  1NYQ A;  1E24 A;  1VQZ A;  4KQE A;  3JCM W;  4G84 A;  4HT8 A;  5GMK e;  2E3C A;  3RGL A;  4CS3 A;  2HNI A;  3PCO B;  3HY0 A;  1LJO A;  4YRE A;  4PJO B;  3JB9 J;  4EX5 A;  2ODR D;  2E10 A;  2RHS A;  4P72 C;  4JRK A;  4AH6 A;  2DXT A;  2JN0 A;  4P72 A;  4RMF A;  4RDX A;  3TEH B;  1WYD A;  5GAO l;  5GMK h;  3V7C A;  4J6Y A;  3EFS A;  4MML A;  4C8Q B;  1QF6 A;  1ASZ A;  4NOY A;  5GAM f;  1X54 A;  2ZT8 A;  3HXX A;  4PG3 A;  1H4S A;  1N9R A;  1Z7M A;  2IY5 A;  2I4M A;  2VXE A;  2FB7 A;  4M7D A;  3A31 A;  2RB6 A;  5CAI A;  3FB9 A;  1B34 B;  4F7U F;  4ZTZ B;  3A7R A;  1G5H A;  4YRG A;  5GAN 7;  2P5I A;  4YCV A;  4C92 G;  2AKW A;  4OP0 A;  1EFW A;  4Q6G A;  1JBM A;  1HK9 A;  3RKX A;  4P75 C;  4M7D D;  3VQV A;  5GAN 4;  3JB9 D;  4TWA A;  4P75 A;  4PNO A;  4YDQ A;  5HGQ A;  1RIQ A;  3V7S A;  2ART A;  3JCM c;  1YFR A;  2EL9 A;  3VQY A;  4YRN A;  5GAN 3;  1LYL A;  1M5Q 1;  3INZ A;  4JLI A;  5GAN j;  2XTI A;  1ASY A;  3REX A;  5E3I A;  5GAN 2;  4H2U A;  5GAN 6;  4CS2 A;  2EJ9 A;  1NJ6 A;  2QHS A;  3LC0 A;  3NET A;  1B70 A;  4F7U B;  3RL6 A;  4M77 A;  3HRI A;  1WPY A;  2DTI A;  5C51 B;  5ELN A;  2I2L A;  5GAN e;  3HFV A;  1KQ2 A;  1B7Y B;  5LJ3 j;  4CS4 A;  4PJO G;  4H2S A;  3LSS A;  3HXY A;  4RQE A;  4M7D F;  2ZIN A;  2ZNJ A;  4M77 D;  4M7A B;  2DVE A;  4XU2 A;  5GAN h;  4M75 C;  2ZR3 A;  4M78 E;  2ZZG A;  5LJ5 e;  4M75 A;  4C8Q G;  4WF2 A;  2C8M A;  2Y90 A;  5GAN g;  5K1P A;  2RHS B;  3ICA A;  4TQF A;  4YP0 A;  2DQ3 A;  5GMK m;  5I21 A;  4J5Y A;  4NL3 A;  4M7A E;  3RF1 A;  3HXU A;  3QTC A;  1YCY A;  3IKM B;  1EVL A;  2DEQ A;  1WQW A;  4YCU A;  5GAO n;  4K87 A;  3VBB A;  4QVD A;  5LJ3 h;  2ARU A;  2IY5 B;  4H2Y A;  2K57 A;  5LJ5 g;  2G4C A;  1NNH A;  2QHU A;  3HXW A;  4WJ3 M;  2RHQ A;  5LJ3 d;  4ZIB A;  4C92 E;  1YFS A;  4Y91 A;  2DDZ A;  4M77 F;  3JCM Q;  3UGQ A;  4H2W A;  3UFG A;  1BBW A;  1MGQ A;  12AS A;  2AKW B;  3BFM A;  5ELO A;  3JCM d;  4YYE A;  5DY9 A;  2ZT7 A;  4YRP A;  2RM4 A;  1SES A;  1ATI A;  4YRL A;  1X55 A;  4J6W A;  4J15 A;  1N9S A;  4F7U G;  2RA2 A;  4TTV A;  3JCM J;  4G85 A;  1I4K 1;  2E64 A;  4M75 F;  4M78 G;  3JCM b;  1WQ7 A;  1YGB A;  3HTZ A;  3A7U A;  4YRC A;  2AMC A;  4TVW A;  1SER A;  4XU1 A;  4HWT A;  1B70 B;  4M77 B;  1NYR A;  5GAN f;  1H4V B;  4PJO E;  2DU5 A;  4M7A G;  1QE0 A;  1EVK A;  4M7D C;  4P73 C;  1GGM A;  3IG2 A;  1X56 A;  1ADJ A;  3W3S A;  4H2V A;  2CJA A;  2Q5H A;  4YRR A;  4P73 A;  2DKG A;  4EMK C;  2CGH A;  4EMK A;  4XTU A;  4C8Q E;  2ALY A;  4H2X A;  5GAO m;  5LJ5 f;  3HY1 A;  1SET A;  4CH5 A;  3REU A;  4H2T A;  3HXZ A;  4M75 B;  2Q7H A;  2EJF A;  3HFN A;  4YRJ A;  3KFU A;  1WU7 A;  4C92 D;  4YRT A;  1G51 A;  1HXD A;  2ZGW A;  4YRO A;  4YRS A;  4QVC A;  2E41 A;  1IL2 A;  4M77 C;  4XTZ A;  1B8A A;  4P3N A;  1H4Q A;  1I8F A;  3HXV A;  2RHQ B;  3E9H A;  2CJB A;  3DSQ A;  2VC8 A;  2RD1 A;  2DU7 A;  3RIR A;  5GAM j;  4BWA A;  3TEG A;  2ZXF A;  3QO5 A;  4XTW A;  1WLE A;  2ZT5 A;  1I81 A;  3MF1 A;  3TEH A;  3JB9 F;  4F7U E;  5GAO q;  2ZIM A;  4LNS A;  2YHT A;  2DXU A;  1USY A;  2ZNI A;  1U1T A;  1E1T A;  1N9W A;  4HVC A;  4XTX A;  1NJ1 A;  3HFO A;  4OLF A;  2DZC A;  2ZIO A;  2ARS A;  3BJU A;  1YB3 A;  2FYK A;  4P71 C;  1JJC A;  3FIF A;  3A32 A;  2EAY A;  2Q7G A;  3L4G A;  5LJ3 e;  3V7R A;  4P71 A;  1NJ2 A;  1FYF A;  1EQR A;  4A54 A;  2XGT A;  1Y96 A;  2AMC B;  4C8Q D;  4A53 A;  1H4T A;  3JCM e;  2QHV A;  4HWO A;  4X5O A;  4UP9 A;  4UP8 A;  4DPG A;  4KR3 A;  1X2G A;  4YCW A;  4CH3 A;  4RQF A;  5GAM d;  3VQX A;  4P74 C;  4M7D B;  1D3B A;  3FJP A;  4HWP A;  2E65 A;  1W66 A;  3VU3 C;  2I4L A;  4P74 A;  4M75 G;  5LJ3 g;  4MMK A;  4XTV A;  1SRY A;  4TQD A;  4EMK B;  3JB9 I;  3I7F A;  1X2H A;  4YRM A;  3JCM h;  1E22 A;  11AS A;  4NL2 A;  2DZ9 A;  4XTY A;  4HA8 A;  2PMF A;  2ALY B;  2ZR2 A;  1U1S A;  3RAC A;  4TVA A;  3JCM g;  1NJ5 A;  4O2D A;  4X9D A;  3EFR A;  2J3M A;  3MF2 A;  1B76 A;  3UGT A; 
#chains in the Genus database with same CATH topology
 4KH1 B;  3S3O A;  2JXB A;  4M78 A;  1C0A A;  2VVK A;  4LN2 A;  5FU6 B;  3L2Z A;  4YRK A;  3CMQ A;  2GTJ A;  5KYX B;  4RCB A;  1G2B A;  3LH0 A;  4EO4 A;  5EG2 A;  2IIM A;  3PIP A;  2O4X A;  1E7O A;  1RAI B;  3SWN A;  4R55 A;  1X2Q A;  4XEO A;  4N0A A;  1UUE A;  3FRN A;  1TXQ A;  4M7A D;  2ZZE A;  3HSB A;  4M77 E;  2KI7 A;  4RG2 A;  1SPK A;  3REA B;  2H3J A;  4ELY C;  3CPW A;  5HY6 A;  3EG0 A;  4RCC A;  1KHC A;  1VA7 A;  4C5I A;  2B8A A;  2PVO B;  1R0C B;  2GGR A;  1V29 B;  2A0F B;  4FU6 A;  2JUF A;  2YRV A;  4ORZ A;  2RHI A;  3JB9 G;  4MDX A;  4JRQ A;  3VS0 A;  1KQS P;  3I56 A;  2I4N A;  4M78 F;  1M2O A;  3A74 A;  5IN1 A;  1KIK A;  2XU8 A;  3AT1 B;  3G6E Q;  4LNP A;  2JT4 A;  2VGN A;  2QQS A;  2ZPF B;  1Q86 C;  4CH4 A;  3CCE A;  4PJO C;  1WNL A;  2BIV A;  4FL6 A;  1SSF A;  1QVF A;  3PNW C;  1JXO A;  4P3O A;  3TUP A;  4TVY A;  2YDL A;  3M0R A;  1ZBX A;  1OEB A;  3CC2 Q;  2M1H A;  1BB9 A;  1RUW A;  1EOV A;  2CSI A;  3LSQ A;  4CC3 A;  3QWX X;  4DOV A;  2X51 A;  4F14 A;  2PME A;  2SEM A;  3A7A A;  2KRO A;  3JCM X;  4PJO D;  3P8B B;  2HKN A;  4JZ4 A;  4RUG A;  5LJ5 j;  4HCZ A;  4M78 B;  3RMS A;  3QSU A;  4QT7 A;  3BW1 A;  3X24 B;  3OYC A;  2DA9 A;  2Q7E A;  1YJ9 Q;  1H3Z A;  3OD1 A;  1FYN A;  4CH6 A;  3MEY A;  1BI1 A;  4HCK A;  3CCR Q;  5GAO r;  1YJN T;  3CC2 T;  5FRN A;  2E5A A;  4PLI A;  2O4X B;  1N8R U;  3SWN B;  2E3I A;  4UP7 A;  1EIF A;  4YRQ A;  4YPF A;  1VQ9 Q;  1ZSG A;  2V26 A;  2E70 A;  3G7Z A;  3PVQ A;  3BDU A;  2R5M A;  4M75 D;  2R57 A;  5HK0 A;  3ZEH A;  4F7U A;  3M5A A;  3NEL A;  4E2F B;  1Q7Y C;  4DA4 A;  4LDX A;  2E3H A;  2KRM A;  1RAA B;  2EWN A;  4OMF B;  4PFO A;  3BDL A;  1HD3 A;  3A5Z A;  2EGA A;  5I22 A;  3OA6 A;  4RTU A;  3GIB A;  2FPD A;  1JU5 C;  1NYQ A;  3VUZ A;  1VQZ A;  3LGF A;  1VQ9 T;  2CP5 A;  3GPL A;  3ZBD A;  4Z8A A;  4A4G A;  1NE8 A;  2QAZ A;  4LD9 K;  4AH6 A;  4P72 A;  4RDX A;  2HSE B;  3X25 B;  3V7C A;  1VUB A;  5IAY A;  3M9Q A;  1ZA1 B;  2HQX A;  3X28 B;  3HXX A;  4FIB A;  3T9N A;  2P0Q A;  2I4M A;  2FB7 A;  1JEG A;  2B86 A;  2LQN A;  1MMN A;  3CXC S;  2JW4 A;  4F7U F;  2JMC A;  3E2U A;  1SKU B;  2K2V A;  2ECZ A;  1EFW A;  4OP0 A;  1VQ7 Q;  1JBM A;  1ZX6 A;  3RKX A;  1VQ6 A;  4P75 C;  4M7D D;  2DIL A;  2RK1 A;  4YDQ A;  3M56 A;  1Q82 U;  5HGQ A;  3MO8 A;  1X27 A;  1YFR A;  2E4H A;  4ZNX A;  2RQU A;  1PG5 B;  2RMO A;  2GFU A;  5GAN 2;  3I35 A;  4ZGE B;  1OX9 A;  5GAN 6;  2QHS A;  2LC4 A;  2P0P A;  3OYG A;  2NYS A;  1PSE A;  2MIO A;  4N4I A;  2G6F X;  1N27 A;  4F7U B;  2DE0 X;  3RL6 A;  4M77 A;  1WHL A;  5C51 B;  3CQT A;  4DBQ A;  5ELN A;  1KC8 U;  1YCS B;  2ENM A;  3OYM A;  5IHI A;  4PFP A;  4O6J A;  4PJO G;  3CCJ Q;  3HXY A;  3A5Z B;  1AEY A;  2EIF A;  2Y4X A;  4Y92 A;  2ZIN A;  1Y7X A;  3EHR A;  4BB7 A;  3ZFJ A;  3CCM A;  3C94 A;  2AK5 A;  4XU2 A;  2LNH B;  3OSV A;  2DD4 A;  2FZC B;  4JJN K;  5LJ5 e;  2DAQ A;  5K1P A;  1RAB B;  4TQF A;  3E1S A;  3E9F A;  4M7A E;  3QTC A;  1YP5 A;  1YCY A;  2KVQ G;  1EVL A;  2MWP A;  4IKF A;  4K87 A;  1D0X A;  5AT1 B;  3G71 T;  1UGQ B;  5LJ3 h;  5L8R E;  2ARU A;  5LJ5 g;  2RHQ A;  2QK0 A;  5LJ3 d;  1YFS A;  2DDZ A;  2E5Q A;  2DIQ A;  4M77 F;  2DL4 A;  3X26 B;  1ZSZ C;  1VQ8 Q;  2QDY B;  1MGQ A;  2KBT A;  3BFM A;  3M4Y A;  4Z89 A;  4ZTJ A;  5I2M A;  3CCL Q;  1VYU A;  2RM4 A;  2ESW A;  5FRO A;  2DRK A;  1QKW A;  5KYY A;  1PHT A;  4IIO A;  1RLP C;  2FPF A;  1BCO A;  4M78 G;  3O8V A;  1QCO A;  1UDL A;  1YGB A;  2DM1 A;  1UEC A;  4TVW A;  4HWT A;  1ABQ A;  2RK2 A;  5D7U A;  4M77 B;  2DJQ A;  4BY6 C;  4RG8 A;  4E6R A;  4PJO E;  1IGQ A;  4P73 C;  3C12 A;  1VQ8 T;  3NMZ C;  2OTL A;  2PVD B;  4LUD A;  2VV5 A;  3W3S A;  4YRR A;  4PJL A;  2YWW A;  1MMA A;  4EMK C;  2CGH A;  4KUL A;  2ROL A;  3CCL T;  2QDL A;  5CO7 A;  4AG1 C;  1X6G A;  3OYD A;  3MCA B;  4XTU A;  1YIT T;  3UF4 A;  3X20 B;  3ASK A;  1CKA A;  5LJ5 f;  3UT1 A;  4X34 A;  1BKB A;  1D0Y A;  2PUO B;  1JJ2 S;  3REU A;  3M0T A;  2EFI A;  2RHX A;  4LE9 A;  3VS1 A;  1QVG P;  3WVE B;  4C92 D;  4YRT A;  3OYB A;  1XOV A;  5L23 A;  2DVJ A;  2OTJ A;  4FSX A;  3KUF A;  2D0Q B;  1OQK A;  5A0G A;  4M77 C;  3RR6 A;  3OYN A;  3OYA A;  1K8A U;  1H4Q A;  2PTK A;  3CXC A;  2JOY A;  2LJ0 A;  4MZT A;  3L2Q A;  2RHQ B;  2CJB A;  1QWE A;  2RHU A;  1VQP A;  2VC8 A;  1VQK A;  3RIR A;  2EQJ A;  2JTF A;  3TEG A;  4MZM A;  2IVW A;  3QO5 A;  4KBM B;  2MI6 A;  2Z0W A;  2ZT5 A;  2ABL A;  2WSE E;  2KEA A;  3UA7 A;  3JB9 F;  1GBQ A;  1X6B A;  3QWY A;  4JJC A;  2DXU A;  1E1T A;  1N9W A;  4LVJ A;  3HP9 A;  4XTX A;  1NJ1 A;  4OLF A;  2DXC A;  5KYY B;  1H92 A;  3PMT A;  1I07 A;  2FYK A;  1JJC A;  3FIF A;  3CME A;  2Q7G A;  2E5K A;  2RI2 A;  3L4G A;  4CRI A;  1R0B G;  1FYF A;  1EQR A;  3ULR B;  2XID A;  1Y96 A;  2COZ A;  4OML A;  4C8Q D;  4A53 A;  3JCM e;  4HWO A;  2XG8 D;  4X5O A;  2KMT A;  4DPG A;  3OYI A;  1NZ9 A;  1WLP B;  1G3S A;  3VQX A;  2YUO A;  3FJP A;  2JTM A;  1LCK A;  3VU3 C;  4P74 A;  2YUN A;  2ZPH B;  4TQD A;  4KGZ B;  1UE9 A;  1IXD A;  3JCM h;  1E22 A;  3QG1 A;  3QPH A;  3VS2 A;  1U1S A;  2FZG B;  4EPC A;  2YRC A;  3NFC A;  3JCM g;  4QQD A;  1NJ5 A;  4O2D A;  1S72 A;  3TCJ A;  3MF2 A;  2QYZ A;  2JZ2 A;  1I0C A;  2M0Y A;  1IHW A;  1W4S A;  3CPW S;  2EYY A;  1S1N A;  2C7I A;  1X01 A;  1M8V A;  4K86 A;  2DTH A;  2K5F A;  2HEQ A;  4HWS A;  4FCY A;  3OYJ A;  3RUX A;  4YRF A;  2RHY A;  3QHS A;  1TWB A;  3I56 Q;  1HSQ A;  4JPB W;  1ZA2 B;  2QQA A;  4UPA A;  4M7A A;  2RI3 A;  1BBU A;  3JCM V;  3OW2 A;  4J9F A;  4IUU A;  1GCP A;  3CCE Q;  2XK0 A;  1K8A C;  4YTL A;  2HBP A;  3GF5 A;  4BE0 A;  2FO0 A;  1R8O B;  1BIA A;  2FEI A;  4IUT A;  4XK8 E;  3P8H A;  2RQT A;  4Y28 E;  4II1 A;  2J3L A;  4F17 A;  5M9O A;  2DQ0 A;  3OY9 A;  2J06 A;  1M3C A;  2MWO A;  4CC4 B;  5I11 A;  1YWP A;  4FYV B;  1C6V X;  2W10 A;  3UA6 A;  1D1A A;  2F5K A;  3L42 A;  1T0H A;  1W2B P;  1WDX A;  1NEB A;  3F70 A;  3R6O A;  4A63 B;  2EYW A;  1JJC B;  3HFZ A;  2DL3 A;  1PYS A;  4HCC A;  3L4G B;  2FL7 A;  4ATO A;  3M53 A;  4J7F A;  2KXD A;  1K9M C;  4LXC A;  1Y96 B;  3JCM f;  4KR2 A;  2QQR A;  4L6V 5;  3CCQ T;  4H02 A;  1YJW Q;  2K5L A;  3AHU A;  1UHC A;  3IAL A;  3CCE T;  4HXJ A;  1TU0 B;  2E6N A;  3NTH A;  1I1J A;  3BY7 A;  3R07 A;  2DXB A;  4MDW A;  3PCO A;  4M7A F;  1LNX A;  4PJO A;  2OAU A;  1PSF A;  4EMH A;  4NS5 A;  4ME7 A;  1JJ2 A;  3QJY A;  4HT9 A;  2JTE A;  2CIM A;  3H0F A;  4CI0 C;  3Q1J A;  1HC7 A;  4M77 G;  3TQ7 P;  2LX9 A;  3WVD B;  1YJW T;  4AG2 C;  2QHT A;  1F1B B;  1VQM A;  1PKS A;  4OB0 B;  4E7I A;  2EJG A;  1E1O A;  2BE7 D;  1OX8 A;  1X43 A;  3TVT A;  1HTT A;  3HRS A;  1XJW B;  2P0L A;  1AOJ A;  1D1C A;  4XEM A;  1JRI A;  5GAO p;  5GAN d;  1Q81 U;  2LDM A;  1KD1 U;  2Q5I A;  1PC0 A;  1WHG A;  1MV3 A;  2YLC A;  8AT1 B;  2KK4 A;  2O01 E;  2LJ3 A;  1OV3 A;  2CZ7 B;  4IUR A;  1G3Y A;  2I4O A;  9ATC B;  4H2X B;  4PJO F;  1YFN A;  3EGU A;  3SB2 A;  2X4J A;  3V8L A;  3ER0 A;  1PKT A;  3PGG A;  1KK7 A;  4XU3 A;  4F04 B;  3RES A;  5C52 B;  2M0O A;  4WI1 A;  3HFZ B;  5GJW B;  3P8V A;  1PYS B;  7AT1 B;  3RKW A;  3NEN A;  3HRK A;  4J9E A;  2HAX A;  4J6X A;  3RKY A;  3SD4 A;  4P3P A;  3GP8 A;  1B7Y A;  4FM4 B;  2XDB A;  3CCV A;  3PE0 A;  2KRN A;  1K73 C;  1VQ4 A;  2MAM A;  4M7A C;  4Q15 A;  3CC4 A;  2FG0 A;  1Q95 G;  3QDR B;  1QVF P;  1K76 A;  3RGL A;  3J81 E;  4HT8 A;  4G84 A;  2E3C A;  3PCO B;  3HY0 A;  4OGC A;  4YRE A;  2VUB A;  1P92 A;  4FW1 A;  4WTO B;  4PJO B;  4JJB A;  5KYN A;  3M57 A;  2E10 A;  2RQW A;  2JM9 A;  4D8K A;  2GCX A;  1SHF A;  1WYD A;  4J6Y A;  3A8G B;  4MML A;  1W1F A;  1N5Z A;  4GBQ A;  4PFZ A;  4J7I A;  1AWW A;  4E7K A;  1WYX A;  1KG1 A;  2HL3 A;  4M7D A;  3S3M A;  3A31 A;  2X35 A;  2KSS A;  1HYO A;  3FB9 A;  2LT1 A;  3MEA A;  1VQN A;  4ZTZ B;  5FWC A;  3SDZ A;  3A7R A;  1AWX A;  1G5H A;  1YBY A;  3A8O B;  3NHN A;  3OBW A;  4YRG A;  1AVZ C;  4YCV A;  2IPO B;  3SFM A;  3CCM Q;  1RAG B;  2EQU A;  4Q6G A;  2QG9 B;  2CYZ B;  2XD0 A;  1FMW A;  4LDU A;  4LD6 A;  4PNO A;  3CCS Q;  4P75 A;  1RIQ A;  2QQ9 A;  2CDT A;  1U3O A;  1NJI C;  3CMA A;  2MOX A;  3L2U A;  1KD1 C;  4O5V A;  2EYZ A;  5FRM A;  1C1A A;  1SHG A;  2GTO A;  2QEX A;  1UB4 A;  1WJQ A;  2DTI A;  2RJC A;  2K3Y A;  3PTA A;  3FLG A;  3OYE A;  3CBM A;  2I2L A;  5EC7 A;  2AKK A;  1JQQ A;  2DRM A;  2SRC A;  1B7Y B;  5LJ3 j;  3G6E T;  4M7D F;  1ZUU A;  2ZNJ A;  3I55 A;  4F16 A;  1UTI A;  3CCS T;  2XDD A;  5KCH A;  4M75 C;  5IXF A;  1WHK A;  2F69 A;  2Y90 A;  4HCB A;  5I2S A;  3RNJ A;  4LDY A;  3MET A;  4E7L A;  1QMC A;  2DQ3 A;  5GMK m;  4J5Y A;  2XKO C;  2DPP B;  3R6N A;  1YI2 A;  2L2P A;  4K11 A;  3IKM B;  2QA4 A;  1OYX A;  1BI3 A;  4YCU A;  1UJ0 A;  5GAO n;  4J83 A;  2A36 A;  1G83 A;  2KT8 A;  2G4C A;  1Y57 A;  5CCA A;  2NUT A;  1LVK A;  1KJW A;  1M90 U;  1MNE A;  3CEY A;  3JCM Q;  1K9A A;  3CC7 A;  3G4S A;  1YJ9 T;  3UFG A;  1NM7 A;  1MV0 B;  1GFC A;  1TOV A;  1ZSZ A;  1CKB A;  3A98 A;  2CP0 A;  3SHW A;  1VOM A;  4YRP A;  5CIU A;  3CCR T;  4ZGD B;  4ANJ A;  2F2V A;  3A1P A;  1ATI A;  1X55 A;  4J15 A;  1M9S A;  4TTV A;  4RKU E;  1AZE A;  2MYS A;  5A0L A;  4OB1 B;  1E6G A;  2E64 A;  3FEO A;  3OS5 A;  4DBF A;  4C0G A;  1VQL Q;  2O2O A;  3JV3 A;  2OTJ Q;  1H3H A;  1SER A;  2EQM A;  1PRL C;  1K0X A;  3MKD A;  1NYR A;  1LPL A;  2DU5 A;  4JJD A;  4M7A G;  1OPL A;  1QE0 A;  1EVK A;  4M7D C;  3OBY A;  1GGM A;  1NG2 A;  1X56 A;  2HL5 C;  4P73 A;  1VQP Q;  1VQK Q;  4E7H A;  1YN8 A;  4EMK A;  2KXC A;  2KAF A;  5CVI A;  3OQ5 A;  4GLK A;  2ALY A;  3NPF A;  5GAO m;  2D9T A;  4H2T A;  3HXZ A;  1FXX A;  4LVM A;  2QAS A;  3C95 A;  1VQL T;  2EJF A;  3HFN A;  4OMQ A;  2OTJ T;  3CME Q;  1AD5 A;  3VS5 A;  3MEU A;  1UGP B;  1RI9 A;  4YRO A;  4YRS A;  1N8R C;  4FSS A;  4QVC A;  1WI7 A;  3EG9 A;  1IL2 A;  4XTZ A;  2AKL A;  4C0D C;  1X69 A;  2QGF B;  1WHJ A;  1PD1 A;  1YHQ Q;  5A0D A;  1KSW A;  2NUT B;  1RLQ C;  3J80 E;  2E12 A;  1VQ7 T;  2DYI A;  1WXB A;  2J6O A;  2LTO A;  1WLE A;  1ZSZ B;  5A2Q E;  3CCU Q;  1I81 A;  3L2W A;  2HCK A;  3TEH A;  5GAO q;  4OGE A;  2ZIM A;  2YHT A;  1NYF A;  1QQJ A;  1U1T A;  1XQH A;  3HFO A;  3CME T;  1VIE A;  2F1L A;  3MPU B;  2ZIO A;  2ARS A;  3BJU A;  4P71 C;  4RTY A;  3A32 A;  1U8R A;  5LJ3 e;  3V7R A;  1NEG A;  5DLO A;  1NLP C;  2XGT A;  1M27 C;  2K3B A;  2ROT A;  3OYL A;  4P5N A;  2J6K A;  1YHQ T;  5KE3 A;  2GFA A;  2ZAE A;  2C0O A;  1AWJ A;  5FU7 C;  1RI0 A;  4UP9 A;  2DMO A;  4BY6 B;  2L3P A;  3EH2 A;  2D1X A;  3CCJ T;  5GAM d;  1D3B A;  3CCU T;  1D09 B;  2KQW A;  1M1G A;  1IRX A;  4M75 G;  5LJ3 g;  4MMK A;  4PJJ A;  3OW2 S;  4EMK B;  3I7F A;  4DEY A;  4YRM A;  1K4U S;  1C0M A;  2O9V A;  4J8O A;  2DX1 A;  4XTY A;  3VRY A;  3UPU A;  1YJN A;  4IUP A;  2VGM A;  2ALY B;  2PMF A;  2DL7 A;  1FX7 A;  2NS6 A;  1TS9 A;  4L5G A;  2P0K A;  4X9D A;  2ED0 A;  2J3M A;  2FRY A;  3LLR A;  1KFZ A;  1M1K R;  2LMJ A;  2HQE A;  1B76 A;  1WFW A;  1NPR A;  1XNI A;  3G1Z A;  2L89 A;  5C0M A;  4E51 A;  2VWF A;  2QTX A;  2C06 A;  1G5I A;  2A7Y A;  4DQ2 A;  1Q82 C;  4BW9 A;  4BUG A;  3M54 A;  5J26 A;  3CXC P;  3EG9 B;  4ZTU B;  1IHV A;  1I5L A;  2EKH A;  4L59 A;  5CKH A;  1TTH B;  3RMQ A;  2RNA A;  2ZTG A;  2ZT6 A;  1OZ3 A;  3A5Y A;  4E7S A;  1ARK A;  2HKQ B;  2CUB A;  4C92 C;  3V8K A;  1VQ9 A;  3QO8 A;  1KC8 C;  5HCK A;  5KCO A;  1PM3 A;  5J3B A;  1GCQ A;  4QKU A;  2YUP A;  5GAN 8;  1K73 R;  2O31 A;  4HVW A;  4ESR A;  1VQO A;  2DER A;  5LJ3 f;  3M58 A;  1D1B A;  1KQ1 A;  4C0Z A;  2CH4 W;  1YFT A;  2OI3 A;  3E9I A;  1PWT A;  4M7D G;  2K79 A;  1EIY A;  1VQM Q;  3BE3 A;  4A4E A;  3EAE A;  3QDF A;  2MK5 A;  3LWH A;  1MMD A;  4HWR A;  4M75 E;  4B6M A;  4AMC A;  5KYU A;  3PZC A;  5CKE A;  3QNE A;  2BZY A;  1LOJ A;  1SEM A;  1D3B B;  3QO3 A;  4KUD K;  4LDV A;  2ZPG B;  1KMN A;  2YSQ A;  2GBQ A;  2RO0 A;  2DET A;  1TH7 A;  2ATC B;  4RTT A;  1YIJ Q;  4WJ4 A;  4C8Q C;  3QUI A;  2Y4Y A;  1Z9Q A;  3MJX A;  3P8Y A;  2LJ1 A;  1MUZ A;  5IXB A;  2AIR B;  1ZLM A;  5C53 B;  3M0S A;  4Z02 A;  2O88 A;  1Q86 R;  2KRS A;  1H8K A;  3M0U A;  3LW5 E;  3PT9 A;  1NJI R;  1TUG B;  2K3X A;  3WQZ A;  3CCV Q;  4K88 A;  1AHJ B;  1YNZ A;  1B07 A;  1VQ4 Q;  5IHN A;  3CC4 Q;  1GRI A;  3JB9 H;  4YRI A;  3IKL A;  1BIB A;  5KH6 A;  2LCS A;  2QQB A;  2K5I A;  2M9U A;  1ZBJ A;  1ACM B;  4J9H A;  1YIJ T;  2DBK A;  3PIO A;  3OMC A;  5CQY A;  3N5B B;  3UDC A;  5GAN 5;  4PKC C;  2CJ9 A;  1BU1 A;  4L87 A;  3HTR A;  3OYF A;  4M7D E;  2VXF A;  3LH5 A;  2ZZF A;  1AWO A;  1WA7 A;  3IQL A;  3MP8 A;  2KE9 A;  3ERR A;  2KY9 A;  2PUK B;  2RI5 A;  3G71 A;  1VQ4 T;  1EIY B;  4JRI A;  3RER A;  1VQN Q;  1MMG A;  3KXT A;  4RMO A;  2LRQ A;  1UGV A;  4A4H A;  2RJD A;  2P84 A;  2V8K A;  3E9G A;  2M51 A;  4VUB A;  1E24 A;  1ZUY A;  1HJD A;  4KQE A;  5GMK e;  3EG3 A;  2LQ8 A;  3RBB B;  2HNI A;  1BK2 A;  4XAX B;  3JB9 J;  2CP7 A;  4EX5 A;  1V76 A;  1JJ2 P;  4JRK A;  1Q7Y R;  3CMA Q;  1SRL A;  1VQ5 A;  2C0I A;  2GF7 A;  2BKD N;  1M1K U;  1WGS A;  1GCQ C;  2CUD A;  2G3R A;  5GMK h;  3CPF A;  4E7J A;  1GXI E;  2YRD A;  1QF6 A;  2L8D A;  1ASZ A;  2M02 A;  2MCN A;  1Z7M A;  2QEX Q;  3EG2 A;  3HRU A;  4PJM A;  2L3S A;  2RB6 A;  5CAI A;  3I56 T;  2D8H A;  3DLL A;  1VQ8 A;  2LP5 A;  4DBR A;  4GY5 A;  2P5I A;  4IUQ A;  2EYX A;  1IRE B;  4C92 G;  4ELZ C;  3I55 Q;  4J9I A;  1GBR A;  2CRE A;  2X3X D;  1ZHI A;  2YT6 A;  1YIT A;  3CMA T;  3JB9 D;  2LNV A;  3OS0 A;  3CD6 A;  3VQY A;  2CT3 A;  4YRN A;  2VB6 A;  2ZPE B;  2LQK A;  1LYL A;  4JLI A;  3QYG B;  5E3I A;  1G3W A;  4HKE A;  4H2U A;  1YI2 Q;  2QEX T;  4C5H A;  2EJ9 A;  2EW3 A;  1NJ6 A;  2GQV A;  4N4G A;  2QA4 Q;  3NET A;  1WHH A;  2CP3 A;  2V8I A;  2PU9 B;  1UEB A;  3GOX A;  1WPY A;  3H41 A;  2K2M A;  3ME9 A;  4BD3 A;  5GAN e;  3GNG A;  3HFV A;  2COY A;  1KQ2 A;  2FZK B;  1KQS S;  2RQV A;  2DLP A;  3VJP A;  2F2X A;  4CS4 A;  4E7Z A;  4AT1 B;  2KT1 A;  3JSC A;  3G4S Q;  2BUD A;  1X75 C;  3NTI A;  3DLM A;  1CSK A;  2DBM A;  8ATC B;  5D6X A;  1N8R R;  4M7A B;  2DVE A;  5GAN h;  1TUC A;  5DLQ E;  2JM8 A;  4M75 A;  4C8Q G;  4UC4 A;  5GAN g;  4AFS C;  3ICA A;  5KYW A;  4KH0 B;  4YP0 A;  3H0H A;  5I21 A;  3JRZ A;  3S3N A;  2A28 A;  2EQI A;  2W0Z A;  4NL3 A;  3CPW P;  2HDA A;  1EX4 A;  2DEQ A;  3HRT A;  2LT4 A;  4TVR A;  3VBB A;  2C0T A;  2ZPB B;  5LL6 S;  1IB8 A;  4QVD A;  2V8J A;  2HBW A;  4H2Y A;  4LVI A;  3MP6 A;  2K57 A;  3EG1 A;  2QHU A;  3KBG A;  3HXW A;  4WJ3 M;  4ZGJ B;  5FWB A;  2DYB A;  2QXF A;  4ZIB A;  1WXT A;  4C92 E;  4Y91 A;  1FMK A;  2HMA A;  2PNI A;  4H2W A;  4HT4 A;  1R77 A;  4PL6 A;  3OB9 A;  4D8D A;  12AS A;  5ELO A;  3HL8 A;  1IGU A;  5DY9 A;  2ZT7 A;  1RAC B;  3GNF B;  1O9S A;  3VS7 A;  2EBP A;  1VQ6 Q;  2RPN A;  4YRL A;  4OB3 B;  4J6W A;  2VKN A;  5CKF A;  4JRP A;  1N9S A;  4GLM A;  4OMO A;  3L2R A;  3I5S A;  1I4K 1;  1WJR A;  4M75 F;  3JCM b;  1WQ7 A;  2V1Q A;  2AMC A;  4XU1 A;  2RF0 A;  1T3S A;  1U5S A;  3QZ5 B;  3KFV A;  2DK3 A;  5GAN f;  4WCI A;  4FYX B;  4DEX A;  2X4W A;  2M16 A;  2JJ9 A;  2XMF A;  3IG2 A;  4H2V A;  2I0N A;  2Q5H A;  2XHC A;  4LVK A;  3MP1 A;  4J9D A;  2YXY A;  1D0Z A;  1SG5 A;  2V1R A;  4BI8 B;  4J9B A;  3VRZ A;  1VQ6 T;  1QP2 A;  2LCL A;  4C8Q E;  1Q82 R;  1IO6 A;  2OJ2 A;  4QQ6 A;  3EGD A;  3HY1 A;  3OYK A;  1Q7Y U;  1SET A;  4RTZ A;  3FDR A;  1BBZ A;  4M75 B;  2Q7H A;  5KYW B;  3KFU A;  1WU7 A;  1G51 A;  5FU6 C;  1Q81 C;  4DOW A;  2CS7 A;  2ZGW A;  3C4S A;  2RJE A;  2COW A;  2FVU A;  1KC8 R;  3CBO A;  1EZZ B;  5HKC A;  2AHJ B;  4BI3 A;  1ZQ1 A;  3CCQ A;  2RQR A;  3HXV A;  3E9H A;  2L3Q A;  2NUP A;  4FYY B;  2JVV A;  1QP3 A;  1O75 A;  2DU7 A;  5GAM j;  3VYG A;  3G1J A;  3OMG A;  5FW9 A;  1MHN A;  2DNU A;  5CKB A;  3CCM T;  4XTW A;  3QZ9 B;  3DB3 A;  1M2V A;  1N6A A;  4ZTF A;  1YJN Q;  3MF1 A;  1K0S A;  2AT1 B;  4LNS A;  2JS0 A;  1USY A;  2JNG A;  3MEV A;  1DJ7 B;  5J39 A;  3GBQ A;  2CZ6 B;  2D8J A;  1QKX A;  2D6F A;  2EAY A;  4P71 A;  2QGG A;  2L3R A;  3LGL A;  1QWF A;  1YJW A;  4R0K A;  4EIK A;  1BYM A;  2AMC B;  4R56 A;  4BDZ A;  1H4T A;  4IUV A;  4JZ3 A;  2BE9 B;  4UP8 A;  1KQS A;  1X2G A;  4AFZ C;  2LQW A;  4Q5W A;  4CH3 A;  4RQF A;  3PVL A;  2XI9 A;  3H8Z A;  4M7D B;  2OTL Q;  1W66 A;  1OZ2 A;  2I4L A;  2EQK A;  3HKS A;  4X1V A;  3JB9 I;  2PQW A;  5CR2 A;  4NL2 A;  2DZ9 A;  2KNB B;  4AFQ C;  4HA8 A;  2ZR2 A;  1GFD A;  5IT9 E;  3RDV A;  3EGD B;  4TVA A;  1NPP A;  3NTK A;  2H8H A;  3EFR A;  1VQO Q;  3H6Z A;  2DO3 A;  3UGT A;  1X6O A;  4M78 C;  1TUD A;  2EKO A;  1UHF A;  3L1A A;  2ZPI B;  2F2W A;  4EMG A;  3H0I A;  2FHD A;  2OTL T;  1A0N B;  2ZCE A;  1Y71 A;  4B9X A;  4C0D B;  2EGE A;  4A4F A;  2NUP B;  3LWI A;  3M4G A;  2BTT A;  4M78 D;  4X9C A;  1TSF A;  2PVG B;  3V8J A;  1WX6 A;  3SWN C;  4FT2 A;  4N0A C;  4OMP A;  3MHX A;  1XTD A;  2JMA A;  1M2V B;  3VQW A;  4C92 A;  1VQO T;  1WHM A;  3THK A;  2QI2 A;  2J6F A;  2ZCF B;  1W6X A;  3MEW A;  3QBY A;  2WSC E;  3VKI A;  1OUL A;  1Z9Z A;  4QW2 A;  3P8T A;  3D7S B;  3LX7 A;  3URG A;  2XIC A;  1K8A R;  1JO8 A;  1UFF A;  2KYM A;  3PMI A;  2MF2 A;  3QO7 A;  1H64 1;  1Y0M A;  2K4Y A;  3OSS C;  4JLG A;  5FU7 B;  1VQP T;  1VQK T;  2J05 A;  2J7I A;  3QJ6 A;  1SRM A;  2CP2 A;  1J5W A;  5KNN A;  1M3B A;  4ZN3 A;  4OF1 A;  1QCN A;  3L2V A;  1K9M R;  1USY C;  1M90 C;  4TVA B;  1SSH A;  1OU9 A;  3OYY A;  2DD5 A;  1QVG S;  4JS4 A;  4ZN1 A;  2P4R A;  4C8Q A;  4C92 F;  1S72 Q;  2JS2 A;  1M3A A;  2YUQ A;  5F5W A;  5GAM e;  5GMK l;  4BAC A;  1ADY A;  1ABO A;  3G71 Q;  1L0W A;  2VYT A;  2CZ1 B;  1B34 A;  2R5A A;  2DTO A;  3UH0 A;  4JUV A;  1NJ8 A;  3PFS A;  2RJF A;  5GMK i;  4XQ3 A;  4PK4 A;  3G6E A;  5GAM h;  2EVR A;  3EGX A;  2XDP A;  1E6H A;  3QYH B;  5CK9 A;  3JCM P;  3CCS A;  1OPK A;  5GAM g;  1M8M A;  1T3L A;  3DB4 A;  5CQX A;  3DKM A;  3TEE A;  4C92 B;  1VQ5 Q;  3CC2 A;  1S72 T;  2L5Q A;  2ED1 A;  1NLO C;  3P8D A;  2E1H A;  2YLB A;  5LJ5 h;  5CKD A;  5K1X A;  2OAW A;  2NLU A;  4EDU A;  3JAM E;  2KGT A;  5LJ5 d;  4NCX A;  5KE2 A;  1RL2 A;  3M4Q A;  5GMK j;  1Z7N A;  1B3Q A;  4PHC A;  2MMP A;  2GQI A;  1AZG B;  4V2S A;  4XU0 A;  1KMM A;  4C8Q F;  2ODR C;  2X4Y A;  2DF6 A;  4HVU A;  2DJZ A;  1YWO A;  2X3W D;  4D6W A;  1KOG A;  1U06 A;  3M0P A;  3OS2 A;  1QVP A;  2GNC A;  3M4P A;  3NEM A;  5ECA A;  1YJ9 A;  3O5Z A;  4KUI A;  4CC2 A;  3JCM W;  1SF9 A;  4CS3 A;  1YIT Q;  2A8E A;  1VQ5 T;  1LJO A;  3CCR A;  4PJN A;  1M4Z A;  1GL5 A;  3CD6 Q;  1BI2 A;  2ODR D;  2R58 A;  2RHS A;  4P72 C;  2DXT A;  2JN0 A;  4RMF A;  1OI1 A;  4QVZ A;  3LYI A;  3TEH B;  4OMN A;  3VS3 A;  5GAO l;  3EFS A;  1JB0 E;  1PD0 A;  4C8Q B;  4NOY A;  5GAM f;  1X54 A;  2ZT8 A;  4PG3 A;  1H4S A;  3TSZ A;  1N9R A;  4LUE A;  2AZS A;  2MPX C;  2PZ1 A;  2VXE A;  4FYW B;  3WXM B;  2IY5 A;  2AZV A;  2E6Z A;  2KDS A;  4PLL A;  3QXE B;  4KGX B;  2D0N A;  1B34 B;  1UJY A;  1NBE B;  3GLX A;  3FC3 A;  4E47 A;  2RH2 A;  4LDW A;  5GAN 7;  4BE1 A;  4J9C A;  3SEM A;  2AKW A;  2HQH A;  2HD0 A;  3CD6 T;  3EGX B;  2BZ8 A;  1HK9 A;  4M4Z A;  5FLX E;  3VQV A;  2CP6 A;  5GAN 4;  3UWN A;  2DFU A;  4TWA A;  1I5O B;  2P4T A;  3V7S A;  3JCM c;  2ART A;  2EL9 A;  4BE2 A;  5GAN 3;  5D6Y A;  4DBH A;  1M5Q 1;  3INZ A;  5GAN j;  2DEU A;  2XTI A;  1ASY A;  3REX A;  2K9G A;  2CT4 A;  1VQL A;  1W2B S;  4CS2 A;  2CH4 A;  1UGR B;  1AT1 B;  5IHK A;  3LC0 A;  5HK3 A;  1B70 A;  2CSQ A;  2FPE A;  3HPW A;  3HRI A;  1VQM T;  4J9G A;  3A8M B;  2OX7 A;  4H2S A;  3LSS A;  1UG1 A;  2K7A A;  3OS1 A;  4RQE A;  1Q81 R;  1KD1 R;  3OW2 P;  4M77 D;  1VQ7 A;  5IH2 A;  1G3T A;  3M59 A;  2X4X A;  2LVM A;  2A37 A;  5C6S A;  2ZR3 A;  4C0F A;  3TU4 K;  4M78 E;  2ZZG A;  4WF2 A;  4RTV A;  1K9M U;  2C8M A;  3QII A;  3EFO A;  2RHS B;  1WJS A;  4FW2 A;  1RAF B;  4A4K A;  3REB B;  1Y07 A;  3OYH A;  1QVG A;  3RF1 A;  4KRT A;  3HXU A;  2VAS A;  1OU8 A;  1X2K A;  2F5T X;  2IG0 A;  4QQG A;  3S6W A;  1WQW A;  2EGC A;  2DL8 A;  2H3E B;  2LX7 A;  2RN8 A;  1YHQ A;  1K1Z A;  2IY5 B;  3VS4 A;  4JS5 A;  1NNH A;  1WXU A;  3CCV T;  1M1F A;  5GJV B;  3TRE A;  3CCJ A;  3UGQ A;  3CC4 T;  2DL5 A;  4C5G A;  3CCU A;  1BBW A;  3A8H B;  4YYE A;  2AKW B;  1RAH B;  2CZ0 B;  3JCM d;  3M55 A;  1IZ6 A;  4BDY A;  1ZUK A;  4C5E A;  5KYU B;  4OMM A;  3EH1 A;  2KR3 A;  1SES A;  3QKJ A;  4KT0 E;  1RAE B;  4F7U G;  4IIM A;  1BI0 A;  1T0J A;  4AFU C;  1PCX A;  2LZ6 B;  2QTV A;  2RA2 A;  3JCM J;  3ZL7 C;  2NWM A;  1JXM A;  2A3L A;  4G85 A;  4BI4 A;  1WZO A;  2WSF E;  3HTZ A;  1J3T A;  3A7U A;  4YRC A;  5D6W A;  1M30 A;  1B70 B;  2WAC A;  1H4V B;  1NYG A;  3CCQ Q;  3H9N A;  1VQN T;  3CBP A;  1VIF A;  1ADJ A;  2CJA A;  4B9W A;  1EFN A;  2DKG A;  4KGV B;  3NGP A;  4JDS A;  5AYF A;  1G5V A;  6AT1 B;  1QVF S;  2X9H A;  4H2X A;  2A08 A;  3CCL A;  2NUZ A;  1VYV A;  4CH5 A;  2LCC A;  2CKK A;  3VUB A;  3EFO B;  1QLY A;  4YRJ A;  1RAD B;  3VV0 A;  4MZP A;  1K73 U;  3MQZ A;  1W70 A;  1B7T A;  1HXD A;  2ZZD A;  1UGS B;  2K6D A;  5DM7 R;  2BZX A;  2E41 A;  1OOT A;  4LVL A;  1BCM A;  1B8A A;  3EHQ A;  4P3N A;  2RHZ A;  5KYX A;  2EPD A;  1TG0 A;  1I8F A;  3HHT B;  3I9Q A;  3DSQ A;  2RD1 A;  1G8X A;  4Z88 A;  3A8L B;  4BWA A;  4RTW A;  3I55 T;  2ZXF A;  1FMV A;  3CC7 Q;  2L0A A;  3VS6 A;  1QW1 A;  1VYT A;  1PRM C;  3J7A F;  3VYH B;  4F7U E;  3E19 A;  2HZY A;  2ZNI A;  4N4H A;  2FRW A;  3C0C A;  3U23 A;  4HVC A;  2DZC A;  1QCF A;  1YB3 A;  2KYB A;  1YI2 T;  1W2B A;  4FT4 A;  3TSW A;  2QA4 T;  1NJ2 A;  2DIG A;  2O9S A;  4A54 A;  1KHI A;  1Q86 U;  2QHV A;  4HVV A;  1M1K C;  1M90 R;  4KR3 A;  1NJI U;  4YCW A;  3CC7 T;  4OVA A;  4CC7 A;  3UAT A;  3G4S T;  4P74 C;  4HWP A;  2E65 A;  1SRY A;  4XTV A;  2EYQ A;  1V1C A;  3FJ5 A;  1X2H A;  1PNJ A;  11AS A;  4RTX A;  3I5R A;  1YIJ A;  1MND A;  1WIE A;  3RAC A;  4OB2 B;  2HSP A;  1FWZ A;  3M0Q A; 
#chains in the Genus database with same CATH homology
 3S3O A;  4M78 A;  1C0A A;  5FU6 B;  3L2Z A;  4YRK A;  3CMQ A;  4RCB A;  3LH0 A;  4EO4 A;  5EG2 A;  3PIP A;  2O4X A;  3SWN A;  4R55 A;  4XEO A;  4N0A A;  3FRN A;  4M7A D;  2ZZE A;  3HSB A;  4M77 E;  4RG2 A;  2H3J A;  4ELY C;  3CPW A;  5HY6 A;  4RCC A;  1KHC A;  4C5I A;  2B8A A;  2PVO B;  1V29 B;  4FU6 A;  2JUF A;  2YRV A;  2RHI A;  3JB9 G;  4MDX A;  4JRQ A;  3I56 A;  2I4N A;  4M78 F;  3A74 A;  5IN1 A;  2XU8 A;  2VGN A;  2QQS A;  2ZPF B;  1Q86 C;  4CH4 A;  3CCE A;  4PJO C;  1WNL A;  2BIV A;  4FL6 A;  1SSF A;  1QVF A;  3PNW C;  4P3O A;  3TUP A;  4TVY A;  1ZBX A;  2M1H A;  1EOV A;  3LSQ A;  4DOV A;  2PME A;  3A7A A;  3JCM X;  4PJO D;  3P8B B;  5LJ5 j;  4HCZ A;  4M78 B;  3RMS A;  3QSU A;  3BW1 A;  3X24 B;  3OYC A;  2Q7E A;  1H3Z A;  3OD1 A;  4CH6 A;  3MEY A;  1BI1 A;  5GAO r;  1YJN T;  3CC2 T;  5FRN A;  2E5A A;  4PLI A;  2O4X B;  1N8R U;  3SWN B;  4UP7 A;  1EIF A;  4YRQ A;  4YPF A;  2E70 A;  3G7Z A;  3BDU A;  2R5M A;  4M75 D;  2R57 A;  5HK0 A;  3ZEH A;  4F7U A;  3M5A A;  3NEL A;  1Q7Y C;  4DA4 A;  4LDX A;  2EWN A;  4OMF B;  3BDL A;  3A5Z A;  3OA6 A;  3GIB A;  1NYQ A;  3VUZ A;  1VQZ A;  3LGF A;  1VQ9 T;  3GPL A;  3ZBD A;  4A4G A;  1NE8 A;  4LD9 K;  4AH6 A;  4P72 A;  4RDX A;  3X25 B;  3V7C A;  1VUB A;  5IAY A;  3M9Q A;  2HQX A;  3X28 B;  3HXX A;  4FIB A;  3T9N A;  2P0Q A;  2I4M A;  2FB7 A;  3CXC S;  4F7U F;  2K2V A;  1EFW A;  4OP0 A;  1JBM A;  3RKX A;  1VQ6 A;  4P75 C;  4M7D D;  4YDQ A;  2RK1 A;  3M56 A;  1Q82 U;  5HGQ A;  3MO8 A;  1YFR A;  2GFU A;  5GAN 2;  4ZGE B;  5GAN 6;  2QHS A;  2LC4 A;  2P0P A;  3OYG A;  1PSE A;  4N4I A;  1N27 A;  4F7U B;  3RL6 A;  4M77 A;  5C51 B;  5ELN A;  1KC8 U;  3OYM A;  4O6J A;  4PJO G;  3HXY A;  3A5Z B;  2EIF A;  2Y4X A;  2ZIN A;  1Y7X A;  4BB7 A;  3ZFJ A;  3CCM A;  3C94 A;  4XU2 A;  3OSV A;  2DD4 A;  4JJN K;  5LJ5 e;  2DAQ A;  5K1P A;  4TQF A;  3E1S A;  3E9F A;  4M7A E;  3QTC A;  1YCY A;  2KVQ G;  1EVL A;  2MWP A;  4IKF A;  4K87 A;  3G71 T;  1UGQ B;  5LJ3 h;  5L8R E;  2ARU A;  5LJ5 g;  2RHQ A;  5LJ3 d;  1YFS A;  2DDZ A;  2E5Q A;  2DIQ A;  4M77 F;  3X26 B;  2QDY B;  1MGQ A;  3BFM A;  3M4Y A;  4ZTJ A;  5I2M A;  2RM4 A;  5FRO A;  4M78 G;  3O8V A;  1YGB A;  4TVW A;  4HWT A;  2RK2 A;  4M77 B;  4BY6 C;  4RG8 A;  4PJO E;  4P73 C;  3C12 A;  1VQ8 T;  2OTL A;  2PVD B;  3W3S A;  2VV5 A;  4YRR A;  4EMK C;  2CGH A;  4KUL A;  3CCL T;  5CO7 A;  3OYD A;  3MCA B;  4XTU A;  1YIT T;  3X20 B;  3ASK A;  5LJ5 f;  3UT1 A;  4X34 A;  1BKB A;  2PUO B;  3REU A;  1JJ2 S;  2EFI A;  2RHX A;  3WVE B;  4C92 D;  4YRT A;  3OYB A;  1XOV A;  2OTJ A;  4FSX A;  3KUF A;  2D0Q B;  5A0G A;  4M77 C;  3OYN A;  3OYA A;  1K8A U;  1H4Q A;  3CXC A;  2JOY A;  4MZT A;  3L2Q A;  2RHQ B;  2CJB A;  2RHU A;  1VQP A;  2VC8 A;  1VQK A;  3RIR A;  2EQJ A;  2JTF A;  3TEG A;  4MZM A;  2IVW A;  3QO5 A;  4KBM B;  2MI6 A;  2ZT5 A;  2WSE E;  3JB9 F;  2DXU A;  1E1T A;  1N9W A;  4LVJ A;  3HP9 A;  4XTX A;  1NJ1 A;  4OLF A;  2DXC A;  3PMT A;  2FYK A;  1JJC A;  3FIF A;  3CME A;  2Q7G A;  2RI2 A;  3L4G A;  4CRI A;  1FYF A;  1EQR A;  2XID A;  1Y96 A;  4C8Q D;  4A53 A;  3JCM e;  4HWO A;  2XG8 D;  4X5O A;  2KMT A;  4DPG A;  3OYI A;  1NZ9 A;  1G3S A;  3VQX A;  3FJP A;  2JTM A;  3VU3 C;  4P74 A;  2ZPH B;  4TQD A;  3JCM h;  1E22 A;  3QG1 A;  3QPH A;  1U1S A;  4EPC A;  3NFC A;  3JCM g;  4QQD A;  1NJ5 A;  4O2D A;  1S72 A;  3TCJ A;  3MF2 A;  2JZ2 A;  1W4S A;  3CPW S;  2C7I A;  1X01 A;  1M8V A;  4K86 A;  2DTH A;  2K5F A;  4HWS A;  3OYJ A;  3RUX A;  4YRF A;  2RHY A;  3QHS A;  2QQA A;  4UPA A;  4M7A A;  2RI3 A;  1BBU A;  3JCM V;  3OW2 A;  4IUU A;  2XK0 A;  1K8A C;  4YTL A;  2HBP A;  3GF5 A;  4BE0 A;  1R8O B;  1BIA A;  4IUT A;  4XK8 E;  3P8H A;  4Y28 E;  4II1 A;  2J3L A;  5M9O A;  2DQ0 A;  3OY9 A;  2MWO A;  2F5K A;  3L42 A;  3F70 A;  3R6O A;  1JJC B;  3HFZ A;  1PYS A;  4HCC A;  3L4G B;  2FL7 A;  4ATO A;  3M53 A;  4J7F A;  1K9M C;  1Y96 B;  3JCM f;  4KR2 A;  2QQR A;  4L6V 5;  3CCQ T;  4H02 A;  2K5L A;  3AHU A;  3IAL A;  3CCE T;  2E6N A;  3NTH A;  3BY7 A;  3R07 A;  2DXB A;  4MDW A;  3PCO A;  4M7A F;  1LNX A;  4PJO A;  2OAU A;  1PSF A;  4EMH A;  4NS5 A;  4ME7 A;  1JJ2 A;  3QJY A;  4HT9 A;  2CIM A;  4CI0 C;  3Q1J A;  1HC7 A;  4M77 G;  2LX9 A;  3WVD B;  1YJW T;  2QHT A;  1VQM A;  4E7I A;  4OB0 B;  2EJG A;  1E1O A;  1HTT A;  3HRS A;  2P0L A;  4XEM A;  1JRI A;  5GAO p;  5GAN d;  1Q81 U;  2LDM A;  1KD1 U;  2Q5I A;  2YLC A;  2KK4 A;  2O01 E;  2CZ7 B;  4IUR A;  1G3Y A;  2I4O A;  4H2X B;  4PJO F;  3SB2 A;  2X4J A;  3V8L A;  3ER0 A;  3PGG A;  4XU3 A;  3RES A;  5C52 B;  2M0O A;  4WI1 A;  3HFZ B;  3P8V A;  1PYS B;  3RKW A;  3NEN A;  3HRK A;  2HAX A;  4J6X A;  3RKY A;  3SD4 A;  4P3P A;  3GP8 A;  1B7Y A;  4FM4 B;  2XDB A;  3CCV A;  1K73 C;  1VQ4 A;  2MAM A;  4M7A C;  4Q15 A;  3CC4 A;  3QDR B;  3RGL A;  3J81 E;  4HT8 A;  4G84 A;  2E3C A;  3PCO B;  3HY0 A;  4OGC A;  4YRE A;  2VUB A;  1P92 A;  4PJO B;  3M57 A;  2E10 A;  2GCX A;  1WYD A;  4J6Y A;  3A8G B;  4MML A;  4J7I A;  4E7K A;  1KG1 A;  4M7D A;  3S3M A;  3A31 A;  2X35 A;  2KSS A;  3FB9 A;  2LT1 A;  3MEA A;  1VQN A;  4ZTZ B;  3A7R A;  3SDZ A;  1G5H A;  1YBY A;  3A8O B;  3OBW A;  4YRG A;  4YCV A;  3SFM A;  2EQU A;  4Q6G A;  2CYZ B;  2XD0 A;  4LDU A;  4LD6 A;  4PNO A;  4P75 A;  1RIQ A;  2QQ9 A;  1NJI C;  3CMA A;  3L2U A;  1KD1 C;  4O5V A;  5FRM A;  2QEX A;  1UB4 A;  1WJQ A;  2DTI A;  2RJC A;  2K3Y A;  3PTA A;  3FLG A;  3OYE A;  3CBM A;  2I2L A;  1B7Y B;  5LJ3 j;  3G6E T;  4M7D F;  2ZNJ A;  3I55 A;  3CCS T;  2XDD A;  5KCH A;  4M75 C;  2F69 A;  2Y90 A;  4HCB A;  5I2S A;  4LDY A;  3MET A;  4E7L A;  2DQ3 A;  5GMK m;  4J5Y A;  2XKO C;  2DPP B;  1YI2 A;  3IKM B;  2QA4 A;  1OYX A;  1BI3 A;  4YCU A;  5GAO n;  4J83 A;  2G4C A;  5CCA A;  1M90 U;  3CEY A;  3JCM Q;  3CC7 A;  3G4S A;  1YJ9 T;  3UFG A;  4YRP A;  5CIU A;  3CCR T;  4ZGD B;  1ATI A;  1X55 A;  4J15 A;  1M9S A;  4TTV A;  4RKU E;  5A0L A;  4OB1 B;  2E64 A;  3FEO A;  3OS5 A;  4C0G A;  1SER A;  2EQM A;  1NYR A;  2DU5 A;  4M7A G;  1QE0 A;  1EVK A;  4M7D C;  3OBY A;  1GGM A;  1X56 A;  4P73 A;  4E7H A;  4EMK A;  2KAF A;  5CVI A;  3OQ5 A;  4GLK A;  2ALY A;  5GAO m;  2D9T A;  4H2T A;  3HXZ A;  1FXX A;  4LVM A;  3C95 A;  1VQL T;  2EJF A;  3HFN A;  2OTJ T;  3MEU A;  1UGP B;  4YRO A;  4YRS A;  1N8R C;  4QVC A;  1IL2 A;  4XTZ A;  4C0D C;  5A0D A;  3J80 E;  2E12 A;  1VQ7 T;  2LTO A;  1WLE A;  5A2Q E;  1I81 A;  3L2W A;  3TEH A;  5GAO q;  4OGE A;  2ZIM A;  2YHT A;  1U1T A;  1XQH A;  3HFO A;  3CME T;  1VIE A;  2ZIO A;  2ARS A;  3BJU A;  4P71 C;  3A32 A;  1U8R A;  5LJ3 e;  3V7R A;  5DLO A;  2XGT A;  3OYL A;  4P5N A;  1YHQ T;  5KE3 A;  2GFA A;  5FU7 C;  1RI0 A;  4UP9 A;  4BY6 B;  3CCJ T;  5GAM d;  1D3B A;  3CCU T;  2KQW A;  1M1G A;  4M75 G;  5LJ3 g;  4MMK A;  3OW2 S;  4EMK B;  3I7F A;  4YRM A;  4J8O A;  4XTY A;  3UPU A;  1YJN A;  4IUP A;  2VGM A;  2ALY B;  2PMF A;  1FX7 A;  2NS6 A;  4L5G A;  2P0K A;  4X9D A;  2J3M A;  3LLR A;  2HQE A;  1B76 A;  1NPR A;  1XNI A;  3G1Z A;  2L89 A;  5C0M A;  4E51 A;  2QTX A;  2C06 A;  1G5I A;  2A7Y A;  4DQ2 A;  1Q82 C;  4BW9 A;  4BUG A;  3M54 A;  5J26 A;  4ZTU B;  1I5L A;  4L59 A;  5CKH A;  3RMQ A;  2ZTG A;  2ZT6 A;  1OZ3 A;  3A5Y A;  4C92 C;  3V8K A;  1VQ9 A;  3QO8 A;  1KC8 C;  5KCO A;  5J3B A;  5GAN 8;  1VQO A;  5LJ3 f;  3M58 A;  1KQ1 A;  4C0Z A;  1YFT A;  3E9I A;  4M7D G;  1EIY A;  4A4E A;  3EAE A;  3LWH A;  4HWR A;  4M75 E;  3PZC A;  5CKE A;  3QNE A;  1LOJ A;  1D3B B;  3QO3 A;  4KUD K;  4LDV A;  2ZPG B;  1KMN A;  2RO0 A;  1TH7 A;  4WJ4 A;  4C8Q C;  3QUI A;  2Y4Y A;  3P8Y A;  5C53 B;  4Z02 A;  3LW5 E;  3PT9 A;  2K3X A;  3WQZ A;  4K88 A;  1AHJ B;  3JB9 H;  4YRI A;  3IKL A;  1BIB A;  5KH6 A;  2QQB A;  2K5I A;  2M9U A;  1YIJ T;  3PIO A;  3OMC A;  5CQY A;  3N5B B;  3UDC A;  5GAN 5;  4PKC C;  2CJ9 A;  4L87 A;  3OYF A;  4M7D E;  2VXF A;  2ZZF A;  3MP8 A;  3ERR A;  2KY9 A;  2PUK B;  2RI5 A;  3G71 A;  1VQ4 T;  1EIY B;  4JRI A;  3RER A;  3KXT A;  4RMO A;  2LRQ A;  4A4H A;  2RJD A;  2V8K A;  3E9G A;  4VUB A;  1E24 A;  4KQE A;  5GMK e;  2LQ8 A;  2HNI A;  4XAX B;  3JB9 J;  4EX5 A;  4JRK A;  1VQ5 A;  2GF7 A;  2BKD N;  1M1K U;  1WGS A;  2G3R A;  5GMK h;  3CPF A;  4E7J A;  1GXI E;  1QF6 A;  2L8D A;  1ASZ A;  1Z7M A;  3HRU A;  2RB6 A;  5CAI A;  3I56 T;  3DLL A;  1VQ8 A;  4GY5 A;  2P5I A;  4IUQ A;  1IRE B;  4C92 G;  4ELZ C;  1ZHI A;  1YIT A;  3CMA T;  3JB9 D;  2LNV A;  3OS0 A;  3CD6 A;  3VQY A;  4YRN A;  2ZPE B;  2LQK A;  1LYL A;  4JLI A;  3QYG B;  5E3I A;  1G3W A;  4HKE A;  4H2U A;  2QEX T;  4C5H A;  2EJ9 A;  1NJ6 A;  2GQV A;  4N4G A;  3NET A;  2V8I A;  2PU9 B;  1UEB A;  3GOX A;  1WPY A;  3ME9 A;  4BD3 A;  5GAN e;  3GNG A;  3HFV A;  1KQ2 A;  1KQS S;  3VJP A;  4CS4 A;  3JSC A;  2BUD A;  1X75 C;  3NTI A;  3DLM A;  5D6X A;  4M7A B;  2DVE A;  5GAN h;  5DLQ E;  4M75 A;  4C8Q G;  4UC4 A;  5GAN g;  3ICA A;  4YP0 A;  5I21 A;  3JRZ A;  3S3N A;  4NL3 A;  2DEQ A;  3HRT A;  2LT4 A;  4TVR A;  3VBB A;  2ZPB B;  5LL6 S;  4QVD A;  2V8J A;  4H2Y A;  4LVI A;  3MP6 A;  2K57 A;  2QHU A;  3KBG A;  3HXW A;  4WJ3 M;  4ZGJ B;  2QXF A;  4ZIB A;  4C92 E;  4Y91 A;  4H2W A;  4HT4 A;  4PL6 A;  3OB9 A;  12AS A;  5ELO A;  3HL8 A;  5DY9 A;  2ZT7 A;  3GNF B;  1O9S A;  4YRL A;  4OB3 B;  4J6W A;  5CKF A;  4JRP A;  1N9S A;  3L2R A;  1I4K 1;  1WJR A;  4M75 F;  3JCM b;  1WQ7 A;  2AMC A;  4XU1 A;  3QZ5 B;  2DK3 A;  5GAN f;  2X4W A;  2M16 A;  3IG2 A;  4H2V A;  2Q5H A;  2XHC A;  4LVK A;  3MP1 A;  4BI8 B;  1VQ6 T;  1QP2 A;  2LCL A;  4C8Q E;  4QQ6 A;  3HY1 A;  3OYK A;  1Q7Y U;  1SET A;  3FDR A;  4M75 B;  2Q7H A;  3KFU A;  1WU7 A;  1G51 A;  5FU6 C;  1Q81 C;  4DOW A;  2CS7 A;  2ZGW A;  3C4S A;  2RJE A;  2FVU A;  3CBO A;  5HKC A;  2AHJ B;  4BI3 A;  1ZQ1 A;  3CCQ A;  3HXV A;  3E9H A;  2JVV A;  1QP3 A;  1O75 A;  2DU7 A;  5GAM j;  3VYG A;  3OMG A;  1MHN A;  5CKB A;  3CCM T;  4XTW A;  3QZ9 B;  3DB3 A;  1N6A A;  4ZTF A;  3MF1 A;  4LNS A;  1USY A;  2JNG A;  3MEV A;  1DJ7 B;  5J39 A;  2CZ6 B;  2D6F A;  2EAY A;  4P71 A;  2L3R A;  3LGL A;  1YJW A;  1BYM A;  2AMC B;  4R56 A;  4BDZ A;  1H4T A;  4IUV A;  4UP8 A;  1KQS A;  1X2G A;  4Q5W A;  4CH3 A;  4RQF A;  2XI9 A;  3H8Z A;  4M7D B;  1W66 A;  2I4L A;  1OZ2 A;  2EQK A;  3HKS A;  3JB9 I;  2PQW A;  5CR2 A;  4NL2 A;  2DZ9 A;  4HA8 A;  2ZR2 A;  5IT9 E;  4TVA A;  1NPP A;  3NTK A;  3EFR A;  3H6Z A;  2DO3 A;  3UGT A;  1X6O A;  4M78 C;  2EKO A;  3L1A A;  2ZPI B;  4EMG A;  2FHD A;  2OTL T;  2ZCE A;  1Y71 A;  4B9X A;  4C0D B;  4A4F A;  3LWI A;  3M4G A;  4M78 D;  4X9C A;  2PVG B;  3V8J A;  3SWN C;  4FT2 A;  4N0A C;  3MHX A;  1XTD A;  3VQW A;  4C92 A;  1VQO T;  2QI2 A;  2ZCF B;  3MEW A;  3QBY A;  2WSC E;  3VKI A;  4QW2 A;  3P8T A;  3LX7 A;  3URG A;  2XIC A;  3PMI A;  2MF2 A;  3QO7 A;  1H64 1;  2K4Y A;  3OSS C;  4JLG A;  5FU7 B;  1VQP T;  1VQK T;  3QJ6 A;  1J5W A;  5KNN A;  4ZN3 A;  4OF1 A;  3L2V A;  1USY C;  1M90 C;  4TVA B;  3OYY A;  2DD5 A;  1QVG S;  4JS4 A;  4ZN1 A;  4C8Q A;  4C92 F;  5F5W A;  5GAM e;  5GMK l;  4BAC A;  1ADY A;  1L0W A;  2VYT A;  2CZ1 B;  1B34 A;  2R5A A;  2DTO A;  3UH0 A;  4JUV A;  1NJ8 A;  3PFS A;  2RJF A;  5GMK i;  4XQ3 A;  3G6E A;  5GAM h;  2XDP A;  3QYH B;  5CK9 A;  3JCM P;  3CCS A;  5GAM g;  3DB4 A;  5CQX A;  3DKM A;  3TEE A;  4C92 B;  3CC2 A;  1S72 T;  2L5Q A;  3P8D A;  2E1H A;  2YLB A;  5LJ5 h;  5CKD A;  5K1X A;  2NLU A;  4EDU A;  3JAM E;  5LJ5 d;  4NCX A;  5KE2 A;  1RL2 A;  3M4Q A;  5GMK j;  1Z7N A;  4PHC A;  2MMP A;  4V2S A;  4XU0 A;  1KMM A;  4C8Q F;  2ODR C;  2X4Y A;  2DJZ A;  4D6W A;  1KOG A;  3OS2 A;  1QVP A;  3M4P A;  3NEM A;  1YJ9 A;  4KUI A;  3JCM W;  4CS3 A;  2A8E A;  1VQ5 T;  1LJO A;  3CCR A;  1M4Z A;  1BI2 A;  2ODR D;  2R58 A;  2RHS A;  4P72 C;  2DXT A;  2JN0 A;  4RMF A;  1OI1 A;  4QVZ A;  3LYI A;  3TEH B;  5GAO l;  3EFS A;  1JB0 E;  4C8Q B;  4NOY A;  5GAM f;  1X54 A;  2ZT8 A;  4PG3 A;  1H4S A;  1N9R A;  3WXM B;  2IY5 A;  2VXE A;  2E6Z A;  2KDS A;  4PLL A;  3QXE B;  1B34 B;  3GLX A;  3FC3 A;  4E47 A;  2RH2 A;  4LDW A;  5GAN 7;  4BE1 A;  2AKW A;  2HD0 A;  3CD6 T;  1HK9 A;  5FLX E;  3VQV A;  5GAN 4;  3UWN A;  4TWA A;  2P4T A;  3V7S A;  3JCM c;  2EL9 A;  2ART A;  4BE2 A;  5GAN 3;  5D6Y A;  1M5Q 1;  3INZ A;  5GAN j;  1ASY A;  2XTI A;  3REX A;  1VQL A;  1W2B S;  4CS2 A;  1UGR B;  3LC0 A;  5HK3 A;  1B70 A;  3HPW A;  3HRI A;  1VQM T;  3A8M B;  4H2S A;  3LSS A;  3OS1 A;  4RQE A;  4M77 D;  1VQ7 A;  1G3T A;  3M59 A;  2X4X A;  2LVM A;  5C6S A;  2ZR3 A;  4C0F A;  3TU4 K;  4M78 E;  2ZZG A;  4WF2 A;  1K9M U;  2C8M A;  3QII A;  2RHS B;  1WJS A;  1QVG A;  4A4K A;  1Y07 A;  3OYH A;  3RF1 A;  3HXU A;  2IG0 A;  2F5T X;  4QQG A;  3S6W A;  1WQW A;  1YHQ A;  2IY5 B;  4JS5 A;  1NNH A;  3CCV T;  1M1F A;  3TRE A;  3CCJ A;  3UGQ A;  3CC4 T;  4C5G A;  3CCU A;  1BBW A;  3A8H B;  4YYE A;  2AKW B;  2CZ0 B;  3JCM d;  3M55 A;  1IZ6 A;  4BDY A;  4C5E A;  1SES A;  3QKJ A;  4KT0 E;  4F7U G;  1BI0 A;  2RA2 A;  3JCM J;  2A3L A;  4G85 A;  4BI4 A;  2WSF E;  3HTZ A;  3A7U A;  4YRC A;  5D6W A;  1B70 B;  2WAC A;  1H4V B;  1VQN T;  3CBP A;  1VIF A;  1ADJ A;  2CJA A;  4B9W A;  2DKG A;  4JDS A;  5AYF A;  1G5V A;  1QVF S;  4H2X A;  3CCL A;  4CH5 A;  2LCC A;  2CKK A;  3VUB A;  4YRJ A;  3VV0 A;  4MZP A;  1K73 U;  3MQZ A;  1HXD A;  2ZZD A;  1UGS B;  5DM7 R;  2E41 A;  4LVL A;  1B8A A;  4P3N A;  2RHZ A;  1I8F A;  3HHT B;  3DSQ A;  2RD1 A;  3A8L B;  4BWA A;  3I55 T;  2ZXF A;  1QW1 A;  3J7A F;  3VYH B;  4F7U E;  3E19 A;  2ZNI A;  4N4H A;  4HVC A;  2DZC A;  1YB3 A;  1YI2 T;  1W2B A;  4FT4 A;  2QA4 T;  1NJ2 A;  2DIG A;  4A54 A;  1KHI A;  1Q86 U;  2QHV A;  1M1K C;  4KR3 A;  1NJI U;  4YCW A;  3CC7 T;  4OVA A;  4P74 C;  3G4S T;  4HWP A;  2E65 A;  1SRY A;  4XTV A;  2EYQ A;  1X2H A;  11AS A;  1YIJ A;  3RAC A;  4OB2 B;  1FWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...