3A7UA

Crystal structure of the bovine lipoyltransferase in its unliganded form
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
343
structure length
325
Chain Sequence
GLILQSISNDVYHNLAVEDWIHDHMNLEGKPVLFLWRNSPTVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLVVRALKAVHPHLDVQATKRFDLLLDGQFKISGTASKIGRNAAYHHCTLLCGTDGTFLSSLLKKNLMEKDPTLTCEVVINAVATEYATSHQIDNHIHLINPTDETVFPGINSKAIELQTWEWIYGKTPKFSVDTSFTVLHEQSHVEIKVFIDVKNGRIEVCNIEAPDHWLPLEICDQLNSSLIGSKFSPIETTVLTSILHRTYPGDDELHSKWNILCEKIKGIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Global conformational change associated with the two-step reaction catalyzed by Escherichia coli lipoate-protein ligase A.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
molecule keywords Lipoyltransferase 1, mitochondrial
total genus 84
structure length 325
sequence length 343
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 3a7uA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3a7uA01
3HY1A 3HXVA 4H2VA 11ASA 2I4MA 1B7YA 4AH6A 3MF2A 4CS3A 1FYFA 2ZT7A 1H4TA 5G5HB 1Z7NA 2I4NA 4CH6A 3HXZA 4YRJA 1RIQA 1H4VB 1WLEA 3A7UA 3P8TA 1KMMA 4UP9A 2ZIMA 4P73C 4XTXA 3L2ZA 3MEYA 4XTWA 1G5IA 3TEHA 2DU5A 4XU3A 3P8YA 2E3TA 4CH5A 4P74A 1N5XA 2ALYA 3CMQA 4OLFA 3TUPA 3HXYA 2PMFA 3HFZB 1EIYA 5F5WA 2W3RA 3NVYB 2ZZEA 1VQZA 3G1ZA 4P3PA 4ZOHB 4K86A 2ZZFA 1B8AA 3AN1A 1NJ8A 1X2HA 2ZINA 4BWAA 1NJ1A 4XEMA 4WJ4A 2Q5IA 1ADYA 4YCVA 2AMCB 2QHSA 4XU1A 3V7SA 1BIAA 3V8LA 1YFRA 2P0LA 4EO4A 3PCOB 4XTYA 1KOGA 2DQ0A 1H4SA 1JRPA 4H2TA 1EVKA 2AMCA 2E10A 3BFMA 3HXXA 2Q7HA 4P71C 3A5YA 1HXDA 5ELNA 3RIRA 1LYLA 3V7CA 4YRQA 3VQVA 3A31A 3REXA 1ASYA 2E65A 4H2XA 4YP0A 4P72A 3E9HA 3B9JB 1WNLA 1WYGA 5K1XA 2DXUA 2IY5B 4H02A 4YYEA 3L4GB 1NYRA 4P72C 4K88A 4TVAB 3IALA 5ELOA 1ZXIC 4XEOA 2ZNJA 4XTUA 1X56A 4X5OA 4YRNA 4OP0A 4BW9A 1N63C 1HTTA 1FFUC 2CGHA 2P5IA 4UP8A 2G4CA 2ODRC 5KNNA 2AKWA 12ASA 3IKLA 4KQEA 3PCOA 1VDVA 2AKWB 1IL2A 4YRPA 1KMNA 4P75A 1ADJA 1EVLA 4J15A 4WJ3M 3NRZB 2E64A 4HWTA 2C8MA 2RHSB 2DTIA 3HRKA 2EJFA 4TVWA 1YFTA 4YCUA 2C7IA 4TQFA 4P75C 3LSSA 3AMZA 4G84A 4TVAA 4YRIA 4G85A 2DVEA 5G5GB 4XU0A 1EIYB 1SERA 3HRDC 1ATIA 2ZXFA 2CJ9A 1X2GA 2PMEA 4UP7A 2XTIA 1NJ2A 3FJPA 2EAYA 4H2YA 2DTOA 1NYQA 2Q7GA 3RKWA 2QHUA 3UGTA 4YROA 5HGQA 2ODRD 1N60C 3NVVB 2ZGWA 3P8VA 2W55A 4CS2A 2RHQB 5E3IA 1WU7A 2I4LA 3NEMA 1SRYA 3WQZA 3HFVA 3VQXA 4HWPA 2ZT8A 3IKMB 3M4PA 1G51A 4YRGA 3A74A 1N9WA 3PZCA 2E1HA 2EJGA 2ZR2A 3HXUA 3NVWB 4UPAA 1V97A 2CJBA 1FO4A 3AM9A 4Q15A 4CH3A 3UH0A 3A7AA 3R07C 3L1AA 3RKXA 5C51B 1NJ6A 3REUA 3LC0A 1QE0A 1YFSA 3LSQA 4PG3A 1GGMA 2DZCA 1E24A 4XTVA 3RL6A 3HY0A 4O2DA 4H2WA 3QTCA 4EX5A 3HFZA 4RDXA 3TEGA 3QO8A 2ARTA 4P74C 1Z7MA 1YGBA 4YCWA 4H2XB 2DJZA 4ZTUB 1N62C 2Q7EA 1QF6A 4H2SA 3I7FA 1WPYA 4RQFA 2DXTA 1J5WA 2ZIOA 2CJAA 1PYSA 4P73A 1B70A 4RQEA 4TWAA 3QO7A 2ZTGA 2ZT6A 3IG2A 3SR6B 1PYSB 3QO5A 1H4QA 4TQDA 4H2UA 4YDQA 4LNSA 2QHTA 3ERRA 1SESA 2EJ9A 4TVYA 1USYA 4YRFA 4YRCA 3VBBA 1SB3B 3NS1B 1FFVC 1N5WC 4YRTA 2DZ9A 1B7YB 4XTZA 2I4OA 3V8KA 1USYC 1L0WA 2RHQA 3HRIA 1EQRA 3RACA 4PHCA 3NETA 4KR2A 1C0AA 2E41A 1NJ5A 4DQ2A 2DTHA 3L4GA 4YRSA 2RHSA 4WI1A 2ALYB 3EFSA 3HXWA 2ARSA 2XGTA 3UGQA 2W54A 2CIMA 3OD1A 4HVCA 1EFWA 4NCXA 5K1PA 1FIQB 1X01A 2J3LA 3RUXA 1B76A 4XU2A 3QNEA 1X54A 3ETRB 4YREA 4P71A 3M4QA 3HTZA 4ZIBA 1ASZA 4HWOA 1BBUA 4YRKA 1E1TA 3NVZB 3EUB3 4YRMA 3RGLA 1W66A 2EL9A 2QHVA 4HA8A 5C52B 1JJCA 4WF2A 2HNIA 1WQ7A 3A32A 3VQYA 4HWRA 3V7RA 4CS4A 4P3OA 1B70B 1T3QC 3A7RA 4P3NA 4L87A 3NELA 4K87A 4RMFA 2EWNA 3W3SA 2ZR3A 4KR3A 3NENA 3ICAA 3R07A 2IY5A 1JJCB 1JROA 2DEQA 3KFUA 1RM6B 4DPGA 2DU7A 2DQ3A 2E3CA 4HWSA 1WYDA 4CH4A 1N61C 4E51A 3BJUA 3DSQA 3A5ZA 1BIBA 3V8JA 2E5AA 3E9IA 1YB3A 1WQWA 2FYKA 1EOVA 4ZTZB 2ARUA 4TTVA 4YRLA 3MF1A 1E1OA 1E22A 2DKGA 3VQWA 5C53B 1NNHA 2ZZGA 4YPFA 1SETA 3UFGA 1BBWA 3EFRA 2J3MA 4Q6GA 2ZCEA 3RKYA 1X55A 1G5HA 2DDZA 2ZNIA 1HC7A 3RF1A 2Q5HA 3TEHB 2W3SA 2ZT5A 4YRRA
chains in the Genus database with same CATH superfamily
1XS2A 3MZNA 2JK6A 3HY1A 4HCHA 3HXVA 4H2VA 3L5OA 1GRFA 3UJRA 11ASA 2I4MA 4H19A 4H4XA 1B7YA 3S47A 2QJNA 3MKCA 4AH6A 3MF2A 2MNRA 2OZTA 4JDRA 1BZLA 4CS3A 5ENLA 1JEHA 3CAWA 3LXDA 3LB8A 3VCCA 1FYFA 2ZT7A 1H4TA 5G5HB 4DWDA 1Z7NA 2I4NA 4CH6A 3P0WA 2PP1A 3HXZA 1KCZA 2PP3A 3V5CA 4H2HA 4YRJA 4HNCA 5FJOA 2V6OA 4MGGA 3TQPA 3ZVHB 1P43A 2BCPA 1H4VB 3NZGA 1RIQA 2HXTA 3ES7A 3R0KA 2PGEA 1WLEA 3A7UA 4E5TA 4E6MA 3P8TA 1KMMA 4UP9A 2ZIMA 4LVMA 2EQ9A 4P73C 3DEQA 4XTXA 3L2ZA 4IT1A 3VA8A 3MEYA 4XTWA 2P8CA 2XH0A 1G5IA 3TEHA 2V3AA 2A8XA 1ZX9A 3GD3A 2EQ6A 4JQ9A 4BURA 2QJJA 1MUCA 1ZMCA 2CFYA 2GGHA 2DU5A 3DGZA 4J56A 4XU3A 3P8YA 2E3TA 3OZYA 3KLJA 4H4VA 4NEWA 3DK9A 4EMWA 4CH5A 3PWIA 4P74A 1N5XA 1F8WA 4GISA 4J1OA 1YEYA 2PCEA 2GGIA 2ALYA 3VC5A 4GMEA 3HW2A 3HPFA 3CMQA 4OLFA 3TUPA 3HXYA 3DJGX 2PMFA 3HFZB 1EIYA 3PK7A 5F5WA 2W3RA 3NVYB 1NELA 2NQLA 5KVHA 2ZZEA 1VQZA 3G1ZA 4P3PA 4ZOHB 3VFCA 4DHGA 4K86A 2ZZFA 2EQ8A 5FJPA 3VCNA 1B8AA 3AN1A 1NJ8A 1X2HA 1GESA 2ZINA 1GRHA 4BWAA 1NJ1A 4XEMA 3IJLA 4WJ4A 1DXLA 2Q5IA 3CXBA 2MUCA 1NHRA 2YQUA 3SSZA 3UGVA 1ADYA 4YCVA 1W6TA 2AMCB 2QHSA 3CB3A 4XU1A 4H83A 2GDQA 4DX3A 2OZ8A 3TOYA 2GR3A 1EBGA 3V7SA 4A3RA 1BIAA 3V8LA 2WPFA 2HQMA 1YFRA 2P0LA 2PTZA 4EO4A 3PCOB 3DFYA 3FXGA 4XTYA 3EAOA 1KOGA 4YWSA 2X50A 3GY1A 3SQSA 2DQ0A 3PFRA 4EM4A 1H4SA 1JRPA 4H2TA 2GR0A 3OTRA 2GGJA 1EVKA 3NXLA 1TYPA 2AMCA 2E10A 1FHVA 1GSNA 5FS9A 2Q7HA 3BFMA 4K2SA 3A5YA 1HXDA 3HXXA 4P71C 4WI1A 5ELNA 3PWGA 3RIRA 1LYLA 4H1ZA 3V7CA 2P88A 2CDUA 4YRQA 3VQVA 3A31A 3REXA 1ASYA 5BOFA 2E65A 3TWBA 1ONFA 3H8AA 4H2XA 4YP0A 4P72A 3E9HA 3B9JB 1WNLA 3CXOA 4EQWA 1WYGA 1BWCA 3TTEA 5K1XA 1XANA 2DXUA 4KPLA 4DNAA 2IY5B 2NPXA 2BC0A 4H02A 4YYEA 2PGWA 1NHQA 3L4GB 3RL6A 1SJCA 1NYRA 4LVKA 3V5FA 4P72C 4IL0A 3MQZA 4K88A 4TVAB 3IALA 5ELOA 3DG3A 4H50A 3FG2P 1ZXIC 4XEOA 1ONEA 2ZNJA 3DK4A 5FS7A 4XTUA 1M6IA 3PG6A 3Q6JA 1X56A 5EU9A 4X5OA 4HYRA 4YRNA 4J3ZA 4OP0A 3RO6A 1SJBA 4H4YA 4BW9A 2QGYA 1N63C 1TZZA 2GRTA 1FFUC 2WPEA 5EBKA 1HTTA 2CGHA 2P5IA 4UP8A 4FP1A 2G4CA 3MQTA 2ODRC 2ZZ0A 2W0HA 4DYEA 12ASA 2AKWA 3IKLA 4KQEA 1FECA 3EF6A 5KNNA 1E9IA 3RGTA 3PCOA 1VDVA 2AKWB 1IL2A 1NPXA 4E8GA 3BJSA 4YRPA 3DG7A 3DERA 2WOWA 1KMNA 2GQWA 3L8KA 1ADJA 1EVLA 4J15A 4P75A 4WJ3M 3NRZB 3T8QA 1JPMA 3UXKA 2E64A 2WOIA 2C8MA 2RHSB 4HWTA 2DTIA 3HRKA 2AL2B 4G8TA 5FS8A 3GRTA 3CGBA 2WOVA 3N6JA 2EJFA 2POZA 3V3WA 4TVWA 1YFTA 4YCUA 2C7IA 1BQGA 4H4UA 7ENLA 3KUMA 1TE6A 3GRSA 2P8BA 2XH2A 4TQFA 4P75C 3D46A 3Q45A 1EBHA 3UJEA 4DXKA 3LSSA 3AMZA 3TCSA 4G84A 2R9ZA 4TVAA 4G85A 2DVEA 4YRIA 5G5GB 2RDXA 3EEZA 4MMWA 2HNEA 4XU0A 3URHA 1R0MA 4H4SA 1EIYB 3QPEA 1SERA 3HRDC 4ROPA 1ATIA 2A8EA 2ZXFA 2QJMA 1KD0A 4KPRA 2NS6A 2CJ9A 4H4RA 1V59A 1X2GA 3FYYA 3CK5A 5U1OA 2ZZCA 1NHPA 1RVKA 2OQHA 4UP7A 2PMEA 2XTIA 2QDDA 1NJ2A 3FJPA 1P48A 2EAYA 2PODA 3DGBA 4H2YA 3QFBA 2DTOA 2OZ3A 3O0HA 1NYQA 2Q7GA 4CS2A 3RKWA 2QHUA 3U9IA 3CGDA 4EWJA 3UGTA 4YROA 5HGQA 2ODRD 2AL1A 1N60C 3GD6A 3NVVB 3VC6A 4EQXA 2PU1A 2ZGWA 3P8VA 3SBFA 4GFIA 2W55A 3GO2A 1AOGA 1F9CA 2RHQB 3ZLGA 3OP2A 4J57A 4LIIA 3STPA 1WU7A 5E3IA 1JCTA 2C3DA 5J04A 2I4LA 5IDZA 3NEMA 1SRYA 3WQZA 3HFVA 3VQXA 4JN8A 4X2PA 3H12A 3SN1A 4HWPA 3DFHA 2ZT8A 1EBDA 4IL2A 3IKMB 3JVAA 1KKOA 3M4PA 1G51A 3RNMA 4YRGA 5KVIA 3A74A 2WP6A 1GETA 1N9WA 3PZCA 4HT4A 1ZKQA 2PTYA 2E1HA 2EJGA 2ZR2A 3HXUA 3NVWB 2OG9A 3OC4A 5ER0A 2PMQA 4UPAA 3IJIA 1V97A 3RR1A 2CJBA 2OQYA 3CGEA 1WUFA 3RCYA 1FO4A 3AM9A 3DJJA 1GRTA 2PTXA 4Q15A 1ZDLA 3UH0A 4CH3A 2YVFA 2PPGA 3A7AA 4M6UA 3IK4A 3R07C 3T9PA 3GD4A 3L1AA 3RKXA 3UXLA 5C51B 1MRAA 1NJ6A 1BKHA 2AKMA 3LC0A 3REUA 1QE0A 1YFSA 4F4RA 3LSQA 1FHUA 4PG3A 1GGMA 6ENLA 1XHCA 2DZCA 1E24A 2V3BA 3ZVHA 4EM3A 1WUEA 2BC1A 3QLDA 3HY0A 4O2DA 3FV9A 4BV6A 4H2WA 4GIRA 3QTCA 4DN1A 3TJ4A 3H70A 3S5SA 4EX5A 3HFZA 1GREA 2WBAA 4GGHA 2YVGA 2OLAA 3EKGA 4RDXA 4H4TA 1MOKA 3TEGA 1MDRA 3OW1A 3DH9A 4JN7A 1STZA 3MWCA 4HN8A 3V4BA 3QO8A 3U4FA 3K1GA 2XH4A 3CYJA 2ARTA 4GYPC 3FCPA 4M0XA 4M52A 2PSNA 3CT2A 1Z7MA 2DW6A 3DESA 1YGBA 4P74C 4H2XB 4YCWA 3MSYA 3N4FA 2DJZA 4ZTUB 2O56A 1N62C 4H4ZA 1GXFA 2Q7EA 1QF6A 4XTVA 1YQZA 4H4PA 5FMHA 4EQRA 3I7FA 4H2SA 1WPYA 2WP5A 4RQFA 2DXTA 1XPYA 1J5WA 2ZIOA 2CJAA 1PYSA 4P73A 1B70A 3N6HA 4RQEA 4E4FA 4TWAA 2XGZA 2P0IA 3THUA 3QO7A 2QDEA 1JOAA 4FX9A 2ZT6A 2ZTGA 3IG2A 3SR6B 1PYSB 3QO5A 1H4QA 3TJIA 4TQDA 4H2UA 4YDQA 3I4KA 4ZA0A 4LNSA 2QHTA 4MKSA 2ZZBA 3ERRA 1DNCA 1NU5A 3DGHA 4H4WA 1SESA 2EJ9A 4TVYA 1PDZA 2C3CA 2QQ6A 4IP5A 1USYA 4YRFA 1D7YA 4YRCA 3TWAA 1SB3B 1EC9A 3VBBA 2ZC8A 3NS1B 3ES8A 3RRAA 1FFVC 1N5WC 3ZVIA 4E4UA 4YRTA 2DZ9A 1B7YB 2F5ZA 2HZGA 4XTZA 1GRBA 1KN0A 1LPFA 4K1WA 2I4OA 2XH7A 3I6EA 1GV4A 3SJNA 2I5QA 1GRGA 3V8KA 1USYC 1L0WA 2RHQA 4H4QA 4YWOA 3T6CA 1EQRA 3HRIA 4LVLA 2P3ZA 1MDLA 3RACA 4PHCA 3NO1A 3NETA 4KR2A 1XDIA 1OEPA 5FJTA 3SQPA 5GRTA 1K4QA 1C0AA 2QAEA 2E41A 1NJ5A 4DQ2A 3LADA 2ONEA 2PA6A 4G7FA 1ZY8A 2DTHA 2OKTA 3L4GA 3II4A 2GL5A 3IJQA 1EC8A 4YRSA 1IYXA 1S7MA 3B97A 2ALYB 2RHSA 3GC2A 3EFSA 2X8HA 3UJFA 2ARSA 3FJ4A 3HXWA 4HCDA 2XGTA 3UGQA 2W54A 2CIMA 3IC9A 3QTPA 5JCKA 3OD1A 4GYPA 4HVCA 3DIPA 3R11A 4JHMA 2DW7A 5FJRA 3ZLHA 1F3PA 4A35A 3RITA 4NCXA 1EFWA 1KKRA 1FIQB 5K1PA 1FEBA 1X01A 2J3LA 3RUXA 1B76A 3OPSA 3QNEA 4XU2A 4APNA 1ECQA 5JRBA 1X54A 3ETRB 4YREA 4P71A 3UCCA 3QN3A 3M4QA 3HTZA 3R0UA 4KT2A 1R6WA 3UJSA 2X99A 4ZIBA 1ASZA 4HWOA 4K8GA 5FS6A 3OZMA 1BBUA 4YRKA 3SN4A 2EQ7A 4LA1A 1E1TA 3NVZB 3TW9A 1GRAA 3EUB3 1MNSA 4YRMA 3RGLA 2PU0A 1W66A 2WPCA 3BSMA 3DDMA 2EL9A 2QHVA 2GSHA 4HA8A 1PDYA 3N4EA 2AKZA 5C52B 4LVJA 2OX4A 1GEUA 2X8CA 1ZMDA 2XSXA 2AAQA 2TPRA 3T4WA 1JJCA 4WF2A 2HNIA 1WQ7A 4EQSA 1GERA 3A32A 5TR3A 2YAUA 3VQYA 4HWRA 3V7RA 4CS4A 4HPNA 1B70B 4P3OA 2NVKX 1T3QC 3A7RA 2RABA 3CGCA 2GR1A 2QVHA 4P3NA 2GR2A 4GGBA 4L87A 3R1ZA 3NELA 2X8GA 4K87A 4GR1A 2ZADA 3UCDA 4RMFA 2EWNA 3W3SA 4NEVA 5JCNA 2ZR3A 4KR3A 4K8DA 2HXUA 1SJAA 3NENA 3ICAA 3R07A 4Z17A 5BOEA 4K7ZA 3BOXA 2IY5A 1JJCB 1JROA 2DEQA 3KFUA 1RM6B 4DPGA 3QFAA 1JPDX 2GGEA 3R25A 4ADWA 2DU7A 2DQ3A 4LVIA 3EANA 2PTWA 2E3CA 4ZCWA 4HWSA 4IHCA 1Q1RA 4Z1YA 1WYDA 4CH4A 3JW7A 3QKEA 4HCLA 1N61C 2J3NA 5FJUA 1SJDA 3D47A 4E51A 3BJUA 2FYMA 3FVDA 2YVJA 5U25A 3ZLFA 3DSQA 3A5ZA 1Q1WA 1BIBA 3V8JA 2E5AA 2GGGA 3E9IA 4EMIA 3DK8A 1FEAA 2FKPA 2AL2A 1YB3A 5JCIA 2OVLA 1WQWA 2OO6A 4FDCB 4FI4A 1NDAA 1L8PA 2FYKA 2PP0A 3SN0A 1EOVA 4ZTZB 2ARUA 1ZK7A 3P93A 5JCMA 4TTVA 4YRLA 3MF1A 3R10A 1E1OA 4IP4A 1E22A 4GRTA 1H6VA 4IZGA 1LVLA 4KWSA 3MY9A 3P3BA 4HNLA 4KEMA 2DKGA 2OFJA 3VQWA 2CHRA 1EC7A 5C53B 3Q4DA 1JDFA 2PS2A 1NNHA 3JZUA 3ENLA 3VDGA 1TKKA 3MUCA 4EMJA 2ZZGA 4YPFA 1SETA 1OJTA 3UFGA 2OPJA 3D9XA 1ELSA 1TYTA 3DG6A 3H7VA 3H4KA 5JCLA 1BBWA 2J3MA 3EFRA 4Q6GA 1DTNA 2ZCEA 1X55A 1G5HA 2DDZA 3RKYA 4ENLA 2GH5A 2ZNIA 1HC7A 3RF1A 3UJ2A 1NHSA 4A6GA 2Q5HA 3TEHB 2W3SA 1H2IA 2ZT5A 3NFUA 1MO9A 3I6TA 4YRRA
chains in the Genus database with same CATH topology
3HY1A 3HXVA 4H2VA 11ASA 2I4MA 1B7YA 4AH6A 3MF2A 4CS3A 1FYFA 2ZT7A 1H4TA 5G5HB 1Z7NA 2I4NA 4CH6A 3HXZA 4YRJA 1RIQA 1H4VB 1WLEA 3A7UA 3P8TA 1KMMA 4UP9A 2ZIMA 4P73C 4XTXA 3L2ZA 3MEYA 4XTWA 1G5IA 3TEHA 2DU5A 4XU3A 3P8YA 2E3TA 4CH5A 4P74A 1N5XA 2ALYA 3CMQA 4OLFA 3TUPA 3HXYA 2PMFA 3HFZB 1EIYA 5F5WA 2W3RA 3NVYB 2ZZEA 1VQZA 3G1ZA 4P3PA 4ZOHB 4K86A 2ZZFA 1B8AA 3AN1A 1NJ8A 1X2HA 2ZINA 4BWAA 1NJ1A 4XEMA 4WJ4A 2Q5IA 1ADYA 4YCVA 2AMCB 2QHSA 4XU1A 3V7SA 1BIAA 3V8LA 1YFRA 2P0LA 4EO4A 3PCOB 4XTYA 1KOGA 2DQ0A 1H4SA 1JRPA 4H2TA 1EVKA 2AMCA 2E10A 3BFMA 3HXXA 2Q7HA 4P71C 3A5YA 1HXDA 5ELNA 3RIRA 1LYLA 3V7CA 4YRQA 3VQVA 3A31A 3REXA 1ASYA 2E65A 4H2XA 4YP0A 4P72A 3E9HA 3B9JB 1WNLA 1WYGA 5K1XA 2DXUA 2IY5B 4H02A 4YYEA 3L4GB 1NYRA 4LVKA 4P72C 3MQZA 4K88A 4TVAB 3IALA 5ELOA 1ZXIC 4XEOA 2ZNJA 4XTUA 1X56A 4X5OA 4YRNA 4OP0A 4BW9A 1N63C 1HTTA 1FFUC 2CGHA 2P5IA 4UP8A 2G4CA 2ODRC 5KNNA 2AKWA 12ASA 3IKLA 4KQEA 3PCOA 1VDVA 2AKWB 1IL2A 4YRPA 1KMNA 4P75A 1ADJA 1EVLA 4J15A 4WJ3M 3NRZB 2E64A 4HWTA 2C8MA 2RHSB 2DTIA 3HRKA 2EJFA 4TVWA 1YFTA 4YCUA 2C7IA 4TQFA 4P75C 3LSSA 3AMZA 4G84A 4TVAA 4YRIA 4G85A 2DVEA 5G5GB 4XU0A 1EIYB 1SERA 3HRDC 1ATIA 2A8EA 2ZXFA 2NS6A 2CJ9A 1X2GA 2PMEA 4UP7A 2XTIA 1NJ2A 3FJPA 2EAYA 4H2YA 2DTOA 1NYQA 2Q7GA 3RKWA 2QHUA 3UGTA 4YROA 5HGQA 2ODRD 1N60C 3NVVB 2ZGWA 3P8VA 2W55A 4CS2A 2RHQB 5E3IA 1WU7A 2I4LA 3NEMA 1SRYA 3WQZA 3HFVA 3VQXA 4HWPA 2ZT8A 3IKMB 3M4PA 1G51A 4YRGA 3A74A 1N9WA 3PZCA 4HT4A 2E1HA 2EJGA 2ZR2A 3HXUA 3NVWB 4UPAA 1V97A 2CJBA 1FO4A 3AM9A 4Q15A 4CH3A 3UH0A 3A7AA 3R07C 3L1AA 3RKXA 5C51B 1NJ6A 3REUA 3LC0A 1QE0A 1YFSA 3LSQA 4PG3A 1GGMA 2DZCA 1E24A 4XTVA 3RL6A 3HY0A 4O2DA 4H2WA 3QTCA 4EX5A 3HFZA 4RDXA 3TEGA 3QO8A 2ARTA 4P74C 1Z7MA 1YGBA 4YCWA 4H2XB 2DJZA 4ZTUB 1N62C 2Q7EA 1QF6A 4H2SA 3I7FA 1WPYA 4RQFA 2DXTA 1J5WA 2ZIOA 2CJAA 1PYSA 4P73A 1B70A 4RQEA 4TWAA 3QO7A 2ZTGA 2ZT6A 3IG2A 3SR6B 1PYSB 3QO5A 1H4QA 4TQDA 4H2UA 4YDQA 4LNSA 2QHTA 3ERRA 1SESA 2EJ9A 4TVYA 1USYA 4YRFA 4YRCA 3VBBA 1SB3B 3NS1B 1FFVC 1N5WC 4YRTA 2DZ9A 1B7YB 4XTZA 2I4OA 3V8KA 1USYC 1L0WA 2RHQA 3HRIA 1EQRA 4LVLA 3RACA 4PHCA 3NETA 4KR2A 1C0AA 2E41A 1NJ5A 4DQ2A 2DTHA 3L4GA 4YRSA 2RHSA 4WI1A 4LVMA 2ALYB 3EFSA 3HXWA 2ARSA 2XGTA 3UGQA 2W54A 2CIMA 3OD1A 4HVCA 1EFWA 4NCXA 5K1PA 1FIQB 1X01A 2J3LA 3RUXA 1B76A 4XU2A 3QNEA 1X54A 3ETRB 4YREA 4P71A 3M4QA 3HTZA 4ZIBA 1ASZA 4HWOA 1BBUA 4YRKA 1E1TA 3NVZB 3EUB3 4YRMA 3RGLA 1W66A 2EL9A 2QHVA 4HA8A 5C52B 4LVJA 1JJCA 4WF2A 2HNIA 1WQ7A 3A32A 3VQYA 4HWRA 3V7RA 4CS4A 4P3OA 1B70B 1T3QC 3A7RA 4P3NA 4L87A 3NELA 4K87A 4RMFA 2EWNA 3W3SA 2ZR3A 4KR3A 3NENA 3ICAA 3R07A 2IY5A 1JJCB 1JROA 2DEQA 3KFUA 1RM6B 4DPGA 2DU7A 2DQ3A 4LVIA 2E3CA 4HWSA 1WYDA 4CH4A 1N61C 4E51A 3BJUA 3DSQA 3A5ZA 1BIBA 3V8JA 2E5AA 3E9IA 1YB3A 1WQWA 2FYKA 1EOVA 4ZTZB 2ARUA 4TTVA 4YRLA 3MF1A 1E1OA 1E22A 2DKGA 3VQWA 5C53B 1NNHA 2ZZGA 4YPFA 1SETA 3UFGA 1BBWA 3EFRA 2J3MA 4Q6GA 2ZCEA 3RKYA 1X55A 1G5HA 2DDZA 2ZNIA 1HC7A 3RF1A 2Q5HA 3TEHB 2W3SA 2ZT5A 4YRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HY1 A;  3HXV A;  4H2V A;  11AS A;  2I4M A;  1B7Y A;  4AH6 A;  3MF2 A;  4CS3 A;  1FYF A;  2ZT7 A;  1H4T A;  5G5H B;  1Z7N A;  2I4N A;  4CH6 A;  3HXZ A;  4YRJ A;  1RIQ A;  1H4V B;  1WLE A;  3A7U A;  3P8T A;  1KMM A;  4UP9 A;  2ZIM A;  4P73 C;  4XTX A;  3L2Z A;  3MEY A;  4XTW A;  1G5I A;  3TEH A;  2DU5 A;  4XU3 A;  3P8Y A;  2E3T A;  4CH5 A;  4P74 A;  1N5X A;  2ALY A;  3CMQ A;  4OLF A;  3TUP A;  3HXY A;  2PMF A;  3HFZ B;  1EIY A;  5F5W A;  2W3R A;  3NVY B;  2ZZE A;  1VQZ A;  3G1Z A;  4P3P A;  4ZOH B;  4K86 A;  2ZZF A;  1B8A A;  3AN1 A;  1NJ8 A;  1X2H A;  2ZIN A;  4BWA A;  1NJ1 A;  4XEM A;  4WJ4 A;  2Q5I A;  1ADY A;  4YCV A;  2AMC B;  2QHS A;  4XU1 A;  3V7S A;  1BIA A;  3V8L A;  1YFR A;  2P0L A;  4EO4 A;  3PCO B;  4XTY A;  1KOG A;  2DQ0 A;  1H4S A;  1JRP A;  4H2T A;  1EVK A;  2AMC A;  2E10 A;  3BFM A;  3HXX A;  2Q7H A;  4P71 C;  3A5Y A;  1HXD A;  5ELN A;  3RIR A;  1LYL A;  3V7C A;  4YRQ A;  3VQV A;  3A31 A;  3REX A;  1ASY A;  2E65 A;  4H2X A;  4YP0 A;  4P72 A;  3E9H A;  3B9J B;  1WNL A;  1WYG A;  5K1X A;  2DXU A;  2IY5 B;  4H02 A;  4YYE A;  3L4G B;  1NYR A;  4P72 C;  4K88 A;  4TVA B;  3IAL A;  5ELO A;  1ZXI C;  4XEO A;  2ZNJ A;  4XTU A;  1X56 A;  4X5O A;  4YRN A;  4OP0 A;  4BW9 A;  1N63 C;  1HTT A;  1FFU C;  2CGH A;  2P5I A;  4UP8 A;  2G4C A;  2ODR C;  5KNN A;  2AKW A;  12AS A;  3IKL A;  4KQE A;  3PCO A;  1VDV A;  2AKW B;  1IL2 A;  4YRP A;  1KMN A;  4P75 A;  1ADJ A;  1EVL A;  4J15 A;  4WJ3 M;  3NRZ B;  2E64 A;  4HWT A;  2C8M A;  2RHS B;  2DTI A;  3HRK A;  2EJF A;  4TVW A;  1YFT A;  4YCU A;  2C7I A;  4TQF A;  4P75 C;  3LSS A;  3AMZ A;  4G84 A;  4TVA A;  4YRI A;  4G85 A;  2DVE A;  5G5G B;  4XU0 A;  1EIY B;  1SER A;  3HRD C;  1ATI A;  2ZXF A;  2CJ9 A;  1X2G A;  2PME A;  4UP7 A;  2XTI A;  1NJ2 A;  3FJP A;  2EAY A;  4H2Y A;  2DTO A;  1NYQ A;  2Q7G A;  3RKW A;  2QHU A;  3UGT A;  4YRO A;  5HGQ A;  2ODR D;  1N60 C;  3NVV B;  2ZGW A;  3P8V A;  2W55 A;  4CS2 A;  2RHQ B;  5E3I A;  1WU7 A;  2I4L A;  3NEM A;  1SRY A;  3WQZ A;  3HFV A;  3VQX A;  4HWP A;  2ZT8 A;  3IKM B;  3M4P A;  1G51 A;  4YRG A;  3A74 A;  1N9W A;  3PZC A;  2E1H A;  2EJG A;  2ZR2 A;  3HXU A;  3NVW B;  4UPA A;  1V97 A;  2CJB A;  1FO4 A;  3AM9 A;  4Q15 A;  4CH3 A;  3UH0 A;  3A7A A;  3R07 C;  3L1A A;  3RKX A;  5C51 B;  1NJ6 A;  3REU A;  3LC0 A;  1QE0 A;  1YFS A;  3LSQ A;  4PG3 A;  1GGM A;  2DZC A;  1E24 A;  4XTV A;  3RL6 A;  3HY0 A;  4O2D A;  4H2W A;  3QTC A;  4EX5 A;  3HFZ A;  4RDX A;  3TEG A;  3QO8 A;  2ART A;  4P74 C;  1Z7M A;  1YGB A;  4YCW A;  4H2X B;  2DJZ A;  4ZTU B;  1N62 C;  2Q7E A;  1QF6 A;  4H2S A;  3I7F A;  1WPY A;  4RQF A;  2DXT A;  1J5W A;  2ZIO A;  2CJA A;  1PYS A;  4P73 A;  1B70 A;  4RQE A;  4TWA A;  3QO7 A;  2ZTG A;  2ZT6 A;  3IG2 A;  3SR6 B;  1PYS B;  3QO5 A;  1H4Q A;  4TQD A;  4H2U A;  4YDQ A;  4LNS A;  2QHT A;  3ERR A;  1SES A;  2EJ9 A;  4TVY A;  1USY A;  4YRF A;  4YRC A;  3VBB A;  1SB3 B;  3NS1 B;  1FFV C;  1N5W C;  4YRT A;  2DZ9 A;  1B7Y B;  4XTZ A;  2I4O A;  3V8K A;  1USY C;  1L0W A;  2RHQ A;  3HRI A;  1EQR A;  3RAC A;  4PHC A;  3NET A;  4KR2 A;  1C0A A;  2E41 A;  1NJ5 A;  4DQ2 A;  2DTH A;  3L4G A;  4YRS A;  2RHS A;  4WI1 A;  2ALY B;  3EFS A;  3HXW A;  2ARS A;  2XGT A;  3UGQ A;  2W54 A;  2CIM A;  3OD1 A;  4HVC A;  1EFW A;  4NCX A;  5K1P A;  1FIQ B;  1X01 A;  2J3L A;  3RUX A;  1B76 A;  4XU2 A;  3QNE A;  1X54 A;  3ETR B;  4YRE A;  4P71 A;  3M4Q A;  3HTZ A;  4ZIB A;  1ASZ A;  4HWO A;  1BBU A;  4YRK A;  1E1T A;  3NVZ B;  3EUB 3;  4YRM A;  3RGL A;  1W66 A;  2EL9 A;  2QHV A;  4HA8 A;  5C52 B;  1JJC A;  4WF2 A;  2HNI A;  1WQ7 A;  3A32 A;  3VQY A;  4HWR A;  3V7R A;  4CS4 A;  4P3O A;  1B70 B;  1T3Q C;  3A7R A;  4P3N A;  4L87 A;  3NEL A;  4K87 A;  4RMF A;  2EWN A;  3W3S A;  2ZR3 A;  4KR3 A;  3NEN A;  3ICA A;  3R07 A;  2IY5 A;  1JJC B;  1JRO A;  2DEQ A;  3KFU A;  1RM6 B;  4DPG A;  2DU7 A;  2DQ3 A;  2E3C A;  4HWS A;  1WYD A;  4CH4 A;  1N61 C;  4E51 A;  3BJU A;  3DSQ A;  3A5Z A;  1BIB A;  3V8J A;  2E5A A;  3E9I A;  1YB3 A;  1WQW A;  2FYK A;  1EOV A;  4ZTZ B;  2ARU A;  4TTV A;  4YRL A;  3MF1 A;  1E1O A;  1E22 A;  2DKG A;  3VQW A;  5C53 B;  1NNH A;  2ZZG A;  4YPF A;  1SET A;  3UFG A;  1BBW A;  3EFR A;  2J3M A;  4Q6G A;  2ZCE A;  3RKY A;  1X55 A;  1G5H A;  2DDZ A;  2ZNI A;  1HC7 A;  3RF1 A;  2Q5H A;  3TEH B;  2W3S A;  2ZT5 A;  4YRR A; 
#chains in the Genus database with same CATH topology
 1XS2 A;  3MZN A;  2JK6 A;  3HY1 A;  4HCH A;  3HXV A;  4H2V A;  3L5O A;  1GRF A;  3UJR A;  11AS A;  2I4M A;  4H19 A;  4H4X A;  1B7Y A;  3S47 A;  2QJN A;  3MKC A;  4AH6 A;  3MF2 A;  2MNR A;  2OZT A;  4JDR A;  1BZL A;  4CS3 A;  5ENL A;  1JEH A;  3CAW A;  3LXD A;  3LB8 A;  3VCC A;  1FYF A;  2ZT7 A;  1H4T A;  5G5H B;  4DWD A;  1Z7N A;  2I4N A;  4CH6 A;  3P0W A;  2PP1 A;  3HXZ A;  1KCZ A;  2PP3 A;  3V5C A;  4H2H A;  4YRJ A;  4HNC A;  5FJO A;  2V6O A;  4MGG A;  3TQP A;  3ZVH B;  1P43 A;  2BCP A;  1H4V B;  3NZG A;  1RIQ A;  2HXT A;  3ES7 A;  3R0K A;  2PGE A;  1WLE A;  3A7U A;  4E5T A;  4E6M A;  3P8T A;  1KMM A;  4UP9 A;  2ZIM A;  4LVM A;  2EQ9 A;  4P73 C;  3DEQ A;  4XTX A;  3L2Z A;  4IT1 A;  3VA8 A;  3MEY A;  4XTW A;  2P8C A;  2XH0 A;  1G5I A;  3TEH A;  2V3A A;  2A8X A;  1ZX9 A;  3GD3 A;  2EQ6 A;  4JQ9 A;  4BUR A;  2QJJ A;  1MUC A;  1ZMC A;  2CFY A;  2GGH A;  2DU5 A;  3DGZ A;  4J56 A;  4XU3 A;  3P8Y A;  2E3T A;  3OZY A;  3KLJ A;  4H4V A;  4NEW A;  3DK9 A;  4EMW A;  4CH5 A;  3PWI A;  4P74 A;  1N5X A;  1F8W A;  4GIS A;  4J1O A;  1YEY A;  2PCE A;  2GGI A;  2ALY A;  3VC5 A;  4GME A;  3HW2 A;  3HPF A;  3CMQ A;  4OLF A;  3TUP A;  3HXY A;  3DJG X;  2PMF A;  3HFZ B;  1EIY A;  3PK7 A;  5F5W A;  2W3R A;  3NVY B;  1NEL A;  2NQL A;  5KVH A;  2ZZE A;  1VQZ A;  3G1Z A;  4P3P A;  4ZOH B;  3VFC A;  4DHG A;  4K86 A;  2ZZF A;  2EQ8 A;  5FJP A;  3VCN A;  1B8A A;  3AN1 A;  1NJ8 A;  1X2H A;  1GES A;  2ZIN A;  1GRH A;  4BWA A;  1NJ1 A;  4XEM A;  3IJL A;  4WJ4 A;  1DXL A;  2Q5I A;  3CXB A;  2MUC A;  1NHR A;  2YQU A;  3SSZ A;  3UGV A;  1ADY A;  4YCV A;  1W6T A;  2AMC B;  2QHS A;  3CB3 A;  4XU1 A;  4H83 A;  2GDQ A;  4DX3 A;  2OZ8 A;  3TOY A;  2GR3 A;  1EBG A;  3V7S A;  4A3R A;  1BIA A;  3V8L A;  2WPF A;  2HQM A;  1YFR A;  2P0L A;  2PTZ A;  4EO4 A;  3PCO B;  3DFY A;  3FXG A;  4XTY A;  3EAO A;  1KOG A;  4YWS A;  2X50 A;  3GY1 A;  3SQS A;  2DQ0 A;  3PFR A;  4EM4 A;  1H4S A;  1JRP A;  4H2T A;  2GR0 A;  3OTR A;  2GGJ A;  1EVK A;  3NXL A;  1TYP A;  2AMC A;  2E10 A;  1FHV A;  1GSN A;  5FS9 A;  2Q7H A;  3BFM A;  4K2S A;  3A5Y A;  1HXD A;  3HXX A;  4P71 C;  4WI1 A;  5ELN A;  3PWG A;  3RIR A;  1LYL A;  4H1Z A;  3V7C A;  2P88 A;  2CDU A;  4YRQ A;  3VQV A;  3A31 A;  3REX A;  1ASY A;  5BOF A;  2E65 A;  3TWB A;  1ONF A;  3H8A A;  4H2X A;  4YP0 A;  4P72 A;  3E9H A;  3B9J B;  1WNL A;  3CXO A;  4EQW A;  1WYG A;  1BWC A;  3TTE A;  5K1X A;  1XAN A;  2DXU A;  4KPL A;  4DNA A;  2IY5 B;  2NPX A;  2BC0 A;  4H02 A;  4YYE A;  2PGW A;  1NHQ A;  3L4G B;  3RL6 A;  1SJC A;  1NYR A;  4LVK A;  3V5F A;  4P72 C;  4IL0 A;  3MQZ A;  4K88 A;  4TVA B;  3IAL A;  5ELO A;  3DG3 A;  4H50 A;  3FG2 P;  1ZXI C;  4XEO A;  1ONE A;  2ZNJ A;  3DK4 A;  5FS7 A;  4XTU A;  1M6I A;  3PG6 A;  3Q6J A;  1X56 A;  5EU9 A;  4X5O A;  4HYR A;  4YRN A;  4J3Z A;  4OP0 A;  3RO6 A;  1SJB A;  4H4Y A;  4BW9 A;  2QGY A;  1N63 C;  1TZZ A;  2GRT A;  1FFU C;  2WPE A;  5EBK A;  1HTT A;  2CGH A;  2P5I A;  4UP8 A;  4FP1 A;  2G4C A;  3MQT A;  2ODR C;  2ZZ0 A;  2W0H A;  4DYE A;  12AS A;  2AKW A;  3IKL A;  4KQE A;  1FEC A;  3EF6 A;  5KNN A;  1E9I A;  3RGT A;  3PCO A;  1VDV A;  2AKW B;  1IL2 A;  1NPX A;  4E8G A;  3BJS A;  4YRP A;  3DG7 A;  3DER A;  2WOW A;  1KMN A;  2GQW A;  3L8K A;  1ADJ A;  1EVL A;  4J15 A;  4P75 A;  4WJ3 M;  3NRZ B;  3T8Q A;  1JPM A;  3UXK A;  2E64 A;  2WOI A;  2C8M A;  2RHS B;  4HWT A;  2DTI A;  3HRK A;  2AL2 B;  4G8T A;  5FS8 A;  3GRT A;  3CGB A;  2WOV A;  3N6J A;  2EJF A;  2POZ A;  3V3W A;  4TVW A;  1YFT A;  4YCU A;  2C7I A;  1BQG A;  4H4U A;  7ENL A;  3KUM A;  1TE6 A;  3GRS A;  2P8B A;  2XH2 A;  4TQF A;  4P75 C;  3D46 A;  3Q45 A;  1EBH A;  3UJE A;  4DXK A;  3LSS A;  3AMZ A;  3TCS A;  4G84 A;  2R9Z A;  4TVA A;  4G85 A;  2DVE A;  4YRI A;  5G5G B;  2RDX A;  3EEZ A;  4MMW A;  2HNE A;  4XU0 A;  3URH A;  1R0M A;  4H4S A;  1EIY B;  3QPE A;  1SER A;  3HRD C;  4ROP A;  1ATI A;  2A8E A;  2ZXF A;  2QJM A;  1KD0 A;  4KPR A;  2NS6 A;  2CJ9 A;  4H4R A;  1V59 A;  1X2G A;  3FYY A;  3CK5 A;  5U1O A;  2ZZC A;  1NHP A;  1RVK A;  2OQH A;  4UP7 A;  2PME A;  2XTI A;  2QDD A;  1NJ2 A;  3FJP A;  1P48 A;  2EAY A;  2POD A;  3DGB A;  4H2Y A;  3QFB A;  2DTO A;  2OZ3 A;  3O0H A;  1NYQ A;  2Q7G A;  4CS2 A;  3RKW A;  2QHU A;  3U9I A;  3CGD A;  4EWJ A;  3UGT A;  4YRO A;  5HGQ A;  2ODR D;  2AL1 A;  1N60 C;  3GD6 A;  3NVV B;  3VC6 A;  4EQX A;  2PU1 A;  2ZGW A;  3P8V A;  3SBF A;  4GFI A;  2W55 A;  3GO2 A;  1AOG A;  1F9C A;  2RHQ B;  3ZLG A;  3OP2 A;  4J57 A;  4LII A;  3STP A;  1WU7 A;  5E3I A;  1JCT A;  2C3D A;  5J04 A;  2I4L A;  5IDZ A;  3NEM A;  1SRY A;  3WQZ A;  3HFV A;  3VQX A;  4JN8 A;  4X2P A;  3H12 A;  3SN1 A;  4HWP A;  3DFH A;  2ZT8 A;  1EBD A;  4IL2 A;  3IKM B;  3JVA A;  1KKO A;  3M4P A;  1G51 A;  3RNM A;  4YRG A;  5KVI A;  3A74 A;  2WP6 A;  1GET A;  1N9W A;  3PZC A;  4HT4 A;  1ZKQ A;  2PTY A;  2E1H A;  2EJG A;  2ZR2 A;  3HXU A;  3NVW B;  2OG9 A;  3OC4 A;  5ER0 A;  2PMQ A;  4UPA A;  3IJI A;  1V97 A;  3RR1 A;  2CJB A;  2OQY A;  3CGE A;  1WUF A;  3RCY A;  1FO4 A;  3AM9 A;  3DJJ A;  1GRT A;  2PTX A;  4Q15 A;  1ZDL A;  3UH0 A;  4CH3 A;  2YVF A;  2PPG A;  3A7A A;  4M6U A;  3IK4 A;  3R07 C;  3T9P A;  3GD4 A;  3L1A A;  3RKX A;  3UXL A;  5C51 B;  1MRA A;  1NJ6 A;  1BKH A;  2AKM A;  3LC0 A;  3REU A;  1QE0 A;  1YFS A;  4F4R A;  3LSQ A;  1FHU A;  4PG3 A;  1GGM A;  6ENL A;  1XHC A;  2DZC A;  1E24 A;  2V3B A;  3ZVH A;  4EM3 A;  1WUE A;  2BC1 A;  3QLD A;  3HY0 A;  4O2D A;  3FV9 A;  4BV6 A;  4H2W A;  4GIR A;  3QTC A;  4DN1 A;  3TJ4 A;  3H70 A;  3S5S A;  4EX5 A;  3HFZ A;  1GRE A;  2WBA A;  4GGH A;  2YVG A;  2OLA A;  3EKG A;  4RDX A;  4H4T A;  1MOK A;  3TEG A;  1MDR A;  3OW1 A;  3DH9 A;  4JN7 A;  1STZ A;  3MWC A;  4HN8 A;  3V4B A;  3QO8 A;  3U4F A;  3K1G A;  2XH4 A;  3CYJ A;  2ART A;  4GYP C;  3FCP A;  4M0X A;  4M52 A;  2PSN A;  3CT2 A;  1Z7M A;  2DW6 A;  3DES A;  1YGB A;  4P74 C;  4H2X B;  4YCW A;  3MSY A;  3N4F A;  2DJZ A;  4ZTU B;  2O56 A;  1N62 C;  4H4Z A;  1GXF A;  2Q7E A;  1QF6 A;  4XTV A;  1YQZ A;  4H4P A;  5FMH A;  4EQR A;  3I7F A;  4H2S A;  1WPY A;  2WP5 A;  4RQF A;  2DXT A;  1XPY A;  1J5W A;  2ZIO A;  2CJA A;  1PYS A;  4P73 A;  1B70 A;  3N6H A;  4RQE A;  4E4F A;  4TWA A;  2XGZ A;  2P0I A;  3THU A;  3QO7 A;  2QDE A;  1JOA A;  4FX9 A;  2ZT6 A;  2ZTG A;  3IG2 A;  3SR6 B;  1PYS B;  3QO5 A;  1H4Q A;  3TJI A;  4TQD A;  4H2U A;  4YDQ A;  3I4K A;  4ZA0 A;  4LNS A;  2QHT A;  4MKS A;  2ZZB A;  3ERR A;  1DNC A;  1NU5 A;  3DGH A;  4H4W A;  1SES A;  2EJ9 A;  4TVY A;  1PDZ A;  2C3C A;  2QQ6 A;  4IP5 A;  1USY A;  4YRF A;  1D7Y A;  4YRC A;  3TWA A;  1SB3 B;  1EC9 A;  3VBB A;  2ZC8 A;  3NS1 B;  3ES8 A;  3RRA A;  1FFV C;  1N5W C;  3ZVI A;  4E4U A;  4YRT A;  2DZ9 A;  1B7Y B;  2F5Z A;  2HZG A;  4XTZ A;  1GRB A;  1KN0 A;  1LPF A;  4K1W A;  2I4O A;  2XH7 A;  3I6E A;  1GV4 A;  3SJN A;  2I5Q A;  1GRG A;  3V8K A;  1USY C;  1L0W A;  2RHQ A;  4H4Q A;  4YWO A;  3T6C A;  1EQR A;  3HRI A;  4LVL A;  2P3Z A;  1MDL A;  3RAC A;  4PHC A;  3NO1 A;  3NET A;  4KR2 A;  1XDI A;  1OEP A;  5FJT A;  3SQP A;  5GRT A;  1K4Q A;  1C0A A;  2QAE A;  2E41 A;  1NJ5 A;  4DQ2 A;  3LAD A;  2ONE A;  2PA6 A;  4G7F A;  1ZY8 A;  2DTH A;  2OKT A;  3L4G A;  3II4 A;  2GL5 A;  3IJQ A;  1EC8 A;  4YRS A;  1IYX A;  1S7M A;  3B97 A;  2ALY B;  2RHS A;  3GC2 A;  3EFS A;  2X8H A;  3UJF A;  2ARS A;  3FJ4 A;  3HXW A;  4HCD A;  2XGT A;  3UGQ A;  2W54 A;  2CIM A;  3IC9 A;  3QTP A;  5JCK A;  3OD1 A;  4GYP A;  4HVC A;  3DIP A;  3R11 A;  4JHM A;  2DW7 A;  5FJR A;  3ZLH A;  1F3P A;  4A35 A;  3RIT A;  4NCX A;  1EFW A;  1KKR A;  1FIQ B;  5K1P A;  1FEB A;  1X01 A;  2J3L A;  3RUX A;  1B76 A;  3OPS A;  3QNE A;  4XU2 A;  4APN A;  1ECQ A;  5JRB A;  1X54 A;  3ETR B;  4YRE A;  4P71 A;  3UCC A;  3QN3 A;  3M4Q A;  3HTZ A;  3R0U A;  4KT2 A;  1R6W A;  3UJS A;  2X99 A;  4ZIB A;  1ASZ A;  4HWO A;  4K8G A;  5FS6 A;  3OZM A;  1BBU A;  4YRK A;  3SN4 A;  2EQ7 A;  4LA1 A;  1E1T A;  3NVZ B;  3TW9 A;  1GRA A;  3EUB 3;  1MNS A;  4YRM A;  3RGL A;  2PU0 A;  1W66 A;  2WPC A;  3BSM A;  3DDM A;  2EL9 A;  2QHV A;  2GSH A;  4HA8 A;  1PDY A;  3N4E A;  2AKZ A;  5C52 B;  4LVJ A;  2OX4 A;  1GEU A;  2X8C A;  1ZMD A;  2XSX A;  2AAQ A;  2TPR A;  3T4W A;  1JJC A;  4WF2 A;  2HNI A;  1WQ7 A;  4EQS A;  1GER A;  3A32 A;  5TR3 A;  2YAU A;  3VQY A;  4HWR A;  3V7R A;  4CS4 A;  4HPN A;  1B70 B;  4P3O A;  2NVK X;  1T3Q C;  3A7R A;  2RAB A;  3CGC A;  2GR1 A;  2QVH A;  4P3N A;  2GR2 A;  4GGB A;  4L87 A;  3R1Z A;  3NEL A;  2X8G A;  4K87 A;  4GR1 A;  2ZAD A;  3UCD A;  4RMF A;  2EWN A;  3W3S A;  4NEV A;  5JCN A;  2ZR3 A;  4KR3 A;  4K8D A;  2HXU A;  1SJA A;  3NEN A;  3ICA A;  3R07 A;  4Z17 A;  5BOE A;  4K7Z A;  3BOX A;  2IY5 A;  1JJC B;  1JRO A;  2DEQ A;  3KFU A;  1RM6 B;  4DPG A;  3QFA A;  1JPD X;  2GGE A;  3R25 A;  4ADW A;  2DU7 A;  2DQ3 A;  4LVI A;  3EAN A;  2PTW A;  2E3C A;  4ZCW A;  4HWS A;  4IHC A;  1Q1R A;  4Z1Y A;  1WYD A;  4CH4 A;  3JW7 A;  3QKE A;  4HCL A;  1N61 C;  2J3N A;  5FJU A;  1SJD A;  3D47 A;  4E51 A;  3BJU A;  2FYM A;  3FVD A;  2YVJ A;  5U25 A;  3ZLF A;  3DSQ A;  3A5Z A;  1Q1W A;  1BIB A;  3V8J A;  2E5A A;  2GGG A;  3E9I A;  4EMI A;  3DK8 A;  1FEA A;  2FKP A;  2AL2 A;  1YB3 A;  5JCI A;  2OVL A;  1WQW A;  2OO6 A;  4FDC B;  4FI4 A;  1NDA A;  1L8P A;  2FYK A;  2PP0 A;  3SN0 A;  1EOV A;  4ZTZ B;  2ARU A;  1ZK7 A;  3P93 A;  5JCM A;  4TTV A;  4YRL A;  3MF1 A;  3R10 A;  1E1O A;  4IP4 A;  1E22 A;  4GRT A;  1H6V A;  4IZG A;  1LVL A;  4KWS A;  3MY9 A;  3P3B A;  4HNL A;  4KEM A;  2DKG A;  2OFJ A;  3VQW A;  2CHR A;  1EC7 A;  5C53 B;  3Q4D A;  1JDF A;  2PS2 A;  1NNH A;  3JZU A;  3ENL A;  3VDG A;  1TKK A;  3MUC A;  4EMJ A;  2ZZG A;  4YPF A;  1SET A;  1OJT A;  3UFG A;  2OPJ A;  3D9X A;  1ELS A;  1TYT A;  3DG6 A;  3H7V A;  3H4K A;  5JCL A;  1BBW A;  2J3M A;  3EFR A;  4Q6G A;  1DTN A;  2ZCE A;  1X55 A;  1G5H A;  2DDZ A;  3RKY A;  4ENL A;  2GH5 A;  2ZNI A;  1HC7 A;  3RF1 A;  3UJ2 A;  1NHS A;  4A6G A;  2Q5H A;  3TEH B;  2W3S A;  1H2I A;  2ZT5 A;  3NFU A;  1MO9 A;  3I6T A;  4YRR A; 
#chains in the Genus database with same CATH homology
 3HY1 A;  3HXV A;  4H2V A;  11AS A;  2I4M A;  1B7Y A;  4AH6 A;  3MF2 A;  4CS3 A;  1FYF A;  2ZT7 A;  1H4T A;  5G5H B;  1Z7N A;  2I4N A;  4CH6 A;  3HXZ A;  4YRJ A;  1RIQ A;  1H4V B;  1WLE A;  3A7U A;  3P8T A;  1KMM A;  4UP9 A;  2ZIM A;  4P73 C;  4XTX A;  3L2Z A;  3MEY A;  4XTW A;  1G5I A;  3TEH A;  2DU5 A;  4XU3 A;  3P8Y A;  2E3T A;  4CH5 A;  4P74 A;  1N5X A;  2ALY A;  3CMQ A;  4OLF A;  3TUP A;  3HXY A;  2PMF A;  3HFZ B;  1EIY A;  5F5W A;  2W3R A;  3NVY B;  2ZZE A;  1VQZ A;  3G1Z A;  4P3P A;  4ZOH B;  4K86 A;  2ZZF A;  1B8A A;  3AN1 A;  1NJ8 A;  1X2H A;  2ZIN A;  4BWA A;  1NJ1 A;  4XEM A;  4WJ4 A;  2Q5I A;  1ADY A;  4YCV A;  2AMC B;  2QHS A;  4XU1 A;  3V7S A;  1BIA A;  3V8L A;  1YFR A;  2P0L A;  4EO4 A;  3PCO B;  4XTY A;  1KOG A;  2DQ0 A;  1H4S A;  1JRP A;  4H2T A;  1EVK A;  2AMC A;  2E10 A;  3BFM A;  3HXX A;  2Q7H A;  4P71 C;  3A5Y A;  1HXD A;  5ELN A;  3RIR A;  1LYL A;  3V7C A;  4YRQ A;  3VQV A;  3A31 A;  3REX A;  1ASY A;  2E65 A;  4H2X A;  4YP0 A;  4P72 A;  3E9H A;  3B9J B;  1WNL A;  1WYG A;  5K1X A;  2DXU A;  2IY5 B;  4H02 A;  4YYE A;  3L4G B;  1NYR A;  4LVK A;  4P72 C;  3MQZ A;  4K88 A;  4TVA B;  3IAL A;  5ELO A;  1ZXI C;  4XEO A;  2ZNJ A;  4XTU A;  1X56 A;  4X5O A;  4YRN A;  4OP0 A;  4BW9 A;  1N63 C;  1HTT A;  1FFU C;  2CGH A;  2P5I A;  4UP8 A;  2G4C A;  2ODR C;  5KNN A;  2AKW A;  12AS A;  3IKL A;  4KQE A;  3PCO A;  1VDV A;  2AKW B;  1IL2 A;  4YRP A;  1KMN A;  4P75 A;  1ADJ A;  1EVL A;  4J15 A;  4WJ3 M;  3NRZ B;  2E64 A;  4HWT A;  2C8M A;  2RHS B;  2DTI A;  3HRK A;  2EJF A;  4TVW A;  1YFT A;  4YCU A;  2C7I A;  4TQF A;  4P75 C;  3LSS A;  3AMZ A;  4G84 A;  4TVA A;  4YRI A;  4G85 A;  2DVE A;  5G5G B;  4XU0 A;  1EIY B;  1SER A;  3HRD C;  1ATI A;  2A8E A;  2ZXF A;  2NS6 A;  2CJ9 A;  1X2G A;  2PME A;  4UP7 A;  2XTI A;  1NJ2 A;  3FJP A;  2EAY A;  4H2Y A;  2DTO A;  1NYQ A;  2Q7G A;  3RKW A;  2QHU A;  3UGT A;  4YRO A;  5HGQ A;  2ODR D;  1N60 C;  3NVV B;  2ZGW A;  3P8V A;  2W55 A;  4CS2 A;  2RHQ B;  5E3I A;  1WU7 A;  2I4L A;  3NEM A;  1SRY A;  3WQZ A;  3HFV A;  3VQX A;  4HWP A;  2ZT8 A;  3IKM B;  3M4P A;  1G51 A;  4YRG A;  3A74 A;  1N9W A;  3PZC A;  4HT4 A;  2E1H A;  2EJG A;  2ZR2 A;  3HXU A;  3NVW B;  4UPA A;  1V97 A;  2CJB A;  1FO4 A;  3AM9 A;  4Q15 A;  4CH3 A;  3UH0 A;  3A7A A;  3R07 C;  3L1A A;  3RKX A;  5C51 B;  1NJ6 A;  3REU A;  3LC0 A;  1QE0 A;  1YFS A;  3LSQ A;  4PG3 A;  1GGM A;  2DZC A;  1E24 A;  4XTV A;  3RL6 A;  3HY0 A;  4O2D A;  4H2W A;  3QTC A;  4EX5 A;  3HFZ A;  4RDX A;  3TEG A;  3QO8 A;  2ART A;  4P74 C;  1Z7M A;  1YGB A;  4YCW A;  4H2X B;  2DJZ A;  4ZTU B;  1N62 C;  2Q7E A;  1QF6 A;  4H2S A;  3I7F A;  1WPY A;  4RQF A;  2DXT A;  1J5W A;  2ZIO A;  2CJA A;  1PYS A;  4P73 A;  1B70 A;  4RQE A;  4TWA A;  3QO7 A;  2ZTG A;  2ZT6 A;  3IG2 A;  3SR6 B;  1PYS B;  3QO5 A;  1H4Q A;  4TQD A;  4H2U A;  4YDQ A;  4LNS A;  2QHT A;  3ERR A;  1SES A;  2EJ9 A;  4TVY A;  1USY A;  4YRF A;  4YRC A;  3VBB A;  1SB3 B;  3NS1 B;  1FFV C;  1N5W C;  4YRT A;  2DZ9 A;  1B7Y B;  4XTZ A;  2I4O A;  3V8K A;  1USY C;  1L0W A;  2RHQ A;  3HRI A;  1EQR A;  4LVL A;  3RAC A;  4PHC A;  3NET A;  4KR2 A;  1C0A A;  2E41 A;  1NJ5 A;  4DQ2 A;  2DTH A;  3L4G A;  4YRS A;  2RHS A;  4WI1 A;  4LVM A;  2ALY B;  3EFS A;  3HXW A;  2ARS A;  2XGT A;  3UGQ A;  2W54 A;  2CIM A;  3OD1 A;  4HVC A;  1EFW A;  4NCX A;  5K1P A;  1FIQ B;  1X01 A;  2J3L A;  3RUX A;  1B76 A;  4XU2 A;  3QNE A;  1X54 A;  3ETR B;  4YRE A;  4P71 A;  3M4Q A;  3HTZ A;  4ZIB A;  1ASZ A;  4HWO A;  1BBU A;  4YRK A;  1E1T A;  3NVZ B;  3EUB 3;  4YRM A;  3RGL A;  1W66 A;  2EL9 A;  2QHV A;  4HA8 A;  5C52 B;  4LVJ A;  1JJC A;  4WF2 A;  2HNI A;  1WQ7 A;  3A32 A;  3VQY A;  4HWR A;  3V7R A;  4CS4 A;  4P3O A;  1B70 B;  1T3Q C;  3A7R A;  4P3N A;  4L87 A;  3NEL A;  4K87 A;  4RMF A;  2EWN A;  3W3S A;  2ZR3 A;  4KR3 A;  3NEN A;  3ICA A;  3R07 A;  2IY5 A;  1JJC B;  1JRO A;  2DEQ A;  3KFU A;  1RM6 B;  4DPG A;  2DU7 A;  2DQ3 A;  4LVI A;  2E3C A;  4HWS A;  1WYD A;  4CH4 A;  1N61 C;  4E51 A;  3BJU A;  3DSQ A;  3A5Z A;  1BIB A;  3V8J A;  2E5A A;  3E9I A;  1YB3 A;  1WQW A;  2FYK A;  1EOV A;  4ZTZ B;  2ARU A;  4TTV A;  4YRL A;  3MF1 A;  1E1O A;  1E22 A;  2DKG A;  3VQW A;  5C53 B;  1NNH A;  2ZZG A;  4YPF A;  1SET A;  3UFG A;  1BBW A;  3EFR A;  2J3M A;  4Q6G A;  2ZCE A;  3RKY A;  1X55 A;  1G5H A;  2DDZ A;  2ZNI A;  1HC7 A;  3RF1 A;  2Q5H A;  3TEH B;  2W3S A;  2ZT5 A;  4YRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...