3A7UA

Crystal structure of the bovine lipoyltransferase in its unliganded form
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
343
structure length
325
Chain Sequence
GLILQSISNDVYHNLAVEDWIHDHMNLEGKPVLFLWRNSPTVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLVVRALKAVHPHLDVQATKRFDLLLDGQFKISGTASKIGRNAAYHHCTLLCGTDGTFLSSLLKKNLMEKDPTLTCEVVINAVATEYATSHQIDNHIHLINPTDETVFPGINSKAIELQTWEWIYGKTPKFSVDTSFTVLHEQSHVEIKVFIDVKNGRIEVCNIEAPDHWLPLEICDQLNSSLIGSKFSPIETTVLTSILHRTYPGDDELHSKWNILCEKIKGIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Lipoyltransferase 1, mitochondrial
publication title Global conformational change associated with the two-step reaction catalyzed by Escherichia coli lipoate-protein ligase A.
pubmed doi rcsb
source organism Bos taurus
total genus 84
structure length 325
sequence length 343
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 3a7uA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3a7uA01
5C51B 1T3QC 3NENA 2DZ9A 2ODRD 1PYSB 5HGQA 2QHSA 3L1AA 1H4VB 3A32A 1NJ8A 1E24A 3HY1A 3NVZB 4KR3A 2E3CA 3EUB3 4XTZA 12ASA 3A7RA 4YRKA 4H2YA 1BBUA 1YFTA 3EFSA 2ZZEA 2P5IA 4YRGA 4YRTA 2Q5HA 2QHUA 2PMFA 4YRSA 2CIMA 5K1XA 3PCOA 2I4OA 3TEHB 1EIYB 1HXDA 2C7IA 3HXZA 2ZR3A 3RUXA 3V7RA 4P74A 1HTTA 1YGBA 2ARSA 3P8TA 4H2SA 2DXUA 3HRDC 4XU1A 2ZT7A 1VQZA 1Z7NA 2P0LA 4H2XA 1NJ1A 4WJ3M 4HWRA 4P74C 1NJ6A 2E3TA 4YROA 1WPYA 4X5OA 1Z7MA 1X01A 3IKMB 1B70A 3IALA 2ARTA 3VQWA 2XTIA 4WF2A 1JJCA 3A31A 1FFUC 2W3RA 4YCUA 2ZTGA 1NJ5A 4OP0A 4EO4A 4J15A 3NRZB 11ASA 1JRPA 3RL6A 4YYEA 2AMCA 4HWTA 4KQEA 4UP9A 1WQWA 2AMCB 1G5HA 1NYQA 1N9WA 4YRCA 4YRJA 2EJ9A 4P73A 2DZCA 2DTOA 1ADYA 1W66A 3LC0A 1FYFA 3HXXA 4P72A 2Q5IA 3HFZA 4L87A 4OLFA 2I4LA 4PG3A 2RHQB 3W3SA 2ZINA 3REUA 1KMNA 4P73C 3IKLA 1EOVA 1GGMA 3QO8A 2E41A 1ATIA 4P72C 2G4CA 2Q7HA 4BWAA 3RKWA 2I4NA 3WQZA 3NELA 4YRIA 5ELNA 4Q15A 4YRNA 4H02A 4P75A 4XTYA 1FO4A 1X2HA 3AN1A 3E9HA 1EQRA 3HRIA 3EFRA 1SESA 2DEQA 4XU3A 1KOGA 2ZNIA 5C53B 1V97A 4YRQA 3DSQA 3SR6B 4YP0A 4P3PA 5K1PA 1WQ7A 3UGTA 5KNNA 5ELOA 4H2TA 1B7YA 1WYGA 4P75C 3P8VA 2CGHA 3V7CA 1ASYA 1QE0A 3L4GA 1NJ2A 2RHSA 3AMZA 3UH0A 4RMFA 4LNSA 4ZOHB 4HWPA 2ALYA 2QHTA 2AKWA 3PCOB 4G84A 1YB3A 1B76A 2CJ9A 1LYLA 1G51A 3HTZA 4P71A 1H4TA 1KMMA 5F5WA 1WNLA 1SETA 3NVWB 4YCVA 1N5XA 1E1OA 4HA8A 4UPAA 3MEYA 4UP7A 1IL2A 3NS1B 2DQ0A 1VDVA 2HNIA 3NETA 2EJGA 1FFVC 3G1ZA 4K87A 1N62C 4AH6A 1JROA 4XU0A 4KR2A 3A5ZA 4H2XB 4P71C 3RF1A 3HXYA 2CJBA 3LSQA 4UP8A 1YFRA 4HWSA 3QO7A 1B70B 1ZXIC 1JJCB 2W3SA 4H2UA 2J3LA 4Q6GA 2ZNJA 5E3IA 3ICAA 3BFMA 4YDQA 2E65A 1ASZA 3B9JB 4RQFA 4ZIBA 5G5HB 3A5YA 3HXVA 3HFZB 1X55A 1SERA 1FIQB 4TVYA 3REXA 4TTVA 2ZT5A 3TEGA 4CH5A 3LSSA 1G5IA 4CH6A 4CH3A 2ZT6A 2DXTA 2ZIMA 4K88A 2DTIA 2ZZFA 3V8LA 1H4QA 4HVCA 3VBBA 4YREA 4TQFA 4YRMA 1NYRA 4RDXA 4DPGA 1E1TA 3M4QA 1BBWA 3NVVB 1H4SA 1E22A 4XTVA 1N63C 3RIRA 1B8AA 3HY0A 4G85A 4CS2A 3HRKA 3UGQA 3MF1A 3A7UA 3HXUA 4O2DA 3BJUA 4YRLA 3VQVA 1WLEA 3V7SA 1B7YB 2EJFA 1C0AA 3A7AA 3PZCA 4HWOA 4YRRA 2CJAA 2ZR2A 1PYSA 3RGLA 3L4GB 1N61C 3L2ZA 1EFWA 3VQXA 2ZT8A 2RHSB 3I7FA 3MF2A 4XTUA 1SB3B 1RM6B 3RKXA 2FYKA 4XTWA 2ALYB 2AKWB 1QF6A 4CS3A 1SRYA 4PHCA 2ZGWA 4XEMA 4WJ4A 2C8MA 2IY5A 1EVLA 2IY5B 4P3NA 4NCXA 4XEOA 3ERRA 3R07A 2QHVA 3A74A 3TEHA 3CMQA 2DU7A 1EIYA 3RKYA 2DDZA 3ETRB 3HFVA 4DQ2A 3FJPA 3RACA 2Q7GA 4TVAA 3V8KA 1X54A 3E9IA 3KFUA 2EWNA 4TVAB 2ZIOA 4BW9A 3AM9A 1BIAA 2ODRC 3NEMA 1RIQA 4YCWA 3IG2A 3R07C 1N60C 2PMEA 4K86A 3M4PA 2J3MA 1YFSA 3P8YA 2DU5A 1BIBA 2DTHA 1X2GA 4CH4A 2E10A 1NNHA 5G5GB 4ZTUB 3VQYA 2E64A 2ZCEA 3UFGA 1USYA 4RQEA 1ADJA 4XU2A 2I4MA 2E1HA 3TUPA 1J5WA 2XGTA 4YRFA 2EL9A 1EVKA 1HC7A 3QNEA 2ARUA 4TVWA 1N5WC 1USYC 2DVEA 4TQDA 4P3OA 4H2VA 2EAYA 4E51A 2W54A 4H2WA 1WYDA 4EX5A 4CS4A 3HXWA 4XTXA 2DKGA 4TWAA 3NVYB 4YRPA 2RHQA 3V8JA 2ZZGA 1X56A 4WI1A 2ZXFA 1L0WA 3OD1A 2DJZA 5C52B 1WU7A 2DQ3A 3QO5A 4YPFA 2W55A 2E5AA 4ZTZB 2Q7EA 3QTCA
chains in the Genus database with same CATH superfamily
1GXFA 5C51B 3TCSA 1T3QC 3CK5A 2GR3A 1MRAA 2DZ9A 2ODRD 3NENA 1PYSB 3MZNA 5HGQA 1JOAA 3FJ4A 2QHSA 3L1AA 1H4VB 1F3PA 3A32A 2ZADA 4A35A 5JCLA 1NJ8A 1E24A 3R1ZA 1NHSA 2PU1A 3HY1A 3NVZB 4DX3A 4KR3A 1GERA 3K1GA 4H50A 3EUB3 5FS7A 2E3CA 4XTZA 1KD0A 2GGHA 12ASA 4J1OA 4KPLA 2RDXA 3A7RA 5EBKA 4YRKA 2PP1A 2XGZA 2PS2A 3MUCA 4H2YA 1ZMCA 1BBUA 4H2HA 3TQPA 1MOKA 2NQLA 3MQTA 3OPSA 1YFTA 3SSZA 3EFSA 2W0HA 3ES8A 2ZZEA 2P5IA 1SJBA 4H4VA 4YRGA 3TWAA 1LVLA 1P43A 3DERA 4YRTA 2GGGA 3FYYA 4M6UA 3UCCA 2Q5HA 2ZZCA 1ZMDA 2RABA 4DN1A 2GGIA 2QHUA 2PMFA 3EANA 4YRSA 3PG6A 4M0XA 3DK8A 2CIMA 1SJDA 4FDCB 4LIIA 5K1XA 4H4QA 1EBHA 3SN1A 4LVKA 3UJFA 3PCOA 3IJQA 1BKHA 2HQMA 2I4OA 3TEHB 1H2IA 3H7VA 4HN8A 3GD4A 1HXDA 2C7IA 1EIYB 3HXZA 2V3BA 3OZYA 4GRTA 4H4SA 2ZR3A 4HPNA 3TJIA 3RUXA 2GR2A 2PODA 3V7RA 4P74A 5JCKA 2PA6A 3OTRA 1HTTA 3SJNA 2HXUA 4H4UA 4GISA 5GRTA 5ER0A 1YGBA 2ARSA 3P8TA 2GL5A 2NVKX 4YWSA 4H2SA 3GY1A 3II4A 4H4TA 3HRDC 2DXUA 4XU1A 1E9IA 2ZT7A 2A8EA 5ENLA 1VQZA 4K8DA 1Z7NA 2P0LA 1NJ1A 4H4XA 4H2XA 4WJ3M 4HWRA 3FG2P 4GR1A 3PK7A 4P74C 1NJ6A 2E3TA 4YROA 2YAUA 2YVJA 4DNAA 1WPYA 4X5OA 1Z7MA 2CDUA 4IP5A 3VCCA 4E4UA 1X01A 3IKMB 2WP5A 1WUFA 4EMIA 1B70A 2ARTA 3IALA 3VQWA 2XTIA 2BC0A 4WF2A 5FJTA 5EU9A 1JJCA 3A31A 1FFUC 2W3RA 4YCUA 2ZTGA 1FHVA 3LXDA 1NJ5A 4LVJA 1JDFA 3OP2A 4M52A 2FKPA 4OP0A 4EO4A 4J15A 4K1WA 3NRZB 4NEWA 2TPRA 11ASA 4MKSA 1JRPA 4EMJA 3RL6A 4YYEA 5FMHA 4E5TA 2OZTA 2AMCA 4HWTA 4KQEA 3DDMA 2NS6A 3CGEA 7ENLA 3T4WA 1WQWA 2AMCB 4UP9A 1G5HA 1NYQA 2V6OA 2GRTA 1N9WA 3NFUA 2EJ9A 3OC4A 4YRCA 4YRJA 2EQ9A 1L8PA 2DZCA 1V59A 2DTOA 4P73A 2QDEA 3I4KA 3VC5A 1ADYA 1W66A 4ZCWA 4IT1A 2QVHA 3LC0A 1FYFA 3ENLA 3HXXA 4KPRA 3O0HA 4JQ9A 4P72A 2Q5IA 2XH7A 3HFZA 4L87A 2PMQA 3GD3A 2HXTA 2C3DA 4E6MA 4OLFA 2JK6A 3QFBA 2GSHA 3RR1A 4Z17A 4GMEA 3FXGA 3SQSA 2I4LA 4PG3A 2RHQB 3W3SA 2ZINA 3REUA 1ELSA 1KMNA 2GR1A 2QJMA 2P8CA 4P73C 1SJAA 3MY9A 1EOVA 1GGMA 3GD6A 4EQSA 5JCIA 3IKLA 4EM4A 3QO8A 2E41A 3VC6A 1ATIA 4A6GA 1Q1WA 5J04A 4P72C 1ZK7A 2G4CA 2Q7HA 4BWAA 3RKWA 4DHGA 2I4NA 3DEQA 4F4RA 3WQZA 4YWOA 3NELA 4YRIA 1NHQA 2FYMA 5ELNA 2X8CA 1S7MA 4G8TA 1D7YA 3CAWA 5KVIA 3UJ2A 2GR0A 4Q15A 3QKEA 4YRNA 1R0MA 4H02A 4EQXA 3CT2A 4P75A 4XTYA 1FO4A 4H4YA 1KN0A 1X2HA 3AN1A 3MWCA 3E9HA 1TKKA 2AL2B 1EQRA 2P88A 4KT2A 3OW1A 1SESA 2DEQA 3VFCA 3EFRA 3HRIA 3JVAA 4XU3A 4H83A 1KOGA 5C53B 2ZNIA 4ADWA 1V97A 4YRQA 1ECQA 1MNSA 4H4ZA 3SR6B 3DSQA 4P3PA 5IDZA 4YP0A 3MQZA 5K1PA 1WQ7A 3UGTA 5KNNA 5ELOA 3H70A 1B7YA 1WYGA 3RO6A 1GEUA 4H2TA 4P75C 2R9ZA 2AL1A 3P8VA 1K4QA 3I6EA 2EQ6A 3QTPA 3DFHA 2CGHA 2AAQA 1JCTA 3V7CA 2OFJA 3V8LA 1ASYA 2YQUA 1QE0A 1ZKQA 3L4GA 5JCMA 1NJ2A 2O56A 3HPFA 1NDAA 2RHSA 3NZGA 2PGWA 3AMZA 3TTEA 1NU5A 1WUEA 4RMFA 3UH0A 4LNSA 4ZOHB 4HCDA 1EBGA 2GGEA 3T9PA 4HWPA 1ONFA 3UJRA 2YVFA 2ALYA 2QHTA 3PFRA 4GGBA 3DGZA 2AKWA 4HCHA 3FV9A 2X8HA 3STPA 4GIRA 1XS2A 3PCOB 2A8XA 3JZUA 4G84A 4EQRA 2X99A 3IJIA 3SQPA 1B76A 1YB3A 3QLDA 2CJ9A 2OZ8A 1LYLA 1G51A 3HTZA 4P71A 1EC9A 4J3ZA 1H4TA 1STZA 1TZZA 4GGHA 3TOYA 1KMMA 5F5WA 1FECA 1WNLA 4H4WA 1SETA 3NXLA 3NVWB 1N5XA 4YCVA 1E1OA 4HA8A 1M6IA 3MEYA 4UPAA 4UP7A 2AKMA 3NS1B 2DQ0A 2EQ8A 1IL2A 3TW9A 4K7ZA 1VDVA 3V4BA 2HNIA 3NETA 2EJGA 1FFVC 2DW7A 4KWSA 3CGCA 3G1ZA 1N62C 4K87A 4IHCA 1JROA 3DG3A 3S5SA 4AH6A 1DNCA 4XU0A 4KR2A 3A5ZA 4H2XB 1GSNA 4P71C 1ZX9A 4HCLA 3RF1A 3HXYA 3V5CA 1GRTA 3DIPA 3FCPA 2CJBA 1ZY8A 3LSQA 5FJOA 3D47A 3VDGA 4UP8A 1YFRA 2C3CA 2MUCA 4HWSA 3CGDA 1B70B 3QO7A 4IP4A 1GRBA 1ZXIC 4H19A 3LADA 3N4EA 3ZLGA 1JJCB 1NPXA 5FS8A 2WPFA 3JW7A 2W3SA 3RCYA 4DWDA 4H2UA 2J3LA 4ZA0A 4HNLA 4Q6GA 1JEHA 4APNA 2ZNJA 5E3IA 2NPXA 3DGBA 4GFIA 2QDDA 3ICAA 1NELA 3BFMA 4YDQA 3CXBA 3DH9A 3DK9A 3N6HA 2YVGA 4JDRA 2E65A 1ASZA 3ZLHA 4A3RA 2X50A 3B9JB 1FHUA 1XANA 4H1ZA 4MGGA 4HYRA 2P8BA 2PTWA 2WBAA 1KCZA 1SJCA 3NO1A 1MUCA 4RQFA 4BURA 4ZIBA 2DW6A 5G5HB 3A5YA 3HXVA 3HFZB 4FX9A 1X55A 2HNEA 1SERA 1FIQB 4TVYA 1EC7A 1TE6A 3REXA 4TTVA 1OJTA 2ZT5A 3TEGA 4CH5A 2HZGA 3CXOA 3LSSA 1G5IA 3P0WA 3RNMA 4CH6A 4CH3A 2ZT6A 3BSMA 2DXTA 2OX4A 2ZIMA 2DTIA 3U9IA 1TYPA 2ZZ0A 4DYEA 2ZZFA 4K88A 1OEPA 4LA1A 5JCNA 5FJUA 3IK4A 3VBBA 4HVCA 1H4QA 4YREA 4TQFA 4YRMA 1NYRA 4RDXA 4DPGA 3H8AA 2PTXA 3S47A 4E4FA 3KUMA 1E1TA 4EMWA 3M4QA 1BBWA 1GREA 2CHRA 1P48A 3NVVB 5FS9A 2GGJA 2GQWA 3UXLA 1H4SA 3HW2A 1E22A 4XTVA 3VA8A 1N63C 1MDRA 1GRFA 3RIRA 2XH4A 1B8AA 2XH0A 3HY0A 3SN4A 4G85A 3DESA 4CS2A 3HRKA 3UGQA 3URHA 1BWCA 3MF1A 1F8WA 2OQYA 3A7UA 4GYPA 3UGVA 3HXUA 4O2DA 4LVIA 4H4RA 4IL0A 4JHMA 3BJUA 1EC8A 4YRLA 2PP0A 4LVLA 3VQVA 2PGEA 3OZMA 1WLEA 3PWGA 1F9CA 2OG9A 3V7SA 1B7YB 3ZVHA 2EJFA 1C0AA 3T8QA 3A7AA 2GDQA 2OKTA 3MSYA 4J56A 5U1OA 2QQ6A 3PZCA 4HWOA 1ONEA 4X2PA 4YRRA 5FJRA 3N4FA 2CJAA 3QN3A 2P3ZA 4KEMA 1PYSA 4GYPC 2ZR2A 2PPGA 3RGLA 2MNRA 3L4GB 1N61C 3L2ZA 1EFWA 3VQXA 2BC1A 3P93A 2ZT8A 2CFYA 2OZ3A 4ROPA 2RHSB 3I7FA 1FEBA 4K2SA 4E8GA 1MO9A 5TR3A 1NHPA 3MF2A 4XTUA 3SBFA 1RM6B 1SB3B 3MKCA 2GH5A 3U4FA 2OQHA 2OVLA 3RKXA 2FYKA 4XTWA 2ALYB 2AKWB 4EQWA 1KKRA 1RVKA 1NHRA 2PTZA 1YQZA 4CS3A 1QF6A 1SRYA 4PHCA 3IC9A 2ZGWA 4XEMA 3H4KA 4WJ4A 1R6WA 1GETA 2C8MA 3CYJA 3PWIA 3R25A 5BOEA 3DG6A 1AOGA 2IY5A 2ONEA 2POZA 1EVLA 5FS6A 2IY5B 1FEAA 3DJJA 4P3NA 4NCXA 3R11A 4XEOA 4MMWA 3ERRA 3DFYA 3R07A 3THUA 2PU0A 2WOWA 2QHVA 3A74A 3KLJA 3TEHA 4HT4A 1Q1RA 3CMQA 2DU7A 4LVMA 1EIYA 3RKYA 2DDZA 3CGBA 3ETRB 3HFVA 1GRGA 1TYTA 2PP3A 4G7FA 3UJSA 3FJPA 3RACA 2WP6A 4JN7A 4DQ2A 2X8GA 2Q7GA 4TVAA 3V8KA 3FVDA 1X54A 3E9IA 3D46A 1EBDA 4J57A 3KFUA 2EWNA 4TVAB 3ZLFA 2ZIOA 3GO2A 1W6TA 4ENLA 2QAEA 4BW9A 3AM9A 3RRAA 1BIAA 2ODRC 2ZC8A 3NEMA 1RIQA 4YCWA 3IG2A 5FJPA 4K8GA 4IZGA 3R07C 1N60C 3LB8A 2PMEA 4K86A 4HNCA 3Q6JA 3T6CA 2J3MA 3M4PA 1BZLA 5U25A 1YFSA 2OLAA 3P8YA 4Z1YA 1BIBA 2DU5A 2DTHA 1IYXA 3CB3A 1X2GA 1XHCA 2EQ7A 4CH4A 2E10A 1NNHA 3ES7A 1LPFA 1YEYA 5G5GB 4ZTUB 3GRTA 3N6JA 3QPEA 2V3AA 3B97A 3Q4DA 3EKGA 2E64A 2ZCEA 3UFGA 3VQYA 5KVHA 1USYA 4RQEA 2QGYA 3H12A 1XDIA 3P3BA 1ADJA 4FI4A 3RGTA 2QJJA 2I4MA 4XU2A 2E1HA 1XPYA 2ZZBA 5BOFA 3BJSA 3DGHA 3TUPA 3DK4A 3IJLA 4BV6A 1J5WA 2XGTA 4YRFA 2P0IA 2J3NA 2EL9A 2OO6A 3L5OA 1JPDX 2PSNA 1EVKA 1HC7A 2ARUA 3QNEA 6ENLA 3R0KA 4H4PA 3GRSA 4TVWA 1N5WC 3QFAA 3UJEA 2BCPA 3R0UA 1USYC 2DVEA 4TQDA 4P3OA 2WPEA 1H6VA 4H2VA 3UXKA 2EAYA 1ZDLA 3BOXA 4E51A 2PTYA 5JRBA 2W54A 3SN0A 1WYDA 1DXLA 4EM3A 4H2WA 4EX5A 2AKZA 1GESA 2WOIA 3V5FA 4CS4A 3EEZA 3ZVIA 2I5QA 4EWJA 3HXWA 4XTXA 2DKGA 2F5ZA 1BQGA 3NVYB 4TWAA 3VCNA 4YRPA 2QJNA 2RHQA 4IL2A 3V8JA 3L8KA 1GRHA 2WPCA 2ZZGA 2PCEA 1X56A 3Q45A 3R10A 1DTNA 3D9XA 1PDZA 3TWBA 2XH2A 3GC2A 3EAOA 2OPJA 3I6TA 4WI1A 3V3WA 1JPMA 1KKOA 2ZXFA 3DJGX 1L0WA 3OD1A 2DJZA 1PDYA 1WU7A 5C52B 2DQ3A 2WOVA 3UCDA 1GRAA 4DXKA 3QO5A 4YPFA 4FP1A 3TJ4A 3ZVHB 4NEVA 3RITA 4JN8A 2W55A 2E5AA 2XSXA 2AL2A 1MDLA 4ZTZB 3EF6A 3DG7A 2Q7EA 1GV4A 3QTCA
chains in the Genus database with same CATH topology
5C51B 1T3QC 3NENA 2DZ9A 2ODRD 1PYSB 5HGQA 2QHSA 3L1AA 1H4VB 3A32A 1NJ8A 1E24A 3HY1A 3NVZB 4KR3A 2E3CA 3EUB3 4XTZA 12ASA 3A7RA 4YRKA 4H2YA 1BBUA 1YFTA 3EFSA 2ZZEA 2P5IA 4YRGA 4YRTA 2Q5HA 2QHUA 2PMFA 4YRSA 2CIMA 5K1XA 4LVKA 3PCOA 2I4OA 3TEHB 1EIYB 1HXDA 2C7IA 3HXZA 2ZR3A 3RUXA 3V7RA 4P74A 1HTTA 1YGBA 2ARSA 3P8TA 4H2SA 2DXUA 3HRDC 4XU1A 2ZT7A 2A8EA 1VQZA 1Z7NA 2P0LA 4H2XA 1NJ1A 4WJ3M 4HWRA 4P74C 1NJ6A 2E3TA 4YROA 1WPYA 4X5OA 1Z7MA 1X01A 3IKMB 1B70A 3IALA 2ARTA 3VQWA 2XTIA 4WF2A 1JJCA 3A31A 1FFUC 2W3RA 4YCUA 2ZTGA 1NJ5A 4LVJA 4OP0A 4EO4A 4J15A 3NRZB 11ASA 1JRPA 3RL6A 4YYEA 2AMCA 4HWTA 4KQEA 2NS6A 4UP9A 1WQWA 2AMCB 1G5HA 1NYQA 1N9WA 4YRCA 4YRJA 2EJ9A 4P73A 2DZCA 2DTOA 1ADYA 1W66A 3LC0A 1FYFA 3HXXA 4P72A 2Q5IA 3HFZA 4L87A 4OLFA 2I4LA 4PG3A 2RHQB 3W3SA 2ZINA 3REUA 1KMNA 4P73C 3IKLA 1EOVA 1GGMA 3QO8A 2E41A 1ATIA 4P72C 2G4CA 2Q7HA 4BWAA 3RKWA 2I4NA 3WQZA 3NELA 4YRIA 5ELNA 4Q15A 4YRNA 4H02A 4P75A 4XTYA 1FO4A 1X2HA 3AN1A 3E9HA 1EQRA 3HRIA 3EFRA 1SESA 2DEQA 4XU3A 1KOGA 2ZNIA 5C53B 1V97A 4YRQA 3DSQA 3SR6B 4YP0A 4P3PA 5K1PA 3MQZA 1WQ7A 3UGTA 5KNNA 5ELOA 4H2TA 1B7YA 1WYGA 4P75C 3P8VA 2CGHA 3V7CA 1ASYA 1QE0A 3L4GA 1NJ2A 2RHSA 3AMZA 3UH0A 4RMFA 4LNSA 4ZOHB 4HWPA 2ALYA 2QHTA 2AKWA 3PCOB 4G84A 1YB3A 1B76A 2CJ9A 1LYLA 1G51A 3HTZA 4P71A 1H4TA 1KMMA 5F5WA 1WNLA 1SETA 3NVWB 4YCVA 1N5XA 1E1OA 4HA8A 4UPAA 3MEYA 4UP7A 1IL2A 3NS1B 2DQ0A 1VDVA 2HNIA 3NETA 2EJGA 1FFVC 3G1ZA 4K87A 1N62C 4AH6A 1JROA 4XU0A 4KR2A 3A5ZA 4H2XB 4P71C 3RF1A 3HXYA 2CJBA 3LSQA 4UP8A 1YFRA 4HWSA 3QO7A 1B70B 1ZXIC 1JJCB 2W3SA 4H2UA 2J3LA 4Q6GA 2ZNJA 5E3IA 3ICAA 3BFMA 4YDQA 2E65A 1ASZA 3B9JB 4RQFA 4ZIBA 5G5HB 3A5YA 3HXVA 3HFZB 1X55A 1SERA 1FIQB 4TVYA 3REXA 4TTVA 2ZT5A 3TEGA 4CH5A 3LSSA 1G5IA 4CH6A 4CH3A 2ZT6A 2DXTA 2ZIMA 4K88A 2DTIA 2ZZFA 3V8LA 1H4QA 4HVCA 3VBBA 4YREA 4TQFA 4YRMA 1NYRA 4RDXA 4DPGA 1E1TA 3M4QA 1BBWA 3NVVB 1H4SA 1E22A 4XTVA 1N63C 3RIRA 1B8AA 3HY0A 4G85A 4CS2A 3HRKA 3UGQA 3MF1A 3A7UA 3HXUA 4O2DA 4LVIA 3BJUA 4YRLA 4LVLA 3VQVA 1WLEA 3V7SA 1B7YB 2EJFA 1C0AA 3A7AA 3PZCA 4HWOA 4YRRA 2CJAA 2ZR2A 1PYSA 3RGLA 3L4GB 1N61C 3L2ZA 1EFWA 3VQXA 2ZT8A 2RHSB 3I7FA 3MF2A 4XTUA 1SB3B 1RM6B 3RKXA 2FYKA 4XTWA 2ALYB 2AKWB 1QF6A 4CS3A 1SRYA 4PHCA 2ZGWA 4XEMA 4WJ4A 2C8MA 2IY5A 1EVLA 2IY5B 4P3NA 4NCXA 4XEOA 3ERRA 3R07A 2QHVA 3A74A 3TEHA 4HT4A 3CMQA 2DU7A 4LVMA 1EIYA 3RKYA 2DDZA 3ETRB 3HFVA 4DQ2A 3FJPA 3RACA 2Q7GA 4TVAA 3V8KA 1X54A 3E9IA 3KFUA 2EWNA 4TVAB 2ZIOA 4BW9A 3AM9A 1BIAA 2ODRC 3NEMA 1RIQA 4YCWA 3IG2A 3R07C 1N60C 2PMEA 4K86A 3M4PA 2J3MA 1YFSA 3P8YA 2DU5A 1BIBA 2DTHA 1X2GA 4CH4A 2E10A 1NNHA 5G5GB 4ZTUB 3VQYA 2E64A 2ZCEA 3UFGA 1USYA 4RQEA 1ADJA 4XU2A 2I4MA 2E1HA 3TUPA 1J5WA 2XGTA 4YRFA 2EL9A 1EVKA 1HC7A 3QNEA 2ARUA 4TVWA 1N5WC 1USYC 2DVEA 4TQDA 4P3OA 4H2VA 2EAYA 4E51A 2W54A 4H2WA 1WYDA 4EX5A 4CS4A 3HXWA 4XTXA 2DKGA 4TWAA 3NVYB 4YRPA 2RHQA 3V8JA 2ZZGA 1X56A 4WI1A 2ZXFA 1L0WA 3OD1A 2DJZA 5C52B 1WU7A 2DQ3A 3QO5A 4YPFA 2W55A 2E5AA 4ZTZB 2Q7EA 3QTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C51 B;  1T3Q C;  3NEN A;  2DZ9 A;  2ODR D;  1PYS B;  5HGQ A;  2QHS A;  3L1A A;  1H4V B;  3A32 A;  1NJ8 A;  1E24 A;  3HY1 A;  3NVZ B;  4KR3 A;  2E3C A;  3EUB 3;  4XTZ A;  12AS A;  3A7R A;  4YRK A;  4H2Y A;  1BBU A;  1YFT A;  3EFS A;  2ZZE A;  2P5I A;  4YRG A;  4YRT A;  2Q5H A;  2QHU A;  2PMF A;  4YRS A;  2CIM A;  5K1X A;  3PCO A;  2I4O A;  3TEH B;  1EIY B;  1HXD A;  2C7I A;  3HXZ A;  2ZR3 A;  3RUX A;  3V7R A;  4P74 A;  1HTT A;  1YGB A;  2ARS A;  3P8T A;  4H2S A;  2DXU A;  3HRD C;  4XU1 A;  2ZT7 A;  1VQZ A;  1Z7N A;  2P0L A;  4H2X A;  1NJ1 A;  4WJ3 M;  4HWR A;  4P74 C;  1NJ6 A;  2E3T A;  4YRO A;  1WPY A;  4X5O A;  1Z7M A;  1X01 A;  3IKM B;  1B70 A;  3IAL A;  2ART A;  3VQW A;  2XTI A;  4WF2 A;  1JJC A;  3A31 A;  1FFU C;  2W3R A;  4YCU A;  2ZTG A;  1NJ5 A;  4OP0 A;  4EO4 A;  4J15 A;  3NRZ B;  11AS A;  1JRP A;  3RL6 A;  4YYE A;  2AMC A;  4HWT A;  4KQE A;  4UP9 A;  1WQW A;  2AMC B;  1G5H A;  1NYQ A;  1N9W A;  4YRC A;  4YRJ A;  2EJ9 A;  4P73 A;  2DZC A;  2DTO A;  1ADY A;  1W66 A;  3LC0 A;  1FYF A;  3HXX A;  4P72 A;  2Q5I A;  3HFZ A;  4L87 A;  4OLF A;  2I4L A;  4PG3 A;  2RHQ B;  3W3S A;  2ZIN A;  3REU A;  1KMN A;  4P73 C;  3IKL A;  1EOV A;  1GGM A;  3QO8 A;  2E41 A;  1ATI A;  4P72 C;  2G4C A;  2Q7H A;  4BWA A;  3RKW A;  2I4N A;  3WQZ A;  3NEL A;  4YRI A;  5ELN A;  4Q15 A;  4YRN A;  4H02 A;  4P75 A;  4XTY A;  1FO4 A;  1X2H A;  3AN1 A;  3E9H A;  1EQR A;  3HRI A;  3EFR A;  1SES A;  2DEQ A;  4XU3 A;  1KOG A;  2ZNI A;  5C53 B;  1V97 A;  4YRQ A;  3DSQ A;  3SR6 B;  4YP0 A;  4P3P A;  5K1P A;  1WQ7 A;  3UGT A;  5KNN A;  5ELO A;  4H2T A;  1B7Y A;  1WYG A;  4P75 C;  3P8V A;  2CGH A;  3V7C A;  1ASY A;  1QE0 A;  3L4G A;  1NJ2 A;  2RHS A;  3AMZ A;  3UH0 A;  4RMF A;  4LNS A;  4ZOH B;  4HWP A;  2ALY A;  2QHT A;  2AKW A;  3PCO B;  4G84 A;  1YB3 A;  1B76 A;  2CJ9 A;  1LYL A;  1G51 A;  3HTZ A;  4P71 A;  1H4T A;  1KMM A;  5F5W A;  1WNL A;  1SET A;  3NVW B;  4YCV A;  1N5X A;  1E1O A;  4HA8 A;  4UPA A;  3MEY A;  4UP7 A;  1IL2 A;  3NS1 B;  2DQ0 A;  1VDV A;  2HNI A;  3NET A;  2EJG A;  1FFV C;  3G1Z A;  4K87 A;  1N62 C;  4AH6 A;  1JRO A;  4XU0 A;  4KR2 A;  3A5Z A;  4H2X B;  4P71 C;  3RF1 A;  3HXY A;  2CJB A;  3LSQ A;  4UP8 A;  1YFR A;  4HWS A;  3QO7 A;  1B70 B;  1ZXI C;  1JJC B;  2W3S A;  4H2U A;  2J3L A;  4Q6G A;  2ZNJ A;  5E3I A;  3ICA A;  3BFM A;  4YDQ A;  2E65 A;  1ASZ A;  3B9J B;  4RQF A;  4ZIB A;  5G5H B;  3A5Y A;  3HXV A;  3HFZ B;  1X55 A;  1SER A;  1FIQ B;  4TVY A;  3REX A;  4TTV A;  2ZT5 A;  3TEG A;  4CH5 A;  3LSS A;  1G5I A;  4CH6 A;  4CH3 A;  2ZT6 A;  2DXT A;  2ZIM A;  4K88 A;  2DTI A;  2ZZF A;  3V8L A;  1H4Q A;  4HVC A;  3VBB A;  4YRE A;  4TQF A;  4YRM A;  1NYR A;  4RDX A;  4DPG A;  1E1T A;  3M4Q A;  1BBW A;  3NVV B;  1H4S A;  1E22 A;  4XTV A;  1N63 C;  3RIR A;  1B8A A;  3HY0 A;  4G85 A;  4CS2 A;  3HRK A;  3UGQ A;  3MF1 A;  3A7U A;  3HXU A;  4O2D A;  3BJU A;  4YRL A;  3VQV A;  1WLE A;  3V7S A;  1B7Y B;  2EJF A;  1C0A A;  3A7A A;  3PZC A;  4HWO A;  4YRR A;  2CJA A;  2ZR2 A;  1PYS A;  3RGL A;  3L4G B;  1N61 C;  3L2Z A;  1EFW A;  3VQX A;  2ZT8 A;  2RHS B;  3I7F A;  3MF2 A;  4XTU A;  1SB3 B;  1RM6 B;  3RKX A;  2FYK A;  4XTW A;  2ALY B;  2AKW B;  1QF6 A;  4CS3 A;  1SRY A;  4PHC A;  2ZGW A;  4XEM A;  4WJ4 A;  2C8M A;  2IY5 A;  1EVL A;  2IY5 B;  4P3N A;  4NCX A;  4XEO A;  3ERR A;  3R07 A;  2QHV A;  3A74 A;  3TEH A;  3CMQ A;  2DU7 A;  1EIY A;  3RKY A;  2DDZ A;  3ETR B;  3HFV A;  4DQ2 A;  3FJP A;  3RAC A;  2Q7G A;  4TVA A;  3V8K A;  1X54 A;  3E9I A;  3KFU A;  2EWN A;  4TVA B;  2ZIO A;  4BW9 A;  3AM9 A;  1BIA A;  2ODR C;  3NEM A;  1RIQ A;  4YCW A;  3IG2 A;  3R07 C;  1N60 C;  2PME A;  4K86 A;  3M4P A;  2J3M A;  1YFS A;  3P8Y A;  2DU5 A;  1BIB A;  2DTH A;  1X2G A;  4CH4 A;  2E10 A;  1NNH A;  5G5G B;  4ZTU B;  3VQY A;  2E64 A;  2ZCE A;  3UFG A;  1USY A;  4RQE A;  1ADJ A;  4XU2 A;  2I4M A;  2E1H A;  3TUP A;  1J5W A;  2XGT A;  4YRF A;  2EL9 A;  1EVK A;  1HC7 A;  3QNE A;  2ARU A;  4TVW A;  1N5W C;  1USY C;  2DVE A;  4TQD A;  4P3O A;  4H2V A;  2EAY A;  4E51 A;  2W54 A;  4H2W A;  1WYD A;  4EX5 A;  4CS4 A;  3HXW A;  4XTX A;  2DKG A;  4TWA A;  3NVY B;  4YRP A;  2RHQ A;  3V8J A;  2ZZG A;  1X56 A;  4WI1 A;  2ZXF A;  1L0W A;  3OD1 A;  2DJZ A;  5C52 B;  1WU7 A;  2DQ3 A;  3QO5 A;  4YPF A;  2W55 A;  2E5A A;  4ZTZ B;  2Q7E A;  3QTC A; 
#chains in the Genus database with same CATH topology
 1GXF A;  5C51 B;  3TCS A;  1T3Q C;  3CK5 A;  2GR3 A;  1MRA A;  2DZ9 A;  2ODR D;  3NEN A;  1PYS B;  3MZN A;  5HGQ A;  1JOA A;  3FJ4 A;  2QHS A;  3L1A A;  1H4V B;  1F3P A;  3A32 A;  2ZAD A;  4A35 A;  5JCL A;  1NJ8 A;  1E24 A;  3R1Z A;  1NHS A;  2PU1 A;  3HY1 A;  3NVZ B;  4DX3 A;  4KR3 A;  1GER A;  3K1G A;  4H50 A;  3EUB 3;  5FS7 A;  2E3C A;  4XTZ A;  1KD0 A;  2GGH A;  12AS A;  4J1O A;  4KPL A;  2RDX A;  3A7R A;  5EBK A;  4YRK A;  2PP1 A;  2XGZ A;  2PS2 A;  3MUC A;  4H2Y A;  1ZMC A;  1BBU A;  4H2H A;  3TQP A;  1MOK A;  2NQL A;  3MQT A;  3OPS A;  1YFT A;  3SSZ A;  3EFS A;  2W0H A;  3ES8 A;  2ZZE A;  2P5I A;  1SJB A;  4H4V A;  4YRG A;  3TWA A;  1LVL A;  1P43 A;  3DER A;  4YRT A;  2GGG A;  3FYY A;  4M6U A;  3UCC A;  2Q5H A;  2ZZC A;  1ZMD A;  2RAB A;  4DN1 A;  2GGI A;  2QHU A;  2PMF A;  3EAN A;  4YRS A;  3PG6 A;  4M0X A;  3DK8 A;  2CIM A;  1SJD A;  4FDC B;  4LII A;  5K1X A;  4H4Q A;  1EBH A;  3SN1 A;  4LVK A;  3UJF A;  3PCO A;  3IJQ A;  1BKH A;  2HQM A;  2I4O A;  3TEH B;  1H2I A;  3H7V A;  4HN8 A;  3GD4 A;  1HXD A;  2C7I A;  1EIY B;  3HXZ A;  2V3B A;  3OZY A;  4GRT A;  4H4S A;  2ZR3 A;  4HPN A;  3TJI A;  3RUX A;  2GR2 A;  2POD A;  3V7R A;  4P74 A;  5JCK A;  2PA6 A;  3OTR A;  1HTT A;  3SJN A;  2HXU A;  4H4U A;  4GIS A;  5GRT A;  5ER0 A;  1YGB A;  2ARS A;  3P8T A;  2GL5 A;  2NVK X;  4YWS A;  4H2S A;  3GY1 A;  3II4 A;  4H4T A;  3HRD C;  2DXU A;  4XU1 A;  1E9I A;  2ZT7 A;  2A8E A;  5ENL A;  1VQZ A;  4K8D A;  1Z7N A;  2P0L A;  1NJ1 A;  4H4X A;  4H2X A;  4WJ3 M;  4HWR A;  3FG2 P;  4GR1 A;  3PK7 A;  4P74 C;  1NJ6 A;  2E3T A;  4YRO A;  2YAU A;  2YVJ A;  4DNA A;  1WPY A;  4X5O A;  1Z7M A;  2CDU A;  4IP5 A;  3VCC A;  4E4U A;  1X01 A;  3IKM B;  2WP5 A;  1WUF A;  4EMI A;  1B70 A;  2ART A;  3IAL A;  3VQW A;  2XTI A;  2BC0 A;  4WF2 A;  5FJT A;  5EU9 A;  1JJC A;  3A31 A;  1FFU C;  2W3R A;  4YCU A;  2ZTG A;  1FHV A;  3LXD A;  1NJ5 A;  4LVJ A;  1JDF A;  3OP2 A;  4M52 A;  2FKP A;  4OP0 A;  4EO4 A;  4J15 A;  4K1W A;  3NRZ B;  4NEW A;  2TPR A;  11AS A;  4MKS A;  1JRP A;  4EMJ A;  3RL6 A;  4YYE A;  5FMH A;  4E5T A;  2OZT A;  2AMC A;  4HWT A;  4KQE A;  3DDM A;  2NS6 A;  3CGE A;  7ENL A;  3T4W A;  1WQW A;  2AMC B;  4UP9 A;  1G5H A;  1NYQ A;  2V6O A;  2GRT A;  1N9W A;  3NFU A;  2EJ9 A;  3OC4 A;  4YRC A;  4YRJ A;  2EQ9 A;  1L8P A;  2DZC A;  1V59 A;  2DTO A;  4P73 A;  2QDE A;  3I4K A;  3VC5 A;  1ADY A;  1W66 A;  4ZCW A;  4IT1 A;  2QVH A;  3LC0 A;  1FYF A;  3ENL A;  3HXX A;  4KPR A;  3O0H A;  4JQ9 A;  4P72 A;  2Q5I A;  2XH7 A;  3HFZ A;  4L87 A;  2PMQ A;  3GD3 A;  2HXT A;  2C3D A;  4E6M A;  4OLF A;  2JK6 A;  3QFB A;  2GSH A;  3RR1 A;  4Z17 A;  4GME A;  3FXG A;  3SQS A;  2I4L A;  4PG3 A;  2RHQ B;  3W3S A;  2ZIN A;  3REU A;  1ELS A;  1KMN A;  2GR1 A;  2QJM A;  2P8C A;  4P73 C;  1SJA A;  3MY9 A;  1EOV A;  1GGM A;  3GD6 A;  4EQS A;  5JCI A;  3IKL A;  4EM4 A;  3QO8 A;  2E41 A;  3VC6 A;  1ATI A;  4A6G A;  1Q1W A;  5J04 A;  4P72 C;  1ZK7 A;  2G4C A;  2Q7H A;  4BWA A;  3RKW A;  4DHG A;  2I4N A;  3DEQ A;  4F4R A;  3WQZ A;  4YWO A;  3NEL A;  4YRI A;  1NHQ A;  2FYM A;  5ELN A;  2X8C A;  1S7M A;  4G8T A;  1D7Y A;  3CAW A;  5KVI A;  3UJ2 A;  2GR0 A;  4Q15 A;  3QKE A;  4YRN A;  1R0M A;  4H02 A;  4EQX A;  3CT2 A;  4P75 A;  4XTY A;  1FO4 A;  4H4Y A;  1KN0 A;  1X2H A;  3AN1 A;  3MWC A;  3E9H A;  1TKK A;  2AL2 B;  1EQR A;  2P88 A;  4KT2 A;  3OW1 A;  1SES A;  2DEQ A;  3VFC A;  3EFR A;  3HRI A;  3JVA A;  4XU3 A;  4H83 A;  1KOG A;  5C53 B;  2ZNI A;  4ADW A;  1V97 A;  4YRQ A;  1ECQ A;  1MNS A;  4H4Z A;  3SR6 B;  3DSQ A;  4P3P A;  5IDZ A;  4YP0 A;  3MQZ A;  5K1P A;  1WQ7 A;  3UGT A;  5KNN A;  5ELO A;  3H70 A;  1B7Y A;  1WYG A;  3RO6 A;  1GEU A;  4H2T A;  4P75 C;  2R9Z A;  2AL1 A;  3P8V A;  1K4Q A;  3I6E A;  2EQ6 A;  3QTP A;  3DFH A;  2CGH A;  2AAQ A;  1JCT A;  3V7C A;  2OFJ A;  3V8L A;  1ASY A;  2YQU A;  1QE0 A;  1ZKQ A;  3L4G A;  5JCM A;  1NJ2 A;  2O56 A;  3HPF A;  1NDA A;  2RHS A;  3NZG A;  2PGW A;  3AMZ A;  3TTE A;  1NU5 A;  1WUE A;  4RMF A;  3UH0 A;  4LNS A;  4ZOH B;  4HCD A;  1EBG A;  2GGE A;  3T9P A;  4HWP A;  1ONF A;  3UJR A;  2YVF A;  2ALY A;  2QHT A;  3PFR A;  4GGB A;  3DGZ A;  2AKW A;  4HCH A;  3FV9 A;  2X8H A;  3STP A;  4GIR A;  1XS2 A;  3PCO B;  2A8X A;  3JZU A;  4G84 A;  4EQR A;  2X99 A;  3IJI A;  3SQP A;  1B76 A;  1YB3 A;  3QLD A;  2CJ9 A;  2OZ8 A;  1LYL A;  1G51 A;  3HTZ A;  4P71 A;  1EC9 A;  4J3Z A;  1H4T A;  1STZ A;  1TZZ A;  4GGH A;  3TOY A;  1KMM A;  5F5W A;  1FEC A;  1WNL A;  4H4W A;  1SET A;  3NXL A;  3NVW B;  1N5X A;  4YCV A;  1E1O A;  4HA8 A;  1M6I A;  3MEY A;  4UPA A;  4UP7 A;  2AKM A;  3NS1 B;  2DQ0 A;  2EQ8 A;  1IL2 A;  3TW9 A;  4K7Z A;  1VDV A;  3V4B A;  2HNI A;  3NET A;  2EJG A;  1FFV C;  2DW7 A;  4KWS A;  3CGC A;  3G1Z A;  1N62 C;  4K87 A;  4IHC A;  1JRO A;  3DG3 A;  3S5S A;  4AH6 A;  1DNC A;  4XU0 A;  4KR2 A;  3A5Z A;  4H2X B;  1GSN A;  4P71 C;  1ZX9 A;  4HCL A;  3RF1 A;  3HXY A;  3V5C A;  1GRT A;  3DIP A;  3FCP A;  2CJB A;  1ZY8 A;  3LSQ A;  5FJO A;  3D47 A;  3VDG A;  4UP8 A;  1YFR A;  2C3C A;  2MUC A;  4HWS A;  3CGD A;  1B70 B;  3QO7 A;  4IP4 A;  1GRB A;  1ZXI C;  4H19 A;  3LAD A;  3N4E A;  3ZLG A;  1JJC B;  1NPX A;  5FS8 A;  2WPF A;  3JW7 A;  2W3S A;  3RCY A;  4DWD A;  4H2U A;  2J3L A;  4ZA0 A;  4HNL A;  4Q6G A;  1JEH A;  4APN A;  2ZNJ A;  5E3I A;  2NPX A;  3DGB A;  4GFI A;  2QDD A;  3ICA A;  1NEL A;  3BFM A;  4YDQ A;  3CXB A;  3DH9 A;  3DK9 A;  3N6H A;  2YVG A;  4JDR A;  2E65 A;  1ASZ A;  3ZLH A;  4A3R A;  2X50 A;  3B9J B;  1FHU A;  1XAN A;  4H1Z A;  4MGG A;  4HYR A;  2P8B A;  2PTW A;  2WBA A;  1KCZ A;  1SJC A;  3NO1 A;  1MUC A;  4RQF A;  4BUR A;  4ZIB A;  2DW6 A;  5G5H B;  3A5Y A;  3HXV A;  3HFZ B;  4FX9 A;  1X55 A;  2HNE A;  1SER A;  1FIQ B;  4TVY A;  1EC7 A;  1TE6 A;  3REX A;  4TTV A;  1OJT A;  2ZT5 A;  3TEG A;  4CH5 A;  2HZG A;  3CXO A;  3LSS A;  1G5I A;  3P0W A;  3RNM A;  4CH6 A;  4CH3 A;  2ZT6 A;  3BSM A;  2DXT A;  2OX4 A;  2ZIM A;  2DTI A;  3U9I A;  1TYP A;  2ZZ0 A;  4DYE A;  2ZZF A;  4K88 A;  1OEP A;  4LA1 A;  5JCN A;  5FJU A;  3IK4 A;  3VBB A;  4HVC A;  1H4Q A;  4YRE A;  4TQF A;  4YRM A;  1NYR A;  4RDX A;  4DPG A;  3H8A A;  2PTX A;  3S47 A;  4E4F A;  3KUM A;  1E1T A;  4EMW A;  3M4Q A;  1BBW A;  1GRE A;  2CHR A;  1P48 A;  3NVV B;  5FS9 A;  2GGJ A;  2GQW A;  3UXL A;  1H4S A;  3HW2 A;  1E22 A;  4XTV A;  3VA8 A;  1N63 C;  1MDR A;  1GRF A;  3RIR A;  2XH4 A;  1B8A A;  2XH0 A;  3HY0 A;  3SN4 A;  4G85 A;  3DES A;  4CS2 A;  3HRK A;  3UGQ A;  3URH A;  1BWC A;  3MF1 A;  1F8W A;  2OQY A;  3A7U A;  4GYP A;  3UGV A;  3HXU A;  4O2D A;  4LVI A;  4H4R A;  4IL0 A;  4JHM A;  3BJU A;  1EC8 A;  4YRL A;  2PP0 A;  4LVL A;  3VQV A;  2PGE A;  3OZM A;  1WLE A;  3PWG A;  1F9C A;  2OG9 A;  3V7S A;  1B7Y B;  3ZVH A;  2EJF A;  1C0A A;  3T8Q A;  3A7A A;  2GDQ A;  2OKT A;  3MSY A;  4J56 A;  5U1O A;  2QQ6 A;  3PZC A;  4HWO A;  1ONE A;  4X2P A;  4YRR A;  5FJR A;  3N4F A;  2CJA A;  3QN3 A;  2P3Z A;  4KEM A;  1PYS A;  4GYP C;  2ZR2 A;  2PPG A;  3RGL A;  2MNR A;  3L4G B;  1N61 C;  3L2Z A;  1EFW A;  3VQX A;  2BC1 A;  3P93 A;  2ZT8 A;  2CFY A;  2OZ3 A;  4ROP A;  2RHS B;  3I7F A;  1FEB A;  4K2S A;  4E8G A;  1MO9 A;  5TR3 A;  1NHP A;  3MF2 A;  4XTU A;  3SBF A;  1RM6 B;  1SB3 B;  3MKC A;  2GH5 A;  3U4F A;  2OQH A;  2OVL A;  3RKX A;  2FYK A;  4XTW A;  2ALY B;  2AKW B;  4EQW A;  1KKR A;  1RVK A;  1NHR A;  2PTZ A;  1YQZ A;  4CS3 A;  1QF6 A;  1SRY A;  4PHC A;  3IC9 A;  2ZGW A;  4XEM A;  3H4K A;  4WJ4 A;  1R6W A;  1GET A;  2C8M A;  3CYJ A;  3PWI A;  3R25 A;  5BOE A;  3DG6 A;  1AOG A;  2IY5 A;  2ONE A;  2POZ A;  1EVL A;  5FS6 A;  2IY5 B;  1FEA A;  3DJJ A;  4P3N A;  4NCX A;  3R11 A;  4XEO A;  4MMW A;  3ERR A;  3DFY A;  3R07 A;  3THU A;  2PU0 A;  2WOW A;  2QHV A;  3A74 A;  3KLJ A;  3TEH A;  4HT4 A;  1Q1R A;  3CMQ A;  2DU7 A;  4LVM A;  1EIY A;  3RKY A;  2DDZ A;  3CGB A;  3ETR B;  3HFV A;  1GRG A;  1TYT A;  2PP3 A;  4G7F A;  3UJS A;  3FJP A;  3RAC A;  2WP6 A;  4JN7 A;  4DQ2 A;  2X8G A;  2Q7G A;  4TVA A;  3V8K A;  3FVD A;  1X54 A;  3E9I A;  3D46 A;  1EBD A;  4J57 A;  3KFU A;  2EWN A;  4TVA B;  3ZLF A;  2ZIO A;  3GO2 A;  1W6T A;  4ENL A;  2QAE A;  4BW9 A;  3AM9 A;  3RRA A;  1BIA A;  2ODR C;  2ZC8 A;  3NEM A;  1RIQ A;  4YCW A;  3IG2 A;  5FJP A;  4K8G A;  4IZG A;  3R07 C;  1N60 C;  3LB8 A;  2PME A;  4K86 A;  4HNC A;  3Q6J A;  3T6C A;  2J3M A;  3M4P A;  1BZL A;  5U25 A;  1YFS A;  2OLA A;  3P8Y A;  4Z1Y A;  1BIB A;  2DU5 A;  2DTH A;  1IYX A;  3CB3 A;  1X2G A;  1XHC A;  2EQ7 A;  4CH4 A;  2E10 A;  1NNH A;  3ES7 A;  1LPF A;  1YEY A;  5G5G B;  4ZTU B;  3GRT A;  3N6J A;  3QPE A;  2V3A A;  3B97 A;  3Q4D A;  3EKG A;  2E64 A;  2ZCE A;  3UFG A;  3VQY A;  5KVH A;  1USY A;  4RQE A;  2QGY A;  3H12 A;  1XDI A;  3P3B A;  1ADJ A;  4FI4 A;  3RGT A;  2QJJ A;  2I4M A;  4XU2 A;  2E1H A;  1XPY A;  2ZZB A;  5BOF A;  3BJS A;  3DGH A;  3TUP A;  3DK4 A;  3IJL A;  4BV6 A;  1J5W A;  2XGT A;  4YRF A;  2P0I A;  2J3N A;  2EL9 A;  2OO6 A;  3L5O A;  1JPD X;  2PSN A;  1EVK A;  1HC7 A;  2ARU A;  3QNE A;  6ENL A;  3R0K A;  4H4P A;  3GRS A;  4TVW A;  1N5W C;  3QFA A;  3UJE A;  2BCP A;  3R0U A;  1USY C;  2DVE A;  4TQD A;  4P3O A;  2WPE A;  1H6V A;  4H2V A;  3UXK A;  2EAY A;  1ZDL A;  3BOX A;  4E51 A;  2PTY A;  5JRB A;  2W54 A;  3SN0 A;  1WYD A;  1DXL A;  4EM3 A;  4H2W A;  4EX5 A;  2AKZ A;  1GES A;  2WOI A;  3V5F A;  4CS4 A;  3EEZ A;  3ZVI A;  2I5Q A;  4EWJ A;  3HXW A;  4XTX A;  2DKG A;  2F5Z A;  1BQG A;  3NVY B;  4TWA A;  3VCN A;  4YRP A;  2QJN A;  2RHQ A;  4IL2 A;  3V8J A;  3L8K A;  1GRH A;  2WPC A;  2ZZG A;  2PCE A;  1X56 A;  3Q45 A;  3R10 A;  1DTN A;  3D9X A;  1PDZ A;  3TWB A;  2XH2 A;  3GC2 A;  3EAO A;  2OPJ A;  3I6T A;  4WI1 A;  3V3W A;  1JPM A;  1KKO A;  2ZXF A;  3DJG X;  1L0W A;  3OD1 A;  2DJZ A;  1PDY A;  1WU7 A;  5C52 B;  2DQ3 A;  2WOV A;  3UCD A;  1GRA A;  4DXK A;  3QO5 A;  4YPF A;  4FP1 A;  3TJ4 A;  3ZVH B;  4NEV A;  3RIT A;  4JN8 A;  2W55 A;  2E5A A;  2XSX A;  2AL2 A;  1MDL A;  4ZTZ B;  3EF6 A;  3DG7 A;  2Q7E A;  1GV4 A;  3QTC A; 
#chains in the Genus database with same CATH homology
 5C51 B;  1T3Q C;  3NEN A;  2DZ9 A;  2ODR D;  1PYS B;  5HGQ A;  2QHS A;  3L1A A;  1H4V B;  3A32 A;  1NJ8 A;  1E24 A;  3HY1 A;  3NVZ B;  4KR3 A;  2E3C A;  3EUB 3;  4XTZ A;  12AS A;  3A7R A;  4YRK A;  4H2Y A;  1BBU A;  1YFT A;  3EFS A;  2ZZE A;  2P5I A;  4YRG A;  4YRT A;  2Q5H A;  2QHU A;  2PMF A;  4YRS A;  2CIM A;  5K1X A;  4LVK A;  3PCO A;  2I4O A;  3TEH B;  1EIY B;  1HXD A;  2C7I A;  3HXZ A;  2ZR3 A;  3RUX A;  3V7R A;  4P74 A;  1HTT A;  1YGB A;  2ARS A;  3P8T A;  4H2S A;  2DXU A;  3HRD C;  4XU1 A;  2ZT7 A;  2A8E A;  1VQZ A;  1Z7N A;  2P0L A;  4H2X A;  1NJ1 A;  4WJ3 M;  4HWR A;  4P74 C;  1NJ6 A;  2E3T A;  4YRO A;  1WPY A;  4X5O A;  1Z7M A;  1X01 A;  3IKM B;  1B70 A;  3IAL A;  2ART A;  3VQW A;  2XTI A;  4WF2 A;  1JJC A;  3A31 A;  1FFU C;  2W3R A;  4YCU A;  2ZTG A;  1NJ5 A;  4LVJ A;  4OP0 A;  4EO4 A;  4J15 A;  3NRZ B;  11AS A;  1JRP A;  3RL6 A;  4YYE A;  2AMC A;  4HWT A;  4KQE A;  2NS6 A;  4UP9 A;  1WQW A;  2AMC B;  1G5H A;  1NYQ A;  1N9W A;  4YRC A;  4YRJ A;  2EJ9 A;  4P73 A;  2DZC A;  2DTO A;  1ADY A;  1W66 A;  3LC0 A;  1FYF A;  3HXX A;  4P72 A;  2Q5I A;  3HFZ A;  4L87 A;  4OLF A;  2I4L A;  4PG3 A;  2RHQ B;  3W3S A;  2ZIN A;  3REU A;  1KMN A;  4P73 C;  3IKL A;  1EOV A;  1GGM A;  3QO8 A;  2E41 A;  1ATI A;  4P72 C;  2G4C A;  2Q7H A;  4BWA A;  3RKW A;  2I4N A;  3WQZ A;  3NEL A;  4YRI A;  5ELN A;  4Q15 A;  4YRN A;  4H02 A;  4P75 A;  4XTY A;  1FO4 A;  1X2H A;  3AN1 A;  3E9H A;  1EQR A;  3HRI A;  3EFR A;  1SES A;  2DEQ A;  4XU3 A;  1KOG A;  2ZNI A;  5C53 B;  1V97 A;  4YRQ A;  3DSQ A;  3SR6 B;  4YP0 A;  4P3P A;  5K1P A;  3MQZ A;  1WQ7 A;  3UGT A;  5KNN A;  5ELO A;  4H2T A;  1B7Y A;  1WYG A;  4P75 C;  3P8V A;  2CGH A;  3V7C A;  1ASY A;  1QE0 A;  3L4G A;  1NJ2 A;  2RHS A;  3AMZ A;  3UH0 A;  4RMF A;  4LNS A;  4ZOH B;  4HWP A;  2ALY A;  2QHT A;  2AKW A;  3PCO B;  4G84 A;  1YB3 A;  1B76 A;  2CJ9 A;  1LYL A;  1G51 A;  3HTZ A;  4P71 A;  1H4T A;  1KMM A;  5F5W A;  1WNL A;  1SET A;  3NVW B;  4YCV A;  1N5X A;  1E1O A;  4HA8 A;  4UPA A;  3MEY A;  4UP7 A;  1IL2 A;  3NS1 B;  2DQ0 A;  1VDV A;  2HNI A;  3NET A;  2EJG A;  1FFV C;  3G1Z A;  4K87 A;  1N62 C;  4AH6 A;  1JRO A;  4XU0 A;  4KR2 A;  3A5Z A;  4H2X B;  4P71 C;  3RF1 A;  3HXY A;  2CJB A;  3LSQ A;  4UP8 A;  1YFR A;  4HWS A;  3QO7 A;  1B70 B;  1ZXI C;  1JJC B;  2W3S A;  4H2U A;  2J3L A;  4Q6G A;  2ZNJ A;  5E3I A;  3ICA A;  3BFM A;  4YDQ A;  2E65 A;  1ASZ A;  3B9J B;  4RQF A;  4ZIB A;  5G5H B;  3A5Y A;  3HXV A;  3HFZ B;  1X55 A;  1SER A;  1FIQ B;  4TVY A;  3REX A;  4TTV A;  2ZT5 A;  3TEG A;  4CH5 A;  3LSS A;  1G5I A;  4CH6 A;  4CH3 A;  2ZT6 A;  2DXT A;  2ZIM A;  4K88 A;  2DTI A;  2ZZF A;  3V8L A;  1H4Q A;  4HVC A;  3VBB A;  4YRE A;  4TQF A;  4YRM A;  1NYR A;  4RDX A;  4DPG A;  1E1T A;  3M4Q A;  1BBW A;  3NVV B;  1H4S A;  1E22 A;  4XTV A;  1N63 C;  3RIR A;  1B8A A;  3HY0 A;  4G85 A;  4CS2 A;  3HRK A;  3UGQ A;  3MF1 A;  3A7U A;  3HXU A;  4O2D A;  4LVI A;  3BJU A;  4YRL A;  4LVL A;  3VQV A;  1WLE A;  3V7S A;  1B7Y B;  2EJF A;  1C0A A;  3A7A A;  3PZC A;  4HWO A;  4YRR A;  2CJA A;  2ZR2 A;  1PYS A;  3RGL A;  3L4G B;  1N61 C;  3L2Z A;  1EFW A;  3VQX A;  2ZT8 A;  2RHS B;  3I7F A;  3MF2 A;  4XTU A;  1SB3 B;  1RM6 B;  3RKX A;  2FYK A;  4XTW A;  2ALY B;  2AKW B;  1QF6 A;  4CS3 A;  1SRY A;  4PHC A;  2ZGW A;  4XEM A;  4WJ4 A;  2C8M A;  2IY5 A;  1EVL A;  2IY5 B;  4P3N A;  4NCX A;  4XEO A;  3ERR A;  3R07 A;  2QHV A;  3A74 A;  3TEH A;  4HT4 A;  3CMQ A;  2DU7 A;  4LVM A;  1EIY A;  3RKY A;  2DDZ A;  3ETR B;  3HFV A;  4DQ2 A;  3FJP A;  3RAC A;  2Q7G A;  4TVA A;  3V8K A;  1X54 A;  3E9I A;  3KFU A;  2EWN A;  4TVA B;  2ZIO A;  4BW9 A;  3AM9 A;  1BIA A;  2ODR C;  3NEM A;  1RIQ A;  4YCW A;  3IG2 A;  3R07 C;  1N60 C;  2PME A;  4K86 A;  3M4P A;  2J3M A;  1YFS A;  3P8Y A;  2DU5 A;  1BIB A;  2DTH A;  1X2G A;  4CH4 A;  2E10 A;  1NNH A;  5G5G B;  4ZTU B;  3VQY A;  2E64 A;  2ZCE A;  3UFG A;  1USY A;  4RQE A;  1ADJ A;  4XU2 A;  2I4M A;  2E1H A;  3TUP A;  1J5W A;  2XGT A;  4YRF A;  2EL9 A;  1EVK A;  1HC7 A;  3QNE A;  2ARU A;  4TVW A;  1N5W C;  1USY C;  2DVE A;  4TQD A;  4P3O A;  4H2V A;  2EAY A;  4E51 A;  2W54 A;  4H2W A;  1WYD A;  4EX5 A;  4CS4 A;  3HXW A;  4XTX A;  2DKG A;  4TWA A;  3NVY B;  4YRP A;  2RHQ A;  3V8J A;  2ZZG A;  1X56 A;  4WI1 A;  2ZXF A;  1L0W A;  3OD1 A;  2DJZ A;  5C52 B;  1WU7 A;  2DQ3 A;  3QO5 A;  4YPF A;  2W55 A;  2E5A A;  4ZTZ B;  2Q7E A;  3QTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...