3A7UA

Crystal structure of the bovine lipoyltransferase in its unliganded form
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
343
structure length
325
Chain Sequence
GLILQSISNDVYHNLAVEDWIHDHMNLEGKPVLFLWRNSPTVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLVVRALKAVHPHLDVQATKRFDLLLDGQFKISGTASKIGRNAAYHHCTLLCGTDGTFLSSLLKKNLMEKDPTLTCEVVINAVATEYATSHQIDNHIHLINPTDETVFPGINSKAIELQTWEWIYGKTPKFSVDTSFTVLHEQSHVEIKVFIDVKNGRIEVCNIEAPDHWLPLEICDQLNSSLIGSKFSPIETTVLTSILHRTYPGDDELHSKWNILCEKIKGIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase 1, mitochondrial
publication title Global conformational change associated with the two-step reaction catalyzed by Escherichia coli lipoate-protein ligase A.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 84
structure length 325
sequence length 343
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 3a7uA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3a7uA01
1JRPA 1SRYA 1BBWA 2CJBA 2EJGA 2EWNA 2ZINA 4XU3A 1PYSB 1WYGA 3VQWA 4EX5A 4X5OA 2E41A 4EO4A 3NVVB 4P72C 3NVYB 2E3CA 3HY1A 1WPYA 1N61C 4YCUA 1G5HA 1T3QC 2DDZA 2E64A 1E1TA 1X56A 2QHVA 2W3RA 3ETRB 3AM9A 4HVCA 4CH5A 1EOVA 1X2HA 4RMFA 4XTWA 4YPFA 1QE0A 1WQWA 2ZT5A 3NENA 3MF1A 2CJ9A 2IY5A 1USYA 4YRJA 1YB3A 4P3NA 3VQYA 4WF2A 1N60C 4TVYA 1G51A 2RHSB 3QTCA 4UPAA 2ODRD 1EVLA 3QO5A 3TEHA 2DU7A 3A32A 1N5WC 4H2YA 3G1ZA 3HRIA 2XTIA 3LC0A 3TUPA 4P72A 4CH4A 3NEMA 3REUA 3QO8A 2AKWA 1SB3B 1H4TA 4ZTZB 5G5HB 2ARTA 3HXZA 5G5GB 1YGBA 3EUB3 3V8LA 2DVEA 1BBUA 2DTIA 2DXTA 3UGTA 5ELOA 3LSQA 3PCOA 2ARUA 1Z7MA 2DXUA 2AMCA 4UP9A 1YFRA 3AN1A 4TQDA 2EJ9A 3V7RA 4P3PA 4XTZA 1GGMA 4DQ2A 3L1AA 1EIYA 4CH3A 3V7CA 4YRTA 5KNNA 4OLFA 1X2GA 3L4GA 4YP0A 1SESA 3HFVA 2CIMA 3HRKA 4P74C 3V7SA 4YRLA 4K86A 12ASA 4Q15A 2J3LA 2PMFA 4RQFA 3RL6A 2IY5B 4HWPA 1W66A 3NS1B 1N62C 2Q5HA 3IALA 3B9JB 3UFGA 3HXWA 4YRSA 3WQZA 4UP7A 3TEHB 2J3MA 2DJZA 4YRPA 4LNSA 3RF1A 1YFSA 4BW9A 4E51A 4XTXA 3VQVA 3RKYA 4XTVA 3P8YA 3A5ZA 1KMMA 2AKWB 1JJCA 3VQXA 2ZIOA 1E22A 1LYLA 4P74A 3HXYA 4YRMA 1N5XA 3A5YA 2ZNIA 1H4SA 4XU2A 3PCOB 4TVAA 1ZXIC 1JROA 2AMCB 1KMNA 4WI1A 3A74A 3NRZB 2W3SA 3SR6B 4P73C 4YRIA 4ZIBA 1RIQA 2E1HA 1EIYB 5C53B 1WYDA 4XTYA 11ASA 4YREA 4WJ3M 4H2XA 1EQRA 4H2SA 4YCVA 3L4GB 1H4VB 1BIBA 2CGHA 2E5AA 3REXA 4DPGA 1KOGA 2FYKA 2DKGA 3V8JA 4G84A 4P75C 4PHCA 4XEMA 3IKMB 4NCXA 2DEQA 4YRNA 2E65A 1WU7A 3CMQA 4YRQA 2EL9A 4AH6A 3NVZB 2Q7GA 4YCWA 1ATIA 1C0AA 4YDQA 1NJ8A 3P8VA 3HXXA 4P73A 4Q6GA 4XU0A 4L87A 4ZOHB 5K1PA 2W55A 2HNIA 3IKLA 2DZ9A 1WLEA 3NVWB 4P3OA 1FFVC 3W3SA 4XU1A 2ZIMA 1JJCB 2XGTA 2DQ3A 2G4CA 4P71C 3P8TA 1NJ1A 1ASYA 1E1OA 2W54A 4ZTUB 3VBBA 4P75A 4YYEA 3ERRA 2DTOA 4HWSA 4RDXA 2ZT8A 4CS4A 1Z7NA 4G85A 2C7IA 2QHTA 4OP0A 4YRRA 5C52B 3HY0A 1HTTA 1H4QA 2ZXFA 2DTHA 1HXDA 4TVAB 1NJ6A 2ZZFA 4YRKA 3RKWA 1ADYA 1B70A 2RHQA 4KR2A 2ZTGA 4YROA 4XTUA 2QHSA 4RQEA 1E24A 3I7FA 4CS2A 2ZCEA 1N63C 3HFZA 3A7AA 5F5WA 3L2ZA 1BIAA 4KQEA 1B76A 4CS3A 4P71A 3A7UA 4H2XB 1B7YA 3BJUA 3MEYA 4TTVA 1X54A 2ZR2A 3NELA 3RKXA 3E9IA 3M4PA 2QHUA 2ODRC 3RACA 3E9HA 3EFRA 2I4LA 1SETA 2C8MA 4YRFA 3PZCA 3HXVA 5K1XA 1FO4A 1NYRA 5HGQA 3HXUA 5E3IA 1WQ7A 3HRDC 1B8AA 1VQZA 2Q5IA 3KFUA 4KR3A 3LSSA 2ZNJA 4HWRA 4O2DA 3EFSA 4H2WA 4K88A 4H2VA 4CH6A 3UGQA 4BWAA 4J15A 1ASZA 4TQFA 2PMEA 2ALYA 4H02A 4YRGA 1X01A 1FIQB 1QF6A 2ZZGA 2P5IA 2Q7HA 4XEOA 1J5WA 4WJ4A 1RM6B 2ZZEA 2EJFA 4HWTA 1PYSA 2DU5A 3QO7A 3MF2A 2ZR3A 1N9WA 1IL2A 5ELNA 1NJ5A 1YFTA 4H2TA 2DZCA 1B70B 3ICAA 4UP8A 2RHQB 2Q7EA 1L0WA 3UH0A 3RUXA 5C51B 3M4QA 4H2UA 4PG3A 1WNLA 3V8KA 3HFZB 1EVKA 3AMZA 2E10A 3HTZA 1ADJA 2ARSA 3DSQA 1B7YB 4HA8A 2ZGWA 3R07C 4TVWA 3A7RA 1SERA 2EAYA 2I4MA 2I4OA 3NETA 2RHSA 1NYQA 2ZT6A 4TWAA 3BFMA 2P0LA 1G5IA 1X55A 2CJAA 3RGLA 2DQ0A 3OD1A 2ZT7A 1EFWA 1HC7A 4HWOA 2I4NA 4YRCA 1NJ2A 3RIRA 3IG2A 1NNHA 3QNEA 1VDVA 3TEGA 3R07A 1V97A 1FFUC 2E3TA 2ALYB 1FYFA 3A31A 4K87A 1USYC 3FJPA
chains in the Genus database with same CATH superfamily
1JRPA 4DWDA 1SRYA 2GDQA 1BBWA 2CJBA 4DX3A 2OZ3A 2EJGA 2EWNA 3LXDA 3QKEA 3ZVIA 2ZINA 4XU3A 1PYSB 3R10A 1WYGA 3VQWA 4APNA 4EX5A 1OEPA 2PTWA 2ZZCA 1JOAA 2E41A 4X5OA 4EO4A 3NVVB 4J56A 3PG6A 4P72C 1GRFA 3NVYB 2XH2A 2E3CA 3HY1A 1WPYA 1N61C 4YCUA 1G5HA 1T3QC 1GEUA 2QJJA 2DDZA 3V3WA 2E64A 5U1OA 1E1TA 1X56A 1YQZA 2QHVA 5EBKA 2W3RA 3ETRB 1H2IA 3AM9A 4HVCA 3T4WA 1PDYA 3DGZA 1EOVA 4CH5A 3TWAA 4GIRA 1X2HA 4RMFA 3CK5A 1NDAA 4XTWA 2PTZA 1BQGA 1TE6A 2OPJA 3EF6A 4J1OA 4YPFA 1QE0A 5FJOA 2X8HA 1WQWA 1DNCA 1FHUA 3CXBA 3QFAA 4IT1A 4MMWA 1NHSA 4HN8A 2ZT5A 4NEVA 2GGEA 3ZVHB 3NENA 3MF1A 2CJ9A 2IY5A 1USYA 4YRJA 1YB3A 3MWCA 4P3NA 1ONFA 3VQYA 2OO6A 3CGDA 2OG9A 1N60C 4TVYA 3UXKA 3VA8A 1G51A 2RHSB 4WF2A 4EMJA 3QTCA 1P48A 2OZTA 3DH9A 4UPAA 2ODRD 1EVLA 3QO5A 3TEHA 5TR3A 2DU7A 3A32A 1NHQA 3LADA 2W0HA 2HNEA 4ZCWA 2GH5A 1N5WC 2BC0A 2GR2A 3L8KA 3G1ZA 3HRIA 4H2YA 5FJUA 1WUEA 3VC5A 2XTIA 3LC0A 3TUPA 4P72A 2CDUA 2DW6A 2WP5A 1MNSA 1R6WA 4EQWA 4CH4A 2HZGA 2WPFA 3OW1A 4BV6A 3NEMA 3REUA 4K7ZA 3QO8A 1MDLA 1OJTA 2PU1A 5FS7A 2PSNA 3I6TA 5EU9A 2AKWA 1XANA 5KVIA 6ENLA 1SB3B 1H4TA 1GRHA 4ZTZB 5G5HB 2ARTA 3HXZA 3DG6A 5G5GB 1YGBA 4DYEA 3DDMA 2AL2A 3EUB3 4HNLA 2ZADA 3V8LA 4FP1A 2GR1A 5JCKA 2DVEA 2MNRA 1K4QA 3N6JA 3OPSA 1BBUA 2DTIA 2DXTA 3UGTA 4LA1A 3GD6A 2YVJA 3QLDA 2PP1A 3UGVA 3S5SA 5IDZA 1D7YA 2GGJA 5ELOA 3LSQA 4GR1A 3TJ4A 4A6GA 3PCOA 2JK6A 2HXTA 1ELSA 3DGBA 3V5FA 2ARUA 3JW7A 3PWIA 4KT2A 1Z7MA 2AKZA 2DXUA 1BZLA 2P3ZA 2AMCA 4UP9A 2WOWA 3OC4A 1YFRA 2PODA 1GRBA 3IC9A 3AN1A 4H4XA 3FVDA 2EQ7A 3VFCA 3CT2A 4TQDA 2QVHA 2EJ9A 3V7RA 4P3PA 3FV9A 4XTZA 3QTPA 1GGMA 4DQ2A 3L1AA 1TZZA 1EIYA 1MUCA 1V59A 1FHVA 4CH3A 1ZY8A 4H4YA 1MDRA 3V7CA 4YRTA 1SJCA 5KNNA 4OLFA 1X2GA 3HPFA 3RO6A 4KPRA 5FJTA 3L4GA 1SESA 4YP0A 4M0XA 4HCLA 3HFVA 2CIMA 4H1ZA 1ZX9A 4H4VA 1IYXA 3ES8A 4J57A 3HRKA 3EKGA 4P74C 3V7SA 2R9ZA 1P43A 4YRLA 3CGCA 3RR1A 4K86A 2X8CA 12ASA 3R25A 1ZK7A 1EC9A 1LPFA 4EMIA 4G8TA 2J3LA 2PMFA 4Q15A 4RQFA 3SQSA 4HCDA 3NO1A 3RRAA 1R0MA 2YAUA 3RL6A 2IY5B 4HWPA 1W66A 1N62C 3NS1B 2Q5HA 3IALA 1SJAA 4BURA 3B9JB 3Q6JA 3UFGA 3HXWA 3JZUA 2MUCA 4YRSA 3WQZA 4UP7A 3TEHB 3RCYA 2PGWA 2V6OA 4H4UA 1AOGA 3DEQA 2J3MA 3ES7A 2A8XA 3NFUA 2DJZA 4M6UA 4YRPA 4EQRA 1E9IA 3PFRA 4LNSA 5JCNA 3RF1A 3P3BA 3SSZA 1YFSA 4BW9A 4E51A 4E4FA 4XTXA 3BOXA 3VQVA 1JEHA 3UCCA 3H7VA 3RKYA 1KKRA 4XTVA 3P8YA 3A5ZA 1GSNA 2AAQA 2TPRA 1KMMA 2AKWB 2BCPA 1JJCA 3VQXA 2ZIOA 3TQPA 3TW9A 2RABA 1E22A 2F5ZA 2POZA 4LIIA 2AL2B 1LYLA 3PK7A 3Q45A 3VDGA 4P74A 4E5TA 3HXYA 1N5XA 4YRMA 3A5YA 1F8WA 2ZNIA 1BKHA 3MKCA 1TYPA 2YVGA 5U25A 4XU2A 1H4SA 4LVLA 3PCOB 1JPMA 2J3NA 4H4QA 4J3ZA 4GMEA 1ECQA 1W6TA 3TWBA 4G7FA 4HCHA 4HPNA 4EM4A 4TVAA 1ZXIC 3CGBA 1JROA 1GXFA 1XS2A 3UJFA 4F4RA 2AMCB 4H4WA 2OQYA 4EM3A 1KMNA 1EBDA 3A74A 4WI1A 3D9XA 2OFJA 3NRZB 3QN3A 1JPDX 3R0KA 4ADWA 5FMHA 2W3SA 3OP2A 3SR6B 5GRTA 4P73C 1F3PA 2EQ6A 4YRIA 3DG7A 3GRSA 4K8DA 5JRBA 4ZIBA 3DESA 1RIQA 2E1HA 1EIYB 2C3CA 5C53B 1WYDA 1NHPA 3VCNA 4XTYA 11ASA 3GC2A 3D46A 3FCPA 2NS6A 4YREA 4WJ3M 5JCLA 1GREA 2DU5A 4H2XA 2ZZBA 2OZ8A 1EQRA 2WOIA 5JCIA 4DNAA 3R0UA 2PA6A 4ZA0A 3R11A 3L4GB 4H2SA 1H4VB 4YCVA 1BIBA 2CGHA 2E5AA 3REXA 4DPGA 5J04A 7ENLA 1KOGA 4IHCA 4HT4A 2FYKA 3TOYA 2DKGA 3V8JA 2PU0A 1M6IA 4G84A 4P75C 2WPEA 2PTXA 4PHCA 2PMQA 4XEMA 3IKMB 4NCXA 2DEQA 4YRNA 2E65A 3ZLFA 1WU7A 4YRQA 1MRAA 3H4KA 4HNCA 4YWOA 2EL9A 3UJSA 2XH7A 4EMWA 3HW2A 4AH6A 3SN4A 3NVZB 2Q7GA 4YCWA 1ATIA 5JCMA 2ZZ0A 1C0AA 2PGEA 3GD4A 1NJ8A 2X99A 4IP5A 3P8VA 2CFYA 3HXXA 4P73A 4YDQA 1XHCA 3MQZA 4H2HA 3CGEA 3IJIA 3N6HA 4Q6GA 4XU0A 4L87A 3N4FA 4ZOHB 3TTEA 5K1PA 3IK4A 3UJEA 2WPCA 2XSXA 1ZMCA 2W55A 2HNIA 3D47A 3IKLA 2DZ9A 1WLEA 3LB8A 3NVWB 3EANA 5ENLA 4E4UA 1FFVC 3KUMA 3MQTA 2A8EA 4P3OA 1GETA 4XU1A 2CHRA 2ZIMA 3W3SA 1JJCB 4GISA 4ENLA 2XGTA 4A3RA 2DQ3A 1FEBA 1SJBA 2G4CA 3FXGA 4P71C 2NQLA 3JVAA 3P8TA 1KN0A 3CAWA 1NJ1A 1ASYA 3II4A 1NHRA 3U9IA 2PCEA 2QDDA 2OKTA 2XGZA 3ZLHA 4MKSA 1E1OA 2W54A 2P88A 4JN8A 3KLJA 4ZTUB 3DFHA 3VBBA 4P75A 4YYEA 3SBFA 3ERRA 5FJPA 2DTOA 4HWSA 2GR0A 4RDXA 3UJRA 1ZDLA 2ZT8A 1Z7NA 4CS4A 3U4FA 2BC1A 4E6MA 4G85A 2C7IA 1GERA 3I6EA 2QHTA 4OP0A 3FG2P 4YRRA 5C52B 1H6VA 5ER0A 3HY0A 2AKMA 1HTTA 1H4QA 4X2PA 2ZXFA 1TKKA 1HXDA 2DTHA 4IL0A 4GRTA 2WOVA 1NJ6A 4TVAB 2ZZFA 4YRKA 3K1GA 3RKWA 2I5QA 2X50A 4H4ZA 1ADYA 1B70A 2RHQA 4KR2A 3O0HA 4JN7A 2ZTGA 4YROA 2V3BA 4XTUA 2FYMA 2QHSA 4RQEA 3SQPA 1E24A 2QAEA 2QJMA 3I4KA 3I7FA 4CS2A 5BOFA 4KWSA 2ZCEA 1XDIA 1N63C 4HYRA 3HFZA 1FECA 4Z1YA 3A7AA 5F5WA 3L2ZA 3T8QA 1BIAA 4KQEA 1B76A 4CS3A 4P71A 3A7UA 3ENLA 4H4RA 4H2XB 1B7YA 3BJUA 1EBGA 4K8GA 3MEYA 4TTVA 1X54A 2ZR2A 3NELA 4KEMA 3RKXA 2HQMA 3DK4A 2NPXA 3E9IA 3M4PA 2QHUA 4LVMA 2ODRC 2XH4A 1ZKQA 2PPGA 3E9HA 3RACA 1KD0A 3EFRA 4NEWA 4IL2A 3FYYA 2I4LA 1SETA 2C8MA 3BJSA 4M52A 4ROPA 2C3DA 2PP0A 4YRFA 3PZCA 3NZGA 3HXVA 3FJPA 4EQXA 5K1XA 1NELA 1FO4A 1NYRA 5HGQA 2GRTA 3BSMA 3HXUA 3EEZA 5E3IA 4H4PA 3CB3A 4EWJA 1WQ7A 2GGGA 3HRDC 1VQZA 3UJ2A 1B8AA 3L5OA 2Q5IA 2NVKX 3KFUA 4K1WA 4KR3A 1STZA 1EC8A 3MUCA 4JHMA 3CYJA 1EC7A 3LSSA 2ZNJA 4HWRA 2GR3A 5KVHA 3GRTA 3IJQA 3EFSA 4GGHA 4H2WA 4O2DA 4K88A 4H83A 4H2VA 4FDCB 4CH6A 1ZMDA 3UGQA 3QFBA 1RVKA 3UXLA 1FEAA 2V3AA 3FJ4A 3STPA 3H12A 4BWAA 2GQWA 1KKOA 4J15A 2OLAA 2PS2A 2RDXA 2ZC8A 4IP4A 2PP3A 3UCDA 4E8GA 2ALYA 4TQFA 2PMEA 4GGBA 1WUFA 3DJGX 4H19A 2OVLA 1TYTA 1JDFA 3TCSA 4H02A 4YRGA 1X01A 1EBHA 4LVKA 2GGHA 1FIQB 1QF6A 2YQUA 1DXLA 3DIPA 4H50A 2EQ9A 4GYPC 3RGTA 2X8GA 1J5WA 2P5IA 2Q7HA 2ZZGA 4XEOA 4WJ4A 1RM6B 2ZZEA 3URHA 2EJFA 2WBAA 3SN0A 3OZMA 3VCCA 1PYSA 3DFYA 4HWTA 2OX4A 3IJLA 1YEYA 3QO7A 1XPYA 3MF2A 2OQHA 2ZR3A 2YVFA 1N9WA 1IL2A 1JCTA 2ONEA 1NJ5A 1YFTA 2DZCA 1B70B 3ICAA 4H2TA 2RHQB 4UP8A 1L0WA 2Q7EA 3UH0A 3NXLA 3RUXA 2P8CA 5C51B 3M4QA 4H2UA 4PG3A 4H4SA 1WNLA 3V8KA 4LVJA 3OTRA 3MY9A 3HFZB 5ELNA 1EVKA 2FKPA 3SJNA 2HXUA 3AMZA 3DK8A 3RNMA 1GV4A 2E10A 3TJIA 4Z17A 1GESA 5FJRA 3V5CA 1ADJA 2ARSA 3HTZA 3DSQA 3GO2A 4IZGA 3SN1A 4A35A 1B7YB 4LVIA 4JQ9A 3V4BA 2QJNA 4HA8A 2ZGWA 3R07C 4TVWA 3A7RA 3ZVHA 1S7MA 4K2SA 5FS8A 4DHGA 1PDZA 1SERA 1KCZA 2QGYA 3DG3A 2EAYA 1LVLA 2GSHA 2I4MA 4DN1A 2I4OA 2O56A 2EQ8A 3GY1A 5BOEA 3NETA 1Q1WA 2RHSA 4KPLA 4FX9A 4GYPA 1NYQA 2ZT6A 1DTNA 4TWAA 3CXOA 3H8AA 3DGHA 1GRAA 4GFIA 3BFMA 2P0LA 1Q1RA 2DW7A 3ZLGA 1SJDA 1G5IA 2QQ6A 1NPXA 4JDRA 1X55A 1ONEA 1MO9A 3DK9A 3DJJA 3Q4DA 2CJAA 3P0WA 3B97A 3THUA 3QPEA 3DERA 3P93A 3RITA 3RGLA 3PWGA 1BWCA 4DXKA 2DQ0A 4FI4A 3OD1A 2ZT7A 1MOKA 3T6CA 3R1ZA 1EFWA 1NU5A 5FS9A 3S47A 1HC7A 1F9CA 3H70A 4HWOA 3GD3A 3N4EA 2I4NA 4YRCA 1NJ2A 2QDEA 3RIRA 2AL1A 2XH0A 3IG2A 2P0IA 3MSYA 1NNHA 3OZYA 3VC6A 3QNEA 2PTYA 1VDVA 3TEGA 1ASZA 3EAOA 3R07A 1GRTA 3T9PA 4MGGA 1L8PA 1V97A 4YWSA 2GGIA 4EQSA 2GL5A 3MZNA 4H4TA 1FFUC 2E3TA 2ALYB 2P8BA 1FYFA 1GRGA 2WP6A 3A31A 4K87A 1USYC 5FS6A 3CMQA
chains in the Genus database with same CATH topology
1JRPA 1SRYA 1BBWA 2CJBA 2EJGA 2EWNA 2ZINA 4XU3A 1PYSB 1WYGA 3VQWA 4EX5A 4X5OA 2E41A 4EO4A 3NVVB 4P72C 3NVYB 2E3CA 3HY1A 1WPYA 1N61C 4YCUA 1G5HA 1T3QC 2DDZA 2E64A 1E1TA 1X56A 2QHVA 2W3RA 3ETRB 3AM9A 4HVCA 4CH5A 1EOVA 1X2HA 4RMFA 4XTWA 4YPFA 1QE0A 1WQWA 2ZT5A 3NENA 3MF1A 2CJ9A 2IY5A 1USYA 4YRJA 1YB3A 4P3NA 3VQYA 4WF2A 1N60C 4TVYA 1G51A 2RHSB 3QTCA 4UPAA 2ODRD 1EVLA 3QO5A 3TEHA 2DU7A 3A32A 1N5WC 4H2YA 3G1ZA 3HRIA 2XTIA 3LC0A 3TUPA 4P72A 4CH4A 3NEMA 3REUA 3QO8A 2AKWA 1SB3B 1H4TA 4ZTZB 5G5HB 2ARTA 3HXZA 5G5GB 1YGBA 3EUB3 3V8LA 2DVEA 1BBUA 2DTIA 2DXTA 3UGTA 5ELOA 3LSQA 3PCOA 2ARUA 1Z7MA 2DXUA 2AMCA 4UP9A 1YFRA 3AN1A 4TQDA 2EJ9A 3V7RA 4P3PA 4XTZA 1GGMA 4DQ2A 3L1AA 1EIYA 4CH3A 3V7CA 4YRTA 5KNNA 4OLFA 1X2GA 3L4GA 4YP0A 1SESA 3HFVA 2CIMA 3HRKA 4P74C 3V7SA 4YRLA 4K86A 12ASA 4Q15A 2J3LA 2PMFA 4RQFA 3RL6A 2IY5B 4HWPA 1W66A 3NS1B 1N62C 2Q5HA 3IALA 3B9JB 3UFGA 3HXWA 4YRSA 3WQZA 4UP7A 3TEHB 2J3MA 2DJZA 4YRPA 4LNSA 3RF1A 1YFSA 4BW9A 4E51A 4XTXA 3VQVA 3RKYA 4XTVA 3P8YA 3A5ZA 1KMMA 2AKWB 1JJCA 3VQXA 2ZIOA 1E22A 1LYLA 4P74A 3HXYA 4YRMA 1N5XA 3A5YA 2ZNIA 1H4SA 4XU2A 4LVLA 3PCOB 4TVAA 1ZXIC 1JROA 2AMCB 1KMNA 4WI1A 3A74A 3NRZB 2W3SA 3SR6B 4P73C 4YRIA 4ZIBA 1RIQA 2E1HA 1EIYB 5C53B 1WYDA 4XTYA 11ASA 4YREA 2NS6A 4WJ3M 4H2XA 1EQRA 4H2SA 4YCVA 3L4GB 1H4VB 1BIBA 2CGHA 2E5AA 3REXA 4DPGA 1KOGA 4HT4A 2FYKA 2DKGA 3V8JA 4G84A 4P75C 4PHCA 4XEMA 3IKMB 4NCXA 2DEQA 4YRNA 2E65A 1WU7A 3CMQA 4YRQA 2EL9A 4AH6A 3NVZB 2Q7GA 4YCWA 1ATIA 1C0AA 4YDQA 1NJ8A 3P8VA 3HXXA 4P73A 3MQZA 4Q6GA 4XU0A 4L87A 4ZOHB 5K1PA 2W55A 2HNIA 3IKLA 2DZ9A 1WLEA 3NVWB 2A8EA 4P3OA 1FFVC 3W3SA 4XU1A 2ZIMA 1JJCB 2XGTA 2DQ3A 2G4CA 4P71C 3P8TA 1NJ1A 1ASYA 1E1OA 2W54A 4ZTUB 3VBBA 4P75A 4YYEA 3ERRA 2DTOA 4HWSA 4RDXA 2ZT8A 4CS4A 1Z7NA 4G85A 2C7IA 2QHTA 4OP0A 4YRRA 5C52B 3HY0A 1HTTA 1H4QA 2ZXFA 2DTHA 1HXDA 4TVAB 1NJ6A 2ZZFA 4YRKA 3RKWA 1ADYA 1B70A 2RHQA 4KR2A 2ZTGA 4YROA 4XTUA 2QHSA 4RQEA 1E24A 3I7FA 4CS2A 2ZCEA 1N63C 3HFZA 3A7AA 5F5WA 3L2ZA 1BIAA 4KQEA 1B76A 4CS3A 4P71A 3A7UA 4H2XB 1B7YA 3BJUA 3MEYA 4TTVA 1X54A 2ZR2A 3NELA 3RKXA 3E9IA 3M4PA 2QHUA 4LVMA 2ODRC 3RACA 3E9HA 3EFRA 2I4LA 1SETA 2C8MA 4YRFA 3PZCA 3HXVA 5K1XA 1FO4A 1NYRA 5HGQA 3HXUA 5E3IA 1WQ7A 3HRDC 1B8AA 1VQZA 2Q5IA 3KFUA 4KR3A 3LSSA 2ZNJA 4HWRA 4O2DA 3EFSA 4H2WA 4K88A 4H2VA 4CH6A 3UGQA 4BWAA 4J15A 1ASZA 4TQFA 2PMEA 2ALYA 4H02A 4YRGA 1X01A 4LVKA 1FIQB 1QF6A 2ZZGA 2P5IA 2Q7HA 4XEOA 1J5WA 4WJ4A 1RM6B 2ZZEA 2EJFA 4HWTA 1PYSA 2DU5A 3QO7A 3MF2A 2ZR3A 1N9WA 1IL2A 5ELNA 1NJ5A 1YFTA 4H2TA 2DZCA 1B70B 3ICAA 4UP8A 2RHQB 2Q7EA 1L0WA 3UH0A 3RUXA 5C51B 3M4QA 4H2UA 4PG3A 1WNLA 3V8KA 4LVJA 3HFZB 1EVKA 3AMZA 2E10A 3HTZA 1ADJA 2ARSA 4LVIA 3DSQA 1B7YB 4HA8A 2ZGWA 3R07C 4TVWA 3A7RA 1SERA 2EAYA 2I4MA 2I4OA 3NETA 2RHSA 1NYQA 2ZT6A 4TWAA 3BFMA 2P0LA 1G5IA 1X55A 2CJAA 3RGLA 2DQ0A 3OD1A 2ZT7A 1EFWA 1HC7A 4HWOA 2I4NA 4YRCA 1NJ2A 3RIRA 3IG2A 1NNHA 3QNEA 1VDVA 3TEGA 3R07A 1V97A 1FFUC 2E3TA 2ALYB 1FYFA 3A31A 4K87A 1USYC 3FJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRP A;  1SRY A;  1BBW A;  2CJB A;  2EJG A;  2EWN A;  2ZIN A;  4XU3 A;  1PYS B;  1WYG A;  3VQW A;  4EX5 A;  4X5O A;  2E41 A;  4EO4 A;  3NVV B;  4P72 C;  3NVY B;  2E3C A;  3HY1 A;  1WPY A;  1N61 C;  4YCU A;  1G5H A;  1T3Q C;  2DDZ A;  2E64 A;  1E1T A;  1X56 A;  2QHV A;  2W3R A;  3ETR B;  3AM9 A;  4HVC A;  4CH5 A;  1EOV A;  1X2H A;  4RMF A;  4XTW A;  4YPF A;  1QE0 A;  1WQW A;  2ZT5 A;  3NEN A;  3MF1 A;  2CJ9 A;  2IY5 A;  1USY A;  4YRJ A;  1YB3 A;  4P3N A;  3VQY A;  4WF2 A;  1N60 C;  4TVY A;  1G51 A;  2RHS B;  3QTC A;  4UPA A;  2ODR D;  1EVL A;  3QO5 A;  3TEH A;  2DU7 A;  3A32 A;  1N5W C;  4H2Y A;  3G1Z A;  3HRI A;  2XTI A;  3LC0 A;  3TUP A;  4P72 A;  4CH4 A;  3NEM A;  3REU A;  3QO8 A;  2AKW A;  1SB3 B;  1H4T A;  4ZTZ B;  5G5H B;  2ART A;  3HXZ A;  5G5G B;  1YGB A;  3EUB 3;  3V8L A;  2DVE A;  1BBU A;  2DTI A;  2DXT A;  3UGT A;  5ELO A;  3LSQ A;  3PCO A;  2ARU A;  1Z7M A;  2DXU A;  2AMC A;  4UP9 A;  1YFR A;  3AN1 A;  4TQD A;  2EJ9 A;  3V7R A;  4P3P A;  4XTZ A;  1GGM A;  4DQ2 A;  3L1A A;  1EIY A;  4CH3 A;  3V7C A;  4YRT A;  5KNN A;  4OLF A;  1X2G A;  3L4G A;  4YP0 A;  1SES A;  3HFV A;  2CIM A;  3HRK A;  4P74 C;  3V7S A;  4YRL A;  4K86 A;  12AS A;  4Q15 A;  2J3L A;  2PMF A;  4RQF A;  3RL6 A;  2IY5 B;  4HWP A;  1W66 A;  3NS1 B;  1N62 C;  2Q5H A;  3IAL A;  3B9J B;  3UFG A;  3HXW A;  4YRS A;  3WQZ A;  4UP7 A;  3TEH B;  2J3M A;  2DJZ A;  4YRP A;  4LNS A;  3RF1 A;  1YFS A;  4BW9 A;  4E51 A;  4XTX A;  3VQV A;  3RKY A;  4XTV A;  3P8Y A;  3A5Z A;  1KMM A;  2AKW B;  1JJC A;  3VQX A;  2ZIO A;  1E22 A;  1LYL A;  4P74 A;  3HXY A;  4YRM A;  1N5X A;  3A5Y A;  2ZNI A;  1H4S A;  4XU2 A;  3PCO B;  4TVA A;  1ZXI C;  1JRO A;  2AMC B;  1KMN A;  4WI1 A;  3A74 A;  3NRZ B;  2W3S A;  3SR6 B;  4P73 C;  4YRI A;  4ZIB A;  1RIQ A;  2E1H A;  1EIY B;  5C53 B;  1WYD A;  4XTY A;  11AS A;  4YRE A;  4WJ3 M;  4H2X A;  1EQR A;  4H2S A;  4YCV A;  3L4G B;  1H4V B;  1BIB A;  2CGH A;  2E5A A;  3REX A;  4DPG A;  1KOG A;  2FYK A;  2DKG A;  3V8J A;  4G84 A;  4P75 C;  4PHC A;  4XEM A;  3IKM B;  4NCX A;  2DEQ A;  4YRN A;  2E65 A;  1WU7 A;  3CMQ A;  4YRQ A;  2EL9 A;  4AH6 A;  3NVZ B;  2Q7G A;  4YCW A;  1ATI A;  1C0A A;  4YDQ A;  1NJ8 A;  3P8V A;  3HXX A;  4P73 A;  4Q6G A;  4XU0 A;  4L87 A;  4ZOH B;  5K1P A;  2W55 A;  2HNI A;  3IKL A;  2DZ9 A;  1WLE A;  3NVW B;  4P3O A;  1FFV C;  3W3S A;  4XU1 A;  2ZIM A;  1JJC B;  2XGT A;  2DQ3 A;  2G4C A;  4P71 C;  3P8T A;  1NJ1 A;  1ASY A;  1E1O A;  2W54 A;  4ZTU B;  3VBB A;  4P75 A;  4YYE A;  3ERR A;  2DTO A;  4HWS A;  4RDX A;  2ZT8 A;  4CS4 A;  1Z7N A;  4G85 A;  2C7I A;  2QHT A;  4OP0 A;  4YRR A;  5C52 B;  3HY0 A;  1HTT A;  1H4Q A;  2ZXF A;  2DTH A;  1HXD A;  4TVA B;  1NJ6 A;  2ZZF A;  4YRK A;  3RKW A;  1ADY A;  1B70 A;  2RHQ A;  4KR2 A;  2ZTG A;  4YRO A;  4XTU A;  2QHS A;  4RQE A;  1E24 A;  3I7F A;  4CS2 A;  2ZCE A;  1N63 C;  3HFZ A;  3A7A A;  5F5W A;  3L2Z A;  1BIA A;  4KQE A;  1B76 A;  4CS3 A;  4P71 A;  3A7U A;  4H2X B;  1B7Y A;  3BJU A;  3MEY A;  4TTV A;  1X54 A;  2ZR2 A;  3NEL A;  3RKX A;  3E9I A;  3M4P A;  2QHU A;  2ODR C;  3RAC A;  3E9H A;  3EFR A;  2I4L A;  1SET A;  2C8M A;  4YRF A;  3PZC A;  3HXV A;  5K1X A;  1FO4 A;  1NYR A;  5HGQ A;  3HXU A;  5E3I A;  1WQ7 A;  3HRD C;  1B8A A;  1VQZ A;  2Q5I A;  3KFU A;  4KR3 A;  3LSS A;  2ZNJ A;  4HWR A;  4O2D A;  3EFS A;  4H2W A;  4K88 A;  4H2V A;  4CH6 A;  3UGQ A;  4BWA A;  4J15 A;  1ASZ A;  4TQF A;  2PME A;  2ALY A;  4H02 A;  4YRG A;  1X01 A;  1FIQ B;  1QF6 A;  2ZZG A;  2P5I A;  2Q7H A;  4XEO A;  1J5W A;  4WJ4 A;  1RM6 B;  2ZZE A;  2EJF A;  4HWT A;  1PYS A;  2DU5 A;  3QO7 A;  3MF2 A;  2ZR3 A;  1N9W A;  1IL2 A;  5ELN A;  1NJ5 A;  1YFT A;  4H2T A;  2DZC A;  1B70 B;  3ICA A;  4UP8 A;  2RHQ B;  2Q7E A;  1L0W A;  3UH0 A;  3RUX A;  5C51 B;  3M4Q A;  4H2U A;  4PG3 A;  1WNL A;  3V8K A;  3HFZ B;  1EVK A;  3AMZ A;  2E10 A;  3HTZ A;  1ADJ A;  2ARS A;  3DSQ A;  1B7Y B;  4HA8 A;  2ZGW A;  3R07 C;  4TVW A;  3A7R A;  1SER A;  2EAY A;  2I4M A;  2I4O A;  3NET A;  2RHS A;  1NYQ A;  2ZT6 A;  4TWA A;  3BFM A;  2P0L A;  1G5I A;  1X55 A;  2CJA A;  3RGL A;  2DQ0 A;  3OD1 A;  2ZT7 A;  1EFW A;  1HC7 A;  4HWO A;  2I4N A;  4YRC A;  1NJ2 A;  3RIR A;  3IG2 A;  1NNH A;  3QNE A;  1VDV A;  3TEG A;  3R07 A;  1V97 A;  1FFU C;  2E3T A;  2ALY B;  1FYF A;  3A31 A;  4K87 A;  1USY C;  3FJP A; 
#chains in the Genus database with same CATH topology
 1JRP A;  4DWD A;  1SRY A;  2GDQ A;  1BBW A;  2CJB A;  4DX3 A;  2OZ3 A;  2EJG A;  2EWN A;  3LXD A;  3QKE A;  3ZVI A;  2ZIN A;  4XU3 A;  1PYS B;  3R10 A;  1WYG A;  3VQW A;  4APN A;  4EX5 A;  1OEP A;  2PTW A;  2ZZC A;  1JOA A;  2E41 A;  4X5O A;  4EO4 A;  3NVV B;  4J56 A;  3PG6 A;  4P72 C;  1GRF A;  3NVY B;  2XH2 A;  2E3C A;  3HY1 A;  1WPY A;  1N61 C;  4YCU A;  1G5H A;  1T3Q C;  1GEU A;  2QJJ A;  2DDZ A;  3V3W A;  2E64 A;  5U1O A;  1E1T A;  1X56 A;  1YQZ A;  2QHV A;  5EBK A;  2W3R A;  3ETR B;  1H2I A;  3AM9 A;  4HVC A;  3T4W A;  1PDY A;  3DGZ A;  1EOV A;  4CH5 A;  3TWA A;  4GIR A;  1X2H A;  4RMF A;  3CK5 A;  1NDA A;  4XTW A;  2PTZ A;  1BQG A;  1TE6 A;  2OPJ A;  3EF6 A;  4J1O A;  4YPF A;  1QE0 A;  5FJO A;  2X8H A;  1WQW A;  1DNC A;  1FHU A;  3CXB A;  3QFA A;  4IT1 A;  4MMW A;  1NHS A;  4HN8 A;  2ZT5 A;  4NEV A;  2GGE A;  3ZVH B;  3NEN A;  3MF1 A;  2CJ9 A;  2IY5 A;  1USY A;  4YRJ A;  1YB3 A;  3MWC A;  4P3N A;  1ONF A;  3VQY A;  2OO6 A;  3CGD A;  2OG9 A;  1N60 C;  4TVY A;  3UXK A;  3VA8 A;  1G51 A;  2RHS B;  4WF2 A;  4EMJ A;  3QTC A;  1P48 A;  2OZT A;  3DH9 A;  4UPA A;  2ODR D;  1EVL A;  3QO5 A;  3TEH A;  5TR3 A;  2DU7 A;  3A32 A;  1NHQ A;  3LAD A;  2W0H A;  2HNE A;  4ZCW A;  2GH5 A;  1N5W C;  2BC0 A;  2GR2 A;  3L8K A;  3G1Z A;  3HRI A;  4H2Y A;  5FJU A;  1WUE A;  3VC5 A;  2XTI A;  3LC0 A;  3TUP A;  4P72 A;  2CDU A;  2DW6 A;  2WP5 A;  1MNS A;  1R6W A;  4EQW A;  4CH4 A;  2HZG A;  2WPF A;  3OW1 A;  4BV6 A;  3NEM A;  3REU A;  4K7Z A;  3QO8 A;  1MDL A;  1OJT A;  2PU1 A;  5FS7 A;  2PSN A;  3I6T A;  5EU9 A;  2AKW A;  1XAN A;  5KVI A;  6ENL A;  1SB3 B;  1H4T A;  1GRH A;  4ZTZ B;  5G5H B;  2ART A;  3HXZ A;  3DG6 A;  5G5G B;  1YGB A;  4DYE A;  3DDM A;  2AL2 A;  3EUB 3;  4HNL A;  2ZAD A;  3V8L A;  4FP1 A;  2GR1 A;  5JCK A;  2DVE A;  2MNR A;  1K4Q A;  3N6J A;  3OPS A;  1BBU A;  2DTI A;  2DXT A;  3UGT A;  4LA1 A;  3GD6 A;  2YVJ A;  3QLD A;  2PP1 A;  3UGV A;  3S5S A;  5IDZ A;  1D7Y A;  2GGJ A;  5ELO A;  3LSQ A;  4GR1 A;  3TJ4 A;  4A6G A;  3PCO A;  2JK6 A;  2HXT A;  1ELS A;  3DGB A;  3V5F A;  2ARU A;  3JW7 A;  3PWI A;  4KT2 A;  1Z7M A;  2AKZ A;  2DXU A;  1BZL A;  2P3Z A;  2AMC A;  4UP9 A;  2WOW A;  3OC4 A;  1YFR A;  2POD A;  1GRB A;  3IC9 A;  3AN1 A;  4H4X A;  3FVD A;  2EQ7 A;  3VFC A;  3CT2 A;  4TQD A;  2QVH A;  2EJ9 A;  3V7R A;  4P3P A;  3FV9 A;  4XTZ A;  3QTP A;  1GGM A;  4DQ2 A;  3L1A A;  1TZZ A;  1EIY A;  1MUC A;  1V59 A;  1FHV A;  4CH3 A;  1ZY8 A;  4H4Y A;  1MDR A;  3V7C A;  4YRT A;  1SJC A;  5KNN A;  4OLF A;  1X2G A;  3HPF A;  3RO6 A;  4KPR A;  5FJT A;  3L4G A;  1SES A;  4YP0 A;  4M0X A;  4HCL A;  3HFV A;  2CIM A;  4H1Z A;  1ZX9 A;  4H4V A;  1IYX A;  3ES8 A;  4J57 A;  3HRK A;  3EKG A;  4P74 C;  3V7S A;  2R9Z A;  1P43 A;  4YRL A;  3CGC A;  3RR1 A;  4K86 A;  2X8C A;  12AS A;  3R25 A;  1ZK7 A;  1EC9 A;  1LPF A;  4EMI A;  4G8T A;  2J3L A;  2PMF A;  4Q15 A;  4RQF A;  3SQS A;  4HCD A;  3NO1 A;  3RRA A;  1R0M A;  2YAU A;  3RL6 A;  2IY5 B;  4HWP A;  1W66 A;  1N62 C;  3NS1 B;  2Q5H A;  3IAL A;  1SJA A;  4BUR A;  3B9J B;  3Q6J A;  3UFG A;  3HXW A;  3JZU A;  2MUC A;  4YRS A;  3WQZ A;  4UP7 A;  3TEH B;  3RCY A;  2PGW A;  2V6O A;  4H4U A;  1AOG A;  3DEQ A;  2J3M A;  3ES7 A;  2A8X A;  3NFU A;  2DJZ A;  4M6U A;  4YRP A;  4EQR A;  1E9I A;  3PFR A;  4LNS A;  5JCN A;  3RF1 A;  3P3B A;  3SSZ A;  1YFS A;  4BW9 A;  4E51 A;  4E4F A;  4XTX A;  3BOX A;  3VQV A;  1JEH A;  3UCC A;  3H7V A;  3RKY A;  1KKR A;  4XTV A;  3P8Y A;  3A5Z A;  1GSN A;  2AAQ A;  2TPR A;  1KMM A;  2AKW B;  2BCP A;  1JJC A;  3VQX A;  2ZIO A;  3TQP A;  3TW9 A;  2RAB A;  1E22 A;  2F5Z A;  2POZ A;  4LII A;  2AL2 B;  1LYL A;  3PK7 A;  3Q45 A;  3VDG A;  4P74 A;  4E5T A;  3HXY A;  1N5X A;  4YRM A;  3A5Y A;  1F8W A;  2ZNI A;  1BKH A;  3MKC A;  1TYP A;  2YVG A;  5U25 A;  4XU2 A;  1H4S A;  4LVL A;  3PCO B;  1JPM A;  2J3N A;  4H4Q A;  4J3Z A;  4GME A;  1ECQ A;  1W6T A;  3TWB A;  4G7F A;  4HCH A;  4HPN A;  4EM4 A;  4TVA A;  1ZXI C;  3CGB A;  1JRO A;  1GXF A;  1XS2 A;  3UJF A;  4F4R A;  2AMC B;  4H4W A;  2OQY A;  4EM3 A;  1KMN A;  1EBD A;  3A74 A;  4WI1 A;  3D9X A;  2OFJ A;  3NRZ B;  3QN3 A;  1JPD X;  3R0K A;  4ADW A;  5FMH A;  2W3S A;  3OP2 A;  3SR6 B;  5GRT A;  4P73 C;  1F3P A;  2EQ6 A;  4YRI A;  3DG7 A;  3GRS A;  4K8D A;  5JRB A;  4ZIB A;  3DES A;  1RIQ A;  2E1H A;  1EIY B;  2C3C A;  5C53 B;  1WYD A;  1NHP A;  3VCN A;  4XTY A;  11AS A;  3GC2 A;  3D46 A;  3FCP A;  2NS6 A;  4YRE A;  4WJ3 M;  5JCL A;  1GRE A;  2DU5 A;  4H2X A;  2ZZB A;  2OZ8 A;  1EQR A;  2WOI A;  5JCI A;  4DNA A;  3R0U A;  2PA6 A;  4ZA0 A;  3R11 A;  3L4G B;  4H2S A;  1H4V B;  4YCV A;  1BIB A;  2CGH A;  2E5A A;  3REX A;  4DPG A;  5J04 A;  7ENL A;  1KOG A;  4IHC A;  4HT4 A;  2FYK A;  3TOY A;  2DKG A;  3V8J A;  2PU0 A;  1M6I A;  4G84 A;  4P75 C;  2WPE A;  2PTX A;  4PHC A;  2PMQ A;  4XEM A;  3IKM B;  4NCX A;  2DEQ A;  4YRN A;  2E65 A;  3ZLF A;  1WU7 A;  4YRQ A;  1MRA A;  3H4K A;  4HNC A;  4YWO A;  2EL9 A;  3UJS A;  2XH7 A;  4EMW A;  3HW2 A;  4AH6 A;  3SN4 A;  3NVZ B;  2Q7G A;  4YCW A;  1ATI A;  5JCM A;  2ZZ0 A;  1C0A A;  2PGE A;  3GD4 A;  1NJ8 A;  2X99 A;  4IP5 A;  3P8V A;  2CFY A;  3HXX A;  4P73 A;  4YDQ A;  1XHC A;  3MQZ A;  4H2H A;  3CGE A;  3IJI A;  3N6H A;  4Q6G A;  4XU0 A;  4L87 A;  3N4F A;  4ZOH B;  3TTE A;  5K1P A;  3IK4 A;  3UJE A;  2WPC A;  2XSX A;  1ZMC A;  2W55 A;  2HNI A;  3D47 A;  3IKL A;  2DZ9 A;  1WLE A;  3LB8 A;  3NVW B;  3EAN A;  5ENL A;  4E4U A;  1FFV C;  3KUM A;  3MQT A;  2A8E A;  4P3O A;  1GET A;  4XU1 A;  2CHR A;  2ZIM A;  3W3S A;  1JJC B;  4GIS A;  4ENL A;  2XGT A;  4A3R A;  2DQ3 A;  1FEB A;  1SJB A;  2G4C A;  3FXG A;  4P71 C;  2NQL A;  3JVA A;  3P8T A;  1KN0 A;  3CAW A;  1NJ1 A;  1ASY A;  3II4 A;  1NHR A;  3U9I A;  2PCE A;  2QDD A;  2OKT A;  2XGZ A;  3ZLH A;  4MKS A;  1E1O A;  2W54 A;  2P88 A;  4JN8 A;  3KLJ A;  4ZTU B;  3DFH A;  3VBB A;  4P75 A;  4YYE A;  3SBF A;  3ERR A;  5FJP A;  2DTO A;  4HWS A;  2GR0 A;  4RDX A;  3UJR A;  1ZDL A;  2ZT8 A;  1Z7N A;  4CS4 A;  3U4F A;  2BC1 A;  4E6M A;  4G85 A;  2C7I A;  1GER A;  3I6E A;  2QHT A;  4OP0 A;  3FG2 P;  4YRR A;  5C52 B;  1H6V A;  5ER0 A;  3HY0 A;  2AKM A;  1HTT A;  1H4Q A;  4X2P A;  2ZXF A;  1TKK A;  1HXD A;  2DTH A;  4IL0 A;  4GRT A;  2WOV A;  1NJ6 A;  4TVA B;  2ZZF A;  4YRK A;  3K1G A;  3RKW A;  2I5Q A;  2X50 A;  4H4Z A;  1ADY A;  1B70 A;  2RHQ A;  4KR2 A;  3O0H A;  4JN7 A;  2ZTG A;  4YRO A;  2V3B A;  4XTU A;  2FYM A;  2QHS A;  4RQE A;  3SQP A;  1E24 A;  2QAE A;  2QJM A;  3I4K A;  3I7F A;  4CS2 A;  5BOF A;  4KWS A;  2ZCE A;  1XDI A;  1N63 C;  4HYR A;  3HFZ A;  1FEC A;  4Z1Y A;  3A7A A;  5F5W A;  3L2Z A;  3T8Q A;  1BIA A;  4KQE A;  1B76 A;  4CS3 A;  4P71 A;  3A7U A;  3ENL A;  4H4R A;  4H2X B;  1B7Y A;  3BJU A;  1EBG A;  4K8G A;  3MEY A;  4TTV A;  1X54 A;  2ZR2 A;  3NEL A;  4KEM A;  3RKX A;  2HQM A;  3DK4 A;  2NPX A;  3E9I A;  3M4P A;  2QHU A;  4LVM A;  2ODR C;  2XH4 A;  1ZKQ A;  2PPG A;  3E9H A;  3RAC A;  1KD0 A;  3EFR A;  4NEW A;  4IL2 A;  3FYY A;  2I4L A;  1SET A;  2C8M A;  3BJS A;  4M52 A;  4ROP A;  2C3D A;  2PP0 A;  4YRF A;  3PZC A;  3NZG A;  3HXV A;  3FJP A;  4EQX A;  5K1X A;  1NEL A;  1FO4 A;  1NYR A;  5HGQ A;  2GRT A;  3BSM A;  3HXU A;  3EEZ A;  5E3I A;  4H4P A;  3CB3 A;  4EWJ A;  1WQ7 A;  2GGG A;  3HRD C;  1VQZ A;  3UJ2 A;  1B8A A;  3L5O A;  2Q5I A;  2NVK X;  3KFU A;  4K1W A;  4KR3 A;  1STZ A;  1EC8 A;  3MUC A;  4JHM A;  3CYJ A;  1EC7 A;  3LSS A;  2ZNJ A;  4HWR A;  2GR3 A;  5KVH A;  3GRT A;  3IJQ A;  3EFS A;  4GGH A;  4H2W A;  4O2D A;  4K88 A;  4H83 A;  4H2V A;  4FDC B;  4CH6 A;  1ZMD A;  3UGQ A;  3QFB A;  1RVK A;  3UXL A;  1FEA A;  2V3A A;  3FJ4 A;  3STP A;  3H12 A;  4BWA A;  2GQW A;  1KKO A;  4J15 A;  2OLA A;  2PS2 A;  2RDX A;  2ZC8 A;  4IP4 A;  2PP3 A;  3UCD A;  4E8G A;  2ALY A;  4TQF A;  2PME A;  4GGB A;  1WUF A;  3DJG X;  4H19 A;  2OVL A;  1TYT A;  1JDF A;  3TCS A;  4H02 A;  4YRG A;  1X01 A;  1EBH A;  4LVK A;  2GGH A;  1FIQ B;  1QF6 A;  2YQU A;  1DXL A;  3DIP A;  4H50 A;  2EQ9 A;  4GYP C;  3RGT A;  2X8G A;  1J5W A;  2P5I A;  2Q7H A;  2ZZG A;  4XEO A;  4WJ4 A;  1RM6 B;  2ZZE A;  3URH A;  2EJF A;  2WBA A;  3SN0 A;  3OZM A;  3VCC A;  1PYS A;  3DFY A;  4HWT A;  2OX4 A;  3IJL A;  1YEY A;  3QO7 A;  1XPY A;  3MF2 A;  2OQH A;  2ZR3 A;  2YVF A;  1N9W A;  1IL2 A;  1JCT A;  2ONE A;  1NJ5 A;  1YFT A;  2DZC A;  1B70 B;  3ICA A;  4H2T A;  2RHQ B;  4UP8 A;  1L0W A;  2Q7E A;  3UH0 A;  3NXL A;  3RUX A;  2P8C A;  5C51 B;  3M4Q A;  4H2U A;  4PG3 A;  4H4S A;  1WNL A;  3V8K A;  4LVJ A;  3OTR A;  3MY9 A;  3HFZ B;  5ELN A;  1EVK A;  2FKP A;  3SJN A;  2HXU A;  3AMZ A;  3DK8 A;  3RNM A;  1GV4 A;  2E10 A;  3TJI A;  4Z17 A;  1GES A;  5FJR A;  3V5C A;  1ADJ A;  2ARS A;  3HTZ A;  3DSQ A;  3GO2 A;  4IZG A;  3SN1 A;  4A35 A;  1B7Y B;  4LVI A;  4JQ9 A;  3V4B A;  2QJN A;  4HA8 A;  2ZGW A;  3R07 C;  4TVW A;  3A7R A;  3ZVH A;  1S7M A;  4K2S A;  5FS8 A;  4DHG A;  1PDZ A;  1SER A;  1KCZ A;  2QGY A;  3DG3 A;  2EAY A;  1LVL A;  2GSH A;  2I4M A;  4DN1 A;  2I4O A;  2O56 A;  2EQ8 A;  3GY1 A;  5BOE A;  3NET A;  1Q1W A;  2RHS A;  4KPL A;  4FX9 A;  4GYP A;  1NYQ A;  2ZT6 A;  1DTN A;  4TWA A;  3CXO A;  3H8A A;  3DGH A;  1GRA A;  4GFI A;  3BFM A;  2P0L A;  1Q1R A;  2DW7 A;  3ZLG A;  1SJD A;  1G5I A;  2QQ6 A;  1NPX A;  4JDR A;  1X55 A;  1ONE A;  1MO9 A;  3DK9 A;  3DJJ A;  3Q4D A;  2CJA A;  3P0W A;  3B97 A;  3THU A;  3QPE A;  3DER A;  3P93 A;  3RIT A;  3RGL A;  3PWG A;  1BWC A;  4DXK A;  2DQ0 A;  4FI4 A;  3OD1 A;  2ZT7 A;  1MOK A;  3T6C A;  3R1Z A;  1EFW A;  1NU5 A;  5FS9 A;  3S47 A;  1HC7 A;  1F9C A;  3H70 A;  4HWO A;  3GD3 A;  3N4E A;  2I4N A;  4YRC A;  1NJ2 A;  2QDE A;  3RIR A;  2AL1 A;  2XH0 A;  3IG2 A;  2P0I A;  3MSY A;  1NNH A;  3OZY A;  3VC6 A;  3QNE A;  2PTY A;  1VDV A;  3TEG A;  1ASZ A;  3EAO A;  3R07 A;  1GRT A;  3T9P A;  4MGG A;  1L8P A;  1V97 A;  4YWS A;  2GGI A;  4EQS A;  2GL5 A;  3MZN A;  4H4T A;  1FFU C;  2E3T A;  2ALY B;  2P8B A;  1FYF A;  1GRG A;  2WP6 A;  3A31 A;  4K87 A;  1USY C;  5FS6 A;  3CMQ A; 
#chains in the Genus database with same CATH homology
 1JRP A;  1SRY A;  1BBW A;  2CJB A;  2EJG A;  2EWN A;  2ZIN A;  4XU3 A;  1PYS B;  1WYG A;  3VQW A;  4EX5 A;  4X5O A;  2E41 A;  4EO4 A;  3NVV B;  4P72 C;  3NVY B;  2E3C A;  3HY1 A;  1WPY A;  1N61 C;  4YCU A;  1G5H A;  1T3Q C;  2DDZ A;  2E64 A;  1E1T A;  1X56 A;  2QHV A;  2W3R A;  3ETR B;  3AM9 A;  4HVC A;  4CH5 A;  1EOV A;  1X2H A;  4RMF A;  4XTW A;  4YPF A;  1QE0 A;  1WQW A;  2ZT5 A;  3NEN A;  3MF1 A;  2CJ9 A;  2IY5 A;  1USY A;  4YRJ A;  1YB3 A;  4P3N A;  3VQY A;  4WF2 A;  1N60 C;  4TVY A;  1G51 A;  2RHS B;  3QTC A;  4UPA A;  2ODR D;  1EVL A;  3QO5 A;  3TEH A;  2DU7 A;  3A32 A;  1N5W C;  4H2Y A;  3G1Z A;  3HRI A;  2XTI A;  3LC0 A;  3TUP A;  4P72 A;  4CH4 A;  3NEM A;  3REU A;  3QO8 A;  2AKW A;  1SB3 B;  1H4T A;  4ZTZ B;  5G5H B;  2ART A;  3HXZ A;  5G5G B;  1YGB A;  3EUB 3;  3V8L A;  2DVE A;  1BBU A;  2DTI A;  2DXT A;  3UGT A;  5ELO A;  3LSQ A;  3PCO A;  2ARU A;  1Z7M A;  2DXU A;  2AMC A;  4UP9 A;  1YFR A;  3AN1 A;  4TQD A;  2EJ9 A;  3V7R A;  4P3P A;  4XTZ A;  1GGM A;  4DQ2 A;  3L1A A;  1EIY A;  4CH3 A;  3V7C A;  4YRT A;  5KNN A;  4OLF A;  1X2G A;  3L4G A;  4YP0 A;  1SES A;  3HFV A;  2CIM A;  3HRK A;  4P74 C;  3V7S A;  4YRL A;  4K86 A;  12AS A;  4Q15 A;  2J3L A;  2PMF A;  4RQF A;  3RL6 A;  2IY5 B;  4HWP A;  1W66 A;  3NS1 B;  1N62 C;  2Q5H A;  3IAL A;  3B9J B;  3UFG A;  3HXW A;  4YRS A;  3WQZ A;  4UP7 A;  3TEH B;  2J3M A;  2DJZ A;  4YRP A;  4LNS A;  3RF1 A;  1YFS A;  4BW9 A;  4E51 A;  4XTX A;  3VQV A;  3RKY A;  4XTV A;  3P8Y A;  3A5Z A;  1KMM A;  2AKW B;  1JJC A;  3VQX A;  2ZIO A;  1E22 A;  1LYL A;  4P74 A;  3HXY A;  4YRM A;  1N5X A;  3A5Y A;  2ZNI A;  1H4S A;  4XU2 A;  4LVL A;  3PCO B;  4TVA A;  1ZXI C;  1JRO A;  2AMC B;  1KMN A;  4WI1 A;  3A74 A;  3NRZ B;  2W3S A;  3SR6 B;  4P73 C;  4YRI A;  4ZIB A;  1RIQ A;  2E1H A;  1EIY B;  5C53 B;  1WYD A;  4XTY A;  11AS A;  4YRE A;  2NS6 A;  4WJ3 M;  4H2X A;  1EQR A;  4H2S A;  4YCV A;  3L4G B;  1H4V B;  1BIB A;  2CGH A;  2E5A A;  3REX A;  4DPG A;  1KOG A;  4HT4 A;  2FYK A;  2DKG A;  3V8J A;  4G84 A;  4P75 C;  4PHC A;  4XEM A;  3IKM B;  4NCX A;  2DEQ A;  4YRN A;  2E65 A;  1WU7 A;  3CMQ A;  4YRQ A;  2EL9 A;  4AH6 A;  3NVZ B;  2Q7G A;  4YCW A;  1ATI A;  1C0A A;  4YDQ A;  1NJ8 A;  3P8V A;  3HXX A;  4P73 A;  3MQZ A;  4Q6G A;  4XU0 A;  4L87 A;  4ZOH B;  5K1P A;  2W55 A;  2HNI A;  3IKL A;  2DZ9 A;  1WLE A;  3NVW B;  2A8E A;  4P3O A;  1FFV C;  3W3S A;  4XU1 A;  2ZIM A;  1JJC B;  2XGT A;  2DQ3 A;  2G4C A;  4P71 C;  3P8T A;  1NJ1 A;  1ASY A;  1E1O A;  2W54 A;  4ZTU B;  3VBB A;  4P75 A;  4YYE A;  3ERR A;  2DTO A;  4HWS A;  4RDX A;  2ZT8 A;  4CS4 A;  1Z7N A;  4G85 A;  2C7I A;  2QHT A;  4OP0 A;  4YRR A;  5C52 B;  3HY0 A;  1HTT A;  1H4Q A;  2ZXF A;  2DTH A;  1HXD A;  4TVA B;  1NJ6 A;  2ZZF A;  4YRK A;  3RKW A;  1ADY A;  1B70 A;  2RHQ A;  4KR2 A;  2ZTG A;  4YRO A;  4XTU A;  2QHS A;  4RQE A;  1E24 A;  3I7F A;  4CS2 A;  2ZCE A;  1N63 C;  3HFZ A;  3A7A A;  5F5W A;  3L2Z A;  1BIA A;  4KQE A;  1B76 A;  4CS3 A;  4P71 A;  3A7U A;  4H2X B;  1B7Y A;  3BJU A;  3MEY A;  4TTV A;  1X54 A;  2ZR2 A;  3NEL A;  3RKX A;  3E9I A;  3M4P A;  2QHU A;  4LVM A;  2ODR C;  3RAC A;  3E9H A;  3EFR A;  2I4L A;  1SET A;  2C8M A;  4YRF A;  3PZC A;  3HXV A;  5K1X A;  1FO4 A;  1NYR A;  5HGQ A;  3HXU A;  5E3I A;  1WQ7 A;  3HRD C;  1B8A A;  1VQZ A;  2Q5I A;  3KFU A;  4KR3 A;  3LSS A;  2ZNJ A;  4HWR A;  4O2D A;  3EFS A;  4H2W A;  4K88 A;  4H2V A;  4CH6 A;  3UGQ A;  4BWA A;  4J15 A;  1ASZ A;  4TQF A;  2PME A;  2ALY A;  4H02 A;  4YRG A;  1X01 A;  4LVK A;  1FIQ B;  1QF6 A;  2ZZG A;  2P5I A;  2Q7H A;  4XEO A;  1J5W A;  4WJ4 A;  1RM6 B;  2ZZE A;  2EJF A;  4HWT A;  1PYS A;  2DU5 A;  3QO7 A;  3MF2 A;  2ZR3 A;  1N9W A;  1IL2 A;  5ELN A;  1NJ5 A;  1YFT A;  4H2T A;  2DZC A;  1B70 B;  3ICA A;  4UP8 A;  2RHQ B;  2Q7E A;  1L0W A;  3UH0 A;  3RUX A;  5C51 B;  3M4Q A;  4H2U A;  4PG3 A;  1WNL A;  3V8K A;  4LVJ A;  3HFZ B;  1EVK A;  3AMZ A;  2E10 A;  3HTZ A;  1ADJ A;  2ARS A;  4LVI A;  3DSQ A;  1B7Y B;  4HA8 A;  2ZGW A;  3R07 C;  4TVW A;  3A7R A;  1SER A;  2EAY A;  2I4M A;  2I4O A;  3NET A;  2RHS A;  1NYQ A;  2ZT6 A;  4TWA A;  3BFM A;  2P0L A;  1G5I A;  1X55 A;  2CJA A;  3RGL A;  2DQ0 A;  3OD1 A;  2ZT7 A;  1EFW A;  1HC7 A;  4HWO A;  2I4N A;  4YRC A;  1NJ2 A;  3RIR A;  3IG2 A;  1NNH A;  3QNE A;  1VDV A;  3TEG A;  3R07 A;  1V97 A;  1FFU C;  2E3T A;  2ALY B;  1FYF A;  3A31 A;  4K87 A;  1USY C;  3FJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...