3A7UA

Crystal structure of the bovine lipoyltransferase in its unliganded form
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
343
structure length
325
Chain Sequence
b'GLILQSISNDVYHNLAVEDWIHDHMNLEGKPVLFLWRNSPTVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLVVRALKAVHPHLDVQATKRFDLLLDGQFKISGTASKIGRNAAYHHCTLLCGTDGTFLSSLLKKNLMEKDPTLTCEVVINAVATEYATSHQIDNHIHLINPTDETVFPGINSKAIELQTWEWIYGKTPKFSVDTSFTVLHEQSHVEIKVFIDVKNGRIEVCNIEAPDHWLPLEICDQLNSSLIGSKFSPIETTVLTSILHRTYPGDDELHSKWNILCEKIKGIM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoyltransferase 1, mitochondrial
publication title Global conformational change associated with the two-step reaction catalyzed by Escherichia coli lipoate-protein ligase A.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 84
structure length 325
sequence length 343
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 3a7uA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3a7uA01
5K1XA 4H02A 4XEOA 3W3SA 1VDVA 4YRFA 1JJCB 4P3OA 2DDZA 3RKYA 3NRZB 1WPYA 1EIYB 2DU5A 4YRPA 4XTYA 4L87A 1BBWA 1EFWA 2I4NA 3NS1B 2ZNJA 4WJ3M 3DSQA 2IY5A 2QHSA 2DQ3A 1YFSA 4UPAA 4HWSA 1J5WA 4AH6A 1X2GA 1B70A 2I4OA 3B9JB 1SETA 2DEQA 2XGTA 1T3QC 1N9WA 2IY5B 4CH5A 2ZTGA 2DTOA 1JROA 4TWAA 4BWAA 1BBUA 3RKXA 2E41A 4CH6A 3NVVB 3NVYB 4E51A 2J3LA 2P0LA 4XU0A 2DVEA 3HY1A 3MEYA 3OD1A 1B70B 1FIQB 2ZNIA 1SERA 4XTUA 2J3MA 4YRRA 3HY0A 3VQVA 4YDQA 1YFRA 3QNEA 5HGQA 4HWPA 2Q7EA 4P72A 2CJ9A 3R07A 2DZCA 4PG3A 4XU2A 1YFTA 1H4QA 2EJ9A 1E22A 2ZT7A 3A5ZA 4H2TA 1KMNA 4P3NA 4BW9A 4YRKA 1USYA 5C53B 5KNNA 2ODRC 3HXZA 1N5WC 3VBBA 3UFGA 4ZTZB 3IG2A 1JRPA 3PCOA 1WLEA 3E9IA 3I7FA 4H2YA 3AM9A 2ZR3A 3HXWA 4UP9A 2EAYA 1YB3A 3PCOB 4CS4A 3MF1A 4YRQA 2C8MA 2Q7HA 2Q5HA 1H4VB 4J15A 5G5HB 5K1PA 1NNHA 3REXA 3VQWA 4YP0A 3HXUA 2ODRD 4KR2A 2ZGWA 4YRMA 1WQWA 3RIRA 2QHUA 2CGHA 2ZZEA 1Z7NA 2E65A 1L0WA 4UP7A 4YYEA 1RM6B 1ADYA 4H2WA 2P5IA 4YROA 4G84A 4ZTUB 1WYGA 2I4LA 1EQRA 4P71C 3CMQA 1WYDA 1SESA 12ASA 3P8YA 1C0AA 1X56A 3EFSA 4PHCA 3HXVA 3V8KA 3ICAA 3L1AA 4YPFA 4Q6GA 2DQ0A 3P8TA 1WQ7A 4K86A 2E1HA 4YCUA 4YRIA 4HWRA 3QO7A 4WI1A 1X55A 3NVZB 4H2SA 1B7YA 3EFRA 2CIMA 2ZINA 1BIBA 1ZXIC 1X54A 4XTWA 2E3CA 2Q5IA 3QTCA 3BFMA 5ELNA 4TVWA 1N61C 1RIQA 4P74A 3RL6A 4LNSA 1E24A 1B7YB 4UP8A 3G1ZA 2I4MA 4ZIBA 4RQEA 1B76A 1KMMA 3AN1A 4YRJA 4XTZA 1NJ2A 1PYSA 2EJGA 4P75A 1HC7A 4XTVA 1NJ1A 3NELA 4YRCA 4YRNA 4WJ4A 2DTHA 2C7IA 4P73A 4G85A 3KFUA 3UGTA 2CJAA 1PYSB 4HWTA 4H2UA 3V8LA 3HXYA 3A32A 3IKLA 2ZT8A 1G5HA 2QHVA 2PMEA 3M4QA 2QHTA 1ATIA 2AMCA 3HFVA 3V7SA 2W54A 2W3RA 1X01A 4DPGA 4P72C 3SR6B 3RF1A 3ETRB 5ELOA 1E1TA 3R07C 2Q7GA 4TTVA 1ASZA 2HNIA 2AMCB 4XTXA 4P3PA 2ZR2A 1V97A 1USYC 2G4CA 4RDXA 2DXUA 3HTZA 3L2ZA 3LC0A 1WU7A 1X2HA 3LSSA 4O2DA 3A7UA 3E9HA 2W55A 3HRDC 4TVYA 2E3TA 1JJCA 4NCXA 2E5AA 3ERRA 4XEMA 1EVLA 3A7RA 4K87A 3QO5A 4CS2A 3HXXA 3HFZA 1FFUC 1N62C 1WNLA 3UGQA 2DZ9A 1N63C 4OP0A 3REUA 2ARTA 3RGLA 3TUPA 3QO8A 3NENA 1QE0A 1H4TA 3IKMB 1FFVC 4TVAA 3HFZB 2ARSA 4H2VA 3BJUA 1KOGA 3VQYA 4YRTA 4KQEA 1E1OA 3A7AA 3FJPA 2ZZFA 2W3SA 3NEMA 1G5IA 4CS3A 4XU1A 1SRYA 3A74A 4TVAB 2RHSA 1VQZA 4H2XA 1FO4A 1B8AA 2EL9A 1G51A 4YCVA 3V8JA 2AKWA 1NYQA 4EX5A 4XU3A 4K88A 2XTIA 3HRIA 4TQFA 2ALYA 3TEHA 3A31A 1QF6A 2RHSB 4H2XB 1HXDA 1FYFA 4X5OA 3RKWA 1ASYA 1NJ8A 1H4SA 4ZOHB 4HWOA 2AKWB 3M4PA 1N5XA 1EOVA 2EJFA 3VQXA 5C52B 3HRKA 4HVCA 1Z7MA 3WQZA 5G5GB 4EO4A 3P8VA 2ALYB 3TEHB 4RQFA 3NETA 4YCWA 1EVKA 4DQ2A 2ZXFA 1W66A 2PMFA 1ADJA 2DKGA 1BIAA 4P74C 1SB3B 1HTTA 5E3IA 2ZZGA 1GGMA 4WF2A 2DXTA 2ZT6A 3A5YA 3V7CA 3AMZA 1YGBA 4P75C 3TEGA 2DTIA 2ZIMA 4YRLA 1NJ6A 4YRSA 4P73C 2FYKA 3PZCA 4Q15A 2ZCEA 2EWNA 3EUB3 4HA8A 2DU7A 2ARUA 3V7RA 4CH3A 2RHQA 2ZT5A 4YREA 4OLFA 5C51B 3L4GA 2DJZA 4KR3A 3LSQA 4P71A 3RUXA 1N60C 2E64A 1IL2A 1NYRA 3RACA 1NJ5A 2ZIOA 3NVWB 2RHQB 2E10A 4RMFA 3L4GB 2CJBA 4CH4A 11ASA 1EIYA 3IALA 3UH0A 5F5WA 3MF2A 4TQDA 4YRGA 1LYLA
chains in the Genus database with same CATH superfamily
5K1XA 1ELSA 4H02A 1GRBA 4XEOA 3W3SA 2C3DA 2CHRA 3TWBA 1VDVA 2QVHA 3PFRA 4YRFA 1JJCB 4P3OA 2DDZA 4DXKA 3T8QA 3H7VA 3RKYA 3DG7A 3DDMA 1NHPA 3OZYA 3NRZB 1WPYA 1EIYB 3H70A 2DU5A 2ZC8A 4YRPA 2PTXA 4HNLA 4JN8A 4XTYA 3TTEA 4L87A 1GRTA 4H4XA 1BBWA 1EFWA 4K1WA 5FJUA 3RRAA 3FV9A 2I4NA 3BOXA 3DIPA 2HXUA 3NS1B 4KEMA 2ZNJA 3DJJA 4WJ3M 3DSQA 2IY5A 3P0WA 2I5QA 2QHSA 2GSHA 2PGWA 3OP2A 3P93A 4MGGA 2DQ3A 5FS7A 4IP4A 3GD3A 1YFSA 4EMWA 4J3ZA 1STZA 4NEWA 2RDXA 2GGIA 4UPAA 4HWSA 1J5WA 4H1ZA 4KPLA 2QAEA 4AH6A 1X2GA 1B70A 4FDCB 3V5FA 2I4OA 3B9JB 1SETA 2DEQA 2XGTA 1T3QC 2YVJA 2XSXA 1N9WA 2IY5B 4CH5A 2AL1A 3MSYA 2ZTGA 1SJBA 1JROA 3FXGA 3SN4A 2DTOA 4TWAA 2YQUA 4BWAA 5FJRA 3JW7A 2HNEA 1BBUA 3RKXA 2E41A 4CH6A 3NVYB 3NVVB 4E51A 2J3LA 2P0LA 2WPFA 2DVEA 4XU0A 1S7MA 1PDZA 3T6CA 3HY1A 1V59A 3MEYA 1H2IA 3OD1A 1B70B 1FIQB 4Z17A 5J04A 2ZNIA 1SERA 2PSNA 4XTUA 2J3MA 4YRRA 3HY0A 2AKZA 3EF6A 3SQPA 3VQVA 1JPMA 4YDQA 5JCKA 1YFRA 3QNEA 2CDUA 5HGQA 1NHQA 4HWPA 2Q7EA 4P72A 4G7FA 4K2SA 2CJ9A 3R0UA 3R07A 4M52A 2DZCA 4PG3A 4LA1A 1M6IA 3VCCA 2QDEA 4XU2A 1YFTA 4E4UA 1H4QA 2EJ9A 3H8AA 2OLAA 1MDRA 1E22A 2ZT7A 2RABA 2XH4A 3A5ZA 1KMNA 4H2TA 4P3NA 2GGJA 4BW9A 3II4A 3OW1A 1USYA 4YRKA 3NZGA 5C53B 5KNNA 2ODRC 4IHCA 2V6OA 3N6HA 3OPSA 3LXDA 1BZLA 3HXZA 1N5WC 3R1ZA 3UFGA 3VBBA 4ZTZB 3IG2A 1JRPA 3PCOA 3QN3A 1WLEA 2A8XA 4H4PA 1F3PA 3E9IA 4GYPA 1NHRA 3I7FA 4H2YA 3AM9A 2BCPA 1BQGA 1EBHA 7ENLA 2ZR3A 3HXWA 4UP9A 4FI4A 2EAYA 2P0IA 3CYJA 1NDAA 4ZCWA 3QFAA 1EBGA 3FJ4A 1YB3A 3IJLA 1NU5A 3PCOB 3MF1A 4YRQA 4CS4A 3N4EA 2C8MA 2Q7HA 2Q5HA 3PWGA 1H4VB 4K8GA 4J15A 5G5HB 2OQYA 5K1PA 1GSNA 2J3NA 3GY1A 4YWSA 1NNHA 3MQZA 2DW7A 1ONFA 2WBAA 1R0MA 3DK9A 2ONEA 4MKSA 3DK8A 3DGHA 3REXA 3VQWA 2GGGA 4NEVA 4YP0A 3T4WA 3L8KA 3HXUA 2ODRD 2HQMA 2A8EA 3CXOA 2P3ZA 3IJQA 2ZGWA 4YRMA 4KR2A 1WQWA 3RIRA 4JN7A 5FJTA 2QHUA 2CGHA 4GISA 2ZZEA 4H2HA 1Z7NA 3D46A 2OKTA 2E65A 5EBKA 1L0WA 4HN8A 1GV4A 1FHVA 1DTNA 4UP7A 4YYEA 1TYTA 5JCMA 2GQWA 2O56A 4GR1A 4K8DA 1RM6B 3CB3A 3QKEA 3DG6A 1ADYA 1D7YA 2QJMA 1TYPA 4H2WA 4HCLA 2P5IA 4YROA 4G84A 2NPXA 4ZTUB 1WYGA 3MKCA 3S47A 2JK6A 1EQRA 4H4VA 3T9PA 3I6EA 3Q4DA 2I4LA 4P71C 3CMQA 1GETA 1WYDA 1GRAA 1SESA 4IL0A 5KVIA 12ASA 3P8YA 1SJCA 5U1OA 1C0AA 1X56A 3TOYA 3FCPA 3EFSA 4PHCA 4J56A 2FKPA 3DFHA 3HXVA 4H4YA 1EC9A 3V8KA 3QTPA 3MZNA 4GGBA 3CT2A 2GL5A 4Z1YA 2OZTA 3CGDA 3QPEA 3ICAA 3L1AA 2WPEA 4YPFA 3R25A 3U4FA 4Q6GA 2GR1A 1YEYA 2DQ0A 3TWAA 2WOIA 3RCYA 1WQ7A 3P8TA 4EMJA 3SN1A 4K86A 2E1HA 4LVMA 2GGEA 4YCUA 4YRIA 5FMHA 4G8TA 2PTZA 3UJ2A 2MNRA 3QO7A 4HWRA 1X55A 4WI1A 2P88A 3NVZB 4H2SA 1JPDX 2FYMA 1B7YA 4M6UA 5IDZA 3EFRA 1BKHA 1GRHA 1ZKQA 5BOFA 2CIMA 2ZINA 3ZVHA 2YVGA 1BIBA 1ZXIC 1MUCA 1X54A 3UJEA 4XTWA 1KKOA 2E3CA 1IYXA 3GC2A 2Q5IA 3IC9A 5TR3A 3QTCA 3H4KA 1TE6A 4M0XA 3BFMA 2OO6A 2PTWA 4TVWA 5ELNA 2WP5A 3DEQA 1N61C 1RIQA 4P74A 2AKMA 4GIRA 3RNMA 3TJIA 2PPGA 3TQPA 4LNSA 1LVLA 3IJIA 3V5CA 1E24A 4BV6A 3TW9A 1MDLA 1B7YB 4UP8A 2OVLA 1TZZA 3G1ZA 3DFYA 4ENLA 2I4MA 1FEBA 4IP5A 5GRTA 3ZVHB 4APNA 4ZIBA 4RQEA 2ZZCA 1SJDA 1B76A 1KMMA 3AN1A 3LADA 4YRJA 3DGZA 4BURA 3THUA 3JVAA 1NJ2A 1PYSA 4XTZA 2EJGA 1GRFA 4P75A 1HC7A 4XTVA 3URHA 1NJ1A 3V4BA 3NELA 2ZZBA 4YRCA 4YRNA 2OG9A 5FS9A 4WJ4A 2GH5A 4FP1A 4HPNA 2C7IA 2DTHA 5FS8A 4G85A 4P73A 3NXLA 3R11A 1EC8A 4A35A 2X50A 1WUFA 3VFCA 1EC7A 2GR2A 4HT4A 4LVIA 2TPRA 2X99A 3OC4A 1KKRA 1ONEA 3PG6A 2BC1A 1FHUA 1GEUA 3NFUA 3KFUA 2QGYA 3UGTA 1JCTA 4JDRA 2CJAA 3ZVIA 1PYSB 1GREA 4HWTA 4H2UA 3DK4A 4FX9A 3V8LA 5FJOA 3HXYA 1XPYA 2WOWA 3QLDA 3A32A 2OZ3A 5EU9A 3IKLA 3FG2P 3OZMA 1L8PA 3GRSA 4H4ZA 2YVFA 2ZT8A 2PS2A 2QDDA 1G5HA 2QHVA 2PMEA 3M4QA 2X8GA 2GR0A 4J57A 3DJGX 1ATIA 2AMCA 2QHTA 3HFVA 2XH0A 3V7SA 4GFIA 2W54A 4HNCA 2W3RA 4YWOA 1X01A 4DPGA 3OTRA 4P72C 3SR6B 3RF1A 4LIIA 3ZLFA 2NS6A 3ETRB 5ELOA 2V3AA 1E1TA 3DGBA 1ZDLA 1ZX9A 3R07C 2HXTA 2Q7GA 4LVLA 1Q1WA 3EKGA 4TTVA 3UJFA 1ASZA 1Q1RA 2GGHA 3MUCA 2HNIA 2AMCB 4DWDA 4XTXA 5JCNA 4P3PA 3K1GA 2ZR2A 3P3BA 2WOVA 1H6VA 1OEPA 1V97A 1USYC 1GESA 2G4CA 4RDXA 2DXUA 3HTZA 1MOKA 3CK5A 1MNSA 2P8BA 3L2ZA 1ZMCA 4F4RA 1WUEA 3LC0A 1NELA 4KT2A 4J1OA 1WU7A 2MUCA 2OX4A 3DH9A 4EWJA 3UGVA 1XANA 2BC0A 1FECA 4GYPC 1X2HA 3VCNA 4EQXA 1NPXA 3LSSA 2ZZ0A 4O2DA 1RVKA 3ENLA 3A7UA 2HZGA 3DESA 3FVDA 5JCLA 3E9HA 2W55A 3HRDC 4TVYA 4IL2A 4HCDA 2E3TA 3TCSA 1JJCA 4IZGA 2F5ZA 2PP3A 4NCXA 3Q45A 2E5AA 2NQLA 3I4KA 3ERRA 4XEMA 1DNCA 1EVLA 3A7RA 3D9XA 1E9IA 3RITA 2QQ6A 2X8CA 3QO5A 4X2PA 1KCZA 4H4QA 4K87A 3HXXA 5KVHA 3CGCA 4CS2A 3MQTA 3IK4A 3VDGA 4A6GA 3HFZA 1FFUC 3MY9A 3R0KA 1R6WA 2X8HA 1JOAA 4GGHA 1N62C 1WNLA 1TKKA 3UGQA 3B97A 1LPFA 1OJTA 1N63C 2DZ9A 4OP0A 3REUA 2ARTA 3STPA 3RGLA 1P48A 2P8CA 3TUPA 3QO8A 4EM4A 3QFBA 3NENA 3HPFA 2EQ8A 4ZA0A 3MWCA 1QE0A 5ER0A 1H4TA 3NO1A 3HW2A 1FFVC 6ENLA 3IKMB 4TVAA 3HFZB 3CGBA 2OFJA 2ARSA 4H2VA 1XDIA 3BJUA 1YQZA 3ZLGA 1KOGA 2AL2A 4H4WA 2PP1A 3VQYA 4YRTA 4KQEA 1E1OA 1GRGA 4EQSA 3I6TA 2PU1A 3A7AA 3FJPA 3VA8A 1MO9A 3O0HA 3N4FA 2ZZFA 3BSMA 1NHSA 1KN0A 2PGEA 2W3SA 5ENLA 3PWIA 5U25A 3NEMA 1G5IA 4CS3A 4XU1A 2QJNA 4GRTA 3ES7A 1SRYA 3A74A 4TVAB 3SBFA 2RHSA 1VQZA 4H2XA 1FO4A 4E5TA 1B8AA 2R9ZA 4H4UA 1JEHA 3H12A 2AL2B 2EL9A 3D47A 4ADWA 1G51A 4EQRA 4YCVA 3V8JA 2OZ8A 2AKWA 1GERA 1NYQA 3N6JA 3SQSA 4XU3A 4H83A 3JZUA 4K88A 4EX5A 2XTIA 3HRIA 4TQFA 3V3WA 2PU0A 3FYYA 2ALYA 3TEHA 3U9IA 3ES8A 2GRTA 2WP6A 3A31A 2RHSB 1QF6A 4H2XB 5FS6A 1HXDA 4E8GA 1FYFA 4X5OA 1W6TA 3RKWA 1ZY8A 4HYRA 3SJNA 1ASYA 1NJ8A 4LVJA 4ZOHB 1H4SA 4ROPA 4EQWA 4HWOA 4DYEA 2AKWB 4DHGA 3S5SA 3GD4A 3M4PA 1MRAA 1N5XA 3SN0A 1EOVA 2EJFA 3VQXA 5C52B 3HRKA 4HVCA 1Z7MA 3WQZA 4H4TA 1BWCA 4EM3A 5G5GB 4EO4A 2POZA 3P8VA 2ALYB 3TEHB 4RQFA 1KD0A 1GXFA 1SJAA 2OQHA 3L5OA 3UJRA 3NETA 4YCWA 1EVKA 4HCHA 4DQ2A 4JHMA 2ZXFA 4DNAA 1W66A 1FEAA 2PMFA 1ADJA 3KLJA 2DKGA 1BIAA 4EMIA 4P74C 1SB3B 2WPCA 3RGTA 1HTTA 3KUMA 5E3IA 5BOEA 3GRTA 2ZZGA 3BJSA 1P43A 2C3CA 4H4RA 2ZADA 1JDFA 1GGMA 4JQ9A 3R10A 3TJ4A 2PTYA 3UXLA 3CGEA 4WF2A 2EQ9A 4H4SA 2DXTA 1ZMDA 3LB8A 4H19A 2ZT6A 3A5YA 3AMZA 5FJPA 1YGBA 3V7CA 2PA6A 4P75C 2XH7A 3TEGA 2DTIA 1XS2A 2ZIMA 3DG3A 4YRLA 1NJ6A 2EQ6A 2GR3A 2W0HA 4YRSA 3UCDA 4P73C 2XH2A 4E4FA 2GDQA 4GMEA 4KWSA 3CAWA 3VC6A 2FYKA 2EQ7A 3UXKA 4A3RA 3PZCA 1XHCA 4Q15A 1F9CA 4MMWA 4DN1A 2ZCEA 1F8WA 2EWNA 2PP0A 1K4QA 3EUB3 4HA8A 4E6MA 2DU7A 2CFYA 2YAUA 3GO2A 2ARUA 4H50A 3V7RA 1ECQA 4CH3A 4K7ZA 3GD6A 2RHQA 3CXBA 2ZT5A 2QJJA 4YREA 2PCEA 4OLFA 3VC5A 3SSZA 5C51B 3ZLHA 1ZK7A 3EEZA 3L4GA 2PMQA 2DJZA 2V3BA 5JRBA 1AOGA 4KR3A 3LSQA 3EANA 4P71A 1EBDA 5JCIA 2PODA 4IT1A 3RUXA 1DXLA 1N60C 2DW6A 3Q6JA 3EAOA 2E64A 2OPJA 3DERA 1NYRA 1IL2A 3RACA 1NJ5A 2AAQA 3RL6A 2ZIOA 3NVWB 2RHQB 2E10A 2NVKX 2XGZA 3RR1A 3UCCA 4RMFA 1PDYA 3L4GB 2CJBA 3RO6A 4CH4A 3UJSA 11ASA 4KPRA 1EIYA 4LVKA 3IALA 3UH0A 4DX3A 5F5WA 3PK7A 3MF2A 4TQDA 4YRGA 1LYLA
chains in the Genus database with same CATH topology
5K1XA 4H02A 4XEOA 3W3SA 1VDVA 4YRFA 1JJCB 4P3OA 2DDZA 3RKYA 3NRZB 1WPYA 1EIYB 2DU5A 4YRPA 4XTYA 4L87A 1BBWA 1EFWA 2I4NA 3NS1B 2ZNJA 4WJ3M 3DSQA 2IY5A 2QHSA 2DQ3A 1YFSA 4UPAA 4HWSA 1J5WA 4AH6A 1X2GA 1B70A 2I4OA 3B9JB 1SETA 2DEQA 2XGTA 1T3QC 1N9WA 2IY5B 4CH5A 2ZTGA 2DTOA 1JROA 4TWAA 4BWAA 1BBUA 3RKXA 2E41A 4CH6A 3NVVB 3NVYB 4E51A 2J3LA 2P0LA 4XU0A 2DVEA 3HY1A 3MEYA 3OD1A 1B70B 1FIQB 2ZNIA 1SERA 4XTUA 2J3MA 4YRRA 3HY0A 3VQVA 4YDQA 1YFRA 3QNEA 5HGQA 4HWPA 2Q7EA 4P72A 2CJ9A 3R07A 2DZCA 4PG3A 4XU2A 1YFTA 1H4QA 2EJ9A 1E22A 2ZT7A 3A5ZA 4H2TA 1KMNA 4P3NA 4BW9A 4YRKA 1USYA 5C53B 5KNNA 2ODRC 3HXZA 1N5WC 3VBBA 3UFGA 4ZTZB 3IG2A 1JRPA 3PCOA 1WLEA 3E9IA 3I7FA 4H2YA 3AM9A 2ZR3A 3HXWA 4UP9A 2EAYA 1YB3A 3PCOB 4CS4A 3MF1A 4YRQA 2C8MA 2Q7HA 2Q5HA 1H4VB 4J15A 5G5HB 5K1PA 1NNHA 3MQZA 3REXA 3VQWA 4YP0A 3HXUA 2ODRD 2A8EA 4KR2A 2ZGWA 4YRMA 1WQWA 3RIRA 2QHUA 2CGHA 2ZZEA 1Z7NA 2E65A 1L0WA 4UP7A 4YYEA 1RM6B 1ADYA 4H2WA 2P5IA 4YROA 4G84A 4ZTUB 1WYGA 2I4LA 1EQRA 4P71C 3CMQA 1WYDA 1SESA 12ASA 3P8YA 1C0AA 1X56A 3EFSA 4PHCA 3HXVA 3V8KA 3ICAA 3L1AA 4YPFA 4Q6GA 2DQ0A 3P8TA 1WQ7A 4K86A 2E1HA 4LVMA 4YCUA 4YRIA 4HWRA 3QO7A 4WI1A 1X55A 3NVZB 4H2SA 1B7YA 3EFRA 2CIMA 2ZINA 1BIBA 1ZXIC 1X54A 4XTWA 2E3CA 2Q5IA 3QTCA 3BFMA 5ELNA 4TVWA 1N61C 1RIQA 4P74A 3RL6A 4LNSA 1E24A 1B7YB 4UP8A 3G1ZA 2I4MA 4ZIBA 4RQEA 1B76A 1KMMA 3AN1A 4YRJA 4XTZA 1NJ2A 1PYSA 2EJGA 4P75A 1HC7A 4XTVA 1NJ1A 3NELA 4YRCA 4YRNA 4WJ4A 2DTHA 2C7IA 4P73A 4G85A 4HT4A 4LVIA 3KFUA 3UGTA 2CJAA 1PYSB 4HWTA 4H2UA 3V8LA 3HXYA 3A32A 3IKLA 2ZT8A 1G5HA 2QHVA 2PMEA 3M4QA 2QHTA 1ATIA 2AMCA 3HFVA 3V7SA 2W54A 2W3RA 1X01A 4DPGA 4P72C 3SR6B 3RF1A 2NS6A 3ETRB 5ELOA 1E1TA 3R07C 2Q7GA 4LVLA 4TTVA 1ASZA 2HNIA 2AMCB 4XTXA 4P3PA 2ZR2A 1V97A 1USYC 2G4CA 4RDXA 2DXUA 3HTZA 3L2ZA 3LC0A 1WU7A 1X2HA 3LSSA 4O2DA 3A7UA 3E9HA 2W55A 3HRDC 4TVYA 2E3TA 1JJCA 4NCXA 2E5AA 3ERRA 4XEMA 1EVLA 3A7RA 4K87A 3QO5A 4CS2A 3HXXA 3HFZA 1FFUC 1N62C 1WNLA 3UGQA 2DZ9A 1N63C 4OP0A 3REUA 2ARTA 3RGLA 3TUPA 3QO8A 3NENA 1QE0A 1H4TA 3IKMB 1FFVC 4TVAA 3HFZB 2ARSA 4H2VA 3BJUA 1KOGA 3VQYA 4YRTA 4KQEA 1E1OA 3A7AA 3FJPA 2ZZFA 2W3SA 3NEMA 1G5IA 4CS3A 4XU1A 1SRYA 3A74A 4TVAB 2RHSA 1VQZA 4H2XA 1FO4A 1B8AA 2EL9A 1G51A 4YCVA 3V8JA 2AKWA 1NYQA 4EX5A 4XU3A 4K88A 2XTIA 3HRIA 4TQFA 2ALYA 3TEHA 3A31A 1QF6A 2RHSB 4H2XB 1HXDA 1FYFA 4X5OA 3RKWA 1ASYA 1NJ8A 4LVJA 4ZOHB 1H4SA 4HWOA 2AKWB 3M4PA 1N5XA 1EOVA 2EJFA 3VQXA 5C52B 3HRKA 4HVCA 1Z7MA 3WQZA 5G5GB 4EO4A 3P8VA 2ALYB 3TEHB 4RQFA 3NETA 4YCWA 1EVKA 4DQ2A 2ZXFA 1W66A 2PMFA 1ADJA 2DKGA 1BIAA 4P74C 1SB3B 1HTTA 5E3IA 2ZZGA 1GGMA 4WF2A 2DXTA 2ZT6A 3A5YA 3V7CA 3AMZA 1YGBA 4P75C 3TEGA 2DTIA 2ZIMA 4YRLA 1NJ6A 4YRSA 4P73C 2FYKA 3PZCA 4Q15A 2ZCEA 2EWNA 3EUB3 4HA8A 2DU7A 2ARUA 3V7RA 4CH3A 2RHQA 2ZT5A 4YREA 4OLFA 5C51B 3L4GA 2DJZA 4KR3A 3LSQA 4P71A 3RUXA 1N60C 2E64A 1IL2A 1NYRA 3RACA 1NJ5A 2ZIOA 3NVWB 2RHQB 2E10A 4RMFA 3L4GB 2CJBA 4CH4A 11ASA 1EIYA 4LVKA 3IALA 3UH0A 5F5WA 3MF2A 4TQDA 4YRGA 1LYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K1X A;  4H02 A;  4XEO A;  3W3S A;  1VDV A;  4YRF A;  1JJC B;  4P3O A;  2DDZ A;  3RKY A;  3NRZ B;  1WPY A;  1EIY B;  2DU5 A;  4YRP A;  4XTY A;  4L87 A;  1BBW A;  1EFW A;  2I4N A;  3NS1 B;  2ZNJ A;  4WJ3 M;  3DSQ A;  2IY5 A;  2QHS A;  2DQ3 A;  1YFS A;  4UPA A;  4HWS A;  1J5W A;  4AH6 A;  1X2G A;  1B70 A;  2I4O A;  3B9J B;  1SET A;  2DEQ A;  2XGT A;  1T3Q C;  1N9W A;  2IY5 B;  4CH5 A;  2ZTG A;  2DTO A;  1JRO A;  4TWA A;  4BWA A;  1BBU A;  3RKX A;  2E41 A;  4CH6 A;  3NVV B;  3NVY B;  4E51 A;  2J3L A;  2P0L A;  4XU0 A;  2DVE A;  3HY1 A;  3MEY A;  3OD1 A;  1B70 B;  1FIQ B;  2ZNI A;  1SER A;  4XTU A;  2J3M A;  4YRR A;  3HY0 A;  3VQV A;  4YDQ A;  1YFR A;  3QNE A;  5HGQ A;  4HWP A;  2Q7E A;  4P72 A;  2CJ9 A;  3R07 A;  2DZC A;  4PG3 A;  4XU2 A;  1YFT A;  1H4Q A;  2EJ9 A;  1E22 A;  2ZT7 A;  3A5Z A;  4H2T A;  1KMN A;  4P3N A;  4BW9 A;  4YRK A;  1USY A;  5C53 B;  5KNN A;  2ODR C;  3HXZ A;  1N5W C;  3VBB A;  3UFG A;  4ZTZ B;  3IG2 A;  1JRP A;  3PCO A;  1WLE A;  3E9I A;  3I7F A;  4H2Y A;  3AM9 A;  2ZR3 A;  3HXW A;  4UP9 A;  2EAY A;  1YB3 A;  3PCO B;  4CS4 A;  3MF1 A;  4YRQ A;  2C8M A;  2Q7H A;  2Q5H A;  1H4V B;  4J15 A;  5G5H B;  5K1P A;  1NNH A;  3REX A;  3VQW A;  4YP0 A;  3HXU A;  2ODR D;  4KR2 A;  2ZGW A;  4YRM A;  1WQW A;  3RIR A;  2QHU A;  2CGH A;  2ZZE A;  1Z7N A;  2E65 A;  1L0W A;  4UP7 A;  4YYE A;  1RM6 B;  1ADY A;  4H2W A;  2P5I A;  4YRO A;  4G84 A;  4ZTU B;  1WYG A;  2I4L A;  1EQR A;  4P71 C;  3CMQ A;  1WYD A;  1SES A;  12AS A;  3P8Y A;  1C0A A;  1X56 A;  3EFS A;  4PHC A;  3HXV A;  3V8K A;  3ICA A;  3L1A A;  4YPF A;  4Q6G A;  2DQ0 A;  3P8T A;  1WQ7 A;  4K86 A;  2E1H A;  4YCU A;  4YRI A;  4HWR A;  3QO7 A;  4WI1 A;  1X55 A;  3NVZ B;  4H2S A;  1B7Y A;  3EFR A;  2CIM A;  2ZIN A;  1BIB A;  1ZXI C;  1X54 A;  4XTW A;  2E3C A;  2Q5I A;  3QTC A;  3BFM A;  5ELN A;  4TVW A;  1N61 C;  1RIQ A;  4P74 A;  3RL6 A;  4LNS A;  1E24 A;  1B7Y B;  4UP8 A;  3G1Z A;  2I4M A;  4ZIB A;  4RQE A;  1B76 A;  1KMM A;  3AN1 A;  4YRJ A;  4XTZ A;  1NJ2 A;  1PYS A;  2EJG A;  4P75 A;  1HC7 A;  4XTV A;  1NJ1 A;  3NEL A;  4YRC A;  4YRN A;  4WJ4 A;  2DTH A;  2C7I A;  4P73 A;  4G85 A;  3KFU A;  3UGT A;  2CJA A;  1PYS B;  4HWT A;  4H2U A;  3V8L A;  3HXY A;  3A32 A;  3IKL A;  2ZT8 A;  1G5H A;  2QHV A;  2PME A;  3M4Q A;  2QHT A;  1ATI A;  2AMC A;  3HFV A;  3V7S A;  2W54 A;  2W3R A;  1X01 A;  4DPG A;  4P72 C;  3SR6 B;  3RF1 A;  3ETR B;  5ELO A;  1E1T A;  3R07 C;  2Q7G A;  4TTV A;  1ASZ A;  2HNI A;  2AMC B;  4XTX A;  4P3P A;  2ZR2 A;  1V97 A;  1USY C;  2G4C A;  4RDX A;  2DXU A;  3HTZ A;  3L2Z A;  3LC0 A;  1WU7 A;  1X2H A;  3LSS A;  4O2D A;  3A7U A;  3E9H A;  2W55 A;  3HRD C;  4TVY A;  2E3T A;  1JJC A;  4NCX A;  2E5A A;  3ERR A;  4XEM A;  1EVL A;  3A7R A;  4K87 A;  3QO5 A;  4CS2 A;  3HXX A;  3HFZ A;  1FFU C;  1N62 C;  1WNL A;  3UGQ A;  2DZ9 A;  1N63 C;  4OP0 A;  3REU A;  2ART A;  3RGL A;  3TUP A;  3QO8 A;  3NEN A;  1QE0 A;  1H4T A;  3IKM B;  1FFV C;  4TVA A;  3HFZ B;  2ARS A;  4H2V A;  3BJU A;  1KOG A;  3VQY A;  4YRT A;  4KQE A;  1E1O A;  3A7A A;  3FJP A;  2ZZF A;  2W3S A;  3NEM A;  1G5I A;  4CS3 A;  4XU1 A;  1SRY A;  3A74 A;  4TVA B;  2RHS A;  1VQZ A;  4H2X A;  1FO4 A;  1B8A A;  2EL9 A;  1G51 A;  4YCV A;  3V8J A;  2AKW A;  1NYQ A;  4EX5 A;  4XU3 A;  4K88 A;  2XTI A;  3HRI A;  4TQF A;  2ALY A;  3TEH A;  3A31 A;  1QF6 A;  2RHS B;  4H2X B;  1HXD A;  1FYF A;  4X5O A;  3RKW A;  1ASY A;  1NJ8 A;  1H4S A;  4ZOH B;  4HWO A;  2AKW B;  3M4P A;  1N5X A;  1EOV A;  2EJF A;  3VQX A;  5C52 B;  3HRK A;  4HVC A;  1Z7M A;  3WQZ A;  5G5G B;  4EO4 A;  3P8V A;  2ALY B;  3TEH B;  4RQF A;  3NET A;  4YCW A;  1EVK A;  4DQ2 A;  2ZXF A;  1W66 A;  2PMF A;  1ADJ A;  2DKG A;  1BIA A;  4P74 C;  1SB3 B;  1HTT A;  5E3I A;  2ZZG A;  1GGM A;  4WF2 A;  2DXT A;  2ZT6 A;  3A5Y A;  3V7C A;  3AMZ A;  1YGB A;  4P75 C;  3TEG A;  2DTI A;  2ZIM A;  4YRL A;  1NJ6 A;  4YRS A;  4P73 C;  2FYK A;  3PZC A;  4Q15 A;  2ZCE A;  2EWN A;  3EUB 3;  4HA8 A;  2DU7 A;  2ARU A;  3V7R A;  4CH3 A;  2RHQ A;  2ZT5 A;  4YRE A;  4OLF A;  5C51 B;  3L4G A;  2DJZ A;  4KR3 A;  3LSQ A;  4P71 A;  3RUX A;  1N60 C;  2E64 A;  1IL2 A;  1NYR A;  3RAC A;  1NJ5 A;  2ZIO A;  3NVW B;  2RHQ B;  2E10 A;  4RMF A;  3L4G B;  2CJB A;  4CH4 A;  11AS A;  1EIY A;  3IAL A;  3UH0 A;  5F5W A;  3MF2 A;  4TQD A;  4YRG A;  1LYL A; 
#chains in the Genus database with same CATH topology
 5K1X A;  1ELS A;  4H02 A;  1GRB A;  4XEO A;  3W3S A;  2C3D A;  2CHR A;  3TWB A;  1VDV A;  2QVH A;  3PFR A;  4YRF A;  1JJC B;  4P3O A;  2DDZ A;  4DXK A;  3T8Q A;  3H7V A;  3RKY A;  3DG7 A;  3DDM A;  1NHP A;  3OZY A;  3NRZ B;  1WPY A;  1EIY B;  3H70 A;  2DU5 A;  2ZC8 A;  4YRP A;  2PTX A;  4HNL A;  4JN8 A;  4XTY A;  3TTE A;  4L87 A;  1GRT A;  4H4X A;  1BBW A;  1EFW A;  4K1W A;  5FJU A;  3RRA A;  3FV9 A;  2I4N A;  3BOX A;  3DIP A;  2HXU A;  3NS1 B;  4KEM A;  2ZNJ A;  3DJJ A;  4WJ3 M;  3DSQ A;  2IY5 A;  3P0W A;  2I5Q A;  2QHS A;  2GSH A;  2PGW A;  3OP2 A;  3P93 A;  4MGG A;  2DQ3 A;  5FS7 A;  4IP4 A;  3GD3 A;  1YFS A;  4EMW A;  4J3Z A;  1STZ A;  4NEW A;  2RDX A;  2GGI A;  4UPA A;  4HWS A;  1J5W A;  4H1Z A;  4KPL A;  2QAE A;  4AH6 A;  1X2G A;  1B70 A;  4FDC B;  3V5F A;  2I4O A;  3B9J B;  1SET A;  2DEQ A;  2XGT A;  1T3Q C;  2YVJ A;  2XSX A;  1N9W A;  2IY5 B;  4CH5 A;  2AL1 A;  3MSY A;  2ZTG A;  1SJB A;  1JRO A;  3FXG A;  3SN4 A;  2DTO A;  4TWA A;  2YQU A;  4BWA A;  5FJR A;  3JW7 A;  2HNE A;  1BBU A;  3RKX A;  2E41 A;  4CH6 A;  3NVY B;  3NVV B;  4E51 A;  2J3L A;  2P0L A;  2WPF A;  2DVE A;  4XU0 A;  1S7M A;  1PDZ A;  3T6C A;  3HY1 A;  1V59 A;  3MEY A;  1H2I A;  3OD1 A;  1B70 B;  1FIQ B;  4Z17 A;  5J04 A;  2ZNI A;  1SER A;  2PSN A;  4XTU A;  2J3M A;  4YRR A;  3HY0 A;  2AKZ A;  3EF6 A;  3SQP A;  3VQV A;  1JPM A;  4YDQ A;  5JCK A;  1YFR A;  3QNE A;  2CDU A;  5HGQ A;  1NHQ A;  4HWP A;  2Q7E A;  4P72 A;  4G7F A;  4K2S A;  2CJ9 A;  3R0U A;  3R07 A;  4M52 A;  2DZC A;  4PG3 A;  4LA1 A;  1M6I A;  3VCC A;  2QDE A;  4XU2 A;  1YFT A;  4E4U A;  1H4Q A;  2EJ9 A;  3H8A A;  2OLA A;  1MDR A;  1E22 A;  2ZT7 A;  2RAB A;  2XH4 A;  3A5Z A;  1KMN A;  4H2T A;  4P3N A;  2GGJ A;  4BW9 A;  3II4 A;  3OW1 A;  1USY A;  4YRK A;  3NZG A;  5C53 B;  5KNN A;  2ODR C;  4IHC A;  2V6O A;  3N6H A;  3OPS A;  3LXD A;  1BZL A;  3HXZ A;  1N5W C;  3R1Z A;  3UFG A;  3VBB A;  4ZTZ B;  3IG2 A;  1JRP A;  3PCO A;  3QN3 A;  1WLE A;  2A8X A;  4H4P A;  1F3P A;  3E9I A;  4GYP A;  1NHR A;  3I7F A;  4H2Y A;  3AM9 A;  2BCP A;  1BQG A;  1EBH A;  7ENL A;  2ZR3 A;  3HXW A;  4UP9 A;  4FI4 A;  2EAY A;  2P0I A;  3CYJ A;  1NDA A;  4ZCW A;  3QFA A;  1EBG A;  3FJ4 A;  1YB3 A;  3IJL A;  1NU5 A;  3PCO B;  3MF1 A;  4YRQ A;  4CS4 A;  3N4E A;  2C8M A;  2Q7H A;  2Q5H A;  3PWG A;  1H4V B;  4K8G A;  4J15 A;  5G5H B;  2OQY A;  5K1P A;  1GSN A;  2J3N A;  3GY1 A;  4YWS A;  1NNH A;  3MQZ A;  2DW7 A;  1ONF A;  2WBA A;  1R0M A;  3DK9 A;  2ONE A;  4MKS A;  3DK8 A;  3DGH A;  3REX A;  3VQW A;  2GGG A;  4NEV A;  4YP0 A;  3T4W A;  3L8K A;  3HXU A;  2ODR D;  2HQM A;  2A8E A;  3CXO A;  2P3Z A;  3IJQ A;  2ZGW A;  4YRM A;  4KR2 A;  1WQW A;  3RIR A;  4JN7 A;  5FJT A;  2QHU A;  2CGH A;  4GIS A;  2ZZE A;  4H2H A;  1Z7N A;  3D46 A;  2OKT A;  2E65 A;  5EBK A;  1L0W A;  4HN8 A;  1GV4 A;  1FHV A;  1DTN A;  4UP7 A;  4YYE A;  1TYT A;  5JCM A;  2GQW A;  2O56 A;  4GR1 A;  4K8D A;  1RM6 B;  3CB3 A;  3QKE A;  3DG6 A;  1ADY A;  1D7Y A;  2QJM A;  1TYP A;  4H2W A;  4HCL A;  2P5I A;  4YRO A;  4G84 A;  2NPX A;  4ZTU B;  1WYG A;  3MKC A;  3S47 A;  2JK6 A;  1EQR A;  4H4V A;  3T9P A;  3I6E A;  3Q4D A;  2I4L A;  4P71 C;  3CMQ A;  1GET A;  1WYD A;  1GRA A;  1SES A;  4IL0 A;  5KVI A;  12AS A;  3P8Y A;  1SJC A;  5U1O A;  1C0A A;  1X56 A;  3TOY A;  3FCP A;  3EFS A;  4PHC A;  4J56 A;  2FKP A;  3DFH A;  3HXV A;  4H4Y A;  1EC9 A;  3V8K A;  3QTP A;  3MZN A;  4GGB A;  3CT2 A;  2GL5 A;  4Z1Y A;  2OZT A;  3CGD A;  3QPE A;  3ICA A;  3L1A A;  2WPE A;  4YPF A;  3R25 A;  3U4F A;  4Q6G A;  2GR1 A;  1YEY A;  2DQ0 A;  3TWA A;  2WOI A;  3RCY A;  1WQ7 A;  3P8T A;  4EMJ A;  3SN1 A;  4K86 A;  2E1H A;  4LVM A;  2GGE A;  4YCU A;  4YRI A;  5FMH A;  4G8T A;  2PTZ A;  3UJ2 A;  2MNR A;  3QO7 A;  4HWR A;  1X55 A;  4WI1 A;  2P88 A;  3NVZ B;  4H2S A;  1JPD X;  2FYM A;  1B7Y A;  4M6U A;  5IDZ A;  3EFR A;  1BKH A;  1GRH A;  1ZKQ A;  5BOF A;  2CIM A;  2ZIN A;  3ZVH A;  2YVG A;  1BIB A;  1ZXI C;  1MUC A;  1X54 A;  3UJE A;  4XTW A;  1KKO A;  2E3C A;  1IYX A;  3GC2 A;  2Q5I A;  3IC9 A;  5TR3 A;  3QTC A;  3H4K A;  1TE6 A;  4M0X A;  3BFM A;  2OO6 A;  2PTW A;  4TVW A;  5ELN A;  2WP5 A;  3DEQ A;  1N61 C;  1RIQ A;  4P74 A;  2AKM A;  4GIR A;  3RNM A;  3TJI A;  2PPG A;  3TQP A;  4LNS A;  1LVL A;  3IJI A;  3V5C A;  1E24 A;  4BV6 A;  3TW9 A;  1MDL A;  1B7Y B;  4UP8 A;  2OVL A;  1TZZ A;  3G1Z A;  3DFY A;  4ENL A;  2I4M A;  1FEB A;  4IP5 A;  5GRT A;  3ZVH B;  4APN A;  4ZIB A;  4RQE A;  2ZZC A;  1SJD A;  1B76 A;  1KMM A;  3AN1 A;  3LAD A;  4YRJ A;  3DGZ A;  4BUR A;  3THU A;  3JVA A;  1NJ2 A;  1PYS A;  4XTZ A;  2EJG A;  1GRF A;  4P75 A;  1HC7 A;  4XTV A;  3URH A;  1NJ1 A;  3V4B A;  3NEL A;  2ZZB A;  4YRC A;  4YRN A;  2OG9 A;  5FS9 A;  4WJ4 A;  2GH5 A;  4FP1 A;  4HPN A;  2C7I A;  2DTH A;  5FS8 A;  4G85 A;  4P73 A;  3NXL A;  3R11 A;  1EC8 A;  4A35 A;  2X50 A;  1WUF A;  3VFC A;  1EC7 A;  2GR2 A;  4HT4 A;  4LVI A;  2TPR A;  2X99 A;  3OC4 A;  1KKR A;  1ONE A;  3PG6 A;  2BC1 A;  1FHU A;  1GEU A;  3NFU A;  3KFU A;  2QGY A;  3UGT A;  1JCT A;  4JDR A;  2CJA A;  3ZVI A;  1PYS B;  1GRE A;  4HWT A;  4H2U A;  3DK4 A;  4FX9 A;  3V8L A;  5FJO A;  3HXY A;  1XPY A;  2WOW A;  3QLD A;  3A32 A;  2OZ3 A;  5EU9 A;  3IKL A;  3FG2 P;  3OZM A;  1L8P A;  3GRS A;  4H4Z A;  2YVF A;  2ZT8 A;  2PS2 A;  2QDD A;  1G5H A;  2QHV A;  2PME A;  3M4Q A;  2X8G A;  2GR0 A;  4J57 A;  3DJG X;  1ATI A;  2AMC A;  2QHT A;  3HFV A;  2XH0 A;  3V7S A;  4GFI A;  2W54 A;  4HNC A;  2W3R A;  4YWO A;  1X01 A;  4DPG A;  3OTR A;  4P72 C;  3SR6 B;  3RF1 A;  4LII A;  3ZLF A;  2NS6 A;  3ETR B;  5ELO A;  2V3A A;  1E1T A;  3DGB A;  1ZDL A;  1ZX9 A;  3R07 C;  2HXT A;  2Q7G A;  4LVL A;  1Q1W A;  3EKG A;  4TTV A;  3UJF A;  1ASZ A;  1Q1R A;  2GGH A;  3MUC A;  2HNI A;  2AMC B;  4DWD A;  4XTX A;  5JCN A;  4P3P A;  3K1G A;  2ZR2 A;  3P3B A;  2WOV A;  1H6V A;  1OEP A;  1V97 A;  1USY C;  1GES A;  2G4C A;  4RDX A;  2DXU A;  3HTZ A;  1MOK A;  3CK5 A;  1MNS A;  2P8B A;  3L2Z A;  1ZMC A;  4F4R A;  1WUE A;  3LC0 A;  1NEL A;  4KT2 A;  4J1O A;  1WU7 A;  2MUC A;  2OX4 A;  3DH9 A;  4EWJ A;  3UGV A;  1XAN A;  2BC0 A;  1FEC A;  4GYP C;  1X2H A;  3VCN A;  4EQX A;  1NPX A;  3LSS A;  2ZZ0 A;  4O2D A;  1RVK A;  3ENL A;  3A7U A;  2HZG A;  3DES A;  3FVD A;  5JCL A;  3E9H A;  2W55 A;  3HRD C;  4TVY A;  4IL2 A;  4HCD A;  2E3T A;  3TCS A;  1JJC A;  4IZG A;  2F5Z A;  2PP3 A;  4NCX A;  3Q45 A;  2E5A A;  2NQL A;  3I4K A;  3ERR A;  4XEM A;  1DNC A;  1EVL A;  3A7R A;  3D9X A;  1E9I A;  3RIT A;  2QQ6 A;  2X8C A;  3QO5 A;  4X2P A;  1KCZ A;  4H4Q A;  4K87 A;  3HXX A;  5KVH A;  3CGC A;  4CS2 A;  3MQT A;  3IK4 A;  3VDG A;  4A6G A;  3HFZ A;  1FFU C;  3MY9 A;  3R0K A;  1R6W A;  2X8H A;  1JOA A;  4GGH A;  1N62 C;  1WNL A;  1TKK A;  3UGQ A;  3B97 A;  1LPF A;  1OJT A;  1N63 C;  2DZ9 A;  4OP0 A;  3REU A;  2ART A;  3STP A;  3RGL A;  1P48 A;  2P8C A;  3TUP A;  3QO8 A;  4EM4 A;  3QFB A;  3NEN A;  3HPF A;  2EQ8 A;  4ZA0 A;  3MWC A;  1QE0 A;  5ER0 A;  1H4T A;  3NO1 A;  3HW2 A;  1FFV C;  6ENL A;  3IKM B;  4TVA A;  3HFZ B;  3CGB A;  2OFJ A;  2ARS A;  4H2V A;  1XDI A;  3BJU A;  1YQZ A;  3ZLG A;  1KOG A;  2AL2 A;  4H4W A;  2PP1 A;  3VQY A;  4YRT A;  4KQE A;  1E1O A;  1GRG A;  4EQS A;  3I6T A;  2PU1 A;  3A7A A;  3FJP A;  3VA8 A;  1MO9 A;  3O0H A;  3N4F A;  2ZZF A;  3BSM A;  1NHS A;  1KN0 A;  2PGE A;  2W3S A;  5ENL A;  3PWI A;  5U25 A;  3NEM A;  1G5I A;  4CS3 A;  4XU1 A;  2QJN A;  4GRT A;  3ES7 A;  1SRY A;  3A74 A;  4TVA B;  3SBF A;  2RHS A;  1VQZ A;  4H2X A;  1FO4 A;  4E5T A;  1B8A A;  2R9Z A;  4H4U A;  1JEH A;  3H12 A;  2AL2 B;  2EL9 A;  3D47 A;  4ADW A;  1G51 A;  4EQR A;  4YCV A;  3V8J A;  2OZ8 A;  2AKW A;  1GER A;  1NYQ A;  3N6J A;  3SQS A;  4XU3 A;  4H83 A;  3JZU A;  4K88 A;  4EX5 A;  2XTI A;  3HRI A;  4TQF A;  3V3W A;  2PU0 A;  3FYY A;  2ALY A;  3TEH A;  3U9I A;  3ES8 A;  2GRT A;  2WP6 A;  3A31 A;  2RHS B;  1QF6 A;  4H2X B;  5FS6 A;  1HXD A;  4E8G A;  1FYF A;  4X5O A;  1W6T A;  3RKW A;  1ZY8 A;  4HYR A;  3SJN A;  1ASY A;  1NJ8 A;  4LVJ A;  4ZOH B;  1H4S A;  4ROP A;  4EQW A;  4HWO A;  4DYE A;  2AKW B;  4DHG A;  3S5S A;  3GD4 A;  3M4P A;  1MRA A;  1N5X A;  3SN0 A;  1EOV A;  2EJF A;  3VQX A;  5C52 B;  3HRK A;  4HVC A;  1Z7M A;  3WQZ A;  4H4T A;  1BWC A;  4EM3 A;  5G5G B;  4EO4 A;  2POZ A;  3P8V A;  2ALY B;  3TEH B;  4RQF A;  1KD0 A;  1GXF A;  1SJA A;  2OQH A;  3L5O A;  3UJR A;  3NET A;  4YCW A;  1EVK A;  4HCH A;  4DQ2 A;  4JHM A;  2ZXF A;  4DNA A;  1W66 A;  1FEA A;  2PMF A;  1ADJ A;  3KLJ A;  2DKG A;  1BIA A;  4EMI A;  4P74 C;  1SB3 B;  2WPC A;  3RGT A;  1HTT A;  3KUM A;  5E3I A;  5BOE A;  3GRT A;  2ZZG A;  3BJS A;  1P43 A;  2C3C A;  4H4R A;  2ZAD A;  1JDF A;  1GGM A;  4JQ9 A;  3R10 A;  3TJ4 A;  2PTY A;  3UXL A;  3CGE A;  4WF2 A;  2EQ9 A;  4H4S A;  2DXT A;  1ZMD A;  3LB8 A;  4H19 A;  2ZT6 A;  3A5Y A;  3AMZ A;  5FJP A;  1YGB A;  3V7C A;  2PA6 A;  4P75 C;  2XH7 A;  3TEG A;  2DTI A;  1XS2 A;  2ZIM A;  3DG3 A;  4YRL A;  1NJ6 A;  2EQ6 A;  2GR3 A;  2W0H A;  4YRS A;  3UCD A;  4P73 C;  2XH2 A;  4E4F A;  2GDQ A;  4GME A;  4KWS A;  3CAW A;  3VC6 A;  2FYK A;  2EQ7 A;  3UXK A;  4A3R A;  3PZC A;  1XHC A;  4Q15 A;  1F9C A;  4MMW A;  4DN1 A;  2ZCE A;  1F8W A;  2EWN A;  2PP0 A;  1K4Q A;  3EUB 3;  4HA8 A;  4E6M A;  2DU7 A;  2CFY A;  2YAU A;  3GO2 A;  2ARU A;  4H50 A;  3V7R A;  1ECQ A;  4CH3 A;  4K7Z A;  3GD6 A;  2RHQ A;  3CXB A;  2ZT5 A;  2QJJ A;  4YRE A;  2PCE A;  4OLF A;  3VC5 A;  3SSZ A;  5C51 B;  3ZLH A;  1ZK7 A;  3EEZ A;  3L4G A;  2PMQ A;  2DJZ A;  2V3B A;  5JRB A;  1AOG A;  4KR3 A;  3LSQ A;  3EAN A;  4P71 A;  1EBD A;  5JCI A;  2POD A;  4IT1 A;  3RUX A;  1DXL A;  1N60 C;  2DW6 A;  3Q6J A;  3EAO A;  2E64 A;  2OPJ A;  3DER A;  1NYR A;  1IL2 A;  3RAC A;  1NJ5 A;  2AAQ A;  3RL6 A;  2ZIO A;  3NVW B;  2RHQ B;  2E10 A;  2NVK X;  2XGZ A;  3RR1 A;  3UCC A;  4RMF A;  1PDY A;  3L4G B;  2CJB A;  3RO6 A;  4CH4 A;  3UJS A;  11AS A;  4KPR A;  1EIY A;  4LVK A;  3IAL A;  3UH0 A;  4DX3 A;  5F5W A;  3PK7 A;  3MF2 A;  4TQD A;  4YRG A;  1LYL A; 
#chains in the Genus database with same CATH homology
 5K1X A;  4H02 A;  4XEO A;  3W3S A;  1VDV A;  4YRF A;  1JJC B;  4P3O A;  2DDZ A;  3RKY A;  3NRZ B;  1WPY A;  1EIY B;  2DU5 A;  4YRP A;  4XTY A;  4L87 A;  1BBW A;  1EFW A;  2I4N A;  3NS1 B;  2ZNJ A;  4WJ3 M;  3DSQ A;  2IY5 A;  2QHS A;  2DQ3 A;  1YFS A;  4UPA A;  4HWS A;  1J5W A;  4AH6 A;  1X2G A;  1B70 A;  2I4O A;  3B9J B;  1SET A;  2DEQ A;  2XGT A;  1T3Q C;  1N9W A;  2IY5 B;  4CH5 A;  2ZTG A;  2DTO A;  1JRO A;  4TWA A;  4BWA A;  1BBU A;  3RKX A;  2E41 A;  4CH6 A;  3NVV B;  3NVY B;  4E51 A;  2J3L A;  2P0L A;  4XU0 A;  2DVE A;  3HY1 A;  3MEY A;  3OD1 A;  1B70 B;  1FIQ B;  2ZNI A;  1SER A;  4XTU A;  2J3M A;  4YRR A;  3HY0 A;  3VQV A;  4YDQ A;  1YFR A;  3QNE A;  5HGQ A;  4HWP A;  2Q7E A;  4P72 A;  2CJ9 A;  3R07 A;  2DZC A;  4PG3 A;  4XU2 A;  1YFT A;  1H4Q A;  2EJ9 A;  1E22 A;  2ZT7 A;  3A5Z A;  4H2T A;  1KMN A;  4P3N A;  4BW9 A;  4YRK A;  1USY A;  5C53 B;  5KNN A;  2ODR C;  3HXZ A;  1N5W C;  3VBB A;  3UFG A;  4ZTZ B;  3IG2 A;  1JRP A;  3PCO A;  1WLE A;  3E9I A;  3I7F A;  4H2Y A;  3AM9 A;  2ZR3 A;  3HXW A;  4UP9 A;  2EAY A;  1YB3 A;  3PCO B;  4CS4 A;  3MF1 A;  4YRQ A;  2C8M A;  2Q7H A;  2Q5H A;  1H4V B;  4J15 A;  5G5H B;  5K1P A;  1NNH A;  3MQZ A;  3REX A;  3VQW A;  4YP0 A;  3HXU A;  2ODR D;  2A8E A;  4KR2 A;  2ZGW A;  4YRM A;  1WQW A;  3RIR A;  2QHU A;  2CGH A;  2ZZE A;  1Z7N A;  2E65 A;  1L0W A;  4UP7 A;  4YYE A;  1RM6 B;  1ADY A;  4H2W A;  2P5I A;  4YRO A;  4G84 A;  4ZTU B;  1WYG A;  2I4L A;  1EQR A;  4P71 C;  3CMQ A;  1WYD A;  1SES A;  12AS A;  3P8Y A;  1C0A A;  1X56 A;  3EFS A;  4PHC A;  3HXV A;  3V8K A;  3ICA A;  3L1A A;  4YPF A;  4Q6G A;  2DQ0 A;  3P8T A;  1WQ7 A;  4K86 A;  2E1H A;  4LVM A;  4YCU A;  4YRI A;  4HWR A;  3QO7 A;  4WI1 A;  1X55 A;  3NVZ B;  4H2S A;  1B7Y A;  3EFR A;  2CIM A;  2ZIN A;  1BIB A;  1ZXI C;  1X54 A;  4XTW A;  2E3C A;  2Q5I A;  3QTC A;  3BFM A;  5ELN A;  4TVW A;  1N61 C;  1RIQ A;  4P74 A;  3RL6 A;  4LNS A;  1E24 A;  1B7Y B;  4UP8 A;  3G1Z A;  2I4M A;  4ZIB A;  4RQE A;  1B76 A;  1KMM A;  3AN1 A;  4YRJ A;  4XTZ A;  1NJ2 A;  1PYS A;  2EJG A;  4P75 A;  1HC7 A;  4XTV A;  1NJ1 A;  3NEL A;  4YRC A;  4YRN A;  4WJ4 A;  2DTH A;  2C7I A;  4P73 A;  4G85 A;  4HT4 A;  4LVI A;  3KFU A;  3UGT A;  2CJA A;  1PYS B;  4HWT A;  4H2U A;  3V8L A;  3HXY A;  3A32 A;  3IKL A;  2ZT8 A;  1G5H A;  2QHV A;  2PME A;  3M4Q A;  2QHT A;  1ATI A;  2AMC A;  3HFV A;  3V7S A;  2W54 A;  2W3R A;  1X01 A;  4DPG A;  4P72 C;  3SR6 B;  3RF1 A;  2NS6 A;  3ETR B;  5ELO A;  1E1T A;  3R07 C;  2Q7G A;  4LVL A;  4TTV A;  1ASZ A;  2HNI A;  2AMC B;  4XTX A;  4P3P A;  2ZR2 A;  1V97 A;  1USY C;  2G4C A;  4RDX A;  2DXU A;  3HTZ A;  3L2Z A;  3LC0 A;  1WU7 A;  1X2H A;  3LSS A;  4O2D A;  3A7U A;  3E9H A;  2W55 A;  3HRD C;  4TVY A;  2E3T A;  1JJC A;  4NCX A;  2E5A A;  3ERR A;  4XEM A;  1EVL A;  3A7R A;  4K87 A;  3QO5 A;  4CS2 A;  3HXX A;  3HFZ A;  1FFU C;  1N62 C;  1WNL A;  3UGQ A;  2DZ9 A;  1N63 C;  4OP0 A;  3REU A;  2ART A;  3RGL A;  3TUP A;  3QO8 A;  3NEN A;  1QE0 A;  1H4T A;  3IKM B;  1FFV C;  4TVA A;  3HFZ B;  2ARS A;  4H2V A;  3BJU A;  1KOG A;  3VQY A;  4YRT A;  4KQE A;  1E1O A;  3A7A A;  3FJP A;  2ZZF A;  2W3S A;  3NEM A;  1G5I A;  4CS3 A;  4XU1 A;  1SRY A;  3A74 A;  4TVA B;  2RHS A;  1VQZ A;  4H2X A;  1FO4 A;  1B8A A;  2EL9 A;  1G51 A;  4YCV A;  3V8J A;  2AKW A;  1NYQ A;  4EX5 A;  4XU3 A;  4K88 A;  2XTI A;  3HRI A;  4TQF A;  2ALY A;  3TEH A;  3A31 A;  1QF6 A;  2RHS B;  4H2X B;  1HXD A;  1FYF A;  4X5O A;  3RKW A;  1ASY A;  1NJ8 A;  4LVJ A;  4ZOH B;  1H4S A;  4HWO A;  2AKW B;  3M4P A;  1N5X A;  1EOV A;  2EJF A;  3VQX A;  5C52 B;  3HRK A;  4HVC A;  1Z7M A;  3WQZ A;  5G5G B;  4EO4 A;  3P8V A;  2ALY B;  3TEH B;  4RQF A;  3NET A;  4YCW A;  1EVK A;  4DQ2 A;  2ZXF A;  1W66 A;  2PMF A;  1ADJ A;  2DKG A;  1BIA A;  4P74 C;  1SB3 B;  1HTT A;  5E3I A;  2ZZG A;  1GGM A;  4WF2 A;  2DXT A;  2ZT6 A;  3A5Y A;  3V7C A;  3AMZ A;  1YGB A;  4P75 C;  3TEG A;  2DTI A;  2ZIM A;  4YRL A;  1NJ6 A;  4YRS A;  4P73 C;  2FYK A;  3PZC A;  4Q15 A;  2ZCE A;  2EWN A;  3EUB 3;  4HA8 A;  2DU7 A;  2ARU A;  3V7R A;  4CH3 A;  2RHQ A;  2ZT5 A;  4YRE A;  4OLF A;  5C51 B;  3L4G A;  2DJZ A;  4KR3 A;  3LSQ A;  4P71 A;  3RUX A;  1N60 C;  2E64 A;  1IL2 A;  1NYR A;  3RAC A;  1NJ5 A;  2ZIO A;  3NVW B;  2RHQ B;  2E10 A;  4RMF A;  3L4G B;  2CJB A;  4CH4 A;  11AS A;  1EIY A;  4LVK A;  3IAL A;  3UH0 A;  5F5W A;  3MF2 A;  4TQD A;  4YRG A;  1LYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...