3A7UA

Crystal structure of the bovine lipoyltransferase in its unliganded form
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
343
structure length
325
Chain Sequence
GLILQSISNDVYHNLAVEDWIHDHMNLEGKPVLFLWRNSPTVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLVVRALKAVHPHLDVQATKRFDLLLDGQFKISGTASKIGRNAAYHHCTLLCGTDGTFLSSLLKKNLMEKDPTLTCEVVINAVATEYATSHQIDNHIHLINPTDETVFPGINSKAIELQTWEWIYGKTPKFSVDTSFTVLHEQSHVEIKVFIDVKNGRIEVCNIEAPDHWLPLEICDQLNSSLIGSKFSPIETTVLTSILHRTYPGDDELHSKWNILCEKIKGIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Global conformational change associated with the two-step reaction catalyzed by Escherichia coli lipoate-protein ligase A.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
molecule keywords Lipoyltransferase 1, mitochondrial
total genus 84
structure length 325
sequence length 343
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 3a7uA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3a7uA01
1BIAA 1X56A 3A7AA 4H02A 4P74A 4XTVA 3HXVA 4P72A 4XU3A 4HWPA 2RHSB 1NJ6A 4XU1A 1ATIA 2DTOA 4P73C 1WQWA 1X55A 2DVEA 4YRRA 1B70A 2EJGA 4G85A 1N9WA 2PMEA 1B76A 2ZINA 2J3LA 4P72C 3ETRB 3UGQA 4WF2A 2ARTA 3RKXA 3HY1A 1EQRA 4H2YA 2Q7EA 1VDVA 2RHQA 4YRJA 1ASZA 3BJUA 4PG3A 3HRIA 3HXZA 3P8VA 1L0WA 1B7YA 3REXA 3P8TA 3CMQA 2E41A 4XTXA 1SRYA 1FFUC 4P71C 5G5HB 4P75C 4DPGA 1NJ2A 3E9HA 4CH5A 3A74A 3LSQA 2RHQB 3M4PA 3WQZA 1X2HA 4AH6A 4HA8A 4H2UA 4TVAA 3ICAA 4LNSA 2ZZFA 3A5ZA 2E64A 4CS2A 1YGBA 3A7RA 3E9IA 3HTZA 2RHSA 4K87A 2AKWA 4YRMA 4EX5A 1PYSA 2CIMA 4YRPA 1NYRA 1SETA 1EOVA 2DQ3A 3V8JA 3ERRA 4KR3A 3VQYA 5K1XA 3A32A 4UP7A 2ZZEA 4YRQA 1V97A 2DTHA 2ZGWA 1QE0A 4L87A 1X01A 4UP8A 3EUB3 4TVYA 2IY5A 3V7SA 2DQ0A 1EIYA 4WJ3M 4HWOA 1J5WA 2CJAA 3REUA 5F5WA 3RUXA 3RL6A 1EVLA 2E3CA 1SESA 2DU5A 4CH3A 4YPFA 2P0LA 4YRKA 2DXUA 3VQVA 1EVKA 3QO5A 3NVYB 3RKWA 2I4NA 3EFSA 3A31A 4Q6GA 1PYSB 4YRCA 4O2DA 4XTZA 3UFGA 1WPYA 1H4VB 2G4CA 3BFMA 3V8KA 3DSQA 1BBUA 1NJ5A 4XEMA 2QHSA 4UPAA 1GGMA 4OLFA 3MF2A 2I4OA 2Q7HA 4ZOHB 1VQZA 1YB3A 1YFSA 2W3SA 2ZTGA 3HFVA 1LYLA 2W55A 4YCVA 1BIBA 3L1AA 5K1PA 2W54A 4TWAA 1B70B 4RQFA 3HXUA 4P73A 3TUPA 1USYC 2J3MA 2ZCEA 4H2XB 2AMCB 3HRDC 1N5XA 2E5AA 4EO4A 3SR6B 1JRPA 2DKGA 3R07C 3NELA 1Z7MA 2CJ9A 3IKLA 5G5GB 4XEOA 1ADYA 2Q5HA 3V7CA 4OP0A 1H4QA 2EAYA 2ZIMA 1C0AA 4E51A 1NJ1A 2ZNJA 3TEGA 4YROA 4NCXA 4ZTZB 3AN1A 2E65A 1KMNA 3UH0A 2ALYA 1JROA 3OD1A 2QHTA 3NRZB 3QTCA 3KFUA 3PCOB 1EFWA 1N5WC 1WLEA 2CJBA 2HNIA 3I7FA 4XTUA 4RQEA 3B9JB 2ZR2A 4RMFA 1JJCA 4YRGA 4UP9A 3RACA 1WYGA 1NYQA 2AMCA 4CS4A 3LSSA 1RM6B 2I4LA 3AMZA 1B8AA 1G5HA 1ASYA 4RDXA 4G84A 4HVCA 2EL9A 2ALYB 1SERA 1G51A 4HWRA 1G5IA 1EIYB 2ARSA 1ADJA 4KR2A 2ODRD 2ZT5A 4TVAB 1E1TA 3R07A 4X5OA 4P74C 3IALA 1N62C 4TVWA 2DZCA 4P3NA 2ZIOA 2EJFA 3LC0A 1USYA 4KQEA 1FYFA 2CGHA 1KOGA 1YFRA 3A5YA 1YFTA 2DEQA 4WJ4A 4H2VA 1E24A 5HGQA 3MEYA 3UGTA 3FJPA 4YP0A 5ELOA 1BBWA 2QHUA 3TEHA 2Q5IA 1E1OA 1RIQA 4XU2A 4Q15A 2XTIA 3L4GB 1N60C 3RGLA 4YRIA 3P8YA 4YRLA 1HC7A 2FYKA 2E1HA 3HFZB 1E22A 3AM9A 4P71A 12ASA 3IG2A 3HRKA 1FIQB 1FO4A 3HXWA 3NS1B 3VBBA 3W3SA 3NVZB 4CH4A 1FFVC 4TQDA 2ARUA 2ZNIA 3L2ZA 3HY0A 2DZ9A 4BWAA 2EJ9A 3HXYA 3RIRA 4YYEA 4J15A 4XTYA 1W66A 4K88A 1X2GA 3NVWB 1B7YB 11ASA 1H4SA 4DQ2A 3TEHB 4YREA 3L4GA 2QHVA 4H2WA 4YCUA 3RF1A 4BW9A 4CH6A 3RKYA 2EWNA 1NJ8A 2ODRC 4YDQA 4P3OA 2E3TA 2IY5B 3HFZA 4PHCA 3NETA 1HXDA 1N63C 4YRFA 3MF1A 2ZT8A 4YCWA 2DU7A 3NVVB 2C8MA 1WYDA 2DDZA 3M4QA 1SB3B 2PMFA 1NNHA 3PCOA 2P5IA 3VQWA 2AKWB 4YRNA 2C7IA 5E3IA 2XGTA 4HWSA 4H2XA 1WU7A 4XTWA 4YRTA 3HXXA 3V8LA 3QO7A 3NEMA 1T3QC 3QO8A 3PZCA 1N61C 2I4MA 2Q7GA 5C53B 3A7UA 3G1ZA 4ZTUB 4YRSA 1H4TA 5C52B 2DTIA 5ELNA 3V7RA 3VQXA 4ZIBA 4H2SA 4HWTA 5KNNA 1JJCB 1WNLA 1Z7NA 1ZXIC 3NENA 2E10A 4CS3A 2ZZGA 2ZXFA 2DXTA 2ZR3A 4P75A 2W3RA 1WQ7A 2ZT7A 4P3PA 4XU0A 4WI1A 1IL2A 1QF6A 2ZT6A 4K86A 4TQFA 1X54A 3EFRA 1HTTA 1KMMA 4H2TA 3QNEA 5C51B 2DJZA 3IKMB 4TTVA
chains in the Genus database with same CATH superfamily
1BIAA 3ZLHA 2EQ8A 3UCDA 1RVKA 1SJDA 4HCLA 1X56A 4A35A 2NPXA 3A7AA 4H02A 3CT2A 4P74A 4XTVA 3HXVA 1STZA 3URHA 3VC5A 3NXLA 2BC0A 5JCMA 4P72A 3SQPA 4XU3A 4HWPA 3QPEA 2RHSB 2WPCA 4GGBA 1NJ6A 2PPGA 4XU1A 4H2HA 1ZMDA 4EMIA 1ATIA 2DTOA 1WQWA 4P73C 3T9PA 1X55A 2DVEA 2ZC8A 3DG3A 1KD0A 4YRRA 1GRFA 1B70A 2EJGA 1FECA 2EQ7A 1Q1WA 1Q1RA 4G85A 1N9WA 4GFIA 4EQXA 3FCPA 1B76A 2ZINA 4HCDA 3MQZA 3R11A 2J3LA 1H2IA 4P72C 3ETRB 2A8EA 4LVKA 3UGVA 4LVMA 1GXFA 1LPFA 3UGQA 4WF2A 4GRTA 1LVLA 4GR1A 2ARTA 3FYYA 5FS9A 2OX4A 5FJRA 3RKXA 3HY1A 4JN8A 1EQRA 2V3AA 4H2YA 5JCLA 2Q7EA 1VDVA 1GEUA 2PTYA 2ZZ0A 2RHQA 4YRJA 1ASZA 4YWOA 3BJUA 4PG3A 3HRIA 4BV6A 3HXZA 3P8VA 1L0WA 4LVLA 1B7YA 3SSZA 4HNCA 4IZGA 3R0KA 3REXA 4JN7A 3RITA 3MZNA 3P8TA 3CMQA 3O0HA 2E41A 3DFHA 3FJ4A 4XTXA 2WP6A 1SRYA 1FFUC 4H4UA 4P71C 4JQ9A 2QDEA 5G5HB 5IDZA 1P43A 4P75C 4DPGA 3OC4A 1NJ2A 1KCZA 2QAEA 3VC6A 3E9HA 4CH5A 3A74A 3LSQA 2V6OA 4MGGA 1H6VA 2A8XA 3DK9A 2PTZA 2YVFA 2RHQB 3OZYA 1EC9A 4H4RA 3UJFA 3D47A 3M4PA 3WQZA 2ZNIA 2PTWA 3TJIA 2GR0A 1X2HA 4AH6A 4HA8A 2WPEA 4H2UA 2ZADA 2BC1A 4TVAA 2YQUA 2PGEA 3ICAA 4LNSA 2ZZFA 3A5ZA 2E64A 4CS2A 1F3PA 2WOIA 3A7RA 2HZGA 1YGBA 3E9IA 3HTZA 2CHRA 2RHSA 4K87A 3MUCA 4Z17A 2PMQA 1YQZA 1DXLA 1WUFA 3CGDA 3ENLA 2AKWA 2OG9A 4JHMA 2C3CA 4YRMA 3H7VA 1GRGA 4EX5A 1PYSA 2CIMA 2P0IA 2PP0A 4YRPA 3L8KA 1NYRA 2X8CA 1SETA 1GERA 1EOVA 2DQ3A 3V8JA 2YVJA 3ERRA 2GL5A 4KR3A 3VQYA 3H8AA 1ZX9A 5K1XA 2OKTA 3ES7A 3A32A 4EQSA 3JZUA 4UP7A 2ZZEA 3THUA 4YRQA 1V97A 5FJPA 3ZVIA 2DTHA 2ZGWA 2GH5A 1QE0A 4K7ZA 1PDZA 4H4YA 4L87A 2WP5A 1X01A 3EUB3 4TVYA 4UP8A 3V4BA 2IY5A 4LVIA 3V7SA 2DQ0A 1EIYA 4WJ3M 1SJBA 4HWOA 1J5WA 1ZDLA 2PODA 3KLJA 2ONEA 2CJAA 4IT1A 1ZKQA 2CFYA 3ZLFA 2MNRA 1MDLA 3FVDA 3REUA 2GGJA 4KEMA 3MWCA 5F5WA 3RUXA 3RL6A 3RGTA 4ADWA 1EVLA 5ENLA 1W6TA 3FXGA 5KVHA 1SESA 2E3CA 2DU5A 4IL0A 4CH3A 4YPFA 2P0LA 2EQ6A 4K8DA 2DJZA 4GMEA 2WOWA 2J3NA 4GISA 4YRKA 3JVAA 2AL2A 2DXUA 3VQVA 2BCPA 1EVKA 3QO5A 1KKRA 3NVYB 3CB3A 4DYEA 3RKWA 3OPSA 1FHUA 2I4NA 3EFSA 3A31A 2EQ9A 3PFRA 3DK4A 3EF6A 3VDGA 1WUEA 1F8WA 4Q6GA 1PYSB 2P8BA 2AKMA 3P0WA 4YRCA 2TPRA 4LVJA 3Q45A 3OP2A 3OW1A 2JK6A 4O2DA 1EBGA 4XTZA 3UJ2A 2RDXA 3UFGA 4M0XA 3VA8A 3ZVHB 4DN1A 1BQGA 1KN0A 1TE6A 3SQSA 3TOYA 5JCNA 1WPYA 2PU1A 1AOGA 1EC7A 1H4VB 2G4CA 2PP3A 3BFMA 3V8KA 3DSQA 3NENA 2OPJA 2OFJA 1BBUA 1NJ5A 5EBKA 1D7YA 4XEMA 1TZZA 2QHSA 2PA6A 4UPAA 4H4PA 3PWIA 1GGMA 1GV4A 3DG7A 1DTNA 4OLFA 3MF2A 2P88A 3DEQA 2I4OA 2Q7HA 4ZOHB 1VQZA 3CGEA 4HT4A 4M6UA 1YB3A 2O56A 7ENLA 1YFSA 4F4RA 2GR3A 1ZK7A 2W3SA 3DIPA 3TJ4A 2R9ZA 3QKEA 3SN4A 2GR1A 1XPYA 2ZTGA 1IYXA 3HFVA 3N6HA 1LYLA 2GGHA 2W55A 4YCVA 3D46A 4H19A 1BIBA 1MO9A 3L1AA 3RNMA 5K1PA 2W54A 4FX9A 1MUCA 4TWAA 1B70B 4RQFA 3HXUA 3QTPA 4P73A 5TR3A 3CXOA 2YVGA 1GRTA 3TUPA 3DGHA 3V5CA 2OZTA 4K1WA 1USYC 2J3MA 2P3ZA 1PDYA 4FDCB 2ZCEA 2AMCB 4H2XB 3HRDC 1N5XA 2E5AA 3CXBA 4EO4A 1NHSA 5FJTA 3CGCA 3T4WA 2OLAA 4GYPA 1JRPA 3SR6B 2DKGA 4GIRA 3R10A 2GSHA 2MUCA 3R07C 3NELA 4YWSA 2AL1A 4H4ZA 2PSNA 1Z7MA 2CJ9A 4E6MA 5BOEA 3IKLA 3STPA 5G5GB 4XEOA 5JCIA 1ADYA 2Q5HA 3IC9A 3V7CA 4OP0A 4H4TA 1JCTA 1H4QA 2EAYA 1R6WA 2ZIMA 1KKOA 1C0AA 2ZZCA 4E51A 2X8HA 1EBHA 1EBDA 3UJRA 4J1OA 3P3BA 1M6IA 3MSYA 4GGHA 1NJ1A 2ZNJA 3PWGA 1ECQA 2OO6A 3N6JA 4NCXA 4YROA 3AN1A 3RRAA 3TEGA 4ZTZB 2E65A 3UXKA 4IHCA 1KMNA 3UH0A 4E8GA 2QGYA 3UCCA 3T8QA 3ZVHA 2ALYA 4HNLA 1JROA 3OD1A 2QHTA 3NRZB 4E4FA 3QTCA 3KFUA 3PCOB 1EFWA 1N5WC 4H50A 2CDUA 1WLEA 4DHGA 2CJBA 2XH0A 3TEHA 2HNIA 1SJCA 3BOXA 1BZLA 3ES8A 3I7FA 4XTUA 4RQEA 3B9JB 2ZR2A 3K1GA 2PTXA 2QJJA 4K2SA 4RMFA 3Q4DA 1JJCA 2I5QA 2OZ3A 4YRGA 1S7MA 4GYPC 2XGZA 2PS2A 4UP9A 3N4EA 3RACA 1WYGA 1NYQA 2AMCA 4CS4A 1R0MA 3LSSA 4IP5A 1RM6B 1E9IA 2I4LA 4DWDA 3AMZA 1NELA 4H1ZA 3SN1A 1B8AA 4Z1YA 1V59A 3MY9A 2AKZA 1G5HA 3DJGX 4RDXA 1ASYA 4LIIA 2V3BA 4G84A 1YEYA 4E5TA 4HVCA 2QVHA 2XH2A 3S47A 4E4UA 2ALYB 2EL9A 3SJNA 3V5FA 1SERA 4KWSA 2PU0A 1G51A 3EKGA 4HWRA 1G5IA 1EIYB 3IJLA 2ARSA 4JDRA 2WPFA 4HN8A 1ADJA 1NPXA 3CYJA 5FMHA 4X2PA 4KR2A 2ODRD 2GQWA 2ZT5A 4TVAB 1GRHA 1E1TA 3R07A 4G8TA 5GRTA 4X5OA 4A3RA 1ZMCA 2NS6A 4P74C 3IALA 1N62C 2X99A 4TVWA 2DZCA 3MQTA 4P3NA 2X8GA 1ZY8A 3DGBA 2DW6A 2ZIOA 2EJFA 3LC0A 1JOAA 1USYA 3RO6A 4KQEA 1FYFA 2AL2B 2CGHA 3IKMB 1YFRA 3A5YA 1GSNA 1KOGA 2OVLA 4IL2A 1YFTA 4KPRA 2DEQA 5FS8A 4WJ4A 3DDMA 3LXDA 4H2VA 1E24A 5HGQA 3MEYA 3DJJA 3UGTA 2PGWA 3CK5A 3FJPA 5JCKA 2WBAA 4YP0A 5ELOA 3MKCA 1BBWA 2QHUA 3R1ZA 2POZA 2HNEA 4ZCWA 1NHPA 2AAQA 5U1OA 4APNA 1ELSA 2QQ6A 1E1OA 1RIQA 2Q5IA 1FEBA 4Q15A 2XTIA 3L4GB 4XU2A 3EANA 1N60C 1GRAA 4MMWA 2OQHA 3RGLA 2XSXA 3ZLGA 4YRIA 5EU9A 1OJTA 3P8YA 4YRLA 1HC7A 3UJEA 2FYKA 2E1HA 3FV9A 2YAUA 3HFZB 1GESA 4ZA0A 1E22A 3AM9A 3UJSA 4DX3A 12ASA 3TWAA 4P71A 5JRBA 3HRKA 1FIQB 1FO4A 1ONEA 3I6EA 3IJIA 3NS1B 3HXWA 3IG2A 3VBBA 3W3SA 3H12A 1JDFA 2RABA 3NVZB 3DERA 3HPFA 4CH4A 2GGGA 4H4SA 3DFYA 1FFVC 3T6CA 3N4FA 3GC2A 4TQDA 2GGEA 2GR2A 4H4VA 4HPNA 3GD6A 2ARUA 3R0UA 2DZ9A 3HY0A 5ER0A 2EJ9A 3H70A 5FS7A 3L2ZA 2P8CA 4BWAA 5BOFA 3HXYA 3RIRA 4IP4A 3L5OA 4YYEA 3DGZA 2PP1A 3DESA 4J15A 4XTYA 1W66A 2OZ8A 2FYMA 1MDRA 2GRTA 4K88A 4EMJA 1NHQA 1X2GA 3OTRA 4H4QA 3NVWB 2OQYA 1B7YB 3DK8A 3VCNA 4K8GA 2GGIA 3PK7A 4H83A 3EAOA 11ASA 3HW2A 1H4SA 3S5SA 4DQ2A 3TEHB 4YREA 3BJSA 2WOVA 3SN0A 3DG6A 3L4GA 1EC8A 1NDAA 2F5ZA 3LB8A 2PMEA 2QHVA 3UXLA 5FS6A 4FP1A 4H2WA 2FKPA 4YCUA 3RF1A 4BW9A 1F9CA 3P93A 3B97A 4EM4A 3RKYA 4CH6A 3I6TA 2EWNA 3Q6JA 4J57A 4NEWA 3TWBA 1MNSA 3R25A 1NJ8A 2ODRC 4YDQA 1TYPA 4P3OA 2E3TA 2IY5B 3HFZA 1OEPA 4PHCA 3CGBA 3NETA 1TKKA 1HXDA 1FEAA 2QDDA 1XHCA 3CAWA 4FI4A 1N63C 2NQLA 4J3ZA 4YRFA 3MF1A 3QN3A 3GY1A 3KUMA 3VCCA 2ZT8A 4YCWA 2DU7A 3NVVB 3VFCA 2C8MA 3IJQA 3TQPA 1XANA 1WYDA 3TCSA 2DDZA 3M4QA 4BURA 1FHVA 1SB3B 2PMFA 4KT2A 3FG2P 4HYRA 1NNHA 3PCOA 2P5IA 3VQWA 4EQWA 2AKWB 3D9XA 4DXKA 4YRNA 2C7IA 5E3IA 2XGTA 4MKSA 4HWSA 4H2XA 1WU7A 4KPLA 4ROPA 4XTWA 3QFBA 3TTEA 4YRTA 3HXXA 3GD4A 3QO7A 3NEMA 3V8LA 1T3QC 4NEVA 3RCYA 4EMWA 3PZCA 3QO8A 1N61C 3TW9A 4EM3A 1MOKA 4A6GA 2I4MA 3NFUA 2NVKX 1BKHA 1P48A 2W0HA 4EWJA 2XH4A 2Q7GA 3BSMA 5C53B 3A7UA 3G1ZA 4ZTUB 1XDIA 2HXTA 4YRSA 1GRBA 2QJMA 2PCEA 3GRTA 1H4TA 5C52B 2DTIA 1NHRA 4DNAA 1ONFA 5ELNA 2DW7A 3NO1A 3V7RA 3VQXA 1JPMA 4ZIBA 4G7FA 3V3WA 6ENLA 4H2SA 3II4A 2HXUA 4M52A 1SJAA 4HWTA 5KNNA 1JJCB 1WNLA 3H4KA 1Z7NA 1ZXIC 1GREA 1GETA 2HQMA 1XS2A 4ENLA 5J04A 2E10A 2ZZGA 5U25A 2ZXFA 3DH9A 2DXTA 4CS3A 3EEZA 2ZR3A 4P75A 2W3RA 3QLDA 4LA1A 1WQ7A 2ZT7A 1NU5A 4P3PA 3QFAA 3U9IA 4XU0A 5FJUA 4WI1A 1IL2A 3OZMA 3GO2A 1K4QA 1QF6A 3GD3A 1TYTA 1DNCA 3IK4A 4HCHA 4EQRA 2ZT6A 3I4KA 5KVIA 3U4FA 3SBFA 3RR1A 1BWCA 4K86A 3NZGA 4TQFA 1X54A 4H4XA 2C3DA 3EFRA 2GDQA 4J56A 3GRSA 3JW7A 5FJOA 1HTTA 1KMMA 4H2TA 1JPDX 2ZZBA 2XH7A 3PG6A 1MRAA 2QJNA 1L8PA 3QNEA 3LADA 5C51B 4H4WA 1JEHA 2X50A 4TTVA
chains in the Genus database with same CATH topology
1BIAA 1X56A 3A7AA 4H02A 4P74A 4XTVA 3HXVA 4P72A 4XU3A 4HWPA 2RHSB 1NJ6A 4XU1A 1ATIA 2DTOA 4P73C 1WQWA 1X55A 2DVEA 4YRRA 1B70A 2EJGA 4G85A 1N9WA 2PMEA 1B76A 2ZINA 3MQZA 4LVKA 2J3LA 4P72C 3ETRB 2A8EA 4LVMA 3UGQA 4WF2A 2ARTA 3RKXA 3HY1A 1EQRA 4H2YA 2Q7EA 1VDVA 2RHQA 4YRJA 1ASZA 3BJUA 4PG3A 3HRIA 3HXZA 3P8VA 1L0WA 4LVLA 1B7YA 3REXA 3P8TA 3CMQA 2E41A 4XTXA 1SRYA 1FFUC 4P71C 5G5HB 4P75C 4DPGA 1NJ2A 3E9HA 4CH5A 3A74A 3LSQA 2RHQB 3M4PA 3WQZA 1X2HA 4AH6A 4HA8A 4H2UA 4TVAA 3ICAA 4LNSA 2ZZFA 3A5ZA 2E64A 4CS2A 1YGBA 3A7RA 3E9IA 3HTZA 2RHSA 4K87A 2AKWA 4YRMA 4EX5A 1PYSA 2CIMA 4YRPA 1NYRA 1SETA 1EOVA 2DQ3A 3V8JA 3ERRA 4KR3A 3VQYA 5K1XA 3A32A 4UP7A 2ZZEA 4YRQA 1V97A 2DTHA 2ZGWA 1QE0A 4L87A 1X01A 4UP8A 3EUB3 4TVYA 2IY5A 4LVIA 3V7SA 2DQ0A 1EIYA 4WJ3M 4HWOA 1J5WA 2CJAA 3REUA 5F5WA 3RUXA 3RL6A 1EVLA 2E3CA 1SESA 2DU5A 4CH3A 4YPFA 2P0LA 4YRKA 2DXUA 3VQVA 1EVKA 3QO5A 3NVYB 3RKWA 2I4NA 3EFSA 3A31A 4Q6GA 1PYSB 4YRCA 4LVJA 4O2DA 4XTZA 3UFGA 1WPYA 1H4VB 2G4CA 3BFMA 3V8KA 3DSQA 1BBUA 1NJ5A 4XEMA 2QHSA 4UPAA 1GGMA 4OLFA 3MF2A 2I4OA 2Q7HA 4ZOHB 1VQZA 4HT4A 1YB3A 1YFSA 2W3SA 2ZTGA 3HFVA 1LYLA 2W55A 4YCVA 1BIBA 3L1AA 5K1PA 2W54A 4TWAA 1B70B 4RQFA 3HXUA 4P73A 3TUPA 1USYC 2J3MA 2ZCEA 4H2XB 2AMCB 3HRDC 1N5XA 2E5AA 4EO4A 3SR6B 1JRPA 2DKGA 3R07C 3NELA 1Z7MA 2CJ9A 3IKLA 5G5GB 4XEOA 1ADYA 2Q5HA 3V7CA 4OP0A 1H4QA 2EAYA 2ZIMA 1C0AA 4E51A 1NJ1A 2ZNJA 3TEGA 4YROA 4NCXA 4ZTZB 3AN1A 2E65A 1KMNA 3UH0A 2ALYA 1JROA 3OD1A 2QHTA 3NRZB 3QTCA 3KFUA 3PCOB 1EFWA 1N5WC 1WLEA 2CJBA 2HNIA 3I7FA 4XTUA 4RQEA 3B9JB 2ZR2A 4RMFA 1JJCA 4YRGA 4UP9A 3RACA 1WYGA 1NYQA 2AMCA 4CS4A 3LSSA 1RM6B 2I4LA 3AMZA 1B8AA 1G5HA 1ASYA 4RDXA 4G84A 4HVCA 2EL9A 2ALYB 1SERA 1G51A 4HWRA 1G5IA 1EIYB 2ARSA 1ADJA 4KR2A 2ODRD 2ZT5A 4TVAB 1E1TA 3R07A 4X5OA 2NS6A 4P74C 3IALA 1N62C 4TVWA 2DZCA 4P3NA 2ZIOA 2EJFA 3LC0A 1USYA 4KQEA 1FYFA 2CGHA 1KOGA 1YFRA 3A5YA 1YFTA 2DEQA 4WJ4A 4H2VA 1E24A 5HGQA 3MEYA 3UGTA 3FJPA 4YP0A 5ELOA 1BBWA 2QHUA 3TEHA 2Q5IA 1E1OA 1RIQA 4XU2A 4Q15A 2XTIA 3L4GB 1N60C 3RGLA 4YRIA 3P8YA 4YRLA 1HC7A 2FYKA 2E1HA 3HFZB 1E22A 3AM9A 4P71A 12ASA 3IG2A 3HRKA 1FIQB 1FO4A 3HXWA 3NS1B 3VBBA 3W3SA 3NVZB 4CH4A 1FFVC 4TQDA 2ARUA 2ZNIA 3L2ZA 3HY0A 2DZ9A 4BWAA 2EJ9A 3HXYA 3RIRA 4YYEA 4J15A 4XTYA 1W66A 4K88A 1X2GA 3NVWB 1B7YB 11ASA 1H4SA 4DQ2A 3TEHB 4YREA 3L4GA 2QHVA 4H2WA 4YCUA 3RF1A 4BW9A 4CH6A 3RKYA 2EWNA 1NJ8A 2ODRC 4YDQA 4P3OA 2E3TA 2IY5B 3HFZA 4PHCA 3NETA 1HXDA 1N63C 4YRFA 3MF1A 2ZT8A 4YCWA 2DU7A 3NVVB 2C8MA 1WYDA 2DDZA 3M4QA 1SB3B 2PMFA 1NNHA 3PCOA 2P5IA 3VQWA 2AKWB 4YRNA 2C7IA 5E3IA 2XGTA 4HWSA 4H2XA 1WU7A 4XTWA 4YRTA 3HXXA 3V8LA 3QO7A 3NEMA 1T3QC 3QO8A 3PZCA 1N61C 2I4MA 2Q7GA 5C53B 3A7UA 3G1ZA 4ZTUB 4YRSA 1H4TA 5C52B 2DTIA 5ELNA 3V7RA 3VQXA 4ZIBA 4H2SA 4HWTA 5KNNA 1JJCB 1WNLA 1Z7NA 1ZXIC 3NENA 2E10A 4CS3A 2ZZGA 2ZXFA 2DXTA 2ZR3A 4P75A 2W3RA 1WQ7A 2ZT7A 4P3PA 4XU0A 4WI1A 1IL2A 1QF6A 2ZT6A 4K86A 4TQFA 1X54A 3EFRA 1HTTA 1KMMA 4H2TA 3QNEA 5C51B 2DJZA 3IKMB 4TTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIA A;  1X56 A;  3A7A A;  4H02 A;  4P74 A;  4XTV A;  3HXV A;  4P72 A;  4XU3 A;  4HWP A;  2RHS B;  1NJ6 A;  4XU1 A;  1ATI A;  2DTO A;  4P73 C;  1WQW A;  1X55 A;  2DVE A;  4YRR A;  1B70 A;  2EJG A;  4G85 A;  1N9W A;  2PME A;  1B76 A;  2ZIN A;  2J3L A;  4P72 C;  3ETR B;  3UGQ A;  4WF2 A;  2ART A;  3RKX A;  3HY1 A;  1EQR A;  4H2Y A;  2Q7E A;  1VDV A;  2RHQ A;  4YRJ A;  1ASZ A;  3BJU A;  4PG3 A;  3HRI A;  3HXZ A;  3P8V A;  1L0W A;  1B7Y A;  3REX A;  3P8T A;  3CMQ A;  2E41 A;  4XTX A;  1SRY A;  1FFU C;  4P71 C;  5G5H B;  4P75 C;  4DPG A;  1NJ2 A;  3E9H A;  4CH5 A;  3A74 A;  3LSQ A;  2RHQ B;  3M4P A;  3WQZ A;  1X2H A;  4AH6 A;  4HA8 A;  4H2U A;  4TVA A;  3ICA A;  4LNS A;  2ZZF A;  3A5Z A;  2E64 A;  4CS2 A;  1YGB A;  3A7R A;  3E9I A;  3HTZ A;  2RHS A;  4K87 A;  2AKW A;  4YRM A;  4EX5 A;  1PYS A;  2CIM A;  4YRP A;  1NYR A;  1SET A;  1EOV A;  2DQ3 A;  3V8J A;  3ERR A;  4KR3 A;  3VQY A;  5K1X A;  3A32 A;  4UP7 A;  2ZZE A;  4YRQ A;  1V97 A;  2DTH A;  2ZGW A;  1QE0 A;  4L87 A;  1X01 A;  4UP8 A;  3EUB 3;  4TVY A;  2IY5 A;  3V7S A;  2DQ0 A;  1EIY A;  4WJ3 M;  4HWO A;  1J5W A;  2CJA A;  3REU A;  5F5W A;  3RUX A;  3RL6 A;  1EVL A;  2E3C A;  1SES A;  2DU5 A;  4CH3 A;  4YPF A;  2P0L A;  4YRK A;  2DXU A;  3VQV A;  1EVK A;  3QO5 A;  3NVY B;  3RKW A;  2I4N A;  3EFS A;  3A31 A;  4Q6G A;  1PYS B;  4YRC A;  4O2D A;  4XTZ A;  3UFG A;  1WPY A;  1H4V B;  2G4C A;  3BFM A;  3V8K A;  3DSQ A;  1BBU A;  1NJ5 A;  4XEM A;  2QHS A;  4UPA A;  1GGM A;  4OLF A;  3MF2 A;  2I4O A;  2Q7H A;  4ZOH B;  1VQZ A;  1YB3 A;  1YFS A;  2W3S A;  2ZTG A;  3HFV A;  1LYL A;  2W55 A;  4YCV A;  1BIB A;  3L1A A;  5K1P A;  2W54 A;  4TWA A;  1B70 B;  4RQF A;  3HXU A;  4P73 A;  3TUP A;  1USY C;  2J3M A;  2ZCE A;  4H2X B;  2AMC B;  3HRD C;  1N5X A;  2E5A A;  4EO4 A;  3SR6 B;  1JRP A;  2DKG A;  3R07 C;  3NEL A;  1Z7M A;  2CJ9 A;  3IKL A;  5G5G B;  4XEO A;  1ADY A;  2Q5H A;  3V7C A;  4OP0 A;  1H4Q A;  2EAY A;  2ZIM A;  1C0A A;  4E51 A;  1NJ1 A;  2ZNJ A;  3TEG A;  4YRO A;  4NCX A;  4ZTZ B;  3AN1 A;  2E65 A;  1KMN A;  3UH0 A;  2ALY A;  1JRO A;  3OD1 A;  2QHT A;  3NRZ B;  3QTC A;  3KFU A;  3PCO B;  1EFW A;  1N5W C;  1WLE A;  2CJB A;  2HNI A;  3I7F A;  4XTU A;  4RQE A;  3B9J B;  2ZR2 A;  4RMF A;  1JJC A;  4YRG A;  4UP9 A;  3RAC A;  1WYG A;  1NYQ A;  2AMC A;  4CS4 A;  3LSS A;  1RM6 B;  2I4L A;  3AMZ A;  1B8A A;  1G5H A;  1ASY A;  4RDX A;  4G84 A;  4HVC A;  2EL9 A;  2ALY B;  1SER A;  1G51 A;  4HWR A;  1G5I A;  1EIY B;  2ARS A;  1ADJ A;  4KR2 A;  2ODR D;  2ZT5 A;  4TVA B;  1E1T A;  3R07 A;  4X5O A;  4P74 C;  3IAL A;  1N62 C;  4TVW A;  2DZC A;  4P3N A;  2ZIO A;  2EJF A;  3LC0 A;  1USY A;  4KQE A;  1FYF A;  2CGH A;  1KOG A;  1YFR A;  3A5Y A;  1YFT A;  2DEQ A;  4WJ4 A;  4H2V A;  1E24 A;  5HGQ A;  3MEY A;  3UGT A;  3FJP A;  4YP0 A;  5ELO A;  1BBW A;  2QHU A;  3TEH A;  2Q5I A;  1E1O A;  1RIQ A;  4XU2 A;  4Q15 A;  2XTI A;  3L4G B;  1N60 C;  3RGL A;  4YRI A;  3P8Y A;  4YRL A;  1HC7 A;  2FYK A;  2E1H A;  3HFZ B;  1E22 A;  3AM9 A;  4P71 A;  12AS A;  3IG2 A;  3HRK A;  1FIQ B;  1FO4 A;  3HXW A;  3NS1 B;  3VBB A;  3W3S A;  3NVZ B;  4CH4 A;  1FFV C;  4TQD A;  2ARU A;  2ZNI A;  3L2Z A;  3HY0 A;  2DZ9 A;  4BWA A;  2EJ9 A;  3HXY A;  3RIR A;  4YYE A;  4J15 A;  4XTY A;  1W66 A;  4K88 A;  1X2G A;  3NVW B;  1B7Y B;  11AS A;  1H4S A;  4DQ2 A;  3TEH B;  4YRE A;  3L4G A;  2QHV A;  4H2W A;  4YCU A;  3RF1 A;  4BW9 A;  4CH6 A;  3RKY A;  2EWN A;  1NJ8 A;  2ODR C;  4YDQ A;  4P3O A;  2E3T A;  2IY5 B;  3HFZ A;  4PHC A;  3NET A;  1HXD A;  1N63 C;  4YRF A;  3MF1 A;  2ZT8 A;  4YCW A;  2DU7 A;  3NVV B;  2C8M A;  1WYD A;  2DDZ A;  3M4Q A;  1SB3 B;  2PMF A;  1NNH A;  3PCO A;  2P5I A;  3VQW A;  2AKW B;  4YRN A;  2C7I A;  5E3I A;  2XGT A;  4HWS A;  4H2X A;  1WU7 A;  4XTW A;  4YRT A;  3HXX A;  3V8L A;  3QO7 A;  3NEM A;  1T3Q C;  3QO8 A;  3PZC A;  1N61 C;  2I4M A;  2Q7G A;  5C53 B;  3A7U A;  3G1Z A;  4ZTU B;  4YRS A;  1H4T A;  5C52 B;  2DTI A;  5ELN A;  3V7R A;  3VQX A;  4ZIB A;  4H2S A;  4HWT A;  5KNN A;  1JJC B;  1WNL A;  1Z7N A;  1ZXI C;  3NEN A;  2E10 A;  4CS3 A;  2ZZG A;  2ZXF A;  2DXT A;  2ZR3 A;  4P75 A;  2W3R A;  1WQ7 A;  2ZT7 A;  4P3P A;  4XU0 A;  4WI1 A;  1IL2 A;  1QF6 A;  2ZT6 A;  4K86 A;  4TQF A;  1X54 A;  3EFR A;  1HTT A;  1KMM A;  4H2T A;  3QNE A;  5C51 B;  2DJZ A;  3IKM B;  4TTV A; 
#chains in the Genus database with same CATH topology
 1BIA A;  3ZLH A;  2EQ8 A;  3UCD A;  1RVK A;  1SJD A;  4HCL A;  1X56 A;  4A35 A;  2NPX A;  3A7A A;  4H02 A;  3CT2 A;  4P74 A;  4XTV A;  3HXV A;  1STZ A;  3URH A;  3VC5 A;  3NXL A;  2BC0 A;  5JCM A;  4P72 A;  3SQP A;  4XU3 A;  4HWP A;  3QPE A;  2RHS B;  2WPC A;  4GGB A;  1NJ6 A;  2PPG A;  4XU1 A;  4H2H A;  1ZMD A;  4EMI A;  1ATI A;  2DTO A;  1WQW A;  4P73 C;  3T9P A;  1X55 A;  2DVE A;  2ZC8 A;  3DG3 A;  1KD0 A;  4YRR A;  1GRF A;  1B70 A;  2EJG A;  1FEC A;  2EQ7 A;  1Q1W A;  1Q1R A;  4G85 A;  1N9W A;  4GFI A;  4EQX A;  3FCP A;  1B76 A;  2ZIN A;  4HCD A;  3MQZ A;  3R11 A;  2J3L A;  1H2I A;  4P72 C;  3ETR B;  2A8E A;  4LVK A;  3UGV A;  4LVM A;  1GXF A;  1LPF A;  3UGQ A;  4WF2 A;  4GRT A;  1LVL A;  4GR1 A;  2ART A;  3FYY A;  5FS9 A;  2OX4 A;  5FJR A;  3RKX A;  3HY1 A;  4JN8 A;  1EQR A;  2V3A A;  4H2Y A;  5JCL A;  2Q7E A;  1VDV A;  1GEU A;  2PTY A;  2ZZ0 A;  2RHQ A;  4YRJ A;  1ASZ A;  4YWO A;  3BJU A;  4PG3 A;  3HRI A;  4BV6 A;  3HXZ A;  3P8V A;  1L0W A;  4LVL A;  1B7Y A;  3SSZ A;  4HNC A;  4IZG A;  3R0K A;  3REX A;  4JN7 A;  3RIT A;  3MZN A;  3P8T A;  3CMQ A;  3O0H A;  2E41 A;  3DFH A;  3FJ4 A;  4XTX A;  2WP6 A;  1SRY A;  1FFU C;  4H4U A;  4P71 C;  4JQ9 A;  2QDE A;  5G5H B;  5IDZ A;  1P43 A;  4P75 C;  4DPG A;  3OC4 A;  1NJ2 A;  1KCZ A;  2QAE A;  3VC6 A;  3E9H A;  4CH5 A;  3A74 A;  3LSQ A;  2V6O A;  4MGG A;  1H6V A;  2A8X A;  3DK9 A;  2PTZ A;  2YVF A;  2RHQ B;  3OZY A;  1EC9 A;  4H4R A;  3UJF A;  3D47 A;  3M4P A;  3WQZ A;  2ZNI A;  2PTW A;  3TJI A;  2GR0 A;  1X2H A;  4AH6 A;  4HA8 A;  2WPE A;  4H2U A;  2ZAD A;  2BC1 A;  4TVA A;  2YQU A;  2PGE A;  3ICA A;  4LNS A;  2ZZF A;  3A5Z A;  2E64 A;  4CS2 A;  1F3P A;  2WOI A;  3A7R A;  2HZG A;  1YGB A;  3E9I A;  3HTZ A;  2CHR A;  2RHS A;  4K87 A;  3MUC A;  4Z17 A;  2PMQ A;  1YQZ A;  1DXL A;  1WUF A;  3CGD A;  3ENL A;  2AKW A;  2OG9 A;  4JHM A;  2C3C A;  4YRM A;  3H7V A;  1GRG A;  4EX5 A;  1PYS A;  2CIM A;  2P0I A;  2PP0 A;  4YRP A;  3L8K A;  1NYR A;  2X8C A;  1SET A;  1GER A;  1EOV A;  2DQ3 A;  3V8J A;  2YVJ A;  3ERR A;  2GL5 A;  4KR3 A;  3VQY A;  3H8A A;  1ZX9 A;  5K1X A;  2OKT A;  3ES7 A;  3A32 A;  4EQS A;  3JZU A;  4UP7 A;  2ZZE A;  3THU A;  4YRQ A;  1V97 A;  5FJP A;  3ZVI A;  2DTH A;  2ZGW A;  2GH5 A;  1QE0 A;  4K7Z A;  1PDZ A;  4H4Y A;  4L87 A;  2WP5 A;  1X01 A;  3EUB 3;  4TVY A;  4UP8 A;  3V4B A;  2IY5 A;  4LVI A;  3V7S A;  2DQ0 A;  1EIY A;  4WJ3 M;  1SJB A;  4HWO A;  1J5W A;  1ZDL A;  2POD A;  3KLJ A;  2ONE A;  2CJA A;  4IT1 A;  1ZKQ A;  2CFY A;  3ZLF A;  2MNR A;  1MDL A;  3FVD A;  3REU A;  2GGJ A;  4KEM A;  3MWC A;  5F5W A;  3RUX A;  3RL6 A;  3RGT A;  4ADW A;  1EVL A;  5ENL A;  1W6T A;  3FXG A;  5KVH A;  1SES A;  2E3C A;  2DU5 A;  4IL0 A;  4CH3 A;  4YPF A;  2P0L A;  2EQ6 A;  4K8D A;  2DJZ A;  4GME A;  2WOW A;  2J3N A;  4GIS A;  4YRK A;  3JVA A;  2AL2 A;  2DXU A;  3VQV A;  2BCP A;  1EVK A;  3QO5 A;  1KKR A;  3NVY B;  3CB3 A;  4DYE A;  3RKW A;  3OPS A;  1FHU A;  2I4N A;  3EFS A;  3A31 A;  2EQ9 A;  3PFR A;  3DK4 A;  3EF6 A;  3VDG A;  1WUE A;  1F8W A;  4Q6G A;  1PYS B;  2P8B A;  2AKM A;  3P0W A;  4YRC A;  2TPR A;  4LVJ A;  3Q45 A;  3OP2 A;  3OW1 A;  2JK6 A;  4O2D A;  1EBG A;  4XTZ A;  3UJ2 A;  2RDX A;  3UFG A;  4M0X A;  3VA8 A;  3ZVH B;  4DN1 A;  1BQG A;  1KN0 A;  1TE6 A;  3SQS A;  3TOY A;  5JCN A;  1WPY A;  2PU1 A;  1AOG A;  1EC7 A;  1H4V B;  2G4C A;  2PP3 A;  3BFM A;  3V8K A;  3DSQ A;  3NEN A;  2OPJ A;  2OFJ A;  1BBU A;  1NJ5 A;  5EBK A;  1D7Y A;  4XEM A;  1TZZ A;  2QHS A;  2PA6 A;  4UPA A;  4H4P A;  3PWI A;  1GGM A;  1GV4 A;  3DG7 A;  1DTN A;  4OLF A;  3MF2 A;  2P88 A;  3DEQ A;  2I4O A;  2Q7H A;  4ZOH B;  1VQZ A;  3CGE A;  4HT4 A;  4M6U A;  1YB3 A;  2O56 A;  7ENL A;  1YFS A;  4F4R A;  2GR3 A;  1ZK7 A;  2W3S A;  3DIP A;  3TJ4 A;  2R9Z A;  3QKE A;  3SN4 A;  2GR1 A;  1XPY A;  2ZTG A;  1IYX A;  3HFV A;  3N6H A;  1LYL A;  2GGH A;  2W55 A;  4YCV A;  3D46 A;  4H19 A;  1BIB A;  1MO9 A;  3L1A A;  3RNM A;  5K1P A;  2W54 A;  4FX9 A;  1MUC A;  4TWA A;  1B70 B;  4RQF A;  3HXU A;  3QTP A;  4P73 A;  5TR3 A;  3CXO A;  2YVG A;  1GRT A;  3TUP A;  3DGH A;  3V5C A;  2OZT A;  4K1W A;  1USY C;  2J3M A;  2P3Z A;  1PDY A;  4FDC B;  2ZCE A;  2AMC B;  4H2X B;  3HRD C;  1N5X A;  2E5A A;  3CXB A;  4EO4 A;  1NHS A;  5FJT A;  3CGC A;  3T4W A;  2OLA A;  4GYP A;  1JRP A;  3SR6 B;  2DKG A;  4GIR A;  3R10 A;  2GSH A;  2MUC A;  3R07 C;  3NEL A;  4YWS A;  2AL1 A;  4H4Z A;  2PSN A;  1Z7M A;  2CJ9 A;  4E6M A;  5BOE A;  3IKL A;  3STP A;  5G5G B;  4XEO A;  5JCI A;  1ADY A;  2Q5H A;  3IC9 A;  3V7C A;  4OP0 A;  4H4T A;  1JCT A;  1H4Q A;  2EAY A;  1R6W A;  2ZIM A;  1KKO A;  1C0A A;  2ZZC A;  4E51 A;  2X8H A;  1EBH A;  1EBD A;  3UJR A;  4J1O A;  3P3B A;  1M6I A;  3MSY A;  4GGH A;  1NJ1 A;  2ZNJ A;  3PWG A;  1ECQ A;  2OO6 A;  3N6J A;  4NCX A;  4YRO A;  3AN1 A;  3RRA A;  3TEG A;  4ZTZ B;  2E65 A;  3UXK A;  4IHC A;  1KMN A;  3UH0 A;  4E8G A;  2QGY A;  3UCC A;  3T8Q A;  3ZVH A;  2ALY A;  4HNL A;  1JRO A;  3OD1 A;  2QHT A;  3NRZ B;  4E4F A;  3QTC A;  3KFU A;  3PCO B;  1EFW A;  1N5W C;  4H50 A;  2CDU A;  1WLE A;  4DHG A;  2CJB A;  2XH0 A;  3TEH A;  2HNI A;  1SJC A;  3BOX A;  1BZL A;  3ES8 A;  3I7F A;  4XTU A;  4RQE A;  3B9J B;  2ZR2 A;  3K1G A;  2PTX A;  2QJJ A;  4K2S A;  4RMF A;  3Q4D A;  1JJC A;  2I5Q A;  2OZ3 A;  4YRG A;  1S7M A;  4GYP C;  2XGZ A;  2PS2 A;  4UP9 A;  3N4E A;  3RAC A;  1WYG A;  1NYQ A;  2AMC A;  4CS4 A;  1R0M A;  3LSS A;  4IP5 A;  1RM6 B;  1E9I A;  2I4L A;  4DWD A;  3AMZ A;  1NEL A;  4H1Z A;  3SN1 A;  1B8A A;  4Z1Y A;  1V59 A;  3MY9 A;  2AKZ A;  1G5H A;  3DJG X;  4RDX A;  1ASY A;  4LII A;  2V3B A;  4G84 A;  1YEY A;  4E5T A;  4HVC A;  2QVH A;  2XH2 A;  3S47 A;  4E4U A;  2ALY B;  2EL9 A;  3SJN A;  3V5F A;  1SER A;  4KWS A;  2PU0 A;  1G51 A;  3EKG A;  4HWR A;  1G5I A;  1EIY B;  3IJL A;  2ARS A;  4JDR A;  2WPF A;  4HN8 A;  1ADJ A;  1NPX A;  3CYJ A;  5FMH A;  4X2P A;  4KR2 A;  2ODR D;  2GQW A;  2ZT5 A;  4TVA B;  1GRH A;  1E1T A;  3R07 A;  4G8T A;  5GRT A;  4X5O A;  4A3R A;  1ZMC A;  2NS6 A;  4P74 C;  3IAL A;  1N62 C;  2X99 A;  4TVW A;  2DZC A;  3MQT A;  4P3N A;  2X8G A;  1ZY8 A;  3DGB A;  2DW6 A;  2ZIO A;  2EJF A;  3LC0 A;  1JOA A;  1USY A;  3RO6 A;  4KQE A;  1FYF A;  2AL2 B;  2CGH A;  3IKM B;  1YFR A;  3A5Y A;  1GSN A;  1KOG A;  2OVL A;  4IL2 A;  1YFT A;  4KPR A;  2DEQ A;  5FS8 A;  4WJ4 A;  3DDM A;  3LXD A;  4H2V A;  1E24 A;  5HGQ A;  3MEY A;  3DJJ A;  3UGT A;  2PGW A;  3CK5 A;  3FJP A;  5JCK A;  2WBA A;  4YP0 A;  5ELO A;  3MKC A;  1BBW A;  2QHU A;  3R1Z A;  2POZ A;  2HNE A;  4ZCW A;  1NHP A;  2AAQ A;  5U1O A;  4APN A;  1ELS A;  2QQ6 A;  1E1O A;  1RIQ A;  2Q5I A;  1FEB A;  4Q15 A;  2XTI A;  3L4G B;  4XU2 A;  3EAN A;  1N60 C;  1GRA A;  4MMW A;  2OQH A;  3RGL A;  2XSX A;  3ZLG A;  4YRI A;  5EU9 A;  1OJT A;  3P8Y A;  4YRL A;  1HC7 A;  3UJE A;  2FYK A;  2E1H A;  3FV9 A;  2YAU A;  3HFZ B;  1GES A;  4ZA0 A;  1E22 A;  3AM9 A;  3UJS A;  4DX3 A;  12AS A;  3TWA A;  4P71 A;  5JRB A;  3HRK A;  1FIQ B;  1FO4 A;  1ONE A;  3I6E A;  3IJI A;  3NS1 B;  3HXW A;  3IG2 A;  3VBB A;  3W3S A;  3H12 A;  1JDF A;  2RAB A;  3NVZ B;  3DER A;  3HPF A;  4CH4 A;  2GGG A;  4H4S A;  3DFY A;  1FFV C;  3T6C A;  3N4F A;  3GC2 A;  4TQD A;  2GGE A;  2GR2 A;  4H4V A;  4HPN A;  3GD6 A;  2ARU A;  3R0U A;  2DZ9 A;  3HY0 A;  5ER0 A;  2EJ9 A;  3H70 A;  5FS7 A;  3L2Z A;  2P8C A;  4BWA A;  5BOF A;  3HXY A;  3RIR A;  4IP4 A;  3L5O A;  4YYE A;  3DGZ A;  2PP1 A;  3DES A;  4J15 A;  4XTY A;  1W66 A;  2OZ8 A;  2FYM A;  1MDR A;  2GRT A;  4K88 A;  4EMJ A;  1NHQ A;  1X2G A;  3OTR A;  4H4Q A;  3NVW B;  2OQY A;  1B7Y B;  3DK8 A;  3VCN A;  4K8G A;  2GGI A;  3PK7 A;  4H83 A;  3EAO A;  11AS A;  3HW2 A;  1H4S A;  3S5S A;  4DQ2 A;  3TEH B;  4YRE A;  3BJS A;  2WOV A;  3SN0 A;  3DG6 A;  3L4G A;  1EC8 A;  1NDA A;  2F5Z A;  3LB8 A;  2PME A;  2QHV A;  3UXL A;  5FS6 A;  4FP1 A;  4H2W A;  2FKP A;  4YCU A;  3RF1 A;  4BW9 A;  1F9C A;  3P93 A;  3B97 A;  4EM4 A;  3RKY A;  4CH6 A;  3I6T A;  2EWN A;  3Q6J A;  4J57 A;  4NEW A;  3TWB A;  1MNS A;  3R25 A;  1NJ8 A;  2ODR C;  4YDQ A;  1TYP A;  4P3O A;  2E3T A;  2IY5 B;  3HFZ A;  1OEP A;  4PHC A;  3CGB A;  3NET A;  1TKK A;  1HXD A;  1FEA A;  2QDD A;  1XHC A;  3CAW A;  4FI4 A;  1N63 C;  2NQL A;  4J3Z A;  4YRF A;  3MF1 A;  3QN3 A;  3GY1 A;  3KUM A;  3VCC A;  2ZT8 A;  4YCW A;  2DU7 A;  3NVV B;  3VFC A;  2C8M A;  3IJQ A;  3TQP A;  1XAN A;  1WYD A;  3TCS A;  2DDZ A;  3M4Q A;  4BUR A;  1FHV A;  1SB3 B;  2PMF A;  4KT2 A;  3FG2 P;  4HYR A;  1NNH A;  3PCO A;  2P5I A;  3VQW A;  4EQW A;  2AKW B;  3D9X A;  4DXK A;  4YRN A;  2C7I A;  5E3I A;  2XGT A;  4MKS A;  4HWS A;  4H2X A;  1WU7 A;  4KPL A;  4ROP A;  4XTW A;  3QFB A;  3TTE A;  4YRT A;  3HXX A;  3GD4 A;  3QO7 A;  3NEM A;  3V8L A;  1T3Q C;  4NEV A;  3RCY A;  4EMW A;  3PZC A;  3QO8 A;  1N61 C;  3TW9 A;  4EM3 A;  1MOK A;  4A6G A;  2I4M A;  3NFU A;  2NVK X;  1BKH A;  1P48 A;  2W0H A;  4EWJ A;  2XH4 A;  2Q7G A;  3BSM A;  5C53 B;  3A7U A;  3G1Z A;  4ZTU B;  1XDI A;  2HXT A;  4YRS A;  1GRB A;  2QJM A;  2PCE A;  3GRT A;  1H4T A;  5C52 B;  2DTI A;  1NHR A;  4DNA A;  1ONF A;  5ELN A;  2DW7 A;  3NO1 A;  3V7R A;  3VQX A;  1JPM A;  4ZIB A;  4G7F A;  3V3W A;  6ENL A;  4H2S A;  3II4 A;  2HXU A;  4M52 A;  1SJA A;  4HWT A;  5KNN A;  1JJC B;  1WNL A;  3H4K A;  1Z7N A;  1ZXI C;  1GRE A;  1GET A;  2HQM A;  1XS2 A;  4ENL A;  5J04 A;  2E10 A;  2ZZG A;  5U25 A;  2ZXF A;  3DH9 A;  2DXT A;  4CS3 A;  3EEZ A;  2ZR3 A;  4P75 A;  2W3R A;  3QLD A;  4LA1 A;  1WQ7 A;  2ZT7 A;  1NU5 A;  4P3P A;  3QFA A;  3U9I A;  4XU0 A;  5FJU A;  4WI1 A;  1IL2 A;  3OZM A;  3GO2 A;  1K4Q A;  1QF6 A;  3GD3 A;  1TYT A;  1DNC A;  3IK4 A;  4HCH A;  4EQR A;  2ZT6 A;  3I4K A;  5KVI A;  3U4F A;  3SBF A;  3RR1 A;  1BWC A;  4K86 A;  3NZG A;  4TQF A;  1X54 A;  4H4X A;  2C3D A;  3EFR A;  2GDQ A;  4J56 A;  3GRS A;  3JW7 A;  5FJO A;  1HTT A;  1KMM A;  4H2T A;  1JPD X;  2ZZB A;  2XH7 A;  3PG6 A;  1MRA A;  2QJN A;  1L8P A;  3QNE A;  3LAD A;  5C51 B;  4H4W A;  1JEH A;  2X50 A;  4TTV A; 
#chains in the Genus database with same CATH homology
 1BIA A;  1X56 A;  3A7A A;  4H02 A;  4P74 A;  4XTV A;  3HXV A;  4P72 A;  4XU3 A;  4HWP A;  2RHS B;  1NJ6 A;  4XU1 A;  1ATI A;  2DTO A;  4P73 C;  1WQW A;  1X55 A;  2DVE A;  4YRR A;  1B70 A;  2EJG A;  4G85 A;  1N9W A;  2PME A;  1B76 A;  2ZIN A;  3MQZ A;  4LVK A;  2J3L A;  4P72 C;  3ETR B;  2A8E A;  4LVM A;  3UGQ A;  4WF2 A;  2ART A;  3RKX A;  3HY1 A;  1EQR A;  4H2Y A;  2Q7E A;  1VDV A;  2RHQ A;  4YRJ A;  1ASZ A;  3BJU A;  4PG3 A;  3HRI A;  3HXZ A;  3P8V A;  1L0W A;  4LVL A;  1B7Y A;  3REX A;  3P8T A;  3CMQ A;  2E41 A;  4XTX A;  1SRY A;  1FFU C;  4P71 C;  5G5H B;  4P75 C;  4DPG A;  1NJ2 A;  3E9H A;  4CH5 A;  3A74 A;  3LSQ A;  2RHQ B;  3M4P A;  3WQZ A;  1X2H A;  4AH6 A;  4HA8 A;  4H2U A;  4TVA A;  3ICA A;  4LNS A;  2ZZF A;  3A5Z A;  2E64 A;  4CS2 A;  1YGB A;  3A7R A;  3E9I A;  3HTZ A;  2RHS A;  4K87 A;  2AKW A;  4YRM A;  4EX5 A;  1PYS A;  2CIM A;  4YRP A;  1NYR A;  1SET A;  1EOV A;  2DQ3 A;  3V8J A;  3ERR A;  4KR3 A;  3VQY A;  5K1X A;  3A32 A;  4UP7 A;  2ZZE A;  4YRQ A;  1V97 A;  2DTH A;  2ZGW A;  1QE0 A;  4L87 A;  1X01 A;  4UP8 A;  3EUB 3;  4TVY A;  2IY5 A;  4LVI A;  3V7S A;  2DQ0 A;  1EIY A;  4WJ3 M;  4HWO A;  1J5W A;  2CJA A;  3REU A;  5F5W A;  3RUX A;  3RL6 A;  1EVL A;  2E3C A;  1SES A;  2DU5 A;  4CH3 A;  4YPF A;  2P0L A;  4YRK A;  2DXU A;  3VQV A;  1EVK A;  3QO5 A;  3NVY B;  3RKW A;  2I4N A;  3EFS A;  3A31 A;  4Q6G A;  1PYS B;  4YRC A;  4LVJ A;  4O2D A;  4XTZ A;  3UFG A;  1WPY A;  1H4V B;  2G4C A;  3BFM A;  3V8K A;  3DSQ A;  1BBU A;  1NJ5 A;  4XEM A;  2QHS A;  4UPA A;  1GGM A;  4OLF A;  3MF2 A;  2I4O A;  2Q7H A;  4ZOH B;  1VQZ A;  4HT4 A;  1YB3 A;  1YFS A;  2W3S A;  2ZTG A;  3HFV A;  1LYL A;  2W55 A;  4YCV A;  1BIB A;  3L1A A;  5K1P A;  2W54 A;  4TWA A;  1B70 B;  4RQF A;  3HXU A;  4P73 A;  3TUP A;  1USY C;  2J3M A;  2ZCE A;  4H2X B;  2AMC B;  3HRD C;  1N5X A;  2E5A A;  4EO4 A;  3SR6 B;  1JRP A;  2DKG A;  3R07 C;  3NEL A;  1Z7M A;  2CJ9 A;  3IKL A;  5G5G B;  4XEO A;  1ADY A;  2Q5H A;  3V7C A;  4OP0 A;  1H4Q A;  2EAY A;  2ZIM A;  1C0A A;  4E51 A;  1NJ1 A;  2ZNJ A;  3TEG A;  4YRO A;  4NCX A;  4ZTZ B;  3AN1 A;  2E65 A;  1KMN A;  3UH0 A;  2ALY A;  1JRO A;  3OD1 A;  2QHT A;  3NRZ B;  3QTC A;  3KFU A;  3PCO B;  1EFW A;  1N5W C;  1WLE A;  2CJB A;  2HNI A;  3I7F A;  4XTU A;  4RQE A;  3B9J B;  2ZR2 A;  4RMF A;  1JJC A;  4YRG A;  4UP9 A;  3RAC A;  1WYG A;  1NYQ A;  2AMC A;  4CS4 A;  3LSS A;  1RM6 B;  2I4L A;  3AMZ A;  1B8A A;  1G5H A;  1ASY A;  4RDX A;  4G84 A;  4HVC A;  2EL9 A;  2ALY B;  1SER A;  1G51 A;  4HWR A;  1G5I A;  1EIY B;  2ARS A;  1ADJ A;  4KR2 A;  2ODR D;  2ZT5 A;  4TVA B;  1E1T A;  3R07 A;  4X5O A;  2NS6 A;  4P74 C;  3IAL A;  1N62 C;  4TVW A;  2DZC A;  4P3N A;  2ZIO A;  2EJF A;  3LC0 A;  1USY A;  4KQE A;  1FYF A;  2CGH A;  1KOG A;  1YFR A;  3A5Y A;  1YFT A;  2DEQ A;  4WJ4 A;  4H2V A;  1E24 A;  5HGQ A;  3MEY A;  3UGT A;  3FJP A;  4YP0 A;  5ELO A;  1BBW A;  2QHU A;  3TEH A;  2Q5I A;  1E1O A;  1RIQ A;  4XU2 A;  4Q15 A;  2XTI A;  3L4G B;  1N60 C;  3RGL A;  4YRI A;  3P8Y A;  4YRL A;  1HC7 A;  2FYK A;  2E1H A;  3HFZ B;  1E22 A;  3AM9 A;  4P71 A;  12AS A;  3IG2 A;  3HRK A;  1FIQ B;  1FO4 A;  3HXW A;  3NS1 B;  3VBB A;  3W3S A;  3NVZ B;  4CH4 A;  1FFV C;  4TQD A;  2ARU A;  2ZNI A;  3L2Z A;  3HY0 A;  2DZ9 A;  4BWA A;  2EJ9 A;  3HXY A;  3RIR A;  4YYE A;  4J15 A;  4XTY A;  1W66 A;  4K88 A;  1X2G A;  3NVW B;  1B7Y B;  11AS A;  1H4S A;  4DQ2 A;  3TEH B;  4YRE A;  3L4G A;  2QHV A;  4H2W A;  4YCU A;  3RF1 A;  4BW9 A;  4CH6 A;  3RKY A;  2EWN A;  1NJ8 A;  2ODR C;  4YDQ A;  4P3O A;  2E3T A;  2IY5 B;  3HFZ A;  4PHC A;  3NET A;  1HXD A;  1N63 C;  4YRF A;  3MF1 A;  2ZT8 A;  4YCW A;  2DU7 A;  3NVV B;  2C8M A;  1WYD A;  2DDZ A;  3M4Q A;  1SB3 B;  2PMF A;  1NNH A;  3PCO A;  2P5I A;  3VQW A;  2AKW B;  4YRN A;  2C7I A;  5E3I A;  2XGT A;  4HWS A;  4H2X A;  1WU7 A;  4XTW A;  4YRT A;  3HXX A;  3V8L A;  3QO7 A;  3NEM A;  1T3Q C;  3QO8 A;  3PZC A;  1N61 C;  2I4M A;  2Q7G A;  5C53 B;  3A7U A;  3G1Z A;  4ZTU B;  4YRS A;  1H4T A;  5C52 B;  2DTI A;  5ELN A;  3V7R A;  3VQX A;  4ZIB A;  4H2S A;  4HWT A;  5KNN A;  1JJC B;  1WNL A;  1Z7N A;  1ZXI C;  3NEN A;  2E10 A;  4CS3 A;  2ZZG A;  2ZXF A;  2DXT A;  2ZR3 A;  4P75 A;  2W3R A;  1WQ7 A;  2ZT7 A;  4P3P A;  4XU0 A;  4WI1 A;  1IL2 A;  1QF6 A;  2ZT6 A;  4K86 A;  4TQF A;  1X54 A;  3EFR A;  1HTT A;  1KMM A;  4H2T A;  3QNE A;  5C51 B;  2DJZ A;  3IKM B;  4TTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...