1WNLA

Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3 in complex with adp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 66
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wnlA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wnlA01
1RIQA 4M75C 5LJ5d 5GAMf 5GMKm 2EWNA 1WPYA 2DZCA 4YRQA 5GAOl 5KNNA 2DQ3A 2EJ9A 4KQEA 2ZNIA 2EL9A 3VBBA 1I5LA 5ELOA 3QO7A 4YPFA 1BIBA 2K57A 4UP7A 4L87A 2I4LA 4C92A 1B34B 1HK9A 5LJ5f 2DTOA 3M4QA 1EFWA 4XEOA 5LJ5g 4WJ4A 2ZCEA 2QHSA 1L0WA 4F7UE 3SB2A 1H4QA 4YCVA 4PJOC 4H2SA 3VQVA 4XU0A 4YRKA 2VXFA 5LJ3f 4F7UG 1YFSA 2RM4A 3FJPA 2FYKA 4KR3A 2QHTA 3RUXA 5GMKi 2E1HA 1U1TA 2P5IA 3JCMQ 4C8QB 2ZT8A 5GMKe 5GANe 1G5IA 1NJ6A 5GANh 1Y96A 4YREA 4M7AE 4YRNA 1X56A 3RGLA 5K1PA 4C92D 1N9SA 5C53B 4KR2A 3M4GA 3BY7A 4M78E 1NYQA 3TUPA 2HNIA 4H2VA 4YDQA 4M75A 3E9HA 3UGQA 3P8VA 3IALA 2VC8A 4TTVA 11ASA 4EO4A 4CS2A 1LNXA 2I4NA 4PNOA 4J15A 3EFRA 3L1AA 4K86A 1EVKA 4BWAA 2JN0A 1J5WA 3JCMX 1USYC 3OD1A 1EIYA 4M7AF 4TVWA 2YLCA 3HTZA 1HTTA 4M77G 4EMGA 4TVYA 2E64A 4M78F 4AH6A 4XU3A 5GMKj 5GANj 4YRLA 4BW9A 1H4SA 4J6XA 4LNSA 4PJOA 4A53A 3QHSA 2RHQA 4M75D 3P8YA 4G84A 4M77A 4M7DB 3BDUA 3LC0A 4P74A 1WQWA 5GAOp 2AMCA 3QTCA 5GAN2 1B70B 3JCMd 3HFZA 4CS4A 3L4GB 5GAN4 4EMKA 4HVCA 4XTXA 2Q5IA 4UP9A 1YCYA 1WLEA 3A7UA 4TVAB 4C8QG 1SRYA 1GGMA 1LJOA 3LSQA 5GAN8 3R07A 5DY9A 1JBMA 4N0AC 1N9RA 4PJOD 4C92C 2RHSB 1ASZA 2I4MA 1HC7A 3JB9F 1X54A 2DKGA 1QF6A 4EX5A 1YGBA 3HY1A 4PHCA 2DZ9A 3TEHB 3NENA 1M5Q1 5GAMd 1E1TA 1D3BA 1E24A 4OLFA 3REXA 4M7AB 4X9CA 2CIMA 4M78B 3A5ZA 3VQWA 2DJZA 2ZR2A 4M7DE 1VQZA 3AHUA 1EOVA 4HT8A 5F5WA 5LJ5h 3JCMb 5GAMg 4Q15A 3RKYA 3MEYA 1Z7MA 2ZT6A 4NL3A 3NELA 2ZT5A 5LJ3d 1JJCA 3QUIA 2E10A 3RERA 4N0AA 2DEQA 2ZIMA 1X55A 4CH6A 1WQ7A 2CGHA 3JCMW 3RL6A 4WF2A 1B7YA 3RIRA 1FYFA 5GAOm 4H2TA 4M7DF 4JRKA 4C92E 3QO5A 2ZINA 5GAN3 4PJOB 4P72A 4M77C 3HFVA 3HRKA 4RCCA 1B8AA 4XTZA 4P74C 5I21A 3SWNC 1I4K1 3EFSA 5LJ3g 1ADJA 2ALYA 2Q7GA 2E5AA 2XGTA 3TEGA 4CH5A 1X2GA 5GAOq 2AKWB 3HXXA 3PGGA 4XTVA 4HT9A 1NJ1A 1KQ1A 4F7UA 4RMFA 5GAOr 3JB9H 2QHUA 4EMKC 3V7SA 4YRTA 5C51B 4RCBA 1I81A 1IL2A 2G4CA 1BBWA 4NCXA 2CJBA 1PYSB 1C0AA 1Z7NA 1YFRA 4M7AG 3I7FA 4C92F 1BBUA 4HWOA 2Q7HA 3RESA 2DDZA 4M78G 2ZZFA 2RA2A 3PCOB 2RD1A 4CH3A 2IY5A 1HXDA 3V7CA 4M75E 1X2HA 3HXWA 2DTHA 2Y90A 4G85A 4H2XA 2EAYA 4NOYA 3JCMJ 3HXYA 4X9DA 4XTUA 2E3CA 2PMEA 4TQFA 3UH0A 4TQDA 5GANf 3BJUA 1NYRA 5GANg 4OP0A 3QO3A 3SWNA 4P75C 4M75F 4PJOE 3INZA 3JCMe 1B34A 3JCMh 3JB9G 1YB3A 3UFGA 4NL2A 1KQ2A 4K88A 4XU1A 5E3IA 4P71A 4YRFA 1W66A 2DXTA 3RACA 2DU5A 4MMLA 4YRIA 2C8MA 2PMFA 4K87A 2QTXA 3HY0A 2I2LA 2C7IA 2J3LA 1KMMA 4M77D 1LOJA 4C92B 4C8QA 1SESA 4PJOF 2ZNJA 4RQEA 2ZIOA 4XEMA 4HA8A 1ADYA 4P73C 4P72C 3IKLA 4XTWA 3V8JA 3REUA 4J6WA 1I8FA 5GAMe 2P0LA 5GAMh 2YLBA 4E51A 3IG2A 3MF2A 4XU2A 3JB9D 2ODRC 3RKXA 3A74A 1Y96B 4P75A 4RDXA 4DQ2A 4XQ3A 4C8QD 1E22A 4YRPA 5LJ5e 4QVCA 3BW1A 3W3SA 4M75B 4M7DG 1H641 4JUVA 4A54A 2E65A 3MF1A 2CJ9A 4M7AC 5CAIA 1M8VA 4HWPA 1NJ2A 3E9IA 3HFNA 4M7DA 5LJ3h 3LSSA 2EJFA 3L2ZA 4YYEA 2ZZEA 2EJGA 1B70A 5GAMj 1H4TA 2Q7EA 3UGTA 4YRRA 1EIYB 3ERRA 3L4GA 3BFMA 4JLIA 2FB7A 1EVLA 2DQ0A 4WJ3M 3JB9I 4P73A 4H2UA 5GAN5 3RKWA 2RHQB 4TVAA 4C92G 4M77B 2VXEA 1KOGA 2ZR3A 3RF1A 5ELNA 2ARUA 3SWNB 5LJ5j 2AMCB 1YFTA 3M4PA 2RHSA 5GAN6 4H2WA 4M7DD 3HFZB 4WI1A 4MMKA 3A7RA 4P3PA 1BIAA 4X5OA 3TEHA 4EMKB 3QO8A 4P71C 4HWRA 1H4VB 5K1XA 5LJ3j 3HFOA 4ZTZB 1NJ5A 2DVEA 1JRIA 4J5YA 3HSBA 3A5YA 4UPAA 1TH7A 4TWAA 4YRCA 1KMNA 4CH4A 2QHVA 3HRIA 3P8TA 4HWSA 4P3NA 1WNLA 3VQXA 4M7AA 4C8QC 3JB9J 4XTYA 3VU3C 5GANd 4H02A 4M78A 5GMKh 4M75G 5C52B 2ODRD 1G51A 2XTIA 1E1OA 2J3MA 3CMQA 4ZTUB 4F7UF 1D3BB 3V7RA 5GAN7 4P3OA 3HXZA 3IKMB 3GIBA 4M7AD 4M77E 4EMHA 2E41A 2RB6A 1SETA 2Q5HA 3KFUA 2ARTA 4PJOG 3WQZA 4M78D 1ATIA 4YCWA 4JRIA 4QVDA 3QSUA 4YP0A 4UP8A 3V8LA 3ICAA 1EQRA 4RQFA 1G5HA 4Y91A 2ZTGA 4M7DC 2ZT7A 1MGQA 3FB9A 1N9WA 1JJCB 4DPGA 3JCMP 1WU7A 3FIFA 3PZCA 2AKWA 2ARSA 1B7YB 1SERA 3DSQA 3G1ZA 4M77F 2ZXFA 2I4OA 4C8QE 1PYSA 2ZGWA 1NNHA 4ZIBA 1U1SA 2ZZGA 4CS3A 4V2SA 2ALYB 4J6YA 2YHTA 3NEMA 3PCOA 4Q6GA 4HWTA 3JCMf 5HGQA 3V8KA 3JCMc 4YROA 3JCMg 4F7UB 2CJAA 3VQYA 1B76A 12ASA 4YRGA 5GAOn 3HXVA 1USYA 4YCUA 3JCMV 4H2YA 4YRSA 4C8QF 1ASYA 3HXUA 3A32A 5GMKl 3QNEA 3A7AA 1WYDA 2DXUA 2IY5B 2DTIA 4PG3A 4O2DA 4M78C 5LJ3e 2DU7A 1X01A 4YRMA 1LYLA 3NETA 3A31A 4H2XB 1QE0A 4YRJA 1NJ8A
chains in the Genus database with same CATH superfamily
4M75C 5LJ5d 5GAMf 4YRQA 2DL5A 1GRIA 4OMQA 2EJ9A 3LGFA 2EL9A 1OZ3A 1Q86R 1VIFA 1I5LA 2AKKA 4C0ZA 1PD0A 2FRWA 4QT7A 1B34B 5LJ5f 4XEOA 5LJ5g 1FWZA 2QHSA 1L0WA 4KGXB 2M9UA 4OGCA 2V8JA 4BI4A 3FJPA 2FYKA 1Q7YC 2BZYA 3JRZA 2E1HA 2LRQA 1U1TA 5KE3A 1UUEA 1WXBA 2EQIA 4QQGA 3EG1A 3UT1A 1Y96A 3WXMB 1K73R 1X56A 4IUUA 3EHRA 3RGLA 4C92D 4KR2A 1YJWA 4M78E 1NYQA 2DLPA 4YDQA 4M75A 3QDRB 3QYGB 4KGZB 1IGUA 3IALA 2DEUA 2IPOB 4EO4A 1LNXA 1VQNA 4J8OA 4BWAA 1J5WA 4LN2A 3VS7A 1TXQA 1IGQA 5CR2A 1EIYA 4M7AF 3R6OA 2A08A 2K2MA 4EMGA 3S3NA 2ABLA 2NWMA 1VQ8T 4FSSA 5GMKj 2RF0A 4LNSA 4A53A 3L2UA 4FT2A 2DILA 1U06A 3LC0A 1KFZA 4P74A 8AT1B 2MK5A 4AMCA 2XD0A 1C0MA 4E7JA 3HFZA 3M0QA 4CS4A 1BKBA 2QQAA 1T0HA 3QDFA 4EMKA 4HVCA 2K4YA 1GXIE 3PTAA 1G5VA 5GJVB 1D1BA 1D0ZA 2V1QA 1QP2A 4TVAB 1GGMA 1K1ZA 3R07A 2KT8A 1JBMA 4PJOD 1WHHA 1W1FA 4OF1A 1ASZA 2I4MA 1HYOA 1WJRA 2G6FX 2K5IA 3CC2A 2EYZA 1X54A 2CYZB 2QXFA 1HSQA 4B6MA 4XAXB 1VQOT 4ZGEB 2LQ8A 1KSWA 1OI1A 5D6WA 3QG1A 3L2WA 1OZ2A 3OQ5A 1TS9A 3OSSC 3I56Q 1AWXA 3FRNA 4DA4A 4M7AB 7AT1B 1NJIR 1OQKA 2CIMA 2DRMA 3CCJT 2QGGA 3UWNA 3A5ZA 1K4US 4M7DE 2Z0WA 5F5WA 1GFDA 3JCMb 2CKKA 1Q86C 3H41A 1VQ9T 2OX7A 1M1KU 1FMWA 1MNDA 1KG1A 3MHXA 3NELA 1KD1U 5LJ3d 1VIEA 2E10A 3CD6A 2EVRA 2ZIMA 4DOVA 4WF2A 4OMLA 2OTJQ 2GNCA 3VS0A 2L3PA 3ULRB 2RHIA 1VQMA 4C92E 1OU9A 3S6WA 1UGSB 2XK0A 2ZINA 5GAN3 2YUNA 4M77C 3HFVA 3HRKA 4OMOA 4XTZA 1B8AA 2EGCA 5LJ3g 1ADJA 2ALYA 2XGTA 1QW1A 1X2GA 5GAOq 2AK5A 1NJ1A 4OMMA 1K73C 2JMCA 2L89A 2OAWA 3CCST 4L59A 1G8XA 1BBWA 4E2FB 3OY9A 4J9EA 2O88A 3I7FA 1E6GA 1N8RR 4ZN1A 2Q7HA 5IAYA 1M2VB 2HBPA 2MOXA 2RA2A 2RJFA 3RMSA 3PCOB 4CH3A 1HXDA 1QVFS 1ZUUA 1X2HA 3RDVA 1YI2A 2AZSA 2CP5A 1VQ5Q 2Y90A 4G85A 1QCFA 1PCXA 4H2XA 1TTHB 4NOYA 3C4SA 3P8DA 2MWOA 2RJCA 4XTUA 5KYWA 2PMEA 3O8VA 3QKJA 4J9GA 4EDUA 3GNGA 5GANf 2A8EA 2QG9B 4P75C 5GANg 3CXCA 3CMAT 4PJOE 2K3XA 4DBFA 2O9SA 3JCMh 2EBPA 1I0CA 3HKSA 3UDCA 1KQ2A 2EQJA 1M4ZA 4K88A 5E3IA 1K76A 1YJNQ 4DBRA 2FG0A 2JUFA 4X34A 2DU5A 4MMLA 4C0FA 2O31A 1KMMA 4C8QA 2ECZA 2C06A 3H0IA 2FL7A 5CIUA 2KRNA 2CS7A 1RAEB 4P72C 1ZBJA 1AVZC 3REUA 2A0FB 2AIRB 2E3IA 1OOTA 4J9IA 1PKSA 4E51A 3OS1A 3IG2A 1NJIC 2ODRC 3P8BB 2J05A 3M55A 1WYXA 1BI2A 2CP3A 4P75A 4LDXA 4DQ2A 3OYHA 5KYUA 3CXCS 2PTKA 4CRIA 3E19A 3VYGA 4QKUA 4YRPA 2BE7D 4E6RA 4QVCA 3BW1A 2OTLQ 2CZ0B 4JUVA 4RG8A 1UJ0A 1RL2A 2CJ9A 1NJ2A 3E9IA 3NTIA 1RAHB 2A36A 2EQMA 4R55A 4KULA 1X6BA 4IKFA 2DIQA 1YJWT 1H3ZA 2D0NA 1B70A 4C0DB 3UGTA 2P0PA 3G6ET 2MCNA 3BFMA 5I22A 3I56T 4JLIA 1EVLA 4WJ3M 4AG1C 2L8DA 2HZYA 2YDLA 2C0OA 1VQNT 2YXYA 1MMGA 4PFOA 1WIEA 1ZX6A 2W10A 9ATCB 1KQSP 3CCQQ 2AMCB 2K9GA 1M3CA 1ZSGA 2L3RA 2BUDA 3VV0A 1NEBA 3MP6A 3Q1JA 3CCRQ 1WZOA 3QIIA 1OULA 1O75A 1NLOC 4P71C 1BBZA 3OYDA 1GBRA 1UGRB 3C0CA 1IREB 1NJ5A 3CCUT 4J5YA 5D6XA 1X2KA 1N5ZA 4YRCA 4TWAA 2XHCA 3HRIA 1Z9QA 4HWSA 1TG0A 2E5KA 1CKBA 3JB9J 4XTYA 1KQSA 2BIVA 2K5FA 4H02A 4M78A 3CCLQ 1WHLA 4F04B 2DF6A 3EGXB 2DAQA 2LCSA 3CC7Q 2DERA 1KC8C 5GJWB 1VYTA 4FT4A 2QEXT 1MNEA 4FW1A 1D3BB 3CC2T 1Y57A 1T3LA 2ED0A 2KVQG 1ZUYA 4P3OA 3HXZA 4TVRA 2HKNA 4M7AD 1R0BG 2BZ8A 4MZMA 2K79A 2E41A 2RB6A 2RO0A 4EMHA 3UA6A 1NEGA 1X27A 4JRIA 2OI3A 3QSUA 4YP0A 3CCMT 3ICAA 4RQFA 4M7DC 3CCEQ 1ZLMA 3HRTA 1N9WA 2QDLA 1Y0MA 3JCMP 2PQWA 1NLPC 3RMQA 3PZCA 3VRZA 1HJDA 3G1JA 2NUTB 1YJ9T 2ZPHB 3G1ZA 2LDMA 2ZXFA 2F1LA 2ZZGA 1AT1B 2EGAA 1FXXA 4J6YA 3X26B 3NEMA 1VQ8A 4HWTA 1X6OA 4LDYA 4ELYC 2FZCB 1M3BA 5KCOA 1KIKA 1U5SA 1VQKQ 12ASA 2FHDA 3PVQA 4RTYA 1USYA 4J9BA 2EYYA 1MMAA 1WHJA 3L42A 1QVPA 2HMAA 3QNEA 3A7AA 2RH2A 2RQWA 4LUEA 2IY5B 1MUZA 2DPPB 1SPKA 2GFUA 1YWPA 2ROLA 4IIOA 5KYYA 4YRMA 2ENMA 3A31A 4YRJA 3NHNA 2SRCA 1KJWA 1JJ2P 4CI0C 1YIJQ 1V1CA 3M9QA 2D1XA 2DZCA 1ZSZB 2QGFB 1K0XA 2A3LA 1M1KR 2DQ3A 5HY6A 3VBBA 2VASA 1YI2T 1KD1R 3QO7A 2K57A 2M1HA 4GLKA 3CC4A 3OSVA 1S72Q 4L87A 4C92A 2DTOA 3QBYA 4CC7A 1TUGB 1PD1A 1WHKA 2F5KA 3EG9B 4QQ6A 1H4QA 4YCVA 4PJOC 2NLUA 3QJYA 4XU0A 4YRKA 4E7KA 1M2OA 3HRSA 3I9QA 1D0YA 1WHGA 4KR3A 2LNVA 5IHNA 3EG0A 2QHTA 3RUXA 5GMKi 1VQ9A 2P5IA 3JCMQ 2ZT8A 1NJ6A 3OMGA 1SSFA 5DLOA 4M7AE 4YRNA 1JO8A 5HK3A 5C53B 1TOVA 2HNIA 1KC8U 1AEYA 3P8VA 1VOMA 11ASA 1OEBA 1EVKA 4PJJA 1TWBA 3EFOB 1AD5A 2EQUA 3OD1A 2I0NA 4KUIA 1QKXA 1EZZB 2B8AA 3EG3A 4HCBA 2VWFA 2DETA 2LP5A 3CCVQ 2YUPA 4BW9A 2IG0A 2DK3A 1OPKA 1K9AA 1H4SA 4J6XA 1JB0E 4PJOA 2RI2A 1D1AA 3P8YA 2EIFA 3GPLA 4RG2A 2JXBA 3OYLA 2KYMA 3QTCA 5IHIA 4OMPA 3HRUA 1M1FA 2KNBB 3MCAB 3OYBA 1BU1A 3IQLA 4XTXA 4KT0E 1R0CB 2Q5IA 4UP9A 1YCYA 2DYIA 4LDUA 3FEOA 1OX9A 2JM8A 2O4XA 2GQIA 3G4SQ 1VQ6Q 3ASKA 1M3AA 3H9NA 4RKUE 2KXCA 4MDXA 1HC7A 1QF6A 4EX5A 1YGBA 3HY1A 2JVVA 2RQUA 4PHCA 2DZ9A 1F1BB 1UHCA 1K9MU 3NENA 3ZL7C 2M51A 3CBMA 3MJXA 3PNWC 2M0OA 4GY5A 5GAMd 2R58A 2LT1A 1PNJA 2P4TA 5M9OA 4LD9K 3GLXA 1EX4A 5J26A 5A0GA 2HSEB 4EPCA 2YRDA 3JSCA 1QVGA 2D6FA 4HT8A 1PM3A 5LJ5h 1M1KC 1NYGA 5GAMg 4Q15A 4LXCA 4C5HA 4RMOA 4HKEA 3RKYA 2VUBA 1KD1C 3MEYA 1Z7MA 2ZT6A 3PIOA 3EG2A 1WQ7A 2CGHA 4JLGA 4D6WA 3FC3A 1MV3A 3KUFA 1Q95G 2R5AA 4P74C 3SWNC 1I4K1 1BCMA 2LZ6B 2VB6A 3TEGA 2HKQB 4FCYA 2R57A 4A63B 2AKWB 1IHVA 3HXXA 2VGNA 4XTVA 3VJPA 1XQHA 1KQ1A 2MWPA 4F7UA 2RN8A 1Y71A 4EMKC 2X4JA 4II1A 4RCBA 1IL2A 1PYSB 1C0AA 1TU0B 3RR6A 3OYNA 1BBUA 3G71T 2KDSA 4HWOA 2V26A 3G6EA 1QVGS 2QQ9A 3JV3A 3VUZA 3I56A 2DDZA 1TUDA 2JTMA 2DXCA 3V7CA 3CBOA 1G3TA 1VYVA 2YT6A 2XI9A 3NMZC 1WFWA 4E7HA 2DL4A 1VQ7T 2PU9B 3VUBA 2YRCA 4C0GA 3QZ9B 2E3CA 1D09B 3UH0A 3OYMA 1YITQ 2H3JA 3EH1A 2NUPB 3VS5A 3CCUA 3OB9A 4AFZC 3ZBDA 3SWNA 2QQSA 1SRLA 3VYHB 1B34A 2OTJA 1YB3A 2F69A 1AZEA 2VKNA 1M8MA 2RMOA 4XU1A 2QQBA 3OYFA 4JZ4A 4YRIA 2PMFA 4K87A 2QEXA 3FDRA 2BZXA 3E9FA 3QZ5B 2C7IA 2J3LA 4JDSA 1X6GA 1SESA 4RQEA 2K6DA 1B3QA 3CQTA 4GLMA 4A4FA 3G7ZA 1ADYA 2C0TA 4P73C 4KRTA 2CT3A 3IKLA 4XTWA 3MEWA 4CC2A 1T0JA 3OYEA 5GAMe 2AT1B 1WDXA 2P0LA 3MP8A 3CC4T 3CCMA 5FWCA 4RTTA 5HCKA 2QA4Q 2ZZDA 4RDXA 2DYBA 3OYKA 2ROTA 2X4XA 3R6NA 5LJ5e 4HT4A 1BB9A 1QVFP 1H641 3DKMA 1YJ9A 3LX7A 2EYQA 4A54A 2E65A 3MF1A 5D7UA 4M7AC 1M8VA 4HWPA 1RI9A 3MEVA 4LVMA 1YP5A 5LJ3h 3TEEA 2EJFA 2J6OA 2ZZEA 4B9XA 2IVWA 1VQPQ 2L5QA 4HCZA 3VRYA 4BE0A 2V1RA 2FB7A 2DQ0A 2EGEA 1YJNA 4P73A 2VYTA 2RHQB 4TVAA 2COYA 4M77B 2FO0A 5IT9E 2ZR3A 3RF1A 2F2XA 2GBQA 5EG2A 1MMNA 3QPHA 2K3BA 2FZKB 5GAN6 4WI1A 4F17A 3A7RA 4P3PA 4O5VA 2DA9A 4X5OA 2LX7A 3QO8A 2ZPGB 4JJCA 4CC3A 4PLIA 5FU7B 5LJ3j 8ATCB 2DVEA 1VQLQ 1KMNA 4CH4A 2JTFA 4QW2A 3LH5A 4P3NA 5LL6S 3VQXA 4M7AA 3HPWA 4C8QC 5FRMA 3J7AF 2EPDA 1AWOA 5GANd 2M02A 2ZPIB 2LX9A 2CP7A 4M75G 5C52B 2RHUA 1RLQC 3A8OB 1VA7A 3QYHB 2X3XD 1E1OA 2B86A 3I55Q 3CMQA 2ZPFB 1KC8R 3M0RA 5DM7R 1CKAA 2DL7A 4DEYA 4N4IA 3PMIA 2SEMA 2F2VA 2DBKA 1AHJB 1WX6A 3M5AA 1SETA 3KFUA 4Z8AA 2ARTA 2E6ZA 4Y28E 3V8LA 5C0MA 2ED1A 2DO3A 4D8DA 2HEQA 1RAGB 3MEAA 3X25B 2ZT7A 4O6JA 5IHKA 1JJCB 2C0IA 4KH0B 3RBBB 2CP2A 3GNFB 3CD6Q 4JRQA 3LWIA 2ARSA 4BDYA 3TREA 1VUBA 1B7YB 4FYXB 1VQMQ 1QWEA 2ZGWA 1LPLA 1RI0A 1SG5A 4V2SA 1M2VA 2YHTA 3PCOA 4PJNA 2RHZA 3JCMf 5HGQA 2HBWA 3JCMg 1M9SA 2LC4A 2LJ1A 2XKOC 2CJAA 3OS2A 3VQYA 2LQWA 3OYAA 1NE8A 1K9MR 2DIGA 4YRGA 5GAOn 1MHNA 3CC7A 4H2YA 5AYFA 3MKDA 1X43A 1UECA 2DMOA 1EFNA 4ZGJB 1ASYA 3HXUA 1LCKA 1FMVA 3A32A 5GMKl 1W6XA 1WYDA 4LDVA 2D8JA 4M78C 2P84A 2DL8A 2WSEE 5LJ3e 2KRSA 3U23A 1X01A 2QAZA 2XDPA 4DBQA 5CVIA 4ZTJA 2K7AA 1D1CA 2WSCE 1RIQA 1GFCA 5GMKm 1S1NA 4MZPA 5GAOl 1JEGA 2KBTA 4LVLA 2VV5A 5KNNA 4FSXA 4KQEA 2CP0A 1NPRA 5KYXB 1IO6A 3F70A 5ELOA 3CPWP 4YPFA 1BIBA 2E5QA 1VQ4Q 2I4LA 2KY9A 1UFFA 2RI3A 2LCLA 4WJ4A 2JT4A 4F7UE 3M0PA 3VQVA 1G3YA 3X20B 2FPEA 2BE9B 4L6V5 2MI6A 4PFPA 2OTJT 2RHXA 2W0ZA 1BI1A 3HHTB 3VS1A 3ZFJA 5GANe 2L3QA 4B9WA 2RQTA 4YREA 2LJ3A 3MO8A 5K1PA 3M56A 4J83A 3TUPA 1DJ7B 1UG1A 1Y7XA 1NZ9A 3E9HA 3MEUA 2CT4A 2HL3A 2VC8A 1ZA1B 2CH4A 4TTVA 2QYZA 4CS2A 1YBYA 2X3WD 2I4NA 4PNOA 3FJ5A 5I11A 4J15A 3EFRA 3L1AA 4C5IA 2PNIA 2YRVA 2JN0A 3JCMX 1USYC 4TVWA 3LWHA 2O2OA 1HTTA 4M77G 2A28A 3CMEQ 2K3YA 4TVYA 2FZGB 4AH6A 1WLPB 1BK2A 5CK9A 2ATCB 5KCHA 2EQKA 1VQ5T 4G84A 3MPUB 4M7DB 3BDUA 3G71A 1WQWA 1IB8A 2J06A 1N27A 2AMCA 1N6AA 1S72A 5GAN2 1RADB 1G2BA 3M58A 4OMFB 2MYSA 3L4GB 1KQSS 5A0DA 2L0AA 4E7LA 3PMTA 2G3RA 1M90U 1ZQ1A 1UEBA 4Q5WA 2RNAA 3PT9A 4C8QG 4ME7A 2A37A 1M27C 3M0SA 1VQ7A 1PC0A 3LSQA 3VS4A 5DY9A 2F2WA 4N0AC 1N9RA 2JTEA 2LQNA 4C92C 2RQRA 3S3MA 2RHSB 4IIMA 1SEMA 4QVZA 1QQJA 2DKGA 1K9MC 3C94A 1WHMA 3QWXX 1YJNT 3TEHB 2P0KA 3EGXA 3A8HB 3OW2P 1YHQQ 1IZ6A 1WXTA 2RHYA 3O5ZA 5I2SA 1E1TA 1D3BA 1BCOA 2QDYB 1E24A 4OLFA 4HCKA 4FM4B 4BY6C 3REXA 4BI3A 3PVLA 4E47A 3NTHA 1E7OA 4IUPA 3VQWA 1KHCA 2DJZA 6AT1B 2CDTA 1B07A 1VQZA 1PSEA 2PVDB 1RAAB 4N4GA 2XICA 2CSQA 1GCQC 2D0QB 4NL3A 1JXOA 5KH6A 1CSKA 3RERA 4N0AA 1X55A 2YUOA 1SF9A 2XDDA 5FU6C 3RL6A 5A2QE 2OTLT 3RIRA 2J7IA 2NUTA 4LE9A 3VS2A 2DD4A 1JJ2A 3EGDB 4C5EA 5CQXA 4PJOB 4LUDA 4UC4A 1UB4A 1G83A 2JW4A 3G4SA 1FMKA 2RI5A 2J6KA 1G3SA 3PGGA 2HQXA 2EKOA 4RMFA 3JB9H 4BE2A 4RTVA 2QHUA 5C51B 4ZNXA 4ATOA 1I81A 2V8KA 2G4CA 4NCXA 3N5BB 1Q81U 4FIBA 3VS6A 1YFRA 1WA7A 4HVVA 4ESRA 3OYIA 3CCQT 3RESA 4BI8B 5HKCA 2CUDA 4M78G 1N8RU 1R77A 2PUOB 2LMJA 3CCRT 4Z88A 1VQ8Q 2IY5A 1SKUB 1GCQA 3L2RA 4OVAA 1B7TA 1I1JA 3THKA 2X35A 1I07A 1QCNA 4E7ZA 1XOVA 3ZEHA 2KSSA 1U8RA 3NPFA 4LVIA 1ZSZA 1RAFB 4X9DA 1A0NB 1W2BP 2NS6A 1JJ2S 4TQFA 3CCLT 4TQDA 4HVUA 3LH0A 2EW3A 1K0SA 4BACA 1NYRA 3BJUA 1SRMA 4M75F 2RJEA 3INZA 3CC7T 4HCCA 2RK1A 4AFSC 3JB9G 3OS5A 4NL2A 2COZA 1I5OB 1RUWA 3EG9A 4PJMA 4YRFA 1W66A 2DXTA 4BE1A 3RACA 1VQOQ 1W2BA 4PLLA 2QTXA 3HY0A 2I2LA 5KE2A 3M59A 1LOJA 3CMET 2ZNJA 2O01E 3M57A 1M1GA 3NFCA 3AT1B 4RTUA 2MPXC 2ZPBB 1PSFA 3UA7A 4XEMA 1PKTA 3CCJQ 3NGPA 2KGTA 3BDLA 3J80E 3CCET 2XIDA 4J6WA 2X4WA 1I8FA 1K8AC 5GAMh 1RACB 3JB9D 3PIPA 3RKXA 1OV3A 3A74A 1JXMA 1Y96B 3REAB 4M4ZA 3EFOA 4XQ3A 2KR3A 2NUZA 5FROA 4EIKA 5CKFA 1E22A 2R5MA 1BI3A 3LW5E 3W3SA 3SEMA 4M75B 4M7DG 1MV0B 2CSIA 1XNIA 1YITA 4BDZA 1WJQA 2KI7A 1HD3A 2LQKA 3GP8A 1VQKT 1NYFA 1WXUA 2CREA 5A0LA 3L2ZA 3LSSA 5EC7A 2KQWA 5C6SA 2EJGA 3T9NA 3SD4A 5GAMj 4F16A 2Q7EA 1EIYB 2H3EB 4OB2B 3WVDB 2HSPA 3JB9I 3CCSQ 4H2UA 3EAEA 4J9FA 3RKWA 4C92G 5KYNA 1OYXA 1Q82U 1WI7A 1KOGA 1PHTA 2ARUA 3SWNB 5LJ5j 2GTJA 1YIJT 3VKIA 2DD5A 4M7DD 3HFZB 2LJ0A 4N4HA 4EMKB 4JJNK 1PG5B 4HWRA 4NS5A 3TQ7P 3REBB 3M0TA 3HFOA 4ZTZB 4RTXA 4A4KA 2MIOA 3HSBA 4PK4A 1TH7A 3H0HA 1S72T 4DBHA 2QHVA 3P8TA 2X4YA 3HL8A 1WNLA 4VUBA 2JZ2A 1QMCA 3VU3C 4BB7A 2EYXA 2QA4A 5GMKh 2P0QA 2AZVA 3KXTA 2PVGB 4A4EA 3UPUA 3CMAQ 3X28B 2XTIA 2AHJB 3V7RA 5GAN7 1W70A 1U3OA 5ECAA 1QLYA 4JJDA 3ME9A 2P4RA 3HTRA 3GOXA 1PWTA 3A5ZB 3GIBA 5FW9A 2Q5HA 1VQPA 4PJOG 3WQZA 1ATIA 4E7SA 4YCWA 1QWFA 2EYWA 4QVDA 4UP8A 2PZ1A 4Z02A 1ZUKA 1UTIA 1EQRA 1G5HA 1UDLA 2QI2A 1JU5C 1MGQA 1WJSA 3QJ6A 3D7SB 5L23A 1WU7A 3H0FA 3FIFA 4LVJA 2GCXA 2KRMA 4FYYB 2AKWA 3BE3A 4QQDA 3KFVA 3CCVT 3DSQA 4M77F 2ESWA 1M90R 2I4OA 1PYSA 2D8HA 3WVEB 1NNHA 1C6VX 2FRYA 4ZIBA 1VQLA 4FL6A 1X75C 4AFUC 1PRLC 5FWBA 2ALYB 1M30A 2HD0A 5AT1B 1K8AU 4Q6GA 3SFMA 3JCMc 3EGUA 4YROA 2KAFA 1VQ5A 2KE9A 1XJWB 2GQVA 3EHQA 2X9HA 3C95A 4IUTA 2JNGA 4YCUA 2H8HA 1YJWQ 1LVKA 2QK0A 3QXEB 4ZTFA 4DEXA 4C8QF 3I55A 3G4ST 5CKEA 1ZHIA 1VQ6T 2KMTA 3G6EQ 5L8RE 2DXUA 3OS0A 2NUPA 4PG3A 3OYJA 1QP3A 4O2DA 4JZ3A 4FYVB 1VQNQ 3LYIA 2DU7A 2LCCA 4H2XB 1IHWA 4AG2C 1QE0A 4K11A 3H8ZA 2E12A 1KHIA 2JOYA 2EWNA 1WPYA 5CO7A 5KYWB 4OB1B 1QVFA 2MMPA 2ZNIA 4R56A 2JMAA 1MMDA 3A8GB 4AFQC 2JM9A 2E70A 1QCOA 5IXBA 3CCUQ 3S3OA 4UP7A 4L5GA 2J6FA 4XK8E 2ZCFB 1HK9A 3M4QA 1EFWA 3URGA 5I2MA 2ZCEA 3SB2A 2E3HA 4H2SA 2OAUA 2VXFA 5LJ3f 4F7UG 1YFSA 1G3WA 2RM4A 3UATA 2LVMA 2RJDA 2KYBA 2QEXQ 1P92A 2HDAA 2QASA 4C8QB 5GMKe 1G5IA 3CC2Q 5GANh 1NPPA 4E7IA 1Q7YU 3TSZA 2A7YA 1FX7A 5CKBA 2FEIA 1Q81R 5FU7C 1ZBXA 1N9SA 2HL5C 3M4GA 3BY7A 2OJ2A 3C12A 2OTLA 4H2VA 4BD3A 4KUDK 3UGQA 3GF5A 1OPLA 4J7IA 4IUVA 3A1PA 3CCMQ 2PVOB 3M54A 2EFIA 4BUGA 3CXCP 2V8IA 1XTDA 1NG2A 4K86A 5CKDA 2MF2A 4ORZA 3FLGA 4OB0B 5KYUB 2YLCA 3HTZA 1BI0A 2COWA 5HK0A 2E64A 2Y4XA 4M78F 4XU3A 1YJ9Q 5GANj 3MQZA 4YRLA 4JRPA 3OBWA 3QHSA 2DFUA 4M75D 2ZAEA 2RHQA 2PUKB 4M77A 3CCQA 3E1SA 5GAOp 3EH2A 1VQ4A 2QQRA 3CCRA 1B70B 3JCMd 3CBPA 2X51A 1M90C 3LGLA 4R0KA 3TCJA 3KBGA 5GAN4 1YITT 2O9VA 1VYUA 1SHFA 1WLEA 3A7UA 1SRYA 1LJOA 2M16A 5GAN8 1H92A 2HAXA 4Z89A 2CH4W 2LTOA 1IRXA 3JB9F 3CCLA 3E9GA 2VGMA 4J7FA 1M5Q1 3X24B 2XU8A 4HXJA 2M0YA 2XDBA 1O9SA 1E6HA 3CEYA 2E4HA 4X9CA 4M78B 3M53A 1YI2Q 2JS2A 2BTTA 2ZR2A 4AT1B 3AHUA 1EOVA 4GBQA 2DNUA 2CUBA 3CMEA 1WGSA 3H6ZA 1AWJA 3OYYA 4RUGA 3CCEA 2QA4T 3OBYA 3J81E 2DXBA 1Q86U 2XMFA 2ZT5A 1JJCA 3QUIA 2DEQA 4CH6A 4C0DC 1UGVA 3JCMW 1B7YA 1FYFA 5GAOm 4H2TA 4KH1B 1ABOA 4P5NA 1OX8A 1NM7A 4PKCC 4M7DF 1ZA2B 4JRKA 2CZ1B 3DLMA 3QO5A 1C1AA 4P72A 3MP1A 3P8HA 1Q82R 4RCCA 2JJ9A 5J3BA 5I21A 4J9HA 3M0UA 4PJLA 3PE0A 3EFSA 4YTLA 2Q7GA 2E5AA 1VQPT 4CH5A 3CPWA 4HT9A 5FLXE 1GCPA 2CZ6B 2DL3A 3I5SA 5GAOr 1Q81C 2JS0A 4IUQA 1VQKA 3V7SA 4YRTA 1K73U 1YHQA 3QWYA 2CJBA 4ZN3A 1Z7NA 1N8RC 4M7AG 4C92F 1TSFA 2ZZFA 2RD1A 1UGQB 4M75E 1YFNA 3HXWA 2DTHA 5D6YA 4OB3B 1YWOA 3PFSA 1VQLT 2EAYA 3JCMJ 1YIJA 2HCKA 2DVJA 3HXYA 4KGVB 3CPFA 2YSQA 1H8KA 1YCSB 2GGRA 4HVWA 5KYXA 2DRKA 4JS5A 4OP0A 3QO3A 1W4SA 5KYYB 4PFZA 3JCMe 3I55T 4Y92A 5IH2A 2RQVA 3JAME 3CPWS 3UFGA 4P71A 4JPBW 4A4HA 2BKDN 4FU6A 2RPNA 2LT4A 3TSWA 4J9DA 1AZGB 2C8MA 3L2VA 1Z9ZA 2RK2A 1V76A 4M77D 4C92B 4ELZC 2CZ7B 4PJOF 2VVKA 2ZIOA 2FVUA 4HA8A 3DB3A 2FPFA 3A98A 2XG8D 3UF4A 2K5LA 4LDWA 3M4YA 3V8JA 1BYMA 4DOWA 5CKHA 3CD6T 3TVTA 2YLBA 3E2UA 3MF2A 1X69A 1K8AR 4XU2A 3NTKA 4BY6B 4PL6A 1JQQA 4CC4B 4FYWB 1NJIU 1TUCA 1VQMT 3I35A 2DBMA 4C8QD 3OW2A 3CCVA 1Y07A 4C5GA 5CAIA 4A4GA 2DJQA 3HFNA 4M7DA 3SHWA 3ER0A 2LNHB 1H3HA 4YYEA 1H4TA 1RABB 3RNJA 5FU6B 4YRRA 3ERRA 3L4GA 3SDZA 1ZSZC 3DLLA 1ARKA 2HQEA 4JS4A 5J39A 1Q82C 5GAN5 1VQOA 3I5RA 1RAIB 2D9TA 3GBQA 2VXEA 5ELNA 1VQ6A 3G71Q 2Y4YA 1D0XA 1YFTA 2L3SA 2RHSA 3M4PA 4H2WA 4OMNA 2L2PA 4X1VA 4WTOB 4MMKA 2IIMA 1BIAA 2QTVA 1PRMC 3TEHA 2E6NA 3CCJA 4F14A 1H4VB 4ZGDB 5K1XA 4MDWA 2KROA 2NYSA 1JRIA 4IURA 2KXDA 3A5YA 1VQ7Q 4UPAA 3OW2S 1VQ4T 2O4XB 4KBMB 1QKWA 5IXFA 2GTOA 1Q7YR 1SSHA 3OYGA 2ODRD 1UJYA 1EIFA 1G51A 2HQHA 2J3MA 2YWWA 4ZTUB 4F7UF 4FW2A 2KEAA 1V29B 2KK4A 1J3TA 5CQYA 2DM1A 3HP9A 2WSFE 2MAMA 4D8KA 3IKMB 1R8OB 2AKLA 4M77E 3A8LB 4M78D 4ANJA 4RTWA 2ZPEB 3EGDA 3TU4K 1UHFA 3CCSA 2GF7A 4Y91A 2ZTGA 2K2VA 4OGEA 3FB9A 3A8MB 4JJBA 4DPGA 4WCIA 3META 3OA6A 3CC4Q 4LD6A 1X2QA 1YN8A 2DX1A 1SERA 2WACA 4MZTA 1SHGA 3OYCA 4RTZA 2DE0X 2CP6A 3L2QA 4C8QE 1IXDA 1U1SA 3LLRA 4CS3A 3OMCA 2YUQA 2KT1A 1YNZA 1T3SA 3V8KA 3VS3A 1VQ9Q 4F7UB 1NBEB 1GL5A 1ACMB 5CCAA 4J9CA 1B76A 1QVGP 5FRNA 1GBQA 3HXVA 3CMAA 2FPDA 5DLQE 3JCMV 4YRSA 1ABQA 1RLPC 1UE9A 1UGPB 4LVKA 1FYNA 1KK7A 1OU8A 2DTIA 3DB4A 2GFAA 1AWWA 4LNPA 1W2BS 1YHQT 1LYLA 3NETA 2EKHA 1AOJA 2F5TX 5IN1A 1NJ8A
chains in the Genus database with same CATH topology
4M75C 5LJ5d 5GAMf 4YRQA 2EJ9A 3LGFA 2EL9A 1OZ3A 1VIFA 1I5LA 4C0ZA 1B34B 5LJ5f 4XEOA 5LJ5g 1FWZA 2QHSA 1L0WA 2M9UA 4OGCA 2V8JA 4BI4A 3FJPA 2FYKA 1Q7YC 3JRZA 2E1HA 2LRQA 1U1TA 5KE3A 4QQGA 3UT1A 1Y96A 3WXMB 1X56A 4IUUA 3RGLA 4C92D 4KR2A 1YJWA 4M78E 1NYQA 4YDQA 4M75A 3QDRB 3QYGB 3IALA 4EO4A 1LNXA 1VQNA 4J8OA 4BWAA 1J5WA 5CR2A 1EIYA 4M7AF 3R6OA 4EMGA 3S3NA 1VQ8T 5GMKj 4LNSA 4A53A 3L2UA 4FT2A 3LC0A 4P74A 2XD0A 4E7JA 3HFZA 4CS4A 1BKBA 2QQAA 4EMKA 4HVCA 2K4YA 1GXIE 3PTAA 1G5VA 1QP2A 4TVAB 1GGMA 3R07A 1JBMA 4PJOD 4OF1A 1ASZA 2I4MA 1WJRA 3CC2A 2K5IA 1X54A 2CYZB 2QXFA 4XAXB 1VQOT 4ZGEB 2LQ8A 1OI1A 5D6WA 3QG1A 3L2WA 1OZ2A 3OQ5A 3OSSC 3FRNA 4DA4A 4M7AB 2CIMA 3CCJT 3UWNA 3A5ZA 4M7DE 5F5WA 3JCMb 2CKKA 1Q86C 1VQ9T 1M1KU 1KG1A 3MHXA 3NELA 1KD1U 5LJ3d 1VIEA 2E10A 3CD6A 2ZIMA 4DOVA 4WF2A 2RHIA 1VQMA 4C92E 3S6WA 1UGSB 2XK0A 2ZINA 5GAN3 4M77C 3HFVA 3HRKA 4XTZA 1B8AA 5LJ3g 1ADJA 2ALYA 2XGTA 1QW1A 1X2GA 5GAOq 1NJ1A 1K73C 2L89A 3CCST 4L59A 1BBWA 3OY9A 3I7FA 4ZN1A 2Q7HA 5IAYA 2HBPA 2RA2A 2RJFA 3RMSA 3PCOB 4CH3A 1HXDA 1QVFS 1X2HA 1YI2A 2Y90A 4G85A 4H2XA 4NOYA 3C4SA 3P8DA 2MWOA 2RJCA 4XTUA 2PMEA 3O8VA 3QKJA 4EDUA 3GNGA 5GANf 2A8EA 4P75C 5GANg 3CXCA 3CMAT 4PJOE 2K3XA 3JCMh 3HKSA 3UDCA 1KQ2A 2EQJA 1M4ZA 4K88A 5E3IA 2JUFA 4X34A 2DU5A 4MMLA 4C0FA 1KMMA 4C8QA 2C06A 2FL7A 5CIUA 2CS7A 4P72C 3REUA 4E51A 3OS1A 3IG2A 1NJIC 2ODRC 3P8BB 3M55A 1BI2A 4P75A 4LDXA 4DQ2A 3OYHA 3CXCS 4CRIA 3E19A 3VYGA 4YRPA 4QVCA 3BW1A 2CZ0B 4JUVA 4RG8A 1RL2A 2CJ9A 1NJ2A 3E9IA 3NTIA 2EQMA 4R55A 4KULA 4IKFA 2DIQA 1YJWT 1H3ZA 1B70A 4C0DB 3UGTA 2P0PA 3G6ET 3BFMA 3I56T 4JLIA 1EVLA 4WJ3M 2L8DA 1VQNT 2AMCB 2L3RA 2BUDA 3VV0A 3MP6A 3Q1JA 3QIIA 1O75A 4P71C 3OYDA 1UGRB 1IREB 1NJ5A 3CCUT 4J5YA 5D6XA 4YRCA 4TWAA 2XHCA 3HRIA 4HWSA 3JB9J 4XTYA 1KQSA 2BIVA 2K5FA 4H02A 4M78A 2DAQA 1KC8C 4FT4A 2QEXT 1D3BB 3CC2T 2KVQG 4P3OA 3HXZA 4TVRA 4M7AD 4MZMA 4EMHA 2E41A 2RB6A 2RO0A 4JRIA 3QSUA 4YP0A 3CCMT 3ICAA 4RQFA 4M7DC 3HRTA 1N9WA 3JCMP 2PQWA 3RMQA 3PZCA 1YJ9T 2ZPHB 3G1ZA 2LDMA 2ZXFA 2ZZGA 1FXXA 4J6YA 3X26B 3NEMA 1VQ8A 4HWTA 1X6OA 4LDYA 4ELYC 5KCOA 12ASA 2FHDA 1USYA 3L42A 1QVPA 3QNEA 3A7AA 2RH2A 2IY5B 2DPPB 2GFUA 4YRMA 3A31A 4YRJA 4CI0C 3M9QA 2DZCA 2A3LA 2DQ3A 5HY6A 3VBBA 1YI2T 3QO7A 2K57A 2M1HA 4GLKA 3CC4A 3OSVA 4L87A 4C92A 2DTOA 3QBYA 2F5KA 1H4QA 4QQ6A 4YCVA 4PJOC 2NLUA 3QJYA 4XU0A 4YRKA 4E7KA 3HRSA 4KR3A 2LNVA 2QHTA 3RUXA 5GMKi 1VQ9A 2P5IA 3JCMQ 2ZT8A 1NJ6A 3OMGA 1SSFA 5DLOA 4M7AE 4YRNA 5HK3A 5C53B 2HNIA 1KC8U 3P8VA 11ASA 1EVKA 2EQUA 3OD1A 4KUIA 2B8AA 4HCBA 4BW9A 2IG0A 2DK3A 1H4SA 4J6XA 1JB0E 4PJOA 2RI2A 3P8YA 2EIFA 3GPLA 4RG2A 3OYLA 3QTCA 3HRUA 1M1FA 3MCAB 3OYBA 4XTXA 4KT0E 2Q5IA 4UP9A 1YCYA 4LDUA 3FEOA 2O4XA 3ASKA 4RKUE 1HC7A 4MDXA 1QF6A 4EX5A 1YGBA 3HY1A 2JVVA 4PHCA 2DZ9A 1K9MU 3NENA 3CBMA 3PNWC 2M0OA 4GY5A 5GAMd 2R58A 2LT1A 2P4TA 5M9OA 4LD9K 3GLXA 5J26A 5A0GA 4EPCA 3JSCA 1QVGA 2D6FA 4HT8A 1M1KC 5LJ5h 5GAMg 4Q15A 4C5HA 4RMOA 4HKEA 3RKYA 2VUBA 1KD1C 3MEYA 1Z7MA 2ZT6A 3PIOA 1WQ7A 2CGHA 4JLGA 4D6WA 3FC3A 3KUFA 2R5AA 4P74C 3SWNC 1I4K1 3TEGA 2R57A 2AKWB 3HXXA 2VGNA 4XTVA 3VJPA 1XQHA 1KQ1A 2MWPA 4F7UA 1Y71A 4EMKC 2X4JA 4II1A 4RCBA 1IL2A 1PYSB 1C0AA 3OYNA 1BBUA 3G71T 2KDSA 4HWOA 3G6EA 1QVGS 2DDZA 2QQ9A 3VUZA 3I56A 2JTMA 2DXCA 3V7CA 3CBOA 1G3TA 2XI9A 4E7HA 1VQ7T 2PU9B 3VUBA 4C0GA 3QZ9B 2E3CA 3UH0A 3OYMA 2H3JA 3CCUA 3OB9A 3ZBDA 3SWNA 2QQSA 3VYHB 1B34A 2OTJA 1YB3A 2F69A 4XU1A 2QQBA 3OYFA 4YRIA 2PMFA 4K87A 2QEXA 3FDRA 3E9FA 3QZ5B 2C7IA 2J3LA 4JDSA 1SESA 4RQEA 4A4FA 3G7ZA 1ADYA 4P73C 3IKLA 4XTWA 3MEWA 3OYEA 5GAMe 2P0LA 3MP8A 3CC4T 3CCMA 2ZZDA 4RDXA 3OYKA 2X4XA 5LJ5e 4HT4A 1H641 3DKMA 1YJ9A 3LX7A 2EYQA 4A54A 2E65A 3MF1A 4M7AC 1M8VA 4HWPA 3MEVA 4LVMA 5LJ3h 3TEEA 2EJFA 2ZZEA 4B9XA 2IVWA 2L5QA 4HCZA 4BE0A 2FB7A 2DQ0A 1YJNA 4P73A 2VYTA 2RHQB 4TVAA 4M77B 5IT9E 2ZR3A 3RF1A 5EG2A 3QPHA 5GAN6 4WI1A 3A7RA 4P3PA 4O5VA 4X5OA 3QO8A 2ZPGB 4PLIA 5FU7B 5LJ3j 2DVEA 1KMNA 4CH4A 2JTFA 4QW2A 4P3NA 5LL6S 3VQXA 4M7AA 3HPWA 4C8QC 5FRMA 3J7AF 5GANd 2ZPIB 2LX9A 4M75G 5C52B 2RHUA 3A8OB 3QYHB 1E1OA 3CMQA 2ZPFB 5DM7R 4N4IA 3PMIA 1AHJB 3M5AA 1SETA 3KFUA 2ARTA 2E6ZA 4Y28E 3V8LA 5C0MA 2DO3A 3MEAA 3X25B 2ZT7A 4O6JA 1JJCB 3GNFB 4JRQA 3LWIA 2ARSA 4BDYA 3TREA 1VUBA 1B7YB 2ZGWA 1RI0A 4V2SA 2YHTA 3PCOA 2RHZA 3JCMf 5HGQA 3JCMg 1M9SA 2LC4A 2CJAA 2XKOC 3VQYA 3OS2A 3OYAA 1NE8A 2DIGA 4YRGA 5GAOn 1MHNA 3CC7A 4H2YA 5AYFA 4ZGJB 1ASYA 3HXUA 3A32A 5GMKl 1WYDA 4LDVA 4M78C 2WSEE 5LJ3e 1X01A 2XDPA 5CVIA 4ZTJA 2WSCE 1RIQA 5GMKm 4MZPA 5GAOl 4LVLA 2VV5A 5KNNA 4FSXA 4KQEA 1NPRA 3F70A 5ELOA 4YPFA 1BIBA 2E5QA 2I4LA 2KY9A 2RI3A 2LCLA 4WJ4A 4F7UE 3VQVA 1G3YA 3X20B 4L6V5 2MI6A 2OTJT 2RHXA 3HHTB 1BI1A 3ZFJA 5GANe 4B9WA 4YREA 3MO8A 5K1PA 3M56A 4J83A 3TUPA 1DJ7B 1Y7XA 1NZ9A 3E9HA 3MEUA 2VC8A 4TTVA 4CS2A 1YBYA 2I4NA 4PNOA 4J15A 3EFRA 3L1AA 4C5IA 2YRVA 2JN0A 3JCMX 1USYC 4TVWA 3LWHA 1HTTA 4M77G 2K3YA 4TVYA 4AH6A 5CK9A 5KCHA 2EQKA 1VQ5T 4G84A 4M7DB 3BDUA 3G71A 1WQWA 1N27A 2AMCA 1N6AA 1S72A 5GAN2 3M58A 4OMFB 3L4GB 1KQSS 5A0DA 4E7LA 3PMTA 2G3RA 1M90U 1ZQ1A 1UEBA 4Q5WA 3PT9A 4C8QG 4ME7A 1VQ7A 3LSQA 5DY9A 4N0AC 1N9RA 4C92C 3S3MA 2RHSB 4QVZA 2DKGA 1K9MC 3C94A 1YJNT 3TEHB 2P0KA 3A8HB 1IZ6A 2RHYA 5I2SA 1E1TA 1D3BA 2QDYB 1E24A 4OLFA 4BY6C 4FM4B 3REXA 4BI3A 4E47A 3NTHA 4IUPA 3VQWA 1KHCA 2DJZA 1VQZA 1PSEA 2PVDB 4N4GA 2XICA 2D0QB 4NL3A 5KH6A 3RERA 4N0AA 1X55A 2XDDA 5FU6C 3RL6A 5A2QE 2OTLT 3RIRA 2DD4A 1JJ2A 4C5EA 5CQXA 4PJOB 4UC4A 1UB4A 3G4SA 2RI5A 1G3SA 3PGGA 2HQXA 2EKOA 4RMFA 3JB9H 4BE2A 2QHUA 5C51B 4ATOA 1I81A 2G4CA 2V8KA 4NCXA 3N5BB 1Q81U 4FIBA 1YFRA 3CCQT 3OYIA 3RESA 4BI8B 5HKCA 4M78G 1N8RU 2PUOB 3CCRT 2IY5A 3L2RA 4OVAA 2X35A 1XOVA 3ZEHA 2KSSA 1U8RA 4LVIA 4X9DA 2NS6A 1JJ2S 4TQFA 3CCLT 4TQDA 3LH0A 4BACA 1NYRA 3BJUA 4M75F 2RJEA 3INZA 3CC7T 4HCCA 2RK1A 3JB9G 3OS5A 4NL2A 4YRFA 1W66A 2DXTA 4BE1A 3RACA 1W2BA 4PLLA 2QTXA 3HY0A 2I2LA 5KE2A 3M59A 1LOJA 3CMET 2ZNJA 2O01E 3M57A 1M1GA 3NFCA 2ZPBB 4XEMA 1PSFA 3BDLA 3J80E 3CCET 2XIDA 4J6WA 2X4WA 1I8FA 1K8AC 5GAMh 3JB9D 3PIPA 3RKXA 3A74A 1Y96B 4XQ3A 5FROA 1E22A 5CKFA 2R5MA 1BI3A 3LW5E 3W3SA 4M75B 4M7DG 1XNIA 1YITA 4BDZA 1WJQA 2LQKA 3GP8A 1VQKT 5A0LA 3L2ZA 3LSSA 2KQWA 5C6SA 2EJGA 3T9NA 3SD4A 5GAMj 2Q7EA 1EIYB 4OB2B 3WVDB 3JB9I 4H2UA 3EAEA 3RKWA 4C92G 1OYXA 1Q82U 1KOGA 2ARUA 3SWNB 5LJ5j 1YIJT 3VKIA 2DD5A 4M7DD 3HFZB 4N4HA 4EMKB 4JJNK 4HWRA 4NS5A 3HFOA 4ZTZB 4A4KA 3HSBA 1TH7A 1S72T 2QHVA 3P8TA 2X4YA 3HL8A 1WNLA 4VUBA 2JZ2A 3VU3C 4BB7A 2QA4A 5GMKh 2P0QA 3KXTA 2PVGB 4A4EA 3UPUA 3X28B 2XTIA 2AHJB 3V7RA 5GAN7 3ME9A 3GOXA 3A5ZB 3GIBA 2Q5HA 1VQPA 4PJOG 3WQZA 1ATIA 4YCWA 4QVDA 4UP8A 4Z02A 1EQRA 1G5HA 2QI2A 1MGQA 1WJSA 3QJ6A 1WU7A 4LVJA 3FIFA 2GCXA 2AKWA 4QQDA 3CCVT 3DSQA 4M77F 2I4OA 1PYSA 3WVEB 1NNHA 4ZIBA 1VQLA 4FL6A 1X75C 2ALYB 2HD0A 1K8AU 4Q6GA 3SFMA 3JCMc 4YROA 2KAFA 1VQ5A 2GQVA 3C95A 4IUTA 2JNGA 4YCUA 3QXEB 4ZTFA 3I55A 4C8QF 3G4ST 5CKEA 1ZHIA 1VQ6T 2KMTA 5L8RE 2DXUA 3OS0A 4PG3A 3OYJA 1QP3A 4O2DA 3LYIA 2DU7A 2LCCA 4H2XB 1QE0A 3H8ZA 2E12A 1KHIA 2JOYA 2EWNA 1WPYA 5CO7A 4OB1B 1QVFA 2MMPA 2ZNIA 4R56A 3A8GB 2E70A 3S3OA 4UP7A 4L5GA 4XK8E 2ZCFB 1HK9A 3M4QA 1EFWA 3URGA 5I2MA 2ZCEA 3SB2A 4H2SA 2OAUA 2VXFA 5LJ3f 4F7UG 1YFSA 1G3WA 2RM4A 2LVMA 2RJDA 1P92A 4C8QB 5GMKe 1G5IA 5GANh 1NPPA 1Q7YU 4E7IA 2A7YA 1FX7A 5CKBA 5FU7C 1ZBXA 1N9SA 3M4GA 3BY7A 3C12A 2OTLA 4H2VA 4BD3A 4KUDK 3UGQA 3GF5A 4J7IA 4IUVA 2PVOB 3M54A 2EFIA 4BUGA 2V8IA 1XTDA 4K86A 5CKDA 2MF2A 3FLGA 4OB0B 2YLCA 3HTZA 1BI0A 5HK0A 2E64A 2Y4XA 4M78F 4XU3A 3MQZA 5GANj 4YRLA 4JRPA 3OBWA 3QHSA 2RHQA 4M75D 2PUKB 4M77A 3CCQA 3E1SA 5GAOp 1VQ4A 2QQRA 3CCRA 1B70B 3JCMd 3CBPA 1M90C 3LGLA 3TCJA 3KBGA 5GAN4 1YITT 1WLEA 3A7UA 1SRYA 1LJOA 2M16A 5GAN8 2HAXA 2LTOA 3JB9F 3CCLA 3E9GA 2VGMA 4J7FA 1M5Q1 3X24B 2XU8A 2XDBA 1O9SA 3CEYA 4X9CA 4M78B 3M53A 2ZR2A 3AHUA 1EOVA 3CMEA 1WGSA 3H6ZA 3OYYA 3CCEA 2QA4T 3OBYA 3J81E 2DXBA 1Q86U 2ZT5A 1JJCA 3QUIA 2DEQA 4CH6A 4C0DC 3JCMW 1B7YA 1FYFA 5GAOm 4H2TA 4P5NA 4PKCC 4M7DF 4JRKA 2CZ1B 3DLMA 3QO5A 4P72A 3MP1A 3P8HA 4RCCA 5J3BA 5I21A 4YTLA 3EFSA 2Q7GA 2E5AA 1VQPT 4CH5A 3CPWA 4HT9A 5FLXE 2CZ6B 1Q81C 5GAOr 4IUQA 1VQKA 3V7SA 4YRTA 1K73U 1YHQA 2CJBA 4ZN3A 1Z7NA 1N8RC 4M7AG 4C92F 2ZZFA 2RD1A 1UGQB 4M75E 3HXWA 2DTHA 5D6YA 4OB3B 3PFSA 1VQLT 2EAYA 3JCMJ 1YIJA 3HXYA 3CPFA 4JS5A 4OP0A 3QO3A 1W4SA 3JCMe 3I55T 3CPWS 3JAME 3UFGA 4P71A 4A4HA 2BKDN 4FU6A 2LT4A 2C8MA 3L2VA 2RK2A 4M77D 4C92B 4ELZC 2CZ7B 4PJOF 2ZIOA 2FVUA 4HA8A 3DB3A 2XG8D 2K5LA 4LDWA 3M4YA 3V8JA 1BYMA 4DOWA 5CKHA 3CD6T 2YLBA 3MF2A 4XU2A 3NTKA 4BY6B 4PL6A 1NJIU 1VQMT 4C8QD 3OW2A 3CCVA 1Y07A 4C5GA 5CAIA 4A4GA 3HFNA 4M7DA 3ER0A 4YYEA 1H4TA 5FU6B 4YRRA 3ERRA 3L4GA 3SDZA 3DLLA 2HQEA 4JS4A 5J39A 1Q82C 5GAN5 1VQOA 2D9TA 2VXEA 5ELNA 1VQ6A 2Y4YA 1YFTA 3M4PA 2RHSA 4H2WA 4MMKA 1BIAA 3TEHA 2E6NA 3CCJA 1H4VB 4ZGDB 5K1XA 4MDWA 1JRIA 4IURA 3A5YA 4UPAA 3OW2S 1VQ4T 2O4XB 4KBMB 3OYGA 2ODRD 1EIFA 1G51A 2J3MA 4ZTUB 4F7UF 1V29B 2KK4A 5CQYA 3HP9A 2WSFE 2MAMA 3IKMB 1R8OB 4M77E 3A8LB 4M78D 2ZPEB 3TU4K 3CCSA 2GF7A 4Y91A 2ZTGA 2K2VA 4OGEA 3FB9A 3A8MB 4DPGA 3META 3OA6A 4LD6A 1SERA 2WACA 4MZTA 3OYCA 3L2QA 4C8QE 1U1SA 3LLRA 4CS3A 3OMCA 3V8KA 4F7UB 5CCAA 1B76A 5FRNA 3HXVA 3CMAA 5DLQE 3JCMV 4YRSA 1UGPB 4LVKA 2DTIA 3DB4A 2GFAA 1W2BS 1YHQT 1LYLA 3NETA 2F5TX 5IN1A 1NJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RIQ A;  4M75 C;  5LJ5 d;  5GAM f;  5GMK m;  2EWN A;  1WPY A;  2DZC A;  4YRQ A;  5GAO l;  5KNN A;  2DQ3 A;  2EJ9 A;  4KQE A;  2ZNI A;  2EL9 A;  3VBB A;  1I5L A;  5ELO A;  3QO7 A;  4YPF A;  1BIB A;  2K57 A;  4UP7 A;  4L87 A;  2I4L A;  4C92 A;  1B34 B;  1HK9 A;  5LJ5 f;  2DTO A;  3M4Q A;  1EFW A;  4XEO A;  5LJ5 g;  4WJ4 A;  2ZCE A;  2QHS A;  1L0W A;  4F7U E;  3SB2 A;  1H4Q A;  4YCV A;  4PJO C;  4H2S A;  3VQV A;  4XU0 A;  4YRK A;  2VXF A;  5LJ3 f;  4F7U G;  1YFS A;  2RM4 A;  3FJP A;  2FYK A;  4KR3 A;  2QHT A;  3RUX A;  5GMK i;  2E1H A;  1U1T A;  2P5I A;  3JCM Q;  4C8Q B;  2ZT8 A;  5GMK e;  5GAN e;  1G5I A;  1NJ6 A;  5GAN h;  1Y96 A;  4YRE A;  4M7A E;  4YRN A;  1X56 A;  3RGL A;  5K1P A;  4C92 D;  1N9S A;  5C53 B;  4KR2 A;  3M4G A;  3BY7 A;  4M78 E;  1NYQ A;  3TUP A;  2HNI A;  4H2V A;  4YDQ A;  4M75 A;  3E9H A;  3UGQ A;  3P8V A;  3IAL A;  2VC8 A;  4TTV A;  11AS A;  4EO4 A;  4CS2 A;  1LNX A;  2I4N A;  4PNO A;  4J15 A;  3EFR A;  3L1A A;  4K86 A;  1EVK A;  4BWA A;  2JN0 A;  1J5W A;  3JCM X;  1USY C;  3OD1 A;  1EIY A;  4M7A F;  4TVW A;  2YLC A;  3HTZ A;  1HTT A;  4M77 G;  4EMG A;  4TVY A;  2E64 A;  4M78 F;  4AH6 A;  4XU3 A;  5GMK j;  5GAN j;  4YRL A;  4BW9 A;  1H4S A;  4J6X A;  4LNS A;  4PJO A;  4A53 A;  3QHS A;  2RHQ A;  4M75 D;  3P8Y A;  4G84 A;  4M77 A;  4M7D B;  3BDU A;  3LC0 A;  4P74 A;  1WQW A;  5GAO p;  2AMC A;  3QTC A;  5GAN 2;  1B70 B;  3JCM d;  3HFZ A;  4CS4 A;  3L4G B;  5GAN 4;  4EMK A;  4HVC A;  4XTX A;  2Q5I A;  4UP9 A;  1YCY A;  1WLE A;  3A7U A;  4TVA B;  4C8Q G;  1SRY A;  1GGM A;  1LJO A;  3LSQ A;  5GAN 8;  3R07 A;  5DY9 A;  1JBM A;  4N0A C;  1N9R A;  4PJO D;  4C92 C;  2RHS B;  1ASZ A;  2I4M A;  1HC7 A;  3JB9 F;  1X54 A;  2DKG A;  1QF6 A;  4EX5 A;  1YGB A;  3HY1 A;  4PHC A;  2DZ9 A;  3TEH B;  3NEN A;  1M5Q 1;  5GAM d;  1E1T A;  1D3B A;  1E24 A;  4OLF A;  3REX A;  4M7A B;  4X9C A;  2CIM A;  4M78 B;  3A5Z A;  3VQW A;  2DJZ A;  2ZR2 A;  4M7D E;  1VQZ A;  3AHU A;  1EOV A;  4HT8 A;  5F5W A;  5LJ5 h;  3JCM b;  5GAM g;  4Q15 A;  3RKY A;  3MEY A;  1Z7M A;  2ZT6 A;  4NL3 A;  3NEL A;  2ZT5 A;  5LJ3 d;  1JJC A;  3QUI A;  2E10 A;  3RER A;  4N0A A;  2DEQ A;  2ZIM A;  1X55 A;  4CH6 A;  1WQ7 A;  2CGH A;  3JCM W;  3RL6 A;  4WF2 A;  1B7Y A;  3RIR A;  1FYF A;  5GAO m;  4H2T A;  4M7D F;  4JRK A;  4C92 E;  3QO5 A;  2ZIN A;  5GAN 3;  4PJO B;  4P72 A;  4M77 C;  3HFV A;  3HRK A;  4RCC A;  1B8A A;  4XTZ A;  4P74 C;  5I21 A;  3SWN C;  1I4K 1;  3EFS A;  5LJ3 g;  1ADJ A;  2ALY A;  2Q7G A;  2E5A A;  2XGT A;  3TEG A;  4CH5 A;  1X2G A;  5GAO q;  2AKW B;  3HXX A;  3PGG A;  4XTV A;  4HT9 A;  1NJ1 A;  1KQ1 A;  4F7U A;  4RMF A;  5GAO r;  3JB9 H;  2QHU A;  4EMK C;  3V7S A;  4YRT A;  5C51 B;  4RCB A;  1I81 A;  1IL2 A;  2G4C A;  1BBW A;  4NCX A;  2CJB A;  1PYS B;  1C0A A;  1Z7N A;  1YFR A;  4M7A G;  3I7F A;  4C92 F;  1BBU A;  4HWO A;  2Q7H A;  3RES A;  2DDZ A;  4M78 G;  2ZZF A;  2RA2 A;  3PCO B;  2RD1 A;  4CH3 A;  2IY5 A;  1HXD A;  3V7C A;  4M75 E;  1X2H A;  3HXW A;  2DTH A;  2Y90 A;  4G85 A;  4H2X A;  2EAY A;  4NOY A;  3JCM J;  3HXY A;  4X9D A;  4XTU A;  2E3C A;  2PME A;  4TQF A;  3UH0 A;  4TQD A;  5GAN f;  3BJU A;  1NYR A;  5GAN g;  4OP0 A;  3QO3 A;  3SWN A;  4P75 C;  4M75 F;  4PJO E;  3INZ A;  3JCM e;  1B34 A;  3JCM h;  3JB9 G;  1YB3 A;  3UFG A;  4NL2 A;  1KQ2 A;  4K88 A;  4XU1 A;  5E3I A;  4P71 A;  4YRF A;  1W66 A;  2DXT A;  3RAC A;  2DU5 A;  4MML A;  4YRI A;  2C8M A;  2PMF A;  4K87 A;  2QTX A;  3HY0 A;  2I2L A;  2C7I A;  2J3L A;  1KMM A;  4M77 D;  1LOJ A;  4C92 B;  4C8Q A;  1SES A;  4PJO F;  2ZNJ A;  4RQE A;  2ZIO A;  4XEM A;  4HA8 A;  1ADY A;  4P73 C;  4P72 C;  3IKL A;  4XTW A;  3V8J A;  3REU A;  4J6W A;  1I8F A;  5GAM e;  2P0L A;  5GAM h;  2YLB A;  4E51 A;  3IG2 A;  3MF2 A;  4XU2 A;  3JB9 D;  2ODR C;  3RKX A;  3A74 A;  1Y96 B;  4P75 A;  4RDX A;  4DQ2 A;  4XQ3 A;  4C8Q D;  1E22 A;  4YRP A;  5LJ5 e;  4QVC A;  3BW1 A;  3W3S A;  4M75 B;  4M7D G;  1H64 1;  4JUV A;  4A54 A;  2E65 A;  3MF1 A;  2CJ9 A;  4M7A C;  5CAI A;  1M8V A;  4HWP A;  1NJ2 A;  3E9I A;  3HFN A;  4M7D A;  5LJ3 h;  3LSS A;  2EJF A;  3L2Z A;  4YYE A;  2ZZE A;  2EJG A;  1B70 A;  5GAM j;  1H4T A;  2Q7E A;  3UGT A;  4YRR A;  1EIY B;  3ERR A;  3L4G A;  3BFM A;  4JLI A;  2FB7 A;  1EVL A;  2DQ0 A;  4WJ3 M;  3JB9 I;  4P73 A;  4H2U A;  5GAN 5;  3RKW A;  2RHQ B;  4TVA A;  4C92 G;  4M77 B;  2VXE A;  1KOG A;  2ZR3 A;  3RF1 A;  5ELN A;  2ARU A;  3SWN B;  5LJ5 j;  2AMC B;  1YFT A;  3M4P A;  2RHS A;  5GAN 6;  4H2W A;  4M7D D;  3HFZ B;  4WI1 A;  4MMK A;  3A7R A;  4P3P A;  1BIA A;  4X5O A;  3TEH A;  4EMK B;  3QO8 A;  4P71 C;  4HWR A;  1H4V B;  5K1X A;  5LJ3 j;  3HFO A;  4ZTZ B;  1NJ5 A;  2DVE A;  1JRI A;  4J5Y A;  3HSB A;  3A5Y A;  4UPA A;  1TH7 A;  4TWA A;  4YRC A;  1KMN A;  4CH4 A;  2QHV A;  3HRI A;  3P8T A;  4HWS A;  4P3N A;  1WNL A;  3VQX A;  4M7A A;  4C8Q C;  3JB9 J;  4XTY A;  3VU3 C;  5GAN d;  4H02 A;  4M78 A;  5GMK h;  4M75 G;  5C52 B;  2ODR D;  1G51 A;  2XTI A;  1E1O A;  2J3M A;  3CMQ A;  4ZTU B;  4F7U F;  1D3B B;  3V7R A;  5GAN 7;  4P3O A;  3HXZ A;  3IKM B;  3GIB A;  4M7A D;  4M77 E;  4EMH A;  2E41 A;  2RB6 A;  1SET A;  2Q5H A;  3KFU A;  2ART A;  4PJO G;  3WQZ A;  4M78 D;  1ATI A;  4YCW A;  4JRI A;  4QVD A;  3QSU A;  4YP0 A;  4UP8 A;  3V8L A;  3ICA A;  1EQR A;  4RQF A;  1G5H A;  4Y91 A;  2ZTG A;  4M7D C;  2ZT7 A;  1MGQ A;  3FB9 A;  1N9W A;  1JJC B;  4DPG A;  3JCM P;  1WU7 A;  3FIF A;  3PZC A;  2AKW A;  2ARS A;  1B7Y B;  1SER A;  3DSQ A;  3G1Z A;  4M77 F;  2ZXF A;  2I4O A;  4C8Q E;  1PYS A;  2ZGW A;  1NNH A;  4ZIB A;  1U1S A;  2ZZG A;  4CS3 A;  4V2S A;  2ALY B;  4J6Y A;  2YHT A;  3NEM A;  3PCO A;  4Q6G A;  4HWT A;  3JCM f;  5HGQ A;  3V8K A;  3JCM c;  4YRO A;  3JCM g;  4F7U B;  2CJA A;  3VQY A;  1B76 A;  12AS A;  4YRG A;  5GAO n;  3HXV A;  1USY A;  4YCU A;  3JCM V;  4H2Y A;  4YRS A;  4C8Q F;  1ASY A;  3HXU A;  3A32 A;  5GMK l;  3QNE A;  3A7A A;  1WYD A;  2DXU A;  2IY5 B;  2DTI A;  4PG3 A;  4O2D A;  4M78 C;  5LJ3 e;  2DU7 A;  1X01 A;  4YRM A;  1LYL A;  3NET A;  3A31 A;  4H2X B;  1QE0 A;  4YRJ A;  1NJ8 A; 
#chains in the Genus database with same CATH topology
 4M75 C;  5LJ5 d;  5GAM f;  4YRQ A;  2DL5 A;  1GRI A;  4OMQ A;  2EJ9 A;  3LGF A;  2EL9 A;  1OZ3 A;  1Q86 R;  1VIF A;  1I5L A;  2AKK A;  4C0Z A;  1PD0 A;  2FRW A;  4QT7 A;  1B34 B;  5LJ5 f;  4XEO A;  5LJ5 g;  1FWZ A;  2QHS A;  1L0W A;  4KGX B;  2M9U A;  4OGC A;  2V8J A;  4BI4 A;  3FJP A;  2FYK A;  1Q7Y C;  2BZY A;  3JRZ A;  2E1H A;  2LRQ A;  1U1T A;  5KE3 A;  1UUE A;  1WXB A;  2EQI A;  4QQG A;  3EG1 A;  3UT1 A;  1Y96 A;  3WXM B;  1K73 R;  1X56 A;  4IUU A;  3EHR A;  3RGL A;  4C92 D;  4KR2 A;  1YJW A;  4M78 E;  1NYQ A;  2DLP A;  4YDQ A;  4M75 A;  3QDR B;  3QYG B;  4KGZ B;  1IGU A;  3IAL A;  2DEU A;  2IPO B;  4EO4 A;  1LNX A;  1VQN A;  4J8O A;  4BWA A;  1J5W A;  4LN2 A;  3VS7 A;  1TXQ A;  1IGQ A;  5CR2 A;  1EIY A;  4M7A F;  3R6O A;  2A08 A;  2K2M A;  4EMG A;  3S3N A;  2ABL A;  2NWM A;  1VQ8 T;  4FSS A;  5GMK j;  2RF0 A;  4LNS A;  4A53 A;  3L2U A;  4FT2 A;  2DIL A;  1U06 A;  3LC0 A;  1KFZ A;  4P74 A;  8AT1 B;  2MK5 A;  4AMC A;  2XD0 A;  1C0M A;  4E7J A;  3HFZ A;  3M0Q A;  4CS4 A;  1BKB A;  2QQA A;  1T0H A;  3QDF A;  4EMK A;  4HVC A;  2K4Y A;  1GXI E;  3PTA A;  1G5V A;  5GJV B;  1D1B A;  1D0Z A;  2V1Q A;  1QP2 A;  4TVA B;  1GGM A;  1K1Z A;  3R07 A;  2KT8 A;  1JBM A;  4PJO D;  1WHH A;  1W1F A;  4OF1 A;  1ASZ A;  2I4M A;  1HYO A;  1WJR A;  2G6F X;  2K5I A;  3CC2 A;  2EYZ A;  1X54 A;  2CYZ B;  2QXF A;  1HSQ A;  4B6M A;  4XAX B;  1VQO T;  4ZGE B;  2LQ8 A;  1KSW A;  1OI1 A;  5D6W A;  3QG1 A;  3L2W A;  1OZ2 A;  3OQ5 A;  1TS9 A;  3OSS C;  3I56 Q;  1AWX A;  3FRN A;  4DA4 A;  4M7A B;  7AT1 B;  1NJI R;  1OQK A;  2CIM A;  2DRM A;  3CCJ T;  2QGG A;  3UWN A;  3A5Z A;  1K4U S;  4M7D E;  2Z0W A;  5F5W A;  1GFD A;  3JCM b;  2CKK A;  1Q86 C;  3H41 A;  1VQ9 T;  2OX7 A;  1M1K U;  1FMW A;  1MND A;  1KG1 A;  3MHX A;  3NEL A;  1KD1 U;  5LJ3 d;  1VIE A;  2E10 A;  3CD6 A;  2EVR A;  2ZIM A;  4DOV A;  4WF2 A;  4OML A;  2OTJ Q;  2GNC A;  3VS0 A;  2L3P A;  3ULR B;  2RHI A;  1VQM A;  4C92 E;  1OU9 A;  3S6W A;  1UGS B;  2XK0 A;  2ZIN A;  5GAN 3;  2YUN A;  4M77 C;  3HFV A;  3HRK A;  4OMO A;  4XTZ A;  1B8A A;  2EGC A;  5LJ3 g;  1ADJ A;  2ALY A;  2XGT A;  1QW1 A;  1X2G A;  5GAO q;  2AK5 A;  1NJ1 A;  4OMM A;  1K73 C;  2JMC A;  2L89 A;  2OAW A;  3CCS T;  4L59 A;  1G8X A;  1BBW A;  4E2F B;  3OY9 A;  4J9E A;  2O88 A;  3I7F A;  1E6G A;  1N8R R;  4ZN1 A;  2Q7H A;  5IAY A;  1M2V B;  2HBP A;  2MOX A;  2RA2 A;  2RJF A;  3RMS A;  3PCO B;  4CH3 A;  1HXD A;  1QVF S;  1ZUU A;  1X2H A;  3RDV A;  1YI2 A;  2AZS A;  2CP5 A;  1VQ5 Q;  2Y90 A;  4G85 A;  1QCF A;  1PCX A;  4H2X A;  1TTH B;  4NOY A;  3C4S A;  3P8D A;  2MWO A;  2RJC A;  4XTU A;  5KYW A;  2PME A;  3O8V A;  3QKJ A;  4J9G A;  4EDU A;  3GNG A;  5GAN f;  2A8E A;  2QG9 B;  4P75 C;  5GAN g;  3CXC A;  3CMA T;  4PJO E;  2K3X A;  4DBF A;  2O9S A;  3JCM h;  2EBP A;  1I0C A;  3HKS A;  3UDC A;  1KQ2 A;  2EQJ A;  1M4Z A;  4K88 A;  5E3I A;  1K76 A;  1YJN Q;  4DBR A;  2FG0 A;  2JUF A;  4X34 A;  2DU5 A;  4MML A;  4C0F A;  2O31 A;  1KMM A;  4C8Q A;  2ECZ A;  2C06 A;  3H0I A;  2FL7 A;  5CIU A;  2KRN A;  2CS7 A;  1RAE B;  4P72 C;  1ZBJ A;  1AVZ C;  3REU A;  2A0F B;  2AIR B;  2E3I A;  1OOT A;  4J9I A;  1PKS A;  4E51 A;  3OS1 A;  3IG2 A;  1NJI C;  2ODR C;  3P8B B;  2J05 A;  3M55 A;  1WYX A;  1BI2 A;  2CP3 A;  4P75 A;  4LDX A;  4DQ2 A;  3OYH A;  5KYU A;  3CXC S;  2PTK A;  4CRI A;  3E19 A;  3VYG A;  4QKU A;  4YRP A;  2BE7 D;  4E6R A;  4QVC A;  3BW1 A;  2OTL Q;  2CZ0 B;  4JUV A;  4RG8 A;  1UJ0 A;  1RL2 A;  2CJ9 A;  1NJ2 A;  3E9I A;  3NTI A;  1RAH B;  2A36 A;  2EQM A;  4R55 A;  4KUL A;  1X6B A;  4IKF A;  2DIQ A;  1YJW T;  1H3Z A;  2D0N A;  1B70 A;  4C0D B;  3UGT A;  2P0P A;  3G6E T;  2MCN A;  3BFM A;  5I22 A;  3I56 T;  4JLI A;  1EVL A;  4WJ3 M;  4AG1 C;  2L8D A;  2HZY A;  2YDL A;  2C0O A;  1VQN T;  2YXY A;  1MMG A;  4PFO A;  1WIE A;  1ZX6 A;  2W10 A;  9ATC B;  1KQS P;  3CCQ Q;  2AMC B;  2K9G A;  1M3C A;  1ZSG A;  2L3R A;  2BUD A;  3VV0 A;  1NEB A;  3MP6 A;  3Q1J A;  3CCR Q;  1WZO A;  3QII A;  1OUL A;  1O75 A;  1NLO C;  4P71 C;  1BBZ A;  3OYD A;  1GBR A;  1UGR B;  3C0C A;  1IRE B;  1NJ5 A;  3CCU T;  4J5Y A;  5D6X A;  1X2K A;  1N5Z A;  4YRC A;  4TWA A;  2XHC A;  3HRI A;  1Z9Q A;  4HWS A;  1TG0 A;  2E5K A;  1CKB A;  3JB9 J;  4XTY A;  1KQS A;  2BIV A;  2K5F A;  4H02 A;  4M78 A;  3CCL Q;  1WHL A;  4F04 B;  2DF6 A;  3EGX B;  2DAQ A;  2LCS A;  3CC7 Q;  2DER A;  1KC8 C;  5GJW B;  1VYT A;  4FT4 A;  2QEX T;  1MNE A;  4FW1 A;  1D3B B;  3CC2 T;  1Y57 A;  1T3L A;  2ED0 A;  2KVQ G;  1ZUY A;  4P3O A;  3HXZ A;  4TVR A;  2HKN A;  4M7A D;  1R0B G;  2BZ8 A;  4MZM A;  2K79 A;  2E41 A;  2RB6 A;  2RO0 A;  4EMH A;  3UA6 A;  1NEG A;  1X27 A;  4JRI A;  2OI3 A;  3QSU A;  4YP0 A;  3CCM T;  3ICA A;  4RQF A;  4M7D C;  3CCE Q;  1ZLM A;  3HRT A;  1N9W A;  2QDL A;  1Y0M A;  3JCM P;  2PQW A;  1NLP C;  3RMQ A;  3PZC A;  3VRZ A;  1HJD A;  3G1J A;  2NUT B;  1YJ9 T;  2ZPH B;  3G1Z A;  2LDM A;  2ZXF A;  2F1L A;  2ZZG A;  1AT1 B;  2EGA A;  1FXX A;  4J6Y A;  3X26 B;  3NEM A;  1VQ8 A;  4HWT A;  1X6O A;  4LDY A;  4ELY C;  2FZC B;  1M3B A;  5KCO A;  1KIK A;  1U5S A;  1VQK Q;  12AS A;  2FHD A;  3PVQ A;  4RTY A;  1USY A;  4J9B A;  2EYY A;  1MMA A;  1WHJ A;  3L42 A;  1QVP A;  2HMA A;  3QNE A;  3A7A A;  2RH2 A;  2RQW A;  4LUE A;  2IY5 B;  1MUZ A;  2DPP B;  1SPK A;  2GFU A;  1YWP A;  2ROL A;  4IIO A;  5KYY A;  4YRM A;  2ENM A;  3A31 A;  4YRJ A;  3NHN A;  2SRC A;  1KJW A;  1JJ2 P;  4CI0 C;  1YIJ Q;  1V1C A;  3M9Q A;  2D1X A;  2DZC A;  1ZSZ B;  2QGF B;  1K0X A;  2A3L A;  1M1K R;  2DQ3 A;  5HY6 A;  3VBB A;  2VAS A;  1YI2 T;  1KD1 R;  3QO7 A;  2K57 A;  2M1H A;  4GLK A;  3CC4 A;  3OSV A;  1S72 Q;  4L87 A;  4C92 A;  2DTO A;  3QBY A;  4CC7 A;  1TUG B;  1PD1 A;  1WHK A;  2F5K A;  3EG9 B;  4QQ6 A;  1H4Q A;  4YCV A;  4PJO C;  2NLU A;  3QJY A;  4XU0 A;  4YRK A;  4E7K A;  1M2O A;  3HRS A;  3I9Q A;  1D0Y A;  1WHG A;  4KR3 A;  2LNV A;  5IHN A;  3EG0 A;  2QHT A;  3RUX A;  5GMK i;  1VQ9 A;  2P5I A;  3JCM Q;  2ZT8 A;  1NJ6 A;  3OMG A;  1SSF A;  5DLO A;  4M7A E;  4YRN A;  1JO8 A;  5HK3 A;  5C53 B;  1TOV A;  2HNI A;  1KC8 U;  1AEY A;  3P8V A;  1VOM A;  11AS A;  1OEB A;  1EVK A;  4PJJ A;  1TWB A;  3EFO B;  1AD5 A;  2EQU A;  3OD1 A;  2I0N A;  4KUI A;  1QKX A;  1EZZ B;  2B8A A;  3EG3 A;  4HCB A;  2VWF A;  2DET A;  2LP5 A;  3CCV Q;  2YUP A;  4BW9 A;  2IG0 A;  2DK3 A;  1OPK A;  1K9A A;  1H4S A;  4J6X A;  1JB0 E;  4PJO A;  2RI2 A;  1D1A A;  3P8Y A;  2EIF A;  3GPL A;  4RG2 A;  2JXB A;  3OYL A;  2KYM A;  3QTC A;  5IHI A;  4OMP A;  3HRU A;  1M1F A;  2KNB B;  3MCA B;  3OYB A;  1BU1 A;  3IQL A;  4XTX A;  4KT0 E;  1R0C B;  2Q5I A;  4UP9 A;  1YCY A;  2DYI A;  4LDU A;  3FEO A;  1OX9 A;  2JM8 A;  2O4X A;  2GQI A;  3G4S Q;  1VQ6 Q;  3ASK A;  1M3A A;  3H9N A;  4RKU E;  2KXC A;  4MDX A;  1HC7 A;  1QF6 A;  4EX5 A;  1YGB A;  3HY1 A;  2JVV A;  2RQU A;  4PHC A;  2DZ9 A;  1F1B B;  1UHC A;  1K9M U;  3NEN A;  3ZL7 C;  2M51 A;  3CBM A;  3MJX A;  3PNW C;  2M0O A;  4GY5 A;  5GAM d;  2R58 A;  2LT1 A;  1PNJ A;  2P4T A;  5M9O A;  4LD9 K;  3GLX A;  1EX4 A;  5J26 A;  5A0G A;  2HSE B;  4EPC A;  2YRD A;  3JSC A;  1QVG A;  2D6F A;  4HT8 A;  1PM3 A;  5LJ5 h;  1M1K C;  1NYG A;  5GAM g;  4Q15 A;  4LXC A;  4C5H A;  4RMO A;  4HKE A;  3RKY A;  2VUB A;  1KD1 C;  3MEY A;  1Z7M A;  2ZT6 A;  3PIO A;  3EG2 A;  1WQ7 A;  2CGH A;  4JLG A;  4D6W A;  3FC3 A;  1MV3 A;  3KUF A;  1Q95 G;  2R5A A;  4P74 C;  3SWN C;  1I4K 1;  1BCM A;  2LZ6 B;  2VB6 A;  3TEG A;  2HKQ B;  4FCY A;  2R57 A;  4A63 B;  2AKW B;  1IHV A;  3HXX A;  2VGN A;  4XTV A;  3VJP A;  1XQH A;  1KQ1 A;  2MWP A;  4F7U A;  2RN8 A;  1Y71 A;  4EMK C;  2X4J A;  4II1 A;  4RCB A;  1IL2 A;  1PYS B;  1C0A A;  1TU0 B;  3RR6 A;  3OYN A;  1BBU A;  3G71 T;  2KDS A;  4HWO A;  2V26 A;  3G6E A;  1QVG S;  2QQ9 A;  3JV3 A;  3VUZ A;  3I56 A;  2DDZ A;  1TUD A;  2JTM A;  2DXC A;  3V7C A;  3CBO A;  1G3T A;  1VYV A;  2YT6 A;  2XI9 A;  3NMZ C;  1WFW A;  4E7H A;  2DL4 A;  1VQ7 T;  2PU9 B;  3VUB A;  2YRC A;  4C0G A;  3QZ9 B;  2E3C A;  1D09 B;  3UH0 A;  3OYM A;  1YIT Q;  2H3J A;  3EH1 A;  2NUP B;  3VS5 A;  3CCU A;  3OB9 A;  4AFZ C;  3ZBD A;  3SWN A;  2QQS A;  1SRL A;  3VYH B;  1B34 A;  2OTJ A;  1YB3 A;  2F69 A;  1AZE A;  2VKN A;  1M8M A;  2RMO A;  4XU1 A;  2QQB A;  3OYF A;  4JZ4 A;  4YRI A;  2PMF A;  4K87 A;  2QEX A;  3FDR A;  2BZX A;  3E9F A;  3QZ5 B;  2C7I A;  2J3L A;  4JDS A;  1X6G A;  1SES A;  4RQE A;  2K6D A;  1B3Q A;  3CQT A;  4GLM A;  4A4F A;  3G7Z A;  1ADY A;  2C0T A;  4P73 C;  4KRT A;  2CT3 A;  3IKL A;  4XTW A;  3MEW A;  4CC2 A;  1T0J A;  3OYE A;  5GAM e;  2AT1 B;  1WDX A;  2P0L A;  3MP8 A;  3CC4 T;  3CCM A;  5FWC A;  4RTT A;  5HCK A;  2QA4 Q;  2ZZD A;  4RDX A;  2DYB A;  3OYK A;  2ROT A;  2X4X A;  3R6N A;  5LJ5 e;  4HT4 A;  1BB9 A;  1QVF P;  1H64 1;  3DKM A;  1YJ9 A;  3LX7 A;  2EYQ A;  4A54 A;  2E65 A;  3MF1 A;  5D7U A;  4M7A C;  1M8V A;  4HWP A;  1RI9 A;  3MEV A;  4LVM A;  1YP5 A;  5LJ3 h;  3TEE A;  2EJF A;  2J6O A;  2ZZE A;  4B9X A;  2IVW A;  1VQP Q;  2L5Q A;  4HCZ A;  3VRY A;  4BE0 A;  2V1R A;  2FB7 A;  2DQ0 A;  2EGE A;  1YJN A;  4P73 A;  2VYT A;  2RHQ B;  4TVA A;  2COY A;  4M77 B;  2FO0 A;  5IT9 E;  2ZR3 A;  3RF1 A;  2F2X A;  2GBQ A;  5EG2 A;  1MMN A;  3QPH A;  2K3B A;  2FZK B;  5GAN 6;  4WI1 A;  4F17 A;  3A7R A;  4P3P A;  4O5V A;  2DA9 A;  4X5O A;  2LX7 A;  3QO8 A;  2ZPG B;  4JJC A;  4CC3 A;  4PLI A;  5FU7 B;  5LJ3 j;  8ATC B;  2DVE A;  1VQL Q;  1KMN A;  4CH4 A;  2JTF A;  4QW2 A;  3LH5 A;  4P3N A;  5LL6 S;  3VQX A;  4M7A A;  3HPW A;  4C8Q C;  5FRM A;  3J7A F;  2EPD A;  1AWO A;  5GAN d;  2M02 A;  2ZPI B;  2LX9 A;  2CP7 A;  4M75 G;  5C52 B;  2RHU A;  1RLQ C;  3A8O B;  1VA7 A;  3QYH B;  2X3X D;  1E1O A;  2B86 A;  3I55 Q;  3CMQ A;  2ZPF B;  1KC8 R;  3M0R A;  5DM7 R;  1CKA A;  2DL7 A;  4DEY A;  4N4I A;  3PMI A;  2SEM A;  2F2V A;  2DBK A;  1AHJ B;  1WX6 A;  3M5A A;  1SET A;  3KFU A;  4Z8A A;  2ART A;  2E6Z A;  4Y28 E;  3V8L A;  5C0M A;  2ED1 A;  2DO3 A;  4D8D A;  2HEQ A;  1RAG B;  3MEA A;  3X25 B;  2ZT7 A;  4O6J A;  5IHK A;  1JJC B;  2C0I A;  4KH0 B;  3RBB B;  2CP2 A;  3GNF B;  3CD6 Q;  4JRQ A;  3LWI A;  2ARS A;  4BDY A;  3TRE A;  1VUB A;  1B7Y B;  4FYX B;  1VQM Q;  1QWE A;  2ZGW A;  1LPL A;  1RI0 A;  1SG5 A;  4V2S A;  1M2V A;  2YHT A;  3PCO A;  4PJN A;  2RHZ A;  3JCM f;  5HGQ A;  2HBW A;  3JCM g;  1M9S A;  2LC4 A;  2LJ1 A;  2XKO C;  2CJA A;  3OS2 A;  3VQY A;  2LQW A;  3OYA A;  1NE8 A;  1K9M R;  2DIG A;  4YRG A;  5GAO n;  1MHN A;  3CC7 A;  4H2Y A;  5AYF A;  3MKD A;  1X43 A;  1UEC A;  2DMO A;  1EFN A;  4ZGJ B;  1ASY A;  3HXU A;  1LCK A;  1FMV A;  3A32 A;  5GMK l;  1W6X A;  1WYD A;  4LDV A;  2D8J A;  4M78 C;  2P84 A;  2DL8 A;  2WSE E;  5LJ3 e;  2KRS A;  3U23 A;  1X01 A;  2QAZ A;  2XDP A;  4DBQ A;  5CVI A;  4ZTJ A;  2K7A A;  1D1C A;  2WSC E;  1RIQ A;  1GFC A;  5GMK m;  1S1N A;  4MZP A;  5GAO l;  1JEG A;  2KBT A;  4LVL A;  2VV5 A;  5KNN A;  4FSX A;  4KQE A;  2CP0 A;  1NPR A;  5KYX B;  1IO6 A;  3F70 A;  5ELO A;  3CPW P;  4YPF A;  1BIB A;  2E5Q A;  1VQ4 Q;  2I4L A;  2KY9 A;  1UFF A;  2RI3 A;  2LCL A;  4WJ4 A;  2JT4 A;  4F7U E;  3M0P A;  3VQV A;  1G3Y A;  3X20 B;  2FPE A;  2BE9 B;  4L6V 5;  2MI6 A;  4PFP A;  2OTJ T;  2RHX A;  2W0Z A;  1BI1 A;  3HHT B;  3VS1 A;  3ZFJ A;  5GAN e;  2L3Q A;  4B9W A;  2RQT A;  4YRE A;  2LJ3 A;  3MO8 A;  5K1P A;  3M56 A;  4J83 A;  3TUP A;  1DJ7 B;  1UG1 A;  1Y7X A;  1NZ9 A;  3E9H A;  3MEU A;  2CT4 A;  2HL3 A;  2VC8 A;  1ZA1 B;  2CH4 A;  4TTV A;  2QYZ A;  4CS2 A;  1YBY A;  2X3W D;  2I4N A;  4PNO A;  3FJ5 A;  5I11 A;  4J15 A;  3EFR A;  3L1A A;  4C5I A;  2PNI A;  2YRV A;  2JN0 A;  3JCM X;  1USY C;  4TVW A;  3LWH A;  2O2O A;  1HTT A;  4M77 G;  2A28 A;  3CME Q;  2K3Y A;  4TVY A;  2FZG B;  4AH6 A;  1WLP B;  1BK2 A;  5CK9 A;  2ATC B;  5KCH A;  2EQK A;  1VQ5 T;  4G84 A;  3MPU B;  4M7D B;  3BDU A;  3G71 A;  1WQW A;  1IB8 A;  2J06 A;  1N27 A;  2AMC A;  1N6A A;  1S72 A;  5GAN 2;  1RAD B;  1G2B A;  3M58 A;  4OMF B;  2MYS A;  3L4G B;  1KQS S;  5A0D A;  2L0A A;  4E7L A;  3PMT A;  2G3R A;  1M90 U;  1ZQ1 A;  1UEB A;  4Q5W A;  2RNA A;  3PT9 A;  4C8Q G;  4ME7 A;  2A37 A;  1M27 C;  3M0S A;  1VQ7 A;  1PC0 A;  3LSQ A;  3VS4 A;  5DY9 A;  2F2W A;  4N0A C;  1N9R A;  2JTE A;  2LQN A;  4C92 C;  2RQR A;  3S3M A;  2RHS B;  4IIM A;  1SEM A;  4QVZ A;  1QQJ A;  2DKG A;  1K9M C;  3C94 A;  1WHM A;  3QWX X;  1YJN T;  3TEH B;  2P0K A;  3EGX A;  3A8H B;  3OW2 P;  1YHQ Q;  1IZ6 A;  1WXT A;  2RHY A;  3O5Z A;  5I2S A;  1E1T A;  1D3B A;  1BCO A;  2QDY B;  1E24 A;  4OLF A;  4HCK A;  4FM4 B;  4BY6 C;  3REX A;  4BI3 A;  3PVL A;  4E47 A;  3NTH A;  1E7O A;  4IUP A;  3VQW A;  1KHC A;  2DJZ A;  6AT1 B;  2CDT A;  1B07 A;  1VQZ A;  1PSE A;  2PVD B;  1RAA B;  4N4G A;  2XIC A;  2CSQ A;  1GCQ C;  2D0Q B;  4NL3 A;  1JXO A;  5KH6 A;  1CSK A;  3RER A;  4N0A A;  1X55 A;  2YUO A;  1SF9 A;  2XDD A;  5FU6 C;  3RL6 A;  5A2Q E;  2OTL T;  3RIR A;  2J7I A;  2NUT A;  4LE9 A;  3VS2 A;  2DD4 A;  1JJ2 A;  3EGD B;  4C5E A;  5CQX A;  4PJO B;  4LUD A;  4UC4 A;  1UB4 A;  1G83 A;  2JW4 A;  3G4S A;  1FMK A;  2RI5 A;  2J6K A;  1G3S A;  3PGG A;  2HQX A;  2EKO A;  4RMF A;  3JB9 H;  4BE2 A;  4RTV A;  2QHU A;  5C51 B;  4ZNX A;  4ATO A;  1I81 A;  2V8K A;  2G4C A;  4NCX A;  3N5B B;  1Q81 U;  4FIB A;  3VS6 A;  1YFR A;  1WA7 A;  4HVV A;  4ESR A;  3OYI A;  3CCQ T;  3RES A;  4BI8 B;  5HKC A;  2CUD A;  4M78 G;  1N8R U;  1R77 A;  2PUO B;  2LMJ A;  3CCR T;  4Z88 A;  1VQ8 Q;  2IY5 A;  1SKU B;  1GCQ A;  3L2R A;  4OVA A;  1B7T A;  1I1J A;  3THK A;  2X35 A;  1I07 A;  1QCN A;  4E7Z A;  1XOV A;  3ZEH A;  2KSS A;  1U8R A;  3NPF A;  4LVI A;  1ZSZ A;  1RAF B;  4X9D A;  1A0N B;  1W2B P;  2NS6 A;  1JJ2 S;  4TQF A;  3CCL T;  4TQD A;  4HVU A;  3LH0 A;  2EW3 A;  1K0S A;  4BAC A;  1NYR A;  3BJU A;  1SRM A;  4M75 F;  2RJE A;  3INZ A;  3CC7 T;  4HCC A;  2RK1 A;  4AFS C;  3JB9 G;  3OS5 A;  4NL2 A;  2COZ A;  1I5O B;  1RUW A;  3EG9 A;  4PJM A;  4YRF A;  1W66 A;  2DXT A;  4BE1 A;  3RAC A;  1VQO Q;  1W2B A;  4PLL A;  2QTX A;  3HY0 A;  2I2L A;  5KE2 A;  3M59 A;  1LOJ A;  3CME T;  2ZNJ A;  2O01 E;  3M57 A;  1M1G A;  3NFC A;  3AT1 B;  4RTU A;  2MPX C;  2ZPB B;  1PSF A;  3UA7 A;  4XEM A;  1PKT A;  3CCJ Q;  3NGP A;  2KGT A;  3BDL A;  3J80 E;  3CCE T;  2XID A;  4J6W A;  2X4W A;  1I8F A;  1K8A C;  5GAM h;  1RAC B;  3JB9 D;  3PIP A;  3RKX A;  1OV3 A;  3A74 A;  1JXM A;  1Y96 B;  3REA B;  4M4Z A;  3EFO A;  4XQ3 A;  2KR3 A;  2NUZ A;  5FRO A;  4EIK A;  5CKF A;  1E22 A;  2R5M A;  1BI3 A;  3LW5 E;  3W3S A;  3SEM A;  4M75 B;  4M7D G;  1MV0 B;  2CSI A;  1XNI A;  1YIT A;  4BDZ A;  1WJQ A;  2KI7 A;  1HD3 A;  2LQK A;  3GP8 A;  1VQK T;  1NYF A;  1WXU A;  2CRE A;  5A0L A;  3L2Z A;  3LSS A;  5EC7 A;  2KQW A;  5C6S A;  2EJG A;  3T9N A;  3SD4 A;  5GAM j;  4F16 A;  2Q7E A;  1EIY B;  2H3E B;  4OB2 B;  3WVD B;  2HSP A;  3JB9 I;  3CCS Q;  4H2U A;  3EAE A;  4J9F A;  3RKW A;  4C92 G;  5KYN A;  1OYX A;  1Q82 U;  1WI7 A;  1KOG A;  1PHT A;  2ARU A;  3SWN B;  5LJ5 j;  2GTJ A;  1YIJ T;  3VKI A;  2DD5 A;  4M7D D;  3HFZ B;  2LJ0 A;  4N4H A;  4EMK B;  4JJN K;  1PG5 B;  4HWR A;  4NS5 A;  3TQ7 P;  3REB B;  3M0T A;  3HFO A;  4ZTZ B;  4RTX A;  4A4K A;  2MIO A;  3HSB A;  4PK4 A;  1TH7 A;  3H0H A;  1S72 T;  4DBH A;  2QHV A;  3P8T A;  2X4Y A;  3HL8 A;  1WNL A;  4VUB A;  2JZ2 A;  1QMC A;  3VU3 C;  4BB7 A;  2EYX A;  2QA4 A;  5GMK h;  2P0Q A;  2AZV A;  3KXT A;  2PVG B;  4A4E A;  3UPU A;  3CMA Q;  3X28 B;  2XTI A;  2AHJ B;  3V7R A;  5GAN 7;  1W70 A;  1U3O A;  5ECA A;  1QLY A;  4JJD A;  3ME9 A;  2P4R A;  3HTR A;  3GOX A;  1PWT A;  3A5Z B;  3GIB A;  5FW9 A;  2Q5H A;  1VQP A;  4PJO G;  3WQZ A;  1ATI A;  4E7S A;  4YCW A;  1QWF A;  2EYW A;  4QVD A;  4UP8 A;  2PZ1 A;  4Z02 A;  1ZUK A;  1UTI A;  1EQR A;  1G5H A;  1UDL A;  2QI2 A;  1JU5 C;  1MGQ A;  1WJS A;  3QJ6 A;  3D7S B;  5L23 A;  1WU7 A;  3H0F A;  3FIF A;  4LVJ A;  2GCX A;  2KRM A;  4FYY B;  2AKW A;  3BE3 A;  4QQD A;  3KFV A;  3CCV T;  3DSQ A;  4M77 F;  2ESW A;  1M90 R;  2I4O A;  1PYS A;  2D8H A;  3WVE B;  1NNH A;  1C6V X;  2FRY A;  4ZIB A;  1VQL A;  4FL6 A;  1X75 C;  4AFU C;  1PRL C;  5FWB A;  2ALY B;  1M30 A;  2HD0 A;  5AT1 B;  1K8A U;  4Q6G A;  3SFM A;  3JCM c;  3EGU A;  4YRO A;  2KAF A;  1VQ5 A;  2KE9 A;  1XJW B;  2GQV A;  3EHQ A;  2X9H A;  3C95 A;  4IUT A;  2JNG A;  4YCU A;  2H8H A;  1YJW Q;  1LVK A;  2QK0 A;  3QXE B;  4ZTF A;  4DEX A;  4C8Q F;  3I55 A;  3G4S T;  5CKE A;  1ZHI A;  1VQ6 T;  2KMT A;  3G6E Q;  5L8R E;  2DXU A;  3OS0 A;  2NUP A;  4PG3 A;  3OYJ A;  1QP3 A;  4O2D A;  4JZ3 A;  4FYV B;  1VQN Q;  3LYI A;  2DU7 A;  2LCC A;  4H2X B;  1IHW A;  4AG2 C;  1QE0 A;  4K11 A;  3H8Z A;  2E12 A;  1KHI A;  2JOY A;  2EWN A;  1WPY A;  5CO7 A;  5KYW B;  4OB1 B;  1QVF A;  2MMP A;  2ZNI A;  4R56 A;  2JMA A;  1MMD A;  3A8G B;  4AFQ C;  2JM9 A;  2E70 A;  1QCO A;  5IXB A;  3CCU Q;  3S3O A;  4UP7 A;  4L5G A;  2J6F A;  4XK8 E;  2ZCF B;  1HK9 A;  3M4Q A;  1EFW A;  3URG A;  5I2M A;  2ZCE A;  3SB2 A;  2E3H A;  4H2S A;  2OAU A;  2VXF A;  5LJ3 f;  4F7U G;  1YFS A;  1G3W A;  2RM4 A;  3UAT A;  2LVM A;  2RJD A;  2KYB A;  2QEX Q;  1P92 A;  2HDA A;  2QAS A;  4C8Q B;  5GMK e;  1G5I A;  3CC2 Q;  5GAN h;  1NPP A;  4E7I A;  1Q7Y U;  3TSZ A;  2A7Y A;  1FX7 A;  5CKB A;  2FEI A;  1Q81 R;  5FU7 C;  1ZBX A;  1N9S A;  2HL5 C;  3M4G A;  3BY7 A;  2OJ2 A;  3C12 A;  2OTL A;  4H2V A;  4BD3 A;  4KUD K;  3UGQ A;  3GF5 A;  1OPL A;  4J7I A;  4IUV A;  3A1P A;  3CCM Q;  2PVO B;  3M54 A;  2EFI A;  4BUG A;  3CXC P;  2V8I A;  1XTD A;  1NG2 A;  4K86 A;  5CKD A;  2MF2 A;  4ORZ A;  3FLG A;  4OB0 B;  5KYU B;  2YLC A;  3HTZ A;  1BI0 A;  2COW A;  5HK0 A;  2E64 A;  2Y4X A;  4M78 F;  4XU3 A;  1YJ9 Q;  5GAN j;  3MQZ A;  4YRL A;  4JRP A;  3OBW A;  3QHS A;  2DFU A;  4M75 D;  2ZAE A;  2RHQ A;  2PUK B;  4M77 A;  3CCQ A;  3E1S A;  5GAO p;  3EH2 A;  1VQ4 A;  2QQR A;  3CCR A;  1B70 B;  3JCM d;  3CBP A;  2X51 A;  1M90 C;  3LGL A;  4R0K A;  3TCJ A;  3KBG A;  5GAN 4;  1YIT T;  2O9V A;  1VYU A;  1SHF A;  1WLE A;  3A7U A;  1SRY A;  1LJO A;  2M16 A;  5GAN 8;  1H92 A;  2HAX A;  4Z89 A;  2CH4 W;  2LTO A;  1IRX A;  3JB9 F;  3CCL A;  3E9G A;  2VGM A;  4J7F A;  1M5Q 1;  3X24 B;  2XU8 A;  4HXJ A;  2M0Y A;  2XDB A;  1O9S A;  1E6H A;  3CEY A;  2E4H A;  4X9C A;  4M78 B;  3M53 A;  1YI2 Q;  2JS2 A;  2BTT A;  2ZR2 A;  4AT1 B;  3AHU A;  1EOV A;  4GBQ A;  2DNU A;  2CUB A;  3CME A;  1WGS A;  3H6Z A;  1AWJ A;  3OYY A;  4RUG A;  3CCE A;  2QA4 T;  3OBY A;  3J81 E;  2DXB A;  1Q86 U;  2XMF A;  2ZT5 A;  1JJC A;  3QUI A;  2DEQ A;  4CH6 A;  4C0D C;  1UGV A;  3JCM W;  1B7Y A;  1FYF A;  5GAO m;  4H2T A;  4KH1 B;  1ABO A;  4P5N A;  1OX8 A;  1NM7 A;  4PKC C;  4M7D F;  1ZA2 B;  4JRK A;  2CZ1 B;  3DLM A;  3QO5 A;  1C1A A;  4P72 A;  3MP1 A;  3P8H A;  1Q82 R;  4RCC A;  2JJ9 A;  5J3B A;  5I21 A;  4J9H A;  3M0U A;  4PJL A;  3PE0 A;  3EFS A;  4YTL A;  2Q7G A;  2E5A A;  1VQP T;  4CH5 A;  3CPW A;  4HT9 A;  5FLX E;  1GCP A;  2CZ6 B;  2DL3 A;  3I5S A;  5GAO r;  1Q81 C;  2JS0 A;  4IUQ A;  1VQK A;  3V7S A;  4YRT A;  1K73 U;  1YHQ A;  3QWY A;  2CJB A;  4ZN3 A;  1Z7N A;  1N8R C;  4M7A G;  4C92 F;  1TSF A;  2ZZF A;  2RD1 A;  1UGQ B;  4M75 E;  1YFN A;  3HXW A;  2DTH A;  5D6Y A;  4OB3 B;  1YWO A;  3PFS A;  1VQL T;  2EAY A;  3JCM J;  1YIJ A;  2HCK A;  2DVJ A;  3HXY A;  4KGV B;  3CPF A;  2YSQ A;  1H8K A;  1YCS B;  2GGR A;  4HVW A;  5KYX A;  2DRK A;  4JS5 A;  4OP0 A;  3QO3 A;  1W4S A;  5KYY B;  4PFZ A;  3JCM e;  3I55 T;  4Y92 A;  5IH2 A;  2RQV A;  3JAM E;  3CPW S;  3UFG A;  4P71 A;  4JPB W;  4A4H A;  2BKD N;  4FU6 A;  2RPN A;  2LT4 A;  3TSW A;  4J9D A;  1AZG B;  2C8M A;  3L2V A;  1Z9Z A;  2RK2 A;  1V76 A;  4M77 D;  4C92 B;  4ELZ C;  2CZ7 B;  4PJO F;  2VVK A;  2ZIO A;  2FVU A;  4HA8 A;  3DB3 A;  2FPF A;  3A98 A;  2XG8 D;  3UF4 A;  2K5L A;  4LDW A;  3M4Y A;  3V8J A;  1BYM A;  4DOW A;  5CKH A;  3CD6 T;  3TVT A;  2YLB A;  3E2U A;  3MF2 A;  1X69 A;  1K8A R;  4XU2 A;  3NTK A;  4BY6 B;  4PL6 A;  1JQQ A;  4CC4 B;  4FYW B;  1NJI U;  1TUC A;  1VQM T;  3I35 A;  2DBM A;  4C8Q D;  3OW2 A;  3CCV A;  1Y07 A;  4C5G A;  5CAI A;  4A4G A;  2DJQ A;  3HFN A;  4M7D A;  3SHW A;  3ER0 A;  2LNH B;  1H3H A;  4YYE A;  1H4T A;  1RAB B;  3RNJ A;  5FU6 B;  4YRR A;  3ERR A;  3L4G A;  3SDZ A;  1ZSZ C;  3DLL A;  1ARK A;  2HQE A;  4JS4 A;  5J39 A;  1Q82 C;  5GAN 5;  1VQO A;  3I5R A;  1RAI B;  2D9T A;  3GBQ A;  2VXE A;  5ELN A;  1VQ6 A;  3G71 Q;  2Y4Y A;  1D0X A;  1YFT A;  2L3S A;  2RHS A;  3M4P A;  4H2W A;  4OMN A;  2L2P A;  4X1V A;  4WTO B;  4MMK A;  2IIM A;  1BIA A;  2QTV A;  1PRM C;  3TEH A;  2E6N A;  3CCJ A;  4F14 A;  1H4V B;  4ZGD B;  5K1X A;  4MDW A;  2KRO A;  2NYS A;  1JRI A;  4IUR A;  2KXD A;  3A5Y A;  1VQ7 Q;  4UPA A;  3OW2 S;  1VQ4 T;  2O4X B;  4KBM B;  1QKW A;  5IXF A;  2GTO A;  1Q7Y R;  1SSH A;  3OYG A;  2ODR D;  1UJY A;  1EIF A;  1G51 A;  2HQH A;  2J3M A;  2YWW A;  4ZTU B;  4F7U F;  4FW2 A;  2KEA A;  1V29 B;  2KK4 A;  1J3T A;  5CQY A;  2DM1 A;  3HP9 A;  2WSF E;  2MAM A;  4D8K A;  3IKM B;  1R8O B;  2AKL A;  4M77 E;  3A8L B;  4M78 D;  4ANJ A;  4RTW A;  2ZPE B;  3EGD A;  3TU4 K;  1UHF A;  3CCS A;  2GF7 A;  4Y91 A;  2ZTG A;  2K2V A;  4OGE A;  3FB9 A;  3A8M B;  4JJB A;  4DPG A;  4WCI A;  3MET A;  3OA6 A;  3CC4 Q;  4LD6 A;  1X2Q A;  1YN8 A;  2DX1 A;  1SER A;  2WAC A;  4MZT A;  1SHG A;  3OYC A;  4RTZ A;  2DE0 X;  2CP6 A;  3L2Q A;  4C8Q E;  1IXD A;  1U1S A;  3LLR A;  4CS3 A;  3OMC A;  2YUQ A;  2KT1 A;  1YNZ A;  1T3S A;  3V8K A;  3VS3 A;  1VQ9 Q;  4F7U B;  1NBE B;  1GL5 A;  1ACM B;  5CCA A;  4J9C A;  1B76 A;  1QVG P;  5FRN A;  1GBQ A;  3HXV A;  3CMA A;  2FPD A;  5DLQ E;  3JCM V;  4YRS A;  1ABQ A;  1RLP C;  1UE9 A;  1UGP B;  4LVK A;  1FYN A;  1KK7 A;  1OU8 A;  2DTI A;  3DB4 A;  2GFA A;  1AWW A;  4LNP A;  1W2B S;  1YHQ T;  1LYL A;  3NET A;  2EKH A;  1AOJ A;  2F5T X;  5IN1 A;  1NJ8 A; 
#chains in the Genus database with same CATH homology
 4M75 C;  5LJ5 d;  5GAM f;  4YRQ A;  2EJ9 A;  3LGF A;  2EL9 A;  1OZ3 A;  1VIF A;  1I5L A;  4C0Z A;  1B34 B;  5LJ5 f;  4XEO A;  5LJ5 g;  1FWZ A;  2QHS A;  1L0W A;  2M9U A;  4OGC A;  2V8J A;  4BI4 A;  3FJP A;  2FYK A;  1Q7Y C;  3JRZ A;  2E1H A;  2LRQ A;  1U1T A;  5KE3 A;  4QQG A;  3UT1 A;  1Y96 A;  3WXM B;  1X56 A;  4IUU A;  3RGL A;  4C92 D;  4KR2 A;  1YJW A;  4M78 E;  1NYQ A;  4YDQ A;  4M75 A;  3QDR B;  3QYG B;  3IAL A;  4EO4 A;  1LNX A;  1VQN A;  4J8O A;  4BWA A;  1J5W A;  5CR2 A;  1EIY A;  4M7A F;  3R6O A;  4EMG A;  3S3N A;  1VQ8 T;  5GMK j;  4LNS A;  4A53 A;  3L2U A;  4FT2 A;  3LC0 A;  4P74 A;  2XD0 A;  4E7J A;  3HFZ A;  4CS4 A;  1BKB A;  2QQA A;  4EMK A;  4HVC A;  2K4Y A;  1GXI E;  3PTA A;  1G5V A;  1QP2 A;  4TVA B;  1GGM A;  3R07 A;  1JBM A;  4PJO D;  4OF1 A;  1ASZ A;  2I4M A;  1WJR A;  3CC2 A;  2K5I A;  1X54 A;  2CYZ B;  2QXF A;  4XAX B;  1VQO T;  4ZGE B;  2LQ8 A;  1OI1 A;  5D6W A;  3QG1 A;  3L2W A;  1OZ2 A;  3OQ5 A;  3OSS C;  3FRN A;  4DA4 A;  4M7A B;  2CIM A;  3CCJ T;  3UWN A;  3A5Z A;  4M7D E;  5F5W A;  3JCM b;  2CKK A;  1Q86 C;  1VQ9 T;  1M1K U;  1KG1 A;  3MHX A;  3NEL A;  1KD1 U;  5LJ3 d;  1VIE A;  2E10 A;  3CD6 A;  2ZIM A;  4DOV A;  4WF2 A;  2RHI A;  1VQM A;  4C92 E;  3S6W A;  1UGS B;  2XK0 A;  2ZIN A;  5GAN 3;  4M77 C;  3HFV A;  3HRK A;  4XTZ A;  1B8A A;  5LJ3 g;  1ADJ A;  2ALY A;  2XGT A;  1QW1 A;  1X2G A;  5GAO q;  1NJ1 A;  1K73 C;  2L89 A;  3CCS T;  4L59 A;  1BBW A;  3OY9 A;  3I7F A;  4ZN1 A;  2Q7H A;  5IAY A;  2HBP A;  2RA2 A;  2RJF A;  3RMS A;  3PCO B;  4CH3 A;  1HXD A;  1QVF S;  1X2H A;  1YI2 A;  2Y90 A;  4G85 A;  4H2X A;  4NOY A;  3C4S A;  3P8D A;  2MWO A;  2RJC A;  4XTU A;  2PME A;  3O8V A;  3QKJ A;  4EDU A;  3GNG A;  5GAN f;  2A8E A;  4P75 C;  5GAN g;  3CXC A;  3CMA T;  4PJO E;  2K3X A;  3JCM h;  3HKS A;  3UDC A;  1KQ2 A;  2EQJ A;  1M4Z A;  4K88 A;  5E3I A;  2JUF A;  4X34 A;  2DU5 A;  4MML A;  4C0F A;  1KMM A;  4C8Q A;  2C06 A;  2FL7 A;  5CIU A;  2CS7 A;  4P72 C;  3REU A;  4E51 A;  3OS1 A;  3IG2 A;  1NJI C;  2ODR C;  3P8B B;  3M55 A;  1BI2 A;  4P75 A;  4LDX A;  4DQ2 A;  3OYH A;  3CXC S;  4CRI A;  3E19 A;  3VYG A;  4YRP A;  4QVC A;  3BW1 A;  2CZ0 B;  4JUV A;  4RG8 A;  1RL2 A;  2CJ9 A;  1NJ2 A;  3E9I A;  3NTI A;  2EQM A;  4R55 A;  4KUL A;  4IKF A;  2DIQ A;  1YJW T;  1H3Z A;  1B70 A;  4C0D B;  3UGT A;  2P0P A;  3G6E T;  3BFM A;  3I56 T;  4JLI A;  1EVL A;  4WJ3 M;  2L8D A;  1VQN T;  2AMC B;  2L3R A;  2BUD A;  3VV0 A;  3MP6 A;  3Q1J A;  3QII A;  1O75 A;  4P71 C;  3OYD A;  1UGR B;  1IRE B;  1NJ5 A;  3CCU T;  4J5Y A;  5D6X A;  4YRC A;  4TWA A;  2XHC A;  3HRI A;  4HWS A;  3JB9 J;  4XTY A;  1KQS A;  2BIV A;  2K5F A;  4H02 A;  4M78 A;  2DAQ A;  1KC8 C;  4FT4 A;  2QEX T;  1D3B B;  3CC2 T;  2KVQ G;  4P3O A;  3HXZ A;  4TVR A;  4M7A D;  4MZM A;  4EMH A;  2E41 A;  2RB6 A;  2RO0 A;  4JRI A;  3QSU A;  4YP0 A;  3CCM T;  3ICA A;  4RQF A;  4M7D C;  3HRT A;  1N9W A;  3JCM P;  2PQW A;  3RMQ A;  3PZC A;  1YJ9 T;  2ZPH B;  3G1Z A;  2LDM A;  2ZXF A;  2ZZG A;  1FXX A;  4J6Y A;  3X26 B;  3NEM A;  1VQ8 A;  4HWT A;  1X6O A;  4LDY A;  4ELY C;  5KCO A;  12AS A;  2FHD A;  1USY A;  3L42 A;  1QVP A;  3QNE A;  3A7A A;  2RH2 A;  2IY5 B;  2DPP B;  2GFU A;  4YRM A;  3A31 A;  4YRJ A;  4CI0 C;  3M9Q A;  2DZC A;  2A3L A;  2DQ3 A;  5HY6 A;  3VBB A;  1YI2 T;  3QO7 A;  2K57 A;  2M1H A;  4GLK A;  3CC4 A;  3OSV A;  4L87 A;  4C92 A;  2DTO A;  3QBY A;  2F5K A;  1H4Q A;  4QQ6 A;  4YCV A;  4PJO C;  2NLU A;  3QJY A;  4XU0 A;  4YRK A;  4E7K A;  3HRS A;  4KR3 A;  2LNV A;  2QHT A;  3RUX A;  5GMK i;  1VQ9 A;  2P5I A;  3JCM Q;  2ZT8 A;  1NJ6 A;  3OMG A;  1SSF A;  5DLO A;  4M7A E;  4YRN A;  5HK3 A;  5C53 B;  2HNI A;  1KC8 U;  3P8V A;  11AS A;  1EVK A;  2EQU A;  3OD1 A;  4KUI A;  2B8A A;  4HCB A;  4BW9 A;  2IG0 A;  2DK3 A;  1H4S A;  4J6X A;  1JB0 E;  4PJO A;  2RI2 A;  3P8Y A;  2EIF A;  3GPL A;  4RG2 A;  3OYL A;  3QTC A;  3HRU A;  1M1F A;  3MCA B;  3OYB A;  4XTX A;  4KT0 E;  2Q5I A;  4UP9 A;  1YCY A;  4LDU A;  3FEO A;  2O4X A;  3ASK A;  4RKU E;  1HC7 A;  4MDX A;  1QF6 A;  4EX5 A;  1YGB A;  3HY1 A;  2JVV A;  4PHC A;  2DZ9 A;  1K9M U;  3NEN A;  3CBM A;  3PNW C;  2M0O A;  4GY5 A;  5GAM d;  2R58 A;  2LT1 A;  2P4T A;  5M9O A;  4LD9 K;  3GLX A;  5J26 A;  5A0G A;  4EPC A;  3JSC A;  1QVG A;  2D6F A;  4HT8 A;  1M1K C;  5LJ5 h;  5GAM g;  4Q15 A;  4C5H A;  4RMO A;  4HKE A;  3RKY A;  2VUB A;  1KD1 C;  3MEY A;  1Z7M A;  2ZT6 A;  3PIO A;  1WQ7 A;  2CGH A;  4JLG A;  4D6W A;  3FC3 A;  3KUF A;  2R5A A;  4P74 C;  3SWN C;  1I4K 1;  3TEG A;  2R57 A;  2AKW B;  3HXX A;  2VGN A;  4XTV A;  3VJP A;  1XQH A;  1KQ1 A;  2MWP A;  4F7U A;  1Y71 A;  4EMK C;  2X4J A;  4II1 A;  4RCB A;  1IL2 A;  1PYS B;  1C0A A;  3OYN A;  1BBU A;  3G71 T;  2KDS A;  4HWO A;  3G6E A;  1QVG S;  2DDZ A;  2QQ9 A;  3VUZ A;  3I56 A;  2JTM A;  2DXC A;  3V7C A;  3CBO A;  1G3T A;  2XI9 A;  4E7H A;  1VQ7 T;  2PU9 B;  3VUB A;  4C0G A;  3QZ9 B;  2E3C A;  3UH0 A;  3OYM A;  2H3J A;  3CCU A;  3OB9 A;  3ZBD A;  3SWN A;  2QQS A;  3VYH B;  1B34 A;  2OTJ A;  1YB3 A;  2F69 A;  4XU1 A;  2QQB A;  3OYF A;  4YRI A;  2PMF A;  4K87 A;  2QEX A;  3FDR A;  3E9F A;  3QZ5 B;  2C7I A;  2J3L A;  4JDS A;  1SES A;  4RQE A;  4A4F A;  3G7Z A;  1ADY A;  4P73 C;  3IKL A;  4XTW A;  3MEW A;  3OYE A;  5GAM e;  2P0L A;  3MP8 A;  3CC4 T;  3CCM A;  2ZZD A;  4RDX A;  3OYK A;  2X4X A;  5LJ5 e;  4HT4 A;  1H64 1;  3DKM A;  1YJ9 A;  3LX7 A;  2EYQ A;  4A54 A;  2E65 A;  3MF1 A;  4M7A C;  1M8V A;  4HWP A;  3MEV A;  4LVM A;  5LJ3 h;  3TEE A;  2EJF A;  2ZZE A;  4B9X A;  2IVW A;  2L5Q A;  4HCZ A;  4BE0 A;  2FB7 A;  2DQ0 A;  1YJN A;  4P73 A;  2VYT A;  2RHQ B;  4TVA A;  4M77 B;  5IT9 E;  2ZR3 A;  3RF1 A;  5EG2 A;  3QPH A;  5GAN 6;  4WI1 A;  3A7R A;  4P3P A;  4O5V A;  4X5O A;  3QO8 A;  2ZPG B;  4PLI A;  5FU7 B;  5LJ3 j;  2DVE A;  1KMN A;  4CH4 A;  2JTF A;  4QW2 A;  4P3N A;  5LL6 S;  3VQX A;  4M7A A;  3HPW A;  4C8Q C;  5FRM A;  3J7A F;  5GAN d;  2ZPI B;  2LX9 A;  4M75 G;  5C52 B;  2RHU A;  3A8O B;  3QYH B;  1E1O A;  3CMQ A;  2ZPF B;  5DM7 R;  4N4I A;  3PMI A;  1AHJ B;  3M5A A;  1SET A;  3KFU A;  2ART A;  2E6Z A;  4Y28 E;  3V8L A;  5C0M A;  2DO3 A;  3MEA A;  3X25 B;  2ZT7 A;  4O6J A;  1JJC B;  3GNF B;  4JRQ A;  3LWI A;  2ARS A;  4BDY A;  3TRE A;  1VUB A;  1B7Y B;  2ZGW A;  1RI0 A;  4V2S A;  2YHT A;  3PCO A;  2RHZ A;  3JCM f;  5HGQ A;  3JCM g;  1M9S A;  2LC4 A;  2CJA A;  2XKO C;  3VQY A;  3OS2 A;  3OYA A;  1NE8 A;  2DIG A;  4YRG A;  5GAO n;  1MHN A;  3CC7 A;  4H2Y A;  5AYF A;  4ZGJ B;  1ASY A;  3HXU A;  3A32 A;  5GMK l;  1WYD A;  4LDV A;  4M78 C;  2WSE E;  5LJ3 e;  1X01 A;  2XDP A;  5CVI A;  4ZTJ A;  2WSC E;  1RIQ A;  5GMK m;  4MZP A;  5GAO l;  4LVL A;  2VV5 A;  5KNN A;  4FSX A;  4KQE A;  1NPR A;  3F70 A;  5ELO A;  4YPF A;  1BIB A;  2E5Q A;  2I4L A;  2KY9 A;  2RI3 A;  2LCL A;  4WJ4 A;  4F7U E;  3VQV A;  1G3Y A;  3X20 B;  4L6V 5;  2MI6 A;  2OTJ T;  2RHX A;  3HHT B;  1BI1 A;  3ZFJ A;  5GAN e;  4B9W A;  4YRE A;  3MO8 A;  5K1P A;  3M56 A;  4J83 A;  3TUP A;  1DJ7 B;  1Y7X A;  1NZ9 A;  3E9H A;  3MEU A;  2VC8 A;  4TTV A;  4CS2 A;  1YBY A;  2I4N A;  4PNO A;  4J15 A;  3EFR A;  3L1A A;  4C5I A;  2YRV A;  2JN0 A;  3JCM X;  1USY C;  4TVW A;  3LWH A;  1HTT A;  4M77 G;  2K3Y A;  4TVY A;  4AH6 A;  5CK9 A;  5KCH A;  2EQK A;  1VQ5 T;  4G84 A;  4M7D B;  3BDU A;  3G71 A;  1WQW A;  1N27 A;  2AMC A;  1N6A A;  1S72 A;  5GAN 2;  3M58 A;  4OMF B;  3L4G B;  1KQS S;  5A0D A;  4E7L A;  3PMT A;  2G3R A;  1M90 U;  1ZQ1 A;  1UEB A;  4Q5W A;  3PT9 A;  4C8Q G;  4ME7 A;  1VQ7 A;  3LSQ A;  5DY9 A;  4N0A C;  1N9R A;  4C92 C;  3S3M A;  2RHS B;  4QVZ A;  2DKG A;  1K9M C;  3C94 A;  1YJN T;  3TEH B;  2P0K A;  3A8H B;  1IZ6 A;  2RHY A;  5I2S A;  1E1T A;  1D3B A;  2QDY B;  1E24 A;  4OLF A;  4BY6 C;  4FM4 B;  3REX A;  4BI3 A;  4E47 A;  3NTH A;  4IUP A;  3VQW A;  1KHC A;  2DJZ A;  1VQZ A;  1PSE A;  2PVD B;  4N4G A;  2XIC A;  2D0Q B;  4NL3 A;  5KH6 A;  3RER A;  4N0A A;  1X55 A;  2XDD A;  5FU6 C;  3RL6 A;  5A2Q E;  2OTL T;  3RIR A;  2DD4 A;  1JJ2 A;  4C5E A;  5CQX A;  4PJO B;  4UC4 A;  1UB4 A;  3G4S A;  2RI5 A;  1G3S A;  3PGG A;  2HQX A;  2EKO A;  4RMF A;  3JB9 H;  4BE2 A;  2QHU A;  5C51 B;  4ATO A;  1I81 A;  2G4C A;  2V8K A;  4NCX A;  3N5B B;  1Q81 U;  4FIB A;  1YFR A;  3CCQ T;  3OYI A;  3RES A;  4BI8 B;  5HKC A;  4M78 G;  1N8R U;  2PUO B;  3CCR T;  2IY5 A;  3L2R A;  4OVA A;  2X35 A;  1XOV A;  3ZEH A;  2KSS A;  1U8R A;  4LVI A;  4X9D A;  2NS6 A;  1JJ2 S;  4TQF A;  3CCL T;  4TQD A;  3LH0 A;  4BAC A;  1NYR A;  3BJU A;  4M75 F;  2RJE A;  3INZ A;  3CC7 T;  4HCC A;  2RK1 A;  3JB9 G;  3OS5 A;  4NL2 A;  4YRF A;  1W66 A;  2DXT A;  4BE1 A;  3RAC A;  1W2B A;  4PLL A;  2QTX A;  3HY0 A;  2I2L A;  5KE2 A;  3M59 A;  1LOJ A;  3CME T;  2ZNJ A;  2O01 E;  3M57 A;  1M1G A;  3NFC A;  2ZPB B;  4XEM A;  1PSF A;  3BDL A;  3J80 E;  3CCE T;  2XID A;  4J6W A;  2X4W A;  1I8F A;  1K8A C;  5GAM h;  3JB9 D;  3PIP A;  3RKX A;  3A74 A;  1Y96 B;  4XQ3 A;  5FRO A;  1E22 A;  5CKF A;  2R5M A;  1BI3 A;  3LW5 E;  3W3S A;  4M75 B;  4M7D G;  1XNI A;  1YIT A;  4BDZ A;  1WJQ A;  2LQK A;  3GP8 A;  1VQK T;  5A0L A;  3L2Z A;  3LSS A;  2KQW A;  5C6S A;  2EJG A;  3T9N A;  3SD4 A;  5GAM j;  2Q7E A;  1EIY B;  4OB2 B;  3WVD B;  3JB9 I;  4H2U A;  3EAE A;  3RKW A;  4C92 G;  1OYX A;  1Q82 U;  1KOG A;  2ARU A;  3SWN B;  5LJ5 j;  1YIJ T;  3VKI A;  2DD5 A;  4M7D D;  3HFZ B;  4N4H A;  4EMK B;  4JJN K;  4HWR A;  4NS5 A;  3HFO A;  4ZTZ B;  4A4K A;  3HSB A;  1TH7 A;  1S72 T;  2QHV A;  3P8T A;  2X4Y A;  3HL8 A;  1WNL A;  4VUB A;  2JZ2 A;  3VU3 C;  4BB7 A;  2QA4 A;  5GMK h;  2P0Q A;  3KXT A;  2PVG B;  4A4E A;  3UPU A;  3X28 B;  2XTI A;  2AHJ B;  3V7R A;  5GAN 7;  3ME9 A;  3GOX A;  3A5Z B;  3GIB A;  2Q5H A;  1VQP A;  4PJO G;  3WQZ A;  1ATI A;  4YCW A;  4QVD A;  4UP8 A;  4Z02 A;  1EQR A;  1G5H A;  2QI2 A;  1MGQ A;  1WJS A;  3QJ6 A;  1WU7 A;  4LVJ A;  3FIF A;  2GCX A;  2AKW A;  4QQD A;  3CCV T;  3DSQ A;  4M77 F;  2I4O A;  1PYS A;  3WVE B;  1NNH A;  4ZIB A;  1VQL A;  4FL6 A;  1X75 C;  2ALY B;  2HD0 A;  1K8A U;  4Q6G A;  3SFM A;  3JCM c;  4YRO A;  2KAF A;  1VQ5 A;  2GQV A;  3C95 A;  4IUT A;  2JNG A;  4YCU A;  3QXE B;  4ZTF A;  3I55 A;  4C8Q F;  3G4S T;  5CKE A;  1ZHI A;  1VQ6 T;  2KMT A;  5L8R E;  2DXU A;  3OS0 A;  4PG3 A;  3OYJ A;  1QP3 A;  4O2D A;  3LYI A;  2DU7 A;  2LCC A;  4H2X B;  1QE0 A;  3H8Z A;  2E12 A;  1KHI A;  2JOY A;  2EWN A;  1WPY A;  5CO7 A;  4OB1 B;  1QVF A;  2MMP A;  2ZNI A;  4R56 A;  3A8G B;  2E70 A;  3S3O A;  4UP7 A;  4L5G A;  4XK8 E;  2ZCF B;  1HK9 A;  3M4Q A;  1EFW A;  3URG A;  5I2M A;  2ZCE A;  3SB2 A;  4H2S A;  2OAU A;  2VXF A;  5LJ3 f;  4F7U G;  1YFS A;  1G3W A;  2RM4 A;  2LVM A;  2RJD A;  1P92 A;  4C8Q B;  5GMK e;  1G5I A;  5GAN h;  1NPP A;  1Q7Y U;  4E7I A;  2A7Y A;  1FX7 A;  5CKB A;  5FU7 C;  1ZBX A;  1N9S A;  3M4G A;  3BY7 A;  3C12 A;  2OTL A;  4H2V A;  4BD3 A;  4KUD K;  3UGQ A;  3GF5 A;  4J7I A;  4IUV A;  2PVO B;  3M54 A;  2EFI A;  4BUG A;  2V8I A;  1XTD A;  4K86 A;  5CKD A;  2MF2 A;  3FLG A;  4OB0 B;  2YLC A;  3HTZ A;  1BI0 A;  5HK0 A;  2E64 A;  2Y4X A;  4M78 F;  4XU3 A;  3MQZ A;  5GAN j;  4YRL A;  4JRP A;  3OBW A;  3QHS A;  2RHQ A;  4M75 D;  2PUK B;  4M77 A;  3CCQ A;  3E1S A;  5GAO p;  1VQ4 A;  2QQR A;  3CCR A;  1B70 B;  3JCM d;  3CBP A;  1M90 C;  3LGL A;  3TCJ A;  3KBG A;  5GAN 4;  1YIT T;  1WLE A;  3A7U A;  1SRY A;  1LJO A;  2M16 A;  5GAN 8;  2HAX A;  2LTO A;  3JB9 F;  3CCL A;  3E9G A;  2VGM A;  4J7F A;  1M5Q 1;  3X24 B;  2XU8 A;  2XDB A;  1O9S A;  3CEY A;  4X9C A;  4M78 B;  3M53 A;  2ZR2 A;  3AHU A;  1EOV A;  3CME A;  1WGS A;  3H6Z A;  3OYY A;  3CCE A;  2QA4 T;  3OBY A;  3J81 E;  2DXB A;  1Q86 U;  2ZT5 A;  1JJC A;  3QUI A;  2DEQ A;  4CH6 A;  4C0D C;  3JCM W;  1B7Y A;  1FYF A;  5GAO m;  4H2T A;  4P5N A;  4PKC C;  4M7D F;  4JRK A;  2CZ1 B;  3DLM A;  3QO5 A;  4P72 A;  3MP1 A;  3P8H A;  4RCC A;  5J3B A;  5I21 A;  4YTL A;  3EFS A;  2Q7G A;  2E5A A;  1VQP T;  4CH5 A;  3CPW A;  4HT9 A;  5FLX E;  2CZ6 B;  1Q81 C;  5GAO r;  4IUQ A;  1VQK A;  3V7S A;  4YRT A;  1K73 U;  1YHQ A;  2CJB A;  4ZN3 A;  1Z7N A;  1N8R C;  4M7A G;  4C92 F;  2ZZF A;  2RD1 A;  1UGQ B;  4M75 E;  3HXW A;  2DTH A;  5D6Y A;  4OB3 B;  3PFS A;  1VQL T;  2EAY A;  3JCM J;  1YIJ A;  3HXY A;  3CPF A;  4JS5 A;  4OP0 A;  3QO3 A;  1W4S A;  3JCM e;  3I55 T;  3CPW S;  3JAM E;  3UFG A;  4P71 A;  4A4H A;  2BKD N;  4FU6 A;  2LT4 A;  2C8M A;  3L2V A;  2RK2 A;  4M77 D;  4C92 B;  4ELZ C;  2CZ7 B;  4PJO F;  2ZIO A;  2FVU A;  4HA8 A;  3DB3 A;  2XG8 D;  2K5L A;  4LDW A;  3M4Y A;  3V8J A;  1BYM A;  4DOW A;  5CKH A;  3CD6 T;  2YLB A;  3MF2 A;  4XU2 A;  3NTK A;  4BY6 B;  4PL6 A;  1NJI U;  1VQM T;  4C8Q D;  3OW2 A;  3CCV A;  1Y07 A;  4C5G A;  5CAI A;  4A4G A;  3HFN A;  4M7D A;  3ER0 A;  4YYE A;  1H4T A;  5FU6 B;  4YRR A;  3ERR A;  3L4G A;  3SDZ A;  3DLL A;  2HQE A;  4JS4 A;  5J39 A;  1Q82 C;  5GAN 5;  1VQO A;  2D9T A;  2VXE A;  5ELN A;  1VQ6 A;  2Y4Y A;  1YFT A;  3M4P A;  2RHS A;  4H2W A;  4MMK A;  1BIA A;  3TEH A;  2E6N A;  3CCJ A;  1H4V B;  4ZGD B;  5K1X A;  4MDW A;  1JRI A;  4IUR A;  3A5Y A;  4UPA A;  3OW2 S;  1VQ4 T;  2O4X B;  4KBM B;  3OYG A;  2ODR D;  1EIF A;  1G51 A;  2J3M A;  4ZTU B;  4F7U F;  1V29 B;  2KK4 A;  5CQY A;  3HP9 A;  2WSF E;  2MAM A;  3IKM B;  1R8O B;  4M77 E;  3A8L B;  4M78 D;  2ZPE B;  3TU4 K;  3CCS A;  2GF7 A;  4Y91 A;  2ZTG A;  2K2V A;  4OGE A;  3FB9 A;  3A8M B;  4DPG A;  3MET A;  3OA6 A;  4LD6 A;  1SER A;  2WAC A;  4MZT A;  3OYC A;  3L2Q A;  4C8Q E;  1U1S A;  3LLR A;  4CS3 A;  3OMC A;  3V8K A;  4F7U B;  5CCA A;  1B76 A;  5FRN A;  3HXV A;  3CMA A;  5DLQ E;  3JCM V;  4YRS A;  1UGP B;  4LVK A;  2DTI A;  3DB4 A;  2GFA A;  1W2B S;  1YHQ T;  1LYL A;  3NET A;  2F5T X;  5IN1 A;  1NJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...