1WNLA

Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3 in complex with adp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 66
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wnlA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wnlA01
3VBBA 3FIFA 5GANd 12ASA 4YRNA 3UFGA 3VQYA 3HFNA 2J3MA 5E3IA 3RL6A 5GAOp 1X2HA 4RMFA 4CS3A 2I4OA 4M75E 1JBMA 4BWAA 3G1ZA 2VXEA 2DTHA 2YLBA 4F7UB 4NCXA 4XEMA 4KQEA 4P73A 4M7DC 4RDXA 3VQXA 4C92B 3QO3A 2VC8A 3JCMe 4M7AE 4RCBA 2RA2A 1YGBA 1Z7NA 4M77A 2DJZA 2E5AA 3V8KA 5K1PA 2RHSA 4CH5A 3JB9D 5DY9A 2DXTA 3JCMP 2DEQA 5GAN4 5GANf 2E41A 4AH6A 1LJOA 4M78B 3SWNB 4PJOC 5GAOq 4C8QG 1QE0A 1X01A 3E9IA 4G85A 2ZT7A 2DU5A 1LYLA 3RACA 2ARUA 1TH7A 2E65A 1EFWA 4HT8A 4M77F 1B34B 3RKWA 2ZTGA 1KMMA 3LSQA 2E64A 2K57A 4HT9A 1HC7A 2AMCB 3FJPA 4C92A 3A7AA 1SRYA 4M7AB 2DXUA 5GANj 2I2LA 4YRSA 4X9DA 3EFSA 5GAMh 1EVKA 4XTVA 5GAMd 4H2XB 3TEHB 5GAOn 2ZIMA 3NEMA 5GAOl 1WNLA 4RCCA 1N9WA 1C0AA 3V8JA 4EMKB 4F7UF 1PYSA 1KOGA 4TWAA 4C92F 1WU7A 2ZIOA 1ADYA 1BIAA 2P0LA 3LC0A 4CH3A 1B34A 4M75A 1G51A 3QTCA 4HWTA 4PJOD 2C7IA 4M77C 1H4VB 4P71A 3A31A 2AMCA 1ADJA 4UP7A 4M7AA 4YCUA 4M78F 4UP8A 3RF1A 5GAMf 2Q5HA 2G4CA 4XTXA 4H2XA 4C8QE 2ZR2A 4YRLA 2Q7EA 2AKWB 3TEHA 4PG3A 2DTIA 4YRMA 1NNHA 3A7UA 4M75F 4X9CA 4EMKA 2ZCEA 4JUVA 4NOYA 3INZA 3PGGA 4M7DG 3PCOB 3QO8A 4RQFA 2CJAA 5LJ3h 4YRRA 5LJ3d 1QF6A 1WYDA 1HXDA 3HXZA 4K86A 1U1SA 4M7AF 1N9RA 2RD1A 5GMKl 4K88A 4H2YA 4C92C 4CS2A 2DKGA 1MGQA 5GAMj 4TVWA 3HTZA 2IY5A 3L2ZA 3RUXA 4PJOG 1Z7MA 5LJ5h 2ALYB 2XTIA 5LJ5d 3UGTA 3RKXA 3NELA 4XU3A 4P75C 3BY7A 4XQ3A 4M78C 3SWNC 3QO7A 4C8QB 1E22A 3QNEA 3V7SA 4HWPA 2AKWA 1KMNA 3BFMA 3JB9J 4J6YA 5CAIA 3WQZA 5KNNA 1I8FA 2EJFA 2ZXFA 3W3SA 2DQ3A 1ASYA 3PCOA 5LJ3f 4QVCA 2CJBA 3L4GA 2E3CA 4L87A 4P71C 1M5Q1 2Y90A 4JLIA 3A32A 1H641 3QSUA 5GAN5 3JCMc 3V7RA 3JCMW 1SERA 2E1HA 5GAMe 1EVLA 5GMKm 2Q7GA 1E1OA 4OLFA 3JB9H 5LJ5f 4PNOA 2ALYA 3VQVA 4ZTUB 3RGLA 4Q6GA 1USYA 4EMKC 1LNXA 4HWRA 4M7DE 1PYSB 2QHUA 4C8QA 4YRPA 5LJ3j 4PHCA 3RIRA 1G5HA 3HXWA 3I7FA 2DVEA 2ARSA 3HFVA 2ODRC 4M75B 4YRGA 1JJCB 2EJ9A 4J6WA 2HNIA 4YROA 3P8TA 1E1TA 2DZ9A 5LJ5j 1I5LA 3RKYA 4PJOE 3PZCA 4OP0A 4YRIA 2ZNIA 2ZZGA 2ZINA 4KR3A 1EOVA 4C8QF 3ICAA 1NYRA 4N0AA 2EJGA 3LSSA 3JCMV 1HTTA 3MEYA 2EL9A 4M7DD 2E10A 3EFRA 4K87A 2CGHA 1W66A 4F7UG 4Q15A 3MF2A 3JCMg 4HA8A 1G5IA 4H2TA 4ZTZB 4P3NA 4XU1A 3VU3C 1BIBA 5LJ3e 2YLCA 3REXA 1YFTA 2ZZEA 4P73C 1H4QA 4P74A 4TQFA 2EWNA 3A5ZA 4WI1A 1JJCA 1NJ8A 4BW9A 2I4NA 4E51A 3BJUA 1YFSA 4J5YA 2C8MA 2IY5B 3IG2A 3RESA 3E9HA 4Y91A 5LJ5e 4M78G 3JB9F 4TVAA 3IALA 3ERRA 3TUPA 2ZT8A 4TQDA 3M4QA 1USYC 4C8QC 4EMHA 5GAN6 2CJ9A 1WLEA 1X54A 4A53A 4H2SA 1B8AA 4NL2A 4XTZA 3UH0A 4YRTA 1U1TA 5GAOm 5GMKi 4YP0A 3L4GB 3JCMb 4YPFA 3JB9I 4UPAA 3QO5A 4X5OA 3HFOA 2ZR3A 1M8VA 3QUIA 3GIBA 1YCYA 4A54A 3VQWA 2Q7HA 4XU2A 4EX5A 1KQ1A 2P5IA 4PJOA 1J5WA 4H2UA 3IKMB 1L0WA 4XU0A 4XTYA 2ZT6A 4F7UE 3L1AA 4DPGA 3JCMQ 4P72A 4M77D 2QHVA 2ZNJA 2ZT5A 4C92E 4H2VA 1HK9A 2QTXA 4H02A 2RM4A 4XEOA 5GAN7 4P74C 5C52B 5C51B 1NJ6A 4YDQA 4M75C 5K1XA 5GANg 2FB7A 1BBUA 3P8YA 4QVDA 1GGMA 4M78E 2YHTA 4M7AC 5C53B 3IKLA 4YYEA 5HGQA 3HRKA 1Y96B 2FYKA 4MMLA 1BBWA 5GMKh 2DTOA 3DSQA 3R07A 4HWSA 2QHSA 1LOJA 4C92D 4NL3A 3M4PA 4RQEA 2Q5IA 1B70B 2ZGWA 4YCVA 2PMEA 4MMKA 2DU7A 4YRQA 4CH6A 4TTVA 4KR2A 1WQWA 3AHUA 2RHQB 2DQ0A 2PMFA 4J15A 4M77G 3SB2A 4M78D 4G84A 1VQZA 2I4LA 1JRIA 1NYQA 1B76A 4TVAB 4V2SA 1NJ5A 1EQRA 4WJ3M 1H4TA 3A7RA 1N9SA 4M75D 2I4MA 1Y96A 2ZZFA 3BDUA 4JRKA 4P72C 3HRIA 3UGQA 5GAN3 2XGTA 3HXYA 4YREA 4M7AD 2DZCA 3HSBA 3NETA 3P8VA 5F5WA 4F7UA 1B70A 1NJ1A 4M7DB 4WJ4A 3JCMX 4C92G 2RHQA 3JCMh 5GAMg 3JCMd 4YRFA 1SETA 3HY0A 1I4K1 1X56A 3FB9A 4JRIA 1B7YB 4YRKA 3OD1A 1EIYB 11ASA 3HXVA 5GMKj 3HFZB 3HXXA 4P75A 4YRJA 4HVCA 4PJOB 3JB9G 3A5YA 4M78A 3SWNA 4HWOA 4LNSA 1D3BB 3NENA 2VXFA 1E24A 2ODRD 4UP9A 4J6XA 4P3PA 5ELNA 4CH4A 2ARTA 3QHSA 3TEGA 3HXUA 2CIMA 1KQ2A 3A74A 2QHTA 1I81A 5GAN2 4CS4A 1ASZA 4M75G 3V8LA 1X55A 4M77E 3V7CA 2JN0A 4DQ2A 3KFUA 4WF2A 4M7DA 2DDZA 3HY1A 3JCMf 2RB6A 4M7AG 4TVYA 3RERA 1NJ2A 5GANe 2EAYA 1YB3A 4YCWA 4EMGA 4ZIBA 1B7YA 4XTUA 3JCMJ 4P3OA 1EIYA 1YFRA 1IL2A 4N0AC 2J3LA 3HFZA 5GMKe 3BW1A 5LJ3g 3MF1A 4YRCA 4O2DA 1D3BA 1SESA 4M7DF 5GAN8 1ATIA 3REUA 4H2WA 1WQ7A 4XTWA 1FYFA 5ELOA 5GAOr 1RIQA 4M77B 3CMQA 1X2GA 4EO4A 5LJ5g 2RHSB 1WPYA 4C8QD 4PJOF 1H4SA 5I21A 5GANh 3M4GA
chains in the Genus database with same CATH superfamily
3VBBA 2QASA 1R8OB 3OYKA 4YRNA 3UFGA 5CKBA 2K9GA 3HFNA 2DIQA 5E3IA 1JB0E 2RI3A 5GAOp 1K8AC 3RL6A 2KK4A 3CCST 2EW3A 4M75E 1JBMA 2O31A 3SD4A 3M56A 3FJ5A 3CCVT 1ZBJA 1QCNA 1M8MA 4P73A 3I35A 2JM8A 3VQXA 3QO3A 4HVVA 3ZFJA 5CCAA 1GRIA 4RCBA 1Z7NA 1D0ZA 2D8HA 3V8KA 3CCUT 2ROTA 4FU6A 5KYUB 1G3WA 2DXTA 1UHFA 4KH0B 2KROA 2JM9A 1VQOQ 1NEBA 1AT1B 1Q95G 3TCJA 5GAOq 2EQKA 2CSIA 1QE0A 1VQKQ 3OS0A 4ZN1A 1BCOA 1M2OA 1QW1A 1YJNQ 2DU5A 1WX6A 2DILA 1TH7A 2L2PA 2ZTGA 4M77F 3OQ5A 1NYFA 1Z9QA 3EAEA 5D6XA 4HT9A 2AMCB 2F1LA 2NUTB 1VQ8A 4M7AB 4BACA 5GANj 2WACA 3ME9A 3EFSA 1T0HA 3ASKA 1GBRA 4E7JA 2Y4YA 2V1RA 3LLRA 1C0AA 2FZKB 3X26B 4HVWA 1YJ9T 1KQSP 1PYSA 1RAHB 1PG5B 1IGUA 4TWAA 2X9HA 5IH2A 5KCOA 4QW2A 4UC4A 3VS6A 3A8HB 1G51A 3QTCA 4L59A 4YTLA 2XDDA 4M77C 2LQNA 4RUGA 3TSZA 3EHRA 2KT8A 4UP7A 4YCUA 3PIPA 1WHLA 2DL8A 4H2XA 4YRLA 4PG3A 2DTIA 3G71Q 3R6OA 2RHZA 1NNHA 2YWWA 3A7UA 2WSFE 3GNFB 1N8RU 3C95A 1SG5A 4EMKA 4R55A 2ZCEA 4QQ6A 3MKDA 5FU7C 2D0NA 2HSEB 1YHQT 1M27C 5GMKl 2KYBA 3UF4A 4H2YA 2SEMA 3C12A 1VQPT 1MGQA 5GAMj 4TVWA 2IY5A 3G6ET 3M4YA 4GBQA 3L2ZA 3MEUA 2XTIA 2HEQA 1QKWA 3OS2A 3UGTA 3ZEHA 3QYGB 4XQ3A 2MI6A 4Z89A 3SWNC 1K0XA 3QNEA 3CCUQ 3H6ZA 3WQZA 2DBKA 5KNNA 1I8FA 2EJFA 4ORZA 2VV5A 5GJVB 5LJ3f 2ZPIB 4BDYA 4L87A 3SFMA 2J6KA 1X27A 3LH5A 2E3IA 3A32A 2GNCA 3GPLA 2CKKA 1BI0A 3JCMc 4ME7A 5GAN5 3JCMW 5I2SA 2KR3A 2LQKA 4HXJA 1OX8A 3I5RA 4OLFA 4OMLA 4PNOA 1JO8A 1JU5C 4ZTUB 1UUEA 1M3CA 2E3HA 2RHYA 2B8AA 5CO7A 3CCJA 5I22A 3OYEA 2O4XB 4C8QA 3EH1A 1ZA2B 4E7HA 3EG3A 2DVEA 3HFVA 4M75B 1D1BA 1NEGA 3G1JA 4J6WA 2YRCA 2MMPA 1YJ9Q 3PFSA 3CCQA 4YROA 2MCNA 1VOMA 4FW2A 5IAYA 4YRIA 2CYZB 1D0XA 2XICA 1GCQA 4LDUA 1X69A 2NWMA 4LUDA 4C5HA 2ZZGA 2KY9A 1NYRA 4N0AA 2C0IA 3JCMV 1HTTA 4LVIA 2EGCA 4O5VA 3EFRA 5FROA 1WHMA 1ZSZA 1VQ6A 2YUOA 3H9NA 4LDYA 1GL5A 3MF2A 1G5IA 4H2TA 4J9DA 2ZAEA 3N5BB 2RQWA 5LJ3e 1IO6A 2ZZEA 4P73C 1PWTA 2DO3A 4A4HA 2RQTA 2HZYA 4DA4A 2LDMA 5IHNA 3L2QA 4Y91A 1PRLC 4TVAA 1G3TA 3IALA 4DBRA 1W2BA 2LP5A 1YN8A 4PFPA 3M4QA 1USYC 2QA4Q 1K9AA 2OTJA 1VQ7T 2E6ZA 5GAN6 1I1JA 1WLEA 2CJ9A 1PSEA 3OMGA 1YIJQ 1GCPA 1X2KA 2AT1B 3TQ7P 1WYXA 1UGRB 2DE0X 4YRTA 1U1TA 4Z02A 3I55A 3L4GB 1K76A 4A4KA 2IG0A 4RTXA 2QQAA 4X5OA 3HFOA 1BB9A 4RTWA 2J6FA 1T0JA 1YCYA 3VQWA 2Q7HA 3CCMQ 4EX5A 2P5IA 1BI1A 1L0WA 3O5ZA 4LVJA 2LCCA 4XTYA 2ZT6A 4F7UE 4P72A 3EG0A 2QHVA 2DX1A 2EKOA 5D7UA 2A7YA 3OYCA 3G4ST 5HKCA 5CQYA 2PZ1A 2RM4A 2ZPEB 4P74C 4YDQA 3F70A 4BUGA 2XG8D 3PVLA 1XTDA 3P8YA 4LE9A 1PD1A 3QYHB 2RJCA 2DRMA 4M78E 4BD3A 3URGA 2RQRA 5C53B 1OU8A 2KRMA 1Y96B 3CC7A 2KI7A 4HWSA 2X4WA 2LCLA 1VQLT 2V8JA 2LQ8A 4NL3A 1OX9A 3UATA 2YUPA 2M0OA 4RQEA 2X35A 2ZGWA 3CCLA 2PMEA 2L8DA 4YRQA 3VS1A 2YXYA 1M1KR 2HCKA 3TREA 2K6DA 2L3PA 3QG1A 4G84A 1D1CA 1VQZA 1KFZA 2I4LA 3OW2A 1YJWT 3OYYA 2YUQA 2OJ2A 1NYQA 2K2MA 1EQRA 1X6OA 2M9UA 3G7ZA 1Q82R 3A7RA 3S3OA 2ZZFA 2AHJB 1D0YA 2JTFA 1AZEA 3CC2Q 2DVJA 3UGQA 5GAN3 5CK9A 3HXYA 4M7AD 3P8VA 4PJNA 2OI3A 1TOVA 3JCMX 4QQGA 1AD5A 1VQ7Q 2GTJA 4YRFA 1SETA 1AWXA 3JV3A 2A3LA 3EG9A 2HQXA 1ZUYA 3HXXA 2ZPBB 3EGDB 4PLLA 3A5YA 4PFOA 3OMCA 2F2WA 3NENA 1NPRA 4UP9A 4CH4A 4P3PA 3QHSA 3HXUA 5FRNA 3OYBA 1KQ2A 3CPWA 2QHTA 3CC4T 4CS4A 1ASZA 4AFUC 4JPBW 3OSSC 1X6BA 4WTOB 4BE1A 4LVLA 3NMZC 5L8RE 3V7CA 2XDBA 4DQ2A 4ZGEB 5KH6A 1ZSGA 2C0OA 5CKFA 2DDZA 1EIFA 1LCKA 3EHQA 5CVIA 2LX7A 3QIIA 3I56T 3G4SQ 4TVYA 2X3XD 1KSWA 4YCWA 3CCET 4ZIBA 1OQKA 1GCQC 1EIYA 1ZLMA 3CXCS 1YITT 3PTAA 1IL2A 4N0AC 2J3LA 1K0SA 2L3QA 1QMCA 2VUBA 3HRUA 3CMEA 3MF1A 4E2FB 4YRCA 1D3BA 2KQWA 1ZSZC 4M7DF 1WHKA 1ATIA 3BE3A 4XTWA 1FMWA 1VQNT 2K79A 4JZ4A 4BI4A 5GAOr 1YI2A 1KC8R 1VQLQ 2QAZA 4IUVA 5LJ5g 1XOVA 3OYMA 3GOXA 1WPYA 1JJ2S 3META 1V29B 1RADB 3M4GA 4LDVA 2DD5A 3VQYA 3THKA 3CMAT 4KGZB 3ZL7C 2RH2A 2I4OA 2LX9A 3G1ZA 2VXEA 2DTHA 2YLBA 1TUDA 2O01E 4F7UB 2MOXA 2NUPA 4M7DC 2MWOA 5HK3A 3OYAA 4M7AE 2QTVA 2VGMA 2RA2A 1YGBA 1WJRA 2M02A 4M77A 4C0DB 2E5AA 2DBMA 3QPHA 1B07A 2RHSA 5DY9A 2JTMA 2AIRB 2DYBA 4PJJA 4J83A 5L23A 1NE8A 2DL7A 3JCMP 1HJDA 5HK0A 2QDYB 5GANf 2E41A 2XI9A 1VYVA 2ZZDA 3H0FA 3TVTA 1LJOA 1Q86R 4M78B 4PJLA 2OTLA 4C8QG 1Q82C 3SEMA 4JRPA 1LYLA 4PFZA 1M2VB 2E65A 2CSQA 4DEXA 4HT8A 2MK5A 1RI0A 4FIBA 1N8RC 1VQ8T 3LSQA 3OYJA 1E7OA 2CH4W 1HC7A 2EYZA 2DL4A 2WSCE 3FJPA 4GLKA 1SRYA 2CH4A 5CKEA 2DXUA 3H0IA 3CC4Q 1RL2A 1WDXA 4YRSA 4H2XB 2HBWA 2A37A 3QJ6A 5IT9E 1N9WA 3P8BB 2JTEA 3TSWA 2LJ3A 1N27A 4EMKB 3FDRA 1M90R 2K7AA 2GFUA 3M53A 1KOGA 4MZMA 4C92F 1WU7A 2ZIOA 1YITQ 1GXIE 1S72A 3MO8A 2YRVA 1B34A 1VQ9Q 5IN1A 4HWTA 1RUWA 2C7IA 2E12A 3HHTB 2LQWA 1H4VB 3M59A 4B6MA 1N6AA 4UP8A 3RF1A 3EGXA 5GAMf 2HDAA 2G4CA 4XTXA 4LVMA 3NHNA 1OI1A 2ZR2A 4HKEA 4RMOA 4YRMA 1MHNA 2P4TA 4M75F 1LPLA 4X9CA 1FYNA 2DRKA 1YWOA 4E6RA 4JUVA 4NOYA 4M7DG 1PD0A 3QO8A 4GLMA 1KQSS 4ZNXA 3CD6Q 1QF6A 2JZ2A 1WYDA 4E7IA 3A1PA 1K9MR 1U1SA 2PUKB 2RD1A 1H8KA 4B9WA 4C92C 2E5KA 3CMAQ 1KJWA 1KC8C 2DKGA 2XMFA 1WIEA 3OYNA 2PNIA 2LNVA 2LCSA 1MMGA 2VVKA 4JS5A 3WVDB 3RUXA 1H3ZA 1Q7YR 1Z7MA 5LJ5h 4QKUA 4RTUA 5LJ5d 3EH2A 4XU3A 1W1FA 5ECAA 4C8QB 1E22A 4BY6C 3UDCA 3V7SA 2AKWA 4HWPA 3BFMA 4FM4B 1D1AA 4J6YA 4ELYC 2MPXC 3OBYA 1ASYA 4J9EA 2CP5A 3LWIA 4X34A 4P71C 3QBYA 4F14A 1QWFA 1H641 2J6OA 1R0CB 1TSFA 1WHJA 4X1VA 3QSUA 2CZ6B 4LXCA 2ECZA 1SERA 2EQUA 5GAMe 3HKSA 5GMKm 2LMJA 2RHUA 3JB9H 2FZCB 4RTVA 3VQVA 3RGLA 4EPCA 2BZYA 3CBMA 3LWHA 3M0SA 1Q86C 1USYA 3EFOA 2DMOA 2GTOA 3BDLA 4YRPA 4PHCA 3FC3A 4FYWB 1PKSA 1G5HA 3CCQT 1M3AA 3HXWA 1QWEA 1U3OA 2ODRC 4JJCA 3LGLA 2EJ9A 2ENMA 5FW9A 3CPFA 4J7FA 1JXOA 2HNIA 4J9GA 1HYOA 4N4IA 1JXMA 2DZ9A 1E1TA 2KXCA 4RG8A 1KD1C 3OYFA 3DLLA 2ZINA 4KR3A 4PL6A 1QP3A 1WI7A 1VQ6T 3ICAA 2FPDA 1VQMT 2DJQA 3LSSA 4IIMA 3NGPA 3HRTA 4K87A 2FEIA 3NFCA 5KYXA 5LL6S 2CGHA 1CKBA 3I5SA 1NJIR 4HA8A 2COYA 1NLPC 2EYYA 1M90C 4P3NA 4ZTZB 3VU3C 4ZGDB 2YLCA 1IXDA 1GFDA 1M1KU 1H4QA 4P74A 2QDLA 3QDRB 4JS4A 4WI1A 4LD6A 2J05A 1JJCA 2RK1A 1VQOA 2I4NA 4E51A 5CR2A 4J5YA 5KYYB 3RESA 1ZHIA 2JW4A 4E7KA 3E9HA 1VQKA 2OTJT 1MMNA 1YJNA 1HSQA 2X4YA 3ERRA 1Q82U 4L5GA 4RKUE 4TQDA 2K3BA 3VJPA 2KYMA 3CPWP 2RN8A 4EMHA 4H2SA 3I55T 1B8AA 2HL3A 4XTZA 2F5TX 1WJQA 2CT4A 5GAOm 1I0CA 4YP0A 1QCOA 1K9MC 3JCMb 4K11A 4YPFA 2C0TA 4ZN3A 1H92A 3JB9I 4LDWA 2ZCFB 2NLUA 3OY9A 1AEYA 2V26A 3CCSQ 1QVGP 3ULRB 3CCVQ 1KQ1A 4PJOA 3PNWC 4H2UA 4GY5A 3IKMB 4IKFA 1E6GA 1MMDA 1AWWA 1JQQA 3L1AA 3JCMQ 2OAWA 2MWPA 2X4JA 1Y57A 2LC4A 2K3XA 5D6WA 1FXXA 3OYDA 1Q81R 2OAUA 3VRZA 2LT1A 2FB7A 4QVZA 4BE2A 1K4US 1BBUA 1VYUA 3VS7A 3CC7T 3G71A 1AWOA 5A2QE 1NLOC 4HCZA 1BBWA 5GMKh 4C5IA 2H3EB 3A8OB 4OMOA 5I11A 1NM7A 4KULA 1VQ5T 2BZXA 3L2RA 2Q5IA 1VQ6Q 1U5SA 2DU7A 2F5KA 1XJWB 1VQMQ 3CCRT 4J15A 1KC8U 4M77G 4CC7A 3A5ZB 3A8MB 4Y28E 1CSKA 4M78D 1U8RA 4KH1B 2ROLA 2BE9B 3EG9B 1EFNA 8ATCB 1JRIA 2SRCA 3CCUA 2L89A 2X51A 4RTYA 1ZQ1A 2RI2A 4JRKA 3M5AA 1A0NB 4YREA 1NJIC 1B70A 1WXTA 1Y7XA 4BI3A 4DOWA 2VWFA 1X56A 3I55Q 3RR6A 3CXCA 2A0FB 1EIYB 4Y92A 4BB7A 11ASA 3FLGA 3ZBDA 1YHQQ 1Q86U 2V8KA 2E70A 1D3BB 2PVDB 1W70A 4IURA 2ARTA 4HCKA 3Q1JA 1VQPQ 5A0LA 3A74A 1BK2A 3G6EQ 1I81A 1YJ9A 5GAN2 2AKLA 5A0GA 1X55A 3UT1A 2ZPFB 2JN0A 1OZ3A 1W6XA 2HD0A 4WF2A 4M7DA 3M55A 1JJ2A 2Y4XA 3JCMf 2CDTA 3REAB 3MP6A 2COZA 1KD1U 1NJ2A 2LNHB 1YB3A 3J81E 3CEYA 4XTUA 3CMET 3JCMJ 2CP3A 5KE2A 4ANJA 3HFZA 1VQ4T 4RTZA 5LJ3g 2R5MA 4C0ZA 1ARKA 1M90U 2W10A 1F1BB 3REUA 1G8XA 1YI2T 4C0GA 3NTIA 4AFSC 2NUPB 4E7SA 4OGEA 4AFQC 1WA7A 3SHWA 2RK2A 4LNPA 4M77B 2NUZA 3I9QA 2QEXT 2RHSB 2IIMA 1VQ5Q 4J9HA 3TU4K 4C8QD 4PJOF 1FMVA 4CC3A 2QA4A 1H4SA 2KRSA 1G83A 3CCRQ 3J7AF 1YIJA 4LUEA 2O9VA 3MEVA 2J3MA 3PE0A 4RMFA 1MNEA 2LJ1A 4CS3A 5FU7B 2B86A 4NCXA 5I2MA 2C06A 4KQEA 1K9MU 2QQRA 1FX7A 4DOVA 3JCMe 5M9OA 3CCMA 5CKHA 2M16A 2DJZA 2RI5A 4XAXB 5K1PA 4CH5A 3JB9D 6AT1B 1Q7YU 5FRMA 2DIGA 2R58A 4MZPA 3VKIA 3SWNB 4AG1C 4PJOC 4IIOA 2P0PA 2ABLA 4G85A 5J39A 1XNIA 5FLXE 1BI2A 3RACA 4A4GA 2L5QA 4OMPA 1C0MA 2H8HA 1EFWA 2YDLA 1B34B 2XHCA 3RKWA 3L2WA 1KMMA 2DL5A 1PKTA 2DXCA 2GF7A 3MEAA 4N4GA 3OS5A 4C92A 3A7AA 2I0NA 4HT4A 5EC7A 2I2LA 2DD4A 4X9DA 1EVKA 1DJ7B 4C5GA 2ZIMA 4C0FA 1WNLA 4HVUA 1O75A 1Y07A 1T3SA 2O4XA 3UWNA 1KQSA 1NZ9A 1FWZA 3MHXA 2DLPA 4RG2A 3OBWA 1ADYA 2DFUA 1QVFS 2BE7D 3CBPA 3LC0A 1S1NA 2MF2A 4CH3A 1VQ4Q 4M75A 2DL3A 1B3QA 2AK5A 2EBPA 2G6FX 2RJFA 4P71A 1OEBA 1Y0MA 1BCMA 2EYXA 3MCAB 1ADJA 2ESWA 4J9BA 1AOJA 3A8LB 3CC2A 2FRYA 4C8QE 2Q7EA 2AKWB 3VYGA 3TEHA 2QEXQ 2YT6A 2JMCA 2CZ1B 2KBTA 1NJIU 1VQ7A 3PGGA 1NBEB 4B9XA 3X25B 3OYHA 5LJ3h 2DAQA 5LJ3d 4CC4B 4K86A 3VS5A 4KBMB 4M7AF 4K88A 2V8IA 1SHFA 2K5FA 4EIKA 1UGQB 4CS2A 1WJSA 2A36A 1X6GA 1PNJA 3DB4A 4LN2A 2M51A 4ESRA 2P0KA 4PJOG 2CP2A 4DBQA 2PVGB 3RKXA 2QQSA 3NELA 3EFOB 1SRLA 2RJDA 2PU9B 1YJWQ 2ZXFA 1WHGA 1TUGB 2D0QB 2DYIA 2YRDA 3G4SA 3PCOA 2XD0A 3L4GA 2KAFA 2EQMA 2NYSA 2XU8A 3VS0A 5DM7R 4FSSA 1M5Q1 2Y90A 3E9FA 1M1GA 2KDSA 2LJ0A 3MJXA 3TEEA 1M1KC 4JJNK 3VUBA 2HKNA 3V7RA 3P8HA 2E1HA 4FYXB 1E1OA 1K8AR 4IUPA 2ALYA 2CUDA 2JJ9A 3NPFA 4ELZC 3KBGA 1IHVA 4LDXA 4Q6GA 3C0CA 3DLMA 2L3SA 1H3HA 1LNXA 4HWRA 4M7DE 1PYSB 2QHUA 1SHGA 1VQLA 1M4ZA 1QP2A 3S6WA 5HCKA 3I7FA 4JZ3A 4OGCA 1JJCB 4A63B 1Q81U 1BKBA 2KNBB 2BIVA 3J80E 1UECA 2EGAA 5LJ5j 1I5LA 3PZCA 1K73R 3T9NA 1UB4A 1J3TA 1YFNA 1M1FA 5DLQE 2E10A 1JEGA 1W66A 2EVRA 3I56Q 4MDXA 5EG2A 4C5EA 2AZVA 4Q15A 4WCIA 5FWBA 4XU1A 1VIFA 1BIBA 1EX4A 3CCEQ 2EYWA 3REXA 2H3JA 2P4RA 4J7IA 3M54A 5J26A 1WLPB 5IXFA 1BI3A 4J9CA 2EWNA 3CXCP 1NJ8A 4BW9A 1YFSA 2C8MA 2IY5B 1D09B 3IG2A 3OA6A 2FHDA 2EPDA 2DM1A 1VQNQ 1W2BP 3TUPA 3D7SB 1NPPA 5DLOA 1G3YA 3HP9A 3MPUB 4FW1A 1GBQA 5KYNA 2HBPA 3CC4A 4ZTJA 3LW5E 1UE9A 1C6VX 2EKHA 2JT4A 3QO5A 4FT4A 4BE0A 2F2XA 3QUIA 3GIBA 1TUCA 5AYFA 1G5VA 3M58A 2DNUA 3X20B 1YITA 3RNJA 1X75C 2HMAA 2K5LA 1EZZB 4ATOA 1VQ9A 3CQTA 5HY6A 4M77D 1WGSA 2CT3A 2LTOA 4C92E 2ZT5A 4H2VA 4H02A 2FVUA 4HCBA 4ZTFA 2XK0A 5GAN7 5C52B 5C51B 3G71T 4M75C 5K1XA 1QKXA 2A8EA 5GANg 3H41A 1UGPB 2FZGB 4N4HA 1ABOA 4AT1B 2YHTA 5KCHA 1U06A 1W4SA 5KYWA 1BYMA 2QQBA 1VQ8Q 2FYKA 1QVGS 3CCJT 1MNDA 2DTOA 3VYHB 2CP6A 3CD6A 3DSQA 1RAAB 3OSVA 1YP5A 2QHSA 1ZSZB 2DERA 1QLYA 4Q5WA 3CMAA 3M4PA 1B7TA 2J7IA 1B70B 2RO0A 4AFZC 4YCVA 4MMKA 1UHCA 3NTKA 4TTVA 4KR2A 3M0RA 7AT1B 4KT0E 2DQ0A 2QGGA 2DA9A 3SB2A 2CZ0B 2MAMA 2D1XA 3OW2P 4OVAA 1AWJA 2M1HA 1MMAA 3VRYA 4TVAB 4V2SA 1NJ5A 1K73C 4WJ3M 2G3RA 2CS7A 4DEYA 2I4MA 3QZ5B 3HRIA 1KG1A 3WXMB 3U23A 5FU6C 2XGTA 3HSBA 2RF0A 5F5WA 4F7UA 3MP8A 1QVPA 1NJ1A 4BDZA 4M7DB 2IVWA 4C92G 4L6V5 4J9FA 2RHQA 2AZSA 5GAMg 3OYLA 2HSPA 4R0KA 1I4K1 5IXBA 4F04B 3OD1A 1R77A 4OB2B 3HXVA 1VA7A 2CREA 4PKCC 5GMKj 3HFZB 2GBQA 3L2UA 4P75A 4YRJA 4HVCA 4M78A 3VV0A 3M0UA 4HWOA 1TWBA 1E24A 5ELNA 3H0HA 3VS2A 4R56A 3MEWA 2Z0WA 2CIMA 3QKJA 1M2VA 1GFCA 2VGNA 1X43A 2VB6A 3L2VA 4M75G 3V8LA 4PK4A 2J06A 4M77E 1IB8A 2WSEE 2RQUA 3HY1A 2QGFB 2KEAA 2KGTA 4AG2C 1X2QA 3RERA 1K1ZA 3L42A 3OYGA 4FL6A 3X24B 1B7YA 2E6NA 3WVEB 4P3OA 3VS4A 1Q7YC 3BW1A 1N5ZA 3M9QA 4O2DA 1RAFB 5GAN8 1IHWA 2QG9B 1WQ7A 2COWA 2W0ZA 2DXBA 2RNAA 2FG0A 1IGQA 3LX7A 3VS3A 2P0QA 3CCJQ 4OB3B 5ELOA 1PM3A 2QA4T 3HTRA 3RDVA 3CMQA 2PTKA 2LZ6B 1YIJT 3O8VA 2GQVA 2JOYA 2KT1A 2M0YA 2BZ8A 2PUOB 5C6SA 5GANh 3FIFA 5GANd 3CCQQ 12ASA 2O2OA 3QDFA 3E1SA 2PQWA 1X2HA 5GJWB 3CCLT 1SKUB 3QZ9B 3KUFA 4BWAA 3PMTA 1VUBA 3CCMT 4XEMA 4RDXA 3CCSA 4C92B 2VC8A 1RAIB 2KVQG 2OX7A 3CCVA 1R0BG 2RHXA 2BTTA 3HPWA 2DEQA 5GAN4 4AH6A 2JS0A 1AVZC 3EGUA 4FYYB 4BY6B 1G3SA 1X01A 4ZGJB 3E9IA 4KUIA 2ZT7A 2KMTA 1QVFA 2DF6A 2ARUA 1C1AA 2HAXA 3OYIA 1SSFA 4E47A 2OTJQ 2E64A 4NS5A 4JLGA 2EYQA 2K57A 2XIDA 5GAMh 2ZPHB 4XTVA 5GAMd 5KYUA 1K8AU 2V1QA 3TEHB 5IHKA 5GAOn 3NEMA 5GAOl 2HL5C 2LVMA 1YWPA 4RCCA 2L3RA 3A98A 3GBQA 3V8JA 1VQMA 1PSFA 3REBB 4F7UF 5A0DA 4QQDA 3E19A 4OB0B 5CKDA 1BIAA 2P0LA 2QI2A 3EG2A 1PCXA 1TG0A 4PJOD 3A31A 3CC2T 2AMCA 2GCXA 5CIUA 2NUTA 1ZUKA 4M7AA 4M78F 5AT1B 1K73U 2QXFA 2K2VA 2Q5HA 2CP7A 2AKKA 1XQHA 1UEBA 3H8ZA 3AT1B 1UJ0A 2FPEA 5CQXA 5FU6B 3QXEB 1UG1A 3MQZA 3INZA 3CC7Q 3PCOB 4RQFA 2CJAA 4YRRA 3A8GB 1OPLA 1TU0B 2A08A 1HXDA 3HXZA 1WFWA 1N9RA 1TTHB 1UDLA 2JNGA 3CCLQ 1WXBA 1YHQA 4C0DC 3HTZA 1Q81C 5KYYA 4J8OA 1RLQC 1RACB 2ALYB 2L0AA 1VQPA 1O9SA 3JSCA 1UGVA 3G6EA 4P75C 4D8DA 3BY7A 3C4SA 4M78C 3QO7A 2CUBA 1KMNA 4FT2A 3JB9J 5CAIA 1PRMC 3W3SA 4RTTA 2DQ3A 4JJBA 2VKNA 3MP1A 4QVCA 2CJBA 3RBBB 1PHTA 2E3CA 1M30A 4JLIA 1YBYA 4D6WA 4CI0C 4KRTA 2DETA 1RAEB 1P92A 5FWCA 2XDPA 1EVLA 2FL7A 2Q7GA 4VUBA 2OTLT 5LJ5f 2GFAA 1WHHA 1IREB 3KFVA 2K4YA 1ZBXA 2YUNA 1SF9A 1SRMA 3P8DA 4EMKC 8AT1B 1YNZA 5LJ3j 2FO0A 2YSQA 2P84A 4DBFA 3PMIA 3RIRA 4LVKA 3S3NA 1VQ5A 4HCCA 3GLXA 2DK3A 3NTHA 1RAGB 2ARSA 4YRGA 4MZTA 3CCRA 3HRSA 2ED1A 4F17A 3DKMA 2XKOC 3P8TA 1M3BA 3RKYA 4PJOE 3VUZA 3OB9A 4E7ZA 4OP0A 2ZNIA 2CP0A 4MDWA 1EOVA 3EGXB 4C8QF 1KK7A 3LYIA 2MYSA 2EJGA 1NYGA 1MV3A 1NG2A 2EL9A 3MEYA 4M7DD 4IUUA 3LGFA 2FRWA 1N8RR 1SSHA 1S72T 4F7UG 3PVQA 3JCMg 4IUTA 2JXBA 4II1A 4CRIA 3CMEQ 1YFTA 2HKQB 1OV3A 4PLIA 2BUDA 4TQFA 3PT9A 2HQHA 3A5ZA 3UPUA 2KXDA 3M0QA 3BJUA 1G2BA 4PJMA 1M9SA 1T3LA 1YI2Q 2JS2A 2DEUA 5LJ5e 4M78G 3JB9F 4F16A 1ZUUA 2ZT8A 2F69A 2DPPB 5C0MA 2FPFA 2K5IA 2GQIA 4C8QC 4FCYA 5IHIA 2MIOA 2JVVA 4A53A 3FRNA 1X54A 1IZ6A 1SEMA 4NL2A 2O88A 2EQIA 3UH0A 2D8JA 2EGEA 2QYZA 2KE9A 5GMKi 2ZPGB 3E2UA 4M4ZA 2RJEA 1UTIA 1Y71A 4OF1A 2D6FA 2NS6A 4UPAA 3FEOA 5KYWB 4KGXB 2LT4A 1QVGA 2ZR3A 1M8VA 2PVOB 1OYXA 1QCFA 2K3YA 4A54A 4XU2A 1VQ9T 1J5WA 1UGSB 1MV0B 1KHIA 1Z9ZA 3QWXX 4IUQA 4XU0A 3GNGA 3OS1A 4OMFB 1W2BS 4DPGA 1VQ4A 2ZNJA 2R5AA 1VYTA 1HK9A 1VIEA 2QQ9A 2QTXA 2OTLQ 4XEOA 1I07A 1RI9A 2RHIA 3X28B 1NJ6A 1PC0A 3LH0A 3GF5A 5J3BA 4QVDA 4OMMA 1FMKA 1GGMA 2QEXA 1OPKA 1BBZA 4TVRA 2VYTA 3C94A 3CD6T 4M7AC 1MUZA 3IKLA 4YYEA 5HGQA 3HRKA 2EFIA 2HQEA 4MMLA 3R07A 4J9IA 1AZGB 1LOJA 2X4XA 4C92D 5KYXB 1AHJB 2JUFA 4A4EA 2GGRA 1OULA 1WZOA 3JAME 4CH6A 1WQWA 3AHUA 2RHQB 2EIFA 2O9SA 2PMFA 1OOTA 4P5NA 3IQLA 4LD9K 1S72Q 1V76A 4E7LA 3GP8A 3M0PA 3S3MA 2EQJA 4OMNA 4JJDA 3PIOA 2QK0A 2JMAA 1B76A 3E9GA 1UFFA 1ZA1B 4KGVB 1H4TA 1QQJA 1N9SA 1TS9A 1LVKA 4M75D 4DBHA 1YJWA 1QVFP 4EDUA 1Y96A 3BDUA 4P72C 2VASA 4O6JA 4XK8E 3EG1A 3R6NA 2DZCA 3NETA 3JRZA 2KSSA 3RMSA 1I5OB 3ER0A 1OZ2A 1BU1A 4WJ4A 1WXUA 1VQOT 3JCMh 1KD1R 3JCMd 3HY0A 2RQVA 1SPKA 1VQKT 3FB9A 4JRIA 1UJYA 1YJNT 1B7YB 4YRKA 4A4FA 3M57A 2ED0A 4QT7A 9ATCB 2ATCB 3UA6A 3OW2S 1V1CA 3JB9G 4PJOB 3SWNA 4LNSA 5KE3A 1RABB 1IRXA 2LRQA 2VXFA 2ODRD 2RMOA 4J6XA 1ACMB 4FYVB 2E4HA 4Z88A 1OU9A 2E5QA 4Z8AA 4BI8B 2RPNA 1HD3A 3KFUA 4KUDK 1JJ2P 3UA7A 2RB6A 4M7AG 2IPOB 5GANe 2EAYA 4EMGA 3QJYA 4OMQA 2A28A 3CBOA 1RLPC 2CZ7B 3I56A 1E6HA 5D6YA 1YFRA 2F2VA 4AMCA 5GMKe 3M0TA 3CCEA 3EGDA 1TXQA 3HL8A 3DB3A 1SESA 1CKAA 4H2WA 1YCSB 1ZX6A 4D8KA 3CPWS 1FYFA 1KHCA 4OB1B 4JDSA 2KRNA 2D9TA 1RIQA 4CC2A 1X2GA 1VQNA 4EO4A 2R57A 2X3WD 3QWYA 1ABQA 3RMQA 4JRQA 3KXTA 3SDZA 2BKDN 1KIKA 4FSXA 5I21A 3TEGA
chains in the Genus database with same CATH topology
3VBBA 1R8OB 3OYKA 4YRNA 3UFGA 5CKBA 3HFNA 2DIQA 5E3IA 1JB0E 2RI3A 5GAOp 1K8AC 3RL6A 2KK4A 3CCST 4M75E 1JBMA 3SD4A 3M56A 3CCVT 4P73A 3VQXA 3QO3A 3ZFJA 5CCAA 4RCBA 1Z7NA 3V8KA 3CCUT 4FU6A 1G3WA 2DXTA 3TCJA 5GAOq 2EQKA 1QE0A 3OS0A 4ZN1A 2DU5A 1QW1A 1TH7A 2ZTGA 4M77F 3OQ5A 3EAEA 5D6XA 4HT9A 2AMCB 1VQ8A 4M7AB 4BACA 5GANj 2WACA 3ME9A 3EFSA 3ASKA 4E7JA 2Y4YA 3LLRA 1C0AA 3X26B 1YJ9T 1PYSA 4TWAA 5KCOA 4QW2A 4UC4A 3A8HB 1G51A 3QTCA 4L59A 4YTLA 2XDDA 4M77C 4UP7A 4YCUA 3PIPA 4H2XA 4YRLA 4PG3A 2DTIA 3R6OA 2RHZA 1NNHA 3A7UA 2WSFE 3GNFB 1N8RU 3C95A 4EMKA 4R55A 2ZCEA 4QQ6A 5FU7C 1YHQT 5GMKl 4H2YA 3C12A 1VQPT 1MGQA 5GAMj 4TVWA 2IY5A 3G6ET 3M4YA 3L2ZA 3MEUA 2XTIA 3OS2A 3UGTA 3ZEHA 3QYGB 4XQ3A 2MI6A 3SWNC 3QNEA 3H6ZA 3WQZA 5KNNA 1I8FA 2EJFA 2VV5A 5LJ3f 2ZPIB 4BDYA 4L87A 3SFMA 3A32A 3GPLA 2CKKA 5GAN5 1BI0A 4ME7A 3JCMc 3JCMW 5I2SA 2LQKA 4OLFA 4PNOA 4ZTUB 2RHYA 2B8AA 5CO7A 3CCJA 3OYEA 2O4XB 4C8QA 4E7HA 2DVEA 3HFVA 4M75B 4J6WA 2MMPA 3PFSA 3CCQA 4YROA 5IAYA 4YRIA 2CYZB 2XICA 4LDUA 4C5HA 2ZZGA 2KY9A 1NYRA 4N0AA 3JCMV 1HTTA 4LVIA 4O5VA 3EFRA 5FROA 1VQ6A 4LDYA 3MF2A 1G5IA 4H2TA 3N5BB 5LJ3e 2ZZEA 4P73C 2DO3A 4A4HA 4DA4A 2LDMA 3L2QA 4Y91A 4TVAA 1G3TA 3IALA 1W2BA 3M4QA 1USYC 2OTJA 1VQ7T 2E6ZA 5GAN6 2CJ9A 1WLEA 1PSEA 3OMGA 1UGRB 4YRTA 1U1TA 4Z02A 3I55A 3L4GB 4A4KA 2IG0A 2QQAA 4X5OA 3HFOA 1YCYA 3VQWA 2Q7HA 4EX5A 2P5IA 1BI1A 1L0WA 4LVJA 2LCCA 4XTYA 2ZT6A 4F7UE 4P72A 2QHVA 3OYCA 2EKOA 3G4ST 2A7YA 5HKCA 5CQYA 2RM4A 2ZPEB 4P74C 4YDQA 3F70A 4BUGA 2XG8D 1XTDA 3P8YA 3QYHB 2RJCA 4M78E 4BD3A 3URGA 5C53B 1Y96B 3CC7A 4HWSA 2X4WA 2LCLA 1VQLT 2V8JA 2LQ8A 4NL3A 4RQEA 2M0OA 2X35A 2ZGWA 3CCLA 2PMEA 2L8DA 4YRQA 3TREA 3QG1A 4G84A 1VQZA 2I4LA 3OW2A 1YJWT 3OYYA 1NYQA 1EQRA 1X6OA 2M9UA 3G7ZA 3A7RA 3S3OA 2ZZFA 2AHJB 2JTFA 3UGQA 5GAN3 5CK9A 3HXYA 4M7AD 3P8VA 3JCMX 4QQGA 4YRFA 1SETA 2A3LA 2HQXA 3HXXA 2ZPBB 4PLLA 3A5YA 3OMCA 3NENA 1NPRA 4UP9A 4CH4A 4P3PA 3QHSA 3HXUA 5FRNA 3OYBA 1KQ2A 3CPWA 2QHTA 3CC4T 4CS4A 1ASZA 3OSSC 4BE1A 4LVLA 5L8RE 3V7CA 2XDBA 4DQ2A 4ZGEB 5KH6A 5CKFA 2DDZA 1EIFA 5CVIA 3QIIA 3I56T 4TVYA 4YCWA 3CCET 4ZIBA 1EIYA 3CXCS 1YITT 3PTAA 1IL2A 4N0AC 2J3LA 2VUBA 3HRUA 3CMEA 3MF1A 4YRCA 1D3BA 2KQWA 4M7DF 1ATIA 4XTWA 1VQNT 4BI4A 5GAOr 1YI2A 4IUVA 5LJ5g 1XOVA 3OYMA 3GOXA 1WPYA 1JJ2S 3META 1V29B 3M4GA 4LDVA 2DD5A 3VQYA 3CMAT 2RH2A 2I4OA 2LX9A 3G1ZA 2VXEA 2DTHA 2YLBA 2O01E 4F7UB 4M7DC 2MWOA 5HK3A 3OYAA 4M7AE 2VGMA 2RA2A 1YGBA 1WJRA 4C0DB 4M77A 2E5AA 3QPHA 2RHSA 5DY9A 2JTMA 4J83A 1NE8A 3JCMP 5HK0A 2QDYB 5GANf 2E41A 2XI9A 2ZZDA 1LJOA 4M78B 2OTLA 4C8QG 1Q82C 4JRPA 1LYLA 2E65A 4HT8A 1RI0A 4FIBA 1N8RC 1VQ8T 3LSQA 3OYJA 1HC7A 2WSCE 3FJPA 4GLKA 1SRYA 5CKEA 2DXUA 1RL2A 4YRSA 4H2XB 3QJ6A 5IT9E 1N9WA 3P8BB 1N27A 4EMKB 3FDRA 2GFUA 3M53A 1KOGA 4MZMA 4C92F 1WU7A 2ZIOA 1GXIE 1S72A 3MO8A 2YRVA 1B34A 5IN1A 4HWTA 2C7IA 2E12A 3HHTB 1H4VB 3M59A 1N6AA 4UP8A 3RF1A 5GAMf 2G4CA 4XTXA 4LVMA 1OI1A 2ZR2A 4HKEA 4RMOA 4YRMA 1MHNA 2P4TA 4M75F 4X9CA 4JUVA 4NOYA 4M7DG 3QO8A 1KQSS 1QF6A 2JZ2A 1WYDA 4E7IA 1U1SA 2PUKB 2RD1A 4B9WA 4C92C 1KC8C 2DKGA 3OYNA 2LNVA 4JS5A 3WVDB 3RUXA 1H3ZA 1Z7MA 5LJ5h 5LJ5d 4XU3A 4C8QB 1E22A 4BY6C 3UDCA 3V7SA 2AKWA 4HWPA 3BFMA 4FM4B 4J6YA 4ELYC 3OBYA 1ASYA 3LWIA 4X34A 4P71C 3QBYA 1H641 3QSUA 2CZ6B 1SERA 2EQUA 5GAMe 3HKSA 5GMKm 2RHUA 3JB9H 3VQVA 3RGLA 4EPCA 3CBMA 3LWHA 1Q86C 1USYA 3BDLA 4YRPA 4PHCA 3FC3A 1G5HA 3CCQT 3HXWA 2ODRC 3LGLA 2EJ9A 3CPFA 4J7FA 2HNIA 4N4IA 2DZ9A 1E1TA 4RG8A 1KD1C 3OYFA 3DLLA 2ZINA 4KR3A 4PL6A 1QP3A 1VQ6T 3ICAA 1VQMT 3LSSA 3HRTA 4K87A 3NFCA 5LL6S 2CGHA 4HA8A 1M90C 4ZTZB 4P3NA 3VU3C 4ZGDB 2YLCA 1M1KU 1H4QA 4P74A 3QDRB 4JS4A 4WI1A 4LD6A 1JJCA 2RK1A 1VQOA 2I4NA 4E51A 5CR2A 4J5YA 3RESA 1ZHIA 4E7KA 3E9HA 1VQKA 2OTJT 1YJNA 2X4YA 3ERRA 1Q82U 4L5GA 4RKUE 4TQDA 3VJPA 4EMHA 4H2SA 3I55T 1B8AA 4XTZA 2F5TX 1WJQA 5GAOm 4YP0A 1K9MC 3JCMb 4YPFA 4ZN3A 3JB9I 4LDWA 2ZCFB 2NLUA 3OY9A 1KQ1A 4PJOA 3PNWC 4H2UA 4GY5A 3IKMB 4IKFA 3L1AA 3JCMQ 2MWPA 2X4JA 2LC4A 2K3XA 5D6WA 1FXXA 3OYDA 2OAUA 2LT1A 2FB7A 4QVZA 4BE2A 1BBUA 3CC7T 3G71A 5A2QE 4HCZA 1BBWA 5GMKh 4C5IA 3A8OB 4KULA 1VQ5T 3L2RA 2Q5IA 2DU7A 2F5KA 3CCRT 4J15A 1KC8U 4M77G 3A5ZB 3A8MB 4Y28E 4M78D 1U8RA 1JRIA 3CCUA 2L89A 1ZQ1A 2RI2A 4JRKA 3M5AA 4YREA 1NJIC 1B70A 1Y7XA 4BI3A 4DOWA 1X56A 3CXCA 1EIYB 4BB7A 11ASA 3FLGA 3ZBDA 1Q86U 2V8KA 2E70A 1D3BB 2PVDB 4IURA 2ARTA 3Q1JA 5A0LA 3A74A 1I81A 1YJ9A 5GAN2 5A0GA 1X55A 3UT1A 2ZPFB 2JN0A 1OZ3A 2HD0A 4WF2A 4M7DA 3M55A 1JJ2A 2Y4XA 3JCMf 1KD1U 3MP6A 1NJ2A 1YB3A 3J81E 3CEYA 4XTUA 3CMET 3JCMJ 5KE2A 3HFZA 1VQ4T 5LJ3g 2R5MA 4C0ZA 1M90U 3REUA 1YI2T 4C0GA 3NTIA 4OGEA 2RK2A 4M77B 2QEXT 2RHSB 3TU4K 4C8QD 4PJOF 2QA4A 1H4SA 3J7AF 1YIJA 3MEVA 2J3MA 4RMFA 4CS3A 5FU7B 4NCXA 5I2MA 2C06A 4KQEA 1K9MU 2QQRA 1FX7A 4DOVA 3JCMe 5M9OA 3CCMA 5CKHA 2M16A 2DJZA 2RI5A 4XAXB 5K1PA 4CH5A 3JB9D 1Q7YU 5FRMA 2DIGA 2R58A 4MZPA 3VKIA 3SWNB 4PJOC 2P0PA 4G85A 5J39A 1XNIA 5FLXE 1BI2A 3RACA 4A4GA 2L5QA 1EFWA 1B34B 2XHCA 3RKWA 3L2WA 1KMMA 2DXCA 2GF7A 3MEAA 4N4GA 3OS5A 4C92A 3A7AA 4HT4A 2I2LA 2DD4A 4X9DA 1EVKA 1DJ7B 4C5GA 2ZIMA 4C0FA 1WNLA 1O75A 1Y07A 2O4XA 3UWNA 1KQSA 1NZ9A 1FWZA 3MHXA 4RG2A 3OBWA 1ADYA 1QVFS 3CBPA 3LC0A 2MF2A 4CH3A 4M75A 2RJFA 4P71A 1ADJA 3MCAB 3A8LB 3CC2A 4C8QE 2Q7EA 2AKWB 3VYGA 3TEHA 2CZ1B 1NJIU 1VQ7A 3PGGA 4B9XA 3X25B 3OYHA 5LJ3h 2DAQA 5LJ3d 4K86A 4KBMB 4M7AF 4K88A 2V8IA 2K5FA 4CS2A 1UGQB 1WJSA 3DB4A 2P0KA 4PJOG 2PVGB 3RKXA 2QQSA 3NELA 2RJDA 2PU9B 2ZXFA 3G4SA 2D0QB 3PCOA 2XD0A 3L4GA 2KAFA 2EQMA 2XU8A 5DM7R 1M5Q1 2Y90A 3E9FA 1M1GA 2KDSA 3TEEA 1M1KC 4JJNK 3VUBA 3V7RA 3P8HA 2E1HA 1E1OA 4IUPA 2ALYA 4ELZC 3KBGA 4LDXA 4Q6GA 3DLMA 1LNXA 4HWRA 4M7DE 1PYSB 2QHUA 1VQLA 1M4ZA 1QP2A 3S6WA 3I7FA 4OGCA 1JJCB 1Q81U 1BKBA 2BIVA 3J80E 5LJ5j 1I5LA 3PZCA 3T9NA 1UB4A 1M1FA 5DLQE 2E10A 1W66A 4MDXA 5EG2A 4C5EA 4Q15A 4XU1A 1VIFA 1BIBA 3REXA 2H3JA 4J7IA 3M54A 5J26A 1BI3A 2EWNA 1NJ8A 4BW9A 1YFSA 2C8MA 2IY5B 3IG2A 3OA6A 2FHDA 3TUPA 1NPPA 5DLOA 1G3YA 3HP9A 2HBPA 3CC4A 4ZTJA 3LW5E 3QO5A 4FT4A 4BE0A 3QUIA 3GIBA 5AYFA 1G5VA 3M58A 3X20B 1YITA 1X75C 2K5LA 4ATOA 1VQ9A 5HY6A 4M77D 1WGSA 2ZT5A 2LTOA 4C92E 4H2VA 4H02A 2FVUA 4HCBA 4ZTFA 2XK0A 5GAN7 5C52B 5C51B 3G71T 4M75C 5K1XA 2A8EA 5GANg 1UGPB 4N4HA 2YHTA 5KCHA 1W4SA 1BYMA 2QQBA 2FYKA 1QVGS 3CCJT 2DTOA 3VYHB 3CD6A 3DSQA 3OSVA 2QHSA 4Q5WA 3CMAA 3M4PA 1B70B 2RO0A 4YCVA 4MMKA 3NTKA 4TTVA 4KR2A 4KT0E 2DQ0A 3SB2A 2CZ0B 2MAMA 4OVAA 2M1HA 4TVAB 4V2SA 1NJ5A 1K73C 4WJ3M 2G3RA 2CS7A 2I4MA 3QZ5B 3HRIA 1KG1A 3WXMB 5FU6C 2XGTA 3HSBA 5F5WA 4F7UA 3MP8A 1QVPA 1NJ1A 4BDZA 4M7DB 2IVWA 4C92G 4L6V5 2RHQA 5GAMg 3OYLA 1I4K1 3OD1A 4OB2B 3HXVA 4PKCC 5GMKj 3HFZB 3L2UA 4P75A 4YRJA 4HVCA 4M78A 3VV0A 4HWOA 1E24A 5ELNA 4R56A 3MEWA 2CIMA 3QKJA 2VGNA 3L2VA 4M75G 3V8LA 4M77E 2WSEE 3HY1A 3RERA 3L42A 3OYGA 4FL6A 3X24B 1B7YA 2E6NA 3WVEB 4P3OA 1Q7YC 3BW1A 3M9QA 4O2DA 5GAN8 1WQ7A 2DXBA 3LX7A 2P0QA 4OB3B 5ELOA 2QA4T 3CMQA 1YIJT 3O8VA 2GQVA 2JOYA 2PUOB 5C6SA 5GANh 3FIFA 5GANd 12ASA 3E1SA 2PQWA 1X2HA 3CCLT 3QZ9B 3KUFA 4BWAA 3PMTA 1VUBA 3CCMT 4XEMA 4RDXA 3CCSA 4C92B 2VC8A 2KVQG 3CCVA 2RHXA 3HPWA 2DEQA 5GAN4 4AH6A 4BY6B 1G3SA 1X01A 4ZGJB 3E9IA 4KUIA 2ZT7A 2KMTA 1QVFA 2ARUA 2HAXA 3OYIA 1SSFA 4E47A 2E64A 4NS5A 4JLGA 2EYQA 2K57A 2XIDA 5GAMh 2ZPHB 4XTVA 5GAMd 1K8AU 3TEHB 5GAOn 3NEMA 5GAOl 2LVMA 4RCCA 2L3RA 3V8JA 1VQMA 1PSFA 4F7UF 5A0DA 4QQDA 3E19A 4OB0B 5CKDA 1BIAA 2P0LA 2QI2A 4PJOD 3A31A 3CC2T 2AMCA 2GCXA 5CIUA 4M7AA 4M78F 1K73U 2QXFA 2K2VA 2Q5HA 1XQHA 1UEBA 3H8ZA 5CQXA 5FU6B 3QXEB 3MQZA 3INZA 3PCOB 4RQFA 2CJAA 4YRRA 3A8GB 1HXDA 3HXZA 1N9RA 2JNGA 1YHQA 4C0DC 3HTZA 1Q81C 4J8OA 2ALYB 1VQPA 1O9SA 3JSCA 3G6EA 4P75C 3BY7A 3C4SA 4M78C 3QO7A 1KMNA 4FT2A 3JB9J 5CAIA 3W3SA 2DQ3A 3MP1A 4QVCA 2CJBA 2E3CA 4JLIA 1YBYA 4D6WA 4CI0C 1P92A 2XDPA 1EVLA 2FL7A 2Q7GA 4VUBA 2OTLT 5LJ5f 2GFAA 1IREB 2K4YA 1ZBXA 3P8DA 4EMKC 5LJ3j 3PMIA 3RIRA 4LVKA 3S3NA 1VQ5A 4HCCA 3GLXA 2DK3A 3NTHA 2ARSA 4YRGA 4MZTA 3CCRA 3HRSA 3DKMA 2XKOC 3P8TA 3RKYA 4PJOE 3VUZA 3OB9A 4OP0A 2ZNIA 4MDWA 1EOVA 4C8QF 3LYIA 2EJGA 3MEYA 2EL9A 4M7DD 4IUUA 3LGFA 1S72T 4F7UG 3JCMg 4IUTA 4II1A 4CRIA 1YFTA 4PLIA 2BUDA 4TQFA 3PT9A 3A5ZA 3UPUA 3BJUA 1M9SA 5LJ5e 4M78G 3JB9F 2ZT8A 2F69A 2DPPB 5C0MA 2K5IA 4C8QC 2JVVA 4A53A 3FRNA 1X54A 1IZ6A 4NL2A 3UH0A 5GMKi 2ZPGB 2RJEA 1Y71A 4OF1A 2D6FA 2NS6A 4UPAA 3FEOA 2LT4A 1QVGA 2ZR3A 1M8VA 2PVOB 1OYXA 2K3YA 4A54A 4XU2A 1VQ9T 1J5WA 1UGSB 1KHIA 4IUQA 4XU0A 3GNGA 3OS1A 4OMFB 1W2BS 4DPGA 1VQ4A 2ZNJA 2R5AA 1HK9A 1VIEA 2QQ9A 2QTXA 4XEOA 2RHIA 3X28B 1NJ6A 3LH0A 3GF5A 5J3BA 4QVDA 1GGMA 2QEXA 4TVRA 2VYTA 3C94A 3CD6T 4M7AC 3IKLA 4YYEA 5HGQA 3HRKA 2EFIA 2HQEA 4MMLA 3R07A 1LOJA 2X4XA 4C92D 1AHJB 2JUFA 4A4EA 3JAME 4CH6A 1WQWA 3AHUA 2RHQB 2EIFA 2PMFA 4P5NA 4LD9K 4E7LA 3GP8A 3S3MA 2EQJA 3PIOA 1B76A 3E9GA 1H4TA 1N9SA 4M75D 1YJWA 4EDUA 1Y96A 3BDUA 4P72C 4O6JA 4XK8E 2DZCA 3NETA 3JRZA 2KSSA 3RMSA 3ER0A 1OZ2A 4WJ4A 1VQOT 3JCMh 3JCMd 3HY0A 1VQKT 3FB9A 4JRIA 1YJNT 1B7YB 4YRKA 4A4FA 3M57A 3OW2S 3JB9G 4PJOB 3SWNA 4LNSA 5KE3A 2LRQA 2VXFA 2ODRD 4J6XA 2E5QA 4BI8B 3KFUA 4KUDK 2RB6A 4M7AG 5GANe 2EAYA 4EMGA 3QJYA 3CBOA 2CZ7B 3I56A 5D6YA 1YFRA 5GMKe 3CCEA 3HL8A 3DB3A 1SESA 4H2WA 3CPWS 1FYFA 1KHCA 4OB1B 4JDSA 2D9TA 1RIQA 1X2GA 1VQNA 4EO4A 2R57A 3RMQA 4JRQA 3KXTA 3SDZA 2BKDN 4FSXA 5I21A 3TEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VBB A;  3FIF A;  5GAN d;  12AS A;  4YRN A;  3UFG A;  3VQY A;  3HFN A;  2J3M A;  5E3I A;  3RL6 A;  5GAO p;  1X2H A;  4RMF A;  4CS3 A;  2I4O A;  4M75 E;  1JBM A;  4BWA A;  3G1Z A;  2VXE A;  2DTH A;  2YLB A;  4F7U B;  4NCX A;  4XEM A;  4KQE A;  4P73 A;  4M7D C;  4RDX A;  3VQX A;  4C92 B;  3QO3 A;  2VC8 A;  3JCM e;  4M7A E;  4RCB A;  2RA2 A;  1YGB A;  1Z7N A;  4M77 A;  2DJZ A;  2E5A A;  3V8K A;  5K1P A;  2RHS A;  4CH5 A;  3JB9 D;  5DY9 A;  2DXT A;  3JCM P;  2DEQ A;  5GAN 4;  5GAN f;  2E41 A;  4AH6 A;  1LJO A;  4M78 B;  3SWN B;  4PJO C;  5GAO q;  4C8Q G;  1QE0 A;  1X01 A;  3E9I A;  4G85 A;  2ZT7 A;  2DU5 A;  1LYL A;  3RAC A;  2ARU A;  1TH7 A;  2E65 A;  1EFW A;  4HT8 A;  4M77 F;  1B34 B;  3RKW A;  2ZTG A;  1KMM A;  3LSQ A;  2E64 A;  2K57 A;  4HT9 A;  1HC7 A;  2AMC B;  3FJP A;  4C92 A;  3A7A A;  1SRY A;  4M7A B;  2DXU A;  5GAN j;  2I2L A;  4YRS A;  4X9D A;  3EFS A;  5GAM h;  1EVK A;  4XTV A;  5GAM d;  4H2X B;  3TEH B;  5GAO n;  2ZIM A;  3NEM A;  5GAO l;  1WNL A;  4RCC A;  1N9W A;  1C0A A;  3V8J A;  4EMK B;  4F7U F;  1PYS A;  1KOG A;  4TWA A;  4C92 F;  1WU7 A;  2ZIO A;  1ADY A;  1BIA A;  2P0L A;  3LC0 A;  4CH3 A;  1B34 A;  4M75 A;  1G51 A;  3QTC A;  4HWT A;  4PJO D;  2C7I A;  4M77 C;  1H4V B;  4P71 A;  3A31 A;  2AMC A;  1ADJ A;  4UP7 A;  4M7A A;  4YCU A;  4M78 F;  4UP8 A;  3RF1 A;  5GAM f;  2Q5H A;  2G4C A;  4XTX A;  4H2X A;  4C8Q E;  2ZR2 A;  4YRL A;  2Q7E A;  2AKW B;  3TEH A;  4PG3 A;  2DTI A;  4YRM A;  1NNH A;  3A7U A;  4M75 F;  4X9C A;  4EMK A;  2ZCE A;  4JUV A;  4NOY A;  3INZ A;  3PGG A;  4M7D G;  3PCO B;  3QO8 A;  4RQF A;  2CJA A;  5LJ3 h;  4YRR A;  5LJ3 d;  1QF6 A;  1WYD A;  1HXD A;  3HXZ A;  4K86 A;  1U1S A;  4M7A F;  1N9R A;  2RD1 A;  5GMK l;  4K88 A;  4H2Y A;  4C92 C;  4CS2 A;  2DKG A;  1MGQ A;  5GAM j;  4TVW A;  3HTZ A;  2IY5 A;  3L2Z A;  3RUX A;  4PJO G;  1Z7M A;  5LJ5 h;  2ALY B;  2XTI A;  5LJ5 d;  3UGT A;  3RKX A;  3NEL A;  4XU3 A;  4P75 C;  3BY7 A;  4XQ3 A;  4M78 C;  3SWN C;  3QO7 A;  4C8Q B;  1E22 A;  3QNE A;  3V7S A;  4HWP A;  2AKW A;  1KMN A;  3BFM A;  3JB9 J;  4J6Y A;  5CAI A;  3WQZ A;  5KNN A;  1I8F A;  2EJF A;  2ZXF A;  3W3S A;  2DQ3 A;  1ASY A;  3PCO A;  5LJ3 f;  4QVC A;  2CJB A;  3L4G A;  2E3C A;  4L87 A;  4P71 C;  1M5Q 1;  2Y90 A;  4JLI A;  3A32 A;  1H64 1;  3QSU A;  5GAN 5;  3JCM c;  3V7R A;  3JCM W;  1SER A;  2E1H A;  5GAM e;  1EVL A;  5GMK m;  2Q7G A;  1E1O A;  4OLF A;  3JB9 H;  5LJ5 f;  4PNO A;  2ALY A;  3VQV A;  4ZTU B;  3RGL A;  4Q6G A;  1USY A;  4EMK C;  1LNX A;  4HWR A;  4M7D E;  1PYS B;  2QHU A;  4C8Q A;  4YRP A;  5LJ3 j;  4PHC A;  3RIR A;  1G5H A;  3HXW A;  3I7F A;  2DVE A;  2ARS A;  3HFV A;  2ODR C;  4M75 B;  4YRG A;  1JJC B;  2EJ9 A;  4J6W A;  2HNI A;  4YRO A;  3P8T A;  1E1T A;  2DZ9 A;  5LJ5 j;  1I5L A;  3RKY A;  4PJO E;  3PZC A;  4OP0 A;  4YRI A;  2ZNI A;  2ZZG A;  2ZIN A;  4KR3 A;  1EOV A;  4C8Q F;  3ICA A;  1NYR A;  4N0A A;  2EJG A;  3LSS A;  3JCM V;  1HTT A;  3MEY A;  2EL9 A;  4M7D D;  2E10 A;  3EFR A;  4K87 A;  2CGH A;  1W66 A;  4F7U G;  4Q15 A;  3MF2 A;  3JCM g;  4HA8 A;  1G5I A;  4H2T A;  4ZTZ B;  4P3N A;  4XU1 A;  3VU3 C;  1BIB A;  5LJ3 e;  2YLC A;  3REX A;  1YFT A;  2ZZE A;  4P73 C;  1H4Q A;  4P74 A;  4TQF A;  2EWN A;  3A5Z A;  4WI1 A;  1JJC A;  1NJ8 A;  4BW9 A;  2I4N A;  4E51 A;  3BJU A;  1YFS A;  4J5Y A;  2C8M A;  2IY5 B;  3IG2 A;  3RES A;  3E9H A;  4Y91 A;  5LJ5 e;  4M78 G;  3JB9 F;  4TVA A;  3IAL A;  3ERR A;  3TUP A;  2ZT8 A;  4TQD A;  3M4Q A;  1USY C;  4C8Q C;  4EMH A;  5GAN 6;  2CJ9 A;  1WLE A;  1X54 A;  4A53 A;  4H2S A;  1B8A A;  4NL2 A;  4XTZ A;  3UH0 A;  4YRT A;  1U1T A;  5GAO m;  5GMK i;  4YP0 A;  3L4G B;  3JCM b;  4YPF A;  3JB9 I;  4UPA A;  3QO5 A;  4X5O A;  3HFO A;  2ZR3 A;  1M8V A;  3QUI A;  3GIB A;  1YCY A;  4A54 A;  3VQW A;  2Q7H A;  4XU2 A;  4EX5 A;  1KQ1 A;  2P5I A;  4PJO A;  1J5W A;  4H2U A;  3IKM B;  1L0W A;  4XU0 A;  4XTY A;  2ZT6 A;  4F7U E;  3L1A A;  4DPG A;  3JCM Q;  4P72 A;  4M77 D;  2QHV A;  2ZNJ A;  2ZT5 A;  4C92 E;  4H2V A;  1HK9 A;  2QTX A;  4H02 A;  2RM4 A;  4XEO A;  5GAN 7;  4P74 C;  5C52 B;  5C51 B;  1NJ6 A;  4YDQ A;  4M75 C;  5K1X A;  5GAN g;  2FB7 A;  1BBU A;  3P8Y A;  4QVD A;  1GGM A;  4M78 E;  2YHT A;  4M7A C;  5C53 B;  3IKL A;  4YYE A;  5HGQ A;  3HRK A;  1Y96 B;  2FYK A;  4MML A;  1BBW A;  5GMK h;  2DTO A;  3DSQ A;  3R07 A;  4HWS A;  2QHS A;  1LOJ A;  4C92 D;  4NL3 A;  3M4P A;  4RQE A;  2Q5I A;  1B70 B;  2ZGW A;  4YCV A;  2PME A;  4MMK A;  2DU7 A;  4YRQ A;  4CH6 A;  4TTV A;  4KR2 A;  1WQW A;  3AHU A;  2RHQ B;  2DQ0 A;  2PMF A;  4J15 A;  4M77 G;  3SB2 A;  4M78 D;  4G84 A;  1VQZ A;  2I4L A;  1JRI A;  1NYQ A;  1B76 A;  4TVA B;  4V2S A;  1NJ5 A;  1EQR A;  4WJ3 M;  1H4T A;  3A7R A;  1N9S A;  4M75 D;  2I4M A;  1Y96 A;  2ZZF A;  3BDU A;  4JRK A;  4P72 C;  3HRI A;  3UGQ A;  5GAN 3;  2XGT A;  3HXY A;  4YRE A;  4M7A D;  2DZC A;  3HSB A;  3NET A;  3P8V A;  5F5W A;  4F7U A;  1B70 A;  1NJ1 A;  4M7D B;  4WJ4 A;  3JCM X;  4C92 G;  2RHQ A;  3JCM h;  5GAM g;  3JCM d;  4YRF A;  1SET A;  3HY0 A;  1I4K 1;  1X56 A;  3FB9 A;  4JRI A;  1B7Y B;  4YRK A;  3OD1 A;  1EIY B;  11AS A;  3HXV A;  5GMK j;  3HFZ B;  3HXX A;  4P75 A;  4YRJ A;  4HVC A;  4PJO B;  3JB9 G;  3A5Y A;  4M78 A;  3SWN A;  4HWO A;  4LNS A;  1D3B B;  3NEN A;  2VXF A;  1E24 A;  2ODR D;  4UP9 A;  4J6X A;  4P3P A;  5ELN A;  4CH4 A;  2ART A;  3QHS A;  3TEG A;  3HXU A;  2CIM A;  1KQ2 A;  3A74 A;  2QHT A;  1I81 A;  5GAN 2;  4CS4 A;  1ASZ A;  4M75 G;  3V8L A;  1X55 A;  4M77 E;  3V7C A;  2JN0 A;  4DQ2 A;  3KFU A;  4WF2 A;  4M7D A;  2DDZ A;  3HY1 A;  3JCM f;  2RB6 A;  4M7A G;  4TVY A;  3RER A;  1NJ2 A;  5GAN e;  2EAY A;  1YB3 A;  4YCW A;  4EMG A;  4ZIB A;  1B7Y A;  4XTU A;  3JCM J;  4P3O A;  1EIY A;  1YFR A;  1IL2 A;  4N0A C;  2J3L A;  3HFZ A;  5GMK e;  3BW1 A;  5LJ3 g;  3MF1 A;  4YRC A;  4O2D A;  1D3B A;  1SES A;  4M7D F;  5GAN 8;  1ATI A;  3REU A;  4H2W A;  1WQ7 A;  4XTW A;  1FYF A;  5ELO A;  5GAO r;  1RIQ A;  4M77 B;  3CMQ A;  1X2G A;  4EO4 A;  5LJ5 g;  2RHS B;  1WPY A;  4C8Q D;  4PJO F;  1H4S A;  5I21 A;  5GAN h;  3M4G A; 
#chains in the Genus database with same CATH topology
 3VBB A;  2QAS A;  1R8O B;  3OYK A;  4YRN A;  3UFG A;  5CKB A;  2K9G A;  3HFN A;  2DIQ A;  5E3I A;  1JB0 E;  2RI3 A;  5GAO p;  1K8A C;  3RL6 A;  2KK4 A;  3CCS T;  2EW3 A;  4M75 E;  1JBM A;  2O31 A;  3SD4 A;  3M56 A;  3FJ5 A;  3CCV T;  1ZBJ A;  1QCN A;  1M8M A;  4P73 A;  3I35 A;  2JM8 A;  3VQX A;  3QO3 A;  4HVV A;  3ZFJ A;  5CCA A;  1GRI A;  4RCB A;  1Z7N A;  1D0Z A;  2D8H A;  3V8K A;  3CCU T;  2ROT A;  4FU6 A;  5KYU B;  1G3W A;  2DXT A;  1UHF A;  4KH0 B;  2KRO A;  2JM9 A;  1VQO Q;  1NEB A;  1AT1 B;  1Q95 G;  3TCJ A;  5GAO q;  2EQK A;  2CSI A;  1QE0 A;  1VQK Q;  3OS0 A;  4ZN1 A;  1BCO A;  1M2O A;  1QW1 A;  1YJN Q;  2DU5 A;  1WX6 A;  2DIL A;  1TH7 A;  2L2P A;  2ZTG A;  4M77 F;  3OQ5 A;  1NYF A;  1Z9Q A;  3EAE A;  5D6X A;  4HT9 A;  2AMC B;  2F1L A;  2NUT B;  1VQ8 A;  4M7A B;  4BAC A;  5GAN j;  2WAC A;  3ME9 A;  3EFS A;  1T0H A;  3ASK A;  1GBR A;  4E7J A;  2Y4Y A;  2V1R A;  3LLR A;  1C0A A;  2FZK B;  3X26 B;  4HVW A;  1YJ9 T;  1KQS P;  1PYS A;  1RAH B;  1PG5 B;  1IGU A;  4TWA A;  2X9H A;  5IH2 A;  5KCO A;  4QW2 A;  4UC4 A;  3VS6 A;  3A8H B;  1G51 A;  3QTC A;  4L59 A;  4YTL A;  2XDD A;  4M77 C;  2LQN A;  4RUG A;  3TSZ A;  3EHR A;  2KT8 A;  4UP7 A;  4YCU A;  3PIP A;  1WHL A;  2DL8 A;  4H2X A;  4YRL A;  4PG3 A;  2DTI A;  3G71 Q;  3R6O A;  2RHZ A;  1NNH A;  2YWW A;  3A7U A;  2WSF E;  3GNF B;  1N8R U;  3C95 A;  1SG5 A;  4EMK A;  4R55 A;  2ZCE A;  4QQ6 A;  3MKD A;  5FU7 C;  2D0N A;  2HSE B;  1YHQ T;  1M27 C;  5GMK l;  2KYB A;  3UF4 A;  4H2Y A;  2SEM A;  3C12 A;  1VQP T;  1MGQ A;  5GAM j;  4TVW A;  2IY5 A;  3G6E T;  3M4Y A;  4GBQ A;  3L2Z A;  3MEU A;  2XTI A;  2HEQ A;  1QKW A;  3OS2 A;  3UGT A;  3ZEH A;  3QYG B;  4XQ3 A;  2MI6 A;  4Z89 A;  3SWN C;  1K0X A;  3QNE A;  3CCU Q;  3H6Z A;  3WQZ A;  2DBK A;  5KNN A;  1I8F A;  2EJF A;  4ORZ A;  2VV5 A;  5GJV B;  5LJ3 f;  2ZPI B;  4BDY A;  4L87 A;  3SFM A;  2J6K A;  1X27 A;  3LH5 A;  2E3I A;  3A32 A;  2GNC A;  3GPL A;  2CKK A;  1BI0 A;  3JCM c;  4ME7 A;  5GAN 5;  3JCM W;  5I2S A;  2KR3 A;  2LQK A;  4HXJ A;  1OX8 A;  3I5R A;  4OLF A;  4OML A;  4PNO A;  1JO8 A;  1JU5 C;  4ZTU B;  1UUE A;  1M3C A;  2E3H A;  2RHY A;  2B8A A;  5CO7 A;  3CCJ A;  5I22 A;  3OYE A;  2O4X B;  4C8Q A;  3EH1 A;  1ZA2 B;  4E7H A;  3EG3 A;  2DVE A;  3HFV A;  4M75 B;  1D1B A;  1NEG A;  3G1J A;  4J6W A;  2YRC A;  2MMP A;  1YJ9 Q;  3PFS A;  3CCQ A;  4YRO A;  2MCN A;  1VOM A;  4FW2 A;  5IAY A;  4YRI A;  2CYZ B;  1D0X A;  2XIC A;  1GCQ A;  4LDU A;  1X69 A;  2NWM A;  4LUD A;  4C5H A;  2ZZG A;  2KY9 A;  1NYR A;  4N0A A;  2C0I A;  3JCM V;  1HTT A;  4LVI A;  2EGC A;  4O5V A;  3EFR A;  5FRO A;  1WHM A;  1ZSZ A;  1VQ6 A;  2YUO A;  3H9N A;  4LDY A;  1GL5 A;  3MF2 A;  1G5I A;  4H2T A;  4J9D A;  2ZAE A;  3N5B B;  2RQW A;  5LJ3 e;  1IO6 A;  2ZZE A;  4P73 C;  1PWT A;  2DO3 A;  4A4H A;  2RQT A;  2HZY A;  4DA4 A;  2LDM A;  5IHN A;  3L2Q A;  4Y91 A;  1PRL C;  4TVA A;  1G3T A;  3IAL A;  4DBR A;  1W2B A;  2LP5 A;  1YN8 A;  4PFP A;  3M4Q A;  1USY C;  2QA4 Q;  1K9A A;  2OTJ A;  1VQ7 T;  2E6Z A;  5GAN 6;  1I1J A;  1WLE A;  2CJ9 A;  1PSE A;  3OMG A;  1YIJ Q;  1GCP A;  1X2K A;  2AT1 B;  3TQ7 P;  1WYX A;  1UGR B;  2DE0 X;  4YRT A;  1U1T A;  4Z02 A;  3I55 A;  3L4G B;  1K76 A;  4A4K A;  2IG0 A;  4RTX A;  2QQA A;  4X5O A;  3HFO A;  1BB9 A;  4RTW A;  2J6F A;  1T0J A;  1YCY A;  3VQW A;  2Q7H A;  3CCM Q;  4EX5 A;  2P5I A;  1BI1 A;  1L0W A;  3O5Z A;  4LVJ A;  2LCC A;  4XTY A;  2ZT6 A;  4F7U E;  4P72 A;  3EG0 A;  2QHV A;  2DX1 A;  2EKO A;  5D7U A;  2A7Y A;  3OYC A;  3G4S T;  5HKC A;  5CQY A;  2PZ1 A;  2RM4 A;  2ZPE B;  4P74 C;  4YDQ A;  3F70 A;  4BUG A;  2XG8 D;  3PVL A;  1XTD A;  3P8Y A;  4LE9 A;  1PD1 A;  3QYH B;  2RJC A;  2DRM A;  4M78 E;  4BD3 A;  3URG A;  2RQR A;  5C53 B;  1OU8 A;  2KRM A;  1Y96 B;  3CC7 A;  2KI7 A;  4HWS A;  2X4W A;  2LCL A;  1VQL T;  2V8J A;  2LQ8 A;  4NL3 A;  1OX9 A;  3UAT A;  2YUP A;  2M0O A;  4RQE A;  2X35 A;  2ZGW A;  3CCL A;  2PME A;  2L8D A;  4YRQ A;  3VS1 A;  2YXY A;  1M1K R;  2HCK A;  3TRE A;  2K6D A;  2L3P A;  3QG1 A;  4G84 A;  1D1C A;  1VQZ A;  1KFZ A;  2I4L A;  3OW2 A;  1YJW T;  3OYY A;  2YUQ A;  2OJ2 A;  1NYQ A;  2K2M A;  1EQR A;  1X6O A;  2M9U A;  3G7Z A;  1Q82 R;  3A7R A;  3S3O A;  2ZZF A;  2AHJ B;  1D0Y A;  2JTF A;  1AZE A;  3CC2 Q;  2DVJ A;  3UGQ A;  5GAN 3;  5CK9 A;  3HXY A;  4M7A D;  3P8V A;  4PJN A;  2OI3 A;  1TOV A;  3JCM X;  4QQG A;  1AD5 A;  1VQ7 Q;  2GTJ A;  4YRF A;  1SET A;  1AWX A;  3JV3 A;  2A3L A;  3EG9 A;  2HQX A;  1ZUY A;  3HXX A;  2ZPB B;  3EGD B;  4PLL A;  3A5Y A;  4PFO A;  3OMC A;  2F2W A;  3NEN A;  1NPR A;  4UP9 A;  4CH4 A;  4P3P A;  3QHS A;  3HXU A;  5FRN A;  3OYB A;  1KQ2 A;  3CPW A;  2QHT A;  3CC4 T;  4CS4 A;  1ASZ A;  4AFU C;  4JPB W;  3OSS C;  1X6B A;  4WTO B;  4BE1 A;  4LVL A;  3NMZ C;  5L8R E;  3V7C A;  2XDB A;  4DQ2 A;  4ZGE B;  5KH6 A;  1ZSG A;  2C0O A;  5CKF A;  2DDZ A;  1EIF A;  1LCK A;  3EHQ A;  5CVI A;  2LX7 A;  3QII A;  3I56 T;  3G4S Q;  4TVY A;  2X3X D;  1KSW A;  4YCW A;  3CCE T;  4ZIB A;  1OQK A;  1GCQ C;  1EIY A;  1ZLM A;  3CXC S;  1YIT T;  3PTA A;  1IL2 A;  4N0A C;  2J3L A;  1K0S A;  2L3Q A;  1QMC A;  2VUB A;  3HRU A;  3CME A;  3MF1 A;  4E2F B;  4YRC A;  1D3B A;  2KQW A;  1ZSZ C;  4M7D F;  1WHK A;  1ATI A;  3BE3 A;  4XTW A;  1FMW A;  1VQN T;  2K79 A;  4JZ4 A;  4BI4 A;  5GAO r;  1YI2 A;  1KC8 R;  1VQL Q;  2QAZ A;  4IUV A;  5LJ5 g;  1XOV A;  3OYM A;  3GOX A;  1WPY A;  1JJ2 S;  3MET A;  1V29 B;  1RAD B;  3M4G A;  4LDV A;  2DD5 A;  3VQY A;  3THK A;  3CMA T;  4KGZ B;  3ZL7 C;  2RH2 A;  2I4O A;  2LX9 A;  3G1Z A;  2VXE A;  2DTH A;  2YLB A;  1TUD A;  2O01 E;  4F7U B;  2MOX A;  2NUP A;  4M7D C;  2MWO A;  5HK3 A;  3OYA A;  4M7A E;  2QTV A;  2VGM A;  2RA2 A;  1YGB A;  1WJR A;  2M02 A;  4M77 A;  4C0D B;  2E5A A;  2DBM A;  3QPH A;  1B07 A;  2RHS A;  5DY9 A;  2JTM A;  2AIR B;  2DYB A;  4PJJ A;  4J83 A;  5L23 A;  1NE8 A;  2DL7 A;  3JCM P;  1HJD A;  5HK0 A;  2QDY B;  5GAN f;  2E41 A;  2XI9 A;  1VYV A;  2ZZD A;  3H0F A;  3TVT A;  1LJO A;  1Q86 R;  4M78 B;  4PJL A;  2OTL A;  4C8Q G;  1Q82 C;  3SEM A;  4JRP A;  1LYL A;  4PFZ A;  1M2V B;  2E65 A;  2CSQ A;  4DEX A;  4HT8 A;  2MK5 A;  1RI0 A;  4FIB A;  1N8R C;  1VQ8 T;  3LSQ A;  3OYJ A;  1E7O A;  2CH4 W;  1HC7 A;  2EYZ A;  2DL4 A;  2WSC E;  3FJP A;  4GLK A;  1SRY A;  2CH4 A;  5CKE A;  2DXU A;  3H0I A;  3CC4 Q;  1RL2 A;  1WDX A;  4YRS A;  4H2X B;  2HBW A;  2A37 A;  3QJ6 A;  5IT9 E;  1N9W A;  3P8B B;  2JTE A;  3TSW A;  2LJ3 A;  1N27 A;  4EMK B;  3FDR A;  1M90 R;  2K7A A;  2GFU A;  3M53 A;  1KOG A;  4MZM A;  4C92 F;  1WU7 A;  2ZIO A;  1YIT Q;  1GXI E;  1S72 A;  3MO8 A;  2YRV A;  1B34 A;  1VQ9 Q;  5IN1 A;  4HWT A;  1RUW A;  2C7I A;  2E12 A;  3HHT B;  2LQW A;  1H4V B;  3M59 A;  4B6M A;  1N6A A;  4UP8 A;  3RF1 A;  3EGX A;  5GAM f;  2HDA A;  2G4C A;  4XTX A;  4LVM A;  3NHN A;  1OI1 A;  2ZR2 A;  4HKE A;  4RMO A;  4YRM A;  1MHN A;  2P4T A;  4M75 F;  1LPL A;  4X9C A;  1FYN A;  2DRK A;  1YWO A;  4E6R A;  4JUV A;  4NOY A;  4M7D G;  1PD0 A;  3QO8 A;  4GLM A;  1KQS S;  4ZNX A;  3CD6 Q;  1QF6 A;  2JZ2 A;  1WYD A;  4E7I A;  3A1P A;  1K9M R;  1U1S A;  2PUK B;  2RD1 A;  1H8K A;  4B9W A;  4C92 C;  2E5K A;  3CMA Q;  1KJW A;  1KC8 C;  2DKG A;  2XMF A;  1WIE A;  3OYN A;  2PNI A;  2LNV A;  2LCS A;  1MMG A;  2VVK A;  4JS5 A;  3WVD B;  3RUX A;  1H3Z A;  1Q7Y R;  1Z7M A;  5LJ5 h;  4QKU A;  4RTU A;  5LJ5 d;  3EH2 A;  4XU3 A;  1W1F A;  5ECA A;  4C8Q B;  1E22 A;  4BY6 C;  3UDC A;  3V7S A;  2AKW A;  4HWP A;  3BFM A;  4FM4 B;  1D1A A;  4J6Y A;  4ELY C;  2MPX C;  3OBY A;  1ASY A;  4J9E A;  2CP5 A;  3LWI A;  4X34 A;  4P71 C;  3QBY A;  4F14 A;  1QWF A;  1H64 1;  2J6O A;  1R0C B;  1TSF A;  1WHJ A;  4X1V A;  3QSU A;  2CZ6 B;  4LXC A;  2ECZ A;  1SER A;  2EQU A;  5GAM e;  3HKS A;  5GMK m;  2LMJ A;  2RHU A;  3JB9 H;  2FZC B;  4RTV A;  3VQV A;  3RGL A;  4EPC A;  2BZY A;  3CBM A;  3LWH A;  3M0S A;  1Q86 C;  1USY A;  3EFO A;  2DMO A;  2GTO A;  3BDL A;  4YRP A;  4PHC A;  3FC3 A;  4FYW B;  1PKS A;  1G5H A;  3CCQ T;  1M3A A;  3HXW A;  1QWE A;  1U3O A;  2ODR C;  4JJC A;  3LGL A;  2EJ9 A;  2ENM A;  5FW9 A;  3CPF A;  4J7F A;  1JXO A;  2HNI A;  4J9G A;  1HYO A;  4N4I A;  1JXM A;  2DZ9 A;  1E1T A;  2KXC A;  4RG8 A;  1KD1 C;  3OYF A;  3DLL A;  2ZIN A;  4KR3 A;  4PL6 A;  1QP3 A;  1WI7 A;  1VQ6 T;  3ICA A;  2FPD A;  1VQM T;  2DJQ A;  3LSS A;  4IIM A;  3NGP A;  3HRT A;  4K87 A;  2FEI A;  3NFC A;  5KYX A;  5LL6 S;  2CGH A;  1CKB A;  3I5S A;  1NJI R;  4HA8 A;  2COY A;  1NLP C;  2EYY A;  1M90 C;  4P3N A;  4ZTZ B;  3VU3 C;  4ZGD B;  2YLC A;  1IXD A;  1GFD A;  1M1K U;  1H4Q A;  4P74 A;  2QDL A;  3QDR B;  4JS4 A;  4WI1 A;  4LD6 A;  2J05 A;  1JJC A;  2RK1 A;  1VQO A;  2I4N A;  4E51 A;  5CR2 A;  4J5Y A;  5KYY B;  3RES A;  1ZHI A;  2JW4 A;  4E7K A;  3E9H A;  1VQK A;  2OTJ T;  1MMN A;  1YJN A;  1HSQ A;  2X4Y A;  3ERR A;  1Q82 U;  4L5G A;  4RKU E;  4TQD A;  2K3B A;  3VJP A;  2KYM A;  3CPW P;  2RN8 A;  4EMH A;  4H2S A;  3I55 T;  1B8A A;  2HL3 A;  4XTZ A;  2F5T X;  1WJQ A;  2CT4 A;  5GAO m;  1I0C A;  4YP0 A;  1QCO A;  1K9M C;  3JCM b;  4K11 A;  4YPF A;  2C0T A;  4ZN3 A;  1H92 A;  3JB9 I;  4LDW A;  2ZCF B;  2NLU A;  3OY9 A;  1AEY A;  2V26 A;  3CCS Q;  1QVG P;  3ULR B;  3CCV Q;  1KQ1 A;  4PJO A;  3PNW C;  4H2U A;  4GY5 A;  3IKM B;  4IKF A;  1E6G A;  1MMD A;  1AWW A;  1JQQ A;  3L1A A;  3JCM Q;  2OAW A;  2MWP A;  2X4J A;  1Y57 A;  2LC4 A;  2K3X A;  5D6W A;  1FXX A;  3OYD A;  1Q81 R;  2OAU A;  3VRZ A;  2LT1 A;  2FB7 A;  4QVZ A;  4BE2 A;  1K4U S;  1BBU A;  1VYU A;  3VS7 A;  3CC7 T;  3G71 A;  1AWO A;  5A2Q E;  1NLO C;  4HCZ A;  1BBW A;  5GMK h;  4C5I A;  2H3E B;  3A8O B;  4OMO A;  5I11 A;  1NM7 A;  4KUL A;  1VQ5 T;  2BZX A;  3L2R A;  2Q5I A;  1VQ6 Q;  1U5S A;  2DU7 A;  2F5K A;  1XJW B;  1VQM Q;  3CCR T;  4J15 A;  1KC8 U;  4M77 G;  4CC7 A;  3A5Z B;  3A8M B;  4Y28 E;  1CSK A;  4M78 D;  1U8R A;  4KH1 B;  2ROL A;  2BE9 B;  3EG9 B;  1EFN A;  8ATC B;  1JRI A;  2SRC A;  3CCU A;  2L89 A;  2X51 A;  4RTY A;  1ZQ1 A;  2RI2 A;  4JRK A;  3M5A A;  1A0N B;  4YRE A;  1NJI C;  1B70 A;  1WXT A;  1Y7X A;  4BI3 A;  4DOW A;  2VWF A;  1X56 A;  3I55 Q;  3RR6 A;  3CXC A;  2A0F B;  1EIY B;  4Y92 A;  4BB7 A;  11AS A;  3FLG A;  3ZBD A;  1YHQ Q;  1Q86 U;  2V8K A;  2E70 A;  1D3B B;  2PVD B;  1W70 A;  4IUR A;  2ART A;  4HCK A;  3Q1J A;  1VQP Q;  5A0L A;  3A74 A;  1BK2 A;  3G6E Q;  1I81 A;  1YJ9 A;  5GAN 2;  2AKL A;  5A0G A;  1X55 A;  3UT1 A;  2ZPF B;  2JN0 A;  1OZ3 A;  1W6X A;  2HD0 A;  4WF2 A;  4M7D A;  3M55 A;  1JJ2 A;  2Y4X A;  3JCM f;  2CDT A;  3REA B;  3MP6 A;  2COZ A;  1KD1 U;  1NJ2 A;  2LNH B;  1YB3 A;  3J81 E;  3CEY A;  4XTU A;  3CME T;  3JCM J;  2CP3 A;  5KE2 A;  4ANJ A;  3HFZ A;  1VQ4 T;  4RTZ A;  5LJ3 g;  2R5M A;  4C0Z A;  1ARK A;  1M90 U;  2W10 A;  1F1B B;  3REU A;  1G8X A;  1YI2 T;  4C0G A;  3NTI A;  4AFS C;  2NUP B;  4E7S A;  4OGE A;  4AFQ C;  1WA7 A;  3SHW A;  2RK2 A;  4LNP A;  4M77 B;  2NUZ A;  3I9Q A;  2QEX T;  2RHS B;  2IIM A;  1VQ5 Q;  4J9H A;  3TU4 K;  4C8Q D;  4PJO F;  1FMV A;  4CC3 A;  2QA4 A;  1H4S A;  2KRS A;  1G83 A;  3CCR Q;  3J7A F;  1YIJ A;  4LUE A;  2O9V A;  3MEV A;  2J3M A;  3PE0 A;  4RMF A;  1MNE A;  2LJ1 A;  4CS3 A;  5FU7 B;  2B86 A;  4NCX A;  5I2M A;  2C06 A;  4KQE A;  1K9M U;  2QQR A;  1FX7 A;  4DOV A;  3JCM e;  5M9O A;  3CCM A;  5CKH A;  2M16 A;  2DJZ A;  2RI5 A;  4XAX B;  5K1P A;  4CH5 A;  3JB9 D;  6AT1 B;  1Q7Y U;  5FRM A;  2DIG A;  2R58 A;  4MZP A;  3VKI A;  3SWN B;  4AG1 C;  4PJO C;  4IIO A;  2P0P A;  2ABL A;  4G85 A;  5J39 A;  1XNI A;  5FLX E;  1BI2 A;  3RAC A;  4A4G A;  2L5Q A;  4OMP A;  1C0M A;  2H8H A;  1EFW A;  2YDL A;  1B34 B;  2XHC A;  3RKW A;  3L2W A;  1KMM A;  2DL5 A;  1PKT A;  2DXC A;  2GF7 A;  3MEA A;  4N4G A;  3OS5 A;  4C92 A;  3A7A A;  2I0N A;  4HT4 A;  5EC7 A;  2I2L A;  2DD4 A;  4X9D A;  1EVK A;  1DJ7 B;  4C5G A;  2ZIM A;  4C0F A;  1WNL A;  4HVU A;  1O75 A;  1Y07 A;  1T3S A;  2O4X A;  3UWN A;  1KQS A;  1NZ9 A;  1FWZ A;  3MHX A;  2DLP A;  4RG2 A;  3OBW A;  1ADY A;  2DFU A;  1QVF S;  2BE7 D;  3CBP A;  3LC0 A;  1S1N A;  2MF2 A;  4CH3 A;  1VQ4 Q;  4M75 A;  2DL3 A;  1B3Q A;  2AK5 A;  2EBP A;  2G6F X;  2RJF A;  4P71 A;  1OEB A;  1Y0M A;  1BCM A;  2EYX A;  3MCA B;  1ADJ A;  2ESW A;  4J9B A;  1AOJ A;  3A8L B;  3CC2 A;  2FRY A;  4C8Q E;  2Q7E A;  2AKW B;  3VYG A;  3TEH A;  2QEX Q;  2YT6 A;  2JMC A;  2CZ1 B;  2KBT A;  1NJI U;  1VQ7 A;  3PGG A;  1NBE B;  4B9X A;  3X25 B;  3OYH A;  5LJ3 h;  2DAQ A;  5LJ3 d;  4CC4 B;  4K86 A;  3VS5 A;  4KBM B;  4M7A F;  4K88 A;  2V8I A;  1SHF A;  2K5F A;  4EIK A;  1UGQ B;  4CS2 A;  1WJS A;  2A36 A;  1X6G A;  1PNJ A;  3DB4 A;  4LN2 A;  2M51 A;  4ESR A;  2P0K A;  4PJO G;  2CP2 A;  4DBQ A;  2PVG B;  3RKX A;  2QQS A;  3NEL A;  3EFO B;  1SRL A;  2RJD A;  2PU9 B;  1YJW Q;  2ZXF A;  1WHG A;  1TUG B;  2D0Q B;  2DYI A;  2YRD A;  3G4S A;  3PCO A;  2XD0 A;  3L4G A;  2KAF A;  2EQM A;  2NYS A;  2XU8 A;  3VS0 A;  5DM7 R;  4FSS A;  1M5Q 1;  2Y90 A;  3E9F A;  1M1G A;  2KDS A;  2LJ0 A;  3MJX A;  3TEE A;  1M1K C;  4JJN K;  3VUB A;  2HKN A;  3V7R A;  3P8H A;  2E1H A;  4FYX B;  1E1O A;  1K8A R;  4IUP A;  2ALY A;  2CUD A;  2JJ9 A;  3NPF A;  4ELZ C;  3KBG A;  1IHV A;  4LDX A;  4Q6G A;  3C0C A;  3DLM A;  2L3S A;  1H3H A;  1LNX A;  4HWR A;  4M7D E;  1PYS B;  2QHU A;  1SHG A;  1VQL A;  1M4Z A;  1QP2 A;  3S6W A;  5HCK A;  3I7F A;  4JZ3 A;  4OGC A;  1JJC B;  4A63 B;  1Q81 U;  1BKB A;  2KNB B;  2BIV A;  3J80 E;  1UEC A;  2EGA A;  5LJ5 j;  1I5L A;  3PZC A;  1K73 R;  3T9N A;  1UB4 A;  1J3T A;  1YFN A;  1M1F A;  5DLQ E;  2E10 A;  1JEG A;  1W66 A;  2EVR A;  3I56 Q;  4MDX A;  5EG2 A;  4C5E A;  2AZV A;  4Q15 A;  4WCI A;  5FWB A;  4XU1 A;  1VIF A;  1BIB A;  1EX4 A;  3CCE Q;  2EYW A;  3REX A;  2H3J A;  2P4R A;  4J7I A;  3M54 A;  5J26 A;  1WLP B;  5IXF A;  1BI3 A;  4J9C A;  2EWN A;  3CXC P;  1NJ8 A;  4BW9 A;  1YFS A;  2C8M A;  2IY5 B;  1D09 B;  3IG2 A;  3OA6 A;  2FHD A;  2EPD A;  2DM1 A;  1VQN Q;  1W2B P;  3TUP A;  3D7S B;  1NPP A;  5DLO A;  1G3Y A;  3HP9 A;  3MPU B;  4FW1 A;  1GBQ A;  5KYN A;  2HBP A;  3CC4 A;  4ZTJ A;  3LW5 E;  1UE9 A;  1C6V X;  2EKH A;  2JT4 A;  3QO5 A;  4FT4 A;  4BE0 A;  2F2X A;  3QUI A;  3GIB A;  1TUC A;  5AYF A;  1G5V A;  3M58 A;  2DNU A;  3X20 B;  1YIT A;  3RNJ A;  1X75 C;  2HMA A;  2K5L A;  1EZZ B;  4ATO A;  1VQ9 A;  3CQT A;  5HY6 A;  4M77 D;  1WGS A;  2CT3 A;  2LTO A;  4C92 E;  2ZT5 A;  4H2V A;  4H02 A;  2FVU A;  4HCB A;  4ZTF A;  2XK0 A;  5GAN 7;  5C52 B;  5C51 B;  3G71 T;  4M75 C;  5K1X A;  1QKX A;  2A8E A;  5GAN g;  3H41 A;  1UGP B;  2FZG B;  4N4H A;  1ABO A;  4AT1 B;  2YHT A;  5KCH A;  1U06 A;  1W4S A;  5KYW A;  1BYM A;  2QQB A;  1VQ8 Q;  2FYK A;  1QVG S;  3CCJ T;  1MND A;  2DTO A;  3VYH B;  2CP6 A;  3CD6 A;  3DSQ A;  1RAA B;  3OSV A;  1YP5 A;  2QHS A;  1ZSZ B;  2DER A;  1QLY A;  4Q5W A;  3CMA A;  3M4P A;  1B7T A;  2J7I A;  1B70 B;  2RO0 A;  4AFZ C;  4YCV A;  4MMK A;  1UHC A;  3NTK A;  4TTV A;  4KR2 A;  3M0R A;  7AT1 B;  4KT0 E;  2DQ0 A;  2QGG A;  2DA9 A;  3SB2 A;  2CZ0 B;  2MAM A;  2D1X A;  3OW2 P;  4OVA A;  1AWJ A;  2M1H A;  1MMA A;  3VRY A;  4TVA B;  4V2S A;  1NJ5 A;  1K73 C;  4WJ3 M;  2G3R A;  2CS7 A;  4DEY A;  2I4M A;  3QZ5 B;  3HRI A;  1KG1 A;  3WXM B;  3U23 A;  5FU6 C;  2XGT A;  3HSB A;  2RF0 A;  5F5W A;  4F7U A;  3MP8 A;  1QVP A;  1NJ1 A;  4BDZ A;  4M7D B;  2IVW A;  4C92 G;  4L6V 5;  4J9F A;  2RHQ A;  2AZS A;  5GAM g;  3OYL A;  2HSP A;  4R0K A;  1I4K 1;  5IXB A;  4F04 B;  3OD1 A;  1R77 A;  4OB2 B;  3HXV A;  1VA7 A;  2CRE A;  4PKC C;  5GMK j;  3HFZ B;  2GBQ A;  3L2U A;  4P75 A;  4YRJ A;  4HVC A;  4M78 A;  3VV0 A;  3M0U A;  4HWO A;  1TWB A;  1E24 A;  5ELN A;  3H0H A;  3VS2 A;  4R56 A;  3MEW A;  2Z0W A;  2CIM A;  3QKJ A;  1M2V A;  1GFC A;  2VGN A;  1X43 A;  2VB6 A;  3L2V A;  4M75 G;  3V8L A;  4PK4 A;  2J06 A;  4M77 E;  1IB8 A;  2WSE E;  2RQU A;  3HY1 A;  2QGF B;  2KEA A;  2KGT A;  4AG2 C;  1X2Q A;  3RER A;  1K1Z A;  3L42 A;  3OYG A;  4FL6 A;  3X24 B;  1B7Y A;  2E6N A;  3WVE B;  4P3O A;  3VS4 A;  1Q7Y C;  3BW1 A;  1N5Z A;  3M9Q A;  4O2D A;  1RAF B;  5GAN 8;  1IHW A;  2QG9 B;  1WQ7 A;  2COW A;  2W0Z A;  2DXB A;  2RNA A;  2FG0 A;  1IGQ A;  3LX7 A;  3VS3 A;  2P0Q A;  3CCJ Q;  4OB3 B;  5ELO A;  1PM3 A;  2QA4 T;  3HTR A;  3RDV A;  3CMQ A;  2PTK A;  2LZ6 B;  1YIJ T;  3O8V A;  2GQV A;  2JOY A;  2KT1 A;  2M0Y A;  2BZ8 A;  2PUO B;  5C6S A;  5GAN h;  3FIF A;  5GAN d;  3CCQ Q;  12AS A;  2O2O A;  3QDF A;  3E1S A;  2PQW A;  1X2H A;  5GJW B;  3CCL T;  1SKU B;  3QZ9 B;  3KUF A;  4BWA A;  3PMT A;  1VUB A;  3CCM T;  4XEM A;  4RDX A;  3CCS A;  4C92 B;  2VC8 A;  1RAI B;  2KVQ G;  2OX7 A;  3CCV A;  1R0B G;  2RHX A;  2BTT A;  3HPW A;  2DEQ A;  5GAN 4;  4AH6 A;  2JS0 A;  1AVZ C;  3EGU A;  4FYY B;  4BY6 B;  1G3S A;  1X01 A;  4ZGJ B;  3E9I A;  4KUI A;  2ZT7 A;  2KMT A;  1QVF A;  2DF6 A;  2ARU A;  1C1A A;  2HAX A;  3OYI A;  1SSF A;  4E47 A;  2OTJ Q;  2E64 A;  4NS5 A;  4JLG A;  2EYQ A;  2K57 A;  2XID A;  5GAM h;  2ZPH B;  4XTV A;  5GAM d;  5KYU A;  1K8A U;  2V1Q A;  3TEH B;  5IHK A;  5GAO n;  3NEM A;  5GAO l;  2HL5 C;  2LVM A;  1YWP A;  4RCC A;  2L3R A;  3A98 A;  3GBQ A;  3V8J A;  1VQM A;  1PSF A;  3REB B;  4F7U F;  5A0D A;  4QQD A;  3E19 A;  4OB0 B;  5CKD A;  1BIA A;  2P0L A;  2QI2 A;  3EG2 A;  1PCX A;  1TG0 A;  4PJO D;  3A31 A;  3CC2 T;  2AMC A;  2GCX A;  5CIU A;  2NUT A;  1ZUK A;  4M7A A;  4M78 F;  5AT1 B;  1K73 U;  2QXF A;  2K2V A;  2Q5H A;  2CP7 A;  2AKK A;  1XQH A;  1UEB A;  3H8Z A;  3AT1 B;  1UJ0 A;  2FPE A;  5CQX A;  5FU6 B;  3QXE B;  1UG1 A;  3MQZ A;  3INZ A;  3CC7 Q;  3PCO B;  4RQF A;  2CJA A;  4YRR A;  3A8G B;  1OPL A;  1TU0 B;  2A08 A;  1HXD A;  3HXZ A;  1WFW A;  1N9R A;  1TTH B;  1UDL A;  2JNG A;  3CCL Q;  1WXB A;  1YHQ A;  4C0D C;  3HTZ A;  1Q81 C;  5KYY A;  4J8O A;  1RLQ C;  1RAC B;  2ALY B;  2L0A A;  1VQP A;  1O9S A;  3JSC A;  1UGV A;  3G6E A;  4P75 C;  4D8D A;  3BY7 A;  3C4S A;  4M78 C;  3QO7 A;  2CUB A;  1KMN A;  4FT2 A;  3JB9 J;  5CAI A;  1PRM C;  3W3S A;  4RTT A;  2DQ3 A;  4JJB A;  2VKN A;  3MP1 A;  4QVC A;  2CJB A;  3RBB B;  1PHT A;  2E3C A;  1M30 A;  4JLI A;  1YBY A;  4D6W A;  4CI0 C;  4KRT A;  2DET A;  1RAE B;  1P92 A;  5FWC A;  2XDP A;  1EVL A;  2FL7 A;  2Q7G A;  4VUB A;  2OTL T;  5LJ5 f;  2GFA A;  1WHH A;  1IRE B;  3KFV A;  2K4Y A;  1ZBX A;  2YUN A;  1SF9 A;  1SRM A;  3P8D A;  4EMK C;  8AT1 B;  1YNZ A;  5LJ3 j;  2FO0 A;  2YSQ A;  2P84 A;  4DBF A;  3PMI A;  3RIR A;  4LVK A;  3S3N A;  1VQ5 A;  4HCC A;  3GLX A;  2DK3 A;  3NTH A;  1RAG B;  2ARS A;  4YRG A;  4MZT A;  3CCR A;  3HRS A;  2ED1 A;  4F17 A;  3DKM A;  2XKO C;  3P8T A;  1M3B A;  3RKY A;  4PJO E;  3VUZ A;  3OB9 A;  4E7Z A;  4OP0 A;  2ZNI A;  2CP0 A;  4MDW A;  1EOV A;  3EGX B;  4C8Q F;  1KK7 A;  3LYI A;  2MYS A;  2EJG A;  1NYG A;  1MV3 A;  1NG2 A;  2EL9 A;  3MEY A;  4M7D D;  4IUU A;  3LGF A;  2FRW A;  1N8R R;  1SSH A;  1S72 T;  4F7U G;  3PVQ A;  3JCM g;  4IUT A;  2JXB A;  4II1 A;  4CRI A;  3CME Q;  1YFT A;  2HKQ B;  1OV3 A;  4PLI A;  2BUD A;  4TQF A;  3PT9 A;  2HQH A;  3A5Z A;  3UPU A;  2KXD A;  3M0Q A;  3BJU A;  1G2B A;  4PJM A;  1M9S A;  1T3L A;  1YI2 Q;  2JS2 A;  2DEU A;  5LJ5 e;  4M78 G;  3JB9 F;  4F16 A;  1ZUU A;  2ZT8 A;  2F69 A;  2DPP B;  5C0M A;  2FPF A;  2K5I A;  2GQI A;  4C8Q C;  4FCY A;  5IHI A;  2MIO A;  2JVV A;  4A53 A;  3FRN A;  1X54 A;  1IZ6 A;  1SEM A;  4NL2 A;  2O88 A;  2EQI A;  3UH0 A;  2D8J A;  2EGE A;  2QYZ A;  2KE9 A;  5GMK i;  2ZPG B;  3E2U A;  4M4Z A;  2RJE A;  1UTI A;  1Y71 A;  4OF1 A;  2D6F A;  2NS6 A;  4UPA A;  3FEO A;  5KYW B;  4KGX B;  2LT4 A;  1QVG A;  2ZR3 A;  1M8V A;  2PVO B;  1OYX A;  1QCF A;  2K3Y A;  4A54 A;  4XU2 A;  1VQ9 T;  1J5W A;  1UGS B;  1MV0 B;  1KHI A;  1Z9Z A;  3QWX X;  4IUQ A;  4XU0 A;  3GNG A;  3OS1 A;  4OMF B;  1W2B S;  4DPG A;  1VQ4 A;  2ZNJ A;  2R5A A;  1VYT A;  1HK9 A;  1VIE A;  2QQ9 A;  2QTX A;  2OTL Q;  4XEO A;  1I07 A;  1RI9 A;  2RHI A;  3X28 B;  1NJ6 A;  1PC0 A;  3LH0 A;  3GF5 A;  5J3B A;  4QVD A;  4OMM A;  1FMK A;  1GGM A;  2QEX A;  1OPK A;  1BBZ A;  4TVR A;  2VYT A;  3C94 A;  3CD6 T;  4M7A C;  1MUZ A;  3IKL A;  4YYE A;  5HGQ A;  3HRK A;  2EFI A;  2HQE A;  4MML A;  3R07 A;  4J9I A;  1AZG B;  1LOJ A;  2X4X A;  4C92 D;  5KYX B;  1AHJ B;  2JUF A;  4A4E A;  2GGR A;  1OUL A;  1WZO A;  3JAM E;  4CH6 A;  1WQW A;  3AHU A;  2RHQ B;  2EIF A;  2O9S A;  2PMF A;  1OOT A;  4P5N A;  3IQL A;  4LD9 K;  1S72 Q;  1V76 A;  4E7L A;  3GP8 A;  3M0P A;  3S3M A;  2EQJ A;  4OMN A;  4JJD A;  3PIO A;  2QK0 A;  2JMA A;  1B76 A;  3E9G A;  1UFF A;  1ZA1 B;  4KGV B;  1H4T A;  1QQJ A;  1N9S A;  1TS9 A;  1LVK A;  4M75 D;  4DBH A;  1YJW A;  1QVF P;  4EDU A;  1Y96 A;  3BDU A;  4P72 C;  2VAS A;  4O6J A;  4XK8 E;  3EG1 A;  3R6N A;  2DZC A;  3NET A;  3JRZ A;  2KSS A;  3RMS A;  1I5O B;  3ER0 A;  1OZ2 A;  1BU1 A;  4WJ4 A;  1WXU A;  1VQO T;  3JCM h;  1KD1 R;  3JCM d;  3HY0 A;  2RQV A;  1SPK A;  1VQK T;  3FB9 A;  4JRI A;  1UJY A;  1YJN T;  1B7Y B;  4YRK A;  4A4F A;  3M57 A;  2ED0 A;  4QT7 A;  9ATC B;  2ATC B;  3UA6 A;  3OW2 S;  1V1C A;  3JB9 G;  4PJO B;  3SWN A;  4LNS A;  5KE3 A;  1RAB B;  1IRX A;  2LRQ A;  2VXF A;  2ODR D;  2RMO A;  4J6X A;  1ACM B;  4FYV B;  2E4H A;  4Z88 A;  1OU9 A;  2E5Q A;  4Z8A A;  4BI8 B;  2RPN A;  1HD3 A;  3KFU A;  4KUD K;  1JJ2 P;  3UA7 A;  2RB6 A;  4M7A G;  2IPO B;  5GAN e;  2EAY A;  4EMG A;  3QJY A;  4OMQ A;  2A28 A;  3CBO A;  1RLP C;  2CZ7 B;  3I56 A;  1E6H A;  5D6Y A;  1YFR A;  2F2V A;  4AMC A;  5GMK e;  3M0T A;  3CCE A;  3EGD A;  1TXQ A;  3HL8 A;  3DB3 A;  1SES A;  1CKA A;  4H2W A;  1YCS B;  1ZX6 A;  4D8K A;  3CPW S;  1FYF A;  1KHC A;  4OB1 B;  4JDS A;  2KRN A;  2D9T A;  1RIQ A;  4CC2 A;  1X2G A;  1VQN A;  4EO4 A;  2R57 A;  2X3W D;  3QWY A;  1ABQ A;  3RMQ A;  4JRQ A;  3KXT A;  3SDZ A;  2BKD N;  1KIK A;  4FSX A;  5I21 A;  3TEG A; 
#chains in the Genus database with same CATH homology
 3VBB A;  1R8O B;  3OYK A;  4YRN A;  3UFG A;  5CKB A;  3HFN A;  2DIQ A;  5E3I A;  1JB0 E;  2RI3 A;  5GAO p;  1K8A C;  3RL6 A;  2KK4 A;  3CCS T;  4M75 E;  1JBM A;  3SD4 A;  3M56 A;  3CCV T;  4P73 A;  3VQX A;  3QO3 A;  3ZFJ A;  5CCA A;  4RCB A;  1Z7N A;  3V8K A;  3CCU T;  4FU6 A;  1G3W A;  2DXT A;  3TCJ A;  5GAO q;  2EQK A;  1QE0 A;  3OS0 A;  4ZN1 A;  2DU5 A;  1QW1 A;  1TH7 A;  2ZTG A;  4M77 F;  3OQ5 A;  3EAE A;  5D6X A;  4HT9 A;  2AMC B;  1VQ8 A;  4M7A B;  4BAC A;  5GAN j;  2WAC A;  3ME9 A;  3EFS A;  3ASK A;  4E7J A;  2Y4Y A;  3LLR A;  1C0A A;  3X26 B;  1YJ9 T;  1PYS A;  4TWA A;  5KCO A;  4QW2 A;  4UC4 A;  3A8H B;  1G51 A;  3QTC A;  4L59 A;  4YTL A;  2XDD A;  4M77 C;  4UP7 A;  4YCU A;  3PIP A;  4H2X A;  4YRL A;  4PG3 A;  2DTI A;  3R6O A;  2RHZ A;  1NNH A;  3A7U A;  2WSF E;  3GNF B;  1N8R U;  3C95 A;  4EMK A;  4R55 A;  2ZCE A;  4QQ6 A;  5FU7 C;  1YHQ T;  5GMK l;  4H2Y A;  3C12 A;  1VQP T;  1MGQ A;  5GAM j;  4TVW A;  2IY5 A;  3G6E T;  3M4Y A;  3L2Z A;  3MEU A;  2XTI A;  3OS2 A;  3UGT A;  3ZEH A;  3QYG B;  4XQ3 A;  2MI6 A;  3SWN C;  3QNE A;  3H6Z A;  3WQZ A;  5KNN A;  1I8F A;  2EJF A;  2VV5 A;  5LJ3 f;  2ZPI B;  4BDY A;  4L87 A;  3SFM A;  3A32 A;  3GPL A;  2CKK A;  5GAN 5;  1BI0 A;  4ME7 A;  3JCM c;  3JCM W;  5I2S A;  2LQK A;  4OLF A;  4PNO A;  4ZTU B;  2RHY A;  2B8A A;  5CO7 A;  3CCJ A;  3OYE A;  2O4X B;  4C8Q A;  4E7H A;  2DVE A;  3HFV A;  4M75 B;  4J6W A;  2MMP A;  3PFS A;  3CCQ A;  4YRO A;  5IAY A;  4YRI A;  2CYZ B;  2XIC A;  4LDU A;  4C5H A;  2ZZG A;  2KY9 A;  1NYR A;  4N0A A;  3JCM V;  1HTT A;  4LVI A;  4O5V A;  3EFR A;  5FRO A;  1VQ6 A;  4LDY A;  3MF2 A;  1G5I A;  4H2T A;  3N5B B;  5LJ3 e;  2ZZE A;  4P73 C;  2DO3 A;  4A4H A;  4DA4 A;  2LDM A;  3L2Q A;  4Y91 A;  4TVA A;  1G3T A;  3IAL A;  1W2B A;  3M4Q A;  1USY C;  2OTJ A;  1VQ7 T;  2E6Z A;  5GAN 6;  2CJ9 A;  1WLE A;  1PSE A;  3OMG A;  1UGR B;  4YRT A;  1U1T A;  4Z02 A;  3I55 A;  3L4G B;  4A4K A;  2IG0 A;  2QQA A;  4X5O A;  3HFO A;  1YCY A;  3VQW A;  2Q7H A;  4EX5 A;  2P5I A;  1BI1 A;  1L0W A;  4LVJ A;  2LCC A;  4XTY A;  2ZT6 A;  4F7U E;  4P72 A;  2QHV A;  3OYC A;  2EKO A;  3G4S T;  2A7Y A;  5HKC A;  5CQY A;  2RM4 A;  2ZPE B;  4P74 C;  4YDQ A;  3F70 A;  4BUG A;  2XG8 D;  1XTD A;  3P8Y A;  3QYH B;  2RJC A;  4M78 E;  4BD3 A;  3URG A;  5C53 B;  1Y96 B;  3CC7 A;  4HWS A;  2X4W A;  2LCL A;  1VQL T;  2V8J A;  2LQ8 A;  4NL3 A;  4RQE A;  2M0O A;  2X35 A;  2ZGW A;  3CCL A;  2PME A;  2L8D A;  4YRQ A;  3TRE A;  3QG1 A;  4G84 A;  1VQZ A;  2I4L A;  3OW2 A;  1YJW T;  3OYY A;  1NYQ A;  1EQR A;  1X6O A;  2M9U A;  3G7Z A;  3A7R A;  3S3O A;  2ZZF A;  2AHJ B;  2JTF A;  3UGQ A;  5GAN 3;  5CK9 A;  3HXY A;  4M7A D;  3P8V A;  3JCM X;  4QQG A;  4YRF A;  1SET A;  2A3L A;  2HQX A;  3HXX A;  2ZPB B;  4PLL A;  3A5Y A;  3OMC A;  3NEN A;  1NPR A;  4UP9 A;  4CH4 A;  4P3P A;  3QHS A;  3HXU A;  5FRN A;  3OYB A;  1KQ2 A;  3CPW A;  2QHT A;  3CC4 T;  4CS4 A;  1ASZ A;  3OSS C;  4BE1 A;  4LVL A;  5L8R E;  3V7C A;  2XDB A;  4DQ2 A;  4ZGE B;  5KH6 A;  5CKF A;  2DDZ A;  1EIF A;  5CVI A;  3QII A;  3I56 T;  4TVY A;  4YCW A;  3CCE T;  4ZIB A;  1EIY A;  3CXC S;  1YIT T;  3PTA A;  1IL2 A;  4N0A C;  2J3L A;  2VUB A;  3HRU A;  3CME A;  3MF1 A;  4YRC A;  1D3B A;  2KQW A;  4M7D F;  1ATI A;  4XTW A;  1VQN T;  4BI4 A;  5GAO r;  1YI2 A;  4IUV A;  5LJ5 g;  1XOV A;  3OYM A;  3GOX A;  1WPY A;  1JJ2 S;  3MET A;  1V29 B;  3M4G A;  4LDV A;  2DD5 A;  3VQY A;  3CMA T;  2RH2 A;  2I4O A;  2LX9 A;  3G1Z A;  2VXE A;  2DTH A;  2YLB A;  2O01 E;  4F7U B;  4M7D C;  2MWO A;  5HK3 A;  3OYA A;  4M7A E;  2VGM A;  2RA2 A;  1YGB A;  1WJR A;  4C0D B;  4M77 A;  2E5A A;  3QPH A;  2RHS A;  5DY9 A;  2JTM A;  4J83 A;  1NE8 A;  3JCM P;  5HK0 A;  2QDY B;  5GAN f;  2E41 A;  2XI9 A;  2ZZD A;  1LJO A;  4M78 B;  2OTL A;  4C8Q G;  1Q82 C;  4JRP A;  1LYL A;  2E65 A;  4HT8 A;  1RI0 A;  4FIB A;  1N8R C;  1VQ8 T;  3LSQ A;  3OYJ A;  1HC7 A;  2WSC E;  3FJP A;  4GLK A;  1SRY A;  5CKE A;  2DXU A;  1RL2 A;  4YRS A;  4H2X B;  3QJ6 A;  5IT9 E;  1N9W A;  3P8B B;  1N27 A;  4EMK B;  3FDR A;  2GFU A;  3M53 A;  1KOG A;  4MZM A;  4C92 F;  1WU7 A;  2ZIO A;  1GXI E;  1S72 A;  3MO8 A;  2YRV A;  1B34 A;  5IN1 A;  4HWT A;  2C7I A;  2E12 A;  3HHT B;  1H4V B;  3M59 A;  1N6A A;  4UP8 A;  3RF1 A;  5GAM f;  2G4C A;  4XTX A;  4LVM A;  1OI1 A;  2ZR2 A;  4HKE A;  4RMO A;  4YRM A;  1MHN A;  2P4T A;  4M75 F;  4X9C A;  4JUV A;  4NOY A;  4M7D G;  3QO8 A;  1KQS S;  1QF6 A;  2JZ2 A;  1WYD A;  4E7I A;  1U1S A;  2PUK B;  2RD1 A;  4B9W A;  4C92 C;  1KC8 C;  2DKG A;  3OYN A;  2LNV A;  4JS5 A;  3WVD B;  3RUX A;  1H3Z A;  1Z7M A;  5LJ5 h;  5LJ5 d;  4XU3 A;  4C8Q B;  1E22 A;  4BY6 C;  3UDC A;  3V7S A;  2AKW A;  4HWP A;  3BFM A;  4FM4 B;  4J6Y A;  4ELY C;  3OBY A;  1ASY A;  3LWI A;  4X34 A;  4P71 C;  3QBY A;  1H64 1;  3QSU A;  2CZ6 B;  1SER A;  2EQU A;  5GAM e;  3HKS A;  5GMK m;  2RHU A;  3JB9 H;  3VQV A;  3RGL A;  4EPC A;  3CBM A;  3LWH A;  1Q86 C;  1USY A;  3BDL A;  4YRP A;  4PHC A;  3FC3 A;  1G5H A;  3CCQ T;  3HXW A;  2ODR C;  3LGL A;  2EJ9 A;  3CPF A;  4J7F A;  2HNI A;  4N4I A;  2DZ9 A;  1E1T A;  4RG8 A;  1KD1 C;  3OYF A;  3DLL A;  2ZIN A;  4KR3 A;  4PL6 A;  1QP3 A;  1VQ6 T;  3ICA A;  1VQM T;  3LSS A;  3HRT A;  4K87 A;  3NFC A;  5LL6 S;  2CGH A;  4HA8 A;  1M90 C;  4ZTZ B;  4P3N A;  3VU3 C;  4ZGD B;  2YLC A;  1M1K U;  1H4Q A;  4P74 A;  3QDR B;  4JS4 A;  4WI1 A;  4LD6 A;  1JJC A;  2RK1 A;  1VQO A;  2I4N A;  4E51 A;  5CR2 A;  4J5Y A;  3RES A;  1ZHI A;  4E7K A;  3E9H A;  1VQK A;  2OTJ T;  1YJN A;  2X4Y A;  3ERR A;  1Q82 U;  4L5G A;  4RKU E;  4TQD A;  3VJP A;  4EMH A;  4H2S A;  3I55 T;  1B8A A;  4XTZ A;  2F5T X;  1WJQ A;  5GAO m;  4YP0 A;  1K9M C;  3JCM b;  4YPF A;  4ZN3 A;  3JB9 I;  4LDW A;  2ZCF B;  2NLU A;  3OY9 A;  1KQ1 A;  4PJO A;  3PNW C;  4H2U A;  4GY5 A;  3IKM B;  4IKF A;  3L1A A;  3JCM Q;  2MWP A;  2X4J A;  2LC4 A;  2K3X A;  5D6W A;  1FXX A;  3OYD A;  2OAU A;  2LT1 A;  2FB7 A;  4QVZ A;  4BE2 A;  1BBU A;  3CC7 T;  3G71 A;  5A2Q E;  4HCZ A;  1BBW A;  5GMK h;  4C5I A;  3A8O B;  4KUL A;  1VQ5 T;  3L2R A;  2Q5I A;  2DU7 A;  2F5K A;  3CCR T;  4J15 A;  1KC8 U;  4M77 G;  3A5Z B;  3A8M B;  4Y28 E;  4M78 D;  1U8R A;  1JRI A;  3CCU A;  2L89 A;  1ZQ1 A;  2RI2 A;  4JRK A;  3M5A A;  4YRE A;  1NJI C;  1B70 A;  1Y7X A;  4BI3 A;  4DOW A;  1X56 A;  3CXC A;  1EIY B;  4BB7 A;  11AS A;  3FLG A;  3ZBD A;  1Q86 U;  2V8K A;  2E70 A;  1D3B B;  2PVD B;  4IUR A;  2ART A;  3Q1J A;  5A0L A;  3A74 A;  1I81 A;  1YJ9 A;  5GAN 2;  5A0G A;  1X55 A;  3UT1 A;  2ZPF B;  2JN0 A;  1OZ3 A;  2HD0 A;  4WF2 A;  4M7D A;  3M55 A;  1JJ2 A;  2Y4X A;  3JCM f;  1KD1 U;  3MP6 A;  1NJ2 A;  1YB3 A;  3J81 E;  3CEY A;  4XTU A;  3CME T;  3JCM J;  5KE2 A;  3HFZ A;  1VQ4 T;  5LJ3 g;  2R5M A;  4C0Z A;  1M90 U;  3REU A;  1YI2 T;  4C0G A;  3NTI A;  4OGE A;  2RK2 A;  4M77 B;  2QEX T;  2RHS B;  3TU4 K;  4C8Q D;  4PJO F;  2QA4 A;  1H4S A;  3J7A F;  1YIJ A;  3MEV A;  2J3M A;  4RMF A;  4CS3 A;  5FU7 B;  4NCX A;  5I2M A;  2C06 A;  4KQE A;  1K9M U;  2QQR A;  1FX7 A;  4DOV A;  3JCM e;  5M9O A;  3CCM A;  5CKH A;  2M16 A;  2DJZ A;  2RI5 A;  4XAX B;  5K1P A;  4CH5 A;  3JB9 D;  1Q7Y U;  5FRM A;  2DIG A;  2R58 A;  4MZP A;  3VKI A;  3SWN B;  4PJO C;  2P0P A;  4G85 A;  5J39 A;  1XNI A;  5FLX E;  1BI2 A;  3RAC A;  4A4G A;  2L5Q A;  1EFW A;  1B34 B;  2XHC A;  3RKW A;  3L2W A;  1KMM A;  2DXC A;  2GF7 A;  3MEA A;  4N4G A;  3OS5 A;  4C92 A;  3A7A A;  4HT4 A;  2I2L A;  2DD4 A;  4X9D A;  1EVK A;  1DJ7 B;  4C5G A;  2ZIM A;  4C0F A;  1WNL A;  1O75 A;  1Y07 A;  2O4X A;  3UWN A;  1KQS A;  1NZ9 A;  1FWZ A;  3MHX A;  4RG2 A;  3OBW A;  1ADY A;  1QVF S;  3CBP A;  3LC0 A;  2MF2 A;  4CH3 A;  4M75 A;  2RJF A;  4P71 A;  1ADJ A;  3MCA B;  3A8L B;  3CC2 A;  4C8Q E;  2Q7E A;  2AKW B;  3VYG A;  3TEH A;  2CZ1 B;  1NJI U;  1VQ7 A;  3PGG A;  4B9X A;  3X25 B;  3OYH A;  5LJ3 h;  2DAQ A;  5LJ3 d;  4K86 A;  4KBM B;  4M7A F;  4K88 A;  2V8I A;  2K5F A;  4CS2 A;  1UGQ B;  1WJS A;  3DB4 A;  2P0K A;  4PJO G;  2PVG B;  3RKX A;  2QQS A;  3NEL A;  2RJD A;  2PU9 B;  2ZXF A;  3G4S A;  2D0Q B;  3PCO A;  2XD0 A;  3L4G A;  2KAF A;  2EQM A;  2XU8 A;  5DM7 R;  1M5Q 1;  2Y90 A;  3E9F A;  1M1G A;  2KDS A;  3TEE A;  1M1K C;  4JJN K;  3VUB A;  3V7R A;  3P8H A;  2E1H A;  1E1O A;  4IUP A;  2ALY A;  4ELZ C;  3KBG A;  4LDX A;  4Q6G A;  3DLM A;  1LNX A;  4HWR A;  4M7D E;  1PYS B;  2QHU A;  1VQL A;  1M4Z A;  1QP2 A;  3S6W A;  3I7F A;  4OGC A;  1JJC B;  1Q81 U;  1BKB A;  2BIV A;  3J80 E;  5LJ5 j;  1I5L A;  3PZC A;  3T9N A;  1UB4 A;  1M1F A;  5DLQ E;  2E10 A;  1W66 A;  4MDX A;  5EG2 A;  4C5E A;  4Q15 A;  4XU1 A;  1VIF A;  1BIB A;  3REX A;  2H3J A;  4J7I A;  3M54 A;  5J26 A;  1BI3 A;  2EWN A;  1NJ8 A;  4BW9 A;  1YFS A;  2C8M A;  2IY5 B;  3IG2 A;  3OA6 A;  2FHD A;  3TUP A;  1NPP A;  5DLO A;  1G3Y A;  3HP9 A;  2HBP A;  3CC4 A;  4ZTJ A;  3LW5 E;  3QO5 A;  4FT4 A;  4BE0 A;  3QUI A;  3GIB A;  5AYF A;  1G5V A;  3M58 A;  3X20 B;  1YIT A;  1X75 C;  2K5L A;  4ATO A;  1VQ9 A;  5HY6 A;  4M77 D;  1WGS A;  2ZT5 A;  2LTO A;  4C92 E;  4H2V A;  4H02 A;  2FVU A;  4HCB A;  4ZTF A;  2XK0 A;  5GAN 7;  5C52 B;  5C51 B;  3G71 T;  4M75 C;  5K1X A;  2A8E A;  5GAN g;  1UGP B;  4N4H A;  2YHT A;  5KCH A;  1W4S A;  1BYM A;  2QQB A;  2FYK A;  1QVG S;  3CCJ T;  2DTO A;  3VYH B;  3CD6 A;  3DSQ A;  3OSV A;  2QHS A;  4Q5W A;  3CMA A;  3M4P A;  1B70 B;  2RO0 A;  4YCV A;  4MMK A;  3NTK A;  4TTV A;  4KR2 A;  4KT0 E;  2DQ0 A;  3SB2 A;  2CZ0 B;  2MAM A;  4OVA A;  2M1H A;  4TVA B;  4V2S A;  1NJ5 A;  1K73 C;  4WJ3 M;  2G3R A;  2CS7 A;  2I4M A;  3QZ5 B;  3HRI A;  1KG1 A;  3WXM B;  5FU6 C;  2XGT A;  3HSB A;  5F5W A;  4F7U A;  3MP8 A;  1QVP A;  1NJ1 A;  4BDZ A;  4M7D B;  2IVW A;  4C92 G;  4L6V 5;  2RHQ A;  5GAM g;  3OYL A;  1I4K 1;  3OD1 A;  4OB2 B;  3HXV A;  4PKC C;  5GMK j;  3HFZ B;  3L2U A;  4P75 A;  4YRJ A;  4HVC A;  4M78 A;  3VV0 A;  4HWO A;  1E24 A;  5ELN A;  4R56 A;  3MEW A;  2CIM A;  3QKJ A;  2VGN A;  3L2V A;  4M75 G;  3V8L A;  4M77 E;  2WSE E;  3HY1 A;  3RER A;  3L42 A;  3OYG A;  4FL6 A;  3X24 B;  1B7Y A;  2E6N A;  3WVE B;  4P3O A;  1Q7Y C;  3BW1 A;  3M9Q A;  4O2D A;  5GAN 8;  1WQ7 A;  2DXB A;  3LX7 A;  2P0Q A;  4OB3 B;  5ELO A;  2QA4 T;  3CMQ A;  1YIJ T;  3O8V A;  2GQV A;  2JOY A;  2PUO B;  5C6S A;  5GAN h;  3FIF A;  5GAN d;  12AS A;  3E1S A;  2PQW A;  1X2H A;  3CCL T;  3QZ9 B;  3KUF A;  4BWA A;  3PMT A;  1VUB A;  3CCM T;  4XEM A;  4RDX A;  3CCS A;  4C92 B;  2VC8 A;  2KVQ G;  3CCV A;  2RHX A;  3HPW A;  2DEQ A;  5GAN 4;  4AH6 A;  4BY6 B;  1G3S A;  1X01 A;  4ZGJ B;  3E9I A;  4KUI A;  2ZT7 A;  2KMT A;  1QVF A;  2ARU A;  2HAX A;  3OYI A;  1SSF A;  4E47 A;  2E64 A;  4NS5 A;  4JLG A;  2EYQ A;  2K57 A;  2XID A;  5GAM h;  2ZPH B;  4XTV A;  5GAM d;  1K8A U;  3TEH B;  5GAO n;  3NEM A;  5GAO l;  2LVM A;  4RCC A;  2L3R A;  3V8J A;  1VQM A;  1PSF A;  4F7U F;  5A0D A;  4QQD A;  3E19 A;  4OB0 B;  5CKD A;  1BIA A;  2P0L A;  2QI2 A;  4PJO D;  3A31 A;  3CC2 T;  2AMC A;  2GCX A;  5CIU A;  4M7A A;  4M78 F;  1K73 U;  2QXF A;  2K2V A;  2Q5H A;  1XQH A;  1UEB A;  3H8Z A;  5CQX A;  5FU6 B;  3QXE B;  3MQZ A;  3INZ A;  3PCO B;  4RQF A;  2CJA A;  4YRR A;  3A8G B;  1HXD A;  3HXZ A;  1N9R A;  2JNG A;  1YHQ A;  4C0D C;  3HTZ A;  1Q81 C;  4J8O A;  2ALY B;  1VQP A;  1O9S A;  3JSC A;  3G6E A;  4P75 C;  3BY7 A;  3C4S A;  4M78 C;  3QO7 A;  1KMN A;  4FT2 A;  3JB9 J;  5CAI A;  3W3S A;  2DQ3 A;  3MP1 A;  4QVC A;  2CJB A;  2E3C A;  4JLI A;  1YBY A;  4D6W A;  4CI0 C;  1P92 A;  2XDP A;  1EVL A;  2FL7 A;  2Q7G A;  4VUB A;  2OTL T;  5LJ5 f;  2GFA A;  1IRE B;  2K4Y A;  1ZBX A;  3P8D A;  4EMK C;  5LJ3 j;  3PMI A;  3RIR A;  4LVK A;  3S3N A;  1VQ5 A;  4HCC A;  3GLX A;  2DK3 A;  3NTH A;  2ARS A;  4YRG A;  4MZT A;  3CCR A;  3HRS A;  3DKM A;  2XKO C;  3P8T A;  3RKY A;  4PJO E;  3VUZ A;  3OB9 A;  4OP0 A;  2ZNI A;  4MDW A;  1EOV A;  4C8Q F;  3LYI A;  2EJG A;  3MEY A;  2EL9 A;  4M7D D;  4IUU A;  3LGF A;  1S72 T;  4F7U G;  3JCM g;  4IUT A;  4II1 A;  4CRI A;  1YFT A;  4PLI A;  2BUD A;  4TQF A;  3PT9 A;  3A5Z A;  3UPU A;  3BJU A;  1M9S A;  5LJ5 e;  4M78 G;  3JB9 F;  2ZT8 A;  2F69 A;  2DPP B;  5C0M A;  2K5I A;  4C8Q C;  2JVV A;  4A53 A;  3FRN A;  1X54 A;  1IZ6 A;  4NL2 A;  3UH0 A;  5GMK i;  2ZPG B;  2RJE A;  1Y71 A;  4OF1 A;  2D6F A;  2NS6 A;  4UPA A;  3FEO A;  2LT4 A;  1QVG A;  2ZR3 A;  1M8V A;  2PVO B;  1OYX A;  2K3Y A;  4A54 A;  4XU2 A;  1VQ9 T;  1J5W A;  1UGS B;  1KHI A;  4IUQ A;  4XU0 A;  3GNG A;  3OS1 A;  4OMF B;  1W2B S;  4DPG A;  1VQ4 A;  2ZNJ A;  2R5A A;  1HK9 A;  1VIE A;  2QQ9 A;  2QTX A;  4XEO A;  2RHI A;  3X28 B;  1NJ6 A;  3LH0 A;  3GF5 A;  5J3B A;  4QVD A;  1GGM A;  2QEX A;  4TVR A;  2VYT A;  3C94 A;  3CD6 T;  4M7A C;  3IKL A;  4YYE A;  5HGQ A;  3HRK A;  2EFI A;  2HQE A;  4MML A;  3R07 A;  1LOJ A;  2X4X A;  4C92 D;  1AHJ B;  2JUF A;  4A4E A;  3JAM E;  4CH6 A;  1WQW A;  3AHU A;  2RHQ B;  2EIF A;  2PMF A;  4P5N A;  4LD9 K;  4E7L A;  3GP8 A;  3S3M A;  2EQJ A;  3PIO A;  1B76 A;  3E9G A;  1H4T A;  1N9S A;  4M75 D;  1YJW A;  4EDU A;  1Y96 A;  3BDU A;  4P72 C;  4O6J A;  4XK8 E;  2DZC A;  3NET A;  3JRZ A;  2KSS A;  3RMS A;  3ER0 A;  1OZ2 A;  4WJ4 A;  1VQO T;  3JCM h;  3JCM d;  3HY0 A;  1VQK T;  3FB9 A;  4JRI A;  1YJN T;  1B7Y B;  4YRK A;  4A4F A;  3M57 A;  3OW2 S;  3JB9 G;  4PJO B;  3SWN A;  4LNS A;  5KE3 A;  2LRQ A;  2VXF A;  2ODR D;  4J6X A;  2E5Q A;  4BI8 B;  3KFU A;  4KUD K;  2RB6 A;  4M7A G;  5GAN e;  2EAY A;  4EMG A;  3QJY A;  3CBO A;  2CZ7 B;  3I56 A;  5D6Y A;  1YFR A;  5GMK e;  3CCE A;  3HL8 A;  3DB3 A;  1SES A;  4H2W A;  3CPW S;  1FYF A;  1KHC A;  4OB1 B;  4JDS A;  2D9T A;  1RIQ A;  1X2G A;  1VQN A;  4EO4 A;  2R57 A;  3RMQ A;  4JRQ A;  3KXT A;  3SDZ A;  2BKD N;  4FSX A;  5I21 A;  3TEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...