1WNLA

Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3 in complex with adp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Crystal Structures of Biotin Protein Ligase from Pyrococcus horikoshii OT3 and its Complexes: Structural Basis of Biotin Activation
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 66
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2004-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1wnlA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1wnlA01
2FYKA 1G51A 1X55A 4M75E 3A32A 3IALA 4QVCA 4P74A 2YLBA 4M77A 3JCMP 2Q5HA 3JCMQ 1X56A 3JCMc 3PGGA 2Q7HA 1WU7A 5GMKh 4HT8A 3PCOA 4WI1A 3VQWA 4YROA 2YHTA 3JCMh 4P72C 3DSQA 4YYEA 4YRIA 2EWNA 4UPAA 3W3SA 1SRYA 1I8FA 3JB9D 3MF1A 4M75C 4M78E 3TEHA 4M75D 3L4GA 1YGBA 1E22A 4P3OA 3QTCA 5GAOl 2DVEA 3FIFA 4MMLA 4K88A 4P72A 3WQZA 4V2SA 1X54A 1NYQA 4DQ2A 5GANf 1YB3A 3UGTA 2AKWA 5LJ5f 2I4LA 2ALYA 3A5YA 2E41A 2YLCA 4NL3A 4M75A 3R07A 4J6WA 4XTVA 1KOGA 2ZT5A 5GAMf 4XU0A 3HXWA 4F7UG 2DTIA 4J15A 1W66A 3UH0A 4TVWA 4CS2A 4M78C 4C8QE 5GAN7 3V8JA 4M78D 4N0AA 3EFSA 2ARTA 4HWOA 2EJFA 2VXEA 4BWAA 4PJOA 3M4PA 4C92A 4HT9A 3VQVA 2Q5IA 3P8YA 2JN0A 3PZCA 3UGQA 5GANg 1Y96B 3NETA 1LNXA 2RD1A 5LJ5g 1PYSB 2P0LA 3CMQA 4Q15A 4ZIBA 4YRJA 1M8VA 5GAMg 1WQ7A 4M7AE 5GANj 2EL9A 1YFSA 4H2XB 4C8QC 3MEYA 3SWNC 4C8QD 2RHQB 5GAOr 3QHSA 2DKGA 3JCMe 1G5IA 1HTTA 4M7DE 1J5WA 3QNEA 4MMKA 2ZIOA 2K57A 3SB2A 3M4QA 4F7UF 4P71C 2DTOA 3RACA 5LJ3d 4C8QA 2ZINA 2ZNJA 3QO8A 4M78B 2ZNIA 2IY5A 5C51B 5LJ5d 4M7AC 4M7AD 4NL2A 5GAMd 4XTUA 1H4VB 1LYLA 4YRPA 2ZIMA 1EIYB 4TWAA 3E9HA 1HXDA 4M77G 2E65A 2DXUA 5GAN3 4M7DC 4TVYA 2E64A 3NELA 4M7DD 4G84A 4H2SA 4XTWA 4H02A 2PMFA 4X9CA 3HFZB 4JRKA 1VQZA 4YRNA 4YDQA 1KQ2A 1BIBA 4UP9A 3GIBA 1KMMA 2ZZGA 1Z7MA 1EFWA 4Y91A 3SWNB 3JB9I 2ZZEA 4XU2A 3RUXA 4YCVA 3ERRA 4KQEA 2DJZA 4YPFA 3VU3C 4P75A 1QF6A 12ASA 1X01A 1JJCA 1B7YA 4YRGA 4EMGA 4AH6A 1H641 3RIRA 1U1SA 2DZCA 2J3MA 3JB9G 1B76A 2DQ0A 4X9DA 4M75G 2XTIA 4H2UA 1C0AA 4M7AB 2QHVA 1L0WA 4M77F 1WPYA 4DPGA 4PJOE 4TVAA 3REUA 2ZT6A 3BDUA 5GAOn 2RHSB 4C92E 4M7DB 1EVKA 1NJ1A 4CH3A 2CJBA 4H2VA 4X5OA 1ATIA 3HY1A 2E1HA 5F5WA 5LJ3f 4XU3A 4M77B 4XQ3A 3RERA 3HXZA 4K86A 4YCUA 4WJ3M 1LJOA 4A54A 4P3PA 1B34A 2ZTGA 4P3NA 4M78G 1QE0A 4BW9A 3BFMA 4N0AC 2QHSA 3TUPA 4UP8A 4KR2A 3M4GA 4PJOC 2J3LA 4YP0A 3PCOB 4PJOD 2E5AA 4H2YA 4C92C 2QHTA 4C92D 3RKYA 3JB9F 4ZTZB 2DDZA 5GMKm 4YRFA 4M75F 1BBUA 3P8VA 5GANh 3LSSA 3JB9J 4HVCA 4OP0A 3TEHB 3L4GB 3KFUA 1EVLA 4H2WA 1HC7A 5GMKi 3QO3A 5LJ3g 4C8QG 4RDXA 2EAYA 3HRIA 5C53B 4J5YA 2AKWB 1H4SA 1BIAA 2I2LA 2ALYB 4PJOF 5LJ3j 4M75B 2EJGA 4TQDA 1NNHA 2DTHA 5I21A 3RKXA 3UFGA 1FYFA 4PNOA 3RGLA 5LJ5j 3G1ZA 3LSQA 4M78F 3MF2A 3AHUA 5GAMj 3JCMd 2E3CA 1E24A 2HNIA 5DY9A 4M7AG 3V8LA 3L2ZA 3OD1A 1JBMA 3I7FA 4PJOB 1SETA 3A7UA 3INZA 4EMKA 4NCXA 4YREA 3JCMJ 1G5HA 4O2DA 4C92B 4JLIA 4M7DG 4E51A 4YRTA 4WF2A 2ZCEA 3HTZA 1EIYA 2ZT8A 3FB9A 2I4NA 4F7UA 3RF1A 4CH6A 2RB6A 3L1AA 1LOJA 1EOVA 2QHUA 4C8QF 2ZR2A 3V7SA 4HWRA 1BBWA 3JCMV 4WJ4A 1GGMA 2I4OA 3A74A 1SESA 3JCMb 3BW1A 3BY7A 1U1TA 1D3BB 2E10A 2DU7A 5K1PA 5K1XA 4EO4A 3IKMB 1MGQA 4P75C 2CJ9A 5GANe 4P73A 5ELNA 2DXTA 4L87A 5LJ5e 1E1OA 4EMHA 4C8QB 1USYA 5GAMe 4YRMA 4JRIA 4M7AF 4YRSA 3QO7A 2IY5B 3IG2A 1JRIA 4EX5A 3QSUA 1M5Q1 1NJ6A 2FB7A 4M7DF 4PG3A 4XEOA 5GAOq 2QTXA 1N9SA 1X2GA 1B70B 2DZ9A 5GMKl 5GAN4 2ZZFA 2VC8A 3HFVA 4RCCA 4YRLA 2ZR3A 3V8KA 2Q7EA 3JCMf 3RESA 2I4MA 2DU5A 2AMCB 3A31A 2RM4A 3VBBA 4OLFA 2ARUA 2DQ3A 2Q7GA 4PJOG 2C8MA 4C92G 1JJCB 4YRQA 1B7YB 3V7RA 3TEGA 4RCBA 1KQ1A 3RKWA 2PMEA 1B8AA 3QUIA 4RMFA 3VQXA 4CS4A 4XTZA 4Q6GA 4ZTUB 4XU1A 3HFOA 1NJ2A 4J6XA 4XTXA 4TVAB 4NOYA 1KMNA 2ODRC 1ADYA 3JCMg 3VQYA 5LJ3h 1Z7NA 1WYDA 2ODRD 2CGHA 3EFRA 1H4QA 5GMKj 1WNLA 2ARSA 1ASYA 3QO5A 1WQWA 5LJ5h 4F7UE 2ZT7A 1Y96A 4G85A 3HXVA 1PYSA 5GAMh 2VXFA 1NJ8A 2CJAA 2P5IA 3NENA 2ZGWA 3RL6A 5GAN8 1N9WA 5GAOp 3HXUA 1H4TA 1B34B 4H2XA 4CH5A 4JUVA 4J6YA 4XTYA 3HXXA 2G4CA 2RHQA 3HFNA 3REXA 4CH4A 1HK9A 3P8TA 4C92F 4TTVA 4EMKC 3NEMA 1WLEA 1EQRA 4UP7A 3LC0A 1NJ5A 1NYRA 4YCWA 3HY0A 3HSBA 3FJPA 4M78A 1I4K1 2XGTA 5GAN5 1E1TA 5GAOm 2RA2A 2CIMA 4XEMA 4CS3A 1SERA 5E3IA 5GMKe 1I81A 4HWPA 4HWSA 1I5LA 1RIQA 3BJUA 3JB9H 1N9RA 1TH7A 2DEQA 4P73C 1D3BA 4K87A 3HFZA 1X2HA 4H2TA 4PHCA 1USYC 5KNNA 1YFRA 3HRKA 3JCMW 2C7IA 5LJ3e 4A53A 4M77E 3SWNA 5GANd 4HA8A 4EMKB 3HXYA 3JCMX 4LNSA 4P71A 4F7UB 4YRCA 4YRRA 4TQFA 1B70A 3IKLA 1YFTA 11ASA 2ZXFA 3A7AA 2EJ9A 5GAN2 1IL2A 4M7AA 1ADJA 4KR3A 3V7CA 3A7RA 4YRKA 2Y90A 4P74C 5GAN6 4M77C 4RQFA 4QVDA 4M77D 2RHSA 4M7DA 5CAIA 4RQEA 2AMCA 3A5ZA 1YCYA 3ICAA 1ASZA 4HWTA 5C52B 3E9IA 5ELOA 5HGQA
chains in the Genus database with same CATH superfamily
4F17A 3VKIA 4M77A 4P5NA 3JCMQ 2ABLA 3EG2A 3JCMc 3PGGA 1WU7A 3CBMA 3UA6A 1F1BB 2F1LA 1ZBXA 1OU8A 3FEOA 2R57A 3PCOA 4YROA 2YHTA 1UUEA 3JCMh 2GCXA 2EQIA 2H3JA 4UPAA 2L3RA 1SPKA 1NYFA 1XTDA 3MF1A 3L4GA 1VQPQ 1ZSZA 3VS1A 1QVGP 4MMLA 3EFOA 1NZ9A 2HDAA 1TS9A 4DBHA 4PFZA 4DQ2A 2YRVA 1YB3A 2O4XB 2ALYA 3A1PA 2F2WA 4M75A 5FU7C 4J6WA 4NL3A 5CIUA 1WYXA 3R07A 5GAMf 1TU0B 3M54A 2YUPA 4XAXB 1JJ2S 3CC2A 2MYSA 3GLXA 1PRMC 2EW3A 1ZBJA 5CKFA 3CC7Q 4N0AA 2O9SA 2HQEA 3P8DA 2RMOA 5AYFA 3OSVA 2DO3A 2HKNA 3UDCA 2Q5IA 4FYXB 3P8YA 1KJWA 1ZA1B 1OYXA 1Y96B 3MEVA 3CCET 1PYSB 2P0LA 4ZIBA 1TUCA 3S3NA 4YRJA 1M8VA 3H8ZA 2O2OA 3M4YA 4E7HA 3I55Q 1M1KU 3CCJQ 3R6NA 4C0ZA 4DA4A 1VIEA 3SWNC 4QQGA 1WZOA 1G5IA 3MJXA 1Q82R 1J5WA 3QNEA 3QG1A 3CXCS 2COYA 3S6WA 2K57A 4F7UF 2DTOA 2JNGA 2DJQA 3OYDA 1NBEB 5GJWB 2ZINA 1UDLA 5FW9A 4GLKA 1NEBA 4M78B 4HVWA 1YP5A 4LVLA 2ZNIA 2D8HA 3OB9A 4M7AC 2GFUA 4NL2A 5GAMd 1H4VB 4TWAA 3E9HA 1HXDA 1MV0B 4E7KA 4E47A 2DXUA 5GAN3 5CQYA 2E64A 1M30A 3IQLA 1QP3A 2AK5A 4H2SA 3G7ZA 3M55A 4H02A 3QYGB 4F16A 1KIKA 2FO0A 4ME7A 1VQZA 2LX7A 3QPHA 4UP9A 2W10A 3Q1JA 2L3PA 3LW5E 1YIJT 4YPFA 2CDTA 4EIKA 1VYTA 2E4HA 2QEXT 1VQ5A 4A4EA 1B7YA 3QWXX 4AH6A 4HVUA 4LDVA 1H641 2KEAA 2DZCA 2J3MA 1SSHA 1GFDA 3M0UA 4HVVA 4X9DA 1C0AA 2XTIA 1JU5C 1L0WA 4DPGA 4PJOE 4TVAA 1OOTA 2J6FA 4PJJA 3C4SA 5GAOn 2QG9B 2QQAA 4C92E 4M7DB 1EVKA 1NJ1A 1AEYA 1PHTA 2CJBA 4H2VA 3EHQA 1WXBA 1H8KA 4GLMA 2RQRA 4DOVA 1ABOA 2ZAEA 4M77B 3RERA 3HXZA 1D0YA 2M02A 2NUPA 1LJOA 1Q7YC 4P3PA 1QCOA 1UE9A 1Q81R 3F70A 2QHSA 3NTIA 4K11A 3REAB 3C0CA 3PCOB 3HRSA 4PJOD 1W6XA 2QQSA 4C92D 1W1FA 1OX9A 2VWFA 4ZTZB 2DDZA 3HL8A 5GMKm 4YRFA 4WCIA 2EYXA 1N8RU 4HVCA 3L4GB 3BE3A 3KFUA 2AT1B 3P8HA 1ZSZB 4J9EA 1G83A 5GMKi 3QO3A 3EFOB 1UGSB 1K0SA 4OB3B 2I2LA 2ALYB 2K6DA 4M75B 1VQPT 3CD6Q 4Z89A 1NNHA 2DTHA 3OW2S 4TQDA 2E3HA 2ZPEB 3PIOA 1FYFA 4JLGA 4ZGDB 1H3HA 5LJ5j 3VRZA 3QDFA 3AHUA 3THKA 1AD5A 1MNDA 2HNIA 5DY9A 3H0FA 5KCOA 4M7AG 3CBOA 2KXCA 1QVFS 2D0NA 2MI6A 4EMKA 1Q86C 4AG1C 4O2DA 3URGA 4E51A 4YRTA 4WF2A 2PVDB 3CC7T 3I35A 4EDUA 3RF1A 1M90R 1AWXA 1M2VA 4CH6A 3I5RA 1TUDA 2EKOA 1QVFP 1K8AR 1D0ZA 3CMEA 2QHUA 3V7SA 4F04B 2ATCB 2CSQA 2VYTA 3JCMV 4WJ4A 2CH4W 1GGMA 2KRNA 3UATA 2I4OA 3A74A 3CCLQ 1QKXA 1SESA 2E10A 3VS5A 3CCEA 3TQ7P 1BI1A 5KYXA 5GANe 1RAAB 3I55T 3CCJT 4BACA 5FU6B 4P73A 2DXTA 1UEBA 4EMHA 3GNGA 1OZ3A 2C06A 2JTFA 2O9VA 1IHWA 2DL5A 5EC7A 2K5IA 2L3QA 3ULRB 2MF2A 1C1AA 5KYUA 3CMAQ 2OTJQ 1M5Q1 1TUGB 2FB7A 1GCQA 3X20B 4XEOA 2CP0A 4A4GA 1QWFA 4XK8E 1B70B 2O01E 3QYHB 1UGQB 1WGSA 8AT1B 1R0BG 2FRYA 1MMGA 2ZR3A 1K9AA 1JJ2A 3V8KA 2BIVA 1OULA 2RM4A 5IT9E 3PT9A 4FSXA 5IHKA 2JTEA 2OAUA 3VS0A 2DETA 4ORZA 2BE9B 4OB2B 3A8LB 1OEBA 1B7YB 3M53A 3H41A 3OS5A 1RL2A 1SRMA 2KBTA 3RKWA 2VVKA 4E7ZA 3QUIA 4RMFA 3M56A 4XU1A 1NJ2A 3JRZA 2LQKA 4TVAB 1KD1U 2QEXA 2KR3A 2KVQG 1KMNA 3LWHA 5LJ3h 1WYDA 1FMWA 4AFZC 1R8OB 4MDWA 1ASYA 3OYJA 2ZZDA 4BY6C 4C0DB 5J26A 1WQWA 1JQQA 3CXCA 1Y7XA 2ZT7A 1V29B 3CPWP 3HXVA 2IG0A 4RTTA 3G71Q 2P5IA 1AT1B 1Y57A 3RL6A 1VQNQ 3UF4A 3M0SA 2NUPB 5C0MA 1I0CA 3BDLA 4JS5A 3HRUA 3CQTA 1VQ5Q 1TOVA 1H4TA 3OS1A 4JUVA 4H2XA 1M2OA 1RLPC 3HFNA 2CREA 4CH4A 4A63B 4OF1A 1QCFA 1B07A 4C92F 4BDYA 1WLEA 4UP7A 4BUGA 1DJ7B 3MP6A 2V26A 1M4ZA 1Q82C 4M4ZA 1IGUA 2KT8A 2MIOA 2DLPA 5GAN5 3QKJA 2CIMA 7AT1B 2XDDA 5A2QE 2HAXA 3AT1B 2GQVA 5GMKe 1NJIR 1I81A 2ED1A 3P8BB 4HWSA 2ECZA 1RIQA 3BJUA 3JB9H 1N9RA 1OPKA 1G3YA 2JXBA 2V8IA 3HFZA 4H2TA 4PHCA 1OX8A 1B3QA 3HRKA 1YJWQ 3CD6T 4KRTA 4AFSC 3MPUB 3OYNA 4ZTJA 4X34A 4M77E 3SWNA 2ENMA 5C6SA 1VQ9Q 3LH5A 2RF0A 5FWCA 5GANd 1VQPA 4HA8A 4EMKB 2G3RA 4PJLA 2DD5A 4KGXB 2SRCA 3PTAA 5D6WA 2DIQA 3PMIA 3I5SA 4TQFA 2HMAA 2FG0A 1KK7A 2ZXFA 4M7AA 5FROA 3EG1A 4PFOA 3OYBA 2FHDA 2O88A 2Y90A 2DYIA 4QVDA 4M77D 3CC7A 3FRNA 2LZ6B 2E70A 5KYXB 3SD4A 3E9IA 2LMJA 2I0NA 5HGQA 1SSFA 2FYKA 3CCLT 1G51A 4M75E 3IALA 2M51A 4PFPA 4QVCA 1YBYA 4FL6A 2EIFA 4LNPA 2P84A 2Q5HA 2J6OA 2DBKA 3QBYA 4C0FA 1WA7A 2D1XA 1CSKA 2WSCE 5KYUB 3OYLA 2Q7HA 4QQDA 4FU6A 5IN1A 1GBQA 2LC4A 3I55A 2FPEA 5GMKh 3CCJA 1SHFA 3GOXA 1KG1A 3VQWA 2IVWA 1X6OA 1LVKA 4P72C 3M0TA 2EYYA 3DSQA 1Q81C 1RABB 3CMAT 2QQRA 2OTJT 4ATOA 3OW2A 1G3SA 1I8FA 4DBRA 1GRIA 4M75D 5FLXE 4LE9A 2RJCA 4K88A 4KULA 1P92A 4V2SA 1ZUKA 1N8RR 2BTTA 2P4TA 2M0YA 3UGTA 2AKWA 4HCCA 2I4LA 2E41A 4QQ6A 4XTVA 3NPFA 1WJQA 2ZPIB 5CR2A 4F7UG 3QZ9B 1RAGB 2DTIA 4J15A 1W66A 2GTJA 4KH0B 4CS2A 1Z9ZA 1AWWA 3EFSA 2ARTA 4JJNK 2VXEA 4BWAA 4B9XA 3M4PA 1OPLA 4HT9A 1RADB 2KT1A 3H9NA 3PZCA 2OTLQ 5GANg 1LNXA 2RD1A 4Q15A 1C6VX 2EL9A 4E6RA 5FRMA 4H2XB 1YJNQ 4JRQA 1M90C 2C0IA 1NM7A 3JCMe 3G71T 3REBB 1K8AC 1GFCA 2RJFA 1VQNT 3HKSA 4MMKA 3RDVA 5FU7B 1VQ5T 3L2UA 4P71C 3RACA 2VGMA 2EGEA 4PLIA 1VQKQ 4C8QA 2ZNJA 1KFZA 2IY5A 5C51B 1NYGA 4RG2A 1TTHB 2C0OA 1LYLA 1AZEA 3T9NA 4ZTFA 1M8MA 3NELA 3UA7A 2HL5C 2JS2A 2K5LA 2CUDA 5KH6A 1D1AA 4X9CA 2CSIA 3HFZB 6AT1B 4N4GA 2NLUA 2EQUA 2E5KA 3GIBA 1KMMA 2K2VA 2WACA 1KQSS 4Y91A 3SWNB 4HCKA 2GQIA 3EGXA 1VYVA 1EIFA 2QK0A 3LLRA 3FC3A 4KQEA 4A4HA 4JZ4A 2DAQA 2EYZA 1YJWT 2HKQB 4EMGA 3OA6A 4BE2A 2DYBA 3ER0A 1VQ9T 1KQSP 1U1SA 2DL3A 2PQWA 1YWOA 3CD6A 1VQOQ 1Y0MA 2DQ0A 2W0ZA 2RHZA 2A7YA 4M7AB 4R55A 2K5FA 3PMTA 4M77F 4AT1B 1QVGS 1AZGB 3R6OA 1I5OB 1QMCA 2ZT6A 3BDUA 2X3XD 3HP9A 1R77A 4CH3A 4RG8A 3J81E 2VV5A 4QVZA 2DBMA 1ATIA 3HY1A 4GY5A 1KD1R 2QAZA 1M27C 3UWNA 5F5WA 4IUVA 4XQ3A 3EHRA 1AOJA 1UHFA 1B34A 1VOMA 2RJEA 5DM7R 1RAFB 4BW9A 3TUPA 2M0OA 3M4GA 1PD1A 4PJOC 2J3LA 2DE0X 4YP0A 1YN8A 3CCLA 4H2YA 4C92C 2OX7A 1CKAA 1WJRA 2QHTA 3GF5A 3RKYA 1IGQA 1ZQ1A 4M75F 3LSSA 3CMET 3CCQQ 1VQMQ 4OP0A 2FZGB 4D8KA 2D9TA 2K3XA 3SDZA 4DBFA 1HC7A 2JUFA 2QGGA 2PUOB 3CMAA 5C53B 2AKWB 3HHTB 2OTJA 1IXDA 3VRYA 3VS6A 2AIRB 2GF7A 1NJIC 2ZPHB 1EFNA 5GAMj 3JCMd 3TVTA 2RHUA 2GFAA 3QXEB 3V8LA 1UHCA 2NUZA 3CCUQ 3OD1A 1NLOC 3OSSC 1UTIA 3I7FA 4YREA 2O31A 2CH4A 3QJ6A 5I2MA 2CP5A 2KRMA 1UFFA 1H92A 1EIYA 1JXMA 4F7UA 1BCMA 1PWTA 2DM1A 2X4WA 3CCMA 2RB6A 3L1AA 1M9SA 5CKDA 1LOJA 3CCSQ 4R0KA 4HWRA 1SKUB 1BBWA 4RMOA 2OTLT 4OMMA 1W2BS 3BW1A 3LH0A 2MCNA 1U1TA 4OMNA 3OYHA 4J9CA 2LCCA 2LX9A 2EPDA 4EO4A 3M9QA 2CJ9A 4P75C 3KBGA 1D1BA 1YJNT 4ESRA 5LJ5e 5CKHA 4UC4A 4C8QB 1W2BP 4OMOA 5M9OA 4YRSA 2IY5B 3G71A 1JRIA 2JS0A 3QWYA 4EX5A 3QDRB 4J9GA 1VQNA 2P0KA 3QSUA 2DEUA 1WHHA 1VQKT 3CPFA 1WDXA 2ZCFB 2AKKA 2M9UA 5GAOq 1FMKA 1N9SA 2V1QA 1HSQA 4HKEA 1D0XA 1X69A 2DZ9A 5GAN4 1K1ZA 2VKNA 2QDYB 2L2PA 1QP2A 2DRMA 1X27A 5KYWA 4BE0A 1ZLMA 2Q7EA 2A08A 3MP8A 2XD0A 3UT1A 2CS7A 1PM3A 3OMCA 2YDLA 2A28A 2QDLA 2AMCB 3EGXB 3A31A 4X1VA 2Q7GA 1SF9A 3C12A 4PJOG 1ACMB 2C8MA 1U8RA 4DEXA 4KUIA 2K3BA 4C92G 4YRQA 2FVUA 2LT4A 2RO0A 2JZ2A 1KQ1A 1N8RC 2XDBA 2PMEA 1XNIA 2CZ0B 2V1RA 4ZTUB 4MZPA 5I11A 1WJSA 1YWPA 3OYAA 1YJWA 4J8OA 1G5VA 1D1CA 3C95A 1SEMA 3JCMg 2ODRD 3WXMB 1VQ9A 3OMGA 2HBPA 1WNLA 3QO5A 5LJ5h 2YRCA 2H8HA 4D6WA 3WVDB 4G85A 1HJDA 4JJDA 3J7AF 2CJAA 3EAEA 1NJ8A 3EG0A 3NENA 3A8HB 5LL6S 2HZYA 2NWMA 2DL4A 1WHGA 1B34B 2KXDA 4CH5A 4J9IA 4J6YA 4XTYA 2QASA 2G4CA 2RHQA 3OYKA 1G3WA 3ZBDA 2RQVA 2COZA 2A0FB 1YHQQ 1NYRA 3CCVQ 2OI3A 2COWA 1B7TA 3ZL7C 1I4K1 2XK0A 4DBQA 1GCPA 3DKMA 4XEMA 2BUDA 2IPOB 4CS3A 1TSFA 2RI2A 1QVPA 2A37A 5E3IA 1AVZC 3CCQT 1QWEA 1VQMT 1VQ4Q 4PL6A 4BY6B 1ZX6A 3LWIA 2FRWA 1D3BA 8ATCB 1WHJA 2YRDA 1Z9QA 4RUGA 1X2HA 2QYZA 2DVJA 2PU9B 1V76A 3M57A 3GPLA 1BI3A 2F2VA 4A53A 5LJ3e 1PCXA 2RHXA 2K2MA 1QVGA 2FZCB 2E12A 1Y07A 5CK9A 3HXYA 4E7LA 3ME9A 4P71A 2YUNA 2LDMA 4F7UB 3G4SQ 3TCJA 3CCUT 1PSEA 1PC0A 1IB8A 3IKLA 1YFTA 2B86A 1ADJA 1RLQC 3OS2A 4JRPA 4KR3A 1PKSA 3V7CA 4BD3A 5KYYA 4YRKA 4M77C 3HTRA 4RQFA 4C5HA 3A5ZA 4FM4B 1KHIA 2B8AA 3VS7A 2KSSA 4KGZB 3M58A 2OTLA 4P74A 1IREB 1KD1C 4ELYC 2EKHA 1YJNA 2XKOC 3CCMQ 3G1JA 2FPDA 3N5BB 3RR6A 5A0DA 4WI1A 5I2SA 3PIPA 2V8KA 4YRIA 2EWNA 2J06A 2CP7A 1YITQ 5D6XA 1SRYA 3CPWS 3JB9D 3CEYA 4M78E 4M75C 3KUFA 3TEHA 1RACB 5KYWB 1YGBA 1VQKA 1E22A 2RPNA 3JAME 3FIFA 1K73U 3MP1A 3WQZA 1X54A 4DOWA 4ZN1A 4E2FB 5GANf 4ANJA 4IUTA 4EPCA 4XU0A 4D8DA 3UH0A 1RUWA 4L5GA 3NTKA 4C8QE 5GAN7 4M78D 1S72Q 3EGDA 2CP6A 1M1KR 2EJFA 4PJOA 1ZUYA 2LNVA 3NFCA 4RTVA 4C92A 2XDPA 3VQVA 2EQJA 3NETA 5LJ5g 2R5MA 3CMQA 2ED0A 3CCRQ 1WQ7A 2EFIA 5FU6C 5GANj 2RHIA 2KROA 1VQOA 1YFSA 3OYGA 1N5ZA 2DNUA 2VASA 3DLMA 4C8QD 3WVEB 2RHQB 3QHSA 1BI2A 2DKGA 2GNCA 2L8DA 1HTTA 4M7DE 4HCBA 3G6EQ 1RI0A 1MMAA 4JJBA 3DLLA 2AZVA 1WHMA 5ECAA 3SB2A 5FWBA 3X26B 5LJ3d 4PKCC 2JW4A 2LT1A 3X28B 1WX6A 3OQ5A 1K9MU 1YHQT 1XJWB 3RMQA 3CCVT 2MAMA 4AMCA 4M77G 2Y4YA 4LVJA 2RI3A 5DLOA 1OU9A 1X6GA 4TVYA 1M2VB 4M7DD 1H3ZA 2BZXA 4G84A 4XTWA 2X4YA 1K0XA 2PMFA 4JRKA 2LJ1A 3D7SB 1VQ4T 4YDQA 2IIMA 4IUQA 5CVIA 4C0GA 2ZZGA 1YNZA 3CCQA 1VQMA 4LVKA 4N4IA 3JB9I 5HK0A 2ZZEA 4XU2A 3A98A 4YCVA 3ERRA 3DB3A 3VU3C 4P75A 12ASA 2DPPB 1X01A 1JJCA 2M1HA 3RIRA 1MUZA 2DIGA 4QKUA 1HYOA 1B76A 3RNJA 4M75G 3J80E 2EVRA 1PKTA 2RK1A 3ZEHA 1BU1A 2QHVA 1MMDA 1YCSB 3G4ST 1FXXA 2JT4A 3CCUA 1BCOA 2EGCA 1X75C 4OMFB 2O4XA 2BKDN 1KC8U 1UG1A 2CT3A 1TG0A 1UB4A 4K86A 4WJ3M 2BZ8A 2YXYA 1XQHA 4A54A 4P3NA 4ZN3A 1QE0A 2KMTA 1QVFA 1MHNA 3BFMA 3CCSA 4KT0E 2ESWA 4LDUA 2E5AA 3TSWA 4LDWA 3JB9F 3VV0A 1W4SA 2CKKA 3A8GB 2D0QB 3CCMT 3OBYA 1Q95G 3JB9J 4LDXA 3L42A 3TEHB 3A8MB 2L0AA 1E7OA 4AFUC 4CC3A 4OGEA 5I22A 2MWOA 5LJ3g 4RDXA 1YITT 1I07A 3OYCA 3NTHA 4OVAA 2XIDA 3HRIA 3GP8A 1H4SA 4VUBA 3I56A 3X25B 2EJGA 5I21A 3MKDA 2CYZB 3I9QA 3UFGA 2DILA 2PVOB 5IXBA 2HQHA 4ZNXA 3LGFA 1ZHIA 3LSQA 4M78F 1G8XA 3MF2A 2GGRA 2LQNA 2DD4A 3C94A 2K79A 3EGDB 1AWJA 4PJOB 3A7UA 3INZA 4KBMB 5A0GA 1G5HA 1A0NB 4C92B 4JLIA 1T0HA 2HCKA 2RJDA 3HTZA 2XHCA 3MEWA 2ZT8A 1S72T 4L59A 1NLPC 1BKBA 4CC4B 3NHNA 2RH2A 1TXQA 1NE8A 1OZ2A 2K4YA 2K7AA 1EOVA 3H0HA 4C8QF 2ZR2A 1WLPB 4FSSA 2CZ7B 2QTVA 2EQKA 5IHNA 2MOXA 3JCMb 3CCRT 3BY7A 3NMZC 4FT2A 3PVLA 3IKMB 1MGQA 4CRIA 1M90U 4L87A 1E1OA 5GAMe 4TVRA 2J6KA 5CQXA 3G6ET 4YRMA 2C0TA 4JRIA 1LCKA 3QO7A 3CPWA 2XU8A 4O6JA 2JM8A 4Y28E 2FEIA 1NJ6A 4RTUA 4M7DF 5D7UA 2QXFA 2KI7A 1N6AA 3OYEA 2QTXA 1X2GA 4J9HA 2KNBB 2RHYA 2VB6A 4MDXA 1WIEA 1YI2Q 2ZZFA 2JTMA 3TEEA 4AG2C 1EZZB 1FX7A 1VA7A 2JMAA 4RCCA 1YHQA 4IKFA 3CCVA 3PVQA 3JCMf 3HPWA 4CI0C 3OY9A 1X43A 2LNHB 3RESA 2DU5A 2P4RA 1ZA2B 4OLFA 2ARUA 4E7JA 4HXJA 2DQ3A 2X3WD 2OAWA 1QQJA 1JJCB 3EG3A 3V7RA 1K73R 1X2KA 1VQ4A 4BI3A 1B8AA 4IUUA 4LD6A 3VQXA 4XTZA 3HFOA 4KH1B 4OMQA 4J6XA 4XTXA 1VQ7Q 2CP2A 3DB4A 5CCAA 3RMSA 4NOYA 2ODRC 3VQYA 5DLQE 3EFRA 1H4QA 2ARSA 4PLLA 3ASKA 3VUZA 1M1KC 2RI5A 5GAMh 2VXFA 1T3SA 2ZGWA 2H3EB 2KK4A 3G4SA 5GAOp 5A0LA 2OJ2A 3REXA 1HK9A 1RAEB 2L89A 1NPRA 4TTVA 3PNWC 2CZ6B 2F69A 2FZKB 1EQRA 2XG8D 3LC0A 1OI1A 1NJ5A 1JJ2P 1UGPB 3O5ZA 4CC7A 2JJ9A 3FJPA 4N4HA 5CO7A 2NYSA 1PD0A 2VUBA 4ZGJB 2RA2A 4OMPA 1Y71A 1YJ9Q 4BI8B 2YT6A 1K9MR 4A4FA 4HWPA 1I5LA 1IZ6A 1WXUA 3MEAA 5GJVB 4BE1A 4K87A 2XICA 3LX7A 3M0QA 3MQZA 1USYC 4J9FA 4L6V5 1M3AA 2X4XA 1YITA 2QA4Q 2KGTA 4J9DA 3CC4A 4E7IA 1NJIU 3CXCP 2KY9A 3H0IA 1NPPA 4LNSA 1K4US 3OYIA 4YRCA 1FMVA 2DFUA 1B70A 4RTWA 2RQWA 3I56Q 2YWWA 5GAN2 1IL2A 2LQ8A 3A7RA 1J3TA 5GAN6 1VYUA 2FL7A 1S72A 2RHSA 3H6ZA 4RQEA 1VQ6Q 2V8JA 4RTXA 2FPFA 3FDRA 1M3BA 1PNJA 3ICAA 2DF6A 3M5AA 4HWTA 1M1FA 5C52B 2F2XA 1VIFA 1X55A 3A32A 4LUDA 2MMPA 3M0RA 2YLBA 3JCMP 1VQLQ 3E1SA 3CCRA 2QI2A 1X56A 2DXCA 3META 2DL8A 2ROLA 2BZYA 2HSPA 3GBQA 1KC8R 3VUBA 1CKBA 4HT8A 3LGLA 2A36A 3S3OA 3S3MA 3VS2A 3QIIA 4YYEA 2AHJB 3G6EA 4Y92A 4BB7A 1ABQA 4C5GA 1ZUUA 2E6ZA 2JMCA 3W3SA 1O75A 1VQOT 1O9SA 2A8EA 4P3OA 3QTCA 4OMLA 2D6FA 3OBWA 5GAOl 2DVEA 1YI2T 4P72A 1HD3A 4FYVB 5KE3A 3TREA 5L8RE 1VQ8Q 1NYQA 2D8JA 2WSEE 3PFSA 4PJMA 5LJ5f 3A5YA 2DA9A 2YLCA 1KOGA 4YTLA 2ZT5A 3A8OB 3JV3A 3HXWA 2QQBA 2AZSA 2NUTA 4TVWA 2VGNA 4M78C 1KSWA 1EX4A 1JXOA 3MCAB 3V8JA 1Q7YU 2KYMA 2RNAA 4HWOA 1FWZA 4FW2A 2NS6A 4MZTA 1FYNA 3CBPA 2PNIA 2HL3A 5FRNA 2JN0A 1OQKA 2A3LA 2P0QA 4MZMA 1VQ7T 2G6FX 3UGQA 1XOVA 2LQWA 3KFVA 4BDZA 1RI9A 3E9GA 5GAMg 4M7AE 4FYYB 1KQSA 4IURA 2LCSA 5HY6A 4C8QC 2HBWA 3MEYA 4ELZC 2SEMA 5GAOr 3VYGA 2Y4XA 1UJYA 2DL7A 1YFNA 3OW2P 4RTYA 2ZIOA 4PK4A 3M4QA 3M0PA 3QO8A 1C0MA 3L2VA 5LJ5d 4JDSA 4M7AD 4XTUA 2P0PA 2X4JA 4GBQA 2ZIMA 4YRPA 1EIYB 2PUKB 4R56A 4F14A 2E65A 5L23A 4M7DC 1Q86U 4LDYA 4LUEA 2ZPBB 3RBBB 3CC2Q 5HCKA 2DRKA 1RAIB 1YJ9T 2K3YA 3MO8A 2LRQA 3PE0A 4YRNA 4J7FA 1KQ2A 1BIBA 4Z02A 1MV3A 1BB9A 5KYNA 2GTOA 1Z7MA 3CCST 1EFWA 2LJ3A 4JZ3A 3RUXA 2RN8A 2DJZA 2JOYA 4CC2A 5IAYA 3VJPA 2QA4T 4QW2A 1QF6A 1U5SA 2PZ1A 4YRGA 5D6YA 2HQXA 2LTOA 2F5KA 2CZ1B 1WHLA 3JB9G 2BE7D 1X2QA 2MWPA 4RKUE 4H2UA 2J05A 4LVMA 1K73C 1ZSZC 1T0JA 3L2QA 4BI4A 1WPYA 3REUA 4JPBW 2PTKA 2RHSB 3ZFJA 2KDSA 4II1A 3I56T 4E7SA 3L2WA 2LCLA 4X5OA 3CC4Q 4OB1B 2E1HA 1JO8A 5LJ3f 4XU3A 1VQ6T 4YCUA 3LYIA 2ZTGA 4M78G 2HSEB 4N0AC 4UP8A 4KR2A 2MPXC 4JS4A 1YIJA 1WI7A 4C5EA 1VQLT 3SEMA 4NS5A 5IXFA 2DMOA 1M1GA 4B6MA 5HKCA 5HK3A 5J3BA 1BBUA 3P8VA 5GANh 2EBPA 2EQMA 3OYMA 1WXTA 2LJ0A 2AKLA 1EVLA 4H2WA 2QQ9A 1W2BA 4C8QG 2EAYA 4J5YA 1BIAA 4J9BA 3EG9A 4PJOF 5LJ3j 3RKXA 3L2RA 4PNOA 3RGLA 1VQ8T 4ZGEB 2K9GA 3G1ZA 1K9MC 2NUTB 1YI2A 3NGPA 2E3CA 2MK5A 3TSZA 1E24A 4IUPA 4IIMA 2KRSA 2LVMA 3L2ZA 1N27A 1JBMA 1GXIE 1SETA 4NCXA 3SHWA 5CKBA 3JCMJ 4M7DG 2ZCEA 1LPLA 4QT7A 3U23A 3OYYA 5KCHA 3FB9A 2I4NA 3OYFA 2HEQA 2XMFA 1I1JA 2CT4A 3VYHB 4LN2A 1SRLA 5EG2A 3MEUA 1Q82U 2DERA 1VUBA 4O5VA 3HRTA 1UJ0A 3KXTA 1VQ7A 2JM9A 2ROTA 1E6GA 1D3BB 2DU7A 5K1PA 5K1XA 3EH2A 1PSFA 3FJ5A 1NG2A 5ELNA 3SFMA 1S1NA 2ZPFB 1K76A 1IO6A 1USYA 2E5QA 4M7AF 1R0CB 4Z88A 3IG2A 2EGAA 1QLYA 2KYBA 1T3LA 2DK3A 3VS4A 1PRLC 1V1CA 4PG3A 3O8VA 2JVVA 2YSQA 3QZ5B 2E3IA 4FW1A 3X24B 1ARKA 2X9HA 4C0DC 5GMKl 1KC8C 2VC8A 3HFVA 3EH1A 3M59A 5KYYB 1GBRA 1G3TA 1W70A 2GBQA 4YRLA 1WFWA 2XI9A 2L5QA 2HD0A 4HCZA 3CC2T 2I4MA 1M3CA 4KUDK 3A5ZB 3FLGA 3VBBA 1U06A 1G2BA 1QCNA 5AT1B 3QJYA 1YJ9A 1SG5A 2WSFE 4J7IA 3TEGA 4RCBA 3CMEQ 1QKWA 4AFQC 1TWBA 1JEGA 4CS4A 4Q6GA 4C5IA 1SHGA 2RQTA 1BK2A 2Z0WA 1KHCA 3CCEQ 2QA4A 1ZSGA 4OB0B 2EYWA 1ADYA 1Z7NA 4OGCA 2CGHA 4A4KA 1MMNA 5GMKj 1Q7YR 2QGFB 4J83A 4F7UE 2EYQA 1JB0E 1Y96A 1Q81U 1MNEA 2X35A 3EGUA 1PYSA 1E6HA 2PVGB 3VS3A 5GAN8 1N9WA 3HXUA 5CKEA 1OV3A 3CC4T 4FT4A 3HXXA 2RQUA 2M16A 1BBZA 1X6BA 3P8TA 1GL5A 4EMKC 3NEMA 4KGVB 2X51A 2F5TX 4B9WA 4DEYA 1AWOA 3E9FA 1VQ6A 4YCWA 1UECA 1UGRB 3HY0A 3HSBA 3UPUA 2RK2A 4IIOA 1IRXA 2YUOA 4M78A 1UGVA 2XGTA 5J39A 2CUBA 1E1TA 2R58A 5GAOm 1VQLA 4JJCA 1SERA 4Z8AA 4WTOB 2KE9A 3EG9B 2DXBA 1TH7A 2DEQA 4P73C 5KE2A 2R5AA 1WHKA 4FCYA 1YIJQ 4LD9K 4Q5WA 1Q86R 3JSCA 5KNNA 2CP3A 2LP5A 1NEGA 3E2UA 4FYWB 4RTZA 5IHIA 1YFRA 2QEXQ 3JCMW 2C7IA 1IHVA 2KAFA 1PG5B 3MHXA 3TU4K 1GCQC 3OS0A 2L3SA 1K8AU 1D09B 1VQ8A 3JCMX 4HT4A 5IH2A 1RAHB 1U3OA 2DX1A 4YRRA 2E6NA 4PJNA 4FIBA 11ASA 3A7AA 2EJ9A 2KQWA 1BI0A 2YUQA 4P74C 2ZPGB 4M7DA 5CAIA 2J7IA 1BYMA 1QW1A 4LXCA 2AMCA 9ATCB 1YCYA 1ASZA 1AHJB 3E19A 4LVIA 3GNFB 5ELOA
chains in the Genus database with same CATH topology
3VKIA 4M77A 4P5NA 3JCMQ 3JCMc 3PGGA 1WU7A 3CBMA 1ZBXA 3FEOA 2R57A 3PCOA 4YROA 2YHTA 3JCMh 2GCXA 2H3JA 4UPAA 2L3RA 1XTDA 3MF1A 3L4GA 4MMLA 1NZ9A 4DQ2A 2YRVA 1YB3A 2O4XB 2ALYA 4NL3A 4M75A 5FU7C 4J6WA 3R07A 5CIUA 5GAMf 3M54A 4XAXB 1JJ2S 3CC2A 3GLXA 5CKFA 4N0AA 2HQEA 3P8DA 5AYFA 3OSVA 2DO3A 3UDCA 2Q5IA 3P8YA 1OYXA 1Y96B 3MEVA 3CCET 1PYSB 2P0LA 4ZIBA 3S3NA 4YRJA 1M8VA 3H8ZA 3M4YA 4E7HA 1M1KU 4C0ZA 4DA4A 1VIEA 3SWNC 4QQGA 1G5IA 1J5WA 3QNEA 3QG1A 3CXCS 3S6WA 2K57A 4F7UF 2DTOA 2JNGA 3OYDA 2ZINA 4GLKA 4M78B 2ZNIA 4LVLA 3OB9A 4M7AC 2GFUA 4NL2A 5GAMd 1H4VB 4TWAA 3E9HA 1HXDA 4E7KA 4E47A 2DXUA 5GAN3 5CQYA 2E64A 1QP3A 4H2SA 3G7ZA 3M55A 4H02A 3QYGB 4ME7A 1VQZA 3QPHA 4UP9A 3Q1JA 3LW5E 1YIJT 4YPFA 2QEXT 1VQ5A 4A4EA 1B7YA 4AH6A 4LDVA 1H641 2DZCA 2J3MA 4X9DA 1C0AA 2XTIA 1L0WA 4DPGA 4PJOE 4TVAA 3C4SA 5GAOn 2QQAA 4C92E 4M7DB 1EVKA 1NJ1A 2CJBA 4H2VA 4DOVA 4M77B 3RERA 3HXZA 1LJOA 1Q7YC 4P3PA 3F70A 2QHSA 3NTIA 3PCOB 3HRSA 4PJOD 2QQSA 4C92D 4ZTZB 2DDZA 3HL8A 5GMKm 4YRFA 1N8RU 4HVCA 3L4GB 3KFUA 3P8HA 5GMKi 3QO3A 1UGSB 4OB3B 2I2LA 2ALYB 4M75B 1VQPT 4TQDA 1NNHA 2DTHA 3OW2S 2ZPEB 3PIOA 1FYFA 4JLGA 4ZGDB 5LJ5j 3AHUA 2HNIA 5DY9A 5KCOA 4M7AG 3CBOA 1QVFS 2MI6A 4EMKA 1Q86C 4O2DA 3URGA 4E51A 4YRTA 4WF2A 2PVDB 3CC7T 4EDUA 3RF1A 4CH6A 2EKOA 3CMEA 2QHUA 3V7SA 2VYTA 3JCMV 4WJ4A 1GGMA 2I4OA 3A74A 1SESA 2E10A 3CCEA 1BI1A 5GANe 3I55T 4BACA 3CCJT 4P73A 5FU6B 2DXTA 1UEBA 4EMHA 3GNGA 1OZ3A 2C06A 2JTFA 2K5IA 2MF2A 1M5Q1 2FB7A 3X20B 4XEOA 4A4GA 4XK8E 1B70B 2O01E 3QYHB 1UGQB 1WGSA 2ZR3A 1JJ2A 3V8KA 2BIVA 2RM4A 5IT9E 3PT9A 4FSXA 2OAUA 4OB2B 3A8LB 1B7YB 3M53A 3OS5A 1RL2A 3RKWA 3QUIA 4RMFA 3M56A 4XU1A 1NJ2A 3JRZA 2LQKA 4TVAB 1KD1U 2QEXA 2KVQG 1KMNA 3LWHA 5LJ3h 1WYDA 1R8OB 4MDWA 1ASYA 3OYJA 2ZZDA 4BY6C 4C0DB 3CXCA 1WQWA 5J26A 2ZT7A 1Y7XA 1V29B 3HXVA 2IG0A 2P5IA 3RL6A 5C0MA 3BDLA 4JS5A 3HRUA 1H4TA 4H2XA 3OS1A 4JUVA 3HFNA 4CH4A 4OF1A 4C92F 4BDYA 1WLEA 4UP7A 4BUGA 1DJ7B 3MP6A 1M4ZA 1Q82C 5GAN5 3QKJA 2CIMA 2XDDA 5A2QE 2HAXA 2GQVA 5GMKe 1I81A 3P8BB 4HWSA 1RIQA 3BJUA 3JB9H 1N9RA 1G3YA 3HFZA 2V8IA 4H2TA 4PHCA 3HRKA 3CD6T 3OYNA 4ZTJA 4X34A 4M77E 3SWNA 5C6SA 5GANd 1VQPA 4HA8A 4EMKB 2G3RA 2DD5A 3PTAA 5D6WA 2DIQA 3PMIA 4TQFA 2ZXFA 4M7AA 5FROA 3OYBA 2FHDA 2Y90A 4QVDA 4M77D 3CC7A 3FRNA 2E70A 3SD4A 3E9IA 5HGQA 1SSFA 2FYKA 3CCLT 1G51A 4M75E 3IALA 4QVCA 1YBYA 4FL6A 2EIFA 2Q5HA 3QBYA 4C0FA 2WSCE 3OYLA 2Q7HA 4QQDA 4FU6A 5IN1A 2LC4A 3I55A 5GMKh 3CCJA 3GOXA 1KG1A 3VQWA 2IVWA 1X6OA 4P72C 3DSQA 1Q81C 3CMAT 2QQRA 2OTJT 4ATOA 3OW2A 1G3SA 1I8FA 4M75D 5FLXE 2RJCA 4K88A 4KULA 1P92A 4V2SA 2P4TA 3UGTA 2AKWA 4HCCA 2I4LA 2E41A 4QQ6A 4XTVA 1WJQA 2ZPIB 5CR2A 4F7UG 3QZ9B 2DTIA 4J15A 1W66A 4CS2A 3EFSA 2ARTA 4JJNK 2VXEA 4BWAA 4B9XA 3M4PA 4HT9A 3PZCA 5GANg 1LNXA 2RD1A 4Q15A 2EL9A 5FRMA 4H2XB 4JRQA 1M90C 3JCMe 3G71T 1K8AC 2RJFA 1VQNT 3HKSA 4MMKA 5FU7B 1VQ5T 3L2UA 4P71C 3RACA 2VGMA 4PLIA 4C8QA 2ZNJA 2IY5A 5C51B 4RG2A 1LYLA 3T9NA 4ZTFA 3NELA 2K5LA 5KH6A 4X9CA 3HFZB 4N4GA 2NLUA 2EQUA 3GIBA 1KMMA 2K2VA 2WACA 1KQSS 4Y91A 3SWNB 1EIFA 3LLRA 3FC3A 4KQEA 4A4HA 2DAQA 1YJWT 4EMGA 3OA6A 4BE2A 3ER0A 1VQ9T 1U1SA 2PQWA 3CD6A 2DQ0A 2RHZA 2A7YA 4M7AB 4R55A 2K5FA 3PMTA 4M77F 1QVGS 3R6OA 2ZT6A 3BDUA 3HP9A 4CH3A 4RG8A 3J81E 2VV5A 4QVZA 1ATIA 3HY1A 4GY5A 3UWNA 5F5WA 4IUVA 4XQ3A 1B34A 2RJEA 5DM7R 4BW9A 3TUPA 2M0OA 3M4GA 4PJOC 2J3LA 4YP0A 3CCLA 4H2YA 4C92C 2QHTA 1WJRA 3GF5A 3RKYA 1ZQ1A 4M75F 3LSSA 3CMET 4OP0A 2D9TA 2K3XA 3SDZA 1HC7A 2JUFA 2PUOB 3CMAA 5C53B 2AKWB 3HHTB 2OTJA 2GF7A 1NJIC 2ZPHB 5GAMj 3JCMd 2RHUA 2GFAA 3QXEB 3V8LA 3OD1A 3OSSC 3I7FA 4YREA 3QJ6A 5I2MA 1EIYA 4F7UA 2X4WA 3CCMA 2RB6A 3L1AA 1M9SA 5CKDA 1LOJA 4HWRA 1BBWA 4RMOA 2OTLT 1W2BS 3BW1A 3LH0A 3OYHA 1U1TA 2LCCA 2LX9A 4EO4A 3M9QA 2CJ9A 4P75C 3KBGA 1YJNT 5LJ5e 5CKHA 4UC4A 4C8QB 5M9OA 4YRSA 2IY5B 3G71A 1JRIA 4EX5A 3QDRB 1VQNA 2P0KA 3QSUA 1VQKT 3CPFA 2ZCFB 2M9UA 5GAOq 1N9SA 4HKEA 2DZ9A 5GAN4 2QDYB 1QP2A 4BE0A 2Q7EA 2XD0A 3MP8A 3UT1A 2CS7A 3OMCA 2AMCB 3A31A 2Q7GA 3C12A 4PJOG 2C8MA 1U8RA 4KUIA 4C92G 4YRQA 2FVUA 2LT4A 2RO0A 2JZ2A 1KQ1A 1N8RC 2XDBA 2PMEA 1XNIA 2CZ0B 4ZTUB 4MZPA 1WJSA 3OYAA 1YJWA 4J8OA 1G5VA 3C95A 3JCMg 2ODRD 3WXMB 1VQ9A 3OMGA 2HBPA 1WNLA 3QO5A 5LJ5h 4D6WA 3WVDB 4G85A 3J7AF 2CJAA 3EAEA 1NJ8A 3NENA 3A8HB 5LL6S 1B34B 4CH5A 4J6YA 4XTYA 2G4CA 2RHQA 3OYKA 1G3WA 3ZBDA 1NYRA 1I4K1 2XK0A 3DKMA 4XEMA 2BUDA 4CS3A 2RI2A 1QVPA 5E3IA 3CCQT 1VQMT 4PL6A 4BY6B 3LWIA 1D3BA 1X2HA 2PU9B 3M57A 3GPLA 1BI3A 5LJ3e 4A53A 2RHXA 1QVGA 2E12A 1Y07A 5CK9A 3HXYA 4E7LA 3ME9A 4P71A 2LDMA 4F7UB 3TCJA 3CCUT 1PSEA 3IKLA 1YFTA 1ADJA 3OS2A 4JRPA 4KR3A 3V7CA 4BD3A 4YRKA 4M77C 4RQFA 4C5HA 3A5ZA 4FM4B 1KHIA 2B8AA 2KSSA 3M58A 2OTLA 4P74A 1IREB 1KD1C 4ELYC 1YJNA 2XKOC 4WI1A 3N5BB 5A0DA 5I2SA 3PIPA 2V8KA 4YRIA 2EWNA 5D6XA 1SRYA 3CPWS 3JB9D 3CEYA 4M78E 4M75C 3KUFA 3TEHA 1YGBA 1VQKA 1E22A 3JAME 3FIFA 1K73U 3MP1A 3WQZA 1X54A 4DOWA 4ZN1A 5GANf 4IUTA 4EPCA 4XU0A 3UH0A 4L5GA 3NTKA 4C8QE 5GAN7 4M78D 2EJFA 4PJOA 2LNVA 3NFCA 4C92A 2XDPA 3VQVA 2EQJA 3NETA 5LJ5g 2R5MA 3CMQA 1WQ7A 2EFIA 5FU6C 5GANj 2RHIA 1YFSA 1VQOA 3OYGA 3DLMA 2RHQB 3WVEB 4C8QD 3QHSA 1BI2A 2DKGA 2L8DA 1HTTA 4M7DE 4HCBA 1RI0A 3DLLA 3SB2A 3X26B 5LJ3d 4PKCC 2LT1A 3X28B 3OQ5A 1K9MU 1YHQT 3RMQA 3CCVT 2MAMA 4M77G 2Y4YA 4LVJA 2RI3A 5DLOA 4TVYA 4M7DD 1H3ZA 4G84A 4XTWA 2X4YA 2PMFA 4JRKA 1VQ4T 4YDQA 4IUQA 5CVIA 4C0GA 2ZZGA 3CCQA 1VQMA 4LVKA 4N4IA 3JB9I 5HK0A 2ZZEA 4XU2A 4YCVA 3ERRA 3DB3A 3VU3C 4P75A 12ASA 2DPPB 1X01A 1JJCA 2M1HA 3RIRA 2DIGA 1B76A 4M75G 3J80E 2RK1A 3ZEHA 2QHVA 3G4ST 1FXXA 3CCUA 1X75C 4OMFB 2O4XA 2BKDN 1KC8U 1UB4A 4K86A 4WJ3M 1XQHA 4A54A 4P3NA 4ZN3A 1QE0A 2KMTA 1QVFA 1MHNA 3BFMA 3CCSA 4KT0E 4LDUA 2E5AA 4LDWA 3JB9F 3VV0A 1W4SA 2CKKA 3A8GB 2D0QB 3CCMT 3OBYA 3JB9J 4LDXA 3L42A 3TEHB 3A8MB 4OGEA 2MWOA 5LJ3g 4RDXA 1YITT 3OYCA 3NTHA 4OVAA 2XIDA 3HRIA 3GP8A 1H4SA 4VUBA 3I56A 3X25B 2EJGA 5I21A 2CYZB 3UFGA 2PVOB 3LGFA 1ZHIA 3LSQA 4M78F 3MF2A 2DD4A 3C94A 4PJOB 3A7UA 3INZA 4KBMB 5A0GA 1G5HA 4C92B 4JLIA 2RJDA 3HTZA 2XHCA 3MEWA 2ZT8A 1S72T 4L59A 1BKBA 2RH2A 1NE8A 1OZ2A 2K4YA 1EOVA 4C8QF 2ZR2A 2CZ7B 2EQKA 3JCMb 3CCRT 3BY7A 4FT2A 3IKMB 1MGQA 4CRIA 1M90U 4L87A 1E1OA 5GAMe 4TVRA 5CQXA 3G6ET 4YRMA 4JRIA 3QO7A 3CPWA 2XU8A 4O6JA 4Y28E 1NJ6A 4M7DF 2QXFA 1N6AA 3OYEA 2QTXA 1X2GA 2RHYA 4MDXA 2ZZFA 2JTMA 3TEEA 1FX7A 4RCCA 1YHQA 4IKFA 3CCVA 3JCMf 3HPWA 4CI0C 3OY9A 3RESA 2DU5A 4OLFA 2ARUA 4E7JA 2DQ3A 1JJCB 3V7RA 1VQ4A 4BI3A 1B8AA 4IUUA 4LD6A 3VQXA 4XTZA 3HFOA 4J6XA 4XTXA 3DB4A 5CCAA 3RMSA 4NOYA 2ODRC 3VQYA 5DLQE 3EFRA 1H4QA 2ARSA 4PLLA 3ASKA 3VUZA 1M1KC 2RI5A 5GAMh 2VXFA 2ZGWA 2KK4A 3G4SA 5GAOp 5A0LA 3REXA 1HK9A 2L89A 1NPRA 4TTVA 3PNWC 2CZ6B 2F69A 1EQRA 2XG8D 3LC0A 1OI1A 1NJ5A 1UGPB 3FJPA 4N4HA 5CO7A 2VUBA 4ZGJB 2RA2A 1Y71A 4BI8B 4A4FA 4HWPA 1I5LA 1IZ6A 3MEAA 4BE1A 4K87A 2XICA 3LX7A 3MQZA 1USYC 4L6V5 2X4XA 1YITA 3CC4A 4E7IA 1NJIU 2KY9A 1NPPA 4LNSA 3OYIA 4YRCA 1B70A 5GAN2 1IL2A 2LQ8A 3A7RA 5GAN6 2FL7A 1S72A 2RHSA 3H6ZA 4RQEA 2V8JA 3FDRA 3ICAA 3M5AA 4HWTA 5C52B 1M1FA 1VIFA 1X55A 3A32A 2MMPA 2YLBA 3JCMP 3E1SA 3CCRA 2QI2A 1X56A 2DXCA 3META 3VUBA 4HT8A 3LGLA 3S3OA 3S3MA 3QIIA 4YYEA 2AHJB 3G6EA 4BB7A 4C5GA 2E6ZA 3W3SA 1O75A 1VQOT 1O9SA 2A8EA 4P3OA 3QTCA 2D6FA 3OBWA 5GAOl 2DVEA 1YI2T 4P72A 5KE3A 3TREA 5L8RE 1NYQA 2WSEE 3PFSA 5LJ5f 3A5YA 2YLCA 1KOGA 4YTLA 2ZT5A 3A8OB 3HXWA 2QQBA 4TVWA 2VGNA 4M78C 3V8JA 3MCAB 1Q7YU 4HWOA 1FWZA 2NS6A 4MZTA 3CBPA 5FRNA 2JN0A 2A3LA 4MZMA 2P0QA 1VQ7T 3UGQA 1XOVA 4BDZA 3E9GA 5GAMg 4M7AE 1KQSA 4IURA 5HY6A 4C8QC 3MEYA 4ELZC 5GAOr 3VYGA 2Y4XA 2ZIOA 3M4QA 3QO8A 3L2VA 5LJ5d 4JDSA 4M7AD 4XTUA 2P0PA 2X4JA 4YRPA 2ZIMA 1EIYB 2PUKB 4R56A 2E65A 4M7DC 1Q86U 4LDYA 2ZPBB 1YJ9T 2K3YA 3MO8A 2LRQA 4YRNA 4J7FA 1KQ2A 1BIBA 4Z02A 1Z7MA 3CCST 1EFWA 3RUXA 2DJZA 2JOYA 5IAYA 3VJPA 2QA4T 4QW2A 1QF6A 4YRGA 5D6YA 2HQXA 2LTOA 2F5KA 2CZ1B 3JB9G 2MWPA 4RKUE 4H2UA 4LVMA 1K73C 3L2QA 4BI4A 1WPYA 3REUA 2RHSB 3ZFJA 2KDSA 4II1A 3I56T 3L2WA 2LCLA 4X5OA 4OB1B 2E1HA 5LJ3f 4XU3A 1VQ6T 4YCUA 3LYIA 2ZTGA 4M78G 4N0AC 4UP8A 4KR2A 4JS4A 1YIJA 1VQLT 4C5EA 4NS5A 1M1GA 5HKCA 5HK3A 5J3BA 1BBUA 3P8VA 5GANh 2EQMA 3OYMA 1EVLA 4H2WA 2QQ9A 1W2BA 4C8QG 2EAYA 4J5YA 1BIAA 4PJOF 5LJ3j 3RKXA 3L2RA 4PNOA 3RGLA 1VQ8T 4ZGEB 3G1ZA 1K9MC 1YI2A 2E3CA 1E24A 4IUPA 2LVMA 3L2ZA 1N27A 1JBMA 1GXIE 1SETA 4NCXA 5CKBA 3JCMJ 4M7DG 2ZCEA 3OYYA 5KCHA 3FB9A 2I4NA 3OYFA 3VYHB 5EG2A 3MEUA 1Q82U 1VUBA 4O5VA 3HRTA 3KXTA 1VQ7A 1D3BB 2DU7A 5K1PA 5K1XA 1PSFA 5ELNA 3SFMA 2ZPFB 1USYA 2E5QA 4M7AF 3IG2A 2DK3A 4PG3A 3O8VA 2JVVA 3QZ5B 3X24B 4C0DC 5GMKl 1KC8C 2VC8A 3HFVA 3M59A 1G3TA 4YRLA 2XI9A 2L5QA 2HD0A 4HCZA 3CC2T 2I4MA 4KUDK 3A5ZB 3FLGA 3VBBA 3QJYA 1YJ9A 2WSFE 4J7IA 3TEGA 4RCBA 4CS4A 4Q6GA 4C5IA 1KHCA 2QA4A 4OB0B 1ADYA 1Z7NA 4OGCA 2CGHA 4A4KA 5GMKj 4J83A 4F7UE 2EYQA 1JB0E 1Y96A 1Q81U 1PYSA 2X35A 2PVGB 5GAN8 1N9WA 3HXUA 5CKEA 3CC4T 4FT4A 3HXXA 2M16A 3P8TA 4EMKC 3NEMA 2F5TX 4B9WA 3E9FA 1VQ6A 4YCWA 1UGRB 3HY0A 3HSBA 3UPUA 2RK2A 4M78A 2XGTA 5J39A 1E1TA 2R58A 5GAOm 1VQLA 1SERA 2DXBA 1TH7A 2DEQA 4P73C 5KE2A 2R5AA 4LD9K 4Q5WA 3JSCA 5KNNA 1YFRA 3JCMW 2C7IA 2KAFA 3MHXA 3TU4K 3OS0A 1K8AU 1VQ8A 3JCMX 4HT4A 4YRRA 2E6NA 11ASA 4FIBA 3A7AA 2EJ9A 2KQWA 1BI0A 4P74C 2ZPGB 4M7DA 5CAIA 1BYMA 1QW1A 2AMCA 1YCYA 1ASZA 1AHJB 3E19A 4LVIA 3GNFB 5ELOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYK A;  1G51 A;  1X55 A;  4M75 E;  3A32 A;  3IAL A;  4QVC A;  4P74 A;  2YLB A;  4M77 A;  3JCM P;  2Q5H A;  3JCM Q;  1X56 A;  3JCM c;  3PGG A;  2Q7H A;  1WU7 A;  5GMK h;  4HT8 A;  3PCO A;  4WI1 A;  3VQW A;  4YRO A;  2YHT A;  3JCM h;  4P72 C;  3DSQ A;  4YYE A;  4YRI A;  2EWN A;  4UPA A;  3W3S A;  1SRY A;  1I8F A;  3JB9 D;  3MF1 A;  4M75 C;  4M78 E;  3TEH A;  4M75 D;  3L4G A;  1YGB A;  1E22 A;  4P3O A;  3QTC A;  5GAO l;  2DVE A;  3FIF A;  4MML A;  4K88 A;  4P72 A;  3WQZ A;  4V2S A;  1X54 A;  1NYQ A;  4DQ2 A;  5GAN f;  1YB3 A;  3UGT A;  2AKW A;  5LJ5 f;  2I4L A;  2ALY A;  3A5Y A;  2E41 A;  2YLC A;  4NL3 A;  4M75 A;  3R07 A;  4J6W A;  4XTV A;  1KOG A;  2ZT5 A;  5GAM f;  4XU0 A;  3HXW A;  4F7U G;  2DTI A;  4J15 A;  1W66 A;  3UH0 A;  4TVW A;  4CS2 A;  4M78 C;  4C8Q E;  5GAN 7;  3V8J A;  4M78 D;  4N0A A;  3EFS A;  2ART A;  4HWO A;  2EJF A;  2VXE A;  4BWA A;  4PJO A;  3M4P A;  4C92 A;  4HT9 A;  3VQV A;  2Q5I A;  3P8Y A;  2JN0 A;  3PZC A;  3UGQ A;  5GAN g;  1Y96 B;  3NET A;  1LNX A;  2RD1 A;  5LJ5 g;  1PYS B;  2P0L A;  3CMQ A;  4Q15 A;  4ZIB A;  4YRJ A;  1M8V A;  5GAM g;  1WQ7 A;  4M7A E;  5GAN j;  2EL9 A;  1YFS A;  4H2X B;  4C8Q C;  3MEY A;  3SWN C;  4C8Q D;  2RHQ B;  5GAO r;  3QHS A;  2DKG A;  3JCM e;  1G5I A;  1HTT A;  4M7D E;  1J5W A;  3QNE A;  4MMK A;  2ZIO A;  2K57 A;  3SB2 A;  3M4Q A;  4F7U F;  4P71 C;  2DTO A;  3RAC A;  5LJ3 d;  4C8Q A;  2ZIN A;  2ZNJ A;  3QO8 A;  4M78 B;  2ZNI A;  2IY5 A;  5C51 B;  5LJ5 d;  4M7A C;  4M7A D;  4NL2 A;  5GAM d;  4XTU A;  1H4V B;  1LYL A;  4YRP A;  2ZIM A;  1EIY B;  4TWA A;  3E9H A;  1HXD A;  4M77 G;  2E65 A;  2DXU A;  5GAN 3;  4M7D C;  4TVY A;  2E64 A;  3NEL A;  4M7D D;  4G84 A;  4H2S A;  4XTW A;  4H02 A;  2PMF A;  4X9C A;  3HFZ B;  4JRK A;  1VQZ A;  4YRN A;  4YDQ A;  1KQ2 A;  1BIB A;  4UP9 A;  3GIB A;  1KMM A;  2ZZG A;  1Z7M A;  1EFW A;  4Y91 A;  3SWN B;  3JB9 I;  2ZZE A;  4XU2 A;  3RUX A;  4YCV A;  3ERR A;  4KQE A;  2DJZ A;  4YPF A;  3VU3 C;  4P75 A;  1QF6 A;  12AS A;  1X01 A;  1JJC A;  1B7Y A;  4YRG A;  4EMG A;  4AH6 A;  1H64 1;  3RIR A;  1U1S A;  2DZC A;  2J3M A;  3JB9 G;  1B76 A;  2DQ0 A;  4X9D A;  4M75 G;  2XTI A;  4H2U A;  1C0A A;  4M7A B;  2QHV A;  1L0W A;  4M77 F;  1WPY A;  4DPG A;  4PJO E;  4TVA A;  3REU A;  2ZT6 A;  3BDU A;  5GAO n;  2RHS B;  4C92 E;  4M7D B;  1EVK A;  1NJ1 A;  4CH3 A;  2CJB A;  4H2V A;  4X5O A;  1ATI A;  3HY1 A;  2E1H A;  5F5W A;  5LJ3 f;  4XU3 A;  4M77 B;  4XQ3 A;  3RER A;  3HXZ A;  4K86 A;  4YCU A;  4WJ3 M;  1LJO A;  4A54 A;  4P3P A;  1B34 A;  2ZTG A;  4P3N A;  4M78 G;  1QE0 A;  4BW9 A;  3BFM A;  4N0A C;  2QHS A;  3TUP A;  4UP8 A;  4KR2 A;  3M4G A;  4PJO C;  2J3L A;  4YP0 A;  3PCO B;  4PJO D;  2E5A A;  4H2Y A;  4C92 C;  2QHT A;  4C92 D;  3RKY A;  3JB9 F;  4ZTZ B;  2DDZ A;  5GMK m;  4YRF A;  4M75 F;  1BBU A;  3P8V A;  5GAN h;  3LSS A;  3JB9 J;  4HVC A;  4OP0 A;  3TEH B;  3L4G B;  3KFU A;  1EVL A;  4H2W A;  1HC7 A;  5GMK i;  3QO3 A;  5LJ3 g;  4C8Q G;  4RDX A;  2EAY A;  3HRI A;  5C53 B;  4J5Y A;  2AKW B;  1H4S A;  1BIA A;  2I2L A;  2ALY B;  4PJO F;  5LJ3 j;  4M75 B;  2EJG A;  4TQD A;  1NNH A;  2DTH A;  5I21 A;  3RKX A;  3UFG A;  1FYF A;  4PNO A;  3RGL A;  5LJ5 j;  3G1Z A;  3LSQ A;  4M78 F;  3MF2 A;  3AHU A;  5GAM j;  3JCM d;  2E3C A;  1E24 A;  2HNI A;  5DY9 A;  4M7A G;  3V8L A;  3L2Z A;  3OD1 A;  1JBM A;  3I7F A;  4PJO B;  1SET A;  3A7U A;  3INZ A;  4EMK A;  4NCX A;  4YRE A;  3JCM J;  1G5H A;  4O2D A;  4C92 B;  4JLI A;  4M7D G;  4E51 A;  4YRT A;  4WF2 A;  2ZCE A;  3HTZ A;  1EIY A;  2ZT8 A;  3FB9 A;  2I4N A;  4F7U A;  3RF1 A;  4CH6 A;  2RB6 A;  3L1A A;  1LOJ A;  1EOV A;  2QHU A;  4C8Q F;  2ZR2 A;  3V7S A;  4HWR A;  1BBW A;  3JCM V;  4WJ4 A;  1GGM A;  2I4O A;  3A74 A;  1SES A;  3JCM b;  3BW1 A;  3BY7 A;  1U1T A;  1D3B B;  2E10 A;  2DU7 A;  5K1P A;  5K1X A;  4EO4 A;  3IKM B;  1MGQ A;  4P75 C;  2CJ9 A;  5GAN e;  4P73 A;  5ELN A;  2DXT A;  4L87 A;  5LJ5 e;  1E1O A;  4EMH A;  4C8Q B;  1USY A;  5GAM e;  4YRM A;  4JRI A;  4M7A F;  4YRS A;  3QO7 A;  2IY5 B;  3IG2 A;  1JRI A;  4EX5 A;  3QSU A;  1M5Q 1;  1NJ6 A;  2FB7 A;  4M7D F;  4PG3 A;  4XEO A;  5GAO q;  2QTX A;  1N9S A;  1X2G A;  1B70 B;  2DZ9 A;  5GMK l;  5GAN 4;  2ZZF A;  2VC8 A;  3HFV A;  4RCC A;  4YRL A;  2ZR3 A;  3V8K A;  2Q7E A;  3JCM f;  3RES A;  2I4M A;  2DU5 A;  2AMC B;  3A31 A;  2RM4 A;  3VBB A;  4OLF A;  2ARU A;  2DQ3 A;  2Q7G A;  4PJO G;  2C8M A;  4C92 G;  1JJC B;  4YRQ A;  1B7Y B;  3V7R A;  3TEG A;  4RCB A;  1KQ1 A;  3RKW A;  2PME A;  1B8A A;  3QUI A;  4RMF A;  3VQX A;  4CS4 A;  4XTZ A;  4Q6G A;  4ZTU B;  4XU1 A;  3HFO A;  1NJ2 A;  4J6X A;  4XTX A;  4TVA B;  4NOY A;  1KMN A;  2ODR C;  1ADY A;  3JCM g;  3VQY A;  5LJ3 h;  1Z7N A;  1WYD A;  2ODR D;  2CGH A;  3EFR A;  1H4Q A;  5GMK j;  1WNL A;  2ARS A;  1ASY A;  3QO5 A;  1WQW A;  5LJ5 h;  4F7U E;  2ZT7 A;  1Y96 A;  4G85 A;  3HXV A;  1PYS A;  5GAM h;  2VXF A;  1NJ8 A;  2CJA A;  2P5I A;  3NEN A;  2ZGW A;  3RL6 A;  5GAN 8;  1N9W A;  5GAO p;  3HXU A;  1H4T A;  1B34 B;  4H2X A;  4CH5 A;  4JUV A;  4J6Y A;  4XTY A;  3HXX A;  2G4C A;  2RHQ A;  3HFN A;  3REX A;  4CH4 A;  1HK9 A;  3P8T A;  4C92 F;  4TTV A;  4EMK C;  3NEM A;  1WLE A;  1EQR A;  4UP7 A;  3LC0 A;  1NJ5 A;  1NYR A;  4YCW A;  3HY0 A;  3HSB A;  3FJP A;  4M78 A;  1I4K 1;  2XGT A;  5GAN 5;  1E1T A;  5GAO m;  2RA2 A;  2CIM A;  4XEM A;  4CS3 A;  1SER A;  5E3I A;  5GMK e;  1I81 A;  4HWP A;  4HWS A;  1I5L A;  1RIQ A;  3BJU A;  3JB9 H;  1N9R A;  1TH7 A;  2DEQ A;  4P73 C;  1D3B A;  4K87 A;  3HFZ A;  1X2H A;  4H2T A;  4PHC A;  1USY C;  5KNN A;  1YFR A;  3HRK A;  3JCM W;  2C7I A;  5LJ3 e;  4A53 A;  4M77 E;  3SWN A;  5GAN d;  4HA8 A;  4EMK B;  3HXY A;  3JCM X;  4LNS A;  4P71 A;  4F7U B;  4YRC A;  4YRR A;  4TQF A;  1B70 A;  3IKL A;  1YFT A;  11AS A;  2ZXF A;  3A7A A;  2EJ9 A;  5GAN 2;  1IL2 A;  4M7A A;  1ADJ A;  4KR3 A;  3V7C A;  3A7R A;  4YRK A;  2Y90 A;  4P74 C;  5GAN 6;  4M77 C;  4RQF A;  4QVD A;  4M77 D;  2RHS A;  4M7D A;  5CAI A;  4RQE A;  2AMC A;  3A5Z A;  1YCY A;  3ICA A;  1ASZ A;  4HWT A;  5C52 B;  3E9I A;  5ELO A;  5HGQ A; 
#chains in the Genus database with same CATH topology
 4F17 A;  3VKI A;  4M77 A;  4P5N A;  3JCM Q;  2ABL A;  3EG2 A;  3JCM c;  3PGG A;  1WU7 A;  3CBM A;  3UA6 A;  1F1B B;  2F1L A;  1ZBX A;  1OU8 A;  3FEO A;  2R57 A;  3PCO A;  4YRO A;  2YHT A;  1UUE A;  3JCM h;  2GCX A;  2EQI A;  2H3J A;  4UPA A;  2L3R A;  1SPK A;  1NYF A;  1XTD A;  3MF1 A;  3L4G A;  1VQP Q;  1ZSZ A;  3VS1 A;  1QVG P;  4MML A;  3EFO A;  1NZ9 A;  2HDA A;  1TS9 A;  4DBH A;  4PFZ A;  4DQ2 A;  2YRV A;  1YB3 A;  2O4X B;  2ALY A;  3A1P A;  2F2W A;  4M75 A;  5FU7 C;  4J6W A;  4NL3 A;  5CIU A;  1WYX A;  3R07 A;  5GAM f;  1TU0 B;  3M54 A;  2YUP A;  4XAX B;  1JJ2 S;  3CC2 A;  2MYS A;  3GLX A;  1PRM C;  2EW3 A;  1ZBJ A;  5CKF A;  3CC7 Q;  4N0A A;  2O9S A;  2HQE A;  3P8D A;  2RMO A;  5AYF A;  3OSV A;  2DO3 A;  2HKN A;  3UDC A;  2Q5I A;  4FYX B;  3P8Y A;  1KJW A;  1ZA1 B;  1OYX A;  1Y96 B;  3MEV A;  3CCE T;  1PYS B;  2P0L A;  4ZIB A;  1TUC A;  3S3N A;  4YRJ A;  1M8V A;  3H8Z A;  2O2O A;  3M4Y A;  4E7H A;  3I55 Q;  1M1K U;  3CCJ Q;  3R6N A;  4C0Z A;  4DA4 A;  1VIE A;  3SWN C;  4QQG A;  1WZO A;  1G5I A;  3MJX A;  1Q82 R;  1J5W A;  3QNE A;  3QG1 A;  3CXC S;  2COY A;  3S6W A;  2K57 A;  4F7U F;  2DTO A;  2JNG A;  2DJQ A;  3OYD A;  1NBE B;  5GJW B;  2ZIN A;  1UDL A;  5FW9 A;  4GLK A;  1NEB A;  4M78 B;  4HVW A;  1YP5 A;  4LVL A;  2ZNI A;  2D8H A;  3OB9 A;  4M7A C;  2GFU A;  4NL2 A;  5GAM d;  1H4V B;  4TWA A;  3E9H A;  1HXD A;  1MV0 B;  4E7K A;  4E47 A;  2DXU A;  5GAN 3;  5CQY A;  2E64 A;  1M30 A;  3IQL A;  1QP3 A;  2AK5 A;  4H2S A;  3G7Z A;  3M55 A;  4H02 A;  3QYG B;  4F16 A;  1KIK A;  2FO0 A;  4ME7 A;  1VQZ A;  2LX7 A;  3QPH A;  4UP9 A;  2W10 A;  3Q1J A;  2L3P A;  3LW5 E;  1YIJ T;  4YPF A;  2CDT A;  4EIK A;  1VYT A;  2E4H A;  2QEX T;  1VQ5 A;  4A4E A;  1B7Y A;  3QWX X;  4AH6 A;  4HVU A;  4LDV A;  1H64 1;  2KEA A;  2DZC A;  2J3M A;  1SSH A;  1GFD A;  3M0U A;  4HVV A;  4X9D A;  1C0A A;  2XTI A;  1JU5 C;  1L0W A;  4DPG A;  4PJO E;  4TVA A;  1OOT A;  2J6F A;  4PJJ A;  3C4S A;  5GAO n;  2QG9 B;  2QQA A;  4C92 E;  4M7D B;  1EVK A;  1NJ1 A;  1AEY A;  1PHT A;  2CJB A;  4H2V A;  3EHQ A;  1WXB A;  1H8K A;  4GLM A;  2RQR A;  4DOV A;  1ABO A;  2ZAE A;  4M77 B;  3RER A;  3HXZ A;  1D0Y A;  2M02 A;  2NUP A;  1LJO A;  1Q7Y C;  4P3P A;  1QCO A;  1UE9 A;  1Q81 R;  3F70 A;  2QHS A;  3NTI A;  4K11 A;  3REA B;  3C0C A;  3PCO B;  3HRS A;  4PJO D;  1W6X A;  2QQS A;  4C92 D;  1W1F A;  1OX9 A;  2VWF A;  4ZTZ B;  2DDZ A;  3HL8 A;  5GMK m;  4YRF A;  4WCI A;  2EYX A;  1N8R U;  4HVC A;  3L4G B;  3BE3 A;  3KFU A;  2AT1 B;  3P8H A;  1ZSZ B;  4J9E A;  1G83 A;  5GMK i;  3QO3 A;  3EFO B;  1UGS B;  1K0S A;  4OB3 B;  2I2L A;  2ALY B;  2K6D A;  4M75 B;  1VQP T;  3CD6 Q;  4Z89 A;  1NNH A;  2DTH A;  3OW2 S;  4TQD A;  2E3H A;  2ZPE B;  3PIO A;  1FYF A;  4JLG A;  4ZGD B;  1H3H A;  5LJ5 j;  3VRZ A;  3QDF A;  3AHU A;  3THK A;  1AD5 A;  1MND A;  2HNI A;  5DY9 A;  3H0F A;  5KCO A;  4M7A G;  3CBO A;  2KXC A;  1QVF S;  2D0N A;  2MI6 A;  4EMK A;  1Q86 C;  4AG1 C;  4O2D A;  3URG A;  4E51 A;  4YRT A;  4WF2 A;  2PVD B;  3CC7 T;  3I35 A;  4EDU A;  3RF1 A;  1M90 R;  1AWX A;  1M2V A;  4CH6 A;  3I5R A;  1TUD A;  2EKO A;  1QVF P;  1K8A R;  1D0Z A;  3CME A;  2QHU A;  3V7S A;  4F04 B;  2ATC B;  2CSQ A;  2VYT A;  3JCM V;  4WJ4 A;  2CH4 W;  1GGM A;  2KRN A;  3UAT A;  2I4O A;  3A74 A;  3CCL Q;  1QKX A;  1SES A;  2E10 A;  3VS5 A;  3CCE A;  3TQ7 P;  1BI1 A;  5KYX A;  5GAN e;  1RAA B;  3I55 T;  3CCJ T;  4BAC A;  5FU6 B;  4P73 A;  2DXT A;  1UEB A;  4EMH A;  3GNG A;  1OZ3 A;  2C06 A;  2JTF A;  2O9V A;  1IHW A;  2DL5 A;  5EC7 A;  2K5I A;  2L3Q A;  3ULR B;  2MF2 A;  1C1A A;  5KYU A;  3CMA Q;  2OTJ Q;  1M5Q 1;  1TUG B;  2FB7 A;  1GCQ A;  3X20 B;  4XEO A;  2CP0 A;  4A4G A;  1QWF A;  4XK8 E;  1B70 B;  2O01 E;  3QYH B;  1UGQ B;  1WGS A;  8AT1 B;  1R0B G;  2FRY A;  1MMG A;  2ZR3 A;  1K9A A;  1JJ2 A;  3V8K A;  2BIV A;  1OUL A;  2RM4 A;  5IT9 E;  3PT9 A;  4FSX A;  5IHK A;  2JTE A;  2OAU A;  3VS0 A;  2DET A;  4ORZ A;  2BE9 B;  4OB2 B;  3A8L B;  1OEB A;  1B7Y B;  3M53 A;  3H41 A;  3OS5 A;  1RL2 A;  1SRM A;  2KBT A;  3RKW A;  2VVK A;  4E7Z A;  3QUI A;  4RMF A;  3M56 A;  4XU1 A;  1NJ2 A;  3JRZ A;  2LQK A;  4TVA B;  1KD1 U;  2QEX A;  2KR3 A;  2KVQ G;  1KMN A;  3LWH A;  5LJ3 h;  1WYD A;  1FMW A;  4AFZ C;  1R8O B;  4MDW A;  1ASY A;  3OYJ A;  2ZZD A;  4BY6 C;  4C0D B;  5J26 A;  1WQW A;  1JQQ A;  3CXC A;  1Y7X A;  2ZT7 A;  1V29 B;  3CPW P;  3HXV A;  2IG0 A;  4RTT A;  3G71 Q;  2P5I A;  1AT1 B;  1Y57 A;  3RL6 A;  1VQN Q;  3UF4 A;  3M0S A;  2NUP B;  5C0M A;  1I0C A;  3BDL A;  4JS5 A;  3HRU A;  3CQT A;  1VQ5 Q;  1TOV A;  1H4T A;  3OS1 A;  4JUV A;  4H2X A;  1M2O A;  1RLP C;  3HFN A;  2CRE A;  4CH4 A;  4A63 B;  4OF1 A;  1QCF A;  1B07 A;  4C92 F;  4BDY A;  1WLE A;  4UP7 A;  4BUG A;  1DJ7 B;  3MP6 A;  2V26 A;  1M4Z A;  1Q82 C;  4M4Z A;  1IGU A;  2KT8 A;  2MIO A;  2DLP A;  5GAN 5;  3QKJ A;  2CIM A;  7AT1 B;  2XDD A;  5A2Q E;  2HAX A;  3AT1 B;  2GQV A;  5GMK e;  1NJI R;  1I81 A;  2ED1 A;  3P8B B;  4HWS A;  2ECZ A;  1RIQ A;  3BJU A;  3JB9 H;  1N9R A;  1OPK A;  1G3Y A;  2JXB A;  2V8I A;  3HFZ A;  4H2T A;  4PHC A;  1OX8 A;  1B3Q A;  3HRK A;  1YJW Q;  3CD6 T;  4KRT A;  4AFS C;  3MPU B;  3OYN A;  4ZTJ A;  4X34 A;  4M77 E;  3SWN A;  2ENM A;  5C6S A;  1VQ9 Q;  3LH5 A;  2RF0 A;  5FWC A;  5GAN d;  1VQP A;  4HA8 A;  4EMK B;  2G3R A;  4PJL A;  2DD5 A;  4KGX B;  2SRC A;  3PTA A;  5D6W A;  2DIQ A;  3PMI A;  3I5S A;  4TQF A;  2HMA A;  2FG0 A;  1KK7 A;  2ZXF A;  4M7A A;  5FRO A;  3EG1 A;  4PFO A;  3OYB A;  2FHD A;  2O88 A;  2Y90 A;  2DYI A;  4QVD A;  4M77 D;  3CC7 A;  3FRN A;  2LZ6 B;  2E70 A;  5KYX B;  3SD4 A;  3E9I A;  2LMJ A;  2I0N A;  5HGQ A;  1SSF A;  2FYK A;  3CCL T;  1G51 A;  4M75 E;  3IAL A;  2M51 A;  4PFP A;  4QVC A;  1YBY A;  4FL6 A;  2EIF A;  4LNP A;  2P84 A;  2Q5H A;  2J6O A;  2DBK A;  3QBY A;  4C0F A;  1WA7 A;  2D1X A;  1CSK A;  2WSC E;  5KYU B;  3OYL A;  2Q7H A;  4QQD A;  4FU6 A;  5IN1 A;  1GBQ A;  2LC4 A;  3I55 A;  2FPE A;  5GMK h;  3CCJ A;  1SHF A;  3GOX A;  1KG1 A;  3VQW A;  2IVW A;  1X6O A;  1LVK A;  4P72 C;  3M0T A;  2EYY A;  3DSQ A;  1Q81 C;  1RAB B;  3CMA T;  2QQR A;  2OTJ T;  4ATO A;  3OW2 A;  1G3S A;  1I8F A;  4DBR A;  1GRI A;  4M75 D;  5FLX E;  4LE9 A;  2RJC A;  4K88 A;  4KUL A;  1P92 A;  4V2S A;  1ZUK A;  1N8R R;  2BTT A;  2P4T A;  2M0Y A;  3UGT A;  2AKW A;  4HCC A;  2I4L A;  2E41 A;  4QQ6 A;  4XTV A;  3NPF A;  1WJQ A;  2ZPI B;  5CR2 A;  4F7U G;  3QZ9 B;  1RAG B;  2DTI A;  4J15 A;  1W66 A;  2GTJ A;  4KH0 B;  4CS2 A;  1Z9Z A;  1AWW A;  3EFS A;  2ART A;  4JJN K;  2VXE A;  4BWA A;  4B9X A;  3M4P A;  1OPL A;  4HT9 A;  1RAD B;  2KT1 A;  3H9N A;  3PZC A;  2OTL Q;  5GAN g;  1LNX A;  2RD1 A;  4Q15 A;  1C6V X;  2EL9 A;  4E6R A;  5FRM A;  4H2X B;  1YJN Q;  4JRQ A;  1M90 C;  2C0I A;  1NM7 A;  3JCM e;  3G71 T;  3REB B;  1K8A C;  1GFC A;  2RJF A;  1VQN T;  3HKS A;  4MMK A;  3RDV A;  5FU7 B;  1VQ5 T;  3L2U A;  4P71 C;  3RAC A;  2VGM A;  2EGE A;  4PLI A;  1VQK Q;  4C8Q A;  2ZNJ A;  1KFZ A;  2IY5 A;  5C51 B;  1NYG A;  4RG2 A;  1TTH B;  2C0O A;  1LYL A;  1AZE A;  3T9N A;  4ZTF A;  1M8M A;  3NEL A;  3UA7 A;  2HL5 C;  2JS2 A;  2K5L A;  2CUD A;  5KH6 A;  1D1A A;  4X9C A;  2CSI A;  3HFZ B;  6AT1 B;  4N4G A;  2NLU A;  2EQU A;  2E5K A;  3GIB A;  1KMM A;  2K2V A;  2WAC A;  1KQS S;  4Y91 A;  3SWN B;  4HCK A;  2GQI A;  3EGX A;  1VYV A;  1EIF A;  2QK0 A;  3LLR A;  3FC3 A;  4KQE A;  4A4H A;  4JZ4 A;  2DAQ A;  2EYZ A;  1YJW T;  2HKQ B;  4EMG A;  3OA6 A;  4BE2 A;  2DYB A;  3ER0 A;  1VQ9 T;  1KQS P;  1U1S A;  2DL3 A;  2PQW A;  1YWO A;  3CD6 A;  1VQO Q;  1Y0M A;  2DQ0 A;  2W0Z A;  2RHZ A;  2A7Y A;  4M7A B;  4R55 A;  2K5F A;  3PMT A;  4M77 F;  4AT1 B;  1QVG S;  1AZG B;  3R6O A;  1I5O B;  1QMC A;  2ZT6 A;  3BDU A;  2X3X D;  3HP9 A;  1R77 A;  4CH3 A;  4RG8 A;  3J81 E;  2VV5 A;  4QVZ A;  2DBM A;  1ATI A;  3HY1 A;  4GY5 A;  1KD1 R;  2QAZ A;  1M27 C;  3UWN A;  5F5W A;  4IUV A;  4XQ3 A;  3EHR A;  1AOJ A;  1UHF A;  1B34 A;  1VOM A;  2RJE A;  5DM7 R;  1RAF B;  4BW9 A;  3TUP A;  2M0O A;  3M4G A;  1PD1 A;  4PJO C;  2J3L A;  2DE0 X;  4YP0 A;  1YN8 A;  3CCL A;  4H2Y A;  4C92 C;  2OX7 A;  1CKA A;  1WJR A;  2QHT A;  3GF5 A;  3RKY A;  1IGQ A;  1ZQ1 A;  4M75 F;  3LSS A;  3CME T;  3CCQ Q;  1VQM Q;  4OP0 A;  2FZG B;  4D8K A;  2D9T A;  2K3X A;  3SDZ A;  4DBF A;  1HC7 A;  2JUF A;  2QGG A;  2PUO B;  3CMA A;  5C53 B;  2AKW B;  3HHT B;  2OTJ A;  1IXD A;  3VRY A;  3VS6 A;  2AIR B;  2GF7 A;  1NJI C;  2ZPH B;  1EFN A;  5GAM j;  3JCM d;  3TVT A;  2RHU A;  2GFA A;  3QXE B;  3V8L A;  1UHC A;  2NUZ A;  3CCU Q;  3OD1 A;  1NLO C;  3OSS C;  1UTI A;  3I7F A;  4YRE A;  2O31 A;  2CH4 A;  3QJ6 A;  5I2M A;  2CP5 A;  2KRM A;  1UFF A;  1H92 A;  1EIY A;  1JXM A;  4F7U A;  1BCM A;  1PWT A;  2DM1 A;  2X4W A;  3CCM A;  2RB6 A;  3L1A A;  1M9S A;  5CKD A;  1LOJ A;  3CCS Q;  4R0K A;  4HWR A;  1SKU B;  1BBW A;  4RMO A;  2OTL T;  4OMM A;  1W2B S;  3BW1 A;  3LH0 A;  2MCN A;  1U1T A;  4OMN A;  3OYH A;  4J9C A;  2LCC A;  2LX9 A;  2EPD A;  4EO4 A;  3M9Q A;  2CJ9 A;  4P75 C;  3KBG A;  1D1B A;  1YJN T;  4ESR A;  5LJ5 e;  5CKH A;  4UC4 A;  4C8Q B;  1W2B P;  4OMO A;  5M9O A;  4YRS A;  2IY5 B;  3G71 A;  1JRI A;  2JS0 A;  3QWY A;  4EX5 A;  3QDR B;  4J9G A;  1VQN A;  2P0K A;  3QSU A;  2DEU A;  1WHH A;  1VQK T;  3CPF A;  1WDX A;  2ZCF B;  2AKK A;  2M9U A;  5GAO q;  1FMK A;  1N9S A;  2V1Q A;  1HSQ A;  4HKE A;  1D0X A;  1X69 A;  2DZ9 A;  5GAN 4;  1K1Z A;  2VKN A;  2QDY B;  2L2P A;  1QP2 A;  2DRM A;  1X27 A;  5KYW A;  4BE0 A;  1ZLM A;  2Q7E A;  2A08 A;  3MP8 A;  2XD0 A;  3UT1 A;  2CS7 A;  1PM3 A;  3OMC A;  2YDL A;  2A28 A;  2QDL A;  2AMC B;  3EGX B;  3A31 A;  4X1V A;  2Q7G A;  1SF9 A;  3C12 A;  4PJO G;  1ACM B;  2C8M A;  1U8R A;  4DEX A;  4KUI A;  2K3B A;  4C92 G;  4YRQ A;  2FVU A;  2LT4 A;  2RO0 A;  2JZ2 A;  1KQ1 A;  1N8R C;  2XDB A;  2PME A;  1XNI A;  2CZ0 B;  2V1R A;  4ZTU B;  4MZP A;  5I11 A;  1WJS A;  1YWP A;  3OYA A;  1YJW A;  4J8O A;  1G5V A;  1D1C A;  3C95 A;  1SEM A;  3JCM g;  2ODR D;  3WXM B;  1VQ9 A;  3OMG A;  2HBP A;  1WNL A;  3QO5 A;  5LJ5 h;  2YRC A;  2H8H A;  4D6W A;  3WVD B;  4G85 A;  1HJD A;  4JJD A;  3J7A F;  2CJA A;  3EAE A;  1NJ8 A;  3EG0 A;  3NEN A;  3A8H B;  5LL6 S;  2HZY A;  2NWM A;  2DL4 A;  1WHG A;  1B34 B;  2KXD A;  4CH5 A;  4J9I A;  4J6Y A;  4XTY A;  2QAS A;  2G4C A;  2RHQ A;  3OYK A;  1G3W A;  3ZBD A;  2RQV A;  2COZ A;  2A0F B;  1YHQ Q;  1NYR A;  3CCV Q;  2OI3 A;  2COW A;  1B7T A;  3ZL7 C;  1I4K 1;  2XK0 A;  4DBQ A;  1GCP A;  3DKM A;  4XEM A;  2BUD A;  2IPO B;  4CS3 A;  1TSF A;  2RI2 A;  1QVP A;  2A37 A;  5E3I A;  1AVZ C;  3CCQ T;  1QWE A;  1VQM T;  1VQ4 Q;  4PL6 A;  4BY6 B;  1ZX6 A;  3LWI A;  2FRW A;  1D3B A;  8ATC B;  1WHJ A;  2YRD A;  1Z9Q A;  4RUG A;  1X2H A;  2QYZ A;  2DVJ A;  2PU9 B;  1V76 A;  3M57 A;  3GPL A;  1BI3 A;  2F2V A;  4A53 A;  5LJ3 e;  1PCX A;  2RHX A;  2K2M A;  1QVG A;  2FZC B;  2E12 A;  1Y07 A;  5CK9 A;  3HXY A;  4E7L A;  3ME9 A;  4P71 A;  2YUN A;  2LDM A;  4F7U B;  3G4S Q;  3TCJ A;  3CCU T;  1PSE A;  1PC0 A;  1IB8 A;  3IKL A;  1YFT A;  2B86 A;  1ADJ A;  1RLQ C;  3OS2 A;  4JRP A;  4KR3 A;  1PKS A;  3V7C A;  4BD3 A;  5KYY A;  4YRK A;  4M77 C;  3HTR A;  4RQF A;  4C5H A;  3A5Z A;  4FM4 B;  1KHI A;  2B8A A;  3VS7 A;  2KSS A;  4KGZ B;  3M58 A;  2OTL A;  4P74 A;  1IRE B;  1KD1 C;  4ELY C;  2EKH A;  1YJN A;  2XKO C;  3CCM Q;  3G1J A;  2FPD A;  3N5B B;  3RR6 A;  5A0D A;  4WI1 A;  5I2S A;  3PIP A;  2V8K A;  4YRI A;  2EWN A;  2J06 A;  2CP7 A;  1YIT Q;  5D6X A;  1SRY A;  3CPW S;  3JB9 D;  3CEY A;  4M78 E;  4M75 C;  3KUF A;  3TEH A;  1RAC B;  5KYW B;  1YGB A;  1VQK A;  1E22 A;  2RPN A;  3JAM E;  3FIF A;  1K73 U;  3MP1 A;  3WQZ A;  1X54 A;  4DOW A;  4ZN1 A;  4E2F B;  5GAN f;  4ANJ A;  4IUT A;  4EPC A;  4XU0 A;  4D8D A;  3UH0 A;  1RUW A;  4L5G A;  3NTK A;  4C8Q E;  5GAN 7;  4M78 D;  1S72 Q;  3EGD A;  2CP6 A;  1M1K R;  2EJF A;  4PJO A;  1ZUY A;  2LNV A;  3NFC A;  4RTV A;  4C92 A;  2XDP A;  3VQV A;  2EQJ A;  3NET A;  5LJ5 g;  2R5M A;  3CMQ A;  2ED0 A;  3CCR Q;  1WQ7 A;  2EFI A;  5FU6 C;  5GAN j;  2RHI A;  2KRO A;  1VQO A;  1YFS A;  3OYG A;  1N5Z A;  2DNU A;  2VAS A;  3DLM A;  4C8Q D;  3WVE B;  2RHQ B;  3QHS A;  1BI2 A;  2DKG A;  2GNC A;  2L8D A;  1HTT A;  4M7D E;  4HCB A;  3G6E Q;  1RI0 A;  1MMA A;  4JJB A;  3DLL A;  2AZV A;  1WHM A;  5ECA A;  3SB2 A;  5FWB A;  3X26 B;  5LJ3 d;  4PKC C;  2JW4 A;  2LT1 A;  3X28 B;  1WX6 A;  3OQ5 A;  1K9M U;  1YHQ T;  1XJW B;  3RMQ A;  3CCV T;  2MAM A;  4AMC A;  4M77 G;  2Y4Y A;  4LVJ A;  2RI3 A;  5DLO A;  1OU9 A;  1X6G A;  4TVY A;  1M2V B;  4M7D D;  1H3Z A;  2BZX A;  4G84 A;  4XTW A;  2X4Y A;  1K0X A;  2PMF A;  4JRK A;  2LJ1 A;  3D7S B;  1VQ4 T;  4YDQ A;  2IIM A;  4IUQ A;  5CVI A;  4C0G A;  2ZZG A;  1YNZ A;  3CCQ A;  1VQM A;  4LVK A;  4N4I A;  3JB9 I;  5HK0 A;  2ZZE A;  4XU2 A;  3A98 A;  4YCV A;  3ERR A;  3DB3 A;  3VU3 C;  4P75 A;  12AS A;  2DPP B;  1X01 A;  1JJC A;  2M1H A;  3RIR A;  1MUZ A;  2DIG A;  4QKU A;  1HYO A;  1B76 A;  3RNJ A;  4M75 G;  3J80 E;  2EVR A;  1PKT A;  2RK1 A;  3ZEH A;  1BU1 A;  2QHV A;  1MMD A;  1YCS B;  3G4S T;  1FXX A;  2JT4 A;  3CCU A;  1BCO A;  2EGC A;  1X75 C;  4OMF B;  2O4X A;  2BKD N;  1KC8 U;  1UG1 A;  2CT3 A;  1TG0 A;  1UB4 A;  4K86 A;  4WJ3 M;  2BZ8 A;  2YXY A;  1XQH A;  4A54 A;  4P3N A;  4ZN3 A;  1QE0 A;  2KMT A;  1QVF A;  1MHN A;  3BFM A;  3CCS A;  4KT0 E;  2ESW A;  4LDU A;  2E5A A;  3TSW A;  4LDW A;  3JB9 F;  3VV0 A;  1W4S A;  2CKK A;  3A8G B;  2D0Q B;  3CCM T;  3OBY A;  1Q95 G;  3JB9 J;  4LDX A;  3L42 A;  3TEH B;  3A8M B;  2L0A A;  1E7O A;  4AFU C;  4CC3 A;  4OGE A;  5I22 A;  2MWO A;  5LJ3 g;  4RDX A;  1YIT T;  1I07 A;  3OYC A;  3NTH A;  4OVA A;  2XID A;  3HRI A;  3GP8 A;  1H4S A;  4VUB A;  3I56 A;  3X25 B;  2EJG A;  5I21 A;  3MKD A;  2CYZ B;  3I9Q A;  3UFG A;  2DIL A;  2PVO B;  5IXB A;  2HQH A;  4ZNX A;  3LGF A;  1ZHI A;  3LSQ A;  4M78 F;  1G8X A;  3MF2 A;  2GGR A;  2LQN A;  2DD4 A;  3C94 A;  2K79 A;  3EGD B;  1AWJ A;  4PJO B;  3A7U A;  3INZ A;  4KBM B;  5A0G A;  1G5H A;  1A0N B;  4C92 B;  4JLI A;  1T0H A;  2HCK A;  2RJD A;  3HTZ A;  2XHC A;  3MEW A;  2ZT8 A;  1S72 T;  4L59 A;  1NLP C;  1BKB A;  4CC4 B;  3NHN A;  2RH2 A;  1TXQ A;  1NE8 A;  1OZ2 A;  2K4Y A;  2K7A A;  1EOV A;  3H0H A;  4C8Q F;  2ZR2 A;  1WLP B;  4FSS A;  2CZ7 B;  2QTV A;  2EQK A;  5IHN A;  2MOX A;  3JCM b;  3CCR T;  3BY7 A;  3NMZ C;  4FT2 A;  3PVL A;  3IKM B;  1MGQ A;  4CRI A;  1M90 U;  4L87 A;  1E1O A;  5GAM e;  4TVR A;  2J6K A;  5CQX A;  3G6E T;  4YRM A;  2C0T A;  4JRI A;  1LCK A;  3QO7 A;  3CPW A;  2XU8 A;  4O6J A;  2JM8 A;  4Y28 E;  2FEI A;  1NJ6 A;  4RTU A;  4M7D F;  5D7U A;  2QXF A;  2KI7 A;  1N6A A;  3OYE A;  2QTX A;  1X2G A;  4J9H A;  2KNB B;  2RHY A;  2VB6 A;  4MDX A;  1WIE A;  1YI2 Q;  2ZZF A;  2JTM A;  3TEE A;  4AG2 C;  1EZZ B;  1FX7 A;  1VA7 A;  2JMA A;  4RCC A;  1YHQ A;  4IKF A;  3CCV A;  3PVQ A;  3JCM f;  3HPW A;  4CI0 C;  3OY9 A;  1X43 A;  2LNH B;  3RES A;  2DU5 A;  2P4R A;  1ZA2 B;  4OLF A;  2ARU A;  4E7J A;  4HXJ A;  2DQ3 A;  2X3W D;  2OAW A;  1QQJ A;  1JJC B;  3EG3 A;  3V7R A;  1K73 R;  1X2K A;  1VQ4 A;  4BI3 A;  1B8A A;  4IUU A;  4LD6 A;  3VQX A;  4XTZ A;  3HFO A;  4KH1 B;  4OMQ A;  4J6X A;  4XTX A;  1VQ7 Q;  2CP2 A;  3DB4 A;  5CCA A;  3RMS A;  4NOY A;  2ODR C;  3VQY A;  5DLQ E;  3EFR A;  1H4Q A;  2ARS A;  4PLL A;  3ASK A;  3VUZ A;  1M1K C;  2RI5 A;  5GAM h;  2VXF A;  1T3S A;  2ZGW A;  2H3E B;  2KK4 A;  3G4S A;  5GAO p;  5A0L A;  2OJ2 A;  3REX A;  1HK9 A;  1RAE B;  2L89 A;  1NPR A;  4TTV A;  3PNW C;  2CZ6 B;  2F69 A;  2FZK B;  1EQR A;  2XG8 D;  3LC0 A;  1OI1 A;  1NJ5 A;  1JJ2 P;  1UGP B;  3O5Z A;  4CC7 A;  2JJ9 A;  3FJP A;  4N4H A;  5CO7 A;  2NYS A;  1PD0 A;  2VUB A;  4ZGJ B;  2RA2 A;  4OMP A;  1Y71 A;  1YJ9 Q;  4BI8 B;  2YT6 A;  1K9M R;  4A4F A;  4HWP A;  1I5L A;  1IZ6 A;  1WXU A;  3MEA A;  5GJV B;  4BE1 A;  4K87 A;  2XIC A;  3LX7 A;  3M0Q A;  3MQZ A;  1USY C;  4J9F A;  4L6V 5;  1M3A A;  2X4X A;  1YIT A;  2QA4 Q;  2KGT A;  4J9D A;  3CC4 A;  4E7I A;  1NJI U;  3CXC P;  2KY9 A;  3H0I A;  1NPP A;  4LNS A;  1K4U S;  3OYI A;  4YRC A;  1FMV A;  2DFU A;  1B70 A;  4RTW A;  2RQW A;  3I56 Q;  2YWW A;  5GAN 2;  1IL2 A;  2LQ8 A;  3A7R A;  1J3T A;  5GAN 6;  1VYU A;  2FL7 A;  1S72 A;  2RHS A;  3H6Z A;  4RQE A;  1VQ6 Q;  2V8J A;  4RTX A;  2FPF A;  3FDR A;  1M3B A;  1PNJ A;  3ICA A;  2DF6 A;  3M5A A;  4HWT A;  1M1F A;  5C52 B;  2F2X A;  1VIF A;  1X55 A;  3A32 A;  4LUD A;  2MMP A;  3M0R A;  2YLB A;  3JCM P;  1VQL Q;  3E1S A;  3CCR A;  2QI2 A;  1X56 A;  2DXC A;  3MET A;  2DL8 A;  2ROL A;  2BZY A;  2HSP A;  3GBQ A;  1KC8 R;  3VUB A;  1CKB A;  4HT8 A;  3LGL A;  2A36 A;  3S3O A;  3S3M A;  3VS2 A;  3QII A;  4YYE A;  2AHJ B;  3G6E A;  4Y92 A;  4BB7 A;  1ABQ A;  4C5G A;  1ZUU A;  2E6Z A;  2JMC A;  3W3S A;  1O75 A;  1VQO T;  1O9S A;  2A8E A;  4P3O A;  3QTC A;  4OML A;  2D6F A;  3OBW A;  5GAO l;  2DVE A;  1YI2 T;  4P72 A;  1HD3 A;  4FYV B;  5KE3 A;  3TRE A;  5L8R E;  1VQ8 Q;  1NYQ A;  2D8J A;  2WSE E;  3PFS A;  4PJM A;  5LJ5 f;  3A5Y A;  2DA9 A;  2YLC A;  1KOG A;  4YTL A;  2ZT5 A;  3A8O B;  3JV3 A;  3HXW A;  2QQB A;  2AZS A;  2NUT A;  4TVW A;  2VGN A;  4M78 C;  1KSW A;  1EX4 A;  1JXO A;  3MCA B;  3V8J A;  1Q7Y U;  2KYM A;  2RNA A;  4HWO A;  1FWZ A;  4FW2 A;  2NS6 A;  4MZT A;  1FYN A;  3CBP A;  2PNI A;  2HL3 A;  5FRN A;  2JN0 A;  1OQK A;  2A3L A;  2P0Q A;  4MZM A;  1VQ7 T;  2G6F X;  3UGQ A;  1XOV A;  2LQW A;  3KFV A;  4BDZ A;  1RI9 A;  3E9G A;  5GAM g;  4M7A E;  4FYY B;  1KQS A;  4IUR A;  2LCS A;  5HY6 A;  4C8Q C;  2HBW A;  3MEY A;  4ELZ C;  2SEM A;  5GAO r;  3VYG A;  2Y4X A;  1UJY A;  2DL7 A;  1YFN A;  3OW2 P;  4RTY A;  2ZIO A;  4PK4 A;  3M4Q A;  3M0P A;  3QO8 A;  1C0M A;  3L2V A;  5LJ5 d;  4JDS A;  4M7A D;  4XTU A;  2P0P A;  2X4J A;  4GBQ A;  2ZIM A;  4YRP A;  1EIY B;  2PUK B;  4R56 A;  4F14 A;  2E65 A;  5L23 A;  4M7D C;  1Q86 U;  4LDY A;  4LUE A;  2ZPB B;  3RBB B;  3CC2 Q;  5HCK A;  2DRK A;  1RAI B;  1YJ9 T;  2K3Y A;  3MO8 A;  2LRQ A;  3PE0 A;  4YRN A;  4J7F A;  1KQ2 A;  1BIB A;  4Z02 A;  1MV3 A;  1BB9 A;  5KYN A;  2GTO A;  1Z7M A;  3CCS T;  1EFW A;  2LJ3 A;  4JZ3 A;  3RUX A;  2RN8 A;  2DJZ A;  2JOY A;  4CC2 A;  5IAY A;  3VJP A;  2QA4 T;  4QW2 A;  1QF6 A;  1U5S A;  2PZ1 A;  4YRG A;  5D6Y A;  2HQX A;  2LTO A;  2F5K A;  2CZ1 B;  1WHL A;  3JB9 G;  2BE7 D;  1X2Q A;  2MWP A;  4RKU E;  4H2U A;  2J05 A;  4LVM A;  1K73 C;  1ZSZ C;  1T0J A;  3L2Q A;  4BI4 A;  1WPY A;  3REU A;  4JPB W;  2PTK A;  2RHS B;  3ZFJ A;  2KDS A;  4II1 A;  3I56 T;  4E7S A;  3L2W A;  2LCL A;  4X5O A;  3CC4 Q;  4OB1 B;  2E1H A;  1JO8 A;  5LJ3 f;  4XU3 A;  1VQ6 T;  4YCU A;  3LYI A;  2ZTG A;  4M78 G;  2HSE B;  4N0A C;  4UP8 A;  4KR2 A;  2MPX C;  4JS4 A;  1YIJ A;  1WI7 A;  4C5E A;  1VQL T;  3SEM A;  4NS5 A;  5IXF A;  2DMO A;  1M1G A;  4B6M A;  5HKC A;  5HK3 A;  5J3B A;  1BBU A;  3P8V A;  5GAN h;  2EBP A;  2EQM A;  3OYM A;  1WXT A;  2LJ0 A;  2AKL A;  1EVL A;  4H2W A;  2QQ9 A;  1W2B A;  4C8Q G;  2EAY A;  4J5Y A;  1BIA A;  4J9B A;  3EG9 A;  4PJO F;  5LJ3 j;  3RKX A;  3L2R A;  4PNO A;  3RGL A;  1VQ8 T;  4ZGE B;  2K9G A;  3G1Z A;  1K9M C;  2NUT B;  1YI2 A;  3NGP A;  2E3C A;  2MK5 A;  3TSZ A;  1E24 A;  4IUP A;  4IIM A;  2KRS A;  2LVM A;  3L2Z A;  1N27 A;  1JBM A;  1GXI E;  1SET A;  4NCX A;  3SHW A;  5CKB A;  3JCM J;  4M7D G;  2ZCE A;  1LPL A;  4QT7 A;  3U23 A;  3OYY A;  5KCH A;  3FB9 A;  2I4N A;  3OYF A;  2HEQ A;  2XMF A;  1I1J A;  2CT4 A;  3VYH B;  4LN2 A;  1SRL A;  5EG2 A;  3MEU A;  1Q82 U;  2DER A;  1VUB A;  4O5V A;  3HRT A;  1UJ0 A;  3KXT A;  1VQ7 A;  2JM9 A;  2ROT A;  1E6G A;  1D3B B;  2DU7 A;  5K1P A;  5K1X A;  3EH2 A;  1PSF A;  3FJ5 A;  1NG2 A;  5ELN A;  3SFM A;  1S1N A;  2ZPF B;  1K76 A;  1IO6 A;  1USY A;  2E5Q A;  4M7A F;  1R0C B;  4Z88 A;  3IG2 A;  2EGA A;  1QLY A;  2KYB A;  1T3L A;  2DK3 A;  3VS4 A;  1PRL C;  1V1C A;  4PG3 A;  3O8V A;  2JVV A;  2YSQ A;  3QZ5 B;  2E3I A;  4FW1 A;  3X24 B;  1ARK A;  2X9H A;  4C0D C;  5GMK l;  1KC8 C;  2VC8 A;  3HFV A;  3EH1 A;  3M59 A;  5KYY B;  1GBR A;  1G3T A;  1W70 A;  2GBQ A;  4YRL A;  1WFW A;  2XI9 A;  2L5Q A;  2HD0 A;  4HCZ A;  3CC2 T;  2I4M A;  1M3C A;  4KUD K;  3A5Z B;  3FLG A;  3VBB A;  1U06 A;  1G2B A;  1QCN A;  5AT1 B;  3QJY A;  1YJ9 A;  1SG5 A;  2WSF E;  4J7I A;  3TEG A;  4RCB A;  3CME Q;  1QKW A;  4AFQ C;  1TWB A;  1JEG A;  4CS4 A;  4Q6G A;  4C5I A;  1SHG A;  2RQT A;  1BK2 A;  2Z0W A;  1KHC A;  3CCE Q;  2QA4 A;  1ZSG A;  4OB0 B;  2EYW A;  1ADY A;  1Z7N A;  4OGC A;  2CGH A;  4A4K A;  1MMN A;  5GMK j;  1Q7Y R;  2QGF B;  4J83 A;  4F7U E;  2EYQ A;  1JB0 E;  1Y96 A;  1Q81 U;  1MNE A;  2X35 A;  3EGU A;  1PYS A;  1E6H A;  2PVG B;  3VS3 A;  5GAN 8;  1N9W A;  3HXU A;  5CKE A;  1OV3 A;  3CC4 T;  4FT4 A;  3HXX A;  2RQU A;  2M16 A;  1BBZ A;  1X6B A;  3P8T A;  1GL5 A;  4EMK C;  3NEM A;  4KGV B;  2X51 A;  2F5T X;  4B9W A;  4DEY A;  1AWO A;  3E9F A;  1VQ6 A;  4YCW A;  1UEC A;  1UGR B;  3HY0 A;  3HSB A;  3UPU A;  2RK2 A;  4IIO A;  1IRX A;  2YUO A;  4M78 A;  1UGV A;  2XGT A;  5J39 A;  2CUB A;  1E1T A;  2R58 A;  5GAO m;  1VQL A;  4JJC A;  1SER A;  4Z8A A;  4WTO B;  2KE9 A;  3EG9 B;  2DXB A;  1TH7 A;  2DEQ A;  4P73 C;  5KE2 A;  2R5A A;  1WHK A;  4FCY A;  1YIJ Q;  4LD9 K;  4Q5W A;  1Q86 R;  3JSC A;  5KNN A;  2CP3 A;  2LP5 A;  1NEG A;  3E2U A;  4FYW B;  4RTZ A;  5IHI A;  1YFR A;  2QEX Q;  3JCM W;  2C7I A;  1IHV A;  2KAF A;  1PG5 B;  3MHX A;  3TU4 K;  1GCQ C;  3OS0 A;  2L3S A;  1K8A U;  1D09 B;  1VQ8 A;  3JCM X;  4HT4 A;  5IH2 A;  1RAH B;  1U3O A;  2DX1 A;  4YRR A;  2E6N A;  4PJN A;  4FIB A;  11AS A;  3A7A A;  2EJ9 A;  2KQW A;  1BI0 A;  2YUQ A;  4P74 C;  2ZPG B;  4M7D A;  5CAI A;  2J7I A;  1BYM A;  1QW1 A;  4LXC A;  2AMC A;  9ATC B;  1YCY A;  1ASZ A;  1AHJ B;  3E19 A;  4LVI A;  3GNF B;  5ELO A; 
#chains in the Genus database with same CATH homology
 3VKI A;  4M77 A;  4P5N A;  3JCM Q;  3JCM c;  3PGG A;  1WU7 A;  3CBM A;  1ZBX A;  3FEO A;  2R57 A;  3PCO A;  4YRO A;  2YHT A;  3JCM h;  2GCX A;  2H3J A;  4UPA A;  2L3R A;  1XTD A;  3MF1 A;  3L4G A;  4MML A;  1NZ9 A;  4DQ2 A;  2YRV A;  1YB3 A;  2O4X B;  2ALY A;  4NL3 A;  4M75 A;  5FU7 C;  4J6W A;  3R07 A;  5CIU A;  5GAM f;  3M54 A;  4XAX B;  1JJ2 S;  3CC2 A;  3GLX A;  5CKF A;  4N0A A;  2HQE A;  3P8D A;  5AYF A;  3OSV A;  2DO3 A;  3UDC A;  2Q5I A;  3P8Y A;  1OYX A;  1Y96 B;  3MEV A;  3CCE T;  1PYS B;  2P0L A;  4ZIB A;  3S3N A;  4YRJ A;  1M8V A;  3H8Z A;  3M4Y A;  4E7H A;  1M1K U;  4C0Z A;  4DA4 A;  1VIE A;  3SWN C;  4QQG A;  1G5I A;  1J5W A;  3QNE A;  3QG1 A;  3CXC S;  3S6W A;  2K57 A;  4F7U F;  2DTO A;  2JNG A;  3OYD A;  2ZIN A;  4GLK A;  4M78 B;  2ZNI A;  4LVL A;  3OB9 A;  4M7A C;  2GFU A;  4NL2 A;  5GAM d;  1H4V B;  4TWA A;  3E9H A;  1HXD A;  4E7K A;  4E47 A;  2DXU A;  5GAN 3;  5CQY A;  2E64 A;  1QP3 A;  4H2S A;  3G7Z A;  3M55 A;  4H02 A;  3QYG B;  4ME7 A;  1VQZ A;  3QPH A;  4UP9 A;  3Q1J A;  3LW5 E;  1YIJ T;  4YPF A;  2QEX T;  1VQ5 A;  4A4E A;  1B7Y A;  4AH6 A;  4LDV A;  1H64 1;  2DZC A;  2J3M A;  4X9D A;  1C0A A;  2XTI A;  1L0W A;  4DPG A;  4PJO E;  4TVA A;  3C4S A;  5GAO n;  2QQA A;  4C92 E;  4M7D B;  1EVK A;  1NJ1 A;  2CJB A;  4H2V A;  4DOV A;  4M77 B;  3RER A;  3HXZ A;  1LJO A;  1Q7Y C;  4P3P A;  3F70 A;  2QHS A;  3NTI A;  3PCO B;  3HRS A;  4PJO D;  2QQS A;  4C92 D;  4ZTZ B;  2DDZ A;  3HL8 A;  5GMK m;  4YRF A;  1N8R U;  4HVC A;  3L4G B;  3KFU A;  3P8H A;  5GMK i;  3QO3 A;  1UGS B;  4OB3 B;  2I2L A;  2ALY B;  4M75 B;  1VQP T;  4TQD A;  1NNH A;  2DTH A;  3OW2 S;  2ZPE B;  3PIO A;  1FYF A;  4JLG A;  4ZGD B;  5LJ5 j;  3AHU A;  2HNI A;  5DY9 A;  5KCO A;  4M7A G;  3CBO A;  1QVF S;  2MI6 A;  4EMK A;  1Q86 C;  4O2D A;  3URG A;  4E51 A;  4YRT A;  4WF2 A;  2PVD B;  3CC7 T;  4EDU A;  3RF1 A;  4CH6 A;  2EKO A;  3CME A;  2QHU A;  3V7S A;  2VYT A;  3JCM V;  4WJ4 A;  1GGM A;  2I4O A;  3A74 A;  1SES A;  2E10 A;  3CCE A;  1BI1 A;  5GAN e;  3I55 T;  4BAC A;  3CCJ T;  4P73 A;  5FU6 B;  2DXT A;  1UEB A;  4EMH A;  3GNG A;  1OZ3 A;  2C06 A;  2JTF A;  2K5I A;  2MF2 A;  1M5Q 1;  2FB7 A;  3X20 B;  4XEO A;  4A4G A;  4XK8 E;  1B70 B;  2O01 E;  3QYH B;  1UGQ B;  1WGS A;  2ZR3 A;  1JJ2 A;  3V8K A;  2BIV A;  2RM4 A;  5IT9 E;  3PT9 A;  4FSX A;  2OAU A;  4OB2 B;  3A8L B;  1B7Y B;  3M53 A;  3OS5 A;  1RL2 A;  3RKW A;  3QUI A;  4RMF A;  3M56 A;  4XU1 A;  1NJ2 A;  3JRZ A;  2LQK A;  4TVA B;  1KD1 U;  2QEX A;  2KVQ G;  1KMN A;  3LWH A;  5LJ3 h;  1WYD A;  1R8O B;  4MDW A;  1ASY A;  3OYJ A;  2ZZD A;  4BY6 C;  4C0D B;  3CXC A;  1WQW A;  5J26 A;  2ZT7 A;  1Y7X A;  1V29 B;  3HXV A;  2IG0 A;  2P5I A;  3RL6 A;  5C0M A;  3BDL A;  4JS5 A;  3HRU A;  1H4T A;  4H2X A;  3OS1 A;  4JUV A;  3HFN A;  4CH4 A;  4OF1 A;  4C92 F;  4BDY A;  1WLE A;  4UP7 A;  4BUG A;  1DJ7 B;  3MP6 A;  1M4Z A;  1Q82 C;  5GAN 5;  3QKJ A;  2CIM A;  2XDD A;  5A2Q E;  2HAX A;  2GQV A;  5GMK e;  1I81 A;  3P8B B;  4HWS A;  1RIQ A;  3BJU A;  3JB9 H;  1N9R A;  1G3Y A;  3HFZ A;  2V8I A;  4H2T A;  4PHC A;  3HRK A;  3CD6 T;  3OYN A;  4ZTJ A;  4X34 A;  4M77 E;  3SWN A;  5C6S A;  5GAN d;  1VQP A;  4HA8 A;  4EMK B;  2G3R A;  2DD5 A;  3PTA A;  5D6W A;  2DIQ A;  3PMI A;  4TQF A;  2ZXF A;  4M7A A;  5FRO A;  3OYB A;  2FHD A;  2Y90 A;  4QVD A;  4M77 D;  3CC7 A;  3FRN A;  2E70 A;  3SD4 A;  3E9I A;  5HGQ A;  1SSF A;  2FYK A;  3CCL T;  1G51 A;  4M75 E;  3IAL A;  4QVC A;  1YBY A;  4FL6 A;  2EIF A;  2Q5H A;  3QBY A;  4C0F A;  2WSC E;  3OYL A;  2Q7H A;  4QQD A;  4FU6 A;  5IN1 A;  2LC4 A;  3I55 A;  5GMK h;  3CCJ A;  3GOX A;  1KG1 A;  3VQW A;  2IVW A;  1X6O A;  4P72 C;  3DSQ A;  1Q81 C;  3CMA T;  2QQR A;  2OTJ T;  4ATO A;  3OW2 A;  1G3S A;  1I8F A;  4M75 D;  5FLX E;  2RJC A;  4K88 A;  4KUL A;  1P92 A;  4V2S A;  2P4T A;  3UGT A;  2AKW A;  4HCC A;  2I4L A;  2E41 A;  4QQ6 A;  4XTV A;  1WJQ A;  2ZPI B;  5CR2 A;  4F7U G;  3QZ9 B;  2DTI A;  4J15 A;  1W66 A;  4CS2 A;  3EFS A;  2ART A;  4JJN K;  2VXE A;  4BWA A;  4B9X A;  3M4P A;  4HT9 A;  3PZC A;  5GAN g;  1LNX A;  2RD1 A;  4Q15 A;  2EL9 A;  5FRM A;  4H2X B;  4JRQ A;  1M90 C;  3JCM e;  3G71 T;  1K8A C;  2RJF A;  1VQN T;  3HKS A;  4MMK A;  5FU7 B;  1VQ5 T;  3L2U A;  4P71 C;  3RAC A;  2VGM A;  4PLI A;  4C8Q A;  2ZNJ A;  2IY5 A;  5C51 B;  4RG2 A;  1LYL A;  3T9N A;  4ZTF A;  3NEL A;  2K5L A;  5KH6 A;  4X9C A;  3HFZ B;  4N4G A;  2NLU A;  2EQU A;  3GIB A;  1KMM A;  2K2V A;  2WAC A;  1KQS S;  4Y91 A;  3SWN B;  1EIF A;  3LLR A;  3FC3 A;  4KQE A;  4A4H A;  2DAQ A;  1YJW T;  4EMG A;  3OA6 A;  4BE2 A;  3ER0 A;  1VQ9 T;  1U1S A;  2PQW A;  3CD6 A;  2DQ0 A;  2RHZ A;  2A7Y A;  4M7A B;  4R55 A;  2K5F A;  3PMT A;  4M77 F;  1QVG S;  3R6O A;  2ZT6 A;  3BDU A;  3HP9 A;  4CH3 A;  4RG8 A;  3J81 E;  2VV5 A;  4QVZ A;  1ATI A;  3HY1 A;  4GY5 A;  3UWN A;  5F5W A;  4IUV A;  4XQ3 A;  1B34 A;  2RJE A;  5DM7 R;  4BW9 A;  3TUP A;  2M0O A;  3M4G A;  4PJO C;  2J3L A;  4YP0 A;  3CCL A;  4H2Y A;  4C92 C;  2QHT A;  1WJR A;  3GF5 A;  3RKY A;  1ZQ1 A;  4M75 F;  3LSS A;  3CME T;  4OP0 A;  2D9T A;  2K3X A;  3SDZ A;  1HC7 A;  2JUF A;  2PUO B;  3CMA A;  5C53 B;  2AKW B;  3HHT B;  2OTJ A;  2GF7 A;  1NJI C;  2ZPH B;  5GAM j;  3JCM d;  2RHU A;  2GFA A;  3QXE B;  3V8L A;  3OD1 A;  3OSS C;  3I7F A;  4YRE A;  3QJ6 A;  5I2M A;  1EIY A;  4F7U A;  2X4W A;  3CCM A;  2RB6 A;  3L1A A;  1M9S A;  5CKD A;  1LOJ A;  4HWR A;  1BBW A;  4RMO A;  2OTL T;  1W2B S;  3BW1 A;  3LH0 A;  3OYH A;  1U1T A;  2LCC A;  2LX9 A;  4EO4 A;  3M9Q A;  2CJ9 A;  4P75 C;  3KBG A;  1YJN T;  5LJ5 e;  5CKH A;  4UC4 A;  4C8Q B;  5M9O A;  4YRS A;  2IY5 B;  3G71 A;  1JRI A;  4EX5 A;  3QDR B;  1VQN A;  2P0K A;  3QSU A;  1VQK T;  3CPF A;  2ZCF B;  2M9U A;  5GAO q;  1N9S A;  4HKE A;  2DZ9 A;  5GAN 4;  2QDY B;  1QP2 A;  4BE0 A;  2Q7E A;  2XD0 A;  3MP8 A;  3UT1 A;  2CS7 A;  3OMC A;  2AMC B;  3A31 A;  2Q7G A;  3C12 A;  4PJO G;  2C8M A;  1U8R A;  4KUI A;  4C92 G;  4YRQ A;  2FVU A;  2LT4 A;  2RO0 A;  2JZ2 A;  1KQ1 A;  1N8R C;  2XDB A;  2PME A;  1XNI A;  2CZ0 B;  4ZTU B;  4MZP A;  1WJS A;  3OYA A;  1YJW A;  4J8O A;  1G5V A;  3C95 A;  3JCM g;  2ODR D;  3WXM B;  1VQ9 A;  3OMG A;  2HBP A;  1WNL A;  3QO5 A;  5LJ5 h;  4D6W A;  3WVD B;  4G85 A;  3J7A F;  2CJA A;  3EAE A;  1NJ8 A;  3NEN A;  3A8H B;  5LL6 S;  1B34 B;  4CH5 A;  4J6Y A;  4XTY A;  2G4C A;  2RHQ A;  3OYK A;  1G3W A;  3ZBD A;  1NYR A;  1I4K 1;  2XK0 A;  3DKM A;  4XEM A;  2BUD A;  4CS3 A;  2RI2 A;  1QVP A;  5E3I A;  3CCQ T;  1VQM T;  4PL6 A;  4BY6 B;  3LWI A;  1D3B A;  1X2H A;  2PU9 B;  3M57 A;  3GPL A;  1BI3 A;  5LJ3 e;  4A53 A;  2RHX A;  1QVG A;  2E12 A;  1Y07 A;  5CK9 A;  3HXY A;  4E7L A;  3ME9 A;  4P71 A;  2LDM A;  4F7U B;  3TCJ A;  3CCU T;  1PSE A;  3IKL A;  1YFT A;  1ADJ A;  3OS2 A;  4JRP A;  4KR3 A;  3V7C A;  4BD3 A;  4YRK A;  4M77 C;  4RQF A;  4C5H A;  3A5Z A;  4FM4 B;  1KHI A;  2B8A A;  2KSS A;  3M58 A;  2OTL A;  4P74 A;  1IRE B;  1KD1 C;  4ELY C;  1YJN A;  2XKO C;  4WI1 A;  3N5B B;  5A0D A;  5I2S A;  3PIP A;  2V8K A;  4YRI A;  2EWN A;  5D6X A;  1SRY A;  3CPW S;  3JB9 D;  3CEY A;  4M78 E;  4M75 C;  3KUF A;  3TEH A;  1YGB A;  1VQK A;  1E22 A;  3JAM E;  3FIF A;  1K73 U;  3MP1 A;  3WQZ A;  1X54 A;  4DOW A;  4ZN1 A;  5GAN f;  4IUT A;  4EPC A;  4XU0 A;  3UH0 A;  4L5G A;  3NTK A;  4C8Q E;  5GAN 7;  4M78 D;  2EJF A;  4PJO A;  2LNV A;  3NFC A;  4C92 A;  2XDP A;  3VQV A;  2EQJ A;  3NET A;  5LJ5 g;  2R5M A;  3CMQ A;  1WQ7 A;  2EFI A;  5FU6 C;  5GAN j;  2RHI A;  1YFS A;  1VQO A;  3OYG A;  3DLM A;  2RHQ B;  3WVE B;  4C8Q D;  3QHS A;  1BI2 A;  2DKG A;  2L8D A;  1HTT A;  4M7D E;  4HCB A;  1RI0 A;  3DLL A;  3SB2 A;  3X26 B;  5LJ3 d;  4PKC C;  2LT1 A;  3X28 B;  3OQ5 A;  1K9M U;  1YHQ T;  3RMQ A;  3CCV T;  2MAM A;  4M77 G;  2Y4Y A;  4LVJ A;  2RI3 A;  5DLO A;  4TVY A;  4M7D D;  1H3Z A;  4G84 A;  4XTW A;  2X4Y A;  2PMF A;  4JRK A;  1VQ4 T;  4YDQ A;  4IUQ A;  5CVI A;  4C0G A;  2ZZG A;  3CCQ A;  1VQM A;  4LVK A;  4N4I A;  3JB9 I;  5HK0 A;  2ZZE A;  4XU2 A;  4YCV A;  3ERR A;  3DB3 A;  3VU3 C;  4P75 A;  12AS A;  2DPP B;  1X01 A;  1JJC A;  2M1H A;  3RIR A;  2DIG A;  1B76 A;  4M75 G;  3J80 E;  2RK1 A;  3ZEH A;  2QHV A;  3G4S T;  1FXX A;  3CCU A;  1X75 C;  4OMF B;  2O4X A;  2BKD N;  1KC8 U;  1UB4 A;  4K86 A;  4WJ3 M;  1XQH A;  4A54 A;  4P3N A;  4ZN3 A;  1QE0 A;  2KMT A;  1QVF A;  1MHN A;  3BFM A;  3CCS A;  4KT0 E;  4LDU A;  2E5A A;  4LDW A;  3JB9 F;  3VV0 A;  1W4S A;  2CKK A;  3A8G B;  2D0Q B;  3CCM T;  3OBY A;  3JB9 J;  4LDX A;  3L42 A;  3TEH B;  3A8M B;  4OGE A;  2MWO A;  5LJ3 g;  4RDX A;  1YIT T;  3OYC A;  3NTH A;  4OVA A;  2XID A;  3HRI A;  3GP8 A;  1H4S A;  4VUB A;  3I56 A;  3X25 B;  2EJG A;  5I21 A;  2CYZ B;  3UFG A;  2PVO B;  3LGF A;  1ZHI A;  3LSQ A;  4M78 F;  3MF2 A;  2DD4 A;  3C94 A;  4PJO B;  3A7U A;  3INZ A;  4KBM B;  5A0G A;  1G5H A;  4C92 B;  4JLI A;  2RJD A;  3HTZ A;  2XHC A;  3MEW A;  2ZT8 A;  1S72 T;  4L59 A;  1BKB A;  2RH2 A;  1NE8 A;  1OZ2 A;  2K4Y A;  1EOV A;  4C8Q F;  2ZR2 A;  2CZ7 B;  2EQK A;  3JCM b;  3CCR T;  3BY7 A;  4FT2 A;  3IKM B;  1MGQ A;  4CRI A;  1M90 U;  4L87 A;  1E1O A;  5GAM e;  4TVR A;  5CQX A;  3G6E T;  4YRM A;  4JRI A;  3QO7 A;  3CPW A;  2XU8 A;  4O6J A;  4Y28 E;  1NJ6 A;  4M7D F;  2QXF A;  1N6A A;  3OYE A;  2QTX A;  1X2G A;  2RHY A;  4MDX A;  2ZZF A;  2JTM A;  3TEE A;  1FX7 A;  4RCC A;  1YHQ A;  4IKF A;  3CCV A;  3JCM f;  3HPW A;  4CI0 C;  3OY9 A;  3RES A;  2DU5 A;  4OLF A;  2ARU A;  4E7J A;  2DQ3 A;  1JJC B;  3V7R A;  1VQ4 A;  4BI3 A;  1B8A A;  4IUU A;  4LD6 A;  3VQX A;  4XTZ A;  3HFO A;  4J6X A;  4XTX A;  3DB4 A;  5CCA A;  3RMS A;  4NOY A;  2ODR C;  3VQY A;  5DLQ E;  3EFR A;  1H4Q A;  2ARS A;  4PLL A;  3ASK A;  3VUZ A;  1M1K C;  2RI5 A;  5GAM h;  2VXF A;  2ZGW A;  2KK4 A;  3G4S A;  5GAO p;  5A0L A;  3REX A;  1HK9 A;  2L89 A;  1NPR A;  4TTV A;  3PNW C;  2CZ6 B;  2F69 A;  1EQR A;  2XG8 D;  3LC0 A;  1OI1 A;  1NJ5 A;  1UGP B;  3FJP A;  4N4H A;  5CO7 A;  2VUB A;  4ZGJ B;  2RA2 A;  1Y71 A;  4BI8 B;  4A4F A;  4HWP A;  1I5L A;  1IZ6 A;  3MEA A;  4BE1 A;  4K87 A;  2XIC A;  3LX7 A;  3MQZ A;  1USY C;  4L6V 5;  2X4X A;  1YIT A;  3CC4 A;  4E7I A;  1NJI U;  2KY9 A;  1NPP A;  4LNS A;  3OYI A;  4YRC A;  1B70 A;  5GAN 2;  1IL2 A;  2LQ8 A;  3A7R A;  5GAN 6;  2FL7 A;  1S72 A;  2RHS A;  3H6Z A;  4RQE A;  2V8J A;  3FDR A;  3ICA A;  3M5A A;  4HWT A;  5C52 B;  1M1F A;  1VIF A;  1X55 A;  3A32 A;  2MMP A;  2YLB A;  3JCM P;  3E1S A;  3CCR A;  2QI2 A;  1X56 A;  2DXC A;  3MET A;  3VUB A;  4HT8 A;  3LGL A;  3S3O A;  3S3M A;  3QII A;  4YYE A;  2AHJ B;  3G6E A;  4BB7 A;  4C5G A;  2E6Z A;  3W3S A;  1O75 A;  1VQO T;  1O9S A;  2A8E A;  4P3O A;  3QTC A;  2D6F A;  3OBW A;  5GAO l;  2DVE A;  1YI2 T;  4P72 A;  5KE3 A;  3TRE A;  5L8R E;  1NYQ A;  2WSE E;  3PFS A;  5LJ5 f;  3A5Y A;  2YLC A;  1KOG A;  4YTL A;  2ZT5 A;  3A8O B;  3HXW A;  2QQB A;  4TVW A;  2VGN A;  4M78 C;  3V8J A;  3MCA B;  1Q7Y U;  4HWO A;  1FWZ A;  2NS6 A;  4MZT A;  3CBP A;  5FRN A;  2JN0 A;  2A3L A;  4MZM A;  2P0Q A;  1VQ7 T;  3UGQ A;  1XOV A;  4BDZ A;  3E9G A;  5GAM g;  4M7A E;  1KQS A;  4IUR A;  5HY6 A;  4C8Q C;  3MEY A;  4ELZ C;  5GAO r;  3VYG A;  2Y4X A;  2ZIO A;  3M4Q A;  3QO8 A;  3L2V A;  5LJ5 d;  4JDS A;  4M7A D;  4XTU A;  2P0P A;  2X4J A;  4YRP A;  2ZIM A;  1EIY B;  2PUK B;  4R56 A;  2E65 A;  4M7D C;  1Q86 U;  4LDY A;  2ZPB B;  1YJ9 T;  2K3Y A;  3MO8 A;  2LRQ A;  4YRN A;  4J7F A;  1KQ2 A;  1BIB A;  4Z02 A;  1Z7M A;  3CCS T;  1EFW A;  3RUX A;  2DJZ A;  2JOY A;  5IAY A;  3VJP A;  2QA4 T;  4QW2 A;  1QF6 A;  4YRG A;  5D6Y A;  2HQX A;  2LTO A;  2F5K A;  2CZ1 B;  3JB9 G;  2MWP A;  4RKU E;  4H2U A;  4LVM A;  1K73 C;  3L2Q A;  4BI4 A;  1WPY A;  3REU A;  2RHS B;  3ZFJ A;  2KDS A;  4II1 A;  3I56 T;  3L2W A;  2LCL A;  4X5O A;  4OB1 B;  2E1H A;  5LJ3 f;  4XU3 A;  1VQ6 T;  4YCU A;  3LYI A;  2ZTG A;  4M78 G;  4N0A C;  4UP8 A;  4KR2 A;  4JS4 A;  1YIJ A;  1VQL T;  4C5E A;  4NS5 A;  1M1G A;  5HKC A;  5HK3 A;  5J3B A;  1BBU A;  3P8V A;  5GAN h;  2EQM A;  3OYM A;  1EVL A;  4H2W A;  2QQ9 A;  1W2B A;  4C8Q G;  2EAY A;  4J5Y A;  1BIA A;  4PJO F;  5LJ3 j;  3RKX A;  3L2R A;  4PNO A;  3RGL A;  1VQ8 T;  4ZGE B;  3G1Z A;  1K9M C;  1YI2 A;  2E3C A;  1E24 A;  4IUP A;  2LVM A;  3L2Z A;  1N27 A;  1JBM A;  1GXI E;  1SET A;  4NCX A;  5CKB A;  3JCM J;  4M7D G;  2ZCE A;  3OYY A;  5KCH A;  3FB9 A;  2I4N A;  3OYF A;  3VYH B;  5EG2 A;  3MEU A;  1Q82 U;  1VUB A;  4O5V A;  3HRT A;  3KXT A;  1VQ7 A;  1D3B B;  2DU7 A;  5K1P A;  5K1X A;  1PSF A;  5ELN A;  3SFM A;  2ZPF B;  1USY A;  2E5Q A;  4M7A F;  3IG2 A;  2DK3 A;  4PG3 A;  3O8V A;  2JVV A;  3QZ5 B;  3X24 B;  4C0D C;  5GMK l;  1KC8 C;  2VC8 A;  3HFV A;  3M59 A;  1G3T A;  4YRL A;  2XI9 A;  2L5Q A;  2HD0 A;  4HCZ A;  3CC2 T;  2I4M A;  4KUD K;  3A5Z B;  3FLG A;  3VBB A;  3QJY A;  1YJ9 A;  2WSF E;  4J7I A;  3TEG A;  4RCB A;  4CS4 A;  4Q6G A;  4C5I A;  1KHC A;  2QA4 A;  4OB0 B;  1ADY A;  1Z7N A;  4OGC A;  2CGH A;  4A4K A;  5GMK j;  4J83 A;  4F7U E;  2EYQ A;  1JB0 E;  1Y96 A;  1Q81 U;  1PYS A;  2X35 A;  2PVG B;  5GAN 8;  1N9W A;  3HXU A;  5CKE A;  3CC4 T;  4FT4 A;  3HXX A;  2M16 A;  3P8T A;  4EMK C;  3NEM A;  2F5T X;  4B9W A;  3E9F A;  1VQ6 A;  4YCW A;  1UGR B;  3HY0 A;  3HSB A;  3UPU A;  2RK2 A;  4M78 A;  2XGT A;  5J39 A;  1E1T A;  2R58 A;  5GAO m;  1VQL A;  1SER A;  2DXB A;  1TH7 A;  2DEQ A;  4P73 C;  5KE2 A;  2R5A A;  4LD9 K;  4Q5W A;  3JSC A;  5KNN A;  1YFR A;  3JCM W;  2C7I A;  2KAF A;  3MHX A;  3TU4 K;  3OS0 A;  1K8A U;  1VQ8 A;  3JCM X;  4HT4 A;  4YRR A;  2E6N A;  11AS A;  4FIB A;  3A7A A;  2EJ9 A;  2KQW A;  1BI0 A;  4P74 C;  2ZPG B;  4M7D A;  5CAI A;  1BYM A;  1QW1 A;  2AMC A;  1YCY A;  1ASZ A;  1AHJ B;  3E19 A;  4LVI A;  3GNF B;  5ELO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...