5F5WA

Crystal structure of the alpha subunit of glycyl trna synthetase (glyrs) from aquifex aeolicus in complex with an analog of glycyl adenylate (gly-sa)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
283
structure length
283
Chain Sequence
b'MYFQDIIMTLHKFWAEKGCLIWQPYDVEVGAGTMNPATFLKVLGKKPWNVAYVEPSRRPQDGRYGENPNRLQHYYQFQVILKPAPRNPQEIYLESLERLGINPLEHDIRFVEDDWESPTLGAWGLGWEVWLDGMEITQFTYFQQAGGLDLDEISVEITYGLERIAMYIQDKDSVFDIEWKEGITYGEIFKRSEWEWSKYNFELADTDMLFQVYEMFEKESKRMVEEGLIFPAYDYLLKCSHVFNILDARGAISVQERARYIRRMNNLAREIAKLYLQVFENVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine--tRNA ligase alpha subunit
publication title Structural Insights into the Polyphyletic Origins of Glycyl tRNA Synthetases.
pubmed doi rcsb
source organism Aquifex aeolicus (strain vf5)
molecule tags Ligase
total genus 110
structure length 283
sequence length 283
chains with identical sequence B, C, D, E
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 5f5wA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5f5wA01
5C51B 1E1OA 2C7IA 4H2YA 3IKLA 2EJ9A 3MF2A 4WJ3M 2ZGWA 1X2HA 2E3CA 1EIYA 4HA8A 3HFVA 1ATIA 2DU5A 1B76A 3A5ZA 4YROA 1EFWA 4UP9A 4HVCA 4HWRA 4KR2A 2E41A 2EJGA 2IY5B 1FYFA 3HXZA 1GGMA 2E10A 4UP8A 4YCVA 2Q7GA 1NJ5A 4EX5A 4CS4A 4H2SA 1X54A 4X5OA 3RACA 4YRKA 4TVAA 4YRNA 2ARUA 4XTXA 4NCXA 1E22A 3A5YA 5ELOA 4DQ2A 1HTTA 2ZZGA 4YP0A 4ZIBA 1HXDA 4TQDA 11ASA 2ALYB 1G5IA 2P0LA 2EJFA 3NENA 4P74C 1NJ1A 3E9HA 1H4QA 1J5WA 1SRYA 3HY0A 2DTHA 1BBUA 1X56A 3HRIA 1NYQA 4UP7A 3PCOB 3M4PA 2E64A 3A74A 4YPFA 3V8JA 2I4LA 4HWTA 4UPAA 4P72C 1H4SA 2AKWA 3W3SA 2P5IA 1WU7A 1WNLA 3UGTA 3A7AA 1PYSB 3E9IA 4TVWA 4YRGA 1H4TA 4P3PA 4TTVA 1B70A 3RKWA 4CH4A 2Q5HA 2Q7EA 2ODRC 1LYLA 3HY1A 5KNNA 4CS2A 1EIYB 4ZTUB 1E24A 2ZNIA 3ICAA 1WYDA 4YRPA 2J3LA 3OD1A 3L4GA 5F5WA 4P71A 3QTCA 4K86A 2ARTA 1ASYA 1PYSA 2ZIOA 3REUA 2RHSA 2Q7HA 2DZ9A 3HRKA 1Z7NA 2ODRD 1E1TA 2I4NA 3V8LA 4Q15A 4YYEA 4H2WA 1NNHA 3IALA 1G5HA 4TVAB 2ARSA 4EO4A 4K88A 4RDXA 1SERA 1SESA 12ASA 3VBBA 3P8YA 4H2VA 3RKYA 2G4CA 3TUPA 4YCWA 4YRJA 3RGLA 2HNIA 2QHTA 3P8TA 3M4QA 3RL6A 2ZT6A 4CH6A 4XTYA 4XU3A 3DSQA 3FJPA 3MF1A 3HXXA 4LNSA 1USYA 4E51A 3HTZA 5K1PA 4P3NA 1KMMA 4WF2A 2ZT8A 2DJZA 3A7RA 2RHQA 1B8AA 1JJCA 1EVKA 2E65A 4XU1A 1YFSA 4AH6A 1ADYA 1EQRA 3P8VA 1HC7A 2E5AA 1YGBA 2AKWB 1W66A 4XEOA 1WLEA 1Z7MA 3VQXA 1EVLA 3RKXA 2EL9A 4KR3A 1B70B 1QF6A 2DXUA 2QHVA 4P75A 2CJ9A 4XEMA 2J3MA 3I7FA 4H2XA 4BW9A 1KMNA 3VQYA 3HFZB 4RQEA 1YFRA 2QHSA 4G85A 3RUXA 2ZTGA 3V7CA 4YRFA 1X01A 3L4GB 3IKMB 4YRLA 4YCUA 5ELNA 1RIQA 4CH3A 3EFRA 4P72A 2RHSB 3L1AA 2ZZFA 2AMCA 4Q6GA 1L0WA 2PMFA 1C0AA 2CJBA 2DQ0A 2ZR3A 4XU0A 4K87A 3TEGA 3HFZA 1BIBA 4YRSA 1YFTA 2PMEA 4H2UA 2DZCA 3CMQA 3WQZA 3VQVA 1EOVA 3EFSA 1B7YA 3BJUA 3QO5A 2ZR2A 4YRRA 4TVYA 5E3IA 2Q5IA 4OLFA 3UGQA 2EAYA 4P71C 1ADJA 3UH0A 1NYRA 3QO8A 4P73A 2DU7A 2RHQB 4HWSA 3IG2A 1JJCB 4DPGA 3VQWA 1WQWA 1G51A 1WPYA 1ASZA 4YRIA 3MEYA 4CH5A 4RMFA 2DQ3A 4YDQA 1NJ6A 2DTIA 2EWNA 2C8MA 4YRTA 2ZT5A 4PG3A 4RQFA 1KOGA 3HXWA 2CGHA 5C53B 1NJ2A 2DXTA 4H2XB 3G1ZA 3PZCA 5K1XA 3RF1A 2I4MA 2DVEA 2ZIMA 4TQFA 1USYC 3R07A 1VQZA 3QNEA 1SETA 3TEHA 2ZT7A 1X55A 4H02A 4XTZA 3LSSA 2AMCB 2ZZEA 2CJAA 4YRMA 3BFMA 3REXA 4P74A 3A7UA 4OP0A 4P75C 3NELA 4XTUA 2IY5A 2DDZA 2ZINA 3HXUA 1B7YB 4G84A 1IL2A 2FYKA 1BBWA 4WJ4A 4WI1A 2XGTA 4YRQA 4XU2A 3QO7A 3L2ZA 5C52B 2E1HA 4YREA 3V8KA 2I4OA 3HXVA 5HGQA 4J15A 4L87A 4BWAA 3LC0A 2DTOA 2ALYA 3NETA 4ZTZB 3ERRA 2CIMA 2ZCEA 4O2DA 4CS3A 4PHCA 3NEMA 4YRCA 2ZXFA 1WQ7A 4P3OA 3V7RA 3A32A 3PCOA 4XTWA 4HWPA 1N9WA 2ZNJA 1BIAA 2XTIA 2QHUA 2DEQA 4XTVA 3TEHB 1YB3A 3LSQA 3A31A 3HXYA 4TWAA 4P73C 3KFUA 4HWOA 2DKGA 1H4VB 3V7SA 3UFGA 4KQEA 1QE0A 1X2GA 4H2TA 3RIRA 1NJ8A
chains in the Genus database with same CATH superfamily
2X9YA 1YW0A 2C7IA 3TKLB 3OYXA 3HKDE 4ASKA 1VCSA 1Z8UA 1ATIA 1KEYA 3EHZA 2XQAA 4HVCA 2WY2A 4HEAA 3PDYA 5LHIB 2IC9A 1FYFA 2K5BB 5AQSB 3MXZA 4XAXB 5AQGB 3HXZA 1GGMA 2E10A 4U72A 4ZXLA 2Q7GA 1LVFA 4U31A 4CS4A 4UV9B 5AQHB 1ZEEA 3ZYMA 4XTXA 4HWCA 4E7ZA 3A5YA 5ELOA 4DV0T 4ZIBA 2KNDA 1HXDA 4TQDA 3Q2MA 3U78A 1E7PA 3KVAA 4P74C 4UV8B 2MAWA 4EEBA 3ETUA 3Q5WA 3E9HA 1J5WA 1H4QA 4HFEA 4KUMB 4EZ4A 3ZJ2A 2W0GA 3VR8A 3HKBE 5F3JA 2Z6EA 4IL4A 4KI0F 2LJLA 1NYQA 4UVAB 3N9MA 3MK7C 2FJDA 4P72C 1KNZA 1VOMA 5L3FB 2BS2A 3A7AA 2XAQB 3E9IA 2V5CA 4CH4A 1B70A 3RKWA 2LKHA 3AVRA 2XM2A 2Q5HA 3CX7B 3O9XA 2ODRC 5HYAA 3ETVA 1FMWA 3C4XA 1G8XA 4X66T 1E24A 4IDZA 1UK5A 4AKLA 4AIUA 2CWOA 1V9DA 1ZP0A 4C91A 1GQEA 4PJJA 3OVUA 2ZIOA 5L3CB 1W09A 3ZMZB 2LE8A 4JI7T 2ODRD 1E1TA 4CI1B 3LK2B 5LMUT 4Q15A 2YINA 3N9LA 4YYEA 4H2WA 3AE7A 3RYHE 4HT4A 3L3PA 4TVAB 1CUNA 5LJMA 2XTLA 4EO4A 5FKYA 3AAAB 3O1JA 1SERA 1SESA 4YJ2E 1KK7A 3H37A 4H2VA 1NAFA 2E9XA 2E8IA 3LDQB 3WAJA 4QH5A 2UUAT 1MNEA 2LM2A 4EGWA 3KINB 4CH6A 2X0HA 4DV1T 4XU3A 5AFUL 3UU6A 3FJPA 2LSGA 1O3XA 3HXXA 1XDPA 1USYA 3N9OA 3RRCA 2BBJA 2KT9A 2RHQA 4DR5T 4AH6A 4JI6T 1D1BA 4YJ3E 4X5TA 3ZC1A 4ERRA 2XAFB 1WLEA 3K3QC 4ZHQE 3VQXA 4GYSA 4EIWA 2V7IA 1OWAA 2JQKA 3NRXA 2WP9A 2NW8A 3X1DA 2H3RA 3ANWB 2K3WA 2J3MA 2W2UA 4QXBB 2VURA 1D1CA 4N78D 2VK9A 2CHNA 3AEAA 1UGOA 5JH7E 4RQEA 2Q9QB 2XZEA 3ZMVB 1S94A 4UF0B 5FNVE 4UEMA 4JI0T 3L4GB 4ILUA 4YRFA 3IKMB 4YTMA 4AKHA 1WYBA 3OPCA 4LVIA 4UVCB 4YCUA 1MIYA 2LKGA 3E0ZA 2E5VA 5FXWA 5IYZE 3C51A 4YSZA 2UXXB 2V7JA 2YEVC 2YDQA 4HFHA 4EOZB 2DI4A 1C0AA 4U2YA 5LYJE 2ZR3A 4XU0A 3S4UA 5C3JA 3RQUA 2W00A 3BK9A 2CWYA 4PNIA 3PUWF 5C8YE 1EOVA 3AA1B 4P0BA 4AXPA 1B7YA 1VRBA 4MLKA 4YRRA 4TVYA 1IZNB 4OLFA 5JDMA 4CN6A 2VVSA 1ADJA 1NYRA 2VKHA 4PW8A 2DU7A 1JJCB 1G51A 4U7YA 4G63A 5LP6E 2UXDT 4HWHA 4ISTA 1IBLT 1I6ZA 4YDQA 4NUVA 2QYWA 1NJ6A 4NXNT 1FJGT 4PG3A 2V7LA 3AEEA 3HXWA 1US7B 3B13A 4H2XB 3G1ZA 5K1XA 3RF1A 4AQFA 5AQTB 4A97A 1T7SA 4TQFA 2LSYA 1SUMB 1VQZA 3LBXA 5AQLB 1SETA 3GA8A 1VCTA 2QA7A 3UTKA 1IAPA 1X55A 3BQIA 3RIUC 4XTZA 2JIWA 5FY0A 2CA5A 4DR4T 5HEOA 2FJEA 3FZLB 2JRKA 2BS3A 2XPKA 4P75C 3NELA 1UURA 2DWKA 3LK3B 1HX8A 2JMHA 2L8KA 5LOVE 1IL2A 2OA5A 2LHRA 2BVMA 4WYVA 3UUBA 1HS7A 3RC3A 1Y64B 2LT3A 1BR2A 4YREA 2I0MA 1OEDB 2P9BA 3HXVA 4TWFA 1X79A 2CBJA 4JI1T 5KDMC 2IDOB 3KV6A 3UU3A 4L87A 4TV8E 4Q25A 2C5JA 2ALYA 2HN2A 4MFRA 4TV9E 1EZ3A 4ZTZB 5EK4A 2Q9QC 4O2DA 1IJ5A 2I6HA 5JTGA 2NS6A 1M62A 2NW9A 2C5IT 3SOLA 4B3MT 4LF4T 4XTWA 2YK0A 1ZKEA 2K9AA 3AE8A 5LHHB 3HKCE 4PK4A 2QHUA 3C50A 2YDSA 4ZI3C 4XTVA 3TEHB 4JUYA 3A31A 3HXYA 5F8PA 4P73C 4DR3T 2NP9A 3UFGA 3ZT5A 3NWIA 3RIRA 2RPAA 3AXJA 4ZI2D 4ZS3A 3MF2A 2ZGWA 3KFWX 2BG9A 3FBLA 4PFOA 4HFDA 4IE0A 1WR6A 3QB5A 4ZI3D 3AAIA 3M3ZB 1YKHB 1EFWA 4AISA 2LSKA 4UP9A 4HWRA 4DUZT 3CQGB 4ZZBA 2E41A 4Z91A 3ZMUB 1OEDE 2RP4A 4U2ZA 1D0XA 1JNZA 1OXZA 5JR9B 5L4EA 2IC6A 2CE7A 2UU9T 4O8SA 5ABFA 1NJ5A 4EV6A 1UCUA 2BBHA 3ZT6A 4YHJA 4H2SA 2E5LT 3CIRA 3RI5A 3RIAA 4OHFA 2ZZGA 4YP0A 1N32T 2BS4A 3PURA 5FVKA 3A8YC 1G5IA 2P0LA 4EXTA 2B1EA 1WYCA 1SE7A 2W61A 1NWMX 2DTHA 4NIQA 1HNWT 3T8OA 3V5SA 1X56A 3TLVA 4YHHT 4ILCA 1N33T 3HRIA 4MALA 4UP7A 2PBIA 3PCOB 2E64A 2GK9A 3A74A 3V8JA 4UPAA 1H4SA 2AKWA 3JCFA 3AA7B 4BJMA 4YTPA 4F6RC 4QH1A 4X20E 2NOXA 3CVRA 4I0UA 3RKOA 5FL0A 2NR4A 5DJQC 1H4TA 4JV5T 4TTVA 4YRGA 1U4QA 3UUMA 3CQXC 4ZI7E 3HY1A 5KNNA 1EIYB 1D0YA 3PUXF 2FJBA 1NENA 1HNXT 4X65T 4EZHA 3AB3B 2ZMAA 5J2TE 2V7KA 1FEWA 4P71A 3KBUA 1WCRA 3EUHA 4TWDA 1ASYA 4KMCA 2RHSA 1ZHCA 4MBQA 4LF9T 4UVBB 4QXCB 1WFDA 2V6YA 3FXEB 4LFCT 4DR7T 2XAGB 1NNHA 1G5HA 4CXXA 12ASA 5AQKB 2IW5B 3UU5A 2XSAA 3GN5A 3ONLC 4YCWA 1WLXA 2XM1A 3RGLA 4LVKA 3EAMA 2HNIA 4IE7A 3M4QA 1Z0PA 3K1SA 2VKDA 3MF1A 1N36T 2UXBT 4IDNA 5A1LA 3RYIE 4E51A 2WQYA 4DR2T 4P3NA 3F31A 3ZYLA 4H9SE 2WB5A 5CB4E 2DJZA 1FIOA 3RKGA 3A7RA 1B8AA 5LA6E 4XU1A 3MZKB 3SS1A 1EQRA 1HC7A 2C0SA 3AEGA 3RYCE 1YGBA 1W66A 2ZM8A 4XEOA 4GYRA 1Z7MA 2WS3A 2DL1A 2KINB 1EVLA 3Q5EA 2ACZA 1QF6A 2KMFA 2DXUA 2W63A 2QHVA 3GMIA 5LCYA 4DBRA 4IL9A 3PJAJ 3KV9A 1KMNA 2CM0A 4B3TT 3OKQA 2QHSA 4G85A 4YSXA 3RUXA 2J62A 5JR9C 3UT5E 4H9PC 4L5GA 1YD8G 5EZYE 4CN1A 1KF6A 5ELNA 2UXCT 4CH3A 2BDEA 4P72A 4IE6A 4DR6T 4L0RA 4HWFA 4QX7B 2VKJA 2LEHA 2NWBA 3IF8B 3O4XE 3ZN1B 4DV2T 2A2FX 4K87A 3H3AA 4LF5T 3HFZA 1BIBA 4YRSA 3FZHB 3ZLIA 1YFTA 4IREA 2UUBT 2E2AA 3WAKA 3CMQA 3VQVA 2CCQA 3EFSA 3BJUA 5E3IA 3CQCB 4H9NC 3ZMSB 3QO8A 5EK2A 1Y01A 2D5UA 4HWSA 4X1IE 3MJXA 1M7KA 4ZS2A 4AQYT 2HHHT 3C64A 5LJNA 1W0BA 4V1Av 4YSYA 4CH5A 2H7VC 4IGUA 4RMFA 1XDOA 2L9QA 2EWNA 2DTIA 2WDQA 2XQ9A 4YRTA 4DO0A 3AE9A 4A56A 4FJOA 3N9QA 3L8RA 2E9XC 3FBZA 4U33A 3I9WA 2X9WA 2CGHA 3NRYA 1NJ2A 3D0TA 2DXTA 1T8BA 4DV4T 2I4MA 2DVEA 3CMLA 3IEEA 4NPPA 1USYC 2VL8A 4GK0E 3QNEA 2BVLA 2A3DA 2X0LB 5C2TA 2ZT7A 3TLSA 1XMQT 3U3IA 3BQLA 4H02A 2H88A 3LSSA 5CGMA 2AMCB 3HL6A 5LBQB 3H3MA 3OYZA 3JC6C 3A7UA 1S35A 1XNRT 3EABA 4HFIA 5AQJB 5HCJA 3AEDA 4OP0A 1QLBA 2K48A 4PAGA 3CX8B 5AQUB 5LXTE 5CFBA 2CXDA 2DDZA 2CLYC 3V5UA 3HXUA 5JVDE 5LHGB 4G84A 2ZM0A 1BBWA 4XU2A 4LVJA 3L2ZA 4ILBA 2N2NA 4LF6T 4IDQA 5HGQA 2ZLYA 3KVBA 4J15A 1WR0A 4BWAA 2DTOA 4JLEA 5IUXA 4G2AA 3EVYA 2CEAA 3SWHA 2EHOB 3ZKRA 4P0AA 5L3GB 3F2EA 4ZOLE 5DQWA 4CS3A 4UR9A 4WW0A 4QWNB 4JI4T 4P3OA 4H63H 1MNDA 3A32A 4LFBT 4HWPA 4L9IA 2XQYA 3QOFA 4QH4A 4FI5A 2CMRA 4LMKA 3DJBA 5LGTB 3LSQA 4BAYB 2KWIB 2CBIA 4TUYE 1XMOT 4TWAA 2DKGA 4ZEYA 2M6IA 5H6RB 5FY1A 4DMVA 5FVLA 2YKSA 4IT4A 3EDUA 5C51B 2MOZA 3IKLA 4CQIA 4WJ3M 2E3CA 1IBKT 4YY3T 3HFVA 1MMAA 4M1PA 2DU5A 5M4YA 4PK6A 1B76A 2JPFA 3A5ZA 4DV5T 3LFMA 4KR2A 2W67A 5JRCA 1D1AA 2QVAA 4DR1T 2IY5B 4O4IE 3NZPA 4PJNA 1AJ3A 2ODUA 4AQFC 3P4WA 4K0UA 5AQFB 2VL0A 3OBVE 4OFZA 4YCVA 2WDVA 4JBWF 3P4RA 3UUNA 3Q5XA 1X54A 3RACA 4TVAA 4YRNA 2OLTA 2ARUA 2ACXA 5HEHA 4NCXA 1E22A 2J1DG 1HTTA 2IAKA 3AE4A 4KBMB 2EJFA 3NENA 4H9RC 2MBGA 2IMLA 5HXCA 1B7TA 1SRYA 1YKEB 3LJCA 3UQ4A 2H7OA 5HEUA 1BBUA 1NEKA 3ZMTB 4YTNA 2HH7A 5L3DB 4YXDA 1KNRA 1HTJF 3RLFF 4KHPT 3JADA 2YU1A 4K0KT 2YDRA 4HWTA 1L0VA 3W3SA 5AQIB 2P5IA 1T72A 1WU7A 1XZYA 1WNLA 2QRXA 4AKGA 4B3ST 2V8SV 2V1DB 1HG2A 3RYFE 4TVWA 5HWXA 4U74A 3CPZA 2PJQA 1MIVA 3ANWA 4EYYR 1HX1B 2D2SA 3K8PC 2Q7EA 3K3OA 4X62T 1HF8A 2V6YB 1LYLA 4I55E 4A98A 4JI8T 3I0QA 4AQGA 5ADXL 4ZTUB 2ZNIA 4EB6E 3ZYKA 4XBFB 2X9XA 1WYDA 3ZN0B 2J3LA 3KV5A 3OD1A 4Z8XA 5BR8T 3L4GA 4JI3T 3QTCA 1SHZC 4U7IA 4CZZB 2WDRA 1PYSA 3QUJA 2DZ9A 2IIUA 4KHZF 2Q9QD 5CA1E 2I4NA 2VWAA 4JI2T 2M67A 2ARSA 4LMJA 4WNKA 5H6QB 3RC8A 2EHOC 4RDXA 3VBBA 3P8YA 2MPKA 5GONE 5AQNB 3P8TA 5HXHA 1HR0T 3RL6A 2BG9C 2X68A 3QNUA 2K24A 5J2UE 4LF7T 2F4VT 3JAEA 4DVDA 5K1PA 5KX5E 1KMMA 2ZT8A 5FL1A 2Y6XA 2EHOD 1JJCA 1EVKA 1ADYA 2E5AA 3AEFA 2XJ7A 3N2OA 1CHUA 3RKXA 3PUVF 2JQQA 4KR3A 1B70B 2JJ9A 3HA4A 1ZV4X 5FMNA 2CJ9A 2BKOA 3I7FA 4QKNA 5JDHA 2WMNA 4F8HA 4QHOA 4H2XA 3VQYA 1IBMT 1IJ6A 3PUGA 3HFZB 1YFRA 1MMGA 2W4XA 2LLYA 5HCMA 3O1HA 3VKGA 3V7CA 2WMOA 2W66A 4B6XA 4P09A 2XQ6A 5AQMB 4DNDA 4YRLA 5L3BB 2NTYA 5LBMA 5JDQA 4IE4A 3EFRA 1BR4A 4CXYA 2SPCA 3L1AA 5DABA 4QXHB 3P4QA 4A5XA 2XHEB 1N34T 2DQ0A 2JQ9A 3I0OA 2CXFA 5TAOA 3TEGA 3M65A 4WZXA 3AA6B 3B5MA 1G73A 2DLRA 1YXRA 4TZ4C 4EYUA 4J2CA 2CHOA 2LRKA 3AECA 2E9XB 5HAXA 1W9RA 3UULA 1BR1A 3WQZA 2JQHA 3ZEFB 2IUBA 2ZR2A 2EAYA 4P71C 3N2GE 2WWUA 3UH0A 1OEDA 3ZC0A 2RHQB 4ANJA 4DPGA 4TN7B 3VQWA 2XSBA 1KFYA 5LGNB 1WPYA 4OYKA 4H63V 3PJAA 2MTQA 4H9OC 5CA0E 2ZM6T 3MKDA 3VR9A 5J1GA 3T1HT 1J1JA 3PTRB 3EDVA 5HEJA 2C8MA 2ZT5A 2BKNA 3B57A 4RQFA 4BJNA 1KOGA 2R6GF 2XQ8A 3PU3A 1LRZA 2YN6A 3CKDA 5C53B 2XQ5A 2A9UA 3PZCA 2CLYB 4JEUB 2NW7A 5ABHA 2ZIMA 3TEHA 3MQZA 2CPTA 1FMVA 2J4GA 2KLQA 1QSDA 2WCAA 3P4SA 2CJAA 2VQFT 4YRMA 3REXA 4P74A 2MYSA 2AXDS 3A7MA 3A5XA 2ODVA 4DBQA 2XAHB 5AQQB 3C98B 3RPUA 4O4HE 4YT0A 4HWIB 3ZJ1A 1B7YB 5JR9A 3KV4A 2FYKA 2X0YA 2JMKA 5JDGA 3AE1A 2XGTA 3QO7A 3VU7H 1DU2A 5E0OA 3CK6A 4HN9A 4B3RT 2ZM2A 4IDPA 3LC0A 4DV6T 3HI2A 1XWMA 1ZOYA 3MACA 5AQPB 3I1AA 2VB6A 4ILAA 4O4JE 5FXXA 4CN4A 5JDNA 4IIJE 1R8IA 1MMNA 3UFEA 2PTFA 4X1KE 4PHCA 4YRCA 2RA1A 3ZSSA 1WQ7A 4H9QC 1BR0A 4ADZA 3PCOA 2OV9A 2PG8A 2ZNJA 1X9BA 2HN1A 2W62A 1BIAA 2XTIA 3PU8A 3W15B 4I4TE 3AE3A 2LOPA 3LBXB 1YB3A 5JRCB 2X66A 5L3EB 2YOEA 3PUAA 3QC9A 3V7SA 5FYMA 1X2GA 2UXNB 4H2TA 1E1HB 3T1YT 3N9NA 1E1OA 2XAJB 2XASB 4H2YA 2EJ9A 3NBXX 4GKJT 2WWVA 5KXJA 1EIYA 1X2HA 4HA8A 2CXLA 2WU5A 3NKZA 3JAFA 3AE6A 4YROA 4NUUA 4EEDA 2X9HA 4LMLA 3N2KE 1I94T 2EJGA 3RQWA 4UP8A 3RIFA 2LRLA 2E9XD 4EX5A 4X5OA 4YRKA 3K3NA 3AEBA 3FZFB 3IBPA 4DQ2A 4O2BE 5L47A 3TLUA 2X67A 3WI3A 2HPJA 5J0ZA 3UU8A 1HCIA 3DP7A 4UELA 11ASA 2ALYB 4ZZCA 5LG4A 1NJ1A 2WM9A 2C5KT 4LFAT 3FZKB 2I59A 4I43B 4PJMA 3HY0A 2VVNA 3P8CD 2LHNA 3FXDB 3AE5A 3VKHA 3P4PA 2L3LA 5AQRB 5HWYA 4U3CA 3JC6D 3LG7A 4C90A 3TLWA 5LG3A 3M4PA 1J5ET 3E08A 2Y48B 4YPFA 2I4LA 2D0UA 4COFA 4NXMT 4GOUA 4YLHA 3RH3A 1WRDA 3NVOA 3UGTA 2V5DA 3VRBA 3O1IA 3VRAA 1PYSB 3ESLA 2LOSA 4P3PA 2V26A 4OX9T 4JEHB 4HKAA 3AXJB 1LKXA 5CJ5A 2IHR1 4KP3C 2VASA 4CS2A 5HXEA 1D0ZA 3ICAA 2BG9B 4YRPA 3NZQA 3ONXA 2AE9A 2LM9A 5F5WA 1YQ3A 4K86A 4QX8B 2ARTA 4IE5A 3ONJA 5FXZA 3REUA 1KNPA 2J47A 2Q7HA 3HRKA 1Z7NA 4AKRB 2XQ3A 1T98A 3V8LA 3PUSA 2FBWA 2A8EA 5ABFB 2NTXA 3UU4A 2XY8B 5JDFA 3IALA 3N9PA 4MHCA 4K88A 4GKKT 5JREA 3RRWA 3RKYA 4OYJA 3ZT7A 2G4CA 4DUYT 4DIDB 3TUPA 4YRJA 2WZIA 3SRZA 5BMVE 4PJLA 2QHTA 2ZT6A 1U5PA 4XTYA 5AQVB 3DSQA 4LF8T 3IHRA 2VQET 2LSJA 4LNSA 3HTZA 3R6NA 4HTEA 3C4WA 4HE8A 5IWAT 4WF2A 4BA9A 2WU2A 2DWGA 1XNQT 2E65A 1YFSA 3RIUA 3QK6A 3P8VA 2XUEA 3I9YA 3PE0A 4DV3T 5KMGP 2AKWB 4JI5T 5HXSA 1QUUA 2KWHA 2WBLA 2EL9A 2CRBA 1HFAA 5DQVA 2XQ7A 3EI0A 2BG9E 4P75A 3CWZB 3AVSA 4XEMA 4HFVA 4Z90A 2B76A 3SFDA 3QB5K 4TNVA 3P7IA 4BW9A 2WZHA 2ZTGA 1X01A 4TWHA 4O2AE 3GWHA 3R84B 2N9DA 3ZCJA 3PUYF 1RIQA 5JQGE 2RHSB 2G0UA 2ZZFA 2AMCA 3Q5DA 5IHYA 4Q6GA 1SA0E 1L0WA 3FHNA 2PMFA 1W0AA 3G06A 4HWDA 3HKEE 2CJBA 2V7MA 2V6XA 1MMDA 2DHRA 3OTOT 2Q9QA 3KBTA 4LVMA 4UF0A 2PMEA 3ZSTA 3GN5B 3ZCIA 3AE2A 4H2UA 5AQOB 2DZCA 3IA3A 5LGUB 2PFVA 1HNZT 3TLTA 3QO5A 4PFPA 4ZI2C 2D0TA 2Y8DA 2Q5IA 3UGQA 5LB7B 4TX5A 5JDLA 5EK3A 4P73A 3UUXB 2DCFA 3IG2A 1WQWA 5ABEA 3MA9A 1ASZA 3VHLA 4YRIA 4OK0A 2EHOA 3MEYA 3RHWA 4O4LE 2DQ3A 4UIGA 3N5LA 1YQ4A 3LSVA 2N1GA 2WAUA 3J9X1 4GK5E 3PUQA 1MIWA 5HXRA 3SFEA 2QGSA 3C4ZA 3L39A 2HPLA 3R07A 3FB2A 4PK5A 1UX5A 4CI3B 5L4HA 2X51A 5LMNT 2YU2A 3PV0F 3J7Yq 4CXWA 3AA0B 4I50E 5L2LA 4XZCA 2UUCT 4HFBA 1UX4A 2VKOA 4AI6A 2KXPB 2ZZEA 3PUZF 3UQ7A 4IDOA 3BFMA 3LK42 4LVLA 4JYAT 2H89A 4X1YE 3DTOA 3ABVA 5ABGA 2BZBA 3HR0A 4XTUA 3ZPOA 3OJAA 4AKIA 3CX6B 3FZMB 3F57A 2IY5A 2ZINA 1LVKA 4TNWA 1H7CA 3E22E 4WJ4A 5FP3A 4WI1A 4YRQA 4UXNB 5HEGA 5C52B 4E7SA 2E1HA 3V8KA 1E2AA 2I4OA 2M6BA 2D9DA 4DV7T 2XQ4A 3NETA 4HGAA 3P50A 3L09A 3AAEB 4HFCA 4YFSA 4WBNE 3Q9DA 3ERRA 2CIMA 5LNKA 2BKPA 2ZCEA 2A72A 3RX6A 1JNRA 3NEMA 2FJAA 2KZ7B 2ZXFA 3V7RA 3KDSE 5ETWA 4WBOA 4GIWA 4CI2B 1N9WA 4KX6A 4DMWA 4X64T 4P1NA 2DEQA 5FY7A 1OEDC 2FUPA 5FXVA 1UUSA 1QE0A 3KFUA 4HWOA 2WSSV 2KSRA 3BQKA 4ISSA 1H4VB 2LSIA 4KQEA 2ES0A 4EAHA 1HG5A 4IHJE 1NJ8A 2DNXA
chains in the Genus database with same CATH topology
5C51B 1E1OA 2C7IA 4H2YA 3IKLA 2EJ9A 3MF2A 4WJ3M 2ZGWA 1X2HA 2E3CA 1EIYA 4HA8A 3HFVA 1ATIA 2DU5A 1B76A 3A5ZA 4YROA 1EFWA 4UP9A 4HVCA 4HWRA 4KR2A 2E41A 2EJGA 2IY5B 1FYFA 3HXZA 1GGMA 2E10A 4UP8A 4YCVA 2Q7GA 1NJ5A 4EX5A 4CS4A 4H2SA 1X54A 4X5OA 3RACA 4YRKA 4TVAA 4YRNA 2ARUA 4XTXA 4NCXA 1E22A 3A5YA 5ELOA 4DQ2A 1HTTA 2ZZGA 4YP0A 4ZIBA 1HXDA 4TQDA 11ASA 2ALYB 1G5IA 2P0LA 2EJFA 3NENA 4P74C 1NJ1A 3E9HA 1H4QA 1J5WA 1SRYA 3HY0A 2DTHA 1BBUA 1X56A 3HRIA 1NYQA 4UP7A 3PCOB 3M4PA 2E64A 3A74A 4YPFA 3V8JA 2I4LA 4HWTA 4UPAA 4P72C 1H4SA 2AKWA 3W3SA 2P5IA 1WU7A 1WNLA 3UGTA 3A7AA 1PYSB 3E9IA 4TVWA 4YRGA 1H4TA 4P3PA 4TTVA 1B70A 3RKWA 4CH4A 2Q5HA 2Q7EA 2ODRC 1LYLA 3HY1A 5KNNA 4CS2A 1EIYB 4ZTUB 1E24A 2ZNIA 3ICAA 1WYDA 4YRPA 2J3LA 3OD1A 3L4GA 5F5WA 4P71A 3QTCA 4K86A 2ARTA 1ASYA 1PYSA 2ZIOA 3REUA 2RHSA 2Q7HA 2DZ9A 3HRKA 1Z7NA 2ODRD 1E1TA 2I4NA 3V8LA 4Q15A 2A8EA 4YYEA 4H2WA 4HT4A 1NNHA 3IALA 1G5HA 4TVAB 2ARSA 4EO4A 4K88A 4RDXA 1SERA 1SESA 12ASA 3VBBA 3P8YA 4H2VA 3RKYA 2G4CA 3TUPA 4YCWA 4YRJA 3RGLA 4LVKA 2HNIA 2QHTA 3P8TA 3M4QA 3RL6A 2ZT6A 4CH6A 4XTYA 4XU3A 3DSQA 3FJPA 3MF1A 3HXXA 4LNSA 1USYA 4E51A 3HTZA 5K1PA 4P3NA 1KMMA 4WF2A 2ZT8A 2DJZA 3A7RA 2RHQA 1B8AA 1JJCA 1EVKA 2E65A 4XU1A 1YFSA 4AH6A 1ADYA 1EQRA 3P8VA 1HC7A 2E5AA 1YGBA 2AKWB 1W66A 4XEOA 1WLEA 1Z7MA 3VQXA 1EVLA 3RKXA 2EL9A 4KR3A 1B70B 1QF6A 2DXUA 2QHVA 4P75A 2CJ9A 4XEMA 2J3MA 3I7FA 4H2XA 4BW9A 1KMNA 3VQYA 3HFZB 4RQEA 1YFRA 2QHSA 4G85A 3RUXA 2ZTGA 3V7CA 4YRFA 1X01A 3L4GB 3IKMB 4LVIA 4YRLA 4YCUA 5ELNA 1RIQA 4CH3A 3EFRA 4P72A 2RHSB 3L1AA 2ZZFA 2AMCA 4Q6GA 1L0WA 2PMFA 1C0AA 2CJBA 2DQ0A 2ZR3A 4XU0A 4K87A 3TEGA 3HFZA 1BIBA 4YRSA 4LVMA 1YFTA 2PMEA 4H2UA 2DZCA 3CMQA 3WQZA 3VQVA 1EOVA 3EFSA 1B7YA 3BJUA 3QO5A 2ZR2A 4YRRA 4TVYA 5E3IA 2Q5IA 4OLFA 3UGQA 2EAYA 4P71C 1ADJA 3UH0A 1NYRA 3QO8A 4P73A 2DU7A 2RHQB 4HWSA 3IG2A 1JJCB 4DPGA 3VQWA 1WQWA 1G51A 1WPYA 1ASZA 4YRIA 3MEYA 4CH5A 4RMFA 2DQ3A 4YDQA 1NJ6A 2DTIA 2EWNA 2C8MA 4YRTA 2ZT5A 4PG3A 4RQFA 1KOGA 3HXWA 2CGHA 5C53B 1NJ2A 2DXTA 4H2XB 3G1ZA 3PZCA 5K1XA 3RF1A 2I4MA 2DVEA 2ZIMA 4TQFA 1USYC 3R07A 1VQZA 3QNEA 1SETA 3MQZA 3TEHA 2ZT7A 1X55A 4H02A 4XTZA 3LSSA 2AMCB 2ZZEA 2CJAA 4YRMA 3BFMA 4LVLA 3REXA 4P74A 3A7UA 4OP0A 4P75C 3NELA 4XTUA 2IY5A 2DDZA 2ZINA 3HXUA 1B7YB 4G84A 1IL2A 2FYKA 1BBWA 4WJ4A 4WI1A 2XGTA 4YRQA 4XU2A 4LVJA 3QO7A 3L2ZA 5C52B 2E1HA 4YREA 3V8KA 2I4OA 3HXVA 5HGQA 4J15A 4L87A 4BWAA 3LC0A 2DTOA 2ALYA 3NETA 4ZTZB 3ERRA 2CIMA 2ZCEA 4O2DA 4CS3A 4PHCA 3NEMA 4YRCA 2NS6A 2ZXFA 1WQ7A 4P3OA 3V7RA 3A32A 3PCOA 4XTWA 4HWPA 1N9WA 2ZNJA 1BIAA 2XTIA 2QHUA 2DEQA 4XTVA 3TEHB 1YB3A 3LSQA 3A31A 3HXYA 4TWAA 4P73C 3KFUA 4HWOA 2DKGA 1H4VB 3V7SA 3UFGA 4KQEA 1QE0A 1X2GA 4H2TA 3RIRA 1NJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C51 B;  1E1O A;  2C7I A;  4H2Y A;  3IKL A;  2EJ9 A;  3MF2 A;  4WJ3 M;  2ZGW A;  1X2H A;  2E3C A;  1EIY A;  4HA8 A;  3HFV A;  1ATI A;  2DU5 A;  1B76 A;  3A5Z A;  4YRO A;  1EFW A;  4UP9 A;  4HVC A;  4HWR A;  4KR2 A;  2E41 A;  2EJG A;  2IY5 B;  1FYF A;  3HXZ A;  1GGM A;  2E10 A;  4UP8 A;  4YCV A;  2Q7G A;  1NJ5 A;  4EX5 A;  4CS4 A;  4H2S A;  1X54 A;  4X5O A;  3RAC A;  4YRK A;  4TVA A;  4YRN A;  2ARU A;  4XTX A;  4NCX A;  1E22 A;  3A5Y A;  5ELO A;  4DQ2 A;  1HTT A;  2ZZG A;  4YP0 A;  4ZIB A;  1HXD A;  4TQD A;  11AS A;  2ALY B;  1G5I A;  2P0L A;  2EJF A;  3NEN A;  4P74 C;  1NJ1 A;  3E9H A;  1H4Q A;  1J5W A;  1SRY A;  3HY0 A;  2DTH A;  1BBU A;  1X56 A;  3HRI A;  1NYQ A;  4UP7 A;  3PCO B;  3M4P A;  2E64 A;  3A74 A;  4YPF A;  3V8J A;  2I4L A;  4HWT A;  4UPA A;  4P72 C;  1H4S A;  2AKW A;  3W3S A;  2P5I A;  1WU7 A;  1WNL A;  3UGT A;  3A7A A;  1PYS B;  3E9I A;  4TVW A;  4YRG A;  1H4T A;  4P3P A;  4TTV A;  1B70 A;  3RKW A;  4CH4 A;  2Q5H A;  2Q7E A;  2ODR C;  1LYL A;  3HY1 A;  5KNN A;  4CS2 A;  1EIY B;  4ZTU B;  1E24 A;  2ZNI A;  3ICA A;  1WYD A;  4YRP A;  2J3L A;  3OD1 A;  3L4G A;  5F5W A;  4P71 A;  3QTC A;  4K86 A;  2ART A;  1ASY A;  1PYS A;  2ZIO A;  3REU A;  2RHS A;  2Q7H A;  2DZ9 A;  3HRK A;  1Z7N A;  2ODR D;  1E1T A;  2I4N A;  3V8L A;  4Q15 A;  4YYE A;  4H2W A;  1NNH A;  3IAL A;  1G5H A;  4TVA B;  2ARS A;  4EO4 A;  4K88 A;  4RDX A;  1SER A;  1SES A;  12AS A;  3VBB A;  3P8Y A;  4H2V A;  3RKY A;  2G4C A;  3TUP A;  4YCW A;  4YRJ A;  3RGL A;  2HNI A;  2QHT A;  3P8T A;  3M4Q A;  3RL6 A;  2ZT6 A;  4CH6 A;  4XTY A;  4XU3 A;  3DSQ A;  3FJP A;  3MF1 A;  3HXX A;  4LNS A;  1USY A;  4E51 A;  3HTZ A;  5K1P A;  4P3N A;  1KMM A;  4WF2 A;  2ZT8 A;  2DJZ A;  3A7R A;  2RHQ A;  1B8A A;  1JJC A;  1EVK A;  2E65 A;  4XU1 A;  1YFS A;  4AH6 A;  1ADY A;  1EQR A;  3P8V A;  1HC7 A;  2E5A A;  1YGB A;  2AKW B;  1W66 A;  4XEO A;  1WLE A;  1Z7M A;  3VQX A;  1EVL A;  3RKX A;  2EL9 A;  4KR3 A;  1B70 B;  1QF6 A;  2DXU A;  2QHV A;  4P75 A;  2CJ9 A;  4XEM A;  2J3M A;  3I7F A;  4H2X A;  4BW9 A;  1KMN A;  3VQY A;  3HFZ B;  4RQE A;  1YFR A;  2QHS A;  4G85 A;  3RUX A;  2ZTG A;  3V7C A;  4YRF A;  1X01 A;  3L4G B;  3IKM B;  4YRL A;  4YCU A;  5ELN A;  1RIQ A;  4CH3 A;  3EFR A;  4P72 A;  2RHS B;  3L1A A;  2ZZF A;  2AMC A;  4Q6G A;  1L0W A;  2PMF A;  1C0A A;  2CJB A;  2DQ0 A;  2ZR3 A;  4XU0 A;  4K87 A;  3TEG A;  3HFZ A;  1BIB A;  4YRS A;  1YFT A;  2PME A;  4H2U A;  2DZC A;  3CMQ A;  3WQZ A;  3VQV A;  1EOV A;  3EFS A;  1B7Y A;  3BJU A;  3QO5 A;  2ZR2 A;  4YRR A;  4TVY A;  5E3I A;  2Q5I A;  4OLF A;  3UGQ A;  2EAY A;  4P71 C;  1ADJ A;  3UH0 A;  1NYR A;  3QO8 A;  4P73 A;  2DU7 A;  2RHQ B;  4HWS A;  3IG2 A;  1JJC B;  4DPG A;  3VQW A;  1WQW A;  1G51 A;  1WPY A;  1ASZ A;  4YRI A;  3MEY A;  4CH5 A;  4RMF A;  2DQ3 A;  4YDQ A;  1NJ6 A;  2DTI A;  2EWN A;  2C8M A;  4YRT A;  2ZT5 A;  4PG3 A;  4RQF A;  1KOG A;  3HXW A;  2CGH A;  5C53 B;  1NJ2 A;  2DXT A;  4H2X B;  3G1Z A;  3PZC A;  5K1X A;  3RF1 A;  2I4M A;  2DVE A;  2ZIM A;  4TQF A;  1USY C;  3R07 A;  1VQZ A;  3QNE A;  1SET A;  3TEH A;  2ZT7 A;  1X55 A;  4H02 A;  4XTZ A;  3LSS A;  2AMC B;  2ZZE A;  2CJA A;  4YRM A;  3BFM A;  3REX A;  4P74 A;  3A7U A;  4OP0 A;  4P75 C;  3NEL A;  4XTU A;  2IY5 A;  2DDZ A;  2ZIN A;  3HXU A;  1B7Y B;  4G84 A;  1IL2 A;  2FYK A;  1BBW A;  4WJ4 A;  4WI1 A;  2XGT A;  4YRQ A;  4XU2 A;  3QO7 A;  3L2Z A;  5C52 B;  2E1H A;  4YRE A;  3V8K A;  2I4O A;  3HXV A;  5HGQ A;  4J15 A;  4L87 A;  4BWA A;  3LC0 A;  2DTO A;  2ALY A;  3NET A;  4ZTZ B;  3ERR A;  2CIM A;  2ZCE A;  4O2D A;  4CS3 A;  4PHC A;  3NEM A;  4YRC A;  2ZXF A;  1WQ7 A;  4P3O A;  3V7R A;  3A32 A;  3PCO A;  4XTW A;  4HWP A;  1N9W A;  2ZNJ A;  1BIA A;  2XTI A;  2QHU A;  2DEQ A;  4XTV A;  3TEH B;  1YB3 A;  3LSQ A;  3A31 A;  3HXY A;  4TWA A;  4P73 C;  3KFU A;  4HWO A;  2DKG A;  1H4V B;  3V7S A;  3UFG A;  4KQE A;  1QE0 A;  1X2G A;  4H2T A;  3RIR A;  1NJ8 A; 
#chains in the Genus database with same CATH topology
 2X9Y A;  1YW0 A;  2C7I A;  3TKL B;  3OYX A;  3HKD E;  4ASK A;  1VCS A;  1Z8U A;  1ATI A;  1KEY A;  3EHZ A;  2XQA A;  4HVC A;  2WY2 A;  4HEA A;  3PDY A;  5LHI B;  2IC9 A;  1FYF A;  2K5B B;  5AQS B;  3MXZ A;  4XAX B;  5AQG B;  3HXZ A;  1GGM A;  2E10 A;  4U72 A;  4ZXL A;  2Q7G A;  1LVF A;  4U31 A;  4CS4 A;  4UV9 B;  5AQH B;  1ZEE A;  3ZYM A;  4XTX A;  4HWC A;  4E7Z A;  3A5Y A;  5ELO A;  4DV0 T;  4ZIB A;  2KND A;  1HXD A;  4TQD A;  3Q2M A;  3U78 A;  1E7P A;  3KVA A;  4P74 C;  4UV8 B;  2MAW A;  4EEB A;  3ETU A;  3Q5W A;  3E9H A;  1J5W A;  1H4Q A;  4HFE A;  4KUM B;  4EZ4 A;  3ZJ2 A;  2W0G A;  3VR8 A;  3HKB E;  5F3J A;  2Z6E A;  4IL4 A;  4KI0 F;  2LJL A;  1NYQ A;  4UVA B;  3N9M A;  3MK7 C;  2FJD A;  4P72 C;  1KNZ A;  1VOM A;  5L3F B;  2BS2 A;  3A7A A;  2XAQ B;  3E9I A;  2V5C A;  4CH4 A;  1B70 A;  3RKW A;  2LKH A;  3AVR A;  2XM2 A;  2Q5H A;  3CX7 B;  3O9X A;  2ODR C;  5HYA A;  3ETV A;  1FMW A;  3C4X A;  1G8X A;  4X66 T;  1E24 A;  4IDZ A;  1UK5 A;  4AKL A;  4AIU A;  2CWO A;  1V9D A;  1ZP0 A;  4C91 A;  1GQE A;  4PJJ A;  3OVU A;  2ZIO A;  5L3C B;  1W09 A;  3ZMZ B;  2LE8 A;  4JI7 T;  2ODR D;  1E1T A;  4CI1 B;  3LK2 B;  5LMU T;  4Q15 A;  2YIN A;  3N9L A;  4YYE A;  4H2W A;  3AE7 A;  3RYH E;  4HT4 A;  3L3P A;  4TVA B;  1CUN A;  5LJM A;  2XTL A;  4EO4 A;  5FKY A;  3AAA B;  3O1J A;  1SER A;  1SES A;  4YJ2 E;  1KK7 A;  3H37 A;  4H2V A;  1NAF A;  2E9X A;  2E8I A;  3LDQ B;  3WAJ A;  4QH5 A;  2UUA T;  1MNE A;  2LM2 A;  4EGW A;  3KIN B;  4CH6 A;  2X0H A;  4DV1 T;  4XU3 A;  5AFU L;  3UU6 A;  3FJP A;  2LSG A;  1O3X A;  3HXX A;  1XDP A;  1USY A;  3N9O A;  3RRC A;  2BBJ A;  2KT9 A;  2RHQ A;  4DR5 T;  4AH6 A;  4JI6 T;  1D1B A;  4YJ3 E;  4X5T A;  3ZC1 A;  4ERR A;  2XAF B;  1WLE A;  3K3Q C;  4ZHQ E;  3VQX A;  4GYS A;  4EIW A;  2V7I A;  1OWA A;  2JQK A;  3NRX A;  2WP9 A;  2NW8 A;  3X1D A;  2H3R A;  3ANW B;  2K3W A;  2J3M A;  2W2U A;  4QXB B;  2VUR A;  1D1C A;  4N78 D;  2VK9 A;  2CHN A;  3AEA A;  1UGO A;  5JH7 E;  4RQE A;  2Q9Q B;  2XZE A;  3ZMV B;  1S94 A;  4UF0 B;  5FNV E;  4UEM A;  4JI0 T;  3L4G B;  4ILU A;  4YRF A;  3IKM B;  4YTM A;  4AKH A;  1WYB A;  3OPC A;  4LVI A;  4UVC B;  4YCU A;  1MIY A;  2LKG A;  3E0Z A;  2E5V A;  5FXW A;  5IYZ E;  3C51 A;  4YSZ A;  2UXX B;  2V7J A;  2YEV C;  2YDQ A;  4HFH A;  4EOZ B;  2DI4 A;  1C0A A;  4U2Y A;  5LYJ E;  2ZR3 A;  4XU0 A;  3S4U A;  5C3J A;  3RQU A;  2W00 A;  3BK9 A;  2CWY A;  4PNI A;  3PUW F;  5C8Y E;  1EOV A;  3AA1 B;  4P0B A;  4AXP A;  1B7Y A;  1VRB A;  4MLK A;  4YRR A;  4TVY A;  1IZN B;  4OLF A;  5JDM A;  4CN6 A;  2VVS A;  1ADJ A;  1NYR A;  2VKH A;  4PW8 A;  2DU7 A;  1JJC B;  1G51 A;  4U7Y A;  4G63 A;  5LP6 E;  2UXD T;  4HWH A;  4IST A;  1IBL T;  1I6Z A;  4YDQ A;  4NUV A;  2QYW A;  1NJ6 A;  4NXN T;  1FJG T;  4PG3 A;  2V7L A;  3AEE A;  3HXW A;  1US7 B;  3B13 A;  4H2X B;  3G1Z A;  5K1X A;  3RF1 A;  4AQF A;  5AQT B;  4A97 A;  1T7S A;  4TQF A;  2LSY A;  1SUM B;  1VQZ A;  3LBX A;  5AQL B;  1SET A;  3GA8 A;  1VCT A;  2QA7 A;  3UTK A;  1IAP A;  1X55 A;  3BQI A;  3RIU C;  4XTZ A;  2JIW A;  5FY0 A;  2CA5 A;  4DR4 T;  5HEO A;  2FJE A;  3FZL B;  2JRK A;  2BS3 A;  2XPK A;  4P75 C;  3NEL A;  1UUR A;  2DWK A;  3LK3 B;  1HX8 A;  2JMH A;  2L8K A;  5LOV E;  1IL2 A;  2OA5 A;  2LHR A;  2BVM A;  4WYV A;  3UUB A;  1HS7 A;  3RC3 A;  1Y64 B;  2LT3 A;  1BR2 A;  4YRE A;  2I0M A;  1OED B;  2P9B A;  3HXV A;  4TWF A;  1X79 A;  2CBJ A;  4JI1 T;  5KDM C;  2IDO B;  3KV6 A;  3UU3 A;  4L87 A;  4TV8 E;  4Q25 A;  2C5J A;  2ALY A;  2HN2 A;  4MFR A;  4TV9 E;  1EZ3 A;  4ZTZ B;  5EK4 A;  2Q9Q C;  4O2D A;  1IJ5 A;  2I6H A;  5JTG A;  2NS6 A;  1M62 A;  2NW9 A;  2C5I T;  3SOL A;  4B3M T;  4LF4 T;  4XTW A;  2YK0 A;  1ZKE A;  2K9A A;  3AE8 A;  5LHH B;  3HKC E;  4PK4 A;  2QHU A;  3C50 A;  2YDS A;  4ZI3 C;  4XTV A;  3TEH B;  4JUY A;  3A31 A;  3HXY A;  5F8P A;  4P73 C;  4DR3 T;  2NP9 A;  3UFG A;  3ZT5 A;  3NWI A;  3RIR A;  2RPA A;  3AXJ A;  4ZI2 D;  4ZS3 A;  3MF2 A;  2ZGW A;  3KFW X;  2BG9 A;  3FBL A;  4PFO A;  4HFD A;  4IE0 A;  1WR6 A;  3QB5 A;  4ZI3 D;  3AAI A;  3M3Z B;  1YKH B;  1EFW A;  4AIS A;  2LSK A;  4UP9 A;  4HWR A;  4DUZ T;  3CQG B;  4ZZB A;  2E41 A;  4Z91 A;  3ZMU B;  1OED E;  2RP4 A;  4U2Z A;  1D0X A;  1JNZ A;  1OXZ A;  5JR9 B;  5L4E A;  2IC6 A;  2CE7 A;  2UU9 T;  4O8S A;  5ABF A;  1NJ5 A;  4EV6 A;  1UCU A;  2BBH A;  3ZT6 A;  4YHJ A;  4H2S A;  2E5L T;  3CIR A;  3RI5 A;  3RIA A;  4OHF A;  2ZZG A;  4YP0 A;  1N32 T;  2BS4 A;  3PUR A;  5FVK A;  3A8Y C;  1G5I A;  2P0L A;  4EXT A;  2B1E A;  1WYC A;  1SE7 A;  2W61 A;  1NWM X;  2DTH A;  4NIQ A;  1HNW T;  3T8O A;  3V5S A;  1X56 A;  3TLV A;  4YHH T;  4ILC A;  1N33 T;  3HRI A;  4MAL A;  4UP7 A;  2PBI A;  3PCO B;  2E64 A;  2GK9 A;  3A74 A;  3V8J A;  4UPA A;  1H4S A;  2AKW A;  3JCF A;  3AA7 B;  4BJM A;  4YTP A;  4F6R C;  4QH1 A;  4X20 E;  2NOX A;  3CVR A;  4I0U A;  3RKO A;  5FL0 A;  2NR4 A;  5DJQ C;  1H4T A;  4JV5 T;  4TTV A;  4YRG A;  1U4Q A;  3UUM A;  3CQX C;  4ZI7 E;  3HY1 A;  5KNN A;  1EIY B;  1D0Y A;  3PUX F;  2FJB A;  1NEN A;  1HNX T;  4X65 T;  4EZH A;  3AB3 B;  2ZMA A;  5J2T E;  2V7K A;  1FEW A;  4P71 A;  3KBU A;  1WCR A;  3EUH A;  4TWD A;  1ASY A;  4KMC A;  2RHS A;  1ZHC A;  4MBQ A;  4LF9 T;  4UVB B;  4QXC B;  1WFD A;  2V6Y A;  3FXE B;  4LFC T;  4DR7 T;  2XAG B;  1NNH A;  1G5H A;  4CXX A;  12AS A;  5AQK B;  2IW5 B;  3UU5 A;  2XSA A;  3GN5 A;  3ONL C;  4YCW A;  1WLX A;  2XM1 A;  3RGL A;  4LVK A;  3EAM A;  2HNI A;  4IE7 A;  3M4Q A;  1Z0P A;  3K1S A;  2VKD A;  3MF1 A;  1N36 T;  2UXB T;  4IDN A;  5A1L A;  3RYI E;  4E51 A;  2WQY A;  4DR2 T;  4P3N A;  3F31 A;  3ZYL A;  4H9S E;  2WB5 A;  5CB4 E;  2DJZ A;  1FIO A;  3RKG A;  3A7R A;  1B8A A;  5LA6 E;  4XU1 A;  3MZK B;  3SS1 A;  1EQR A;  1HC7 A;  2C0S A;  3AEG A;  3RYC E;  1YGB A;  1W66 A;  2ZM8 A;  4XEO A;  4GYR A;  1Z7M A;  2WS3 A;  2DL1 A;  2KIN B;  1EVL A;  3Q5E A;  2ACZ A;  1QF6 A;  2KMF A;  2DXU A;  2W63 A;  2QHV A;  3GMI A;  5LCY A;  4DBR A;  4IL9 A;  3PJA J;  3KV9 A;  1KMN A;  2CM0 A;  4B3T T;  3OKQ A;  2QHS A;  4G85 A;  4YSX A;  3RUX A;  2J62 A;  5JR9 C;  3UT5 E;  4H9P C;  4L5G A;  1YD8 G;  5EZY E;  4CN1 A;  1KF6 A;  5ELN A;  2UXC T;  4CH3 A;  2BDE A;  4P72 A;  4IE6 A;  4DR6 T;  4L0R A;  4HWF A;  4QX7 B;  2VKJ A;  2LEH A;  2NWB A;  3IF8 B;  3O4X E;  3ZN1 B;  4DV2 T;  2A2F X;  4K87 A;  3H3A A;  4LF5 T;  3HFZ A;  1BIB A;  4YRS A;  3FZH B;  3ZLI A;  1YFT A;  4IRE A;  2UUB T;  2E2A A;  3WAK A;  3CMQ A;  3VQV A;  2CCQ A;  3EFS A;  3BJU A;  5E3I A;  3CQC B;  4H9N C;  3ZMS B;  3QO8 A;  5EK2 A;  1Y01 A;  2D5U A;  4HWS A;  4X1I E;  3MJX A;  1M7K A;  4ZS2 A;  4AQY T;  2HHH T;  3C64 A;  5LJN A;  1W0B A;  4V1A v;  4YSY A;  4CH5 A;  2H7V C;  4IGU A;  4RMF A;  1XDO A;  2L9Q A;  2EWN A;  2DTI A;  2WDQ A;  2XQ9 A;  4YRT A;  4DO0 A;  3AE9 A;  4A56 A;  4FJO A;  3N9Q A;  3L8R A;  2E9X C;  3FBZ A;  4U33 A;  3I9W A;  2X9W A;  2CGH A;  3NRY A;  1NJ2 A;  3D0T A;  2DXT A;  1T8B A;  4DV4 T;  2I4M A;  2DVE A;  3CML A;  3IEE A;  4NPP A;  1USY C;  2VL8 A;  4GK0 E;  3QNE A;  2BVL A;  2A3D A;  2X0L B;  5C2T A;  2ZT7 A;  3TLS A;  1XMQ T;  3U3I A;  3BQL A;  4H02 A;  2H88 A;  3LSS A;  5CGM A;  2AMC B;  3HL6 A;  5LBQ B;  3H3M A;  3OYZ A;  3JC6 C;  3A7U A;  1S35 A;  1XNR T;  3EAB A;  4HFI A;  5AQJ B;  5HCJ A;  3AED A;  4OP0 A;  1QLB A;  2K48 A;  4PAG A;  3CX8 B;  5AQU B;  5LXT E;  5CFB A;  2CXD A;  2DDZ A;  2CLY C;  3V5U A;  3HXU A;  5JVD E;  5LHG B;  4G84 A;  2ZM0 A;  1BBW A;  4XU2 A;  4LVJ A;  3L2Z A;  4ILB A;  2N2N A;  4LF6 T;  4IDQ A;  5HGQ A;  2ZLY A;  3KVB A;  4J15 A;  1WR0 A;  4BWA A;  2DTO A;  4JLE A;  5IUX A;  4G2A A;  3EVY A;  2CEA A;  3SWH A;  2EHO B;  3ZKR A;  4P0A A;  5L3G B;  3F2E A;  4ZOL E;  5DQW A;  4CS3 A;  4UR9 A;  4WW0 A;  4QWN B;  4JI4 T;  4P3O A;  4H63 H;  1MND A;  3A32 A;  4LFB T;  4HWP A;  4L9I A;  2XQY A;  3QOF A;  4QH4 A;  4FI5 A;  2CMR A;  4LMK A;  3DJB A;  5LGT B;  3LSQ A;  4BAY B;  2KWI B;  2CBI A;  4TUY E;  1XMO T;  4TWA A;  2DKG A;  4ZEY A;  2M6I A;  5H6R B;  5FY1 A;  4DMV A;  5FVL A;  2YKS A;  4IT4 A;  3EDU A;  5C51 B;  2MOZ A;  3IKL A;  4CQI A;  4WJ3 M;  2E3C A;  1IBK T;  4YY3 T;  3HFV A;  1MMA A;  4M1P A;  2DU5 A;  5M4Y A;  4PK6 A;  1B76 A;  2JPF A;  3A5Z A;  4DV5 T;  3LFM A;  4KR2 A;  2W67 A;  5JRC A;  1D1A A;  2QVA A;  4DR1 T;  2IY5 B;  4O4I E;  3NZP A;  4PJN A;  1AJ3 A;  2ODU A;  4AQF C;  3P4W A;  4K0U A;  5AQF B;  2VL0 A;  3OBV E;  4OFZ A;  4YCV A;  2WDV A;  4JBW F;  3P4R A;  3UUN A;  3Q5X A;  1X54 A;  3RAC A;  4TVA A;  4YRN A;  2OLT A;  2ARU A;  2ACX A;  5HEH A;  4NCX A;  1E22 A;  2J1D G;  1HTT A;  2IAK A;  3AE4 A;  4KBM B;  2EJF A;  3NEN A;  4H9R C;  2MBG A;  2IML A;  5HXC A;  1B7T A;  1SRY A;  1YKE B;  3LJC A;  3UQ4 A;  2H7O A;  5HEU A;  1BBU A;  1NEK A;  3ZMT B;  4YTN A;  2HH7 A;  5L3D B;  4YXD A;  1KNR A;  1HTJ F;  3RLF F;  4KHP T;  3JAD A;  2YU1 A;  4K0K T;  2YDR A;  4HWT A;  1L0V A;  3W3S A;  5AQI B;  2P5I A;  1T72 A;  1WU7 A;  1XZY A;  1WNL A;  2QRX A;  4AKG A;  4B3S T;  2V8S V;  2V1D B;  1HG2 A;  3RYF E;  4TVW A;  5HWX A;  4U74 A;  3CPZ A;  2PJQ A;  1MIV A;  3ANW A;  4EYY R;  1HX1 B;  2D2S A;  3K8P C;  2Q7E A;  3K3O A;  4X62 T;  1HF8 A;  2V6Y B;  1LYL A;  4I55 E;  4A98 A;  4JI8 T;  3I0Q A;  4AQG A;  5ADX L;  4ZTU B;  2ZNI A;  4EB6 E;  3ZYK A;  4XBF B;  2X9X A;  1WYD A;  3ZN0 B;  2J3L A;  3KV5 A;  3OD1 A;  4Z8X A;  5BR8 T;  3L4G A;  4JI3 T;  3QTC A;  1SHZ C;  4U7I A;  4CZZ B;  2WDR A;  1PYS A;  3QUJ A;  2DZ9 A;  2IIU A;  4KHZ F;  2Q9Q D;  5CA1 E;  2I4N A;  2VWA A;  4JI2 T;  2M67 A;  2ARS A;  4LMJ A;  4WNK A;  5H6Q B;  3RC8 A;  2EHO C;  4RDX A;  3VBB A;  3P8Y A;  2MPK A;  5GON E;  5AQN B;  3P8T A;  5HXH A;  1HR0 T;  3RL6 A;  2BG9 C;  2X68 A;  3QNU A;  2K24 A;  5J2U E;  4LF7 T;  2F4V T;  3JAE A;  4DVD A;  5K1P A;  5KX5 E;  1KMM A;  2ZT8 A;  5FL1 A;  2Y6X A;  2EHO D;  1JJC A;  1EVK A;  1ADY A;  2E5A A;  3AEF A;  2XJ7 A;  3N2O A;  1CHU A;  3RKX A;  3PUV F;  2JQQ A;  4KR3 A;  1B70 B;  2JJ9 A;  3HA4 A;  1ZV4 X;  5FMN A;  2CJ9 A;  2BKO A;  3I7F A;  4QKN A;  5JDH A;  2WMN A;  4F8H A;  4QHO A;  4H2X A;  3VQY A;  1IBM T;  1IJ6 A;  3PUG A;  3HFZ B;  1YFR A;  1MMG A;  2W4X A;  2LLY A;  5HCM A;  3O1H A;  3VKG A;  3V7C A;  2WMO A;  2W66 A;  4B6X A;  4P09 A;  2XQ6 A;  5AQM B;  4DND A;  4YRL A;  5L3B B;  2NTY A;  5LBM A;  5JDQ A;  4IE4 A;  3EFR A;  1BR4 A;  4CXY A;  2SPC A;  3L1A A;  5DAB A;  4QXH B;  3P4Q A;  4A5X A;  2XHE B;  1N34 T;  2DQ0 A;  2JQ9 A;  3I0O A;  2CXF A;  5TAO A;  3TEG A;  3M65 A;  4WZX A;  3AA6 B;  3B5M A;  1G73 A;  2DLR A;  1YXR A;  4TZ4 C;  4EYU A;  4J2C A;  2CHO A;  2LRK A;  3AEC A;  2E9X B;  5HAX A;  1W9R A;  3UUL A;  1BR1 A;  3WQZ A;  2JQH A;  3ZEF B;  2IUB A;  2ZR2 A;  2EAY A;  4P71 C;  3N2G E;  2WWU A;  3UH0 A;  1OED A;  3ZC0 A;  2RHQ B;  4ANJ A;  4DPG A;  4TN7 B;  3VQW A;  2XSB A;  1KFY A;  5LGN B;  1WPY A;  4OYK A;  4H63 V;  3PJA A;  2MTQ A;  4H9O C;  5CA0 E;  2ZM6 T;  3MKD A;  3VR9 A;  5J1G A;  3T1H T;  1J1J A;  3PTR B;  3EDV A;  5HEJ A;  2C8M A;  2ZT5 A;  2BKN A;  3B57 A;  4RQF A;  4BJN A;  1KOG A;  2R6G F;  2XQ8 A;  3PU3 A;  1LRZ A;  2YN6 A;  3CKD A;  5C53 B;  2XQ5 A;  2A9U A;  3PZC A;  2CLY B;  4JEU B;  2NW7 A;  5ABH A;  2ZIM A;  3TEH A;  3MQZ A;  2CPT A;  1FMV A;  2J4G A;  2KLQ A;  1QSD A;  2WCA A;  3P4S A;  2CJA A;  2VQF T;  4YRM A;  3REX A;  4P74 A;  2MYS A;  2AXD S;  3A7M A;  3A5X A;  2ODV A;  4DBQ A;  2XAH B;  5AQQ B;  3C98 B;  3RPU A;  4O4H E;  4YT0 A;  4HWI B;  3ZJ1 A;  1B7Y B;  5JR9 A;  3KV4 A;  2FYK A;  2X0Y A;  2JMK A;  5JDG A;  3AE1 A;  2XGT A;  3QO7 A;  3VU7 H;  1DU2 A;  5E0O A;  3CK6 A;  4HN9 A;  4B3R T;  2ZM2 A;  4IDP A;  3LC0 A;  4DV6 T;  3HI2 A;  1XWM A;  1ZOY A;  3MAC A;  5AQP B;  3I1A A;  2VB6 A;  4ILA A;  4O4J E;  5FXX A;  4CN4 A;  5JDN A;  4IIJ E;  1R8I A;  1MMN A;  3UFE A;  2PTF A;  4X1K E;  4PHC A;  4YRC A;  2RA1 A;  3ZSS A;  1WQ7 A;  4H9Q C;  1BR0 A;  4ADZ A;  3PCO A;  2OV9 A;  2PG8 A;  2ZNJ A;  1X9B A;  2HN1 A;  2W62 A;  1BIA A;  2XTI A;  3PU8 A;  3W15 B;  4I4T E;  3AE3 A;  2LOP A;  3LBX B;  1YB3 A;  5JRC B;  2X66 A;  5L3E B;  2YOE A;  3PUA A;  3QC9 A;  3V7S A;  5FYM A;  1X2G A;  2UXN B;  4H2T A;  1E1H B;  3T1Y T;  3N9N A;  1E1O A;  2XAJ B;  2XAS B;  4H2Y A;  2EJ9 A;  3NBX X;  4GKJ T;  2WWV A;  5KXJ A;  1EIY A;  1X2H A;  4HA8 A;  2CXL A;  2WU5 A;  3NKZ A;  3JAF A;  3AE6 A;  4YRO A;  4NUU A;  4EED A;  2X9H A;  4LML A;  3N2K E;  1I94 T;  2EJG A;  3RQW A;  4UP8 A;  3RIF A;  2LRL A;  2E9X D;  4EX5 A;  4X5O A;  4YRK A;  3K3N A;  3AEB A;  3FZF B;  3IBP A;  4DQ2 A;  4O2B E;  5L47 A;  3TLU A;  2X67 A;  3WI3 A;  2HPJ A;  5J0Z A;  3UU8 A;  1HCI A;  3DP7 A;  4UEL A;  11AS A;  2ALY B;  4ZZC A;  5LG4 A;  1NJ1 A;  2WM9 A;  2C5K T;  4LFA T;  3FZK B;  2I59 A;  4I43 B;  4PJM A;  3HY0 A;  2VVN A;  3P8C D;  2LHN A;  3FXD B;  3AE5 A;  3VKH A;  3P4P A;  2L3L A;  5AQR B;  5HWY A;  4U3C A;  3JC6 D;  3LG7 A;  4C90 A;  3TLW A;  5LG3 A;  3M4P A;  1J5E T;  3E08 A;  2Y48 B;  4YPF A;  2I4L A;  2D0U A;  4COF A;  4NXM T;  4GOU A;  4YLH A;  3RH3 A;  1WRD A;  3NVO A;  3UGT A;  2V5D A;  3VRB A;  3O1I A;  3VRA A;  1PYS B;  3ESL A;  2LOS A;  4P3P A;  2V26 A;  4OX9 T;  4JEH B;  4HKA A;  3AXJ B;  1LKX A;  5CJ5 A;  2IHR 1;  4KP3 C;  2VAS A;  4CS2 A;  5HXE A;  1D0Z A;  3ICA A;  2BG9 B;  4YRP A;  3NZQ A;  3ONX A;  2AE9 A;  2LM9 A;  5F5W A;  1YQ3 A;  4K86 A;  4QX8 B;  2ART A;  4IE5 A;  3ONJ A;  5FXZ A;  3REU A;  1KNP A;  2J47 A;  2Q7H A;  3HRK A;  1Z7N A;  4AKR B;  2XQ3 A;  1T98 A;  3V8L A;  3PUS A;  2FBW A;  2A8E A;  5ABF B;  2NTX A;  3UU4 A;  2XY8 B;  5JDF A;  3IAL A;  3N9P A;  4MHC A;  4K88 A;  4GKK T;  5JRE A;  3RRW A;  3RKY A;  4OYJ A;  3ZT7 A;  2G4C A;  4DUY T;  4DID B;  3TUP A;  4YRJ A;  2WZI A;  3SRZ A;  5BMV E;  4PJL A;  2QHT A;  2ZT6 A;  1U5P A;  4XTY A;  5AQV B;  3DSQ A;  4LF8 T;  3IHR A;  2VQE T;  2LSJ A;  4LNS A;  3HTZ A;  3R6N A;  4HTE A;  3C4W A;  4HE8 A;  5IWA T;  4WF2 A;  4BA9 A;  2WU2 A;  2DWG A;  1XNQ T;  2E65 A;  1YFS A;  3RIU A;  3QK6 A;  3P8V A;  2XUE A;  3I9Y A;  3PE0 A;  4DV3 T;  5KMG P;  2AKW B;  4JI5 T;  5HXS A;  1QUU A;  2KWH A;  2WBL A;  2EL9 A;  2CRB A;  1HFA A;  5DQV A;  2XQ7 A;  3EI0 A;  2BG9 E;  4P75 A;  3CWZ B;  3AVS A;  4XEM A;  4HFV A;  4Z90 A;  2B76 A;  3SFD A;  3QB5 K;  4TNV A;  3P7I A;  4BW9 A;  2WZH A;  2ZTG A;  1X01 A;  4TWH A;  4O2A E;  3GWH A;  3R84 B;  2N9D A;  3ZCJ A;  3PUY F;  1RIQ A;  5JQG E;  2RHS B;  2G0U A;  2ZZF A;  2AMC A;  3Q5D A;  5IHY A;  4Q6G A;  1SA0 E;  1L0W A;  3FHN A;  2PMF A;  1W0A A;  3G06 A;  4HWD A;  3HKE E;  2CJB A;  2V7M A;  2V6X A;  1MMD A;  2DHR A;  3OTO T;  2Q9Q A;  3KBT A;  4LVM A;  4UF0 A;  2PME A;  3ZST A;  3GN5 B;  3ZCI A;  3AE2 A;  4H2U A;  5AQO B;  2DZC A;  3IA3 A;  5LGU B;  2PFV A;  1HNZ T;  3TLT A;  3QO5 A;  4PFP A;  4ZI2 C;  2D0T A;  2Y8D A;  2Q5I A;  3UGQ A;  5LB7 B;  4TX5 A;  5JDL A;  5EK3 A;  4P73 A;  3UUX B;  2DCF A;  3IG2 A;  1WQW A;  5ABE A;  3MA9 A;  1ASZ A;  3VHL A;  4YRI A;  4OK0 A;  2EHO A;  3MEY A;  3RHW A;  4O4L E;  2DQ3 A;  4UIG A;  3N5L A;  1YQ4 A;  3LSV A;  2N1G A;  2WAU A;  3J9X 1;  4GK5 E;  3PUQ A;  1MIW A;  5HXR A;  3SFE A;  2QGS A;  3C4Z A;  3L39 A;  2HPL A;  3R07 A;  3FB2 A;  4PK5 A;  1UX5 A;  4CI3 B;  5L4H A;  2X51 A;  5LMN T;  2YU2 A;  3PV0 F;  3J7Y q;  4CXW A;  3AA0 B;  4I50 E;  5L2L A;  4XZC A;  2UUC T;  4HFB A;  1UX4 A;  2VKO A;  4AI6 A;  2KXP B;  2ZZE A;  3PUZ F;  3UQ7 A;  4IDO A;  3BFM A;  3LK4 2;  4LVL A;  4JYA T;  2H89 A;  4X1Y E;  3DTO A;  3ABV A;  5ABG A;  2BZB A;  3HR0 A;  4XTU A;  3ZPO A;  3OJA A;  4AKI A;  3CX6 B;  3FZM B;  3F57 A;  2IY5 A;  2ZIN A;  1LVK A;  4TNW A;  1H7C A;  3E22 E;  4WJ4 A;  5FP3 A;  4WI1 A;  4YRQ A;  4UXN B;  5HEG A;  5C52 B;  4E7S A;  2E1H A;  3V8K A;  1E2A A;  2I4O A;  2M6B A;  2D9D A;  4DV7 T;  2XQ4 A;  3NET A;  4HGA A;  3P50 A;  3L09 A;  3AAE B;  4HFC A;  4YFS A;  4WBN E;  3Q9D A;  3ERR A;  2CIM A;  5LNK A;  2BKP A;  2ZCE A;  2A72 A;  3RX6 A;  1JNR A;  3NEM A;  2FJA A;  2KZ7 B;  2ZXF A;  3V7R A;  3KDS E;  5ETW A;  4WBO A;  4GIW A;  4CI2 B;  1N9W A;  4KX6 A;  4DMW A;  4X64 T;  4P1N A;  2DEQ A;  5FY7 A;  1OED C;  2FUP A;  5FXV A;  1UUS A;  1QE0 A;  3KFU A;  4HWO A;  2WSS V;  2KSR A;  3BQK A;  4ISS A;  1H4V B;  2LSI A;  4KQE A;  2ES0 A;  4EAH A;  1HG5 A;  4IHJ E;  1NJ8 A;  2DNX A; 
#chains in the Genus database with same CATH homology
 5C51 B;  1E1O A;  2C7I A;  4H2Y A;  3IKL A;  2EJ9 A;  3MF2 A;  4WJ3 M;  2ZGW A;  1X2H A;  2E3C A;  1EIY A;  4HA8 A;  3HFV A;  1ATI A;  2DU5 A;  1B76 A;  3A5Z A;  4YRO A;  1EFW A;  4UP9 A;  4HVC A;  4HWR A;  4KR2 A;  2E41 A;  2EJG A;  2IY5 B;  1FYF A;  3HXZ A;  1GGM A;  2E10 A;  4UP8 A;  4YCV A;  2Q7G A;  1NJ5 A;  4EX5 A;  4CS4 A;  4H2S A;  1X54 A;  4X5O A;  3RAC A;  4YRK A;  4TVA A;  4YRN A;  2ARU A;  4XTX A;  4NCX A;  1E22 A;  3A5Y A;  5ELO A;  4DQ2 A;  1HTT A;  2ZZG A;  4YP0 A;  4ZIB A;  1HXD A;  4TQD A;  11AS A;  2ALY B;  1G5I A;  2P0L A;  2EJF A;  3NEN A;  4P74 C;  1NJ1 A;  3E9H A;  1H4Q A;  1J5W A;  1SRY A;  3HY0 A;  2DTH A;  1BBU A;  1X56 A;  3HRI A;  1NYQ A;  4UP7 A;  3PCO B;  3M4P A;  2E64 A;  3A74 A;  4YPF A;  3V8J A;  2I4L A;  4HWT A;  4UPA A;  4P72 C;  1H4S A;  2AKW A;  3W3S A;  2P5I A;  1WU7 A;  1WNL A;  3UGT A;  3A7A A;  1PYS B;  3E9I A;  4TVW A;  4YRG A;  1H4T A;  4P3P A;  4TTV A;  1B70 A;  3RKW A;  4CH4 A;  2Q5H A;  2Q7E A;  2ODR C;  1LYL A;  3HY1 A;  5KNN A;  4CS2 A;  1EIY B;  4ZTU B;  1E24 A;  2ZNI A;  3ICA A;  1WYD A;  4YRP A;  2J3L A;  3OD1 A;  3L4G A;  5F5W A;  4P71 A;  3QTC A;  4K86 A;  2ART A;  1ASY A;  1PYS A;  2ZIO A;  3REU A;  2RHS A;  2Q7H A;  2DZ9 A;  3HRK A;  1Z7N A;  2ODR D;  1E1T A;  2I4N A;  3V8L A;  4Q15 A;  2A8E A;  4YYE A;  4H2W A;  4HT4 A;  1NNH A;  3IAL A;  1G5H A;  4TVA B;  2ARS A;  4EO4 A;  4K88 A;  4RDX A;  1SER A;  1SES A;  12AS A;  3VBB A;  3P8Y A;  4H2V A;  3RKY A;  2G4C A;  3TUP A;  4YCW A;  4YRJ A;  3RGL A;  4LVK A;  2HNI A;  2QHT A;  3P8T A;  3M4Q A;  3RL6 A;  2ZT6 A;  4CH6 A;  4XTY A;  4XU3 A;  3DSQ A;  3FJP A;  3MF1 A;  3HXX A;  4LNS A;  1USY A;  4E51 A;  3HTZ A;  5K1P A;  4P3N A;  1KMM A;  4WF2 A;  2ZT8 A;  2DJZ A;  3A7R A;  2RHQ A;  1B8A A;  1JJC A;  1EVK A;  2E65 A;  4XU1 A;  1YFS A;  4AH6 A;  1ADY A;  1EQR A;  3P8V A;  1HC7 A;  2E5A A;  1YGB A;  2AKW B;  1W66 A;  4XEO A;  1WLE A;  1Z7M A;  3VQX A;  1EVL A;  3RKX A;  2EL9 A;  4KR3 A;  1B70 B;  1QF6 A;  2DXU A;  2QHV A;  4P75 A;  2CJ9 A;  4XEM A;  2J3M A;  3I7F A;  4H2X A;  4BW9 A;  1KMN A;  3VQY A;  3HFZ B;  4RQE A;  1YFR A;  2QHS A;  4G85 A;  3RUX A;  2ZTG A;  3V7C A;  4YRF A;  1X01 A;  3L4G B;  3IKM B;  4LVI A;  4YRL A;  4YCU A;  5ELN A;  1RIQ A;  4CH3 A;  3EFR A;  4P72 A;  2RHS B;  3L1A A;  2ZZF A;  2AMC A;  4Q6G A;  1L0W A;  2PMF A;  1C0A A;  2CJB A;  2DQ0 A;  2ZR3 A;  4XU0 A;  4K87 A;  3TEG A;  3HFZ A;  1BIB A;  4YRS A;  4LVM A;  1YFT A;  2PME A;  4H2U A;  2DZC A;  3CMQ A;  3WQZ A;  3VQV A;  1EOV A;  3EFS A;  1B7Y A;  3BJU A;  3QO5 A;  2ZR2 A;  4YRR A;  4TVY A;  5E3I A;  2Q5I A;  4OLF A;  3UGQ A;  2EAY A;  4P71 C;  1ADJ A;  3UH0 A;  1NYR A;  3QO8 A;  4P73 A;  2DU7 A;  2RHQ B;  4HWS A;  3IG2 A;  1JJC B;  4DPG A;  3VQW A;  1WQW A;  1G51 A;  1WPY A;  1ASZ A;  4YRI A;  3MEY A;  4CH5 A;  4RMF A;  2DQ3 A;  4YDQ A;  1NJ6 A;  2DTI A;  2EWN A;  2C8M A;  4YRT A;  2ZT5 A;  4PG3 A;  4RQF A;  1KOG A;  3HXW A;  2CGH A;  5C53 B;  1NJ2 A;  2DXT A;  4H2X B;  3G1Z A;  3PZC A;  5K1X A;  3RF1 A;  2I4M A;  2DVE A;  2ZIM A;  4TQF A;  1USY C;  3R07 A;  1VQZ A;  3QNE A;  1SET A;  3MQZ A;  3TEH A;  2ZT7 A;  1X55 A;  4H02 A;  4XTZ A;  3LSS A;  2AMC B;  2ZZE A;  2CJA A;  4YRM A;  3BFM A;  4LVL A;  3REX A;  4P74 A;  3A7U A;  4OP0 A;  4P75 C;  3NEL A;  4XTU A;  2IY5 A;  2DDZ A;  2ZIN A;  3HXU A;  1B7Y B;  4G84 A;  1IL2 A;  2FYK A;  1BBW A;  4WJ4 A;  4WI1 A;  2XGT A;  4YRQ A;  4XU2 A;  4LVJ A;  3QO7 A;  3L2Z A;  5C52 B;  2E1H A;  4YRE A;  3V8K A;  2I4O A;  3HXV A;  5HGQ A;  4J15 A;  4L87 A;  4BWA A;  3LC0 A;  2DTO A;  2ALY A;  3NET A;  4ZTZ B;  3ERR A;  2CIM A;  2ZCE A;  4O2D A;  4CS3 A;  4PHC A;  3NEM A;  4YRC A;  2NS6 A;  2ZXF A;  1WQ7 A;  4P3O A;  3V7R A;  3A32 A;  3PCO A;  4XTW A;  4HWP A;  1N9W A;  2ZNJ A;  1BIA A;  2XTI A;  2QHU A;  2DEQ A;  4XTV A;  3TEH B;  1YB3 A;  3LSQ A;  3A31 A;  3HXY A;  4TWA A;  4P73 C;  3KFU A;  4HWO A;  2DKG A;  1H4V B;  3V7S A;  3UFG A;  4KQE A;  1QE0 A;  1X2G A;  4H2T A;  3RIR A;  1NJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...