5F5WA

Crystal structure of the alpha subunit of glycyl trna synthetase (glyrs) from aquifex aeolicus in complex with an analog of glycyl adenylate (gly-sa)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
283
structure length
283
Chain Sequence
MYFQDIIMTLHKFWAEKGCLIWQPYDVEVGAGTMNPATFLKVLGKKPWNVAYVEPSRRPQDGRYGENPNRLQHYYQFQVILKPAPRNPQEIYLESLERLGINPLEHDIRFVEDDWESPTLGAWGLGWEVWLDGMEITQFTYFQQAGGLDLDEISVEITYGLERIAMYIQDKDSVFDIEWKEGITYGEIFKRSEWEWSKYNFELADTDMLFQVYEMFEKESKRMVEEGLIFPAYDYLLKCSHVFNILDARGAISVQERARYIRRMNNLAREIAKLYLQVFENVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Polyphyletic Origins of Glycyl tRNA Synthetases.
pubmed doi rcsb
source organism Aquifex aeolicus (strain vf5)
molecule tags Ligase
molecule keywords Glycine--tRNA ligase alpha subunit
total genus 110
structure length 283
sequence length 283
chains with identical sequence B, C, D, E
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 5f5wA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5f5wA01
4YREA 3W3SA 2QHVA 3V7CA 4UPAA 2ZIOA 4XEOA 4YRJA 3HTZA 3A5ZA 1BBUA 3MEYA 2P0LA 1B70B 1SERA 3BJUA 3MF2A 1NYQA 2CJBA 4YRQA 1WPYA 3QTCA 4E51A 5K1PA 1H4SA 2PMEA 3HXXA 2EJGA 4CS4A 4XTYA 4P72A 4YRNA 1B7YA 3IALA 5ELNA 4YRMA 4YRCA 4J15A 4YRRA 2I4MA 2RHQA 3RACA 4P73C 3DSQA 4KQEA 3L4GA 3E9HA 3UH0A 2E1HA 4DQ2A 4H2XB 2Q5HA 1PYSB 4K86A 5ELOA 1X54A 2DJZA 3P8VA 3EFRA 3A74A 3QNEA 4TVAB 1NJ6A 4X5OA 1FYFA 1X55A 4YCVA 4XEMA 2HNIA 1KOGA 2Q7GA 4XTVA 3V8LA 1Z7MA 1X2HA 2XGTA 1EIYA 3EFSA 2RHSA 1X2GA 4XU3A 3PZCA 4WF2A 4YRTA 2QHTA 2ZXFA 4YCWA 3E9IA 3ICAA 3P8YA 4TQFA 2QHSA 5HGQA 1YGBA 2Q7HA 2EJ9A 1BIAA 1EOVA 5E3IA 4YRKA 4HA8A 1YB3A 1X01A 4YROA 2ODRC 1BIBA 2DEQA 3VQXA 3PCOA 1EVKA 4NCXA 2P5IA 1EFWA 1WYDA 3RL6A 1WNLA 4HWRA 4RQEA 4YP0A 2ARUA 4XTUA 1YFSA 2DKGA 3NELA 4UP8A 4K87A 2DZCA 2DTIA 1C0AA 3L1AA 3HRKA 1HXDA 4KR3A 2DTHA 2DU7A 4DPGA 3UFGA 2EAYA 4YPFA 3A32A 4XTWA 2J3MA 2ZR2A 5F5WA 4P71C 3A31A 3HXZA 1B70A 2DQ3A 2CGHA 1NJ1A 1YFTA 4P73A 4G85A 4HWOA 2E65A 1E1OA 2DDZA 2E10A 4HWTA 2I4NA 1ATIA 1NYRA 4O2DA 2C7IA 1G51A 4ZTUB 1ASYA 3R07A 3A7UA 4TTVA 5K1XA 1ASZA 4P74C 1J5WA 1QF6A 4XTZA 1LYLA 3FJPA 3HXVA 4Q6GA 3HFVA 3UGQA 4CH6A 2EWNA 2ZNJA 1N9WA 1EQRA 1WU7A 2ZZEA 3LSSA 4H2SA 4H02A 4HWSA 2ARTA 3HY1A 1SETA 4P71A 1ADJA 1E22A 1L0WA 1SRYA 2I4OA 4P74A 2ZZGA 2ARSA 3RKWA 2DTOA 4TWAA 2ZIMA 3M4QA 3P8TA 1JJCA 4HWPA 5C51B 3V8JA 4YRGA 3PCOB 3REXA 4H2VA 3KFUA 2AKWA 4YYEA 1B8AA 4H2XA 5KNNA 3HFZB 4YDQA 4CH5A 1HC7A 3V7RA 3NEMA 3TUPA 12ASA 3HY0A 3RKXA 1USYA 4ZTZB 1B7YB 4BWAA 1SESA 4TQDA 4WJ3M 3CMQA 3QO8A 1H4VB 3QO7A 4H2TA 2PMFA 2ZCEA 4YRFA 2RHSB 1E1TA 1EIYB 5C53B 4K88A 2E41A 3HXUA 2E5AA 2DVEA 3UGTA 1X56A 4YRIA 3NETA 2ALYA 1WQ7A 4H2WA 3RGLA 4TVAA 4YRSA 2EL9A 2E3CA 4RMFA 4CS2A 3VQWA 3BFMA 1B76A 4XU2A 2DXUA 1QE0A 4UP9A 2ZR3A 2ZZFA 3RF1A 4XU1A 4Q15A 3A5YA 3TEGA 1H4QA 1NJ8A 2QHUA 2AMCB 1G5HA 4YCUA 2E64A 2AMCA 4H2YA 5C52B 1KMMA 2IY5A 2ALYB 2CJ9A 4RDXA 3REUA 2ZTGA 2C8MA 3HXYA 4PG3A 4EO4A 3RIRA 4ZIBA 3VQYA 3RKYA 1NNHA 4XTXA 3IG2A 2Q7EA 2ZT6A 4CH3A 3IKLA 4OLFA 1G5IA 1HTTA 2ZNIA 1VQZA 2DZ9A 4LNSA 4P3NA 3HRIA 3OD1A 1EVLA 1NJ2A 4H2UA 2ZT8A 4YRLA 1ADYA 3HXWA 3VBBA 3RUXA 4UP7A 1Z7NA 3TEHB 2G4CA 3WQZA 3MF1A 2I4LA 1NJ5A 2DQ0A 1W66A 11ASA 3VQVA 4WI1A 4P72C 3HFZA 3V7SA 2AKWB 2ODRD 1GGMA 3A7AA 4P75C 4OP0A 4CH4A 1JJCB 1E24A 1H4TA 2CIMA 2DXTA 4AH6A 2Q5IA 3LC0A 1IL2A 2J3LA 4TVYA 1WLEA 1PYSA 1USYC 1WQWA 4EX5A 3IKMB 3L4GB 4RQFA 2IY5B 4WJ4A 2RHQB 3L2ZA 4XU0A 3TEHA 4CS3A 1BBWA 4PHCA 3NENA 4KR2A 4YRPA 4HVCA 2XTIA 2ZT5A 2EJFA 4BW9A 3G1ZA 4P75A 1YFRA 3ERRA 4L87A 4P3PA 2DU5A 3A7RA 4G84A 3LSQA 2CJAA 3M4PA 1RIQA 2FYKA 3QO5A 2ZGWA 3V8KA 2ZT7A 3I7FA 4TVWA 2ZINA 1KMNA 4P3OA
chains in the Genus database with same CATH superfamily
4ILAA 4A98A 2QHVA 4HWFA 1BBUA 3SWHA 5AFUL 2W63A 4MALA 1D1CA 2CJBA 4ISTA 3QTCA 3CWZB 5K1PA 3HXXA 2MPKA 4YRNA 4IDPA 5H6QB 2KT9A 2B76A 3VHLA 3IALA 5ELNA 2LOPA 4AISA 3RACA 2XQYA 4P73C 2LKGA 3L4GA 4QXCB 2ACZA 2HPJA 2E1HA 1MIYA 2CLYB 3UTKA 2Q5HA 3FXDB 2PFVA 3UUMA 4AQGA 3RYFE 2K9AA 1Z0PA 2WM9A 4LF9T 3I1AA 1MMDA 5JVDE 3EFRA 3PU8A 3RKOA 4ZHQE 2H3RA 4B3MT 2W66A 4HFCA 4ZZCA 2I6HA 4TVAB 3AE1A 1D0ZA 2WP9A 5FKYA 3UU3A 1X55A 4JI3T 2X9XA 3CVRA 4XTVA 4OFZA 3V8LA 1Z7MA 1LKXA 1X2HA 3LDQB 5FYMA 2RHSA 3PZCA 4WF2A 4YRTA 5HXCA 1BR1A 3LBXB 1MIVA 3E9IA 3ICAA 3TLTA 4YTMA 4TQFA 4AQFC 4YRKA 4LFCT 1BIBA 2XAGB 3TKLB 4TUYE 4ZI3C 4XZCA 2Q9QD 1EFWA 4YJ3E 4YP0A 3Q5WA 2V7JA 3T1YT 2WB5A 4UP8A 3IF8B 3I0OA 1T7SA 5HEOA 2FUPA 5JREA 1HXDA 5AQRB 3EABA 4KR3A 1IZNB 2JJ9A 3K1SA 5LHHB 3KV5A 4EEDA 2C5JA 3A32A 2BG9C 4KUMB 1UURA 3N9PA 2LLYA 3P4WA 4ZOLE 3UQ7A 2DQ3A 2WMNA 3OBVE 2IMLA 2VK9A 3OTOT 1GQEA 3VR8A 2X67A 1V9DA 4CZZB 2XAFB 3K3OA 3JAEA 4IE4A 4P0AA 5AQMB 4FI5A 4I4TE 4BJMA 4L5GA 4EGWA 2DWKA 3B57A 1ASYA 3U78A 3L09A 4X66T 5LYJE 1WR6A 5FL0A 1VCSA 1KFYA 4UF0A 3ZMUB 2JRKA 4P74C 3C4ZA 4Q6GA 3OYZA 3HFVA 4DUYT 4IDZA 4HT4A 4JI0T 4CH6A 1N9WA 3FZKB 5LCYA 2XAJB 5L2LA 2ARTA 2BVMA 3O4XE 3PUQA 1R8IA 3HKCE 1WCRA 1E22A 4PJLA 4U74A 4TWDA 1SRYA 2ODVA 2XY8B 3RKGA 2ZM8A 3A7MA 2NW7A 3ZSTA 3IBPA 2LHRA 4JI5T 5LHGB 2CWYA 4AIUA 4L0RA 4DR5T 3M4QA 3P8TA 3GA8A 5C51B 2JQ9A 1FMWA 3RYHE 3C51A 1YQ4A 1B8AA 1HC7A 1N36T 4ZTZB 4K0UA 5CFBA 1SESA 4WJ3M 4DIDB 2RPAA 3ZCIA 3QO8A 3ZT6A 3FZLB 2E5LT 3ZT7A 5ABGA 3UU8A 4H2TA 3VKGA 5FY7A 2RHSB 1YXRA 1CUNA 3C64A 4OYJA 2E5AA 2CMRA 4QXHB 3NETA 4ERRA 1XNQT 3N9MA 2W67A 2ZLYA 2UXXB 4H2WA 4TVAA 4KMCA 3EVYA 4RMFA 3G06A 3BFMA 1J5ET 1B76A 5F3JA 5LGNB 4UP9A 2ZR3A 5TAOA 5JDQA 5HXHA 5FXZA 3BQLA 2C5KT 1H4QA 2QHUA 2FJDA 2A8EA 4ILBA 2IUBA 2X51A 2AMCB 4UXNB 4U2ZA 3CX7B 2AMCA 4IDQA 4H2YA 2VURA 2DNXA 2UU9T 4O4HE 5L3BB 3DTOA 3H3MA 4U33A 2C8MA 1H7CA 4PG3A 1CHUA 5L3CB 4ZIBA 5HWXA 3MA9A 2Q7EA 2VQET 4O8SA 4PK6A 5LG3A 1UUSA 2V7LA 2N2NA 3AE8A 4CN4A 3ZT5A 5LA6E 2D0TA 3NWIA 2ZNIA 3E0ZA 3DP7A 4G63A 4P3NA 1EVLA 3B5MA 4YRLA 2Y8DA 3IA3A 3N9QA 1WRDA 4KP3C 3UU5A 2NS6A 2VKJA 3TEHB 4H9SE 3SFEA 1HR0T 4PW8A 4LF7T 1D1BA 2UUCT 4TWHA 4WI1A 2WWVA 2M6IA 3AEAA 3I9YA 3I0QA 4UV8B 4YFSA 2XHEB 4P75C 3AXJA 1IJ6A 4OP0A 3L3PA 5J1GA 2CBJA 2J62A 2IW5B 4IHJE 3WI3A 2J47A 2ODUA 4A97A 1IAPA 2YEVC 3J7Yq 2Q5IA 3U3IA 4LVLA 3GN5B 3O1HA 2J3LA 3PUAA 4UEMA 2MTQA 2R6GF 4TWFA 1WLEA 3ZKRA 2G0UA 3JCFA 4TV9E 5KX5E 2XSBA 4EX5A 4RQFA 2IY5B 3L2ZA 2DHRA 4QXBB 4XU0A 1LVKA 4UIGA 1WYBA 2V26A 1BR4A 4YRPA 1KF6A 4UF0B 2XTIA 3H37A 1WYCA 3X1DA 4JLEA 2H88A 4H9NC 3FBZA 2EJFA 1VOMA 1Z8UA 3RX6A 3G1ZA 4P75A 2DU5A 4B3ST 2A3DA 3JC6C 4U7IA 4X5TA 1RIQA 2BKNA 4YSXA 3QO5A 2ZGWA 3HA4A 2IC6A 2CA5A 3I7FA 3PV0F 3Q5DA 2AXDS 3V7CA 3P7IA 3UULA 3ZYLA 5GONE 2LKHA 2XTLA 1XMQT 3BJUA 3MF2A 5L3GB 1XDPA 1WPYA 4E51A 4WBOA 1H4SA 4AQYT 3AVRA 1T8BA 2W61A 4P72A 1B7YA 4YRCA 3L39A 4PFOA 1MNEA 4HFIA 4GKKT 3KBUA 3UH0A 4HE8A 4H2XB 1PYSB 2AE9A 3N5LA 2JIWA 2M67A 5LG4A 4UV9B 1X54A 2BKPA 4QX7B 1D0YA 2DJZA 1UX4A 2FJAA 3AE9A 3QNEA 4EYYR 5FP3A 3ZJ2A 4YCVA 2XM1A 4XEMA 4OHFA 2YDRA 1KOGA 5JRCB 2VL8A 5JH7E 4LMLA 3CIRA 4ILCA 4PJMA 4XU3A 4ANJA 4EEBA 2ZXFA 2LRLA 3P8YA 4EZ4A 2LM2A 3R6NA 5HGQA 2KSRA 4LFAT 1YGBA 4MLKA 2EJ9A 1BIAA 1MMAA 3EI0A 2UXBT 2P9BA 1YB3A 1ZHCA 1X01A 5LGTB 5J2UE 2LSGA 2BG9A 5AQNB 2LOSA 3PCOA 4X62T 4NPPA 1WYDA 3RL6A 4YXDA 5AQTB 4HTEA 2K5BB 4HWRA 2A9UA 4HFDA 2ARUA 4H63H 4XTUA 5CGMA 1YFSA 2WU5A 3AEBA 3ZPOA 1J1JA 1C0AA 3NZQA 1M62A 2XAQB 2J4GA 3HI2A 4DV1T 4IE5A 1OEDE 3L8RA 4A56A 3UFGA 3VRBA 4G2AA 4TX5A 4IL4A 2ZR2A 5AQJB 3LK3B 2IC9A 4NUVA 3S4UA 5LGUB 3AA0B 1YFTA 4E7ZA 4P73A 4F6RC 5EK3A 1ZV4X 3KV4A 4HWCA 5HYAA 2E65A 2K24A 2RA1A 1E1OA 3QUJA 3UT5E 2DDZA 2E10A 2YOEA 4DV7T 3C98B 4H9OC 2C7IA 2X9HA 4ZTUB 4HWIB 1YKHB 3R07A 3N2GE 2DWGA 5FL1A 4ADZA 5K1XA 3PUGA 3K8PC 3TLWA 4XTZA 3HXVA 3V5SA 3UGQA 4JEHB 5M4YA 1MMNA 2EWNA 4YLHA 3FZHB 1EQRA 1WU7A 2ZZEA 4PK4A 1QSDA 5LXTE 2L9QA 2CM0A 2XQ9A 2VKDA 1ADJA 4B3TT 4HKAA 1L0WA 4V1Av 2I4OA 3M3ZB 3PUXF 2XM2A 2DI4A 2ZZGA 2V5DA 4DR4T 2N9DA 1S94A 3ZMTB 4QH5A 4JYAT 2ZIMA 3JADA 4KHZF 5KMGP 2WWUA 2BS4A 4X1IE 2VVNA 4O4IE 3AEGA 4HFBA 4H9QC 4H2VA 1D1AA 1KNRA 5ADXL 4EIWA 3CX6B 5KDMC 4CN1A 3AE6A 1U4QA 1NEKA 3F31A 3RHWA 2IHR1 4CI1B 2GK9A 3QO7A 1WR0A 2IAKA 4YRFA 2PG8A 3NKZA 4NXMT 5C53B 2E41A 2VKHA 3N9OA 1X56A 2PTFA 3UUNA 2UUAT 4JBWF 5E0OA 4XAXB 4U72A 2EHOB 2UXNB 4EB6E 3N9NA 4PJJA 4YRSA 4IDNA 4DBQA 3LK42 3VRAA 4YSYA 4XU2A 2C5IT 5ABFA 4GKJT 4Q15A 3PUYF 2UUBT 3TEGA 1WLXA 3IEEA 3LJCA 2BBJA 5FXVA 3TLUA 3CQCB 3OPCA 2IIUA 3NBXX 2CHNA 2RP4A 2E64A 4YCUA 4WBNE 3C50A 1KMMA 5LJNA 4JI2T 3ZMZB 4WYVA 5FMNA 3JAFA 2X0LB 5FNVE 3RIRA 3RKYA 5F8PA 5ABHA 2ES0A 2V1DB 3ETUA 4TZ4C 3IKLA 3RIUC 5JDGA 3AEFA 1HTTA 1VCTA 3J9X1 1VQZA 4YHHT 2X68A 2WMOA 2WQYA 4O2AE 2WSSV 4H2UA 1G8XA 3PJAJ 3HXWA 3AEDA 2ZM2A 3VBBA 3RUXA 1UCUA 3EHZA 3MACA 4WNKA 3WQZA 3PE0A 3MF1A 5EZYE 1W66A 3VQVA 4P72C 2LT3A 2QRXA 3HFZA 1MIWA 3CKDA 3QB5A 4Q25A 3A7AA 3AE7A 2CXDA 2EHOD 1E24A 3RYIE 2K3WA 5EK4A 2MAWA 2CIMA 1G73A 1JNZA 2KWIB 5CB4E 2VASA 3ZSSA 4O2BE 3IKMB 2E9XA 2RHQB 3AECA 5JR9B 3ONXA 4P1NA 4CN6A 1NENA 1BBWA 2ZMAA 4YSZA 4KR2A 1SE7A 2KNDA 4LVKA 4ISSA 4KBMB 1L0VA 4BW9A 2DCFA 5AQLB 2BBHA 2W62A 3RRWA 3ZJ1A 3CQXC 4YTPA 2Q9QC 5HXRA 1MNDA 2XQAA 3Q5EA 3V8KA 5FXXA 2E5VA 2LSIA 2ZM0A 3HKEE 1KMNA 2ALYB 4P3OA 4DMVA 4YREA 4DV6T 5AQFB 3RC3A 2CE7A 1ZP0A 3MEYA 3CPZA 1B70B 1YQ3A 1NYQA 3EDUA 5BR8T 1FJGT 2EJGA 2V6YB 4CS4A 2JQQA 2V8SV 4YRMA 5JTGA 4LF6T 4J15A 4YRRA 2RHQA 3DSQA 4KQEA 2E9XB 4DV0T 5AQVB 5LOVE 3E9HA 4HGAA 3P4SA 4DQ2A 5DJQC 3ETVA 4DV4T 5JDLA 4K86A 4I43B 5C8YE 4X1YE 2CXLA 3KV6A 4XBFB 4IE7A 3SOLA 4IGUA 4QH4A 2H89A 5KXJA 4OYKA 2LJLA 1HF8A 5JDHA 3WAJA 4X5OA 1FYFA 3KDSE 4AQFA 5AQUB 3OVUA 5DQWA 3P8CD 2Q7GA 5HXEA 3AAIA 3UU6A 4AKHA 4ZI2C 1SHZC 4QKNA 5H6RB 3FZMB 1US7B 1YKEB 3B13A 1EIYA 3EFSA 5HEHA 1X2GA 3A5XA 2BS2A 3ABVA 3W15B 3EUHA 3RIFA 3C4WA 1UX5A 5IWAT 3KVAA 2KWHA 3ANWB 4H9RC 2L8KA 2XPKA 2V6XA 1OEDA 1IBMT 4E7SA 2KZ7B 2LM9A 2V5CA 2CRBA 4YROA 3LFMA 4FJOA 1BR2A 3IHRA 3VQXA 2CCQA 3QK6A 4IE6A 3AAAB 3OJAA 3I9WA 3PUVF 1WNLA 3D0TA 1XNRT 4LF8T 2WZIA 2Q9QB 5HEGA 3VKHA 2H7VC 2DKGA 2QGSA 4BAYB 1DU2A 5FXWA 3NELA 2YINA 4EYUA 1MMGA 2KLQA 5IHYA 2DTIA 2ACXA 3L1AA 3HRKA 3HR0A 4EAHA 4ZZBA 4YTNA 5LBMA 2DTHA 2B1EA 2EAYA 3K3QC 2VL0A 4GK0E 5L3EB 5JDNA 3RPUA 4DR2T 5L4HA 3A31A 3HXZA 2HPLA 2CGHA 4U7YA 4WZXA 3H3AA 4GYSA 2Q9QA 3T8OA 4UVAB 4QHOA 5FVKA 4ZS2A 4HWTA 2EHOA 1NYRA 4EV6A 4ZI2D 4AXPA 3A7UA 2X0YA 3FHNA 3ZLIA 3AE4A 1QF6A 4OX9T 5HEUA 1N33T 2XUEA 3P50A 4X20E 1FEWA 2WY2A 3MXZA 3LSSA 4H02A 4ZI3D 4H2SA 3M65A 3HY1A 3C4XA 3DJBA 2IDOB 3TLVA 3NVOA 3UUBA 5AQKB 4X1KE 1T98A 5LNKA 4P74A 3HL6A 4I50E 4Z91A 1ZOYA 2ARSA 4CQIA 2DTOA 1JJCA 1E1HB 2V7IA 3V8JA 4YRGA 2Z6EA 2M6BA 5AQPB 5JDFA 3T1HT 2YN6A 3KFUA 2AKWA 4YYEA 3Q9DA 4YDQA 4CH5A 5HCJA 1OEDB 2LHNA 5HCMA 3NEMA 2CHOA 12ASA 3HY0A 2BZBA 3ANWA 2VKOA 3A8YC 3RH3A 4BWAA 4H63V 2V6YA 2N1GA 4IE0A 3CMQA 3FBLA 3P4RA 1H4VB 3RC8A 2PMFA 4BJNA 2ZCEA 4U3CA 1EIYB 3KVBA 3HXUA 4ZI7E 4YRIA 3QOFA 3WAKA 2E2AA 1XMOT 2XAHB 2ALYA 4BA9A 1WQ7A 1XDOA 3RYCE 2JQKA 3RGLA 3SFDA 4DVDA 4LVMA 5CA0E 2E3CA 1KEYA 2WDQA 2X9YA 4AKRB 2UXDT 3AE5A 5C2TA 2DL1A 3RRCA 2DXUA 3HKDE 1BR0A 4IL9A 2ZZFA 2JQHA 4XU1A 2WU2A 1FIOA 5JR9C 2X66A 3A5YA 1X9BA 3CX8B 4B6XA 1HFAA 4J2CA 3RIUA 2A2FX 4DUZT 3SS1A 4I55E 5C52B 4KX6A 3O9XA 4DV3T 1HG2A 2CJ9A 4JI4T 1B7TA 4RDXA 4JUYA 4PNIA 4MFRA 4DBRA 4TNVA 2D0UA 3KBTA 4IDOA 2BDEA 3V5UA 5DQVA 2ZTGA 4LF5T 3VU7H 5JDMA 3E22E 4XTXA 2WS3A 3IG2A 3PJAA 3O1JA 4CH3A 4O4LE 4UELA 1UK5A 4UR9A 4PAGA 4OLFA 4P0BA 2NOXA 2BG9B 4U31A 5CA1E 3OD1A 3JC6D 1ADYA 4TV8E 1W0AA 3ONJA 4ASKA 2WZHA 4LF4T 4UP7A 2ZM6T 1Z7NA 2MOZA 1T72A 4NXNT 4COFA 2I4LA 4EOZB 1NJ5A 2DQ0A 2HHHT 2E8IA 3NZPA 4AKGA 2YDSA 3V7SA 2AKWB 2ODRD 2DLRA 4WW0A 5JRCA 4P09A 3Q2MA 3AAEB 4CH4A 1JJCB 3F57A 4ZXLA 3RQUA 4GIWA 1N34T 1H4TA 4O4JE 3AA7B 4HFEA 2DXTA 2D2SA 3PUWF 3LC0A 1IL2A 3GWHA 1I94T 5LP6E 4QX8B 4N78D 1PYSA 5L3DB 2HN1A 3UFEA 3UU4A 4WJ4A 2BVLA 2WAUA 4DV5T 4CS3A 1HX8A 1AJ3A 4ZS3A 4QH1A 3NENA 4PFPA 5L3FB 4KHPT 1NAFA 4IT4A 2LRKA 2ZT5A 2HN2A 3FXEB 3N2OA 5CJ5A 1I6ZA 1VRBA 2VVSA 2LSKA 3F2EA 5AQOB 1QUUA 2NW9A 4AI6A 3ZN1B 2Y6XA 4CI3B 1YFRA 3ERRA 4P3PA 3A7RA 4G84A 3LSQA 2CJAA 2FYKA 5ABEA 3AA1B 3FB2A 2ZINA 3W3SA 4IREA 2J1DG 4UPAA 1IBLT 2ZIOA 2VQFT 4XEOA 3HTZA 2SPCA 4HWDA 3CK6A 3A5ZA 4YRJA 2P0LA 2W4XA 2HH7A 1SERA 5LJMA 1XWMA 2V7MA 2NP9A 3MK7C 4YRQA 2PMEA 4XTYA 4HWHA 2XQ4A 3Q5XA 2YU2A 4M1PA 1FMVA 2VWAA 2D5UA 4LVIA 2I4MA 3ESLA 3QNUA 4L9IA 3R84B 2WCAA 3LK2B 3RIAA 4CXYA 3NRYA 4H9PC 5ELOA 3FZFB 4GOUA 2JMHA 4EXTA 3P8VA 3GN5A 4YY3T 3HKBE 5AQGB 2NTXA 4MHCA 3A74A 2XZEA 3SRZA 1OEDC 2XQ7A 1NJ6A 3ZC1A 3PU3A 4IIJE 5C3JA 2HNIA 2FBWA 3P4PA 2A72A 2XGTA 5HXSA 4DV2T 2BS3A 4ZEYA 2LE8A 2QHTA 4C90A 4YCWA 2QHSA 5A1LA 4C91A 4QWNB 2Q7HA 4JI7T 1IBKT 1EOVA 5E3IA 4UVCB 1YD8G 5AQIB 1HNZT 4HA8A 2ODRC 2DEQA 2YK0A 1EVKA 4NCXA 2P5IA 3PUSA 4F8HA 2NTYA 1S35A 4X64T 4RQEA 1UGOA 1SA0E 2YKSA 2CEAA 5AQSB 4K87A 2W00A 2C0SA 1XZYA 4OK0A 2DZCA 2K48A 2EHOC 5LBQB 2WDRA 2XQ3A 5LHIB 2H7OA 2DU7A 4DPGA 2WBLA 3EDVA 3BQKA 4JI6T 4YPFA 3PTRB 4XTWA 1SUMB 2J3MA 2JPFA 1KNPA 5F5WA 4P71C 1NWMX 1B70A 3RI5A 1NJ1A 2KINB 1Y64B 3OYXA 4PK5A 4G85A 3MKDA 4HWOA 3N2KE 2BG9E 3BQIA 1HX1B 1U5PA 1IJ5A 2OV9A 5ETWA 4CI2B 5HWYA 2I4NA 1ATIA 4LVJA 5EK2A 4O2DA 1HS7A 2QA7A 4DR1T 2D9DA 1G51A 4DNDA 4CXXA 4MBQA 4TTVA 3ZMSB 1ASZA 1J5WA 3AA6B 1KNZA 1W9RA 4PJNA 4ILUA 1LYLA 3FJPA 1EZ3A 3GMIA 2ZNJA 2PBIA 5JR9A 1E7PA 2E9XD 1E2AA 5BMVE 4HWSA 4AKIA 4LMKA 2NR4A 5FY1A 2NWBA 1SETA 4K0KT 4P71A 2XASB 3KINB 3MJXA 3NRXA 3TLSA 3RKWA 1LRZA 5L47A 4Z8XA 2W0GA 4TWAA 3CQGB 4KI0F 4HWPA 2UXCT 2MBGA 2OLTA 1D0XA 2I0MA 4NUUA 4LFBT 4GK5E 3PCOB 3REXA 2F4VT 1JNRA 3P4QA 4H2XA 5KNNA 5FVLA 1N32T 3HFZB 1Y01A 3V7RA 3RLFF 3ZN0B 3TUPA 2CLYC 4A5XA 5FY0A 3RKXA 3UUXB 1USYA 2LSJA 3PUZF 1B7YB 1W09A 4TQDA 4EZHA 3LSVA 2KMFA 3BK9A 1HG5A 1E1TA 4JI8T 4CXWA 4X65T 4K88A 2CXFA 4YT0A 1KK7A 2DVEA 3UGTA 3AVSA 5AQHB 3OKQA 2OA5A 2W2UA 2LEHA 3LG7A 2XQ5A 3ZMVB 3AB3B 1HNWT 2EL9A 5IYZE 4JV5T 4CS2A 3VQWA 3ZYMA 4YHJA 2QYWA 1W0BA 2LSYA 4AKLA 1QE0A 4DR3T 2KXPB 2JMKA 3RF1A 3MQZA 4LMJA 5L4EA 4HN9A 1NJ8A 3K3NA 4DR7T 1OWAA 2XSAA 4TNWA 3E08A 1G5HA 5IUXA 2QVAA 2IY5A 2VB6A 3ZCJA 1HCIA 3QB5K 3PURA 1HNXT 3ZYKA 2NW8A 4JEUB 3REUA 5HAXA 5ABFB 5J0ZA 3EAMA 5LMNT 4UVBB 3HXYA 4EO4A 2CWOA 4B3RT 3KV9A 3VQYA 4HFHA 5AQQB 1NNHA 3AE3A 2ZT6A 3AXJB 1LVFA 2XJ7A 4U2YA 1G5IA 2YU1A 2L3LA 2DZ9A 4LNSA 1ZEEA 4TN7B 3HRIA 1NJ2A 2ZT8A 2XQ8A 5LMUT 1WFDA 2FJEA 4JI1T 2YDQA 4Z90A 3VR9A 5J2TE 2X0HA 2G4CA 3LBXA 2CPTA 2CBIA 3KFWX 11ASA 4HFVA 2FJBA 2Y48B 1HTJF 1ZKEA 3RQWA 3ZEFB 1GGMA 4DO0A 2E9XC 2BKOA 2I59A 5DABA 4GYRA 4AH6A 3CMLA 3AE2A 3QC9A 1QLBA 3MZKB 2WDVA 4TVYA 3AEEA 4YJ2E 4I0UA 1USYC 1WQWA 1O3XA 2PJQA 2XQ6A 3L4GB 1X79A 5HEJA 4HEAA 2MYSA 1OXZA 3TEHA 4DR6T 4PHCA 4HVCA 3ZC0A 2X9WA 2V7KA 5JQGE 3N9LA 1YW0A 3ONLC 5LB7B 3UQ4A 4L87A 3O1IA 3M4PA 3PDYA 4NIQA 2ZT7A 4DMWA 1M7KA 4TVWA
chains in the Genus database with same CATH topology
4YREA 3W3SA 2QHVA 3V7CA 4UPAA 2ZIOA 4XEOA 4YRJA 3HTZA 3A5ZA 1BBUA 3MEYA 2P0LA 1B70B 1SERA 3BJUA 3MF2A 1NYQA 2CJBA 4YRQA 1WPYA 3QTCA 4E51A 5K1PA 1H4SA 2PMEA 3HXXA 2EJGA 4CS4A 4XTYA 4P72A 4YRNA 1B7YA 3IALA 5ELNA 4YRMA 4YRCA 4J15A 4YRRA 4LVIA 2I4MA 2RHQA 3RACA 4P73C 3DSQA 4KQEA 3L4GA 3E9HA 3UH0A 2E1HA 4DQ2A 4H2XB 2Q5HA 1PYSB 4K86A 5ELOA 1X54A 2DJZA 3P8VA 3EFRA 3A74A 3QNEA 4TVAB 1NJ6A 4X5OA 1FYFA 1X55A 4YCVA 4XEMA 2HNIA 1KOGA 2Q7GA 4XTVA 3V8LA 1Z7MA 1X2HA 2XGTA 1EIYA 3EFSA 2RHSA 1X2GA 4XU3A 3PZCA 4WF2A 4YRTA 2QHTA 2ZXFA 4YCWA 3E9IA 3ICAA 3P8YA 4TQFA 2QHSA 5HGQA 1YGBA 2Q7HA 2EJ9A 1BIAA 1EOVA 5E3IA 4YRKA 4HA8A 1YB3A 1X01A 4YROA 2ODRC 1BIBA 2DEQA 3VQXA 3PCOA 1EVKA 4NCXA 2P5IA 1EFWA 1WYDA 3RL6A 1WNLA 4HWRA 4RQEA 4YP0A 2ARUA 4XTUA 1YFSA 2DKGA 3NELA 4UP8A 4K87A 2DZCA 2DTIA 1C0AA 3L1AA 3HRKA 1HXDA 4KR3A 2DTHA 2DU7A 4DPGA 3UFGA 2EAYA 4YPFA 3A32A 4XTWA 2J3MA 2ZR2A 5F5WA 4P71C 3A31A 3HXZA 1B70A 2DQ3A 2CGHA 1NJ1A 1YFTA 4P73A 4G85A 4HWOA 2E65A 1E1OA 2DDZA 2E10A 4HWTA 2I4NA 1ATIA 1NYRA 4LVJA 4O2DA 2C7IA 1G51A 4ZTUB 1ASYA 3R07A 3A7UA 4TTVA 5K1XA 1ASZA 4P74C 1J5WA 1QF6A 4XTZA 1LYLA 3FJPA 3HXVA 4Q6GA 3HFVA 3UGQA 4HT4A 4CH6A 2EWNA 2ZNJA 1N9WA 1EQRA 1WU7A 2ZZEA 3LSSA 4H2SA 4H02A 4HWSA 2ARTA 3HY1A 1SETA 4P71A 1ADJA 1E22A 1L0WA 1SRYA 2I4OA 4P74A 2ZZGA 2ARSA 3RKWA 2DTOA 4TWAA 2ZIMA 3M4QA 3P8TA 1JJCA 4HWPA 5C51B 3V8JA 4YRGA 3PCOB 3REXA 4H2VA 3KFUA 2AKWA 4YYEA 1B8AA 4H2XA 5KNNA 3HFZB 4YDQA 4CH5A 1HC7A 3V7RA 3NEMA 3TUPA 12ASA 3HY0A 3RKXA 1USYA 4ZTZB 1B7YB 4BWAA 1SESA 4TQDA 4WJ3M 3CMQA 3QO8A 1H4VB 3QO7A 4H2TA 2PMFA 2ZCEA 4YRFA 2RHSB 1E1TA 1EIYB 5C53B 4K88A 2E41A 3HXUA 2E5AA 2DVEA 3UGTA 1X56A 4YRIA 3NETA 2ALYA 1WQ7A 4H2WA 3RGLA 4TVAA 4YRSA 2EL9A 4LVMA 2E3CA 4RMFA 4CS2A 3VQWA 3BFMA 1B76A 4XU2A 2DXUA 1QE0A 4UP9A 2ZR3A 2ZZFA 3RF1A 4XU1A 4Q15A 3A5YA 3TEGA 3MQZA 1H4QA 1NJ8A 2QHUA 2A8EA 2AMCB 1G5HA 4YCUA 2E64A 2AMCA 4H2YA 5C52B 1KMMA 2IY5A 2ALYB 2CJ9A 4RDXA 3REUA 2ZTGA 2C8MA 3HXYA 4PG3A 4EO4A 3RIRA 4ZIBA 3VQYA 3RKYA 1NNHA 4XTXA 3IG2A 2Q7EA 2ZT6A 4CH3A 3IKLA 4OLFA 1G5IA 1HTTA 2ZNIA 1VQZA 2DZ9A 4LNSA 4P3NA 3HRIA 3OD1A 1EVLA 1NJ2A 4H2UA 2ZT8A 4YRLA 1ADYA 3HXWA 3VBBA 3RUXA 4UP7A 2NS6A 1Z7NA 3TEHB 2G4CA 3WQZA 3MF1A 2I4LA 1NJ5A 2DQ0A 1W66A 11ASA 3VQVA 4WI1A 4P72C 3HFZA 3V7SA 2AKWB 2ODRD 1GGMA 3A7AA 4P75C 4OP0A 4CH4A 1JJCB 1E24A 1H4TA 2CIMA 2DXTA 4AH6A 2Q5IA 4LVLA 3LC0A 1IL2A 2J3LA 4TVYA 1WLEA 1PYSA 1USYC 1WQWA 4EX5A 3IKMB 3L4GB 4RQFA 2IY5B 4WJ4A 2RHQB 3L2ZA 4XU0A 3TEHA 4CS3A 1BBWA 4PHCA 3NENA 4KR2A 4YRPA 4HVCA 2XTIA 2ZT5A 4LVKA 2EJFA 4BW9A 3G1ZA 4P75A 1YFRA 3ERRA 4L87A 4P3PA 2DU5A 3A7RA 4G84A 3LSQA 2CJAA 3M4PA 1RIQA 2FYKA 3QO5A 2ZGWA 3V8KA 2ZT7A 3I7FA 4TVWA 2ZINA 1KMNA 4P3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRE A;  3W3S A;  2QHV A;  3V7C A;  4UPA A;  2ZIO A;  4XEO A;  4YRJ A;  3HTZ A;  3A5Z A;  1BBU A;  3MEY A;  2P0L A;  1B70 B;  1SER A;  3BJU A;  3MF2 A;  1NYQ A;  2CJB A;  4YRQ A;  1WPY A;  3QTC A;  4E51 A;  5K1P A;  1H4S A;  2PME A;  3HXX A;  2EJG A;  4CS4 A;  4XTY A;  4P72 A;  4YRN A;  1B7Y A;  3IAL A;  5ELN A;  4YRM A;  4YRC A;  4J15 A;  4YRR A;  2I4M A;  2RHQ A;  3RAC A;  4P73 C;  3DSQ A;  4KQE A;  3L4G A;  3E9H A;  3UH0 A;  2E1H A;  4DQ2 A;  4H2X B;  2Q5H A;  1PYS B;  4K86 A;  5ELO A;  1X54 A;  2DJZ A;  3P8V A;  3EFR A;  3A74 A;  3QNE A;  4TVA B;  1NJ6 A;  4X5O A;  1FYF A;  1X55 A;  4YCV A;  4XEM A;  2HNI A;  1KOG A;  2Q7G A;  4XTV A;  3V8L A;  1Z7M A;  1X2H A;  2XGT A;  1EIY A;  3EFS A;  2RHS A;  1X2G A;  4XU3 A;  3PZC A;  4WF2 A;  4YRT A;  2QHT A;  2ZXF A;  4YCW A;  3E9I A;  3ICA A;  3P8Y A;  4TQF A;  2QHS A;  5HGQ A;  1YGB A;  2Q7H A;  2EJ9 A;  1BIA A;  1EOV A;  5E3I A;  4YRK A;  4HA8 A;  1YB3 A;  1X01 A;  4YRO A;  2ODR C;  1BIB A;  2DEQ A;  3VQX A;  3PCO A;  1EVK A;  4NCX A;  2P5I A;  1EFW A;  1WYD A;  3RL6 A;  1WNL A;  4HWR A;  4RQE A;  4YP0 A;  2ARU A;  4XTU A;  1YFS A;  2DKG A;  3NEL A;  4UP8 A;  4K87 A;  2DZC A;  2DTI A;  1C0A A;  3L1A A;  3HRK A;  1HXD A;  4KR3 A;  2DTH A;  2DU7 A;  4DPG A;  3UFG A;  2EAY A;  4YPF A;  3A32 A;  4XTW A;  2J3M A;  2ZR2 A;  5F5W A;  4P71 C;  3A31 A;  3HXZ A;  1B70 A;  2DQ3 A;  2CGH A;  1NJ1 A;  1YFT A;  4P73 A;  4G85 A;  4HWO A;  2E65 A;  1E1O A;  2DDZ A;  2E10 A;  4HWT A;  2I4N A;  1ATI A;  1NYR A;  4O2D A;  2C7I A;  1G51 A;  4ZTU B;  1ASY A;  3R07 A;  3A7U A;  4TTV A;  5K1X A;  1ASZ A;  4P74 C;  1J5W A;  1QF6 A;  4XTZ A;  1LYL A;  3FJP A;  3HXV A;  4Q6G A;  3HFV A;  3UGQ A;  4CH6 A;  2EWN A;  2ZNJ A;  1N9W A;  1EQR A;  1WU7 A;  2ZZE A;  3LSS A;  4H2S A;  4H02 A;  4HWS A;  2ART A;  3HY1 A;  1SET A;  4P71 A;  1ADJ A;  1E22 A;  1L0W A;  1SRY A;  2I4O A;  4P74 A;  2ZZG A;  2ARS A;  3RKW A;  2DTO A;  4TWA A;  2ZIM A;  3M4Q A;  3P8T A;  1JJC A;  4HWP A;  5C51 B;  3V8J A;  4YRG A;  3PCO B;  3REX A;  4H2V A;  3KFU A;  2AKW A;  4YYE A;  1B8A A;  4H2X A;  5KNN A;  3HFZ B;  4YDQ A;  4CH5 A;  1HC7 A;  3V7R A;  3NEM A;  3TUP A;  12AS A;  3HY0 A;  3RKX A;  1USY A;  4ZTZ B;  1B7Y B;  4BWA A;  1SES A;  4TQD A;  4WJ3 M;  3CMQ A;  3QO8 A;  1H4V B;  3QO7 A;  4H2T A;  2PMF A;  2ZCE A;  4YRF A;  2RHS B;  1E1T A;  1EIY B;  5C53 B;  4K88 A;  2E41 A;  3HXU A;  2E5A A;  2DVE A;  3UGT A;  1X56 A;  4YRI A;  3NET A;  2ALY A;  1WQ7 A;  4H2W A;  3RGL A;  4TVA A;  4YRS A;  2EL9 A;  2E3C A;  4RMF A;  4CS2 A;  3VQW A;  3BFM A;  1B76 A;  4XU2 A;  2DXU A;  1QE0 A;  4UP9 A;  2ZR3 A;  2ZZF A;  3RF1 A;  4XU1 A;  4Q15 A;  3A5Y A;  3TEG A;  1H4Q A;  1NJ8 A;  2QHU A;  2AMC B;  1G5H A;  4YCU A;  2E64 A;  2AMC A;  4H2Y A;  5C52 B;  1KMM A;  2IY5 A;  2ALY B;  2CJ9 A;  4RDX A;  3REU A;  2ZTG A;  2C8M A;  3HXY A;  4PG3 A;  4EO4 A;  3RIR A;  4ZIB A;  3VQY A;  3RKY A;  1NNH A;  4XTX A;  3IG2 A;  2Q7E A;  2ZT6 A;  4CH3 A;  3IKL A;  4OLF A;  1G5I A;  1HTT A;  2ZNI A;  1VQZ A;  2DZ9 A;  4LNS A;  4P3N A;  3HRI A;  3OD1 A;  1EVL A;  1NJ2 A;  4H2U A;  2ZT8 A;  4YRL A;  1ADY A;  3HXW A;  3VBB A;  3RUX A;  4UP7 A;  1Z7N A;  3TEH B;  2G4C A;  3WQZ A;  3MF1 A;  2I4L A;  1NJ5 A;  2DQ0 A;  1W66 A;  11AS A;  3VQV A;  4WI1 A;  4P72 C;  3HFZ A;  3V7S A;  2AKW B;  2ODR D;  1GGM A;  3A7A A;  4P75 C;  4OP0 A;  4CH4 A;  1JJC B;  1E24 A;  1H4T A;  2CIM A;  2DXT A;  4AH6 A;  2Q5I A;  3LC0 A;  1IL2 A;  2J3L A;  4TVY A;  1WLE A;  1PYS A;  1USY C;  1WQW A;  4EX5 A;  3IKM B;  3L4G B;  4RQF A;  2IY5 B;  4WJ4 A;  2RHQ B;  3L2Z A;  4XU0 A;  3TEH A;  4CS3 A;  1BBW A;  4PHC A;  3NEN A;  4KR2 A;  4YRP A;  4HVC A;  2XTI A;  2ZT5 A;  2EJF A;  4BW9 A;  3G1Z A;  4P75 A;  1YFR A;  3ERR A;  4L87 A;  4P3P A;  2DU5 A;  3A7R A;  4G84 A;  3LSQ A;  2CJA A;  3M4P A;  1RIQ A;  2FYK A;  3QO5 A;  2ZGW A;  3V8K A;  2ZT7 A;  3I7F A;  4TVW A;  2ZIN A;  1KMN A;  4P3O A; 
#chains in the Genus database with same CATH topology
 4ILA A;  4A98 A;  2QHV A;  4HWF A;  1BBU A;  3SWH A;  5AFU L;  2W63 A;  4MAL A;  1D1C A;  2CJB A;  4IST A;  3QTC A;  3CWZ B;  5K1P A;  3HXX A;  2MPK A;  4YRN A;  4IDP A;  5H6Q B;  2KT9 A;  2B76 A;  3VHL A;  3IAL A;  5ELN A;  2LOP A;  4AIS A;  3RAC A;  2XQY A;  4P73 C;  2LKG A;  3L4G A;  4QXC B;  2ACZ A;  2HPJ A;  2E1H A;  1MIY A;  2CLY B;  3UTK A;  2Q5H A;  3FXD B;  2PFV A;  3UUM A;  4AQG A;  3RYF E;  2K9A A;  1Z0P A;  2WM9 A;  4LF9 T;  3I1A A;  1MMD A;  5JVD E;  3EFR A;  3PU8 A;  3RKO A;  4ZHQ E;  2H3R A;  4B3M T;  2W66 A;  4HFC A;  4ZZC A;  2I6H A;  4TVA B;  3AE1 A;  1D0Z A;  2WP9 A;  5FKY A;  3UU3 A;  1X55 A;  4JI3 T;  2X9X A;  3CVR A;  4XTV A;  4OFZ A;  3V8L A;  1Z7M A;  1LKX A;  1X2H A;  3LDQ B;  5FYM A;  2RHS A;  3PZC A;  4WF2 A;  4YRT A;  5HXC A;  1BR1 A;  3LBX B;  1MIV A;  3E9I A;  3ICA A;  3TLT A;  4YTM A;  4TQF A;  4AQF C;  4YRK A;  4LFC T;  1BIB A;  2XAG B;  3TKL B;  4TUY E;  4ZI3 C;  4XZC A;  2Q9Q D;  1EFW A;  4YJ3 E;  4YP0 A;  3Q5W A;  2V7J A;  3T1Y T;  2WB5 A;  4UP8 A;  3IF8 B;  3I0O A;  1T7S A;  5HEO A;  2FUP A;  5JRE A;  1HXD A;  5AQR B;  3EAB A;  4KR3 A;  1IZN B;  2JJ9 A;  3K1S A;  5LHH B;  3KV5 A;  4EED A;  2C5J A;  3A32 A;  2BG9 C;  4KUM B;  1UUR A;  3N9P A;  2LLY A;  3P4W A;  4ZOL E;  3UQ7 A;  2DQ3 A;  2WMN A;  3OBV E;  2IML A;  2VK9 A;  3OTO T;  1GQE A;  3VR8 A;  2X67 A;  1V9D A;  4CZZ B;  2XAF B;  3K3O A;  3JAE A;  4IE4 A;  4P0A A;  5AQM B;  4FI5 A;  4I4T E;  4BJM A;  4L5G A;  4EGW A;  2DWK A;  3B57 A;  1ASY A;  3U78 A;  3L09 A;  4X66 T;  5LYJ E;  1WR6 A;  5FL0 A;  1VCS A;  1KFY A;  4UF0 A;  3ZMU B;  2JRK A;  4P74 C;  3C4Z A;  4Q6G A;  3OYZ A;  3HFV A;  4DUY T;  4IDZ A;  4HT4 A;  4JI0 T;  4CH6 A;  1N9W A;  3FZK B;  5LCY A;  2XAJ B;  5L2L A;  2ART A;  2BVM A;  3O4X E;  3PUQ A;  1R8I A;  3HKC E;  1WCR A;  1E22 A;  4PJL A;  4U74 A;  4TWD A;  1SRY A;  2ODV A;  2XY8 B;  3RKG A;  2ZM8 A;  3A7M A;  2NW7 A;  3ZST A;  3IBP A;  2LHR A;  4JI5 T;  5LHG B;  2CWY A;  4AIU A;  4L0R A;  4DR5 T;  3M4Q A;  3P8T A;  3GA8 A;  5C51 B;  2JQ9 A;  1FMW A;  3RYH E;  3C51 A;  1YQ4 A;  1B8A A;  1HC7 A;  1N36 T;  4ZTZ B;  4K0U A;  5CFB A;  1SES A;  4WJ3 M;  4DID B;  2RPA A;  3ZCI A;  3QO8 A;  3ZT6 A;  3FZL B;  2E5L T;  3ZT7 A;  5ABG A;  3UU8 A;  4H2T A;  3VKG A;  5FY7 A;  2RHS B;  1YXR A;  1CUN A;  3C64 A;  4OYJ A;  2E5A A;  2CMR A;  4QXH B;  3NET A;  4ERR A;  1XNQ T;  3N9M A;  2W67 A;  2ZLY A;  2UXX B;  4H2W A;  4TVA A;  4KMC A;  3EVY A;  4RMF A;  3G06 A;  3BFM A;  1J5E T;  1B76 A;  5F3J A;  5LGN B;  4UP9 A;  2ZR3 A;  5TAO A;  5JDQ A;  5HXH A;  5FXZ A;  3BQL A;  2C5K T;  1H4Q A;  2QHU A;  2FJD A;  2A8E A;  4ILB A;  2IUB A;  2X51 A;  2AMC B;  4UXN B;  4U2Z A;  3CX7 B;  2AMC A;  4IDQ A;  4H2Y A;  2VUR A;  2DNX A;  2UU9 T;  4O4H E;  5L3B B;  3DTO A;  3H3M A;  4U33 A;  2C8M A;  1H7C A;  4PG3 A;  1CHU A;  5L3C B;  4ZIB A;  5HWX A;  3MA9 A;  2Q7E A;  2VQE T;  4O8S A;  4PK6 A;  5LG3 A;  1UUS A;  2V7L A;  2N2N A;  3AE8 A;  4CN4 A;  3ZT5 A;  5LA6 E;  2D0T A;  3NWI A;  2ZNI A;  3E0Z A;  3DP7 A;  4G63 A;  4P3N A;  1EVL A;  3B5M A;  4YRL A;  2Y8D A;  3IA3 A;  3N9Q A;  1WRD A;  4KP3 C;  3UU5 A;  2NS6 A;  2VKJ A;  3TEH B;  4H9S E;  3SFE A;  1HR0 T;  4PW8 A;  4LF7 T;  1D1B A;  2UUC T;  4TWH A;  4WI1 A;  2WWV A;  2M6I A;  3AEA A;  3I9Y A;  3I0Q A;  4UV8 B;  4YFS A;  2XHE B;  4P75 C;  3AXJ A;  1IJ6 A;  4OP0 A;  3L3P A;  5J1G A;  2CBJ A;  2J62 A;  2IW5 B;  4IHJ E;  3WI3 A;  2J47 A;  2ODU A;  4A97 A;  1IAP A;  2YEV C;  3J7Y q;  2Q5I A;  3U3I A;  4LVL A;  3GN5 B;  3O1H A;  2J3L A;  3PUA A;  4UEM A;  2MTQ A;  2R6G F;  4TWF A;  1WLE A;  3ZKR A;  2G0U A;  3JCF A;  4TV9 E;  5KX5 E;  2XSB A;  4EX5 A;  4RQF A;  2IY5 B;  3L2Z A;  2DHR A;  4QXB B;  4XU0 A;  1LVK A;  4UIG A;  1WYB A;  2V26 A;  1BR4 A;  4YRP A;  1KF6 A;  4UF0 B;  2XTI A;  3H37 A;  1WYC A;  3X1D A;  4JLE A;  2H88 A;  4H9N C;  3FBZ A;  2EJF A;  1VOM A;  1Z8U A;  3RX6 A;  3G1Z A;  4P75 A;  2DU5 A;  4B3S T;  2A3D A;  3JC6 C;  4U7I A;  4X5T A;  1RIQ A;  2BKN A;  4YSX A;  3QO5 A;  2ZGW A;  3HA4 A;  2IC6 A;  2CA5 A;  3I7F A;  3PV0 F;  3Q5D A;  2AXD S;  3V7C A;  3P7I A;  3UUL A;  3ZYL A;  5GON E;  2LKH A;  2XTL A;  1XMQ T;  3BJU A;  3MF2 A;  5L3G B;  1XDP A;  1WPY A;  4E51 A;  4WBO A;  1H4S A;  4AQY T;  3AVR A;  1T8B A;  2W61 A;  4P72 A;  1B7Y A;  4YRC A;  3L39 A;  4PFO A;  1MNE A;  4HFI A;  4GKK T;  3KBU A;  3UH0 A;  4HE8 A;  4H2X B;  1PYS B;  2AE9 A;  3N5L A;  2JIW A;  2M67 A;  5LG4 A;  4UV9 B;  1X54 A;  2BKP A;  4QX7 B;  1D0Y A;  2DJZ A;  1UX4 A;  2FJA A;  3AE9 A;  3QNE A;  4EYY R;  5FP3 A;  3ZJ2 A;  4YCV A;  2XM1 A;  4XEM A;  4OHF A;  2YDR A;  1KOG A;  5JRC B;  2VL8 A;  5JH7 E;  4LML A;  3CIR A;  4ILC A;  4PJM A;  4XU3 A;  4ANJ A;  4EEB A;  2ZXF A;  2LRL A;  3P8Y A;  4EZ4 A;  2LM2 A;  3R6N A;  5HGQ A;  2KSR A;  4LFA T;  1YGB A;  4MLK A;  2EJ9 A;  1BIA A;  1MMA A;  3EI0 A;  2UXB T;  2P9B A;  1YB3 A;  1ZHC A;  1X01 A;  5LGT B;  5J2U E;  2LSG A;  2BG9 A;  5AQN B;  2LOS A;  3PCO A;  4X62 T;  4NPP A;  1WYD A;  3RL6 A;  4YXD A;  5AQT B;  4HTE A;  2K5B B;  4HWR A;  2A9U A;  4HFD A;  2ARU A;  4H63 H;  4XTU A;  5CGM A;  1YFS A;  2WU5 A;  3AEB A;  3ZPO A;  1J1J A;  1C0A A;  3NZQ A;  1M62 A;  2XAQ B;  2J4G A;  3HI2 A;  4DV1 T;  4IE5 A;  1OED E;  3L8R A;  4A56 A;  3UFG A;  3VRB A;  4G2A A;  4TX5 A;  4IL4 A;  2ZR2 A;  5AQJ B;  3LK3 B;  2IC9 A;  4NUV A;  3S4U A;  5LGU B;  3AA0 B;  1YFT A;  4E7Z A;  4P73 A;  4F6R C;  5EK3 A;  1ZV4 X;  3KV4 A;  4HWC A;  5HYA A;  2E65 A;  2K24 A;  2RA1 A;  1E1O A;  3QUJ A;  3UT5 E;  2DDZ A;  2E10 A;  2YOE A;  4DV7 T;  3C98 B;  4H9O C;  2C7I A;  2X9H A;  4ZTU B;  4HWI B;  1YKH B;  3R07 A;  3N2G E;  2DWG A;  5FL1 A;  4ADZ A;  5K1X A;  3PUG A;  3K8P C;  3TLW A;  4XTZ A;  3HXV A;  3V5S A;  3UGQ A;  4JEH B;  5M4Y A;  1MMN A;  2EWN A;  4YLH A;  3FZH B;  1EQR A;  1WU7 A;  2ZZE A;  4PK4 A;  1QSD A;  5LXT E;  2L9Q A;  2CM0 A;  2XQ9 A;  2VKD A;  1ADJ A;  4B3T T;  4HKA A;  1L0W A;  4V1A v;  2I4O A;  3M3Z B;  3PUX F;  2XM2 A;  2DI4 A;  2ZZG A;  2V5D A;  4DR4 T;  2N9D A;  1S94 A;  3ZMT B;  4QH5 A;  4JYA T;  2ZIM A;  3JAD A;  4KHZ F;  5KMG P;  2WWU A;  2BS4 A;  4X1I E;  2VVN A;  4O4I E;  3AEG A;  4HFB A;  4H9Q C;  4H2V A;  1D1A A;  1KNR A;  5ADX L;  4EIW A;  3CX6 B;  5KDM C;  4CN1 A;  3AE6 A;  1U4Q A;  1NEK A;  3F31 A;  3RHW A;  2IHR 1;  4CI1 B;  2GK9 A;  3QO7 A;  1WR0 A;  2IAK A;  4YRF A;  2PG8 A;  3NKZ A;  4NXM T;  5C53 B;  2E41 A;  2VKH A;  3N9O A;  1X56 A;  2PTF A;  3UUN A;  2UUA T;  4JBW F;  5E0O A;  4XAX B;  4U72 A;  2EHO B;  2UXN B;  4EB6 E;  3N9N A;  4PJJ A;  4YRS A;  4IDN A;  4DBQ A;  3LK4 2;  3VRA A;  4YSY A;  4XU2 A;  2C5I T;  5ABF A;  4GKJ T;  4Q15 A;  3PUY F;  2UUB T;  3TEG A;  1WLX A;  3IEE A;  3LJC A;  2BBJ A;  5FXV A;  3TLU A;  3CQC B;  3OPC A;  2IIU A;  3NBX X;  2CHN A;  2RP4 A;  2E64 A;  4YCU A;  4WBN E;  3C50 A;  1KMM A;  5LJN A;  4JI2 T;  3ZMZ B;  4WYV A;  5FMN A;  3JAF A;  2X0L B;  5FNV E;  3RIR A;  3RKY A;  5F8P A;  5ABH A;  2ES0 A;  2V1D B;  3ETU A;  4TZ4 C;  3IKL A;  3RIU C;  5JDG A;  3AEF A;  1HTT A;  1VCT A;  3J9X 1;  1VQZ A;  4YHH T;  2X68 A;  2WMO A;  2WQY A;  4O2A E;  2WSS V;  4H2U A;  1G8X A;  3PJA J;  3HXW A;  3AED A;  2ZM2 A;  3VBB A;  3RUX A;  1UCU A;  3EHZ A;  3MAC A;  4WNK A;  3WQZ A;  3PE0 A;  3MF1 A;  5EZY E;  1W66 A;  3VQV A;  4P72 C;  2LT3 A;  2QRX A;  3HFZ A;  1MIW A;  3CKD A;  3QB5 A;  4Q25 A;  3A7A A;  3AE7 A;  2CXD A;  2EHO D;  1E24 A;  3RYI E;  2K3W A;  5EK4 A;  2MAW A;  2CIM A;  1G73 A;  1JNZ A;  2KWI B;  5CB4 E;  2VAS A;  3ZSS A;  4O2B E;  3IKM B;  2E9X A;  2RHQ B;  3AEC A;  5JR9 B;  3ONX A;  4P1N A;  4CN6 A;  1NEN A;  1BBW A;  2ZMA A;  4YSZ A;  4KR2 A;  1SE7 A;  2KND A;  4LVK A;  4ISS A;  4KBM B;  1L0V A;  4BW9 A;  2DCF A;  5AQL B;  2BBH A;  2W62 A;  3RRW A;  3ZJ1 A;  3CQX C;  4YTP A;  2Q9Q C;  5HXR A;  1MND A;  2XQA A;  3Q5E A;  3V8K A;  5FXX A;  2E5V A;  2LSI A;  2ZM0 A;  3HKE E;  1KMN A;  2ALY B;  4P3O A;  4DMV A;  4YRE A;  4DV6 T;  5AQF B;  3RC3 A;  2CE7 A;  1ZP0 A;  3MEY A;  3CPZ A;  1B70 B;  1YQ3 A;  1NYQ A;  3EDU A;  5BR8 T;  1FJG T;  2EJG A;  2V6Y B;  4CS4 A;  2JQQ A;  2V8S V;  4YRM A;  5JTG A;  4LF6 T;  4J15 A;  4YRR A;  2RHQ A;  3DSQ A;  4KQE A;  2E9X B;  4DV0 T;  5AQV B;  5LOV E;  3E9H A;  4HGA A;  3P4S A;  4DQ2 A;  5DJQ C;  3ETV A;  4DV4 T;  5JDL A;  4K86 A;  4I43 B;  5C8Y E;  4X1Y E;  2CXL A;  3KV6 A;  4XBF B;  4IE7 A;  3SOL A;  4IGU A;  4QH4 A;  2H89 A;  5KXJ A;  4OYK A;  2LJL A;  1HF8 A;  5JDH A;  3WAJ A;  4X5O A;  1FYF A;  3KDS E;  4AQF A;  5AQU B;  3OVU A;  5DQW A;  3P8C D;  2Q7G A;  5HXE A;  3AAI A;  3UU6 A;  4AKH A;  4ZI2 C;  1SHZ C;  4QKN A;  5H6R B;  3FZM B;  1US7 B;  1YKE B;  3B13 A;  1EIY A;  3EFS A;  5HEH A;  1X2G A;  3A5X A;  2BS2 A;  3ABV A;  3W15 B;  3EUH A;  3RIF A;  3C4W A;  1UX5 A;  5IWA T;  3KVA A;  2KWH A;  3ANW B;  4H9R C;  2L8K A;  2XPK A;  2V6X A;  1OED A;  1IBM T;  4E7S A;  2KZ7 B;  2LM9 A;  2V5C A;  2CRB A;  4YRO A;  3LFM A;  4FJO A;  1BR2 A;  3IHR A;  3VQX A;  2CCQ A;  3QK6 A;  4IE6 A;  3AAA B;  3OJA A;  3I9W A;  3PUV F;  1WNL A;  3D0T A;  1XNR T;  4LF8 T;  2WZI A;  2Q9Q B;  5HEG A;  3VKH A;  2H7V C;  2DKG A;  2QGS A;  4BAY B;  1DU2 A;  5FXW A;  3NEL A;  2YIN A;  4EYU A;  1MMG A;  2KLQ A;  5IHY A;  2DTI A;  2ACX A;  3L1A A;  3HRK A;  3HR0 A;  4EAH A;  4ZZB A;  4YTN A;  5LBM A;  2DTH A;  2B1E A;  2EAY A;  3K3Q C;  2VL0 A;  4GK0 E;  5L3E B;  5JDN A;  3RPU A;  4DR2 T;  5L4H A;  3A31 A;  3HXZ A;  2HPL A;  2CGH A;  4U7Y A;  4WZX A;  3H3A A;  4GYS A;  2Q9Q A;  3T8O A;  4UVA B;  4QHO A;  5FVK A;  4ZS2 A;  4HWT A;  2EHO A;  1NYR A;  4EV6 A;  4ZI2 D;  4AXP A;  3A7U A;  2X0Y A;  3FHN A;  3ZLI A;  3AE4 A;  1QF6 A;  4OX9 T;  5HEU A;  1N33 T;  2XUE A;  3P50 A;  4X20 E;  1FEW A;  2WY2 A;  3MXZ A;  3LSS A;  4H02 A;  4ZI3 D;  4H2S A;  3M65 A;  3HY1 A;  3C4X A;  3DJB A;  2IDO B;  3TLV A;  3NVO A;  3UUB A;  5AQK B;  4X1K E;  1T98 A;  5LNK A;  4P74 A;  3HL6 A;  4I50 E;  4Z91 A;  1ZOY A;  2ARS A;  4CQI A;  2DTO A;  1JJC A;  1E1H B;  2V7I A;  3V8J A;  4YRG A;  2Z6E A;  2M6B A;  5AQP B;  5JDF A;  3T1H T;  2YN6 A;  3KFU A;  2AKW A;  4YYE A;  3Q9D A;  4YDQ A;  4CH5 A;  5HCJ A;  1OED B;  2LHN A;  5HCM A;  3NEM A;  2CHO A;  12AS A;  3HY0 A;  2BZB A;  3ANW A;  2VKO A;  3A8Y C;  3RH3 A;  4BWA A;  4H63 V;  2V6Y A;  2N1G A;  4IE0 A;  3CMQ A;  3FBL A;  3P4R A;  1H4V B;  3RC8 A;  2PMF A;  4BJN A;  2ZCE A;  4U3C A;  1EIY B;  3KVB A;  3HXU A;  4ZI7 E;  4YRI A;  3QOF A;  3WAK A;  2E2A A;  1XMO T;  2XAH B;  2ALY A;  4BA9 A;  1WQ7 A;  1XDO A;  3RYC E;  2JQK A;  3RGL A;  3SFD A;  4DVD A;  4LVM A;  5CA0 E;  2E3C A;  1KEY A;  2WDQ A;  2X9Y A;  4AKR B;  2UXD T;  3AE5 A;  5C2T A;  2DL1 A;  3RRC A;  2DXU A;  3HKD E;  1BR0 A;  4IL9 A;  2ZZF A;  2JQH A;  4XU1 A;  2WU2 A;  1FIO A;  5JR9 C;  2X66 A;  3A5Y A;  1X9B A;  3CX8 B;  4B6X A;  1HFA A;  4J2C A;  3RIU A;  2A2F X;  4DUZ T;  3SS1 A;  4I55 E;  5C52 B;  4KX6 A;  3O9X A;  4DV3 T;  1HG2 A;  2CJ9 A;  4JI4 T;  1B7T A;  4RDX A;  4JUY A;  4PNI A;  4MFR A;  4DBR A;  4TNV A;  2D0U A;  3KBT A;  4IDO A;  2BDE A;  3V5U A;  5DQV A;  2ZTG A;  4LF5 T;  3VU7 H;  5JDM A;  3E22 E;  4XTX A;  2WS3 A;  3IG2 A;  3PJA A;  3O1J A;  4CH3 A;  4O4L E;  4UEL A;  1UK5 A;  4UR9 A;  4PAG A;  4OLF A;  4P0B A;  2NOX A;  2BG9 B;  4U31 A;  5CA1 E;  3OD1 A;  3JC6 D;  1ADY A;  4TV8 E;  1W0A A;  3ONJ A;  4ASK A;  2WZH A;  4LF4 T;  4UP7 A;  2ZM6 T;  1Z7N A;  2MOZ A;  1T72 A;  4NXN T;  4COF A;  2I4L A;  4EOZ B;  1NJ5 A;  2DQ0 A;  2HHH T;  2E8I A;  3NZP A;  4AKG A;  2YDS A;  3V7S A;  2AKW B;  2ODR D;  2DLR A;  4WW0 A;  5JRC A;  4P09 A;  3Q2M A;  3AAE B;  4CH4 A;  1JJC B;  3F57 A;  4ZXL A;  3RQU A;  4GIW A;  1N34 T;  1H4T A;  4O4J E;  3AA7 B;  4HFE A;  2DXT A;  2D2S A;  3PUW F;  3LC0 A;  1IL2 A;  3GWH A;  1I94 T;  5LP6 E;  4QX8 B;  4N78 D;  1PYS A;  5L3D B;  2HN1 A;  3UFE A;  3UU4 A;  4WJ4 A;  2BVL A;  2WAU A;  4DV5 T;  4CS3 A;  1HX8 A;  1AJ3 A;  4ZS3 A;  4QH1 A;  3NEN A;  4PFP A;  5L3F B;  4KHP T;  1NAF A;  4IT4 A;  2LRK A;  2ZT5 A;  2HN2 A;  3FXE B;  3N2O A;  5CJ5 A;  1I6Z A;  1VRB A;  2VVS A;  2LSK A;  3F2E A;  5AQO B;  1QUU A;  2NW9 A;  4AI6 A;  3ZN1 B;  2Y6X A;  4CI3 B;  1YFR A;  3ERR A;  4P3P A;  3A7R A;  4G84 A;  3LSQ A;  2CJA A;  2FYK A;  5ABE A;  3AA1 B;  3FB2 A;  2ZIN A;  3W3S A;  4IRE A;  2J1D G;  4UPA A;  1IBL T;  2ZIO A;  2VQF T;  4XEO A;  3HTZ A;  2SPC A;  4HWD A;  3CK6 A;  3A5Z A;  4YRJ A;  2P0L A;  2W4X A;  2HH7 A;  1SER A;  5LJM A;  1XWM A;  2V7M A;  2NP9 A;  3MK7 C;  4YRQ A;  2PME A;  4XTY A;  4HWH A;  2XQ4 A;  3Q5X A;  2YU2 A;  4M1P A;  1FMV A;  2VWA A;  2D5U A;  4LVI A;  2I4M A;  3ESL A;  3QNU A;  4L9I A;  3R84 B;  2WCA A;  3LK2 B;  3RIA A;  4CXY A;  3NRY A;  4H9P C;  5ELO A;  3FZF B;  4GOU A;  2JMH A;  4EXT A;  3P8V A;  3GN5 A;  4YY3 T;  3HKB E;  5AQG B;  2NTX A;  4MHC A;  3A74 A;  2XZE A;  3SRZ A;  1OED C;  2XQ7 A;  1NJ6 A;  3ZC1 A;  3PU3 A;  4IIJ E;  5C3J A;  2HNI A;  2FBW A;  3P4P A;  2A72 A;  2XGT A;  5HXS A;  4DV2 T;  2BS3 A;  4ZEY A;  2LE8 A;  2QHT A;  4C90 A;  4YCW A;  2QHS A;  5A1L A;  4C91 A;  4QWN B;  2Q7H A;  4JI7 T;  1IBK T;  1EOV A;  5E3I A;  4UVC B;  1YD8 G;  5AQI B;  1HNZ T;  4HA8 A;  2ODR C;  2DEQ A;  2YK0 A;  1EVK A;  4NCX A;  2P5I A;  3PUS A;  4F8H A;  2NTY A;  1S35 A;  4X64 T;  4RQE A;  1UGO A;  1SA0 E;  2YKS A;  2CEA A;  5AQS B;  4K87 A;  2W00 A;  2C0S A;  1XZY A;  4OK0 A;  2DZC A;  2K48 A;  2EHO C;  5LBQ B;  2WDR A;  2XQ3 A;  5LHI B;  2H7O A;  2DU7 A;  4DPG A;  2WBL A;  3EDV A;  3BQK A;  4JI6 T;  4YPF A;  3PTR B;  4XTW A;  1SUM B;  2J3M A;  2JPF A;  1KNP A;  5F5W A;  4P71 C;  1NWM X;  1B70 A;  3RI5 A;  1NJ1 A;  2KIN B;  1Y64 B;  3OYX A;  4PK5 A;  4G85 A;  3MKD A;  4HWO A;  3N2K E;  2BG9 E;  3BQI A;  1HX1 B;  1U5P A;  1IJ5 A;  2OV9 A;  5ETW A;  4CI2 B;  5HWY A;  2I4N A;  1ATI A;  4LVJ A;  5EK2 A;  4O2D A;  1HS7 A;  2QA7 A;  4DR1 T;  2D9D A;  1G51 A;  4DND A;  4CXX A;  4MBQ A;  4TTV A;  3ZMS B;  1ASZ A;  1J5W A;  3AA6 B;  1KNZ A;  1W9R A;  4PJN A;  4ILU A;  1LYL A;  3FJP A;  1EZ3 A;  3GMI A;  2ZNJ A;  2PBI A;  5JR9 A;  1E7P A;  2E9X D;  1E2A A;  5BMV E;  4HWS A;  4AKI A;  4LMK A;  2NR4 A;  5FY1 A;  2NWB A;  1SET A;  4K0K T;  4P71 A;  2XAS B;  3KIN B;  3MJX A;  3NRX A;  3TLS A;  3RKW A;  1LRZ A;  5L47 A;  4Z8X A;  2W0G A;  4TWA A;  3CQG B;  4KI0 F;  4HWP A;  2UXC T;  2MBG A;  2OLT A;  1D0X A;  2I0M A;  4NUU A;  4LFB T;  4GK5 E;  3PCO B;  3REX A;  2F4V T;  1JNR A;  3P4Q A;  4H2X A;  5KNN A;  5FVL A;  1N32 T;  3HFZ B;  1Y01 A;  3V7R A;  3RLF F;  3ZN0 B;  3TUP A;  2CLY C;  4A5X A;  5FY0 A;  3RKX A;  3UUX B;  1USY A;  2LSJ A;  3PUZ F;  1B7Y B;  1W09 A;  4TQD A;  4EZH A;  3LSV A;  2KMF A;  3BK9 A;  1HG5 A;  1E1T A;  4JI8 T;  4CXW A;  4X65 T;  4K88 A;  2CXF A;  4YT0 A;  1KK7 A;  2DVE A;  3UGT A;  3AVS A;  5AQH B;  3OKQ A;  2OA5 A;  2W2U A;  2LEH A;  3LG7 A;  2XQ5 A;  3ZMV B;  3AB3 B;  1HNW T;  2EL9 A;  5IYZ E;  4JV5 T;  4CS2 A;  3VQW A;  3ZYM A;  4YHJ A;  2QYW A;  1W0B A;  2LSY A;  4AKL A;  1QE0 A;  4DR3 T;  2KXP B;  2JMK A;  3RF1 A;  3MQZ A;  4LMJ A;  5L4E A;  4HN9 A;  1NJ8 A;  3K3N A;  4DR7 T;  1OWA A;  2XSA A;  4TNW A;  3E08 A;  1G5H A;  5IUX A;  2QVA A;  2IY5 A;  2VB6 A;  3ZCJ A;  1HCI A;  3QB5 K;  3PUR A;  1HNX T;  3ZYK A;  2NW8 A;  4JEU B;  3REU A;  5HAX A;  5ABF B;  5J0Z A;  3EAM A;  5LMN T;  4UVB B;  3HXY A;  4EO4 A;  2CWO A;  4B3R T;  3KV9 A;  3VQY A;  4HFH A;  5AQQ B;  1NNH A;  3AE3 A;  2ZT6 A;  3AXJ B;  1LVF A;  2XJ7 A;  4U2Y A;  1G5I A;  2YU1 A;  2L3L A;  2DZ9 A;  4LNS A;  1ZEE A;  4TN7 B;  3HRI A;  1NJ2 A;  2ZT8 A;  2XQ8 A;  5LMU T;  1WFD A;  2FJE A;  4JI1 T;  2YDQ A;  4Z90 A;  3VR9 A;  5J2T E;  2X0H A;  2G4C A;  3LBX A;  2CPT A;  2CBI A;  3KFW X;  11AS A;  4HFV A;  2FJB A;  2Y48 B;  1HTJ F;  1ZKE A;  3RQW A;  3ZEF B;  1GGM A;  4DO0 A;  2E9X C;  2BKO A;  2I59 A;  5DAB A;  4GYR A;  4AH6 A;  3CML A;  3AE2 A;  3QC9 A;  1QLB A;  3MZK B;  2WDV A;  4TVY A;  3AEE A;  4YJ2 E;  4I0U A;  1USY C;  1WQW A;  1O3X A;  2PJQ A;  2XQ6 A;  3L4G B;  1X79 A;  5HEJ A;  4HEA A;  2MYS A;  1OXZ A;  3TEH A;  4DR6 T;  4PHC A;  4HVC A;  3ZC0 A;  2X9W A;  2V7K A;  5JQG E;  3N9L A;  1YW0 A;  3ONL C;  5LB7 B;  3UQ4 A;  4L87 A;  3O1I A;  3M4P A;  3PDY A;  4NIQ A;  2ZT7 A;  4DMW A;  1M7K A;  4TVW A; 
#chains in the Genus database with same CATH homology
 4YRE A;  3W3S A;  2QHV A;  3V7C A;  4UPA A;  2ZIO A;  4XEO A;  4YRJ A;  3HTZ A;  3A5Z A;  1BBU A;  3MEY A;  2P0L A;  1B70 B;  1SER A;  3BJU A;  3MF2 A;  1NYQ A;  2CJB A;  4YRQ A;  1WPY A;  3QTC A;  4E51 A;  5K1P A;  1H4S A;  2PME A;  3HXX A;  2EJG A;  4CS4 A;  4XTY A;  4P72 A;  4YRN A;  1B7Y A;  3IAL A;  5ELN A;  4YRM A;  4YRC A;  4J15 A;  4YRR A;  4LVI A;  2I4M A;  2RHQ A;  3RAC A;  4P73 C;  3DSQ A;  4KQE A;  3L4G A;  3E9H A;  3UH0 A;  2E1H A;  4DQ2 A;  4H2X B;  2Q5H A;  1PYS B;  4K86 A;  5ELO A;  1X54 A;  2DJZ A;  3P8V A;  3EFR A;  3A74 A;  3QNE A;  4TVA B;  1NJ6 A;  4X5O A;  1FYF A;  1X55 A;  4YCV A;  4XEM A;  2HNI A;  1KOG A;  2Q7G A;  4XTV A;  3V8L A;  1Z7M A;  1X2H A;  2XGT A;  1EIY A;  3EFS A;  2RHS A;  1X2G A;  4XU3 A;  3PZC A;  4WF2 A;  4YRT A;  2QHT A;  2ZXF A;  4YCW A;  3E9I A;  3ICA A;  3P8Y A;  4TQF A;  2QHS A;  5HGQ A;  1YGB A;  2Q7H A;  2EJ9 A;  1BIA A;  1EOV A;  5E3I A;  4YRK A;  4HA8 A;  1YB3 A;  1X01 A;  4YRO A;  2ODR C;  1BIB A;  2DEQ A;  3VQX A;  3PCO A;  1EVK A;  4NCX A;  2P5I A;  1EFW A;  1WYD A;  3RL6 A;  1WNL A;  4HWR A;  4RQE A;  4YP0 A;  2ARU A;  4XTU A;  1YFS A;  2DKG A;  3NEL A;  4UP8 A;  4K87 A;  2DZC A;  2DTI A;  1C0A A;  3L1A A;  3HRK A;  1HXD A;  4KR3 A;  2DTH A;  2DU7 A;  4DPG A;  3UFG A;  2EAY A;  4YPF A;  3A32 A;  4XTW A;  2J3M A;  2ZR2 A;  5F5W A;  4P71 C;  3A31 A;  3HXZ A;  1B70 A;  2DQ3 A;  2CGH A;  1NJ1 A;  1YFT A;  4P73 A;  4G85 A;  4HWO A;  2E65 A;  1E1O A;  2DDZ A;  2E10 A;  4HWT A;  2I4N A;  1ATI A;  1NYR A;  4LVJ A;  4O2D A;  2C7I A;  1G51 A;  4ZTU B;  1ASY A;  3R07 A;  3A7U A;  4TTV A;  5K1X A;  1ASZ A;  4P74 C;  1J5W A;  1QF6 A;  4XTZ A;  1LYL A;  3FJP A;  3HXV A;  4Q6G A;  3HFV A;  3UGQ A;  4HT4 A;  4CH6 A;  2EWN A;  2ZNJ A;  1N9W A;  1EQR A;  1WU7 A;  2ZZE A;  3LSS A;  4H2S A;  4H02 A;  4HWS A;  2ART A;  3HY1 A;  1SET A;  4P71 A;  1ADJ A;  1E22 A;  1L0W A;  1SRY A;  2I4O A;  4P74 A;  2ZZG A;  2ARS A;  3RKW A;  2DTO A;  4TWA A;  2ZIM A;  3M4Q A;  3P8T A;  1JJC A;  4HWP A;  5C51 B;  3V8J A;  4YRG A;  3PCO B;  3REX A;  4H2V A;  3KFU A;  2AKW A;  4YYE A;  1B8A A;  4H2X A;  5KNN A;  3HFZ B;  4YDQ A;  4CH5 A;  1HC7 A;  3V7R A;  3NEM A;  3TUP A;  12AS A;  3HY0 A;  3RKX A;  1USY A;  4ZTZ B;  1B7Y B;  4BWA A;  1SES A;  4TQD A;  4WJ3 M;  3CMQ A;  3QO8 A;  1H4V B;  3QO7 A;  4H2T A;  2PMF A;  2ZCE A;  4YRF A;  2RHS B;  1E1T A;  1EIY B;  5C53 B;  4K88 A;  2E41 A;  3HXU A;  2E5A A;  2DVE A;  3UGT A;  1X56 A;  4YRI A;  3NET A;  2ALY A;  1WQ7 A;  4H2W A;  3RGL A;  4TVA A;  4YRS A;  2EL9 A;  4LVM A;  2E3C A;  4RMF A;  4CS2 A;  3VQW A;  3BFM A;  1B76 A;  4XU2 A;  2DXU A;  1QE0 A;  4UP9 A;  2ZR3 A;  2ZZF A;  3RF1 A;  4XU1 A;  4Q15 A;  3A5Y A;  3TEG A;  3MQZ A;  1H4Q A;  1NJ8 A;  2QHU A;  2A8E A;  2AMC B;  1G5H A;  4YCU A;  2E64 A;  2AMC A;  4H2Y A;  5C52 B;  1KMM A;  2IY5 A;  2ALY B;  2CJ9 A;  4RDX A;  3REU A;  2ZTG A;  2C8M A;  3HXY A;  4PG3 A;  4EO4 A;  3RIR A;  4ZIB A;  3VQY A;  3RKY A;  1NNH A;  4XTX A;  3IG2 A;  2Q7E A;  2ZT6 A;  4CH3 A;  3IKL A;  4OLF A;  1G5I A;  1HTT A;  2ZNI A;  1VQZ A;  2DZ9 A;  4LNS A;  4P3N A;  3HRI A;  3OD1 A;  1EVL A;  1NJ2 A;  4H2U A;  2ZT8 A;  4YRL A;  1ADY A;  3HXW A;  3VBB A;  3RUX A;  4UP7 A;  2NS6 A;  1Z7N A;  3TEH B;  2G4C A;  3WQZ A;  3MF1 A;  2I4L A;  1NJ5 A;  2DQ0 A;  1W66 A;  11AS A;  3VQV A;  4WI1 A;  4P72 C;  3HFZ A;  3V7S A;  2AKW B;  2ODR D;  1GGM A;  3A7A A;  4P75 C;  4OP0 A;  4CH4 A;  1JJC B;  1E24 A;  1H4T A;  2CIM A;  2DXT A;  4AH6 A;  2Q5I A;  4LVL A;  3LC0 A;  1IL2 A;  2J3L A;  4TVY A;  1WLE A;  1PYS A;  1USY C;  1WQW A;  4EX5 A;  3IKM B;  3L4G B;  4RQF A;  2IY5 B;  4WJ4 A;  2RHQ B;  3L2Z A;  4XU0 A;  3TEH A;  4CS3 A;  1BBW A;  4PHC A;  3NEN A;  4KR2 A;  4YRP A;  4HVC A;  2XTI A;  2ZT5 A;  4LVK A;  2EJF A;  4BW9 A;  3G1Z A;  4P75 A;  1YFR A;  3ERR A;  4L87 A;  4P3P A;  2DU5 A;  3A7R A;  4G84 A;  3LSQ A;  2CJA A;  3M4P A;  1RIQ A;  2FYK A;  3QO5 A;  2ZGW A;  3V8K A;  2ZT7 A;  3I7F A;  4TVW A;  2ZIN A;  1KMN A;  4P3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...