5F5WA

Crystal structure of the alpha subunit of glycyl trna synthetase (glyrs) from aquifex aeolicus in complex with an analog of glycyl adenylate (gly-sa)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
283
structure length
283
Chain Sequence
MYFQDIIMTLHKFWAEKGCLIWQPYDVEVGAGTMNPATFLKVLGKKPWNVAYVEPSRRPQDGRYGENPNRLQHYYQFQVILKPAPRNPQEIYLESLERLGINPLEHDIRFVEDDWESPTLGAWGLGWEVWLDGMEITQFTYFQQAGGLDLDEISVEITYGLERIAMYIQDKDSVFDIEWKEGITYGEIFKRSEWEWSKYNFELADTDMLFQVYEMFEKESKRMVEEGLIFPAYDYLLKCSHVFNILDARGAISVQERARYIRRMNNLAREIAKLYLQVFENVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Polyphyletic Origins of Glycyl tRNA Synthetases.
pubmed doi rcsb
source organism Aquifex aeolicus (strain vf5)
molecule tags Ligase
molecule keywords Glycine--tRNA ligase alpha subunit
total genus 110
structure length 283
sequence length 283
chains with identical sequence B, C, D, E
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 5f5wA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5f5wA01
3TEHB 4H2TA 2DEQA 3HY1A 2E41A 3IALA 4ZIBA 4P3OA 4BWAA 1SETA 2QHVA 3M4QA 3VBBA 3L2ZA 2DXUA 1WU7A 3VQWA 2Q7GA 4XEMA 1PYSB 4YRNA 3NENA 3G1ZA 3HXYA 1EQRA 1G5HA 4RDXA 5C53B 4P3PA 2IY5B 2RHSB 4CH3A 2RHSA 3UGTA 4XU3A 4EX5A 3V8LA 3WQZA 1SERA 4H2SA 4YREA 4XTZA 2CJ9A 4YRLA 4CS4A 4HWSA 2DTOA 3EFRA 3IG2A 1B8AA 1NJ1A 4PHCA 1E1OA 5K1XA 2QHTA 4WJ3M 3TEGA 1NJ2A 3HTZA 3P8TA 2CJBA 3NELA 2E10A 2ZNJA 3PZCA 2ODRC 3LSSA 3RIRA 3RKWA 1WNLA 4YRTA 1G5IA 3W3SA 4H02A 3NETA 4P3NA 5E3IA 4H2VA 1BIBA 12ASA 3QO8A 4TVYA 2EJ9A 4E51A 2QHSA 4DQ2A 4YPFA 2XGTA 4G84A 1NJ6A 2I4MA 2QHUA 3L1AA 4UPAA 3PCOB 2EAYA 3MF2A 2J3LA 3HFVA 1X56A 2E3CA 4XTXA 1IL2A 2ZT6A 2PMEA 4RQFA 3RF1A 1JJCB 2ARUA 1NJ8A 1N9WA 1NYQA 1HTTA 4HWTA 3RKYA 3HY0A 4LNSA 11ASA 1B70A 1BIAA 4H2XA 4P71A 4XTVA 3TEHA 4TVAA 1USYA 2DVEA 4HWRA 4HVCA 5K1PA 4YRRA 3A7AA 2C8MA 4YRPA 3QO7A 4G85A 1J5WA 2DU7A 3RKXA 4YRMA 3V7SA 3MF1A 2EL9A 1ASZA 1WYDA 4OP0A 1E1TA 3UFGA 2RHQA 2ALYA 1H4TA 1PYSA 3L4GA 1SESA 3REUA 4CH6A 2ZCEA 1WQ7A 3RGLA 2J3MA 3IKLA 4Q6GA 1B7YA 2ZNIA 4EO4A 2DXTA 4YRCA 3MEYA 4TQDA 5C52B 3HXWA 1GGMA 2Q7EA 4K86A 1Z7NA 2CGHA 2Q5IA 3HFZA 2ZZEA 3E9IA 4O2DA 1H4VB 2E65A 3M4PA 4TQFA 2AMCB 3A31A 1H4QA 4P75C 4TVWA 1B70B 2ZR3A 1BBUA 2DJZA 3REXA 2ODRD 4KR2A 2I4OA 3V8KA 4XEOA 3V7CA 1BBWA 4TVAB 2Q7HA 1NYRA 5ELOA 2E5AA 1HC7A 3A5ZA 2ZR2A 1NNHA 3A32A 3LSQA 2I4NA 2Q5HA 2AMCA 1WPYA 1W66A 3VQVA 3DSQA 4TTVA 4ZTUB 2ZTGA 2E64A 3HRKA 4CH5A 4XTYA 1X2HA 4YRIA 2G4CA 3HXXA 3BFMA 4XU2A 1B7YB 1H4SA 4PG3A 5F5WA 2DQ0A 1YGBA 4H2UA 2ZXFA 3BJUA 2RHQB 3A7RA 2ZT7A 3IKMB 1RIQA 1KMMA 2EJFA 3P8VA 4HWPA 3HXZA 3V7RA 2I4LA 1LYLA 4YRFA 2ZIMA 4HA8A 4YRKA 1Z7MA 4YCVA 1X55A 3L4GB 1ASYA 4CS3A 5C51B 3I7FA 3VQYA 4NCXA 4DPGA 3KFUA 4YRQA 1EVLA 3RUXA 4UP8A 4X5OA 3QO5A 1ATIA 4YP0A 4CH4A 3FJPA 2CIMA 3ERRA 4ZTZB 4YCWA 4P74A 2DZCA 3ICAA 2IY5A 2ZIOA 2FYKA 1YFSA 3P8YA 1YB3A 1KMNA 1EVKA 1ADJA 2HNIA 1SRYA 4K87A 5HGQA 2EWNA 3RL6A 2ZZGA 3HXUA 3VQXA 4J15A 3V8JA 4YRSA 2ARTA 1C0AA 1HXDA 2ARSA 2ZT5A 3EFSA 2DDZA 4UP9A 2P0LA 4YRJA 5KNNA 4XU0A 1L0WA 2ZT8A 4YCUA 4WI1A 3NEMA 4UP7A 1WLEA 3A74A 4YYEA 4WJ4A 1USYC 3QTCA 2DZ9A 3CMQA 3HFZB 4RQEA 4BW9A 3HRIA 2DKGA 2AKWB 4XTWA 4P73A 1ADYA 2EJGA 4YROA 4H2YA 1X01A 4K88A 1KOGA 2P5IA 1JJCA 2DQ3A 2ZINA 4Q15A 1QE0A 1FYFA 4P72C 2ZGWA 4H2WA 5ELNA 1WQWA 1NJ5A 3TUPA 4P73C 1EIYA 2C7IA 1EIYB 4TWAA 1E22A 4HWOA 3A7UA 4KQEA 1VQZA 2XTIA 2AKWA 1YFTA 2ALYB 3UH0A 1E24A 1EFWA 4AH6A 4CS2A 1YFRA 4KR3A 4WF2A 4P74C 4OLFA 1X2GA 4YRGA 2DU5A 3HXVA 2ZZFA 4P71C 4YDQA 4XU1A 2CJAA 4RMFA 1G51A 4XTUA 3A5YA 2PMFA 3QNEA 4L87A 2E1HA 3OD1A 4P72A 1QF6A 4H2XB 2DTIA 1EOVA 1X54A 4P75A 3E9HA 3LC0A 1B76A 3UGQA 3PCOA 3R07A 3RACA 2DTHA
chains in the Genus database with same CATH superfamily
2XZEA 1T8BA 2VQET 4HFEA 2E41A 5DQVA 4ZIBA 3ZC1A 3ZPOA 3FZFB 3TLVA 5AQLB 2D2SA 5KDMC 3NRXA 1WU7A 3ONJA 2WU5A 2NS6A 5HEOA 2ES0A 5FKYA 3RLFF 3HXYA 1G5HA 2JJ9A 2DCFA 3OVUA 4YTNA 5JR9C 3JC6D 4KI0F 3UGTA 5JDFA 3V8LA 3P4PA 3VU7H 2UU9T 3ZLIA 4CS4A 1BR0A 4HWSA 4TWDA 5LG4A 5AQGB 2XQ9A 2CLYC 4C90A 1XMQT 3RIFA 3UT5E 2FJBA 3EDUA 1E1OA 3SOLA 3TEGA 2Y6XA 1NAFA 1E1HB 4JI5T 4UVAB 5FXZA 4JBWF 4AISA 2KXPB 4DR6T 2AE9A 3RIRA 5C3JA 1WNLA 1G5IA 3ZN0B 5ABEA 3NETA 4ZI2D 2NW9A 1NENA 2WM9A 3AE6A 3RIUC 2QGSA 4DQ2A 5DQWA 3UUXB 4LMLA 3ZCJA 4J2CA 2CHOA 3AEGA 4EEBA 2I4MA 3QOFA 3RYIE 4QX7B 4A56A 4DBRA 3CKDA 2YU1A 4O4IE 1HNZT 2VWAA 4B3RT 1IL2A 2ZT6A 3K8PC 4RQFA 1JJCB 3ESLA 4DV5T 1YXRA 2EHOD 3PUZF 3PDYA 5CFBA 1N9WA 3EDVA 4UEMA 2V7IA 3RKYA 4TNWA 1G73A 1IZNB 4CQIA 4TX5A 1B70A 5LA6E 4HWDA 3ZC0A 4GYSA 3PJAJ 3AAAB 3TLSA 2DVEA 4HWRA 3LSVA 3CX6B 4YRRA 1GQEA 3QO7A 4G85A 3DP7A 1J5WA 3RKXA 2NW8A 2LOSA 1MIYA 2JQKA 3BQKA 4OP0A 2VKDA 1FIOA 3VRAA 4JEHB 1KNZA 3PTRB 4ZI3D 2C5KT 2F4VT 4KHPT 3RGLA 1B7YA 5JH7E 2D0UA 3CQXC 4EGWA 2H7OA 5L3DB 4DIDB 4HFDA 4I4TE 4HTEA 1D1AA 4V1Av 3HXWA 3HKDE 1WYBA 2CEAA 3CX7B 3AA1B 1H4QA 2CRBA 2JRKA 5E0OA 1XZYA 3Q5XA 1XDOA 2XQ4A 3AE8A 2E9XA 2XM2A 1BBUA 4QKNA 2ODRD 4KR2A 2OV9A 3RKOA 3CQCB 2Q7HA 2DNXA 2DI4A 2V6XA 2E5AA 1IJ5A 2ZR2A 4X66T 3GN5B 2J4GA 3A8YC 3AE5A 3ZMUB 2WMNA 3UU5A 2AMCA 3CQGB 4B6XA 2V8SV 3E22E 4HWHA 4O2BE 2W00A 1WRDA 4ZS2A 2ZTGA 1JNZA 2R6GF 3UU6A 2LOPA 2BVMA 4IE7A 5C8YE 2KZ7B 1X2HA 2IMLA 2G4CA 3PV0F 4K0UA 3O9XA 2BG9B 2IC9A 5LGNB 5JDQA 2WU2A 5EK2A 3BK9A 3F57A 1E2AA 1RIQA 4YLHA 1R8IA 2LHRA 1W09A 5LJMA 2KINB 5JR9A 4NUVA 5FY7A 5JDHA 2XUEA 5L3GB 2NR4A 4HA8A 3L39A 3L4GB 2X67A 3N9QA 3AEBA 4F6RC 1CUNA 4NCXA 3AEAA 1MIVA 2WZHA 4YRQA 2JQ9A 3QUJA 4WYVA 1HCIA 3RUXA 5JVDE 1QLBA 3ZMSB 1BR1A 2N9DA 5FY1A 1MIWA 3SFDA 4LF5T 4CI1B 3UFEA 3FJPA 2V7JA 3RC3A 2CIMA 1D0XA 2VURA 2XM1A 2YEVC 1WFDA 1AJ3A 2BG9E 4TV9E 5LJNA 1EVKA 4EEDA 4LF4T 4X1KE 3F2EA 2XQ5A 4WW0A 2EWNA 3C4XA 1LVKA 3H3AA 3HXUA 3ETUA 1T7SA 4HFCA 4XAXB 4ASKA 3V8JA 4GIWA 4YRSA 5HEGA 5EK4A 3Q5DA 4HT4A 1HXDA 2ZMAA 3ABVA 2IIUA 4TWHA 2BS3A 4AKLA 1KFYA 3C50A 2ARSA 3IA3A 3EI0A 3AE2A 2PBIA 4H63H 3KFWX 4LFBT 1HFAA 2CHNA 2P0LA 3ETVA 4HFIA 4MBQA 3OYXA 1MMGA 2ZT8A 4YCUA 4WI1A 3NEMA 1HX1B 4UP7A 1W0AA 1WLEA 4YYEA 4WJ4A 2HHHT 2UUBT 3QTCA 2XJ7A 2ACZA 4PFPA 2DWKA 2V6YA 4LFCT 2WCAA 2DKGA 4CN1A 3P50A 4H9SE 3FXEB 4IGUA 2H89A 4X5TA 2UXDT 1UX4A 3SRZA 1ZOYA 4COFA 2Y48B 4ILCA 5M4YA 5HWXA 3HKBE 3ZSTA 2ZINA 4P72C 3KBTA 2XAHB 2P9BA 4ILAA 4H2WA 3H3MA 5ELNA 1WQWA 2XSBA 3ZMVB 3GWHA 1EIYB 4TWAA 1E22A 3RRCA 2E9XD 4HWOA 2A8EA 4AQFA 3H37A 4L5GA 3NZPA 3N5LA 5HXSA 4NPPA 4CS2A 2VASA 4M1PA 4OHFA 4WF2A 3P7IA 4ZEYA 4DV4T 1ZEEA 4YXDA 4IREA 4P71C 3WI3A 3PUYF 2ACXA 4PAGA 5FNVE 2LKHA 3QNEA 5AQPB 5ABGA 3OBVE 2E1HA 3HKEE 4O4HE 2CWOA 2BG9C 2WBLA 4H2XB 5L47A 2DTIA 3FZHB 4AXPA 4QH4A 5AFUL 3UU3A 2K5BB 4HKAA 3R07A 2XHEB 4IDPA 3JAFA 4PK4A 4H2TA 2C5JA 3Q5WA 2BBJA 3HY1A 3AVSA 4JLEA 1O3XA 2HPLA 4I0UA 1SETA 2QHVA 4LVIA 2BZBA 4U31A 2DLRA 1PYSB 4XEMA 3NENA 3G1ZA 2MYSA 2J47A 4YFSA 4PJNA 3UUNA 2JQHA 4P3PA 2CM0A 2IY5B 2ZLYA 1HNXT 4UVBB 2UXNB 1XNRT 2K3WA 2VL0A 4H2SA 2D5UA 2E9XC 2NTYA 2CJ9A 2BKPA 3IG2A 5BMVE 1NJ1A 1V9DA 5FVKA 4GKKT 4PHCA 3Q9DA 4CN6A 3Q2MA 4WJ3M 3PU8A 2KNDA 3HTZA 4DR1T 2CJBA 2E10A 5FVLA 2WQYA 2PFVA 3PZCA 2ODRC 3IHRA 3LSSA 3N2OA 3N2KE 4DV7T 4JI7T 4X62T 4IE6A 2H3RA 1BIBA 4AIUA 2EJ9A 3MZKB 2QHSA 4Z91A 5H6QB 5JTGA 4JI6T 4PW8A 5IWAT 4CN4A 4G84A 3L1AA 5A1LA 3NBXX 2BDEA 5L4EA 4I55E 2EAYA 2J3LA 5LNKA 3CWZB 3RQUA 4YSYA 1I94T 4MHCA 2E3CA 5HXHA 3N9OA 2Y8DA 1NYQA 4O4LE 1HTTA 3HY0A 4PNIA 11ASA 1BIAA 4H2XA 1B7TA 4P71A 2LEHA 2LT3A 1USYA 2CXDA 3PUGA 1MMAA 2WSSV 5F8PA 4Z8XA 3IF8B 1UGOA 3VHLA 2DU7A 3V7SA 3MF1A 2EL9A 2A9UA 5HEUA 4I43B 2WDRA 3L4GA 1SESA 3REUA 2IDOB 1WR6A 3AA0B 2LSKA 3IKLA 4IIJE 5AQKB 4HGAA 4YRCA 3E0ZA 3MEYA 4TQDA 5C52B 5AQIB 1D1BA 4HWCA 1GGMA 2Q7EA 1Z7NA 2NP9A 3HFZA 3E9IA 3LBXB 1DU2A 2LM2A 2LRLA 3M4PA 2AMCB 1KNPA 4EZ4A 2Q9QD 2W63A 2DJZA 2I4OA 3K1SA 4TVAB 3ZMZB 5ELOA 3AE4A 2V5CA 3N9NA 2W66A 5CA1E 4DR2T 3A32A 5HEJA 4UV8B 1KF6A 2YN6A 4TTVA 2WDQA 2E64A 3HRKA 3FZMB 1MNEA 2PJQA 1Z0PA 4DR4T 3VR9A 1LVFA 2KLQA 3PUQA 2WB5A 1B7YB 3RQWA 1H4SA 3A5XA 1NWMX 4PG3A 5F5WA 3UUBA 2V5DA 4EAHA 5AQOB 4YTPA 1SE7A 1YGBA 2ZXFA 4MFRA 3A7RA 3IKMB 2VKJA 1YKHB 3ZT6A 3P8VA 4NUUA 3V7RA 3RPUA 5FXVA 2BBHA 2RPAA 4AKGA 2ZIMA 3RYFE 3NRYA 4GOUA 4YCVA 1YD8G 1ASYA 2WS3A 2H7VC 2CMRA 3BQIA 4U7YA 1YKEB 4QXHB 3I7FA 5AQJB 5EZYE 3S4UA 3V5SA 1EVLA 3SS1A 3HA4A 3AEFA 4UP8A 4HN9A 2UXCT 3QB5K 5LBQB 4OK0A 1Y64B 4BJMA 2W0GA 5ABFA 4CH4A 4ZTZB 4YCWA 2X9HA 3C64A 3ZT7A 1KEYA 3P8YA 3I9YA 1YB3A 1SA0E 2HNIA 1SRYA 2VKOA 3PUAA 4ZS3A 4G63A 5HGQA 2MAWA 5L3FB 3VR8A 5KX5E 2DWGA 4E7SA 3NKZA 3QB5A 2ARTA 1BR2A 2ZT5A 5AQNB 3EFSA 4PK6A 4YTMA 4QXBB 3EHZA 4JI8T 4WBNE 2BKOA 1U5PA 4LVJA 3C51A 1X79A 1WR0A 3HR0A 4TV8E 3RC8A 2YDRA 3HRIA 2AKWB 2E5LT 4XTWA 4EV6A 4YROA 3CPZA 4DR5T 1KOGA 5AQFB 3I1AA 4Q15A 1QE0A 4TUYE 2ZGWA 1MMDA 1NJ5A 5LGTB 2C7IA 3AE9A 2E5VA 2WP9A 4KQEA 2JMKA 2K48A 2AKWA 2W61A 1E24A 4HE8A 4AKRB 1IBKT 1YFRA 2A3DA 3PUSA 3VKHA 3M3ZB 1MMNA 3W15B 4UV9B 4JEUB 4QX8B 5LBMA 2XQYA 4YDQA 4XU1A 2LHNA 2YDQA 4RMFA 1G51A 1W0BA 4TWFA 2Q9QC 4L87A 3OD1A 3CX8B 4MLKA 1EOVA 3NWIA 3RYHE 4WNKA 5CJ5A 2WAUA 3MK7C 1L0VA 4P75A 2V26A 1IJ6A 1S35A 2EHOA 1EZ3A 2DTHA 4CI3B 2JPFA 3K3QC 3IALA 4P0BA 4ZI2C 4HFHA 4P3OA 2BVLA 4B3TT 3OPCA 3M4QA 3VBBA 2A2FX 1T98A 3L2ZA 2H88A 2XQ6A 2CA5A 1E7PA 3VQWA 1N36T 1YQ3A 4YRNA 5AQSB 5ABFB 3KDSE 4ZZCA 4RDXA 5C53B 2RHSB 4CH3A 2RHSA 5FY0A 1XNQT 3EAMA 3J9X1 2XAJB 3WQZA 1SERA 5JDNA 4XTZA 4HEAA 1J5ET 4YRLA 1UUSA 5HYAA 1D0YA 4X1IE 2DTOA 3EFRA 3SWHA 3ONLC 1B8AA 4GYRA 4ILBA 4E7ZA 2V7KA 5K1XA 2QHTA 1NJ2A 3P8TA 3NELA 3JAEA 5LGUB 3AE7A 2UUCT 1NEKA 1HF8A 1HTJF 3ZMTB 4YRTA 2CWYA 2UUAT 2K24A 3N9LA 4DMVA 4QWNB 5HCMA 3O1IA 4H2VA 2YK0A 2LM9A 5LOVE 4TVYA 2ZM8A 3ZYKA 4E51A 4YSXA 2G0UA 2X66A 5CGMA 1FMWA 3X1DA 3LG7A 1VCTA 5AQVB 4IDZA 1NJ6A 2QHUA 3UULA 4UPAA 3I0OA 3PCOB 4KBMB 3MF2A 3HFVA 2HH7A 1X56A 2XPKA 4LMJA 2PMEA 3RX6A 3CMLA 4OFZA 1NJ8A 2M67A 4LVKA 4O2AE 2XQ7A 2CCQA 2IC6A 5L3BB 4OYKA 4F8HA 4EIWA 2N2NA 3TEHA 2X0LB 2L9QA 1UCUA 4I50E 5LXTE 4X20E 3T1YT 4EYYR 5K1PA 1FJGT 2IUBA 3O1JA 4EZHA 2LRKA 4AQGA 4DV1T 3T1HT 1WYDA 3UFGA 3P4WA 2IAKA 3BQLA 2RHQA 2VQFT 1PYSA 4CH6A 4ADZA 5IUXA 4U33A 4CXXA 3RIAA 2ZCEA 4Q6GA 2CBIA 2PG8A 4QH1A 1YW0A 4AI6A 4GK0E 1XMOT 1VCSA 1FEWA 3P8CD 3JADA 3DJBA 4K86A 1WLXA 3ZYLA 2J62A 2CGHA 2Q5IA 2ZZEA 4O2DA 3AEEA 1H4VB 1Y01A 5HEHA 2E65A 1SHZC 3A31A 3EUHA 2MOZA 5JDMA 4P75C 5HCJA 4TVWA 2WWUA 4YY3T 4YHJA 3RKGA 3IBPA 2ZR3A 3REXA 1CHUA 2N1GA 3V8KA 5CA0E 4XEOA 2I6HA 4AKHA 1BBWA 1NYRA 3LK2B 3P4QA 4IL9A 3ZN1B 5AQHB 1NNHA 3LSQA 2I4NA 2Q5HA 4EOZB 3C4ZA 1W66A 3DSQA 3LDQB 4EB6E 4DVDA 4HWFA 2QA7A 2VL8A 4CH5A 2M6BA 2JMHA 5FYMA 5EK3A 4IT4A 2HN1A 4H9NC 4LF7T 2XY8B 4YRIA 3K3OA 4XU2A 3RH3A 3ZSSA 1WCRA 5H6RB 3P4RA 4X64T 2V7LA 5LHGB 3R6NA 4O4JE 4H2UA 3BJUA 3B13A 2ZT7A 3C4WA 3G06A 2X9XA 5LHIB 3D0TA 3AECA 4EXTA 3FBZA 4LF8T 2I4LA 4IE0A 2M6IA 3AVRA 4YRKA 4UVCB 1ZV4X 1IBLT 3UUMA 1OWAA 4KUMB 5C51B 3FZLB 4UIGA 3VQYA 3E08A 4GK5E 4DPGA 5LCYA 4AKIA 3GN5A 4CZZB 1OEDA 2YDSA 2W2UA 2NW7A 3KV4A 2V6YB 3QO5A 2LSJA 4H9PC 3LBXA 1ATIA 1OEDB 3ZCIA 2E9XB 3ZEFB 2UXXB 4P74A 4A98A 2HPJA 2XQ8A 3ICAA 2ZIOA 1YFSA 3F31A 1ADJA 4BAYB 5LYJE 3O4XE 4QH5A 2XSAA 2KWIB 1J1JA 3JCFA 3MJXA 2JQQA 4DR7T 4J15A 4EYUA 3PUXF 3CIRA 4DV6T 2RP4A 1C0AA 4DMWA 4ANJA 4L9IA 4QHOA 2DHRA 2WDVA 4UXNB 4UP9A 3N2GE 3N9PA 4YRJA 4XU0A 4LF6T 3CVRA 2WZIA 3QK6A 4QXCB 1LKXA 4PJMA 1LRZA 3HL6A 3A74A 3PU3A 1UX5A 2ODUA 2RA1A 2NTXA 2DZ9A 4MALA 3UQ7A 5LMNT 3TKLB 4N78D 3CMQA 3KVAA 4GKJT 4ZXLA 4UF0A 3ZYMA 2MBGA 4BW9A 4OX9T 3T8OA 4P73A 1ADYA 2X0YA 2DL1A 2I0MA 5KXJA 4DV2T 1OEDC 4H2YA 1Z8UA 4PK5A 1X01A 4JUYA 4IDNA 2YINA 3NVOA 4ZHQE 1JJCA 3NZQA 1FYFA 5L3CB 1KK7A 1VRBA 3AA6B 3KBUA 2QRXA 2XAGB 4JI0T 4H9QC 3U78A 5JR9B 3A7UA 2V1DB 1D0ZA 3RYCE 3UTKA 2ALYB 3UH0A 3TLWA 5HXRA 4LF9T 2CE7A 3HI2A 4AH6A 3KV5A 3RRWA 3L09A 5AQTB 5FXXA 4OLFA 4YRGA 3HXVA 2QVAA 2W62A 3RI5A 1HNWT 2GK9A 1N33T 2CJAA 4UELA 2EHOC 3AAIA 2PMFA 2CPTA 4BJNA 2YOEA 3ZJ2A 4P72A 5HAXA 1S94A 4K0KT 4ISSA 1YQ4A 4C91A 5C2TA 2Z6EA 5IHYA 3B5MA 1X54A 3J7Yq 3PURA 2X0HA 4B3MT 2CXLA 4CXWA 4IDQA 3UGQA 4WZXA 4AQFC 3PCOA 3U3IA 3RACA 3AA7B 3TEHB 1ZHCA 3WAKA 1VOMA 2DEQA 2BS2A 4H9OC 3PUWF 2FUPA 4BWAA 4HWIB 3I9WA 2DXUA 3FXDB 3AAEB 2Q7GA 3IEEA 4JI1T 1EQRA 4DNDA 3ZKRA 1D1CA 3GMIA 2XASB 4XU3A 4EX5A 4P09A 3ZJ1A 4ERRA 4YREA 5BR8T 2WMOA 4U2YA 4WBOA 2X9YA 1M62A 3KV9A 4KMCA 3A7MA 4PJLA 3N9MA 5AQUB 3K3NA 4ZOLE 3LJCA 2QYWA 4TN7B 2ZNJA 1I6ZA 2X51A 3RKWA 4KX6A 3HKCE 3AXJA 3DTOA 4B3ST 3W3SA 4H02A 4P3NA 4FJOA 4FI5A 5E3IA 12ASA 3QO8A 2L8KA 4PJJA 2XTLA 4YPFA 2XGTA 3KVBA 3AE3A 4U7IA 2OLTA 1N34T 4YHHT 2PTFA 3PE0A 3LK3B 4KP3C 4JYAT 4JI2T 1FMVA 2VK9A 5L4HA 4H9RC 4XTXA 3ZT5A 5FXWA 1M7KA 2NOXA 2XQ3A 3RF1A 2ARUA 5FL1A 1UURA 2LSIA 4XZCA 2LJLA 4HWTA 5JRCA 3OJAA 4LNSA 4XTVA 4TZ4C 5ABHA 4TVAA 3L8RA 4CXYA 4LVLA 4NIQA 3UU8A 4HVCA 2IW5B 3CK6A 1T72A 3A7AA 2C8MA 3ANWA 2YKSA 4YRPA 5LP6E 2JIWA 5KMGP 3R84B 4YRMA 5ADXL 2CXFA 3M65A 4A5XA 1ASZA 1E1TA 4PFOA 3TLTA 2ALYA 1H4TA 5ETWA 4P1NA 2LE8A 1WQ7A 2J3MA 3OYZA 3MACA 2ZNIA 4EO4A 3UQ4A 5J1GA 2DXTA 2LKGA 1SUMB 2ZM0A 2B1EA 4O8SA 2UXBT 5AQRB 1UK5A 4IHJE 4JI4T 1BR4A 4TQFA 4XBFB 1U4QA 3MA9A 3KINB 4YJ2E 4NXMT 1QUUA 1B70B 4DR3T 5LB7B 1W9RA 4YJ3E 4OYJA 4YT0A 5TAOA 3V7CA 2BS4A 3EVYA 3VRBA 2E8IA 5J2UE 3ANWB 4CI2B 1HC7A 3A5ZA 2X9WA 2NWBA 4DV0T 3FZKB 1WPYA 3VQVA 2CBJA 5JREA 4U72A 4ZTUB 5FMNA 2W67A 3LK42 5J2TE 4XTYA 5JRCB 3FB2A 2D0TA 5HXCA 3QC9A 2FJEA 3UU4A 2ZM2A 2KT9A 3HXXA 3BFMA 2CLYB 4DUZT 3RIUA 4ISTA 1IBMT 2XAFB 1KNRA 1HR0T 2DQ0A 2E2AA 3TLUA 5GONE 3SFEA 5FL0A 5LMUT 2RHQB 2MTQA 2FJAA 1KMMA 2EJFA 3OTOT 4HWPA 3HXZA 4KHZF 2SPCA 1LYLA 5JQGE 4YRFA 4A97A 1Z7MA 2XQAA 1ZKEA 1X55A 4ZI7E 2HN2A 1HX8A 4CS3A 3ONXA 2BG9A 2LSGA 4HFBA 4ILUA 4U2ZA 4DO0A 3KFUA 5JDLA 4UR9A 4X5OA 2I59A 3QNUA 1ZP0A 4YP0A 4P0AA 3EABA 3FHNA 3ERRA 3O1HA 2B76A 4NXNT 2DZCA 4G2AA 5F3JA 2IY5A 5IYZE 2Q9QA 5CB4E 5AQQB 2FYKA 4JV5T 2WY2A 3AE1A 5FP3A 1JNRA 2IHR1 1KMNA 1WYCA 3KV6A 4DBQA 4K87A 2AXDS 4LVMA 3RL6A 3PJAA 2ZZGA 4BA9A 3VQXA 4JI3T 3RHWA 3FBLA 3V5UA 3WAJA 2WWVA 4ZZBA 2KSRA 4IDOA 2ODVA 2VVNA 4LMKA 5AQMB 1MNDA 2DDZA 5KNNA 3JC6C 4U3CA 4DV3T 2Q9QB 2LLYA 1L0WA 5HXEA 1XWMA 2KMFA 1G8XA 2OA5A 2J1DG 1HG5A 5DJQC 1HG2A 3PUVF 4X1YE 2W4XA 4IL4A 1USYC 4ZI3C 4U74A 1N32T 1XDPA 2K9AA 3HFZB 2LSYA 4DUYT 2A72A 4RQEA 5JDGA 1OEDE 4IE5A 2MPKA 2EJGA 5L3EB 4K88A 3MXZA 1H7CA 2P5IA 2DQ3A 3Q5EA 2BKNA 3LFMA 4X65T 1HS7A 4LFAT 3TUPA 5HWYA 3I0QA 4P73C 1EIYA 4Z90A 2FBWA 2ZM6T 1X9BA 5J0ZA 3B57A 1VQZA 2XTIA 2L3LA 4H63V 2YU2A 1YFTA 2EHOB 1EFWA 3MQZA 1QSDA 5L2LA 2XAQB 5LG3A 2X68A 1OXZA 4Q25A 5DABA 4KR3A 3OKQA 1IAPA 4P74C 3MKDA 1X2GA 2C0SA 2DU5A 4HFVA 3GA8A 2FJDA 3C98B 2VKHA 2ZZFA 4AQYT 3AXJB 3P4SA 3AB3B 4XTUA 3A5YA 3VKGA 4TNVA 3L3PA 2D9DA 3AEDA 1QF6A 5LHHB 2VB6A 4YSZA 4UF0B 4L0RA 2KWHA 3E9HA 3LC0A 1US7B 1B76A 2VVSA 2V7MA 4IE4A 2C5IT
chains in the Genus database with same CATH topology
3TEHB 4H2TA 2DEQA 3HY1A 2E41A 3IALA 4ZIBA 4P3OA 4BWAA 1SETA 2QHVA 3M4QA 3VBBA 4LVIA 3L2ZA 2DXUA 1WU7A 3VQWA 2NS6A 2Q7GA 4XEMA 1PYSB 4YRNA 3NENA 3G1ZA 3HXYA 1EQRA 1G5HA 4RDXA 5C53B 4P3PA 2IY5B 2RHSB 4CH3A 2RHSA 3UGTA 4XU3A 4EX5A 3V8LA 3WQZA 1SERA 4H2SA 4YREA 4XTZA 2CJ9A 4YRLA 4CS4A 4HWSA 2DTOA 3EFRA 3IG2A 1B8AA 1NJ1A 4PHCA 1E1OA 5K1XA 2QHTA 4WJ3M 3TEGA 1NJ2A 3HTZA 3P8TA 2CJBA 3NELA 2E10A 2ZNJA 3PZCA 2ODRC 3LSSA 3RIRA 3RKWA 1WNLA 4YRTA 1G5IA 3W3SA 4H02A 3NETA 4P3NA 5E3IA 4H2VA 1BIBA 12ASA 3QO8A 4TVYA 2EJ9A 4E51A 2QHSA 4DQ2A 4YPFA 2XGTA 4G84A 1NJ6A 2I4MA 2QHUA 3L1AA 4UPAA 3PCOB 2EAYA 3MF2A 2J3LA 3HFVA 1X56A 2E3CA 4XTXA 1IL2A 2ZT6A 2PMEA 4RQFA 3RF1A 1JJCB 2ARUA 1NJ8A 4LVKA 1N9WA 1NYQA 1HTTA 4HWTA 3RKYA 3HY0A 4LNSA 11ASA 1B70A 1BIAA 4H2XA 4P71A 4XTVA 3TEHA 4TVAA 4LVLA 1USYA 2DVEA 4HWRA 4HVCA 5K1PA 4YRRA 3A7AA 2C8MA 4YRPA 3QO7A 4G85A 1J5WA 2DU7A 3RKXA 4YRMA 3V7SA 3MF1A 2EL9A 1ASZA 1WYDA 4OP0A 1E1TA 3UFGA 2RHQA 2ALYA 1H4TA 1PYSA 3L4GA 1SESA 3REUA 4CH6A 2ZCEA 1WQ7A 3RGLA 2J3MA 3IKLA 4Q6GA 1B7YA 2ZNIA 4EO4A 2DXTA 4YRCA 3MEYA 4TQDA 5C52B 3HXWA 1GGMA 2Q7EA 4K86A 1Z7NA 2CGHA 2Q5IA 3HFZA 2ZZEA 3E9IA 4O2DA 1H4VB 2E65A 3M4PA 4TQFA 2AMCB 3A31A 1H4QA 4P75C 4TVWA 1B70B 2ZR3A 1BBUA 2DJZA 3REXA 2ODRD 4KR2A 2I4OA 3V8KA 4XEOA 3V7CA 1BBWA 4TVAB 2Q7HA 1NYRA 5ELOA 2E5AA 1HC7A 3A5ZA 2ZR2A 1NNHA 3A32A 3LSQA 2I4NA 2Q5HA 2AMCA 1WPYA 1W66A 3VQVA 3DSQA 4TTVA 4ZTUB 2ZTGA 2E64A 3HRKA 4CH5A 4XTYA 1X2HA 4YRIA 2G4CA 3HXXA 3BFMA 4XU2A 1B7YB 1H4SA 4PG3A 5F5WA 2DQ0A 1YGBA 4H2UA 2ZXFA 3BJUA 2RHQB 3A7RA 2ZT7A 3IKMB 1RIQA 1KMMA 2EJFA 3P8VA 4HWPA 3HXZA 3V7RA 2I4LA 1LYLA 4YRFA 2ZIMA 4HA8A 4YRKA 1Z7MA 4YCVA 1X55A 3L4GB 1ASYA 4CS3A 5C51B 3I7FA 3VQYA 4NCXA 4DPGA 3KFUA 4YRQA 1EVLA 3RUXA 4UP8A 4X5OA 3QO5A 1ATIA 4YP0A 4CH4A 3FJPA 2CIMA 3ERRA 4ZTZB 4YCWA 4P74A 2DZCA 3ICAA 2IY5A 2ZIOA 2FYKA 1YFSA 3P8YA 1YB3A 1KMNA 1EVKA 1ADJA 2HNIA 1SRYA 4K87A 5HGQA 4LVMA 2EWNA 3RL6A 2ZZGA 3HXUA 3VQXA 4J15A 3V8JA 4YRSA 2ARTA 4HT4A 1C0AA 1HXDA 2ARSA 2ZT5A 3EFSA 2DDZA 4UP9A 2P0LA 4YRJA 5KNNA 4XU0A 1L0WA 2ZT8A 4YCUA 4WI1A 3NEMA 4UP7A 1WLEA 4LVJA 3A74A 4YYEA 4WJ4A 1USYC 3QTCA 2DZ9A 3CMQA 3HFZB 4RQEA 4BW9A 3HRIA 2DKGA 2AKWB 4XTWA 4P73A 1ADYA 2EJGA 4YROA 4H2YA 1X01A 4K88A 1KOGA 2P5IA 1JJCA 2DQ3A 2ZINA 4Q15A 1QE0A 1FYFA 4P72C 2ZGWA 4H2WA 5ELNA 1WQWA 1NJ5A 3TUPA 4P73C 1EIYA 2C7IA 1EIYB 4TWAA 1E22A 4HWOA 2A8EA 3A7UA 4KQEA 1VQZA 2XTIA 2AKWA 1YFTA 2ALYB 3UH0A 1E24A 1EFWA 3MQZA 4AH6A 4CS2A 1YFRA 4KR3A 4WF2A 4P74C 4OLFA 1X2GA 4YRGA 2DU5A 3HXVA 2ZZFA 4P71C 4YDQA 4XU1A 2CJAA 4RMFA 1G51A 4XTUA 3A5YA 2PMFA 3QNEA 4L87A 2E1HA 3OD1A 4P72A 1QF6A 4H2XB 2DTIA 1EOVA 1X54A 4P75A 3E9HA 3LC0A 1B76A 3UGQA 3PCOA 3R07A 3RACA 2DTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TEH B;  4H2T A;  2DEQ A;  3HY1 A;  2E41 A;  3IAL A;  4ZIB A;  4P3O A;  4BWA A;  1SET A;  2QHV A;  3M4Q A;  3VBB A;  3L2Z A;  2DXU A;  1WU7 A;  3VQW A;  2Q7G A;  4XEM A;  1PYS B;  4YRN A;  3NEN A;  3G1Z A;  3HXY A;  1EQR A;  1G5H A;  4RDX A;  5C53 B;  4P3P A;  2IY5 B;  2RHS B;  4CH3 A;  2RHS A;  3UGT A;  4XU3 A;  4EX5 A;  3V8L A;  3WQZ A;  1SER A;  4H2S A;  4YRE A;  4XTZ A;  2CJ9 A;  4YRL A;  4CS4 A;  4HWS A;  2DTO A;  3EFR A;  3IG2 A;  1B8A A;  1NJ1 A;  4PHC A;  1E1O A;  5K1X A;  2QHT A;  4WJ3 M;  3TEG A;  1NJ2 A;  3HTZ A;  3P8T A;  2CJB A;  3NEL A;  2E10 A;  2ZNJ A;  3PZC A;  2ODR C;  3LSS A;  3RIR A;  3RKW A;  1WNL A;  4YRT A;  1G5I A;  3W3S A;  4H02 A;  3NET A;  4P3N A;  5E3I A;  4H2V A;  1BIB A;  12AS A;  3QO8 A;  4TVY A;  2EJ9 A;  4E51 A;  2QHS A;  4DQ2 A;  4YPF A;  2XGT A;  4G84 A;  1NJ6 A;  2I4M A;  2QHU A;  3L1A A;  4UPA A;  3PCO B;  2EAY A;  3MF2 A;  2J3L A;  3HFV A;  1X56 A;  2E3C A;  4XTX A;  1IL2 A;  2ZT6 A;  2PME A;  4RQF A;  3RF1 A;  1JJC B;  2ARU A;  1NJ8 A;  1N9W A;  1NYQ A;  1HTT A;  4HWT A;  3RKY A;  3HY0 A;  4LNS A;  11AS A;  1B70 A;  1BIA A;  4H2X A;  4P71 A;  4XTV A;  3TEH A;  4TVA A;  1USY A;  2DVE A;  4HWR A;  4HVC A;  5K1P A;  4YRR A;  3A7A A;  2C8M A;  4YRP A;  3QO7 A;  4G85 A;  1J5W A;  2DU7 A;  3RKX A;  4YRM A;  3V7S A;  3MF1 A;  2EL9 A;  1ASZ A;  1WYD A;  4OP0 A;  1E1T A;  3UFG A;  2RHQ A;  2ALY A;  1H4T A;  1PYS A;  3L4G A;  1SES A;  3REU A;  4CH6 A;  2ZCE A;  1WQ7 A;  3RGL A;  2J3M A;  3IKL A;  4Q6G A;  1B7Y A;  2ZNI A;  4EO4 A;  2DXT A;  4YRC A;  3MEY A;  4TQD A;  5C52 B;  3HXW A;  1GGM A;  2Q7E A;  4K86 A;  1Z7N A;  2CGH A;  2Q5I A;  3HFZ A;  2ZZE A;  3E9I A;  4O2D A;  1H4V B;  2E65 A;  3M4P A;  4TQF A;  2AMC B;  3A31 A;  1H4Q A;  4P75 C;  4TVW A;  1B70 B;  2ZR3 A;  1BBU A;  2DJZ A;  3REX A;  2ODR D;  4KR2 A;  2I4O A;  3V8K A;  4XEO A;  3V7C A;  1BBW A;  4TVA B;  2Q7H A;  1NYR A;  5ELO A;  2E5A A;  1HC7 A;  3A5Z A;  2ZR2 A;  1NNH A;  3A32 A;  3LSQ A;  2I4N A;  2Q5H A;  2AMC A;  1WPY A;  1W66 A;  3VQV A;  3DSQ A;  4TTV A;  4ZTU B;  2ZTG A;  2E64 A;  3HRK A;  4CH5 A;  4XTY A;  1X2H A;  4YRI A;  2G4C A;  3HXX A;  3BFM A;  4XU2 A;  1B7Y B;  1H4S A;  4PG3 A;  5F5W A;  2DQ0 A;  1YGB A;  4H2U A;  2ZXF A;  3BJU A;  2RHQ B;  3A7R A;  2ZT7 A;  3IKM B;  1RIQ A;  1KMM A;  2EJF A;  3P8V A;  4HWP A;  3HXZ A;  3V7R A;  2I4L A;  1LYL A;  4YRF A;  2ZIM A;  4HA8 A;  4YRK A;  1Z7M A;  4YCV A;  1X55 A;  3L4G B;  1ASY A;  4CS3 A;  5C51 B;  3I7F A;  3VQY A;  4NCX A;  4DPG A;  3KFU A;  4YRQ A;  1EVL A;  3RUX A;  4UP8 A;  4X5O A;  3QO5 A;  1ATI A;  4YP0 A;  4CH4 A;  3FJP A;  2CIM A;  3ERR A;  4ZTZ B;  4YCW A;  4P74 A;  2DZC A;  3ICA A;  2IY5 A;  2ZIO A;  2FYK A;  1YFS A;  3P8Y A;  1YB3 A;  1KMN A;  1EVK A;  1ADJ A;  2HNI A;  1SRY A;  4K87 A;  5HGQ A;  2EWN A;  3RL6 A;  2ZZG A;  3HXU A;  3VQX A;  4J15 A;  3V8J A;  4YRS A;  2ART A;  1C0A A;  1HXD A;  2ARS A;  2ZT5 A;  3EFS A;  2DDZ A;  4UP9 A;  2P0L A;  4YRJ A;  5KNN A;  4XU0 A;  1L0W A;  2ZT8 A;  4YCU A;  4WI1 A;  3NEM A;  4UP7 A;  1WLE A;  3A74 A;  4YYE A;  4WJ4 A;  1USY C;  3QTC A;  2DZ9 A;  3CMQ A;  3HFZ B;  4RQE A;  4BW9 A;  3HRI A;  2DKG A;  2AKW B;  4XTW A;  4P73 A;  1ADY A;  2EJG A;  4YRO A;  4H2Y A;  1X01 A;  4K88 A;  1KOG A;  2P5I A;  1JJC A;  2DQ3 A;  2ZIN A;  4Q15 A;  1QE0 A;  1FYF A;  4P72 C;  2ZGW A;  4H2W A;  5ELN A;  1WQW A;  1NJ5 A;  3TUP A;  4P73 C;  1EIY A;  2C7I A;  1EIY B;  4TWA A;  1E22 A;  4HWO A;  3A7U A;  4KQE A;  1VQZ A;  2XTI A;  2AKW A;  1YFT A;  2ALY B;  3UH0 A;  1E24 A;  1EFW A;  4AH6 A;  4CS2 A;  1YFR A;  4KR3 A;  4WF2 A;  4P74 C;  4OLF A;  1X2G A;  4YRG A;  2DU5 A;  3HXV A;  2ZZF A;  4P71 C;  4YDQ A;  4XU1 A;  2CJA A;  4RMF A;  1G51 A;  4XTU A;  3A5Y A;  2PMF A;  3QNE A;  4L87 A;  2E1H A;  3OD1 A;  4P72 A;  1QF6 A;  4H2X B;  2DTI A;  1EOV A;  1X54 A;  4P75 A;  3E9H A;  3LC0 A;  1B76 A;  3UGQ A;  3PCO A;  3R07 A;  3RAC A;  2DTH A; 
#chains in the Genus database with same CATH topology
 2XZE A;  1T8B A;  2VQE T;  4HFE A;  2E41 A;  5DQV A;  4ZIB A;  3ZC1 A;  3ZPO A;  3FZF B;  3TLV A;  5AQL B;  2D2S A;  5KDM C;  3NRX A;  1WU7 A;  3ONJ A;  2WU5 A;  2NS6 A;  5HEO A;  2ES0 A;  5FKY A;  3RLF F;  3HXY A;  1G5H A;  2JJ9 A;  2DCF A;  3OVU A;  4YTN A;  5JR9 C;  3JC6 D;  4KI0 F;  3UGT A;  5JDF A;  3V8L A;  3P4P A;  3VU7 H;  2UU9 T;  3ZLI A;  4CS4 A;  1BR0 A;  4HWS A;  4TWD A;  5LG4 A;  5AQG B;  2XQ9 A;  2CLY C;  4C90 A;  1XMQ T;  3RIF A;  3UT5 E;  2FJB A;  3EDU A;  1E1O A;  3SOL A;  3TEG A;  2Y6X A;  1NAF A;  1E1H B;  4JI5 T;  4UVA B;  5FXZ A;  4JBW F;  4AIS A;  2KXP B;  4DR6 T;  2AE9 A;  3RIR A;  5C3J A;  1WNL A;  1G5I A;  3ZN0 B;  5ABE A;  3NET A;  4ZI2 D;  2NW9 A;  1NEN A;  2WM9 A;  3AE6 A;  3RIU C;  2QGS A;  4DQ2 A;  5DQW A;  3UUX B;  4LML A;  3ZCJ A;  4J2C A;  2CHO A;  3AEG A;  4EEB A;  2I4M A;  3QOF A;  3RYI E;  4QX7 B;  4A56 A;  4DBR A;  3CKD A;  2YU1 A;  4O4I E;  1HNZ T;  2VWA A;  4B3R T;  1IL2 A;  2ZT6 A;  3K8P C;  4RQF A;  1JJC B;  3ESL A;  4DV5 T;  1YXR A;  2EHO D;  3PUZ F;  3PDY A;  5CFB A;  1N9W A;  3EDV A;  4UEM A;  2V7I A;  3RKY A;  4TNW A;  1G73 A;  1IZN B;  4CQI A;  4TX5 A;  1B70 A;  5LA6 E;  4HWD A;  3ZC0 A;  4GYS A;  3PJA J;  3AAA B;  3TLS A;  2DVE A;  4HWR A;  3LSV A;  3CX6 B;  4YRR A;  1GQE A;  3QO7 A;  4G85 A;  3DP7 A;  1J5W A;  3RKX A;  2NW8 A;  2LOS A;  1MIY A;  2JQK A;  3BQK A;  4OP0 A;  2VKD A;  1FIO A;  3VRA A;  4JEH B;  1KNZ A;  3PTR B;  4ZI3 D;  2C5K T;  2F4V T;  4KHP T;  3RGL A;  1B7Y A;  5JH7 E;  2D0U A;  3CQX C;  4EGW A;  2H7O A;  5L3D B;  4DID B;  4HFD A;  4I4T E;  4HTE A;  1D1A A;  4V1A v;  3HXW A;  3HKD E;  1WYB A;  2CEA A;  3CX7 B;  3AA1 B;  1H4Q A;  2CRB A;  2JRK A;  5E0O A;  1XZY A;  3Q5X A;  1XDO A;  2XQ4 A;  3AE8 A;  2E9X A;  2XM2 A;  1BBU A;  4QKN A;  2ODR D;  4KR2 A;  2OV9 A;  3RKO A;  3CQC B;  2Q7H A;  2DNX A;  2DI4 A;  2V6X A;  2E5A A;  1IJ5 A;  2ZR2 A;  4X66 T;  3GN5 B;  2J4G A;  3A8Y C;  3AE5 A;  3ZMU B;  2WMN A;  3UU5 A;  2AMC A;  3CQG B;  4B6X A;  2V8S V;  3E22 E;  4HWH A;  4O2B E;  2W00 A;  1WRD A;  4ZS2 A;  2ZTG A;  1JNZ A;  2R6G F;  3UU6 A;  2LOP A;  2BVM A;  4IE7 A;  5C8Y E;  2KZ7 B;  1X2H A;  2IML A;  2G4C A;  3PV0 F;  4K0U A;  3O9X A;  2BG9 B;  2IC9 A;  5LGN B;  5JDQ A;  2WU2 A;  5EK2 A;  3BK9 A;  3F57 A;  1E2A A;  1RIQ A;  4YLH A;  1R8I A;  2LHR A;  1W09 A;  5LJM A;  2KIN B;  5JR9 A;  4NUV A;  5FY7 A;  5JDH A;  2XUE A;  5L3G B;  2NR4 A;  4HA8 A;  3L39 A;  3L4G B;  2X67 A;  3N9Q A;  3AEB A;  4F6R C;  1CUN A;  4NCX A;  3AEA A;  1MIV A;  2WZH A;  4YRQ A;  2JQ9 A;  3QUJ A;  4WYV A;  1HCI A;  3RUX A;  5JVD E;  1QLB A;  3ZMS B;  1BR1 A;  2N9D A;  5FY1 A;  1MIW A;  3SFD A;  4LF5 T;  4CI1 B;  3UFE A;  3FJP A;  2V7J A;  3RC3 A;  2CIM A;  1D0X A;  2VUR A;  2XM1 A;  2YEV C;  1WFD A;  1AJ3 A;  2BG9 E;  4TV9 E;  5LJN A;  1EVK A;  4EED A;  4LF4 T;  4X1K E;  3F2E A;  2XQ5 A;  4WW0 A;  2EWN A;  3C4X A;  1LVK A;  3H3A A;  3HXU A;  3ETU A;  1T7S A;  4HFC A;  4XAX B;  4ASK A;  3V8J A;  4GIW A;  4YRS A;  5HEG A;  5EK4 A;  3Q5D A;  4HT4 A;  1HXD A;  2ZMA A;  3ABV A;  2IIU A;  4TWH A;  2BS3 A;  4AKL A;  1KFY A;  3C50 A;  2ARS A;  3IA3 A;  3EI0 A;  3AE2 A;  2PBI A;  4H63 H;  3KFW X;  4LFB T;  1HFA A;  2CHN A;  2P0L A;  3ETV A;  4HFI A;  4MBQ A;  3OYX A;  1MMG A;  2ZT8 A;  4YCU A;  4WI1 A;  3NEM A;  1HX1 B;  4UP7 A;  1W0A A;  1WLE A;  4YYE A;  4WJ4 A;  2HHH T;  2UUB T;  3QTC A;  2XJ7 A;  2ACZ A;  4PFP A;  2DWK A;  2V6Y A;  4LFC T;  2WCA A;  2DKG A;  4CN1 A;  3P50 A;  4H9S E;  3FXE B;  4IGU A;  2H89 A;  4X5T A;  2UXD T;  1UX4 A;  3SRZ A;  1ZOY A;  4COF A;  2Y48 B;  4ILC A;  5M4Y A;  5HWX A;  3HKB E;  3ZST A;  2ZIN A;  4P72 C;  3KBT A;  2XAH B;  2P9B A;  4ILA A;  4H2W A;  3H3M A;  5ELN A;  1WQW A;  2XSB A;  3ZMV B;  3GWH A;  1EIY B;  4TWA A;  1E22 A;  3RRC A;  2E9X D;  4HWO A;  2A8E A;  4AQF A;  3H37 A;  4L5G A;  3NZP A;  3N5L A;  5HXS A;  4NPP A;  4CS2 A;  2VAS A;  4M1P A;  4OHF A;  4WF2 A;  3P7I A;  4ZEY A;  4DV4 T;  1ZEE A;  4YXD A;  4IRE A;  4P71 C;  3WI3 A;  3PUY F;  2ACX A;  4PAG A;  5FNV E;  2LKH A;  3QNE A;  5AQP B;  5ABG A;  3OBV E;  2E1H A;  3HKE E;  4O4H E;  2CWO A;  2BG9 C;  2WBL A;  4H2X B;  5L47 A;  2DTI A;  3FZH B;  4AXP A;  4QH4 A;  5AFU L;  3UU3 A;  2K5B B;  4HKA A;  3R07 A;  2XHE B;  4IDP A;  3JAF A;  4PK4 A;  4H2T A;  2C5J A;  3Q5W A;  2BBJ A;  3HY1 A;  3AVS A;  4JLE A;  1O3X A;  2HPL A;  4I0U A;  1SET A;  2QHV A;  4LVI A;  2BZB A;  4U31 A;  2DLR A;  1PYS B;  4XEM A;  3NEN A;  3G1Z A;  2MYS A;  2J47 A;  4YFS A;  4PJN A;  3UUN A;  2JQH A;  4P3P A;  2CM0 A;  2IY5 B;  2ZLY A;  1HNX T;  4UVB B;  2UXN B;  1XNR T;  2K3W A;  2VL0 A;  4H2S A;  2D5U A;  2E9X C;  2NTY A;  2CJ9 A;  2BKP A;  3IG2 A;  5BMV E;  1NJ1 A;  1V9D A;  5FVK A;  4GKK T;  4PHC A;  3Q9D A;  4CN6 A;  3Q2M A;  4WJ3 M;  3PU8 A;  2KND A;  3HTZ A;  4DR1 T;  2CJB A;  2E10 A;  5FVL A;  2WQY A;  2PFV A;  3PZC A;  2ODR C;  3IHR A;  3LSS A;  3N2O A;  3N2K E;  4DV7 T;  4JI7 T;  4X62 T;  4IE6 A;  2H3R A;  1BIB A;  4AIU A;  2EJ9 A;  3MZK B;  2QHS A;  4Z91 A;  5H6Q B;  5JTG A;  4JI6 T;  4PW8 A;  5IWA T;  4CN4 A;  4G84 A;  3L1A A;  5A1L A;  3NBX X;  2BDE A;  5L4E A;  4I55 E;  2EAY A;  2J3L A;  5LNK A;  3CWZ B;  3RQU A;  4YSY A;  1I94 T;  4MHC A;  2E3C A;  5HXH A;  3N9O A;  2Y8D A;  1NYQ A;  4O4L E;  1HTT A;  3HY0 A;  4PNI A;  11AS A;  1BIA A;  4H2X A;  1B7T A;  4P71 A;  2LEH A;  2LT3 A;  1USY A;  2CXD A;  3PUG A;  1MMA A;  2WSS V;  5F8P A;  4Z8X A;  3IF8 B;  1UGO A;  3VHL A;  2DU7 A;  3V7S A;  3MF1 A;  2EL9 A;  2A9U A;  5HEU A;  4I43 B;  2WDR A;  3L4G A;  1SES A;  3REU A;  2IDO B;  1WR6 A;  3AA0 B;  2LSK A;  3IKL A;  4IIJ E;  5AQK B;  4HGA A;  4YRC A;  3E0Z A;  3MEY A;  4TQD A;  5C52 B;  5AQI B;  1D1B A;  4HWC A;  1GGM A;  2Q7E A;  1Z7N A;  2NP9 A;  3HFZ A;  3E9I A;  3LBX B;  1DU2 A;  2LM2 A;  2LRL A;  3M4P A;  2AMC B;  1KNP A;  4EZ4 A;  2Q9Q D;  2W63 A;  2DJZ A;  2I4O A;  3K1S A;  4TVA B;  3ZMZ B;  5ELO A;  3AE4 A;  2V5C A;  3N9N A;  2W66 A;  5CA1 E;  4DR2 T;  3A32 A;  5HEJ A;  4UV8 B;  1KF6 A;  2YN6 A;  4TTV A;  2WDQ A;  2E64 A;  3HRK A;  3FZM B;  1MNE A;  2PJQ A;  1Z0P A;  4DR4 T;  3VR9 A;  1LVF A;  2KLQ A;  3PUQ A;  2WB5 A;  1B7Y B;  3RQW A;  1H4S A;  3A5X A;  1NWM X;  4PG3 A;  5F5W A;  3UUB A;  2V5D A;  4EAH A;  5AQO B;  4YTP A;  1SE7 A;  1YGB A;  2ZXF A;  4MFR A;  3A7R A;  3IKM B;  2VKJ A;  1YKH B;  3ZT6 A;  3P8V A;  4NUU A;  3V7R A;  3RPU A;  5FXV A;  2BBH A;  2RPA A;  4AKG A;  2ZIM A;  3RYF E;  3NRY A;  4GOU A;  4YCV A;  1YD8 G;  1ASY A;  2WS3 A;  2H7V C;  2CMR A;  3BQI A;  4U7Y A;  1YKE B;  4QXH B;  3I7F A;  5AQJ B;  5EZY E;  3S4U A;  3V5S A;  1EVL A;  3SS1 A;  3HA4 A;  3AEF A;  4UP8 A;  4HN9 A;  2UXC T;  3QB5 K;  5LBQ B;  4OK0 A;  1Y64 B;  4BJM A;  2W0G A;  5ABF A;  4CH4 A;  4ZTZ B;  4YCW A;  2X9H A;  3C64 A;  3ZT7 A;  1KEY A;  3P8Y A;  3I9Y A;  1YB3 A;  1SA0 E;  2HNI A;  1SRY A;  2VKO A;  3PUA A;  4ZS3 A;  4G63 A;  5HGQ A;  2MAW A;  5L3F B;  3VR8 A;  5KX5 E;  2DWG A;  4E7S A;  3NKZ A;  3QB5 A;  2ART A;  1BR2 A;  2ZT5 A;  5AQN B;  3EFS A;  4PK6 A;  4YTM A;  4QXB B;  3EHZ A;  4JI8 T;  4WBN E;  2BKO A;  1U5P A;  4LVJ A;  3C51 A;  1X79 A;  1WR0 A;  3HR0 A;  4TV8 E;  3RC8 A;  2YDR A;  3HRI A;  2AKW B;  2E5L T;  4XTW A;  4EV6 A;  4YRO A;  3CPZ A;  4DR5 T;  1KOG A;  5AQF B;  3I1A A;  4Q15 A;  1QE0 A;  4TUY E;  2ZGW A;  1MMD A;  1NJ5 A;  5LGT B;  2C7I A;  3AE9 A;  2E5V A;  2WP9 A;  4KQE A;  2JMK A;  2K48 A;  2AKW A;  2W61 A;  1E24 A;  4HE8 A;  4AKR B;  1IBK T;  1YFR A;  2A3D A;  3PUS A;  3VKH A;  3M3Z B;  1MMN A;  3W15 B;  4UV9 B;  4JEU B;  4QX8 B;  5LBM A;  2XQY A;  4YDQ A;  4XU1 A;  2LHN A;  2YDQ A;  4RMF A;  1G51 A;  1W0B A;  4TWF A;  2Q9Q C;  4L87 A;  3OD1 A;  3CX8 B;  4MLK A;  1EOV A;  3NWI A;  3RYH E;  4WNK A;  5CJ5 A;  2WAU A;  3MK7 C;  1L0V A;  4P75 A;  2V26 A;  1IJ6 A;  1S35 A;  2EHO A;  1EZ3 A;  2DTH A;  4CI3 B;  2JPF A;  3K3Q C;  3IAL A;  4P0B A;  4ZI2 C;  4HFH A;  4P3O A;  2BVL A;  4B3T T;  3OPC A;  3M4Q A;  3VBB A;  2A2F X;  1T98 A;  3L2Z A;  2H88 A;  2XQ6 A;  2CA5 A;  1E7P A;  3VQW A;  1N36 T;  1YQ3 A;  4YRN A;  5AQS B;  5ABF B;  3KDS E;  4ZZC A;  4RDX A;  5C53 B;  2RHS B;  4CH3 A;  2RHS A;  5FY0 A;  1XNQ T;  3EAM A;  3J9X 1;  2XAJ B;  3WQZ A;  1SER A;  5JDN A;  4XTZ A;  4HEA A;  1J5E T;  4YRL A;  1UUS A;  5HYA A;  1D0Y A;  4X1I E;  2DTO A;  3EFR A;  3SWH A;  3ONL C;  1B8A A;  4GYR A;  4ILB A;  4E7Z A;  2V7K A;  5K1X A;  2QHT A;  1NJ2 A;  3P8T A;  3NEL A;  3JAE A;  5LGU B;  3AE7 A;  2UUC T;  1NEK A;  1HF8 A;  1HTJ F;  3ZMT B;  4YRT A;  2CWY A;  2UUA T;  2K24 A;  3N9L A;  4DMV A;  4QWN B;  5HCM A;  3O1I A;  4H2V A;  2YK0 A;  2LM9 A;  5LOV E;  4TVY A;  2ZM8 A;  3ZYK A;  4E51 A;  4YSX A;  2G0U A;  2X66 A;  5CGM A;  1FMW A;  3X1D A;  3LG7 A;  1VCT A;  5AQV B;  4IDZ A;  1NJ6 A;  2QHU A;  3UUL A;  4UPA A;  3I0O A;  3PCO B;  4KBM B;  3MF2 A;  3HFV A;  2HH7 A;  1X56 A;  2XPK A;  4LMJ A;  2PME A;  3RX6 A;  3CML A;  4OFZ A;  1NJ8 A;  2M67 A;  4LVK A;  4O2A E;  2XQ7 A;  2CCQ A;  2IC6 A;  5L3B B;  4OYK A;  4F8H A;  4EIW A;  2N2N A;  3TEH A;  2X0L B;  2L9Q A;  1UCU A;  4I50 E;  5LXT E;  4X20 E;  3T1Y T;  4EYY R;  5K1P A;  1FJG T;  2IUB A;  3O1J A;  4EZH A;  2LRK A;  4AQG A;  4DV1 T;  3T1H T;  1WYD A;  3UFG A;  3P4W A;  2IAK A;  3BQL A;  2RHQ A;  2VQF T;  1PYS A;  4CH6 A;  4ADZ A;  5IUX A;  4U33 A;  4CXX A;  3RIA A;  2ZCE A;  4Q6G A;  2CBI A;  2PG8 A;  4QH1 A;  1YW0 A;  4AI6 A;  4GK0 E;  1XMO T;  1VCS A;  1FEW A;  3P8C D;  3JAD A;  3DJB A;  4K86 A;  1WLX A;  3ZYL A;  2J62 A;  2CGH A;  2Q5I A;  2ZZE A;  4O2D A;  3AEE A;  1H4V B;  1Y01 A;  5HEH A;  2E65 A;  1SHZ C;  3A31 A;  3EUH A;  2MOZ A;  5JDM A;  4P75 C;  5HCJ A;  4TVW A;  2WWU A;  4YY3 T;  4YHJ A;  3RKG A;  3IBP A;  2ZR3 A;  3REX A;  1CHU A;  2N1G A;  3V8K A;  5CA0 E;  4XEO A;  2I6H A;  4AKH A;  1BBW A;  1NYR A;  3LK2 B;  3P4Q A;  4IL9 A;  3ZN1 B;  5AQH B;  1NNH A;  3LSQ A;  2I4N A;  2Q5H A;  4EOZ B;  3C4Z A;  1W66 A;  3DSQ A;  3LDQ B;  4EB6 E;  4DVD A;  4HWF A;  2QA7 A;  2VL8 A;  4CH5 A;  2M6B A;  2JMH A;  5FYM A;  5EK3 A;  4IT4 A;  2HN1 A;  4H9N C;  4LF7 T;  2XY8 B;  4YRI A;  3K3O A;  4XU2 A;  3RH3 A;  3ZSS A;  1WCR A;  5H6R B;  3P4R A;  4X64 T;  2V7L A;  5LHG B;  3R6N A;  4O4J E;  4H2U A;  3BJU A;  3B13 A;  2ZT7 A;  3C4W A;  3G06 A;  2X9X A;  5LHI B;  3D0T A;  3AEC A;  4EXT A;  3FBZ A;  4LF8 T;  2I4L A;  4IE0 A;  2M6I A;  3AVR A;  4YRK A;  4UVC B;  1ZV4 X;  1IBL T;  3UUM A;  1OWA A;  4KUM B;  5C51 B;  3FZL B;  4UIG A;  3VQY A;  3E08 A;  4GK5 E;  4DPG A;  5LCY A;  4AKI A;  3GN5 A;  4CZZ B;  1OED A;  2YDS A;  2W2U A;  2NW7 A;  3KV4 A;  2V6Y B;  3QO5 A;  2LSJ A;  4H9P C;  3LBX A;  1ATI A;  1OED B;  3ZCI A;  2E9X B;  3ZEF B;  2UXX B;  4P74 A;  4A98 A;  2HPJ A;  2XQ8 A;  3ICA A;  2ZIO A;  1YFS A;  3F31 A;  1ADJ A;  4BAY B;  5LYJ E;  3O4X E;  4QH5 A;  2XSA A;  2KWI B;  1J1J A;  3JCF A;  3MJX A;  2JQQ A;  4DR7 T;  4J15 A;  4EYU A;  3PUX F;  3CIR A;  4DV6 T;  2RP4 A;  1C0A A;  4DMW A;  4ANJ A;  4L9I A;  4QHO A;  2DHR A;  2WDV A;  4UXN B;  4UP9 A;  3N2G E;  3N9P A;  4YRJ A;  4XU0 A;  4LF6 T;  3CVR A;  2WZI A;  3QK6 A;  4QXC B;  1LKX A;  4PJM A;  1LRZ A;  3HL6 A;  3A74 A;  3PU3 A;  1UX5 A;  2ODU A;  2RA1 A;  2NTX A;  2DZ9 A;  4MAL A;  3UQ7 A;  5LMN T;  3TKL B;  4N78 D;  3CMQ A;  3KVA A;  4GKJ T;  4ZXL A;  4UF0 A;  3ZYM A;  2MBG A;  4BW9 A;  4OX9 T;  3T8O A;  4P73 A;  1ADY A;  2X0Y A;  2DL1 A;  2I0M A;  5KXJ A;  4DV2 T;  1OED C;  4H2Y A;  1Z8U A;  4PK5 A;  1X01 A;  4JUY A;  4IDN A;  2YIN A;  3NVO A;  4ZHQ E;  1JJC A;  3NZQ A;  1FYF A;  5L3C B;  1KK7 A;  1VRB A;  3AA6 B;  3KBU A;  2QRX A;  2XAG B;  4JI0 T;  4H9Q C;  3U78 A;  5JR9 B;  3A7U A;  2V1D B;  1D0Z A;  3RYC E;  3UTK A;  2ALY B;  3UH0 A;  3TLW A;  5HXR A;  4LF9 T;  2CE7 A;  3HI2 A;  4AH6 A;  3KV5 A;  3RRW A;  3L09 A;  5AQT B;  5FXX A;  4OLF A;  4YRG A;  3HXV A;  2QVA A;  2W62 A;  3RI5 A;  1HNW T;  2GK9 A;  1N33 T;  2CJA A;  4UEL A;  2EHO C;  3AAI A;  2PMF A;  2CPT A;  4BJN A;  2YOE A;  3ZJ2 A;  4P72 A;  5HAX A;  1S94 A;  4K0K T;  4ISS A;  1YQ4 A;  4C91 A;  5C2T A;  2Z6E A;  5IHY A;  3B5M A;  1X54 A;  3J7Y q;  3PUR A;  2X0H A;  4B3M T;  2CXL A;  4CXW A;  4IDQ A;  3UGQ A;  4WZX A;  4AQF C;  3PCO A;  3U3I A;  3RAC A;  3AA7 B;  3TEH B;  1ZHC A;  3WAK A;  1VOM A;  2DEQ A;  2BS2 A;  4H9O C;  3PUW F;  2FUP A;  4BWA A;  4HWI B;  3I9W A;  2DXU A;  3FXD B;  3AAE B;  2Q7G A;  3IEE A;  4JI1 T;  1EQR A;  4DND A;  3ZKR A;  1D1C A;  3GMI A;  2XAS B;  4XU3 A;  4EX5 A;  4P09 A;  3ZJ1 A;  4ERR A;  4YRE A;  5BR8 T;  2WMO A;  4U2Y A;  4WBO A;  2X9Y A;  1M62 A;  3KV9 A;  4KMC A;  3A7M A;  4PJL A;  3N9M A;  5AQU B;  3K3N A;  4ZOL E;  3LJC A;  2QYW A;  4TN7 B;  2ZNJ A;  1I6Z A;  2X51 A;  3RKW A;  4KX6 A;  3HKC E;  3AXJ A;  3DTO A;  4B3S T;  3W3S A;  4H02 A;  4P3N A;  4FJO A;  4FI5 A;  5E3I A;  12AS A;  3QO8 A;  2L8K A;  4PJJ A;  2XTL A;  4YPF A;  2XGT A;  3KVB A;  3AE3 A;  4U7I A;  2OLT A;  1N34 T;  4YHH T;  2PTF A;  3PE0 A;  3LK3 B;  4KP3 C;  4JYA T;  4JI2 T;  1FMV A;  2VK9 A;  5L4H A;  4H9R C;  4XTX A;  3ZT5 A;  5FXW A;  1M7K A;  2NOX A;  2XQ3 A;  3RF1 A;  2ARU A;  5FL1 A;  1UUR A;  2LSI A;  4XZC A;  2LJL A;  4HWT A;  5JRC A;  3OJA A;  4LNS A;  4XTV A;  4TZ4 C;  5ABH A;  4TVA A;  3L8R A;  4CXY A;  4LVL A;  4NIQ A;  3UU8 A;  4HVC A;  2IW5 B;  3CK6 A;  1T72 A;  3A7A A;  2C8M A;  3ANW A;  2YKS A;  4YRP A;  5LP6 E;  2JIW A;  5KMG P;  3R84 B;  4YRM A;  5ADX L;  2CXF A;  3M65 A;  4A5X A;  1ASZ A;  1E1T A;  4PFO A;  3TLT A;  2ALY A;  1H4T A;  5ETW A;  4P1N A;  2LE8 A;  1WQ7 A;  2J3M A;  3OYZ A;  3MAC A;  2ZNI A;  4EO4 A;  3UQ4 A;  5J1G A;  2DXT A;  2LKG A;  1SUM B;  2ZM0 A;  2B1E A;  4O8S A;  2UXB T;  5AQR B;  1UK5 A;  4IHJ E;  4JI4 T;  1BR4 A;  4TQF A;  4XBF B;  1U4Q A;  3MA9 A;  3KIN B;  4YJ2 E;  4NXM T;  1QUU A;  1B70 B;  4DR3 T;  5LB7 B;  1W9R A;  4YJ3 E;  4OYJ A;  4YT0 A;  5TAO A;  3V7C A;  2BS4 A;  3EVY A;  3VRB A;  2E8I A;  5J2U E;  3ANW B;  4CI2 B;  1HC7 A;  3A5Z A;  2X9W A;  2NWB A;  4DV0 T;  3FZK B;  1WPY A;  3VQV A;  2CBJ A;  5JRE A;  4U72 A;  4ZTU B;  5FMN A;  2W67 A;  3LK4 2;  5J2T E;  4XTY A;  5JRC B;  3FB2 A;  2D0T A;  5HXC A;  3QC9 A;  2FJE A;  3UU4 A;  2ZM2 A;  2KT9 A;  3HXX A;  3BFM A;  2CLY B;  4DUZ T;  3RIU A;  4IST A;  1IBM T;  2XAF B;  1KNR A;  1HR0 T;  2DQ0 A;  2E2A A;  3TLU A;  5GON E;  3SFE A;  5FL0 A;  5LMU T;  2RHQ B;  2MTQ A;  2FJA A;  1KMM A;  2EJF A;  3OTO T;  4HWP A;  3HXZ A;  4KHZ F;  2SPC A;  1LYL A;  5JQG E;  4YRF A;  4A97 A;  1Z7M A;  2XQA A;  1ZKE A;  1X55 A;  4ZI7 E;  2HN2 A;  1HX8 A;  4CS3 A;  3ONX A;  2BG9 A;  2LSG A;  4HFB A;  4ILU A;  4U2Z A;  4DO0 A;  3KFU A;  5JDL A;  4UR9 A;  4X5O A;  2I59 A;  3QNU A;  1ZP0 A;  4YP0 A;  4P0A A;  3EAB A;  3FHN A;  3ERR A;  3O1H A;  2B76 A;  4NXN T;  2DZC A;  4G2A A;  5F3J A;  2IY5 A;  5IYZ E;  2Q9Q A;  5CB4 E;  5AQQ B;  2FYK A;  4JV5 T;  2WY2 A;  3AE1 A;  5FP3 A;  1JNR A;  2IHR 1;  1KMN A;  1WYC A;  3KV6 A;  4DBQ A;  4K87 A;  2AXD S;  4LVM A;  3RL6 A;  3PJA A;  2ZZG A;  4BA9 A;  3VQX A;  4JI3 T;  3RHW A;  3FBL A;  3V5U A;  3WAJ A;  2WWV A;  4ZZB A;  2KSR A;  4IDO A;  2ODV A;  2VVN A;  4LMK A;  5AQM B;  1MND A;  2DDZ A;  5KNN A;  3JC6 C;  4U3C A;  4DV3 T;  2Q9Q B;  2LLY A;  1L0W A;  5HXE A;  1XWM A;  2KMF A;  1G8X A;  2OA5 A;  2J1D G;  1HG5 A;  5DJQ C;  1HG2 A;  3PUV F;  4X1Y E;  2W4X A;  4IL4 A;  1USY C;  4ZI3 C;  4U74 A;  1N32 T;  1XDP A;  2K9A A;  3HFZ B;  2LSY A;  4DUY T;  2A72 A;  4RQE A;  5JDG A;  1OED E;  4IE5 A;  2MPK A;  2EJG A;  5L3E B;  4K88 A;  3MXZ A;  1H7C A;  2P5I A;  2DQ3 A;  3Q5E A;  2BKN A;  3LFM A;  4X65 T;  1HS7 A;  4LFA T;  3TUP A;  5HWY A;  3I0Q A;  4P73 C;  1EIY A;  4Z90 A;  2FBW A;  2ZM6 T;  1X9B A;  5J0Z A;  3B57 A;  1VQZ A;  2XTI A;  2L3L A;  4H63 V;  2YU2 A;  1YFT A;  2EHO B;  1EFW A;  3MQZ A;  1QSD A;  5L2L A;  2XAQ B;  5LG3 A;  2X68 A;  1OXZ A;  4Q25 A;  5DAB A;  4KR3 A;  3OKQ A;  1IAP A;  4P74 C;  3MKD A;  1X2G A;  2C0S A;  2DU5 A;  4HFV A;  3GA8 A;  2FJD A;  3C98 B;  2VKH A;  2ZZF A;  4AQY T;  3AXJ B;  3P4S A;  3AB3 B;  4XTU A;  3A5Y A;  3VKG A;  4TNV A;  3L3P A;  2D9D A;  3AED A;  1QF6 A;  5LHH B;  2VB6 A;  4YSZ A;  4UF0 B;  4L0R A;  2KWH A;  3E9H A;  3LC0 A;  1US7 B;  1B76 A;  2VVS A;  2V7M A;  4IE4 A;  2C5I T; 
#chains in the Genus database with same CATH homology
 3TEH B;  4H2T A;  2DEQ A;  3HY1 A;  2E41 A;  3IAL A;  4ZIB A;  4P3O A;  4BWA A;  1SET A;  2QHV A;  3M4Q A;  3VBB A;  4LVI A;  3L2Z A;  2DXU A;  1WU7 A;  3VQW A;  2NS6 A;  2Q7G A;  4XEM A;  1PYS B;  4YRN A;  3NEN A;  3G1Z A;  3HXY A;  1EQR A;  1G5H A;  4RDX A;  5C53 B;  4P3P A;  2IY5 B;  2RHS B;  4CH3 A;  2RHS A;  3UGT A;  4XU3 A;  4EX5 A;  3V8L A;  3WQZ A;  1SER A;  4H2S A;  4YRE A;  4XTZ A;  2CJ9 A;  4YRL A;  4CS4 A;  4HWS A;  2DTO A;  3EFR A;  3IG2 A;  1B8A A;  1NJ1 A;  4PHC A;  1E1O A;  5K1X A;  2QHT A;  4WJ3 M;  3TEG A;  1NJ2 A;  3HTZ A;  3P8T A;  2CJB A;  3NEL A;  2E10 A;  2ZNJ A;  3PZC A;  2ODR C;  3LSS A;  3RIR A;  3RKW A;  1WNL A;  4YRT A;  1G5I A;  3W3S A;  4H02 A;  3NET A;  4P3N A;  5E3I A;  4H2V A;  1BIB A;  12AS A;  3QO8 A;  4TVY A;  2EJ9 A;  4E51 A;  2QHS A;  4DQ2 A;  4YPF A;  2XGT A;  4G84 A;  1NJ6 A;  2I4M A;  2QHU A;  3L1A A;  4UPA A;  3PCO B;  2EAY A;  3MF2 A;  2J3L A;  3HFV A;  1X56 A;  2E3C A;  4XTX A;  1IL2 A;  2ZT6 A;  2PME A;  4RQF A;  3RF1 A;  1JJC B;  2ARU A;  1NJ8 A;  4LVK A;  1N9W A;  1NYQ A;  1HTT A;  4HWT A;  3RKY A;  3HY0 A;  4LNS A;  11AS A;  1B70 A;  1BIA A;  4H2X A;  4P71 A;  4XTV A;  3TEH A;  4TVA A;  4LVL A;  1USY A;  2DVE A;  4HWR A;  4HVC A;  5K1P A;  4YRR A;  3A7A A;  2C8M A;  4YRP A;  3QO7 A;  4G85 A;  1J5W A;  2DU7 A;  3RKX A;  4YRM A;  3V7S A;  3MF1 A;  2EL9 A;  1ASZ A;  1WYD A;  4OP0 A;  1E1T A;  3UFG A;  2RHQ A;  2ALY A;  1H4T A;  1PYS A;  3L4G A;  1SES A;  3REU A;  4CH6 A;  2ZCE A;  1WQ7 A;  3RGL A;  2J3M A;  3IKL A;  4Q6G A;  1B7Y A;  2ZNI A;  4EO4 A;  2DXT A;  4YRC A;  3MEY A;  4TQD A;  5C52 B;  3HXW A;  1GGM A;  2Q7E A;  4K86 A;  1Z7N A;  2CGH A;  2Q5I A;  3HFZ A;  2ZZE A;  3E9I A;  4O2D A;  1H4V B;  2E65 A;  3M4P A;  4TQF A;  2AMC B;  3A31 A;  1H4Q A;  4P75 C;  4TVW A;  1B70 B;  2ZR3 A;  1BBU A;  2DJZ A;  3REX A;  2ODR D;  4KR2 A;  2I4O A;  3V8K A;  4XEO A;  3V7C A;  1BBW A;  4TVA B;  2Q7H A;  1NYR A;  5ELO A;  2E5A A;  1HC7 A;  3A5Z A;  2ZR2 A;  1NNH A;  3A32 A;  3LSQ A;  2I4N A;  2Q5H A;  2AMC A;  1WPY A;  1W66 A;  3VQV A;  3DSQ A;  4TTV A;  4ZTU B;  2ZTG A;  2E64 A;  3HRK A;  4CH5 A;  4XTY A;  1X2H A;  4YRI A;  2G4C A;  3HXX A;  3BFM A;  4XU2 A;  1B7Y B;  1H4S A;  4PG3 A;  5F5W A;  2DQ0 A;  1YGB A;  4H2U A;  2ZXF A;  3BJU A;  2RHQ B;  3A7R A;  2ZT7 A;  3IKM B;  1RIQ A;  1KMM A;  2EJF A;  3P8V A;  4HWP A;  3HXZ A;  3V7R A;  2I4L A;  1LYL A;  4YRF A;  2ZIM A;  4HA8 A;  4YRK A;  1Z7M A;  4YCV A;  1X55 A;  3L4G B;  1ASY A;  4CS3 A;  5C51 B;  3I7F A;  3VQY A;  4NCX A;  4DPG A;  3KFU A;  4YRQ A;  1EVL A;  3RUX A;  4UP8 A;  4X5O A;  3QO5 A;  1ATI A;  4YP0 A;  4CH4 A;  3FJP A;  2CIM A;  3ERR A;  4ZTZ B;  4YCW A;  4P74 A;  2DZC A;  3ICA A;  2IY5 A;  2ZIO A;  2FYK A;  1YFS A;  3P8Y A;  1YB3 A;  1KMN A;  1EVK A;  1ADJ A;  2HNI A;  1SRY A;  4K87 A;  5HGQ A;  4LVM A;  2EWN A;  3RL6 A;  2ZZG A;  3HXU A;  3VQX A;  4J15 A;  3V8J A;  4YRS A;  2ART A;  4HT4 A;  1C0A A;  1HXD A;  2ARS A;  2ZT5 A;  3EFS A;  2DDZ A;  4UP9 A;  2P0L A;  4YRJ A;  5KNN A;  4XU0 A;  1L0W A;  2ZT8 A;  4YCU A;  4WI1 A;  3NEM A;  4UP7 A;  1WLE A;  4LVJ A;  3A74 A;  4YYE A;  4WJ4 A;  1USY C;  3QTC A;  2DZ9 A;  3CMQ A;  3HFZ B;  4RQE A;  4BW9 A;  3HRI A;  2DKG A;  2AKW B;  4XTW A;  4P73 A;  1ADY A;  2EJG A;  4YRO A;  4H2Y A;  1X01 A;  4K88 A;  1KOG A;  2P5I A;  1JJC A;  2DQ3 A;  2ZIN A;  4Q15 A;  1QE0 A;  1FYF A;  4P72 C;  2ZGW A;  4H2W A;  5ELN A;  1WQW A;  1NJ5 A;  3TUP A;  4P73 C;  1EIY A;  2C7I A;  1EIY B;  4TWA A;  1E22 A;  4HWO A;  2A8E A;  3A7U A;  4KQE A;  1VQZ A;  2XTI A;  2AKW A;  1YFT A;  2ALY B;  3UH0 A;  1E24 A;  1EFW A;  3MQZ A;  4AH6 A;  4CS2 A;  1YFR A;  4KR3 A;  4WF2 A;  4P74 C;  4OLF A;  1X2G A;  4YRG A;  2DU5 A;  3HXV A;  2ZZF A;  4P71 C;  4YDQ A;  4XU1 A;  2CJA A;  4RMF A;  1G51 A;  4XTU A;  3A5Y A;  2PMF A;  3QNE A;  4L87 A;  2E1H A;  3OD1 A;  4P72 A;  1QF6 A;  4H2X B;  2DTI A;  1EOV A;  1X54 A;  4P75 A;  3E9H A;  3LC0 A;  1B76 A;  3UGQ A;  3PCO A;  3R07 A;  3RAC A;  2DTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...