5F5WA

Crystal structure of the alpha subunit of glycyl trna synthetase (glyrs) from aquifex aeolicus in complex with an analog of glycyl adenylate (gly-sa)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
283
structure length
283
Chain Sequence
MYFQDIIMTLHKFWAEKGCLIWQPYDVEVGAGTMNPATFLKVLGKKPWNVAYVEPSRRPQDGRYGENPNRLQHYYQFQVILKPAPRNPQEIYLESLERLGINPLEHDIRFVEDDWESPTLGAWGLGWEVWLDGMEITQFTYFQQAGGLDLDEISVEITYGLERIAMYIQDKDSVFDIEWKEGITYGEIFKRSEWEWSKYNFELADTDMLFQVYEMFEKESKRMVEEGLIFPAYDYLLKCSHVFNILDARGAISVQERARYIRRMNNLAREIAKLYLQVFENVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine--tRNA ligase alpha subunit
publication title Structural Insights into the Polyphyletic Origins of Glycyl tRNA Synthetases.
pubmed doi rcsb
source organism Aquifex aeolicus (strain vf5)
molecule tags Ligase
total genus 110
structure length 283
sequence length 283
chains with identical sequence B, C, D, E
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 5f5wA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5f5wA01
3RKXA 3ICAA 3IG2A 5ELOA 3KFUA 4YREA 3A7UA 4H2XA 5C52B 4DPGA 1E24A 1BBUA 1SESA 1SETA 1YFSA 2DKGA 4YDQA 3MEYA 4P72A 1YFRA 4HWOA 3RGLA 1NYQA 3LSSA 1GGMA 2IY5B 3NEMA 3WQZA 1N9WA 3HRIA 4P73C 1B70A 2DTOA 2DQ0A 4G84A 1X54A 2ZGWA 1X01A 3DSQA 4YRCA 3HXZA 1WLEA 4ZIBA 4XU2A 2P0LA 1B7YB 2FYKA 4Q15A 3RF1A 2ZR2A 2DTHA 4YRTA 1Z7MA 2ZTGA 3HXVA 2QHTA 4H02A 3BFMA 1USYC 1ATIA 2RHQB 3UH0A 1YFTA 3NENA 2ZT7A 3HXYA 2PMEA 4YRSA 4H2YA 2QHVA 1PYSA 3RL6A 3EFSA 3IALA 5C53B 4XEOA 2E41A 2DQ3A 3QTCA 2AMCA 1KMMA 2ZT8A 3HY1A 1H4SA 3QO7A 4P3NA 1NJ5A 1HC7A 4X5OA 2ZIMA 3V8JA 3QNEA 2C7IA 1EFWA 3L4GA 3IKMB 2DZCA 1SRYA 3TEHA 4XTXA 4OP0A 4YRRA 5K1XA 3V7CA 2CJBA 2AMCB 4XTYA 4P74C 4K86A 4XTUA 4RMFA 1EIYA 1ASYA 2QHSA 4KQEA 3A31A 2ZZGA 4H2WA 4XU0A 4HVCA 3VQYA 3NETA 1H4TA 4H2UA 3A7RA 2Q7EA 2ZIOA 1HTTA 4XTWA 4K87A 4HWRA 3L4GB 1NYRA 1B76A 2I4OA 4P75A 1BIBA 4TVWA 4OLFA 3TEHB 4YRQA 4RDXA 4RQEA 1NJ1A 4J15A 3QO5A 4O2DA 1HXDA 1EIYB 1B7YA 2ARUA 1W66A 4H2VA 3V7RA 1WQWA 2I4LA 3HY0A 1IL2A 4BW9A 4ZTUB 1KMNA 2DTIA 4XEMA 2I4NA 3CMQA 1NJ8A 2ARSA 2ZZEA 3W3SA 1QF6A 2RHSB 2RHQA 3G1ZA 4TVAA 3EFRA 1QE0A 3REUA 3LC0A 4DQ2A 3BJUA 3A5ZA 4YPFA 2ZCEA 4PHCA 3A32A 2XTIA 4LNSA 4TQFA 3HXWA 2E64A 2CGHA 1BBWA 4AH6A 4KR3A 4YRGA 4P71C 1YGBA 1Z7NA 2QHUA 4XTVA 2EJGA 2ZZFA 5ELNA 2CJ9A 2DXTA 1H4VB 1LYLA 3LSQA 1E1TA 2G4CA 4TVAB 2PMFA 4YRKA 4P3OA 4YRNA 4YYEA 1WPYA 3RKWA 2EAYA 2ODRD 5E3IA 1VQZA 2E3CA 4G85A 4PG3A 1ASZA 1EOVA 2ZT6A 2E5AA 3L1AA 2HNIA 4H2TA 2DVEA 4YRJA 1X2GA 1EVKA 3RACA 4KR2A 4EX5A 3R07A 4P72C 4YRLA 3A74A 4L87A 2J3LA 2ZNIA 4TTVA 2DJZA 4CH5A 3E9HA 3P8VA 2E10A 4HWPA 2DEQA 3M4QA 4P73A 4HWSA 2ALYB 4YCUA 3M4PA 3PZCA 1X55A 4YRPA 3NELA 3QO8A 4YROA 3MF2A 1G5IA 3UGTA 5F5WA 4YRIA 3UFGA 4TVYA 2RHSA 1EVLA 1WYDA 1WQ7A 3FJPA 1G5HA 4XU1A 5KNNA 1KOGA 1ADJA 2I4MA 2EJFA 4E51A 1H4QA 3MF1A 1USYA 3ERRA 3V8KA 3RKYA 3HTZA 4HWTA 3P8YA 4YCVA 1E1OA 2DU7A 4XTZA 1WU7A 2E65A 2ZT5A 1NNHA 2CIMA 3UGQA 2ZXFA 3I7FA 3HFZB 3TEGA 2C8MA 2J3MA 4WI1A 4RQFA 3PCOA 4CS4A 2P5IA 4TQDA 2AKWA 4UP9A 4WF2A 4YP0A 2ZINA 4CS3A 4ZTZB 2ODRC 2Q5HA 1B8AA 3OD1A 4BWAA 4WJ4A 4YRMA 3VQWA 1X2HA 4UP8A 4WJ3M 2EJ9A 1L0WA 4P74A 4NCXA 3HXUA 2Q7HA 4K88A 4P75C 3HXXA 4H2XB 2DDZA 12ASA 1NJ2A 2E1HA 2Q5IA 3PCOB 1EQRA 2AKWB 3RIRA 3VQXA 3RUXA 1JJCA 1WNLA 4HA8A 3IKLA 2EWNA 3E9IA 4CH4A 2ALYA 1J5WA 1B70B 2ZNJA 4EO4A 2ZR3A 4CS2A 4UP7A 2XGTA 3TUPA 5C51B 2EL9A 1X56A 3VQVA 11ASA 1YB3A 5HGQA 1JJCB 3A5YA 1BIAA 2Q7GA 3VBBA 1G51A 2DU5A 4XU3A 3HFVA 3HRKA 2DZ9A 4Q6GA 4H2SA 1PYSB 3A7AA 1ADYA 4YCWA 4P71A 4CH6A 4P3PA 1E22A 3P8TA 2CJAA 3HFZA 4UPAA 1NJ6A 2DXUA 3V7SA 3L2ZA 1C0AA 4YRFA 4CH3A 2IY5A 4TWAA 1SERA 3REXA 2ARTA 3V8LA 1RIQA 1FYFA 5K1PA
chains in the Genus database with same CATH superfamily
2CPTA 3FZHB 3JCFA 4OYJA 3K3QC 2CLYB 4H2XA 4DPGA 1BBUA 4EV6A 1SETA 4DV2T 2FJDA 4LFBT 1YFRA 2YK0A 3RGLA 3O1IA 3LSSA 3NEMA 2UU9T 4CN6A 1N9WA 5HXSA 2W61A 5LGUB 2DTOA 2Q9QA 2JJ9A 5EK3A 2UUAT 4P0BA 4QHOA 3RF1A 3P4QA 4QH4A 4H9SE 4DR6T 3OJAA 2XZEA 4YRTA 2RP4A 2KWHA 4EZ4A 2QHTA 4IL4A 5ABHA 4H02A 4BJMA 1HNWT 2X9HA 2RHQB 3O1HA 5LCYA 3OVUA 1ZEEA 2UXBT 5C53B 2LM9A 2BG9B 4CQIA 4EOZB 1CUNA 5J0ZA 4X62T 3KVAA 1KMMA 3UU8A 3MXZA 3QO7A 4KP3C 4EB6E 5LOVE 1R8IA 1N33T 3V8JA 1IBLT 4O4IE 2CWYA 1EFWA 5AQIB 4LF9T 1Y01A 2WU2A 3GN5A 2KLQA 3I9WA 4JI4T 3VRBA 3AEDA 4IE0A 2AMCB 3JAFA 5FNVE 3RYCE 4XTUA 3I0QA 4KQEA 4HVCA 3PV0F 3N2GE 4YLHA 4L0RA 4UELA 4H2UA 2MTQA 3A7RA 3F2EA 2CE7A 3AEGA 3LSVA 1NYRA 1B76A 4UIGA 2I4OA 1LVKA 3AE8A 5LHIB 3ETUA 3ZYKA 1ZOYA 2RA1A 3HKBE 4O2DA 3MKDA 4IE7A 4YTMA 3PUSA 4KHPT 1HXDA 2BDEA 5EK2A 4DV1T 5CA0E 2XSBA 4I0UA 2I4LA 4HWFA 4BW9A 4EXTA 4ZTUB 4XEMA 3AVRA 3UU5A 2I4NA 2A8EA 2VKDA 4GK5E 1US7B 3RLFF 3VKHA 2ARSA 2PJQA 1NENA 3W3SA 3EAMA 1QF6A 3G1ZA 4HGAA 2N9DA 4UVBB 2UUCT 3TKLB 3LC0A 4DQ2A 2BS4A 4IE6A 2BKOA 4YPFA 2X0YA 2ZCEA 4PHCA 3OBVE 2CGHA 2J62A 2MOZA 3IHRA 2L8KA 3HKDE 2XASB 3AAEB 4X64T 2V26A 3QB5A 4EIWA 3CQGB 3Q9DA 4B3ST 2EHOC 4LVKA 1LYLA 5FKYA 3Q2MA 1YXRA 4WYVA 3SFEA 5LA6E 5AQOB 1WYCA 2YINA 2EAYA 1VQZA 5HWXA 2V6YA 3PUYF 2C5JA 4AKRB 4G63A 2E3CA 4ZI7E 4PG3A 1ASZA 2IMLA 2IC9A 2E5AA 4IIJE 4TUYE 5HEJA 4LMLA 5JDQA 2BBJA 2DVEA 3T1HT 1EVKA 3RACA 4KR2A 2DL1A 4IE5A 1YD8G 4P72C 3A74A 2W4XA 1W09A 2J3LA 4TTVA 2DJZA 1H7CA 3AVSA 1YW0A 3P7IA 4CH5A 3I9YA 4LMJA 2XQ8A 3N9LA 4YSXA 3P4WA 2UXCT 3RIUC 1X79A 2BZBA 2E10A 4PNIA 4H9NC 5L3BB 3AAIA 2W2UA 1HCIA 5FYMA 4GKJT 4WW0A 3KVBA 4KI0F 3NELA 3NWIA 3UGTA 5F5WA 4OYKA 4UV9B 1WRDA 2CXFA 4NPPA 2BVMA 5FL0A 4TVYA 1WYDA 2I4MA 4HWDA 3P50A 4DR1T 1U4QA 1H4QA 4TNVA 1USYA 1V9DA 3ETVA 1N34T 4XAXB 5HEHA 4AIUA 5AQTB 3P8YA 4AKHA 4A97A 3GA8A 3LFMA 4XTZA 5DQVA 3EABA 1WU7A 3RYFE 1D0YA 5LP6E 3UGQA 2ZXFA 1MIWA 2CM0A 1Z8UA 3KV9A 4QKNA 2JRKA 4IL9A 3HFZB 1HS7A 3IF8B 1ZV4X 3P8CD 1KK7A 3SOLA 2ZINA 1HG2A 3C64A 4CN4A 3QNUA 3RC3A 2ODRC 5KDMC 1B8AA 3MACA 3LBXA 4BWAA 1WCRA 5HXRA 2CCQA 2NR4A 4WJ3M 2EJ9A 2DWKA 4GOUA 1E1HB 2H7OA 2MYSA 4NXMT 4K88A 5JDFA 4HE8A 5HXCA 2K24A 4DV0T 2Q5IA 3PCOB 1EQRA 2UXDT 2YEVC 3P4PA 3UU6A 4JI3T 2AKWB 3AA6B 3RIRA 2I0MA 4KMCA 2A2FX 4ZI3C 1YQ3A 3RUXA 1JJCA 3RQUA 4HA8A 4BJNA 2CXDA 2VQET 2CHOA 3FBZA 4AISA 3JC6D 2ZNJA 3ANWA 4FJOA 4CS2A 3E22E 1EZ3A 3N9QA 4UP7A 3FXEB 3VR8A 4DV4T 4B3TT 3AECA 2EL9A 1FEWA 1S35A 2FJAA 4YT0A 2UXXB 2KMFA 3RPUA 11ASA 4DMWA 1KNZA 2V7MA 1BIAA 1KNRA 2KWIB 5CA1E 4XU3A 4AQFA 4LF4T 3WI3A 3HRKA 2ZLYA 1D1CA 2DZ9A 1D0ZA 1LRZA 1N36T 3KDSE 3ZC1A 2W0GA 1PYSB 2DI4A 4HFDA 5JDMA 3NBXX 1ADYA 4KUMB 3BQIA 4P71A 1HFAA 2JMKA 3ZEFB 3CMLA 1T72A 3ZN1B 2XAGB 4EEDA 3G06A 2LOPA 3I0OA 4O8SA 4TWAA 1SERA 3LK3B 1RIQA 3QUJA 2XAFB 4LF5T 1FYFA 2NW8A 4TWDA 3Q5XA 1UURA 3ICAA 4PJMA 1WLXA 3GWHA 4JI1T 5ELOA 3CIRA 1SESA 1VRBA 2DKGA 2WU5A 4ZZBA 3MEYA 2E9XD 5H6QB 1AJ3A 2WP9A 5AQHB 2M67A 2QA7A 5AQGB 4ANJA 2VWAA 3HA4A 2NTYA 1IZNB 2YOEA 2LSJA 3AE6A 4U72A 1B70A 2F4VT 4IDNA 1XMQT 5ETWA 4G84A 2XQ3A 4IT4A 2XQ4A 4X65T 5DJQC 2P0LA 3RRWA 1B7YB 4Q15A 2B1EA 4DV7T 5CJ5A 4X5TA 2D9DA 3NZQA 4AKLA 3DJBA 2DTHA 2IIUA 2ZTGA 2XUEA 3K3OA 5FXZA 4L5GA 1ATIA 3H3MA 5FXWA 2XY8B 3NENA 4YRSA 2QHVA 2VB6A 3RL6A 3IALA 4QH5A 1MMDA 2AMCA 4H9OC 5M4YA 3HY1A 1IAPA 3JADA 4B3MT 2A3DA 1DU2A 4KX6A 5AQUB 4A56A 5HCMA 4XTXA 4OP0A 3N9MA 2J4GA 5FXXA 1M7KA 4P74C 2WZIA 4U31A 3A31A 4XU0A 5H6RB 3A5XA 3ZSTA 1H4TA 4AKGA 4QWNB 3HL6A 2Q7EA 2ZIOA 4XTWA 4YFSA 4CI2B 3L4GB 3S4UA 4HEAA 4HTEA 1UUSA 3K3NA 2Q9QD 4DV5T 4NXNT 2B76A 3TEHB 4DBRA 2MBGA 3OPCA 4IDZA 4RDXA 4RQEA 2MPKA 4J15A 4CN1A 4ZZCA 3NKZA 1EIYB 1W0AA 3C4WA 4DNDA 4YXDA 3AEBA 1W66A 4OK0A 4Z91A 4H2VA 1LVFA 2XM1A 1IL2A 5CGMA 1KMNA 2ODVA 2DTIA 5JR9A 3CMQA 3DTOA 2YDQA 2ZZEA 3N2KE 1QE0A 3ZMTB 4ZXLA 2X9YA 3BJUA 1E7PA 1HX1B 2XTIA 4TX5A 3CWZB 3HXWA 2E64A 5KXJA 4AH6A 4YRGA 4MALA 2UUBT 3QK6A 1YGBA 4MLKA 1Z7NA 4XTVA 4BAYB 4WBOA 2OV9A 1H4VB 3LSQA 2MAWA 2H89A 5J1GA 4YRKA 4YRNA 2CBJA 3C4ZA 4CI3B 1G8XA 4DR7T 4L9IA 2XPKA 3RKWA 3F57A 5FL1A 3O4XE 4IGUA 3N2OA 2E8IA 2ZT6A 3L1AA 4GK0E 3O9XA 2HNIA 4YRJA 2W66A 4EX5A 3R07A 1QLBA 4IHJE 4YRLA 2GK9A 3C51A 5LMNT 2ZNIA 4N78D 4TZ4C 4PW8A 2V5DA 1WFDA 2V7KA 3LJCA 4YY3T 4JV5T 5L47A 3ZLIA 3P8VA 3H37A 3PUZF 5LXTE 1HR0T 2DEQA 1N32T 2PBIA 2E9XB 2XAJB 3QC9A 1SUMB 2WDVA 2ALYB 4O4LE 3NRXA 2LOSA 5AQRB 2BS3A 1X55A 2LKHA 4YRPA 3QO8A 4YROA 1T98A 5LMUT 2VKHA 4YRIA 5C2TA 2RHSA 4U7IA 2A9UA 2AE9A 5AQQB 4PJNA 4PJLA 1KF6A 3TLVA 3PUAA 5F8PA 2V7IA 3MF1A 3NZPA 2J1DG 3BK9A 2HN1A 3ZCIA 2LRKA 2NS6A 4YHHT 3V8KA 3HTZA 4HWTA 3ZSSA 1YKHB 5FY1A 1OEDC 1D1AA 1E1OA 2DU7A 2ZM8A 2WMOA 4YJ3E 4HWHA 4ZS3A 2V7JA 5J2UE 2DHRA 2CIMA 2H7VC 2AXDS 3KV5A 4IDPA 1NEKA 2CHNA 1JNZA 3I7FA 3NRYA 3TEGA 2CRBA 2C8MA 2J3MA 3CVRA 4DV6T 3PCOA 2ZM0A 4CS4A 3PURA 5GONE 2AKWA 4GKKT 2WBLA 3Q5EA 4CS3A 4X1YE 2WZHA 3VQWA 4UP8A 2D5UA 5IYZE 2V7LA 2LT3A 4DBQA 3SFDA 2XJ7A 4TV8E 5ABFB 3UUBA 4PFOA 4P75C 4H2XB 1X9BA 2IHR1 1NJ2A 4P0AA 3AE2A 3RKOA 2E1HA 3AEEA 5L3DB 5AQSB 3AXJA 3UQ4A 2NWBA 1IJ5A 3VQXA 2WMNA 2X68A 1WNLA 4JI0T 3IKLA 2EWNA 3KFWX 5AQMB 5JRCA 3AE4A 2Q9QB 3CX6B 2IW5B 1SE7A 4EO4A 2WY2A 5LGTB 4AQYT 2LEHA 5FVLA 1NAFA 2LE8A 3Q5DA 3ZYMA 3T1YT 3VKGA 5HGQA 4DV3T 3KBTA 2Q7GA 4ZI2D 4U2YA 3RH3A 3HFVA 5J2TE 4DIDB 2XQ6A 4ILUA 4LF8T 4A98A 5IWAT 3Q5WA 4H2SA 4U7YA 2CMRA 4I43B 3LDQB 3A7AA 1WR0A 2VKJA 5IHYA 3J7Yq 3UTKA 4OX9T 4J2CA 4EEBA 3ZMVB 2VL0A 2CJAA 4UPAA 2EHOA 3ZT6A 3N5LA 2Y48B 1HG5A 4U2ZA 2V1DB 1NJ6A 5IUXA 3BQKA 3PUXF 4DUZT 1C0AA 3E0ZA 5LBQB 3OTOT 2XAQB 2IUBA 3GN5B 2W62A 3ZMZB 3FZKB 2XQ9A 2WS3A 4UF0B 3A7UA 5C52B 3RYIE 4C91A 1IBMT 3ZJ1A 2HPLA 2X9WA 2L9QA 4CZZB 4YDQA 4P72A 4O4HE 3B13A 2IY5B 3EDUA 4Q25A 4QXHB 3ABVA 5C8YE 4P73C 3RIUA 2DQ0A 1MMNA 1X54A 2M6IA 2ZGWA 4UXNB 1SA0E 1X01A 3DSQA 4E7ZA 5JDGA 3FBLA 5L3FB 3JC6C 4AQGA 2M6BA 2QYWA 2NP9A 3PJAA 1Z7MA 2IAKA 4AXPA 5CFBA 3CPZA 4KBMB 3BFMA 3SS1A 4LVJA 2CA5A 3B57A 1YFTA 2K48A 3HXYA 2PMEA 4C90A 3MJXA 2E5VA 4JYAT 4H2YA 4DR2T 4F6RC 4XEOA 2CWOA 3VHLA 2W63A 3QTCA 2DLRA 3ZKRA 2QVAA 1H4SA 4ZHQE 2JMHA 1QSDA 4P3NA 4UEMA 3EHZA 3RHWA 2HH7A 3AA7B 1HC7A 2ACZA 4X5OA 2I59A 5LB7B 4HFEA 2ZIMA 5TAOA 3QNEA 3OYXA 3UUMA 2C7IA 3L4GA 1UCUA 3U3IA 3IKMB 5AQFB 1SRYA 2N1GA 3TEHA 4EGWA 3LK42 3RKGA 4YRRA 1D1BA 5L4HA 3A8YC 4XTYA 4JLEA 2V6YB 1EIYA 1ASYA 4UR9A 2WB5A 5AQPB 2QHSA 2ZZGA 3ZYLA 4H2WA 3VQYA 3NETA 2V5CA 3P4RA 1OEDB 2VK9A 3C50A 1HTTA 4LFAT 3AE7A 1BR4A 1U5PA 4FI5A 5F3JA 1BIBA 4TVWA 2E9XC 4OLFA 4ILAA 3CQCB 3OKQA 1OWAA 2BG9E 3CK6A 2WM9A 4O2BE 4LF7T 3PUGA 1NJ1A 4LMKA 1XNRT 1CHUA 3L3PA 3N9OA 5JREA 1WQWA 5FY7A 3HY0A 4EYYR 1B7TA 1IBKT 3ZCJA 2LSKA 5AQJB 2Z6EA 1NJ8A 2KNDA 2Y6XA 4TWHA 2I6HA 3M65A 4H63H 4K0KT 5ADXL 2RHQA 1J5ET 2NW9A 3EFRA 1VCSA 3UFEA 5FY0A 3REUA 1OXZA 5AQLB 5LYJE 1XZYA 2N2NA 3MZKB 4JI7T 3A5ZA 5AQKB 2BG9A 3A32A 3AE9A 5LBMA 4LNSA 4TQFA 3HKEE 1BBWA 4KR3A 2X9XA 2WWUA 2YDRA 1UGOA 2XQ7A 3JAEA 4ZS2A 2ZMAA 5ELNA 2VKOA 1KFYA 5JTGA 4WBNE 4JI5T 1YQ4A 4TVAB 2VASA 2JQ9A 4YYEA 1FMVA 2LHNA 5L3CB 2VQFT 2VL8A 4ISTA 4G2AA 1LKXA 1G73A 4ZEYA 2VURA 3V5SA 1XDPA 4WNKA 3LBXB 4O4JE 5FMNA 1MNDA 5LG4A 4H2TA 2LSIA 3D0TA 4JEUB 4JBWF 2KZ7B 4L87A 1SHZC 4IDOA 4YTNA 3J9X1 4BA9A 4EAHA 3E9HA 2ES0A 4QH1A 2Q9QC 3M3ZB 4QX8B 4ISSA 3CKDA 4NUVA 4H9PC 3TLSA 2RPAA 2H3RA 4HWSA 2X0LB 2X66A 3PZCA 4JI8T 1J1JA 1MIVA 3ANWB 4CI1B 2XM2A 4COFA 3UUXB 5HEGA 2BBHA 1EVLA 2BKPA 2E5LT 4P1NA 2WDQA 4PFPA 3NVOA 1ADJA 4ZOLE 4DR3T 2G0UA 4DR4T 2YU2A 3PUVF 4TN7B 1QUUA 5C3JA 3AA0B 4LVIA 3AE5A 5LG3A 2YN6A 4XBFB 5FP3A 2ZT5A 4XZCA 4HKAA 4P09A 5ABFA 4I4TE 2Y8DA 1XMOT 3U78A 4UP9A 3B5MA 4WF2A 5L2LA 3K8PC 1HF8A 4CXXA 4O2AE 3RQWA 2Q5HA 3AA1B 3KINB 3OD1A 1X2HA 4H63V 1MMGA 1L0WA 4P74A 2FJBA 4YSZA 2Q7HA 2W00A 3FB2A 2DDZA 3AAAB 12ASA 3A7MA 5DABA 4ASKA 1ZKEA 5AFUL 1O3XA 4QXCB 5HCJA 4A5XA 3E9IA 4CH4A 4HFBA 4YJ2E 3ZJ2A 1E2AA 1WR6A 1B70B 2KSRA 4PJJA 2LM2A 4MHCA 5JVDE 4ILBA 4OHFA 2X0HA 2P9BA 3VU7H 3TUPA 4E7SA 3WAKA 4HFVA 3PE0A 1X56A 3CX7B 3PDYA 2ZM2A 3VQVA 2KXPB 4I55E 2VVSA 3ONJA 4IE4A 4TNWA 3VBBA 3RIAA 1G51A 3W15B 2ZM6T 4HWCA 2D0UA 4TV9E 4ADZA 4B6XA 3C98B 3X1DA 5JH7E 3FZMB 3UQ7A 5E0OA 3UU4A 5HWYA 2C5IT 2D2SA 3OYZA 4YCWA 5A1LA 2IDOB 4CH6A 4UF0A 3L39A 2CBIA 3HFZA 3F31A 3AE3A 3RIFA 2DXUA 3V7SA 1HNZT 5EZYE 4YRFA 2IY5A 4PK5A 2C0SA 3REXA 5AQNB 2ARTA 3V8LA 5ABGA 5LJMA 2FBWA 4AI6A 1MNEA 3RKXA 1I94T 3ONLC 2LSGA 3IG2A 4M1PA 3KFUA 1W9RA 4YREA 1E24A 3SRZA 1BR1A 4GYRA 4U74A 1YFSA 2X67A 4HWOA 1NYQA 1GGMA 3TLWA 3MK7C 2LHRA 4DR5T 3WQZA 2A72A 3LG7A 5ABEA 3HRIA 4LVLA 4I50E 2VVNA 3MA9A 4YSYA 3WAJA 4YRCA 2DWGA 4CXWA 3HXZA 1WLEA 4ZIBA 4XU2A 1OEDE 3FZFB 1ZHCA 2FYKA 4B3RT 2KINB 2BKNA 1T7SA 2ZR2A 4NIQA 5JR9B 3HXVA 5LHGB 3R84B 1WYBA 1USYC 1GQEA 2DCFA 2J47A 3UH0A 4PAGA 4DMVA 3E08A 3QB5K 2ZT7A 1BR0A 4ZI2C 1PYSA 3EFSA 2YU1A 2CXLA 4UVAB 2E41A 5DQWA 2DQ3A 2ZT8A 1VOMA 1HX8A 3TLUA 2EHOD 5JDNA 4AKIA 1NJ5A 3VRAA 4TWFA 1XDOA 1OEDA 3ESLA 3C4XA 2XQYA 4X1IE 3L09A 3RRCA 2DZCA 3PUWF 5FVKA 2H88A 4QXBB 5HYAA 2HPJA 5K1XA 1HTJF 3V7CA 2CJBA 4K86A 4RMFA 3TLTA 4H9RC 3EVYA 2HN2A 2NTXA 1UK5A 4HFIA 5CB4E 3HKCE 3IEEA 5HEUA 4K87A 4HWRA 2JPFA 2XQ5A 3CX8B 5BMVE 2ODUA 4DUYT 3FXDB 4P75A 5KX5E 4Z8XA 3I1AA 4UVCB 4YRQA 3P4SA 4GYSA 3ZPOA 3N9NA 3QO5A 3ZT7A 4HN9A 2OLTA 1UX4A 4HFHA 4YTPA 1B7YA 2ARUA 4ILCA 2CEAA 2L3LA 5L3GB 3V7RA 4UV8B 1IJ6A 2XQAA 1HNXT 2RHSB 4LFCT 4KHZF 4TVAA 4AQFC 3RI5A 2V8SV 3QOFA 4YHJA 2LKGA 3PTRB 3UUNA 3UT5E 4IREA 1BR2A 1FIOA 3MQZA 1W0BA 2WDRA 2JIWA 4P71C 4QX7B 3CQXC 3T8OA 2V6XA 2QRXA 2CLYC 3PJAJ 3FHNA 2QHUA 2EJGA 3L8RA 2ZZFA 1XWMA 4EYUA 2CJ9A 2QGSA 2DXTA 5L3EB 3DP7A 5HXHA 1E1TA 5EK4A 2G4CA 2PMFA 4P3OA 3HR0A 3V5UA 4WZXA 5BR8T 3BQLA 4OFZA 5HAXA 3PU3A 2K5BB 1WPYA 3N9PA 2ODRD 5E3IA 4X1KE 3AEFA 1KNPA 4V1Av 3KBUA 4G85A 3EI0A 3EUHA 1EOVA 2PTFA 3RYHE 3PUQA 1I6ZA 1X2GA 4IDQA 4PK4A 2WAUA 3LK2B 3O1JA 4ZI3D 5KMGP 1JNRA 4X66T 3AXJB 2WWVA 2PFVA 4HWPA 1M62A 3M4QA 2BG9C 4P73A 2WSSV 5JRCB 2LSYA 1L0VA 4YCUA 3M4PA 3AB3B 2K9AA 1KEYA 3MF2A 1G5IA 3IA3A 3RC8A 2BVLA 3KV4A 4DVDA 3AE1A 3HI2A 3KV6A 3UFGA 2BS2A 2JQQA 1WQ7A 3FJPA 1G5HA 5JDLA 4JI2T 1XNQT 4U33A 4XU1A 5KNNA 1UX5A 3UU3A 1KOGA 1Y64B 3AEAA 4F8HA 2EJFA 1T8BA 4E51A 1VCTA 2XSAA 2LRLA 3ERRA 4HWIB 3K1SA 4H9QC 4K0UA 3RKYA 2WCAA 5LNKA 1D0XA 4JI6T 5HXEA 4YCVA 2JQHA 4HT4A 5LJNA 1S94A 2E65A 2K3WA 1NNHA 4X20E 2FUPA 2EHOB 4WI1A 4RQFA 2P5IA 3ZT5A 3ZC0A 4TQDA 5JDHA 2KT9A 1MIYA 4YP0A 1FMWA 4ZTZB 3UULA 2X51A 3ZN0B 4WJ4A 1FJGT 4YRMA 1Z0PA 4PK6A 3ZMSB 4NCXA 3HXUA 2FJEA 2YDSA 3PU8A 1MMAA 3ONXA 3HXXA 4CXYA 3R6NA 2ACXA 4ERRA 2E9XA 2ALYA 2NW7A 2SPCA 1J5WA 4EZHA 4DO0A 4MFRA 2OA5A 4NUUA 2ZR3A 2UXNB 3RX6A 5JR9C 2DNXA 1NWMX 2XGTA 3IBPA 2WQYA 4LF6T 5C51B 5HEOA 3H3AA 2IC6A 1YB3A 4Z90A 4LVMA 1JJCB 3A5YA 4MBQA 5LHHB 3EDVA 2DU5A 2XTLA 2W67A 4JEHB 2D0TA 4Q6GA 1ZP0A 2R6GF 3ZMUB 1YKEB 2JQKA 4P3PA 1E22A 3P8TA 2LLYA 5LGNB 2LJLA 5L4EA 3FZLB 3VR9A 4GIWA 3L2ZA 3SWHA 2HHHT 4CH3A 2NOXA 5JQGE 4HFCA 4U3CA 4JUYA 2PG8A 5FXVA 2XAHB 5AQVB 3GMIA 2XHEB 2E2AA 2YKSA 5K1PA 2C5KT
chains in the Genus database with same CATH topology
3RKXA 3ICAA 3IG2A 5ELOA 3KFUA 4YREA 3A7UA 4H2XA 5C52B 4DPGA 1E24A 1BBUA 1SESA 1SETA 1YFSA 2DKGA 4YDQA 3MEYA 4P72A 1YFRA 4HWOA 3RGLA 1NYQA 3LSSA 1GGMA 2IY5B 3NEMA 3WQZA 1N9WA 3HRIA 4LVLA 4P73C 1B70A 2DTOA 2DQ0A 4G84A 1X54A 2ZGWA 1X01A 3DSQA 4YRCA 3HXZA 1WLEA 4ZIBA 4XU2A 2P0LA 1B7YB 2FYKA 4Q15A 3RF1A 2ZR2A 2DTHA 4YRTA 1Z7MA 2ZTGA 3HXVA 2QHTA 4H02A 3BFMA 1USYC 1ATIA 4LVJA 2RHQB 3UH0A 1YFTA 3NENA 2ZT7A 3HXYA 2PMEA 4YRSA 4H2YA 2QHVA 1PYSA 3RL6A 3EFSA 3IALA 5C53B 4XEOA 2E41A 2DQ3A 3QTCA 2AMCA 1KMMA 2ZT8A 3HY1A 1H4SA 3QO7A 4P3NA 1NJ5A 1HC7A 4X5OA 2ZIMA 3V8JA 3QNEA 2C7IA 1EFWA 3L4GA 3IKMB 2DZCA 1SRYA 3TEHA 4XTXA 4OP0A 4YRRA 5K1XA 3V7CA 2CJBA 2AMCB 4XTYA 4P74C 4K86A 4XTUA 4RMFA 1EIYA 1ASYA 2QHSA 4KQEA 3A31A 2ZZGA 4H2WA 4XU0A 4HVCA 3VQYA 3NETA 1H4TA 4H2UA 3A7RA 2Q7EA 2ZIOA 1HTTA 4XTWA 4K87A 4HWRA 3L4GB 1NYRA 1B76A 2I4OA 4P75A 1BIBA 4TVWA 4OLFA 3TEHB 4YRQA 4RDXA 4RQEA 1NJ1A 4J15A 3QO5A 4O2DA 1HXDA 1EIYB 1B7YA 2ARUA 1W66A 4H2VA 3V7RA 1WQWA 2I4LA 3HY0A 1IL2A 4BW9A 4ZTUB 1KMNA 2DTIA 4XEMA 2I4NA 3CMQA 2A8EA 1NJ8A 2ARSA 2ZZEA 3W3SA 1QF6A 2RHSB 2RHQA 3G1ZA 4TVAA 3EFRA 1QE0A 3REUA 3LC0A 4DQ2A 3BJUA 3A5ZA 4YPFA 2ZCEA 4PHCA 3A32A 2XTIA 4LNSA 4TQFA 3HXWA 2E64A 2CGHA 1BBWA 4AH6A 4KR3A 3MQZA 4YRGA 4P71C 1YGBA 1Z7NA 2QHUA 4XTVA 2EJGA 2ZZFA 5ELNA 2CJ9A 2DXTA 4LVKA 1H4VB 1LYLA 3LSQA 1E1TA 2G4CA 4TVAB 2PMFA 4YRKA 4P3OA 4YRNA 4YYEA 1WPYA 3RKWA 2EAYA 2ODRD 5E3IA 1VQZA 2E3CA 4G85A 4PG3A 1ASZA 1EOVA 2ZT6A 2E5AA 3L1AA 2HNIA 4H2TA 2DVEA 4YRJA 1X2GA 1EVKA 3RACA 4KR2A 4EX5A 3R07A 4P72C 4YRLA 3A74A 4L87A 2J3LA 2ZNIA 4TTVA 2DJZA 4CH5A 3E9HA 3P8VA 2E10A 4HWPA 2DEQA 3M4QA 4P73A 4HWSA 2ALYB 4YCUA 3M4PA 3PZCA 1X55A 4YRPA 3NELA 3QO8A 4YROA 3MF2A 1G5IA 3UGTA 5F5WA 4YRIA 3UFGA 4TVYA 2RHSA 1EVLA 1WYDA 1WQ7A 3FJPA 1G5HA 4XU1A 5KNNA 1KOGA 1ADJA 2I4MA 2EJFA 4E51A 1H4QA 3MF1A 1USYA 3ERRA 2NS6A 3V8KA 3RKYA 4LVIA 3HTZA 4HWTA 3P8YA 4YCVA 1E1OA 2DU7A 4XTZA 4HT4A 1WU7A 2E65A 2ZT5A 1NNHA 2CIMA 3UGQA 2ZXFA 3I7FA 3HFZB 3TEGA 2C8MA 2J3MA 4WI1A 4RQFA 3PCOA 4CS4A 2P5IA 4TQDA 2AKWA 4UP9A 4WF2A 4YP0A 2ZINA 4CS3A 4ZTZB 2ODRC 2Q5HA 1B8AA 3OD1A 4BWAA 4WJ4A 4YRMA 3VQWA 1X2HA 4UP8A 4WJ3M 2EJ9A 1L0WA 4P74A 4NCXA 3HXUA 2Q7HA 4K88A 4P75C 3HXXA 4H2XB 2DDZA 12ASA 1NJ2A 2E1HA 2Q5IA 3PCOB 1EQRA 2AKWB 3RIRA 3VQXA 3RUXA 1JJCA 1WNLA 4HA8A 3IKLA 2EWNA 3E9IA 4CH4A 2ALYA 1J5WA 1B70B 2ZNJA 4EO4A 2ZR3A 4CS2A 4UP7A 2XGTA 3TUPA 5C51B 2EL9A 1X56A 3VQVA 11ASA 1YB3A 5HGQA 4LVMA 1JJCB 3A5YA 1BIAA 2Q7GA 3VBBA 1G51A 2DU5A 4XU3A 3HFVA 3HRKA 2DZ9A 4Q6GA 4H2SA 1PYSB 3A7AA 1ADYA 4YCWA 4P71A 4CH6A 4P3PA 1E22A 3P8TA 2CJAA 3HFZA 4UPAA 1NJ6A 2DXUA 3V7SA 3L2ZA 1C0AA 4YRFA 4CH3A 2IY5A 4TWAA 1SERA 3REXA 2ARTA 3V8LA 1RIQA 1FYFA 5K1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKX A;  3ICA A;  3IG2 A;  5ELO A;  3KFU A;  4YRE A;  3A7U A;  4H2X A;  5C52 B;  4DPG A;  1E24 A;  1BBU A;  1SES A;  1SET A;  1YFS A;  2DKG A;  4YDQ A;  3MEY A;  4P72 A;  1YFR A;  4HWO A;  3RGL A;  1NYQ A;  3LSS A;  1GGM A;  2IY5 B;  3NEM A;  3WQZ A;  1N9W A;  3HRI A;  4P73 C;  1B70 A;  2DTO A;  2DQ0 A;  4G84 A;  1X54 A;  2ZGW A;  1X01 A;  3DSQ A;  4YRC A;  3HXZ A;  1WLE A;  4ZIB A;  4XU2 A;  2P0L A;  1B7Y B;  2FYK A;  4Q15 A;  3RF1 A;  2ZR2 A;  2DTH A;  4YRT A;  1Z7M A;  2ZTG A;  3HXV A;  2QHT A;  4H02 A;  3BFM A;  1USY C;  1ATI A;  2RHQ B;  3UH0 A;  1YFT A;  3NEN A;  2ZT7 A;  3HXY A;  2PME A;  4YRS A;  4H2Y A;  2QHV A;  1PYS A;  3RL6 A;  3EFS A;  3IAL A;  5C53 B;  4XEO A;  2E41 A;  2DQ3 A;  3QTC A;  2AMC A;  1KMM A;  2ZT8 A;  3HY1 A;  1H4S A;  3QO7 A;  4P3N A;  1NJ5 A;  1HC7 A;  4X5O A;  2ZIM A;  3V8J A;  3QNE A;  2C7I A;  1EFW A;  3L4G A;  3IKM B;  2DZC A;  1SRY A;  3TEH A;  4XTX A;  4OP0 A;  4YRR A;  5K1X A;  3V7C A;  2CJB A;  2AMC B;  4XTY A;  4P74 C;  4K86 A;  4XTU A;  4RMF A;  1EIY A;  1ASY A;  2QHS A;  4KQE A;  3A31 A;  2ZZG A;  4H2W A;  4XU0 A;  4HVC A;  3VQY A;  3NET A;  1H4T A;  4H2U A;  3A7R A;  2Q7E A;  2ZIO A;  1HTT A;  4XTW A;  4K87 A;  4HWR A;  3L4G B;  1NYR A;  1B76 A;  2I4O A;  4P75 A;  1BIB A;  4TVW A;  4OLF A;  3TEH B;  4YRQ A;  4RDX A;  4RQE A;  1NJ1 A;  4J15 A;  3QO5 A;  4O2D A;  1HXD A;  1EIY B;  1B7Y A;  2ARU A;  1W66 A;  4H2V A;  3V7R A;  1WQW A;  2I4L A;  3HY0 A;  1IL2 A;  4BW9 A;  4ZTU B;  1KMN A;  2DTI A;  4XEM A;  2I4N A;  3CMQ A;  1NJ8 A;  2ARS A;  2ZZE A;  3W3S A;  1QF6 A;  2RHS B;  2RHQ A;  3G1Z A;  4TVA A;  3EFR A;  1QE0 A;  3REU A;  3LC0 A;  4DQ2 A;  3BJU A;  3A5Z A;  4YPF A;  2ZCE A;  4PHC A;  3A32 A;  2XTI A;  4LNS A;  4TQF A;  3HXW A;  2E64 A;  2CGH A;  1BBW A;  4AH6 A;  4KR3 A;  4YRG A;  4P71 C;  1YGB A;  1Z7N A;  2QHU A;  4XTV A;  2EJG A;  2ZZF A;  5ELN A;  2CJ9 A;  2DXT A;  1H4V B;  1LYL A;  3LSQ A;  1E1T A;  2G4C A;  4TVA B;  2PMF A;  4YRK A;  4P3O A;  4YRN A;  4YYE A;  1WPY A;  3RKW A;  2EAY A;  2ODR D;  5E3I A;  1VQZ A;  2E3C A;  4G85 A;  4PG3 A;  1ASZ A;  1EOV A;  2ZT6 A;  2E5A A;  3L1A A;  2HNI A;  4H2T A;  2DVE A;  4YRJ A;  1X2G A;  1EVK A;  3RAC A;  4KR2 A;  4EX5 A;  3R07 A;  4P72 C;  4YRL A;  3A74 A;  4L87 A;  2J3L A;  2ZNI A;  4TTV A;  2DJZ A;  4CH5 A;  3E9H A;  3P8V A;  2E10 A;  4HWP A;  2DEQ A;  3M4Q A;  4P73 A;  4HWS A;  2ALY B;  4YCU A;  3M4P A;  3PZC A;  1X55 A;  4YRP A;  3NEL A;  3QO8 A;  4YRO A;  3MF2 A;  1G5I A;  3UGT A;  5F5W A;  4YRI A;  3UFG A;  4TVY A;  2RHS A;  1EVL A;  1WYD A;  1WQ7 A;  3FJP A;  1G5H A;  4XU1 A;  5KNN A;  1KOG A;  1ADJ A;  2I4M A;  2EJF A;  4E51 A;  1H4Q A;  3MF1 A;  1USY A;  3ERR A;  3V8K A;  3RKY A;  3HTZ A;  4HWT A;  3P8Y A;  4YCV A;  1E1O A;  2DU7 A;  4XTZ A;  1WU7 A;  2E65 A;  2ZT5 A;  1NNH A;  2CIM A;  3UGQ A;  2ZXF A;  3I7F A;  3HFZ B;  3TEG A;  2C8M A;  2J3M A;  4WI1 A;  4RQF A;  3PCO A;  4CS4 A;  2P5I A;  4TQD A;  2AKW A;  4UP9 A;  4WF2 A;  4YP0 A;  2ZIN A;  4CS3 A;  4ZTZ B;  2ODR C;  2Q5H A;  1B8A A;  3OD1 A;  4BWA A;  4WJ4 A;  4YRM A;  3VQW A;  1X2H A;  4UP8 A;  4WJ3 M;  2EJ9 A;  1L0W A;  4P74 A;  4NCX A;  3HXU A;  2Q7H A;  4K88 A;  4P75 C;  3HXX A;  4H2X B;  2DDZ A;  12AS A;  1NJ2 A;  2E1H A;  2Q5I A;  3PCO B;  1EQR A;  2AKW B;  3RIR A;  3VQX A;  3RUX A;  1JJC A;  1WNL A;  4HA8 A;  3IKL A;  2EWN A;  3E9I A;  4CH4 A;  2ALY A;  1J5W A;  1B70 B;  2ZNJ A;  4EO4 A;  2ZR3 A;  4CS2 A;  4UP7 A;  2XGT A;  3TUP A;  5C51 B;  2EL9 A;  1X56 A;  3VQV A;  11AS A;  1YB3 A;  5HGQ A;  1JJC B;  3A5Y A;  1BIA A;  2Q7G A;  3VBB A;  1G51 A;  2DU5 A;  4XU3 A;  3HFV A;  3HRK A;  2DZ9 A;  4Q6G A;  4H2S A;  1PYS B;  3A7A A;  1ADY A;  4YCW A;  4P71 A;  4CH6 A;  4P3P A;  1E22 A;  3P8T A;  2CJA A;  3HFZ A;  4UPA A;  1NJ6 A;  2DXU A;  3V7S A;  3L2Z A;  1C0A A;  4YRF A;  4CH3 A;  2IY5 A;  4TWA A;  1SER A;  3REX A;  2ART A;  3V8L A;  1RIQ A;  1FYF A;  5K1P A; 
#chains in the Genus database with same CATH topology
 2CPT A;  3FZH B;  3JCF A;  4OYJ A;  3K3Q C;  2CLY B;  4H2X A;  4DPG A;  1BBU A;  4EV6 A;  1SET A;  4DV2 T;  2FJD A;  4LFB T;  1YFR A;  2YK0 A;  3RGL A;  3O1I A;  3LSS A;  3NEM A;  2UU9 T;  4CN6 A;  1N9W A;  5HXS A;  2W61 A;  5LGU B;  2DTO A;  2Q9Q A;  2JJ9 A;  5EK3 A;  2UUA T;  4P0B A;  4QHO A;  3RF1 A;  3P4Q A;  4QH4 A;  4H9S E;  4DR6 T;  3OJA A;  2XZE A;  4YRT A;  2RP4 A;  2KWH A;  4EZ4 A;  2QHT A;  4IL4 A;  5ABH A;  4H02 A;  4BJM A;  1HNW T;  2X9H A;  2RHQ B;  3O1H A;  5LCY A;  3OVU A;  1ZEE A;  2UXB T;  5C53 B;  2LM9 A;  2BG9 B;  4CQI A;  4EOZ B;  1CUN A;  5J0Z A;  4X62 T;  3KVA A;  1KMM A;  3UU8 A;  3MXZ A;  3QO7 A;  4KP3 C;  4EB6 E;  5LOV E;  1R8I A;  1N33 T;  3V8J A;  1IBL T;  4O4I E;  2CWY A;  1EFW A;  5AQI B;  4LF9 T;  1Y01 A;  2WU2 A;  3GN5 A;  2KLQ A;  3I9W A;  4JI4 T;  3VRB A;  3AED A;  4IE0 A;  2AMC B;  3JAF A;  5FNV E;  3RYC E;  4XTU A;  3I0Q A;  4KQE A;  4HVC A;  3PV0 F;  3N2G E;  4YLH A;  4L0R A;  4UEL A;  4H2U A;  2MTQ A;  3A7R A;  3F2E A;  2CE7 A;  3AEG A;  3LSV A;  1NYR A;  1B76 A;  4UIG A;  2I4O A;  1LVK A;  3AE8 A;  5LHI B;  3ETU A;  3ZYK A;  1ZOY A;  2RA1 A;  3HKB E;  4O2D A;  3MKD A;  4IE7 A;  4YTM A;  3PUS A;  4KHP T;  1HXD A;  2BDE A;  5EK2 A;  4DV1 T;  5CA0 E;  2XSB A;  4I0U A;  2I4L A;  4HWF A;  4BW9 A;  4EXT A;  4ZTU B;  4XEM A;  3AVR A;  3UU5 A;  2I4N A;  2A8E A;  2VKD A;  4GK5 E;  1US7 B;  3RLF F;  3VKH A;  2ARS A;  2PJQ A;  1NEN A;  3W3S A;  3EAM A;  1QF6 A;  3G1Z A;  4HGA A;  2N9D A;  4UVB B;  2UUC T;  3TKL B;  3LC0 A;  4DQ2 A;  2BS4 A;  4IE6 A;  2BKO A;  4YPF A;  2X0Y A;  2ZCE A;  4PHC A;  3OBV E;  2CGH A;  2J62 A;  2MOZ A;  3IHR A;  2L8K A;  3HKD E;  2XAS B;  3AAE B;  4X64 T;  2V26 A;  3QB5 A;  4EIW A;  3CQG B;  3Q9D A;  4B3S T;  2EHO C;  4LVK A;  1LYL A;  5FKY A;  3Q2M A;  1YXR A;  4WYV A;  3SFE A;  5LA6 E;  5AQO B;  1WYC A;  2YIN A;  2EAY A;  1VQZ A;  5HWX A;  2V6Y A;  3PUY F;  2C5J A;  4AKR B;  4G63 A;  2E3C A;  4ZI7 E;  4PG3 A;  1ASZ A;  2IML A;  2IC9 A;  2E5A A;  4IIJ E;  4TUY E;  5HEJ A;  4LML A;  5JDQ A;  2BBJ A;  2DVE A;  3T1H T;  1EVK A;  3RAC A;  4KR2 A;  2DL1 A;  4IE5 A;  1YD8 G;  4P72 C;  3A74 A;  2W4X A;  1W09 A;  2J3L A;  4TTV A;  2DJZ A;  1H7C A;  3AVS A;  1YW0 A;  3P7I A;  4CH5 A;  3I9Y A;  4LMJ A;  2XQ8 A;  3N9L A;  4YSX A;  3P4W A;  2UXC T;  3RIU C;  1X79 A;  2BZB A;  2E10 A;  4PNI A;  4H9N C;  5L3B B;  3AAI A;  2W2U A;  1HCI A;  5FYM A;  4GKJ T;  4WW0 A;  3KVB A;  4KI0 F;  3NEL A;  3NWI A;  3UGT A;  5F5W A;  4OYK A;  4UV9 B;  1WRD A;  2CXF A;  4NPP A;  2BVM A;  5FL0 A;  4TVY A;  1WYD A;  2I4M A;  4HWD A;  3P50 A;  4DR1 T;  1U4Q A;  1H4Q A;  4TNV A;  1USY A;  1V9D A;  3ETV A;  1N34 T;  4XAX B;  5HEH A;  4AIU A;  5AQT B;  3P8Y A;  4AKH A;  4A97 A;  3GA8 A;  3LFM A;  4XTZ A;  5DQV A;  3EAB A;  1WU7 A;  3RYF E;  1D0Y A;  5LP6 E;  3UGQ A;  2ZXF A;  1MIW A;  2CM0 A;  1Z8U A;  3KV9 A;  4QKN A;  2JRK A;  4IL9 A;  3HFZ B;  1HS7 A;  3IF8 B;  1ZV4 X;  3P8C D;  1KK7 A;  3SOL A;  2ZIN A;  1HG2 A;  3C64 A;  4CN4 A;  3QNU A;  3RC3 A;  2ODR C;  5KDM C;  1B8A A;  3MAC A;  3LBX A;  4BWA A;  1WCR A;  5HXR A;  2CCQ A;  2NR4 A;  4WJ3 M;  2EJ9 A;  2DWK A;  4GOU A;  1E1H B;  2H7O A;  2MYS A;  4NXM T;  4K88 A;  5JDF A;  4HE8 A;  5HXC A;  2K24 A;  4DV0 T;  2Q5I A;  3PCO B;  1EQR A;  2UXD T;  2YEV C;  3P4P A;  3UU6 A;  4JI3 T;  2AKW B;  3AA6 B;  3RIR A;  2I0M A;  4KMC A;  2A2F X;  4ZI3 C;  1YQ3 A;  3RUX A;  1JJC A;  3RQU A;  4HA8 A;  4BJN A;  2CXD A;  2VQE T;  2CHO A;  3FBZ A;  4AIS A;  3JC6 D;  2ZNJ A;  3ANW A;  4FJO A;  4CS2 A;  3E22 E;  1EZ3 A;  3N9Q A;  4UP7 A;  3FXE B;  3VR8 A;  4DV4 T;  4B3T T;  3AEC A;  2EL9 A;  1FEW A;  1S35 A;  2FJA A;  4YT0 A;  2UXX B;  2KMF A;  3RPU A;  11AS A;  4DMW A;  1KNZ A;  2V7M A;  1BIA A;  1KNR A;  2KWI B;  5CA1 E;  4XU3 A;  4AQF A;  4LF4 T;  3WI3 A;  3HRK A;  2ZLY A;  1D1C A;  2DZ9 A;  1D0Z A;  1LRZ A;  1N36 T;  3KDS E;  3ZC1 A;  2W0G A;  1PYS B;  2DI4 A;  4HFD A;  5JDM A;  3NBX X;  1ADY A;  4KUM B;  3BQI A;  4P71 A;  1HFA A;  2JMK A;  3ZEF B;  3CML A;  1T72 A;  3ZN1 B;  2XAG B;  4EED A;  3G06 A;  2LOP A;  3I0O A;  4O8S A;  4TWA A;  1SER A;  3LK3 B;  1RIQ A;  3QUJ A;  2XAF B;  4LF5 T;  1FYF A;  2NW8 A;  4TWD A;  3Q5X A;  1UUR A;  3ICA A;  4PJM A;  1WLX A;  3GWH A;  4JI1 T;  5ELO A;  3CIR A;  1SES A;  1VRB A;  2DKG A;  2WU5 A;  4ZZB A;  3MEY A;  2E9X D;  5H6Q B;  1AJ3 A;  2WP9 A;  5AQH B;  2M67 A;  2QA7 A;  5AQG B;  4ANJ A;  2VWA A;  3HA4 A;  2NTY A;  1IZN B;  2YOE A;  2LSJ A;  3AE6 A;  4U72 A;  1B70 A;  2F4V T;  4IDN A;  1XMQ T;  5ETW A;  4G84 A;  2XQ3 A;  4IT4 A;  2XQ4 A;  4X65 T;  5DJQ C;  2P0L A;  3RRW A;  1B7Y B;  4Q15 A;  2B1E A;  4DV7 T;  5CJ5 A;  4X5T A;  2D9D A;  3NZQ A;  4AKL A;  3DJB A;  2DTH A;  2IIU A;  2ZTG A;  2XUE A;  3K3O A;  5FXZ A;  4L5G A;  1ATI A;  3H3M A;  5FXW A;  2XY8 B;  3NEN A;  4YRS A;  2QHV A;  2VB6 A;  3RL6 A;  3IAL A;  4QH5 A;  1MMD A;  2AMC A;  4H9O C;  5M4Y A;  3HY1 A;  1IAP A;  3JAD A;  4B3M T;  2A3D A;  1DU2 A;  4KX6 A;  5AQU B;  4A56 A;  5HCM A;  4XTX A;  4OP0 A;  3N9M A;  2J4G A;  5FXX A;  1M7K A;  4P74 C;  2WZI A;  4U31 A;  3A31 A;  4XU0 A;  5H6R B;  3A5X A;  3ZST A;  1H4T A;  4AKG A;  4QWN B;  3HL6 A;  2Q7E A;  2ZIO A;  4XTW A;  4YFS A;  4CI2 B;  3L4G B;  3S4U A;  4HEA A;  4HTE A;  1UUS A;  3K3N A;  2Q9Q D;  4DV5 T;  4NXN T;  2B76 A;  3TEH B;  4DBR A;  2MBG A;  3OPC A;  4IDZ A;  4RDX A;  4RQE A;  2MPK A;  4J15 A;  4CN1 A;  4ZZC A;  3NKZ A;  1EIY B;  1W0A A;  3C4W A;  4DND A;  4YXD A;  3AEB A;  1W66 A;  4OK0 A;  4Z91 A;  4H2V A;  1LVF A;  2XM1 A;  1IL2 A;  5CGM A;  1KMN A;  2ODV A;  2DTI A;  5JR9 A;  3CMQ A;  3DTO A;  2YDQ A;  2ZZE A;  3N2K E;  1QE0 A;  3ZMT B;  4ZXL A;  2X9Y A;  3BJU A;  1E7P A;  1HX1 B;  2XTI A;  4TX5 A;  3CWZ B;  3HXW A;  2E64 A;  5KXJ A;  4AH6 A;  4YRG A;  4MAL A;  2UUB T;  3QK6 A;  1YGB A;  4MLK A;  1Z7N A;  4XTV A;  4BAY B;  4WBO A;  2OV9 A;  1H4V B;  3LSQ A;  2MAW A;  2H89 A;  5J1G A;  4YRK A;  4YRN A;  2CBJ A;  3C4Z A;  4CI3 B;  1G8X A;  4DR7 T;  4L9I A;  2XPK A;  3RKW A;  3F57 A;  5FL1 A;  3O4X E;  4IGU A;  3N2O A;  2E8I A;  2ZT6 A;  3L1A A;  4GK0 E;  3O9X A;  2HNI A;  4YRJ A;  2W66 A;  4EX5 A;  3R07 A;  1QLB A;  4IHJ E;  4YRL A;  2GK9 A;  3C51 A;  5LMN T;  2ZNI A;  4N78 D;  4TZ4 C;  4PW8 A;  2V5D A;  1WFD A;  2V7K A;  3LJC A;  4YY3 T;  4JV5 T;  5L47 A;  3ZLI A;  3P8V A;  3H37 A;  3PUZ F;  5LXT E;  1HR0 T;  2DEQ A;  1N32 T;  2PBI A;  2E9X B;  2XAJ B;  3QC9 A;  1SUM B;  2WDV A;  2ALY B;  4O4L E;  3NRX A;  2LOS A;  5AQR B;  2BS3 A;  1X55 A;  2LKH A;  4YRP A;  3QO8 A;  4YRO A;  1T98 A;  5LMU T;  2VKH A;  4YRI A;  5C2T A;  2RHS A;  4U7I A;  2A9U A;  2AE9 A;  5AQQ B;  4PJN A;  4PJL A;  1KF6 A;  3TLV A;  3PUA A;  5F8P A;  2V7I A;  3MF1 A;  3NZP A;  2J1D G;  3BK9 A;  2HN1 A;  3ZCI A;  2LRK A;  2NS6 A;  4YHH T;  3V8K A;  3HTZ A;  4HWT A;  3ZSS A;  1YKH B;  5FY1 A;  1OED C;  1D1A A;  1E1O A;  2DU7 A;  2ZM8 A;  2WMO A;  4YJ3 E;  4HWH A;  4ZS3 A;  2V7J A;  5J2U E;  2DHR A;  2CIM A;  2H7V C;  2AXD S;  3KV5 A;  4IDP A;  1NEK A;  2CHN A;  1JNZ A;  3I7F A;  3NRY A;  3TEG A;  2CRB A;  2C8M A;  2J3M A;  3CVR A;  4DV6 T;  3PCO A;  2ZM0 A;  4CS4 A;  3PUR A;  5GON E;  2AKW A;  4GKK T;  2WBL A;  3Q5E A;  4CS3 A;  4X1Y E;  2WZH A;  3VQW A;  4UP8 A;  2D5U A;  5IYZ E;  2V7L A;  2LT3 A;  4DBQ A;  3SFD A;  2XJ7 A;  4TV8 E;  5ABF B;  3UUB A;  4PFO A;  4P75 C;  4H2X B;  1X9B A;  2IHR 1;  1NJ2 A;  4P0A A;  3AE2 A;  3RKO A;  2E1H A;  3AEE A;  5L3D B;  5AQS B;  3AXJ A;  3UQ4 A;  2NWB A;  1IJ5 A;  3VQX A;  2WMN A;  2X68 A;  1WNL A;  4JI0 T;  3IKL A;  2EWN A;  3KFW X;  5AQM B;  5JRC A;  3AE4 A;  2Q9Q B;  3CX6 B;  2IW5 B;  1SE7 A;  4EO4 A;  2WY2 A;  5LGT B;  4AQY T;  2LEH A;  5FVL A;  1NAF A;  2LE8 A;  3Q5D A;  3ZYM A;  3T1Y T;  3VKG A;  5HGQ A;  4DV3 T;  3KBT A;  2Q7G A;  4ZI2 D;  4U2Y A;  3RH3 A;  3HFV A;  5J2T E;  4DID B;  2XQ6 A;  4ILU A;  4LF8 T;  4A98 A;  5IWA T;  3Q5W A;  4H2S A;  4U7Y A;  2CMR A;  4I43 B;  3LDQ B;  3A7A A;  1WR0 A;  2VKJ A;  5IHY A;  3J7Y q;  3UTK A;  4OX9 T;  4J2C A;  4EEB A;  3ZMV B;  2VL0 A;  2CJA A;  4UPA A;  2EHO A;  3ZT6 A;  3N5L A;  2Y48 B;  1HG5 A;  4U2Z A;  2V1D B;  1NJ6 A;  5IUX A;  3BQK A;  3PUX F;  4DUZ T;  1C0A A;  3E0Z A;  5LBQ B;  3OTO T;  2XAQ B;  2IUB A;  3GN5 B;  2W62 A;  3ZMZ B;  3FZK B;  2XQ9 A;  2WS3 A;  4UF0 B;  3A7U A;  5C52 B;  3RYI E;  4C91 A;  1IBM T;  3ZJ1 A;  2HPL A;  2X9W A;  2L9Q A;  4CZZ B;  4YDQ A;  4P72 A;  4O4H E;  3B13 A;  2IY5 B;  3EDU A;  4Q25 A;  4QXH B;  3ABV A;  5C8Y E;  4P73 C;  3RIU A;  2DQ0 A;  1MMN A;  1X54 A;  2M6I A;  2ZGW A;  4UXN B;  1SA0 E;  1X01 A;  3DSQ A;  4E7Z A;  5JDG A;  3FBL A;  5L3F B;  3JC6 C;  4AQG A;  2M6B A;  2QYW A;  2NP9 A;  3PJA A;  1Z7M A;  2IAK A;  4AXP A;  5CFB A;  3CPZ A;  4KBM B;  3BFM A;  3SS1 A;  4LVJ A;  2CA5 A;  3B57 A;  1YFT A;  2K48 A;  3HXY A;  2PME A;  4C90 A;  3MJX A;  2E5V A;  4JYA T;  4H2Y A;  4DR2 T;  4F6R C;  4XEO A;  2CWO A;  3VHL A;  2W63 A;  3QTC A;  2DLR A;  3ZKR A;  2QVA A;  1H4S A;  4ZHQ E;  2JMH A;  1QSD A;  4P3N A;  4UEM A;  3EHZ A;  3RHW A;  2HH7 A;  3AA7 B;  1HC7 A;  2ACZ A;  4X5O A;  2I59 A;  5LB7 B;  4HFE A;  2ZIM A;  5TAO A;  3QNE A;  3OYX A;  3UUM A;  2C7I A;  3L4G A;  1UCU A;  3U3I A;  3IKM B;  5AQF B;  1SRY A;  2N1G A;  3TEH A;  4EGW A;  3LK4 2;  3RKG A;  4YRR A;  1D1B A;  5L4H A;  3A8Y C;  4XTY A;  4JLE A;  2V6Y B;  1EIY A;  1ASY A;  4UR9 A;  2WB5 A;  5AQP B;  2QHS A;  2ZZG A;  3ZYL A;  4H2W A;  3VQY A;  3NET A;  2V5C A;  3P4R A;  1OED B;  2VK9 A;  3C50 A;  1HTT A;  4LFA T;  3AE7 A;  1BR4 A;  1U5P A;  4FI5 A;  5F3J A;  1BIB A;  4TVW A;  2E9X C;  4OLF A;  4ILA A;  3CQC B;  3OKQ A;  1OWA A;  2BG9 E;  3CK6 A;  2WM9 A;  4O2B E;  4LF7 T;  3PUG A;  1NJ1 A;  4LMK A;  1XNR T;  1CHU A;  3L3P A;  3N9O A;  5JRE A;  1WQW A;  5FY7 A;  3HY0 A;  4EYY R;  1B7T A;  1IBK T;  3ZCJ A;  2LSK A;  5AQJ B;  2Z6E A;  1NJ8 A;  2KND A;  2Y6X A;  4TWH A;  2I6H A;  3M65 A;  4H63 H;  4K0K T;  5ADX L;  2RHQ A;  1J5E T;  2NW9 A;  3EFR A;  1VCS A;  3UFE A;  5FY0 A;  3REU A;  1OXZ A;  5AQL B;  5LYJ E;  1XZY A;  2N2N A;  3MZK B;  4JI7 T;  3A5Z A;  5AQK B;  2BG9 A;  3A32 A;  3AE9 A;  5LBM A;  4LNS A;  4TQF A;  3HKE E;  1BBW A;  4KR3 A;  2X9X A;  2WWU A;  2YDR A;  1UGO A;  2XQ7 A;  3JAE A;  4ZS2 A;  2ZMA A;  5ELN A;  2VKO A;  1KFY A;  5JTG A;  4WBN E;  4JI5 T;  1YQ4 A;  4TVA B;  2VAS A;  2JQ9 A;  4YYE A;  1FMV A;  2LHN A;  5L3C B;  2VQF T;  2VL8 A;  4IST A;  4G2A A;  1LKX A;  1G73 A;  4ZEY A;  2VUR A;  3V5S A;  1XDP A;  4WNK A;  3LBX B;  4O4J E;  5FMN A;  1MND A;  5LG4 A;  4H2T A;  2LSI A;  3D0T A;  4JEU B;  4JBW F;  2KZ7 B;  4L87 A;  1SHZ C;  4IDO A;  4YTN A;  3J9X 1;  4BA9 A;  4EAH A;  3E9H A;  2ES0 A;  4QH1 A;  2Q9Q C;  3M3Z B;  4QX8 B;  4ISS A;  3CKD A;  4NUV A;  4H9P C;  3TLS A;  2RPA A;  2H3R A;  4HWS A;  2X0L B;  2X66 A;  3PZC A;  4JI8 T;  1J1J A;  1MIV A;  3ANW B;  4CI1 B;  2XM2 A;  4COF A;  3UUX B;  5HEG A;  2BBH A;  1EVL A;  2BKP A;  2E5L T;  4P1N A;  2WDQ A;  4PFP A;  3NVO A;  1ADJ A;  4ZOL E;  4DR3 T;  2G0U A;  4DR4 T;  2YU2 A;  3PUV F;  4TN7 B;  1QUU A;  5C3J A;  3AA0 B;  4LVI A;  3AE5 A;  5LG3 A;  2YN6 A;  4XBF B;  5FP3 A;  2ZT5 A;  4XZC A;  4HKA A;  4P09 A;  5ABF A;  4I4T E;  2Y8D A;  1XMO T;  3U78 A;  4UP9 A;  3B5M A;  4WF2 A;  5L2L A;  3K8P C;  1HF8 A;  4CXX A;  4O2A E;  3RQW A;  2Q5H A;  3AA1 B;  3KIN B;  3OD1 A;  1X2H A;  4H63 V;  1MMG A;  1L0W A;  4P74 A;  2FJB A;  4YSZ A;  2Q7H A;  2W00 A;  3FB2 A;  2DDZ A;  3AAA B;  12AS A;  3A7M A;  5DAB A;  4ASK A;  1ZKE A;  5AFU L;  1O3X A;  4QXC B;  5HCJ A;  4A5X A;  3E9I A;  4CH4 A;  4HFB A;  4YJ2 E;  3ZJ2 A;  1E2A A;  1WR6 A;  1B70 B;  2KSR A;  4PJJ A;  2LM2 A;  4MHC A;  5JVD E;  4ILB A;  4OHF A;  2X0H A;  2P9B A;  3VU7 H;  3TUP A;  4E7S A;  3WAK A;  4HFV A;  3PE0 A;  1X56 A;  3CX7 B;  3PDY A;  2ZM2 A;  3VQV A;  2KXP B;  4I55 E;  2VVS A;  3ONJ A;  4IE4 A;  4TNW A;  3VBB A;  3RIA A;  1G51 A;  3W15 B;  2ZM6 T;  4HWC A;  2D0U A;  4TV9 E;  4ADZ A;  4B6X A;  3C98 B;  3X1D A;  5JH7 E;  3FZM B;  3UQ7 A;  5E0O A;  3UU4 A;  5HWY A;  2C5I T;  2D2S A;  3OYZ A;  4YCW A;  5A1L A;  2IDO B;  4CH6 A;  4UF0 A;  3L39 A;  2CBI A;  3HFZ A;  3F31 A;  3AE3 A;  3RIF A;  2DXU A;  3V7S A;  1HNZ T;  5EZY E;  4YRF A;  2IY5 A;  4PK5 A;  2C0S A;  3REX A;  5AQN B;  2ART A;  3V8L A;  5ABG A;  5LJM A;  2FBW A;  4AI6 A;  1MNE A;  3RKX A;  1I94 T;  3ONL C;  2LSG A;  3IG2 A;  4M1P A;  3KFU A;  1W9R A;  4YRE A;  1E24 A;  3SRZ A;  1BR1 A;  4GYR A;  4U74 A;  1YFS A;  2X67 A;  4HWO A;  1NYQ A;  1GGM A;  3TLW A;  3MK7 C;  2LHR A;  4DR5 T;  3WQZ A;  2A72 A;  3LG7 A;  5ABE A;  3HRI A;  4LVL A;  4I50 E;  2VVN A;  3MA9 A;  4YSY A;  3WAJ A;  4YRC A;  2DWG A;  4CXW A;  3HXZ A;  1WLE A;  4ZIB A;  4XU2 A;  1OED E;  3FZF B;  1ZHC A;  2FYK A;  4B3R T;  2KIN B;  2BKN A;  1T7S A;  2ZR2 A;  4NIQ A;  5JR9 B;  3HXV A;  5LHG B;  3R84 B;  1WYB A;  1USY C;  1GQE A;  2DCF A;  2J47 A;  3UH0 A;  4PAG A;  4DMV A;  3E08 A;  3QB5 K;  2ZT7 A;  1BR0 A;  4ZI2 C;  1PYS A;  3EFS A;  2YU1 A;  2CXL A;  4UVA B;  2E41 A;  5DQW A;  2DQ3 A;  2ZT8 A;  1VOM A;  1HX8 A;  3TLU A;  2EHO D;  5JDN A;  4AKI A;  1NJ5 A;  3VRA A;  4TWF A;  1XDO A;  1OED A;  3ESL A;  3C4X A;  2XQY A;  4X1I E;  3L09 A;  3RRC A;  2DZC A;  3PUW F;  5FVK A;  2H88 A;  4QXB B;  5HYA A;  2HPJ A;  5K1X A;  1HTJ F;  3V7C A;  2CJB A;  4K86 A;  4RMF A;  3TLT A;  4H9R C;  3EVY A;  2HN2 A;  2NTX A;  1UK5 A;  4HFI A;  5CB4 E;  3HKC E;  3IEE A;  5HEU A;  4K87 A;  4HWR A;  2JPF A;  2XQ5 A;  3CX8 B;  5BMV E;  2ODU A;  4DUY T;  3FXD B;  4P75 A;  5KX5 E;  4Z8X A;  3I1A A;  4UVC B;  4YRQ A;  3P4S A;  4GYS A;  3ZPO A;  3N9N A;  3QO5 A;  3ZT7 A;  4HN9 A;  2OLT A;  1UX4 A;  4HFH A;  4YTP A;  1B7Y A;  2ARU A;  4ILC A;  2CEA A;  2L3L A;  5L3G B;  3V7R A;  4UV8 B;  1IJ6 A;  2XQA A;  1HNX T;  2RHS B;  4LFC T;  4KHZ F;  4TVA A;  4AQF C;  3RI5 A;  2V8S V;  3QOF A;  4YHJ A;  2LKG A;  3PTR B;  3UUN A;  3UT5 E;  4IRE A;  1BR2 A;  1FIO A;  3MQZ A;  1W0B A;  2WDR A;  2JIW A;  4P71 C;  4QX7 B;  3CQX C;  3T8O A;  2V6X A;  2QRX A;  2CLY C;  3PJA J;  3FHN A;  2QHU A;  2EJG A;  3L8R A;  2ZZF A;  1XWM A;  4EYU A;  2CJ9 A;  2QGS A;  2DXT A;  5L3E B;  3DP7 A;  5HXH A;  1E1T A;  5EK4 A;  2G4C A;  2PMF A;  4P3O A;  3HR0 A;  3V5U A;  4WZX A;  5BR8 T;  3BQL A;  4OFZ A;  5HAX A;  3PU3 A;  2K5B B;  1WPY A;  3N9P A;  2ODR D;  5E3I A;  4X1K E;  3AEF A;  1KNP A;  4V1A v;  3KBU A;  4G85 A;  3EI0 A;  3EUH A;  1EOV A;  2PTF A;  3RYH E;  3PUQ A;  1I6Z A;  1X2G A;  4IDQ A;  4PK4 A;  2WAU A;  3LK2 B;  3O1J A;  4ZI3 D;  5KMG P;  1JNR A;  4X66 T;  3AXJ B;  2WWV A;  2PFV A;  4HWP A;  1M62 A;  3M4Q A;  2BG9 C;  4P73 A;  2WSS V;  5JRC B;  2LSY A;  1L0V A;  4YCU A;  3M4P A;  3AB3 B;  2K9A A;  1KEY A;  3MF2 A;  1G5I A;  3IA3 A;  3RC8 A;  2BVL A;  3KV4 A;  4DVD A;  3AE1 A;  3HI2 A;  3KV6 A;  3UFG A;  2BS2 A;  2JQQ A;  1WQ7 A;  3FJP A;  1G5H A;  5JDL A;  4JI2 T;  1XNQ T;  4U33 A;  4XU1 A;  5KNN A;  1UX5 A;  3UU3 A;  1KOG A;  1Y64 B;  3AEA A;  4F8H A;  2EJF A;  1T8B A;  4E51 A;  1VCT A;  2XSA A;  2LRL A;  3ERR A;  4HWI B;  3K1S A;  4H9Q C;  4K0U A;  3RKY A;  2WCA A;  5LNK A;  1D0X A;  4JI6 T;  5HXE A;  4YCV A;  2JQH A;  4HT4 A;  5LJN A;  1S94 A;  2E65 A;  2K3W A;  1NNH A;  4X20 E;  2FUP A;  2EHO B;  4WI1 A;  4RQF A;  2P5I A;  3ZT5 A;  3ZC0 A;  4TQD A;  5JDH A;  2KT9 A;  1MIY A;  4YP0 A;  1FMW A;  4ZTZ B;  3UUL A;  2X51 A;  3ZN0 B;  4WJ4 A;  1FJG T;  4YRM A;  1Z0P A;  4PK6 A;  3ZMS B;  4NCX A;  3HXU A;  2FJE A;  2YDS A;  3PU8 A;  1MMA A;  3ONX A;  3HXX A;  4CXY A;  3R6N A;  2ACX A;  4ERR A;  2E9X A;  2ALY A;  2NW7 A;  2SPC A;  1J5W A;  4EZH A;  4DO0 A;  4MFR A;  2OA5 A;  4NUU A;  2ZR3 A;  2UXN B;  3RX6 A;  5JR9 C;  2DNX A;  1NWM X;  2XGT A;  3IBP A;  2WQY A;  4LF6 T;  5C51 B;  5HEO A;  3H3A A;  2IC6 A;  1YB3 A;  4Z90 A;  4LVM A;  1JJC B;  3A5Y A;  4MBQ A;  5LHH B;  3EDV A;  2DU5 A;  2XTL A;  2W67 A;  4JEH B;  2D0T A;  4Q6G A;  1ZP0 A;  2R6G F;  3ZMU B;  1YKE B;  2JQK A;  4P3P A;  1E22 A;  3P8T A;  2LLY A;  5LGN B;  2LJL A;  5L4E A;  3FZL B;  3VR9 A;  4GIW A;  3L2Z A;  3SWH A;  2HHH T;  4CH3 A;  2NOX A;  5JQG E;  4HFC A;  4U3C A;  4JUY A;  2PG8 A;  5FXV A;  2XAH B;  5AQV B;  3GMI A;  2XHE B;  2E2A A;  2YKS A;  5K1P A;  2C5K T; 
#chains in the Genus database with same CATH homology
 3RKX A;  3ICA A;  3IG2 A;  5ELO A;  3KFU A;  4YRE A;  3A7U A;  4H2X A;  5C52 B;  4DPG A;  1E24 A;  1BBU A;  1SES A;  1SET A;  1YFS A;  2DKG A;  4YDQ A;  3MEY A;  4P72 A;  1YFR A;  4HWO A;  3RGL A;  1NYQ A;  3LSS A;  1GGM A;  2IY5 B;  3NEM A;  3WQZ A;  1N9W A;  3HRI A;  4LVL A;  4P73 C;  1B70 A;  2DTO A;  2DQ0 A;  4G84 A;  1X54 A;  2ZGW A;  1X01 A;  3DSQ A;  4YRC A;  3HXZ A;  1WLE A;  4ZIB A;  4XU2 A;  2P0L A;  1B7Y B;  2FYK A;  4Q15 A;  3RF1 A;  2ZR2 A;  2DTH A;  4YRT A;  1Z7M A;  2ZTG A;  3HXV A;  2QHT A;  4H02 A;  3BFM A;  1USY C;  1ATI A;  4LVJ A;  2RHQ B;  3UH0 A;  1YFT A;  3NEN A;  2ZT7 A;  3HXY A;  2PME A;  4YRS A;  4H2Y A;  2QHV A;  1PYS A;  3RL6 A;  3EFS A;  3IAL A;  5C53 B;  4XEO A;  2E41 A;  2DQ3 A;  3QTC A;  2AMC A;  1KMM A;  2ZT8 A;  3HY1 A;  1H4S A;  3QO7 A;  4P3N A;  1NJ5 A;  1HC7 A;  4X5O A;  2ZIM A;  3V8J A;  3QNE A;  2C7I A;  1EFW A;  3L4G A;  3IKM B;  2DZC A;  1SRY A;  3TEH A;  4XTX A;  4OP0 A;  4YRR A;  5K1X A;  3V7C A;  2CJB A;  2AMC B;  4XTY A;  4P74 C;  4K86 A;  4XTU A;  4RMF A;  1EIY A;  1ASY A;  2QHS A;  4KQE A;  3A31 A;  2ZZG A;  4H2W A;  4XU0 A;  4HVC A;  3VQY A;  3NET A;  1H4T A;  4H2U A;  3A7R A;  2Q7E A;  2ZIO A;  1HTT A;  4XTW A;  4K87 A;  4HWR A;  3L4G B;  1NYR A;  1B76 A;  2I4O A;  4P75 A;  1BIB A;  4TVW A;  4OLF A;  3TEH B;  4YRQ A;  4RDX A;  4RQE A;  1NJ1 A;  4J15 A;  3QO5 A;  4O2D A;  1HXD A;  1EIY B;  1B7Y A;  2ARU A;  1W66 A;  4H2V A;  3V7R A;  1WQW A;  2I4L A;  3HY0 A;  1IL2 A;  4BW9 A;  4ZTU B;  1KMN A;  2DTI A;  4XEM A;  2I4N A;  3CMQ A;  2A8E A;  1NJ8 A;  2ARS A;  2ZZE A;  3W3S A;  1QF6 A;  2RHS B;  2RHQ A;  3G1Z A;  4TVA A;  3EFR A;  1QE0 A;  3REU A;  3LC0 A;  4DQ2 A;  3BJU A;  3A5Z A;  4YPF A;  2ZCE A;  4PHC A;  3A32 A;  2XTI A;  4LNS A;  4TQF A;  3HXW A;  2E64 A;  2CGH A;  1BBW A;  4AH6 A;  4KR3 A;  3MQZ A;  4YRG A;  4P71 C;  1YGB A;  1Z7N A;  2QHU A;  4XTV A;  2EJG A;  2ZZF A;  5ELN A;  2CJ9 A;  2DXT A;  4LVK A;  1H4V B;  1LYL A;  3LSQ A;  1E1T A;  2G4C A;  4TVA B;  2PMF A;  4YRK A;  4P3O A;  4YRN A;  4YYE A;  1WPY A;  3RKW A;  2EAY A;  2ODR D;  5E3I A;  1VQZ A;  2E3C A;  4G85 A;  4PG3 A;  1ASZ A;  1EOV A;  2ZT6 A;  2E5A A;  3L1A A;  2HNI A;  4H2T A;  2DVE A;  4YRJ A;  1X2G A;  1EVK A;  3RAC A;  4KR2 A;  4EX5 A;  3R07 A;  4P72 C;  4YRL A;  3A74 A;  4L87 A;  2J3L A;  2ZNI A;  4TTV A;  2DJZ A;  4CH5 A;  3E9H A;  3P8V A;  2E10 A;  4HWP A;  2DEQ A;  3M4Q A;  4P73 A;  4HWS A;  2ALY B;  4YCU A;  3M4P A;  3PZC A;  1X55 A;  4YRP A;  3NEL A;  3QO8 A;  4YRO A;  3MF2 A;  1G5I A;  3UGT A;  5F5W A;  4YRI A;  3UFG A;  4TVY A;  2RHS A;  1EVL A;  1WYD A;  1WQ7 A;  3FJP A;  1G5H A;  4XU1 A;  5KNN A;  1KOG A;  1ADJ A;  2I4M A;  2EJF A;  4E51 A;  1H4Q A;  3MF1 A;  1USY A;  3ERR A;  2NS6 A;  3V8K A;  3RKY A;  4LVI A;  3HTZ A;  4HWT A;  3P8Y A;  4YCV A;  1E1O A;  2DU7 A;  4XTZ A;  4HT4 A;  1WU7 A;  2E65 A;  2ZT5 A;  1NNH A;  2CIM A;  3UGQ A;  2ZXF A;  3I7F A;  3HFZ B;  3TEG A;  2C8M A;  2J3M A;  4WI1 A;  4RQF A;  3PCO A;  4CS4 A;  2P5I A;  4TQD A;  2AKW A;  4UP9 A;  4WF2 A;  4YP0 A;  2ZIN A;  4CS3 A;  4ZTZ B;  2ODR C;  2Q5H A;  1B8A A;  3OD1 A;  4BWA A;  4WJ4 A;  4YRM A;  3VQW A;  1X2H A;  4UP8 A;  4WJ3 M;  2EJ9 A;  1L0W A;  4P74 A;  4NCX A;  3HXU A;  2Q7H A;  4K88 A;  4P75 C;  3HXX A;  4H2X B;  2DDZ A;  12AS A;  1NJ2 A;  2E1H A;  2Q5I A;  3PCO B;  1EQR A;  2AKW B;  3RIR A;  3VQX A;  3RUX A;  1JJC A;  1WNL A;  4HA8 A;  3IKL A;  2EWN A;  3E9I A;  4CH4 A;  2ALY A;  1J5W A;  1B70 B;  2ZNJ A;  4EO4 A;  2ZR3 A;  4CS2 A;  4UP7 A;  2XGT A;  3TUP A;  5C51 B;  2EL9 A;  1X56 A;  3VQV A;  11AS A;  1YB3 A;  5HGQ A;  4LVM A;  1JJC B;  3A5Y A;  1BIA A;  2Q7G A;  3VBB A;  1G51 A;  2DU5 A;  4XU3 A;  3HFV A;  3HRK A;  2DZ9 A;  4Q6G A;  4H2S A;  1PYS B;  3A7A A;  1ADY A;  4YCW A;  4P71 A;  4CH6 A;  4P3P A;  1E22 A;  3P8T A;  2CJA A;  3HFZ A;  4UPA A;  1NJ6 A;  2DXU A;  3V7S A;  3L2Z A;  1C0A A;  4YRF A;  4CH3 A;  2IY5 A;  4TWA A;  1SER A;  3REX A;  2ART A;  3V8L A;  1RIQ A;  1FYF A;  5K1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...