5F5WA

Crystal structure of the alpha subunit of glycyl trna synthetase (glyrs) from aquifex aeolicus in complex with an analog of glycyl adenylate (gly-sa)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
283
structure length
283
Chain Sequence
MYFQDIIMTLHKFWAEKGCLIWQPYDVEVGAGTMNPATFLKVLGKKPWNVAYVEPSRRPQDGRYGENPNRLQHYYQFQVILKPAPRNPQEIYLESLERLGINPLEHDIRFVEDDWESPTLGAWGLGWEVWLDGMEITQFTYFQQAGGLDLDEISVEITYGLERIAMYIQDKDSVFDIEWKEGITYGEIFKRSEWEWSKYNFELADTDMLFQVYEMFEKESKRMVEEGLIFPAYDYLLKCSHVFNILDARGAISVQERARYIRRMNNLAREIAKLYLQVFENVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glycine--tRNA ligase alpha subunit
publication title Structural Insights into the Polyphyletic Origins of Glycyl tRNA Synthetases.
pubmed doi rcsb
source organism Aquifex aeolicus (strain vf5)
total genus 110
structure length 283
sequence length 283
chains with identical sequence B, C, D, E
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 5f5wA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5f5wA01
3UFGA 3VQXA 1NJ6A 4TTVA 2IY5A 1USYC 1BIAA 1YFRA 2DEQA 4XTYA 4PHCA 4HA8A 1WLEA 1WQWA 4YRKA 4P74C 2DU5A 1X2HA 2DZCA 4WJ3M 2ZT6A 2J3LA 4XEMA 1EQRA 2DTIA 1G5HA 2ZTGA 2E10A 2CGHA 4EX5A 1KMNA 4XTXA 2Q5IA 3P8VA 2AKWA 2I4MA 1HXDA 3A31A 4XU3A 3A7AA 3HRIA 3A32A 1IL2A 3IG2A 2DXTA 1H4VB 2I4LA 1WNLA 4H2SA 4H2XB 4DPGA 4ZIBA 2RHSB 3M4PA 4K88A 1X55A 3KFUA 1EVLA 4P3NA 4YYEA 4YP0A 2DTHA 4HWOA 3QNEA 2ZT8A 3VQWA 3ICAA 4YCVA 4CH4A 4CH5A 3OD1A 3TEHB 1Z7NA 4TWAA 4DQ2A 4CS3A 4CS2A 2ZIOA 2AKWB 3RF1A 3LC0A 4L87A 2Q7EA 1N9WA 3RGLA 3HXYA 2EJGA 4TVAA 1B76A 4YRSA 4KR3A 1YB3A 2E3CA 3NELA 2C7IA 3PCOB 4XTWA 3W3SA 3LSQA 5C53B 1EOVA 1YGBA 1B70A 2Q5HA 1WYDA 1B8AA 3MF2A 1X56A 1X54A 2J3MA 1SESA 1QF6A 4P71A 3HXWA 2ZZGA 4P73A 2EAYA 1VQZA 3E9IA 2E41A 3V7RA 2RHQB 4P72C 4YCWA 3M4QA 1H4TA 3L4GB 2DZ9A 1WU7A 2ZGWA 3V8JA 2AMCA 3V8LA 2HNIA 4UP9A 4YDQA 3RUXA 1QE0A 4P3PA 4HWPA 1LYLA 5C51B 1PYSB 2ODRC 4P75C 4TQFA 4ZTZB 3NETA 4YRRA 2ZINA 1B7YA 4YRMA 3QO5A 3HFZA 4CH6A 4YRNA 3A5YA 1NJ2A 2QHUA 1X2GA 3E9HA 2ARUA 4WJ4A 2XTIA 3L2ZA 4XTZA 4YRPA 4HVCA 11ASA 3R07A 3FJPA 3V7CA 3QO7A 3RACA 1EFWA 2EJ9A 1YFSA 2DDZA 3MEYA 1E24A 3V8KA 3HXZA 2I4OA 4BWAA 1BBWA 4K86A 1YFTA 2DQ0A 5ELOA 4OLFA 4O2DA 4UP7A 1NYRA 4RQFA 3HXVA 1SERA 4YRQA 2Q7HA 4NCXA 1J5WA 3UH0A 2ALYA 2IY5B 2DKGA 2CJ9A 3A7UA 1ADYA 3WQZA 1W66A 1G51A 4YRCA 4WI1A 3V7SA 1HC7A 3MF1A 4H2WA 1JJCA 1ADJA 4YRFA 3UGQA 1EIYA 3REXA 4HWSA 1EVKA 4G85A 3EFRA 4RQEA 3DSQA 3VQVA 2G4CA 5HGQA 1ATIA 1USYA 4UP8A 1WQ7A 3HY1A 4WF2A 2ZT7A 2E1HA 2E64A 3HRKA 3ERRA 2ZZEA 4P74A 4J15A 2EJFA 4YPFA 4XU0A 3HXUA 2ZXFA 2ARTA 2DXUA 3A74A 4H2TA 5K1XA 1NJ8A 3P8TA 1NYQA 3QTCA 4TVWA 1RIQA 3CMQA 2QHSA 4TQDA 1H4SA 2ZR3A 4YRJA 1NJ5A 4YROA 3A5ZA 3QO8A 2P0LA 12ASA 4G84A 4AH6A 2QHTA 1C0AA 2EL9A 3HTZA 4H02A 3G1ZA 4TVAB 2DJZA 1NNHA 4YRTA 4K87A 4ZTUB 2ZCEA 3IKMB 4HWRA 1B70B 4CS4A 4YCUA 2ZR2A 3BJUA 3TEGA 1X01A 1H4QA 4H2XA 2RHSA 1BIBA 2ODRD 3TUPA 4KQEA 4YRGA 2ZIMA 4YRLA 1GGMA 1ASYA 1NJ1A 2ZT5A 4H2UA 2AMCB 3TEHA 5ELNA 4XTVA 3RKXA 3VQYA 4KR2A 2CIMA 1E1TA 2DVEA 4LNSA 4X5OA 3A7RA 4P71C 4YRIA 3HY0A 3RL6A 4P73C 1E22A 1KMMA 2E5AA 1BBUA 4EO4A 1Z7MA 1B7YB 5E3IA 4RMFA 3HFZB 3PCOA 2Q7GA 4P72A 1KOGA 4PG3A 5K1PA 4HWTA 4XTUA 4Q6GA 4Q15A 3RKWA 4BW9A 2DU7A 1SETA 3IALA 3L1AA 1G5IA 4P75A 4XU1A 3RIRA 2CJBA 1E1OA 2RHQA 5C52B 3NEMA 3P8YA 3VBBA 3L4GA 1SRYA 3BFMA 2DQ3A 4TVYA 2ZZFA 2I4NA 2DTOA 3IKLA 4CH3A 2ALYB 2PMEA 1PYSA 3HXXA 2ZNJA 3HFVA 3EFSA 2P5IA 1ASZA 3PZCA 3NENA 3REUA 4YREA 5F5WA 4E51A 4XEOA 1JJCB 1WPYA 5KNNA 1EIYB 2ARSA 3LSSA 2FYKA 4H2YA 2C8MA 3UGTA 4XU2A 3RKYA 2ZNIA 4UPAA 2EWNA 4H2VA 1FYFA 3I7FA 2PMFA 1L0WA 2CJAA 2E65A 4RDXA 2XGTA 2QHVA 4P3OA 1HTTA 4OP0A
chains in the Genus database with same CATH superfamily
2D5UA 1XWMA 1NJ6A 2IY5A 1US7B 4EOZB 4HWFA 4LF4T 1BIAA 2DEQA 2JQKA 2YN6A 3JADA 4DV1T 4PHCA 1WLEA 4YRKA 4AKRB 3RYFE 2AXDS 3PUZF 5JDGA 4LVIA 3AE8A 2YU2A 5DJQC 4IDOA 1MMNA 2XSAA 2J3LA 1D1CA 2DTIA 3RC8A 4DV2T 2MOZA 3Q5WA 2ZTGA 5L3CB 2E10A 2HHHT 2ES0A 4XTXA 2Q5IA 2AKWA 1MIWA 3P4WA 1HXDA 3A31A 2EHOA 3KBTA 3A32A 1IL2A 4EGWA 2LJLA 2V6YB 4OHFA 4EV6A 5H6RB 3MACA 4A98A 5LP6E 2I4LA 1WNLA 4DPGA 2NTYA 1YKHB 2OLTA 1UX5A 4K88A 5M4YA 3ABVA 1SA0E 3KINB 1EVLA 4YYEA 4FJOA 5CB4E 4JI4T 2WU5A 3QB5K 3AA6B 3CPZA 3SWHA 3ICAA 4G63A 4YCVA 1HG2A 3GN5B 4EYYR 4CH4A 3M3ZB 5J1GA 3MZKB 1G73A 1KNZA 4TWAA 3EVYA 1CHUA 2UUAT 5L3EB 3UUBA 4COFA 4EEBA 1W9RA 2AKWB 3RF1A 4L87A 1D0XA 4O4LE 5JDLA 4K0UA 4CI2B 1WR6A 4J2CA 4UIGA 2E3CA 2E2AA 3NKZA 3LSQA 2BG9B 2YDQA 4YJ2E 2YEVC 1X56A 1X54A 4Z91A 4DBQA 4KHPT 3HXWA 2EAYA 2WS3A 3C4ZA 2ODUA 3ZEFB 3V7RA 4P72C 5HXHA 4GK5E 3LK2B 2Y8DA 2OV9A 3ZCIA 3EI0A 3E0ZA 2HNIA 1IJ6A 2WZHA 4P3PA 1G8XA 1VRBA 2BS4A 3J9X1 2VWAA 2WCAA 4TQFA 4ZTZB 2V8SV 3R84B 1WLXA 2ZINA 1B7YA 2XQ4A 3KV6A 4EAHA 4CH6A 3A5YA 1NJ2A 4U72A 4LF8T 4YT0A 4DO0A 5AQKB 5HXSA 1R8IA 3FJPA 1E24A 4U7YA 3F57A 2DLRA 2WDRA 4NIQA 2IUBA 2I4OA 2WWVA 2H7OA 1XMOT 5LCYA 5ELOA 1UGOA 2NS6A 1NYRA 1KFYA 4RQFA 5FYMA 1XZYA 2XJ7A 4M1PA 3P7IA 1OEDE 2BS3A 4U2ZA 4LVMA 4LF9T 3UH0A 1HCIA 1FMVA 3AE4A 3AA0B 4TWFA 2V7KA 1NENA 2D2SA 3V7SA 1HR0T 2FUPA 4I0UA 1JJCA 4YRFA 4HWDA 5HCMA 3RLFF 1EIYA 2C5IT 3REXA 1XNRT 3WAJA 1NAFA 3WI3A 4G85A 2Y48B 3RHWA 5AQMB 2VQFT 1ATIA 4DUYT 3AE6A 2XUEA 4WF2A 1ZHCA 3AEDA 4O2AE 1YQ3A 3T8OA 3ERRA 4JI2T 3N9NA 4X65T 1HNZT 5AQPB 3SOLA 2VURA 2VVSA 5KX5E 1WCRA 4DR4T 3NVOA 3P4QA 4IDZA 3OYZA 4H2TA 5CFBA 4E7SA 5L2LA 2X68A 5K1XA 2H89A 1NJ8A 2F4VT 3V5UA 2XASB 5HWXA 1RIQA 5JQGE 3CMQA 3PUSA 4F8HA 2V7LA 2M6IA 4YHHT 4PJNA 2CPTA 12ASA 3VR9A 4AH6A 4KX6A 1C0AA 2EL9A 3HTZA 4YRTA 2BDEA 4K87A 3Q5XA 3UTKA 4ZTUB 2ZCEA 5JDMA 4EB6E 4DBRA 2QYWA 4YCUA 4O4JE 1U4QA 3TEGA 1X01A 2I6HA 1I94T 4H2XA 2HN1A 4H9RC 2LHNA 4C91A 3AEEA 5CA1E 3AAAB 1BIBA 2E8IA 2R6GF 4KHZF 4ZI2C 2BKNA 3ONXA 4MBQA 4KQEA 5HEGA 4YSZA 2BVMA 1VCSA 3UU5A 1ASYA 2ZT5A 5FKYA 2AMCB 1BR4A 2V5CA 2LKGA 3VQYA 5C8YE 3N5LA 2CIMA 4H9SE 4UF0A 4YY3T 4LNSA 4X5OA 3A7RA 4P71C 4YRIA 2WDQA 3PE0A 3RL6A 4KP3C 2W0GA 1KMMA 1J1JA 4ZI2D 2E9XB 1Z7MA 3NZQA 5E3IA 3HFZB 3PCOA 2Q7GA 4P72A 2E5VA 4PG3A 1SE7A 1BR0A 4EZ4A 4HWTA 1MNDA 2YOEA 3RIAA 1HX1B 3P50A 5AQQB 2V7MA 4BA9A 2DU7A 3HKDE 3IALA 5AQSB 1EZ3A 3VU7H 3SFEA 3FHNA 3AECA 1G5IA 4XU1A 2RHQA 3P8YA 2X67A 3L4GA 4EYUA 5HEUA 2DQ3A 5JDHA 2WSSV 3VR8A 3B57A 4YXDA 2DWKA 1FEWA 3Q2MA 4PK6A 4DUZT 2ALYB 3JC6C 3ZJ2A 2XPKA 5HWYA 3UUXB 3NBXX 4DV0T 2P5IA 5LMNT 3PUGA 1YKEB 2J47A 1W0BA 2CBIA 5F5WA 4E51A 4JI6T 3OKQA 5EK4A 3PV0F 3ZN0B 4PNIA 2AE9A 5HEOA 3CVRA 5L3GB 2KT9A 1XNQT 5FXXA 2KNDA 2D0UA 2GK9A 2EWNA 1L0WA 4RDXA 2BVLA 1Y01A 2I59A 2YINA 1JNZA 5C2TA 4OX9T 2HPLA 2X9HA 4OP0A 4ZZCA 3LBXB 3VQXA 4U74A 4TTVA 1H7CA 4A97A 3FBZA 2D9DA 2UXBT 2W63A 5AQUB 2V1DB 4U3CA 1WQWA 2JQ9A 5BR8T 4HFVA 3U78A 1ZP0A 4XEMA 4CXXA 2XQ9A 3AE2A 3RQWA 2XAQB 1G5HA 3I1AA 2D0TA 5L3DB 1D0YA 2CGHA 1KMNA 2W61A 5LHGB 4UVBB 3I9WA 3E22E 3A7AA 3HRIA 3PU8A 1ZKEA 2LSJA 3K8PC 2N9DA 2M6BA 1H4VB 1KNPA 2V5DA 4P1NA 4H9QC 4QH5A 3QB5A 4PFOA 4HFEA 4LFCT 1HNWT 4NXMT 3KFUA 2UXCT 4X62T 5AQIB 3QNEA 3ONLC 2ZT8A 3TEHB 5AQRB 2LSKA 2XM2A 3JCFA 4CS3A 2WBLA 3ZSTA 4ZI3C 3RGLA 3VHLA 4OYJA 2A2FX 5JH7E 1B76A 4KR3A 4H63H 3N9QA 2VQET 3NELA 3AVSA 3LK3B 4LMJA 5C53B 2LRKA 5EK3A 4ERRA 1YGBA 1B70A 4ZZBA 5ABFB 4AKIA 2X0YA 2CXLA 3ZSSA 3PDYA 4JI8T 2C5JA 1MMDA 2J3MA 2B76A 3UFEA 1D1BA 4P71A 5FY7A 4ZI3D 2M67A 2XQ8A 1VQZA 3ZCJA 2E41A 2W2UA 3M4QA 1H4TA 5LB7B 3X1DA 3N9LA 1WU7A 2ZGWA 5AQVB 3PJAA 4DR7T 3V8LA 4UVAB 2LT3A 2UXXB 5LNKA 1ZV4X 2IDOB 4KI0F 4BJMA 1QE0A 3TLTA 2XZEA 4HWPA 1S35A 3K3OA 4JLEA 4QKNA 2ODRC 3NETA 4IDQA 1X79A 3EDUA 4YRNA 2KXPB 2WM9A 3K3QC 3NRYA 3ZT6A 2CHOA 2LRLA 2QHUA 4ISTA 2JQQA 2V7IA 11ASA 2L3LA 2XAJB 5L4HA 3RACA 5JVDE 4JI5T 1YFSA 5GONE 2DDZA 4LMLA 2N1GA 5FL0A 2IHR1 4IE5A 4MFRA 3V8KA 3Q9DA 4BWAA 3SRZA 2CCQA 1YFTA 1NEKA 4OLFA 3HKBE 4B3ST 4UP7A 1IBLT 3K3NA 4PJLA 3HXVA 1SERA 4E7ZA 2Q7HA 4ILAA 4NCXA 1JNRA 3I0OA 1MNEA 1VCTA 2IY5B 5FMNA 2DKGA 5KMGP 4GYRA 3QUJA 3A7UA 3WQZA 1G51A 3RRWA 4WI1A 1SUMB 3DJBA 3MF1A 4JUYA 4H2WA 1ADJA 1LRZA 5JRCA 1EVKA 1YW0A 3BQIA 3DSQA 2W4XA 5HGQA 2E9XC 3ZN1B 2ZM2A 4AKHA 2Q9QC 1WQ7A 1BR1A 2EHOB 2UXNB 3P4RA 3HY1A 4GK0E 5HXCA 2E1HA 1V9DA 3KFWX 4IL4A 3NZPA 3RI5A 3IF8B 2X0LB 3ZMVB 4J15A 4XU0A 3C50A 1N34T 2ARTA 5TAOA 2W00A 3UQ4A 2PTFA 3N2KE 3C4XA 2YDRA 4GKJT 2NW8A 1H4SA 3CX8B 3UUMA 4CN4A 5LGUB 4YROA 3QO8A 3UUNA 4PJMA 3HKCE 3HKEE 1T7SA 3OJAA 2ODVA 5LG3A 5HEJA 1Z8UA 3FZMB 4QX7B 2YDSA 1NNHA 2DJZA 1S94A 5L3BB 3O1JA 4YLHA 4LFBT 2VKDA 3IKMB 4OYKA 1KEYA 3C4WA 3BJUA 4UELA 4U2YA 2XY8B 2RHSA 3EUHA 2CXDA 3FXEB 4XBFB 3UU8A 2PFVA 4TX5A 4WZXA 5LGTB 3F2EA 3ZC1A 4LVLA 2LSGA 2LSIA 1NJ1A 3N2GE 3ZPOA 5AQHB 5ELNA 4XTVA 2WZIA 4KR2A 1U5PA 3AXJA 2DVEA 4X64T 2ZMAA 3LFMA 4CXYA 4IIJE 3C64A 5AQLB 3AE1A 4IL9A 1OEDA 4QXHB 3N2OA 2V6XA 3BQKA 4EO4A 1B7YB 2PJQA 2KINB 1KOGA 2A9UA 1UK5A 2SPCA 5K1PA 4XTUA 4IT4A 3AAEB 3L8RA 1AJ3A 4B3RT 3RKWA 3RIUC 4BW9A 5CGMA 1SETA 4UXNB 5FXZA 3CX7B 4AKGA 4FI5A 2FJEA 1N36T 3AA1B 2QA7A 2UU9T 3NEMA 4AQFC 2DL1A 4WYVA 3BFMA 4TVYA 4AQGA 2P9BA 4IE0A 2IC9A 2XAGB 1PYSA 3L09A 5ABEA 4DR1T 5F8PA 3EFSA 3ZYLA 5JDQA 1ASZA 3PZCA 3L3PA 2CLYB 3AEBA 2ZM8A 3KVAA 2IMLA 1JJCB 1HNXT 5JR9C 3ZMUB 1EIYB 5JDFA 4HWHA 3LSSA 5LGNB 5EK2A 4HFDA 3KBUA 2BKPA 4XU2A 3RKYA 4CI3B 2RPAA 4OK0A 2IIUA 2VKJA 4ANJA 1FYFA 2PMFA 2LM2A 4P3OA 1HTTA 4BAYB 4QHOA 2CEAA 4IDPA 5AQJB 1USYC 3D0TA 5AQGB 1YFRA 2HPJA 2A8EA 2XQYA 2Q9QA 2LM9A 4HA8A 2L9QA 2DZCA 4JEHB 4O4IE 3CQXC 4WJ3M 1EQRA 2LE8A 2MYSA 2ZM6T 3PUAA 4N78D 4EX5A 1T8BA 2WDVA 4PK4A 3P8VA 2I4MA 1WYBA 3AE5A 3DP7A 3IG2A 5DQVA 4B3MT 2X9YA 2XTLA 3ANWA 4HFBA 4H2XB 2NTXA 3ZYKA 2XQ5A 4JI7T 5HCJA 3M4PA 1LKXA 2X0HA 4ISSA 1J5ET 4OFZA 3MJXA 4YP0A 2DTHA 4HWOA 4QH1A 3VQWA 2DHRA 1MMGA 3RYIE 2CHNA 5CJ5A 2CMRA 5KXJA 3OD1A 1KNRA 2VKHA 4UF0B 4DQ2A 3O4XE 5FVKA 4DMWA 3PUVF 2ZIOA 2X51A 2CWYA 3ONJA 3RYCE 2EJGA 4TVAA 4PK5A 2VK9A 1YB3A 3PCOB 4XTWA 3W3SA 4PJJA 2BBJA 2BKOA 1EOVA 4AI6A 2JMKA 2Q5HA 2WU2A 1WYDA 3MF2A 2XAFB 5FL1A 1W09A 2HH7A 3MKDA 2V26A 3TLWA 4ADZA 3UULA 1SESA 4Z90A 4GYSA 3JC6D 4WBNE 2MPKA 4ILUA 3E9IA 2XQ6A 2KMFA 2WAUA 2RHQB 4YCWA 4DR3T 2BG9C 2DZ9A 3L4GB 5L3FB 3NRXA 5JTGA 4LF5T 2BBHA 2IC6A 4IE7A 1Z0PA 5HXRA 4V1Av 3RUXA 3RIUA 4P09A 4UVCB 5FNVE 4JI0T 1LYLA 5C51B 1NWMX 2FJDA 5KDMC 4P75C 4IDNA 3UQ7A 4A5XA 4TWHA 4YRMA 2DWGA 3QO5A 4TV8E 4WW0A 3RPUA 2IAKA 3NWIA 3R6NA 1W0AA 2B1EA 3AVRA 3IBPA 1X2GA 3E9HA 3SS1A 2UUCT 2JJ9A 1BR2A 4G2AA 2XTIA 1FIOA 4XTZA 2X66A 4YRPA 3RIFA 5IUXA 4HVCA 2ACZA 4XZCA 1I6ZA 1EFWA 3UU4A 2QRXA 3N9MA 4ZI7E 4UR9A 4UV8B 4DIDB 1BBWA 2XQ7A 2LLYA 4H9OC 5ADXL 3MQZA 4HFCA 4O2DA 2LOPA 5JR9A 4YRQA 3KV5A 2X9XA 1OWAA 4IE4A 2LSYA 5J0ZA 1E1HB 3T1HT 1W66A 4YRCA 3QNUA 2RA1A 4DV5T 3EFRA 2KZ7B 4RQEA 3VQVA 1N33T 2A3DA 3KDSE 1XDPA 1USYA 2LEHA 1D1AA 4UP8A 2VB6A 1WRDA 1M7KA 4IE6A 2ZZEA 5AQOB 1WR0A 1FMWA 2J62A 2EJFA 4YPFA 2WY2A 4CQIA 2ZXFA 2DXUA 4NPPA 3A74A 3HL6A 1D0ZA 2XAHB 2ACXA 3P8TA 3QTCA 4TVWA 2W67A 4EIWA 4JEUB 2QHSA 1ZEEA 3EABA 1IJ5A 2JPFA 2ZR3A 4YRJA 2HN2A 1NJ5A 3I9YA 1MIVA 2CA5A 3A5XA 3M65A 2P0LA 3KV4A 4G84A 4PFPA 4IGUA 2C0SA 4TNVA 4H9NC 1IAPA 3G1ZA 3WAKA 3AE3A 3PJAJ 2V6YA 4HWRA 1B70B 1SHZC 3RH3A 3E08A 2E5LT 5LJMA 2PBIA 1VOMA 5LHHB 5E0OA 3DTOA 3PUQA 4X1YE 4HWCA 2ODRD 3PTRB 4YRGA 2YKSA 1GGMA 3GN5A 3TLSA 4H2UA 4DNDA 4ILCA 3TKLB 2XHEB 4P73C 3IHRA 2YK0A 3PUXF 2E5AA 1BBUA 2BG9E 3ZMZB 2CM0A 4RMFA 3AEGA 2I0MA 2CWOA 3GMIA 2BG9A 2OA5A 4Q6GA 4C90A 4Q15A 1YD8G 3ZMSB 3AB3B 4A56A 1CUNA 3I0QA 1WFDA 4X1IE 3FXDB 3CWZB 3L1AA 5HEHA 4IREA 3RRCA 4P75A 3H37A 3P4PA 2G0UA 2XSBA 2CJBA 1E1OA 5C52B 3VBBA 3ESLA 4P0BA 4QXCB 4DR5T 1SRYA 4AQYT 4UEMA 2IW5B 2ZZFA 3ZJ1A 4UV9B 4KMCA 4JI3T 2JRKA 1FJGT 5HXEA 4K0KT 2BS2A 3IKLA 4AKLA 4DR6T 2PMEA 3PU3A 3IA3A 2ZNJA 2JQHA 3MXZA 4DVDA 3IEEA 5C3JA 2E9XD 3NENA 4GOUA 2Q9QD 3ZKRA 2QVAA 4XEOA 3RYHE 1WPYA 5KNNA 4IHJE 3ZLIA 4X1KE 5JRCB 5J2UE 3CMLA 4LMKA 2FYKA 4TWDA 4MALA 3UU6A 4U33A 3F31A 3UGTA 3ZT7A 4JYAT 5JDNA 3FZHB 4UPAA 3BK9A 3AA7B 3HR0A 2ZM0A 2VL0A 3B5MA 5FY1A 5H6QB 3CQGB 2QHVA 3AE7A 5LBQB 3T1YT 3UFGA 5ABGA 1KF6A 3UU3A 2WP9A 3KVBA 1LVKA 4ASKA 1HG5A 4XTYA 4DV3T 3TLVA 2UUBT 1LVFA 2DCFA 5BMVE 4P74C 5ETWA 3OTOT 1X2HA 5LA6E 2DU5A 2ZLYA 3AEAA 5LOVE 4GKKT 4L5GA 2ZT6A 4HE8A 4YHJA 4LF6T 5LMUT 3JAEA 1Y64B 2W62A 1WYCA 4CN1A 1OXZA 4HTEA 4AXPA 4HKAA 4ZHQE 2XQAA 4XU3A 1YQ4A 2K48A 1UUSA 4U31A 3S4UA 2DXTA 2V7JA 2JIWA 4I55E 2UXDT 4KBMB 4H2SA 3H3AA 3OPCA 2LKHA 3MK7C 4ZIBA 5DQWA 2RHSB 3RQUA 3W15B 3EDVA 1X55A 3BQLA 2QGSA 2WWUA 4P3NA 4JV5T 3C51A 3AEFA 1M62A 2J4GA 4I50E 3LDQB 4HN9A 4CH5A 1Z7NA 3AXJB 3OVUA 2XQ3A 4CS2A 2MTQA 2CBJA 3LC0A 2Q7EA 1N9WA 1OEDB 3QK6A 5ABHA 3HXYA 3EAMA 1UURA 4YRSA 2C7IA 3GA8A 4X66T 2N2NA 3ZC0A 2KWHA 3FZKB 1B8AA 5HAXA 4DV7T 1E7PA 1XDOA 3UT5E 2DI4A 4YSXA 3SFDA 1HF8A 4TNWA 1QF6A 2LOSA 2ZZGA 4P73A 2YU1A 2BZBA 2C5KT 4O2BE 4AISA 4LVKA 2Z6EA 3J7Yq 4ZS3A 3P4SA 3RX6A 3CKDA 4ILBA 3V8JA 2AMCA 4UP9A 4YDQA 3P8CD 3CX6B 3V5SA 3L39A 1HFAA 1PYSB 4QH4A 3C98B 4CN6A 4YRRA 3VKHA 1IBKT 3LJCA 2E9XA 3HFZA 1GQEA 5LJNA 4NUVA 2PG8A 4O8SA 2ARUA 4WJ4A 3L2ZA 4HGAA 3N9OA 3CQCB 3R07A 3V7CA 3QO7A 3K1SA 4PW8A 2J1DG 3A7MA 3ZYMA 3ZT5A 2EJ9A 3MEYA 5L47A 1IZNB 2H88A 3FZLB 3VKGA 2NR4A 3HXZA 2X9WA 5A1LA 4BJNA 5LBMA 3B13A 4K86A 3CIRA 2DQ0A 1QSDA 2XM1A 3N9PA 4YJ3E 4B3TT 3LK42 2K3WA 3RKGA 3Q5EA 5HYAA 4TV9E 5FXWA 4TUYE 4HEAA 2H7VC 1J5WA 4LVJA 2A72A 1O3XA 2ALYA 3ETVA 4MLKA 4KUMB 3O1HA 2CJ9A 3KV9A 3FB2A 1ADYA 2WMNA 2Q9QB 4DV6T 4XAXB 4PAGA 5DABA 2CE7A 1HC7A 2NP9A 1N32T 4YFSA 4B6XA 5LYJE 3UGQA 4ZS2A 4HWSA 2K24A 2K5BB 1YXRA 2KSRA 2JMHA 1KK7A 3O9XA 2G4CA 2KWIB 4H9PC 1IBMT 2NW9A 4I43B 2E64A 3RKOA 2ZT7A 3HRKA 2L8KA 4P74A 3ANWB 2VKOA 2H3RA 3HXUA 3LBXA 3HI2A 3LSVA 4DV4T 2Y6XA 3QOFA 1NYQA 2EHOC 3ZMTB 1T98A 3U3IA 4EXTA 4ZEYA 4YTMA 3AAIA 4DMVA 3CK6A 4TQDA 4WBOA 4NXNT 3PUWF 1UX4A 1XMQT 3A5ZA 2QHTA 2NWBA 2CRBA 4H02A 4TVAB 2EHOD 4EEDA 4JI1T 1QLBA 5IHYA 1T72A 2W66A 4AQFA 3VRAA 3FZFB 1ZOYA 4CS4A 4YSYA 2ZR2A 3MA9A 4P0AA 1H4QA 4L9IA 3HA4A 4HFHA 4TZ4C 4EZHA 3JAFA 4GIWA 2MAWA 3TUPA 4TN7B 2VASA 4CXWA 2ZIMA 4YRLA 2LHRA 1MMAA 2RP4A 4X20E 3TEHA 4Q25A 5FP3A 5AFUL 3RKXA 3EHZA 1E1TA 4QXBB 1UCUA 5FVLA 2K9AA 3HY0A 4I4TE 1E22A 4ZOLE 2FBWA 4YTPA 4HT4A 4LFAT 4JBWF 4NUUA 1HS7A 3AE9A 4YTNA 4CI1B 4F6RC 2FJAA 3H3MA 5ABFA 3OYXA 4LF7T 4U7IA 1E2AA 2DNXA 5AQTB 4Z8XA 3Q5DA 2NOXA 5FY0A 4MHCA 3G06A 3RIRA 3OBVE 2FJBA 1L0VA 5EZYE 3ETUA 4DR2T 4QWNB 4H63V 3O1IA 5LG4A 2WB5A 2WQYA 5JR9B 3PURA 2I4NA 2DTOA 5AQFB 4ZXLA 5LXTE 5FXVA 4CH3A 5CA0E 5LHIB 2CXFA 3HXXA 3GWHA 1HX8A 1DU2A 3HFVA 2VL8A 4QX8B 2VVNA 4L0RA 4WNKA 3A8YC 4CZZB 3REUA 1HTJF 4YREA 5L4EA 5JREA 3QC9A 2ARSA 5AQNB 5F3JA 3PUYF 1MIYA 2KLQA 5IYZE 1OEDC 4H2YA 3RC3A 2C8MA 4HFIA 3VRBA 4AIUA 2ZNIA 4O4HE 4X5TA 4HWIB 5IWAT 3FBLA 4H2VA 2CLYC 3I7FA 2CJAA 1QUUA 2E65A 2WMOA 1B7TA 3TLUA 3LG7A 2XGTA 1X9BA 2MBGA 2NW7A 5J2TE
chains in the Genus database with same CATH topology
3UFGA 3VQXA 1NJ6A 4TTVA 2IY5A 1USYC 1BIAA 1YFRA 2DEQA 2A8EA 4XTYA 4PHCA 4HA8A 1WLEA 1WQWA 4YRKA 4LVIA 4P74C 2DU5A 1X2HA 2DZCA 4WJ3M 2ZT6A 2J3LA 4XEMA 1EQRA 2DTIA 1G5HA 2ZTGA 2E10A 2CGHA 4EX5A 1KMNA 4XTXA 2Q5IA 3P8VA 2AKWA 2I4MA 1HXDA 3A31A 4XU3A 3A7AA 3HRIA 3A32A 1IL2A 3IG2A 2DXTA 1H4VB 2I4LA 1WNLA 4H2SA 4H2XB 4DPGA 4ZIBA 2RHSB 3M4PA 4K88A 1X55A 3KFUA 1EVLA 4P3NA 4YYEA 4YP0A 2DTHA 4HWOA 3QNEA 2ZT8A 3VQWA 3ICAA 4YCVA 4CH4A 4CH5A 3OD1A 3TEHB 1Z7NA 4TWAA 4DQ2A 4CS3A 4CS2A 2ZIOA 2AKWB 3RF1A 3LC0A 4L87A 2Q7EA 1N9WA 3RGLA 3HXYA 2EJGA 4TVAA 1B76A 4YRSA 4KR3A 1YB3A 2E3CA 3NELA 2C7IA 3PCOB 4XTWA 3W3SA 3LSQA 5C53B 1EOVA 1YGBA 1B70A 2Q5HA 1WYDA 1B8AA 3MF2A 1X56A 1X54A 2J3MA 1SESA 1QF6A 4P71A 3HXWA 2ZZGA 4P73A 2EAYA 1VQZA 3E9IA 2E41A 3V7RA 2RHQB 4P72C 4YCWA 3M4QA 1H4TA 4LVKA 3L4GB 2DZ9A 1WU7A 2ZGWA 3V8JA 2AMCA 3V8LA 2HNIA 4UP9A 4YDQA 3RUXA 1QE0A 4P3PA 4HWPA 1LYLA 5C51B 1PYSB 2ODRC 4P75C 4TQFA 4ZTZB 3NETA 4YRRA 2ZINA 1B7YA 4YRMA 3QO5A 3HFZA 4CH6A 4YRNA 3A5YA 1NJ2A 2QHUA 1X2GA 3E9HA 2ARUA 4WJ4A 2XTIA 3L2ZA 4XTZA 4YRPA 4HVCA 11ASA 3R07A 3FJPA 3V7CA 3QO7A 3RACA 1EFWA 2EJ9A 1YFSA 2DDZA 3MEYA 1E24A 3V8KA 3HXZA 2I4OA 4BWAA 1BBWA 4K86A 1YFTA 2DQ0A 5ELOA 4OLFA 3MQZA 2NS6A 4O2DA 4UP7A 1NYRA 4RQFA 3HXVA 1SERA 4YRQA 2Q7HA 4NCXA 1J5WA 4LVJA 4LVMA 3UH0A 2ALYA 2IY5B 2DKGA 2CJ9A 3A7UA 1ADYA 3WQZA 1W66A 1G51A 4YRCA 4WI1A 3V7SA 1HC7A 3MF1A 4H2WA 1JJCA 1ADJA 4YRFA 3UGQA 1EIYA 3REXA 4HWSA 1EVKA 4G85A 3EFRA 4RQEA 3DSQA 3VQVA 2G4CA 5HGQA 1ATIA 1USYA 4UP8A 1WQ7A 3HY1A 4WF2A 2ZT7A 2E1HA 2E64A 3HRKA 3ERRA 2ZZEA 4P74A 4J15A 2EJFA 4YPFA 4XU0A 3HXUA 2ZXFA 2ARTA 2DXUA 3A74A 4H2TA 5K1XA 1NJ8A 3P8TA 1NYQA 3QTCA 4TVWA 1RIQA 3CMQA 2QHSA 4TQDA 1H4SA 2ZR3A 4YRJA 1NJ5A 4YROA 3A5ZA 3QO8A 2P0LA 12ASA 4G84A 4AH6A 2QHTA 1C0AA 2EL9A 3HTZA 4H02A 3G1ZA 4TVAB 2DJZA 1NNHA 4YRTA 4K87A 4ZTUB 2ZCEA 3IKMB 4HWRA 1B70B 4CS4A 4YCUA 2ZR2A 3BJUA 3TEGA 1X01A 1H4QA 4H2XA 2RHSA 1BIBA 2ODRD 3TUPA 4KQEA 4YRGA 2ZIMA 4YRLA 1GGMA 4LVLA 1ASYA 1NJ1A 2ZT5A 4H2UA 2AMCB 3TEHA 5ELNA 4XTVA 3RKXA 3VQYA 4KR2A 2CIMA 1E1TA 2DVEA 4LNSA 4X5OA 3A7RA 4P71C 4YRIA 3HY0A 3RL6A 4P73C 1E22A 1KMMA 4HT4A 2E5AA 1BBUA 4EO4A 1Z7MA 1B7YB 5E3IA 4RMFA 3HFZB 3PCOA 2Q7GA 4P72A 1KOGA 4PG3A 5K1PA 4HWTA 4XTUA 4Q6GA 4Q15A 3RKWA 4BW9A 2DU7A 1SETA 3IALA 3L1AA 1G5IA 4P75A 4XU1A 3RIRA 2CJBA 1E1OA 2RHQA 5C52B 3NEMA 3P8YA 3VBBA 3L4GA 1SRYA 3BFMA 2DQ3A 4TVYA 2ZZFA 2I4NA 2DTOA 3IKLA 4CH3A 2ALYB 2PMEA 1PYSA 3HXXA 2ZNJA 3HFVA 3EFSA 2P5IA 1ASZA 3PZCA 3NENA 3REUA 4YREA 5F5WA 4E51A 4XEOA 1JJCB 1WPYA 5KNNA 1EIYB 2ARSA 3LSSA 2FYKA 4H2YA 2C8MA 3UGTA 4XU2A 3RKYA 2ZNIA 4UPAA 2EWNA 4H2VA 1FYFA 3I7FA 2PMFA 1L0WA 2CJAA 2E65A 4RDXA 2XGTA 2QHVA 4P3OA 1HTTA 4OP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UFG A;  3VQX A;  1NJ6 A;  4TTV A;  2IY5 A;  1USY C;  1BIA A;  1YFR A;  2DEQ A;  4XTY A;  4PHC A;  4HA8 A;  1WLE A;  1WQW A;  4YRK A;  4P74 C;  2DU5 A;  1X2H A;  2DZC A;  4WJ3 M;  2ZT6 A;  2J3L A;  4XEM A;  1EQR A;  2DTI A;  1G5H A;  2ZTG A;  2E10 A;  2CGH A;  4EX5 A;  1KMN A;  4XTX A;  2Q5I A;  3P8V A;  2AKW A;  2I4M A;  1HXD A;  3A31 A;  4XU3 A;  3A7A A;  3HRI A;  3A32 A;  1IL2 A;  3IG2 A;  2DXT A;  1H4V B;  2I4L A;  1WNL A;  4H2S A;  4H2X B;  4DPG A;  4ZIB A;  2RHS B;  3M4P A;  4K88 A;  1X55 A;  3KFU A;  1EVL A;  4P3N A;  4YYE A;  4YP0 A;  2DTH A;  4HWO A;  3QNE A;  2ZT8 A;  3VQW A;  3ICA A;  4YCV A;  4CH4 A;  4CH5 A;  3OD1 A;  3TEH B;  1Z7N A;  4TWA A;  4DQ2 A;  4CS3 A;  4CS2 A;  2ZIO A;  2AKW B;  3RF1 A;  3LC0 A;  4L87 A;  2Q7E A;  1N9W A;  3RGL A;  3HXY A;  2EJG A;  4TVA A;  1B76 A;  4YRS A;  4KR3 A;  1YB3 A;  2E3C A;  3NEL A;  2C7I A;  3PCO B;  4XTW A;  3W3S A;  3LSQ A;  5C53 B;  1EOV A;  1YGB A;  1B70 A;  2Q5H A;  1WYD A;  1B8A A;  3MF2 A;  1X56 A;  1X54 A;  2J3M A;  1SES A;  1QF6 A;  4P71 A;  3HXW A;  2ZZG A;  4P73 A;  2EAY A;  1VQZ A;  3E9I A;  2E41 A;  3V7R A;  2RHQ B;  4P72 C;  4YCW A;  3M4Q A;  1H4T A;  3L4G B;  2DZ9 A;  1WU7 A;  2ZGW A;  3V8J A;  2AMC A;  3V8L A;  2HNI A;  4UP9 A;  4YDQ A;  3RUX A;  1QE0 A;  4P3P A;  4HWP A;  1LYL A;  5C51 B;  1PYS B;  2ODR C;  4P75 C;  4TQF A;  4ZTZ B;  3NET A;  4YRR A;  2ZIN A;  1B7Y A;  4YRM A;  3QO5 A;  3HFZ A;  4CH6 A;  4YRN A;  3A5Y A;  1NJ2 A;  2QHU A;  1X2G A;  3E9H A;  2ARU A;  4WJ4 A;  2XTI A;  3L2Z A;  4XTZ A;  4YRP A;  4HVC A;  11AS A;  3R07 A;  3FJP A;  3V7C A;  3QO7 A;  3RAC A;  1EFW A;  2EJ9 A;  1YFS A;  2DDZ A;  3MEY A;  1E24 A;  3V8K A;  3HXZ A;  2I4O A;  4BWA A;  1BBW A;  4K86 A;  1YFT A;  2DQ0 A;  5ELO A;  4OLF A;  4O2D A;  4UP7 A;  1NYR A;  4RQF A;  3HXV A;  1SER A;  4YRQ A;  2Q7H A;  4NCX A;  1J5W A;  3UH0 A;  2ALY A;  2IY5 B;  2DKG A;  2CJ9 A;  3A7U A;  1ADY A;  3WQZ A;  1W66 A;  1G51 A;  4YRC A;  4WI1 A;  3V7S A;  1HC7 A;  3MF1 A;  4H2W A;  1JJC A;  1ADJ A;  4YRF A;  3UGQ A;  1EIY A;  3REX A;  4HWS A;  1EVK A;  4G85 A;  3EFR A;  4RQE A;  3DSQ A;  3VQV A;  2G4C A;  5HGQ A;  1ATI A;  1USY A;  4UP8 A;  1WQ7 A;  3HY1 A;  4WF2 A;  2ZT7 A;  2E1H A;  2E64 A;  3HRK A;  3ERR A;  2ZZE A;  4P74 A;  4J15 A;  2EJF A;  4YPF A;  4XU0 A;  3HXU A;  2ZXF A;  2ART A;  2DXU A;  3A74 A;  4H2T A;  5K1X A;  1NJ8 A;  3P8T A;  1NYQ A;  3QTC A;  4TVW A;  1RIQ A;  3CMQ A;  2QHS A;  4TQD A;  1H4S A;  2ZR3 A;  4YRJ A;  1NJ5 A;  4YRO A;  3A5Z A;  3QO8 A;  2P0L A;  12AS A;  4G84 A;  4AH6 A;  2QHT A;  1C0A A;  2EL9 A;  3HTZ A;  4H02 A;  3G1Z A;  4TVA B;  2DJZ A;  1NNH A;  4YRT A;  4K87 A;  4ZTU B;  2ZCE A;  3IKM B;  4HWR A;  1B70 B;  4CS4 A;  4YCU A;  2ZR2 A;  3BJU A;  3TEG A;  1X01 A;  1H4Q A;  4H2X A;  2RHS A;  1BIB A;  2ODR D;  3TUP A;  4KQE A;  4YRG A;  2ZIM A;  4YRL A;  1GGM A;  1ASY A;  1NJ1 A;  2ZT5 A;  4H2U A;  2AMC B;  3TEH A;  5ELN A;  4XTV A;  3RKX A;  3VQY A;  4KR2 A;  2CIM A;  1E1T A;  2DVE A;  4LNS A;  4X5O A;  3A7R A;  4P71 C;  4YRI A;  3HY0 A;  3RL6 A;  4P73 C;  1E22 A;  1KMM A;  2E5A A;  1BBU A;  4EO4 A;  1Z7M A;  1B7Y B;  5E3I A;  4RMF A;  3HFZ B;  3PCO A;  2Q7G A;  4P72 A;  1KOG A;  4PG3 A;  5K1P A;  4HWT A;  4XTU A;  4Q6G A;  4Q15 A;  3RKW A;  4BW9 A;  2DU7 A;  1SET A;  3IAL A;  3L1A A;  1G5I A;  4P75 A;  4XU1 A;  3RIR A;  2CJB A;  1E1O A;  2RHQ A;  5C52 B;  3NEM A;  3P8Y A;  3VBB A;  3L4G A;  1SRY A;  3BFM A;  2DQ3 A;  4TVY A;  2ZZF A;  2I4N A;  2DTO A;  3IKL A;  4CH3 A;  2ALY B;  2PME A;  1PYS A;  3HXX A;  2ZNJ A;  3HFV A;  3EFS A;  2P5I A;  1ASZ A;  3PZC A;  3NEN A;  3REU A;  4YRE A;  5F5W A;  4E51 A;  4XEO A;  1JJC B;  1WPY A;  5KNN A;  1EIY B;  2ARS A;  3LSS A;  2FYK A;  4H2Y A;  2C8M A;  3UGT A;  4XU2 A;  3RKY A;  2ZNI A;  4UPA A;  2EWN A;  4H2V A;  1FYF A;  3I7F A;  2PMF A;  1L0W A;  2CJA A;  2E65 A;  4RDX A;  2XGT A;  2QHV A;  4P3O A;  1HTT A;  4OP0 A; 
#chains in the Genus database with same CATH topology
 2D5U A;  1XWM A;  1NJ6 A;  2IY5 A;  1US7 B;  4EOZ B;  4HWF A;  4LF4 T;  1BIA A;  2DEQ A;  2JQK A;  2YN6 A;  3JAD A;  4DV1 T;  4PHC A;  1WLE A;  4YRK A;  4AKR B;  3RYF E;  2AXD S;  3PUZ F;  5JDG A;  4LVI A;  3AE8 A;  2YU2 A;  5DJQ C;  4IDO A;  1MMN A;  2XSA A;  2J3L A;  1D1C A;  2DTI A;  3RC8 A;  4DV2 T;  2MOZ A;  3Q5W A;  2ZTG A;  5L3C B;  2E10 A;  2HHH T;  2ES0 A;  4XTX A;  2Q5I A;  2AKW A;  1MIW A;  3P4W A;  1HXD A;  3A31 A;  2EHO A;  3KBT A;  3A32 A;  1IL2 A;  4EGW A;  2LJL A;  2V6Y B;  4OHF A;  4EV6 A;  5H6R B;  3MAC A;  4A98 A;  5LP6 E;  2I4L A;  1WNL A;  4DPG A;  2NTY A;  1YKH B;  2OLT A;  1UX5 A;  4K88 A;  5M4Y A;  3ABV A;  1SA0 E;  3KIN B;  1EVL A;  4YYE A;  4FJO A;  5CB4 E;  4JI4 T;  2WU5 A;  3QB5 K;  3AA6 B;  3CPZ A;  3SWH A;  3ICA A;  4G63 A;  4YCV A;  1HG2 A;  3GN5 B;  4EYY R;  4CH4 A;  3M3Z B;  5J1G A;  3MZK B;  1G73 A;  1KNZ A;  4TWA A;  3EVY A;  1CHU A;  2UUA T;  5L3E B;  3UUB A;  4COF A;  4EEB A;  1W9R A;  2AKW B;  3RF1 A;  4L87 A;  1D0X A;  4O4L E;  5JDL A;  4K0U A;  4CI2 B;  1WR6 A;  4J2C A;  4UIG A;  2E3C A;  2E2A A;  3NKZ A;  3LSQ A;  2BG9 B;  2YDQ A;  4YJ2 E;  2YEV C;  1X56 A;  1X54 A;  4Z91 A;  4DBQ A;  4KHP T;  3HXW A;  2EAY A;  2WS3 A;  3C4Z A;  2ODU A;  3ZEF B;  3V7R A;  4P72 C;  5HXH A;  4GK5 E;  3LK2 B;  2Y8D A;  2OV9 A;  3ZCI A;  3EI0 A;  3E0Z A;  2HNI A;  1IJ6 A;  2WZH A;  4P3P A;  1G8X A;  1VRB A;  2BS4 A;  3J9X 1;  2VWA A;  2WCA A;  4TQF A;  4ZTZ B;  2V8S V;  3R84 B;  1WLX A;  2ZIN A;  1B7Y A;  2XQ4 A;  3KV6 A;  4EAH A;  4CH6 A;  3A5Y A;  1NJ2 A;  4U72 A;  4LF8 T;  4YT0 A;  4DO0 A;  5AQK B;  5HXS A;  1R8I A;  3FJP A;  1E24 A;  4U7Y A;  3F57 A;  2DLR A;  2WDR A;  4NIQ A;  2IUB A;  2I4O A;  2WWV A;  2H7O A;  1XMO T;  5LCY A;  5ELO A;  1UGO A;  2NS6 A;  1NYR A;  1KFY A;  4RQF A;  5FYM A;  1XZY A;  2XJ7 A;  4M1P A;  3P7I A;  1OED E;  2BS3 A;  4U2Z A;  4LVM A;  4LF9 T;  3UH0 A;  1HCI A;  1FMV A;  3AE4 A;  3AA0 B;  4TWF A;  2V7K A;  1NEN A;  2D2S A;  3V7S A;  1HR0 T;  2FUP A;  4I0U A;  1JJC A;  4YRF A;  4HWD A;  5HCM A;  3RLF F;  1EIY A;  2C5I T;  3REX A;  1XNR T;  3WAJ A;  1NAF A;  3WI3 A;  4G85 A;  2Y48 B;  3RHW A;  5AQM B;  2VQF T;  1ATI A;  4DUY T;  3AE6 A;  2XUE A;  4WF2 A;  1ZHC A;  3AED A;  4O2A E;  1YQ3 A;  3T8O A;  3ERR A;  4JI2 T;  3N9N A;  4X65 T;  1HNZ T;  5AQP B;  3SOL A;  2VUR A;  2VVS A;  5KX5 E;  1WCR A;  4DR4 T;  3NVO A;  3P4Q A;  4IDZ A;  3OYZ A;  4H2T A;  5CFB A;  4E7S A;  5L2L A;  2X68 A;  5K1X A;  2H89 A;  1NJ8 A;  2F4V T;  3V5U A;  2XAS B;  5HWX A;  1RIQ A;  5JQG E;  3CMQ A;  3PUS A;  4F8H A;  2V7L A;  2M6I A;  4YHH T;  4PJN A;  2CPT A;  12AS A;  3VR9 A;  4AH6 A;  4KX6 A;  1C0A A;  2EL9 A;  3HTZ A;  4YRT A;  2BDE A;  4K87 A;  3Q5X A;  3UTK A;  4ZTU B;  2ZCE A;  5JDM A;  4EB6 E;  4DBR A;  2QYW A;  4YCU A;  4O4J E;  1U4Q A;  3TEG A;  1X01 A;  2I6H A;  1I94 T;  4H2X A;  2HN1 A;  4H9R C;  2LHN A;  4C91 A;  3AEE A;  5CA1 E;  3AAA B;  1BIB A;  2E8I A;  2R6G F;  4KHZ F;  4ZI2 C;  2BKN A;  3ONX A;  4MBQ A;  4KQE A;  5HEG A;  4YSZ A;  2BVM A;  1VCS A;  3UU5 A;  1ASY A;  2ZT5 A;  5FKY A;  2AMC B;  1BR4 A;  2V5C A;  2LKG A;  3VQY A;  5C8Y E;  3N5L A;  2CIM A;  4H9S E;  4UF0 A;  4YY3 T;  4LNS A;  4X5O A;  3A7R A;  4P71 C;  4YRI A;  2WDQ A;  3PE0 A;  3RL6 A;  4KP3 C;  2W0G A;  1KMM A;  1J1J A;  4ZI2 D;  2E9X B;  1Z7M A;  3NZQ A;  5E3I A;  3HFZ B;  3PCO A;  2Q7G A;  4P72 A;  2E5V A;  4PG3 A;  1SE7 A;  1BR0 A;  4EZ4 A;  4HWT A;  1MND A;  2YOE A;  3RIA A;  1HX1 B;  3P50 A;  5AQQ B;  2V7M A;  4BA9 A;  2DU7 A;  3HKD E;  3IAL A;  5AQS B;  1EZ3 A;  3VU7 H;  3SFE A;  3FHN A;  3AEC A;  1G5I A;  4XU1 A;  2RHQ A;  3P8Y A;  2X67 A;  3L4G A;  4EYU A;  5HEU A;  2DQ3 A;  5JDH A;  2WSS V;  3VR8 A;  3B57 A;  4YXD A;  2DWK A;  1FEW A;  3Q2M A;  4PK6 A;  4DUZ T;  2ALY B;  3JC6 C;  3ZJ2 A;  2XPK A;  5HWY A;  3UUX B;  3NBX X;  4DV0 T;  2P5I A;  5LMN T;  3PUG A;  1YKE B;  2J47 A;  1W0B A;  2CBI A;  5F5W A;  4E51 A;  4JI6 T;  3OKQ A;  5EK4 A;  3PV0 F;  3ZN0 B;  4PNI A;  2AE9 A;  5HEO A;  3CVR A;  5L3G B;  2KT9 A;  1XNQ T;  5FXX A;  2KND A;  2D0U A;  2GK9 A;  2EWN A;  1L0W A;  4RDX A;  2BVL A;  1Y01 A;  2I59 A;  2YIN A;  1JNZ A;  5C2T A;  4OX9 T;  2HPL A;  2X9H A;  4OP0 A;  4ZZC A;  3LBX B;  3VQX A;  4U74 A;  4TTV A;  1H7C A;  4A97 A;  3FBZ A;  2D9D A;  2UXB T;  2W63 A;  5AQU B;  2V1D B;  4U3C A;  1WQW A;  2JQ9 A;  5BR8 T;  4HFV A;  3U78 A;  1ZP0 A;  4XEM A;  4CXX A;  2XQ9 A;  3AE2 A;  3RQW A;  2XAQ B;  1G5H A;  3I1A A;  2D0T A;  5L3D B;  1D0Y A;  2CGH A;  1KMN A;  2W61 A;  5LHG B;  4UVB B;  3I9W A;  3E22 E;  3A7A A;  3HRI A;  3PU8 A;  1ZKE A;  2LSJ A;  3K8P C;  2N9D A;  2M6B A;  1H4V B;  1KNP A;  2V5D A;  4P1N A;  4H9Q C;  4QH5 A;  3QB5 A;  4PFO A;  4HFE A;  4LFC T;  1HNW T;  4NXM T;  3KFU A;  2UXC T;  4X62 T;  5AQI B;  3QNE A;  3ONL C;  2ZT8 A;  3TEH B;  5AQR B;  2LSK A;  2XM2 A;  3JCF A;  4CS3 A;  2WBL A;  3ZST A;  4ZI3 C;  3RGL A;  3VHL A;  4OYJ A;  2A2F X;  5JH7 E;  1B76 A;  4KR3 A;  4H63 H;  3N9Q A;  2VQE T;  3NEL A;  3AVS A;  3LK3 B;  4LMJ A;  5C53 B;  2LRK A;  5EK3 A;  4ERR A;  1YGB A;  1B70 A;  4ZZB A;  5ABF B;  4AKI A;  2X0Y A;  2CXL A;  3ZSS A;  3PDY A;  4JI8 T;  2C5J A;  1MMD A;  2J3M A;  2B76 A;  3UFE A;  1D1B A;  4P71 A;  5FY7 A;  4ZI3 D;  2M67 A;  2XQ8 A;  1VQZ A;  3ZCJ A;  2E41 A;  2W2U A;  3M4Q A;  1H4T A;  5LB7 B;  3X1D A;  3N9L A;  1WU7 A;  2ZGW A;  5AQV B;  3PJA A;  4DR7 T;  3V8L A;  4UVA B;  2LT3 A;  2UXX B;  5LNK A;  1ZV4 X;  2IDO B;  4KI0 F;  4BJM A;  1QE0 A;  3TLT A;  2XZE A;  4HWP A;  1S35 A;  3K3O A;  4JLE A;  4QKN A;  2ODR C;  3NET A;  4IDQ A;  1X79 A;  3EDU A;  4YRN A;  2KXP B;  2WM9 A;  3K3Q C;  3NRY A;  3ZT6 A;  2CHO A;  2LRL A;  2QHU A;  4IST A;  2JQQ A;  2V7I A;  11AS A;  2L3L A;  2XAJ B;  5L4H A;  3RAC A;  5JVD E;  4JI5 T;  1YFS A;  5GON E;  2DDZ A;  4LML A;  2N1G A;  5FL0 A;  2IHR 1;  4IE5 A;  4MFR A;  3V8K A;  3Q9D A;  4BWA A;  3SRZ A;  2CCQ A;  1YFT A;  1NEK A;  4OLF A;  3HKB E;  4B3S T;  4UP7 A;  1IBL T;  3K3N A;  4PJL A;  3HXV A;  1SER A;  4E7Z A;  2Q7H A;  4ILA A;  4NCX A;  1JNR A;  3I0O A;  1MNE A;  1VCT A;  2IY5 B;  5FMN A;  2DKG A;  5KMG P;  4GYR A;  3QUJ A;  3A7U A;  3WQZ A;  1G51 A;  3RRW A;  4WI1 A;  1SUM B;  3DJB A;  3MF1 A;  4JUY A;  4H2W A;  1ADJ A;  1LRZ A;  5JRC A;  1EVK A;  1YW0 A;  3BQI A;  3DSQ A;  2W4X A;  5HGQ A;  2E9X C;  3ZN1 B;  2ZM2 A;  4AKH A;  2Q9Q C;  1WQ7 A;  1BR1 A;  2EHO B;  2UXN B;  3P4R A;  3HY1 A;  4GK0 E;  5HXC A;  2E1H A;  1V9D A;  3KFW X;  4IL4 A;  3NZP A;  3RI5 A;  3IF8 B;  2X0L B;  3ZMV B;  4J15 A;  4XU0 A;  3C50 A;  1N34 T;  2ART A;  5TAO A;  2W00 A;  3UQ4 A;  2PTF A;  3N2K E;  3C4X A;  2YDR A;  4GKJ T;  2NW8 A;  1H4S A;  3CX8 B;  3UUM A;  4CN4 A;  5LGU B;  4YRO A;  3QO8 A;  3UUN A;  4PJM A;  3HKC E;  3HKE E;  1T7S A;  3OJA A;  2ODV A;  5LG3 A;  5HEJ A;  1Z8U A;  3FZM B;  4QX7 B;  2YDS A;  1NNH A;  2DJZ A;  1S94 A;  5L3B B;  3O1J A;  4YLH A;  4LFB T;  2VKD A;  3IKM B;  4OYK A;  1KEY A;  3C4W A;  3BJU A;  4UEL A;  4U2Y A;  2XY8 B;  2RHS A;  3EUH A;  2CXD A;  3FXE B;  4XBF B;  3UU8 A;  2PFV A;  4TX5 A;  4WZX A;  5LGT B;  3F2E A;  3ZC1 A;  4LVL A;  2LSG A;  2LSI A;  1NJ1 A;  3N2G E;  3ZPO A;  5AQH B;  5ELN A;  4XTV A;  2WZI A;  4KR2 A;  1U5P A;  3AXJ A;  2DVE A;  4X64 T;  2ZMA A;  3LFM A;  4CXY A;  4IIJ E;  3C64 A;  5AQL B;  3AE1 A;  4IL9 A;  1OED A;  4QXH B;  3N2O A;  2V6X A;  3BQK A;  4EO4 A;  1B7Y B;  2PJQ A;  2KIN B;  1KOG A;  2A9U A;  1UK5 A;  2SPC A;  5K1P A;  4XTU A;  4IT4 A;  3AAE B;  3L8R A;  1AJ3 A;  4B3R T;  3RKW A;  3RIU C;  4BW9 A;  5CGM A;  1SET A;  4UXN B;  5FXZ A;  3CX7 B;  4AKG A;  4FI5 A;  2FJE A;  1N36 T;  3AA1 B;  2QA7 A;  2UU9 T;  3NEM A;  4AQF C;  2DL1 A;  4WYV A;  3BFM A;  4TVY A;  4AQG A;  2P9B A;  4IE0 A;  2IC9 A;  2XAG B;  1PYS A;  3L09 A;  5ABE A;  4DR1 T;  5F8P A;  3EFS A;  3ZYL A;  5JDQ A;  1ASZ A;  3PZC A;  3L3P A;  2CLY B;  3AEB A;  2ZM8 A;  3KVA A;  2IML A;  1JJC B;  1HNX T;  5JR9 C;  3ZMU B;  1EIY B;  5JDF A;  4HWH A;  3LSS A;  5LGN B;  5EK2 A;  4HFD A;  3KBU A;  2BKP A;  4XU2 A;  3RKY A;  4CI3 B;  2RPA A;  4OK0 A;  2IIU A;  2VKJ A;  4ANJ A;  1FYF A;  2PMF A;  2LM2 A;  4P3O A;  1HTT A;  4BAY B;  4QHO A;  2CEA A;  4IDP A;  5AQJ B;  1USY C;  3D0T A;  5AQG B;  1YFR A;  2HPJ A;  2A8E A;  2XQY A;  2Q9Q A;  2LM9 A;  4HA8 A;  2L9Q A;  2DZC A;  4JEH B;  4O4I E;  3CQX C;  4WJ3 M;  1EQR A;  2LE8 A;  2MYS A;  2ZM6 T;  3PUA A;  4N78 D;  4EX5 A;  1T8B A;  2WDV A;  4PK4 A;  3P8V A;  2I4M A;  1WYB A;  3AE5 A;  3DP7 A;  3IG2 A;  5DQV A;  4B3M T;  2X9Y A;  2XTL A;  3ANW A;  4HFB A;  4H2X B;  2NTX A;  3ZYK A;  2XQ5 A;  4JI7 T;  5HCJ A;  3M4P A;  1LKX A;  2X0H A;  4ISS A;  1J5E T;  4OFZ A;  3MJX A;  4YP0 A;  2DTH A;  4HWO A;  4QH1 A;  3VQW A;  2DHR A;  1MMG A;  3RYI E;  2CHN A;  5CJ5 A;  2CMR A;  5KXJ A;  3OD1 A;  1KNR A;  2VKH A;  4UF0 B;  4DQ2 A;  3O4X E;  5FVK A;  4DMW A;  3PUV F;  2ZIO A;  2X51 A;  2CWY A;  3ONJ A;  3RYC E;  2EJG A;  4TVA A;  4PK5 A;  2VK9 A;  1YB3 A;  3PCO B;  4XTW A;  3W3S A;  4PJJ A;  2BBJ A;  2BKO A;  1EOV A;  4AI6 A;  2JMK A;  2Q5H A;  2WU2 A;  1WYD A;  3MF2 A;  2XAF B;  5FL1 A;  1W09 A;  2HH7 A;  3MKD A;  2V26 A;  3TLW A;  4ADZ A;  3UUL A;  1SES A;  4Z90 A;  4GYS A;  3JC6 D;  4WBN E;  2MPK A;  4ILU A;  3E9I A;  2XQ6 A;  2KMF A;  2WAU A;  2RHQ B;  4YCW A;  4DR3 T;  2BG9 C;  2DZ9 A;  3L4G B;  5L3F B;  3NRX A;  5JTG A;  4LF5 T;  2BBH A;  2IC6 A;  4IE7 A;  1Z0P A;  5HXR A;  4V1A v;  3RUX A;  3RIU A;  4P09 A;  4UVC B;  5FNV E;  4JI0 T;  1LYL A;  5C51 B;  1NWM X;  2FJD A;  5KDM C;  4P75 C;  4IDN A;  3UQ7 A;  4A5X A;  4TWH A;  4YRM A;  2DWG A;  3QO5 A;  4TV8 E;  4WW0 A;  3RPU A;  2IAK A;  3NWI A;  3R6N A;  1W0A A;  2B1E A;  3AVR A;  3IBP A;  1X2G A;  3E9H A;  3SS1 A;  2UUC T;  2JJ9 A;  1BR2 A;  4G2A A;  2XTI A;  1FIO A;  4XTZ A;  2X66 A;  4YRP A;  3RIF A;  5IUX A;  4HVC A;  2ACZ A;  4XZC A;  1I6Z A;  1EFW A;  3UU4 A;  2QRX A;  3N9M A;  4ZI7 E;  4UR9 A;  4UV8 B;  4DID B;  1BBW A;  2XQ7 A;  2LLY A;  4H9O C;  5ADX L;  3MQZ A;  4HFC A;  4O2D A;  2LOP A;  5JR9 A;  4YRQ A;  3KV5 A;  2X9X A;  1OWA A;  4IE4 A;  2LSY A;  5J0Z A;  1E1H B;  3T1H T;  1W66 A;  4YRC A;  3QNU A;  2RA1 A;  4DV5 T;  3EFR A;  2KZ7 B;  4RQE A;  3VQV A;  1N33 T;  2A3D A;  3KDS E;  1XDP A;  1USY A;  2LEH A;  1D1A A;  4UP8 A;  2VB6 A;  1WRD A;  1M7K A;  4IE6 A;  2ZZE A;  5AQO B;  1WR0 A;  1FMW A;  2J62 A;  2EJF A;  4YPF A;  2WY2 A;  4CQI A;  2ZXF A;  2DXU A;  4NPP A;  3A74 A;  3HL6 A;  1D0Z A;  2XAH B;  2ACX A;  3P8T A;  3QTC A;  4TVW A;  2W67 A;  4EIW A;  4JEU B;  2QHS A;  1ZEE A;  3EAB A;  1IJ5 A;  2JPF A;  2ZR3 A;  4YRJ A;  2HN2 A;  1NJ5 A;  3I9Y A;  1MIV A;  2CA5 A;  3A5X A;  3M65 A;  2P0L A;  3KV4 A;  4G84 A;  4PFP A;  4IGU A;  2C0S A;  4TNV A;  4H9N C;  1IAP A;  3G1Z A;  3WAK A;  3AE3 A;  3PJA J;  2V6Y A;  4HWR A;  1B70 B;  1SHZ C;  3RH3 A;  3E08 A;  2E5L T;  5LJM A;  2PBI A;  1VOM A;  5LHH B;  5E0O A;  3DTO A;  3PUQ A;  4X1Y E;  4HWC A;  2ODR D;  3PTR B;  4YRG A;  2YKS A;  1GGM A;  3GN5 A;  3TLS A;  4H2U A;  4DND A;  4ILC A;  3TKL B;  2XHE B;  4P73 C;  3IHR A;  2YK0 A;  3PUX F;  2E5A A;  1BBU A;  2BG9 E;  3ZMZ B;  2CM0 A;  4RMF A;  3AEG A;  2I0M A;  2CWO A;  3GMI A;  2BG9 A;  2OA5 A;  4Q6G A;  4C90 A;  4Q15 A;  1YD8 G;  3ZMS B;  3AB3 B;  4A56 A;  1CUN A;  3I0Q A;  1WFD A;  4X1I E;  3FXD B;  3CWZ B;  3L1A A;  5HEH A;  4IRE A;  3RRC A;  4P75 A;  3H37 A;  3P4P A;  2G0U A;  2XSB A;  2CJB A;  1E1O A;  5C52 B;  3VBB A;  3ESL A;  4P0B A;  4QXC B;  4DR5 T;  1SRY A;  4AQY T;  4UEM A;  2IW5 B;  2ZZF A;  3ZJ1 A;  4UV9 B;  4KMC A;  4JI3 T;  2JRK A;  1FJG T;  5HXE A;  4K0K T;  2BS2 A;  3IKL A;  4AKL A;  4DR6 T;  2PME A;  3PU3 A;  3IA3 A;  2ZNJ A;  2JQH A;  3MXZ A;  4DVD A;  3IEE A;  5C3J A;  2E9X D;  3NEN A;  4GOU A;  2Q9Q D;  3ZKR A;  2QVA A;  4XEO A;  3RYH E;  1WPY A;  5KNN A;  4IHJ E;  3ZLI A;  4X1K E;  5JRC B;  5J2U E;  3CML A;  4LMK A;  2FYK A;  4TWD A;  4MAL A;  3UU6 A;  4U33 A;  3F31 A;  3UGT A;  3ZT7 A;  4JYA T;  5JDN A;  3FZH B;  4UPA A;  3BK9 A;  3AA7 B;  3HR0 A;  2ZM0 A;  2VL0 A;  3B5M A;  5FY1 A;  5H6Q B;  3CQG B;  2QHV A;  3AE7 A;  5LBQ B;  3T1Y T;  3UFG A;  5ABG A;  1KF6 A;  3UU3 A;  2WP9 A;  3KVB A;  1LVK A;  4ASK A;  1HG5 A;  4XTY A;  4DV3 T;  3TLV A;  2UUB T;  1LVF A;  2DCF A;  5BMV E;  4P74 C;  5ETW A;  3OTO T;  1X2H A;  5LA6 E;  2DU5 A;  2ZLY A;  3AEA A;  5LOV E;  4GKK T;  4L5G A;  2ZT6 A;  4HE8 A;  4YHJ A;  4LF6 T;  5LMU T;  3JAE A;  1Y64 B;  2W62 A;  1WYC A;  4CN1 A;  1OXZ A;  4HTE A;  4AXP A;  4HKA A;  4ZHQ E;  2XQA A;  4XU3 A;  1YQ4 A;  2K48 A;  1UUS A;  4U31 A;  3S4U A;  2DXT A;  2V7J A;  2JIW A;  4I55 E;  2UXD T;  4KBM B;  4H2S A;  3H3A A;  3OPC A;  2LKH A;  3MK7 C;  4ZIB A;  5DQW A;  2RHS B;  3RQU A;  3W15 B;  3EDV A;  1X55 A;  3BQL A;  2QGS A;  2WWU A;  4P3N A;  4JV5 T;  3C51 A;  3AEF A;  1M62 A;  2J4G A;  4I50 E;  3LDQ B;  4HN9 A;  4CH5 A;  1Z7N A;  3AXJ B;  3OVU A;  2XQ3 A;  4CS2 A;  2MTQ A;  2CBJ A;  3LC0 A;  2Q7E A;  1N9W A;  1OED B;  3QK6 A;  5ABH A;  3HXY A;  3EAM A;  1UUR A;  4YRS A;  2C7I A;  3GA8 A;  4X66 T;  2N2N A;  3ZC0 A;  2KWH A;  3FZK B;  1B8A A;  5HAX A;  4DV7 T;  1E7P A;  1XDO A;  3UT5 E;  2DI4 A;  4YSX A;  3SFD A;  1HF8 A;  4TNW A;  1QF6 A;  2LOS A;  2ZZG A;  4P73 A;  2YU1 A;  2BZB A;  2C5K T;  4O2B E;  4AIS A;  4LVK A;  2Z6E A;  3J7Y q;  4ZS3 A;  3P4S A;  3RX6 A;  3CKD A;  4ILB A;  3V8J A;  2AMC A;  4UP9 A;  4YDQ A;  3P8C D;  3CX6 B;  3V5S A;  3L39 A;  1HFA A;  1PYS B;  4QH4 A;  3C98 B;  4CN6 A;  4YRR A;  3VKH A;  1IBK T;  3LJC A;  2E9X A;  3HFZ A;  1GQE A;  5LJN A;  4NUV A;  2PG8 A;  4O8S A;  2ARU A;  4WJ4 A;  3L2Z A;  4HGA A;  3N9O A;  3CQC B;  3R07 A;  3V7C A;  3QO7 A;  3K1S A;  4PW8 A;  2J1D G;  3A7M A;  3ZYM A;  3ZT5 A;  2EJ9 A;  3MEY A;  5L47 A;  1IZN B;  2H88 A;  3FZL B;  3VKG A;  2NR4 A;  3HXZ A;  2X9W A;  5A1L A;  4BJN A;  5LBM A;  3B13 A;  4K86 A;  3CIR A;  2DQ0 A;  1QSD A;  2XM1 A;  3N9P A;  4YJ3 E;  4B3T T;  3LK4 2;  2K3W A;  3RKG A;  3Q5E A;  5HYA A;  4TV9 E;  5FXW A;  4TUY E;  4HEA A;  2H7V C;  1J5W A;  4LVJ A;  2A72 A;  1O3X A;  2ALY A;  3ETV A;  4MLK A;  4KUM B;  3O1H A;  2CJ9 A;  3KV9 A;  3FB2 A;  1ADY A;  2WMN A;  2Q9Q B;  4DV6 T;  4XAX B;  4PAG A;  5DAB A;  2CE7 A;  1HC7 A;  2NP9 A;  1N32 T;  4YFS A;  4B6X A;  5LYJ E;  3UGQ A;  4ZS2 A;  4HWS A;  2K24 A;  2K5B B;  1YXR A;  2KSR A;  2JMH A;  1KK7 A;  3O9X A;  2G4C A;  2KWI B;  4H9P C;  1IBM T;  2NW9 A;  4I43 B;  2E64 A;  3RKO A;  2ZT7 A;  3HRK A;  2L8K A;  4P74 A;  3ANW B;  2VKO A;  2H3R A;  3HXU A;  3LBX A;  3HI2 A;  3LSV A;  4DV4 T;  2Y6X A;  3QOF A;  1NYQ A;  2EHO C;  3ZMT B;  1T98 A;  3U3I A;  4EXT A;  4ZEY A;  4YTM A;  3AAI A;  4DMV A;  3CK6 A;  4TQD A;  4WBO A;  4NXN T;  3PUW F;  1UX4 A;  1XMQ T;  3A5Z A;  2QHT A;  2NWB A;  2CRB A;  4H02 A;  4TVA B;  2EHO D;  4EED A;  4JI1 T;  1QLB A;  5IHY A;  1T72 A;  2W66 A;  4AQF A;  3VRA A;  3FZF B;  1ZOY A;  4CS4 A;  4YSY A;  2ZR2 A;  3MA9 A;  4P0A A;  1H4Q A;  4L9I A;  3HA4 A;  4HFH A;  4TZ4 C;  4EZH A;  3JAF A;  4GIW A;  2MAW A;  3TUP A;  4TN7 B;  2VAS A;  4CXW A;  2ZIM A;  4YRL A;  2LHR A;  1MMA A;  2RP4 A;  4X20 E;  3TEH A;  4Q25 A;  5FP3 A;  5AFU L;  3RKX A;  3EHZ A;  1E1T A;  4QXB B;  1UCU A;  5FVL A;  2K9A A;  3HY0 A;  4I4T E;  1E22 A;  4ZOL E;  2FBW A;  4YTP A;  4HT4 A;  4LFA T;  4JBW F;  4NUU A;  1HS7 A;  3AE9 A;  4YTN A;  4CI1 B;  4F6R C;  2FJA A;  3H3M A;  5ABF A;  3OYX A;  4LF7 T;  4U7I A;  1E2A A;  2DNX A;  5AQT B;  4Z8X A;  3Q5D A;  2NOX A;  5FY0 A;  4MHC A;  3G06 A;  3RIR A;  3OBV E;  2FJB A;  1L0V A;  5EZY E;  3ETU A;  4DR2 T;  4QWN B;  4H63 V;  3O1I A;  5LG4 A;  2WB5 A;  2WQY A;  5JR9 B;  3PUR A;  2I4N A;  2DTO A;  5AQF B;  4ZXL A;  5LXT E;  5FXV A;  4CH3 A;  5CA0 E;  5LHI B;  2CXF A;  3HXX A;  3GWH A;  1HX8 A;  1DU2 A;  3HFV A;  2VL8 A;  4QX8 B;  2VVN A;  4L0R A;  4WNK A;  3A8Y C;  4CZZ B;  3REU A;  1HTJ F;  4YRE A;  5L4E A;  5JRE A;  3QC9 A;  2ARS A;  5AQN B;  5F3J A;  3PUY F;  1MIY A;  2KLQ A;  5IYZ E;  1OED C;  4H2Y A;  3RC3 A;  2C8M A;  4HFI A;  3VRB A;  4AIU A;  2ZNI A;  4O4H E;  4X5T A;  4HWI B;  5IWA T;  3FBL A;  4H2V A;  2CLY C;  3I7F A;  2CJA A;  1QUU A;  2E65 A;  2WMO A;  1B7T A;  3TLU A;  3LG7 A;  2XGT A;  1X9B A;  2MBG A;  2NW7 A;  5J2T E; 
#chains in the Genus database with same CATH homology
 3UFG A;  3VQX A;  1NJ6 A;  4TTV A;  2IY5 A;  1USY C;  1BIA A;  1YFR A;  2DEQ A;  2A8E A;  4XTY A;  4PHC A;  4HA8 A;  1WLE A;  1WQW A;  4YRK A;  4LVI A;  4P74 C;  2DU5 A;  1X2H A;  2DZC A;  4WJ3 M;  2ZT6 A;  2J3L A;  4XEM A;  1EQR A;  2DTI A;  1G5H A;  2ZTG A;  2E10 A;  2CGH A;  4EX5 A;  1KMN A;  4XTX A;  2Q5I A;  3P8V A;  2AKW A;  2I4M A;  1HXD A;  3A31 A;  4XU3 A;  3A7A A;  3HRI A;  3A32 A;  1IL2 A;  3IG2 A;  2DXT A;  1H4V B;  2I4L A;  1WNL A;  4H2S A;  4H2X B;  4DPG A;  4ZIB A;  2RHS B;  3M4P A;  4K88 A;  1X55 A;  3KFU A;  1EVL A;  4P3N A;  4YYE A;  4YP0 A;  2DTH A;  4HWO A;  3QNE A;  2ZT8 A;  3VQW A;  3ICA A;  4YCV A;  4CH4 A;  4CH5 A;  3OD1 A;  3TEH B;  1Z7N A;  4TWA A;  4DQ2 A;  4CS3 A;  4CS2 A;  2ZIO A;  2AKW B;  3RF1 A;  3LC0 A;  4L87 A;  2Q7E A;  1N9W A;  3RGL A;  3HXY A;  2EJG A;  4TVA A;  1B76 A;  4YRS A;  4KR3 A;  1YB3 A;  2E3C A;  3NEL A;  2C7I A;  3PCO B;  4XTW A;  3W3S A;  3LSQ A;  5C53 B;  1EOV A;  1YGB A;  1B70 A;  2Q5H A;  1WYD A;  1B8A A;  3MF2 A;  1X56 A;  1X54 A;  2J3M A;  1SES A;  1QF6 A;  4P71 A;  3HXW A;  2ZZG A;  4P73 A;  2EAY A;  1VQZ A;  3E9I A;  2E41 A;  3V7R A;  2RHQ B;  4P72 C;  4YCW A;  3M4Q A;  1H4T A;  4LVK A;  3L4G B;  2DZ9 A;  1WU7 A;  2ZGW A;  3V8J A;  2AMC A;  3V8L A;  2HNI A;  4UP9 A;  4YDQ A;  3RUX A;  1QE0 A;  4P3P A;  4HWP A;  1LYL A;  5C51 B;  1PYS B;  2ODR C;  4P75 C;  4TQF A;  4ZTZ B;  3NET A;  4YRR A;  2ZIN A;  1B7Y A;  4YRM A;  3QO5 A;  3HFZ A;  4CH6 A;  4YRN A;  3A5Y A;  1NJ2 A;  2QHU A;  1X2G A;  3E9H A;  2ARU A;  4WJ4 A;  2XTI A;  3L2Z A;  4XTZ A;  4YRP A;  4HVC A;  11AS A;  3R07 A;  3FJP A;  3V7C A;  3QO7 A;  3RAC A;  1EFW A;  2EJ9 A;  1YFS A;  2DDZ A;  3MEY A;  1E24 A;  3V8K A;  3HXZ A;  2I4O A;  4BWA A;  1BBW A;  4K86 A;  1YFT A;  2DQ0 A;  5ELO A;  4OLF A;  3MQZ A;  2NS6 A;  4O2D A;  4UP7 A;  1NYR A;  4RQF A;  3HXV A;  1SER A;  4YRQ A;  2Q7H A;  4NCX A;  1J5W A;  4LVJ A;  4LVM A;  3UH0 A;  2ALY A;  2IY5 B;  2DKG A;  2CJ9 A;  3A7U A;  1ADY A;  3WQZ A;  1W66 A;  1G51 A;  4YRC A;  4WI1 A;  3V7S A;  1HC7 A;  3MF1 A;  4H2W A;  1JJC A;  1ADJ A;  4YRF A;  3UGQ A;  1EIY A;  3REX A;  4HWS A;  1EVK A;  4G85 A;  3EFR A;  4RQE A;  3DSQ A;  3VQV A;  2G4C A;  5HGQ A;  1ATI A;  1USY A;  4UP8 A;  1WQ7 A;  3HY1 A;  4WF2 A;  2ZT7 A;  2E1H A;  2E64 A;  3HRK A;  3ERR A;  2ZZE A;  4P74 A;  4J15 A;  2EJF A;  4YPF A;  4XU0 A;  3HXU A;  2ZXF A;  2ART A;  2DXU A;  3A74 A;  4H2T A;  5K1X A;  1NJ8 A;  3P8T A;  1NYQ A;  3QTC A;  4TVW A;  1RIQ A;  3CMQ A;  2QHS A;  4TQD A;  1H4S A;  2ZR3 A;  4YRJ A;  1NJ5 A;  4YRO A;  3A5Z A;  3QO8 A;  2P0L A;  12AS A;  4G84 A;  4AH6 A;  2QHT A;  1C0A A;  2EL9 A;  3HTZ A;  4H02 A;  3G1Z A;  4TVA B;  2DJZ A;  1NNH A;  4YRT A;  4K87 A;  4ZTU B;  2ZCE A;  3IKM B;  4HWR A;  1B70 B;  4CS4 A;  4YCU A;  2ZR2 A;  3BJU A;  3TEG A;  1X01 A;  1H4Q A;  4H2X A;  2RHS A;  1BIB A;  2ODR D;  3TUP A;  4KQE A;  4YRG A;  2ZIM A;  4YRL A;  1GGM A;  4LVL A;  1ASY A;  1NJ1 A;  2ZT5 A;  4H2U A;  2AMC B;  3TEH A;  5ELN A;  4XTV A;  3RKX A;  3VQY A;  4KR2 A;  2CIM A;  1E1T A;  2DVE A;  4LNS A;  4X5O A;  3A7R A;  4P71 C;  4YRI A;  3HY0 A;  3RL6 A;  4P73 C;  1E22 A;  1KMM A;  4HT4 A;  2E5A A;  1BBU A;  4EO4 A;  1Z7M A;  1B7Y B;  5E3I A;  4RMF A;  3HFZ B;  3PCO A;  2Q7G A;  4P72 A;  1KOG A;  4PG3 A;  5K1P A;  4HWT A;  4XTU A;  4Q6G A;  4Q15 A;  3RKW A;  4BW9 A;  2DU7 A;  1SET A;  3IAL A;  3L1A A;  1G5I A;  4P75 A;  4XU1 A;  3RIR A;  2CJB A;  1E1O A;  2RHQ A;  5C52 B;  3NEM A;  3P8Y A;  3VBB A;  3L4G A;  1SRY A;  3BFM A;  2DQ3 A;  4TVY A;  2ZZF A;  2I4N A;  2DTO A;  3IKL A;  4CH3 A;  2ALY B;  2PME A;  1PYS A;  3HXX A;  2ZNJ A;  3HFV A;  3EFS A;  2P5I A;  1ASZ A;  3PZC A;  3NEN A;  3REU A;  4YRE A;  5F5W A;  4E51 A;  4XEO A;  1JJC B;  1WPY A;  5KNN A;  1EIY B;  2ARS A;  3LSS A;  2FYK A;  4H2Y A;  2C8M A;  3UGT A;  4XU2 A;  3RKY A;  2ZNI A;  4UPA A;  2EWN A;  4H2V A;  1FYF A;  3I7F A;  2PMF A;  1L0W A;  2CJA A;  2E65 A;  4RDX A;  2XGT A;  2QHV A;  4P3O A;  1HTT A;  4OP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...