5F5WA

Crystal structure of the alpha subunit of glycyl trna synthetase (glyrs) from aquifex aeolicus in complex with an analog of glycyl adenylate (gly-sa)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
283
structure length
283
Chain Sequence
MYFQDIIMTLHKFWAEKGCLIWQPYDVEVGAGTMNPATFLKVLGKKPWNVAYVEPSRRPQDGRYGENPNRLQHYYQFQVILKPAPRNPQEIYLESLERLGINPLEHDIRFVEDDWESPTLGAWGLGWEVWLDGMEITQFTYFQQAGGLDLDEISVEITYGLERIAMYIQDKDSVFDIEWKEGITYGEIFKRSEWEWSKYNFELADTDMLFQVYEMFEKESKRMVEEGLIFPAYDYLLKCSHVFNILDARGAISVQERARYIRRMNNLAREIAKLYLQVFENVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine--tRNA ligase alpha subunit
publication title Structural Insights into the Polyphyletic Origins of Glycyl tRNA Synthetases.
pubmed doi rcsb
source organism Aquifex aeolicus (strain vf5)
molecule tags Ligase
total genus 110
structure length 283
sequence length 283
chains with identical sequence B, C, D, E
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 5f5wA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5f5wA01
1YFRA 2DU7A 4XEOA 2DVEA 4P75C 4YRTA 2PMFA 4YP0A 1ADYA 2CIMA 2J3MA 2P0LA 4NCXA 1X56A 3L4GA 5C53B 2DJZA 2XGTA 3QNEA 2ARTA 3A5YA 3HRKA 4P71A 3BJUA 1VQZA 4TVWA 3RKXA 2EJGA 2ODRD 4H2YA 5KNNA 3A74A 1B7YA 2DXTA 5K1XA 2I4NA 3RUXA 1NJ6A 4YCUA 4UP7A 3CMQA 2AKWB 4H2UA 2AMCB 3A5ZA 4P74A 4Q6GA 4YRLA 4HWSA 4HVCA 1E22A 2I4LA 4P72C 3V7RA 1BIAA 3PCOA 2C7IA 4HA8A 1B70B 3VQYA 2G4CA 2ALYB 3HXYA 1X2HA 4YRFA 2ZIOA 4H2VA 2Q5HA 2E3CA 1BBUA 2EAYA 3IKLA 3HFVA 3L4GB 2CJAA 4XTUA 4YREA 2ZNIA 1H4TA 4TVAA 4TQFA 2I4MA 4PG3A 4WF2A 4CH6A 1RIQA 4CH5A 4ZTZB 2DZ9A 3RIRA 3HFZA 2DDZA 4YRKA 1YFTA 2DTIA 3A32A 4K88A 4LNSA 1NJ5A 1B7YB 3RL6A 2DQ0A 3A7AA 2XTIA 2P5IA 4XU1A 4K86A 4YRQA 4XEMA 4TTVA 3MF1A 3RKWA 4P71C 1W66A 1WQ7A 4K87A 3LSSA 4YRJA 1PYSA 3KFUA 1USYA 3ICAA 3TEGA 3TUPA 3HXZA 4ZTUB 1NJ1A 1JJCA 1Z7NA 2I4OA 2ZT6A 1L0WA 1J5WA 2DEQA 3PCOB 4XU2A 4X5OA 2E10A 5K1PA 4YRCA 4DQ2A 3TEHA 2RHQA 3E9IA 4YCVA 2ZGWA 1BBWA 4YRPA 2PMEA 4P73A 2EJFA 1HTTA 2ZXFA 2ZIMA 4P3NA 4O2DA 5ELNA 1QF6A 3PZCA 4H2TA 3DSQA 2ZZFA 3EFRA 4PHCA 4YYEA 3MEYA 4YRIA 4H2XA 4KR2A 1X2GA 1EVLA 3REUA 2ZCEA 3IKMB 4OP0A 12ASA 4TVAB 4XU0A 3HY0A 4HWPA 1WYDA 3VQXA 4KQEA 4TQDA 3UGQA 4UP8A 4CH3A 3HFZB 3IG2A 2FYKA 3REXA 3OD1A 1KMMA 4ZIBA 1YGBA 3M4QA 4OLFA 3HY1A 1H4QA 3MF2A 1WU7A 2ODRC 2E41A 4H2WA 1G51A 1KMNA 3RKYA 1NJ8A 3V8KA 1PYSB 4XTYA 3R07A 2EJ9A 2DTOA 4XTVA 4CS3A 5ELOA 1LYLA 4KR3A 4G84A 2Q7GA 1JJCB 4RDXA 3M4PA 3EFSA 2E64A 1EVKA 1SERA 4RMFA 3TEHB 4YRGA 2RHQB 1ASYA 4XTZA 1H4SA 4H2SA 1X54A 2HNIA 1USYC 1B76A 1WQWA 4XTWA 1E1TA 1BIBA 2ARUA 1ATIA 2J3LA 4E51A 2DKGA 4P72A 4H2XB 3HXVA 4YPFA 3V7CA 5F5WA 3NELA 3V7SA 4YROA 4P3PA 2ZT5A 1FYFA 4YRRA 3FJPA 3UFGA 2Q7EA 1Z7MA 2IY5A 3A7RA 1E1OA 4P73C 5C51B 1WLEA 4HWRA 3NEMA 3UH0A 4RQFA 2RHSA 4CS4A 4WI1A 1GGMA 2E5AA 4EO4A 4TVYA 1E24A 4YRMA 3P8VA 3QO8A 4P74C 3ERRA 11ASA 1EIYA 3V8LA 3HXXA 1X55A 2ZINA 3V8JA 1B8AA 5E3IA 4G85A 3LSQA 3I7FA 2EL9A 2DU5A 4TWAA 5C52B 3HXWA 4L87A 4BWAA 3LC0A 3E9HA 3QO7A 4RQEA 4YRNA 4WJ3M 2ZR3A 3RGLA 1YFSA 3QTCA 1EFWA 4P75A 2DQ3A 3RACA 4EX5A 4HWTA 1SESA 2DTHA 2CJ9A 2E65A 2DZCA 3UGTA 2QHVA 2IY5B 2ZT7A 4YDQA 3VBBA 3HXUA 1SRYA 1YB3A 4J15A 4YCWA 2ZR2A 1QE0A 1ASZA 3NETA 3RF1A 1C0AA 4YRSA 2RHSB 1N9WA 3P8TA 1NYQA 2C8MA 3BFMA 3IALA 3P8YA 1EQRA 4UPAA 1NNHA 4WJ4A 1KOGA 2QHTA 4H02A 1G5IA 4HWOA 2QHUA 1X01A 4XU3A 2CGHA 2ZTGA 2EWNA 4DPGA 1EIYB 3G1ZA 2DXUA 1H4VB 1NJ2A 1G5HA 3VQVA 4XTXA 2E1HA 2ZZGA 2ZZEA 2Q5IA 3NENA 3A7UA 3WQZA 1HXDA 4CH4A 2AKWA 1EOVA 1HC7A 3L1AA 2AMCA 3HRIA 2ARSA 2Q7HA 2ZNJA 4Q15A 4UP9A 1WPYA 1ADJA 3L2ZA 1NYRA 3A31A 4P3OA 1IL2A 2QHSA 4AH6A 2CJBA 3QO5A 1SETA 4BW9A 3VQWA 1B70A 1WNLA 5HGQA 3HTZA 2ZT8A 2ALYA 3W3SA 4CS2A
chains in the Genus database with same CATH superfamily
2WY2A 5L3BB 4XEOA 4P75C 1YXRA 2CRBA 2CIMA 5AFUL 2WS3A 2W63A 3TLTA 1X56A 5LCYA 5ABFB 4LVJA 5HXCA 5C53B 3MACA 3QNEA 1NEKA 3A5YA 2KINB 2JJ9A 3BJUA 4DR6T 4M1PA 3IF8B 2JPFA 4TVWA 1HF8A 2DL1A 3J7Yq 3HA4A 5HXEA 5KNNA 3A74A 3PUZF 2VL8A 3RUXA 4YCUA 4UP7A 4HGAA 1XDPA 2ODVA 3N9MA 4H2UA 3CVRA 3PV0F 1OEDA 1IBKT 3A5ZA 3AE2A 4P74A 2KMFA 4HWSA 3N9QA 3RI5A 4P72C 2CBIA 4MFRA 2W0GA 3OBVE 4LFBT 1BIAA 3VKGA 1JNRA 2C7IA 3I0OA 4O2BE 3IBPA 4DV3T 4I55E 2VKJA 2G4CA 1ZV4X 2KWHA 5LGNB 1WR0A 3SFEA 3P4SA 1X2HA 3N2OA 4H2VA 3C4XA 1E1HB 4E7SA 2EAYA 2LHNA 1W09A 1BBUA 1LKXA 3Q5WA 2QYWA 2CHOA 1R8IA 3Q2MA 2WWVA 2BKNA 4TVAA 5HEGA 3HL6A 5FY0A 2XASB 1FIOA 4LF6T 4CH5A 4IGUA 4Q25A 3KV6A 3LBXA 4OK0A 2VVNA 2OA5A 3RRCA 4A5XA 4AKHA 1NJ5A 3RL6A 2XSBA 2D9DA 2FJEA 5IHYA 3A7AA 3L3PA 2XTIA 3P4PA 1EZ3A 2WAUA 4TTVA 1NWMX 1OEDB 3RH3A 3FZMB 4P71C 1W66A 3CQXC 3PUXF 3ONLC 1SUMB 4K87A 4G63A 4GKKT 1PYSA 3ICAA 1HTJF 4WBNE 2ACXA 3TEGA 4G2AA 3HXZA 3N5LA 2VURA 4KHPT 3JCFA 5FVLA 2I4OA 2ZT6A 4GK5E 3SRZA 5JDNA 2CCQA 2BS3A 2XM2A 2K48A 5JDMA 5LHIB 2RHQA 4L0RA 2K5BB 2LJLA 5AQGB 1HTTA 5M4YA 2ZIMA 4P3NA 5ELNA 2LM2A 2JMKA 2N2NA 5AQSB 4JI5T 1KF6A 4X64T 4PHCA 5L4EA 5EZYE 2R6GF 4EEBA 4YSZA 3P4WA 4H2XA 4JEHB 2PBIA 3REUA 3JADA 4TVAB 2WZIA 4HWPA 2W00A 3AXJA 3ZC0A 3M3ZB 1CHUA 1YKHB 3LBXB 1ZP0A 2FYKA 2Y48B 2SPCA 3QC9A 2CE7A 3RLFF 3MF2A 3C50A 2XAJB 4CI2B 1Y64B 4COFA 2L9QA 3ZYMA 4ZHQE 4BAYB 2NP9A 2A72A 3CPZA 3OVUA 1PYSB 3ZYLA 5JDFA 4DR1T 3BQKA 3C4WA 3MK7C 3ZN1B 2IDOB 2JQKA 3BQLA 5BR8T 2RHQB 5CJ5A 4XTZA 2K3WA 3VU7H 4DMWA 1XMQT 4IDPA 3DP7A 4JI8T 4JV5T 1X54A 1IBMT 4ADZA 5DQVA 2IAKA 4QXCB 1WQWA 3KBTA 2MYSA 5JR9C 3OYXA 2DKGA 3LDQB 1O3XA 4H2XB 5F5WA 3NELA 4YTPA 4P3PA 2E9XD 4AI6A 4IE4A 1Z7MA 3AXJB 2IY5A 4LVMA 3RIAA 3NVOA 3NEMA 2RHSA 3ONXA 2DWGA 3FB2A 2KWIB 3T1HT 3RX6A 4QH4A 4YXDA 2XQAA 4QH1A 2VQET 1E24A 4GK0E 3PE0A 4ZI3D 1HS7A 4CI3B 3P7IA 2Y8DA 11ASA 3HXXA 4YSXA 1HR0T 2CXDA 5HXRA 3I1AA 4L87A 3RQWA 3QOFA 3AE1A 4RQEA 2LSGA 5CGMA 4WJ3M 3GWHA 3RGLA 2UU9T 3NZPA 3PUWF 3PJAA 4F6RC 4EAHA 2W4XA 5AQQB 4DV1T 2UXDT 3NRYA 4B3TT 2E65A 4LF5T 2IY5B 4ZI2D 4DR7T 3VBBA 2BG9C 3P4QA 4H9OC 4AKIA 3NWIA 2ZR2A 4LVKA 3K3NA 1E7PA 4OFZA 4MLKA 3C64A 1C0AA 2W66A 2RHSB 2ZLYA 4U31A 3BFMA 3IALA 1OXZA 4UPAA 2L8KA 4HT4A 2PTFA 4PFOA 2RPAA 4HWOA 4XU3A 2DHRA 4P1NA 3R84B 4DPGA 5LG4A 4JI3T 1WYCA 2I0MA 3CQCB 2J47A 2DXUA 1NJ2A 3H3AA 3PUAA 2D0TA 3AE8A 3VQVA 4DIDB 4KUMB 5JDGA 2ZZGA 2Q5IA 2EHOD 4O4HE 3A7UA 1HXDA 1XWMA 3C98B 1GQEA 1NENA 4ZOLE 4YHJA 4H9SE 1DU2A 4QWNB 1EOVA 2OV9A 3IHRA 3QB5A 3QNUA 1HNXT 2XAFB 2Q7HA 3Q5EA 2LOPA 2IC6A 3L2ZA 4P3OA 3FBZA 1IL2A 3QK6A 3TKLB 4AH6A 3FZFB 3HR0A 1ZEEA 1B70A 4JI7T 3G06A 3C4ZA 4N78D 4U7YA 2D5UA 3UTKA 3PUSA 5AQJB 4CS2A 2UUBT 2IMLA 4YP0A 2FUPA 4ILCA 2P0LA 2I59A 4NCXA 3L4GA 2IIUA 4IDZA 2HN1A 4PNIA 3FZLB 4U72A 3CKDA 4TWFA 4DV2T 4Z8XA 1VQZA 2YU2A 4IL9A 1UURA 3CX8B 2EJGA 5HXHA 2ODRD 2VL0A 4ZXLA 3UULA 5K1XA 4CN1A 4I50E 2I4NA 4L5GA 4CXXA 5ABGA 3O1HA 3DTOA 2BKOA 3V5SA 5AQUB 1XMOT 1H7CA 2JQHA 3PURA 4QXHB 3AA1B 2QGSA 5JQGE 2XQ6A 3AVSA 4HVCA 1E22A 2YOEA 4X1IE 4AKGA 4F8HA 3OPCA 3N9OA 2X9HA 3PCOA 4HA8A 1B70B 3E0ZA 3VQYA 4UV9B 4EV6A 2NS6A 5AQPB 5JDQA 3H3MA 4YRFA 4HEAA 2ZIOA 3AE7A 4ISTA 2Q5HA 2QA7A 4QH5A 3L4GB 2CJAA 4XTUA 4YREA 2V8SV 2VK9A 1H4TA 3AEBA 4TQFA 2H7OA 2I4MA 4CH6A 2W2UA 4C91A 5IUXA 1KNZA 3RIRA 3ZN0B 3L39A 3HFZA 3AEEA 2DDZA 4YRKA 1KFYA 3A32A 1M62A 4K88A 3E22E 1WCRA 3FZKB 3SS1A 3M65A 4B3RT 2H7VC 2VKDA 4K0UA 4EZ4A 4DR3T 2ZM0A 2P5IA 3MF1A 1IBLT 2LRLA 4YRJA 2X68A 5AQOB 1USYA 4IT4A 4HWDA 1JJCA 1Z7NA 1L0WA 5J1GA 2HN2A 2XQ8A 3PCOB 5LXTE 3GA8A 4KX6A 3VHLA 2HPLA 4BJMA 3KV5A 4YCVA 2ZGWA 2MPKA 2WMOA 4TWDA 2PMEA 4P73A 2LOSA 1KK7A 1QF6A 4O2DA 3PZCA 4IHJE 2V1DB 3DSQA 2ZZFA 3EFRA 4DV6T 3I0QA 4TV9E 2YKSA 4NXMT 3ZSSA 1XDOA 4OP0A 4GYRA 2RA1A 5HEJA 12ASA 4XU0A 2PG8A 1WYDA 3VQXA 2A8EA 4B3MT 4KQEA 4TQDA 5DJQC 3AA0B 4CH3A 3AE6A 3HFZB 3OD1A 4OLFA 4QKNA 4JI0T 4JI1T 1H4QA 5FY1A 1WU7A 4HFVA 4NXNT 1MNEA 3L8RA 4WYVA 2BBHA 2XQ9A 3AAIA 4JI4T 2J4GA 1NAFA 2RP4A 1MIVA 3X1DA 4ANJA 1KMNA 3LFMA 2IW5B 5LBQB 3JC6D 4NPPA 4U2YA 4P0BA 3RYFE 2LSIA 4K0KT 2EJ9A 4X66T 4XTVA 5ELOA 1JJCB 3M4PA 3EFSA 1SERA 3VRBA 3ZJ1A 1HNZT 4IDOA 2UXNB 3T8OA 3U78A 1CUNA 4MALA 4HN9A 4LF8T 2CXFA 2UXCT 1E2AA 2Q9QC 4A98A 4YTMA 5KX5E 4E51A 4EEDA 4P72A 1HCIA 4YPFA 2X67A 5ABEA 5JTGA 4AKRB 4MHCA 3EDUA 2XY8B 5LYJE 5HEHA 2LEHA 2B1EA 3TLWA 4DO0A 2XZEA 1E1OA 3W15B 1LRZA 1T8BA 4LMKA 1WR6A 5C2TA 2JQQA 4RQFA 3GMIA 4KHZF 4CS4A 2CHNA 1BR0A 5HYAA 2CXLA 2DCFA 5HWYA 2VASA 3T1YT 4DUZT 1GGMA 4QHOA 2E5AA 2MTQA 3ZMZB 1WYBA 3MA9A 2UXXB 3MKDA 3ERRA 5L4HA 3PU8A 1G73A 3V8LA 3TLVA 4PJLA 4ASKA 1X55A 3V8JA 3RYHE 5E3IA 3LSQA 5TAOA 4HFCA 2EL9A 2E9XA 4YLHA 2DU5A 3EUHA 1D1CA 3K1SA 3RPUA 5BMVE 2CEAA 3Q5XA 4BWAA 3A5XA 1FMWA 1BR1A 3E9HA 5AQFB 4U33A 1YFSA 3QTCA 2ZM8A 4HE8A 4EZHA 3AAEB 4EX5A 4ZEYA 5FP3A 2DTHA 3QB5K 3NRXA 4UVCB 2DNXA 4EGWA 2LM9A 2QHVA 3ANWA 5HEOA 3ZMVB 4YDQA 5FXWA 1YB3A 4PJMA 2VKOA 2FJAA 4TV8E 1QE0A 2VB6A 3N9NA 4LMJA 2YDSA 3VR9A 5AQKB 4YRSA 1NYQA 1J1JA 5CFBA 4GYSA 5LNKA 1NNHA 3ETUA 1V9DA 1KOGA 3BK9A 2OLTA 3UUMA 4YTNA 3O9XA 1X01A 1QSDA 5JRCA 1X79A 4HFIA 1UGOA 3FHNA 3A8YC 1OWAA 2YU1A 2M6BA 2XAQB 2K9AA 2A2FX 2E9XB 4XTXA 2BZBA 2E1HA 2ZZEA 1M7KA 3WQZA 1MIWA 3IEEA 5J2TE 2CMRA 2PJQA 5EK2A 2LHRA 5FXZA 2XHEB 2AMCA 3UU4A 1MMAA 3CQGB 4WBOA 4UVBB 3NBXX 4JEUB 1MNDA 2BDEA 1WFDA 4YFSA 1ADJA 3PU3A 1L0VA 3CMLA 2WMNA 4IE7A 2ES0A 3ANWB 4KBMB 5E0OA 3HI2A 2CJBA 5FY7A 1SETA 5ETWA 3LK42 3BQIA 1YFRA 5CA1E 4UF0A 4LFCT 2PMFA 2LLYA 1ADYA 2J3MA 1MMGA 2EHOA 3GN5A 5LJMA 2DJZA 5JRCB 2XGTA 5IYZE 4LVIA 3LJCA 5ADXL 4PJJA 3AEFA 5JREA 3AA6B 2UUAT 3RKXA 4AXPA 4HTEA 2CBJA 4H2YA 4CN6A 3E08A 5LOVE 3O4XE 4DMVA 1NJ6A 2DWKA 1S94A 4JYAT 2AMCB 4H63V 2MAWA 3FXDB 5KXJA 4OYKA 5L3EB 3N9PA 2YEVC 4H63H 4CZZB 3KFWX 2A9UA 1D1BA 2I4LA 1MMNA 4A56A 4LFAT 5A1LA 4P0AA 2V7JA 3V7RA 4O8SA 2XSAA 2WU5A 2LKGA 2V7LA 4IDQA 2H89A 2X0LB 3AEAA 4HWCA 3SOLA 4CN4A 4EB6E 1Y01A 3HXYA 4UXNB 4AQFC 4UF0B 4YY3T 5AQTB 3CX6B 2YK0A 3HKEE 2EHOB 3GN5B 4YJ3E 4HFEA 3ZKRA 2F4VT 3P8CD 3HFVA 5H6QB 5DABA 2WU2A 2ZNIA 3HKCE 4TNWA 4WF2A 3K8PC 3ONJA 1ZOYA 2BKPA 4HWIB 5L47A 4ZTZB 4PK6A 1Z0PA 4PK5A 1YFTA 4YJ2E 4X5TA 1T98A 2D0UA 2WBLA 3ZMUB 1MIYA 4U2ZA 3LK3B 3ZSTA 3AAAB 3FZHB 4K86A 3ABVA 2HPJA 2LSJA 5EK3A 4HWHA 3RIUC 4DVDA 2E5VA 3ZCIA 3ZMSB 3FBLA 3AE4A 4H9PC 1YD8G 3TUPA 4J2CA 4DBRA 2HH7A 2XAGB 1NJ1A 4I0UA 2A3DA 2NOXA 1J5WA 2JIWA 2DEQA 4C90A 4DV5T 2E10A 5K1PA 4YRCA 4JUYA 5LJNA 1UUSA 5LMUT 1BBWA 3JAFA 2WCAA 1Z8UA 2LE8A 1WLXA 1D0XA 3F2EA 2N9DA 2KLQA 5J0ZA 4PK4A 4YYEA 4ZI7E 4V1Av 4YRIA 2QVAA 3AEDA 4AIUA 2X0HA 2BS2A 1EVLA 2ZCEA 4X62T 2J62A 3IKMB 3HY0A 4X1KE 4NUVA 3EDVA 4PAGA 3UQ4A 2XQ3A 2ACZA 3UGQA 3B57A 2JRKA 3REXA 1KMMA 4ZIBA 1YGBA 4QX8B 1BR4A 3HY1A 3PUGA 2NTYA 3PDYA 1JNZA 2X51A 3U3IA 2V7MA 3DJBA 1SHZC 4KMCA 4H2WA 1IZNB 3RKYA 1NJ8A 3KINB 3R07A 4EXTA 5KMGP 4UELA 1ZKEA 2DTOA 4HKAA 3EVYA 4CS3A 1LYLA 4XAXB 4KR3A 4IE5A 1YW0A 4EYUA 2E64A 1G8XA 1EVKA 4RMFA 4ILAA 2WSSV 1H4SA 2WDVA 5AQRB 3QUJA 2BG9E 2HNIA 4MBQA 1USYC 2XTLA 1D0ZA 3PUVF 4YT0A 3K3QC 1BIBA 4NUUA 2J3LA 4UV8B 4X1YE 3HXVA 2C5IT 2V7IA 3V7SA 2CWOA 5F8PA 4DBQA 2CPTA 2ZT5A 1FYFA 4YRRA 5LGTB 1KNRA 3UFGA 1UCUA 2L3LA 4GIWA 5LHHB 1XNQT 2BBJA 2C0SA 5CA0E 4P73C 2CLYB 5GONE 5C51B 4FI5A 2X66A 3UH0A 3TLUA 3UUNA 1IJ6A 5LMNT 4WI1A 4OHFA 3O1IA 2J1DG 4YSYA 2LKHA 3WAJA 5LGUB 4H9NC 4FJOA 1OEDC 4HFHA 3P8VA 4P74C 4LVLA 3PUYF 2ZINA 3ZC1A 3Q9DA 3I9WA 4B6XA 4CXWA 2MBGA 3D0TA 1W0AA 3ZLIA 4LMLA 4TN7B 2K24A 3EAMA 3RKOA 2PFVA 3LC0A 2LSYA 4YRNA 3OKQA 2CWYA 2N1GA 2XQ7A 3KV9A 1EFWA 2UXBT 2G0UA 4P75A 2DQ3A 3AE3A 3RACA 1SESA 2LT3A 3NZQA 3ZT5A 2CJ9A 3UGTA 1KNPA 4X65T 3RKGA 4E7ZA 4J15A 4YCWA 2KSRA 3KVAA 4DR4T 4TWHA 5IWAT 3NETA 1YKEB 4IE6A 4H9QC 2WWUA 4O4LE 3UU5A 2XUEA 4YHHT 3ZYKA 3P8YA 3AE9A 4ILUA 2IC9A 1N36T 2VQFT 4WJ4A 1LVKA 3UUBA 3MQZA 4H02A 2DI4A 4JI6T 3EHZA 4JBWF 2X9YA 2ZTGA 2EWNA 2NWBA 3UU3A 3KV4A 3LK2B 3RC3A 3EI0A 3RQUA 4AKLA 3ZMTB 2YDRA 2V26A 4WW0A 3NENA 4Z90A 1J5ET 4A97A 2V6XA 4AISA 2AKWA 2LRKA 1SA0E 2ARSA 4DUYT 4Q15A 4WZXA 4UP9A 2V5CA 3RYIE 1WPYA 2E9XC 4ZS3A 5LA6E 5FMNA 3PJAJ 1NYRA 4OX9T 1HNWT 3KDSE 5LP6E 5FYMA 3R6NA 4QXBB 1HG2A 3O1JA 5HGQA 4PFPA 4CQIA 5H6RB 4UR9A 2ALYA 4U3CA 5HWXA 2Q9QA 2DU7A 2DVEA 2FJDA 4YRTA 1FMVA 4IL4A 3WAKA 2MOZA 4LF9T 3UU8A 2M67A 3NKZA 5LHGB 4CI1B 4O4JE 4O2AE 4WNKA 5ABHA 2ARTA 3HRKA 4P71A 3Q5DA 5HEUA 4ZI3C 1N34T 2JMHA 2DLRA 3WI3A 3UFEA 2YINA 1B7YA 2DXTA 4NIQA 2NR4A 2WM9A 5L3DB 3ZT6A 3CMQA 3N2GE 3JAEA 3VR8A 2M6IA 2XM1A 4I4TE 2AKWB 5CB4E 3VRAA 4ZS2A 3IA3A 3C51A 3UU6A 4Q6GA 1OEDE 4YRLA 4XBFB 1X9BA 3AVRA 3RRWA 5FNVE 4OYJA 1I6ZA 2XQ5A 4ZI2C 3ZCJA 3LG7A 3ZPOA 1YQ4A 2YN6A 3I9YA 1IJ5A 1B7TA 1VOMA 1S35A 2ALYB 3OJAA 2Q9QB 1FJGT 4IREA 5JDLA 2AXDS 2Q9QD 3P50A 1SE7A 2BVLA 2WP9A 5LBMA 2E3CA 3F57A 4P09A 1LVFA 3L09A 3IKLA 1W9RA 5HAXA 4TUYE 4LF7T 2XPKA 3F31A 4PG3A 1UK5A 1RIQA 2DZ9A 1N32T 1US7B 2H3RA 2DTIA 3MZKB 4LNSA 2B76A 1MMDA 1B7YB 4UEMA 2DQ0A 2EHOC 5AQMB 1D0YA 4XU1A 4YRQA 4QX7B 4XEMA 3AECA 3RKWA 4Z91A 1WQ7A 2AE9A 4EYYR 3LSSA 3KFUA 4O4IE 1QLBA 2VKHA 4UIGA 4TX5A 2V5DA 1N33T 1XNRT 2P9BA 5L3GB 5JR9A 4ZTUB 3UUXB 3EABA 3KBUA 2BVMA 4EOZB 4XU2A 4X5OA 2ODUA 2X0YA 2IUBA 5AQVB 4DQ2A 2V7KA 3TEHA 2NTXA 4TNVA 5C8YE 2E5LT 3E9IA 4YRPA 4ZZBA 3ZEFB 5JH7E 4PJNA 4UVAB 2EJFA 2ZXFA 3AB3B 4U74A 1HX1B 4H2TA 4LF4T 5LB7B 4DR5T 1ZHCA 3LSVA 3MEYA 2FBWA 4L9IA 4KR2A 1X2GA 5AQLB 3N9LA 1UX4A 2I6HA 5AQNB 4UP8A 1IAPA 4BJNA 1VCTA 1W0BA 3IG2A 4HWFA 1WRDA 3M4QA 3N2KE 3FXEB 2XQYA 5FXVA 2CA5A 5L3CB 2ODRC 3CK6A 2KZ7B 2D2SA 2E41A 2WDRA 1G51A 4HFDA 3UT5E 3V8KA 2KXPB 3AE5A 4IDNA 4XTYA 1HX8A 2JQ9A 5JR9B 5FKYA 2FJBA 2BS4A 2WB5A 2NW8A 4HFBA 1T72A 3KVBA 4DV7T 2Q7GA 4G84A 4ILBA 5FVKA 4RDXA 4KP3C 1T7SA 4AQYT 1AJ3A 3CIRA 2V6YA 3TEHB 5HXSA 4YRGA 5C3JA 1ASYA 4H9RC 1U5PA 2BG9A 2QRXA 4H2SA 2ZM2A 3HKBE 2XQ4A 4XZCA 4DV4T 1B76A 4XTWA 2C5KT 1E1TA 2ARUA 2Y6XA 1ATIA 2C5JA 3K3OA 3V7CA 4YROA 2IHR1 2W62A 2H88A 5F3JA 4AQGA 3FJPA 1BR2A 2Q7EA 4TZ4C 5HCMA 3J9X1 3A7RA 3ZJ2A 3ZT7A 2HHHT 5LG3A 1I94T 2Z6EA 4BA9A 4AQFA 1QUUA 1WLEA 4HWRA 4DV0T 4IIJE 3B13A 4GOUA 4I43B 5JDHA 3H37A 3ESLA 3RC8A 4DNDA 2KNDA 4EO4A 4TVYA 3MXZA 3A7MA 4YRMA 3QO8A 3RIFA 2CLYC 3AEGA 1EIYA 1VCSA 3PUQA 3RYCE 1B8AA 5FL0A 4G85A 2V6YB 3I7FA 2E2AA 1HFAA 4TWAA 5C52B 2BG9B 2WQYA 1D1AA 3HXWA 4ZZCA 3RIUA 2VWAA 3QO7A 2ZR3A 3B5MA 2CM0A 4JI2T 5DQWA 1VRBA 4HWTA 4ERRA 2WDQA 3VKHA 2KT9A 2DZCA 2GK9A 3UQ7A 2WZHA 2ZT7A 3HXUA 1SRYA 3P4RA 3S4UA 1FEWA 1ASZA 3RF1A 3V5UA 3OYZA 4JLEA 3ETVA 1XZYA 3CX7B 5L3FB 4PW8A 5J2UE 1N9WA 4B3ST 3P8TA 2C8MA 4EIWA 3TLSA 1EQRA 2XAHB 4ISSA 5FXXA 2QHTA 5ABFA 2E8IA 1HG5A 1G5IA 5JVDE 2QHUA 2CGHA 3JC6C 2VVSA 3RHWA 1EIYB 3G1ZA 4GKJT 2X9XA 1H4VB 2ZMAA 4IE0A 1G5HA 2X9WA 3HKDE 4KI0F 3CWZB 4CH4A 2YDQA 3PTRB 1UX5A 5KDMC 1KEYA 5HCJA 3MJXA 3SWHA 2NW7A 2UUCT 3L1AA 3AA7B 1HC7A 1U4QA 2W61A 3HRIA 5AQHB 1YQ3A 2ZNJA 2LSKA 2NW9A 4CXYA 2XJ7A 4DR2T 4X20E 4U7IA 5EK4A 2ZM6T 3A31A 5AQIB 5L2LA 3OTOT 2QHSA 3QO5A 4BW9A 3VQWA 5FL1A 2W67A 1WNLA 3HTZA 2ZT8A 3SFDA 3W3SA
chains in the Genus database with same CATH topology
1YFRA 2DU7A 4XEOA 2DVEA 4P75C 4YRTA 2PMFA 4YP0A 1ADYA 2CIMA 2J3MA 2P0LA 4NCXA 1X56A 3L4GA 4LVJA 5C53B 2DJZA 2XGTA 3QNEA 2ARTA 3A5YA 3HRKA 4P71A 4LVIA 3BJUA 1VQZA 4TVWA 3RKXA 2EJGA 2ODRD 4H2YA 5KNNA 3A74A 1B7YA 2DXTA 5K1XA 2I4NA 3RUXA 1NJ6A 4YCUA 4UP7A 3CMQA 2AKWB 4H2UA 2AMCB 3A5ZA 4P74A 4Q6GA 4YRLA 4HWSA 4HVCA 1E22A 2I4LA 4P72C 3V7RA 1BIAA 3PCOA 2C7IA 4HA8A 1B70B 3VQYA 2G4CA 2NS6A 2ALYB 3HXYA 1X2HA 4YRFA 2ZIOA 4H2VA 2Q5HA 2E3CA 1BBUA 2EAYA 3IKLA 3HFVA 3L4GB 2CJAA 4XTUA 4YREA 2ZNIA 1H4TA 4TVAA 4TQFA 2I4MA 4PG3A 4WF2A 4CH6A 1RIQA 4CH5A 4ZTZB 2DZ9A 3RIRA 3HFZA 2DDZA 4YRKA 1YFTA 2DTIA 3A32A 4K88A 4LNSA 1NJ5A 1B7YB 3RL6A 2DQ0A 3A7AA 2XTIA 2P5IA 4XU1A 4K86A 4YRQA 4XEMA 4TTVA 3MF1A 3RKWA 4P71C 1W66A 1WQ7A 4K87A 3LSSA 4YRJA 1PYSA 3KFUA 1USYA 3ICAA 3TEGA 3TUPA 3HXZA 4ZTUB 1NJ1A 1JJCA 1Z7NA 2I4OA 2ZT6A 1L0WA 1J5WA 2DEQA 3PCOB 4XU2A 4X5OA 2E10A 5K1PA 4YRCA 4DQ2A 3TEHA 2RHQA 3E9IA 4YCVA 2ZGWA 1BBWA 4YRPA 2PMEA 4P73A 2EJFA 1HTTA 2ZXFA 2ZIMA 4P3NA 4O2DA 5ELNA 1QF6A 3PZCA 4H2TA 3DSQA 2ZZFA 3EFRA 4PHCA 4YYEA 3MEYA 4YRIA 4H2XA 4KR2A 1X2GA 1EVLA 3REUA 2ZCEA 3IKMB 4OP0A 12ASA 4TVAB 4XU0A 3HY0A 4HWPA 1WYDA 3VQXA 2A8EA 4KQEA 4TQDA 3UGQA 4UP8A 4CH3A 3HFZB 3IG2A 2FYKA 3REXA 3OD1A 1KMMA 4ZIBA 1YGBA 3M4QA 4OLFA 3HY1A 1H4QA 3MF2A 1WU7A 2ODRC 2E41A 4H2WA 1G51A 1KMNA 3RKYA 1NJ8A 3V8KA 1PYSB 4XTYA 3R07A 2EJ9A 2DTOA 4XTVA 4CS3A 5ELOA 1LYLA 4KR3A 4G84A 2Q7GA 1JJCB 4RDXA 3M4PA 3EFSA 2E64A 1EVKA 1SERA 4RMFA 3TEHB 4YRGA 2RHQB 1ASYA 4XTZA 1H4SA 4H2SA 1X54A 2HNIA 1USYC 1B76A 1WQWA 4XTWA 1E1TA 1BIBA 2ARUA 1ATIA 2J3LA 4E51A 2DKGA 4P72A 4H2XB 3HXVA 4YPFA 3V7CA 5F5WA 3NELA 3V7SA 4YROA 4P3PA 2ZT5A 1FYFA 4YRRA 3FJPA 3UFGA 2Q7EA 1Z7MA 2IY5A 3A7RA 1E1OA 4LVMA 4P73C 5C51B 1WLEA 4HWRA 3NEMA 3UH0A 4RQFA 2RHSA 4CS4A 4WI1A 1GGMA 2E5AA 4EO4A 4TVYA 1E24A 4YRMA 3P8VA 3QO8A 4P74C 4LVLA 3ERRA 11ASA 1EIYA 3V8LA 3HXXA 1X55A 2ZINA 3V8JA 1B8AA 5E3IA 4G85A 3LSQA 3I7FA 2EL9A 2DU5A 4TWAA 5C52B 3HXWA 4L87A 4BWAA 3LC0A 3E9HA 3QO7A 4RQEA 4YRNA 4WJ3M 2ZR3A 3RGLA 1YFSA 3QTCA 1EFWA 4P75A 2DQ3A 3RACA 4EX5A 4HWTA 1SESA 2DTHA 2CJ9A 2E65A 2DZCA 3UGTA 2QHVA 2IY5B 2ZT7A 4YDQA 3VBBA 3HXUA 1SRYA 1YB3A 4J15A 4YCWA 2ZR2A 4LVKA 1QE0A 1ASZA 3NETA 3RF1A 1C0AA 4YRSA 2RHSB 1N9WA 3P8TA 1NYQA 2C8MA 3BFMA 3IALA 3P8YA 1EQRA 4UPAA 4HT4A 1NNHA 4WJ4A 1KOGA 2QHTA 3MQZA 4H02A 1G5IA 4HWOA 2QHUA 1X01A 4XU3A 2CGHA 2ZTGA 2EWNA 4DPGA 1EIYB 3G1ZA 2DXUA 1H4VB 1NJ2A 1G5HA 3VQVA 4XTXA 2E1HA 2ZZGA 2ZZEA 2Q5IA 3NENA 3A7UA 3WQZA 1HXDA 4CH4A 2AKWA 1EOVA 1HC7A 3L1AA 2AMCA 3HRIA 2ARSA 2Q7HA 2ZNJA 4Q15A 4UP9A 1WPYA 1ADJA 3L2ZA 1NYRA 3A31A 4P3OA 1IL2A 2QHSA 4AH6A 2CJBA 3QO5A 1SETA 4BW9A 3VQWA 1B70A 1WNLA 5HGQA 3HTZA 2ZT8A 2ALYA 3W3SA 4CS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFR A;  2DU7 A;  4XEO A;  2DVE A;  4P75 C;  4YRT A;  2PMF A;  4YP0 A;  1ADY A;  2CIM A;  2J3M A;  2P0L A;  4NCX A;  1X56 A;  3L4G A;  5C53 B;  2DJZ A;  2XGT A;  3QNE A;  2ART A;  3A5Y A;  3HRK A;  4P71 A;  3BJU A;  1VQZ A;  4TVW A;  3RKX A;  2EJG A;  2ODR D;  4H2Y A;  5KNN A;  3A74 A;  1B7Y A;  2DXT A;  5K1X A;  2I4N A;  3RUX A;  1NJ6 A;  4YCU A;  4UP7 A;  3CMQ A;  2AKW B;  4H2U A;  2AMC B;  3A5Z A;  4P74 A;  4Q6G A;  4YRL A;  4HWS A;  4HVC A;  1E22 A;  2I4L A;  4P72 C;  3V7R A;  1BIA A;  3PCO A;  2C7I A;  4HA8 A;  1B70 B;  3VQY A;  2G4C A;  2ALY B;  3HXY A;  1X2H A;  4YRF A;  2ZIO A;  4H2V A;  2Q5H A;  2E3C A;  1BBU A;  2EAY A;  3IKL A;  3HFV A;  3L4G B;  2CJA A;  4XTU A;  4YRE A;  2ZNI A;  1H4T A;  4TVA A;  4TQF A;  2I4M A;  4PG3 A;  4WF2 A;  4CH6 A;  1RIQ A;  4CH5 A;  4ZTZ B;  2DZ9 A;  3RIR A;  3HFZ A;  2DDZ A;  4YRK A;  1YFT A;  2DTI A;  3A32 A;  4K88 A;  4LNS A;  1NJ5 A;  1B7Y B;  3RL6 A;  2DQ0 A;  3A7A A;  2XTI A;  2P5I A;  4XU1 A;  4K86 A;  4YRQ A;  4XEM A;  4TTV A;  3MF1 A;  3RKW A;  4P71 C;  1W66 A;  1WQ7 A;  4K87 A;  3LSS A;  4YRJ A;  1PYS A;  3KFU A;  1USY A;  3ICA A;  3TEG A;  3TUP A;  3HXZ A;  4ZTU B;  1NJ1 A;  1JJC A;  1Z7N A;  2I4O A;  2ZT6 A;  1L0W A;  1J5W A;  2DEQ A;  3PCO B;  4XU2 A;  4X5O A;  2E10 A;  5K1P A;  4YRC A;  4DQ2 A;  3TEH A;  2RHQ A;  3E9I A;  4YCV A;  2ZGW A;  1BBW A;  4YRP A;  2PME A;  4P73 A;  2EJF A;  1HTT A;  2ZXF A;  2ZIM A;  4P3N A;  4O2D A;  5ELN A;  1QF6 A;  3PZC A;  4H2T A;  3DSQ A;  2ZZF A;  3EFR A;  4PHC A;  4YYE A;  3MEY A;  4YRI A;  4H2X A;  4KR2 A;  1X2G A;  1EVL A;  3REU A;  2ZCE A;  3IKM B;  4OP0 A;  12AS A;  4TVA B;  4XU0 A;  3HY0 A;  4HWP A;  1WYD A;  3VQX A;  4KQE A;  4TQD A;  3UGQ A;  4UP8 A;  4CH3 A;  3HFZ B;  3IG2 A;  2FYK A;  3REX A;  3OD1 A;  1KMM A;  4ZIB A;  1YGB A;  3M4Q A;  4OLF A;  3HY1 A;  1H4Q A;  3MF2 A;  1WU7 A;  2ODR C;  2E41 A;  4H2W A;  1G51 A;  1KMN A;  3RKY A;  1NJ8 A;  3V8K A;  1PYS B;  4XTY A;  3R07 A;  2EJ9 A;  2DTO A;  4XTV A;  4CS3 A;  5ELO A;  1LYL A;  4KR3 A;  4G84 A;  2Q7G A;  1JJC B;  4RDX A;  3M4P A;  3EFS A;  2E64 A;  1EVK A;  1SER A;  4RMF A;  3TEH B;  4YRG A;  2RHQ B;  1ASY A;  4XTZ A;  1H4S A;  4H2S A;  1X54 A;  2HNI A;  1USY C;  1B76 A;  1WQW A;  4XTW A;  1E1T A;  1BIB A;  2ARU A;  1ATI A;  2J3L A;  4E51 A;  2DKG A;  4P72 A;  4H2X B;  3HXV A;  4YPF A;  3V7C A;  5F5W A;  3NEL A;  3V7S A;  4YRO A;  4P3P A;  2ZT5 A;  1FYF A;  4YRR A;  3FJP A;  3UFG A;  2Q7E A;  1Z7M A;  2IY5 A;  3A7R A;  1E1O A;  4P73 C;  5C51 B;  1WLE A;  4HWR A;  3NEM A;  3UH0 A;  4RQF A;  2RHS A;  4CS4 A;  4WI1 A;  1GGM A;  2E5A A;  4EO4 A;  4TVY A;  1E24 A;  4YRM A;  3P8V A;  3QO8 A;  4P74 C;  3ERR A;  11AS A;  1EIY A;  3V8L A;  3HXX A;  1X55 A;  2ZIN A;  3V8J A;  1B8A A;  5E3I A;  4G85 A;  3LSQ A;  3I7F A;  2EL9 A;  2DU5 A;  4TWA A;  5C52 B;  3HXW A;  4L87 A;  4BWA A;  3LC0 A;  3E9H A;  3QO7 A;  4RQE A;  4YRN A;  4WJ3 M;  2ZR3 A;  3RGL A;  1YFS A;  3QTC A;  1EFW A;  4P75 A;  2DQ3 A;  3RAC A;  4EX5 A;  4HWT A;  1SES A;  2DTH A;  2CJ9 A;  2E65 A;  2DZC A;  3UGT A;  2QHV A;  2IY5 B;  2ZT7 A;  4YDQ A;  3VBB A;  3HXU A;  1SRY A;  1YB3 A;  4J15 A;  4YCW A;  2ZR2 A;  1QE0 A;  1ASZ A;  3NET A;  3RF1 A;  1C0A A;  4YRS A;  2RHS B;  1N9W A;  3P8T A;  1NYQ A;  2C8M A;  3BFM A;  3IAL A;  3P8Y A;  1EQR A;  4UPA A;  1NNH A;  4WJ4 A;  1KOG A;  2QHT A;  4H02 A;  1G5I A;  4HWO A;  2QHU A;  1X01 A;  4XU3 A;  2CGH A;  2ZTG A;  2EWN A;  4DPG A;  1EIY B;  3G1Z A;  2DXU A;  1H4V B;  1NJ2 A;  1G5H A;  3VQV A;  4XTX A;  2E1H A;  2ZZG A;  2ZZE A;  2Q5I A;  3NEN A;  3A7U A;  3WQZ A;  1HXD A;  4CH4 A;  2AKW A;  1EOV A;  1HC7 A;  3L1A A;  2AMC A;  3HRI A;  2ARS A;  2Q7H A;  2ZNJ A;  4Q15 A;  4UP9 A;  1WPY A;  1ADJ A;  3L2Z A;  1NYR A;  3A31 A;  4P3O A;  1IL2 A;  2QHS A;  4AH6 A;  2CJB A;  3QO5 A;  1SET A;  4BW9 A;  3VQW A;  1B70 A;  1WNL A;  5HGQ A;  3HTZ A;  2ZT8 A;  2ALY A;  3W3S A;  4CS2 A; 
#chains in the Genus database with same CATH topology
 2WY2 A;  5L3B B;  4XEO A;  4P75 C;  1YXR A;  2CRB A;  2CIM A;  5AFU L;  2WS3 A;  2W63 A;  3TLT A;  1X56 A;  5LCY A;  5ABF B;  4LVJ A;  5HXC A;  5C53 B;  3MAC A;  3QNE A;  1NEK A;  3A5Y A;  2KIN B;  2JJ9 A;  3BJU A;  4DR6 T;  4M1P A;  3IF8 B;  2JPF A;  4TVW A;  1HF8 A;  2DL1 A;  3J7Y q;  3HA4 A;  5HXE A;  5KNN A;  3A74 A;  3PUZ F;  2VL8 A;  3RUX A;  4YCU A;  4UP7 A;  4HGA A;  1XDP A;  2ODV A;  3N9M A;  4H2U A;  3CVR A;  3PV0 F;  1OED A;  1IBK T;  3A5Z A;  3AE2 A;  4P74 A;  2KMF A;  4HWS A;  3N9Q A;  3RI5 A;  4P72 C;  2CBI A;  4MFR A;  2W0G A;  3OBV E;  4LFB T;  1BIA A;  3VKG A;  1JNR A;  2C7I A;  3I0O A;  4O2B E;  3IBP A;  4DV3 T;  4I55 E;  2VKJ A;  2G4C A;  1ZV4 X;  2KWH A;  5LGN B;  1WR0 A;  3SFE A;  3P4S A;  1X2H A;  3N2O A;  4H2V A;  3C4X A;  1E1H B;  4E7S A;  2EAY A;  2LHN A;  1W09 A;  1BBU A;  1LKX A;  3Q5W A;  2QYW A;  2CHO A;  1R8I A;  3Q2M A;  2WWV A;  2BKN A;  4TVA A;  5HEG A;  3HL6 A;  5FY0 A;  2XAS B;  1FIO A;  4LF6 T;  4CH5 A;  4IGU A;  4Q25 A;  3KV6 A;  3LBX A;  4OK0 A;  2VVN A;  2OA5 A;  3RRC A;  4A5X A;  4AKH A;  1NJ5 A;  3RL6 A;  2XSB A;  2D9D A;  2FJE A;  5IHY A;  3A7A A;  3L3P A;  2XTI A;  3P4P A;  1EZ3 A;  2WAU A;  4TTV A;  1NWM X;  1OED B;  3RH3 A;  3FZM B;  4P71 C;  1W66 A;  3CQX C;  3PUX F;  3ONL C;  1SUM B;  4K87 A;  4G63 A;  4GKK T;  1PYS A;  3ICA A;  1HTJ F;  4WBN E;  2ACX A;  3TEG A;  4G2A A;  3HXZ A;  3N5L A;  2VUR A;  4KHP T;  3JCF A;  5FVL A;  2I4O A;  2ZT6 A;  4GK5 E;  3SRZ A;  5JDN A;  2CCQ A;  2BS3 A;  2XM2 A;  2K48 A;  5JDM A;  5LHI B;  2RHQ A;  4L0R A;  2K5B B;  2LJL A;  5AQG B;  1HTT A;  5M4Y A;  2ZIM A;  4P3N A;  5ELN A;  2LM2 A;  2JMK A;  2N2N A;  5AQS B;  4JI5 T;  1KF6 A;  4X64 T;  4PHC A;  5L4E A;  5EZY E;  2R6G F;  4EEB A;  4YSZ A;  3P4W A;  4H2X A;  4JEH B;  2PBI A;  3REU A;  3JAD A;  4TVA B;  2WZI A;  4HWP A;  2W00 A;  3AXJ A;  3ZC0 A;  3M3Z B;  1CHU A;  1YKH B;  3LBX B;  1ZP0 A;  2FYK A;  2Y48 B;  2SPC A;  3QC9 A;  2CE7 A;  3RLF F;  3MF2 A;  3C50 A;  2XAJ B;  4CI2 B;  1Y64 B;  4COF A;  2L9Q A;  3ZYM A;  4ZHQ E;  4BAY B;  2NP9 A;  2A72 A;  3CPZ A;  3OVU A;  1PYS B;  3ZYL A;  5JDF A;  4DR1 T;  3BQK A;  3C4W A;  3MK7 C;  3ZN1 B;  2IDO B;  2JQK A;  3BQL A;  5BR8 T;  2RHQ B;  5CJ5 A;  4XTZ A;  2K3W A;  3VU7 H;  4DMW A;  1XMQ T;  4IDP A;  3DP7 A;  4JI8 T;  4JV5 T;  1X54 A;  1IBM T;  4ADZ A;  5DQV A;  2IAK A;  4QXC B;  1WQW A;  3KBT A;  2MYS A;  5JR9 C;  3OYX A;  2DKG A;  3LDQ B;  1O3X A;  4H2X B;  5F5W A;  3NEL A;  4YTP A;  4P3P A;  2E9X D;  4AI6 A;  4IE4 A;  1Z7M A;  3AXJ B;  2IY5 A;  4LVM A;  3RIA A;  3NVO A;  3NEM A;  2RHS A;  3ONX A;  2DWG A;  3FB2 A;  2KWI B;  3T1H T;  3RX6 A;  4QH4 A;  4YXD A;  2XQA A;  4QH1 A;  2VQE T;  1E24 A;  4GK0 E;  3PE0 A;  4ZI3 D;  1HS7 A;  4CI3 B;  3P7I A;  2Y8D A;  11AS A;  3HXX A;  4YSX A;  1HR0 T;  2CXD A;  5HXR A;  3I1A A;  4L87 A;  3RQW A;  3QOF A;  3AE1 A;  4RQE A;  2LSG A;  5CGM A;  4WJ3 M;  3GWH A;  3RGL A;  2UU9 T;  3NZP A;  3PUW F;  3PJA A;  4F6R C;  4EAH A;  2W4X A;  5AQQ B;  4DV1 T;  2UXD T;  3NRY A;  4B3T T;  2E65 A;  4LF5 T;  2IY5 B;  4ZI2 D;  4DR7 T;  3VBB A;  2BG9 C;  3P4Q A;  4H9O C;  4AKI A;  3NWI A;  2ZR2 A;  4LVK A;  3K3N A;  1E7P A;  4OFZ A;  4MLK A;  3C64 A;  1C0A A;  2W66 A;  2RHS B;  2ZLY A;  4U31 A;  3BFM A;  3IAL A;  1OXZ A;  4UPA A;  2L8K A;  4HT4 A;  2PTF A;  4PFO A;  2RPA A;  4HWO A;  4XU3 A;  2DHR A;  4P1N A;  3R84 B;  4DPG A;  5LG4 A;  4JI3 T;  1WYC A;  2I0M A;  3CQC B;  2J47 A;  2DXU A;  1NJ2 A;  3H3A A;  3PUA A;  2D0T A;  3AE8 A;  3VQV A;  4DID B;  4KUM B;  5JDG A;  2ZZG A;  2Q5I A;  2EHO D;  4O4H E;  3A7U A;  1HXD A;  1XWM A;  3C98 B;  1GQE A;  1NEN A;  4ZOL E;  4YHJ A;  4H9S E;  1DU2 A;  4QWN B;  1EOV A;  2OV9 A;  3IHR A;  3QB5 A;  3QNU A;  1HNX T;  2XAF B;  2Q7H A;  3Q5E A;  2LOP A;  2IC6 A;  3L2Z A;  4P3O A;  3FBZ A;  1IL2 A;  3QK6 A;  3TKL B;  4AH6 A;  3FZF B;  3HR0 A;  1ZEE A;  1B70 A;  4JI7 T;  3G06 A;  3C4Z A;  4N78 D;  4U7Y A;  2D5U A;  3UTK A;  3PUS A;  5AQJ B;  4CS2 A;  2UUB T;  2IML A;  4YP0 A;  2FUP A;  4ILC A;  2P0L A;  2I59 A;  4NCX A;  3L4G A;  2IIU A;  4IDZ A;  2HN1 A;  4PNI A;  3FZL B;  4U72 A;  3CKD A;  4TWF A;  4DV2 T;  4Z8X A;  1VQZ A;  2YU2 A;  4IL9 A;  1UUR A;  3CX8 B;  2EJG A;  5HXH A;  2ODR D;  2VL0 A;  4ZXL A;  3UUL A;  5K1X A;  4CN1 A;  4I50 E;  2I4N A;  4L5G A;  4CXX A;  5ABG A;  3O1H A;  3DTO A;  2BKO A;  3V5S A;  5AQU B;  1XMO T;  1H7C A;  2JQH A;  3PUR A;  4QXH B;  3AA1 B;  2QGS A;  5JQG E;  2XQ6 A;  3AVS A;  4HVC A;  1E22 A;  2YOE A;  4X1I E;  4AKG A;  4F8H A;  3OPC A;  3N9O A;  2X9H A;  3PCO A;  4HA8 A;  1B70 B;  3E0Z A;  3VQY A;  4UV9 B;  4EV6 A;  2NS6 A;  5AQP B;  5JDQ A;  3H3M A;  4YRF A;  4HEA A;  2ZIO A;  3AE7 A;  4IST A;  2Q5H A;  2QA7 A;  4QH5 A;  3L4G B;  2CJA A;  4XTU A;  4YRE A;  2V8S V;  2VK9 A;  1H4T A;  3AEB A;  4TQF A;  2H7O A;  2I4M A;  4CH6 A;  2W2U A;  4C91 A;  5IUX A;  1KNZ A;  3RIR A;  3ZN0 B;  3L39 A;  3HFZ A;  3AEE A;  2DDZ A;  4YRK A;  1KFY A;  3A32 A;  1M62 A;  4K88 A;  3E22 E;  1WCR A;  3FZK B;  3SS1 A;  3M65 A;  4B3R T;  2H7V C;  2VKD A;  4K0U A;  4EZ4 A;  4DR3 T;  2ZM0 A;  2P5I A;  3MF1 A;  1IBL T;  2LRL A;  4YRJ A;  2X68 A;  5AQO B;  1USY A;  4IT4 A;  4HWD A;  1JJC A;  1Z7N A;  1L0W A;  5J1G A;  2HN2 A;  2XQ8 A;  3PCO B;  5LXT E;  3GA8 A;  4KX6 A;  3VHL A;  2HPL A;  4BJM A;  3KV5 A;  4YCV A;  2ZGW A;  2MPK A;  2WMO A;  4TWD A;  2PME A;  4P73 A;  2LOS A;  1KK7 A;  1QF6 A;  4O2D A;  3PZC A;  4IHJ E;  2V1D B;  3DSQ A;  2ZZF A;  3EFR A;  4DV6 T;  3I0Q A;  4TV9 E;  2YKS A;  4NXM T;  3ZSS A;  1XDO A;  4OP0 A;  4GYR A;  2RA1 A;  5HEJ A;  12AS A;  4XU0 A;  2PG8 A;  1WYD A;  3VQX A;  2A8E A;  4B3M T;  4KQE A;  4TQD A;  5DJQ C;  3AA0 B;  4CH3 A;  3AE6 A;  3HFZ B;  3OD1 A;  4OLF A;  4QKN A;  4JI0 T;  4JI1 T;  1H4Q A;  5FY1 A;  1WU7 A;  4HFV A;  4NXN T;  1MNE A;  3L8R A;  4WYV A;  2BBH A;  2XQ9 A;  3AAI A;  4JI4 T;  2J4G A;  1NAF A;  2RP4 A;  1MIV A;  3X1D A;  4ANJ A;  1KMN A;  3LFM A;  2IW5 B;  5LBQ B;  3JC6 D;  4NPP A;  4U2Y A;  4P0B A;  3RYF E;  2LSI A;  4K0K T;  2EJ9 A;  4X66 T;  4XTV A;  5ELO A;  1JJC B;  3M4P A;  3EFS A;  1SER A;  3VRB A;  3ZJ1 A;  1HNZ T;  4IDO A;  2UXN B;  3T8O A;  3U78 A;  1CUN A;  4MAL A;  4HN9 A;  4LF8 T;  2CXF A;  2UXC T;  1E2A A;  2Q9Q C;  4A98 A;  4YTM A;  5KX5 E;  4E51 A;  4EED A;  4P72 A;  1HCI A;  4YPF A;  2X67 A;  5ABE A;  5JTG A;  4AKR B;  4MHC A;  3EDU A;  2XY8 B;  5LYJ E;  5HEH A;  2LEH A;  2B1E A;  3TLW A;  4DO0 A;  2XZE A;  1E1O A;  3W15 B;  1LRZ A;  1T8B A;  4LMK A;  1WR6 A;  5C2T A;  2JQQ A;  4RQF A;  3GMI A;  4KHZ F;  4CS4 A;  2CHN A;  1BR0 A;  5HYA A;  2CXL A;  2DCF A;  5HWY A;  2VAS A;  3T1Y T;  4DUZ T;  1GGM A;  4QHO A;  2E5A A;  2MTQ A;  3ZMZ B;  1WYB A;  3MA9 A;  2UXX B;  3MKD A;  3ERR A;  5L4H A;  3PU8 A;  1G73 A;  3V8L A;  3TLV A;  4PJL A;  4ASK A;  1X55 A;  3V8J A;  3RYH E;  5E3I A;  3LSQ A;  5TAO A;  4HFC A;  2EL9 A;  2E9X A;  4YLH A;  2DU5 A;  3EUH A;  1D1C A;  3K1S A;  3RPU A;  5BMV E;  2CEA A;  3Q5X A;  4BWA A;  3A5X A;  1FMW A;  1BR1 A;  3E9H A;  5AQF B;  4U33 A;  1YFS A;  3QTC A;  2ZM8 A;  4HE8 A;  4EZH A;  3AAE B;  4EX5 A;  4ZEY A;  5FP3 A;  2DTH A;  3QB5 K;  3NRX A;  4UVC B;  2DNX A;  4EGW A;  2LM9 A;  2QHV A;  3ANW A;  5HEO A;  3ZMV B;  4YDQ A;  5FXW A;  1YB3 A;  4PJM A;  2VKO A;  2FJA A;  4TV8 E;  1QE0 A;  2VB6 A;  3N9N A;  4LMJ A;  2YDS A;  3VR9 A;  5AQK B;  4YRS A;  1NYQ A;  1J1J A;  5CFB A;  4GYS A;  5LNK A;  1NNH A;  3ETU A;  1V9D A;  1KOG A;  3BK9 A;  2OLT A;  3UUM A;  4YTN A;  3O9X A;  1X01 A;  1QSD A;  5JRC A;  1X79 A;  4HFI A;  1UGO A;  3FHN A;  3A8Y C;  1OWA A;  2YU1 A;  2M6B A;  2XAQ B;  2K9A A;  2A2F X;  2E9X B;  4XTX A;  2BZB A;  2E1H A;  2ZZE A;  1M7K A;  3WQZ A;  1MIW A;  3IEE A;  5J2T E;  2CMR A;  2PJQ A;  5EK2 A;  2LHR A;  5FXZ A;  2XHE B;  2AMC A;  3UU4 A;  1MMA A;  3CQG B;  4WBO A;  4UVB B;  3NBX X;  4JEU B;  1MND A;  2BDE A;  1WFD A;  4YFS A;  1ADJ A;  3PU3 A;  1L0V A;  3CML A;  2WMN A;  4IE7 A;  2ES0 A;  3ANW B;  4KBM B;  5E0O A;  3HI2 A;  2CJB A;  5FY7 A;  1SET A;  5ETW A;  3LK4 2;  3BQI A;  1YFR A;  5CA1 E;  4UF0 A;  4LFC T;  2PMF A;  2LLY A;  1ADY A;  2J3M A;  1MMG A;  2EHO A;  3GN5 A;  5LJM A;  2DJZ A;  5JRC B;  2XGT A;  5IYZ E;  4LVI A;  3LJC A;  5ADX L;  4PJJ A;  3AEF A;  5JRE A;  3AA6 B;  2UUA T;  3RKX A;  4AXP A;  4HTE A;  2CBJ A;  4H2Y A;  4CN6 A;  3E08 A;  5LOV E;  3O4X E;  4DMV A;  1NJ6 A;  2DWK A;  1S94 A;  4JYA T;  2AMC B;  4H63 V;  2MAW A;  3FXD B;  5KXJ A;  4OYK A;  5L3E B;  3N9P A;  2YEV C;  4H63 H;  4CZZ B;  3KFW X;  2A9U A;  1D1B A;  2I4L A;  1MMN A;  4A56 A;  4LFA T;  5A1L A;  4P0A A;  2V7J A;  3V7R A;  4O8S A;  2XSA A;  2WU5 A;  2LKG A;  2V7L A;  4IDQ A;  2H89 A;  2X0L B;  3AEA A;  4HWC A;  3SOL A;  4CN4 A;  4EB6 E;  1Y01 A;  3HXY A;  4UXN B;  4AQF C;  4UF0 B;  4YY3 T;  5AQT B;  3CX6 B;  2YK0 A;  3HKE E;  2EHO B;  3GN5 B;  4YJ3 E;  4HFE A;  3ZKR A;  2F4V T;  3P8C D;  3HFV A;  5H6Q B;  5DAB A;  2WU2 A;  2ZNI A;  3HKC E;  4TNW A;  4WF2 A;  3K8P C;  3ONJ A;  1ZOY A;  2BKP A;  4HWI B;  5L47 A;  4ZTZ B;  4PK6 A;  1Z0P A;  4PK5 A;  1YFT A;  4YJ2 E;  4X5T A;  1T98 A;  2D0U A;  2WBL A;  3ZMU B;  1MIY A;  4U2Z A;  3LK3 B;  3ZST A;  3AAA B;  3FZH B;  4K86 A;  3ABV A;  2HPJ A;  2LSJ A;  5EK3 A;  4HWH A;  3RIU C;  4DVD A;  2E5V A;  3ZCI A;  3ZMS B;  3FBL A;  3AE4 A;  4H9P C;  1YD8 G;  3TUP A;  4J2C A;  4DBR A;  2HH7 A;  2XAG B;  1NJ1 A;  4I0U A;  2A3D A;  2NOX A;  1J5W A;  2JIW A;  2DEQ A;  4C90 A;  4DV5 T;  2E10 A;  5K1P A;  4YRC A;  4JUY A;  5LJN A;  1UUS A;  5LMU T;  1BBW A;  3JAF A;  2WCA A;  1Z8U A;  2LE8 A;  1WLX A;  1D0X A;  3F2E A;  2N9D A;  2KLQ A;  5J0Z A;  4PK4 A;  4YYE A;  4ZI7 E;  4V1A v;  4YRI A;  2QVA A;  3AED A;  4AIU A;  2X0H A;  2BS2 A;  1EVL A;  2ZCE A;  4X62 T;  2J62 A;  3IKM B;  3HY0 A;  4X1K E;  4NUV A;  3EDV A;  4PAG A;  3UQ4 A;  2XQ3 A;  2ACZ A;  3UGQ A;  3B57 A;  2JRK A;  3REX A;  1KMM A;  4ZIB A;  1YGB A;  4QX8 B;  1BR4 A;  3HY1 A;  3PUG A;  2NTY A;  3PDY A;  1JNZ A;  2X51 A;  3U3I A;  2V7M A;  3DJB A;  1SHZ C;  4KMC A;  4H2W A;  1IZN B;  3RKY A;  1NJ8 A;  3KIN B;  3R07 A;  4EXT A;  5KMG P;  4UEL A;  1ZKE A;  2DTO A;  4HKA A;  3EVY A;  4CS3 A;  1LYL A;  4XAX B;  4KR3 A;  4IE5 A;  1YW0 A;  4EYU A;  2E64 A;  1G8X A;  1EVK A;  4RMF A;  4ILA A;  2WSS V;  1H4S A;  2WDV A;  5AQR B;  3QUJ A;  2BG9 E;  2HNI A;  4MBQ A;  1USY C;  2XTL A;  1D0Z A;  3PUV F;  4YT0 A;  3K3Q C;  1BIB A;  4NUU A;  2J3L A;  4UV8 B;  4X1Y E;  3HXV A;  2C5I T;  2V7I A;  3V7S A;  2CWO A;  5F8P A;  4DBQ A;  2CPT A;  2ZT5 A;  1FYF A;  4YRR A;  5LGT B;  1KNR A;  3UFG A;  1UCU A;  2L3L A;  4GIW A;  5LHH B;  1XNQ T;  2BBJ A;  2C0S A;  5CA0 E;  4P73 C;  2CLY B;  5GON E;  5C51 B;  4FI5 A;  2X66 A;  3UH0 A;  3TLU A;  3UUN A;  1IJ6 A;  5LMN T;  4WI1 A;  4OHF A;  3O1I A;  2J1D G;  4YSY A;  2LKH A;  3WAJ A;  5LGU B;  4H9N C;  4FJO A;  1OED C;  4HFH A;  3P8V A;  4P74 C;  4LVL A;  3PUY F;  2ZIN A;  3ZC1 A;  3Q9D A;  3I9W A;  4B6X A;  4CXW A;  2MBG A;  3D0T A;  1W0A A;  3ZLI A;  4LML A;  4TN7 B;  2K24 A;  3EAM A;  3RKO A;  2PFV A;  3LC0 A;  2LSY A;  4YRN A;  3OKQ A;  2CWY A;  2N1G A;  2XQ7 A;  3KV9 A;  1EFW A;  2UXB T;  2G0U A;  4P75 A;  2DQ3 A;  3AE3 A;  3RAC A;  1SES A;  2LT3 A;  3NZQ A;  3ZT5 A;  2CJ9 A;  3UGT A;  1KNP A;  4X65 T;  3RKG A;  4E7Z A;  4J15 A;  4YCW A;  2KSR A;  3KVA A;  4DR4 T;  4TWH A;  5IWA T;  3NET A;  1YKE B;  4IE6 A;  4H9Q C;  2WWU A;  4O4L E;  3UU5 A;  2XUE A;  4YHH T;  3ZYK A;  3P8Y A;  3AE9 A;  4ILU A;  2IC9 A;  1N36 T;  2VQF T;  4WJ4 A;  1LVK A;  3UUB A;  3MQZ A;  4H02 A;  2DI4 A;  4JI6 T;  3EHZ A;  4JBW F;  2X9Y A;  2ZTG A;  2EWN A;  2NWB A;  3UU3 A;  3KV4 A;  3LK2 B;  3RC3 A;  3EI0 A;  3RQU A;  4AKL A;  3ZMT B;  2YDR A;  2V26 A;  4WW0 A;  3NEN A;  4Z90 A;  1J5E T;  4A97 A;  2V6X A;  4AIS A;  2AKW A;  2LRK A;  1SA0 E;  2ARS A;  4DUY T;  4Q15 A;  4WZX A;  4UP9 A;  2V5C A;  3RYI E;  1WPY A;  2E9X C;  4ZS3 A;  5LA6 E;  5FMN A;  3PJA J;  1NYR A;  4OX9 T;  1HNW T;  3KDS E;  5LP6 E;  5FYM A;  3R6N A;  4QXB B;  1HG2 A;  3O1J A;  5HGQ A;  4PFP A;  4CQI A;  5H6R B;  4UR9 A;  2ALY A;  4U3C A;  5HWX A;  2Q9Q A;  2DU7 A;  2DVE A;  2FJD A;  4YRT A;  1FMV A;  4IL4 A;  3WAK A;  2MOZ A;  4LF9 T;  3UU8 A;  2M67 A;  3NKZ A;  5LHG B;  4CI1 B;  4O4J E;  4O2A E;  4WNK A;  5ABH A;  2ART A;  3HRK A;  4P71 A;  3Q5D A;  5HEU A;  4ZI3 C;  1N34 T;  2JMH A;  2DLR A;  3WI3 A;  3UFE A;  2YIN A;  1B7Y A;  2DXT A;  4NIQ A;  2NR4 A;  2WM9 A;  5L3D B;  3ZT6 A;  3CMQ A;  3N2G E;  3JAE A;  3VR8 A;  2M6I A;  2XM1 A;  4I4T E;  2AKW B;  5CB4 E;  3VRA A;  4ZS2 A;  3IA3 A;  3C51 A;  3UU6 A;  4Q6G A;  1OED E;  4YRL A;  4XBF B;  1X9B A;  3AVR A;  3RRW A;  5FNV E;  4OYJ A;  1I6Z A;  2XQ5 A;  4ZI2 C;  3ZCJ A;  3LG7 A;  3ZPO A;  1YQ4 A;  2YN6 A;  3I9Y A;  1IJ5 A;  1B7T A;  1VOM A;  1S35 A;  2ALY B;  3OJA A;  2Q9Q B;  1FJG T;  4IRE A;  5JDL A;  2AXD S;  2Q9Q D;  3P50 A;  1SE7 A;  2BVL A;  2WP9 A;  5LBM A;  2E3C A;  3F57 A;  4P09 A;  1LVF A;  3L09 A;  3IKL A;  1W9R A;  5HAX A;  4TUY E;  4LF7 T;  2XPK A;  3F31 A;  4PG3 A;  1UK5 A;  1RIQ A;  2DZ9 A;  1N32 T;  1US7 B;  2H3R A;  2DTI A;  3MZK B;  4LNS A;  2B76 A;  1MMD A;  1B7Y B;  4UEM A;  2DQ0 A;  2EHO C;  5AQM B;  1D0Y A;  4XU1 A;  4YRQ A;  4QX7 B;  4XEM A;  3AEC A;  3RKW A;  4Z91 A;  1WQ7 A;  2AE9 A;  4EYY R;  3LSS A;  3KFU A;  4O4I E;  1QLB A;  2VKH A;  4UIG A;  4TX5 A;  2V5D A;  1N33 T;  1XNR T;  2P9B A;  5L3G B;  5JR9 A;  4ZTU B;  3UUX B;  3EAB A;  3KBU A;  2BVM A;  4EOZ B;  4XU2 A;  4X5O A;  2ODU A;  2X0Y A;  2IUB A;  5AQV B;  4DQ2 A;  2V7K A;  3TEH A;  2NTX A;  4TNV A;  5C8Y E;  2E5L T;  3E9I A;  4YRP A;  4ZZB A;  3ZEF B;  5JH7 E;  4PJN A;  4UVA B;  2EJF A;  2ZXF A;  3AB3 B;  4U74 A;  1HX1 B;  4H2T A;  4LF4 T;  5LB7 B;  4DR5 T;  1ZHC A;  3LSV A;  3MEY A;  2FBW A;  4L9I A;  4KR2 A;  1X2G A;  5AQL B;  3N9L A;  1UX4 A;  2I6H A;  5AQN B;  4UP8 A;  1IAP A;  4BJN A;  1VCT A;  1W0B A;  3IG2 A;  4HWF A;  1WRD A;  3M4Q A;  3N2K E;  3FXE B;  2XQY A;  5FXV A;  2CA5 A;  5L3C B;  2ODR C;  3CK6 A;  2KZ7 B;  2D2S A;  2E41 A;  2WDR A;  1G51 A;  4HFD A;  3UT5 E;  3V8K A;  2KXP B;  3AE5 A;  4IDN A;  4XTY A;  1HX8 A;  2JQ9 A;  5JR9 B;  5FKY A;  2FJB A;  2BS4 A;  2WB5 A;  2NW8 A;  4HFB A;  1T72 A;  3KVB A;  4DV7 T;  2Q7G A;  4G84 A;  4ILB A;  5FVK A;  4RDX A;  4KP3 C;  1T7S A;  4AQY T;  1AJ3 A;  3CIR A;  2V6Y A;  3TEH B;  5HXS A;  4YRG A;  5C3J A;  1ASY A;  4H9R C;  1U5P A;  2BG9 A;  2QRX A;  4H2S A;  2ZM2 A;  3HKB E;  2XQ4 A;  4XZC A;  4DV4 T;  1B76 A;  4XTW A;  2C5K T;  1E1T A;  2ARU A;  2Y6X A;  1ATI A;  2C5J A;  3K3O A;  3V7C A;  4YRO A;  2IHR 1;  2W62 A;  2H88 A;  5F3J A;  4AQG A;  3FJP A;  1BR2 A;  2Q7E A;  4TZ4 C;  5HCM A;  3J9X 1;  3A7R A;  3ZJ2 A;  3ZT7 A;  2HHH T;  5LG3 A;  1I94 T;  2Z6E A;  4BA9 A;  4AQF A;  1QUU A;  1WLE A;  4HWR A;  4DV0 T;  4IIJ E;  3B13 A;  4GOU A;  4I43 B;  5JDH A;  3H37 A;  3ESL A;  3RC8 A;  4DND A;  2KND A;  4EO4 A;  4TVY A;  3MXZ A;  3A7M A;  4YRM A;  3QO8 A;  3RIF A;  2CLY C;  3AEG A;  1EIY A;  1VCS A;  3PUQ A;  3RYC E;  1B8A A;  5FL0 A;  4G85 A;  2V6Y B;  3I7F A;  2E2A A;  1HFA A;  4TWA A;  5C52 B;  2BG9 B;  2WQY A;  1D1A A;  3HXW A;  4ZZC A;  3RIU A;  2VWA A;  3QO7 A;  2ZR3 A;  3B5M A;  2CM0 A;  4JI2 T;  5DQW A;  1VRB A;  4HWT A;  4ERR A;  2WDQ A;  3VKH A;  2KT9 A;  2DZC A;  2GK9 A;  3UQ7 A;  2WZH A;  2ZT7 A;  3HXU A;  1SRY A;  3P4R A;  3S4U A;  1FEW A;  1ASZ A;  3RF1 A;  3V5U A;  3OYZ A;  4JLE A;  3ETV A;  1XZY A;  3CX7 B;  5L3F B;  4PW8 A;  5J2U E;  1N9W A;  4B3S T;  3P8T A;  2C8M A;  4EIW A;  3TLS A;  1EQR A;  2XAH B;  4ISS A;  5FXX A;  2QHT A;  5ABF A;  2E8I A;  1HG5 A;  1G5I A;  5JVD E;  2QHU A;  2CGH A;  3JC6 C;  2VVS A;  3RHW A;  1EIY B;  3G1Z A;  4GKJ T;  2X9X A;  1H4V B;  2ZMA A;  4IE0 A;  1G5H A;  2X9W A;  3HKD E;  4KI0 F;  3CWZ B;  4CH4 A;  2YDQ A;  3PTR B;  1UX5 A;  5KDM C;  1KEY A;  5HCJ A;  3MJX A;  3SWH A;  2NW7 A;  2UUC T;  3L1A A;  3AA7 B;  1HC7 A;  1U4Q A;  2W61 A;  3HRI A;  5AQH B;  1YQ3 A;  2ZNJ A;  2LSK A;  2NW9 A;  4CXY A;  2XJ7 A;  4DR2 T;  4X20 E;  4U7I A;  5EK4 A;  2ZM6 T;  3A31 A;  5AQI B;  5L2L A;  3OTO T;  2QHS A;  3QO5 A;  4BW9 A;  3VQW A;  5FL1 A;  2W67 A;  1WNL A;  3HTZ A;  2ZT8 A;  3SFD A;  3W3S A; 
#chains in the Genus database with same CATH homology
 1YFR A;  2DU7 A;  4XEO A;  2DVE A;  4P75 C;  4YRT A;  2PMF A;  4YP0 A;  1ADY A;  2CIM A;  2J3M A;  2P0L A;  4NCX A;  1X56 A;  3L4G A;  4LVJ A;  5C53 B;  2DJZ A;  2XGT A;  3QNE A;  2ART A;  3A5Y A;  3HRK A;  4P71 A;  4LVI A;  3BJU A;  1VQZ A;  4TVW A;  3RKX A;  2EJG A;  2ODR D;  4H2Y A;  5KNN A;  3A74 A;  1B7Y A;  2DXT A;  5K1X A;  2I4N A;  3RUX A;  1NJ6 A;  4YCU A;  4UP7 A;  3CMQ A;  2AKW B;  4H2U A;  2AMC B;  3A5Z A;  4P74 A;  4Q6G A;  4YRL A;  4HWS A;  4HVC A;  1E22 A;  2I4L A;  4P72 C;  3V7R A;  1BIA A;  3PCO A;  2C7I A;  4HA8 A;  1B70 B;  3VQY A;  2G4C A;  2NS6 A;  2ALY B;  3HXY A;  1X2H A;  4YRF A;  2ZIO A;  4H2V A;  2Q5H A;  2E3C A;  1BBU A;  2EAY A;  3IKL A;  3HFV A;  3L4G B;  2CJA A;  4XTU A;  4YRE A;  2ZNI A;  1H4T A;  4TVA A;  4TQF A;  2I4M A;  4PG3 A;  4WF2 A;  4CH6 A;  1RIQ A;  4CH5 A;  4ZTZ B;  2DZ9 A;  3RIR A;  3HFZ A;  2DDZ A;  4YRK A;  1YFT A;  2DTI A;  3A32 A;  4K88 A;  4LNS A;  1NJ5 A;  1B7Y B;  3RL6 A;  2DQ0 A;  3A7A A;  2XTI A;  2P5I A;  4XU1 A;  4K86 A;  4YRQ A;  4XEM A;  4TTV A;  3MF1 A;  3RKW A;  4P71 C;  1W66 A;  1WQ7 A;  4K87 A;  3LSS A;  4YRJ A;  1PYS A;  3KFU A;  1USY A;  3ICA A;  3TEG A;  3TUP A;  3HXZ A;  4ZTU B;  1NJ1 A;  1JJC A;  1Z7N A;  2I4O A;  2ZT6 A;  1L0W A;  1J5W A;  2DEQ A;  3PCO B;  4XU2 A;  4X5O A;  2E10 A;  5K1P A;  4YRC A;  4DQ2 A;  3TEH A;  2RHQ A;  3E9I A;  4YCV A;  2ZGW A;  1BBW A;  4YRP A;  2PME A;  4P73 A;  2EJF A;  1HTT A;  2ZXF A;  2ZIM A;  4P3N A;  4O2D A;  5ELN A;  1QF6 A;  3PZC A;  4H2T A;  3DSQ A;  2ZZF A;  3EFR A;  4PHC A;  4YYE A;  3MEY A;  4YRI A;  4H2X A;  4KR2 A;  1X2G A;  1EVL A;  3REU A;  2ZCE A;  3IKM B;  4OP0 A;  12AS A;  4TVA B;  4XU0 A;  3HY0 A;  4HWP A;  1WYD A;  3VQX A;  2A8E A;  4KQE A;  4TQD A;  3UGQ A;  4UP8 A;  4CH3 A;  3HFZ B;  3IG2 A;  2FYK A;  3REX A;  3OD1 A;  1KMM A;  4ZIB A;  1YGB A;  3M4Q A;  4OLF A;  3HY1 A;  1H4Q A;  3MF2 A;  1WU7 A;  2ODR C;  2E41 A;  4H2W A;  1G51 A;  1KMN A;  3RKY A;  1NJ8 A;  3V8K A;  1PYS B;  4XTY A;  3R07 A;  2EJ9 A;  2DTO A;  4XTV A;  4CS3 A;  5ELO A;  1LYL A;  4KR3 A;  4G84 A;  2Q7G A;  1JJC B;  4RDX A;  3M4P A;  3EFS A;  2E64 A;  1EVK A;  1SER A;  4RMF A;  3TEH B;  4YRG A;  2RHQ B;  1ASY A;  4XTZ A;  1H4S A;  4H2S A;  1X54 A;  2HNI A;  1USY C;  1B76 A;  1WQW A;  4XTW A;  1E1T A;  1BIB A;  2ARU A;  1ATI A;  2J3L A;  4E51 A;  2DKG A;  4P72 A;  4H2X B;  3HXV A;  4YPF A;  3V7C A;  5F5W A;  3NEL A;  3V7S A;  4YRO A;  4P3P A;  2ZT5 A;  1FYF A;  4YRR A;  3FJP A;  3UFG A;  2Q7E A;  1Z7M A;  2IY5 A;  3A7R A;  1E1O A;  4LVM A;  4P73 C;  5C51 B;  1WLE A;  4HWR A;  3NEM A;  3UH0 A;  4RQF A;  2RHS A;  4CS4 A;  4WI1 A;  1GGM A;  2E5A A;  4EO4 A;  4TVY A;  1E24 A;  4YRM A;  3P8V A;  3QO8 A;  4P74 C;  4LVL A;  3ERR A;  11AS A;  1EIY A;  3V8L A;  3HXX A;  1X55 A;  2ZIN A;  3V8J A;  1B8A A;  5E3I A;  4G85 A;  3LSQ A;  3I7F A;  2EL9 A;  2DU5 A;  4TWA A;  5C52 B;  3HXW A;  4L87 A;  4BWA A;  3LC0 A;  3E9H A;  3QO7 A;  4RQE A;  4YRN A;  4WJ3 M;  2ZR3 A;  3RGL A;  1YFS A;  3QTC A;  1EFW A;  4P75 A;  2DQ3 A;  3RAC A;  4EX5 A;  4HWT A;  1SES A;  2DTH A;  2CJ9 A;  2E65 A;  2DZC A;  3UGT A;  2QHV A;  2IY5 B;  2ZT7 A;  4YDQ A;  3VBB A;  3HXU A;  1SRY A;  1YB3 A;  4J15 A;  4YCW A;  2ZR2 A;  4LVK A;  1QE0 A;  1ASZ A;  3NET A;  3RF1 A;  1C0A A;  4YRS A;  2RHS B;  1N9W A;  3P8T A;  1NYQ A;  2C8M A;  3BFM A;  3IAL A;  3P8Y A;  1EQR A;  4UPA A;  4HT4 A;  1NNH A;  4WJ4 A;  1KOG A;  2QHT A;  3MQZ A;  4H02 A;  1G5I A;  4HWO A;  2QHU A;  1X01 A;  4XU3 A;  2CGH A;  2ZTG A;  2EWN A;  4DPG A;  1EIY B;  3G1Z A;  2DXU A;  1H4V B;  1NJ2 A;  1G5H A;  3VQV A;  4XTX A;  2E1H A;  2ZZG A;  2ZZE A;  2Q5I A;  3NEN A;  3A7U A;  3WQZ A;  1HXD A;  4CH4 A;  2AKW A;  1EOV A;  1HC7 A;  3L1A A;  2AMC A;  3HRI A;  2ARS A;  2Q7H A;  2ZNJ A;  4Q15 A;  4UP9 A;  1WPY A;  1ADJ A;  3L2Z A;  1NYR A;  3A31 A;  4P3O A;  1IL2 A;  2QHS A;  4AH6 A;  2CJB A;  3QO5 A;  1SET A;  4BW9 A;  3VQW A;  1B70 A;  1WNL A;  5HGQ A;  3HTZ A;  2ZT8 A;  2ALY A;  3W3S A;  4CS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...