4XU0A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 73 that has a 2'-methyl on the ribose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 96
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu0A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu0A01
4YYEA 3BJUA 1WPYA 4M7DD 3R07A 2DEQA 2EJFA 4M78G 3V7RA 1WU7A 2E64A 3E9HA 2ZR3A 2DU7A 3V8KA 4P71A 2ZNIA 1E22A 1E1TA 1LJOA 4CS2A 3A74A 2CJ9A 4XTXA 3FJPA 1BBUA 2ZT5A 4F7UF 4J15A 4YRPA 4OLFA 3RL6A 4C8QF 1JJCA 1KQ1A 3NENA 3JB9H 5C52B 2JN0A 2ZZFA 1H4QA 4HWRA 1B34A 4JUVA 4M7DA 2DQ0A 4YRJA 1G5HA 2DXUA 5GAN5 4AH6A 5F5WA 4ZIBA 1H4SA 3PGGA 2ZIMA 3QO8A 4RQFA 1USYC 2I2LA 3JCMW 4M7AF 4M75E 1EOVA 2Q7GA 5GAOn 4JLIA 2DXTA 4C8QB 4P75A 4ZTZB 2DDZA 3JCMd 1YGBA 1U1SA 4KQEA 1VQZA 1NJ8A 2C7IA 5GAN3 3VQYA 1Z7NA 1JJCB 4F7UG 2EL9A 1WNLA 2YLBA 4CH3A 5GAOl 3L4GB 4MMKA 3V7CA 5LJ3j 3HXUA 1X55A 5K1PA 4M75C 4YRLA 4YROA 3JCMh 3A7AA 3NEMA 3TEHB 3JCMX 3HY1A 4A53A 4M78B 4C8QC 3MF1A 4E51A 4M75D 4NOYA 3MF2A 3SWNA 4PJOG 4HA8A 2Q7HA 4YDQA 5GANd 1SETA 1NJ2A 4YRIA 2I4NA 4N0AA 4P74A 1U1TA 2EJ9A 3JCMV 5K1XA 3UGQA 4HWOA 3RF1A 4XEMA 1PYSB 1LNXA 4EO4A 5GMKm 3UFGA 1KMMA 4HWTA 3P8TA 4M78C 3RIRA 3SWNB 5GMKi 5C51B 1QF6A 1N9SA 4BW9A 1ADJA 4EMKC 3RKYA 4UPAA 4M78D 2ZXFA 3JCMQ 12ASA 4M78E 1FYFA 1HC7A 4K88A 2IY5B 3JB9G 4PJOF 5GAN6 1X54A 4YRQA 2ZGWA 4YRRA 2RD1A 4RDXA 1Y96B 2ODRD 2G4CA 5GAMf 3WQZA 4EX5A 2Q5IA 4M77F 2CJAA 1EFWA 3PZCA 4H2TA 2ODRC 3MEYA 4WF2A 2E65A 2DTIA 1I4K1 4PJOB 4C92B 1NJ1A 3JCMf 4TVWA 4C8QG 4BWAA 3IKMB 4P72A 4TVAB 2RHQA 4TTVA 5GAN2 1YFTA 2ZR2A 3V8LA 2Y90A 3PCOB 3LSQA 4YCVA 4H2XA 3REXA 2E5AA 2I4MA 4HT9A 3VBBA 4P73A 4XTYA 4UP8A 1B8AA 3W3SA 4K86A 2J3MA 4XU0A 4UP7A 4DQ2A 3EFRA 4N0AC 4P74C 5GMKl 3JCMP 5LJ5h 4KR3A 1YCYA 5LJ5d 2DU5A 2RM4A 1NJ5A 4C92A 1WQ7A 5CAIA 3QO7A 3IG2A 1H4VB 3VQXA 4L87A 5GANe 3JB9D 3FIFA 3HXXA 5GMKj 1J5WA 2AMCA 4TQFA 1I81A 1ASZA 4P3NA 1L0WA 1LOJA 3M4GA 4M75A 1X56A 2QHVA 2EAYA 2DZCA 4WJ4A 1H641 3QTCA 2YLCA 4XTWA 2FYKA 4XU2A 4H2SA 2ZT7A 4C92C 4TVYA 4H2WA 2I4OA 5GAOq 3EFSA 2EWNA 3NETA 4M7AG 3A7UA 5GAMh 4HWSA 1X2HA 3LC0A 2J3LA 4YPFA 5GAMj 4P3OA 1D3BA 4MMLA 2C8MA 1ATIA 4RQEA 4WJ3M 1PYSA 2K57A 5LJ3d 3JCMe 1I5LA 3TEHA 4QVDA 4P73C 4C92F 1USYA 5HGQA 4DPGA 1ASYA 1NYQA 2AMCB 4CS3A 1H4TA 4P72C 3VQWA 4X9CA 4M7DC 3HY0A 3FB9A 5GMKe 3L1AA 1EVLA 5GANj 1B7YA 1WQWA 2RB6A 1NNHA 3RUXA 3OD1A 2FB7A 3HRIA 1B70A 2E1HA 3RACA 2E41A 1SERA 3HFNA 5C53B 2ALYA 3I7FA 3JCMc 2ZZEA 3QSUA 5E3IA 1M8VA 4P71C 3SB2A 4WI1A 1M5Q1 4JRIA 3L4GA 1I8FA 4PHCA 2HNIA 4NL3A 3RKXA 4EMKA 4H2UA 4JRKA 3VQVA 3RESA 4C92G 5LJ3e 3TEGA 4C92D 3ICAA 4M78A 1YFRA 2RHSB 1KQ2A 4M77G 1WYDA 4Q6GA 4NCXA 4M75F 2QHUA 1Y96A 1ADYA 5GAN7 3QO3A 2ZT8A 4M77B 4YRGA 2ZCEA 4M7DF 3A31A 3JCMg 4M7DE 4TVAA 4G85A 2ZZGA 2DZ9A 3JCMJ 2ZT6A 3SWNC 2ZNJA 4KR2A 3A5ZA 5I21A 4C8QA 4V2SA 1NJ6A 4F7UA 1N9RA 3HXVA 4C8QD 3GIBA 1QE0A 4XEOA 4XU3A 5GAOr 1B70B 1IL2A 1JBMA 4M78F 2E3CA 4Y91A 2P0LA 2DTHA 3VU3C 2ALYB 5ELOA 1MGQA 5GAOp 4H02A 4PJOD 5GAOm 5LJ5j 4ZTUB 4M7AD 2QHTA 1X2GA 4EMKB 5LJ3h 4YCUA 2DVEA 4M7AE 2ARSA 4YP0A 2DQ3A 4EMHA 1Z7MA 4PJOC 4M77E 4UP9A 1HK9A 4XTUA 1N9WA 3A7RA 4XTZA 4M77D 4P75C 1KMNA 2VXEA 2XTIA 3RKWA 5LJ5f 11ASA 2AKWB 5GAMg 2QHSA 1EQRA 3CMQA 1YFSA 4M77C 2AKWA 4M75B 2ZTGA 2ZINA 1B7YB 4F7UB 5GANh 1TH7A 3QUIA 3HXYA 3M4PA 4QVCA 1YB3A 4H2YA 4HVCA 4LNSA 5GANf 2CIMA 4M7AB 1GGMA 5GMKh 5LJ3f 5LJ5e 4XU1A 1SRYA 4A54A 3DSQA 5GAMd 4PJOE 4OP0A 3BDUA 3QO5A 2Q5HA 2E10A 4YRMA 4O2DA 1RIQA 3ERRA 1W66A 3HTZA 3HFOA 4H2VA 4H2XB 1SESA 5GAN8 3HRKA 3RGLA 1C0AA 2DTOA 2RA2A 5GAMe 4M7DG 3JB9J 3G1ZA 4J6YA 4YRSA 3JB9I 3IKLA 1BBWA 3E9IA 5KNNA 4M7AC 5DY9A 4CH5A 4XQ3A 4PNOA 3L2ZA 4TQDA 5LJ5g 1HTTA 4CH4A 4XTVA 4M77A 2DKGA 3QNEA 2PMEA 2ARTA 4Q15A 1EVKA 4K87A 3KFUA 2Q7EA 1G5IA 3BFMA 5GANg 3QHSA 3HXZA 3HFVA 3PCOA 2RHSA 4PJOA 4C92E 1HXDA 5LJ3g 2RHQB 2XGTA 5GAN4 3JCMb 3UH0A 3HSBA 4YRKA 4CH6A 4J6WA 2EJGA 2CGHA 2ZIOA 3HFZA 4X5OA 3V7SA 2PMFA 1EIYB 2VC8A 2I4LA 1BIAA 3AHUA 3NELA 1WLEA 4M75G 3IALA 3HXWA 2P5IA 4YRCA 1B34B 4M7DB 2YHTA 3LSSA 5ELNA 1JRIA 1D3BB 1BIBA 2DJZA 4YRTA 1KOGA 4P3PA 4RMFA 3P8VA 4YCWA 1E24A 4YRNA 3BW1A 3INZA 4F7UE 3A5YA 4NL2A 3M4QA 4PG3A 4RCCA 4C8QE 4HT8A 3P8YA 4CS4A 1B76A 4RCBA 4YRFA 4J5YA 3RERA 3BY7A 2IY5A 1G51A 3TUPA 2VXFA 4YREA 1EIYA 3A32A 3V8JA 4HWPA 1NYRA 3HFZB 1LYLA 4TWAA 4J6XA 3JB9F 2ARUA 3REUA 4M7AA 1X01A 4G84A 3UGTA 4X9DA 2QTXA 1E1OA 2CJBA 4EMGA
chains in the Genus database with same CATH superfamily
3OMCA 3OYEA 2IVWA 4BE2A 4PL6A 2XI9A 2GTJA 1WU7A 2EGCA 2XHCA 1X6BA 4P71A 5FWBA 3M55A 2VKNA 1LJOA 1YITQ 2GBQA 3M0SA 2VGMA 2M51A 2COZA 2RHIA 3FJPA 2ZT5A 1MV3A 3CC2A 4PFOA 3BE3A 3RL6A 4C8QF 1JJCA 2M9UA 4DEYA 2GCXA 2JN0A 4JUVA 4YRJA 2GFAA 2DXUA 5GAN5 1K9MU 1VQKT 2ZIMA 1MV0B 2JM9A 3QO8A 3JCMW 4FYYB 1K73R 2YUQA 2ROLA 2ABLA 2JMAA 4C8QB 5DM7R 2F2WA 3QXEB 4ZTZB 2KY9A 1CSKA 1I5OB 4WTOB 2DDZA 4LXCA 4KQEA 3OYBA 2KR3A 1KQSP 1D0ZA 3CCLA 4QQ6A 3QJ6A 3EHRA 7AT1B 2CUBA 1OZ3A 2RH2A 4HXJA 3VS5A 1YHQQ 4M75C 4YRLA 1SEMA 1BI0A 3NEMA 1ZSZA 1M4ZA 2OJ2A 4JPBW 4F17A 2OI3A 3CPWP 3HY1A 4M78B 4C8QC 2QA4T 4E51A 3GP8A 4NOYA 4E7JA 5FU6B 3UA6A 1M3AA 4E7HA 1VIEA 2DBKA 1OX9A 2HZYA 1X6OA 4CC7A 2XDDA 1SPKA 3CCEA 2FG0A 1U1TA 1M3BA 4BE0A 3UATA 4FYVB 3H0IA 5FWCA 1YITA 2CP2A 1VQ7Q 4C0DB 5LL6S 3VUBA 3CCLT 3RNJA 3QPHA 1Y07A 4DOVA 3REBB 3FDRA 1VYVA 3E9GA 2ZPEB 1QF6A 5CKDA 2F5TX 1ADJA 3RKYA 1J3TA 1ZUUA 1K1ZA 3OYYA 5KE3A 12ASA 2L3PA 1FYFA 3UT1A 4J9FA 4PFPA 1VQ7A 1Q81U 2RHYA 5A0GA 2K3BA 1PKTA 4F04B 1NPRA 1VOMA 1M1KR 1Y96B 2LT4A 4A4GA 2DIQA 2CUDA 3CCVQ 5GAMf 1Q82U 2JTFA 4J9EA 3UPUA 4K11A 3CCET 4Z02A 3CPWA 2ODRC 3P8BB 1I4K1 4PJOB 4C92B 3CC2T 4P72A 4TVAB 1N5ZA 4TTVA 3CCJQ 2ZR2A 2AHJB 4DEXA 4OMLA 4CC4B 5KYXA 4KT0E 4YCVA 1PD0A 4II1A 1QW1A 4P73A 1MNEA 4XTYA 4UP8A 5D6YA 4A4FA 3GF5A 2A36A 4DQ2A 4KH0B 3EFRA 1KQSA 1JEGA 4P74C 3JCMP 4KR3A 1YCYA 2DU5A 1RAGB 2MYSA 3M5AA 3IG2A 1H4VB 3VQXA 4OGCA 1EFNA 3PFSA 2A08A 1R77A 1EX4A 1GBQA 2AMCA 4TQFA 4M75A 3CD6T 3PIPA 3OYLA 2EAYA 2GNCA 3QJYA 5D7UA 4XU2A 4CRIA 1OYXA 2XDBA 4BDZA 1VQ8A 3C12A 3OQ5A 4DBHA 3MCAB 2EWNA 4IUVA 1VA7A 5GAMh 1Q86U 1D3BA 4MMLA 4Z8AA 1ATIA 1PYSA 2OTLT 3M56A 5L23A 2RQTA 1M2OA 3PMIA 4MZPA 1PSFA 1NYQA 2VASA 1S72T 2P0KA 4JRQA 1OPLA 4P72C 1K9MR 4M7DC 3CCVT 3FB9A 2YUPA 4RTVA 4X34A 1B7YA 2X3XD 3H0FA 3RUXA 1M2VB 2FB7A 1B70A 3VRZA 2OTJT 3RACA 2R5AA 2V8IA 1SERA 2QAZA 3OYKA 2ZZEA 3NPFA 3QSUA 3J81E 4OMPA 1M8VA 4WI1A 1T3SA 1JO8A 4QVZA 1VQ7T 4JJCA 2JTEA 2D8JA 2HNIA 3RKXA 3CMET 4H2UA 5D6WA 1PKSA 2CYZB 4D8DA 2FRWA 1P92A 2JNGA 4M78A 4M77G 4MDWA 4AFUC 2HL5C 4Q6GA 1NEGA 1M9SA 4A63B 1X43A 1IREB 4KH1B 2D8HA 3I55T 2DETA 3RR6A 4O6JA 3REAB 2PNIA 5D6XA 1WI7A 4M77B 3OYCA 3L2VA 1UJYA 4M7DE 3KFVA 2E6ZA 4G85A 3A8OB 1YNZA 2MK5A 2OTJA 8AT1B 3M57A 3A5ZA 1GRIA 5I21A 2KRMA 4PJNA 3MQZA 3OSSC 4KGVB 1TS9A 3U23A 3I5SA 1NJ6A 1S1NA 2K6DA 1SKUB 8ATCB 2KNBB 5CKBA 3C94A 1WGSA 3CEYA 2MCNA 3MP8A 4KGZB 1B70B 4M78F 4B9XA 5GAOp 4H02A 3P8HA 5LJ5j 4ZTUB 1VQPA 1X2GA 2QHTA 1U5SA 2ARSA 3M4YA 3PMTA 1TXQA 2NYSA 3CC7T 1N27A 1WHGA 4XTZA 2F2VA 1KMNA 1VQLT 2B8AA 2AKWB 2QHSA 3SFMA 3RBBB 4RTUA 3OMGA 3LGFA 2EGEA 1TH7A 4D6WA 3VS3A 3M54A 4PJJA 3UF4A 1FMKA 3CCSA 2LVMA 4F16A 2DL3A 4A54A 1K8AC 4PJOE 1WXUA 4ZGEB 1YI2A 3HKSA 1UG1A 2PVDB 2MIOA 4O2DA 1A0NB 3ERRA 3HTZA 1B07A 3HRSA 4RTTA 5KYUB 4C0DC 4PK4A 1RADB 1C0AA 1JQQA 3GNFB 4LNPA 5A0DA 3QDRB 4J6YA 4YRSA 3TQ7P 1R0CB 1MMAA 2ZPBB 3QZ5B 3NMZC 4J9BA 2Z0WA 2O9VA 1Q82C 5DY9A 4CH5A 4PNOA 2C06A 1KC8C 1C0MA 4LDYA 1GCQA 2RJEA 3WVEB 4TVRA 3THKA 2ARTA 1G2BA 3I56Q 2RMOA 3F70A 3QHSA 3HFVA 2FO0A 2O88A 3LWHA 2KYBA 3VJPA 3CCST 4C92E 1YJWA 2ENMA 4FT4A 1WLPB 2VWFA 1FX7A 3CCRA 1UHFA 1KC8R 3DB4A 4YRKA 4CH6A 2PVOB 3I55Q 1LVKA 3TEEA 4JJNK 1VQ4T 1UDLA 3HFZA 3KUFA 2QDLA 2PMFA 3EGDA 3CPFA 3OS5A 2RQWA 3M53A 4ELYC 4Z88A 3IALA 2P5IA 2J05A 3PIOA 3CCQT 2YHTA 5ELNA 4IIMA 1KOGA 1MHNA 5FU7B 2KAFA 2CKKA 4PFZA 1ZUKA 2CH4A 1UGSB 3OSVA 3A5YA 3M4QA 1TTHB 4QKUA 2C0OA 1B76A 1QVGA 1IXDA 3EH1A 3BY7A 3CBMA 2F5KA 1RI9A 2D6FA 2VXFA 4YREA 3DLMA 4ELZC 2LDMA 4XAXB 4EPCA 4TWAA 2ARUA 3M0PA 1UFFA 3EGXB 3UGTA 1G83A 4BD3A 2QTXA 3O5ZA 1AWXA 4N4HA 2ZPGB 2EYWA 4LVKA 2E12A 5KYYA 2C0TA 1VQ6Q 2ZR3A 1M1KU 3OA6A 5IXBA 1H3ZA 4AT1B 3GNGA 3A74A 2CP6A 3FEOA 2CJ9A 3FC3A 1BCMA 5KCOA 4F7UF 2CP5A 4YRPA 1YJ9T 1QP3A 1H4QA 2DQ0A 4HVUA 1D0YA 1IHWA 3CXCS 4IUQA 1JXOA 3SDZA 5DLQE 3C4SA 3PGGA 2FVUA 1ABQA 4M7AF 1UUEA 2EPDA 4M75E 2KK4A 5KYXB 4IUTA 2CP3A 2E3IA 4JLIA 4B6MA 4QT7A 4R56A 1AHJB 4AMCA 2CDTA 1U1SA 2FPEA 4ZN3A 3UA7A 2LJ0A 1ZX6A 4UC4A 2WACA 3M0RA 3TREA 2FZCB 2YLBA 3L4GB 4MMKA 1R8OB 1T0HA 2DMOA 1SRLA 1X55A 5K1PA 3AT1B 5KYWB 4J9GA 2XU8A 1VQPQ 3TEHB 1WHJA 3EH2A 1IHVA 3L2UA 4PJOG 2AZSA 4ATOA 4YDQA 3G6EQ 1KHCA 4N0AA 1NLOC 4GBQA 4JS4A 2EJ9A 1V1CA 2RJDA 2ZPHB 3VS1A 5K1XA 2OX7A 3UGQA 1BK2A 3G1JA 3RF1A 2M1HA 4EO4A 3UFGA 2COYA 2EQMA 2EKHA 4XK8E 1Y0MA 2EIFA 2P4TA 3GLXA 1QVFP 5CQYA 2WSFE 2SEMA 2LNHB 5GMKi 3CCMQ 3EGUA 4BW9A 2KE9A 4C0GA 4DOWA 4UPAA 4M78D 1SSFA 2ZXFA 3H6ZA 1M8MA 5CK9A 2YXYA 3JB9G 2EQKA 1GBRA 4YRQA 1WHLA 2ZGWA 1HD3A 2VB6A 2RI3A 2RD1A 3LWIA 1PNJA 3E2UA 2HKQB 2ODRD 4OMFB 2G4CA 4EX5A 4OF1A 2Q5IA 2CJAA 3PZCA 4KRTA 4J7IA 5I11A 1D1AA 2E65A 2DTIA 3EG9A 4WF2A 2D9TA 1NJ1A 3JCMf 2NWMA 4LN2A 1Y7XA 3IKMB 3A8HB 1N8RR 1VQ8T 2KBTA 2RHQA 5HK3A 5GAN2 4MDXA 1YFTA 3V8LA 1UEBA 2K2VA 1VQNQ 3I9QA 2I4MA 4LDXA 2X4JA 1SHFA 2BZ8A 1B8AA 4K86A 1RAEB 4UP7A 2KSSA 2BZYA 2K3YA 3RMQA 2K7AA 5GMKl 1JJ2P 3OYJA 2LC4A 3A8LB 1NJ5A 3QYGB 3QWXX 1JU5C 4C92A 1WQ7A 5CAIA 5ECAA 3H9NA 2FRYA 3EFOA 2M0YA 5GANe 3EGXA 3FIFA 1ZSZC 3KBGA 1VQMQ 1ASZA 2K9GA 1L0WA 5FROA 4A4EA 3X26B 3RDVA 4XTWA 1M1KC 1MNDA 2DXCA 1KK7A 1NLPC 2I4OA 3NHNA 3X28B 2RQRA 1OQKA 3URGA 4YTLA 3NETA 5L8RE 2J3LA 3LC0A 5GAMj 4P3OA 1FMVA 1QCFA 3CCMT 1VQ5A 2YSQA 2QASA 2K57A 3JCMe 2PQWA 4C92F 2O4XA 3MP1A 1VQKQ 1MMGA 2X51A 3ULRB 1VQOQ 2QDYB 4CS3A 1PSEA 3A5ZB 2E70A 1SSHA 2OTLA 1OPKA 5GANj 1WQWA 3MEUA 1NNHA 3CD6Q 3TSWA 2P0PA 3QG1A 4RTZA 3DB3A 2E1HA 5DLOA 3CC2Q 4AFZC 4VUBA 2ALYA 3JCMc 1VQ9T 4QW2A 2HD0A 2A28A 2DD5A 1M5Q1 2O01E 2PUKB 1T3LA 4OMNA 2E5KA 4J9DA 4NL3A 2CSIA 1D09B 4WCIA 4JRKA 3LW5E 3HTRA 3VQVA 3S6WA 3RESA 2QEXT 1QKWA 3LGLA 2EYQA 3VS7A 3HRUA 1FMWA 4NCXA 1RAFB 2EQUA 4OVAA 2RPNA 5A0LA 2LQWA 5IAYA 1K0XA 2X4XA 4FL6A 5I2MA 2X4YA 1YHQA 4JDSA 2BIVA 1KC8U 2JJ9A 5CKEA 2DZ9A 1X6GA 1AVZC 3OW2A 2ZNJA 4C8QA 1RI0A 3ZEHA 2DM1A 1N9RA 1QKXA 4L6V5 2FPFA 5KYUA 1M1GA 1QE0A 3CMEQ 2KVQG 5CO7A 5EC7A 1IL2A 2E3CA 5M9OA 4Y91A 3VU3C 2ALYB 3G4SQ 1KG1A 3PT9A 3OYNA 4PJOD 5J3BA 2YDLA 1U3OA 1KFZA 4M7AD 3G7ZA 4YCUA 2NLUA 2DVEA 4M7AE 4YP0A 1IO6A 4UP9A 2RO0A 4M77E 4AFQC 3A7RA 2ECZA 4M77D 1YWOA 3NGPA 4P75C 2AT1B 2VXEA 2XTIA 2FPDA 5LJ5f 2AIRB 1WHKA 5GAMg 1YJNT 3GBQA 2LQNA 2JS2A 1YFSA 1RUWA 3HL8A 2AKWA 1RLPC 2ZTGA 1UTIA 1XQHA 1B7YB 4F7UB 3SD4A 1N8RU 3X25B 4LNSA 1TWBA 3QZ9B 1S72A 4P5NA 3S3NA 1VQ6A 1W4SA 2JOYA 4M7AB 1GGMA 5LJ3f 4BB7A 2LNVA 1GCPA 1K73C 3CCVA 4RKUE 1VQLA 3DSQA 2L3RA 4OP0A 1AWJA 2KEAA 2Q5HA 1RIQA 2JMCA 5CQXA 1UE9A 3HFOA 3LX7A 4H2VA 4Q5WA 1PM3A 2KROA 3RGLA 2LJ1A 2RA2A 4ME7A 4ZTJA 1X27A 3JB9J 3G1ZA 3IKLA 2QQSA 2DFUA 1VYTA 1W1FA 3CCQA 1BBWA 2GTOA 2GQIA 5KNNA 1PHTA 4M7AC 5LJ5g 1NZ9A 1F1BB 1HTTA 1W6XA 1XJWB 1YIJA 2EGAA 4M77A 2DERA 3QNEA 2PMEA 4K87A 1BB9A 2Q7EA 5GANg 4BACA 4E7IA 2RHSA 2X3WD 2EBPA 3OS1A 4PJOA 1AZGB 2MWPA 2XGTA 2A7YA 2QEXQ 1UECA 1IB8A 3E1SA 3JCMb 1YFNA 5GAN4 3UH0A 4DBFA 3UDCA 3HSBA 1K4US 4BE1A 4J6WA 2LCCA 3HPWA 2JTMA 3V7SA 2DJQA 2VC8A 2I4LA 3CQTA 3NELA 1PRMC 4FIBA 2V1QA 3EG3A 1B34B 4M7DB 3LSSA 3EG9B 1D3BB 1BIBA 4OMQA 3QIIA 1M3CA 3P8VA 1WFWA 4YRNA 1HYOA 4F7UE 4PG3A 4NL2A 5HK0A 1ZA1B 1G3WA 1QVFA 5FRNA 4YRFA 2YWWA 1KSWA 3A1PA 3TCJA 3DKMA 3PNWC 4ANJA 3CC7A 3RERA 3NTKA 1K9MC 2FHDA 2HMAA 3TUPA 1VQOT 2PUOB 1YJNA 4E47A 3CD6A 3JB9F 2EW3A 2BUDA 4LVLA 2RQVA 4BI8B 4JJDA 1CKBA 4EMGA 3HP9A 4PJMA 1VQ6T 4YYEA 2KQWA 1WPYA 4M7DD 3E19A 2DEQA 1X69A 1OI1A 3JSCA 4M78G 3V7RA 3TSZA 3E9HA 2DU7A 2FZGB 3OB9A 2ZNIA 2PVGB 3CBOA 4LUDA 4CS2A 1WHMA 5KH6A 2LQ8A 2QXFA 1BBUA 4J15A 4C5IA 1G3TA 1GFDA 1ZBJA 1D0XA 3JB9H 1QWEA 4HWRA 1B34A 4M7DA 1G5HA 1PC0A 5HY6A 4AH6A 4ZIBA 2EQJA 1K0SA 5KYWA 1NM7A 5KYNA 2I2LA 4IIOA 1EOVA 4E2FB 2Q7GA 2H3JA 4JZ3A 1AEYA 2DXTA 4J9IA 2L0AA 4P75A 3L2WA 2KT8A 2L8DA 2RN8A 1QVPA 2J06A 1YGBA 1W2BA 2DA9A 1NJ8A 3MKDA 1VQZA 2KXDA 1O75A 1Q95G 3NTIA 5GAN3 1WHHA 3CMEA 4F7UG 3GPLA 1WNLA 5IT9E 4CH3A 1NJIU 6AT1B 2CZ7B 3HHTB 3V7CA 3X24B 2PZ1A 5LJ3j 3LH0A 2E4HA 1OEBA 3O8VA 4YROA 1NEBA 2O31A 1K8AU 2J6OA 3G4ST 3VKIA 1ABOA 2M02A 4A53A 3G71Q 1ZA2B 5FW9A 2DIGA 4M75D 3MF2A 4AG1C 4X1VA 3VYGA 3SWNA 4HA8A 1NG2A 1YI2T 4OB3B 1SETA 4D8KA 3CC4Q 1PD1A 1NJ2A 4YRIA 2P0QA 2CH4W 4J8OA 4BUGA 1W70A 1U8RA 1QQJA 3JCMV 2F69A 1K76A 4E6RA 3TVTA 4LE9A 1AD5A 1LNXA 1UGRB 5GMKm 3UWNA 1KMMA 1GFCA 3P8TA 4OB0B 1QVGP 3CCQQ 4M78C 3VS2A 4PLIA 2RK1A 5C51B 1N9SA 1Q82R 2ATCB 1WX6A 1QVFS 5KE2A 1VQPT 4K88A 4PJOF 1BU1A 5GAN6 1X54A 3QWYA 1EIFA 2EFIA 2A0FB 2HSEB 3EGDB 4NS5A 2CREA 2X9HA 3WQZA 1RAAB 2DL4A 3I35A 1C6VX 2DPPB 3CCUT 4M77F 4C0ZA 2MPXC 1EFWA 2GGRA 1SF9A 2HCKA 1FYNA 2D1XA 2JS0A 4BWAA 1SG5A 4C8QG 1VQLQ 4C0FA 2W10A 2CT4A 1OV3A 3CXCP 9ATCB 1JXMA 3QDFA 3OBWA 1AOJA 2E5AA 1KD1U 3CCMA 4RG2A 2MMPA 3ME9A 3W3SA 4XU0A 3G71A 3VS0A 2ZZDA 1YWPA 2HL3A 1T0JA 4N0AC 3X20B 4J9HA 4RUGA 2DAQA 5LJ5d 2RM4A 2VVKA 1TUCA 1Q7YR 4FSXA 4L87A 1LCKA 1WXTA 2V8JA 3JB9D 1ARKA 2BKDN 5GMKj 1UGQB 2KMTA 4P3NA 4R0KA 1LOJA 2J6FA 1X56A 2JUFA 2QHVA 2Y4YA 4KUIA 4IUPA 2RHZA 3P8DA 1H641 2YLCA 4IURA 1M2VA 2FYKA 1B3QA 4GY5A 2ZT7A 4C92C 4TVYA 3CCJT 5GAOq 3EG1A 4B9WA 1OZ2A 5I22A 2YRVA 4M7AG 3A7UA 2E5QA 1X2HA 2HSPA 4OMMA 4WJ3M 4RQEA 2QQRA 3OYHA 4DBQA 2G6FX 3TEHA 3CCRT 4QVDA 2KXCA 1USYA 5HGQA 3MJXA 1ASYA 1AWOA 3CMAA 3S3MA 2AMCB 4RTXA 4N4GA 1Q86R 3CPWS 3HY0A 1TSFA 1JB0E 1QVGS 1BYMA 1EVLA 2RB6A 4AG2C 4BY6C 4FSSA 3CC4T 1K9AA 2E41A 2JVVA 2LCLA 1PRLC 3ER0A 2JM8A 2KI7A 1MMNA 3LYIA 3I7FA 4C5HA 1TU0B 2DEUA 5CKFA 3SB2A 4ESRA 1I8FA 4PHCA 1LPLA 2JT4A 4OMOA 5FU7C 2OAUA 2MI6A 2DK3A 4OGEA 2IIMA 1C1AA 1N6AA 1XTDA 4C92G 5LJ3e 3TEGA 2K79A 1R0BG 2CZ6B 4Z89A 4C92D 3TU4K 1YFRA 2MF2A 2Y4XA 2ZPIB 1WYDA 4M75F 2L89A 4A4HA 2QHUA 2HQEA 2NUPA 4FYXB 5GAN7 3QO3A 1RAHB 1W2BS 1B7TA 2LT1A 4YRGA 2ZCEA 3A8MB 3NFCA 4M7DF 2YUNA 4ZGJB 2RK2A 3JCMg 3NTHA 3PVQA 2JXBA 3CC4A 4FYWB 2XG8D 2LZ6B 1YITT 4KR2A 1BBZA 2P4RA 2E6NA 3M59A 2RNAA 5IN1A 1KHIA 2D0NA 3HXVA 2R57A 2A8EA 4LVMA 4HCKA 2V26A 1QMCA 1JBMA 2P0LA 2DTHA 2HEQA 3PTAA 1Q81C 3KXTA 2BE9B 3T9NA 4CC3A 3VYHB 2ESWA 4EMKB 5LJ3h 2VUBA 2DQ3A 1Z7MA 3PE0A 4PJOC 3OS0A 4HCCA 3OW2S 1G8XA 1RABB 1N9WA 3ZFJA 2P84A 1KIKA 1BI2A 2F2XA 2O4XB 2YRDA 4LVJA 3OS2A 3CMQA 2NUTA 4M77C 3L42A 4M75B 1GCQC 2QK0A 1RLQC 3JAME 3QBYA 2LQKA 1FXXA 3QUIA 5EG2A 1YB3A 4H2YA 3CCLQ 2LP5A 1Q86C 2CP7A 5GMKh 2AK5A 2X35A 3MEWA 4XU1A 4OB1B 1SRYA 2DX1A 2DD4A 4BI3A 1RL2A 2LJ3A 2XDPA 3OYMA 1YI2Q 1NPPA 2DRMA 4YRMA 2XIDA 3BDLA 1W66A 4KGXB 3M58A 1SESA 2RQUA 3RMSA 2KGTA 2K5IA 3EHQA 4M7DG 5AT1B 3JB9I 3E9IA 1VQKA 1WZOA 2KDSA 1OOTA 3L2ZA 3G6EA 4ZTFA 1OU8A 1YN8A 4XTVA 3L2QA 5A2QE 1KD1R 3VUZA 1UB4A 2DKGA 1EVKA 3A98A 1G5IA 3BFMA 5HKCA 3HXZA 2GQVA 2PU9B 1X75C 1VQOA 2RHQB 4LDWA 1M1FA 1ZSGA 4MZMA 1G5VA 4JLGA 1QCNA 1QCOA 2HAXA 5GJVB 2K5FA 2EJGA 1VQMT 2EYYA 4FU6A 2CGHA 1JJ2S 1K8AR 2ZIOA 3I5RA 4X5OA 1BIAA 3R6OA 3AHUA 2CS7A 2FL7A 2DO3A 2I0NA 4LVIA 2QQAA 2QQBA 2OTJQ 4M75G 2YT6A 1IRXA 2A3LA 2ZAEA 1UGVA 5FLXE 2DJZA 4YRTA 1QWFA 2QTVA 4RMFA 3BW1A 1HSQA 4HT8A 1UGPB 4RCBA 1K73U 4J5YA 1X2QA 1G3YA 3C0CA 1V29B 1I07A 2QEXA 3A32A 4HWPA 1NYRA 3HFZB 1D1BA 2O9SA 3FRNA 3REUA 1M30A 4M7AA 1X01A 4G84A 4X9DA 5IXFA 2DE0X 2LRQA 1BI1A 2RHUA 2QG9B 2L2PA 4Y92A 2K5LA 5I2SA 5IH2A 1M90C 3BJUA 3R07A 1KD1C 2LMJA 3SEMA 2EJFA 4CI0C 4IKFA 2E64A 3IQLA 3V8KA 1E22A 1E1TA 1RAIB 3CMAQ 2MOXA 4XTXA 1E6GA 5IHKA 5CR2A 4CC2A 4L5GA 2LTOA 1XNIA 4OLFA 1KQ1A 3NENA 5C52B 2ZZFA 1AWWA 5F5WA 1ACMB 1WJRA 2RF0A 1H4SA 4BY6B 1S72Q 4RQFA 1VQ5Q 1USYC 3G6ET 2HQXA 4E7LA 3EG2A 2DYBA 5GAOn 2L3SA 4JZ4A 1Y57A 2G3RA 2ED1A 1YCSB 3CCEQ 3OYDA 2LX9A 2HBWA 2NS6A 4JJBA 4M4ZA 2X4WA 1Q7YU 3JCMd 2C7IA 3FLGA 3VQYA 1Z7NA 1JJCB 1PWTA 2EL9A 4HKEA 3M0QA 5GAOl 2QGGA 4PLLA 1PG5B 3MO8A 3HXUA 2ZPFB 4RMOA 3S3OA 1VQMA 4E7SA 1YJ9Q 3JCMh 3VRYA 5FRMA 3A7AA 1YIJQ 3JCMX 4LD6A 5KYYB 1Z9ZA 3CCRQ 3MF1A 3GOXA 3I55A 4HCBA 4PJLA 3MEAA 3CCUA 2Q7HA 2XD0A 5GANd 4LD9K 2I4NA 4P74A 3ASKA 1AT1B 3ZL7C 2DL8A 2KRNA 4HWOA 1IZ6A 3LH5A 4XEMA 4ZNXA 1PYSB 2JZ2A 2B86A 4E7ZA 4QQGA 3OYGA 2DNUA 4HWTA 4RTWA 3RIRA 3SWNB 4R55A 2DRKA 2BZXA 2DYIA 4EMKC 4JRPA 3JCMQ 4M78E 1HC7A 2IY5B 2DILA 4GLMA 5J26A 2V8KA 4YRRA 2QA4A 1KQSS 4RDXA 3HRTA 2ED0A 2KT1A 3MEVA 3ZBDA 2DF6A 2A37A 4FW1A 1WA7A 2M0OA 2RI2A 4H2TA 3EFOB 2EQIA 1VQ4A 3MEYA 2AZVA 3OY9A 4TVWA 4L59A 1YJNQ 2DL7A 2CT3A 2E3HA 1H3HA 1Y71A 2V1RA 2H3EB 2Y90A 3WVDB 3PCOB 1VQ8Q 3LSQA 4H2XA 3REXA 4HT9A 1YBYA 2K3XA 3OYIA 3VBBA 2QGFB 2J3MA 2CZ1B 3L2RA 5CVIA 1V76A 4IUUA 4OB2B 5LJ5h 1WYXA 2J7IA 2QYZA 1MMDA 3CCSQ 3M9QA 1RACB 3QKJA 3QO7A 4GLKA 2DXBA 2HBPA 2YRCA 1WIEA 3R6NA 4E7KA 3EG0A 2W0ZA 3HXXA 1J5WA 3Q1JA 1I81A 2RJCA 4LDVA 3OYFA 3M4GA 1ZLMA 4N4IA 1M90U 1SHGA 1NYGA 3M0UA 2DZCA 4WJ4A 3QTCA 1I0CA 2YUOA 1VIFA 3OBYA 3G4SA 4H2SA 4H2WA 2HKNA 3EFSA 5IHNA 3VS6A 4HWSA 4YPFA 5KCHA 2C8MA 2EKOA 1VUBA 2SRCA 1PCXA 2RI5A 4FM4B 5LJ3d 1I5LA 4P73C 2F1LA 4DPGA 3CCJA 2GFUA 2R5MA 1M27C 4J7FA 2FZKB 4A4KA 1VQ9A 4FW2A 1YJWQ 1E6HA 1H4TA 3VQWA 4X9CA 1AZEA 3PVLA 3H41A 1VQ4Q 3MPUB 5GMKe 1HJDA 1VQ5T 3JV3A 1IGQA 3L1AA 3OD1A 3HRIA 4JS5A 4ORZA 5CKHA 3HFNA 2XICA 5C53B 4QQDA 1SRMA 2XKOC 2XMFA 2AKKA 1JJ2A 5E3IA 1TOVA 1OX8A 4P71C 3L4GA 4JRIA 2GF7A 1VQ9Q 1GL5A 4BDYA 2HDAA 4ZN1A 2EVRA 4EMKA 1O9SA 3H8ZA 4HVWA 1TG0A 2PTKA 2AKLA 4LUEA 3ICAA 4RG8A 4LDUA 2RHSB 1KQ2A 1D1CA 2NUPB 4J9CA 1Y96A 4KBMB 2H8HA 3CC7Q 1ADYA 2DL5A 1GXIE 3C95A 2EYZA 4DBRA 2ZT8A 2EYXA 1BKBA 3WXMB 3J80E 3CCUQ 3A31A 1ZUYA 4TVAA 2ZZGA 1FWZA 2ZT6A 3JCMJ 3SWNC 1YJ9A 3OW2P 2BE7D 4V2SA 2ROTA 4F7UA 3VS4A 4C8QD 3QYHB 3GIBA 2NUTB 4XEOA 4XU3A 1YHQT 4FT2A 2QQ9A 1DJ7B 3E9FA 5GAOr 4F14A 1NJIC 3N5BB 4BI4A 2D0QB 5ELOA 1MGQA 2VGNA 4MZTA 4O5VA 1W2BP 5GAOm 2CZ0B 1UJ0A 2LCSA 2J6KA 4EMHA 3VV0A 4HVVA 1HK9A 1IGUA 4XTUA 4FCYA 2RJFA 2DVJA 2L3QA 1X2KA 3RKWA 2VYTA 11ASA 1YP5A 1EQRA 4Y28E 2CSQA 3JRZA 4C5EA 2ZINA 2MWOA 5GANh 3M4PA 3HXYA 4HVCA 4QVCA 1KJWA 5GANf 2CIMA 3CMAT 2KYMA 2LX7A 3I56A 2QI2A 5LJ5e 3MHXA 2WSEE 2QA4Q 5GAMd 4KULA 5J39A 3G71T 2R58A 3SHWA 3BDUA 3EAEA 3QO5A 1ZSZB 1NYFA 1ZBXA 2E10A 2CP0A 5CIUA 1XOVA 1Q81R 3H0HA 4H2XB 1OU9A 3M0TA 5GAN8 3HRKA 4C5GA 5IHIA 5C0MA 2DTOA 5FU6C 5GAMe 1VYUA 1QP2A 2JW4A 1TUDA 3FJ5A 1OULA 2DLPA 2RHXA 1WJSA 4XQ3A 4TQDA 1I1JA 2DBMA 4HCZA 4CH4A 1U06A 3CXCA 4Q15A 1ZQ1A 1VQNT 3KFUA 2M16A 2K2MA 3D7SB 3J7AF 3META 1WDXA 3A8GB 1NJIR 3PCOA 2OAWA 3I56T 1QLYA 4PKCC 1HXDA 5LJ3g 1BCOA 2OTLQ 2NUZA 1YIJT 2BTTA 2O2OA 3CBPA 2IPOB 1MUZA 1WJQA 1G3SA 3LLRA 2K4YA 4HT4A 4EIKA 1H92A 1M90R 5CCAA 1EIYB 1EZZB 1N8RC 1WLEA 5AYFA 2VV5A 2HQHA 3HXWA 1TUGB 4YRCA 2IG0A 2ZCFB 1JRIA 2C0IA 4J83A 4P3PA 2XK0A 5GJWB 2KRSA 4YCWA 1E24A 3INZA 1NBEB 1WXBA 2COWA 1Q7YC 1Z9QA 4DA4A 1ZHIA 4RCCA 4C8QE 1NE8A 3P8YA 1VQNA 5C6SA 3OYAA 4CS4A 4AFSC 1BI3A 2L5QA 1H8KA 5HCKA 2IY5A 1E7OA 3DLLA 1G51A 2MAMA 1YJWT 1EIYA 4ZGDB 3V8JA 3MP6A 1LYLA 1CKAA 1UHCA 4J6XA 4RTYA 2FEIA 2WSCE 4KUDK 1E1OA 4EDUA 2CJBA
chains in the Genus database with same CATH topology
3OMCA 3OYEA 2IVWA 4BE2A 4PL6A 2XI9A 1WU7A 2XHCA 4P71A 3M55A 1LJOA 2VGMA 2RHIA 3FJPA 2ZT5A 3CC2A 3RL6A 4C8QF 1JJCA 2M9UA 2GCXA 2JN0A 4JUVA 4YRJA 2GFAA 2DXUA 5GAN5 1K9MU 1VQKT 2ZIMA 3QO8A 3JCMW 4C8QB 5DM7R 3QXEB 4ZTZB 2KY9A 2DDZA 4KQEA 3OYBA 3CCLA 4QQ6A 3QJ6A 1OZ3A 2RH2A 4M75C 4YRLA 1BI0A 3NEMA 1M4ZA 3HY1A 4M78B 4C8QC 2QA4T 4E51A 3GP8A 4NOYA 4E7JA 5FU6B 4E7HA 1VIEA 1X6OA 2XDDA 3CCEA 1U1TA 4BE0A 1YITA 4C0DB 5LL6S 3VUBA 3CCLT 3QPHA 1Y07A 4DOVA 3FDRA 3E9GA 2ZPEB 1QF6A 5CKDA 2F5TX 1ADJA 3RKYA 3OYYA 5KE3A 12ASA 1FYFA 3UT1A 1VQ7A 1Q81U 2RHYA 5A0GA 1NPRA 1Y96B 2LT4A 4A4GA 2DIQA 1Q82U 5GAMf 2JTFA 3UPUA 3CCET 4Z02A 3CPWA 2ODRC 3P8BB 1I4K1 4PJOB 4C92B 3CC2T 4P72A 4TVAB 4TTVA 2ZR2A 2AHJB 4KT0E 4YCVA 4II1A 1QW1A 4P73A 4XTYA 4UP8A 5D6YA 4A4FA 3GF5A 4DQ2A 3EFRA 1KQSA 4P74C 3JCMP 4KR3A 1YCYA 2DU5A 3M5AA 3IG2A 1H4VB 3VQXA 4OGCA 3PFSA 2AMCA 4TQFA 4M75A 3CD6T 3PIPA 3OYLA 2EAYA 3QJYA 4XU2A 4CRIA 1OYXA 2XDBA 4BDZA 1VQ8A 3C12A 3OQ5A 3MCAB 2EWNA 4IUVA 5GAMh 1Q86U 1D3BA 4MMLA 1ATIA 1PYSA 2OTLT 3M56A 3PMIA 4MZPA 1PSFA 1NYQA 1S72T 2P0KA 4JRQA 4P72C 4M7DC 3CCVT 3FB9A 4X34A 1B7YA 3RUXA 2FB7A 1B70A 2OTJT 3RACA 2R5AA 2V8IA 1SERA 3OYKA 2ZZEA 3QSUA 3J81E 1M8VA 4WI1A 4QVZA 1VQ7T 2HNIA 3RKXA 3CMET 4H2UA 5D6WA 2CYZB 1P92A 2JNGA 4M78A 4M77G 4MDWA 4Q6GA 1M9SA 1IREB 3I55T 4O6JA 5D6XA 4M77B 3OYCA 3L2VA 4M7DE 2E6ZA 4G85A 3A8OB 2OTJA 3M57A 3A5ZA 5I21A 3MQZA 3OSSC 1NJ6A 5CKBA 3C94A 1WGSA 3CEYA 3MP8A 1B70B 4M78F 4B9XA 5GAOp 4H02A 3P8HA 5LJ5j 4ZTUB 1VQPA 1X2GA 2QHTA 2ARSA 3M4YA 3PMTA 3CC7T 1N27A 4XTZA 1KMNA 2AKWB 2B8AA 1VQLT 2QHSA 3SFMA 3OMGA 3LGFA 1TH7A 4D6WA 3M54A 3CCSA 2LVMA 4A54A 1K8AC 4PJOE 4ZGEB 1YI2A 3HKSA 2PVDB 4O2DA 3ERRA 3HTZA 3HRSA 4C0DC 1C0AA 3GNFB 5A0DA 3QDRB 4J6YA 4YRSA 2ZPBB 3QZ5B 1Q82C 5DY9A 4CH5A 4PNOA 2C06A 1KC8C 4LDYA 2RJEA 3WVEB 4TVRA 2ARTA 3F70A 3QHSA 3HFVA 3LWHA 3VJPA 3CCST 4C92E 1YJWA 4FT4A 1FX7A 3CCRA 4YRKA 3DB4A 4CH6A 2PVOB 3TEEA 4JJNK 1VQ4T 3HFZA 3KUFA 2PMFA 3OS5A 3CPFA 3M53A 4ELYC 3IALA 2P5IA 3PIOA 3CCQT 2YHTA 5ELNA 1KOGA 1MHNA 5FU7B 2KAFA 2CKKA 1UGSB 3OSVA 3A5YA 3M4QA 1B76A 1QVGA 3BY7A 3CBMA 2F5KA 2D6FA 2VXFA 4YREA 3DLMA 4ELZC 2LDMA 4XAXB 4EPCA 4TWAA 2ARUA 3UGTA 4BD3A 2QTXA 4N4HA 2ZPGB 4LVKA 2E12A 2ZR3A 1M1KU 3OA6A 1H3ZA 3GNGA 3A74A 3FEOA 2CJ9A 3FC3A 5KCOA 4F7UF 4YRPA 1YJ9T 1QP3A 1H4QA 2DQ0A 3CXCS 4IUQA 3SDZA 5DLQE 3C4SA 3PGGA 2FVUA 4M7AF 4M75E 2KK4A 4IUTA 4JLIA 4R56A 1AHJB 1U1SA 4ZN3A 4UC4A 2WACA 3TREA 2YLBA 3L4GB 4MMKA 1R8OB 1X55A 5K1PA 2XU8A 3TEHB 3L2UA 4PJOG 4ATOA 4YDQA 1KHCA 4N0AA 4JS4A 2EJ9A 2RJDA 2ZPHB 5K1XA 3UGQA 3RF1A 2M1HA 4EO4A 3UFGA 2EQMA 4XK8E 2EIFA 2P4TA 3GLXA 5CQYA 2WSFE 5GMKi 4BW9A 4DOWA 4C0GA 4UPAA 4M78D 1SSFA 2ZXFA 3H6ZA 5CK9A 3JB9G 2EQKA 4YRQA 2ZGWA 2RI3A 2RD1A 3LWIA 2ODRD 4OMFB 2G4CA 4EX5A 4OF1A 2Q5IA 2CJAA 3PZCA 4J7IA 4WF2A 2E65A 2DTIA 1NJ1A 2D9TA 3JCMf 1Y7XA 3IKMB 3A8HB 1VQ8T 2RHQA 5HK3A 5GAN2 4MDXA 1YFTA 3V8LA 1UEBA 2K2VA 2I4MA 4LDXA 2X4JA 1B8AA 4K86A 4UP7A 2KSSA 2K3YA 3RMQA 5GMKl 3OYJA 2LC4A 3A8LB 1NJ5A 3QYGB 4C92A 1WQ7A 5CAIA 5GANe 3FIFA 3KBGA 1ASZA 1L0WA 5FROA 4A4EA 3X26B 4XTWA 1M1KC 2DXCA 2I4OA 3X28B 3URGA 4YTLA 3NETA 5L8RE 2J3LA 3LC0A 5GAMj 4P3OA 3CCMT 1VQ5A 2K57A 3JCMe 2PQWA 4C92F 2O4XA 3MP1A 2QDYB 4CS3A 1PSEA 3A5ZB 2E70A 2OTLA 5GANj 1WQWA 3MEUA 1NNHA 2P0PA 3QG1A 3DB3A 2E1HA 5DLOA 4VUBA 2ALYA 3JCMc 1VQ9T 4QW2A 2HD0A 2DD5A 1M5Q1 2O01E 2PUKB 4NL3A 3LW5E 4JRKA 3VQVA 3S6WA 3RESA 2QEXT 3LGLA 2EYQA 3HRUA 4NCXA 2EQUA 4OVAA 5A0LA 5IAYA 2X4XA 4FL6A 5I2MA 2X4YA 1YHQA 4JDSA 2BIVA 1KC8U 5CKEA 2DZ9A 3OW2A 2ZNJA 4C8QA 1RI0A 3ZEHA 1N9RA 4L6V5 1M1GA 1QE0A 2KVQG 5CO7A 1IL2A 2E3CA 5M9OA 4Y91A 3VU3C 2ALYB 1KG1A 3PT9A 3OYNA 4PJOD 5J3BA 4M7AD 3G7ZA 4YCUA 2NLUA 2DVEA 4M7AE 4YP0A 4UP9A 2RO0A 4M77E 3A7RA 4M77D 4P75C 2VXEA 2XTIA 5LJ5f 5GAMg 1YJNT 1YFSA 3HL8A 2AKWA 2ZTGA 1XQHA 1B7YB 4F7UB 3SD4A 1N8RU 3X25B 4LNSA 3QZ9B 1S72A 4P5NA 3S3NA 1VQ6A 1W4SA 2JOYA 4M7AB 1GGMA 5LJ3f 4BB7A 2LNVA 1K73C 3CCVA 4RKUE 1VQLA 3DSQA 2L3RA 4OP0A 2Q5HA 1RIQA 5CQXA 3HFOA 3LX7A 4H2VA 4Q5WA 3RGLA 2RA2A 4ME7A 4ZTJA 3JB9J 3G1ZA 3IKLA 2QQSA 3CCQA 1BBWA 5KNNA 4M7AC 5LJ5g 1NZ9A 1HTTA 1YIJA 4M77A 3QNEA 2PMEA 4K87A 2Q7EA 5GANg 4BACA 4E7IA 2RHSA 3OS1A 4PJOA 2MWPA 2XGTA 2A7YA 5GAN4 3E1SA 3JCMb 3UH0A 3UDCA 3HSBA 4BE1A 4J6WA 2LCCA 3HPWA 2JTMA 3V7SA 2VC8A 2I4LA 3NELA 4FIBA 1B34B 4M7DB 3LSSA 1D3BB 1BIBA 3QIIA 3P8VA 4YRNA 4F7UE 4PG3A 4NL2A 5HK0A 1G3WA 1QVFA 5FRNA 4YRFA 3CC7A 3TCJA 3DKMA 3PNWC 3RERA 3NTKA 1K9MC 2FHDA 3TUPA 1VQOT 2PUOB 1YJNA 4E47A 3CD6A 3JB9F 2BUDA 4LVLA 4BI8B 4EMGA 3HP9A 1VQ6T 4YYEA 2KQWA 1WPYA 4M7DD 3E19A 2DEQA 1OI1A 3JSCA 4M78G 3V7RA 3E9HA 2DU7A 3OB9A 2ZNIA 2PVGB 3CBOA 4CS2A 5KH6A 2LQ8A 2QXFA 1BBUA 4J15A 4C5IA 1G3TA 3JB9H 4HWRA 1B34A 4M7DA 1G5HA 5HY6A 4AH6A 4ZIBA 2EQJA 2I2LA 1EOVA 2Q7GA 2H3JA 2DXTA 4P75A 3L2WA 2L8DA 1QVPA 1YGBA 1W2BA 1VQZA 1NJ8A 1O75A 3NTIA 5GAN3 3CMEA 4F7UG 3GPLA 1WNLA 5IT9E 4CH3A 1NJIU 2CZ7B 3HHTB 3V7CA 3X24B 5LJ3j 3LH0A 3O8VA 4YROA 1K8AU 3G4ST 3VKIA 4A53A 2DIGA 4M75D 3MF2A 3VYGA 3SWNA 4HA8A 1YI2T 4OB3B 1SETA 1NJ2A 4YRIA 2P0QA 4J8OA 4BUGA 1U8RA 3JCMV 2F69A 1UGRB 1LNXA 5GMKm 3UWNA 1KMMA 3P8TA 4OB0B 4M78C 4PLIA 2RK1A 5C51B 1N9SA 1QVFS 5KE2A 1VQPT 4K88A 4PJOF 5GAN6 1X54A 1EIFA 2EFIA 4NS5A 3WQZA 3CCUT 2DPPB 4M77F 4C0ZA 1EFWA 4BWAA 4C8QG 4C0FA 3OBWA 2E5AA 1KD1U 3CCMA 4RG2A 2MMPA 3ME9A 3W3SA 4XU0A 3G71A 2ZZDA 4N0AC 3X20B 2DAQA 5LJ5d 2RM4A 4FSXA 4L87A 2V8JA 3JB9D 2BKDN 5GMKj 1UGQB 2KMTA 4P3NA 1LOJA 1X56A 2JUFA 2QHVA 2Y4YA 4KUIA 4IUPA 2RHZA 3P8DA 1H641 2YLCA 4IURA 2FYKA 4GY5A 2ZT7A 4C92C 4TVYA 3CCJT 5GAOq 4B9WA 1OZ2A 2YRVA 4M7AG 3A7UA 2E5QA 1X2HA 4WJ3M 4RQEA 2QQRA 3OYHA 3TEHA 3CCRT 4QVDA 1USYA 5HGQA 1ASYA 3CMAA 3S3MA 2AMCB 4N4GA 3CPWS 3HY0A 1JB0E 1QVGS 1BYMA 1EVLA 2RB6A 4BY6C 3CC4T 2E41A 2JVVA 2LCLA 3ER0A 3LYIA 3I7FA 4C5HA 5CKFA 3SB2A 1I8FA 4PHCA 5FU7C 2OAUA 2MI6A 2DK3A 4OGEA 4C92G 1N6AA 1XTDA 5LJ3e 3TEGA 2CZ6B 4C92D 3TU4K 1YFRA 2MF2A 2Y4XA 2ZPIB 1WYDA 4M75F 2L89A 4A4HA 2QHUA 2HQEA 5GAN7 3QO3A 1W2BS 2LT1A 4YRGA 2ZCEA 3A8MB 3NFCA 4M7DF 4ZGJB 2RK2A 3JCMg 3NTHA 3CC4A 2XG8D 1YITT 4KR2A 2E6NA 3M59A 5IN1A 1KHIA 3HXVA 2R57A 2A8EA 4LVMA 1JBMA 2P0LA 2DTHA 1Q81C 3PTAA 3KXTA 3T9NA 3VYHB 4EMKB 5LJ3h 2VUBA 2DQ3A 1Z7MA 4PJOC 3OS0A 4HCCA 3OW2S 1N9WA 3ZFJA 1BI2A 2O4XB 4LVJA 3OS2A 3CMQA 4M77C 3L42A 4M75B 3JAME 3QBYA 2LQKA 1FXXA 3QUIA 5EG2A 1YB3A 4H2YA 1Q86C 5GMKh 2X35A 3MEWA 4XU1A 4OB1B 1SRYA 2DD4A 4BI3A 1RL2A 2XDPA 3OYMA 1NPPA 4YRMA 2XIDA 3BDLA 1W66A 3M58A 1SESA 3RMSA 2K5IA 4M7DG 3JB9I 3E9IA 1VQKA 2KDSA 3L2ZA 3G6EA 4ZTFA 4XTVA 3L2QA 5A2QE 3VUZA 1UB4A 2DKGA 1EVKA 1G5IA 3BFMA 5HKCA 3HXZA 2GQVA 2PU9B 1X75C 1VQOA 2RHQB 4LDWA 1M1FA 4MZMA 1G5VA 4JLGA 2HAXA 2K5FA 2EJGA 1VQMT 4FU6A 2CGHA 1JJ2S 2ZIOA 4X5OA 1BIAA 3R6OA 3AHUA 2CS7A 2FL7A 2DO3A 4LVIA 2QQAA 2QQBA 4M75G 2A3LA 5FLXE 2DJZA 4YRTA 4RMFA 3BW1A 4HT8A 1UGPB 4RCBA 1K73U 4J5YA 1G3YA 1V29B 2QEXA 3A32A 4HWPA 1NYRA 3HFZB 3FRNA 3REUA 4M7AA 1X01A 4G84A 4X9DA 2LRQA 1BI1A 2RHUA 2K5LA 5I2SA 1M90C 3BJUA 3R07A 1KD1C 2EJFA 4CI0C 4IKFA 2E64A 3V8KA 1E22A 1E1TA 4XTXA 5CR2A 4L5GA 2LTOA 1XNIA 4OLFA 1KQ1A 3NENA 5C52B 2ZZFA 5F5WA 1WJRA 1H4SA 4BY6B 4RQFA 1USYC 3G6ET 2HQXA 4E7LA 5GAOn 2G3RA 3OYDA 2LX9A 2NS6A 2X4WA 1Q7YU 3JCMd 2C7IA 3FLGA 3VQYA 1Z7NA 1JJCB 2EL9A 4HKEA 5GAOl 4PLLA 3MO8A 3HXUA 2ZPFB 4RMOA 3S3OA 1VQMA 3JCMh 5FRMA 3A7AA 3JCMX 4LD6A 3MF1A 3GOXA 3I55A 4HCBA 3MEAA 3CCUA 2Q7HA 2XD0A 5GANd 4LD9K 2I4NA 4P74A 3ASKA 4HWOA 1IZ6A 4XEMA 1PYSB 2JZ2A 4QQGA 3OYGA 4HWTA 3RIRA 3SWNB 4R55A 4EMKC 4JRPA 3JCMQ 4M78E 1HC7A 2IY5B 5J26A 2V8KA 4YRRA 2QA4A 1KQSS 4RDXA 3HRTA 3MEVA 3ZBDA 2M0OA 2RI2A 4H2TA 1VQ4A 3MEYA 3OY9A 4TVWA 4L59A 1Y71A 2Y90A 3WVDB 3PCOB 3LSQA 4H2XA 3REXA 4HT9A 1YBYA 2K3XA 3OYIA 3VBBA 2J3MA 2CZ1B 3L2RA 5CVIA 4IUUA 4OB2B 5LJ5h 3M9QA 3QKJA 3QO7A 4GLKA 2DXBA 2HBPA 4E7KA 3HXXA 1J5WA 3Q1JA 1I81A 2RJCA 4LDVA 3OYFA 3M4GA 4N4IA 1M90U 2DZCA 4WJ4A 3QTCA 1VIFA 3OBYA 3G4SA 4H2SA 4H2WA 3EFSA 4HWSA 4YPFA 5KCHA 2C8MA 2EKOA 1VUBA 2RI5A 4FM4B 5LJ3d 1I5LA 4P73C 4DPGA 3CCJA 2GFUA 2R5MA 4J7FA 4A4KA 1VQ9A 1H4TA 3VQWA 4X9CA 5GMKe 1VQ5T 3L1AA 3OD1A 3HRIA 4JS5A 5CKHA 2XICA 3HFNA 5C53B 4QQDA 2XKOC 1JJ2A 5E3IA 4P71C 3L4GA 4JRIA 2GF7A 4BDYA 4ZN1A 4EMKA 1O9SA 3H8ZA 3ICAA 4RG8A 4LDUA 2RHSB 1KQ2A 1Y96A 4KBMB 1ADYA 1GXIE 3C95A 2ZT8A 1BKBA 3WXMB 3J80E 3A31A 4TVAA 2ZZGA 1FWZA 2ZT6A 3JCMJ 3SWNC 1YJ9A 4V2SA 4F7UA 4C8QD 3QYHB 3GIBA 4XEOA 4XU3A 1YHQT 4FT2A 2QQ9A 1DJ7B 3E9FA 5GAOr 1NJIC 3N5BB 4BI4A 2D0QB 5ELOA 1MGQA 2VGNA 4MZTA 4O5VA 5GAOm 2CZ0B 4EMHA 3VV0A 1HK9A 4XTUA 2RJFA 3RKWA 2VYTA 11ASA 1EQRA 4Y28E 3JRZA 4C5EA 2ZINA 2MWOA 5GANh 3M4PA 3HXYA 4HVCA 4QVCA 5GANf 2CIMA 3CMAT 3I56A 2QI2A 5LJ5e 3MHXA 2WSEE 5GAMd 4KULA 5J39A 3G71T 2R58A 3BDUA 3EAEA 3QO5A 1ZBXA 2E10A 5CIUA 1XOVA 4H2XB 5GAN8 3HRKA 4C5GA 5C0MA 2DTOA 5FU6C 5GAMe 1QP2A 2RHXA 1WJSA 4XQ3A 4TQDA 4HCZA 4CH4A 3CXCA 4Q15A 1ZQ1A 1VQNT 3KFUA 2M16A 3J7AF 3META 3A8GB 3PCOA 3I56T 4PKCC 1HXDA 5LJ3g 1YIJT 3CBPA 1WJQA 1G3SA 3LLRA 2K4YA 4HT4A 5CCAA 1EIYB 1N8RC 1WLEA 2VV5A 5AYFA 3HXWA 4YRCA 2IG0A 2ZCFB 1JRIA 4J83A 4P3PA 2XK0A 4YCWA 1E24A 3INZA 1Q7YC 4DA4A 1ZHIA 4RCCA 4C8QE 1NE8A 3P8YA 1VQNA 5C6SA 3OYAA 4CS4A 1BI3A 2L5QA 2IY5A 3DLLA 1G51A 2MAMA 1YJWT 1EIYA 4ZGDB 3V8JA 3MP6A 1LYLA 4J6XA 2WSCE 4KUDK 1E1OA 4EDUA 2CJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYE A;  3BJU A;  1WPY A;  4M7D D;  3R07 A;  2DEQ A;  2EJF A;  4M78 G;  3V7R A;  1WU7 A;  2E64 A;  3E9H A;  2ZR3 A;  2DU7 A;  3V8K A;  4P71 A;  2ZNI A;  1E22 A;  1E1T A;  1LJO A;  4CS2 A;  3A74 A;  2CJ9 A;  4XTX A;  3FJP A;  1BBU A;  2ZT5 A;  4F7U F;  4J15 A;  4YRP A;  4OLF A;  3RL6 A;  4C8Q F;  1JJC A;  1KQ1 A;  3NEN A;  3JB9 H;  5C52 B;  2JN0 A;  2ZZF A;  1H4Q A;  4HWR A;  1B34 A;  4JUV A;  4M7D A;  2DQ0 A;  4YRJ A;  1G5H A;  2DXU A;  5GAN 5;  4AH6 A;  5F5W A;  4ZIB A;  1H4S A;  3PGG A;  2ZIM A;  3QO8 A;  4RQF A;  1USY C;  2I2L A;  3JCM W;  4M7A F;  4M75 E;  1EOV A;  2Q7G A;  5GAO n;  4JLI A;  2DXT A;  4C8Q B;  4P75 A;  4ZTZ B;  2DDZ A;  3JCM d;  1YGB A;  1U1S A;  4KQE A;  1VQZ A;  1NJ8 A;  2C7I A;  5GAN 3;  3VQY A;  1Z7N A;  1JJC B;  4F7U G;  2EL9 A;  1WNL A;  2YLB A;  4CH3 A;  5GAO l;  3L4G B;  4MMK A;  3V7C A;  5LJ3 j;  3HXU A;  1X55 A;  5K1P A;  4M75 C;  4YRL A;  4YRO A;  3JCM h;  3A7A A;  3NEM A;  3TEH B;  3JCM X;  3HY1 A;  4A53 A;  4M78 B;  4C8Q C;  3MF1 A;  4E51 A;  4M75 D;  4NOY A;  3MF2 A;  3SWN A;  4PJO G;  4HA8 A;  2Q7H A;  4YDQ A;  5GAN d;  1SET A;  1NJ2 A;  4YRI A;  2I4N A;  4N0A A;  4P74 A;  1U1T A;  2EJ9 A;  3JCM V;  5K1X A;  3UGQ A;  4HWO A;  3RF1 A;  4XEM A;  1PYS B;  1LNX A;  4EO4 A;  5GMK m;  3UFG A;  1KMM A;  4HWT A;  3P8T A;  4M78 C;  3RIR A;  3SWN B;  5GMK i;  5C51 B;  1QF6 A;  1N9S A;  4BW9 A;  1ADJ A;  4EMK C;  3RKY A;  4UPA A;  4M78 D;  2ZXF A;  3JCM Q;  12AS A;  4M78 E;  1FYF A;  1HC7 A;  4K88 A;  2IY5 B;  3JB9 G;  4PJO F;  5GAN 6;  1X54 A;  4YRQ A;  2ZGW A;  4YRR A;  2RD1 A;  4RDX A;  1Y96 B;  2ODR D;  2G4C A;  5GAM f;  3WQZ A;  4EX5 A;  2Q5I A;  4M77 F;  2CJA A;  1EFW A;  3PZC A;  4H2T A;  2ODR C;  3MEY A;  4WF2 A;  2E65 A;  2DTI A;  1I4K 1;  4PJO B;  4C92 B;  1NJ1 A;  3JCM f;  4TVW A;  4C8Q G;  4BWA A;  3IKM B;  4P72 A;  4TVA B;  2RHQ A;  4TTV A;  5GAN 2;  1YFT A;  2ZR2 A;  3V8L A;  2Y90 A;  3PCO B;  3LSQ A;  4YCV A;  4H2X A;  3REX A;  2E5A A;  2I4M A;  4HT9 A;  3VBB A;  4P73 A;  4XTY A;  4UP8 A;  1B8A A;  3W3S A;  4K86 A;  2J3M A;  4XU0 A;  4UP7 A;  4DQ2 A;  3EFR A;  4N0A C;  4P74 C;  5GMK l;  3JCM P;  5LJ5 h;  4KR3 A;  1YCY A;  5LJ5 d;  2DU5 A;  2RM4 A;  1NJ5 A;  4C92 A;  1WQ7 A;  5CAI A;  3QO7 A;  3IG2 A;  1H4V B;  3VQX A;  4L87 A;  5GAN e;  3JB9 D;  3FIF A;  3HXX A;  5GMK j;  1J5W A;  2AMC A;  4TQF A;  1I81 A;  1ASZ A;  4P3N A;  1L0W A;  1LOJ A;  3M4G A;  4M75 A;  1X56 A;  2QHV A;  2EAY A;  2DZC A;  4WJ4 A;  1H64 1;  3QTC A;  2YLC A;  4XTW A;  2FYK A;  4XU2 A;  4H2S A;  2ZT7 A;  4C92 C;  4TVY A;  4H2W A;  2I4O A;  5GAO q;  3EFS A;  2EWN A;  3NET A;  4M7A G;  3A7U A;  5GAM h;  4HWS A;  1X2H A;  3LC0 A;  2J3L A;  4YPF A;  5GAM j;  4P3O A;  1D3B A;  4MML A;  2C8M A;  1ATI A;  4RQE A;  4WJ3 M;  1PYS A;  2K57 A;  5LJ3 d;  3JCM e;  1I5L A;  3TEH A;  4QVD A;  4P73 C;  4C92 F;  1USY A;  5HGQ A;  4DPG A;  1ASY A;  1NYQ A;  2AMC B;  4CS3 A;  1H4T A;  4P72 C;  3VQW A;  4X9C A;  4M7D C;  3HY0 A;  3FB9 A;  5GMK e;  3L1A A;  1EVL A;  5GAN j;  1B7Y A;  1WQW A;  2RB6 A;  1NNH A;  3RUX A;  3OD1 A;  2FB7 A;  3HRI A;  1B70 A;  2E1H A;  3RAC A;  2E41 A;  1SER A;  3HFN A;  5C53 B;  2ALY A;  3I7F A;  3JCM c;  2ZZE A;  3QSU A;  5E3I A;  1M8V A;  4P71 C;  3SB2 A;  4WI1 A;  1M5Q 1;  4JRI A;  3L4G A;  1I8F A;  4PHC A;  2HNI A;  4NL3 A;  3RKX A;  4EMK A;  4H2U A;  4JRK A;  3VQV A;  3RES A;  4C92 G;  5LJ3 e;  3TEG A;  4C92 D;  3ICA A;  4M78 A;  1YFR A;  2RHS B;  1KQ2 A;  4M77 G;  1WYD A;  4Q6G A;  4NCX A;  4M75 F;  2QHU A;  1Y96 A;  1ADY A;  5GAN 7;  3QO3 A;  2ZT8 A;  4M77 B;  4YRG A;  2ZCE A;  4M7D F;  3A31 A;  3JCM g;  4M7D E;  4TVA A;  4G85 A;  2ZZG A;  2DZ9 A;  3JCM J;  2ZT6 A;  3SWN C;  2ZNJ A;  4KR2 A;  3A5Z A;  5I21 A;  4C8Q A;  4V2S A;  1NJ6 A;  4F7U A;  1N9R A;  3HXV A;  4C8Q D;  3GIB A;  1QE0 A;  4XEO A;  4XU3 A;  5GAO r;  1B70 B;  1IL2 A;  1JBM A;  4M78 F;  2E3C A;  4Y91 A;  2P0L A;  2DTH A;  3VU3 C;  2ALY B;  5ELO A;  1MGQ A;  5GAO p;  4H02 A;  4PJO D;  5GAO m;  5LJ5 j;  4ZTU B;  4M7A D;  2QHT A;  1X2G A;  4EMK B;  5LJ3 h;  4YCU A;  2DVE A;  4M7A E;  2ARS A;  4YP0 A;  2DQ3 A;  4EMH A;  1Z7M A;  4PJO C;  4M77 E;  4UP9 A;  1HK9 A;  4XTU A;  1N9W A;  3A7R A;  4XTZ A;  4M77 D;  4P75 C;  1KMN A;  2VXE A;  2XTI A;  3RKW A;  5LJ5 f;  11AS A;  2AKW B;  5GAM g;  2QHS A;  1EQR A;  3CMQ A;  1YFS A;  4M77 C;  2AKW A;  4M75 B;  2ZTG A;  2ZIN A;  1B7Y B;  4F7U B;  5GAN h;  1TH7 A;  3QUI A;  3HXY A;  3M4P A;  4QVC A;  1YB3 A;  4H2Y A;  4HVC A;  4LNS A;  5GAN f;  2CIM A;  4M7A B;  1GGM A;  5GMK h;  5LJ3 f;  5LJ5 e;  4XU1 A;  1SRY A;  4A54 A;  3DSQ A;  5GAM d;  4PJO E;  4OP0 A;  3BDU A;  3QO5 A;  2Q5H A;  2E10 A;  4YRM A;  4O2D A;  1RIQ A;  3ERR A;  1W66 A;  3HTZ A;  3HFO A;  4H2V A;  4H2X B;  1SES A;  5GAN 8;  3HRK A;  3RGL A;  1C0A A;  2DTO A;  2RA2 A;  5GAM e;  4M7D G;  3JB9 J;  3G1Z A;  4J6Y A;  4YRS A;  3JB9 I;  3IKL A;  1BBW A;  3E9I A;  5KNN A;  4M7A C;  5DY9 A;  4CH5 A;  4XQ3 A;  4PNO A;  3L2Z A;  4TQD A;  5LJ5 g;  1HTT A;  4CH4 A;  4XTV A;  4M77 A;  2DKG A;  3QNE A;  2PME A;  2ART A;  4Q15 A;  1EVK A;  4K87 A;  3KFU A;  2Q7E A;  1G5I A;  3BFM A;  5GAN g;  3QHS A;  3HXZ A;  3HFV A;  3PCO A;  2RHS A;  4PJO A;  4C92 E;  1HXD A;  5LJ3 g;  2RHQ B;  2XGT A;  5GAN 4;  3JCM b;  3UH0 A;  3HSB A;  4YRK A;  4CH6 A;  4J6W A;  2EJG A;  2CGH A;  2ZIO A;  3HFZ A;  4X5O A;  3V7S A;  2PMF A;  1EIY B;  2VC8 A;  2I4L A;  1BIA A;  3AHU A;  3NEL A;  1WLE A;  4M75 G;  3IAL A;  3HXW A;  2P5I A;  4YRC A;  1B34 B;  4M7D B;  2YHT A;  3LSS A;  5ELN A;  1JRI A;  1D3B B;  1BIB A;  2DJZ A;  4YRT A;  1KOG A;  4P3P A;  4RMF A;  3P8V A;  4YCW A;  1E24 A;  4YRN A;  3BW1 A;  3INZ A;  4F7U E;  3A5Y A;  4NL2 A;  3M4Q A;  4PG3 A;  4RCC A;  4C8Q E;  4HT8 A;  3P8Y A;  4CS4 A;  1B76 A;  4RCB A;  4YRF A;  4J5Y A;  3RER A;  3BY7 A;  2IY5 A;  1G51 A;  3TUP A;  2VXF A;  4YRE A;  1EIY A;  3A32 A;  3V8J A;  4HWP A;  1NYR A;  3HFZ B;  1LYL A;  4TWA A;  4J6X A;  3JB9 F;  2ARU A;  3REU A;  4M7A A;  1X01 A;  4G84 A;  3UGT A;  4X9D A;  2QTX A;  1E1O A;  2CJB A;  4EMG A; 
#chains in the Genus database with same CATH topology
 3OMC A;  3OYE A;  2IVW A;  4BE2 A;  4PL6 A;  2XI9 A;  2GTJ A;  1WU7 A;  2EGC A;  2XHC A;  1X6B A;  4P71 A;  5FWB A;  3M55 A;  2VKN A;  1LJO A;  1YIT Q;  2GBQ A;  3M0S A;  2VGM A;  2M51 A;  2COZ A;  2RHI A;  3FJP A;  2ZT5 A;  1MV3 A;  3CC2 A;  4PFO A;  3BE3 A;  3RL6 A;  4C8Q F;  1JJC A;  2M9U A;  4DEY A;  2GCX A;  2JN0 A;  4JUV A;  4YRJ A;  2GFA A;  2DXU A;  5GAN 5;  1K9M U;  1VQK T;  2ZIM A;  1MV0 B;  2JM9 A;  3QO8 A;  3JCM W;  4FYY B;  1K73 R;  2YUQ A;  2ROL A;  2ABL A;  2JMA A;  4C8Q B;  5DM7 R;  2F2W A;  3QXE B;  4ZTZ B;  2KY9 A;  1CSK A;  1I5O B;  4WTO B;  2DDZ A;  4LXC A;  4KQE A;  3OYB A;  2KR3 A;  1KQS P;  1D0Z A;  3CCL A;  4QQ6 A;  3QJ6 A;  3EHR A;  7AT1 B;  2CUB A;  1OZ3 A;  2RH2 A;  4HXJ A;  3VS5 A;  1YHQ Q;  4M75 C;  4YRL A;  1SEM A;  1BI0 A;  3NEM A;  1ZSZ A;  1M4Z A;  2OJ2 A;  4JPB W;  4F17 A;  2OI3 A;  3CPW P;  3HY1 A;  4M78 B;  4C8Q C;  2QA4 T;  4E51 A;  3GP8 A;  4NOY A;  4E7J A;  5FU6 B;  3UA6 A;  1M3A A;  4E7H A;  1VIE A;  2DBK A;  1OX9 A;  2HZY A;  1X6O A;  4CC7 A;  2XDD A;  1SPK A;  3CCE A;  2FG0 A;  1U1T A;  1M3B A;  4BE0 A;  3UAT A;  4FYV B;  3H0I A;  5FWC A;  1YIT A;  2CP2 A;  1VQ7 Q;  4C0D B;  5LL6 S;  3VUB A;  3CCL T;  3RNJ A;  3QPH A;  1Y07 A;  4DOV A;  3REB B;  3FDR A;  1VYV A;  3E9G A;  2ZPE B;  1QF6 A;  5CKD A;  2F5T X;  1ADJ A;  3RKY A;  1J3T A;  1ZUU A;  1K1Z A;  3OYY A;  5KE3 A;  12AS A;  2L3P A;  1FYF A;  3UT1 A;  4J9F A;  4PFP A;  1VQ7 A;  1Q81 U;  2RHY A;  5A0G A;  2K3B A;  1PKT A;  4F04 B;  1NPR A;  1VOM A;  1M1K R;  1Y96 B;  2LT4 A;  4A4G A;  2DIQ A;  2CUD A;  3CCV Q;  5GAM f;  1Q82 U;  2JTF A;  4J9E A;  3UPU A;  4K11 A;  3CCE T;  4Z02 A;  3CPW A;  2ODR C;  3P8B B;  1I4K 1;  4PJO B;  4C92 B;  3CC2 T;  4P72 A;  4TVA B;  1N5Z A;  4TTV A;  3CCJ Q;  2ZR2 A;  2AHJ B;  4DEX A;  4OML A;  4CC4 B;  5KYX A;  4KT0 E;  4YCV A;  1PD0 A;  4II1 A;  1QW1 A;  4P73 A;  1MNE A;  4XTY A;  4UP8 A;  5D6Y A;  4A4F A;  3GF5 A;  2A36 A;  4DQ2 A;  4KH0 B;  3EFR A;  1KQS A;  1JEG A;  4P74 C;  3JCM P;  4KR3 A;  1YCY A;  2DU5 A;  1RAG B;  2MYS A;  3M5A A;  3IG2 A;  1H4V B;  3VQX A;  4OGC A;  1EFN A;  3PFS A;  2A08 A;  1R77 A;  1EX4 A;  1GBQ A;  2AMC A;  4TQF A;  4M75 A;  3CD6 T;  3PIP A;  3OYL A;  2EAY A;  2GNC A;  3QJY A;  5D7U A;  4XU2 A;  4CRI A;  1OYX A;  2XDB A;  4BDZ A;  1VQ8 A;  3C12 A;  3OQ5 A;  4DBH A;  3MCA B;  2EWN A;  4IUV A;  1VA7 A;  5GAM h;  1Q86 U;  1D3B A;  4MML A;  4Z8A A;  1ATI A;  1PYS A;  2OTL T;  3M56 A;  5L23 A;  2RQT A;  1M2O A;  3PMI A;  4MZP A;  1PSF A;  1NYQ A;  2VAS A;  1S72 T;  2P0K A;  4JRQ A;  1OPL A;  4P72 C;  1K9M R;  4M7D C;  3CCV T;  3FB9 A;  2YUP A;  4RTV A;  4X34 A;  1B7Y A;  2X3X D;  3H0F A;  3RUX A;  1M2V B;  2FB7 A;  1B70 A;  3VRZ A;  2OTJ T;  3RAC A;  2R5A A;  2V8I A;  1SER A;  2QAZ A;  3OYK A;  2ZZE A;  3NPF A;  3QSU A;  3J81 E;  4OMP A;  1M8V A;  4WI1 A;  1T3S A;  1JO8 A;  4QVZ A;  1VQ7 T;  4JJC A;  2JTE A;  2D8J A;  2HNI A;  3RKX A;  3CME T;  4H2U A;  5D6W A;  1PKS A;  2CYZ B;  4D8D A;  2FRW A;  1P92 A;  2JNG A;  4M78 A;  4M77 G;  4MDW A;  4AFU C;  2HL5 C;  4Q6G A;  1NEG A;  1M9S A;  4A63 B;  1X43 A;  1IRE B;  4KH1 B;  2D8H A;  3I55 T;  2DET A;  3RR6 A;  4O6J A;  3REA B;  2PNI A;  5D6X A;  1WI7 A;  4M77 B;  3OYC A;  3L2V A;  1UJY A;  4M7D E;  3KFV A;  2E6Z A;  4G85 A;  3A8O B;  1YNZ A;  2MK5 A;  2OTJ A;  8AT1 B;  3M57 A;  3A5Z A;  1GRI A;  5I21 A;  2KRM A;  4PJN A;  3MQZ A;  3OSS C;  4KGV B;  1TS9 A;  3U23 A;  3I5S A;  1NJ6 A;  1S1N A;  2K6D A;  1SKU B;  8ATC B;  2KNB B;  5CKB A;  3C94 A;  1WGS A;  3CEY A;  2MCN A;  3MP8 A;  4KGZ B;  1B70 B;  4M78 F;  4B9X A;  5GAO p;  4H02 A;  3P8H A;  5LJ5 j;  4ZTU B;  1VQP A;  1X2G A;  2QHT A;  1U5S A;  2ARS A;  3M4Y A;  3PMT A;  1TXQ A;  2NYS A;  3CC7 T;  1N27 A;  1WHG A;  4XTZ A;  2F2V A;  1KMN A;  1VQL T;  2B8A A;  2AKW B;  2QHS A;  3SFM A;  3RBB B;  4RTU A;  3OMG A;  3LGF A;  2EGE A;  1TH7 A;  4D6W A;  3VS3 A;  3M54 A;  4PJJ A;  3UF4 A;  1FMK A;  3CCS A;  2LVM A;  4F16 A;  2DL3 A;  4A54 A;  1K8A C;  4PJO E;  1WXU A;  4ZGE B;  1YI2 A;  3HKS A;  1UG1 A;  2PVD B;  2MIO A;  4O2D A;  1A0N B;  3ERR A;  3HTZ A;  1B07 A;  3HRS A;  4RTT A;  5KYU B;  4C0D C;  4PK4 A;  1RAD B;  1C0A A;  1JQQ A;  3GNF B;  4LNP A;  5A0D A;  3QDR B;  4J6Y A;  4YRS A;  3TQ7 P;  1R0C B;  1MMA A;  2ZPB B;  3QZ5 B;  3NMZ C;  4J9B A;  2Z0W A;  2O9V A;  1Q82 C;  5DY9 A;  4CH5 A;  4PNO A;  2C06 A;  1KC8 C;  1C0M A;  4LDY A;  1GCQ A;  2RJE A;  3WVE B;  4TVR A;  3THK A;  2ART A;  1G2B A;  3I56 Q;  2RMO A;  3F70 A;  3QHS A;  3HFV A;  2FO0 A;  2O88 A;  3LWH A;  2KYB A;  3VJP A;  3CCS T;  4C92 E;  1YJW A;  2ENM A;  4FT4 A;  1WLP B;  2VWF A;  1FX7 A;  3CCR A;  1UHF A;  1KC8 R;  3DB4 A;  4YRK A;  4CH6 A;  2PVO B;  3I55 Q;  1LVK A;  3TEE A;  4JJN K;  1VQ4 T;  1UDL A;  3HFZ A;  3KUF A;  2QDL A;  2PMF A;  3EGD A;  3CPF A;  3OS5 A;  2RQW A;  3M53 A;  4ELY C;  4Z88 A;  3IAL A;  2P5I A;  2J05 A;  3PIO A;  3CCQ T;  2YHT A;  5ELN A;  4IIM A;  1KOG A;  1MHN A;  5FU7 B;  2KAF A;  2CKK A;  4PFZ A;  1ZUK A;  2CH4 A;  1UGS B;  3OSV A;  3A5Y A;  3M4Q A;  1TTH B;  4QKU A;  2C0O A;  1B76 A;  1QVG A;  1IXD A;  3EH1 A;  3BY7 A;  3CBM A;  2F5K A;  1RI9 A;  2D6F A;  2VXF A;  4YRE A;  3DLM A;  4ELZ C;  2LDM A;  4XAX B;  4EPC A;  4TWA A;  2ARU A;  3M0P A;  1UFF A;  3EGX B;  3UGT A;  1G83 A;  4BD3 A;  2QTX A;  3O5Z A;  1AWX A;  4N4H A;  2ZPG B;  2EYW A;  4LVK A;  2E12 A;  5KYY A;  2C0T A;  1VQ6 Q;  2ZR3 A;  1M1K U;  3OA6 A;  5IXB A;  1H3Z A;  4AT1 B;  3GNG A;  3A74 A;  2CP6 A;  3FEO A;  2CJ9 A;  3FC3 A;  1BCM A;  5KCO A;  4F7U F;  2CP5 A;  4YRP A;  1YJ9 T;  1QP3 A;  1H4Q A;  2DQ0 A;  4HVU A;  1D0Y A;  1IHW A;  3CXC S;  4IUQ A;  1JXO A;  3SDZ A;  5DLQ E;  3C4S A;  3PGG A;  2FVU A;  1ABQ A;  4M7A F;  1UUE A;  2EPD A;  4M75 E;  2KK4 A;  5KYX B;  4IUT A;  2CP3 A;  2E3I A;  4JLI A;  4B6M A;  4QT7 A;  4R56 A;  1AHJ B;  4AMC A;  2CDT A;  1U1S A;  2FPE A;  4ZN3 A;  3UA7 A;  2LJ0 A;  1ZX6 A;  4UC4 A;  2WAC A;  3M0R A;  3TRE A;  2FZC B;  2YLB A;  3L4G B;  4MMK A;  1R8O B;  1T0H A;  2DMO A;  1SRL A;  1X55 A;  5K1P A;  3AT1 B;  5KYW B;  4J9G A;  2XU8 A;  1VQP Q;  3TEH B;  1WHJ A;  3EH2 A;  1IHV A;  3L2U A;  4PJO G;  2AZS A;  4ATO A;  4YDQ A;  3G6E Q;  1KHC A;  4N0A A;  1NLO C;  4GBQ A;  4JS4 A;  2EJ9 A;  1V1C A;  2RJD A;  2ZPH B;  3VS1 A;  5K1X A;  2OX7 A;  3UGQ A;  1BK2 A;  3G1J A;  3RF1 A;  2M1H A;  4EO4 A;  3UFG A;  2COY A;  2EQM A;  2EKH A;  4XK8 E;  1Y0M A;  2EIF A;  2P4T A;  3GLX A;  1QVF P;  5CQY A;  2WSF E;  2SEM A;  2LNH B;  5GMK i;  3CCM Q;  3EGU A;  4BW9 A;  2KE9 A;  4C0G A;  4DOW A;  4UPA A;  4M78 D;  1SSF A;  2ZXF A;  3H6Z A;  1M8M A;  5CK9 A;  2YXY A;  3JB9 G;  2EQK A;  1GBR A;  4YRQ A;  1WHL A;  2ZGW A;  1HD3 A;  2VB6 A;  2RI3 A;  2RD1 A;  3LWI A;  1PNJ A;  3E2U A;  2HKQ B;  2ODR D;  4OMF B;  2G4C A;  4EX5 A;  4OF1 A;  2Q5I A;  2CJA A;  3PZC A;  4KRT A;  4J7I A;  5I11 A;  1D1A A;  2E65 A;  2DTI A;  3EG9 A;  4WF2 A;  2D9T A;  1NJ1 A;  3JCM f;  2NWM A;  4LN2 A;  1Y7X A;  3IKM B;  3A8H B;  1N8R R;  1VQ8 T;  2KBT A;  2RHQ A;  5HK3 A;  5GAN 2;  4MDX A;  1YFT A;  3V8L A;  1UEB A;  2K2V A;  1VQN Q;  3I9Q A;  2I4M A;  4LDX A;  2X4J A;  1SHF A;  2BZ8 A;  1B8A A;  4K86 A;  1RAE B;  4UP7 A;  2KSS A;  2BZY A;  2K3Y A;  3RMQ A;  2K7A A;  5GMK l;  1JJ2 P;  3OYJ A;  2LC4 A;  3A8L B;  1NJ5 A;  3QYG B;  3QWX X;  1JU5 C;  4C92 A;  1WQ7 A;  5CAI A;  5ECA A;  3H9N A;  2FRY A;  3EFO A;  2M0Y A;  5GAN e;  3EGX A;  3FIF A;  1ZSZ C;  3KBG A;  1VQM Q;  1ASZ A;  2K9G A;  1L0W A;  5FRO A;  4A4E A;  3X26 B;  3RDV A;  4XTW A;  1M1K C;  1MND A;  2DXC A;  1KK7 A;  1NLP C;  2I4O A;  3NHN A;  3X28 B;  2RQR A;  1OQK A;  3URG A;  4YTL A;  3NET A;  5L8R E;  2J3L A;  3LC0 A;  5GAM j;  4P3O A;  1FMV A;  1QCF A;  3CCM T;  1VQ5 A;  2YSQ A;  2QAS A;  2K57 A;  3JCM e;  2PQW A;  4C92 F;  2O4X A;  3MP1 A;  1VQK Q;  1MMG A;  2X51 A;  3ULR B;  1VQO Q;  2QDY B;  4CS3 A;  1PSE A;  3A5Z B;  2E70 A;  1SSH A;  2OTL A;  1OPK A;  5GAN j;  1WQW A;  3MEU A;  1NNH A;  3CD6 Q;  3TSW A;  2P0P A;  3QG1 A;  4RTZ A;  3DB3 A;  2E1H A;  5DLO A;  3CC2 Q;  4AFZ C;  4VUB A;  2ALY A;  3JCM c;  1VQ9 T;  4QW2 A;  2HD0 A;  2A28 A;  2DD5 A;  1M5Q 1;  2O01 E;  2PUK B;  1T3L A;  4OMN A;  2E5K A;  4J9D A;  4NL3 A;  2CSI A;  1D09 B;  4WCI A;  4JRK A;  3LW5 E;  3HTR A;  3VQV A;  3S6W A;  3RES A;  2QEX T;  1QKW A;  3LGL A;  2EYQ A;  3VS7 A;  3HRU A;  1FMW A;  4NCX A;  1RAF B;  2EQU A;  4OVA A;  2RPN A;  5A0L A;  2LQW A;  5IAY A;  1K0X A;  2X4X A;  4FL6 A;  5I2M A;  2X4Y A;  1YHQ A;  4JDS A;  2BIV A;  1KC8 U;  2JJ9 A;  5CKE A;  2DZ9 A;  1X6G A;  1AVZ C;  3OW2 A;  2ZNJ A;  4C8Q A;  1RI0 A;  3ZEH A;  2DM1 A;  1N9R A;  1QKX A;  4L6V 5;  2FPF A;  5KYU A;  1M1G A;  1QE0 A;  3CME Q;  2KVQ G;  5CO7 A;  5EC7 A;  1IL2 A;  2E3C A;  5M9O A;  4Y91 A;  3VU3 C;  2ALY B;  3G4S Q;  1KG1 A;  3PT9 A;  3OYN A;  4PJO D;  5J3B A;  2YDL A;  1U3O A;  1KFZ A;  4M7A D;  3G7Z A;  4YCU A;  2NLU A;  2DVE A;  4M7A E;  4YP0 A;  1IO6 A;  4UP9 A;  2RO0 A;  4M77 E;  4AFQ C;  3A7R A;  2ECZ A;  4M77 D;  1YWO A;  3NGP A;  4P75 C;  2AT1 B;  2VXE A;  2XTI A;  2FPD A;  5LJ5 f;  2AIR B;  1WHK A;  5GAM g;  1YJN T;  3GBQ A;  2LQN A;  2JS2 A;  1YFS A;  1RUW A;  3HL8 A;  2AKW A;  1RLP C;  2ZTG A;  1UTI A;  1XQH A;  1B7Y B;  4F7U B;  3SD4 A;  1N8R U;  3X25 B;  4LNS A;  1TWB A;  3QZ9 B;  1S72 A;  4P5N A;  3S3N A;  1VQ6 A;  1W4S A;  2JOY A;  4M7A B;  1GGM A;  5LJ3 f;  4BB7 A;  2LNV A;  1GCP A;  1K73 C;  3CCV A;  4RKU E;  1VQL A;  3DSQ A;  2L3R A;  4OP0 A;  1AWJ A;  2KEA A;  2Q5H A;  1RIQ A;  2JMC A;  5CQX A;  1UE9 A;  3HFO A;  3LX7 A;  4H2V A;  4Q5W A;  1PM3 A;  2KRO A;  3RGL A;  2LJ1 A;  2RA2 A;  4ME7 A;  4ZTJ A;  1X27 A;  3JB9 J;  3G1Z A;  3IKL A;  2QQS A;  2DFU A;  1VYT A;  1W1F A;  3CCQ A;  1BBW A;  2GTO A;  2GQI A;  5KNN A;  1PHT A;  4M7A C;  5LJ5 g;  1NZ9 A;  1F1B B;  1HTT A;  1W6X A;  1XJW B;  1YIJ A;  2EGA A;  4M77 A;  2DER A;  3QNE A;  2PME A;  4K87 A;  1BB9 A;  2Q7E A;  5GAN g;  4BAC A;  4E7I A;  2RHS A;  2X3W D;  2EBP A;  3OS1 A;  4PJO A;  1AZG B;  2MWP A;  2XGT A;  2A7Y A;  2QEX Q;  1UEC A;  1IB8 A;  3E1S A;  3JCM b;  1YFN A;  5GAN 4;  3UH0 A;  4DBF A;  3UDC A;  3HSB A;  1K4U S;  4BE1 A;  4J6W A;  2LCC A;  3HPW A;  2JTM A;  3V7S A;  2DJQ A;  2VC8 A;  2I4L A;  3CQT A;  3NEL A;  1PRM C;  4FIB A;  2V1Q A;  3EG3 A;  1B34 B;  4M7D B;  3LSS A;  3EG9 B;  1D3B B;  1BIB A;  4OMQ A;  3QII A;  1M3C A;  3P8V A;  1WFW A;  4YRN A;  1HYO A;  4F7U E;  4PG3 A;  4NL2 A;  5HK0 A;  1ZA1 B;  1G3W A;  1QVF A;  5FRN A;  4YRF A;  2YWW A;  1KSW A;  3A1P A;  3TCJ A;  3DKM A;  3PNW C;  4ANJ A;  3CC7 A;  3RER A;  3NTK A;  1K9M C;  2FHD A;  2HMA A;  3TUP A;  1VQO T;  2PUO B;  1YJN A;  4E47 A;  3CD6 A;  3JB9 F;  2EW3 A;  2BUD A;  4LVL A;  2RQV A;  4BI8 B;  4JJD A;  1CKB A;  4EMG A;  3HP9 A;  4PJM A;  1VQ6 T;  4YYE A;  2KQW A;  1WPY A;  4M7D D;  3E19 A;  2DEQ A;  1X69 A;  1OI1 A;  3JSC A;  4M78 G;  3V7R A;  3TSZ A;  3E9H A;  2DU7 A;  2FZG B;  3OB9 A;  2ZNI A;  2PVG B;  3CBO A;  4LUD A;  4CS2 A;  1WHM A;  5KH6 A;  2LQ8 A;  2QXF A;  1BBU A;  4J15 A;  4C5I A;  1G3T A;  1GFD A;  1ZBJ A;  1D0X A;  3JB9 H;  1QWE A;  4HWR A;  1B34 A;  4M7D A;  1G5H A;  1PC0 A;  5HY6 A;  4AH6 A;  4ZIB A;  2EQJ A;  1K0S A;  5KYW A;  1NM7 A;  5KYN A;  2I2L A;  4IIO A;  1EOV A;  4E2F B;  2Q7G A;  2H3J A;  4JZ3 A;  1AEY A;  2DXT A;  4J9I A;  2L0A A;  4P75 A;  3L2W A;  2KT8 A;  2L8D A;  2RN8 A;  1QVP A;  2J06 A;  1YGB A;  1W2B A;  2DA9 A;  1NJ8 A;  3MKD A;  1VQZ A;  2KXD A;  1O75 A;  1Q95 G;  3NTI A;  5GAN 3;  1WHH A;  3CME A;  4F7U G;  3GPL A;  1WNL A;  5IT9 E;  4CH3 A;  1NJI U;  6AT1 B;  2CZ7 B;  3HHT B;  3V7C A;  3X24 B;  2PZ1 A;  5LJ3 j;  3LH0 A;  2E4H A;  1OEB A;  3O8V A;  4YRO A;  1NEB A;  2O31 A;  1K8A U;  2J6O A;  3G4S T;  3VKI A;  1ABO A;  2M02 A;  4A53 A;  3G71 Q;  1ZA2 B;  5FW9 A;  2DIG A;  4M75 D;  3MF2 A;  4AG1 C;  4X1V A;  3VYG A;  3SWN A;  4HA8 A;  1NG2 A;  1YI2 T;  4OB3 B;  1SET A;  4D8K A;  3CC4 Q;  1PD1 A;  1NJ2 A;  4YRI A;  2P0Q A;  2CH4 W;  4J8O A;  4BUG A;  1W70 A;  1U8R A;  1QQJ A;  3JCM V;  2F69 A;  1K76 A;  4E6R A;  3TVT A;  4LE9 A;  1AD5 A;  1LNX A;  1UGR B;  5GMK m;  3UWN A;  1KMM A;  1GFC A;  3P8T A;  4OB0 B;  1QVG P;  3CCQ Q;  4M78 C;  3VS2 A;  4PLI A;  2RK1 A;  5C51 B;  1N9S A;  1Q82 R;  2ATC B;  1WX6 A;  1QVF S;  5KE2 A;  1VQP T;  4K88 A;  4PJO F;  1BU1 A;  5GAN 6;  1X54 A;  3QWY A;  1EIF A;  2EFI A;  2A0F B;  2HSE B;  3EGD B;  4NS5 A;  2CRE A;  2X9H A;  3WQZ A;  1RAA B;  2DL4 A;  3I35 A;  1C6V X;  2DPP B;  3CCU T;  4M77 F;  4C0Z A;  2MPX C;  1EFW A;  2GGR A;  1SF9 A;  2HCK A;  1FYN A;  2D1X A;  2JS0 A;  4BWA A;  1SG5 A;  4C8Q G;  1VQL Q;  4C0F A;  2W10 A;  2CT4 A;  1OV3 A;  3CXC P;  9ATC B;  1JXM A;  3QDF A;  3OBW A;  1AOJ A;  2E5A A;  1KD1 U;  3CCM A;  4RG2 A;  2MMP A;  3ME9 A;  3W3S A;  4XU0 A;  3G71 A;  3VS0 A;  2ZZD A;  1YWP A;  2HL3 A;  1T0J A;  4N0A C;  3X20 B;  4J9H A;  4RUG A;  2DAQ A;  5LJ5 d;  2RM4 A;  2VVK A;  1TUC A;  1Q7Y R;  4FSX A;  4L87 A;  1LCK A;  1WXT A;  2V8J A;  3JB9 D;  1ARK A;  2BKD N;  5GMK j;  1UGQ B;  2KMT A;  4P3N A;  4R0K A;  1LOJ A;  2J6F A;  1X56 A;  2JUF A;  2QHV A;  2Y4Y A;  4KUI A;  4IUP A;  2RHZ A;  3P8D A;  1H64 1;  2YLC A;  4IUR A;  1M2V A;  2FYK A;  1B3Q A;  4GY5 A;  2ZT7 A;  4C92 C;  4TVY A;  3CCJ T;  5GAO q;  3EG1 A;  4B9W A;  1OZ2 A;  5I22 A;  2YRV A;  4M7A G;  3A7U A;  2E5Q A;  1X2H A;  2HSP A;  4OMM A;  4WJ3 M;  4RQE A;  2QQR A;  3OYH A;  4DBQ A;  2G6F X;  3TEH A;  3CCR T;  4QVD A;  2KXC A;  1USY A;  5HGQ A;  3MJX A;  1ASY A;  1AWO A;  3CMA A;  3S3M A;  2AMC B;  4RTX A;  4N4G A;  1Q86 R;  3CPW S;  3HY0 A;  1TSF A;  1JB0 E;  1QVG S;  1BYM A;  1EVL A;  2RB6 A;  4AG2 C;  4BY6 C;  4FSS A;  3CC4 T;  1K9A A;  2E41 A;  2JVV A;  2LCL A;  1PRL C;  3ER0 A;  2JM8 A;  2KI7 A;  1MMN A;  3LYI A;  3I7F A;  4C5H A;  1TU0 B;  2DEU A;  5CKF A;  3SB2 A;  4ESR A;  1I8F A;  4PHC A;  1LPL A;  2JT4 A;  4OMO A;  5FU7 C;  2OAU A;  2MI6 A;  2DK3 A;  4OGE A;  2IIM A;  1C1A A;  1N6A A;  1XTD A;  4C92 G;  5LJ3 e;  3TEG A;  2K79 A;  1R0B G;  2CZ6 B;  4Z89 A;  4C92 D;  3TU4 K;  1YFR A;  2MF2 A;  2Y4X A;  2ZPI B;  1WYD A;  4M75 F;  2L89 A;  4A4H A;  2QHU A;  2HQE A;  2NUP A;  4FYX B;  5GAN 7;  3QO3 A;  1RAH B;  1W2B S;  1B7T A;  2LT1 A;  4YRG A;  2ZCE A;  3A8M B;  3NFC A;  4M7D F;  2YUN A;  4ZGJ B;  2RK2 A;  3JCM g;  3NTH A;  3PVQ A;  2JXB A;  3CC4 A;  4FYW B;  2XG8 D;  2LZ6 B;  1YIT T;  4KR2 A;  1BBZ A;  2P4R A;  2E6N A;  3M59 A;  2RNA A;  5IN1 A;  1KHI A;  2D0N A;  3HXV A;  2R57 A;  2A8E A;  4LVM A;  4HCK A;  2V26 A;  1QMC A;  1JBM A;  2P0L A;  2DTH A;  2HEQ A;  3PTA A;  1Q81 C;  3KXT A;  2BE9 B;  3T9N A;  4CC3 A;  3VYH B;  2ESW A;  4EMK B;  5LJ3 h;  2VUB A;  2DQ3 A;  1Z7M A;  3PE0 A;  4PJO C;  3OS0 A;  4HCC A;  3OW2 S;  1G8X A;  1RAB B;  1N9W A;  3ZFJ A;  2P84 A;  1KIK A;  1BI2 A;  2F2X A;  2O4X B;  2YRD A;  4LVJ A;  3OS2 A;  3CMQ A;  2NUT A;  4M77 C;  3L42 A;  4M75 B;  1GCQ C;  2QK0 A;  1RLQ C;  3JAM E;  3QBY A;  2LQK A;  1FXX A;  3QUI A;  5EG2 A;  1YB3 A;  4H2Y A;  3CCL Q;  2LP5 A;  1Q86 C;  2CP7 A;  5GMK h;  2AK5 A;  2X35 A;  3MEW A;  4XU1 A;  4OB1 B;  1SRY A;  2DX1 A;  2DD4 A;  4BI3 A;  1RL2 A;  2LJ3 A;  2XDP A;  3OYM A;  1YI2 Q;  1NPP A;  2DRM A;  4YRM A;  2XID A;  3BDL A;  1W66 A;  4KGX B;  3M58 A;  1SES A;  2RQU A;  3RMS A;  2KGT A;  2K5I A;  3EHQ A;  4M7D G;  5AT1 B;  3JB9 I;  3E9I A;  1VQK A;  1WZO A;  2KDS A;  1OOT A;  3L2Z A;  3G6E A;  4ZTF A;  1OU8 A;  1YN8 A;  4XTV A;  3L2Q A;  5A2Q E;  1KD1 R;  3VUZ A;  1UB4 A;  2DKG A;  1EVK A;  3A98 A;  1G5I A;  3BFM A;  5HKC A;  3HXZ A;  2GQV A;  2PU9 B;  1X75 C;  1VQO A;  2RHQ B;  4LDW A;  1M1F A;  1ZSG A;  4MZM A;  1G5V A;  4JLG A;  1QCN A;  1QCO A;  2HAX A;  5GJV B;  2K5F A;  2EJG A;  1VQM T;  2EYY A;  4FU6 A;  2CGH A;  1JJ2 S;  1K8A R;  2ZIO A;  3I5R A;  4X5O A;  1BIA A;  3R6O A;  3AHU A;  2CS7 A;  2FL7 A;  2DO3 A;  2I0N A;  4LVI A;  2QQA A;  2QQB A;  2OTJ Q;  4M75 G;  2YT6 A;  1IRX A;  2A3L A;  2ZAE A;  1UGV A;  5FLX E;  2DJZ A;  4YRT A;  1QWF A;  2QTV A;  4RMF A;  3BW1 A;  1HSQ A;  4HT8 A;  1UGP B;  4RCB A;  1K73 U;  4J5Y A;  1X2Q A;  1G3Y A;  3C0C A;  1V29 B;  1I07 A;  2QEX A;  3A32 A;  4HWP A;  1NYR A;  3HFZ B;  1D1B A;  2O9S A;  3FRN A;  3REU A;  1M30 A;  4M7A A;  1X01 A;  4G84 A;  4X9D A;  5IXF A;  2DE0 X;  2LRQ A;  1BI1 A;  2RHU A;  2QG9 B;  2L2P A;  4Y92 A;  2K5L A;  5I2S A;  5IH2 A;  1M90 C;  3BJU A;  3R07 A;  1KD1 C;  2LMJ A;  3SEM A;  2EJF A;  4CI0 C;  4IKF A;  2E64 A;  3IQL A;  3V8K A;  1E22 A;  1E1T A;  1RAI B;  3CMA Q;  2MOX A;  4XTX A;  1E6G A;  5IHK A;  5CR2 A;  4CC2 A;  4L5G A;  2LTO A;  1XNI A;  4OLF A;  1KQ1 A;  3NEN A;  5C52 B;  2ZZF A;  1AWW A;  5F5W A;  1ACM B;  1WJR A;  2RF0 A;  1H4S A;  4BY6 B;  1S72 Q;  4RQF A;  1VQ5 Q;  1USY C;  3G6E T;  2HQX A;  4E7L A;  3EG2 A;  2DYB A;  5GAO n;  2L3S A;  4JZ4 A;  1Y57 A;  2G3R A;  2ED1 A;  1YCS B;  3CCE Q;  3OYD A;  2LX9 A;  2HBW A;  2NS6 A;  4JJB A;  4M4Z A;  2X4W A;  1Q7Y U;  3JCM d;  2C7I A;  3FLG A;  3VQY A;  1Z7N A;  1JJC B;  1PWT A;  2EL9 A;  4HKE A;  3M0Q A;  5GAO l;  2QGG A;  4PLL A;  1PG5 B;  3MO8 A;  3HXU A;  2ZPF B;  4RMO A;  3S3O A;  1VQM A;  4E7S A;  1YJ9 Q;  3JCM h;  3VRY A;  5FRM A;  3A7A A;  1YIJ Q;  3JCM X;  4LD6 A;  5KYY B;  1Z9Z A;  3CCR Q;  3MF1 A;  3GOX A;  3I55 A;  4HCB A;  4PJL A;  3MEA A;  3CCU A;  2Q7H A;  2XD0 A;  5GAN d;  4LD9 K;  2I4N A;  4P74 A;  3ASK A;  1AT1 B;  3ZL7 C;  2DL8 A;  2KRN A;  4HWO A;  1IZ6 A;  3LH5 A;  4XEM A;  4ZNX A;  1PYS B;  2JZ2 A;  2B86 A;  4E7Z A;  4QQG A;  3OYG A;  2DNU A;  4HWT A;  4RTW A;  3RIR A;  3SWN B;  4R55 A;  2DRK A;  2BZX A;  2DYI A;  4EMK C;  4JRP A;  3JCM Q;  4M78 E;  1HC7 A;  2IY5 B;  2DIL A;  4GLM A;  5J26 A;  2V8K A;  4YRR A;  2QA4 A;  1KQS S;  4RDX A;  3HRT A;  2ED0 A;  2KT1 A;  3MEV A;  3ZBD A;  2DF6 A;  2A37 A;  4FW1 A;  1WA7 A;  2M0O A;  2RI2 A;  4H2T A;  3EFO B;  2EQI A;  1VQ4 A;  3MEY A;  2AZV A;  3OY9 A;  4TVW A;  4L59 A;  1YJN Q;  2DL7 A;  2CT3 A;  2E3H A;  1H3H A;  1Y71 A;  2V1R A;  2H3E B;  2Y90 A;  3WVD B;  3PCO B;  1VQ8 Q;  3LSQ A;  4H2X A;  3REX A;  4HT9 A;  1YBY A;  2K3X A;  3OYI A;  3VBB A;  2QGF B;  2J3M A;  2CZ1 B;  3L2R A;  5CVI A;  1V76 A;  4IUU A;  4OB2 B;  5LJ5 h;  1WYX A;  2J7I A;  2QYZ A;  1MMD A;  3CCS Q;  3M9Q A;  1RAC B;  3QKJ A;  3QO7 A;  4GLK A;  2DXB A;  2HBP A;  2YRC A;  1WIE A;  3R6N A;  4E7K A;  3EG0 A;  2W0Z A;  3HXX A;  1J5W A;  3Q1J A;  1I81 A;  2RJC A;  4LDV A;  3OYF A;  3M4G A;  1ZLM A;  4N4I A;  1M90 U;  1SHG A;  1NYG A;  3M0U A;  2DZC A;  4WJ4 A;  3QTC A;  1I0C A;  2YUO A;  1VIF A;  3OBY A;  3G4S A;  4H2S A;  4H2W A;  2HKN A;  3EFS A;  5IHN A;  3VS6 A;  4HWS A;  4YPF A;  5KCH A;  2C8M A;  2EKO A;  1VUB A;  2SRC A;  1PCX A;  2RI5 A;  4FM4 B;  5LJ3 d;  1I5L A;  4P73 C;  2F1L A;  4DPG A;  3CCJ A;  2GFU A;  2R5M A;  1M27 C;  4J7F A;  2FZK B;  4A4K A;  1VQ9 A;  4FW2 A;  1YJW Q;  1E6H A;  1H4T A;  3VQW A;  4X9C A;  1AZE A;  3PVL A;  3H41 A;  1VQ4 Q;  3MPU B;  5GMK e;  1HJD A;  1VQ5 T;  3JV3 A;  1IGQ A;  3L1A A;  3OD1 A;  3HRI A;  4JS5 A;  4ORZ A;  5CKH A;  3HFN A;  2XIC A;  5C53 B;  4QQD A;  1SRM A;  2XKO C;  2XMF A;  2AKK A;  1JJ2 A;  5E3I A;  1TOV A;  1OX8 A;  4P71 C;  3L4G A;  4JRI A;  2GF7 A;  1VQ9 Q;  1GL5 A;  4BDY A;  2HDA A;  4ZN1 A;  2EVR A;  4EMK A;  1O9S A;  3H8Z A;  4HVW A;  1TG0 A;  2PTK A;  2AKL A;  4LUE A;  3ICA A;  4RG8 A;  4LDU A;  2RHS B;  1KQ2 A;  1D1C A;  2NUP B;  4J9C A;  1Y96 A;  4KBM B;  2H8H A;  3CC7 Q;  1ADY A;  2DL5 A;  1GXI E;  3C95 A;  2EYZ A;  4DBR A;  2ZT8 A;  2EYX A;  1BKB A;  3WXM B;  3J80 E;  3CCU Q;  3A31 A;  1ZUY A;  4TVA A;  2ZZG A;  1FWZ A;  2ZT6 A;  3JCM J;  3SWN C;  1YJ9 A;  3OW2 P;  2BE7 D;  4V2S A;  2ROT A;  4F7U A;  3VS4 A;  4C8Q D;  3QYH B;  3GIB A;  2NUT B;  4XEO A;  4XU3 A;  1YHQ T;  4FT2 A;  2QQ9 A;  1DJ7 B;  3E9F A;  5GAO r;  4F14 A;  1NJI C;  3N5B B;  4BI4 A;  2D0Q B;  5ELO A;  1MGQ A;  2VGN A;  4MZT A;  4O5V A;  1W2B P;  5GAO m;  2CZ0 B;  1UJ0 A;  2LCS A;  2J6K A;  4EMH A;  3VV0 A;  4HVV A;  1HK9 A;  1IGU A;  4XTU A;  4FCY A;  2RJF A;  2DVJ A;  2L3Q A;  1X2K A;  3RKW A;  2VYT A;  11AS A;  1YP5 A;  1EQR A;  4Y28 E;  2CSQ A;  3JRZ A;  4C5E A;  2ZIN A;  2MWO A;  5GAN h;  3M4P A;  3HXY A;  4HVC A;  4QVC A;  1KJW A;  5GAN f;  2CIM A;  3CMA T;  2KYM A;  2LX7 A;  3I56 A;  2QI2 A;  5LJ5 e;  3MHX A;  2WSE E;  2QA4 Q;  5GAM d;  4KUL A;  5J39 A;  3G71 T;  2R58 A;  3SHW A;  3BDU A;  3EAE A;  3QO5 A;  1ZSZ B;  1NYF A;  1ZBX A;  2E10 A;  2CP0 A;  5CIU A;  1XOV A;  1Q81 R;  3H0H A;  4H2X B;  1OU9 A;  3M0T A;  5GAN 8;  3HRK A;  4C5G A;  5IHI A;  5C0M A;  2DTO A;  5FU6 C;  5GAM e;  1VYU A;  1QP2 A;  2JW4 A;  1TUD A;  3FJ5 A;  1OUL A;  2DLP A;  2RHX A;  1WJS A;  4XQ3 A;  4TQD A;  1I1J A;  2DBM A;  4HCZ A;  4CH4 A;  1U06 A;  3CXC A;  4Q15 A;  1ZQ1 A;  1VQN T;  3KFU A;  2M16 A;  2K2M A;  3D7S B;  3J7A F;  3MET A;  1WDX A;  3A8G B;  1NJI R;  3PCO A;  2OAW A;  3I56 T;  1QLY A;  4PKC C;  1HXD A;  5LJ3 g;  1BCO A;  2OTL Q;  2NUZ A;  1YIJ T;  2BTT A;  2O2O A;  3CBP A;  2IPO B;  1MUZ A;  1WJQ A;  1G3S A;  3LLR A;  2K4Y A;  4HT4 A;  4EIK A;  1H92 A;  1M90 R;  5CCA A;  1EIY B;  1EZZ B;  1N8R C;  1WLE A;  5AYF A;  2VV5 A;  2HQH A;  3HXW A;  1TUG B;  4YRC A;  2IG0 A;  2ZCF B;  1JRI A;  2C0I A;  4J83 A;  4P3P A;  2XK0 A;  5GJW B;  2KRS A;  4YCW A;  1E24 A;  3INZ A;  1NBE B;  1WXB A;  2COW A;  1Q7Y C;  1Z9Q A;  4DA4 A;  1ZHI A;  4RCC A;  4C8Q E;  1NE8 A;  3P8Y A;  1VQN A;  5C6S A;  3OYA A;  4CS4 A;  4AFS C;  1BI3 A;  2L5Q A;  1H8K A;  5HCK A;  2IY5 A;  1E7O A;  3DLL A;  1G51 A;  2MAM A;  1YJW T;  1EIY A;  4ZGD B;  3V8J A;  3MP6 A;  1LYL A;  1CKA A;  1UHC A;  4J6X A;  4RTY A;  2FEI A;  2WSC E;  4KUD K;  1E1O A;  4EDU A;  2CJB A; 
#chains in the Genus database with same CATH homology
 3OMC A;  3OYE A;  2IVW A;  4BE2 A;  4PL6 A;  2XI9 A;  1WU7 A;  2XHC A;  4P71 A;  3M55 A;  1LJO A;  2VGM A;  2RHI A;  3FJP A;  2ZT5 A;  3CC2 A;  3RL6 A;  4C8Q F;  1JJC A;  2M9U A;  2GCX A;  2JN0 A;  4JUV A;  4YRJ A;  2GFA A;  2DXU A;  5GAN 5;  1K9M U;  1VQK T;  2ZIM A;  3QO8 A;  3JCM W;  4C8Q B;  5DM7 R;  3QXE B;  4ZTZ B;  2KY9 A;  2DDZ A;  4KQE A;  3OYB A;  3CCL A;  4QQ6 A;  3QJ6 A;  1OZ3 A;  2RH2 A;  4M75 C;  4YRL A;  1BI0 A;  3NEM A;  1M4Z A;  3HY1 A;  4M78 B;  4C8Q C;  2QA4 T;  4E51 A;  3GP8 A;  4NOY A;  4E7J A;  5FU6 B;  4E7H A;  1VIE A;  1X6O A;  2XDD A;  3CCE A;  1U1T A;  4BE0 A;  1YIT A;  4C0D B;  5LL6 S;  3VUB A;  3CCL T;  3QPH A;  1Y07 A;  4DOV A;  3FDR A;  3E9G A;  2ZPE B;  1QF6 A;  5CKD A;  2F5T X;  1ADJ A;  3RKY A;  3OYY A;  5KE3 A;  12AS A;  1FYF A;  3UT1 A;  1VQ7 A;  1Q81 U;  2RHY A;  5A0G A;  1NPR A;  1Y96 B;  2LT4 A;  4A4G A;  2DIQ A;  1Q82 U;  5GAM f;  2JTF A;  3UPU A;  3CCE T;  4Z02 A;  3CPW A;  2ODR C;  3P8B B;  1I4K 1;  4PJO B;  4C92 B;  3CC2 T;  4P72 A;  4TVA B;  4TTV A;  2ZR2 A;  2AHJ B;  4KT0 E;  4YCV A;  4II1 A;  1QW1 A;  4P73 A;  4XTY A;  4UP8 A;  5D6Y A;  4A4F A;  3GF5 A;  4DQ2 A;  3EFR A;  1KQS A;  4P74 C;  3JCM P;  4KR3 A;  1YCY A;  2DU5 A;  3M5A A;  3IG2 A;  1H4V B;  3VQX A;  4OGC A;  3PFS A;  2AMC A;  4TQF A;  4M75 A;  3CD6 T;  3PIP A;  3OYL A;  2EAY A;  3QJY A;  4XU2 A;  4CRI A;  1OYX A;  2XDB A;  4BDZ A;  1VQ8 A;  3C12 A;  3OQ5 A;  3MCA B;  2EWN A;  4IUV A;  5GAM h;  1Q86 U;  1D3B A;  4MML A;  1ATI A;  1PYS A;  2OTL T;  3M56 A;  3PMI A;  4MZP A;  1PSF A;  1NYQ A;  1S72 T;  2P0K A;  4JRQ A;  4P72 C;  4M7D C;  3CCV T;  3FB9 A;  4X34 A;  1B7Y A;  3RUX A;  2FB7 A;  1B70 A;  2OTJ T;  3RAC A;  2R5A A;  2V8I A;  1SER A;  3OYK A;  2ZZE A;  3QSU A;  3J81 E;  1M8V A;  4WI1 A;  4QVZ A;  1VQ7 T;  2HNI A;  3RKX A;  3CME T;  4H2U A;  5D6W A;  2CYZ B;  1P92 A;  2JNG A;  4M78 A;  4M77 G;  4MDW A;  4Q6G A;  1M9S A;  1IRE B;  3I55 T;  4O6J A;  5D6X A;  4M77 B;  3OYC A;  3L2V A;  4M7D E;  2E6Z A;  4G85 A;  3A8O B;  2OTJ A;  3M57 A;  3A5Z A;  5I21 A;  3MQZ A;  3OSS C;  1NJ6 A;  5CKB A;  3C94 A;  1WGS A;  3CEY A;  3MP8 A;  1B70 B;  4M78 F;  4B9X A;  5GAO p;  4H02 A;  3P8H A;  5LJ5 j;  4ZTU B;  1VQP A;  1X2G A;  2QHT A;  2ARS A;  3M4Y A;  3PMT A;  3CC7 T;  1N27 A;  4XTZ A;  1KMN A;  2AKW B;  2B8A A;  1VQL T;  2QHS A;  3SFM A;  3OMG A;  3LGF A;  1TH7 A;  4D6W A;  3M54 A;  3CCS A;  2LVM A;  4A54 A;  1K8A C;  4PJO E;  4ZGE B;  1YI2 A;  3HKS A;  2PVD B;  4O2D A;  3ERR A;  3HTZ A;  3HRS A;  4C0D C;  1C0A A;  3GNF B;  5A0D A;  3QDR B;  4J6Y A;  4YRS A;  2ZPB B;  3QZ5 B;  1Q82 C;  5DY9 A;  4CH5 A;  4PNO A;  2C06 A;  1KC8 C;  4LDY A;  2RJE A;  3WVE B;  4TVR A;  2ART A;  3F70 A;  3QHS A;  3HFV A;  3LWH A;  3VJP A;  3CCS T;  4C92 E;  1YJW A;  4FT4 A;  1FX7 A;  3CCR A;  4YRK A;  3DB4 A;  4CH6 A;  2PVO B;  3TEE A;  4JJN K;  1VQ4 T;  3HFZ A;  3KUF A;  2PMF A;  3OS5 A;  3CPF A;  3M53 A;  4ELY C;  3IAL A;  2P5I A;  3PIO A;  3CCQ T;  2YHT A;  5ELN A;  1KOG A;  1MHN A;  5FU7 B;  2KAF A;  2CKK A;  1UGS B;  3OSV A;  3A5Y A;  3M4Q A;  1B76 A;  1QVG A;  3BY7 A;  3CBM A;  2F5K A;  2D6F A;  2VXF A;  4YRE A;  3DLM A;  4ELZ C;  2LDM A;  4XAX B;  4EPC A;  4TWA A;  2ARU A;  3UGT A;  4BD3 A;  2QTX A;  4N4H A;  2ZPG B;  4LVK A;  2E12 A;  2ZR3 A;  1M1K U;  3OA6 A;  1H3Z A;  3GNG A;  3A74 A;  3FEO A;  2CJ9 A;  3FC3 A;  5KCO A;  4F7U F;  4YRP A;  1YJ9 T;  1QP3 A;  1H4Q A;  2DQ0 A;  3CXC S;  4IUQ A;  3SDZ A;  5DLQ E;  3C4S A;  3PGG A;  2FVU A;  4M7A F;  4M75 E;  2KK4 A;  4IUT A;  4JLI A;  4R56 A;  1AHJ B;  1U1S A;  4ZN3 A;  4UC4 A;  2WAC A;  3TRE A;  2YLB A;  3L4G B;  4MMK A;  1R8O B;  1X55 A;  5K1P A;  2XU8 A;  3TEH B;  3L2U A;  4PJO G;  4ATO A;  4YDQ A;  1KHC A;  4N0A A;  4JS4 A;  2EJ9 A;  2RJD A;  2ZPH B;  5K1X A;  3UGQ A;  3RF1 A;  2M1H A;  4EO4 A;  3UFG A;  2EQM A;  4XK8 E;  2EIF A;  2P4T A;  3GLX A;  5CQY A;  2WSF E;  5GMK i;  4BW9 A;  4DOW A;  4C0G A;  4UPA A;  4M78 D;  1SSF A;  2ZXF A;  3H6Z A;  5CK9 A;  3JB9 G;  2EQK A;  4YRQ A;  2ZGW A;  2RI3 A;  2RD1 A;  3LWI A;  2ODR D;  4OMF B;  2G4C A;  4EX5 A;  4OF1 A;  2Q5I A;  2CJA A;  3PZC A;  4J7I A;  4WF2 A;  2E65 A;  2DTI A;  1NJ1 A;  2D9T A;  3JCM f;  1Y7X A;  3IKM B;  3A8H B;  1VQ8 T;  2RHQ A;  5HK3 A;  5GAN 2;  4MDX A;  1YFT A;  3V8L A;  1UEB A;  2K2V A;  2I4M A;  4LDX A;  2X4J A;  1B8A A;  4K86 A;  4UP7 A;  2KSS A;  2K3Y A;  3RMQ A;  5GMK l;  3OYJ A;  2LC4 A;  3A8L B;  1NJ5 A;  3QYG B;  4C92 A;  1WQ7 A;  5CAI A;  5GAN e;  3FIF A;  3KBG A;  1ASZ A;  1L0W A;  5FRO A;  4A4E A;  3X26 B;  4XTW A;  1M1K C;  2DXC A;  2I4O A;  3X28 B;  3URG A;  4YTL A;  3NET A;  5L8R E;  2J3L A;  3LC0 A;  5GAM j;  4P3O A;  3CCM T;  1VQ5 A;  2K57 A;  3JCM e;  2PQW A;  4C92 F;  2O4X A;  3MP1 A;  2QDY B;  4CS3 A;  1PSE A;  3A5Z B;  2E70 A;  2OTL A;  5GAN j;  1WQW A;  3MEU A;  1NNH A;  2P0P A;  3QG1 A;  3DB3 A;  2E1H A;  5DLO A;  4VUB A;  2ALY A;  3JCM c;  1VQ9 T;  4QW2 A;  2HD0 A;  2DD5 A;  1M5Q 1;  2O01 E;  2PUK B;  4NL3 A;  3LW5 E;  4JRK A;  3VQV A;  3S6W A;  3RES A;  2QEX T;  3LGL A;  2EYQ A;  3HRU A;  4NCX A;  2EQU A;  4OVA A;  5A0L A;  5IAY A;  2X4X A;  4FL6 A;  5I2M A;  2X4Y A;  1YHQ A;  4JDS A;  2BIV A;  1KC8 U;  5CKE A;  2DZ9 A;  3OW2 A;  2ZNJ A;  4C8Q A;  1RI0 A;  3ZEH A;  1N9R A;  4L6V 5;  1M1G A;  1QE0 A;  2KVQ G;  5CO7 A;  1IL2 A;  2E3C A;  5M9O A;  4Y91 A;  3VU3 C;  2ALY B;  1KG1 A;  3PT9 A;  3OYN A;  4PJO D;  5J3B A;  4M7A D;  3G7Z A;  4YCU A;  2NLU A;  2DVE A;  4M7A E;  4YP0 A;  4UP9 A;  2RO0 A;  4M77 E;  3A7R A;  4M77 D;  4P75 C;  2VXE A;  2XTI A;  5LJ5 f;  5GAM g;  1YJN T;  1YFS A;  3HL8 A;  2AKW A;  2ZTG A;  1XQH A;  1B7Y B;  4F7U B;  3SD4 A;  1N8R U;  3X25 B;  4LNS A;  3QZ9 B;  1S72 A;  4P5N A;  3S3N A;  1VQ6 A;  1W4S A;  2JOY A;  4M7A B;  1GGM A;  5LJ3 f;  4BB7 A;  2LNV A;  1K73 C;  3CCV A;  4RKU E;  1VQL A;  3DSQ A;  2L3R A;  4OP0 A;  2Q5H A;  1RIQ A;  5CQX A;  3HFO A;  3LX7 A;  4H2V A;  4Q5W A;  3RGL A;  2RA2 A;  4ME7 A;  4ZTJ A;  3JB9 J;  3G1Z A;  3IKL A;  2QQS A;  3CCQ A;  1BBW A;  5KNN A;  4M7A C;  5LJ5 g;  1NZ9 A;  1HTT A;  1YIJ A;  4M77 A;  3QNE A;  2PME A;  4K87 A;  2Q7E A;  5GAN g;  4BAC A;  4E7I A;  2RHS A;  3OS1 A;  4PJO A;  2MWP A;  2XGT A;  2A7Y A;  5GAN 4;  3E1S A;  3JCM b;  3UH0 A;  3UDC A;  3HSB A;  4BE1 A;  4J6W A;  2LCC A;  3HPW A;  2JTM A;  3V7S A;  2VC8 A;  2I4L A;  3NEL A;  4FIB A;  1B34 B;  4M7D B;  3LSS A;  1D3B B;  1BIB A;  3QII A;  3P8V A;  4YRN A;  4F7U E;  4PG3 A;  4NL2 A;  5HK0 A;  1G3W A;  1QVF A;  5FRN A;  4YRF A;  3CC7 A;  3TCJ A;  3DKM A;  3PNW C;  3RER A;  3NTK A;  1K9M C;  2FHD A;  3TUP A;  1VQO T;  2PUO B;  1YJN A;  4E47 A;  3CD6 A;  3JB9 F;  2BUD A;  4LVL A;  4BI8 B;  4EMG A;  3HP9 A;  1VQ6 T;  4YYE A;  2KQW A;  1WPY A;  4M7D D;  3E19 A;  2DEQ A;  1OI1 A;  3JSC A;  4M78 G;  3V7R A;  3E9H A;  2DU7 A;  3OB9 A;  2ZNI A;  2PVG B;  3CBO A;  4CS2 A;  5KH6 A;  2LQ8 A;  2QXF A;  1BBU A;  4J15 A;  4C5I A;  1G3T A;  3JB9 H;  4HWR A;  1B34 A;  4M7D A;  1G5H A;  5HY6 A;  4AH6 A;  4ZIB A;  2EQJ A;  2I2L A;  1EOV A;  2Q7G A;  2H3J A;  2DXT A;  4P75 A;  3L2W A;  2L8D A;  1QVP A;  1YGB A;  1W2B A;  1VQZ A;  1NJ8 A;  1O75 A;  3NTI A;  5GAN 3;  3CME A;  4F7U G;  3GPL A;  1WNL A;  5IT9 E;  4CH3 A;  1NJI U;  2CZ7 B;  3HHT B;  3V7C A;  3X24 B;  5LJ3 j;  3LH0 A;  3O8V A;  4YRO A;  1K8A U;  3G4S T;  3VKI A;  4A53 A;  2DIG A;  4M75 D;  3MF2 A;  3VYG A;  3SWN A;  4HA8 A;  1YI2 T;  4OB3 B;  1SET A;  1NJ2 A;  4YRI A;  2P0Q A;  4J8O A;  4BUG A;  1U8R A;  3JCM V;  2F69 A;  1UGR B;  1LNX A;  5GMK m;  3UWN A;  1KMM A;  3P8T A;  4OB0 B;  4M78 C;  4PLI A;  2RK1 A;  5C51 B;  1N9S A;  1QVF S;  5KE2 A;  1VQP T;  4K88 A;  4PJO F;  5GAN 6;  1X54 A;  1EIF A;  2EFI A;  4NS5 A;  3WQZ A;  3CCU T;  2DPP B;  4M77 F;  4C0Z A;  1EFW A;  4BWA A;  4C8Q G;  4C0F A;  3OBW A;  2E5A A;  1KD1 U;  3CCM A;  4RG2 A;  2MMP A;  3ME9 A;  3W3S A;  4XU0 A;  3G71 A;  2ZZD A;  4N0A C;  3X20 B;  2DAQ A;  5LJ5 d;  2RM4 A;  4FSX A;  4L87 A;  2V8J A;  3JB9 D;  2BKD N;  5GMK j;  1UGQ B;  2KMT A;  4P3N A;  1LOJ A;  1X56 A;  2JUF A;  2QHV A;  2Y4Y A;  4KUI A;  4IUP A;  2RHZ A;  3P8D A;  1H64 1;  2YLC A;  4IUR A;  2FYK A;  4GY5 A;  2ZT7 A;  4C92 C;  4TVY A;  3CCJ T;  5GAO q;  4B9W A;  1OZ2 A;  2YRV A;  4M7A G;  3A7U A;  2E5Q A;  1X2H A;  4WJ3 M;  4RQE A;  2QQR A;  3OYH A;  3TEH A;  3CCR T;  4QVD A;  1USY A;  5HGQ A;  1ASY A;  3CMA A;  3S3M A;  2AMC B;  4N4G A;  3CPW S;  3HY0 A;  1JB0 E;  1QVG S;  1BYM A;  1EVL A;  2RB6 A;  4BY6 C;  3CC4 T;  2E41 A;  2JVV A;  2LCL A;  3ER0 A;  3LYI A;  3I7F A;  4C5H A;  5CKF A;  3SB2 A;  1I8F A;  4PHC A;  5FU7 C;  2OAU A;  2MI6 A;  2DK3 A;  4OGE A;  4C92 G;  1N6A A;  1XTD A;  5LJ3 e;  3TEG A;  2CZ6 B;  4C92 D;  3TU4 K;  1YFR A;  2MF2 A;  2Y4X A;  2ZPI B;  1WYD A;  4M75 F;  2L89 A;  4A4H A;  2QHU A;  2HQE A;  5GAN 7;  3QO3 A;  1W2B S;  2LT1 A;  4YRG A;  2ZCE A;  3A8M B;  3NFC A;  4M7D F;  4ZGJ B;  2RK2 A;  3JCM g;  3NTH A;  3CC4 A;  2XG8 D;  1YIT T;  4KR2 A;  2E6N A;  3M59 A;  5IN1 A;  1KHI A;  3HXV A;  2R57 A;  2A8E A;  4LVM A;  1JBM A;  2P0L A;  2DTH A;  1Q81 C;  3PTA A;  3KXT A;  3T9N A;  3VYH B;  4EMK B;  5LJ3 h;  2VUB A;  2DQ3 A;  1Z7M A;  4PJO C;  3OS0 A;  4HCC A;  3OW2 S;  1N9W A;  3ZFJ A;  1BI2 A;  2O4X B;  4LVJ A;  3OS2 A;  3CMQ A;  4M77 C;  3L42 A;  4M75 B;  3JAM E;  3QBY A;  2LQK A;  1FXX A;  3QUI A;  5EG2 A;  1YB3 A;  4H2Y A;  1Q86 C;  5GMK h;  2X35 A;  3MEW A;  4XU1 A;  4OB1 B;  1SRY A;  2DD4 A;  4BI3 A;  1RL2 A;  2XDP A;  3OYM A;  1NPP A;  4YRM A;  2XID A;  3BDL A;  1W66 A;  3M58 A;  1SES A;  3RMS A;  2K5I A;  4M7D G;  3JB9 I;  3E9I A;  1VQK A;  2KDS A;  3L2Z A;  3G6E A;  4ZTF A;  4XTV A;  3L2Q A;  5A2Q E;  3VUZ A;  1UB4 A;  2DKG A;  1EVK A;  1G5I A;  3BFM A;  5HKC A;  3HXZ A;  2GQV A;  2PU9 B;  1X75 C;  1VQO A;  2RHQ B;  4LDW A;  1M1F A;  4MZM A;  1G5V A;  4JLG A;  2HAX A;  2K5F A;  2EJG A;  1VQM T;  4FU6 A;  2CGH A;  1JJ2 S;  2ZIO A;  4X5O A;  1BIA A;  3R6O A;  3AHU A;  2CS7 A;  2FL7 A;  2DO3 A;  4LVI A;  2QQA A;  2QQB A;  4M75 G;  2A3L A;  5FLX E;  2DJZ A;  4YRT A;  4RMF A;  3BW1 A;  4HT8 A;  1UGP B;  4RCB A;  1K73 U;  4J5Y A;  1G3Y A;  1V29 B;  2QEX A;  3A32 A;  4HWP A;  1NYR A;  3HFZ B;  3FRN A;  3REU A;  4M7A A;  1X01 A;  4G84 A;  4X9D A;  2LRQ A;  1BI1 A;  2RHU A;  2K5L A;  5I2S A;  1M90 C;  3BJU A;  3R07 A;  1KD1 C;  2EJF A;  4CI0 C;  4IKF A;  2E64 A;  3V8K A;  1E22 A;  1E1T A;  4XTX A;  5CR2 A;  4L5G A;  2LTO A;  1XNI A;  4OLF A;  1KQ1 A;  3NEN A;  5C52 B;  2ZZF A;  5F5W A;  1WJR A;  1H4S A;  4BY6 B;  4RQF A;  1USY C;  3G6E T;  2HQX A;  4E7L A;  5GAO n;  2G3R A;  3OYD A;  2LX9 A;  2NS6 A;  2X4W A;  1Q7Y U;  3JCM d;  2C7I A;  3FLG A;  3VQY A;  1Z7N A;  1JJC B;  2EL9 A;  4HKE A;  5GAO l;  4PLL A;  3MO8 A;  3HXU A;  2ZPF B;  4RMO A;  3S3O A;  1VQM A;  3JCM h;  5FRM A;  3A7A A;  3JCM X;  4LD6 A;  3MF1 A;  3GOX A;  3I55 A;  4HCB A;  3MEA A;  3CCU A;  2Q7H A;  2XD0 A;  5GAN d;  4LD9 K;  2I4N A;  4P74 A;  3ASK A;  4HWO A;  1IZ6 A;  4XEM A;  1PYS B;  2JZ2 A;  4QQG A;  3OYG A;  4HWT A;  3RIR A;  3SWN B;  4R55 A;  4EMK C;  4JRP A;  3JCM Q;  4M78 E;  1HC7 A;  2IY5 B;  5J26 A;  2V8K A;  4YRR A;  2QA4 A;  1KQS S;  4RDX A;  3HRT A;  3MEV A;  3ZBD A;  2M0O A;  2RI2 A;  4H2T A;  1VQ4 A;  3MEY A;  3OY9 A;  4TVW A;  4L59 A;  1Y71 A;  2Y90 A;  3WVD B;  3PCO B;  3LSQ A;  4H2X A;  3REX A;  4HT9 A;  1YBY A;  2K3X A;  3OYI A;  3VBB A;  2J3M A;  2CZ1 B;  3L2R A;  5CVI A;  4IUU A;  4OB2 B;  5LJ5 h;  3M9Q A;  3QKJ A;  3QO7 A;  4GLK A;  2DXB A;  2HBP A;  4E7K A;  3HXX A;  1J5W A;  3Q1J A;  1I81 A;  2RJC A;  4LDV A;  3OYF A;  3M4G A;  4N4I A;  1M90 U;  2DZC A;  4WJ4 A;  3QTC A;  1VIF A;  3OBY A;  3G4S A;  4H2S A;  4H2W A;  3EFS A;  4HWS A;  4YPF A;  5KCH A;  2C8M A;  2EKO A;  1VUB A;  2RI5 A;  4FM4 B;  5LJ3 d;  1I5L A;  4P73 C;  4DPG A;  3CCJ A;  2GFU A;  2R5M A;  4J7F A;  4A4K A;  1VQ9 A;  1H4T A;  3VQW A;  4X9C A;  5GMK e;  1VQ5 T;  3L1A A;  3OD1 A;  3HRI A;  4JS5 A;  5CKH A;  2XIC A;  3HFN A;  5C53 B;  4QQD A;  2XKO C;  1JJ2 A;  5E3I A;  4P71 C;  3L4G A;  4JRI A;  2GF7 A;  4BDY A;  4ZN1 A;  4EMK A;  1O9S A;  3H8Z A;  3ICA A;  4RG8 A;  4LDU A;  2RHS B;  1KQ2 A;  1Y96 A;  4KBM B;  1ADY A;  1GXI E;  3C95 A;  2ZT8 A;  1BKB A;  3WXM B;  3J80 E;  3A31 A;  4TVA A;  2ZZG A;  1FWZ A;  2ZT6 A;  3JCM J;  3SWN C;  1YJ9 A;  4V2S A;  4F7U A;  4C8Q D;  3QYH B;  3GIB A;  4XEO A;  4XU3 A;  1YHQ T;  4FT2 A;  2QQ9 A;  1DJ7 B;  3E9F A;  5GAO r;  1NJI C;  3N5B B;  4BI4 A;  2D0Q B;  5ELO A;  1MGQ A;  2VGN A;  4MZT A;  4O5V A;  5GAO m;  2CZ0 B;  4EMH A;  3VV0 A;  1HK9 A;  4XTU A;  2RJF A;  3RKW A;  2VYT A;  11AS A;  1EQR A;  4Y28 E;  3JRZ A;  4C5E A;  2ZIN A;  2MWO A;  5GAN h;  3M4P A;  3HXY A;  4HVC A;  4QVC A;  5GAN f;  2CIM A;  3CMA T;  3I56 A;  2QI2 A;  5LJ5 e;  3MHX A;  2WSE E;  5GAM d;  4KUL A;  5J39 A;  3G71 T;  2R58 A;  3BDU A;  3EAE A;  3QO5 A;  1ZBX A;  2E10 A;  5CIU A;  1XOV A;  4H2X B;  5GAN 8;  3HRK A;  4C5G A;  5C0M A;  2DTO A;  5FU6 C;  5GAM e;  1QP2 A;  2RHX A;  1WJS A;  4XQ3 A;  4TQD A;  4HCZ A;  4CH4 A;  3CXC A;  4Q15 A;  1ZQ1 A;  1VQN T;  3KFU A;  2M16 A;  3J7A F;  3MET A;  3A8G B;  3PCO A;  3I56 T;  4PKC C;  1HXD A;  5LJ3 g;  1YIJ T;  3CBP A;  1WJQ A;  1G3S A;  3LLR A;  2K4Y A;  4HT4 A;  5CCA A;  1EIY B;  1N8R C;  1WLE A;  2VV5 A;  5AYF A;  3HXW A;  4YRC A;  2IG0 A;  2ZCF B;  1JRI A;  4J83 A;  4P3P A;  2XK0 A;  4YCW A;  1E24 A;  3INZ A;  1Q7Y C;  4DA4 A;  1ZHI A;  4RCC A;  4C8Q E;  1NE8 A;  3P8Y A;  1VQN A;  5C6S A;  3OYA A;  4CS4 A;  1BI3 A;  2L5Q A;  2IY5 A;  3DLL A;  1G51 A;  2MAM A;  1YJW T;  1EIY A;  4ZGD B;  3V8J A;  3MP6 A;  1LYL A;  4J6X A;  2WSC E;  4KUD K;  1E1O A;  4EDU A;  2CJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...