4XU0A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 73 that has a 2'-methyl on the ribose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 96
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu0A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu0A01
4YRQA 2DTOA 3V7CA 4RCCA 2FB7A 2VC8A 4H02A 2Y90A 2DJZA 1M8VA 4Q6GA 4Y91A 2QHTA 4M77D 4HWTA 5K1PA 4J6YA 3RL6A 4KR3A 1MGQA 4M7DG 1PYSB 1I4K1 3VQYA 5LJ3f 4C92G 4ZIBA 4M77F 2ARSA 3RKYA 3VU3C 5GANf 3JCMe 1SRYA 3QO7A 4M7AC 5LJ5h 1YGBA 2ZNIA 2AKWB 2ZR2A 2I2LA 2VXEA 3GIBA 2J3MA 4C92B 4M7AA 1EIYB 1BIAA 3TEHB 1KQ1A 3JCMb 4JUVA 4HT8A 1ASYA 1D3BB 4M7DF 5KNNA 2AMCB 4YRFA 1U1SA 4WI1A 1WQ7A 3MEYA 3QTCA 4TVAA 5LJ5d 5GAN8 3HFZB 4HT9A 1X54A 4F7UF 4H2VA 5ELNA 4PJOD 4CH6A 3SWNC 3A7RA 4YRSA 12ASA 4XU0A 5GAOl 2QHVA 1SETA 4M7DE 3SWNA 3JB9H 1QE0A 1GGMA 4C8QF 2ZIMA 1HK9A 4C92D 3JB9I 1ADJA 4PJOE 1YFSA 4YRNA 11ASA 4J15A 2DQ3A 2DZ9A 4K88A 1B76A 4F7UG 2Q7HA 4YRJA 4M7DC 2ALYA 3JCMV 3QO5A 4JRKA 1QF6A 3CMQA 3E9HA 1HC7A 1B8AA 5GANg 3UGTA 3A7AA 5GAN2 4YRLA 3HFNA 3JCMc 5LJ3g 1JBMA 2C8MA 4EO4A 4P3NA 4ZTZB 4F7UA 3NENA 1HTTA 5ELOA 3HXYA 4CS3A 3PZCA 2EJFA 4XEOA 4YROA 5GMKl 1D3BA 3VQWA 2QHSA 4M78A 5LJ5g 3JB9J 4M7AD 1E1TA 3RESA 2E64A 2IY5A 1NJ2A 4M7AE 4PJOG 3HRIA 4L87A 4F7UB 1WNLA 4M75D 4C8QG 4F7UE 5E3IA 4DPGA 4J6WA 2DQ0A 4N0AC 5C51B 2YLCA 1VQZA 3M4PA 4H2XB 3JCMJ 2ZZGA 3KFUA 1EFWA 5GANh 4EMHA 3REXA 4PJOC 3EFRA 2I4MA 2DZCA 4X9CA 4TVYA 2RD1A 1BBUA 3VBBA 3OD1A 1LYLA 4DQ2A 1EOVA 2EAYA 4C92A 3INZA 5GAOp 4YRIA 4YDQA 1EIYA 1EVLA 3P8YA 1Z7NA 4X9DA 4PNOA 3LSQA 4XEMA 1H4VB 2CJBA 2QTXA 2VXFA 2EL9A 2Q5HA 3QO3A 3JCMf 4M7AG 4UP8A 1YFTA 5GAOq 4BW9A 1YCYA 1IL2A 1EQRA 4C8QE 4P75C 2AMCA 2E65A 3REUA 2Q7EA 4C92C 2DKGA 3PCOB 4M75B 2E5AA 5LJ3d 1NYQA 3L2ZA 1I81A 1B34B 4M7AF 3RF1A 5GANj 4M78D 5GAN7 4KQEA 4TQFA 2DU7A 2P0LA 2ODRC 2XTIA 2CIMA 1YFRA 3P8VA 2ZNJA 2RHQB 2ZTGA 3RGLA 1HXDA 2G4CA 3A31A 4PG3A 1LNXA 5DY9A 3IKLA 3UH0A 1J5WA 2Q5IA 3HY1A 4RDXA 1W66A 1X01A 4YRMA 2ZGWA 3RIRA 1WU7A 4NOYA 2K57A 4HWPA 2DXTA 3JCMW 3IKMB 1KMMA 3TEHA 4MMLA 1Y96B 1I5LA 5GAMe 3HFOA 1USYA 4P3PA 1I8FA 4P73A 1SERA 4M77E 5GAOr 2RHQA 4RCBA 4XU3A 2ZCEA 4QVCA 4V2SA 4P72C 4M78B 5GMKe 1NJ6A 5GAMf 3LSSA 1L0WA 2RHSA 1FYFA 1SESA 4H2UA 3V8LA 3TUPA 3MF2A 4RQFA 5GMKi 1Y96A 4P71C 5LJ3j 4M78G 4MMKA 1PYSA 1B70A 4YREA 3EFSA 2ALYB 4J6XA 2DVEA 4WJ3M 3BFMA 4EMGA 2E3CA 2ZZFA 3ERRA 4P71A 2EJ9A 5C52B 2I4LA 5GAMg 3WQZA 1B34A 1M5Q1 2DXUA 3V7RA 3NELA 5GAN3 1H641 4EX5A 3FJPA 2RB6A 4G85A 4P74C 3QHSA 1JJCB 3QSUA 4M75C 4M77G 4M78F 4C92F 3HXZA 3VQVA 4PJOB 4XTYA 3FIFA 1X56A 2ZINA 4HWSA 4CH5A 1ADYA 1ASZA 2PMFA 3QNEA 4OP0A 4O2DA 3SWNB 2CGHA 3SB2A 3RERA 5GAMh 3IALA 4H2SA 1NJ1A 2ZIOA 4C8QC 4HA8A 4G84A 1RIQA 1EVKA 1NYRA 4YRTA 4M78E 4P3OA 3NEMA 2PMEA 2DTIA 1TH7A 2EJGA 4CS2A 2ZR3A 1WYDA 3A5ZA 4JRIA 3HFVA 2E1HA 5GAN6 1G51A 4EMKB 4K87A 1WLEA 3HTZA 2ODRD 2ZT6A 1NJ8A 2RHSB 4N0AA 4M7AB 4XTXA 2CJ9A 3I7FA 4H2TA 5GMKj 4BWAA 4XTUA 3JCMd 2FYKA 4XU2A 4CS4A 4M75F 4H2XA 5I21A 5F5WA 5HGQA 3R07A 2I4OA 3L1AA 1N9SA 1BIBA 3M4QA 2DDZA 4XTVA 4P74A 5GAN5 2YHTA 3A5YA 3BW1A 4CH4A 2Q7GA 4CH3A 3A74A 4M75G 2CJAA 4NL2A 4TWAA 3JB9D 3P8TA 5GMKh 1JJCA 4YRGA 1E1OA 3W3SA 3DSQA 1U1TA 4XU1A 3JCMh 1N9WA 2DTHA 3RUXA 3PCOA 4YRPA 4XQ3A 3JB9G 4A54A 1KOGA 4EMKC 3JCMX 1NJ5A 3V8JA 2QHUA 4M78C 3HXWA 1C0AA 3AHUA 4YRCA 4KR2A 4YCWA 3MF1A 1H4TA 1JRIA 4NCXA 4TQDA 4HVCA 5K1XA 4C8QD 1B7YB 4PHCA 4XTWA 4H2YA 5GAN4 3IG2A 5LJ5j 4J5YA 4HWRA 5GAOm 4M75E 2EWNA 2ZZEA 3M4GA 4EMKA 2E10A 2ARTA 1E22A 3G1ZA 5LJ5f 3JCMQ 4M7DA 3QUIA 3HXVA 5GAOn 3ICAA 4YCUA 4TTVA 4AH6A 3FB9A 1B7YA 2E41A 4WF2A 1X2GA 4RMFA 5LJ3h 4UP9A 1YB3A 1NNHA 5GMKm 5C53B 2RA2A 4YCVA 4M77A 3RKXA 4QVDA 4YPFA 2IY5B 3HSBA 4PJOF 4OLFA 4YRKA 1WQWA 4LNSA 3JB9F 1LOJA 3L4GB 3HRKA 2RM4A 4WJ4A 3JCMP 4Q15A 3VQXA 1H4QA 4M7DD 3LC0A 4K86A 2ZT8A 3A7UA 4XTZA 5GANe 3E9IA 2DU5A 4ZTUB 1KQ2A 4YP0A 4YYEA 1LJOA 5GAMd 4M77C 1X2HA 4C8QB 4A53A 3A32A 2ZXFA 3BY7A 3V8KA 2XGTA 3HFZA 4P75A 4UPAA 4UP7A 5GANd 4H2WA 1BBWA 3V7SA 2DEQA 3JCMg 4P72A 4PJOA 4C8QA 2P5IA 3TEGA 1WPYA 4M7DB 5LJ5e 1N9RA 1G5IA 3UFGA 3RKWA 1USYC 4TVWA 4RQEA 3PGGA 3NETA 2ZT5A 1G5HA 4M75A 1X55A 1KMNA 4C92E 1B70B 3BDUA 4M77B 2I4NA 5LJ3e 4TVAB 4YRRA 1Z7MA 4JLIA 3HY0A 3HXXA 2ARUA 2HNIA 5GAMj 2C7IA 3UGQA 1E24A 5CAIA 3BJUA 4E51A 2JN0A 4X5OA 1H4SA 4HWOA 2AKWA 1ATIA 2ZT7A 2YLBA 4NL3A 3RACA 3L4GA 3HXUA 4P73C 3QO8A 2J3LA
chains in the Genus database with same CATH superfamily
3UA6A 2L5QA 2RK2A 1WHKA 2FB7A 3QG1A 2CYZB 4BD3A 4OMLA 1ZLMA 2CUBA 4J6YA 3RL6A 4KR3A 2ESWA 1QVPA 1PYSB 5LL6S 3VQYA 2K4YA 4Y92A 2GCXA 3CC2T 1RAIB 3OY9A 1I5OB 3GBQA 3OYCA 4AG1C 4M4ZA 4M7AC 5LJ5h 4EIKA 1OPLA 7AT1B 4WCIA 1K9MC 2VXEA 2M0OA 5KCOA 1YJ9T 5CR2A 3KFVA 4M7AA 1EIYB 5FU6B 1OPKA 5HKCA 3CQTA 2AMCB 4YRFA 2I0NA 4Z88A 1U5SA 4R0KA 1ZA2B 3VYGA 3Q1JA 5LJ5d 2LQNA 3MHXA 1X54A 4PJOD 2V1RA 5GAOl 2YDLA 4ZTJA 2QHVA 1GBQA 1QLYA 3J7AF 3L2VA 1GGMA 1PRLC 4JDSA 2ZPEB 4QQGA 2ZIMA 2GFUA 2P0KA 3NFCA 5KCHA 2EYZA 4E6RA 5KYWB 2VYTA 1ADJA 4YRNA 2OTJA 1RI9A 3PE0A 1Q82U 4J15A 2DL8A 2QG9B 1AWOA 2V8IA 4BI3A 2O88A 2XD0A 4M7DC 3PFSA 2LCSA 3JCMV 3QO5A 1TG0A 3DB4A 4RKUE 2AKLA 2DBMA 4QQDA 4DBFA 5GAN2 3MEAA 3JCMc 1JBMA 1XJWB 2V8KA 1V76A 5J26A 3EFOB 2PVDB 5ELOA 3HXYA 2EIFA 2K7AA 3CEYA 1WHHA 1VQ5T 4YROA 5GMKl 1D3BA 1Q95G 3DKMA 2QHSA 3KBGA 1M2VA 4IURA 1M90U 2E64A 1YNZA 5I22A 4QQ6A 1K9MU 4L87A 1K8AC 2JM8A 1FYNA 3G6ET 4LVIA 4M75D 1VQKQ 4C8QG 4E2FB 4F7UE 1OX8A 1NJIU 1ABQA 2F1LA 2RQRA 1YJ9A 2YLCA 1NPRA 3FRNA 2J7IA 2ZZGA 3CCLT 3EG0A 3EFRA 5KE3A 4DOVA 4LUEA 1G3WA 4FU6A 3VBBA 4C92A 3N5BB 4YRIA 1FWZA 3RDVA 1BCMA 4PNOA 1X27A 3LSQA 4PFPA 2CJBA 2YRVA 2O4XA 2QGGA 3M55A 4AFUC 1OULA 2GNCA 2PUOB 3LX7A 4J83A 3CCQA 2X9HA 4UP8A 1BCOA 2MWOA 1EIFA 5GAOq 2Y4YA 1J3TA 1EQRA 2P0PA 3OYIA 1M3BA 1S1NA 1UJ0A 2M16A 1VQMA 2P0QA 2E65A 3EG9A 3REUA 2KAFA 3PCOB 4J9EA 4JLGA 2KXDA 1YJ9Q 2E5AA 2XHCA 1D1AA 3CD6A 1I81A 1O9SA 1PM3A 3CCMQ 1N8RU 3H0IA 1SKUB 4C5HA 2XK0A 4AFQC 3CPWS 2LT1A 1W1FA 4PJLA 2DU7A 4A4KA 5DM7R 3VKIA 1VQ5A 3M59A 2NLUA 3CCUQ 1PD0A 3L42A 3RGLA 1QVGS 3A31A 5DY9A 1KD1C 3HY1A 4QVZA 1ZX6A 2F2WA 3CCVA 1W66A 2J05A 1KK7A 1WU7A 1BI3A 3JCMW 2CP6A 2FZCB 2O01E 3IKMB 4PLLA 5GAMe 2YXYA 2EBPA 2ZCEA 4BY6B 4QVCA 5CKDA 2XICA 3A5ZB 5GMKe 2QQRA 2EGCA 2X4YA 3JAME 2HQEA 2RHSA 1SRLA 1BK2A 3WVEB 1QVGP 3RMQA 1SEMA 1YI2Q 2X3WD 4DBRA 5LJ3j 1TSFA 3SFMA 4BDYA 2CZ6B 4RTTA 2PVOB 2E5KA 2L3QA 3ERRA 3X26B 4ORZA 4KH1B 2I4LA 1M5Q1 2PZ1A 3EGXB 1BI2A 1WIEA 4FYVB 4G85A 4P74C 1VQOT 3QSUA 2RHXA 2W10A 2EKOA 1NLOC 1OQKA 3CCMT 2KSSA 3VQVA 2ZINA 2DJQA 2QAZA 1S72A 1GFCA 3QNEA 2CGHA 3RERA 1SF9A 5GAMh 3EFOA 4PLIA 1GL5A 2OAUA 4H2SA 1MV0B 2ZIOA 4C8QC 1K9AA 2GF7A 3NEMA 3M56A 2OTJT 2DTIA 4VUBA 2ZR3A 1N6AA 1QCOA 1X6GA 2DYBA 1YWOA 2DIQA 3LGLA 2VWFA 2ZT6A 4N0AA 1G3SA 1Q86C 4M7AB 1ARKA 4PFZA 4ZTFA 4E47A 5GMKj 1PC0A 1RI0A 3QJ6A 3HPWA 1HJDA 2KK4A 2E6ZA 2I4OA 4MZMA 3L1AA 1BIBA 2BUDA 1Q7YU 3M4QA 4XTVA 3A8MB 4IUPA 1YJWA 2L0AA 1GCQA 1X69A 3A74A 2CJAA 1K73U 2FRWA 2CREA 3W3SA 2EYYA 2XKOC 4RG2A 1TUCA 1WJRA 1VQ9Q 4O6JA 1N9WA 4QKUA 2RH2A 1M2OA 1JXOA 3JB9G 4B9XA 4A54A 1M3CA 1KHIA 1M3AA 2HZYA 2IVWA 1H4TA 4NCXA 1CSKA 1WLPB 4LVJA 2VB6A 5FROA 1R77A 3NMZC 2NUTA 2CS7A 5KYUB 4C0ZA 4C5GA 5KYXA 3L2UA 2RHUA 2DD4A 3IQLA 2QDLA 2HQHA 4M75E 3CXCP 2DVJA 2X4JA 2OX7A 4E7SA 1YI2A 2COWA 2RJFA 4M7DA 5J3BA 1ZSGA 3I56A 2FPEA 4ZN1A 1W2BP 3CCRA 1B7YA 2HKQB 4BI8B 1Y57A 4UP9A 1YB3A 1SHGA 2RJCA 1KFZA 3ZL7C 1M8MA 5IXFA 3I56Q 4OB0B 2CP0A 2DETA 2RQUA 2K3BA 3HRKA 4PFOA 3QBYA 3I5RA 3UPUA 2JT4A 2QK0A 2ZT8A 2HL3A 2ATCB 1NYFA 2EVRA 2MWPA 4XTZA 4CC4B 5GANe 1UHCA 5KH6A 1KQSP 1LJOA 2RQWA 4DEYA 4ME7A 3CC7T 5FWBA 1E6GA 3V8KA 3F70A 1YN8A 1M1GA 4UPAA 4A4HA 4OGEA 4E7KA 5KYYA 4H2WA 2KRMA 2DM1A 4CRIA 1W2BA 2A3LA 3JCMg 4LVLA 4PJOA 4C8QA 4BE1A 1IXDA 1N9RA 1K8AU 4E7IA 3QWXX 2DX1A 3RKWA 1USYC 3UFGA 3X20B 2O9VA 1M1KU 3ZFJA 1FMVA 2K5IA 2ZT5A 3OW2S 1VQ8T 2RF0A 2F5TX 5D6YA 2KBTA 1TUDA 4PJJA 1X55A 4JPBW 3M0QA 3G4SA 4M77B 2D8HA 3M0PA 4PK4A 1ACMB 1VYVA 3FEOA 3CCRT 4JLIA 3HY0A 1XQHA 4E7LA 3HXXA 2YUQA 2HNIA 3MP1A 3OYMA 5CAIA 2M02A 1TU0B 3HHTB 2RPNA 1H4SA 2Y4XA 3VS4A 1FXXA 5IH2A 4ZNXA 1EX4A 3HL8A 1AWWA 4YRQA 2RMOA 2VC8A 2Y90A 3OSVA 2DJZA 2FEIA 1UHFA 2LT4A 1M8VA 4Y91A 2E3HA 4M77D 1EFNA 2FPDA 5K1PA 1KC8U 2BTTA 1MGQA 3OS1A 3VS6A 1E7OA 5LJ3f 4ANJA 4L5GA 3VJPA 4ZGEB 3LGFA 3VU3C 5GANf 1Z9ZA 2HL5C 2LQKA 3M57A 2ZNIA 3T9NA 1YIJA 1VQPA 3KXTA 1BIAA 1ZSZC 2EW3A 2BZ8A 4HT8A 1VQMT 1ASYA 4M7DF 1QVFP 1HSQA 1ZSZA 4F17A 3P8DA 2HKNA 3MEYA 1A0NB 5HK3A 3HFZB 4E7JA 1I0CA 4H2VA 5ELNA 3SWNC 3A7RA 4YRSA 12ASA 4XU0A 3GP8A 4ZGDB 4M7DE 4KGVB 2CP3A 2E5QA 3NTKA 3GPLA 2LX7A 4OF1A 1HK9A 4TVRA 1ZA1B 3OYYA 2K5FA 2KGTA 5D6WA 2RK1A 2DEUA 4K88A 2J6OA 2KMTA 4F7UG 2Q7HA 1VQNA 2ALYA 5KYXB 4JRKA 1Q82C 1B8AA 5GANg 3UGTA 1AZGB 4A4EA 2LX9A 5LJ3g 3VS3A 2CUDA 4BUGA 3EG2A 2DO3A 3WXMB 4K11A 4OMOA 2PVGB 2EJFA 2KT8A 2X51A 4GLMA 5FU7C 3HKSA 2E12A 2VASA 3VQWA 4M78A 3UATA 3JB9J 4M7AD 1E1TA 3RESA 2IG0A 1NJ2A 2WACA 4PJOG 5CCAA 3PVQA 1SHFA 1UGSB 3P8HA 2K3XA 2LRQA 2RJDA 4N4HA 3LLRA 3UT1A 4ATOA 2VGNA 2KVQG 2WSFE 3M4PA 5AT1B 3JCMJ 5CK9A 3CBPA 2VUBA 3J81E 4EMHA 3REXA 2LCLA 3MO8A 4PJOC 1VQOQ 2DZCA 4X9CA 4TVYA 1VQ4A 2RD1A 1BBUA 1OU9A 2K2VA 3OD1A 1EOVA 1FMWA 1EIYA 2J6FA 4J9IA 2A8EA 1DJ7B 3P8YA 2K3YA 1JJ2S 3DLLA 4XEMA 4J8OA 5D7UA 4JJCA 4JZ4A 2YUOA 2JTEA 4A4GA 3MEWA 2RQTA 3VUBA 4DBQA 4M7AG 2OTLT 2OJ2A 2F69A 3CXCS 2RO0A 1G3TA 4MDWA 4O5VA 4D6WA 4FL6A 4FSXA 1K76A 1S72Q 1VQNT 3FC3A 3PMIA 5LJ3d 2K5LA 2DE0X 1IHWA 1BI1A 5GANj 2O2OA 5GAN7 4KQEA 3X28B 1KD1U 5CKHA 3M54A 1QVFS 2XTIA 3C94A 2B86A 3P8VA 2RHQB 3LW5E 2ZTGA 1IO6A 1HXDA 2G4CA 1OU8A 3S6WA 3IKLA 1UE9A 2ZCFB 1J5WA 4CC2A 4JS4A 4NOYA 4HWPA 2DXTA 1FMKA 3TEHA 4RG8A 1KQSA 2ZPBB 4P3PA 1SERA 4PJNA 1Q81C 5GAOr 2RHQA 5AYFA 2KYBA 4V2SA 2EQMA 4E7ZA 2X4WA 5GAMf 3LSSA 3AT1B 4H2UA 3QYGB 1K1ZA 3VS7A 3VS1A 1MMNA 1CKAA 2LZ6B 2HCKA 4C0DC 3NTIA 4MMKA 1UGRB 4FW2A 2LCCA 2XDBA 4LVKA 5EC7A 2MYSA 4WJ3M 4YTLA 4GLKA 4EMGA 2E3CA 5C0MA 4P71A 2JVVA 4FCYA 1B34A 3NELA 1UGVA 4EX5A 3CCVQ 3FJPA 1M1FA 4M77G 2DL4A 2A37A 4M78F 4MZPA 4C92F 1XNIA 4D8DA 2WSEE 4HWSA 4CH5A 2XIDA 2PMFA 1H3HA 4J9GA 4OP0A 1Y71A 3SB2A 3VV0A 4LD6A 2KYMA 2LDMA 2PU9B 2EQIA 2MK5A 3CD6Q 4MDXA 3CMAA 2A0FB 4G84A 1RIQA 1EVKA 3OBYA 1NYRA 4YRTA 4M78E 4P3OA 1JO8A 1JJ2A 5DLOA 3G7ZA 3OW2A 2EJGA 3G6EA 1OV3A 2LNVA 1G51A 5L8RE 4BB7A 3G71T 3HTZA 1RAAB 1RLPC 3RNJA 3E9FA 2JNGA 4PJMA 4C0GA 4LE9A 3I5SA 4M75F 4BI4A 4JRQA 4KUIA 2EGAA 5I21A 3OSSC 1UTIA 4FYXB 1SSFA 5GAN5 1RUWA 2YUNA 2Q7GA 4CH3A 4IKFA 1OYXA 1MUZA 1MNDA 4M75G 4TWAA 4BE0A 4OMMA 1VYUA 3HP9A 4JJBA 3DB3A 3EG3A 3QXEB 8ATCB 1YITT 3DSQA 2CZ7B 2DTHA 3E19A 3PCOA 1PSFA 3CCUT 1K73C 2BE7D 4EMKC 1NJ5A 4HCZA 2QHUA 3CCST 3HXWA 1C0AA 4YRCA 2ROTA 4YCWA 4KR2A 5FWCA 3M5AA 5A0LA 4TQDA 1ZUKA 4F14A 4HVCA 4C5IA 3DLMA 1CKBA 1B7YB 1UJYA 3HRTA 3VRZA 5GAOm 4RTVA 2H8HA 2H3EB 3M4GA 1YJWT 1GCQC 1E22A 3G1ZA 2DA9A 4OB2B 2NUPA 4RMFA 1PKTA 1YIJT 2RA2A 4YCVA 3VRYA 4M77A 2L2PA 2IY5B 3HSBA 1ABOA 3PIOA 1VOMA 2YWWA 2AKKA 2DD5A 1VQ5Q 5FU6C 4WJ4A 2ZAEA 1H4QA 4B9WA 2AHJB 4LXCA 3CMAQ 2L8DA 3OYNA 3E9IA 2DU5A 4ZTUB 5CQXA 2AT1B 4M77C 2K79A 2WSCE 1X2HA 4C8QB 1T3LA 2H3JA 3A32A 2LC4A 3NHNA 4HCBA 2KRNA 1YI2T 4DOWA 2HSPA 1X2QA 4P72A 1F1BB 1WA7A 5IHKA 2QEXT 5KYWA 2E4HA 3CC4T 5L23A 1D0YA 1M1KR 2DRKA 1WGSA 1JU5C 3EHQA 3EH1A 4M75A 4HXJA 3TSWA 3OMGA 1V1CA 1WI7A 3OW2P 1SRMA 2I4NA 2GTJA 4YRRA 5HK0A 2D0NA 1IRXA 2JZ2A 2O4XB 4BE2A 4HVWA 1P92A 2A7YA 5GAMj 1E24A 3SD4A 4X5OA 2MI6A 1TUGB 2MCNA 2AKWA 2QA4Q 3LH5A 2B8AA 4NL3A 4ELZC 1UFFA 4ZGJB 4L59A 3HXUA 8AT1B 4D8KA 1NE8A 3OS2A 1MV3A 3V7CA 4RCCA 4H02A 1K8AR 1AOJA 2EKHA 1VQ8Q 3OA6A 2K2MA 2HAXA 1KQSS 2QHTA 4HWTA 4KUDK 2JS2A 3UWNA 1VUBA 2ED1A 4M7DG 3QWYA 1VQ7Q 4ZIBA 3G71A 1EZZB 3RKYA 4PKCC 2R58A 3JCMe 3QO7A 3QZ5B 3M58A 2FL7A 2QGFB 1RADB 3PMTA 2ZR2A 3GIBA 2LJ3A 1Y7XA 1NBEB 2M1HA 3JCMb 2C0TA 4JUVA 4F04B 3OYLA 1D3BB 2G6FX 3H9NA 1AEYA 1U1SA 1WQ7A 3TCJA 3CPWP 4TVAA 1UGPB 4II1A 1SG5A 3TU4K 5CO7A 5IN1A 4F7UF 3CC4A 1AT1B 3C0CA 1U8RA 2VV5A 1IGQA 5HCKA 1BU1A 1G2BA 1NZ9A 4C8QF 1B07A 2JUFA 2EFIA 2FHDA 3A8HB 4PJOE 2XMFA 3JRZA 2YRDA 3REBB 2LMJA 1QWFA 1IHVA 3MPUB 1OEBA 2DZ9A 3G6EQ 1B76A 4FW1A 1WJSA 2CSIA 4IUVA 1Q7YC 2HSEB 3QZ9B 3TQ7P 3CMET 1HC7A 2C0IA 2RI5A 1WXUA 2A28A 3A7AA 4FT4A 2C8MA 2AK5A 2EYQA 4EO4A 2E3IA 2YSQA 3M0UA 4P3NA 1B7TA 3NENA 3MQZA 3CPWA 2KROA 5I2SA 1KHCA 4CS3A 1U06A 3PZCA 1C0MA 2CT3A 5CKEA 1KJWA 2QI2A 1ZUUA 3QPHA 5LJ5g 2LJ0A 3OYKA 2IY5A 4M7AE 2ENMA 3EHRA 4J9HA 2DLPA 4OVAA 4C0FA 1WFWA 3VS2A 5E3IA 2OAWA 2D1XA 3CMEQ 2DQ0A 1QW1A 3J80E 2MF2A 1AWJA 4LDXA 5C51B 4Q5WA 1PRMC 1VQNQ 1RAHB 2R5AA 3KFUA 1EFWA 5GANh 2EYWA 2LJ1A 4L6V5 3META 4RUGA 2C0OA 2D6FA 4YDQA 5GAOp 3GLXA 1XOVA 1Z7NA 4X9DA 1IB8A 4X34A 2F2XA 3G1JA 1N8RC 3QDFA 2VXFA 3I55Q 2SEMA 2Q5HA 4OMPA 2QQSA 1QCNA 1GRIA 4BW9A 1IL2A 3EGUA 2X3XD 4Y28E 3E1SA 2MMPA 4P75C 1N27A 2CKKA 2YUPA 3CCRQ 1AZEA 2GGRA 2NWMA 4LVMA 1D1CA 4M75B 3TSZA 4FYWB 3L2ZA 1PCXA 3CMEA 1VIEA 1VYTA 4FYYB 2KY9A 4LDYA 4M78D 4TQFA 5A0GA 2P0LA 3VS0A 2FRYA 2ODRC 2COYA 2ZNJA 2HDAA 2MAMA 2DL5A 1WJQA 4MZTA 1LNXA 3UH0A 1WHMA 1WX6A 1JQQA 2V26A 1G3YA 5IT9E 4YRMA 2ZGWA 1UDLA 2K57A 1KMMA 1N5ZA 3HFOA 4P73A 1I8FA 1AHJB 1GXIE 4M77E 1OI1A 4RCBA 1ZBXA 3MEVA 2PQWA 4M78B 1VQ6A 3OYJA 4AT1B 3CC7Q 1LCKA 1GBRA 1FYFA 1SESA 4IUTA 2BIVA 4RQFA 5GMKi 3EAEA 1WYXA 4P71C 4M78G 3X24B 2RHZA 4RTWA 1NLPC 4JRPA 4YREA 2HBPA 2ALYB 1JXMA 4J6XA 2CH4W 4IUUA 3O5ZA 2D8JA 1BBZA 2DK3A 1TTHB 2LTOA 2RJEA 2EJ9A 4OB1B 5GAMg 3WQZA 2DXUA 1I1JA 4GBQA 2M9UA 4OGCA 3C4SA 3CCSA 2RB6A 5FLXE 3QHSA 1AD5A 1T0JA 1YITQ 5IHIA 3HXZA 2EYXA 4PJOB 3FIFA 1X56A 1E6HA 4J9FA 1ASZA 3RBBB 3L2QA 2P4TA 1NJ1A 3ULRB 4HA8A 3S3NA 5FRMA 5D6XA 3M9QA 2SRCA 2ED0A 2PMEA 4LDUA 1TH7A 2CZ1B 1JEGA 1WYDA 3A5ZA 2EQUA 4JRIA 3VUZA 5GAN6 1XTDA 2DPPB 1WLEA 4K87A 4OMQA 4J9BA 2ODRD 3OYHA 4RMOA 3ASKA 2CJ9A 2HMAA 2P4RA 1K73R 3JCMd 2KDSA 4XU2A 3I9QA 2DL7A 2COZA 1MMAA 5KYYB 1R0BG 1N9SA 4FT2A 3MCAB 4LD9K 4P74A 3A8OB 1K0SA 2YHTA 3A5YA 4CH4A 2RQVA 3M53A 3JB9D 2KT1A 5GMKh 2ZPFB 1VQ7A 1JJCA 4YRGA 2OTJQ 2QQ9A 2NS6A 3RUXA 1JB0E 5A0DA 2YT6A 4YRPA 3JSCA 4XQ3A 4IIMA 5CVIA 3JCMX 1X43A 3EG9B 3MEUA 4EDUA 1QMCA 2ABLA 2C06A 3AHUA 1IREB 2M51A 3MF1A 1NG2A 2PTKA 4DA4A 1G83A 2L3SA 1VQ4Q 4A4FA 5J39A 1YJNA 2QASA 3NGPA 5K1XA 1K4US 1PNJA 2NUPB 3LWIA 4XTWA 2A36A 1HYOA 4RTYA 5GAN4 3IG2A 5LJ5j 2DILA 4HWRA 2E70A 3EGXA 4CC3A 1M27C 2EWNA 1SSHA 2ZZEA 2O31A 2W0ZA 5C6SA 2E10A 2ARTA 4J9CA 1TWBA 2LP5A 1YJWQ 2LNHB 1PG5B 3HXVA 4TTVA 2XU8A 3FB9A 3ME9A 4HVUA 4PL6A 4A63B 2E41A 4WF2A 3CCEA 1VQPT 1X2GA 2RI2A 1VQLT 1NNHA 1WHGA 1W6XA 2P84A 5GMKm 3H41A 1QVGA 3SEMA 4QVDA 2PUKB 1G8XA 1KG1A 2VGMA 2KRSA 2FPFA 1BB9A 4PJOF 5FW9A 4LNSA 2GFAA 1LOJA 2QA4T 3L4GB 2RM4A 2JXBA 3OYBA 2KQWA 3VQXA 4LN2A 4M7DD 4K86A 1YHQQ 2J06A 3MKDA 2JMAA 1TXQA 1AVZC 2BKDN 1KQ2A 4YYEA 3OYAA 5GAMd 4JJNK 3EG1A 4BACA 3UF4A 1UB4A 1Q7YR 2PNIA 2RI3A 4HCCA 3OYDA 2ZXFA 4EPCA 4P75A 1VQ7T 4UP7A 4C5EA 5GANd 3R6NA 4DEXA 1VQKA 3V7SA 2ZPHB 2BE9B 1D0ZA 2QEXQ 1VQ6T 2G3RA 3OYFA 3TEGA 1B3QA 1TS9A 4M7DB 5LJ5e 1K0XA 1MNEA 4QT7A 4TVWA 4RQEA 2VKNA 1ZUYA 2DBKA 1YHQT 3FJ5A 3PVLA 1G5HA 4KRTA 1ZQ1A 1YJNT 1OOTA 1KMNA 1B70B 3BDUA 3PNWC 4TVAB 1Z7MA 3CBOA 1D1BA 3GNGA 1YIJQ 2ARUA 1VQLA 1Y0MA 2C7IA 3URGA 5KYNA 3BJUA 4E51A 2JN0A 4IUQA 4AG2C 1QQJA 4LDVA 1D0XA 2KNBB 4KT0E 4LNPA 1ATIA 2ECZA 3CCET 2YLBA 3L4GA 1T0HA 1M2VB 3I55A 2DTOA 1RAFB 4HCKA 2QEXA 3OQ5A 4Q6GA 3BE3A 3HTRA 1KC8R 2JM9A 1WDXA 2DL3A 4HKEA 2EGEA 1VQPQ 1K9MR 3OS5A 1I4K1 1RLQC 3CCJT 4ZN3A 4RTXA 4C92G 3CCUA 4M77F 2ARSA 2CSQA 2RHYA 4B6MA 1SRYA 2GBQA 5IXBA 2ZPIB 1QP3A 4KGZB 1YGBA 2AKWB 3RR6A 3CPFA 2I2LA 2J3MA 4C92B 4N4IA 3CCVT 3TEHB 1KQ1A 1NPPA 3OYEA 1N8RR 5KNNA 4WI1A 1WZOA 1VQMQ 3M0RA 4J7FA 3QTCA 3L2WA 1M1KC 5KYUA 2HD0A 1YHQA 2A08A 3OS0A 5GAN8 2CT4A 4HT9A 3TREA 2GQIA 2CP5A 2GTOA 2KI7A 4CH6A 1OZ2A 2FZGB 1D09B 1SETA 3OYGA 3SWNA 1GFDA 3JB9H 1QE0A 1YFNA 1BKBA 2X4XA 1VQ6Q 4R56A 4C92D 3JB9I 4JZ3A 1Q82R 1YFSA 3CCEQ 11ASA 5FRNA 1BYMA 2DQ3A 4UC4A 2DYIA 4YRJA 1X2KA 1JJ2P 1KSWA 1UUEA 1QF6A 3CMQA 3OBWA 3E9HA 1VA7A 3I55T 3CXCA 1X6BA 4YRLA 4KBMB 3VS5A 3HFNA 4AMCA 2BZXA 2IIMA 4ZTZB 2DF6A 2DFUA 4C0DB 4F7UA 1C6VX 3ZEHA 2ZPGB 3A8LB 1HTTA 5CKBA 2FVUA 3SDZA 3G71Q 1G5VA 2EQJA 3CC4Q 4FM4B 4XEOA 2DMOA 3CCQT 2JTFA 2QQAA 1M90R 3CC2A 2O9SA 1UEBA 3CCJA 5ECAA 3HRIA 2ZZDA 4F7UB 4IIOA 1WNLA 3PIPA 1WXTA 1NJIR 1YWPA 2DXCA 3NPFA 2VVKA 4NS5A 1PHTA 4DPGA 3MP8A 4J6WA 4N0AC 2QA4A 1MHNA 2V8JA 1VQZA 2CDTA 2E6NA 4E7HA 4H2XB 4LDWA 2MPXC 2I4MA 1IGUA 1MMGA 1X6OA 3CMAT 3PT9A 1LYLA 4DQ2A 2EAYA 3INZA 4DBHA 1NEGA 1EVLA 4OMFB 3D7SB 3S3MA 4HVVA 2HEQA 1H4VB 4BY6C 2QTXA 3QYHB 3NTHA 2DERA 1HD3A 2EL9A 3OB9A 3QO3A 4HT4A 3JCMf 2FG0A 2RHIA 1Q86R 1YFTA 1YCYA 2R5MA 3C12A 2AZVA 2NYSA 4C8QE 4AFZC 2AMCA 3A8GB 2V1QA 3GNFB 3H0HA 4Z8AA 3OMCA 4KH0B 2Q7EA 4C92C 2DKGA 2NUZA 2OI3A 3RMSA 1UG1A 1NYQA 1W70A 1YBYA 1RAEB 4F16A 2D0QB 1B34B 4M7AF 3RF1A 1RACB 2AZSA 2CIMA 1YFRA 1UECA 1M30A 2CZ0B 4FIBA 1YITA 4PG3A 1YP5A 5M9OA 1VQ9A 5GJVB 3EH2A 3CCSQ 2Q5IA 4RDXA 2L3PA 1X01A 3RIRA 2DXBA 3JV3A 1YCSB 2K9GA 1VQOA 2OTLQ 2J6KA 5IAYA 4MMLA 1Y96B 1I5LA 3H8ZA 1QP2A 2KEAA 1USYA 4XU3A 1V29B 3E2UA 2GQVA 5I2MA 4P72C 2MOXA 1NJ6A 2CH4A 1L0WA 1FX7A 1PKSA 5FU7B 3GOXA 2DNUA 2CP7A 4KULA 1NJIC 1M4ZA 1R8OB 3V8LA 3TUPA 3MF2A 2QTVA 3QDRB 1AWXA 1Y96A 1W4SA 2HBWA 1PYSA 1NEBA 3U23A 1B70A 4KGXB 3EFSA 1QVFA 1Q81U 2DVEA 3BFMA 1QKWA 4N4GA 3A98A 1LPLA 2ZZFA 5C52B 2K6DA 3V7RA 5GAN3 3M0TA 1H641 3LYIA 1ZHIA 5I11A 4RTUA 1JJCB 4M75C 3LWHA 1KD1R 3R6OA 4XTYA 4QW2A 3TVTA 1ADYA 1UGQB 2JJ9A 3CCLA 4O2DA 2FZKB 3SWNB 1VQLQ 5A2QE 3CD6T 3CBMA 3IALA 1VIFA 1PD1A 2XDDA 2XG8D 1VQ4T 3TEEA 3M0SA 5IHNA 1C1AA 3UA7A 4LUDA 2X35A 1WHJA 1VQ8A 2FO0A 3CCJQ 2DAQA 2LVMA 1PSEA 1Q86U 2HQXA 4CS2A 3CC2Q 3HFVA 2E1HA 3SHWA 5KE2A 4EMKB 3A1PA 3G4ST 4CC7A 4CI0C 4RTZA 1NJ8A 2RHSB 2D9TA 3QIIA 2EPDA 4XTXA 3I7FA 4H2TA 4BWAA 2R57A 3KUFA 2F5KA 2LQ8A 4XTUA 2J3LA 2FYKA 2IPOB 3C95A 4X1VA 4CS4A 5HY6A 3FDRA 1NYGA 1H3ZA 2DIGA 2RN8A 4H2XA 5F5WA 5HGQA 3R07A 1WHLA 3E9GA 3S3OA 2M0YA 1RAGB 2BZYA 4R55A 2DDZA 1GCPA 3BW1A 4NL2A 3P8TA 3I56T 4JS5A 5GJWB 1E1OA 2XI9A 3UDCA 1U1TA 1U3OA 1X75C 3FLGA 4XU1A 3JCMh 1W2BS 1KC8C 4BDZA 2CP2A 1VQKT 1KOGA 4WTOB 1SPKA 3V8JA 4XK8E 2F2VA 4M78C 3HRSA 3H6ZA 2JMCA 3H0FA 3CCMA 3I35A 1JRIA 1QWEA 1Y07A 1KIKA 4ESRA 4ELYC 3X25B 4C8QD 4PHCA 2DRMA 5DLQE 4H2YA 3CC7A 4Z89A 2KXCA 4J5YA 1PWTA 4JJDA 3L2RA 1T3SA 3G4SQ 4EMKA 3CCQQ 1H8KA 5LJ5f 3JCMQ 2L3RA 3QUIA 5GAOn 1NM7A 2NUTB 3ICAA 4YCUA 4AH6A 3P8BB 1YJNQ 2XDPA 5LJ3h 5C53B 4OMNA 3HRUA 3M4YA 3RKXA 4YPFA 1S72T 4OLFA 4YRKA 1WQWA 1ZBJA 1QKXA 1ZSZB 3JB9F 2QYZA 3JCMP 4Q15A 3LC0A 4FSSA 3A7UA 2JTMA 3THKA 3O8VA 1MMDA 4J7IA 2KE9A 1VQ9T 4YP0A 1QCFA 3QJYA 4A53A 2Z0WA 3MJXA 2JOYA 1M90C 4Z02A 3BY7A 3GF5A 2RNAA 1M9SA 2XGTA 3HFZA 1RABB 2MIOA 3MP6A 4J9DA 1RL2A 5CQYA 1BBWA 3CCLQ 2DEQA 2QDYB 3LH0A 2P5IA 1WXBA 6AT1B 3REAB 1WPYA 1R0CB 4P5NA 5CIUA 3VYHB 1G5IA 1OZ3A 2EQKA 2QXFA 4OB3B 1I07A 1OX9A 3PGGA 4AFSC 3NETA 2L89A 3EGDA 1Z9QA 4XAXB 2ROLA 3BDLA 2JS0A 1IZ6A 3ER0A 4C92E 2AIRB 5LJ3e 5EG2A 5CKFA 9ATCB 3ZBDA 1Q81R 2KR3A 3PTAA 2JW4A 3UGQA 3WVDB 3EGDB 3QKJA 2LQWA 4HWOA 2QQBA 1H92A 2OTLA 2YRCA 2ZT7A 1O75A 3RACA 1LVKA 4P73C 1BI0A 1TOVA 3QO8A 4GY5A
chains in the Genus database with same CATH topology
2L5QA 2RK2A 2FB7A 3QG1A 2CYZB 4BD3A 4J6YA 3RL6A 4KR3A 1QVPA 1PYSB 5LL6S 3VQYA 2K4YA 2GCXA 3CC2T 3OY9A 3OYCA 4M7AC 5LJ5h 1K9MC 2VXEA 2M0OA 5KCOA 1YJ9T 5CR2A 4M7AA 1EIYB 5FU6B 5HKCA 2AMCB 4YRFA 3VYGA 3Q1JA 5LJ5d 3MHXA 1X54A 4PJOD 5GAOl 4ZTJA 2QHVA 1GGMA 3J7AF 3L2VA 4JDSA 2ZPEB 4QQGA 2ZIMA 2GFUA 2P0KA 3NFCA 5KCHA 1ADJA 2VYTA 4YRNA 2OTJA 1Q82U 4J15A 2V8IA 4BI3A 4M7DC 2XD0A 3PFSA 3JCMV 3QO5A 3DB4A 4RKUE 4QQDA 5GAN2 3MEAA 3JCMc 1JBMA 2V8KA 5J26A 2PVDB 5ELOA 3HXYA 2EIFA 3CEYA 1VQ5T 4YROA 5GMKl 1D3BA 3DKMA 2QHSA 3KBGA 4IURA 1M90U 2E64A 4QQ6A 1K9MU 4L87A 1K8AC 3G6ET 4LVIA 4M75D 4C8QG 4F7UE 1NJIU 1YJ9A 2YLCA 1NPRA 3FRNA 2ZZGA 3CCLT 3EFRA 5KE3A 4DOVA 1G3WA 4FU6A 3VBBA 4C92A 3N5BB 4YRIA 1FWZA 4PNOA 3LSQA 2CJBA 2YRVA 2O4XA 3M55A 2PUOB 3LX7A 4J83A 3CCQA 4UP8A 5GAOq 2MWOA 1EIFA 2Y4YA 1EQRA 2P0PA 3OYIA 2M16A 1VQMA 2P0QA 2E65A 3REUA 2KAFA 3PCOB 4JLGA 2E5AA 2XHCA 3CD6A 1I81A 1O9SA 1N8RU 4C5HA 2XK0A 3CPWS 2LT1A 2DU7A 4A4KA 5DM7R 3VKIA 1VQ5A 3M59A 2NLUA 3L42A 3RGLA 1QVGS 3A31A 5DY9A 1KD1C 3HY1A 4QVZA 3CCVA 1W66A 1WU7A 1BI3A 3JCMW 3IKMB 2O01E 4PLLA 5GAMe 2ZCEA 4BY6B 4QVCA 5CKDA 2XICA 3A5ZB 5GMKe 2QQRA 2X4YA 3JAME 2HQEA 2RHSA 3WVEB 3RMQA 5LJ3j 3SFMA 4BDYA 2CZ6B 2PVOB 3ERRA 3X26B 2I4LA 1M5Q1 1BI2A 4G85A 4P74C 1VQOT 3QSUA 2RHXA 2EKOA 3CCMT 2KSSA 3VQVA 2ZINA 1S72A 3QNEA 2CGHA 3RERA 5GAMh 4PLIA 2OAUA 4H2SA 2ZIOA 4C8QC 2GF7A 3NEMA 3M56A 2OTJT 2DTIA 4VUBA 2ZR3A 1N6AA 2DIQA 3LGLA 2ZT6A 4N0AA 1Q86C 1G3SA 4M7AB 4ZTFA 4E47A 5GMKj 1RI0A 3QJ6A 3HPWA 2KK4A 2E6ZA 2I4OA 4MZMA 3L1AA 1BIBA 2BUDA 1Q7YU 3M4QA 4XTVA 3A8MB 4IUPA 1YJWA 3A74A 2CJAA 1K73U 3W3SA 2XKOC 4RG2A 1WJRA 4O6JA 1N9WA 2RH2A 3JB9G 4B9XA 4A54A 1KHIA 2IVWA 1H4TA 4NCXA 4LVJA 5FROA 2CS7A 4C0ZA 4C5GA 3L2UA 2RHUA 2DD4A 4M75E 2X4JA 1YI2A 2RJFA 4M7DA 5J3BA 3I56A 4ZN1A 3CCRA 1B7YA 4BI8B 4UP9A 1YB3A 2RJCA 4OB0B 3HRKA 3QBYA 3UPUA 2ZT8A 4XTZA 2MWPA 5GANe 5KH6A 1LJOA 3CC7T 4ME7A 3V8KA 3F70A 1M1GA 4UPAA 4A4HA 4OGEA 4E7KA 4H2WA 4CRIA 1W2BA 2A3LA 3JCMg 4LVLA 4PJOA 4C8QA 4BE1A 1N9RA 1K8AU 4E7IA 3UFGA 3RKWA 1USYC 3X20B 1M1KU 3ZFJA 2K5IA 2ZT5A 3OW2S 1VQ8T 2F5TX 5D6YA 1X55A 3G4SA 4M77B 3FEOA 3CCRT 4JLIA 3HY0A 1XQHA 4E7LA 3HXXA 2HNIA 3MP1A 3OYMA 5CAIA 3HHTB 1H4SA 2Y4XA 1FXXA 3HL8A 4YRQA 2VC8A 2Y90A 3OSVA 2DJZA 2LT4A 1M8VA 4Y91A 4M77D 5K1PA 1KC8U 1MGQA 3OS1A 5LJ3f 4L5GA 3VJPA 4ZGEB 3LGFA 3VU3C 5GANf 2LQKA 3M57A 2ZNIA 3T9NA 1YIJA 1VQPA 3KXTA 1BIAA 4HT8A 1VQMT 1ASYA 4M7DF 3P8DA 3MEYA 5HK3A 3HFZB 4E7JA 4H2VA 5ELNA 3SWNC 3A7RA 4YRSA 12ASA 4XU0A 3GP8A 4ZGDB 4M7DE 2E5QA 3NTKA 3GPLA 4OF1A 1HK9A 4TVRA 3OYYA 2K5FA 5D6WA 2RK1A 4K88A 2KMTA 4F7UG 2Q7HA 1VQNA 2ALYA 4JRKA 1Q82C 1B8AA 5GANg 3UGTA 4A4EA 2LX9A 5LJ3g 4BUGA 2DO3A 3WXMB 2PVGB 2EJFA 5FU7C 3HKSA 2E12A 3VQWA 4M78A 3JB9J 4M7AD 1E1TA 3RESA 2IG0A 1NJ2A 2WACA 4PJOG 5CCAA 1UGSB 3P8HA 2K3XA 2LRQA 2RJDA 4N4HA 3LLRA 3UT1A 4ATOA 2VGNA 2KVQG 2WSFE 3M4PA 3JCMJ 5CK9A 3CBPA 2VUBA 3J81E 4EMHA 3REXA 2LCLA 3MO8A 4PJOC 2DZCA 4X9CA 4TVYA 1VQ4A 2RD1A 1BBUA 2K2VA 3OD1A 1EOVA 1EIYA 2A8EA 1DJ7B 3P8YA 2K3YA 1JJ2S 3DLLA 4XEMA 4J8OA 4A4GA 3MEWA 4M7AG 3VUBA 2OTLT 2F69A 3CXCS 2RO0A 1G3TA 4MDWA 4O5VA 4D6WA 4FL6A 4FSXA 1VQNT 3FC3A 3PMIA 5LJ3d 2K5LA 1BI1A 5GANj 5GAN7 4KQEA 3X28B 1KD1U 5CKHA 3M54A 1QVFS 2XTIA 3C94A 3P8VA 2RHQB 3LW5E 2ZTGA 1HXDA 2G4CA 3S6WA 3IKLA 2ZCFB 1J5WA 4JS4A 4NOYA 4HWPA 2DXTA 3TEHA 4RG8A 1KQSA 2ZPBB 4P3PA 1SERA 1Q81C 5GAOr 2RHQA 5AYFA 4V2SA 2EQMA 2X4WA 5GAMf 3LSSA 4H2UA 3QYGB 4C0DC 3NTIA 4MMKA 1UGRB 2LCCA 2XDBA 4LVKA 4WJ3M 4YTLA 4GLKA 4EMGA 2E3CA 5C0MA 4P71A 2JVVA 1B34A 3NELA 4EX5A 3FJPA 1M1FA 4M77G 4M78F 4MZPA 4C92F 1XNIA 2WSEE 4HWSA 4CH5A 2XIDA 2PMFA 4OP0A 1Y71A 3SB2A 3VV0A 4LD6A 2LDMA 2PU9B 4MDXA 3CMAA 4G84A 1RIQA 1EVKA 3OBYA 1NYRA 4YRTA 4M78E 4P3OA 1JJ2A 5DLOA 3G7ZA 3OW2A 2EJGA 3G6EA 2LNVA 1G51A 5L8RE 4BB7A 3G71T 3HTZA 3E9FA 2JNGA 4C0GA 4M75F 4BI4A 4JRQA 4KUIA 5I21A 3OSSC 1SSFA 5GAN5 2Q7GA 4CH3A 4IKFA 1OYXA 4M75G 4TWAA 4BE0A 3HP9A 3DB3A 3QXEB 1YITT 3DSQA 2CZ7B 2DTHA 3E19A 3PCOA 1PSFA 3CCUT 1K73C 4EMKC 1NJ5A 4HCZA 2QHUA 3CCST 3HXWA 1C0AA 4YRCA 4KR2A 4YCWA 3M5AA 5A0LA 4TQDA 4HVCA 4C5IA 3DLMA 1B7YB 3HRTA 5GAOm 3M4GA 1YJWT 1E22A 3G1ZA 4OB2B 4RMFA 1YIJT 2RA2A 4YCVA 4M77A 2IY5B 3HSBA 3PIOA 2DD5A 5FU6C 4WJ4A 1H4QA 4B9WA 2AHJB 2L8DA 3OYNA 3E9IA 2DU5A 4ZTUB 5CQXA 4M77C 2WSCE 1X2HA 4C8QB 2H3JA 3A32A 2LC4A 4HCBA 1YI2T 4DOWA 4P72A 2QEXT 3CC4T 1WGSA 4M75A 3OMGA 2I4NA 4YRRA 5HK0A 2JZ2A 2O4XB 4BE2A 1P92A 2A7YA 5GAMj 1E24A 3SD4A 4X5OA 2MI6A 2AKWA 2B8AA 4NL3A 4ELZC 4ZGJB 4L59A 3HXUA 1NE8A 3OS2A 3V7CA 4RCCA 4H02A 3OA6A 2HAXA 1KQSS 2QHTA 4HWTA 4KUDK 3UWNA 1VUBA 4M7DG 4ZIBA 3G71A 3RKYA 4PKCC 2R58A 3JCMe 3QO7A 3QZ5B 3M58A 2FL7A 2ZR2A 3PMTA 3GIBA 1Y7XA 2M1HA 3JCMb 4JUVA 3OYLA 1D3BB 1U1SA 1WQ7A 3TCJA 4TVAA 1UGPB 4II1A 3TU4K 5CO7A 5IN1A 4F7UF 3CC4A 1U8RA 2VV5A 1NZ9A 4C8QF 2JUFA 2EFIA 2FHDA 3A8HB 4PJOE 3JRZA 2DZ9A 1B76A 1WJSA 4IUVA 1Q7YC 3QZ9B 3CMET 1HC7A 2RI5A 3A7AA 4FT4A 2C8MA 2EYQA 4EO4A 4P3NA 3NENA 3MQZA 3CPWA 5I2SA 1KHCA 4CS3A 3PZCA 5CKEA 2QI2A 3QPHA 5LJ5g 3OYKA 2IY5A 4M7AE 4OVAA 4C0FA 5E3IA 2DQ0A 1QW1A 3J80E 2MF2A 4LDXA 5C51B 4Q5WA 2R5AA 3KFUA 1EFWA 5GANh 4L6V5 3META 2D6FA 4YDQA 5GAOp 3GLXA 1XOVA 1Z7NA 4X9DA 4X34A 1N8RC 2VXFA 2Q5HA 2QQSA 4BW9A 1IL2A 4Y28E 3E1SA 2MMPA 4P75C 1N27A 2CKKA 4LVMA 4M75B 3L2ZA 3CMEA 1VIEA 2KY9A 4LDYA 4M78D 4TQFA 5A0GA 2P0LA 2ODRC 2ZNJA 2MAMA 1WJQA 4MZTA 1LNXA 3UH0A 1G3YA 5IT9E 4YRMA 2ZGWA 2K57A 1KMMA 3HFOA 4P73A 1I8FA 1AHJB 1GXIE 4M77E 1OI1A 4RCBA 1ZBXA 3MEVA 2PQWA 4M78B 1VQ6A 3OYJA 1FYFA 1SESA 4IUTA 2BIVA 4RQFA 5GMKi 3EAEA 4P71C 4M78G 3X24B 2RHZA 4JRPA 4YREA 2HBPA 2ALYB 4J6XA 4IUUA 2DK3A 2LTOA 2RJEA 2EJ9A 4OB1B 5GAMg 3WQZA 2DXUA 2M9UA 4OGCA 3C4SA 3CCSA 2RB6A 5FLXE 3QHSA 3HXZA 4PJOB 3FIFA 1X56A 1ASZA 3L2QA 2P4TA 1NJ1A 4HA8A 3S3NA 5FRMA 5D6XA 3M9QA 2PMEA 4LDUA 1TH7A 2CZ1B 1WYDA 3A5ZA 2EQUA 4JRIA 3VUZA 5GAN6 1XTDA 2DPPB 1WLEA 4K87A 2ODRD 3OYHA 4RMOA 3ASKA 2CJ9A 3JCMd 2KDSA 4XU2A 1N9SA 4FT2A 3MCAB 4LD9K 4P74A 3A8OB 2YHTA 3A5YA 4CH4A 3M53A 3JB9D 5GMKh 2ZPFB 1VQ7A 1JJCA 4YRGA 2QQ9A 2NS6A 3RUXA 1JB0E 5A0DA 4YRPA 3JSCA 4XQ3A 5CVIA 3JCMX 3MEUA 4EDUA 2C06A 3AHUA 1IREB 3MF1A 4DA4A 4A4FA 5J39A 1YJNA 5K1XA 3LWIA 4XTWA 5GAN4 3IG2A 5LJ5j 4HWRA 2E70A 2EWNA 2ZZEA 5C6SA 2E10A 2ARTA 3HXVA 4TTVA 2XU8A 3FB9A 3ME9A 4PL6A 3CCEA 1VQPT 2E41A 4WF2A 1X2GA 2RI2A 1VQLT 1NNHA 5GMKm 1QVGA 4QVDA 2PUKB 1KG1A 2VGMA 4PJOF 4LNSA 2GFAA 1LOJA 2QA4T 3L4GB 2RM4A 3OYBA 2KQWA 3VQXA 4M7DD 4K86A 2BKDN 1KQ2A 4YYEA 3OYAA 5GAMd 4JJNK 4BACA 1UB4A 2RI3A 4HCCA 3OYDA 2ZXFA 4EPCA 4P75A 1VQ7T 4UP7A 4C5EA 5GANd 1VQKA 3V7SA 2ZPHB 1VQ6T 2G3RA 3OYFA 3TEGA 4M7DB 5LJ5e 4TVWA 4RQEA 1YHQT 1G5HA 1ZQ1A 1YJNT 1KMNA 1B70B 3BDUA 3PNWC 4TVAB 1Z7MA 3CBOA 3GNGA 2ARUA 1VQLA 2C7IA 3URGA 4E51A 3BJUA 2JN0A 4IUQA 4LDVA 4KT0E 1ATIA 3CCET 2YLBA 3L4GA 3I55A 2DTOA 2QEXA 3OQ5A 4Q6GA 4HKEA 3OS5A 1I4K1 3CCJT 4ZN3A 4C92G 3CCUA 4M77F 2ARSA 2RHYA 1SRYA 2ZPIB 1QP3A 1YGBA 2AKWB 3CPFA 2I2LA 2J3MA 4C92B 4N4IA 3CCVT 3TEHB 1KQ1A 1NPPA 3OYEA 5KNNA 4WI1A 4J7FA 3QTCA 3L2WA 1M1KC 2HD0A 1YHQA 3OS0A 5GAN8 4HT9A 3TREA 4CH6A 1OZ2A 1SETA 3OYGA 3SWNA 3JB9H 1QE0A 1BKBA 2X4XA 4R56A 4C92D 3JB9I 1YFSA 11ASA 5FRNA 1BYMA 2DQ3A 4UC4A 4YRJA 1QF6A 3CMQA 3OBWA 3E9HA 3I55T 3CXCA 4YRLA 4KBMB 3HFNA 4ZTZB 4C0DB 4F7UA 3ZEHA 2ZPGB 3A8LB 1HTTA 5CKBA 2FVUA 3SDZA 1G5VA 2EQJA 4FM4B 4XEOA 3CCQT 2JTFA 2QQAA 3CC2A 1UEBA 3CCJA 3HRIA 2ZZDA 4F7UB 1WNLA 3PIPA 2DXCA 4NS5A 4DPGA 3MP8A 4J6WA 4N0AC 2QA4A 1MHNA 2V8JA 1VQZA 2E6NA 4E7HA 4H2XB 4LDWA 2I4MA 1X6OA 3CMAT 3PT9A 1LYLA 4DQ2A 2EAYA 3INZA 1EVLA 4OMFB 3S3MA 1H4VB 4BY6C 2QTXA 3QYHB 3NTHA 2EL9A 3OB9A 3QO3A 4HT4A 3JCMf 2RHIA 1YFTA 1YCYA 2R5MA 3C12A 4C8QE 2AMCA 3A8GB 3GNFB 3OMCA 2Q7EA 4C92C 2DKGA 3RMSA 1NYQA 1YBYA 2D0QB 1B34B 4M7AF 3RF1A 2CIMA 1YFRA 2CZ0B 4FIBA 1YITA 4PG3A 5M9OA 1VQ9A 2Q5IA 4RDXA 1X01A 3RIRA 2DXBA 1VQOA 5IAYA 4MMLA 1Y96B 1I5LA 1USYA 3H8ZA 1QP2A 4XU3A 1V29B 2GQVA 5I2MA 4P72C 1NJ6A 1L0WA 1FX7A 5FU7B 3GOXA 4KULA 1NJIC 1M4ZA 1R8OB 3V8LA 3TUPA 3MF2A 3QDRB 1Y96A 1W4SA 1PYSA 1B70A 3EFSA 1QVFA 1Q81U 2DVEA 3BFMA 4N4GA 2ZZFA 5C52B 3V7RA 5GAN3 1H641 3LYIA 1ZHIA 1JJCB 4M75C 3LWHA 3R6OA 4XTYA 4QW2A 1ADYA 1UGQB 3CCLA 4O2DA 3SWNB 5A2QE 3CD6T 3CBMA 3IALA 1VIFA 2XDDA 2XG8D 1VQ4T 3TEEA 2X35A 1VQ8A 2DAQA 2LVMA 1PSEA 1Q86U 2HQXA 4CS2A 3HFVA 2E1HA 5KE2A 4EMKB 3G4ST 4CI0C 1NJ8A 2RHSB 2D9TA 3QIIA 4XTXA 3I7FA 4H2TA 4BWAA 2R57A 3KUFA 2F5KA 2LQ8A 4XTUA 2J3LA 2FYKA 3C95A 4CS4A 5HY6A 3FDRA 1H3ZA 2DIGA 4H2XA 5F5WA 5HGQA 3R07A 3E9GA 3S3OA 4R55A 2DDZA 3BW1A 4NL2A 3P8TA 3I56T 4JS5A 1E1OA 2XI9A 3UDCA 1U1TA 1X75C 3FLGA 4XU1A 3JCMh 1W2BS 1KC8C 4BDZA 1VQKT 1KOGA 3V8JA 4XK8E 4M78C 3HRSA 3H6ZA 3CCMA 1JRIA 1Y07A 4ELYC 3X25B 4C8QD 4PHCA 5DLQE 4H2YA 3CC7A 4J5YA 3L2RA 4EMKA 5LJ5f 3JCMQ 2L3RA 3QUIA 5GAOn 3ICAA 4YCUA 4AH6A 3P8BB 2XDPA 5LJ3h 5C53B 3HRUA 3M4YA 3RKXA 4YPFA 1S72T 4OLFA 4YRKA 1WQWA 3JB9F 3JCMP 4Q15A 3LC0A 3A7UA 2JTMA 3O8VA 4J7IA 1VQ9T 4YP0A 3QJYA 4A53A 2JOYA 1M90C 4Z02A 3BY7A 3GF5A 1M9SA 2XGTA 3HFZA 3MP6A 1RL2A 5CQYA 1BBWA 2DEQA 2QDYB 3LH0A 2P5IA 1WPYA 4P5NA 5CIUA 3VYHB 1G5IA 1OZ3A 2EQKA 2QXFA 4OB3B 3PGGA 3NETA 2L89A 4XAXB 3BDLA 1IZ6A 3ER0A 4C92E 5LJ3e 5EG2A 5CKFA 3ZBDA 3PTAA 3UGQA 3WVDB 3QKJA 4HWOA 2QQBA 2OTLA 2ZT7A 1O75A 3RACA 4P73C 1BI0A 3QO8A 4GY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRQ A;  2DTO A;  3V7C A;  4RCC A;  2FB7 A;  2VC8 A;  4H02 A;  2Y90 A;  2DJZ A;  1M8V A;  4Q6G A;  4Y91 A;  2QHT A;  4M77 D;  4HWT A;  5K1P A;  4J6Y A;  3RL6 A;  4KR3 A;  1MGQ A;  4M7D G;  1PYS B;  1I4K 1;  3VQY A;  5LJ3 f;  4C92 G;  4ZIB A;  4M77 F;  2ARS A;  3RKY A;  3VU3 C;  5GAN f;  3JCM e;  1SRY A;  3QO7 A;  4M7A C;  5LJ5 h;  1YGB A;  2ZNI A;  2AKW B;  2ZR2 A;  2I2L A;  2VXE A;  3GIB A;  2J3M A;  4C92 B;  4M7A A;  1EIY B;  1BIA A;  3TEH B;  1KQ1 A;  3JCM b;  4JUV A;  4HT8 A;  1ASY A;  1D3B B;  4M7D F;  5KNN A;  2AMC B;  4YRF A;  1U1S A;  4WI1 A;  1WQ7 A;  3MEY A;  3QTC A;  4TVA A;  5LJ5 d;  5GAN 8;  3HFZ B;  4HT9 A;  1X54 A;  4F7U F;  4H2V A;  5ELN A;  4PJO D;  4CH6 A;  3SWN C;  3A7R A;  4YRS A;  12AS A;  4XU0 A;  5GAO l;  2QHV A;  1SET A;  4M7D E;  3SWN A;  3JB9 H;  1QE0 A;  1GGM A;  4C8Q F;  2ZIM A;  1HK9 A;  4C92 D;  3JB9 I;  1ADJ A;  4PJO E;  1YFS A;  4YRN A;  11AS A;  4J15 A;  2DQ3 A;  2DZ9 A;  4K88 A;  1B76 A;  4F7U G;  2Q7H A;  4YRJ A;  4M7D C;  2ALY A;  3JCM V;  3QO5 A;  4JRK A;  1QF6 A;  3CMQ A;  3E9H A;  1HC7 A;  1B8A A;  5GAN g;  3UGT A;  3A7A A;  5GAN 2;  4YRL A;  3HFN A;  3JCM c;  5LJ3 g;  1JBM A;  2C8M A;  4EO4 A;  4P3N A;  4ZTZ B;  4F7U A;  3NEN A;  1HTT A;  5ELO A;  3HXY A;  4CS3 A;  3PZC A;  2EJF A;  4XEO A;  4YRO A;  5GMK l;  1D3B A;  3VQW A;  2QHS A;  4M78 A;  5LJ5 g;  3JB9 J;  4M7A D;  1E1T A;  3RES A;  2E64 A;  2IY5 A;  1NJ2 A;  4M7A E;  4PJO G;  3HRI A;  4L87 A;  4F7U B;  1WNL A;  4M75 D;  4C8Q G;  4F7U E;  5E3I A;  4DPG A;  4J6W A;  2DQ0 A;  4N0A C;  5C51 B;  2YLC A;  1VQZ A;  3M4P A;  4H2X B;  3JCM J;  2ZZG A;  3KFU A;  1EFW A;  5GAN h;  4EMH A;  3REX A;  4PJO C;  3EFR A;  2I4M A;  2DZC A;  4X9C A;  4TVY A;  2RD1 A;  1BBU A;  3VBB A;  3OD1 A;  1LYL A;  4DQ2 A;  1EOV A;  2EAY A;  4C92 A;  3INZ A;  5GAO p;  4YRI A;  4YDQ A;  1EIY A;  1EVL A;  3P8Y A;  1Z7N A;  4X9D A;  4PNO A;  3LSQ A;  4XEM A;  1H4V B;  2CJB A;  2QTX A;  2VXF A;  2EL9 A;  2Q5H A;  3QO3 A;  3JCM f;  4M7A G;  4UP8 A;  1YFT A;  5GAO q;  4BW9 A;  1YCY A;  1IL2 A;  1EQR A;  4C8Q E;  4P75 C;  2AMC A;  2E65 A;  3REU A;  2Q7E A;  4C92 C;  2DKG A;  3PCO B;  4M75 B;  2E5A A;  5LJ3 d;  1NYQ A;  3L2Z A;  1I81 A;  1B34 B;  4M7A F;  3RF1 A;  5GAN j;  4M78 D;  5GAN 7;  4KQE A;  4TQF A;  2DU7 A;  2P0L A;  2ODR C;  2XTI A;  2CIM A;  1YFR A;  3P8V A;  2ZNJ A;  2RHQ B;  2ZTG A;  3RGL A;  1HXD A;  2G4C A;  3A31 A;  4PG3 A;  1LNX A;  5DY9 A;  3IKL A;  3UH0 A;  1J5W A;  2Q5I A;  3HY1 A;  4RDX A;  1W66 A;  1X01 A;  4YRM A;  2ZGW A;  3RIR A;  1WU7 A;  4NOY A;  2K57 A;  4HWP A;  2DXT A;  3JCM W;  3IKM B;  1KMM A;  3TEH A;  4MML A;  1Y96 B;  1I5L A;  5GAM e;  3HFO A;  1USY A;  4P3P A;  1I8F A;  4P73 A;  1SER A;  4M77 E;  5GAO r;  2RHQ A;  4RCB A;  4XU3 A;  2ZCE A;  4QVC A;  4V2S A;  4P72 C;  4M78 B;  5GMK e;  1NJ6 A;  5GAM f;  3LSS A;  1L0W A;  2RHS A;  1FYF A;  1SES A;  4H2U A;  3V8L A;  3TUP A;  3MF2 A;  4RQF A;  5GMK i;  1Y96 A;  4P71 C;  5LJ3 j;  4M78 G;  4MMK A;  1PYS A;  1B70 A;  4YRE A;  3EFS A;  2ALY B;  4J6X A;  2DVE A;  4WJ3 M;  3BFM A;  4EMG A;  2E3C A;  2ZZF A;  3ERR A;  4P71 A;  2EJ9 A;  5C52 B;  2I4L A;  5GAM g;  3WQZ A;  1B34 A;  1M5Q 1;  2DXU A;  3V7R A;  3NEL A;  5GAN 3;  1H64 1;  4EX5 A;  3FJP A;  2RB6 A;  4G85 A;  4P74 C;  3QHS A;  1JJC B;  3QSU A;  4M75 C;  4M77 G;  4M78 F;  4C92 F;  3HXZ A;  3VQV A;  4PJO B;  4XTY A;  3FIF A;  1X56 A;  2ZIN A;  4HWS A;  4CH5 A;  1ADY A;  1ASZ A;  2PMF A;  3QNE A;  4OP0 A;  4O2D A;  3SWN B;  2CGH A;  3SB2 A;  3RER A;  5GAM h;  3IAL A;  4H2S A;  1NJ1 A;  2ZIO A;  4C8Q C;  4HA8 A;  4G84 A;  1RIQ A;  1EVK A;  1NYR A;  4YRT A;  4M78 E;  4P3O A;  3NEM A;  2PME A;  2DTI A;  1TH7 A;  2EJG A;  4CS2 A;  2ZR3 A;  1WYD A;  3A5Z A;  4JRI A;  3HFV A;  2E1H A;  5GAN 6;  1G51 A;  4EMK B;  4K87 A;  1WLE A;  3HTZ A;  2ODR D;  2ZT6 A;  1NJ8 A;  2RHS B;  4N0A A;  4M7A B;  4XTX A;  2CJ9 A;  3I7F A;  4H2T A;  5GMK j;  4BWA A;  4XTU A;  3JCM d;  2FYK A;  4XU2 A;  4CS4 A;  4M75 F;  4H2X A;  5I21 A;  5F5W A;  5HGQ A;  3R07 A;  2I4O A;  3L1A A;  1N9S A;  1BIB A;  3M4Q A;  2DDZ A;  4XTV A;  4P74 A;  5GAN 5;  2YHT A;  3A5Y A;  3BW1 A;  4CH4 A;  2Q7G A;  4CH3 A;  3A74 A;  4M75 G;  2CJA A;  4NL2 A;  4TWA A;  3JB9 D;  3P8T A;  5GMK h;  1JJC A;  4YRG A;  1E1O A;  3W3S A;  3DSQ A;  1U1T A;  4XU1 A;  3JCM h;  1N9W A;  2DTH A;  3RUX A;  3PCO A;  4YRP A;  4XQ3 A;  3JB9 G;  4A54 A;  1KOG A;  4EMK C;  3JCM X;  1NJ5 A;  3V8J A;  2QHU A;  4M78 C;  3HXW A;  1C0A A;  3AHU A;  4YRC A;  4KR2 A;  4YCW A;  3MF1 A;  1H4T A;  1JRI A;  4NCX A;  4TQD A;  4HVC A;  5K1X A;  4C8Q D;  1B7Y B;  4PHC A;  4XTW A;  4H2Y A;  5GAN 4;  3IG2 A;  5LJ5 j;  4J5Y A;  4HWR A;  5GAO m;  4M75 E;  2EWN A;  2ZZE A;  3M4G A;  4EMK A;  2E10 A;  2ART A;  1E22 A;  3G1Z A;  5LJ5 f;  3JCM Q;  4M7D A;  3QUI A;  3HXV A;  5GAO n;  3ICA A;  4YCU A;  4TTV A;  4AH6 A;  3FB9 A;  1B7Y A;  2E41 A;  4WF2 A;  1X2G A;  4RMF A;  5LJ3 h;  4UP9 A;  1YB3 A;  1NNH A;  5GMK m;  5C53 B;  2RA2 A;  4YCV A;  4M77 A;  3RKX A;  4QVD A;  4YPF A;  2IY5 B;  3HSB A;  4PJO F;  4OLF A;  4YRK A;  1WQW A;  4LNS A;  3JB9 F;  1LOJ A;  3L4G B;  3HRK A;  2RM4 A;  4WJ4 A;  3JCM P;  4Q15 A;  3VQX A;  1H4Q A;  4M7D D;  3LC0 A;  4K86 A;  2ZT8 A;  3A7U A;  4XTZ A;  5GAN e;  3E9I A;  2DU5 A;  4ZTU B;  1KQ2 A;  4YP0 A;  4YYE A;  1LJO A;  5GAM d;  4M77 C;  1X2H A;  4C8Q B;  4A53 A;  3A32 A;  2ZXF A;  3BY7 A;  3V8K A;  2XGT A;  3HFZ A;  4P75 A;  4UPA A;  4UP7 A;  5GAN d;  4H2W A;  1BBW A;  3V7S A;  2DEQ A;  3JCM g;  4P72 A;  4PJO A;  4C8Q A;  2P5I A;  3TEG A;  1WPY A;  4M7D B;  5LJ5 e;  1N9R A;  1G5I A;  3UFG A;  3RKW A;  1USY C;  4TVW A;  4RQE A;  3PGG A;  3NET A;  2ZT5 A;  1G5H A;  4M75 A;  1X55 A;  1KMN A;  4C92 E;  1B70 B;  3BDU A;  4M77 B;  2I4N A;  5LJ3 e;  4TVA B;  4YRR A;  1Z7M A;  4JLI A;  3HY0 A;  3HXX A;  2ARU A;  2HNI A;  5GAM j;  2C7I A;  3UGQ A;  1E24 A;  5CAI A;  3BJU A;  4E51 A;  2JN0 A;  4X5O A;  1H4S A;  4HWO A;  2AKW A;  1ATI A;  2ZT7 A;  2YLB A;  4NL3 A;  3RAC A;  3L4G A;  3HXU A;  4P73 C;  3QO8 A;  2J3L A; 
#chains in the Genus database with same CATH topology
 3UA6 A;  2L5Q A;  2RK2 A;  1WHK A;  2FB7 A;  3QG1 A;  2CYZ B;  4BD3 A;  4OML A;  1ZLM A;  2CUB A;  4J6Y A;  3RL6 A;  4KR3 A;  2ESW A;  1QVP A;  1PYS B;  5LL6 S;  3VQY A;  2K4Y A;  4Y92 A;  2GCX A;  3CC2 T;  1RAI B;  3OY9 A;  1I5O B;  3GBQ A;  3OYC A;  4AG1 C;  4M4Z A;  4M7A C;  5LJ5 h;  4EIK A;  1OPL A;  7AT1 B;  4WCI A;  1K9M C;  2VXE A;  2M0O A;  5KCO A;  1YJ9 T;  5CR2 A;  3KFV A;  4M7A A;  1EIY B;  5FU6 B;  1OPK A;  5HKC A;  3CQT A;  2AMC B;  4YRF A;  2I0N A;  4Z88 A;  1U5S A;  4R0K A;  1ZA2 B;  3VYG A;  3Q1J A;  5LJ5 d;  2LQN A;  3MHX A;  1X54 A;  4PJO D;  2V1R A;  5GAO l;  2YDL A;  4ZTJ A;  2QHV A;  1GBQ A;  1QLY A;  3J7A F;  3L2V A;  1GGM A;  1PRL C;  4JDS A;  2ZPE B;  4QQG A;  2ZIM A;  2GFU A;  2P0K A;  3NFC A;  5KCH A;  2EYZ A;  4E6R A;  5KYW B;  2VYT A;  1ADJ A;  4YRN A;  2OTJ A;  1RI9 A;  3PE0 A;  1Q82 U;  4J15 A;  2DL8 A;  2QG9 B;  1AWO A;  2V8I A;  4BI3 A;  2O88 A;  2XD0 A;  4M7D C;  3PFS A;  2LCS A;  3JCM V;  3QO5 A;  1TG0 A;  3DB4 A;  4RKU E;  2AKL A;  2DBM A;  4QQD A;  4DBF A;  5GAN 2;  3MEA A;  3JCM c;  1JBM A;  1XJW B;  2V8K A;  1V76 A;  5J26 A;  3EFO B;  2PVD B;  5ELO A;  3HXY A;  2EIF A;  2K7A A;  3CEY A;  1WHH A;  1VQ5 T;  4YRO A;  5GMK l;  1D3B A;  1Q95 G;  3DKM A;  2QHS A;  3KBG A;  1M2V A;  4IUR A;  1M90 U;  2E64 A;  1YNZ A;  5I22 A;  4QQ6 A;  1K9M U;  4L87 A;  1K8A C;  2JM8 A;  1FYN A;  3G6E T;  4LVI A;  4M75 D;  1VQK Q;  4C8Q G;  4E2F B;  4F7U E;  1OX8 A;  1NJI U;  1ABQ A;  2F1L A;  2RQR A;  1YJ9 A;  2YLC A;  1NPR A;  3FRN A;  2J7I A;  2ZZG A;  3CCL T;  3EG0 A;  3EFR A;  5KE3 A;  4DOV A;  4LUE A;  1G3W A;  4FU6 A;  3VBB A;  4C92 A;  3N5B B;  4YRI A;  1FWZ A;  3RDV A;  1BCM A;  4PNO A;  1X27 A;  3LSQ A;  4PFP A;  2CJB A;  2YRV A;  2O4X A;  2QGG A;  3M55 A;  4AFU C;  1OUL A;  2GNC A;  2PUO B;  3LX7 A;  4J83 A;  3CCQ A;  2X9H A;  4UP8 A;  1BCO A;  2MWO A;  1EIF A;  5GAO q;  2Y4Y A;  1J3T A;  1EQR A;  2P0P A;  3OYI A;  1M3B A;  1S1N A;  1UJ0 A;  2M16 A;  1VQM A;  2P0Q A;  2E65 A;  3EG9 A;  3REU A;  2KAF A;  3PCO B;  4J9E A;  4JLG A;  2KXD A;  1YJ9 Q;  2E5A A;  2XHC A;  1D1A A;  3CD6 A;  1I81 A;  1O9S A;  1PM3 A;  3CCM Q;  1N8R U;  3H0I A;  1SKU B;  4C5H A;  2XK0 A;  4AFQ C;  3CPW S;  2LT1 A;  1W1F A;  4PJL A;  2DU7 A;  4A4K A;  5DM7 R;  3VKI A;  1VQ5 A;  3M59 A;  2NLU A;  3CCU Q;  1PD0 A;  3L42 A;  3RGL A;  1QVG S;  3A31 A;  5DY9 A;  1KD1 C;  3HY1 A;  4QVZ A;  1ZX6 A;  2F2W A;  3CCV A;  1W66 A;  2J05 A;  1KK7 A;  1WU7 A;  1BI3 A;  3JCM W;  2CP6 A;  2FZC B;  2O01 E;  3IKM B;  4PLL A;  5GAM e;  2YXY A;  2EBP A;  2ZCE A;  4BY6 B;  4QVC A;  5CKD A;  2XIC A;  3A5Z B;  5GMK e;  2QQR A;  2EGC A;  2X4Y A;  3JAM E;  2HQE A;  2RHS A;  1SRL A;  1BK2 A;  3WVE B;  1QVG P;  3RMQ A;  1SEM A;  1YI2 Q;  2X3W D;  4DBR A;  5LJ3 j;  1TSF A;  3SFM A;  4BDY A;  2CZ6 B;  4RTT A;  2PVO B;  2E5K A;  2L3Q A;  3ERR A;  3X26 B;  4ORZ A;  4KH1 B;  2I4L A;  1M5Q 1;  2PZ1 A;  3EGX B;  1BI2 A;  1WIE A;  4FYV B;  4G85 A;  4P74 C;  1VQO T;  3QSU A;  2RHX A;  2W10 A;  2EKO A;  1NLO C;  1OQK A;  3CCM T;  2KSS A;  3VQV A;  2ZIN A;  2DJQ A;  2QAZ A;  1S72 A;  1GFC A;  3QNE A;  2CGH A;  3RER A;  1SF9 A;  5GAM h;  3EFO A;  4PLI A;  1GL5 A;  2OAU A;  4H2S A;  1MV0 B;  2ZIO A;  4C8Q C;  1K9A A;  2GF7 A;  3NEM A;  3M56 A;  2OTJ T;  2DTI A;  4VUB A;  2ZR3 A;  1N6A A;  1QCO A;  1X6G A;  2DYB A;  1YWO A;  2DIQ A;  3LGL A;  2VWF A;  2ZT6 A;  4N0A A;  1G3S A;  1Q86 C;  4M7A B;  1ARK A;  4PFZ A;  4ZTF A;  4E47 A;  5GMK j;  1PC0 A;  1RI0 A;  3QJ6 A;  3HPW A;  1HJD A;  2KK4 A;  2E6Z A;  2I4O A;  4MZM A;  3L1A A;  1BIB A;  2BUD A;  1Q7Y U;  3M4Q A;  4XTV A;  3A8M B;  4IUP A;  1YJW A;  2L0A A;  1GCQ A;  1X69 A;  3A74 A;  2CJA A;  1K73 U;  2FRW A;  2CRE A;  3W3S A;  2EYY A;  2XKO C;  4RG2 A;  1TUC A;  1WJR A;  1VQ9 Q;  4O6J A;  1N9W A;  4QKU A;  2RH2 A;  1M2O A;  1JXO A;  3JB9 G;  4B9X A;  4A54 A;  1M3C A;  1KHI A;  1M3A A;  2HZY A;  2IVW A;  1H4T A;  4NCX A;  1CSK A;  1WLP B;  4LVJ A;  2VB6 A;  5FRO A;  1R77 A;  3NMZ C;  2NUT A;  2CS7 A;  5KYU B;  4C0Z A;  4C5G A;  5KYX A;  3L2U A;  2RHU A;  2DD4 A;  3IQL A;  2QDL A;  2HQH A;  4M75 E;  3CXC P;  2DVJ A;  2X4J A;  2OX7 A;  4E7S A;  1YI2 A;  2COW A;  2RJF A;  4M7D A;  5J3B A;  1ZSG A;  3I56 A;  2FPE A;  4ZN1 A;  1W2B P;  3CCR A;  1B7Y A;  2HKQ B;  4BI8 B;  1Y57 A;  4UP9 A;  1YB3 A;  1SHG A;  2RJC A;  1KFZ A;  3ZL7 C;  1M8M A;  5IXF A;  3I56 Q;  4OB0 B;  2CP0 A;  2DET A;  2RQU A;  2K3B A;  3HRK A;  4PFO A;  3QBY A;  3I5R A;  3UPU A;  2JT4 A;  2QK0 A;  2ZT8 A;  2HL3 A;  2ATC B;  1NYF A;  2EVR A;  2MWP A;  4XTZ A;  4CC4 B;  5GAN e;  1UHC A;  5KH6 A;  1KQS P;  1LJO A;  2RQW A;  4DEY A;  4ME7 A;  3CC7 T;  5FWB A;  1E6G A;  3V8K A;  3F70 A;  1YN8 A;  1M1G A;  4UPA A;  4A4H A;  4OGE A;  4E7K A;  5KYY A;  4H2W A;  2KRM A;  2DM1 A;  4CRI A;  1W2B A;  2A3L A;  3JCM g;  4LVL A;  4PJO A;  4C8Q A;  4BE1 A;  1IXD A;  1N9R A;  1K8A U;  4E7I A;  3QWX X;  2DX1 A;  3RKW A;  1USY C;  3UFG A;  3X20 B;  2O9V A;  1M1K U;  3ZFJ A;  1FMV A;  2K5I A;  2ZT5 A;  3OW2 S;  1VQ8 T;  2RF0 A;  2F5T X;  5D6Y A;  2KBT A;  1TUD A;  4PJJ A;  1X55 A;  4JPB W;  3M0Q A;  3G4S A;  4M77 B;  2D8H A;  3M0P A;  4PK4 A;  1ACM B;  1VYV A;  3FEO A;  3CCR T;  4JLI A;  3HY0 A;  1XQH A;  4E7L A;  3HXX A;  2YUQ A;  2HNI A;  3MP1 A;  3OYM A;  5CAI A;  2M02 A;  1TU0 B;  3HHT B;  2RPN A;  1H4S A;  2Y4X A;  3VS4 A;  1FXX A;  5IH2 A;  4ZNX A;  1EX4 A;  3HL8 A;  1AWW A;  4YRQ A;  2RMO A;  2VC8 A;  2Y90 A;  3OSV A;  2DJZ A;  2FEI A;  1UHF A;  2LT4 A;  1M8V A;  4Y91 A;  2E3H A;  4M77 D;  1EFN A;  2FPD A;  5K1P A;  1KC8 U;  2BTT A;  1MGQ A;  3OS1 A;  3VS6 A;  1E7O A;  5LJ3 f;  4ANJ A;  4L5G A;  3VJP A;  4ZGE B;  3LGF A;  3VU3 C;  5GAN f;  1Z9Z A;  2HL5 C;  2LQK A;  3M57 A;  2ZNI A;  3T9N A;  1YIJ A;  1VQP A;  3KXT A;  1BIA A;  1ZSZ C;  2EW3 A;  2BZ8 A;  4HT8 A;  1VQM T;  1ASY A;  4M7D F;  1QVF P;  1HSQ A;  1ZSZ A;  4F17 A;  3P8D A;  2HKN A;  3MEY A;  1A0N B;  5HK3 A;  3HFZ B;  4E7J A;  1I0C A;  4H2V A;  5ELN A;  3SWN C;  3A7R A;  4YRS A;  12AS A;  4XU0 A;  3GP8 A;  4ZGD B;  4M7D E;  4KGV B;  2CP3 A;  2E5Q A;  3NTK A;  3GPL A;  2LX7 A;  4OF1 A;  1HK9 A;  4TVR A;  1ZA1 B;  3OYY A;  2K5F A;  2KGT A;  5D6W A;  2RK1 A;  2DEU A;  4K88 A;  2J6O A;  2KMT A;  4F7U G;  2Q7H A;  1VQN A;  2ALY A;  5KYX B;  4JRK A;  1Q82 C;  1B8A A;  5GAN g;  3UGT A;  1AZG B;  4A4E A;  2LX9 A;  5LJ3 g;  3VS3 A;  2CUD A;  4BUG A;  3EG2 A;  2DO3 A;  3WXM B;  4K11 A;  4OMO A;  2PVG B;  2EJF A;  2KT8 A;  2X51 A;  4GLM A;  5FU7 C;  3HKS A;  2E12 A;  2VAS A;  3VQW A;  4M78 A;  3UAT A;  3JB9 J;  4M7A D;  1E1T A;  3RES A;  2IG0 A;  1NJ2 A;  2WAC A;  4PJO G;  5CCA A;  3PVQ A;  1SHF A;  1UGS B;  3P8H A;  2K3X A;  2LRQ A;  2RJD A;  4N4H A;  3LLR A;  3UT1 A;  4ATO A;  2VGN A;  2KVQ G;  2WSF E;  3M4P A;  5AT1 B;  3JCM J;  5CK9 A;  3CBP A;  2VUB A;  3J81 E;  4EMH A;  3REX A;  2LCL A;  3MO8 A;  4PJO C;  1VQO Q;  2DZC A;  4X9C A;  4TVY A;  1VQ4 A;  2RD1 A;  1BBU A;  1OU9 A;  2K2V A;  3OD1 A;  1EOV A;  1FMW A;  1EIY A;  2J6F A;  4J9I A;  2A8E A;  1DJ7 B;  3P8Y A;  2K3Y A;  1JJ2 S;  3DLL A;  4XEM A;  4J8O A;  5D7U A;  4JJC A;  4JZ4 A;  2YUO A;  2JTE A;  4A4G A;  3MEW A;  2RQT A;  3VUB A;  4DBQ A;  4M7A G;  2OTL T;  2OJ2 A;  2F69 A;  3CXC S;  2RO0 A;  1G3T A;  4MDW A;  4O5V A;  4D6W A;  4FL6 A;  4FSX A;  1K76 A;  1S72 Q;  1VQN T;  3FC3 A;  3PMI A;  5LJ3 d;  2K5L A;  2DE0 X;  1IHW A;  1BI1 A;  5GAN j;  2O2O A;  5GAN 7;  4KQE A;  3X28 B;  1KD1 U;  5CKH A;  3M54 A;  1QVF S;  2XTI A;  3C94 A;  2B86 A;  3P8V A;  2RHQ B;  3LW5 E;  2ZTG A;  1IO6 A;  1HXD A;  2G4C A;  1OU8 A;  3S6W A;  3IKL A;  1UE9 A;  2ZCF B;  1J5W A;  4CC2 A;  4JS4 A;  4NOY A;  4HWP A;  2DXT A;  1FMK A;  3TEH A;  4RG8 A;  1KQS A;  2ZPB B;  4P3P A;  1SER A;  4PJN A;  1Q81 C;  5GAO r;  2RHQ A;  5AYF A;  2KYB A;  4V2S A;  2EQM A;  4E7Z A;  2X4W A;  5GAM f;  3LSS A;  3AT1 B;  4H2U A;  3QYG B;  1K1Z A;  3VS7 A;  3VS1 A;  1MMN A;  1CKA A;  2LZ6 B;  2HCK A;  4C0D C;  3NTI A;  4MMK A;  1UGR B;  4FW2 A;  2LCC A;  2XDB A;  4LVK A;  5EC7 A;  2MYS A;  4WJ3 M;  4YTL A;  4GLK A;  4EMG A;  2E3C A;  5C0M A;  4P71 A;  2JVV A;  4FCY A;  1B34 A;  3NEL A;  1UGV A;  4EX5 A;  3CCV Q;  3FJP A;  1M1F A;  4M77 G;  2DL4 A;  2A37 A;  4M78 F;  4MZP A;  4C92 F;  1XNI A;  4D8D A;  2WSE E;  4HWS A;  4CH5 A;  2XID A;  2PMF A;  1H3H A;  4J9G A;  4OP0 A;  1Y71 A;  3SB2 A;  3VV0 A;  4LD6 A;  2KYM A;  2LDM A;  2PU9 B;  2EQI A;  2MK5 A;  3CD6 Q;  4MDX A;  3CMA A;  2A0F B;  4G84 A;  1RIQ A;  1EVK A;  3OBY A;  1NYR A;  4YRT A;  4M78 E;  4P3O A;  1JO8 A;  1JJ2 A;  5DLO A;  3G7Z A;  3OW2 A;  2EJG A;  3G6E A;  1OV3 A;  2LNV A;  1G51 A;  5L8R E;  4BB7 A;  3G71 T;  3HTZ A;  1RAA B;  1RLP C;  3RNJ A;  3E9F A;  2JNG A;  4PJM A;  4C0G A;  4LE9 A;  3I5S A;  4M75 F;  4BI4 A;  4JRQ A;  4KUI A;  2EGA A;  5I21 A;  3OSS C;  1UTI A;  4FYX B;  1SSF A;  5GAN 5;  1RUW A;  2YUN A;  2Q7G A;  4CH3 A;  4IKF A;  1OYX A;  1MUZ A;  1MND A;  4M75 G;  4TWA A;  4BE0 A;  4OMM A;  1VYU A;  3HP9 A;  4JJB A;  3DB3 A;  3EG3 A;  3QXE B;  8ATC B;  1YIT T;  3DSQ A;  2CZ7 B;  2DTH A;  3E19 A;  3PCO A;  1PSF A;  3CCU T;  1K73 C;  2BE7 D;  4EMK C;  1NJ5 A;  4HCZ A;  2QHU A;  3CCS T;  3HXW A;  1C0A A;  4YRC A;  2ROT A;  4YCW A;  4KR2 A;  5FWC A;  3M5A A;  5A0L A;  4TQD A;  1ZUK A;  4F14 A;  4HVC A;  4C5I A;  3DLM A;  1CKB A;  1B7Y B;  1UJY A;  3HRT A;  3VRZ A;  5GAO m;  4RTV A;  2H8H A;  2H3E B;  3M4G A;  1YJW T;  1GCQ C;  1E22 A;  3G1Z A;  2DA9 A;  4OB2 B;  2NUP A;  4RMF A;  1PKT A;  1YIJ T;  2RA2 A;  4YCV A;  3VRY A;  4M77 A;  2L2P A;  2IY5 B;  3HSB A;  1ABO A;  3PIO A;  1VOM A;  2YWW A;  2AKK A;  2DD5 A;  1VQ5 Q;  5FU6 C;  4WJ4 A;  2ZAE A;  1H4Q A;  4B9W A;  2AHJ B;  4LXC A;  3CMA Q;  2L8D A;  3OYN A;  3E9I A;  2DU5 A;  4ZTU B;  5CQX A;  2AT1 B;  4M77 C;  2K79 A;  2WSC E;  1X2H A;  4C8Q B;  1T3L A;  2H3J A;  3A32 A;  2LC4 A;  3NHN A;  4HCB A;  2KRN A;  1YI2 T;  4DOW A;  2HSP A;  1X2Q A;  4P72 A;  1F1B B;  1WA7 A;  5IHK A;  2QEX T;  5KYW A;  2E4H A;  3CC4 T;  5L23 A;  1D0Y A;  1M1K R;  2DRK A;  1WGS A;  1JU5 C;  3EHQ A;  3EH1 A;  4M75 A;  4HXJ A;  3TSW A;  3OMG A;  1V1C A;  1WI7 A;  3OW2 P;  1SRM A;  2I4N A;  2GTJ A;  4YRR A;  5HK0 A;  2D0N A;  1IRX A;  2JZ2 A;  2O4X B;  4BE2 A;  4HVW A;  1P92 A;  2A7Y A;  5GAM j;  1E24 A;  3SD4 A;  4X5O A;  2MI6 A;  1TUG B;  2MCN A;  2AKW A;  2QA4 Q;  3LH5 A;  2B8A A;  4NL3 A;  4ELZ C;  1UFF A;  4ZGJ B;  4L59 A;  3HXU A;  8AT1 B;  4D8K A;  1NE8 A;  3OS2 A;  1MV3 A;  3V7C A;  4RCC A;  4H02 A;  1K8A R;  1AOJ A;  2EKH A;  1VQ8 Q;  3OA6 A;  2K2M A;  2HAX A;  1KQS S;  2QHT A;  4HWT A;  4KUD K;  2JS2 A;  3UWN A;  1VUB A;  2ED1 A;  4M7D G;  3QWY A;  1VQ7 Q;  4ZIB A;  3G71 A;  1EZZ B;  3RKY A;  4PKC C;  2R58 A;  3JCM e;  3QO7 A;  3QZ5 B;  3M58 A;  2FL7 A;  2QGF B;  1RAD B;  3PMT A;  2ZR2 A;  3GIB A;  2LJ3 A;  1Y7X A;  1NBE B;  2M1H A;  3JCM b;  2C0T A;  4JUV A;  4F04 B;  3OYL A;  1D3B B;  2G6F X;  3H9N A;  1AEY A;  1U1S A;  1WQ7 A;  3TCJ A;  3CPW P;  4TVA A;  1UGP B;  4II1 A;  1SG5 A;  3TU4 K;  5CO7 A;  5IN1 A;  4F7U F;  3CC4 A;  1AT1 B;  3C0C A;  1U8R A;  2VV5 A;  1IGQ A;  5HCK A;  1BU1 A;  1G2B A;  1NZ9 A;  4C8Q F;  1B07 A;  2JUF A;  2EFI A;  2FHD A;  3A8H B;  4PJO E;  2XMF A;  3JRZ A;  2YRD A;  3REB B;  2LMJ A;  1QWF A;  1IHV A;  3MPU B;  1OEB A;  2DZ9 A;  3G6E Q;  1B76 A;  4FW1 A;  1WJS A;  2CSI A;  4IUV A;  1Q7Y C;  2HSE B;  3QZ9 B;  3TQ7 P;  3CME T;  1HC7 A;  2C0I A;  2RI5 A;  1WXU A;  2A28 A;  3A7A A;  4FT4 A;  2C8M A;  2AK5 A;  2EYQ A;  4EO4 A;  2E3I A;  2YSQ A;  3M0U A;  4P3N A;  1B7T A;  3NEN A;  3MQZ A;  3CPW A;  2KRO A;  5I2S A;  1KHC A;  4CS3 A;  1U06 A;  3PZC A;  1C0M A;  2CT3 A;  5CKE A;  1KJW A;  2QI2 A;  1ZUU A;  3QPH A;  5LJ5 g;  2LJ0 A;  3OYK A;  2IY5 A;  4M7A E;  2ENM A;  3EHR A;  4J9H A;  2DLP A;  4OVA A;  4C0F A;  1WFW A;  3VS2 A;  5E3I A;  2OAW A;  2D1X A;  3CME Q;  2DQ0 A;  1QW1 A;  3J80 E;  2MF2 A;  1AWJ A;  4LDX A;  5C51 B;  4Q5W A;  1PRM C;  1VQN Q;  1RAH B;  2R5A A;  3KFU A;  1EFW A;  5GAN h;  2EYW A;  2LJ1 A;  4L6V 5;  3MET A;  4RUG A;  2C0O A;  2D6F A;  4YDQ A;  5GAO p;  3GLX A;  1XOV A;  1Z7N A;  4X9D A;  1IB8 A;  4X34 A;  2F2X A;  3G1J A;  1N8R C;  3QDF A;  2VXF A;  3I55 Q;  2SEM A;  2Q5H A;  4OMP A;  2QQS A;  1QCN A;  1GRI A;  4BW9 A;  1IL2 A;  3EGU A;  2X3X D;  4Y28 E;  3E1S A;  2MMP A;  4P75 C;  1N27 A;  2CKK A;  2YUP A;  3CCR Q;  1AZE A;  2GGR A;  2NWM A;  4LVM A;  1D1C A;  4M75 B;  3TSZ A;  4FYW B;  3L2Z A;  1PCX A;  3CME A;  1VIE A;  1VYT A;  4FYY B;  2KY9 A;  4LDY A;  4M78 D;  4TQF A;  5A0G A;  2P0L A;  3VS0 A;  2FRY A;  2ODR C;  2COY A;  2ZNJ A;  2HDA A;  2MAM A;  2DL5 A;  1WJQ A;  4MZT A;  1LNX A;  3UH0 A;  1WHM A;  1WX6 A;  1JQQ A;  2V26 A;  1G3Y A;  5IT9 E;  4YRM A;  2ZGW A;  1UDL A;  2K57 A;  1KMM A;  1N5Z A;  3HFO A;  4P73 A;  1I8F A;  1AHJ B;  1GXI E;  4M77 E;  1OI1 A;  4RCB A;  1ZBX A;  3MEV A;  2PQW A;  4M78 B;  1VQ6 A;  3OYJ A;  4AT1 B;  3CC7 Q;  1LCK A;  1GBR A;  1FYF A;  1SES A;  4IUT A;  2BIV A;  4RQF A;  5GMK i;  3EAE A;  1WYX A;  4P71 C;  4M78 G;  3X24 B;  2RHZ A;  4RTW A;  1NLP C;  4JRP A;  4YRE A;  2HBP A;  2ALY B;  1JXM A;  4J6X A;  2CH4 W;  4IUU A;  3O5Z A;  2D8J A;  1BBZ A;  2DK3 A;  1TTH B;  2LTO A;  2RJE A;  2EJ9 A;  4OB1 B;  5GAM g;  3WQZ A;  2DXU A;  1I1J A;  4GBQ A;  2M9U A;  4OGC A;  3C4S A;  3CCS A;  2RB6 A;  5FLX E;  3QHS A;  1AD5 A;  1T0J A;  1YIT Q;  5IHI A;  3HXZ A;  2EYX A;  4PJO B;  3FIF A;  1X56 A;  1E6H A;  4J9F A;  1ASZ A;  3RBB B;  3L2Q A;  2P4T A;  1NJ1 A;  3ULR B;  4HA8 A;  3S3N A;  5FRM A;  5D6X A;  3M9Q A;  2SRC A;  2ED0 A;  2PME A;  4LDU A;  1TH7 A;  2CZ1 B;  1JEG A;  1WYD A;  3A5Z A;  2EQU A;  4JRI A;  3VUZ A;  5GAN 6;  1XTD A;  2DPP B;  1WLE A;  4K87 A;  4OMQ A;  4J9B A;  2ODR D;  3OYH A;  4RMO A;  3ASK A;  2CJ9 A;  2HMA A;  2P4R A;  1K73 R;  3JCM d;  2KDS A;  4XU2 A;  3I9Q A;  2DL7 A;  2COZ A;  1MMA A;  5KYY B;  1R0B G;  1N9S A;  4FT2 A;  3MCA B;  4LD9 K;  4P74 A;  3A8O B;  1K0S A;  2YHT A;  3A5Y A;  4CH4 A;  2RQV A;  3M53 A;  3JB9 D;  2KT1 A;  5GMK h;  2ZPF B;  1VQ7 A;  1JJC A;  4YRG A;  2OTJ Q;  2QQ9 A;  2NS6 A;  3RUX A;  1JB0 E;  5A0D A;  2YT6 A;  4YRP A;  3JSC A;  4XQ3 A;  4IIM A;  5CVI A;  3JCM X;  1X43 A;  3EG9 B;  3MEU A;  4EDU A;  1QMC A;  2ABL A;  2C06 A;  3AHU A;  1IRE B;  2M51 A;  3MF1 A;  1NG2 A;  2PTK A;  4DA4 A;  1G83 A;  2L3S A;  1VQ4 Q;  4A4F A;  5J39 A;  1YJN A;  2QAS A;  3NGP A;  5K1X A;  1K4U S;  1PNJ A;  2NUP B;  3LWI A;  4XTW A;  2A36 A;  1HYO A;  4RTY A;  5GAN 4;  3IG2 A;  5LJ5 j;  2DIL A;  4HWR A;  2E70 A;  3EGX A;  4CC3 A;  1M27 C;  2EWN A;  1SSH A;  2ZZE A;  2O31 A;  2W0Z A;  5C6S A;  2E10 A;  2ART A;  4J9C A;  1TWB A;  2LP5 A;  1YJW Q;  2LNH B;  1PG5 B;  3HXV A;  4TTV A;  2XU8 A;  3FB9 A;  3ME9 A;  4HVU A;  4PL6 A;  4A63 B;  2E41 A;  4WF2 A;  3CCE A;  1VQP T;  1X2G A;  2RI2 A;  1VQL T;  1NNH A;  1WHG A;  1W6X A;  2P84 A;  5GMK m;  3H41 A;  1QVG A;  3SEM A;  4QVD A;  2PUK B;  1G8X A;  1KG1 A;  2VGM A;  2KRS A;  2FPF A;  1BB9 A;  4PJO F;  5FW9 A;  4LNS A;  2GFA A;  1LOJ A;  2QA4 T;  3L4G B;  2RM4 A;  2JXB A;  3OYB A;  2KQW A;  3VQX A;  4LN2 A;  4M7D D;  4K86 A;  1YHQ Q;  2J06 A;  3MKD A;  2JMA A;  1TXQ A;  1AVZ C;  2BKD N;  1KQ2 A;  4YYE A;  3OYA A;  5GAM d;  4JJN K;  3EG1 A;  4BAC A;  3UF4 A;  1UB4 A;  1Q7Y R;  2PNI A;  2RI3 A;  4HCC A;  3OYD A;  2ZXF A;  4EPC A;  4P75 A;  1VQ7 T;  4UP7 A;  4C5E A;  5GAN d;  3R6N A;  4DEX A;  1VQK A;  3V7S A;  2ZPH B;  2BE9 B;  1D0Z A;  2QEX Q;  1VQ6 T;  2G3R A;  3OYF A;  3TEG A;  1B3Q A;  1TS9 A;  4M7D B;  5LJ5 e;  1K0X A;  1MNE A;  4QT7 A;  4TVW A;  4RQE A;  2VKN A;  1ZUY A;  2DBK A;  1YHQ T;  3FJ5 A;  3PVL A;  1G5H A;  4KRT A;  1ZQ1 A;  1YJN T;  1OOT A;  1KMN A;  1B70 B;  3BDU A;  3PNW C;  4TVA B;  1Z7M A;  3CBO A;  1D1B A;  3GNG A;  1YIJ Q;  2ARU A;  1VQL A;  1Y0M A;  2C7I A;  3URG A;  5KYN A;  3BJU A;  4E51 A;  2JN0 A;  4IUQ A;  4AG2 C;  1QQJ A;  4LDV A;  1D0X A;  2KNB B;  4KT0 E;  4LNP A;  1ATI A;  2ECZ A;  3CCE T;  2YLB A;  3L4G A;  1T0H A;  1M2V B;  3I55 A;  2DTO A;  1RAF B;  4HCK A;  2QEX A;  3OQ5 A;  4Q6G A;  3BE3 A;  3HTR A;  1KC8 R;  2JM9 A;  1WDX A;  2DL3 A;  4HKE A;  2EGE A;  1VQP Q;  1K9M R;  3OS5 A;  1I4K 1;  1RLQ C;  3CCJ T;  4ZN3 A;  4RTX A;  4C92 G;  3CCU A;  4M77 F;  2ARS A;  2CSQ A;  2RHY A;  4B6M A;  1SRY A;  2GBQ A;  5IXB A;  2ZPI B;  1QP3 A;  4KGZ B;  1YGB A;  2AKW B;  3RR6 A;  3CPF A;  2I2L A;  2J3M A;  4C92 B;  4N4I A;  3CCV T;  3TEH B;  1KQ1 A;  1NPP A;  3OYE A;  1N8R R;  5KNN A;  4WI1 A;  1WZO A;  1VQM Q;  3M0R A;  4J7F A;  3QTC A;  3L2W A;  1M1K C;  5KYU A;  2HD0 A;  1YHQ A;  2A08 A;  3OS0 A;  5GAN 8;  2CT4 A;  4HT9 A;  3TRE A;  2GQI A;  2CP5 A;  2GTO A;  2KI7 A;  4CH6 A;  1OZ2 A;  2FZG B;  1D09 B;  1SET A;  3OYG A;  3SWN A;  1GFD A;  3JB9 H;  1QE0 A;  1YFN A;  1BKB A;  2X4X A;  1VQ6 Q;  4R56 A;  4C92 D;  3JB9 I;  4JZ3 A;  1Q82 R;  1YFS A;  3CCE Q;  11AS A;  5FRN A;  1BYM A;  2DQ3 A;  4UC4 A;  2DYI A;  4YRJ A;  1X2K A;  1JJ2 P;  1KSW A;  1UUE A;  1QF6 A;  3CMQ A;  3OBW A;  3E9H A;  1VA7 A;  3I55 T;  3CXC A;  1X6B A;  4YRL A;  4KBM B;  3VS5 A;  3HFN A;  4AMC A;  2BZX A;  2IIM A;  4ZTZ B;  2DF6 A;  2DFU A;  4C0D B;  4F7U A;  1C6V X;  3ZEH A;  2ZPG B;  3A8L B;  1HTT A;  5CKB A;  2FVU A;  3SDZ A;  3G71 Q;  1G5V A;  2EQJ A;  3CC4 Q;  4FM4 B;  4XEO A;  2DMO A;  3CCQ T;  2JTF A;  2QQA A;  1M90 R;  3CC2 A;  2O9S A;  1UEB A;  3CCJ A;  5ECA A;  3HRI A;  2ZZD A;  4F7U B;  4IIO A;  1WNL A;  3PIP A;  1WXT A;  1NJI R;  1YWP A;  2DXC A;  3NPF A;  2VVK A;  4NS5 A;  1PHT A;  4DPG A;  3MP8 A;  4J6W A;  4N0A C;  2QA4 A;  1MHN A;  2V8J A;  1VQZ A;  2CDT A;  2E6N A;  4E7H A;  4H2X B;  4LDW A;  2MPX C;  2I4M A;  1IGU A;  1MMG A;  1X6O A;  3CMA T;  3PT9 A;  1LYL A;  4DQ2 A;  2EAY A;  3INZ A;  4DBH A;  1NEG A;  1EVL A;  4OMF B;  3D7S B;  3S3M A;  4HVV A;  2HEQ A;  1H4V B;  4BY6 C;  2QTX A;  3QYH B;  3NTH A;  2DER A;  1HD3 A;  2EL9 A;  3OB9 A;  3QO3 A;  4HT4 A;  3JCM f;  2FG0 A;  2RHI A;  1Q86 R;  1YFT A;  1YCY A;  2R5M A;  3C12 A;  2AZV A;  2NYS A;  4C8Q E;  4AFZ C;  2AMC A;  3A8G B;  2V1Q A;  3GNF B;  3H0H A;  4Z8A A;  3OMC A;  4KH0 B;  2Q7E A;  4C92 C;  2DKG A;  2NUZ A;  2OI3 A;  3RMS A;  1UG1 A;  1NYQ A;  1W70 A;  1YBY A;  1RAE B;  4F16 A;  2D0Q B;  1B34 B;  4M7A F;  3RF1 A;  1RAC B;  2AZS A;  2CIM A;  1YFR A;  1UEC A;  1M30 A;  2CZ0 B;  4FIB A;  1YIT A;  4PG3 A;  1YP5 A;  5M9O A;  1VQ9 A;  5GJV B;  3EH2 A;  3CCS Q;  2Q5I A;  4RDX A;  2L3P A;  1X01 A;  3RIR A;  2DXB A;  3JV3 A;  1YCS B;  2K9G A;  1VQO A;  2OTL Q;  2J6K A;  5IAY A;  4MML A;  1Y96 B;  1I5L A;  3H8Z A;  1QP2 A;  2KEA A;  1USY A;  4XU3 A;  1V29 B;  3E2U A;  2GQV A;  5I2M A;  4P72 C;  2MOX A;  1NJ6 A;  2CH4 A;  1L0W A;  1FX7 A;  1PKS A;  5FU7 B;  3GOX A;  2DNU A;  2CP7 A;  4KUL A;  1NJI C;  1M4Z A;  1R8O B;  3V8L A;  3TUP A;  3MF2 A;  2QTV A;  3QDR B;  1AWX A;  1Y96 A;  1W4S A;  2HBW A;  1PYS A;  1NEB A;  3U23 A;  1B70 A;  4KGX B;  3EFS A;  1QVF A;  1Q81 U;  2DVE A;  3BFM A;  1QKW A;  4N4G A;  3A98 A;  1LPL A;  2ZZF A;  5C52 B;  2K6D A;  3V7R A;  5GAN 3;  3M0T A;  1H64 1;  3LYI A;  1ZHI A;  5I11 A;  4RTU A;  1JJC B;  4M75 C;  3LWH A;  1KD1 R;  3R6O A;  4XTY A;  4QW2 A;  3TVT A;  1ADY A;  1UGQ B;  2JJ9 A;  3CCL A;  4O2D A;  2FZK B;  3SWN B;  1VQL Q;  5A2Q E;  3CD6 T;  3CBM A;  3IAL A;  1VIF A;  1PD1 A;  2XDD A;  2XG8 D;  1VQ4 T;  3TEE A;  3M0S A;  5IHN A;  1C1A A;  3UA7 A;  4LUD A;  2X35 A;  1WHJ A;  1VQ8 A;  2FO0 A;  3CCJ Q;  2DAQ A;  2LVM A;  1PSE A;  1Q86 U;  2HQX A;  4CS2 A;  3CC2 Q;  3HFV A;  2E1H A;  3SHW A;  5KE2 A;  4EMK B;  3A1P A;  3G4S T;  4CC7 A;  4CI0 C;  4RTZ A;  1NJ8 A;  2RHS B;  2D9T A;  3QII A;  2EPD A;  4XTX A;  3I7F A;  4H2T A;  4BWA A;  2R57 A;  3KUF A;  2F5K A;  2LQ8 A;  4XTU A;  2J3L A;  2FYK A;  2IPO B;  3C95 A;  4X1V A;  4CS4 A;  5HY6 A;  3FDR A;  1NYG A;  1H3Z A;  2DIG A;  2RN8 A;  4H2X A;  5F5W A;  5HGQ A;  3R07 A;  1WHL A;  3E9G A;  3S3O A;  2M0Y A;  1RAG B;  2BZY A;  4R55 A;  2DDZ A;  1GCP A;  3BW1 A;  4NL2 A;  3P8T A;  3I56 T;  4JS5 A;  5GJW B;  1E1O A;  2XI9 A;  3UDC A;  1U1T A;  1U3O A;  1X75 C;  3FLG A;  4XU1 A;  3JCM h;  1W2B S;  1KC8 C;  4BDZ A;  2CP2 A;  1VQK T;  1KOG A;  4WTO B;  1SPK A;  3V8J A;  4XK8 E;  2F2V A;  4M78 C;  3HRS A;  3H6Z A;  2JMC A;  3H0F A;  3CCM A;  3I35 A;  1JRI A;  1QWE A;  1Y07 A;  1KIK A;  4ESR A;  4ELY C;  3X25 B;  4C8Q D;  4PHC A;  2DRM A;  5DLQ E;  4H2Y A;  3CC7 A;  4Z89 A;  2KXC A;  4J5Y A;  1PWT A;  4JJD A;  3L2R A;  1T3S A;  3G4S Q;  4EMK A;  3CCQ Q;  1H8K A;  5LJ5 f;  3JCM Q;  2L3R A;  3QUI A;  5GAO n;  1NM7 A;  2NUT B;  3ICA A;  4YCU A;  4AH6 A;  3P8B B;  1YJN Q;  2XDP A;  5LJ3 h;  5C53 B;  4OMN A;  3HRU A;  3M4Y A;  3RKX A;  4YPF A;  1S72 T;  4OLF A;  4YRK A;  1WQW A;  1ZBJ A;  1QKX A;  1ZSZ B;  3JB9 F;  2QYZ A;  3JCM P;  4Q15 A;  3LC0 A;  4FSS A;  3A7U A;  2JTM A;  3THK A;  3O8V A;  1MMD A;  4J7I A;  2KE9 A;  1VQ9 T;  4YP0 A;  1QCF A;  3QJY A;  4A53 A;  2Z0W A;  3MJX A;  2JOY A;  1M90 C;  4Z02 A;  3BY7 A;  3GF5 A;  2RNA A;  1M9S A;  2XGT A;  3HFZ A;  1RAB B;  2MIO A;  3MP6 A;  4J9D A;  1RL2 A;  5CQY A;  1BBW A;  3CCL Q;  2DEQ A;  2QDY B;  3LH0 A;  2P5I A;  1WXB A;  6AT1 B;  3REA B;  1WPY A;  1R0C B;  4P5N A;  5CIU A;  3VYH B;  1G5I A;  1OZ3 A;  2EQK A;  2QXF A;  4OB3 B;  1I07 A;  1OX9 A;  3PGG A;  4AFS C;  3NET A;  2L89 A;  3EGD A;  1Z9Q A;  4XAX B;  2ROL A;  3BDL A;  2JS0 A;  1IZ6 A;  3ER0 A;  4C92 E;  2AIR B;  5LJ3 e;  5EG2 A;  5CKF A;  9ATC B;  3ZBD A;  1Q81 R;  2KR3 A;  3PTA A;  2JW4 A;  3UGQ A;  3WVD B;  3EGD B;  3QKJ A;  2LQW A;  4HWO A;  2QQB A;  1H92 A;  2OTL A;  2YRC A;  2ZT7 A;  1O75 A;  3RAC A;  1LVK A;  4P73 C;  1BI0 A;  1TOV A;  3QO8 A;  4GY5 A; 
#chains in the Genus database with same CATH homology
 2L5Q A;  2RK2 A;  2FB7 A;  3QG1 A;  2CYZ B;  4BD3 A;  4J6Y A;  3RL6 A;  4KR3 A;  1QVP A;  1PYS B;  5LL6 S;  3VQY A;  2K4Y A;  2GCX A;  3CC2 T;  3OY9 A;  3OYC A;  4M7A C;  5LJ5 h;  1K9M C;  2VXE A;  2M0O A;  5KCO A;  1YJ9 T;  5CR2 A;  4M7A A;  1EIY B;  5FU6 B;  5HKC A;  2AMC B;  4YRF A;  3VYG A;  3Q1J A;  5LJ5 d;  3MHX A;  1X54 A;  4PJO D;  5GAO l;  4ZTJ A;  2QHV A;  1GGM A;  3J7A F;  3L2V A;  4JDS A;  2ZPE B;  4QQG A;  2ZIM A;  2GFU A;  2P0K A;  3NFC A;  5KCH A;  1ADJ A;  2VYT A;  4YRN A;  2OTJ A;  1Q82 U;  4J15 A;  2V8I A;  4BI3 A;  4M7D C;  2XD0 A;  3PFS A;  3JCM V;  3QO5 A;  3DB4 A;  4RKU E;  4QQD A;  5GAN 2;  3MEA A;  3JCM c;  1JBM A;  2V8K A;  5J26 A;  2PVD B;  5ELO A;  3HXY A;  2EIF A;  3CEY A;  1VQ5 T;  4YRO A;  5GMK l;  1D3B A;  3DKM A;  2QHS A;  3KBG A;  4IUR A;  1M90 U;  2E64 A;  4QQ6 A;  1K9M U;  4L87 A;  1K8A C;  3G6E T;  4LVI A;  4M75 D;  4C8Q G;  4F7U E;  1NJI U;  1YJ9 A;  2YLC A;  1NPR A;  3FRN A;  2ZZG A;  3CCL T;  3EFR A;  5KE3 A;  4DOV A;  1G3W A;  4FU6 A;  3VBB A;  4C92 A;  3N5B B;  4YRI A;  1FWZ A;  4PNO A;  3LSQ A;  2CJB A;  2YRV A;  2O4X A;  3M55 A;  2PUO B;  3LX7 A;  4J83 A;  3CCQ A;  4UP8 A;  5GAO q;  2MWO A;  1EIF A;  2Y4Y A;  1EQR A;  2P0P A;  3OYI A;  2M16 A;  1VQM A;  2P0Q A;  2E65 A;  3REU A;  2KAF A;  3PCO B;  4JLG A;  2E5A A;  2XHC A;  3CD6 A;  1I81 A;  1O9S A;  1N8R U;  4C5H A;  2XK0 A;  3CPW S;  2LT1 A;  2DU7 A;  4A4K A;  5DM7 R;  3VKI A;  1VQ5 A;  3M59 A;  2NLU A;  3L42 A;  3RGL A;  1QVG S;  3A31 A;  5DY9 A;  1KD1 C;  3HY1 A;  4QVZ A;  3CCV A;  1W66 A;  1WU7 A;  1BI3 A;  3JCM W;  3IKM B;  2O01 E;  4PLL A;  5GAM e;  2ZCE A;  4BY6 B;  4QVC A;  5CKD A;  2XIC A;  3A5Z B;  5GMK e;  2QQR A;  2X4Y A;  3JAM E;  2HQE A;  2RHS A;  3WVE B;  3RMQ A;  5LJ3 j;  3SFM A;  4BDY A;  2CZ6 B;  2PVO B;  3ERR A;  3X26 B;  2I4L A;  1M5Q 1;  1BI2 A;  4G85 A;  4P74 C;  1VQO T;  3QSU A;  2RHX A;  2EKO A;  3CCM T;  2KSS A;  3VQV A;  2ZIN A;  1S72 A;  3QNE A;  2CGH A;  3RER A;  5GAM h;  4PLI A;  2OAU A;  4H2S A;  2ZIO A;  4C8Q C;  2GF7 A;  3NEM A;  3M56 A;  2OTJ T;  2DTI A;  4VUB A;  2ZR3 A;  1N6A A;  2DIQ A;  3LGL A;  2ZT6 A;  4N0A A;  1Q86 C;  1G3S A;  4M7A B;  4ZTF A;  4E47 A;  5GMK j;  1RI0 A;  3QJ6 A;  3HPW A;  2KK4 A;  2E6Z A;  2I4O A;  4MZM A;  3L1A A;  1BIB A;  2BUD A;  1Q7Y U;  3M4Q A;  4XTV A;  3A8M B;  4IUP A;  1YJW A;  3A74 A;  2CJA A;  1K73 U;  3W3S A;  2XKO C;  4RG2 A;  1WJR A;  4O6J A;  1N9W A;  2RH2 A;  3JB9 G;  4B9X A;  4A54 A;  1KHI A;  2IVW A;  1H4T A;  4NCX A;  4LVJ A;  5FRO A;  2CS7 A;  4C0Z A;  4C5G A;  3L2U A;  2RHU A;  2DD4 A;  4M75 E;  2X4J A;  1YI2 A;  2RJF A;  4M7D A;  5J3B A;  3I56 A;  4ZN1 A;  3CCR A;  1B7Y A;  4BI8 B;  4UP9 A;  1YB3 A;  2RJC A;  4OB0 B;  3HRK A;  3QBY A;  3UPU A;  2ZT8 A;  4XTZ A;  2MWP A;  5GAN e;  5KH6 A;  1LJO A;  3CC7 T;  4ME7 A;  3V8K A;  3F70 A;  1M1G A;  4UPA A;  4A4H A;  4OGE A;  4E7K A;  4H2W A;  4CRI A;  1W2B A;  2A3L A;  3JCM g;  4LVL A;  4PJO A;  4C8Q A;  4BE1 A;  1N9R A;  1K8A U;  4E7I A;  3UFG A;  3RKW A;  1USY C;  3X20 B;  1M1K U;  3ZFJ A;  2K5I A;  2ZT5 A;  3OW2 S;  1VQ8 T;  2F5T X;  5D6Y A;  1X55 A;  3G4S A;  4M77 B;  3FEO A;  3CCR T;  4JLI A;  3HY0 A;  1XQH A;  4E7L A;  3HXX A;  2HNI A;  3MP1 A;  3OYM A;  5CAI A;  3HHT B;  1H4S A;  2Y4X A;  1FXX A;  3HL8 A;  4YRQ A;  2VC8 A;  2Y90 A;  3OSV A;  2DJZ A;  2LT4 A;  1M8V A;  4Y91 A;  4M77 D;  5K1P A;  1KC8 U;  1MGQ A;  3OS1 A;  5LJ3 f;  4L5G A;  3VJP A;  4ZGE B;  3LGF A;  3VU3 C;  5GAN f;  2LQK A;  3M57 A;  2ZNI A;  3T9N A;  1YIJ A;  1VQP A;  3KXT A;  1BIA A;  4HT8 A;  1VQM T;  1ASY A;  4M7D F;  3P8D A;  3MEY A;  5HK3 A;  3HFZ B;  4E7J A;  4H2V A;  5ELN A;  3SWN C;  3A7R A;  4YRS A;  12AS A;  4XU0 A;  3GP8 A;  4ZGD B;  4M7D E;  2E5Q A;  3NTK A;  3GPL A;  4OF1 A;  1HK9 A;  4TVR A;  3OYY A;  2K5F A;  5D6W A;  2RK1 A;  4K88 A;  2KMT A;  4F7U G;  2Q7H A;  1VQN A;  2ALY A;  4JRK A;  1Q82 C;  1B8A A;  5GAN g;  3UGT A;  4A4E A;  2LX9 A;  5LJ3 g;  4BUG A;  2DO3 A;  3WXM B;  2PVG B;  2EJF A;  5FU7 C;  3HKS A;  2E12 A;  3VQW A;  4M78 A;  3JB9 J;  4M7A D;  1E1T A;  3RES A;  2IG0 A;  1NJ2 A;  2WAC A;  4PJO G;  5CCA A;  1UGS B;  3P8H A;  2K3X A;  2LRQ A;  2RJD A;  4N4H A;  3LLR A;  3UT1 A;  4ATO A;  2VGN A;  2KVQ G;  2WSF E;  3M4P A;  3JCM J;  5CK9 A;  3CBP A;  2VUB A;  3J81 E;  4EMH A;  3REX A;  2LCL A;  3MO8 A;  4PJO C;  2DZC A;  4X9C A;  4TVY A;  1VQ4 A;  2RD1 A;  1BBU A;  2K2V A;  3OD1 A;  1EOV A;  1EIY A;  2A8E A;  1DJ7 B;  3P8Y A;  2K3Y A;  1JJ2 S;  3DLL A;  4XEM A;  4J8O A;  4A4G A;  3MEW A;  4M7A G;  3VUB A;  2OTL T;  2F69 A;  3CXC S;  2RO0 A;  1G3T A;  4MDW A;  4O5V A;  4D6W A;  4FL6 A;  4FSX A;  1VQN T;  3FC3 A;  3PMI A;  5LJ3 d;  2K5L A;  1BI1 A;  5GAN j;  5GAN 7;  4KQE A;  3X28 B;  1KD1 U;  5CKH A;  3M54 A;  1QVF S;  2XTI A;  3C94 A;  3P8V A;  2RHQ B;  3LW5 E;  2ZTG A;  1HXD A;  2G4C A;  3S6W A;  3IKL A;  2ZCF B;  1J5W A;  4JS4 A;  4NOY A;  4HWP A;  2DXT A;  3TEH A;  4RG8 A;  1KQS A;  2ZPB B;  4P3P A;  1SER A;  1Q81 C;  5GAO r;  2RHQ A;  5AYF A;  4V2S A;  2EQM A;  2X4W A;  5GAM f;  3LSS A;  4H2U A;  3QYG B;  4C0D C;  3NTI A;  4MMK A;  1UGR B;  2LCC A;  2XDB A;  4LVK A;  4WJ3 M;  4YTL A;  4GLK A;  4EMG A;  2E3C A;  5C0M A;  4P71 A;  2JVV A;  1B34 A;  3NEL A;  4EX5 A;  3FJP A;  1M1F A;  4M77 G;  4M78 F;  4MZP A;  4C92 F;  1XNI A;  2WSE E;  4HWS A;  4CH5 A;  2XID A;  2PMF A;  4OP0 A;  1Y71 A;  3SB2 A;  3VV0 A;  4LD6 A;  2LDM A;  2PU9 B;  4MDX A;  3CMA A;  4G84 A;  1RIQ A;  1EVK A;  3OBY A;  1NYR A;  4YRT A;  4M78 E;  4P3O A;  1JJ2 A;  5DLO A;  3G7Z A;  3OW2 A;  2EJG A;  3G6E A;  2LNV A;  1G51 A;  5L8R E;  4BB7 A;  3G71 T;  3HTZ A;  3E9F A;  2JNG A;  4C0G A;  4M75 F;  4BI4 A;  4JRQ A;  4KUI A;  5I21 A;  3OSS C;  1SSF A;  5GAN 5;  2Q7G A;  4CH3 A;  4IKF A;  1OYX A;  4M75 G;  4TWA A;  4BE0 A;  3HP9 A;  3DB3 A;  3QXE B;  1YIT T;  3DSQ A;  2CZ7 B;  2DTH A;  3E19 A;  3PCO A;  1PSF A;  3CCU T;  1K73 C;  4EMK C;  1NJ5 A;  4HCZ A;  2QHU A;  3CCS T;  3HXW A;  1C0A A;  4YRC A;  4KR2 A;  4YCW A;  3M5A A;  5A0L A;  4TQD A;  4HVC A;  4C5I A;  3DLM A;  1B7Y B;  3HRT A;  5GAO m;  3M4G A;  1YJW T;  1E22 A;  3G1Z A;  4OB2 B;  4RMF A;  1YIJ T;  2RA2 A;  4YCV A;  4M77 A;  2IY5 B;  3HSB A;  3PIO A;  2DD5 A;  5FU6 C;  4WJ4 A;  1H4Q A;  4B9W A;  2AHJ B;  2L8D A;  3OYN A;  3E9I A;  2DU5 A;  4ZTU B;  5CQX A;  4M77 C;  2WSC E;  1X2H A;  4C8Q B;  2H3J A;  3A32 A;  2LC4 A;  4HCB A;  1YI2 T;  4DOW A;  4P72 A;  2QEX T;  3CC4 T;  1WGS A;  4M75 A;  3OMG A;  2I4N A;  4YRR A;  5HK0 A;  2JZ2 A;  2O4X B;  4BE2 A;  1P92 A;  2A7Y A;  5GAM j;  1E24 A;  3SD4 A;  4X5O A;  2MI6 A;  2AKW A;  2B8A A;  4NL3 A;  4ELZ C;  4ZGJ B;  4L59 A;  3HXU A;  1NE8 A;  3OS2 A;  3V7C A;  4RCC A;  4H02 A;  3OA6 A;  2HAX A;  1KQS S;  2QHT A;  4HWT A;  4KUD K;  3UWN A;  1VUB A;  4M7D G;  4ZIB A;  3G71 A;  3RKY A;  4PKC C;  2R58 A;  3JCM e;  3QO7 A;  3QZ5 B;  3M58 A;  2FL7 A;  2ZR2 A;  3PMT A;  3GIB A;  1Y7X A;  2M1H A;  3JCM b;  4JUV A;  3OYL A;  1D3B B;  1U1S A;  1WQ7 A;  3TCJ A;  4TVA A;  1UGP B;  4II1 A;  3TU4 K;  5CO7 A;  5IN1 A;  4F7U F;  3CC4 A;  1U8R A;  2VV5 A;  1NZ9 A;  4C8Q F;  2JUF A;  2EFI A;  2FHD A;  3A8H B;  4PJO E;  3JRZ A;  2DZ9 A;  1B76 A;  1WJS A;  4IUV A;  1Q7Y C;  3QZ9 B;  3CME T;  1HC7 A;  2RI5 A;  3A7A A;  4FT4 A;  2C8M A;  2EYQ A;  4EO4 A;  4P3N A;  3NEN A;  3MQZ A;  3CPW A;  5I2S A;  1KHC A;  4CS3 A;  3PZC A;  5CKE A;  2QI2 A;  3QPH A;  5LJ5 g;  3OYK A;  2IY5 A;  4M7A E;  4OVA A;  4C0F A;  5E3I A;  2DQ0 A;  1QW1 A;  3J80 E;  2MF2 A;  4LDX A;  5C51 B;  4Q5W A;  2R5A A;  3KFU A;  1EFW A;  5GAN h;  4L6V 5;  3MET A;  2D6F A;  4YDQ A;  5GAO p;  3GLX A;  1XOV A;  1Z7N A;  4X9D A;  4X34 A;  1N8R C;  2VXF A;  2Q5H A;  2QQS A;  4BW9 A;  1IL2 A;  4Y28 E;  3E1S A;  2MMP A;  4P75 C;  1N27 A;  2CKK A;  4LVM A;  4M75 B;  3L2Z A;  3CME A;  1VIE A;  2KY9 A;  4LDY A;  4M78 D;  4TQF A;  5A0G A;  2P0L A;  2ODR C;  2ZNJ A;  2MAM A;  1WJQ A;  4MZT A;  1LNX A;  3UH0 A;  1G3Y A;  5IT9 E;  4YRM A;  2ZGW A;  2K57 A;  1KMM A;  3HFO A;  4P73 A;  1I8F A;  1AHJ B;  1GXI E;  4M77 E;  1OI1 A;  4RCB A;  1ZBX A;  3MEV A;  2PQW A;  4M78 B;  1VQ6 A;  3OYJ A;  1FYF A;  1SES A;  4IUT A;  2BIV A;  4RQF A;  5GMK i;  3EAE A;  4P71 C;  4M78 G;  3X24 B;  2RHZ A;  4JRP A;  4YRE A;  2HBP A;  2ALY B;  4J6X A;  4IUU A;  2DK3 A;  2LTO A;  2RJE A;  2EJ9 A;  4OB1 B;  5GAM g;  3WQZ A;  2DXU A;  2M9U A;  4OGC A;  3C4S A;  3CCS A;  2RB6 A;  5FLX E;  3QHS A;  3HXZ A;  4PJO B;  3FIF A;  1X56 A;  1ASZ A;  3L2Q A;  2P4T A;  1NJ1 A;  4HA8 A;  3S3N A;  5FRM A;  5D6X A;  3M9Q A;  2PME A;  4LDU A;  1TH7 A;  2CZ1 B;  1WYD A;  3A5Z A;  2EQU A;  4JRI A;  3VUZ A;  5GAN 6;  1XTD A;  2DPP B;  1WLE A;  4K87 A;  2ODR D;  3OYH A;  4RMO A;  3ASK A;  2CJ9 A;  3JCM d;  2KDS A;  4XU2 A;  1N9S A;  4FT2 A;  3MCA B;  4LD9 K;  4P74 A;  3A8O B;  2YHT A;  3A5Y A;  4CH4 A;  3M53 A;  3JB9 D;  5GMK h;  2ZPF B;  1VQ7 A;  1JJC A;  4YRG A;  2QQ9 A;  2NS6 A;  3RUX A;  1JB0 E;  5A0D A;  4YRP A;  3JSC A;  4XQ3 A;  5CVI A;  3JCM X;  3MEU A;  4EDU A;  2C06 A;  3AHU A;  1IRE B;  3MF1 A;  4DA4 A;  4A4F A;  5J39 A;  1YJN A;  5K1X A;  3LWI A;  4XTW A;  5GAN 4;  3IG2 A;  5LJ5 j;  4HWR A;  2E70 A;  2EWN A;  2ZZE A;  5C6S A;  2E10 A;  2ART A;  3HXV A;  4TTV A;  2XU8 A;  3FB9 A;  3ME9 A;  4PL6 A;  3CCE A;  1VQP T;  2E41 A;  4WF2 A;  1X2G A;  2RI2 A;  1VQL T;  1NNH A;  5GMK m;  1QVG A;  4QVD A;  2PUK B;  1KG1 A;  2VGM A;  4PJO F;  4LNS A;  2GFA A;  1LOJ A;  2QA4 T;  3L4G B;  2RM4 A;  3OYB A;  2KQW A;  3VQX A;  4M7D D;  4K86 A;  2BKD N;  1KQ2 A;  4YYE A;  3OYA A;  5GAM d;  4JJN K;  4BAC A;  1UB4 A;  2RI3 A;  4HCC A;  3OYD A;  2ZXF A;  4EPC A;  4P75 A;  1VQ7 T;  4UP7 A;  4C5E A;  5GAN d;  1VQK A;  3V7S A;  2ZPH B;  1VQ6 T;  2G3R A;  3OYF A;  3TEG A;  4M7D B;  5LJ5 e;  4TVW A;  4RQE A;  1YHQ T;  1G5H A;  1ZQ1 A;  1YJN T;  1KMN A;  1B70 B;  3BDU A;  3PNW C;  4TVA B;  1Z7M A;  3CBO A;  3GNG A;  2ARU A;  1VQL A;  2C7I A;  3URG A;  4E51 A;  3BJU A;  2JN0 A;  4IUQ A;  4LDV A;  4KT0 E;  1ATI A;  3CCE T;  2YLB A;  3L4G A;  3I55 A;  2DTO A;  2QEX A;  3OQ5 A;  4Q6G A;  4HKE A;  3OS5 A;  1I4K 1;  3CCJ T;  4ZN3 A;  4C92 G;  3CCU A;  4M77 F;  2ARS A;  2RHY A;  1SRY A;  2ZPI B;  1QP3 A;  1YGB A;  2AKW B;  3CPF A;  2I2L A;  2J3M A;  4C92 B;  4N4I A;  3CCV T;  3TEH B;  1KQ1 A;  1NPP A;  3OYE A;  5KNN A;  4WI1 A;  4J7F A;  3QTC A;  3L2W A;  1M1K C;  2HD0 A;  1YHQ A;  3OS0 A;  5GAN 8;  4HT9 A;  3TRE A;  4CH6 A;  1OZ2 A;  1SET A;  3OYG A;  3SWN A;  3JB9 H;  1QE0 A;  1BKB A;  2X4X A;  4R56 A;  4C92 D;  3JB9 I;  1YFS A;  11AS A;  5FRN A;  1BYM A;  2DQ3 A;  4UC4 A;  4YRJ A;  1QF6 A;  3CMQ A;  3OBW A;  3E9H A;  3I55 T;  3CXC A;  4YRL A;  4KBM B;  3HFN A;  4ZTZ B;  4C0D B;  4F7U A;  3ZEH A;  2ZPG B;  3A8L B;  1HTT A;  5CKB A;  2FVU A;  3SDZ A;  1G5V A;  2EQJ A;  4FM4 B;  4XEO A;  3CCQ T;  2JTF A;  2QQA A;  3CC2 A;  1UEB A;  3CCJ A;  3HRI A;  2ZZD A;  4F7U B;  1WNL A;  3PIP A;  2DXC A;  4NS5 A;  4DPG A;  3MP8 A;  4J6W A;  4N0A C;  2QA4 A;  1MHN A;  2V8J A;  1VQZ A;  2E6N A;  4E7H A;  4H2X B;  4LDW A;  2I4M A;  1X6O A;  3CMA T;  3PT9 A;  1LYL A;  4DQ2 A;  2EAY A;  3INZ A;  1EVL A;  4OMF B;  3S3M A;  1H4V B;  4BY6 C;  2QTX A;  3QYH B;  3NTH A;  2EL9 A;  3OB9 A;  3QO3 A;  4HT4 A;  3JCM f;  2RHI A;  1YFT A;  1YCY A;  2R5M A;  3C12 A;  4C8Q E;  2AMC A;  3A8G B;  3GNF B;  3OMC A;  2Q7E A;  4C92 C;  2DKG A;  3RMS A;  1NYQ A;  1YBY A;  2D0Q B;  1B34 B;  4M7A F;  3RF1 A;  2CIM A;  1YFR A;  2CZ0 B;  4FIB A;  1YIT A;  4PG3 A;  5M9O A;  1VQ9 A;  2Q5I A;  4RDX A;  1X01 A;  3RIR A;  2DXB A;  1VQO A;  5IAY A;  4MML A;  1Y96 B;  1I5L A;  1USY A;  3H8Z A;  1QP2 A;  4XU3 A;  1V29 B;  2GQV A;  5I2M A;  4P72 C;  1NJ6 A;  1L0W A;  1FX7 A;  5FU7 B;  3GOX A;  4KUL A;  1NJI C;  1M4Z A;  1R8O B;  3V8L A;  3TUP A;  3MF2 A;  3QDR B;  1Y96 A;  1W4S A;  1PYS A;  1B70 A;  3EFS A;  1QVF A;  1Q81 U;  2DVE A;  3BFM A;  4N4G A;  2ZZF A;  5C52 B;  3V7R A;  5GAN 3;  1H64 1;  3LYI A;  1ZHI A;  1JJC B;  4M75 C;  3LWH A;  3R6O A;  4XTY A;  4QW2 A;  1ADY A;  1UGQ B;  3CCL A;  4O2D A;  3SWN B;  5A2Q E;  3CD6 T;  3CBM A;  3IAL A;  1VIF A;  2XDD A;  2XG8 D;  1VQ4 T;  3TEE A;  2X35 A;  1VQ8 A;  2DAQ A;  2LVM A;  1PSE A;  1Q86 U;  2HQX A;  4CS2 A;  3HFV A;  2E1H A;  5KE2 A;  4EMK B;  3G4S T;  4CI0 C;  1NJ8 A;  2RHS B;  2D9T A;  3QII A;  4XTX A;  3I7F A;  4H2T A;  4BWA A;  2R57 A;  3KUF A;  2F5K A;  2LQ8 A;  4XTU A;  2J3L A;  2FYK A;  3C95 A;  4CS4 A;  5HY6 A;  3FDR A;  1H3Z A;  2DIG A;  4H2X A;  5F5W A;  5HGQ A;  3R07 A;  3E9G A;  3S3O A;  4R55 A;  2DDZ A;  3BW1 A;  4NL2 A;  3P8T A;  3I56 T;  4JS5 A;  1E1O A;  2XI9 A;  3UDC A;  1U1T A;  1X75 C;  3FLG A;  4XU1 A;  3JCM h;  1W2B S;  1KC8 C;  4BDZ A;  1VQK T;  1KOG A;  3V8J A;  4XK8 E;  4M78 C;  3HRS A;  3H6Z A;  3CCM A;  1JRI A;  1Y07 A;  4ELY C;  3X25 B;  4C8Q D;  4PHC A;  5DLQ E;  4H2Y A;  3CC7 A;  4J5Y A;  3L2R A;  4EMK A;  5LJ5 f;  3JCM Q;  2L3R A;  3QUI A;  5GAO n;  3ICA A;  4YCU A;  4AH6 A;  3P8B B;  2XDP A;  5LJ3 h;  5C53 B;  3HRU A;  3M4Y A;  3RKX A;  4YPF A;  1S72 T;  4OLF A;  4YRK A;  1WQW A;  3JB9 F;  3JCM P;  4Q15 A;  3LC0 A;  3A7U A;  2JTM A;  3O8V A;  4J7I A;  1VQ9 T;  4YP0 A;  3QJY A;  4A53 A;  2JOY A;  1M90 C;  4Z02 A;  3BY7 A;  3GF5 A;  1M9S A;  2XGT A;  3HFZ A;  3MP6 A;  1RL2 A;  5CQY A;  1BBW A;  2DEQ A;  2QDY B;  3LH0 A;  2P5I A;  1WPY A;  4P5N A;  5CIU A;  3VYH B;  1G5I A;  1OZ3 A;  2EQK A;  2QXF A;  4OB3 B;  3PGG A;  3NET A;  2L89 A;  4XAX B;  3BDL A;  1IZ6 A;  3ER0 A;  4C92 E;  5LJ3 e;  5EG2 A;  5CKF A;  3ZBD A;  3PTA A;  3UGQ A;  3WVD B;  3QKJ A;  4HWO A;  2QQB A;  2OTL A;  2ZT7 A;  1O75 A;  3RAC A;  4P73 C;  1BI0 A;  3QO8 A;  4GY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...