4XU0A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 73 that has a 2'-methyl on the ribose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 96
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu0A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu0A01
4C8QF 1H4TA 4M7AE 4PJOC 3HXUA 4K88A 2C8MA 2CJ9A 2IY5B 3VQVA 4KR3A 3W3SA 4YRCA 5LJ5e 2I2LA 4M7AG 4PJOB 5GAN6 3TEGA 3SWNA 2DTHA 3JCMg 4XU2A 4PNOA 3NEMA 1NJ5A 4XEMA 4M78C 4M7AA 1I81A 1FYFA 3FIFA 5LJ5f 4YYEA 4YRGA 4UP7A 2XTIA 4C8QE 4M7AD 4DPGA 4CH6A 4YRPA 1YFTA 2DEQA 3JCMd 3IALA 4TVWA 4UP9A 1KOGA 5GMKm 2AMCB 1BIBA 1NNHA 2Y90A 4C8QG 1WQWA 3JCMW 1X55A 1E1OA 4M75F 3BW1A 2QHVA 2Q7EA 3QO5A 2I4MA 5GANj 4C8QA 2ZXFA 3VQYA 5GAOl 3QSUA 3REXA 2DQ3A 4P75C 4XTWA 3RKWA 4C8QD 2DZ9A 5GAN3 3HRIA 3M4GA 3NELA 4JLIA 5GAOq 3BDUA 1WYDA 4H2XA 1NYRA 3L4GB 3RUXA 5GAMg 1SERA 3V7SA 1G5HA 2HNIA 3P8TA 3BY7A 4M75E 2ZZEA 3V8JA 3IKLA 1U1TA 3EFSA 3HFZA 5GAMd 3HY1A 5GAN5 3JCMh 3IG2A 3INZA 4M75G 3LSQA 1NJ6A 2ARSA 5KNNA 2E1HA 4QVCA 3QUIA 1SRYA 4M75A 4F7UE 2EJ9A 5LJ5g 4P72A 3JB9F 2Q7HA 3A74A 2DDZA 3A7AA 4M75D 5K1PA 4XU1A 4P71C 4XU3A 4HWPA 4M7DF 2J3LA 2YHTA 2I4NA 1Z7NA 4RCBA 5LJ5d 1WPYA 1H641 2AKWB 4OLFA 4YPFA 4HA8A 1PYSB 1KMNA 1BIAA 5CAIA 3GIBA 4TVAB 3JB9H 4YRKA 3P8YA 4YRNA 5I21A 1ATIA 4M77C 2EL9A 4YRRA 4YRIA 5C52B 5GAMh 4P3OA 3UH0A 2P5IA 3VU3C 5LJ3j 5GMKe 3A7UA 2YLBA 4M77B 4JRIA 3JB9G 1M5Q1 5GAN2 1HC7A 4M7AF 2ZR2A 3LC0A 4H2XB 4J6YA 4PHCA 1U1SA 2E64A 2ZT7A 5GAOn 1HTTA 4QVDA 4H2WA 4P74C 1BBWA 3RL6A 3JB9D 4CS3A 5LJ5h 5GMKl 4XTXA 3JCMX 2I4OA 3HFZB 1X01A 3VQXA 1B70B 3P8VA 3VBBA 1HXDA 1HK9A 3HTZA 4L87A 1EVKA 4RDXA 2CJAA 1SETA 3A7RA 1X2GA 2RB6A 1LNXA 3JCMV 2FB7A 4YRFA 5E3IA 1EVLA 1EIYB 4RCCA 3HSBA 3JCMJ 3RERA 4XU0A 3JB9J 4K87A 2RHQA 3QNEA 1YFSA 2QHSA 5LJ3h 3SB2A 3JCMc 2VC8A 2PMFA 3A5YA 1B7YB 4C92F 3CMQA 3I7FA 3A32A 3DSQA 4M78B 5DY9A 4HT9A 4DQ2A 4H2TA 3RESA 1Y96A 1E24A 5GMKi 3TEHA 4YRLA 1B34B 3JCMQ 4ZIBA 4CH3A 2DQ0A 2ZT6A 2FYKA 2ZNJA 4CS4A 2E10A 3EFRA 2ZT5A 4H2UA 4M7DC 3HXWA 4CH4A 4C92E 1WU7A 3LSSA 3PCOB 3VQWA 1N9SA 4EMKC 4F7UF 4TWAA 4EO4A 3AHUA 4HWRA 4XTYA 4H02A 4M7DB 3JCMP 1JJCA 2ZTGA 4C92G 1BBUA 3HXYA 4Q15A 3HXXA 2ZT8A 5GAMj 3TUPA 4EMKB 1YCYA 1C0AA 4XEOA 4C92A 1VQZA 1YGBA 4NL2A 4YRTA 1ASZA 1QF6A 3SWNC 4C92D 2C7IA 4JUVA 1X2HA 4M7AC 4J5YA 2DXTA 2DU7A 2I4LA 4E51A 4G85A 2YLCA 4HWOA 3SWNB 5GAN4 5LJ5j 3A5ZA 3E9IA 4M7AB 2QHTA 1IL2A 4F7UG 2VXEA 3RACA 4BW9A 2DTOA 2RM4A 5GMKh 4A53A 1NJ1A 4V2SA 4PJOE 4F7UA 2QHUA 4C8QC 1E22A 5K1XA 1GGMA 4P73A 3TEHB 1L0WA 4XQ3A 2ODRD 1NYQA 1NJ2A 4P3PA 3UGQA 4C8QB 4M78E 3HY0A 3E9HA 1EOVA 3ICAA 3ERRA 1G51A 2ZCEA 1I8FA 4O2DA 4LNSA 1H4VB 5C53B 2RA2A 4AH6A 2DTIA 2ZZFA 2JN0A 4X9CA 4X5OA 2AMCA 5GANe 4BWAA 1X54A 1EQRA 3MEYA 2EJFA 4M75C 3RKXA 4RMFA 4P72C 2Q5HA 5GANf 5GAOp 4NCXA 4CS2A 1YB3A 2E3CA 4M75B 1KQ2A 3V8LA 4YRQA 1I4K1 3QO8A 4YRSA 1USYA 3L4GA 4XTUA 5C51B 4EX5A 4X9DA 2RHSA 4YRMA 4XTZA 3FB9A 2ALYA 2QTXA 3FJPA 3RF1A 4F7UB 3REUA 4J6XA 3PZCA 4YDQA 3L1AA 1J5WA 12ASA 1KMMA 1H4QA 4WI1A 1NJ8A 4UPAA 4M77F 1D3BA 3V7CA 3QHSA 3QO7A 1WQ7A 2DKGA 3V7RA 4H2YA 4OP0A 4XTVA 4H2SA 4CH5A 1WLEA 3JCMb 2CGHA 2P0LA 3RIRA 2ARTA 4WJ3M 2EAYA 2ZIMA 5GMKj 2EWNA 2ZR3A 3OD1A 5GAN8 3QTCA 1WNLA 4HT8A 2AKWA 2ARUA 1PYSA 2ZINA 3RGLA 4P71A 4M77E 4TVAA 4HVCA 3BFMA 5GANg 4NL3A 1N9RA 4WF2A 5LJ3e 4YREA 3IKMB 11ASA 4RQFA 2ZNIA 4M77G 5GAOr 1USYC 3HFNA 2DVEA 3HFVA 3NENA 4TQDA 4PJOF 4EMGA 5GANd 4M77A 1RIQA 5LJ3f 4MMLA 2E41A 4H2VA 1G5IA 4N0AA 3M4QA 2PMEA 4K86A 3BJUA 4M77D 4TQFA 4WJ4A 1ADYA 4ZTUB 3HXZA 4KQEA 2RHSB 3WQZA 2RHQB 5ELNA 2Q7GA 4M78F 2ALYB 1SESA 4HWTA 2E65A 1EFWA 2EJGA 1B70A 4P74A 4YP0A 1JRIA 1TH7A 4YCUA 2J3MA 1H4SA 5HGQA 1D3BB 1X56A 4UP8A 1Y96B 3KFUA 3M4PA 2IY5A 1LYLA 1KQ1A 4PJOG 1I5LA 4TVYA 3L2ZA 5GAOm 1EIYA 2ZZGA 4YCWA 5GANh 4PJOA 4NOYA 3V8KA 3JCMe 1Z7MA 4MMKA 3PGGA 2ZGWA 5GAN7 4PJOD 4YCVA 2RD1A 4YROA 5ELOA 1JBMA 3RKYA 4JRKA 4M78G 2CJBA 1B7YA 1MGQA 2CIMA 2K57A 3JCMf 4C92C 1JJCB 4EMHA 4HWSA 3HRKA 2VXFA 4M78A 3UGTA 3NETA 2E5AA 4Q6GA 1N9WA 3MF2A 1LOJA 5LJ3g 1ASYA 1W66A 1B76A 1M8VA 3HFOA 4N0AC 1B34A 3MF1A 4M78D 4C92B 4Y91A 4J6WA 2DU5A 3R07A 1YFRA 4M7DE 4J15A 2Q5IA 4ZTZB 5LJ3d 1B8AA 2DJZA 1ADJA 2ZIOA 3JB9I 1QE0A 4M7DG 3PCOA 5F5WA 4G84A 2DXUA 3HXVA 2XGTA 5GAMe 4M7DA 1E1TA 3A31A 4P75A 2G4CA 2DZCA 4YRJA 4PG3A 3QO3A 3G1ZA 2ODRC 4P73C 4TTVA 4M7DD 4P3NA 3UFGA 4EMKA 4RQEA 5GAMf 4KR2A 4A54A 1LJOA
chains in the Genus database with same CATH superfamily
4C8QF 1UHCA 3SEMA 2HQXA 2IVWA 1U3OA 4M7AE 1OX8A 4K88A 5DLOA 2IY5B 3VQVA 3VYGA 4YRCA 5LJ5e 1JXMA 4PJOB 3M54A 2P0QA 2ZPGB 1AT1B 4PNOA 1SRMA 2EYQA 1WLPB 4YRGA 4UP7A 4C8QE 3CPFA 4M7AD 4J7IA 2H3JA 1VOMA 1FMKA 2DEQA 3JCMd 2JOYA 2AMCB 4FYWB 3A8LB 1VQOT 3A8OB 1M90R 1RUWA 3M4YA 1IGUA 2Q7EA 4ZGEB 2I4MA 2ZXFA 1WFWA 3OW2S 5GJVB 4XTWA 4C8QD 2NYSA 4ME7A 1MV0B 1WYDA 3BDUA 3OYLA 2D8HA 1SERA 3V7SA 2MYSA 2CZ1B 1M4ZA 2DVJA 3NTHA 3NHNA 3QZ5B 3TSWA 1Y57A 4Z88A 2OTJQ 2PUKB 1C1AA 1U1TA 3EFSA 5GAMd 5GAN5 1UUEA 3OB9A 4M75G 1BCOA 2CYZB 1NJ6A 2CUDA 1ZA2B 2L8DA 2DE0X 3QUIA 5J39A 4F7UE 2EJ9A 5LJ5g 3NGPA 2M0YA 3VS6A 5FWCA 3JB9F 2GBQA 1XJWB 1NG2A 5K1PA 4LDVA 1JEGA 4P71C 2J06A 4M7DF 2DYIA 2YHTA 4X1VA 2EQUA 3ULRB 1H641 1EZZB 1VQ9T 3OBWA 3P8HA 4HA8A 2OX7A 1GXIE 1PYSB 3QIIA 4RUGA 1KMNA 2LQNA 1BIAA 2DBKA 3JB9H 2BTTA 4KGXB 2DJQA 3CXCP 4PK4A 1QVGA 3QJYA 4J7FA 1FMWA 2F2WA 2EYYA 2DFUA 3VU3C 2DL5A 5LJ3j 5GMKe 1KHCA 1QVFP 3A7UA 4FW2A 5FWBA 5KE2A 4AFQC 1M5Q1 1Q81R 5KYYB 5KCHA 3L2WA 3CPWP 4PHCA 2ZT7A 1HTTA 1BBWA 5A0DA 1YITA 3RL6A 4N4GA 3JB9D 4IUVA 1RADB 3E1SA 1WDXA 2M51A 3CCRA 1TUDA 2LCLA 2J6OA 4N4IA 1IXDA 4L87A 2MWPA 1Z9QA 1GL5A 2HBPA 4E7LA 4RDXA 1M3CA 3CCEA 2YRVA 2FRYA 4RKUE 1PHTA 3H41A 4C0DB 2RB6A 5E3IA 3OYMA 3RNJA 4XK8E 3RERA 3JB9J 1YFSA 3SB2A 3H0HA 2D8JA 2VC8A 1YI2A 3Q1JA 1AEYA 2KY9A 2RJCA 3G1JA 2CUBA 3KFVA 4HVUA 1YFNA 3DSQA 4JJBA 2F2XA 3VS5A 3VV0A 4E7SA 1N27A 3QPHA 2BKDN 4DQ2A 3M58A 1Y96A 3TEHA 1B34B 3JCMQ 2E6NA 2L5QA 2GFAA 2NLUA 2GF7A 1YITQ 1B07A 5I11A 3OYYA 3HPWA 1IO6A 3CCRQ 2FVUA 2I0NA 5IT9E 2LP5A 4BDZA 1Y07A 4HWRA 1XQHA 3M0PA 1W2BA 2AIRB 7AT1B 4DOWA 1UFFA 3GNGA 4Q15A 3CCEQ 1CKAA 4C92A 1VQZA 1YGBA 1QF6A 1Q7YR 3UA6A 3H8ZA 3LX7A 2VB6A 3J7AF 2HL5C 4M7AC 1YI2Q 5FRNA 4ZN3A 1OZ3A 2RJEA 2I4LA 4JS4A 3RMSA 4J9BA 3CCJQ 2KNBB 3SWNB 2FPEA 2R5MA 3A5ZA 2RQVA 2D0QB 2C0TA 2DTOA 4J9IA 3UT1A 4PJNA 4A53A 1Q86C 2LQWA 2QHUA 3T9NA 2VUBA 1RAFB 4C8QC 1RAIB 1YJ9T 1NPPA 1GGMA 3TEHB 3MO8A 2XU8A 1NYQA 1VYUA 4ZN1A 3UGQA 2EW3A 3E9HA 3ICAA 4RTTA 2EYZA 1G51A 2ZCEA 4O2DA 2WSCE 1QLYA 4E7HA 5EG2A 1ABOA 1M8MA 1H4VB 5CKDA 1UG1A 1IRXA 2DTIA 3M0RA 4X9CA 3I55T 4X5OA 1YWOA 4BWAA 2HQEA 1X54A 2F1LA 1W4SA 1N8RC 1SEMA 1LCKA 3FEOA 1TS9A 1X75C 4ORZA 3EHQA 5GANf 3A8GB 4BD3A 4NCXA 4M75B 1KG1A 3V8LA 4K11A 3MJXA 1AVZC 2KT8A 2VGNA 3CMET 2MAMA 3L4GA 4IIMA 5GJWB 3KUFA 4YRMA 1X27A 4LNPA 3NMZC 4E7ZA 3BE3A 1KC8C 4DEYA 2QTXA 4YTLA 3FJPA 3CCQA 1UEBA 2KE9A 1C6VX 1K9AA 3M55A 4J6XA 4YDQA 1EIFA 12ASA 1GBRA 1KQSP 1KMMA 2VKNA 5CO7A 1BB9A 3CXCS 2K4YA 5CIUA 2DF6A 3QO7A 2DRMA 4H2YA 2EPDA 1QVFS 1AWJA 2ZPIB 5A0LA 2Y4YA 4L5GA 3H0FA 1KC8U 3S3NA 2ARTA 1VQ6A 3CPWS 5GAN8 1E6HA 3QTCA 1WNLA 2WSEE 3VKIA 2YSQA 4P71A 1N6AA 2DYBA 3KBGA 4TVAA 2FL7A 3BFMA 1N9RA 3MEWA 3OSSC 4WF2A 5LJ3e 1TU0B 1UGRB 3IKMB 11ASA 1SG5A 2ROTA 1KJWA 2J05A 4RTXA 1A0NB 4M77G 5KYNA 2XDPA 2X4YA 2ZNIA 1K8AR 1USYC 4D8KA 4FYVB 3HFVA 4EMGA 2E41A 2PMEA 3CCQQ 4OMLA 1VQPA 1VQPT 4AFSC 4TQFA 2YXYA 2CKKA 3TREA 1TUCA 1M30A 1ARKA 5CK9A 5FU7B 4HCZA 3X26B 2CSIA 4HWTA 2E65A 4UC4A 1B70A 4LVLA 1JRIA 4YCUA 1H4SA 2P4TA 4B6MA 2CDTA 4OMOA 2Z0WA 3OY9A 4KGZB 2L89A 1VQ6Q 3KFUA 5CQXA 3VS4A 3CCMQ 4PJOG 2MWOA 1EIYA 2ZZGA 2H3EB 1YIJA 2JM8A 1YIJT 4NOYA 2K2MA 5LL6S 1VQMA 1Z7MA 2QA4A 2QA4T 4N4HA 3CBMA 2E4HA 3CCLA 4J9GA 3RKYA 1BK2A 2CJBA 1MGQA 4E7JA 3R6OA 3JCMf 1RAAB 4EMHA 2C06A 4OMFB 3HRKA 2VXFA 4M78A 2E5AA 4Q6GA 1N9WA 1LOJA 5LJ3g 3C12A 1OPKA 2HD0A 1H92A 1M8VA 3VS1A 1U8RA 3UPUA 3ASKA 3M5AA 4LXCA 1YFRA 2HSPA 2ZPFB 2AT1B 3DB4A 3GP8A 1Q82R 4AG2C 2DJZA 2COYA 4BI3A 4JZ3A 2KK4A 3JB9I 1M90C 4M7DG 4Z02A 5F5WA 4G84A 4C5GA 1G3SA 2LNHB 2RHYA 4LD9K 2E3IA 2CZ0B 4LDYA 2XGTA 2Y4XA 4IUUA 2KR3A 3A31A 2G4CA 4CRIA 4PG3A 4P73C 1NJIR 5GAMf 4KR2A 2HKNA 4A54A 1LJOA 3OYKA 2PVGB 3HXUA 4HCKA 1JXOA 1VQMQ 3CMAA 2WSFE 2LJ1A 4JRQA 4PJLA 4KR3A 2V8IA 3CCLQ 2XHCA 2CSQA 1X6BA 2GQVA 3VUZA 2I2LA 2DM1A 3UDCA 3HHTB 1ZX6A 2RI5A 5GAN6 2DTHA 2J6FA 2VASA 3NEMA 2A28A 4M7AA 1FYFA 2BUDA 3FIFA 5CQYA 1BI1A 2SEMA 5M9OA 1X43A 1UGSB 2M1HA 1D1CA 1WHKA 5CCAA 1VQKQ 3IALA 1PWTA 2DMOA 1KOGA 5GMKm 2PUOB 2YUQA 2HSEB 3PVQA 3JCMW 2RK1A 3TQ7P 1E1OA 3BW1A 3QO5A 1DJ7B 2K9GA 3OYDA 2M0OA 5GANj 4C8QA 5GAOl 2COWA 3QSUA 2BZYA 3REXA 4QW2A 2DZ9A 3CEYA 3EG9B 1CKBA 2NUPA 5KYWA 2EGEA 2EKOA 5GAOq 2PVDB 4H2XA 3OYAA 1QCOA 2OTLT 3SDZA 3CMAQ 3P8TA 4P5NA 1G3WA 4OB2B 2ZZEA 2AZVA 2GTOA 3EAEA 1Q81C 2QQBA 1PG5B 1KQSS 2DXBA 3CCUA 2DILA 3LSQA 5KNNA 1FMVA 4QVCA 1SRYA 2CP2A 3CCVA 4BUGA 4J9EA 3A74A 5CKBA 2ED0A 4BDYA 2FPFA 4XU1A 2JS2A 3MEAA 4LDUA 2GFUA 1M1KR 4ZTFA 2AKWB 1QKXA 4OLFA 4YPFA 4FYXB 4ANJA 2W0ZA 4HT4A 1MMNA 4AT1B 3P8YA 4YRRA 2EL9A 1PD1A 4GBQA 5C52B 1ACMB 3I9QA 3OYCA 3HKSA 2RN8A 3EGDA 4M77B 4C5IA 1BI3A 3CCSQ 2ZPHB 4M7AF 1WJRA 4H2XB 4J6YA 1U1SA 2SRCA 1VQLA 2MPXC 2EFIA 4H2WA 3X25B 3CCUQ 1I1JA 3LH0A 3MP8A 5LJ5h 3PE0A 3CCVQ 2HQHA 4XTXA 3JCMX 1QCNA 1X01A 1GBQA 3P8VA 1HK9A 3HTZA 1PNJA 3EH1A 2F69A 4JJDA 1K73U 4C5HA 3PNWC 1WHHA 2RQTA 3VS7A 3META 3GOXA 3E19A 2OTJA 2OTJT 1LNXA 3JCMV 2LCSA 2VV5A 1NLOC 3NTIA 1F1BB 2QHSA 1Q7YC 3JCMc 1WJQA 3UF4A 3G71A 2KYMA 1G8XA 1B7YB 4HXJA 3A32A 4C0FA 1H3ZA 2PTKA 2RPNA 3H6ZA 1M3AA 1G3YA 5D6WA 4ZIBA 1NEGA 2L3PA 1VQLQ 1VQNA 2DQ0A 4CS4A 2D9TA 4Y92A 1RLQC 2IPOB 1IHVA 3G7ZA 2LNVA 4H2UA 5FU6B 1QKWA 2K5IA 2F2VA 2LMJA 8AT1B 3HXWA 4LN2A 2XG8D 2LX9A 3LSSA 3PCOB 2O9SA 2V26A 4EMKC 3L2RA 2QYZA 4F7UF 3AHUA 3OS1A 4XTYA 4M7DB 4J83A 2CP7A 1JJCA 4C92G 3HRSA 2ZT8A 5GAMj 3TUPA 2ZAEA 4IIOA 3OBYA 3OW2A 2CS7A 4XEOA 3LLRA 6AT1B 2C7IA 3G71Q 2VWFA 1R0CB 2DAQA 2YLCA 2KVQG 4HWOA 3FC3A 1OX9A 4PLLA 4DBQA 3TEEA 1AZGB 1D0YA 3MCAB 1IL2A 3RACA 2RHXA 3RBBB 4BW9A 2RM4A 5GMKh 2QASA 1NJ1A 4PJOE 1BKBA 1VQNQ 1S72Q 2G6FX 4FU6A 3QZ9B 4RTUA 3OMCA 4P73A 3E2UA 1M27C 1M2VA 3I5SA 1AOJA 3QDRB 3FJ5A 2H8HA 1NJ2A 1D09B 3EHRA 3DKMA 5A2QE 3EG3A 3OYEA 3ERRA 1VYTA 1EFNA 1JJ2P 1VIEA 2DD4A 1SHGA 1KHIA 1NYFA 4AH6A 4JRPA 2CT3A 2ZZFA 2EQJA 2JN0A 1YITT 1WI7A 2HL3A 2O4XA 5GANe 2JVVA 2EJFA 4BI4A 2J6KA 3CCRT 4RMFA 1I07A 3OYGA 1TG0A 5GAOp 4ZNXA 3RDVA 2E3CA 1K0SA 2XMFA 5DLQE 3M57A 1IB8A 3CCET 3M9QA 2EIFA 4BY6B 4XTUA 4A4HA 1WXTA 1K8AC 2RHSA 1TUGB 1NE8A 3FB9A 2ALYA 5KYUA 2IIMA 3RF1A 1YI2T 4II1A 1YWPA 2OI3A 3UWNA 3CCJA 1RI0A 3CCJT 1H4QA 2DETA 1OEBA 5HCKA 3UATA 1VIFA 4UPAA 4NS5A 1MUZA 1P92A 2PQWA 1ZQ1A 2W10A 1WQ7A 1PD0A 4FCYA 4OP0A 2KSSA 2L3QA 4CH5A 1WLEA 1T3LA 1UDLA 4RTZA 3JCMb 2NUTA 1ZBJA 3MP6A 2CGHA 3RIRA 4QVZA 3EFOA 2EAYA 3OYHA 1IHWA 2QDLA 2EWNA 2ZIMA 4O6JA 2ZR3A 3HL8A 2DO3A 3MPUB 4Z89A 2B86A 2QEXQ 2CP6A 2KMTA 2ARUA 2ZINA 3RGLA 4DEXA 4HVVA 2O4XB 3OYJA 5GANg 3LWHA 1WXUA 1ZSZA 1AWOA 3HRUA 1M1FA 4YREA 1G3TA 4RQFA 5IN1A 1PRLC 2A0FB 3HFNA 4FW1A 3NENA 1RIQA 3PMIA 1G5IA 3M4QA 4LVIA 5KH6A 3BJUA 1VQ8A 4FSSA 1ADYA 4ZTUB 2RHSB 3H0IA 2BZ8A 4E7KA 1BCMA 2ALYB 1Q82C 3I56Q 5CVIA 1V1CA 4YP0A 2DL7A 1B7TA 3QYGB 4CI0C 4LUEA 2J3MA 3IQLA 1QMCA 1MNDA 1VQ7A 3QG1A 1X56A 4FIBA 2KGTA 1Y96B 2LDMA 1LYLA 1YJNQ 3GBQA 1KQ1A 3J80E 1NJIC 4OB0B 2KROA 3QYHB 4YCWA 4PL6A 1CSKA 1YNZA 3JCMe 3EGUA 4MMKA 3PGGA 2ZGWA 3HRTA 4KH1B 2HAXA 2RD1A 4PLIA 1JBMA 2QDYB 5CR2A 4M78G 2AK5A 1Q86U 4EIKA 1WYXA 3FRNA 4HWSA 1ZSZB 5EC7A 3R6NA 1KSWA 1HD3A 1ASYA 3CBPA 3URGA 4N0AC 2K79A 1VQ8Q 4C92B 2O2OA 3LGLA 4Y91A 4J6WA 4L59A 1YHQA 3R07A 2QGFB 2EVRA 1UE9A 2M9UA 1XNIA 1K9MC 3PMTA 4BE2A 3OS0A 5GAMe 3A5ZB 1VQ7Q 4YRJA 2DZCA 3G1ZA 1X2QA 4OF1A 4LDWA 2RK2A 1AZEA 3MQZA 1KK7A 1N8RU 3M0SA 4EMKA 1RI9A 1W6XA 2COZA 3UA7A 3FDRA 3CCQT 4P3PA 4JLGA 2R5AA 1H4TA 4KH0B 4PJOC 1NBEB 1K9MU 2C8MA 1J3TA 4MDXA 1SRLA 1V76A 2YDLA 3O5ZA 2K2VA 2BIVA 4M7AG 2RQWA 3JCMg 1UECA 1NJ5A 4E2FB 4XEMA 1RAGB 4WTOB 1JJ2S 1VQ6T 3CCMA 3N5BB 3CCMT 4DPGA 1YHQQ 4YRPA 4VUBA 3CXCA 2CREA 2D0NA 3NFCA 2FZGB 3TVTA 1BIBA 2RI3A 1NNHA 2O9VA 2Y90A 4OMMA 4C8QG 4R55A 4M75F 2QHVA 3L2QA 1QVFA 2RJDA 1SKUB 2DIGA 2MF2A 1T3SA 2CH4W 3VQYA 2BE7D 4ELYC 3CPWA 2KBTA 1G83A 4P75C 3RKWA 3NELA 2R57A 2YRCA 3SD4A 4JLIA 2AHJB 1YBYA 3LYIA 4AMCA 1NYRA 3L4GB 3RUXA 5GAMg 2ENMA 2KXCA 1G5HA 2HNIA 4IUTA 2KQWA 3BY7A 4M75E 1M2OA 4PFOA 3V8JA 1UTIA 2GQIA 3IKLA 3HFZA 3HY1A 2JZ2A 2NWMA 2JUFA 2E1HA 4OGEA 2F5KA 3H9NA 2QQAA 2LZ6B 2HDAA 1ZSGA 2DA9A 2Q7HA 4KT0E 3A7AA 4M75D 4OMPA 2LQ8A 2QTVA 4XU3A 1LVKA 2LC4A 4HWPA 2I4NA 5AT1B 1VQMT 1Z7NA 5LJ5d 3CC7A 1JO8A 1WPYA 2A8EA 1D0ZA 3CCLT 1W1FA 2RF0A 2V1QA 4ELZC 5CAIA 4WJ3M 4TVAB 2R58A 1K0XA 4YRNA 5I21A 1ATIA 1OPLA 2QK0A 1TTHB 4YRIA 4AG1C 4Q5WA 2EKHA 2RI2A 1GCQC 5C6SA 3NPFA 1FWZA 2YLBA 1VQKA 1AHJB 2CP5A 4JRIA 1Y0MA 3JB9G 1VQKT 5GAN2 2RQUA 3PFSA 3LC0A 2VYTA 2E64A 2EQKA 5CKFA 5GAOn 3A98A 2L2PA 4P74C 2YUNA 3S3MA 1VQ5A 4CS3A 2RMOA 1X6OA 5GMKl 4RTYA 5I22A 3VJPA 3CD6Q 2I4OA 3HFZB 2XDDA 1UHFA 3VQXA 1B70B 3RR6A 2ZPEB 4C0DC 1LPLA 1WJSA 2E6ZA 2RHZA 2RJFA 3CMAT 2QGGA 3CC7Q 2CJAA 2D1XA 1M90U 1X2GA 2DIQA 1EIYB 2FB7A 4YRFA 1EVLA 1OV3A 4XU0A 3ZL7C 2RHQA 1BI0A 3QNEA 4Y28E 1QCFA 4DOVA 4A4GA 3QWXX 3PT9A 2AKKA 4OB1B 1YJWA 1G2BA 4E47A 3GNFB 4J9DA 1GFDA 5KYXA 4M78B 2K6DA 4HT9A 4OVAA 1E24A 4ATOA 1QP3A 2JMCA 1U06A 4CH3A 2K5LA 1K76A 2FYKA 1QVGP 3EFRA 2E10A 3VYHB 3SHWA 2ZT5A 1VQ5Q 1O9SA 4BB7A 4CH4A 1WU7A 3VQWA 1I5OB 1N9SA 4O5VA 2V8JA 3CC2Q 4CC2A 4EO4A 1VQ4A 2BE9B 2L3RA 3JCMP 4KUIA 4AFUC 3WXMB 3GLXA 2C0IA 4KRTA 3CCSA 3CC4Q 3CCST 1BI2A 1WIEA 3TCJA 2XICA 5FRMA 1VYVA 4YRTA 1ASZA 4ZGDB 3SFMA 2E5KA 1KC8R 3SWNC 2K3YA 2X4WA 3CCUT 3LW5E 2LCCA 3PIPA 1X2HA 2JTEA 4J5YA 4E7IA 3MHXA 2HMAA 3CCVT 1XOVA 1PCXA 1YJWQ 4G85A 4LE9A 5J26A 2F5TX 4AFZC 2XKOC 2YUOA 3S6WA 2XIDA 4R0KA 4M7AB 3HP9A 2PZ1A 1KQSA 2QI2A 1Q81U 3QKJA 3THKA 4F7UA 5K1XA 2JM9A 2EGAA 4IUPA 1X2KA 3VRZA 4DBFA 1L0WA 2CZ6B 4X34A 5I2MA 3C95A 3M0QA 3QJ6A 4HVWA 2LJ3A 4C8QB 4M78E 3G4SA 1VQ4Q 3HY0A 3TU4K 5L23A 1I8FA 3REAB 4LNSA 2RQRA 2NUPB 2L3SA 5KYWB 4R56A 3LGFA 3OYBA 2ZZDA 3C0CA 1VQLT 1SPKA 1NPRA 4CC3A 2CH4A 4DBRA 2AMCA 5FW9A 5HKCA 3E9FA 4RTVA 1EQRA 1C0MA 4M75C 1W2BP 3G6EA 3EG2A 2DEUA 2Q5HA 2MK5A 4P72C 2DL8A 1AWXA 1YN8A 1AD5A 3OSVA 4CS2A 4A4EA 1YB3A 2LVMA 4PJMA 1KQ2A 1R0BG 3QO8A 2FG0A 1USYA 2KAFA 4EX5A 3EG0A 2O31A 1Y7XA 2DPPB 4XTZA 4GLKA 5D6YA 3P8DA 4F7UB 1UGPB 3REUA 3G71T 1BU1A 1PSEA 1VUBA 3PZCA 3G4SQ 2DERA 1J5WA 4ZGJB 1NJ8A 1D0XA 4M77F 4B9WA 1D3BA 3MEVA 3I35A 3V7CA 3QHSA 2RHIA 3OYFA 2DKGA 4FSXA 2CP0A 4KUDK 3PIOA 1S1NA 4J8OA 2DL4A 5DM7R 1NZ9A 1S72T 4L6V5 4M4ZA 1S72A 1VQNT 3EGDB 5C0MA 1Q7YU 2P0LA 1OYXA 2JT4A 3OD1A 3G6EQ 2B8AA 3C94A 1PYSA 2EBPA 1WHJA 4M77E 2MCNA 4HVCA 2CP3A 2K3XA 1VQOA 2P0PA 4PFZA 1HYOA 4J9CA 4D6WA 5GAOr 2KRSA 2DVEA 2LX7A 4C0ZA 4PJOF 1UGQB 4MMLA 4H2VA 2QQRA 5KYYA 5FU7C 4K86A 4M77D 1GCQA 4WJ4A 4QKUA 2A08A 8ATCB 3HXZA 3VS0A 1UJYA 2JTFA 1SESA 2YRDA 2EJGA 4P74A 1ZBXA 3OYIA 2LT1A 1TH7A 2KDSA 1O75A 5HGQA 1Y71A 2PVOB 3P8BB 1D3BB 3LWIA 4LVKA 4JPBW 4UP8A 4PFPA 1QW1A 4OMQA 2LT4A 2P4RA 3PTAA 4XAXB 1QVGS 2K5FA 1PRMC 5GANh 1RABB 3V8KA 2DLPA 1VQOQ 2GTJA 2WACA 4F17A 2O88A 4PJJA 5GAN7 1VQ9A 4PJOD 5ELOA 1MMGA 1R77A 1KD1R 2QXFA 4JRKA 2K57A 1UJ0A 3M53A 1JJCB 2LQKA 2FZCB 4MZTA 3MF2A 1W66A 2X4JA 3OS2A 2EGCA 1B76A 1B34A 3LH5A 5D7UA 3L42A 2QEXA 1GFCA 3VUBA 2QEXT 1QQJA 4M7DE 4J15A 2KYBA 2LTOA 2A37A 4F14A 2DL3A 1IREB 4Z8AA 3OQ5A 5LJ3d 1ADJA 1TOVA 2DX1A 4A4KA 2DXUA 1YCSB 1E1TA 1E6GA 3QO3A 1Z9ZA 4D8DA 3NTKA 4TTVA 4M7DD 3UFGA 3CQTA 3QWYA 2GGRA 3J81E 4HCBA 1BBZA 2CJ9A 1M2VB 4IURA 1D1AA 5L8RE 1VQ9Q 3L2UA 3MP1A 3I56A 3W3SA 3I56T 1SHFA 2QG9B 3TEGA 3SWNA 1JQQA 4XU2A 1K8AU 4M78C 1I81A 1V29B 5LJ5f 4YYEA 1MV3A 2XTIA 1KFZA 1ZLMA 1YJNA 1YJNT 2ED1A 4CH6A 1QVPA 4KBMB 1K73R 2E3HA 1YFTA 3A8MB 4TVWA 4UP9A 3QDFA 4IUQA 1WQWA 3I5RA 1X55A 4LVMA 1W2BS 5KCOA 2KXDA 3X20B 1M9SA 4MZPA 3MKDA 4JZ4A 2DQ3A 5GAN3 3HRIA 3M4GA 3O8VA 1UGVA 1VQ8T 2QQSA 2JXBA 4MZMA 3DLLA 4PKCC 1TXQA 5KYUB 2OJ2A 3JCMh 1RLPC 2X3XD 3IG2A 2RHUA 3INZA 3AT1B 2ARSA 2JNGA 2X51A 4QQDA 1VQ7T 1QWFA 4M75A 1OOTA 1H3HA 1TWBA 1SSFA 1WA7A 4P72A 2RO0A 3RMQA 1T0JA 2DDZA 2VGMA 2NUTB 3L2VA 5A0GA 2V8KA 4RG8A 2ZCFB 2X35A 3GPLA 5CKHA 2J3LA 3EFOB 3EH2A 1Q82U 4JS5A 4RCBA 4JDSA 3VS3A 1GRIA 1FYNA 1SSHA 1YJ9A 3GIBA 4YRKA 1IGQA 4FYYB 3EG1A 4M77C 2P84A 5GAMh 4P3OA 1N5ZA 2G3RA 3UH0A 1NJIU 2P5IA 1WHLA 1YHQT 1K1ZA 3EGXA 2BZXA 4ZTJA 1HC7A 2ZR2A 3S3OA 2EQIA 1I0CA 5IHNA 4WCIA 3OMGA 1U5SA 1FXXA 4QVDA 3I55A 3OA6A 1NM7A 4KGVB 1RACB 2M16A 2OAUA 2ECZA 1X69A 3ZBDA 1KIKA 1ZUKA 4LVJA 2XK0A 3OS5A 2FRWA 3VBBA 1HXDA 2HEQA 1K4US 1E7OA 4OGCA 2D6FA 1EVKA 4HKEA 2YT6A 3VRYA 1SETA 4E6RA 3A7RA 1ZA1B 3CMEA 2DBMA 4RCCA 3HSBA 3JCMJ 1YJ9Q 4K87A 4A63B 3HTRA 2KRNA 5LJ3h 5HK0A 4FL6A 2PMFA 3A5YA 2JW4A 4C92F 2JTMA 3CMQA 3I7FA 2PU9B 4ESRA 1PC0A 5DY9A 4H2TA 3RESA 5GMKi 4YRLA 5FU6C 1JB0E 3GF5A 1VA7A 5KE3A 4QT7A 5CKEA 1PM3A 2ZT6A 4GLMA 1ZUUA 3A8HB 1M1KC 2ZNJA 2FEIA 4LDXA 2NUZA 3EGXB 3I55Q 3DB3A 2K7AA 3E9GA 4EPCA 1JJ2A 2YWWA 4M7DC 3REBB 2PNIA 2L0AA 4C92E 1MNEA 2OAWA 4TWAA 1B3QA 1X6GA 2HCKA 4H02A 1WHMA 4C0GA 2ZPBB 3ZEHA 2ZTGA 2J7IA 1BBUA 3HXYA 3HXXA 5IAYA 1FX7A 4EMKB 1YCYA 3CMEQ 1C0AA 1M1KU 2C0OA 4NL2A 2CT4A 4F04B 5I2SA 4C92D 4JUVA 2EQMA 1W70A 3BDLA 2DXTA 1JU5C 3DLMA 2ABLA 2DU7A 3CD6A 4QQGA 3CD6T 4E51A 4FT2A 3U23A 5GAN4 5LJ5j 3E9IA 2E5QA 2CZ7B 4J9FA 2QHTA 4F7UG 2VXEA 2JJ9A 3FLGA 1RAHB 3CC7T 4V2SA 2X9HA 2DRKA 4J9HA 1E22A 4OB3B 2E70A 1TSFA 2MI6A 2ROLA 2DD5A 1XTDA 4XQ3A 2ODRD 3ME9A 2EYWA 3ER0A 1EOVA 1PSFA 1Q95G 1YP5A 1OU8A 1WZOA 3C4SA 5C53B 2RA2A 3ZFJA 5IXFA 2KEAA 2LRQA 2DNUA 1IZ6A 3X28B 1UB4A 3M59A 2HZYA 2KT1A 1VQ5T 2MOXA 4FT4A 4DA4A 1VQPQ 4OMNA 2JMAA 3MEYA 1WHGA 4EDUA 3CC2A 4BY6C 3OW2P 3QXEB 3CC2T 3OYNA 1QWEA 5D6XA 2A36A 3EG9A 1ZHIA 1Q86R 4YRQA 1I4K1 4YRSA 3X24B 3CC4A 3CC4T 3M0TA 2AZSA 4BE1A 3VS2A 5C51B 2LJ0A 4X9DA 2XDBA 4IKFA 1AWWA 1OZ2A 4LUDA 1M1GA 2IG0A 2V1RA 1BYMA 2XI9A 2GCXA 2MIOA 1OQKA 5HY6A 4BE0A 1YIJQ 3L1AA 3KXTA 2X3WD 3D7SB 1YJWT 1SF9A 2QA4Q 2YUPA 4WI1A 2EYXA 2VVKA 4GY5A 3V7RA 3A1PA 4JJCA 4XTVA 4H2SA 1WGSA 1N8RR 3JRZA 5GMKj 3M56A 2QAZA 4HT8A 2AKWA 3PVLA 4A4FA 1K9MR 1VQ4T 2FO0A 2XD0A 4NL3A 1G5VA 1HJDA 1RAEB 4RG2A 2FHDA 1OI1A 2DXCA 5J3BA 1KD1C 1GCPA 5AYFA 2FZKB 4TQDA 2ATCB 1HSQA 5GANd 1MMAA 4M77A 1NLPC 5LJ3f 3WVDB 2MMPA 4C5EA 3TSZA 4CC4B 4N0AA 1OULA 2P0KA 1QP2A 4BACA 2OTLA 2E12A 4KQEA 4MDWA 5ECAA 3WQZA 1WXBA 2RHQB 5ELNA 2Q7GA 2HKQB 2FPDA 4M78F 4CC7A 2NS6A 4FM4B 5FLXE 2O01E 2AKLA 4RMOA 1EFWA 1EX4A 1KD1U 2RNAA 3JV3A 5KYXB 3M0UA 3F70A 3M4PA 2IY5A 1D1BA 3CBOA 1MMDA 4RTWA 4B9XA 2RH2A 1I5LA 5IHIA 4TVYA 3L2ZA 5GAOm 2A7YA 4KULA 3QBYA 3G4ST 4HCCA 4PJOA 1PKSA 1ZSZC 5IHKA 5IXBA 1T0HA 4YCVA 4YROA 4JJNK 1R8OB 1NYGA 9ATCB 4TVRA 1B7YA 2CIMA 5HK3A 4C92C 1H8KA 1RL2A 1PKTA 3UGTA 3NETA 2QQ9A 5IH2A 3HFOA 3JAME 3MF1A 4M78D 3MEUA 3JSCA 5FROA 2OTLQ 2DU5A 1ABQA 3G6ET 1M3BA 1K73C 2ESWA 2Q5IA 2X4XA 4ZTZB 1B8AA 1ZUYA 2DK3A 2ZIOA 2A3LA 4LD6A 1QE0A 3PCOA 4QQ6A 1NEBA 4DBHA 3HXVA 2M02A 2KI7A 1OU9A 4M7DA 1WX6A 4P75A 1MHNA 2K3BA 2HBWA 3WVEB 2ODRC 2KRMA 4BI8B 4P3NA 2JS0A 2GNCA 4RQEA 4F16A 3RKXA
chains in the Genus database with same CATH topology
4C8QF 2HQXA 2IVWA 4M7AE 4K88A 5DLOA 2IY5B 3VQVA 3VYGA 4YRCA 5LJ5e 4PJOB 3M54A 2P0QA 2ZPGB 4PNOA 2EYQA 4YRGA 4UP7A 4C8QE 3CPFA 4M7AD 4J7IA 2H3JA 2DEQA 3JCMd 2JOYA 2AMCB 3A8LB 1VQOT 3A8OB 3M4YA 2Q7EA 4ZGEB 2I4MA 2ZXFA 3OW2S 4XTWA 4C8QD 4ME7A 1WYDA 3BDUA 3OYLA 1SERA 3V7SA 2CZ1B 1M4ZA 3NTHA 3QZ5B 2PUKB 1U1TA 3EFSA 5GAMd 5GAN5 3OB9A 4M75G 2CYZB 1NJ6A 2L8DA 3QUIA 5J39A 4F7UE 2EJ9A 5LJ5g 3JB9F 5K1PA 4LDVA 4P71C 4M7DF 2YHTA 2EQUA 1H641 1VQ9T 3OBWA 3P8HA 4HA8A 1GXIE 1PYSB 3QIIA 1KMNA 1BIAA 3JB9H 1QVGA 3QJYA 4J7FA 3VU3C 5LJ3j 5GMKe 1KHCA 3A7UA 5KE2A 1M5Q1 5KCHA 3L2WA 4PHCA 2ZT7A 1HTTA 1BBWA 5A0DA 1YITA 3RL6A 4N4GA 3JB9D 4IUVA 3E1SA 3CCRA 2LCLA 4N4IA 4L87A 2MWPA 2HBPA 4E7LA 4RDXA 3CCEA 2YRVA 4RKUE 4C0DB 2RB6A 5E3IA 3OYMA 4XK8E 3RERA 3JB9J 1YFSA 3SB2A 2VC8A 1YI2A 3Q1JA 2KY9A 2RJCA 3DSQA 3VV0A 1N27A 3QPHA 2BKDN 4DQ2A 3M58A 1Y96A 3TEHA 1B34B 3JCMQ 2E6NA 2L5QA 2GFAA 2NLUA 2GF7A 3OYYA 3HPWA 2FVUA 5IT9E 4BDZA 1Y07A 4HWRA 1XQHA 1W2BA 4DOWA 4Q15A 3GNGA 4C92A 1VQZA 1YGBA 1QF6A 3H8ZA 3LX7A 3J7AF 4M7AC 5FRNA 4ZN3A 1OZ3A 2RJEA 2I4LA 4JS4A 3RMSA 3SWNB 2R5MA 3A5ZA 2D0QB 2DTOA 3UT1A 4A53A 1Q86C 2QHUA 3T9NA 2VUBA 4C8QC 1YJ9T 1NPPA 1GGMA 3TEHB 3MO8A 2XU8A 1NYQA 4ZN1A 3UGQA 3E9HA 3ICAA 1G51A 2ZCEA 4O2DA 2WSCE 4E7HA 5EG2A 1H4VB 5CKDA 2DTIA 4X9CA 3I55T 4X5OA 4BWAA 2HQEA 1X54A 1W4SA 1N8RC 3FEOA 1X75C 5GANf 3A8GB 4BD3A 4NCXA 4M75B 1KG1A 3V8LA 2VGNA 3CMET 2MAMA 3L4GA 3KUFA 4YRMA 1KC8C 2QTXA 4YTLA 3FJPA 3CCQA 1UEBA 4J6XA 3M55A 4YDQA 1EIFA 12ASA 1KMMA 5CO7A 3CXCS 2K4YA 5CIUA 3QO7A 4H2YA 1QVFS 2ZPIB 5A0LA 2Y4YA 4L5GA 1KC8U 3S3NA 2ARTA 1VQ6A 3CPWS 5GAN8 3QTCA 1WNLA 2WSEE 3VKIA 4P71A 1N6AA 3KBGA 4TVAA 2FL7A 3BFMA 1N9RA 3MEWA 3OSSC 4WF2A 5LJ3e 1UGRB 3IKMB 11ASA 2ZNIA 4M77G 2XDPA 2X4YA 1USYC 3HFVA 4EMGA 2E41A 2PMEA 1VQPA 1VQPT 4TQFA 2CKKA 3TREA 5CK9A 5FU7B 4HCZA 3X26B 4HWTA 2E65A 4UC4A 1B70A 4LVLA 1JRIA 4YCUA 1H4SA 2P4TA 3OY9A 2L89A 3KFUA 5CQXA 4PJOG 2MWOA 1EIYA 2ZZGA 1YIJA 1YIJT 4NOYA 5LL6S 1VQMA 1Z7MA 2QA4A 2QA4T 4N4HA 3CBMA 3CCLA 3RKYA 2CJBA 1MGQA 4E7JA 3R6OA 3JCMf 4EMHA 2C06A 4OMFB 3HRKA 2VXFA 4M78A 2E5AA 4Q6GA 1N9WA 1LOJA 5LJ3g 3C12A 2HD0A 1M8VA 1U8RA 3UPUA 3ASKA 3M5AA 1YFRA 2ZPFB 3DB4A 3GP8A 2DJZA 4BI3A 2KK4A 3JB9I 1M90C 4M7DG 4Z02A 5F5WA 4G84A 4C5GA 1G3SA 2RHYA 4LD9K 2XGTA 2CZ0B 4LDYA 2Y4XA 4IUUA 3A31A 2G4CA 4CRIA 4PG3A 4P73C 5GAMf 4KR2A 4A54A 1LJOA 3OYKA 2PVGB 3HXUA 3CMAA 2WSFE 4JRQA 4KR3A 2V8IA 2XHCA 2GQVA 3VUZA 2I2LA 3UDCA 3HHTB 2RI5A 5GAN6 2DTHA 3NEMA 4M7AA 1FYFA 2BUDA 3FIFA 5CQYA 1BI1A 5M9OA 1UGSB 2M1HA 5CCAA 3IALA 1KOGA 5GMKm 2PUOB 3JCMW 2RK1A 1E1OA 3BW1A 3QO5A 1DJ7B 3OYDA 2M0OA 5GANj 4C8QA 5GAOl 3QSUA 3REXA 4QW2A 2DZ9A 3CEYA 2EKOA 5GAOq 2PVDB 4H2XA 3OYAA 2OTLT 3SDZA 3P8TA 4P5NA 1G3WA 4OB2B 2ZZEA 3EAEA 1Q81C 2QQBA 1KQSS 2DXBA 3CCUA 3LSQA 5KNNA 4QVCA 1SRYA 3CCVA 4BUGA 3A74A 5CKBA 4BDYA 4XU1A 3MEAA 4LDUA 2GFUA 4ZTFA 2AKWB 4OLFA 4YPFA 4HT4A 3P8YA 4YRRA 2EL9A 5C52B 3OYCA 3HKSA 4M77B 4C5IA 1BI3A 2ZPHB 4M7AF 1WJRA 4H2XB 4J6YA 1U1SA 1VQLA 2EFIA 4H2WA 3X25B 3LH0A 3MP8A 5LJ5h 4XTXA 3JCMX 1X01A 3P8VA 1HK9A 3HTZA 2F69A 1K73U 4C5HA 3PNWC 3META 3GOXA 3E19A 2OTJA 2OTJT 1LNXA 3JCMV 2VV5A 3NTIA 2QHSA 1Q7YC 3JCMc 1WJQA 3G71A 1B7YB 3A32A 4C0FA 1H3ZA 3H6ZA 1G3YA 5D6WA 4ZIBA 1VQNA 2DQ0A 4CS4A 2D9TA 3G7ZA 2LNVA 4H2UA 5FU6B 2K5IA 3HXWA 2XG8D 2LX9A 3LSSA 3PCOB 4EMKC 3L2RA 4F7UF 3AHUA 3OS1A 4XTYA 4M7DB 4J83A 1JJCA 4C92G 3HRSA 2ZT8A 5GAMj 3TUPA 3OBYA 3OW2A 2CS7A 4XEOA 3LLRA 2C7IA 2DAQA 2YLCA 2KVQG 4HWOA 3FC3A 4PLLA 3TEEA 3MCAB 1IL2A 3RACA 2RHXA 4BW9A 2RM4A 5GMKh 1NJ1A 4PJOE 1BKBA 4FU6A 3QZ9B 3OMCA 4P73A 3QDRB 1NJ2A 3DKMA 5A2QE 3OYEA 3ERRA 1VIEA 2DD4A 4AH6A 1KHIA 4JRPA 2ZZFA 2EQJA 2JN0A 1YITT 2O4XA 5GANe 2JVVA 2EJFA 4BI4A 3CCRT 4RMFA 3OYGA 5GAOp 2E3CA 5DLQE 3M57A 3CCET 3M9QA 2EIFA 4BY6B 4XTUA 4A4HA 1K8AC 2RHSA 1NE8A 3FB9A 2ALYA 3RF1A 1YI2T 4II1A 3UWNA 3CCJA 1RI0A 3CCJT 1H4QA 1VIFA 4UPAA 4NS5A 1P92A 2PQWA 1ZQ1A 1WQ7A 2KSSA 4OP0A 4CH5A 1WLEA 3JCMb 3MP6A 2CGHA 3RIRA 4QVZA 4WJ3M 2ZIMA 2EAYA 3OYHA 2EWNA 2ZR3A 4O6JA 3HL8A 2DO3A 2KMTA 2ARUA 2ZINA 3RGLA 2O4XB 3OYJA 5GANg 3LWHA 3HRUA 1M1FA 4YREA 1G3TA 4RQFA 5IN1A 3HFNA 3NENA 1RIQA 3PMIA 1G5IA 3M4QA 4LVIA 5KH6A 3BJUA 1VQ8A 1ADYA 4ZTUB 2RHSB 4E7KA 2ALYB 1Q82C 5CVIA 4YP0A 3QYGB 4CI0C 2J3MA 1VQ7A 3QG1A 1X56A 4FIBA 1Y96B 2LDMA 1LYLA 1KQ1A 3J80E 1NJIC 4OB0B 3QYHB 4YCWA 4PL6A 3JCMe 4MMKA 3PGGA 2ZGWA 3HRTA 2HAXA 2RD1A 4PLIA 1JBMA 2QDYB 5CR2A 4M78G 1Q86U 3FRNA 4HWSA 1ASYA 3CBPA 3URGA 4N0AC 4C92B 3LGLA 4Y91A 4J6WA 4L59A 1YHQA 3R07A 2M9UA 1XNIA 1K9MC 3PMTA 4BE2A 3OS0A 5GAMe 3A5ZB 4YRJA 2DZCA 3G1ZA 4OF1A 4LDWA 2RK2A 3MQZA 1N8RU 4EMKA 3FDRA 3CCQT 4P3PA 4JLGA 2R5AA 1H4TA 4PJOC 1K9MU 2C8MA 4MDXA 2K2VA 2BIVA 4M7AG 3JCMg 1NJ5A 4XEMA 1JJ2S 1VQ6T 3CCMA 3N5BB 3CCMT 4DPGA 4YRPA 4VUBA 3CXCA 3NFCA 1BIBA 2RI3A 1NNHA 2Y90A 4C8QG 4R55A 4M75F 2QHVA 3L2QA 1QVFA 2RJDA 2DIGA 2MF2A 3VQYA 4ELYC 3CPWA 4P75C 3RKWA 3NELA 2R57A 3SD4A 4JLIA 2AHJB 1YBYA 3LYIA 1NYRA 3L4GB 3RUXA 5GAMg 1G5HA 2HNIA 4IUTA 2KQWA 3BY7A 4M75E 3V8JA 3IKLA 3HFZA 3HY1A 2JZ2A 2JUFA 2E1HA 4OGEA 2F5KA 2QQAA 2Q7HA 4KT0E 3A7AA 4M75D 2LQ8A 4XU3A 4HWPA 2LC4A 2I4NA 1VQMT 1Z7NA 5LJ5d 3CC7A 1WPYA 2A8EA 3CCLT 4ELZC 5CAIA 4TVAB 2R58A 4YRNA 5I21A 1ATIA 4YRIA 4Q5WA 2RI2A 5C6SA 1FWZA 2YLBA 1VQKA 1AHJB 1VQKT 4JRIA 3JB9G 5GAN2 3PFSA 3LC0A 2VYTA 2E64A 2EQKA 5CKFA 5GAOn 4P74C 3S3MA 1VQ5A 4CS3A 1X6OA 5GMKl 3VJPA 2I4OA 3HFZB 2XDDA 3VQXA 1B70B 2ZPEB 4C0DC 1WJSA 2E6ZA 2RHZA 2RJFA 3CMAT 2CJAA 1M90U 1X2GA 2DIQA 1EIYB 2FB7A 4YRFA 1EVLA 4XU0A 2RHQA 1BI0A 3QNEA 4Y28E 4DOVA 4A4GA 3PT9A 4OB1B 1YJWA 4E47A 3GNFB 4M78B 4HT9A 4OVAA 1E24A 4ATOA 1QP3A 4CH3A 2K5LA 2FYKA 2E10A 3EFRA 3VYHB 2ZT5A 1O9SA 4BB7A 4CH4A 1WU7A 3VQWA 1N9SA 4O5VA 2V8JA 4EO4A 1VQ4A 2L3RA 3JCMP 4KUIA 3WXMB 3GLXA 3CCSA 3CCST 1BI2A 3TCJA 2XICA 5FRMA 4YRTA 1ASZA 4ZGDB 3SFMA 3SWNC 2K3YA 2X4WA 3CCUT 3LW5E 2LCCA 3PIPA 1X2HA 4J5YA 4E7IA 3MHXA 3CCVT 1XOVA 4G85A 5J26A 2F5TX 2XKOC 3S6WA 2XIDA 4M7AB 3HP9A 1KQSA 2QI2A 1Q81U 3QKJA 4F7UA 5K1XA 4IUPA 1L0WA 2CZ6B 4X34A 5I2MA 3C95A 3QJ6A 4C8QB 4M78E 3G4SA 3HY0A 3TU4K 1I8FA 4LNSA 4R56A 3LGFA 3OYBA 2ZZDA 1VQLT 1NPRA 2AMCA 5HKCA 3E9FA 1EQRA 4M75C 3G6EA 4P72C 2Q5HA 3OSVA 4CS2A 4A4EA 1YB3A 2LVMA 1KQ2A 3QO8A 1USYA 2KAFA 4EX5A 1Y7XA 2DPPB 4XTZA 4GLKA 5D6YA 3P8DA 4F7UB 1UGPB 3REUA 3G71T 1PSEA 1VUBA 3PZCA 1J5WA 4ZGJB 1NJ8A 4M77F 4B9WA 1D3BA 3MEVA 3V7CA 3QHSA 2RHIA 3OYFA 2DKGA 4FSXA 4KUDK 3PIOA 4J8OA 1S72A 5DM7R 1NZ9A 1S72T 4L6V5 1VQNT 5C0MA 1Q7YU 2P0LA 1OYXA 3OD1A 2B8AA 3C94A 1PYSA 4M77E 4HVCA 2K3XA 1VQOA 2P0PA 4D6WA 5GAOr 4C0ZA 2DVEA 4PJOF 1UGQB 4MMLA 4H2VA 2QQRA 5FU7C 4K86A 4M77D 4WJ4A 3HXZA 2JTFA 1SESA 2EJGA 4P74A 1ZBXA 3OYIA 2LT1A 1TH7A 2KDSA 1O75A 5HGQA 1Y71A 2PVOB 3P8BB 1D3BB 3LWIA 4LVKA 4UP8A 1QW1A 2LT4A 3PTAA 4XAXB 1QVGS 2K5FA 5GANh 3V8KA 2WACA 5GAN7 1VQ9A 4PJOD 5ELOA 2QXFA 4JRKA 2K57A 3M53A 1JJCB 2LQKA 4MZTA 3MF2A 1W66A 1B76A 2X4JA 3OS2A 1B34A 3L42A 2QEXA 3VUBA 2QEXT 4M7DE 4J15A 2LTOA 1IREB 3OQ5A 5LJ3d 1ADJA 4A4KA 2DXUA 1E1TA 3QO3A 3NTKA 4TTVA 4M7DD 3UFGA 3J81E 4HCBA 2CJ9A 4IURA 5L8RE 3L2UA 3MP1A 3I56A 3W3SA 3I56T 3TEGA 3SWNA 4XU2A 1K8AU 4M78C 1I81A 1V29B 5LJ5f 4YYEA 2XTIA 1YJNA 1YJNT 4CH6A 1QVPA 4KBMB 1YFTA 3A8MB 4TVWA 4UP9A 4IUQA 1WQWA 1X55A 4LVMA 1W2BS 5KCOA 3X20B 1M9SA 4MZPA 2DQ3A 5GAN3 3HRIA 3M4GA 3O8VA 1VQ8T 2QQSA 4MZMA 3DLLA 4PKCC 3JCMh 3IG2A 2RHUA 3INZA 2ARSA 2JNGA 4QQDA 1VQ7T 4M75A 1SSFA 4P72A 2RO0A 3RMQA 2DDZA 2VGMA 3L2VA 5A0GA 2V8KA 4RG8A 2ZCFB 2X35A 3GPLA 5CKHA 2J3LA 1Q82U 4JS5A 4RCBA 4JDSA 1YJ9A 3GIBA 4YRKA 4M77C 5GAMh 4P3OA 2G3RA 3UH0A 1NJIU 2P5IA 1YHQT 4ZTJA 1HC7A 2ZR2A 3S3OA 3OMGA 1FXXA 4QVDA 3I55A 3OA6A 2M16A 2OAUA 3ZBDA 4LVJA 2XK0A 3OS5A 3VBBA 1HXDA 4OGCA 2D6FA 1EVKA 4HKEA 1SETA 3A7RA 3CMEA 4RCCA 3HSBA 3JCMJ 4K87A 5LJ3h 5HK0A 4FL6A 2PMFA 3A5YA 4C92F 2JTMA 3CMQA 3I7FA 2PU9B 5DY9A 4H2TA 3RESA 5GMKi 4YRLA 5FU6C 1JB0E 3GF5A 5KE3A 5CKEA 2ZT6A 3A8HB 1M1KC 2ZNJA 4LDXA 3DB3A 3E9GA 4EPCA 1JJ2A 4M7DC 4C92E 4TWAA 4H02A 4C0GA 2ZPBB 3ZEHA 2ZTGA 1BBUA 3HXYA 3HXXA 5IAYA 1FX7A 4EMKB 1YCYA 1C0AA 1M1KU 4NL2A 5I2SA 4C92D 4JUVA 2EQMA 3BDLA 2DXTA 3DLMA 2DU7A 3CD6A 4QQGA 3CD6T 4E51A 4FT2A 5GAN4 5LJ5j 3E9IA 2E5QA 2CZ7B 2QHTA 4F7UG 2VXEA 3FLGA 3CC7T 4V2SA 1E22A 4OB3B 2E70A 2MI6A 2DD5A 1XTDA 4XQ3A 2ODRD 3ME9A 3ER0A 1EOVA 1PSFA 3C4SA 5C53B 2RA2A 3ZFJA 2LRQA 1IZ6A 3X28B 1UB4A 3M59A 1VQ5T 4FT4A 4DA4A 3MEYA 4EDUA 3CC2A 4BY6C 3CC2T 3QXEB 3OYNA 5D6XA 1ZHIA 4YRQA 1I4K1 4YRSA 3X24B 3CC4A 3CC4T 4BE1A 5C51B 4X9DA 2XDBA 4IKFA 1OZ2A 1M1GA 2IG0A 1BYMA 2XI9A 2GCXA 5HY6A 4BE0A 3L1AA 3KXTA 1YJWT 4WI1A 4GY5A 3V7RA 4XTVA 4H2SA 1WGSA 3JRZA 5GMKj 3M56A 4HT8A 2AKWA 4A4FA 1VQ4T 2XD0A 4NL3A 1G5VA 4RG2A 2FHDA 1OI1A 2DXCA 5J3BA 1KD1C 5AYFA 4TQDA 5GANd 4M77A 5LJ3f 3WVDB 2MMPA 4C5EA 4N0AA 2P0KA 1QP2A 4BACA 2OTLA 2E12A 4KQEA 4MDWA 3WQZA 2RHQB 5ELNA 2Q7GA 4M78F 2NS6A 4FM4B 5FLXE 2O01E 4RMOA 1EFWA 1KD1U 3F70A 3M4PA 2IY5A 3CBOA 4B9XA 2RH2A 1I5LA 4TVYA 3L2ZA 5GAOm 2A7YA 4KULA 3QBYA 3G4ST 4HCCA 4PJOA 4YCVA 4YROA 4JJNK 1R8OB 4TVRA 1B7YA 2CIMA 5HK3A 4C92C 1RL2A 3UGTA 3NETA 2QQ9A 3HFOA 3JAME 3MF1A 4M78D 3MEUA 3JSCA 5FROA 2DU5A 3G6ET 1K73C 2Q5IA 2X4XA 4ZTZB 1B8AA 2DK3A 2ZIOA 2A3LA 4LD6A 1QE0A 3PCOA 4QQ6A 3HXVA 4M7DA 4P75A 1MHNA 3WVEB 2ODRC 4BI8B 4P3NA 4RQEA 3RKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q F;  1H4T A;  4M7A E;  4PJO C;  3HXU A;  4K88 A;  2C8M A;  2CJ9 A;  2IY5 B;  3VQV A;  4KR3 A;  3W3S A;  4YRC A;  5LJ5 e;  2I2L A;  4M7A G;  4PJO B;  5GAN 6;  3TEG A;  3SWN A;  2DTH A;  3JCM g;  4XU2 A;  4PNO A;  3NEM A;  1NJ5 A;  4XEM A;  4M78 C;  4M7A A;  1I81 A;  1FYF A;  3FIF A;  5LJ5 f;  4YYE A;  4YRG A;  4UP7 A;  2XTI A;  4C8Q E;  4M7A D;  4DPG A;  4CH6 A;  4YRP A;  1YFT A;  2DEQ A;  3JCM d;  3IAL A;  4TVW A;  4UP9 A;  1KOG A;  5GMK m;  2AMC B;  1BIB A;  1NNH A;  2Y90 A;  4C8Q G;  1WQW A;  3JCM W;  1X55 A;  1E1O A;  4M75 F;  3BW1 A;  2QHV A;  2Q7E A;  3QO5 A;  2I4M A;  5GAN j;  4C8Q A;  2ZXF A;  3VQY A;  5GAO l;  3QSU A;  3REX A;  2DQ3 A;  4P75 C;  4XTW A;  3RKW A;  4C8Q D;  2DZ9 A;  5GAN 3;  3HRI A;  3M4G A;  3NEL A;  4JLI A;  5GAO q;  3BDU A;  1WYD A;  4H2X A;  1NYR A;  3L4G B;  3RUX A;  5GAM g;  1SER A;  3V7S A;  1G5H A;  2HNI A;  3P8T A;  3BY7 A;  4M75 E;  2ZZE A;  3V8J A;  3IKL A;  1U1T A;  3EFS A;  3HFZ A;  5GAM d;  3HY1 A;  5GAN 5;  3JCM h;  3IG2 A;  3INZ A;  4M75 G;  3LSQ A;  1NJ6 A;  2ARS A;  5KNN A;  2E1H A;  4QVC A;  3QUI A;  1SRY A;  4M75 A;  4F7U E;  2EJ9 A;  5LJ5 g;  4P72 A;  3JB9 F;  2Q7H A;  3A74 A;  2DDZ A;  3A7A A;  4M75 D;  5K1P A;  4XU1 A;  4P71 C;  4XU3 A;  4HWP A;  4M7D F;  2J3L A;  2YHT A;  2I4N A;  1Z7N A;  4RCB A;  5LJ5 d;  1WPY A;  1H64 1;  2AKW B;  4OLF A;  4YPF A;  4HA8 A;  1PYS B;  1KMN A;  1BIA A;  5CAI A;  3GIB A;  4TVA B;  3JB9 H;  4YRK A;  3P8Y A;  4YRN A;  5I21 A;  1ATI A;  4M77 C;  2EL9 A;  4YRR A;  4YRI A;  5C52 B;  5GAM h;  4P3O A;  3UH0 A;  2P5I A;  3VU3 C;  5LJ3 j;  5GMK e;  3A7U A;  2YLB A;  4M77 B;  4JRI A;  3JB9 G;  1M5Q 1;  5GAN 2;  1HC7 A;  4M7A F;  2ZR2 A;  3LC0 A;  4H2X B;  4J6Y A;  4PHC A;  1U1S A;  2E64 A;  2ZT7 A;  5GAO n;  1HTT A;  4QVD A;  4H2W A;  4P74 C;  1BBW A;  3RL6 A;  3JB9 D;  4CS3 A;  5LJ5 h;  5GMK l;  4XTX A;  3JCM X;  2I4O A;  3HFZ B;  1X01 A;  3VQX A;  1B70 B;  3P8V A;  3VBB A;  1HXD A;  1HK9 A;  3HTZ A;  4L87 A;  1EVK A;  4RDX A;  2CJA A;  1SET A;  3A7R A;  1X2G A;  2RB6 A;  1LNX A;  3JCM V;  2FB7 A;  4YRF A;  5E3I A;  1EVL A;  1EIY B;  4RCC A;  3HSB A;  3JCM J;  3RER A;  4XU0 A;  3JB9 J;  4K87 A;  2RHQ A;  3QNE A;  1YFS A;  2QHS A;  5LJ3 h;  3SB2 A;  3JCM c;  2VC8 A;  2PMF A;  3A5Y A;  1B7Y B;  4C92 F;  3CMQ A;  3I7F A;  3A32 A;  3DSQ A;  4M78 B;  5DY9 A;  4HT9 A;  4DQ2 A;  4H2T A;  3RES A;  1Y96 A;  1E24 A;  5GMK i;  3TEH A;  4YRL A;  1B34 B;  3JCM Q;  4ZIB A;  4CH3 A;  2DQ0 A;  2ZT6 A;  2FYK A;  2ZNJ A;  4CS4 A;  2E10 A;  3EFR A;  2ZT5 A;  4H2U A;  4M7D C;  3HXW A;  4CH4 A;  4C92 E;  1WU7 A;  3LSS A;  3PCO B;  3VQW A;  1N9S A;  4EMK C;  4F7U F;  4TWA A;  4EO4 A;  3AHU A;  4HWR A;  4XTY A;  4H02 A;  4M7D B;  3JCM P;  1JJC A;  2ZTG A;  4C92 G;  1BBU A;  3HXY A;  4Q15 A;  3HXX A;  2ZT8 A;  5GAM j;  3TUP A;  4EMK B;  1YCY A;  1C0A A;  4XEO A;  4C92 A;  1VQZ A;  1YGB A;  4NL2 A;  4YRT A;  1ASZ A;  1QF6 A;  3SWN C;  4C92 D;  2C7I A;  4JUV A;  1X2H A;  4M7A C;  4J5Y A;  2DXT A;  2DU7 A;  2I4L A;  4E51 A;  4G85 A;  2YLC A;  4HWO A;  3SWN B;  5GAN 4;  5LJ5 j;  3A5Z A;  3E9I A;  4M7A B;  2QHT A;  1IL2 A;  4F7U G;  2VXE A;  3RAC A;  4BW9 A;  2DTO A;  2RM4 A;  5GMK h;  4A53 A;  1NJ1 A;  4V2S A;  4PJO E;  4F7U A;  2QHU A;  4C8Q C;  1E22 A;  5K1X A;  1GGM A;  4P73 A;  3TEH B;  1L0W A;  4XQ3 A;  2ODR D;  1NYQ A;  1NJ2 A;  4P3P A;  3UGQ A;  4C8Q B;  4M78 E;  3HY0 A;  3E9H A;  1EOV A;  3ICA A;  3ERR A;  1G51 A;  2ZCE A;  1I8F A;  4O2D A;  4LNS A;  1H4V B;  5C53 B;  2RA2 A;  4AH6 A;  2DTI A;  2ZZF A;  2JN0 A;  4X9C A;  4X5O A;  2AMC A;  5GAN e;  4BWA A;  1X54 A;  1EQR A;  3MEY A;  2EJF A;  4M75 C;  3RKX A;  4RMF A;  4P72 C;  2Q5H A;  5GAN f;  5GAO p;  4NCX A;  4CS2 A;  1YB3 A;  2E3C A;  4M75 B;  1KQ2 A;  3V8L A;  4YRQ A;  1I4K 1;  3QO8 A;  4YRS A;  1USY A;  3L4G A;  4XTU A;  5C51 B;  4EX5 A;  4X9D A;  2RHS A;  4YRM A;  4XTZ A;  3FB9 A;  2ALY A;  2QTX A;  3FJP A;  3RF1 A;  4F7U B;  3REU A;  4J6X A;  3PZC A;  4YDQ A;  3L1A A;  1J5W A;  12AS A;  1KMM A;  1H4Q A;  4WI1 A;  1NJ8 A;  4UPA A;  4M77 F;  1D3B A;  3V7C A;  3QHS A;  3QO7 A;  1WQ7 A;  2DKG A;  3V7R A;  4H2Y A;  4OP0 A;  4XTV A;  4H2S A;  4CH5 A;  1WLE A;  3JCM b;  2CGH A;  2P0L A;  3RIR A;  2ART A;  4WJ3 M;  2EAY A;  2ZIM A;  5GMK j;  2EWN A;  2ZR3 A;  3OD1 A;  5GAN 8;  3QTC A;  1WNL A;  4HT8 A;  2AKW A;  2ARU A;  1PYS A;  2ZIN A;  3RGL A;  4P71 A;  4M77 E;  4TVA A;  4HVC A;  3BFM A;  5GAN g;  4NL3 A;  1N9R A;  4WF2 A;  5LJ3 e;  4YRE A;  3IKM B;  11AS A;  4RQF A;  2ZNI A;  4M77 G;  5GAO r;  1USY C;  3HFN A;  2DVE A;  3HFV A;  3NEN A;  4TQD A;  4PJO F;  4EMG A;  5GAN d;  4M77 A;  1RIQ A;  5LJ3 f;  4MML A;  2E41 A;  4H2V A;  1G5I A;  4N0A A;  3M4Q A;  2PME A;  4K86 A;  3BJU A;  4M77 D;  4TQF A;  4WJ4 A;  1ADY A;  4ZTU B;  3HXZ A;  4KQE A;  2RHS B;  3WQZ A;  2RHQ B;  5ELN A;  2Q7G A;  4M78 F;  2ALY B;  1SES A;  4HWT A;  2E65 A;  1EFW A;  2EJG A;  1B70 A;  4P74 A;  4YP0 A;  1JRI A;  1TH7 A;  4YCU A;  2J3M A;  1H4S A;  5HGQ A;  1D3B B;  1X56 A;  4UP8 A;  1Y96 B;  3KFU A;  3M4P A;  2IY5 A;  1LYL A;  1KQ1 A;  4PJO G;  1I5L A;  4TVY A;  3L2Z A;  5GAO m;  1EIY A;  2ZZG A;  4YCW A;  5GAN h;  4PJO A;  4NOY A;  3V8K A;  3JCM e;  1Z7M A;  4MMK A;  3PGG A;  2ZGW A;  5GAN 7;  4PJO D;  4YCV A;  2RD1 A;  4YRO A;  5ELO A;  1JBM A;  3RKY A;  4JRK A;  4M78 G;  2CJB A;  1B7Y A;  1MGQ A;  2CIM A;  2K57 A;  3JCM f;  4C92 C;  1JJC B;  4EMH A;  4HWS A;  3HRK A;  2VXF A;  4M78 A;  3UGT A;  3NET A;  2E5A A;  4Q6G A;  1N9W A;  3MF2 A;  1LOJ A;  5LJ3 g;  1ASY A;  1W66 A;  1B76 A;  1M8V A;  3HFO A;  4N0A C;  1B34 A;  3MF1 A;  4M78 D;  4C92 B;  4Y91 A;  4J6W A;  2DU5 A;  3R07 A;  1YFR A;  4M7D E;  4J15 A;  2Q5I A;  4ZTZ B;  5LJ3 d;  1B8A A;  2DJZ A;  1ADJ A;  2ZIO A;  3JB9 I;  1QE0 A;  4M7D G;  3PCO A;  5F5W A;  4G84 A;  2DXU A;  3HXV A;  2XGT A;  5GAM e;  4M7D A;  1E1T A;  3A31 A;  4P75 A;  2G4C A;  2DZC A;  4YRJ A;  4PG3 A;  3QO3 A;  3G1Z A;  2ODR C;  4P73 C;  4TTV A;  4M7D D;  4P3N A;  3UFG A;  4EMK A;  4RQE A;  5GAM f;  4KR2 A;  4A54 A;  1LJO A; 
#chains in the Genus database with same CATH topology
 4C8Q F;  1UHC A;  3SEM A;  2HQX A;  2IVW A;  1U3O A;  4M7A E;  1OX8 A;  4K88 A;  5DLO A;  2IY5 B;  3VQV A;  3VYG A;  4YRC A;  5LJ5 e;  1JXM A;  4PJO B;  3M54 A;  2P0Q A;  2ZPG B;  1AT1 B;  4PNO A;  1SRM A;  2EYQ A;  1WLP B;  4YRG A;  4UP7 A;  4C8Q E;  3CPF A;  4M7A D;  4J7I A;  2H3J A;  1VOM A;  1FMK A;  2DEQ A;  3JCM d;  2JOY A;  2AMC B;  4FYW B;  3A8L B;  1VQO T;  3A8O B;  1M90 R;  1RUW A;  3M4Y A;  1IGU A;  2Q7E A;  4ZGE B;  2I4M A;  2ZXF A;  1WFW A;  3OW2 S;  5GJV B;  4XTW A;  4C8Q D;  2NYS A;  4ME7 A;  1MV0 B;  1WYD A;  3BDU A;  3OYL A;  2D8H A;  1SER A;  3V7S A;  2MYS A;  2CZ1 B;  1M4Z A;  2DVJ A;  3NTH A;  3NHN A;  3QZ5 B;  3TSW A;  1Y57 A;  4Z88 A;  2OTJ Q;  2PUK B;  1C1A A;  1U1T A;  3EFS A;  5GAM d;  5GAN 5;  1UUE A;  3OB9 A;  4M75 G;  1BCO A;  2CYZ B;  1NJ6 A;  2CUD A;  1ZA2 B;  2L8D A;  2DE0 X;  3QUI A;  5J39 A;  4F7U E;  2EJ9 A;  5LJ5 g;  3NGP A;  2M0Y A;  3VS6 A;  5FWC A;  3JB9 F;  2GBQ A;  1XJW B;  1NG2 A;  5K1P A;  4LDV A;  1JEG A;  4P71 C;  2J06 A;  4M7D F;  2DYI A;  2YHT A;  4X1V A;  2EQU A;  3ULR B;  1H64 1;  1EZZ B;  1VQ9 T;  3OBW A;  3P8H A;  4HA8 A;  2OX7 A;  1GXI E;  1PYS B;  3QII A;  4RUG A;  1KMN A;  2LQN A;  1BIA A;  2DBK A;  3JB9 H;  2BTT A;  4KGX B;  2DJQ A;  3CXC P;  4PK4 A;  1QVG A;  3QJY A;  4J7F A;  1FMW A;  2F2W A;  2EYY A;  2DFU A;  3VU3 C;  2DL5 A;  5LJ3 j;  5GMK e;  1KHC A;  1QVF P;  3A7U A;  4FW2 A;  5FWB A;  5KE2 A;  4AFQ C;  1M5Q 1;  1Q81 R;  5KYY B;  5KCH A;  3L2W A;  3CPW P;  4PHC A;  2ZT7 A;  1HTT A;  1BBW A;  5A0D A;  1YIT A;  3RL6 A;  4N4G A;  3JB9 D;  4IUV A;  1RAD B;  3E1S A;  1WDX A;  2M51 A;  3CCR A;  1TUD A;  2LCL A;  2J6O A;  4N4I A;  1IXD A;  4L87 A;  2MWP A;  1Z9Q A;  1GL5 A;  2HBP A;  4E7L A;  4RDX A;  1M3C A;  3CCE A;  2YRV A;  2FRY A;  4RKU E;  1PHT A;  3H41 A;  4C0D B;  2RB6 A;  5E3I A;  3OYM A;  3RNJ A;  4XK8 E;  3RER A;  3JB9 J;  1YFS A;  3SB2 A;  3H0H A;  2D8J A;  2VC8 A;  1YI2 A;  3Q1J A;  1AEY A;  2KY9 A;  2RJC A;  3G1J A;  2CUB A;  3KFV A;  4HVU A;  1YFN A;  3DSQ A;  4JJB A;  2F2X A;  3VS5 A;  3VV0 A;  4E7S A;  1N27 A;  3QPH A;  2BKD N;  4DQ2 A;  3M58 A;  1Y96 A;  3TEH A;  1B34 B;  3JCM Q;  2E6N A;  2L5Q A;  2GFA A;  2NLU A;  2GF7 A;  1YIT Q;  1B07 A;  5I11 A;  3OYY A;  3HPW A;  1IO6 A;  3CCR Q;  2FVU A;  2I0N A;  5IT9 E;  2LP5 A;  4BDZ A;  1Y07 A;  4HWR A;  1XQH A;  3M0P A;  1W2B A;  2AIR B;  7AT1 B;  4DOW A;  1UFF A;  3GNG A;  4Q15 A;  3CCE Q;  1CKA A;  4C92 A;  1VQZ A;  1YGB A;  1QF6 A;  1Q7Y R;  3UA6 A;  3H8Z A;  3LX7 A;  2VB6 A;  3J7A F;  2HL5 C;  4M7A C;  1YI2 Q;  5FRN A;  4ZN3 A;  1OZ3 A;  2RJE A;  2I4L A;  4JS4 A;  3RMS A;  4J9B A;  3CCJ Q;  2KNB B;  3SWN B;  2FPE A;  2R5M A;  3A5Z A;  2RQV A;  2D0Q B;  2C0T A;  2DTO A;  4J9I A;  3UT1 A;  4PJN A;  4A53 A;  1Q86 C;  2LQW A;  2QHU A;  3T9N A;  2VUB A;  1RAF B;  4C8Q C;  1RAI B;  1YJ9 T;  1NPP A;  1GGM A;  3TEH B;  3MO8 A;  2XU8 A;  1NYQ A;  1VYU A;  4ZN1 A;  3UGQ A;  2EW3 A;  3E9H A;  3ICA A;  4RTT A;  2EYZ A;  1G51 A;  2ZCE A;  4O2D A;  2WSC E;  1QLY A;  4E7H A;  5EG2 A;  1ABO A;  1M8M A;  1H4V B;  5CKD A;  1UG1 A;  1IRX A;  2DTI A;  3M0R A;  4X9C A;  3I55 T;  4X5O A;  1YWO A;  4BWA A;  2HQE A;  1X54 A;  2F1L A;  1W4S A;  1N8R C;  1SEM A;  1LCK A;  3FEO A;  1TS9 A;  1X75 C;  4ORZ A;  3EHQ A;  5GAN f;  3A8G B;  4BD3 A;  4NCX A;  4M75 B;  1KG1 A;  3V8L A;  4K11 A;  3MJX A;  1AVZ C;  2KT8 A;  2VGN A;  3CME T;  2MAM A;  3L4G A;  4IIM A;  5GJW B;  3KUF A;  4YRM A;  1X27 A;  4LNP A;  3NMZ C;  4E7Z A;  3BE3 A;  1KC8 C;  4DEY A;  2QTX A;  4YTL A;  3FJP A;  3CCQ A;  1UEB A;  2KE9 A;  1C6V X;  1K9A A;  3M55 A;  4J6X A;  4YDQ A;  1EIF A;  12AS A;  1GBR A;  1KQS P;  1KMM A;  2VKN A;  5CO7 A;  1BB9 A;  3CXC S;  2K4Y A;  5CIU A;  2DF6 A;  3QO7 A;  2DRM A;  4H2Y A;  2EPD A;  1QVF S;  1AWJ A;  2ZPI B;  5A0L A;  2Y4Y A;  4L5G A;  3H0F A;  1KC8 U;  3S3N A;  2ART A;  1VQ6 A;  3CPW S;  5GAN 8;  1E6H A;  3QTC A;  1WNL A;  2WSE E;  3VKI A;  2YSQ A;  4P71 A;  1N6A A;  2DYB A;  3KBG A;  4TVA A;  2FL7 A;  3BFM A;  1N9R A;  3MEW A;  3OSS C;  4WF2 A;  5LJ3 e;  1TU0 B;  1UGR B;  3IKM B;  11AS A;  1SG5 A;  2ROT A;  1KJW A;  2J05 A;  4RTX A;  1A0N B;  4M77 G;  5KYN A;  2XDP A;  2X4Y A;  2ZNI A;  1K8A R;  1USY C;  4D8K A;  4FYV B;  3HFV A;  4EMG A;  2E41 A;  2PME A;  3CCQ Q;  4OML A;  1VQP A;  1VQP T;  4AFS C;  4TQF A;  2YXY A;  2CKK A;  3TRE A;  1TUC A;  1M30 A;  1ARK A;  5CK9 A;  5FU7 B;  4HCZ A;  3X26 B;  2CSI A;  4HWT A;  2E65 A;  4UC4 A;  1B70 A;  4LVL A;  1JRI A;  4YCU A;  1H4S A;  2P4T A;  4B6M A;  2CDT A;  4OMO A;  2Z0W A;  3OY9 A;  4KGZ B;  2L89 A;  1VQ6 Q;  3KFU A;  5CQX A;  3VS4 A;  3CCM Q;  4PJO G;  2MWO A;  1EIY A;  2ZZG A;  2H3E B;  1YIJ A;  2JM8 A;  1YIJ T;  4NOY A;  2K2M A;  5LL6 S;  1VQM A;  1Z7M A;  2QA4 A;  2QA4 T;  4N4H A;  3CBM A;  2E4H A;  3CCL A;  4J9G A;  3RKY A;  1BK2 A;  2CJB A;  1MGQ A;  4E7J A;  3R6O A;  3JCM f;  1RAA B;  4EMH A;  2C06 A;  4OMF B;  3HRK A;  2VXF A;  4M78 A;  2E5A A;  4Q6G A;  1N9W A;  1LOJ A;  5LJ3 g;  3C12 A;  1OPK A;  2HD0 A;  1H92 A;  1M8V A;  3VS1 A;  1U8R A;  3UPU A;  3ASK A;  3M5A A;  4LXC A;  1YFR A;  2HSP A;  2ZPF B;  2AT1 B;  3DB4 A;  3GP8 A;  1Q82 R;  4AG2 C;  2DJZ A;  2COY A;  4BI3 A;  4JZ3 A;  2KK4 A;  3JB9 I;  1M90 C;  4M7D G;  4Z02 A;  5F5W A;  4G84 A;  4C5G A;  1G3S A;  2LNH B;  2RHY A;  4LD9 K;  2E3I A;  2CZ0 B;  4LDY A;  2XGT A;  2Y4X A;  4IUU A;  2KR3 A;  3A31 A;  2G4C A;  4CRI A;  4PG3 A;  4P73 C;  1NJI R;  5GAM f;  4KR2 A;  2HKN A;  4A54 A;  1LJO A;  3OYK A;  2PVG B;  3HXU A;  4HCK A;  1JXO A;  1VQM Q;  3CMA A;  2WSF E;  2LJ1 A;  4JRQ A;  4PJL A;  4KR3 A;  2V8I A;  3CCL Q;  2XHC A;  2CSQ A;  1X6B A;  2GQV A;  3VUZ A;  2I2L A;  2DM1 A;  3UDC A;  3HHT B;  1ZX6 A;  2RI5 A;  5GAN 6;  2DTH A;  2J6F A;  2VAS A;  3NEM A;  2A28 A;  4M7A A;  1FYF A;  2BUD A;  3FIF A;  5CQY A;  1BI1 A;  2SEM A;  5M9O A;  1X43 A;  1UGS B;  2M1H A;  1D1C A;  1WHK A;  5CCA A;  1VQK Q;  3IAL A;  1PWT A;  2DMO A;  1KOG A;  5GMK m;  2PUO B;  2YUQ A;  2HSE B;  3PVQ A;  3JCM W;  2RK1 A;  3TQ7 P;  1E1O A;  3BW1 A;  3QO5 A;  1DJ7 B;  2K9G A;  3OYD A;  2M0O A;  5GAN j;  4C8Q A;  5GAO l;  2COW A;  3QSU A;  2BZY A;  3REX A;  4QW2 A;  2DZ9 A;  3CEY A;  3EG9 B;  1CKB A;  2NUP A;  5KYW A;  2EGE A;  2EKO A;  5GAO q;  2PVD B;  4H2X A;  3OYA A;  1QCO A;  2OTL T;  3SDZ A;  3CMA Q;  3P8T A;  4P5N A;  1G3W A;  4OB2 B;  2ZZE A;  2AZV A;  2GTO A;  3EAE A;  1Q81 C;  2QQB A;  1PG5 B;  1KQS S;  2DXB A;  3CCU A;  2DIL A;  3LSQ A;  5KNN A;  1FMV A;  4QVC A;  1SRY A;  2CP2 A;  3CCV A;  4BUG A;  4J9E A;  3A74 A;  5CKB A;  2ED0 A;  4BDY A;  2FPF A;  4XU1 A;  2JS2 A;  3MEA A;  4LDU A;  2GFU A;  1M1K R;  4ZTF A;  2AKW B;  1QKX A;  4OLF A;  4YPF A;  4FYX B;  4ANJ A;  2W0Z A;  4HT4 A;  1MMN A;  4AT1 B;  3P8Y A;  4YRR A;  2EL9 A;  1PD1 A;  4GBQ A;  5C52 B;  1ACM B;  3I9Q A;  3OYC A;  3HKS A;  2RN8 A;  3EGD A;  4M77 B;  4C5I A;  1BI3 A;  3CCS Q;  2ZPH B;  4M7A F;  1WJR A;  4H2X B;  4J6Y A;  1U1S A;  2SRC A;  1VQL A;  2MPX C;  2EFI A;  4H2W A;  3X25 B;  3CCU Q;  1I1J A;  3LH0 A;  3MP8 A;  5LJ5 h;  3PE0 A;  3CCV Q;  2HQH A;  4XTX A;  3JCM X;  1QCN A;  1X01 A;  1GBQ A;  3P8V A;  1HK9 A;  3HTZ A;  1PNJ A;  3EH1 A;  2F69 A;  4JJD A;  1K73 U;  4C5H A;  3PNW C;  1WHH A;  2RQT A;  3VS7 A;  3MET A;  3GOX A;  3E19 A;  2OTJ A;  2OTJ T;  1LNX A;  3JCM V;  2LCS A;  2VV5 A;  1NLO C;  3NTI A;  1F1B B;  2QHS A;  1Q7Y C;  3JCM c;  1WJQ A;  3UF4 A;  3G71 A;  2KYM A;  1G8X A;  1B7Y B;  4HXJ A;  3A32 A;  4C0F A;  1H3Z A;  2PTK A;  2RPN A;  3H6Z A;  1M3A A;  1G3Y A;  5D6W A;  4ZIB A;  1NEG A;  2L3P A;  1VQL Q;  1VQN A;  2DQ0 A;  4CS4 A;  2D9T A;  4Y92 A;  1RLQ C;  2IPO B;  1IHV A;  3G7Z A;  2LNV A;  4H2U A;  5FU6 B;  1QKW A;  2K5I A;  2F2V A;  2LMJ A;  8AT1 B;  3HXW A;  4LN2 A;  2XG8 D;  2LX9 A;  3LSS A;  3PCO B;  2O9S A;  2V26 A;  4EMK C;  3L2R A;  2QYZ A;  4F7U F;  3AHU A;  3OS1 A;  4XTY A;  4M7D B;  4J83 A;  2CP7 A;  1JJC A;  4C92 G;  3HRS A;  2ZT8 A;  5GAM j;  3TUP A;  2ZAE A;  4IIO A;  3OBY A;  3OW2 A;  2CS7 A;  4XEO A;  3LLR A;  6AT1 B;  2C7I A;  3G71 Q;  2VWF A;  1R0C B;  2DAQ A;  2YLC A;  2KVQ G;  4HWO A;  3FC3 A;  1OX9 A;  4PLL A;  4DBQ A;  3TEE A;  1AZG B;  1D0Y A;  3MCA B;  1IL2 A;  3RAC A;  2RHX A;  3RBB B;  4BW9 A;  2RM4 A;  5GMK h;  2QAS A;  1NJ1 A;  4PJO E;  1BKB A;  1VQN Q;  1S72 Q;  2G6F X;  4FU6 A;  3QZ9 B;  4RTU A;  3OMC A;  4P73 A;  3E2U A;  1M27 C;  1M2V A;  3I5S A;  1AOJ A;  3QDR B;  3FJ5 A;  2H8H A;  1NJ2 A;  1D09 B;  3EHR A;  3DKM A;  5A2Q E;  3EG3 A;  3OYE A;  3ERR A;  1VYT A;  1EFN A;  1JJ2 P;  1VIE A;  2DD4 A;  1SHG A;  1KHI A;  1NYF A;  4AH6 A;  4JRP A;  2CT3 A;  2ZZF A;  2EQJ A;  2JN0 A;  1YIT T;  1WI7 A;  2HL3 A;  2O4X A;  5GAN e;  2JVV A;  2EJF A;  4BI4 A;  2J6K A;  3CCR T;  4RMF A;  1I07 A;  3OYG A;  1TG0 A;  5GAO p;  4ZNX A;  3RDV A;  2E3C A;  1K0S A;  2XMF A;  5DLQ E;  3M57 A;  1IB8 A;  3CCE T;  3M9Q A;  2EIF A;  4BY6 B;  4XTU A;  4A4H A;  1WXT A;  1K8A C;  2RHS A;  1TUG B;  1NE8 A;  3FB9 A;  2ALY A;  5KYU A;  2IIM A;  3RF1 A;  1YI2 T;  4II1 A;  1YWP A;  2OI3 A;  3UWN A;  3CCJ A;  1RI0 A;  3CCJ T;  1H4Q A;  2DET A;  1OEB A;  5HCK A;  3UAT A;  1VIF A;  4UPA A;  4NS5 A;  1MUZ A;  1P92 A;  2PQW A;  1ZQ1 A;  2W10 A;  1WQ7 A;  1PD0 A;  4FCY A;  4OP0 A;  2KSS A;  2L3Q A;  4CH5 A;  1WLE A;  1T3L A;  1UDL A;  4RTZ A;  3JCM b;  2NUT A;  1ZBJ A;  3MP6 A;  2CGH A;  3RIR A;  4QVZ A;  3EFO A;  2EAY A;  3OYH A;  1IHW A;  2QDL A;  2EWN A;  2ZIM A;  4O6J A;  2ZR3 A;  3HL8 A;  2DO3 A;  3MPU B;  4Z89 A;  2B86 A;  2QEX Q;  2CP6 A;  2KMT A;  2ARU A;  2ZIN A;  3RGL A;  4DEX A;  4HVV A;  2O4X B;  3OYJ A;  5GAN g;  3LWH A;  1WXU A;  1ZSZ A;  1AWO A;  3HRU A;  1M1F A;  4YRE A;  1G3T A;  4RQF A;  5IN1 A;  1PRL C;  2A0F B;  3HFN A;  4FW1 A;  3NEN A;  1RIQ A;  3PMI A;  1G5I A;  3M4Q A;  4LVI A;  5KH6 A;  3BJU A;  1VQ8 A;  4FSS A;  1ADY A;  4ZTU B;  2RHS B;  3H0I A;  2BZ8 A;  4E7K A;  1BCM A;  2ALY B;  1Q82 C;  3I56 Q;  5CVI A;  1V1C A;  4YP0 A;  2DL7 A;  1B7T A;  3QYG B;  4CI0 C;  4LUE A;  2J3M A;  3IQL A;  1QMC A;  1MND A;  1VQ7 A;  3QG1 A;  1X56 A;  4FIB A;  2KGT A;  1Y96 B;  2LDM A;  1LYL A;  1YJN Q;  3GBQ A;  1KQ1 A;  3J80 E;  1NJI C;  4OB0 B;  2KRO A;  3QYH B;  4YCW A;  4PL6 A;  1CSK A;  1YNZ A;  3JCM e;  3EGU A;  4MMK A;  3PGG A;  2ZGW A;  3HRT A;  4KH1 B;  2HAX A;  2RD1 A;  4PLI A;  1JBM A;  2QDY B;  5CR2 A;  4M78 G;  2AK5 A;  1Q86 U;  4EIK A;  1WYX A;  3FRN A;  4HWS A;  1ZSZ B;  5EC7 A;  3R6N A;  1KSW A;  1HD3 A;  1ASY A;  3CBP A;  3URG A;  4N0A C;  2K79 A;  1VQ8 Q;  4C92 B;  2O2O A;  3LGL A;  4Y91 A;  4J6W A;  4L59 A;  1YHQ A;  3R07 A;  2QGF B;  2EVR A;  1UE9 A;  2M9U A;  1XNI A;  1K9M C;  3PMT A;  4BE2 A;  3OS0 A;  5GAM e;  3A5Z B;  1VQ7 Q;  4YRJ A;  2DZC A;  3G1Z A;  1X2Q A;  4OF1 A;  4LDW A;  2RK2 A;  1AZE A;  3MQZ A;  1KK7 A;  1N8R U;  3M0S A;  4EMK A;  1RI9 A;  1W6X A;  2COZ A;  3UA7 A;  3FDR A;  3CCQ T;  4P3P A;  4JLG A;  2R5A A;  1H4T A;  4KH0 B;  4PJO C;  1NBE B;  1K9M U;  2C8M A;  1J3T A;  4MDX A;  1SRL A;  1V76 A;  2YDL A;  3O5Z A;  2K2V A;  2BIV A;  4M7A G;  2RQW A;  3JCM g;  1UEC A;  1NJ5 A;  4E2F B;  4XEM A;  1RAG B;  4WTO B;  1JJ2 S;  1VQ6 T;  3CCM A;  3N5B B;  3CCM T;  4DPG A;  1YHQ Q;  4YRP A;  4VUB A;  3CXC A;  2CRE A;  2D0N A;  3NFC A;  2FZG B;  3TVT A;  1BIB A;  2RI3 A;  1NNH A;  2O9V A;  2Y90 A;  4OMM A;  4C8Q G;  4R55 A;  4M75 F;  2QHV A;  3L2Q A;  1QVF A;  2RJD A;  1SKU B;  2DIG A;  2MF2 A;  1T3S A;  2CH4 W;  3VQY A;  2BE7 D;  4ELY C;  3CPW A;  2KBT A;  1G83 A;  4P75 C;  3RKW A;  3NEL A;  2R57 A;  2YRC A;  3SD4 A;  4JLI A;  2AHJ B;  1YBY A;  3LYI A;  4AMC A;  1NYR A;  3L4G B;  3RUX A;  5GAM g;  2ENM A;  2KXC A;  1G5H A;  2HNI A;  4IUT A;  2KQW A;  3BY7 A;  4M75 E;  1M2O A;  4PFO A;  3V8J A;  1UTI A;  2GQI A;  3IKL A;  3HFZ A;  3HY1 A;  2JZ2 A;  2NWM A;  2JUF A;  2E1H A;  4OGE A;  2F5K A;  3H9N A;  2QQA A;  2LZ6 B;  2HDA A;  1ZSG A;  2DA9 A;  2Q7H A;  4KT0 E;  3A7A A;  4M75 D;  4OMP A;  2LQ8 A;  2QTV A;  4XU3 A;  1LVK A;  2LC4 A;  4HWP A;  2I4N A;  5AT1 B;  1VQM T;  1Z7N A;  5LJ5 d;  3CC7 A;  1JO8 A;  1WPY A;  2A8E A;  1D0Z A;  3CCL T;  1W1F A;  2RF0 A;  2V1Q A;  4ELZ C;  5CAI A;  4WJ3 M;  4TVA B;  2R58 A;  1K0X A;  4YRN A;  5I21 A;  1ATI A;  1OPL A;  2QK0 A;  1TTH B;  4YRI A;  4AG1 C;  4Q5W A;  2EKH A;  2RI2 A;  1GCQ C;  5C6S A;  3NPF A;  1FWZ A;  2YLB A;  1VQK A;  1AHJ B;  2CP5 A;  4JRI A;  1Y0M A;  3JB9 G;  1VQK T;  5GAN 2;  2RQU A;  3PFS A;  3LC0 A;  2VYT A;  2E64 A;  2EQK A;  5CKF A;  5GAO n;  3A98 A;  2L2P A;  4P74 C;  2YUN A;  3S3M A;  1VQ5 A;  4CS3 A;  2RMO A;  1X6O A;  5GMK l;  4RTY A;  5I22 A;  3VJP A;  3CD6 Q;  2I4O A;  3HFZ B;  2XDD A;  1UHF A;  3VQX A;  1B70 B;  3RR6 A;  2ZPE B;  4C0D C;  1LPL A;  1WJS A;  2E6Z A;  2RHZ A;  2RJF A;  3CMA T;  2QGG A;  3CC7 Q;  2CJA A;  2D1X A;  1M90 U;  1X2G A;  2DIQ A;  1EIY B;  2FB7 A;  4YRF A;  1EVL A;  1OV3 A;  4XU0 A;  3ZL7 C;  2RHQ A;  1BI0 A;  3QNE A;  4Y28 E;  1QCF A;  4DOV A;  4A4G A;  3QWX X;  3PT9 A;  2AKK A;  4OB1 B;  1YJW A;  1G2B A;  4E47 A;  3GNF B;  4J9D A;  1GFD A;  5KYX A;  4M78 B;  2K6D A;  4HT9 A;  4OVA A;  1E24 A;  4ATO A;  1QP3 A;  2JMC A;  1U06 A;  4CH3 A;  2K5L A;  1K76 A;  2FYK A;  1QVG P;  3EFR A;  2E10 A;  3VYH B;  3SHW A;  2ZT5 A;  1VQ5 Q;  1O9S A;  4BB7 A;  4CH4 A;  1WU7 A;  3VQW A;  1I5O B;  1N9S A;  4O5V A;  2V8J A;  3CC2 Q;  4CC2 A;  4EO4 A;  1VQ4 A;  2BE9 B;  2L3R A;  3JCM P;  4KUI A;  4AFU C;  3WXM B;  3GLX A;  2C0I A;  4KRT A;  3CCS A;  3CC4 Q;  3CCS T;  1BI2 A;  1WIE A;  3TCJ A;  2XIC A;  5FRM A;  1VYV A;  4YRT A;  1ASZ A;  4ZGD B;  3SFM A;  2E5K A;  1KC8 R;  3SWN C;  2K3Y A;  2X4W A;  3CCU T;  3LW5 E;  2LCC A;  3PIP A;  1X2H A;  2JTE A;  4J5Y A;  4E7I A;  3MHX A;  2HMA A;  3CCV T;  1XOV A;  1PCX A;  1YJW Q;  4G85 A;  4LE9 A;  5J26 A;  2F5T X;  4AFZ C;  2XKO C;  2YUO A;  3S6W A;  2XID A;  4R0K A;  4M7A B;  3HP9 A;  2PZ1 A;  1KQS A;  2QI2 A;  1Q81 U;  3QKJ A;  3THK A;  4F7U A;  5K1X A;  2JM9 A;  2EGA A;  4IUP A;  1X2K A;  3VRZ A;  4DBF A;  1L0W A;  2CZ6 B;  4X34 A;  5I2M A;  3C95 A;  3M0Q A;  3QJ6 A;  4HVW A;  2LJ3 A;  4C8Q B;  4M78 E;  3G4S A;  1VQ4 Q;  3HY0 A;  3TU4 K;  5L23 A;  1I8F A;  3REA B;  4LNS A;  2RQR A;  2NUP B;  2L3S A;  5KYW B;  4R56 A;  3LGF A;  3OYB A;  2ZZD A;  3C0C A;  1VQL T;  1SPK A;  1NPR A;  4CC3 A;  2CH4 A;  4DBR A;  2AMC A;  5FW9 A;  5HKC A;  3E9F A;  4RTV A;  1EQR A;  1C0M A;  4M75 C;  1W2B P;  3G6E A;  3EG2 A;  2DEU A;  2Q5H A;  2MK5 A;  4P72 C;  2DL8 A;  1AWX A;  1YN8 A;  1AD5 A;  3OSV A;  4CS2 A;  4A4E A;  1YB3 A;  2LVM A;  4PJM A;  1KQ2 A;  1R0B G;  3QO8 A;  2FG0 A;  1USY A;  2KAF A;  4EX5 A;  3EG0 A;  2O31 A;  1Y7X A;  2DPP B;  4XTZ A;  4GLK A;  5D6Y A;  3P8D A;  4F7U B;  1UGP B;  3REU A;  3G71 T;  1BU1 A;  1PSE A;  1VUB A;  3PZC A;  3G4S Q;  2DER A;  1J5W A;  4ZGJ B;  1NJ8 A;  1D0X A;  4M77 F;  4B9W A;  1D3B A;  3MEV A;  3I35 A;  3V7C A;  3QHS A;  2RHI A;  3OYF A;  2DKG A;  4FSX A;  2CP0 A;  4KUD K;  3PIO A;  1S1N A;  4J8O A;  2DL4 A;  5DM7 R;  1NZ9 A;  1S72 T;  4L6V 5;  4M4Z A;  1S72 A;  1VQN T;  3EGD B;  5C0M A;  1Q7Y U;  2P0L A;  1OYX A;  2JT4 A;  3OD1 A;  3G6E Q;  2B8A A;  3C94 A;  1PYS A;  2EBP A;  1WHJ A;  4M77 E;  2MCN A;  4HVC A;  2CP3 A;  2K3X A;  1VQO A;  2P0P A;  4PFZ A;  1HYO A;  4J9C A;  4D6W A;  5GAO r;  2KRS A;  2DVE A;  2LX7 A;  4C0Z A;  4PJO F;  1UGQ B;  4MML A;  4H2V A;  2QQR A;  5KYY A;  5FU7 C;  4K86 A;  4M77 D;  1GCQ A;  4WJ4 A;  4QKU A;  2A08 A;  8ATC B;  3HXZ A;  3VS0 A;  1UJY A;  2JTF A;  1SES A;  2YRD A;  2EJG A;  4P74 A;  1ZBX A;  3OYI A;  2LT1 A;  1TH7 A;  2KDS A;  1O75 A;  5HGQ A;  1Y71 A;  2PVO B;  3P8B B;  1D3B B;  3LWI A;  4LVK A;  4JPB W;  4UP8 A;  4PFP A;  1QW1 A;  4OMQ A;  2LT4 A;  2P4R A;  3PTA A;  4XAX B;  1QVG S;  2K5F A;  1PRM C;  5GAN h;  1RAB B;  3V8K A;  2DLP A;  1VQO Q;  2GTJ A;  2WAC A;  4F17 A;  2O88 A;  4PJJ A;  5GAN 7;  1VQ9 A;  4PJO D;  5ELO A;  1MMG A;  1R77 A;  1KD1 R;  2QXF A;  4JRK A;  2K57 A;  1UJ0 A;  3M53 A;  1JJC B;  2LQK A;  2FZC B;  4MZT A;  3MF2 A;  1W66 A;  2X4J A;  3OS2 A;  2EGC A;  1B76 A;  1B34 A;  3LH5 A;  5D7U A;  3L42 A;  2QEX A;  1GFC A;  3VUB A;  2QEX T;  1QQJ A;  4M7D E;  4J15 A;  2KYB A;  2LTO A;  2A37 A;  4F14 A;  2DL3 A;  1IRE B;  4Z8A A;  3OQ5 A;  5LJ3 d;  1ADJ A;  1TOV A;  2DX1 A;  4A4K A;  2DXU A;  1YCS B;  1E1T A;  1E6G A;  3QO3 A;  1Z9Z A;  4D8D A;  3NTK A;  4TTV A;  4M7D D;  3UFG A;  3CQT A;  3QWY A;  2GGR A;  3J81 E;  4HCB A;  1BBZ A;  2CJ9 A;  1M2V B;  4IUR A;  1D1A A;  5L8R E;  1VQ9 Q;  3L2U A;  3MP1 A;  3I56 A;  3W3S A;  3I56 T;  1SHF A;  2QG9 B;  3TEG A;  3SWN A;  1JQQ A;  4XU2 A;  1K8A U;  4M78 C;  1I81 A;  1V29 B;  5LJ5 f;  4YYE A;  1MV3 A;  2XTI A;  1KFZ A;  1ZLM A;  1YJN A;  1YJN T;  2ED1 A;  4CH6 A;  1QVP A;  4KBM B;  1K73 R;  2E3H A;  1YFT A;  3A8M B;  4TVW A;  4UP9 A;  3QDF A;  4IUQ A;  1WQW A;  3I5R A;  1X55 A;  4LVM A;  1W2B S;  5KCO A;  2KXD A;  3X20 B;  1M9S A;  4MZP A;  3MKD A;  4JZ4 A;  2DQ3 A;  5GAN 3;  3HRI A;  3M4G A;  3O8V A;  1UGV A;  1VQ8 T;  2QQS A;  2JXB A;  4MZM A;  3DLL A;  4PKC C;  1TXQ A;  5KYU B;  2OJ2 A;  3JCM h;  1RLP C;  2X3X D;  3IG2 A;  2RHU A;  3INZ A;  3AT1 B;  2ARS A;  2JNG A;  2X51 A;  4QQD A;  1VQ7 T;  1QWF A;  4M75 A;  1OOT A;  1H3H A;  1TWB A;  1SSF A;  1WA7 A;  4P72 A;  2RO0 A;  3RMQ A;  1T0J A;  2DDZ A;  2VGM A;  2NUT B;  3L2V A;  5A0G A;  2V8K A;  4RG8 A;  2ZCF B;  2X35 A;  3GPL A;  5CKH A;  2J3L A;  3EFO B;  3EH2 A;  1Q82 U;  4JS5 A;  4RCB A;  4JDS A;  3VS3 A;  1GRI A;  1FYN A;  1SSH A;  1YJ9 A;  3GIB A;  4YRK A;  1IGQ A;  4FYY B;  3EG1 A;  4M77 C;  2P84 A;  5GAM h;  4P3O A;  1N5Z A;  2G3R A;  3UH0 A;  1NJI U;  2P5I A;  1WHL A;  1YHQ T;  1K1Z A;  3EGX A;  2BZX A;  4ZTJ A;  1HC7 A;  2ZR2 A;  3S3O A;  2EQI A;  1I0C A;  5IHN A;  4WCI A;  3OMG A;  1U5S A;  1FXX A;  4QVD A;  3I55 A;  3OA6 A;  1NM7 A;  4KGV B;  1RAC B;  2M16 A;  2OAU A;  2ECZ A;  1X69 A;  3ZBD A;  1KIK A;  1ZUK A;  4LVJ A;  2XK0 A;  3OS5 A;  2FRW A;  3VBB A;  1HXD A;  2HEQ A;  1K4U S;  1E7O A;  4OGC A;  2D6F A;  1EVK A;  4HKE A;  2YT6 A;  3VRY A;  1SET A;  4E6R A;  3A7R A;  1ZA1 B;  3CME A;  2DBM A;  4RCC A;  3HSB A;  3JCM J;  1YJ9 Q;  4K87 A;  4A63 B;  3HTR A;  2KRN A;  5LJ3 h;  5HK0 A;  4FL6 A;  2PMF A;  3A5Y A;  2JW4 A;  4C92 F;  2JTM A;  3CMQ A;  3I7F A;  2PU9 B;  4ESR A;  1PC0 A;  5DY9 A;  4H2T A;  3RES A;  5GMK i;  4YRL A;  5FU6 C;  1JB0 E;  3GF5 A;  1VA7 A;  5KE3 A;  4QT7 A;  5CKE A;  1PM3 A;  2ZT6 A;  4GLM A;  1ZUU A;  3A8H B;  1M1K C;  2ZNJ A;  2FEI A;  4LDX A;  2NUZ A;  3EGX B;  3I55 Q;  3DB3 A;  2K7A A;  3E9G A;  4EPC A;  1JJ2 A;  2YWW A;  4M7D C;  3REB B;  2PNI A;  2L0A A;  4C92 E;  1MNE A;  2OAW A;  4TWA A;  1B3Q A;  1X6G A;  2HCK A;  4H02 A;  1WHM A;  4C0G A;  2ZPB B;  3ZEH A;  2ZTG A;  2J7I A;  1BBU A;  3HXY A;  3HXX A;  5IAY A;  1FX7 A;  4EMK B;  1YCY A;  3CME Q;  1C0A A;  1M1K U;  2C0O A;  4NL2 A;  2CT4 A;  4F04 B;  5I2S A;  4C92 D;  4JUV A;  2EQM A;  1W70 A;  3BDL A;  2DXT A;  1JU5 C;  3DLM A;  2ABL A;  2DU7 A;  3CD6 A;  4QQG A;  3CD6 T;  4E51 A;  4FT2 A;  3U23 A;  5GAN 4;  5LJ5 j;  3E9I A;  2E5Q A;  2CZ7 B;  4J9F A;  2QHT A;  4F7U G;  2VXE A;  2JJ9 A;  3FLG A;  1RAH B;  3CC7 T;  4V2S A;  2X9H A;  2DRK A;  4J9H A;  1E22 A;  4OB3 B;  2E70 A;  1TSF A;  2MI6 A;  2ROL A;  2DD5 A;  1XTD A;  4XQ3 A;  2ODR D;  3ME9 A;  2EYW A;  3ER0 A;  1EOV A;  1PSF A;  1Q95 G;  1YP5 A;  1OU8 A;  1WZO A;  3C4S A;  5C53 B;  2RA2 A;  3ZFJ A;  5IXF A;  2KEA A;  2LRQ A;  2DNU A;  1IZ6 A;  3X28 B;  1UB4 A;  3M59 A;  2HZY A;  2KT1 A;  1VQ5 T;  2MOX A;  4FT4 A;  4DA4 A;  1VQP Q;  4OMN A;  2JMA A;  3MEY A;  1WHG A;  4EDU A;  3CC2 A;  4BY6 C;  3OW2 P;  3QXE B;  3CC2 T;  3OYN A;  1QWE A;  5D6X A;  2A36 A;  3EG9 A;  1ZHI A;  1Q86 R;  4YRQ A;  1I4K 1;  4YRS A;  3X24 B;  3CC4 A;  3CC4 T;  3M0T A;  2AZS A;  4BE1 A;  3VS2 A;  5C51 B;  2LJ0 A;  4X9D A;  2XDB A;  4IKF A;  1AWW A;  1OZ2 A;  4LUD A;  1M1G A;  2IG0 A;  2V1R A;  1BYM A;  2XI9 A;  2GCX A;  2MIO A;  1OQK A;  5HY6 A;  4BE0 A;  1YIJ Q;  3L1A A;  3KXT A;  2X3W D;  3D7S B;  1YJW T;  1SF9 A;  2QA4 Q;  2YUP A;  4WI1 A;  2EYX A;  2VVK A;  4GY5 A;  3V7R A;  3A1P A;  4JJC A;  4XTV A;  4H2S A;  1WGS A;  1N8R R;  3JRZ A;  5GMK j;  3M56 A;  2QAZ A;  4HT8 A;  2AKW A;  3PVL A;  4A4F A;  1K9M R;  1VQ4 T;  2FO0 A;  2XD0 A;  4NL3 A;  1G5V A;  1HJD A;  1RAE B;  4RG2 A;  2FHD A;  1OI1 A;  2DXC A;  5J3B A;  1KD1 C;  1GCP A;  5AYF A;  2FZK B;  4TQD A;  2ATC B;  1HSQ A;  5GAN d;  1MMA A;  4M77 A;  1NLP C;  5LJ3 f;  3WVD B;  2MMP A;  4C5E A;  3TSZ A;  4CC4 B;  4N0A A;  1OUL A;  2P0K A;  1QP2 A;  4BAC A;  2OTL A;  2E12 A;  4KQE A;  4MDW A;  5ECA A;  3WQZ A;  1WXB A;  2RHQ B;  5ELN A;  2Q7G A;  2HKQ B;  2FPD A;  4M78 F;  4CC7 A;  2NS6 A;  4FM4 B;  5FLX E;  2O01 E;  2AKL A;  4RMO A;  1EFW A;  1EX4 A;  1KD1 U;  2RNA A;  3JV3 A;  5KYX B;  3M0U A;  3F70 A;  3M4P A;  2IY5 A;  1D1B A;  3CBO A;  1MMD A;  4RTW A;  4B9X A;  2RH2 A;  1I5L A;  5IHI A;  4TVY A;  3L2Z A;  5GAO m;  2A7Y A;  4KUL A;  3QBY A;  3G4S T;  4HCC A;  4PJO A;  1PKS A;  1ZSZ C;  5IHK A;  5IXB A;  1T0H A;  4YCV A;  4YRO A;  4JJN K;  1R8O B;  1NYG A;  9ATC B;  4TVR A;  1B7Y A;  2CIM A;  5HK3 A;  4C92 C;  1H8K A;  1RL2 A;  1PKT A;  3UGT A;  3NET A;  2QQ9 A;  5IH2 A;  3HFO A;  3JAM E;  3MF1 A;  4M78 D;  3MEU A;  3JSC A;  5FRO A;  2OTL Q;  2DU5 A;  1ABQ A;  3G6E T;  1M3B A;  1K73 C;  2ESW A;  2Q5I A;  2X4X A;  4ZTZ B;  1B8A A;  1ZUY A;  2DK3 A;  2ZIO A;  2A3L A;  4LD6 A;  1QE0 A;  3PCO A;  4QQ6 A;  1NEB A;  4DBH A;  3HXV A;  2M02 A;  2KI7 A;  1OU9 A;  4M7D A;  1WX6 A;  4P75 A;  1MHN A;  2K3B A;  2HBW A;  3WVE B;  2ODR C;  2KRM A;  4BI8 B;  4P3N A;  2JS0 A;  2GNC A;  4RQE A;  4F16 A;  3RKX A; 
#chains in the Genus database with same CATH homology
 4C8Q F;  2HQX A;  2IVW A;  4M7A E;  4K88 A;  5DLO A;  2IY5 B;  3VQV A;  3VYG A;  4YRC A;  5LJ5 e;  4PJO B;  3M54 A;  2P0Q A;  2ZPG B;  4PNO A;  2EYQ A;  4YRG A;  4UP7 A;  4C8Q E;  3CPF A;  4M7A D;  4J7I A;  2H3J A;  2DEQ A;  3JCM d;  2JOY A;  2AMC B;  3A8L B;  1VQO T;  3A8O B;  3M4Y A;  2Q7E A;  4ZGE B;  2I4M A;  2ZXF A;  3OW2 S;  4XTW A;  4C8Q D;  4ME7 A;  1WYD A;  3BDU A;  3OYL A;  1SER A;  3V7S A;  2CZ1 B;  1M4Z A;  3NTH A;  3QZ5 B;  2PUK B;  1U1T A;  3EFS A;  5GAM d;  5GAN 5;  3OB9 A;  4M75 G;  2CYZ B;  1NJ6 A;  2L8D A;  3QUI A;  5J39 A;  4F7U E;  2EJ9 A;  5LJ5 g;  3JB9 F;  5K1P A;  4LDV A;  4P71 C;  4M7D F;  2YHT A;  2EQU A;  1H64 1;  1VQ9 T;  3OBW A;  3P8H A;  4HA8 A;  1GXI E;  1PYS B;  3QII A;  1KMN A;  1BIA A;  3JB9 H;  1QVG A;  3QJY A;  4J7F A;  3VU3 C;  5LJ3 j;  5GMK e;  1KHC A;  3A7U A;  5KE2 A;  1M5Q 1;  5KCH A;  3L2W A;  4PHC A;  2ZT7 A;  1HTT A;  1BBW A;  5A0D A;  1YIT A;  3RL6 A;  4N4G A;  3JB9 D;  4IUV A;  3E1S A;  3CCR A;  2LCL A;  4N4I A;  4L87 A;  2MWP A;  2HBP A;  4E7L A;  4RDX A;  3CCE A;  2YRV A;  4RKU E;  4C0D B;  2RB6 A;  5E3I A;  3OYM A;  4XK8 E;  3RER A;  3JB9 J;  1YFS A;  3SB2 A;  2VC8 A;  1YI2 A;  3Q1J A;  2KY9 A;  2RJC A;  3DSQ A;  3VV0 A;  1N27 A;  3QPH A;  2BKD N;  4DQ2 A;  3M58 A;  1Y96 A;  3TEH A;  1B34 B;  3JCM Q;  2E6N A;  2L5Q A;  2GFA A;  2NLU A;  2GF7 A;  3OYY A;  3HPW A;  2FVU A;  5IT9 E;  4BDZ A;  1Y07 A;  4HWR A;  1XQH A;  1W2B A;  4DOW A;  4Q15 A;  3GNG A;  4C92 A;  1VQZ A;  1YGB A;  1QF6 A;  3H8Z A;  3LX7 A;  3J7A F;  4M7A C;  5FRN A;  4ZN3 A;  1OZ3 A;  2RJE A;  2I4L A;  4JS4 A;  3RMS A;  3SWN B;  2R5M A;  3A5Z A;  2D0Q B;  2DTO A;  3UT1 A;  4A53 A;  1Q86 C;  2QHU A;  3T9N A;  2VUB A;  4C8Q C;  1YJ9 T;  1NPP A;  1GGM A;  3TEH B;  3MO8 A;  2XU8 A;  1NYQ A;  4ZN1 A;  3UGQ A;  3E9H A;  3ICA A;  1G51 A;  2ZCE A;  4O2D A;  2WSC E;  4E7H A;  5EG2 A;  1H4V B;  5CKD A;  2DTI A;  4X9C A;  3I55 T;  4X5O A;  4BWA A;  2HQE A;  1X54 A;  1W4S A;  1N8R C;  3FEO A;  1X75 C;  5GAN f;  3A8G B;  4BD3 A;  4NCX A;  4M75 B;  1KG1 A;  3V8L A;  2VGN A;  3CME T;  2MAM A;  3L4G A;  3KUF A;  4YRM A;  1KC8 C;  2QTX A;  4YTL A;  3FJP A;  3CCQ A;  1UEB A;  4J6X A;  3M55 A;  4YDQ A;  1EIF A;  12AS A;  1KMM A;  5CO7 A;  3CXC S;  2K4Y A;  5CIU A;  3QO7 A;  4H2Y A;  1QVF S;  2ZPI B;  5A0L A;  2Y4Y A;  4L5G A;  1KC8 U;  3S3N A;  2ART A;  1VQ6 A;  3CPW S;  5GAN 8;  3QTC A;  1WNL A;  2WSE E;  3VKI A;  4P71 A;  1N6A A;  3KBG A;  4TVA A;  2FL7 A;  3BFM A;  1N9R A;  3MEW A;  3OSS C;  4WF2 A;  5LJ3 e;  1UGR B;  3IKM B;  11AS A;  2ZNI A;  4M77 G;  2XDP A;  2X4Y A;  1USY C;  3HFV A;  4EMG A;  2E41 A;  2PME A;  1VQP A;  1VQP T;  4TQF A;  2CKK A;  3TRE A;  5CK9 A;  5FU7 B;  4HCZ A;  3X26 B;  4HWT A;  2E65 A;  4UC4 A;  1B70 A;  4LVL A;  1JRI A;  4YCU A;  1H4S A;  2P4T A;  3OY9 A;  2L89 A;  3KFU A;  5CQX A;  4PJO G;  2MWO A;  1EIY A;  2ZZG A;  1YIJ A;  1YIJ T;  4NOY A;  5LL6 S;  1VQM A;  1Z7M A;  2QA4 A;  2QA4 T;  4N4H A;  3CBM A;  3CCL A;  3RKY A;  2CJB A;  1MGQ A;  4E7J A;  3R6O A;  3JCM f;  4EMH A;  2C06 A;  4OMF B;  3HRK A;  2VXF A;  4M78 A;  2E5A A;  4Q6G A;  1N9W A;  1LOJ A;  5LJ3 g;  3C12 A;  2HD0 A;  1M8V A;  1U8R A;  3UPU A;  3ASK A;  3M5A A;  1YFR A;  2ZPF B;  3DB4 A;  3GP8 A;  2DJZ A;  4BI3 A;  2KK4 A;  3JB9 I;  1M90 C;  4M7D G;  4Z02 A;  5F5W A;  4G84 A;  4C5G A;  1G3S A;  2RHY A;  4LD9 K;  2XGT A;  2CZ0 B;  4LDY A;  2Y4X A;  4IUU A;  3A31 A;  2G4C A;  4CRI A;  4PG3 A;  4P73 C;  5GAM f;  4KR2 A;  4A54 A;  1LJO A;  3OYK A;  2PVG B;  3HXU A;  3CMA A;  2WSF E;  4JRQ A;  4KR3 A;  2V8I A;  2XHC A;  2GQV A;  3VUZ A;  2I2L A;  3UDC A;  3HHT B;  2RI5 A;  5GAN 6;  2DTH A;  3NEM A;  4M7A A;  1FYF A;  2BUD A;  3FIF A;  5CQY A;  1BI1 A;  5M9O A;  1UGS B;  2M1H A;  5CCA A;  3IAL A;  1KOG A;  5GMK m;  2PUO B;  3JCM W;  2RK1 A;  1E1O A;  3BW1 A;  3QO5 A;  1DJ7 B;  3OYD A;  2M0O A;  5GAN j;  4C8Q A;  5GAO l;  3QSU A;  3REX A;  4QW2 A;  2DZ9 A;  3CEY A;  2EKO A;  5GAO q;  2PVD B;  4H2X A;  3OYA A;  2OTL T;  3SDZ A;  3P8T A;  4P5N A;  1G3W A;  4OB2 B;  2ZZE A;  3EAE A;  1Q81 C;  2QQB A;  1KQS S;  2DXB A;  3CCU A;  3LSQ A;  5KNN A;  4QVC A;  1SRY A;  3CCV A;  4BUG A;  3A74 A;  5CKB A;  4BDY A;  4XU1 A;  3MEA A;  4LDU A;  2GFU A;  4ZTF A;  2AKW B;  4OLF A;  4YPF A;  4HT4 A;  3P8Y A;  4YRR A;  2EL9 A;  5C52 B;  3OYC A;  3HKS A;  4M77 B;  4C5I A;  1BI3 A;  2ZPH B;  4M7A F;  1WJR A;  4H2X B;  4J6Y A;  1U1S A;  1VQL A;  2EFI A;  4H2W A;  3X25 B;  3LH0 A;  3MP8 A;  5LJ5 h;  4XTX A;  3JCM X;  1X01 A;  3P8V A;  1HK9 A;  3HTZ A;  2F69 A;  1K73 U;  4C5H A;  3PNW C;  3MET A;  3GOX A;  3E19 A;  2OTJ A;  2OTJ T;  1LNX A;  3JCM V;  2VV5 A;  3NTI A;  2QHS A;  1Q7Y C;  3JCM c;  1WJQ A;  3G71 A;  1B7Y B;  3A32 A;  4C0F A;  1H3Z A;  3H6Z A;  1G3Y A;  5D6W A;  4ZIB A;  1VQN A;  2DQ0 A;  4CS4 A;  2D9T A;  3G7Z A;  2LNV A;  4H2U A;  5FU6 B;  2K5I A;  3HXW A;  2XG8 D;  2LX9 A;  3LSS A;  3PCO B;  4EMK C;  3L2R A;  4F7U F;  3AHU A;  3OS1 A;  4XTY A;  4M7D B;  4J83 A;  1JJC A;  4C92 G;  3HRS A;  2ZT8 A;  5GAM j;  3TUP A;  3OBY A;  3OW2 A;  2CS7 A;  4XEO A;  3LLR A;  2C7I A;  2DAQ A;  2YLC A;  2KVQ G;  4HWO A;  3FC3 A;  4PLL A;  3TEE A;  3MCA B;  1IL2 A;  3RAC A;  2RHX A;  4BW9 A;  2RM4 A;  5GMK h;  1NJ1 A;  4PJO E;  1BKB A;  4FU6 A;  3QZ9 B;  3OMC A;  4P73 A;  3QDR B;  1NJ2 A;  3DKM A;  5A2Q E;  3OYE A;  3ERR A;  1VIE A;  2DD4 A;  4AH6 A;  1KHI A;  4JRP A;  2ZZF A;  2EQJ A;  2JN0 A;  1YIT T;  2O4X A;  5GAN e;  2JVV A;  2EJF A;  4BI4 A;  3CCR T;  4RMF A;  3OYG A;  5GAO p;  2E3C A;  5DLQ E;  3M57 A;  3CCE T;  3M9Q A;  2EIF A;  4BY6 B;  4XTU A;  4A4H A;  1K8A C;  2RHS A;  1NE8 A;  3FB9 A;  2ALY A;  3RF1 A;  1YI2 T;  4II1 A;  3UWN A;  3CCJ A;  1RI0 A;  3CCJ T;  1H4Q A;  1VIF A;  4UPA A;  4NS5 A;  1P92 A;  2PQW A;  1ZQ1 A;  1WQ7 A;  2KSS A;  4OP0 A;  4CH5 A;  1WLE A;  3JCM b;  3MP6 A;  2CGH A;  3RIR A;  4QVZ A;  4WJ3 M;  2ZIM A;  2EAY A;  3OYH A;  2EWN A;  2ZR3 A;  4O6J A;  3HL8 A;  2DO3 A;  2KMT A;  2ARU A;  2ZIN A;  3RGL A;  2O4X B;  3OYJ A;  5GAN g;  3LWH A;  3HRU A;  1M1F A;  4YRE A;  1G3T A;  4RQF A;  5IN1 A;  3HFN A;  3NEN A;  1RIQ A;  3PMI A;  1G5I A;  3M4Q A;  4LVI A;  5KH6 A;  3BJU A;  1VQ8 A;  1ADY A;  4ZTU B;  2RHS B;  4E7K A;  2ALY B;  1Q82 C;  5CVI A;  4YP0 A;  3QYG B;  4CI0 C;  2J3M A;  1VQ7 A;  3QG1 A;  1X56 A;  4FIB A;  1Y96 B;  2LDM A;  1LYL A;  1KQ1 A;  3J80 E;  1NJI C;  4OB0 B;  3QYH B;  4YCW A;  4PL6 A;  3JCM e;  4MMK A;  3PGG A;  2ZGW A;  3HRT A;  2HAX A;  2RD1 A;  4PLI A;  1JBM A;  2QDY B;  5CR2 A;  4M78 G;  1Q86 U;  3FRN A;  4HWS A;  1ASY A;  3CBP A;  3URG A;  4N0A C;  4C92 B;  3LGL A;  4Y91 A;  4J6W A;  4L59 A;  1YHQ A;  3R07 A;  2M9U A;  1XNI A;  1K9M C;  3PMT A;  4BE2 A;  3OS0 A;  5GAM e;  3A5Z B;  4YRJ A;  2DZC A;  3G1Z A;  4OF1 A;  4LDW A;  2RK2 A;  3MQZ A;  1N8R U;  4EMK A;  3FDR A;  3CCQ T;  4P3P A;  4JLG A;  2R5A A;  1H4T A;  4PJO C;  1K9M U;  2C8M A;  4MDX A;  2K2V A;  2BIV A;  4M7A G;  3JCM g;  1NJ5 A;  4XEM A;  1JJ2 S;  1VQ6 T;  3CCM A;  3N5B B;  3CCM T;  4DPG A;  4YRP A;  4VUB A;  3CXC A;  3NFC A;  1BIB A;  2RI3 A;  1NNH A;  2Y90 A;  4C8Q G;  4R55 A;  4M75 F;  2QHV A;  3L2Q A;  1QVF A;  2RJD A;  2DIG A;  2MF2 A;  3VQY A;  4ELY C;  3CPW A;  4P75 C;  3RKW A;  3NEL A;  2R57 A;  3SD4 A;  4JLI A;  2AHJ B;  1YBY A;  3LYI A;  1NYR A;  3L4G B;  3RUX A;  5GAM g;  1G5H A;  2HNI A;  4IUT A;  2KQW A;  3BY7 A;  4M75 E;  3V8J A;  3IKL A;  3HFZ A;  3HY1 A;  2JZ2 A;  2JUF A;  2E1H A;  4OGE A;  2F5K A;  2QQA A;  2Q7H A;  4KT0 E;  3A7A A;  4M75 D;  2LQ8 A;  4XU3 A;  4HWP A;  2LC4 A;  2I4N A;  1VQM T;  1Z7N A;  5LJ5 d;  3CC7 A;  1WPY A;  2A8E A;  3CCL T;  4ELZ C;  5CAI A;  4TVA B;  2R58 A;  4YRN A;  5I21 A;  1ATI A;  4YRI A;  4Q5W A;  2RI2 A;  5C6S A;  1FWZ A;  2YLB A;  1VQK A;  1AHJ B;  1VQK T;  4JRI A;  3JB9 G;  5GAN 2;  3PFS A;  3LC0 A;  2VYT A;  2E64 A;  2EQK A;  5CKF A;  5GAO n;  4P74 C;  3S3M A;  1VQ5 A;  4CS3 A;  1X6O A;  5GMK l;  3VJP A;  2I4O A;  3HFZ B;  2XDD A;  3VQX A;  1B70 B;  2ZPE B;  4C0D C;  1WJS A;  2E6Z A;  2RHZ A;  2RJF A;  3CMA T;  2CJA A;  1M90 U;  1X2G A;  2DIQ A;  1EIY B;  2FB7 A;  4YRF A;  1EVL A;  4XU0 A;  2RHQ A;  1BI0 A;  3QNE A;  4Y28 E;  4DOV A;  4A4G A;  3PT9 A;  4OB1 B;  1YJW A;  4E47 A;  3GNF B;  4M78 B;  4HT9 A;  4OVA A;  1E24 A;  4ATO A;  1QP3 A;  4CH3 A;  2K5L A;  2FYK A;  2E10 A;  3EFR A;  3VYH B;  2ZT5 A;  1O9S A;  4BB7 A;  4CH4 A;  1WU7 A;  3VQW A;  1N9S A;  4O5V A;  2V8J A;  4EO4 A;  1VQ4 A;  2L3R A;  3JCM P;  4KUI A;  3WXM B;  3GLX A;  3CCS A;  3CCS T;  1BI2 A;  3TCJ A;  2XIC A;  5FRM A;  4YRT A;  1ASZ A;  4ZGD B;  3SFM A;  3SWN C;  2K3Y A;  2X4W A;  3CCU T;  3LW5 E;  2LCC A;  3PIP A;  1X2H A;  4J5Y A;  4E7I A;  3MHX A;  3CCV T;  1XOV A;  4G85 A;  5J26 A;  2F5T X;  2XKO C;  3S6W A;  2XID A;  4M7A B;  3HP9 A;  1KQS A;  2QI2 A;  1Q81 U;  3QKJ A;  4F7U A;  5K1X A;  4IUP A;  1L0W A;  2CZ6 B;  4X34 A;  5I2M A;  3C95 A;  3QJ6 A;  4C8Q B;  4M78 E;  3G4S A;  3HY0 A;  3TU4 K;  1I8F A;  4LNS A;  4R56 A;  3LGF A;  3OYB A;  2ZZD A;  1VQL T;  1NPR A;  2AMC A;  5HKC A;  3E9F A;  1EQR A;  4M75 C;  3G6E A;  4P72 C;  2Q5H A;  3OSV A;  4CS2 A;  4A4E A;  1YB3 A;  2LVM A;  1KQ2 A;  3QO8 A;  1USY A;  2KAF A;  4EX5 A;  1Y7X A;  2DPP B;  4XTZ A;  4GLK A;  5D6Y A;  3P8D A;  4F7U B;  1UGP B;  3REU A;  3G71 T;  1PSE A;  1VUB A;  3PZC A;  1J5W A;  4ZGJ B;  1NJ8 A;  4M77 F;  4B9W A;  1D3B A;  3MEV A;  3V7C A;  3QHS A;  2RHI A;  3OYF A;  2DKG A;  4FSX A;  4KUD K;  3PIO A;  4J8O A;  1S72 A;  5DM7 R;  1NZ9 A;  1S72 T;  4L6V 5;  1VQN T;  5C0M A;  1Q7Y U;  2P0L A;  1OYX A;  3OD1 A;  2B8A A;  3C94 A;  1PYS A;  4M77 E;  4HVC A;  2K3X A;  1VQO A;  2P0P A;  4D6W A;  5GAO r;  4C0Z A;  2DVE A;  4PJO F;  1UGQ B;  4MML A;  4H2V A;  2QQR A;  5FU7 C;  4K86 A;  4M77 D;  4WJ4 A;  3HXZ A;  2JTF A;  1SES A;  2EJG A;  4P74 A;  1ZBX A;  3OYI A;  2LT1 A;  1TH7 A;  2KDS A;  1O75 A;  5HGQ A;  1Y71 A;  2PVO B;  3P8B B;  1D3B B;  3LWI A;  4LVK A;  4UP8 A;  1QW1 A;  2LT4 A;  3PTA A;  4XAX B;  1QVG S;  2K5F A;  5GAN h;  3V8K A;  2WAC A;  5GAN 7;  1VQ9 A;  4PJO D;  5ELO A;  2QXF A;  4JRK A;  2K57 A;  3M53 A;  1JJC B;  2LQK A;  4MZT A;  3MF2 A;  1W66 A;  1B76 A;  2X4J A;  3OS2 A;  1B34 A;  3L42 A;  2QEX A;  3VUB A;  2QEX T;  4M7D E;  4J15 A;  2LTO A;  1IRE B;  3OQ5 A;  5LJ3 d;  1ADJ A;  4A4K A;  2DXU A;  1E1T A;  3QO3 A;  3NTK A;  4TTV A;  4M7D D;  3UFG A;  3J81 E;  4HCB A;  2CJ9 A;  4IUR A;  5L8R E;  3L2U A;  3MP1 A;  3I56 A;  3W3S A;  3I56 T;  3TEG A;  3SWN A;  4XU2 A;  1K8A U;  4M78 C;  1I81 A;  1V29 B;  5LJ5 f;  4YYE A;  2XTI A;  1YJN A;  1YJN T;  4CH6 A;  1QVP A;  4KBM B;  1YFT A;  3A8M B;  4TVW A;  4UP9 A;  4IUQ A;  1WQW A;  1X55 A;  4LVM A;  1W2B S;  5KCO A;  3X20 B;  1M9S A;  4MZP A;  2DQ3 A;  5GAN 3;  3HRI A;  3M4G A;  3O8V A;  1VQ8 T;  2QQS A;  4MZM A;  3DLL A;  4PKC C;  3JCM h;  3IG2 A;  2RHU A;  3INZ A;  2ARS A;  2JNG A;  4QQD A;  1VQ7 T;  4M75 A;  1SSF A;  4P72 A;  2RO0 A;  3RMQ A;  2DDZ A;  2VGM A;  3L2V A;  5A0G A;  2V8K A;  4RG8 A;  2ZCF B;  2X35 A;  3GPL A;  5CKH A;  2J3L A;  1Q82 U;  4JS5 A;  4RCB A;  4JDS A;  1YJ9 A;  3GIB A;  4YRK A;  4M77 C;  5GAM h;  4P3O A;  2G3R A;  3UH0 A;  1NJI U;  2P5I A;  1YHQ T;  4ZTJ A;  1HC7 A;  2ZR2 A;  3S3O A;  3OMG A;  1FXX A;  4QVD A;  3I55 A;  3OA6 A;  2M16 A;  2OAU A;  3ZBD A;  4LVJ A;  2XK0 A;  3OS5 A;  3VBB A;  1HXD A;  4OGC A;  2D6F A;  1EVK A;  4HKE A;  1SET A;  3A7R A;  3CME A;  4RCC A;  3HSB A;  3JCM J;  4K87 A;  5LJ3 h;  5HK0 A;  4FL6 A;  2PMF A;  3A5Y A;  4C92 F;  2JTM A;  3CMQ A;  3I7F A;  2PU9 B;  5DY9 A;  4H2T A;  3RES A;  5GMK i;  4YRL A;  5FU6 C;  1JB0 E;  3GF5 A;  5KE3 A;  5CKE A;  2ZT6 A;  3A8H B;  1M1K C;  2ZNJ A;  4LDX A;  3DB3 A;  3E9G A;  4EPC A;  1JJ2 A;  4M7D C;  4C92 E;  4TWA A;  4H02 A;  4C0G A;  2ZPB B;  3ZEH A;  2ZTG A;  1BBU A;  3HXY A;  3HXX A;  5IAY A;  1FX7 A;  4EMK B;  1YCY A;  1C0A A;  1M1K U;  4NL2 A;  5I2S A;  4C92 D;  4JUV A;  2EQM A;  3BDL A;  2DXT A;  3DLM A;  2DU7 A;  3CD6 A;  4QQG A;  3CD6 T;  4E51 A;  4FT2 A;  5GAN 4;  5LJ5 j;  3E9I A;  2E5Q A;  2CZ7 B;  2QHT A;  4F7U G;  2VXE A;  3FLG A;  3CC7 T;  4V2S A;  1E22 A;  4OB3 B;  2E70 A;  2MI6 A;  2DD5 A;  1XTD A;  4XQ3 A;  2ODR D;  3ME9 A;  3ER0 A;  1EOV A;  1PSF A;  3C4S A;  5C53 B;  2RA2 A;  3ZFJ A;  2LRQ A;  1IZ6 A;  3X28 B;  1UB4 A;  3M59 A;  1VQ5 T;  4FT4 A;  4DA4 A;  3MEY A;  4EDU A;  3CC2 A;  4BY6 C;  3CC2 T;  3QXE B;  3OYN A;  5D6X A;  1ZHI A;  4YRQ A;  1I4K 1;  4YRS A;  3X24 B;  3CC4 A;  3CC4 T;  4BE1 A;  5C51 B;  4X9D A;  2XDB A;  4IKF A;  1OZ2 A;  1M1G A;  2IG0 A;  1BYM A;  2XI9 A;  2GCX A;  5HY6 A;  4BE0 A;  3L1A A;  3KXT A;  1YJW T;  4WI1 A;  4GY5 A;  3V7R A;  4XTV A;  4H2S A;  1WGS A;  3JRZ A;  5GMK j;  3M56 A;  4HT8 A;  2AKW A;  4A4F A;  1VQ4 T;  2XD0 A;  4NL3 A;  1G5V A;  4RG2 A;  2FHD A;  1OI1 A;  2DXC A;  5J3B A;  1KD1 C;  5AYF A;  4TQD A;  5GAN d;  4M77 A;  5LJ3 f;  3WVD B;  2MMP A;  4C5E A;  4N0A A;  2P0K A;  1QP2 A;  4BAC A;  2OTL A;  2E12 A;  4KQE A;  4MDW A;  3WQZ A;  2RHQ B;  5ELN A;  2Q7G A;  4M78 F;  2NS6 A;  4FM4 B;  5FLX E;  2O01 E;  4RMO A;  1EFW A;  1KD1 U;  3F70 A;  3M4P A;  2IY5 A;  3CBO A;  4B9X A;  2RH2 A;  1I5L A;  4TVY A;  3L2Z A;  5GAO m;  2A7Y A;  4KUL A;  3QBY A;  3G4S T;  4HCC A;  4PJO A;  4YCV A;  4YRO A;  4JJN K;  1R8O B;  4TVR A;  1B7Y A;  2CIM A;  5HK3 A;  4C92 C;  1RL2 A;  3UGT A;  3NET A;  2QQ9 A;  3HFO A;  3JAM E;  3MF1 A;  4M78 D;  3MEU A;  3JSC A;  5FRO A;  2DU5 A;  3G6E T;  1K73 C;  2Q5I A;  2X4X A;  4ZTZ B;  1B8A A;  2DK3 A;  2ZIO A;  2A3L A;  4LD6 A;  1QE0 A;  3PCO A;  4QQ6 A;  3HXV A;  4M7D A;  4P75 A;  1MHN A;  3WVE B;  2ODR C;  4BI8 B;  4P3N A;  4RQE A;  3RKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...