4XU0A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 73 that has a 2'-methyl on the ribose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
b'TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 96
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu0A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu0A01
3RIRA 1W66A 4YYEA 1HK9A 3RESA 3QO5A 3A5YA 5C52B 4AH6A 1HXDA 4C8QC 5LJ3f 4NL3A 5GAMd 4M75F 1G5HA 4ZTZB 1YFSA 5GMKe 2XGTA 1G5IA 4P71C 4C8QE 4CS2A 2DVEA 4XTWA 4L87A 1JJCB 1ATIA 2JN0A 5GAOm 1B70A 4K88A 1YB3A 3FJPA 2ZIOA 3EFSA 3E9IA 4C92D 5GAMg 4QVCA 1EVLA 2I4MA 4C8QB 4X5OA 4TVYA 4YRNA 2C7IA 4YRJA 3A31A 4XEMA 2RD1A 3M4QA 1JJCA 3BFMA 2ZT8A 3RL6A 4XTUA 4CH3A 4M77G 3JCMe 4M75B 3JCMW 2J3LA 2ZT5A 3JCMJ 4N0AA 4A54A 5GAMf 4C8QA 3JCMP 1EOVA 1GGMA 2ZIMA 4H2SA 4M77C 3BY7A 3P8TA 1N9SA 4XTYA 3I7FA 2DU7A 2VXFA 1HC7A 4M7AD 1N9WA 4OP0A 4YRSA 1EVKA 3RUXA 4M77E 1B76A 2E5AA 2ZTGA 1KQ2A 4YRTA 4M78F 4M75A 3JB9D 3QTCA 4HWRA 4P74A 2AMCB 1LOJA 3JCMc 4J5YA 5LJ5j 5GAOn 4RQFA 2IY5B 4PJOG 3JCMh 4EMHA 2DTIA 3V8KA 2VC8A 3TUPA 3JCMX 5GANe 4PJOC 4X9DA 1FYFA 4CH6A 4YRKA 3A7AA 2AMCA 2DXUA 4XTXA 12ASA 3EFRA 3UGQA 4PJOE 1B34B 2EJGA 4YRQA 5ELNA 2IY5A 2CJBA 3L1AA 4MMLA 4M7DD 3MF1A 2ODRC 4M78B 2Q7EA 2QHTA 4EO4A 4H2XB 2ALYB 4YRIA 4A53A 1NJ6A 2DZCA 3IKLA 4H2VA 4HWTA 3G1ZA 1PYSB 4F7UF 4NOYA 4CH5A 1B34A 4WJ4A 3HXWA 1SETA 3JCMb 1TH7A 3SWNB 2ZR2A 4M78A 3VU3C 5K1XA 1NJ5A 2DTOA 1SRYA 4O2DA 3PGGA 3A7RA 4H2XA 11ASA 2ALYA 3DSQA 4UP8A 2E65A 2ZCEA 5K1PA 1KQ1A 1ADJA 3M4GA 2ZZFA 3OD1A 3PZCA 2DQ0A 1PYSA 5LJ5d 1ADYA 3HTZA 2DTHA 2EWNA 3SWNA 4P3OA 3IG2A 4N0AC 4RDXA 4WJ3M 4C92F 5LJ5g 2RB6A 5GAMh 5GMKj 4HWOA 4M75G 1WNLA 2E10A 2K57A 4WF2A 2DZ9A 4X9CA 1B7YB 2ZZEA 1EIYB 1BBUA 4PNOA 4XQ3A 4G84A 1Z7MA 1WU7A 2PMEA 1C0AA 3QO8A 4HT8A 2Q7GA 1JRIA 4M75C 2EAYA 4XEOA 2E3CA 4P74C 4DPGA 3V8JA 2ZXFA 2HNIA 3JB9H 4DQ2A 1H4VB 4M75E 1BIBA 3RERA 3IKMB 4JRIA 4C8QD 2ARSA 5LJ5f 1B7YA 1WQWA 3REUA 1E1OA 3HRKA 1EIYA 3ERRA 4YRLA 4C92B 2DDZA 1I81A 2YLBA 1X55A 4RQEA 4M7AF 4BWAA 2C8MA 3M4PA 3JB9F 1I4K1 2RHQB 4YCUA 3HY1A 4LNSA 1NYRA 1MGQA 2QHVA 1I5LA 4C92A 2FYKA 2Q5IA 2CIMA 4MMKA 3A7UA 5GAN6 3HSBA 4M78G 3L2ZA 2ZT6A 4J6WA 2ZNIA 1U1SA 3RGLA 3IALA 4TQFA 4NL2A 4EMKB 1H4QA 4HA8A 5LJ3e 4YROA 4K86A 4M7AB 2RHQA 4M78C 1H4TA 5F5WA 1LJOA 4HWSA 4H02A 3QO7A 4M77D 2DEQA 5GANj 4M7DF 1BIAA 3INZA 2I4LA 4UPAA 4M78E 4YP0A 4G85A 2E64A 1I8FA 4H2WA 2EJ9A 3FB9A 2RHSB 1NNHA 4EMKA 4YRFA 3TEHB 3QHSA 1WLEA 1KMMA 3QSUA 1LNXA 3SWNC 1X2HA 4M7AA 3JCMV 1YGBA 2E1HA 4RMFA 2RM4A 3JCMd 3MF2A 2DU5A 2XTIA 3QNEA 5LJ3h 4XU0A 2RHSA 4PJOD 2ZINA 3JCMg 3UH0A 4F7UG 5GAMe 4M7DB 1NJ2A 3TEHA 1SERA 4EX5A 4CH4A 2QHSA 1D3BB 1LYLA 3VQWA 2EJFA 5GAN7 2AKWB 2ODRD 3BJUA 3FIFA 3V7RA 3ICAA 1U1TA 3HFOA 5CAIA 1X56A 4P75A 3VQXA 2I2LA 4JUVA 2YLCA 1WQ7A 3RACA 3R07A 1KOGA 4F7UE 1RIQA 1ASYA 4M7DA 3VQYA 4P72A 4XU2A 4UP7A 1D3BA 3JCMf 2DXTA 3NELA 3RKYA 3NENA 1X01A 4XTZA 5GANd 3UFGA 1H4SA 2AKWA 4C92G 4F7UB 1WYDA 3HRIA 2CGHA 1USYA 2ZT7A 3KFUA 3REXA 1YCYA 5GANg 1M8VA 1EFWA 5C51B 2I4OA 4C92C 4C8QF 2DKGA 4J15A 1B70B 1VQZA 4Y91A 2Q7HA 3JB9J 1WPYA 5GAN3 5DY9A 4C92E 4TVWA 1EQRA 3A74A 4NCXA 4F7UA 5GAN5 3SB2A 1NJ8A 2P5IA 4XTVA 4ZIBA 2G4CA 1Y96B 3V8LA 2PMFA 2J3MA 4YRPA 4E51A 1E22A 2CJAA 3VQVA 1SESA 2I4NA 3W3SA 4P3NA 5GANf 2E41A 4M7AG 4K87A 3LC0A 3CMQA 4EMKC 4M75D 4TWAA 4EMGA 4HT9A 3JB9G 4YRCA 3HXYA 4BW9A 3GIBA 3LSSA 4H2UA 1Y96A 4M7AC 5GAN2 1IL2A 2RA2A 4P3PA 4J6XA 3L4GB 3V7CA 5GAN8 3HFZB 4RCCA 2QTXA 3A5ZA 4YREA 4XU1A 4M7AE 3V7SA 1QF6A 1X2GA 3RKXA 4TVAB 4YDQA 4M77F 4V2SA 4HVCA 4PG3A 5LJ3j 2CJ9A 4YCVA 5GMKh 2EL9A 5GAOp 4YRGA 3A32A 3HXZA 1X54A 4WI1A 2QHUA 3L4GA 3HFZA 4P71A 4M7DG 5E3IA 2P0LA 4JRKA 1J5WA 3NEMA 3PCOB 4P75C 3BW1A 4RCBA 4TVAA 4TTVA 1HTTA 3HY0A 1NYQA 2ZZGA 3BDUA 5GAOq 3AHUA 1B8AA 4M7DC 4TQDA 4P72C 3QO3A 1Z7NA 5ELOA 4PJOF 1BBWA 4P73C 1YFRA 5GMKl 4M77B 5KNNA 5LJ5e 3HXVA 4M7DE 1YFTA 3WQZA 2Y90A 4M78D 3MEYA 4YRRA 3HFVA 1N9RA 3PCOA 4YCWA 3RF1A 5GAMj 1USYC 5GMKi 3QUIA 4JLIA 5I21A 2ZR3A 4Q15A 4KR2A 3LSQA 4KR3A 1E24A 3UGTA 4M77A 3NETA 4HWPA 4Q6GA 3TEGA 3P8YA 4J6YA 2ZGWA 1QE0A 5GMKm 1E1TA 4YRMA 1M5Q1 3E9HA 2DJZA 2ZNJA 4XU3A 3HXUA 4PJOB 5LJ3d 2ARUA 1H641 4OLFA 4H2TA 1ASZA 1G51A 5LJ5h 4CS4A 4H2YA 2DQ3A 3JCMQ 4ZTUB 4PHCA 3P8VA 2YHTA 3RKWA 4QVDA 4P73A 4UP9A 5GAOr 4KQEA 5C53B 5GANh 1NJ1A 5LJ3g 4YPFA 2Q5HA 3JB9I 2VXEA 4CS3A 4PJOA 1JBMA 1KMNA 5GAOl 1L0WA 3HXXA 2FB7A 3VBBA 3HFNA 5HGQA 5GAN4 2ARTA 4C8QG
chains in the Genus database with same CATH superfamily
4PJJA 1MMAA 3LGLA 2KQWA 2F2WA 1X6GA 2JXBA 3WVEB 2WSFE 1SRMA 3MQZA 3I9QA 3CPWS 5FWBA 1M2VB 2NUPB 1VQ6A 4P71C 4C8QE 4CS2A 2DVEA 3QWYA 4L87A 1ZSZC 3OYKA 2J7IA 2YUPA 1W2BA 1JJ2P 4UC4A 1M27C 4QVCA 3J81E 1QKWA 3HP9A 2DYBA 1M90U 4C8QB 5HK0A 1GRIA 2MK5A 1VQKT 2X51A 1M2VA 2NUPA 2QAZA 5IHIA 2CS7A 4XEMA 4OGEA 3WXMB 2J06A 1D09B 4CH3A 2CZ0B 1K8AC 2PUOB 1Y7XA 1W6XA 3JCMJ 1KIKA 1WHGA 3C95A 3SEMA 3ULRB 4LN2A 4ELZC 1X27A 3FDRA 4JJBA 4C8QA 3JCMP 3J7AF 3CC7A 3LH5A 4H2SA 3BY7A 3I7FA 3TSWA 2GTOA 3OYAA 4M7AD 2ZPFB 1N9WA 3OS5A 3M9QA 1MNDA 4M77E 2K3YA 2ZTGA 4YRTA 4M78F 3JB9D 2GBQA 3QTCA 4FYYB 3OYHA 4P74A 2CT3A 2NUZA 3QXEB 2KMTA 2AMCB 3JCMc 4FYXB 4J5YA 4C5IA 2L8DA 3L2RA 3TREA 2X4XA 2OTLA 4N4HA 2K3XA 2WSEE 5GANe 2ZPHB 1G8XA 4X9DA 4PJOC 1FYFA 3MEWA 2ENMA 2AMCA 2EIFA 3A8OB 3CC2A 1KQSA 1RAEB 3RMSA 4ZGJB 2LRQA 5ELNA 2GF7A 2CJBA 3L1AA 3MF1A 3M57A 1Y07A 4M78B 4ZN1A 1NZ9A 1Y0MA 1S72Q 2QHTA 4C0FA 1QVGS 2XKOC 5FRMA 4YRIA 1VYVA 1YJ9T 2LC4A 1NJ6A 4LDUA 2BIVA 2DZCA 3IKLA 4HWTA 4E7IA 1VQLQ 1R77A 4F7UF 4CH5A 2RQRA 3OMGA 2E12A 2GFAA 3JCMb 4M78A 2COWA 4P5NA 1GFDA 3A7RA 2DBMA 1RL2A 3OSSC 2QA4Q 2HL3A 2MYSA 1ADJA 3M4GA 1U8RA 3OD1A 3VS0A 4A63B 3PZCA 2DQ0A 3UA7A 4PFOA 4Y92A 5LJ5d 1F1BB 2DTHA 4PJLA 2EWNA 2RJDA 2RQUA 5AT1B 5D7UA 5GMKj 1WNLA 2E10A 2K57A 3EH1A 2BUDA 4JDSA 5CK9A 1OPKA 2ZZEA 2EBPA 2EYQA 5HCKA 5HKCA 1VQ4Q 3EG9B 1WU7A 1C0AA 3QO8A 2Q7GA 3ZBDA 4HCBA 1AWOA 2EAYA 4DPGA 1YI2T 2HNIA 3JB9H 5IXBA 3E2UA 2LQ8A 4LVLA 3IKMB 2ARSA 5LJ5f 2NUTB 4KH1B 3ERRA 4YRLA 1G3TA 3C4SA 3ME9A 2IG0A 3EG9A 2QK0A 4E6RA 2CZ6B 3GF5A 4BWAA 4CC3A 2C8MA 1VQOT 1YCSB 3QZ5B 2P0KA 4KULA 3MKDA 2D6FA 1OX8A 2MCNA 3L2QA 1PG5B 2QQAA 1SPKA 2NUTA 1YJNA 1YFNA 4E7JA 1TG0A 2RQTA 3A7UA 1GCQA 2M02A 5GAN6 4M78G 2G3RA 4J6WA 1U1SA 2QYZA 4MDXA 3RGLA 2DBKA 4BI3A 5LJ3e 4YROA 1AWXA 5L23A 2JTMA 1SKUB 1WJRA 1MV3A 2CYZB 3OA6A 1QMCA 1SSHA 1YJ9A 2HSPA 3CD6T 2CKKA 4LUDA 4YP0A 1I8FA 2EJ9A 1PSEA 3FB9A 4BB7A 4KUDK 2FVUA 1NNHA 2H3JA 3CCVT 3QHSA 1WLEA 2K7AA 4LNPA 3F70A 2LQNA 1ZA2B 1YGBA 2E1HA 3JCMd 3OYGA 1OU9A 3QNEA 1U5SA 2OX7A 2EGCA 5CO7A 3CCJQ 2ZINA 4RKUE 1RI0A 3A8HB 4F7UG 1NJ2A 4EX5A 3GP8A 3MCAB 1M1KR 2CUBA 2D8HA 3C12A 3EGDB 1IRXA 4DBFA 1HSQA 2KXDA 3VQXA 4P75A 4JUVA 4ZGEB 1WFWA 2PUKB 1SHGA 2YRVA 2BZ8A 3R07A 1MMGA 1RAHB 1WX6A 1PNJA 1CKBA 1YI2A 3JCMf 3RKYA 2PZ1A 4LUEA 1FMVA 5KCHA 3VV0A 3EGDA 2EYWA 3M56A 3PTAA 3HRIA 1LCKA 4FW2A 2CP3A 3HL8A 2EQUA 2ZT7A 4AG1C 1GBQA 1OOTA 2ECZA 1I1JA 4C92C 3OYLA 2DKGA 2I4OA 1MMDA 3OYFA 1VQOA 4Y91A 4QQDA 3UDCA 2X3XD 3JB9J 3QYHB 1WPYA 1FX7A 3MEUA 1QP2A 2KRMA 1IREB 2P4TA 4PJNA 2L3RA 1RAAB 1D1BA 1T3LA 8AT1B 2VASA 2Y4YA 3V8LA 4OMPA 5DLQE 5D6YA 3G71T 4YRPA 2V8JA 3R6OA 2CJAA 1EX4A 2DD5A 2V8KA 4L5GA 2LDMA 8ATCB 4K87A 1KD1R 3LC0A 3M0TA 1Q7YC 4TWAA 2QG9B 4EMGA 3OW2S 3QJYA 2YUOA 3GIBA 4BW9A 2A8EA 4RTYA 2SEMA 5GAN2 3CD6A 1IL2A 2H8HA 3JV3A 3GOXA 1T0HA 4RCCA 5KYUB 1E7OA 5FU6B 3V7SA 4M7AE 4BDYA 4TVAB 4YDQA 3REAB 1IGUA 1NPRA 2SRCA 5CKBA 3CCVA 2NLUA 1RAFB 1M1KU 2CJ9A 4ME7A 1N8RC 2X4JA 2RI5A 3A32A 3GNGA 4MZPA 3X28B 1J3TA 1AD5A 5KYUA 3KXTA 1J5WA 2OTJT 3BW1A 2XMFA 4TVAA 1DJ7B 2FG0A 2LNVA 3CCUT 2GCXA 2QQRA 3A8GB 2GNCA 1B8AA 3M0SA 4M7DC 3CCQQ 2E70A 3META 2RO0A 2DLPA 1BBWA 1YFRA 1NJIR 4HKEA 1RLQC 2A36A 4M78D 3MEYA 1D1CA 4ANJA 4YCWA 3RF1A 2RHYA 3EH2A 5GAMj 3QUIA 1RI9A 5I21A 2X9HA 4KR2A 4A4EA 4HT4A 3X25B 1YWPA 2E3HA 2MF2A 3OBWA 1BYMA 3UGTA 1O9SA 3NETA 3VYHB 4Q6GA 2IIMA 1MMNA 4Y28E 4RTXA 1QE0A 2AK5A 2LJ3A 1NBEB 2ZNJA 3H0FA 4OMNA 4OLFA 1JJ2S 1KD1U 1KFZA 4BDZA 3JCMQ 4EIKA 1M9SA 4PHCA 2HDAA 2DERA 4QVDA 4UP9A 1AWJA 1K73R 4YPFA 2C06A 3G71A 4J9GA 1KMNA 5GAOl 1W4SA 4LVKA 3HFNA 3P8DA 1VQKQ 4BUGA 2IVWA 4PJMA 2ROTA 1Q82R 1HK9A 1SEMA 3RESA 1HXDA 2K9GA 4C8QC 3NTIA 4M75F 2DL7A 2EYYA 2JMAA 2JZ2A 2K2MA 3SHWA 3G7ZA 5GMKe 2AT1B 1Q81C 1ATIA 2JN0A 2R5MA 2KROA 4J83A 1B70A 3FJPA 2R57A 5GAMg 4CI0C 4ATOA 1EVLA 4IKFA 2QDYB 3I56T 1NJIU 2XG8D 2I4MA 3UT1A 1VQ7T 2E5KA 1QVFP 3THKA 4TVYA 1IGQA 1MHNA 1PD1A 2OTJA 3A31A 2RD1A 1E6HA 3CCUA 3RL6A 1Q86R 5A0DA 4M75B 2ZT5A 3H8ZA 4QQ6A 3MP6A 4N0AA 1K76A 4LD6A 3CMAQ 1AT1B 4WTOB 4M77C 5CKDA 2YUNA 4PLLA 1VQMQ 2JM8A 1LVKA 4OP0A 4YRSA 1EVKA 3RUXA 1CSKA 1B76A 2E5AA 2BZXA 1KQ2A 1GFCA 4M75A 1K1ZA 2QXFA 5J3BA 1VUBA 1K73U 2F69A 3CXCP 2IY5B 6AT1B 1ABQA 4LDWA 1TTHB 3VS2A 4EMHA 3OYNA 2VB6A 2DD4A 2D8JA 2ZAEA 3HRTA 3M0UA 1N5ZA 3JCMX 1ZA1B 2KRNA 1O75A 1SHFA 2L3PA 1W2BP 3JSCA 2YSQA 4LDXA 3G1JA 1Q82U 4M4ZA 4YRQA 2IY5A 1UHFA 2WSCE 1PCXA 3AT1B 2ODRC 2RJFA 4CC4B 5IHNA 3I55Q 1VQPQ 2ZCFB 3E9GA 1B7TA 2OTLT 1UFFA 3E1SA 4N4GA 4KRTA 2C0OA 1K73C 2P0PA 3G1ZA 3TSZA 3VS3A 2VVKA 1D1AA 4DOWA 1PYSB 4NOYA 4YTLA 4HVVA 3CC2T 4WJ4A 4PLIA 3VU3C 3QG1A 3UWNA 2DTOA 4KGZB 2FPDA 4K11A 3PGGA 1KK7A 11ASA 1R0CB 3DSQA 1NYGA 2ZCEA 4FIBA 1Q86U 2FO0A 5LL6S 2ZZFA 1Q82C 2VWFA 1PYSA 2AHJB 1ADYA 3OYBA 3HTZA 2FPFA 3I56A 2JOYA 1VQ7A 1QCFA 4RMOA 3QDFA 4WJ3M 2F2XA 3KUFA 3M58A 2RB6A 3EHQA 3CXCA 4GY5A 1RACB 2GFUA 2JM9A 4M75G 4HWOA 2DZ9A 1KQSP 3VS6A 4F17A 3H9NA 4XQ3A 4JJNK 1Z7MA 1GCQC 4HT8A 5HK3A 3S3NA 1VQ5Q 2CDTA 4HVWA 1M8MA 4RUGA 1WLPB 1H3HA 1H4VB 1BIBA 1MUZA 1RLPC 2LCCA 3VS4A 2M1HA 2PVDB 4Z89A 1VQ9Q 3RERA 4JRIA 2KGTA 2KVQG 2FPEA 3HRKA 3MO8A 5GJWB 1I81A 3DB3A 2YLBA 3HRSA 1NEGA 7AT1B 1I4K1 3IQLA 3CCMA 2ESWA 2GGRA 3H0IA 4YCUA 3HY1A 4J7FA 4DBHA 2YWWA 2QHVA 1I5LA 3CBOA 3HSBA 2L3QA 2L0AA 4AFZC 2ZT6A 1M90C 2ZNIA 3E9FA 1VQ8Q 2V1RA 1WJQA 1QVPA 4RTTA 1YIJT 4K86A 4JZ4A 2DNUA 4DA4A 2PVGB 2O31A 1W70A 4QQGA 4AT1B 2O01E 4H02A 1H3ZA 1D0YA 2GQVA 2QEXA 5DM7R 1MNEA 1H92A 2I4LA 1YJNT 4M78E 4G85A 1ACMB 3OYJA 3OB9A 2ABLA 4YRFA 3TEHB 1UUEA 3PVQA 3SWNC 2PNIA 2RM4A 4KUIA 2FRWA 1BCOA 3CCLT 4FT4A 1ARKA 1PD0A 3LGFA 1AZEA 3PVLA 3UH0A 5GAMe 3TEHA 1SERA 2MWPA 5A0LA 3L2WA 1I0CA 2C0IA 4CH4A 2QHSA 2OI3A 1VIEA 4KBMB 2HAXA 2FZKB 3VQWA 5GAN7 3BJUA 3HHTB 2D1XA 1QCOA 4QT7A 3ICAA 1U1TA 4HCCA 3EG3A 1X56A 2I2LA 4IIOA 3SFMA 2BTTA 4F7UE 1BU1A 2DIGA 1IO6A 3VQYA 3CMET 4P72A 2V26A 3NELA 4IURA 3G6EQ 3NENA 5GANd 4F14A 3CCEA 2KXCA 4F7UB 5CIUA 3REBB 1BI1A 4J9CA 2KYMA 1X75C 2COZA 4ZTFA 3CEYA 2O9VA 4HVUA 2HBPA 2EVRA 1FMWA 3EGUA 5FU7B 5C51B 3EG2A 3L2VA 3M54A 5IAYA 2JS0A 2XD0A 2DL4A 3VKIA 3A74A 1Q95G 4F7UA 1M30A 1A0NB 3SB2A 3HTRA 4XTVA 3QYGB 1Y96B 2PMFA 2QTVA 1JEGA 1UEBA 1E22A 1TOVA 1G83A 1WJSA 1SESA 3W3SA 5CCAA 5FU6C 5GANf 1UGPB 2DRMA 1WXTA 2MMPA 1YIJA 1YITQ 1VYTA 4M75D 4EMKC 3C0CA 5FRNA 1WHMA 2R5AA 3LSSA 1Y96A 4M7AC 3GNFB 2RA2A 4P3PA 4J6XA 2BE7D 3L42A 2QTXA 4YREA 2EQJA 1QF6A 1X2GA 1ZUUA 3RKXA 2MPXC 3MEVA 4AFUC 1YJWQ 5FW9A 1OEBA 4PG3A 4CC7A 3CCRA 3CBMA 4AG2C 1M2OA 4YCVA 2CREA 1AZGB 1VA7A 2KK4A 5GAOp 4RTVA 1JU5C 3CCLA 3D7SB 4P71A 3NEMA 3ZFJA 2RN8A 2ZPEB 3VYGA 2KI7A 3HY0A 2LX9A 1NYQA 2ZZGA 1M4ZA 1NE8A 2Z0WA 5GAOq 2XI9A 4PKCC 1UGQB 3VJPA 4PJOF 2XIDA 1QQJA 1UE9A 3NFCA 2RI2A 1BI3A 1E6GA 3H41A 3FRNA 4C0DB 1YFTA 4FYVB 1X2KA 2MAMA 3CC4Q 3G4SQ 3CCSA 1YHQQ 2JNGA 3CMEA 1USYC 4LE9A 4JLIA 2BKDN 2ZR3A 4ORZA 3OYYA 4FYWB 4KR3A 1E24A 4HWPA 2L89A 5L8RE 1B3QA 5GMKm 3VRZA 4YRMA 2DL8A 3U23A 4XU3A 4PJOB 3SDZA 5LJ3d 2ARUA 1ASZA 5HY6A 5LJ5h 4H2YA 4CS4A 4ZTUB 2ATCB 1QKXA 2XDPA 2YHTA 2Y4XA 4P73A 2DO3A 1QVFS 4KQEA 5C53B 2X4WA 2O2OA 5GANh 1NJ1A 1SRLA 1KJWA 3EG1A 1WXUA 2BZYA 4J9FA 1OV3A 2Q5HA 1WI7A 2VXEA 2EYXA 4CS3A 4PJOA 3DKMA 1N6AA 5GAN4 2C0TA 3M0RA 1S72T 3CPWA 1VQ6Q 9ATCB 2A08A 4J7IA 5C52B 3MJXA 4AH6A 3QIIA 5LJ3f 4JS4A 1RAGB 4NL3A 1I5OB 1TU0B 1G5HA 1UGSB 4F16A 4ZTZB 1VQLT 1ABOA 1G5IA 3M5AA 4XTWA 1JJCB 3UATA 2CSQA 2ZIOA 3CXCS 3EFSA 4DEXA 3S3MA 1YN8A 2V8IA 3NGPA 3A8LB 4OB2B 2QA4T 4X5OA 2HCKA 4JPBW 2AKKA 3OYIA 1EIFA 4YRNA 2C7IA 1W2BS 3X20B 2JW4A 2LQWA 3CC7Q 2EFIA 1JJCA 3BFMA 2LVMA 1VQ5A 3OYEA 2ZT8A 1IHWA 4XTUA 1X6OA 1ZUYA 2QQSA 2QGFB 5M9OA 4N4IA 1X43A 2RHIA 4A54A 3OS0A 4RTWA 5EG2A 2KAFA 2KY9A 5CVIA 2K79A 3Q1JA 2KR3A 1EOVA 3M55A 2VGMA 3P8TA 1N9SA 1WHHA 2LTOA 3NTKA 1JQQA 4XTYA 2DU7A 2VXFA 2RQVA 3N5BB 4FU6A 3S3OA 1HC7A 2RHXA 3TCJA 1CKAA 3M59A 2ZPGB 2CP6A 2HKQB 1NPPA 2E6NA 1VQNQ 2RJCA 2EYZA 3OYMA 1YP5A 1SF9A 2EGEA 1FYNA 3H6ZA 4LXCA 5LJ5j 4HCZA 4E7LA 4PJOG 1RADB 3JCMh 2DTIA 2ZPIB 4AFQC 4VUBA 5CKEA 1R0BG 2J05A 2PTKA 2VC8A 3TUPA 1KC8R 1BB9A 1BI0A 3RNJA 1IZ6A 2W10A 1M1KC 2R58A 3ER0A 2YT6A 1QVGA 4J9DA 4A4KA 3TVTA 3CBPA 4XTXA 12ASA 1ZQ1A 3EFRA 3UGQA 4LVIA 2EJGA 4A4GA 3MP8A 4PFZA 2Q7EA 1OULA 1TUGB 1NLPC 3EHRA 1KQSS 4A4FA 2ALYB 1M1GA 2KEAA 4A53A 1YBYA 1WIEA 3LH0A 2XDDA 1TSFA 1S72A 3HXWA 3A1PA 5KCOA 1TH7A 2ZR2A 2LX7A 5K1XA 4CC2A 1OQKA 3DLMA 4Z88A 4C0GA 2LMJA 2ALYA 2RK2A 2DJQA 5KYXB 4R0KA 2F2VA 4OF1A 1VQLA 1QCNA 4UP8A 2CT4A 4O6JA 1RUWA 5K1PA 1KQ1A 2HKNA 2W0ZA 5I2SA 5A2QE 2ROLA 2P84A 2COYA 1PSFA 4P3OA 2QA4A 2FEIA 3IG2A 1PKTA 4RDXA 4C92F 1WHJA 5LJ5g 5KYXA 2RH2A 2HSEB 2P4RA 3CCJT 1K9AA 1KD1C 4WF2A 1P92A 2XDBA 3G6EA 1BBUA 2XHCA 4E7KA 3OYCA 2PMEA 2FZGB 4DBQA 1B07A 4P74C 4J8OA 1PC0A 1U06A 3V8JA 5KYWB 4DQ2A 4M75E 2DRKA 1VQ4A 4F04B 1KC8U 2MI6A 1WQWA 1UJ0A 4C92B 2DDZA 1H8KA 1X55A 3MP1A 3UF4A 2DYIA 3MEAA 2OJ2A 1QWFA 3P8HA 1K4US 3M4PA 5KYNA 5KYWA 4E2FB 4AFSC 4J9BA 2RF0A 2MOXA 4LNSA 1NYRA 4C92A 2FYKA 2D0NA 2CIMA 1UECA 3VUBA 3PT9A 1BK2A 1YJ9Q 1G3WA 3KFVA 3L2ZA 2LQKA 1NJIC 4J9HA 3IALA 1HYOA 4NL2A 1H4QA 5C0MA 2VYTA 4FL6A 3NTHA 3NMZC 4JS5A 2KYBA 1K8AR 3QWXX 4M78C 3CCMT 1LJOA 4HWSA 1SG5A 2NYSA 3O8VA 1G3YA 4EDUA 4M7DF 3INZA 3OS2A 3PIPA 2E64A 1S1NA 3DLLA 4H2WA 2FZCB 1N27A 2RHSB 2QDLA 1M1FA 2L2PA 3HKSA 4LDVA 3A8MB 1KMMA 1WA7A 3QSUA 1LNXA 1K0SA 3WVDB 1WYXA 3MF2A 2OAWA 4BY6B 1GXIE 1Y71A 2HZYA 2QEXT 2RHSA 4PJOD 2D9TA 3JCMg 4ESRA 4M7DB 1IB8A 3LW5E 2DL3A 4IUUA 1D3BB 2LP5A 3QPHA 4ELYC 1LYLA 2M0OA 2E3IA 2LJ0A 3CCJA 1KHCA 3OSVA 2AKWB 1EZZB 4IUTA 4ZNXA 3V7RA 1NLOC 1NYFA 1YI2Q 3HFOA 5CAIA 1KOGA 3CCQT 2LT4A 4M7DA 4UP7A 1D3BA 3M0QA 4L59A 3GLXA 1X01A 2L5QA 4E47A 4E7ZA 3UFGA 2AKWA 5FLXE 4C92G 1VQOQ 2K5IA 4FSXA 1WHKA 3BDLA 1YCYA 3FC3A 3M53A 1NEBA 4C8QF 4IUPA 4II1A 2CH4A 2EGAA 1VQZA 2Q7HA 2JJ9A 1ZX6A 2HMAA 3RBBB 1HJDA 1M3AA 3PMIA 4OMQA 1K8AU 1RABB 1EQRA 2CP7A 4TVWA 4HXJA 2P5IA 1Q86C 3CCET 2G4CA 2G6FX 4RTUA 2J3MA 4E51A 3VQVA 2I4NA 3A5ZB 3OW2A 3CPFA 3MHXA 3CD6Q 1EFNA 2CP2A 2EW3A 2E41A 1PRMC 1WGSA 1V1CA 4KH0B 4GLKA 3CMQA 1FXXA 1VOMA 5IN1A 2F5TX 3HXYA 3CCVQ 5CKFA 4H2UA 1PKSA 2RI3A 2EQIA 2VV5A 3V7CA 1C1AA 3A5ZA 2VGNA 1FMKA 1UJYA 1ZBXA 4OB1B 4M77F 2RMOA 4V2SA 3JRZA 2M16A 4GBQA 3S6WA 4CRIA 5GMKh 2DILA 2EL9A 4YRGA 5CQXA 3JAME 4NS5A 1X54A 2CH4W 3J80E 2QHUA 4C0DC 2ED1A 4M7DG 5E3IA 2P0LA 2JTFA 3PCOB 2HQHA 4P75C 1QLYA 2A28A 1Z9QA 4MZTA 3CCRT 1Z7NA 1R8OB 5ELOA 4P73C 4M77B 4DBRA 5LJ5e 1C0MA 2HD0A 1VQNA 3HXVA 3WQZA 1Z9ZA 4E7SA 3PCOA 3CCQA 1M3CA 4R56A 1TXQA 5GMKi 5ECAA 3CMAT 2CZ7B 4Q15A 1UB4A 3I5SA 3BE3A 3LSQA 2DF6A 1QP3A 2QI2A 2DMOA 1VQMT 4M77A 3PIOA 3EFOB 1JJ2A 1T0JA 2J6KA 5IXFA 3TEGA 3P8YA 3OYDA 2ZGWA 4B9XA 3URGA 2DJZA 1D0XA 3HXUA 3LX7A 2LNHB 3CCST 3CQTA 3VRYA 3G71Q 2DQ3A 5J26A 4E7HA 3EFOA 2K2VA 3EG0A 3DB4A 5IT9E 1BKBA 3JB9I 2KSSA 2DK3A 4KT0E 1JBMA 5FWCA 3ZEHA 1L0WA 3HXXA 2F5KA 1TUDA 3VBBA 3NHNA 5HGQA 2ARTA 1RAIB 2V1QA 4C8QG 4OMFB 5EC7A 2K6DA 4JJCA 3I55T 1VQPT 3RIRA 1XOVA 2HQXA 4BE2A 1W66A 4YYEA 4OMMA 2DAQA 1XNIA 1JO8A 3QO5A 3A5YA 5DLOA 1VQKA 3FJ5A 5GAMd 3QJ6A 1ZSGA 1YFSA 2EKHA 2XGTA 2LT1A 1GL5A 2LCLA 5GAOm 4K88A 2YUQA 1G5VA 4X34A 1YB3A 3E9IA 4C92D 2OTJQ 2HBWA 1PHTA 3CCUQ 4D6WA 1OU8A 4JZ3A 3H0HA 3P8BB 5CKHA 2HEQA 2LJ1A 3ASKA 2DPPB 3PMTA 4YRJA 1G2BA 2J6FA 1BI2A 3M4QA 1WHLA 1ZSZB 1D0ZA 4M77G 3JCMe 5IHKA 1WXBA 3JCMW 2J3LA 4ZGDB 2VKNA 5A0GA 4O5VA 2CP0A 3GBQA 5GAMf 3OY9A 1VIFA 1GGMA 2ZIMA 2DVJA 4QVZA 2JVVA 2M0YA 1ZLMA 2E5QA 1Q7YR 2X3WD 4IIMA 2JMCA 1ZSZA 5I22A 5J39A 3CMAA 3CPWP 1UGVA 3RDVA 3MPUB 4FCYA 1VQ5T 4QKUA 4HWRA 1LOJA 2DM1A 1VQMA 1AWWA 2X35A 1VQ9T 5GAOn 2EKOA 2H3EB 4RQFA 4DOVA 2PU9B 3V8KA 1XJWB 1NG2A 2CZ1B 2DA9A 1N8RR 4BD3A 4CH6A 1Y57A 4YRKA 3A7AA 5IH2A 1IHVA 2DXUA 4DEYA 1GBRA 2MWOA 1AHJB 1B34B 3OMCA 4PJOE 4MMLA 4M7DD 2A0FB 2ZPBB 2E4HA 1PRLC 2JS2A 3FLGA 3QZ9B 2IPOB 4EO4A 2DFUA 2L3SA 4H2XB 4IUVA 2RHUA 1VQ8T 2RK1A 1OPLA 4C0ZA 4H2VA 2QASA 2DL5A 3I5RA 4B6MA 3I55A 1T3SA 1VQPA 1B34A 1XQHA 1ZHIA 1SETA 3SWNB 1JXOA 3HPWA 1NJ5A 4D8DA 1SRYA 3VS5A 5KE2A 4FW1A 4O2DA 4H2XA 2VUBA 3I56Q 1PM3A 2QQBA 1VQ7Q 5KYYB 2E65A 1K9MR 2HL5C 4A4HA 4LVJA 4OB3B 2O9SA 1UHCA 5I2MA 3SWNA 2F1LA 1X69A 3QBYA 5C6SA 4FM4B 3O5ZA 4N0AC 2NS6A 2CUDA 4MZMA 1Q7YU 5GAMh 2A7YA 5KYYA 1NM7A 2RHZA 1QVGP 2A37A 2DXBA 4X9CA 1B7YB 1EIYB 2A3LA 4JRPA 4PNOA 3L2UA 3EGXB 4G84A 2RPNA 1XTDA 1JRIA 4M75C 3X24B 4XEOA 2E3CA 2K3BA 1KSWA 2AZVA 2ZXFA 1TS9A 4XAXB 2J6OA 4BI8B 1N8RU 4PL6A 1KG1A 2JTEA 4Z8AA 4C8QD 2EPDA 1U3OA 2KNBB 2KT8A 4RTZA 1B7YA 4RG2A 1E1OA 3TQ7P 3CCMQ 3REUA 1EIYA 3EGXA 4RQEA 1X2QA 3G6ET 2P0QA 4M7AF 2HQEA 1HD3A 1VQ9A 2FHDA 4FSSA 1C6VX 2KRSA 1Q81R 3JB9F 2M9UA 3SD4A 2RHQB 1AVZC 1VQ4T 1W1FA 2MIOA 1MGQA 1OI1A 1BCMA 2Q5IA 3LYIA 4MMKA 5AYFA 2OTLQ 2YDLA 4L6V5 2QEXQ 1UTIA 4TQFA 4EMKB 3KBGA 4HA8A 3OQ5A 4M7AB 3CC2Q 2RHQA 1H4TA 5F5WA 4OVAA 1I07A 2FRYA 1K9MU 3QO7A 4M77D 2DEQA 5GANj 1VQ8A 4BY6C 1BIAA 2DX1A 4UPAA 1AOJA 4X1VA 1OX9A 3OS1A 2KT1A 4JRQA 1YITT 4EPCA 4EMKA 1VYUA 4JJDA 4BI4A 4BE0A 3RR6A 4GLMA 2DE0X 2YRDA 4C5HA 1X2HA 4M7AA 4FT2A 3JCMV 4RMFA 4B9WA 2GTJA 3RMQA 5I11A 1SSFA 4BE1A 2DU5A 2XTIA 1YJWT 5LJ3h 2JT4A 4IUQA 3T9NA 2DIQA 2LCSA 4XU0A 2K4YA 3R6NA 3LWIA 2QQ9A 1UGRB 1X6BA 1K9MC 4RG8A 2JUFA 2I0NA 2YXYA 3LLRA 3FEOA 2EJFA 2ODRD 1MV0B 2EQKA 2KDSA 3FIFA 2M51A 1ZBJA 2YLCA 1WQ7A 4KGVB 3CCEQ 3RACA 2X4YA 3QDRB 2EQMA 1RIQA 1ASYA 3I35A 4QW2A 4XU2A 2YRCA 1Q81U 2DXTA 4XTZA 5CQYA 4OMOA 3CC4T 1H4SA 5CR2A 3G4ST 1TWBA 1YHQT 1WYDA 2AKLA 3QKJA 3GPLA 2CGHA 1USYA 1OYXA 1M3BA 1JB0E 3REXA 3KFUA 4TVRA 1V76A 5GANg 1M8VA 2QGGA 1EFWA 4J15A 3PE0A 1B70B 2B86A 2CP5A 1OZ2A 2O88A 1UDLA 5GAN3 5DY9A 2ZZDA 4C92E 1V29B 3NPFA 4NCXA 2FL7A 5GAN5 1NJ8A 1QWEA 4ZIBA 1YIJQ 1WDXA 2PQWA 4P3NA 3HRUA 2RNAA 4OGCA 2WACA 1YWOA 3ZL7C 2XU8A 4M7AG 1JXMA 3PFSA 1YJNQ 1K0XA 4XK8E 4C5EA 3C94A 3PNWC 4HT9A 3JB9G 2DEUA 4YRCA 2ED0A 3OBYA 2CSIA 2O4XB 3CCRQ 4ZTJA 3L4GB 3HFZB 5GAN8 1GCPA 4XU1A 1YITA 2AZSA 5FROA 1VQ6T 3E19A 2LZ6B 2AIRB 3CCLQ 4HVCA 3TU4K 3VS1A 5LJ3j 2K5LA 3A98A 4LVMA 4PFPA 4WCIA 1KC8C 2B8AA 3LWHA 3HXZA 2O4XA 4WI1A 5KE3A 3X26B 3L4GA 3HFZA 1YJWA 3VS7A 4JRKA 1UG1A 1YNZA 5D6WA 4JLGA 4RCBA 4TTVA 4LDYA 1HTTA 3BDUA 3EAEA 5D6XA 3AHUA 4TQDA 4P72C 3CCSQ 2KBTA 3QO3A 3CMEQ 2NWMA 1LPLA 1ZUKA 5GMKl 5KNNA 4Z02A 2E6ZA 2XK0A 4ZN3A 1M90R 3CC7T 4PK4A 4Q5WA 3VUZA 4M7DE 3OW2P 2Y90A 4YRRA 3HFVA 1N9RA 1TUCA 1G3SA 2RQWA 3UPUA 2K5FA 4AMCA 2BE9B 1BBZA 1OZ3A 4D8KA 4LD9K 2D0QB 3CC4A 3G4SA 1YHQA 3M0PA 3TEEA 2KE9A 4J6YA 3M4YA 1E1TA 1VQNT 4OMLA 1M5Q1 1QVFA 3E9HA 2DXCA 1H641 4H2TA 1G51A 1PWTA 1KHIA 4J9EA 5FU7C 1WZOA 4MDWA 3P8VA 4HCKA 1FWZA 3RKWA 2PVOB 5GAOr 4J9IA 4R55A 1IXDA 5LJ3g 4KGXB 2DETA 5KH6A 2RJEA 2GQIA 4C5GA 1AEYA 3UA6A 4BACA 2OAUA 4OB0B 2XICA 2FB7A 1QW1A 5GJVB
chains in the Genus database with same CATH topology
3LGLA 2KQWA 3WVEB 2WSFE 3MQZA 3CPWS 1VQ6A 4P71C 4C8QE 4CS2A 2DVEA 4L87A 3OYKA 1W2BA 4UC4A 4QVCA 3J81E 3HP9A 1M90U 4C8QB 5HK0A 1VQKT 2CS7A 4XEMA 4OGEA 3WXMB 4CH3A 2CZ0B 1K8AC 2PUOB 1Y7XA 3JCMJ 3C95A 4ELZC 4C8QA 3FDRA 3JCMP 3J7AF 3CC7A 4H2SA 3BY7A 3I7FA 3OYAA 4M7AD 2ZPFB 1N9WA 3OS5A 3M9QA 4M77E 2K3YA 2ZTGA 4YRTA 4M78F 3JB9D 3QTCA 3OYHA 4P74A 3QXEB 2AMCB 2KMTA 3JCMc 4J5YA 4C5IA 2L8DA 3L2RA 3TREA 2X4XA 2OTLA 4N4HA 2K3XA 2WSEE 5GANe 2ZPHB 4PJOC 4X9DA 1FYFA 3MEWA 2AMCA 2EIFA 3A8OB 3CC2A 1KQSA 3RMSA 4ZGJB 2LRQA 5ELNA 2GF7A 2CJBA 3L1AA 3MF1A 3M57A 1Y07A 4M78B 4ZN1A 1NZ9A 2QHTA 4C0FA 1QVGS 2XKOC 5FRMA 4YRIA 1YJ9T 2LC4A 1NJ6A 4LDUA 2BIVA 2DZCA 3IKLA 4HWTA 4E7IA 4F7UF 4CH5A 3OMGA 2E12A 2GFAA 3JCMb 4M78A 4P5NA 3A7RA 1RL2A 3OSSC 1ADJA 3M4GA 1U8RA 3OD1A 3PZCA 2DQ0A 5LJ5d 2DTHA 2EWNA 2RJDA 5GMKj 1WNLA 2E10A 2K57A 5CK9A 2BUDA 4JDSA 2ZZEA 2EYQA 5HKCA 1WU7A 1C0AA 3QO8A 2Q7GA 3ZBDA 4HCBA 2EAYA 4DPGA 1YI2T 2HNIA 3JB9H 2LQ8A 4LVLA 3IKMB 2ARSA 5LJ5f 3ERRA 4YRLA 1G3TA 3C4SA 3ME9A 2IG0A 2CZ6B 3GF5A 4BWAA 2C8MA 1VQOT 3QZ5B 2P0KA 4KULA 2D6FA 3L2QA 2QQAA 1YJNA 4E7JA 3A7UA 5GAN6 4M78G 2G3RA 4J6WA 1U1SA 4MDXA 3RGLA 4BI3A 5LJ3e 4YROA 2JTMA 1WJRA 2CYZB 3OA6A 1YJ9A 3CD6T 2CKKA 4YP0A 1I8FA 2EJ9A 1PSEA 3FB9A 4BB7A 4KUDK 2FVUA 1NNHA 2H3JA 3CCVT 3QHSA 1WLEA 3F70A 1YGBA 2E1HA 3JCMd 3OYGA 3QNEA 5CO7A 2ZINA 4RKUE 1RI0A 3A8HB 4F7UG 1NJ2A 4EX5A 3GP8A 3MCAB 3C12A 3VQXA 4P75A 4JUVA 4ZGEB 2PUKB 2YRVA 3R07A 1YI2A 3JCMf 3RKYA 5KCHA 3VV0A 3M56A 3PTAA 3HRIA 3HL8A 2EQUA 2ZT7A 2I4OA 4C92C 3OYLA 2DKGA 3OYFA 1VQOA 4Y91A 4QQDA 3UDCA 3JB9J 3QYHB 1WPYA 1FX7A 3MEUA 1QP2A 1IREB 2P4TA 2L3RA 2Y4YA 3V8LA 5DLQE 5D6YA 3G71T 4YRPA 2V8JA 3R6OA 2CJAA 2DD5A 2V8KA 4L5GA 2LDMA 4K87A 3LC0A 1Q7YC 4TWAA 4EMGA 3OW2S 3QJYA 4BW9A 3GIBA 2A8EA 3CD6A 5GAN2 1IL2A 3GOXA 4RCCA 4M7AE 5FU6B 3V7SA 4BDYA 4TVAB 4YDQA 1NPRA 5CKBA 3CCVA 2NLUA 1M1KU 2CJ9A 4ME7A 1N8RC 2X4JA 2RI5A 3A32A 3GNGA 4MZPA 3X28B 3KXTA 1J5WA 2OTJT 3BW1A 4TVAA 1DJ7B 2LNVA 3CCUT 2GCXA 2QQRA 3A8GB 1B8AA 4M7DC 2E70A 3META 2RO0A 1BBWA 1YFRA 4HKEA 4M78D 3MEYA 4YCWA 3RF1A 2RHYA 5GAMj 3QUIA 5I21A 4KR2A 4A4EA 4HT4A 3X25B 2MF2A 3OBWA 1BYMA 3UGTA 1O9SA 3NETA 3VYHB 4Q6GA 4Y28E 1QE0A 2ZNJA 4OLFA 1JJ2S 1KD1U 4BDZA 3JCMQ 1M9SA 4PHCA 4QVDA 4UP9A 4YPFA 2C06A 3G71A 1KMNA 5GAOl 1W4SA 4LVKA 3HFNA 3P8DA 4BUGA 2IVWA 1HK9A 3RESA 1HXDA 4C8QC 3NTIA 4M75F 2JZ2A 5GMKe 3G7ZA 1Q81C 1ATIA 2JN0A 2R5MA 1B70A 4J83A 3FJPA 2R57A 5GAMg 4CI0C 4ATOA 1EVLA 4IKFA 2QDYB 3I56T 1NJIU 2XG8D 2I4MA 3UT1A 1VQ7T 4TVYA 1MHNA 2OTJA 3A31A 2RD1A 3CCUA 3RL6A 5A0DA 4M75B 2ZT5A 3H8ZA 4QQ6A 3MP6A 4N0AA 4LD6A 4M77C 5CKDA 4PLLA 4OP0A 4YRSA 1EVKA 3RUXA 1B76A 2E5AA 1KQ2A 4M75A 2QXFA 5J3BA 1VUBA 1K73U 2F69A 2IY5B 4LDWA 4EMHA 3OYNA 2DD4A 3HRTA 3JCMX 1O75A 3JSCA 4LDXA 1Q82U 4YRQA 2IY5A 2WSCE 2ODRC 2RJFA 2ZCFB 3E9GA 2OTLT 3E1SA 4N4GA 1K73C 2P0PA 3G1ZA 4DOWA 1PYSB 4NOYA 4YTLA 3CC2T 4WJ4A 4PLIA 3VU3C 3QG1A 3UWNA 2DTOA 3PGGA 11ASA 3DSQA 2ZCEA 4FIBA 1Q86U 5LL6S 2ZZFA 1Q82C 1PYSA 2AHJB 1ADYA 3OYBA 3HTZA 3I56A 2JOYA 1VQ7A 4RMOA 4WJ3M 3KUFA 3M58A 2RB6A 3CXCA 4GY5A 2GFUA 4HWOA 4M75G 2DZ9A 4XQ3A 4JJNK 1Z7MA 4HT8A 5HK3A 3S3NA 1H4VB 1BIBA 2LCCA 2M1HA 2PVDB 3RERA 4JRIA 2KVQG 3HRKA 3MO8A 1I81A 3DB3A 2YLBA 3HRSA 1I4K1 3CCMA 4YCUA 3HY1A 4J7FA 2QHVA 1I5LA 3CBOA 3HSBA 2ZT6A 1M90C 2ZNIA 3E9FA 1WJQA 1QVPA 1YIJT 4K86A 4DA4A 2PVGB 4QQGA 2O01E 4H02A 1H3ZA 2GQVA 2QEXA 5DM7R 2I4LA 1YJNT 4M78E 4G85A 3OYJA 3OB9A 4YRFA 3TEHB 3SWNC 2RM4A 4KUIA 3CCLT 4FT4A 3LGFA 3UH0A 5GAMe 3TEHA 1SERA 2MWPA 5A0LA 3L2WA 4CH4A 2QHSA 1VIEA 4KBMB 2HAXA 3VQWA 5GAN7 3BJUA 3HHTB 3ICAA 1U1TA 4HCCA 1X56A 2I2LA 3SFMA 4F7UE 2DIGA 3VQYA 3CMET 4P72A 3NELA 4IURA 3NENA 5GANd 3CCEA 4F7UB 5CIUA 1BI1A 1X75C 4ZTFA 3CEYA 2HBPA 5FU7B 5C51B 3L2VA 3M54A 5IAYA 2XD0A 3VKIA 3A74A 4F7UA 3SB2A 4XTVA 3QYGB 1Y96B 2PMFA 1UEBA 1E22A 1SESA 1WJSA 3W3SA 5CCAA 5FU6C 5GANf 1UGPB 2MMPA 1YIJA 4EMKC 4M75D 5FRNA 2R5AA 3LSSA 1Y96A 4M7AC 3GNFB 2RA2A 4P3PA 4J6XA 3L42A 2QTXA 4YREA 2EQJA 1QF6A 1X2GA 3RKXA 3MEVA 4PG3A 3CCRA 3CBMA 4YCVA 2KK4A 5GAOp 3CCLA 4P71A 3NEMA 3ZFJA 2ZPEB 3VYGA 3HY0A 2LX9A 1NYQA 2ZZGA 1M4ZA 1NE8A 5GAOq 2XI9A 4PKCC 1UGQB 3VJPA 4PJOF 2XIDA 3NFCA 2RI2A 1BI3A 3FRNA 4C0DB 1YFTA 2MAMA 3CCSA 2JNGA 3CMEA 1USYC 4JLIA 2BKDN 2ZR3A 3OYYA 4KR3A 1E24A 4HWPA 2L89A 5L8RE 5GMKm 4YRMA 4XU3A 4PJOB 3SDZA 5LJ3d 2ARUA 1ASZA 5HY6A 5LJ5h 4H2YA 4CS4A 4ZTUB 2XDPA 2YHTA 2Y4XA 4P73A 2DO3A 1QVFS 4KQEA 5C53B 2X4WA 5GANh 1NJ1A 2Q5HA 2VXEA 4CS3A 4PJOA 3DKMA 1N6AA 5GAN4 1S72T 3CPWA 4J7IA 5C52B 4AH6A 3QIIA 5LJ3f 4JS4A 4NL3A 1G5HA 1UGSB 4ZTZB 1VQLT 1G5IA 3M5AA 4XTWA 1JJCB 2ZIOA 3CXCS 3EFSA 3S3MA 2V8IA 3A8LB 4OB2B 2QA4T 4X5OA 3OYIA 1EIFA 4YRNA 2C7IA 1W2BS 3X20B 2EFIA 1JJCA 3BFMA 2LVMA 1VQ5A 3OYEA 2ZT8A 4XTUA 1X6OA 2QQSA 5M9OA 4N4IA 2RHIA 4A54A 3OS0A 5EG2A 2KAFA 2KY9A 5CVIA 3Q1JA 1EOVA 3M55A 2VGMA 3P8TA 1N9SA 4XTYA 2LTOA 3NTKA 2DU7A 2VXFA 3N5BB 4FU6A 3S3OA 1HC7A 2RHXA 3TCJA 3M59A 2ZPGB 1NPPA 2E6NA 2RJCA 3OYMA 3H6ZA 5LJ5j 4HCZA 4E7LA 4PJOG 3JCMh 2DTIA 2ZPIB 4VUBA 5CKEA 2VC8A 3TUPA 1BI0A 1IZ6A 1M1KC 2R58A 3ER0A 1QVGA 4A4KA 3CBPA 4XTXA 12ASA 1ZQ1A 3EFRA 3UGQA 4LVIA 2EJGA 4A4GA 3MP8A 2Q7EA 1KQSS 4A4FA 2ALYB 1M1GA 4A53A 1YBYA 3LH0A 2XDDA 1S72A 3HXWA 5KCOA 1TH7A 2ZR2A 5K1XA 3DLMA 4C0GA 2ALYA 2RK2A 1VQLA 4UP8A 4OF1A 4O6JA 5K1PA 1KQ1A 5I2SA 5A2QE 1PSFA 4P3OA 2QA4A 3IG2A 4RDXA 4C92F 5LJ5g 2RH2A 3CCJT 1KD1C 4WF2A 1P92A 2XDBA 3G6EA 1BBUA 2XHCA 4E7KA 3OYCA 2PMEA 4P74C 4J8OA 3V8JA 4DQ2A 4M75E 1VQ4A 1KC8U 2MI6A 1WQWA 4C92B 2DDZA 1X55A 3MP1A 3MEAA 3P8HA 3M4PA 4LNSA 1NYRA 4C92A 2FYKA 2CIMA 3VUBA 3PT9A 1G3WA 3L2ZA 2LQKA 1NJIC 3IALA 4NL2A 1H4QA 5C0MA 2VYTA 4FL6A 3NTHA 4JS5A 4M78C 3CCMT 1LJOA 4HWSA 3O8VA 1G3YA 4EDUA 4M7DF 3INZA 3OS2A 3PIPA 2E64A 3DLLA 4H2WA 1N27A 2RHSB 3HKSA 1M1FA 4LDVA 3A8MB 1KMMA 3QSUA 1LNXA 3WVDB 3MF2A 4BY6B 1GXIE 1Y71A 2QEXT 2RHSA 4PJOD 2D9TA 3JCMg 4M7DB 3LW5E 4IUUA 1D3BB 3QPHA 4ELYC 1LYLA 2M0OA 3CCJA 1KHCA 3OSVA 2AKWB 4IUTA 3V7RA 3HFOA 5CAIA 1KOGA 3CCQT 2LT4A 4M7DA 4UP7A 1D3BA 4L59A 3GLXA 1X01A 2L5QA 4E47A 3UFGA 2AKWA 5FLXE 4C92G 2K5IA 4FSXA 3BDLA 3FC3A 1YCYA 3M53A 4C8QF 4IUPA 4II1A 1VQZA 2Q7HA 3PMIA 1K8AU 4TVWA 1EQRA 2P5IA 1Q86C 3CCET 2G4CA 2J3MA 4E51A 3VQVA 2I4NA 3A5ZB 3OW2A 3CPFA 3MHXA 2E41A 1WGSA 4GLKA 3CMQA 1FXXA 5IN1A 2F5TX 3HXYA 5CKFA 4H2UA 2RI3A 2VV5A 3V7CA 3A5ZA 2VGNA 1ZBXA 4OB1B 4M77F 4V2SA 3JRZA 2M16A 3S6WA 4CRIA 5GMKh 2EL9A 4YRGA 5CQXA 3JAME 4NS5A 1X54A 3J80E 2QHUA 4C0DC 4M7DG 5E3IA 2P0LA 2JTFA 3PCOB 4P75C 4MZTA 3CCRT 1Z7NA 1R8OB 5ELOA 4P73C 4M77B 5LJ5e 2HD0A 1VQNA 3HXVA 3WQZA 3PCOA 3CCQA 4R56A 5GMKi 3CMAT 2CZ7B 4Q15A 1UB4A 3LSQA 1QP3A 2QI2A 1VQMT 4M77A 3PIOA 1JJ2A 3TEGA 3P8YA 3OYDA 2ZGWA 4B9XA 3URGA 2DJZA 3HXUA 3LX7A 3CCST 2DQ3A 5J26A 4E7HA 2K2VA 3DB4A 5IT9E 1BKBA 3JB9I 2KSSA 2DK3A 4KT0E 1JBMA 3ZEHA 1L0WA 3HXXA 2F5KA 3VBBA 5HGQA 2ARTA 4C8QG 4OMFB 3I55T 1VQPT 3RIRA 1XOVA 2HQXA 4BE2A 1W66A 4YYEA 2DAQA 1XNIA 3QO5A 3A5YA 5DLOA 1VQKA 5GAMd 3QJ6A 1YFSA 2XGTA 2LT1A 2LCLA 5GAOm 4K88A 1G5VA 4X34A 1YB3A 3E9IA 4C92D 4D6WA 3P8BB 5CKHA 3ASKA 2DPPB 3PMTA 4YRJA 1BI2A 3M4QA 4M77G 3JCMe 3JCMW 2J3LA 4ZGDB 5A0GA 4O5VA 5GAMf 3OY9A 1VIFA 1GGMA 2ZIMA 4QVZA 2JVVA 2E5QA 5J39A 3CMAA 1VQ5T 4HWRA 1LOJA 1VQMA 2X35A 1VQ9T 5GAOn 2EKOA 4RQFA 4DOVA 2PU9B 3V8KA 2CZ1B 4BD3A 4CH6A 4YRKA 3A7AA 2DXUA 2MWOA 1AHJB 1B34B 3OMCA 4PJOE 4MMLA 4M7DD 2ZPBB 3FLGA 3QZ9B 4EO4A 4H2XB 4IUVA 2RHUA 1VQ8T 2RK1A 4C0ZA 4H2VA 3I55A 1VQPA 1B34A 1XQHA 1ZHIA 1SETA 3SWNB 3HPWA 1NJ5A 1SRYA 5KE2A 4O2DA 4H2XA 2VUBA 2QQBA 2E65A 4A4HA 4LVJA 4OB3B 5I2MA 3SWNA 3QBYA 5C6SA 4FM4B 4N0AC 2NS6A 4MZMA 1Q7YU 5GAMh 2A7YA 2RHZA 2DXBA 4X9CA 1B7YB 1EIYB 2A3LA 4JRPA 4PNOA 3L2UA 4G84A 1XTDA 1JRIA 4M75C 3X24B 4XEOA 2E3CA 2ZXFA 4XAXB 4BI8B 1N8RU 4PL6A 1KG1A 4C8QD 1B7YA 4RG2A 1E1OA 3REUA 1EIYA 4RQEA 3G6ET 2P0QA 4M7AF 2HQEA 1VQ9A 2FHDA 3JB9F 2M9UA 3SD4A 2RHQB 1VQ4T 1MGQA 1OI1A 2Q5IA 3LYIA 4MMKA 5AYFA 4L6V5 4TQFA 4EMKB 3KBGA 4HA8A 3OQ5A 2RHQA 4M7AB 5F5WA 1H4TA 4OVAA 1K9MU 3QO7A 4M77D 2DEQA 5GANj 1VQ8A 4BY6C 1BIAA 4UPAA 3OS1A 4JRQA 1YITT 4EPCA 4EMKA 4BI4A 4BE0A 4C5HA 1X2HA 4M7AA 4FT2A 3JCMV 4RMFA 4B9WA 3RMQA 1SSFA 4BE1A 2DU5A 2XTIA 1YJWT 5LJ3h 4IUQA 3T9NA 2DIQA 4XU0A 2K4YA 3LWIA 2QQ9A 1UGRB 1K9MC 4RG8A 2JUFA 3LLRA 3FEOA 2EJFA 2ODRD 2EQKA 2KDSA 3FIFA 2YLCA 1WQ7A 3RACA 2X4YA 3QDRB 2EQMA 1RIQA 1ASYA 4QW2A 4XU2A 1Q81U 2DXTA 4XTZA 5CQYA 3CC4T 1H4SA 5CR2A 3G4ST 1YHQT 1WYDA 3QKJA 3GPLA 2CGHA 1USYA 1OYXA 3KFUA 1JB0E 3REXA 4TVRA 5GANg 1M8VA 1EFWA 4J15A 1B70B 1OZ2A 5GAN3 5DY9A 2ZZDA 4C92E 1V29B 4NCXA 2FL7A 5GAN5 1NJ8A 4ZIBA 2PQWA 4P3NA 3HRUA 4OGCA 2WACA 2XU8A 4M7AG 3PFSA 4XK8E 4C5EA 3C94A 3PNWC 4HT9A 3JB9G 4YRCA 3OBYA 2O4XB 4ZTJA 3L4GB 3HFZB 5GAN8 4XU1A 1YITA 5FROA 1VQ6T 3E19A 4HVCA 3TU4K 5LJ3j 2K5LA 4LVMA 1KC8C 2B8AA 3LWHA 3HXZA 2O4XA 4WI1A 5KE3A 3X26B 3L4GA 3HFZA 1YJWA 4JRKA 5D6WA 4JLGA 4RCBA 4TTVA 4LDYA 1HTTA 3BDUA 3EAEA 5D6XA 3AHUA 4TQDA 4P72C 3QO3A 5GMKl 5KNNA 4Z02A 4ZN3A 2E6ZA 2XK0A 3CC7T 4M7DE 3VUZA 4Q5WA 2Y90A 4YRRA 3HFVA 1N9RA 1G3SA 3UPUA 2K5FA 1OZ3A 4LD9K 2D0QB 3CC4A 3G4SA 1YHQA 3TEEA 4J6YA 3M4YA 1E1TA 1VQNT 1M5Q1 1QVFA 3E9HA 2DXCA 1H641 4H2TA 1G51A 1KHIA 5FU7C 4MDWA 3P8VA 1FWZA 3RKWA 2PVOB 5GAOr 4R55A 5LJ3g 5KH6A 2RJEA 4C5GA 4BACA 2OAUA 4OB0B 2XICA 2FB7A 1QW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIR A;  1W66 A;  4YYE A;  1HK9 A;  3RES A;  3QO5 A;  3A5Y A;  5C52 B;  4AH6 A;  1HXD A;  4C8Q C;  5LJ3 f;  4NL3 A;  5GAM d;  4M75 F;  1G5H A;  4ZTZ B;  1YFS A;  5GMK e;  2XGT A;  1G5I A;  4P71 C;  4C8Q E;  4CS2 A;  2DVE A;  4XTW A;  4L87 A;  1JJC B;  1ATI A;  2JN0 A;  5GAO m;  1B70 A;  4K88 A;  1YB3 A;  3FJP A;  2ZIO A;  3EFS A;  3E9I A;  4C92 D;  5GAM g;  4QVC A;  1EVL A;  2I4M A;  4C8Q B;  4X5O A;  4TVY A;  4YRN A;  2C7I A;  4YRJ A;  3A31 A;  4XEM A;  2RD1 A;  3M4Q A;  1JJC A;  3BFM A;  2ZT8 A;  3RL6 A;  4XTU A;  4CH3 A;  4M77 G;  3JCM e;  4M75 B;  3JCM W;  2J3L A;  2ZT5 A;  3JCM J;  4N0A A;  4A54 A;  5GAM f;  4C8Q A;  3JCM P;  1EOV A;  1GGM A;  2ZIM A;  4H2S A;  4M77 C;  3BY7 A;  3P8T A;  1N9S A;  4XTY A;  3I7F A;  2DU7 A;  2VXF A;  1HC7 A;  4M7A D;  1N9W A;  4OP0 A;  4YRS A;  1EVK A;  3RUX A;  4M77 E;  1B76 A;  2E5A A;  2ZTG A;  1KQ2 A;  4YRT A;  4M78 F;  4M75 A;  3JB9 D;  3QTC A;  4HWR A;  4P74 A;  2AMC B;  1LOJ A;  3JCM c;  4J5Y A;  5LJ5 j;  5GAO n;  4RQF A;  2IY5 B;  4PJO G;  3JCM h;  4EMH A;  2DTI A;  3V8K A;  2VC8 A;  3TUP A;  3JCM X;  5GAN e;  4PJO C;  4X9D A;  1FYF A;  4CH6 A;  4YRK A;  3A7A A;  2AMC A;  2DXU A;  4XTX A;  12AS A;  3EFR A;  3UGQ A;  4PJO E;  1B34 B;  2EJG A;  4YRQ A;  5ELN A;  2IY5 A;  2CJB A;  3L1A A;  4MML A;  4M7D D;  3MF1 A;  2ODR C;  4M78 B;  2Q7E A;  2QHT A;  4EO4 A;  4H2X B;  2ALY B;  4YRI A;  4A53 A;  1NJ6 A;  2DZC A;  3IKL A;  4H2V A;  4HWT A;  3G1Z A;  1PYS B;  4F7U F;  4NOY A;  4CH5 A;  1B34 A;  4WJ4 A;  3HXW A;  1SET A;  3JCM b;  1TH7 A;  3SWN B;  2ZR2 A;  4M78 A;  3VU3 C;  5K1X A;  1NJ5 A;  2DTO A;  1SRY A;  4O2D A;  3PGG A;  3A7R A;  4H2X A;  11AS A;  2ALY A;  3DSQ A;  4UP8 A;  2E65 A;  2ZCE A;  5K1P A;  1KQ1 A;  1ADJ A;  3M4G A;  2ZZF A;  3OD1 A;  3PZC A;  2DQ0 A;  1PYS A;  5LJ5 d;  1ADY A;  3HTZ A;  2DTH A;  2EWN A;  3SWN A;  4P3O A;  3IG2 A;  4N0A C;  4RDX A;  4WJ3 M;  4C92 F;  5LJ5 g;  2RB6 A;  5GAM h;  5GMK j;  4HWO A;  4M75 G;  1WNL A;  2E10 A;  2K57 A;  4WF2 A;  2DZ9 A;  4X9C A;  1B7Y B;  2ZZE A;  1EIY B;  1BBU A;  4PNO A;  4XQ3 A;  4G84 A;  1Z7M A;  1WU7 A;  2PME A;  1C0A A;  3QO8 A;  4HT8 A;  2Q7G A;  1JRI A;  4M75 C;  2EAY A;  4XEO A;  2E3C A;  4P74 C;  4DPG A;  3V8J A;  2ZXF A;  2HNI A;  3JB9 H;  4DQ2 A;  1H4V B;  4M75 E;  1BIB A;  3RER A;  3IKM B;  4JRI A;  4C8Q D;  2ARS A;  5LJ5 f;  1B7Y A;  1WQW A;  3REU A;  1E1O A;  3HRK A;  1EIY A;  3ERR A;  4YRL A;  4C92 B;  2DDZ A;  1I81 A;  2YLB A;  1X55 A;  4RQE A;  4M7A F;  4BWA A;  2C8M A;  3M4P A;  3JB9 F;  1I4K 1;  2RHQ B;  4YCU A;  3HY1 A;  4LNS A;  1NYR A;  1MGQ A;  2QHV A;  1I5L A;  4C92 A;  2FYK A;  2Q5I A;  2CIM A;  4MMK A;  3A7U A;  5GAN 6;  3HSB A;  4M78 G;  3L2Z A;  2ZT6 A;  4J6W A;  2ZNI A;  1U1S A;  3RGL A;  3IAL A;  4TQF A;  4NL2 A;  4EMK B;  1H4Q A;  4HA8 A;  5LJ3 e;  4YRO A;  4K86 A;  4M7A B;  2RHQ A;  4M78 C;  1H4T A;  5F5W A;  1LJO A;  4HWS A;  4H02 A;  3QO7 A;  4M77 D;  2DEQ A;  5GAN j;  4M7D F;  1BIA A;  3INZ A;  2I4L A;  4UPA A;  4M78 E;  4YP0 A;  4G85 A;  2E64 A;  1I8F A;  4H2W A;  2EJ9 A;  3FB9 A;  2RHS B;  1NNH A;  4EMK A;  4YRF A;  3TEH B;  3QHS A;  1WLE A;  1KMM A;  3QSU A;  1LNX A;  3SWN C;  1X2H A;  4M7A A;  3JCM V;  1YGB A;  2E1H A;  4RMF A;  2RM4 A;  3JCM d;  3MF2 A;  2DU5 A;  2XTI A;  3QNE A;  5LJ3 h;  4XU0 A;  2RHS A;  4PJO D;  2ZIN A;  3JCM g;  3UH0 A;  4F7U G;  5GAM e;  4M7D B;  1NJ2 A;  3TEH A;  1SER A;  4EX5 A;  4CH4 A;  2QHS A;  1D3B B;  1LYL A;  3VQW A;  2EJF A;  5GAN 7;  2AKW B;  2ODR D;  3BJU A;  3FIF A;  3V7R A;  3ICA A;  1U1T A;  3HFO A;  5CAI A;  1X56 A;  4P75 A;  3VQX A;  2I2L A;  4JUV A;  2YLC A;  1WQ7 A;  3RAC A;  3R07 A;  1KOG A;  4F7U E;  1RIQ A;  1ASY A;  4M7D A;  3VQY A;  4P72 A;  4XU2 A;  4UP7 A;  1D3B A;  3JCM f;  2DXT A;  3NEL A;  3RKY A;  3NEN A;  1X01 A;  4XTZ A;  5GAN d;  3UFG A;  1H4S A;  2AKW A;  4C92 G;  4F7U B;  1WYD A;  3HRI A;  2CGH A;  1USY A;  2ZT7 A;  3KFU A;  3REX A;  1YCY A;  5GAN g;  1M8V A;  1EFW A;  5C51 B;  2I4O A;  4C92 C;  4C8Q F;  2DKG A;  4J15 A;  1B70 B;  1VQZ A;  4Y91 A;  2Q7H A;  3JB9 J;  1WPY A;  5GAN 3;  5DY9 A;  4C92 E;  4TVW A;  1EQR A;  3A74 A;  4NCX A;  4F7U A;  5GAN 5;  3SB2 A;  1NJ8 A;  2P5I A;  4XTV A;  4ZIB A;  2G4C A;  1Y96 B;  3V8L A;  2PMF A;  2J3M A;  4YRP A;  4E51 A;  1E22 A;  2CJA A;  3VQV A;  1SES A;  2I4N A;  3W3S A;  4P3N A;  5GAN f;  2E41 A;  4M7A G;  4K87 A;  3LC0 A;  3CMQ A;  4EMK C;  4M75 D;  4TWA A;  4EMG A;  4HT9 A;  3JB9 G;  4YRC A;  3HXY A;  4BW9 A;  3GIB A;  3LSS A;  4H2U A;  1Y96 A;  4M7A C;  5GAN 2;  1IL2 A;  2RA2 A;  4P3P A;  4J6X A;  3L4G B;  3V7C A;  5GAN 8;  3HFZ B;  4RCC A;  2QTX A;  3A5Z A;  4YRE A;  4XU1 A;  4M7A E;  3V7S A;  1QF6 A;  1X2G A;  3RKX A;  4TVA B;  4YDQ A;  4M77 F;  4V2S A;  4HVC A;  4PG3 A;  5LJ3 j;  2CJ9 A;  4YCV A;  5GMK h;  2EL9 A;  5GAO p;  4YRG A;  3A32 A;  3HXZ A;  1X54 A;  4WI1 A;  2QHU A;  3L4G A;  3HFZ A;  4P71 A;  4M7D G;  5E3I A;  2P0L A;  4JRK A;  1J5W A;  3NEM A;  3PCO B;  4P75 C;  3BW1 A;  4RCB A;  4TVA A;  4TTV A;  1HTT A;  3HY0 A;  1NYQ A;  2ZZG A;  3BDU A;  5GAO q;  3AHU A;  1B8A A;  4M7D C;  4TQD A;  4P72 C;  3QO3 A;  1Z7N A;  5ELO A;  4PJO F;  1BBW A;  4P73 C;  1YFR A;  5GMK l;  4M77 B;  5KNN A;  5LJ5 e;  3HXV A;  4M7D E;  1YFT A;  3WQZ A;  2Y90 A;  4M78 D;  3MEY A;  4YRR A;  3HFV A;  1N9R A;  3PCO A;  4YCW A;  3RF1 A;  5GAM j;  1USY C;  5GMK i;  3QUI A;  4JLI A;  5I21 A;  2ZR3 A;  4Q15 A;  4KR2 A;  3LSQ A;  4KR3 A;  1E24 A;  3UGT A;  4M77 A;  3NET A;  4HWP A;  4Q6G A;  3TEG A;  3P8Y A;  4J6Y A;  2ZGW A;  1QE0 A;  5GMK m;  1E1T A;  4YRM A;  1M5Q 1;  3E9H A;  2DJZ A;  2ZNJ A;  4XU3 A;  3HXU A;  4PJO B;  5LJ3 d;  2ARU A;  1H64 1;  4OLF A;  4H2T A;  1ASZ A;  1G51 A;  5LJ5 h;  4CS4 A;  4H2Y A;  2DQ3 A;  3JCM Q;  4ZTU B;  4PHC A;  3P8V A;  2YHT A;  3RKW A;  4QVD A;  4P73 A;  4UP9 A;  5GAO r;  4KQE A;  5C53 B;  5GAN h;  1NJ1 A;  5LJ3 g;  4YPF A;  2Q5H A;  3JB9 I;  2VXE A;  4CS3 A;  4PJO A;  1JBM A;  1KMN A;  5GAO l;  1L0W A;  3HXX A;  2FB7 A;  3VBB A;  3HFN A;  5HGQ A;  5GAN 4;  2ART A;  4C8Q G; 
#chains in the Genus database with same CATH topology
 4PJJ A;  1MMA A;  3LGL A;  2KQW A;  2F2W A;  1X6G A;  2JXB A;  3WVE B;  2WSF E;  1SRM A;  3MQZ A;  3I9Q A;  3CPW S;  5FWB A;  1M2V B;  2NUP B;  1VQ6 A;  4P71 C;  4C8Q E;  4CS2 A;  2DVE A;  3QWY A;  4L87 A;  1ZSZ C;  3OYK A;  2J7I A;  2YUP A;  1W2B A;  1JJ2 P;  4UC4 A;  1M27 C;  4QVC A;  3J81 E;  1QKW A;  3HP9 A;  2DYB A;  1M90 U;  4C8Q B;  5HK0 A;  1GRI A;  2MK5 A;  1VQK T;  2X51 A;  1M2V A;  2NUP A;  2QAZ A;  5IHI A;  2CS7 A;  4XEM A;  4OGE A;  3WXM B;  2J06 A;  1D09 B;  4CH3 A;  2CZ0 B;  1K8A C;  2PUO B;  1Y7X A;  1W6X A;  3JCM J;  1KIK A;  1WHG A;  3C95 A;  3SEM A;  3ULR B;  4LN2 A;  4ELZ C;  1X27 A;  3FDR A;  4JJB A;  4C8Q A;  3JCM P;  3J7A F;  3CC7 A;  3LH5 A;  4H2S A;  3BY7 A;  3I7F A;  3TSW A;  2GTO A;  3OYA A;  4M7A D;  2ZPF B;  1N9W A;  3OS5 A;  3M9Q A;  1MND A;  4M77 E;  2K3Y A;  2ZTG A;  4YRT A;  4M78 F;  3JB9 D;  2GBQ A;  3QTC A;  4FYY B;  3OYH A;  4P74 A;  2CT3 A;  2NUZ A;  3QXE B;  2KMT A;  2AMC B;  3JCM c;  4FYX B;  4J5Y A;  4C5I A;  2L8D A;  3L2R A;  3TRE A;  2X4X A;  2OTL A;  4N4H A;  2K3X A;  2WSE E;  5GAN e;  2ZPH B;  1G8X A;  4X9D A;  4PJO C;  1FYF A;  3MEW A;  2ENM A;  2AMC A;  2EIF A;  3A8O B;  3CC2 A;  1KQS A;  1RAE B;  3RMS A;  4ZGJ B;  2LRQ A;  5ELN A;  2GF7 A;  2CJB A;  3L1A A;  3MF1 A;  3M57 A;  1Y07 A;  4M78 B;  4ZN1 A;  1NZ9 A;  1Y0M A;  1S72 Q;  2QHT A;  4C0F A;  1QVG S;  2XKO C;  5FRM A;  4YRI A;  1VYV A;  1YJ9 T;  2LC4 A;  1NJ6 A;  4LDU A;  2BIV A;  2DZC A;  3IKL A;  4HWT A;  4E7I A;  1VQL Q;  1R77 A;  4F7U F;  4CH5 A;  2RQR A;  3OMG A;  2E12 A;  2GFA A;  3JCM b;  4M78 A;  2COW A;  4P5N A;  1GFD A;  3A7R A;  2DBM A;  1RL2 A;  3OSS C;  2QA4 Q;  2HL3 A;  2MYS A;  1ADJ A;  3M4G A;  1U8R A;  3OD1 A;  3VS0 A;  4A63 B;  3PZC A;  2DQ0 A;  3UA7 A;  4PFO A;  4Y92 A;  5LJ5 d;  1F1B B;  2DTH A;  4PJL A;  2EWN A;  2RJD A;  2RQU A;  5AT1 B;  5D7U A;  5GMK j;  1WNL A;  2E10 A;  2K57 A;  3EH1 A;  2BUD A;  4JDS A;  5CK9 A;  1OPK A;  2ZZE A;  2EBP A;  2EYQ A;  5HCK A;  5HKC A;  1VQ4 Q;  3EG9 B;  1WU7 A;  1C0A A;  3QO8 A;  2Q7G A;  3ZBD A;  4HCB A;  1AWO A;  2EAY A;  4DPG A;  1YI2 T;  2HNI A;  3JB9 H;  5IXB A;  3E2U A;  2LQ8 A;  4LVL A;  3IKM B;  2ARS A;  5LJ5 f;  2NUT B;  4KH1 B;  3ERR A;  4YRL A;  1G3T A;  3C4S A;  3ME9 A;  2IG0 A;  3EG9 A;  2QK0 A;  4E6R A;  2CZ6 B;  3GF5 A;  4BWA A;  4CC3 A;  2C8M A;  1VQO T;  1YCS B;  3QZ5 B;  2P0K A;  4KUL A;  3MKD A;  2D6F A;  1OX8 A;  2MCN A;  3L2Q A;  1PG5 B;  2QQA A;  1SPK A;  2NUT A;  1YJN A;  1YFN A;  4E7J A;  1TG0 A;  2RQT A;  3A7U A;  1GCQ A;  2M02 A;  5GAN 6;  4M78 G;  2G3R A;  4J6W A;  1U1S A;  2QYZ A;  4MDX A;  3RGL A;  2DBK A;  4BI3 A;  5LJ3 e;  4YRO A;  1AWX A;  5L23 A;  2JTM A;  1SKU B;  1WJR A;  1MV3 A;  2CYZ B;  3OA6 A;  1QMC A;  1SSH A;  1YJ9 A;  2HSP A;  3CD6 T;  2CKK A;  4LUD A;  4YP0 A;  1I8F A;  2EJ9 A;  1PSE A;  3FB9 A;  4BB7 A;  4KUD K;  2FVU A;  1NNH A;  2H3J A;  3CCV T;  3QHS A;  1WLE A;  2K7A A;  4LNP A;  3F70 A;  2LQN A;  1ZA2 B;  1YGB A;  2E1H A;  3JCM d;  3OYG A;  1OU9 A;  3QNE A;  1U5S A;  2OX7 A;  2EGC A;  5CO7 A;  3CCJ Q;  2ZIN A;  4RKU E;  1RI0 A;  3A8H B;  4F7U G;  1NJ2 A;  4EX5 A;  3GP8 A;  3MCA B;  1M1K R;  2CUB A;  2D8H A;  3C12 A;  3EGD B;  1IRX A;  4DBF A;  1HSQ A;  2KXD A;  3VQX A;  4P75 A;  4JUV A;  4ZGE B;  1WFW A;  2PUK B;  1SHG A;  2YRV A;  2BZ8 A;  3R07 A;  1MMG A;  1RAH B;  1WX6 A;  1PNJ A;  1CKB A;  1YI2 A;  3JCM f;  3RKY A;  2PZ1 A;  4LUE A;  1FMV A;  5KCH A;  3VV0 A;  3EGD A;  2EYW A;  3M56 A;  3PTA A;  3HRI A;  1LCK A;  4FW2 A;  2CP3 A;  3HL8 A;  2EQU A;  2ZT7 A;  4AG1 C;  1GBQ A;  1OOT A;  2ECZ A;  1I1J A;  4C92 C;  3OYL A;  2DKG A;  2I4O A;  1MMD A;  3OYF A;  1VQO A;  4Y91 A;  4QQD A;  3UDC A;  2X3X D;  3JB9 J;  3QYH B;  1WPY A;  1FX7 A;  3MEU A;  1QP2 A;  2KRM A;  1IRE B;  2P4T A;  4PJN A;  2L3R A;  1RAA B;  1D1B A;  1T3L A;  8AT1 B;  2VAS A;  2Y4Y A;  3V8L A;  4OMP A;  5DLQ E;  5D6Y A;  3G71 T;  4YRP A;  2V8J A;  3R6O A;  2CJA A;  1EX4 A;  2DD5 A;  2V8K A;  4L5G A;  2LDM A;  8ATC B;  4K87 A;  1KD1 R;  3LC0 A;  3M0T A;  1Q7Y C;  4TWA A;  2QG9 B;  4EMG A;  3OW2 S;  3QJY A;  2YUO A;  3GIB A;  4BW9 A;  2A8E A;  4RTY A;  2SEM A;  5GAN 2;  3CD6 A;  1IL2 A;  2H8H A;  3JV3 A;  3GOX A;  1T0H A;  4RCC A;  5KYU B;  1E7O A;  5FU6 B;  3V7S A;  4M7A E;  4BDY A;  4TVA B;  4YDQ A;  3REA B;  1IGU A;  1NPR A;  2SRC A;  5CKB A;  3CCV A;  2NLU A;  1RAF B;  1M1K U;  2CJ9 A;  4ME7 A;  1N8R C;  2X4J A;  2RI5 A;  3A32 A;  3GNG A;  4MZP A;  3X28 B;  1J3T A;  1AD5 A;  5KYU A;  3KXT A;  1J5W A;  2OTJ T;  3BW1 A;  2XMF A;  4TVA A;  1DJ7 B;  2FG0 A;  2LNV A;  3CCU T;  2GCX A;  2QQR A;  3A8G B;  2GNC A;  1B8A A;  3M0S A;  4M7D C;  3CCQ Q;  2E70 A;  3MET A;  2RO0 A;  2DLP A;  1BBW A;  1YFR A;  1NJI R;  4HKE A;  1RLQ C;  2A36 A;  4M78 D;  3MEY A;  1D1C A;  4ANJ A;  4YCW A;  3RF1 A;  2RHY A;  3EH2 A;  5GAM j;  3QUI A;  1RI9 A;  5I21 A;  2X9H A;  4KR2 A;  4A4E A;  4HT4 A;  3X25 B;  1YWP A;  2E3H A;  2MF2 A;  3OBW A;  1BYM A;  3UGT A;  1O9S A;  3NET A;  3VYH B;  4Q6G A;  2IIM A;  1MMN A;  4Y28 E;  4RTX A;  1QE0 A;  2AK5 A;  2LJ3 A;  1NBE B;  2ZNJ A;  3H0F A;  4OMN A;  4OLF A;  1JJ2 S;  1KD1 U;  1KFZ A;  4BDZ A;  3JCM Q;  4EIK A;  1M9S A;  4PHC A;  2HDA A;  2DER A;  4QVD A;  4UP9 A;  1AWJ A;  1K73 R;  4YPF A;  2C06 A;  3G71 A;  4J9G A;  1KMN A;  5GAO l;  1W4S A;  4LVK A;  3HFN A;  3P8D A;  1VQK Q;  4BUG A;  2IVW A;  4PJM A;  2ROT A;  1Q82 R;  1HK9 A;  1SEM A;  3RES A;  1HXD A;  2K9G A;  4C8Q C;  3NTI A;  4M75 F;  2DL7 A;  2EYY A;  2JMA A;  2JZ2 A;  2K2M A;  3SHW A;  3G7Z A;  5GMK e;  2AT1 B;  1Q81 C;  1ATI A;  2JN0 A;  2R5M A;  2KRO A;  4J83 A;  1B70 A;  3FJP A;  2R57 A;  5GAM g;  4CI0 C;  4ATO A;  1EVL A;  4IKF A;  2QDY B;  3I56 T;  1NJI U;  2XG8 D;  2I4M A;  3UT1 A;  1VQ7 T;  2E5K A;  1QVF P;  3THK A;  4TVY A;  1IGQ A;  1MHN A;  1PD1 A;  2OTJ A;  3A31 A;  2RD1 A;  1E6H A;  3CCU A;  3RL6 A;  1Q86 R;  5A0D A;  4M75 B;  2ZT5 A;  3H8Z A;  4QQ6 A;  3MP6 A;  4N0A A;  1K76 A;  4LD6 A;  3CMA Q;  1AT1 B;  4WTO B;  4M77 C;  5CKD A;  2YUN A;  4PLL A;  1VQM Q;  2JM8 A;  1LVK A;  4OP0 A;  4YRS A;  1EVK A;  3RUX A;  1CSK A;  1B76 A;  2E5A A;  2BZX A;  1KQ2 A;  1GFC A;  4M75 A;  1K1Z A;  2QXF A;  5J3B A;  1VUB A;  1K73 U;  2F69 A;  3CXC P;  2IY5 B;  6AT1 B;  1ABQ A;  4LDW A;  1TTH B;  3VS2 A;  4EMH A;  3OYN A;  2VB6 A;  2DD4 A;  2D8J A;  2ZAE A;  3HRT A;  3M0U A;  1N5Z A;  3JCM X;  1ZA1 B;  2KRN A;  1O75 A;  1SHF A;  2L3P A;  1W2B P;  3JSC A;  2YSQ A;  4LDX A;  3G1J A;  1Q82 U;  4M4Z A;  4YRQ A;  2IY5 A;  1UHF A;  2WSC E;  1PCX A;  3AT1 B;  2ODR C;  2RJF A;  4CC4 B;  5IHN A;  3I55 Q;  1VQP Q;  2ZCF B;  3E9G A;  1B7T A;  2OTL T;  1UFF A;  3E1S A;  4N4G A;  4KRT A;  2C0O A;  1K73 C;  2P0P A;  3G1Z A;  3TSZ A;  3VS3 A;  2VVK A;  1D1A A;  4DOW A;  1PYS B;  4NOY A;  4YTL A;  4HVV A;  3CC2 T;  4WJ4 A;  4PLI A;  3VU3 C;  3QG1 A;  3UWN A;  2DTO A;  4KGZ B;  2FPD A;  4K11 A;  3PGG A;  1KK7 A;  11AS A;  1R0C B;  3DSQ A;  1NYG A;  2ZCE A;  4FIB A;  1Q86 U;  2FO0 A;  5LL6 S;  2ZZF A;  1Q82 C;  2VWF A;  1PYS A;  2AHJ B;  1ADY A;  3OYB A;  3HTZ A;  2FPF A;  3I56 A;  2JOY A;  1VQ7 A;  1QCF A;  4RMO A;  3QDF A;  4WJ3 M;  2F2X A;  3KUF A;  3M58 A;  2RB6 A;  3EHQ A;  3CXC A;  4GY5 A;  1RAC B;  2GFU A;  2JM9 A;  4M75 G;  4HWO A;  2DZ9 A;  1KQS P;  3VS6 A;  4F17 A;  3H9N A;  4XQ3 A;  4JJN K;  1Z7M A;  1GCQ C;  4HT8 A;  5HK3 A;  3S3N A;  1VQ5 Q;  2CDT A;  4HVW A;  1M8M A;  4RUG A;  1WLP B;  1H3H A;  1H4V B;  1BIB A;  1MUZ A;  1RLP C;  2LCC A;  3VS4 A;  2M1H A;  2PVD B;  4Z89 A;  1VQ9 Q;  3RER A;  4JRI A;  2KGT A;  2KVQ G;  2FPE A;  3HRK A;  3MO8 A;  5GJW B;  1I81 A;  3DB3 A;  2YLB A;  3HRS A;  1NEG A;  7AT1 B;  1I4K 1;  3IQL A;  3CCM A;  2ESW A;  2GGR A;  3H0I A;  4YCU A;  3HY1 A;  4J7F A;  4DBH A;  2YWW A;  2QHV A;  1I5L A;  3CBO A;  3HSB A;  2L3Q A;  2L0A A;  4AFZ C;  2ZT6 A;  1M90 C;  2ZNI A;  3E9F A;  1VQ8 Q;  2V1R A;  1WJQ A;  1QVP A;  4RTT A;  1YIJ T;  4K86 A;  4JZ4 A;  2DNU A;  4DA4 A;  2PVG B;  2O31 A;  1W70 A;  4QQG A;  4AT1 B;  2O01 E;  4H02 A;  1H3Z A;  1D0Y A;  2GQV A;  2QEX A;  5DM7 R;  1MNE A;  1H92 A;  2I4L A;  1YJN T;  4M78 E;  4G85 A;  1ACM B;  3OYJ A;  3OB9 A;  2ABL A;  4YRF A;  3TEH B;  1UUE A;  3PVQ A;  3SWN C;  2PNI A;  2RM4 A;  4KUI A;  2FRW A;  1BCO A;  3CCL T;  4FT4 A;  1ARK A;  1PD0 A;  3LGF A;  1AZE A;  3PVL A;  3UH0 A;  5GAM e;  3TEH A;  1SER A;  2MWP A;  5A0L A;  3L2W A;  1I0C A;  2C0I A;  4CH4 A;  2QHS A;  2OI3 A;  1VIE A;  4KBM B;  2HAX A;  2FZK B;  3VQW A;  5GAN 7;  3BJU A;  3HHT B;  2D1X A;  1QCO A;  4QT7 A;  3ICA A;  1U1T A;  4HCC A;  3EG3 A;  1X56 A;  2I2L A;  4IIO A;  3SFM A;  2BTT A;  4F7U E;  1BU1 A;  2DIG A;  1IO6 A;  3VQY A;  3CME T;  4P72 A;  2V26 A;  3NEL A;  4IUR A;  3G6E Q;  3NEN A;  5GAN d;  4F14 A;  3CCE A;  2KXC A;  4F7U B;  5CIU A;  3REB B;  1BI1 A;  4J9C A;  2KYM A;  1X75 C;  2COZ A;  4ZTF A;  3CEY A;  2O9V A;  4HVU A;  2HBP A;  2EVR A;  1FMW A;  3EGU A;  5FU7 B;  5C51 B;  3EG2 A;  3L2V A;  3M54 A;  5IAY A;  2JS0 A;  2XD0 A;  2DL4 A;  3VKI A;  3A74 A;  1Q95 G;  4F7U A;  1M30 A;  1A0N B;  3SB2 A;  3HTR A;  4XTV A;  3QYG B;  1Y96 B;  2PMF A;  2QTV A;  1JEG A;  1UEB A;  1E22 A;  1TOV A;  1G83 A;  1WJS A;  1SES A;  3W3S A;  5CCA A;  5FU6 C;  5GAN f;  1UGP B;  2DRM A;  1WXT A;  2MMP A;  1YIJ A;  1YIT Q;  1VYT A;  4M75 D;  4EMK C;  3C0C A;  5FRN A;  1WHM A;  2R5A A;  3LSS A;  1Y96 A;  4M7A C;  3GNF B;  2RA2 A;  4P3P A;  4J6X A;  2BE7 D;  3L42 A;  2QTX A;  4YRE A;  2EQJ A;  1QF6 A;  1X2G A;  1ZUU A;  3RKX A;  2MPX C;  3MEV A;  4AFU C;  1YJW Q;  5FW9 A;  1OEB A;  4PG3 A;  4CC7 A;  3CCR A;  3CBM A;  4AG2 C;  1M2O A;  4YCV A;  2CRE A;  1AZG B;  1VA7 A;  2KK4 A;  5GAO p;  4RTV A;  1JU5 C;  3CCL A;  3D7S B;  4P71 A;  3NEM A;  3ZFJ A;  2RN8 A;  2ZPE B;  3VYG A;  2KI7 A;  3HY0 A;  2LX9 A;  1NYQ A;  2ZZG A;  1M4Z A;  1NE8 A;  2Z0W A;  5GAO q;  2XI9 A;  4PKC C;  1UGQ B;  3VJP A;  4PJO F;  2XID A;  1QQJ A;  1UE9 A;  3NFC A;  2RI2 A;  1BI3 A;  1E6G A;  3H41 A;  3FRN A;  4C0D B;  1YFT A;  4FYV B;  1X2K A;  2MAM A;  3CC4 Q;  3G4S Q;  3CCS A;  1YHQ Q;  2JNG A;  3CME A;  1USY C;  4LE9 A;  4JLI A;  2BKD N;  2ZR3 A;  4ORZ A;  3OYY A;  4FYW B;  4KR3 A;  1E24 A;  4HWP A;  2L89 A;  5L8R E;  1B3Q A;  5GMK m;  3VRZ A;  4YRM A;  2DL8 A;  3U23 A;  4XU3 A;  4PJO B;  3SDZ A;  5LJ3 d;  2ARU A;  1ASZ A;  5HY6 A;  5LJ5 h;  4H2Y A;  4CS4 A;  4ZTU B;  2ATC B;  1QKX A;  2XDP A;  2YHT A;  2Y4X A;  4P73 A;  2DO3 A;  1QVF S;  4KQE A;  5C53 B;  2X4W A;  2O2O A;  5GAN h;  1NJ1 A;  1SRL A;  1KJW A;  3EG1 A;  1WXU A;  2BZY A;  4J9F A;  1OV3 A;  2Q5H A;  1WI7 A;  2VXE A;  2EYX A;  4CS3 A;  4PJO A;  3DKM A;  1N6A A;  5GAN 4;  2C0T A;  3M0R A;  1S72 T;  3CPW A;  1VQ6 Q;  9ATC B;  2A08 A;  4J7I A;  5C52 B;  3MJX A;  4AH6 A;  3QII A;  5LJ3 f;  4JS4 A;  1RAG B;  4NL3 A;  1I5O B;  1TU0 B;  1G5H A;  1UGS B;  4F16 A;  4ZTZ B;  1VQL T;  1ABO A;  1G5I A;  3M5A A;  4XTW A;  1JJC B;  3UAT A;  2CSQ A;  2ZIO A;  3CXC S;  3EFS A;  4DEX A;  3S3M A;  1YN8 A;  2V8I A;  3NGP A;  3A8L B;  4OB2 B;  2QA4 T;  4X5O A;  2HCK A;  4JPB W;  2AKK A;  3OYI A;  1EIF A;  4YRN A;  2C7I A;  1W2B S;  3X20 B;  2JW4 A;  2LQW A;  3CC7 Q;  2EFI A;  1JJC A;  3BFM A;  2LVM A;  1VQ5 A;  3OYE A;  2ZT8 A;  1IHW A;  4XTU A;  1X6O A;  1ZUY A;  2QQS A;  2QGF B;  5M9O A;  4N4I A;  1X43 A;  2RHI A;  4A54 A;  3OS0 A;  4RTW A;  5EG2 A;  2KAF A;  2KY9 A;  5CVI A;  2K79 A;  3Q1J A;  2KR3 A;  1EOV A;  3M55 A;  2VGM A;  3P8T A;  1N9S A;  1WHH A;  2LTO A;  3NTK A;  1JQQ A;  4XTY A;  2DU7 A;  2VXF A;  2RQV A;  3N5B B;  4FU6 A;  3S3O A;  1HC7 A;  2RHX A;  3TCJ A;  1CKA A;  3M59 A;  2ZPG B;  2CP6 A;  2HKQ B;  1NPP A;  2E6N A;  1VQN Q;  2RJC A;  2EYZ A;  3OYM A;  1YP5 A;  1SF9 A;  2EGE A;  1FYN A;  3H6Z A;  4LXC A;  5LJ5 j;  4HCZ A;  4E7L A;  4PJO G;  1RAD B;  3JCM h;  2DTI A;  2ZPI B;  4AFQ C;  4VUB A;  5CKE A;  1R0B G;  2J05 A;  2PTK A;  2VC8 A;  3TUP A;  1KC8 R;  1BB9 A;  1BI0 A;  3RNJ A;  1IZ6 A;  2W10 A;  1M1K C;  2R58 A;  3ER0 A;  2YT6 A;  1QVG A;  4J9D A;  4A4K A;  3TVT A;  3CBP A;  4XTX A;  12AS A;  1ZQ1 A;  3EFR A;  3UGQ A;  4LVI A;  2EJG A;  4A4G A;  3MP8 A;  4PFZ A;  2Q7E A;  1OUL A;  1TUG B;  1NLP C;  3EHR A;  1KQS S;  4A4F A;  2ALY B;  1M1G A;  2KEA A;  4A53 A;  1YBY A;  1WIE A;  3LH0 A;  2XDD A;  1TSF A;  1S72 A;  3HXW A;  3A1P A;  5KCO A;  1TH7 A;  2ZR2 A;  2LX7 A;  5K1X A;  4CC2 A;  1OQK A;  3DLM A;  4Z88 A;  4C0G A;  2LMJ A;  2ALY A;  2RK2 A;  2DJQ A;  5KYX B;  4R0K A;  2F2V A;  4OF1 A;  1VQL A;  1QCN A;  4UP8 A;  2CT4 A;  4O6J A;  1RUW A;  5K1P A;  1KQ1 A;  2HKN A;  2W0Z A;  5I2S A;  5A2Q E;  2ROL A;  2P84 A;  2COY A;  1PSF A;  4P3O A;  2QA4 A;  2FEI A;  3IG2 A;  1PKT A;  4RDX A;  4C92 F;  1WHJ A;  5LJ5 g;  5KYX A;  2RH2 A;  2HSE B;  2P4R A;  3CCJ T;  1K9A A;  1KD1 C;  4WF2 A;  1P92 A;  2XDB A;  3G6E A;  1BBU A;  2XHC A;  4E7K A;  3OYC A;  2PME A;  2FZG B;  4DBQ A;  1B07 A;  4P74 C;  4J8O A;  1PC0 A;  1U06 A;  3V8J A;  5KYW B;  4DQ2 A;  4M75 E;  2DRK A;  1VQ4 A;  4F04 B;  1KC8 U;  2MI6 A;  1WQW A;  1UJ0 A;  4C92 B;  2DDZ A;  1H8K A;  1X55 A;  3MP1 A;  3UF4 A;  2DYI A;  3MEA A;  2OJ2 A;  1QWF A;  3P8H A;  1K4U S;  3M4P A;  5KYN A;  5KYW A;  4E2F B;  4AFS C;  4J9B A;  2RF0 A;  2MOX A;  4LNS A;  1NYR A;  4C92 A;  2FYK A;  2D0N A;  2CIM A;  1UEC A;  3VUB A;  3PT9 A;  1BK2 A;  1YJ9 Q;  1G3W A;  3KFV A;  3L2Z A;  2LQK A;  1NJI C;  4J9H A;  3IAL A;  1HYO A;  4NL2 A;  1H4Q A;  5C0M A;  2VYT A;  4FL6 A;  3NTH A;  3NMZ C;  4JS5 A;  2KYB A;  1K8A R;  3QWX X;  4M78 C;  3CCM T;  1LJO A;  4HWS A;  1SG5 A;  2NYS A;  3O8V A;  1G3Y A;  4EDU A;  4M7D F;  3INZ A;  3OS2 A;  3PIP A;  2E64 A;  1S1N A;  3DLL A;  4H2W A;  2FZC B;  1N27 A;  2RHS B;  2QDL A;  1M1F A;  2L2P A;  3HKS A;  4LDV A;  3A8M B;  1KMM A;  1WA7 A;  3QSU A;  1LNX A;  1K0S A;  3WVD B;  1WYX A;  3MF2 A;  2OAW A;  4BY6 B;  1GXI E;  1Y71 A;  2HZY A;  2QEX T;  2RHS A;  4PJO D;  2D9T A;  3JCM g;  4ESR A;  4M7D B;  1IB8 A;  3LW5 E;  2DL3 A;  4IUU A;  1D3B B;  2LP5 A;  3QPH A;  4ELY C;  1LYL A;  2M0O A;  2E3I A;  2LJ0 A;  3CCJ A;  1KHC A;  3OSV A;  2AKW B;  1EZZ B;  4IUT A;  4ZNX A;  3V7R A;  1NLO C;  1NYF A;  1YI2 Q;  3HFO A;  5CAI A;  1KOG A;  3CCQ T;  2LT4 A;  4M7D A;  4UP7 A;  1D3B A;  3M0Q A;  4L59 A;  3GLX A;  1X01 A;  2L5Q A;  4E47 A;  4E7Z A;  3UFG A;  2AKW A;  5FLX E;  4C92 G;  1VQO Q;  2K5I A;  4FSX A;  1WHK A;  3BDL A;  1YCY A;  3FC3 A;  3M53 A;  1NEB A;  4C8Q F;  4IUP A;  4II1 A;  2CH4 A;  2EGA A;  1VQZ A;  2Q7H A;  2JJ9 A;  1ZX6 A;  2HMA A;  3RBB B;  1HJD A;  1M3A A;  3PMI A;  4OMQ A;  1K8A U;  1RAB B;  1EQR A;  2CP7 A;  4TVW A;  4HXJ A;  2P5I A;  1Q86 C;  3CCE T;  2G4C A;  2G6F X;  4RTU A;  2J3M A;  4E51 A;  3VQV A;  2I4N A;  3A5Z B;  3OW2 A;  3CPF A;  3MHX A;  3CD6 Q;  1EFN A;  2CP2 A;  2EW3 A;  2E41 A;  1PRM C;  1WGS A;  1V1C A;  4KH0 B;  4GLK A;  3CMQ A;  1FXX A;  1VOM A;  5IN1 A;  2F5T X;  3HXY A;  3CCV Q;  5CKF A;  4H2U A;  1PKS A;  2RI3 A;  2EQI A;  2VV5 A;  3V7C A;  1C1A A;  3A5Z A;  2VGN A;  1FMK A;  1UJY A;  1ZBX A;  4OB1 B;  4M77 F;  2RMO A;  4V2S A;  3JRZ A;  2M16 A;  4GBQ A;  3S6W A;  4CRI A;  5GMK h;  2DIL A;  2EL9 A;  4YRG A;  5CQX A;  3JAM E;  4NS5 A;  1X54 A;  2CH4 W;  3J80 E;  2QHU A;  4C0D C;  2ED1 A;  4M7D G;  5E3I A;  2P0L A;  2JTF A;  3PCO B;  2HQH A;  4P75 C;  1QLY A;  2A28 A;  1Z9Q A;  4MZT A;  3CCR T;  1Z7N A;  1R8O B;  5ELO A;  4P73 C;  4M77 B;  4DBR A;  5LJ5 e;  1C0M A;  2HD0 A;  1VQN A;  3HXV A;  3WQZ A;  1Z9Z A;  4E7S A;  3PCO A;  3CCQ A;  1M3C A;  4R56 A;  1TXQ A;  5GMK i;  5ECA A;  3CMA T;  2CZ7 B;  4Q15 A;  1UB4 A;  3I5S A;  3BE3 A;  3LSQ A;  2DF6 A;  1QP3 A;  2QI2 A;  2DMO A;  1VQM T;  4M77 A;  3PIO A;  3EFO B;  1JJ2 A;  1T0J A;  2J6K A;  5IXF A;  3TEG A;  3P8Y A;  3OYD A;  2ZGW A;  4B9X A;  3URG A;  2DJZ A;  1D0X A;  3HXU A;  3LX7 A;  2LNH B;  3CCS T;  3CQT A;  3VRY A;  3G71 Q;  2DQ3 A;  5J26 A;  4E7H A;  3EFO A;  2K2V A;  3EG0 A;  3DB4 A;  5IT9 E;  1BKB A;  3JB9 I;  2KSS A;  2DK3 A;  4KT0 E;  1JBM A;  5FWC A;  3ZEH A;  1L0W A;  3HXX A;  2F5K A;  1TUD A;  3VBB A;  3NHN A;  5HGQ A;  2ART A;  1RAI B;  2V1Q A;  4C8Q G;  4OMF B;  5EC7 A;  2K6D A;  4JJC A;  3I55 T;  1VQP T;  3RIR A;  1XOV A;  2HQX A;  4BE2 A;  1W66 A;  4YYE A;  4OMM A;  2DAQ A;  1XNI A;  1JO8 A;  3QO5 A;  3A5Y A;  5DLO A;  1VQK A;  3FJ5 A;  5GAM d;  3QJ6 A;  1ZSG A;  1YFS A;  2EKH A;  2XGT A;  2LT1 A;  1GL5 A;  2LCL A;  5GAO m;  4K88 A;  2YUQ A;  1G5V A;  4X34 A;  1YB3 A;  3E9I A;  4C92 D;  2OTJ Q;  2HBW A;  1PHT A;  3CCU Q;  4D6W A;  1OU8 A;  4JZ3 A;  3H0H A;  3P8B B;  5CKH A;  2HEQ A;  2LJ1 A;  3ASK A;  2DPP B;  3PMT A;  4YRJ A;  1G2B A;  2J6F A;  1BI2 A;  3M4Q A;  1WHL A;  1ZSZ B;  1D0Z A;  4M77 G;  3JCM e;  5IHK A;  1WXB A;  3JCM W;  2J3L A;  4ZGD B;  2VKN A;  5A0G A;  4O5V A;  2CP0 A;  3GBQ A;  5GAM f;  3OY9 A;  1VIF A;  1GGM A;  2ZIM A;  2DVJ A;  4QVZ A;  2JVV A;  2M0Y A;  1ZLM A;  2E5Q A;  1Q7Y R;  2X3W D;  4IIM A;  2JMC A;  1ZSZ A;  5I22 A;  5J39 A;  3CMA A;  3CPW P;  1UGV A;  3RDV A;  3MPU B;  4FCY A;  1VQ5 T;  4QKU A;  4HWR A;  1LOJ A;  2DM1 A;  1VQM A;  1AWW A;  2X35 A;  1VQ9 T;  5GAO n;  2EKO A;  2H3E B;  4RQF A;  4DOV A;  2PU9 B;  3V8K A;  1XJW B;  1NG2 A;  2CZ1 B;  2DA9 A;  1N8R R;  4BD3 A;  4CH6 A;  1Y57 A;  4YRK A;  3A7A A;  5IH2 A;  1IHV A;  2DXU A;  4DEY A;  1GBR A;  2MWO A;  1AHJ B;  1B34 B;  3OMC A;  4PJO E;  4MML A;  4M7D D;  2A0F B;  2ZPB B;  2E4H A;  1PRL C;  2JS2 A;  3FLG A;  3QZ9 B;  2IPO B;  4EO4 A;  2DFU A;  2L3S A;  4H2X B;  4IUV A;  2RHU A;  1VQ8 T;  2RK1 A;  1OPL A;  4C0Z A;  4H2V A;  2QAS A;  2DL5 A;  3I5R A;  4B6M A;  3I55 A;  1T3S A;  1VQP A;  1B34 A;  1XQH A;  1ZHI A;  1SET A;  3SWN B;  1JXO A;  3HPW A;  1NJ5 A;  4D8D A;  1SRY A;  3VS5 A;  5KE2 A;  4FW1 A;  4O2D A;  4H2X A;  2VUB A;  3I56 Q;  1PM3 A;  2QQB A;  1VQ7 Q;  5KYY B;  2E65 A;  1K9M R;  2HL5 C;  4A4H A;  4LVJ A;  4OB3 B;  2O9S A;  1UHC A;  5I2M A;  3SWN A;  2F1L A;  1X69 A;  3QBY A;  5C6S A;  4FM4 B;  3O5Z A;  4N0A C;  2NS6 A;  2CUD A;  4MZM A;  1Q7Y U;  5GAM h;  2A7Y A;  5KYY A;  1NM7 A;  2RHZ A;  1QVG P;  2A37 A;  2DXB A;  4X9C A;  1B7Y B;  1EIY B;  2A3L A;  4JRP A;  4PNO A;  3L2U A;  3EGX B;  4G84 A;  2RPN A;  1XTD A;  1JRI A;  4M75 C;  3X24 B;  4XEO A;  2E3C A;  2K3B A;  1KSW A;  2AZV A;  2ZXF A;  1TS9 A;  4XAX B;  2J6O A;  4BI8 B;  1N8R U;  4PL6 A;  1KG1 A;  2JTE A;  4Z8A A;  4C8Q D;  2EPD A;  1U3O A;  2KNB B;  2KT8 A;  4RTZ A;  1B7Y A;  4RG2 A;  1E1O A;  3TQ7 P;  3CCM Q;  3REU A;  1EIY A;  3EGX A;  4RQE A;  1X2Q A;  3G6E T;  2P0Q A;  4M7A F;  2HQE A;  1HD3 A;  1VQ9 A;  2FHD A;  4FSS A;  1C6V X;  2KRS A;  1Q81 R;  3JB9 F;  2M9U A;  3SD4 A;  2RHQ B;  1AVZ C;  1VQ4 T;  1W1F A;  2MIO A;  1MGQ A;  1OI1 A;  1BCM A;  2Q5I A;  3LYI A;  4MMK A;  5AYF A;  2OTL Q;  2YDL A;  4L6V 5;  2QEX Q;  1UTI A;  4TQF A;  4EMK B;  3KBG A;  4HA8 A;  3OQ5 A;  4M7A B;  3CC2 Q;  2RHQ A;  1H4T A;  5F5W A;  4OVA A;  1I07 A;  2FRY A;  1K9M U;  3QO7 A;  4M77 D;  2DEQ A;  5GAN j;  1VQ8 A;  4BY6 C;  1BIA A;  2DX1 A;  4UPA A;  1AOJ A;  4X1V A;  1OX9 A;  3OS1 A;  2KT1 A;  4JRQ A;  1YIT T;  4EPC A;  4EMK A;  1VYU A;  4JJD A;  4BI4 A;  4BE0 A;  3RR6 A;  4GLM A;  2DE0 X;  2YRD A;  4C5H A;  1X2H A;  4M7A A;  4FT2 A;  3JCM V;  4RMF A;  4B9W A;  2GTJ A;  3RMQ A;  5I11 A;  1SSF A;  4BE1 A;  2DU5 A;  2XTI A;  1YJW T;  5LJ3 h;  2JT4 A;  4IUQ A;  3T9N A;  2DIQ A;  2LCS A;  4XU0 A;  2K4Y A;  3R6N A;  3LWI A;  2QQ9 A;  1UGR B;  1X6B A;  1K9M C;  4RG8 A;  2JUF A;  2I0N A;  2YXY A;  3LLR A;  3FEO A;  2EJF A;  2ODR D;  1MV0 B;  2EQK A;  2KDS A;  3FIF A;  2M51 A;  1ZBJ A;  2YLC A;  1WQ7 A;  4KGV B;  3CCE Q;  3RAC A;  2X4Y A;  3QDR B;  2EQM A;  1RIQ A;  1ASY A;  3I35 A;  4QW2 A;  4XU2 A;  2YRC A;  1Q81 U;  2DXT A;  4XTZ A;  5CQY A;  4OMO A;  3CC4 T;  1H4S A;  5CR2 A;  3G4S T;  1TWB A;  1YHQ T;  1WYD A;  2AKL A;  3QKJ A;  3GPL A;  2CGH A;  1USY A;  1OYX A;  1M3B A;  1JB0 E;  3REX A;  3KFU A;  4TVR A;  1V76 A;  5GAN g;  1M8V A;  2QGG A;  1EFW A;  4J15 A;  3PE0 A;  1B70 B;  2B86 A;  2CP5 A;  1OZ2 A;  2O88 A;  1UDL A;  5GAN 3;  5DY9 A;  2ZZD A;  4C92 E;  1V29 B;  3NPF A;  4NCX A;  2FL7 A;  5GAN 5;  1NJ8 A;  1QWE A;  4ZIB A;  1YIJ Q;  1WDX A;  2PQW A;  4P3N A;  3HRU A;  2RNA A;  4OGC A;  2WAC A;  1YWO A;  3ZL7 C;  2XU8 A;  4M7A G;  1JXM A;  3PFS A;  1YJN Q;  1K0X A;  4XK8 E;  4C5E A;  3C94 A;  3PNW C;  4HT9 A;  3JB9 G;  2DEU A;  4YRC A;  2ED0 A;  3OBY A;  2CSI A;  2O4X B;  3CCR Q;  4ZTJ A;  3L4G B;  3HFZ B;  5GAN 8;  1GCP A;  4XU1 A;  1YIT A;  2AZS A;  5FRO A;  1VQ6 T;  3E19 A;  2LZ6 B;  2AIR B;  3CCL Q;  4HVC A;  3TU4 K;  3VS1 A;  5LJ3 j;  2K5L A;  3A98 A;  4LVM A;  4PFP A;  4WCI A;  1KC8 C;  2B8A A;  3LWH A;  3HXZ A;  2O4X A;  4WI1 A;  5KE3 A;  3X26 B;  3L4G A;  3HFZ A;  1YJW A;  3VS7 A;  4JRK A;  1UG1 A;  1YNZ A;  5D6W A;  4JLG A;  4RCB A;  4TTV A;  4LDY A;  1HTT A;  3BDU A;  3EAE A;  5D6X A;  3AHU A;  4TQD A;  4P72 C;  3CCS Q;  2KBT A;  3QO3 A;  3CME Q;  2NWM A;  1LPL A;  1ZUK A;  5GMK l;  5KNN A;  4Z02 A;  2E6Z A;  2XK0 A;  4ZN3 A;  1M90 R;  3CC7 T;  4PK4 A;  4Q5W A;  3VUZ A;  4M7D E;  3OW2 P;  2Y90 A;  4YRR A;  3HFV A;  1N9R A;  1TUC A;  1G3S A;  2RQW A;  3UPU A;  2K5F A;  4AMC A;  2BE9 B;  1BBZ A;  1OZ3 A;  4D8K A;  4LD9 K;  2D0Q B;  3CC4 A;  3G4S A;  1YHQ A;  3M0P A;  3TEE A;  2KE9 A;  4J6Y A;  3M4Y A;  1E1T A;  1VQN T;  4OML A;  1M5Q 1;  1QVF A;  3E9H A;  2DXC A;  1H64 1;  4H2T A;  1G51 A;  1PWT A;  1KHI A;  4J9E A;  5FU7 C;  1WZO A;  4MDW A;  3P8V A;  4HCK A;  1FWZ A;  3RKW A;  2PVO B;  5GAO r;  4J9I A;  4R55 A;  1IXD A;  5LJ3 g;  4KGX B;  2DET A;  5KH6 A;  2RJE A;  2GQI A;  4C5G A;  1AEY A;  3UA6 A;  4BAC A;  2OAU A;  4OB0 B;  2XIC A;  2FB7 A;  1QW1 A;  5GJV B; 
#chains in the Genus database with same CATH homology
 3LGL A;  2KQW A;  3WVE B;  2WSF E;  3MQZ A;  3CPW S;  1VQ6 A;  4P71 C;  4C8Q E;  4CS2 A;  2DVE A;  4L87 A;  3OYK A;  1W2B A;  4UC4 A;  4QVC A;  3J81 E;  3HP9 A;  1M90 U;  4C8Q B;  5HK0 A;  1VQK T;  2CS7 A;  4XEM A;  4OGE A;  3WXM B;  4CH3 A;  2CZ0 B;  1K8A C;  2PUO B;  1Y7X A;  3JCM J;  3C95 A;  4ELZ C;  4C8Q A;  3FDR A;  3JCM P;  3J7A F;  3CC7 A;  4H2S A;  3BY7 A;  3I7F A;  3OYA A;  4M7A D;  2ZPF B;  1N9W A;  3OS5 A;  3M9Q A;  4M77 E;  2K3Y A;  2ZTG A;  4YRT A;  4M78 F;  3JB9 D;  3QTC A;  3OYH A;  4P74 A;  3QXE B;  2AMC B;  2KMT A;  3JCM c;  4J5Y A;  4C5I A;  2L8D A;  3L2R A;  3TRE A;  2X4X A;  2OTL A;  4N4H A;  2K3X A;  2WSE E;  5GAN e;  2ZPH B;  4PJO C;  4X9D A;  1FYF A;  3MEW A;  2AMC A;  2EIF A;  3A8O B;  3CC2 A;  1KQS A;  3RMS A;  4ZGJ B;  2LRQ A;  5ELN A;  2GF7 A;  2CJB A;  3L1A A;  3MF1 A;  3M57 A;  1Y07 A;  4M78 B;  4ZN1 A;  1NZ9 A;  2QHT A;  4C0F A;  1QVG S;  2XKO C;  5FRM A;  4YRI A;  1YJ9 T;  2LC4 A;  1NJ6 A;  4LDU A;  2BIV A;  2DZC A;  3IKL A;  4HWT A;  4E7I A;  4F7U F;  4CH5 A;  3OMG A;  2E12 A;  2GFA A;  3JCM b;  4M78 A;  4P5N A;  3A7R A;  1RL2 A;  3OSS C;  1ADJ A;  3M4G A;  1U8R A;  3OD1 A;  3PZC A;  2DQ0 A;  5LJ5 d;  2DTH A;  2EWN A;  2RJD A;  5GMK j;  1WNL A;  2E10 A;  2K57 A;  5CK9 A;  2BUD A;  4JDS A;  2ZZE A;  2EYQ A;  5HKC A;  1WU7 A;  1C0A A;  3QO8 A;  2Q7G A;  3ZBD A;  4HCB A;  2EAY A;  4DPG A;  1YI2 T;  2HNI A;  3JB9 H;  2LQ8 A;  4LVL A;  3IKM B;  2ARS A;  5LJ5 f;  3ERR A;  4YRL A;  1G3T A;  3C4S A;  3ME9 A;  2IG0 A;  2CZ6 B;  3GF5 A;  4BWA A;  2C8M A;  1VQO T;  3QZ5 B;  2P0K A;  4KUL A;  2D6F A;  3L2Q A;  2QQA A;  1YJN A;  4E7J A;  3A7U A;  5GAN 6;  4M78 G;  2G3R A;  4J6W A;  1U1S A;  4MDX A;  3RGL A;  4BI3 A;  5LJ3 e;  4YRO A;  2JTM A;  1WJR A;  2CYZ B;  3OA6 A;  1YJ9 A;  3CD6 T;  2CKK A;  4YP0 A;  1I8F A;  2EJ9 A;  1PSE A;  3FB9 A;  4BB7 A;  4KUD K;  2FVU A;  1NNH A;  2H3J A;  3CCV T;  3QHS A;  1WLE A;  3F70 A;  1YGB A;  2E1H A;  3JCM d;  3OYG A;  3QNE A;  5CO7 A;  2ZIN A;  4RKU E;  1RI0 A;  3A8H B;  4F7U G;  1NJ2 A;  4EX5 A;  3GP8 A;  3MCA B;  3C12 A;  3VQX A;  4P75 A;  4JUV A;  4ZGE B;  2PUK B;  2YRV A;  3R07 A;  1YI2 A;  3JCM f;  3RKY A;  5KCH A;  3VV0 A;  3M56 A;  3PTA A;  3HRI A;  3HL8 A;  2EQU A;  2ZT7 A;  2I4O A;  4C92 C;  3OYL A;  2DKG A;  3OYF A;  1VQO A;  4Y91 A;  4QQD A;  3UDC A;  3JB9 J;  3QYH B;  1WPY A;  1FX7 A;  3MEU A;  1QP2 A;  1IRE B;  2P4T A;  2L3R A;  2Y4Y A;  3V8L A;  5DLQ E;  5D6Y A;  3G71 T;  4YRP A;  2V8J A;  3R6O A;  2CJA A;  2DD5 A;  2V8K A;  4L5G A;  2LDM A;  4K87 A;  3LC0 A;  1Q7Y C;  4TWA A;  4EMG A;  3OW2 S;  3QJY A;  4BW9 A;  3GIB A;  2A8E A;  3CD6 A;  5GAN 2;  1IL2 A;  3GOX A;  4RCC A;  4M7A E;  5FU6 B;  3V7S A;  4BDY A;  4TVA B;  4YDQ A;  1NPR A;  5CKB A;  3CCV A;  2NLU A;  1M1K U;  2CJ9 A;  4ME7 A;  1N8R C;  2X4J A;  2RI5 A;  3A32 A;  3GNG A;  4MZP A;  3X28 B;  3KXT A;  1J5W A;  2OTJ T;  3BW1 A;  4TVA A;  1DJ7 B;  2LNV A;  3CCU T;  2GCX A;  2QQR A;  3A8G B;  1B8A A;  4M7D C;  2E70 A;  3MET A;  2RO0 A;  1BBW A;  1YFR A;  4HKE A;  4M78 D;  3MEY A;  4YCW A;  3RF1 A;  2RHY A;  5GAM j;  3QUI A;  5I21 A;  4KR2 A;  4A4E A;  4HT4 A;  3X25 B;  2MF2 A;  3OBW A;  1BYM A;  3UGT A;  1O9S A;  3NET A;  3VYH B;  4Q6G A;  4Y28 E;  1QE0 A;  2ZNJ A;  4OLF A;  1JJ2 S;  1KD1 U;  4BDZ A;  3JCM Q;  1M9S A;  4PHC A;  4QVD A;  4UP9 A;  4YPF A;  2C06 A;  3G71 A;  1KMN A;  5GAO l;  1W4S A;  4LVK A;  3HFN A;  3P8D A;  4BUG A;  2IVW A;  1HK9 A;  3RES A;  1HXD A;  4C8Q C;  3NTI A;  4M75 F;  2JZ2 A;  5GMK e;  3G7Z A;  1Q81 C;  1ATI A;  2JN0 A;  2R5M A;  1B70 A;  4J83 A;  3FJP A;  2R57 A;  5GAM g;  4CI0 C;  4ATO A;  1EVL A;  4IKF A;  2QDY B;  3I56 T;  1NJI U;  2XG8 D;  2I4M A;  3UT1 A;  1VQ7 T;  4TVY A;  1MHN A;  2OTJ A;  3A31 A;  2RD1 A;  3CCU A;  3RL6 A;  5A0D A;  4M75 B;  2ZT5 A;  3H8Z A;  4QQ6 A;  3MP6 A;  4N0A A;  4LD6 A;  4M77 C;  5CKD A;  4PLL A;  4OP0 A;  4YRS A;  1EVK A;  3RUX A;  1B76 A;  2E5A A;  1KQ2 A;  4M75 A;  2QXF A;  5J3B A;  1VUB A;  1K73 U;  2F69 A;  2IY5 B;  4LDW A;  4EMH A;  3OYN A;  2DD4 A;  3HRT A;  3JCM X;  1O75 A;  3JSC A;  4LDX A;  1Q82 U;  4YRQ A;  2IY5 A;  2WSC E;  2ODR C;  2RJF A;  2ZCF B;  3E9G A;  2OTL T;  3E1S A;  4N4G A;  1K73 C;  2P0P A;  3G1Z A;  4DOW A;  1PYS B;  4NOY A;  4YTL A;  3CC2 T;  4WJ4 A;  4PLI A;  3VU3 C;  3QG1 A;  3UWN A;  2DTO A;  3PGG A;  11AS A;  3DSQ A;  2ZCE A;  4FIB A;  1Q86 U;  5LL6 S;  2ZZF A;  1Q82 C;  1PYS A;  2AHJ B;  1ADY A;  3OYB A;  3HTZ A;  3I56 A;  2JOY A;  1VQ7 A;  4RMO A;  4WJ3 M;  3KUF A;  3M58 A;  2RB6 A;  3CXC A;  4GY5 A;  2GFU A;  4HWO A;  4M75 G;  2DZ9 A;  4XQ3 A;  4JJN K;  1Z7M A;  4HT8 A;  5HK3 A;  3S3N A;  1H4V B;  1BIB A;  2LCC A;  2M1H A;  2PVD B;  3RER A;  4JRI A;  2KVQ G;  3HRK A;  3MO8 A;  1I81 A;  3DB3 A;  2YLB A;  3HRS A;  1I4K 1;  3CCM A;  4YCU A;  3HY1 A;  4J7F A;  2QHV A;  1I5L A;  3CBO A;  3HSB A;  2ZT6 A;  1M90 C;  2ZNI A;  3E9F A;  1WJQ A;  1QVP A;  1YIJ T;  4K86 A;  4DA4 A;  2PVG B;  4QQG A;  2O01 E;  4H02 A;  1H3Z A;  2GQV A;  2QEX A;  5DM7 R;  2I4L A;  1YJN T;  4M78 E;  4G85 A;  3OYJ A;  3OB9 A;  4YRF A;  3TEH B;  3SWN C;  2RM4 A;  4KUI A;  3CCL T;  4FT4 A;  3LGF A;  3UH0 A;  5GAM e;  3TEH A;  1SER A;  2MWP A;  5A0L A;  3L2W A;  4CH4 A;  2QHS A;  1VIE A;  4KBM B;  2HAX A;  3VQW A;  5GAN 7;  3BJU A;  3HHT B;  3ICA A;  1U1T A;  4HCC A;  1X56 A;  2I2L A;  3SFM A;  4F7U E;  2DIG A;  3VQY A;  3CME T;  4P72 A;  3NEL A;  4IUR A;  3NEN A;  5GAN d;  3CCE A;  4F7U B;  5CIU A;  1BI1 A;  1X75 C;  4ZTF A;  3CEY A;  2HBP A;  5FU7 B;  5C51 B;  3L2V A;  3M54 A;  5IAY A;  2XD0 A;  3VKI A;  3A74 A;  4F7U A;  3SB2 A;  4XTV A;  3QYG B;  1Y96 B;  2PMF A;  1UEB A;  1E22 A;  1SES A;  1WJS A;  3W3S A;  5CCA A;  5FU6 C;  5GAN f;  1UGP B;  2MMP A;  1YIJ A;  4EMK C;  4M75 D;  5FRN A;  2R5A A;  3LSS A;  1Y96 A;  4M7A C;  3GNF B;  2RA2 A;  4P3P A;  4J6X A;  3L42 A;  2QTX A;  4YRE A;  2EQJ A;  1QF6 A;  1X2G A;  3RKX A;  3MEV A;  4PG3 A;  3CCR A;  3CBM A;  4YCV A;  2KK4 A;  5GAO p;  3CCL A;  4P71 A;  3NEM A;  3ZFJ A;  2ZPE B;  3VYG A;  3HY0 A;  2LX9 A;  1NYQ A;  2ZZG A;  1M4Z A;  1NE8 A;  5GAO q;  2XI9 A;  4PKC C;  1UGQ B;  3VJP A;  4PJO F;  2XID A;  3NFC A;  2RI2 A;  1BI3 A;  3FRN A;  4C0D B;  1YFT A;  2MAM A;  3CCS A;  2JNG A;  3CME A;  1USY C;  4JLI A;  2BKD N;  2ZR3 A;  3OYY A;  4KR3 A;  1E24 A;  4HWP A;  2L89 A;  5L8R E;  5GMK m;  4YRM A;  4XU3 A;  4PJO B;  3SDZ A;  5LJ3 d;  2ARU A;  1ASZ A;  5HY6 A;  5LJ5 h;  4H2Y A;  4CS4 A;  4ZTU B;  2XDP A;  2YHT A;  2Y4X A;  4P73 A;  2DO3 A;  1QVF S;  4KQE A;  5C53 B;  2X4W A;  5GAN h;  1NJ1 A;  2Q5H A;  2VXE A;  4CS3 A;  4PJO A;  3DKM A;  1N6A A;  5GAN 4;  1S72 T;  3CPW A;  4J7I A;  5C52 B;  4AH6 A;  3QII A;  5LJ3 f;  4JS4 A;  4NL3 A;  1G5H A;  1UGS B;  4ZTZ B;  1VQL T;  1G5I A;  3M5A A;  4XTW A;  1JJC B;  2ZIO A;  3CXC S;  3EFS A;  3S3M A;  2V8I A;  3A8L B;  4OB2 B;  2QA4 T;  4X5O A;  3OYI A;  1EIF A;  4YRN A;  2C7I A;  1W2B S;  3X20 B;  2EFI A;  1JJC A;  3BFM A;  2LVM A;  1VQ5 A;  3OYE A;  2ZT8 A;  4XTU A;  1X6O A;  2QQS A;  5M9O A;  4N4I A;  2RHI A;  4A54 A;  3OS0 A;  5EG2 A;  2KAF A;  2KY9 A;  5CVI A;  3Q1J A;  1EOV A;  3M55 A;  2VGM A;  3P8T A;  1N9S A;  4XTY A;  2LTO A;  3NTK A;  2DU7 A;  2VXF A;  3N5B B;  4FU6 A;  3S3O A;  1HC7 A;  2RHX A;  3TCJ A;  3M59 A;  2ZPG B;  1NPP A;  2E6N A;  2RJC A;  3OYM A;  3H6Z A;  5LJ5 j;  4HCZ A;  4E7L A;  4PJO G;  3JCM h;  2DTI A;  2ZPI B;  4VUB A;  5CKE A;  2VC8 A;  3TUP A;  1BI0 A;  1IZ6 A;  1M1K C;  2R58 A;  3ER0 A;  1QVG A;  4A4K A;  3CBP A;  4XTX A;  12AS A;  1ZQ1 A;  3EFR A;  3UGQ A;  4LVI A;  2EJG A;  4A4G A;  3MP8 A;  2Q7E A;  1KQS S;  4A4F A;  2ALY B;  1M1G A;  4A53 A;  1YBY A;  3LH0 A;  2XDD A;  1S72 A;  3HXW A;  5KCO A;  1TH7 A;  2ZR2 A;  5K1X A;  3DLM A;  4C0G A;  2ALY A;  2RK2 A;  1VQL A;  4UP8 A;  4OF1 A;  4O6J A;  5K1P A;  1KQ1 A;  5I2S A;  5A2Q E;  1PSF A;  4P3O A;  2QA4 A;  3IG2 A;  4RDX A;  4C92 F;  5LJ5 g;  2RH2 A;  3CCJ T;  1KD1 C;  4WF2 A;  1P92 A;  2XDB A;  3G6E A;  1BBU A;  2XHC A;  4E7K A;  3OYC A;  2PME A;  4P74 C;  4J8O A;  3V8J A;  4DQ2 A;  4M75 E;  1VQ4 A;  1KC8 U;  2MI6 A;  1WQW A;  4C92 B;  2DDZ A;  1X55 A;  3MP1 A;  3MEA A;  3P8H A;  3M4P A;  4LNS A;  1NYR A;  4C92 A;  2FYK A;  2CIM A;  3VUB A;  3PT9 A;  1G3W A;  3L2Z A;  2LQK A;  1NJI C;  3IAL A;  4NL2 A;  1H4Q A;  5C0M A;  2VYT A;  4FL6 A;  3NTH A;  4JS5 A;  4M78 C;  3CCM T;  1LJO A;  4HWS A;  3O8V A;  1G3Y A;  4EDU A;  4M7D F;  3INZ A;  3OS2 A;  3PIP A;  2E64 A;  3DLL A;  4H2W A;  1N27 A;  2RHS B;  3HKS A;  1M1F A;  4LDV A;  3A8M B;  1KMM A;  3QSU A;  1LNX A;  3WVD B;  3MF2 A;  4BY6 B;  1GXI E;  1Y71 A;  2QEX T;  2RHS A;  4PJO D;  2D9T A;  3JCM g;  4M7D B;  3LW5 E;  4IUU A;  1D3B B;  3QPH A;  4ELY C;  1LYL A;  2M0O A;  3CCJ A;  1KHC A;  3OSV A;  2AKW B;  4IUT A;  3V7R A;  3HFO A;  5CAI A;  1KOG A;  3CCQ T;  2LT4 A;  4M7D A;  4UP7 A;  1D3B A;  4L59 A;  3GLX A;  1X01 A;  2L5Q A;  4E47 A;  3UFG A;  2AKW A;  5FLX E;  4C92 G;  2K5I A;  4FSX A;  3BDL A;  3FC3 A;  1YCY A;  3M53 A;  4C8Q F;  4IUP A;  4II1 A;  1VQZ A;  2Q7H A;  3PMI A;  1K8A U;  4TVW A;  1EQR A;  2P5I A;  1Q86 C;  3CCE T;  2G4C A;  2J3M A;  4E51 A;  3VQV A;  2I4N A;  3A5Z B;  3OW2 A;  3CPF A;  3MHX A;  2E41 A;  1WGS A;  4GLK A;  3CMQ A;  1FXX A;  5IN1 A;  2F5T X;  3HXY A;  5CKF A;  4H2U A;  2RI3 A;  2VV5 A;  3V7C A;  3A5Z A;  2VGN A;  1ZBX A;  4OB1 B;  4M77 F;  4V2S A;  3JRZ A;  2M16 A;  3S6W A;  4CRI A;  5GMK h;  2EL9 A;  4YRG A;  5CQX A;  3JAM E;  4NS5 A;  1X54 A;  3J80 E;  2QHU A;  4C0D C;  4M7D G;  5E3I A;  2P0L A;  2JTF A;  3PCO B;  4P75 C;  4MZT A;  3CCR T;  1Z7N A;  1R8O B;  5ELO A;  4P73 C;  4M77 B;  5LJ5 e;  2HD0 A;  1VQN A;  3HXV A;  3WQZ A;  3PCO A;  3CCQ A;  4R56 A;  5GMK i;  3CMA T;  2CZ7 B;  4Q15 A;  1UB4 A;  3LSQ A;  1QP3 A;  2QI2 A;  1VQM T;  4M77 A;  3PIO A;  1JJ2 A;  3TEG A;  3P8Y A;  3OYD A;  2ZGW A;  4B9X A;  3URG A;  2DJZ A;  3HXU A;  3LX7 A;  3CCS T;  2DQ3 A;  5J26 A;  4E7H A;  2K2V A;  3DB4 A;  5IT9 E;  1BKB A;  3JB9 I;  2KSS A;  2DK3 A;  4KT0 E;  1JBM A;  3ZEH A;  1L0W A;  3HXX A;  2F5K A;  3VBB A;  5HGQ A;  2ART A;  4C8Q G;  4OMF B;  3I55 T;  1VQP T;  3RIR A;  1XOV A;  2HQX A;  4BE2 A;  1W66 A;  4YYE A;  2DAQ A;  1XNI A;  3QO5 A;  3A5Y A;  5DLO A;  1VQK A;  5GAM d;  3QJ6 A;  1YFS A;  2XGT A;  2LT1 A;  2LCL A;  5GAO m;  4K88 A;  1G5V A;  4X34 A;  1YB3 A;  3E9I A;  4C92 D;  4D6W A;  3P8B B;  5CKH A;  3ASK A;  2DPP B;  3PMT A;  4YRJ A;  1BI2 A;  3M4Q A;  4M77 G;  3JCM e;  3JCM W;  2J3L A;  4ZGD B;  5A0G A;  4O5V A;  5GAM f;  3OY9 A;  1VIF A;  1GGM A;  2ZIM A;  4QVZ A;  2JVV A;  2E5Q A;  5J39 A;  3CMA A;  1VQ5 T;  4HWR A;  1LOJ A;  1VQM A;  2X35 A;  1VQ9 T;  5GAO n;  2EKO A;  4RQF A;  4DOV A;  2PU9 B;  3V8K A;  2CZ1 B;  4BD3 A;  4CH6 A;  4YRK A;  3A7A A;  2DXU A;  2MWO A;  1AHJ B;  1B34 B;  3OMC A;  4PJO E;  4MML A;  4M7D D;  2ZPB B;  3FLG A;  3QZ9 B;  4EO4 A;  4H2X B;  4IUV A;  2RHU A;  1VQ8 T;  2RK1 A;  4C0Z A;  4H2V A;  3I55 A;  1VQP A;  1B34 A;  1XQH A;  1ZHI A;  1SET A;  3SWN B;  3HPW A;  1NJ5 A;  1SRY A;  5KE2 A;  4O2D A;  4H2X A;  2VUB A;  2QQB A;  2E65 A;  4A4H A;  4LVJ A;  4OB3 B;  5I2M A;  3SWN A;  3QBY A;  5C6S A;  4FM4 B;  4N0A C;  2NS6 A;  4MZM A;  1Q7Y U;  5GAM h;  2A7Y A;  2RHZ A;  2DXB A;  4X9C A;  1B7Y B;  1EIY B;  2A3L A;  4JRP A;  4PNO A;  3L2U A;  4G84 A;  1XTD A;  1JRI A;  4M75 C;  3X24 B;  4XEO A;  2E3C A;  2ZXF A;  4XAX B;  4BI8 B;  1N8R U;  4PL6 A;  1KG1 A;  4C8Q D;  1B7Y A;  4RG2 A;  1E1O A;  3REU A;  1EIY A;  4RQE A;  3G6E T;  2P0Q A;  4M7A F;  2HQE A;  1VQ9 A;  2FHD A;  3JB9 F;  2M9U A;  3SD4 A;  2RHQ B;  1VQ4 T;  1MGQ A;  1OI1 A;  2Q5I A;  3LYI A;  4MMK A;  5AYF A;  4L6V 5;  4TQF A;  4EMK B;  3KBG A;  4HA8 A;  3OQ5 A;  2RHQ A;  4M7A B;  5F5W A;  1H4T A;  4OVA A;  1K9M U;  3QO7 A;  4M77 D;  2DEQ A;  5GAN j;  1VQ8 A;  4BY6 C;  1BIA A;  4UPA A;  3OS1 A;  4JRQ A;  1YIT T;  4EPC A;  4EMK A;  4BI4 A;  4BE0 A;  4C5H A;  1X2H A;  4M7A A;  4FT2 A;  3JCM V;  4RMF A;  4B9W A;  3RMQ A;  1SSF A;  4BE1 A;  2DU5 A;  2XTI A;  1YJW T;  5LJ3 h;  4IUQ A;  3T9N A;  2DIQ A;  4XU0 A;  2K4Y A;  3LWI A;  2QQ9 A;  1UGR B;  1K9M C;  4RG8 A;  2JUF A;  3LLR A;  3FEO A;  2EJF A;  2ODR D;  2EQK A;  2KDS A;  3FIF A;  2YLC A;  1WQ7 A;  3RAC A;  2X4Y A;  3QDR B;  2EQM A;  1RIQ A;  1ASY A;  4QW2 A;  4XU2 A;  1Q81 U;  2DXT A;  4XTZ A;  5CQY A;  3CC4 T;  1H4S A;  5CR2 A;  3G4S T;  1YHQ T;  1WYD A;  3QKJ A;  3GPL A;  2CGH A;  1USY A;  1OYX A;  3KFU A;  1JB0 E;  3REX A;  4TVR A;  5GAN g;  1M8V A;  1EFW A;  4J15 A;  1B70 B;  1OZ2 A;  5GAN 3;  5DY9 A;  2ZZD A;  4C92 E;  1V29 B;  4NCX A;  2FL7 A;  5GAN 5;  1NJ8 A;  4ZIB A;  2PQW A;  4P3N A;  3HRU A;  4OGC A;  2WAC A;  2XU8 A;  4M7A G;  3PFS A;  4XK8 E;  4C5E A;  3C94 A;  3PNW C;  4HT9 A;  3JB9 G;  4YRC A;  3OBY A;  2O4X B;  4ZTJ A;  3L4G B;  3HFZ B;  5GAN 8;  4XU1 A;  1YIT A;  5FRO A;  1VQ6 T;  3E19 A;  4HVC A;  3TU4 K;  5LJ3 j;  2K5L A;  4LVM A;  1KC8 C;  2B8A A;  3LWH A;  3HXZ A;  2O4X A;  4WI1 A;  5KE3 A;  3X26 B;  3L4G A;  3HFZ A;  1YJW A;  4JRK A;  5D6W A;  4JLG A;  4RCB A;  4TTV A;  4LDY A;  1HTT A;  3BDU A;  3EAE A;  5D6X A;  3AHU A;  4TQD A;  4P72 C;  3QO3 A;  5GMK l;  5KNN A;  4Z02 A;  4ZN3 A;  2E6Z A;  2XK0 A;  3CC7 T;  4M7D E;  3VUZ A;  4Q5W A;  2Y90 A;  4YRR A;  3HFV A;  1N9R A;  1G3S A;  3UPU A;  2K5F A;  1OZ3 A;  4LD9 K;  2D0Q B;  3CC4 A;  3G4S A;  1YHQ A;  3TEE A;  4J6Y A;  3M4Y A;  1E1T A;  1VQN T;  1M5Q 1;  1QVF A;  3E9H A;  2DXC A;  1H64 1;  4H2T A;  1G51 A;  1KHI A;  5FU7 C;  4MDW A;  3P8V A;  1FWZ A;  3RKW A;  2PVO B;  5GAO r;  4R55 A;  5LJ3 g;  5KH6 A;  2RJE A;  4C5G A;  4BAC A;  2OAU A;  4OB0 B;  2XIC A;  2FB7 A;  1QW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...