2DEQA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111g mutation
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKGIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 70
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2deqA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2deqA01
3VQXA 2C7IA 5GAOq 3A7AA 3OD1A 1B34A 4RCCA 3QNEA 3IG2A 3QO3A 5K1XA 4M77C 1H4SA 1E1TA 1VQZA 4PJOD 1D3BB 4C92D 4M75D 3HXYA 4DPGA 2ARSA 3BJUA 4HWSA 1X54A 3SWNB 4YCUA 3QO5A 3RKWA 4YRFA 5GAMd 1B8AA 2ZZFA 3DSQA 3TEHA 1Z7MA 5LJ3j 1RIQA 4NOYA 4YRTA 4XTZA 5C51B 2I4OA 1B7YB 4XEOA 1KOGA 3ERRA 3W3SA 3GIBA 4YRCA 1PYSB 2E5AA 3JCMJ 2RB6A 1YFTA 4XU3A 3BDUA 3QO8A 3HRIA 2ZZGA 4M78D 4F7UA 1WYDA 2ZR2A 3I7FA 2Q7HA 4M77A 2J3LA 4V2SA 5GMKm 1ATIA 3P8YA 5C52B 2I4LA 3TEHB 5GANf 1WLEA 3NEMA 4H2YA 3BFMA 3VQYA 5GAN5 4F7UE 4M77E 2XGTA 2DZCA 1YGBA 3MEYA 2ZNJA 2ZTGA 3QSUA 3IKLA 3V7RA 4ZTUB 2ZT6A 3KFUA 4M7AF 2ODRC 2EWNA 5LJ3e 1WNLA 1NYRA 1ASYA 4M7AB 1X2HA 1WPYA 2Q5HA 4HVCA 4G85A 3JB9H 3WQZA 1H4VB 1I8FA 4F7UB 1HTTA 1G5HA 3P8VA 3R07A 4C8QC 4KR2A 4P74A 1KMMA 5GANg 1SETA 4KR3A 2QHUA 1X2GA 2J3MA 2E3CA 4PJOF 4C92F 3MF2A 4YP0A 4M75F 1EIYA 2YLBA 1Z7NA 3QUIA 4J6YA 3HSBA 4CS3A 1LNXA 5LJ5j 2QHSA 3HFOA 4F7UG 4M7DB 2FB7A 2E41A 4M77G 4RCBA 4BW9A 2EJGA 3A5YA 3MF1A 2CIMA 2P5IA 2I2LA 2Q5IA 1KQ2A 4JLIA 2EAYA 4X5OA 1H4QA 2DU5A 4CH4A 4H2TA 2DTIA 1NJ5A 2EL9A 3PCOB 4CH3A 2RHSA 1L0WA 5LJ3d 5I21A 2DXTA 2AKWB 2DKGA 3HY0A 4H2SA 4EMHA 4JUVA 1QE0A 4JRKA 4RQEA 5GAOr 1JJCA 4C8QA 2DDZA 1E1OA 2ZNIA 3NETA 3L4GA 4M78F 4YPFA 3LC0A 4XTXA 1EQRA 4JRIA 3UFGA 1BIAA 4C8QE 2IY5B 1SESA 2FYKA 3A5ZA 3M4GA 3HXUA 4Y91A 4EMGA 4M77D 2PMFA 2HNIA 5GAOm 4OP0A 1B70A 1WQ7A 5CAIA 5LJ5e 1YFSA 2DXUA 4HWRA 3RIRA 4WF2A 2E64A 4TVWA 1HC7A 2ZIMA 2ZT8A 5GANj 4M7DD 2ZT7A 2RHQA 2DQ0A 3VQWA 4YRNA 2ZT5A 2EJ9A 4YRPA 2ZCEA 4L87A 4UPAA 3JCMe 3JB9G 4WI1A 3LSQA 1ADYA 3JCMc 3JCMb 4J5YA 3VU3C 1B76A 5HGQA 4ZTZB 3V8JA 2DU7A 2G4CA 5GMKl 4C8QG 3L1AA 5GMKe 1B34B 4N0AC 4YRJA 1NJ6A 2DVEA 4TVAA 3ICAA 2DTHA 4P3NA 4DQ2A 3P8TA 3REXA 4P74C 3INZA 2E1HA 3JCMQ 4NCXA 4XTYA 5LJ5d 5E3IA 2ZIOA 3HXXA 3RF1A 2ODRD 3V7SA 4XTUA 2RD1A 5GAMh 5F5WA 1G5IA 3PZCA 5GANe 4P3OA 1I4K1 1KMNA 1X56A 1C0AA 3JCMd 4AH6A 1Y96A 1YCYA 1I81A 2DJZA 4PHCA 4CH5A 4TWAA 1WQWA 4MMKA 4C8QD 1IL2A 3RGLA 2Y90A 4F7UF 4TVAB 5GAN8 2ARUA 4M77F 4N0AA 1G51A 2ALYA 4P75C 1FYFA 1W66A 1YB3A 3FJPA 4M77B 12ASA 1X01A 3M4PA 2QHVA 3E9IA 4H2XA 1TH7A 1QF6A 1X55A 4H2UA 4YRIA 2RM4A 2CGHA 2VXEA 4M7DF 3A7RA 4TQDA 3EFRA 4PJOE 2I4NA 2P0LA 1LOJA 4X9CA 4M75E 4OLFA 3UGQA 1U1SA 1Y96B 1H641 1JBMA 3AHUA 4H2WA 4TTVA 3HFZA 4UP9A 3SWNC 5GAOn 1NJ1A 5GANd 3M4QA 4UP8A 2YLCA 3EFSA 2AMCA 4A53A 4RMFA 2CJAA 4LNSA 4O2DA 1N9WA 3IKMB 1KQ1A 4P75A 3BW1A 1MGQA 4YREA 1J5WA 3HTZA 2C8MA 2E65A 4TVYA 4PNOA 3JB9I 1EIYB 4YRMA 5GAMf 4BWAA 1NJ8A 4P3PA 4YRGA 4M78E 2ZR3A 2E10A 1NNHA 4PJOG 3HXZA 4M75G 3HFZB 4YRSA 4G84A 4Q15A 1ASZA 2ZGWA 4EMKC 1M5Q1 3LSSA 2VXFA 1SERA 3SWNA 4YROA 4XTVA 1LYLA 2RA2A 1H4TA 4YDQA 2QTXA 1GGMA 2RHSB 1BBWA 3QTCA 3V7CA 4C8QF 3JCMV 1ADJA 1USYC 3L2ZA 4NL2A 5GAN3 4J6WA 1JJCB 3TUPA 4C8QB 2PMEA 2DTOA 1B7YA 4NL3A 3L4GB 5KNNA 5GAMg 1PYSA 5GAN6 4M7AC 4H02A 3REUA 1SRYA 1HK9A 3RL6A 4HA8A 1NJ2A 4M78G 4Q6GA 3HXWA 5GAN2 1U1TA 3JCMP 3JCMf 4KQEA 4J15A 4HWOA 4YYEA 4X9DA 1B70B 2VC8A 3SB2A 4WJ4A 4EMKA 2YHTA 3HXVA 1JRIA 4HWPA 4XU0A 4PJOC 4C92C 4J6XA 4M75C 4P73C 5DY9A 3QO7A 4M7DC 2RHQB 5GAN7 1USYA 5LJ5g 4XQ3A 4HWTA 3JB9D 5C53B 4YRRA 4M7AA 1NYQA 2Q7EA 2ZINA 1EVKA 3HY1A 2XTIA 3JCMg 2DEQA 4E51A 4YCVA 3IALA 3RACA 4HT9A 4M7AE 3HFNA 1BBUA 4EMKB 5GMKi 2K57A 4XEMA 3JCMX 3UGTA 4YRLA 1LJOA 3TEGA 4CH6A 4M78C 1YFRA 5ELOA 4MMLA 5LJ3f 3JCMW 4PJOA 4C92A 4EX5A 1EVLA 4M75A 3QHSA 4P73A 5GAMj 4M7DA 2ARTA 3FIFA 4XU1A 5GAN4 4K88A 3NELA 4YCWA 5LJ5h 2DZ9A 3RERA 4C92E 4H2VA 3VQVA 1WU7A 2I4MA 2EJFA 4EO4A 1N9RA 5GAOp 4M7DE 4YRKA 4RDXA 4RQFA 4QVDA 3PCOA 2JN0A 3RESA 2AKWA 2Q7GA 4P72C 4YRQA 3JCMh 3E9HA 4CS2A 2ALYB 3V8LA 4M7AG 4ZIBA 3CMQA 1N9SA 4XTWA 5LJ3g 4P71C 4PJOB 4H2XB 4C92B 4M75B 4M78A 3A32A 3NENA 5GMKh 2IY5A 3JB9J 5GAOl 3FB9A 1EFWA 3A7UA 4XU2A 3A31A 2ZXFA 4TQFA 4K86A 4HT8A 2DQ3A 3UH0A 4PG3A 4QVCA 3RKYA 5GAMe 4C92G 3RUXA 1E22A 3JB9F 3A74A 2ZZEA 4M7DG 1BIBA 3BY7A 5ELNA 1D3BA 3VBBA 1I5LA 4CS4A 4A54A 2AMCB 2CJ9A 4P72A 2QHTA 5K1PA 3HFVA 2CJBA 1HXDA 3V8KA 1E24A 5GANh 3RKXA 5GMKj 4M7AD 4K87A 3HRKA 4M78B 4WJ3M 3G1ZA 1EOVA 4P71A 5LJ3h 1M8VA 4UP7A 11ASA 5LJ5f 3PGGA
chains in the Genus database with same CATH superfamily
2RQWA 1GFCA 2QEXA 3CC4Q 2K4YA 4P5NA 4YTLA 3A7AA 1M27C 4C5EA 4TVRA 1VQMA 2AKLA 3PVLA 3QNEA 1NZ9A 5K1XA 4RTYA 1VQZA 2XICA 4GY5A 1IRXA 2K5LA 2DAQA 5M9OA 1XQHA 1IB8A 2B8AA 3BJUA 2KXCA 4HWSA 4YCUA 1M1FA 2DIQA 1Z7MA 3TSZA 2MAMA 3CBMA 3RR6A 4XTZA 2HAXA 5C51B 2I4OA 2KXDA 2VASA 4IUQA 4KBMB 4PFPA 4XEOA 1KOGA 3ERRA 5FU6B 4YRCA 4OMQA 3QWXX 2LJ1A 1TG0A 5AT1B 2GBQA 4E7IA 1WDXA 2LCLA 4AMCA 1QCOA 2V26A 4L5GA 4XU3A 3BDUA 2JOYA 2ZCFB 3REAB 4M78D 1WYDA 2O4XB 4DEXA 4KH0B 4OF1A 1VIFA 5GMKm 2JTEA 1PHTA 4ZGJB 3TEHB 1TU0B 1WJRA 3BFMA 4OMPA 1W2BS 2XGTA 2JJ9A 3MCAB 4OB1B 1KC8C 1W70A 3H0FA 2M0OA 2ZNJA 2ZTGA 4OGCA 3QSUA 2M9UA 4ME7A 1I07A 2AHJB 4LDYA 4M7AB 2BE9B 1KK7A 2KNBB 2NUPB 4RMOA 1WGSA 1U5SA 1RI0A 2KYMA 1NEBA 5L8RE 2O31A 5CCAA 4KR2A 2HKQB 2Y4YA 3MP6A 3TCJA 1SETA 2DL7A 3LYIA 3MF2A 4FCYA 1MNDA 2GGRA 4J6YA 1VQ9A 4CS3A 3M56A 4HVUA 2AZSA 3ME9A 4BW9A 2GNCA 2MMPA 3MF1A 2L0AA 5CO7A 1XOVA 2KR3A 4JLIA 2DTIA 4CH3A 5FWCA 3CMAQ 2M51A 1QKXA 5A0DA 5I21A 2DXTA 2AKWB 4H2SA 3A98A 4A4KA 1OU8A 1VQMT 2J6KA 2CZ7B 4JUVA 2QDYB 2COWA 4C8QA 2F2WA 4ZN1A 1NYFA 3VS1A 2PQWA 4YPFA 1PRLC 3U23A 2F5TX 2L3QA 4JRIA 3MEUA 3LLRA 1M30A 2LCSA 1YHQQ 4C8QE 3OYNA 2IY5B 3OYGA 1YIJQ 4Y91A 2HNIA 3TREA 3M58A 3QYGB 1YWOA 1YFSA 3G71T 2CP0A 2E6NA 2EQIA 2ZT7A 1ZBXA 4RTWA 2ZT5A 2QQAA 4L87A 3JB9G 1YJWQ 1Z9ZA 3JCMc 5D6WA 1N8RC 1CSKA 3IQLA 4ZTZB 3UDCA 1VQPA 2OTLA 1AZEA 2G4CA 4WCIA 1FMWA 4PJJA 2RJCA 1K73U 3ER0A 4C8QG 4Z89A 4N0AC 4YRJA 1UDLA 2LQWA 1M90U 2RQUA 1LPLA 3P8TA 3INZA 2E4HA 2E3HA 2E12A 3RBBB 2X3WD 1RACB 5KH6A 3VYHB 3UA6A 3E1SA 3PIOA 3PVQA 3RDVA 4XTUA 1VA7A 4KT0E 3H9NA 5DLQE 5F5WA 2D1XA 3PZCA 2CS7A 4P3OA 4AH6A 3CCSA 1I81A 2DJZA 2L89A 2Z0WA 1VQ9T 4BI8B 1VQ6A 4C8QD 1XJWB 4CC3A 4JJDA 4PKCC 4M77F 4QW2A 1TUCA 8AT1B 2ALYA 1X69A 12ASA 7AT1B 1TUDA 1YITA 4A4FA 3GPLA 1I5OB 4YRIA 2F69A 1XTDA 2VXEA 4M7DF 3A7RA 4J9BA 2L3SA 1JJ2P 1QVFA 2XHCA 5FU7B 3UGQA 1U1SA 1Y96B 4Q5WA 2PUKB 3AHUA 4R56A 2DNUA 1WHHA 1M90R 4H2WA 4RG2A 4HXJA 3QZ5B 5GAOn 3E9FA 4UP8A 2YLCA 3EFSA 1D1CA 3UWNA 3IKMB 1KQ1A 1YP5A 4ZGEB 1MGQA 2E65A 4PNOA 5I2SA 1VYUA 5GAMf 1C0MA 4P3PA 3BDLA 2FRWA 5HKCA 1IHVA 3DB3A 2DD5A 2DXCA 4MDXA 1IHWA 1UE9A 3HXZA 1M1KR 3HFZB 3CCEA 4HVVA 4G84A 2GTOA 1ASZA 5KYWA 1VQPT 2EKHA 1SERA 2WACA 3SWNA 1LYLA 1AWXA 1H4TA 3D7SB 1ZSZC 1PG5B 2CP3A 3JCMV 2JS0A 2KK4A 2DMOA 5GAN3 2PZ1A 4C8QB 2PMEA 1UGVA 1VQKA 1N5ZA 3H0IA 1KQSA 2P4TA 5GAN6 1QQJA 1SRYA 1HK9A 3GF5A 3SFMA 3RL6A 1OQKA 3E9GA 2ZPBB 2YUQA 4II1A 3SDZA 4Q6GA 5GAN2 1U1TA 3JCMP 2JTFA 1SSFA 3BE3A 4KQEA 1VQMQ 4IKFA 2LX7A 4X9DA 3SB2A 1Y7XA 2MPXC 4F16A 3CD6A 4GLMA 4D8DA 4XU0A 1VQ6T 1D1BA 2CP5A 3OS5A 5KYUA 4OMMA 5GAN7 1USYA 1OPLA 3EG3A 2J6FA 4XQ3A 4BD3A 5C53B 1VQOT 4YRRA 2C06A 2QI2A 4R0KA 4FYVB 2ZINA 1RAHB 2A08A 3HY1A 1OEBA 2X4XA 3MEVA 3G71Q 4QQGA 3IALA 3RACA 4ZN3A 3OYHA 3TU4K 3PE0A 5GMKi 1BKBA 3HHTB 1NJIU 1RI9A 2DM1A 1VQ4A 2HSPA 3TEGA 3CC7T 5KCOA 1YFRA 2F5KA 3JCMW 2W10A 4C92A 1Q81R 3QHSA 2XD0A 4M7DA 2ARTA 3FIFA 2A28A 4PK4A 5LJ5h 2DVJA 2NLUA 2HD0A 4E47A 4H2VA 2AK5A 4C92E 1WU7A 2R5MA 2EJFA 3QJ6A 3UATA 1W1FA 1U06A 5GAOp 3PTAA 4JRQA 4M7DE 4YRKA 2JTMA 2ZAEA 1RABB 1TXQA 2WSCE 3EAEA 2Q7GA 4P72C 3JCMh 2XG8D 2KVQG 1PD1A 1E6GA 2ALYB 3OYCA 3V8LA 2DF6A 2LTOA 4X34A 5LJ3g 4P71C 4A4EA 1FMVA 3M9QA 3A32A 2DK3A 2QGFB 5GMKh 2QDLA 3OSVA 3S3MA 3JB9J 2D9TA 3DB4A 3FB9A 1VQ9Q 3A7UA 3A31A 3J7AF 1G3TA 3RNJA 4A63B 2KRSA 1YJNA 1QWEA 4DBFA 4C92G 1K4US 2RJDA 2QXFA 2KDSA 4PJNA 1JJ2S 4M7DG 5ELNA 3OBYA 1NJIR 1JXOA 3VBBA 3UF4A 4A54A 3M53A 1PKTA 4OMNA 3OMGA 3SD4A 4C0FA 2LT1A 1VQLA 4E7LA 3G4SA 3CPWA 3HRKA 2PVOB 3SHWA 2H3JA 2ZPGB 4AFZC 3OYAA 1EOVA 3NHNA 2VGNA 4BE1A 1N27A 3CD6T 1PRMC 4OMFB 4QT7A 4MZMA 3OYIA 5GAOq 4FSXA 2COYA 1AWWA 3HL8A 3IG2A 1K1ZA 1G3SA 3QO3A 4J7IA 1QCNA 1PSFA 4M77C 1MV0B 2C0IA 1H4SA 1D3BB 2OI3A 2OX7A 4OB3B 4C92D 2EYZA 4RUGA 1X54A 1W2BP 4RKUE 3SWNB 4X1VA 3RKWA 3X24B 3JRZA 3QPHA 5GAMd 3TEHA 2LMJA 2ZZFA 2CKKA 5LJ3j 1H3ZA 4DBRA 1TUGB 4YRTA 4C0DC 4LVIA 1G3YA 1ZHIA 3VS0A 2IIMA 1WHMA 4UC4A 1VQPQ 1SPKA 1YI2A 2NUPA 2DA9A 4M4ZA 8ATCB 2ZZGA 3M54A 3RMSA 1AD5A 1NLOC 4E6RA 2J3LA 4V2SA 3P8YA 2QG9B 5GANf 4BI4A 4H2YA 1UJ0A 2MF2A 1GL5A 1Q86C 3CCLA 5KYUB 2RHZA 4C5GA 2ODRC 1QVGA 2DL3A 2DBKA 5LJ3e 4DEYA 5J39A 1K0SA 1X2HA 2RMOA 2Q5HA 4HVCA 3WQZA 1VQ6Q 3MEWA 3EGUA 1ZUKA 2RK1A 2DILA 1YJNT 1Q82U 4P74A 3X20B 3FLGA 2QHUA 4AFSC 2J3MA 3G6EA 3R6NA 4PJOF 2C0TA 2E3CA 4M75F 1VQOQ 3P8DA 1PD0A 2RPNA 5LJ5j 1ZX6A 4M7DB 2FB7A 2X4WA 5A2QE 1AZGB 4QQDA 2QYZA 1BI1A 3L2UA 1JJ2A 2QK0A 2NYSA 2P5IA 2I2LA 3C12A 5CQXA 3M0RA 1OZ3A 4LD6A 3QDFA 1NM7A 2EAYA 2EBPA 4FYYB 4X5OA 4CH4A 1H4QA 1IGQA 1V76A 2M02A 2RHSA 2YRVA 2DKGA 3CC7Q 3HY0A 1WHGA 3AT1B 4RQEA 1B07A 3CCJA 1KIKA 3THKA 3L4GA 4BY6C 3LC0A 3EG1A 1EQRA 2O88A 1SF9A 5FWBA 2L8DA 3UFGA 1BIAA 4CC2A 1SESA 3M4YA 2FYKA 3CCMT 2ED1A 1AEYA 3WVDB 4OP0A 2PUOB 1QCFA 2NUTB 2X35A 5LJ5e 3CBPA 2LVMA 4DBHA 2PVGB 1Q82C 3EGXA 2RO0A 1HC7A 2ZIMA 3PMTA 3NGPA 2CT4A 4J9CA 2RHQA 4FT2A 2DQ0A 2WSEE 4A4GA 4KGZB 4JRPA 3C94A 4LDVA 3NTKA 3JCMe 3LSQA 3GBQA 1B76A 2QA4A 4HT4A 2MCNA 3V8JA 4BUGA 3N5BB 3MHXA 2DU7A 2ESWA 5FRNA 4IUPA 4BB7A 4DOVA 1O9SA 3L1AA 5GMKe 1ZLMA 3L2WA 2QQSA 2VV5A 4D8KA 4P3NA 1PSEA 4XAXB 3M5AA 3KUFA 2LP5A 4DQ2A 2PU9B 4Y28E 1PKSA 4P74C 2EGAA 2E1HA 3CD6Q 2ZIOA 3FC3A 3HXXA 1M3AA 1X43A 4BY6B 5DLOA 5IHNA 1KC8R 1FXXA 3OY9A 2CYZB 1KMNA 1Y96A 2H8HA 2ZZDA 2DXBA 3QZ9B 3H41A 2CDTA 3VUBA 1WQWA 2EGEA 3VS5A 5CK9A 4F7UF 4TVAB 5GAN8 5CKBA 3FDRA 2KY9A 3HP9A 3QXEB 4N0AA 1G51A 2ARUA 4RTZA 2HQXA 1ARKA 4P75C 3CXCA 1YB3A 2BZYA 2EQKA 2QHVA 3PIPA 3LWIA 2EFIA 3E9IA 2A36A 4H2XA 4AT1B 1X55A 5HK3A 4E7ZA 2RHXA 2RM4A 4TQDA 2RI2A 2L2PA 3QDRB 3NTIA 4NS5A 4PJOE 3I35A 2P0LA 3CCVA 4M75E 1X6BA 4OLFA 3CCJT 4QQ6A 1JBMA 2X4JA 1RUWA 1KJWA 4JS5A 1N8RU 2FPEA 3CC2A 4TTVA 3HFZA 2JM9A 2HDAA 1NJ1A 5GANd 4ANJA 4AFQC 3TEEA 2QEXT 3VYGA 2R57A 2CJAA 3MPUB 2DL5A 3TQ7P 4O2DA 3FEOA 1BBZA 1NE8A 4YREA 1J5WA 1NBEB 3HTZA 2D6FA 2RN8A 2O2OA 1KD1C 1NJ8A 1A0NB 4YRGA 2ROTA 1BI0A 2M1HA 3OMCA 3H6ZA 2E10A 3OB9A 1PCXA 2DYBA 4PJOG 4CI0C 2NS6A 4FU6A 4M75G 4C0ZA 3ZFJA 4YRSA 1SKUB 3LSSA 1YJNQ 2ZPHB 1TTHB 4YROA 1YWPA 4XTVA 2VYTA 4YDQA 1GGMA 3A8MB 2IG0A 2RI5A 2RHSB 1U3OA 1JXMA 3OW2P 4D6WA 3EFOA 1G5VA 1ZA2B 2RJEA 1YN8A 4HVWA 2OAUA 2KI7A 2HL3A 2RHIA 3M55A 1B7YA 3L4GB 2K2VA 5CKHA 1F1BB 4O6JA 3RMQA 3REUA 4LUDA 3M0TA 2C0OA 1N8RR 1BI2A 3A8GB 3M0PA 4HA8A 3S3NA 1NJ2A 3LGFA 1KFZA 2O01E 2CH4A 3JCMf 2EYXA 3OQ5A 2LCCA 4N4IA 1ZSGA 4B6MA 1X27A 3S6WA 1UGPB 2YHTA 4XK8E 3EGXB 3TVTA 1JEGA 1JRIA 5EG2A 4HWPA 4KUIA 1W2BA 3MO8A 4PJOC 4M75C 4P73C 5DY9A 2VWFA 1R0CB 1ZSZA 2RHQB 3MP8A 1O75A 3CCMQ 1VQ7A 2K7AA 3QBYA 3HRUA 3JB9D 2EQMA 2CP2A 3DKMA 3PFSA 5CVIA 1SHFA 2R58A 1TOVA 1WIEA 2YUPA 1BBUA 4B9XA 2K57A 2JMAA 4XEMA 3CC2T 1Y57A 4YRLA 4CH6A 1RAAB 4MMLA 2RQVA 4LVLA 1AVZC 4OVAA 3CBOA 3NELA 1PNJA 3J80E 4IUUA 1UHCA 3X28B 1K73R 2DZ9A 4BACA 3RERA 5IXBA 3VQVA 1Y71A 2HEQA 1DJ7B 1MHNA 1QWFA 2YUNA 2V8IA 2J6OA 2EYYA 3O8VA 1H92A 4CS2A 2FVUA 5CKEA 4ZIBA 3VS4A 1K8AC 3OS1A 4PJOB 4H2XB 5KYXB 4M75B 4Z88A 2J06A 1EFWA 1JO8A 4TQFA 1WFWA 4LDWA 4K86A 2G6FX 1E22A 3I55A 1D3BA 3QIIA 3REBB 4CS4A 2KROA 3MJXA 2OTLT 2HL5C 4K11A 2CJ9A 4P72A 5K1PA 2E70A 2CJBA 4KGXB 3OYKA 4PFZA 2BE7D 3OS2A 3M57A 1K0XA 1D1AA 1OV3A 4C5IA 3CCJQ 4P71A 5LJ3h 2KGTA 11ASA 3PGGA 1PC0A 4JJNK 1K9AA 3VQXA 2LQ8A 2HBPA 2KSSA 1H3HA 1IREB 4DBQA 1VQ7T 2JNGA 2QEXQ 1ABOA 2JXBA 2XI9A 4RG8A 3HXYA 4DPGA 2OAWA 2RI3A 3ZBDA 3C0CA 3CCST 4YRFA 2ATCB 3KXTA 3DSQA 1ZUUA 2K3XA 1RIQA 2K5IA 3EFOB 4NOYA 1GCPA 1UTIA 4CC7A 1J3TA 1B7YB 3W3SA 2RQTA 3OW2S 3VS7A 3GIBA 2E5AA 3JCMJ 1BB9A 1X2QA 3QYHB 2GCXA 2P4RA 4JLGA 2RB6A 1R0BG 1YFTA 1YITT 1V1CA 5HY6A 1T3SA 2EW3A 3QO8A 2ENMA 5CIUA 1YFNA 2ROLA 2ZPIB 3VKIA 2DJQA 4M77A 1Q7YU 1GXIE 5C52B 2DX1A 3QKJA 2MYSA 3NEMA 1HD3A 2HKNA 2KMTA 2R5AA 4M77E 1ZSZB 2DZCA 4KH1B 4O5VA 3IKLA 3A8LB 2ZT6A 3KFUA 2PNIA 4M7AF 1NYRA 1MMGA 1CKAA 3CMEA 1LCKA 2HZYA 4J7FA 4MZPA 4LDXA 1UGQB 1OPKA 5CKFA 3OBWA 3JB9H 1I8FA 4F7UB 1S72A 1G5HA 3R07A 1GCQC 4KRTA 4BDYA 1KMMA 4KR3A 3I55T 3ZEHA 1X2GA 2KRMA 3CCET 1TWBA 2QQ9A 2GFUA 4YP0A 1EIYA 2YLBA 4RTVA 1Z7NA 2CUDA 2YDLA 2X3XD 4IURA 3HSBA 1FX7A 2ZPEB 3HFOA 2E41A 4M77G 4VUBA 1QP2A 3A5YA 2CIMA 3VUZA 1JQQA 1BU1A 2D0QB 4E7SA 2Q5IA 1VQKT 4ELYC 1AT1B 1M2VA 1KQ2A 4CC4B 2M0YA 2NUTA 1SEMA 1OYXA 3F70A 3GNGA 1Q7YC 2EL9A 3CC2Q 2OJ2A 1QP3A 2K3BA 4JRKA 4PLIA 5GAOr 1JJCA 3CPFA 2DDZA 1E1OA 2ZNIA 3EGDA 3NETA 4M78F 1K76A 5J26A 1YIJA 1VOMA 2HCKA 4XTXA 5A0GA 1D0XA 1OULA 4KULA 5HK0A 1SRMA 1Q86U 1T3LA 2EQJA 2MIOA 4B9WA 2DRMA 3HXUA 4M77D 3OYMA 4J9EA 4OMOA 1ZBJA 1WHKA 2JW4A 1B70A 2E5QA 5CAIA 3EH1A 2DXUA 2DE0X 1Z9QA 1M1GA 3WXMB 2K2MA 1I0CA 4M7DD 3VQWA 1SSHA 4YRNA 3Q1JA 1KHIA 4YRPA 2ZCEA 3HRSA 1RAFB 2LC4A 1BK2A 2J7IA 4LE9A 1ADYA 1MV3A 1RLQC 4J9IA 2V1RA 2O9SA 4FSSA 5HGQA 1VQ4T 2RF0A 4E7KA 3L2RA 2FRYA 3OYEA 2HQEA 2OTLQ 4EIKA 1M4ZA 2DVEA 1VQNA 4TVAA 2DYIA 3ICAA 2DTHA 1GBQA 3CMET 5GJVB 3REXA 2FPFA 5ECAA 1K9MU 4NCXA 3EH2A 4EPCA 4XTYA 2P0QA 3VJPA 2XIDA 3VRZA 1S72T 1NLPC 1RL2A 2ODRD 3V7SA 4ZTJA 2LQKA 2RD1A 2FZGB 3CEYA 5GAMh 1G5IA 2MI6A 2K6DA 1VYTA 3L2QA 1VQ7Q 1I4K1 1QLYA 1YCYA 3DLLA 2DRKA 2MWOA 4E2FB 3UPUA 4L6V5 2Y90A 1B7TA 1MMDA 3CCSQ 1FYFA 4M77B 1C1AA 3JAME 2KE9A 3R6OA 1WHLA 2K79A 1TH7A 3A8HB 1QVFP 4HCKA 2P0KA 1FYNA 2CGHA 1YITQ 1M2OA 1LOJA 4X9CA 3URGA 4C0DB 1H641 1VQLT 3NTHA 2AT1B 3G4ST 3MKDA 1KG1A 4UP9A 1ZA1B 1NEGA 1VYVA 2EVRA 4N4HA 4Z02A 5D6XA 4A53A 2AMCA 4RMFA 1K9MC 4LNSA 1OX8A 1UJYA 5DM7R 3P8BB 1UB4A 4P75A 5J3BA 2XK0A 2G3RA 3BW1A 2C8MA 2HSEB 3PMIA 4OB0B 3JB9I 1EIYB 4YRMA 4BWAA 5I2MA 1W4SA 4M78E 4OB2B 2F2XA 1GBRA 1NNHA 3HTRA 2FZKB 1R8OB 4F14A 2JUFA 2QQBA 4J9FA 4ZNXA 2GFAA 2YWWA 4EMKC 4LVJA 2KRNA 1M5Q1 4RTUA 1GRIA 1M2VB 2E5KA 2VXFA 2XDBA 3I55Q 2FZCB 4QKUA 1Q82R 2QTXA 4GLKA 2RNAA 3CCEQ 1BBWA 2QQRA 3QTCA 4J8OA 5IXFA 4C8QF 1YI2T 4NL2A 2XU8A 2JZ2A 3OSSC 1KQSP 1JJCB 1VQNT 3TUPA 3EG2A 3JSCA 1R77A 3EGDB 3GP8A 5KNNA 2RHYA 5GAMg 1TSFA 1PYSA 2KT8A 4M7AC 4H02A 3TSWA 2A3LA 4KUDK 3DLMA 2DD4A 4F17A 2BKDN 1VQKQ 4BE2A 4OMLA 3OYLA 4M78G 3HXWA 3CCLT 3I56A 1EIFA 4HWOA 3CCUA 1B70B 2VC8A 4LNPA 3HXVA 2FEIA 4DOWA 2EYQA 4FW1A 4C0GA 2V1QA 2CSQA 2LZ6B 2QAZA 4IUTA 4AG2C 1TS9A 3O5ZA 4Z8AA 4FIBA 3FJ5A 2VVKA 3G71A 1M9SA 1G3WA 1KD1U 1IO6A 3GLXA 3G6ET 2E6ZA 4IUVA 3I5SA 4C5HA 2DEQA 2SEMA 2DIGA 1VQ5A 4E51A 2L3RA 1T0HA 4J9DA 4LVKA 1AHJB 1MUZA 4HT9A 2B86A 3PT9A 3HFNA 2CZ1B 2SRCA 1UFFA 4EMKB 2FL7A 4PFOA 5IAYA 3JCMX 3UGTA 1LJOA 4M78C 5ELOA 1NYGA 1FWZA 5LJ3f 1ABQA 4PJOA 1QVPA 5KYXA 2A7YA 4M75A 3CCQA 4P73A 2AKKA 5GAMj 5GJWB 1VQ4Q 5GAN4 1B3QA 4K88A 4KGVB 1JU5C 2BZXA 3A8OB 3EHQA 1D0ZA 4Y92A 4EO4A 1N9RA 4RDXA 2LQNA 2JS2A 3PCOA 3M59A 2YXYA 2JN0A 3L2VA 3CMEQ 1OX9A 3E9HA 3GOXA 5KE3A 4HCZA 3X25B 1S72Q 1X2KA 3VRYA 4R55A 1N9SA 4J9GA 3G7ZA 3CCRA 3NENA 1MMNA 1KD1R 4XU2A 2X9HA 2ZXFA 2L5QA 4HT8A 2DQ3A 3UH0A 4FM4B 1QVFS 4FYWB 4BE0A 4PG3A 5D7UA 4QVCA 4HCCA 1T0JA 4JDSA 2FHDA 5GAMe 3LX7A 1U8RA 3X26B 1M3CA 2QA4T 3A1PA 2YSQA 2AMCB 3CPWP 5CQYA 5AYFA 5FRMA 2QHTA 1UG1A 5KYYA 3HFVA 3C95A 1ZUYA 3I56T 5GANh 2L3PA 3CCUT 3HKSA 4K87A 3LH0A 4M78B 1WA7A 2BUDA 2EPDA 2EIFA 4WJ3M 1KHCA 2X4YA 5IN1A 3T9NA 1M8VA 1VQLQ 4UP7A 1V29B 5LJ5f 2AIRB 3PNWC 3G4SQ 2C7IA 3MEAA 5C0MA 4ORZA 3OD1A 1B34A 2RK2A 2FPDA 4RCCA 1YJ9A 2DBMA 1E1TA 2P84A 4PJOD 1WXBA 1G2BA 3GNFB 4M75D 1SG5A 1NG2A 2ARSA 3ULRB 3MQZA 3QO5A 1VQ5T 1B8AA 4AFUC 4J9HA 3H0HA 3WVEB 3S3OA 2V8JA 5FU7C 4LDUA 2DL4A 2V8KA 2A37A 4LUEA 1K8AU 3OYFA 1PYSB 2OTJA 1KQSS 3H8ZA 2CZ0B 1WXUA 2F2VA 3CCQT 2DO3A 2VKNA 1BCOA 3JV3A 3C4SA 3HRIA 1WHJA 4LD9K 4F7UA 3CCVT 2ZR2A 2Q7HA 3I7FA 1YI2Q 2MK5A 1ATIA 1WLPB 1NPPA 1VQNQ 2I4LA 2I0NA 1WLEA 4ESRA 2LNHB 1S1NA 3VQYA 4RTXA 5GAN5 4F7UE 1W6XA 1WZOA 1YGBA 3MEYA 1QVGP 9ATCB 3V7RA 4ZTUB 2JVVA 1EZZB 1RAGB 2GQIA 3NFCA 3QG1A 2NUZA 2EWNA 3CCLQ 1WNLA 2DLPA 3M0UA 2WSFE 5EC7A 3CCRT 1ASYA 1ZQ1A 2XKOC 1WPYA 1M1KU 2IVWA 3P8HA 4G85A 1KSWA 2KT1A 1H4VB 2K9GA 4BDZA 1HTTA 5LL6S 3P8VA 5FROA 1IGUA 2LRQA 2PTKA 1WI7A 4C8QC 1VQOA 4LVMA 5GANg 4MDWA 2ZPFB 2GTJA 2QGGA 4C92F 1K8AR 2EQUA 3QUIA 1LNXA 1ACMB 1K73C 2QHSA 4IIOA 4F7UG 3G6EQ 3OS0A 2K5FA 4RCBA 2EJGA 1HSQA 2GF7A 1M90C 1CKBA 1D0YA 3CC7A 2DU5A 1G83A 4H2TA 1QW1A 4E7HA 1NJ5A 3PCOB 1VQ8A 1L0WA 2LJ3A 5LJ3d 2CP7A 2QTVA 2XDDA 4EMHA 1QE0A 1WXTA 1GCQA 1YJ9T 2D8JA 3I9QA 3CC4A 2QASA 3LH5A 5KYNA 3A5ZA 2KBTA 3M4GA 1I1JA 1BI3A 4EMGA 2CSIA 4LN2A 2PMFA 1M1KC 5GAOm 1VIEA 2DPPB 3EG9A 1WQ7A 1G8XA 2VB6A 3RIRA 4HWRA 2OTJT 2ABLA 4WF2A 2E64A 2BIVA 4TVWA 3QWYA 2ZT8A 5GANj 4RTTA 2DEUA 1H8KA 3EG0A 5KYYB 2EJ9A 4UPAA 2X51A 4FW2A 6AT1B 1Q81U 1HYOA 4WI1A 5IT9E 3E2UA 2XMFA 3CPWS 3JCMb 3HRTA 4J5YA 3VU3C 1X6GA 4JZ3A 1C6VX 5GMKl 2YRDA 2QA4Q 1B34B 4HCBA 1NJ6A 2DETA 1M8MA 3I56Q 4QVZA 3CCUQ 2ECZA 2KYBA 1Y07A 2MOXA 2VUBA 3JCMQ 2LT4A 2IPOB 5LJ5d 5CR2A 5E3IA 2FO0A 2A8EA 3RF1A 2YT6A 3QJYA 3KFVA 1OU9A 2A0FB 3OYYA 1IXDA 2K3YA 2EYWA 5GANe 5FLXE 2CT3A 1C0AA 1X56A 4FYXB 3JCMd 3ASKA 4PHCA 4CH5A 4TWAA 1RLPC 1RAEB 4MMKA 3CXCP 2JT4A 5HCKA 1IL2A 3RGLA 1SRLA 5I11A 1GFDA 1VQ5Q 1X6OA 3NMZC 1W66A 3FJPA 2M16A 1X01A 3G1JA 3M4PA 3M0QA 1QF6A 1Q81C 1N6AA 2MWPA 1VQ8T 4H2UA 5L23A 4E7JA 2E3IA 1IZ6A 1BYMA 3EFRA 2I4NA 3CCQQ 1PM3A 4FT4A 5D6YA 2HBWA 2CP6A 2ED0A 1LVKA 3CC4T 1QVGS 3CMAA 3CCVQ 3SWNC 3M4QA 1UUEA 1Q7YR 1P92A 3UT1A 3VS2A 1N9WA 1X75C 2NWMA 3E19A 1VUBA 4J83A 4TVYA 1YHQA 3OYDA 3HPWA 1MNEA 2JM8A 3CQTA 3EHRA 3CCRQ 2KEAA 2VGMA 2ZR3A 2XDPA 2DFUA 1YNZA 2RJFA 4CRIA 2AZVA 4Q15A 2ZGWA 1NJIC 1E6HA 2F1LA 4FL6A 2RA2A 3V7CA 4MZTA 2LDMA 1YJWA 1ADJA 1USYC 3L2ZA 4J6WA 1E7OA 4OGEA 3OW2A 2DTOA 4NL3A 4A4HA 4F04B 3FRNA 2EKOA 3NPFA 3L42A 4HKEA 3ZL7C 4JZ4A 1BCMA 1EX4A 3A5ZB 2Y4XA 4LXCA 2D0NA 1PWTA 5KYWB 2CUBA 1WYXA 2O4XA 4ATOA 4J15A 4YYEA 2LJ0A 3EG9B 1FMKA 1YJ9Q 4JJCA 4EMKA 3LWHA 4ZGDB 1AWOA 5I22A 2W0ZA 3CCMA 4C92C 4J6XA 2KQWA 5IH2A 3QO7A 4M7DC 1M3BA 2YRCA 5LJ5g 3VV0A 3M0SA 4DA4A 1Q95G 3KBGA 1EFNA 4HWTA 1Q86R 3VS6A 1D09B 1NPRA 4JS4A 4M7AA 1NYQA 2Q7EA 1UGRB 1QKWA 4IIMA 3OYBA 1HJDA 4N4GA 2OTJQ 1EVKA 2XTIA 2EGCA 3JCMg 3LGLA 4PL6A 5FW9A 2J05A 4YCVA 2LNVA 3OYJA 4EDUA 4M7AE 1UGSB 2FG0A 1RAIB 4PJMA 2BZ8A 2CH4W 1AWJA 3CMAT 5KCHA 2P0PA 3VS3A 4AG1C 1AOJA 4EX5A 1UECA 1EVLA 1Y0MA 4GBQA 1UEBA 4XU1A 2PVDB 1QMCA 3I5RA 4YCWA 1OZ2A 4L59A 2LX9A 3OA6A 4ZTFA 2I4MA 5KE2A 1YCSB 1YHQT 4RQFA 2KAFA 2COZA 1YIJT 4QVDA 5IHKA 3RESA 1OOTA 4JPBW 2YUOA 4PLLA 2AKWA 4YRQA 3UA7A 1WJQA 2HQHA 2DL8A 4ELZC 2RQRA 1K9MR 4M7AG 3CMQA 1YBYA 3CXCS 4XTWA 3SEMA 4C92B 4WTOB 5IHIA 2BTTA 4M78A 5FU6C 2GQVA 4PJLA 2IY5A 2HMAA 5GAOl 2H3EB 1YJWT 2CZ6B 3J81E 2DERA 1UHFA 3MP1A 5CKDA 3RKYA 4JJBA 1JB0E 1RADB 3RUXA 1MMAA 3JB9F 3A74A 2ZZEA 1BIBA 3BY7A 1I5LA 1WX6A 1XNIA 2RH2A 1VQ8Q 1OI1A 3META 1HXDA 2D8HA 3V8KA 1E24A 1WJSA 2O9VA 2CREA 3LW5E 3RKXA 5GMKj 5C6SA 4M7AD 3G1ZA 2JMCA 4BI3A 5A0LA 4WJ4A 1SHGA 2RHUA 1KC8U
chains in the Genus database with same CATH topology
2QEXA 2K4YA 4P5NA 4YTLA 3A7AA 4C5EA 4TVRA 1VQMA 3QNEA 1NZ9A 5K1XA 1VQZA 2XICA 4GY5A 2K5LA 2DAQA 5M9OA 1XQHA 2B8AA 3BJUA 4HWSA 4YCUA 1M1FA 2DIQA 1Z7MA 2MAMA 3CBMA 4XTZA 2HAXA 5C51B 2I4OA 4IUQA 4KBMB 4XEOA 1KOGA 3ERRA 5FU6B 4YRCA 4E7IA 2LCLA 4L5GA 4XU3A 3BDUA 2JOYA 2ZCFB 4M78D 1WYDA 2O4XB 4OF1A 1VIFA 5GMKm 4ZGJB 3TEHB 1WJRA 3BFMA 1W2BS 2XGTA 3MCAB 4OB1B 1KC8C 2M0OA 2ZNJA 2ZTGA 4OGCA 3QSUA 2M9UA 4ME7A 2AHJB 4LDYA 4M7AB 4RMOA 1WGSA 1RI0A 5L8RE 5CCAA 4KR2A 2Y4YA 3MP6A 3TCJA 1SETA 3LYIA 3MF2A 4J6YA 1VQ9A 4CS3A 3M56A 3ME9A 4BW9A 2MMPA 3MF1A 5CO7A 1XOVA 4JLIA 2DTIA 4CH3A 5A0DA 5I21A 2DXTA 2AKWB 4H2SA 4A4KA 1VQMT 2CZ7B 4JUVA 2QDYB 4C8QA 4ZN1A 4YPFA 2PQWA 2F5TX 4JRIA 3MEUA 3LLRA 4C8QE 3OYNA 2IY5B 3OYGA 4Y91A 2HNIA 3TREA 3M58A 3QYGB 1YFSA 3G71T 2E6NA 2ZT7A 1ZBXA 2ZT5A 2QQAA 4L87A 3JB9G 3JCMc 5D6WA 1N8RC 4ZTZB 3UDCA 1VQPA 2OTLA 2G4CA 1K73U 2RJCA 3ER0A 4C8QG 4N0AC 4YRJA 1M90U 3P8TA 3INZA 2E12A 5KH6A 3VYHB 3E1SA 3PIOA 4XTUA 4KT0E 5DLQE 5F5WA 3PZCA 2CS7A 4P3OA 4AH6A 3CCSA 1I81A 2DJZA 2L89A 1VQ9T 4BI8B 1VQ6A 4C8QD 4PKCC 4M77F 4QW2A 2ALYA 12ASA 1YITA 4A4FA 3GPLA 4YRIA 2F69A 1XTDA 2VXEA 4M7DF 3A7RA 1QVFA 2XHCA 5FU7B 3UGQA 1U1SA 1Y96B 4Q5WA 2PUKB 3AHUA 4R56A 4H2WA 4RG2A 3QZ5B 5GAOn 3E9FA 4UP8A 2YLCA 3EFSA 3UWNA 3IKMB 1KQ1A 4ZGEB 1MGQA 2E65A 4PNOA 5I2SA 5GAMf 4P3PA 3BDLA 5HKCA 3DB3A 2DD5A 2DXCA 4MDXA 3HXZA 3HFZB 3CCEA 4G84A 1ASZA 1VQPT 1SERA 2WACA 3SWNA 1LYLA 1H4TA 3JCMV 2KK4A 5GAN3 4C8QB 2PMEA 1VQKA 1KQSA 2P4TA 5GAN6 1SRYA 1HK9A 3GF5A 3SFMA 3RL6A 3E9GA 2ZPBB 4II1A 3SDZA 4Q6GA 5GAN2 1U1TA 3JCMP 2JTFA 1SSFA 4KQEA 4IKFA 4X9DA 3SB2A 1Y7XA 3CD6A 4XU0A 1VQ6T 3OS5A 5GAN7 1USYA 4XQ3A 4BD3A 5C53B 1VQOT 4YRRA 2C06A 2QI2A 2ZINA 3HY1A 2X4XA 3MEVA 4QQGA 3IALA 3RACA 4ZN3A 3OYHA 3TU4K 5GMKi 1BKBA 3HHTB 1NJIU 1VQ4A 3TEGA 3CC7T 5KCOA 1YFRA 2F5KA 3JCMW 4C92A 3QHSA 2XD0A 4M7DA 2ARTA 3FIFA 5LJ5h 2NLUA 2HD0A 4E47A 4H2VA 4C92E 1WU7A 2R5MA 2EJFA 3QJ6A 3PTAA 5GAOp 4JRQA 4M7DE 4YRKA 2JTMA 2WSCE 3EAEA 2Q7GA 4P72C 3JCMh 2XG8D 2KVQG 2ALYB 3OYCA 3V8LA 2LTOA 4X34A 5LJ3g 4P71C 4A4EA 3M9QA 3A32A 2DK3A 5GMKh 3OSVA 3JB9J 3S3MA 2D9TA 3DB4A 3FB9A 3A7UA 3A31A 3J7AF 1G3TA 1YJNA 4C92G 2RJDA 2QXFA 2KDSA 1JJ2S 4M7DG 5ELNA 3OBYA 3VBBA 4A54A 3M53A 3OMGA 3SD4A 4C0FA 2LT1A 1VQLA 4E7LA 3G4SA 3CPWA 3HRKA 2PVOB 2H3JA 2ZPGB 3OYAA 1EOVA 2VGNA 4BE1A 1N27A 3CD6T 4OMFB 4MZMA 3OYIA 5GAOq 4FSXA 3HL8A 3IG2A 1G3SA 3QO3A 4J7IA 1PSFA 4M77C 1H4SA 1D3BB 4OB3B 4C92D 1X54A 4RKUE 3SWNB 3RKWA 3X24B 3JRZA 3QPHA 5GAMd 3TEHA 2ZZFA 2CKKA 5LJ3j 1H3ZA 4YRTA 4C0DC 4LVIA 1G3YA 1ZHIA 4UC4A 1YI2A 2ZZGA 3M54A 3RMSA 2J3LA 4V2SA 3P8YA 5GANf 4BI4A 4H2YA 2MF2A 1Q86C 3CCLA 2RHZA 4C5GA 2ODRC 1QVGA 5LJ3e 5J39A 1X2HA 2Q5HA 4HVCA 3WQZA 3MEWA 2RK1A 1YJNT 1Q82U 4P74A 3X20B 3FLGA 2QHUA 2J3MA 3G6EA 2E3CA 4PJOF 4M75F 3P8DA 5LJ5j 4M7DB 2FB7A 2X4WA 5A2QE 4QQDA 1BI1A 3L2UA 1JJ2A 2P5IA 2I2LA 3C12A 5CQXA 1OZ3A 4LD6A 2EAYA 4X5OA 1H4QA 4CH4A 2RHSA 2YRVA 2DKGA 3HY0A 4RQEA 3CCJA 3L4GA 4BY6C 3LC0A 1EQRA 2L8DA 3UFGA 1BIAA 1SESA 3M4YA 2FYKA 3CCMT 3WVDB 4OP0A 2PUOB 2X35A 5LJ5e 3CBPA 2LVMA 2PVGB 1Q82C 2RO0A 1HC7A 2ZIMA 3PMTA 2RHQA 4FT2A 2DQ0A 2WSEE 4A4GA 4JRPA 3C94A 4LDVA 3NTKA 3JCMe 3LSQA 1B76A 2QA4A 4HT4A 3V8JA 4BUGA 3N5BB 3MHXA 2DU7A 5FRNA 4IUPA 4BB7A 4DOVA 1O9SA 3L1AA 5GMKe 3L2WA 2QQSA 2VV5A 4P3NA 1PSEA 4XAXB 3M5AA 3KUFA 4DQ2A 2PU9B 4Y28E 4P74C 2E1HA 2ZIOA 3FC3A 3HXXA 4BY6B 5DLOA 1FXXA 3OY9A 2CYZB 1KMNA 1Y96A 2ZZDA 2DXBA 3QZ9B 3VUBA 1WQWA 5CK9A 4F7UF 4TVAB 5GAN8 5CKBA 3FDRA 2KY9A 3HP9A 3QXEB 4N0AA 1G51A 2ARUA 2HQXA 4P75C 3CXCA 1YB3A 2EQKA 2QHVA 3PIPA 3LWIA 2EFIA 3E9IA 4H2XA 1X55A 5HK3A 2RHXA 2RM4A 4TQDA 2RI2A 3QDRB 3NTIA 4NS5A 4PJOE 2P0LA 3CCVA 4M75E 4OLFA 3CCJT 4QQ6A 1JBMA 2X4JA 4JS5A 1N8RU 3CC2A 4TTVA 3HFZA 1NJ1A 5GANd 3TEEA 2QEXT 3VYGA 2R57A 2CJAA 4O2DA 3FEOA 1NE8A 4YREA 1J5WA 3HTZA 2D6FA 1KD1C 1NJ8A 4YRGA 1BI0A 2M1HA 3OMCA 3H6ZA 2E10A 3OB9A 4PJOG 4CI0C 2NS6A 4FU6A 4M75G 4C0ZA 3ZFJA 4YRSA 3LSSA 2ZPHB 4YROA 4XTVA 2VYTA 4YDQA 1GGMA 3A8MB 2IG0A 2RI5A 2RHSB 1G5VA 4D6WA 2RJEA 2OAUA 2RHIA 3M55A 1B7YA 3L4GB 2K2VA 5CKHA 4O6JA 3RMQA 3REUA 1BI2A 3A8GB 4HA8A 3S3NA 1NJ2A 3LGFA 2O01E 3JCMf 3OQ5A 2LCCA 4N4IA 3S6WA 1UGPB 2YHTA 4XK8E 1JRIA 5EG2A 4HWPA 4KUIA 1W2BA 3MO8A 4PJOC 4M75C 4P73C 5DY9A 2RHQB 3MP8A 1O75A 1VQ7A 3QBYA 3HRUA 3JB9D 2EQMA 3DKMA 3PFSA 5CVIA 2R58A 1BBUA 4B9XA 2K57A 4XEMA 3CC2T 4YRLA 4CH6A 4MMLA 4LVLA 4OVAA 3CBOA 3NELA 3J80E 4IUUA 3X28B 2DZ9A 4BACA 3RERA 3VQVA 1Y71A 1DJ7B 1MHNA 2V8IA 3O8VA 4CS2A 2FVUA 5CKEA 4ZIBA 1K8AC 3OS1A 4PJOB 4H2XB 4M75B 1EFWA 4TQFA 4LDWA 4K86A 1E22A 3I55A 1D3BA 3QIIA 4CS4A 2OTLT 2CJ9A 4P72A 5K1PA 2E70A 2CJBA 3OYKA 3OS2A 3M57A 4C5IA 4P71A 5LJ3h 11ASA 3PGGA 4JJNK 3VQXA 2LQ8A 2HBPA 2KSSA 1IREB 1VQ7T 2JNGA 2XI9A 4RG8A 3HXYA 4DPGA 2RI3A 3ZBDA 3CCST 4YRFA 3KXTA 3DSQA 2K3XA 1RIQA 2K5IA 4NOYA 1B7YB 3W3SA 3OW2S 3GIBA 2E5AA 3JCMJ 3QYHB 2GCXA 4JLGA 2RB6A 1YFTA 1YITT 5HY6A 3QO8A 5CIUA 2ZPIB 3VKIA 4M77A 1Q7YU 1GXIE 5C52B 3QKJA 3NEMA 2KMTA 2R5AA 4M77E 2DZCA 3IKLA 4O5VA 3A8LB 2ZT6A 3KFUA 4M7AF 1NYRA 3CMEA 4J7FA 4MZPA 4LDXA 1UGQB 5CKFA 3OBWA 3JB9H 1I8FA 4F7UB 1S72A 1G5HA 3R07A 4BDYA 1KMMA 4KR3A 3I55T 3ZEHA 1X2GA 3CCET 2QQ9A 2GFUA 4YP0A 1EIYA 2YLBA 1Z7NA 4IURA 3HSBA 1FX7A 2ZPEB 3HFOA 2E41A 4M77G 4VUBA 1QP2A 3A5YA 2CIMA 3VUZA 2D0QB 2Q5IA 1VQKT 4ELYC 1KQ2A 1OYXA 3F70A 3GNGA 1Q7YC 2EL9A 1QP3A 4JRKA 4PLIA 5GAOr 1JJCA 3CPFA 2DDZA 1E1OA 2ZNIA 3NETA 4M78F 5J26A 1YIJA 4XTXA 5A0GA 4KULA 5HK0A 1Q86U 2EQJA 4B9WA 3HXUA 4M77D 3OYMA 1B70A 2E5QA 5CAIA 2DXUA 1M1GA 3WXMB 4M7DD 3VQWA 4YRNA 3Q1JA 1KHIA 4YRPA 2ZCEA 3HRSA 2LC4A 1ADYA 5HGQA 1VQ4T 4E7KA 3L2RA 3OYEA 2HQEA 1M4ZA 2DVEA 1VQNA 4TVAA 3ICAA 2DTHA 3CMET 3REXA 1K9MU 4NCXA 4EPCA 4XTYA 2P0QA 3VJPA 2XIDA 1S72T 1RL2A 2ODRD 3V7SA 4ZTJA 2LQKA 2RD1A 3CEYA 5GAMh 1G5IA 2MI6A 3L2QA 1I4K1 1YCYA 3DLLA 2MWOA 3UPUA 4L6V5 2Y90A 1FYFA 4M77B 3JAME 3R6OA 1TH7A 3A8HB 2P0KA 2CGHA 1LOJA 4X9CA 3URGA 4C0DB 1H641 1VQLT 3NTHA 3G4ST 1KG1A 4UP9A 4N4HA 4Z02A 5D6XA 4A53A 2AMCA 4RMFA 1K9MC 4LNSA 5DM7R 3P8BB 1UB4A 4P75A 5J3BA 2XK0A 2G3RA 3BW1A 2C8MA 3PMIA 4OB0B 3JB9I 1EIYB 4YRMA 4BWAA 5I2MA 1W4SA 4M78E 4OB2B 1NNHA 1R8OB 2JUFA 2QQBA 2GFAA 4EMKC 4LVJA 1M5Q1 2XDBA 2VXFA 2QTXA 4GLKA 1BBWA 2QQRA 3QTCA 4J8OA 4C8QF 1YI2T 2XU8A 2JZ2A 3OSSC 4NL2A 1JJCB 1VQNT 3TUPA 3JSCA 3GP8A 5KNNA 2RHYA 5GAMg 1PYSA 4M7AC 4H02A 2A3LA 4KUDK 3DLMA 2DD4A 2BKDN 4BE2A 3OYLA 4M78G 3HXWA 3CCLT 3I56A 1EIFA 4HWOA 3CCUA 1B70B 2VC8A 3HXVA 4DOWA 2EYQA 4C0GA 4IUTA 4FIBA 3G71A 1M9SA 1G3WA 1KD1U 3GLXA 3G6ET 2E6ZA 4IUVA 4C5HA 2DEQA 1VQ5A 2DIGA 4E51A 2L3RA 4LVKA 1AHJB 4HT9A 3PT9A 3HFNA 2CZ1B 4EMKB 2FL7A 5IAYA 3JCMX 3UGTA 1LJOA 4M78C 5ELOA 1FWZA 5LJ3f 4PJOA 1QVPA 2A7YA 4M75A 3CCQA 4P73A 5GAMj 5GAN4 4K88A 3A8OB 4EO4A 1N9RA 4RDXA 3PCOA 3M59A 2JN0A 3L2VA 3E9HA 3GOXA 5KE3A 4HCZA 3X25B 4R55A 1N9SA 3G7ZA 3CCRA 3NENA 4XU2A 2ZXFA 2L5QA 4HT8A 2DQ3A 3UH0A 4FM4B 1QVFS 4BE0A 4PG3A 4QVCA 4HCCA 4JDSA 2FHDA 5GAMe 3LX7A 1U8RA 3X26B 2QA4T 2AMCB 5CQYA 5AYFA 5FRMA 2QHTA 3HFVA 3C95A 3I56T 5GANh 3CCUT 3HKSA 4K87A 3LH0A 4M78B 2BUDA 4WJ3M 2EIFA 1KHCA 2X4YA 5IN1A 3T9NA 1M8VA 4UP7A 5LJ5f 1V29B 3PNWC 2C7IA 3MEAA 5C0MA 3OD1A 1B34A 2RK2A 4RCCA 1YJ9A 1E1TA 4PJOD 3GNFB 4M75D 2ARSA 3MQZA 3QO5A 1VQ5T 1B8AA 3WVEB 3S3OA 2V8JA 5FU7C 4LDUA 2V8KA 1K8AU 3OYFA 1PYSB 2OTJA 1KQSS 3H8ZA 2CZ0B 3CCQT 2DO3A 3HRIA 3C4SA 4LD9K 4F7UA 3CCVT 2ZR2A 2Q7HA 3I7FA 1ATIA 1NPPA 2I4LA 1WLEA 3VQYA 5GAN5 4F7UE 1YGBA 3MEYA 3V7RA 4ZTUB 2JVVA 3NFCA 3QG1A 2EWNA 1WNLA 2WSFE 3CCRT 1ASYA 1ZQ1A 2XKOC 1WPYA 1M1KU 2IVWA 3P8HA 4G85A 1H4VB 4BDZA 1HTTA 5LL6S 3P8VA 5FROA 2LRQA 4C8QC 1VQOA 4LVMA 5GANg 4MDWA 2ZPFB 4C92F 2EQUA 3QUIA 1LNXA 1K73C 2QHSA 4F7UG 3OS0A 2K5FA 4RCBA 2EJGA 2GF7A 1M90C 3CC7A 2DU5A 4H2TA 1QW1A 4E7HA 1NJ5A 3PCOB 1VQ8A 1L0WA 5LJ3d 2XDDA 4EMHA 1QE0A 1YJ9T 3CC4A 3A5ZA 3M4GA 1BI3A 4EMGA 2PMFA 1M1KC 5GAOm 1VIEA 2DPPB 1WQ7A 4HWRA 3RIRA 2OTJT 4WF2A 2E64A 2BIVA 4TVWA 2ZT8A 5GANj 2EJ9A 4UPAA 1Q81U 4WI1A 5IT9E 3CPWS 3JCMb 3HRTA 4J5YA 3VU3C 5GMKl 1B34B 4HCBA 1NJ6A 4QVZA 1Y07A 2VUBA 3JCMQ 2LT4A 5LJ5d 5CR2A 5E3IA 2A8EA 3RF1A 3QJYA 3OYYA 2K3YA 5GANe 5FLXE 1C0AA 1X56A 3JCMd 3ASKA 4PHCA 4CH5A 4TWAA 4MMKA 1IL2A 3RGLA 1X6OA 1W66A 3FJPA 2M16A 1X01A 3M4PA 1QF6A 1Q81C 1N6AA 2MWPA 1VQ8T 4H2UA 4E7JA 1IZ6A 1BYMA 3EFRA 2I4NA 4FT4A 5D6YA 3CC4T 1QVGS 3CMAA 3SWNC 3M4QA 1P92A 3UT1A 1N9WA 1X75C 3E19A 1VUBA 4J83A 4TVYA 1YHQA 3OYDA 3HPWA 2VGMA 2ZR3A 2XDPA 2RJFA 4CRIA 4Q15A 2ZGWA 1NJIC 4FL6A 2RA2A 3V7CA 4MZTA 2LDMA 1YJWA 1ADJA 1USYC 3L2ZA 4J6WA 4OGEA 3OW2A 2DTOA 4NL3A 4A4HA 3FRNA 2EKOA 3L42A 4HKEA 3A5ZB 2Y4XA 2O4XA 4ATOA 4J15A 4YYEA 4EMKA 3LWHA 4ZGDB 3CCMA 4C92C 4J6XA 2KQWA 3QO7A 4M7DC 5LJ5g 3VV0A 4DA4A 3KBGA 4HWTA 1NPRA 4JS4A 4M7AA 1NYQA 2Q7EA 1UGRB 3OYBA 1EVKA 4N4GA 2XTIA 3JCMg 3LGLA 4PL6A 4YCVA 2LNVA 3OYJA 4EDUA 4M7AE 1UGSB 3CMAT 5KCHA 2P0PA 4EX5A 1EVLA 1UEBA 4XU1A 2PVDB 4YCWA 1OZ2A 4L59A 2LX9A 3OA6A 4ZTFA 2I4MA 5KE2A 1YHQT 4RQFA 2KAFA 1YIJT 4QVDA 3RESA 2AKWA 4PLLA 4YRQA 1WJQA 4ELZC 4M7AG 3CMQA 1YBYA 3CXCS 4XTWA 4C92B 4M78A 5FU6C 2GQVA 2IY5A 5GAOl 1YJWT 2CZ6B 3J81E 3MP1A 5CKDA 3RKYA 1JB0E 3RUXA 3JB9F 3A74A 2ZZEA 1BIBA 3BY7A 1I5LA 1XNIA 2RH2A 1OI1A 3META 1HXDA 3V8KA 1E24A 1WJSA 3LW5E 3RKXA 5GMKj 5C6SA 4M7AD 3G1ZA 4BI3A 5A0LA 4WJ4A 2RHUA 1KC8U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQX A;  2C7I A;  5GAO q;  3A7A A;  3OD1 A;  1B34 A;  4RCC A;  3QNE A;  3IG2 A;  3QO3 A;  5K1X A;  4M77 C;  1H4S A;  1E1T A;  1VQZ A;  4PJO D;  1D3B B;  4C92 D;  4M75 D;  3HXY A;  4DPG A;  2ARS A;  3BJU A;  4HWS A;  1X54 A;  3SWN B;  4YCU A;  3QO5 A;  3RKW A;  4YRF A;  5GAM d;  1B8A A;  2ZZF A;  3DSQ A;  3TEH A;  1Z7M A;  5LJ3 j;  1RIQ A;  4NOY A;  4YRT A;  4XTZ A;  5C51 B;  2I4O A;  1B7Y B;  4XEO A;  1KOG A;  3ERR A;  3W3S A;  3GIB A;  4YRC A;  1PYS B;  2E5A A;  3JCM J;  2RB6 A;  1YFT A;  4XU3 A;  3BDU A;  3QO8 A;  3HRI A;  2ZZG A;  4M78 D;  4F7U A;  1WYD A;  2ZR2 A;  3I7F A;  2Q7H A;  4M77 A;  2J3L A;  4V2S A;  5GMK m;  1ATI A;  3P8Y A;  5C52 B;  2I4L A;  3TEH B;  5GAN f;  1WLE A;  3NEM A;  4H2Y A;  3BFM A;  3VQY A;  5GAN 5;  4F7U E;  4M77 E;  2XGT A;  2DZC A;  1YGB A;  3MEY A;  2ZNJ A;  2ZTG A;  3QSU A;  3IKL A;  3V7R A;  4ZTU B;  2ZT6 A;  3KFU A;  4M7A F;  2ODR C;  2EWN A;  5LJ3 e;  1WNL A;  1NYR A;  1ASY A;  4M7A B;  1X2H A;  1WPY A;  2Q5H A;  4HVC A;  4G85 A;  3JB9 H;  3WQZ A;  1H4V B;  1I8F A;  4F7U B;  1HTT A;  1G5H A;  3P8V A;  3R07 A;  4C8Q C;  4KR2 A;  4P74 A;  1KMM A;  5GAN g;  1SET A;  4KR3 A;  2QHU A;  1X2G A;  2J3M A;  2E3C A;  4PJO F;  4C92 F;  3MF2 A;  4YP0 A;  4M75 F;  1EIY A;  2YLB A;  1Z7N A;  3QUI A;  4J6Y A;  3HSB A;  4CS3 A;  1LNX A;  5LJ5 j;  2QHS A;  3HFO A;  4F7U G;  4M7D B;  2FB7 A;  2E41 A;  4M77 G;  4RCB A;  4BW9 A;  2EJG A;  3A5Y A;  3MF1 A;  2CIM A;  2P5I A;  2I2L A;  2Q5I A;  1KQ2 A;  4JLI A;  2EAY A;  4X5O A;  1H4Q A;  2DU5 A;  4CH4 A;  4H2T A;  2DTI A;  1NJ5 A;  2EL9 A;  3PCO B;  4CH3 A;  2RHS A;  1L0W A;  5LJ3 d;  5I21 A;  2DXT A;  2AKW B;  2DKG A;  3HY0 A;  4H2S A;  4EMH A;  4JUV A;  1QE0 A;  4JRK A;  4RQE A;  5GAO r;  1JJC A;  4C8Q A;  2DDZ A;  1E1O A;  2ZNI A;  3NET A;  3L4G A;  4M78 F;  4YPF A;  3LC0 A;  4XTX A;  1EQR A;  4JRI A;  3UFG A;  1BIA A;  4C8Q E;  2IY5 B;  1SES A;  2FYK A;  3A5Z A;  3M4G A;  3HXU A;  4Y91 A;  4EMG A;  4M77 D;  2PMF A;  2HNI A;  5GAO m;  4OP0 A;  1B70 A;  1WQ7 A;  5CAI A;  5LJ5 e;  1YFS A;  2DXU A;  4HWR A;  3RIR A;  4WF2 A;  2E64 A;  4TVW A;  1HC7 A;  2ZIM A;  2ZT8 A;  5GAN j;  4M7D D;  2ZT7 A;  2RHQ A;  2DQ0 A;  3VQW A;  4YRN A;  2ZT5 A;  2EJ9 A;  4YRP A;  2ZCE A;  4L87 A;  4UPA A;  3JCM e;  3JB9 G;  4WI1 A;  3LSQ A;  1ADY A;  3JCM c;  3JCM b;  4J5Y A;  3VU3 C;  1B76 A;  5HGQ A;  4ZTZ B;  3V8J A;  2DU7 A;  2G4C A;  5GMK l;  4C8Q G;  3L1A A;  5GMK e;  1B34 B;  4N0A C;  4YRJ A;  1NJ6 A;  2DVE A;  4TVA A;  3ICA A;  2DTH A;  4P3N A;  4DQ2 A;  3P8T A;  3REX A;  4P74 C;  3INZ A;  2E1H A;  3JCM Q;  4NCX A;  4XTY A;  5LJ5 d;  5E3I A;  2ZIO A;  3HXX A;  3RF1 A;  2ODR D;  3V7S A;  4XTU A;  2RD1 A;  5GAM h;  5F5W A;  1G5I A;  3PZC A;  5GAN e;  4P3O A;  1I4K 1;  1KMN A;  1X56 A;  1C0A A;  3JCM d;  4AH6 A;  1Y96 A;  1YCY A;  1I81 A;  2DJZ A;  4PHC A;  4CH5 A;  4TWA A;  1WQW A;  4MMK A;  4C8Q D;  1IL2 A;  3RGL A;  2Y90 A;  4F7U F;  4TVA B;  5GAN 8;  2ARU A;  4M77 F;  4N0A A;  1G51 A;  2ALY A;  4P75 C;  1FYF A;  1W66 A;  1YB3 A;  3FJP A;  4M77 B;  12AS A;  1X01 A;  3M4P A;  2QHV A;  3E9I A;  4H2X A;  1TH7 A;  1QF6 A;  1X55 A;  4H2U A;  4YRI A;  2RM4 A;  2CGH A;  2VXE A;  4M7D F;  3A7R A;  4TQD A;  3EFR A;  4PJO E;  2I4N A;  2P0L A;  1LOJ A;  4X9C A;  4M75 E;  4OLF A;  3UGQ A;  1U1S A;  1Y96 B;  1H64 1;  1JBM A;  3AHU A;  4H2W A;  4TTV A;  3HFZ A;  4UP9 A;  3SWN C;  5GAO n;  1NJ1 A;  5GAN d;  3M4Q A;  4UP8 A;  2YLC A;  3EFS A;  2AMC A;  4A53 A;  4RMF A;  2CJA A;  4LNS A;  4O2D A;  1N9W A;  3IKM B;  1KQ1 A;  4P75 A;  3BW1 A;  1MGQ A;  4YRE A;  1J5W A;  3HTZ A;  2C8M A;  2E65 A;  4TVY A;  4PNO A;  3JB9 I;  1EIY B;  4YRM A;  5GAM f;  4BWA A;  1NJ8 A;  4P3P A;  4YRG A;  4M78 E;  2ZR3 A;  2E10 A;  1NNH A;  4PJO G;  3HXZ A;  4M75 G;  3HFZ B;  4YRS A;  4G84 A;  4Q15 A;  1ASZ A;  2ZGW A;  4EMK C;  1M5Q 1;  3LSS A;  2VXF A;  1SER A;  3SWN A;  4YRO A;  4XTV A;  1LYL A;  2RA2 A;  1H4T A;  4YDQ A;  2QTX A;  1GGM A;  2RHS B;  1BBW A;  3QTC A;  3V7C A;  4C8Q F;  3JCM V;  1ADJ A;  1USY C;  3L2Z A;  4NL2 A;  5GAN 3;  4J6W A;  1JJC B;  3TUP A;  4C8Q B;  2PME A;  2DTO A;  1B7Y A;  4NL3 A;  3L4G B;  5KNN A;  5GAM g;  1PYS A;  5GAN 6;  4M7A C;  4H02 A;  3REU A;  1SRY A;  1HK9 A;  3RL6 A;  4HA8 A;  1NJ2 A;  4M78 G;  4Q6G A;  3HXW A;  5GAN 2;  1U1T A;  3JCM P;  3JCM f;  4KQE A;  4J15 A;  4HWO A;  4YYE A;  4X9D A;  1B70 B;  2VC8 A;  3SB2 A;  4WJ4 A;  4EMK A;  2YHT A;  3HXV A;  1JRI A;  4HWP A;  4XU0 A;  4PJO C;  4C92 C;  4J6X A;  4M75 C;  4P73 C;  5DY9 A;  3QO7 A;  4M7D C;  2RHQ B;  5GAN 7;  1USY A;  5LJ5 g;  4XQ3 A;  4HWT A;  3JB9 D;  5C53 B;  4YRR A;  4M7A A;  1NYQ A;  2Q7E A;  2ZIN A;  1EVK A;  3HY1 A;  2XTI A;  3JCM g;  2DEQ A;  4E51 A;  4YCV A;  3IAL A;  3RAC A;  4HT9 A;  4M7A E;  3HFN A;  1BBU A;  4EMK B;  5GMK i;  2K57 A;  4XEM A;  3JCM X;  3UGT A;  4YRL A;  1LJO A;  3TEG A;  4CH6 A;  4M78 C;  1YFR A;  5ELO A;  4MML A;  5LJ3 f;  3JCM W;  4PJO A;  4C92 A;  4EX5 A;  1EVL A;  4M75 A;  3QHS A;  4P73 A;  5GAM j;  4M7D A;  2ART A;  3FIF A;  4XU1 A;  5GAN 4;  4K88 A;  3NEL A;  4YCW A;  5LJ5 h;  2DZ9 A;  3RER A;  4C92 E;  4H2V A;  3VQV A;  1WU7 A;  2I4M A;  2EJF A;  4EO4 A;  1N9R A;  5GAO p;  4M7D E;  4YRK A;  4RDX A;  4RQF A;  4QVD A;  3PCO A;  2JN0 A;  3RES A;  2AKW A;  2Q7G A;  4P72 C;  4YRQ A;  3JCM h;  3E9H A;  4CS2 A;  2ALY B;  3V8L A;  4M7A G;  4ZIB A;  3CMQ A;  1N9S A;  4XTW A;  5LJ3 g;  4P71 C;  4PJO B;  4H2X B;  4C92 B;  4M75 B;  4M78 A;  3A32 A;  3NEN A;  5GMK h;  2IY5 A;  3JB9 J;  5GAO l;  3FB9 A;  1EFW A;  3A7U A;  4XU2 A;  3A31 A;  2ZXF A;  4TQF A;  4K86 A;  4HT8 A;  2DQ3 A;  3UH0 A;  4PG3 A;  4QVC A;  3RKY A;  5GAM e;  4C92 G;  3RUX A;  1E22 A;  3JB9 F;  3A74 A;  2ZZE A;  4M7D G;  1BIB A;  3BY7 A;  5ELN A;  1D3B A;  3VBB A;  1I5L A;  4CS4 A;  4A54 A;  2AMC B;  2CJ9 A;  4P72 A;  2QHT A;  5K1P A;  3HFV A;  2CJB A;  1HXD A;  3V8K A;  1E24 A;  5GAN h;  3RKX A;  5GMK j;  4M7A D;  4K87 A;  3HRK A;  4M78 B;  4WJ3 M;  3G1Z A;  1EOV A;  4P71 A;  5LJ3 h;  1M8V A;  4UP7 A;  11AS A;  5LJ5 f;  3PGG A; 
#chains in the Genus database with same CATH topology
 2RQW A;  1GFC A;  2QEX A;  3CC4 Q;  2K4Y A;  4P5N A;  4YTL A;  3A7A A;  1M27 C;  4C5E A;  4TVR A;  1VQM A;  2AKL A;  3PVL A;  3QNE A;  1NZ9 A;  5K1X A;  4RTY A;  1VQZ A;  2XIC A;  4GY5 A;  1IRX A;  2K5L A;  2DAQ A;  5M9O A;  1XQH A;  1IB8 A;  2B8A A;  3BJU A;  2KXC A;  4HWS A;  4YCU A;  1M1F A;  2DIQ A;  1Z7M A;  3TSZ A;  2MAM A;  3CBM A;  3RR6 A;  4XTZ A;  2HAX A;  5C51 B;  2I4O A;  2KXD A;  2VAS A;  4IUQ A;  4KBM B;  4PFP A;  4XEO A;  1KOG A;  3ERR A;  5FU6 B;  4YRC A;  4OMQ A;  3QWX X;  2LJ1 A;  1TG0 A;  5AT1 B;  2GBQ A;  4E7I A;  1WDX A;  2LCL A;  4AMC A;  1QCO A;  2V26 A;  4L5G A;  4XU3 A;  3BDU A;  2JOY A;  2ZCF B;  3REA B;  4M78 D;  1WYD A;  2O4X B;  4DEX A;  4KH0 B;  4OF1 A;  1VIF A;  5GMK m;  2JTE A;  1PHT A;  4ZGJ B;  3TEH B;  1TU0 B;  1WJR A;  3BFM A;  4OMP A;  1W2B S;  2XGT A;  2JJ9 A;  3MCA B;  4OB1 B;  1KC8 C;  1W70 A;  3H0F A;  2M0O A;  2ZNJ A;  2ZTG A;  4OGC A;  3QSU A;  2M9U A;  4ME7 A;  1I07 A;  2AHJ B;  4LDY A;  4M7A B;  2BE9 B;  1KK7 A;  2KNB B;  2NUP B;  4RMO A;  1WGS A;  1U5S A;  1RI0 A;  2KYM A;  1NEB A;  5L8R E;  2O31 A;  5CCA A;  4KR2 A;  2HKQ B;  2Y4Y A;  3MP6 A;  3TCJ A;  1SET A;  2DL7 A;  3LYI A;  3MF2 A;  4FCY A;  1MND A;  2GGR A;  4J6Y A;  1VQ9 A;  4CS3 A;  3M56 A;  4HVU A;  2AZS A;  3ME9 A;  4BW9 A;  2GNC A;  2MMP A;  3MF1 A;  2L0A A;  5CO7 A;  1XOV A;  2KR3 A;  4JLI A;  2DTI A;  4CH3 A;  5FWC A;  3CMA Q;  2M51 A;  1QKX A;  5A0D A;  5I21 A;  2DXT A;  2AKW B;  4H2S A;  3A98 A;  4A4K A;  1OU8 A;  1VQM T;  2J6K A;  2CZ7 B;  4JUV A;  2QDY B;  2COW A;  4C8Q A;  2F2W A;  4ZN1 A;  1NYF A;  3VS1 A;  2PQW A;  4YPF A;  1PRL C;  3U23 A;  2F5T X;  2L3Q A;  4JRI A;  3MEU A;  3LLR A;  1M30 A;  2LCS A;  1YHQ Q;  4C8Q E;  3OYN A;  2IY5 B;  3OYG A;  1YIJ Q;  4Y91 A;  2HNI A;  3TRE A;  3M58 A;  3QYG B;  1YWO A;  1YFS A;  3G71 T;  2CP0 A;  2E6N A;  2EQI A;  2ZT7 A;  1ZBX A;  4RTW A;  2ZT5 A;  2QQA A;  4L87 A;  3JB9 G;  1YJW Q;  1Z9Z A;  3JCM c;  5D6W A;  1N8R C;  1CSK A;  3IQL A;  4ZTZ B;  3UDC A;  1VQP A;  2OTL A;  1AZE A;  2G4C A;  4WCI A;  1FMW A;  4PJJ A;  2RJC A;  1K73 U;  3ER0 A;  4C8Q G;  4Z89 A;  4N0A C;  4YRJ A;  1UDL A;  2LQW A;  1M90 U;  2RQU A;  1LPL A;  3P8T A;  3INZ A;  2E4H A;  2E3H A;  2E12 A;  3RBB B;  2X3W D;  1RAC B;  5KH6 A;  3VYH B;  3UA6 A;  3E1S A;  3PIO A;  3PVQ A;  3RDV A;  4XTU A;  1VA7 A;  4KT0 E;  3H9N A;  5DLQ E;  5F5W A;  2D1X A;  3PZC A;  2CS7 A;  4P3O A;  4AH6 A;  3CCS A;  1I81 A;  2DJZ A;  2L89 A;  2Z0W A;  1VQ9 T;  4BI8 B;  1VQ6 A;  4C8Q D;  1XJW B;  4CC3 A;  4JJD A;  4PKC C;  4M77 F;  4QW2 A;  1TUC A;  8AT1 B;  2ALY A;  1X69 A;  12AS A;  7AT1 B;  1TUD A;  1YIT A;  4A4F A;  3GPL A;  1I5O B;  4YRI A;  2F69 A;  1XTD A;  2VXE A;  4M7D F;  3A7R A;  4J9B A;  2L3S A;  1JJ2 P;  1QVF A;  2XHC A;  5FU7 B;  3UGQ A;  1U1S A;  1Y96 B;  4Q5W A;  2PUK B;  3AHU A;  4R56 A;  2DNU A;  1WHH A;  1M90 R;  4H2W A;  4RG2 A;  4HXJ A;  3QZ5 B;  5GAO n;  3E9F A;  4UP8 A;  2YLC A;  3EFS A;  1D1C A;  3UWN A;  3IKM B;  1KQ1 A;  1YP5 A;  4ZGE B;  1MGQ A;  2E65 A;  4PNO A;  5I2S A;  1VYU A;  5GAM f;  1C0M A;  4P3P A;  3BDL A;  2FRW A;  5HKC A;  1IHV A;  3DB3 A;  2DD5 A;  2DXC A;  4MDX A;  1IHW A;  1UE9 A;  3HXZ A;  1M1K R;  3HFZ B;  3CCE A;  4HVV A;  4G84 A;  2GTO A;  1ASZ A;  5KYW A;  1VQP T;  2EKH A;  1SER A;  2WAC A;  3SWN A;  1LYL A;  1AWX A;  1H4T A;  3D7S B;  1ZSZ C;  1PG5 B;  2CP3 A;  3JCM V;  2JS0 A;  2KK4 A;  2DMO A;  5GAN 3;  2PZ1 A;  4C8Q B;  2PME A;  1UGV A;  1VQK A;  1N5Z A;  3H0I A;  1KQS A;  2P4T A;  5GAN 6;  1QQJ A;  1SRY A;  1HK9 A;  3GF5 A;  3SFM A;  3RL6 A;  1OQK A;  3E9G A;  2ZPB B;  2YUQ A;  4II1 A;  3SDZ A;  4Q6G A;  5GAN 2;  1U1T A;  3JCM P;  2JTF A;  1SSF A;  3BE3 A;  4KQE A;  1VQM Q;  4IKF A;  2LX7 A;  4X9D A;  3SB2 A;  1Y7X A;  2MPX C;  4F16 A;  3CD6 A;  4GLM A;  4D8D A;  4XU0 A;  1VQ6 T;  1D1B A;  2CP5 A;  3OS5 A;  5KYU A;  4OMM A;  5GAN 7;  1USY A;  1OPL A;  3EG3 A;  2J6F A;  4XQ3 A;  4BD3 A;  5C53 B;  1VQO T;  4YRR A;  2C06 A;  2QI2 A;  4R0K A;  4FYV B;  2ZIN A;  1RAH B;  2A08 A;  3HY1 A;  1OEB A;  2X4X A;  3MEV A;  3G71 Q;  4QQG A;  3IAL A;  3RAC A;  4ZN3 A;  3OYH A;  3TU4 K;  3PE0 A;  5GMK i;  1BKB A;  3HHT B;  1NJI U;  1RI9 A;  2DM1 A;  1VQ4 A;  2HSP A;  3TEG A;  3CC7 T;  5KCO A;  1YFR A;  2F5K A;  3JCM W;  2W10 A;  4C92 A;  1Q81 R;  3QHS A;  2XD0 A;  4M7D A;  2ART A;  3FIF A;  2A28 A;  4PK4 A;  5LJ5 h;  2DVJ A;  2NLU A;  2HD0 A;  4E47 A;  4H2V A;  2AK5 A;  4C92 E;  1WU7 A;  2R5M A;  2EJF A;  3QJ6 A;  3UAT A;  1W1F A;  1U06 A;  5GAO p;  3PTA A;  4JRQ A;  4M7D E;  4YRK A;  2JTM A;  2ZAE A;  1RAB B;  1TXQ A;  2WSC E;  3EAE A;  2Q7G A;  4P72 C;  3JCM h;  2XG8 D;  2KVQ G;  1PD1 A;  1E6G A;  2ALY B;  3OYC A;  3V8L A;  2DF6 A;  2LTO A;  4X34 A;  5LJ3 g;  4P71 C;  4A4E A;  1FMV A;  3M9Q A;  3A32 A;  2DK3 A;  2QGF B;  5GMK h;  2QDL A;  3OSV A;  3S3M A;  3JB9 J;  2D9T A;  3DB4 A;  3FB9 A;  1VQ9 Q;  3A7U A;  3A31 A;  3J7A F;  1G3T A;  3RNJ A;  4A63 B;  2KRS A;  1YJN A;  1QWE A;  4DBF A;  4C92 G;  1K4U S;  2RJD A;  2QXF A;  2KDS A;  4PJN A;  1JJ2 S;  4M7D G;  5ELN A;  3OBY A;  1NJI R;  1JXO A;  3VBB A;  3UF4 A;  4A54 A;  3M53 A;  1PKT A;  4OMN A;  3OMG A;  3SD4 A;  4C0F A;  2LT1 A;  1VQL A;  4E7L A;  3G4S A;  3CPW A;  3HRK A;  2PVO B;  3SHW A;  2H3J A;  2ZPG B;  4AFZ C;  3OYA A;  1EOV A;  3NHN A;  2VGN A;  4BE1 A;  1N27 A;  3CD6 T;  1PRM C;  4OMF B;  4QT7 A;  4MZM A;  3OYI A;  5GAO q;  4FSX A;  2COY A;  1AWW A;  3HL8 A;  3IG2 A;  1K1Z A;  1G3S A;  3QO3 A;  4J7I A;  1QCN A;  1PSF A;  4M77 C;  1MV0 B;  2C0I A;  1H4S A;  1D3B B;  2OI3 A;  2OX7 A;  4OB3 B;  4C92 D;  2EYZ A;  4RUG A;  1X54 A;  1W2B P;  4RKU E;  3SWN B;  4X1V A;  3RKW A;  3X24 B;  3JRZ A;  3QPH A;  5GAM d;  3TEH A;  2LMJ A;  2ZZF A;  2CKK A;  5LJ3 j;  1H3Z A;  4DBR A;  1TUG B;  4YRT A;  4C0D C;  4LVI A;  1G3Y A;  1ZHI A;  3VS0 A;  2IIM A;  1WHM A;  4UC4 A;  1VQP Q;  1SPK A;  1YI2 A;  2NUP A;  2DA9 A;  4M4Z A;  8ATC B;  2ZZG A;  3M54 A;  3RMS A;  1AD5 A;  1NLO C;  4E6R A;  2J3L A;  4V2S A;  3P8Y A;  2QG9 B;  5GAN f;  4BI4 A;  4H2Y A;  1UJ0 A;  2MF2 A;  1GL5 A;  1Q86 C;  3CCL A;  5KYU B;  2RHZ A;  4C5G A;  2ODR C;  1QVG A;  2DL3 A;  2DBK A;  5LJ3 e;  4DEY A;  5J39 A;  1K0S A;  1X2H A;  2RMO A;  2Q5H A;  4HVC A;  3WQZ A;  1VQ6 Q;  3MEW A;  3EGU A;  1ZUK A;  2RK1 A;  2DIL A;  1YJN T;  1Q82 U;  4P74 A;  3X20 B;  3FLG A;  2QHU A;  4AFS C;  2J3M A;  3G6E A;  3R6N A;  4PJO F;  2C0T A;  2E3C A;  4M75 F;  1VQO Q;  3P8D A;  1PD0 A;  2RPN A;  5LJ5 j;  1ZX6 A;  4M7D B;  2FB7 A;  2X4W A;  5A2Q E;  1AZG B;  4QQD A;  2QYZ A;  1BI1 A;  3L2U A;  1JJ2 A;  2QK0 A;  2NYS A;  2P5I A;  2I2L A;  3C12 A;  5CQX A;  3M0R A;  1OZ3 A;  4LD6 A;  3QDF A;  1NM7 A;  2EAY A;  2EBP A;  4FYY B;  4X5O A;  4CH4 A;  1H4Q A;  1IGQ A;  1V76 A;  2M02 A;  2RHS A;  2YRV A;  2DKG A;  3CC7 Q;  3HY0 A;  1WHG A;  3AT1 B;  4RQE A;  1B07 A;  3CCJ A;  1KIK A;  3THK A;  3L4G A;  4BY6 C;  3LC0 A;  3EG1 A;  1EQR A;  2O88 A;  1SF9 A;  5FWB A;  2L8D A;  3UFG A;  1BIA A;  4CC2 A;  1SES A;  3M4Y A;  2FYK A;  3CCM T;  2ED1 A;  1AEY A;  3WVD B;  4OP0 A;  2PUO B;  1QCF A;  2NUT B;  2X35 A;  5LJ5 e;  3CBP A;  2LVM A;  4DBH A;  2PVG B;  1Q82 C;  3EGX A;  2RO0 A;  1HC7 A;  2ZIM A;  3PMT A;  3NGP A;  2CT4 A;  4J9C A;  2RHQ A;  4FT2 A;  2DQ0 A;  2WSE E;  4A4G A;  4KGZ B;  4JRP A;  3C94 A;  4LDV A;  3NTK A;  3JCM e;  3LSQ A;  3GBQ A;  1B76 A;  2QA4 A;  4HT4 A;  2MCN A;  3V8J A;  4BUG A;  3N5B B;  3MHX A;  2DU7 A;  2ESW A;  5FRN A;  4IUP A;  4BB7 A;  4DOV A;  1O9S A;  3L1A A;  5GMK e;  1ZLM A;  3L2W A;  2QQS A;  2VV5 A;  4D8K A;  4P3N A;  1PSE A;  4XAX B;  3M5A A;  3KUF A;  2LP5 A;  4DQ2 A;  2PU9 B;  4Y28 E;  1PKS A;  4P74 C;  2EGA A;  2E1H A;  3CD6 Q;  2ZIO A;  3FC3 A;  3HXX A;  1M3A A;  1X43 A;  4BY6 B;  5DLO A;  5IHN A;  1KC8 R;  1FXX A;  3OY9 A;  2CYZ B;  1KMN A;  1Y96 A;  2H8H A;  2ZZD A;  2DXB A;  3QZ9 B;  3H41 A;  2CDT A;  3VUB A;  1WQW A;  2EGE A;  3VS5 A;  5CK9 A;  4F7U F;  4TVA B;  5GAN 8;  5CKB A;  3FDR A;  2KY9 A;  3HP9 A;  3QXE B;  4N0A A;  1G51 A;  2ARU A;  4RTZ A;  2HQX A;  1ARK A;  4P75 C;  3CXC A;  1YB3 A;  2BZY A;  2EQK A;  2QHV A;  3PIP A;  3LWI A;  2EFI A;  3E9I A;  2A36 A;  4H2X A;  4AT1 B;  1X55 A;  5HK3 A;  4E7Z A;  2RHX A;  2RM4 A;  4TQD A;  2RI2 A;  2L2P A;  3QDR B;  3NTI A;  4NS5 A;  4PJO E;  3I35 A;  2P0L A;  3CCV A;  4M75 E;  1X6B A;  4OLF A;  3CCJ T;  4QQ6 A;  1JBM A;  2X4J A;  1RUW A;  1KJW A;  4JS5 A;  1N8R U;  2FPE A;  3CC2 A;  4TTV A;  3HFZ A;  2JM9 A;  2HDA A;  1NJ1 A;  5GAN d;  4ANJ A;  4AFQ C;  3TEE A;  2QEX T;  3VYG A;  2R57 A;  2CJA A;  3MPU B;  2DL5 A;  3TQ7 P;  4O2D A;  3FEO A;  1BBZ A;  1NE8 A;  4YRE A;  1J5W A;  1NBE B;  3HTZ A;  2D6F A;  2RN8 A;  2O2O A;  1KD1 C;  1NJ8 A;  1A0N B;  4YRG A;  2ROT A;  1BI0 A;  2M1H A;  3OMC A;  3H6Z A;  2E10 A;  3OB9 A;  1PCX A;  2DYB A;  4PJO G;  4CI0 C;  2NS6 A;  4FU6 A;  4M75 G;  4C0Z A;  3ZFJ A;  4YRS A;  1SKU B;  3LSS A;  1YJN Q;  2ZPH B;  1TTH B;  4YRO A;  1YWP A;  4XTV A;  2VYT A;  4YDQ A;  1GGM A;  3A8M B;  2IG0 A;  2RI5 A;  2RHS B;  1U3O A;  1JXM A;  3OW2 P;  4D6W A;  3EFO A;  1G5V A;  1ZA2 B;  2RJE A;  1YN8 A;  4HVW A;  2OAU A;  2KI7 A;  2HL3 A;  2RHI A;  3M55 A;  1B7Y A;  3L4G B;  2K2V A;  5CKH A;  1F1B B;  4O6J A;  3RMQ A;  3REU A;  4LUD A;  3M0T A;  2C0O A;  1N8R R;  1BI2 A;  3A8G B;  3M0P A;  4HA8 A;  3S3N A;  1NJ2 A;  3LGF A;  1KFZ A;  2O01 E;  2CH4 A;  3JCM f;  2EYX A;  3OQ5 A;  2LCC A;  4N4I A;  1ZSG A;  4B6M A;  1X27 A;  3S6W A;  1UGP B;  2YHT A;  4XK8 E;  3EGX B;  3TVT A;  1JEG A;  1JRI A;  5EG2 A;  4HWP A;  4KUI A;  1W2B A;  3MO8 A;  4PJO C;  4M75 C;  4P73 C;  5DY9 A;  2VWF A;  1R0C B;  1ZSZ A;  2RHQ B;  3MP8 A;  1O75 A;  3CCM Q;  1VQ7 A;  2K7A A;  3QBY A;  3HRU A;  3JB9 D;  2EQM A;  2CP2 A;  3DKM A;  3PFS A;  5CVI A;  1SHF A;  2R58 A;  1TOV A;  1WIE A;  2YUP A;  1BBU A;  4B9X A;  2K57 A;  2JMA A;  4XEM A;  3CC2 T;  1Y57 A;  4YRL A;  4CH6 A;  1RAA B;  4MML A;  2RQV A;  4LVL A;  1AVZ C;  4OVA A;  3CBO A;  3NEL A;  1PNJ A;  3J80 E;  4IUU A;  1UHC A;  3X28 B;  1K73 R;  2DZ9 A;  4BAC A;  3RER A;  5IXB A;  3VQV A;  1Y71 A;  2HEQ A;  1DJ7 B;  1MHN A;  1QWF A;  2YUN A;  2V8I A;  2J6O A;  2EYY A;  3O8V A;  1H92 A;  4CS2 A;  2FVU A;  5CKE A;  4ZIB A;  3VS4 A;  1K8A C;  3OS1 A;  4PJO B;  4H2X B;  5KYX B;  4M75 B;  4Z88 A;  2J06 A;  1EFW A;  1JO8 A;  4TQF A;  1WFW A;  4LDW A;  4K86 A;  2G6F X;  1E22 A;  3I55 A;  1D3B A;  3QII A;  3REB B;  4CS4 A;  2KRO A;  3MJX A;  2OTL T;  2HL5 C;  4K11 A;  2CJ9 A;  4P72 A;  5K1P A;  2E70 A;  2CJB A;  4KGX B;  3OYK A;  4PFZ A;  2BE7 D;  3OS2 A;  3M57 A;  1K0X A;  1D1A A;  1OV3 A;  4C5I A;  3CCJ Q;  4P71 A;  5LJ3 h;  2KGT A;  11AS A;  3PGG A;  1PC0 A;  4JJN K;  1K9A A;  3VQX A;  2LQ8 A;  2HBP A;  2KSS A;  1H3H A;  1IRE B;  4DBQ A;  1VQ7 T;  2JNG A;  2QEX Q;  1ABO A;  2JXB A;  2XI9 A;  4RG8 A;  3HXY A;  4DPG A;  2OAW A;  2RI3 A;  3ZBD A;  3C0C A;  3CCS T;  4YRF A;  2ATC B;  3KXT A;  3DSQ A;  1ZUU A;  2K3X A;  1RIQ A;  2K5I A;  3EFO B;  4NOY A;  1GCP A;  1UTI A;  4CC7 A;  1J3T A;  1B7Y B;  3W3S A;  2RQT A;  3OW2 S;  3VS7 A;  3GIB A;  2E5A A;  3JCM J;  1BB9 A;  1X2Q A;  3QYH B;  2GCX A;  2P4R A;  4JLG A;  2RB6 A;  1R0B G;  1YFT A;  1YIT T;  1V1C A;  5HY6 A;  1T3S A;  2EW3 A;  3QO8 A;  2ENM A;  5CIU A;  1YFN A;  2ROL A;  2ZPI B;  3VKI A;  2DJQ A;  4M77 A;  1Q7Y U;  1GXI E;  5C52 B;  2DX1 A;  3QKJ A;  2MYS A;  3NEM A;  1HD3 A;  2HKN A;  2KMT A;  2R5A A;  4M77 E;  1ZSZ B;  2DZC A;  4KH1 B;  4O5V A;  3IKL A;  3A8L B;  2ZT6 A;  3KFU A;  2PNI A;  4M7A F;  1NYR A;  1MMG A;  1CKA A;  3CME A;  1LCK A;  2HZY A;  4J7F A;  4MZP A;  4LDX A;  1UGQ B;  1OPK A;  5CKF A;  3OBW A;  3JB9 H;  1I8F A;  4F7U B;  1S72 A;  1G5H A;  3R07 A;  1GCQ C;  4KRT A;  4BDY A;  1KMM A;  4KR3 A;  3I55 T;  3ZEH A;  1X2G A;  2KRM A;  3CCE T;  1TWB A;  2QQ9 A;  2GFU A;  4YP0 A;  1EIY A;  2YLB A;  4RTV A;  1Z7N A;  2CUD A;  2YDL A;  2X3X D;  4IUR A;  3HSB A;  1FX7 A;  2ZPE B;  3HFO A;  2E41 A;  4M77 G;  4VUB A;  1QP2 A;  3A5Y A;  2CIM A;  3VUZ A;  1JQQ A;  1BU1 A;  2D0Q B;  4E7S A;  2Q5I A;  1VQK T;  4ELY C;  1AT1 B;  1M2V A;  1KQ2 A;  4CC4 B;  2M0Y A;  2NUT A;  1SEM A;  1OYX A;  3F70 A;  3GNG A;  1Q7Y C;  2EL9 A;  3CC2 Q;  2OJ2 A;  1QP3 A;  2K3B A;  4JRK A;  4PLI A;  5GAO r;  1JJC A;  3CPF A;  2DDZ A;  1E1O A;  2ZNI A;  3EGD A;  3NET A;  4M78 F;  1K76 A;  5J26 A;  1YIJ A;  1VOM A;  2HCK A;  4XTX A;  5A0G A;  1D0X A;  1OUL A;  4KUL A;  5HK0 A;  1SRM A;  1Q86 U;  1T3L A;  2EQJ A;  2MIO A;  4B9W A;  2DRM A;  3HXU A;  4M77 D;  3OYM A;  4J9E A;  4OMO A;  1ZBJ A;  1WHK A;  2JW4 A;  1B70 A;  2E5Q A;  5CAI A;  3EH1 A;  2DXU A;  2DE0 X;  1Z9Q A;  1M1G A;  3WXM B;  2K2M A;  1I0C A;  4M7D D;  3VQW A;  1SSH A;  4YRN A;  3Q1J A;  1KHI A;  4YRP A;  2ZCE A;  3HRS A;  1RAF B;  2LC4 A;  1BK2 A;  2J7I A;  4LE9 A;  1ADY A;  1MV3 A;  1RLQ C;  4J9I A;  2V1R A;  2O9S A;  4FSS A;  5HGQ A;  1VQ4 T;  2RF0 A;  4E7K A;  3L2R A;  2FRY A;  3OYE A;  2HQE A;  2OTL Q;  4EIK A;  1M4Z A;  2DVE A;  1VQN A;  4TVA A;  2DYI A;  3ICA A;  2DTH A;  1GBQ A;  3CME T;  5GJV B;  3REX A;  2FPF A;  5ECA A;  1K9M U;  4NCX A;  3EH2 A;  4EPC A;  4XTY A;  2P0Q A;  3VJP A;  2XID A;  3VRZ A;  1S72 T;  1NLP C;  1RL2 A;  2ODR D;  3V7S A;  4ZTJ A;  2LQK A;  2RD1 A;  2FZG B;  3CEY A;  5GAM h;  1G5I A;  2MI6 A;  2K6D A;  1VYT A;  3L2Q A;  1VQ7 Q;  1I4K 1;  1QLY A;  1YCY A;  3DLL A;  2DRK A;  2MWO A;  4E2F B;  3UPU A;  4L6V 5;  2Y90 A;  1B7T A;  1MMD A;  3CCS Q;  1FYF A;  4M77 B;  1C1A A;  3JAM E;  2KE9 A;  3R6O A;  1WHL A;  2K79 A;  1TH7 A;  3A8H B;  1QVF P;  4HCK A;  2P0K A;  1FYN A;  2CGH A;  1YIT Q;  1M2O A;  1LOJ A;  4X9C A;  3URG A;  4C0D B;  1H64 1;  1VQL T;  3NTH A;  2AT1 B;  3G4S T;  3MKD A;  1KG1 A;  4UP9 A;  1ZA1 B;  1NEG A;  1VYV A;  2EVR A;  4N4H A;  4Z02 A;  5D6X A;  4A53 A;  2AMC A;  4RMF A;  1K9M C;  4LNS A;  1OX8 A;  1UJY A;  5DM7 R;  3P8B B;  1UB4 A;  4P75 A;  5J3B A;  2XK0 A;  2G3R A;  3BW1 A;  2C8M A;  2HSE B;  3PMI A;  4OB0 B;  3JB9 I;  1EIY B;  4YRM A;  4BWA A;  5I2M A;  1W4S A;  4M78 E;  4OB2 B;  2F2X A;  1GBR A;  1NNH A;  3HTR A;  2FZK B;  1R8O B;  4F14 A;  2JUF A;  2QQB A;  4J9F A;  4ZNX A;  2GFA A;  2YWW A;  4EMK C;  4LVJ A;  2KRN A;  1M5Q 1;  4RTU A;  1GRI A;  1M2V B;  2E5K A;  2VXF A;  2XDB A;  3I55 Q;  2FZC B;  4QKU A;  1Q82 R;  2QTX A;  4GLK A;  2RNA A;  3CCE Q;  1BBW A;  2QQR A;  3QTC A;  4J8O A;  5IXF A;  4C8Q F;  1YI2 T;  4NL2 A;  2XU8 A;  2JZ2 A;  3OSS C;  1KQS P;  1JJC B;  1VQN T;  3TUP A;  3EG2 A;  3JSC A;  1R77 A;  3EGD B;  3GP8 A;  5KNN A;  2RHY A;  5GAM g;  1TSF A;  1PYS A;  2KT8 A;  4M7A C;  4H02 A;  3TSW A;  2A3L A;  4KUD K;  3DLM A;  2DD4 A;  4F17 A;  2BKD N;  1VQK Q;  4BE2 A;  4OML A;  3OYL A;  4M78 G;  3HXW A;  3CCL T;  3I56 A;  1EIF A;  4HWO A;  3CCU A;  1B70 B;  2VC8 A;  4LNP A;  3HXV A;  2FEI A;  4DOW A;  2EYQ A;  4FW1 A;  4C0G A;  2V1Q A;  2CSQ A;  2LZ6 B;  2QAZ A;  4IUT A;  4AG2 C;  1TS9 A;  3O5Z A;  4Z8A A;  4FIB A;  3FJ5 A;  2VVK A;  3G71 A;  1M9S A;  1G3W A;  1KD1 U;  1IO6 A;  3GLX A;  3G6E T;  2E6Z A;  4IUV A;  3I5S A;  4C5H A;  2DEQ A;  2SEM A;  2DIG A;  1VQ5 A;  4E51 A;  2L3R A;  1T0H A;  4J9D A;  4LVK A;  1AHJ B;  1MUZ A;  4HT9 A;  2B86 A;  3PT9 A;  3HFN A;  2CZ1 B;  2SRC A;  1UFF A;  4EMK B;  2FL7 A;  4PFO A;  5IAY A;  3JCM X;  3UGT A;  1LJO A;  4M78 C;  5ELO A;  1NYG A;  1FWZ A;  5LJ3 f;  1ABQ A;  4PJO A;  1QVP A;  5KYX A;  2A7Y A;  4M75 A;  3CCQ A;  4P73 A;  2AKK A;  5GAM j;  5GJW B;  1VQ4 Q;  5GAN 4;  1B3Q A;  4K88 A;  4KGV B;  1JU5 C;  2BZX A;  3A8O B;  3EHQ A;  1D0Z A;  4Y92 A;  4EO4 A;  1N9R A;  4RDX A;  2LQN A;  2JS2 A;  3PCO A;  3M59 A;  2YXY A;  2JN0 A;  3L2V A;  3CME Q;  1OX9 A;  3E9H A;  3GOX A;  5KE3 A;  4HCZ A;  3X25 B;  1S72 Q;  1X2K A;  3VRY A;  4R55 A;  1N9S A;  4J9G A;  3G7Z A;  3CCR A;  3NEN A;  1MMN A;  1KD1 R;  4XU2 A;  2X9H A;  2ZXF A;  2L5Q A;  4HT8 A;  2DQ3 A;  3UH0 A;  4FM4 B;  1QVF S;  4FYW B;  4BE0 A;  4PG3 A;  5D7U A;  4QVC A;  4HCC A;  1T0J A;  4JDS A;  2FHD A;  5GAM e;  3LX7 A;  1U8R A;  3X26 B;  1M3C A;  2QA4 T;  3A1P A;  2YSQ A;  2AMC B;  3CPW P;  5CQY A;  5AYF A;  5FRM A;  2QHT A;  1UG1 A;  5KYY A;  3HFV A;  3C95 A;  1ZUY A;  3I56 T;  5GAN h;  2L3P A;  3CCU T;  3HKS A;  4K87 A;  3LH0 A;  4M78 B;  1WA7 A;  2BUD A;  2EPD A;  2EIF A;  4WJ3 M;  1KHC A;  2X4Y A;  5IN1 A;  3T9N A;  1M8V A;  1VQL Q;  4UP7 A;  1V29 B;  5LJ5 f;  2AIR B;  3PNW C;  3G4S Q;  2C7I A;  3MEA A;  5C0M A;  4ORZ A;  3OD1 A;  1B34 A;  2RK2 A;  2FPD A;  4RCC A;  1YJ9 A;  2DBM A;  1E1T A;  2P84 A;  4PJO D;  1WXB A;  1G2B A;  3GNF B;  4M75 D;  1SG5 A;  1NG2 A;  2ARS A;  3ULR B;  3MQZ A;  3QO5 A;  1VQ5 T;  1B8A A;  4AFU C;  4J9H A;  3H0H A;  3WVE B;  3S3O A;  2V8J A;  5FU7 C;  4LDU A;  2DL4 A;  2V8K A;  2A37 A;  4LUE A;  1K8A U;  3OYF A;  1PYS B;  2OTJ A;  1KQS S;  3H8Z A;  2CZ0 B;  1WXU A;  2F2V A;  3CCQ T;  2DO3 A;  2VKN A;  1BCO A;  3JV3 A;  3C4S A;  3HRI A;  1WHJ A;  4LD9 K;  4F7U A;  3CCV T;  2ZR2 A;  2Q7H A;  3I7F A;  1YI2 Q;  2MK5 A;  1ATI A;  1WLP B;  1NPP A;  1VQN Q;  2I4L A;  2I0N A;  1WLE A;  4ESR A;  2LNH B;  1S1N A;  3VQY A;  4RTX A;  5GAN 5;  4F7U E;  1W6X A;  1WZO A;  1YGB A;  3MEY A;  1QVG P;  9ATC B;  3V7R A;  4ZTU B;  2JVV A;  1EZZ B;  1RAG B;  2GQI A;  3NFC A;  3QG1 A;  2NUZ A;  2EWN A;  3CCL Q;  1WNL A;  2DLP A;  3M0U A;  2WSF E;  5EC7 A;  3CCR T;  1ASY A;  1ZQ1 A;  2XKO C;  1WPY A;  1M1K U;  2IVW A;  3P8H A;  4G85 A;  1KSW A;  2KT1 A;  1H4V B;  2K9G A;  4BDZ A;  1HTT A;  5LL6 S;  3P8V A;  5FRO A;  1IGU A;  2LRQ A;  2PTK A;  1WI7 A;  4C8Q C;  1VQO A;  4LVM A;  5GAN g;  4MDW A;  2ZPF B;  2GTJ A;  2QGG A;  4C92 F;  1K8A R;  2EQU A;  3QUI A;  1LNX A;  1ACM B;  1K73 C;  2QHS A;  4IIO A;  4F7U G;  3G6E Q;  3OS0 A;  2K5F A;  4RCB A;  2EJG A;  1HSQ A;  2GF7 A;  1M90 C;  1CKB A;  1D0Y A;  3CC7 A;  2DU5 A;  1G83 A;  4H2T A;  1QW1 A;  4E7H A;  1NJ5 A;  3PCO B;  1VQ8 A;  1L0W A;  2LJ3 A;  5LJ3 d;  2CP7 A;  2QTV A;  2XDD A;  4EMH A;  1QE0 A;  1WXT A;  1GCQ A;  1YJ9 T;  2D8J A;  3I9Q A;  3CC4 A;  2QAS A;  3LH5 A;  5KYN A;  3A5Z A;  2KBT A;  3M4G A;  1I1J A;  1BI3 A;  4EMG A;  2CSI A;  4LN2 A;  2PMF A;  1M1K C;  5GAO m;  1VIE A;  2DPP B;  3EG9 A;  1WQ7 A;  1G8X A;  2VB6 A;  3RIR A;  4HWR A;  2OTJ T;  2ABL A;  4WF2 A;  2E64 A;  2BIV A;  4TVW A;  3QWY A;  2ZT8 A;  5GAN j;  4RTT A;  2DEU A;  1H8K A;  3EG0 A;  5KYY B;  2EJ9 A;  4UPA A;  2X51 A;  4FW2 A;  6AT1 B;  1Q81 U;  1HYO A;  4WI1 A;  5IT9 E;  3E2U A;  2XMF A;  3CPW S;  3JCM b;  3HRT A;  4J5Y A;  3VU3 C;  1X6G A;  4JZ3 A;  1C6V X;  5GMK l;  2YRD A;  2QA4 Q;  1B34 B;  4HCB A;  1NJ6 A;  2DET A;  1M8M A;  3I56 Q;  4QVZ A;  3CCU Q;  2ECZ A;  2KYB A;  1Y07 A;  2MOX A;  2VUB A;  3JCM Q;  2LT4 A;  2IPO B;  5LJ5 d;  5CR2 A;  5E3I A;  2FO0 A;  2A8E A;  3RF1 A;  2YT6 A;  3QJY A;  3KFV A;  1OU9 A;  2A0F B;  3OYY A;  1IXD A;  2K3Y A;  2EYW A;  5GAN e;  5FLX E;  2CT3 A;  1C0A A;  1X56 A;  4FYX B;  3JCM d;  3ASK A;  4PHC A;  4CH5 A;  4TWA A;  1RLP C;  1RAE B;  4MMK A;  3CXC P;  2JT4 A;  5HCK A;  1IL2 A;  3RGL A;  1SRL A;  5I11 A;  1GFD A;  1VQ5 Q;  1X6O A;  3NMZ C;  1W66 A;  3FJP A;  2M16 A;  1X01 A;  3G1J A;  3M4P A;  3M0Q A;  1QF6 A;  1Q81 C;  1N6A A;  2MWP A;  1VQ8 T;  4H2U A;  5L23 A;  4E7J A;  2E3I A;  1IZ6 A;  1BYM A;  3EFR A;  2I4N A;  3CCQ Q;  1PM3 A;  4FT4 A;  5D6Y A;  2HBW A;  2CP6 A;  2ED0 A;  1LVK A;  3CC4 T;  1QVG S;  3CMA A;  3CCV Q;  3SWN C;  3M4Q A;  1UUE A;  1Q7Y R;  1P92 A;  3UT1 A;  3VS2 A;  1N9W A;  1X75 C;  2NWM A;  3E19 A;  1VUB A;  4J83 A;  4TVY A;  1YHQ A;  3OYD A;  3HPW A;  1MNE A;  2JM8 A;  3CQT A;  3EHR A;  3CCR Q;  2KEA A;  2VGM A;  2ZR3 A;  2XDP A;  2DFU A;  1YNZ A;  2RJF A;  4CRI A;  2AZV A;  4Q15 A;  2ZGW A;  1NJI C;  1E6H A;  2F1L A;  4FL6 A;  2RA2 A;  3V7C A;  4MZT A;  2LDM A;  1YJW A;  1ADJ A;  1USY C;  3L2Z A;  4J6W A;  1E7O A;  4OGE A;  3OW2 A;  2DTO A;  4NL3 A;  4A4H A;  4F04 B;  3FRN A;  2EKO A;  3NPF A;  3L42 A;  4HKE A;  3ZL7 C;  4JZ4 A;  1BCM A;  1EX4 A;  3A5Z B;  2Y4X A;  4LXC A;  2D0N A;  1PWT A;  5KYW B;  2CUB A;  1WYX A;  2O4X A;  4ATO A;  4J15 A;  4YYE A;  2LJ0 A;  3EG9 B;  1FMK A;  1YJ9 Q;  4JJC A;  4EMK A;  3LWH A;  4ZGD B;  1AWO A;  5I22 A;  2W0Z A;  3CCM A;  4C92 C;  4J6X A;  2KQW A;  5IH2 A;  3QO7 A;  4M7D C;  1M3B A;  2YRC A;  5LJ5 g;  3VV0 A;  3M0S A;  4DA4 A;  1Q95 G;  3KBG A;  1EFN A;  4HWT A;  1Q86 R;  3VS6 A;  1D09 B;  1NPR A;  4JS4 A;  4M7A A;  1NYQ A;  2Q7E A;  1UGR B;  1QKW A;  4IIM A;  3OYB A;  1HJD A;  4N4G A;  2OTJ Q;  1EVK A;  2XTI A;  2EGC A;  3JCM g;  3LGL A;  4PL6 A;  5FW9 A;  2J05 A;  4YCV A;  2LNV A;  3OYJ A;  4EDU A;  4M7A E;  1UGS B;  2FG0 A;  1RAI B;  4PJM A;  2BZ8 A;  2CH4 W;  1AWJ A;  3CMA T;  5KCH A;  2P0P A;  3VS3 A;  4AG1 C;  1AOJ A;  4EX5 A;  1UEC A;  1EVL A;  1Y0M A;  4GBQ A;  1UEB A;  4XU1 A;  2PVD B;  1QMC A;  3I5R A;  4YCW A;  1OZ2 A;  4L59 A;  2LX9 A;  3OA6 A;  4ZTF A;  2I4M A;  5KE2 A;  1YCS B;  1YHQ T;  4RQF A;  2KAF A;  2COZ A;  1YIJ T;  4QVD A;  5IHK A;  3RES A;  1OOT A;  4JPB W;  2YUO A;  4PLL A;  2AKW A;  4YRQ A;  3UA7 A;  1WJQ A;  2HQH A;  2DL8 A;  4ELZ C;  2RQR A;  1K9M R;  4M7A G;  3CMQ A;  1YBY A;  3CXC S;  4XTW A;  3SEM A;  4C92 B;  4WTO B;  5IHI A;  2BTT A;  4M78 A;  5FU6 C;  2GQV A;  4PJL A;  2IY5 A;  2HMA A;  5GAO l;  2H3E B;  1YJW T;  2CZ6 B;  3J81 E;  2DER A;  1UHF A;  3MP1 A;  5CKD A;  3RKY A;  4JJB A;  1JB0 E;  1RAD B;  3RUX A;  1MMA A;  3JB9 F;  3A74 A;  2ZZE A;  1BIB A;  3BY7 A;  1I5L A;  1WX6 A;  1XNI A;  2RH2 A;  1VQ8 Q;  1OI1 A;  3MET A;  1HXD A;  2D8H A;  3V8K A;  1E24 A;  1WJS A;  2O9V A;  2CRE A;  3LW5 E;  3RKX A;  5GMK j;  5C6S A;  4M7A D;  3G1Z A;  2JMC A;  4BI3 A;  5A0L A;  4WJ4 A;  1SHG A;  2RHU A;  1KC8 U; 
#chains in the Genus database with same CATH homology
 2QEX A;  2K4Y A;  4P5N A;  4YTL A;  3A7A A;  4C5E A;  4TVR A;  1VQM A;  3QNE A;  1NZ9 A;  5K1X A;  1VQZ A;  2XIC A;  4GY5 A;  2K5L A;  2DAQ A;  5M9O A;  1XQH A;  2B8A A;  3BJU A;  4HWS A;  4YCU A;  1M1F A;  2DIQ A;  1Z7M A;  2MAM A;  3CBM A;  4XTZ A;  2HAX A;  5C51 B;  2I4O A;  4IUQ A;  4KBM B;  4XEO A;  1KOG A;  3ERR A;  5FU6 B;  4YRC A;  4E7I A;  2LCL A;  4L5G A;  4XU3 A;  3BDU A;  2JOY A;  2ZCF B;  4M78 D;  1WYD A;  2O4X B;  4OF1 A;  1VIF A;  5GMK m;  4ZGJ B;  3TEH B;  1WJR A;  3BFM A;  1W2B S;  2XGT A;  3MCA B;  4OB1 B;  1KC8 C;  2M0O A;  2ZNJ A;  2ZTG A;  4OGC A;  3QSU A;  2M9U A;  4ME7 A;  2AHJ B;  4LDY A;  4M7A B;  4RMO A;  1WGS A;  1RI0 A;  5L8R E;  5CCA A;  4KR2 A;  2Y4Y A;  3MP6 A;  3TCJ A;  1SET A;  3LYI A;  3MF2 A;  4J6Y A;  1VQ9 A;  4CS3 A;  3M56 A;  3ME9 A;  4BW9 A;  2MMP A;  3MF1 A;  5CO7 A;  1XOV A;  4JLI A;  2DTI A;  4CH3 A;  5A0D A;  5I21 A;  2DXT A;  2AKW B;  4H2S A;  4A4K A;  1VQM T;  2CZ7 B;  4JUV A;  2QDY B;  4C8Q A;  4ZN1 A;  4YPF A;  2PQW A;  2F5T X;  4JRI A;  3MEU A;  3LLR A;  4C8Q E;  3OYN A;  2IY5 B;  3OYG A;  4Y91 A;  2HNI A;  3TRE A;  3M58 A;  3QYG B;  1YFS A;  3G71 T;  2E6N A;  2ZT7 A;  1ZBX A;  2ZT5 A;  2QQA A;  4L87 A;  3JB9 G;  3JCM c;  5D6W A;  1N8R C;  4ZTZ B;  3UDC A;  1VQP A;  2OTL A;  2G4C A;  1K73 U;  2RJC A;  3ER0 A;  4C8Q G;  4N0A C;  4YRJ A;  1M90 U;  3P8T A;  3INZ A;  2E12 A;  5KH6 A;  3VYH B;  3E1S A;  3PIO A;  4XTU A;  4KT0 E;  5DLQ E;  5F5W A;  3PZC A;  2CS7 A;  4P3O A;  4AH6 A;  3CCS A;  1I81 A;  2DJZ A;  2L89 A;  1VQ9 T;  4BI8 B;  1VQ6 A;  4C8Q D;  4PKC C;  4M77 F;  4QW2 A;  2ALY A;  12AS A;  1YIT A;  4A4F A;  3GPL A;  4YRI A;  2F69 A;  1XTD A;  2VXE A;  4M7D F;  3A7R A;  1QVF A;  2XHC A;  5FU7 B;  3UGQ A;  1U1S A;  1Y96 B;  4Q5W A;  2PUK B;  3AHU A;  4R56 A;  4H2W A;  4RG2 A;  3QZ5 B;  5GAO n;  3E9F A;  4UP8 A;  2YLC A;  3EFS A;  3UWN A;  3IKM B;  1KQ1 A;  4ZGE B;  1MGQ A;  2E65 A;  4PNO A;  5I2S A;  5GAM f;  4P3P A;  3BDL A;  5HKC A;  3DB3 A;  2DD5 A;  2DXC A;  4MDX A;  3HXZ A;  3HFZ B;  3CCE A;  4G84 A;  1ASZ A;  1VQP T;  1SER A;  2WAC A;  3SWN A;  1LYL A;  1H4T A;  3JCM V;  2KK4 A;  5GAN 3;  4C8Q B;  2PME A;  1VQK A;  1KQS A;  2P4T A;  5GAN 6;  1SRY A;  1HK9 A;  3GF5 A;  3SFM A;  3RL6 A;  3E9G A;  2ZPB B;  4II1 A;  3SDZ A;  4Q6G A;  5GAN 2;  1U1T A;  3JCM P;  2JTF A;  1SSF A;  4KQE A;  4IKF A;  4X9D A;  3SB2 A;  1Y7X A;  3CD6 A;  4XU0 A;  1VQ6 T;  3OS5 A;  5GAN 7;  1USY A;  4XQ3 A;  4BD3 A;  5C53 B;  1VQO T;  4YRR A;  2C06 A;  2QI2 A;  2ZIN A;  3HY1 A;  2X4X A;  3MEV A;  4QQG A;  3IAL A;  3RAC A;  4ZN3 A;  3OYH A;  3TU4 K;  5GMK i;  1BKB A;  3HHT B;  1NJI U;  1VQ4 A;  3TEG A;  3CC7 T;  5KCO A;  1YFR A;  2F5K A;  3JCM W;  4C92 A;  3QHS A;  2XD0 A;  4M7D A;  2ART A;  3FIF A;  5LJ5 h;  2NLU A;  2HD0 A;  4E47 A;  4H2V A;  4C92 E;  1WU7 A;  2R5M A;  2EJF A;  3QJ6 A;  3PTA A;  5GAO p;  4JRQ A;  4M7D E;  4YRK A;  2JTM A;  2WSC E;  3EAE A;  2Q7G A;  4P72 C;  3JCM h;  2XG8 D;  2KVQ G;  2ALY B;  3OYC A;  3V8L A;  2LTO A;  4X34 A;  5LJ3 g;  4P71 C;  4A4E A;  3M9Q A;  3A32 A;  2DK3 A;  5GMK h;  3OSV A;  3JB9 J;  3S3M A;  2D9T A;  3DB4 A;  3FB9 A;  3A7U A;  3A31 A;  3J7A F;  1G3T A;  1YJN A;  4C92 G;  2RJD A;  2QXF A;  2KDS A;  1JJ2 S;  4M7D G;  5ELN A;  3OBY A;  3VBB A;  4A54 A;  3M53 A;  3OMG A;  3SD4 A;  4C0F A;  2LT1 A;  1VQL A;  4E7L A;  3G4S A;  3CPW A;  3HRK A;  2PVO B;  2H3J A;  2ZPG B;  3OYA A;  1EOV A;  2VGN A;  4BE1 A;  1N27 A;  3CD6 T;  4OMF B;  4MZM A;  3OYI A;  5GAO q;  4FSX A;  3HL8 A;  3IG2 A;  1G3S A;  3QO3 A;  4J7I A;  1PSF A;  4M77 C;  1H4S A;  1D3B B;  4OB3 B;  4C92 D;  1X54 A;  4RKU E;  3SWN B;  3RKW A;  3X24 B;  3JRZ A;  3QPH A;  5GAM d;  3TEH A;  2ZZF A;  2CKK A;  5LJ3 j;  1H3Z A;  4YRT A;  4C0D C;  4LVI A;  1G3Y A;  1ZHI A;  4UC4 A;  1YI2 A;  2ZZG A;  3M54 A;  3RMS A;  2J3L A;  4V2S A;  3P8Y A;  5GAN f;  4BI4 A;  4H2Y A;  2MF2 A;  1Q86 C;  3CCL A;  2RHZ A;  4C5G A;  2ODR C;  1QVG A;  5LJ3 e;  5J39 A;  1X2H A;  2Q5H A;  4HVC A;  3WQZ A;  3MEW A;  2RK1 A;  1YJN T;  1Q82 U;  4P74 A;  3X20 B;  3FLG A;  2QHU A;  2J3M A;  3G6E A;  2E3C A;  4PJO F;  4M75 F;  3P8D A;  5LJ5 j;  4M7D B;  2FB7 A;  2X4W A;  5A2Q E;  4QQD A;  1BI1 A;  3L2U A;  1JJ2 A;  2P5I A;  2I2L A;  3C12 A;  5CQX A;  1OZ3 A;  4LD6 A;  2EAY A;  4X5O A;  1H4Q A;  4CH4 A;  2RHS A;  2YRV A;  2DKG A;  3HY0 A;  4RQE A;  3CCJ A;  3L4G A;  4BY6 C;  3LC0 A;  1EQR A;  2L8D A;  3UFG A;  1BIA A;  1SES A;  3M4Y A;  2FYK A;  3CCM T;  3WVD B;  4OP0 A;  2PUO B;  2X35 A;  5LJ5 e;  3CBP A;  2LVM A;  2PVG B;  1Q82 C;  2RO0 A;  1HC7 A;  2ZIM A;  3PMT A;  2RHQ A;  4FT2 A;  2DQ0 A;  2WSE E;  4A4G A;  4JRP A;  3C94 A;  4LDV A;  3NTK A;  3JCM e;  3LSQ A;  1B76 A;  2QA4 A;  4HT4 A;  3V8J A;  4BUG A;  3N5B B;  3MHX A;  2DU7 A;  5FRN A;  4IUP A;  4BB7 A;  4DOV A;  1O9S A;  3L1A A;  5GMK e;  3L2W A;  2QQS A;  2VV5 A;  4P3N A;  1PSE A;  4XAX B;  3M5A A;  3KUF A;  4DQ2 A;  2PU9 B;  4Y28 E;  4P74 C;  2E1H A;  2ZIO A;  3FC3 A;  3HXX A;  4BY6 B;  5DLO A;  1FXX A;  3OY9 A;  2CYZ B;  1KMN A;  1Y96 A;  2ZZD A;  2DXB A;  3QZ9 B;  3VUB A;  1WQW A;  5CK9 A;  4F7U F;  4TVA B;  5GAN 8;  5CKB A;  3FDR A;  2KY9 A;  3HP9 A;  3QXE B;  4N0A A;  1G51 A;  2ARU A;  2HQX A;  4P75 C;  3CXC A;  1YB3 A;  2EQK A;  2QHV A;  3PIP A;  3LWI A;  2EFI A;  3E9I A;  4H2X A;  1X55 A;  5HK3 A;  2RHX A;  2RM4 A;  4TQD A;  2RI2 A;  3QDR B;  3NTI A;  4NS5 A;  4PJO E;  2P0L A;  3CCV A;  4M75 E;  4OLF A;  3CCJ T;  4QQ6 A;  1JBM A;  2X4J A;  4JS5 A;  1N8R U;  3CC2 A;  4TTV A;  3HFZ A;  1NJ1 A;  5GAN d;  3TEE A;  2QEX T;  3VYG A;  2R57 A;  2CJA A;  4O2D A;  3FEO A;  1NE8 A;  4YRE A;  1J5W A;  3HTZ A;  2D6F A;  1KD1 C;  1NJ8 A;  4YRG A;  1BI0 A;  2M1H A;  3OMC A;  3H6Z A;  2E10 A;  3OB9 A;  4PJO G;  4CI0 C;  2NS6 A;  4FU6 A;  4M75 G;  4C0Z A;  3ZFJ A;  4YRS A;  3LSS A;  2ZPH B;  4YRO A;  4XTV A;  2VYT A;  4YDQ A;  1GGM A;  3A8M B;  2IG0 A;  2RI5 A;  2RHS B;  1G5V A;  4D6W A;  2RJE A;  2OAU A;  2RHI A;  3M55 A;  1B7Y A;  3L4G B;  2K2V A;  5CKH A;  4O6J A;  3RMQ A;  3REU A;  1BI2 A;  3A8G B;  4HA8 A;  3S3N A;  1NJ2 A;  3LGF A;  2O01 E;  3JCM f;  3OQ5 A;  2LCC A;  4N4I A;  3S6W A;  1UGP B;  2YHT A;  4XK8 E;  1JRI A;  5EG2 A;  4HWP A;  4KUI A;  1W2B A;  3MO8 A;  4PJO C;  4M75 C;  4P73 C;  5DY9 A;  2RHQ B;  3MP8 A;  1O75 A;  1VQ7 A;  3QBY A;  3HRU A;  3JB9 D;  2EQM A;  3DKM A;  3PFS A;  5CVI A;  2R58 A;  1BBU A;  4B9X A;  2K57 A;  4XEM A;  3CC2 T;  4YRL A;  4CH6 A;  4MML A;  4LVL A;  4OVA A;  3CBO A;  3NEL A;  3J80 E;  4IUU A;  3X28 B;  2DZ9 A;  4BAC A;  3RER A;  3VQV A;  1Y71 A;  1DJ7 B;  1MHN A;  2V8I A;  3O8V A;  4CS2 A;  2FVU A;  5CKE A;  4ZIB A;  1K8A C;  3OS1 A;  4PJO B;  4H2X B;  4M75 B;  1EFW A;  4TQF A;  4LDW A;  4K86 A;  1E22 A;  3I55 A;  1D3B A;  3QII A;  4CS4 A;  2OTL T;  2CJ9 A;  4P72 A;  5K1P A;  2E70 A;  2CJB A;  3OYK A;  3OS2 A;  3M57 A;  4C5I A;  4P71 A;  5LJ3 h;  11AS A;  3PGG A;  4JJN K;  3VQX A;  2LQ8 A;  2HBP A;  2KSS A;  1IRE B;  1VQ7 T;  2JNG A;  2XI9 A;  4RG8 A;  3HXY A;  4DPG A;  2RI3 A;  3ZBD A;  3CCS T;  4YRF A;  3KXT A;  3DSQ A;  2K3X A;  1RIQ A;  2K5I A;  4NOY A;  1B7Y B;  3W3S A;  3OW2 S;  3GIB A;  2E5A A;  3JCM J;  3QYH B;  2GCX A;  4JLG A;  2RB6 A;  1YFT A;  1YIT T;  5HY6 A;  3QO8 A;  5CIU A;  2ZPI B;  3VKI A;  4M77 A;  1Q7Y U;  1GXI E;  5C52 B;  3QKJ A;  3NEM A;  2KMT A;  2R5A A;  4M77 E;  2DZC A;  3IKL A;  4O5V A;  3A8L B;  2ZT6 A;  3KFU A;  4M7A F;  1NYR A;  3CME A;  4J7F A;  4MZP A;  4LDX A;  1UGQ B;  5CKF A;  3OBW A;  3JB9 H;  1I8F A;  4F7U B;  1S72 A;  1G5H A;  3R07 A;  4BDY A;  1KMM A;  4KR3 A;  3I55 T;  3ZEH A;  1X2G A;  3CCE T;  2QQ9 A;  2GFU A;  4YP0 A;  1EIY A;  2YLB A;  1Z7N A;  4IUR A;  3HSB A;  1FX7 A;  2ZPE B;  3HFO A;  2E41 A;  4M77 G;  4VUB A;  1QP2 A;  3A5Y A;  2CIM A;  3VUZ A;  2D0Q B;  2Q5I A;  1VQK T;  4ELY C;  1KQ2 A;  1OYX A;  3F70 A;  3GNG A;  1Q7Y C;  2EL9 A;  1QP3 A;  4JRK A;  4PLI A;  5GAO r;  1JJC A;  3CPF A;  2DDZ A;  1E1O A;  2ZNI A;  3NET A;  4M78 F;  5J26 A;  1YIJ A;  4XTX A;  5A0G A;  4KUL A;  5HK0 A;  1Q86 U;  2EQJ A;  4B9W A;  3HXU A;  4M77 D;  3OYM A;  1B70 A;  2E5Q A;  5CAI A;  2DXU A;  1M1G A;  3WXM B;  4M7D D;  3VQW A;  4YRN A;  3Q1J A;  1KHI A;  4YRP A;  2ZCE A;  3HRS A;  2LC4 A;  1ADY A;  5HGQ A;  1VQ4 T;  4E7K A;  3L2R A;  3OYE A;  2HQE A;  1M4Z A;  2DVE A;  1VQN A;  4TVA A;  3ICA A;  2DTH A;  3CME T;  3REX A;  1K9M U;  4NCX A;  4EPC A;  4XTY A;  2P0Q A;  3VJP A;  2XID A;  1S72 T;  1RL2 A;  2ODR D;  3V7S A;  4ZTJ A;  2LQK A;  2RD1 A;  3CEY A;  5GAM h;  1G5I A;  2MI6 A;  3L2Q A;  1I4K 1;  1YCY A;  3DLL A;  2MWO A;  3UPU A;  4L6V 5;  2Y90 A;  1FYF A;  4M77 B;  3JAM E;  3R6O A;  1TH7 A;  3A8H B;  2P0K A;  2CGH A;  1LOJ A;  4X9C A;  3URG A;  4C0D B;  1H64 1;  1VQL T;  3NTH A;  3G4S T;  1KG1 A;  4UP9 A;  4N4H A;  4Z02 A;  5D6X A;  4A53 A;  2AMC A;  4RMF A;  1K9M C;  4LNS A;  5DM7 R;  3P8B B;  1UB4 A;  4P75 A;  5J3B A;  2XK0 A;  2G3R A;  3BW1 A;  2C8M A;  3PMI A;  4OB0 B;  3JB9 I;  1EIY B;  4YRM A;  4BWA A;  5I2M A;  1W4S A;  4M78 E;  4OB2 B;  1NNH A;  1R8O B;  2JUF A;  2QQB A;  2GFA A;  4EMK C;  4LVJ A;  1M5Q 1;  2XDB A;  2VXF A;  2QTX A;  4GLK A;  1BBW A;  2QQR A;  3QTC A;  4J8O A;  4C8Q F;  1YI2 T;  2XU8 A;  2JZ2 A;  3OSS C;  4NL2 A;  1JJC B;  1VQN T;  3TUP A;  3JSC A;  3GP8 A;  5KNN A;  2RHY A;  5GAM g;  1PYS A;  4M7A C;  4H02 A;  2A3L A;  4KUD K;  3DLM A;  2DD4 A;  2BKD N;  4BE2 A;  3OYL A;  4M78 G;  3HXW A;  3CCL T;  3I56 A;  1EIF A;  4HWO A;  3CCU A;  1B70 B;  2VC8 A;  3HXV A;  4DOW A;  2EYQ A;  4C0G A;  4IUT A;  4FIB A;  3G71 A;  1M9S A;  1G3W A;  1KD1 U;  3GLX A;  3G6E T;  2E6Z A;  4IUV A;  4C5H A;  2DEQ A;  1VQ5 A;  2DIG A;  4E51 A;  2L3R A;  4LVK A;  1AHJ B;  4HT9 A;  3PT9 A;  3HFN A;  2CZ1 B;  4EMK B;  2FL7 A;  5IAY A;  3JCM X;  3UGT A;  1LJO A;  4M78 C;  5ELO A;  1FWZ A;  5LJ3 f;  4PJO A;  1QVP A;  2A7Y A;  4M75 A;  3CCQ A;  4P73 A;  5GAM j;  5GAN 4;  4K88 A;  3A8O B;  4EO4 A;  1N9R A;  4RDX A;  3PCO A;  3M59 A;  2JN0 A;  3L2V A;  3E9H A;  3GOX A;  5KE3 A;  4HCZ A;  3X25 B;  4R55 A;  1N9S A;  3G7Z A;  3CCR A;  3NEN A;  4XU2 A;  2ZXF A;  2L5Q A;  4HT8 A;  2DQ3 A;  3UH0 A;  4FM4 B;  1QVF S;  4BE0 A;  4PG3 A;  4QVC A;  4HCC A;  4JDS A;  2FHD A;  5GAM e;  3LX7 A;  1U8R A;  3X26 B;  2QA4 T;  2AMC B;  5CQY A;  5AYF A;  5FRM A;  2QHT A;  3HFV A;  3C95 A;  3I56 T;  5GAN h;  3CCU T;  3HKS A;  4K87 A;  3LH0 A;  4M78 B;  2BUD A;  4WJ3 M;  2EIF A;  1KHC A;  2X4Y A;  5IN1 A;  3T9N A;  1M8V A;  4UP7 A;  5LJ5 f;  1V29 B;  3PNW C;  2C7I A;  3MEA A;  5C0M A;  3OD1 A;  1B34 A;  2RK2 A;  4RCC A;  1YJ9 A;  1E1T A;  4PJO D;  3GNF B;  4M75 D;  2ARS A;  3MQZ A;  3QO5 A;  1VQ5 T;  1B8A A;  3WVE B;  3S3O A;  2V8J A;  5FU7 C;  4LDU A;  2V8K A;  1K8A U;  3OYF A;  1PYS B;  2OTJ A;  1KQS S;  3H8Z A;  2CZ0 B;  3CCQ T;  2DO3 A;  3HRI A;  3C4S A;  4LD9 K;  4F7U A;  3CCV T;  2ZR2 A;  2Q7H A;  3I7F A;  1ATI A;  1NPP A;  2I4L A;  1WLE A;  3VQY A;  5GAN 5;  4F7U E;  1YGB A;  3MEY A;  3V7R A;  4ZTU B;  2JVV A;  3NFC A;  3QG1 A;  2EWN A;  1WNL A;  2WSF E;  3CCR T;  1ASY A;  1ZQ1 A;  2XKO C;  1WPY A;  1M1K U;  2IVW A;  3P8H A;  4G85 A;  1H4V B;  4BDZ A;  1HTT A;  5LL6 S;  3P8V A;  5FRO A;  2LRQ A;  4C8Q C;  1VQO A;  4LVM A;  5GAN g;  4MDW A;  2ZPF B;  4C92 F;  2EQU A;  3QUI A;  1LNX A;  1K73 C;  2QHS A;  4F7U G;  3OS0 A;  2K5F A;  4RCB A;  2EJG A;  2GF7 A;  1M90 C;  3CC7 A;  2DU5 A;  4H2T A;  1QW1 A;  4E7H A;  1NJ5 A;  3PCO B;  1VQ8 A;  1L0W A;  5LJ3 d;  2XDD A;  4EMH A;  1QE0 A;  1YJ9 T;  3CC4 A;  3A5Z A;  3M4G A;  1BI3 A;  4EMG A;  2PMF A;  1M1K C;  5GAO m;  1VIE A;  2DPP B;  1WQ7 A;  4HWR A;  3RIR A;  2OTJ T;  4WF2 A;  2E64 A;  2BIV A;  4TVW A;  2ZT8 A;  5GAN j;  2EJ9 A;  4UPA A;  1Q81 U;  4WI1 A;  5IT9 E;  3CPW S;  3JCM b;  3HRT A;  4J5Y A;  3VU3 C;  5GMK l;  1B34 B;  4HCB A;  1NJ6 A;  4QVZ A;  1Y07 A;  2VUB A;  3JCM Q;  2LT4 A;  5LJ5 d;  5CR2 A;  5E3I A;  2A8E A;  3RF1 A;  3QJY A;  3OYY A;  2K3Y A;  5GAN e;  5FLX E;  1C0A A;  1X56 A;  3JCM d;  3ASK A;  4PHC A;  4CH5 A;  4TWA A;  4MMK A;  1IL2 A;  3RGL A;  1X6O A;  1W66 A;  3FJP A;  2M16 A;  1X01 A;  3M4P A;  1QF6 A;  1Q81 C;  1N6A A;  2MWP A;  1VQ8 T;  4H2U A;  4E7J A;  1IZ6 A;  1BYM A;  3EFR A;  2I4N A;  4FT4 A;  5D6Y A;  3CC4 T;  1QVG S;  3CMA A;  3SWN C;  3M4Q A;  1P92 A;  3UT1 A;  1N9W A;  1X75 C;  3E19 A;  1VUB A;  4J83 A;  4TVY A;  1YHQ A;  3OYD A;  3HPW A;  2VGM A;  2ZR3 A;  2XDP A;  2RJF A;  4CRI A;  4Q15 A;  2ZGW A;  1NJI C;  4FL6 A;  2RA2 A;  3V7C A;  4MZT A;  2LDM A;  1YJW A;  1ADJ A;  1USY C;  3L2Z A;  4J6W A;  4OGE A;  3OW2 A;  2DTO A;  4NL3 A;  4A4H A;  3FRN A;  2EKO A;  3L42 A;  4HKE A;  3A5Z B;  2Y4X A;  2O4X A;  4ATO A;  4J15 A;  4YYE A;  4EMK A;  3LWH A;  4ZGD B;  3CCM A;  4C92 C;  4J6X A;  2KQW A;  3QO7 A;  4M7D C;  5LJ5 g;  3VV0 A;  4DA4 A;  3KBG A;  4HWT A;  1NPR A;  4JS4 A;  4M7A A;  1NYQ A;  2Q7E A;  1UGR B;  3OYB A;  1EVK A;  4N4G A;  2XTI A;  3JCM g;  3LGL A;  4PL6 A;  4YCV A;  2LNV A;  3OYJ A;  4EDU A;  4M7A E;  1UGS B;  3CMA T;  5KCH A;  2P0P A;  4EX5 A;  1EVL A;  1UEB A;  4XU1 A;  2PVD B;  4YCW A;  1OZ2 A;  4L59 A;  2LX9 A;  3OA6 A;  4ZTF A;  2I4M A;  5KE2 A;  1YHQ T;  4RQF A;  2KAF A;  1YIJ T;  4QVD A;  3RES A;  2AKW A;  4PLL A;  4YRQ A;  1WJQ A;  4ELZ C;  4M7A G;  3CMQ A;  1YBY A;  3CXC S;  4XTW A;  4C92 B;  4M78 A;  5FU6 C;  2GQV A;  2IY5 A;  5GAO l;  1YJW T;  2CZ6 B;  3J81 E;  3MP1 A;  5CKD A;  3RKY A;  1JB0 E;  3RUX A;  3JB9 F;  3A74 A;  2ZZE A;  1BIB A;  3BY7 A;  1I5L A;  1XNI A;  2RH2 A;  1OI1 A;  3MET A;  1HXD A;  3V8K A;  1E24 A;  1WJS A;  3LW5 E;  3RKX A;  5GMK j;  5C6S A;  4M7A D;  3G1Z A;  4BI3 A;  5A0L A;  4WJ4 A;  2RHU A;  1KC8 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...