2DEQA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111g mutation
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKGIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
total genus 70
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2deqA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2deqA01
5GMKj 4C92A 1NJ8A 3QUIA 4YRSA 4M7AC 4XEMA 3I7FA 4X9CA 1I81A 4C92D 2EJGA 2ALYA 4C92B 1WPYA 1NJ2A 4C92G 3HFZA 4PJOF 3M4PA 1YFTA 3A7AA 2ZT7A 4AH6A 1NNHA 2DKGA 4HVCA 5GAMh 1B34B 1ASZA 3RACA 1X01A 1E1TA 4TQDA 2Q7EA 3HXUA 1EIYA 4WJ4A 5GANh 1B34A 3UGTA 1U1SA 1C0AA 1PYSA 4M77E 1H4TA 4EMHA 4M7DF 4YRFA 1USYA 1TH7A 4M75G 4P73A 1WLEA 1Y96B 5I21A 3JCMX 3R07A 3RESA 4TVAA 1ASYA 4YRRA 4PG3A 3JCMP 4M77D 4M75C 3HFVA 2I4OA 12ASA 4YRNA 2Y90A 1BIAA 5LJ3d 5GANf 4PNOA 5GANj 1G51A 1I8FA 5KNNA 1EOVA 4E51A 1MGQA 1NJ1A 4YRTA 4P71C 3BJUA 2DU5A 5GANe 4UP8A 2FB7A 2JN0A 3JCMJ 5LJ3g 2DU7A 2FYKA 1QF6A 4EMKB 4M7AD 1H641 3MEYA 3IKLA 3HY1A 2ZT6A 1NYRA 4HWSA 1KOGA 2ZT8A 1B70A 1D3BB 4RDXA 3QO7A 2XTIA 2RHQA 1B7YA 1WQWA 4KQEA 4K88A 4RQFA 4P72C 3UFGA 3REXA 4Q6GA 2QHTA 2E64A 5K1PA 3V8JA 3QSUA 5ELOA 2EJFA 4M77B 1JJCB 5LJ5f 3MF1A 4WI1A 4CS2A 3RL6A 3UH0A 4DPGA 5GAN5 3VU3C 1JBMA 3BY7A 4PJOB 2ARSA 2ODRC 5CAIA 1W66A 3M4GA 2VC8A 5GAN7 2RB6A 1I5LA 1WQ7A 3QO5A 1QE0A 4QVCA 2ALYB 3JCMh 2QHVA 4Q15A 2PMEA 4YYEA 3RKXA 4C8QG 5LJ5d 4TVAB 5GMKl 4OLFA 4XQ3A 5GAN4 1Y96A 2CJAA 1X2HA 2YLCA 1L0WA 3NEMA 4RCBA 5GAOl 2ZINA 3QHSA 4H2XB 4P74A 2QHSA 4K87A 1U1TA 4TWAA 3QNEA 4YRMA 3HSBA 3A32A 1FYFA 1J5WA 1EVLA 5LJ5g 3RGLA 2J3MA 3FIFA 3VBBA 4CS4A 1LJOA 4H2XA 5GMKh 4XTWA 4C8QE 3A5ZA 4XU0A 4H2VA 5LJ5j 1VQZA 2C7IA 3JB9H 3A7RA 4J6YA 3E9HA 3A7UA 1NYQA 1YCYA 5GMKm 5GANg 3L1AA 4M78D 1G5HA 4P75C 2ODRD 4M75F 3PGGA 3HFOA 3V7CA 1Z7MA 2CJBA 4F7UE 2EL9A 2DZCA 3V8LA 3JB9D 2ZZGA 4P3OA 3MF2A 3HXWA 4EX5A 3NETA 2IY5B 2K57A 3SWNC 3BFMA 4WF2A 4HT9A 2DZ9A 1GGMA 4J6WA 2EWNA 4H2UA 1IL2A 4QVDA 2Q5IA 4NOYA 5C53B 1HK9A 4M78C 5GAN3 5GAOr 4M75A 4HWPA 3LC0A 2QTXA 2E5AA 1BIBA 1D3BA 5GAOp 4M75D 1KMNA 5LJ5h 2ZGWA 1WNLA 3LSSA 4TQFA 3V7SA 2DDZA 4M78F 1X54A 4KR2A 4KR3A 3TEHB 4C8QF 4HWRA 4H2SA 2Q7GA 3LSQA 4YPFA 2ZZFA 4M7DB 4YRPA 4C8QA 4NCXA 5GAOq 1LYLA 4YP0A 1X56A 4XU1A 3RF1A 3CMQA 4XTVA 5LJ3e 4M75B 4M7AE 3JCMb 1X55A 4XTZA 3RKWA 2P5IA 1M5Q1 2AMCB 3PCOB 1JRIA 1B70B 4L87A 4BWAA 1HC7A 2PMFA 2ZNIA 1H4VB 4RQEA 3QO3A 3JB9I 3JB9J 5HGQA 4XU2A 4M7DC 4PJOC 3JCMd 5K1XA 2Q7HA 3NENA 4A53A 4RCCA 2DTHA 4M77C 1E22A 3TEHA 2ARUA 3TEGA 3E9IA 3JCMW 5LJ3h 3VQXA 4TVWA 4M78B 4N0AA 1BBWA 4X9DA 3L4GB 5C51B 4YREA 2DQ3A 3P8VA 4XTYA 4DQ2A 11ASA 4CH4A 4P74C 4JRKA 2AKWA 3HXVA 4A54A 2DQ0A 3V7RA 4F7UA 1SESA 2ZIOA 1ATIA 4PJOE 4XTUA 1JJCA 3EFSA 2DVEA 4HWTA 4PJOG 3JCMg 3NELA 4NL2A 3HTZA 4UP7A 4CS3A 3RERA 4CH6A 4H2TA 3A5YA 2C8MA 4YCWA 5GMKi 4HA8A 3UGQA 4CH5A 2VXFA 1WYDA 2AMCA 3PCOA 3BW1A 3JCMQ 4H2YA 3FB9A 4XU3A 3BDUA 3HY0A 2ZTGA 2RHSB 3JCMe 4BW9A 3SB2A 4P75A 2Q5HA 5GAMf 4YRIA 4M7DE 4EMKC 4ZTZB 5LJ3f 3AHUA 2DEQA 2YHTA 4MMKA 5GAMd 1N9SA 1KQ2A 4LNSA 2E65A 3JCMc 3SWNA 4M7DD 3HRKA 1WU7A 1H4SA 4C92C 1M8VA 4M7AA 4YDQA 4UPAA 4C8QD 4YCVA 4J15A 4M78A 5GAOm 2ZIMA 4YRLA 4G84A 1EFWA 3G1ZA 1EVKA 2IY5A 1N9RA 4OP0A 1EQRA 3KFUA 4PHCA 4YRQA 4YRJA 2VXEA 2ZR2A 3VQYA 4J5YA 1SERA 1NJ5A 4F7UB 3JB9G 4MMLA 4V2SA 3HRIA 3IALA 3INZA 3HXXA 3V8KA 2DXUA 4TVYA 1H4QA 1X2GA 5GAN8 4C8QC 5GMKe 4K86A 1USYC 2RHSA 3IKMB 4RMFA 4P73C 3M4QA 2DXTA 4M78G 1ADYA 2EAYA 2G4CA 2CJ9A 2ARTA 3ICAA 3QTCA 4UP9A 1SRYA 1B7YB 4H02A 2I4LA 2RHQB 2HNIA 4HWOA 2E41A 1LOJA 1RIQA 2J3LA 5GAN6 4YCUA 5ELNA 4F7UG 4C8QB 4JRIA 3ERRA 4J6XA 1KMMA 3A31A 4P71A 2ZNJA 2ZXFA 2ZZEA 2CIMA 5GAMe 4M7DA 4PJOA 1I4K1 4M77F 1NJ6A 2E1HA 4YRCA 3JCMV 3JCMf 1BBUA 3A74A 4M77A 4ZTUB 2DJZA 1N9WA 3OD1A 4EO4A 3HXYA 4M77G 3P8TA 4HT8A 2DTIA 4M78E 4P72A 5LJ3j 2EJ9A 1LNXA 5F5WA 2ZT5A 4ZIBA 4N0AC 4XTXA 3L2ZA 5E3IA 3RIRA 4M7DG 3W3SA 1YFRA 1Z7NA 4P3NA 3RUXA 1G5IA 1PYSB 3GIBA 5LJ5e 4TTVA 4M7AG 3SWNB 4JLIA 1SETA 3FJPA 2P0LA 3WQZA 2I2LA 2RA2A 4PJOD 2ZR3A 2E10A 4YRKA 4Y91A 2RM4A 2ZCEA 1ADJA 4C92F 3TUPA 1EIYB 1B76A 4YRGA 5GAN2 4CH3A 1YFSA 2E3CA 2I4NA 2XGTA 3IG2A 4X5OA 4F7UF 3JB9F 1B8AA 3HFZB 3VQWA 3RKYA 4P3PA 3REUA 3P8YA 4M75E 4M7AB 4NL3A 4O2DA 1YGBA 2DTOA 5GAMg 1KQ1A 5C52B 2QHUA 2YLBA 3HFNA 1E24A 4YROA 4XEOA 5GAMj 1YB3A 3VQVA 4EMKA 4WJ3M 1HTTA 2I4MA 2AKWB 2RD1A 5GAOn 5GANd 3EFRA 3QO8A 4C92E 1E1OA 1HXDA 2CGHA 4EMGA 5DY9A 3DSQA 4G85A 3PZCA 4H2WA 3HXZA 4M7AF 4JUVA 3L4GA
chains in the Genus database with same CATH superfamily
2F5KA 5GMKj 4C92A 4XEMA 1XQHA 3QIIA 4X9CA 2ALYA 2QQBA 1VYVA 4QT7A 1NJ2A 1OQKA 1YFTA 1VQPQ 2LP5A 3JRZA 2ZT7A 3META 4AH6A 1LVKA 2DBMA 1VQPA 1NNHA 1TG0A 1YWPA 1ZX6A 2ED1A 5GAMh 1NM7A 1ASZA 1X01A 1K9MC 3HXUA 2KNBB 2ROLA 3TREA 2KDSA 2CZ0B 4QW2A 1YIJT 2K5LA 3PE0A 4M77E 4M7DF 1OV3A 1G83A 2XIDA 1WLEA 5I21A 3R07A 4DEYA 4C5GA 2F2VA 2JM9A 3RESA 1BI1A 1ASYA 4YRNA 12ASA 1BIAA 1UJYA 1VQ5Q 1VQ8T 1WXTA 3OYJA 4C0ZA 1I8FA 3RMSA 1VIEA 1UGVA 1PD1A 4YRTA 4KUDK 1QLYA 1WLPB 2DU7A 3JCMJ 1VQKT 5EG2A 1QF6A 2MYSA 5FLXE 3CEYA 3HY1A 4EDUA 4HCCA 3OYLA 2PVOB 4Y28E 2ZT8A 2DO3A 1BCOA 4D6WA 3QO7A 4BI4A 3H6ZA 2JOYA 1YI2A 4K88A 3CC7A 4D8KA 1GCPA 2LZ6B 3D7SB 4LXCA 1YHQA 4Q6GA 3VUZA 5K1PA 4FSSA 1YJ9T 2YUQA 4DBFA 1MUZA 3MEVA 3QSUA 2F1LA 1VQ8A 2EJFA 1JJCB 3CCUA 2LDMA 3RL6A 4DPGA 2RJFA 2D6FA 1K1ZA 4RTVA 3VU3C 3BY7A 2GFUA 4PJOB 1JO8A 2PTKA 5CAIA 3G4SA 4RTZA 1W66A 2DMOA 1C0MA 1QWEA 1WQ7A 1Z9QA 5HCKA 3G4SQ 4MDWA 4QVCA 2ALYB 1R0CB 4Q15A 4YYEA 1NZ9A 4C8QG 2YXYA 5GMKl 4M7AF 3LGLA 5D6YA 1Y96A 2DM1A 1X2HA 4DOWA 1L0WA 1Q81R 2ROTA 2WSFE 3EG2A 4RCBA 3L2UA 3QHSA 1WGSA 4ZN3A 4H2XB 1YJ9A 2QHSA 3GLXA 3VS5A 1BI3A 4AG1C 3KXTA 4KRTA 4LD6A 1QKWA 4DOVA 3C0CA 1FYFA 5KYYB 3C12A 5LJ5g 2M9UA 1KG1A 1M9SA 2XICA 2EGEA 3VBBA 2MAMA 5CKEA 1ZA1B 1V29B 1X69A 4C8QE 4XU0A 1M90C 1VQZA 3A7RA 1MMGA 1W70A 2LJ0A 1KHCA 1AWOA 3A7UA 3G6ET 1NYQA 3DLLA 2J6FA 4LDXA 1E7OA 3L1AA 4M78D 5IN1A 4J8OA 2CP7A 1QVFS 1J3TA 2G6FX 3MO8A 3CPWS 2DBKA 1Z7MA 2CJBA 1UB4A 2M02A 1QP3A 4F7UE 4E7LA 2EL9A 2D9TA 2XMFA 3NTHA 3A8GB 4IUPA 1QVGS 2RK2A 1VQ6T 3NETA 4R56A 3OBYA 3BFMA 1G2BA 2DZ9A 3M0TA 4H2UA 3SFMA 2NUTA 1HK9A 1UFFA 5GAN3 3CC7Q 5GAOr 2KI7A 2K3XA 2JMAA 1G5VA 2LCSA 3TEHB 4OGCA 4H2SA 2O9VA 5L23A 3LSQA 2RJDA 1PG5B 4M7DB 3WVEB 1VQLQ 1X2KA 1UJ0A 4NS5A 1LYLA 1WIEA 4YP0A 4XU1A 2VWFA 3CMQA 4XTVA 2HQXA 3CCLQ 5A0DA 3FDRA 3I56A 1RAFB 4E7SA 3ASKA 3PCOB 4PKCC 4L87A 3OYDA 3QO3A 5HGQA 2RK1A 3C4SA 2P0QA 4LDWA 5LL6S 4KH0B 4RCCA 2AZSA 2DYIA 4B9WA 1BU1A 3FJ5A 3U23A 3JCMW 5LJ3h 3CMET 4QQDA 2NUPA 3CCVT 2F2WA 1AZEA 4M78B 1UE9A 3OBWA 2COZA 3H8ZA 1S1NA 4N0AA 6AT1B 3RNJA 3OYNA 4X9DA 2DQ3A 1H92A 2MI6A 1QVFA 3LLRA 4DQ2A 11ASA 2X3XD 1M1KR 4AFQC 1RL2A 2DK3A 4JRKA 1PSEA 3HXVA 3OYGA 1SESA 3EGXA 3VS0A 1CKBA 4PJOE 4PFZA 1PC0A 2DVEA 1QVGA 1W2BA 5CKFA 2K7AA 2YUOA 3UF4A 4QQ6A 2XKOC 3HRUA 1Y71A 2QK0A 3UGQA 4CH5A 1M3CA 1WA7A 2VXFA 2E5KA 2ZPBB 1WYDA 4KULA 2IIMA 5HY6A 2LJ1A 1VQOT 1OZ3A 1PKSA 2D0NA 3SB2A 2OTJA 4C5HA 4P75A 2DVJA 1YITQ 1YITT 3KUFA 3TSWA 2QA4T 1OOTA 5GAMf 4YRIA 4WTOB 1VQ4A 4EMKC 4ZTZB 2A36A 4JPBW 3AHUA 4FSXA 4IURA 4A4GA 2E5QA 2FZKB 1WDXA 4JRQA 3SWNA 2LCCA 1NEGA 1I07A 1Y0MA 2E3HA 1F1BB 3MKDA 4FW1A 3HL8A 2AKKA 5CKDA 2K79A 2V8KA 1EFWA 2IY5A 2GFAA 1T0JA 2V26A 4OP0A 4BY6C 3KFUA 2DYBA 4YRQA 2L3RA 4YRJA 3GPLA 5FW9A 2X51A 3CCRQ 2ENMA 1U3OA 3G6EA 3HRIA 1YI2T 3IALA 3V8KA 1WHJA 2FRYA 5GAN8 2VKNA 3PT9A 3OYKA 4C8QC 1WJSA 5GMKe 4BACA 1USYC 2RHSA 4RMFA 3MEWA 4E7IA 4P73C 2FL7A 3M4QA 1WFWA 3CMEQ 2O88A 2PVDB 1UEBA 1SHGA 3QTCA 1OZ2A 4LVKA 1FMWA 2AZVA 2I4LA 4R0KA 3ZBDA 4DBHA 4OMOA 2J3LA 2LTOA 1ZSZB 2MMPA 4JRIA 3A31A 2LRQA 4P71A 5IXBA 2QEXQ 4M7DA 4A4FA 1I4K1 3J80E 1T3LA 1VQNQ 4LUEA 1KQSS 3LH0A 3JCMf 4Z8AA 4ZTUB 2ESWA 2KY9A 3CCLT 2J05A 3MJXA 3CC2T 1UUEA 4EO4A 1NE8A 3CCQT 1K0SA 4KUIA 4Q5WA 4OMFB 5LJ3j 2EJ9A 4J9GA 1PM3A 1WZOA 1JQQA 2ZT5A 2H3JA 3L2ZA 2P84A 2AKLA 3W3SA 3QYHB 3RUXA 3GIBA 1PYSB 5LJ5e 2C06A 2XDBA 2RA2A 2HSEB 4CC4B 4YTLA 1NEBA 1RAIB 2EQJA 3NFCA 4PJOD 3NTIA 2RM4A 1ADJA 2QG9B 3CC7T 4Z02A 1JJ2A 3EG0A 5GAN2 1YFSA 3OYEA 3IG2A 4X5OA 4HCZA 3CC4Q 1M1KC 2NUTB 2YDLA 2W0ZA 3RKYA 1KIKA 4M7AB 1Q7YR 1YGBA 1K73R 2A8EA 5GAMg 1I1JA 1K9MR 4J7IA 3S3MA 3KBGA 4LDYA 1G3TA 4ZGDB 1X6BA 5DLQE 4YROA 3QXEB 3HHTB 1U8RA 3VQVA 1VQ7A 4JJDA 4PLIA 1HXDA 2F5TX 3DSQA 1SSFA 3O5ZA 1YWOA 1IHWA 3QUIA 3CCMT 2X4WA 4J9BA 4OMQA 2E6ZA 4M7AC 1NJ8A 2E6NA 1YJNA 4J83A 4C92B 1WPYA 3M4YA 2JTEA 4C92G 2EKHA 3A7AA 1WXUA 2HD0A 2CUDA 2JM8A 3MP1A 4MDXA 4KGZB 3CCMQ 2JMCA 1K73C 2L3PA 2RPNA 4TQDA 1E1TA 2Q7EA 2WACA 5GANh 2C0TA 3L2QA 3UGTA 2E12A 3VS4A 1AWJA 1W4SA 4EMHA 2K4YA 2IVWA 4VUBA 2RHZA 1E6HA 5KYWA 4C0FA 3X24B 4C5IA 3I5RA 4PG3A 3JCMP 2BZYA 4M77D 3G1JA 5A2QE 3EGDB 2NLUA 7AT1B 2LX7A 5GANj 4ELYC 4N4GA 3EFOA 4E51A 3BJUA 2DU5A 2RI3A 1YJ9Q 4UP8A 2FB7A 3CCSA 2KVQG 5IXFA 5I2SA 1I5OB 3R6OA 3IKLA 1AT1B 2ZT6A 2X35A 1NYRA 1KOGA 1NG2A 4HVUA 2LCLA 1RI9A 4C0DC 4HVVA 4OMPA 3MP6A 2XTIA 1BB9A 1RI0A 2QYZA 5CQYA 1WI7A 4GY5A 3OW2A 1S72Q 4P72C 3UFGA 4PJLA 2DNUA 1VQKQ 3V8JA 1VQOA 5GJVB 4J7FA 2YT6A 1Q7YU 1ZBJA 3MF1A 2RN8A 3UH0A 5GAN5 1VQ5T 1WHMA 1UGSB 2NYSA 4PLLA 2RO0A 3SDZA 3QG1A 1M1FA 2PUKB 5I22A 2RB6A 3QO5A 2Y4YA 3I35A 2QHVA 4QQGA 2BZXA 5LJ5d 2QEXT 4TVAB 4XQ3A 1PSFA 5GAN4 3GNFB 1SHFA 1UG1A 2DRMA 2CJAA 1N6AA 2COYA 2ZINA 4P74A 1TTHB 1VQPT 2RHIA 4TWAA 3M54A 2GBQA 4ZN1A 4QKUA 3A32A 3GNGA 2CH4A 2LT4A 2J06A 3RGLA 3FIFA 4CS4A 1D1CA 3VS2A 4CC2A 4PK4A 4X34A 3A5ZA 5D6XA 1K73U 4H2VA 5LJ5j 4C0GA 3CD6T 2C7IA 4E7HA 3E9HA 3PIPA 4BB7A 2ZPHB 3M55A 3OW2P 2JUFA 1TS9A 5KYXA 3LH5A 1G5HA 2ODRD 4IKFA 1Q86R 2DRKA 1LPLA 2BTTA 2MIOA 1BCMA 4J9IA 4FCYA 2RQTA 4AFSC 1RUWA 2R5AA 1C1AA 4ELZC 3EG3A 3MF2A 3HXWA 2GNCA 3OS5A 4EX5A 3L2RA 5IT9E 3MQZA 4WF2A 4HT9A 2CUBA 2EWNA 4OB0B 4RKUE 5IHNA 2QGGA 5C53B 4OMLA 2DL5A 2OJ2A 3DB4A 1G3WA 4M75A 4HWPA 2QTXA 2E5AA 1X6OA 1UDLA 2ZZDA 5GAOp 3LSSA 2M1HA 1BBZA 2M16A 2EKOA 4KR2A 1AHJB 2D0QB 2O9SA 3ER0A 4J9DA 5CCAA 1HD3A 1BI2A 1MMNA 4D8DA 1XNIA 4YRPA 2QTVA 2BZ8A 2JW4A 4R55A 2KYBA 2OAWA 5GAOq 1X43A 4BE1A 3RF1A 4ANJA 4M75B 2ZPIB 1UHFA 2CKKA 4PFPA 4XTZA 2ZCFB 1IO6A 1M5Q1 2KK4A 3QBYA 2PMFA 1AZGB 3E9GA 5FRNA 2LJ3A 2K5FA 4FW2A 2EPDA 4XU2A 1HJDA 3JCMd 4JRPA 4FT2A 2DD5A 1RLQC 2FVUA 4K11A 3OYAA 3CCVQ 3EH1A 3URGA 4B9XA 4F16A 1GCQC 4O5VA 2ARUA 4QVZA 3PMIA 2OTLA 2XU8A 3F70A 5KH6A 2PZ1A 4PJMA 2OAUA 2OTLQ 2XDDA 4E7KA 1Q82C 1BBWA 9ATCB 1VQ7T 5CKHA 4YREA 3P8VA 3FLGA 3I9QA 4E6RA 2AKWA 2J7IA 2DQ0A 2K2VA 1PRLC 5FU7B 4N4IA 2XD0A 1RADB 4PJOG 3NELA 3HTZA 2LQ8A 4BE0A 5DLOA 1H3HA 3A5YA 2RMOA 5GMKi 1ZBXA 2WSCE 1GBQA 1VQ4T 1M2OA 3FB9A 3HY0A 3FC3A 4ATOA 2ZTGA 2GF7A 4BW9A 2MOXA 2VVKA 2Y4XA 4C0DB 2QI2A 2O01E 1KD1U 1KSWA 2GCXA 3CXCA 4M7DE 3S3NA 4ZTFA 2FPDA 5LJ3f 2DEQA 1X2QA 2MPXC 4MMKA 2CYZB 3KFVA 5GAMd 3CPWP 4LNSA 2ZPFB 3C95A 3TEEA 3M59A 1IGQA 5KCHA 2WSEE 4LVLA 1GRIA 4UPAA 1CSKA 4IUQA 2VASA 3QYGB 4RTUA 4J15A 2CREA 4M78A 5HK3A 2ZIMA 3A8HB 4G84A 3PIOA 3G1ZA 3QZ5B 1N9RA 2EBPA 3G71A 1KC8R 2VXEA 1NYFA 5DM7R 4F7UB 1VQ7Q 1KK7A 3VV0A 4V2SA 2RQVA 3INZA 2A7YA 2JS2A 1X2GA 2JNGA 2OTLT 3M0UA 3WXMB 1OPLA 2AT1B 2EFIA 4GLMA 4RG2A 2DXTA 2EAYA 1OYXA 3J81E 2G4CA 4OB2B 2EQMA 5A0GA 1B7YB 2FRWA 3CC4A 2KGTA 2HNIA 4HWOA 2FZGB 5IHKA 5ELNA 4J9FA 4C8QB 1WX6A 2ZXFA 1YJWA 1VQMA 4PJOA 2KMTA 1NJ6A 2DFUA 3RR6A 2QEXA 2DD4A 2MK5A 4YRCA 1BBUA 1V1CA 1Q7YC 4E47A 4F04B 4HT8A 4KGXB 4EIKA 1LNXA 2X3WD 3E2UA 5KYUB 3CBMA 4N0AC 5E3IA 4M7DG 4OB3B 1YFRA 1G5IA 4TTVA 3J7AF 1VYTA 2I2LA 5ECAA 1K76A 2E10A 1YHQT 2ZCEA 1NPRA 4C92F 4AFZC 3TUPA 1VYUA 1B76A 2CT3A 2GQVA 4F7UF 1K9MU 3JB9F 1B8AA 1IZ6A 2YSQA 1VQ9T 1MMAA 2RH2A 2J6KA 2GQIA 1WHKA 1M27C 1PHTA 2XHCA 3PNWC 1VQ8Q 4Y92A 5D6WA 3CBPA 3HFNA 3EHRA 3CPWA 4DBRA 3TSZA 1NJIU 1JJ2P 4CRIA 4N4HA 2RNAA 1PCXA 4FYYB 2AIRB 4XAXB 5GANd 3EFRA 1YIJQ 1ACMB 1VA7A 2KT1A 1FXXA 1D1AA 2RHXA 5AT1B 2L3QA 3PZCA 5J3BA 2DJQA 2CH4W 3WVDB 3I7FA 2K9GA 1I81A 4C92D 2EJGA 2RI5A 2B8AA 2EYXA 1WHGA 3HFZA 1Q81U 4HXJA 2ATCB 1OU9A 2K3BA 4J9CA 1K8AC 2DL4A 1JXMA 2RQUA 4KGVB 1M90U 1BYMA 1B34B 3RACA 4JJBA 3GF5A 1M1KU 1KQSP 4WJ4A 4Z89A 2XI9A 3HKSA 1ZUYA 3TU4K 2KR3A 3OYCA 1USYA 5IAYA 1ZSZA 3JCMX 1ARKA 3A8OB 4TVAA 1IXDA 2O4XA 2DIQA 4YRRA 3L42A 4L6V5 1N8RR 3HFVA 2Y90A 5GANf 1WHHA 4PNOA 1G51A 2EIFA 5KNNA 1UGRB 2ABLA 1EOVA 1EX4A 2EGCA 3CCQA 4P71C 2KEAA 2LX9A 2QXFA 3REBB 5LJ3g 1BKBA 1TUDA 2FYKA 3NHNA 4EMKB 1H641 1JJ2S 2EYWA 3MEYA 2CP6A 2EYQA 5CK9A 4FYWB 1M8MA 4HWSA 1QQJA 4ME7A 1XJWB 1B70A 1G3YA 4RDXA 1WXBA 1Q81C 1B7YA 1WQWA 3CCST 4KQEA 2L5QA 2M0OA 4RQFA 2PU9B 2RQRA 3REXA 4LE9A 2E64A 8AT1B 5D7UA 3T9NA 5ELOA 5FRMA 1VOMA 4CS2A 3OYFA 2KRMA 3CCUQ 3CMAA 4BI8B 2ODRC 5GAN7 1RAGB 1QE0A 1YJWT 2CZ1B 5KYXB 1ZLMA 3RKXA 1ZSGA 2KSSA 4OLFA 5KYUA 1VQ5A 2HBPA 2QQRA 3NEMA 4OB1B 5GAOl 1W2BP 3GP8A 3Q1JA 4K87A 1U1TA 4LDUA 3QNEA 1EFNA 2L8DA 1YJNT 2XDPA 1J5WA 1EVLA 4BE2A 3M0PA 3P8HA 2A3LA 3QJYA 1Q82U 3C94A 1LJOA 1KD1C 1VQLA 5IH2A 5FU6B 3JB9H 4J6YA 3G71T 3S3OA 3NPFA 2B86A 1N8RU 1NJIR 2R57A 1WJRA 3UATA 3CBOA 5GANg 4P75C 2EVRA 2QASA 2HZYA 3PGGA 3HFOA 3JB9D 2ZZGA 4P3OA 5M9OA 1HYOA 5J26A 1ABOA 4PJJA 3LX7A 1T0HA 2EW3A 3CC2A 2IY5B 1KC8C 2QDLA 3X26B 2P0KA 3EGDA 1GGMA 1G8XA 2JTFA 2L2PA 4QVDA 2RF0A 1MMDA 2Q5IA 4NOYA 3OYBA 2RQWA 3OSVA 3LC0A 1A0NB 2A08A 3P8DA 2LVMA 5LJ5h 2ZGWA 3VS6A 2X9HA 3NMZC 2ZAEA 4WCIA 3V7SA 4M78F 1X54A 3NGPA 1ZHIA 3BE3A 1KQSA 2Q7GA 1ZQ1A 2L3SA 3ZFJA 4YPFA 2ZPEB 2ZZFA 3CMAQ 4C8QA 4OGEA 3X28B 2HQHA 2MF2A 4NCXA 2A37A 3CC2Q 1YNZA 2EQIA 2DEUA 3JCMb 2P4RA 1X55A 4O6JA 3RKWA 2P5IA 2YUNA 4RMOA 1R0BG 2DE0X 1KJWA 1VQNT 1VUBA 2YUPA 3HPWA 3OMGA 4BWAA 1HC7A 2ZNIA 4RQEA 3JB9I 3JB9J 3VS1A 2DL7A 1GFCA 2DAQA 4BDYA 5K1XA 2Q7HA 3NENA 1M2VA 4A53A 1VQ9A 4M77C 4PL6A 2LNHB 2LQWA 3E9IA 5C0MA 1H3ZA 2MWOA 3VQXA 4ZGJB 1I0CA 4KBMB 3OS1A 2DF6A 5AYFA 1OEBA 3I56Q 2RJCA 4CI0C 2ECZA 3EHQA 3CPFA 3JAME 3L4GB 5C51B 1YITA 2CT4A 4PFOA 3CCRT 2HEQA 2RJEA 5GJWB 3OY9A 2YRDA 2V8IA 3H0IA 3EH2A 4A54A 3OB9A 5CVIA 3V7RA 4F7UA 2F2XA 2DXCA 5FWBA 1ATIA 2DILA 1JJCA 4IUVA 2H8HA 3M56A 4UP7A 4NL2A 3RERA 2V1RA 1JXOA 4H2TA 1LCKA 3CCJA 2QQ9A 2YWWA 3JV3A 4B6MA 4ORZA 2AMCA 3BW1A 4RTWA 2EGAA 1Q86U 3BDUA 2CS7A 3JCMe 5A0LA 1YBYA 2Q5HA 1OULA 3HRSA 1AEYA 5KE2A 4FT4A 2DX1A 3CD6A 2A28A 4HCKA 1QCOA 3PMTA 2MCNA 1UGPB 2YHTA 2BE7D 5C6SA 1N9SA 1KFZA 4M7DD 3CMEA 3HRKA 1H4SA 2HBWA 4C92C 3UPUA 4M4ZA 3AT1B 1M8VA 4M7AA 4FYVB 4A4KA 2DIGA 3M57A 5GAOm 2HL5C 4YRLA 3OYHA 4X1VA 3E19A 1EVKA 2BIVA 3R6NA 1UHCA 2NUPB 2ZR2A 1JU5C 2LNVA 4J5YA 1SERA 1NJ5A 3CD6Q 4MMLA 2QQAA 4TVYA 3I56T 1H4QA 1SG5A 2FZCB 3IKMB 1O75A 1PKTA 4M78G 1ADYA 2HL3A 2FPFA 4RUGA 4GBQA 2CJ9A 1SSHA 3ICAA 4UP9A 1OX8A 1T3SA 2O4XB 4E7ZA 2QAZA 4H02A 2RHQB 3MEAA 2DETA 1LOJA 1RIQA 3MCAB 5GAN6 2BE9B 2D1XA 3MP8A 4F7UG 4J6XA 2ZNJA 1RAEB 2RI2A 2FHDA 3E9FA 2KROA 4OMMA 5FROA 5GAMe 1GL5A 4M77F 1AWWA 3CQTA 3A74A 2QDYB 1K4US 2PQWA 3H0FA 3TQ7P 1K0XA 1U5SA 1M30A 2SEMA 3UA7A 2HSPA 4P5NA 3EGUA 4M77G 2EYYA 4P72A 3CMAT 5HK0A 3OYIA 2K3YA 3I55T 1H8KA 1RAHB 4XTXA 2I0NA 3RIRA 2SRCA 4DEXA 3SWNB 3ME9A 1AWXA 3CXCS 1SETA 3FJPA 2P0LA 2ZR3A 1M4ZA 1S72T 4Y91A 3GBQA 3UDCA 1M1GA 4BDZA 4YRGA 1VQNA 3DKMA 1TXQA 1K9AA 1UECA 1TWBA 2E3CA 2DL3A 3A98A 4JJNK 2JVVA 3HFZB 2PVGB 2VGMA 1VQ6Q 3VQWA 3REUA 1SRLA 3P8YA 4M75E 4F17A 4NL3A 4O2DA 1QW1A 2AK5A 5KE3A 1PD0A 2BKDN 2L89A 1KD1R 1KQ1A 3I55A 3A5ZB 3UT1A 2E4HA 4DA4A 5FU7C 5CKBA 2CZ7B 5EC7A 1MNEA 4XEOA 5GAMj 2KQWA 2IPOB 3RBBB 4EMKA 4WJ3M 1HTTA 3OYMA 1YIJA 1Y07A 1SEMA 3G6EQ 2NUZA 3EFOB 3QO8A 1O9SA 2EQKA 4C92E 3PVLA 4BY6B 2KYMA 4AG2C 5DY9A 2W10A 3RDVA 4H2WA 2GTJA 3HXZA 1TU0B 4A63B 3S6WA 5I2MA 4YRSA 3VRYA 2HMAA 1KC8U 2CP0A 1YJNQ 4PJOF 3M4PA 4HT4A 4KH1B 1YFNA 1R8OB 1QVGP 2JXBA 2DKGA 4HVCA 4ESRA 3HTRA 1EIYA 3QWYA 3EAEA 1GBRA 3VKIA 1B34A 1U1SA 2K2MA 1C0AA 2HKNA 1PYSA 1X75C 2CP3A 1H4TA 2NS6A 1QVFP 4YRFA 1TH7A 4M75G 3CCEA 4P73A 1B3QA 1P92A 1Y96B 4MZMA 4CC7A 5I11A 5CR2A 3EG9B 3G7ZA 1VQKA 1D09B 2QQSA 3O8VA 4M75C 2DXBA 5KYNA 3P8BB 2I4OA 3A8LB 5LJ3d 1X6GA 1PWTA 3L2VA 3VUBA 4CC3A 1QMCA 1MGQA 1NJ1A 1B07A 1FWZA 5GANe 3A1PA 3MEUA 3CC4T 2JN0A 4PJNA 5CQXA 4ZGEB 3GOXA 4M7AD 2R5MA 3UWNA 1UGQB 4JJCA 4LUDA 1D3BB 3QDRB 1FX7A 2RHQA 2HCKA 2KT8A 4EPCA 4AT1B 2QHTA 3M0SA 1E6GA 2OX7A 2RHUA 2V8JA 2LQNA 3I55Q 3OSSC 4M77B 4WI1A 5LJ5f 3E1SA 3LYIA 3CCQQ 1M90R 1M2VB 2M51A 1JBMA 3CXCP 2PNIA 1PNJA 4OF1A 1GCQA 1IHVA 3QKJA 1NPPA 2ARSA 3M4GA 2VC8A 1I5LA 1NJIC 2EQUA 4TVRA 4OMNA 2O2OA 4IIOA 3JCMh 1AD5A 4HKEA 2PMEA 4KT0E 2FG0A 2YLCA 3LGFA 1IRXA 4A4HA 1TUCA 2P4TA 5CIUA 4YRMA 3HSBA 1MV3A 4JZ4A 3OS0A 4AMCA 2J3MA 4L59A 2P0PA 2D8JA 4H2XA 3REAB 4XTWA 5GMKh 1RAAB 1X27A 1YI2Q 1YCSB 3CCET 2QA4A 4JS5A 1OPKA 2JJ9A 1YCYA 2OI3A 5GMKm 2GTOA 3VRZA 3OQ5A 4FIBA 4M75F 4ZNXA 3ZL7C 1VQMT 2X4JA 2KRNA 3V7CA 3NTKA 2DZCA 3V8LA 1SKUB 1TSFA 4JZ3A 3RMQA 2LMJA 1M3BA 2CDTA 1VQ9Q 1W2BS 1WYXA 2K57A 3SWNC 1W6XA 4J6WA 1IL2A 4FL6A 2NWMA 2QA4Q 4J9EA 1V76A 1TOVA 1G3SA 4M78C 1D0YA 3VS3A 1OX9A 2KE9A 4C5EA 1RACB 1YHQQ 2XG8D 4LVJA 1BIBA 1D3BA 1SF9A 2A0FB 3H0HA 4M75D 1VQOQ 3TVTA 4BUGA 1Z9ZA 1WNLA 1KMNA 3M58A 4TQFA 2DDZA 4KR3A 3OS2A 2R58A 4C8QF 3IQLA 2KXCA 4HWRA 2KRSA 3SHWA 1IREB 5CO7A 1OU8A 1XOVA 1N8RC 4OVAA 3MPUB 1RLPC 1Q82R 1X56A 1R77A 5LJ3e 1QWFA 4M7AE 1NBEB 3QDFA 2DA9A 3TCJA 2K5IA 2AMCB 1DJ7B 2E70A 1JRIA 1ZUUA 1B70B 3OA6A 2C0IA 1H4VB 1QVPA 4E7JA 2OTJQ 1QP2A 1NLPC 4FYXB 3CCVA 4M7DC 4PJOC 1UTIA 3VYGA 1EZZB 2HKQB 4BD3A 2CP2A 2EYZA 2DTHA 2E3IA 2JZ2A 2YRVA 4BI3A 2J6OA 1E22A 4GLKA 3TEHA 3TEGA 2LQKA 2HQEA 2X4YA 1FYNA 1PRMC 4TVWA 3ZEHA 1NLOC 1IB8A 3N5BB 1CKAA 2BUDA 4MZPA 3H9NA 4A4EA 1WHLA 2G3RA 2CP5A 4XTYA 1AOJA 4CH4A 4P74C 3HP9A 2AHJB 2JS0A 1M3AA 4J9HA 4ZTJA 2ZIOA 5KYYA 4XTUA 2CZ6B 1B7TA 3EFSA 4HWTA 4F14A 3JCMg 1VQLT 4CS3A 4II1A 3CCJQ 3CCLA 3QWXX 4CH6A 2C8MA 1BI0A 4YCWA 2K6DA 4HA8A 3X20B 3PCOA 1Q95G 3A8MB 2XK0A 4E2FB 3JCMQ 4H2YA 3JSCA 3X25B 4XU3A 1RABB 3QPHA 2HAXA 1VIFA 5KYWB 4JS4A 2RHSB 4AFUC 4LVMA 1BK2A 2VV5A 3FRNA 2CSIA 3VS7A 2KAFA 3SD4A 1ZUKA 3OYYA 1VQ4Q 1GXIE 2C0OA 2HDAA 1KQ2A 2DL8A 2E65A 3FEOA 1IGUA 3JCMc 1WU7A 2VUBA 3M0QA 3DLMA 8ATCB 2LC4A 1D0XA 3CCJT 5J39A 4YDQA 4MZTA 2VB6A 4RTXA 4C8QD 1W1FA 1N5ZA 4YCVA 4JDSA 3M5AA 4RG8A 4IUTA 5KCOA 4L5GA 3CCRA 1EQRA 3I5SA 4PHCA 3VQYA 3G71Q 4LNPA 2DPPB 1MV0B 3EGXB 3JB9G 4JLGA 3THKA 3PFSA 1XTDA 3HXXA 2DXUA 1GFDA 1JB0E 2DERA 1KHIA 2X4XA 1Y7XA 4K86A 3LWIA 2DLPA 4DBQA 1ZSZC 2H3EB 3LWHA 3VJPA 1MNDA 2O31A 2ARTA 5IHIA 1TUGB 3PTAA 2KXDA 1SRYA 1D0ZA 2QGFB 3EG9A 4LDVA 2CSQA 1WJQA 2E41A 1VQ6A 1OI1A 2MWPA 4YCUA 2F69A 2YRCA 2OTJT 3ERRA 1KMMA 1N27A 1MHNA 1QCFA 2ED0A 2VYTA 4FU6A 3H41A 2ZZEA 2CIMA 3EG1A 2FO0A 1YJWQ 2JT4A 3G4ST 2E1HA 3QJ6A 3JCMV 5FWCA 4LVIA 4M77A 3DB3A 2DJZA 1N9WA 3OD1A 1NYGA 2GGRA 1QCNA 3CCUT 2M0YA 4RTTA 3HXYA 2D8HA 3P8TA 3MHXA 2DTIA 3M53A 4M78E 1ZA2B 5F5WA 1ABQA 4ZIBA 2ZPGB 1Z7NA 1EIFA 4P3NA 4M7AG 1SPKA 4JLIA 3WQZA 1QKXA 2COWA 3L2WA 4FM4B 1U06A 3CCSQ 4YRKA 3CCMA 1EIYB 1JEGA 5L8RE 3M0RA 4CH3A 3HRTA 2I4NA 2XGTA 1C6VX 1Y57A 5HKCA 1YP5A 1S72A 2Z0WA 4P3PA 1FMKA 1K8AR 1FMVA 2JTMA 4LN2A 2LT1A 3OW2S 2PUOB 4RTYA 3M9QA 4XK8E 3PVQA 3VYHB 3QZ9B 5FU6C 2DTOA 2IG0A 3BDLA 1SRMA 5C52B 1HSQA 1VQMQ 2YLBA 2QHUA 1E24A 3LW5E 1D1BA 3OMCA 4UC4A 4HCBA 2FPEA 4IUUA 2L0AA 4HVWA 1YB3A 1AVZC 2V1QA 4Z88A 2I4MA 2FEIA 2AKWB 2RD1A 2RHYA 5GAOn 4IIMA 1Q86C 1E1OA 3CCEQ 1YN8A 2KBTA 2CGHA 4EMGA 4G85A 2VGNA 3ULRB 3UA6A 3SEMA 4LD9K 4JUVA 1K8AU 3L4GA
chains in the Genus database with same CATH topology
2F5KA 5GMKj 4C92A 4XEMA 1XQHA 3QIIA 4X9CA 2ALYA 2QQBA 1NJ2A 1YFTA 3JRZA 2ZT7A 3META 4AH6A 1VQPA 1NNHA 5GAMh 1ASZA 1X01A 1K9MC 3HXUA 3TREA 2KDSA 2CZ0B 4QW2A 1YIJT 2K5LA 4M77E 4M7DF 2XIDA 1WLEA 5I21A 3R07A 4C5GA 3RESA 1BI1A 1ASYA 4YRNA 12ASA 1BIAA 1VQ8T 3OYJA 4C0ZA 1I8FA 3RMSA 1VIEA 4YRTA 4KUDK 2DU7A 3JCMJ 1VQKT 5EG2A 1QF6A 5FLXE 3CEYA 3HY1A 4EDUA 4HCCA 3OYLA 2PVOB 4Y28E 2ZT8A 2DO3A 4D6WA 3QO7A 4BI4A 3H6ZA 2JOYA 1YI2A 4K88A 3CC7A 1YHQA 4Q6GA 3VUZA 5K1PA 1YJ9T 3MEVA 3QSUA 1VQ8A 2EJFA 1JJCB 3CCUA 2LDMA 3RL6A 4DPGA 2RJFA 2D6FA 3VU3C 3BY7A 2GFUA 4PJOB 5CAIA 3G4SA 1W66A 1WQ7A 4MDWA 4QVCA 2ALYB 4Q15A 4YYEA 1NZ9A 4C8QG 5GMKl 3LGLA 5D6YA 1Y96A 1X2HA 4DOWA 1L0WA 2WSFE 4RCBA 3L2UA 3QHSA 1WGSA 4ZN3A 4H2XB 1YJ9A 2QHSA 3GLXA 1BI3A 3KXTA 4LD6A 4DOVA 1FYFA 3C12A 5LJ5g 2M9UA 1KG1A 1M9SA 2XICA 3VBBA 2MAMA 5CKEA 1V29B 4C8QE 4XU0A 1M90C 1VQZA 3A7RA 1KHCA 3A7UA 3G6ET 1NYQA 3DLLA 4LDXA 3L1AA 4M78D 5IN1A 4J8OA 1QVFS 3MO8A 3CPWS 1Z7MA 2CJBA 1UB4A 4F7UE 1QP3A 4E7LA 2EL9A 2D9TA 3NTHA 3A8GB 4IUPA 1QVGS 2RK2A 1VQ6T 3NETA 4R56A 3OBYA 3BFMA 2DZ9A 4H2UA 3SFMA 1HK9A 5GAN3 5GAOr 2K3XA 1G5VA 3TEHB 4OGCA 4H2SA 3LSQA 2RJDA 4M7DB 3WVEB 4NS5A 1LYLA 4YP0A 4XU1A 3CMQA 4XTVA 2HQXA 5A0DA 3FDRA 3I56A 3ASKA 3PCOB 4PKCC 4L87A 3OYDA 3QO3A 5HGQA 2RK1A 3C4SA 2P0QA 4LDWA 5LL6S 4RCCA 4B9WA 3JCMW 5LJ3h 3CMET 4QQDA 3CCVT 4M78B 3OBWA 3H8ZA 4N0AA 3OYNA 4X9DA 2DQ3A 2MI6A 1QVFA 3LLRA 4DQ2A 11ASA 1RL2A 2DK3A 4JRKA 1PSEA 3HXVA 3OYGA 1SESA 4PJOE 2DVEA 1QVGA 1W2BA 5CKFA 4QQ6A 2XKOC 3HRUA 1Y71A 3UGQA 4CH5A 2VXFA 2ZPBB 1WYDA 4KULA 5HY6A 1VQOT 1OZ3A 3SB2A 2OTJA 4C5HA 4P75A 1YITT 3KUFA 2QA4T 5GAMf 4YRIA 1VQ4A 4EMKC 4ZTZB 3AHUA 4FSXA 4IURA 4A4GA 2E5QA 4JRQA 3SWNA 2LCCA 3HL8A 5CKDA 2V8KA 1EFWA 2IY5A 2GFAA 4OP0A 4BY6C 3KFUA 4YRQA 2L3RA 4YRJA 3GPLA 3G6EA 3HRIA 1YI2T 3IALA 3V8KA 5GAN8 3PT9A 3OYKA 4C8QC 1WJSA 5GMKe 4BACA 1USYC 2RHSA 4RMFA 3MEWA 4E7IA 4P73C 2FL7A 3M4QA 2PVDB 1UEBA 3QTCA 1OZ2A 4LVKA 2I4LA 3ZBDA 2J3LA 2LTOA 2MMPA 4JRIA 3A31A 2LRQA 4P71A 4M7DA 4A4FA 1I4K1 3J80E 1KQSS 3LH0A 3JCMf 4ZTUB 2KY9A 3CCLT 3CC2T 4EO4A 1NE8A 3CCQT 4KUIA 4Q5WA 4OMFB 5LJ3j 2EJ9A 2ZT5A 2H3JA 3L2ZA 3W3SA 3QYHB 3RUXA 3GIBA 1PYSB 5LJ5e 2C06A 2XDBA 2RA2A 4PJOD 3NFCA 2EQJA 4YTLA 3NTIA 2RM4A 1ADJA 3CC7T 4Z02A 1JJ2A 5GAN2 1YFSA 3OYEA 3IG2A 4X5OA 4HCZA 1M1KC 3RKYA 4M7AB 1YGBA 2A8EA 5GAMg 4J7IA 3S3MA 3KBGA 4LDYA 1G3TA 4ZGDB 5DLQE 4YROA 3QXEB 3HHTB 1U8RA 3VQVA 1VQ7A 4PLIA 1HXDA 2F5TX 3DSQA 1SSFA 1NJ8A 3QUIA 3CCMT 2X4WA 4M7AC 2E6ZA 2E6NA 1YJNA 4J83A 4C92B 1WPYA 3M4YA 4C92G 3A7AA 2HD0A 3MP1A 4MDXA 1K73C 4TQDA 1E1TA 2Q7EA 2WACA 5GANh 3L2QA 3UGTA 2E12A 1W4SA 4EMHA 2K4YA 2IVWA 4VUBA 2RHZA 4C0FA 3X24B 4C5IA 4PG3A 3JCMP 4M77D 5A2QE 2NLUA 5GANj 4ELYC 4N4GA 4E51A 3BJUA 2DU5A 2RI3A 4UP8A 2FB7A 3CCSA 2KVQG 5I2SA 3R6OA 3IKLA 2ZT6A 2X35A 1NYRA 1KOGA 2LCLA 4C0DC 3MP6A 2XTIA 1RI0A 5CQYA 4GY5A 3OW2A 4P72C 3UFGA 3V8JA 1VQOA 4J7FA 1Q7YU 3MF1A 3UH0A 5GAN5 1VQ5T 1UGSB 4PLLA 2RO0A 3SDZA 3QG1A 1M1FA 2PUKB 2RB6A 3QO5A 2Y4YA 2QHVA 4QQGA 5LJ5d 2QEXT 4TVAB 4XQ3A 1PSFA 5GAN4 3GNFB 2CJAA 1N6AA 2ZINA 4P74A 1VQPT 2RHIA 4TWAA 3M54A 4ZN1A 3A32A 3GNGA 2LT4A 3RGLA 3FIFA 4CS4A 4X34A 3A5ZA 5D6XA 1K73U 4H2VA 5LJ5j 4C0GA 3CD6T 2C7IA 4E7HA 3E9HA 3PIPA 4BB7A 2ZPHB 3M55A 2JUFA 1G5HA 2ODRD 4IKFA 2R5AA 4ELZC 3MF2A 3HXWA 3OS5A 4EX5A 3L2RA 5IT9E 3MQZA 4WF2A 4HT9A 4OB0B 2EWNA 4RKUE 5C53B 3DB4A 1G3WA 4M75A 4HWPA 2QTXA 2E5AA 1X6OA 2ZZDA 5GAOp 3LSSA 2M1HA 2M16A 4KR2A 2EKOA 1AHJB 2D0QB 3ER0A 5CCAA 1BI2A 4YRPA 1XNIA 4R55A 5GAOq 4BE1A 3RF1A 4M75B 2ZPIB 2CKKA 4XTZA 2ZCFB 1M5Q1 2KK4A 3QBYA 2PMFA 3E9GA 5FRNA 2K5FA 4XU2A 3JCMd 4JRPA 4FT2A 2DD5A 2FVUA 3OYAA 3URGA 4B9XA 4O5VA 2ARUA 4QVZA 3PMIA 2OTLA 2XU8A 3F70A 5KH6A 2OAUA 2XDDA 4E7KA 1Q82C 1BBWA 1VQ7T 5CKHA 4YREA 3P8VA 3FLGA 2AKWA 2DQ0A 2K2VA 5FU7B 4N4IA 2XD0A 4PJOG 3NELA 3HTZA 2LQ8A 4BE0A 5DLOA 3A5YA 5GMKi 1ZBXA 2WSCE 1VQ4T 3FB9A 3HY0A 3FC3A 4ATOA 2ZTGA 2GF7A 4BW9A 4C0DB 2Y4XA 2QI2A 2O01E 1KD1U 2GCXA 3CXCA 4M7DE 3S3NA 4ZTFA 5LJ3f 2DEQA 4MMKA 5GAMd 2CYZB 4LNSA 2ZPFB 3C95A 3TEEA 3M59A 5KCHA 2WSEE 4LVLA 4UPAA 4IUQA 3QYGB 4J15A 4M78A 5HK3A 2ZIMA 3A8HB 4G84A 3PIOA 3G1ZA 3QZ5B 1N9RA 3G71A 2VXEA 5DM7R 4F7UB 3VV0A 4V2SA 3INZA 2A7YA 1X2GA 2JNGA 2OTLT 3WXMB 2EFIA 4RG2A 2DXTA 2EAYA 1OYXA 3J81E 2G4CA 4OB2B 2EQMA 5A0GA 1B7YB 3CC4A 2HNIA 4HWOA 5ELNA 4C8QB 2ZXFA 1YJWA 1VQMA 4PJOA 2KMTA 1NJ6A 2QEXA 2DD4A 4YRCA 1BBUA 1Q7YC 4E47A 4HT8A 1LNXA 3CBMA 4N0AC 5E3IA 4M7DG 4OB3B 1YFRA 1G5IA 4TTVA 3J7AF 2I2LA 2E10A 1YHQT 2ZCEA 1NPRA 4C92F 3TUPA 1B76A 2GQVA 4F7UF 1K9MU 3JB9F 1B8AA 1IZ6A 1VQ9T 2RH2A 2XHCA 3PNWC 5D6WA 3CBPA 3HFNA 3CPWA 1NJIU 4CRIA 4N4HA 4XAXB 5GANd 3EFRA 1FXXA 2RHXA 3PZCA 5J3BA 3WVDB 3I7FA 1I81A 4C92D 2EJGA 2RI5A 2B8AA 3HFZA 1Q81U 1K8AC 1M90U 1BYMA 1B34B 3RACA 3GF5A 1M1KU 4WJ4A 2XI9A 3HKSA 3TU4K 3OYCA 1USYA 5IAYA 3JCMX 3A8OB 4TVAA 2O4XA 2DIQA 4YRRA 3L42A 4L6V5 3HFVA 2Y90A 5GANf 4PNOA 1G51A 2EIFA 5KNNA 1UGRB 1EOVA 3CCQA 4P71C 2LX9A 2QXFA 5LJ3g 1BKBA 2FYKA 4EMKB 1H641 1JJ2S 3MEYA 2EYQA 5CK9A 4HWSA 4ME7A 1B70A 1G3YA 4RDXA 1Q81C 1B7YA 1WQWA 3CCST 4KQEA 2L5QA 2M0OA 4RQFA 2PU9B 3REXA 2E64A 3T9NA 5ELOA 5FRMA 4CS2A 3OYFA 3CMAA 4BI8B 2ODRC 5GAN7 1QE0A 1YJWT 2CZ1B 3RKXA 4OLFA 2KSSA 1VQ5A 2HBPA 2QQRA 3NEMA 4OB1B 5GAOl 3GP8A 3Q1JA 4K87A 1U1TA 4LDUA 3QNEA 2L8DA 1YJNT 2XDPA 1J5WA 1EVLA 4BE2A 3P8HA 2A3LA 3QJYA 1Q82U 3C94A 1LJOA 1KD1C 1VQLA 5FU6B 3JB9H 4J6YA 3G71T 3S3OA 1N8RU 2R57A 1WJRA 4P75C 3CBOA 5GANg 3PGGA 3HFOA 3JB9D 2ZZGA 4P3OA 5M9OA 5J26A 3LX7A 2IY5B 3CC2A 1KC8C 3X26B 2P0KA 1GGMA 2JTFA 4QVDA 2Q5IA 4NOYA 3OYBA 3OSVA 3LC0A 3P8DA 2LVMA 5LJ5h 2ZGWA 3V7SA 4M78F 1X54A 1ZHIA 1KQSA 2Q7GA 1ZQ1A 3ZFJA 4YPFA 2ZPEB 2ZZFA 4C8QA 4OGEA 3X28B 2MF2A 4NCXA 3JCMb 1X55A 4O6JA 3RKWA 2P5IA 4RMOA 1VQNT 1VUBA 3HPWA 3OMGA 4BWAA 1HC7A 2ZNIA 4RQEA 3JB9I 3JB9J 2DAQA 4BDYA 5K1XA 2Q7HA 3NENA 1VQ9A 4A53A 4M77C 4PL6A 3E9IA 5C0MA 1H3ZA 2MWOA 3VQXA 4ZGJB 4KBMB 3OS1A 5AYFA 2RJCA 4CI0C 3CPFA 3JAME 3L4GB 5C51B 1YITA 3CCRT 2RJEA 3OY9A 2V8IA 4A54A 3OB9A 5CVIA 3V7RA 4F7UA 2DXCA 1ATIA 1JJCA 4IUVA 3M56A 4UP7A 4NL2A 3RERA 4H2TA 3CCJA 2QQ9A 2AMCA 3BW1A 1Q86U 3BDUA 2CS7A 3JCMe 5A0LA 1YBYA 2Q5HA 3HRSA 5KE2A 4FT4A 3CD6A 3PMTA 1UGPB 2YHTA 5C6SA 1N9SA 3HRKA 3CMEA 4M7DD 1H4SA 4C92C 3UPUA 1M8VA 4M7AA 4A4KA 2DIGA 3M57A 5GAOm 4YRLA 3OYHA 3E19A 1EVKA 2BIVA 2ZR2A 2LNVA 4J5YA 1SERA 1NJ5A 4MMLA 2QQAA 4TVYA 3I56T 1H4QA 3IKMB 1O75A 4M78G 1ADYA 2CJ9A 3ICAA 4UP9A 2O4XB 4H02A 2RHQB 3MEAA 1LOJA 1RIQA 3MCAB 5GAN6 3MP8A 4F7UG 4J6XA 2ZNJA 2RI2A 2FHDA 3E9FA 5FROA 5GAMe 4M77F 3A74A 2QDYB 2PQWA 4P5NA 4M77G 4P72A 3CMAT 5HK0A 3OYIA 2K3YA 3I55T 4XTXA 3RIRA 3SWNB 3ME9A 3CXCS 1SETA 3FJPA 2P0LA 2ZR3A 1M4ZA 1S72T 4Y91A 3UDCA 1M1GA 4BDZA 4YRGA 1VQNA 3DKMA 2E3CA 4JJNK 2JVVA 3HFZB 2PVGB 2VGMA 3VQWA 3REUA 3P8YA 4M75E 4NL3A 4O2DA 1QW1A 5KE3A 2BKDN 2L89A 1KQ1A 3I55A 3A5ZB 3UT1A 4DA4A 5FU7C 5CKBA 2CZ7B 4XEOA 5GAMj 2KQWA 4EMKA 4WJ3M 1HTTA 3OYMA 1YIJA 1Y07A 3QO8A 1O9SA 2EQKA 4C92E 4BY6B 5DY9A 4H2WA 3HXZA 3S6WA 5I2MA 4YRSA 1KC8U 4PJOF 3M4PA 4HT4A 1R8OB 2DKGA 4HVCA 1EIYA 3EAEA 3VKIA 1B34A 1U1SA 1C0AA 1PYSA 1X75C 1H4TA 2NS6A 4YRFA 1TH7A 4M75G 3CCEA 4P73A 4MZMA 1P92A 1Y96B 5CR2A 3G7ZA 1VQKA 2QQSA 3O8VA 4M75C 2DXBA 2I4OA 3P8BB 3A8LB 5LJ3d 3L2VA 3VUBA 1MGQA 1NJ1A 1FWZA 5GANe 3MEUA 3CC4T 2JN0A 5CQXA 4ZGEB 3GOXA 4M7AD 2R5MA 3UWNA 1UGQB 1D3BB 3QDRB 1FX7A 2RHQA 4EPCA 2QHTA 2RHUA 2V8JA 3OSSC 4M77B 4WI1A 5LJ5f 3E1SA 3LYIA 1JBMA 4OF1A 3QKJA 1NPPA 2ARSA 3M4GA 2VC8A 1I5LA 1NJIC 2EQUA 4TVRA 3JCMh 4HKEA 2PMEA 4KT0E 2YLCA 3LGFA 4A4HA 2P4TA 5CIUA 4YRMA 3HSBA 3OS0A 2J3MA 4L59A 2P0PA 4H2XA 5GMKh 4XTWA 3CCET 2QA4A 4JS5A 1YCYA 5GMKm 3OQ5A 4FIBA 4M75F 1VQMT 2X4JA 3V7CA 3NTKA 2DZCA 3V8LA 3RMQA 1W2BS 2K57A 3SWNC 4J6WA 1IL2A 4FL6A 1G3SA 4M78C 4C5EA 2XG8D 4LVJA 1BIBA 1D3BA 4M75D 1KMNA 4BUGA 1WNLA 3M58A 4TQFA 2DDZA 4KR3A 3OS2A 2R58A 4C8QF 4HWRA 1IREB 5CO7A 1XOVA 1N8RC 4OVAA 1X56A 5LJ3e 4M7AE 3TCJA 2K5IA 2AMCB 1DJ7B 2E70A 1JRIA 1B70B 3OA6A 1H4VB 1QVPA 4E7JA 1QP2A 3CCVA 4M7DC 4PJOC 3VYGA 4BD3A 2DTHA 2JZ2A 4BI3A 2YRVA 1E22A 4GLKA 3TEHA 3TEGA 2LQKA 2HQEA 2X4YA 4TVWA 3ZEHA 3N5BB 2BUDA 4MZPA 4A4EA 2G3RA 4XTYA 4CH4A 4P74C 3HP9A 2AHJB 4ZTJA 2ZIOA 4XTUA 2CZ6B 3EFSA 4HWTA 3JCMg 1VQLT 4CS3A 4II1A 3CCLA 4CH6A 2C8MA 1BI0A 4YCWA 4HA8A 3X20B 3PCOA 3A8MB 2XK0A 3JCMQ 4H2YA 3JSCA 3X25B 4XU3A 3QPHA 2HAXA 1VIFA 4JS4A 2RHSB 4LVMA 2VV5A 3FRNA 2KAFA 3SD4A 3OYYA 1GXIE 1KQ2A 2E65A 3FEOA 3JCMc 1WU7A 2VUBA 3DLMA 3CCJT 2LC4A 5J39A 4YDQA 4MZTA 4C8QD 4YCVA 4JDSA 3M5AA 4RG8A 4IUTA 5KCOA 4L5GA 3CCRA 1EQRA 4PHCA 3VQYA 2DPPB 3JB9G 4LD9K 4JLGA 3PFSA 1XTDA 3HXXA 2DXUA 1JB0E 1KHIA 2X4XA 1Y7XA 4K86A 3LWIA 3LWHA 3VJPA 2ARTA 3PTAA 1SRYA 4LDVA 1WJQA 2E41A 1VQ6A 1OI1A 2MWPA 4YCUA 2F69A 2OTJT 3ERRA 1KMMA 1N27A 1MHNA 2VYTA 4FU6A 2ZZEA 2CIMA 3G4ST 2E1HA 3QJ6A 3JCMV 4LVIA 4M77A 3DB3A 2DJZA 1N9WA 3OD1A 3CCUT 3HXYA 3P8TA 3MHXA 2DTIA 3M53A 4M78E 5F5WA 4ZIBA 2ZPGB 1Z7NA 1EIFA 4P3NA 4M7AG 4JLIA 3WQZA 3L2WA 4YRKA 4FM4B 3CCMA 1EIYB 5L8RE 4CH3A 3HRTA 2I4NA 2XGTA 5HKCA 1S72A 4P3PA 2JTMA 2LT1A 3OW2S 2PUOB 3M9QA 4XK8E 3VYHB 3QZ9B 5FU6C 2DTOA 2IG0A 3BDLA 5C52B 2QHUA 2YLBA 1E24A 3LW5E 3OMCA 4UC4A 4HCBA 4IUUA 1YB3A 2I4MA 2AKWB 2RD1A 2RHYA 5GAOn 1Q86C 1E1OA 2CGHA 4EMGA 4G85A 2VGNA 4M7AF 4JUVA 1K8AU 3L4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMK j;  4C92 A;  1NJ8 A;  3QUI A;  4YRS A;  4M7A C;  4XEM A;  3I7F A;  4X9C A;  1I81 A;  4C92 D;  2EJG A;  2ALY A;  4C92 B;  1WPY A;  1NJ2 A;  4C92 G;  3HFZ A;  4PJO F;  3M4P A;  1YFT A;  3A7A A;  2ZT7 A;  4AH6 A;  1NNH A;  2DKG A;  4HVC A;  5GAM h;  1B34 B;  1ASZ A;  3RAC A;  1X01 A;  1E1T A;  4TQD A;  2Q7E A;  3HXU A;  1EIY A;  4WJ4 A;  5GAN h;  1B34 A;  3UGT A;  1U1S A;  1C0A A;  1PYS A;  4M77 E;  1H4T A;  4EMH A;  4M7D F;  4YRF A;  1USY A;  1TH7 A;  4M75 G;  4P73 A;  1WLE A;  1Y96 B;  5I21 A;  3JCM X;  3R07 A;  3RES A;  4TVA A;  1ASY A;  4YRR A;  4PG3 A;  3JCM P;  4M77 D;  4M75 C;  3HFV A;  2I4O A;  12AS A;  4YRN A;  2Y90 A;  1BIA A;  5LJ3 d;  5GAN f;  4PNO A;  5GAN j;  1G51 A;  1I8F A;  5KNN A;  1EOV A;  4E51 A;  1MGQ A;  1NJ1 A;  4YRT A;  4P71 C;  3BJU A;  2DU5 A;  5GAN e;  4UP8 A;  2FB7 A;  2JN0 A;  3JCM J;  5LJ3 g;  2DU7 A;  2FYK A;  1QF6 A;  4EMK B;  4M7A D;  1H64 1;  3MEY A;  3IKL A;  3HY1 A;  2ZT6 A;  1NYR A;  4HWS A;  1KOG A;  2ZT8 A;  1B70 A;  1D3B B;  4RDX A;  3QO7 A;  2XTI A;  2RHQ A;  1B7Y A;  1WQW A;  4KQE A;  4K88 A;  4RQF A;  4P72 C;  3UFG A;  3REX A;  4Q6G A;  2QHT A;  2E64 A;  5K1P A;  3V8J A;  3QSU A;  5ELO A;  2EJF A;  4M77 B;  1JJC B;  5LJ5 f;  3MF1 A;  4WI1 A;  4CS2 A;  3RL6 A;  3UH0 A;  4DPG A;  5GAN 5;  3VU3 C;  1JBM A;  3BY7 A;  4PJO B;  2ARS A;  2ODR C;  5CAI A;  1W66 A;  3M4G A;  2VC8 A;  5GAN 7;  2RB6 A;  1I5L A;  1WQ7 A;  3QO5 A;  1QE0 A;  4QVC A;  2ALY B;  3JCM h;  2QHV A;  4Q15 A;  2PME A;  4YYE A;  3RKX A;  4C8Q G;  5LJ5 d;  4TVA B;  5GMK l;  4OLF A;  4XQ3 A;  5GAN 4;  1Y96 A;  2CJA A;  1X2H A;  2YLC A;  1L0W A;  3NEM A;  4RCB A;  5GAO l;  2ZIN A;  3QHS A;  4H2X B;  4P74 A;  2QHS A;  4K87 A;  1U1T A;  4TWA A;  3QNE A;  4YRM A;  3HSB A;  3A32 A;  1FYF A;  1J5W A;  1EVL A;  5LJ5 g;  3RGL A;  2J3M A;  3FIF A;  3VBB A;  4CS4 A;  1LJO A;  4H2X A;  5GMK h;  4XTW A;  4C8Q E;  3A5Z A;  4XU0 A;  4H2V A;  5LJ5 j;  1VQZ A;  2C7I A;  3JB9 H;  3A7R A;  4J6Y A;  3E9H A;  3A7U A;  1NYQ A;  1YCY A;  5GMK m;  5GAN g;  3L1A A;  4M78 D;  1G5H A;  4P75 C;  2ODR D;  4M75 F;  3PGG A;  3HFO A;  3V7C A;  1Z7M A;  2CJB A;  4F7U E;  2EL9 A;  2DZC A;  3V8L A;  3JB9 D;  2ZZG A;  4P3O A;  3MF2 A;  3HXW A;  4EX5 A;  3NET A;  2IY5 B;  2K57 A;  3SWN C;  3BFM A;  4WF2 A;  4HT9 A;  2DZ9 A;  1GGM A;  4J6W A;  2EWN A;  4H2U A;  1IL2 A;  4QVD A;  2Q5I A;  4NOY A;  5C53 B;  1HK9 A;  4M78 C;  5GAN 3;  5GAO r;  4M75 A;  4HWP A;  3LC0 A;  2QTX A;  2E5A A;  1BIB A;  1D3B A;  5GAO p;  4M75 D;  1KMN A;  5LJ5 h;  2ZGW A;  1WNL A;  3LSS A;  4TQF A;  3V7S A;  2DDZ A;  4M78 F;  1X54 A;  4KR2 A;  4KR3 A;  3TEH B;  4C8Q F;  4HWR A;  4H2S A;  2Q7G A;  3LSQ A;  4YPF A;  2ZZF A;  4M7D B;  4YRP A;  4C8Q A;  4NCX A;  5GAO q;  1LYL A;  4YP0 A;  1X56 A;  4XU1 A;  3RF1 A;  3CMQ A;  4XTV A;  5LJ3 e;  4M75 B;  4M7A E;  3JCM b;  1X55 A;  4XTZ A;  3RKW A;  2P5I A;  1M5Q 1;  2AMC B;  3PCO B;  1JRI A;  1B70 B;  4L87 A;  4BWA A;  1HC7 A;  2PMF A;  2ZNI A;  1H4V B;  4RQE A;  3QO3 A;  3JB9 I;  3JB9 J;  5HGQ A;  4XU2 A;  4M7D C;  4PJO C;  3JCM d;  5K1X A;  2Q7H A;  3NEN A;  4A53 A;  4RCC A;  2DTH A;  4M77 C;  1E22 A;  3TEH A;  2ARU A;  3TEG A;  3E9I A;  3JCM W;  5LJ3 h;  3VQX A;  4TVW A;  4M78 B;  4N0A A;  1BBW A;  4X9D A;  3L4G B;  5C51 B;  4YRE A;  2DQ3 A;  3P8V A;  4XTY A;  4DQ2 A;  11AS A;  4CH4 A;  4P74 C;  4JRK A;  2AKW A;  3HXV A;  4A54 A;  2DQ0 A;  3V7R A;  4F7U A;  1SES A;  2ZIO A;  1ATI A;  4PJO E;  4XTU A;  1JJC A;  3EFS A;  2DVE A;  4HWT A;  4PJO G;  3JCM g;  3NEL A;  4NL2 A;  3HTZ A;  4UP7 A;  4CS3 A;  3RER A;  4CH6 A;  4H2T A;  3A5Y A;  2C8M A;  4YCW A;  5GMK i;  4HA8 A;  3UGQ A;  4CH5 A;  2VXF A;  1WYD A;  2AMC A;  3PCO A;  3BW1 A;  3JCM Q;  4H2Y A;  3FB9 A;  4XU3 A;  3BDU A;  3HY0 A;  2ZTG A;  2RHS B;  3JCM e;  4BW9 A;  3SB2 A;  4P75 A;  2Q5H A;  5GAM f;  4YRI A;  4M7D E;  4EMK C;  4ZTZ B;  5LJ3 f;  3AHU A;  2DEQ A;  2YHT A;  4MMK A;  5GAM d;  1N9S A;  1KQ2 A;  4LNS A;  2E65 A;  3JCM c;  3SWN A;  4M7D D;  3HRK A;  1WU7 A;  1H4S A;  4C92 C;  1M8V A;  4M7A A;  4YDQ A;  4UPA A;  4C8Q D;  4YCV A;  4J15 A;  4M78 A;  5GAO m;  2ZIM A;  4YRL A;  4G84 A;  1EFW A;  3G1Z A;  1EVK A;  2IY5 A;  1N9R A;  4OP0 A;  1EQR A;  3KFU A;  4PHC A;  4YRQ A;  4YRJ A;  2VXE A;  2ZR2 A;  3VQY A;  4J5Y A;  1SER A;  1NJ5 A;  4F7U B;  3JB9 G;  4MML A;  4V2S A;  3HRI A;  3IAL A;  3INZ A;  3HXX A;  3V8K A;  2DXU A;  4TVY A;  1H4Q A;  1X2G A;  5GAN 8;  4C8Q C;  5GMK e;  4K86 A;  1USY C;  2RHS A;  3IKM B;  4RMF A;  4P73 C;  3M4Q A;  2DXT A;  4M78 G;  1ADY A;  2EAY A;  2G4C A;  2CJ9 A;  2ART A;  3ICA A;  3QTC A;  4UP9 A;  1SRY A;  1B7Y B;  4H02 A;  2I4L A;  2RHQ B;  2HNI A;  4HWO A;  2E41 A;  1LOJ A;  1RIQ A;  2J3L A;  5GAN 6;  4YCU A;  5ELN A;  4F7U G;  4C8Q B;  4JRI A;  3ERR A;  4J6X A;  1KMM A;  3A31 A;  4P71 A;  2ZNJ A;  2ZXF A;  2ZZE A;  2CIM A;  5GAM e;  4M7D A;  4PJO A;  1I4K 1;  4M77 F;  1NJ6 A;  2E1H A;  4YRC A;  3JCM V;  3JCM f;  1BBU A;  3A74 A;  4M77 A;  4ZTU B;  2DJZ A;  1N9W A;  3OD1 A;  4EO4 A;  3HXY A;  4M77 G;  3P8T A;  4HT8 A;  2DTI A;  4M78 E;  4P72 A;  5LJ3 j;  2EJ9 A;  1LNX A;  5F5W A;  2ZT5 A;  4ZIB A;  4N0A C;  4XTX A;  3L2Z A;  5E3I A;  3RIR A;  4M7D G;  3W3S A;  1YFR A;  1Z7N A;  4P3N A;  3RUX A;  1G5I A;  1PYS B;  3GIB A;  5LJ5 e;  4TTV A;  4M7A G;  3SWN B;  4JLI A;  1SET A;  3FJP A;  2P0L A;  3WQZ A;  2I2L A;  2RA2 A;  4PJO D;  2ZR3 A;  2E10 A;  4YRK A;  4Y91 A;  2RM4 A;  2ZCE A;  1ADJ A;  4C92 F;  3TUP A;  1EIY B;  1B76 A;  4YRG A;  5GAN 2;  4CH3 A;  1YFS A;  2E3C A;  2I4N A;  2XGT A;  3IG2 A;  4X5O A;  4F7U F;  3JB9 F;  1B8A A;  3HFZ B;  3VQW A;  3RKY A;  4P3P A;  3REU A;  3P8Y A;  4M75 E;  4M7A B;  4NL3 A;  4O2D A;  1YGB A;  2DTO A;  5GAM g;  1KQ1 A;  5C52 B;  2QHU A;  2YLB A;  3HFN A;  1E24 A;  4YRO A;  4XEO A;  5GAM j;  1YB3 A;  3VQV A;  4EMK A;  4WJ3 M;  1HTT A;  2I4M A;  2AKW B;  2RD1 A;  5GAO n;  5GAN d;  3EFR A;  3QO8 A;  4C92 E;  1E1O A;  1HXD A;  2CGH A;  4EMG A;  5DY9 A;  3DSQ A;  4G85 A;  3PZC A;  4H2W A;  3HXZ A;  4M7A F;  4JUV A;  3L4G A; 
#chains in the Genus database with same CATH topology
 2F5K A;  5GMK j;  4C92 A;  4XEM A;  1XQH A;  3QII A;  4X9C A;  2ALY A;  2QQB A;  1VYV A;  4QT7 A;  1NJ2 A;  1OQK A;  1YFT A;  1VQP Q;  2LP5 A;  3JRZ A;  2ZT7 A;  3MET A;  4AH6 A;  1LVK A;  2DBM A;  1VQP A;  1NNH A;  1TG0 A;  1YWP A;  1ZX6 A;  2ED1 A;  5GAM h;  1NM7 A;  1ASZ A;  1X01 A;  1K9M C;  3HXU A;  2KNB B;  2ROL A;  3TRE A;  2KDS A;  2CZ0 B;  4QW2 A;  1YIJ T;  2K5L A;  3PE0 A;  4M77 E;  4M7D F;  1OV3 A;  1G83 A;  2XID A;  1WLE A;  5I21 A;  3R07 A;  4DEY A;  4C5G A;  2F2V A;  2JM9 A;  3RES A;  1BI1 A;  1ASY A;  4YRN A;  12AS A;  1BIA A;  1UJY A;  1VQ5 Q;  1VQ8 T;  1WXT A;  3OYJ A;  4C0Z A;  1I8F A;  3RMS A;  1VIE A;  1UGV A;  1PD1 A;  4YRT A;  4KUD K;  1QLY A;  1WLP B;  2DU7 A;  3JCM J;  1VQK T;  5EG2 A;  1QF6 A;  2MYS A;  5FLX E;  3CEY A;  3HY1 A;  4EDU A;  4HCC A;  3OYL A;  2PVO B;  4Y28 E;  2ZT8 A;  2DO3 A;  1BCO A;  4D6W A;  3QO7 A;  4BI4 A;  3H6Z A;  2JOY A;  1YI2 A;  4K88 A;  3CC7 A;  4D8K A;  1GCP A;  2LZ6 B;  3D7S B;  4LXC A;  1YHQ A;  4Q6G A;  3VUZ A;  5K1P A;  4FSS A;  1YJ9 T;  2YUQ A;  4DBF A;  1MUZ A;  3MEV A;  3QSU A;  2F1L A;  1VQ8 A;  2EJF A;  1JJC B;  3CCU A;  2LDM A;  3RL6 A;  4DPG A;  2RJF A;  2D6F A;  1K1Z A;  4RTV A;  3VU3 C;  3BY7 A;  2GFU A;  4PJO B;  1JO8 A;  2PTK A;  5CAI A;  3G4S A;  4RTZ A;  1W66 A;  2DMO A;  1C0M A;  1QWE A;  1WQ7 A;  1Z9Q A;  5HCK A;  3G4S Q;  4MDW A;  4QVC A;  2ALY B;  1R0C B;  4Q15 A;  4YYE A;  1NZ9 A;  4C8Q G;  2YXY A;  5GMK l;  4M7A F;  3LGL A;  5D6Y A;  1Y96 A;  2DM1 A;  1X2H A;  4DOW A;  1L0W A;  1Q81 R;  2ROT A;  2WSF E;  3EG2 A;  4RCB A;  3L2U A;  3QHS A;  1WGS A;  4ZN3 A;  4H2X B;  1YJ9 A;  2QHS A;  3GLX A;  3VS5 A;  1BI3 A;  4AG1 C;  3KXT A;  4KRT A;  4LD6 A;  1QKW A;  4DOV A;  3C0C A;  1FYF A;  5KYY B;  3C12 A;  5LJ5 g;  2M9U A;  1KG1 A;  1M9S A;  2XIC A;  2EGE A;  3VBB A;  2MAM A;  5CKE A;  1ZA1 B;  1V29 B;  1X69 A;  4C8Q E;  4XU0 A;  1M90 C;  1VQZ A;  3A7R A;  1MMG A;  1W70 A;  2LJ0 A;  1KHC A;  1AWO A;  3A7U A;  3G6E T;  1NYQ A;  3DLL A;  2J6F A;  4LDX A;  1E7O A;  3L1A A;  4M78 D;  5IN1 A;  4J8O A;  2CP7 A;  1QVF S;  1J3T A;  2G6F X;  3MO8 A;  3CPW S;  2DBK A;  1Z7M A;  2CJB A;  1UB4 A;  2M02 A;  1QP3 A;  4F7U E;  4E7L A;  2EL9 A;  2D9T A;  2XMF A;  3NTH A;  3A8G B;  4IUP A;  1QVG S;  2RK2 A;  1VQ6 T;  3NET A;  4R56 A;  3OBY A;  3BFM A;  1G2B A;  2DZ9 A;  3M0T A;  4H2U A;  3SFM A;  2NUT A;  1HK9 A;  1UFF A;  5GAN 3;  3CC7 Q;  5GAO r;  2KI7 A;  2K3X A;  2JMA A;  1G5V A;  2LCS A;  3TEH B;  4OGC A;  4H2S A;  2O9V A;  5L23 A;  3LSQ A;  2RJD A;  1PG5 B;  4M7D B;  3WVE B;  1VQL Q;  1X2K A;  1UJ0 A;  4NS5 A;  1LYL A;  1WIE A;  4YP0 A;  4XU1 A;  2VWF A;  3CMQ A;  4XTV A;  2HQX A;  3CCL Q;  5A0D A;  3FDR A;  3I56 A;  1RAF B;  4E7S A;  3ASK A;  3PCO B;  4PKC C;  4L87 A;  3OYD A;  3QO3 A;  5HGQ A;  2RK1 A;  3C4S A;  2P0Q A;  4LDW A;  5LL6 S;  4KH0 B;  4RCC A;  2AZS A;  2DYI A;  4B9W A;  1BU1 A;  3FJ5 A;  3U23 A;  3JCM W;  5LJ3 h;  3CME T;  4QQD A;  2NUP A;  3CCV T;  2F2W A;  1AZE A;  4M78 B;  1UE9 A;  3OBW A;  2COZ A;  3H8Z A;  1S1N A;  4N0A A;  6AT1 B;  3RNJ A;  3OYN A;  4X9D A;  2DQ3 A;  1H92 A;  2MI6 A;  1QVF A;  3LLR A;  4DQ2 A;  11AS A;  2X3X D;  1M1K R;  4AFQ C;  1RL2 A;  2DK3 A;  4JRK A;  1PSE A;  3HXV A;  3OYG A;  1SES A;  3EGX A;  3VS0 A;  1CKB A;  4PJO E;  4PFZ A;  1PC0 A;  2DVE A;  1QVG A;  1W2B A;  5CKF A;  2K7A A;  2YUO A;  3UF4 A;  4QQ6 A;  2XKO C;  3HRU A;  1Y71 A;  2QK0 A;  3UGQ A;  4CH5 A;  1M3C A;  1WA7 A;  2VXF A;  2E5K A;  2ZPB B;  1WYD A;  4KUL A;  2IIM A;  5HY6 A;  2LJ1 A;  1VQO T;  1OZ3 A;  1PKS A;  2D0N A;  3SB2 A;  2OTJ A;  4C5H A;  4P75 A;  2DVJ A;  1YIT Q;  1YIT T;  3KUF A;  3TSW A;  2QA4 T;  1OOT A;  5GAM f;  4YRI A;  4WTO B;  1VQ4 A;  4EMK C;  4ZTZ B;  2A36 A;  4JPB W;  3AHU A;  4FSX A;  4IUR A;  4A4G A;  2E5Q A;  2FZK B;  1WDX A;  4JRQ A;  3SWN A;  2LCC A;  1NEG A;  1I07 A;  1Y0M A;  2E3H A;  1F1B B;  3MKD A;  4FW1 A;  3HL8 A;  2AKK A;  5CKD A;  2K79 A;  2V8K A;  1EFW A;  2IY5 A;  2GFA A;  1T0J A;  2V26 A;  4OP0 A;  4BY6 C;  3KFU A;  2DYB A;  4YRQ A;  2L3R A;  4YRJ A;  3GPL A;  5FW9 A;  2X51 A;  3CCR Q;  2ENM A;  1U3O A;  3G6E A;  3HRI A;  1YI2 T;  3IAL A;  3V8K A;  1WHJ A;  2FRY A;  5GAN 8;  2VKN A;  3PT9 A;  3OYK A;  4C8Q C;  1WJS A;  5GMK e;  4BAC A;  1USY C;  2RHS A;  4RMF A;  3MEW A;  4E7I A;  4P73 C;  2FL7 A;  3M4Q A;  1WFW A;  3CME Q;  2O88 A;  2PVD B;  1UEB A;  1SHG A;  3QTC A;  1OZ2 A;  4LVK A;  1FMW A;  2AZV A;  2I4L A;  4R0K A;  3ZBD A;  4DBH A;  4OMO A;  2J3L A;  2LTO A;  1ZSZ B;  2MMP A;  4JRI A;  3A31 A;  2LRQ A;  4P71 A;  5IXB A;  2QEX Q;  4M7D A;  4A4F A;  1I4K 1;  3J80 E;  1T3L A;  1VQN Q;  4LUE A;  1KQS S;  3LH0 A;  3JCM f;  4Z8A A;  4ZTU B;  2ESW A;  2KY9 A;  3CCL T;  2J05 A;  3MJX A;  3CC2 T;  1UUE A;  4EO4 A;  1NE8 A;  3CCQ T;  1K0S A;  4KUI A;  4Q5W A;  4OMF B;  5LJ3 j;  2EJ9 A;  4J9G A;  1PM3 A;  1WZO A;  1JQQ A;  2ZT5 A;  2H3J A;  3L2Z A;  2P84 A;  2AKL A;  3W3S A;  3QYH B;  3RUX A;  3GIB A;  1PYS B;  5LJ5 e;  2C06 A;  2XDB A;  2RA2 A;  2HSE B;  4CC4 B;  4YTL A;  1NEB A;  1RAI B;  2EQJ A;  3NFC A;  4PJO D;  3NTI A;  2RM4 A;  1ADJ A;  2QG9 B;  3CC7 T;  4Z02 A;  1JJ2 A;  3EG0 A;  5GAN 2;  1YFS A;  3OYE A;  3IG2 A;  4X5O A;  4HCZ A;  3CC4 Q;  1M1K C;  2NUT B;  2YDL A;  2W0Z A;  3RKY A;  1KIK A;  4M7A B;  1Q7Y R;  1YGB A;  1K73 R;  2A8E A;  5GAM g;  1I1J A;  1K9M R;  4J7I A;  3S3M A;  3KBG A;  4LDY A;  1G3T A;  4ZGD B;  1X6B A;  5DLQ E;  4YRO A;  3QXE B;  3HHT B;  1U8R A;  3VQV A;  1VQ7 A;  4JJD A;  4PLI A;  1HXD A;  2F5T X;  3DSQ A;  1SSF A;  3O5Z A;  1YWO A;  1IHW A;  3QUI A;  3CCM T;  2X4W A;  4J9B A;  4OMQ A;  2E6Z A;  4M7A C;  1NJ8 A;  2E6N A;  1YJN A;  4J83 A;  4C92 B;  1WPY A;  3M4Y A;  2JTE A;  4C92 G;  2EKH A;  3A7A A;  1WXU A;  2HD0 A;  2CUD A;  2JM8 A;  3MP1 A;  4MDX A;  4KGZ B;  3CCM Q;  2JMC A;  1K73 C;  2L3P A;  2RPN A;  4TQD A;  1E1T A;  2Q7E A;  2WAC A;  5GAN h;  2C0T A;  3L2Q A;  3UGT A;  2E12 A;  3VS4 A;  1AWJ A;  1W4S A;  4EMH A;  2K4Y A;  2IVW A;  4VUB A;  2RHZ A;  1E6H A;  5KYW A;  4C0F A;  3X24 B;  4C5I A;  3I5R A;  4PG3 A;  3JCM P;  2BZY A;  4M77 D;  3G1J A;  5A2Q E;  3EGD B;  2NLU A;  7AT1 B;  2LX7 A;  5GAN j;  4ELY C;  4N4G A;  3EFO A;  4E51 A;  3BJU A;  2DU5 A;  2RI3 A;  1YJ9 Q;  4UP8 A;  2FB7 A;  3CCS A;  2KVQ G;  5IXF A;  5I2S A;  1I5O B;  3R6O A;  3IKL A;  1AT1 B;  2ZT6 A;  2X35 A;  1NYR A;  1KOG A;  1NG2 A;  4HVU A;  2LCL A;  1RI9 A;  4C0D C;  4HVV A;  4OMP A;  3MP6 A;  2XTI A;  1BB9 A;  1RI0 A;  2QYZ A;  5CQY A;  1WI7 A;  4GY5 A;  3OW2 A;  1S72 Q;  4P72 C;  3UFG A;  4PJL A;  2DNU A;  1VQK Q;  3V8J A;  1VQO A;  5GJV B;  4J7F A;  2YT6 A;  1Q7Y U;  1ZBJ A;  3MF1 A;  2RN8 A;  3UH0 A;  5GAN 5;  1VQ5 T;  1WHM A;  1UGS B;  2NYS A;  4PLL A;  2RO0 A;  3SDZ A;  3QG1 A;  1M1F A;  2PUK B;  5I22 A;  2RB6 A;  3QO5 A;  2Y4Y A;  3I35 A;  2QHV A;  4QQG A;  2BZX A;  5LJ5 d;  2QEX T;  4TVA B;  4XQ3 A;  1PSF A;  5GAN 4;  3GNF B;  1SHF A;  1UG1 A;  2DRM A;  2CJA A;  1N6A A;  2COY A;  2ZIN A;  4P74 A;  1TTH B;  1VQP T;  2RHI A;  4TWA A;  3M54 A;  2GBQ A;  4ZN1 A;  4QKU A;  3A32 A;  3GNG A;  2CH4 A;  2LT4 A;  2J06 A;  3RGL A;  3FIF A;  4CS4 A;  1D1C A;  3VS2 A;  4CC2 A;  4PK4 A;  4X34 A;  3A5Z A;  5D6X A;  1K73 U;  4H2V A;  5LJ5 j;  4C0G A;  3CD6 T;  2C7I A;  4E7H A;  3E9H A;  3PIP A;  4BB7 A;  2ZPH B;  3M55 A;  3OW2 P;  2JUF A;  1TS9 A;  5KYX A;  3LH5 A;  1G5H A;  2ODR D;  4IKF A;  1Q86 R;  2DRK A;  1LPL A;  2BTT A;  2MIO A;  1BCM A;  4J9I A;  4FCY A;  2RQT A;  4AFS C;  1RUW A;  2R5A A;  1C1A A;  4ELZ C;  3EG3 A;  3MF2 A;  3HXW A;  2GNC A;  3OS5 A;  4EX5 A;  3L2R A;  5IT9 E;  3MQZ A;  4WF2 A;  4HT9 A;  2CUB A;  2EWN A;  4OB0 B;  4RKU E;  5IHN A;  2QGG A;  5C53 B;  4OML A;  2DL5 A;  2OJ2 A;  3DB4 A;  1G3W A;  4M75 A;  4HWP A;  2QTX A;  2E5A A;  1X6O A;  1UDL A;  2ZZD A;  5GAO p;  3LSS A;  2M1H A;  1BBZ A;  2M16 A;  2EKO A;  4KR2 A;  1AHJ B;  2D0Q B;  2O9S A;  3ER0 A;  4J9D A;  5CCA A;  1HD3 A;  1BI2 A;  1MMN A;  4D8D A;  1XNI A;  4YRP A;  2QTV A;  2BZ8 A;  2JW4 A;  4R55 A;  2KYB A;  2OAW A;  5GAO q;  1X43 A;  4BE1 A;  3RF1 A;  4ANJ A;  4M75 B;  2ZPI B;  1UHF A;  2CKK A;  4PFP A;  4XTZ A;  2ZCF B;  1IO6 A;  1M5Q 1;  2KK4 A;  3QBY A;  2PMF A;  1AZG B;  3E9G A;  5FRN A;  2LJ3 A;  2K5F A;  4FW2 A;  2EPD A;  4XU2 A;  1HJD A;  3JCM d;  4JRP A;  4FT2 A;  2DD5 A;  1RLQ C;  2FVU A;  4K11 A;  3OYA A;  3CCV Q;  3EH1 A;  3URG A;  4B9X A;  4F16 A;  1GCQ C;  4O5V A;  2ARU A;  4QVZ A;  3PMI A;  2OTL A;  2XU8 A;  3F70 A;  5KH6 A;  2PZ1 A;  4PJM A;  2OAU A;  2OTL Q;  2XDD A;  4E7K A;  1Q82 C;  1BBW A;  9ATC B;  1VQ7 T;  5CKH A;  4YRE A;  3P8V A;  3FLG A;  3I9Q A;  4E6R A;  2AKW A;  2J7I A;  2DQ0 A;  2K2V A;  1PRL C;  5FU7 B;  4N4I A;  2XD0 A;  1RAD B;  4PJO G;  3NEL A;  3HTZ A;  2LQ8 A;  4BE0 A;  5DLO A;  1H3H A;  3A5Y A;  2RMO A;  5GMK i;  1ZBX A;  2WSC E;  1GBQ A;  1VQ4 T;  1M2O A;  3FB9 A;  3HY0 A;  3FC3 A;  4ATO A;  2ZTG A;  2GF7 A;  4BW9 A;  2MOX A;  2VVK A;  2Y4X A;  4C0D B;  2QI2 A;  2O01 E;  1KD1 U;  1KSW A;  2GCX A;  3CXC A;  4M7D E;  3S3N A;  4ZTF A;  2FPD A;  5LJ3 f;  2DEQ A;  1X2Q A;  2MPX C;  4MMK A;  2CYZ B;  3KFV A;  5GAM d;  3CPW P;  4LNS A;  2ZPF B;  3C95 A;  3TEE A;  3M59 A;  1IGQ A;  5KCH A;  2WSE E;  4LVL A;  1GRI A;  4UPA A;  1CSK A;  4IUQ A;  2VAS A;  3QYG B;  4RTU A;  4J15 A;  2CRE A;  4M78 A;  5HK3 A;  2ZIM A;  3A8H B;  4G84 A;  3PIO A;  3G1Z A;  3QZ5 B;  1N9R A;  2EBP A;  3G71 A;  1KC8 R;  2VXE A;  1NYF A;  5DM7 R;  4F7U B;  1VQ7 Q;  1KK7 A;  3VV0 A;  4V2S A;  2RQV A;  3INZ A;  2A7Y A;  2JS2 A;  1X2G A;  2JNG A;  2OTL T;  3M0U A;  3WXM B;  1OPL A;  2AT1 B;  2EFI A;  4GLM A;  4RG2 A;  2DXT A;  2EAY A;  1OYX A;  3J81 E;  2G4C A;  4OB2 B;  2EQM A;  5A0G A;  1B7Y B;  2FRW A;  3CC4 A;  2KGT A;  2HNI A;  4HWO A;  2FZG B;  5IHK A;  5ELN A;  4J9F A;  4C8Q B;  1WX6 A;  2ZXF A;  1YJW A;  1VQM A;  4PJO A;  2KMT A;  1NJ6 A;  2DFU A;  3RR6 A;  2QEX A;  2DD4 A;  2MK5 A;  4YRC A;  1BBU A;  1V1C A;  1Q7Y C;  4E47 A;  4F04 B;  4HT8 A;  4KGX B;  4EIK A;  1LNX A;  2X3W D;  3E2U A;  5KYU B;  3CBM A;  4N0A C;  5E3I A;  4M7D G;  4OB3 B;  1YFR A;  1G5I A;  4TTV A;  3J7A F;  1VYT A;  2I2L A;  5ECA A;  1K76 A;  2E10 A;  1YHQ T;  2ZCE A;  1NPR A;  4C92 F;  4AFZ C;  3TUP A;  1VYU A;  1B76 A;  2CT3 A;  2GQV A;  4F7U F;  1K9M U;  3JB9 F;  1B8A A;  1IZ6 A;  2YSQ A;  1VQ9 T;  1MMA A;  2RH2 A;  2J6K A;  2GQI A;  1WHK A;  1M27 C;  1PHT A;  2XHC A;  3PNW C;  1VQ8 Q;  4Y92 A;  5D6W A;  3CBP A;  3HFN A;  3EHR A;  3CPW A;  4DBR A;  3TSZ A;  1NJI U;  1JJ2 P;  4CRI A;  4N4H A;  2RNA A;  1PCX A;  4FYY B;  2AIR B;  4XAX B;  5GAN d;  3EFR A;  1YIJ Q;  1ACM B;  1VA7 A;  2KT1 A;  1FXX A;  1D1A A;  2RHX A;  5AT1 B;  2L3Q A;  3PZC A;  5J3B A;  2DJQ A;  2CH4 W;  3WVD B;  3I7F A;  2K9G A;  1I81 A;  4C92 D;  2EJG A;  2RI5 A;  2B8A A;  2EYX A;  1WHG A;  3HFZ A;  1Q81 U;  4HXJ A;  2ATC B;  1OU9 A;  2K3B A;  4J9C A;  1K8A C;  2DL4 A;  1JXM A;  2RQU A;  4KGV B;  1M90 U;  1BYM A;  1B34 B;  3RAC A;  4JJB A;  3GF5 A;  1M1K U;  1KQS P;  4WJ4 A;  4Z89 A;  2XI9 A;  3HKS A;  1ZUY A;  3TU4 K;  2KR3 A;  3OYC A;  1USY A;  5IAY A;  1ZSZ A;  3JCM X;  1ARK A;  3A8O B;  4TVA A;  1IXD A;  2O4X A;  2DIQ A;  4YRR A;  3L42 A;  4L6V 5;  1N8R R;  3HFV A;  2Y90 A;  5GAN f;  1WHH A;  4PNO A;  1G51 A;  2EIF A;  5KNN A;  1UGR B;  2ABL A;  1EOV A;  1EX4 A;  2EGC A;  3CCQ A;  4P71 C;  2KEA A;  2LX9 A;  2QXF A;  3REB B;  5LJ3 g;  1BKB A;  1TUD A;  2FYK A;  3NHN A;  4EMK B;  1H64 1;  1JJ2 S;  2EYW A;  3MEY A;  2CP6 A;  2EYQ A;  5CK9 A;  4FYW B;  1M8M A;  4HWS A;  1QQJ A;  4ME7 A;  1XJW B;  1B70 A;  1G3Y A;  4RDX A;  1WXB A;  1Q81 C;  1B7Y A;  1WQW A;  3CCS T;  4KQE A;  2L5Q A;  2M0O A;  4RQF A;  2PU9 B;  2RQR A;  3REX A;  4LE9 A;  2E64 A;  8AT1 B;  5D7U A;  3T9N A;  5ELO A;  5FRM A;  1VOM A;  4CS2 A;  3OYF A;  2KRM A;  3CCU Q;  3CMA A;  4BI8 B;  2ODR C;  5GAN 7;  1RAG B;  1QE0 A;  1YJW T;  2CZ1 B;  5KYX B;  1ZLM A;  3RKX A;  1ZSG A;  2KSS A;  4OLF A;  5KYU A;  1VQ5 A;  2HBP A;  2QQR A;  3NEM A;  4OB1 B;  5GAO l;  1W2B P;  3GP8 A;  3Q1J A;  4K87 A;  1U1T A;  4LDU A;  3QNE A;  1EFN A;  2L8D A;  1YJN T;  2XDP A;  1J5W A;  1EVL A;  4BE2 A;  3M0P A;  3P8H A;  2A3L A;  3QJY A;  1Q82 U;  3C94 A;  1LJO A;  1KD1 C;  1VQL A;  5IH2 A;  5FU6 B;  3JB9 H;  4J6Y A;  3G71 T;  3S3O A;  3NPF A;  2B86 A;  1N8R U;  1NJI R;  2R57 A;  1WJR A;  3UAT A;  3CBO A;  5GAN g;  4P75 C;  2EVR A;  2QAS A;  2HZY A;  3PGG A;  3HFO A;  3JB9 D;  2ZZG A;  4P3O A;  5M9O A;  1HYO A;  5J26 A;  1ABO A;  4PJJ A;  3LX7 A;  1T0H A;  2EW3 A;  3CC2 A;  2IY5 B;  1KC8 C;  2QDL A;  3X26 B;  2P0K A;  3EGD A;  1GGM A;  1G8X A;  2JTF A;  2L2P A;  4QVD A;  2RF0 A;  1MMD A;  2Q5I A;  4NOY A;  3OYB A;  2RQW A;  3OSV A;  3LC0 A;  1A0N B;  2A08 A;  3P8D A;  2LVM A;  5LJ5 h;  2ZGW A;  3VS6 A;  2X9H A;  3NMZ C;  2ZAE A;  4WCI A;  3V7S A;  4M78 F;  1X54 A;  3NGP A;  1ZHI A;  3BE3 A;  1KQS A;  2Q7G A;  1ZQ1 A;  2L3S A;  3ZFJ A;  4YPF A;  2ZPE B;  2ZZF A;  3CMA Q;  4C8Q A;  4OGE A;  3X28 B;  2HQH A;  2MF2 A;  4NCX A;  2A37 A;  3CC2 Q;  1YNZ A;  2EQI A;  2DEU A;  3JCM b;  2P4R A;  1X55 A;  4O6J A;  3RKW A;  2P5I A;  2YUN A;  4RMO A;  1R0B G;  2DE0 X;  1KJW A;  1VQN T;  1VUB A;  2YUP A;  3HPW A;  3OMG A;  4BWA A;  1HC7 A;  2ZNI A;  4RQE A;  3JB9 I;  3JB9 J;  3VS1 A;  2DL7 A;  1GFC A;  2DAQ A;  4BDY A;  5K1X A;  2Q7H A;  3NEN A;  1M2V A;  4A53 A;  1VQ9 A;  4M77 C;  4PL6 A;  2LNH B;  2LQW A;  3E9I A;  5C0M A;  1H3Z A;  2MWO A;  3VQX A;  4ZGJ B;  1I0C A;  4KBM B;  3OS1 A;  2DF6 A;  5AYF A;  1OEB A;  3I56 Q;  2RJC A;  4CI0 C;  2ECZ A;  3EHQ A;  3CPF A;  3JAM E;  3L4G B;  5C51 B;  1YIT A;  2CT4 A;  4PFO A;  3CCR T;  2HEQ A;  2RJE A;  5GJW B;  3OY9 A;  2YRD A;  2V8I A;  3H0I A;  3EH2 A;  4A54 A;  3OB9 A;  5CVI A;  3V7R A;  4F7U A;  2F2X A;  2DXC A;  5FWB A;  1ATI A;  2DIL A;  1JJC A;  4IUV A;  2H8H A;  3M56 A;  4UP7 A;  4NL2 A;  3RER A;  2V1R A;  1JXO A;  4H2T A;  1LCK A;  3CCJ A;  2QQ9 A;  2YWW A;  3JV3 A;  4B6M A;  4ORZ A;  2AMC A;  3BW1 A;  4RTW A;  2EGA A;  1Q86 U;  3BDU A;  2CS7 A;  3JCM e;  5A0L A;  1YBY A;  2Q5H A;  1OUL A;  3HRS A;  1AEY A;  5KE2 A;  4FT4 A;  2DX1 A;  3CD6 A;  2A28 A;  4HCK A;  1QCO A;  3PMT A;  2MCN A;  1UGP B;  2YHT A;  2BE7 D;  5C6S A;  1N9S A;  1KFZ A;  4M7D D;  3CME A;  3HRK A;  1H4S A;  2HBW A;  4C92 C;  3UPU A;  4M4Z A;  3AT1 B;  1M8V A;  4M7A A;  4FYV B;  4A4K A;  2DIG A;  3M57 A;  5GAO m;  2HL5 C;  4YRL A;  3OYH A;  4X1V A;  3E19 A;  1EVK A;  2BIV A;  3R6N A;  1UHC A;  2NUP B;  2ZR2 A;  1JU5 C;  2LNV A;  4J5Y A;  1SER A;  1NJ5 A;  3CD6 Q;  4MML A;  2QQA A;  4TVY A;  3I56 T;  1H4Q A;  1SG5 A;  2FZC B;  3IKM B;  1O75 A;  1PKT A;  4M78 G;  1ADY A;  2HL3 A;  2FPF A;  4RUG A;  4GBQ A;  2CJ9 A;  1SSH A;  3ICA A;  4UP9 A;  1OX8 A;  1T3S A;  2O4X B;  4E7Z A;  2QAZ A;  4H02 A;  2RHQ B;  3MEA A;  2DET A;  1LOJ A;  1RIQ A;  3MCA B;  5GAN 6;  2BE9 B;  2D1X A;  3MP8 A;  4F7U G;  4J6X A;  2ZNJ A;  1RAE B;  2RI2 A;  2FHD A;  3E9F A;  2KRO A;  4OMM A;  5FRO A;  5GAM e;  1GL5 A;  4M77 F;  1AWW A;  3CQT A;  3A74 A;  2QDY B;  1K4U S;  2PQW A;  3H0F A;  3TQ7 P;  1K0X A;  1U5S A;  1M30 A;  2SEM A;  3UA7 A;  2HSP A;  4P5N A;  3EGU A;  4M77 G;  2EYY A;  4P72 A;  3CMA T;  5HK0 A;  3OYI A;  2K3Y A;  3I55 T;  1H8K A;  1RAH B;  4XTX A;  2I0N A;  3RIR A;  2SRC A;  4DEX A;  3SWN B;  3ME9 A;  1AWX A;  3CXC S;  1SET A;  3FJP A;  2P0L A;  2ZR3 A;  1M4Z A;  1S72 T;  4Y91 A;  3GBQ A;  3UDC A;  1M1G A;  4BDZ A;  4YRG A;  1VQN A;  3DKM A;  1TXQ A;  1K9A A;  1UEC A;  1TWB A;  2E3C A;  2DL3 A;  3A98 A;  4JJN K;  2JVV A;  3HFZ B;  2PVG B;  2VGM A;  1VQ6 Q;  3VQW A;  3REU A;  1SRL A;  3P8Y A;  4M75 E;  4F17 A;  4NL3 A;  4O2D A;  1QW1 A;  2AK5 A;  5KE3 A;  1PD0 A;  2BKD N;  2L89 A;  1KD1 R;  1KQ1 A;  3I55 A;  3A5Z B;  3UT1 A;  2E4H A;  4DA4 A;  5FU7 C;  5CKB A;  2CZ7 B;  5EC7 A;  1MNE A;  4XEO A;  5GAM j;  2KQW A;  2IPO B;  3RBB B;  4EMK A;  4WJ3 M;  1HTT A;  3OYM A;  1YIJ A;  1Y07 A;  1SEM A;  3G6E Q;  2NUZ A;  3EFO B;  3QO8 A;  1O9S A;  2EQK A;  4C92 E;  3PVL A;  4BY6 B;  2KYM A;  4AG2 C;  5DY9 A;  2W10 A;  3RDV A;  4H2W A;  2GTJ A;  3HXZ A;  1TU0 B;  4A63 B;  3S6W A;  5I2M A;  4YRS A;  3VRY A;  2HMA A;  1KC8 U;  2CP0 A;  1YJN Q;  4PJO F;  3M4P A;  4HT4 A;  4KH1 B;  1YFN A;  1R8O B;  1QVG P;  2JXB A;  2DKG A;  4HVC A;  4ESR A;  3HTR A;  1EIY A;  3QWY A;  3EAE A;  1GBR A;  3VKI A;  1B34 A;  1U1S A;  2K2M A;  1C0A A;  2HKN A;  1PYS A;  1X75 C;  2CP3 A;  1H4T A;  2NS6 A;  1QVF P;  4YRF A;  1TH7 A;  4M75 G;  3CCE A;  4P73 A;  1B3Q A;  1P92 A;  1Y96 B;  4MZM A;  4CC7 A;  5I11 A;  5CR2 A;  3EG9 B;  3G7Z A;  1VQK A;  1D09 B;  2QQS A;  3O8V A;  4M75 C;  2DXB A;  5KYN A;  3P8B B;  2I4O A;  3A8L B;  5LJ3 d;  1X6G A;  1PWT A;  3L2V A;  3VUB A;  4CC3 A;  1QMC A;  1MGQ A;  1NJ1 A;  1B07 A;  1FWZ A;  5GAN e;  3A1P A;  3MEU A;  3CC4 T;  2JN0 A;  4PJN A;  5CQX A;  4ZGE B;  3GOX A;  4M7A D;  2R5M A;  3UWN A;  1UGQ B;  4JJC A;  4LUD A;  1D3B B;  3QDR B;  1FX7 A;  2RHQ A;  2HCK A;  2KT8 A;  4EPC A;  4AT1 B;  2QHT A;  3M0S A;  1E6G A;  2OX7 A;  2RHU A;  2V8J A;  2LQN A;  3I55 Q;  3OSS C;  4M77 B;  4WI1 A;  5LJ5 f;  3E1S A;  3LYI A;  3CCQ Q;  1M90 R;  1M2V B;  2M51 A;  1JBM A;  3CXC P;  2PNI A;  1PNJ A;  4OF1 A;  1GCQ A;  1IHV A;  3QKJ A;  1NPP A;  2ARS A;  3M4G A;  2VC8 A;  1I5L A;  1NJI C;  2EQU A;  4TVR A;  4OMN A;  2O2O A;  4IIO A;  3JCM h;  1AD5 A;  4HKE A;  2PME A;  4KT0 E;  2FG0 A;  2YLC A;  3LGF A;  1IRX A;  4A4H A;  1TUC A;  2P4T A;  5CIU A;  4YRM A;  3HSB A;  1MV3 A;  4JZ4 A;  3OS0 A;  4AMC A;  2J3M A;  4L59 A;  2P0P A;  2D8J A;  4H2X A;  3REA B;  4XTW A;  5GMK h;  1RAA B;  1X27 A;  1YI2 Q;  1YCS B;  3CCE T;  2QA4 A;  4JS5 A;  1OPK A;  2JJ9 A;  1YCY A;  2OI3 A;  5GMK m;  2GTO A;  3VRZ A;  3OQ5 A;  4FIB A;  4M75 F;  4ZNX A;  3ZL7 C;  1VQM T;  2X4J A;  2KRN A;  3V7C A;  3NTK A;  2DZC A;  3V8L A;  1SKU B;  1TSF A;  4JZ3 A;  3RMQ A;  2LMJ A;  1M3B A;  2CDT A;  1VQ9 Q;  1W2B S;  1WYX A;  2K57 A;  3SWN C;  1W6X A;  4J6W A;  1IL2 A;  4FL6 A;  2NWM A;  2QA4 Q;  4J9E A;  1V76 A;  1TOV A;  1G3S A;  4M78 C;  1D0Y A;  3VS3 A;  1OX9 A;  2KE9 A;  4C5E A;  1RAC B;  1YHQ Q;  2XG8 D;  4LVJ A;  1BIB A;  1D3B A;  1SF9 A;  2A0F B;  3H0H A;  4M75 D;  1VQO Q;  3TVT A;  4BUG A;  1Z9Z A;  1WNL A;  1KMN A;  3M58 A;  4TQF A;  2DDZ A;  4KR3 A;  3OS2 A;  2R58 A;  4C8Q F;  3IQL A;  2KXC A;  4HWR A;  2KRS A;  3SHW A;  1IRE B;  5CO7 A;  1OU8 A;  1XOV A;  1N8R C;  4OVA A;  3MPU B;  1RLP C;  1Q82 R;  1X56 A;  1R77 A;  5LJ3 e;  1QWF A;  4M7A E;  1NBE B;  3QDF A;  2DA9 A;  3TCJ A;  2K5I A;  2AMC B;  1DJ7 B;  2E70 A;  1JRI A;  1ZUU A;  1B70 B;  3OA6 A;  2C0I A;  1H4V B;  1QVP A;  4E7J A;  2OTJ Q;  1QP2 A;  1NLP C;  4FYX B;  3CCV A;  4M7D C;  4PJO C;  1UTI A;  3VYG A;  1EZZ B;  2HKQ B;  4BD3 A;  2CP2 A;  2EYZ A;  2DTH A;  2E3I A;  2JZ2 A;  2YRV A;  4BI3 A;  2J6O A;  1E22 A;  4GLK A;  3TEH A;  3TEG A;  2LQK A;  2HQE A;  2X4Y A;  1FYN A;  1PRM C;  4TVW A;  3ZEH A;  1NLO C;  1IB8 A;  3N5B B;  1CKA A;  2BUD A;  4MZP A;  3H9N A;  4A4E A;  1WHL A;  2G3R A;  2CP5 A;  4XTY A;  1AOJ A;  4CH4 A;  4P74 C;  3HP9 A;  2AHJ B;  2JS0 A;  1M3A A;  4J9H A;  4ZTJ A;  2ZIO A;  5KYY A;  4XTU A;  2CZ6 B;  1B7T A;  3EFS A;  4HWT A;  4F14 A;  3JCM g;  1VQL T;  4CS3 A;  4II1 A;  3CCJ Q;  3CCL A;  3QWX X;  4CH6 A;  2C8M A;  1BI0 A;  4YCW A;  2K6D A;  4HA8 A;  3X20 B;  3PCO A;  1Q95 G;  3A8M B;  2XK0 A;  4E2F B;  3JCM Q;  4H2Y A;  3JSC A;  3X25 B;  4XU3 A;  1RAB B;  3QPH A;  2HAX A;  1VIF A;  5KYW B;  4JS4 A;  2RHS B;  4AFU C;  4LVM A;  1BK2 A;  2VV5 A;  3FRN A;  2CSI A;  3VS7 A;  2KAF A;  3SD4 A;  1ZUK A;  3OYY A;  1VQ4 Q;  1GXI E;  2C0O A;  2HDA A;  1KQ2 A;  2DL8 A;  2E65 A;  3FEO A;  1IGU A;  3JCM c;  1WU7 A;  2VUB A;  3M0Q A;  3DLM A;  8ATC B;  2LC4 A;  1D0X A;  3CCJ T;  5J39 A;  4YDQ A;  4MZT A;  2VB6 A;  4RTX A;  4C8Q D;  1W1F A;  1N5Z A;  4YCV A;  4JDS A;  3M5A A;  4RG8 A;  4IUT A;  5KCO A;  4L5G A;  3CCR A;  1EQR A;  3I5S A;  4PHC A;  3VQY A;  3G71 Q;  4LNP A;  2DPP B;  1MV0 B;  3EGX B;  3JB9 G;  4JLG A;  3THK A;  3PFS A;  1XTD A;  3HXX A;  2DXU A;  1GFD A;  1JB0 E;  2DER A;  1KHI A;  2X4X A;  1Y7X A;  4K86 A;  3LWI A;  2DLP A;  4DBQ A;  1ZSZ C;  2H3E B;  3LWH A;  3VJP A;  1MND A;  2O31 A;  2ART A;  5IHI A;  1TUG B;  3PTA A;  2KXD A;  1SRY A;  1D0Z A;  2QGF B;  3EG9 A;  4LDV A;  2CSQ A;  1WJQ A;  2E41 A;  1VQ6 A;  1OI1 A;  2MWP A;  4YCU A;  2F69 A;  2YRC A;  2OTJ T;  3ERR A;  1KMM A;  1N27 A;  1MHN A;  1QCF A;  2ED0 A;  2VYT A;  4FU6 A;  3H41 A;  2ZZE A;  2CIM A;  3EG1 A;  2FO0 A;  1YJW Q;  2JT4 A;  3G4S T;  2E1H A;  3QJ6 A;  3JCM V;  5FWC A;  4LVI A;  4M77 A;  3DB3 A;  2DJZ A;  1N9W A;  3OD1 A;  1NYG A;  2GGR A;  1QCN A;  3CCU T;  2M0Y A;  4RTT A;  3HXY A;  2D8H A;  3P8T A;  3MHX A;  2DTI A;  3M53 A;  4M78 E;  1ZA2 B;  5F5W A;  1ABQ A;  4ZIB A;  2ZPG B;  1Z7N A;  1EIF A;  4P3N A;  4M7A G;  1SPK A;  4JLI A;  3WQZ A;  1QKX A;  2COW A;  3L2W A;  4FM4 B;  1U06 A;  3CCS Q;  4YRK A;  3CCM A;  1EIY B;  1JEG A;  5L8R E;  3M0R A;  4CH3 A;  3HRT A;  2I4N A;  2XGT A;  1C6V X;  1Y57 A;  5HKC A;  1YP5 A;  1S72 A;  2Z0W A;  4P3P A;  1FMK A;  1K8A R;  1FMV A;  2JTM A;  4LN2 A;  2LT1 A;  3OW2 S;  2PUO B;  4RTY A;  3M9Q A;  4XK8 E;  3PVQ A;  3VYH B;  3QZ9 B;  5FU6 C;  2DTO A;  2IG0 A;  3BDL A;  1SRM A;  5C52 B;  1HSQ A;  1VQM Q;  2YLB A;  2QHU A;  1E24 A;  3LW5 E;  1D1B A;  3OMC A;  4UC4 A;  4HCB A;  2FPE A;  4IUU A;  2L0A A;  4HVW A;  1YB3 A;  1AVZ C;  2V1Q A;  4Z88 A;  2I4M A;  2FEI A;  2AKW B;  2RD1 A;  2RHY A;  5GAO n;  4IIM A;  1Q86 C;  1E1O A;  3CCE Q;  1YN8 A;  2KBT A;  2CGH A;  4EMG A;  4G85 A;  2VGN A;  3ULR B;  3UA6 A;  3SEM A;  4LD9 K;  4JUV A;  1K8A U;  3L4G A; 
#chains in the Genus database with same CATH homology
 2F5K A;  5GMK j;  4C92 A;  4XEM A;  1XQH A;  3QII A;  4X9C A;  2ALY A;  2QQB A;  1NJ2 A;  1YFT A;  3JRZ A;  2ZT7 A;  3MET A;  4AH6 A;  1VQP A;  1NNH A;  5GAM h;  1ASZ A;  1X01 A;  1K9M C;  3HXU A;  3TRE A;  2KDS A;  2CZ0 B;  4QW2 A;  1YIJ T;  2K5L A;  4M77 E;  4M7D F;  2XID A;  1WLE A;  5I21 A;  3R07 A;  4C5G A;  3RES A;  1BI1 A;  1ASY A;  4YRN A;  12AS A;  1BIA A;  1VQ8 T;  3OYJ A;  4C0Z A;  1I8F A;  3RMS A;  1VIE A;  4YRT A;  4KUD K;  2DU7 A;  3JCM J;  1VQK T;  5EG2 A;  1QF6 A;  5FLX E;  3CEY A;  3HY1 A;  4EDU A;  4HCC A;  3OYL A;  2PVO B;  4Y28 E;  2ZT8 A;  2DO3 A;  4D6W A;  3QO7 A;  4BI4 A;  3H6Z A;  2JOY A;  1YI2 A;  4K88 A;  3CC7 A;  1YHQ A;  4Q6G A;  3VUZ A;  5K1P A;  1YJ9 T;  3MEV A;  3QSU A;  1VQ8 A;  2EJF A;  1JJC B;  3CCU A;  2LDM A;  3RL6 A;  4DPG A;  2RJF A;  2D6F A;  3VU3 C;  3BY7 A;  2GFU A;  4PJO B;  5CAI A;  3G4S A;  1W66 A;  1WQ7 A;  4MDW A;  4QVC A;  2ALY B;  4Q15 A;  4YYE A;  1NZ9 A;  4C8Q G;  5GMK l;  3LGL A;  5D6Y A;  1Y96 A;  1X2H A;  4DOW A;  1L0W A;  2WSF E;  4RCB A;  3L2U A;  3QHS A;  1WGS A;  4ZN3 A;  4H2X B;  1YJ9 A;  2QHS A;  3GLX A;  1BI3 A;  3KXT A;  4LD6 A;  4DOV A;  1FYF A;  3C12 A;  5LJ5 g;  2M9U A;  1KG1 A;  1M9S A;  2XIC A;  3VBB A;  2MAM A;  5CKE A;  1V29 B;  4C8Q E;  4XU0 A;  1M90 C;  1VQZ A;  3A7R A;  1KHC A;  3A7U A;  3G6E T;  1NYQ A;  3DLL A;  4LDX A;  3L1A A;  4M78 D;  5IN1 A;  4J8O A;  1QVF S;  3MO8 A;  3CPW S;  1Z7M A;  2CJB A;  1UB4 A;  4F7U E;  1QP3 A;  4E7L A;  2EL9 A;  2D9T A;  3NTH A;  3A8G B;  4IUP A;  1QVG S;  2RK2 A;  1VQ6 T;  3NET A;  4R56 A;  3OBY A;  3BFM A;  2DZ9 A;  4H2U A;  3SFM A;  1HK9 A;  5GAN 3;  5GAO r;  2K3X A;  1G5V A;  3TEH B;  4OGC A;  4H2S A;  3LSQ A;  2RJD A;  4M7D B;  3WVE B;  4NS5 A;  1LYL A;  4YP0 A;  4XU1 A;  3CMQ A;  4XTV A;  2HQX A;  5A0D A;  3FDR A;  3I56 A;  3ASK A;  3PCO B;  4PKC C;  4L87 A;  3OYD A;  3QO3 A;  5HGQ A;  2RK1 A;  3C4S A;  2P0Q A;  4LDW A;  5LL6 S;  4RCC A;  4B9W A;  3JCM W;  5LJ3 h;  3CME T;  4QQD A;  3CCV T;  4M78 B;  3OBW A;  3H8Z A;  4N0A A;  3OYN A;  4X9D A;  2DQ3 A;  2MI6 A;  1QVF A;  3LLR A;  4DQ2 A;  11AS A;  1RL2 A;  2DK3 A;  4JRK A;  1PSE A;  3HXV A;  3OYG A;  1SES A;  4PJO E;  2DVE A;  1QVG A;  1W2B A;  5CKF A;  4QQ6 A;  2XKO C;  3HRU A;  1Y71 A;  3UGQ A;  4CH5 A;  2VXF A;  2ZPB B;  1WYD A;  4KUL A;  5HY6 A;  1VQO T;  1OZ3 A;  3SB2 A;  2OTJ A;  4C5H A;  4P75 A;  1YIT T;  3KUF A;  2QA4 T;  5GAM f;  4YRI A;  1VQ4 A;  4EMK C;  4ZTZ B;  3AHU A;  4FSX A;  4IUR A;  4A4G A;  2E5Q A;  4JRQ A;  3SWN A;  2LCC A;  3HL8 A;  5CKD A;  2V8K A;  1EFW A;  2IY5 A;  2GFA A;  4OP0 A;  4BY6 C;  3KFU A;  4YRQ A;  2L3R A;  4YRJ A;  3GPL A;  3G6E A;  3HRI A;  1YI2 T;  3IAL A;  3V8K A;  5GAN 8;  3PT9 A;  3OYK A;  4C8Q C;  1WJS A;  5GMK e;  4BAC A;  1USY C;  2RHS A;  4RMF A;  3MEW A;  4E7I A;  4P73 C;  2FL7 A;  3M4Q A;  2PVD B;  1UEB A;  3QTC A;  1OZ2 A;  4LVK A;  2I4L A;  3ZBD A;  2J3L A;  2LTO A;  2MMP A;  4JRI A;  3A31 A;  2LRQ A;  4P71 A;  4M7D A;  4A4F A;  1I4K 1;  3J80 E;  1KQS S;  3LH0 A;  3JCM f;  4ZTU B;  2KY9 A;  3CCL T;  3CC2 T;  4EO4 A;  1NE8 A;  3CCQ T;  4KUI A;  4Q5W A;  4OMF B;  5LJ3 j;  2EJ9 A;  2ZT5 A;  2H3J A;  3L2Z A;  3W3S A;  3QYH B;  3RUX A;  3GIB A;  1PYS B;  5LJ5 e;  2C06 A;  2XDB A;  2RA2 A;  4PJO D;  3NFC A;  2EQJ A;  4YTL A;  3NTI A;  2RM4 A;  1ADJ A;  3CC7 T;  4Z02 A;  1JJ2 A;  5GAN 2;  1YFS A;  3OYE A;  3IG2 A;  4X5O A;  4HCZ A;  1M1K C;  3RKY A;  4M7A B;  1YGB A;  2A8E A;  5GAM g;  4J7I A;  3S3M A;  3KBG A;  4LDY A;  1G3T A;  4ZGD B;  5DLQ E;  4YRO A;  3QXE B;  3HHT B;  1U8R A;  3VQV A;  1VQ7 A;  4PLI A;  1HXD A;  2F5T X;  3DSQ A;  1SSF A;  1NJ8 A;  3QUI A;  3CCM T;  2X4W A;  4M7A C;  2E6Z A;  2E6N A;  1YJN A;  4J83 A;  4C92 B;  1WPY A;  3M4Y A;  4C92 G;  3A7A A;  2HD0 A;  3MP1 A;  4MDX A;  1K73 C;  4TQD A;  1E1T A;  2Q7E A;  2WAC A;  5GAN h;  3L2Q A;  3UGT A;  2E12 A;  1W4S A;  4EMH A;  2K4Y A;  2IVW A;  4VUB A;  2RHZ A;  4C0F A;  3X24 B;  4C5I A;  4PG3 A;  3JCM P;  4M77 D;  5A2Q E;  2NLU A;  5GAN j;  4ELY C;  4N4G A;  4E51 A;  3BJU A;  2DU5 A;  2RI3 A;  4UP8 A;  2FB7 A;  3CCS A;  2KVQ G;  5I2S A;  3R6O A;  3IKL A;  2ZT6 A;  2X35 A;  1NYR A;  1KOG A;  2LCL A;  4C0D C;  3MP6 A;  2XTI A;  1RI0 A;  5CQY A;  4GY5 A;  3OW2 A;  4P72 C;  3UFG A;  3V8J A;  1VQO A;  4J7F A;  1Q7Y U;  3MF1 A;  3UH0 A;  5GAN 5;  1VQ5 T;  1UGS B;  4PLL A;  2RO0 A;  3SDZ A;  3QG1 A;  1M1F A;  2PUK B;  2RB6 A;  3QO5 A;  2Y4Y A;  2QHV A;  4QQG A;  5LJ5 d;  2QEX T;  4TVA B;  4XQ3 A;  1PSF A;  5GAN 4;  3GNF B;  2CJA A;  1N6A A;  2ZIN A;  4P74 A;  1VQP T;  2RHI A;  4TWA A;  3M54 A;  4ZN1 A;  3A32 A;  3GNG A;  2LT4 A;  3RGL A;  3FIF A;  4CS4 A;  4X34 A;  3A5Z A;  5D6X A;  1K73 U;  4H2V A;  5LJ5 j;  4C0G A;  3CD6 T;  2C7I A;  4E7H A;  3E9H A;  3PIP A;  4BB7 A;  2ZPH B;  3M55 A;  2JUF A;  1G5H A;  2ODR D;  4IKF A;  2R5A A;  4ELZ C;  3MF2 A;  3HXW A;  3OS5 A;  4EX5 A;  3L2R A;  5IT9 E;  3MQZ A;  4WF2 A;  4HT9 A;  4OB0 B;  2EWN A;  4RKU E;  5C53 B;  3DB4 A;  1G3W A;  4M75 A;  4HWP A;  2QTX A;  2E5A A;  1X6O A;  2ZZD A;  5GAO p;  3LSS A;  2M1H A;  2M16 A;  4KR2 A;  2EKO A;  1AHJ B;  2D0Q B;  3ER0 A;  5CCA A;  1BI2 A;  4YRP A;  1XNI A;  4R55 A;  5GAO q;  4BE1 A;  3RF1 A;  4M75 B;  2ZPI B;  2CKK A;  4XTZ A;  2ZCF B;  1M5Q 1;  2KK4 A;  3QBY A;  2PMF A;  3E9G A;  5FRN A;  2K5F A;  4XU2 A;  3JCM d;  4JRP A;  4FT2 A;  2DD5 A;  2FVU A;  3OYA A;  3URG A;  4B9X A;  4O5V A;  2ARU A;  4QVZ A;  3PMI A;  2OTL A;  2XU8 A;  3F70 A;  5KH6 A;  2OAU A;  2XDD A;  4E7K A;  1Q82 C;  1BBW A;  1VQ7 T;  5CKH A;  4YRE A;  3P8V A;  3FLG A;  2AKW A;  2DQ0 A;  2K2V A;  5FU7 B;  4N4I A;  2XD0 A;  4PJO G;  3NEL A;  3HTZ A;  2LQ8 A;  4BE0 A;  5DLO A;  3A5Y A;  5GMK i;  1ZBX A;  2WSC E;  1VQ4 T;  3FB9 A;  3HY0 A;  3FC3 A;  4ATO A;  2ZTG A;  2GF7 A;  4BW9 A;  4C0D B;  2Y4X A;  2QI2 A;  2O01 E;  1KD1 U;  2GCX A;  3CXC A;  4M7D E;  3S3N A;  4ZTF A;  5LJ3 f;  2DEQ A;  4MMK A;  5GAM d;  2CYZ B;  4LNS A;  2ZPF B;  3C95 A;  3TEE A;  3M59 A;  5KCH A;  2WSE E;  4LVL A;  4UPA A;  4IUQ A;  3QYG B;  4J15 A;  4M78 A;  5HK3 A;  2ZIM A;  3A8H B;  4G84 A;  3PIO A;  3G1Z A;  3QZ5 B;  1N9R A;  3G71 A;  2VXE A;  5DM7 R;  4F7U B;  3VV0 A;  4V2S A;  3INZ A;  2A7Y A;  1X2G A;  2JNG A;  2OTL T;  3WXM B;  2EFI A;  4RG2 A;  2DXT A;  2EAY A;  1OYX A;  3J81 E;  2G4C A;  4OB2 B;  2EQM A;  5A0G A;  1B7Y B;  3CC4 A;  2HNI A;  4HWO A;  5ELN A;  4C8Q B;  2ZXF A;  1YJW A;  1VQM A;  4PJO A;  2KMT A;  1NJ6 A;  2QEX A;  2DD4 A;  4YRC A;  1BBU A;  1Q7Y C;  4E47 A;  4HT8 A;  1LNX A;  3CBM A;  4N0A C;  5E3I A;  4M7D G;  4OB3 B;  1YFR A;  1G5I A;  4TTV A;  3J7A F;  2I2L A;  2E10 A;  1YHQ T;  2ZCE A;  1NPR A;  4C92 F;  3TUP A;  1B76 A;  2GQV A;  4F7U F;  1K9M U;  3JB9 F;  1B8A A;  1IZ6 A;  1VQ9 T;  2RH2 A;  2XHC A;  3PNW C;  5D6W A;  3CBP A;  3HFN A;  3CPW A;  1NJI U;  4CRI A;  4N4H A;  4XAX B;  5GAN d;  3EFR A;  1FXX A;  2RHX A;  3PZC A;  5J3B A;  3WVD B;  3I7F A;  1I81 A;  4C92 D;  2EJG A;  2RI5 A;  2B8A A;  3HFZ A;  1Q81 U;  1K8A C;  1M90 U;  1BYM A;  1B34 B;  3RAC A;  3GF5 A;  1M1K U;  4WJ4 A;  2XI9 A;  3HKS A;  3TU4 K;  3OYC A;  1USY A;  5IAY A;  3JCM X;  3A8O B;  4TVA A;  2O4X A;  2DIQ A;  4YRR A;  3L42 A;  4L6V 5;  3HFV A;  2Y90 A;  5GAN f;  4PNO A;  1G51 A;  2EIF A;  5KNN A;  1UGR B;  1EOV A;  3CCQ A;  4P71 C;  2LX9 A;  2QXF A;  5LJ3 g;  1BKB A;  2FYK A;  4EMK B;  1H64 1;  1JJ2 S;  3MEY A;  2EYQ A;  5CK9 A;  4HWS A;  4ME7 A;  1B70 A;  1G3Y A;  4RDX A;  1Q81 C;  1B7Y A;  1WQW A;  3CCS T;  4KQE A;  2L5Q A;  2M0O A;  4RQF A;  2PU9 B;  3REX A;  2E64 A;  3T9N A;  5ELO A;  5FRM A;  4CS2 A;  3OYF A;  3CMA A;  4BI8 B;  2ODR C;  5GAN 7;  1QE0 A;  1YJW T;  2CZ1 B;  3RKX A;  4OLF A;  2KSS A;  1VQ5 A;  2HBP A;  2QQR A;  3NEM A;  4OB1 B;  5GAO l;  3GP8 A;  3Q1J A;  4K87 A;  1U1T A;  4LDU A;  3QNE A;  2L8D A;  1YJN T;  2XDP A;  1J5W A;  1EVL A;  4BE2 A;  3P8H A;  2A3L A;  3QJY A;  1Q82 U;  3C94 A;  1LJO A;  1KD1 C;  1VQL A;  5FU6 B;  3JB9 H;  4J6Y A;  3G71 T;  3S3O A;  1N8R U;  2R57 A;  1WJR A;  4P75 C;  3CBO A;  5GAN g;  3PGG A;  3HFO A;  3JB9 D;  2ZZG A;  4P3O A;  5M9O A;  5J26 A;  3LX7 A;  2IY5 B;  3CC2 A;  1KC8 C;  3X26 B;  2P0K A;  1GGM A;  2JTF A;  4QVD A;  2Q5I A;  4NOY A;  3OYB A;  3OSV A;  3LC0 A;  3P8D A;  2LVM A;  5LJ5 h;  2ZGW A;  3V7S A;  4M78 F;  1X54 A;  1ZHI A;  1KQS A;  2Q7G A;  1ZQ1 A;  3ZFJ A;  4YPF A;  2ZPE B;  2ZZF A;  4C8Q A;  4OGE A;  3X28 B;  2MF2 A;  4NCX A;  3JCM b;  1X55 A;  4O6J A;  3RKW A;  2P5I A;  4RMO A;  1VQN T;  1VUB A;  3HPW A;  3OMG A;  4BWA A;  1HC7 A;  2ZNI A;  4RQE A;  3JB9 I;  3JB9 J;  2DAQ A;  4BDY A;  5K1X A;  2Q7H A;  3NEN A;  1VQ9 A;  4A53 A;  4M77 C;  4PL6 A;  3E9I A;  5C0M A;  1H3Z A;  2MWO A;  3VQX A;  4ZGJ B;  4KBM B;  3OS1 A;  5AYF A;  2RJC A;  4CI0 C;  3CPF A;  3JAM E;  3L4G B;  5C51 B;  1YIT A;  3CCR T;  2RJE A;  3OY9 A;  2V8I A;  4A54 A;  3OB9 A;  5CVI A;  3V7R A;  4F7U A;  2DXC A;  1ATI A;  1JJC A;  4IUV A;  3M56 A;  4UP7 A;  4NL2 A;  3RER A;  4H2T A;  3CCJ A;  2QQ9 A;  2AMC A;  3BW1 A;  1Q86 U;  3BDU A;  2CS7 A;  3JCM e;  5A0L A;  1YBY A;  2Q5H A;  3HRS A;  5KE2 A;  4FT4 A;  3CD6 A;  3PMT A;  1UGP B;  2YHT A;  5C6S A;  1N9S A;  3HRK A;  3CME A;  4M7D D;  1H4S A;  4C92 C;  3UPU A;  1M8V A;  4M7A A;  4A4K A;  2DIG A;  3M57 A;  5GAO m;  4YRL A;  3OYH A;  3E19 A;  1EVK A;  2BIV A;  2ZR2 A;  2LNV A;  4J5Y A;  1SER A;  1NJ5 A;  4MML A;  2QQA A;  4TVY A;  3I56 T;  1H4Q A;  3IKM B;  1O75 A;  4M78 G;  1ADY A;  2CJ9 A;  3ICA A;  4UP9 A;  2O4X B;  4H02 A;  2RHQ B;  3MEA A;  1LOJ A;  1RIQ A;  3MCA B;  5GAN 6;  3MP8 A;  4F7U G;  4J6X A;  2ZNJ A;  2RI2 A;  2FHD A;  3E9F A;  5FRO A;  5GAM e;  4M77 F;  3A74 A;  2QDY B;  2PQW A;  4P5N A;  4M77 G;  4P72 A;  3CMA T;  5HK0 A;  3OYI A;  2K3Y A;  3I55 T;  4XTX A;  3RIR A;  3SWN B;  3ME9 A;  3CXC S;  1SET A;  3FJP A;  2P0L A;  2ZR3 A;  1M4Z A;  1S72 T;  4Y91 A;  3UDC A;  1M1G A;  4BDZ A;  4YRG A;  1VQN A;  3DKM A;  2E3C A;  4JJN K;  2JVV A;  3HFZ B;  2PVG B;  2VGM A;  3VQW A;  3REU A;  3P8Y A;  4M75 E;  4NL3 A;  4O2D A;  1QW1 A;  5KE3 A;  2BKD N;  2L89 A;  1KQ1 A;  3I55 A;  3A5Z B;  3UT1 A;  4DA4 A;  5FU7 C;  5CKB A;  2CZ7 B;  4XEO A;  5GAM j;  2KQW A;  4EMK A;  4WJ3 M;  1HTT A;  3OYM A;  1YIJ A;  1Y07 A;  3QO8 A;  1O9S A;  2EQK A;  4C92 E;  4BY6 B;  5DY9 A;  4H2W A;  3HXZ A;  3S6W A;  5I2M A;  4YRS A;  1KC8 U;  4PJO F;  3M4P A;  4HT4 A;  1R8O B;  2DKG A;  4HVC A;  1EIY A;  3EAE A;  3VKI A;  1B34 A;  1U1S A;  1C0A A;  1PYS A;  1X75 C;  1H4T A;  2NS6 A;  4YRF A;  1TH7 A;  4M75 G;  3CCE A;  4P73 A;  4MZM A;  1P92 A;  1Y96 B;  5CR2 A;  3G7Z A;  1VQK A;  2QQS A;  3O8V A;  4M75 C;  2DXB A;  2I4O A;  3P8B B;  3A8L B;  5LJ3 d;  3L2V A;  3VUB A;  1MGQ A;  1NJ1 A;  1FWZ A;  5GAN e;  3MEU A;  3CC4 T;  2JN0 A;  5CQX A;  4ZGE B;  3GOX A;  4M7A D;  2R5M A;  3UWN A;  1UGQ B;  1D3B B;  3QDR B;  1FX7 A;  2RHQ A;  4EPC A;  2QHT A;  2RHU A;  2V8J A;  3OSS C;  4M77 B;  4WI1 A;  5LJ5 f;  3E1S A;  3LYI A;  1JBM A;  4OF1 A;  3QKJ A;  1NPP A;  2ARS A;  3M4G A;  2VC8 A;  1I5L A;  1NJI C;  2EQU A;  4TVR A;  3JCM h;  4HKE A;  2PME A;  4KT0 E;  2YLC A;  3LGF A;  4A4H A;  2P4T A;  5CIU A;  4YRM A;  3HSB A;  3OS0 A;  2J3M A;  4L59 A;  2P0P A;  4H2X A;  5GMK h;  4XTW A;  3CCE T;  2QA4 A;  4JS5 A;  1YCY A;  5GMK m;  3OQ5 A;  4FIB A;  4M75 F;  1VQM T;  2X4J A;  3V7C A;  3NTK A;  2DZC A;  3V8L A;  3RMQ A;  1W2B S;  2K57 A;  3SWN C;  4J6W A;  1IL2 A;  4FL6 A;  1G3S A;  4M78 C;  4C5E A;  2XG8 D;  4LVJ A;  1BIB A;  1D3B A;  4M75 D;  1KMN A;  4BUG A;  1WNL A;  3M58 A;  4TQF A;  2DDZ A;  4KR3 A;  3OS2 A;  2R58 A;  4C8Q F;  4HWR A;  1IRE B;  5CO7 A;  1XOV A;  1N8R C;  4OVA A;  1X56 A;  5LJ3 e;  4M7A E;  3TCJ A;  2K5I A;  2AMC B;  1DJ7 B;  2E70 A;  1JRI A;  1B70 B;  3OA6 A;  1H4V B;  1QVP A;  4E7J A;  1QP2 A;  3CCV A;  4M7D C;  4PJO C;  3VYG A;  4BD3 A;  2DTH A;  2JZ2 A;  4BI3 A;  2YRV A;  1E22 A;  4GLK A;  3TEH A;  3TEG A;  2LQK A;  2HQE A;  2X4Y A;  4TVW A;  3ZEH A;  3N5B B;  2BUD A;  4MZP A;  4A4E A;  2G3R A;  4XTY A;  4CH4 A;  4P74 C;  3HP9 A;  2AHJ B;  4ZTJ A;  2ZIO A;  4XTU A;  2CZ6 B;  3EFS A;  4HWT A;  3JCM g;  1VQL T;  4CS3 A;  4II1 A;  3CCL A;  4CH6 A;  2C8M A;  1BI0 A;  4YCW A;  4HA8 A;  3X20 B;  3PCO A;  3A8M B;  2XK0 A;  3JCM Q;  4H2Y A;  3JSC A;  3X25 B;  4XU3 A;  3QPH A;  2HAX A;  1VIF A;  4JS4 A;  2RHS B;  4LVM A;  2VV5 A;  3FRN A;  2KAF A;  3SD4 A;  3OYY A;  1GXI E;  1KQ2 A;  2E65 A;  3FEO A;  3JCM c;  1WU7 A;  2VUB A;  3DLM A;  3CCJ T;  2LC4 A;  5J39 A;  4YDQ A;  4MZT A;  4C8Q D;  4YCV A;  4JDS A;  3M5A A;  4RG8 A;  4IUT A;  5KCO A;  4L5G A;  3CCR A;  1EQR A;  4PHC A;  3VQY A;  2DPP B;  3JB9 G;  4LD9 K;  4JLG A;  3PFS A;  1XTD A;  3HXX A;  2DXU A;  1JB0 E;  1KHI A;  2X4X A;  1Y7X A;  4K86 A;  3LWI A;  3LWH A;  3VJP A;  2ART A;  3PTA A;  1SRY A;  4LDV A;  1WJQ A;  2E41 A;  1VQ6 A;  1OI1 A;  2MWP A;  4YCU A;  2F69 A;  2OTJ T;  3ERR A;  1KMM A;  1N27 A;  1MHN A;  2VYT A;  4FU6 A;  2ZZE A;  2CIM A;  3G4S T;  2E1H A;  3QJ6 A;  3JCM V;  4LVI A;  4M77 A;  3DB3 A;  2DJZ A;  1N9W A;  3OD1 A;  3CCU T;  3HXY A;  3P8T A;  3MHX A;  2DTI A;  3M53 A;  4M78 E;  5F5W A;  4ZIB A;  2ZPG B;  1Z7N A;  1EIF A;  4P3N A;  4M7A G;  4JLI A;  3WQZ A;  3L2W A;  4YRK A;  4FM4 B;  3CCM A;  1EIY B;  5L8R E;  4CH3 A;  3HRT A;  2I4N A;  2XGT A;  5HKC A;  1S72 A;  4P3P A;  2JTM A;  2LT1 A;  3OW2 S;  2PUO B;  3M9Q A;  4XK8 E;  3VYH B;  3QZ9 B;  5FU6 C;  2DTO A;  2IG0 A;  3BDL A;  5C52 B;  2QHU A;  2YLB A;  1E24 A;  3LW5 E;  3OMC A;  4UC4 A;  4HCB A;  4IUU A;  1YB3 A;  2I4M A;  2AKW B;  2RD1 A;  2RHY A;  5GAO n;  1Q86 C;  1E1O A;  2CGH A;  4EMG A;  4G85 A;  2VGN A;  4M7A F;  4JUV A;  1K8A U;  3L4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...