2DEQA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111g mutation
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKGIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 70
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2deqA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2deqA01
4BWAA 2RB6A 4M78B 4MMLA 2ZT8A 3HSBA 3HXWA 3A7UA 3JCMP 4JLIA 4C92F 4HVCA 2XTIA 5GMKh 1HC7A 1YCYA 3JCMe 2IY5A 3RIRA 2I4OA 4H2YA 2YHTA 5GAMh 3NENA 4H2VA 4M78C 3JCMW 1NJ8A 4YDQA 1X2GA 5LJ3g 4K86A 11ASA 3JB9G 3L4GB 4YCWA 4KR3A 1I4K1 3RKWA 2ODRC 4TVAB 4M7DG 3JB9D 1ADJA 1HTTA 1B76A 1BBUA 2CJ9A 4F7UF 1NJ5A 5I21A 3V7CA 3QO7A 1M5Q1 2JN0A 1E22A 2I4MA 4RMFA 1NJ6A 2DTOA 4M7DD 1ASZA 4C92A 3JCMg 5GMKl 4YRTA 3HXZA 3VBBA 4M7AG 5GAN4 1Y96A 4M7AE 4EMKB 4P72C 2EJ9A 1KQ2A 3IKMB 4RQFA 1B70A 4YRFA 4TQDA 4M7AD 3M4GA 3V8KA 4HWSA 3L2ZA 4HWTA 4NL3A 4P71C 5GAN6 2ZZEA 4PG3A 3VQYA 4ZTZB 4YRSA 4AH6A 4WF2A 2VXEA 4PJOC 4P3NA 4X9DA 4M7DF 3REUA 4A54A 4F7UA 3BJUA 1ASYA 4RDXA 4C8QB 2RHQB 4YCVA 2DDZA 2DQ3A 4M75G 4J5YA 4E51A 2ZNJA 5GMKj 4XEOA 3SB2A 5C53B 4M75E 1N9SA 3QO3A 5LJ5g 1PYSB 3WQZA 4BW9A 3LSQA 4H02A 4M75D 4K87A 5GANh 5GAMe 2ARUA 4C8QC 4H2XA 4EO4A 3JCMQ 4HWPA 1KMNA 2VXFA 3TEHB 1EOVA 1QE0A 5C51B 3FB9A 4M77C 4XU1A 3SWNC 1VQZA 2RHSB 3G1ZA 3NEMA 1I8FA 3HRKA 4CS2A 4CS3A 2AKWA 1B7YA 3DSQA 3I7FA 4EMGA 3BDUA 5GAMg 3E9HA 4YPFA 3JCMf 4C92G 4M78A 1YGBA 3RF1A 4C92E 3QO8A 2CJAA 3W3SA 5ELOA 2EWNA 3KFUA 4C92D 2ALYB 1QF6A 1B8AA 3EFSA 1G51A 1I5LA 3JB9H 4PJOF 3IG2A 4DPGA 5LJ3e 5GAOp 1B34A 1W66A 5GAOl 2QHUA 5GAOn 1EVKA 3QTCA 1KQ1A 4HT8A 1NJ1A 4YRPA 4UP9A 4QVCA 4F7UG 4M7DB 3JCMd 2ZCEA 4YRGA 4F7UE 1IL2A 4TVAA 1EIYB 3RERA 4WJ3M 4P72A 2AMCB 4J6YA 5GANj 1YFTA 2ARTA 2QHVA 4P71A 5LJ5f 4DQ2A 4M7AB 2EAYA 2HNIA 4XTYA 3A74A 4N0AC 4PJOA 2ZZFA 3HXUA 1M8VA 1J5WA 2C8MA 3GIBA 4J6XA 4H2UA 4M77F 1JJCA 2ZXFA 3VQVA 2RD1A 1X54A 4YRKA 4M7DE 3MEYA 2EJGA 2VC8A 2DU5A 4X9CA 1NYQA 3QO5A 5ELNA 3OD1A 3NETA 3QHSA 5LJ5d 3HFZA 5GANg 1H4TA 4P73C 1E1TA 2Q7GA 3JB9I 4M75B 3UFGA 4XTWA 4C8QA 4JUVA 5GAMf 3JCMV 2YLBA 1U1SA 4JRKA 1D3BA 5LJ5e 5K1XA 3HY1A 2IY5B 4M77A 3SWNA 3BW1A 4M75C 2Q7HA 2DXTA 3PCOA 4EMKC 1YFSA 1HXDA 2CIMA 3TEHA 4HT9A 2I2LA 4EMHA 2ARSA 5GAMd 3HY0A 1WQWA 2P5IA 3IALA 3A7AA 2DTIA 5GMKe 12ASA 3HXYA 3A7RA 1USYC 4CH6A 1LJOA 4P3PA 4M78F 4C92B 2DU7A 2ZINA 4XTVA 1Z7NA 4YRLA 4P74C 4QVDA 4Q6GA 1Y96B 5LJ3f 2ZTGA 4TVYA 4PJOG 1B70B 2ZIMA 3R07A 3P8TA 3RGLA 3HFOA 2Q7EA 2DTHA 4PJOE 4TQFA 4UPAA 1H641 3JCMb 1L0WA 2E64A 1X01A 4PJOD 1WU7A 4WI1A 4Y91A 3AHUA 4F7UB 5KNNA 3HFVA 4P3OA 3TEGA 3LC0A 3UGTA 4HA8A 4NOYA 3A31A 2DXUA 4N0AA 3RESA 1HK9A 3P8VA 5LJ3d 3VU3C 3PZCA 4YRMA 4YREA 4XEMA 4TTVA 1E1OA 4XU3A 4G84A 3JCMc 4XU0A 4PHCA 1GGMA 4M77G 2ZT6A 4H2XB 2PMEA 3A32A 1BIAA 2ZGWA 4M77E 3L4GA 1RIQA 1Z7MA 4P73A 4M77D 4L87A 4TVWA 5GAN5 5DY9A 2RA2A 1FYFA 1X2HA 1ADYA 4WJ4A 2E41A 2PMFA 1TH7A 5GMKm 5GAN7 2P0LA 2FYKA 4PNOA 2AKWB 3M4PA 3RKXA 5GANe 2ZR3A 4C8QF 4UP8A 3BFMA 4CH3A 4M7DC 1LYLA 4YRCA 5GAN3 5CAIA 3IKLA 4J15A 3VQXA 2EJFA 4M75A 1SERA 1WQ7A 3LSSA 4KQEA 1JBMA 4EMKA 4NCXA 4H2TA 4K88A 1EFWA 1I81A 2G4CA 3JCMJ 3QSUA 4M7AC 3RUXA 3E9IA 5C52B 4YRNA 3CMQA 2DVEA 1NNHA 4YRQA 4Q15A 4CH5A 1B34B 2K57A 2ZIOA 4TWAA 2DZ9A 3UH0A 5HGQA 3HTZA 3RKYA 1USYA 2Q5IA 4XTUA 1N9RA 1NYRA 3RACA 1YFRA 4YRJA 1YB3A 2RHQA 4XQ3A 4LNSA 4P75C 3EFRA 5GAOq 1H4VB 4P74A 4M78G 4YP0A 4M78E 4HWRA 1PYSA 4NL2A 3MF2A 2J3LA 1LOJA 2Q5HA 2Y90A 4M78D 3BY7A 4CH4A 4RCBA 3FIFA 2QHSA 3VQWA 2ZT5A 1WYDA 4CS4A 4PJOB 2XGTA 1MGQA 5LJ5j 2ODRD 4XTXA 4YYEA 3PGGA 3A5YA 1JJCB 4ZIBA 4RQEA 4OP0A 4XU2A 2E10A 3JB9F 1E24A 2RHSA 4H2WA 3A5ZA 2DKGA 3V8LA 4YCUA 5GAN8 2DJZA 2RM4A 3TUPA 5LJ3h 3HFZB 4A53A 4YRRA 1N9WA 1G5IA 2FB7A 4G85A 3UGQA 2DQ0A 2ZT7A 5F5WA 4O2DA 2E1HA 1WPYA 4MMKA 1JRIA 1G5HA 1D3BB 3L1AA 3JB9J 2EL9A 4X5OA 5GAOr 4M7AF 2I4LA 5GAOm 1SESA 1U1TA 2ALYA 5GMKi 1SRYA 4C92C 3ERRA 4UP7A 5GAMj 4JRIA 2ZNIA 4M77B 4RCCA 3SWNB 3JCMh 1KOGA 3RL6A 3JCMX 4YROA 3HXVA 2I4NA 3PCOB 4J6WA 4OLFA 1X56A 1H4QA 1WNLA 1X55A 1H4SA 1ATIA 1EVLA 2DEQA 2CGHA 5GANf 2E5AA 3V7SA 4M7DA 4ZTUB 1SETA 4C8QG 1EIYA 3HXXA 3ICAA 2QHTA 2AMCA 3M4QA 4C8QE 1WLEA 2ZZGA 3REXA 5GAN2 2ZR2A 3INZA 4M75F 4C8QD 4M7AA 1KMMA 5E3IA 5K1PA 2J3MA 3FJPA 2DZCA 3NELA 2E65A 4EX5A 1BBWA 2E3CA 3P8YA 4H2SA 2YLCA 3V7RA 3HRIA 2C7IA 5GANd 1BIBA 3QNEA 1LNXA 5LJ5h 1EQRA 4V2SA 4KR2A 3V8JA 4YRIA 4P75A 5LJ3j 3QUIA 2CJBA 1B7YB 2QTXA 3MF1A 4HWOA 1C0AA 4XTZA 3HFNA 1NJ2A
chains in the Genus database with same CATH superfamily
3EAEA 2COYA 4LDVA 1IHVA 2JTMA 3CCLQ 1V1CA 3A7UA 4BI4A 2DXCA 4AG2C 1GBRA 1AD5A 1YCYA 2IY5A 3RIRA 3VRZA 4C5GA 5A0GA 2YHTA 3NENA 2PQWA 4H2VA 1GBQA 4M78C 4YDQA 2NWMA 1FXXA 3L4GB 3RDVA 4YCWA 1T3LA 2GBQA 4KR3A 3GPLA 2L5QA 2CSIA 3OS5A 1HTTA 1I0CA 1UGRB 1VQ4Q 1NJ5A 5I21A 3V7CA 2EYYA 4KRTA 1VQNT 3QO7A 1VQ7T 1OX8A 1E22A 1SSFA 2DTOA 4M7DD 2XD0A 1ASZA 3VS3A 1NEBA 5GMKl 1BB9A 5FROA 3CCQT 2RHYA 1U06A 1KSWA 2MF2A 4BY6C 1X2QA 1YBYA 5GAN4 2KYBA 4P72C 2OTJA 4YRFA 5L8RE 4M7AD 2FG0A 3MP1A 3I56T 2IVWA 2A08A 3CXCP 3DLMA 5GAN6 1QP3A 1Q86U 3EG3A 5CVIA 1RADB 4AH6A 4WF2A 4P3NA 4X9DA 3REUA 1NZ9A 1ASYA 1Q82C 3TQ7P 2ESWA 4C8QB 2O9VA 2AK5A 4CC3A 1PNJA 1RL2A 3M55A 4J5YA 2QQBA 4XEOA 2FL7A 4M75E 1TUDA 4AFSC 3QO3A 5LJ5g 3CBMA 3OSVA 4J9CA 2ARUA 1VYUA 3PFSA 3LGLA 5IXBA 4BD3A 4EO4A 2X9HA 1Y0MA 1KD1C 2VXFA 1VQ8A 1X69A 2K5FA 2CDTA 2RK1A 2I0NA 4OB1B 3NMZC 3FB9A 2AHJB 2RHSB 3G1ZA 3NEMA 3A5ZB 4J9FA 2DYBA 1E7OA 1B7YA 4LDYA 2RQTA 1M1FA 5FU6B 1PSFA 2NUPB 4D8KA 3D7SB 1M90C 4M78A 1YGBA 3RF1A 1D1CA 1ZSZB 4JRPA 4LVKA 4D8DA 1FX7A 2O01E 2R57A 1I5LA 3IG2A 2XU8A 1T3SA 1M1KR 2EQJA 1AVZC 5LJ3e 1FMWA 4FW2A 2KGTA 1JQQA 1PKTA 3A8HB 3OYAA 4N4GA 2H3EB 2X4WA 2LNVA 2DRMA 1KC8C 2ZCEA 2NUTA 1EIYB 4OVAA 4JPBW 5CKDA 4P72A 1KHIA 1VUBA 2QASA 2WSFE 5GANj 2AIRB 1TOVA 4MZMA 3OW2S 4RTUA 1Q81C 1ZUYA 4DOWA 1J5WA 1UG1A 1AWJA 2M9UA 3EH1A 1QVPA 1AHJB 2XHCA 3N5BB 4GBQA 4YRKA 3OYJA 2LQKA 1OQKA 4X9CA 3PTAA 1M3CA 1O9SA 5ELNA 4EDUA 4KGVB 4OMNA 5LJ5d 4P73C 1VQ6Q 2OTJT 3UFGA 2O2OA 1B07A 5GAMf 1VQLQ 3JCMV 4HVVA 4B9XA 3L2QA 3EHQA 3LWHA 2FZGB 1YJ9Q 1PC0A 4L6V5 3GNFB 2Q7HA 3I35A 2MI6A 4QQDA 1YFSA 1HXDA 3QYHB 1UGPB 4Z89A 3CCJA 4EMHA 1WXUA 5ECAA 1WQWA 3QZ5B 4KGZB 9ATCB 3GLXA 2DTIA 2L3PA 3HXYA 2QQSA 4CH6A 1OU8A 2HSPA 2ATCB 4C92B 4AFUC 1VQ8T 2X3WD 4IUUA 3MEVA 1PRLC 4QVDA 1Y96B 4GLMA 4F14A 4IIOA 2ZIMA 3P8TA 3HFOA 2Q7EA 1HSQA 3VUZA 2Z0WA 3REBB 1Q82U 3C94A 2A0FB 4PJOD 5A2QE 2EQKA 1NLPC 2LCLA 3VJPA 1R0CB 1PWTA 1VQ6T 4Y91A 4WI1A 2JVVA 4FYVB 3OA6A 2PUOB 1T0HA 5IAYA 4P3OA 4ANJA 3UGTA 1D0ZA 2CREA 2JNGA 3A31A 5LJ3d 3VU3C 6AT1B 2QGGA 8AT1B 1HD3A 1K1ZA 1H3HA 3GP8A 2OI3A 3CPWS 3EGXB 4BE2A 5KYXA 1E1OA 3JCMc 2GNCA 5I2SA 5EC7A 4ZTJA 4E47A 2ZT6A 4OMQA 1S72Q 1BIAA 4JDSA 3TSWA 2VKNA 1Z7MA 4P73A 4PFPA 5DY9A 1FYFA 3G71Q 2HSEB 2DMOA 1RI0A 2E41A 2P0LA 2FYKA 1ZHIA 2DA9A 1X75C 1FWZA 3M4PA 4K11A 5GANe 3PVQA 2AZSA 2NUZA 2CP7A 2DIQA 4UP8A 5CKHA 4YRCA 3OSSC 3URGA 1SERA 3NHNA 4KQEA 1SRMA 2M0YA 3RMQA 3MP6A 3J81E 1ZUKA 3QBYA 4J9DA 2EQMA 1IGUA 3G1JA 4E7HA 4Z02A 2EBPA 3RUXA 2DRKA 2DVEA 1N8RR 2LJ0A 4Q15A 4LVJA 1RAHB 3I5SA 3MQZA 2DO3A 5IXFA 1B34B 3OYFA 4TWAA 2JZ2A 1JJ2S 1UJ0A 1BI1A 3HTZA 2Q5IA 1YFRA 4C0GA 3CCEA 2RHQA 3ASKA 5GAOq 1NJIR 4M78G 1W2BA 2DERA 8ATCB 2DL7A 4HWRA 1PYSA 2FRYA 1WHMA 1Q81U 3MF2A 1TWBA 2J3LA 5L23A 3CQTA 1YI2Q 4N4IA 2YUQA 2P84A 3BY7A 2RH2A 1YJWA 3CCJT 3VS6A 1RLPC 2XGTA 1MGQA 2QAZA 4XTXA 5KH6A 2JJ9A 2K3BA 4ZIBA 3NPFA 4RQEA 2F2XA 2H3JA 4OP0A 4H2WA 3CD6A 3C95A 2DKGA 1V76A 3LH0A 2LTOA 2M02A 1B7TA 1JJ2P 5GAN8 5DLOA 2G3RA 5IHNA 4FL6A 3HFZB 4YRRA 1N9WA 3MO8A 1G5IA 1YHQA 4G85A 2ZT7A 2E1HA 2V26A 3OW2A 2LQWA 4CC4B 1JRIA 1D3BB 2MAMA 3LGFA 3CCSQ 1NYGA 3JB9J 3MJXA 2AZVA 2D6FA 2RK2A 3H0HA 4UP7A 1KQSP 4KH0B 4JRIA 1K73C 4M77B 2KBTA 3JCMh 4HVUA 2X4JA 2D0QB 4AT1B 1NM7A 3CEYA 2JM9A 3PIPA 2QDYB 4J6WA 4L59A 1TTHB 1WFWA 1H4QA 2RJEA 1YITA 2ZPHB 2CGHA 2RJCA 1X6GA 4R56A 3CCEQ 1M1GA 5C0MA 2DX1A 2KAFA 2DBMA 5GJWB 2SEMA 1BBZA 3HXXA 2QHTA 4C5IA 1KHCA 2AMCA 3FDRA 1WLEA 4BI3A 5GAN2 3VUBA 3INZA 3CMEA 4C8QD 1KMMA 3J80E 1WXBA 3NELA 2CP6A 2CT3A 4PFOA 3P8YA 3E19A 3OS0A 2D1XA 1M8MA 2C7IA 5GANd 2J7IA 1ACMB 2LRQA 4QQ6A 1VQMA 3META 1QVFP 4J9GA 1YWOA 2QTXA 3QYGB 4RTVA 2KQWA 5D7UA 1YIJQ 1AWXA 2BIVA 2HQXA 3OYCA 4BWAA 2GFUA 3E1SA 2O4XB 3HXWA 1UGVA 2HCKA 4JLIA 4IIMA 1QVGS 4HVCA 4FSSA 2EYQA 1YJNQ 3JCMe 3M56A 4E7ZA 1Q7YU 1PSEA 2I4OA 2CT4A 2DD4A 5FU7C 2RI3A 2ZPFB 3CCET 2EKHA 1X2GA 2LDMA 1WXTA 4K86A 2RI2A 1WHKA 3S6WA 4C5HA 2C0OA 1CKBA 3RKWA 2DJQA 3LYIA 4M7DG 4RG2A 3JB9D 1UE9A 1BBUA 2CJ9A 4J9HA 4GY5A 2K2MA 2P4TA 1UFFA 2COZA 4VUBA 1YJWT 1SSHA 3CPWA 3JCMg 5HK0A 3EG0A 4YRTA 2F5KA 4B9WA 3HXZA 4M7AG 4A63B 2KEAA 4RTXA 3FC3A 2RO0A 4JJBA 4EMKB 3OYDA 1TG0A 1RABB 3E9GA 4TQDA 3M4GA 2K5IA 3L2ZA 4HWSA 4P71C 2ZZEA 2DPPB 2RHUA 2KNBB 1YHQT 2VXEA 3CCMQ 1YIJT 1WJSA 3LLRA 4DOVA 2C06A 3JSCA 4Y28E 4YCVA 3QWXX 1PD1A 3UDCA 3QJYA 2Y4YA 4MDXA 4E51A 3U23A 1RAAB 3A1PA 3WQZA 3LSQA 4H02A 2QEXA 5FRNA 1MNDA 1M4ZA 1YITT 4C8QC 1UJYA 3JCMQ 4HWPA 3TEHB 4OGEA 2B86A 2D8HA 3A8OB 4XU1A 3SWNC 4F04B 1I8FA 2M16A 3UT1A 2KRMA 3E2UA 3HRKA 3ME9A 4CS2A 1Q95G 2AKWA 1W6XA 5HK3A 3DSQA 2RMOA 3I7FA 1N6AA 1N5ZA 1VQNQ 3BDUA 3E9HA 5KYUB 3G4SA 2XDDA 4Z88A 2DNUA 3QO8A 2CJAA 1VQ9A 1VQMT 1TXQA 3FLGA 3KFUA 2XICA 4C92D 3ULRB 2MK5A 3UPUA 2VVKA 1GFCA 4C0FA 3CC2A 4DPGA 1WHJA 2ZPIB 5GAOl 1OPKA 1U8RA 1EVKA 3QTCA 2RF0A 1OV3A 1NJ1A 3H6ZA 4YRPA 4F7UG 3JCMd 2X4XA 3VS7A 1D1AA 2F69A 2EQUA 4WJ3M 2DK3A 3TSZA 1Y71A 2DETA 3QDRB 2XDPA 2ARTA 1OEBA 3EG9A 1I1JA 3CXCS 1VQ5A 4P71A 2QEXQ 2EAYA 4ZGDB 1MMAA 4F17A 1VQOA 4N0AC 1RI9A 4LUDA 3HXUA 2LVMA 1M8VA 4J6XA 4H2UA 2PU9B 2ZXFA 2BE9B 4HXJA 1VYTA 2PUKB 2E6NA 3MEYA 2EJGA 4A4FA 1UHFA 4CI0C 4JS4A 1RAFB 2R5MA 1H4TA 1SF9A 4O5VA 4KUIA 4M75B 3JB9I 3G4SQ 4C8QA 1WHLA 1T0JA 2DLPA 2YLBA 2DVJA 3G6EQ 1VQ9Q 5LJ5e 3QWYA 4PLIA 3EH2A 2KXCA 3HRUA 1PM3A 2IY5B 3SWNA 3QJ6A 2JUFA 2KMTA 2XIDA 4UC4A 2J6KA 2YRCA 2DXTA 5D6YA 1EX4A 2YUPA 1UEBA 5LL6S 2QG9B 2XDBA 2QQ9A 4IUVA 1K76A 3HY0A 2QEXT 3A7AA 1LPLA 1K8AR 12ASA 3A7RA 3CC7A 3OBWA 1USYC 2ZCFB 1QVGA 4P3PA 2HQEA 2DILA 4M78F 2EQIA 1M30A 2DU7A 4ZGJB 3OYYA 2PNIA 4XTVA 1Z7NA 4OF1A 1UB4A 2CUDA 2ZTGA 4TVYA 1HYOA 4PJOG 4E7LA 3R07A 1QWEA 2DTHA 2RQVA 1RACB 4UPAA 2OTLA 1H641 3M59A 3JCMb 1L0WA 1X01A 2DBKA 3C0CA 3G4ST 3AHUA 2LC4A 5IN1A 5KNNA 1JEGA 3VS2A 3HFVA 3M53A 3OQ5A 3LC0A 3G6ET 1VQ9T 1IREB 4HA8A 2FEIA 3P8VA 2MWPA 4N0AA 2OTJQ 1XQHA 4XEMA 2KK4A 3ZEHA 3CC2T 4KGXB 1K8AC 2LQ8A 2CP0A 5KYYA 5FWBA 3TVTA 4XU0A 3DLLA 1IO6A 4FT4A 4ORZA 5CKBA 3UATA 2PMEA 3PNWC 4BUGA 2D9TA 1RIQA 1ZA2B 2JW4A 4IKFA 4M77D 4TVWA 5GAN5 2BUDA 1K9MR 3SHWA 2PVDB 1RUWA 1BK2A 2HEQA 2BZXA 3S3NA 1VQ5T 1TH7A 2AKKA 5GMKm 5GAN7 4PKCC 2MCNA 1Y57A 3RKXA 1VQOT 3QKJA 1PRMC 4M7DC 2DL5A 5CAIA 3VQXA 2A28A 2VV5A 1VQ8Q 1BI3A 3H8ZA 1SKUB 1JBMA 4JZ4A 3CC4A 4H2TA 1U3OA 3A8LB 4K88A 1I81A 1EFWA 3JCMJ 4M7AC 4BDYA 3WVEB 4YRNA 1QWFA 1X6BA 3OYHA 1M1KC 2ZIOA 2K9GA 3VS0A 2KSSA 1USYA 1NYRA 4YRJA 5D6WA 2OAWA 4BY6B 2PVOB 2DM1A 3EFRA 1H4VB 1K9MC 2NUTB 2HDAA 4M78E 3GNGA 4LUEA 4XAXB 2Y4XA 2JM8A 3SFMA 2JT4A 4LD6A 2Q5HA 4ZN3A 3X28B 5FLXE 1OZ2A 4PJLA 2QHSA 4CS4A 2MMPA 2K2VA 1Y07A 2MIOA 2L89A 2ODRD 2VUBA 1G3SA 3M57A 3A5YA 3REAB 2CUBA 3CC7T 2O9SA 3V8LA 1G83A 4YCUA 3OMGA 1EIFA 3TUPA 1TSFA 2VGNA 1MV0B 3C4SA 5CR2A 3CXCA 1OI1A 3EFOA 3OB9A 1WPYA 4J9EA 1EFNA 3I55A 2OTLT 4X5OA 2XG8D 3CC4Q 4M7AF 2ROTA 2ALYA 2RHZA 5GMKi 5GAMj 2V1QA 5IH2A 2KI7A 4FW1A 3THKA 4LDUA 1FMKA 1MMGA 5CKFA 2X3XD 2GF7A 4OLFA 1X56A 1K9AA 1NYFA 1Q7YR 4TVRA 2PVGB 1DJ7B 4M7DA 4J8OA 4ZTUB 1SETA 5A0LA 4E7KA 4C8QG 3ICAA 2E3HA 3HRSA 3M4QA 1AWOA 1BKBA 1KD1U 1KK7A 7AT1B 3HPWA 3JAME 4M7AA 2J3MA 3FJPA 1M9SA 5CIUA 4EX5A 1BBWA 2E3CA 2RI5A 4KULA 1QP2A 1W4SA 3S3MA 1GL5A 4FYYB 1GXIE 1AOJA 2LP5A 3HRIA 1G3YA 3CCJQ 2NLUA 2PZ1A 2FRWA 4LDWA 3LX7A 3QNEA 3CCRA 4V2SA 1ABQA 1XTDA 3QUIA 3HHTB 1M90U 1RAGB 4HWOA 1WHGA 3HFNA 1MMNA 2J06A 2JOYA 4ZN1A 4LVIA 3CC4T 1H8KA 1NE8A 2DAQA 3JCMP 2DD5A 4KH1B 2XTIA 5GMKh 4LDXA 1HC7A 5KYXB 2EGAA 5GAMh 1KC8U 1VIFA 1JXOA 4LVLA 4MZPA 1UGQB 1NJ8A 1TUGB 4JRQA 3JB9G 2GFAA 2JTEA 1G8XA 4RTYA 2ODRC 2DL4A 4PJJA 4JS5A 4TVAB 4ME7A 1ADJA 3CMAA 5KCHA 1B76A 1MMDA 4CRIA 4Z8AA 4F7UF 3J7AF 2HQHA 1M5Q1 1KQSS 2KT8A 1WGSA 2HZYA 1C1AA 4HCBA 4YTLA 2R58A 1M3BA 3VBBA 1LVKA 2FHDA 5KE3A 5KYWB 2L8DA 4M7AE 2MOXA 4OGCA 3GBQA 1KQ2A 3IKMB 4E7JA 4RQFA 1B70A 1KG1A 2RJFA 1M1KU 4HWTA 1BYMA 4OMOA 1D0XA 2CKKA 2EVRA 2A7YA 4Y92A 1N8RC 1Z9ZA 4YRSA 4PJOC 1MUZA 4A54A 1WIEA 2GTOA 2QYZA 4F7UA 4LN2A 1KJWA 2HKNA 2J6FA 1R8OB 2V8IA 2RHQB 4C0DC 1YN8A 2ZNJA 1NJIC 5C53B 4FYXB 4OMFB 3NTIA 5A0DA 1PYSB 1GCQC 3EHRA 4M75D 2BZYA 4K87A 4PJMA 2KY9A 4A4HA 5GAMe 3VS1A 1QVFS 2CH4W 2FZCB 1G2BA 4H2XA 2DEUA 3I9QA 2AKLA 1KMNA 4WCIA 1EOVA 3H0FA 1IZ6A 1QE0A 5C51B 3M0TA 3MKDA 4PLLA 4MDWA 4FYWB 2VB6A 2CS7A 4ATOA 2ENMA 2KYMA 1NBEB 1M2VA 2F2WA 3A8MB 4FIBA 4EMGA 2OX7A 5GAMg 1YJWQ 4C92G 3M58A 1AZEA 3CCRT 3LW5E 1J3TA 3PVLA 2EWNA 2HBPA 1NPRA 4RTWA 3EGDA 4ELZC 4QKUA 1NEGA 3CD6Q 2HD0A 1ABOA 4J7FA 1QF6A 3EFSA 1G51A 3JB9H 4PJOF 4KT0E 4O6JA 4E7IA 2E70A 1W66A 2QHUA 5GAOn 4PL6A 1E6GA 1Q86R 2LNHB 4RTTA 4HT8A 2PTKA 1YHQQ 1R0BG 2CSQA 4E2FB 1VQPA 4YRGA 4F7UE 1IL2A 3LWIA 2CYZB 3VV0A 2EGCA 2AMCB 3R6OA 4DA4A 2QHVA 5LJ5f 1O75A 3OMCA 1PKSA 2F1LA 4OB0B 1NPPA 4PJOA 2ZZFA 1YITQ 1UTIA 2C8MA 1K0XA 2KR3A 3CMAT 3GIBA 4QQGA 4RG8A 1JJCA 3VQVA 2DL3A 2RD1A 3DB3A 1X54A 4X1VA 2RQWA 1X2KA 1I07A 2VC8A 2V8JA 2DU5A 1NYQA 1C0MA 3VS5A 2B8AA 3CMEQ 3OD1A 3NETA 3QHSA 1GCQA 3M4YA 4J83A 2HAXA 1VA7A 4JUVA 1PCXA 1H92A 4JRKA 5CK9A 5IHKA 3CD6T 2P4RA 2XKOC 2P0PA 5K1XA 3HY1A 2K7AA 1BI0A 1GFDA 3OYIA 1VQMQ 3MPUB 4QT7A 4M75C 4XK8E 3PCOA 5D6XA 2RN8A 2CP3A 2CIMA 3TEHA 4IUQA 2I2LA 5GAMd 1B3QA 1ZSGA 1ZBJA 2P5IA 2YUOA 3LH5A 3IALA 5KE2A 1LJOA 1EZZB 5M9OA 4YRLA 2ZPBB 4HCKA 3ZL7C 1JJ2A 4P74C 5LJ3f 5C6SA 2LT4A 3CCLA 2DIGA 1N8RU 1F1BB 4ELYC 3RGLA 4PJOE 3JV3A 3CMET 3Q1JA 1NLOC 2W10A 4IUPA 1OX9A 2HBWA 2QA4A 1WU7A 4WTOB 4FT2A 1Z9QA 2LX9A 2KE9A 4FSXA 3RR6A 4RMOA 4FM4B 1KQSA 1AEYA 2L2PA 4NOYA 1K73U 1UDLA 2DXUA 3PZCA 4L5GA 4YREA 1NG2A 1VQ4A 5FU6C 2P0QA 3UF4A 4TTVA 3OYLA 4II1A 1IXDA 4LE9A 2KRSA 3VS4A 3ZFJA 2M0OA 4G84A 2RPNA 1C6VX 4ZNXA 4M77G 3OYGA 3A32A 1VQPT 1ZSZC 3L4GA 4JJDA 1QCOA 3M0QA 4D6WA 5KYNA 1W70A 1CSKA 3M0RA 4LD9K 3M54A 2COWA 3JRZA 1ZQ1A 2RA2A 2VASA 1X2HA 1WYXA 2BKDN 1ADYA 1D09B 1LCKA 2AKWB 2ZR3A 4C8QF 4CH3A 1WZOA 3BFMA 1LYLA 1AT1B 2ROLA 3VKIA 3IKLA 2XI9A 4P5NA 4ZTFA 2EJFA 4M75A 5FU7B 1QVFA 2LX7A 3LSSA 2EYZA 3TEEA 1JU5C 4HT4A 3A8GB 2IG0A 1RAIB 3OYKA 3OBYA 5C52B 3CMQA 1NNHA 2C0IA 2J05A 2LCSA 2LT1A 1M2OA 2QA4Q 4CH5A 1IRXA 4OMMA 5HGQA 4OB3B 3RKYA 1WDXA 1Q82R 2GGRA 1N9RA 3RACA 4KBMB 1YB3A 4C5EA 2R5AA 2GQIA 2XMFA 1QCFA 1G3TA 1M3AA 4P74A 5HY6A 4RUGA 1OULA 4NL2A 1TUCA 2CZ6B 3EG9B 2A37A 3CC2Q 2AT1B 1XJWB 3UA6A 3FIFA 3CCVA 2HMAA 3M0SA 3R6NA 1X6OA 1KD1R 1WYDA 5CKEA 3UA7A 4OMPA 5AYFA 4YYEA 2DE0X 2KT1A 1X27A 2CZ7B 4JJCA 3JB9F 2RHSA 3A5ZA 3QPHA 2RM4A 1VQ5Q 5LJ3h 1YFNA 2NUPA 4A53A 3EG2A 3H9NA 3CCLT 2FB7A 1VQOQ 2BE7D 4E6RA 2VWFA 3UGQA 5F5WA 1M90R 2XK0A 3O5ZA 1G5HA 1IHWA 4RTZA 2HL3A 1ZSZA 4CC2A 2NS6A 2I4LA 2QA4T 5GAOm 1SESA 3HKSA 3MEUA 1U1TA 4C92C 3ERRA 2ZNIA 4RCCA 3SWNB 4JJNK 1U5SA 1UGSB 1VOMA 1WHHA 2CH4A 1X55A 2FZKB 1EVLA 2DEQA 1V29B 5GANf 2E5AA 3V7SA 1KC8R 4HCZA 3WVDB 1VQ4T 1PG5B 1SHGA 3PT9A 3P8DA 1EIYA 3M0PA 3FEOA 2OJ2A 4C8QE 3REXA 4OMLA 1WX6A 2ZR2A 2GCXA 3X25B 2L3SA 3CCVQ 4H2SA 1Q81R 1VQ6A 2E5KA 1OOTA 2YLCA 3VYHB 2RQRA 1VQLA 1W2BS 2FPFA 1BIBA 2KRNA 2L3RA 4J9BA 3L2RA 1LNXA 5AT1B 4R55A 2A8EA 4KR2A 3V8JA 4A4GA 1K4US 1ZX6A 1YJ9A 2WACA 3F70A 3CC7Q 2CJBA 1B7YB 4BACA 1JO8A 4XTZA 2K6DA 1NJ2A 2GQVA 1A0NB 2RB6A 1TS9A 4M78B 4MMLA 2ZT8A 3CCUA 3MEWA 3QG1A 5CQXA 3X26B 3HSBA 4Q5WA 2WSEE 4C92F 4FU6A 2OTLQ 5KYYB 4PFZA 3DKMA 2L0AA 2YDLA 4H2YA 4LVMA 3JCMW 1W2BP 1H3ZA 3SDZA 5LJ3g 11ASA 3O8VA 2LZ6B 4DEYA 1I4K1 2EPDA 2E3IA 1P92A 1UHCA 2JN0A 3CCVT 2I4MA 4RMFA 1NJ6A 2HL5C 4C92A 3QZ9B 1PD0A 3KFVA 2EIFA 1Y96A 3L2VA 2EJ9A 4ZGEB 3HL8A 3CBPA 2LJ1A 3V8KA 2ZPGB 2M1HA 4NL3A 2G6FX 4BE1A 2C0TA 3OW2P 4PG3A 3VQYA 4ZTZB 2JMCA 1Y7XA 3RMSA 2A36A 3FRNA 4M7DF 5I22A 5EG2A 1S72A 3BJUA 4RDXA 1QCNA 1YP5A 2DDZA 3CCUQ 5GJVB 4HCCA 4M75G 2DQ3A 3G71A 5GMKj 3E9FA 2DF6A 3SB2A 3UWNA 1E6HA 3KXTA 1N9SA 1YWPA 4DEXA 2RHIA 3EGXA 3OYNA 4BW9A 1G5VA 5GANh 5IT9E 1CKAA 1N27A 1SG5A 2X4YA 3NGPA 1OZ3A 3PIOA 2YUNA 4M77C 2L3QA 2YXYA 4X34A 1VQZA 1RLQC 4AMCA 2LMJA 3MEAA 5FRMA 2K3XA 3WXMB 4CS3A 5FW9A 5DM7R 1D1BA 1WA7A 1VQLT 1VIEA 3NFCA 3QIIA 4YPFA 3JCMf 3EFOB 1JB0E 4C92E 3W3SA 5ELOA 1FMVA 1MV3A 2GTJA 1YJ9T 2K4YA 1VYVA 3GF5A 3TCJA 4IURA 3HTRA 2ALYB 1B8AA 4PK4A 1SHFA 2OAUA 1YI2A 5DLQE 4KUDK 5GAOp 1B34A 2QXFA 2RJDA 2MWOA 2YWWA 1KQ1A 2EGEA 3CCUT 1AWWA 2EW3A 1Q7YC 4UP9A 4QVCA 4M7DB 1K8AU 2DXBA 5CQYA 1K0SA 3I55Q 4TVAA 3OYMA 4R0KA 3RERA 3L2UA 1ZLMA 4J6YA 2X51A 4FCYA 1YFTA 4DQ2A 4M7AB 2M51A 2HNIA 2JXBA 3CBOA 4XTYA 3A74A 2LQNA 2ED1A 5KYWA 2JMAA 3G7ZA 3CCSA 4F16A 1BU1A 4M77F 3CPWP 2QGFB 1WI7A 4GLKA 2CZ0B 2MYSA 3H41A 4M7DE 2X35A 3QO5A 3HRTA 3PMTA 4DBFA 2HKQB 3HFZA 2D0NA 3SEMA 5GANg 1E1TA 4M4ZA 4A4EA 2Q7GA 2SRCA 1RAEB 4XTWA 3KBGA 1U1SA 4J9IA 2QTVA 1D3BA 3QXEB 2J6OA 4LNPA 3VYGA 2A3LA 3CCRQ 2F5TX 4OB2B 2KDSA 2D8JA 2FPEA 3MCAB 1K73R 4M77A 5CO7A 1AZGB 1ZBXA 1S72T 4CC7A 5I2MA 3BW1A 1K9MU 4EMKC 5I11A 3I55T 3G71T 4HT9A 2ARSA 2W0ZA 2ZAEA 4AFZC 4DBHA 1YNZA 5GMKe 2O88A 2YRDA 3C12A 1ZA1B 3X24B 2VGMA 3FJ5A 1MHNA 1KFZA 3M9QA 2YRVA 1OPLA 2NYSA 2ZINA 1YIJA 4EPCA 4Q6GA 1HJDA 3BE3A 1B70B 4NS5A 3CMAQ 4TQFA 2KXDA 1YJNA 2E64A 3QDFA 4JLGA 1XOVA 4MZTA 2RHXA 3SD4A 4F7UB 2P0KA 1VQKA 3TEGA 2EYWA 3KUFA 5FWCA 3P8HA 1FYNA 4EIKA 3RESA 1HK9A 2O4XA 4YRMA 1TU0B 1SEMA 1YI2T 1X43A 2JS0A 4AFQC 2F2VA 3TU4K 1MNEA 3EGUA 3M0UA 1WJQA 4XU3A 4PHCA 4QW2A 1GGMA 1QW1A 3H0IA 3L2WA 3VRYA 3A98A 4H2XB 2ZGWA 4M77E 3X20B 3PE0A 2DYIA 3GOXA 3EG1A 3CPFA 1OYXA 1M27C 4L87A 3IQLA 3P8BB 1KIKA 4WJ4A 4QVZA 2PMFA 1JXMA 2LJ3A 2EKOA 4PNOA 2QI2A 3CCMA 1BI2A 1M2VB 2QQRA 4AG1C 4ESRA 4HKEA 5GAN3 2EFIA 3BDLA 3CCST 4J15A 1SRLA 2CZ1B 1R77A 1WQ7A 1WLPB 4EMKA 2RNAA 4BB7A 4NCXA 2KVQG 2G4CA 3M5AA 3EGDB 3QSUA 1I5OB 4BI8B 3E9IA 2E5QA 1GRIA 4YRQA 5HKCA 3PMIA 5J39A 2K57A 3UH0A 2DZ9A 2ED0A 2H8HA 4PJNA 3S3OA 1Q86C 4BDZA 4XTUA 1VQKQ 2IIMA 1UECA 2ECZA 2VYTA 4XQ3A 4LNSA 4P75C 4YP0A 4B6MA 3OYBA 3MHXA 2JTFA 1W1FA 1LOJA 2Y90A 1QKWA 1QKXA 1XNIA 4M78D 4CH4A 1VQNA 1ZUUA 4RCBA 1VQ7A 3VQWA 2QDLA 1UUEA 2EYXA 2ZT5A 2E6ZA 4PJOB 1YCSB 4DBQA 4LXCA 2LCCA 2O31A 1OU9A 5KCOA 3CCQA 5LJ5j 1QVGP 3PGGA 1WJRA 2ZZDA 1VQPQ 1JJCB 5J26A 4E7SA 2YT6A 4XU2A 4C0DB 2E10A 1E24A 4BE0A 3TREA 1BCOA 1QLYA 2CP2A 3I56A 2DJZA 2K79A 2V8KA 4DBRA 3RNJA 4RKUE 3ZBDA 2CP5A 3ER0A 1QMCA 2FPDA 2BTTA 3I5RA 2JS2A 5KYUA 2DQ0A 4O2DA 1D0YA 4MMKA 3OS2A 2K3YA 3L1AA 2EL9A 3NTHA 5GAOr 1YJNT 4A4KA 2ABLA 1SRYA 2IPOB 2RQUA 3NTKA 2FVUA 1KOGA 1IB8A 4HVWA 3AT1B 3JCMX 3RL6A 1VQKT 4YROA 2V1RA 5IHIA 3MP8A 3HXVA 2I4NA 3PCOB 2DFUA 1WNLA 1NJIU 1H4SA 1ATIA 2K5LA 1BCMA 2ZPEB 2YSQA 3OYEA 3HP9A 4JZ3A 5J3BA 2MPXC 2E4HA 3L42A 1ARKA 4J7IA 1S1NA 5CCAA 3OS1A 2ZZGA 2WSCE 4M75F 5K1PA 5E3IA 2KROA 2DZCA 2E65A 1VQ7Q 3T9NA 5HCKA 2FO0A 3V7RA 1QQJA 2QQAA 1IGQA 3CCQQ 1G3WA 3DB4A 4C0ZA 3G6EA 3OY9A 5LJ5h 1EQRA 1SPKA 2QK0A 4N4HA 3CCMT 4YRIA 3RBBB 4P75A 1GCPA 5LJ3j 2E12A 3I56Q 2DL8A 3MF1A 1PHTA 4IUTA 1C0AA 2BZ8A
chains in the Genus database with same CATH topology
3EAEA 4LDVA 2JTMA 3A7UA 4BI4A 2DXCA 1YCYA 2IY5A 3RIRA 4C5GA 5A0GA 2YHTA 3NENA 2PQWA 4H2VA 4M78C 4YDQA 1FXXA 3L4GB 4YCWA 4KR3A 3GPLA 2L5QA 3OS5A 1HTTA 1UGRB 1NJ5A 5I21A 3V7CA 1VQNT 3QO7A 1VQ7T 1E22A 1SSFA 2DTOA 4M7DD 2XD0A 1ASZA 5GMKl 5FROA 3CCQT 2RHYA 4BY6C 2MF2A 1YBYA 5GAN4 4P72C 2OTJA 4YRFA 5L8RE 4M7AD 3MP1A 3I56T 2IVWA 3DLMA 5GAN6 1QP3A 1Q86U 5CVIA 4AH6A 4WF2A 4P3NA 4X9DA 3REUA 1NZ9A 1ASYA 1Q82C 4C8QB 1RL2A 3M55A 4J5YA 2QQBA 4XEOA 2FL7A 4M75E 3QO3A 5LJ5g 3CBMA 3OSVA 2ARUA 3PFSA 3LGLA 4BD3A 4EO4A 1KD1C 2VXFA 1VQ8A 2K5FA 2RK1A 4OB1B 3FB9A 2AHJB 2RHSB 3G1ZA 3NEMA 3A5ZB 1B7YA 4LDYA 1M1FA 5FU6B 1PSFA 1M90C 4M78A 1YGBA 3RF1A 4JRPA 4LVKA 1FX7A 2O01E 2R57A 1I5LA 3IG2A 2XU8A 2EQJA 5LJ3e 3A8HB 3OYAA 4N4GA 2X4WA 2LNVA 1KC8C 2ZCEA 1EIYB 4OVAA 5CKDA 4P72A 1KHIA 1VUBA 2WSFE 5GANj 4MZMA 3OW2S 1Q81C 4DOWA 1J5WA 2M9UA 1QVPA 1AHJB 2XHCA 3N5BB 4YRKA 3OYJA 2LQKA 4X9CA 3PTAA 1O9SA 5ELNA 4EDUA 5LJ5d 4P73C 2OTJT 3UFGA 5GAMf 3JCMV 4B9XA 3L2QA 3LWHA 4L6V5 3GNFB 2Q7HA 2MI6A 4QQDA 1YFSA 1HXDA 3QYHB 1UGPB 3CCJA 4EMHA 1WQWA 3QZ5B 3GLXA 2DTIA 3HXYA 2QQSA 4CH6A 4C92B 1VQ8T 4IUUA 3MEVA 4QVDA 1Y96B 2ZIMA 3P8TA 3HFOA 2Q7EA 3VUZA 1Q82U 3C94A 4PJOD 5A2QE 2EQKA 3VJPA 2LCLA 1VQ6T 4WI1A 4Y91A 2JVVA 3OA6A 2PUOB 5IAYA 4P3OA 3UGTA 2JNGA 3A31A 5LJ3d 3VU3C 3GP8A 3CPWS 4BE2A 1E1OA 3JCMc 5I2SA 4ZTJA 4E47A 2ZT6A 1BIAA 4JDSA 1Z7MA 4P73A 5DY9A 1FYFA 1RI0A 2E41A 2P0LA 2FYKA 1ZHIA 1X75C 1FWZA 3M4PA 5GANe 2DIQA 4UP8A 5CKHA 4YRCA 3OSSC 3URGA 1SERA 4KQEA 3RMQA 3MP6A 3J81E 3QBYA 2EQMA 4E7HA 4Z02A 3RUXA 2DVEA 4Q15A 4LVJA 3MQZA 2DO3A 1B34B 3OYFA 4TWAA 2JZ2A 1JJ2S 1BI1A 3HTZA 2Q5IA 1YFRA 4C0GA 3CCEA 2RHQA 3ASKA 5GAOq 4M78G 1W2BA 4HWRA 1PYSA 1Q81U 3MF2A 2J3LA 4N4IA 3BY7A 2RH2A 1YJWA 3CCJT 2XGTA 1MGQA 4XTXA 5KH6A 4ZIBA 4RQEA 2H3JA 4OP0A 4H2WA 3CD6A 3C95A 2DKGA 3LH0A 2LTOA 5GAN8 5DLOA 2G3RA 4FL6A 3HFZB 4YRRA 1N9WA 3MO8A 1G5IA 1YHQA 4G85A 2ZT7A 2E1HA 3OW2A 1JRIA 1D3BB 2MAMA 3LGFA 3JB9J 2D6FA 2RK2A 4UP7A 4JRIA 1K73C 4M77B 3JCMh 2X4JA 2D0QB 3CEYA 3PIPA 2QDYB 4J6WA 4L59A 1H4QA 2RJEA 1YITA 2ZPHB 2CGHA 2RJCA 4R56A 1M1GA 5C0MA 2KAFA 3HXXA 2QHTA 4C5IA 1KHCA 2AMCA 3FDRA 1WLEA 4BI3A 5GAN2 3VUBA 3INZA 3CMEA 4C8QD 1KMMA 3J80E 3NELA 3P8YA 3E19A 3OS0A 2C7IA 5GANd 2LRQA 4QQ6A 1VQMA 3META 2QTXA 3QYGB 2KQWA 2HQXA 2BIVA 4BWAA 3OYCA 2GFUA 3E1SA 2O4XB 3HXWA 4JLIA 1QVGS 4HVCA 2EYQA 3JCMe 3M56A 1Q7YU 1PSEA 2I4OA 2DD4A 5FU7C 2RI3A 2ZPFB 3CCET 1X2GA 2LDMA 4K86A 2RI2A 3S6WA 4C5HA 3RKWA 3LYIA 4M7DG 4RG2A 3JB9D 1BBUA 2CJ9A 4GY5A 2P4TA 4VUBA 1YJWT 3CPWA 3JCMg 5HK0A 4YRTA 2F5KA 4B9WA 3HXZA 4M7AG 3FC3A 2RO0A 4EMKB 3OYDA 3E9GA 4TQDA 3M4GA 2K5IA 3L2ZA 4HWSA 4P71C 2ZZEA 2DPPB 2RHUA 1YHQT 2VXEA 1YIJT 1WJSA 3LLRA 4DOVA 2C06A 3JSCA 4Y28E 4YCVA 3UDCA 3QJYA 2Y4YA 4MDXA 4E51A 3WQZA 3LSQA 4H02A 2QEXA 5FRNA 1M4ZA 1YITT 4C8QC 3JCMQ 4HWPA 3TEHB 4OGEA 3A8OB 4XU1A 3SWNC 1I8FA 2M16A 3UT1A 3HRKA 3ME9A 4CS2A 2AKWA 5HK3A 3DSQA 3I7FA 1N6AA 3BDUA 3E9HA 3G4SA 2XDDA 3QO8A 2CJAA 1VQ9A 1VQMT 3FLGA 3KFUA 2XICA 4C92D 3UPUA 4C0FA 3CC2A 4DPGA 2ZPIB 5GAOl 1U8RA 1EVKA 3QTCA 1NJ1A 3H6ZA 4YRPA 4F7UG 3JCMd 2X4XA 2F69A 2EQUA 4WJ3M 2DK3A 1Y71A 3QDRB 2XDPA 2ARTA 1VQ5A 3CXCS 4P71A 2EAYA 4ZGDB 1VQOA 4N0AC 3HXUA 2LVMA 1M8VA 4J6XA 4H2UA 2PU9B 2ZXFA 2PUKB 2E6NA 3MEYA 2EJGA 4A4FA 4CI0C 4JS4A 2R5MA 1H4TA 4O5VA 4KUIA 4M75B 3JB9I 4C8QA 2YLBA 5LJ5e 4PLIA 3HRUA 2IY5B 3SWNA 3QJ6A 2JUFA 2KMTA 2XIDA 4UC4A 2DXTA 5D6YA 1UEBA 5LL6S 2XDBA 2QQ9A 4IUVA 3HY0A 2QEXT 3A7AA 12ASA 3A7RA 3CC7A 3OBWA 1USYC 2ZCFB 1QVGA 4P3PA 2HQEA 4M78F 2DU7A 4ZGJB 3OYYA 4XTVA 1Z7NA 4OF1A 1UB4A 2ZTGA 4TVYA 4PJOG 4E7LA 3R07A 2DTHA 4UPAA 2OTLA 1H641 3M59A 3JCMb 1L0WA 1X01A 3G4ST 3AHUA 2LC4A 5IN1A 5KNNA 3HFVA 3M53A 3OQ5A 3LC0A 3G6ET 1VQ9T 1IREB 4HA8A 3P8VA 2MWPA 4N0AA 1XQHA 4XEMA 2KK4A 3ZEHA 3CC2T 1K8AC 2LQ8A 4XU0A 3DLLA 4FT4A 5CKBA 2PMEA 3PNWC 4BUGA 2D9TA 1RIQA 4IKFA 4M77D 4TVWA 5GAN5 2BUDA 2PVDB 3S3NA 1VQ5T 1TH7A 5GMKm 5GAN7 4PKCC 3RKXA 1VQOT 3QKJA 4M7DC 5CAIA 3VQXA 2VV5A 1BI3A 3H8ZA 1JBMA 3CC4A 4H2TA 3A8LB 4K88A 1EFWA 1I81A 3JCMJ 4M7AC 4BDYA 3WVEB 4YRNA 3OYHA 1M1KC 2ZIOA 2KSSA 1USYA 1NYRA 4YRJA 5D6WA 4BY6B 2PVOB 3EFRA 1H4VB 1K9MC 4M78E 3GNGA 4XAXB 2Y4XA 3SFMA 4LD6A 2Q5HA 4ZN3A 3X28B 5FLXE 1OZ2A 2QHSA 4CS4A 2MMPA 2K2VA 1Y07A 2L89A 2ODRD 2VUBA 1G3SA 3M57A 3A5YA 3CC7T 3V8LA 4YCUA 3OMGA 1EIFA 3TUPA 2VGNA 3C4SA 5CR2A 3CXCA 1OI1A 3OB9A 1WPYA 3I55A 2OTLT 4X5OA 2XG8D 4M7AF 2ALYA 2RHZA 5GMKi 5GAMj 4LDUA 5CKFA 2GF7A 4OLFA 1X56A 4TVRA 2PVGB 1DJ7B 4M7DA 4J8OA 4ZTUB 1SETA 5A0LA 4E7KA 4C8QG 3ICAA 3HRSA 3M4QA 1BKBA 1KD1U 3HPWA 3JAME 4M7AA 2J3MA 3FJPA 1M9SA 5CIUA 4EX5A 1BBWA 2E3CA 2RI5A 4KULA 1QP2A 1W4SA 3S3MA 1GXIE 3HRIA 1G3YA 2NLUA 4LDWA 3LX7A 3QNEA 3CCRA 4V2SA 1XTDA 3QUIA 3HHTB 1M90U 4HWOA 3HFNA 2JOYA 4ZN1A 4LVIA 3CC4T 1NE8A 2DAQA 3JCMP 2DD5A 2XTIA 5GMKh 4LDXA 1HC7A 5GAMh 1KC8U 1VIFA 4LVLA 4MZPA 1UGQB 1NJ8A 4JRQA 3JB9G 2GFAA 2ODRC 4JS5A 4TVAB 4ME7A 1ADJA 3CMAA 5KCHA 1B76A 4CRIA 4F7UF 3J7AF 1M5Q1 1KQSS 1WGSA 4HCBA 4YTLA 2R58A 3VBBA 2FHDA 5KE3A 2L8DA 4M7AE 4OGCA 1KQ2A 3IKMB 4E7JA 4RQFA 1B70A 1KG1A 2RJFA 1M1KU 4HWTA 1BYMA 2CKKA 2A7YA 1N8RC 4YRSA 4PJOC 4A54A 4F7UA 1R8OB 2V8IA 2RHQB 4C0DC 2ZNJA 1NJIC 5C53B 4OMFB 3NTIA 5A0DA 1PYSB 4M75D 4K87A 4A4HA 2KY9A 5GAMe 1QVFS 4H2XA 1KMNA 1EOVA 1IZ6A 1QE0A 5C51B 4PLLA 4MDWA 2CS7A 4ATOA 3A8MB 4EMGA 4FIBA 5GAMg 4C92G 3M58A 3CCRT 3LW5E 2EWNA 2HBPA 1NPRA 4ELZC 1QF6A 2HD0A 4J7FA 3EFSA 1G51A 3JB9H 4PJOF 4KT0E 4O6JA 4E7IA 2E70A 1W66A 2QHUA 5GAOn 4PL6A 4HT8A 1VQPA 4YRGA 4F7UE 1IL2A 3LWIA 2CYZB 3VV0A 2AMCB 3R6OA 4DA4A 2QHVA 5LJ5f 1O75A 3OMCA 4OB0B 1NPPA 4PJOA 2ZZFA 2C8MA 3CMAT 3GIBA 4QQGA 4RG8A 1JJCA 3VQVA 2RD1A 3DB3A 1X54A 2VC8A 2DU5A 2V8JA 1NYQA 2B8AA 3OD1A 3NETA 3QHSA 3M4YA 4J83A 2HAXA 4JUVA 4JRKA 5CK9A 3CD6T 2XKOC 2P0PA 5K1XA 3HY1A 1BI0A 3OYIA 4M75C 4XK8E 3PCOA 5D6XA 2CIMA 3TEHA 4IUQA 2I2LA 5GAMd 2P5IA 3IALA 5KE2A 1LJOA 5M9OA 4YRLA 2ZPBB 4P74C 1JJ2A 5LJ3f 5C6SA 2LT4A 3CCLA 2DIGA 1N8RU 4ELYC 3RGLA 4PJOE 3CMET 3Q1JA 4IUPA 2QA4A 1WU7A 4FT2A 2LX9A 4FSXA 4RMOA 4FM4B 1KQSA 4NOYA 1K73U 2DXUA 3PZCA 4L5GA 4YREA 1VQ4A 5FU6C 2P0QA 4TTVA 3OYLA 4II1A 3ZFJA 4G84A 2M0OA 4M77G 3OYGA 3A32A 1VQPT 3L4GA 4D6WA 4LD9K 3M54A 2RA2A 1ZQ1A 3JRZA 1X2HA 2BKDN 1ADYA 2AKWB 2ZR3A 4C8QF 4CH3A 3BFMA 1LYLA 3VKIA 3IKLA 2XI9A 4P5NA 4ZTFA 2EJFA 4M75A 5FU7B 1QVFA 3LSSA 3TEEA 4HT4A 3A8GB 2IG0A 3OYKA 3OBYA 5C52B 3CMQA 1NNHA 2LT1A 4CH5A 5HGQA 4OB3B 3RKYA 1N9RA 3RACA 4KBMB 1YB3A 4C5EA 2R5AA 1G3TA 4P74A 5HY6A 4NL2A 2CZ6B 3FIFA 3CCVA 1WYDA 1X6OA 5CKEA 5AYFA 4YYEA 2CZ7B 3JB9F 2RHSA 3A5ZA 3QPHA 2RM4A 5LJ3h 4A53A 3CCLT 2FB7A 3UGQA 5F5WA 2XK0A 1G5HA 2NS6A 2I4LA 2QA4T 5GAOm 1SESA 3HKSA 3MEUA 1U1TA 4C92C 3ERRA 2ZNIA 4RCCA 3SWNB 4JJNK 1UGSB 1X55A 1EVLA 2DEQA 1V29B 5GANf 2E5AA 3V7SA 4HCZA 3WVDB 1VQ4T 3PT9A 3P8DA 1EIYA 3FEOA 4C8QE 3REXA 2ZR2A 2GCXA 3X25B 4H2SA 1VQ6A 2YLCA 3VYHB 1VQLA 1W2BS 1BIBA 2L3RA 3L2RA 1LNXA 4R55A 2A8EA 4KR2A 3V8JA 4A4GA 1YJ9A 2WACA 3F70A 2CJBA 1B7YB 4BACA 4XTZA 1NJ2A 2GQVA 2RB6A 4M78B 4MMLA 2ZT8A 3CCUA 3MEWA 3QG1A 5CQXA 3X26B 3HSBA 4Q5WA 2WSEE 4C92F 4FU6A 3DKMA 4H2YA 4LVMA 3JCMW 1H3ZA 3SDZA 5LJ3g 11ASA 3O8VA 1I4K1 1P92A 2JN0A 3CCVT 2I4MA 4RMFA 1NJ6A 4C92A 3QZ9B 2EIFA 1Y96A 3L2VA 2EJ9A 4ZGEB 3HL8A 3CBPA 3V8KA 2ZPGB 2M1HA 4NL3A 4BE1A 4PG3A 3VQYA 4ZTZB 1Y7XA 3RMSA 3FRNA 4M7DF 1S72A 5EG2A 3BJUA 4RDXA 2DDZA 4HCCA 4M75G 2DQ3A 3G71A 5GMKj 3E9FA 3SB2A 3UWNA 3KXTA 1N9SA 2RHIA 4BW9A 3OYNA 1G5VA 5GANh 5IT9E 1N27A 2X4YA 1OZ3A 3PIOA 4M77C 4X34A 1VQZA 3MEAA 5FRMA 2K3XA 3WXMB 4CS3A 5DM7R 1VQLT 1VIEA 3NFCA 3QIIA 4YPFA 3JCMf 1JB0E 4C92E 3W3SA 5ELOA 1YJ9T 2K4YA 3GF5A 3TCJA 4IURA 2ALYB 1B8AA 2OAUA 1YI2A 5DLQE 4KUDK 5GAOp 1B34A 2QXFA 2RJDA 2MWOA 1KQ1A 3CCUT 4UP9A 1Q7YC 4QVCA 4M7DB 1K8AU 2DXBA 5CQYA 4TVAA 3OYMA 3RERA 3L2UA 4J6YA 1YFTA 4DQ2A 4M7AB 2HNIA 3CBOA 4XTYA 3A74A 3G7ZA 3CCSA 4M77F 4GLKA 2CZ0B 4M7DE 2X35A 3QO5A 3HRTA 3PMTA 3HFZA 5GANg 1E1TA 4A4EA 2Q7GA 4XTWA 3KBGA 1U1SA 1D3BA 3QXEB 3VYGA 2A3LA 2F5TX 4OB2B 2KDSA 3MCAB 4M77A 5CO7A 1S72T 1ZBXA 5I2MA 3BW1A 1K9MU 4EMKC 3I55T 3G71T 4HT9A 2ARSA 5GMKe 3C12A 3X24B 2VGMA 1MHNA 3M9QA 2YRVA 2ZINA 1YIJA 4EPCA 4Q6GA 1B70B 4NS5A 4TQFA 1YJNA 2E64A 4JLGA 1XOVA 4MZTA 2RHXA 3SD4A 4F7UB 2P0KA 1VQKA 3TEGA 3KUFA 3P8HA 3RESA 1HK9A 2O4XA 4YRMA 1YI2T 3TU4K 1WJQA 4XU3A 4PHCA 4QW2A 1GGMA 1QW1A 4H2XB 3L2WA 2ZGWA 4M77E 3X20B 3GOXA 3CPFA 1OYXA 4L87A 3P8BB 4WJ4A 4QVZA 2PMFA 2EKOA 4PNOA 2QI2A 3CCMA 1BI2A 2QQRA 4HKEA 5GAN3 2EFIA 3BDLA 3CCST 4J15A 2CZ1B 1WQ7A 4EMKA 4BB7A 4NCXA 2KVQG 2G4CA 3M5AA 3QSUA 3E9IA 4BI8B 2E5QA 4YRQA 5HKCA 3PMIA 5J39A 2K57A 3UH0A 2DZ9A 3S3OA 1Q86C 4BDZA 4XTUA 2VYTA 4XQ3A 4LNSA 4P75C 4YP0A 3OYBA 3MHXA 2JTFA 1LOJA 2Y90A 1XNIA 4M78D 4CH4A 1VQNA 4RCBA 1VQ7A 3VQWA 2ZT5A 2E6ZA 4PJOB 2LCCA 5KCOA 3CCQA 5LJ5j 3PGGA 1WJRA 2ZZDA 1JJCB 5J26A 4XU2A 4C0DB 2E10A 1E24A 4BE0A 3TREA 3I56A 2DJZA 2V8KA 4RKUE 3ZBDA 3ER0A 2DQ0A 4O2DA 4MMKA 3OS2A 2K3YA 3L1AA 2EL9A 3NTHA 5GAOr 1YJNT 4A4KA 1SRYA 3NTKA 2FVUA 1KOGA 3RL6A 3JCMX 1VQKT 4YROA 3MP8A 3HXVA 2I4NA 3PCOB 1WNLA 1NJIU 1H4SA 1ATIA 2K5LA 2ZPEB 3OYEA 3HP9A 5J3BA 3L42A 4J7IA 5CCAA 3OS1A 2ZZGA 2WSCE 4M75F 5K1PA 5E3IA 2DZCA 2E65A 3T9NA 3V7RA 2QQAA 1G3WA 3DB4A 4C0ZA 3G6EA 3OY9A 5LJ5h 1EQRA 4N4HA 3CCMT 4YRIA 4P75A 5LJ3j 2E12A 3MF1A 4IUTA 1C0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWA A;  2RB6 A;  4M78 B;  4MML A;  2ZT8 A;  3HSB A;  3HXW A;  3A7U A;  3JCM P;  4JLI A;  4C92 F;  4HVC A;  2XTI A;  5GMK h;  1HC7 A;  1YCY A;  3JCM e;  2IY5 A;  3RIR A;  2I4O A;  4H2Y A;  2YHT A;  5GAM h;  3NEN A;  4H2V A;  4M78 C;  3JCM W;  1NJ8 A;  4YDQ A;  1X2G A;  5LJ3 g;  4K86 A;  11AS A;  3JB9 G;  3L4G B;  4YCW A;  4KR3 A;  1I4K 1;  3RKW A;  2ODR C;  4TVA B;  4M7D G;  3JB9 D;  1ADJ A;  1HTT A;  1B76 A;  1BBU A;  2CJ9 A;  4F7U F;  1NJ5 A;  5I21 A;  3V7C A;  3QO7 A;  1M5Q 1;  2JN0 A;  1E22 A;  2I4M A;  4RMF A;  1NJ6 A;  2DTO A;  4M7D D;  1ASZ A;  4C92 A;  3JCM g;  5GMK l;  4YRT A;  3HXZ A;  3VBB A;  4M7A G;  5GAN 4;  1Y96 A;  4M7A E;  4EMK B;  4P72 C;  2EJ9 A;  1KQ2 A;  3IKM B;  4RQF A;  1B70 A;  4YRF A;  4TQD A;  4M7A D;  3M4G A;  3V8K A;  4HWS A;  3L2Z A;  4HWT A;  4NL3 A;  4P71 C;  5GAN 6;  2ZZE A;  4PG3 A;  3VQY A;  4ZTZ B;  4YRS A;  4AH6 A;  4WF2 A;  2VXE A;  4PJO C;  4P3N A;  4X9D A;  4M7D F;  3REU A;  4A54 A;  4F7U A;  3BJU A;  1ASY A;  4RDX A;  4C8Q B;  2RHQ B;  4YCV A;  2DDZ A;  2DQ3 A;  4M75 G;  4J5Y A;  4E51 A;  2ZNJ A;  5GMK j;  4XEO A;  3SB2 A;  5C53 B;  4M75 E;  1N9S A;  3QO3 A;  5LJ5 g;  1PYS B;  3WQZ A;  4BW9 A;  3LSQ A;  4H02 A;  4M75 D;  4K87 A;  5GAN h;  5GAM e;  2ARU A;  4C8Q C;  4H2X A;  4EO4 A;  3JCM Q;  4HWP A;  1KMN A;  2VXF A;  3TEH B;  1EOV A;  1QE0 A;  5C51 B;  3FB9 A;  4M77 C;  4XU1 A;  3SWN C;  1VQZ A;  2RHS B;  3G1Z A;  3NEM A;  1I8F A;  3HRK A;  4CS2 A;  4CS3 A;  2AKW A;  1B7Y A;  3DSQ A;  3I7F A;  4EMG A;  3BDU A;  5GAM g;  3E9H A;  4YPF A;  3JCM f;  4C92 G;  4M78 A;  1YGB A;  3RF1 A;  4C92 E;  3QO8 A;  2CJA A;  3W3S A;  5ELO A;  2EWN A;  3KFU A;  4C92 D;  2ALY B;  1QF6 A;  1B8A A;  3EFS A;  1G51 A;  1I5L A;  3JB9 H;  4PJO F;  3IG2 A;  4DPG A;  5LJ3 e;  5GAO p;  1B34 A;  1W66 A;  5GAO l;  2QHU A;  5GAO n;  1EVK A;  3QTC A;  1KQ1 A;  4HT8 A;  1NJ1 A;  4YRP A;  4UP9 A;  4QVC A;  4F7U G;  4M7D B;  3JCM d;  2ZCE A;  4YRG A;  4F7U E;  1IL2 A;  4TVA A;  1EIY B;  3RER A;  4WJ3 M;  4P72 A;  2AMC B;  4J6Y A;  5GAN j;  1YFT A;  2ART A;  2QHV A;  4P71 A;  5LJ5 f;  4DQ2 A;  4M7A B;  2EAY A;  2HNI A;  4XTY A;  3A74 A;  4N0A C;  4PJO A;  2ZZF A;  3HXU A;  1M8V A;  1J5W A;  2C8M A;  3GIB A;  4J6X A;  4H2U A;  4M77 F;  1JJC A;  2ZXF A;  3VQV A;  2RD1 A;  1X54 A;  4YRK A;  4M7D E;  3MEY A;  2EJG A;  2VC8 A;  2DU5 A;  4X9C A;  1NYQ A;  3QO5 A;  5ELN A;  3OD1 A;  3NET A;  3QHS A;  5LJ5 d;  3HFZ A;  5GAN g;  1H4T A;  4P73 C;  1E1T A;  2Q7G A;  3JB9 I;  4M75 B;  3UFG A;  4XTW A;  4C8Q A;  4JUV A;  5GAM f;  3JCM V;  2YLB A;  1U1S A;  4JRK A;  1D3B A;  5LJ5 e;  5K1X A;  3HY1 A;  2IY5 B;  4M77 A;  3SWN A;  3BW1 A;  4M75 C;  2Q7H A;  2DXT A;  3PCO A;  4EMK C;  1YFS A;  1HXD A;  2CIM A;  3TEH A;  4HT9 A;  2I2L A;  4EMH A;  2ARS A;  5GAM d;  3HY0 A;  1WQW A;  2P5I A;  3IAL A;  3A7A A;  2DTI A;  5GMK e;  12AS A;  3HXY A;  3A7R A;  1USY C;  4CH6 A;  1LJO A;  4P3P A;  4M78 F;  4C92 B;  2DU7 A;  2ZIN A;  4XTV A;  1Z7N A;  4YRL A;  4P74 C;  4QVD A;  4Q6G A;  1Y96 B;  5LJ3 f;  2ZTG A;  4TVY A;  4PJO G;  1B70 B;  2ZIM A;  3R07 A;  3P8T A;  3RGL A;  3HFO A;  2Q7E A;  2DTH A;  4PJO E;  4TQF A;  4UPA A;  1H64 1;  3JCM b;  1L0W A;  2E64 A;  1X01 A;  4PJO D;  1WU7 A;  4WI1 A;  4Y91 A;  3AHU A;  4F7U B;  5KNN A;  3HFV A;  4P3O A;  3TEG A;  3LC0 A;  3UGT A;  4HA8 A;  4NOY A;  3A31 A;  2DXU A;  4N0A A;  3RES A;  1HK9 A;  3P8V A;  5LJ3 d;  3VU3 C;  3PZC A;  4YRM A;  4YRE A;  4XEM A;  4TTV A;  1E1O A;  4XU3 A;  4G84 A;  3JCM c;  4XU0 A;  4PHC A;  1GGM A;  4M77 G;  2ZT6 A;  4H2X B;  2PME A;  3A32 A;  1BIA A;  2ZGW A;  4M77 E;  3L4G A;  1RIQ A;  1Z7M A;  4P73 A;  4M77 D;  4L87 A;  4TVW A;  5GAN 5;  5DY9 A;  2RA2 A;  1FYF A;  1X2H A;  1ADY A;  4WJ4 A;  2E41 A;  2PMF A;  1TH7 A;  5GMK m;  5GAN 7;  2P0L A;  2FYK A;  4PNO A;  2AKW B;  3M4P A;  3RKX A;  5GAN e;  2ZR3 A;  4C8Q F;  4UP8 A;  3BFM A;  4CH3 A;  4M7D C;  1LYL A;  4YRC A;  5GAN 3;  5CAI A;  3IKL A;  4J15 A;  3VQX A;  2EJF A;  4M75 A;  1SER A;  1WQ7 A;  3LSS A;  4KQE A;  1JBM A;  4EMK A;  4NCX A;  4H2T A;  4K88 A;  1EFW A;  1I81 A;  2G4C A;  3JCM J;  3QSU A;  4M7A C;  3RUX A;  3E9I A;  5C52 B;  4YRN A;  3CMQ A;  2DVE A;  1NNH A;  4YRQ A;  4Q15 A;  4CH5 A;  1B34 B;  2K57 A;  2ZIO A;  4TWA A;  2DZ9 A;  3UH0 A;  5HGQ A;  3HTZ A;  3RKY A;  1USY A;  2Q5I A;  4XTU A;  1N9R A;  1NYR A;  3RAC A;  1YFR A;  4YRJ A;  1YB3 A;  2RHQ A;  4XQ3 A;  4LNS A;  4P75 C;  3EFR A;  5GAO q;  1H4V B;  4P74 A;  4M78 G;  4YP0 A;  4M78 E;  4HWR A;  1PYS A;  4NL2 A;  3MF2 A;  2J3L A;  1LOJ A;  2Q5H A;  2Y90 A;  4M78 D;  3BY7 A;  4CH4 A;  4RCB A;  3FIF A;  2QHS A;  3VQW A;  2ZT5 A;  1WYD A;  4CS4 A;  4PJO B;  2XGT A;  1MGQ A;  5LJ5 j;  2ODR D;  4XTX A;  4YYE A;  3PGG A;  3A5Y A;  1JJC B;  4ZIB A;  4RQE A;  4OP0 A;  4XU2 A;  2E10 A;  3JB9 F;  1E24 A;  2RHS A;  4H2W A;  3A5Z A;  2DKG A;  3V8L A;  4YCU A;  5GAN 8;  2DJZ A;  2RM4 A;  3TUP A;  5LJ3 h;  3HFZ B;  4A53 A;  4YRR A;  1N9W A;  1G5I A;  2FB7 A;  4G85 A;  3UGQ A;  2DQ0 A;  2ZT7 A;  5F5W A;  4O2D A;  2E1H A;  1WPY A;  4MMK A;  1JRI A;  1G5H A;  1D3B B;  3L1A A;  3JB9 J;  2EL9 A;  4X5O A;  5GAO r;  4M7A F;  2I4L A;  5GAO m;  1SES A;  1U1T A;  2ALY A;  5GMK i;  1SRY A;  4C92 C;  3ERR A;  4UP7 A;  5GAM j;  4JRI A;  2ZNI A;  4M77 B;  4RCC A;  3SWN B;  3JCM h;  1KOG A;  3RL6 A;  3JCM X;  4YRO A;  3HXV A;  2I4N A;  3PCO B;  4J6W A;  4OLF A;  1X56 A;  1H4Q A;  1WNL A;  1X55 A;  1H4S A;  1ATI A;  1EVL A;  2DEQ A;  2CGH A;  5GAN f;  2E5A A;  3V7S A;  4M7D A;  4ZTU B;  1SET A;  4C8Q G;  1EIY A;  3HXX A;  3ICA A;  2QHT A;  2AMC A;  3M4Q A;  4C8Q E;  1WLE A;  2ZZG A;  3REX A;  5GAN 2;  2ZR2 A;  3INZ A;  4M75 F;  4C8Q D;  4M7A A;  1KMM A;  5E3I A;  5K1P A;  2J3M A;  3FJP A;  2DZC A;  3NEL A;  2E65 A;  4EX5 A;  1BBW A;  2E3C A;  3P8Y A;  4H2S A;  2YLC A;  3V7R A;  3HRI A;  2C7I A;  5GAN d;  1BIB A;  3QNE A;  1LNX A;  5LJ5 h;  1EQR A;  4V2S A;  4KR2 A;  3V8J A;  4YRI A;  4P75 A;  5LJ3 j;  3QUI A;  2CJB A;  1B7Y B;  2QTX A;  3MF1 A;  4HWO A;  1C0A A;  4XTZ A;  3HFN A;  1NJ2 A; 
#chains in the Genus database with same CATH topology
 3EAE A;  2COY A;  4LDV A;  1IHV A;  2JTM A;  3CCL Q;  1V1C A;  3A7U A;  4BI4 A;  2DXC A;  4AG2 C;  1GBR A;  1AD5 A;  1YCY A;  2IY5 A;  3RIR A;  3VRZ A;  4C5G A;  5A0G A;  2YHT A;  3NEN A;  2PQW A;  4H2V A;  1GBQ A;  4M78 C;  4YDQ A;  2NWM A;  1FXX A;  3L4G B;  3RDV A;  4YCW A;  1T3L A;  2GBQ A;  4KR3 A;  3GPL A;  2L5Q A;  2CSI A;  3OS5 A;  1HTT A;  1I0C A;  1UGR B;  1VQ4 Q;  1NJ5 A;  5I21 A;  3V7C A;  2EYY A;  4KRT A;  1VQN T;  3QO7 A;  1VQ7 T;  1OX8 A;  1E22 A;  1SSF A;  2DTO A;  4M7D D;  2XD0 A;  1ASZ A;  3VS3 A;  1NEB A;  5GMK l;  1BB9 A;  5FRO A;  3CCQ T;  2RHY A;  1U06 A;  1KSW A;  2MF2 A;  4BY6 C;  1X2Q A;  1YBY A;  5GAN 4;  2KYB A;  4P72 C;  2OTJ A;  4YRF A;  5L8R E;  4M7A D;  2FG0 A;  3MP1 A;  3I56 T;  2IVW A;  2A08 A;  3CXC P;  3DLM A;  5GAN 6;  1QP3 A;  1Q86 U;  3EG3 A;  5CVI A;  1RAD B;  4AH6 A;  4WF2 A;  4P3N A;  4X9D A;  3REU A;  1NZ9 A;  1ASY A;  1Q82 C;  3TQ7 P;  2ESW A;  4C8Q B;  2O9V A;  2AK5 A;  4CC3 A;  1PNJ A;  1RL2 A;  3M55 A;  4J5Y A;  2QQB A;  4XEO A;  2FL7 A;  4M75 E;  1TUD A;  4AFS C;  3QO3 A;  5LJ5 g;  3CBM A;  3OSV A;  4J9C A;  2ARU A;  1VYU A;  3PFS A;  3LGL A;  5IXB A;  4BD3 A;  4EO4 A;  2X9H A;  1Y0M A;  1KD1 C;  2VXF A;  1VQ8 A;  1X69 A;  2K5F A;  2CDT A;  2RK1 A;  2I0N A;  4OB1 B;  3NMZ C;  3FB9 A;  2AHJ B;  2RHS B;  3G1Z A;  3NEM A;  3A5Z B;  4J9F A;  2DYB A;  1E7O A;  1B7Y A;  4LDY A;  2RQT A;  1M1F A;  5FU6 B;  1PSF A;  2NUP B;  4D8K A;  3D7S B;  1M90 C;  4M78 A;  1YGB A;  3RF1 A;  1D1C A;  1ZSZ B;  4JRP A;  4LVK A;  4D8D A;  1FX7 A;  2O01 E;  2R57 A;  1I5L A;  3IG2 A;  2XU8 A;  1T3S A;  1M1K R;  2EQJ A;  1AVZ C;  5LJ3 e;  1FMW A;  4FW2 A;  2KGT A;  1JQQ A;  1PKT A;  3A8H B;  3OYA A;  4N4G A;  2H3E B;  2X4W A;  2LNV A;  2DRM A;  1KC8 C;  2ZCE A;  2NUT A;  1EIY B;  4OVA A;  4JPB W;  5CKD A;  4P72 A;  1KHI A;  1VUB A;  2QAS A;  2WSF E;  5GAN j;  2AIR B;  1TOV A;  4MZM A;  3OW2 S;  4RTU A;  1Q81 C;  1ZUY A;  4DOW A;  1J5W A;  1UG1 A;  1AWJ A;  2M9U A;  3EH1 A;  1QVP A;  1AHJ B;  2XHC A;  3N5B B;  4GBQ A;  4YRK A;  3OYJ A;  2LQK A;  1OQK A;  4X9C A;  3PTA A;  1M3C A;  1O9S A;  5ELN A;  4EDU A;  4KGV B;  4OMN A;  5LJ5 d;  4P73 C;  1VQ6 Q;  2OTJ T;  3UFG A;  2O2O A;  1B07 A;  5GAM f;  1VQL Q;  3JCM V;  4HVV A;  4B9X A;  3L2Q A;  3EHQ A;  3LWH A;  2FZG B;  1YJ9 Q;  1PC0 A;  4L6V 5;  3GNF B;  2Q7H A;  3I35 A;  2MI6 A;  4QQD A;  1YFS A;  1HXD A;  3QYH B;  1UGP B;  4Z89 A;  3CCJ A;  4EMH A;  1WXU A;  5ECA A;  1WQW A;  3QZ5 B;  4KGZ B;  9ATC B;  3GLX A;  2DTI A;  2L3P A;  3HXY A;  2QQS A;  4CH6 A;  1OU8 A;  2HSP A;  2ATC B;  4C92 B;  4AFU C;  1VQ8 T;  2X3W D;  4IUU A;  3MEV A;  1PRL C;  4QVD A;  1Y96 B;  4GLM A;  4F14 A;  4IIO A;  2ZIM A;  3P8T A;  3HFO A;  2Q7E A;  1HSQ A;  3VUZ A;  2Z0W A;  3REB B;  1Q82 U;  3C94 A;  2A0F B;  4PJO D;  5A2Q E;  2EQK A;  1NLP C;  2LCL A;  3VJP A;  1R0C B;  1PWT A;  1VQ6 T;  4Y91 A;  4WI1 A;  2JVV A;  4FYV B;  3OA6 A;  2PUO B;  1T0H A;  5IAY A;  4P3O A;  4ANJ A;  3UGT A;  1D0Z A;  2CRE A;  2JNG A;  3A31 A;  5LJ3 d;  3VU3 C;  6AT1 B;  2QGG A;  8AT1 B;  1HD3 A;  1K1Z A;  1H3H A;  3GP8 A;  2OI3 A;  3CPW S;  3EGX B;  4BE2 A;  5KYX A;  1E1O A;  3JCM c;  2GNC A;  5I2S A;  5EC7 A;  4ZTJ A;  4E47 A;  2ZT6 A;  4OMQ A;  1S72 Q;  1BIA A;  4JDS A;  3TSW A;  2VKN A;  1Z7M A;  4P73 A;  4PFP A;  5DY9 A;  1FYF A;  3G71 Q;  2HSE B;  2DMO A;  1RI0 A;  2E41 A;  2P0L A;  2FYK A;  1ZHI A;  2DA9 A;  1X75 C;  1FWZ A;  3M4P A;  4K11 A;  5GAN e;  3PVQ A;  2AZS A;  2NUZ A;  2CP7 A;  2DIQ A;  4UP8 A;  5CKH A;  4YRC A;  3OSS C;  3URG A;  1SER A;  3NHN A;  4KQE A;  1SRM A;  2M0Y A;  3RMQ A;  3MP6 A;  3J81 E;  1ZUK A;  3QBY A;  4J9D A;  2EQM A;  1IGU A;  3G1J A;  4E7H A;  4Z02 A;  2EBP A;  3RUX A;  2DRK A;  2DVE A;  1N8R R;  2LJ0 A;  4Q15 A;  4LVJ A;  1RAH B;  3I5S A;  3MQZ A;  2DO3 A;  5IXF A;  1B34 B;  3OYF A;  4TWA A;  2JZ2 A;  1JJ2 S;  1UJ0 A;  1BI1 A;  3HTZ A;  2Q5I A;  1YFR A;  4C0G A;  3CCE A;  2RHQ A;  3ASK A;  5GAO q;  1NJI R;  4M78 G;  1W2B A;  2DER A;  8ATC B;  2DL7 A;  4HWR A;  1PYS A;  2FRY A;  1WHM A;  1Q81 U;  3MF2 A;  1TWB A;  2J3L A;  5L23 A;  3CQT A;  1YI2 Q;  4N4I A;  2YUQ A;  2P84 A;  3BY7 A;  2RH2 A;  1YJW A;  3CCJ T;  3VS6 A;  1RLP C;  2XGT A;  1MGQ A;  2QAZ A;  4XTX A;  5KH6 A;  2JJ9 A;  2K3B A;  4ZIB A;  3NPF A;  4RQE A;  2F2X A;  2H3J A;  4OP0 A;  4H2W A;  3CD6 A;  3C95 A;  2DKG A;  1V76 A;  3LH0 A;  2LTO A;  2M02 A;  1B7T A;  1JJ2 P;  5GAN 8;  5DLO A;  2G3R A;  5IHN A;  4FL6 A;  3HFZ B;  4YRR A;  1N9W A;  3MO8 A;  1G5I A;  1YHQ A;  4G85 A;  2ZT7 A;  2E1H A;  2V26 A;  3OW2 A;  2LQW A;  4CC4 B;  1JRI A;  1D3B B;  2MAM A;  3LGF A;  3CCS Q;  1NYG A;  3JB9 J;  3MJX A;  2AZV A;  2D6F A;  2RK2 A;  3H0H A;  4UP7 A;  1KQS P;  4KH0 B;  4JRI A;  1K73 C;  4M77 B;  2KBT A;  3JCM h;  4HVU A;  2X4J A;  2D0Q B;  4AT1 B;  1NM7 A;  3CEY A;  2JM9 A;  3PIP A;  2QDY B;  4J6W A;  4L59 A;  1TTH B;  1WFW A;  1H4Q A;  2RJE A;  1YIT A;  2ZPH B;  2CGH A;  2RJC A;  1X6G A;  4R56 A;  3CCE Q;  1M1G A;  5C0M A;  2DX1 A;  2KAF A;  2DBM A;  5GJW B;  2SEM A;  1BBZ A;  3HXX A;  2QHT A;  4C5I A;  1KHC A;  2AMC A;  3FDR A;  1WLE A;  4BI3 A;  5GAN 2;  3VUB A;  3INZ A;  3CME A;  4C8Q D;  1KMM A;  3J80 E;  1WXB A;  3NEL A;  2CP6 A;  2CT3 A;  4PFO A;  3P8Y A;  3E19 A;  3OS0 A;  2D1X A;  1M8M A;  2C7I A;  5GAN d;  2J7I A;  1ACM B;  2LRQ A;  4QQ6 A;  1VQM A;  3MET A;  1QVF P;  4J9G A;  1YWO A;  2QTX A;  3QYG B;  4RTV A;  2KQW A;  5D7U A;  1YIJ Q;  1AWX A;  2BIV A;  2HQX A;  3OYC A;  4BWA A;  2GFU A;  3E1S A;  2O4X B;  3HXW A;  1UGV A;  2HCK A;  4JLI A;  4IIM A;  1QVG S;  4HVC A;  4FSS A;  2EYQ A;  1YJN Q;  3JCM e;  3M56 A;  4E7Z A;  1Q7Y U;  1PSE A;  2I4O A;  2CT4 A;  2DD4 A;  5FU7 C;  2RI3 A;  2ZPF B;  3CCE T;  2EKH A;  1X2G A;  2LDM A;  1WXT A;  4K86 A;  2RI2 A;  1WHK A;  3S6W A;  4C5H A;  2C0O A;  1CKB A;  3RKW A;  2DJQ A;  3LYI A;  4M7D G;  4RG2 A;  3JB9 D;  1UE9 A;  1BBU A;  2CJ9 A;  4J9H A;  4GY5 A;  2K2M A;  2P4T A;  1UFF A;  2COZ A;  4VUB A;  1YJW T;  1SSH A;  3CPW A;  3JCM g;  5HK0 A;  3EG0 A;  4YRT A;  2F5K A;  4B9W A;  3HXZ A;  4M7A G;  4A63 B;  2KEA A;  4RTX A;  3FC3 A;  2RO0 A;  4JJB A;  4EMK B;  3OYD A;  1TG0 A;  1RAB B;  3E9G A;  4TQD A;  3M4G A;  2K5I A;  3L2Z A;  4HWS A;  4P71 C;  2ZZE A;  2DPP B;  2RHU A;  2KNB B;  1YHQ T;  2VXE A;  3CCM Q;  1YIJ T;  1WJS A;  3LLR A;  4DOV A;  2C06 A;  3JSC A;  4Y28 E;  4YCV A;  3QWX X;  1PD1 A;  3UDC A;  3QJY A;  2Y4Y A;  4MDX A;  4E51 A;  3U23 A;  1RAA B;  3A1P A;  3WQZ A;  3LSQ A;  4H02 A;  2QEX A;  5FRN A;  1MND A;  1M4Z A;  1YIT T;  4C8Q C;  1UJY A;  3JCM Q;  4HWP A;  3TEH B;  4OGE A;  2B86 A;  2D8H A;  3A8O B;  4XU1 A;  3SWN C;  4F04 B;  1I8F A;  2M16 A;  3UT1 A;  2KRM A;  3E2U A;  3HRK A;  3ME9 A;  4CS2 A;  1Q95 G;  2AKW A;  1W6X A;  5HK3 A;  3DSQ A;  2RMO A;  3I7F A;  1N6A A;  1N5Z A;  1VQN Q;  3BDU A;  3E9H A;  5KYU B;  3G4S A;  2XDD A;  4Z88 A;  2DNU A;  3QO8 A;  2CJA A;  1VQ9 A;  1VQM T;  1TXQ A;  3FLG A;  3KFU A;  2XIC A;  4C92 D;  3ULR B;  2MK5 A;  3UPU A;  2VVK A;  1GFC A;  4C0F A;  3CC2 A;  4DPG A;  1WHJ A;  2ZPI B;  5GAO l;  1OPK A;  1U8R A;  1EVK A;  3QTC A;  2RF0 A;  1OV3 A;  1NJ1 A;  3H6Z A;  4YRP A;  4F7U G;  3JCM d;  2X4X A;  3VS7 A;  1D1A A;  2F69 A;  2EQU A;  4WJ3 M;  2DK3 A;  3TSZ A;  1Y71 A;  2DET A;  3QDR B;  2XDP A;  2ART A;  1OEB A;  3EG9 A;  1I1J A;  3CXC S;  1VQ5 A;  4P71 A;  2QEX Q;  2EAY A;  4ZGD B;  1MMA A;  4F17 A;  1VQO A;  4N0A C;  1RI9 A;  4LUD A;  3HXU A;  2LVM A;  1M8V A;  4J6X A;  4H2U A;  2PU9 B;  2ZXF A;  2BE9 B;  4HXJ A;  1VYT A;  2PUK B;  2E6N A;  3MEY A;  2EJG A;  4A4F A;  1UHF A;  4CI0 C;  4JS4 A;  1RAF B;  2R5M A;  1H4T A;  1SF9 A;  4O5V A;  4KUI A;  4M75 B;  3JB9 I;  3G4S Q;  4C8Q A;  1WHL A;  1T0J A;  2DLP A;  2YLB A;  2DVJ A;  3G6E Q;  1VQ9 Q;  5LJ5 e;  3QWY A;  4PLI A;  3EH2 A;  2KXC A;  3HRU A;  1PM3 A;  2IY5 B;  3SWN A;  3QJ6 A;  2JUF A;  2KMT A;  2XID A;  4UC4 A;  2J6K A;  2YRC A;  2DXT A;  5D6Y A;  1EX4 A;  2YUP A;  1UEB A;  5LL6 S;  2QG9 B;  2XDB A;  2QQ9 A;  4IUV A;  1K76 A;  3HY0 A;  2QEX T;  3A7A A;  1LPL A;  1K8A R;  12AS A;  3A7R A;  3CC7 A;  3OBW A;  1USY C;  2ZCF B;  1QVG A;  4P3P A;  2HQE A;  2DIL A;  4M78 F;  2EQI A;  1M30 A;  2DU7 A;  4ZGJ B;  3OYY A;  2PNI A;  4XTV A;  1Z7N A;  4OF1 A;  1UB4 A;  2CUD A;  2ZTG A;  4TVY A;  1HYO A;  4PJO G;  4E7L A;  3R07 A;  1QWE A;  2DTH A;  2RQV A;  1RAC B;  4UPA A;  2OTL A;  1H64 1;  3M59 A;  3JCM b;  1L0W A;  1X01 A;  2DBK A;  3C0C A;  3G4S T;  3AHU A;  2LC4 A;  5IN1 A;  5KNN A;  1JEG A;  3VS2 A;  3HFV A;  3M53 A;  3OQ5 A;  3LC0 A;  3G6E T;  1VQ9 T;  1IRE B;  4HA8 A;  2FEI A;  3P8V A;  2MWP A;  4N0A A;  2OTJ Q;  1XQH A;  4XEM A;  2KK4 A;  3ZEH A;  3CC2 T;  4KGX B;  1K8A C;  2LQ8 A;  2CP0 A;  5KYY A;  5FWB A;  3TVT A;  4XU0 A;  3DLL A;  1IO6 A;  4FT4 A;  4ORZ A;  5CKB A;  3UAT A;  2PME A;  3PNW C;  4BUG A;  2D9T A;  1RIQ A;  1ZA2 B;  2JW4 A;  4IKF A;  4M77 D;  4TVW A;  5GAN 5;  2BUD A;  1K9M R;  3SHW A;  2PVD B;  1RUW A;  1BK2 A;  2HEQ A;  2BZX A;  3S3N A;  1VQ5 T;  1TH7 A;  2AKK A;  5GMK m;  5GAN 7;  4PKC C;  2MCN A;  1Y57 A;  3RKX A;  1VQO T;  3QKJ A;  1PRM C;  4M7D C;  2DL5 A;  5CAI A;  3VQX A;  2A28 A;  2VV5 A;  1VQ8 Q;  1BI3 A;  3H8Z A;  1SKU B;  1JBM A;  4JZ4 A;  3CC4 A;  4H2T A;  1U3O A;  3A8L B;  4K88 A;  1I81 A;  1EFW A;  3JCM J;  4M7A C;  4BDY A;  3WVE B;  4YRN A;  1QWF A;  1X6B A;  3OYH A;  1M1K C;  2ZIO A;  2K9G A;  3VS0 A;  2KSS A;  1USY A;  1NYR A;  4YRJ A;  5D6W A;  2OAW A;  4BY6 B;  2PVO B;  2DM1 A;  3EFR A;  1H4V B;  1K9M C;  2NUT B;  2HDA A;  4M78 E;  3GNG A;  4LUE A;  4XAX B;  2Y4X A;  2JM8 A;  3SFM A;  2JT4 A;  4LD6 A;  2Q5H A;  4ZN3 A;  3X28 B;  5FLX E;  1OZ2 A;  4PJL A;  2QHS A;  4CS4 A;  2MMP A;  2K2V A;  1Y07 A;  2MIO A;  2L89 A;  2ODR D;  2VUB A;  1G3S A;  3M57 A;  3A5Y A;  3REA B;  2CUB A;  3CC7 T;  2O9S A;  3V8L A;  1G83 A;  4YCU A;  3OMG A;  1EIF A;  3TUP A;  1TSF A;  2VGN A;  1MV0 B;  3C4S A;  5CR2 A;  3CXC A;  1OI1 A;  3EFO A;  3OB9 A;  1WPY A;  4J9E A;  1EFN A;  3I55 A;  2OTL T;  4X5O A;  2XG8 D;  3CC4 Q;  4M7A F;  2ROT A;  2ALY A;  2RHZ A;  5GMK i;  5GAM j;  2V1Q A;  5IH2 A;  2KI7 A;  4FW1 A;  3THK A;  4LDU A;  1FMK A;  1MMG A;  5CKF A;  2X3X D;  2GF7 A;  4OLF A;  1X56 A;  1K9A A;  1NYF A;  1Q7Y R;  4TVR A;  2PVG B;  1DJ7 B;  4M7D A;  4J8O A;  4ZTU B;  1SET A;  5A0L A;  4E7K A;  4C8Q G;  3ICA A;  2E3H A;  3HRS A;  3M4Q A;  1AWO A;  1BKB A;  1KD1 U;  1KK7 A;  7AT1 B;  3HPW A;  3JAM E;  4M7A A;  2J3M A;  3FJP A;  1M9S A;  5CIU A;  4EX5 A;  1BBW A;  2E3C A;  2RI5 A;  4KUL A;  1QP2 A;  1W4S A;  3S3M A;  1GL5 A;  4FYY B;  1GXI E;  1AOJ A;  2LP5 A;  3HRI A;  1G3Y A;  3CCJ Q;  2NLU A;  2PZ1 A;  2FRW A;  4LDW A;  3LX7 A;  3QNE A;  3CCR A;  4V2S A;  1ABQ A;  1XTD A;  3QUI A;  3HHT B;  1M90 U;  1RAG B;  4HWO A;  1WHG A;  3HFN A;  1MMN A;  2J06 A;  2JOY A;  4ZN1 A;  4LVI A;  3CC4 T;  1H8K A;  1NE8 A;  2DAQ A;  3JCM P;  2DD5 A;  4KH1 B;  2XTI A;  5GMK h;  4LDX A;  1HC7 A;  5KYX B;  2EGA A;  5GAM h;  1KC8 U;  1VIF A;  1JXO A;  4LVL A;  4MZP A;  1UGQ B;  1NJ8 A;  1TUG B;  4JRQ A;  3JB9 G;  2GFA A;  2JTE A;  1G8X A;  4RTY A;  2ODR C;  2DL4 A;  4PJJ A;  4JS5 A;  4TVA B;  4ME7 A;  1ADJ A;  3CMA A;  5KCH A;  1B76 A;  1MMD A;  4CRI A;  4Z8A A;  4F7U F;  3J7A F;  2HQH A;  1M5Q 1;  1KQS S;  2KT8 A;  1WGS A;  2HZY A;  1C1A A;  4HCB A;  4YTL A;  2R58 A;  1M3B A;  3VBB A;  1LVK A;  2FHD A;  5KE3 A;  5KYW B;  2L8D A;  4M7A E;  2MOX A;  4OGC A;  3GBQ A;  1KQ2 A;  3IKM B;  4E7J A;  4RQF A;  1B70 A;  1KG1 A;  2RJF A;  1M1K U;  4HWT A;  1BYM A;  4OMO A;  1D0X A;  2CKK A;  2EVR A;  2A7Y A;  4Y92 A;  1N8R C;  1Z9Z A;  4YRS A;  4PJO C;  1MUZ A;  4A54 A;  1WIE A;  2GTO A;  2QYZ A;  4F7U A;  4LN2 A;  1KJW A;  2HKN A;  2J6F A;  1R8O B;  2V8I A;  2RHQ B;  4C0D C;  1YN8 A;  2ZNJ A;  1NJI C;  5C53 B;  4FYX B;  4OMF B;  3NTI A;  5A0D A;  1PYS B;  1GCQ C;  3EHR A;  4M75 D;  2BZY A;  4K87 A;  4PJM A;  2KY9 A;  4A4H A;  5GAM e;  3VS1 A;  1QVF S;  2CH4 W;  2FZC B;  1G2B A;  4H2X A;  2DEU A;  3I9Q A;  2AKL A;  1KMN A;  4WCI A;  1EOV A;  3H0F A;  1IZ6 A;  1QE0 A;  5C51 B;  3M0T A;  3MKD A;  4PLL A;  4MDW A;  4FYW B;  2VB6 A;  2CS7 A;  4ATO A;  2ENM A;  2KYM A;  1NBE B;  1M2V A;  2F2W A;  3A8M B;  4FIB A;  4EMG A;  2OX7 A;  5GAM g;  1YJW Q;  4C92 G;  3M58 A;  1AZE A;  3CCR T;  3LW5 E;  1J3T A;  3PVL A;  2EWN A;  2HBP A;  1NPR A;  4RTW A;  3EGD A;  4ELZ C;  4QKU A;  1NEG A;  3CD6 Q;  2HD0 A;  1ABO A;  4J7F A;  1QF6 A;  3EFS A;  1G51 A;  3JB9 H;  4PJO F;  4KT0 E;  4O6J A;  4E7I A;  2E70 A;  1W66 A;  2QHU A;  5GAO n;  4PL6 A;  1E6G A;  1Q86 R;  2LNH B;  4RTT A;  4HT8 A;  2PTK A;  1YHQ Q;  1R0B G;  2CSQ A;  4E2F B;  1VQP A;  4YRG A;  4F7U E;  1IL2 A;  3LWI A;  2CYZ B;  3VV0 A;  2EGC A;  2AMC B;  3R6O A;  4DA4 A;  2QHV A;  5LJ5 f;  1O75 A;  3OMC A;  1PKS A;  2F1L A;  4OB0 B;  1NPP A;  4PJO A;  2ZZF A;  1YIT Q;  1UTI A;  2C8M A;  1K0X A;  2KR3 A;  3CMA T;  3GIB A;  4QQG A;  4RG8 A;  1JJC A;  3VQV A;  2DL3 A;  2RD1 A;  3DB3 A;  1X54 A;  4X1V A;  2RQW A;  1X2K A;  1I07 A;  2VC8 A;  2V8J A;  2DU5 A;  1NYQ A;  1C0M A;  3VS5 A;  2B8A A;  3CME Q;  3OD1 A;  3NET A;  3QHS A;  1GCQ A;  3M4Y A;  4J83 A;  2HAX A;  1VA7 A;  4JUV A;  1PCX A;  1H92 A;  4JRK A;  5CK9 A;  5IHK A;  3CD6 T;  2P4R A;  2XKO C;  2P0P A;  5K1X A;  3HY1 A;  2K7A A;  1BI0 A;  1GFD A;  3OYI A;  1VQM Q;  3MPU B;  4QT7 A;  4M75 C;  4XK8 E;  3PCO A;  5D6X A;  2RN8 A;  2CP3 A;  2CIM A;  3TEH A;  4IUQ A;  2I2L A;  5GAM d;  1B3Q A;  1ZSG A;  1ZBJ A;  2P5I A;  2YUO A;  3LH5 A;  3IAL A;  5KE2 A;  1LJO A;  1EZZ B;  5M9O A;  4YRL A;  2ZPB B;  4HCK A;  3ZL7 C;  1JJ2 A;  4P74 C;  5LJ3 f;  5C6S A;  2LT4 A;  3CCL A;  2DIG A;  1N8R U;  1F1B B;  4ELY C;  3RGL A;  4PJO E;  3JV3 A;  3CME T;  3Q1J A;  1NLO C;  2W10 A;  4IUP A;  1OX9 A;  2HBW A;  2QA4 A;  1WU7 A;  4WTO B;  4FT2 A;  1Z9Q A;  2LX9 A;  2KE9 A;  4FSX A;  3RR6 A;  4RMO A;  4FM4 B;  1KQS A;  1AEY A;  2L2P A;  4NOY A;  1K73 U;  1UDL A;  2DXU A;  3PZC A;  4L5G A;  4YRE A;  1NG2 A;  1VQ4 A;  5FU6 C;  2P0Q A;  3UF4 A;  4TTV A;  3OYL A;  4II1 A;  1IXD A;  4LE9 A;  2KRS A;  3VS4 A;  3ZFJ A;  2M0O A;  4G84 A;  2RPN A;  1C6V X;  4ZNX A;  4M77 G;  3OYG A;  3A32 A;  1VQP T;  1ZSZ C;  3L4G A;  4JJD A;  1QCO A;  3M0Q A;  4D6W A;  5KYN A;  1W70 A;  1CSK A;  3M0R A;  4LD9 K;  3M54 A;  2COW A;  3JRZ A;  1ZQ1 A;  2RA2 A;  2VAS A;  1X2H A;  1WYX A;  2BKD N;  1ADY A;  1D09 B;  1LCK A;  2AKW B;  2ZR3 A;  4C8Q F;  4CH3 A;  1WZO A;  3BFM A;  1LYL A;  1AT1 B;  2ROL A;  3VKI A;  3IKL A;  2XI9 A;  4P5N A;  4ZTF A;  2EJF A;  4M75 A;  5FU7 B;  1QVF A;  2LX7 A;  3LSS A;  2EYZ A;  3TEE A;  1JU5 C;  4HT4 A;  3A8G B;  2IG0 A;  1RAI B;  3OYK A;  3OBY A;  5C52 B;  3CMQ A;  1NNH A;  2C0I A;  2J05 A;  2LCS A;  2LT1 A;  1M2O A;  2QA4 Q;  4CH5 A;  1IRX A;  4OMM A;  5HGQ A;  4OB3 B;  3RKY A;  1WDX A;  1Q82 R;  2GGR A;  1N9R A;  3RAC A;  4KBM B;  1YB3 A;  4C5E A;  2R5A A;  2GQI A;  2XMF A;  1QCF A;  1G3T A;  1M3A A;  4P74 A;  5HY6 A;  4RUG A;  1OUL A;  4NL2 A;  1TUC A;  2CZ6 B;  3EG9 B;  2A37 A;  3CC2 Q;  2AT1 B;  1XJW B;  3UA6 A;  3FIF A;  3CCV A;  2HMA A;  3M0S A;  3R6N A;  1X6O A;  1KD1 R;  1WYD A;  5CKE A;  3UA7 A;  4OMP A;  5AYF A;  4YYE A;  2DE0 X;  2KT1 A;  1X27 A;  2CZ7 B;  4JJC A;  3JB9 F;  2RHS A;  3A5Z A;  3QPH A;  2RM4 A;  1VQ5 Q;  5LJ3 h;  1YFN A;  2NUP A;  4A53 A;  3EG2 A;  3H9N A;  3CCL T;  2FB7 A;  1VQO Q;  2BE7 D;  4E6R A;  2VWF A;  3UGQ A;  5F5W A;  1M90 R;  2XK0 A;  3O5Z A;  1G5H A;  1IHW A;  4RTZ A;  2HL3 A;  1ZSZ A;  4CC2 A;  2NS6 A;  2I4L A;  2QA4 T;  5GAO m;  1SES A;  3HKS A;  3MEU A;  1U1T A;  4C92 C;  3ERR A;  2ZNI A;  4RCC A;  3SWN B;  4JJN K;  1U5S A;  1UGS B;  1VOM A;  1WHH A;  2CH4 A;  1X55 A;  2FZK B;  1EVL A;  2DEQ A;  1V29 B;  5GAN f;  2E5A A;  3V7S A;  1KC8 R;  4HCZ A;  3WVD B;  1VQ4 T;  1PG5 B;  1SHG A;  3PT9 A;  3P8D A;  1EIY A;  3M0P A;  3FEO A;  2OJ2 A;  4C8Q E;  3REX A;  4OML A;  1WX6 A;  2ZR2 A;  2GCX A;  3X25 B;  2L3S A;  3CCV Q;  4H2S A;  1Q81 R;  1VQ6 A;  2E5K A;  1OOT A;  2YLC A;  3VYH B;  2RQR A;  1VQL A;  1W2B S;  2FPF A;  1BIB A;  2KRN A;  2L3R A;  4J9B A;  3L2R A;  1LNX A;  5AT1 B;  4R55 A;  2A8E A;  4KR2 A;  3V8J A;  4A4G A;  1K4U S;  1ZX6 A;  1YJ9 A;  2WAC A;  3F70 A;  3CC7 Q;  2CJB A;  1B7Y B;  4BAC A;  1JO8 A;  4XTZ A;  2K6D A;  1NJ2 A;  2GQV A;  1A0N B;  2RB6 A;  1TS9 A;  4M78 B;  4MML A;  2ZT8 A;  3CCU A;  3MEW A;  3QG1 A;  5CQX A;  3X26 B;  3HSB A;  4Q5W A;  2WSE E;  4C92 F;  4FU6 A;  2OTL Q;  5KYY B;  4PFZ A;  3DKM A;  2L0A A;  2YDL A;  4H2Y A;  4LVM A;  3JCM W;  1W2B P;  1H3Z A;  3SDZ A;  5LJ3 g;  11AS A;  3O8V A;  2LZ6 B;  4DEY A;  1I4K 1;  2EPD A;  2E3I A;  1P92 A;  1UHC A;  2JN0 A;  3CCV T;  2I4M A;  4RMF A;  1NJ6 A;  2HL5 C;  4C92 A;  3QZ9 B;  1PD0 A;  3KFV A;  2EIF A;  1Y96 A;  3L2V A;  2EJ9 A;  4ZGE B;  3HL8 A;  3CBP A;  2LJ1 A;  3V8K A;  2ZPG B;  2M1H A;  4NL3 A;  2G6F X;  4BE1 A;  2C0T A;  3OW2 P;  4PG3 A;  3VQY A;  4ZTZ B;  2JMC A;  1Y7X A;  3RMS A;  2A36 A;  3FRN A;  4M7D F;  5I22 A;  5EG2 A;  1S72 A;  3BJU A;  4RDX A;  1QCN A;  1YP5 A;  2DDZ A;  3CCU Q;  5GJV B;  4HCC A;  4M75 G;  2DQ3 A;  3G71 A;  5GMK j;  3E9F A;  2DF6 A;  3SB2 A;  3UWN A;  1E6H A;  3KXT A;  1N9S A;  1YWP A;  4DEX A;  2RHI A;  3EGX A;  3OYN A;  4BW9 A;  1G5V A;  5GAN h;  5IT9 E;  1CKA A;  1N27 A;  1SG5 A;  2X4Y A;  3NGP A;  1OZ3 A;  3PIO A;  2YUN A;  4M77 C;  2L3Q A;  2YXY A;  4X34 A;  1VQZ A;  1RLQ C;  4AMC A;  2LMJ A;  3MEA A;  5FRM A;  2K3X A;  3WXM B;  4CS3 A;  5FW9 A;  5DM7 R;  1D1B A;  1WA7 A;  1VQL T;  1VIE A;  3NFC A;  3QII A;  4YPF A;  3JCM f;  3EFO B;  1JB0 E;  4C92 E;  3W3S A;  5ELO A;  1FMV A;  1MV3 A;  2GTJ A;  1YJ9 T;  2K4Y A;  1VYV A;  3GF5 A;  3TCJ A;  4IUR A;  3HTR A;  2ALY B;  1B8A A;  4PK4 A;  1SHF A;  2OAU A;  1YI2 A;  5DLQ E;  4KUD K;  5GAO p;  1B34 A;  2QXF A;  2RJD A;  2MWO A;  2YWW A;  1KQ1 A;  2EGE A;  3CCU T;  1AWW A;  2EW3 A;  1Q7Y C;  4UP9 A;  4QVC A;  4M7D B;  1K8A U;  2DXB A;  5CQY A;  1K0S A;  3I55 Q;  4TVA A;  3OYM A;  4R0K A;  3RER A;  3L2U A;  1ZLM A;  4J6Y A;  2X51 A;  4FCY A;  1YFT A;  4DQ2 A;  4M7A B;  2M51 A;  2HNI A;  2JXB A;  3CBO A;  4XTY A;  3A74 A;  2LQN A;  2ED1 A;  5KYW A;  2JMA A;  3G7Z A;  3CCS A;  4F16 A;  1BU1 A;  4M77 F;  3CPW P;  2QGF B;  1WI7 A;  4GLK A;  2CZ0 B;  2MYS A;  3H41 A;  4M7D E;  2X35 A;  3QO5 A;  3HRT A;  3PMT A;  4DBF A;  2HKQ B;  3HFZ A;  2D0N A;  3SEM A;  5GAN g;  1E1T A;  4M4Z A;  4A4E A;  2Q7G A;  2SRC A;  1RAE B;  4XTW A;  3KBG A;  1U1S A;  4J9I A;  2QTV A;  1D3B A;  3QXE B;  2J6O A;  4LNP A;  3VYG A;  2A3L A;  3CCR Q;  2F5T X;  4OB2 B;  2KDS A;  2D8J A;  2FPE A;  3MCA B;  1K73 R;  4M77 A;  5CO7 A;  1AZG B;  1ZBX A;  1S72 T;  4CC7 A;  5I2M A;  3BW1 A;  1K9M U;  4EMK C;  5I11 A;  3I55 T;  3G71 T;  4HT9 A;  2ARS A;  2W0Z A;  2ZAE A;  4AFZ C;  4DBH A;  1YNZ A;  5GMK e;  2O88 A;  2YRD A;  3C12 A;  1ZA1 B;  3X24 B;  2VGM A;  3FJ5 A;  1MHN A;  1KFZ A;  3M9Q A;  2YRV A;  1OPL A;  2NYS A;  2ZIN A;  1YIJ A;  4EPC A;  4Q6G A;  1HJD A;  3BE3 A;  1B70 B;  4NS5 A;  3CMA Q;  4TQF A;  2KXD A;  1YJN A;  2E64 A;  3QDF A;  4JLG A;  1XOV A;  4MZT A;  2RHX A;  3SD4 A;  4F7U B;  2P0K A;  1VQK A;  3TEG A;  2EYW A;  3KUF A;  5FWC A;  3P8H A;  1FYN A;  4EIK A;  3RES A;  1HK9 A;  2O4X A;  4YRM A;  1TU0 B;  1SEM A;  1YI2 T;  1X43 A;  2JS0 A;  4AFQ C;  2F2V A;  3TU4 K;  1MNE A;  3EGU A;  3M0U A;  1WJQ A;  4XU3 A;  4PHC A;  4QW2 A;  1GGM A;  1QW1 A;  3H0I A;  3L2W A;  3VRY A;  3A98 A;  4H2X B;  2ZGW A;  4M77 E;  3X20 B;  3PE0 A;  2DYI A;  3GOX A;  3EG1 A;  3CPF A;  1OYX A;  1M27 C;  4L87 A;  3IQL A;  3P8B B;  1KIK A;  4WJ4 A;  4QVZ A;  2PMF A;  1JXM A;  2LJ3 A;  2EKO A;  4PNO A;  2QI2 A;  3CCM A;  1BI2 A;  1M2V B;  2QQR A;  4AG1 C;  4ESR A;  4HKE A;  5GAN 3;  2EFI A;  3BDL A;  3CCS T;  4J15 A;  1SRL A;  2CZ1 B;  1R77 A;  1WQ7 A;  1WLP B;  4EMK A;  2RNA A;  4BB7 A;  4NCX A;  2KVQ G;  2G4C A;  3M5A A;  3EGD B;  3QSU A;  1I5O B;  4BI8 B;  3E9I A;  2E5Q A;  1GRI A;  4YRQ A;  5HKC A;  3PMI A;  5J39 A;  2K57 A;  3UH0 A;  2DZ9 A;  2ED0 A;  2H8H A;  4PJN A;  3S3O A;  1Q86 C;  4BDZ A;  4XTU A;  1VQK Q;  2IIM A;  1UEC A;  2ECZ A;  2VYT A;  4XQ3 A;  4LNS A;  4P75 C;  4YP0 A;  4B6M A;  3OYB A;  3MHX A;  2JTF A;  1W1F A;  1LOJ A;  2Y90 A;  1QKW A;  1QKX A;  1XNI A;  4M78 D;  4CH4 A;  1VQN A;  1ZUU A;  4RCB A;  1VQ7 A;  3VQW A;  2QDL A;  1UUE A;  2EYX A;  2ZT5 A;  2E6Z A;  4PJO B;  1YCS B;  4DBQ A;  4LXC A;  2LCC A;  2O31 A;  1OU9 A;  5KCO A;  3CCQ A;  5LJ5 j;  1QVG P;  3PGG A;  1WJR A;  2ZZD A;  1VQP Q;  1JJC B;  5J26 A;  4E7S A;  2YT6 A;  4XU2 A;  4C0D B;  2E10 A;  1E24 A;  4BE0 A;  3TRE A;  1BCO A;  1QLY A;  2CP2 A;  3I56 A;  2DJZ A;  2K79 A;  2V8K A;  4DBR A;  3RNJ A;  4RKU E;  3ZBD A;  2CP5 A;  3ER0 A;  1QMC A;  2FPD A;  2BTT A;  3I5R A;  2JS2 A;  5KYU A;  2DQ0 A;  4O2D A;  1D0Y A;  4MMK A;  3OS2 A;  2K3Y A;  3L1A A;  2EL9 A;  3NTH A;  5GAO r;  1YJN T;  4A4K A;  2ABL A;  1SRY A;  2IPO B;  2RQU A;  3NTK A;  2FVU A;  1KOG A;  1IB8 A;  4HVW A;  3AT1 B;  3JCM X;  3RL6 A;  1VQK T;  4YRO A;  2V1R A;  5IHI A;  3MP8 A;  3HXV A;  2I4N A;  3PCO B;  2DFU A;  1WNL A;  1NJI U;  1H4S A;  1ATI A;  2K5L A;  1BCM A;  2ZPE B;  2YSQ A;  3OYE A;  3HP9 A;  4JZ3 A;  5J3B A;  2MPX C;  2E4H A;  3L42 A;  1ARK A;  4J7I A;  1S1N A;  5CCA A;  3OS1 A;  2ZZG A;  2WSC E;  4M75 F;  5K1P A;  5E3I A;  2KRO A;  2DZC A;  2E65 A;  1VQ7 Q;  3T9N A;  5HCK A;  2FO0 A;  3V7R A;  1QQJ A;  2QQA A;  1IGQ A;  3CCQ Q;  1G3W A;  3DB4 A;  4C0Z A;  3G6E A;  3OY9 A;  5LJ5 h;  1EQR A;  1SPK A;  2QK0 A;  4N4H A;  3CCM T;  4YRI A;  3RBB B;  4P75 A;  1GCP A;  5LJ3 j;  2E12 A;  3I56 Q;  2DL8 A;  3MF1 A;  1PHT A;  4IUT A;  1C0A A;  2BZ8 A; 
#chains in the Genus database with same CATH homology
 3EAE A;  4LDV A;  2JTM A;  3A7U A;  4BI4 A;  2DXC A;  1YCY A;  2IY5 A;  3RIR A;  4C5G A;  5A0G A;  2YHT A;  3NEN A;  2PQW A;  4H2V A;  4M78 C;  4YDQ A;  1FXX A;  3L4G B;  4YCW A;  4KR3 A;  3GPL A;  2L5Q A;  3OS5 A;  1HTT A;  1UGR B;  1NJ5 A;  5I21 A;  3V7C A;  1VQN T;  3QO7 A;  1VQ7 T;  1E22 A;  1SSF A;  2DTO A;  4M7D D;  2XD0 A;  1ASZ A;  5GMK l;  5FRO A;  3CCQ T;  2RHY A;  4BY6 C;  2MF2 A;  1YBY A;  5GAN 4;  4P72 C;  2OTJ A;  4YRF A;  5L8R E;  4M7A D;  3MP1 A;  3I56 T;  2IVW A;  3DLM A;  5GAN 6;  1QP3 A;  1Q86 U;  5CVI A;  4AH6 A;  4WF2 A;  4P3N A;  4X9D A;  3REU A;  1NZ9 A;  1ASY A;  1Q82 C;  4C8Q B;  1RL2 A;  3M55 A;  4J5Y A;  2QQB A;  4XEO A;  2FL7 A;  4M75 E;  3QO3 A;  5LJ5 g;  3CBM A;  3OSV A;  2ARU A;  3PFS A;  3LGL A;  4BD3 A;  4EO4 A;  1KD1 C;  2VXF A;  1VQ8 A;  2K5F A;  2RK1 A;  4OB1 B;  3FB9 A;  2AHJ B;  2RHS B;  3G1Z A;  3NEM A;  3A5Z B;  1B7Y A;  4LDY A;  1M1F A;  5FU6 B;  1PSF A;  1M90 C;  4M78 A;  1YGB A;  3RF1 A;  4JRP A;  4LVK A;  1FX7 A;  2O01 E;  2R57 A;  1I5L A;  3IG2 A;  2XU8 A;  2EQJ A;  5LJ3 e;  3A8H B;  3OYA A;  4N4G A;  2X4W A;  2LNV A;  1KC8 C;  2ZCE A;  1EIY B;  4OVA A;  5CKD A;  4P72 A;  1KHI A;  1VUB A;  2WSF E;  5GAN j;  4MZM A;  3OW2 S;  1Q81 C;  4DOW A;  1J5W A;  2M9U A;  1QVP A;  1AHJ B;  2XHC A;  3N5B B;  4YRK A;  3OYJ A;  2LQK A;  4X9C A;  3PTA A;  1O9S A;  5ELN A;  4EDU A;  5LJ5 d;  4P73 C;  2OTJ T;  3UFG A;  5GAM f;  3JCM V;  4B9X A;  3L2Q A;  3LWH A;  4L6V 5;  3GNF B;  2Q7H A;  2MI6 A;  4QQD A;  1YFS A;  1HXD A;  3QYH B;  1UGP B;  3CCJ A;  4EMH A;  1WQW A;  3QZ5 B;  3GLX A;  2DTI A;  3HXY A;  2QQS A;  4CH6 A;  4C92 B;  1VQ8 T;  4IUU A;  3MEV A;  4QVD A;  1Y96 B;  2ZIM A;  3P8T A;  3HFO A;  2Q7E A;  3VUZ A;  1Q82 U;  3C94 A;  4PJO D;  5A2Q E;  2EQK A;  3VJP A;  2LCL A;  1VQ6 T;  4WI1 A;  4Y91 A;  2JVV A;  3OA6 A;  2PUO B;  5IAY A;  4P3O A;  3UGT A;  2JNG A;  3A31 A;  5LJ3 d;  3VU3 C;  3GP8 A;  3CPW S;  4BE2 A;  1E1O A;  3JCM c;  5I2S A;  4ZTJ A;  4E47 A;  2ZT6 A;  1BIA A;  4JDS A;  1Z7M A;  4P73 A;  5DY9 A;  1FYF A;  1RI0 A;  2E41 A;  2P0L A;  2FYK A;  1ZHI A;  1X75 C;  1FWZ A;  3M4P A;  5GAN e;  2DIQ A;  4UP8 A;  5CKH A;  4YRC A;  3OSS C;  3URG A;  1SER A;  4KQE A;  3RMQ A;  3MP6 A;  3J81 E;  3QBY A;  2EQM A;  4E7H A;  4Z02 A;  3RUX A;  2DVE A;  4Q15 A;  4LVJ A;  3MQZ A;  2DO3 A;  1B34 B;  3OYF A;  4TWA A;  2JZ2 A;  1JJ2 S;  1BI1 A;  3HTZ A;  2Q5I A;  1YFR A;  4C0G A;  3CCE A;  2RHQ A;  3ASK A;  5GAO q;  4M78 G;  1W2B A;  4HWR A;  1PYS A;  1Q81 U;  3MF2 A;  2J3L A;  4N4I A;  3BY7 A;  2RH2 A;  1YJW A;  3CCJ T;  2XGT A;  1MGQ A;  4XTX A;  5KH6 A;  4ZIB A;  4RQE A;  2H3J A;  4OP0 A;  4H2W A;  3CD6 A;  3C95 A;  2DKG A;  3LH0 A;  2LTO A;  5GAN 8;  5DLO A;  2G3R A;  4FL6 A;  3HFZ B;  4YRR A;  1N9W A;  3MO8 A;  1G5I A;  1YHQ A;  4G85 A;  2ZT7 A;  2E1H A;  3OW2 A;  1JRI A;  1D3B B;  2MAM A;  3LGF A;  3JB9 J;  2D6F A;  2RK2 A;  4UP7 A;  4JRI A;  1K73 C;  4M77 B;  3JCM h;  2X4J A;  2D0Q B;  3CEY A;  3PIP A;  2QDY B;  4J6W A;  4L59 A;  1H4Q A;  2RJE A;  1YIT A;  2ZPH B;  2CGH A;  2RJC A;  4R56 A;  1M1G A;  5C0M A;  2KAF A;  3HXX A;  2QHT A;  4C5I A;  1KHC A;  2AMC A;  3FDR A;  1WLE A;  4BI3 A;  5GAN 2;  3VUB A;  3INZ A;  3CME A;  4C8Q D;  1KMM A;  3J80 E;  3NEL A;  3P8Y A;  3E19 A;  3OS0 A;  2C7I A;  5GAN d;  2LRQ A;  4QQ6 A;  1VQM A;  3MET A;  2QTX A;  3QYG B;  2KQW A;  2HQX A;  2BIV A;  4BWA A;  3OYC A;  2GFU A;  3E1S A;  2O4X B;  3HXW A;  4JLI A;  1QVG S;  4HVC A;  2EYQ A;  3JCM e;  3M56 A;  1Q7Y U;  1PSE A;  2I4O A;  2DD4 A;  5FU7 C;  2RI3 A;  2ZPF B;  3CCE T;  1X2G A;  2LDM A;  4K86 A;  2RI2 A;  3S6W A;  4C5H A;  3RKW A;  3LYI A;  4M7D G;  4RG2 A;  3JB9 D;  1BBU A;  2CJ9 A;  4GY5 A;  2P4T A;  4VUB A;  1YJW T;  3CPW A;  3JCM g;  5HK0 A;  4YRT A;  2F5K A;  4B9W A;  3HXZ A;  4M7A G;  3FC3 A;  2RO0 A;  4EMK B;  3OYD A;  3E9G A;  4TQD A;  3M4G A;  2K5I A;  3L2Z A;  4HWS A;  4P71 C;  2ZZE A;  2DPP B;  2RHU A;  1YHQ T;  2VXE A;  1YIJ T;  1WJS A;  3LLR A;  4DOV A;  2C06 A;  3JSC A;  4Y28 E;  4YCV A;  3UDC A;  3QJY A;  2Y4Y A;  4MDX A;  4E51 A;  3WQZ A;  3LSQ A;  4H02 A;  2QEX A;  5FRN A;  1M4Z A;  1YIT T;  4C8Q C;  3JCM Q;  4HWP A;  3TEH B;  4OGE A;  3A8O B;  4XU1 A;  3SWN C;  1I8F A;  2M16 A;  3UT1 A;  3HRK A;  3ME9 A;  4CS2 A;  2AKW A;  5HK3 A;  3DSQ A;  3I7F A;  1N6A A;  3BDU A;  3E9H A;  3G4S A;  2XDD A;  3QO8 A;  2CJA A;  1VQ9 A;  1VQM T;  3FLG A;  3KFU A;  2XIC A;  4C92 D;  3UPU A;  4C0F A;  3CC2 A;  4DPG A;  2ZPI B;  5GAO l;  1U8R A;  1EVK A;  3QTC A;  1NJ1 A;  3H6Z A;  4YRP A;  4F7U G;  3JCM d;  2X4X A;  2F69 A;  2EQU A;  4WJ3 M;  2DK3 A;  1Y71 A;  3QDR B;  2XDP A;  2ART A;  1VQ5 A;  3CXC S;  4P71 A;  2EAY A;  4ZGD B;  1VQO A;  4N0A C;  3HXU A;  2LVM A;  1M8V A;  4J6X A;  4H2U A;  2PU9 B;  2ZXF A;  2PUK B;  2E6N A;  3MEY A;  2EJG A;  4A4F A;  4CI0 C;  4JS4 A;  2R5M A;  1H4T A;  4O5V A;  4KUI A;  4M75 B;  3JB9 I;  4C8Q A;  2YLB A;  5LJ5 e;  4PLI A;  3HRU A;  2IY5 B;  3SWN A;  3QJ6 A;  2JUF A;  2KMT A;  2XID A;  4UC4 A;  2DXT A;  5D6Y A;  1UEB A;  5LL6 S;  2XDB A;  2QQ9 A;  4IUV A;  3HY0 A;  2QEX T;  3A7A A;  12AS A;  3A7R A;  3CC7 A;  3OBW A;  1USY C;  2ZCF B;  1QVG A;  4P3P A;  2HQE A;  4M78 F;  2DU7 A;  4ZGJ B;  3OYY A;  4XTV A;  1Z7N A;  4OF1 A;  1UB4 A;  2ZTG A;  4TVY A;  4PJO G;  4E7L A;  3R07 A;  2DTH A;  4UPA A;  2OTL A;  1H64 1;  3M59 A;  3JCM b;  1L0W A;  1X01 A;  3G4S T;  3AHU A;  2LC4 A;  5IN1 A;  5KNN A;  3HFV A;  3M53 A;  3OQ5 A;  3LC0 A;  3G6E T;  1VQ9 T;  1IRE B;  4HA8 A;  3P8V A;  2MWP A;  4N0A A;  1XQH A;  4XEM A;  2KK4 A;  3ZEH A;  3CC2 T;  1K8A C;  2LQ8 A;  4XU0 A;  3DLL A;  4FT4 A;  5CKB A;  2PME A;  3PNW C;  4BUG A;  2D9T A;  1RIQ A;  4IKF A;  4M77 D;  4TVW A;  5GAN 5;  2BUD A;  2PVD B;  3S3N A;  1VQ5 T;  1TH7 A;  5GMK m;  5GAN 7;  4PKC C;  3RKX A;  1VQO T;  3QKJ A;  4M7D C;  5CAI A;  3VQX A;  2VV5 A;  1BI3 A;  3H8Z A;  1JBM A;  3CC4 A;  4H2T A;  3A8L B;  4K88 A;  1EFW A;  1I81 A;  3JCM J;  4M7A C;  4BDY A;  3WVE B;  4YRN A;  3OYH A;  1M1K C;  2ZIO A;  2KSS A;  1USY A;  1NYR A;  4YRJ A;  5D6W A;  4BY6 B;  2PVO B;  3EFR A;  1H4V B;  1K9M C;  4M78 E;  3GNG A;  4XAX B;  2Y4X A;  3SFM A;  4LD6 A;  2Q5H A;  4ZN3 A;  3X28 B;  5FLX E;  1OZ2 A;  2QHS A;  4CS4 A;  2MMP A;  2K2V A;  1Y07 A;  2L89 A;  2ODR D;  2VUB A;  1G3S A;  3M57 A;  3A5Y A;  3CC7 T;  3V8L A;  4YCU A;  3OMG A;  1EIF A;  3TUP A;  2VGN A;  3C4S A;  5CR2 A;  3CXC A;  1OI1 A;  3OB9 A;  1WPY A;  3I55 A;  2OTL T;  4X5O A;  2XG8 D;  4M7A F;  2ALY A;  2RHZ A;  5GMK i;  5GAM j;  4LDU A;  5CKF A;  2GF7 A;  4OLF A;  1X56 A;  4TVR A;  2PVG B;  1DJ7 B;  4M7D A;  4J8O A;  4ZTU B;  1SET A;  5A0L A;  4E7K A;  4C8Q G;  3ICA A;  3HRS A;  3M4Q A;  1BKB A;  1KD1 U;  3HPW A;  3JAM E;  4M7A A;  2J3M A;  3FJP A;  1M9S A;  5CIU A;  4EX5 A;  1BBW A;  2E3C A;  2RI5 A;  4KUL A;  1QP2 A;  1W4S A;  3S3M A;  1GXI E;  3HRI A;  1G3Y A;  2NLU A;  4LDW A;  3LX7 A;  3QNE A;  3CCR A;  4V2S A;  1XTD A;  3QUI A;  3HHT B;  1M90 U;  4HWO A;  3HFN A;  2JOY A;  4ZN1 A;  4LVI A;  3CC4 T;  1NE8 A;  2DAQ A;  3JCM P;  2DD5 A;  2XTI A;  5GMK h;  4LDX A;  1HC7 A;  5GAM h;  1KC8 U;  1VIF A;  4LVL A;  4MZP A;  1UGQ B;  1NJ8 A;  4JRQ A;  3JB9 G;  2GFA A;  2ODR C;  4JS5 A;  4TVA B;  4ME7 A;  1ADJ A;  3CMA A;  5KCH A;  1B76 A;  4CRI A;  4F7U F;  3J7A F;  1M5Q 1;  1KQS S;  1WGS A;  4HCB A;  4YTL A;  2R58 A;  3VBB A;  2FHD A;  5KE3 A;  2L8D A;  4M7A E;  4OGC A;  1KQ2 A;  3IKM B;  4E7J A;  4RQF A;  1B70 A;  1KG1 A;  2RJF A;  1M1K U;  4HWT A;  1BYM A;  2CKK A;  2A7Y A;  1N8R C;  4YRS A;  4PJO C;  4A54 A;  4F7U A;  1R8O B;  2V8I A;  2RHQ B;  4C0D C;  2ZNJ A;  1NJI C;  5C53 B;  4OMF B;  3NTI A;  5A0D A;  1PYS B;  4M75 D;  4K87 A;  4A4H A;  2KY9 A;  5GAM e;  1QVF S;  4H2X A;  1KMN A;  1EOV A;  1IZ6 A;  1QE0 A;  5C51 B;  4PLL A;  4MDW A;  2CS7 A;  4ATO A;  3A8M B;  4EMG A;  4FIB A;  5GAM g;  4C92 G;  3M58 A;  3CCR T;  3LW5 E;  2EWN A;  2HBP A;  1NPR A;  4ELZ C;  1QF6 A;  2HD0 A;  4J7F A;  3EFS A;  1G51 A;  3JB9 H;  4PJO F;  4KT0 E;  4O6J A;  4E7I A;  2E70 A;  1W66 A;  2QHU A;  5GAO n;  4PL6 A;  4HT8 A;  1VQP A;  4YRG A;  4F7U E;  1IL2 A;  3LWI A;  2CYZ B;  3VV0 A;  2AMC B;  3R6O A;  4DA4 A;  2QHV A;  5LJ5 f;  1O75 A;  3OMC A;  4OB0 B;  1NPP A;  4PJO A;  2ZZF A;  2C8M A;  3CMA T;  3GIB A;  4QQG A;  4RG8 A;  1JJC A;  3VQV A;  2RD1 A;  3DB3 A;  1X54 A;  2VC8 A;  2DU5 A;  2V8J A;  1NYQ A;  2B8A A;  3OD1 A;  3NET A;  3QHS A;  3M4Y A;  4J83 A;  2HAX A;  4JUV A;  4JRK A;  5CK9 A;  3CD6 T;  2XKO C;  2P0P A;  5K1X A;  3HY1 A;  1BI0 A;  3OYI A;  4M75 C;  4XK8 E;  3PCO A;  5D6X A;  2CIM A;  3TEH A;  4IUQ A;  2I2L A;  5GAM d;  2P5I A;  3IAL A;  5KE2 A;  1LJO A;  5M9O A;  4YRL A;  2ZPB B;  4P74 C;  1JJ2 A;  5LJ3 f;  5C6S A;  2LT4 A;  3CCL A;  2DIG A;  1N8R U;  4ELY C;  3RGL A;  4PJO E;  3CME T;  3Q1J A;  4IUP A;  2QA4 A;  1WU7 A;  4FT2 A;  2LX9 A;  4FSX A;  4RMO A;  4FM4 B;  1KQS A;  4NOY A;  1K73 U;  2DXU A;  3PZC A;  4L5G A;  4YRE A;  1VQ4 A;  5FU6 C;  2P0Q A;  4TTV A;  3OYL A;  4II1 A;  3ZFJ A;  4G84 A;  2M0O A;  4M77 G;  3OYG A;  3A32 A;  1VQP T;  3L4G A;  4D6W A;  4LD9 K;  3M54 A;  2RA2 A;  1ZQ1 A;  3JRZ A;  1X2H A;  2BKD N;  1ADY A;  2AKW B;  2ZR3 A;  4C8Q F;  4CH3 A;  3BFM A;  1LYL A;  3VKI A;  3IKL A;  2XI9 A;  4P5N A;  4ZTF A;  2EJF A;  4M75 A;  5FU7 B;  1QVF A;  3LSS A;  3TEE A;  4HT4 A;  3A8G B;  2IG0 A;  3OYK A;  3OBY A;  5C52 B;  3CMQ A;  1NNH A;  2LT1 A;  4CH5 A;  5HGQ A;  4OB3 B;  3RKY A;  1N9R A;  3RAC A;  4KBM B;  1YB3 A;  4C5E A;  2R5A A;  1G3T A;  4P74 A;  5HY6 A;  4NL2 A;  2CZ6 B;  3FIF A;  3CCV A;  1WYD A;  1X6O A;  5CKE A;  5AYF A;  4YYE A;  2CZ7 B;  3JB9 F;  2RHS A;  3A5Z A;  3QPH A;  2RM4 A;  5LJ3 h;  4A53 A;  3CCL T;  2FB7 A;  3UGQ A;  5F5W A;  2XK0 A;  1G5H A;  2NS6 A;  2I4L A;  2QA4 T;  5GAO m;  1SES A;  3HKS A;  3MEU A;  1U1T A;  4C92 C;  3ERR A;  2ZNI A;  4RCC A;  3SWN B;  4JJN K;  1UGS B;  1X55 A;  1EVL A;  2DEQ A;  1V29 B;  5GAN f;  2E5A A;  3V7S A;  4HCZ A;  3WVD B;  1VQ4 T;  3PT9 A;  3P8D A;  1EIY A;  3FEO A;  4C8Q E;  3REX A;  2ZR2 A;  2GCX A;  3X25 B;  4H2S A;  1VQ6 A;  2YLC A;  3VYH B;  1VQL A;  1W2B S;  1BIB A;  2L3R A;  3L2R A;  1LNX A;  4R55 A;  2A8E A;  4KR2 A;  3V8J A;  4A4G A;  1YJ9 A;  2WAC A;  3F70 A;  2CJB A;  1B7Y B;  4BAC A;  4XTZ A;  1NJ2 A;  2GQV A;  2RB6 A;  4M78 B;  4MML A;  2ZT8 A;  3CCU A;  3MEW A;  3QG1 A;  5CQX A;  3X26 B;  3HSB A;  4Q5W A;  2WSE E;  4C92 F;  4FU6 A;  3DKM A;  4H2Y A;  4LVM A;  3JCM W;  1H3Z A;  3SDZ A;  5LJ3 g;  11AS A;  3O8V A;  1I4K 1;  1P92 A;  2JN0 A;  3CCV T;  2I4M A;  4RMF A;  1NJ6 A;  4C92 A;  3QZ9 B;  2EIF A;  1Y96 A;  3L2V A;  2EJ9 A;  4ZGE B;  3HL8 A;  3CBP A;  3V8K A;  2ZPG B;  2M1H A;  4NL3 A;  4BE1 A;  4PG3 A;  3VQY A;  4ZTZ B;  1Y7X A;  3RMS A;  3FRN A;  4M7D F;  1S72 A;  5EG2 A;  3BJU A;  4RDX A;  2DDZ A;  4HCC A;  4M75 G;  2DQ3 A;  3G71 A;  5GMK j;  3E9F A;  3SB2 A;  3UWN A;  3KXT A;  1N9S A;  2RHI A;  4BW9 A;  3OYN A;  1G5V A;  5GAN h;  5IT9 E;  1N27 A;  2X4Y A;  1OZ3 A;  3PIO A;  4M77 C;  4X34 A;  1VQZ A;  3MEA A;  5FRM A;  2K3X A;  3WXM B;  4CS3 A;  5DM7 R;  1VQL T;  1VIE A;  3NFC A;  3QII A;  4YPF A;  3JCM f;  1JB0 E;  4C92 E;  3W3S A;  5ELO A;  1YJ9 T;  2K4Y A;  3GF5 A;  3TCJ A;  4IUR A;  2ALY B;  1B8A A;  2OAU A;  1YI2 A;  5DLQ E;  4KUD K;  5GAO p;  1B34 A;  2QXF A;  2RJD A;  2MWO A;  1KQ1 A;  3CCU T;  4UP9 A;  1Q7Y C;  4QVC A;  4M7D B;  1K8A U;  2DXB A;  5CQY A;  4TVA A;  3OYM A;  3RER A;  3L2U A;  4J6Y A;  1YFT A;  4DQ2 A;  4M7A B;  2HNI A;  3CBO A;  4XTY A;  3A74 A;  3G7Z A;  3CCS A;  4M77 F;  4GLK A;  2CZ0 B;  4M7D E;  2X35 A;  3QO5 A;  3HRT A;  3PMT A;  3HFZ A;  5GAN g;  1E1T A;  4A4E A;  2Q7G A;  4XTW A;  3KBG A;  1U1S A;  1D3B A;  3QXE B;  3VYG A;  2A3L A;  2F5T X;  4OB2 B;  2KDS A;  3MCA B;  4M77 A;  5CO7 A;  1S72 T;  1ZBX A;  5I2M A;  3BW1 A;  1K9M U;  4EMK C;  3I55 T;  3G71 T;  4HT9 A;  2ARS A;  5GMK e;  3C12 A;  3X24 B;  2VGM A;  1MHN A;  3M9Q A;  2YRV A;  2ZIN A;  1YIJ A;  4EPC A;  4Q6G A;  1B70 B;  4NS5 A;  4TQF A;  1YJN A;  2E64 A;  4JLG A;  1XOV A;  4MZT A;  2RHX A;  3SD4 A;  4F7U B;  2P0K A;  1VQK A;  3TEG A;  3KUF A;  3P8H A;  3RES A;  1HK9 A;  2O4X A;  4YRM A;  1YI2 T;  3TU4 K;  1WJQ A;  4XU3 A;  4PHC A;  4QW2 A;  1GGM A;  1QW1 A;  4H2X B;  3L2W A;  2ZGW A;  4M77 E;  3X20 B;  3GOX A;  3CPF A;  1OYX A;  4L87 A;  3P8B B;  4WJ4 A;  4QVZ A;  2PMF A;  2EKO A;  4PNO A;  2QI2 A;  3CCM A;  1BI2 A;  2QQR A;  4HKE A;  5GAN 3;  2EFI A;  3BDL A;  3CCS T;  4J15 A;  2CZ1 B;  1WQ7 A;  4EMK A;  4BB7 A;  4NCX A;  2KVQ G;  2G4C A;  3M5A A;  3QSU A;  3E9I A;  4BI8 B;  2E5Q A;  4YRQ A;  5HKC A;  3PMI A;  5J39 A;  2K57 A;  3UH0 A;  2DZ9 A;  3S3O A;  1Q86 C;  4BDZ A;  4XTU A;  2VYT A;  4XQ3 A;  4LNS A;  4P75 C;  4YP0 A;  3OYB A;  3MHX A;  2JTF A;  1LOJ A;  2Y90 A;  1XNI A;  4M78 D;  4CH4 A;  1VQN A;  4RCB A;  1VQ7 A;  3VQW A;  2ZT5 A;  2E6Z A;  4PJO B;  2LCC A;  5KCO A;  3CCQ A;  5LJ5 j;  3PGG A;  1WJR A;  2ZZD A;  1JJC B;  5J26 A;  4XU2 A;  4C0D B;  2E10 A;  1E24 A;  4BE0 A;  3TRE A;  3I56 A;  2DJZ A;  2V8K A;  4RKU E;  3ZBD A;  3ER0 A;  2DQ0 A;  4O2D A;  4MMK A;  3OS2 A;  2K3Y A;  3L1A A;  2EL9 A;  3NTH A;  5GAO r;  1YJN T;  4A4K A;  1SRY A;  3NTK A;  2FVU A;  1KOG A;  3RL6 A;  3JCM X;  1VQK T;  4YRO A;  3MP8 A;  3HXV A;  2I4N A;  3PCO B;  1WNL A;  1NJI U;  1H4S A;  1ATI A;  2K5L A;  2ZPE B;  3OYE A;  3HP9 A;  5J3B A;  3L42 A;  4J7I A;  5CCA A;  3OS1 A;  2ZZG A;  2WSC E;  4M75 F;  5K1P A;  5E3I A;  2DZC A;  2E65 A;  3T9N A;  3V7R A;  2QQA A;  1G3W A;  3DB4 A;  4C0Z A;  3G6E A;  3OY9 A;  5LJ5 h;  1EQR A;  4N4H A;  3CCM T;  4YRI A;  4P75 A;  5LJ3 j;  2E12 A;  3MF1 A;  4IUT A;  1C0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...