2DEQA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111g mutation
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
235
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKGIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 70
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2deqA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2deqA01
1E1TA 3QO7A 4P3NA 4M77D 4P73A 4M77F 1RIQA 1W66A 3V7CA 3HXWA 4Y91A 5GAMf 3L4GA 2DU7A 2ZIOA 4EO4A 5LJ3g 2ZCEA 4M78A 3G1ZA 4H2TA 3W3SA 4M75D 1YB3A 2RM4A 3VQVA 1NJ1A 2XGTA 1Y96A 1Y96B 2RHSA 1KMNA 2RHSB 5GAN3 1I8FA 5GAN8 2EAYA 2E5AA 1D3BB 1HXDA 2DXTA 4UPAA 1SESA 5LJ3h 4CS2A 1B70B 5GAOm 1H4TA 3BJUA 1X54A 3QO8A 3JB9F 2DU5A 1N9RA 5C53B 5GAOl 2QTXA 4YRIA 4YRJA 4F7UA 4J6XA 3JCMb 2G4CA 4CH6A 4M78G 5I21A 1PYSB 1YFRA 4K86A 4XEMA 4HT8A 2QHVA 3ICAA 2ZGWA 1HC7A 4X5OA 4PG3A 3QO3A 2VXFA 4OP0A 3V7SA 3V8JA 4P74C 4YRTA 4Q6GA 4QVDA 1BBUA 4P72A 3REXA 4C8QB 4G84A 3FJPA 11ASA 4PJOD 5GANd 4C92D 1B7YA 1LNXA 4C92F 3RKYA 4YRRA 4G85A 1SRYA 3QUIA 3PCOA 1Z7NA 3PCOB 4ZIBA 4CS3A 4TTVA 3M4QA 2ARTA 3CMQA 4XU2A 4EMKC 1KMMA 4C8QC 3ERRA 2RB6A 4F7UG 1EVLA 1C0AA 4M77C 3RUXA 3INZA 4TQDA 1Z7MA 3HRKA 1L0WA 3QNEA 4YRQA 4M78D 1YFTA 3M4PA 3P8YA 4M78F 1X2HA 1I4K1 2CIMA 3E9HA 3HXVA 2PMEA 4M75C 4JRIA 3RKWA 3RACA 2AMCB 4PHCA 4H2XB 5GANf 4A53A 5LJ3e 3TEHB 2E41A 5ELNA 3L2ZA 2FB7A 3SB2A 5LJ5d 3JCMX 1E1OA 3A31A 1SETA 4J6YA 4XTXA 4HWPA 3P8TA 5LJ3j 4RMFA 1I5LA 3UGQA 2ARSA 4C8QE 3REUA 2VC8A 2AKWA 3A32A 2AKWB 2Q7EA 5GMKl 2ZT7A 4CH5A 3A5ZA 1U1TA 4V2SA 4M77E 1VQZA 4XTYA 1LYLA 5E3IA 1M8VA 3HRIA 4QVCA 4PJOB 4F7UF 4M75E 2ZZEA 2ARUA 4YRLA 3HSBA 3LC0A 3BDUA 1ADYA 4M7DG 1QE0A 4M7AD 5GAN6 1GGMA 2ZZFA 4RCCA 4M7AF 4YYEA 4EMGA 4HA8A 3VQWA 5LJ3d 3MF2A 4RDXA 1MGQA 5LJ5f 1ADJA 2ODRD 4YRGA 2YLCA 4PJOC 5C52B 3LSSA 2ZR2A 1LJOA 3EFSA 4C92C 5GAOr 3IKLA 1D3BA 1BBWA 5ELOA 4EX5A 1WQWA 3JCMc 2ZT5A 1SERA 1B70A 4DPGA 4NL3A 3JCMJ 4P74A 1YCYA 3VU3C 2EJFA 3JB9D 5K1PA 4L87A 4ZTZB 4RCBA 4YRFA 3QTCA 2Q7HA 1KOGA 2EJGA 4P75C 3RL6A 3I7FA 4WF2A 2IY5A 2IY5B 4XTUA 1B34B 1KQ2A 1PYSA 4HT9A 2CGHA 3NELA 4YRNA 4OLFA 1B8AA 4YROA 1H4QA 3PZCA 2XTIA 3IG2A 5LJ3f 4MMLA 3QSUA 4P3PA 4M7DD 4HVCA 1USYC 4M7DF 4H2YA 3HY1A 2DTOA 3SWNB 4PJOE 4C92E 4EMKA 4HWSA 4C8QA 4YCUA 1U1SA 2JN0A 4EMKB 4P3OA 3MF1A 3QO5A 2DEQA 3UFGA 2VXEA 4XTWA 4WI1A 2ZNJA 4DQ2A 4CS4A 4M77A 4CH4A 4M77B 2EJ9A 5GAOp 2QHUA 4PNOA 3SWNC 4M75A 5GAMe 4YP0A 1NNHA 4M75B 1WU7A 2PMFA 1IL2A 4TQFA 1WLEA 5C51B 3HFZB 5GMKe 3E9IA 1NYQA 4O2DA 1I81A 2DZ9A 4EMHA 4N0AC 5GAMj 2QHTA 4J6WA 3VBBA 3RIRA 2QHSA 3P8VA 4M7AC 5GMKj 3A7AA 2C8MA 4C8QG 2AMCA 4UP7A 1G5IA 4YREA 4H2XA 1ATIA 3HXYA 3TEHA 2DKGA 3R07A 3A74A 4H2WA 4P71C 5GAN2 5GAN4 4M77G 4LNSA 4TWAA 3VQYA 1X2GA 4RQEA 1KQ1A 5GAMg 4ZTUB 4YRSA 2DVEA 5GMKm 3UGTA 2DTHA 4XEOA 4M75G 4JRKA 3PGGA 2Q5HA 4AH6A 3FIFA 3HTZA 4NOYA 3A7RA 2J3LA 3TUPA 3JCMe 1H4SA 1JJCB 3DSQA 1HK9A 4XTVA 4PJOA 3JCMQ 4C92A 1BIAA 3JB9I 2DTIA 4M7AE 1ASZA 1WQ7A 4C92B 1HTTA 4TVAB 4XQ3A 1NJ5A 5GAMh 3AHUA 4X9CA 3RESA 2K57A 2E3CA 3A7UA 2Y90A 2YLBA 1EQRA 2DQ0A 3V8KA 1NYRA 4HWOA 5KNNA 4M7DC 2ZT8A 2ZXFA 2CJBA 5K1XA 4C8QD 5GMKh 1NJ2A 4C8QF 3NEMA 3JB9J 2I4MA 4XTZA 4YRKA 2C7IA 1YFSA 4P75A 3RF1A 4UP8A 4K87A 3WQZA 2E1HA 1X01A 5GAN7 2Q5IA 2ZINA 3L4GB 1G51A 2DDZA 3JCMg 3HFOA 4H2UA 4Q15A 4M78B 1EVKA 2ZT6A 4HWRA 1NJ6A 1USYA 4M75F 3HXXA 4RQFA 1X55A 4MMKA 3BY7A 4JUVA 3JCMd 4PJOG 2P0LA 4C92G 1EIYA 2EL9A 1B34A 1EIYB 5GANe 3HXZA 3IKMB 4H2SA 4P73C 1WYDA 4M7DE 3JCMP 1BIBA 4TVWA 5CAIA 2DQ3A 4TVYA 4M78C 4YCVA 2J3MA 1H641 3SWNA 5GANj 3JCMh 2HNIA 12ASA 2ZR3A 3VQXA 2CJAA 4H02A 4NL2A 3UH0A 1WNLA 4HWTA 1WPYA 4CH3A 4YDQA 1LOJA 4N0AA 4BWAA 3BFMA 5HGQA 2I4OA 1N9WA 4F7UB 5GMKi 5GAN5 2I2LA 4A54A 3RERA 2CJ9A 4M7AA 1J5WA 4YRCA 3JCMf 2I4LA 3JB9H 4M7AB 3BW1A 4X9DA 2DZCA 3L1AA 2DJZA 5GANg 4KQEA 4JLIA 2YHTA 3V7RA 1YGBA 3EFRA 4BW9A 4NCXA 3HFZA 3HFNA 4P71A 3NETA 1TH7A 2FYKA 4PJOF 4XU3A 4M78E 5LJ5e 2EWNA 2I4NA 4KR3A 1B7YB 1NJ8A 4XU1A 1FYFA 1JRIA 3HY0A 3FB9A 4UP9A 1G5HA 4WJ3M 3QHSA 2P5IA 3HFVA 5LJ5j 4KR2A 1E22A 1EFWA 5GAOq 2ZNIA 3V8LA 5GANh 4P72C 2ODRC 1B76A 3M4GA 5DY9A 3LSQA 2E65A 4YPFA 2RHQA 3A5YA 3JCMV 2RHQB 2ALYA 3IALA 4YRMA 2ZTGA 1JBMA 4M7AG 2ALYB 2E10A 1X56A 3RGLA 1N9SA 2RD1A 5GAOn 5GAMd 3HXUA 3OD1A 4M7DA 4YCWA 4J5YA 5LJ5g 4M7DB 4WJ4A 3RKXA 1ASYA 1E24A 1JJCA 4F7UE 2ZZGA 1QF6A 4YRPA 1H4VB 2Q7GA 3JCMW 4XU0A 4TVAA 4J15A 4H2VA 3GIBA 2RA2A 2ZIMA 1EOVA 3TEGA 4E51A 2E64A 3JB9G 3KFUA 5LJ5h 3MEYA 4K88A 1M5Q1 2DXUA 3NENA 5F5WA
chains in the Genus database with same CATH superfamily
1E1TA 3CBPA 1AHJB 4P73A 2L2PA 3HXWA 3TCJA 2JOYA 5GAMf 2PZ1A 1R8OB 2P4RA 2KYMA 3MHXA 4HCZA 2L3SA 2DL5A 1M3CA 1PC0A 5M9OA 4AG1C 2RM4A 3CD6T 2KR3A 2CP6A 2JS2A 2R5MA 3META 2L0AA 2RHSA 4BE0A 4J9BA 2RHSB 4BD3A 2KQWA 5GAN3 3C94A 2RQWA 1NE8A 2KK4A 1D3BB 2KT8A 1WJRA 1E7OA 1ACMB 1M1KU 1QLYA 1FX7A 1VQ9T 4CS2A 2K3BA 8AT1B 1FMWA 4DOWA 2JMAA 2K5FA 2DA9A 3Q1JA 1N9RA 4HXJA 4B6MA 2M0OA 2QTXA 1D0YA 3JCMb 2AZVA 4JJDA 1PYSB 1PKSA 3A8GB 3A8MB 4E7JA 5CKBA 1HC7A 2X4WA 1X2KA 3V8JA 4P74C 1NJIU 3OY9A 2MK5A 1NEBA 4FT4A 4P72A 3REXA 2XG8D 2FO0A 1VQLQ 2L3RA 5GANd 4C92D 1B7YA 1ZX6A 1S72Q 4KRTA 3S3OA 1G3WA 1TUGB 4PL6A 4X1VA 2XD0A 3NFCA 1WXBA 4CS3A 4TTVA 5J39A 3HHTB 2HD0A 3PNWC 1UG1A 3CMQA 1VQ5T 4XU2A 1KMMA 1T3SA 3ERRA 2DRKA 2IG0A 2MYSA 1C0AA 4M77C 3FJ5A 1L0WA 3PIOA 2LX7A 4M78D 3M4PA 3OYYA 4N4IA 2O88A 2CIMA 4CI0C 3E9HA 4M75C 2EKOA 2RK1A 3RACA 3CCUQ 3G6ET 4PHCA 1EIFA 2CREA 3CD6A 5LJ3e 3TEHB 2O4XA 3VUZA 3PVQA 4E7HA 2O4XB 4JPBW 2XKOC 2LVMA 4E7KA 3OA6A 3GBQA 3CCET 1AD5A 1EFNA 1SETA 2LP5A 2GF7A 2HBWA 2J05A 3REUA 3UGQA 1VQ9A 3EH1A 5C0MA 3A32A 3PMIA 4CC3A 2Q7EA 5GMKl 2CP0A 1VQZA 3OMGA 3TSWA 3P8BB 3OYCA 3CCMQ 4XTYA 5E3IA 2E70A 4AFUC 4O6JA 1X6OA 4J9HA 1M8VA 2GFUA 3NGPA 4PJOB 1BYMA 1K8AU 1ZUKA 4YRLA 3HSBA 3BDUA 1ADYA 5GAN6 4RCCA 3M54A 3P8HA 3OYEA 1SPKA 1SF9A 4QKUA 4EMGA 2LQ8A 3CC2Q 1WHJA 2ODRD 2YLCA 2F2VA 2MPXC 3UDCA 1M1KC 2LJ3A 2RQVA 4PJOC 3EFSA 1RI0A 1BBWA 4EX5A 4A4EA 2KBTA 4BUGA 2M51A 3JCMc 2ZT5A 2QI2A 1VYVA 5KYXA 1B70A 1ZLMA 2ZPHB 5KYXB 4NL3A 2F1LA 1VQ5A 4L87A 2V8KA 1RAIB 3SFMA 3EGDA 3I7FA 2IY5A 3TVTA 1O75A 4QQ6A 2IY5B 2HSPA 2FZCB 2KXCA 2CGHA 2EQMA 2CUBA 3S3NA 1GCQA 4KULA 1QVGA 2JTEA 1AZEA 3HL8A 3PZCA 3J80E 1SG5A 2K2MA 2QK0A 4P3PA 3ER0A 3TREA 1USYC 3PMTA 4JJNK 4HWSA 1N5ZA 2KEAA 4C8QA 3G6EA 4YCUA 2OX7A 1U1SA 2VB6A 2X3WD 2QQRA 3QO5A 3MP6A 3CCEA 5GJVB 3VV0A 4KUIA 2J6FA 2QHUA 4RTTA 4BE1A 3I56Q 2DILA 2MMPA 5EG2A 3OSSC 3E2UA 2AKKA 1YI2T 1WU7A 4ORZA 2DETA 1KHIA 5C51B 1UGVA 4FSSA 3X28B 4GLMA 1R0BG 2JMCA 2CP3A 5CKEA 3CC4Q 3P8VA 4ZNXA 3GLXA 4YREA 2KVQG 2XI9A 2DKGA 2PNIA 5FU6B 1OQKA 2E4HA 2GCXA 4TVRA 2D0NA 4KGVB 2HL3A 2IVWA 3REAB 5GAN2 5GAN4 1QVGP 1X2GA 2A7YA 1ZSGA 2ECZA 5GAMg 1H3ZA 2C0IA 4XEOA 3J81E 2HZYA 2DMOA 4JRKA 1RI9A 3PGGA 4JJBA 2CH4W 3OQ5A 2COWA 1BCOA 3FIFA 3TQ7P 2CKKA 1K0SA 1QKXA 3HTZA 2RHZA 4NOYA 1K8AC 2J3LA 1H4SA 3DSQA 4C0FA 1HK9A 1FYNA 3EG3A 2XHCA 4LNPA 3CCSQ 4LDXA 3HTRA 1ZQ1A 1WQ7A 2ZPIB 5CVIA 2K57A 2E3CA 3A7UA 2DQ0A 3I9QA 4M7DC 1KHCA 2ZXFA 4E47A 1PSFA 2RJEA 1NJ2A 4C8QF 4MZTA 2DPPB 2I4MA 4YTLA 1IHWA 3CCQQ 1G3TA 1UGSB 1JXMA 4ESRA 1KC8C 4K87A 2FPEA 3PE0A 1VQ7Q 5GAN7 2RI2A 3E1SA 4RUGA 1VQKQ 4FW1A 5KYYA 1VQ4Q 5KYYB 4HWRA 2HSEB 4RQFA 1X55A 3OBWA 3L2VA 2XK0A 4JUVA 2NUPB 1B3QA 1M1FA 3MP1A 4DOVA 1YI2A 1N8RC 2FL7A 3UWNA 1EIYA 1B34A 5HK0A 1EIYB 5GANe 3QIIA 3IKMB 2OAUA 4E7ZA 1AWXA 2LCLA 2B8AA 3WXMB 1KD1C 2DQ3A 2P0KA 4K11A 2J3MA 2F2WA 2DE0X 2GQIA 2EGEA 3MJXA 3E9GA 12ASA 4FSXA 2PUKB 2ZR3A 2ATCB 1KJWA 1M3AA 1WPYA 5KYNA 4BWAA 4E7LA 5L8RE 2I4OA 4AFQC 3CBOA 2J6KA 4ZN3A 5GAN5 4KH1B 4QW2A 3UA7A 4M7AA 4YRCA 1E6HA 3JCMf 2I4LA 2QYZA 3BW1A 4PJJA 4X9DA 4M7AB 3L1AA 5CKDA 1IGUA 3HFZA 3CMET 1Q82U 2KXDA 2X51A 3H6ZA 3NETA 4CRIA 3M9QA 4WTOB 5KYUA 5LL6S 2FYKA 1BK2A 2QEXT 1XTDA 4HVWA 2I4NA 1NJ8A 4XU1A 4LVJA 1JRIA 1AOJA 3QXEB 3FB9A 1TSFA 3OYDA 1TOVA 4KR2A 2RI3A 4Z02A 3G1JA 1EFWA 3V8LA 2O31A 1VQ6Q 1X2QA 2JUFA 5GANh 5KYWA 3M4GA 5DY9A 2E65A 5FU7B 2X4YA 5KYWB 1WHLA 2ED1A 2FVUA 2RHQA 3A5YA 2KYBA 4ZN1A 5DM7R 4PFZA 2RHQB 3IALA 1JBMA 1X56A 5CO7A 2E6NA 2CSIA 1VYUA 3A1PA 1D0XA 5GAMd 3OYKA 5GJWB 4C5GA 4J5YA 2Z0WA 3RKXA 3OYBA 5FU7C 5FRMA 4LDUA 3CCLQ 1H4VB 9ATCB 4C0DB 1X6GA 1PD0A 1T3LA 1VQPT 1OOTA 2Y4YA 2ZPGB 1KSWA 2HQHA 3TSZA 3I55T 4OB1B 3QG1A 3FC3A 3EG9B 1VQOT 2D8HA 3OYMA 3L2UA 2LZ6B 3MEVA 3MEUA 4C0DC 1CKAA 1M5Q1 5F5WA 1PRLC 4D6WA 2KE9A 2SRCA 3LYIA 3EHRA 4Y91A 1X6BA 3L4GA 2ZIOA 3CXCS 4EO4A 1M90R 4M78A 1D1AA 3MQZA 3VYHB 3VQVA 2XGTA 5CKFA 3L2QA 1Q7YU 2CS7A 3CMEA 1V1CA 4HT4A 3GP8A 1I8FA 1SHFA 1YHQT 2QEXA 2EAYA 4Z8AA 5C6SA 4X34A 3QJYA 1NBEB 2E5AA 1GBQA 3A98A 4FIBA 2DXTA 2QASA 1SESA 2BE9B 1ZSZA 1WA7A 4IUTA 1Q81U 3CC7T 2XDBA 1X54A 1Y0MA 2DU5A 4D8KA 4YRIA 2RHYA 3I35A 2O01E 2L8DA 5IXFA 2VUBA 4F7UA 1N6AA 3X24B 5IAYA 1TS9A 1LVKA 3GF5A 1U3OA 3O8VA 4X5OA 3H0FA 2VXFA 1BU1A 3V7SA 2CP7A 3EFOA 4PJLA 4Q6GA 1RAHB 1FMKA 2AK5A 4QVDA 3EFOB 3CBMA 3RMSA 2DERA 2LT1A 3ME9A 2FPFA 3NHNA 1CSKA 4C92F 5CIUA 3L2RA 3RKYA 1VQPA 1JEGA 2ZPEB 1E6GA 1S1NA 3VS5A 3I55A 3J7AF 2ARTA 1TUCA 2LNHB 4RMOA 3FEOA 4AT1B 4EMKC 1VQOA 1RAFB 2L3PA 2NLUA 1VUBA 1UJYA 1EVLA 1G83A 3RUXA 1VQNT 4TQDA 1VQ8T 3HRKA 1QCOA 1XJWB 4PJMA 5D7UA 1I0CA 3G71T 2XMFA 4M78F 2RF0A 1X2HA 1I4K1 3HXVA 1K73R 3SDZA 2VASA 2ZPBB 3VUBA 5KCOA 2SEMA 1Z9QA 2YXYA 5ELNA 3IQLA 2RHXA 2LX9A 2RMOA 4HVVA 1FWZA 4LUEA 4WCIA 1YHQA 2CH4A 3UF4A 2FRWA 4J6YA 3CD6Q 2M16A 3P8TA 1I5LA 2J06A 4QT7A 2AKWA 1NYGA 1UTIA 2YUOA 1WJQA 2AKWB 1WHMA 1RAAB 2ZT7A 3CC7A 2K9GA 1C6VX 1VQ9Q 1LYLA 1KQSA 4CC7A 1MNEA 3HRIA 4F7UF 2DL7A 3OS1A 2K3YA 1QWFA 1Q7YC 4M7DG 2BZYA 2F5TX 1K9AA 1YJWT 4M7AD 1HYOA 2A3LA 1W2BS 4KGXB 3X25B 3MF2A 1EX4A 4E6RA 5DLOA 1UB4A 5C52B 3X20B 1Q81C 2LQWA 1D3BA 5ELOA 5CCAA 4KBMB 2C0OA 4CC4B 1SERA 2VGMA 4JZ4A 4DPGA 4P74A 2FZKB 4RCBA 1K1ZA 3QTCA 4IIMA 1KOGA 2EJGA 1K9MR 4P75C 3RL6A 4XTUA 4JS4A 4LDYA 3RBBB 2RI5A 1PYSA 1VQ5Q 4RG8A 1VQNA 3NELA 1VQ8A 4OLFA 1B8AA 3RMQA 2DJQA 3QKJA 5LJ3f 3G71A 3QSUA 2DTOA 1KQSP 4C92E 2JVVA 1IGQA 4MZMA 5IN1A 2DEQA 4WI1A 4JDSA 3GOXA 4M77A 1BKBA 2NYSA 4CH4A 4M77B 3G6EQ 3M59A 2JW4A 2DM1A 1RADB 1WX6A 3CCEQ 2KAFA 4J8OA 4M75A 5GAMe 1YJNT 2DBKA 1NNHA 3LH0A 4M75B 2PMFA 3KBGA 1UEBA 1TXQA 4RTWA 2PVGB 2QHTA 3CCVT 1Q86R 1TU0B 3RIRA 1YJWA 5GMKj 3OYLA 3A7AA 5A0LA 1H92A 2HCKA 1KIKA 3TEHA 4AFSC 3R07A 4J9FA 3WVEB 3EH2A 2KNBB 3M58A 2EBPA 4P71C 2GFAA 2FHDA 2XIDA 4RG2A 4B9XA 2LQKA 3VQYA 4RQEA 1KQ1A 3KFVA 1NJIR 1YFNA 5GMKm 3C95A 3UGTA 2ABLA 4BI3A 2FRYA 1JO8A 2CZ1B 2QQAA 4AH6A 1QCNA 2AT1B 2M0YA 1I07A 2QXFA 4HCCA 4IUUA 2X4JA 1JJCB 1UDLA 4PJOA 4LVLA 3H0IA 1BBZA 5CKHA 1BI2A 1ABOA 1NJ5A 5GAMh 1ZBXA 4X9CA 3RESA 3AHUA 1YP5A 1ZA1B 2A08A 2Y90A 2YLBA 3H8ZA 2DEUA 2XDDA 4J9GA 3OS0A 2CJBA 4F04B 1YJ9T 4J83A 3CCRT 2QQBA 3NEMA 3JB9J 2XICA 3VKIA 3E9FA 1YFSA 4UP8A 1JJ2S 2D0QB 4B9WA 1J3TA 2COYA 2E1HA 4Y28E 2Q5IA 4F17A 4H2UA 3OYIA 1GFDA 3T9NA 1KC8U 1USYA 4M75F 3HXXA 4OB0B 4MMKA 4RTUA 4OMNA 1YJNA 4BB7A 1W1FA 3JCMd 3C12A 3GNFB 2P0LA 1M2VA 4C92G 5L23A 2V26A 1M2VB 4PLIA 1HJDA 4H2SA 4FW2A 1WYDA 1QVFA 1YI2Q 3FRNA 3CCVA 4DEYA 4OVAA 1N8RU 2E3HA 2RQUA 2D1XA 4BACA 1RABB 2X9HA 5IXBA 2J6OA 4LXCA 1H3HA 3QYGB 1I5OB 2BTTA 2LC4A 5CQYA 1KD1U 3DKMA 2LCCA 3SD4A 3EG0A 5FWBA 2OTLQ 1VIEA 1LOJA 1W2BA 1OU9A 3A8HB 1N9WA 4PFPA 1OZ3A 2EQIA 5GMKi 2GGRA 1JQQA 2QGGA 2CJ9A 1YBYA 2VVKA 1K0XA 1AWOA 2DZCA 3FDRA 1BI1A 1YGBA 2EGCA 2HKNA 3EFRA 4A4GA 1TH7A 4JS5A 2D8JA 4PJOF 4KR3A 5AYFA 2FG0A 3HKSA 2QAZA 4UP9A 2FEIA 1NPPA 4WJ3M 2OTLT 3CPWS 2L89A 1PNJA 5LJ5j 1E22A 3QYHB 4QVZA 1YJ9A 1DJ7B 1QVFP 3CCRA 2E5KA 1KK7A 5CR2A 2QA4T 4YRMA 2ZTGA 1MUZA 1YN8A 3RGLA 1NM7A 2YSQA 1N9SA 3CPFA 5GAOn 2DIQA 3LLRA 3HXUA 3OD1A 4M7DA 4YCWA 1OI1A 4M7DB 1PKTA 5IH2A 2QDLA 5J3BA 1W2BP 4RTVA 2C06A 4OF1A 2ZPFB 4MZPA 2Q7GA 2DFUA 3JCMW 4XU0A 4D8DA 1YWPA 1TTHB 2WACA 3LWHA 2EYYA 3ZBDA 3PT9A 2RN8A 1M2OA 3GIBA 2K6DA 3TEGA 2AZSA 4E51A 2YT6A 3EGXB 2RQRA 2MOXA 4K88A 2DXUA 2RQTA 1G8XA 3NTIA 4OMFB 1OPKA 4P3NA 1UJ0A 3HRTA 4M77D 1RIQA 1W66A 3V7CA 3LW5E 3EGUA 4C0GA 2DU7A 5LJ3g 2ZCEA 2NUTB 3G1ZA 4H2TA 3W3SA 4M75D 4DBRA 4GBQA 4LUDA 1YB3A 2BE7D 2NUPA 2LQNA 1Y96A 2XU8A 4ZGDB 2OJ2A 4JRQA 2DBMA 1Y96B 2LTOA 2QG9B 1QVPA 1UHCA 1ZBJA 5GAN8 1LCKA 2G3RA 1HXDA 1V76A 4UPAA 3BE3A 3CMEQ 1W6XA 3L2WA 2LT4A 1SRMA 2OTLA 4ZTFA 2QEXQ 5GAOm 2K5LA 3ASKA 1UGPB 4JRPA 2R57A 3QO8A 3JB9F 2K7AA 3OYJA 4II1A 2OAWA 1N27A 3RR6A 5C53B 5GAOl 4RTYA 3VS2A 4J9IA 2AIRB 2QA4A 2KRMA 4J6XA 2RK2A 4GY5A 2DVJA 4K86A 4XEMA 1VOMA 4HT8A 2DK3A 1JJ2A 3C4SA 2MCNA 1OPLA 3BDLA 3PIPA 4OP0A 4YRTA 1NYFA 3CCJT 5CK9A 2G6FX 4G84A 1AWWA 1XNIA 3MP8A 1MHNA 4PJOD 1LNXA 4BE2A 1VYTA 4BY6C 4G85A 1RLQC 1SRYA 3QUIA 3O5ZA 1Z7NA 4FYVB 5HY6A 4BI4A 2EGAA 1VQMT 1VQPQ 2YRVA 3HPWA 3LH5A 2DYBA 3M0TA 5A2QE 2YDLA 3I55Q 1WXUA 2DXCA 5KE2A 1VQOQ 3INZA 1Z7MA 4XAXB 4UC4A 3QNEA 1ARKA 2MIOA 1YFTA 3KXTA 2I0NA 3LWIA 2PMEA 1RUWA 1XQHA 4JRIA 3RKWA 1H8KA 1PHTA 2AMCB 1Z9ZA 4H2XB 4J7IA 2EYWA 2E41A 1RLPC 3JSCA 3VYGA 2FB7A 1JB0E 3SB2A 8ATCB 3JCMX 4ANJA 1JJ2P 1E1OA 3A31A 4XTXA 1WLPB 5LJ3j 4OMQA 2LCSA 3M55A 1Q82R 2ARSA 4C8QE 2E5QA 2VC8A 1ABQA 2F5KA 3EG9A 5D6WA 1YHQQ 4CH5A 1F1BB 4OMLA 3HP9A 1OZ2A 1U1TA 2D6FA 2HEQA 3MKDA 3CPWA 3P8DA 4EPCA 2GBQA 2KSSA 1K76A 3CC7Q 2DIGA 3REBB 3LGFA 4HCKA 1NPRA 1QE0A 2ZZFA 2RHIA 1P92A 2ZAEA 4M7AF 5I11A 4YYEA 2YWWA 1TUDA 2O9VA 1CKBA 3VQWA 3OS5A 1PWTA 5LJ3d 3X26B 1SHGA 1MGQA 3CCJA 4RDXA 5LJ5f 3CMAT 1ADJA 3UATA 2YUQA 3G7ZA 3OB9A 4R0KA 2GTOA 1LJOA 2EIFA 4C92C 1U8RA 2ZCFB 4OGCA 1WQWA 5FRNA 1NG2A 1Y71A 1WZOA 3JCMJ 4EIKA 1YCYA 2EJFA 1A0NB 1VQMA 3JB9D 5K1PA 2HQXA 2HDAA 3S3MA 4YRFA 2Q7HA 1OYXA 1NLPC 4WF2A 3ULRB 3OYNA 3OW2S 3WVDB 2OTJT 1KQ2A 3UT1A 4YROA 1H4QA 1QCFA 3OSVA 3IG2A 1VA7A 3M0QA 3PFSA 4M7DD 4HVCA 1D09B 1GL5A 3CPWP 3HY1A 3SWNB 5HCKA 4EMKA 1VQNQ 1VQ8Q 2JN0A 4EMKB 3MF1A 3UFGA 2VXEA 3G71Q 3M5AA 1Y7XA 2JXBA 1K73U 1M8MA 2DLPA 3R6NA 2ZZDA 2LMJA 1Y07A 1MMGA 1UGRB 4PNOA 4FM4B 3SWNC 4YP0A 1B7TA 4KH0B 2A0FB 1IL2A 5KE3A 1WLEA 2FPDA 3VRZA 1G5VA 3E9IA 1NYQA 4O2DA 1I81A 2DZ9A 4EMHA 4N0AC 4J6WA 1Q81R 1U5SA 5IHIA 1YNZA 2YUPA 1FMVA 4LDWA 2JM9A 1M90C 2QHSA 2CT3A 2YRCA 4CC2A 2C8MA 4C8QG 2DXBA 3I5SA 4LVIA 3M53A 3HXYA 3H9NA 3A74A 3CMAA 4H2WA 4ATOA 1YJWQ 2KROA 3EG2A 1Y57A 2DVEA 4L6V5 1SSHA 2DL4A 1NLOC 2RJFA 3CEYA 2RO0A 2PQWA 1M30A 4LN2A 2CZ6B 4RTXA 5FROA 1OULA 4N4GA 1M3BA 3G4ST 1MMNA 3A7RA 3TUPA 2MWPA 2PVDB 2MAMA 2GNCA 4MDXA 2BKDN 1BIAA 1ASZA 2DTIA 4JJCA 4M7AE 1IRXA 2OTJA 1M9SA 4TVAB 3QWXX 2CSQA 4A4FA 4KUDK 2IPOB 1K9MU 2J7IA 2VGNA 1Q95G 2HQEA 2MWOA 3MPUB 1PSEA 1OX8A 3M57A 4XTZA 4YRKA 1GRIA 4P75A 2K5IA 1HSQA 2CUDA 2MI6A 1UFFA 1WHKA 2VV5A 3QDRB 4F16A 4P5NA 1G51A 3JCMg 3HFOA 1HD3A 4HVUA 3JRZA 4Z89A 1GBRA 1WIEA 1B07A 4LD6A 4LD9K 4C5HA 4BDYA 3A8OB 2EL9A 2L5QA 1MNDA 3HXZA 4P73C 1AEYA 3OYAA 1YJNQ 3SHWA 3JCMP 2K3XA 1BIBA 5I2SA 5CAIA 1QMCA 2EVRA 2B86A 2V1RA 1K73C 1ZUYA 5GANj 2HNIA 3VQXA 2CJAA 4H02A 3CXCA 3CCVQ 1Q86U 2R58A 1SEMA 1WNLA 4HWTA 2KDSA 1UUEA 2VKNA 4CH3A 4YDQA 2WSEE 4JLGA 2AKLA 3BFMA 2PTKA 5EC7A 1MV3A 1G3SA 3LX7A 1RAGB 1J5WA 3OYHA 3S6WA 2RHUA 2D9TA 3JB9H 1GCPA 4JLIA 3G4SA 1PD1A 3UA6A 4BW9A 4NCXA 1RAEB 2F2XA 4P71A 1M1KR 1IREB 2QQ9A 1MMDA 2V8IA 4XU3A 4M78E 2EWNA 4C0ZA 1B7YB 1FYFA 2JS0A 3JV3A 1VIFA 2GTJA 5J26A 1G5HA 3QHSA 3OW2A 1WFWA 2XDPA 1QKWA 2ZNIA 5IHNA 4P72C 4E7IA 1MV0B 4NS5A 4YPFA 2EPDA 3OS2A 2LDMA 5I2MA 4DBHA 4M4ZA 2ALYA 2ALYB 1YJ9Q 4M7AG 2CYZB 2RJDA 2E10A 3CCRQ 4VUBA 2RD1A 1VQLT 3CXCP 1ZUUA 2QGFB 2DYIA 1S72T 1NZ9A 5LJ5g 4WJ4A 1D1CA 3QWYA 4OMOA 1E24A 3M4YA 4F7UE 1JJCA 2ZZGA 1QF6A 4YRPA 1K9MC 1UECA 1QWEA 3M0UA 4LE9A 5ECAA 4J15A 2E12A 2A36A 1YWOA 4J7FA 2E64A 4DBQA 2DL8A 3KFUA 4A4KA 2RNAA 3QO7A 2VYTA 3OW2P 4M77F 3CCUT 3AT1B 3I5RA 2JNGA 2HAXA 1WYXA 2QTVA 1NJ1A 3VRYA 2RH2A 1BB9A 4BI8B 5D6XA 2Y4XA 3JAME 1KMNA 3HRSA 4ZGJB 1OEBA 2ENMA 4FCYA 1Q86C 3CCMT 1U06A 4FU6A 2H8HA 2PU9B 5LJ3h 5CQXA 2KI7A 2P0QA 1B70B 4LDVA 4RTZA 4R55A 4KGZB 1H4TA 3BJUA 2LJ1A 3A8LB 1K8AR 3QDFA 2HL5C 1WI7A 4ELYC 4F14A 4L5GA 2BIVA 3EGDB 3EG1A 4YRJA 3FLGA 1NJIC 3CC2T 2G4CA 4CH6A 4M78G 5I21A 1YFRA 2A8EA 4PJNA 3CQTA 2KGTA 2QHVA 2CP2A 3ICAA 2ZGWA 4BDZA 1VQLA 1R77A 4PG3A 2JM8A 1S72A 3QO3A 2QA4Q 3DB3A 3THKA 1BBUA 4FYWB 2WSFE 4C8QB 1SRLA 3FJPA 2MF2A 11ASA 3U23A 1KC8R 1X27A 2L3QA 4YRRA 1GCQC 4J9EA 3PCOA 3H0HA 3PCOB 4ZIBA 3M4QA 4DA4A 2BZ8A 3M0SA 3L42A 4C8QC 2RB6A 2BUDA 2X4XA 1N8RR 3RNJA 5AT1B 2DL3A 3QBYA 4F7UG 1V29B 1PM3A 3R6OA 1OX9A 3OBYA 4AG2C 5A0DA 4FT2A 3CCUA 2EW3A 5HK3A 1KD1R 4YRQA 2RJCA 3P8YA 2M9UA 4C5IA 3VS1A 4QQDA 2M1HA 1EZZB 2LNVA 4PKCC 2NS6A 3D7SB 1XOVA 5GANf 4A53A 3L2ZA 4IIOA 2M02A 5LJ5d 3I56T 4EDUA 1SKUB 3QZ5B 4HWPA 1M1GA 4RMFA 2EQJA 2KRSA 1M4ZA 3CCMA 4AFZC 1D1BA 3EGXA 2COZA 5FU6C 3NTKA 3CC4T 3A5ZA 4V2SA 1PRMC 4M77E 3A5ZB 1QQJA 2DX1A 3QZ9B 2HBPA 3OMCA 2V8JA 4QVCA 4HKEA 4M75E 2ZZEA 2ARUA 1AWJA 3CC2A 2NUTA 2KMTA 3LC0A 2JT4A 2PVOB 4AMCA 1GGMA 3OYGA 4JZ3A 4HA8A 2DD5A 5DLQE 3UPUA 5A0GA 4A63B 4YRGA 2DD4A 1QP2A 3KUFA 4O5VA 3LSSA 2ZR2A 5GAOr 3PVLA 1M27C 3IKLA 3CCJQ 4ME7A 3LGLA 2H3JA 4FYYB 1UE9A 1YIJQ 3DLLA 3CCST 5KH6A 3DB4A 4A4HA 1JXOA 4ZTJA 5FW9A 2K2VA 3VU3C 1TWBA 4J9DA 1IZ6A 4ZTZB 2BZXA 2FZGB 1RACB 1AZGB 2V1QA 3TEEA 2EYZA 4PK4A 2DNUA 4L59A 1B34B 1VQMQ 4HT9A 1IXDA 3VS3A 1W4SA 3MEWA 4DBFA 3OYFA 4YRNA 4BY6B 2DO3A 2F69A 3QPHA 2XTIA 3CCQT 4MMLA 1NEGA 4M7DF 4H2YA 4PJOE 2P4TA 1VQ7T 1VQKT 3TU4K 2CP5A 4P3OA 6AT1B 1YIJT 2CZ7B 4XTWA 1VQ4T 3GPLA 2ZNJA 1I1JA 2HKQB 4DQ2A 3I56A 1D0ZA 4CS4A 2ROLA 1C1AA 3H41A 4PLLA 2JZ2A 4R56A 3ZEHA 2W0ZA 2EJ9A 5GAOp 4IUQA 3MO8A 1X75C 3CC4A 1UHFA 2P0PA 3MCAB 3SEMA 2K4YA 1O9SA 2EYXA 4TQFA 3EHQA 3HFZB 5GMKe 1QW1A 2C0TA 4KT0E 2DRMA 5GAMj 5KYUB 2OI3A 3VBBA 2JJ9A 3ZL7C 3DLMA 4M7AC 4ZGEB 1KQSS 1T0HA 2X35A 2AMCA 3M0PA 1G5IA 4XK8E 4H2XA 1ATIA 4UP7A 4IUVA 4HCBA 3QJ6A 1M90U 2RPNA 3GNGA 2X3XD 4M77G 4J9CA 4LNSA 1LPLA 4TWAA 2KY9A 4ZTUB 4YRSA 5IT9E 1K4US 2DTHA 3CMAQ 4Z88A 2EYQA 4M75G 1FXXA 1PCXA 3CCSA 2Q5HA 1OU8A 3NMZC 3RDVA 1GFCA 4MDWA 1MMAA 4ELZC 3JCMe 2PUOB 4XTVA 3JCMQ 4C92A 3JB9I 4RKUE 4C92B 1WHHA 1VQ6T 1HTTA 4XQ3A 2CT4A 3M56A 1BI0A 1BI3A 1EQRA 3V8KA 3HRUA 4OMPA 1NYRA 4Q5WA 4LVKA 3CCQA 4HWOA 5KNNA 1KFZA 2ZT8A 2OTJQ 3VS0A 3NTHA 3URGA 4FYXB 5K1XA 4C8QD 2LJ0A 5GMKh 1VQ7A 1VQKA 2C7IA 1YIJA 1X69A 3RF1A 3MEAA 1VQ4A 3VS6A 5IHKA 3WQZA 1X01A 1ZA2B 1WXTA 3VJPA 2E3IA 2O9SA 1YITQ 2ZINA 2ESWA 3CCLT 3L4GB 2DDZA 4Q15A 4M78B 1EVKA 2ZT6A 1NJ6A 5HKCA 2EFIA 3ZFJA 5D6YA 1ZHIA 3BY7A 1KG1A 1WHGA 4PJOG 1QP3A 2A28A 2QDYB 3EAEA 4M7DE 2JTFA 4TVWA 2A37A 1G3YA 2NUZA 5FWCA 4TVYA 3M0RA 4M78C 4YCVA 4OB2B 1GXIE 1H641 3SWNA 3JCMh 1ZSZB 4E2FB 1RL2A 1YITT 4NL2A 1PG5B 2ED0A 3UH0A 2O2OA 4N4HA 3PTAA 3VS7A 2CDTA 4N0AA 2IIMA 1UGQB 3NPFA 5HGQA 1T0JA 2ROTA 4QQGA 3VS4A 4F7UB 7AT1B 1AT1B 2I2LA 1Q82C 1Q7YR 4E7SA 3N5BB 2VWFA 4A54A 3RERA 1ZSZC 1IB8A 1TG0A 2E6ZA 5I22A 4OMMA 2DJZA 5GANg 4KQEA 1W70A 2DAQA 2YHTA 3V7RA 2YRDA 4IURA 1YCSB 3HFNA 2NWMA 1X43A 2DF6A 1R0CB 5LJ5e 2LRQA 4PFOA 5FLXE 3G4SQ 1VQ6A 3HY0A 1WGSA 5KCHA 2P5IA 3HFVA 1JU5C 5GAOq 4OB3B 2WSCE 4GLKA 3F70A 1SSFA 2ODRC 1B76A 2P84A 3LSQA 2AHJB 3JCMV 1AVZC 2W10A 4DEXA 3E19A 2KRNA 1IHVA 4FL6A 3C0CA 3CCLA 1C0MA 2EKHA 2EQUA 2JTMA 1ASYA 2EQKA 2QQSA 2R5AA 2K79A 1WDXA 4OGEA 2GQVA 4TVAA 2CZ0B 1IO6A 2H3EB 4H2VA 4C5EA 1OV3A 2RA2A 2ZIMA 1EOVA 4IUPA 1BCMA 4Y92A 1WJSA 4LVMA 2KT1A 3JB9G 2HMAA 1QVFS 2YUNA 5LJ5h 1QVGS 3MEYA 1YITA 1G2BA 4IKFA 3NENA
chains in the Genus database with same CATH topology
1E1TA 3CBPA 1AHJB 4P73A 3HXWA 3TCJA 2JOYA 5GAMf 1R8OB 3MHXA 4HCZA 5M9OA 2RM4A 3CD6T 2R5MA 3META 2RHSA 4BE0A 2RHSB 4BD3A 2KQWA 5GAN3 3C94A 1NE8A 2KK4A 1D3BB 1WJRA 1M1KU 1FX7A 1VQ9T 4CS2A 4DOWA 2K5FA 3Q1JA 1N9RA 2M0OA 2QTXA 3JCMb 1PYSB 3A8GB 3A8MB 4E7JA 5CKBA 1HC7A 2X4WA 3V8JA 4P74C 1NJIU 3OY9A 4FT4A 4P72A 3REXA 2XG8D 2L3RA 5GANd 4C92D 1B7YA 3S3OA 1G3WA 4PL6A 2XD0A 3NFCA 4CS3A 4TTVA 5J39A 3HHTB 2HD0A 3PNWC 3CMQA 1VQ5T 4XU2A 1KMMA 3ERRA 2IG0A 1C0AA 4M77C 1L0WA 3PIOA 4M78D 3M4PA 3OYYA 4N4IA 2CIMA 4CI0C 3E9HA 4M75C 2EKOA 2RK1A 3RACA 3G6ET 4PHCA 1EIFA 3CD6A 5LJ3e 3TEHB 2O4XA 3VUZA 4E7HA 3CCET 2O4XB 4E7KA 2XKOC 2LVMA 3OA6A 1SETA 2GF7A 3UGQA 3REUA 1VQ9A 5C0MA 3A32A 3PMIA 2Q7EA 5GMKl 1VQZA 3OMGA 3OYCA 3P8BB 4XTYA 5E3IA 2E70A 4O6JA 1X6OA 1M8VA 2GFUA 4PJOB 1BYMA 1K8AU 4YRLA 3HSBA 1ADYA 3BDUA 5GAN6 4RCCA 3M54A 3P8HA 3OYEA 4EMGA 2LQ8A 2ODRD 2YLCA 3UDCA 1M1KC 4PJOC 3EFSA 1RI0A 1BBWA 4EX5A 4A4EA 4BUGA 3JCMc 2ZT5A 2QI2A 1B70A 2ZPHB 4NL3A 1VQ5A 4L87A 2V8KA 3SFMA 3I7FA 2IY5A 1O75A 4QQ6A 2IY5B 2CGHA 2EQMA 3S3NA 4KULA 1QVGA 3HL8A 3PZCA 3J80E 4P3PA 3ER0A 3TREA 1USYC 3PMTA 4JJNK 4HWSA 4C8QA 3G6EA 4YCUA 1U1SA 2QQRA 3QO5A 3MP6A 3CCEA 3VV0A 4KUIA 2QHUA 4BE1A 2MMPA 5EG2A 3OSSC 1YI2T 1WU7A 1KHIA 5C51B 3X28B 5CKEA 3P8VA 3GLXA 4YREA 2KVQG 2XI9A 2DKGA 5FU6B 2GCXA 4TVRA 2IVWA 5GAN2 5GAN4 1X2GA 2A7YA 5GAMg 1H3ZA 4XEOA 3J81E 4JRKA 3PGGA 3OQ5A 3FIFA 2CKKA 3HTZA 2RHZA 4NOYA 1K8AC 2J3LA 1H4SA 3DSQA 4C0FA 1HK9A 2XHCA 4LDXA 1ZQ1A 1WQ7A 2ZPIB 5CVIA 2K57A 2E3CA 3A7UA 2DQ0A 4M7DC 1KHCA 2ZXFA 4E47A 1PSFA 2RJEA 1NJ2A 4C8QF 4MZTA 2DPPB 2I4MA 4YTLA 1G3TA 1UGSB 1KC8C 4K87A 5GAN7 2RI2A 3E1SA 4HWRA 4RQFA 1X55A 3OBWA 3L2VA 2XK0A 4JUVA 4DOVA 1M1FA 3MP1A 1YI2A 1N8RC 2FL7A 3UWNA 1EIYA 1B34A 5HK0A 1EIYB 5GANe 3QIIA 3IKMB 2OAUA 2LCLA 2B8AA 3WXMB 1KD1C 2DQ3A 2P0KA 2J3MA 3E9GA 12ASA 4FSXA 2PUKB 2ZR3A 1WPYA 4BWAA 4E7LA 5L8RE 2I4OA 3CBOA 4ZN3A 5GAN5 4QW2A 4M7AA 4YRCA 3JCMf 2I4LA 4M7AB 3BW1A 4X9DA 3L1AA 5CKDA 3HFZA 3CMET 1Q82U 3H6ZA 3NETA 4CRIA 3M9QA 5LL6S 2FYKA 2QEXT 1XTDA 2I4NA 1NJ8A 4XU1A 4LVJA 1JRIA 3QXEB 3FB9A 3OYDA 4KR2A 2RI3A 4Z02A 1EFWA 3V8LA 5GANh 2JUFA 3M4GA 5DY9A 2E65A 5FU7B 2X4YA 2FVUA 2RHQA 3A5YA 4ZN1A 5DM7R 2RHQB 3IALA 1JBMA 1X56A 5CO7A 2E6NA 5GAMd 3OYKA 4C5GA 4J5YA 3RKXA 3OYBA 5FU7C 5FRMA 4LDUA 1H4VB 4C0DB 1VQPT 2Y4YA 2ZPGB 3I55T 4OB1B 3QG1A 3FC3A 1VQOT 3OYMA 3L2UA 3MEVA 3MEUA 4C0DC 1M5Q1 5F5WA 4D6WA 3LYIA 4Y91A 3L4GA 2ZIOA 3CXCS 4EO4A 4M78A 3MQZA 3VYHB 3VQVA 2XGTA 5CKFA 3L2QA 1Q7YU 2CS7A 3CMEA 4HT4A 3GP8A 1I8FA 1YHQT 2QEXA 2EAYA 5C6SA 4X34A 3QJYA 2E5AA 4FIBA 2DXTA 1SESA 4IUTA 1Q81U 3CC7T 2XDBA 1X54A 2DU5A 4YRIA 2RHYA 2O01E 2L8DA 2VUBA 4F7UA 1N6AA 3X24B 5IAYA 3GF5A 3O8VA 4X5OA 2VXFA 3V7SA 4Q6GA 4QVDA 3CBMA 3RMSA 2LT1A 3ME9A 4C92F 5CIUA 3L2RA 3RKYA 1VQPA 2ZPEB 3I55A 3J7AF 2ARTA 4RMOA 3FEOA 4EMKC 1VQOA 2NLUA 1VUBA 1EVLA 3RUXA 1VQNT 4TQDA 1VQ8T 3HRKA 3G71T 4M78F 1X2HA 1I4K1 3HXVA 3SDZA 2ZPBB 3VUBA 5KCOA 5ELNA 2RHXA 2LX9A 1FWZA 1YHQA 4J6YA 2M16A 3P8TA 1I5LA 2AKWA 1WJQA 2AKWB 2ZT7A 3CC7A 1LYLA 1KQSA 3HRIA 4F7UF 3OS1A 2K3YA 1Q7YC 4M7DG 2F5TX 1YJWT 4M7AD 2A3LA 1W2BS 3X25B 3MF2A 5DLOA 1UB4A 5C52B 3X20B 1Q81C 1D3BA 5ELOA 5CCAA 4KBMB 1SERA 2VGMA 4DPGA 4P74A 4RCBA 3QTCA 1KOGA 2EJGA 4P75C 3RL6A 4XTUA 4JS4A 4LDYA 2RI5A 1PYSA 4RG8A 1VQNA 3NELA 1VQ8A 4OLFA 1B8AA 3RMQA 3QKJA 5LJ3f 3G71A 3QSUA 2DTOA 4C92E 2JVVA 4MZMA 5IN1A 2DEQA 4WI1A 4JDSA 3GOXA 4M77A 1BKBA 4CH4A 4M77B 3M59A 2KAFA 4J8OA 4M75A 5GAMe 1YJNT 1NNHA 3LH0A 4M75B 2PMFA 3KBGA 1UEBA 2PVGB 2QHTA 3CCVT 3RIRA 1YJWA 5GMKj 3OYLA 3A7AA 5A0LA 3TEHA 3R07A 3WVEB 3M58A 4P71C 2GFAA 2FHDA 2XIDA 4RG2A 4B9XA 2LQKA 3VQYA 4RQEA 1KQ1A 5GMKm 3UGTA 3C95A 4BI3A 2CZ1B 2QQAA 4AH6A 2QXFA 4HCCA 4IUUA 2X4JA 1JJCB 4PJOA 4LVLA 5CKHA 1BI2A 1NJ5A 5GAMh 1ZBXA 4X9CA 3RESA 3AHUA 2Y90A 2YLBA 3H8ZA 2XDDA 3OS0A 2CJBA 1YJ9T 4J83A 3CCRT 2QQBA 3NEMA 3JB9J 2XICA 3VKIA 3E9FA 1YFSA 4UP8A 1JJ2S 2D0QB 4B9WA 2E1HA 4Y28E 2Q5IA 4H2UA 3OYIA 3T9NA 1KC8U 1USYA 4M75F 3HXXA 4OB0B 4MMKA 1YJNA 4BB7A 3JCMd 3C12A 3GNFB 2P0LA 4C92G 4PLIA 4H2SA 1WYDA 1QVFA 3FRNA 3CCVA 4OVAA 1N8RU 4BACA 3QYGB 2LC4A 5CQYA 1KD1U 3DKMA 2LCCA 3SD4A 1VIEA 1LOJA 1W2BA 3A8HB 1N9WA 1OZ3A 5GMKi 2CJ9A 1YBYA 2DZCA 3FDRA 1BI1A 1YGBA 3EFRA 4A4GA 1TH7A 4JS5A 4PJOF 4KR3A 5AYFA 3HKSA 4UP9A 1NPPA 4WJ3M 2OTLT 3CPWS 2L89A 5LJ5j 1E22A 3QYHB 4QVZA 1YJ9A 1DJ7B 3CCRA 5CR2A 2QA4T 4YRMA 2ZTGA 3RGLA 1N9SA 3CPFA 5GAOn 2DIQA 3LLRA 3HXUA 3OD1A 4M7DA 4YCWA 1OI1A 4M7DB 5J3BA 2C06A 4OF1A 2ZPFB 4MZPA 2Q7GA 3JCMW 4XU0A 2WACA 3LWHA 3ZBDA 3PT9A 3GIBA 3TEGA 4E51A 4K88A 2DXUA 3NTIA 4OMFB 4P3NA 3HRTA 4M77D 1RIQA 1W66A 3V7CA 3LW5E 4C0GA 2DU7A 5LJ3g 2ZCEA 3G1ZA 4H2TA 3W3SA 4M75D 1YB3A 1Y96A 2XU8A 4ZGDB 4JRQA 1Y96B 2LTOA 1QVPA 5GAN8 2G3RA 1HXDA 4UPAA 3L2WA 2LT4A 2OTLA 4ZTFA 5GAOm 2K5LA 3ASKA 1UGPB 4JRPA 2R57A 3QO8A 3JB9F 3OYJA 4II1A 1N27A 5C53B 5GAOl 2QA4A 4J6XA 2RK2A 4GY5A 4K86A 4XEMA 4HT8A 2DK3A 1JJ2A 3C4SA 3BDLA 3PIPA 4OP0A 4YRTA 3CCJT 5CK9A 4G84A 1XNIA 3MP8A 1MHNA 4PJOD 1LNXA 4BE2A 4BY6C 4G85A 1SRYA 3QUIA 1Z7NA 5HY6A 4BI4A 1VQMT 2YRVA 3HPWA 5A2QE 2DXCA 5KE2A 3INZA 1Z7MA 4XAXB 4UC4A 3QNEA 1YFTA 3KXTA 3LWIA 2PMEA 1XQHA 4JRIA 3RKWA 2AMCB 4H2XB 4J7IA 2E41A 3VYGA 3JSCA 2FB7A 1JB0E 3SB2A 3JCMX 1E1OA 3A31A 4XTXA 5LJ3j 3M55A 2ARSA 4C8QE 2E5QA 2VC8A 2F5KA 5D6WA 4CH5A 3HP9A 1OZ2A 1U1TA 2D6FA 3CPWA 3P8DA 4EPCA 2KSSA 2DIGA 3LGFA 1NPRA 1QE0A 2ZZFA 2RHIA 1P92A 4M7AF 4YYEA 3VQWA 3OS5A 3X26B 5LJ3d 3CCJA 1MGQA 4RDXA 5LJ5f 3CMAT 1ADJA 3G7ZA 3OB9A 1LJOA 2EIFA 4C92C 1U8RA 2ZCFB 4OGCA 1WQWA 5FRNA 1Y71A 3JCMJ 1YCYA 2EJFA 1VQMA 3JB9D 5K1PA 2HQXA 3S3MA 4YRFA 2Q7HA 1OYXA 4WF2A 3OYNA 3OW2S 3WVDB 2OTJT 1KQ2A 3UT1A 4YROA 1H4QA 3OSVA 3IG2A 3PFSA 4M7DD 4HVCA 3HY1A 3SWNB 4EMKA 2JN0A 4EMKB 3MF1A 3UFGA 2VXEA 3M5AA 1Y7XA 1K73U 2ZZDA 1Y07A 1UGRB 4PNOA 4FM4B 3SWNC 4YP0A 1IL2A 5KE3A 1WLEA 1G5VA 3E9IA 1NYQA 4O2DA 1I81A 2DZ9A 4EMHA 4N0AC 4J6WA 4LDWA 1M90C 2QHSA 2C8MA 4C8QG 2DXBA 4LVIA 3M53A 3HXYA 3A74A 3CMAA 4H2WA 4ATOA 2DVEA 4L6V5 2RJFA 3CEYA 2RO0A 2PQWA 2CZ6B 5FROA 4N4GA 3G4ST 3A7RA 3TUPA 2MWPA 2PVDB 2MAMA 4MDXA 2BKDN 1BIAA 1ASZA 2DTIA 4M7AE 2OTJA 1M9SA 4TVAB 4A4FA 4KUDK 1K9MU 2VGNA 2HQEA 2MWOA 1PSEA 3M57A 4XTZA 4YRKA 4P75A 2K5IA 2MI6A 2VV5A 3QDRB 4P5NA 1G51A 3JCMg 3HFOA 3JRZA 4LD6A 4LD9K 4C5HA 4BDYA 3A8OB 2EL9A 2L5QA 3HXZA 4P73C 3OYAA 3JCMP 2K3XA 1BIBA 5I2SA 5CAIA 1K73C 5GANj 2HNIA 3VQXA 2CJAA 4H02A 3CXCA 1Q86U 2R58A 1WNLA 4HWTA 2KDSA 4CH3A 4YDQA 2WSEE 4JLGA 3BFMA 1G3SA 3LX7A 1J5WA 3OYHA 3S6WA 2RHUA 2D9TA 3JB9H 4JLIA 3G4SA 4BW9A 4NCXA 4P71A 1IREB 2QQ9A 2V8IA 4XU3A 4M78E 2EWNA 4C0ZA 1B7YB 1FYFA 1VIFA 5J26A 1G5HA 3QHSA 3OW2A 2XDPA 2ZNIA 4P72C 4E7IA 4NS5A 4YPFA 3OS2A 2LDMA 5I2MA 2ALYA 2ALYB 4M7AG 2CYZB 2RJDA 2E10A 4VUBA 2RD1A 1VQLT 1S72T 1NZ9A 5LJ5g 4WJ4A 1E24A 3M4YA 4F7UE 1JJCA 2ZZGA 1QF6A 4YRPA 1K9MC 4J15A 2E12A 4J7FA 2E64A 3KFUA 4A4KA 3QO7A 2VYTA 4M77F 3CCUT 2JNGA 2HAXA 1NJ1A 2RH2A 4BI8B 5D6XA 2Y4XA 3JAME 1KMNA 3HRSA 4ZGJB 1Q86C 3CCMT 4FU6A 2PU9B 5LJ3h 5CQXA 2P0QA 1B70B 4LDVA 4R55A 1H4TA 3BJUA 3A8LB 4ELYC 4L5GA 2BIVA 4YRJA 3FLGA 1NJIC 3CC2T 2G4CA 4CH6A 4M78G 5I21A 1YFRA 2A8EA 2QHVA 3ICAA 2ZGWA 4BDZA 1VQLA 4PG3A 1S72A 3QO3A 3DB3A 1BBUA 2WSFE 4C8QB 3FJPA 2MF2A 11ASA 4YRRA 3PCOA 3PCOB 4ZIBA 3M4QA 4DA4A 3L42A 4C8QC 2RB6A 2BUDA 2X4XA 3QBYA 4F7UG 1V29B 3R6OA 3OBYA 5A0DA 4FT2A 3CCUA 5HK3A 4YRQA 2RJCA 3P8YA 2M9UA 4C5IA 4QQDA 2M1HA 2LNVA 4PKCC 2NS6A 1XOVA 5GANf 4A53A 3L2ZA 5LJ5d 3I56T 4EDUA 3QZ5B 4HWPA 1M1GA 4RMFA 2EQJA 1M4ZA 3CCMA 5FU6C 3NTKA 3CC4T 3A5ZA 4V2SA 4M77E 3A5ZB 3QZ9B 2HBPA 3OMCA 2V8JA 4QVCA 4HKEA 4M75E 2ZZEA 2ARUA 3CC2A 2KMTA 3LC0A 1GGMA 2PVOB 3OYGA 4HA8A 2DD5A 5DLQE 3UPUA 5A0GA 4YRGA 2DD4A 1QP2A 3KUFA 4O5VA 3LSSA 2ZR2A 5GAOr 3IKLA 4ME7A 3LGLA 2H3JA 3DLLA 3CCST 5KH6A 3DB4A 4A4HA 4ZTJA 2K2VA 3VU3C 1IZ6A 4ZTZB 3TEEA 4L59A 1B34B 4HT9A 1W4SA 3MEWA 3OYFA 4YRNA 4BY6B 2DO3A 2F69A 3QPHA 2XTIA 3CCQT 4MMLA 4M7DF 4H2YA 4PJOE 2P4TA 1VQ7T 1VQKT 3TU4K 4P3OA 1YIJT 2CZ7B 4XTWA 1VQ4T 3GPLA 2ZNJA 3I56A 4DQ2A 4CS4A 4PLLA 2JZ2A 4R56A 3ZEHA 2EJ9A 5GAOp 4IUQA 3MO8A 1X75C 3CC4A 2P0PA 3MCAB 2K4YA 1O9SA 4TQFA 3HFZB 5GMKe 1QW1A 4KT0E 5GAMj 3VBBA 3DLMA 4M7AC 4ZGEB 1KQSS 2X35A 2AMCA 4UP7A 1G5IA 4XK8E 4H2XA 1ATIA 4IUVA 4HCBA 3QJ6A 1M90U 3GNGA 4M77G 4LNSA 4TWAA 2KY9A 4ZTUB 4YRSA 5IT9E 2DTHA 2EYQA 4M75G 1FXXA 3CCSA 2Q5HA 4MDWA 4ELZC 3JCMe 2PUOB 4XTVA 3JCMQ 4C92A 3JB9I 4RKUE 4C92B 1VQ6T 1HTTA 4XQ3A 3M56A 1BI0A 1BI3A 1EQRA 3V8KA 3HRUA 1NYRA 4Q5WA 4LVKA 3CCQA 4HWOA 5KNNA 2ZT8A 3NTHA 3URGA 5K1XA 4C8QD 5GMKh 1VQ7A 1VQKA 2C7IA 1YIJA 3RF1A 3MEAA 1VQ4A 3WQZA 1X01A 3VJPA 2ZINA 3CCLT 3L4GB 2DDZA 4Q15A 4M78B 1EVKA 2ZT6A 1NJ6A 5HKCA 2EFIA 3ZFJA 5D6YA 1ZHIA 3BY7A 1KG1A 4PJOG 1QP3A 2QDYB 3EAEA 4M7DE 2JTFA 4TVWA 1G3YA 4TVYA 4M78C 4YCVA 4OB2B 1GXIE 1H641 3SWNA 3JCMh 1RL2A 1YITT 4NL2A 3UH0A 4N4HA 3PTAA 4N0AA 1UGQB 5HGQA 4QQGA 4F7UB 2I2LA 1Q82C 3N5BB 4A54A 3RERA 2E6ZA 2DJZA 5GANg 4KQEA 2DAQA 2YHTA 3V7RA 4IURA 3HFNA 5LJ5e 2LRQA 5FLXE 1VQ6A 3HY0A 1WGSA 5KCHA 2P5IA 3HFVA 5GAOq 4OB3B 2WSCE 4GLKA 3F70A 1SSFA 2ODRC 1B76A 3LSQA 2AHJB 3JCMV 3E19A 4FL6A 3CCLA 2EQUA 2JTMA 1ASYA 2EQKA 2QQSA 2R5AA 4OGEA 2GQVA 4TVAA 2CZ0B 4H2VA 4C5EA 2RA2A 2ZIMA 1EOVA 4IUPA 1WJSA 4LVMA 3JB9G 1QVFS 5LJ5h 1QVGS 3MEYA 1YITA 4IKFA 3NENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1T A;  3QO7 A;  4P3N A;  4M77 D;  4P73 A;  4M77 F;  1RIQ A;  1W66 A;  3V7C A;  3HXW A;  4Y91 A;  5GAM f;  3L4G A;  2DU7 A;  2ZIO A;  4EO4 A;  5LJ3 g;  2ZCE A;  4M78 A;  3G1Z A;  4H2T A;  3W3S A;  4M75 D;  1YB3 A;  2RM4 A;  3VQV A;  1NJ1 A;  2XGT A;  1Y96 A;  1Y96 B;  2RHS A;  1KMN A;  2RHS B;  5GAN 3;  1I8F A;  5GAN 8;  2EAY A;  2E5A A;  1D3B B;  1HXD A;  2DXT A;  4UPA A;  1SES A;  5LJ3 h;  4CS2 A;  1B70 B;  5GAO m;  1H4T A;  3BJU A;  1X54 A;  3QO8 A;  3JB9 F;  2DU5 A;  1N9R A;  5C53 B;  5GAO l;  2QTX A;  4YRI A;  4YRJ A;  4F7U A;  4J6X A;  3JCM b;  2G4C A;  4CH6 A;  4M78 G;  5I21 A;  1PYS B;  1YFR A;  4K86 A;  4XEM A;  4HT8 A;  2QHV A;  3ICA A;  2ZGW A;  1HC7 A;  4X5O A;  4PG3 A;  3QO3 A;  2VXF A;  4OP0 A;  3V7S A;  3V8J A;  4P74 C;  4YRT A;  4Q6G A;  4QVD A;  1BBU A;  4P72 A;  3REX A;  4C8Q B;  4G84 A;  3FJP A;  11AS A;  4PJO D;  5GAN d;  4C92 D;  1B7Y A;  1LNX A;  4C92 F;  3RKY A;  4YRR A;  4G85 A;  1SRY A;  3QUI A;  3PCO A;  1Z7N A;  3PCO B;  4ZIB A;  4CS3 A;  4TTV A;  3M4Q A;  2ART A;  3CMQ A;  4XU2 A;  4EMK C;  1KMM A;  4C8Q C;  3ERR A;  2RB6 A;  4F7U G;  1EVL A;  1C0A A;  4M77 C;  3RUX A;  3INZ A;  4TQD A;  1Z7M A;  3HRK A;  1L0W A;  3QNE A;  4YRQ A;  4M78 D;  1YFT A;  3M4P A;  3P8Y A;  4M78 F;  1X2H A;  1I4K 1;  2CIM A;  3E9H A;  3HXV A;  2PME A;  4M75 C;  4JRI A;  3RKW A;  3RAC A;  2AMC B;  4PHC A;  4H2X B;  5GAN f;  4A53 A;  5LJ3 e;  3TEH B;  2E41 A;  5ELN A;  3L2Z A;  2FB7 A;  3SB2 A;  5LJ5 d;  3JCM X;  1E1O A;  3A31 A;  1SET A;  4J6Y A;  4XTX A;  4HWP A;  3P8T A;  5LJ3 j;  4RMF A;  1I5L A;  3UGQ A;  2ARS A;  4C8Q E;  3REU A;  2VC8 A;  2AKW A;  3A32 A;  2AKW B;  2Q7E A;  5GMK l;  2ZT7 A;  4CH5 A;  3A5Z A;  1U1T A;  4V2S A;  4M77 E;  1VQZ A;  4XTY A;  1LYL A;  5E3I A;  1M8V A;  3HRI A;  4QVC A;  4PJO B;  4F7U F;  4M75 E;  2ZZE A;  2ARU A;  4YRL A;  3HSB A;  3LC0 A;  3BDU A;  1ADY A;  4M7D G;  1QE0 A;  4M7A D;  5GAN 6;  1GGM A;  2ZZF A;  4RCC A;  4M7A F;  4YYE A;  4EMG A;  4HA8 A;  3VQW A;  5LJ3 d;  3MF2 A;  4RDX A;  1MGQ A;  5LJ5 f;  1ADJ A;  2ODR D;  4YRG A;  2YLC A;  4PJO C;  5C52 B;  3LSS A;  2ZR2 A;  1LJO A;  3EFS A;  4C92 C;  5GAO r;  3IKL A;  1D3B A;  1BBW A;  5ELO A;  4EX5 A;  1WQW A;  3JCM c;  2ZT5 A;  1SER A;  1B70 A;  4DPG A;  4NL3 A;  3JCM J;  4P74 A;  1YCY A;  3VU3 C;  2EJF A;  3JB9 D;  5K1P A;  4L87 A;  4ZTZ B;  4RCB A;  4YRF A;  3QTC A;  2Q7H A;  1KOG A;  2EJG A;  4P75 C;  3RL6 A;  3I7F A;  4WF2 A;  2IY5 A;  2IY5 B;  4XTU A;  1B34 B;  1KQ2 A;  1PYS A;  4HT9 A;  2CGH A;  3NEL A;  4YRN A;  4OLF A;  1B8A A;  4YRO A;  1H4Q A;  3PZC A;  2XTI A;  3IG2 A;  5LJ3 f;  4MML A;  3QSU A;  4P3P A;  4M7D D;  4HVC A;  1USY C;  4M7D F;  4H2Y A;  3HY1 A;  2DTO A;  3SWN B;  4PJO E;  4C92 E;  4EMK A;  4HWS A;  4C8Q A;  4YCU A;  1U1S A;  2JN0 A;  4EMK B;  4P3O A;  3MF1 A;  3QO5 A;  2DEQ A;  3UFG A;  2VXE A;  4XTW A;  4WI1 A;  2ZNJ A;  4DQ2 A;  4CS4 A;  4M77 A;  4CH4 A;  4M77 B;  2EJ9 A;  5GAO p;  2QHU A;  4PNO A;  3SWN C;  4M75 A;  5GAM e;  4YP0 A;  1NNH A;  4M75 B;  1WU7 A;  2PMF A;  1IL2 A;  4TQF A;  1WLE A;  5C51 B;  3HFZ B;  5GMK e;  3E9I A;  1NYQ A;  4O2D A;  1I81 A;  2DZ9 A;  4EMH A;  4N0A C;  5GAM j;  2QHT A;  4J6W A;  3VBB A;  3RIR A;  2QHS A;  3P8V A;  4M7A C;  5GMK j;  3A7A A;  2C8M A;  4C8Q G;  2AMC A;  4UP7 A;  1G5I A;  4YRE A;  4H2X A;  1ATI A;  3HXY A;  3TEH A;  2DKG A;  3R07 A;  3A74 A;  4H2W A;  4P71 C;  5GAN 2;  5GAN 4;  4M77 G;  4LNS A;  4TWA A;  3VQY A;  1X2G A;  4RQE A;  1KQ1 A;  5GAM g;  4ZTU B;  4YRS A;  2DVE A;  5GMK m;  3UGT A;  2DTH A;  4XEO A;  4M75 G;  4JRK A;  3PGG A;  2Q5H A;  4AH6 A;  3FIF A;  3HTZ A;  4NOY A;  3A7R A;  2J3L A;  3TUP A;  3JCM e;  1H4S A;  1JJC B;  3DSQ A;  1HK9 A;  4XTV A;  4PJO A;  3JCM Q;  4C92 A;  1BIA A;  3JB9 I;  2DTI A;  4M7A E;  1ASZ A;  1WQ7 A;  4C92 B;  1HTT A;  4TVA B;  4XQ3 A;  1NJ5 A;  5GAM h;  3AHU A;  4X9C A;  3RES A;  2K57 A;  2E3C A;  3A7U A;  2Y90 A;  2YLB A;  1EQR A;  2DQ0 A;  3V8K A;  1NYR A;  4HWO A;  5KNN A;  4M7D C;  2ZT8 A;  2ZXF A;  2CJB A;  5K1X A;  4C8Q D;  5GMK h;  1NJ2 A;  4C8Q F;  3NEM A;  3JB9 J;  2I4M A;  4XTZ A;  4YRK A;  2C7I A;  1YFS A;  4P75 A;  3RF1 A;  4UP8 A;  4K87 A;  3WQZ A;  2E1H A;  1X01 A;  5GAN 7;  2Q5I A;  2ZIN A;  3L4G B;  1G51 A;  2DDZ A;  3JCM g;  3HFO A;  4H2U A;  4Q15 A;  4M78 B;  1EVK A;  2ZT6 A;  4HWR A;  1NJ6 A;  1USY A;  4M75 F;  3HXX A;  4RQF A;  1X55 A;  4MMK A;  3BY7 A;  4JUV A;  3JCM d;  4PJO G;  2P0L A;  4C92 G;  1EIY A;  2EL9 A;  1B34 A;  1EIY B;  5GAN e;  3HXZ A;  3IKM B;  4H2S A;  4P73 C;  1WYD A;  4M7D E;  3JCM P;  1BIB A;  4TVW A;  5CAI A;  2DQ3 A;  4TVY A;  4M78 C;  4YCV A;  2J3M A;  1H64 1;  3SWN A;  5GAN j;  3JCM h;  2HNI A;  12AS A;  2ZR3 A;  3VQX A;  2CJA A;  4H02 A;  4NL2 A;  3UH0 A;  1WNL A;  4HWT A;  1WPY A;  4CH3 A;  4YDQ A;  1LOJ A;  4N0A A;  4BWA A;  3BFM A;  5HGQ A;  2I4O A;  1N9W A;  4F7U B;  5GMK i;  5GAN 5;  2I2L A;  4A54 A;  3RER A;  2CJ9 A;  4M7A A;  1J5W A;  4YRC A;  3JCM f;  2I4L A;  3JB9 H;  4M7A B;  3BW1 A;  4X9D A;  2DZC A;  3L1A A;  2DJZ A;  5GAN g;  4KQE A;  4JLI A;  2YHT A;  3V7R A;  1YGB A;  3EFR A;  4BW9 A;  4NCX A;  3HFZ A;  3HFN A;  4P71 A;  3NET A;  1TH7 A;  2FYK A;  4PJO F;  4XU3 A;  4M78 E;  5LJ5 e;  2EWN A;  2I4N A;  4KR3 A;  1B7Y B;  1NJ8 A;  4XU1 A;  1FYF A;  1JRI A;  3HY0 A;  3FB9 A;  4UP9 A;  1G5H A;  4WJ3 M;  3QHS A;  2P5I A;  3HFV A;  5LJ5 j;  4KR2 A;  1E22 A;  1EFW A;  5GAO q;  2ZNI A;  3V8L A;  5GAN h;  4P72 C;  2ODR C;  1B76 A;  3M4G A;  5DY9 A;  3LSQ A;  2E65 A;  4YPF A;  2RHQ A;  3A5Y A;  3JCM V;  2RHQ B;  2ALY A;  3IAL A;  4YRM A;  2ZTG A;  1JBM A;  4M7A G;  2ALY B;  2E10 A;  1X56 A;  3RGL A;  1N9S A;  2RD1 A;  5GAO n;  5GAM d;  3HXU A;  3OD1 A;  4M7D A;  4YCW A;  4J5Y A;  5LJ5 g;  4M7D B;  4WJ4 A;  3RKX A;  1ASY A;  1E24 A;  1JJC A;  4F7U E;  2ZZG A;  1QF6 A;  4YRP A;  1H4V B;  2Q7G A;  3JCM W;  4XU0 A;  4TVA A;  4J15 A;  4H2V A;  3GIB A;  2RA2 A;  2ZIM A;  1EOV A;  3TEG A;  4E51 A;  2E64 A;  3JB9 G;  3KFU A;  5LJ5 h;  3MEY A;  4K88 A;  1M5Q 1;  2DXU A;  3NEN A;  5F5W A; 
#chains in the Genus database with same CATH topology
 1E1T A;  3CBP A;  1AHJ B;  4P73 A;  2L2P A;  3HXW A;  3TCJ A;  2JOY A;  5GAM f;  2PZ1 A;  1R8O B;  2P4R A;  2KYM A;  3MHX A;  4HCZ A;  2L3S A;  2DL5 A;  1M3C A;  1PC0 A;  5M9O A;  4AG1 C;  2RM4 A;  3CD6 T;  2KR3 A;  2CP6 A;  2JS2 A;  2R5M A;  3MET A;  2L0A A;  2RHS A;  4BE0 A;  4J9B A;  2RHS B;  4BD3 A;  2KQW A;  5GAN 3;  3C94 A;  2RQW A;  1NE8 A;  2KK4 A;  1D3B B;  2KT8 A;  1WJR A;  1E7O A;  1ACM B;  1M1K U;  1QLY A;  1FX7 A;  1VQ9 T;  4CS2 A;  2K3B A;  8AT1 B;  1FMW A;  4DOW A;  2JMA A;  2K5F A;  2DA9 A;  3Q1J A;  1N9R A;  4HXJ A;  4B6M A;  2M0O A;  2QTX A;  1D0Y A;  3JCM b;  2AZV A;  4JJD A;  1PYS B;  1PKS A;  3A8G B;  3A8M B;  4E7J A;  5CKB A;  1HC7 A;  2X4W A;  1X2K A;  3V8J A;  4P74 C;  1NJI U;  3OY9 A;  2MK5 A;  1NEB A;  4FT4 A;  4P72 A;  3REX A;  2XG8 D;  2FO0 A;  1VQL Q;  2L3R A;  5GAN d;  4C92 D;  1B7Y A;  1ZX6 A;  1S72 Q;  4KRT A;  3S3O A;  1G3W A;  1TUG B;  4PL6 A;  4X1V A;  2XD0 A;  3NFC A;  1WXB A;  4CS3 A;  4TTV A;  5J39 A;  3HHT B;  2HD0 A;  3PNW C;  1UG1 A;  3CMQ A;  1VQ5 T;  4XU2 A;  1KMM A;  1T3S A;  3ERR A;  2DRK A;  2IG0 A;  2MYS A;  1C0A A;  4M77 C;  3FJ5 A;  1L0W A;  3PIO A;  2LX7 A;  4M78 D;  3M4P A;  3OYY A;  4N4I A;  2O88 A;  2CIM A;  4CI0 C;  3E9H A;  4M75 C;  2EKO A;  2RK1 A;  3RAC A;  3CCU Q;  3G6E T;  4PHC A;  1EIF A;  2CRE A;  3CD6 A;  5LJ3 e;  3TEH B;  2O4X A;  3VUZ A;  3PVQ A;  4E7H A;  2O4X B;  4JPB W;  2XKO C;  2LVM A;  4E7K A;  3OA6 A;  3GBQ A;  3CCE T;  1AD5 A;  1EFN A;  1SET A;  2LP5 A;  2GF7 A;  2HBW A;  2J05 A;  3REU A;  3UGQ A;  1VQ9 A;  3EH1 A;  5C0M A;  3A32 A;  3PMI A;  4CC3 A;  2Q7E A;  5GMK l;  2CP0 A;  1VQZ A;  3OMG A;  3TSW A;  3P8B B;  3OYC A;  3CCM Q;  4XTY A;  5E3I A;  2E70 A;  4AFU C;  4O6J A;  1X6O A;  4J9H A;  1M8V A;  2GFU A;  3NGP A;  4PJO B;  1BYM A;  1K8A U;  1ZUK A;  4YRL A;  3HSB A;  3BDU A;  1ADY A;  5GAN 6;  4RCC A;  3M54 A;  3P8H A;  3OYE A;  1SPK A;  1SF9 A;  4QKU A;  4EMG A;  2LQ8 A;  3CC2 Q;  1WHJ A;  2ODR D;  2YLC A;  2F2V A;  2MPX C;  3UDC A;  1M1K C;  2LJ3 A;  2RQV A;  4PJO C;  3EFS A;  1RI0 A;  1BBW A;  4EX5 A;  4A4E A;  2KBT A;  4BUG A;  2M51 A;  3JCM c;  2ZT5 A;  2QI2 A;  1VYV A;  5KYX A;  1B70 A;  1ZLM A;  2ZPH B;  5KYX B;  4NL3 A;  2F1L A;  1VQ5 A;  4L87 A;  2V8K A;  1RAI B;  3SFM A;  3EGD A;  3I7F A;  2IY5 A;  3TVT A;  1O75 A;  4QQ6 A;  2IY5 B;  2HSP A;  2FZC B;  2KXC A;  2CGH A;  2EQM A;  2CUB A;  3S3N A;  1GCQ A;  4KUL A;  1QVG A;  2JTE A;  1AZE A;  3HL8 A;  3PZC A;  3J80 E;  1SG5 A;  2K2M A;  2QK0 A;  4P3P A;  3ER0 A;  3TRE A;  1USY C;  3PMT A;  4JJN K;  4HWS A;  1N5Z A;  2KEA A;  4C8Q A;  3G6E A;  4YCU A;  2OX7 A;  1U1S A;  2VB6 A;  2X3W D;  2QQR A;  3QO5 A;  3MP6 A;  3CCE A;  5GJV B;  3VV0 A;  4KUI A;  2J6F A;  2QHU A;  4RTT A;  4BE1 A;  3I56 Q;  2DIL A;  2MMP A;  5EG2 A;  3OSS C;  3E2U A;  2AKK A;  1YI2 T;  1WU7 A;  4ORZ A;  2DET A;  1KHI A;  5C51 B;  1UGV A;  4FSS A;  3X28 B;  4GLM A;  1R0B G;  2JMC A;  2CP3 A;  5CKE A;  3CC4 Q;  3P8V A;  4ZNX A;  3GLX A;  4YRE A;  2KVQ G;  2XI9 A;  2DKG A;  2PNI A;  5FU6 B;  1OQK A;  2E4H A;  2GCX A;  4TVR A;  2D0N A;  4KGV B;  2HL3 A;  2IVW A;  3REA B;  5GAN 2;  5GAN 4;  1QVG P;  1X2G A;  2A7Y A;  1ZSG A;  2ECZ A;  5GAM g;  1H3Z A;  2C0I A;  4XEO A;  3J81 E;  2HZY A;  2DMO A;  4JRK A;  1RI9 A;  3PGG A;  4JJB A;  2CH4 W;  3OQ5 A;  2COW A;  1BCO A;  3FIF A;  3TQ7 P;  2CKK A;  1K0S A;  1QKX A;  3HTZ A;  2RHZ A;  4NOY A;  1K8A C;  2J3L A;  1H4S A;  3DSQ A;  4C0F A;  1HK9 A;  1FYN A;  3EG3 A;  2XHC A;  4LNP A;  3CCS Q;  4LDX A;  3HTR A;  1ZQ1 A;  1WQ7 A;  2ZPI B;  5CVI A;  2K57 A;  2E3C A;  3A7U A;  2DQ0 A;  3I9Q A;  4M7D C;  1KHC A;  2ZXF A;  4E47 A;  1PSF A;  2RJE A;  1NJ2 A;  4C8Q F;  4MZT A;  2DPP B;  2I4M A;  4YTL A;  1IHW A;  3CCQ Q;  1G3T A;  1UGS B;  1JXM A;  4ESR A;  1KC8 C;  4K87 A;  2FPE A;  3PE0 A;  1VQ7 Q;  5GAN 7;  2RI2 A;  3E1S A;  4RUG A;  1VQK Q;  4FW1 A;  5KYY A;  1VQ4 Q;  5KYY B;  4HWR A;  2HSE B;  4RQF A;  1X55 A;  3OBW A;  3L2V A;  2XK0 A;  4JUV A;  2NUP B;  1B3Q A;  1M1F A;  3MP1 A;  4DOV A;  1YI2 A;  1N8R C;  2FL7 A;  3UWN A;  1EIY A;  1B34 A;  5HK0 A;  1EIY B;  5GAN e;  3QII A;  3IKM B;  2OAU A;  4E7Z A;  1AWX A;  2LCL A;  2B8A A;  3WXM B;  1KD1 C;  2DQ3 A;  2P0K A;  4K11 A;  2J3M A;  2F2W A;  2DE0 X;  2GQI A;  2EGE A;  3MJX A;  3E9G A;  12AS A;  4FSX A;  2PUK B;  2ZR3 A;  2ATC B;  1KJW A;  1M3A A;  1WPY A;  5KYN A;  4BWA A;  4E7L A;  5L8R E;  2I4O A;  4AFQ C;  3CBO A;  2J6K A;  4ZN3 A;  5GAN 5;  4KH1 B;  4QW2 A;  3UA7 A;  4M7A A;  4YRC A;  1E6H A;  3JCM f;  2I4L A;  2QYZ A;  3BW1 A;  4PJJ A;  4X9D A;  4M7A B;  3L1A A;  5CKD A;  1IGU A;  3HFZ A;  3CME T;  1Q82 U;  2KXD A;  2X51 A;  3H6Z A;  3NET A;  4CRI A;  3M9Q A;  4WTO B;  5KYU A;  5LL6 S;  2FYK A;  1BK2 A;  2QEX T;  1XTD A;  4HVW A;  2I4N A;  1NJ8 A;  4XU1 A;  4LVJ A;  1JRI A;  1AOJ A;  3QXE B;  3FB9 A;  1TSF A;  3OYD A;  1TOV A;  4KR2 A;  2RI3 A;  4Z02 A;  3G1J A;  1EFW A;  3V8L A;  2O31 A;  1VQ6 Q;  1X2Q A;  2JUF A;  5GAN h;  5KYW A;  3M4G A;  5DY9 A;  2E65 A;  5FU7 B;  2X4Y A;  5KYW B;  1WHL A;  2ED1 A;  2FVU A;  2RHQ A;  3A5Y A;  2KYB A;  4ZN1 A;  5DM7 R;  4PFZ A;  2RHQ B;  3IAL A;  1JBM A;  1X56 A;  5CO7 A;  2E6N A;  2CSI A;  1VYU A;  3A1P A;  1D0X A;  5GAM d;  3OYK A;  5GJW B;  4C5G A;  4J5Y A;  2Z0W A;  3RKX A;  3OYB A;  5FU7 C;  5FRM A;  4LDU A;  3CCL Q;  1H4V B;  9ATC B;  4C0D B;  1X6G A;  1PD0 A;  1T3L A;  1VQP T;  1OOT A;  2Y4Y A;  2ZPG B;  1KSW A;  2HQH A;  3TSZ A;  3I55 T;  4OB1 B;  3QG1 A;  3FC3 A;  3EG9 B;  1VQO T;  2D8H A;  3OYM A;  3L2U A;  2LZ6 B;  3MEV A;  3MEU A;  4C0D C;  1CKA A;  1M5Q 1;  5F5W A;  1PRL C;  4D6W A;  2KE9 A;  2SRC A;  3LYI A;  3EHR A;  4Y91 A;  1X6B A;  3L4G A;  2ZIO A;  3CXC S;  4EO4 A;  1M90 R;  4M78 A;  1D1A A;  3MQZ A;  3VYH B;  3VQV A;  2XGT A;  5CKF A;  3L2Q A;  1Q7Y U;  2CS7 A;  3CME A;  1V1C A;  4HT4 A;  3GP8 A;  1I8F A;  1SHF A;  1YHQ T;  2QEX A;  2EAY A;  4Z8A A;  5C6S A;  4X34 A;  3QJY A;  1NBE B;  2E5A A;  1GBQ A;  3A98 A;  4FIB A;  2DXT A;  2QAS A;  1SES A;  2BE9 B;  1ZSZ A;  1WA7 A;  4IUT A;  1Q81 U;  3CC7 T;  2XDB A;  1X54 A;  1Y0M A;  2DU5 A;  4D8K A;  4YRI A;  2RHY A;  3I35 A;  2O01 E;  2L8D A;  5IXF A;  2VUB A;  4F7U A;  1N6A A;  3X24 B;  5IAY A;  1TS9 A;  1LVK A;  3GF5 A;  1U3O A;  3O8V A;  4X5O A;  3H0F A;  2VXF A;  1BU1 A;  3V7S A;  2CP7 A;  3EFO A;  4PJL A;  4Q6G A;  1RAH B;  1FMK A;  2AK5 A;  4QVD A;  3EFO B;  3CBM A;  3RMS A;  2DER A;  2LT1 A;  3ME9 A;  2FPF A;  3NHN A;  1CSK A;  4C92 F;  5CIU A;  3L2R A;  3RKY A;  1VQP A;  1JEG A;  2ZPE B;  1E6G A;  1S1N A;  3VS5 A;  3I55 A;  3J7A F;  2ART A;  1TUC A;  2LNH B;  4RMO A;  3FEO A;  4AT1 B;  4EMK C;  1VQO A;  1RAF B;  2L3P A;  2NLU A;  1VUB A;  1UJY A;  1EVL A;  1G83 A;  3RUX A;  1VQN T;  4TQD A;  1VQ8 T;  3HRK A;  1QCO A;  1XJW B;  4PJM A;  5D7U A;  1I0C A;  3G71 T;  2XMF A;  4M78 F;  2RF0 A;  1X2H A;  1I4K 1;  3HXV A;  1K73 R;  3SDZ A;  2VAS A;  2ZPB B;  3VUB A;  5KCO A;  2SEM A;  1Z9Q A;  2YXY A;  5ELN A;  3IQL A;  2RHX A;  2LX9 A;  2RMO A;  4HVV A;  1FWZ A;  4LUE A;  4WCI A;  1YHQ A;  2CH4 A;  3UF4 A;  2FRW A;  4J6Y A;  3CD6 Q;  2M16 A;  3P8T A;  1I5L A;  2J06 A;  4QT7 A;  2AKW A;  1NYG A;  1UTI A;  2YUO A;  1WJQ A;  2AKW B;  1WHM A;  1RAA B;  2ZT7 A;  3CC7 A;  2K9G A;  1C6V X;  1VQ9 Q;  1LYL A;  1KQS A;  4CC7 A;  1MNE A;  3HRI A;  4F7U F;  2DL7 A;  3OS1 A;  2K3Y A;  1QWF A;  1Q7Y C;  4M7D G;  2BZY A;  2F5T X;  1K9A A;  1YJW T;  4M7A D;  1HYO A;  2A3L A;  1W2B S;  4KGX B;  3X25 B;  3MF2 A;  1EX4 A;  4E6R A;  5DLO A;  1UB4 A;  5C52 B;  3X20 B;  1Q81 C;  2LQW A;  1D3B A;  5ELO A;  5CCA A;  4KBM B;  2C0O A;  4CC4 B;  1SER A;  2VGM A;  4JZ4 A;  4DPG A;  4P74 A;  2FZK B;  4RCB A;  1K1Z A;  3QTC A;  4IIM A;  1KOG A;  2EJG A;  1K9M R;  4P75 C;  3RL6 A;  4XTU A;  4JS4 A;  4LDY A;  3RBB B;  2RI5 A;  1PYS A;  1VQ5 Q;  4RG8 A;  1VQN A;  3NEL A;  1VQ8 A;  4OLF A;  1B8A A;  3RMQ A;  2DJQ A;  3QKJ A;  5LJ3 f;  3G71 A;  3QSU A;  2DTO A;  1KQS P;  4C92 E;  2JVV A;  1IGQ A;  4MZM A;  5IN1 A;  2DEQ A;  4WI1 A;  4JDS A;  3GOX A;  4M77 A;  1BKB A;  2NYS A;  4CH4 A;  4M77 B;  3G6E Q;  3M59 A;  2JW4 A;  2DM1 A;  1RAD B;  1WX6 A;  3CCE Q;  2KAF A;  4J8O A;  4M75 A;  5GAM e;  1YJN T;  2DBK A;  1NNH A;  3LH0 A;  4M75 B;  2PMF A;  3KBG A;  1UEB A;  1TXQ A;  4RTW A;  2PVG B;  2QHT A;  3CCV T;  1Q86 R;  1TU0 B;  3RIR A;  1YJW A;  5GMK j;  3OYL A;  3A7A A;  5A0L A;  1H92 A;  2HCK A;  1KIK A;  3TEH A;  4AFS C;  3R07 A;  4J9F A;  3WVE B;  3EH2 A;  2KNB B;  3M58 A;  2EBP A;  4P71 C;  2GFA A;  2FHD A;  2XID A;  4RG2 A;  4B9X A;  2LQK A;  3VQY A;  4RQE A;  1KQ1 A;  3KFV A;  1NJI R;  1YFN A;  5GMK m;  3C95 A;  3UGT A;  2ABL A;  4BI3 A;  2FRY A;  1JO8 A;  2CZ1 B;  2QQA A;  4AH6 A;  1QCN A;  2AT1 B;  2M0Y A;  1I07 A;  2QXF A;  4HCC A;  4IUU A;  2X4J A;  1JJC B;  1UDL A;  4PJO A;  4LVL A;  3H0I A;  1BBZ A;  5CKH A;  1BI2 A;  1ABO A;  1NJ5 A;  5GAM h;  1ZBX A;  4X9C A;  3RES A;  3AHU A;  1YP5 A;  1ZA1 B;  2A08 A;  2Y90 A;  2YLB A;  3H8Z A;  2DEU A;  2XDD A;  4J9G A;  3OS0 A;  2CJB A;  4F04 B;  1YJ9 T;  4J83 A;  3CCR T;  2QQB A;  3NEM A;  3JB9 J;  2XIC A;  3VKI A;  3E9F A;  1YFS A;  4UP8 A;  1JJ2 S;  2D0Q B;  4B9W A;  1J3T A;  2COY A;  2E1H A;  4Y28 E;  2Q5I A;  4F17 A;  4H2U A;  3OYI A;  1GFD A;  3T9N A;  1KC8 U;  1USY A;  4M75 F;  3HXX A;  4OB0 B;  4MMK A;  4RTU A;  4OMN A;  1YJN A;  4BB7 A;  1W1F A;  3JCM d;  3C12 A;  3GNF B;  2P0L A;  1M2V A;  4C92 G;  5L23 A;  2V26 A;  1M2V B;  4PLI A;  1HJD A;  4H2S A;  4FW2 A;  1WYD A;  1QVF A;  1YI2 Q;  3FRN A;  3CCV A;  4DEY A;  4OVA A;  1N8R U;  2E3H A;  2RQU A;  2D1X A;  4BAC A;  1RAB B;  2X9H A;  5IXB A;  2J6O A;  4LXC A;  1H3H A;  3QYG B;  1I5O B;  2BTT A;  2LC4 A;  5CQY A;  1KD1 U;  3DKM A;  2LCC A;  3SD4 A;  3EG0 A;  5FWB A;  2OTL Q;  1VIE A;  1LOJ A;  1W2B A;  1OU9 A;  3A8H B;  1N9W A;  4PFP A;  1OZ3 A;  2EQI A;  5GMK i;  2GGR A;  1JQQ A;  2QGG A;  2CJ9 A;  1YBY A;  2VVK A;  1K0X A;  1AWO A;  2DZC A;  3FDR A;  1BI1 A;  1YGB A;  2EGC A;  2HKN A;  3EFR A;  4A4G A;  1TH7 A;  4JS5 A;  2D8J A;  4PJO F;  4KR3 A;  5AYF A;  2FG0 A;  3HKS A;  2QAZ A;  4UP9 A;  2FEI A;  1NPP A;  4WJ3 M;  2OTL T;  3CPW S;  2L89 A;  1PNJ A;  5LJ5 j;  1E22 A;  3QYH B;  4QVZ A;  1YJ9 A;  1DJ7 B;  1QVF P;  3CCR A;  2E5K A;  1KK7 A;  5CR2 A;  2QA4 T;  4YRM A;  2ZTG A;  1MUZ A;  1YN8 A;  3RGL A;  1NM7 A;  2YSQ A;  1N9S A;  3CPF A;  5GAO n;  2DIQ A;  3LLR A;  3HXU A;  3OD1 A;  4M7D A;  4YCW A;  1OI1 A;  4M7D B;  1PKT A;  5IH2 A;  2QDL A;  5J3B A;  1W2B P;  4RTV A;  2C06 A;  4OF1 A;  2ZPF B;  4MZP A;  2Q7G A;  2DFU A;  3JCM W;  4XU0 A;  4D8D A;  1YWP A;  1TTH B;  2WAC A;  3LWH A;  2EYY A;  3ZBD A;  3PT9 A;  2RN8 A;  1M2O A;  3GIB A;  2K6D A;  3TEG A;  2AZS A;  4E51 A;  2YT6 A;  3EGX B;  2RQR A;  2MOX A;  4K88 A;  2DXU A;  2RQT A;  1G8X A;  3NTI A;  4OMF B;  1OPK A;  4P3N A;  1UJ0 A;  3HRT A;  4M77 D;  1RIQ A;  1W66 A;  3V7C A;  3LW5 E;  3EGU A;  4C0G A;  2DU7 A;  5LJ3 g;  2ZCE A;  2NUT B;  3G1Z A;  4H2T A;  3W3S A;  4M75 D;  4DBR A;  4GBQ A;  4LUD A;  1YB3 A;  2BE7 D;  2NUP A;  2LQN A;  1Y96 A;  2XU8 A;  4ZGD B;  2OJ2 A;  4JRQ A;  2DBM A;  1Y96 B;  2LTO A;  2QG9 B;  1QVP A;  1UHC A;  1ZBJ A;  5GAN 8;  1LCK A;  2G3R A;  1HXD A;  1V76 A;  4UPA A;  3BE3 A;  3CME Q;  1W6X A;  3L2W A;  2LT4 A;  1SRM A;  2OTL A;  4ZTF A;  2QEX Q;  5GAO m;  2K5L A;  3ASK A;  1UGP B;  4JRP A;  2R57 A;  3QO8 A;  3JB9 F;  2K7A A;  3OYJ A;  4II1 A;  2OAW A;  1N27 A;  3RR6 A;  5C53 B;  5GAO l;  4RTY A;  3VS2 A;  4J9I A;  2AIR B;  2QA4 A;  2KRM A;  4J6X A;  2RK2 A;  4GY5 A;  2DVJ A;  4K86 A;  4XEM A;  1VOM A;  4HT8 A;  2DK3 A;  1JJ2 A;  3C4S A;  2MCN A;  1OPL A;  3BDL A;  3PIP A;  4OP0 A;  4YRT A;  1NYF A;  3CCJ T;  5CK9 A;  2G6F X;  4G84 A;  1AWW A;  1XNI A;  3MP8 A;  1MHN A;  4PJO D;  1LNX A;  4BE2 A;  1VYT A;  4BY6 C;  4G85 A;  1RLQ C;  1SRY A;  3QUI A;  3O5Z A;  1Z7N A;  4FYV B;  5HY6 A;  4BI4 A;  2EGA A;  1VQM T;  1VQP Q;  2YRV A;  3HPW A;  3LH5 A;  2DYB A;  3M0T A;  5A2Q E;  2YDL A;  3I55 Q;  1WXU A;  2DXC A;  5KE2 A;  1VQO Q;  3INZ A;  1Z7M A;  4XAX B;  4UC4 A;  3QNE A;  1ARK A;  2MIO A;  1YFT A;  3KXT A;  2I0N A;  3LWI A;  2PME A;  1RUW A;  1XQH A;  4JRI A;  3RKW A;  1H8K A;  1PHT A;  2AMC B;  1Z9Z A;  4H2X B;  4J7I A;  2EYW A;  2E41 A;  1RLP C;  3JSC A;  3VYG A;  2FB7 A;  1JB0 E;  3SB2 A;  8ATC B;  3JCM X;  4ANJ A;  1JJ2 P;  1E1O A;  3A31 A;  4XTX A;  1WLP B;  5LJ3 j;  4OMQ A;  2LCS A;  3M55 A;  1Q82 R;  2ARS A;  4C8Q E;  2E5Q A;  2VC8 A;  1ABQ A;  2F5K A;  3EG9 A;  5D6W A;  1YHQ Q;  4CH5 A;  1F1B B;  4OML A;  3HP9 A;  1OZ2 A;  1U1T A;  2D6F A;  2HEQ A;  3MKD A;  3CPW A;  3P8D A;  4EPC A;  2GBQ A;  2KSS A;  1K76 A;  3CC7 Q;  2DIG A;  3REB B;  3LGF A;  4HCK A;  1NPR A;  1QE0 A;  2ZZF A;  2RHI A;  1P92 A;  2ZAE A;  4M7A F;  5I11 A;  4YYE A;  2YWW A;  1TUD A;  2O9V A;  1CKB A;  3VQW A;  3OS5 A;  1PWT A;  5LJ3 d;  3X26 B;  1SHG A;  1MGQ A;  3CCJ A;  4RDX A;  5LJ5 f;  3CMA T;  1ADJ A;  3UAT A;  2YUQ A;  3G7Z A;  3OB9 A;  4R0K A;  2GTO A;  1LJO A;  2EIF A;  4C92 C;  1U8R A;  2ZCF B;  4OGC A;  1WQW A;  5FRN A;  1NG2 A;  1Y71 A;  1WZO A;  3JCM J;  4EIK A;  1YCY A;  2EJF A;  1A0N B;  1VQM A;  3JB9 D;  5K1P A;  2HQX A;  2HDA A;  3S3M A;  4YRF A;  2Q7H A;  1OYX A;  1NLP C;  4WF2 A;  3ULR B;  3OYN A;  3OW2 S;  3WVD B;  2OTJ T;  1KQ2 A;  3UT1 A;  4YRO A;  1H4Q A;  1QCF A;  3OSV A;  3IG2 A;  1VA7 A;  3M0Q A;  3PFS A;  4M7D D;  4HVC A;  1D09 B;  1GL5 A;  3CPW P;  3HY1 A;  3SWN B;  5HCK A;  4EMK A;  1VQN Q;  1VQ8 Q;  2JN0 A;  4EMK B;  3MF1 A;  3UFG A;  2VXE A;  3G71 Q;  3M5A A;  1Y7X A;  2JXB A;  1K73 U;  1M8M A;  2DLP A;  3R6N A;  2ZZD A;  2LMJ A;  1Y07 A;  1MMG A;  1UGR B;  4PNO A;  4FM4 B;  3SWN C;  4YP0 A;  1B7T A;  4KH0 B;  2A0F B;  1IL2 A;  5KE3 A;  1WLE A;  2FPD A;  3VRZ A;  1G5V A;  3E9I A;  1NYQ A;  4O2D A;  1I81 A;  2DZ9 A;  4EMH A;  4N0A C;  4J6W A;  1Q81 R;  1U5S A;  5IHI A;  1YNZ A;  2YUP A;  1FMV A;  4LDW A;  2JM9 A;  1M90 C;  2QHS A;  2CT3 A;  2YRC A;  4CC2 A;  2C8M A;  4C8Q G;  2DXB A;  3I5S A;  4LVI A;  3M53 A;  3HXY A;  3H9N A;  3A74 A;  3CMA A;  4H2W A;  4ATO A;  1YJW Q;  2KRO A;  3EG2 A;  1Y57 A;  2DVE A;  4L6V 5;  1SSH A;  2DL4 A;  1NLO C;  2RJF A;  3CEY A;  2RO0 A;  2PQW A;  1M30 A;  4LN2 A;  2CZ6 B;  4RTX A;  5FRO A;  1OUL A;  4N4G A;  1M3B A;  3G4S T;  1MMN A;  3A7R A;  3TUP A;  2MWP A;  2PVD B;  2MAM A;  2GNC A;  4MDX A;  2BKD N;  1BIA A;  1ASZ A;  2DTI A;  4JJC A;  4M7A E;  1IRX A;  2OTJ A;  1M9S A;  4TVA B;  3QWX X;  2CSQ A;  4A4F A;  4KUD K;  2IPO B;  1K9M U;  2J7I A;  2VGN A;  1Q95 G;  2HQE A;  2MWO A;  3MPU B;  1PSE A;  1OX8 A;  3M57 A;  4XTZ A;  4YRK A;  1GRI A;  4P75 A;  2K5I A;  1HSQ A;  2CUD A;  2MI6 A;  1UFF A;  1WHK A;  2VV5 A;  3QDR B;  4F16 A;  4P5N A;  1G51 A;  3JCM g;  3HFO A;  1HD3 A;  4HVU A;  3JRZ A;  4Z89 A;  1GBR A;  1WIE A;  1B07 A;  4LD6 A;  4LD9 K;  4C5H A;  4BDY A;  3A8O B;  2EL9 A;  2L5Q A;  1MND A;  3HXZ A;  4P73 C;  1AEY A;  3OYA A;  1YJN Q;  3SHW A;  3JCM P;  2K3X A;  1BIB A;  5I2S A;  5CAI A;  1QMC A;  2EVR A;  2B86 A;  2V1R A;  1K73 C;  1ZUY A;  5GAN j;  2HNI A;  3VQX A;  2CJA A;  4H02 A;  3CXC A;  3CCV Q;  1Q86 U;  2R58 A;  1SEM A;  1WNL A;  4HWT A;  2KDS A;  1UUE A;  2VKN A;  4CH3 A;  4YDQ A;  2WSE E;  4JLG A;  2AKL A;  3BFM A;  2PTK A;  5EC7 A;  1MV3 A;  1G3S A;  3LX7 A;  1RAG B;  1J5W A;  3OYH A;  3S6W A;  2RHU A;  2D9T A;  3JB9 H;  1GCP A;  4JLI A;  3G4S A;  1PD1 A;  3UA6 A;  4BW9 A;  4NCX A;  1RAE B;  2F2X A;  4P71 A;  1M1K R;  1IRE B;  2QQ9 A;  1MMD A;  2V8I A;  4XU3 A;  4M78 E;  2EWN A;  4C0Z A;  1B7Y B;  1FYF A;  2JS0 A;  3JV3 A;  1VIF A;  2GTJ A;  5J26 A;  1G5H A;  3QHS A;  3OW2 A;  1WFW A;  2XDP A;  1QKW A;  2ZNI A;  5IHN A;  4P72 C;  4E7I A;  1MV0 B;  4NS5 A;  4YPF A;  2EPD A;  3OS2 A;  2LDM A;  5I2M A;  4DBH A;  4M4Z A;  2ALY A;  2ALY B;  1YJ9 Q;  4M7A G;  2CYZ B;  2RJD A;  2E10 A;  3CCR Q;  4VUB A;  2RD1 A;  1VQL T;  3CXC P;  1ZUU A;  2QGF B;  2DYI A;  1S72 T;  1NZ9 A;  5LJ5 g;  4WJ4 A;  1D1C A;  3QWY A;  4OMO A;  1E24 A;  3M4Y A;  4F7U E;  1JJC A;  2ZZG A;  1QF6 A;  4YRP A;  1K9M C;  1UEC A;  1QWE A;  3M0U A;  4LE9 A;  5ECA A;  4J15 A;  2E12 A;  2A36 A;  1YWO A;  4J7F A;  2E64 A;  4DBQ A;  2DL8 A;  3KFU A;  4A4K A;  2RNA A;  3QO7 A;  2VYT A;  3OW2 P;  4M77 F;  3CCU T;  3AT1 B;  3I5R A;  2JNG A;  2HAX A;  1WYX A;  2QTV A;  1NJ1 A;  3VRY A;  2RH2 A;  1BB9 A;  4BI8 B;  5D6X A;  2Y4X A;  3JAM E;  1KMN A;  3HRS A;  4ZGJ B;  1OEB A;  2ENM A;  4FCY A;  1Q86 C;  3CCM T;  1U06 A;  4FU6 A;  2H8H A;  2PU9 B;  5LJ3 h;  5CQX A;  2KI7 A;  2P0Q A;  1B70 B;  4LDV A;  4RTZ A;  4R55 A;  4KGZ B;  1H4T A;  3BJU A;  2LJ1 A;  3A8L B;  1K8A R;  3QDF A;  2HL5 C;  1WI7 A;  4ELY C;  4F14 A;  4L5G A;  2BIV A;  3EGD B;  3EG1 A;  4YRJ A;  3FLG A;  1NJI C;  3CC2 T;  2G4C A;  4CH6 A;  4M78 G;  5I21 A;  1YFR A;  2A8E A;  4PJN A;  3CQT A;  2KGT A;  2QHV A;  2CP2 A;  3ICA A;  2ZGW A;  4BDZ A;  1VQL A;  1R77 A;  4PG3 A;  2JM8 A;  1S72 A;  3QO3 A;  2QA4 Q;  3DB3 A;  3THK A;  1BBU A;  4FYW B;  2WSF E;  4C8Q B;  1SRL A;  3FJP A;  2MF2 A;  11AS A;  3U23 A;  1KC8 R;  1X27 A;  2L3Q A;  4YRR A;  1GCQ C;  4J9E A;  3PCO A;  3H0H A;  3PCO B;  4ZIB A;  3M4Q A;  4DA4 A;  2BZ8 A;  3M0S A;  3L42 A;  4C8Q C;  2RB6 A;  2BUD A;  2X4X A;  1N8R R;  3RNJ A;  5AT1 B;  2DL3 A;  3QBY A;  4F7U G;  1V29 B;  1PM3 A;  3R6O A;  1OX9 A;  3OBY A;  4AG2 C;  5A0D A;  4FT2 A;  3CCU A;  2EW3 A;  5HK3 A;  1KD1 R;  4YRQ A;  2RJC A;  3P8Y A;  2M9U A;  4C5I A;  3VS1 A;  4QQD A;  2M1H A;  1EZZ B;  2LNV A;  4PKC C;  2NS6 A;  3D7S B;  1XOV A;  5GAN f;  4A53 A;  3L2Z A;  4IIO A;  2M02 A;  5LJ5 d;  3I56 T;  4EDU A;  1SKU B;  3QZ5 B;  4HWP A;  1M1G A;  4RMF A;  2EQJ A;  2KRS A;  1M4Z A;  3CCM A;  4AFZ C;  1D1B A;  3EGX A;  2COZ A;  5FU6 C;  3NTK A;  3CC4 T;  3A5Z A;  4V2S A;  1PRM C;  4M77 E;  3A5Z B;  1QQJ A;  2DX1 A;  3QZ9 B;  2HBP A;  3OMC A;  2V8J A;  4QVC A;  4HKE A;  4M75 E;  2ZZE A;  2ARU A;  1AWJ A;  3CC2 A;  2NUT A;  2KMT A;  3LC0 A;  2JT4 A;  2PVO B;  4AMC A;  1GGM A;  3OYG A;  4JZ3 A;  4HA8 A;  2DD5 A;  5DLQ E;  3UPU A;  5A0G A;  4A63 B;  4YRG A;  2DD4 A;  1QP2 A;  3KUF A;  4O5V A;  3LSS A;  2ZR2 A;  5GAO r;  3PVL A;  1M27 C;  3IKL A;  3CCJ Q;  4ME7 A;  3LGL A;  2H3J A;  4FYY B;  1UE9 A;  1YIJ Q;  3DLL A;  3CCS T;  5KH6 A;  3DB4 A;  4A4H A;  1JXO A;  4ZTJ A;  5FW9 A;  2K2V A;  3VU3 C;  1TWB A;  4J9D A;  1IZ6 A;  4ZTZ B;  2BZX A;  2FZG B;  1RAC B;  1AZG B;  2V1Q A;  3TEE A;  2EYZ A;  4PK4 A;  2DNU A;  4L59 A;  1B34 B;  1VQM Q;  4HT9 A;  1IXD A;  3VS3 A;  1W4S A;  3MEW A;  4DBF A;  3OYF A;  4YRN A;  4BY6 B;  2DO3 A;  2F69 A;  3QPH A;  2XTI A;  3CCQ T;  4MML A;  1NEG A;  4M7D F;  4H2Y A;  4PJO E;  2P4T A;  1VQ7 T;  1VQK T;  3TU4 K;  2CP5 A;  4P3O A;  6AT1 B;  1YIJ T;  2CZ7 B;  4XTW A;  1VQ4 T;  3GPL A;  2ZNJ A;  1I1J A;  2HKQ B;  4DQ2 A;  3I56 A;  1D0Z A;  4CS4 A;  2ROL A;  1C1A A;  3H41 A;  4PLL A;  2JZ2 A;  4R56 A;  3ZEH A;  2W0Z A;  2EJ9 A;  5GAO p;  4IUQ A;  3MO8 A;  1X75 C;  3CC4 A;  1UHF A;  2P0P A;  3MCA B;  3SEM A;  2K4Y A;  1O9S A;  2EYX A;  4TQF A;  3EHQ A;  3HFZ B;  5GMK e;  1QW1 A;  2C0T A;  4KT0 E;  2DRM A;  5GAM j;  5KYU B;  2OI3 A;  3VBB A;  2JJ9 A;  3ZL7 C;  3DLM A;  4M7A C;  4ZGE B;  1KQS S;  1T0H A;  2X35 A;  2AMC A;  3M0P A;  1G5I A;  4XK8 E;  4H2X A;  1ATI A;  4UP7 A;  4IUV A;  4HCB A;  3QJ6 A;  1M90 U;  2RPN A;  3GNG A;  2X3X D;  4M77 G;  4J9C A;  4LNS A;  1LPL A;  4TWA A;  2KY9 A;  4ZTU B;  4YRS A;  5IT9 E;  1K4U S;  2DTH A;  3CMA Q;  4Z88 A;  2EYQ A;  4M75 G;  1FXX A;  1PCX A;  3CCS A;  2Q5H A;  1OU8 A;  3NMZ C;  3RDV A;  1GFC A;  4MDW A;  1MMA A;  4ELZ C;  3JCM e;  2PUO B;  4XTV A;  3JCM Q;  4C92 A;  3JB9 I;  4RKU E;  4C92 B;  1WHH A;  1VQ6 T;  1HTT A;  4XQ3 A;  2CT4 A;  3M56 A;  1BI0 A;  1BI3 A;  1EQR A;  3V8K A;  3HRU A;  4OMP A;  1NYR A;  4Q5W A;  4LVK A;  3CCQ A;  4HWO A;  5KNN A;  1KFZ A;  2ZT8 A;  2OTJ Q;  3VS0 A;  3NTH A;  3URG A;  4FYX B;  5K1X A;  4C8Q D;  2LJ0 A;  5GMK h;  1VQ7 A;  1VQK A;  2C7I A;  1YIJ A;  1X69 A;  3RF1 A;  3MEA A;  1VQ4 A;  3VS6 A;  5IHK A;  3WQZ A;  1X01 A;  1ZA2 B;  1WXT A;  3VJP A;  2E3I A;  2O9S A;  1YIT Q;  2ZIN A;  2ESW A;  3CCL T;  3L4G B;  2DDZ A;  4Q15 A;  4M78 B;  1EVK A;  2ZT6 A;  1NJ6 A;  5HKC A;  2EFI A;  3ZFJ A;  5D6Y A;  1ZHI A;  3BY7 A;  1KG1 A;  1WHG A;  4PJO G;  1QP3 A;  2A28 A;  2QDY B;  3EAE A;  4M7D E;  2JTF A;  4TVW A;  2A37 A;  1G3Y A;  2NUZ A;  5FWC A;  4TVY A;  3M0R A;  4M78 C;  4YCV A;  4OB2 B;  1GXI E;  1H64 1;  3SWN A;  3JCM h;  1ZSZ B;  4E2F B;  1RL2 A;  1YIT T;  4NL2 A;  1PG5 B;  2ED0 A;  3UH0 A;  2O2O A;  4N4H A;  3PTA A;  3VS7 A;  2CDT A;  4N0A A;  2IIM A;  1UGQ B;  3NPF A;  5HGQ A;  1T0J A;  2ROT A;  4QQG A;  3VS4 A;  4F7U B;  7AT1 B;  1AT1 B;  2I2L A;  1Q82 C;  1Q7Y R;  4E7S A;  3N5B B;  2VWF A;  4A54 A;  3RER A;  1ZSZ C;  1IB8 A;  1TG0 A;  2E6Z A;  5I22 A;  4OMM A;  2DJZ A;  5GAN g;  4KQE A;  1W70 A;  2DAQ A;  2YHT A;  3V7R A;  2YRD A;  4IUR A;  1YCS B;  3HFN A;  2NWM A;  1X43 A;  2DF6 A;  1R0C B;  5LJ5 e;  2LRQ A;  4PFO A;  5FLX E;  3G4S Q;  1VQ6 A;  3HY0 A;  1WGS A;  5KCH A;  2P5I A;  3HFV A;  1JU5 C;  5GAO q;  4OB3 B;  2WSC E;  4GLK A;  3F70 A;  1SSF A;  2ODR C;  1B76 A;  2P84 A;  3LSQ A;  2AHJ B;  3JCM V;  1AVZ C;  2W10 A;  4DEX A;  3E19 A;  2KRN A;  1IHV A;  4FL6 A;  3C0C A;  3CCL A;  1C0M A;  2EKH A;  2EQU A;  2JTM A;  1ASY A;  2EQK A;  2QQS A;  2R5A A;  2K79 A;  1WDX A;  4OGE A;  2GQV A;  4TVA A;  2CZ0 B;  1IO6 A;  2H3E B;  4H2V A;  4C5E A;  1OV3 A;  2RA2 A;  2ZIM A;  1EOV A;  4IUP A;  1BCM A;  4Y92 A;  1WJS A;  4LVM A;  2KT1 A;  3JB9 G;  2HMA A;  1QVF S;  2YUN A;  5LJ5 h;  1QVG S;  3MEY A;  1YIT A;  1G2B A;  4IKF A;  3NEN A; 
#chains in the Genus database with same CATH homology
 1E1T A;  3CBP A;  1AHJ B;  4P73 A;  3HXW A;  3TCJ A;  2JOY A;  5GAM f;  1R8O B;  3MHX A;  4HCZ A;  5M9O A;  2RM4 A;  3CD6 T;  2R5M A;  3MET A;  2RHS A;  4BE0 A;  2RHS B;  4BD3 A;  2KQW A;  5GAN 3;  3C94 A;  1NE8 A;  2KK4 A;  1D3B B;  1WJR A;  1M1K U;  1FX7 A;  1VQ9 T;  4CS2 A;  4DOW A;  2K5F A;  3Q1J A;  1N9R A;  2M0O A;  2QTX A;  3JCM b;  1PYS B;  3A8G B;  3A8M B;  4E7J A;  5CKB A;  1HC7 A;  2X4W A;  3V8J A;  4P74 C;  1NJI U;  3OY9 A;  4FT4 A;  4P72 A;  3REX A;  2XG8 D;  2L3R A;  5GAN d;  4C92 D;  1B7Y A;  3S3O A;  1G3W A;  4PL6 A;  2XD0 A;  3NFC A;  4CS3 A;  4TTV A;  5J39 A;  3HHT B;  2HD0 A;  3PNW C;  3CMQ A;  1VQ5 T;  4XU2 A;  1KMM A;  3ERR A;  2IG0 A;  1C0A A;  4M77 C;  1L0W A;  3PIO A;  4M78 D;  3M4P A;  3OYY A;  4N4I A;  2CIM A;  4CI0 C;  3E9H A;  4M75 C;  2EKO A;  2RK1 A;  3RAC A;  3G6E T;  4PHC A;  1EIF A;  3CD6 A;  5LJ3 e;  3TEH B;  2O4X A;  3VUZ A;  4E7H A;  3CCE T;  2O4X B;  4E7K A;  2XKO C;  2LVM A;  3OA6 A;  1SET A;  2GF7 A;  3UGQ A;  3REU A;  1VQ9 A;  5C0M A;  3A32 A;  3PMI A;  2Q7E A;  5GMK l;  1VQZ A;  3OMG A;  3OYC A;  3P8B B;  4XTY A;  5E3I A;  2E70 A;  4O6J A;  1X6O A;  1M8V A;  2GFU A;  4PJO B;  1BYM A;  1K8A U;  4YRL A;  3HSB A;  1ADY A;  3BDU A;  5GAN 6;  4RCC A;  3M54 A;  3P8H A;  3OYE A;  4EMG A;  2LQ8 A;  2ODR D;  2YLC A;  3UDC A;  1M1K C;  4PJO C;  3EFS A;  1RI0 A;  1BBW A;  4EX5 A;  4A4E A;  4BUG A;  3JCM c;  2ZT5 A;  2QI2 A;  1B70 A;  2ZPH B;  4NL3 A;  1VQ5 A;  4L87 A;  2V8K A;  3SFM A;  3I7F A;  2IY5 A;  1O75 A;  4QQ6 A;  2IY5 B;  2CGH A;  2EQM A;  3S3N A;  4KUL A;  1QVG A;  3HL8 A;  3PZC A;  3J80 E;  4P3P A;  3ER0 A;  3TRE A;  1USY C;  3PMT A;  4JJN K;  4HWS A;  4C8Q A;  3G6E A;  4YCU A;  1U1S A;  2QQR A;  3QO5 A;  3MP6 A;  3CCE A;  3VV0 A;  4KUI A;  2QHU A;  4BE1 A;  2MMP A;  5EG2 A;  3OSS C;  1YI2 T;  1WU7 A;  1KHI A;  5C51 B;  3X28 B;  5CKE A;  3P8V A;  3GLX A;  4YRE A;  2KVQ G;  2XI9 A;  2DKG A;  5FU6 B;  2GCX A;  4TVR A;  2IVW A;  5GAN 2;  5GAN 4;  1X2G A;  2A7Y A;  5GAM g;  1H3Z A;  4XEO A;  3J81 E;  4JRK A;  3PGG A;  3OQ5 A;  3FIF A;  2CKK A;  3HTZ A;  2RHZ A;  4NOY A;  1K8A C;  2J3L A;  1H4S A;  3DSQ A;  4C0F A;  1HK9 A;  2XHC A;  4LDX A;  1ZQ1 A;  1WQ7 A;  2ZPI B;  5CVI A;  2K57 A;  2E3C A;  3A7U A;  2DQ0 A;  4M7D C;  1KHC A;  2ZXF A;  4E47 A;  1PSF A;  2RJE A;  1NJ2 A;  4C8Q F;  4MZT A;  2DPP B;  2I4M A;  4YTL A;  1G3T A;  1UGS B;  1KC8 C;  4K87 A;  5GAN 7;  2RI2 A;  3E1S A;  4HWR A;  4RQF A;  1X55 A;  3OBW A;  3L2V A;  2XK0 A;  4JUV A;  4DOV A;  1M1F A;  3MP1 A;  1YI2 A;  1N8R C;  2FL7 A;  3UWN A;  1EIY A;  1B34 A;  5HK0 A;  1EIY B;  5GAN e;  3QII A;  3IKM B;  2OAU A;  2LCL A;  2B8A A;  3WXM B;  1KD1 C;  2DQ3 A;  2P0K A;  2J3M A;  3E9G A;  12AS A;  4FSX A;  2PUK B;  2ZR3 A;  1WPY A;  4BWA A;  4E7L A;  5L8R E;  2I4O A;  3CBO A;  4ZN3 A;  5GAN 5;  4QW2 A;  4M7A A;  4YRC A;  3JCM f;  2I4L A;  4M7A B;  3BW1 A;  4X9D A;  3L1A A;  5CKD A;  3HFZ A;  3CME T;  1Q82 U;  3H6Z A;  3NET A;  4CRI A;  3M9Q A;  5LL6 S;  2FYK A;  2QEX T;  1XTD A;  2I4N A;  1NJ8 A;  4XU1 A;  4LVJ A;  1JRI A;  3QXE B;  3FB9 A;  3OYD A;  4KR2 A;  2RI3 A;  4Z02 A;  1EFW A;  3V8L A;  5GAN h;  2JUF A;  3M4G A;  5DY9 A;  2E65 A;  5FU7 B;  2X4Y A;  2FVU A;  2RHQ A;  3A5Y A;  4ZN1 A;  5DM7 R;  2RHQ B;  3IAL A;  1JBM A;  1X56 A;  5CO7 A;  2E6N A;  5GAM d;  3OYK A;  4C5G A;  4J5Y A;  3RKX A;  3OYB A;  5FU7 C;  5FRM A;  4LDU A;  1H4V B;  4C0D B;  1VQP T;  2Y4Y A;  2ZPG B;  3I55 T;  4OB1 B;  3QG1 A;  3FC3 A;  1VQO T;  3OYM A;  3L2U A;  3MEV A;  3MEU A;  4C0D C;  1M5Q 1;  5F5W A;  4D6W A;  3LYI A;  4Y91 A;  3L4G A;  2ZIO A;  3CXC S;  4EO4 A;  4M78 A;  3MQZ A;  3VYH B;  3VQV A;  2XGT A;  5CKF A;  3L2Q A;  1Q7Y U;  2CS7 A;  3CME A;  4HT4 A;  3GP8 A;  1I8F A;  1YHQ T;  2QEX A;  2EAY A;  5C6S A;  4X34 A;  3QJY A;  2E5A A;  4FIB A;  2DXT A;  1SES A;  4IUT A;  1Q81 U;  3CC7 T;  2XDB A;  1X54 A;  2DU5 A;  4YRI A;  2RHY A;  2O01 E;  2L8D A;  2VUB A;  4F7U A;  1N6A A;  3X24 B;  5IAY A;  3GF5 A;  3O8V A;  4X5O A;  2VXF A;  3V7S A;  4Q6G A;  4QVD A;  3CBM A;  3RMS A;  2LT1 A;  3ME9 A;  4C92 F;  5CIU A;  3L2R A;  3RKY A;  1VQP A;  2ZPE B;  3I55 A;  3J7A F;  2ART A;  4RMO A;  3FEO A;  4EMK C;  1VQO A;  2NLU A;  1VUB A;  1EVL A;  3RUX A;  1VQN T;  4TQD A;  1VQ8 T;  3HRK A;  3G71 T;  4M78 F;  1X2H A;  1I4K 1;  3HXV A;  3SDZ A;  2ZPB B;  3VUB A;  5KCO A;  5ELN A;  2RHX A;  2LX9 A;  1FWZ A;  1YHQ A;  4J6Y A;  2M16 A;  3P8T A;  1I5L A;  2AKW A;  1WJQ A;  2AKW B;  2ZT7 A;  3CC7 A;  1LYL A;  1KQS A;  3HRI A;  4F7U F;  3OS1 A;  2K3Y A;  1Q7Y C;  4M7D G;  2F5T X;  1YJW T;  4M7A D;  2A3L A;  1W2B S;  3X25 B;  3MF2 A;  5DLO A;  1UB4 A;  5C52 B;  3X20 B;  1Q81 C;  1D3B A;  5ELO A;  5CCA A;  4KBM B;  1SER A;  2VGM A;  4DPG A;  4P74 A;  4RCB A;  3QTC A;  1KOG A;  2EJG A;  4P75 C;  3RL6 A;  4XTU A;  4JS4 A;  4LDY A;  2RI5 A;  1PYS A;  4RG8 A;  1VQN A;  3NEL A;  1VQ8 A;  4OLF A;  1B8A A;  3RMQ A;  3QKJ A;  5LJ3 f;  3G71 A;  3QSU A;  2DTO A;  4C92 E;  2JVV A;  4MZM A;  5IN1 A;  2DEQ A;  4WI1 A;  4JDS A;  3GOX A;  4M77 A;  1BKB A;  4CH4 A;  4M77 B;  3M59 A;  2KAF A;  4J8O A;  4M75 A;  5GAM e;  1YJN T;  1NNH A;  3LH0 A;  4M75 B;  2PMF A;  3KBG A;  1UEB A;  2PVG B;  2QHT A;  3CCV T;  3RIR A;  1YJW A;  5GMK j;  3OYL A;  3A7A A;  5A0L A;  3TEH A;  3R07 A;  3WVE B;  3M58 A;  4P71 C;  2GFA A;  2FHD A;  2XID A;  4RG2 A;  4B9X A;  2LQK A;  3VQY A;  4RQE A;  1KQ1 A;  5GMK m;  3UGT A;  3C95 A;  4BI3 A;  2CZ1 B;  2QQA A;  4AH6 A;  2QXF A;  4HCC A;  4IUU A;  2X4J A;  1JJC B;  4PJO A;  4LVL A;  5CKH A;  1BI2 A;  1NJ5 A;  5GAM h;  1ZBX A;  4X9C A;  3RES A;  3AHU A;  2Y90 A;  2YLB A;  3H8Z A;  2XDD A;  3OS0 A;  2CJB A;  1YJ9 T;  4J83 A;  3CCR T;  2QQB A;  3NEM A;  3JB9 J;  2XIC A;  3VKI A;  3E9F A;  1YFS A;  4UP8 A;  1JJ2 S;  2D0Q B;  4B9W A;  2E1H A;  4Y28 E;  2Q5I A;  4H2U A;  3OYI A;  3T9N A;  1KC8 U;  1USY A;  4M75 F;  3HXX A;  4OB0 B;  4MMK A;  1YJN A;  4BB7 A;  3JCM d;  3C12 A;  3GNF B;  2P0L A;  4C92 G;  4PLI A;  4H2S A;  1WYD A;  1QVF A;  3FRN A;  3CCV A;  4OVA A;  1N8R U;  4BAC A;  3QYG B;  2LC4 A;  5CQY A;  1KD1 U;  3DKM A;  2LCC A;  3SD4 A;  1VIE A;  1LOJ A;  1W2B A;  3A8H B;  1N9W A;  1OZ3 A;  5GMK i;  2CJ9 A;  1YBY A;  2DZC A;  3FDR A;  1BI1 A;  1YGB A;  3EFR A;  4A4G A;  1TH7 A;  4JS5 A;  4PJO F;  4KR3 A;  5AYF A;  3HKS A;  4UP9 A;  1NPP A;  4WJ3 M;  2OTL T;  3CPW S;  2L89 A;  5LJ5 j;  1E22 A;  3QYH B;  4QVZ A;  1YJ9 A;  1DJ7 B;  3CCR A;  5CR2 A;  2QA4 T;  4YRM A;  2ZTG A;  3RGL A;  1N9S A;  3CPF A;  5GAO n;  2DIQ A;  3LLR A;  3HXU A;  3OD1 A;  4M7D A;  4YCW A;  1OI1 A;  4M7D B;  5J3B A;  2C06 A;  4OF1 A;  2ZPF B;  4MZP A;  2Q7G A;  3JCM W;  4XU0 A;  2WAC A;  3LWH A;  3ZBD A;  3PT9 A;  3GIB A;  3TEG A;  4E51 A;  4K88 A;  2DXU A;  3NTI A;  4OMF B;  4P3N A;  3HRT A;  4M77 D;  1RIQ A;  1W66 A;  3V7C A;  3LW5 E;  4C0G A;  2DU7 A;  5LJ3 g;  2ZCE A;  3G1Z A;  4H2T A;  3W3S A;  4M75 D;  1YB3 A;  1Y96 A;  2XU8 A;  4ZGD B;  4JRQ A;  1Y96 B;  2LTO A;  1QVP A;  5GAN 8;  2G3R A;  1HXD A;  4UPA A;  3L2W A;  2LT4 A;  2OTL A;  4ZTF A;  5GAO m;  2K5L A;  3ASK A;  1UGP B;  4JRP A;  2R57 A;  3QO8 A;  3JB9 F;  3OYJ A;  4II1 A;  1N27 A;  5C53 B;  5GAO l;  2QA4 A;  4J6X A;  2RK2 A;  4GY5 A;  4K86 A;  4XEM A;  4HT8 A;  2DK3 A;  1JJ2 A;  3C4S A;  3BDL A;  3PIP A;  4OP0 A;  4YRT A;  3CCJ T;  5CK9 A;  4G84 A;  1XNI A;  3MP8 A;  1MHN A;  4PJO D;  1LNX A;  4BE2 A;  4BY6 C;  4G85 A;  1SRY A;  3QUI A;  1Z7N A;  5HY6 A;  4BI4 A;  1VQM T;  2YRV A;  3HPW A;  5A2Q E;  2DXC A;  5KE2 A;  3INZ A;  1Z7M A;  4XAX B;  4UC4 A;  3QNE A;  1YFT A;  3KXT A;  3LWI A;  2PME A;  1XQH A;  4JRI A;  3RKW A;  2AMC B;  4H2X B;  4J7I A;  2E41 A;  3VYG A;  3JSC A;  2FB7 A;  1JB0 E;  3SB2 A;  3JCM X;  1E1O A;  3A31 A;  4XTX A;  5LJ3 j;  3M55 A;  2ARS A;  4C8Q E;  2E5Q A;  2VC8 A;  2F5K A;  5D6W A;  4CH5 A;  3HP9 A;  1OZ2 A;  1U1T A;  2D6F A;  3CPW A;  3P8D A;  4EPC A;  2KSS A;  2DIG A;  3LGF A;  1NPR A;  1QE0 A;  2ZZF A;  2RHI A;  1P92 A;  4M7A F;  4YYE A;  3VQW A;  3OS5 A;  3X26 B;  5LJ3 d;  3CCJ A;  1MGQ A;  4RDX A;  5LJ5 f;  3CMA T;  1ADJ A;  3G7Z A;  3OB9 A;  1LJO A;  2EIF A;  4C92 C;  1U8R A;  2ZCF B;  4OGC A;  1WQW A;  5FRN A;  1Y71 A;  3JCM J;  1YCY A;  2EJF A;  1VQM A;  3JB9 D;  5K1P A;  2HQX A;  3S3M A;  4YRF A;  2Q7H A;  1OYX A;  4WF2 A;  3OYN A;  3OW2 S;  3WVD B;  2OTJ T;  1KQ2 A;  3UT1 A;  4YRO A;  1H4Q A;  3OSV A;  3IG2 A;  3PFS A;  4M7D D;  4HVC A;  3HY1 A;  3SWN B;  4EMK A;  2JN0 A;  4EMK B;  3MF1 A;  3UFG A;  2VXE A;  3M5A A;  1Y7X A;  1K73 U;  2ZZD A;  1Y07 A;  1UGR B;  4PNO A;  4FM4 B;  3SWN C;  4YP0 A;  1IL2 A;  5KE3 A;  1WLE A;  1G5V A;  3E9I A;  1NYQ A;  4O2D A;  1I81 A;  2DZ9 A;  4EMH A;  4N0A C;  4J6W A;  4LDW A;  1M90 C;  2QHS A;  2C8M A;  4C8Q G;  2DXB A;  4LVI A;  3M53 A;  3HXY A;  3A74 A;  3CMA A;  4H2W A;  4ATO A;  2DVE A;  4L6V 5;  2RJF A;  3CEY A;  2RO0 A;  2PQW A;  2CZ6 B;  5FRO A;  4N4G A;  3G4S T;  3A7R A;  3TUP A;  2MWP A;  2PVD B;  2MAM A;  4MDX A;  2BKD N;  1BIA A;  1ASZ A;  2DTI A;  4M7A E;  2OTJ A;  1M9S A;  4TVA B;  4A4F A;  4KUD K;  1K9M U;  2VGN A;  2HQE A;  2MWO A;  1PSE A;  3M57 A;  4XTZ A;  4YRK A;  4P75 A;  2K5I A;  2MI6 A;  2VV5 A;  3QDR B;  4P5N A;  1G51 A;  3JCM g;  3HFO A;  3JRZ A;  4LD6 A;  4LD9 K;  4C5H A;  4BDY A;  3A8O B;  2EL9 A;  2L5Q A;  3HXZ A;  4P73 C;  3OYA A;  3JCM P;  2K3X A;  1BIB A;  5I2S A;  5CAI A;  1K73 C;  5GAN j;  2HNI A;  3VQX A;  2CJA A;  4H02 A;  3CXC A;  1Q86 U;  2R58 A;  1WNL A;  4HWT A;  2KDS A;  4CH3 A;  4YDQ A;  2WSE E;  4JLG A;  3BFM A;  1G3S A;  3LX7 A;  1J5W A;  3OYH A;  3S6W A;  2RHU A;  2D9T A;  3JB9 H;  4JLI A;  3G4S A;  4BW9 A;  4NCX A;  4P71 A;  1IRE B;  2QQ9 A;  2V8I A;  4XU3 A;  4M78 E;  2EWN A;  4C0Z A;  1B7Y B;  1FYF A;  1VIF A;  5J26 A;  1G5H A;  3QHS A;  3OW2 A;  2XDP A;  2ZNI A;  4P72 C;  4E7I A;  4NS5 A;  4YPF A;  3OS2 A;  2LDM A;  5I2M A;  2ALY A;  2ALY B;  4M7A G;  2CYZ B;  2RJD A;  2E10 A;  4VUB A;  2RD1 A;  1VQL T;  1S72 T;  1NZ9 A;  5LJ5 g;  4WJ4 A;  1E24 A;  3M4Y A;  4F7U E;  1JJC A;  2ZZG A;  1QF6 A;  4YRP A;  1K9M C;  4J15 A;  2E12 A;  4J7F A;  2E64 A;  3KFU A;  4A4K A;  3QO7 A;  2VYT A;  4M77 F;  3CCU T;  2JNG A;  2HAX A;  1NJ1 A;  2RH2 A;  4BI8 B;  5D6X A;  2Y4X A;  3JAM E;  1KMN A;  3HRS A;  4ZGJ B;  1Q86 C;  3CCM T;  4FU6 A;  2PU9 B;  5LJ3 h;  5CQX A;  2P0Q A;  1B70 B;  4LDV A;  4R55 A;  1H4T A;  3BJU A;  3A8L B;  4ELY C;  4L5G A;  2BIV A;  4YRJ A;  3FLG A;  1NJI C;  3CC2 T;  2G4C A;  4CH6 A;  4M78 G;  5I21 A;  1YFR A;  2A8E A;  2QHV A;  3ICA A;  2ZGW A;  4BDZ A;  1VQL A;  4PG3 A;  1S72 A;  3QO3 A;  3DB3 A;  1BBU A;  2WSF E;  4C8Q B;  3FJP A;  2MF2 A;  11AS A;  4YRR A;  3PCO A;  3PCO B;  4ZIB A;  3M4Q A;  4DA4 A;  3L42 A;  4C8Q C;  2RB6 A;  2BUD A;  2X4X A;  3QBY A;  4F7U G;  1V29 B;  3R6O A;  3OBY A;  5A0D A;  4FT2 A;  3CCU A;  5HK3 A;  4YRQ A;  2RJC A;  3P8Y A;  2M9U A;  4C5I A;  4QQD A;  2M1H A;  2LNV A;  4PKC C;  2NS6 A;  1XOV A;  5GAN f;  4A53 A;  3L2Z A;  5LJ5 d;  3I56 T;  4EDU A;  3QZ5 B;  4HWP A;  1M1G A;  4RMF A;  2EQJ A;  1M4Z A;  3CCM A;  5FU6 C;  3NTK A;  3CC4 T;  3A5Z A;  4V2S A;  4M77 E;  3A5Z B;  3QZ9 B;  2HBP A;  3OMC A;  2V8J A;  4QVC A;  4HKE A;  4M75 E;  2ZZE A;  2ARU A;  3CC2 A;  2KMT A;  3LC0 A;  1GGM A;  2PVO B;  3OYG A;  4HA8 A;  2DD5 A;  5DLQ E;  3UPU A;  5A0G A;  4YRG A;  2DD4 A;  1QP2 A;  3KUF A;  4O5V A;  3LSS A;  2ZR2 A;  5GAO r;  3IKL A;  4ME7 A;  3LGL A;  2H3J A;  3DLL A;  3CCS T;  5KH6 A;  3DB4 A;  4A4H A;  4ZTJ A;  2K2V A;  3VU3 C;  1IZ6 A;  4ZTZ B;  3TEE A;  4L59 A;  1B34 B;  4HT9 A;  1W4S A;  3MEW A;  3OYF A;  4YRN A;  4BY6 B;  2DO3 A;  2F69 A;  3QPH A;  2XTI A;  3CCQ T;  4MML A;  4M7D F;  4H2Y A;  4PJO E;  2P4T A;  1VQ7 T;  1VQK T;  3TU4 K;  4P3O A;  1YIJ T;  2CZ7 B;  4XTW A;  1VQ4 T;  3GPL A;  2ZNJ A;  3I56 A;  4DQ2 A;  4CS4 A;  4PLL A;  2JZ2 A;  4R56 A;  3ZEH A;  2EJ9 A;  5GAO p;  4IUQ A;  3MO8 A;  1X75 C;  3CC4 A;  2P0P A;  3MCA B;  2K4Y A;  1O9S A;  4TQF A;  3HFZ B;  5GMK e;  1QW1 A;  4KT0 E;  5GAM j;  3VBB A;  3DLM A;  4M7A C;  4ZGE B;  1KQS S;  2X35 A;  2AMC A;  4UP7 A;  1G5I A;  4XK8 E;  4H2X A;  1ATI A;  4IUV A;  4HCB A;  3QJ6 A;  1M90 U;  3GNG A;  4M77 G;  4LNS A;  4TWA A;  2KY9 A;  4ZTU B;  4YRS A;  5IT9 E;  2DTH A;  2EYQ A;  4M75 G;  1FXX A;  3CCS A;  2Q5H A;  4MDW A;  4ELZ C;  3JCM e;  2PUO B;  4XTV A;  3JCM Q;  4C92 A;  3JB9 I;  4RKU E;  4C92 B;  1VQ6 T;  1HTT A;  4XQ3 A;  3M56 A;  1BI0 A;  1BI3 A;  1EQR A;  3V8K A;  3HRU A;  1NYR A;  4Q5W A;  4LVK A;  3CCQ A;  4HWO A;  5KNN A;  2ZT8 A;  3NTH A;  3URG A;  5K1X A;  4C8Q D;  5GMK h;  1VQ7 A;  1VQK A;  2C7I A;  1YIJ A;  3RF1 A;  3MEA A;  1VQ4 A;  3WQZ A;  1X01 A;  3VJP A;  2ZIN A;  3CCL T;  3L4G B;  2DDZ A;  4Q15 A;  4M78 B;  1EVK A;  2ZT6 A;  1NJ6 A;  5HKC A;  2EFI A;  3ZFJ A;  5D6Y A;  1ZHI A;  3BY7 A;  1KG1 A;  4PJO G;  1QP3 A;  2QDY B;  3EAE A;  4M7D E;  2JTF A;  4TVW A;  1G3Y A;  4TVY A;  4M78 C;  4YCV A;  4OB2 B;  1GXI E;  1H64 1;  3SWN A;  3JCM h;  1RL2 A;  1YIT T;  4NL2 A;  3UH0 A;  4N4H A;  3PTA A;  4N0A A;  1UGQ B;  5HGQ A;  4QQG A;  4F7U B;  2I2L A;  1Q82 C;  3N5B B;  4A54 A;  3RER A;  2E6Z A;  2DJZ A;  5GAN g;  4KQE A;  2DAQ A;  2YHT A;  3V7R A;  4IUR A;  3HFN A;  5LJ5 e;  2LRQ A;  5FLX E;  1VQ6 A;  3HY0 A;  1WGS A;  5KCH A;  2P5I A;  3HFV A;  5GAO q;  4OB3 B;  2WSC E;  4GLK A;  3F70 A;  1SSF A;  2ODR C;  1B76 A;  3LSQ A;  2AHJ B;  3JCM V;  3E19 A;  4FL6 A;  3CCL A;  2EQU A;  2JTM A;  1ASY A;  2EQK A;  2QQS A;  2R5A A;  4OGE A;  2GQV A;  4TVA A;  2CZ0 B;  4H2V A;  4C5E A;  2RA2 A;  2ZIM A;  1EOV A;  4IUP A;  1WJS A;  4LVM A;  3JB9 G;  1QVF S;  5LJ5 h;  1QVG S;  3MEY A;  1YIT A;  4IKF A;  3NEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...