2DEQA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111g mutation
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKGIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
total genus 70
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2deqA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2deqA01
4C8QG 3HRKA 3CMQA 5E3IA 2AMCB 3JB9H 1ASZA 1B70B 4H2UA 4HWPA 5ELNA 1H4QA 4J5YA 4EMKB 2VXFA 4XU2A 1E1OA 4XTVA 2CGHA 4YCUA 3IG2A 4RCCA 1YFRA 2C7IA 4M77F 4C92F 2QHUA 4KR2A 4PJOA 3HXXA 4C8QE 3GIBA 4HWRA 3NETA 5GAN3 3JB9I 3JB9G 1YCYA 1RIQA 3JCMh 1WU7A 4WJ4A 4CH4A 5GAOm 3L2ZA 4YRMA 3MF2A 1X2HA 1I4K1 4WJ3M 4RQEA 3BY7A 4OP0A 3UGTA 1KQ2A 1VQZA 3G1ZA 3L4GA 1W66A 3LC0A 4M77D 4YRKA 5GAOp 1G5HA 1NYRA 4PJOG 1B34A 4H2XB 2QHTA 3IALA 2XTIA 3JB9J 4M77C 1TH7A 1PYSB 1H641 4F7UA 4C92A 4WI1A 1U1SA 1ADYA 1J5WA 2ALYA 2ARUA 3E9HA 2QHVA 3TUPA 1HK9A 5LJ3e 3ERRA 3W3SA 5GMKi 5GAMe 4NCXA 1Y96B 3JCMf 4M75D 4PJOE 3KFUA 1WLEA 5LJ3j 4H2SA 1QE0A 5GAMj 4M7DC 1H4SA 2QTXA 4C8QF 3VBBA 3OD1A 4X5OA 4M75C 2JN0A 3HRIA 5GANe 1H4TA 4P73C 3TEHA 1E1TA 4N0AA 2ZIOA 1G5IA 3BW1A 1KMMA 1L0WA 5DY9A 4XTZA 1NJ5A 4JRKA 4YRTA 3VQXA 4M7DB 4UP7A 1NNHA 4HT9A 4MMLA 4J15A 4M7AD 1LYLA 4M75B 4J6XA 3M4GA 4TQFA 2DJZA 2DQ3A 2E65A 1B7YA 3HFZA 3JB9F 1YFSA 2DTIA 1WQ7A 4M7AC 3VQYA 2C8MA 3NEMA 5CAIA 2RHQA 3JCMQ 1JBMA 2Y90A 5C51B 2QHSA 4BW9A 4YRCA 1D3BB 2I4OA 1JRIA 3QO8A 3JCMb 4C8QA 2PMEA 5GMKe 3FJPA 2P5IA 4PJOF 4J6YA 4M7AB 11ASA 3JB9D 5GMKj 4TVAA 3VQWA 4NL2A 2CJBA 2YHTA 3QO7A 3HFNA 4P75A 5GAOq 4YP0A 3VQVA 4EMGA 2K57A 3QHSA 1NJ1A 4P3PA 2CIMA 1ATIA 2Q7GA 2ZCEA 3HFVA 3QO3A 2FB7A 2E1HA 5GAMf 4XEMA 4PJOD 2DXTA 3HXVA 2DEQA 4TTVA 1SETA 1USYA 4RQFA 5LJ3g 1WPYA 1ASYA 1HXDA 5GAMg 1EFWA 2DQ0A 2I4MA 1BIBA 3RKWA 2I2LA 1WYDA 4UP9A 4WF2A 4PJOC 4P3OA 1WNLA 4EO4A 5GMKh 3INZA 2G4CA 4XU3A 2I4LA 4F7UF 5GAN6 5GAN4 1M8VA 2P0LA 4YRLA 5GANg 2RHSB 3SB2A 5ELOA 1E22A 2EWNA 4YRGA 1KOGA 3PZCA 3RL6A 5LJ3d 4Q6GA 4PJOB 2EJGA 5GAMd 4X9CA 1BBUA 4A53A 1I5LA 2J3LA 1WQWA 4JUVA 1GGMA 4C92D 4V2SA 4P3NA 4CH6A 2DU5A 4M78A 1YFTA 1LJOA 4MMKA 3JCMJ 1SESA 5GANd 4AH6A 2ZINA 4EMHA 2E41A 4C92C 3RGLA 1EIYA 1EVKA 3UFGA 2DXUA 2EAYA 3A7AA 3QSUA 4YRFA 3LSQA 2ZIMA 1N9RA 3FB9A 3V7RA 3RKXA 2CJAA 1N9SA 4O2DA 5K1PA 3V8LA 3FIFA 4F7UB 3MEYA 4P71A 4M77B 4C92B 4M78G 2ALYB 4CS2A 3A31A 3BDUA 3EFSA 2RD1A 4G84A 4N0AC 3HY0A 3L1AA 4YRIA 2RM4A 1X55A 3A74A 3SWNA 4PG3A 5C53B 1EVLA 3HFOA 2Q5HA 3HTZA 5GANj 5GAN7 2Q7EA 3M4QA 4TVYA 4X9DA 3WQZA 4A54A 3IKMB 4M78E 3PCOA 3TEHB 5LJ5e 4L87A 1B8AA 4XTXA 4C8QD 3JCMV 5LJ5j 4QVCA 5GAOn 5F5WA 5LJ3h 4M7DA 2ZT8A 4K86A 5GAMh 4HWSA 3RIRA 4KQEA 5GAN8 1H4VB 3M4PA 4C8QC 1JJCA 1Z7MA 3HFZB 1I81A 2VXEA 4LNSA 1KMNA 4XQ3A 1U1TA 4OLFA 4H02A 1BIAA 4P72A 5GANh 2RHQB 1C0AA 4Q15A 3E9IA 12ASA 1X01A 2IY5A 2J3MA 2FYKA 1D3BA 4P75C 4M7DG 5K1XA 4C8QB 3DSQA 4YPFA 4PNOA 5LJ5h 4M75G 4JLIA 3JCMX 4TVAB 3ICAA 4YRNA 1USYC 4ZTUB 3RERA 1B76A 2ZT7A 4YRRA 1YB3A 2AKWA 5LJ3f 1FYFA 1Z7NA 4HA8A 3MF1A 3JCMW 4TQDA 4KR3A 4YREA 2ZZGA 4DQ2A 2DKGA 2YLBA 3A7RA 4M78F 4YRSA 2DZ9A 4M7DE 3JCMe 5KNNA 2ZZFA 4CS3A 4M75E 2AMCA 1NJ8A 5GAN2 5I21A 4P74A 4NL3A 5HGQA 3QO5A 5GANf 3RKYA 1B70A 1X54A 4JRIA 4M7AG 4YRJA 1NJ6A 5C52B 4EMKA 2DTHA 1X56A 2ARSA 3LSSA 4J6WA 1EOVA 3HSBA 2E5AA 4ZTZB 3EFRA 1N9WA 2DDZA 2E3CA 4M78D 3P8VA 4UPAA 4G85A 4YCVA 5LJ5f 2ZR3A 4QVDA 4XTWA 2DTOA 2RHSA 5LJ5g 4HT8A 3A5YA 4M78C 2YLCA 3UH0A 2ZGWA 2ARTA 4XEOA 4M7AE 2EL9A 2RB6A 3HXYA 4DPGA 4YROA 3RF1A 3L4GB 3QUIA 2VC8A 3HXUA 1B34B 4M78B 3UGQA 4H2XA 1NJ2A 3AHUA 3V8JA 5LJ5d 4M7DF 4P71C 1EIYB 3I7FA 3HXZA 1X2GA 1QF6A 1PYSA 4RCBA 4TWAA 4M75F 4PHCA 4TVWA 4ZIBA 4H2YA 1HC7A 3SWNC 3QTCA 4H2WA 3R07A 2RA2A 3BFMA 1Y96A 1MGQA 2ZR2A 3QNEA 4K87A 2ZTGA 4M77A 4M7DD 1ADJA 3P8YA 4CH5A 2ZT5A 2E64A 4YRPA 3P8TA 4CH3A 3RESA 3SWNB 3BJUA 3A32A 2EJFA 4K88A 5GMKl 3JCMg 2Q7HA 1E24A 4M7AF 4YDQA 2CJ9A 1M5Q1 1I8FA 2DU7A 3NENA 3PCOB 4F7UG 4HWTA 4M77G 4C92G 4HVCA 2DVEA 4E51A 4M75A 1NYQA 1SERA 4P73A 4P72C 1B7YB 1SRYA 4H2VA 1HTTA 4XU0A 4BWAA 3REXA 4UP8A 4XTYA 3JCMd 2ODRD 1JJCB 2DZCA 3TEGA 2EJ9A 4XTUA 2ZT6A 4RDXA 3A5ZA 3A7UA 1BBWA 4F7UE 2HNIA 4M77E 4C92E 2ODRC 2ZNIA 4NOYA 3REUA 2ZZEA 1LOJA 2IY5B 4M7AA 2I4NA 2E10A 5GAOr 5GAN5 1EQRA 1G51A 2ZNJA 4Y91A 3HY1A 5GMKm 5GAOl 2PMFA 1YGBA 3JCMc 4XU1A 3RACA 3V7CA 2XGTA 4H2TA 1IL2A 4YRQA 4CS4A 3VU3C 4P74C 1LNXA 3PGGA 2AKWB 4RMFA 4YYEA 3JCMP 4EMKC 2Q5IA 1KQ1A 3RUXA 3IKLA 3NELA 4HWOA 3HXWA 3V7SA 3V8KA 4YCWA 4EX5A 2ZXFA
chains in the Genus database with same CATH superfamily
2LTOA 2KI7A 3QJYA 1PD1A 4OMLA 4H2UA 3M0QA 4HWPA 3M56A 2P0QA 4KBMB 3GLXA 3HKSA 3CPWA 1P92A 4XTVA 3IG2A 2L0AA 2CUBA 1W70A 4RCCA 1JQQA 3L2WA 1EZZB 2EYYA 1R8OB 1VQPQ 3JB9G 5HK0A 2HZYA 2IVWA 2KRSA 3JCMh 3G71T 1VQ5Q 4CH4A 2LX7A 1VQLA 3EFOA 4YRMA 4FW1A 4LVMA 4WJ3M 3BDLA 1K8AU 4RQEA 3G4SA 1RAAB 2J6OA 3BY7A 4OP0A 2KRMA 4D8DA 1W66A 2L5QA 2QQAA 3G1JA 3LC0A 2X51A 1G5HA 2K2MA 4WTOB 1MMNA 4PJOG 3CBOA 3CCVT 3C95A 2CSQA 2EIFA 4BB7A 4M77C 4JJNK 4HVWA 2K6DA 3L2RA 1YITT 3C0CA 5KH6A 2CP0A 2QASA 3X28B 1H641 2PTKA 2SRCA 4WI1A 1ADYA 2ALYA 2XG8D 3LH5A 3TUPA 5LJ3e 1UG1A 1OZ2A 3MKDA 4QT7A 3KFUA 3CPWS 4H2SA 1GCPA 1QE0A 5GAMj 2NWMA 1K8AC 3CCEQ 2FO0A 4M75C 3HRIA 3URGA 1D1AA 2DX1A 1D1BA 2QI2A 4M4ZA 4E7HA 1M1KU 4LVJA 3BW1A 1FMWA 3TCJA 1KMMA 2WACA 1L0WA 4YRTA 2KDSA 1UECA 4DBHA 3M0TA 4RG2A 4BY6B 1AWXA 1IXDA 2DQ3A 4PJLA 2ATCB 3JB9F 2DL8A 4KULA 4M7AC 2E70A 2C8MA 3EHQA 3CCLQ 2EQIA 1JBMA 2Y90A 1VQPT 2FPEA 1D3BB 5CKEA 1VQ5T 3EG1A 1RABB 2E6ZA 5GMKe 1M1KC 3FEOA 3HRSA 2LX9A 1W1FA 3CD6A 4PJOF 2DPPB 9ATCB 1K0XA 4WCIA 4F04B 2YHTA 1HJDA 3CCSA 1VQNQ 2EYZA 1U8RA 4EIKA 1RUWA 2FRWA 1A0NB 4YP0A 4FIBA 3OMGA 1BB9A 2DD4A 1S72Q 2FL7A 3NTIA 2ZCEA 3EH1A 3CMEQ 1WJSA 2DIGA 5IN1A 3HXVA 2DEQA 4RTXA 4TTVA 4RTWA 5LJ3g 2E6NA 2DERA 1HXDA 1Y07A 1K73R 1QVPA 5KYUA 2R58A 3PIPA 4FM4B 4EO4A 4P3OA 1M3AA 1QLYA 1G2BA 1FWZA 1VQOA 4BACA 3CCET 2JTEA 1ZX6A 3A8GB 3SB2A 1S72A 5CQXA 3VV0A 1E22A 4YRGA 3C12A 1IGQA 2BE7D 5FROA 3RL6A 5CKHA 2JMAA 4Q6GA 3HTRA 2EJGA 5GAMd 4A53A 2LNHB 3MHXA 4JUVA 4FYVB 2MWOA 2E12A 3CD6T 3I9QA 4X34A 4K11A 2KXDA 4V2SA 1R0CB 1YFTA 4MMKA 3JCMJ 1OU9A 3X20B 3LW5E 5GANd 1KQSA 3OA6A 5D6WA 3MP6A 2ZINA 2P0PA 4BE1A 1IRXA 1EIYA 4ATOA 3CCLT 4YTLA 1QVGA 1QWFA 4XAXB 2EAYA 3A7AA 1MV0B 2DEUA 2A0FB 2F2WA 2DF6A 4N4GA 3DKMA 4KUDK 2LQNA 1NBEB 2KYMA 3VS6A 4O2DA 5DLOA 5KYXA 4F7UB 3P8BB 3MEYA 3UA7A 4M77B 4M78G 4CS2A 1Q81C 3A31A 4L5GA 2E5KA 5FU7C 1VQNT 5CKBA 2F1LA 1VQOT 3L1AA 3TREA 3QYGB 3A74A 1TSFA 2KT1A 3OS1A 1M2OA 1S72T 3UF4A 3MPUB 2XK0A 2YT6A 2F5TX 2O2OA 3CMET 1FMVA 3M4QA 2QEXQ 3OS5A 1N5ZA 1NPRA 3IKMB 1RADB 1K8AR 4L87A 1BI0A 4XTXA 2DNUA 2ESWA 1OULA 5CCAA 5GAOn 5LJ3h 3T9NA 1KQSS 5KYWA 8AT1B 3OYBA 5GAN8 1JJ2A 2PVOB 4JZ3A 3I5SA 3PVLA 1RLPC 1QVFA 2CH4A 3HFZB 1UGPB 4H02A 2B8AA 1BIAA 4P72A 1OPLA 2RHQB 1C0MA 1AWJA 2A7YA 3ZFJA 1X01A 1YJ9A 4XK8E 2J3MA 1N8RU 1D3BA 4LD9K 4KRTA 1TS9A 1BU1A 4PNOA 4AFQC 4M75G 2WSCE 1U3OA 4TVAB 4KH0B 3ICAA 2RJFA 4YRNA 1USYC 3RERA 2ZT7A 1YB3A 2MIOA 2AKWA 1M90U 1Z7NA 3H9NA 5KYNA 4C5HA 4KR3A 2AT1B 3THKA 2ZZGA 4M78F 2DZ9A 1Y57A 1IHWA 2BZYA 2EW3A 4JJDA 2VUBA 4OF1A 3SD4A 4LE9A 4CS3A 4JZ4A 2AMCA 2JZ2A 3M53A 5I21A 1GFCA 5HGQA 2DLPA 1B70A 1RI0A 4JRIA 4M7AG 1JJ2S 3S6WA 1Y71A 4EMKA 3OW2A 1E6HA 2DTHA 1BI1A 4QKUA 1O75A 1QVFS 1K9MC 4ZTZB 4FCYA 1YN8A 4UPAA 4DOVA 4YCVA 4EPCA 5LJ5f 4QVDA 3QPHA 1UGVA 2EFIA 1M9SA 2LJ0A 2AK5A 3LYIA 3EGXA 3HXYA 3EGDB 4RTYA 2RNAA 3L4GB 2HEQA 2HCKA 1U06A 2AKLA 1NPPA 1B34B 2LJ1A 2RQTA 4H2XA 3QZ9B 3HXZA 1QF6A 3ME9A 1M1GA 2MPXC 4M75F 2FZGB 4ZIBA 2V8IA 5A0LA 3D7SB 2LCLA 4JPBW 4R56A 3J80E 4H2WA 1KHIA 2O01E 4RUGA 4HKEA 3R07A 2RJDA 1YJWA 3OW2S 3BFMA 2GBQA 2ZR2A 2CT4A 4M77A 1SEMA 2EQKA 4OGEA 4KUIA 2AZSA 2A8EA 4LVLA 2W10A 2DAQA 2E64A 4MZTA 1VOMA 4CH3A 2MK5A 4IIMA 4J9HA 1NM7A 2J6FA 3VS4A 5GMKl 5KE2A 2OX7A 4M7AF 1JXOA 2RH2A 1OU8A 3C94A 2QGGA 2DU7A 1Z9ZA 2OAWA 3LLRA 3SFMA 3PCOB 3CXCS 2WSFE 1ZSZB 4M75A 5D6YA 1KD1U 2JXBA 3S3MA 2GQIA 2VVKA 3QG1A 5D7UA 1ZBXA 1JXMA 3REXA 2CH4W 5I22A 4UP8A 1WHKA 4BE0A 3TEGA 5CVIA 4FYYB 4RDXA 4PL6A 1BBWA 2M1HA 4F7UE 2QQSA 4M77E 2ZNIA 1XQHA 1YJWT 1LOJA 1VQKA 4M7AA 2E10A 5GAOr 2JM8A 1EQRA 2ZNJA 1PKTA 1TUDA 3OYGA 4OVAA 2NUPA 1DJ7B 2IG0A 4H2TA 3OMCA 4ZTFA 4CS4A 3VU3C 4RMFA 4YYEA 5EG2A 3JCMP 3PNWC 4JJBA 2Q5IA 1KQ1A 2E3IA 2L3RA 3HXWA 5CO7A 3TU4K 3V8KA 3J81E 1G3WA 3OQ5A 3KXTA 3CMQA 2X4XA 5KYYB 5E3IA 1G3YA 1ASZA 2JVVA 5ELNA 4J5YA 1YP5A 2LZ6B 1KHCA 1MMGA 4HCCA 1N8RR 1YFRA 2C7IA 2QHUA 2ZPEB 3LX7A 4BI3A 2X4YA 4HWRA 2L3QA 2K3XA 4LN2A 3CCMA 2C06A 2V8JA 5GAOm 2YUPA 1VYTA 3RMQA 5CKDA 1AWOA 1M90R 1KSWA 3CPFA 4LDYA 3L4GA 4R0KA 4M77D 5GAOp 1NYRA 3RR6A 1AOJA 4PLLA 1B34A 5HCKA 5AYFA 4C5IA 2QHTA 1PD0A 3X25B 3JB9J 4PFPA 2KT8A 2YWWA 2VB6A 1PYSB 3NHNA 1SF9A 1I5OB 4PFZA 2H3EB 3E1SA 2E3HA 2LVMA 3A8OB 1BBZA 4RTUA 2ARUA 5FU6C 5AT1B 3ERRA 4FL6A 2X4WA 1RACB 5GAMe 5GMKi 4ELYC 4NCXA 1RAGB 1WIEA 2DYBA 3S3OA 4M75D 2DRKA 4QQ6A 3HP9A 2CP2A 3OS2A 1ZA2B 3E2UA 2QTXA 5C0MA 2NLUA 1RAEB 2M9UA 3M0SA 3Q1JA 3VBBA 4X5OA 3VS5A 4BY6C 3OYJA 2ROTA 3QDRB 5GANe 3KFVA 1H4TA 4GLKA 1E1TA 5IXBA 3OY9A 3CCMT 3CC2Q 2OAUA 1T0JA 4JLGA 5IHKA 1HD3A 1NJ5A 4JRKA 2QXFA 4M7DB 2KXCA 1GBQA 5J3BA 1KJWA 1PRLC 2HL5C 2COZA 2IIMA 2HKQB 4J15A 4M7AD 2RHIA 3M4GA 3EG0A 2RI2A 2KK4A 6AT1B 3NEMA 4OB0B 4HCBA 2C0OA 3NTKA 5C51B 4YRCA 2A3LA 2K9GA 3A8HB 3OBYA 2QQRA 3CCQQ 3CC2A 2I4OA 3H8ZA 1W2BA 2KAFA 3O8VA 5L8RE 3OYIA 11ASA 2CJBA 4DBFA 3F70A 4J7FA 2GTJA 4F16A 3UT1A 3UATA 3VUZA 3S3NA 2K57A 3X24B 3QHSA 1ATIA 3EHRA 2Q7GA 3MQZA 1RL2A 2HDAA 3M57A 4ANJA 2V8KA 2FB7A 2E1HA 3L2QA 4XEMA 2PQWA 1KD1R 2ZPBB 3REBB 1USYA 1VQ7A 2O4XB 3CC4Q 2BE9B 5GAMg 1EFWA 2DQ0A 4E7JA 1BIBA 2EGAA 4O6JA 1WYDA 2G4CA 2CKKA 1U5SA 1UB4A 3UWNA 1YCSB 3CMAQ 2D1XA 2P0LA 1K4US 3OYFA 2FPFA 5GANg 2RHSB 1D0YA 4PLIA 1MMAA 1PSEA 3PZCA 2QA4Q 2GF7A 4C0FA 3CC2T 4ZTJA 4PJOB 1X75C 3M58A 1W2BS 2DL4A 3OSVA 1YHQQ 1BBUA 2CT3A 1I5LA 1WQWA 1QCOA 2J3LA 4LVIA 1YJNQ 1X2QA 2K7AA 3MEAA 2HQHA 3PT9A 4IUQA 1W6XA 4FW2A 4GBQA 4CH6A 4J8OA 1LJOA 1PWTA 2E41A 1VQPA 4AFSC 3UFGA 1OEBA 1AEYA 2DXUA 1VQ5A 2J06A 4PKCC 3QSUA 4YRFA 3EH2A 2ZIMA 5CK9A 3QZ5B 3FB9A 1VQ7T 3MCAB 5K1PA 1EFNA 2ROLA 1PCXA 2PVDB 3V8LA 4C92B 1MUZA 2DBMA 2HKNA 3LWIA 2CS7A 2XMFA 1NZ9A 4L6V5 4MDWA 2RD1A 1YWOA 4PJNA 2PNIA 5FU6B 4PG3A 1N6AA 3CBPA 1X69A 2L3SA 5GANj 5GAN7 3HTZA 3RBBB 4KGXB 2Q7EA 1UGRB 2DL5A 3G7ZA 4X9DA 2CSIA 3UDCA 2JM9A 3CC4T 3M0RA 3TEHB 2M51A 1QP2A 2EYXA 4QVCA 4M7DA 4AMCA 4A4EA 5GAMh 3JAME 3CCEA 3CC7Q 3RIRA 3CMAT 2I0NA 4HWSA 1IGUA 2EQJA 3LH0A 3OYEA 3SHWA 2Y4YA 2VXEA 2QA4T 2HQXA 1B7TA 1U1TA 4FSXA 5GANh 4Z02A 1YHQT 12ASA 5C6SA 2CREA 3E9IA 4O5VA 4ORZA 2IY5A 2FYKA 3A98A 1WXUA 4P75C 4C8QB 1M2VB 4OMPA 3DSQA 5HKCA 4JLIA 1TUCA 1YNZA 3CCLA 1PNJA 3TSZA 4CC4B 1B76A 2QTVA 3QKJA 4HA8A 2Y4XA 1MV3A 4TQDA 2LQ8A 4YREA 2DKGA 2YLBA 4HVUA 1TXQA 3A7RA 4M7DE 4KH1B 3L2UA 2K3BA 1WFWA 1FMKA 1M30A 3ZEHA 2GFAA 4QVZA 2G3RA 1FXXA 3META 1VQNA 3QO5A 5FW9A 4MZPA 1UDLA 1OV3A 3OYDA 4IUPA 1X56A 3LSSA 4VUBA 2R5AA 1XTDA 3CMEA 1N9WA 4DEXA 3EG3A 1EX4A 2CP3A 2F2XA 1JB0E 2ZR3A 1Q82U 2EYQA 1NEBA 2LDMA 1Q81U 2RHSA 3OSSC 3VYHB 1VYUA 3A5YA 3H0HA 5A0GA 1M3CA 4FU6A 3UH0A 1WHHA 2JS2A 3C4SA 2VWFA 2K5LA 3CC7T 3EAEA 4ME7A 4CC3A 1KC8U 4M78B 1NJ2A 2AIRB 4P71C 1Q86C 1PHTA 1X2GA 1D0XA 3NTHA 4GY5A 3VS1A 2RO0A 2COYA 4RCBA 4FT4A 4BE2A 4PHCA 4TVWA 1Q82C 4C5EA 4J9CA 2JTMA 3QTCA 1R77A 3P8HA 2FRYA 3OBWA 3OYAA 3VRZA 4M7DD 2X4JA 2XDDA 4QQGA 2CDTA 4YRPA 1UTIA 1ZSZC 3RESA 3SWNB 3A32A 4LNPA 2VKNA 1KC8C 2MYSA 1NJIC 4IURA 1X6GA 5HK3A 5M9OA 3NENA 3M54A 4J9GA 4F7UG 4HWTA 1WXTA 4M77G 1TWBA 4HVCA 2SEMA 1NYQA 3GOXA 1SERA 1OPKA 2X3XD 1QVGS 1B7YB 2DYIA 1WXBA 3PMIA 2QEXA 4XU0A 4BWAA 1QQJA 4BUGA 1VYVA 4E7LA 1JJCB 2EJ9A 5IHIA 3PVQA 4XTUA 2ZT6A 4C92E 1K9MU 2BTTA 4JS5A 1BI2A 2L3PA 4PFOA 2ZZEA 2XDPA 1BCOA 1I07A 3NPFA 1G51A 4AFUC 1M1KR 5GAOl 4DBRA 2KYBA 2QAZA 4XU1A 2HSPA 4CC7A 2XGTA 2HBPA 2ABLA 4P74C 4OMFB 2MF2A 2RJCA 3OS0A 2X3WD 2M16A 3O5ZA 1VIEA 4A4KA 1X6BA 3RUXA 3CCJQ 4LDWA 3V7SA 3E9FA 3HRTA 3CCRQ 2LQWA 3VKIA 2EQUA 1WJRA 2XI9A 2MOXA 3JB9H 4N4IA 1H4QA 1SHFA 2VV5A 1CSKA 1WLPB 3FC3A 2QEXT 2RJEA 5KCHA 4XU2A 2CGHA 4YCUA 3JV3A 3IQLA 2F5KA 3VS2A 1AWWA 2AHJB 3H0FA 4M77F 2MI6A 3HXXA 4Y92A 2L89A 4C8QE 3NETA 3I56Q 5GAN3 3JB9I 3CCUQ 4DA4A 1RIQA 1WU7A 4WJ4A 3MF2A 3QJ6A 1X2HA 2IPOB 3DLMA 4RKUE 1OX8A 4OB2B 5CIUA 3MO8A 1ZSGA 1VQ4Q 4YRKA 4IUTA 4HT4A 3CXCP 2L8DA 1W4SA 1Q7YU 1SSHA 1TH7A 3I56A 2NUTB 3CCUA 1KIKA 3A1PA 1TG0A 4J9DA 4F7UA 1XJWB 2FG0A 2O31A 1PSFA 2CZ6B 4L59A 3E9HA 2QHVA 3MP1A 1VA7A 3L42A 2HD0A 3KUFA 2V1QA 1IO6A 4BDZA 1Y96B 3VS7A 2NYSA 3JCMf 1WLEA 1Q81R 2KROA 4M7DC 2ED0A 2LT4A 2V1RA 1H4SA 1AZEA 1PM3A 3LGFA 2KRNA 1I0CA 1X43A 3OD1A 4LUDA 1NYFA 5GJVB 4GLMA 2KE9A 3CCJT 4P73C 3A8LB 1OX9A 1Q7YC 4LDVA 2LMJA 1G5IA 2JUFA 3CCRT 4B9WA 3GF5A 3CQTA 1NNHA 2RN8A 3MJXA 1IZ6A 5FWCA 1XOVA 1OYXA 2DE0X 2DXCA 3PIOA 4LVKA 2RHUA 2VGMA 5A0DA 2DJZA 2E65A 1B7YA 2A08A 3HFZA 1UHFA 2L2PA 2HSEB 4RMOA 2RHQA 1AD5A 3JCMQ 2DETA 3I56T 4BW9A 3CCUT 2CP7A 4JJCA 1TTHB 3A5ZB 1WGSA 1JRIA 3JCMb 2ENMA 4UC4A 4P5NA 2PMEA 2EQMA 2P5IA 1H3ZA 4J6YA 2HQEA 2ED1A 4TVAA 4NL2A 1ZQ1A 2D0QB 1IB8A 1VQ4T 2O9VA 3HFNA 4P75A 1NYGA 5GAOq 3GNGA 3VQVA 4E6RA 2YRVA 2OTLQ 4P3PA 2KMTA 4ZN3A 4E7KA 3QO3A 3TEEA 1WHMA 2C0IA 3QWXX 4A4FA 2F2VA 5GAMf 4RQFA 1SETA 1WPYA 1JU5C 1D09B 2YUOA 4BDYA 2MAMA 2I4MA 2I2LA 2MCNA 3GBQA 4UP9A 1GCQC 2ZPFB 4WF2A 4PJOC 4DEYA 5I11A 4II1A 2EYWA 2DIQA 3INZA 1PRMC 5GAN6 4YRLA 1H8KA 3HRUA 3M0UA 2OTLA 5ELOA 3L2VA 1K9MR 3WVDB 1KOGA 2DA9A 1G3TA 3FRNA 1SSFA 3G6EQ 4ZN1A 4X9CA 2JMCA 4LDUA 3U23A 3EGDA 1UEBA 1GGMA 2QDYB 2XDBA 2O88A 5IXFA 1VQ9Q 2GGRA 4EMHA 3RMSA 4C92C 2JS0A 1EVKA 1MNDA 4A63B 2M0OA 4J9IA 3G6EA 2K4YA 2YUNA 1SRMA 1WI7A 2XKOC 2CJAA 1N9SA 3LGLA 1JEGA 4P71A 2ALYB 2A28A 3BDUA 3MP8A 4N0AC 2RM4A 1AVZC 2EGEA 2OTLT 2NUZA 3QDFA 3HFOA 2Q5HA 3I55Q 1M8MA 1MMDA 4TVYA 2AKKA 3WQZA 2PUOB 3PCOA 2LCSA 1B8AA 4J9EA 3A8MB 1ZSZA 4PK4A 5LJ5j 2V26A 3J7AF 1KK7A 5CQYA 1Q7YR 3CBMA 2ZPIB 1NLOC 4LD6A 2RHYA 4HCKA 2KNBB 3WXMB 4J7IA 4C8QC 2OTJQ 2VYTA 4E2FB 2VGNA 2C0TA 1Z7MA 3SEMA 2RHZA 4C5GA 1K73U 4CC2A 1KMNA 3H0IA 3I55A 3I35A 2FHDA 2CP6A 3G6ET 4Q15A 1ZBJA 2K79A 1KFZA 1QMCA 3CCVQ 4M7DG 5K1XA 1OQKA 2EKOA 4YPFA 5LJ5h 1ARKA 1WA7A 3JCMX 1VQ9T 1ACMB 2CZ1B 2DL3A 4ZTUB 4JRPA 3CCQA 5LJ3f 1FYFA 3QXEB 3VS0A 3JCMW 3WVEB 2ZPHB 2BIVA 4YRSA 2XHCA 1SG5A 4OGCA 1K73C 5KNNA 2YSQA 2ZZFA 5KYYA 4JS4A 1ZA1B 4F14A 4NL3A 4P74A 3RKYA 4ELZC 3PFSA 1V76A 5KYUB 4OB3B 2E4HA 1UE9A 2ARSA 4J6WA 1EOVA 3HSBA 2E5AA 1VQLQ 1V29B 2ZCFB 3P8VA 2E3CA 5FLXE 4G85A 3CPWP 3H41A 3G4SQ 3I55T 4XTWA 3CC4A 2DTOA 2AZVA 1F1BB 3UPUA 4M78C 1OOTA 4Z88A 1RLQC 2EL9A 2RB6A 4ZNXA 1M1FA 3CMAA 4DPGA 3QWYA 4YROA 3RF1A 4OMMA 2B86A 1AHJB 2P4TA 4N4HA 2OTJT 2QA4A 1LPLA 4R55A 1D0ZA 3CCQT 3AHUA 1N27A 5LJ5d 1YHQA 4M7DF 1EIYB 4KGZB 1YJNA 1PYSA 3DLLA 3OYNA 4TWAA 2FZKB 4CI0C 4H2YA 1RAIB 2P84A 1Z9QA 3SWNC 1UJ0A 5KYXB 1MGQA 4BI4A 4K87A 5KE3A 1J3TA 2M02A 1ADJA 1C6VX 2EBPA 4CH5A 2EKHA 3P8TA 1LCKA 4E7IA 3BJUA 2RHXA 1QKXA 2EJFA 4AT1B 4K88A 2Q7HA 2YUQA 1E24A 4LDXA 3EGUA 1B07A 1G5VA 4DBQA 3TSWA 4C92G 1OI1A 5HY6A 2X35A 2DVEA 2FPDA 2BUDA 4OMQA 4P73A 1G8XA 1VQLT 3GPLA 1HTTA 5KYWB 1UUEA 1AT1B 3CD6Q 2RMOA 3G4ST 2QK0A 4XTYA 5J26A 3JCMd 4IUUA 2DZCA 2D8HA 1YJNT 2RQRA 4CRIA 1H92A 2R57A 3CCSQ 1PC0A 3PE0A 1NEGA 1UGSB 4A4HA 4ZGDB 2ODRC 4NOYA 5D6XA 1WX6A 4NS5A 5IAYA 3CC7A 3REUA 1Y7XA 1BYMA 2PZ1A 3HY1A 2EVRA 3QYHB 1WJQA 1Y0MA 1YGBA 3V7CA 2OI3A 4D6WA 2PU9B 4YRQA 3TVTA 1NE8A 1LNXA 3PGGA 2MMPA 2AKWB 5I2MA 1VQOQ 1UHCA 1WZOA 2QQBA 2YRCA 2O4XA 3QBYA 4DOWA 5FWBA 4C8QG 4D8KA 3HRKA 5J39A 1Q86U 1E7OA 3OYCA 2AMCB 4OB1B 3RNJA 3ULRB 8ATCB 1B70B 3VUBA 4EMKB 1XNIA 2VXFA 1E1OA 4C0DB 2OJ2A 1UFFA 2QQ9A 4HCZA 2LC4A 2XICA 4KR2A 4C92F 1GCQA 3OYKA 4PJOA 4KT0E 2CZ7B 3GIBA 3HL8A 1UJYA 1X27A 1YCYA 2PVGB 3L2ZA 2ZZDA 3NMZC 4E47A 3EG9B 3EGXB 1I4K1 2GNCA 1NJIU 2QG9B 2G6FX 3UGTA 1KQ2A 3MEVA 1VQZA 3G1ZA 2YRDA 4ZGEB 4OMNA 1KQSP 3R6NA 3PTAA 4E7SA 4H2XB 3CCST 1RAFB 4Q5WA 1IHVA 3IALA 1QVGP 1ZUYA 2XTIA 2HBWA 1PKSA 2LJ3A 4J9BA 1EIFA 1SRLA 2XD0A 2RK1A 1O9SA 4Z89A 4C92A 2KR3A 1U1SA 1J5WA 1K9AA 1TU0B 3VS3A 1HK9A 4BI8B 2LT1A 3W3SA 2E5QA 1E6GA 4PJOE 5LJ3j 5IHNA 2K3YA 2CYZB 2EGCA 3AT1B 2HAXA 3M5AA 4C0GA 4TVRA 4C8QF 2JN0A 1VUBA 1YI2Q 3JRZA 4HVVA 2GQVA 3TEHA 4N0AA 4Y28E 2RI5A 2ZIOA 5DY9A 4XTZA 1ZUKA 3VQXA 3GNFB 4UP7A 3CEYA 4HT9A 5FRNA 3SDZA 4MMLA 1YJ9Q 1LYLA 4M75B 4J6XA 1JJ2P 1QKWA 4TQFA 2K5FA 4RTZA 2FEIA 1YFSA 1RAHB 2DTIA 2YDLA 1WQ7A 4A4GA 2F69A 1HSQA 1QVFP 2DO3A 5A2QE 1NLPC 1YI2A 3VQYA 5CAIA 3BE3A 1GL5A 1MNEA 1T0HA 2QHSA 3VYGA 2J6KA 3FDRA 1M3BA 1YWPA 4C0ZA 3QO8A 3GP8A 4C8QA 1M2VA 3LWHA 3FJPA 2RQUA 2QDLA 2DL7A 3DB3A 2LP5A 4M7AB 3JB9D 5GMKj 3VQWA 3MEUA 4LUEA 2PUKB 3HPWA 3QO7A 3R6OA 4RTTA 2NUPB 4FSSA 2HL3A 4EMGA 3N5BB 1NJ1A 2CIMA 3ASKA 4IUVA 3HFVA 2RF0A 4PJOD 2DXTA 1ASYA 2GCXA 1KG1A 2QGFB 4Z8AA 2JT4A 3OYLA 3RKWA 2LRQA 1WNLA 2KQWA 3OW2P 5GMKh 5I2SA 4XU3A 2I4LA 3NGPA 4F7UF 5GAN4 4IIOA 1M8VA 2JTFA 2MWPA 1IREB 3KBGA 1N8RC 1B3QA 1BKBA 5LL6S 3CCJA 2DD5A 1ZHIA 1QWEA 2EWNA 2JOYA 1YI2T 1ABQA 2KSSA 2XIDA 3CCRA 1VQ8Q 5LJ3d 1I1JA 2J05A 2JW4A 1YJ9T 1M90C 2NS6A 4C92D 2HMAA 2LNVA 4FYWB 3EG9A 4P3NA 1RI9A 2DU5A 4M78A 1FX7A 2Z0WA 1SESA 1YJWQ 2JNGA 2CP5A 2FZCB 4AH6A 4PJMA 3OYMA 3CXCA 3RGLA 2K5IA 2DJQA 3OYHA 1K0SA 1ABOA 3TQ7P 1NG2A 3ZL7C 1G83A 1VQ8A 3LSQA 1Q86R 1T3LA 1N9RA 3V7RA 3E9GA 3RKXA 2KEAA 2DM1A 3FIFA 1Q82R 1VQ4A 1SHGA 2ZPGB 3H6ZA 1OZ3A 1ZLMA 3EFSA 1VQMQ 4G84A 3HY0A 4YRIA 1M27C 1X55A 2KGTA 3SWNA 2H3JA 2VASA 1MHNA 3VJPA 4ZGJB 1EVLA 5C53B 2RQWA 3I5RA 4B9XA 2LQKA 2RQVA 4FYXB 2CZ0B 4ESRA 1KC8R 4A54A 3DB4A 4M78E 5FU7B 5LJ5e 1NJIR 2A37A 5ECAA 4C8QD 1K1ZA 3JCMV 3ER0A 5F5WA 2ZT8A 4K86A 1S1NA 1VQMA 2DVJA 2BZ8A 2RK2A 3REAB 4KQEA 5EC7A 1VQKQ 3QIIA 1R0BG 1H4VB 2D9TA 2DRMA 3M4PA 3FLGA 1JJCA 2P4RA 1I81A 1HYOA 4LNSA 1WYXA 2COWA 4XQ3A 1QCFA 2RPNA 4OLFA 1VQ8T 1CKAA 1C0AA 1CKBA 4PJJA 2D8JA 2DBKA 1WDXA 1X6OA 2K2VA 3M59A 4YRRA 4KGVB 1K76A 4FT2A 2KBTA 4HXJA 3MF1A 4DQ2A 1KD1C 4AG2C 2ECZA 1T3SA 2BZXA 1QW1A 3JCMe 2P0KA 1BK2A 4M75E 2XU8A 5GAN2 1NJ8A 4B6MA 5GANf 1X54A 5L23A 4QQDA 4YRJA 2GTOA 1VQMT 1NJ6A 5C52B 5FRMA 3CCMQ 1YFNA 2YXYA 4EDUA 1VQ6Q 1QP3A 3EFRA 2DDZA 4M78D 4OMOA 5LJ5g 4HT8A 5DM7R 4J9FA 5KCOA 2YLCA 2JJ9A 1YIJQ 2ZGWA 2ARTA 2KY9A 4XEOA 4AG1C 4M7AE 3EFOB 3NFCA 4LXCA 3ZBDA 1H3HA 2DXBA 4JDSA 1X2KA 2W0ZA 1GXIE 3QUIA 1VQKT 1WHLA 1UGQB 1BI3A 1VQ6A 2H8HA 4MZMA 2DFUA 1LVKA 2VC8A 3HXUA 2X9HA 3M0PA 3UGQA 3V8JA 5IT9E 4X1VA 3I7FA 2NUTA 2CUDA 3RDVA 1FYNA 3FJ5A 1YIJA 2DILA 4QW2A 1HC7A 1YBYA 2LCCA 2KVQG 2RA2A 4AFZC 1VQ9A 1Y96A 3M4YA 3QNEA 1G3SA 2ZTGA 1GFDA 2BKDN 3P8YA 1M4ZA 4IKFA 2ZT5A 3M55A 2R5MA 2EPDA 3OB9A 3PMTA 3JCMg 1AZGB 4YDQA 2DMOA 2CJ9A 1JO8A 1SKUB 3M9QA 1M5Q1 1I8FA 3UA6A 1V1CA 1D1CA 4MDXA 2D6FA 1WHJA 3G71Q 2M0YA 4E51A 4RG8A 1VQ6T 4P72C 5GJWB 2RI3A 1SRYA 3EG2A 4H2VA 1GBRA 5CR2A 2ODRD 2GFUA 1TOVA 1GRIA 2J7IA 2WSEE 3MEWA 1WHGA 1YIJT 3A5ZA 3A7UA 3VRYA 1C1AA 2ZAEA 2HNIA 1TUGB 3X26B 1VIFA 4RTVA 3P8DA 2DK3A 5IH2A 1YITQ 2QYZA 1PG5B 3G71A 2O9SA 2D0NA 2IY5B 1W2BP 2I4NA 2OTJA 3HHTB 5GAN5 4Y91A 3JSCA 1VQ7Q 7AT1B 5GMKm 5DLQE 4BD3A 1QCNA 2PMFA 4JRQA 3JCMc 3RACA 4E7ZA 5CKFA 4F17A 1IL2A 1SPKA 3CCVA 3E19A 3OYYA 2A36A 1Q95G 4EMKC 1ZUUA 3IKLA 3NELA 4HWOA 4C0DC 1BCMA 1YITA 2FVUA 4J83A 4YCWA 4EX5A 2ZXFA
chains in the Genus database with same CATH topology
2LTOA 3QJYA 4H2UA 4HWPA 3M56A 2P0QA 4KBMB 3GLXA 3HKSA 3CPWA 1P92A 4XTVA 3IG2A 4RCCA 3L2WA 1R8OB 3JB9G 5HK0A 2IVWA 3JCMh 3G71T 4CH4A 1VQLA 4YRMA 4LVMA 4WJ3M 3BDLA 1K8AU 4RQEA 3G4SA 3BY7A 4OP0A 1W66A 2L5QA 2QQAA 3LC0A 1G5HA 4PJOG 3CBOA 3CCVT 3C95A 2EIFA 4BB7A 4M77C 4JJNK 3L2RA 1YITT 5KH6A 3X28B 1H641 4WI1A 1ADYA 2ALYA 2XG8D 3TUPA 5LJ3e 1OZ2A 3KFUA 3CPWS 4H2SA 1QE0A 5GAMj 1K8AC 4M75C 3HRIA 3URGA 2QI2A 4E7HA 1M1KU 4LVJA 3BW1A 3TCJA 1KMMA 2WACA 1L0WA 4YRTA 2KDSA 4RG2A 4BY6B 2DQ3A 3JB9F 4KULA 4M7AC 2E70A 2C8MA 1JBMA 2Y90A 1VQPT 1D3BB 5CKEA 1VQ5T 2E6ZA 5GMKe 1M1KC 3FEOA 3HRSA 2LX9A 3CD6A 4PJOF 2DPPB 2YHTA 3CCSA 1U8RA 4YP0A 4FIBA 3OMGA 2DD4A 2FL7A 3NTIA 2ZCEA 1WJSA 2DIGA 5IN1A 3HXVA 2DEQA 4TTVA 5LJ3g 2E6NA 1HXDA 1Y07A 1QVPA 2R58A 3PIPA 4FM4B 4EO4A 4P3OA 1FWZA 1VQOA 4BACA 3CCET 3A8GB 3SB2A 1S72A 5CQXA 3VV0A 1E22A 4YRGA 3C12A 5FROA 3RL6A 5CKHA 4Q6GA 2EJGA 5GAMd 4A53A 3MHXA 4JUVA 2MWOA 2E12A 3CD6T 4X34A 4V2SA 1YFTA 4MMKA 3JCMJ 3X20B 3LW5E 5GANd 1KQSA 3OA6A 5D6WA 3MP6A 2ZINA 2P0PA 4BE1A 1EIYA 4ATOA 3CCLT 4YTLA 1QVGA 4XAXB 2EAYA 3A7AA 4N4GA 3DKMA 4KUDK 4O2DA 5DLOA 4F7UB 3P8BB 3MEYA 4M77B 4M78G 4CS2A 1Q81C 3A31A 4L5GA 5FU7C 1VQNT 5CKBA 1VQOT 3L1AA 3TREA 3QYGB 3A74A 3OS1A 1S72T 2XK0A 2F5TX 3CMET 3M4QA 3OS5A 1NPRA 3IKMB 4L87A 1BI0A 4XTXA 5CCAA 5GAOn 5LJ3h 3T9NA 1KQSS 3OYBA 5GAN8 1JJ2A 2PVOB 1QVFA 3HFZB 1UGPB 4H02A 2B8AA 1BIAA 4P72A 2RHQB 2A7YA 3ZFJA 1X01A 1YJ9A 4XK8E 2J3MA 1N8RU 1D3BA 4LD9K 4PNOA 4M75G 2WSCE 4TVAB 3ICAA 2RJFA 4YRNA 1USYC 3RERA 2ZT7A 1YB3A 2AKWA 1M90U 1Z7NA 4C5HA 4KR3A 2ZZGA 4M78F 2DZ9A 2VUBA 4OF1A 3SD4A 4CS3A 2AMCA 2JZ2A 3M53A 5I21A 5HGQA 1B70A 1RI0A 4JRIA 4M7AG 1JJ2S 3S6WA 1Y71A 4EMKA 3OW2A 2DTHA 1BI1A 1O75A 1QVFS 1K9MC 4ZTZB 4UPAA 4DOVA 4YCVA 4EPCA 5LJ5f 4QVDA 3QPHA 2EFIA 1M9SA 3LYIA 3HXYA 3L4GB 1NPPA 1B34B 4H2XA 3QZ9B 3HXZA 1QF6A 3ME9A 1M1GA 4M75F 4ZIBA 2V8IA 5A0LA 2LCLA 4R56A 3J80E 4H2WA 1KHIA 2O01E 4HKEA 3R07A 2RJDA 1YJWA 3OW2S 3BFMA 2ZR2A 4M77A 2EQKA 4OGEA 4KUIA 2A8EA 4LVLA 2DAQA 2E64A 4MZTA 4CH3A 5GMKl 5KE2A 4M7AF 2RH2A 3C94A 2DU7A 3LLRA 3SFMA 3PCOB 3CXCS 2WSFE 4M75A 5D6YA 1KD1U 3S3MA 3QG1A 1ZBXA 3REXA 4UP8A 4BE0A 3TEGA 5CVIA 4RDXA 4PL6A 1BBWA 2M1HA 4F7UE 2QQSA 4M77E 2ZNIA 1XQHA 1YJWT 1LOJA 1VQKA 4M7AA 2E10A 5GAOr 1EQRA 2ZNJA 3OYGA 4OVAA 1DJ7B 2IG0A 4H2TA 3OMCA 4ZTFA 4CS4A 3VU3C 4RMFA 4YYEA 5EG2A 3JCMP 3PNWC 2Q5IA 1KQ1A 2L3RA 3HXWA 5CO7A 3TU4K 3V8KA 3J81E 1G3WA 3OQ5A 3KXTA 3CMQA 2X4XA 5E3IA 1G3YA 1ASZA 2JVVA 5ELNA 4J5YA 1KHCA 4HCCA 1YFRA 2C7IA 2QHUA 2ZPEB 3LX7A 4BI3A 2X4YA 4HWRA 2K3XA 3CCMA 2C06A 2V8JA 5GAOm 3RMQA 5CKDA 3CPFA 4LDYA 3L4GA 4M77D 5GAOp 1NYRA 4PLLA 1B34A 5AYFA 4C5IA 2QHTA 3X25B 3JB9J 1PYSB 3E1SA 3A8OB 2LVMA 2ARUA 5FU6C 3ERRA 4FL6A 2X4WA 5GAMe 5GMKi 4ELYC 4NCXA 3S3OA 4M75D 4QQ6A 3HP9A 3OS2A 2QTXA 5C0MA 2NLUA 2M9UA 3Q1JA 3VBBA 4X5OA 4BY6C 3OYJA 3QDRB 5GANe 1H4TA 4GLKA 1E1TA 3OY9A 3CCMT 2OAUA 4JLGA 1NJ5A 4JRKA 2QXFA 4M7DB 5J3BA 4J15A 4M7AD 2RHIA 3M4GA 2RI2A 2KK4A 3NEMA 4OB0B 4HCBA 3NTKA 5C51B 4YRCA 2A3LA 3A8HB 3OBYA 2QQRA 3CC2A 2I4OA 3H8ZA 1W2BA 2KAFA 3O8VA 5L8RE 3OYIA 11ASA 2CJBA 3F70A 4J7FA 3UT1A 3S3NA 3VUZA 2K57A 3X24B 3QHSA 1ATIA 2Q7GA 3MQZA 1RL2A 3M57A 2V8KA 2FB7A 2E1HA 3L2QA 4XEMA 2PQWA 2ZPBB 1USYA 1VQ7A 2O4XB 5GAMg 1EFWA 2DQ0A 4E7JA 1BIBA 4O6JA 1WYDA 2G4CA 2CKKA 1UB4A 3UWNA 2P0LA 3OYFA 5GANg 2RHSB 4PLIA 1PSEA 3PZCA 2GF7A 4C0FA 3CC2T 4ZTJA 4PJOB 1X75C 3M58A 1W2BS 3OSVA 1BBUA 1I5LA 2J3LA 1WQWA 4LVIA 3MEAA 3PT9A 4IUQA 4CH6A 4J8OA 1LJOA 2E41A 1VQPA 3UFGA 2DXUA 1VQ5A 4PKCC 3QSUA 4YRFA 2ZIMA 5CK9A 3QZ5B 3FB9A 1VQ7T 3MCAB 5K1PA 2PVDB 3V8LA 4C92B 3LWIA 2CS7A 1NZ9A 4L6V5 4MDWA 2RD1A 5FU6B 4PG3A 1N6AA 3CBPA 3HTZA 5GANj 5GAN7 2Q7EA 1UGRB 3G7ZA 4X9DA 3UDCA 3CC4T 3TEHB 1QP2A 4QVCA 4M7DA 4A4EA 5GAMh 3JAME 3CCEA 4HWSA 3RIRA 3CMAT 2EQJA 3LH0A 3OYEA 2Y4YA 2VXEA 2QA4T 2HQXA 1U1TA 4FSXA 5GANh 4Z02A 1YHQT 12ASA 5C6SA 3E9IA 4O5VA 2IY5A 2FYKA 4P75C 4C8QB 3DSQA 5HKCA 4JLIA 3CCLA 1B76A 3QKJA 4HA8A 2Y4XA 4TQDA 2LQ8A 4YREA 2DKGA 2YLBA 3A7RA 4M7DE 3L2UA 3ZEHA 2GFAA 4QVZA 2G3RA 1FXXA 3META 1VQNA 3QO5A 4MZPA 3OYDA 4IUPA 1X56A 3LSSA 4VUBA 2R5AA 1XTDA 3CMEA 1N9WA 2ZR3A 1JB0E 1Q82U 2EYQA 2LDMA 1Q81U 2RHSA 3OSSC 3VYHB 3A5YA 5A0GA 4FU6A 3UH0A 3C4SA 2K5LA 3CC7T 3EAEA 4ME7A 1KC8U 4M78B 1NJ2A 4P71C 1Q86C 1X2GA 3NTHA 4GY5A 2RO0A 4RCBA 4FT4A 4BE2A 4PHCA 4TVWA 1Q82C 4C5EA 2JTMA 3QTCA 3P8HA 3OBWA 3OYAA 4M7DD 2X4JA 2XDDA 4QQGA 4YRPA 3RESA 3SWNB 3A32A 1KC8C 1NJIC 4IURA 5HK3A 5M9OA 3NENA 3M54A 4F7UG 4HWTA 4M77G 4HVCA 1NYQA 3GOXA 1SERA 1QVGS 1B7YB 3PMIA 2QEXA 4XU0A 4BWAA 4BUGA 4E7LA 1JJCB 2EJ9A 4XTUA 2ZT6A 4C92E 1K9MU 4JS5A 1BI2A 2ZZEA 2XDPA 1G51A 5GAOl 4XU1A 2XGTA 2HBPA 4P74C 4OMFB 2MF2A 2RJCA 3OS0A 2M16A 1VIEA 4A4KA 3RUXA 4LDWA 3V7SA 3E9FA 3HRTA 3VKIA 2EQUA 1WJRA 2XI9A 3JB9H 4N4IA 1H4QA 2VV5A 3FC3A 2QEXT 2RJEA 5KCHA 4XU2A 2CGHA 4YCUA 2F5KA 2AHJB 4M77F 2MI6A 3HXXA 2L89A 4C8QE 3NETA 5GAN3 3JB9I 4DA4A 1RIQA 1WU7A 4WJ4A 3MF2A 3QJ6A 1X2HA 3DLMA 4RKUE 4OB2B 5CIUA 3MO8A 4YRKA 4IUTA 4HT4A 2L8DA 1W4SA 1Q7YU 1TH7A 3I56A 3CCUA 4F7UA 1PSFA 2CZ6B 4L59A 3E9HA 2QHVA 3MP1A 3L42A 2HD0A 3KUFA 4BDZA 1Y96B 3JCMf 1WLEA 4M7DC 2LT4A 1H4SA 3LGFA 3OD1A 3CCJT 4P73C 3A8LB 1Q7YC 4LDVA 1G5IA 2JUFA 3CCRT 4B9WA 3GF5A 1NNHA 1IZ6A 1XOVA 1OYXA 2DXCA 4LVKA 3PIOA 2RHUA 2VGMA 5A0DA 2DJZA 2E65A 1B7YA 3HFZA 4RMOA 2RHQA 3JCMQ 3I56T 4BW9A 3CCUT 3A5ZB 1WGSA 1JRIA 3JCMb 4UC4A 4P5NA 2PMEA 2EQMA 2P5IA 1H3ZA 4J6YA 2HQEA 4TVAA 4NL2A 1ZQ1A 2D0QB 1VQ4T 3HFNA 4P75A 5GAOq 3GNGA 3VQVA 2YRVA 4P3PA 2KMTA 4ZN3A 4E7KA 3QO3A 3TEEA 4A4FA 5GAMf 4RQFA 1SETA 1WPYA 4BDYA 2MAMA 2I4MA 2I2LA 4UP9A 2ZPFB 4WF2A 4PJOC 4II1A 2DIQA 3INZA 5GAN6 4YRLA 3HRUA 2OTLA 5ELOA 3L2VA 3WVDB 1KOGA 1G3TA 3FRNA 1SSFA 4ZN1A 4X9CA 4LDUA 1UEBA 1GGMA 2QDYB 2XDBA 4EMHA 3RMSA 4C92C 1EVKA 2M0OA 3G6EA 2K4YA 2XKOC 2CJAA 1N9SA 3LGLA 4P71A 2ALYB 3BDUA 3MP8A 4N0AC 2RM4A 2OTLT 3HFOA 2Q5HA 4TVYA 3WQZA 2PUOB 3PCOA 1B8AA 3A8MB 5LJ5j 3J7AF 5CQYA 3CBMA 2ZPIB 4LD6A 2RHYA 3WXMB 4J7IA 4C8QC 2VYTA 2VGNA 1Z7MA 2RHZA 4C5GA 1K73U 1KMNA 3I55A 2FHDA 3G6ET 4Q15A 4M7DG 5K1XA 2EKOA 4YPFA 5LJ5h 3JCMX 1VQ9T 2CZ1B 4ZTUB 4JRPA 3CCQA 5LJ3f 1FYFA 3QXEB 3JCMW 3WVEB 2ZPHB 2BIVA 4YRSA 2XHCA 4OGCA 1K73C 5KNNA 2ZZFA 4JS4A 4P74A 4NL3A 3RKYA 4ELZC 3PFSA 4OB3B 2ARSA 4J6WA 1EOVA 3HSBA 2E5AA 1V29B 2ZCFB 3P8VA 2E3CA 5FLXE 4G85A 3I55T 4XTWA 3CC4A 2DTOA 3UPUA 4M78C 2EL9A 2RB6A 1M1FA 3CMAA 4DPGA 4YROA 3RF1A 1AHJB 2P4TA 4N4HA 2OTJT 2QA4A 4R55A 3CCQT 3AHUA 1N27A 5LJ5d 1YHQA 4M7DF 1EIYB 1YJNA 1PYSA 3DLLA 3OYNA 4TWAA 4CI0C 4H2YA 3SWNC 1MGQA 4BI4A 4K87A 5KE3A 1ADJA 4CH5A 3P8TA 4E7IA 3BJUA 2RHXA 2EJFA 4K88A 2Q7HA 1E24A 4LDXA 1G5VA 4C92G 1OI1A 5HY6A 2X35A 2DVEA 2BUDA 4P73A 1VQLT 3GPLA 1HTTA 3G4ST 4XTYA 5J26A 3JCMd 4IUUA 2DZCA 1YJNT 4CRIA 2R57A 1UGSB 4A4HA 2ODRC 4ZGDB 4NOYA 5D6XA 4NS5A 5IAYA 3CC7A 3REUA 1Y7XA 1BYMA 3HY1A 3QYHB 1WJQA 1YGBA 3V7CA 4D6WA 2PU9B 4YRQA 1NE8A 1LNXA 3PGGA 2MMPA 2AKWB 5I2MA 2QQBA 2O4XA 3QBYA 4DOWA 4C8QG 3HRKA 5J39A 1Q86U 3OYCA 2AMCB 4OB1B 1B70B 3VUBA 4EMKB 1XNIA 2VXFA 1E1OA 4C0DB 2QQ9A 4HCZA 2LC4A 2XICA 4KR2A 4C92F 3OYKA 4PJOA 4KT0E 2CZ7B 3GIBA 3HL8A 1YCYA 2PVGB 3L2ZA 2ZZDA 4E47A 1I4K1 1NJIU 3UGTA 1KQ2A 3MEVA 1VQZA 3G1ZA 4ZGEB 3PTAA 4H2XB 3CCST 4Q5WA 3IALA 2XTIA 1EIFA 2XD0A 2RK1A 1O9SA 4C92A 1U1SA 1J5WA 1HK9A 4BI8B 2LT1A 3W3SA 2E5QA 4PJOE 5LJ3j 2K3YA 2CYZB 2HAXA 3M5AA 4C0GA 4TVRA 4C8QF 2JN0A 1VUBA 3JRZA 2GQVA 3TEHA 4N0AA 4Y28E 2RI5A 2ZIOA 5DY9A 4XTZA 3VQXA 3GNFB 4UP7A 3CEYA 4HT9A 5FRNA 3SDZA 4MMLA 1LYLA 4M75B 4J6XA 4TQFA 2K5FA 1YFSA 2DTIA 4A4GA 1WQ7A 2F69A 2DO3A 5A2QE 3VQYA 1YI2A 5CAIA 2QHSA 3VYGA 3FDRA 4C0ZA 3QO8A 3GP8A 4C8QA 3LWHA 3FJPA 3DB3A 4M7AB 3JB9D 5GMKj 3VQWA 3MEUA 2PUKB 3HPWA 3QO7A 3R6OA 4EMGA 3N5BB 1NJ1A 2CIMA 3ASKA 4IUVA 3HFVA 4PJOD 2DXTA 1ASYA 2GCXA 1KG1A 3OYLA 3RKWA 2LRQA 1WNLA 2KQWA 5GMKh 5I2SA 4XU3A 2I4LA 4F7UF 5GAN4 1M8VA 2JTFA 2MWPA 1IREB 3KBGA 1N8RC 1BKBA 5LL6S 3CCJA 2DD5A 1ZHIA 2EWNA 1YI2T 2JOYA 2KSSA 2XIDA 3CCRA 5LJ3d 1YJ9T 1M90C 2NS6A 4C92D 2LNVA 4P3NA 2DU5A 4M78A 1FX7A 1SESA 2JNGA 4AH6A 3OYMA 3CXCA 3RGLA 2K5IA 3OYHA 1VQ8A 3LSQA 1N9RA 3V7RA 3E9GA 3RKXA 3FIFA 1VQ4A 2ZPGB 3H6ZA 1OZ3A 3EFSA 4G84A 3HY0A 4YRIA 1X55A 3SWNA 2H3JA 1MHNA 3VJPA 4ZGJB 1EVLA 5C53B 4B9XA 2LQKA 2CZ0B 4A54A 3DB4A 4M78E 5FU7B 5LJ5e 4C8QD 3JCMV 3ER0A 5F5WA 2ZT8A 4K86A 1VQMA 2RK2A 4KQEA 3QIIA 1H4VB 2D9TA 3M4PA 3FLGA 1JJCA 1I81A 4LNSA 4XQ3A 4OLFA 1VQ8T 1C0AA 1X6OA 2K2VA 3M59A 4YRRA 4FT2A 3MF1A 4DQ2A 1KD1C 1QW1A 3JCMe 2P0KA 4M75E 2XU8A 5GAN2 1NJ8A 1X54A 5GANf 4QQDA 4YRJA 1VQMT 1NJ6A 5C52B 5FRMA 4EDUA 1QP3A 3EFRA 2DDZA 4M78D 5LJ5g 4HT8A 5DM7R 5KCOA 2YLCA 2ZGWA 2ARTA 2KY9A 4XEOA 4M7AE 3NFCA 3ZBDA 2DXBA 4JDSA 1GXIE 3QUIA 1VQKT 1UGQB 1BI3A 1VQ6A 4MZMA 2VC8A 3HXUA 3UGQA 3V8JA 5IT9E 3I7FA 1YIJA 4QW2A 1HC7A 1YBYA 2LCCA 2KVQG 2RA2A 1VQ9A 1Y96A 3M4YA 3QNEA 1G3SA 2ZTGA 2BKDN 3P8YA 1M4ZA 4IKFA 2ZT5A 3M55A 2R5MA 3OB9A 3PMTA 3JCMg 4YDQA 2CJ9A 3M9QA 1M5Q1 1I8FA 4MDXA 2D6FA 4E51A 4RG8A 1VQ6T 4P72C 2RI3A 1SRYA 4H2VA 5CR2A 2ODRD 2GFUA 2WSEE 3MEWA 1YIJT 3A5ZA 3A7UA 2HNIA 3X26B 1VIFA 3P8DA 2DK3A 3G71A 2IY5B 2I4NA 2OTJA 3HHTB 5GAN5 4Y91A 3JSCA 5GMKm 5DLQE 4BD3A 2PMFA 4JRQA 3JCMc 3RACA 5CKFA 1IL2A 3CCVA 3E19A 3OYYA 4EMKC 3IKLA 3NELA 4HWOA 4C0DC 1YITA 2FVUA 4J83A 4YCWA 4EX5A 2ZXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q G;  3HRK A;  3CMQ A;  5E3I A;  2AMC B;  3JB9 H;  1ASZ A;  1B70 B;  4H2U A;  4HWP A;  5ELN A;  1H4Q A;  4J5Y A;  4EMK B;  2VXF A;  4XU2 A;  1E1O A;  4XTV A;  2CGH A;  4YCU A;  3IG2 A;  4RCC A;  1YFR A;  2C7I A;  4M77 F;  4C92 F;  2QHU A;  4KR2 A;  4PJO A;  3HXX A;  4C8Q E;  3GIB A;  4HWR A;  3NET A;  5GAN 3;  3JB9 I;  3JB9 G;  1YCY A;  1RIQ A;  3JCM h;  1WU7 A;  4WJ4 A;  4CH4 A;  5GAO m;  3L2Z A;  4YRM A;  3MF2 A;  1X2H A;  1I4K 1;  4WJ3 M;  4RQE A;  3BY7 A;  4OP0 A;  3UGT A;  1KQ2 A;  1VQZ A;  3G1Z A;  3L4G A;  1W66 A;  3LC0 A;  4M77 D;  4YRK A;  5GAO p;  1G5H A;  1NYR A;  4PJO G;  1B34 A;  4H2X B;  2QHT A;  3IAL A;  2XTI A;  3JB9 J;  4M77 C;  1TH7 A;  1PYS B;  1H64 1;  4F7U A;  4C92 A;  4WI1 A;  1U1S A;  1ADY A;  1J5W A;  2ALY A;  2ARU A;  3E9H A;  2QHV A;  3TUP A;  1HK9 A;  5LJ3 e;  3ERR A;  3W3S A;  5GMK i;  5GAM e;  4NCX A;  1Y96 B;  3JCM f;  4M75 D;  4PJO E;  3KFU A;  1WLE A;  5LJ3 j;  4H2S A;  1QE0 A;  5GAM j;  4M7D C;  1H4S A;  2QTX A;  4C8Q F;  3VBB A;  3OD1 A;  4X5O A;  4M75 C;  2JN0 A;  3HRI A;  5GAN e;  1H4T A;  4P73 C;  3TEH A;  1E1T A;  4N0A A;  2ZIO A;  1G5I A;  3BW1 A;  1KMM A;  1L0W A;  5DY9 A;  4XTZ A;  1NJ5 A;  4JRK A;  4YRT A;  3VQX A;  4M7D B;  4UP7 A;  1NNH A;  4HT9 A;  4MML A;  4J15 A;  4M7A D;  1LYL A;  4M75 B;  4J6X A;  3M4G A;  4TQF A;  2DJZ A;  2DQ3 A;  2E65 A;  1B7Y A;  3HFZ A;  3JB9 F;  1YFS A;  2DTI A;  1WQ7 A;  4M7A C;  3VQY A;  2C8M A;  3NEM A;  5CAI A;  2RHQ A;  3JCM Q;  1JBM A;  2Y90 A;  5C51 B;  2QHS A;  4BW9 A;  4YRC A;  1D3B B;  2I4O A;  1JRI A;  3QO8 A;  3JCM b;  4C8Q A;  2PME A;  5GMK e;  3FJP A;  2P5I A;  4PJO F;  4J6Y A;  4M7A B;  11AS A;  3JB9 D;  5GMK j;  4TVA A;  3VQW A;  4NL2 A;  2CJB A;  2YHT A;  3QO7 A;  3HFN A;  4P75 A;  5GAO q;  4YP0 A;  3VQV A;  4EMG A;  2K57 A;  3QHS A;  1NJ1 A;  4P3P A;  2CIM A;  1ATI A;  2Q7G A;  2ZCE A;  3HFV A;  3QO3 A;  2FB7 A;  2E1H A;  5GAM f;  4XEM A;  4PJO D;  2DXT A;  3HXV A;  2DEQ A;  4TTV A;  1SET A;  1USY A;  4RQF A;  5LJ3 g;  1WPY A;  1ASY A;  1HXD A;  5GAM g;  1EFW A;  2DQ0 A;  2I4M A;  1BIB A;  3RKW A;  2I2L A;  1WYD A;  4UP9 A;  4WF2 A;  4PJO C;  4P3O A;  1WNL A;  4EO4 A;  5GMK h;  3INZ A;  2G4C A;  4XU3 A;  2I4L A;  4F7U F;  5GAN 6;  5GAN 4;  1M8V A;  2P0L A;  4YRL A;  5GAN g;  2RHS B;  3SB2 A;  5ELO A;  1E22 A;  2EWN A;  4YRG A;  1KOG A;  3PZC A;  3RL6 A;  5LJ3 d;  4Q6G A;  4PJO B;  2EJG A;  5GAM d;  4X9C A;  1BBU A;  4A53 A;  1I5L A;  2J3L A;  1WQW A;  4JUV A;  1GGM A;  4C92 D;  4V2S A;  4P3N A;  4CH6 A;  2DU5 A;  4M78 A;  1YFT A;  1LJO A;  4MMK A;  3JCM J;  1SES A;  5GAN d;  4AH6 A;  2ZIN A;  4EMH A;  2E41 A;  4C92 C;  3RGL A;  1EIY A;  1EVK A;  3UFG A;  2DXU A;  2EAY A;  3A7A A;  3QSU A;  4YRF A;  3LSQ A;  2ZIM A;  1N9R A;  3FB9 A;  3V7R A;  3RKX A;  2CJA A;  1N9S A;  4O2D A;  5K1P A;  3V8L A;  3FIF A;  4F7U B;  3MEY A;  4P71 A;  4M77 B;  4C92 B;  4M78 G;  2ALY B;  4CS2 A;  3A31 A;  3BDU A;  3EFS A;  2RD1 A;  4G84 A;  4N0A C;  3HY0 A;  3L1A A;  4YRI A;  2RM4 A;  1X55 A;  3A74 A;  3SWN A;  4PG3 A;  5C53 B;  1EVL A;  3HFO A;  2Q5H A;  3HTZ A;  5GAN j;  5GAN 7;  2Q7E A;  3M4Q A;  4TVY A;  4X9D A;  3WQZ A;  4A54 A;  3IKM B;  4M78 E;  3PCO A;  3TEH B;  5LJ5 e;  4L87 A;  1B8A A;  4XTX A;  4C8Q D;  3JCM V;  5LJ5 j;  4QVC A;  5GAO n;  5F5W A;  5LJ3 h;  4M7D A;  2ZT8 A;  4K86 A;  5GAM h;  4HWS A;  3RIR A;  4KQE A;  5GAN 8;  1H4V B;  3M4P A;  4C8Q C;  1JJC A;  1Z7M A;  3HFZ B;  1I81 A;  2VXE A;  4LNS A;  1KMN A;  4XQ3 A;  1U1T A;  4OLF A;  4H02 A;  1BIA A;  4P72 A;  5GAN h;  2RHQ B;  1C0A A;  4Q15 A;  3E9I A;  12AS A;  1X01 A;  2IY5 A;  2J3M A;  2FYK A;  1D3B A;  4P75 C;  4M7D G;  5K1X A;  4C8Q B;  3DSQ A;  4YPF A;  4PNO A;  5LJ5 h;  4M75 G;  4JLI A;  3JCM X;  4TVA B;  3ICA A;  4YRN A;  1USY C;  4ZTU B;  3RER A;  1B76 A;  2ZT7 A;  4YRR A;  1YB3 A;  2AKW A;  5LJ3 f;  1FYF A;  1Z7N A;  4HA8 A;  3MF1 A;  3JCM W;  4TQD A;  4KR3 A;  4YRE A;  2ZZG A;  4DQ2 A;  2DKG A;  2YLB A;  3A7R A;  4M78 F;  4YRS A;  2DZ9 A;  4M7D E;  3JCM e;  5KNN A;  2ZZF A;  4CS3 A;  4M75 E;  2AMC A;  1NJ8 A;  5GAN 2;  5I21 A;  4P74 A;  4NL3 A;  5HGQ A;  3QO5 A;  5GAN f;  3RKY A;  1B70 A;  1X54 A;  4JRI A;  4M7A G;  4YRJ A;  1NJ6 A;  5C52 B;  4EMK A;  2DTH A;  1X56 A;  2ARS A;  3LSS A;  4J6W A;  1EOV A;  3HSB A;  2E5A A;  4ZTZ B;  3EFR A;  1N9W A;  2DDZ A;  2E3C A;  4M78 D;  3P8V A;  4UPA A;  4G85 A;  4YCV A;  5LJ5 f;  2ZR3 A;  4QVD A;  4XTW A;  2DTO A;  2RHS A;  5LJ5 g;  4HT8 A;  3A5Y A;  4M78 C;  2YLC A;  3UH0 A;  2ZGW A;  2ART A;  4XEO A;  4M7A E;  2EL9 A;  2RB6 A;  3HXY A;  4DPG A;  4YRO A;  3RF1 A;  3L4G B;  3QUI A;  2VC8 A;  3HXU A;  1B34 B;  4M78 B;  3UGQ A;  4H2X A;  1NJ2 A;  3AHU A;  3V8J A;  5LJ5 d;  4M7D F;  4P71 C;  1EIY B;  3I7F A;  3HXZ A;  1X2G A;  1QF6 A;  1PYS A;  4RCB A;  4TWA A;  4M75 F;  4PHC A;  4TVW A;  4ZIB A;  4H2Y A;  1HC7 A;  3SWN C;  3QTC A;  4H2W A;  3R07 A;  2RA2 A;  3BFM A;  1Y96 A;  1MGQ A;  2ZR2 A;  3QNE A;  4K87 A;  2ZTG A;  4M77 A;  4M7D D;  1ADJ A;  3P8Y A;  4CH5 A;  2ZT5 A;  2E64 A;  4YRP A;  3P8T A;  4CH3 A;  3RES A;  3SWN B;  3BJU A;  3A32 A;  2EJF A;  4K88 A;  5GMK l;  3JCM g;  2Q7H A;  1E24 A;  4M7A F;  4YDQ A;  2CJ9 A;  1M5Q 1;  1I8F A;  2DU7 A;  3NEN A;  3PCO B;  4F7U G;  4HWT A;  4M77 G;  4C92 G;  4HVC A;  2DVE A;  4E51 A;  4M75 A;  1NYQ A;  1SER A;  4P73 A;  4P72 C;  1B7Y B;  1SRY A;  4H2V A;  1HTT A;  4XU0 A;  4BWA A;  3REX A;  4UP8 A;  4XTY A;  3JCM d;  2ODR D;  1JJC B;  2DZC A;  3TEG A;  2EJ9 A;  4XTU A;  2ZT6 A;  4RDX A;  3A5Z A;  3A7U A;  1BBW A;  4F7U E;  2HNI A;  4M77 E;  4C92 E;  2ODR C;  2ZNI A;  4NOY A;  3REU A;  2ZZE A;  1LOJ A;  2IY5 B;  4M7A A;  2I4N A;  2E10 A;  5GAO r;  5GAN 5;  1EQR A;  1G51 A;  2ZNJ A;  4Y91 A;  3HY1 A;  5GMK m;  5GAO l;  2PMF A;  1YGB A;  3JCM c;  4XU1 A;  3RAC A;  3V7C A;  2XGT A;  4H2T A;  1IL2 A;  4YRQ A;  4CS4 A;  3VU3 C;  4P74 C;  1LNX A;  3PGG A;  2AKW B;  4RMF A;  4YYE A;  3JCM P;  4EMK C;  2Q5I A;  1KQ1 A;  3RUX A;  3IKL A;  3NEL A;  4HWO A;  3HXW A;  3V7S A;  3V8K A;  4YCW A;  4EX5 A;  2ZXF A; 
#chains in the Genus database with same CATH topology
 2LTO A;  2KI7 A;  3QJY A;  1PD1 A;  4OML A;  4H2U A;  3M0Q A;  4HWP A;  3M56 A;  2P0Q A;  4KBM B;  3GLX A;  3HKS A;  3CPW A;  1P92 A;  4XTV A;  3IG2 A;  2L0A A;  2CUB A;  1W70 A;  4RCC A;  1JQQ A;  3L2W A;  1EZZ B;  2EYY A;  1R8O B;  1VQP Q;  3JB9 G;  5HK0 A;  2HZY A;  2IVW A;  2KRS A;  3JCM h;  3G71 T;  1VQ5 Q;  4CH4 A;  2LX7 A;  1VQL A;  3EFO A;  4YRM A;  4FW1 A;  4LVM A;  4WJ3 M;  3BDL A;  1K8A U;  4RQE A;  3G4S A;  1RAA B;  2J6O A;  3BY7 A;  4OP0 A;  2KRM A;  4D8D A;  1W66 A;  2L5Q A;  2QQA A;  3G1J A;  3LC0 A;  2X51 A;  1G5H A;  2K2M A;  4WTO B;  1MMN A;  4PJO G;  3CBO A;  3CCV T;  3C95 A;  2CSQ A;  2EIF A;  4BB7 A;  4M77 C;  4JJN K;  4HVW A;  2K6D A;  3L2R A;  1YIT T;  3C0C A;  5KH6 A;  2CP0 A;  2QAS A;  3X28 B;  1H64 1;  2PTK A;  2SRC A;  4WI1 A;  1ADY A;  2ALY A;  2XG8 D;  3LH5 A;  3TUP A;  5LJ3 e;  1UG1 A;  1OZ2 A;  3MKD A;  4QT7 A;  3KFU A;  3CPW S;  4H2S A;  1GCP A;  1QE0 A;  5GAM j;  2NWM A;  1K8A C;  3CCE Q;  2FO0 A;  4M75 C;  3HRI A;  3URG A;  1D1A A;  2DX1 A;  1D1B A;  2QI2 A;  4M4Z A;  4E7H A;  1M1K U;  4LVJ A;  3BW1 A;  1FMW A;  3TCJ A;  1KMM A;  2WAC A;  1L0W A;  4YRT A;  2KDS A;  1UEC A;  4DBH A;  3M0T A;  4RG2 A;  4BY6 B;  1AWX A;  1IXD A;  2DQ3 A;  4PJL A;  2ATC B;  3JB9 F;  2DL8 A;  4KUL A;  4M7A C;  2E70 A;  2C8M A;  3EHQ A;  3CCL Q;  2EQI A;  1JBM A;  2Y90 A;  1VQP T;  2FPE A;  1D3B B;  5CKE A;  1VQ5 T;  3EG1 A;  1RAB B;  2E6Z A;  5GMK e;  1M1K C;  3FEO A;  3HRS A;  2LX9 A;  1W1F A;  3CD6 A;  4PJO F;  2DPP B;  9ATC B;  1K0X A;  4WCI A;  4F04 B;  2YHT A;  1HJD A;  3CCS A;  1VQN Q;  2EYZ A;  1U8R A;  4EIK A;  1RUW A;  2FRW A;  1A0N B;  4YP0 A;  4FIB A;  3OMG A;  1BB9 A;  2DD4 A;  1S72 Q;  2FL7 A;  3NTI A;  2ZCE A;  3EH1 A;  3CME Q;  1WJS A;  2DIG A;  5IN1 A;  3HXV A;  2DEQ A;  4RTX A;  4TTV A;  4RTW A;  5LJ3 g;  2E6N A;  2DER A;  1HXD A;  1Y07 A;  1K73 R;  1QVP A;  5KYU A;  2R58 A;  3PIP A;  4FM4 B;  4EO4 A;  4P3O A;  1M3A A;  1QLY A;  1G2B A;  1FWZ A;  1VQO A;  4BAC A;  3CCE T;  2JTE A;  1ZX6 A;  3A8G B;  3SB2 A;  1S72 A;  5CQX A;  3VV0 A;  1E22 A;  4YRG A;  3C12 A;  1IGQ A;  2BE7 D;  5FRO A;  3RL6 A;  5CKH A;  2JMA A;  4Q6G A;  3HTR A;  2EJG A;  5GAM d;  4A53 A;  2LNH B;  3MHX A;  4JUV A;  4FYV B;  2MWO A;  2E12 A;  3CD6 T;  3I9Q A;  4X34 A;  4K11 A;  2KXD A;  4V2S A;  1R0C B;  1YFT A;  4MMK A;  3JCM J;  1OU9 A;  3X20 B;  3LW5 E;  5GAN d;  1KQS A;  3OA6 A;  5D6W A;  3MP6 A;  2ZIN A;  2P0P A;  4BE1 A;  1IRX A;  1EIY A;  4ATO A;  3CCL T;  4YTL A;  1QVG A;  1QWF A;  4XAX B;  2EAY A;  3A7A A;  1MV0 B;  2DEU A;  2A0F B;  2F2W A;  2DF6 A;  4N4G A;  3DKM A;  4KUD K;  2LQN A;  1NBE B;  2KYM A;  3VS6 A;  4O2D A;  5DLO A;  5KYX A;  4F7U B;  3P8B B;  3MEY A;  3UA7 A;  4M77 B;  4M78 G;  4CS2 A;  1Q81 C;  3A31 A;  4L5G A;  2E5K A;  5FU7 C;  1VQN T;  5CKB A;  2F1L A;  1VQO T;  3L1A A;  3TRE A;  3QYG B;  3A74 A;  1TSF A;  2KT1 A;  3OS1 A;  1M2O A;  1S72 T;  3UF4 A;  3MPU B;  2XK0 A;  2YT6 A;  2F5T X;  2O2O A;  3CME T;  1FMV A;  3M4Q A;  2QEX Q;  3OS5 A;  1N5Z A;  1NPR A;  3IKM B;  1RAD B;  1K8A R;  4L87 A;  1BI0 A;  4XTX A;  2DNU A;  2ESW A;  1OUL A;  5CCA A;  5GAO n;  5LJ3 h;  3T9N A;  1KQS S;  5KYW A;  8AT1 B;  3OYB A;  5GAN 8;  1JJ2 A;  2PVO B;  4JZ3 A;  3I5S A;  3PVL A;  1RLP C;  1QVF A;  2CH4 A;  3HFZ B;  1UGP B;  4H02 A;  2B8A A;  1BIA A;  4P72 A;  1OPL A;  2RHQ B;  1C0M A;  1AWJ A;  2A7Y A;  3ZFJ A;  1X01 A;  1YJ9 A;  4XK8 E;  2J3M A;  1N8R U;  1D3B A;  4LD9 K;  4KRT A;  1TS9 A;  1BU1 A;  4PNO A;  4AFQ C;  4M75 G;  2WSC E;  1U3O A;  4TVA B;  4KH0 B;  3ICA A;  2RJF A;  4YRN A;  1USY C;  3RER A;  2ZT7 A;  1YB3 A;  2MIO A;  2AKW A;  1M90 U;  1Z7N A;  3H9N A;  5KYN A;  4C5H A;  4KR3 A;  2AT1 B;  3THK A;  2ZZG A;  4M78 F;  2DZ9 A;  1Y57 A;  1IHW A;  2BZY A;  2EW3 A;  4JJD A;  2VUB A;  4OF1 A;  3SD4 A;  4LE9 A;  4CS3 A;  4JZ4 A;  2AMC A;  2JZ2 A;  3M53 A;  5I21 A;  1GFC A;  5HGQ A;  2DLP A;  1B70 A;  1RI0 A;  4JRI A;  4M7A G;  1JJ2 S;  3S6W A;  1Y71 A;  4EMK A;  3OW2 A;  1E6H A;  2DTH A;  1BI1 A;  4QKU A;  1O75 A;  1QVF S;  1K9M C;  4ZTZ B;  4FCY A;  1YN8 A;  4UPA A;  4DOV A;  4YCV A;  4EPC A;  5LJ5 f;  4QVD A;  3QPH A;  1UGV A;  2EFI A;  1M9S A;  2LJ0 A;  2AK5 A;  3LYI A;  3EGX A;  3HXY A;  3EGD B;  4RTY A;  2RNA A;  3L4G B;  2HEQ A;  2HCK A;  1U06 A;  2AKL A;  1NPP A;  1B34 B;  2LJ1 A;  2RQT A;  4H2X A;  3QZ9 B;  3HXZ A;  1QF6 A;  3ME9 A;  1M1G A;  2MPX C;  4M75 F;  2FZG B;  4ZIB A;  2V8I A;  5A0L A;  3D7S B;  2LCL A;  4JPB W;  4R56 A;  3J80 E;  4H2W A;  1KHI A;  2O01 E;  4RUG A;  4HKE A;  3R07 A;  2RJD A;  1YJW A;  3OW2 S;  3BFM A;  2GBQ A;  2ZR2 A;  2CT4 A;  4M77 A;  1SEM A;  2EQK A;  4OGE A;  4KUI A;  2AZS A;  2A8E A;  4LVL A;  2W10 A;  2DAQ A;  2E64 A;  4MZT A;  1VOM A;  4CH3 A;  2MK5 A;  4IIM A;  4J9H A;  1NM7 A;  2J6F A;  3VS4 A;  5GMK l;  5KE2 A;  2OX7 A;  4M7A F;  1JXO A;  2RH2 A;  1OU8 A;  3C94 A;  2QGG A;  2DU7 A;  1Z9Z A;  2OAW A;  3LLR A;  3SFM A;  3PCO B;  3CXC S;  2WSF E;  1ZSZ B;  4M75 A;  5D6Y A;  1KD1 U;  2JXB A;  3S3M A;  2GQI A;  2VVK A;  3QG1 A;  5D7U A;  1ZBX A;  1JXM A;  3REX A;  2CH4 W;  5I22 A;  4UP8 A;  1WHK A;  4BE0 A;  3TEG A;  5CVI A;  4FYY B;  4RDX A;  4PL6 A;  1BBW A;  2M1H A;  4F7U E;  2QQS A;  4M77 E;  2ZNI A;  1XQH A;  1YJW T;  1LOJ A;  1VQK A;  4M7A A;  2E10 A;  5GAO r;  2JM8 A;  1EQR A;  2ZNJ A;  1PKT A;  1TUD A;  3OYG A;  4OVA A;  2NUP A;  1DJ7 B;  2IG0 A;  4H2T A;  3OMC A;  4ZTF A;  4CS4 A;  3VU3 C;  4RMF A;  4YYE A;  5EG2 A;  3JCM P;  3PNW C;  4JJB A;  2Q5I A;  1KQ1 A;  2E3I A;  2L3R A;  3HXW A;  5CO7 A;  3TU4 K;  3V8K A;  3J81 E;  1G3W A;  3OQ5 A;  3KXT A;  3CMQ A;  2X4X A;  5KYY B;  5E3I A;  1G3Y A;  1ASZ A;  2JVV A;  5ELN A;  4J5Y A;  1YP5 A;  2LZ6 B;  1KHC A;  1MMG A;  4HCC A;  1N8R R;  1YFR A;  2C7I A;  2QHU A;  2ZPE B;  3LX7 A;  4BI3 A;  2X4Y A;  4HWR A;  2L3Q A;  2K3X A;  4LN2 A;  3CCM A;  2C06 A;  2V8J A;  5GAO m;  2YUP A;  1VYT A;  3RMQ A;  5CKD A;  1AWO A;  1M90 R;  1KSW A;  3CPF A;  4LDY A;  3L4G A;  4R0K A;  4M77 D;  5GAO p;  1NYR A;  3RR6 A;  1AOJ A;  4PLL A;  1B34 A;  5HCK A;  5AYF A;  4C5I A;  2QHT A;  1PD0 A;  3X25 B;  3JB9 J;  4PFP A;  2KT8 A;  2YWW A;  2VB6 A;  1PYS B;  3NHN A;  1SF9 A;  1I5O B;  4PFZ A;  2H3E B;  3E1S A;  2E3H A;  2LVM A;  3A8O B;  1BBZ A;  4RTU A;  2ARU A;  5FU6 C;  5AT1 B;  3ERR A;  4FL6 A;  2X4W A;  1RAC B;  5GAM e;  5GMK i;  4ELY C;  4NCX A;  1RAG B;  1WIE A;  2DYB A;  3S3O A;  4M75 D;  2DRK A;  4QQ6 A;  3HP9 A;  2CP2 A;  3OS2 A;  1ZA2 B;  3E2U A;  2QTX A;  5C0M A;  2NLU A;  1RAE B;  2M9U A;  3M0S A;  3Q1J A;  3VBB A;  4X5O A;  3VS5 A;  4BY6 C;  3OYJ A;  2ROT A;  3QDR B;  5GAN e;  3KFV A;  1H4T A;  4GLK A;  1E1T A;  5IXB A;  3OY9 A;  3CCM T;  3CC2 Q;  2OAU A;  1T0J A;  4JLG A;  5IHK A;  1HD3 A;  1NJ5 A;  4JRK A;  2QXF A;  4M7D B;  2KXC A;  1GBQ A;  5J3B A;  1KJW A;  1PRL C;  2HL5 C;  2COZ A;  2IIM A;  2HKQ B;  4J15 A;  4M7A D;  2RHI A;  3M4G A;  3EG0 A;  2RI2 A;  2KK4 A;  6AT1 B;  3NEM A;  4OB0 B;  4HCB A;  2C0O A;  3NTK A;  5C51 B;  4YRC A;  2A3L A;  2K9G A;  3A8H B;  3OBY A;  2QQR A;  3CCQ Q;  3CC2 A;  2I4O A;  3H8Z A;  1W2B A;  2KAF A;  3O8V A;  5L8R E;  3OYI A;  11AS A;  2CJB A;  4DBF A;  3F70 A;  4J7F A;  2GTJ A;  4F16 A;  3UT1 A;  3UAT A;  3VUZ A;  3S3N A;  2K57 A;  3X24 B;  3QHS A;  1ATI A;  3EHR A;  2Q7G A;  3MQZ A;  1RL2 A;  2HDA A;  3M57 A;  4ANJ A;  2V8K A;  2FB7 A;  2E1H A;  3L2Q A;  4XEM A;  2PQW A;  1KD1 R;  2ZPB B;  3REB B;  1USY A;  1VQ7 A;  2O4X B;  3CC4 Q;  2BE9 B;  5GAM g;  1EFW A;  2DQ0 A;  4E7J A;  1BIB A;  2EGA A;  4O6J A;  1WYD A;  2G4C A;  2CKK A;  1U5S A;  1UB4 A;  3UWN A;  1YCS B;  3CMA Q;  2D1X A;  2P0L A;  1K4U S;  3OYF A;  2FPF A;  5GAN g;  2RHS B;  1D0Y A;  4PLI A;  1MMA A;  1PSE A;  3PZC A;  2QA4 Q;  2GF7 A;  4C0F A;  3CC2 T;  4ZTJ A;  4PJO B;  1X75 C;  3M58 A;  1W2B S;  2DL4 A;  3OSV A;  1YHQ Q;  1BBU A;  2CT3 A;  1I5L A;  1WQW A;  1QCO A;  2J3L A;  4LVI A;  1YJN Q;  1X2Q A;  2K7A A;  3MEA A;  2HQH A;  3PT9 A;  4IUQ A;  1W6X A;  4FW2 A;  4GBQ A;  4CH6 A;  4J8O A;  1LJO A;  1PWT A;  2E41 A;  1VQP A;  4AFS C;  3UFG A;  1OEB A;  1AEY A;  2DXU A;  1VQ5 A;  2J06 A;  4PKC C;  3QSU A;  4YRF A;  3EH2 A;  2ZIM A;  5CK9 A;  3QZ5 B;  3FB9 A;  1VQ7 T;  3MCA B;  5K1P A;  1EFN A;  2ROL A;  1PCX A;  2PVD B;  3V8L A;  4C92 B;  1MUZ A;  2DBM A;  2HKN A;  3LWI A;  2CS7 A;  2XMF A;  1NZ9 A;  4L6V 5;  4MDW A;  2RD1 A;  1YWO A;  4PJN A;  2PNI A;  5FU6 B;  4PG3 A;  1N6A A;  3CBP A;  1X69 A;  2L3S A;  5GAN j;  5GAN 7;  3HTZ A;  3RBB B;  4KGX B;  2Q7E A;  1UGR B;  2DL5 A;  3G7Z A;  4X9D A;  2CSI A;  3UDC A;  2JM9 A;  3CC4 T;  3M0R A;  3TEH B;  2M51 A;  1QP2 A;  2EYX A;  4QVC A;  4M7D A;  4AMC A;  4A4E A;  5GAM h;  3JAM E;  3CCE A;  3CC7 Q;  3RIR A;  3CMA T;  2I0N A;  4HWS A;  1IGU A;  2EQJ A;  3LH0 A;  3OYE A;  3SHW A;  2Y4Y A;  2VXE A;  2QA4 T;  2HQX A;  1B7T A;  1U1T A;  4FSX A;  5GAN h;  4Z02 A;  1YHQ T;  12AS A;  5C6S A;  2CRE A;  3E9I A;  4O5V A;  4ORZ A;  2IY5 A;  2FYK A;  3A98 A;  1WXU A;  4P75 C;  4C8Q B;  1M2V B;  4OMP A;  3DSQ A;  5HKC A;  4JLI A;  1TUC A;  1YNZ A;  3CCL A;  1PNJ A;  3TSZ A;  4CC4 B;  1B76 A;  2QTV A;  3QKJ A;  4HA8 A;  2Y4X A;  1MV3 A;  4TQD A;  2LQ8 A;  4YRE A;  2DKG A;  2YLB A;  4HVU A;  1TXQ A;  3A7R A;  4M7D E;  4KH1 B;  3L2U A;  2K3B A;  1WFW A;  1FMK A;  1M30 A;  3ZEH A;  2GFA A;  4QVZ A;  2G3R A;  1FXX A;  3MET A;  1VQN A;  3QO5 A;  5FW9 A;  4MZP A;  1UDL A;  1OV3 A;  3OYD A;  4IUP A;  1X56 A;  3LSS A;  4VUB A;  2R5A A;  1XTD A;  3CME A;  1N9W A;  4DEX A;  3EG3 A;  1EX4 A;  2CP3 A;  2F2X A;  1JB0 E;  2ZR3 A;  1Q82 U;  2EYQ A;  1NEB A;  2LDM A;  1Q81 U;  2RHS A;  3OSS C;  3VYH B;  1VYU A;  3A5Y A;  3H0H A;  5A0G A;  1M3C A;  4FU6 A;  3UH0 A;  1WHH A;  2JS2 A;  3C4S A;  2VWF A;  2K5L A;  3CC7 T;  3EAE A;  4ME7 A;  4CC3 A;  1KC8 U;  4M78 B;  1NJ2 A;  2AIR B;  4P71 C;  1Q86 C;  1PHT A;  1X2G A;  1D0X A;  3NTH A;  4GY5 A;  3VS1 A;  2RO0 A;  2COY A;  4RCB A;  4FT4 A;  4BE2 A;  4PHC A;  4TVW A;  1Q82 C;  4C5E A;  4J9C A;  2JTM A;  3QTC A;  1R77 A;  3P8H A;  2FRY A;  3OBW A;  3OYA A;  3VRZ A;  4M7D D;  2X4J A;  2XDD A;  4QQG A;  2CDT A;  4YRP A;  1UTI A;  1ZSZ C;  3RES A;  3SWN B;  3A32 A;  4LNP A;  2VKN A;  1KC8 C;  2MYS A;  1NJI C;  4IUR A;  1X6G A;  5HK3 A;  5M9O A;  3NEN A;  3M54 A;  4J9G A;  4F7U G;  4HWT A;  1WXT A;  4M77 G;  1TWB A;  4HVC A;  2SEM A;  1NYQ A;  3GOX A;  1SER A;  1OPK A;  2X3X D;  1QVG S;  1B7Y B;  2DYI A;  1WXB A;  3PMI A;  2QEX A;  4XU0 A;  4BWA A;  1QQJ A;  4BUG A;  1VYV A;  4E7L A;  1JJC B;  2EJ9 A;  5IHI A;  3PVQ A;  4XTU A;  2ZT6 A;  4C92 E;  1K9M U;  2BTT A;  4JS5 A;  1BI2 A;  2L3P A;  4PFO A;  2ZZE A;  2XDP A;  1BCO A;  1I07 A;  3NPF A;  1G51 A;  4AFU C;  1M1K R;  5GAO l;  4DBR A;  2KYB A;  2QAZ A;  4XU1 A;  2HSP A;  4CC7 A;  2XGT A;  2HBP A;  2ABL A;  4P74 C;  4OMF B;  2MF2 A;  2RJC A;  3OS0 A;  2X3W D;  2M16 A;  3O5Z A;  1VIE A;  4A4K A;  1X6B A;  3RUX A;  3CCJ Q;  4LDW A;  3V7S A;  3E9F A;  3HRT A;  3CCR Q;  2LQW A;  3VKI A;  2EQU A;  1WJR A;  2XI9 A;  2MOX A;  3JB9 H;  4N4I A;  1H4Q A;  1SHF A;  2VV5 A;  1CSK A;  1WLP B;  3FC3 A;  2QEX T;  2RJE A;  5KCH A;  4XU2 A;  2CGH A;  4YCU A;  3JV3 A;  3IQL A;  2F5K A;  3VS2 A;  1AWW A;  2AHJ B;  3H0F A;  4M77 F;  2MI6 A;  3HXX A;  4Y92 A;  2L89 A;  4C8Q E;  3NET A;  3I56 Q;  5GAN 3;  3JB9 I;  3CCU Q;  4DA4 A;  1RIQ A;  1WU7 A;  4WJ4 A;  3MF2 A;  3QJ6 A;  1X2H A;  2IPO B;  3DLM A;  4RKU E;  1OX8 A;  4OB2 B;  5CIU A;  3MO8 A;  1ZSG A;  1VQ4 Q;  4YRK A;  4IUT A;  4HT4 A;  3CXC P;  2L8D A;  1W4S A;  1Q7Y U;  1SSH A;  1TH7 A;  3I56 A;  2NUT B;  3CCU A;  1KIK A;  3A1P A;  1TG0 A;  4J9D A;  4F7U A;  1XJW B;  2FG0 A;  2O31 A;  1PSF A;  2CZ6 B;  4L59 A;  3E9H A;  2QHV A;  3MP1 A;  1VA7 A;  3L42 A;  2HD0 A;  3KUF A;  2V1Q A;  1IO6 A;  4BDZ A;  1Y96 B;  3VS7 A;  2NYS A;  3JCM f;  1WLE A;  1Q81 R;  2KRO A;  4M7D C;  2ED0 A;  2LT4 A;  2V1R A;  1H4S A;  1AZE A;  1PM3 A;  3LGF A;  2KRN A;  1I0C A;  1X43 A;  3OD1 A;  4LUD A;  1NYF A;  5GJV B;  4GLM A;  2KE9 A;  3CCJ T;  4P73 C;  3A8L B;  1OX9 A;  1Q7Y C;  4LDV A;  2LMJ A;  1G5I A;  2JUF A;  3CCR T;  4B9W A;  3GF5 A;  3CQT A;  1NNH A;  2RN8 A;  3MJX A;  1IZ6 A;  5FWC A;  1XOV A;  1OYX A;  2DE0 X;  2DXC A;  3PIO A;  4LVK A;  2RHU A;  2VGM A;  5A0D A;  2DJZ A;  2E65 A;  1B7Y A;  2A08 A;  3HFZ A;  1UHF A;  2L2P A;  2HSE B;  4RMO A;  2RHQ A;  1AD5 A;  3JCM Q;  2DET A;  3I56 T;  4BW9 A;  3CCU T;  2CP7 A;  4JJC A;  1TTH B;  3A5Z B;  1WGS A;  1JRI A;  3JCM b;  2ENM A;  4UC4 A;  4P5N A;  2PME A;  2EQM A;  2P5I A;  1H3Z A;  4J6Y A;  2HQE A;  2ED1 A;  4TVA A;  4NL2 A;  1ZQ1 A;  2D0Q B;  1IB8 A;  1VQ4 T;  2O9V A;  3HFN A;  4P75 A;  1NYG A;  5GAO q;  3GNG A;  3VQV A;  4E6R A;  2YRV A;  2OTL Q;  4P3P A;  2KMT A;  4ZN3 A;  4E7K A;  3QO3 A;  3TEE A;  1WHM A;  2C0I A;  3QWX X;  4A4F A;  2F2V A;  5GAM f;  4RQF A;  1SET A;  1WPY A;  1JU5 C;  1D09 B;  2YUO A;  4BDY A;  2MAM A;  2I4M A;  2I2L A;  2MCN A;  3GBQ A;  4UP9 A;  1GCQ C;  2ZPF B;  4WF2 A;  4PJO C;  4DEY A;  5I11 A;  4II1 A;  2EYW A;  2DIQ A;  3INZ A;  1PRM C;  5GAN 6;  4YRL A;  1H8K A;  3HRU A;  3M0U A;  2OTL A;  5ELO A;  3L2V A;  1K9M R;  3WVD B;  1KOG A;  2DA9 A;  1G3T A;  3FRN A;  1SSF A;  3G6E Q;  4ZN1 A;  4X9C A;  2JMC A;  4LDU A;  3U23 A;  3EGD A;  1UEB A;  1GGM A;  2QDY B;  2XDB A;  2O88 A;  5IXF A;  1VQ9 Q;  2GGR A;  4EMH A;  3RMS A;  4C92 C;  2JS0 A;  1EVK A;  1MND A;  4A63 B;  2M0O A;  4J9I A;  3G6E A;  2K4Y A;  2YUN A;  1SRM A;  1WI7 A;  2XKO C;  2CJA A;  1N9S A;  3LGL A;  1JEG A;  4P71 A;  2ALY B;  2A28 A;  3BDU A;  3MP8 A;  4N0A C;  2RM4 A;  1AVZ C;  2EGE A;  2OTL T;  2NUZ A;  3QDF A;  3HFO A;  2Q5H A;  3I55 Q;  1M8M A;  1MMD A;  4TVY A;  2AKK A;  3WQZ A;  2PUO B;  3PCO A;  2LCS A;  1B8A A;  4J9E A;  3A8M B;  1ZSZ A;  4PK4 A;  5LJ5 j;  2V26 A;  3J7A F;  1KK7 A;  5CQY A;  1Q7Y R;  3CBM A;  2ZPI B;  1NLO C;  4LD6 A;  2RHY A;  4HCK A;  2KNB B;  3WXM B;  4J7I A;  4C8Q C;  2OTJ Q;  2VYT A;  4E2F B;  2VGN A;  2C0T A;  1Z7M A;  3SEM A;  2RHZ A;  4C5G A;  1K73 U;  4CC2 A;  1KMN A;  3H0I A;  3I55 A;  3I35 A;  2FHD A;  2CP6 A;  3G6E T;  4Q15 A;  1ZBJ A;  2K79 A;  1KFZ A;  1QMC A;  3CCV Q;  4M7D G;  5K1X A;  1OQK A;  2EKO A;  4YPF A;  5LJ5 h;  1ARK A;  1WA7 A;  3JCM X;  1VQ9 T;  1ACM B;  2CZ1 B;  2DL3 A;  4ZTU B;  4JRP A;  3CCQ A;  5LJ3 f;  1FYF A;  3QXE B;  3VS0 A;  3JCM W;  3WVE B;  2ZPH B;  2BIV A;  4YRS A;  2XHC A;  1SG5 A;  4OGC A;  1K73 C;  5KNN A;  2YSQ A;  2ZZF A;  5KYY A;  4JS4 A;  1ZA1 B;  4F14 A;  4NL3 A;  4P74 A;  3RKY A;  4ELZ C;  3PFS A;  1V76 A;  5KYU B;  4OB3 B;  2E4H A;  1UE9 A;  2ARS A;  4J6W A;  1EOV A;  3HSB A;  2E5A A;  1VQL Q;  1V29 B;  2ZCF B;  3P8V A;  2E3C A;  5FLX E;  4G85 A;  3CPW P;  3H41 A;  3G4S Q;  3I55 T;  4XTW A;  3CC4 A;  2DTO A;  2AZV A;  1F1B B;  3UPU A;  4M78 C;  1OOT A;  4Z88 A;  1RLQ C;  2EL9 A;  2RB6 A;  4ZNX A;  1M1F A;  3CMA A;  4DPG A;  3QWY A;  4YRO A;  3RF1 A;  4OMM A;  2B86 A;  1AHJ B;  2P4T A;  4N4H A;  2OTJ T;  2QA4 A;  1LPL A;  4R55 A;  1D0Z A;  3CCQ T;  3AHU A;  1N27 A;  5LJ5 d;  1YHQ A;  4M7D F;  1EIY B;  4KGZ B;  1YJN A;  1PYS A;  3DLL A;  3OYN A;  4TWA A;  2FZK B;  4CI0 C;  4H2Y A;  1RAI B;  2P84 A;  1Z9Q A;  3SWN C;  1UJ0 A;  5KYX B;  1MGQ A;  4BI4 A;  4K87 A;  5KE3 A;  1J3T A;  2M02 A;  1ADJ A;  1C6V X;  2EBP A;  4CH5 A;  2EKH A;  3P8T A;  1LCK A;  4E7I A;  3BJU A;  2RHX A;  1QKX A;  2EJF A;  4AT1 B;  4K88 A;  2Q7H A;  2YUQ A;  1E24 A;  4LDX A;  3EGU A;  1B07 A;  1G5V A;  4DBQ A;  3TSW A;  4C92 G;  1OI1 A;  5HY6 A;  2X35 A;  2DVE A;  2FPD A;  2BUD A;  4OMQ A;  4P73 A;  1G8X A;  1VQL T;  3GPL A;  1HTT A;  5KYW B;  1UUE A;  1AT1 B;  3CD6 Q;  2RMO A;  3G4S T;  2QK0 A;  4XTY A;  5J26 A;  3JCM d;  4IUU A;  2DZC A;  2D8H A;  1YJN T;  2RQR A;  4CRI A;  1H92 A;  2R57 A;  3CCS Q;  1PC0 A;  3PE0 A;  1NEG A;  1UGS B;  4A4H A;  4ZGD B;  2ODR C;  4NOY A;  5D6X A;  1WX6 A;  4NS5 A;  5IAY A;  3CC7 A;  3REU A;  1Y7X A;  1BYM A;  2PZ1 A;  3HY1 A;  2EVR A;  3QYH B;  1WJQ A;  1Y0M A;  1YGB A;  3V7C A;  2OI3 A;  4D6W A;  2PU9 B;  4YRQ A;  3TVT A;  1NE8 A;  1LNX A;  3PGG A;  2MMP A;  2AKW B;  5I2M A;  1VQO Q;  1UHC A;  1WZO A;  2QQB A;  2YRC A;  2O4X A;  3QBY A;  4DOW A;  5FWB A;  4C8Q G;  4D8K A;  3HRK A;  5J39 A;  1Q86 U;  1E7O A;  3OYC A;  2AMC B;  4OB1 B;  3RNJ A;  3ULR B;  8ATC B;  1B70 B;  3VUB A;  4EMK B;  1XNI A;  2VXF A;  1E1O A;  4C0D B;  2OJ2 A;  1UFF A;  2QQ9 A;  4HCZ A;  2LC4 A;  2XIC A;  4KR2 A;  4C92 F;  1GCQ A;  3OYK A;  4PJO A;  4KT0 E;  2CZ7 B;  3GIB A;  3HL8 A;  1UJY A;  1X27 A;  1YCY A;  2PVG B;  3L2Z A;  2ZZD A;  3NMZ C;  4E47 A;  3EG9 B;  3EGX B;  1I4K 1;  2GNC A;  1NJI U;  2QG9 B;  2G6F X;  3UGT A;  1KQ2 A;  3MEV A;  1VQZ A;  3G1Z A;  2YRD A;  4ZGE B;  4OMN A;  1KQS P;  3R6N A;  3PTA A;  4E7S A;  4H2X B;  3CCS T;  1RAF B;  4Q5W A;  1IHV A;  3IAL A;  1QVG P;  1ZUY A;  2XTI A;  2HBW A;  1PKS A;  2LJ3 A;  4J9B A;  1EIF A;  1SRL A;  2XD0 A;  2RK1 A;  1O9S A;  4Z89 A;  4C92 A;  2KR3 A;  1U1S A;  1J5W A;  1K9A A;  1TU0 B;  3VS3 A;  1HK9 A;  4BI8 B;  2LT1 A;  3W3S A;  2E5Q A;  1E6G A;  4PJO E;  5LJ3 j;  5IHN A;  2K3Y A;  2CYZ B;  2EGC A;  3AT1 B;  2HAX A;  3M5A A;  4C0G A;  4TVR A;  4C8Q F;  2JN0 A;  1VUB A;  1YI2 Q;  3JRZ A;  4HVV A;  2GQV A;  3TEH A;  4N0A A;  4Y28 E;  2RI5 A;  2ZIO A;  5DY9 A;  4XTZ A;  1ZUK A;  3VQX A;  3GNF B;  4UP7 A;  3CEY A;  4HT9 A;  5FRN A;  3SDZ A;  4MML A;  1YJ9 Q;  1LYL A;  4M75 B;  4J6X A;  1JJ2 P;  1QKW A;  4TQF A;  2K5F A;  4RTZ A;  2FEI A;  1YFS A;  1RAH B;  2DTI A;  2YDL A;  1WQ7 A;  4A4G A;  2F69 A;  1HSQ A;  1QVF P;  2DO3 A;  5A2Q E;  1NLP C;  1YI2 A;  3VQY A;  5CAI A;  3BE3 A;  1GL5 A;  1MNE A;  1T0H A;  2QHS A;  3VYG A;  2J6K A;  3FDR A;  1M3B A;  1YWP A;  4C0Z A;  3QO8 A;  3GP8 A;  4C8Q A;  1M2V A;  3LWH A;  3FJP A;  2RQU A;  2QDL A;  2DL7 A;  3DB3 A;  2LP5 A;  4M7A B;  3JB9 D;  5GMK j;  3VQW A;  3MEU A;  4LUE A;  2PUK B;  3HPW A;  3QO7 A;  3R6O A;  4RTT A;  2NUP B;  4FSS A;  2HL3 A;  4EMG A;  3N5B B;  1NJ1 A;  2CIM A;  3ASK A;  4IUV A;  3HFV A;  2RF0 A;  4PJO D;  2DXT A;  1ASY A;  2GCX A;  1KG1 A;  2QGF B;  4Z8A A;  2JT4 A;  3OYL A;  3RKW A;  2LRQ A;  1WNL A;  2KQW A;  3OW2 P;  5GMK h;  5I2S A;  4XU3 A;  2I4L A;  3NGP A;  4F7U F;  5GAN 4;  4IIO A;  1M8V A;  2JTF A;  2MWP A;  1IRE B;  3KBG A;  1N8R C;  1B3Q A;  1BKB A;  5LL6 S;  3CCJ A;  2DD5 A;  1ZHI A;  1QWE A;  2EWN A;  2JOY A;  1YI2 T;  1ABQ A;  2KSS A;  2XID A;  3CCR A;  1VQ8 Q;  5LJ3 d;  1I1J A;  2J05 A;  2JW4 A;  1YJ9 T;  1M90 C;  2NS6 A;  4C92 D;  2HMA A;  2LNV A;  4FYW B;  3EG9 A;  4P3N A;  1RI9 A;  2DU5 A;  4M78 A;  1FX7 A;  2Z0W A;  1SES A;  1YJW Q;  2JNG A;  2CP5 A;  2FZC B;  4AH6 A;  4PJM A;  3OYM A;  3CXC A;  3RGL A;  2K5I A;  2DJQ A;  3OYH A;  1K0S A;  1ABO A;  3TQ7 P;  1NG2 A;  3ZL7 C;  1G83 A;  1VQ8 A;  3LSQ A;  1Q86 R;  1T3L A;  1N9R A;  3V7R A;  3E9G A;  3RKX A;  2KEA A;  2DM1 A;  3FIF A;  1Q82 R;  1VQ4 A;  1SHG A;  2ZPG B;  3H6Z A;  1OZ3 A;  1ZLM A;  3EFS A;  1VQM Q;  4G84 A;  3HY0 A;  4YRI A;  1M27 C;  1X55 A;  2KGT A;  3SWN A;  2H3J A;  2VAS A;  1MHN A;  3VJP A;  4ZGJ B;  1EVL A;  5C53 B;  2RQW A;  3I5R A;  4B9X A;  2LQK A;  2RQV A;  4FYX B;  2CZ0 B;  4ESR A;  1KC8 R;  4A54 A;  3DB4 A;  4M78 E;  5FU7 B;  5LJ5 e;  1NJI R;  2A37 A;  5ECA A;  4C8Q D;  1K1Z A;  3JCM V;  3ER0 A;  5F5W A;  2ZT8 A;  4K86 A;  1S1N A;  1VQM A;  2DVJ A;  2BZ8 A;  2RK2 A;  3REA B;  4KQE A;  5EC7 A;  1VQK Q;  3QII A;  1R0B G;  1H4V B;  2D9T A;  2DRM A;  3M4P A;  3FLG A;  1JJC A;  2P4R A;  1I81 A;  1HYO A;  4LNS A;  1WYX A;  2COW A;  4XQ3 A;  1QCF A;  2RPN A;  4OLF A;  1VQ8 T;  1CKA A;  1C0A A;  1CKB A;  4PJJ A;  2D8J A;  2DBK A;  1WDX A;  1X6O A;  2K2V A;  3M59 A;  4YRR A;  4KGV B;  1K76 A;  4FT2 A;  2KBT A;  4HXJ A;  3MF1 A;  4DQ2 A;  1KD1 C;  4AG2 C;  2ECZ A;  1T3S A;  2BZX A;  1QW1 A;  3JCM e;  2P0K A;  1BK2 A;  4M75 E;  2XU8 A;  5GAN 2;  1NJ8 A;  4B6M A;  5GAN f;  1X54 A;  5L23 A;  4QQD A;  4YRJ A;  2GTO A;  1VQM T;  1NJ6 A;  5C52 B;  5FRM A;  3CCM Q;  1YFN A;  2YXY A;  4EDU A;  1VQ6 Q;  1QP3 A;  3EFR A;  2DDZ A;  4M78 D;  4OMO A;  5LJ5 g;  4HT8 A;  5DM7 R;  4J9F A;  5KCO A;  2YLC A;  2JJ9 A;  1YIJ Q;  2ZGW A;  2ART A;  2KY9 A;  4XEO A;  4AG1 C;  4M7A E;  3EFO B;  3NFC A;  4LXC A;  3ZBD A;  1H3H A;  2DXB A;  4JDS A;  1X2K A;  2W0Z A;  1GXI E;  3QUI A;  1VQK T;  1WHL A;  1UGQ B;  1BI3 A;  1VQ6 A;  2H8H A;  4MZM A;  2DFU A;  1LVK A;  2VC8 A;  3HXU A;  2X9H A;  3M0P A;  3UGQ A;  3V8J A;  5IT9 E;  4X1V A;  3I7F A;  2NUT A;  2CUD A;  3RDV A;  1FYN A;  3FJ5 A;  1YIJ A;  2DIL A;  4QW2 A;  1HC7 A;  1YBY A;  2LCC A;  2KVQ G;  2RA2 A;  4AFZ C;  1VQ9 A;  1Y96 A;  3M4Y A;  3QNE A;  1G3S A;  2ZTG A;  1GFD A;  2BKD N;  3P8Y A;  1M4Z A;  4IKF A;  2ZT5 A;  3M55 A;  2R5M A;  2EPD A;  3OB9 A;  3PMT A;  3JCM g;  1AZG B;  4YDQ A;  2DMO A;  2CJ9 A;  1JO8 A;  1SKU B;  3M9Q A;  1M5Q 1;  1I8F A;  3UA6 A;  1V1C A;  1D1C A;  4MDX A;  2D6F A;  1WHJ A;  3G71 Q;  2M0Y A;  4E51 A;  4RG8 A;  1VQ6 T;  4P72 C;  5GJW B;  2RI3 A;  1SRY A;  3EG2 A;  4H2V A;  1GBR A;  5CR2 A;  2ODR D;  2GFU A;  1TOV A;  1GRI A;  2J7I A;  2WSE E;  3MEW A;  1WHG A;  1YIJ T;  3A5Z A;  3A7U A;  3VRY A;  1C1A A;  2ZAE A;  2HNI A;  1TUG B;  3X26 B;  1VIF A;  4RTV A;  3P8D A;  2DK3 A;  5IH2 A;  1YIT Q;  2QYZ A;  1PG5 B;  3G71 A;  2O9S A;  2D0N A;  2IY5 B;  1W2B P;  2I4N A;  2OTJ A;  3HHT B;  5GAN 5;  4Y91 A;  3JSC A;  1VQ7 Q;  7AT1 B;  5GMK m;  5DLQ E;  4BD3 A;  1QCN A;  2PMF A;  4JRQ A;  3JCM c;  3RAC A;  4E7Z A;  5CKF A;  4F17 A;  1IL2 A;  1SPK A;  3CCV A;  3E19 A;  3OYY A;  2A36 A;  1Q95 G;  4EMK C;  1ZUU A;  3IKL A;  3NEL A;  4HWO A;  4C0D C;  1BCM A;  1YIT A;  2FVU A;  4J83 A;  4YCW A;  4EX5 A;  2ZXF A; 
#chains in the Genus database with same CATH homology
 2LTO A;  3QJY A;  4H2U A;  4HWP A;  3M56 A;  2P0Q A;  4KBM B;  3GLX A;  3HKS A;  3CPW A;  1P92 A;  4XTV A;  3IG2 A;  4RCC A;  3L2W A;  1R8O B;  3JB9 G;  5HK0 A;  2IVW A;  3JCM h;  3G71 T;  4CH4 A;  1VQL A;  4YRM A;  4LVM A;  4WJ3 M;  3BDL A;  1K8A U;  4RQE A;  3G4S A;  3BY7 A;  4OP0 A;  1W66 A;  2L5Q A;  2QQA A;  3LC0 A;  1G5H A;  4PJO G;  3CBO A;  3CCV T;  3C95 A;  2EIF A;  4BB7 A;  4M77 C;  4JJN K;  3L2R A;  1YIT T;  5KH6 A;  3X28 B;  1H64 1;  4WI1 A;  1ADY A;  2ALY A;  2XG8 D;  3TUP A;  5LJ3 e;  1OZ2 A;  3KFU A;  3CPW S;  4H2S A;  1QE0 A;  5GAM j;  1K8A C;  4M75 C;  3HRI A;  3URG A;  2QI2 A;  4E7H A;  1M1K U;  4LVJ A;  3BW1 A;  3TCJ A;  1KMM A;  2WAC A;  1L0W A;  4YRT A;  2KDS A;  4RG2 A;  4BY6 B;  2DQ3 A;  3JB9 F;  4KUL A;  4M7A C;  2E70 A;  2C8M A;  1JBM A;  2Y90 A;  1VQP T;  1D3B B;  5CKE A;  1VQ5 T;  2E6Z A;  5GMK e;  1M1K C;  3FEO A;  3HRS A;  2LX9 A;  3CD6 A;  4PJO F;  2DPP B;  2YHT A;  3CCS A;  1U8R A;  4YP0 A;  4FIB A;  3OMG A;  2DD4 A;  2FL7 A;  3NTI A;  2ZCE A;  1WJS A;  2DIG A;  5IN1 A;  3HXV A;  2DEQ A;  4TTV A;  5LJ3 g;  2E6N A;  1HXD A;  1Y07 A;  1QVP A;  2R58 A;  3PIP A;  4FM4 B;  4EO4 A;  4P3O A;  1FWZ A;  1VQO A;  4BAC A;  3CCE T;  3A8G B;  3SB2 A;  1S72 A;  5CQX A;  3VV0 A;  1E22 A;  4YRG A;  3C12 A;  5FRO A;  3RL6 A;  5CKH A;  4Q6G A;  2EJG A;  5GAM d;  4A53 A;  3MHX A;  4JUV A;  2MWO A;  2E12 A;  3CD6 T;  4X34 A;  4V2S A;  1YFT A;  4MMK A;  3JCM J;  3X20 B;  3LW5 E;  5GAN d;  1KQS A;  3OA6 A;  5D6W A;  3MP6 A;  2ZIN A;  2P0P A;  4BE1 A;  1EIY A;  4ATO A;  3CCL T;  4YTL A;  1QVG A;  4XAX B;  2EAY A;  3A7A A;  4N4G A;  3DKM A;  4KUD K;  4O2D A;  5DLO A;  4F7U B;  3P8B B;  3MEY A;  4M77 B;  4M78 G;  4CS2 A;  1Q81 C;  3A31 A;  4L5G A;  5FU7 C;  1VQN T;  5CKB A;  1VQO T;  3L1A A;  3TRE A;  3QYG B;  3A74 A;  3OS1 A;  1S72 T;  2XK0 A;  2F5T X;  3CME T;  3M4Q A;  3OS5 A;  1NPR A;  3IKM B;  4L87 A;  1BI0 A;  4XTX A;  5CCA A;  5GAO n;  5LJ3 h;  3T9N A;  1KQS S;  3OYB A;  5GAN 8;  1JJ2 A;  2PVO B;  1QVF A;  3HFZ B;  1UGP B;  4H02 A;  2B8A A;  1BIA A;  4P72 A;  2RHQ B;  2A7Y A;  3ZFJ A;  1X01 A;  1YJ9 A;  4XK8 E;  2J3M A;  1N8R U;  1D3B A;  4LD9 K;  4PNO A;  4M75 G;  2WSC E;  4TVA B;  3ICA A;  2RJF A;  4YRN A;  1USY C;  3RER A;  2ZT7 A;  1YB3 A;  2AKW A;  1M90 U;  1Z7N A;  4C5H A;  4KR3 A;  2ZZG A;  4M78 F;  2DZ9 A;  2VUB A;  4OF1 A;  3SD4 A;  4CS3 A;  2AMC A;  2JZ2 A;  3M53 A;  5I21 A;  5HGQ A;  1B70 A;  1RI0 A;  4JRI A;  4M7A G;  1JJ2 S;  3S6W A;  1Y71 A;  4EMK A;  3OW2 A;  2DTH A;  1BI1 A;  1O75 A;  1QVF S;  1K9M C;  4ZTZ B;  4UPA A;  4DOV A;  4YCV A;  4EPC A;  5LJ5 f;  4QVD A;  3QPH A;  2EFI A;  1M9S A;  3LYI A;  3HXY A;  3L4G B;  1NPP A;  1B34 B;  4H2X A;  3QZ9 B;  3HXZ A;  1QF6 A;  3ME9 A;  1M1G A;  4M75 F;  4ZIB A;  2V8I A;  5A0L A;  2LCL A;  4R56 A;  3J80 E;  4H2W A;  1KHI A;  2O01 E;  4HKE A;  3R07 A;  2RJD A;  1YJW A;  3OW2 S;  3BFM A;  2ZR2 A;  4M77 A;  2EQK A;  4OGE A;  4KUI A;  2A8E A;  4LVL A;  2DAQ A;  2E64 A;  4MZT A;  4CH3 A;  5GMK l;  5KE2 A;  4M7A F;  2RH2 A;  3C94 A;  2DU7 A;  3LLR A;  3SFM A;  3PCO B;  3CXC S;  2WSF E;  4M75 A;  5D6Y A;  1KD1 U;  3S3M A;  3QG1 A;  1ZBX A;  3REX A;  4UP8 A;  4BE0 A;  3TEG A;  5CVI A;  4RDX A;  4PL6 A;  1BBW A;  2M1H A;  4F7U E;  2QQS A;  4M77 E;  2ZNI A;  1XQH A;  1YJW T;  1LOJ A;  1VQK A;  4M7A A;  2E10 A;  5GAO r;  1EQR A;  2ZNJ A;  3OYG A;  4OVA A;  1DJ7 B;  2IG0 A;  4H2T A;  3OMC A;  4ZTF A;  4CS4 A;  3VU3 C;  4RMF A;  4YYE A;  5EG2 A;  3JCM P;  3PNW C;  2Q5I A;  1KQ1 A;  2L3R A;  3HXW A;  5CO7 A;  3TU4 K;  3V8K A;  3J81 E;  1G3W A;  3OQ5 A;  3KXT A;  3CMQ A;  2X4X A;  5E3I A;  1G3Y A;  1ASZ A;  2JVV A;  5ELN A;  4J5Y A;  1KHC A;  4HCC A;  1YFR A;  2C7I A;  2QHU A;  2ZPE B;  3LX7 A;  4BI3 A;  2X4Y A;  4HWR A;  2K3X A;  3CCM A;  2C06 A;  2V8J A;  5GAO m;  3RMQ A;  5CKD A;  3CPF A;  4LDY A;  3L4G A;  4M77 D;  5GAO p;  1NYR A;  4PLL A;  1B34 A;  5AYF A;  4C5I A;  2QHT A;  3X25 B;  3JB9 J;  1PYS B;  3E1S A;  3A8O B;  2LVM A;  2ARU A;  5FU6 C;  3ERR A;  4FL6 A;  2X4W A;  5GAM e;  5GMK i;  4ELY C;  4NCX A;  3S3O A;  4M75 D;  4QQ6 A;  3HP9 A;  3OS2 A;  2QTX A;  5C0M A;  2NLU A;  2M9U A;  3Q1J A;  3VBB A;  4X5O A;  4BY6 C;  3OYJ A;  3QDR B;  5GAN e;  1H4T A;  4GLK A;  1E1T A;  3OY9 A;  3CCM T;  2OAU A;  4JLG A;  1NJ5 A;  4JRK A;  2QXF A;  4M7D B;  5J3B A;  4J15 A;  4M7A D;  2RHI A;  3M4G A;  2RI2 A;  2KK4 A;  3NEM A;  4OB0 B;  4HCB A;  3NTK A;  5C51 B;  4YRC A;  2A3L A;  3A8H B;  3OBY A;  2QQR A;  3CC2 A;  2I4O A;  3H8Z A;  1W2B A;  2KAF A;  3O8V A;  5L8R E;  3OYI A;  11AS A;  2CJB A;  3F70 A;  4J7F A;  3UT1 A;  3S3N A;  3VUZ A;  2K57 A;  3X24 B;  3QHS A;  1ATI A;  2Q7G A;  3MQZ A;  1RL2 A;  3M57 A;  2V8K A;  2FB7 A;  2E1H A;  3L2Q A;  4XEM A;  2PQW A;  2ZPB B;  1USY A;  1VQ7 A;  2O4X B;  5GAM g;  1EFW A;  2DQ0 A;  4E7J A;  1BIB A;  4O6J A;  1WYD A;  2G4C A;  2CKK A;  1UB4 A;  3UWN A;  2P0L A;  3OYF A;  5GAN g;  2RHS B;  4PLI A;  1PSE A;  3PZC A;  2GF7 A;  4C0F A;  3CC2 T;  4ZTJ A;  4PJO B;  1X75 C;  3M58 A;  1W2B S;  3OSV A;  1BBU A;  1I5L A;  2J3L A;  1WQW A;  4LVI A;  3MEA A;  3PT9 A;  4IUQ A;  4CH6 A;  4J8O A;  1LJO A;  2E41 A;  1VQP A;  3UFG A;  2DXU A;  1VQ5 A;  4PKC C;  3QSU A;  4YRF A;  2ZIM A;  5CK9 A;  3QZ5 B;  3FB9 A;  1VQ7 T;  3MCA B;  5K1P A;  2PVD B;  3V8L A;  4C92 B;  3LWI A;  2CS7 A;  1NZ9 A;  4L6V 5;  4MDW A;  2RD1 A;  5FU6 B;  4PG3 A;  1N6A A;  3CBP A;  3HTZ A;  5GAN j;  5GAN 7;  2Q7E A;  1UGR B;  3G7Z A;  4X9D A;  3UDC A;  3CC4 T;  3TEH B;  1QP2 A;  4QVC A;  4M7D A;  4A4E A;  5GAM h;  3JAM E;  3CCE A;  4HWS A;  3RIR A;  3CMA T;  2EQJ A;  3LH0 A;  3OYE A;  2Y4Y A;  2VXE A;  2QA4 T;  2HQX A;  1U1T A;  4FSX A;  5GAN h;  4Z02 A;  1YHQ T;  12AS A;  5C6S A;  3E9I A;  4O5V A;  2IY5 A;  2FYK A;  4P75 C;  4C8Q B;  3DSQ A;  5HKC A;  4JLI A;  3CCL A;  1B76 A;  3QKJ A;  4HA8 A;  2Y4X A;  4TQD A;  2LQ8 A;  4YRE A;  2DKG A;  2YLB A;  3A7R A;  4M7D E;  3L2U A;  3ZEH A;  2GFA A;  4QVZ A;  2G3R A;  1FXX A;  3MET A;  1VQN A;  3QO5 A;  4MZP A;  3OYD A;  4IUP A;  1X56 A;  3LSS A;  4VUB A;  2R5A A;  1XTD A;  3CME A;  1N9W A;  2ZR3 A;  1JB0 E;  1Q82 U;  2EYQ A;  2LDM A;  1Q81 U;  2RHS A;  3OSS C;  3VYH B;  3A5Y A;  5A0G A;  4FU6 A;  3UH0 A;  3C4S A;  2K5L A;  3CC7 T;  3EAE A;  4ME7 A;  1KC8 U;  4M78 B;  1NJ2 A;  4P71 C;  1Q86 C;  1X2G A;  3NTH A;  4GY5 A;  2RO0 A;  4RCB A;  4FT4 A;  4BE2 A;  4PHC A;  4TVW A;  1Q82 C;  4C5E A;  2JTM A;  3QTC A;  3P8H A;  3OBW A;  3OYA A;  4M7D D;  2X4J A;  2XDD A;  4QQG A;  4YRP A;  3RES A;  3SWN B;  3A32 A;  1KC8 C;  1NJI C;  4IUR A;  5HK3 A;  5M9O A;  3NEN A;  3M54 A;  4F7U G;  4HWT A;  4M77 G;  4HVC A;  1NYQ A;  3GOX A;  1SER A;  1QVG S;  1B7Y B;  3PMI A;  2QEX A;  4XU0 A;  4BWA A;  4BUG A;  4E7L A;  1JJC B;  2EJ9 A;  4XTU A;  2ZT6 A;  4C92 E;  1K9M U;  4JS5 A;  1BI2 A;  2ZZE A;  2XDP A;  1G51 A;  5GAO l;  4XU1 A;  2XGT A;  2HBP A;  4P74 C;  4OMF B;  2MF2 A;  2RJC A;  3OS0 A;  2M16 A;  1VIE A;  4A4K A;  3RUX A;  4LDW A;  3V7S A;  3E9F A;  3HRT A;  3VKI A;  2EQU A;  1WJR A;  2XI9 A;  3JB9 H;  4N4I A;  1H4Q A;  2VV5 A;  3FC3 A;  2QEX T;  2RJE A;  5KCH A;  4XU2 A;  2CGH A;  4YCU A;  2F5K A;  2AHJ B;  4M77 F;  2MI6 A;  3HXX A;  2L89 A;  4C8Q E;  3NET A;  5GAN 3;  3JB9 I;  4DA4 A;  1RIQ A;  1WU7 A;  4WJ4 A;  3MF2 A;  3QJ6 A;  1X2H A;  3DLM A;  4RKU E;  4OB2 B;  5CIU A;  3MO8 A;  4YRK A;  4IUT A;  4HT4 A;  2L8D A;  1W4S A;  1Q7Y U;  1TH7 A;  3I56 A;  3CCU A;  4F7U A;  1PSF A;  2CZ6 B;  4L59 A;  3E9H A;  2QHV A;  3MP1 A;  3L42 A;  2HD0 A;  3KUF A;  4BDZ A;  1Y96 B;  3JCM f;  1WLE A;  4M7D C;  2LT4 A;  1H4S A;  3LGF A;  3OD1 A;  3CCJ T;  4P73 C;  3A8L B;  1Q7Y C;  4LDV A;  1G5I A;  2JUF A;  3CCR T;  4B9W A;  3GF5 A;  1NNH A;  1IZ6 A;  1XOV A;  1OYX A;  2DXC A;  4LVK A;  3PIO A;  2RHU A;  2VGM A;  5A0D A;  2DJZ A;  2E65 A;  1B7Y A;  3HFZ A;  4RMO A;  2RHQ A;  3JCM Q;  3I56 T;  4BW9 A;  3CCU T;  3A5Z B;  1WGS A;  1JRI A;  3JCM b;  4UC4 A;  4P5N A;  2PME A;  2EQM A;  2P5I A;  1H3Z A;  4J6Y A;  2HQE A;  4TVA A;  4NL2 A;  1ZQ1 A;  2D0Q B;  1VQ4 T;  3HFN A;  4P75 A;  5GAO q;  3GNG A;  3VQV A;  2YRV A;  4P3P A;  2KMT A;  4ZN3 A;  4E7K A;  3QO3 A;  3TEE A;  4A4F A;  5GAM f;  4RQF A;  1SET A;  1WPY A;  4BDY A;  2MAM A;  2I4M A;  2I2L A;  4UP9 A;  2ZPF B;  4WF2 A;  4PJO C;  4II1 A;  2DIQ A;  3INZ A;  5GAN 6;  4YRL A;  3HRU A;  2OTL A;  5ELO A;  3L2V A;  3WVD B;  1KOG A;  1G3T A;  3FRN A;  1SSF A;  4ZN1 A;  4X9C A;  4LDU A;  1UEB A;  1GGM A;  2QDY B;  2XDB A;  4EMH A;  3RMS A;  4C92 C;  1EVK A;  2M0O A;  3G6E A;  2K4Y A;  2XKO C;  2CJA A;  1N9S A;  3LGL A;  4P71 A;  2ALY B;  3BDU A;  3MP8 A;  4N0A C;  2RM4 A;  2OTL T;  3HFO A;  2Q5H A;  4TVY A;  3WQZ A;  2PUO B;  3PCO A;  1B8A A;  3A8M B;  5LJ5 j;  3J7A F;  5CQY A;  3CBM A;  2ZPI B;  4LD6 A;  2RHY A;  3WXM B;  4J7I A;  4C8Q C;  2VYT A;  2VGN A;  1Z7M A;  2RHZ A;  4C5G A;  1K73 U;  1KMN A;  3I55 A;  2FHD A;  3G6E T;  4Q15 A;  4M7D G;  5K1X A;  2EKO A;  4YPF A;  5LJ5 h;  3JCM X;  1VQ9 T;  2CZ1 B;  4ZTU B;  4JRP A;  3CCQ A;  5LJ3 f;  1FYF A;  3QXE B;  3JCM W;  3WVE B;  2ZPH B;  2BIV A;  4YRS A;  2XHC A;  4OGC A;  1K73 C;  5KNN A;  2ZZF A;  4JS4 A;  4P74 A;  4NL3 A;  3RKY A;  4ELZ C;  3PFS A;  4OB3 B;  2ARS A;  4J6W A;  1EOV A;  3HSB A;  2E5A A;  1V29 B;  2ZCF B;  3P8V A;  2E3C A;  5FLX E;  4G85 A;  3I55 T;  4XTW A;  3CC4 A;  2DTO A;  3UPU A;  4M78 C;  2EL9 A;  2RB6 A;  1M1F A;  3CMA A;  4DPG A;  4YRO A;  3RF1 A;  1AHJ B;  2P4T A;  4N4H A;  2OTJ T;  2QA4 A;  4R55 A;  3CCQ T;  3AHU A;  1N27 A;  5LJ5 d;  1YHQ A;  4M7D F;  1EIY B;  1YJN A;  1PYS A;  3DLL A;  3OYN A;  4TWA A;  4CI0 C;  4H2Y A;  3SWN C;  1MGQ A;  4BI4 A;  4K87 A;  5KE3 A;  1ADJ A;  4CH5 A;  3P8T A;  4E7I A;  3BJU A;  2RHX A;  2EJF A;  4K88 A;  2Q7H A;  1E24 A;  4LDX A;  1G5V A;  4C92 G;  1OI1 A;  5HY6 A;  2X35 A;  2DVE A;  2BUD A;  4P73 A;  1VQL T;  3GPL A;  1HTT A;  3G4S T;  4XTY A;  5J26 A;  3JCM d;  4IUU A;  2DZC A;  1YJN T;  4CRI A;  2R57 A;  1UGS B;  4A4H A;  2ODR C;  4ZGD B;  4NOY A;  5D6X A;  4NS5 A;  5IAY A;  3CC7 A;  3REU A;  1Y7X A;  1BYM A;  3HY1 A;  3QYH B;  1WJQ A;  1YGB A;  3V7C A;  4D6W A;  2PU9 B;  4YRQ A;  1NE8 A;  1LNX A;  3PGG A;  2MMP A;  2AKW B;  5I2M A;  2QQB A;  2O4X A;  3QBY A;  4DOW A;  4C8Q G;  3HRK A;  5J39 A;  1Q86 U;  3OYC A;  2AMC B;  4OB1 B;  1B70 B;  3VUB A;  4EMK B;  1XNI A;  2VXF A;  1E1O A;  4C0D B;  2QQ9 A;  4HCZ A;  2LC4 A;  2XIC A;  4KR2 A;  4C92 F;  3OYK A;  4PJO A;  4KT0 E;  2CZ7 B;  3GIB A;  3HL8 A;  1YCY A;  2PVG B;  3L2Z A;  2ZZD A;  4E47 A;  1I4K 1;  1NJI U;  3UGT A;  1KQ2 A;  3MEV A;  1VQZ A;  3G1Z A;  4ZGE B;  3PTA A;  4H2X B;  3CCS T;  4Q5W A;  3IAL A;  2XTI A;  1EIF A;  2XD0 A;  2RK1 A;  1O9S A;  4C92 A;  1U1S A;  1J5W A;  1HK9 A;  4BI8 B;  2LT1 A;  3W3S A;  2E5Q A;  4PJO E;  5LJ3 j;  2K3Y A;  2CYZ B;  2HAX A;  3M5A A;  4C0G A;  4TVR A;  4C8Q F;  2JN0 A;  1VUB A;  3JRZ A;  2GQV A;  3TEH A;  4N0A A;  4Y28 E;  2RI5 A;  2ZIO A;  5DY9 A;  4XTZ A;  3VQX A;  3GNF B;  4UP7 A;  3CEY A;  4HT9 A;  5FRN A;  3SDZ A;  4MML A;  1LYL A;  4M75 B;  4J6X A;  4TQF A;  2K5F A;  1YFS A;  2DTI A;  4A4G A;  1WQ7 A;  2F69 A;  2DO3 A;  5A2Q E;  3VQY A;  1YI2 A;  5CAI A;  2QHS A;  3VYG A;  3FDR A;  4C0Z A;  3QO8 A;  3GP8 A;  4C8Q A;  3LWH A;  3FJP A;  3DB3 A;  4M7A B;  3JB9 D;  5GMK j;  3VQW A;  3MEU A;  2PUK B;  3HPW A;  3QO7 A;  3R6O A;  4EMG A;  3N5B B;  1NJ1 A;  2CIM A;  3ASK A;  4IUV A;  3HFV A;  4PJO D;  2DXT A;  1ASY A;  2GCX A;  1KG1 A;  3OYL A;  3RKW A;  2LRQ A;  1WNL A;  2KQW A;  5GMK h;  5I2S A;  4XU3 A;  2I4L A;  4F7U F;  5GAN 4;  1M8V A;  2JTF A;  2MWP A;  1IRE B;  3KBG A;  1N8R C;  1BKB A;  5LL6 S;  3CCJ A;  2DD5 A;  1ZHI A;  2EWN A;  1YI2 T;  2JOY A;  2KSS A;  2XID A;  3CCR A;  5LJ3 d;  1YJ9 T;  1M90 C;  2NS6 A;  4C92 D;  2LNV A;  4P3N A;  2DU5 A;  4M78 A;  1FX7 A;  1SES A;  2JNG A;  4AH6 A;  3OYM A;  3CXC A;  3RGL A;  2K5I A;  3OYH A;  1VQ8 A;  3LSQ A;  1N9R A;  3V7R A;  3E9G A;  3RKX A;  3FIF A;  1VQ4 A;  2ZPG B;  3H6Z A;  1OZ3 A;  3EFS A;  4G84 A;  3HY0 A;  4YRI A;  1X55 A;  3SWN A;  2H3J A;  1MHN A;  3VJP A;  4ZGJ B;  1EVL A;  5C53 B;  4B9X A;  2LQK A;  2CZ0 B;  4A54 A;  3DB4 A;  4M78 E;  5FU7 B;  5LJ5 e;  4C8Q D;  3JCM V;  3ER0 A;  5F5W A;  2ZT8 A;  4K86 A;  1VQM A;  2RK2 A;  4KQE A;  3QII A;  1H4V B;  2D9T A;  3M4P A;  3FLG A;  1JJC A;  1I81 A;  4LNS A;  4XQ3 A;  4OLF A;  1VQ8 T;  1C0A A;  1X6O A;  2K2V A;  3M59 A;  4YRR A;  4FT2 A;  3MF1 A;  4DQ2 A;  1KD1 C;  1QW1 A;  3JCM e;  2P0K A;  4M75 E;  2XU8 A;  5GAN 2;  1NJ8 A;  1X54 A;  5GAN f;  4QQD A;  4YRJ A;  1VQM T;  1NJ6 A;  5C52 B;  5FRM A;  4EDU A;  1QP3 A;  3EFR A;  2DDZ A;  4M78 D;  5LJ5 g;  4HT8 A;  5DM7 R;  5KCO A;  2YLC A;  2ZGW A;  2ART A;  2KY9 A;  4XEO A;  4M7A E;  3NFC A;  3ZBD A;  2DXB A;  4JDS A;  1GXI E;  3QUI A;  1VQK T;  1UGQ B;  1BI3 A;  1VQ6 A;  4MZM A;  2VC8 A;  3HXU A;  3UGQ A;  3V8J A;  5IT9 E;  3I7F A;  1YIJ A;  4QW2 A;  1HC7 A;  1YBY A;  2LCC A;  2KVQ G;  2RA2 A;  1VQ9 A;  1Y96 A;  3M4Y A;  3QNE A;  1G3S A;  2ZTG A;  2BKD N;  3P8Y A;  1M4Z A;  4IKF A;  2ZT5 A;  3M55 A;  2R5M A;  3OB9 A;  3PMT A;  3JCM g;  4YDQ A;  2CJ9 A;  3M9Q A;  1M5Q 1;  1I8F A;  4MDX A;  2D6F A;  4E51 A;  4RG8 A;  1VQ6 T;  4P72 C;  2RI3 A;  1SRY A;  4H2V A;  5CR2 A;  2ODR D;  2GFU A;  2WSE E;  3MEW A;  1YIJ T;  3A5Z A;  3A7U A;  2HNI A;  3X26 B;  1VIF A;  3P8D A;  2DK3 A;  3G71 A;  2IY5 B;  2I4N A;  2OTJ A;  3HHT B;  5GAN 5;  4Y91 A;  3JSC A;  5GMK m;  5DLQ E;  4BD3 A;  2PMF A;  4JRQ A;  3JCM c;  3RAC A;  5CKF A;  1IL2 A;  3CCV A;  3E19 A;  3OYY A;  4EMK C;  3IKL A;  3NEL A;  4HWO A;  4C0D C;  1YIT A;  2FVU A;  4J83 A;  4YCW A;  4EX5 A;  2ZXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...