2DEQA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111g mutation
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKGIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
total genus 70
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2deqA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2deqA01
2FB7A 5GAN4 4X9DA 4RQEA 2ZR2A 3IKLA 4XTWA 2I4MA 4M78B 1H4QA 2E3CA 4YRQA 4M7DD 4J5YA 5C53B 4YRFA 1NJ8A 1JJCA 4WJ4A 2P0LA 1LJOA 1WQ7A 4XQ3A 5LJ5f 3FIFA 1KQ1A 4P73C 4C92B 4M7DA 5CAIA 3PCOB 4PJOD 3L2ZA 4XTZA 3M4QA 2E64A 3JCMc 4P71A 4H2XB 3JB9H 2RHQB 1JRIA 2IY5A 2DZ9A 1YGBA 3HRKA 2DEQA 1NJ1A 3HY0A 2DQ3A 1N9RA 4EMKC 1D3BB 4G85A 4XEMA 2ZZEA 4UP7A 4EO4A 3VQVA 4H02A 1H4SA 1EQRA 5GAMd 3I7FA 2J3LA 3JCMh 2EJ9A 4Q6GA 2ALYA 4UP9A 1B8AA 1NJ6A 4C8QB 3LC0A 1D3BA 4P72A 4EMGA 3HXZA 3IKMB 1Y96A 4TVYA 2DTOA 1KMNA 4CS4A 1SRYA 3WQZA 4DPGA 4J15A 4C92C 1W66A 4TWAA 4QVDA 1VQZA 2ZNIA 1HK9A 3UGQA 4M78F 3QSUA 4PJOC 5GAOl 3R07A 2DZCA 2Q5HA 2ZNJA 2RHSA 1TH7A 2JN0A 2EAYA 4M7DF 3E9IA 4YRIA 4EMKA 1ASYA 3RESA 1MGQA 1E1TA 4YPFA 1PYSA 4M75B 5GAOr 1BBWA 4F7UF 1EIYB 1JBMA 4ZTUB 2ZZFA 3HXUA 4QVCA 2J3MA 4NL3A 1E1OA 2ZINA 3HSBA 5GMKm 2I2LA 5KNNA 4CH4A 4HWOA 3A5YA 4YYEA 1YFTA 4PHCA 1H641 4XU3A 3JCMX 2RD1A 1NJ5A 4M77D 5GAMg 2ZZGA 1WLEA 3EFRA 2DTHA 2Q7GA 4C92D 2XTIA 3SWNC 5GANg 2ZXFA 4P71C 4TQFA 4YCVA 2RM4A 3SB2A 5LJ3f 3REXA 2ODRC 1N9SA 3UH0A 1YFRA 4YRGA 5GMKh 4ZIBA 2RB6A 2RHQA 3IG2A 3RKWA 2VXFA 5GANd 3JCMJ 3MF1A 3QTCA 4H2UA 3L1AA 3TEGA 4HA8A 3NENA 4K87A 4YRTA 1YCYA 1G5HA 3BY7A 3AHUA 4YDQA 3HFZA 4O2DA 2AKWA 1C0AA 4M78C 2ZT7A 3A74A 1ASZA 1B70A 2C7IA 4C92G 3VQXA 1N9WA 3V7CA 3NELA 1BIBA 2QTXA 4M77G 1KMMA 2C8MA 4YRLA 3A7AA 3ICAA 1WNLA 4EX5A 3SWNB 5LJ3j 4JRIA 1L0WA 2ODRD 3M4PA 1SESA 4XU0A 5GMKj 1I4K1 4L87A 1I81A 4HT8A 5E3IA 4M75D 2I4OA 4RQFA 2Q7EA 5GMKi 4XU2A 4M77E 4YP0A 4YRNA 5LJ5d 4TVAA 5GANh 3A7UA 5GAN8 1LOJA 3SWNA 4TTVA 1QF6A 3V8JA 4J6XA 4M7DE 3RACA 5LJ3g 4C8QD 1B7YA 1X55A 4PJOF 4C8QC 3V8KA 3GIBA 1B70B 3G1ZA 2E5AA 5GAN7 4M77B 4C92F 1ADYA 3A5ZA 3MF2A 4C8QA 3M4GA 1M8VA 4PNOA 3VBBA 2HNIA 1B76A 3HTZA 4X5OA 4YRSA 4M77A 1H4VB 1I5LA 3E9HA 3P8YA 3MEYA 4C92A 5LJ5g 5GANe 1HTTA 4M7AF 2QHUA 5GAMj 4H2WA 3QNEA 2ZGWA 5LJ3h 5GAN3 4WF2A 3JCMd 3JCMP 4YRMA 3RUXA 5GAOp 3RIRA 4M75C 3QO5A 3JB9D 3BJUA 5GAN6 2CJAA 2ZIOA 4HVCA 3A7RA 3IALA 3P8TA 3TEHB 4AH6A 2DXUA 4UPAA 1B34A 3RKYA 1U1SA 2YHTA 2QHSA 4TVAB 2Q7HA 4P3PA 4JLIA 5LJ5h 3QHSA 2VXEA 4M77C 1B34B 3RF1A 4CH5A 2RA2A 1BBUA 4NL2A 1H4TA 3BDUA 4G84A 4ZTZB 3HRIA 1LNXA 4N0AC 3HXXA 4C92E 1USYA 3CMQA 2E1HA 2ARSA 3RL6A 2QHVA 2DKGA 2QHTA 2RHSB 5GAMh 1KOGA 3HXYA 2YLCA 1EVKA 4J6WA 3JB9J 4CS2A 3BFMA 1EFWA 2E41A 3BW1A 1I8FA 1BIAA 2DXTA 4M7AA 1X56A 3PGGA 1ATIA 4XEOA 4K88A 2ZT5A 4K86A 3PZCA 4WJ3M 3V7RA 3NEMA 4M7DG 5LJ5e 4P74A 3V7SA 12ASA 4HT9A 2Y90A 3VQWA 3EFSA 3A31A 2IY5B 1WQWA 5LJ3d 1USYC 2CJ9A 4PJOA 4X9CA 4YRRA 1LYLA 4KR3A 4M7AE 3HXVA 3PCOA 2EJFA 4YRPA 4RDXA 4M78G 2DTIA 4XTYA 4PG3A 5GMKl 4P75C 3FB9A 4RMFA 2Q5IA 5ELNA 3JB9I 2ARTA 4P75A 1EIYA 1G51A 3JCMb 5F5WA 4YRKA 4C8QE 11ASA 4P72C 1YFSA 1Z7NA 4YRCA 1X54A 3QO7A 2G4CA 3JCMe 3JCMg 4M78E 5GANf 3QUIA 3V8LA 3A32A 5K1XA 5GAMf 4XU1A 4RCCA 5GAOm 2AMCB 2FYKA 2DJZA 3L4GB 3P8VA 2VC8A 4RCBA 4HWPA 1NYQA 4CH3A 2CIMA 4YROA 1WPYA 4PJOG 1EOVA 3TUPA 5I21A 1J5WA 1PYSB 2ZT6A 4TQDA 2E10A 4Y91A 3HFZB 3JCMW 3VQYA 5LJ5j 4V2SA 2I4NA 5GAOn 3JB9F 4F7UB 4JRKA 1NNHA 4M7DC 2P5IA 5K1PA 2AKWB 5C52B 1KQ2A 4N0AA 4YREA 3ERRA 4J6YA 2DQ0A 2EL9A 3JCMV 1ADJA 4M7AB 3JB9G 4F7UE 1Y96B 4XTUA 4P3NA 3FJPA 1B7YB 3LSQA 4H2SA 1HXDA 1E22A 3DSQA 4NCXA 2AMCA 1X01A 1WYDA 4OLFA 3JCMf 3QO8A 4P3OA 4YCUA 4EMKB 4CH6A 4F7UA 4C8QF 5GAMe 4M7AG 1JJCB 4F7UG 2DU7A 4M75E 4NOYA 5C51B 1FYFA 4CS3A 4M75F 3W3SA 4M78D 4OP0A 4KQEA 5GAOq 4XTVA 4M7DB 4UP8A 4MMKA 4C8QG 5GAN5 4E51A 1SERA 3TEHA 3REUA 4XTXA 1X2HA 3OD1A 3RERA 4M7AC 3JCMQ 1EVLA 2E65A 4HWRA 4WI1A 4H2VA 4Q15A 3VU3C 5HGQA 1Z7MA 4A53A 2ALYB 5GAN2 4M75G 1M5Q1 4PJOB 4EMHA 5LJ3e 2PMEA 4H2YA 3QO3A 2ZTGA 2CGHA 5DY9A 2DVEA 2ARUA 4DQ2A 4HWTA 1YB3A 1HC7A 2ZT8A 4P73A 4BWAA 1IL2A 3NETA 4YRJA 1NJ2A 4PJOE 4A54A 3HFVA 1U1TA 4LNSA 2CJBA 2YLBA 2ZCEA 3LSSA 1SETA 5ELOA 4MMLA 2ZIMA 2ZR3A 3HXWA 1NYRA 3INZA 2EWNA 4M7AD 1E24A 4BW9A 3KFUA 3HFOA 1WU7A 1X2GA 4M77F 2DU5A 2XGTA 4TVWA 4YCWA 3RGLA 3UGTA 2K57A 3RKXA 5GMKe 1G5IA 2EJGA 3UFGA 2DDZA 5GANj 3HY1A 4H2XA 1GGMA 2PMFA 3L4GA 3HFNA 4P74C 4JUVA 4HWSA 4H2TA 2I4LA 4M75A 4M78A 1QE0A 1RIQA 4KR2A
chains in the Genus database with same CATH superfamily
4JS5A 2FB7A 5GAN4 1VQ6A 4X9DA 1GXIE 2ZR2A 3M0TA 4M78B 1NJIU 2D9TA 4ZTJA 1D1CA 3OYKA 1KD1R 4J5YA 3OBWA 1JJCA 4WJ4A 3HTRA 1LJOA 1WQ7A 2JZ2A 2KRNA 3VS7A 3GPLA 3CCST 2A37A 5LJ5f 3CCRT 1KQ1A 3H0IA 5L8RE 2DNUA 4C92B 3CCEQ 2DJQA 3EG9A 3L2ZA 2LT4A 1OV3A 2E64A 3JCMc 2XMFA 4P71A 1QVFP 1ZLMA 2DZ9A 2AK5A 3HRKA 2CZ1B 1ZBXA 1NJ1A 3QWYA 1AD5A 3OYEA 1G3YA 1M27C 2EKHA 4RG8A 1YJWT 2YUQA 1SHGA 1V1CA 4KBMB 3JCMh 4BDYA 3LC0A 4P72A 1IRXA 3LYIA 4EMGA 3I56T 2HBPA 2RI5A 1FMWA 4CS4A 1M1KR 2FZGB 3O5ZA 1ARKA 2RQWA 2DL7A 3RR6A 4C92C 2EIFA 4E7IA 1VQZA 1RAEB 2ZNIA 3OS1A 2RQRA 3QSUA 1SHFA 4E7KA 2ZNJA 2OX7A 1QP3A 2JN0A 4M7DF 4LDXA 1MGQA 2JOYA 2M51A 3EG3A 4M75B 4A63B 4FL6A 2NLUA 3KUFA 3OYBA 3VRYA 2ABLA 5IXFA 1VQ9T 1NJ5A 3CC2T 1RI9A 2DYBA 3SWNC 1VQ7Q 2CREA 2ZPGB 4YCVA 1D09B 2LJ3A 1FX7A 1K9AA 2EYZA 4Y28E 1Q95G 2ODRC 1N9SA 3CCVT 2FL7A 2V8IA 3I9QA 3UH0A 4K11A 5GMKh 2NWMA 2RB6A 3M54A 3IG2A 3RKWA 5GANd 3A5ZB 2P84A 5D7UA 3NENA 4K87A 4YRTA 3E2UA 2LNHB 1M9SA 3HRTA 1RAAB 2Y4YA 3CCJT 2CT4A 2D8JA 3EAEA 1GBRA 3N5BB 4QQDA 2C7IA 4AG2C 4C92G 4RTWA 2KXCA 1WNLA 2QG9B 2KROA 1VQ9Q 4EX5A 3SWNB 2CP5A 4R56A 4OB1B 1PD0A 4GBQA 1YIJA 3CXCA 1H3HA 1NYFA 1I4K1 3TCJA 2I4OA 1YITQ 3WXMB 4TVRA 2QTVA 1M1GA 4YRNA 3DLMA 1M30A 5GANh 2GF7A 4E7HA 2RQUA 5IH2A 4M7DE 4ZTFA 5LJ3g 1HD3A 2FVUA 1X55A 3MEVA 1N8RR 1VQMA 3GIBA 2PVGB 4J9GA 4HCBA 3G1ZA 1KIKA 5CKEA 2CP7A 2JUFA 3CPFA 2HMAA 4LDUA 3MF2A 1B7TA 1G83A 4PJLA 1K8AU 3J81E 1WHMA 2COZA 2F69A 2HKQB 4YRSA 5KH6A 3O8VA 1I5LA 2X3XD 4C92A 3EHRA 1HTTA 1VQ9A 4M7AF 1SKUB 1YJNQ 3S3MA 1MV0B 1VQKA 4QVZA 2DF6A 2ZGWA 1QVGA 4WF2A 3JCMd 1EZZB 3M0PA 1NPPA 2K79A 5GAOp 2EYWA 4GLMA 3RIRA 1YITT 5FU6C 2DO3A 2ZIOA 4HVCA 3ME9A 3IALA 4JDSA 3ULRB 3TEHB 2OJ2A 4FT4A 2DXUA 3VV0A 5CKDA 2QQRA 1U1SA 2YHTA 3HL8A 3M0SA 2FZCB 1B34B 3RF1A 2RA2A 3JRZA 2GQIA 2FZKB 2GQVA 2E1HA 1KJWA 1PWTA 1ZSZA 3QPHA 3ZBDA 1E7OA 2ED1A 1RI0A 2XKOC 5GAMh 3CMAT 2BKDN 7AT1B 1EVKA 4HVWA 1YJNT 2RJCA 4A4GA 3JB9J 2FPDA 3I35A 3BW1A 5CKBA 5FU6B 3DKMA 3DB3A 4M7AA 2DXTA 3NHNA 3VS2A 1VQLA 1OZ2A 2G6FX 1X6GA 2HD0A 4LD6A 1M1KU 1VQOA 3V7RA 2JVVA 5FROA 2DEUA 1OQKA 4BY6B 1FMVA 5KYNA 1TWBA 4PFPA 2RI2A 4FYVB 4BD3A 5LJ3d 2CJ9A 4YRRA 2EGEA 2IIMA 2EBPA 1ABOA 4HVVA 1PKTA 3HXVA 4YRPA 3MP1A 1Q81R 5GMKl 2CSIA 3FB9A 4FW1A 5ELNA 3JB9I 2D6FA 3M55A 2CZ0B 4E7JA 4P75A 2ZPFB 1HJDA 3LWHA 4C8QE 3TQ7P 4IKFA 2RPNA 4LXCA 3X26B 3J80E 2O4XA 3CCQQ 1X54A 3JCMe 4M78E 5GANf 2JW4A 3QG1A 1SG5A 5DLOA 3I5SA 2YRDA 2EVRA 4QT7A 5DLQE 1TOVA 2VC8A 1NLOC 1QCNA 2LX7A 4CH3A 2K3XA 1K1ZA 4OVAA 1UGQB 2JM9A 5KYYB 5CCAA 3CPWA 2EYXA 4JRPA 1VQNT 3L2QA 4RTVA 4Y91A 4B6MA 4HCZA 3UA6A 1AZEA 3JB9F 4LVKA 1VQLQ 4X1VA 5I2MA 3GP8A 3KXTA 4BDZA 5C52B 1MMNA 3OMGA 1G2BA 5L23A 2CP0A 3JB9G 2GTJA 4F7UE 3CD6A 3TVTA 3PIOA 9ATCB 2F5KA 2E3HA 1PG5B 2ESWA 1M1FA 2EGAA 4JS4A 4OB2B 1X01A 1VQKQ 2M9UA 1UJYA 4OLFA 3F70A 1VQ6Q 3CCVA 3M0QA 4C8QF 3VS1A 2KGTA 5LL6S 2E4HA 1JJCB 4F7UG 1NYGA 2EQUA 3IQLA 5C51B 3MCAB 2H3JA 4CS3A 4M75F 1MMAA 1RAFB 2XDDA 4M7DB 1U5SA 2NUTB 3TEHA 1TUDA 1ZHIA 4LN2A 4C0FA 1EVLA 4PKCC 1N8RU 4WI1A 4FYXB 4AFZC 3VU3C 1Q7YU 5CQXA 1FYNA 3OS2A 2Y4XA 4PJOB 2RHUA 2RF0A 5LJ3e 3GLXA 3GNFB 1E6HA 1BU1A 3OYYA 2CGHA 3CEYA 1GFCA 2HEQA 3MEWA 4HWTA 2D0QB 2VB6A 4P73A 4DOWA 4YRJA 3P8BB 1X75C 3G6EA 4RTUA 5ELOA 2ECZA 5C0MA 3JSCA 3CMAA 1AWJA 2RJFA 4MMLA 2ZIMA 3HXWA 2KRMA 1QVFA 1AVZC 2EQJA 3G4ST 5C6SA 3OYHA 4M7AD 1NLPC 3CCUT 3ZEHA 1EX4A 1VQ5T 2BIVA 2LRQA 3UDCA 4J9BA 4M77F 2R58A 4QW2A 1VQ7A 2DU5A 3RGLA 2A3LA 4LNPA 2K57A 2BZYA 1G5IA 2LCCA 2CUDA 1O75A 5KYUB 2DERA 1GGMA 1OOTA 3CCMT 3S3OA 4Z88A 2J06A 2I4LA 4M78A 1I0CA 3GF5A 4B9XA 1QE0A 4RQEA 1M1KC 3IKLA 3OW2S 2I4MA 2VYTA 3PTAA 1K4US 1WJSA 3OA6A 1S72A 2E3CA 2EQMA 4QQ6A 3UA7A 4YRFA 1N6AA 2OI3A 3OY9A 2CZ6B 4XQ3A 2O4XB 4UC4A 3EG1A 5FWBA 4P73C 3QYGB 2A36A 5CAIA 4XTZA 3M4QA 1S1NA 1Q7YC 2PUOB 1O9SA 3WVDB 3JB9H 4ATOA 1PSEA 1X6BA 3CMET 2IY5A 1YGBA 2DEQA 2YRCA 3ZL7C 2ATCB 4J9EA 1D3BB 2ZZEA 1H4SA 3OSSC 1OZ3A 3C4SA 2J3LA 2C0IA 2EKOA 3LH0A 3QZ5B 4UP9A 1B8AA 4C8QB 1D0XA 4DBFA 3HXZA 1Y96A 1AZGB 4BACA 1FWZA 2DL8A 2DTOA 4LDWA 1KMNA 1SRYA 1NEGA 4KR2A 1H92A 2XDPA 4J15A 2GCXA 2O9VA 2EFIA 4IUPA 4QQGA 3FJ5A 3OSVA 2KAFA 5FRMA 4PJOC 4OGCA 4D8DA 3R07A 3G1JA 4HCKA 2Q5HA 1GFDA 1Q82R 3E19A 4YRIA 4ZN3A 1WJQA 4X34A 1E1TA 3OW2P 5GAOr 1BBWA 2EYQA 1JBMA 3I5RA 4IIOA 1MHNA 1QVPA 4M4ZA 1WYXA 3LGLA 1E1OA 3TU4K 5GMKm 2I2LA 5KNNA 5A2QE 1YJ9T 1LVKA 1SPKA 1YJ9A 3CQTA 1G3SA 3CCMA 1KQSA 1Y7XA 2K5IA 4O5VA 2XG8D 2RD1A 4M77D 2DTHA 2HDAA 5EG2A 2XTIA 2RH2A 4TQFA 2KDSA 4J83A 3CD6T 2JM8A 2CKKA 5LJ3f 1ZA1B 5KCOA 2MWPA 3CC7Q 2RHQA 2H3EB 3M0RA 3JCMJ 4ZN1A 3QTCA 4H2UA 3L1AA 1M90C 3TEGA 5KYWA 3TSWA 1YCYA 3G6EQ 1G5HA 1QQJA 2DXCA 3SHWA 3PE0A 5KCHA 2LQWA 2MMPA 2CH4A 1JU5C 2LJ0A 3CBMA 2KMTA 2QK0A 2JTMA 1VQ4Q 2FRYA 1ASZA 4E7LA 4BE0A 1VUBA 3OBYA 2RK2A 1N9WA 2CH4W 1KMMA 2C8MA 2OTJQ 4YRLA 3OYDA 1VQPT 3A7AA 3ICAA 3UT1A 1YHQQ 4FSSA 2DPPB 2XDBA 2XD0A 1L0WA 3QDRB 2C0OA 4IUTA 3M4PA 4XK8E 1SESA 4OMNA 1UE9A 4L87A 1I81A 5EC7A 4HT8A 5E3IA 5KYXA 2Q7EA 2ROTA 1WHJA 2H8HA 2SRCA 3E9GA 3SFMA 2K3YA 4TVAA 3A98A 4OMQA 3A7UA 3Q1JA 3SWNA 3RACA 4PJNA 2DE0X 1KC8C 1UHFA 2YUOA 1BI3A 2LMJA 1B70B 5A0GA 2YUPA 3S3NA 1AWXA 2IG0A 2J6KA 2MK5A 5GAN7 3X28B 1ADYA 1IO6A 1OX9A 2OAUA 3A5ZA 2P0QA 3LGFA 4C8QA 4PNOA 2HNIA 1B76A 1OU8A 1UJ0A 4AFSC 4X5OA 2DL4A 3A1PA 2O31A 3E9HA 2QDLA 2GFAA 3MEYA 4OMMA 5GANe 1BCMA 3VS6A 3QIIA 2QI2A 1H3ZA 4RMOA 2LZ6B 2JS2A 1OPKA 3TREA 4YRMA 3NPFA 3QXEB 3BJUA 2L5QA 1WFWA 4PLLA 3CXCP 1B34A 4N4GA 3RKYA 1AT1B 4TVAB 1BCOA 2Q7HA 4P3PA 1K9MR 4JLIA 5LJ5h 2VXEA 4M77C 4CH5A 1H4TA 2AKKA 1K73R 4JZ4A 4L5GA 3HXXA 3CMQA 3WVEB 3RDVA 2ARSA 3CCJA 3FC3A 2QHVA 3CCET 2QHTA 3OYFA 3GOXA 5KYXB 2SEMA 3OMCA 4J6WA 3BFMA 2LVMA 1UGVA 1I07A 2DK3A 2X4JA 8ATCB 1OULA 1X56A 2J05A 1ATIA 2A28A 2ZCFB 2ROLA 4CC7A 3EGXA 2ZT5A 2QGGA 2W0ZA 2MCNA 2P4TA 1DJ7B 1QMCA 1AWWA 4M7DG 4P5NA 5LJ5e 1I5OB 4BB7A 1VA7A 2RMOA 1WHHA 3CPWS 3EFSA 1NEBA 3HP9A 1USYC 3LLRA 4PJJA 4PJOA 1LYLA 3I56Q 2RI3A 2DD4A 2K6DA 4KR3A 1UFFA 1VQ5Q 4M7AE 1NM7A 4E47A 3EG9B 3UATA 1YBYA 2DMOA 4XTYA 1YWPA 4P75C 4RMFA 1B07A 1VQ8Q 3KFVA 3GBQA 5CVIA 2D0NA 3UWNA 1EIYA 1KD1U 2AZSA 2VKNA 2C06A 1OX8A 2FRWA 1WJRA 1RLPC 5FWCA 1QP2A 4AG1C 2K4YA 1IB8A 1WXBA 3M59A 2OTJA 1NPRA 5K1XA 4ZNXA 2LP5A 5GAOm 3L4GB 2LCSA 2L3RA 2PU9B 4MDWA 4PLIA 3CMEA 1AHJB 2YSQA 1TSFA 2WSCE 1TTHB 3S6WA 2CIMA 1EOVA 2DFUA 1R0CB 2CP6A 3EH2A 5I21A 4FSXA 1PYSB 2ZT6A 4Z89A 1X43A 2X4XA 1YI2Q 2P0PA 2DXBA 2HL5C 3VQYA 4DOVA 5LJ5j 1JJ2P 4V2SA 5GAOn 3OYGA 3UF4A 4A4KA 1M90U 4JRKA 2K7AA 2EPDA 4AFQC 4EPCA 1IHVA 1SSFA 4YREA 2QDYB 2EL9A 1VQMT 3MEAA 1VYVA 4J8OA 4XTUA 4H2SA 5FLXE 1HXDA 1V76A 1WYDA 3L2RA 3QO8A 2WSEE 2KR3A 3G71A 2QEXT 3CCUA 1D0YA 2MF2A 4M75E 5FRNA 1KD1C 3G7ZA 5IXBA 4RTZA 1UGPB 4M78D 5GAOq 1MMDA 3M4YA 3VS0A 4RG2A 2HCKA 2M0YA 4C8QG 1SERA 1VQPA 1MNDA 3MPUB 2G3RA 1UDLA 2RJEA 3OD1A 3RERA 4C0DC 3EHQA 1WDXA 2E65A 1IHWA 1M3CA 2JT4A 4Q15A 2DA9A 2ALYB 2L8DA 4M75G 2E70A 3JV3A 1IGQA 3QO3A 1KQSP 5DY9A 1WXTA 1NBEB 2R5MA 2E6ZA 2QASA 4DQ2A 2ARUA 1WIEA 1HC7A 2BZXA 1IL2A 3NETA 5HY6A 1NJ2A 1WXUA 1VQOQ 4PL6A 4J9DA 1U1TA 3PNWC 3CC4Q 1Y57A 3VUZA 4LNSA 4GLKA 2P0KA 2YLBA 4C0GA 1SETA 2GTOA 3BDLA 3META 2EWNA 1E24A 4FW2A 1GL5A 1ZSZB 1UG1A 2E12A 3UGTA 4R0KA 2AZVA 2KI7A 4DEYA 3UFGA 2DLPA 3HY1A 2CS7A 2CT3A 3L4GA 3HFNA 1VQ8A 4P74C 3QJ6A 3R6OA 4JUVA 1UTIA 4KT0E 4M75A 3CCUQ 1K73C 3LH5A 4F17A 1AWOA 3TSZA 1GCQA 4XTWA 4A4EA 4A4HA 3OYNA 1BI2A 1UUEA 4YRQA 4LVLA 4L59A 5HKCA 1YNZA 2F2WA 3M56A 2P0LA 1M3BA 2A8EA 4CC3A 1BYMA 3FIFA 3QDFA 4ZGEB 4OF1A 3OW2A 1U8RA 4M7DA 1Y71A 4ESRA 2CP2A 5D6XA 4RTYA 2RHQB 1YI2A 3HY0A 2DRKA 1Q81U 2DQ3A 4EMKC 4G85A 4XEMA 1YCSB 1YWOA 3NTKA 4EO4A 3VQVA 1EQRA 2MI6A 5GAMd 1U3OA 5CQYA 3I7FA 4Q6GA 2EJ9A 1R0BG 2ALYA 1YJ9Q 1NJ6A 1D3BA 1H8KA 3IKMB 1Q81C 1VQ8T 3LWIA 3WQZA 5CK9A 4DPGA 1SF9A 4C0DB 1VQ6T 3CBPA 1W66A 2RNAA 4QVDA 1HK9A 3VS3A 4M78F 1C6VX 1D1AA 2JS0A 5GAOl 1W2BP 2JJ9A 4LD9K 1IXDA 2EAYA 3QWXX 3E9IA 1TUCA 4EMKA 1ASYA 1W4SA 3HRSA 3M5AA 2DL3A 2D1XA 4F7UF 3C95A 3HXUA 2VGNA 2J3MA 3H9NA 2KE9A 2HSPA 2QAZA 1G3TA 4F14A 3OYMA 3HSBA 1RABB 4E6RA 3A5YA 2DAQA 1RAGB 1GCPA 5D6WA 4PHCA 4XU3A 1FXXA 2DX1A 3JCMX 2R5AA 1OPLA 3OYIA 2ZZGA 4CC4B 5KYUA 3EFRA 4C92D 1VQNQ 5GANg 2ZXFA 1NJIR 4HCCA 1ZSZC 4YTLA 2L2PA 3SB2A 3CCJQ 3KBGA 3M0UA 3G71Q 1PSFA 3MEUA 5KE2A 1VQLT 1C1AA 2M02A 4RUGA 5HK0A 2RK1A 4DBHA 1W6XA 5M9OA 1T0JA 3BY7A 4JJCA 1ABQA 4O2DA 4LUEA 2AKWA 3C94A 4LVJA 5A0LA 4M78C 1A0NB 2ZT7A 1PHTA 4BY6C 2CSQA 1B70A 4A4FA 1ZUKA 4QKUA 3VQXA 2QTXA 4M77G 2C0TA 4O6JA 4FCYA 2QA4T 3X20B 5LJ3j 2RHXA 4MZPA 3CCSQ 2LQ8A 2ODRD 3HPWA 3FRNA 4XU0A 5GMKj 3NGPA 4JRQA 1EIFA 1T0HA 4M75D 1SEMA 2V1RA 4RQFA 5GMKi 1XTDA 2GFUA 4M77E 4YP0A 1YHQA 4HXJA 1K9MC 2MPXC 5GAN8 3RBBB 3V8JA 5A0DA 2CP3A 1W70A 4C8QD 3J7AF 4KGXB 1B7YA 2VWFA 4N4IA 2E5AA 2LDMA 5CO7A 4E7SA 2KBTA 1XQHA 1HYOA 4C92F 2DBMA 2DVJA 2HKNA 4E2FB 2KNBB 1PD1A 4FT2A 3HTZA 1H4VB 3HRUA 2QGFB 5LJ5g 2EW3A 3NTHA 1TG0A 2QHUA 1G5VA 5GAMj 1JO8A 5GAN3 2O2OA 4KGZB 1TU0B 4M75C 3JB9D 2CJAA 3A7RA 4AH6A 3L2VA 2O88A 1OYXA 2J7IA 2YXYA 1BKBA 5ECAA 3FDRA 4LUDA 3H0FA 2QEXA 1SRLA 1E6GA 4F16A 1BBUA 4NL2A 1YFNA 3BDUA 4G84A 4ZTZB 2J6OA 4LDVA 2AIRB 4N0AC 2W10A 1M3AA 3RL6A 1OI1A 3SDZA 1CSKA 4DBRA 2CDTA 2DKGA 3MP8A 2RHSB 1KOGA 1QWFA 3HXYA 1X27A 3CBOA 3CC7T 4CS2A 3CC2A 4FYYB 2AT1B 4F04B 1PNJA 2E41A 2O01E 1GCQC 1I8FA 1OU9A 2GNCA 2PZ1A 4GY5A 4DBQA 3L42A 2P4RA 5IN1A 4WJ3M 4AT1B 3CC4T 2QQ9A 4P74A 1VQNA 12ASA 3VQWA 2Y90A 2JMCA 3EGXB 2A08A 2E5KA 3A31A 2IY5B 4X9CA 2M16A 5AYFA 2RHZA 1N27A 2F5TX 3PVQA 1VIEA 2EJFA 2ZPIB 4D8KA 4M78G 3PCOA 4PG3A 3G4SA 2Q5IA 1WA7A 2JXBA 1Y0MA 3CCLQ 3ZFJA 1M2VA 1P92A 1YJNA 4PFZA 1VOMA 2X4WA 2FEIA 3EH1A 4BE1A 1G51A 2XIDA 2LCLA 3X25B 3I56A 4P72C 11ASA 2X9HA 2KY9A 1Z7NA 1EFNA 2DD5A 4YRCA 1TS9A 3FEOA 3QO7A 1Q82C 1U06A 2XHCA 4BUGA 3JCMg 4AMCA 2BE7D 2MOXA 3LX7A 4KH0B 3V8LA 2KRSA 4LE9A 4XU1A 4RCCA 3E1SA 2QEXQ 3M58A 2DJZA 3P8VA 1X2KA 1UEBA 4CRIA 1ZBJA 1NYQA 5IAYA 4KRTA 4EDUA 2V8JA 4PJOG 2KSSA 3EG2A 4ZGDB 4TQDA 1KK7A 2E10A 1JQQA 3JCMW 3M53A 2I4NA 1RAHB 1YN8A 1NNHA 4RKUE 4M7DC 2YWWA 5IHIA 4J6YA 1WI7A 3CCVQ 2DQ0A 3ERRA 4PK4A 3JCMV 4IUUA 4M7AB 4NS5A 5HCKA 1N8RC 1YI2T 1XJWB 1QKWA 4LVMA 4P3NA 2PVDB 4IURA 3SEMA 3FJPA 3CCQA 3VRZA 3VKIA 2COWA 3DSQA 2AMCA 4J9IA 4BI4A 2YT6A 2KXDA 3G4SQ 3VS4A 4CH6A 2L89A 4F7UA 2X35A 1VQ4T 5CKFA 3EFOB 5GAMe 2X4YA 3THKA 4M7AG 4FU6A 4CI0C 2DU7A 3H8ZA 2M0OA 1KHIA 2QYZA 4HKEA 1YIJQ 1FYFA 2EGCA 3W3SA 4BI8B 2HBWA 4XTVA 4MMKA 2LNVA 1X6OA 2HQEA 4E51A 4J7FA 2MIOA 2DETA 2E6NA 1AOJA 2VASA 3JCMQ 4M7AC 3OYLA 2LQNA 1X69A 2YRVA 3HHTB 4JLGA 1Z7MA 4A53A 5GAN2 4FIBA 1M5Q1 1T3LA 4EMHA 1QKXA 3I55Q 3CC4A 4DA4A 1Z9ZA 2FHDA 4KULA 2ZTGA 3EGUA 2IVWA 3C12A 2DVEA 2EQIA 3CC2Q 5GJVB 1YB3A 4Q5WA 2ZT8A 3G71T 3HFVA 1ACMB 3DLLA 2LTOA 5FW9A 2DBKA 2X3WD 2WACA 3R6NA 2ZR3A 4B9WA 1UGSB 1MNEA 2RHIA 3C0CA 1NYRA 3INZA 3HKSA 1V29B 3H6ZA 3HFOA 2VVKA 1VQ5A 1BBZA 3BE3A 3TEEA 5KYYA 2OTLT 4N4HA 2HAXA 2LT1A 1M90R 3D7SB 1M4ZA 2A0FB 2MAMA 1C0MA 5GMKe 1S72Q 2EJGA 2XI9A 1X2QA 1K73U 1K0XA 2DDZA 5GANj 1ZA2B 4H2XA 3URGA 1VYTA 2QA4Q 2PMFA 4ELZC 4WTOB 4JJDA 4ZGJB 2I0NA 4H2TA 1JB0E 1JXOA 2K2VA 2F1LA 3T9NA 2J6FA 4KGVB 2PTKA 1KC8U 5CR2A 1BI0A 3OB9A 1H4QA 2FPFA 2DIGA 2V8KA 4M7DD 2RO0A 5C53B 4L6V5 1NJ8A 3MJXA 1XNIA 1M2VB 2K3BA 2A7YA 1QWEA 1JEGA 1JJ2A 2D8HA 1VQMQ 3PCOB 1WZOA 1WX6A 4PJOD 3CMAQ 2V26A 4R55A 3EGDB 1Y07A 4C0ZA 3MHXA 3VUBA 4KUDK 1N5ZA 2KEAA 4H2XB 1JRIA 1CKBA 2XICA 2DL5A 4XAXB 1PRLC 4MZMA 5D6YA 1VYUA 1YP5A 1Q86C 1N9RA 4C5HA 3CCMQ 2GBQA 1R77A 1W2BS 4UP7A 4H02A 1M2OA 4IUVA 3A8GB 1MMGA 2ENMA 3EGDA 1B3QA 3M57A 4MDXA 1ZUUA 4J7IA 2K5FA 4TVYA 1VQKT 2Z0WA 2ZPEB 3PMTA 2AHJB 3CC7A 2DILA 5I11A 1OEBA 2KK4A 3REAB 5J3BA 3CCLT 4TWAA 3VYGA 3UGQA 2LX9A 1WHKA 2DZCA 1QW1A 4JPBW 1PM3A 1TH7A 3E9FA 2RHSA 2HL3A 3RESA 4YPFA 1PYSA 2JTEA 5I22A 2OTJT 1EIYB 1TUGB 4ZTUB 2ZZFA 4QVCA 3GNGA 2VV5A 1XOVA 4RTTA 6AT1B 4NL3A 1KSWA 3RMSA 2ZINA 2HSEB 1Q86R 4J9HA 2NUPB 2HZYA 4HWOA 4CH4A 3A8OB 4YYEA 1YFTA 1PKSA 4E7ZA 2CYZB 1H641 1W2BA 1K9MU 4OB0B 1SRMA 2PUKB 3ER0A 5GAMg 1WLEA 1LPLA 2Q7GA 2E5QA 4P71C 1PC0A 1UGRB 2RM4A 3REXA 1Q7YR 4PJMA 1VQ4A 2M1HA 1YFRA 4YRGA 4ZIBA 2VXFA 3PT9A 3MF1A 3CCRA 1KG1A 4HA8A 1NG2A 5IHNA 1Q86U 1ZSGA 3AHUA 2K9GA 3AT1B 2OTLQ 5HK3A 3NMZC 4YDQA 3HFZA 2RQVA 3NFCA 2XK0A 1C0AA 3A74A 4OMLA 3V7CA 3NELA 1BIBA 1QVGP 1K8AC 3MQZA 1RACB 4JRIA 2LC4A 4KUIA 5DM7R 2E3IA 1K0SA 1KQSS 4RTXA 1TXQA 4LVIA 3I55T 1JXMA 4XU2A 2KYMA 1CKAA 4OGEA 5LJ5d 1NZ9A 5J39A 3CCQT 4OMOA 1LOJA 4TTVA 1QF6A 1UHCA 4J6XA 3SD4A 2BE9B 2EQKA 1YJWQ 1UB4A 3A8HB 3P8HA 4PJOF 1VQOT 4C8QC 3U23A 3V8KA 2EYYA 4M77B 2V1QA 1GBQA 3M4GA 3MP6A 1M8VA 3VBBA 4BE2A 1FMKA 4FM4B 2PNIA 4M77A 3P8YA 2FPEA 1MUZA 4H2WA 3QNEA 2FO0A 1D0ZA 3DB4A 5LJ3h 3JCMP 2KQWA 3RUXA 3QO5A 1YITA 5GAN6 4C5EA 2HQHA 4DEXA 2RN8A 3P8TA 3VS5A 4UPAA 2BUDA 2QHSA 1WHGA 5J26A 3QHSA 4MZTA 2OAWA 2RQTA 3HRIA 1LNXA 4C92E 1USYA 2JNGA 1RUWA 2XU8A 4OMFB 1RL2A 3REBB 1K8AR 2PQWA 1I1JA 2QQAA 1UECA 3VJPA 2PVOB 2JMAA 3ASKA 2L0AA 1QCOA 2YLCA 2ZPBB 1Q82U 1K76A 2NUZA 5KE3A 1G8XA 4VUBA 1EFWA 4C5GA 1BIAA 1VQ7T 5IHKA 2ZPHB 3PGGA 1T3SA 2K5LA 1JJ2S 3A8LB 4XEOA 4K88A 4K86A 3PZCA 3NEMA 3QYHB 4ME7A 1G3WA 5CKHA 4HT4A 3V7SA 4HT9A 1WQWA 2NYSA 3PIPA 1ZX6A 3G6ET 3MO8A 2JTFA 2LJ1A 4RDXA 2DTIA 2YDLA 4OB3B 3QKJA 2L3PA 3OYAA 2ARTA 1VIFA 2L3QA 2KT8A 3L2UA 2ZZDA 3QZ9B 2OTLA 5FU7C 3JCMb 5F5WA 4YRKA 2K2MA 1BI1A 1WGSA 1YHQT 1YFSA 1VQPQ 2COYA 3CPWP 2MWOA 1W1FA 2FG0A 2HQXA 3EFOA 3CCSA 1J3TA 1ZQ1A 2G4CA 2NUTA 3QUIA 2BZ8A 3CCLA 3A32A 5GAMf 2GGRA 4BI3A 2WSFE 1QVFS 2AMCB 2FYKA 3QBYA 4ANJA 3X24B 4AFUC 3RMQA 4RCBA 1KC8R 4HWPA 2B8AA 4KH1B 4IUQA 4ORZA 4Y92A 4YROA 1WHLA 1WPYA 3TUPA 2F2XA 1J5WA 4Z8AA 3HFZB 3FLGA 3CD6Q 4LDYA 4ELYC 2QQBA 4F7UB 2KVQG 2L3SA 2VGMA 4PFOA 3H41A 4FYWB 2VUBA 3LW5E 3MKDA 2DYIA 3CMEQ 2DM1A 3PFSA 2P5IA 5K1PA 2AKWB 1KQ2A 4N0AA 2ED0A 1ADJA 4J9FA 1IZ6A 3OYJA 1GRIA 1RLQC 1Y96B 3CXCS 2DRMA 1Z9QA 1B7YB 3LSQA 5GJWB 1E22A 4NCXA 3OS5A 1RAIB 3NTIA 3H0HA 3JCMf 4P3OA 4YCUA 4EMKB 2QXFA 1YJWA 3PMIA 3JAME 1NE8A 2F2VA 4EIKA 2NS6A 1QLYA 4II1A 4NOYA 3VYHB 1QCFA 1F1BB 1LCKA 1S72T 2LQKA 4C5IA 4OP0A 4KQEA 3QJYA 4UP8A 3OS0A 5AT1B 4CC2A 5GAN5 3L2WA 3REUA 3I55A 4XTXA 1X2HA 2R57A 1QVGS 1IGUA 1HSQA 1RADB 4HWRA 4H2VA 5HGQA 5I2SA 1PCXA 1BB9A 4HVUA 4J9CA 2QA4A 4D6WA 2PMEA 2CUBA 4JZ3A 4H2YA 4Z02A 3RNJA 1D1BA 2KT1A 3P8DA 1WLPB 2KYBA 1SSHA 4BWAA 1AEYA 2ZAEA 4PJOE 4A54A 1PRMC 3A8MB 2CJBA 1NJIC 5FU7B 2X51A 3OYCA 2ZCEA 3LSSA 5KYWB 1KHCA 2IPOB 4IIMA 3EG0A 4JJBA 3CCEA 1ZUYA 2O9SA 3OQ5A 2QQSA 3KFUA 2RHYA 2DIQA 4BW9A 4WCIA 1WU7A 1X2GA 1M8MA 4OMPA 2XGTA 4TVWA 4YCWA 4JJNK 2AKLA 3RKXA 2B86A 3M9QA 1YIJT 3UPUA 2MYSA 1MV3A 2RJDA 1IREB 1R8OB 1KFZA 3CCRQ 4HWSA 5IT9E 2YUNA 2BTTA 8AT1B 2CZ7B 2NUPA 1BK2A 3PVLA 1RIQA 5CIUA
chains in the Genus database with same CATH topology
4JS5A 2FB7A 5GAN4 1VQ6A 4X9DA 1GXIE 2ZR2A 4M78B 1NJIU 2D9TA 4ZTJA 3OYKA 4J5YA 3OBWA 1JJCA 4WJ4A 1LJOA 1WQ7A 2JZ2A 3GPLA 3CCST 5LJ5f 3CCRT 1KQ1A 5L8RE 4C92B 3L2ZA 2LT4A 2E64A 3JCMc 4P71A 2DZ9A 3HRKA 2CZ1B 1ZBXA 1NJ1A 3OYEA 1G3YA 4RG8A 1YJWT 4KBMB 3JCMh 4BDYA 3LC0A 4P72A 3LYIA 4EMGA 3I56T 2HBPA 2RI5A 4CS4A 4C92C 2EIFA 4E7IA 1VQZA 2ZNIA 3OS1A 3QSUA 4E7KA 2ZNJA 1QP3A 2JN0A 4M7DF 4LDXA 1MGQA 2JOYA 4M75B 4FL6A 2NLUA 3KUFA 3OYBA 1VQ9T 1NJ5A 3CC2T 3SWNC 2ZPGB 4YCVA 1FX7A 4Y28E 2ODRC 1N9SA 3CCVT 2FL7A 2V8IA 3UH0A 5GMKh 2RB6A 3M54A 3IG2A 3RKWA 5GANd 3A5ZB 3NENA 4K87A 4YRTA 1M9SA 3HRTA 2Y4YA 3CCJT 3EAEA 3N5BB 4QQDA 2C7IA 4C92G 1WNLA 4EX5A 3SWNB 4R56A 4OB1B 1YIJA 3CXCA 1I4K1 3TCJA 2I4OA 3WXMB 4TVRA 1M1GA 4YRNA 3DLMA 5GANh 2GF7A 4E7HA 4M7DE 4ZTFA 5LJ3g 2FVUA 1X55A 3MEVA 1VQMA 3GIBA 2PVGB 4HCBA 3G1ZA 5CKEA 2JUFA 3CPFA 4LDUA 3MF2A 1K8AU 3J81E 2F69A 4YRSA 5KH6A 3O8VA 1I5LA 4C92A 1HTTA 1VQ9A 4M7AF 3S3MA 1VQKA 4QVZA 2ZGWA 1QVGA 4WF2A 3JCMd 1NPPA 5GAOp 3RIRA 1YITT 5FU6C 2DO3A 2ZIOA 4HVCA 3ME9A 3IALA 4JDSA 3TEHB 4FT4A 2DXUA 3VV0A 5CKDA 2QQRA 1U1SA 2YHTA 3HL8A 1B34B 3RF1A 2RA2A 3JRZA 2GQVA 2E1HA 3QPHA 3ZBDA 1RI0A 2XKOC 5GAMh 3CMAT 2BKDN 1EVKA 1YJNT 2RJCA 4A4GA 3JB9J 3BW1A 5CKBA 5FU6B 3DKMA 3DB3A 4M7AA 2DXTA 1VQLA 1OZ2A 2HD0A 4LD6A 1M1KU 1VQOA 3V7RA 2JVVA 5FROA 4BY6B 2RI2A 4BD3A 5LJ3d 2CJ9A 4YRRA 3HXVA 4YRPA 3MP1A 5GMKl 3FB9A 5ELNA 3JB9I 2D6FA 3M55A 2CZ0B 4E7JA 4P75A 2ZPFB 3LWHA 4C8QE 4IKFA 3X26B 3J80E 2O4XA 1X54A 3JCMe 4M78E 5GANf 3QG1A 5DLOA 5DLQE 2VC8A 4CH3A 2K3XA 4OVAA 1UGQB 5CCAA 3CPWA 4JRPA 1VQNT 3L2QA 4Y91A 4HCZA 3JB9F 4LVKA 5I2MA 3GP8A 3KXTA 4BDZA 5C52B 3OMGA 3JB9G 4F7UE 3CD6A 3PIOA 2F5KA 1M1FA 4JS4A 4OB2B 1X01A 2M9UA 4OLFA 3F70A 3CCVA 4C8QF 5LL6S 1JJCB 4F7UG 2EQUA 5C51B 3MCAB 2H3JA 4CS3A 4M75F 2XDDA 4M7DB 3TEHA 1ZHIA 4C0FA 1EVLA 4PKCC 1N8RU 4WI1A 3VU3C 1Q7YU 5CQXA 3OS2A 2Y4XA 4PJOB 2RHUA 5LJ3e 3GLXA 3GNFB 3OYYA 2CGHA 3CEYA 3MEWA 4HWTA 2D0QB 4P73A 4DOWA 4YRJA 3P8BB 1X75C 3G6EA 5ELOA 5C0MA 3JSCA 3CMAA 2RJFA 4MMLA 2ZIMA 3HXWA 1QVFA 2EQJA 3G4ST 5C6SA 3OYHA 4M7AD 3CCUT 3ZEHA 1VQ5T 2BIVA 2LRQA 3UDCA 4M77F 2R58A 4QW2A 1VQ7A 2DU5A 3RGLA 2A3LA 2K57A 1G5IA 2LCCA 1O75A 1GGMA 3CCMT 3S3OA 2I4LA 4M78A 3GF5A 4B9XA 1QE0A 4RQEA 1M1KC 3IKLA 3OW2S 2I4MA 2VYTA 3PTAA 1WJSA 3OA6A 1S72A 2E3CA 2EQMA 4QQ6A 4YRFA 1N6AA 3OY9A 2CZ6B 4XQ3A 2O4XB 4UC4A 4P73C 3QYGB 5CAIA 4XTZA 3M4QA 1Q7YC 2PUOB 1O9SA 3WVDB 3JB9H 4ATOA 1PSEA 3CMET 2IY5A 1YGBA 2DEQA 1D3BB 2ZZEA 1H4SA 3OSSC 1OZ3A 3C4SA 2J3LA 2EKOA 3LH0A 3QZ5B 4UP9A 1B8AA 4C8QB 3HXZA 1Y96A 4BACA 1FWZA 4LDWA 2DTOA 1KMNA 1SRYA 4KR2A 2XDPA 4J15A 2GCXA 2EFIA 4IUPA 4QQGA 3OSVA 2KAFA 5FRMA 4PJOC 4OGCA 3R07A 2Q5HA 3E19A 4YRIA 4ZN3A 1WJQA 4X34A 1E1TA 5GAOr 1BBWA 2EYQA 1JBMA 1MHNA 1QVPA 3LGLA 1E1OA 3TU4K 5GMKm 2I2LA 5KNNA 5A2QE 1YJ9T 1YJ9A 1G3SA 3CCMA 1KQSA 1Y7XA 2K5IA 4O5VA 2XG8D 2RD1A 4M77D 2DTHA 5EG2A 2XTIA 2RH2A 4TQFA 2KDSA 4J83A 3CD6T 2CKKA 5LJ3f 5KCOA 2MWPA 2RHQA 3JCMJ 4ZN1A 3QTCA 4H2UA 3L1AA 1M90C 3TEGA 1YCYA 1G5HA 2DXCA 5KCHA 2MMPA 3CBMA 2KMTA 2JTMA 1ASZA 4E7LA 4BE0A 1VUBA 3OBYA 2RK2A 1N9WA 1KMMA 2C8MA 4YRLA 3OYDA 1VQPT 3A7AA 3ICAA 3UT1A 2DPPB 2XDBA 2XD0A 1L0WA 3QDRB 4IUTA 3M4PA 4XK8E 1SESA 4L87A 1I81A 4HT8A 5E3IA 2Q7EA 3E9GA 3SFMA 2K3YA 4TVAA 3A7UA 3Q1JA 3SWNA 3RACA 1KC8C 1BI3A 1B70B 5A0GA 3S3NA 2IG0A 5GAN7 3X28B 1ADYA 2OAUA 3A5ZA 2P0QA 3LGFA 4C8QA 4PNOA 2HNIA 1B76A 4X5OA 3E9HA 2GFAA 3MEYA 5GANe 3QIIA 2QI2A 1H3ZA 4RMOA 3TREA 4YRMA 3QXEB 3BJUA 2L5QA 4PLLA 1B34A 4N4GA 3RKYA 4TVAB 2Q7HA 4P3PA 4JLIA 5LJ5h 2VXEA 4M77C 4CH5A 1H4TA 4L5GA 3HXXA 3CMQA 3WVEB 2ARSA 3CCJA 3FC3A 2QHVA 3CCET 2QHTA 3OYFA 3GOXA 4J6WA 3OMCA 3BFMA 2LVMA 2DK3A 2X4JA 1X56A 1ATIA 2ZCFB 2ZT5A 2P4TA 1DJ7B 4M7DG 4P5NA 5LJ5e 4BB7A 3CPWS 3EFSA 3HP9A 1USYC 3LLRA 4PJOA 1LYLA 2RI3A 2DD4A 4KR3A 4M7AE 4E47A 1YBYA 4XTYA 4P75C 4RMFA 5CVIA 3UWNA 1EIYA 1KD1U 2C06A 1WJRA 1QP2A 2K4YA 3M59A 2OTJA 1NPRA 5K1XA 5GAOm 3L4GB 2L3RA 2PU9B 4MDWA 4PLIA 3CMEA 1AHJB 2WSCE 3S6WA 2CIMA 1EOVA 5I21A 4FSXA 1PYSB 2ZT6A 2X4XA 2P0PA 2DXBA 3VQYA 4DOVA 5LJ5j 4V2SA 5GAOn 3OYGA 4A4KA 1M90U 4JRKA 4EPCA 1SSFA 4YREA 2QDYB 2EL9A 1VQMT 3MEAA 4XTUA 4J8OA 4H2SA 5FLXE 1HXDA 1WYDA 3L2RA 3QO8A 2WSEE 3G71A 2QEXT 3CCUA 2MF2A 4M75E 5FRNA 1KD1C 3G7ZA 1UGPB 4M78D 5GAOq 3M4YA 4RG2A 4C8QG 1SERA 1VQPA 2G3RA 2RJEA 3OD1A 3RERA 4C0DC 2E65A 4Q15A 2ALYB 2L8DA 4M75G 2E70A 3QO3A 5DY9A 2R5MA 2E6ZA 4DQ2A 2ARUA 1HC7A 1IL2A 3NETA 5HY6A 1NJ2A 4PL6A 1U1TA 3PNWC 3VUZA 4LNSA 4GLKA 2P0KA 2YLBA 4C0GA 1SETA 3BDLA 3META 2EWNA 1E24A 2E12A 3UGTA 3UFGA 3HY1A 2CS7A 3L4GA 3HFNA 1VQ8A 4P74C 3QJ6A 3R6OA 4JUVA 4KT0E 4M75A 1K73C 4XTWA 4A4EA 4A4HA 3OYNA 1BI2A 4YRQA 4LVLA 4L59A 5HKCA 3M56A 2P0LA 2A8EA 1BYMA 3FIFA 4ZGEB 4OF1A 3OW2A 1U8RA 4M7DA 1Y71A 5D6XA 2RHQB 1YI2A 3HY0A 1Q81U 2DQ3A 4EMKC 4G85A 4XEMA 3NTKA 4EO4A 3VQVA 1EQRA 2MI6A 5GAMd 5CQYA 3I7FA 4Q6GA 2EJ9A 2ALYA 1NJ6A 1D3BA 3IKMB 1Q81C 1VQ8T 3LWIA 3WQZA 5CK9A 4DPGA 4C0DB 1VQ6T 3CBPA 1W66A 4QVDA 1HK9A 4M78F 5GAOl 4LD9K 2EAYA 3E9IA 1ASYA 4EMKA 1W4SA 3HRSA 3M5AA 4F7UF 3C95A 3HXUA 2VGNA 2J3MA 1G3TA 3OYMA 3HSBA 3A5YA 2DAQA 5D6WA 4PHCA 4XU3A 1FXXA 3JCMX 2R5AA 3OYIA 2ZZGA 3EFRA 4C92D 5GANg 2ZXFA 4HCCA 4YTLA 3SB2A 3KBGA 1PSFA 3MEUA 5KE2A 1VQLT 5HK0A 2RK1A 5M9OA 3BY7A 4O2DA 2AKWA 3C94A 4LVJA 5A0LA 4M78C 2ZT7A 4BY6C 1B70A 4A4FA 3VQXA 2QTXA 4M77G 4O6JA 2QA4T 3X20B 5LJ3j 2RHXA 4MZPA 2LQ8A 2ODRD 3HPWA 3FRNA 4XU0A 5GMKj 4JRQA 1EIFA 4M75D 4RQFA 5GMKi 1XTDA 2GFUA 4M77E 4YP0A 1YHQA 1K9MC 5GAN8 3V8JA 5A0DA 4C8QD 1B7YA 3J7AF 4N4IA 2E5AA 2LDMA 5CO7A 1XQHA 4C92F 4FT2A 3HTZA 1H4VB 3HRUA 5LJ5g 3NTHA 2QHUA 1G5VA 5GAMj 5GAN3 4M75C 3JB9D 2CJAA 3A7RA 4AH6A 3L2VA 1OYXA 1BKBA 3FDRA 2QEXA 1BBUA 4NL2A 3BDUA 4G84A 4ZTZB 4LDVA 4N0AC 3RL6A 1OI1A 3SDZA 2DKGA 3MP8A 2RHSB 1KOGA 3HXYA 3CBOA 3CC7T 4CS2A 3CC2A 2E41A 2O01E 1I8FA 4GY5A 3L42A 5IN1A 4WJ3M 3CC4T 2QQ9A 4P74A 1VQNA 12ASA 3VQWA 2Y90A 3A31A 2IY5B 4X9CA 2M16A 5AYFA 2RHZA 1N27A 2F5TX 1VIEA 2EJFA 2ZPIB 3PCOA 4M78G 4PG3A 3G4SA 3ZFJA 1P92A 1YJNA 2X4WA 4BE1A 1G51A 2XIDA 2LCLA 3X25B 3I56A 4P72C 11ASA 2KY9A 1Z7NA 2DD5A 4YRCA 3FEOA 3QO7A 1Q82C 2XHCA 4BUGA 3JCMg 3LX7A 3V8LA 4XU1A 4RCCA 3E1SA 3M58A 2DJZA 3P8VA 1UEBA 4CRIA 1NYQA 5IAYA 4EDUA 2V8JA 4PJOG 2KSSA 4ZGDB 4TQDA 2E10A 3JCMW 3M53A 2I4NA 1NNHA 4RKUE 4M7DC 1RIQA 3ERRA 4J6YA 2DQ0A 3JCMV 4IUUA 4M7AB 4NS5A 1N8RC 1YI2T 4LVMA 4P3NA 2PVDB 4IURA 3CCQA 3FJPA 3VKIA 3DSQA 2AMCA 4BI4A 4CH6A 2L89A 4F7UA 2X35A 1VQ4T 5CKFA 5GAMe 2X4YA 4M7AG 4FU6A 4CI0C 2DU7A 3H8ZA 2M0OA 1KHIA 4HKEA 1FYFA 3W3SA 4BI8B 4XTVA 4MMKA 2LNVA 1X6OA 2HQEA 4E51A 4J7FA 2E6NA 4M7AC 3JCMQ 3OYLA 2YRVA 3HHTB 4JLGA 1Z7MA 4A53A 5GAN2 4FIBA 1M5Q1 4EMHA 3CC4A 4DA4A 2FHDA 4KULA 2ZTGA 2IVWA 3C12A 2DVEA 1YB3A 4Q5WA 2ZT8A 3G71T 3HFVA 3DLLA 2LTOA 2WACA 2ZR3A 4B9WA 1UGSB 2RHIA 1NYRA 3INZA 3HKSA 1V29B 3H6ZA 3HFOA 1VQ5A 3TEEA 2OTLT 4N4HA 2HAXA 2LT1A 1M4ZA 2MAMA 5GMKe 1K73U 2XI9A 2EJGA 2DDZA 5GANj 4H2XA 3URGA 2PMFA 4ELZC 4ZGJB 4H2TA 1JB0E 2K2VA 3T9NA 1KC8U 5CR2A 1BI0A 3OB9A 1H4QA 2DIGA 2V8KA 4M7DD 2RO0A 5C53B 4L6V5 1NJ8A 1XNIA 2A7YA 1JJ2A 3PCOB 4PJOD 4R55A 1Y07A 4C0ZA 3MHXA 3VUBA 4KUDK 4H2XB 1JRIA 2XICA 4XAXB 4MZMA 5D6YA 1Q86C 1N9RA 4C5HA 4UP7A 1W2BS 4H02A 4IUVA 3A8GB 3M57A 4MDXA 4J7IA 2K5FA 4TVYA 1VQKT 2ZPEB 3PMTA 2AHJB 3CC7A 2KK4A 5J3BA 3CCLT 4TWAA 3VYGA 3UGQA 2LX9A 2DZCA 1QW1A 2RHSA 1TH7A 3E9FA 3RESA 4YPFA 1PYSA 2OTJT 1EIYB 4ZTUB 2ZZFA 4QVCA 3GNGA 2VV5A 1XOVA 4NL3A 3RMSA 2ZINA 4CH4A 4HWOA 3A8OB 4YYEA 1YFTA 2CYZB 1H641 1K9MU 1W2BA 4OB0B 2PUKB 3ER0A 5GAMg 1WLEA 2Q7GA 2E5QA 4P71C 1UGRB 2RM4A 3REXA 1VQ4A 2M1HA 1YFRA 4YRGA 4ZIBA 2VXFA 3PT9A 3MF1A 3CCRA 1KG1A 4HA8A 1Q86U 3AHUA 5HK3A 4YDQA 3HFZA 3NFCA 2XK0A 1C0AA 3A74A 3V7CA 3NELA 1BIBA 1K8AC 3MQZA 4JRIA 2LC4A 4KUIA 5DM7R 1KQSS 4LVIA 3I55T 4XU2A 4OGEA 5LJ5d 1NZ9A 5J39A 3CCQT 1LOJA 4TTVA 1QF6A 4J6XA 3SD4A 2EQKA 1UB4A 3A8HB 3P8HA 4PJOF 1VQOT 4C8QC 3V8KA 4M77B 3M4GA 3MP6A 1M8VA 3VBBA 4BE2A 4FM4B 4M77A 3P8YA 4H2WA 3QNEA 3DB4A 5LJ3h 3JCMP 2KQWA 3RUXA 3QO5A 1YITA 5GAN6 4C5EA 3P8TA 4UPAA 2BUDA 2QHSA 5J26A 3QHSA 4MZTA 3HRIA 1LNXA 4C92E 1USYA 2JNGA 2XU8A 4OMFB 1RL2A 2PQWA 2QQAA 3VJPA 2PVOB 3ASKA 2YLCA 2ZPBB 1Q82U 5KE3A 4VUBA 1EFWA 4C5GA 1BIAA 1VQ7T 2ZPHB 3PGGA 2K5LA 1JJ2S 3A8LB 4XEOA 4K88A 4K86A 3PZCA 3NEMA 3QYHB 4ME7A 1G3WA 5CKHA 4HT4A 3V7SA 4HT9A 1WQWA 3PIPA 3G6ET 3MO8A 2JTFA 4RDXA 2DTIA 4OB3B 3QKJA 3OYAA 2ARTA 1VIFA 3L2UA 2ZZDA 3QZ9B 2OTLA 5FU7C 3JCMb 5F5WA 4YRKA 1BI1A 1WGSA 1YHQT 1YFSA 2MWOA 2HQXA 3CCSA 1ZQ1A 2G4CA 3QUIA 3CCLA 3A32A 5GAMf 4BI3A 2WSFE 1QVFS 2AMCB 2FYKA 3QBYA 3X24B 3RMQA 4RCBA 4HWPA 2B8AA 4IUQA 4YROA 1WPYA 3TUPA 1J5WA 3HFZB 3FLGA 4LDYA 4ELYC 2QQBA 4F7UB 2KVQG 2VGMA 2VUBA 3LW5E 3PFSA 2P5IA 5K1PA 2AKWB 1KQ2A 4N0AA 1ADJA 1IZ6A 3OYJA 3CXCS 1Y96B 1B7YB 3LSQA 1E22A 4NCXA 3OS5A 3NTIA 3JCMf 4P3OA 4YCUA 4EMKB 2QXFA 1YJWA 3PMIA 3JAME 1NE8A 2NS6A 4II1A 4NOYA 3VYHB 1S72T 2LQKA 4C5IA 4OP0A 4KQEA 3QJYA 4UP8A 3OS0A 5GAN5 3L2WA 3REUA 3I55A 4XTXA 1X2HA 2R57A 1QVGS 4HWRA 4H2VA 5HGQA 5I2SA 2QA4A 4D6WA 2PMEA 4H2YA 4Z02A 3P8DA 4BWAA 4PJOE 4A54A 3A8MB 2CJBA 1NJIC 5FU7B 3OYCA 2ZCEA 3LSSA 1KHCA 3CCEA 3OQ5A 2QQSA 3KFUA 2RHYA 2DIQA 4BW9A 1WU7A 1X2GA 2XGTA 4TVWA 4YCWA 4JJNK 3RKXA 3M9QA 1YIJT 3UPUA 2RJDA 1IREB 1R8OB 4HWSA 5IT9E 2CZ7B 2Q5IA 5CIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FB7 A;  5GAN 4;  4X9D A;  4RQE A;  2ZR2 A;  3IKL A;  4XTW A;  2I4M A;  4M78 B;  1H4Q A;  2E3C A;  4YRQ A;  4M7D D;  4J5Y A;  5C53 B;  4YRF A;  1NJ8 A;  1JJC A;  4WJ4 A;  2P0L A;  1LJO A;  1WQ7 A;  4XQ3 A;  5LJ5 f;  3FIF A;  1KQ1 A;  4P73 C;  4C92 B;  4M7D A;  5CAI A;  3PCO B;  4PJO D;  3L2Z A;  4XTZ A;  3M4Q A;  2E64 A;  3JCM c;  4P71 A;  4H2X B;  3JB9 H;  2RHQ B;  1JRI A;  2IY5 A;  2DZ9 A;  1YGB A;  3HRK A;  2DEQ A;  1NJ1 A;  3HY0 A;  2DQ3 A;  1N9R A;  4EMK C;  1D3B B;  4G85 A;  4XEM A;  2ZZE A;  4UP7 A;  4EO4 A;  3VQV A;  4H02 A;  1H4S A;  1EQR A;  5GAM d;  3I7F A;  2J3L A;  3JCM h;  2EJ9 A;  4Q6G A;  2ALY A;  4UP9 A;  1B8A A;  1NJ6 A;  4C8Q B;  3LC0 A;  1D3B A;  4P72 A;  4EMG A;  3HXZ A;  3IKM B;  1Y96 A;  4TVY A;  2DTO A;  1KMN A;  4CS4 A;  1SRY A;  3WQZ A;  4DPG A;  4J15 A;  4C92 C;  1W66 A;  4TWA A;  4QVD A;  1VQZ A;  2ZNI A;  1HK9 A;  3UGQ A;  4M78 F;  3QSU A;  4PJO C;  5GAO l;  3R07 A;  2DZC A;  2Q5H A;  2ZNJ A;  2RHS A;  1TH7 A;  2JN0 A;  2EAY A;  4M7D F;  3E9I A;  4YRI A;  4EMK A;  1ASY A;  3RES A;  1MGQ A;  1E1T A;  4YPF A;  1PYS A;  4M75 B;  5GAO r;  1BBW A;  4F7U F;  1EIY B;  1JBM A;  4ZTU B;  2ZZF A;  3HXU A;  4QVC A;  2J3M A;  4NL3 A;  1E1O A;  2ZIN A;  3HSB A;  5GMK m;  2I2L A;  5KNN A;  4CH4 A;  4HWO A;  3A5Y A;  4YYE A;  1YFT A;  4PHC A;  1H64 1;  4XU3 A;  3JCM X;  2RD1 A;  1NJ5 A;  4M77 D;  5GAM g;  2ZZG A;  1WLE A;  3EFR A;  2DTH A;  2Q7G A;  4C92 D;  2XTI A;  3SWN C;  5GAN g;  2ZXF A;  4P71 C;  4TQF A;  4YCV A;  2RM4 A;  3SB2 A;  5LJ3 f;  3REX A;  2ODR C;  1N9S A;  3UH0 A;  1YFR A;  4YRG A;  5GMK h;  4ZIB A;  2RB6 A;  2RHQ A;  3IG2 A;  3RKW A;  2VXF A;  5GAN d;  3JCM J;  3MF1 A;  3QTC A;  4H2U A;  3L1A A;  3TEG A;  4HA8 A;  3NEN A;  4K87 A;  4YRT A;  1YCY A;  1G5H A;  3BY7 A;  3AHU A;  4YDQ A;  3HFZ A;  4O2D A;  2AKW A;  1C0A A;  4M78 C;  2ZT7 A;  3A74 A;  1ASZ A;  1B70 A;  2C7I A;  4C92 G;  3VQX A;  1N9W A;  3V7C A;  3NEL A;  1BIB A;  2QTX A;  4M77 G;  1KMM A;  2C8M A;  4YRL A;  3A7A A;  3ICA A;  1WNL A;  4EX5 A;  3SWN B;  5LJ3 j;  4JRI A;  1L0W A;  2ODR D;  3M4P A;  1SES A;  4XU0 A;  5GMK j;  1I4K 1;  4L87 A;  1I81 A;  4HT8 A;  5E3I A;  4M75 D;  2I4O A;  4RQF A;  2Q7E A;  5GMK i;  4XU2 A;  4M77 E;  4YP0 A;  4YRN A;  5LJ5 d;  4TVA A;  5GAN h;  3A7U A;  5GAN 8;  1LOJ A;  3SWN A;  4TTV A;  1QF6 A;  3V8J A;  4J6X A;  4M7D E;  3RAC A;  5LJ3 g;  4C8Q D;  1B7Y A;  1X55 A;  4PJO F;  4C8Q C;  3V8K A;  3GIB A;  1B70 B;  3G1Z A;  2E5A A;  5GAN 7;  4M77 B;  4C92 F;  1ADY A;  3A5Z A;  3MF2 A;  4C8Q A;  3M4G A;  1M8V A;  4PNO A;  3VBB A;  2HNI A;  1B76 A;  3HTZ A;  4X5O A;  4YRS A;  4M77 A;  1H4V B;  1I5L A;  3E9H A;  3P8Y A;  3MEY A;  4C92 A;  5LJ5 g;  5GAN e;  1HTT A;  4M7A F;  2QHU A;  5GAM j;  4H2W A;  3QNE A;  2ZGW A;  5LJ3 h;  5GAN 3;  4WF2 A;  3JCM d;  3JCM P;  4YRM A;  3RUX A;  5GAO p;  3RIR A;  4M75 C;  3QO5 A;  3JB9 D;  3BJU A;  5GAN 6;  2CJA A;  2ZIO A;  4HVC A;  3A7R A;  3IAL A;  3P8T A;  3TEH B;  4AH6 A;  2DXU A;  4UPA A;  1B34 A;  3RKY A;  1U1S A;  2YHT A;  2QHS A;  4TVA B;  2Q7H A;  4P3P A;  4JLI A;  5LJ5 h;  3QHS A;  2VXE A;  4M77 C;  1B34 B;  3RF1 A;  4CH5 A;  2RA2 A;  1BBU A;  4NL2 A;  1H4T A;  3BDU A;  4G84 A;  4ZTZ B;  3HRI A;  1LNX A;  4N0A C;  3HXX A;  4C92 E;  1USY A;  3CMQ A;  2E1H A;  2ARS A;  3RL6 A;  2QHV A;  2DKG A;  2QHT A;  2RHS B;  5GAM h;  1KOG A;  3HXY A;  2YLC A;  1EVK A;  4J6W A;  3JB9 J;  4CS2 A;  3BFM A;  1EFW A;  2E41 A;  3BW1 A;  1I8F A;  1BIA A;  2DXT A;  4M7A A;  1X56 A;  3PGG A;  1ATI A;  4XEO A;  4K88 A;  2ZT5 A;  4K86 A;  3PZC A;  4WJ3 M;  3V7R A;  3NEM A;  4M7D G;  5LJ5 e;  4P74 A;  3V7S A;  12AS A;  4HT9 A;  2Y90 A;  3VQW A;  3EFS A;  3A31 A;  2IY5 B;  1WQW A;  5LJ3 d;  1USY C;  2CJ9 A;  4PJO A;  4X9C A;  4YRR A;  1LYL A;  4KR3 A;  4M7A E;  3HXV A;  3PCO A;  2EJF A;  4YRP A;  4RDX A;  4M78 G;  2DTI A;  4XTY A;  4PG3 A;  5GMK l;  4P75 C;  3FB9 A;  4RMF A;  2Q5I A;  5ELN A;  3JB9 I;  2ART A;  4P75 A;  1EIY A;  1G51 A;  3JCM b;  5F5W A;  4YRK A;  4C8Q E;  11AS A;  4P72 C;  1YFS A;  1Z7N A;  4YRC A;  1X54 A;  3QO7 A;  2G4C A;  3JCM e;  3JCM g;  4M78 E;  5GAN f;  3QUI A;  3V8L A;  3A32 A;  5K1X A;  5GAM f;  4XU1 A;  4RCC A;  5GAO m;  2AMC B;  2FYK A;  2DJZ A;  3L4G B;  3P8V A;  2VC8 A;  4RCB A;  4HWP A;  1NYQ A;  4CH3 A;  2CIM A;  4YRO A;  1WPY A;  4PJO G;  1EOV A;  3TUP A;  5I21 A;  1J5W A;  1PYS B;  2ZT6 A;  4TQD A;  2E10 A;  4Y91 A;  3HFZ B;  3JCM W;  3VQY A;  5LJ5 j;  4V2S A;  2I4N A;  5GAO n;  3JB9 F;  4F7U B;  4JRK A;  1NNH A;  4M7D C;  2P5I A;  5K1P A;  2AKW B;  5C52 B;  1KQ2 A;  4N0A A;  4YRE A;  3ERR A;  4J6Y A;  2DQ0 A;  2EL9 A;  3JCM V;  1ADJ A;  4M7A B;  3JB9 G;  4F7U E;  1Y96 B;  4XTU A;  4P3N A;  3FJP A;  1B7Y B;  3LSQ A;  4H2S A;  1HXD A;  1E22 A;  3DSQ A;  4NCX A;  2AMC A;  1X01 A;  1WYD A;  4OLF A;  3JCM f;  3QO8 A;  4P3O A;  4YCU A;  4EMK B;  4CH6 A;  4F7U A;  4C8Q F;  5GAM e;  4M7A G;  1JJC B;  4F7U G;  2DU7 A;  4M75 E;  4NOY A;  5C51 B;  1FYF A;  4CS3 A;  4M75 F;  3W3S A;  4M78 D;  4OP0 A;  4KQE A;  5GAO q;  4XTV A;  4M7D B;  4UP8 A;  4MMK A;  4C8Q G;  5GAN 5;  4E51 A;  1SER A;  3TEH A;  3REU A;  4XTX A;  1X2H A;  3OD1 A;  3RER A;  4M7A C;  3JCM Q;  1EVL A;  2E65 A;  4HWR A;  4WI1 A;  4H2V A;  4Q15 A;  3VU3 C;  5HGQ A;  1Z7M A;  4A53 A;  2ALY B;  5GAN 2;  4M75 G;  1M5Q 1;  4PJO B;  4EMH A;  5LJ3 e;  2PME A;  4H2Y A;  3QO3 A;  2ZTG A;  2CGH A;  5DY9 A;  2DVE A;  2ARU A;  4DQ2 A;  4HWT A;  1YB3 A;  1HC7 A;  2ZT8 A;  4P73 A;  4BWA A;  1IL2 A;  3NET A;  4YRJ A;  1NJ2 A;  4PJO E;  4A54 A;  3HFV A;  1U1T A;  4LNS A;  2CJB A;  2YLB A;  2ZCE A;  3LSS A;  1SET A;  5ELO A;  4MML A;  2ZIM A;  2ZR3 A;  3HXW A;  1NYR A;  3INZ A;  2EWN A;  4M7A D;  1E24 A;  4BW9 A;  3KFU A;  3HFO A;  1WU7 A;  1X2G A;  4M77 F;  2DU5 A;  2XGT A;  4TVW A;  4YCW A;  3RGL A;  3UGT A;  2K57 A;  3RKX A;  5GMK e;  1G5I A;  2EJG A;  3UFG A;  2DDZ A;  5GAN j;  3HY1 A;  4H2X A;  1GGM A;  2PMF A;  3L4G A;  3HFN A;  4P74 C;  4JUV A;  4HWS A;  4H2T A;  2I4L A;  4M75 A;  4M78 A;  1QE0 A;  1RIQ A;  4KR2 A; 
#chains in the Genus database with same CATH topology
 4JS5 A;  2FB7 A;  5GAN 4;  1VQ6 A;  4X9D A;  1GXI E;  2ZR2 A;  3M0T A;  4M78 B;  1NJI U;  2D9T A;  4ZTJ A;  1D1C A;  3OYK A;  1KD1 R;  4J5Y A;  3OBW A;  1JJC A;  4WJ4 A;  3HTR A;  1LJO A;  1WQ7 A;  2JZ2 A;  2KRN A;  3VS7 A;  3GPL A;  3CCS T;  2A37 A;  5LJ5 f;  3CCR T;  1KQ1 A;  3H0I A;  5L8R E;  2DNU A;  4C92 B;  3CCE Q;  2DJQ A;  3EG9 A;  3L2Z A;  2LT4 A;  1OV3 A;  2E64 A;  3JCM c;  2XMF A;  4P71 A;  1QVF P;  1ZLM A;  2DZ9 A;  2AK5 A;  3HRK A;  2CZ1 B;  1ZBX A;  1NJ1 A;  3QWY A;  1AD5 A;  3OYE A;  1G3Y A;  1M27 C;  2EKH A;  4RG8 A;  1YJW T;  2YUQ A;  1SHG A;  1V1C A;  4KBM B;  3JCM h;  4BDY A;  3LC0 A;  4P72 A;  1IRX A;  3LYI A;  4EMG A;  3I56 T;  2HBP A;  2RI5 A;  1FMW A;  4CS4 A;  1M1K R;  2FZG B;  3O5Z A;  1ARK A;  2RQW A;  2DL7 A;  3RR6 A;  4C92 C;  2EIF A;  4E7I A;  1VQZ A;  1RAE B;  2ZNI A;  3OS1 A;  2RQR A;  3QSU A;  1SHF A;  4E7K A;  2ZNJ A;  2OX7 A;  1QP3 A;  2JN0 A;  4M7D F;  4LDX A;  1MGQ A;  2JOY A;  2M51 A;  3EG3 A;  4M75 B;  4A63 B;  4FL6 A;  2NLU A;  3KUF A;  3OYB A;  3VRY A;  2ABL A;  5IXF A;  1VQ9 T;  1NJ5 A;  3CC2 T;  1RI9 A;  2DYB A;  3SWN C;  1VQ7 Q;  2CRE A;  2ZPG B;  4YCV A;  1D09 B;  2LJ3 A;  1FX7 A;  1K9A A;  2EYZ A;  4Y28 E;  1Q95 G;  2ODR C;  1N9S A;  3CCV T;  2FL7 A;  2V8I A;  3I9Q A;  3UH0 A;  4K11 A;  5GMK h;  2NWM A;  2RB6 A;  3M54 A;  3IG2 A;  3RKW A;  5GAN d;  3A5Z B;  2P84 A;  5D7U A;  3NEN A;  4K87 A;  4YRT A;  3E2U A;  2LNH B;  1M9S A;  3HRT A;  1RAA B;  2Y4Y A;  3CCJ T;  2CT4 A;  2D8J A;  3EAE A;  1GBR A;  3N5B B;  4QQD A;  2C7I A;  4AG2 C;  4C92 G;  4RTW A;  2KXC A;  1WNL A;  2QG9 B;  2KRO A;  1VQ9 Q;  4EX5 A;  3SWN B;  2CP5 A;  4R56 A;  4OB1 B;  1PD0 A;  4GBQ A;  1YIJ A;  3CXC A;  1H3H A;  1NYF A;  1I4K 1;  3TCJ A;  2I4O A;  1YIT Q;  3WXM B;  4TVR A;  2QTV A;  1M1G A;  4YRN A;  3DLM A;  1M30 A;  5GAN h;  2GF7 A;  4E7H A;  2RQU A;  5IH2 A;  4M7D E;  4ZTF A;  5LJ3 g;  1HD3 A;  2FVU A;  1X55 A;  3MEV A;  1N8R R;  1VQM A;  3GIB A;  2PVG B;  4J9G A;  4HCB A;  3G1Z A;  1KIK A;  5CKE A;  2CP7 A;  2JUF A;  3CPF A;  2HMA A;  4LDU A;  3MF2 A;  1B7T A;  1G83 A;  4PJL A;  1K8A U;  3J81 E;  1WHM A;  2COZ A;  2F69 A;  2HKQ B;  4YRS A;  5KH6 A;  3O8V A;  1I5L A;  2X3X D;  4C92 A;  3EHR A;  1HTT A;  1VQ9 A;  4M7A F;  1SKU B;  1YJN Q;  3S3M A;  1MV0 B;  1VQK A;  4QVZ A;  2DF6 A;  2ZGW A;  1QVG A;  4WF2 A;  3JCM d;  1EZZ B;  3M0P A;  1NPP A;  2K79 A;  5GAO p;  2EYW A;  4GLM A;  3RIR A;  1YIT T;  5FU6 C;  2DO3 A;  2ZIO A;  4HVC A;  3ME9 A;  3IAL A;  4JDS A;  3ULR B;  3TEH B;  2OJ2 A;  4FT4 A;  2DXU A;  3VV0 A;  5CKD A;  2QQR A;  1U1S A;  2YHT A;  3HL8 A;  3M0S A;  2FZC B;  1B34 B;  3RF1 A;  2RA2 A;  3JRZ A;  2GQI A;  2FZK B;  2GQV A;  2E1H A;  1KJW A;  1PWT A;  1ZSZ A;  3QPH A;  3ZBD A;  1E7O A;  2ED1 A;  1RI0 A;  2XKO C;  5GAM h;  3CMA T;  2BKD N;  7AT1 B;  1EVK A;  4HVW A;  1YJN T;  2RJC A;  4A4G A;  3JB9 J;  2FPD A;  3I35 A;  3BW1 A;  5CKB A;  5FU6 B;  3DKM A;  3DB3 A;  4M7A A;  2DXT A;  3NHN A;  3VS2 A;  1VQL A;  1OZ2 A;  2G6F X;  1X6G A;  2HD0 A;  4LD6 A;  1M1K U;  1VQO A;  3V7R A;  2JVV A;  5FRO A;  2DEU A;  1OQK A;  4BY6 B;  1FMV A;  5KYN A;  1TWB A;  4PFP A;  2RI2 A;  4FYV B;  4BD3 A;  5LJ3 d;  2CJ9 A;  4YRR A;  2EGE A;  2IIM A;  2EBP A;  1ABO A;  4HVV A;  1PKT A;  3HXV A;  4YRP A;  3MP1 A;  1Q81 R;  5GMK l;  2CSI A;  3FB9 A;  4FW1 A;  5ELN A;  3JB9 I;  2D6F A;  3M55 A;  2CZ0 B;  4E7J A;  4P75 A;  2ZPF B;  1HJD A;  3LWH A;  4C8Q E;  3TQ7 P;  4IKF A;  2RPN A;  4LXC A;  3X26 B;  3J80 E;  2O4X A;  3CCQ Q;  1X54 A;  3JCM e;  4M78 E;  5GAN f;  2JW4 A;  3QG1 A;  1SG5 A;  5DLO A;  3I5S A;  2YRD A;  2EVR A;  4QT7 A;  5DLQ E;  1TOV A;  2VC8 A;  1NLO C;  1QCN A;  2LX7 A;  4CH3 A;  2K3X A;  1K1Z A;  4OVA A;  1UGQ B;  2JM9 A;  5KYY B;  5CCA A;  3CPW A;  2EYX A;  4JRP A;  1VQN T;  3L2Q A;  4RTV A;  4Y91 A;  4B6M A;  4HCZ A;  3UA6 A;  1AZE A;  3JB9 F;  4LVK A;  1VQL Q;  4X1V A;  5I2M A;  3GP8 A;  3KXT A;  4BDZ A;  5C52 B;  1MMN A;  3OMG A;  1G2B A;  5L23 A;  2CP0 A;  3JB9 G;  2GTJ A;  4F7U E;  3CD6 A;  3TVT A;  3PIO A;  9ATC B;  2F5K A;  2E3H A;  1PG5 B;  2ESW A;  1M1F A;  2EGA A;  4JS4 A;  4OB2 B;  1X01 A;  1VQK Q;  2M9U A;  1UJY A;  4OLF A;  3F70 A;  1VQ6 Q;  3CCV A;  3M0Q A;  4C8Q F;  3VS1 A;  2KGT A;  5LL6 S;  2E4H A;  1JJC B;  4F7U G;  1NYG A;  2EQU A;  3IQL A;  5C51 B;  3MCA B;  2H3J A;  4CS3 A;  4M75 F;  1MMA A;  1RAF B;  2XDD A;  4M7D B;  1U5S A;  2NUT B;  3TEH A;  1TUD A;  1ZHI A;  4LN2 A;  4C0F A;  1EVL A;  4PKC C;  1N8R U;  4WI1 A;  4FYX B;  4AFZ C;  3VU3 C;  1Q7Y U;  5CQX A;  1FYN A;  3OS2 A;  2Y4X A;  4PJO B;  2RHU A;  2RF0 A;  5LJ3 e;  3GLX A;  3GNF B;  1E6H A;  1BU1 A;  3OYY A;  2CGH A;  3CEY A;  1GFC A;  2HEQ A;  3MEW A;  4HWT A;  2D0Q B;  2VB6 A;  4P73 A;  4DOW A;  4YRJ A;  3P8B B;  1X75 C;  3G6E A;  4RTU A;  5ELO A;  2ECZ A;  5C0M A;  3JSC A;  3CMA A;  1AWJ A;  2RJF A;  4MML A;  2ZIM A;  3HXW A;  2KRM A;  1QVF A;  1AVZ C;  2EQJ A;  3G4S T;  5C6S A;  3OYH A;  4M7A D;  1NLP C;  3CCU T;  3ZEH A;  1EX4 A;  1VQ5 T;  2BIV A;  2LRQ A;  3UDC A;  4J9B A;  4M77 F;  2R58 A;  4QW2 A;  1VQ7 A;  2DU5 A;  3RGL A;  2A3L A;  4LNP A;  2K57 A;  2BZY A;  1G5I A;  2LCC A;  2CUD A;  1O75 A;  5KYU B;  2DER A;  1GGM A;  1OOT A;  3CCM T;  3S3O A;  4Z88 A;  2J06 A;  2I4L A;  4M78 A;  1I0C A;  3GF5 A;  4B9X A;  1QE0 A;  4RQE A;  1M1K C;  3IKL A;  3OW2 S;  2I4M A;  2VYT A;  3PTA A;  1K4U S;  1WJS A;  3OA6 A;  1S72 A;  2E3C A;  2EQM A;  4QQ6 A;  3UA7 A;  4YRF A;  1N6A A;  2OI3 A;  3OY9 A;  2CZ6 B;  4XQ3 A;  2O4X B;  4UC4 A;  3EG1 A;  5FWB A;  4P73 C;  3QYG B;  2A36 A;  5CAI A;  4XTZ A;  3M4Q A;  1S1N A;  1Q7Y C;  2PUO B;  1O9S A;  3WVD B;  3JB9 H;  4ATO A;  1PSE A;  1X6B A;  3CME T;  2IY5 A;  1YGB A;  2DEQ A;  2YRC A;  3ZL7 C;  2ATC B;  4J9E A;  1D3B B;  2ZZE A;  1H4S A;  3OSS C;  1OZ3 A;  3C4S A;  2J3L A;  2C0I A;  2EKO A;  3LH0 A;  3QZ5 B;  4UP9 A;  1B8A A;  4C8Q B;  1D0X A;  4DBF A;  3HXZ A;  1Y96 A;  1AZG B;  4BAC A;  1FWZ A;  2DL8 A;  2DTO A;  4LDW A;  1KMN A;  1SRY A;  1NEG A;  4KR2 A;  1H92 A;  2XDP A;  4J15 A;  2GCX A;  2O9V A;  2EFI A;  4IUP A;  4QQG A;  3FJ5 A;  3OSV A;  2KAF A;  5FRM A;  4PJO C;  4OGC A;  4D8D A;  3R07 A;  3G1J A;  4HCK A;  2Q5H A;  1GFD A;  1Q82 R;  3E19 A;  4YRI A;  4ZN3 A;  1WJQ A;  4X34 A;  1E1T A;  3OW2 P;  5GAO r;  1BBW A;  2EYQ A;  1JBM A;  3I5R A;  4IIO A;  1MHN A;  1QVP A;  4M4Z A;  1WYX A;  3LGL A;  1E1O A;  3TU4 K;  5GMK m;  2I2L A;  5KNN A;  5A2Q E;  1YJ9 T;  1LVK A;  1SPK A;  1YJ9 A;  3CQT A;  1G3S A;  3CCM A;  1KQS A;  1Y7X A;  2K5I A;  4O5V A;  2XG8 D;  2RD1 A;  4M77 D;  2DTH A;  2HDA A;  5EG2 A;  2XTI A;  2RH2 A;  4TQF A;  2KDS A;  4J83 A;  3CD6 T;  2JM8 A;  2CKK A;  5LJ3 f;  1ZA1 B;  5KCO A;  2MWP A;  3CC7 Q;  2RHQ A;  2H3E B;  3M0R A;  3JCM J;  4ZN1 A;  3QTC A;  4H2U A;  3L1A A;  1M90 C;  3TEG A;  5KYW A;  3TSW A;  1YCY A;  3G6E Q;  1G5H A;  1QQJ A;  2DXC A;  3SHW A;  3PE0 A;  5KCH A;  2LQW A;  2MMP A;  2CH4 A;  1JU5 C;  2LJ0 A;  3CBM A;  2KMT A;  2QK0 A;  2JTM A;  1VQ4 Q;  2FRY A;  1ASZ A;  4E7L A;  4BE0 A;  1VUB A;  3OBY A;  2RK2 A;  1N9W A;  2CH4 W;  1KMM A;  2C8M A;  2OTJ Q;  4YRL A;  3OYD A;  1VQP T;  3A7A A;  3ICA A;  3UT1 A;  1YHQ Q;  4FSS A;  2DPP B;  2XDB A;  2XD0 A;  1L0W A;  3QDR B;  2C0O A;  4IUT A;  3M4P A;  4XK8 E;  1SES A;  4OMN A;  1UE9 A;  4L87 A;  1I81 A;  5EC7 A;  4HT8 A;  5E3I A;  5KYX A;  2Q7E A;  2ROT A;  1WHJ A;  2H8H A;  2SRC A;  3E9G A;  3SFM A;  2K3Y A;  4TVA A;  3A98 A;  4OMQ A;  3A7U A;  3Q1J A;  3SWN A;  3RAC A;  4PJN A;  2DE0 X;  1KC8 C;  1UHF A;  2YUO A;  1BI3 A;  2LMJ A;  1B70 B;  5A0G A;  2YUP A;  3S3N A;  1AWX A;  2IG0 A;  2J6K A;  2MK5 A;  5GAN 7;  3X28 B;  1ADY A;  1IO6 A;  1OX9 A;  2OAU A;  3A5Z A;  2P0Q A;  3LGF A;  4C8Q A;  4PNO A;  2HNI A;  1B76 A;  1OU8 A;  1UJ0 A;  4AFS C;  4X5O A;  2DL4 A;  3A1P A;  2O31 A;  3E9H A;  2QDL A;  2GFA A;  3MEY A;  4OMM A;  5GAN e;  1BCM A;  3VS6 A;  3QII A;  2QI2 A;  1H3Z A;  4RMO A;  2LZ6 B;  2JS2 A;  1OPK A;  3TRE A;  4YRM A;  3NPF A;  3QXE B;  3BJU A;  2L5Q A;  1WFW A;  4PLL A;  3CXC P;  1B34 A;  4N4G A;  3RKY A;  1AT1 B;  4TVA B;  1BCO A;  2Q7H A;  4P3P A;  1K9M R;  4JLI A;  5LJ5 h;  2VXE A;  4M77 C;  4CH5 A;  1H4T A;  2AKK A;  1K73 R;  4JZ4 A;  4L5G A;  3HXX A;  3CMQ A;  3WVE B;  3RDV A;  2ARS A;  3CCJ A;  3FC3 A;  2QHV A;  3CCE T;  2QHT A;  3OYF A;  3GOX A;  5KYX B;  2SEM A;  3OMC A;  4J6W A;  3BFM A;  2LVM A;  1UGV A;  1I07 A;  2DK3 A;  2X4J A;  8ATC B;  1OUL A;  1X56 A;  2J05 A;  1ATI A;  2A28 A;  2ZCF B;  2ROL A;  4CC7 A;  3EGX A;  2ZT5 A;  2QGG A;  2W0Z A;  2MCN A;  2P4T A;  1DJ7 B;  1QMC A;  1AWW A;  4M7D G;  4P5N A;  5LJ5 e;  1I5O B;  4BB7 A;  1VA7 A;  2RMO A;  1WHH A;  3CPW S;  3EFS A;  1NEB A;  3HP9 A;  1USY C;  3LLR A;  4PJJ A;  4PJO A;  1LYL A;  3I56 Q;  2RI3 A;  2DD4 A;  2K6D A;  4KR3 A;  1UFF A;  1VQ5 Q;  4M7A E;  1NM7 A;  4E47 A;  3EG9 B;  3UAT A;  1YBY A;  2DMO A;  4XTY A;  1YWP A;  4P75 C;  4RMF A;  1B07 A;  1VQ8 Q;  3KFV A;  3GBQ A;  5CVI A;  2D0N A;  3UWN A;  1EIY A;  1KD1 U;  2AZS A;  2VKN A;  2C06 A;  1OX8 A;  2FRW A;  1WJR A;  1RLP C;  5FWC A;  1QP2 A;  4AG1 C;  2K4Y A;  1IB8 A;  1WXB A;  3M59 A;  2OTJ A;  1NPR A;  5K1X A;  4ZNX A;  2LP5 A;  5GAO m;  3L4G B;  2LCS A;  2L3R A;  2PU9 B;  4MDW A;  4PLI A;  3CME A;  1AHJ B;  2YSQ A;  1TSF A;  2WSC E;  1TTH B;  3S6W A;  2CIM A;  1EOV A;  2DFU A;  1R0C B;  2CP6 A;  3EH2 A;  5I21 A;  4FSX A;  1PYS B;  2ZT6 A;  4Z89 A;  1X43 A;  2X4X A;  1YI2 Q;  2P0P A;  2DXB A;  2HL5 C;  3VQY A;  4DOV A;  5LJ5 j;  1JJ2 P;  4V2S A;  5GAO n;  3OYG A;  3UF4 A;  4A4K A;  1M90 U;  4JRK A;  2K7A A;  2EPD A;  4AFQ C;  4EPC A;  1IHV A;  1SSF A;  4YRE A;  2QDY B;  2EL9 A;  1VQM T;  3MEA A;  1VYV A;  4J8O A;  4XTU A;  4H2S A;  5FLX E;  1HXD A;  1V76 A;  1WYD A;  3L2R A;  3QO8 A;  2WSE E;  2KR3 A;  3G71 A;  2QEX T;  3CCU A;  1D0Y A;  2MF2 A;  4M75 E;  5FRN A;  1KD1 C;  3G7Z A;  5IXB A;  4RTZ A;  1UGP B;  4M78 D;  5GAO q;  1MMD A;  3M4Y A;  3VS0 A;  4RG2 A;  2HCK A;  2M0Y A;  4C8Q G;  1SER A;  1VQP A;  1MND A;  3MPU B;  2G3R A;  1UDL A;  2RJE A;  3OD1 A;  3RER A;  4C0D C;  3EHQ A;  1WDX A;  2E65 A;  1IHW A;  1M3C A;  2JT4 A;  4Q15 A;  2DA9 A;  2ALY B;  2L8D A;  4M75 G;  2E70 A;  3JV3 A;  1IGQ A;  3QO3 A;  1KQS P;  5DY9 A;  1WXT A;  1NBE B;  2R5M A;  2E6Z A;  2QAS A;  4DQ2 A;  2ARU A;  1WIE A;  1HC7 A;  2BZX A;  1IL2 A;  3NET A;  5HY6 A;  1NJ2 A;  1WXU A;  1VQO Q;  4PL6 A;  4J9D A;  1U1T A;  3PNW C;  3CC4 Q;  1Y57 A;  3VUZ A;  4LNS A;  4GLK A;  2P0K A;  2YLB A;  4C0G A;  1SET A;  2GTO A;  3BDL A;  3MET A;  2EWN A;  1E24 A;  4FW2 A;  1GL5 A;  1ZSZ B;  1UG1 A;  2E12 A;  3UGT A;  4R0K A;  2AZV A;  2KI7 A;  4DEY A;  3UFG A;  2DLP A;  3HY1 A;  2CS7 A;  2CT3 A;  3L4G A;  3HFN A;  1VQ8 A;  4P74 C;  3QJ6 A;  3R6O A;  4JUV A;  1UTI A;  4KT0 E;  4M75 A;  3CCU Q;  1K73 C;  3LH5 A;  4F17 A;  1AWO A;  3TSZ A;  1GCQ A;  4XTW A;  4A4E A;  4A4H A;  3OYN A;  1BI2 A;  1UUE A;  4YRQ A;  4LVL A;  4L59 A;  5HKC A;  1YNZ A;  2F2W A;  3M56 A;  2P0L A;  1M3B A;  2A8E A;  4CC3 A;  1BYM A;  3FIF A;  3QDF A;  4ZGE B;  4OF1 A;  3OW2 A;  1U8R A;  4M7D A;  1Y71 A;  4ESR A;  2CP2 A;  5D6X A;  4RTY A;  2RHQ B;  1YI2 A;  3HY0 A;  2DRK A;  1Q81 U;  2DQ3 A;  4EMK C;  4G85 A;  4XEM A;  1YCS B;  1YWO A;  3NTK A;  4EO4 A;  3VQV A;  1EQR A;  2MI6 A;  5GAM d;  1U3O A;  5CQY A;  3I7F A;  4Q6G A;  2EJ9 A;  1R0B G;  2ALY A;  1YJ9 Q;  1NJ6 A;  1D3B A;  1H8K A;  3IKM B;  1Q81 C;  1VQ8 T;  3LWI A;  3WQZ A;  5CK9 A;  4DPG A;  1SF9 A;  4C0D B;  1VQ6 T;  3CBP A;  1W66 A;  2RNA A;  4QVD A;  1HK9 A;  3VS3 A;  4M78 F;  1C6V X;  1D1A A;  2JS0 A;  5GAO l;  1W2B P;  2JJ9 A;  4LD9 K;  1IXD A;  2EAY A;  3QWX X;  3E9I A;  1TUC A;  4EMK A;  1ASY A;  1W4S A;  3HRS A;  3M5A A;  2DL3 A;  2D1X A;  4F7U F;  3C95 A;  3HXU A;  2VGN A;  2J3M A;  3H9N A;  2KE9 A;  2HSP A;  2QAZ A;  1G3T A;  4F14 A;  3OYM A;  3HSB A;  1RAB B;  4E6R A;  3A5Y A;  2DAQ A;  1RAG B;  1GCP A;  5D6W A;  4PHC A;  4XU3 A;  1FXX A;  2DX1 A;  3JCM X;  2R5A A;  1OPL A;  3OYI A;  2ZZG A;  4CC4 B;  5KYU A;  3EFR A;  4C92 D;  1VQN Q;  5GAN g;  2ZXF A;  1NJI R;  4HCC A;  1ZSZ C;  4YTL A;  2L2P A;  3SB2 A;  3CCJ Q;  3KBG A;  3M0U A;  3G71 Q;  1PSF A;  3MEU A;  5KE2 A;  1VQL T;  1C1A A;  2M02 A;  4RUG A;  5HK0 A;  2RK1 A;  4DBH A;  1W6X A;  5M9O A;  1T0J A;  3BY7 A;  4JJC A;  1ABQ A;  4O2D A;  4LUE A;  2AKW A;  3C94 A;  4LVJ A;  5A0L A;  4M78 C;  1A0N B;  2ZT7 A;  1PHT A;  4BY6 C;  2CSQ A;  1B70 A;  4A4F A;  1ZUK A;  4QKU A;  3VQX A;  2QTX A;  4M77 G;  2C0T A;  4O6J A;  4FCY A;  2QA4 T;  3X20 B;  5LJ3 j;  2RHX A;  4MZP A;  3CCS Q;  2LQ8 A;  2ODR D;  3HPW A;  3FRN A;  4XU0 A;  5GMK j;  3NGP A;  4JRQ A;  1EIF A;  1T0H A;  4M75 D;  1SEM A;  2V1R A;  4RQF A;  5GMK i;  1XTD A;  2GFU A;  4M77 E;  4YP0 A;  1YHQ A;  4HXJ A;  1K9M C;  2MPX C;  5GAN 8;  3RBB B;  3V8J A;  5A0D A;  2CP3 A;  1W70 A;  4C8Q D;  3J7A F;  4KGX B;  1B7Y A;  2VWF A;  4N4I A;  2E5A A;  2LDM A;  5CO7 A;  4E7S A;  2KBT A;  1XQH A;  1HYO A;  4C92 F;  2DBM A;  2DVJ A;  2HKN A;  4E2F B;  2KNB B;  1PD1 A;  4FT2 A;  3HTZ A;  1H4V B;  3HRU A;  2QGF B;  5LJ5 g;  2EW3 A;  3NTH A;  1TG0 A;  2QHU A;  1G5V A;  5GAM j;  1JO8 A;  5GAN 3;  2O2O A;  4KGZ B;  1TU0 B;  4M75 C;  3JB9 D;  2CJA A;  3A7R A;  4AH6 A;  3L2V A;  2O88 A;  1OYX A;  2J7I A;  2YXY A;  1BKB A;  5ECA A;  3FDR A;  4LUD A;  3H0F A;  2QEX A;  1SRL A;  1E6G A;  4F16 A;  1BBU A;  4NL2 A;  1YFN A;  3BDU A;  4G84 A;  4ZTZ B;  2J6O A;  4LDV A;  2AIR B;  4N0A C;  2W10 A;  1M3A A;  3RL6 A;  1OI1 A;  3SDZ A;  1CSK A;  4DBR A;  2CDT A;  2DKG A;  3MP8 A;  2RHS B;  1KOG A;  1QWF A;  3HXY A;  1X27 A;  3CBO A;  3CC7 T;  4CS2 A;  3CC2 A;  4FYY B;  2AT1 B;  4F04 B;  1PNJ A;  2E41 A;  2O01 E;  1GCQ C;  1I8F A;  1OU9 A;  2GNC A;  2PZ1 A;  4GY5 A;  4DBQ A;  3L42 A;  2P4R A;  5IN1 A;  4WJ3 M;  4AT1 B;  3CC4 T;  2QQ9 A;  4P74 A;  1VQN A;  12AS A;  3VQW A;  2Y90 A;  2JMC A;  3EGX B;  2A08 A;  2E5K A;  3A31 A;  2IY5 B;  4X9C A;  2M16 A;  5AYF A;  2RHZ A;  1N27 A;  2F5T X;  3PVQ A;  1VIE A;  2EJF A;  2ZPI B;  4D8K A;  4M78 G;  3PCO A;  4PG3 A;  3G4S A;  2Q5I A;  1WA7 A;  2JXB A;  1Y0M A;  3CCL Q;  3ZFJ A;  1M2V A;  1P92 A;  1YJN A;  4PFZ A;  1VOM A;  2X4W A;  2FEI A;  3EH1 A;  4BE1 A;  1G51 A;  2XID A;  2LCL A;  3X25 B;  3I56 A;  4P72 C;  11AS A;  2X9H A;  2KY9 A;  1Z7N A;  1EFN A;  2DD5 A;  4YRC A;  1TS9 A;  3FEO A;  3QO7 A;  1Q82 C;  1U06 A;  2XHC A;  4BUG A;  3JCM g;  4AMC A;  2BE7 D;  2MOX A;  3LX7 A;  4KH0 B;  3V8L A;  2KRS A;  4LE9 A;  4XU1 A;  4RCC A;  3E1S A;  2QEX Q;  3M58 A;  2DJZ A;  3P8V A;  1X2K A;  1UEB A;  4CRI A;  1ZBJ A;  1NYQ A;  5IAY A;  4KRT A;  4EDU A;  2V8J A;  4PJO G;  2KSS A;  3EG2 A;  4ZGD B;  4TQD A;  1KK7 A;  2E10 A;  1JQQ A;  3JCM W;  3M53 A;  2I4N A;  1RAH B;  1YN8 A;  1NNH A;  4RKU E;  4M7D C;  2YWW A;  5IHI A;  4J6Y A;  1WI7 A;  3CCV Q;  2DQ0 A;  3ERR A;  4PK4 A;  3JCM V;  4IUU A;  4M7A B;  4NS5 A;  5HCK A;  1N8R C;  1YI2 T;  1XJW B;  1QKW A;  4LVM A;  4P3N A;  2PVD B;  4IUR A;  3SEM A;  3FJP A;  3CCQ A;  3VRZ A;  3VKI A;  2COW A;  3DSQ A;  2AMC A;  4J9I A;  4BI4 A;  2YT6 A;  2KXD A;  3G4S Q;  3VS4 A;  4CH6 A;  2L89 A;  4F7U A;  2X35 A;  1VQ4 T;  5CKF A;  3EFO B;  5GAM e;  2X4Y A;  3THK A;  4M7A G;  4FU6 A;  4CI0 C;  2DU7 A;  3H8Z A;  2M0O A;  1KHI A;  2QYZ A;  4HKE A;  1YIJ Q;  1FYF A;  2EGC A;  3W3S A;  4BI8 B;  2HBW A;  4XTV A;  4MMK A;  2LNV A;  1X6O A;  2HQE A;  4E51 A;  4J7F A;  2MIO A;  2DET A;  2E6N A;  1AOJ A;  2VAS A;  3JCM Q;  4M7A C;  3OYL A;  2LQN A;  1X69 A;  2YRV A;  3HHT B;  4JLG A;  1Z7M A;  4A53 A;  5GAN 2;  4FIB A;  1M5Q 1;  1T3L A;  4EMH A;  1QKX A;  3I55 Q;  3CC4 A;  4DA4 A;  1Z9Z A;  2FHD A;  4KUL A;  2ZTG A;  3EGU A;  2IVW A;  3C12 A;  2DVE A;  2EQI A;  3CC2 Q;  5GJV B;  1YB3 A;  4Q5W A;  2ZT8 A;  3G71 T;  3HFV A;  1ACM B;  3DLL A;  2LTO A;  5FW9 A;  2DBK A;  2X3W D;  2WAC A;  3R6N A;  2ZR3 A;  4B9W A;  1UGS B;  1MNE A;  2RHI A;  3C0C A;  1NYR A;  3INZ A;  3HKS A;  1V29 B;  3H6Z A;  3HFO A;  2VVK A;  1VQ5 A;  1BBZ A;  3BE3 A;  3TEE A;  5KYY A;  2OTL T;  4N4H A;  2HAX A;  2LT1 A;  1M90 R;  3D7S B;  1M4Z A;  2A0F B;  2MAM A;  1C0M A;  5GMK e;  1S72 Q;  2EJG A;  2XI9 A;  1X2Q A;  1K73 U;  1K0X A;  2DDZ A;  5GAN j;  1ZA2 B;  4H2X A;  3URG A;  1VYT A;  2QA4 Q;  2PMF A;  4ELZ C;  4WTO B;  4JJD A;  4ZGJ B;  2I0N A;  4H2T A;  1JB0 E;  1JXO A;  2K2V A;  2F1L A;  3T9N A;  2J6F A;  4KGV B;  2PTK A;  1KC8 U;  5CR2 A;  1BI0 A;  3OB9 A;  1H4Q A;  2FPF A;  2DIG A;  2V8K A;  4M7D D;  2RO0 A;  5C53 B;  4L6V 5;  1NJ8 A;  3MJX A;  1XNI A;  1M2V B;  2K3B A;  2A7Y A;  1QWE A;  1JEG A;  1JJ2 A;  2D8H A;  1VQM Q;  3PCO B;  1WZO A;  1WX6 A;  4PJO D;  3CMA Q;  2V26 A;  4R55 A;  3EGD B;  1Y07 A;  4C0Z A;  3MHX A;  3VUB A;  4KUD K;  1N5Z A;  2KEA A;  4H2X B;  1JRI A;  1CKB A;  2XIC A;  2DL5 A;  4XAX B;  1PRL C;  4MZM A;  5D6Y A;  1VYU A;  1YP5 A;  1Q86 C;  1N9R A;  4C5H A;  3CCM Q;  2GBQ A;  1R77 A;  1W2B S;  4UP7 A;  4H02 A;  1M2O A;  4IUV A;  3A8G B;  1MMG A;  2ENM A;  3EGD A;  1B3Q A;  3M57 A;  4MDX A;  1ZUU A;  4J7I A;  2K5F A;  4TVY A;  1VQK T;  2Z0W A;  2ZPE B;  3PMT A;  2AHJ B;  3CC7 A;  2DIL A;  5I11 A;  1OEB A;  2KK4 A;  3REA B;  5J3B A;  3CCL T;  4TWA A;  3VYG A;  3UGQ A;  2LX9 A;  1WHK A;  2DZC A;  1QW1 A;  4JPB W;  1PM3 A;  1TH7 A;  3E9F A;  2RHS A;  2HL3 A;  3RES A;  4YPF A;  1PYS A;  2JTE A;  5I22 A;  2OTJ T;  1EIY B;  1TUG B;  4ZTU B;  2ZZF A;  4QVC A;  3GNG A;  2VV5 A;  1XOV A;  4RTT A;  6AT1 B;  4NL3 A;  1KSW A;  3RMS A;  2ZIN A;  2HSE B;  1Q86 R;  4J9H A;  2NUP B;  2HZY A;  4HWO A;  4CH4 A;  3A8O B;  4YYE A;  1YFT A;  1PKS A;  4E7Z A;  2CYZ B;  1H64 1;  1W2B A;  1K9M U;  4OB0 B;  1SRM A;  2PUK B;  3ER0 A;  5GAM g;  1WLE A;  1LPL A;  2Q7G A;  2E5Q A;  4P71 C;  1PC0 A;  1UGR B;  2RM4 A;  3REX A;  1Q7Y R;  4PJM A;  1VQ4 A;  2M1H A;  1YFR A;  4YRG A;  4ZIB A;  2VXF A;  3PT9 A;  3MF1 A;  3CCR A;  1KG1 A;  4HA8 A;  1NG2 A;  5IHN A;  1Q86 U;  1ZSG A;  3AHU A;  2K9G A;  3AT1 B;  2OTL Q;  5HK3 A;  3NMZ C;  4YDQ A;  3HFZ A;  2RQV A;  3NFC A;  2XK0 A;  1C0A A;  3A74 A;  4OML A;  3V7C A;  3NEL A;  1BIB A;  1QVG P;  1K8A C;  3MQZ A;  1RAC B;  4JRI A;  2LC4 A;  4KUI A;  5DM7 R;  2E3I A;  1K0S A;  1KQS S;  4RTX A;  1TXQ A;  4LVI A;  3I55 T;  1JXM A;  4XU2 A;  2KYM A;  1CKA A;  4OGE A;  5LJ5 d;  1NZ9 A;  5J39 A;  3CCQ T;  4OMO A;  1LOJ A;  4TTV A;  1QF6 A;  1UHC A;  4J6X A;  3SD4 A;  2BE9 B;  2EQK A;  1YJW Q;  1UB4 A;  3A8H B;  3P8H A;  4PJO F;  1VQO T;  4C8Q C;  3U23 A;  3V8K A;  2EYY A;  4M77 B;  2V1Q A;  1GBQ A;  3M4G A;  3MP6 A;  1M8V A;  3VBB A;  4BE2 A;  1FMK A;  4FM4 B;  2PNI A;  4M77 A;  3P8Y A;  2FPE A;  1MUZ A;  4H2W A;  3QNE A;  2FO0 A;  1D0Z A;  3DB4 A;  5LJ3 h;  3JCM P;  2KQW A;  3RUX A;  3QO5 A;  1YIT A;  5GAN 6;  4C5E A;  2HQH A;  4DEX A;  2RN8 A;  3P8T A;  3VS5 A;  4UPA A;  2BUD A;  2QHS A;  1WHG A;  5J26 A;  3QHS A;  4MZT A;  2OAW A;  2RQT A;  3HRI A;  1LNX A;  4C92 E;  1USY A;  2JNG A;  1RUW A;  2XU8 A;  4OMF B;  1RL2 A;  3REB B;  1K8A R;  2PQW A;  1I1J A;  2QQA A;  1UEC A;  3VJP A;  2PVO B;  2JMA A;  3ASK A;  2L0A A;  1QCO A;  2YLC A;  2ZPB B;  1Q82 U;  1K76 A;  2NUZ A;  5KE3 A;  1G8X A;  4VUB A;  1EFW A;  4C5G A;  1BIA A;  1VQ7 T;  5IHK A;  2ZPH B;  3PGG A;  1T3S A;  2K5L A;  1JJ2 S;  3A8L B;  4XEO A;  4K88 A;  4K86 A;  3PZC A;  3NEM A;  3QYH B;  4ME7 A;  1G3W A;  5CKH A;  4HT4 A;  3V7S A;  4HT9 A;  1WQW A;  2NYS A;  3PIP A;  1ZX6 A;  3G6E T;  3MO8 A;  2JTF A;  2LJ1 A;  4RDX A;  2DTI A;  2YDL A;  4OB3 B;  3QKJ A;  2L3P A;  3OYA A;  2ART A;  1VIF A;  2L3Q A;  2KT8 A;  3L2U A;  2ZZD A;  3QZ9 B;  2OTL A;  5FU7 C;  3JCM b;  5F5W A;  4YRK A;  2K2M A;  1BI1 A;  1WGS A;  1YHQ T;  1YFS A;  1VQP Q;  2COY A;  3CPW P;  2MWO A;  1W1F A;  2FG0 A;  2HQX A;  3EFO A;  3CCS A;  1J3T A;  1ZQ1 A;  2G4C A;  2NUT A;  3QUI A;  2BZ8 A;  3CCL A;  3A32 A;  5GAM f;  2GGR A;  4BI3 A;  2WSF E;  1QVF S;  2AMC B;  2FYK A;  3QBY A;  4ANJ A;  3X24 B;  4AFU C;  3RMQ A;  4RCB A;  1KC8 R;  4HWP A;  2B8A A;  4KH1 B;  4IUQ A;  4ORZ A;  4Y92 A;  4YRO A;  1WHL A;  1WPY A;  3TUP A;  2F2X A;  1J5W A;  4Z8A A;  3HFZ B;  3FLG A;  3CD6 Q;  4LDY A;  4ELY C;  2QQB A;  4F7U B;  2KVQ G;  2L3S A;  2VGM A;  4PFO A;  3H41 A;  4FYW B;  2VUB A;  3LW5 E;  3MKD A;  2DYI A;  3CME Q;  2DM1 A;  3PFS A;  2P5I A;  5K1P A;  2AKW B;  1KQ2 A;  4N0A A;  2ED0 A;  1ADJ A;  4J9F A;  1IZ6 A;  3OYJ A;  1GRI A;  1RLQ C;  1Y96 B;  3CXC S;  2DRM A;  1Z9Q A;  1B7Y B;  3LSQ A;  5GJW B;  1E22 A;  4NCX A;  3OS5 A;  1RAI B;  3NTI A;  3H0H A;  3JCM f;  4P3O A;  4YCU A;  4EMK B;  2QXF A;  1YJW A;  3PMI A;  3JAM E;  1NE8 A;  2F2V A;  4EIK A;  2NS6 A;  1QLY A;  4II1 A;  4NOY A;  3VYH B;  1QCF A;  1F1B B;  1LCK A;  1S72 T;  2LQK A;  4C5I A;  4OP0 A;  4KQE A;  3QJY A;  4UP8 A;  3OS0 A;  5AT1 B;  4CC2 A;  5GAN 5;  3L2W A;  3REU A;  3I55 A;  4XTX A;  1X2H A;  2R57 A;  1QVG S;  1IGU A;  1HSQ A;  1RAD B;  4HWR A;  4H2V A;  5HGQ A;  5I2S A;  1PCX A;  1BB9 A;  4HVU A;  4J9C A;  2QA4 A;  4D6W A;  2PME A;  2CUB A;  4JZ3 A;  4H2Y A;  4Z02 A;  3RNJ A;  1D1B A;  2KT1 A;  3P8D A;  1WLP B;  2KYB A;  1SSH A;  4BWA A;  1AEY A;  2ZAE A;  4PJO E;  4A54 A;  1PRM C;  3A8M B;  2CJB A;  1NJI C;  5FU7 B;  2X51 A;  3OYC A;  2ZCE A;  3LSS A;  5KYW B;  1KHC A;  2IPO B;  4IIM A;  3EG0 A;  4JJB A;  3CCE A;  1ZUY A;  2O9S A;  3OQ5 A;  2QQS A;  3KFU A;  2RHY A;  2DIQ A;  4BW9 A;  4WCI A;  1WU7 A;  1X2G A;  1M8M A;  4OMP A;  2XGT A;  4TVW A;  4YCW A;  4JJN K;  2AKL A;  3RKX A;  2B86 A;  3M9Q A;  1YIJ T;  3UPU A;  2MYS A;  1MV3 A;  2RJD A;  1IRE B;  1R8O B;  1KFZ A;  3CCR Q;  4HWS A;  5IT9 E;  2YUN A;  2BTT A;  8AT1 B;  2CZ7 B;  2NUP A;  1BK2 A;  3PVL A;  1RIQ A;  5CIU A; 
#chains in the Genus database with same CATH homology
 4JS5 A;  2FB7 A;  5GAN 4;  1VQ6 A;  4X9D A;  1GXI E;  2ZR2 A;  4M78 B;  1NJI U;  2D9T A;  4ZTJ A;  3OYK A;  4J5Y A;  3OBW A;  1JJC A;  4WJ4 A;  1LJO A;  1WQ7 A;  2JZ2 A;  3GPL A;  3CCS T;  5LJ5 f;  3CCR T;  1KQ1 A;  5L8R E;  4C92 B;  3L2Z A;  2LT4 A;  2E64 A;  3JCM c;  4P71 A;  2DZ9 A;  3HRK A;  2CZ1 B;  1ZBX A;  1NJ1 A;  3OYE A;  1G3Y A;  4RG8 A;  1YJW T;  4KBM B;  3JCM h;  4BDY A;  3LC0 A;  4P72 A;  3LYI A;  4EMG A;  3I56 T;  2HBP A;  2RI5 A;  4CS4 A;  4C92 C;  2EIF A;  4E7I A;  1VQZ A;  2ZNI A;  3OS1 A;  3QSU A;  4E7K A;  2ZNJ A;  1QP3 A;  2JN0 A;  4M7D F;  4LDX A;  1MGQ A;  2JOY A;  4M75 B;  4FL6 A;  2NLU A;  3KUF A;  3OYB A;  1VQ9 T;  1NJ5 A;  3CC2 T;  3SWN C;  2ZPG B;  4YCV A;  1FX7 A;  4Y28 E;  2ODR C;  1N9S A;  3CCV T;  2FL7 A;  2V8I A;  3UH0 A;  5GMK h;  2RB6 A;  3M54 A;  3IG2 A;  3RKW A;  5GAN d;  3A5Z B;  3NEN A;  4K87 A;  4YRT A;  1M9S A;  3HRT A;  2Y4Y A;  3CCJ T;  3EAE A;  3N5B B;  4QQD A;  2C7I A;  4C92 G;  1WNL A;  4EX5 A;  3SWN B;  4R56 A;  4OB1 B;  1YIJ A;  3CXC A;  1I4K 1;  3TCJ A;  2I4O A;  3WXM B;  4TVR A;  1M1G A;  4YRN A;  3DLM A;  5GAN h;  2GF7 A;  4E7H A;  4M7D E;  4ZTF A;  5LJ3 g;  2FVU A;  1X55 A;  3MEV A;  1VQM A;  3GIB A;  2PVG B;  4HCB A;  3G1Z A;  5CKE A;  2JUF A;  3CPF A;  4LDU A;  3MF2 A;  1K8A U;  3J81 E;  2F69 A;  4YRS A;  5KH6 A;  3O8V A;  1I5L A;  4C92 A;  1HTT A;  1VQ9 A;  4M7A F;  3S3M A;  1VQK A;  4QVZ A;  2ZGW A;  1QVG A;  4WF2 A;  3JCM d;  1NPP A;  5GAO p;  3RIR A;  1YIT T;  5FU6 C;  2DO3 A;  2ZIO A;  4HVC A;  3ME9 A;  3IAL A;  4JDS A;  3TEH B;  4FT4 A;  2DXU A;  3VV0 A;  5CKD A;  2QQR A;  1U1S A;  2YHT A;  3HL8 A;  1B34 B;  3RF1 A;  2RA2 A;  3JRZ A;  2GQV A;  2E1H A;  3QPH A;  3ZBD A;  1RI0 A;  2XKO C;  5GAM h;  3CMA T;  2BKD N;  1EVK A;  1YJN T;  2RJC A;  4A4G A;  3JB9 J;  3BW1 A;  5CKB A;  5FU6 B;  3DKM A;  3DB3 A;  4M7A A;  2DXT A;  1VQL A;  1OZ2 A;  2HD0 A;  4LD6 A;  1M1K U;  1VQO A;  3V7R A;  2JVV A;  5FRO A;  4BY6 B;  2RI2 A;  4BD3 A;  5LJ3 d;  2CJ9 A;  4YRR A;  3HXV A;  4YRP A;  3MP1 A;  5GMK l;  3FB9 A;  5ELN A;  3JB9 I;  2D6F A;  3M55 A;  2CZ0 B;  4E7J A;  4P75 A;  2ZPF B;  3LWH A;  4C8Q E;  4IKF A;  3X26 B;  3J80 E;  2O4X A;  1X54 A;  3JCM e;  4M78 E;  5GAN f;  3QG1 A;  5DLO A;  5DLQ E;  2VC8 A;  4CH3 A;  2K3X A;  4OVA A;  1UGQ B;  5CCA A;  3CPW A;  4JRP A;  1VQN T;  3L2Q A;  4Y91 A;  4HCZ A;  3JB9 F;  4LVK A;  5I2M A;  3GP8 A;  3KXT A;  4BDZ A;  5C52 B;  3OMG A;  3JB9 G;  4F7U E;  3CD6 A;  3PIO A;  2F5K A;  1M1F A;  4JS4 A;  4OB2 B;  1X01 A;  2M9U A;  4OLF A;  3F70 A;  3CCV A;  4C8Q F;  5LL6 S;  1JJC B;  4F7U G;  2EQU A;  5C51 B;  3MCA B;  2H3J A;  4CS3 A;  4M75 F;  2XDD A;  4M7D B;  3TEH A;  1ZHI A;  4C0F A;  1EVL A;  4PKC C;  1N8R U;  4WI1 A;  3VU3 C;  1Q7Y U;  5CQX A;  3OS2 A;  2Y4X A;  4PJO B;  2RHU A;  5LJ3 e;  3GLX A;  3GNF B;  3OYY A;  2CGH A;  3CEY A;  3MEW A;  4HWT A;  2D0Q B;  4P73 A;  4DOW A;  4YRJ A;  3P8B B;  1X75 C;  3G6E A;  5ELO A;  5C0M A;  3JSC A;  3CMA A;  2RJF A;  4MML A;  2ZIM A;  3HXW A;  1QVF A;  2EQJ A;  3G4S T;  5C6S A;  3OYH A;  4M7A D;  3CCU T;  3ZEH A;  1VQ5 T;  2BIV A;  2LRQ A;  3UDC A;  4M77 F;  2R58 A;  4QW2 A;  1VQ7 A;  2DU5 A;  3RGL A;  2A3L A;  2K57 A;  1G5I A;  2LCC A;  1O75 A;  1GGM A;  3CCM T;  3S3O A;  2I4L A;  4M78 A;  3GF5 A;  4B9X A;  1QE0 A;  4RQE A;  1M1K C;  3IKL A;  3OW2 S;  2I4M A;  2VYT A;  3PTA A;  1WJS A;  3OA6 A;  1S72 A;  2E3C A;  2EQM A;  4QQ6 A;  4YRF A;  1N6A A;  3OY9 A;  2CZ6 B;  4XQ3 A;  2O4X B;  4UC4 A;  4P73 C;  3QYG B;  5CAI A;  4XTZ A;  3M4Q A;  1Q7Y C;  2PUO B;  1O9S A;  3WVD B;  3JB9 H;  4ATO A;  1PSE A;  3CME T;  2IY5 A;  1YGB A;  2DEQ A;  1D3B B;  2ZZE A;  1H4S A;  3OSS C;  1OZ3 A;  3C4S A;  2J3L A;  2EKO A;  3LH0 A;  3QZ5 B;  4UP9 A;  1B8A A;  4C8Q B;  3HXZ A;  1Y96 A;  4BAC A;  1FWZ A;  4LDW A;  2DTO A;  1KMN A;  1SRY A;  4KR2 A;  2XDP A;  4J15 A;  2GCX A;  2EFI A;  4IUP A;  4QQG A;  3OSV A;  2KAF A;  5FRM A;  4PJO C;  4OGC A;  3R07 A;  2Q5H A;  3E19 A;  4YRI A;  4ZN3 A;  1WJQ A;  4X34 A;  1E1T A;  5GAO r;  1BBW A;  2EYQ A;  1JBM A;  1MHN A;  1QVP A;  3LGL A;  1E1O A;  3TU4 K;  5GMK m;  2I2L A;  5KNN A;  5A2Q E;  1YJ9 T;  1YJ9 A;  1G3S A;  3CCM A;  1KQS A;  1Y7X A;  2K5I A;  4O5V A;  2XG8 D;  2RD1 A;  4M77 D;  2DTH A;  5EG2 A;  2XTI A;  2RH2 A;  4TQF A;  2KDS A;  4J83 A;  3CD6 T;  2CKK A;  5LJ3 f;  5KCO A;  2MWP A;  2RHQ A;  3JCM J;  4ZN1 A;  3QTC A;  4H2U A;  3L1A A;  1M90 C;  3TEG A;  1YCY A;  1G5H A;  2DXC A;  5KCH A;  2MMP A;  3CBM A;  2KMT A;  2JTM A;  1ASZ A;  4E7L A;  4BE0 A;  1VUB A;  3OBY A;  2RK2 A;  1N9W A;  1KMM A;  2C8M A;  4YRL A;  3OYD A;  1VQP T;  3A7A A;  3ICA A;  3UT1 A;  2DPP B;  2XDB A;  2XD0 A;  1L0W A;  3QDR B;  4IUT A;  3M4P A;  4XK8 E;  1SES A;  4L87 A;  1I81 A;  4HT8 A;  5E3I A;  2Q7E A;  3E9G A;  3SFM A;  2K3Y A;  4TVA A;  3A7U A;  3Q1J A;  3SWN A;  3RAC A;  1KC8 C;  1BI3 A;  1B70 B;  5A0G A;  3S3N A;  2IG0 A;  5GAN 7;  3X28 B;  1ADY A;  2OAU A;  3A5Z A;  2P0Q A;  3LGF A;  4C8Q A;  4PNO A;  2HNI A;  1B76 A;  4X5O A;  3E9H A;  2GFA A;  3MEY A;  5GAN e;  3QII A;  2QI2 A;  1H3Z A;  4RMO A;  3TRE A;  4YRM A;  3QXE B;  3BJU A;  2L5Q A;  4PLL A;  1B34 A;  4N4G A;  3RKY A;  4TVA B;  2Q7H A;  4P3P A;  4JLI A;  5LJ5 h;  2VXE A;  4M77 C;  4CH5 A;  1H4T A;  4L5G A;  3HXX A;  3CMQ A;  3WVE B;  2ARS A;  3CCJ A;  3FC3 A;  2QHV A;  3CCE T;  2QHT A;  3OYF A;  3GOX A;  4J6W A;  3OMC A;  3BFM A;  2LVM A;  2DK3 A;  2X4J A;  1X56 A;  1ATI A;  2ZCF B;  2ZT5 A;  2P4T A;  1DJ7 B;  4M7D G;  4P5N A;  5LJ5 e;  4BB7 A;  3CPW S;  3EFS A;  3HP9 A;  1USY C;  3LLR A;  4PJO A;  1LYL A;  2RI3 A;  2DD4 A;  4KR3 A;  4M7A E;  4E47 A;  1YBY A;  4XTY A;  4P75 C;  4RMF A;  5CVI A;  3UWN A;  1EIY A;  1KD1 U;  2C06 A;  1WJR A;  1QP2 A;  2K4Y A;  3M59 A;  2OTJ A;  1NPR A;  5K1X A;  5GAO m;  3L4G B;  2L3R A;  2PU9 B;  4MDW A;  4PLI A;  3CME A;  1AHJ B;  2WSC E;  3S6W A;  2CIM A;  1EOV A;  5I21 A;  4FSX A;  1PYS B;  2ZT6 A;  2X4X A;  2P0P A;  2DXB A;  3VQY A;  4DOV A;  5LJ5 j;  4V2S A;  5GAO n;  3OYG A;  4A4K A;  1M90 U;  4JRK A;  4EPC A;  1SSF A;  4YRE A;  2QDY B;  2EL9 A;  1VQM T;  3MEA A;  4XTU A;  4J8O A;  4H2S A;  5FLX E;  1HXD A;  1WYD A;  3L2R A;  3QO8 A;  2WSE E;  3G71 A;  2QEX T;  3CCU A;  2MF2 A;  4M75 E;  5FRN A;  1KD1 C;  3G7Z A;  1UGP B;  4M78 D;  5GAO q;  3M4Y A;  4RG2 A;  4C8Q G;  1SER A;  1VQP A;  2G3R A;  2RJE A;  3OD1 A;  3RER A;  4C0D C;  2E65 A;  4Q15 A;  2ALY B;  2L8D A;  4M75 G;  2E70 A;  3QO3 A;  5DY9 A;  2R5M A;  2E6Z A;  4DQ2 A;  2ARU A;  1HC7 A;  1IL2 A;  3NET A;  5HY6 A;  1NJ2 A;  4PL6 A;  1U1T A;  3PNW C;  3VUZ A;  4LNS A;  4GLK A;  2P0K A;  2YLB A;  4C0G A;  1SET A;  3BDL A;  3MET A;  2EWN A;  1E24 A;  2E12 A;  3UGT A;  3UFG A;  3HY1 A;  2CS7 A;  3L4G A;  3HFN A;  1VQ8 A;  4P74 C;  3QJ6 A;  3R6O A;  4JUV A;  4KT0 E;  4M75 A;  1K73 C;  4XTW A;  4A4E A;  4A4H A;  3OYN A;  1BI2 A;  4YRQ A;  4LVL A;  4L59 A;  5HKC A;  3M56 A;  2P0L A;  2A8E A;  1BYM A;  3FIF A;  4ZGE B;  4OF1 A;  3OW2 A;  1U8R A;  4M7D A;  1Y71 A;  5D6X A;  2RHQ B;  1YI2 A;  3HY0 A;  1Q81 U;  2DQ3 A;  4EMK C;  4G85 A;  4XEM A;  3NTK A;  4EO4 A;  3VQV A;  1EQR A;  2MI6 A;  5GAM d;  5CQY A;  3I7F A;  4Q6G A;  2EJ9 A;  2ALY A;  1NJ6 A;  1D3B A;  3IKM B;  1Q81 C;  1VQ8 T;  3LWI A;  3WQZ A;  5CK9 A;  4DPG A;  4C0D B;  1VQ6 T;  3CBP A;  1W66 A;  4QVD A;  1HK9 A;  4M78 F;  5GAO l;  4LD9 K;  2EAY A;  3E9I A;  1ASY A;  4EMK A;  1W4S A;  3HRS A;  3M5A A;  4F7U F;  3C95 A;  3HXU A;  2VGN A;  2J3M A;  1G3T A;  3OYM A;  3HSB A;  3A5Y A;  2DAQ A;  5D6W A;  4PHC A;  4XU3 A;  1FXX A;  3JCM X;  2R5A A;  3OYI A;  2ZZG A;  3EFR A;  4C92 D;  5GAN g;  2ZXF A;  4HCC A;  4YTL A;  3SB2 A;  3KBG A;  1PSF A;  3MEU A;  5KE2 A;  1VQL T;  5HK0 A;  2RK1 A;  5M9O A;  3BY7 A;  4O2D A;  2AKW A;  3C94 A;  4LVJ A;  5A0L A;  4M78 C;  2ZT7 A;  4BY6 C;  1B70 A;  4A4F A;  3VQX A;  2QTX A;  4M77 G;  4O6J A;  2QA4 T;  3X20 B;  5LJ3 j;  2RHX A;  4MZP A;  2LQ8 A;  2ODR D;  3HPW A;  3FRN A;  4XU0 A;  5GMK j;  4JRQ A;  1EIF A;  4M75 D;  4RQF A;  5GMK i;  1XTD A;  2GFU A;  4M77 E;  4YP0 A;  1YHQ A;  1K9M C;  5GAN 8;  3V8J A;  5A0D A;  4C8Q D;  1B7Y A;  3J7A F;  4N4I A;  2E5A A;  2LDM A;  5CO7 A;  1XQH A;  4C92 F;  4FT2 A;  3HTZ A;  1H4V B;  3HRU A;  5LJ5 g;  3NTH A;  2QHU A;  1G5V A;  5GAM j;  5GAN 3;  4M75 C;  3JB9 D;  2CJA A;  3A7R A;  4AH6 A;  3L2V A;  1OYX A;  1BKB A;  3FDR A;  2QEX A;  1BBU A;  4NL2 A;  3BDU A;  4G84 A;  4ZTZ B;  4LDV A;  4N0A C;  3RL6 A;  1OI1 A;  3SDZ A;  2DKG A;  3MP8 A;  2RHS B;  1KOG A;  3HXY A;  3CBO A;  3CC7 T;  4CS2 A;  3CC2 A;  2E41 A;  2O01 E;  1I8F A;  4GY5 A;  3L42 A;  5IN1 A;  4WJ3 M;  3CC4 T;  2QQ9 A;  4P74 A;  1VQN A;  12AS A;  3VQW A;  2Y90 A;  3A31 A;  2IY5 B;  4X9C A;  2M16 A;  5AYF A;  2RHZ A;  1N27 A;  2F5T X;  1VIE A;  2EJF A;  2ZPI B;  3PCO A;  4M78 G;  4PG3 A;  3G4S A;  3ZFJ A;  1P92 A;  1YJN A;  2X4W A;  4BE1 A;  1G51 A;  2XID A;  2LCL A;  3X25 B;  3I56 A;  4P72 C;  11AS A;  2KY9 A;  1Z7N A;  2DD5 A;  4YRC A;  3FEO A;  3QO7 A;  1Q82 C;  2XHC A;  4BUG A;  3JCM g;  3LX7 A;  3V8L A;  4XU1 A;  4RCC A;  3E1S A;  3M58 A;  2DJZ A;  3P8V A;  1UEB A;  4CRI A;  1NYQ A;  5IAY A;  4EDU A;  2V8J A;  4PJO G;  2KSS A;  4ZGD B;  4TQD A;  2E10 A;  3JCM W;  3M53 A;  2I4N A;  1NNH A;  4RKU E;  4M7D C;  1RIQ A;  3ERR A;  4J6Y A;  2DQ0 A;  3JCM V;  4IUU A;  4M7A B;  4NS5 A;  1N8R C;  1YI2 T;  4LVM A;  4P3N A;  2PVD B;  4IUR A;  3CCQ A;  3FJP A;  3VKI A;  3DSQ A;  2AMC A;  4BI4 A;  4CH6 A;  2L89 A;  4F7U A;  2X35 A;  1VQ4 T;  5CKF A;  5GAM e;  2X4Y A;  4M7A G;  4FU6 A;  4CI0 C;  2DU7 A;  3H8Z A;  2M0O A;  1KHI A;  4HKE A;  1FYF A;  3W3S A;  4BI8 B;  4XTV A;  4MMK A;  2LNV A;  1X6O A;  2HQE A;  4E51 A;  4J7F A;  2E6N A;  4M7A C;  3JCM Q;  3OYL A;  2YRV A;  3HHT B;  4JLG A;  1Z7M A;  4A53 A;  5GAN 2;  4FIB A;  1M5Q 1;  4EMH A;  3CC4 A;  4DA4 A;  2FHD A;  4KUL A;  2ZTG A;  2IVW A;  3C12 A;  2DVE A;  1YB3 A;  4Q5W A;  2ZT8 A;  3G71 T;  3HFV A;  3DLL A;  2LTO A;  2WAC A;  2ZR3 A;  4B9W A;  1UGS B;  2RHI A;  1NYR A;  3INZ A;  3HKS A;  1V29 B;  3H6Z A;  3HFO A;  1VQ5 A;  3TEE A;  2OTL T;  4N4H A;  2HAX A;  2LT1 A;  1M4Z A;  2MAM A;  5GMK e;  1K73 U;  2XI9 A;  2EJG A;  2DDZ A;  5GAN j;  4H2X A;  3URG A;  2PMF A;  4ELZ C;  4ZGJ B;  4H2T A;  1JB0 E;  2K2V A;  3T9N A;  1KC8 U;  5CR2 A;  1BI0 A;  3OB9 A;  1H4Q A;  2DIG A;  2V8K A;  4M7D D;  2RO0 A;  5C53 B;  4L6V 5;  1NJ8 A;  1XNI A;  2A7Y A;  1JJ2 A;  3PCO B;  4PJO D;  4R55 A;  1Y07 A;  4C0Z A;  3MHX A;  3VUB A;  4KUD K;  4H2X B;  1JRI A;  2XIC A;  4XAX B;  4MZM A;  5D6Y A;  1Q86 C;  1N9R A;  4C5H A;  4UP7 A;  1W2B S;  4H02 A;  4IUV A;  3A8G B;  3M57 A;  4MDX A;  4J7I A;  2K5F A;  4TVY A;  1VQK T;  2ZPE B;  3PMT A;  2AHJ B;  3CC7 A;  2KK4 A;  5J3B A;  3CCL T;  4TWA A;  3VYG A;  3UGQ A;  2LX9 A;  2DZC A;  1QW1 A;  2RHS A;  1TH7 A;  3E9F A;  3RES A;  4YPF A;  1PYS A;  2OTJ T;  1EIY B;  4ZTU B;  2ZZF A;  4QVC A;  3GNG A;  2VV5 A;  1XOV A;  4NL3 A;  3RMS A;  2ZIN A;  4CH4 A;  4HWO A;  3A8O B;  4YYE A;  1YFT A;  2CYZ B;  1H64 1;  1K9M U;  1W2B A;  4OB0 B;  2PUK B;  3ER0 A;  5GAM g;  1WLE A;  2Q7G A;  2E5Q A;  4P71 C;  1UGR B;  2RM4 A;  3REX A;  1VQ4 A;  2M1H A;  1YFR A;  4YRG A;  4ZIB A;  2VXF A;  3PT9 A;  3MF1 A;  3CCR A;  1KG1 A;  4HA8 A;  1Q86 U;  3AHU A;  5HK3 A;  4YDQ A;  3HFZ A;  3NFC A;  2XK0 A;  1C0A A;  3A74 A;  3V7C A;  3NEL A;  1BIB A;  1K8A C;  3MQZ A;  4JRI A;  2LC4 A;  4KUI A;  5DM7 R;  1KQS S;  4LVI A;  3I55 T;  4XU2 A;  4OGE A;  5LJ5 d;  1NZ9 A;  5J39 A;  3CCQ T;  1LOJ A;  4TTV A;  1QF6 A;  4J6X A;  3SD4 A;  2EQK A;  1UB4 A;  3A8H B;  3P8H A;  4PJO F;  1VQO T;  4C8Q C;  3V8K A;  4M77 B;  3M4G A;  3MP6 A;  1M8V A;  3VBB A;  4BE2 A;  4FM4 B;  4M77 A;  3P8Y A;  4H2W A;  3QNE A;  3DB4 A;  5LJ3 h;  3JCM P;  2KQW A;  3RUX A;  3QO5 A;  1YIT A;  5GAN 6;  4C5E A;  3P8T A;  4UPA A;  2BUD A;  2QHS A;  5J26 A;  3QHS A;  4MZT A;  3HRI A;  1LNX A;  4C92 E;  1USY A;  2JNG A;  2XU8 A;  4OMF B;  1RL2 A;  2PQW A;  2QQA A;  3VJP A;  2PVO B;  3ASK A;  2YLC A;  2ZPB B;  1Q82 U;  5KE3 A;  4VUB A;  1EFW A;  4C5G A;  1BIA A;  1VQ7 T;  2ZPH B;  3PGG A;  2K5L A;  1JJ2 S;  3A8L B;  4XEO A;  4K88 A;  4K86 A;  3PZC A;  3NEM A;  3QYH B;  4ME7 A;  1G3W A;  5CKH A;  4HT4 A;  3V7S A;  4HT9 A;  1WQW A;  3PIP A;  3G6E T;  3MO8 A;  2JTF A;  4RDX A;  2DTI A;  4OB3 B;  3QKJ A;  3OYA A;  2ART A;  1VIF A;  3L2U A;  2ZZD A;  3QZ9 B;  2OTL A;  5FU7 C;  3JCM b;  5F5W A;  4YRK A;  1BI1 A;  1WGS A;  1YHQ T;  1YFS A;  2MWO A;  2HQX A;  3CCS A;  1ZQ1 A;  2G4C A;  3QUI A;  3CCL A;  3A32 A;  5GAM f;  4BI3 A;  2WSF E;  1QVF S;  2AMC B;  2FYK A;  3QBY A;  3X24 B;  3RMQ A;  4RCB A;  4HWP A;  2B8A A;  4IUQ A;  4YRO A;  1WPY A;  3TUP A;  1J5W A;  3HFZ B;  3FLG A;  4LDY A;  4ELY C;  2QQB A;  4F7U B;  2KVQ G;  2VGM A;  2VUB A;  3LW5 E;  3PFS A;  2P5I A;  5K1P A;  2AKW B;  1KQ2 A;  4N0A A;  1ADJ A;  1IZ6 A;  3OYJ A;  3CXC S;  1Y96 B;  1B7Y B;  3LSQ A;  1E22 A;  4NCX A;  3OS5 A;  3NTI A;  3JCM f;  4P3O A;  4YCU A;  4EMK B;  2QXF A;  1YJW A;  3PMI A;  3JAM E;  1NE8 A;  2NS6 A;  4II1 A;  4NOY A;  3VYH B;  1S72 T;  2LQK A;  4C5I A;  4OP0 A;  4KQE A;  3QJY A;  4UP8 A;  3OS0 A;  5GAN 5;  3L2W A;  3REU A;  3I55 A;  4XTX A;  1X2H A;  2R57 A;  1QVG S;  4HWR A;  4H2V A;  5HGQ A;  5I2S A;  2QA4 A;  4D6W A;  2PME A;  4H2Y A;  4Z02 A;  3P8D A;  4BWA A;  4PJO E;  4A54 A;  3A8M B;  2CJB A;  1NJI C;  5FU7 B;  3OYC A;  2ZCE A;  3LSS A;  1KHC A;  3CCE A;  3OQ5 A;  2QQS A;  3KFU A;  2RHY A;  2DIQ A;  4BW9 A;  1WU7 A;  1X2G A;  2XGT A;  4TVW A;  4YCW A;  4JJN K;  3RKX A;  3M9Q A;  1YIJ T;  3UPU A;  2RJD A;  1IRE B;  1R8O B;  4HWS A;  5IT9 E;  2CZ7 B;  2Q5I A;  5CIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...