3BJUA

Crystal structure of tetrameric form of human lysyl-trna synthetase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
507
structure length
503
Chain Sequence
SVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysyl-tRNA synthetase
publication title Crystal structure of tetrameric form of human lysyl-tRNA synthetase: Implications for multisynthetase complex formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 160
structure length 503
sequence length 507
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2007-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3bjuA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3bjuA02
5LMNQ 2JA5H 4IPGA 3L2ZA 4JBJA 2R93H 2HIVA 4BY7G 2DZCA 3REXA 1I3QH 1BBWA 4OONA 5LMNW 2JK8A 2D0PA 3PUVA 4HJ5A 2UUBQ 2PQAA 2KCTA 2LXJA 4HIDA 5C4XG 1USYC 2EJ9A 4EO4A 4YRLA 2ID0A 5C0XG 5M3FG 1K8AC 1Y1VH 2PNHA 3CMQA 4LF8L 2IX0A 4DV6L 2CQOA 4B3RL 1YGBA 3NBHB 4B3TL 2ZIMA 4DV4Q 1ASZA 2VZAA 1Q86C 2EIFA 3A5YA 2ZZFA 1QUQA 4LF5L 3GTKH 4A3JG 1EIFA 4YY3Q 2OWOA 1Z47A 4GLVB 5IY0A 5H1SE 5LMUL 3S14H 1FGUA 1NMFA 1WNLA 4OP0A 3M4QA 3SGIA 1IBMQ 2XGTA 1Z9FA 2QHTA 4A3IH 4YRCA 4ZTZB 1QZGA 4X64Q 3I7FA 2HNIA 1E7ZA 4BWAA 5M3MH 1I94Q 3L1AA 4BY1G 4IJLA 3H0GH 1S72A 2LXKA 2VY3A 4JBWA 3PGZA 3ULPA 2DXTA 1WOCA 2B63G 4MZ9A 3J7A5 4LF7Q 2E64A 5E3IA 4RG1A 2OTJA 3RUXA 1HR0L 3RZDH 4X5OA 4XTYA 3DLLA 4DR6Q 2B29A 4YRIA 3S15H 2E41A 4XEOA 4TTVA 3F2BA 3GTLH 4WF2A 1QF6A 5IP9H 2R92G 4A3LH 1YFRA 4NPSA 2UXCQ 2DXUA 2JA8H 3TS0A 4O0AA 4BBRH 4JI2L 2E3CA 1SRUA 3KLWA 4PZ6A 4UPAA 1EYGA 2D0OA 1B70A 3CMAA 3RGLA 1B7YA 1VQFA 1G291 4DV7Q 3GTGH 1BIBA 2Q7EA 2I5LX 2E5AA 2OTLA 3IALA 4XTXA 2I4LA 4A4IA 3UDIA 1CKNB 2OCEA 2AWNA 1L1OB 1YB3A 3RKXA 1NMGA 2VNUD 1U0LA 4YHHL 1FYFA 2WB1G 1VS0A 4IFDG 4LFBQ 1IZ6A 1A8VA 2YTYA 4A3GH 3DM3A 4KHPL 2DKGA 1N9WA 5BR8Q 3TEHA 2UXDL 1YZ6A 2HHHQ 3U4VA 2YU9H 3VQVA 1XNQL 4LF6L 4Q15A 4H2VA 4A3BH 1IXRA 5JEAJ 4J15A 5IWAL 4KR2A 1HNZQ 1JJ2A 5E7NA 3H3VI 1HNWL 1S3OA 1JJCA 1YHBA 4R4CA 4HWOA 3PO3G 2UU9Q 3CD6A 1PA6A 3CCMA 2WFWA 3H15A 1HTTA 2VL6A 3BU2A 3OTOL 4A3DH 2ZR2A 4R4OA 4JI3L 1DGSA 4DR3Q 3LC0A 3M9BA 4JBMA 3NETA 4DR7Q 3PO2H 4JYAL 1TWGH 4L87A 5HGQA 1KOGA 4DV1Q 1RIQA 1SN8A 3HFZB 1J5EQ 1IBLQ 4POGA 4X62L 4B3SQ 2NZOA 4OX9Q 2ZCEA 3VQXA 2MNAA 4ZIBA 3E9HA 4JI1L 4A3EG 2KBNA 2CGHA 2Q2IA 4XU0A 4XEMA 2BH8A 1ADYA 2MQHA 1PH7A 1VCIA 1YJNA 4LFCQ 1KC8C 3CC4A 4HJ8A 3I4NG 4DV0Q 4PMWA 1PH1A 2CIMA 1NJIC 2B3GA 3CQZH 4NXMQ 3HY0A 2ZR3A 1BBUA 3GTPH 3A31A 3HOXH 3ERRA 1J5WA 4DV3L 1GGMA 1NNHA 3BJUA 4LF4Q 4OWXB 4IPDA 3A0JA 3CMEA 2JA7G 1UE5A 1N32Q 4DR4L 1EQRA 1E22A 3UGTA 4YRMA 4P72A 2AMCB 5AJ3Q 2E1HA 4A93H 2K14A 2DVEA 2CJ9A 2DGYA 3CCEA 4G85A 3RF1A 3ICAA 5IYBH 4X66L 1WCMH 1X3EA 4LUOA 2ZZGA 4TVWA 3W3SA 1XMQL 2CWPA 4AQYQ 1C9OA 1A62A 2VQEQ 5FLMG 1VQZA 2JA6G 4YCVA 4R4IA 1LTLA 1N33Q 3HKZG 3A74A 3LGJA 4WJ4A 2UUAL 1W2BA 3J81j 3PSIA 4QL5A 3S1NH 3L4GB 4YRNA 1N8RC 3BFMA 1H4QA 4X6AH 4G84A 2DU5A 1H4TA 1PH5A 4XTWA 4DUZL 4MTNA 1VQ5A 3I56A 1V1QA 2UUCL 2IY5A 4A3MG 3TS2A 1YFTA 1QE0A 3CW2C 4H2WA 3RLFA 4JI6L 4WI1A 2C7IA 4L5TA 5GADC 1KIXA 1V43A 1XNRL 2ZNJA 4ALPA 4CS4A 3FP9A 3HOYH 4DV5L 2DZ9A 4HIKA 1ATIA 4OXPA 3S16H 1PHJA 1AE3A 2DDZA 2VUMH 4LF9L 1VQIA 2ZM6L 1I6HH 1KRTA 2Q2TA 5KNNA 1YVCA 3UH0A 2ZT8A 3T1YL 4A3FG 1CKNA 3D31A 4AIMA 4P3OA 1L1OA 2E5LL 1G6PA 1IBKQ 1Q82C 1Z7MA 2NVXH 4HWPA 2RHQB 4YRFA 3F1ZA 2ZJPA 1XPRA 4JI0L 3CXCA 3P8VA 4YYEA 2N78A 5C3EH 4L5RC 4YCWA 3UDGA 4LFAL 2EAYA 1J6QA 1XPOA 3PUWA 1NE3A 4O2DA 3J80c 1FJGL 2DUDA 2Q7HA 4POFA 1BKBA 4LNSA 1JE5A 1A0IA 1XMOQ 3ERSX 3H3VH 4K0KQ 2NVQH 4MNOA 3VQYA 4DR5Q 3S1RH 1CKMA 3G48A 4DNIA 2P0LA 2PMZE 1L2FA 2EJFA 4GKKL 3HOVH 4KQEA 4A3CG 2WB1E 1G5HA 4YRJA 4UP9A 3PIPA 4DR2Q 1E1OA 3D0FA 5M5WH 3QO7A 2QHVA 2ZT6A 1XPUA 3VDYA 3J80i 3M85A 1QVCA 2ODRD 1NJ1A 4TVAB 3CCSA 1EOVA 5LMNL 1EVKA 3HOZH 1PH2A 1VQ4A 1JB7A 4QGUA 3AEVA 1HZAA 4BXXH 3HFZA 2DQ0A 2HQLA 2Q2UA 1X3FA 2I4OA 4GN5A 3HFVA 4GNXB 3MF2A 2ZZEA 2JA5G 2J3LA 2R93G 2UUBL 4GN4B 3CCVA 4JOIA 2AHOB 1KQSA 2RCNA 5GAEC 1M90C 1JJGA 4DAYB 2ALYB 2K52A 4TWAA 1YHAA 3KF6B 3MF1A 2RHSA 2VQFL 3HRIA 3VBBA 1VQGA 4RQEA 1N34Q 3PF5A 1I5FA 3M4OH 4DV4L 3AQQA 4WJ3M 3FHWA 1Y1VG 5C52B 1SROA 4JI8L 2DTOA 4YY3L 3UDXA 1WI5A 3T1HL 2FYKA 2ES2A 4JV5Q 2ZTDA 2AMCA 2ARTA 1NJ6A 1IBML 4PZ8A 1CSPA 2QHSA 1UE6A 4XTCS 4JC0A 2Q5HA 4H2YA 1OXSC 4LUZA 1K73C 1GM5A 3S17H 5J3BA 4X64L 3I4OA 1JT8A 2K5VA 4HWTA 1I94L 3RKYA 1Z7NA 2LSSA 1K9MC 2NN6I 3K7AH 5FJ8H 2ZTCA 3L4GA 1VQ7A 1Q81C 1MIUA 2JA9A 4LF7L 4A3IG 4A3KH 2ATWA 1PH8A 1YI2A 2F4VQ 2F3IA 1XJVA 3M4PA 2PMEA 3M7NA 5M3MG 2CKZB 4XIGS 1KL9A 4GOPB 4DV2Q 1HC7A 3H0GG 3PUXA 3HOWH 4Y52H 4OO1I 4JCVE 4DR6L 4YHHQ 3J7ZC 1HNXQ 2IX1A 4H2UA 1HXDA 2ZXFA 3G6EA 2UXCL 1ADJA 5IP7H 2AKWB 3HKZE 4DKAC 1VQOA 3GTOH 1X3GA 3AFQA 3WWVA 4GS3A 2ZIOA 3IG2A 4DAMA 1CUKA 3QNEA 4P73A 5IP9G 1SR3A 1D7QA 4B3MQ 4CH4A 4Q6GA 4A3LG 1LM0A 4DV7L 3PCOB 5FJ8G 3V7SA 2JA8G 1SETA 2R7ZH 4NCXA 1OXVA 3JAMc 4BBRG 4R4QA 4NB3A 1IL2A 4YRPA 3KOJA 1P8LA 1YEZA 3DSQA 3L7ZC 3S1MH 3PUYA 4NXNQ 4RQFA 3P8TA 4LFBL 3HXYA 5C0XI 4QJFA 3HRKA 4H2XA 4OLFA 2ZTEA 1L0WA 4JI3Q 3E9IA 1V9PA 3MEYA 3OW2A 1VQ8A 4P75A 1SFOH 4DPGA 4IOAA 2JEAI 5BR8L 2MO1A 3JAMi 4GKJQ 2HHHL 4JBKA 3S2HH 4A3GG 3FJPA 1SERA 2PMFA 4IJHA 3HKSA 2PI2A 3RKWA 3KJOA 5HY6A 4CH3A 2R7ZG 11ASA 1AH9A 4GLXA 2D62A 1HNZL 3UE0A 3REUA 2C8MA 4DUYQ 1X2GA 4TQUS 1OXXK 4TVAA 2UU9L 1S40A 2CWAA 4X65Q 1SESA 4A3BG 4PZ7A 1QVGA 4C3JH 4FDBA 4DR1Q 3LSQA 2K5NA 2DEQA 1GKHA 2K75A 4DR3L 2YTVA 4QY7A 2UXBQ 4DR7L 4BBSH 5GQOA 3CCUA 4GNXA 1FVIA 1HH2P 1NYRA 1WLEA 4DV1L 4P74A 3HOUH 1J5EL 1TWAH 4P3NA 1IBLL 2Q5IA 5IYDH 4B3SL 2QHUA 4K88A 4OWWB 4IFDJ 4A3DG 1WQWA 1X55A 3EBEA 1KMMA 5C44H 3PO2G 3QO5A 2RF4A 2ALYA 2GN5A 4JI5Q 3KF6A 2JQOA 3I4MH 1YNXA 3MXNB 5C4JH 4RDXA 4DK6C 4LFCL 2OQ0A 2HIXA 4DV0L 3RN5A 3K8AA 2KCMA 3AYHB 4P72C 1C0AA 3AFPA 4NXML 3RL6A 3CP0A 2EWNA 4IPHA 1VQNA 3A7RA 1MKHA 2QA4A 2ZTGA 4YROA 2WAQG 3FKIH 3K0XA 4LF4L 4JG2A 3UE1A 4JI4Q 5ELNA 4YCUA 1WQ7A 2QGQA 4JI7Q 4YREA 4YRSA 3F2CA 3HOXG 4AYBG 4KI0A 2EQSA 5AJ3L 2H5XA 4L5SA 12ASA 4YWMA 3A7UA 2YYZA 3K81C 3HY1A 5JJKA 1KAWA 4HJAA 4IFDI 1VQCA 1YITA 4CH6A 3TREA 3RACA 1UE7A 2CJAA 4AQYL 2FXQA 3GTQH 2E2HH 5IYCH 2VQEL 3R07A 1N33L 4A93G 1B70B 2IT1A 1EIYB 1UE1A 1VQLA 3PV0A 3G1ZA 1NJ5A 3V7CA 5IYBG 1WCMG 3OYYA 1VQBA 4L5QA 4CH5A 1MJCA 3QTCA 2K5HA 2NVYH 2EXDA 2KHJA 1Y1WH 3STBD 2ODRC 4GN3B 1TWFH 2EJGA 3A5ZB 2C35B 2I0QA 4KHZA 4BY7H 4YRGA 1EFWA 2XTIA 3RLOA 1L1OC 2AKWA 3BZKA 3F2DA 2F52A 1WYDA 2JJQA 1O7IA 4HJ9A 5GAHC 1BVSA 3EFRA 4XU2A 2E65A 3EFSA 3TEGA 1VQ9A 3P8YA 1T9HA 3PCOA 5C4XH 1MJEA 1PYBA 4HA8A 3B6YA 5M3FH 2CJBA 4AH6A 3CCRA 1SMXA 2QEXA 3ICEA 1PH6A 3RN2A 1IBKL 3HOYG 2GVAA 4QIWE 1NJ2A 1QZHA 1X54A 1K83H 4P71A 2VUMG 2HT1A 4P71C 1G5IA 4LF8Q 4DV6Q 1N36L 4A3JH 1VQJA 3TQYA 4B3RQ 1EQQA 4HWSA 3PZCA 1GVPA 4B3TQ 5K36G 2Y0SG 3J81c 3W5OA 3CF5A 1PYSB 1Q12A 2AWOA 1W3SA 3HXUA 4K86A 1XMOL 2I4MA 3HXWA 5C3EG 4CS2A 4K0KL 1USYA 4LF5Q 3RIRA 4DR5L 5IE8A 5LMUQ 2E2IH 2ZJRA 1PH9A 1KRSA 5IT9c 1BIAA 3A32A 4HWRA 2ZGWA 4BY1H 2ZT5A 2VQFQ 5F5WA 4DR2L 2VW9A 1GO3E 3CCJA 3ER0A 2B63H 4DK3C 1X9NA 3J81i 1TWCH 1PVOA 4JOIC 3IKMB 1VQDA 4QQBX 3HOVG 2N3SA 1VQPA 2ZNIA 4XU3A 4JI8Q 1PH4A 3HXZA 2DJZA 3KDFB 1VQEA 1E24A 3IKLA 2JE6I 3JC66 4YWKA 2BA0A 3T1HQ 4HJ7A 3UGQA 2Q2HA 2R92H 3IRBA 1RIPA 2E2JH 4HIOA 1HR0Q 3HOZG 1UWVA 3V8LA 3U4ZA 3OD1A 4BXXG 3ULLA 3S2DH 3HXVA 1TWHH 4XTVA 3S24A 1RL2A 5K1PA 1H95A 3F8TA 5JEAG 5FLXc 1HR0W 3UDFA 2E8GA 4BW9A 1X01A 1N34L 4RMFA 1WU7A 3S1QH 1H4SA 4ME3A 4JI2Q 2PI2E 3TRZA 1K8GA 1EWIA 2IHFA 1YFSA 3CC7A 2J3MA 4JV5L 4PG3A 1A63A 3K7UC 2IY5B 1VQMA 1VQHA 5C0XJ 4HVCA 3RLNA 1E3PA 5ELOA 4DQ2A 4XU1A 2R6GA 4LWCA 3G71A 1TXYA 2A8VA 1K0RA 4C3HH 2L15A 3NEMA 2Z0SA 1EVLA 3GDEA 1EIYA 2WAQE 1KD1C 3L2PA 4KHPQ 2DU7A 3W1BA 1NBWA 3V8JA 2P5IA 5M5XH 3K80C 4IO9A 1WJJA 1X56A 2UXDQ 1KXLA 4YPFA 1X65A 2F4VL 1SE8A 1XNQQ 4AYBE 4PHCA 4P73C 2A19A 1PH3A 4LF6Q 3PO3H 2KENA 3A5ZA 3ZJYC 1OXTA 4DV2L 1P16A 1LYLA 5IWAQ 2NVTH 2R7DA 1R9TH 1G51A 4A3KG 4TQFA 1HNXL 5C53B 2I5HA 2RHQA 1YBYA 4ZTUB 1HNWQ 2CCZA 1UEBA 1PV4A 4UP7A 3HOWG 1WPYA 4R1JA 4H2SA 3OTOQ 3U58A 4C3IH 4B3ML 1Q7YC 2BH2A 1Y14B 1NYQA 1E1TA 4A3EH 1SRYA 4JYAQ 3V7RA 4P75C 2KHIA 5IP7G 3QO8A 4TQDA 2ARSA 3GTMH 4X62Q 4KR3A 4IOCA 3I4NH 4UP8A 3E0EA 3BZCA 4E51A 1WFQA 4YDQA 2YV5A 2G4CA 3V8KA 4JI1Q 2PQAB 4YP0A 4NXNL 3KF8B 3PF4A 3NELA 1B8AA 3M3YH 2EL9A 2JA7H 1PYSA 4OWTB 3GTJH 3KFUA 2N49A 3CPWA 1QVFA 4CS3A 2Z6KA 1C7YA 1HJPA 3KYHC 4GKJL 2Z6KC 1B76A 2MO0A 4DV3Q 5GROA 2E10A 1X6OA 2IHEA 3CPFA 4LW1A 2GVBA 1IYJB 3KJPA 2K4KA 1QUQB 2V1CC 3RR5A 3UFGA 1X2HA 3I55A 1XTDA 4DR4Q 1Q46A 5JJIA 3NENA 1CSQA 4GNXC 2DTIA 4BA1I 3LSSA 4BA2I 3Q8DA 4HIMA 4P74C 2I4NA 4OX9L 3CC2A 5FLMH 2ASBA 2JA6H 4P3PA 4DUYL 3PIOA 2Q7GA 1D8LA 2RHSB 2ZJQA 2K50A 4TVYA 2Y0SE 4X65L 1VQ6A 4XTZA 1NJ8A 4X66Q 1K3RA 4DR1L 3EN2A 2VS1A 3KDFA 1XMQQ 3STBC 2JEBI 1FL0A 2UXBL 4A76A 2NZHA 2CFMA 2ZINA 2I5MX 4A3MH 1NY4A 2UUAQ 4YRQA 1HZ9A 3U50C 1W66A 1LUZA 4K87A 3GD7A 4A75A 4DUZQ 1PFSA 1N32L 2UUCQ 4BBSG 4YWLA 4JI5L 2BA1A 3A5UA 1NTGA 1EUJA 4JI6Q 3HOUG 4UY8C 5IYDG 3RZOH 4H2TA 5M5YH 4Y7NH 1OXUA 4KLKA 1YJWA 4EX5A 1VQKA 4LUVA 4EQ5A 3EIVA 2MFIA 3HTZA 1XNRQ 5C44G 5K1XA 4A3FH 1KMNA 3I4MG 4YRKA 4DV5Q 1KHIA 4YRRA 4JI4L 4LF9Q 2ZM6Q 1B7YB 4JI7L 3RNUA 5EAYA 3T1YQ 1H4VB 4GLAC 1U5KA 2E5LQ 3MEFA 4APVA 1AE2A 4GOPA 1HZCA 3W1GA 3FKIG 3TUPA 2OQKA 4GOPC 3A7AA 3VQWA 2ARUA 2DTHA 2A1AA 3PUZA 4JI0Q 4C2MH 1Q1EA 1I50H 5GAGC 3GO5A 1Q1BA 1ASYA 3G4SA 4XTUA 1Q8KA 4LFAQ 1M1KC 2NN6G 5C51B 1YHQA 3WQZA 4R4TA 1FJGQ 2R7FA 4A3CH 2ZT7A 2WP8J 2N8NA 1CKOA 3I2ZA 3TEHB 1JMCA 3ULJA 3CAMA 1SLJA 1YJ9A 3HXXA 3CCQA 5IYCG 1YIJA 4OO1G 3L0OA 4GKKQ 4LNQA 2DQ3A 1N36Q 4IPCA 1HZBA 4H2XB 3CCLA 1OTCA 4H02A 5JJLA 1VQAA 2YTXA 1Y1WG 1JJCB 1GD7A 5DLQE 4YRTA
chains in the Genus database with same CATH superfamily
4A3BB 4WFN3 5LMNQ 2JA5H 4IPGA 3L2ZA 1Y8PB 4JBJA 2KQ3A 2R93H 2HIVA 1FD7D 4BY7G 3LWUA 2DZCA 1F2ZA 3H3VC 3J80L 3G6JB 2SNMA 3I4NB 4KK7A 4FNFA 3REXA 1WD1A 1UNSA 1GUOA 3DWPA 4DXFA 1B9NA 2EYJA 5HURA 1I3QH 1BBWA 1B3QA 4L8JA 4OONA 5LMNW 2JK8A 2D0PA 5FO8B 1PRTC 4E6IA 1AN8A 3PUVA 4HJ5A 2UUBQ 4HCSA 2PQAA 1PRTF 2KCTA 2LXJA 3NUCA 4HIDA 1IYUA 2Z8LA 4A3DB 1EL0A 3KF8A 4RKBA 1B50A 3FPUB 5C4XG 1USYC 2EJ9A 4EO4A 4UAIA 4YRLA 5KIXA 4ID6A 2ID0A 1PZID 3PO2B 1STBA 5C0XG 3K5NA 5M3FG 3GTJB 5CV8A 3TP8A 1K8AC 1Y1VH 1BUVT 2PNHA 1ZXTA 3URYA 2IX0A 4LF8L 1HA6A 3CMQA 1TWGB 2O4XA 4DV6L 3Q23A 3NTIA 2CQOA 1SNCA 4B3RL 5FO9B 1YGBA 3NWTA 3NBHB 4KN4C 3J81L 2A8EA 4B3TL 1GUSA 1TU2B 4FXDA 2ZIMA 4OELB 4DV4Q 4PMBA 2K32A 1ASZA 2X6LA 2VZAA 1Q86C 2EIFA 3P20A 3A5YA 1X3QA 2ZZFA 1NR4A 1QUQA 3VR2A 2WAQB 4LF5L 3GTKH 4ZKBB 4A3JG 2XRSD 1EIFA 4YY3Q 2OWOA 4ABNA 2JA6B 1Z47A 4GLVB 5IY0A 5H1SE 4RA8A 5LMUL 3S14H 1FGUA 3HKZB 1Y69U 1NMFA 4FF3A 4N8X1 4XYQA 5IT9L 3VYTA 4XYOA 3GTPB 1K28A 1WNLA 4OP0A 2RCFA 3M4QA 3SGIA 1O80A 1SE3A 1EYDA 1IBMQ 4AYBB 1UUPA 4F87A 2M00A 4RGOS 2XGTA 1Z9FA 2RDFA 4RH6A 1D1KA 2QHTA 1KLGD 4A3IH 4YRCA 1HTPA 1V8QA 4MN3A 5L37A 1CA5A 4ZTZB 1LTAD 3VR5A 5C3XA 1QZGA 4X64Q 3I7FA 1NR2A 1EEID 2HNIA 2DN8A 1E7ZA 2RDHA 1B4OA 5M3MH 4BWAA 1I94Q 3L1AA 4PV1C 4BY1G 4KJOA 5CGKA 4G7ZC 4IJLA 3H0GH 3GP7A 2FFKB 1PRTD 4OGQC 1S72A 2LXKA 1BQQT 2VY3A 4JBWA 4A93B 3PGZA 3ULPA 2WKDA 2DXTA 1WOCA 1HCZA 2B63G 1LTSD 4MZ9A 1ONLA 2K7VA 3J7A5 2EPBA 4LF7Q 2E64A 5E3IA 4RG1A 2OTJA 4LK1C 3RUXA 3J80E 1WCMB 1HR0L 3RZDH 2QF7A 5F2DA 3G7LA 4X5OA 4PNYA 4FF2A 1X32A 4XTYA 1D5MC 4IQZA 1A2UA 5E3FA 3DLLA 4DR6Q 2B29A 5LL6X 4YRIA 3S15H 2E41A 3RMHA 5KYIA 4XEOA 4TTVA 3F2BA 3GTLH 4WF2A 1QF6A 5IP9H 3EQLC 2R92G 2RVLA 1QNKA 3I91A 5FLXL 4A3LH 1IKMA 2HQEA 3S1NB 2B2YA 3FDTA 3OMCA 1YFRA 4NPSA 4CDEC 4L6TB 2UXCQ 2NBFA 2XN9C 2F1MA 2DXUA 2JA8H 2XVSA 3TS0A 4O0AA 4BBRH 5I2XA 4J1MA 4JI2L 2E3CA 1SRUA 3KLWA 2N55A 2OT2A 4PZ6A 4UPAA 3VR4A 4FF4A 1EYGA 4ZUIA 5BN4A 2D0OA 1B70A 4RKLA 1V1PA 3CMAA 2KHSA 3RGLA 1ET6A 1B7YA 1VQFA 1G291 4HAEA 4HSVA 4DV7Q 3GTGH 1BIBA 2Q7EA 1HFGA 1F9RA 2I5LX 2E5AA 1M8AA 2B2WA 2OEOA 2BE5C 2OTLA 4C56C 3IALA 2H4OA 2B2WC 1D1IA 3OOCA 4XTXA 4ZQ3A 1CHQD 4LVKA 2I4LA 4A4IA 3UDIA 1CKNB 2OCEA 2AWNA 1TS5A 1L1OB 3HOYB 1I4PA 1YB3A 3RKXA 1S5ED 5CBEE 1NMGA 3S16B 1QILA 1W6KA 4DNTB 2VNUD 1U0LA 3TP6A 4YHHL 1FYFA 2WB1G 1VS0A 2VUMB 4IFDG 4LFBQ 4RGNA 3KLSA 1IZ6A 1WTQA 1A8VA 2YTYA 4A3GH 4FYDA 3DM3A 3HRZC 2JSOA 5LL6S 4G4KA 1YNNC 3MFGA 4CGYB 4KHPL 2DKGA 3MXUA 3OWFA 3A7LA 2NVXB 1N9WA 5BR8Q 2M2LA 5EPLA 3TEHA 3CU7A 2UXDL 1YZ6A 2BOSA 1JB3A 2HHHQ 1SNQA 3U4VA 2YU9H 1RTNA 4HEDA 2V4DA 3VQVA 2K5DA 4C3HG 1XNQL 4LF6L 4Q15A 4H2VA 4BWGB 1TQOA 4A3BH 3JAML 1IXRA 4KD4A 5JEAJ 4J15A 3Q22A 1SJED 1U4LA 5IWAL 2J0TD 3K5MA 4KR2A 3EROA 3U9OA 1HNZQ 1JJ2A 5E7NA 3U9SA 1KABA 5EKKA 3H3VI 4KHVA 1QB5D 1HNWL 2R93B 4UHVA 1S3OA 1JJCA 2DNCA 1YHBA 4R4CA 1DZ1A 4HWOA 1PLFA 1VF7A 3NE5B 3PO3G 2UU9Q 3L3OC 2NVQB 2LS01 3CD6A 3S1RB 2E76C 1PA6A 3CCMA 2WFWA 3H15A 1HTTA 2VL6A 3BU2A 3OTOL 4A3DH 1JR0D 2ZR2A 4R4OA 4JI3L 5TSSA 1DGSA 3I72A 4DR3Q 4RHRA 1BBXC 3M9BA 4CKEA 1HHVA 3LC0A 4JBMA 4HCEA 3NETA 4RWSC 3PO2H 4DR7Q 4JYAL 5CV7A 1TWGH 1QJOA 5HGQA 5M5WB 4DV1Q 1RIQA 4L87A 1SN8A 1KOGA 3HFZB 1J5EQ 2F3VA 1IBLQ 4POGA 1JICA 4KV6A 4X62L 4B3SQ 2Z9HA 2NZOA 4OX9Q 1J9OA 2ZCEA 3VQXA 1STNA 2D2CC 4C3IG 4B9WA 2MNAA 1GJXA 2EYHA 4ODGA 4ZIBA 3E9HA 4JI1L 4A3EG 2KBNA 1SYBA 2CGHA 4H13C 2Q2IA 1DD2A 1YNND 1K0SA 4XU0A 4XEMA 4CDDC 3J7YW 2BH8A 2EE1A 1ADYA 3MZ5A 2MQHA 5JVG3 3NBHA 1PH7A 4IUQA 1VCIA 1YJNA 4LFCQ 1KC8C 3CC4A 2NZ1D 4HJ8A 1SAPA 3I4NG 4DV0Q 2A69C 4PMWA 1PH1A 2CIMA 1PZKD 5EPKA 1NJIC 2B3GA 3CQZH 4NXMQ 3HY0A 2ZR3A 3GTKB 1R4QB 4IZ8A 1BBUA 4N8FA 1EY6A 3GTPH 3TN2A 1QOHA 4C1NI 3A31A 3S14B 4MTKA 3HOXH 2MHVA 3ERRA 1HQMC 2A6EC 1J5WA 4DV3L 4ULLA 3TBIB 1GGMA 2KA7A 1NNHA 3BJUA 5CR3A 3MA2B 4OIKA 4LF4Q 4OWXB 4IPDA 2ZT9C 5BN3A 3GQBA 3A0JA 3CMEA 2JA7G 2F0UA 3J7AV 5ELBA 2FMMA 1UE5A 3QB3A 1N32Q 4DR4L 1A3UA 1EQRA 1SE4A 1ZYRD 5JVH3 5IOCA 4XQNA 1E22A 3UGTA 3M7GA 4YRMA 3M4OB 1H9KA 3KLRA 2KUMA 1ILQA 3N6RA 4P72A 2F0LA 2AMCB 5AJ3Q 1HPCA 2E1HA 3VR3A 3JAME 4A93H 1FGBD 1HUNA 2K14A 2DVEA 2CJ9A 1L0YB 5M3MB 2DGYA 3CCEA 2M9VA 1RD9D 4G85A 3RF1A 3I70A 1UAPA 3ICAA 5IYBH 4X66L 2ICEC 1WCMH 3FEWX 1WTWA 1X3EA 2B2TA 4DU9A 4LUOA 5M9OA 2ZZGA 4TVWA 3W3SA 1XMQL 3I73A 1O7YA 2CWPA 2PZTA 4AQYQ 1C9OA 1AFPA 1A62A 2VQEQ 5FLMG 1VQZA 2JA6G 2XRQD 4QIWB 4YCVA 4R4IA 1LTLA 1N33Q 3MWYW 3HKZG 3A74A 3LGJA 3ND9A 4WJ4A 4ZLTF 2UUAL 1EIHA 1IHZA 2BDOA 1GUNA 3R93A 1W2BA 1STGA 3J81j 3PSIA 4QL5A 3S1NH 3L4GB 4YRNA 1GOZA 5JOBA 1N8RC 1UEAB 3BFMA 1H4QA 4X6AH 4G84A 2DU5A 4CDCC 1A15A 1MD2D 1H4TA 1PH5A 4XTWA 4DUZL 1EWHA 4MTNA 1VQ5A 3I56A 1FNUA 1V1QA 3K7AB 4ME5A 2UUCL 2IY5A 4XQQA 4A3MG 1X3PA 3TS2A 1YFTA 1QE0A 3CW2C 4H2WA 3BYTB 3RLFA 4JI6L 4WI1A 4EQOA 3EVQA 2F0PA 2F0NA 4A3KB 2C7IA 2KVMA 4L5TA 5GADC 1KIXA 2ZXRA 2Q8TA 2VB3X 1YNJC 1V43A 1JC7A 3SXHA 1DJRD 4KKTA 3GV3A 4ILWA 5IGCA 1XNRL 1WTOA 3HOWB 2ZNJA 4IUPA 1DXMA 4ALPA 4CS4A 4OHJA 2X6GA 3FP9A 3HOYH 3BS1A 1SDFA 4DV5L 2DZ9A 4HIKA 1ATIA 4OXPA 3S16H 2F0TA 4JPBW 1PHJA 1AE3A 2DDZA 4CBVA 2VUMH 1OO9B 4LF9L 1SYGA 2DY7A 1VQIA 2ZM6L 1I6HH 4X3KA 1KRTA 1TR5A 2Q2TA 1K8OA 1CZWA 1YVCA 1S4ZA 3FPPA 4I7AA 3UH0A 5KNNA 2ZT8A 4DAVA 3T1YL 3RUZA 3KBXA 4A3FG 3GTOB 1CKNA 3MEHA 3D31A 4AIMA 4P3OA 1L1OA 2E5LL 2MPMA 1G6PA 5IGFA 5EJWA 3SK8A 1IBKQ 3K5LA 1Q82C 1Z7MA 2NVXH 5K36H 3AMUA 2F0GA 4HWPA 2RHQB 4YRFA 1VMCA 3F1ZA 1A3VA 2F0WA 2ZJPA 4IALA 4BS9A 1XPRA 4JI0L 1T5XD 1R4PB 3CXCA 3P8VA 4YYEA 2N78A 5C3EH 2N88A 2ZXOA 4L5RC 2R7ZB 1SYEA 4YCWA 2L9HA 3UDGA 4LFAL 2A68D 2EAYA 1J6QA 1XPOA 1CHPD 4K5VA 3PUWA 2PW5A 2YU9B 1NE3A 4O2DA 2DJFC 3J80c 1TY2A 1FJGL 3NBIA 2EYMA 2LFNA 2DUDA 2Q8RE 3QG1A 2Q7HA 4POFA 3QIAA 1BKBA 5IGDA 1DYQA 4LNSA 1JE5A 2B39A 1A0IA 1XMOQ 3ERSX 3H3VH 4K0KQ 1LTBD 2FMCA 3K0YA 2NVQH 4MNOA 2KJXA 2J7ZA 3VQYA 4DR5Q 3S1RH 1CKMA 1JWSD 3G48A 1TS2A 4DNIA 2P0LA 2QKIC 2PMZE 1L2FA 2EJFA 1AZQA 4GKKL 3ND8A 1YNJD 4CKBA 1I4RA 3HOVH 4KQEA 4OL7A 3N52A 2WB1E 4A3CG 2EJFC 3NSWA 1SSOA 1SMYC 2KOLA 1G5HA 4YRJA 4UP9A 3PIPA 1DCZA 4K2LA 4DR2Q 1E1OA 4LVIA 3D0FA 1MSGA 5M5WH 3S2HB 3MHBA 4FXKC 3QO7A 2QHVA 1DONA 2ZT6A 4CJ2C 1XPUA 3VDYA 2Z1CA 3J80i 3M85A 1QVCA 2ODRD 1NJ1A 4TVAB 4JW0A 3CCSA 1EOVA 5LMNL 1LTTD 1WTVA 1EVKA 1CTMA 3HOZH 2QDBA 1I4XA 1PH2A 1VQ4A 2I46A 2JP1A 5EGTA 4PMCA 4GZYC 2EZVA 1JB7A 4QGUA 3AEVA 1HZAA 4BXXH 4F88A 3HFZA 5ISRA 3FVQA 2HQLA 2DQ0A 1LT3D 4K5WA 2B8GA 2Q2UA 1XYIA 1MI2A 1X3FA 2I4OA 4GN5A 3HFVA 1EU3A 1LV9A 4GNXB 4DK0A 3MF2A 2ZZEA 3T56B 2JA5G 1ML0D 3OIQA 4DN4M 4C3JB 5JEAH 2J3LA 2R93G 2UUBL 2A73B 5DM73 1PTOB 4GN4B 1JOQA 4TKOB 3CCVA 1WTRA 2PNRC 4JOIA 1KLUD 1SNPA 3PIO3 2AHOB 1KQSA 3CQZB 1S5BD 2RCNA 5GAEC 1D5XC 1M90C 4BBSB 1JJGA 4DAYB 4K14A 2ALYB 2K52A 1BNZA 4TWAA 1EY9A 1L0XB 4B9XA 1YHAA 3KF6B 1EQVA 3MF1A 5KGUA 2RHSA 3HOXB 1U4MA 2TSSA 4XDXA 2VQFL 3HRIA 3X3NA 2B2VA 2K01A 3VBBA 1VQGA 1LTRD 1N34Q 4RQEA 3P7JA 3PF5A 3HGBA 2LY7A 1I5FA 1HQRD 3M4OH 5I2YA 4DV4L 1Z6HA 3VA7A 4V190 3AQQA 4WJ3M 1F2MA 5C44B 3FHWA 5ELFA 4B08A 1Y1VG 2WV6D 3TMEA 3OIPA 5C52B 2GA4B 1SROA 4FF1A 5EKLA 2EVBA 2FINB 4JI8L 5J22A 2TMPA 1SMYD 2DTOA 4YY3L 3UDXA 1EY4A 3W3AA 1WI5A 2C5CA 3T1HL 2FYKA 2ES2A 4JV5Q 2ZTDA 2AMCA 1CQVA 3C1EA 2ARTA 3HP3A 1FR3A 1GHJA 2DY8A 3X3MA 1XX8A 1NJ6A 1IBML 2K5QA 4PZ8A 1CSPA 2QHSA 1UE6A 4XTCS 4JC0A 3K58A 4G57A 2Q5HA 2NWGA 4FP5D 4H2YA 1OXSC 1ET9A 4LUZA 1CT1D 4RCOA 4QF4A 1RF2D 1K73C 1GM5A 3S17H 4ZKCB 5J3BA 2FJ2A 4X64L 1SNOA 4MIUA 1STYA 3I4OA 1IW7D 2K5VA 2K6AA 1JT8A 4HWTA 2L4NA 1I94L 3RKYA 1Z7NA 2LSSA 1W6JA 3S9WA 5IODA 1K9MC 2NN6I 3K7AH 1O7ZA 5FJ8H 4ZUJA 1HTLD 2B2YC 2QDLA 2ZTCA 3L4GA 2RDGA 2O5JC 1VQ7A 1Q81C 4G7OC 1MIUA 3QOJA 2JA9A 5FKAC 1CI3M 4A3IG 4A3KH 4LF7L 3A56A 3DWQA 4DF7A 2ATWA 3D4RA 4KY6A 2F0DA 1PH8A 3TDQA 1SE2A 4WRDA 5ELCA 3VYRA 1YI2A 3J81E 1MBYA 2F4VQ 2F3IA 1XJVA 3M4PA 5IGEA 2PMEA 1AP0A 3M7NA 3MVVA 5M3MG 2CKZB 3GV6A 4XIGS 3Q0AA 1KL9A 4GOPB 4DV2Q 3PUXA 3H0GG 3HOWH 3GTQB 2E2HB 4QUFA 4Y52H 1HC7A 4OO1I 4JCVE 4DR6L 4YHHQ 2IJ0A 1BR9A 5AFWA 3J7ZC 1RTOA 2MJ8A 1HNXQ 4DK1A 5A35A 2MGSA 2IX1A 4H2UA 1HXDA 2ZXFA 3G6EA 3BDLA 1JOOA 1JWUD 2UXCL 3VA5A 1BO0A 3LNNA 1ADJA 5IT9E 5IP7H 2AKWB 3HKZE 4DKAC 1VQOA 1RJTA 3GTOH 1X3GA 2Z4HA 4H0LC 4KY5A 1Y1WB 3AFQA 3DEPA 4RHSA 2HCIA 4GS3A 3WWVA 1TWFB 2ZIOA 1I6HB 1F9PA 3IG2A 4DAMA 4DNRB 1CUKA 3EA6A 3QNEA 4P73A 2BDNA 2F0OA 5IP9G 3QR8A 1SR3A 1D7QA 4B3MQ 1G2TA 4CH4A 1BXTA 4Q6GA 4A3LG 4BY7B 1LM0A 2KEDA 1BCPB 4DV7L 1RODA 3PCOB 3H09A 5FJ8G 3V7SA 2Y0SB 5CORA 2JA8G 1SETA 2R7ZH 4NCXA 1ENCA 1OXVA 3JAMc 1Z7TA 4BBRG 4R4QA 4NB3A 1IL2A 1G8ZD 4YRPA 1FNVA 1XXGA 3IAYA 5KNBA 3KOJA 5C3EB 4KKUA 1P8LA 1PMRA 1MGSA 1YEZA 3OMGA 3DSQA 3L7ZC 3S1MH 3F2UA 4ZRZA 2C9OA 1DOLA 3MC0B 2EYLA 1LABA 3PUYA 4NXNQ 5C4XB 4RQFA 5BN5A 3P8TA 2F0QA 4LFBL 3HXYA 5JJZA 5C0XI 1ICWA 4QJFA 3HRKA 4H2XA 1TT2A 4OLFA 2ZTEA 3K6OA 1L0WA 1GUWA 4JI3Q 1LO5D 1QWYA 3I8ZA 3E9IA 1AW7A 1V9PA 2NB0A 3MEYA 1B3AA 3OW2A 1VQ8A 1ZYRC 2F3WA 4P75A 2B8FA 1SFOH 4DPGA 1TS3A 3T51B 1KNEA 5I9PA 4IOAA 1C8CA 4LVMA 1E2WA 1TVXA 2JEAI 5BR8L 1ENAA 1K83B 1F2YA 5FLXE 2AQ2B 2MO1A 3JAMi 4GKJQ 2F0VA 2SEBD 2HHHL 1HFNA 1BDOA 3HOVB 4JBKA 1PRTB 1GUTA 3S2HH 4A3GG 3FJPA 1SERA 2PMFA 4IJHA 1HRJA 1S5FD 3HKSA 1KAAA 2PI2A 5DNFA 3KJOA 3RKWA 4A3JB 5HY6A 5EPJA 3MXGA 5C5LA 4CH3A 2F0SA 4KN7C 2R7ZG 3E0JA 1AH9A 11ASA 4GLXA 2D62A 4HN7A 1HNZL 4O1NA 3UE0A 3REUA 2Q8IB 1PXUA 1SNMA 2C8MA 4DUYQ 3HOZB 1DOMA 4NDXA 4EVOA 1X2GA 2K04A 4TQUS 2L5TA 1OXXK 4TVAA 5C5MA 2UU9L 1S40A 2CWAA 4X65Q 1SESA 4A3BG 4RCNA 4PZ7A 1QVGA 3OPOA 4C3JH 5CBAE 1NUCA 4FDBA 4IUNA 1EEFD 4DR1Q 3A8IE 1LTID 3K57A 2E75C 3LSQA 1PTOH 2K5NA 2DEQA 1GKHA 2K75A 1H9MA 2ENBA 4K6LA 4DR3L 2YTVA 5EBCA 4QY7A 1RCVD 2UXBQ 3R2IA 4DR7L 3C1FA 1NSNS 3NTHA 4BBSH 5GQOA 3CCUA 4GNXA 1FVIA 1HH2P 1NYRA 2K03A 1WLEA 4DV1L 4P74A 4WORA 3HOUH 2B63B 1J5EL 1TWAH 4P3NA 2E2DC 4K5XA 1IBLL 5D65A 2Q5IA 5IYDH 1II3A 4B3SL 3NHHA 2KCCA 2QHUA 4K88A 4CDFC 4OWWB 4IFDJ 4A3DG 5T1GA 1WQWA 3PQIA 1X55A 3H91A 3EBEA 1KMMA 5ELEA 5J1ZA 5C44H 2PO4A 3VYSA 4DAYA 3PO2G 3QO5A 2RF4A 2ALYA 5JPMC 2GN5A 4JI5Q 3KF6A 2JQOA 4QUCA 3I4MH 1YNXA 3MXNB 5C4JH 4RGMA 2ICIA 3MTSA 4RDXA 4DK6C 4HMJA 4WJWA 3BZDB 2OF1A 4LFCL 2OQ0A 3KBGA 3SDZA 4XT1B 2HIXA 2E2JB 4DV0L 2PYKA 4X3UA 3K8AA 3RN5A 4R8NA 1EY0A 2KCMA 3AYHB 4DA2A 4P72C 4R9WA 1C0AA 4FVMA 3AFPA 4NXML 4TSSA 3V2TA 5COYA 2PW7A 5DM63 2DNEA 3RL6A 3CP0A 2OXPA 5NUCA 4IPHA 1VQNA 2EWNA 3A7RA 2L12A 1MKHA 1WTHA 4NW2A 2QA4A 2ZTGA 4YROA 2WAQG 3S2DB 3FKIH 1ESFA 1TWHB 2B2TC 3K0XA 4LF4L 4JG2A 5HGTA 3UE1A 4JI4Q 2QILA 5ELNA 3WOFA 2XWBB 3D3RA 4YCUA 1WQ7A 1CA6A 2A6HD 2QGQA 4JI7Q 4RGTA 4YREA 4YRSA 3S1QB 3F2CA 2A68C 4LJZC 1CZGA 4QCLA 4QB4A 1U4RA 3OSOA 3FRPB 3HOXG 3SK4A 4AYBG 4P2CB 4KI0A 2NN6H 2EQSA 4YIJA 3DWAA 5AJ3L 1QNUA 3S17B 2H5XA 4L5SA 12ASA 2VXWA 1JOKA 4YWMA 3EFXD 3A7UA 2MP1A 2PMZB 2YYZA 3K81C 3HY1A 5JJKA 1SNDA 1IL8A 1KAWA 4HJAA 4IFDI 1C4QA 3PMFA 2WIIB 3IFDA 5FOBB 1VQCA 1YITA 4CH6A 2L0CA 3TREA 2IPKD 3RACA 1H9RA 1UE7A 2CJAA 2G5DA 4AQYL 2FXQA 5E1FA 3GTQH 2E2HH 2CW0C 2X69A 5IYCH 2VQEL 3R07A 1N33L 4OO1H 4A93G 1B70B 2IT1A 2LMCB 1EIYB 1PTOD 5KNDA 1J8IA 1UE1A 4N9PA 1VQLA 2CH4W 3PV0A 3G1ZA 1NJ5A 3V7CA 5IYBG 2EJMA 1WCMG 2WKCA 3OYYA 1LT5D 4KY7A 1VQBA 2VB2X 4IUVA 4L5QA 4CH5A 1MJCA 2HCCA 3QTCA 2K5HA 2NVYH 4CJ0B 2I07B 1SYFA 2EXDA 4KMUC 4C3HB 2KHJA 1Y1WH 3STBD 2ODRC 1E2VA 4GN3B 1TWFH 2IL8A 2EJGA 3QOLA 3A5ZB 2C35B 3D4WA 3NTKA 5D3IB 2EJGC 5CC4A 2I0QA 5M5XB 4KHZA 4ZYSA 4BY7H 4HTHA 4YRGA 1EFWA 3K5OA 1LTGD 1GHKA 2XTIA 4JK1C 3RLOA 1L1OC 2AKWA 3BZKA 3F2DA 4L63B 1I4HA 2F52A 2EOTA 1WYDA 1WD0A 4LVLA 2JJQA 1O7IA 4HJ9A 1KNAA 5GAHC 1BVSA 4IUUA 3EFRA 4XU2A 2L1BA 1PFBA 2E65A 3EFSA 1D5ZC 1QE6A 2NVTB 3TEGA 2K33A 2EY6A 1VQ9A 1STHA 3BYYB 3P8YA 2RQXA 1NCVA 1T9HA 3PCOA 4LAAA 4NP5A 5C4XH 1MJEA 1G6ZA 1PYBA 4HA8A 1K8MA 3B6YA 1I6VC 4RFBA 4ZK9B 5M3FH 2AUKA 4AH6A 1PFNA 3CCRA 3S1MB 2CJBA 1SMXA 2QEXA 4I7ZC 3ICEA 1PH6A 3RN2A 2XIWA 1TS4A 2QW7A 3A54A 3W2DA 1IBKL 4DAPA 3HOYG 1V1OA 2RKSA 3P1HA 2K1BA 2GVAA 4EQNA 4QIWE 5DAUA 1B9MA 4C3IB 1QZHA 1NJ2A 1EZ6A 1X54A 1K83H 4P71A 2CW0D 4XT3B 2VUMG 4A3EB 2HT1A 4P71C 2XNAC 1SFOB 1G5IA 4LF8Q 3TZUA 1B53A 2F0KA 4DV6Q 1N36L 1PYWD 2A74C 5EKIA 3J7AF 2CHBD 3GTMB 4A3JH 1VQJA 2K05A 3TQYA 3OHXC 5KEEA 2PPBC 4B3RQ 1EQQA 4HWSA 3PZCA 1GVPA 4B3TQ 5K36G 1B2TA 2Y0SG 3J81c 3W5OA 3A8KE 5A2QL 3CF5A 3E3XA 5FK9C 1PYSB 1Q12A 2AWOA 3TP5A 1RKNA 1JCKB 1WTPA 1W3SA 2PCFB 3HXUA 4K86A 1XMOL 2I4MA 3HXWA 5C3EG 4CS2A 3DM1A 4K0KL 1USYA 3KK7A 5CYUA 4LF5Q 3D8GA 3RIRA 4DR5L 5IE8A 1B1ZA 5JAVA 3M3YB 2O2LD 1PDQA 4TRDA 5LMUQ 2E2IH 2JN4A 2JA7B 4H7BA 4K6DA 1EOTA 1IW7C 4EQPA 2ZJRA 2WACA 2RSOA 4V0BA 1PH9A 1KRSA 4MHEA 5IT9c 1BIAA 3A32A 1D6EC 4HWRA 2ZGWA 4BY1H 4C1NK 4ZCKA 2ZT5A 2EY2A 2VQFQ 3OW7A 5F5WA 3OWEB 4DR2L 2VW9A 1GO3E 3CCJA 3ER0A 2AQ1B 2R3ZA 2B63H 3KUPA 4DK3C 1X9NA 3J81i 1TWCH 1BCPD 5CV6A 1PVOA 4JOIC 3IKMB 1VQDA 2WINB 4QQBX 3HOVG 4S3SA 4M8AA 4F7XA 1EYCA 1WVLA 3HOUB 1TWAB 2N3SA 1VQPA 2F0HA 2KECA 2ZNIA 4XU3A 3SK6A 4JI8Q 1PH4A 2P5ZX 2DJZA 3HXZA 3KDFB 3NWSA 3T53B 4XQJA 4J6HA 4NMZA 1VQEA 1NNXA 1E24A 3IKLA 2JE6I 3JC66 2IW3A 4YWKA 4FXGC 2BA0A 2L55A 3T1HQ 3Q6SA 2B2VC 3BDCA 5G3LF 4HJ7A 3UGQA 2Q2HA 5E4XA 5ELDA 1KDAA 2J4XA 1LLRD 2R92H 1K3BC 3IRBA 3HG9A 1RIPA 2E2JH 4U673 4HIOA 5J39A 1HR0Q 3I4MB 3HOZG 2XWJB 5C4JB 1UWVA 4IUTA 3V96A 3V8LA 3U4ZA 1VF5C 3OD1A 5LHY1 4BXXG 3MXNA 4O42A 2NTTA 3CRKC 3ULLA 1CFMA 5C4HA 4A3MB 3S2DH 3C2PA 3R2TA 3HXVA 1TWHH 2O5IC 4XTVA 1PZJD 3S24A 1RL2A 5K1PA 1H95A 1F9SA 3F8TA 1XTCD 1H9SB 5JEAG 5FLXc 3H94A 3UDFA 1HR0W 1EY7A 2E8GA 4BW9A 2A5HA 3KLSX 2Z6BA 1T5EA 2FHTA 4DGZA 1X01A 3FKIB 3LWEA 4QMGA 1N34L 4RMFA 1Q3LA 1WU7A 3S1QH 1H4SA 4ME3A 4JI2Q 2PI2E 3BVMA 1VDZA 2NTSA 3R8BA 1A6XA 1HA5A 2HDMA 2IWHA 1Q90A 3K59A 1ZKOA 3NQTA 5CV9A 3TRZA 1K8GA 1EWIA 2IHFA 3ERQA 5A2QE 1YFSA 3RZOB 1EWCA 3CC7A 1HXYD 5M5YB 2J3MA 4Y7NB 4CKCA 4IFDH 3BVGA 1U9RA 4JV5L 4LVJA 4PG3A 1A63A 1KTKA 3K7UC 2IY5B 4A3FB 1VQMA 3TSSA 1VQHA 5C0XJ 2PZWA 4HVCA 3RLNA 1E3PA 5ELOA 1I4QA 2EYOA 5E4WC 4DQ2A 4PQXA 1M4VA 4XU1A 2R6GA 4LWCA 3G71A 3NXWA 1FNWA 2PZUA 2IX3A 3A7AB 1TXYA 3CKIB 5C3WA 1DOKA 5G3LD 2A8VA 2EY1A 1K0RA 4C3HH 1QCBD 2L15A 3NEMA 4R8IA 4KD3A 2SDFA 2Z0SA 1EVLA 3GDEA 3IKJA 1EIYA 2WAQE 1KD1C 1G91A 2SOBA 2RA4A 3L2PA 4KHPQ 2DU7A 1CQFA 1SYCA 1SEBD 3W1BA 2EYPA 2NVYB 1NBWA 3V8JA 4Z9CB 3HS0C 2P5IA 1RDPD 5M5XH 3K80C 3T16A 4IO9A 1WJJA 4XXEA 3NK9A 1EY8A 1X56A 2UXDQ 1KXLA 2CH4A 4NKLA 1EYAA 4C2MB 4YPFA 1X65A 2R61A 2F4VL 1I50B 1SE8A 2DJGC 1XNQQ 4AYBE 4PHCA 4P73C 2A19A 4KKSA 1PH3A 4LF6Q 3PO3H 2KENA 3A5ZA 3ZJYC 1OXTA 4DV2L 1P16A 1EFID 1LYLA 2JXMB 5IWAQ 2NVTH 2R7DA 1R9TH 4Q0FA 5EQ0A 1G51A 4A3KG 2K28A 4TQFA 1EQTA 1HNXL 3C3LA 5C53B 3DHQA 4HMIA 2Z4IA 4K2KA 2I5HA 2RHQA 1CK1A 1BF4A 1EIGA 1YBYA 4ZTUB 1TKWB 1HNWQ 2CCZA 3M4YA 1UEBA 1PV4A 1ESRA 2F03A 4UP7A 3HOWG 1WPYA 1RHPA 4R1JA 5M3FB 3TZDA 4H2SA 3OTOQ 3U58A 4C3IH 4JVZA 3DXJC 4HSPA 1JORA 4Q5VA 4ZAIA 1Q7YC 2EY5A 4B3ML 2BH2A 2F0EA 1SXTA 4OIJA 1Y14B 1NYQA 1E1TA 4A3EH 3ITPA 1SRYA 3QWNA 4JYAQ 3MFYA 3V7RA 5K5PA 4P75C 2KHIA 5IP7G 3QO8A 4TQDA 2ARSA 3WOEA 5CV5A 3GTMH 2NYZD 4X62Q 2EYFA 4KR3A 4IOCA 3MAQA 4UP8A 4RAUC 3I4NH 2JA5B 3E0EA 1I4GA 1IYVA 3BZCA 5CMDA 4E51A 1WFQA 4YDQA 2YV5A 2G4CA 3V8KA 4JI1Q 2PQAB 4YP0A 4NXNL 2JYOA 3PIP3 3KF8B 1O7LA 1TIID 4DFAA 4U68A 2K5WA 3PF4A 3NELA 4HR7B 2BE5D 1STEA 1B8AA 1I3QB 1B44D 3AB9A 3IFTA 3M3YH 2EL9A 1F9QA 2A6HC 2JA7H 1S5DD 1PYSA 4OWTB 3GTJH 3KFUA 2MUYA 4OEMB 2N49A 1JQYD 1ENFA 3CPWA 1QVFA 4CS3A 1IKLA 2Z6KA 1C7YA 1KDCA 3D4DA 1HJPA 3KYHC 1AZPA 3BVZA 4IURA 5I6WA 3Q24A 2D9UA 2E2IB 4GKJL 1VMPA 2Z6KC 3AU7A 1B76A 3O13A 4X3TA 2MO0A 3I4LA 3HEJA 1Y1VB 5GROA 4DV3Q 2E10A 3LX0A 1X6OA 4LMQD 4H44C 2IHEA 3CPFA 4K8JA 4LW1A 1EZ8A 2GVBA 1IYJB 5KYLA 3KJPA 4BY1B 3EJIA 3NQIA 2K4KA 1QUQB 2V1CC 3RR5A 5IIFA 1X2HA 3UFGA 3UI2A 3I55A 1XTDA 4DR4Q 1WTXA 1Q46A 4I65A 1PFMA 5JJIA 4FO2A 2E74C 3NENA 1CSQA 5IGGA 4GNXC 2DTIA 4BA1I 2F0JA 1TWCB 3LSSA 4BA2I 3HZXA 3Q8DA 4HIMA 4P74C 2I4NA 4OX9L 3CC2A 3VYUA 3QO2A 5FLMH 2ASBA 2JA6H 4P3PA 3FMCA 4DUYL 1GXDC 1PTOC 1STAA 3PIOA 3MXPA 2Q7GA 1D8LA 1PTOF 3L9AX 2RHSB 1Q8IA 2ZJQA 2K50A 4TVYA 2Y0SE 4X65L 1VQ6A 4XTZA 1XWEA 1NJ8A 4X66Q 1K3RA 4DR1L 3EN2A 1Y8OB 2VS1A 3NP8A 1O78A 4HT4A 3KDFA 1XMQQ 2R92B 3STBC 2JEBI 3D6WA 5I4DA 5KRUA 1FL0A 2UXBL 3CRLC 4A76A 1KDBA 2NZHA 1SBBB 2CFMA 3C46A 2ZINA 4EGVA 2I5MX 4A3MH 5T1IA 1NY4A 2UUAQ 4YRQA 1HZ9A 3VR6A 3U50C 1W66A 1LUZA 4A3IB 4C3JG 2EDGA 3E6ZX 4K8IA 2SNSA 1JWMD 5EBDA 4K87A 5CV4A 3SVMA 3GD7A 1ZEQX 3DEOA 2RSNA 4A75A 1ILPA 4G7HC 1JE4A 4DUZQ 3QJYA 1AEXA 1PFSA 2CQAA 2H1EA 1N32L 2UUCQ 4KTAA 3H0GB 2L11A 4BBSG 4YWLA 4X3SA 4JI5L 2BA1A 4KJNA 3A5UA 1NTGA 3DMUA 1EUJA 1H9SA 4JI6Q 3HOUG 1TY0A 5JPNC 5KNCA 4UY8C 5IYDG 2PQEA 2RBMA 3RZOH 4H2TA 2G9HD 5M5YH 3WDNA 2B2UA 4Y7NH 1SJHD 1OXUA 4KLKA 5D3DA 1YJWA 1LT4D 4EX5A 1QG7A 1VQKA 4LUVA 3RZDB 4EQ5A 2B2UC 2AQ3B 3EIVA 2MFIA 4UDUC 3HTZA 1XNRQ 1E0BA 5C44G 5K1XA 4A3FH 3BDOA 2XSCA 1MHWC 2WB1B 4IN3A 2F0FA 1KMNA 1BOSA 3I4MG 3S15B 3ZYYX 3A55A 4YRKA 4M1UB 4DV5Q 3I90A 3GTLB 1CM9A 3NPPA 1KHIA 2F0IA 1U4PA 4YRRA 3T4AC 2QCPX 4JI4L 3CHBD 5D14A 4LF9Q 2CVRA 1V1PB 1C48A 2ZM6Q 2A69D 3D6CA 1B7YB 1E2ZA 4JI7L 3R3OA 5EAYA 3RNUA 3T1YQ 2JA8B 1H4VB 4BBRB 1Y8NB 4GLAC 1U5KA 2LKVA 3SR1A 2E5LQ 3MEFA 4APVA 1GUGA 1AE2A 4GOPA 1HZCA 2HD3A 3W1GA 1FYCA 2A6ED 1DM0B 1MSHA 2HUGA 3E5SA 3FKIG 3SK5A 3TUPA 2OQKA 4N9TA 4GOPC 3A7AA 3VQWA 2ARUA 2DTHA 2A1AA 2G9DA 3PUZA 3T13A 4JI0Q 4C2MH 3GTGB 1Q1EA 2D5DA 2ZXPA 3P75A 1I50H 5GAGC 3GO5A 1Q1BA 1ASYA 3G4SA 5IGBA 4XTUA 4F8MA 1H9JA 3SEBA 1Q8KA 4LFAQ 1M1KC 2NN6G 5C6AA 1YHQA 5C51B 2F4IA 3WQZA 4R4TA 1FJGQ 2R7FA 1LT6D 3PO3B 4A3CH 2ZT7A 2WP8J 2N8NA 4CJ1B 1CKOA 3I2ZA 3V05A 2KCNA 2F0MA 5I9OA 1S5CD 1A2TA 4J8QA 5C4ZA 2BCOA 1HUMA 4CHTB 3SE0A 3TEHB 3ONAB 1JMCA 3TP7A 3ULJA 3I3CA 1R9TB 3CAMA 3BG3A 1LACA 1SLJA 4A3GB 1YJ9A 4DXGA 1BCPC 2HDLA 3HXXA 3CCQA 5IYCG 3H6MA 1YIJA 5DEHA 3RD4A 3MQZA 1BCPF 1SYDA 4OO1G 3L0OA 5C0XH 4GKKQ 1EU4A 2QEJC 2EXZA 3DUZA 4LNQA 2NS6A 2DQ3A 1N36Q 4IPCA 1HZBA 5I6YA 1EY5A 4H2XB 3CCLA 1OTCA 1NAPA 2AUJD 4H02A 3SHLA 1D2BA 5JJLA 1F77A 1G2SA 1F2LA 3A8JE 3IL8A 1VQAA 2YTXA 1Y1WG 2NUCA 5FO7B 2KEEA 1A3TA 1JJCB 1GD7A 1ICFB 5DLQE 4YRTA
chains in the Genus database with same CATH topology
5LMNQ 2JA5H 4IPGA 3L2ZA 4JBJA 2R93H 2HIVA 4BY7G 2DZCA 3REXA 1I3QH 1BBWA 4OONA 5LMNW 2JK8A 2D0PA 3PUVA 4HJ5A 2UUBQ 2PQAA 2KCTA 2LXJA 4HIDA 5C4XG 1USYC 2EJ9A 4EO4A 4YRLA 2ID0A 5C0XG 5M3FG 1K8AC 1Y1VH 2PNHA 3CMQA 4LF8L 2IX0A 4DV6L 2CQOA 4B3RL 1YGBA 2A8EA 3NBHB 4B3TL 2ZIMA 4DV4Q 1ASZA 2VZAA 1Q86C 2EIFA 3A5YA 2ZZFA 1QUQA 4LF5L 3GTKH 4A3JG 1EIFA 4YY3Q 2OWOA 1Z47A 4GLVB 5IY0A 5H1SE 5LMUL 3S14H 1FGUA 1NMFA 1WNLA 4OP0A 3M4QA 3SGIA 1IBMQ 2XGTA 1Z9FA 2QHTA 4A3IH 4YRCA 4ZTZB 1QZGA 4X64Q 3I7FA 2HNIA 1E7ZA 4BWAA 5M3MH 1I94Q 3L1AA 4BY1G 4IJLA 3H0GH 1S72A 2LXKA 2VY3A 4JBWA 3PGZA 3ULPA 2DXTA 1WOCA 2B63G 4MZ9A 3J7A5 4LF7Q 2E64A 5E3IA 4RG1A 2OTJA 3RUXA 1HR0L 3RZDH 4X5OA 4XTYA 3DLLA 4DR6Q 2B29A 4YRIA 3S15H 2E41A 4XEOA 4TTVA 3F2BA 3GTLH 4WF2A 1QF6A 5IP9H 2R92G 4A3LH 1YFRA 4NPSA 2UXCQ 2DXUA 2JA8H 3TS0A 4O0AA 4BBRH 4JI2L 2E3CA 1SRUA 3KLWA 4PZ6A 4UPAA 1EYGA 2D0OA 1B70A 3CMAA 3RGLA 1B7YA 1VQFA 1G291 4DV7Q 3GTGH 1BIBA 2Q7EA 2I5LX 2E5AA 2OTLA 3IALA 4XTXA 4LVKA 2I4LA 4A4IA 3UDIA 1CKNB 2OCEA 2AWNA 1L1OB 1YB3A 3RKXA 1NMGA 2VNUD 1U0LA 4YHHL 1FYFA 2WB1G 1VS0A 4IFDG 4LFBQ 1IZ6A 1A8VA 2YTYA 4A3GH 3DM3A 4KHPL 2DKGA 1N9WA 5BR8Q 3TEHA 2UXDL 1YZ6A 2HHHQ 3U4VA 2YU9H 3VQVA 1XNQL 4LF6L 4Q15A 4H2VA 4A3BH 1IXRA 5JEAJ 4J15A 5IWAL 4KR2A 1HNZQ 1JJ2A 5E7NA 3H3VI 1HNWL 1S3OA 1JJCA 1YHBA 4R4CA 4HWOA 3PO3G 2UU9Q 3CD6A 1PA6A 3CCMA 2WFWA 3H15A 1HTTA 2VL6A 3BU2A 3OTOL 4A3DH 2ZR2A 4R4OA 4JI3L 1DGSA 4DR3Q 3LC0A 3M9BA 4JBMA 3NETA 4DR7Q 3PO2H 4JYAL 1TWGH 4L87A 5HGQA 1KOGA 4DV1Q 1RIQA 1SN8A 3HFZB 1J5EQ 1IBLQ 4POGA 4X62L 4B3SQ 2NZOA 4OX9Q 2ZCEA 3VQXA 2MNAA 4ZIBA 3E9HA 4JI1L 4A3EG 2KBNA 2CGHA 2Q2IA 4XU0A 4XEMA 2BH8A 1ADYA 2MQHA 1PH7A 1VCIA 1YJNA 4LFCQ 1KC8C 3CC4A 4HJ8A 3I4NG 4DV0Q 4PMWA 1PH1A 2CIMA 1NJIC 2B3GA 3CQZH 4NXMQ 3HY0A 2ZR3A 1BBUA 3GTPH 3A31A 3HOXH 3ERRA 1J5WA 4DV3L 1GGMA 1NNHA 3BJUA 4LF4Q 4OWXB 4IPDA 3A0JA 3CMEA 2JA7G 1UE5A 1N32Q 4DR4L 1EQRA 1E22A 3UGTA 4YRMA 4P72A 2AMCB 5AJ3Q 2E1HA 4A93H 2K14A 2DVEA 2CJ9A 2DGYA 3CCEA 4G85A 3RF1A 3ICAA 5IYBH 4X66L 1WCMH 1X3EA 4LUOA 2ZZGA 4TVWA 3W3SA 1XMQL 2CWPA 4AQYQ 1C9OA 1A62A 2VQEQ 5FLMG 1VQZA 2JA6G 4YCVA 4R4IA 1LTLA 1N33Q 3HKZG 3A74A 3LGJA 4WJ4A 2UUAL 1W2BA 3J81j 3PSIA 4QL5A 3S1NH 3L4GB 4YRNA 1N8RC 3BFMA 1H4QA 4X6AH 4G84A 2DU5A 1H4TA 1PH5A 4XTWA 4DUZL 4MTNA 1VQ5A 3I56A 1V1QA 2UUCL 2IY5A 4A3MG 3TS2A 1YFTA 1QE0A 3CW2C 4H2WA 3RLFA 4JI6L 4WI1A 2C7IA 4L5TA 5GADC 1KIXA 1V43A 1XNRL 2ZNJA 4ALPA 4CS4A 3FP9A 3HOYH 4DV5L 2DZ9A 4HIKA 1ATIA 4OXPA 3S16H 1PHJA 1AE3A 2DDZA 2VUMH 4LF9L 1VQIA 2ZM6L 1I6HH 1KRTA 2Q2TA 5KNNA 1YVCA 3UH0A 2ZT8A 3T1YL 4A3FG 1CKNA 3D31A 4AIMA 4P3OA 1L1OA 2E5LL 1G6PA 1IBKQ 1Q82C 1Z7MA 2NVXH 4HWPA 2RHQB 4YRFA 3F1ZA 2ZJPA 1XPRA 4JI0L 3CXCA 3P8VA 4YYEA 2N78A 5C3EH 4L5RC 4YCWA 3UDGA 4LFAL 2EAYA 1J6QA 1XPOA 3PUWA 1NE3A 4O2DA 3J80c 1FJGL 2DUDA 2Q7HA 4POFA 1BKBA 4LNSA 1JE5A 1A0IA 1XMOQ 3ERSX 3H3VH 4K0KQ 2NVQH 4MNOA 3VQYA 4DR5Q 3S1RH 1CKMA 3G48A 4DNIA 2P0LA 2PMZE 1L2FA 2EJFA 4GKKL 3HOVH 4KQEA 4A3CG 2WB1E 1G5HA 4YRJA 4UP9A 3PIPA 4DR2Q 1E1OA 4LVIA 3D0FA 5M5WH 3QO7A 2QHVA 2ZT6A 1XPUA 3VDYA 3J80i 3M85A 1QVCA 2ODRD 1NJ1A 4TVAB 3CCSA 1EOVA 5LMNL 1EVKA 3HOZH 1PH2A 1VQ4A 1JB7A 4QGUA 3AEVA 1HZAA 4BXXH 3HFZA 2DQ0A 2HQLA 2Q2UA 1X3FA 2I4OA 4GN5A 3HFVA 4GNXB 3MF2A 2ZZEA 2JA5G 2J3LA 2R93G 2UUBL 4GN4B 3CCVA 4JOIA 2AHOB 1KQSA 2RCNA 5GAEC 1M90C 1JJGA 4DAYB 2ALYB 2K52A 4TWAA 1YHAA 3KF6B 3MF1A 2RHSA 2VQFL 3HRIA 3VBBA 1VQGA 4RQEA 1N34Q 3PF5A 1I5FA 3M4OH 4DV4L 3AQQA 4WJ3M 3FHWA 1Y1VG 5C52B 1SROA 4JI8L 2DTOA 4YY3L 3UDXA 1WI5A 3T1HL 2FYKA 2ES2A 4JV5Q 2ZTDA 2AMCA 2ARTA 1NJ6A 1IBML 4PZ8A 1CSPA 2QHSA 1UE6A 4XTCS 4JC0A 2Q5HA 4H2YA 1OXSC 4LUZA 1K73C 1GM5A 3S17H 5J3BA 4X64L 3I4OA 1JT8A 2K5VA 4HWTA 1I94L 3RKYA 1Z7NA 2LSSA 1K9MC 2NN6I 3K7AH 5FJ8H 2ZTCA 3L4GA 1VQ7A 1Q81C 1MIUA 2JA9A 4LF7L 4A3IG 4A3KH 2ATWA 1PH8A 1YI2A 2F4VQ 2F3IA 1XJVA 3M4PA 2PMEA 3M7NA 5M3MG 2CKZB 4XIGS 1KL9A 4GOPB 4DV2Q 1HC7A 3H0GG 3PUXA 3HOWH 4Y52H 4OO1I 4JCVE 4DR6L 4YHHQ 3J7ZC 1HNXQ 2IX1A 4H2UA 1HXDA 2ZXFA 3G6EA 2UXCL 1ADJA 5IP7H 2AKWB 3HKZE 4DKAC 1VQOA 3GTOH 1X3GA 3AFQA 3WWVA 4GS3A 2ZIOA 3IG2A 4DAMA 1CUKA 3QNEA 4P73A 5IP9G 1SR3A 1D7QA 4B3MQ 4CH4A 4Q6GA 4A3LG 1LM0A 4DV7L 3PCOB 5FJ8G 3V7SA 2JA8G 1SETA 2R7ZH 4NCXA 1OXVA 3JAMc 4BBRG 4R4QA 4NB3A 1IL2A 4YRPA 3KOJA 1P8LA 1YEZA 3DSQA 3L7ZC 3S1MH 3PUYA 4NXNQ 4RQFA 3P8TA 4LFBL 3HXYA 5C0XI 4QJFA 3HRKA 4H2XA 4OLFA 2ZTEA 1L0WA 4JI3Q 3E9IA 1V9PA 3MEYA 3OW2A 1VQ8A 4P75A 1SFOH 4DPGA 4IOAA 4LVMA 2JEAI 5BR8L 2MO1A 3JAMi 4GKJQ 2HHHL 4JBKA 3S2HH 4A3GG 3FJPA 1SERA 2PMFA 4IJHA 3HKSA 2PI2A 3RKWA 3KJOA 5HY6A 4CH3A 2R7ZG 11ASA 1AH9A 4GLXA 2D62A 1HNZL 3UE0A 3REUA 2C8MA 4DUYQ 1X2GA 4TQUS 1OXXK 4TVAA 2UU9L 1S40A 2CWAA 4X65Q 1SESA 4A3BG 4PZ7A 1QVGA 4C3JH 4FDBA 4DR1Q 3LSQA 2K5NA 2DEQA 1GKHA 2K75A 4DR3L 2YTVA 4QY7A 2UXBQ 4DR7L 4BBSH 5GQOA 3CCUA 4GNXA 1FVIA 1HH2P 1NYRA 1WLEA 4DV1L 4P74A 3HOUH 1J5EL 1TWAH 4P3NA 1IBLL 2Q5IA 5IYDH 4B3SL 2QHUA 4K88A 4OWWB 4IFDJ 4A3DG 1WQWA 1X55A 3EBEA 1KMMA 5C44H 3PO2G 3QO5A 2RF4A 2ALYA 2GN5A 4JI5Q 3KF6A 2JQOA 3I4MH 1YNXA 3MXNB 5C4JH 4RDXA 4DK6C 4LFCL 2OQ0A 2HIXA 4DV0L 3RN5A 3K8AA 2KCMA 3AYHB 4P72C 1C0AA 3AFPA 4NXML 3RL6A 3CP0A 2EWNA 4IPHA 1VQNA 3A7RA 1MKHA 2QA4A 2ZTGA 4YROA 2WAQG 3FKIH 3K0XA 4LF4L 4JG2A 3UE1A 4JI4Q 5ELNA 4YCUA 1WQ7A 2QGQA 4JI7Q 4YREA 4YRSA 3F2CA 3HOXG 4AYBG 4KI0A 2EQSA 5AJ3L 2H5XA 4L5SA 12ASA 4YWMA 3A7UA 2YYZA 3K81C 3HY1A 5JJKA 1KAWA 4HJAA 4IFDI 1VQCA 1YITA 4CH6A 3TREA 3RACA 1UE7A 2CJAA 4AQYL 2FXQA 3GTQH 2E2HH 5IYCH 2VQEL 3R07A 1N33L 4A93G 1B70B 2IT1A 1EIYB 1UE1A 1VQLA 3PV0A 3G1ZA 1NJ5A 3V7CA 5IYBG 1WCMG 3OYYA 1VQBA 4L5QA 4CH5A 1MJCA 3QTCA 2K5HA 2NVYH 2EXDA 2KHJA 1Y1WH 3STBD 2ODRC 4GN3B 1TWFH 2EJGA 3A5ZB 2C35B 2I0QA 4KHZA 4BY7H 4YRGA 1EFWA 2XTIA 3RLOA 1L1OC 2AKWA 3BZKA 3F2DA 2F52A 1WYDA 4LVLA 2JJQA 1O7IA 4HJ9A 5GAHC 1BVSA 3EFRA 4XU2A 2E65A 3EFSA 3TEGA 1VQ9A 3P8YA 1T9HA 3PCOA 5C4XH 1MJEA 1PYBA 4HA8A 3B6YA 5M3FH 2CJBA 4AH6A 3CCRA 1SMXA 2QEXA 3ICEA 1PH6A 3RN2A 1IBKL 3HOYG 2GVAA 4QIWE 1NJ2A 1QZHA 1X54A 1K83H 4P71A 2VUMG 2HT1A 4P71C 1G5IA 4LF8Q 4DV6Q 1N36L 4A3JH 1VQJA 3TQYA 4B3RQ 1EQQA 4HWSA 3PZCA 1GVPA 4B3TQ 5K36G 2Y0SG 3J81c 3W5OA 3CF5A 1PYSB 1Q12A 2AWOA 1W3SA 3HXUA 4K86A 1XMOL 2I4MA 3HXWA 5C3EG 4CS2A 4K0KL 1USYA 4LF5Q 3RIRA 4DR5L 5IE8A 5LMUQ 2E2IH 2ZJRA 1PH9A 1KRSA 5IT9c 1BIAA 3A32A 4HWRA 2ZGWA 4BY1H 2ZT5A 2VQFQ 5F5WA 4DR2L 2VW9A 1GO3E 3CCJA 3ER0A 2B63H 4DK3C 1X9NA 3J81i 1TWCH 1PVOA 4JOIC 3IKMB 1VQDA 4QQBX 3HOVG 2N3SA 1VQPA 2ZNIA 4XU3A 4JI8Q 1PH4A 3HXZA 2DJZA 3KDFB 1VQEA 1E24A 3IKLA 2JE6I 3JC66 4YWKA 2BA0A 3T1HQ 4HJ7A 3UGQA 2Q2HA 2R92H 3IRBA 1RIPA 2E2JH 4HIOA 1HR0Q 3HOZG 1UWVA 3V8LA 3U4ZA 3OD1A 4BXXG 3ULLA 3S2DH 3HXVA 1TWHH 4XTVA 3S24A 1RL2A 5K1PA 1H95A 3F8TA 5JEAG 5FLXc 1HR0W 3UDFA 2E8GA 4BW9A 1X01A 1N34L 4RMFA 1WU7A 3S1QH 1H4SA 4ME3A 4JI2Q 2PI2E 3TRZA 1K8GA 1EWIA 2IHFA 1YFSA 3CC7A 2J3MA 4JV5L 4LVJA 4PG3A 1A63A 3K7UC 2IY5B 1VQMA 1VQHA 5C0XJ 4HVCA 3RLNA 1E3PA 5ELOA 4DQ2A 4XU1A 2R6GA 4LWCA 3G71A 1TXYA 2A8VA 1K0RA 4C3HH 2L15A 3NEMA 2Z0SA 1EVLA 3GDEA 1EIYA 2WAQE 1KD1C 3L2PA 4KHPQ 2DU7A 3W1BA 1NBWA 3V8JA 2P5IA 5M5XH 3K80C 4IO9A 1WJJA 1X56A 2UXDQ 1KXLA 4YPFA 1X65A 2F4VL 1SE8A 1XNQQ 4AYBE 4PHCA 4P73C 2A19A 1PH3A 4LF6Q 3PO3H 2KENA 3A5ZA 3ZJYC 1OXTA 4DV2L 1P16A 1LYLA 5IWAQ 2NVTH 2R7DA 1R9TH 1G51A 4A3KG 4TQFA 1HNXL 5C53B 2I5HA 2RHQA 1YBYA 4ZTUB 1HNWQ 2CCZA 1UEBA 1PV4A 4UP7A 3HOWG 1WPYA 4R1JA 4H2SA 3OTOQ 3U58A 4C3IH 4B3ML 1Q7YC 2BH2A 1Y14B 1NYQA 1E1TA 4A3EH 1SRYA 4JYAQ 3V7RA 4P75C 2KHIA 5IP7G 3QO8A 4TQDA 2ARSA 3GTMH 4X62Q 4KR3A 4IOCA 3I4NH 4UP8A 3E0EA 3BZCA 4E51A 1WFQA 4YDQA 2YV5A 2G4CA 3V8KA 4JI1Q 2PQAB 4YP0A 4NXNL 3KF8B 3PF4A 3NELA 1B8AA 3M3YH 2EL9A 2JA7H 1PYSA 4OWTB 3GTJH 3KFUA 2N49A 3CPWA 1QVFA 4CS3A 2Z6KA 1C7YA 1HJPA 3KYHC 4GKJL 2Z6KC 1B76A 2MO0A 4DV3Q 5GROA 2E10A 1X6OA 2IHEA 3CPFA 4LW1A 2GVBA 1IYJB 3KJPA 2K4KA 1QUQB 2V1CC 3RR5A 3UFGA 1X2HA 3I55A 1XTDA 4DR4Q 1Q46A 5JJIA 3NENA 1CSQA 4GNXC 2DTIA 4BA1I 3LSSA 4BA2I 3Q8DA 4HIMA 4P74C 2I4NA 4OX9L 3CC2A 5FLMH 2ASBA 2JA6H 4P3PA 4DUYL 3PIOA 2Q7GA 1D8LA 2RHSB 2ZJQA 2K50A 4TVYA 2Y0SE 4X65L 1VQ6A 4XTZA 1NJ8A 4X66Q 1K3RA 4DR1L 3EN2A 2VS1A 4HT4A 3KDFA 1XMQQ 3STBC 2JEBI 1FL0A 2UXBL 4A76A 2NZHA 2CFMA 2ZINA 2I5MX 4A3MH 1NY4A 2UUAQ 4YRQA 1HZ9A 3U50C 1W66A 1LUZA 4K87A 3GD7A 4A75A 4DUZQ 1PFSA 1N32L 2UUCQ 4BBSG 4YWLA 4JI5L 2BA1A 3A5UA 1NTGA 1EUJA 4JI6Q 3HOUG 4UY8C 5IYDG 3RZOH 4H2TA 5M5YH 4Y7NH 1OXUA 4KLKA 1YJWA 4EX5A 1VQKA 4LUVA 4EQ5A 3EIVA 2MFIA 3HTZA 1XNRQ 5C44G 5K1XA 4A3FH 1KMNA 3I4MG 4YRKA 4DV5Q 1KHIA 4YRRA 4JI4L 4LF9Q 2ZM6Q 1B7YB 4JI7L 3RNUA 5EAYA 3T1YQ 1H4VB 4GLAC 1U5KA 2E5LQ 3MEFA 4APVA 1AE2A 4GOPA 1HZCA 3W1GA 3FKIG 3TUPA 2OQKA 4GOPC 3A7AA 3VQWA 2ARUA 2DTHA 2A1AA 3PUZA 4JI0Q 4C2MH 1Q1EA 1I50H 5GAGC 3GO5A 1Q1BA 1ASYA 3G4SA 4XTUA 1Q8KA 4LFAQ 1M1KC 2NN6G 5C51B 1YHQA 3WQZA 4R4TA 1FJGQ 2R7FA 4A3CH 2ZT7A 2WP8J 2N8NA 1CKOA 3I2ZA 3TEHB 1JMCA 3ULJA 3CAMA 1SLJA 1YJ9A 3HXXA 3CCQA 5IYCG 1YIJA 3MQZA 4OO1G 3L0OA 4GKKQ 4LNQA 2NS6A 2DQ3A 1N36Q 4IPCA 1HZBA 4H2XB 3CCLA 1OTCA 4H02A 5JJLA 1VQAA 2YTXA 1Y1WG 1JJCB 1GD7A 5DLQE 4YRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN Q;  2JA5 H;  4IPG A;  3L2Z A;  4JBJ A;  2R93 H;  2HIV A;  4BY7 G;  2DZC A;  3REX A;  1I3Q H;  1BBW A;  4OON A;  5LMN W;  2JK8 A;  2D0P A;  3PUV A;  4HJ5 A;  2UUB Q;  2PQA A;  2KCT A;  2LXJ A;  4HID A;  5C4X G;  1USY C;  2EJ9 A;  4EO4 A;  4YRL A;  2ID0 A;  5C0X G;  5M3F G;  1K8A C;  1Y1V H;  2PNH A;  3CMQ A;  4LF8 L;  2IX0 A;  4DV6 L;  2CQO A;  4B3R L;  1YGB A;  3NBH B;  4B3T L;  2ZIM A;  4DV4 Q;  1ASZ A;  2VZA A;  1Q86 C;  2EIF A;  3A5Y A;  2ZZF A;  1QUQ A;  4LF5 L;  3GTK H;  4A3J G;  1EIF A;  4YY3 Q;  2OWO A;  1Z47 A;  4GLV B;  5IY0 A;  5H1S E;  5LMU L;  3S14 H;  1FGU A;  1NMF A;  1WNL A;  4OP0 A;  3M4Q A;  3SGI A;  1IBM Q;  2XGT A;  1Z9F A;  2QHT A;  4A3I H;  4YRC A;  4ZTZ B;  1QZG A;  4X64 Q;  3I7F A;  2HNI A;  1E7Z A;  4BWA A;  5M3M H;  1I94 Q;  3L1A A;  4BY1 G;  4IJL A;  3H0G H;  1S72 A;  2LXK A;  2VY3 A;  4JBW A;  3PGZ A;  3ULP A;  2DXT A;  1WOC A;  2B63 G;  4MZ9 A;  3J7A 5;  4LF7 Q;  2E64 A;  5E3I A;  4RG1 A;  2OTJ A;  3RUX A;  1HR0 L;  3RZD H;  4X5O A;  4XTY A;  3DLL A;  4DR6 Q;  2B29 A;  4YRI A;  3S15 H;  2E41 A;  4XEO A;  4TTV A;  3F2B A;  3GTL H;  4WF2 A;  1QF6 A;  5IP9 H;  2R92 G;  4A3L H;  1YFR A;  4NPS A;  2UXC Q;  2DXU A;  2JA8 H;  3TS0 A;  4O0A A;  4BBR H;  4JI2 L;  2E3C A;  1SRU A;  3KLW A;  4PZ6 A;  4UPA A;  1EYG A;  2D0O A;  1B70 A;  3CMA A;  3RGL A;  1B7Y A;  1VQF A;  1G29 1;  4DV7 Q;  3GTG H;  1BIB A;  2Q7E A;  2I5L X;  2E5A A;  2OTL A;  3IAL A;  4XTX A;  2I4L A;  4A4I A;  3UDI A;  1CKN B;  2OCE A;  2AWN A;  1L1O B;  1YB3 A;  3RKX A;  1NMG A;  2VNU D;  1U0L A;  4YHH L;  1FYF A;  2WB1 G;  1VS0 A;  4IFD G;  4LFB Q;  1IZ6 A;  1A8V A;  2YTY A;  4A3G H;  3DM3 A;  4KHP L;  2DKG A;  1N9W A;  5BR8 Q;  3TEH A;  2UXD L;  1YZ6 A;  2HHH Q;  3U4V A;  2YU9 H;  3VQV A;  1XNQ L;  4LF6 L;  4Q15 A;  4H2V A;  4A3B H;  1IXR A;  5JEA J;  4J15 A;  5IWA L;  4KR2 A;  1HNZ Q;  1JJ2 A;  5E7N A;  3H3V I;  1HNW L;  1S3O A;  1JJC A;  1YHB A;  4R4C A;  4HWO A;  3PO3 G;  2UU9 Q;  3CD6 A;  1PA6 A;  3CCM A;  2WFW A;  3H15 A;  1HTT A;  2VL6 A;  3BU2 A;  3OTO L;  4A3D H;  2ZR2 A;  4R4O A;  4JI3 L;  1DGS A;  4DR3 Q;  3LC0 A;  3M9B A;  4JBM A;  3NET A;  4DR7 Q;  3PO2 H;  4JYA L;  1TWG H;  4L87 A;  5HGQ A;  1KOG A;  4DV1 Q;  1RIQ A;  1SN8 A;  3HFZ B;  1J5E Q;  1IBL Q;  4POG A;  4X62 L;  4B3S Q;  2NZO A;  4OX9 Q;  2ZCE A;  3VQX A;  2MNA A;  4ZIB A;  3E9H A;  4JI1 L;  4A3E G;  2KBN A;  2CGH A;  2Q2I A;  4XU0 A;  4XEM A;  2BH8 A;  1ADY A;  2MQH A;  1PH7 A;  1VCI A;  1YJN A;  4LFC Q;  1KC8 C;  3CC4 A;  4HJ8 A;  3I4N G;  4DV0 Q;  4PMW A;  1PH1 A;  2CIM A;  1NJI C;  2B3G A;  3CQZ H;  4NXM Q;  3HY0 A;  2ZR3 A;  1BBU A;  3GTP H;  3A31 A;  3HOX H;  3ERR A;  1J5W A;  4DV3 L;  1GGM A;  1NNH A;  3BJU A;  4LF4 Q;  4OWX B;  4IPD A;  3A0J A;  3CME A;  2JA7 G;  1UE5 A;  1N32 Q;  4DR4 L;  1EQR A;  1E22 A;  3UGT A;  4YRM A;  4P72 A;  2AMC B;  5AJ3 Q;  2E1H A;  4A93 H;  2K14 A;  2DVE A;  2CJ9 A;  2DGY A;  3CCE A;  4G85 A;  3RF1 A;  3ICA A;  5IYB H;  4X66 L;  1WCM H;  1X3E A;  4LUO A;  2ZZG A;  4TVW A;  3W3S A;  1XMQ L;  2CWP A;  4AQY Q;  1C9O A;  1A62 A;  2VQE Q;  5FLM G;  1VQZ A;  2JA6 G;  4YCV A;  4R4I A;  1LTL A;  1N33 Q;  3HKZ G;  3A74 A;  3LGJ A;  4WJ4 A;  2UUA L;  1W2B A;  3J81 j;  3PSI A;  4QL5 A;  3S1N H;  3L4G B;  4YRN A;  1N8R C;  3BFM A;  1H4Q A;  4X6A H;  4G84 A;  2DU5 A;  1H4T A;  1PH5 A;  4XTW A;  4DUZ L;  4MTN A;  1VQ5 A;  3I56 A;  1V1Q A;  2UUC L;  2IY5 A;  4A3M G;  3TS2 A;  1YFT A;  1QE0 A;  3CW2 C;  4H2W A;  3RLF A;  4JI6 L;  4WI1 A;  2C7I A;  4L5T A;  5GAD C;  1KIX A;  1V43 A;  1XNR L;  2ZNJ A;  4ALP A;  4CS4 A;  3FP9 A;  3HOY H;  4DV5 L;  2DZ9 A;  4HIK A;  1ATI A;  4OXP A;  3S16 H;  1PHJ A;  1AE3 A;  2DDZ A;  2VUM H;  4LF9 L;  1VQI A;  2ZM6 L;  1I6H H;  1KRT A;  2Q2T A;  5KNN A;  1YVC A;  3UH0 A;  2ZT8 A;  3T1Y L;  4A3F G;  1CKN A;  3D31 A;  4AIM A;  4P3O A;  1L1O A;  2E5L L;  1G6P A;  1IBK Q;  1Q82 C;  1Z7M A;  2NVX H;  4HWP A;  2RHQ B;  4YRF A;  3F1Z A;  2ZJP A;  1XPR A;  4JI0 L;  3CXC A;  3P8V A;  4YYE A;  2N78 A;  5C3E H;  4L5R C;  4YCW A;  3UDG A;  4LFA L;  2EAY A;  1J6Q A;  1XPO A;  3PUW A;  1NE3 A;  4O2D A;  3J80 c;  1FJG L;  2DUD A;  2Q7H A;  4POF A;  1BKB A;  4LNS A;  1JE5 A;  1A0I A;  1XMO Q;  3ERS X;  3H3V H;  4K0K Q;  2NVQ H;  4MNO A;  3VQY A;  4DR5 Q;  3S1R H;  1CKM A;  3G48 A;  4DNI A;  2P0L A;  2PMZ E;  1L2F A;  2EJF A;  4GKK L;  3HOV H;  4KQE A;  4A3C G;  2WB1 E;  1G5H A;  4YRJ A;  4UP9 A;  3PIP A;  4DR2 Q;  1E1O A;  3D0F A;  5M5W H;  3QO7 A;  2QHV A;  2ZT6 A;  1XPU A;  3VDY A;  3J80 i;  3M85 A;  1QVC A;  2ODR D;  1NJ1 A;  4TVA B;  3CCS A;  1EOV A;  5LMN L;  1EVK A;  3HOZ H;  1PH2 A;  1VQ4 A;  1JB7 A;  4QGU A;  3AEV A;  1HZA A;  4BXX H;  3HFZ A;  2DQ0 A;  2HQL A;  2Q2U A;  1X3F A;  2I4O A;  4GN5 A;  3HFV A;  4GNX B;  3MF2 A;  2ZZE A;  2JA5 G;  2J3L A;  2R93 G;  2UUB L;  4GN4 B;  3CCV A;  4JOI A;  2AHO B;  1KQS A;  2RCN A;  5GAE C;  1M90 C;  1JJG A;  4DAY B;  2ALY B;  2K52 A;  4TWA A;  1YHA A;  3KF6 B;  3MF1 A;  2RHS A;  2VQF L;  3HRI A;  3VBB A;  1VQG A;  4RQE A;  1N34 Q;  3PF5 A;  1I5F A;  3M4O H;  4DV4 L;  3AQQ A;  4WJ3 M;  3FHW A;  1Y1V G;  5C52 B;  1SRO A;  4JI8 L;  2DTO A;  4YY3 L;  3UDX A;  1WI5 A;  3T1H L;  2FYK A;  2ES2 A;  4JV5 Q;  2ZTD A;  2AMC A;  2ART A;  1NJ6 A;  1IBM L;  4PZ8 A;  1CSP A;  2QHS A;  1UE6 A;  4XTC S;  4JC0 A;  2Q5H A;  4H2Y A;  1OXS C;  4LUZ A;  1K73 C;  1GM5 A;  3S17 H;  5J3B A;  4X64 L;  3I4O A;  1JT8 A;  2K5V A;  4HWT A;  1I94 L;  3RKY A;  1Z7N A;  2LSS A;  1K9M C;  2NN6 I;  3K7A H;  5FJ8 H;  2ZTC A;  3L4G A;  1VQ7 A;  1Q81 C;  1MIU A;  2JA9 A;  4LF7 L;  4A3I G;  4A3K H;  2ATW A;  1PH8 A;  1YI2 A;  2F4V Q;  2F3I A;  1XJV A;  3M4P A;  2PME A;  3M7N A;  5M3M G;  2CKZ B;  4XIG S;  1KL9 A;  4GOP B;  4DV2 Q;  1HC7 A;  3H0G G;  3PUX A;  3HOW H;  4Y52 H;  4OO1 I;  4JCV E;  4DR6 L;  4YHH Q;  3J7Z C;  1HNX Q;  2IX1 A;  4H2U A;  1HXD A;  2ZXF A;  3G6E A;  2UXC L;  1ADJ A;  5IP7 H;  2AKW B;  3HKZ E;  4DKA C;  1VQO A;  3GTO H;  1X3G A;  3AFQ A;  3WWV A;  4GS3 A;  2ZIO A;  3IG2 A;  4DAM A;  1CUK A;  3QNE A;  4P73 A;  5IP9 G;  1SR3 A;  1D7Q A;  4B3M Q;  4CH4 A;  4Q6G A;  4A3L G;  1LM0 A;  4DV7 L;  3PCO B;  5FJ8 G;  3V7S A;  2JA8 G;  1SET A;  2R7Z H;  4NCX A;  1OXV A;  3JAM c;  4BBR G;  4R4Q A;  4NB3 A;  1IL2 A;  4YRP A;  3KOJ A;  1P8L A;  1YEZ A;  3DSQ A;  3L7Z C;  3S1M H;  3PUY A;  4NXN Q;  4RQF A;  3P8T A;  4LFB L;  3HXY A;  5C0X I;  4QJF A;  3HRK A;  4H2X A;  4OLF A;  2ZTE A;  1L0W A;  4JI3 Q;  3E9I A;  1V9P A;  3MEY A;  3OW2 A;  1VQ8 A;  4P75 A;  1SFO H;  4DPG A;  4IOA A;  2JEA I;  5BR8 L;  2MO1 A;  3JAM i;  4GKJ Q;  2HHH L;  4JBK A;  3S2H H;  4A3G G;  3FJP A;  1SER A;  2PMF A;  4IJH A;  3HKS A;  2PI2 A;  3RKW A;  3KJO A;  5HY6 A;  4CH3 A;  2R7Z G;  11AS A;  1AH9 A;  4GLX A;  2D62 A;  1HNZ L;  3UE0 A;  3REU A;  2C8M A;  4DUY Q;  1X2G A;  4TQU S;  1OXX K;  4TVA A;  2UU9 L;  1S40 A;  2CWA A;  4X65 Q;  1SES A;  4A3B G;  4PZ7 A;  1QVG A;  4C3J H;  4FDB A;  4DR1 Q;  3LSQ A;  2K5N A;  2DEQ A;  1GKH A;  2K75 A;  4DR3 L;  2YTV A;  4QY7 A;  2UXB Q;  4DR7 L;  4BBS H;  5GQO A;  3CCU A;  4GNX A;  1FVI A;  1HH2 P;  1NYR A;  1WLE A;  4DV1 L;  4P74 A;  3HOU H;  1J5E L;  1TWA H;  4P3N A;  1IBL L;  2Q5I A;  5IYD H;  4B3S L;  2QHU A;  4K88 A;  4OWW B;  4IFD J;  4A3D G;  1WQW A;  1X55 A;  3EBE A;  1KMM A;  5C44 H;  3PO2 G;  3QO5 A;  2RF4 A;  2ALY A;  2GN5 A;  4JI5 Q;  3KF6 A;  2JQO A;  3I4M H;  1YNX A;  3MXN B;  5C4J H;  4RDX A;  4DK6 C;  4LFC L;  2OQ0 A;  2HIX A;  4DV0 L;  3RN5 A;  3K8A A;  2KCM A;  3AYH B;  4P72 C;  1C0A A;  3AFP A;  4NXM L;  3RL6 A;  3CP0 A;  2EWN A;  4IPH A;  1VQN A;  3A7R A;  1MKH A;  2QA4 A;  2ZTG A;  4YRO A;  2WAQ G;  3FKI H;  3K0X A;  4LF4 L;  4JG2 A;  3UE1 A;  4JI4 Q;  5ELN A;  4YCU A;  1WQ7 A;  2QGQ A;  4JI7 Q;  4YRE A;  4YRS A;  3F2C A;  3HOX G;  4AYB G;  4KI0 A;  2EQS A;  5AJ3 L;  2H5X A;  4L5S A;  12AS A;  4YWM A;  3A7U A;  2YYZ A;  3K81 C;  3HY1 A;  5JJK A;  1KAW A;  4HJA A;  4IFD I;  1VQC A;  1YIT A;  4CH6 A;  3TRE A;  3RAC A;  1UE7 A;  2CJA A;  4AQY L;  2FXQ A;  3GTQ H;  2E2H H;  5IYC H;  2VQE L;  3R07 A;  1N33 L;  4A93 G;  1B70 B;  2IT1 A;  1EIY B;  1UE1 A;  1VQL A;  3PV0 A;  3G1Z A;  1NJ5 A;  3V7C A;  5IYB G;  1WCM G;  3OYY A;  1VQB A;  4L5Q A;  4CH5 A;  1MJC A;  3QTC A;  2K5H A;  2NVY H;  2EXD A;  2KHJ A;  1Y1W H;  3STB D;  2ODR C;  4GN3 B;  1TWF H;  2EJG A;  3A5Z B;  2C35 B;  2I0Q A;  4KHZ A;  4BY7 H;  4YRG A;  1EFW A;  2XTI A;  3RLO A;  1L1O C;  2AKW A;  3BZK A;  3F2D A;  2F52 A;  1WYD A;  2JJQ A;  1O7I A;  4HJ9 A;  5GAH C;  1BVS A;  3EFR A;  4XU2 A;  2E65 A;  3EFS A;  3TEG A;  1VQ9 A;  3P8Y A;  1T9H A;  3PCO A;  5C4X H;  1MJE A;  1PYB A;  4HA8 A;  3B6Y A;  5M3F H;  2CJB A;  4AH6 A;  3CCR A;  1SMX A;  2QEX A;  3ICE A;  1PH6 A;  3RN2 A;  1IBK L;  3HOY G;  2GVA A;  4QIW E;  1NJ2 A;  1QZH A;  1X54 A;  1K83 H;  4P71 A;  2VUM G;  2HT1 A;  4P71 C;  1G5I A;  4LF8 Q;  4DV6 Q;  1N36 L;  4A3J H;  1VQJ A;  3TQY A;  4B3R Q;  1EQQ A;  4HWS A;  3PZC A;  1GVP A;  4B3T Q;  5K36 G;  2Y0S G;  3J81 c;  3W5O A;  3CF5 A;  1PYS B;  1Q12 A;  2AWO A;  1W3S A;  3HXU A;  4K86 A;  1XMO L;  2I4M A;  3HXW A;  5C3E G;  4CS2 A;  4K0K L;  1USY A;  4LF5 Q;  3RIR A;  4DR5 L;  5IE8 A;  5LMU Q;  2E2I H;  2ZJR A;  1PH9 A;  1KRS A;  5IT9 c;  1BIA A;  3A32 A;  4HWR A;  2ZGW A;  4BY1 H;  2ZT5 A;  2VQF Q;  5F5W A;  4DR2 L;  2VW9 A;  1GO3 E;  3CCJ A;  3ER0 A;  2B63 H;  4DK3 C;  1X9N A;  3J81 i;  1TWC H;  1PVO A;  4JOI C;  3IKM B;  1VQD A;  4QQB X;  3HOV G;  2N3S A;  1VQP A;  2ZNI A;  4XU3 A;  4JI8 Q;  1PH4 A;  3HXZ A;  2DJZ A;  3KDF B;  1VQE A;  1E24 A;  3IKL A;  2JE6 I;  3JC6 6;  4YWK A;  2BA0 A;  3T1H Q;  4HJ7 A;  3UGQ A;  2Q2H A;  2R92 H;  3IRB A;  1RIP A;  2E2J H;  4HIO A;  1HR0 Q;  3HOZ G;  1UWV A;  3V8L A;  3U4Z A;  3OD1 A;  4BXX G;  3ULL A;  3S2D H;  3HXV A;  1TWH H;  4XTV A;  3S24 A;  1RL2 A;  5K1P A;  1H95 A;  3F8T A;  5JEA G;  5FLX c;  1HR0 W;  3UDF A;  2E8G A;  4BW9 A;  1X01 A;  1N34 L;  4RMF A;  1WU7 A;  3S1Q H;  1H4S A;  4ME3 A;  4JI2 Q;  2PI2 E;  3TRZ A;  1K8G A;  1EWI A;  2IHF A;  1YFS A;  3CC7 A;  2J3M A;  4JV5 L;  4PG3 A;  1A63 A;  3K7U C;  2IY5 B;  1VQM A;  1VQH A;  5C0X J;  4HVC A;  3RLN A;  1E3P A;  5ELO A;  4DQ2 A;  4XU1 A;  2R6G A;  4LWC A;  3G71 A;  1TXY A;  2A8V A;  1K0R A;  4C3H H;  2L15 A;  3NEM A;  2Z0S A;  1EVL A;  3GDE A;  1EIY A;  2WAQ E;  1KD1 C;  3L2P A;  4KHP Q;  2DU7 A;  3W1B A;  1NBW A;  3V8J A;  2P5I A;  5M5X H;  3K80 C;  4IO9 A;  1WJJ A;  1X56 A;  2UXD Q;  1KXL A;  4YPF A;  1X65 A;  2F4V L;  1SE8 A;  1XNQ Q;  4AYB E;  4PHC A;  4P73 C;  2A19 A;  1PH3 A;  4LF6 Q;  3PO3 H;  2KEN A;  3A5Z A;  3ZJY C;  1OXT A;  4DV2 L;  1P16 A;  1LYL A;  5IWA Q;  2NVT H;  2R7D A;  1R9T H;  1G51 A;  4A3K G;  4TQF A;  1HNX L;  5C53 B;  2I5H A;  2RHQ A;  1YBY A;  4ZTU B;  1HNW Q;  2CCZ A;  1UEB A;  1PV4 A;  4UP7 A;  3HOW G;  1WPY A;  4R1J A;  4H2S A;  3OTO Q;  3U58 A;  4C3I H;  4B3M L;  1Q7Y C;  2BH2 A;  1Y14 B;  1NYQ A;  1E1T A;  4A3E H;  1SRY A;  4JYA Q;  3V7R A;  4P75 C;  2KHI A;  5IP7 G;  3QO8 A;  4TQD A;  2ARS A;  3GTM H;  4X62 Q;  4KR3 A;  4IOC A;  3I4N H;  4UP8 A;  3E0E A;  3BZC A;  4E51 A;  1WFQ A;  4YDQ A;  2YV5 A;  2G4C A;  3V8K A;  4JI1 Q;  2PQA B;  4YP0 A;  4NXN L;  3KF8 B;  3PF4 A;  3NEL A;  1B8A A;  3M3Y H;  2EL9 A;  2JA7 H;  1PYS A;  4OWT B;  3GTJ H;  3KFU A;  2N49 A;  3CPW A;  1QVF A;  4CS3 A;  2Z6K A;  1C7Y A;  1HJP A;  3KYH C;  4GKJ L;  2Z6K C;  1B76 A;  2MO0 A;  4DV3 Q;  5GRO A;  2E10 A;  1X6O A;  2IHE A;  3CPF A;  4LW1 A;  2GVB A;  1IYJ B;  3KJP A;  2K4K A;  1QUQ B;  2V1C C;  3RR5 A;  3UFG A;  1X2H A;  3I55 A;  1XTD A;  4DR4 Q;  1Q46 A;  5JJI A;  3NEN A;  1CSQ A;  4GNX C;  2DTI A;  4BA1 I;  3LSS A;  4BA2 I;  3Q8D A;  4HIM A;  4P74 C;  2I4N A;  4OX9 L;  3CC2 A;  5FLM H;  2ASB A;  2JA6 H;  4P3P A;  4DUY L;  3PIO A;  2Q7G A;  1D8L A;  2RHS B;  2ZJQ A;  2K50 A;  4TVY A;  2Y0S E;  4X65 L;  1VQ6 A;  4XTZ A;  1NJ8 A;  4X66 Q;  1K3R A;  4DR1 L;  3EN2 A;  2VS1 A;  3KDF A;  1XMQ Q;  3STB C;  2JEB I;  1FL0 A;  2UXB L;  4A76 A;  2NZH A;  2CFM A;  2ZIN A;  2I5M X;  4A3M H;  1NY4 A;  2UUA Q;  4YRQ A;  1HZ9 A;  3U50 C;  1W66 A;  1LUZ A;  4K87 A;  3GD7 A;  4A75 A;  4DUZ Q;  1PFS A;  1N32 L;  2UUC Q;  4BBS G;  4YWL A;  4JI5 L;  2BA1 A;  3A5U A;  1NTG A;  1EUJ A;  4JI6 Q;  3HOU G;  4UY8 C;  5IYD G;  3RZO H;  4H2T A;  5M5Y H;  4Y7N H;  1OXU A;  4KLK A;  1YJW A;  4EX5 A;  1VQK A;  4LUV A;  4EQ5 A;  3EIV A;  2MFI A;  3HTZ A;  1XNR Q;  5C44 G;  5K1X A;  4A3F H;  1KMN A;  3I4M G;  4YRK A;  4DV5 Q;  1KHI A;  4YRR A;  4JI4 L;  4LF9 Q;  2ZM6 Q;  1B7Y B;  4JI7 L;  3RNU A;  5EAY A;  3T1Y Q;  1H4V B;  4GLA C;  1U5K A;  2E5L Q;  3MEF A;  4APV A;  1AE2 A;  4GOP A;  1HZC A;  3W1G A;  3FKI G;  3TUP A;  2OQK A;  4GOP C;  3A7A A;  3VQW A;  2ARU A;  2DTH A;  2A1A A;  3PUZ A;  4JI0 Q;  4C2M H;  1Q1E A;  1I50 H;  5GAG C;  3GO5 A;  1Q1B A;  1ASY A;  3G4S A;  4XTU A;  1Q8K A;  4LFA Q;  1M1K C;  2NN6 G;  5C51 B;  1YHQ A;  3WQZ A;  4R4T A;  1FJG Q;  2R7F A;  4A3C H;  2ZT7 A;  2WP8 J;  2N8N A;  1CKO A;  3I2Z A;  3TEH B;  1JMC A;  3ULJ A;  3CAM A;  1SLJ A;  1YJ9 A;  3HXX A;  3CCQ A;  5IYC G;  1YIJ A;  4OO1 G;  3L0O A;  4GKK Q;  4LNQ A;  2DQ3 A;  1N36 Q;  4IPC A;  1HZB A;  4H2X B;  3CCL A;  1OTC A;  4H02 A;  5JJL A;  1VQA A;  2YTX A;  1Y1W G;  1JJC B;  1GD7 A;  5DLQ E;  4YRT A; 
#chains in the Genus database with same CATH topology
 4A3B B;  4WFN 3;  5LMN Q;  2JA5 H;  4IPG A;  3L2Z A;  1Y8P B;  4JBJ A;  2KQ3 A;  2R93 H;  2HIV A;  1FD7 D;  4BY7 G;  3LWU A;  2DZC A;  1F2Z A;  3H3V C;  3J80 L;  3G6J B;  2SNM A;  3I4N B;  4KK7 A;  4FNF A;  3REX A;  1WD1 A;  1UNS A;  1GUO A;  3DWP A;  4DXF A;  1B9N A;  2EYJ A;  5HUR A;  1I3Q H;  1BBW A;  1B3Q A;  4L8J A;  4OON A;  5LMN W;  2JK8 A;  2D0P A;  5FO8 B;  1PRT C;  4E6I A;  1AN8 A;  3PUV A;  4HJ5 A;  2UUB Q;  4HCS A;  2PQA A;  1PRT F;  2KCT A;  2LXJ A;  3NUC A;  4HID A;  1IYU A;  2Z8L A;  4A3D B;  1EL0 A;  3KF8 A;  4RKB A;  1B50 A;  3FPU B;  5C4X G;  1USY C;  2EJ9 A;  4EO4 A;  4UAI A;  4YRL A;  5KIX A;  4ID6 A;  2ID0 A;  1PZI D;  3PO2 B;  1STB A;  5C0X G;  3K5N A;  5M3F G;  3GTJ B;  5CV8 A;  3TP8 A;  1K8A C;  1Y1V H;  1BUV T;  2PNH A;  1ZXT A;  3URY A;  2IX0 A;  4LF8 L;  1HA6 A;  3CMQ A;  1TWG B;  2O4X A;  4DV6 L;  3Q23 A;  3NTI A;  2CQO A;  1SNC A;  4B3R L;  5FO9 B;  1YGB A;  3NWT A;  3NBH B;  4KN4 C;  3J81 L;  2A8E A;  4B3T L;  1GUS A;  1TU2 B;  4FXD A;  2ZIM A;  4OEL B;  4DV4 Q;  4PMB A;  2K32 A;  1ASZ A;  2X6L A;  2VZA A;  1Q86 C;  2EIF A;  3P20 A;  3A5Y A;  1X3Q A;  2ZZF A;  1NR4 A;  1QUQ A;  3VR2 A;  2WAQ B;  4LF5 L;  3GTK H;  4ZKB B;  4A3J G;  2XRS D;  1EIF A;  4YY3 Q;  2OWO A;  4ABN A;  2JA6 B;  1Z47 A;  4GLV B;  5IY0 A;  5H1S E;  4RA8 A;  5LMU L;  3S14 H;  1FGU A;  3HKZ B;  1Y69 U;  1NMF A;  4FF3 A;  4N8X 1;  4XYQ A;  5IT9 L;  3VYT A;  4XYO A;  3GTP B;  1K28 A;  1WNL A;  4OP0 A;  2RCF A;  3M4Q A;  3SGI A;  1O80 A;  1SE3 A;  1EYD A;  1IBM Q;  4AYB B;  1UUP A;  4F87 A;  2M00 A;  4RGO S;  2XGT A;  1Z9F A;  2RDF A;  4RH6 A;  1D1K A;  2QHT A;  1KLG D;  4A3I H;  4YRC A;  1HTP A;  1V8Q A;  4MN3 A;  5L37 A;  1CA5 A;  4ZTZ B;  1LTA D;  3VR5 A;  5C3X A;  1QZG A;  4X64 Q;  3I7F A;  1NR2 A;  1EEI D;  2HNI A;  2DN8 A;  1E7Z A;  2RDH A;  1B4O A;  5M3M H;  4BWA A;  1I94 Q;  3L1A A;  4PV1 C;  4BY1 G;  4KJO A;  5CGK A;  4G7Z C;  4IJL A;  3H0G H;  3GP7 A;  2FFK B;  1PRT D;  4OGQ C;  1S72 A;  2LXK A;  1BQQ T;  2VY3 A;  4JBW A;  4A93 B;  3PGZ A;  3ULP A;  2WKD A;  2DXT A;  1WOC A;  1HCZ A;  2B63 G;  1LTS D;  4MZ9 A;  1ONL A;  2K7V A;  3J7A 5;  2EPB A;  4LF7 Q;  2E64 A;  5E3I A;  4RG1 A;  2OTJ A;  4LK1 C;  3RUX A;  3J80 E;  1WCM B;  1HR0 L;  3RZD H;  2QF7 A;  5F2D A;  3G7L A;  4X5O A;  4PNY A;  4FF2 A;  1X32 A;  4XTY A;  1D5M C;  4IQZ A;  1A2U A;  5E3F A;  3DLL A;  4DR6 Q;  2B29 A;  5LL6 X;  4YRI A;  3S15 H;  2E41 A;  3RMH A;  5KYI A;  4XEO A;  4TTV A;  3F2B A;  3GTL H;  4WF2 A;  1QF6 A;  5IP9 H;  3EQL C;  2R92 G;  2RVL A;  1QNK A;  3I91 A;  5FLX L;  4A3L H;  1IKM A;  2HQE A;  3S1N B;  2B2Y A;  3FDT A;  3OMC A;  1YFR A;  4NPS A;  4CDE C;  4L6T B;  2UXC Q;  2NBF A;  2XN9 C;  2F1M A;  2DXU A;  2JA8 H;  2XVS A;  3TS0 A;  4O0A A;  4BBR H;  5I2X A;  4J1M A;  4JI2 L;  2E3C A;  1SRU A;  3KLW A;  2N55 A;  2OT2 A;  4PZ6 A;  4UPA A;  3VR4 A;  4FF4 A;  1EYG A;  4ZUI A;  5BN4 A;  2D0O A;  1B70 A;  4RKL A;  1V1P A;  3CMA A;  2KHS A;  3RGL A;  1ET6 A;  1B7Y A;  1VQF A;  1G29 1;  4HAE A;  4HSV A;  4DV7 Q;  3GTG H;  1BIB A;  2Q7E A;  1HFG A;  1F9R A;  2I5L X;  2E5A A;  1M8A A;  2B2W A;  2OEO A;  2BE5 C;  2OTL A;  4C56 C;  3IAL A;  2H4O A;  2B2W C;  1D1I A;  3OOC A;  4XTX A;  4ZQ3 A;  1CHQ D;  4LVK A;  2I4L A;  4A4I A;  3UDI A;  1CKN B;  2OCE A;  2AWN A;  1TS5 A;  1L1O B;  3HOY B;  1I4P A;  1YB3 A;  3RKX A;  1S5E D;  5CBE E;  1NMG A;  3S16 B;  1QIL A;  1W6K A;  4DNT B;  2VNU D;  1U0L A;  3TP6 A;  4YHH L;  1FYF A;  2WB1 G;  1VS0 A;  2VUM B;  4IFD G;  4LFB Q;  4RGN A;  3KLS A;  1IZ6 A;  1WTQ A;  1A8V A;  2YTY A;  4A3G H;  4FYD A;  3DM3 A;  3HRZ C;  2JSO A;  5LL6 S;  4G4K A;  1YNN C;  3MFG A;  4CGY B;  4KHP L;  2DKG A;  3MXU A;  3OWF A;  3A7L A;  2NVX B;  1N9W A;  5BR8 Q;  2M2L A;  5EPL A;  3TEH A;  3CU7 A;  2UXD L;  1YZ6 A;  2BOS A;  1JB3 A;  2HHH Q;  1SNQ A;  3U4V A;  2YU9 H;  1RTN A;  4HED A;  2V4D A;  3VQV A;  2K5D A;  4C3H G;  1XNQ L;  4LF6 L;  4Q15 A;  4H2V A;  4BWG B;  1TQO A;  4A3B H;  3JAM L;  1IXR A;  4KD4 A;  5JEA J;  4J15 A;  3Q22 A;  1SJE D;  1U4L A;  5IWA L;  2J0T D;  3K5M A;  4KR2 A;  3ERO A;  3U9O A;  1HNZ Q;  1JJ2 A;  5E7N A;  3U9S A;  1KAB A;  5EKK A;  3H3V I;  4KHV A;  1QB5 D;  1HNW L;  2R93 B;  4UHV A;  1S3O A;  1JJC A;  2DNC A;  1YHB A;  4R4C A;  1DZ1 A;  4HWO A;  1PLF A;  1VF7 A;  3NE5 B;  3PO3 G;  2UU9 Q;  3L3O C;  2NVQ B;  2LS0 1;  3CD6 A;  3S1R B;  2E76 C;  1PA6 A;  3CCM A;  2WFW A;  3H15 A;  1HTT A;  2VL6 A;  3BU2 A;  3OTO L;  4A3D H;  1JR0 D;  2ZR2 A;  4R4O A;  4JI3 L;  5TSS A;  1DGS A;  3I72 A;  4DR3 Q;  4RHR A;  1BBX C;  3M9B A;  4CKE A;  1HHV A;  3LC0 A;  4JBM A;  4HCE A;  3NET A;  4RWS C;  3PO2 H;  4DR7 Q;  4JYA L;  5CV7 A;  1TWG H;  1QJO A;  5HGQ A;  5M5W B;  4DV1 Q;  1RIQ A;  4L87 A;  1SN8 A;  1KOG A;  3HFZ B;  1J5E Q;  2F3V A;  1IBL Q;  4POG A;  1JIC A;  4KV6 A;  4X62 L;  4B3S Q;  2Z9H A;  2NZO A;  4OX9 Q;  1J9O A;  2ZCE A;  3VQX A;  1STN A;  2D2C C;  4C3I G;  4B9W A;  2MNA A;  1GJX A;  2EYH A;  4ODG A;  4ZIB A;  3E9H A;  4JI1 L;  4A3E G;  2KBN A;  1SYB A;  2CGH A;  4H13 C;  2Q2I A;  1DD2 A;  1YNN D;  1K0S A;  4XU0 A;  4XEM A;  4CDD C;  3J7Y W;  2BH8 A;  2EE1 A;  1ADY A;  3MZ5 A;  2MQH A;  5JVG 3;  3NBH A;  1PH7 A;  4IUQ A;  1VCI A;  1YJN A;  4LFC Q;  1KC8 C;  3CC4 A;  2NZ1 D;  4HJ8 A;  1SAP A;  3I4N G;  4DV0 Q;  2A69 C;  4PMW A;  1PH1 A;  2CIM A;  1PZK D;  5EPK A;  1NJI C;  2B3G A;  3CQZ H;  4NXM Q;  3HY0 A;  2ZR3 A;  3GTK B;  1R4Q B;  4IZ8 A;  1BBU A;  4N8F A;  1EY6 A;  3GTP H;  3TN2 A;  1QOH A;  4C1N I;  3A31 A;  3S14 B;  4MTK A;  3HOX H;  2MHV A;  3ERR A;  1HQM C;  2A6E C;  1J5W A;  4DV3 L;  4ULL A;  3TBI B;  1GGM A;  2KA7 A;  1NNH A;  3BJU A;  5CR3 A;  3MA2 B;  4OIK A;  4LF4 Q;  4OWX B;  4IPD A;  2ZT9 C;  5BN3 A;  3GQB A;  3A0J A;  3CME A;  2JA7 G;  2F0U A;  3J7A V;  5ELB A;  2FMM A;  1UE5 A;  3QB3 A;  1N32 Q;  4DR4 L;  1A3U A;  1EQR A;  1SE4 A;  1ZYR D;  5JVH 3;  5IOC A;  4XQN A;  1E22 A;  3UGT A;  3M7G A;  4YRM A;  3M4O B;  1H9K A;  3KLR A;  2KUM A;  1ILQ A;  3N6R A;  4P72 A;  2F0L A;  2AMC B;  5AJ3 Q;  1HPC A;  2E1H A;  3VR3 A;  3JAM E;  4A93 H;  1FGB D;  1HUN A;  2K14 A;  2DVE A;  2CJ9 A;  1L0Y B;  5M3M B;  2DGY A;  3CCE A;  2M9V A;  1RD9 D;  4G85 A;  3RF1 A;  3I70 A;  1UAP A;  3ICA A;  5IYB H;  4X66 L;  2ICE C;  1WCM H;  3FEW X;  1WTW A;  1X3E A;  2B2T A;  4DU9 A;  4LUO A;  5M9O A;  2ZZG A;  4TVW A;  3W3S A;  1XMQ L;  3I73 A;  1O7Y A;  2CWP A;  2PZT A;  4AQY Q;  1C9O A;  1AFP A;  1A62 A;  2VQE Q;  5FLM G;  1VQZ A;  2JA6 G;  2XRQ D;  4QIW B;  4YCV A;  4R4I A;  1LTL A;  1N33 Q;  3MWY W;  3HKZ G;  3A74 A;  3LGJ A;  3ND9 A;  4WJ4 A;  4ZLT F;  2UUA L;  1EIH A;  1IHZ A;  2BDO A;  1GUN A;  3R93 A;  1W2B A;  1STG A;  3J81 j;  3PSI A;  4QL5 A;  3S1N H;  3L4G B;  4YRN A;  1GOZ A;  5JOB A;  1N8R C;  1UEA B;  3BFM A;  1H4Q A;  4X6A H;  4G84 A;  2DU5 A;  4CDC C;  1A15 A;  1MD2 D;  1H4T A;  1PH5 A;  4XTW A;  4DUZ L;  1EWH A;  4MTN A;  1VQ5 A;  3I56 A;  1FNU A;  1V1Q A;  3K7A B;  4ME5 A;  2UUC L;  2IY5 A;  4XQQ A;  4A3M G;  1X3P A;  3TS2 A;  1YFT A;  1QE0 A;  3CW2 C;  4H2W A;  3BYT B;  3RLF A;  4JI6 L;  4WI1 A;  4EQO A;  3EVQ A;  2F0P A;  2F0N A;  4A3K B;  2C7I A;  2KVM A;  4L5T A;  5GAD C;  1KIX A;  2ZXR A;  2Q8T A;  2VB3 X;  1YNJ C;  1V43 A;  1JC7 A;  3SXH A;  1DJR D;  4KKT A;  3GV3 A;  4ILW A;  5IGC A;  1XNR L;  1WTO A;  3HOW B;  2ZNJ A;  4IUP A;  1DXM A;  4ALP A;  4CS4 A;  4OHJ A;  2X6G A;  3FP9 A;  3HOY H;  3BS1 A;  1SDF A;  4DV5 L;  2DZ9 A;  4HIK A;  1ATI A;  4OXP A;  3S16 H;  2F0T A;  4JPB W;  1PHJ A;  1AE3 A;  2DDZ A;  4CBV A;  2VUM H;  1OO9 B;  4LF9 L;  1SYG A;  2DY7 A;  1VQI A;  2ZM6 L;  1I6H H;  4X3K A;  1KRT A;  1TR5 A;  2Q2T A;  1K8O A;  1CZW A;  1YVC A;  1S4Z A;  3FPP A;  4I7A A;  3UH0 A;  5KNN A;  2ZT8 A;  4DAV A;  3T1Y L;  3RUZ A;  3KBX A;  4A3F G;  3GTO B;  1CKN A;  3MEH A;  3D31 A;  4AIM A;  4P3O A;  1L1O A;  2E5L L;  2MPM A;  1G6P A;  5IGF A;  5EJW A;  3SK8 A;  1IBK Q;  3K5L A;  1Q82 C;  1Z7M A;  2NVX H;  5K36 H;  3AMU A;  2F0G A;  4HWP A;  2RHQ B;  4YRF A;  1VMC A;  3F1Z A;  1A3V A;  2F0W A;  2ZJP A;  4IAL A;  4BS9 A;  1XPR A;  4JI0 L;  1T5X D;  1R4P B;  3CXC A;  3P8V A;  4YYE A;  2N78 A;  5C3E H;  2N88 A;  2ZXO A;  4L5R C;  2R7Z B;  1SYE A;  4YCW A;  2L9H A;  3UDG A;  4LFA L;  2A68 D;  2EAY A;  1J6Q A;  1XPO A;  1CHP D;  4K5V A;  3PUW A;  2PW5 A;  2YU9 B;  1NE3 A;  4O2D A;  2DJF C;  3J80 c;  1TY2 A;  1FJG L;  3NBI A;  2EYM A;  2LFN A;  2DUD A;  2Q8R E;  3QG1 A;  2Q7H A;  4POF A;  3QIA A;  1BKB A;  5IGD A;  1DYQ A;  4LNS A;  1JE5 A;  2B39 A;  1A0I A;  1XMO Q;  3ERS X;  3H3V H;  4K0K Q;  1LTB D;  2FMC A;  3K0Y A;  2NVQ H;  4MNO A;  2KJX A;  2J7Z A;  3VQY A;  4DR5 Q;  3S1R H;  1CKM A;  1JWS D;  3G48 A;  1TS2 A;  4DNI A;  2P0L A;  2QKI C;  2PMZ E;  1L2F A;  2EJF A;  1AZQ A;  4GKK L;  3ND8 A;  1YNJ D;  4CKB A;  1I4R A;  3HOV H;  4KQE A;  4OL7 A;  3N52 A;  2WB1 E;  4A3C G;  2EJF C;  3NSW A;  1SSO A;  1SMY C;  2KOL A;  1G5H A;  4YRJ A;  4UP9 A;  3PIP A;  1DCZ A;  4K2L A;  4DR2 Q;  1E1O A;  4LVI A;  3D0F A;  1MSG A;  5M5W H;  3S2H B;  3MHB A;  4FXK C;  3QO7 A;  2QHV A;  1DON A;  2ZT6 A;  4CJ2 C;  1XPU A;  3VDY A;  2Z1C A;  3J80 i;  3M85 A;  1QVC A;  2ODR D;  1NJ1 A;  4TVA B;  4JW0 A;  3CCS A;  1EOV A;  5LMN L;  1LTT D;  1WTV A;  1EVK A;  1CTM A;  3HOZ H;  2QDB A;  1I4X A;  1PH2 A;  1VQ4 A;  2I46 A;  2JP1 A;  5EGT A;  4PMC A;  4GZY C;  2EZV A;  1JB7 A;  4QGU A;  3AEV A;  1HZA A;  4BXX H;  4F88 A;  3HFZ A;  5ISR A;  3FVQ A;  2HQL A;  2DQ0 A;  1LT3 D;  4K5W A;  2B8G A;  2Q2U A;  1XYI A;  1MI2 A;  1X3F A;  2I4O A;  4GN5 A;  3HFV A;  1EU3 A;  1LV9 A;  4GNX B;  4DK0 A;  3MF2 A;  2ZZE A;  3T56 B;  2JA5 G;  1ML0 D;  3OIQ A;  4DN4 M;  4C3J B;  5JEA H;  2J3L A;  2R93 G;  2UUB L;  2A73 B;  5DM7 3;  1PTO B;  4GN4 B;  1JOQ A;  4TKO B;  3CCV A;  1WTR A;  2PNR C;  4JOI A;  1KLU D;  1SNP A;  3PIO 3;  2AHO B;  1KQS A;  3CQZ B;  1S5B D;  2RCN A;  5GAE C;  1D5X C;  1M90 C;  4BBS B;  1JJG A;  4DAY B;  4K14 A;  2ALY B;  2K52 A;  1BNZ A;  4TWA A;  1EY9 A;  1L0X B;  4B9X A;  1YHA A;  3KF6 B;  1EQV A;  3MF1 A;  5KGU A;  2RHS A;  3HOX B;  1U4M A;  2TSS A;  4XDX A;  2VQF L;  3HRI A;  3X3N A;  2B2V A;  2K01 A;  3VBB A;  1VQG A;  1LTR D;  1N34 Q;  4RQE A;  3P7J A;  3PF5 A;  3HGB A;  2LY7 A;  1I5F A;  1HQR D;  3M4O H;  5I2Y A;  4DV4 L;  1Z6H A;  3VA7 A;  4V19 0;  3AQQ A;  4WJ3 M;  1F2M A;  5C44 B;  3FHW A;  5ELF A;  4B08 A;  1Y1V G;  2WV6 D;  3TME A;  3OIP A;  5C52 B;  2GA4 B;  1SRO A;  4FF1 A;  5EKL A;  2EVB A;  2FIN B;  4JI8 L;  5J22 A;  2TMP A;  1SMY D;  2DTO A;  4YY3 L;  3UDX A;  1EY4 A;  3W3A A;  1WI5 A;  2C5C A;  3T1H L;  2FYK A;  2ES2 A;  4JV5 Q;  2ZTD A;  2AMC A;  1CQV A;  3C1E A;  2ART A;  3HP3 A;  1FR3 A;  1GHJ A;  2DY8 A;  3X3M A;  1XX8 A;  1NJ6 A;  1IBM L;  2K5Q A;  4PZ8 A;  1CSP A;  2QHS A;  1UE6 A;  4XTC S;  4JC0 A;  3K58 A;  4G57 A;  2Q5H A;  2NWG A;  4FP5 D;  4H2Y A;  1OXS C;  1ET9 A;  4LUZ A;  1CT1 D;  4RCO A;  4QF4 A;  1RF2 D;  1K73 C;  1GM5 A;  3S17 H;  4ZKC B;  5J3B A;  2FJ2 A;  4X64 L;  1SNO A;  4MIU A;  1STY A;  3I4O A;  1IW7 D;  2K5V A;  2K6A A;  1JT8 A;  4HWT A;  2L4N A;  1I94 L;  3RKY A;  1Z7N A;  2LSS A;  1W6J A;  3S9W A;  5IOD A;  1K9M C;  2NN6 I;  3K7A H;  1O7Z A;  5FJ8 H;  4ZUJ A;  1HTL D;  2B2Y C;  2QDL A;  2ZTC A;  3L4G A;  2RDG A;  2O5J C;  1VQ7 A;  1Q81 C;  4G7O C;  1MIU A;  3QOJ A;  2JA9 A;  5FKA C;  1CI3 M;  4A3I G;  4A3K H;  4LF7 L;  3A56 A;  3DWQ A;  4DF7 A;  2ATW A;  3D4R A;  4KY6 A;  2F0D A;  1PH8 A;  3TDQ A;  1SE2 A;  4WRD A;  5ELC A;  3VYR A;  1YI2 A;  3J81 E;  1MBY A;  2F4V Q;  2F3I A;  1XJV A;  3M4P A;  5IGE A;  2PME A;  1AP0 A;  3M7N A;  3MVV A;  5M3M G;  2CKZ B;  3GV6 A;  4XIG S;  3Q0A A;  1KL9 A;  4GOP B;  4DV2 Q;  3PUX A;  3H0G G;  3HOW H;  3GTQ B;  2E2H B;  4QUF A;  4Y52 H;  1HC7 A;  4OO1 I;  4JCV E;  4DR6 L;  4YHH Q;  2IJ0 A;  1BR9 A;  5AFW A;  3J7Z C;  1RTO A;  2MJ8 A;  1HNX Q;  4DK1 A;  5A35 A;  2MGS A;  2IX1 A;  4H2U A;  1HXD A;  2ZXF A;  3G6E A;  3BDL A;  1JOO A;  1JWU D;  2UXC L;  3VA5 A;  1BO0 A;  3LNN A;  1ADJ A;  5IT9 E;  5IP7 H;  2AKW B;  3HKZ E;  4DKA C;  1VQO A;  1RJT A;  3GTO H;  1X3G A;  2Z4H A;  4H0L C;  4KY5 A;  1Y1W B;  3AFQ A;  3DEP A;  4RHS A;  2HCI A;  4GS3 A;  3WWV A;  1TWF B;  2ZIO A;  1I6H B;  1F9P A;  3IG2 A;  4DAM A;  4DNR B;  1CUK A;  3EA6 A;  3QNE A;  4P73 A;  2BDN A;  2F0O A;  5IP9 G;  3QR8 A;  1SR3 A;  1D7Q A;  4B3M Q;  1G2T A;  4CH4 A;  1BXT A;  4Q6G A;  4A3L G;  4BY7 B;  1LM0 A;  2KED A;  1BCP B;  4DV7 L;  1ROD A;  3PCO B;  3H09 A;  5FJ8 G;  3V7S A;  2Y0S B;  5COR A;  2JA8 G;  1SET A;  2R7Z H;  4NCX A;  1ENC A;  1OXV A;  3JAM c;  1Z7T A;  4BBR G;  4R4Q A;  4NB3 A;  1IL2 A;  1G8Z D;  4YRP A;  1FNV A;  1XXG A;  3IAY A;  5KNB A;  3KOJ A;  5C3E B;  4KKU A;  1P8L A;  1PMR A;  1MGS A;  1YEZ A;  3OMG A;  3DSQ A;  3L7Z C;  3S1M H;  3F2U A;  4ZRZ A;  2C9O A;  1DOL A;  3MC0 B;  2EYL A;  1LAB A;  3PUY A;  4NXN Q;  5C4X B;  4RQF A;  5BN5 A;  3P8T A;  2F0Q A;  4LFB L;  3HXY A;  5JJZ A;  5C0X I;  1ICW A;  4QJF A;  3HRK A;  4H2X A;  1TT2 A;  4OLF A;  2ZTE A;  3K6O A;  1L0W A;  1GUW A;  4JI3 Q;  1LO5 D;  1QWY A;  3I8Z A;  3E9I A;  1AW7 A;  1V9P A;  2NB0 A;  3MEY A;  1B3A A;  3OW2 A;  1VQ8 A;  1ZYR C;  2F3W A;  4P75 A;  2B8F A;  1SFO H;  4DPG A;  1TS3 A;  3T51 B;  1KNE A;  5I9P A;  4IOA A;  1C8C A;  4LVM A;  1E2W A;  1TVX A;  2JEA I;  5BR8 L;  1ENA A;  1K83 B;  1F2Y A;  5FLX E;  2AQ2 B;  2MO1 A;  3JAM i;  4GKJ Q;  2F0V A;  2SEB D;  2HHH L;  1HFN A;  1BDO A;  3HOV B;  4JBK A;  1PRT B;  1GUT A;  3S2H H;  4A3G G;  3FJP A;  1SER A;  2PMF A;  4IJH A;  1HRJ A;  1S5F D;  3HKS A;  1KAA A;  2PI2 A;  5DNF A;  3KJO A;  3RKW A;  4A3J B;  5HY6 A;  5EPJ A;  3MXG A;  5C5L A;  4CH3 A;  2F0S A;  4KN7 C;  2R7Z G;  3E0J A;  1AH9 A;  11AS A;  4GLX A;  2D62 A;  4HN7 A;  1HNZ L;  4O1N A;  3UE0 A;  3REU A;  2Q8I B;  1PXU A;  1SNM A;  2C8M A;  4DUY Q;  3HOZ B;  1DOM A;  4NDX A;  4EVO A;  1X2G A;  2K04 A;  4TQU S;  2L5T A;  1OXX K;  4TVA A;  5C5M A;  2UU9 L;  1S40 A;  2CWA A;  4X65 Q;  1SES A;  4A3B G;  4RCN A;  4PZ7 A;  1QVG A;  3OPO A;  4C3J H;  5CBA E;  1NUC A;  4FDB A;  4IUN A;  1EEF D;  4DR1 Q;  3A8I E;  1LTI D;  3K57 A;  2E75 C;  3LSQ A;  1PTO H;  2K5N A;  2DEQ A;  1GKH A;  2K75 A;  1H9M A;  2ENB A;  4K6L A;  4DR3 L;  2YTV A;  5EBC A;  4QY7 A;  1RCV D;  2UXB Q;  3R2I A;  4DR7 L;  3C1F A;  1NSN S;  3NTH A;  4BBS H;  5GQO A;  3CCU A;  4GNX A;  1FVI A;  1HH2 P;  1NYR A;  2K03 A;  1WLE A;  4DV1 L;  4P74 A;  4WOR A;  3HOU H;  2B63 B;  1J5E L;  1TWA H;  4P3N A;  2E2D C;  4K5X A;  1IBL L;  5D65 A;  2Q5I A;  5IYD H;  1II3 A;  4B3S L;  3NHH A;  2KCC A;  2QHU A;  4K88 A;  4CDF C;  4OWW B;  4IFD J;  4A3D G;  5T1G A;  1WQW A;  3PQI A;  1X55 A;  3H91 A;  3EBE A;  1KMM A;  5ELE A;  5J1Z A;  5C44 H;  2PO4 A;  3VYS A;  4DAY A;  3PO2 G;  3QO5 A;  2RF4 A;  2ALY A;  5JPM C;  2GN5 A;  4JI5 Q;  3KF6 A;  2JQO A;  4QUC A;  3I4M H;  1YNX A;  3MXN B;  5C4J H;  4RGM A;  2ICI A;  3MTS A;  4RDX A;  4DK6 C;  4HMJ A;  4WJW A;  3BZD B;  2OF1 A;  4LFC L;  2OQ0 A;  3KBG A;  3SDZ A;  4XT1 B;  2HIX A;  2E2J B;  4DV0 L;  2PYK A;  4X3U A;  3K8A A;  3RN5 A;  4R8N A;  1EY0 A;  2KCM A;  3AYH B;  4DA2 A;  4P72 C;  4R9W A;  1C0A A;  4FVM A;  3AFP A;  4NXM L;  4TSS A;  3V2T A;  5COY A;  2PW7 A;  5DM6 3;  2DNE A;  3RL6 A;  3CP0 A;  2OXP A;  5NUC A;  4IPH A;  1VQN A;  2EWN A;  3A7R A;  2L12 A;  1MKH A;  1WTH A;  4NW2 A;  2QA4 A;  2ZTG A;  4YRO A;  2WAQ G;  3S2D B;  3FKI H;  1ESF A;  1TWH B;  2B2T C;  3K0X A;  4LF4 L;  4JG2 A;  5HGT A;  3UE1 A;  4JI4 Q;  2QIL A;  5ELN A;  3WOF A;  2XWB B;  3D3R A;  4YCU A;  1WQ7 A;  1CA6 A;  2A6H D;  2QGQ A;  4JI7 Q;  4RGT A;  4YRE A;  4YRS A;  3S1Q B;  3F2C A;  2A68 C;  4LJZ C;  1CZG A;  4QCL A;  4QB4 A;  1U4R A;  3OSO A;  3FRP B;  3HOX G;  3SK4 A;  4AYB G;  4P2C B;  4KI0 A;  2NN6 H;  2EQS A;  4YIJ A;  3DWA A;  5AJ3 L;  1QNU A;  3S17 B;  2H5X A;  4L5S A;  12AS A;  2VXW A;  1JOK A;  4YWM A;  3EFX D;  3A7U A;  2MP1 A;  2PMZ B;  2YYZ A;  3K81 C;  3HY1 A;  5JJK A;  1SND A;  1IL8 A;  1KAW A;  4HJA A;  4IFD I;  1C4Q A;  3PMF A;  2WII B;  3IFD A;  5FOB B;  1VQC A;  1YIT A;  4CH6 A;  2L0C A;  3TRE A;  2IPK D;  3RAC A;  1H9R A;  1UE7 A;  2CJA A;  2G5D A;  4AQY L;  2FXQ A;  5E1F A;  3GTQ H;  2E2H H;  2CW0 C;  2X69 A;  5IYC H;  2VQE L;  3R07 A;  1N33 L;  4OO1 H;  4A93 G;  1B70 B;  2IT1 A;  2LMC B;  1EIY B;  1PTO D;  5KND A;  1J8I A;  1UE1 A;  4N9P A;  1VQL A;  2CH4 W;  3PV0 A;  3G1Z A;  1NJ5 A;  3V7C A;  5IYB G;  2EJM A;  1WCM G;  2WKC A;  3OYY A;  1LT5 D;  4KY7 A;  1VQB A;  2VB2 X;  4IUV A;  4L5Q A;  4CH5 A;  1MJC A;  2HCC A;  3QTC A;  2K5H A;  2NVY H;  4CJ0 B;  2I07 B;  1SYF A;  2EXD A;  4KMU C;  4C3H B;  2KHJ A;  1Y1W H;  3STB D;  2ODR C;  1E2V A;  4GN3 B;  1TWF H;  2IL8 A;  2EJG A;  3QOL A;  3A5Z B;  2C35 B;  3D4W A;  3NTK A;  5D3I B;  2EJG C;  5CC4 A;  2I0Q A;  5M5X B;  4KHZ A;  4ZYS A;  4BY7 H;  4HTH A;  4YRG A;  1EFW A;  3K5O A;  1LTG D;  1GHK A;  2XTI A;  4JK1 C;  3RLO A;  1L1O C;  2AKW A;  3BZK A;  3F2D A;  4L63 B;  1I4H A;  2F52 A;  2EOT A;  1WYD A;  1WD0 A;  4LVL A;  2JJQ A;  1O7I A;  4HJ9 A;  1KNA A;  5GAH C;  1BVS A;  4IUU A;  3EFR A;  4XU2 A;  2L1B A;  1PFB A;  2E65 A;  3EFS A;  1D5Z C;  1QE6 A;  2NVT B;  3TEG A;  2K33 A;  2EY6 A;  1VQ9 A;  1STH A;  3BYY B;  3P8Y A;  2RQX A;  1NCV A;  1T9H A;  3PCO A;  4LAA A;  4NP5 A;  5C4X H;  1MJE A;  1G6Z A;  1PYB A;  4HA8 A;  1K8M A;  3B6Y A;  1I6V C;  4RFB A;  4ZK9 B;  5M3F H;  2AUK A;  4AH6 A;  1PFN A;  3CCR A;  3S1M B;  2CJB A;  1SMX A;  2QEX A;  4I7Z C;  3ICE A;  1PH6 A;  3RN2 A;  2XIW A;  1TS4 A;  2QW7 A;  3A54 A;  3W2D A;  1IBK L;  4DAP A;  3HOY G;  1V1O A;  2RKS A;  3P1H A;  2K1B A;  2GVA A;  4EQN A;  4QIW E;  5DAU A;  1B9M A;  4C3I B;  1QZH A;  1NJ2 A;  1EZ6 A;  1X54 A;  1K83 H;  4P71 A;  2CW0 D;  4XT3 B;  2VUM G;  4A3E B;  2HT1 A;  4P71 C;  2XNA C;  1SFO B;  1G5I A;  4LF8 Q;  3TZU A;  1B53 A;  2F0K A;  4DV6 Q;  1N36 L;  1PYW D;  2A74 C;  5EKI A;  3J7A F;  2CHB D;  3GTM B;  4A3J H;  1VQJ A;  2K05 A;  3TQY A;  3OHX C;  5KEE A;  2PPB C;  4B3R Q;  1EQQ A;  4HWS A;  3PZC A;  1GVP A;  4B3T Q;  5K36 G;  1B2T A;  2Y0S G;  3J81 c;  3W5O A;  3A8K E;  5A2Q L;  3CF5 A;  3E3X A;  5FK9 C;  1PYS B;  1Q12 A;  2AWO A;  3TP5 A;  1RKN A;  1JCK B;  1WTP A;  1W3S A;  2PCF B;  3HXU A;  4K86 A;  1XMO L;  2I4M A;  3HXW A;  5C3E G;  4CS2 A;  3DM1 A;  4K0K L;  1USY A;  3KK7 A;  5CYU A;  4LF5 Q;  3D8G A;  3RIR A;  4DR5 L;  5IE8 A;  1B1Z A;  5JAV A;  3M3Y B;  2O2L D;  1PDQ A;  4TRD A;  5LMU Q;  2E2I H;  2JN4 A;  2JA7 B;  4H7B A;  4K6D A;  1EOT A;  1IW7 C;  4EQP A;  2ZJR A;  2WAC A;  2RSO A;  4V0B A;  1PH9 A;  1KRS A;  4MHE A;  5IT9 c;  1BIA A;  3A32 A;  1D6E C;  4HWR A;  2ZGW A;  4BY1 H;  4C1N K;  4ZCK A;  2ZT5 A;  2EY2 A;  2VQF Q;  3OW7 A;  5F5W A;  3OWE B;  4DR2 L;  2VW9 A;  1GO3 E;  3CCJ A;  3ER0 A;  2AQ1 B;  2R3Z A;  2B63 H;  3KUP A;  4DK3 C;  1X9N A;  3J81 i;  1TWC H;  1BCP D;  5CV6 A;  1PVO A;  4JOI C;  3IKM B;  1VQD A;  2WIN B;  4QQB X;  3HOV G;  4S3S A;  4M8A A;  4F7X A;  1EYC A;  1WVL A;  3HOU B;  1TWA B;  2N3S A;  1VQP A;  2F0H A;  2KEC A;  2ZNI A;  4XU3 A;  3SK6 A;  4JI8 Q;  1PH4 A;  2P5Z X;  2DJZ A;  3HXZ A;  3KDF B;  3NWS A;  3T53 B;  4XQJ A;  4J6H A;  4NMZ A;  1VQE A;  1NNX A;  1E24 A;  3IKL A;  2JE6 I;  3JC6 6;  2IW3 A;  4YWK A;  4FXG C;  2BA0 A;  2L55 A;  3T1H Q;  3Q6S A;  2B2V C;  3BDC A;  5G3L F;  4HJ7 A;  3UGQ A;  2Q2H A;  5E4X A;  5ELD A;  1KDA A;  2J4X A;  1LLR D;  2R92 H;  1K3B C;  3IRB A;  3HG9 A;  1RIP A;  2E2J H;  4U67 3;  4HIO A;  5J39 A;  1HR0 Q;  3I4M B;  3HOZ G;  2XWJ B;  5C4J B;  1UWV A;  4IUT A;  3V96 A;  3V8L A;  3U4Z A;  1VF5 C;  3OD1 A;  5LHY 1;  4BXX G;  3MXN A;  4O42 A;  2NTT A;  3CRK C;  3ULL A;  1CFM A;  5C4H A;  4A3M B;  3S2D H;  3C2P A;  3R2T A;  3HXV A;  1TWH H;  2O5I C;  4XTV A;  1PZJ D;  3S24 A;  1RL2 A;  5K1P A;  1H95 A;  1F9S A;  3F8T A;  1XTC D;  1H9S B;  5JEA G;  5FLX c;  3H94 A;  3UDF A;  1HR0 W;  1EY7 A;  2E8G A;  4BW9 A;  2A5H A;  3KLS X;  2Z6B A;  1T5E A;  2FHT A;  4DGZ A;  1X01 A;  3FKI B;  3LWE A;  4QMG A;  1N34 L;  4RMF A;  1Q3L A;  1WU7 A;  3S1Q H;  1H4S A;  4ME3 A;  4JI2 Q;  2PI2 E;  3BVM A;  1VDZ A;  2NTS A;  3R8B A;  1A6X A;  1HA5 A;  2HDM A;  2IWH A;  1Q90 A;  3K59 A;  1ZKO A;  3NQT A;  5CV9 A;  3TRZ A;  1K8G A;  1EWI A;  2IHF A;  3ERQ A;  5A2Q E;  1YFS A;  3RZO B;  1EWC A;  3CC7 A;  1HXY D;  5M5Y B;  2J3M A;  4Y7N B;  4CKC A;  4IFD H;  3BVG A;  1U9R A;  4JV5 L;  4LVJ A;  4PG3 A;  1A63 A;  1KTK A;  3K7U C;  2IY5 B;  4A3F B;  1VQM A;  3TSS A;  1VQH A;  5C0X J;  2PZW A;  4HVC A;  3RLN A;  1E3P A;  5ELO A;  1I4Q A;  2EYO A;  5E4W C;  4DQ2 A;  4PQX A;  1M4V A;  4XU1 A;  2R6G A;  4LWC A;  3G71 A;  3NXW A;  1FNW A;  2PZU A;  2IX3 A;  3A7A B;  1TXY A;  3CKI B;  5C3W A;  1DOK A;  5G3L D;  2A8V A;  2EY1 A;  1K0R A;  4C3H H;  1QCB D;  2L15 A;  3NEM A;  4R8I A;  4KD3 A;  2SDF A;  2Z0S A;  1EVL A;  3GDE A;  3IKJ A;  1EIY A;  2WAQ E;  1KD1 C;  1G91 A;  2SOB A;  2RA4 A;  3L2P A;  4KHP Q;  2DU7 A;  1CQF A;  1SYC A;  1SEB D;  3W1B A;  2EYP A;  2NVY B;  1NBW A;  3V8J A;  4Z9C B;  3HS0 C;  2P5I A;  1RDP D;  5M5X H;  3K80 C;  3T16 A;  4IO9 A;  1WJJ A;  4XXE A;  3NK9 A;  1EY8 A;  1X56 A;  2UXD Q;  1KXL A;  2CH4 A;  4NKL A;  1EYA A;  4C2M B;  4YPF A;  1X65 A;  2R61 A;  2F4V L;  1I50 B;  1SE8 A;  2DJG C;  1XNQ Q;  4AYB E;  4PHC A;  4P73 C;  2A19 A;  4KKS A;  1PH3 A;  4LF6 Q;  3PO3 H;  2KEN A;  3A5Z A;  3ZJY C;  1OXT A;  4DV2 L;  1P16 A;  1EFI D;  1LYL A;  2JXM B;  5IWA Q;  2NVT H;  2R7D A;  1R9T H;  4Q0F A;  5EQ0 A;  1G51 A;  4A3K G;  2K28 A;  4TQF A;  1EQT A;  1HNX L;  3C3L A;  5C53 B;  3DHQ A;  4HMI A;  2Z4I A;  4K2K A;  2I5H A;  2RHQ A;  1CK1 A;  1BF4 A;  1EIG A;  1YBY A;  4ZTU B;  1TKW B;  1HNW Q;  2CCZ A;  3M4Y A;  1UEB A;  1PV4 A;  1ESR A;  2F03 A;  4UP7 A;  3HOW G;  1WPY A;  1RHP A;  4R1J A;  5M3F B;  3TZD A;  4H2S A;  3OTO Q;  3U58 A;  4C3I H;  4JVZ A;  3DXJ C;  4HSP A;  1JOR A;  4Q5V A;  4ZAI A;  1Q7Y C;  2EY5 A;  4B3M L;  2BH2 A;  2F0E A;  1SXT A;  4OIJ A;  1Y14 B;  1NYQ A;  1E1T A;  4A3E H;  3ITP A;  1SRY A;  3QWN A;  4JYA Q;  3MFY A;  3V7R A;  5K5P A;  4P75 C;  2KHI A;  5IP7 G;  3QO8 A;  4TQD A;  2ARS A;  3WOE A;  5CV5 A;  3GTM H;  2NYZ D;  4X62 Q;  2EYF A;  4KR3 A;  4IOC A;  3MAQ A;  4UP8 A;  4RAU C;  3I4N H;  2JA5 B;  3E0E A;  1I4G A;  1IYV A;  3BZC A;  5CMD A;  4E51 A;  1WFQ A;  4YDQ A;  2YV5 A;  2G4C A;  3V8K A;  4JI1 Q;  2PQA B;  4YP0 A;  4NXN L;  2JYO A;  3PIP 3;  3KF8 B;  1O7L A;  1TII D;  4DFA A;  4U68 A;  2K5W A;  3PF4 A;  3NEL A;  4HR7 B;  2BE5 D;  1STE A;  1B8A A;  1I3Q B;  1B44 D;  3AB9 A;  3IFT A;  3M3Y H;  2EL9 A;  1F9Q A;  2A6H C;  2JA7 H;  1S5D D;  1PYS A;  4OWT B;  3GTJ H;  3KFU A;  2MUY A;  4OEM B;  2N49 A;  1JQY D;  1ENF A;  3CPW A;  1QVF A;  4CS3 A;  1IKL A;  2Z6K A;  1C7Y A;  1KDC A;  3D4D A;  1HJP A;  3KYH C;  1AZP A;  3BVZ A;  4IUR A;  5I6W A;  3Q24 A;  2D9U A;  2E2I B;  4GKJ L;  1VMP A;  2Z6K C;  3AU7 A;  1B76 A;  3O13 A;  4X3T A;  2MO0 A;  3I4L A;  3HEJ A;  1Y1V B;  5GRO A;  4DV3 Q;  2E10 A;  3LX0 A;  1X6O A;  4LMQ D;  4H44 C;  2IHE A;  3CPF A;  4K8J A;  4LW1 A;  1EZ8 A;  2GVB A;  1IYJ B;  5KYL A;  3KJP A;  4BY1 B;  3EJI A;  3NQI A;  2K4K A;  1QUQ B;  2V1C C;  3RR5 A;  5IIF A;  1X2H A;  3UFG A;  3UI2 A;  3I55 A;  1XTD A;  4DR4 Q;  1WTX A;  1Q46 A;  4I65 A;  1PFM A;  5JJI A;  4FO2 A;  2E74 C;  3NEN A;  1CSQ A;  5IGG A;  4GNX C;  2DTI A;  4BA1 I;  2F0J A;  1TWC B;  3LSS A;  4BA2 I;  3HZX A;  3Q8D A;  4HIM A;  4P74 C;  2I4N A;  4OX9 L;  3CC2 A;  3VYU A;  3QO2 A;  5FLM H;  2ASB A;  2JA6 H;  4P3P A;  3FMC A;  4DUY L;  1GXD C;  1PTO C;  1STA A;  3PIO A;  3MXP A;  2Q7G A;  1D8L A;  1PTO F;  3L9A X;  2RHS B;  1Q8I A;  2ZJQ A;  2K50 A;  4TVY A;  2Y0S E;  4X65 L;  1VQ6 A;  4XTZ A;  1XWE A;  1NJ8 A;  4X66 Q;  1K3R A;  4DR1 L;  3EN2 A;  1Y8O B;  2VS1 A;  3NP8 A;  1O78 A;  4HT4 A;  3KDF A;  1XMQ Q;  2R92 B;  3STB C;  2JEB I;  3D6W A;  5I4D A;  5KRU A;  1FL0 A;  2UXB L;  3CRL C;  4A76 A;  1KDB A;  2NZH A;  1SBB B;  2CFM A;  3C46 A;  2ZIN A;  4EGV A;  2I5M X;  4A3M H;  5T1I A;  1NY4 A;  2UUA Q;  4YRQ A;  1HZ9 A;  3VR6 A;  3U50 C;  1W66 A;  1LUZ A;  4A3I B;  4C3J G;  2EDG A;  3E6Z X;  4K8I A;  2SNS A;  1JWM D;  5EBD A;  4K87 A;  5CV4 A;  3SVM A;  3GD7 A;  1ZEQ X;  3DEO A;  2RSN A;  4A75 A;  1ILP A;  4G7H C;  1JE4 A;  4DUZ Q;  3QJY A;  1AEX A;  1PFS A;  2CQA A;  2H1E A;  1N32 L;  2UUC Q;  4KTA A;  3H0G B;  2L11 A;  4BBS G;  4YWL A;  4X3S A;  4JI5 L;  2BA1 A;  4KJN A;  3A5U A;  1NTG A;  3DMU A;  1EUJ A;  1H9S A;  4JI6 Q;  3HOU G;  1TY0 A;  5JPN C;  5KNC A;  4UY8 C;  5IYD G;  2PQE A;  2RBM A;  3RZO H;  4H2T A;  2G9H D;  5M5Y H;  3WDN A;  2B2U A;  4Y7N H;  1SJH D;  1OXU A;  4KLK A;  5D3D A;  1YJW A;  1LT4 D;  4EX5 A;  1QG7 A;  1VQK A;  4LUV A;  3RZD B;  4EQ5 A;  2B2U C;  2AQ3 B;  3EIV A;  2MFI A;  4UDU C;  3HTZ A;  1XNR Q;  1E0B A;  5C44 G;  5K1X A;  4A3F H;  3BDO A;  2XSC A;  1MHW C;  2WB1 B;  4IN3 A;  2F0F A;  1KMN A;  1BOS A;  3I4M G;  3S15 B;  3ZYY X;  3A55 A;  4YRK A;  4M1U B;  4DV5 Q;  3I90 A;  3GTL B;  1CM9 A;  3NPP A;  1KHI A;  2F0I A;  1U4P A;  4YRR A;  3T4A C;  2QCP X;  4JI4 L;  3CHB D;  5D14 A;  4LF9 Q;  2CVR A;  1V1P B;  1C48 A;  2ZM6 Q;  2A69 D;  3D6C A;  1B7Y B;  1E2Z A;  4JI7 L;  3R3O A;  5EAY A;  3RNU A;  3T1Y Q;  2JA8 B;  1H4V B;  4BBR B;  1Y8N B;  4GLA C;  1U5K A;  2LKV A;  3SR1 A;  2E5L Q;  3MEF A;  4APV A;  1GUG A;  1AE2 A;  4GOP A;  1HZC A;  2HD3 A;  3W1G A;  1FYC A;  2A6E D;  1DM0 B;  1MSH A;  2HUG A;  3E5S A;  3FKI G;  3SK5 A;  3TUP A;  2OQK A;  4N9T A;  4GOP C;  3A7A A;  3VQW A;  2ARU A;  2DTH A;  2A1A A;  2G9D A;  3PUZ A;  3T13 A;  4JI0 Q;  4C2M H;  3GTG B;  1Q1E A;  2D5D A;  2ZXP A;  3P75 A;  1I50 H;  5GAG C;  3GO5 A;  1Q1B A;  1ASY A;  3G4S A;  5IGB A;  4XTU A;  4F8M A;  1H9J A;  3SEB A;  1Q8K A;  4LFA Q;  1M1K C;  2NN6 G;  5C6A A;  1YHQ A;  5C51 B;  2F4I A;  3WQZ A;  4R4T A;  1FJG Q;  2R7F A;  1LT6 D;  3PO3 B;  4A3C H;  2ZT7 A;  2WP8 J;  2N8N A;  4CJ1 B;  1CKO A;  3I2Z A;  3V05 A;  2KCN A;  2F0M A;  5I9O A;  1S5C D;  1A2T A;  4J8Q A;  5C4Z A;  2BCO A;  1HUM A;  4CHT B;  3SE0 A;  3TEH B;  3ONA B;  1JMC A;  3TP7 A;  3ULJ A;  3I3C A;  1R9T B;  3CAM A;  3BG3 A;  1LAC A;  1SLJ A;  4A3G B;  1YJ9 A;  4DXG A;  1BCP C;  2HDL A;  3HXX A;  3CCQ A;  5IYC G;  3H6M A;  1YIJ A;  5DEH A;  3RD4 A;  3MQZ A;  1BCP F;  1SYD A;  4OO1 G;  3L0O A;  5C0X H;  4GKK Q;  1EU4 A;  2QEJ C;  2EXZ A;  3DUZ A;  4LNQ A;  2NS6 A;  2DQ3 A;  1N36 Q;  4IPC A;  1HZB A;  5I6Y A;  1EY5 A;  4H2X B;  3CCL A;  1OTC A;  1NAP A;  2AUJ D;  4H02 A;  3SHL A;  1D2B A;  5JJL A;  1F77 A;  1G2S A;  1F2L A;  3A8J E;  3IL8 A;  1VQA A;  2YTX A;  1Y1W G;  2NUC A;  5FO7 B;  2KEE A;  1A3T A;  1JJC B;  1GD7 A;  1ICF B;  5DLQ E;  4YRT A; 
#chains in the Genus database with same CATH homology
 5LMN Q;  2JA5 H;  4IPG A;  3L2Z A;  4JBJ A;  2R93 H;  2HIV A;  4BY7 G;  2DZC A;  3REX A;  1I3Q H;  1BBW A;  4OON A;  5LMN W;  2JK8 A;  2D0P A;  3PUV A;  4HJ5 A;  2UUB Q;  2PQA A;  2KCT A;  2LXJ A;  4HID A;  5C4X G;  1USY C;  2EJ9 A;  4EO4 A;  4YRL A;  2ID0 A;  5C0X G;  5M3F G;  1K8A C;  1Y1V H;  2PNH A;  3CMQ A;  4LF8 L;  2IX0 A;  4DV6 L;  2CQO A;  4B3R L;  1YGB A;  2A8E A;  3NBH B;  4B3T L;  2ZIM A;  4DV4 Q;  1ASZ A;  2VZA A;  1Q86 C;  2EIF A;  3A5Y A;  2ZZF A;  1QUQ A;  4LF5 L;  3GTK H;  4A3J G;  1EIF A;  4YY3 Q;  2OWO A;  1Z47 A;  4GLV B;  5IY0 A;  5H1S E;  5LMU L;  3S14 H;  1FGU A;  1NMF A;  1WNL A;  4OP0 A;  3M4Q A;  3SGI A;  1IBM Q;  2XGT A;  1Z9F A;  2QHT A;  4A3I H;  4YRC A;  4ZTZ B;  1QZG A;  4X64 Q;  3I7F A;  2HNI A;  1E7Z A;  4BWA A;  5M3M H;  1I94 Q;  3L1A A;  4BY1 G;  4IJL A;  3H0G H;  1S72 A;  2LXK A;  2VY3 A;  4JBW A;  3PGZ A;  3ULP A;  2DXT A;  1WOC A;  2B63 G;  4MZ9 A;  3J7A 5;  4LF7 Q;  2E64 A;  5E3I A;  4RG1 A;  2OTJ A;  3RUX A;  1HR0 L;  3RZD H;  4X5O A;  4XTY A;  3DLL A;  4DR6 Q;  2B29 A;  4YRI A;  3S15 H;  2E41 A;  4XEO A;  4TTV A;  3F2B A;  3GTL H;  4WF2 A;  1QF6 A;  5IP9 H;  2R92 G;  4A3L H;  1YFR A;  4NPS A;  2UXC Q;  2DXU A;  2JA8 H;  3TS0 A;  4O0A A;  4BBR H;  4JI2 L;  2E3C A;  1SRU A;  3KLW A;  4PZ6 A;  4UPA A;  1EYG A;  2D0O A;  1B70 A;  3CMA A;  3RGL A;  1B7Y A;  1VQF A;  1G29 1;  4DV7 Q;  3GTG H;  1BIB A;  2Q7E A;  2I5L X;  2E5A A;  2OTL A;  3IAL A;  4XTX A;  4LVK A;  2I4L A;  4A4I A;  3UDI A;  1CKN B;  2OCE A;  2AWN A;  1L1O B;  1YB3 A;  3RKX A;  1NMG A;  2VNU D;  1U0L A;  4YHH L;  1FYF A;  2WB1 G;  1VS0 A;  4IFD G;  4LFB Q;  1IZ6 A;  1A8V A;  2YTY A;  4A3G H;  3DM3 A;  4KHP L;  2DKG A;  1N9W A;  5BR8 Q;  3TEH A;  2UXD L;  1YZ6 A;  2HHH Q;  3U4V A;  2YU9 H;  3VQV A;  1XNQ L;  4LF6 L;  4Q15 A;  4H2V A;  4A3B H;  1IXR A;  5JEA J;  4J15 A;  5IWA L;  4KR2 A;  1HNZ Q;  1JJ2 A;  5E7N A;  3H3V I;  1HNW L;  1S3O A;  1JJC A;  1YHB A;  4R4C A;  4HWO A;  3PO3 G;  2UU9 Q;  3CD6 A;  1PA6 A;  3CCM A;  2WFW A;  3H15 A;  1HTT A;  2VL6 A;  3BU2 A;  3OTO L;  4A3D H;  2ZR2 A;  4R4O A;  4JI3 L;  1DGS A;  4DR3 Q;  3LC0 A;  3M9B A;  4JBM A;  3NET A;  4DR7 Q;  3PO2 H;  4JYA L;  1TWG H;  4L87 A;  5HGQ A;  1KOG A;  4DV1 Q;  1RIQ A;  1SN8 A;  3HFZ B;  1J5E Q;  1IBL Q;  4POG A;  4X62 L;  4B3S Q;  2NZO A;  4OX9 Q;  2ZCE A;  3VQX A;  2MNA A;  4ZIB A;  3E9H A;  4JI1 L;  4A3E G;  2KBN A;  2CGH A;  2Q2I A;  4XU0 A;  4XEM A;  2BH8 A;  1ADY A;  2MQH A;  1PH7 A;  1VCI A;  1YJN A;  4LFC Q;  1KC8 C;  3CC4 A;  4HJ8 A;  3I4N G;  4DV0 Q;  4PMW A;  1PH1 A;  2CIM A;  1NJI C;  2B3G A;  3CQZ H;  4NXM Q;  3HY0 A;  2ZR3 A;  1BBU A;  3GTP H;  3A31 A;  3HOX H;  3ERR A;  1J5W A;  4DV3 L;  1GGM A;  1NNH A;  3BJU A;  4LF4 Q;  4OWX B;  4IPD A;  3A0J A;  3CME A;  2JA7 G;  1UE5 A;  1N32 Q;  4DR4 L;  1EQR A;  1E22 A;  3UGT A;  4YRM A;  4P72 A;  2AMC B;  5AJ3 Q;  2E1H A;  4A93 H;  2K14 A;  2DVE A;  2CJ9 A;  2DGY A;  3CCE A;  4G85 A;  3RF1 A;  3ICA A;  5IYB H;  4X66 L;  1WCM H;  1X3E A;  4LUO A;  2ZZG A;  4TVW A;  3W3S A;  1XMQ L;  2CWP A;  4AQY Q;  1C9O A;  1A62 A;  2VQE Q;  5FLM G;  1VQZ A;  2JA6 G;  4YCV A;  4R4I A;  1LTL A;  1N33 Q;  3HKZ G;  3A74 A;  3LGJ A;  4WJ4 A;  2UUA L;  1W2B A;  3J81 j;  3PSI A;  4QL5 A;  3S1N H;  3L4G B;  4YRN A;  1N8R C;  3BFM A;  1H4Q A;  4X6A H;  4G84 A;  2DU5 A;  1H4T A;  1PH5 A;  4XTW A;  4DUZ L;  4MTN A;  1VQ5 A;  3I56 A;  1V1Q A;  2UUC L;  2IY5 A;  4A3M G;  3TS2 A;  1YFT A;  1QE0 A;  3CW2 C;  4H2W A;  3RLF A;  4JI6 L;  4WI1 A;  2C7I A;  4L5T A;  5GAD C;  1KIX A;  1V43 A;  1XNR L;  2ZNJ A;  4ALP A;  4CS4 A;  3FP9 A;  3HOY H;  4DV5 L;  2DZ9 A;  4HIK A;  1ATI A;  4OXP A;  3S16 H;  1PHJ A;  1AE3 A;  2DDZ A;  2VUM H;  4LF9 L;  1VQI A;  2ZM6 L;  1I6H H;  1KRT A;  2Q2T A;  5KNN A;  1YVC A;  3UH0 A;  2ZT8 A;  3T1Y L;  4A3F G;  1CKN A;  3D31 A;  4AIM A;  4P3O A;  1L1O A;  2E5L L;  1G6P A;  1IBK Q;  1Q82 C;  1Z7M A;  2NVX H;  4HWP A;  2RHQ B;  4YRF A;  3F1Z A;  2ZJP A;  1XPR A;  4JI0 L;  3CXC A;  3P8V A;  4YYE A;  2N78 A;  5C3E H;  4L5R C;  4YCW A;  3UDG A;  4LFA L;  2EAY A;  1J6Q A;  1XPO A;  3PUW A;  1NE3 A;  4O2D A;  3J80 c;  1FJG L;  2DUD A;  2Q7H A;  4POF A;  1BKB A;  4LNS A;  1JE5 A;  1A0I A;  1XMO Q;  3ERS X;  3H3V H;  4K0K Q;  2NVQ H;  4MNO A;  3VQY A;  4DR5 Q;  3S1R H;  1CKM A;  3G48 A;  4DNI A;  2P0L A;  2PMZ E;  1L2F A;  2EJF A;  4GKK L;  3HOV H;  4KQE A;  4A3C G;  2WB1 E;  1G5H A;  4YRJ A;  4UP9 A;  3PIP A;  4DR2 Q;  1E1O A;  4LVI A;  3D0F A;  5M5W H;  3QO7 A;  2QHV A;  2ZT6 A;  1XPU A;  3VDY A;  3J80 i;  3M85 A;  1QVC A;  2ODR D;  1NJ1 A;  4TVA B;  3CCS A;  1EOV A;  5LMN L;  1EVK A;  3HOZ H;  1PH2 A;  1VQ4 A;  1JB7 A;  4QGU A;  3AEV A;  1HZA A;  4BXX H;  3HFZ A;  2DQ0 A;  2HQL A;  2Q2U A;  1X3F A;  2I4O A;  4GN5 A;  3HFV A;  4GNX B;  3MF2 A;  2ZZE A;  2JA5 G;  2J3L A;  2R93 G;  2UUB L;  4GN4 B;  3CCV A;  4JOI A;  2AHO B;  1KQS A;  2RCN A;  5GAE C;  1M90 C;  1JJG A;  4DAY B;  2ALY B;  2K52 A;  4TWA A;  1YHA A;  3KF6 B;  3MF1 A;  2RHS A;  2VQF L;  3HRI A;  3VBB A;  1VQG A;  4RQE A;  1N34 Q;  3PF5 A;  1I5F A;  3M4O H;  4DV4 L;  3AQQ A;  4WJ3 M;  3FHW A;  1Y1V G;  5C52 B;  1SRO A;  4JI8 L;  2DTO A;  4YY3 L;  3UDX A;  1WI5 A;  3T1H L;  2FYK A;  2ES2 A;  4JV5 Q;  2ZTD A;  2AMC A;  2ART A;  1NJ6 A;  1IBM L;  4PZ8 A;  1CSP A;  2QHS A;  1UE6 A;  4XTC S;  4JC0 A;  2Q5H A;  4H2Y A;  1OXS C;  4LUZ A;  1K73 C;  1GM5 A;  3S17 H;  5J3B A;  4X64 L;  3I4O A;  1JT8 A;  2K5V A;  4HWT A;  1I94 L;  3RKY A;  1Z7N A;  2LSS A;  1K9M C;  2NN6 I;  3K7A H;  5FJ8 H;  2ZTC A;  3L4G A;  1VQ7 A;  1Q81 C;  1MIU A;  2JA9 A;  4LF7 L;  4A3I G;  4A3K H;  2ATW A;  1PH8 A;  1YI2 A;  2F4V Q;  2F3I A;  1XJV A;  3M4P A;  2PME A;  3M7N A;  5M3M G;  2CKZ B;  4XIG S;  1KL9 A;  4GOP B;  4DV2 Q;  1HC7 A;  3H0G G;  3PUX A;  3HOW H;  4Y52 H;  4OO1 I;  4JCV E;  4DR6 L;  4YHH Q;  3J7Z C;  1HNX Q;  2IX1 A;  4H2U A;  1HXD A;  2ZXF A;  3G6E A;  2UXC L;  1ADJ A;  5IP7 H;  2AKW B;  3HKZ E;  4DKA C;  1VQO A;  3GTO H;  1X3G A;  3AFQ A;  3WWV A;  4GS3 A;  2ZIO A;  3IG2 A;  4DAM A;  1CUK A;  3QNE A;  4P73 A;  5IP9 G;  1SR3 A;  1D7Q A;  4B3M Q;  4CH4 A;  4Q6G A;  4A3L G;  1LM0 A;  4DV7 L;  3PCO B;  5FJ8 G;  3V7S A;  2JA8 G;  1SET A;  2R7Z H;  4NCX A;  1OXV A;  3JAM c;  4BBR G;  4R4Q A;  4NB3 A;  1IL2 A;  4YRP A;  3KOJ A;  1P8L A;  1YEZ A;  3DSQ A;  3L7Z C;  3S1M H;  3PUY A;  4NXN Q;  4RQF A;  3P8T A;  4LFB L;  3HXY A;  5C0X I;  4QJF A;  3HRK A;  4H2X A;  4OLF A;  2ZTE A;  1L0W A;  4JI3 Q;  3E9I A;  1V9P A;  3MEY A;  3OW2 A;  1VQ8 A;  4P75 A;  1SFO H;  4DPG A;  4IOA A;  4LVM A;  2JEA I;  5BR8 L;  2MO1 A;  3JAM i;  4GKJ Q;  2HHH L;  4JBK A;  3S2H H;  4A3G G;  3FJP A;  1SER A;  2PMF A;  4IJH A;  3HKS A;  2PI2 A;  3RKW A;  3KJO A;  5HY6 A;  4CH3 A;  2R7Z G;  11AS A;  1AH9 A;  4GLX A;  2D62 A;  1HNZ L;  3UE0 A;  3REU A;  2C8M A;  4DUY Q;  1X2G A;  4TQU S;  1OXX K;  4TVA A;  2UU9 L;  1S40 A;  2CWA A;  4X65 Q;  1SES A;  4A3B G;  4PZ7 A;  1QVG A;  4C3J H;  4FDB A;  4DR1 Q;  3LSQ A;  2K5N A;  2DEQ A;  1GKH A;  2K75 A;  4DR3 L;  2YTV A;  4QY7 A;  2UXB Q;  4DR7 L;  4BBS H;  5GQO A;  3CCU A;  4GNX A;  1FVI A;  1HH2 P;  1NYR A;  1WLE A;  4DV1 L;  4P74 A;  3HOU H;  1J5E L;  1TWA H;  4P3N A;  1IBL L;  2Q5I A;  5IYD H;  4B3S L;  2QHU A;  4K88 A;  4OWW B;  4IFD J;  4A3D G;  1WQW A;  1X55 A;  3EBE A;  1KMM A;  5C44 H;  3PO2 G;  3QO5 A;  2RF4 A;  2ALY A;  2GN5 A;  4JI5 Q;  3KF6 A;  2JQO A;  3I4M H;  1YNX A;  3MXN B;  5C4J H;  4RDX A;  4DK6 C;  4LFC L;  2OQ0 A;  2HIX A;  4DV0 L;  3RN5 A;  3K8A A;  2KCM A;  3AYH B;  4P72 C;  1C0A A;  3AFP A;  4NXM L;  3RL6 A;  3CP0 A;  2EWN A;  4IPH A;  1VQN A;  3A7R A;  1MKH A;  2QA4 A;  2ZTG A;  4YRO A;  2WAQ G;  3FKI H;  3K0X A;  4LF4 L;  4JG2 A;  3UE1 A;  4JI4 Q;  5ELN A;  4YCU A;  1WQ7 A;  2QGQ A;  4JI7 Q;  4YRE A;  4YRS A;  3F2C A;  3HOX G;  4AYB G;  4KI0 A;  2EQS A;  5AJ3 L;  2H5X A;  4L5S A;  12AS A;  4YWM A;  3A7U A;  2YYZ A;  3K81 C;  3HY1 A;  5JJK A;  1KAW A;  4HJA A;  4IFD I;  1VQC A;  1YIT A;  4CH6 A;  3TRE A;  3RAC A;  1UE7 A;  2CJA A;  4AQY L;  2FXQ A;  3GTQ H;  2E2H H;  5IYC H;  2VQE L;  3R07 A;  1N33 L;  4A93 G;  1B70 B;  2IT1 A;  1EIY B;  1UE1 A;  1VQL A;  3PV0 A;  3G1Z A;  1NJ5 A;  3V7C A;  5IYB G;  1WCM G;  3OYY A;  1VQB A;  4L5Q A;  4CH5 A;  1MJC A;  3QTC A;  2K5H A;  2NVY H;  2EXD A;  2KHJ A;  1Y1W H;  3STB D;  2ODR C;  4GN3 B;  1TWF H;  2EJG A;  3A5Z B;  2C35 B;  2I0Q A;  4KHZ A;  4BY7 H;  4YRG A;  1EFW A;  2XTI A;  3RLO A;  1L1O C;  2AKW A;  3BZK A;  3F2D A;  2F52 A;  1WYD A;  4LVL A;  2JJQ A;  1O7I A;  4HJ9 A;  5GAH C;  1BVS A;  3EFR A;  4XU2 A;  2E65 A;  3EFS A;  3TEG A;  1VQ9 A;  3P8Y A;  1T9H A;  3PCO A;  5C4X H;  1MJE A;  1PYB A;  4HA8 A;  3B6Y A;  5M3F H;  2CJB A;  4AH6 A;  3CCR A;  1SMX A;  2QEX A;  3ICE A;  1PH6 A;  3RN2 A;  1IBK L;  3HOY G;  2GVA A;  4QIW E;  1NJ2 A;  1QZH A;  1X54 A;  1K83 H;  4P71 A;  2VUM G;  2HT1 A;  4P71 C;  1G5I A;  4LF8 Q;  4DV6 Q;  1N36 L;  4A3J H;  1VQJ A;  3TQY A;  4B3R Q;  1EQQ A;  4HWS A;  3PZC A;  1GVP A;  4B3T Q;  5K36 G;  2Y0S G;  3J81 c;  3W5O A;  3CF5 A;  1PYS B;  1Q12 A;  2AWO A;  1W3S A;  3HXU A;  4K86 A;  1XMO L;  2I4M A;  3HXW A;  5C3E G;  4CS2 A;  4K0K L;  1USY A;  4LF5 Q;  3RIR A;  4DR5 L;  5IE8 A;  5LMU Q;  2E2I H;  2ZJR A;  1PH9 A;  1KRS A;  5IT9 c;  1BIA A;  3A32 A;  4HWR A;  2ZGW A;  4BY1 H;  2ZT5 A;  2VQF Q;  5F5W A;  4DR2 L;  2VW9 A;  1GO3 E;  3CCJ A;  3ER0 A;  2B63 H;  4DK3 C;  1X9N A;  3J81 i;  1TWC H;  1PVO A;  4JOI C;  3IKM B;  1VQD A;  4QQB X;  3HOV G;  2N3S A;  1VQP A;  2ZNI A;  4XU3 A;  4JI8 Q;  1PH4 A;  3HXZ A;  2DJZ A;  3KDF B;  1VQE A;  1E24 A;  3IKL A;  2JE6 I;  3JC6 6;  4YWK A;  2BA0 A;  3T1H Q;  4HJ7 A;  3UGQ A;  2Q2H A;  2R92 H;  3IRB A;  1RIP A;  2E2J H;  4HIO A;  1HR0 Q;  3HOZ G;  1UWV A;  3V8L A;  3U4Z A;  3OD1 A;  4BXX G;  3ULL A;  3S2D H;  3HXV A;  1TWH H;  4XTV A;  3S24 A;  1RL2 A;  5K1P A;  1H95 A;  3F8T A;  5JEA G;  5FLX c;  1HR0 W;  3UDF A;  2E8G A;  4BW9 A;  1X01 A;  1N34 L;  4RMF A;  1WU7 A;  3S1Q H;  1H4S A;  4ME3 A;  4JI2 Q;  2PI2 E;  3TRZ A;  1K8G A;  1EWI A;  2IHF A;  1YFS A;  3CC7 A;  2J3M A;  4JV5 L;  4LVJ A;  4PG3 A;  1A63 A;  3K7U C;  2IY5 B;  1VQM A;  1VQH A;  5C0X J;  4HVC A;  3RLN A;  1E3P A;  5ELO A;  4DQ2 A;  4XU1 A;  2R6G A;  4LWC A;  3G71 A;  1TXY A;  2A8V A;  1K0R A;  4C3H H;  2L15 A;  3NEM A;  2Z0S A;  1EVL A;  3GDE A;  1EIY A;  2WAQ E;  1KD1 C;  3L2P A;  4KHP Q;  2DU7 A;  3W1B A;  1NBW A;  3V8J A;  2P5I A;  5M5X H;  3K80 C;  4IO9 A;  1WJJ A;  1X56 A;  2UXD Q;  1KXL A;  4YPF A;  1X65 A;  2F4V L;  1SE8 A;  1XNQ Q;  4AYB E;  4PHC A;  4P73 C;  2A19 A;  1PH3 A;  4LF6 Q;  3PO3 H;  2KEN A;  3A5Z A;  3ZJY C;  1OXT A;  4DV2 L;  1P16 A;  1LYL A;  5IWA Q;  2NVT H;  2R7D A;  1R9T H;  1G51 A;  4A3K G;  4TQF A;  1HNX L;  5C53 B;  2I5H A;  2RHQ A;  1YBY A;  4ZTU B;  1HNW Q;  2CCZ A;  1UEB A;  1PV4 A;  4UP7 A;  3HOW G;  1WPY A;  4R1J A;  4H2S A;  3OTO Q;  3U58 A;  4C3I H;  4B3M L;  1Q7Y C;  2BH2 A;  1Y14 B;  1NYQ A;  1E1T A;  4A3E H;  1SRY A;  4JYA Q;  3V7R A;  4P75 C;  2KHI A;  5IP7 G;  3QO8 A;  4TQD A;  2ARS A;  3GTM H;  4X62 Q;  4KR3 A;  4IOC A;  3I4N H;  4UP8 A;  3E0E A;  3BZC A;  4E51 A;  1WFQ A;  4YDQ A;  2YV5 A;  2G4C A;  3V8K A;  4JI1 Q;  2PQA B;  4YP0 A;  4NXN L;  3KF8 B;  3PF4 A;  3NEL A;  1B8A A;  3M3Y H;  2EL9 A;  2JA7 H;  1PYS A;  4OWT B;  3GTJ H;  3KFU A;  2N49 A;  3CPW A;  1QVF A;  4CS3 A;  2Z6K A;  1C7Y A;  1HJP A;  3KYH C;  4GKJ L;  2Z6K C;  1B76 A;  2MO0 A;  4DV3 Q;  5GRO A;  2E10 A;  1X6O A;  2IHE A;  3CPF A;  4LW1 A;  2GVB A;  1IYJ B;  3KJP A;  2K4K A;  1QUQ B;  2V1C C;  3RR5 A;  3UFG A;  1X2H A;  3I55 A;  1XTD A;  4DR4 Q;  1Q46 A;  5JJI A;  3NEN A;  1CSQ A;  4GNX C;  2DTI A;  4BA1 I;  3LSS A;  4BA2 I;  3Q8D A;  4HIM A;  4P74 C;  2I4N A;  4OX9 L;  3CC2 A;  5FLM H;  2ASB A;  2JA6 H;  4P3P A;  4DUY L;  3PIO A;  2Q7G A;  1D8L A;  2RHS B;  2ZJQ A;  2K50 A;  4TVY A;  2Y0S E;  4X65 L;  1VQ6 A;  4XTZ A;  1NJ8 A;  4X66 Q;  1K3R A;  4DR1 L;  3EN2 A;  2VS1 A;  4HT4 A;  3KDF A;  1XMQ Q;  3STB C;  2JEB I;  1FL0 A;  2UXB L;  4A76 A;  2NZH A;  2CFM A;  2ZIN A;  2I5M X;  4A3M H;  1NY4 A;  2UUA Q;  4YRQ A;  1HZ9 A;  3U50 C;  1W66 A;  1LUZ A;  4K87 A;  3GD7 A;  4A75 A;  4DUZ Q;  1PFS A;  1N32 L;  2UUC Q;  4BBS G;  4YWL A;  4JI5 L;  2BA1 A;  3A5U A;  1NTG A;  1EUJ A;  4JI6 Q;  3HOU G;  4UY8 C;  5IYD G;  3RZO H;  4H2T A;  5M5Y H;  4Y7N H;  1OXU A;  4KLK A;  1YJW A;  4EX5 A;  1VQK A;  4LUV A;  4EQ5 A;  3EIV A;  2MFI A;  3HTZ A;  1XNR Q;  5C44 G;  5K1X A;  4A3F H;  1KMN A;  3I4M G;  4YRK A;  4DV5 Q;  1KHI A;  4YRR A;  4JI4 L;  4LF9 Q;  2ZM6 Q;  1B7Y B;  4JI7 L;  3RNU A;  5EAY A;  3T1Y Q;  1H4V B;  4GLA C;  1U5K A;  2E5L Q;  3MEF A;  4APV A;  1AE2 A;  4GOP A;  1HZC A;  3W1G A;  3FKI G;  3TUP A;  2OQK A;  4GOP C;  3A7A A;  3VQW A;  2ARU A;  2DTH A;  2A1A A;  3PUZ A;  4JI0 Q;  4C2M H;  1Q1E A;  1I50 H;  5GAG C;  3GO5 A;  1Q1B A;  1ASY A;  3G4S A;  4XTU A;  1Q8K A;  4LFA Q;  1M1K C;  2NN6 G;  5C51 B;  1YHQ A;  3WQZ A;  4R4T A;  1FJG Q;  2R7F A;  4A3C H;  2ZT7 A;  2WP8 J;  2N8N A;  1CKO A;  3I2Z A;  3TEH B;  1JMC A;  3ULJ A;  3CAM A;  1SLJ A;  1YJ9 A;  3HXX A;  3CCQ A;  5IYC G;  1YIJ A;  3MQZ A;  4OO1 G;  3L0O A;  4GKK Q;  4LNQ A;  2NS6 A;  2DQ3 A;  1N36 Q;  4IPC A;  1HZB A;  4H2X B;  3CCL A;  1OTC A;  4H02 A;  5JJL A;  1VQA A;  2YTX A;  1Y1W G;  1JJC B;  1GD7 A;  5DLQ E;  4YRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...