3BJUA

Crystal structure of tetrameric form of human lysyl-trna synthetase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
507
structure length
503
Chain Sequence
SVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Lysyl-tRNA synthetase
publication title Crystal structure of tetrameric form of human lysyl-tRNA synthetase: Implications for multisynthetase complex formation
pubmed doi rcsb
source organism Homo sapiens
total genus 160
structure length 503
sequence length 507
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2007-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3bjuA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3bjuA02
4XTWA 3F2BA 1XMOQ 4LWCA 1S72A 4KHPQ 4WF2A 3V8KA 2P0LA 4LF5L 2AWOA 2OCEA 4BXXG 2PI2A 1RIQA 5J3BA 2H5XA 2ARTA 1NJ1A 4OX9Q 4JI5L 4XIGS 1IBKL 4X64L 1PHJA 4DV5Q 1G51A 3FJPA 4AH6A 1AE2A 2IY5B 1JJCA 1EQRA 3H15A 4LFCQ 5FLXc 3HXWA 4JI4L 2DDZA 5IWAQ 3SGIA 5GAEC 3CF5A 1SETA 2E3CA 2CWPA 3HOXH 1B70B 4IOCA 3VQVA 2GVAA 2JA7G 2HT1A 1PH2A 4YRNA 4L5QA 3KDFA 4IJLA 1Z7MA 3P8YA 1X2HA 2UUBL 4DNIA 4X66Q 2ODRD 4JI1L 3VDYA 3L4GA 1S40A 1U0LA 1B8AA 3K80C 3CAMA 4HJ9A 4DR1Q 2VUMG 1XNQL 3PF5A 4BW9A 4DV0L 2Z0SA 4A3IH 4A3CH 3P8VA 3A7UA 1H4SA 1E24A 4DV3L 2UXDL 2JE6I 1JJGA 2NVTH 4Y7NH 2A8VA 2E64A 1YFRA 4JI5Q 2WP8J 2FXQA 4YWMA 2YTXA 3WQZA 3EFSA 2EWNA 3CCJA 4YREA 3LC0A 1MIUA 2DJZA 2G4CA 4BXXH 2E41A 4DR6L 2R92H 2B3GA 4ZIBA 1RL2A 4P71C 1SFOH 1NMGA 4DAMA 4A75A 3M3YH 2ZTGA 4GN5A 4ZTZB 4O2DA 3CCQA 3TREA 3STBC 4HIMA 4B3SL 1IBML 4JI0Q 1YHAA 2N78A 1ASYA 1EYGA 1XNQQ 4H2XA 4ALPA 2DGYA 1KIXA 4A3EH 1K83H 2QA4A 4OO1G 1EWIA 3UDFA 4YHHQ 3EIVA 1Q46A 3FKIH 4LW1A 4P3PA 5IYDH 1YITA 4P74A 3EBEA 4HIDA 2AKWA 1SRYA 3A5UA 4TVYA 4RQFA 1VQAA 1J5EL 1OXVA 4GOPC 4LF9Q 1B7YB 4X62L 2AHOB 2R7ZG 2CCZA 2JEAI 3E0EA 3A74A 3TS0A 2CJBA 2ZZEA 2KCTA 2K52A 4HJ7A 3G48A 3T1YQ 4EO4A 5C51B 5IT9c 3J81j 2Q7GA 4A3BG 3IALA 2OQKA 3RL6A 3HOYG 4EX5A 1G291 3J7ZC 4B3SQ 1IBMQ 4BY1G 2L15A 3ULPA 4Q15A 3KYHC 2ES2A 3E9IA 1OXSC 4DV4Q 3U50C 1TWAH 4OWTB 1HH2P 3KOJA 1YGBA 3KF6B 1VQ7A 1N33Q 4E51A 3PUXA 3JAMc 1ADJA 2ZZFA 5IYCG 3CMEA 2QHVA 2E65A 4JBJA 3H0GG 2ZT5A 4BY7G 3CCSA 1J5EQ 1GGMA 4DR2L 1PYSA 1WNLA 3MEFA 3QNEA 3J81i 3HKSA 1P8LA 3B6YA 5EAYA 2OTJA 4MTNA 1NJ8A 4A93G 1KL9A 3ICEA 4B3RQ 1KXLA 3AEVA 3PIPA 1PA6A 3CQZH 1CKMA 3RNUA 1NYRA 3H3VI 5IP9H 5JJKA 3M7NA 4JBKA 1NYQA 4YROA 1WCMG 4LUZA 3K7UC 1LM0A 4GLAC 3IG2A 3QO5A 1TWFH 3M4QA 2QHTA 2ZIMA 4P75C 3UDIA 2C8MA 1I5FA 2E5AA 1ASZA 1RIPA 4DQ2A 3IRBA 1I3QH 1NNHA 4DUYL 4GOPB 3ICAA 4HJ5A 4GKKL 4TQUS 5E3IA 5H1SE 4A3KG 1WFQA 1D7QA 1NJ5A 2ARUA 4XEOA 4X65L 1I50H 4BBRG 1CUKA 3UFGA 3KLWA 4DR5L 4DR4L 4DK3C 4CS2A 3FHWA 1O7IA 2PMZE 3HY0A 4A3DH 3KJPA 4JI6Q 2IHFA 1A0IA 1X55A 1CSPA 4TVWA 4H2TA 2MQHA 1K8GA 3UH0A 1N34Q 5IYCH 2ZJRA 1I6HH 4P73A 2A1AA 2DVEA 4C3IH 4ME3A 1Q86C 3HXXA 4GNXC 2OTLA 1PYBA 1VQMA 5HY6A 4IFDJ 2BA0A 2AMCA 1PH5A 4A3GG 1EVKA 4OP0A 4GLVB 4O0AA 2JEBI 4HVCA 3ER0A 3CD6A 2Z6KA 4JG2A 3U4ZA 3NETA 4DUYQ 2EIFA 3PUWA 1P16A 2ZT7A 1JT8A 4XTCS 1X01A 3MF2A 2QEXA 3HOXG 4H2UA 2CJAA 4HWRA 4JI7L 1WI5A 1H4VB 4DV5L 4A3LH 2PMFA 4OWWB 3GDEA 3CW2C 3RF1A 3I2ZA 1UWVA 2Q2UA 2JA6H 4CS4A 3L2ZA 3RLOA 1G5HA 1UE6A 2K75A 4EQ5A 4YRRA 5JJIA 4IFDG 5IYBH 2IY5A 1C7YA 4RDXA 2P5IA 12ASA 1GKHA 2ASBA 4A3CG 1B70A 3CCUA 4XU0A 1SE8A 1SROA 2WFWA 3KF8B 3PO3H 4CH4A 1V43A 1U5KA 4K87A 4YRCA 1VQDA 4ZTUB 3R07A 1QF6A 4UP8A 3CC2A 4IPGA 4GKJQ 5C4XG 4DR1L 3KJOA 4JI3L 2N3SA 1UEBA 1HXDA 3LSQA 1SLJA 2EQSA 1A62A 3OW2A 2B63H 2OWOA 2V1CC 4YRIA 3E9HA 4YY3Q 1WYDA 1WPYA 3W1GA 3KFUA 1YB3A 2NZOA 2VW9A 1HNXL 4HWPA 3I7FA 2DQ0A 1E22A 5C44H 1PH6A 5JEAG 4GLXA 2R92G 3S14H 1EUJA 2F52A 3HKZE 3F1ZA 4A3GH 3ERSX 5M5XH 2NN6G 2EAYA 3AFQA 1CKNA 2PI2E 2E10A 1D8LA 4JI7Q 4AQYQ 1BIBA 2Y0SE 3V7SA 4UP7A 1QZGA 1YEZA 3UGTA 4QL5A 1Y14B 1VQPA 3GTLH 4GNXB 4JBWA 3J81c 1EIYB 3AQQA 4YYEA 1Y1WH 4A3EG 2Q7HA 2K5NA 2ZJPA 3CMAA 3CCVA 5E7NA 1FYFA 1X54A 3FKIG 1K3RA 1B76A 2VQFL 3CPFA 4CS3A 5IYDG 3PF4A 4G84A 2VL6A 4YRFA 3S1NH 4JI0L 3DM3A 3I4MH 2ZTCA 4JI3Q 2K14A 1X6OA 4LUVA 4XEMA 3PUVA 2JA9A 3S24A 5KNNA 4YHHL 3CMQA 1IYJB 2WAQE 4XU2A 4YP0A 2Q2IA 3PO2G 4L5TA 1SERA 1HNXQ 1QE0A 1E1TA 1E7ZA 4CH6A 1R9TH 5C4XH 2Q7EA 4H2YA 1YJNA 3S15H 4XTYA 1PH3A 2C35B 1M1KC 5C53B 4LF9L 2EJ9A 4A3MH 1B7YA 3OTOQ 3UDXA 1N36Q 3K81C 2ZR3A 3HXZA 4DKAC 3VQYA 2J3MA 1KC8C 3V7RA 1OXXK 1HTTA 3AFPA 3I4NH 2K5VA 1OXUA 1SRUA 1Q1EA 4AIMA 1GVPA 1NBWA 3T1YL 4HWSA 2JA5G 1VQ9A 4KLKA 4RMFA 4C3HH 4X5OA 3G4SA 2VQFQ 2ID0A 2D0PA 1K73C 4DV2L 3RZOH 1GO3E 2ZT8A 3HOZH 2CGHA 2CKZB 1VQJA 1Z47A 2DU7A 2EJGA 4NPSA 3U4VA 4DV4L 3A5ZB 1N32L 3KF6A 5DLQE 4LNQA 2CFMA 1A8VA 1N33L 4L87A 1OTCA 2KBNA 5M3MH 4OO1I 4JYAQ 1OXTA 3U58A 5IP9G 3BU2A 3VQWA 1JB7A 2JJQA 3EN2A 2DEQA 4P71A 1VQEA 4PZ7A 4JI8Q 4DV7L 2R7FA 2F3IA 2ZXFA 4B3RL 3PO2H 1X3EA 1XJVA 5FLMG 3HOVH 1FVIA 1HC7A 2DXUA 3K7AH 5BR8Q 3I4OA 4TWAA 2RHSB 1X56A 4P3OA 4BA1I 3HTZA 4A3JH 4XTVA 3M85A 4JV5L 2CWAA 4DAYB 4DV2Q 2PNHA 3HKZG 4YRQA 4YRJA 1KMMA 4TVAB 1NJ6A 1VQKA 2GN5A 4GN4B 2DXTA 2Y0SG 1IBLL 2VZAA 4X6AH 4TTVA 4IOAA 2JA5H 4CH5A 5LMUL 1N32Q 4A3DG 1IZ6A 4WJ4A 2DUDA 4OXPA 2IX0A 4HWTA 4YCUA 1TWGH 1JMCA 1K0RA 3PCOB 1VQ8A 3VQXA 4PG3A 2ALYB 3CC7A 1VQ6A 3ULJA 2F4VQ 3RACA 5K1XA 4BWAA 1MJEA 4DV7Q 4JI6L 4HA8A 2RF4A 3STBD 4RG1A 1VQLA 1HZ9A 4QY7A 1N34L 2WAQG 2VQEL 1WOCA 3L7ZC 4A3FH 1EQQA 1VS0A 2CQOA 1BKBA 3IKLA 4JV5Q 3HFZB 3NELA 4LF6Q 3MF1A 1QUQB 2DU5A 1PH4A 2D0OA 1MJCA 1IBLQ 2UUCL 1GD7A 5FLMH 4OONA 4XU1A 2PMEA 4A3LG 5ELOA 5JJLA 3PGZA 1VCIA 5LMUQ 1YJWA 2JA6G 3RLNA 3UE1A 1YZ6A 3HRIA 1USYA 1WQ7A 4P73C 2HHHQ 1SR3A 2EL9A 1AH9A 5IYBG 2VY3A 4PZ6A 3A7AA 1VQCA 2DZCA 4G85A 4LFBL 4HIKA 4WI1A 5C4JH 3PSIA 4UY8C 4P72C 2ZTEA 4QJFA 4YRLA 4R4TA 3PO3G 1LYLA 4Q6GA 1IXRA 3S1MH 4YDQA 1YFTA 2XTIA 2Z6KC 3M4OH 2VS1A 4JOIC 4TQDA 1Y1VH 5M5WH 1L1OC 1PH8A 2NZHA 2KENA 2VQEQ 1E3PA 3L2PA 2B63G 2YU9H 4A76A 5C3EH 1S3OA 1VQHA 5K1PA 1Q7YC 4HJAA 4AYBE 3S16H 5C44G 4H2VA 4BBSH 3NEMA 1PH1A 2UUAQ 4GKJL 2LSSA 5M5YH 2ZR2A 1NE3A 2UUCQ 3F8TA 4LNSA 4XTXA 4J15A 4IPDA 1KRTA 1G6PA 1PH7A 4YY3L 1XPUA 1BIAA 2GVBA 1XMQQ 1Q12A 3V7CA 3G71A 4PZ8A 4LFBQ 1Y1WG 3TEGA 2ZTDA 1SMXA 2UU9L 1BBUA 2I5MX 1HR0W 3J80c 2RHQB 1G5IA 4AQYL 5C0XJ 2B29A 3ULLA 3S17H 2I4MA 3ERRA 3CCMA 2D62A 3GTMH 3PV0A 4L5SA 3I4MG 3GTGH 2ZINA 4L5RC 5M3FH 4LF7Q 1EIYA 3G1ZA 3IKMB 2EJFA 4IFDI 3D31A 2CJ9A 2HIVA 3HOUH 4QQBX 3RKWA 4POGA 3PIOA 1NY4A 2JQOA 1XNRQ 4DR7Q 2IHEA 3P8TA 1DGSA 4JBMA 4LF8Q 4DV6Q 1X2GA 1A63A 2I4NA 3OYYA 4IO9A 1HZCA 3FP9A 4YWLA 4H2WA 4A3MG 3W1BA 1EFWA 4OLFA 5C0XG 3BJUA 4P3NA 1H4QA 3UGQA 3I4NG 1W2BA 1VQBA 1KMNA 2JK8A 2I5LX 2KCMA 2OQ0A 1EOVA 2UU9Q 1L1OB 2NVQH 3J7A5 1QVFA 3BFMA 4K86A 1UE7A 4POFA 3OTOL 1N36L 4FDBA 4K0KQ 2UXBQ 2NN6I 3WWVA 4DV1Q 1WLEA 3L1AA 3TEHB 2N8NA 1K8AC 3A7RA 3HOZG 3DSQA 1NMFA 2PQAB 3I55A 2NVXH 2AWNA 1Z7NA 1Q81C 1WJJA 4NXNL 2I4LA 1V1QA 1T9HA 1CKOA 2ATWA 3PUYA 2DKGA 4B3MQ 1HNZQ 2QHSA 3GTQH 3QO8A 3F2CA 1KD1C 4JC0A 2R93H 1L2FA 3HOWG 5M3MG 3TQYA 2I0QA 4IPHA 4NXMQ 2BH8A 4LUOA 1HR0L 3RN2A 5GAHC 3A5ZA 4IJHA 2E2HH 1Z9FA 4DK6C 3VBBA 2Q2HA 3QTCA 3UE0A 3CP0A 1KAWA 4JYAL 2DZ9A 3CC4A 4XTUA 3HOVG 1PH9A 3LGJA 1X9NA 4YPFA 1TWCH 1IL2A 1I94L 1TWHH 1NTGA 3GTPH 4AYBG 4A3JG 4R4OA 4JI8L 2ZZGA 4LF5Q 2DTOA 3RN5A 1VQ5A 5IP7H 1CKNB 4NB3A 4KR2A 1XPOA 1UE1A 1IBKQ 4X64Q 4NXNQ 5BR8L 4R1JA 1CSQA 2K4KA 4P74C 1FL0A 4MZ9A 4H2SA 2RHSA 3K8AA 5LMNW 1JJCB 2Q2TA 4JI4Q 3RGLA 1YHQA 4TVAA 1YI2A 1J5WA 2Q5IA 2MO0A 1HR0Q 3KDFB 1VQZA 2UUBQ 3NBHB 4LFAL 1EVLA 5FJ8G 2FYKA 1VQGA 1YNXA 4JI1Q 2YV5A 4JI2L 3L4GB 4Y52H 4APVA 3J80i 3EFRA 1KQSA 3HY1A 3NENA 3HOWH 3M9BA 1VQFA 3PCOA 1PFSA 1W3SA 2ARSA 4B3TL 3T1HL 4DV0Q 2ALYA 1I94Q 3AYHB 4YRGA 2JA7H 4A3FG 2N49A 2F4VL 1LUZA 4MNOA 4KQEA 4CH3A 4DV3Q 2UXDQ 3F2DA 4YRTA 1PVOA 2LXJA 3HRKA 2VUMH 2BH2A 4TQFA 5IE8A 1HZAA 3S2HH 4YWKA 4C2MH 1FGUA 3CXCA 3MEYA 4RQEA 5HGQA 3HFZA 4LF6L 3TS2A 4DR6Q 3LSSA 3CCRA 1QUQA 3S2DH 1M90C 4QGUA 1TXYA 2DTHA 1YFSA 4IPCA 4LFAQ 5F5WA 2HIXA 4HWOA 2HQLA 2YTVA 4JI2Q 2HHHL 3GTOH 4GOPA 1Y1VG 1C9OA 2WB1E 5GAGC 3HXUA 1QVGA 3GD7A 4H2XB 1VQIA 1V9PA 1KHIA 4DR3L 4YCVA 1YIJA 4B3TQ 2E2JH 4HIOA 3BZCA 3T1HQ 3RZDH 1MKHA 5C3EG 2UXCL 3RUXA 3DLLA 3K0XA 3M4PA 5LMNL 3OD1A 1XTDA 4YRPA 2NVYH 2E8GA 2E5LL 1PV4A 3W5OA 1N8RC 2AKWB 5FJ8H 1X65A 4BA2I 1X3FA 3MXNB 4BBSG 1USYC 2YTYA 4XU3A 4DUZL 2K50A 1K9MC 3JC66 1KRSA 4HJ8A 1EIFA 3RIRA 1VQ4A 1WQWA 2A19A 1C0AA 4X62Q 3CCEA 3A0JA 1BBWA 2MNAA 3CCLA 2ZT6A 4LF4L 2KHIA 2UUAL 5IY0A 4DPGA 1NJIC 4C3JH 2RCNA 4R4IA 2Q5HA 3PZCA 2ZM6L 1QZHA 4A4IA 4OWXB 3RR5A 5ELNA 3I56A 2R7ZH 2IX1A 3V8LA 1UE5A 4KHZA 1SESA 2QGQA 4YRSA 2ZJQA 1XMQL 3A31A 4XTZA 4PMWA 5M3FG 3RKYA 2R6GA 4NCXA 2E2IH 1E1OA 1Q82C 5GADC 4DR3Q 4R4CA 3RLFA 2I4OA 5K36G 3HOUG 2MO1A 2UXCQ 2E1HA 4H02A 4A3BH 5LMNQ 1AE3A 2RHQA 1H4TA 3GTKH 1J6QA 2DQ3A 3CPWA 11ASA 3RKXA 2E5LQ 3HOYH 1X3GA 3TRZA 1Q1BA 3PUZA 2ZCEA 2ZIOA 4BY1H 3HXYA 2J3LA 3Q8DA 1XPRA 1BVSA 4DUZQ 4LF7L 1PYSB 4DR2Q 4R4QA 4JCVE 1HNWL 1FJGL 4P75A 2JA8G 4GS3A 5GROA 1YBYA 5AJ3L 1XNRL 1VQOA 4DR7L 1WU7A 4LF8L 3V8JA 3L0OA 2HNIA 4DV6L 2BA1A 5C52B 4LF4Q 3A32A 3G6EA 1JE5A 3H0GH 3S1QH 4BY7H 1Q8KA 4GN3B 2VNUD 2ZM6Q 2EXDA 4P72A 3BZKA 4KR3A 4A93H 4K88A 3H3VH 1W66A 3D0FA 2XGTA 3HXVA 4KI0A 1JJ2A 4JOIA 4WJ3M 3HFVA 3QO7A 2CIMA 1ATIA 2ZNJA 4UPAA 3GO5A 1L1OA 3S1RH 1XMOL 4KHPL 3A5YA 4UP9A 2ODRC 1WCMH 4GKKQ 2R93G 4K0KL 3W3SA 3ZJYC 2UXBL 1HJPA 4DV1L 1L0WA 3TEHA 4YCWA 2PQAA 4X65Q 4OX9L 4PHCA 4DR5Q 4GNXA 4DR4Q 2KHJA 4YRMA 1ADYA 1KOGA 2WB1G 4B3ML 1HNZL 1HNWQ 2QHUA 2I5HA 1FJGQ 2ZNIA 4LFCL 4QIWE 5AJ3Q 1VQNA 3REXA 1N9WA 5JEAJ 3UDGA 5IWAL 4A3KH 2YYZA 3TUPA 2K5HA 4A3IG 4BBRH 1YJ9A 4NXML 2ZGWA 3REUA 2LXKA 1YVCA 2R7DA 3GTJH 1SN8A 2DTIA 4X66L 2AMCB 1QVCA 1LTLA 2JA8H 2IT1A 5IP7G 1NJ2A 4YRKA 5C0XI 3JAMi 1GM5A 1HZBA 2MFIA 2C7IA 5GQOA 1YHBA 1H95A
chains in the Genus database with same CATH superfamily
4XTWA 2K33A 3F2BA 1XMOQ 4LWCA 1S72A 4KHPQ 4WF2A 1DOMA 1Q8IA 1EY7A 3V8KA 2P0LA 4LF5L 2AWOA 2KEDA 1BCPC 2OCEA 4HTHA 4BXXG 2FFKB 2PI2A 4FF3A 1RIQA 1EEID 2QILA 2H5XA 4IUUA 5J3BA 2ARTA 3RZDB 1NJ1A 4QMGA 4OX9Q 4JI5L 3JAME 3SR1A 4XIGS 5EPKA 3DXJC 1B2TA 3OPOA 4K5WA 1IBKL 1FR3A 4X64L 3H3VC 1H9SA 2NVYB 3MXPA 1PHJA 4DV5Q 4H0LC 2EOTA 2ICEC 1BF4A 1K8OA 1XWEA 3SK8A 1G51A 3SEBA 4GZYC 3FJPA 2Z4HA 4AH6A 1BQQT 4HMJA 3T13A 1AE2A 4KKTA 2IY5B 1JJCA 1EQRA 3H15A 4LFCQ 1DM0B 1DXMA 5FLXc 3HXWA 2E75C 4JI4L 3K57A 1ENAA 2DDZA 5IWAQ 3SGIA 5GAEC 3CF5A 1SETA 2E3CA 5DNFA 1CZWA 4N8X1 4B9WA 2CWPA 5I6WA 1XTCD 3HOXH 2SNSA 1B70B 4IOCA 3VQVA 4CJ2C 1S5FD 2JYOA 2GVAA 5EBDA 3V2TA 2JA7G 2HT1A 1PH2A 4YRNA 4L5QA 2FHTA 3KDFA 4IJLA 1Z7MA 3P8YA 4A3FB 1X2HA 4DGZA 1Z6HA 2CH4A 2UUBL 3NBHA 4DNIA 3IFDA 3NK9A 1WTRA 5KIXA 2F3WA 4X66Q 2ODRD 2L12A 4H7BA 4JI1L 3VDYA 3L4GA 3Q22A 1U0LA 1B8AA 1S40A 1TS2A 3K80C 2VB3X 3CAMA 1A3VA 1AP0A 4HJ9A 4DR1Q 2VUMG 1XNQL 2A68D 2PW7A 2O4XA 3PF5A 2G9DA 4FF2A 3V05A 2A6EC 4BW9A 4DV0L 2Z0SA 5KNCA 2KCCA 4A3IH 4A3CH 3P8VA 3A7UA 1SYCA 1SYGA 3MZ5A 2KQ3A 4MIUA 3J80L 1H4SA 1TIID 3CHBD 1E24A 4DV3L 1UAPA 1MD2D 3EFXD 4CGYB 2UXDL 2JE6I 2XNAC 4X3SA 1JJGA 5C4JB 2NVTH 1CHQD 4Y7NH 2A8VA 2E64A 1YFRA 1PTOH 4JI5Q 2AQ1B 2F03A 2WP8J 2FXQA 3TP8A 4YWMA 2RDGA 2YTXA 2M00A 3NHHA 3WQZA 3S1MB 3EFSA 2A73B 1WTVA 2EY6A 1CQFA 3HOYB 1CA6A 2EWNA 3CCJA 4YREA 3M4OB 1IW7C 1EY9A 3LC0A 3PIP3 1MIUA 2DJZA 1Y1VB 1PZKD 5M5WB 2KHSA 2G4CA 5EQ0A 4BXXH 2E41A 5JEAH 4DR6L 2DNCA 2R92H 2B3GA 4ZIBA 1RL2A 4P71C 1SFOH 1IYUA 2L1BA 3OWFA 1NMGA 2NN6H 4DFAA 4DAMA 4A75A 5C3EB 2EY5A 3C2PA 3M3YH 3MXGA 1VMCA 2ZTGA 1ZKOA 2E2DC 1F9SA 4GN5A 4ZTZB 4HCSA 4O2DA 3CCQA 3TREA 3STBC 4HIMA 3S16B 5M9OA 4B3SL 4BBSB 1IBML 4JI0Q 1YHAA 3I91A 2N78A 1ASYA 3TMEA 1WTHA 3GV6A 4KY5A 5M5YB 1EYGA 1XNQQ 1K0SA 1BCPB 4H2XA 3T56B 4ALPA 1MGSA 2DGYA 1RHPA 1KIXA 3QWNA 4A3EH 1K83H 2QA4A 4OO1G 3CRKC 1EWIA 3AMUA 1IYVA 3UDFA 4YHHQ 2XRQD 1Q46A 3EIVA 2KA7A 3IAYA 1GUWA 3S9WA 5EKIA 3FKIH 2Z4IA 4LW1A 1C4QA 3EA6A 1LTSD 2PNRC 4P3PA 5IYDH 1ET6A 1YITA 2EZVA 4P74A 3EBEA 1ILQA 4HIDA 2AKWA 1SRYA 1RTNA 5A2QE 1AZPA 3A5UA 2NZ1D 2C5CA 5EGTA 1HA6A 4TVYA 4RQFA 4C3JG 1D2BA 1VQAA 3N52A 1J5EL 3LNNA 2M9VA 4ZRZA 4LJZC 1OXVA 4GOPC 2KJXA 1WCMB 4LF9Q 1B7YB 1QNUA 1D6EC 1SNOA 1BR9A 2IPKD 4X62L 1EY8A 2AHOB 2CCZA 2R7ZG 2F0WA 3OOCA 3PMFA 2JEAI 3E0EA 3GTMB 3A74A 2H4OA 3TS0A 2CJBA 1NNXA 2DY8A 2ZZEA 1U4RA 3GTGB 2JXMB 3EROA 2KCTA 2K52A 1SJED 4HJ7A 5M3FB 3G48A 3NSWA 4V190 1I4XA 3T1YQ 4EO4A 1SNPA 2K5WA 4DU9A 5C51B 3HOUB 5IT9c 1SYBA 3J81j 2Q7GA 2OT2A 4A3BG 3IALA 2X6GA 1F2MA 2OQKA 1EWHA 1HTLD 2NBFA 1PTOC 2WACA 1SMYC 4HR7B 3RL6A 1SE2A 3FVQA 4DAVA 3HOYG 1LO5D 3NXWA 5JVH3 4EX5A 1G291 3J7ZC 3I72A 4B3SQ 5BN5A 1IBMQ 3Q23A 4BY1G 3KBGA 3KK7A 5I4DA 2L15A 4BS9A 3ULPA 4BBRB 4Q15A 4IUVA 4ULLA 3KYHC 2ES2A 3VA5A 3E9IA 2BE5C 1OXSC 4DV4Q 3U50C 1TWAH 3NWTA 4OGQC 4OWTB 1HH2P 3KOJA 1YGBA 3D6CA 3KF6B 4B08A 1VQ7A 3NTIA 4HCEA 1CQVA 5KGUA 4ZKBB 1CA5A 2JA8B 1N33Q 4E51A 3PUXA 3JAMc 1ADJA 2ZZFA 1U4MA 4ZUIA 2BOSA 5IYCG 3CMEA 2SDFA 2QHVA 3X3NA 1OO9B 5KRUA 2E65A 3LX0A 4JBJA 3H0GG 2ZT5A 4BY7G 3CCSA 1ICWA 1J5EQ 2NVQB 1GGMA 4DR2L 3T16A 3OIPA 1PYSA 1WNLA 3MEFA 3QNEA 3J81i 3HKSA 1P8LA 4XT3B 3B6YA 5EAYA 4DNTB 2OTJA 4MTNA 1NJ8A 3TP5A 4A93G 3I90A 4JVZA 1KLGD 4FF4A 1KL9A 3ICEA 4B3RQ 1KXLA 5E1FA 5D3IB 3AEVA 1PFMA 3PIPA 1PA6A 4MHEA 4MN3A 5IGEA 3FRPB 2IL8A 1IHZA 1MSGA 5DM73 5LL6X 3CQZH 1CKMA 1HCZA 1PZJD 3RNUA 1NYRA 3H3VI 5IP9H 5JJKA 3M7NA 4JBKA 2RA4A 1A15A 5FLXE 1KABA 1NYQA 1NSNS 3GTQB 4YROA 3FMCA 1WTQA 1WCMG 3J81E 4LUZA 2R93B 3KBXA 3K7UC 1LM0A 1JCKB 4GLAC 3IG2A 3QO5A 1TWFH 1JWSD 3M4QA 2QHTA 1LT5D 1TY2A 2ZIMA 3N6RA 1S4ZA 5FK9C 3SE0A 3UDIA 4P75C 2C8MA 1I5FA 2E5AA 1ASZA 4ZKCB 1RIPA 4DQ2A 3NPPA 3K5OA 1LTTD 3IRBA 1G2SA 3QG1A 2WB1B 2L4NA 1KAAA 1I3QH 2XVSA 5CC4A 1NNHA 1K28A 2AUKA 2K6AA 2F0JA 4DUYL 4GOPB 2MP1A 3ICAA 4HJ5A 4DXFA 1MBYA 4GKKL 4TQUS 5E3IA 5H1SE 1ESRA 3W2DA 4A3KG 1LTAD 4IUTA 2FJ2A 1WFQA 1D7QA 1NJ5A 2SOBA 5FO7B 4HSVA 2ARUA 1TWCB 4A3IB 4X65L 1EQTA 1E2WA 1I50H 5IIFA 4BBRG 4XEOA 1CUKA 1TWHB 3UFGA 1B44D 3KLWA 4DR5L 4DR4L 4DK3C 3GTPB 4CS2A 5HGTA 3FHWA 1D1KA 1O7IA 4RAUC 4U68A 2PMZE 3HY0A 2EXZA 4A3DH 3KJPA 3QR8A 4Z9CB 4JI6Q 2IHFA 1A0IA 1X55A 4M1UB 1CSPA 1PLFA 4TVWA 2NVTB 1PYWD 4KN4C 1FGBD 4H2TA 3K5NA 4DF7A 2PW5A 4I65A 2MQHA 3VR5A 1F9RA 1K8GA 3UH0A 2IX3A 1N34Q 5IYCH 2ZJRA 1FNVA 1I6HH 4P73A 1BBXC 4WJWA 2A1AA 2B2YC 2DVEA 4C3IH 4L63B 4DXGA 4ME3A 1A6XA 2CQAA 1ZEQX 1Q86C 3HXXA 4J6HA 4DNRB 4GNXC 4RKBA 2OTLA 4XDXA 4IN3A 1NR2A 1PYBA 1VQMA 5HY6A 2F4IA 3GQBA 2EJFC 4IFDJ 2BA0A 2AMCA 1PH5A 4A3GG 1EVKA 4OP0A 4GLVB 5C5LA 4O0AA 2JEBI 1LABA 2IJ0A 4HVCA 1S5BD 3ER0A 3CD6A 5EJWA 1Q90A 2Z6KA 2GA4B 1JE4A 1PFNA 4IZ8A 1JICA 4JG2A 2F0OA 4G7OC 2EYPA 2XRSD 3U4ZA 1B3AA 3NETA 3QJYA 4DUYQ 1FYCA 3DUZA 3A7AB 2OXPA 2EIFA 3PUWA 2F0KA 1P16A 5IGGA 1SYFA 2D9UA 1PMRA 1EFID 1SJHD 2ZT7A 1WD0A 1JT8A 3SDZA 4XTCS 4CJ1B 1X01A 3MF2A 5ISRA 2QEXA 1CFMA 3HOXG 3ND9A 4H2UA 2CJAA 4HWRA 1ESFA 1MI2A 4JI7L 2JA7B 3FKIB 5D14A 3C1FA 2DJFC 1WI5A 2A69D 5I9PA 4FXDA 1H4VB 5EPLA 4DV5L 4A3LH 2PMFA 2G5DA 2D5DA 3GDEA 3CW2C 4OWWB 3RF1A 1RDPD 1UWVA 1JQYD 3I2ZA 2Q2UA 5CORA 2JA6H 3L2ZA 4CS4A 3RLOA 1NUCA 1G5HA 1UE6A 2K75A 1A2UA 4EQ5A 4YRRA 2B8GA 5JJIA 1O7LA 4IUQA 3SXHA 4IFDG 5IYBH 2IY5A 2PZTA 5E3FA 1C7YA 5ELBA 4RDXA 2P5IA 4LVMA 4C2MB 1GKHA 12ASA 2F1MA 2ASBA 3C1EA 4A3CG 1B70A 3CCUA 4XU0A 1SE8A 1SROA 2WFWA 3KF8B 5FO8B 2JSOA 3PO3H 3H91A 4CH4A 1V43A 1U5KA 4K87A 4YRCA 1TS5A 4ZLTF 1VQDA 3DEPA 5K5PA 3G7LA 4ZTUB 1HTPA 3R07A 1V1PB 1QF6A 5IT9E 4UP8A 3URYA 3S2DB 2A74C 3CC2A 4IPGA 4RGOS 4GKJQ 5C4XG 4DR1L 3KJOA 4JI3L 2N3SA 1UEBA 1HXDA 3LSQA 1SLJA 2EQSA 3VYTA 2RBMA 4K2KA 1A62A 1JOOA 4E6IA 3OW2A 2B63H 1HXYD 2OWOA 2V1CC 4YRIA 1DOKA 3BYYB 3SK5A 3E9HA 4YY3Q 1WYDA 1WPYA 2F0LA 3W1GA 3KFUA 1U9RA 1YB3A 3GTOB 2L55A 2PPBC 1TY0A 5D65A 2NZOA 4NP5A 2VW9A 1HNXL 4HWPA 5J22A 1I4QA 3I7FA 1E22A 4RGMA 5C44H 2DQ0A 1PH6A 5JEAG 3SVMA 4GLXA 2R92G 5G3LD 3S14H 1EUJA 1TWAB 4KKSA 2F52A 4F7XA 3HKZE 3F1ZA 4A3GH 3ERSX 5M5XH 2E2JB 2F0HA 1PDQA 2NN6G 2EAYA 3AFQA 1CKNA 2PI2E 2IW3A 2E10A 1D8LA 2L5TA 4JI7Q 1EZ8A 2CVRA 1ICFB 4AQYQ 1BIBA 2Y0SE 3V7SA 4UP7A 3MC0B 5IODA 1QZGA 1YEZA 3TP7A 2K5DA 3UGTA 4QL5A 1Y14B 1VQPA 2A6HC 4CDDC 3OW7A 4FXKC 2J7ZA 3M7GA 1DZ1A 3GTLH 4GNXB 1QWYA 2WKCA 2Z6BA 4JBWA 3J81c 1BCPF 1EIYB 3AQQA 4YYEA 4LAAA 1Y1WH 1PFBA 2F3VA 4A3EG 2Q7HA 2QDBA 2K5NA 2ZJPA 1ONLA 3CMAA 2B2TC 3CCVA 5E7NA 2QW7A 1SE3A 1FYFA 1XX8A 4QIWB 1X54A 3FKIG 1K3RA 2XN9C 1B76A 2VQFL 3CPFA 4KTAA 1RJTA 5CV9A 4CS3A 5IYDG 3PF4A 4G84A 2V4DA 1IKMA 3DEOA 2VL6A 2CW0C 4ODGA 4YRFA 1GUSA 2AQ2B 3S1NH 4H44C 4JI0L 4ME5A 3DM3A 1SYDA 4IFDH 3I4MH 3R93A 3KLSA 4C3JB 1A3TA 1Y8OB 2ZTCA 4JI3Q 2K14A 1Y8PB 1X6OA 2EYMA 4Q5VA 4LUVA 4XEMA 4DN4M 3PUVA 4Q0FA 2JA9A 3S24A 5KNNA 4YHHL 2R7ZB 3CMQA 1IYJB 2WAQE 5A2QL 1F9PA 4O42A 4XU2A 4YP0A 4K5VA 2Q2IA 3PO2G 2F0TA 4L5TA 1SERA 1HNXQ 1QE0A 4RHRA 1E1TA 1E7ZA 4CH6A 3A56A 4KMUC 2E2IB 1R9TH 3Q24A 5C4XH 1JC7A 1CT1D 1GOZA 5IGDA 2Q7EA 4FXGC 1YJNA 1KDBA 4H2YA 3S15H 4XTYA 1PH3A 1JOKA 2C35B 4CKEA 3E3XA 1M1KC 4A3BB 3A8IE 4J1MA 5C53B 3HZXA 4LF9L 2EJ9A 4A3MH 1B7YA 3OTOQ 2ENBA 1JB3A 1HFGA 1R4PB 1T5EA 2R61A 3K81C 3UDXA 1N36Q 3GTKB 2ZR3A 4LVIA 5AFWA 3HXZA 1VDZA 1WTXA 1YNJD 1H95A 1I4PA 4DKAC 3VQYA 2J3MA 1KC8C 3V7RA 4BY1B 1W6KA 1OXXK 1HTTA 1BNZA 1SYEA 3AFPA 3I4NH 2K5VA 3P1HA 4KY7A 1OXUA 1SRUA 1Q1EA 4AIMA 1GVPA 1NBWA 3T1YL 4HWSA 2JA5G 3OIQA 1VQ9A 1PRTC 4KLKA 4RMFA 3NWSA 4C3HH 4X5OA 3G4SA 1WTOA 2EYLA 2VQFQ 2ID0A 3TZDA 3L9AX 5NUCA 2D0PA 1K73C 4HT4A 4DV2L 2B39A 1TVXA 2FMCA 5JPNC 3RZOH 1GO3E 2QEJC 2ZT8A 3HGBA 1BCPD 3HOZH 2CGHA 2CKZB 3H0GB 1VQJA 1Z47A 2RSOA 3S1QB 4BY7B 4HMIA 2DU7A 1LT4D 2EJGA 4NPSA 3U4VA 3GP7A 1B53A 4DV4L 3I8ZA 3T4AC 3G6JB 1CM9A 3A5ZB 1N32L 5EPJA 3KF6A 2EE1A 5DLQE 1I4RA 4A93B 4LNQA 2CFMA 1A8VA 2O2LD 1N33L 1KLUD 4L87A 4ABNA 1SBBB 1OTCA 1KNEA 2B2WA 2KBNA 2D2CC 5M3MH 4OO1I 2A6HD 3U9OA 4C1NK 4JYAQ 1DJRD 3MXNA 4FNFA 1OXTA 3U58A 2N88A 3ITPA 1HPCA 5IP9G 1WTPA 3S1RB 3BU2A 3TSSA 5CMDA 3EQLC 3VQWA 1JB7A 2JJQA 3NP8A 3EN2A 2DEQA 4P71A 1VQEA 4PZ7A 4JI8Q 3D6WA 4DV7L 2R7FA 2F3IA 2ZXFA 4B3RL 1GXDC 4DK1A 1F2YA 3PO2H 4RHSA 1X3EA 3K5MA 1XJVA 2NB0A 5FLXL 4K5XA 2JN4A 5FLMG 2I07B 2HCIA 3BDCA 3HOVH 1JWMD 1FVIA 1HC7A 4TKOB 2DXUA 1HQMC 3K7AH 4RH6A 4PQXA 5BR8Q 3I4OA 5COYA 4TWAA 1JR0D 2A8EA 4F88A 3E0JA 2RHSB 3K6OA 1X56A 3DM1A 4P3OA 4BA1I 1C48A 2EDGA 3HTZA 2A6ED 4G7HC 4A3JH 3HS0C 5JVG3 2EY2A 3C46A 4XTVA 3M85A 2CWAA 4DAYB 4JV5L 1QCBD 2PNHA 3HKZG 4DV2Q 4YRQA 4YRJA 1RTOA 4A3KB 1KMMA 4TVAB 1NJ6A 3IKJA 1VQKA 1D5XC 5FOBB 1RD9D 4ZAIA 4GN4B 2GN5A 4S3SA 2DXTA 2Y0SG 1H9JA 1IBLL 2VZAA 1GHJA 2EYOA 4X6AH 4K6LA 4TTVA 3Q0AA 3GTJB 4IOAA 2JA5H 4CH5A 1QJOA 5LMUL 1ZYRC 1N32Q 4A3DG 3IFTA 1IZ6A 2XWBB 4QCLA 4WJ4A 1STGA 5C6AA 2DUDA 4OXPA 1S5ED 2IX0A 4HWTA 4YCUA 5FKAC 1LTBD 1G91A 1TWGH 4CDCC 2FMMA 1JMCA 1IW7D 1K0RA 3PCOB 4CBVA 2NWGA 1VQ8A 3VQXA 4KY6A 3E6ZX 4PG3A 2B63B 2ALYB 2L0CA 3CC7A 1Y69U 1VQ6A 1DD2A 4O1NA 3CKIB 3BYTB 4OELB 5CYUA 4C3IG 5E4WC 4OIKA 2Z1CA 3ULJA 2F4VQ 3RACA 5K1XA 1PRTD 3OHXC 4BWAA 1MJEA 3TDQA 4CHTB 4DV7Q 4JI6L 5C44B 2MGSA 1PRTB 4HA8A 4A3GB 2RF4A 3STBD 1II3A 4RG1A 4CKBA 1VQLA 1HZ9A 2LMCB 1LV9A 2Z8LA 4QY7A 1N34L 2WAQG 2VQEL 3EVQA 1WOCA 4G57A 2PO4A 3U9SA 1TU2B 1GUTA 3NQIA 4IALA 3PIO3 2PYKA 3NTHA 3L7ZC 1NCVA 1E2ZA 4A3FH 1EQQA 4XQJA 1VS0A 2CQOA 1D5ZC 1BKBA 3IKLA 2ICIA 4JV5Q 3HFZB 3NELA 3K5LA 4LF6Q 1TQOA 1Y1WB 3MF1A 1QILA 1QUQB 4DA2A 4PMCA 3K58A 2DU5A 1PH4A 1JWUD 3HOXB 2D0OA 1YNNC 4HEDA 1MJCA 1IBLQ 2UUCL 4G4KA 1GD7A 2B2VA 5FLMH 4RCNA 4OONA 4XU1A 2PMEA 1Y8NB 4A3LG 5ELOA 5JJLA 5T1IA 2AQ3B 3PGZA 1VCIA 5LMUQ 1YJWA 2JA6G 3KUPA 2K1BA 4RA8A 2CH4W 3RLNA 3UE1A 1YZ6A 3HRIA 2OEOA 1USYA 4I7ZC 3S1NB 2N55A 1WQ7A 3HP3A 4R8IA 2HHHQ 1SR3A 4P73C 5EBCA 2O5IC 2EL9A 3I4MB 5I2YA 2VY3A 2WKDA 4PZ6A 5IYBG 4K14A 1AH9A 3A7AA 1Z7TA 1VQCA 1TR5A 2DZCA 4G85A 1X3QA 1EIHA 1GHKA 2HQEA 5J1ZA 4QUFA 4LFBL 2F0DA 4HIKA 4WI1A 5C4JH 3PSIA 2F0MA 4UY8C 3A55A 1XXGA 4P72C 4LVKA 2ZTEA 4QJFA 4YRLA 1EQVA 5F2DA 1TS3A 4KJNA 4R4TA 3PO3G 1LYLA 3CU7A 3I73A 4L6TB 4Q6GA 2XSCA 2B2UA 3J7AF 4MTKA 1IXRA 4N8FA 4XYOA 2VB2X 3S1MH 2DN8A 3RMHA 4YDQA 1YFTA 2XTIA 2Z6KC 3VYRA 3M4OH 1J9OA 3A54A 1PTOD 1SMYD 2VS1A 2KCNA 3BDOA 5A35A 4JOIC 4TQDA 1Y1VH 4Y7NB 5C4XB 5M5WH 1PTOB 1L1OC 3S15B 1PH8A 4RGNA 4JK1C 3DMUA 5KYLA 2NTTA 3ZYYX 2BCOA 5FO9B 2NZHA 3OMCA 2KENA 3FPPA 2VQEQ 1E3PA 3L2PA 2B63G 2YU9H 4A76A 4EQOA 3ERQA 1IL8A 5C3EH 2BE5D 3PQIA 1O7ZA 1S3OA 2NYZD 2ZT9C 1UEAB 5IT9L 4L8JA 1VQHA 1K3BC 3NE5B 5K1PA 1Q7YC 4ZQ3A 4HJAA 2F0IA 2K28A 4AYBE 3S16H 5C44G 2RDFA 3MXUA 4H2VA 2R92B 3AU7A 4BBSH 1V1PA 2QF7A 3NEMA 1PH1A 1SFOB 2UUAQ 1DYQA 4F8MA 5E4XA 4GKJL 1HFNA 5JOBA 4CDFC 3QB3A 2LSSA 1FD7D 5T1GA 5M5YH 5G3LF 3M3YB 2ZR2A 1NE3A 2UUCQ 2QKIC 3D4WA 3F8TA 1HUMA 4LNSA 4XTXA 4WORA 2AUJD 4IPDA 2PCFB 4J15A 4DK0A 3QO2A 1KRTA 1G6PA 1NAPA 2JP1A 4B9XA 4YY3L 5EKKA 1PH7A 3RZOB 1XPUA 1GJXA 1BIAA 2GVBA 3UI2A 4RCOA 3HOZB 3A8KE 1XMQQ 1C8CA 5BN3A 1SNQA 1Q12A 3V7CA 3JAML 5ELCA 3G71A 4PZ8A 4LFBQ 4K8JA 1MSHA 1Y1WG 4A3EB 3TEGA 2ZTDA 4UAIA 1K83B 1SMXA 2UU9L 1BBUA 5CR3A 2I5MX 3BVZA 1HR0W 3J80c 1ENFA 2RHQB 1G5IA 1GUGA 4AQYL 1RCVD 5C0XJ 2B29A 3ULLA 3S17H 2QCPX 2I4MA 3ERRA 1VMPA 3CCMA 2D62A 3GTMH 1RODA 3PV0A 5DM63 2A68C 3I4LA 4L5SA 3I4MG 3GTGH 1A3UA 2LS01 2ZINA 2RSNA 4L5RC 2PMZB 4QB4A 5M3FH 3K0YA 1EWCA 4LF7Q 1FNUA 1EIYA 3G1ZA 4TRDA 5DAUA 3IKMB 2EJFA 1STAA 1YNND 1H9MA 4IFDI 3D31A 5K36H 2HIVA 2CJ9A 3HOUH 3GV3A 1PZID 4QQBX 3RKWA 4POGA 3PO2B 3PIOA 1G2TA 4ZK9B 1NY4A 2JQOA 1XNRQ 4FO2A 1F2ZA 4DR7Q 2ZXOA 2IHEA 3P8TA 4P2CB 1DGSA 4JBMA 4LF8Q 3HOVB 1ZXTA 4HAEA 4DV6Q 1X2GA 1A63A 2I4NA 2HDMA 2CHBD 3OYYA 2DY7A 4IO9A 1STNA 2K7VA 1HZCA 4N9PA 4PV1C 4KJOA 3FP9A 4YWLA 1EOTA 3C3LA 3O13A 4H2WA 3H6MA 4A3MG 3W1BA 1O80A 1EFWA 4OLFA 2EY1A 5C0XG 1QNKA 3BJUA 4P3NA 1H4QA 2A5HA 2E74C 3RD4A 3UGQA 3I4NG 1W2BA 4LMQD 1EEFD 1VQBA 3J7YW 2JA5B 1KMNA 2JK8A 2I5LX 1SXTA 2B8FA 2KCMA 4J8QA 2OQ0A 1LT3D 1XYIA 5IGCA 1EU3A 3MAQA 1EOVA 2UU9Q 1L1OB 4LK1C 3DWAA 5ELDA 4C3HG 2ZXRA 1QVFA 2NVQH 3J7A5 1ML0D 1UE7A 3BFMA 4K86A 4POFA 1DONA 1H9KA 2F0PA 3OTOL 2Q8RE 2C9OA 4NMZA 5IOCA 2K5QA 4FDBA 4JW0A 1N36L 1TWGB 4K0KQ 1LTRD 1TT2A 2UXBQ 2NN6I 3WWVA 1HUNA 5C3XA 4C56C 1D1IA 4DV1Q 1WLEA 1LT6D 3L1AA 3TEHB 2N8NA 2F0GA 1K8AC 3A7RA 3HOZG 3DSQA 4HSPA 3QIAA 1NMFA 2PQAB 2KECA 5CV5A 3R8BA 3I55A 2NVXH 2AWNA 2DNEA 4OEMB 1Q81C 1Z7NA 2KOLA 1I4HA 1WJJA 4NXNL 2I4LA 1DCZA 5KNBA 3K59A 1V1QA 1LTID 1T9HA 3A8JE 1CKOA 2PQEA 2ATWA 3PUYA 2DKGA 4K6DA 4QF4A 4B3MQ 1HNZQ 2QHSA 3GTQH 2XWJB 3QO8A 1B3QA 5C4HA 3H94A 3F2CA 1E0BA 1KD1C 1BO0A 4JC0A 3QOLA 2R93H 1L2FA 3HOWG 2HCCA 5M3MG 4PMBA 4UHVA 4H13C 1EYAA 3TQYA 4EQPA 5CV8A 2OF1A 3CQZB 4RGTA 2KVMA 2RKSA 2KEEA 5KEEA 4KN7C 2I0QA 4IPHA 4NXMQ 2BH8A 4LUOA 1HR0L 3RN2A 5GAHC 4OHJA 3A5ZA 4IJHA 2E2HH 1BUVT 2K01A 1EY6A 1Z9FA 4KD3A 4DK6C 1TWFB 3VBBA 2L11A 2M2LA 5HURA 2Q2HA 1V1OA 3QTCA 3UE0A 3CP0A 1KAWA 3SHLA 1CHPD 4RKLA 4JYAL 2DZ9A 3CC4A 4XTUA 3HOVG 3FDTA 1PH9A 5CV7A 1M4VA 3LGJA 2R3ZA 3BVGA 1G8ZD 3TZUA 1X9NA 1F2LA 4YPFA 1TWCH 1IL2A 1I94L 5DEHA 1IKLA 1TWHH 1I3QB 3KLSX 1A2TA 1NTGA 3R2IA 3GTPH 4AYBG 4A3JG 3HEJA 4R4OA 4JI8L 3MTSA 5C0XH 2ZZGA 4LF5Q 3HKZB 5IGFA 2EJGC 3FEWX 1SNDA 1SNMA 2B2TA 2DTOA 1U4LA 3MFYA 4FP5D 2Z9HA 3RN5A 1VQ5A 5IP7H 1I50B 1CKNB 1AEXA 4NB3A 2Y0SB 4R8NA 1HHVA 4KR2A 1XPOA 4JPBW 1UE1A 1H9SB 1IBKQ 4X64Q 4NXNQ 5BR8L 1B50A 4CJ0B 4R1JA 2B2WC 1CSQA 2K4KA 4P74C 1FL0A 4MZ9A 2HDLA 4A3DB 2RHSA 4H2SA 3K8AA 5LMNW 2H1EA 2SNMA 1JJCB 2WIIB 1R4QB 2Q2TA 4DAYA 4JI4Q 3RGLA 1YHQA 3BDLA 4TVAA 1YI2A 1J5WA 4XQQA 1I6HB 3I70A 5ELFA 1SEBD 2YU9B 1ILPA 3X3MA 5KYIA 3NQTA 2Q5IA 2MO0A 4C3IB 4ZYSA 1HR0Q 1O7YA 3KDFB 4IQZA 1VQZA 2UUBQ 3NBHB 4LFAL 1EYDA 1EVLA 5FJ8G 2FYKA 2J4XA 1VQGA 1YNXA 4JI1Q 2RDHA 2YV5A 4JI2L 3L4GB 4Y52H 2K04A 1STEA 1PRTF 4CDEC 4FF1A 4APVA 3J80i 3EFRA 4LVJA 1KQSA 2WINB 2EPBA 3HY1A 3NENA 1KDAA 3HOWH 3M9BA 1LLRD 1MHWC 1VQFA 1EY0A 3PCOA 1PFSA 1W3SA 2ARSA 2WAQB 4B3TL 1WD1A 3BVMA 3T1HL 4DV0Q 2ALYA 1I94Q 3AYHB 2LY7A 1JOQA 4YRGA 2F0QA 4ID6A 2JA7H 2J0TD 4TSSA 4A3FG 2N49A 2F4VL 1LUZA 2X69A 4MNOA 5JPMC 1LTGD 4KQEA 4CH3A 3LWEA 4UDUC 1KTKA 4DV3Q 2F0NA 2K32A 3OMGA 2UXDQ 2ZXPA 3F2DA 4YRTA 1QE6A 1PVOA 4KHVA 4RWSC 3VYSA 3J80E 2LXJA 2CW0D 3HRKA 2VUMH 2BH2A 4TQFA 5IE8A 1HZAA 3VYUA 3LWUA 1S5CD 3FPUB 3S2HH 3J81L 4YWKA 4C2MH 3S17B 1FGUA 2SEBD 4NDXA 4X3UA 3CXCA 2JA6B 3MEYA 1JORA 1AZQA 3MHBA 3MFGA 4RQEA 5JJZA 4WFN3 3DHQA 5HGQA 1BDOA 3HFZA 1STHA 1B1ZA 4LF6L 3TS2A 4DR6Q 3LSSA 3TBIB 3CCRA 1QUQA 1X3PA 4M8AA 1B9NA 3VR4A 3S2DH 1M90C 4NKLA 4XXEA 3QOJA 4QGUA 3PO3B 1S5DD 1TXYA 2BDNA 3J7AV 1T5XD 1WVLA 2O5JC 1D5MC 2DTHA 1YFSA 4IPCA 4LFAQ 3M4YA 2Q8IB 4C1NI 2HIXA 5F5WA 5EKLA 4HWOA 3NTKA 2HQLA 1EY4A 2YTVA 4JI2Q 2HHHL 3GTOH 4GOPA 1Y1VG 3EJIA 1C9OA 5LHY1 1HRJA 2WB1E 5GAGC 3HXUA 1STBA 1QVGA 1G6ZA 2DJGC 3GD7A 2NTSA 1STYA 1PTOF 2PZWA 4H2XB 1VQIA 3HG9A 1V9PA 3W3AA 3T53B 1KHIA 3D8GA 4DR3L 1EY5A 1GUNA 4YCVA 1YIJA 4B3TQ 4EVOA 2E2JH 4HIOA 3BZCA 3T1HQ 3RZDH 1MKHA 5C3EG 2HD3A 2UXCL 3RUXA 3DLLA 3K0XA 3M4PA 5LMNL 3OWEB 1XTDA 3OD1A 4YRPA 2NVYH 2E8GA 3ND8A 5KNDA 2E5LL 1PV4A 4ILWA 1SE4A 2B2VC 3KLRA 3W5OA 2AKWB 4XQNA 5FJ8H 1X65A 1N8RC 4BA2I 1X3FA 3MXNB 4BBSG 3S14B 5CBEE 2RCFA 4XT1B 5M5XB 2F0UA 1USYC 2YTYA 4XU3A 4NW2A 4DUZL 2K50A 4CKCA 1K9MC 1AW7A 3JC66 1KRSA 2XIWA 4HJ8A 1EIFA 3RUZA 5I6YA 2NUCA 3RIRA 1VQ4A 1WQWA 3BS1A 2A19A 4OO1H 1C0AA 2HUGA 3WOEA 4X62Q 1KDCA 3CCEA 4KV6A 2BDOA 3A0JA 5C3WA 1RKNA 3H09A 1BBWA 1SAPA 2MPMA 1NR4A 1TS4A 2G9HD 2MNAA 5JAVA 2NVXB 3P75A 4EQNA 3GTLB 2B2UC 2WV6D 3CCLA 2ZT6A 4LF4L 2KHIA 3V96A 5IY0A 2UUAL 4DPGA 1NJIC 2EYHA 2A69C 4C3JH 1QB5D 2RCNA 2F0VA 2EYFA 4R4IA 4WRDA 3SK6A 3VR3A 2I46A 3F2UA 2Q5HA 3PZCA 2ZM6L 1QZHA 4A4IA 4U673 4DAPA 2K05A 4OWXB 2K03A 2QDLA 3RR5A 2EVBA 3HRZC 5ELNA 4ZUJA 1CTMA 3I56A 2R7ZH 2F0FA 2IX1A 3V8LA 1UE5A 4KHZA 3SK4A 1SESA 2QGQA 4YRSA 1EU4A 4OL7A 2ZJQA 1XMQL 4OIJA 4F87A 3A31A 4XTZA 4PMWA 5CV6A 5M3FG 5ELEA 3RKYA 2R6GA 4G7ZC 3NUCA 3MQZA 4NCXA 2E2IH 1E1OA 1Q82C 5GADC 4DR3Q 4R4CA 3RLFA 2I4OA 2E2HB 5K36G 3HOUG 2MO1A 2UXCQ 2E1HA 4H02A 3WOFA 4YIJA 4A3BH 5LMNQ 1AE3A 2RHQA 5IGBA 1H4TA 3GTKH 1J6QA 3AB9A 2DQ3A 1F77A 3CPWA 11ASA 3RKXA 2E5LQ 3HOYH 1X3GA 5CV4A 5C5MA 3TRZA 1Q1BA 3PUZA 2ZCEA 2ZIOA 4BY1H 1SNCA 3HXYA 2J3LA 3Q8DA 4KKUA 3TN2A 1R9TB 1M8AA 1U4PA 1XPRA 1BVSA 4DUZQ 1H9RA 1QOHA 4K2LA 4LF7L 1PYSB 1X32A 1UNSA 4KK7A 4DR2Q 4R4QA 5D3DA 1CI3M 4A3MB 1EYCA 1ENCA 1O78A 3DWPA 4JCVE 4V0BA 1HNWL 3KF8A 3IL8A 1FJGL 4P75A 1ZYRD 4GS3A 2JA8G 5GROA 2TMPA 5I9OA 1YBYA 4N9TA 5AJ3L 1XNRL 3TP6A 1VQOA 3I4NB 4DR7L 1WU7A 1V8QA 2E76C 4FVMA 4RFBA 4LF8L 3V8JA 3L0OA 2HNIA 4DV6L 3VR2A 2BA1A 1LACA 3T51B 5C52B 4LF4Q 3A32A 3G6EA 1JE5A 2LFNA 3H0GH 3D3RA 3S1QH 4BY7H 3CRLC 1BXTA 4I7AA 4BWGB 1Q8KA 4GN3B 4C3HB 2VNUD 1DOLA 4ZCKA 3NBIA 4LVLA 2L9HA 2ZM6Q 2EXDA 1EIGA 2PZUA 5CGKA 4R9WA 4P72A 3BZKA 2F0EA 4A93H 4KR3A 1Q3LA 3L3OC 1CZGA 3P7JA 4K88A 3H3VH 3A7LA 1SSOA 1J8IA 1BOSA 1EL0A 1W66A 1E2VA 4HN7A 3BZDB 3E5SA 3D0FA 1RF2D 2XGTA 4IURA 4QUCA 3HXVA 1UUPA 4KI0A 1JJ2A 4JOIA 2VXWA 4WJ3M 3HFVA 2CIMA 3QO7A 1EZ6A 1ATIA 2ZNJA 4UPAA 2MHVA 3GO5A 1L1OA 3S1RH 5BN4A 1XMOL 3R3OA 3D4DA 4KHPL 3A5YA 2FINB 3OSOA 4UP9A 1SDFA 1WCMH 2ODRC 2NS6A 4GKKQ 3P20A 4K0KL 2R93G 3W3SA 5L37A 5LL6S 3HOWB 3ZJYC 2UXBL 1HJPA 1HA5A 5M3MB 3VA7A 1AN8A 1VF7A 3MVVA 4DV1L 2B2YA 1L0WA 1QG7A 3D4RA 3TEHA 2Q8TA 2EYJA 4YCWA 1L0YB 2F0SA 2PQAA 4X65Q 4OX9L 3ONAB 5I2XA 4PHCA 4DR5Q 4GNXA 4DR4Q 4EGVA 4KD4A 2KHJA 5CBAE 4YRMA 1ADYA 1KOGA 2WB1G 4B3ML 1HNZL 1HNWQ 1FNWA 3MA2B 2QHUA 1B4OA 2I5HA 1CK1A 1FJGQ 2ZNIA 4LFCL 4QIWE 2RQXA 5AJ3Q 1VQNA 1ET9A 2P5ZX 3REXA 2VUMB 1N9WA 1TKWB 1VF5C 5JEAJ 3UDGA 5IWAL 4A3KH 2YYZA 3S2HB 3K7AB 1HQRD 3TUPA 2EJMA 2K5HA 4A3IG 4BBRH 1YJ9A 2IWHA 4NXML 4K8IA 2ZGWA 1W6JA 3REUA 2MJ8A 4IUNA 2LXKA 4X3KA 4XYQA 1YVCA 3WDNA 4AYBB 2R7DA 3GTJH 4A3JB 4PNYA 3I3CA 4FYDA 1YNJC 1L0XB 1SN8A 5TSSA 2X6LA 2DTIA 4X66L 2MUYA 2TSSA 1I4GA 3R2TA 1KNAA 2AMCB 3MEHA 1QVCA 1LTLA 2JA8H 2IT1A 2LKVA 5IP7G 1NJ2A 4YRKA 2KUMA 5C0XI 1F9QA 3JAMi 1B9MA 1K8MA 1GM5A 1HZBA 4IUPA 2MFIA 2C7IA 5GQOA 1AFPA 3VR6A 1GUOA 3Q6SA 3MWYW 3BG3A 4X3TA 5C4ZA 1PXUA 5J39A 2RVLA 1I6VC 1YHBA 1WTWA 3DWQA
chains in the Genus database with same CATH topology
4XTWA 3F2BA 1XMOQ 4LWCA 1S72A 4KHPQ 4WF2A 3V8KA 2P0LA 4LF5L 2AWOA 2OCEA 4BXXG 2PI2A 1RIQA 5J3BA 2H5XA 2ARTA 1NJ1A 4OX9Q 4JI5L 4XIGS 1IBKL 4X64L 1PHJA 4DV5Q 1G51A 3FJPA 4AH6A 1AE2A 2IY5B 1JJCA 1EQRA 3H15A 4LFCQ 5FLXc 3HXWA 4JI4L 2DDZA 5IWAQ 3SGIA 5GAEC 3CF5A 1SETA 2E3CA 2CWPA 3HOXH 1B70B 4IOCA 3VQVA 2GVAA 2JA7G 2HT1A 1PH2A 4YRNA 4L5QA 3KDFA 4IJLA 1Z7MA 3P8YA 1X2HA 2UUBL 4DNIA 4X66Q 2ODRD 4JI1L 3VDYA 3L4GA 1S40A 1U0LA 1B8AA 3K80C 3CAMA 4HJ9A 4DR1Q 2VUMG 1XNQL 3PF5A 4BW9A 4DV0L 2Z0SA 4A3IH 4A3CH 3P8VA 3A7UA 1H4SA 1E24A 4DV3L 2UXDL 2JE6I 1JJGA 2NVTH 4Y7NH 2A8VA 2E64A 1YFRA 4JI5Q 2WP8J 2FXQA 4YWMA 2YTXA 3WQZA 3EFSA 2EWNA 3CCJA 4YREA 3LC0A 1MIUA 2DJZA 2G4CA 4BXXH 2E41A 4DR6L 2R92H 2B3GA 4ZIBA 1RL2A 4P71C 1SFOH 1NMGA 4DAMA 4A75A 3M3YH 2ZTGA 4GN5A 4ZTZB 4O2DA 3CCQA 3TREA 3STBC 4HIMA 4B3SL 1IBML 4JI0Q 1YHAA 2N78A 1ASYA 1EYGA 1XNQQ 4H2XA 4ALPA 2DGYA 1KIXA 4A3EH 1K83H 2QA4A 4OO1G 1EWIA 3UDFA 4YHHQ 3EIVA 1Q46A 3FKIH 4LW1A 4P3PA 5IYDH 1YITA 4P74A 3EBEA 4HIDA 2AKWA 1SRYA 3A5UA 4TVYA 4RQFA 1VQAA 1J5EL 1OXVA 4GOPC 4LF9Q 1B7YB 4X62L 2AHOB 2R7ZG 2CCZA 2JEAI 3E0EA 3A74A 3TS0A 2CJBA 2ZZEA 2KCTA 2K52A 4HJ7A 3G48A 3T1YQ 4EO4A 5C51B 5IT9c 3J81j 2Q7GA 4A3BG 3IALA 2OQKA 3RL6A 3HOYG 4EX5A 1G291 3J7ZC 4B3SQ 1IBMQ 4BY1G 2L15A 3ULPA 4Q15A 3KYHC 2ES2A 3E9IA 1OXSC 4DV4Q 3U50C 1TWAH 4OWTB 1HH2P 3KOJA 1YGBA 3KF6B 1VQ7A 1N33Q 4E51A 3PUXA 3JAMc 1ADJA 2ZZFA 5IYCG 3CMEA 2QHVA 2E65A 4JBJA 3H0GG 2ZT5A 4BY7G 3CCSA 1J5EQ 1GGMA 4DR2L 1PYSA 1WNLA 3MEFA 3QNEA 3J81i 3HKSA 1P8LA 3B6YA 5EAYA 2OTJA 4MTNA 1NJ8A 4A93G 1KL9A 3ICEA 4B3RQ 1KXLA 3AEVA 3PIPA 1PA6A 3CQZH 1CKMA 3RNUA 1NYRA 3H3VI 5IP9H 5JJKA 3M7NA 4JBKA 1NYQA 4YROA 1WCMG 4LUZA 3K7UC 1LM0A 4GLAC 3IG2A 3QO5A 1TWFH 3M4QA 2QHTA 2ZIMA 4P75C 3UDIA 2C8MA 1I5FA 2E5AA 1ASZA 1RIPA 4DQ2A 3IRBA 1I3QH 1NNHA 4DUYL 4GOPB 3ICAA 4HJ5A 4GKKL 4TQUS 5E3IA 5H1SE 4A3KG 1WFQA 1D7QA 1NJ5A 2ARUA 4XEOA 4X65L 1I50H 4BBRG 1CUKA 3UFGA 3KLWA 4DR5L 4DR4L 4DK3C 4CS2A 3FHWA 1O7IA 2PMZE 3HY0A 4A3DH 3KJPA 4JI6Q 2IHFA 1A0IA 1X55A 1CSPA 4TVWA 4H2TA 2MQHA 1K8GA 3UH0A 1N34Q 5IYCH 2ZJRA 1I6HH 4P73A 2A1AA 2DVEA 4C3IH 4ME3A 1Q86C 3HXXA 4GNXC 2OTLA 1PYBA 1VQMA 5HY6A 4IFDJ 2BA0A 2AMCA 1PH5A 4A3GG 1EVKA 4OP0A 4GLVB 4O0AA 2JEBI 4HVCA 3ER0A 3CD6A 2Z6KA 4JG2A 3U4ZA 3NETA 4DUYQ 2EIFA 3PUWA 1P16A 2ZT7A 1JT8A 4XTCS 1X01A 3MF2A 2QEXA 3HOXG 4H2UA 2CJAA 4HWRA 4JI7L 1WI5A 1H4VB 4DV5L 4A3LH 2PMFA 4OWWB 3GDEA 3CW2C 3RF1A 3I2ZA 1UWVA 2Q2UA 2JA6H 4CS4A 3L2ZA 3RLOA 1G5HA 1UE6A 2K75A 4EQ5A 4YRRA 5JJIA 4IFDG 5IYBH 2IY5A 1C7YA 4RDXA 2P5IA 4LVMA 12ASA 1GKHA 2ASBA 4A3CG 1B70A 3CCUA 4XU0A 1SE8A 1SROA 2WFWA 3KF8B 3PO3H 4CH4A 1V43A 1U5KA 4K87A 4YRCA 1VQDA 4ZTUB 3R07A 1QF6A 4UP8A 3CC2A 4IPGA 4GKJQ 5C4XG 4DR1L 3KJOA 4JI3L 2N3SA 1UEBA 1HXDA 3LSQA 1SLJA 2EQSA 1A62A 3OW2A 2B63H 2OWOA 2V1CC 4YRIA 3E9HA 4YY3Q 1WYDA 1WPYA 3W1GA 3KFUA 1YB3A 2NZOA 2VW9A 1HNXL 4HWPA 3I7FA 2DQ0A 1E22A 5C44H 1PH6A 5JEAG 4GLXA 2R92G 3S14H 1EUJA 2F52A 3HKZE 3F1ZA 4A3GH 3ERSX 5M5XH 2NN6G 2EAYA 3AFQA 1CKNA 2PI2E 2E10A 1D8LA 4JI7Q 4AQYQ 1BIBA 2Y0SE 3V7SA 4UP7A 1QZGA 1YEZA 3UGTA 4QL5A 1Y14B 1VQPA 3GTLH 4GNXB 4JBWA 3J81c 1EIYB 3AQQA 4YYEA 1Y1WH 4A3EG 2Q7HA 2K5NA 2ZJPA 3CMAA 3CCVA 5E7NA 1FYFA 1X54A 3FKIG 1K3RA 1B76A 2VQFL 3CPFA 4CS3A 5IYDG 3PF4A 4G84A 2VL6A 4YRFA 3S1NH 4JI0L 3DM3A 3I4MH 2ZTCA 4JI3Q 2K14A 1X6OA 4LUVA 4XEMA 3PUVA 2JA9A 3S24A 5KNNA 4YHHL 3CMQA 1IYJB 2WAQE 4XU2A 4YP0A 2Q2IA 3PO2G 4L5TA 1SERA 1HNXQ 1QE0A 1E1TA 1E7ZA 4CH6A 1R9TH 5C4XH 2Q7EA 4H2YA 1YJNA 3S15H 4XTYA 1PH3A 2C35B 1M1KC 5C53B 4LF9L 2EJ9A 4A3MH 1B7YA 3OTOQ 3UDXA 1N36Q 3K81C 2ZR3A 4LVIA 3HXZA 4DKAC 3VQYA 2J3MA 1KC8C 3V7RA 1OXXK 1HTTA 3AFPA 3I4NH 2K5VA 1OXUA 1SRUA 1Q1EA 4AIMA 1GVPA 1NBWA 3T1YL 4HWSA 2JA5G 1VQ9A 4KLKA 4RMFA 4C3HH 4X5OA 3G4SA 2VQFQ 2ID0A 2D0PA 1K73C 4HT4A 4DV2L 3RZOH 1GO3E 2ZT8A 3HOZH 2CGHA 2CKZB 1VQJA 1Z47A 2DU7A 2EJGA 4NPSA 3U4VA 4DV4L 3A5ZB 1N32L 3KF6A 5DLQE 4LNQA 2CFMA 1A8VA 1N33L 4L87A 1OTCA 2KBNA 5M3MH 4OO1I 4JYAQ 1OXTA 3U58A 5IP9G 3BU2A 3VQWA 1JB7A 2JJQA 3EN2A 2DEQA 4P71A 1VQEA 4PZ7A 4JI8Q 4DV7L 2R7FA 2F3IA 2ZXFA 4B3RL 3PO2H 1X3EA 1XJVA 5FLMG 3HOVH 1FVIA 1HC7A 2DXUA 3K7AH 5BR8Q 3I4OA 4TWAA 2A8EA 2RHSB 1X56A 4P3OA 4BA1I 3HTZA 4A3JH 4XTVA 3M85A 4JV5L 2CWAA 4DAYB 4DV2Q 2PNHA 3HKZG 4YRQA 4YRJA 1KMMA 4TVAB 1NJ6A 1VQKA 2GN5A 4GN4B 2DXTA 2Y0SG 1IBLL 2VZAA 4X6AH 4TTVA 4IOAA 2JA5H 4CH5A 5LMUL 1N32Q 4A3DG 1IZ6A 4WJ4A 2DUDA 4OXPA 2IX0A 4HWTA 4YCUA 1TWGH 1JMCA 1K0RA 3PCOB 1VQ8A 3VQXA 4PG3A 2ALYB 3CC7A 1VQ6A 3ULJA 2F4VQ 3RACA 5K1XA 4BWAA 1MJEA 4DV7Q 4JI6L 4HA8A 2RF4A 3STBD 4RG1A 1VQLA 1HZ9A 4QY7A 1N34L 2WAQG 2VQEL 1WOCA 3L7ZC 4A3FH 1EQQA 1VS0A 2CQOA 1BKBA 3IKLA 4JV5Q 3HFZB 3NELA 4LF6Q 3MF1A 1QUQB 2DU5A 1PH4A 2D0OA 1MJCA 1IBLQ 2UUCL 1GD7A 5FLMH 4OONA 4XU1A 2PMEA 4A3LG 5ELOA 5JJLA 3PGZA 1VCIA 5LMUQ 1YJWA 2JA6G 3RLNA 3UE1A 1YZ6A 3HRIA 1USYA 1WQ7A 4P73C 2HHHQ 1SR3A 2EL9A 1AH9A 5IYBG 2VY3A 4PZ6A 3A7AA 1VQCA 2DZCA 4G85A 4LFBL 4HIKA 4WI1A 5C4JH 3PSIA 4UY8C 4P72C 4LVKA 2ZTEA 4QJFA 4YRLA 4R4TA 3PO3G 1LYLA 4Q6GA 1IXRA 3S1MH 4YDQA 1YFTA 2XTIA 2Z6KC 3M4OH 2VS1A 4JOIC 4TQDA 1Y1VH 5M5WH 1L1OC 1PH8A 2NZHA 2KENA 2VQEQ 1E3PA 3L2PA 2B63G 2YU9H 4A76A 5C3EH 1S3OA 1VQHA 5K1PA 1Q7YC 4HJAA 4AYBE 3S16H 5C44G 4H2VA 4BBSH 3NEMA 1PH1A 2UUAQ 4GKJL 2LSSA 5M5YH 2ZR2A 1NE3A 2UUCQ 3F8TA 4LNSA 4XTXA 4J15A 4IPDA 1KRTA 1G6PA 1PH7A 4YY3L 1XPUA 1BIAA 2GVBA 1XMQQ 1Q12A 3V7CA 3G71A 4PZ8A 4LFBQ 1Y1WG 3TEGA 2ZTDA 1SMXA 2UU9L 1BBUA 2I5MX 1HR0W 3J80c 2RHQB 1G5IA 4AQYL 5C0XJ 2B29A 3ULLA 3S17H 2I4MA 3ERRA 3CCMA 2D62A 3GTMH 3PV0A 4L5SA 3I4MG 3GTGH 2ZINA 4L5RC 5M3FH 4LF7Q 1EIYA 3G1ZA 3IKMB 2EJFA 4IFDI 3D31A 2CJ9A 2HIVA 3HOUH 4QQBX 3RKWA 4POGA 3PIOA 1NY4A 2JQOA 1XNRQ 4DR7Q 2IHEA 3P8TA 1DGSA 4JBMA 4LF8Q 4DV6Q 1X2GA 1A63A 2I4NA 3OYYA 4IO9A 1HZCA 3FP9A 4YWLA 4H2WA 4A3MG 3W1BA 1EFWA 4OLFA 5C0XG 3BJUA 4P3NA 1H4QA 3UGQA 3I4NG 1W2BA 1VQBA 1KMNA 2JK8A 2I5LX 2KCMA 2OQ0A 1EOVA 2UU9Q 1L1OB 2NVQH 3J7A5 1QVFA 3BFMA 4K86A 1UE7A 4POFA 3OTOL 1N36L 4FDBA 4K0KQ 2UXBQ 2NN6I 3WWVA 4DV1Q 1WLEA 3L1AA 3TEHB 2N8NA 1K8AC 3A7RA 3HOZG 3DSQA 1NMFA 2PQAB 3I55A 2NVXH 2AWNA 1Z7NA 1Q81C 1WJJA 4NXNL 2I4LA 1V1QA 1T9HA 1CKOA 2ATWA 3PUYA 2DKGA 4B3MQ 1HNZQ 2QHSA 3GTQH 3QO8A 3F2CA 1KD1C 4JC0A 2R93H 1L2FA 3HOWG 5M3MG 3TQYA 2I0QA 4IPHA 4NXMQ 2BH8A 4LUOA 1HR0L 3RN2A 5GAHC 3A5ZA 4IJHA 2E2HH 1Z9FA 4DK6C 3VBBA 2Q2HA 3QTCA 3UE0A 3CP0A 1KAWA 4JYAL 2DZ9A 3CC4A 4XTUA 3HOVG 1PH9A 3LGJA 1X9NA 4YPFA 1TWCH 1IL2A 1I94L 1TWHH 1NTGA 3GTPH 4AYBG 4A3JG 4R4OA 4JI8L 2ZZGA 4LF5Q 2DTOA 3RN5A 1VQ5A 5IP7H 1CKNB 4NB3A 4KR2A 1XPOA 1UE1A 1IBKQ 4X64Q 4NXNQ 5BR8L 4R1JA 1CSQA 2K4KA 4P74C 1FL0A 4MZ9A 4H2SA 2RHSA 3K8AA 5LMNW 1JJCB 2Q2TA 4JI4Q 3RGLA 1YHQA 4TVAA 1YI2A 1J5WA 2Q5IA 2MO0A 1HR0Q 3KDFB 1VQZA 2UUBQ 3NBHB 4LFAL 1EVLA 5FJ8G 2FYKA 1VQGA 1YNXA 4JI1Q 2YV5A 4JI2L 3L4GB 4Y52H 4LVJA 4APVA 3J80i 3EFRA 1KQSA 3HY1A 3NENA 3HOWH 3M9BA 1VQFA 3PCOA 1PFSA 1W3SA 2ARSA 4B3TL 3T1HL 4DV0Q 2ALYA 1I94Q 3AYHB 4YRGA 2JA7H 4A3FG 2N49A 2F4VL 1LUZA 4MNOA 4KQEA 4CH3A 4DV3Q 2UXDQ 3F2DA 4YRTA 1PVOA 2LXJA 3HRKA 2VUMH 2BH2A 4TQFA 5IE8A 1HZAA 3S2HH 4YWKA 4C2MH 1FGUA 3CXCA 3MEYA 4RQEA 5HGQA 3HFZA 4LF6L 3TS2A 4DR6Q 3LSSA 3CCRA 1QUQA 3S2DH 1M90C 4QGUA 1TXYA 2DTHA 1YFSA 4IPCA 4LFAQ 5F5WA 2HIXA 4HWOA 2HQLA 2YTVA 4JI2Q 2HHHL 3GTOH 4GOPA 1Y1VG 1C9OA 2WB1E 5GAGC 3HXUA 1QVGA 3GD7A 4H2XB 1VQIA 1V9PA 1KHIA 4DR3L 4YCVA 1YIJA 4B3TQ 2E2JH 4HIOA 3BZCA 3T1HQ 3RZDH 1MKHA 5C3EG 2UXCL 3RUXA 3DLLA 3K0XA 3M4PA 5LMNL 3OD1A 1XTDA 4YRPA 2NVYH 2E8GA 2E5LL 1PV4A 3W5OA 1N8RC 2AKWB 5FJ8H 1X65A 4BA2I 1X3FA 3MXNB 4BBSG 1USYC 2YTYA 4XU3A 4DUZL 2K50A 1K9MC 3JC66 1KRSA 4HJ8A 1EIFA 3RIRA 1VQ4A 1WQWA 2A19A 1C0AA 4X62Q 3CCEA 3A0JA 1BBWA 2MNAA 3CCLA 2ZT6A 4LF4L 2KHIA 2UUAL 5IY0A 4DPGA 1NJIC 4C3JH 2RCNA 4R4IA 2Q5HA 3PZCA 2ZM6L 1QZHA 4A4IA 4OWXB 3RR5A 5ELNA 3I56A 2R7ZH 2IX1A 3V8LA 1UE5A 4KHZA 1SESA 2QGQA 4YRSA 2ZJQA 1XMQL 3A31A 4XTZA 4PMWA 5M3FG 3RKYA 2R6GA 3MQZA 4NCXA 2E2IH 1E1OA 1Q82C 5GADC 4DR3Q 4R4CA 3RLFA 2I4OA 5K36G 3HOUG 2MO1A 2UXCQ 2E1HA 4H02A 4A3BH 5LMNQ 1AE3A 2RHQA 1H4TA 3GTKH 1J6QA 2DQ3A 3CPWA 11ASA 3RKXA 2E5LQ 3HOYH 1X3GA 3TRZA 1Q1BA 3PUZA 2ZCEA 2ZIOA 4BY1H 3HXYA 2J3LA 3Q8DA 1XPRA 1BVSA 4DUZQ 4LF7L 1PYSB 4DR2Q 4R4QA 4JCVE 1HNWL 1FJGL 4P75A 2JA8G 4GS3A 5GROA 1YBYA 5AJ3L 1XNRL 1VQOA 4DR7L 1WU7A 4LF8L 3V8JA 3L0OA 2HNIA 4DV6L 2BA1A 5C52B 4LF4Q 3A32A 3G6EA 1JE5A 3H0GH 3S1QH 4BY7H 1Q8KA 4GN3B 2VNUD 4LVLA 2ZM6Q 2EXDA 4P72A 3BZKA 4KR3A 4A93H 4K88A 3H3VH 1W66A 3D0FA 2XGTA 3HXVA 4KI0A 1JJ2A 4JOIA 4WJ3M 3HFVA 3QO7A 2CIMA 1ATIA 2ZNJA 4UPAA 3GO5A 1L1OA 3S1RH 1XMOL 4KHPL 3A5YA 4UP9A 2ODRC 1WCMH 2NS6A 4GKKQ 2R93G 4K0KL 3W3SA 3ZJYC 2UXBL 1HJPA 4DV1L 1L0WA 3TEHA 4YCWA 2PQAA 4X65Q 4OX9L 4PHCA 4DR5Q 4GNXA 4DR4Q 2KHJA 4YRMA 1ADYA 1KOGA 2WB1G 4B3ML 1HNZL 1HNWQ 2QHUA 2I5HA 1FJGQ 2ZNIA 4LFCL 4QIWE 5AJ3Q 1VQNA 3REXA 1N9WA 5JEAJ 3UDGA 5IWAL 4A3KH 2YYZA 3TUPA 2K5HA 4A3IG 4BBRH 1YJ9A 4NXML 2ZGWA 3REUA 2LXKA 1YVCA 2R7DA 3GTJH 1SN8A 2DTIA 4X66L 2AMCB 1QVCA 1LTLA 2JA8H 2IT1A 5IP7G 1NJ2A 4YRKA 5C0XI 3JAMi 1GM5A 1HZBA 2MFIA 2C7IA 5GQOA 1YHBA 1H95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTW A;  3F2B A;  1XMO Q;  4LWC A;  1S72 A;  4KHP Q;  4WF2 A;  3V8K A;  2P0L A;  4LF5 L;  2AWO A;  2OCE A;  4BXX G;  2PI2 A;  1RIQ A;  5J3B A;  2H5X A;  2ART A;  1NJ1 A;  4OX9 Q;  4JI5 L;  4XIG S;  1IBK L;  4X64 L;  1PHJ A;  4DV5 Q;  1G51 A;  3FJP A;  4AH6 A;  1AE2 A;  2IY5 B;  1JJC A;  1EQR A;  3H15 A;  4LFC Q;  5FLX c;  3HXW A;  4JI4 L;  2DDZ A;  5IWA Q;  3SGI A;  5GAE C;  3CF5 A;  1SET A;  2E3C A;  2CWP A;  3HOX H;  1B70 B;  4IOC A;  3VQV A;  2GVA A;  2JA7 G;  2HT1 A;  1PH2 A;  4YRN A;  4L5Q A;  3KDF A;  4IJL A;  1Z7M A;  3P8Y A;  1X2H A;  2UUB L;  4DNI A;  4X66 Q;  2ODR D;  4JI1 L;  3VDY A;  3L4G A;  1S40 A;  1U0L A;  1B8A A;  3K80 C;  3CAM A;  4HJ9 A;  4DR1 Q;  2VUM G;  1XNQ L;  3PF5 A;  4BW9 A;  4DV0 L;  2Z0S A;  4A3I H;  4A3C H;  3P8V A;  3A7U A;  1H4S A;  1E24 A;  4DV3 L;  2UXD L;  2JE6 I;  1JJG A;  2NVT H;  4Y7N H;  2A8V A;  2E64 A;  1YFR A;  4JI5 Q;  2WP8 J;  2FXQ A;  4YWM A;  2YTX A;  3WQZ A;  3EFS A;  2EWN A;  3CCJ A;  4YRE A;  3LC0 A;  1MIU A;  2DJZ A;  2G4C A;  4BXX H;  2E41 A;  4DR6 L;  2R92 H;  2B3G A;  4ZIB A;  1RL2 A;  4P71 C;  1SFO H;  1NMG A;  4DAM A;  4A75 A;  3M3Y H;  2ZTG A;  4GN5 A;  4ZTZ B;  4O2D A;  3CCQ A;  3TRE A;  3STB C;  4HIM A;  4B3S L;  1IBM L;  4JI0 Q;  1YHA A;  2N78 A;  1ASY A;  1EYG A;  1XNQ Q;  4H2X A;  4ALP A;  2DGY A;  1KIX A;  4A3E H;  1K83 H;  2QA4 A;  4OO1 G;  1EWI A;  3UDF A;  4YHH Q;  3EIV A;  1Q46 A;  3FKI H;  4LW1 A;  4P3P A;  5IYD H;  1YIT A;  4P74 A;  3EBE A;  4HID A;  2AKW A;  1SRY A;  3A5U A;  4TVY A;  4RQF A;  1VQA A;  1J5E L;  1OXV A;  4GOP C;  4LF9 Q;  1B7Y B;  4X62 L;  2AHO B;  2R7Z G;  2CCZ A;  2JEA I;  3E0E A;  3A74 A;  3TS0 A;  2CJB A;  2ZZE A;  2KCT A;  2K52 A;  4HJ7 A;  3G48 A;  3T1Y Q;  4EO4 A;  5C51 B;  5IT9 c;  3J81 j;  2Q7G A;  4A3B G;  3IAL A;  2OQK A;  3RL6 A;  3HOY G;  4EX5 A;  1G29 1;  3J7Z C;  4B3S Q;  1IBM Q;  4BY1 G;  2L15 A;  3ULP A;  4Q15 A;  3KYH C;  2ES2 A;  3E9I A;  1OXS C;  4DV4 Q;  3U50 C;  1TWA H;  4OWT B;  1HH2 P;  3KOJ A;  1YGB A;  3KF6 B;  1VQ7 A;  1N33 Q;  4E51 A;  3PUX A;  3JAM c;  1ADJ A;  2ZZF A;  5IYC G;  3CME A;  2QHV A;  2E65 A;  4JBJ A;  3H0G G;  2ZT5 A;  4BY7 G;  3CCS A;  1J5E Q;  1GGM A;  4DR2 L;  1PYS A;  1WNL A;  3MEF A;  3QNE A;  3J81 i;  3HKS A;  1P8L A;  3B6Y A;  5EAY A;  2OTJ A;  4MTN A;  1NJ8 A;  4A93 G;  1KL9 A;  3ICE A;  4B3R Q;  1KXL A;  3AEV A;  3PIP A;  1PA6 A;  3CQZ H;  1CKM A;  3RNU A;  1NYR A;  3H3V I;  5IP9 H;  5JJK A;  3M7N A;  4JBK A;  1NYQ A;  4YRO A;  1WCM G;  4LUZ A;  3K7U C;  1LM0 A;  4GLA C;  3IG2 A;  3QO5 A;  1TWF H;  3M4Q A;  2QHT A;  2ZIM A;  4P75 C;  3UDI A;  2C8M A;  1I5F A;  2E5A A;  1ASZ A;  1RIP A;  4DQ2 A;  3IRB A;  1I3Q H;  1NNH A;  4DUY L;  4GOP B;  3ICA A;  4HJ5 A;  4GKK L;  4TQU S;  5E3I A;  5H1S E;  4A3K G;  1WFQ A;  1D7Q A;  1NJ5 A;  2ARU A;  4XEO A;  4X65 L;  1I50 H;  4BBR G;  1CUK A;  3UFG A;  3KLW A;  4DR5 L;  4DR4 L;  4DK3 C;  4CS2 A;  3FHW A;  1O7I A;  2PMZ E;  3HY0 A;  4A3D H;  3KJP A;  4JI6 Q;  2IHF A;  1A0I A;  1X55 A;  1CSP A;  4TVW A;  4H2T A;  2MQH A;  1K8G A;  3UH0 A;  1N34 Q;  5IYC H;  2ZJR A;  1I6H H;  4P73 A;  2A1A A;  2DVE A;  4C3I H;  4ME3 A;  1Q86 C;  3HXX A;  4GNX C;  2OTL A;  1PYB A;  1VQM A;  5HY6 A;  4IFD J;  2BA0 A;  2AMC A;  1PH5 A;  4A3G G;  1EVK A;  4OP0 A;  4GLV B;  4O0A A;  2JEB I;  4HVC A;  3ER0 A;  3CD6 A;  2Z6K A;  4JG2 A;  3U4Z A;  3NET A;  4DUY Q;  2EIF A;  3PUW A;  1P16 A;  2ZT7 A;  1JT8 A;  4XTC S;  1X01 A;  3MF2 A;  2QEX A;  3HOX G;  4H2U A;  2CJA A;  4HWR A;  4JI7 L;  1WI5 A;  1H4V B;  4DV5 L;  4A3L H;  2PMF A;  4OWW B;  3GDE A;  3CW2 C;  3RF1 A;  3I2Z A;  1UWV A;  2Q2U A;  2JA6 H;  4CS4 A;  3L2Z A;  3RLO A;  1G5H A;  1UE6 A;  2K75 A;  4EQ5 A;  4YRR A;  5JJI A;  4IFD G;  5IYB H;  2IY5 A;  1C7Y A;  4RDX A;  2P5I A;  12AS A;  1GKH A;  2ASB A;  4A3C G;  1B70 A;  3CCU A;  4XU0 A;  1SE8 A;  1SRO A;  2WFW A;  3KF8 B;  3PO3 H;  4CH4 A;  1V43 A;  1U5K A;  4K87 A;  4YRC A;  1VQD A;  4ZTU B;  3R07 A;  1QF6 A;  4UP8 A;  3CC2 A;  4IPG A;  4GKJ Q;  5C4X G;  4DR1 L;  3KJO A;  4JI3 L;  2N3S A;  1UEB A;  1HXD A;  3LSQ A;  1SLJ A;  2EQS A;  1A62 A;  3OW2 A;  2B63 H;  2OWO A;  2V1C C;  4YRI A;  3E9H A;  4YY3 Q;  1WYD A;  1WPY A;  3W1G A;  3KFU A;  1YB3 A;  2NZO A;  2VW9 A;  1HNX L;  4HWP A;  3I7F A;  2DQ0 A;  1E22 A;  5C44 H;  1PH6 A;  5JEA G;  4GLX A;  2R92 G;  3S14 H;  1EUJ A;  2F52 A;  3HKZ E;  3F1Z A;  4A3G H;  3ERS X;  5M5X H;  2NN6 G;  2EAY A;  3AFQ A;  1CKN A;  2PI2 E;  2E10 A;  1D8L A;  4JI7 Q;  4AQY Q;  1BIB A;  2Y0S E;  3V7S A;  4UP7 A;  1QZG A;  1YEZ A;  3UGT A;  4QL5 A;  1Y14 B;  1VQP A;  3GTL H;  4GNX B;  4JBW A;  3J81 c;  1EIY B;  3AQQ A;  4YYE A;  1Y1W H;  4A3E G;  2Q7H A;  2K5N A;  2ZJP A;  3CMA A;  3CCV A;  5E7N A;  1FYF A;  1X54 A;  3FKI G;  1K3R A;  1B76 A;  2VQF L;  3CPF A;  4CS3 A;  5IYD G;  3PF4 A;  4G84 A;  2VL6 A;  4YRF A;  3S1N H;  4JI0 L;  3DM3 A;  3I4M H;  2ZTC A;  4JI3 Q;  2K14 A;  1X6O A;  4LUV A;  4XEM A;  3PUV A;  2JA9 A;  3S24 A;  5KNN A;  4YHH L;  3CMQ A;  1IYJ B;  2WAQ E;  4XU2 A;  4YP0 A;  2Q2I A;  3PO2 G;  4L5T A;  1SER A;  1HNX Q;  1QE0 A;  1E1T A;  1E7Z A;  4CH6 A;  1R9T H;  5C4X H;  2Q7E A;  4H2Y A;  1YJN A;  3S15 H;  4XTY A;  1PH3 A;  2C35 B;  1M1K C;  5C53 B;  4LF9 L;  2EJ9 A;  4A3M H;  1B7Y A;  3OTO Q;  3UDX A;  1N36 Q;  3K81 C;  2ZR3 A;  3HXZ A;  4DKA C;  3VQY A;  2J3M A;  1KC8 C;  3V7R A;  1OXX K;  1HTT A;  3AFP A;  3I4N H;  2K5V A;  1OXU A;  1SRU A;  1Q1E A;  4AIM A;  1GVP A;  1NBW A;  3T1Y L;  4HWS A;  2JA5 G;  1VQ9 A;  4KLK A;  4RMF A;  4C3H H;  4X5O A;  3G4S A;  2VQF Q;  2ID0 A;  2D0P A;  1K73 C;  4DV2 L;  3RZO H;  1GO3 E;  2ZT8 A;  3HOZ H;  2CGH A;  2CKZ B;  1VQJ A;  1Z47 A;  2DU7 A;  2EJG A;  4NPS A;  3U4V A;  4DV4 L;  3A5Z B;  1N32 L;  3KF6 A;  5DLQ E;  4LNQ A;  2CFM A;  1A8V A;  1N33 L;  4L87 A;  1OTC A;  2KBN A;  5M3M H;  4OO1 I;  4JYA Q;  1OXT A;  3U58 A;  5IP9 G;  3BU2 A;  3VQW A;  1JB7 A;  2JJQ A;  3EN2 A;  2DEQ A;  4P71 A;  1VQE A;  4PZ7 A;  4JI8 Q;  4DV7 L;  2R7F A;  2F3I A;  2ZXF A;  4B3R L;  3PO2 H;  1X3E A;  1XJV A;  5FLM G;  3HOV H;  1FVI A;  1HC7 A;  2DXU A;  3K7A H;  5BR8 Q;  3I4O A;  4TWA A;  2RHS B;  1X56 A;  4P3O A;  4BA1 I;  3HTZ A;  4A3J H;  4XTV A;  3M85 A;  4JV5 L;  2CWA A;  4DAY B;  4DV2 Q;  2PNH A;  3HKZ G;  4YRQ A;  4YRJ A;  1KMM A;  4TVA B;  1NJ6 A;  1VQK A;  2GN5 A;  4GN4 B;  2DXT A;  2Y0S G;  1IBL L;  2VZA A;  4X6A H;  4TTV A;  4IOA A;  2JA5 H;  4CH5 A;  5LMU L;  1N32 Q;  4A3D G;  1IZ6 A;  4WJ4 A;  2DUD A;  4OXP A;  2IX0 A;  4HWT A;  4YCU A;  1TWG H;  1JMC A;  1K0R A;  3PCO B;  1VQ8 A;  3VQX A;  4PG3 A;  2ALY B;  3CC7 A;  1VQ6 A;  3ULJ A;  2F4V Q;  3RAC A;  5K1X A;  4BWA A;  1MJE A;  4DV7 Q;  4JI6 L;  4HA8 A;  2RF4 A;  3STB D;  4RG1 A;  1VQL A;  1HZ9 A;  4QY7 A;  1N34 L;  2WAQ G;  2VQE L;  1WOC A;  3L7Z C;  4A3F H;  1EQQ A;  1VS0 A;  2CQO A;  1BKB A;  3IKL A;  4JV5 Q;  3HFZ B;  3NEL A;  4LF6 Q;  3MF1 A;  1QUQ B;  2DU5 A;  1PH4 A;  2D0O A;  1MJC A;  1IBL Q;  2UUC L;  1GD7 A;  5FLM H;  4OON A;  4XU1 A;  2PME A;  4A3L G;  5ELO A;  5JJL A;  3PGZ A;  1VCI A;  5LMU Q;  1YJW A;  2JA6 G;  3RLN A;  3UE1 A;  1YZ6 A;  3HRI A;  1USY A;  1WQ7 A;  4P73 C;  2HHH Q;  1SR3 A;  2EL9 A;  1AH9 A;  5IYB G;  2VY3 A;  4PZ6 A;  3A7A A;  1VQC A;  2DZC A;  4G85 A;  4LFB L;  4HIK A;  4WI1 A;  5C4J H;  3PSI A;  4UY8 C;  4P72 C;  2ZTE A;  4QJF A;  4YRL A;  4R4T A;  3PO3 G;  1LYL A;  4Q6G A;  1IXR A;  3S1M H;  4YDQ A;  1YFT A;  2XTI A;  2Z6K C;  3M4O H;  2VS1 A;  4JOI C;  4TQD A;  1Y1V H;  5M5W H;  1L1O C;  1PH8 A;  2NZH A;  2KEN A;  2VQE Q;  1E3P A;  3L2P A;  2B63 G;  2YU9 H;  4A76 A;  5C3E H;  1S3O A;  1VQH A;  5K1P A;  1Q7Y C;  4HJA A;  4AYB E;  3S16 H;  5C44 G;  4H2V A;  4BBS H;  3NEM A;  1PH1 A;  2UUA Q;  4GKJ L;  2LSS A;  5M5Y H;  2ZR2 A;  1NE3 A;  2UUC Q;  3F8T A;  4LNS A;  4XTX A;  4J15 A;  4IPD A;  1KRT A;  1G6P A;  1PH7 A;  4YY3 L;  1XPU A;  1BIA A;  2GVB A;  1XMQ Q;  1Q12 A;  3V7C A;  3G71 A;  4PZ8 A;  4LFB Q;  1Y1W G;  3TEG A;  2ZTD A;  1SMX A;  2UU9 L;  1BBU A;  2I5M X;  1HR0 W;  3J80 c;  2RHQ B;  1G5I A;  4AQY L;  5C0X J;  2B29 A;  3ULL A;  3S17 H;  2I4M A;  3ERR A;  3CCM A;  2D62 A;  3GTM H;  3PV0 A;  4L5S A;  3I4M G;  3GTG H;  2ZIN A;  4L5R C;  5M3F H;  4LF7 Q;  1EIY A;  3G1Z A;  3IKM B;  2EJF A;  4IFD I;  3D31 A;  2CJ9 A;  2HIV A;  3HOU H;  4QQB X;  3RKW A;  4POG A;  3PIO A;  1NY4 A;  2JQO A;  1XNR Q;  4DR7 Q;  2IHE A;  3P8T A;  1DGS A;  4JBM A;  4LF8 Q;  4DV6 Q;  1X2G A;  1A63 A;  2I4N A;  3OYY A;  4IO9 A;  1HZC A;  3FP9 A;  4YWL A;  4H2W A;  4A3M G;  3W1B A;  1EFW A;  4OLF A;  5C0X G;  3BJU A;  4P3N A;  1H4Q A;  3UGQ A;  3I4N G;  1W2B A;  1VQB A;  1KMN A;  2JK8 A;  2I5L X;  2KCM A;  2OQ0 A;  1EOV A;  2UU9 Q;  1L1O B;  2NVQ H;  3J7A 5;  1QVF A;  3BFM A;  4K86 A;  1UE7 A;  4POF A;  3OTO L;  1N36 L;  4FDB A;  4K0K Q;  2UXB Q;  2NN6 I;  3WWV A;  4DV1 Q;  1WLE A;  3L1A A;  3TEH B;  2N8N A;  1K8A C;  3A7R A;  3HOZ G;  3DSQ A;  1NMF A;  2PQA B;  3I55 A;  2NVX H;  2AWN A;  1Z7N A;  1Q81 C;  1WJJ A;  4NXN L;  2I4L A;  1V1Q A;  1T9H A;  1CKO A;  2ATW A;  3PUY A;  2DKG A;  4B3M Q;  1HNZ Q;  2QHS A;  3GTQ H;  3QO8 A;  3F2C A;  1KD1 C;  4JC0 A;  2R93 H;  1L2F A;  3HOW G;  5M3M G;  3TQY A;  2I0Q A;  4IPH A;  4NXM Q;  2BH8 A;  4LUO A;  1HR0 L;  3RN2 A;  5GAH C;  3A5Z A;  4IJH A;  2E2H H;  1Z9F A;  4DK6 C;  3VBB A;  2Q2H A;  3QTC A;  3UE0 A;  3CP0 A;  1KAW A;  4JYA L;  2DZ9 A;  3CC4 A;  4XTU A;  3HOV G;  1PH9 A;  3LGJ A;  1X9N A;  4YPF A;  1TWC H;  1IL2 A;  1I94 L;  1TWH H;  1NTG A;  3GTP H;  4AYB G;  4A3J G;  4R4O A;  4JI8 L;  2ZZG A;  4LF5 Q;  2DTO A;  3RN5 A;  1VQ5 A;  5IP7 H;  1CKN B;  4NB3 A;  4KR2 A;  1XPO A;  1UE1 A;  1IBK Q;  4X64 Q;  4NXN Q;  5BR8 L;  4R1J A;  1CSQ A;  2K4K A;  4P74 C;  1FL0 A;  4MZ9 A;  4H2S A;  2RHS A;  3K8A A;  5LMN W;  1JJC B;  2Q2T A;  4JI4 Q;  3RGL A;  1YHQ A;  4TVA A;  1YI2 A;  1J5W A;  2Q5I A;  2MO0 A;  1HR0 Q;  3KDF B;  1VQZ A;  2UUB Q;  3NBH B;  4LFA L;  1EVL A;  5FJ8 G;  2FYK A;  1VQG A;  1YNX A;  4JI1 Q;  2YV5 A;  4JI2 L;  3L4G B;  4Y52 H;  4APV A;  3J80 i;  3EFR A;  1KQS A;  3HY1 A;  3NEN A;  3HOW H;  3M9B A;  1VQF A;  3PCO A;  1PFS A;  1W3S A;  2ARS A;  4B3T L;  3T1H L;  4DV0 Q;  2ALY A;  1I94 Q;  3AYH B;  4YRG A;  2JA7 H;  4A3F G;  2N49 A;  2F4V L;  1LUZ A;  4MNO A;  4KQE A;  4CH3 A;  4DV3 Q;  2UXD Q;  3F2D A;  4YRT A;  1PVO A;  2LXJ A;  3HRK A;  2VUM H;  2BH2 A;  4TQF A;  5IE8 A;  1HZA A;  3S2H H;  4YWK A;  4C2M H;  1FGU A;  3CXC A;  3MEY A;  4RQE A;  5HGQ A;  3HFZ A;  4LF6 L;  3TS2 A;  4DR6 Q;  3LSS A;  3CCR A;  1QUQ A;  3S2D H;  1M90 C;  4QGU A;  1TXY A;  2DTH A;  1YFS A;  4IPC A;  4LFA Q;  5F5W A;  2HIX A;  4HWO A;  2HQL A;  2YTV A;  4JI2 Q;  2HHH L;  3GTO H;  4GOP A;  1Y1V G;  1C9O A;  2WB1 E;  5GAG C;  3HXU A;  1QVG A;  3GD7 A;  4H2X B;  1VQI A;  1V9P A;  1KHI A;  4DR3 L;  4YCV A;  1YIJ A;  4B3T Q;  2E2J H;  4HIO A;  3BZC A;  3T1H Q;  3RZD H;  1MKH A;  5C3E G;  2UXC L;  3RUX A;  3DLL A;  3K0X A;  3M4P A;  5LMN L;  3OD1 A;  1XTD A;  4YRP A;  2NVY H;  2E8G A;  2E5L L;  1PV4 A;  3W5O A;  1N8R C;  2AKW B;  5FJ8 H;  1X65 A;  4BA2 I;  1X3F A;  3MXN B;  4BBS G;  1USY C;  2YTY A;  4XU3 A;  4DUZ L;  2K50 A;  1K9M C;  3JC6 6;  1KRS A;  4HJ8 A;  1EIF A;  3RIR A;  1VQ4 A;  1WQW A;  2A19 A;  1C0A A;  4X62 Q;  3CCE A;  3A0J A;  1BBW A;  2MNA A;  3CCL A;  2ZT6 A;  4LF4 L;  2KHI A;  2UUA L;  5IY0 A;  4DPG A;  1NJI C;  4C3J H;  2RCN A;  4R4I A;  2Q5H A;  3PZC A;  2ZM6 L;  1QZH A;  4A4I A;  4OWX B;  3RR5 A;  5ELN A;  3I56 A;  2R7Z H;  2IX1 A;  3V8L A;  1UE5 A;  4KHZ A;  1SES A;  2QGQ A;  4YRS A;  2ZJQ A;  1XMQ L;  3A31 A;  4XTZ A;  4PMW A;  5M3F G;  3RKY A;  2R6G A;  4NCX A;  2E2I H;  1E1O A;  1Q82 C;  5GAD C;  4DR3 Q;  4R4C A;  3RLF A;  2I4O A;  5K36 G;  3HOU G;  2MO1 A;  2UXC Q;  2E1H A;  4H02 A;  4A3B H;  5LMN Q;  1AE3 A;  2RHQ A;  1H4T A;  3GTK H;  1J6Q A;  2DQ3 A;  3CPW A;  11AS A;  3RKX A;  2E5L Q;  3HOY H;  1X3G A;  3TRZ A;  1Q1B A;  3PUZ A;  2ZCE A;  2ZIO A;  4BY1 H;  3HXY A;  2J3L A;  3Q8D A;  1XPR A;  1BVS A;  4DUZ Q;  4LF7 L;  1PYS B;  4DR2 Q;  4R4Q A;  4JCV E;  1HNW L;  1FJG L;  4P75 A;  2JA8 G;  4GS3 A;  5GRO A;  1YBY A;  5AJ3 L;  1XNR L;  1VQO A;  4DR7 L;  1WU7 A;  4LF8 L;  3V8J A;  3L0O A;  2HNI A;  4DV6 L;  2BA1 A;  5C52 B;  4LF4 Q;  3A32 A;  3G6E A;  1JE5 A;  3H0G H;  3S1Q H;  4BY7 H;  1Q8K A;  4GN3 B;  2VNU D;  2ZM6 Q;  2EXD A;  4P72 A;  3BZK A;  4KR3 A;  4A93 H;  4K88 A;  3H3V H;  1W66 A;  3D0F A;  2XGT A;  3HXV A;  4KI0 A;  1JJ2 A;  4JOI A;  4WJ3 M;  3HFV A;  3QO7 A;  2CIM A;  1ATI A;  2ZNJ A;  4UPA A;  3GO5 A;  1L1O A;  3S1R H;  1XMO L;  4KHP L;  3A5Y A;  4UP9 A;  2ODR C;  1WCM H;  4GKK Q;  2R93 G;  4K0K L;  3W3S A;  3ZJY C;  2UXB L;  1HJP A;  4DV1 L;  1L0W A;  3TEH A;  4YCW A;  2PQA A;  4X65 Q;  4OX9 L;  4PHC A;  4DR5 Q;  4GNX A;  4DR4 Q;  2KHJ A;  4YRM A;  1ADY A;  1KOG A;  2WB1 G;  4B3M L;  1HNZ L;  1HNW Q;  2QHU A;  2I5H A;  1FJG Q;  2ZNI A;  4LFC L;  4QIW E;  5AJ3 Q;  1VQN A;  3REX A;  1N9W A;  5JEA J;  3UDG A;  5IWA L;  4A3K H;  2YYZ A;  3TUP A;  2K5H A;  4A3I G;  4BBR H;  1YJ9 A;  4NXM L;  2ZGW A;  3REU A;  2LXK A;  1YVC A;  2R7D A;  3GTJ H;  1SN8 A;  2DTI A;  4X66 L;  2AMC B;  1QVC A;  1LTL A;  2JA8 H;  2IT1 A;  5IP7 G;  1NJ2 A;  4YRK A;  5C0X I;  3JAM i;  1GM5 A;  1HZB A;  2MFI A;  2C7I A;  5GQO A;  1YHB A;  1H95 A; 
#chains in the Genus database with same CATH topology
 4XTW A;  2K33 A;  3F2B A;  1XMO Q;  4LWC A;  1S72 A;  4KHP Q;  4WF2 A;  1DOM A;  1Q8I A;  1EY7 A;  3V8K A;  2P0L A;  4LF5 L;  2AWO A;  2KED A;  1BCP C;  2OCE A;  4HTH A;  4BXX G;  2FFK B;  2PI2 A;  4FF3 A;  1RIQ A;  1EEI D;  2QIL A;  2H5X A;  4IUU A;  5J3B A;  2ART A;  3RZD B;  1NJ1 A;  4QMG A;  4OX9 Q;  4JI5 L;  3JAM E;  3SR1 A;  4XIG S;  5EPK A;  3DXJ C;  1B2T A;  3OPO A;  4K5W A;  1IBK L;  1FR3 A;  4X64 L;  3H3V C;  1H9S A;  2NVY B;  3MXP A;  1PHJ A;  4DV5 Q;  4H0L C;  2EOT A;  2ICE C;  1BF4 A;  1K8O A;  1XWE A;  3SK8 A;  1G51 A;  3SEB A;  4GZY C;  3FJP A;  2Z4H A;  4AH6 A;  1BQQ T;  4HMJ A;  3T13 A;  1AE2 A;  4KKT A;  2IY5 B;  1JJC A;  1EQR A;  3H15 A;  4LFC Q;  1DM0 B;  1DXM A;  5FLX c;  3HXW A;  2E75 C;  4JI4 L;  3K57 A;  1ENA A;  2DDZ A;  5IWA Q;  3SGI A;  5GAE C;  3CF5 A;  1SET A;  2E3C A;  5DNF A;  1CZW A;  4N8X 1;  4B9W A;  2CWP A;  5I6W A;  1XTC D;  3HOX H;  2SNS A;  1B70 B;  4IOC A;  3VQV A;  4CJ2 C;  1S5F D;  2JYO A;  2GVA A;  5EBD A;  3V2T A;  2JA7 G;  2HT1 A;  1PH2 A;  4YRN A;  4L5Q A;  2FHT A;  3KDF A;  4IJL A;  1Z7M A;  3P8Y A;  4A3F B;  1X2H A;  4DGZ A;  1Z6H A;  2CH4 A;  2UUB L;  3NBH A;  4DNI A;  3IFD A;  3NK9 A;  1WTR A;  5KIX A;  2F3W A;  4X66 Q;  2ODR D;  2L12 A;  4H7B A;  4JI1 L;  3VDY A;  3L4G A;  3Q22 A;  1U0L A;  1B8A A;  1S40 A;  1TS2 A;  3K80 C;  2VB3 X;  3CAM A;  1A3V A;  1AP0 A;  4HJ9 A;  4DR1 Q;  2VUM G;  1XNQ L;  2A68 D;  2PW7 A;  2O4X A;  3PF5 A;  2G9D A;  4FF2 A;  3V05 A;  2A6E C;  4BW9 A;  4DV0 L;  2Z0S A;  5KNC A;  2KCC A;  4A3I H;  4A3C H;  3P8V A;  3A7U A;  1SYC A;  1SYG A;  3MZ5 A;  2KQ3 A;  4MIU A;  3J80 L;  1H4S A;  1TII D;  3CHB D;  1E24 A;  4DV3 L;  1UAP A;  1MD2 D;  3EFX D;  4CGY B;  2UXD L;  2JE6 I;  2XNA C;  4X3S A;  1JJG A;  5C4J B;  2NVT H;  1CHQ D;  4Y7N H;  2A8V A;  2E64 A;  1YFR A;  1PTO H;  4JI5 Q;  2AQ1 B;  2F03 A;  2WP8 J;  2FXQ A;  3TP8 A;  4YWM A;  2RDG A;  2YTX A;  2M00 A;  3NHH A;  3WQZ A;  3S1M B;  3EFS A;  2A73 B;  1WTV A;  2EY6 A;  1CQF A;  3HOY B;  1CA6 A;  2EWN A;  3CCJ A;  4YRE A;  3M4O B;  1IW7 C;  1EY9 A;  3LC0 A;  3PIP 3;  1MIU A;  2DJZ A;  1Y1V B;  1PZK D;  5M5W B;  2KHS A;  2G4C A;  5EQ0 A;  4BXX H;  2E41 A;  5JEA H;  4DR6 L;  2DNC A;  2R92 H;  2B3G A;  4ZIB A;  1RL2 A;  4P71 C;  1SFO H;  1IYU A;  2L1B A;  3OWF A;  1NMG A;  2NN6 H;  4DFA A;  4DAM A;  4A75 A;  5C3E B;  2EY5 A;  3C2P A;  3M3Y H;  3MXG A;  1VMC A;  2ZTG A;  1ZKO A;  2E2D C;  1F9S A;  4GN5 A;  4ZTZ B;  4HCS A;  4O2D A;  3CCQ A;  3TRE A;  3STB C;  4HIM A;  3S16 B;  5M9O A;  4B3S L;  4BBS B;  1IBM L;  4JI0 Q;  1YHA A;  3I91 A;  2N78 A;  1ASY A;  3TME A;  1WTH A;  3GV6 A;  4KY5 A;  5M5Y B;  1EYG A;  1XNQ Q;  1K0S A;  1BCP B;  4H2X A;  3T56 B;  4ALP A;  1MGS A;  2DGY A;  1RHP A;  1KIX A;  3QWN A;  4A3E H;  1K83 H;  2QA4 A;  4OO1 G;  3CRK C;  1EWI A;  3AMU A;  1IYV A;  3UDF A;  4YHH Q;  2XRQ D;  1Q46 A;  3EIV A;  2KA7 A;  3IAY A;  1GUW A;  3S9W A;  5EKI A;  3FKI H;  2Z4I A;  4LW1 A;  1C4Q A;  3EA6 A;  1LTS D;  2PNR C;  4P3P A;  5IYD H;  1ET6 A;  1YIT A;  2EZV A;  4P74 A;  3EBE A;  1ILQ A;  4HID A;  2AKW A;  1SRY A;  1RTN A;  5A2Q E;  1AZP A;  3A5U A;  2NZ1 D;  2C5C A;  5EGT A;  1HA6 A;  4TVY A;  4RQF A;  4C3J G;  1D2B A;  1VQA A;  3N52 A;  1J5E L;  3LNN A;  2M9V A;  4ZRZ A;  4LJZ C;  1OXV A;  4GOP C;  2KJX A;  1WCM B;  4LF9 Q;  1B7Y B;  1QNU A;  1D6E C;  1SNO A;  1BR9 A;  2IPK D;  4X62 L;  1EY8 A;  2AHO B;  2CCZ A;  2R7Z G;  2F0W A;  3OOC A;  3PMF A;  2JEA I;  3E0E A;  3GTM B;  3A74 A;  2H4O A;  3TS0 A;  2CJB A;  1NNX A;  2DY8 A;  2ZZE A;  1U4R A;  3GTG B;  2JXM B;  3ERO A;  2KCT A;  2K52 A;  1SJE D;  4HJ7 A;  5M3F B;  3G48 A;  3NSW A;  4V19 0;  1I4X A;  3T1Y Q;  4EO4 A;  1SNP A;  2K5W A;  4DU9 A;  5C51 B;  3HOU B;  5IT9 c;  1SYB A;  3J81 j;  2Q7G A;  2OT2 A;  4A3B G;  3IAL A;  2X6G A;  1F2M A;  2OQK A;  1EWH A;  1HTL D;  2NBF A;  1PTO C;  2WAC A;  1SMY C;  4HR7 B;  3RL6 A;  1SE2 A;  3FVQ A;  4DAV A;  3HOY G;  1LO5 D;  3NXW A;  5JVH 3;  4EX5 A;  1G29 1;  3J7Z C;  3I72 A;  4B3S Q;  5BN5 A;  1IBM Q;  3Q23 A;  4BY1 G;  3KBG A;  3KK7 A;  5I4D A;  2L15 A;  4BS9 A;  3ULP A;  4BBR B;  4Q15 A;  4IUV A;  4ULL A;  3KYH C;  2ES2 A;  3VA5 A;  3E9I A;  2BE5 C;  1OXS C;  4DV4 Q;  3U50 C;  1TWA H;  3NWT A;  4OGQ C;  4OWT B;  1HH2 P;  3KOJ A;  1YGB A;  3D6C A;  3KF6 B;  4B08 A;  1VQ7 A;  3NTI A;  4HCE A;  1CQV A;  5KGU A;  4ZKB B;  1CA5 A;  2JA8 B;  1N33 Q;  4E51 A;  3PUX A;  3JAM c;  1ADJ A;  2ZZF A;  1U4M A;  4ZUI A;  2BOS A;  5IYC G;  3CME A;  2SDF A;  2QHV A;  3X3N A;  1OO9 B;  5KRU A;  2E65 A;  3LX0 A;  4JBJ A;  3H0G G;  2ZT5 A;  4BY7 G;  3CCS A;  1ICW A;  1J5E Q;  2NVQ B;  1GGM A;  4DR2 L;  3T16 A;  3OIP A;  1PYS A;  1WNL A;  3MEF A;  3QNE A;  3J81 i;  3HKS A;  1P8L A;  4XT3 B;  3B6Y A;  5EAY A;  4DNT B;  2OTJ A;  4MTN A;  1NJ8 A;  3TP5 A;  4A93 G;  3I90 A;  4JVZ A;  1KLG D;  4FF4 A;  1KL9 A;  3ICE A;  4B3R Q;  1KXL A;  5E1F A;  5D3I B;  3AEV A;  1PFM A;  3PIP A;  1PA6 A;  4MHE A;  4MN3 A;  5IGE A;  3FRP B;  2IL8 A;  1IHZ A;  1MSG A;  5DM7 3;  5LL6 X;  3CQZ H;  1CKM A;  1HCZ A;  1PZJ D;  3RNU A;  1NYR A;  3H3V I;  5IP9 H;  5JJK A;  3M7N A;  4JBK A;  2RA4 A;  1A15 A;  5FLX E;  1KAB A;  1NYQ A;  1NSN S;  3GTQ B;  4YRO A;  3FMC A;  1WTQ A;  1WCM G;  3J81 E;  4LUZ A;  2R93 B;  3KBX A;  3K7U C;  1LM0 A;  1JCK B;  4GLA C;  3IG2 A;  3QO5 A;  1TWF H;  1JWS D;  3M4Q A;  2QHT A;  1LT5 D;  1TY2 A;  2ZIM A;  3N6R A;  1S4Z A;  5FK9 C;  3SE0 A;  3UDI A;  4P75 C;  2C8M A;  1I5F A;  2E5A A;  1ASZ A;  4ZKC B;  1RIP A;  4DQ2 A;  3NPP A;  3K5O A;  1LTT D;  3IRB A;  1G2S A;  3QG1 A;  2WB1 B;  2L4N A;  1KAA A;  1I3Q H;  2XVS A;  5CC4 A;  1NNH A;  1K28 A;  2AUK A;  2K6A A;  2F0J A;  4DUY L;  4GOP B;  2MP1 A;  3ICA A;  4HJ5 A;  4DXF A;  1MBY A;  4GKK L;  4TQU S;  5E3I A;  5H1S E;  1ESR A;  3W2D A;  4A3K G;  1LTA D;  4IUT A;  2FJ2 A;  1WFQ A;  1D7Q A;  1NJ5 A;  2SOB A;  5FO7 B;  4HSV A;  2ARU A;  1TWC B;  4A3I B;  4X65 L;  1EQT A;  1E2W A;  1I50 H;  5IIF A;  4BBR G;  4XEO A;  1CUK A;  1TWH B;  3UFG A;  1B44 D;  3KLW A;  4DR5 L;  4DR4 L;  4DK3 C;  3GTP B;  4CS2 A;  5HGT A;  3FHW A;  1D1K A;  1O7I A;  4RAU C;  4U68 A;  2PMZ E;  3HY0 A;  2EXZ A;  4A3D H;  3KJP A;  3QR8 A;  4Z9C B;  4JI6 Q;  2IHF A;  1A0I A;  1X55 A;  4M1U B;  1CSP A;  1PLF A;  4TVW A;  2NVT B;  1PYW D;  4KN4 C;  1FGB D;  4H2T A;  3K5N A;  4DF7 A;  2PW5 A;  4I65 A;  2MQH A;  3VR5 A;  1F9R A;  1K8G A;  3UH0 A;  2IX3 A;  1N34 Q;  5IYC H;  2ZJR A;  1FNV A;  1I6H H;  4P73 A;  1BBX C;  4WJW A;  2A1A A;  2B2Y C;  2DVE A;  4C3I H;  4L63 B;  4DXG A;  4ME3 A;  1A6X A;  2CQA A;  1ZEQ X;  1Q86 C;  3HXX A;  4J6H A;  4DNR B;  4GNX C;  4RKB A;  2OTL A;  4XDX A;  4IN3 A;  1NR2 A;  1PYB A;  1VQM A;  5HY6 A;  2F4I A;  3GQB A;  2EJF C;  4IFD J;  2BA0 A;  2AMC A;  1PH5 A;  4A3G G;  1EVK A;  4OP0 A;  4GLV B;  5C5L A;  4O0A A;  2JEB I;  1LAB A;  2IJ0 A;  4HVC A;  1S5B D;  3ER0 A;  3CD6 A;  5EJW A;  1Q90 A;  2Z6K A;  2GA4 B;  1JE4 A;  1PFN A;  4IZ8 A;  1JIC A;  4JG2 A;  2F0O A;  4G7O C;  2EYP A;  2XRS D;  3U4Z A;  1B3A A;  3NET A;  3QJY A;  4DUY Q;  1FYC A;  3DUZ A;  3A7A B;  2OXP A;  2EIF A;  3PUW A;  2F0K A;  1P16 A;  5IGG A;  1SYF A;  2D9U A;  1PMR A;  1EFI D;  1SJH D;  2ZT7 A;  1WD0 A;  1JT8 A;  3SDZ A;  4XTC S;  4CJ1 B;  1X01 A;  3MF2 A;  5ISR A;  2QEX A;  1CFM A;  3HOX G;  3ND9 A;  4H2U A;  2CJA A;  4HWR A;  1ESF A;  1MI2 A;  4JI7 L;  2JA7 B;  3FKI B;  5D14 A;  3C1F A;  2DJF C;  1WI5 A;  2A69 D;  5I9P A;  4FXD A;  1H4V B;  5EPL A;  4DV5 L;  4A3L H;  2PMF A;  2G5D A;  2D5D A;  3GDE A;  3CW2 C;  4OWW B;  3RF1 A;  1RDP D;  1UWV A;  1JQY D;  3I2Z A;  2Q2U A;  5COR A;  2JA6 H;  3L2Z A;  4CS4 A;  3RLO A;  1NUC A;  1G5H A;  1UE6 A;  2K75 A;  1A2U A;  4EQ5 A;  4YRR A;  2B8G A;  5JJI A;  1O7L A;  4IUQ A;  3SXH A;  4IFD G;  5IYB H;  2IY5 A;  2PZT A;  5E3F A;  1C7Y A;  5ELB A;  4RDX A;  2P5I A;  4LVM A;  4C2M B;  1GKH A;  12AS A;  2F1M A;  2ASB A;  3C1E A;  4A3C G;  1B70 A;  3CCU A;  4XU0 A;  1SE8 A;  1SRO A;  2WFW A;  3KF8 B;  5FO8 B;  2JSO A;  3PO3 H;  3H91 A;  4CH4 A;  1V43 A;  1U5K A;  4K87 A;  4YRC A;  1TS5 A;  4ZLT F;  1VQD A;  3DEP A;  5K5P A;  3G7L A;  4ZTU B;  1HTP A;  3R07 A;  1V1P B;  1QF6 A;  5IT9 E;  4UP8 A;  3URY A;  3S2D B;  2A74 C;  3CC2 A;  4IPG A;  4RGO S;  4GKJ Q;  5C4X G;  4DR1 L;  3KJO A;  4JI3 L;  2N3S A;  1UEB A;  1HXD A;  3LSQ A;  1SLJ A;  2EQS A;  3VYT A;  2RBM A;  4K2K A;  1A62 A;  1JOO A;  4E6I A;  3OW2 A;  2B63 H;  1HXY D;  2OWO A;  2V1C C;  4YRI A;  1DOK A;  3BYY B;  3SK5 A;  3E9H A;  4YY3 Q;  1WYD A;  1WPY A;  2F0L A;  3W1G A;  3KFU A;  1U9R A;  1YB3 A;  3GTO B;  2L55 A;  2PPB C;  1TY0 A;  5D65 A;  2NZO A;  4NP5 A;  2VW9 A;  1HNX L;  4HWP A;  5J22 A;  1I4Q A;  3I7F A;  1E22 A;  4RGM A;  5C44 H;  2DQ0 A;  1PH6 A;  5JEA G;  3SVM A;  4GLX A;  2R92 G;  5G3L D;  3S14 H;  1EUJ A;  1TWA B;  4KKS A;  2F52 A;  4F7X A;  3HKZ E;  3F1Z A;  4A3G H;  3ERS X;  5M5X H;  2E2J B;  2F0H A;  1PDQ A;  2NN6 G;  2EAY A;  3AFQ A;  1CKN A;  2PI2 E;  2IW3 A;  2E10 A;  1D8L A;  2L5T A;  4JI7 Q;  1EZ8 A;  2CVR A;  1ICF B;  4AQY Q;  1BIB A;  2Y0S E;  3V7S A;  4UP7 A;  3MC0 B;  5IOD A;  1QZG A;  1YEZ A;  3TP7 A;  2K5D A;  3UGT A;  4QL5 A;  1Y14 B;  1VQP A;  2A6H C;  4CDD C;  3OW7 A;  4FXK C;  2J7Z A;  3M7G A;  1DZ1 A;  3GTL H;  4GNX B;  1QWY A;  2WKC A;  2Z6B A;  4JBW A;  3J81 c;  1BCP F;  1EIY B;  3AQQ A;  4YYE A;  4LAA A;  1Y1W H;  1PFB A;  2F3V A;  4A3E G;  2Q7H A;  2QDB A;  2K5N A;  2ZJP A;  1ONL A;  3CMA A;  2B2T C;  3CCV A;  5E7N A;  2QW7 A;  1SE3 A;  1FYF A;  1XX8 A;  4QIW B;  1X54 A;  3FKI G;  1K3R A;  2XN9 C;  1B76 A;  2VQF L;  3CPF A;  4KTA A;  1RJT A;  5CV9 A;  4CS3 A;  5IYD G;  3PF4 A;  4G84 A;  2V4D A;  1IKM A;  3DEO A;  2VL6 A;  2CW0 C;  4ODG A;  4YRF A;  1GUS A;  2AQ2 B;  3S1N H;  4H44 C;  4JI0 L;  4ME5 A;  3DM3 A;  1SYD A;  4IFD H;  3I4M H;  3R93 A;  3KLS A;  4C3J B;  1A3T A;  1Y8O B;  2ZTC A;  4JI3 Q;  2K14 A;  1Y8P B;  1X6O A;  2EYM A;  4Q5V A;  4LUV A;  4XEM A;  4DN4 M;  3PUV A;  4Q0F A;  2JA9 A;  3S24 A;  5KNN A;  4YHH L;  2R7Z B;  3CMQ A;  1IYJ B;  2WAQ E;  5A2Q L;  1F9P A;  4O42 A;  4XU2 A;  4YP0 A;  4K5V A;  2Q2I A;  3PO2 G;  2F0T A;  4L5T A;  1SER A;  1HNX Q;  1QE0 A;  4RHR A;  1E1T A;  1E7Z A;  4CH6 A;  3A56 A;  4KMU C;  2E2I B;  1R9T H;  3Q24 A;  5C4X H;  1JC7 A;  1CT1 D;  1GOZ A;  5IGD A;  2Q7E A;  4FXG C;  1YJN A;  1KDB A;  4H2Y A;  3S15 H;  4XTY A;  1PH3 A;  1JOK A;  2C35 B;  4CKE A;  3E3X A;  1M1K C;  4A3B B;  3A8I E;  4J1M A;  5C53 B;  3HZX A;  4LF9 L;  2EJ9 A;  4A3M H;  1B7Y A;  3OTO Q;  2ENB A;  1JB3 A;  1HFG A;  1R4P B;  1T5E A;  2R61 A;  3K81 C;  3UDX A;  1N36 Q;  3GTK B;  2ZR3 A;  4LVI A;  5AFW A;  3HXZ A;  1VDZ A;  1WTX A;  1YNJ D;  1H95 A;  1I4P A;  4DKA C;  3VQY A;  2J3M A;  1KC8 C;  3V7R A;  4BY1 B;  1W6K A;  1OXX K;  1HTT A;  1BNZ A;  1SYE A;  3AFP A;  3I4N H;  2K5V A;  3P1H A;  4KY7 A;  1OXU A;  1SRU A;  1Q1E A;  4AIM A;  1GVP A;  1NBW A;  3T1Y L;  4HWS A;  2JA5 G;  3OIQ A;  1VQ9 A;  1PRT C;  4KLK A;  4RMF A;  3NWS A;  4C3H H;  4X5O A;  3G4S A;  1WTO A;  2EYL A;  2VQF Q;  2ID0 A;  3TZD A;  3L9A X;  5NUC A;  2D0P A;  1K73 C;  4HT4 A;  4DV2 L;  2B39 A;  1TVX A;  2FMC A;  5JPN C;  3RZO H;  1GO3 E;  2QEJ C;  2ZT8 A;  3HGB A;  1BCP D;  3HOZ H;  2CGH A;  2CKZ B;  3H0G B;  1VQJ A;  1Z47 A;  2RSO A;  3S1Q B;  4BY7 B;  4HMI A;  2DU7 A;  1LT4 D;  2EJG A;  4NPS A;  3U4V A;  3GP7 A;  1B53 A;  4DV4 L;  3I8Z A;  3T4A C;  3G6J B;  1CM9 A;  3A5Z B;  1N32 L;  5EPJ A;  3KF6 A;  2EE1 A;  5DLQ E;  1I4R A;  4A93 B;  4LNQ A;  2CFM A;  1A8V A;  2O2L D;  1N33 L;  1KLU D;  4L87 A;  4ABN A;  1SBB B;  1OTC A;  1KNE A;  2B2W A;  2KBN A;  2D2C C;  5M3M H;  4OO1 I;  2A6H D;  3U9O A;  4C1N K;  4JYA Q;  1DJR D;  3MXN A;  4FNF A;  1OXT A;  3U58 A;  2N88 A;  3ITP A;  1HPC A;  5IP9 G;  1WTP A;  3S1R B;  3BU2 A;  3TSS A;  5CMD A;  3EQL C;  3VQW A;  1JB7 A;  2JJQ A;  3NP8 A;  3EN2 A;  2DEQ A;  4P71 A;  1VQE A;  4PZ7 A;  4JI8 Q;  3D6W A;  4DV7 L;  2R7F A;  2F3I A;  2ZXF A;  4B3R L;  1GXD C;  4DK1 A;  1F2Y A;  3PO2 H;  4RHS A;  1X3E A;  3K5M A;  1XJV A;  2NB0 A;  5FLX L;  4K5X A;  2JN4 A;  5FLM G;  2I07 B;  2HCI A;  3BDC A;  3HOV H;  1JWM D;  1FVI A;  1HC7 A;  4TKO B;  2DXU A;  1HQM C;  3K7A H;  4RH6 A;  4PQX A;  5BR8 Q;  3I4O A;  5COY A;  4TWA A;  1JR0 D;  2A8E A;  4F88 A;  3E0J A;  2RHS B;  3K6O A;  1X56 A;  3DM1 A;  4P3O A;  4BA1 I;  1C48 A;  2EDG A;  3HTZ A;  2A6E D;  4G7H C;  4A3J H;  3HS0 C;  5JVG 3;  2EY2 A;  3C46 A;  4XTV A;  3M85 A;  2CWA A;  4DAY B;  4JV5 L;  1QCB D;  2PNH A;  3HKZ G;  4DV2 Q;  4YRQ A;  4YRJ A;  1RTO A;  4A3K B;  1KMM A;  4TVA B;  1NJ6 A;  3IKJ A;  1VQK A;  1D5X C;  5FOB B;  1RD9 D;  4ZAI A;  4GN4 B;  2GN5 A;  4S3S A;  2DXT A;  2Y0S G;  1H9J A;  1IBL L;  2VZA A;  1GHJ A;  2EYO A;  4X6A H;  4K6L A;  4TTV A;  3Q0A A;  3GTJ B;  4IOA A;  2JA5 H;  4CH5 A;  1QJO A;  5LMU L;  1ZYR C;  1N32 Q;  4A3D G;  3IFT A;  1IZ6 A;  2XWB B;  4QCL A;  4WJ4 A;  1STG A;  5C6A A;  2DUD A;  4OXP A;  1S5E D;  2IX0 A;  4HWT A;  4YCU A;  5FKA C;  1LTB D;  1G91 A;  1TWG H;  4CDC C;  2FMM A;  1JMC A;  1IW7 D;  1K0R A;  3PCO B;  4CBV A;  2NWG A;  1VQ8 A;  3VQX A;  4KY6 A;  3E6Z X;  4PG3 A;  2B63 B;  2ALY B;  2L0C A;  3CC7 A;  1Y69 U;  1VQ6 A;  1DD2 A;  4O1N A;  3CKI B;  3BYT B;  4OEL B;  5CYU A;  4C3I G;  5E4W C;  4OIK A;  2Z1C A;  3ULJ A;  2F4V Q;  3RAC A;  5K1X A;  1PRT D;  3OHX C;  4BWA A;  1MJE A;  3TDQ A;  4CHT B;  4DV7 Q;  4JI6 L;  5C44 B;  2MGS A;  1PRT B;  4HA8 A;  4A3G B;  2RF4 A;  3STB D;  1II3 A;  4RG1 A;  4CKB A;  1VQL A;  1HZ9 A;  2LMC B;  1LV9 A;  2Z8L A;  4QY7 A;  1N34 L;  2WAQ G;  2VQE L;  3EVQ A;  1WOC A;  4G57 A;  2PO4 A;  3U9S A;  1TU2 B;  1GUT A;  3NQI A;  4IAL A;  3PIO 3;  2PYK A;  3NTH A;  3L7Z C;  1NCV A;  1E2Z A;  4A3F H;  1EQQ A;  4XQJ A;  1VS0 A;  2CQO A;  1D5Z C;  1BKB A;  3IKL A;  2ICI A;  4JV5 Q;  3HFZ B;  3NEL A;  3K5L A;  4LF6 Q;  1TQO A;  1Y1W B;  3MF1 A;  1QIL A;  1QUQ B;  4DA2 A;  4PMC A;  3K58 A;  2DU5 A;  1PH4 A;  1JWU D;  3HOX B;  2D0O A;  1YNN C;  4HED A;  1MJC A;  1IBL Q;  2UUC L;  4G4K A;  1GD7 A;  2B2V A;  5FLM H;  4RCN A;  4OON A;  4XU1 A;  2PME A;  1Y8N B;  4A3L G;  5ELO A;  5JJL A;  5T1I A;  2AQ3 B;  3PGZ A;  1VCI A;  5LMU Q;  1YJW A;  2JA6 G;  3KUP A;  2K1B A;  4RA8 A;  2CH4 W;  3RLN A;  3UE1 A;  1YZ6 A;  3HRI A;  2OEO A;  1USY A;  4I7Z C;  3S1N B;  2N55 A;  1WQ7 A;  3HP3 A;  4R8I A;  2HHH Q;  1SR3 A;  4P73 C;  5EBC A;  2O5I C;  2EL9 A;  3I4M B;  5I2Y A;  2VY3 A;  2WKD A;  4PZ6 A;  5IYB G;  4K14 A;  1AH9 A;  3A7A A;  1Z7T A;  1VQC A;  1TR5 A;  2DZC A;  4G85 A;  1X3Q A;  1EIH A;  1GHK A;  2HQE A;  5J1Z A;  4QUF A;  4LFB L;  2F0D A;  4HIK A;  4WI1 A;  5C4J H;  3PSI A;  2F0M A;  4UY8 C;  3A55 A;  1XXG A;  4P72 C;  4LVK A;  2ZTE A;  4QJF A;  4YRL A;  1EQV A;  5F2D A;  1TS3 A;  4KJN A;  4R4T A;  3PO3 G;  1LYL A;  3CU7 A;  3I73 A;  4L6T B;  4Q6G A;  2XSC A;  2B2U A;  3J7A F;  4MTK A;  1IXR A;  4N8F A;  4XYO A;  2VB2 X;  3S1M H;  2DN8 A;  3RMH A;  4YDQ A;  1YFT A;  2XTI A;  2Z6K C;  3VYR A;  3M4O H;  1J9O A;  3A54 A;  1PTO D;  1SMY D;  2VS1 A;  2KCN A;  3BDO A;  5A35 A;  4JOI C;  4TQD A;  1Y1V H;  4Y7N B;  5C4X B;  5M5W H;  1PTO B;  1L1O C;  3S15 B;  1PH8 A;  4RGN A;  4JK1 C;  3DMU A;  5KYL A;  2NTT A;  3ZYY X;  2BCO A;  5FO9 B;  2NZH A;  3OMC A;  2KEN A;  3FPP A;  2VQE Q;  1E3P A;  3L2P A;  2B63 G;  2YU9 H;  4A76 A;  4EQO A;  3ERQ A;  1IL8 A;  5C3E H;  2BE5 D;  3PQI A;  1O7Z A;  1S3O A;  2NYZ D;  2ZT9 C;  1UEA B;  5IT9 L;  4L8J A;  1VQH A;  1K3B C;  3NE5 B;  5K1P A;  1Q7Y C;  4ZQ3 A;  4HJA A;  2F0I A;  2K28 A;  4AYB E;  3S16 H;  5C44 G;  2RDF A;  3MXU A;  4H2V A;  2R92 B;  3AU7 A;  4BBS H;  1V1P A;  2QF7 A;  3NEM A;  1PH1 A;  1SFO B;  2UUA Q;  1DYQ A;  4F8M A;  5E4X A;  4GKJ L;  1HFN A;  5JOB A;  4CDF C;  3QB3 A;  2LSS A;  1FD7 D;  5T1G A;  5M5Y H;  5G3L F;  3M3Y B;  2ZR2 A;  1NE3 A;  2UUC Q;  2QKI C;  3D4W A;  3F8T A;  1HUM A;  4LNS A;  4XTX A;  4WOR A;  2AUJ D;  4IPD A;  2PCF B;  4J15 A;  4DK0 A;  3QO2 A;  1KRT A;  1G6P A;  1NAP A;  2JP1 A;  4B9X A;  4YY3 L;  5EKK A;  1PH7 A;  3RZO B;  1XPU A;  1GJX A;  1BIA A;  2GVB A;  3UI2 A;  4RCO A;  3HOZ B;  3A8K E;  1XMQ Q;  1C8C A;  5BN3 A;  1SNQ A;  1Q12 A;  3V7C A;  3JAM L;  5ELC A;  3G71 A;  4PZ8 A;  4LFB Q;  4K8J A;  1MSH A;  1Y1W G;  4A3E B;  3TEG A;  2ZTD A;  4UAI A;  1K83 B;  1SMX A;  2UU9 L;  1BBU A;  5CR3 A;  2I5M X;  3BVZ A;  1HR0 W;  3J80 c;  1ENF A;  2RHQ B;  1G5I A;  1GUG A;  4AQY L;  1RCV D;  5C0X J;  2B29 A;  3ULL A;  3S17 H;  2QCP X;  2I4M A;  3ERR A;  1VMP A;  3CCM A;  2D62 A;  3GTM H;  1ROD A;  3PV0 A;  5DM6 3;  2A68 C;  3I4L A;  4L5S A;  3I4M G;  3GTG H;  1A3U A;  2LS0 1;  2ZIN A;  2RSN A;  4L5R C;  2PMZ B;  4QB4 A;  5M3F H;  3K0Y A;  1EWC A;  4LF7 Q;  1FNU A;  1EIY A;  3G1Z A;  4TRD A;  5DAU A;  3IKM B;  2EJF A;  1STA A;  1YNN D;  1H9M A;  4IFD I;  3D31 A;  5K36 H;  2HIV A;  2CJ9 A;  3HOU H;  3GV3 A;  1PZI D;  4QQB X;  3RKW A;  4POG A;  3PO2 B;  3PIO A;  1G2T A;  4ZK9 B;  1NY4 A;  2JQO A;  1XNR Q;  4FO2 A;  1F2Z A;  4DR7 Q;  2ZXO A;  2IHE A;  3P8T A;  4P2C B;  1DGS A;  4JBM A;  4LF8 Q;  3HOV B;  1ZXT A;  4HAE A;  4DV6 Q;  1X2G A;  1A63 A;  2I4N A;  2HDM A;  2CHB D;  3OYY A;  2DY7 A;  4IO9 A;  1STN A;  2K7V A;  1HZC A;  4N9P A;  4PV1 C;  4KJO A;  3FP9 A;  4YWL A;  1EOT A;  3C3L A;  3O13 A;  4H2W A;  3H6M A;  4A3M G;  3W1B A;  1O80 A;  1EFW A;  4OLF A;  2EY1 A;  5C0X G;  1QNK A;  3BJU A;  4P3N A;  1H4Q A;  2A5H A;  2E74 C;  3RD4 A;  3UGQ A;  3I4N G;  1W2B A;  4LMQ D;  1EEF D;  1VQB A;  3J7Y W;  2JA5 B;  1KMN A;  2JK8 A;  2I5L X;  1SXT A;  2B8F A;  2KCM A;  4J8Q A;  2OQ0 A;  1LT3 D;  1XYI A;  5IGC A;  1EU3 A;  3MAQ A;  1EOV A;  2UU9 Q;  1L1O B;  4LK1 C;  3DWA A;  5ELD A;  4C3H G;  2ZXR A;  1QVF A;  2NVQ H;  3J7A 5;  1ML0 D;  1UE7 A;  3BFM A;  4K86 A;  4POF A;  1DON A;  1H9K A;  2F0P A;  3OTO L;  2Q8R E;  2C9O A;  4NMZ A;  5IOC A;  2K5Q A;  4FDB A;  4JW0 A;  1N36 L;  1TWG B;  4K0K Q;  1LTR D;  1TT2 A;  2UXB Q;  2NN6 I;  3WWV A;  1HUN A;  5C3X A;  4C56 C;  1D1I A;  4DV1 Q;  1WLE A;  1LT6 D;  3L1A A;  3TEH B;  2N8N A;  2F0G A;  1K8A C;  3A7R A;  3HOZ G;  3DSQ A;  4HSP A;  3QIA A;  1NMF A;  2PQA B;  2KEC A;  5CV5 A;  3R8B A;  3I55 A;  2NVX H;  2AWN A;  2DNE A;  4OEM B;  1Q81 C;  1Z7N A;  2KOL A;  1I4H A;  1WJJ A;  4NXN L;  2I4L A;  1DCZ A;  5KNB A;  3K59 A;  1V1Q A;  1LTI D;  1T9H A;  3A8J E;  1CKO A;  2PQE A;  2ATW A;  3PUY A;  2DKG A;  4K6D A;  4QF4 A;  4B3M Q;  1HNZ Q;  2QHS A;  3GTQ H;  2XWJ B;  3QO8 A;  1B3Q A;  5C4H A;  3H94 A;  3F2C A;  1E0B A;  1KD1 C;  1BO0 A;  4JC0 A;  3QOL A;  2R93 H;  1L2F A;  3HOW G;  2HCC A;  5M3M G;  4PMB A;  4UHV A;  4H13 C;  1EYA A;  3TQY A;  4EQP A;  5CV8 A;  2OF1 A;  3CQZ B;  4RGT A;  2KVM A;  2RKS A;  2KEE A;  5KEE A;  4KN7 C;  2I0Q A;  4IPH A;  4NXM Q;  2BH8 A;  4LUO A;  1HR0 L;  3RN2 A;  5GAH C;  4OHJ A;  3A5Z A;  4IJH A;  2E2H H;  1BUV T;  2K01 A;  1EY6 A;  1Z9F A;  4KD3 A;  4DK6 C;  1TWF B;  3VBB A;  2L11 A;  2M2L A;  5HUR A;  2Q2H A;  1V1O A;  3QTC A;  3UE0 A;  3CP0 A;  1KAW A;  3SHL A;  1CHP D;  4RKL A;  4JYA L;  2DZ9 A;  3CC4 A;  4XTU A;  3HOV G;  3FDT A;  1PH9 A;  5CV7 A;  1M4V A;  3LGJ A;  2R3Z A;  3BVG A;  1G8Z D;  3TZU A;  1X9N A;  1F2L A;  4YPF A;  1TWC H;  1IL2 A;  1I94 L;  5DEH A;  1IKL A;  1TWH H;  1I3Q B;  3KLS X;  1A2T A;  1NTG A;  3R2I A;  3GTP H;  4AYB G;  4A3J G;  3HEJ A;  4R4O A;  4JI8 L;  3MTS A;  5C0X H;  2ZZG A;  4LF5 Q;  3HKZ B;  5IGF A;  2EJG C;  3FEW X;  1SND A;  1SNM A;  2B2T A;  2DTO A;  1U4L A;  3MFY A;  4FP5 D;  2Z9H A;  3RN5 A;  1VQ5 A;  5IP7 H;  1I50 B;  1CKN B;  1AEX A;  4NB3 A;  2Y0S B;  4R8N A;  1HHV A;  4KR2 A;  1XPO A;  4JPB W;  1UE1 A;  1H9S B;  1IBK Q;  4X64 Q;  4NXN Q;  5BR8 L;  1B50 A;  4CJ0 B;  4R1J A;  2B2W C;  1CSQ A;  2K4K A;  4P74 C;  1FL0 A;  4MZ9 A;  2HDL A;  4A3D B;  2RHS A;  4H2S A;  3K8A A;  5LMN W;  2H1E A;  2SNM A;  1JJC B;  2WII B;  1R4Q B;  2Q2T A;  4DAY A;  4JI4 Q;  3RGL A;  1YHQ A;  3BDL A;  4TVA A;  1YI2 A;  1J5W A;  4XQQ A;  1I6H B;  3I70 A;  5ELF A;  1SEB D;  2YU9 B;  1ILP A;  3X3M A;  5KYI A;  3NQT A;  2Q5I A;  2MO0 A;  4C3I B;  4ZYS A;  1HR0 Q;  1O7Y A;  3KDF B;  4IQZ A;  1VQZ A;  2UUB Q;  3NBH B;  4LFA L;  1EYD A;  1EVL A;  5FJ8 G;  2FYK A;  2J4X A;  1VQG A;  1YNX A;  4JI1 Q;  2RDH A;  2YV5 A;  4JI2 L;  3L4G B;  4Y52 H;  2K04 A;  1STE A;  1PRT F;  4CDE C;  4FF1 A;  4APV A;  3J80 i;  3EFR A;  4LVJ A;  1KQS A;  2WIN B;  2EPB A;  3HY1 A;  3NEN A;  1KDA A;  3HOW H;  3M9B A;  1LLR D;  1MHW C;  1VQF A;  1EY0 A;  3PCO A;  1PFS A;  1W3S A;  2ARS A;  2WAQ B;  4B3T L;  1WD1 A;  3BVM A;  3T1H L;  4DV0 Q;  2ALY A;  1I94 Q;  3AYH B;  2LY7 A;  1JOQ A;  4YRG A;  2F0Q A;  4ID6 A;  2JA7 H;  2J0T D;  4TSS A;  4A3F G;  2N49 A;  2F4V L;  1LUZ A;  2X69 A;  4MNO A;  5JPM C;  1LTG D;  4KQE A;  4CH3 A;  3LWE A;  4UDU C;  1KTK A;  4DV3 Q;  2F0N A;  2K32 A;  3OMG A;  2UXD Q;  2ZXP A;  3F2D A;  4YRT A;  1QE6 A;  1PVO A;  4KHV A;  4RWS C;  3VYS A;  3J80 E;  2LXJ A;  2CW0 D;  3HRK A;  2VUM H;  2BH2 A;  4TQF A;  5IE8 A;  1HZA A;  3VYU A;  3LWU A;  1S5C D;  3FPU B;  3S2H H;  3J81 L;  4YWK A;  4C2M H;  3S17 B;  1FGU A;  2SEB D;  4NDX A;  4X3U A;  3CXC A;  2JA6 B;  3MEY A;  1JOR A;  1AZQ A;  3MHB A;  3MFG A;  4RQE A;  5JJZ A;  4WFN 3;  3DHQ A;  5HGQ A;  1BDO A;  3HFZ A;  1STH A;  1B1Z A;  4LF6 L;  3TS2 A;  4DR6 Q;  3LSS A;  3TBI B;  3CCR A;  1QUQ A;  1X3P A;  4M8A A;  1B9N A;  3VR4 A;  3S2D H;  1M90 C;  4NKL A;  4XXE A;  3QOJ A;  4QGU A;  3PO3 B;  1S5D D;  1TXY A;  2BDN A;  3J7A V;  1T5X D;  1WVL A;  2O5J C;  1D5M C;  2DTH A;  1YFS A;  4IPC A;  4LFA Q;  3M4Y A;  2Q8I B;  4C1N I;  2HIX A;  5F5W A;  5EKL A;  4HWO A;  3NTK A;  2HQL A;  1EY4 A;  2YTV A;  4JI2 Q;  2HHH L;  3GTO H;  4GOP A;  1Y1V G;  3EJI A;  1C9O A;  5LHY 1;  1HRJ A;  2WB1 E;  5GAG C;  3HXU A;  1STB A;  1QVG A;  1G6Z A;  2DJG C;  3GD7 A;  2NTS A;  1STY A;  1PTO F;  2PZW A;  4H2X B;  1VQI A;  3HG9 A;  1V9P A;  3W3A A;  3T53 B;  1KHI A;  3D8G A;  4DR3 L;  1EY5 A;  1GUN A;  4YCV A;  1YIJ A;  4B3T Q;  4EVO A;  2E2J H;  4HIO A;  3BZC A;  3T1H Q;  3RZD H;  1MKH A;  5C3E G;  2HD3 A;  2UXC L;  3RUX A;  3DLL A;  3K0X A;  3M4P A;  5LMN L;  3OWE B;  1XTD A;  3OD1 A;  4YRP A;  2NVY H;  2E8G A;  3ND8 A;  5KND A;  2E5L L;  1PV4 A;  4ILW A;  1SE4 A;  2B2V C;  3KLR A;  3W5O A;  2AKW B;  4XQN A;  5FJ8 H;  1X65 A;  1N8R C;  4BA2 I;  1X3F A;  3MXN B;  4BBS G;  3S14 B;  5CBE E;  2RCF A;  4XT1 B;  5M5X B;  2F0U A;  1USY C;  2YTY A;  4XU3 A;  4NW2 A;  4DUZ L;  2K50 A;  4CKC A;  1K9M C;  1AW7 A;  3JC6 6;  1KRS A;  2XIW A;  4HJ8 A;  1EIF A;  3RUZ A;  5I6Y A;  2NUC A;  3RIR A;  1VQ4 A;  1WQW A;  3BS1 A;  2A19 A;  4OO1 H;  1C0A A;  2HUG A;  3WOE A;  4X62 Q;  1KDC A;  3CCE A;  4KV6 A;  2BDO A;  3A0J A;  5C3W A;  1RKN A;  3H09 A;  1BBW A;  1SAP A;  2MPM A;  1NR4 A;  1TS4 A;  2G9H D;  2MNA A;  5JAV A;  2NVX B;  3P75 A;  4EQN A;  3GTL B;  2B2U C;  2WV6 D;  3CCL A;  2ZT6 A;  4LF4 L;  2KHI A;  3V96 A;  5IY0 A;  2UUA L;  4DPG A;  1NJI C;  2EYH A;  2A69 C;  4C3J H;  1QB5 D;  2RCN A;  2F0V A;  2EYF A;  4R4I A;  4WRD A;  3SK6 A;  3VR3 A;  2I46 A;  3F2U A;  2Q5H A;  3PZC A;  2ZM6 L;  1QZH A;  4A4I A;  4U67 3;  4DAP A;  2K05 A;  4OWX B;  2K03 A;  2QDL A;  3RR5 A;  2EVB A;  3HRZ C;  5ELN A;  4ZUJ A;  1CTM A;  3I56 A;  2R7Z H;  2F0F A;  2IX1 A;  3V8L A;  1UE5 A;  4KHZ A;  3SK4 A;  1SES A;  2QGQ A;  4YRS A;  1EU4 A;  4OL7 A;  2ZJQ A;  1XMQ L;  4OIJ A;  4F87 A;  3A31 A;  4XTZ A;  4PMW A;  5CV6 A;  5M3F G;  5ELE A;  3RKY A;  2R6G A;  4G7Z C;  3NUC A;  3MQZ A;  4NCX A;  2E2I H;  1E1O A;  1Q82 C;  5GAD C;  4DR3 Q;  4R4C A;  3RLF A;  2I4O A;  2E2H B;  5K36 G;  3HOU G;  2MO1 A;  2UXC Q;  2E1H A;  4H02 A;  3WOF A;  4YIJ A;  4A3B H;  5LMN Q;  1AE3 A;  2RHQ A;  5IGB A;  1H4T A;  3GTK H;  1J6Q A;  3AB9 A;  2DQ3 A;  1F77 A;  3CPW A;  11AS A;  3RKX A;  2E5L Q;  3HOY H;  1X3G A;  5CV4 A;  5C5M A;  3TRZ A;  1Q1B A;  3PUZ A;  2ZCE A;  2ZIO A;  4BY1 H;  1SNC A;  3HXY A;  2J3L A;  3Q8D A;  4KKU A;  3TN2 A;  1R9T B;  1M8A A;  1U4P A;  1XPR A;  1BVS A;  4DUZ Q;  1H9R A;  1QOH A;  4K2L A;  4LF7 L;  1PYS B;  1X32 A;  1UNS A;  4KK7 A;  4DR2 Q;  4R4Q A;  5D3D A;  1CI3 M;  4A3M B;  1EYC A;  1ENC A;  1O78 A;  3DWP A;  4JCV E;  4V0B A;  1HNW L;  3KF8 A;  3IL8 A;  1FJG L;  4P75 A;  1ZYR D;  4GS3 A;  2JA8 G;  5GRO A;  2TMP A;  5I9O A;  1YBY A;  4N9T A;  5AJ3 L;  1XNR L;  3TP6 A;  1VQO A;  3I4N B;  4DR7 L;  1WU7 A;  1V8Q A;  2E76 C;  4FVM A;  4RFB A;  4LF8 L;  3V8J A;  3L0O A;  2HNI A;  4DV6 L;  3VR2 A;  2BA1 A;  1LAC A;  3T51 B;  5C52 B;  4LF4 Q;  3A32 A;  3G6E A;  1JE5 A;  2LFN A;  3H0G H;  3D3R A;  3S1Q H;  4BY7 H;  3CRL C;  1BXT A;  4I7A A;  4BWG B;  1Q8K A;  4GN3 B;  4C3H B;  2VNU D;  1DOL A;  4ZCK A;  3NBI A;  4LVL A;  2L9H A;  2ZM6 Q;  2EXD A;  1EIG A;  2PZU A;  5CGK A;  4R9W A;  4P72 A;  3BZK A;  2F0E A;  4A93 H;  4KR3 A;  1Q3L A;  3L3O C;  1CZG A;  3P7J A;  4K88 A;  3H3V H;  3A7L A;  1SSO A;  1J8I A;  1BOS A;  1EL0 A;  1W66 A;  1E2V A;  4HN7 A;  3BZD B;  3E5S A;  3D0F A;  1RF2 D;  2XGT A;  4IUR A;  4QUC A;  3HXV A;  1UUP A;  4KI0 A;  1JJ2 A;  4JOI A;  2VXW A;  4WJ3 M;  3HFV A;  2CIM A;  3QO7 A;  1EZ6 A;  1ATI A;  2ZNJ A;  4UPA A;  2MHV A;  3GO5 A;  1L1O A;  3S1R H;  5BN4 A;  1XMO L;  3R3O A;  3D4D A;  4KHP L;  3A5Y A;  2FIN B;  3OSO A;  4UP9 A;  1SDF A;  1WCM H;  2ODR C;  2NS6 A;  4GKK Q;  3P20 A;  4K0K L;  2R93 G;  3W3S A;  5L37 A;  5LL6 S;  3HOW B;  3ZJY C;  2UXB L;  1HJP A;  1HA5 A;  5M3M B;  3VA7 A;  1AN8 A;  1VF7 A;  3MVV A;  4DV1 L;  2B2Y A;  1L0W A;  1QG7 A;  3D4R A;  3TEH A;  2Q8T A;  2EYJ A;  4YCW A;  1L0Y B;  2F0S A;  2PQA A;  4X65 Q;  4OX9 L;  3ONA B;  5I2X A;  4PHC A;  4DR5 Q;  4GNX A;  4DR4 Q;  4EGV A;  4KD4 A;  2KHJ A;  5CBA E;  4YRM A;  1ADY A;  1KOG A;  2WB1 G;  4B3M L;  1HNZ L;  1HNW Q;  1FNW A;  3MA2 B;  2QHU A;  1B4O A;  2I5H A;  1CK1 A;  1FJG Q;  2ZNI A;  4LFC L;  4QIW E;  2RQX A;  5AJ3 Q;  1VQN A;  1ET9 A;  2P5Z X;  3REX A;  2VUM B;  1N9W A;  1TKW B;  1VF5 C;  5JEA J;  3UDG A;  5IWA L;  4A3K H;  2YYZ A;  3S2H B;  3K7A B;  1HQR D;  3TUP A;  2EJM A;  2K5H A;  4A3I G;  4BBR H;  1YJ9 A;  2IWH A;  4NXM L;  4K8I A;  2ZGW A;  1W6J A;  3REU A;  2MJ8 A;  4IUN A;  2LXK A;  4X3K A;  4XYQ A;  1YVC A;  3WDN A;  4AYB B;  2R7D A;  3GTJ H;  4A3J B;  4PNY A;  3I3C A;  4FYD A;  1YNJ C;  1L0X B;  1SN8 A;  5TSS A;  2X6L A;  2DTI A;  4X66 L;  2MUY A;  2TSS A;  1I4G A;  3R2T A;  1KNA A;  2AMC B;  3MEH A;  1QVC A;  1LTL A;  2JA8 H;  2IT1 A;  2LKV A;  5IP7 G;  1NJ2 A;  4YRK A;  2KUM A;  5C0X I;  1F9Q A;  3JAM i;  1B9M A;  1K8M A;  1GM5 A;  1HZB A;  4IUP A;  2MFI A;  2C7I A;  5GQO A;  1AFP A;  3VR6 A;  1GUO A;  3Q6S A;  3MWY W;  3BG3 A;  4X3T A;  5C4Z A;  1PXU A;  5J39 A;  2RVL A;  1I6V C;  1YHB A;  1WTW A;  3DWQ A; 
#chains in the Genus database with same CATH homology
 4XTW A;  3F2B A;  1XMO Q;  4LWC A;  1S72 A;  4KHP Q;  4WF2 A;  3V8K A;  2P0L A;  4LF5 L;  2AWO A;  2OCE A;  4BXX G;  2PI2 A;  1RIQ A;  5J3B A;  2H5X A;  2ART A;  1NJ1 A;  4OX9 Q;  4JI5 L;  4XIG S;  1IBK L;  4X64 L;  1PHJ A;  4DV5 Q;  1G51 A;  3FJP A;  4AH6 A;  1AE2 A;  2IY5 B;  1JJC A;  1EQR A;  3H15 A;  4LFC Q;  5FLX c;  3HXW A;  4JI4 L;  2DDZ A;  5IWA Q;  3SGI A;  5GAE C;  3CF5 A;  1SET A;  2E3C A;  2CWP A;  3HOX H;  1B70 B;  4IOC A;  3VQV A;  2GVA A;  2JA7 G;  2HT1 A;  1PH2 A;  4YRN A;  4L5Q A;  3KDF A;  4IJL A;  1Z7M A;  3P8Y A;  1X2H A;  2UUB L;  4DNI A;  4X66 Q;  2ODR D;  4JI1 L;  3VDY A;  3L4G A;  1S40 A;  1U0L A;  1B8A A;  3K80 C;  3CAM A;  4HJ9 A;  4DR1 Q;  2VUM G;  1XNQ L;  3PF5 A;  4BW9 A;  4DV0 L;  2Z0S A;  4A3I H;  4A3C H;  3P8V A;  3A7U A;  1H4S A;  1E24 A;  4DV3 L;  2UXD L;  2JE6 I;  1JJG A;  2NVT H;  4Y7N H;  2A8V A;  2E64 A;  1YFR A;  4JI5 Q;  2WP8 J;  2FXQ A;  4YWM A;  2YTX A;  3WQZ A;  3EFS A;  2EWN A;  3CCJ A;  4YRE A;  3LC0 A;  1MIU A;  2DJZ A;  2G4C A;  4BXX H;  2E41 A;  4DR6 L;  2R92 H;  2B3G A;  4ZIB A;  1RL2 A;  4P71 C;  1SFO H;  1NMG A;  4DAM A;  4A75 A;  3M3Y H;  2ZTG A;  4GN5 A;  4ZTZ B;  4O2D A;  3CCQ A;  3TRE A;  3STB C;  4HIM A;  4B3S L;  1IBM L;  4JI0 Q;  1YHA A;  2N78 A;  1ASY A;  1EYG A;  1XNQ Q;  4H2X A;  4ALP A;  2DGY A;  1KIX A;  4A3E H;  1K83 H;  2QA4 A;  4OO1 G;  1EWI A;  3UDF A;  4YHH Q;  3EIV A;  1Q46 A;  3FKI H;  4LW1 A;  4P3P A;  5IYD H;  1YIT A;  4P74 A;  3EBE A;  4HID A;  2AKW A;  1SRY A;  3A5U A;  4TVY A;  4RQF A;  1VQA A;  1J5E L;  1OXV A;  4GOP C;  4LF9 Q;  1B7Y B;  4X62 L;  2AHO B;  2R7Z G;  2CCZ A;  2JEA I;  3E0E A;  3A74 A;  3TS0 A;  2CJB A;  2ZZE A;  2KCT A;  2K52 A;  4HJ7 A;  3G48 A;  3T1Y Q;  4EO4 A;  5C51 B;  5IT9 c;  3J81 j;  2Q7G A;  4A3B G;  3IAL A;  2OQK A;  3RL6 A;  3HOY G;  4EX5 A;  1G29 1;  3J7Z C;  4B3S Q;  1IBM Q;  4BY1 G;  2L15 A;  3ULP A;  4Q15 A;  3KYH C;  2ES2 A;  3E9I A;  1OXS C;  4DV4 Q;  3U50 C;  1TWA H;  4OWT B;  1HH2 P;  3KOJ A;  1YGB A;  3KF6 B;  1VQ7 A;  1N33 Q;  4E51 A;  3PUX A;  3JAM c;  1ADJ A;  2ZZF A;  5IYC G;  3CME A;  2QHV A;  2E65 A;  4JBJ A;  3H0G G;  2ZT5 A;  4BY7 G;  3CCS A;  1J5E Q;  1GGM A;  4DR2 L;  1PYS A;  1WNL A;  3MEF A;  3QNE A;  3J81 i;  3HKS A;  1P8L A;  3B6Y A;  5EAY A;  2OTJ A;  4MTN A;  1NJ8 A;  4A93 G;  1KL9 A;  3ICE A;  4B3R Q;  1KXL A;  3AEV A;  3PIP A;  1PA6 A;  3CQZ H;  1CKM A;  3RNU A;  1NYR A;  3H3V I;  5IP9 H;  5JJK A;  3M7N A;  4JBK A;  1NYQ A;  4YRO A;  1WCM G;  4LUZ A;  3K7U C;  1LM0 A;  4GLA C;  3IG2 A;  3QO5 A;  1TWF H;  3M4Q A;  2QHT A;  2ZIM A;  4P75 C;  3UDI A;  2C8M A;  1I5F A;  2E5A A;  1ASZ A;  1RIP A;  4DQ2 A;  3IRB A;  1I3Q H;  1NNH A;  4DUY L;  4GOP B;  3ICA A;  4HJ5 A;  4GKK L;  4TQU S;  5E3I A;  5H1S E;  4A3K G;  1WFQ A;  1D7Q A;  1NJ5 A;  2ARU A;  4XEO A;  4X65 L;  1I50 H;  4BBR G;  1CUK A;  3UFG A;  3KLW A;  4DR5 L;  4DR4 L;  4DK3 C;  4CS2 A;  3FHW A;  1O7I A;  2PMZ E;  3HY0 A;  4A3D H;  3KJP A;  4JI6 Q;  2IHF A;  1A0I A;  1X55 A;  1CSP A;  4TVW A;  4H2T A;  2MQH A;  1K8G A;  3UH0 A;  1N34 Q;  5IYC H;  2ZJR A;  1I6H H;  4P73 A;  2A1A A;  2DVE A;  4C3I H;  4ME3 A;  1Q86 C;  3HXX A;  4GNX C;  2OTL A;  1PYB A;  1VQM A;  5HY6 A;  4IFD J;  2BA0 A;  2AMC A;  1PH5 A;  4A3G G;  1EVK A;  4OP0 A;  4GLV B;  4O0A A;  2JEB I;  4HVC A;  3ER0 A;  3CD6 A;  2Z6K A;  4JG2 A;  3U4Z A;  3NET A;  4DUY Q;  2EIF A;  3PUW A;  1P16 A;  2ZT7 A;  1JT8 A;  4XTC S;  1X01 A;  3MF2 A;  2QEX A;  3HOX G;  4H2U A;  2CJA A;  4HWR A;  4JI7 L;  1WI5 A;  1H4V B;  4DV5 L;  4A3L H;  2PMF A;  4OWW B;  3GDE A;  3CW2 C;  3RF1 A;  3I2Z A;  1UWV A;  2Q2U A;  2JA6 H;  4CS4 A;  3L2Z A;  3RLO A;  1G5H A;  1UE6 A;  2K75 A;  4EQ5 A;  4YRR A;  5JJI A;  4IFD G;  5IYB H;  2IY5 A;  1C7Y A;  4RDX A;  2P5I A;  4LVM A;  12AS A;  1GKH A;  2ASB A;  4A3C G;  1B70 A;  3CCU A;  4XU0 A;  1SE8 A;  1SRO A;  2WFW A;  3KF8 B;  3PO3 H;  4CH4 A;  1V43 A;  1U5K A;  4K87 A;  4YRC A;  1VQD A;  4ZTU B;  3R07 A;  1QF6 A;  4UP8 A;  3CC2 A;  4IPG A;  4GKJ Q;  5C4X G;  4DR1 L;  3KJO A;  4JI3 L;  2N3S A;  1UEB A;  1HXD A;  3LSQ A;  1SLJ A;  2EQS A;  1A62 A;  3OW2 A;  2B63 H;  2OWO A;  2V1C C;  4YRI A;  3E9H A;  4YY3 Q;  1WYD A;  1WPY A;  3W1G A;  3KFU A;  1YB3 A;  2NZO A;  2VW9 A;  1HNX L;  4HWP A;  3I7F A;  2DQ0 A;  1E22 A;  5C44 H;  1PH6 A;  5JEA G;  4GLX A;  2R92 G;  3S14 H;  1EUJ A;  2F52 A;  3HKZ E;  3F1Z A;  4A3G H;  3ERS X;  5M5X H;  2NN6 G;  2EAY A;  3AFQ A;  1CKN A;  2PI2 E;  2E10 A;  1D8L A;  4JI7 Q;  4AQY Q;  1BIB A;  2Y0S E;  3V7S A;  4UP7 A;  1QZG A;  1YEZ A;  3UGT A;  4QL5 A;  1Y14 B;  1VQP A;  3GTL H;  4GNX B;  4JBW A;  3J81 c;  1EIY B;  3AQQ A;  4YYE A;  1Y1W H;  4A3E G;  2Q7H A;  2K5N A;  2ZJP A;  3CMA A;  3CCV A;  5E7N A;  1FYF A;  1X54 A;  3FKI G;  1K3R A;  1B76 A;  2VQF L;  3CPF A;  4CS3 A;  5IYD G;  3PF4 A;  4G84 A;  2VL6 A;  4YRF A;  3S1N H;  4JI0 L;  3DM3 A;  3I4M H;  2ZTC A;  4JI3 Q;  2K14 A;  1X6O A;  4LUV A;  4XEM A;  3PUV A;  2JA9 A;  3S24 A;  5KNN A;  4YHH L;  3CMQ A;  1IYJ B;  2WAQ E;  4XU2 A;  4YP0 A;  2Q2I A;  3PO2 G;  4L5T A;  1SER A;  1HNX Q;  1QE0 A;  1E1T A;  1E7Z A;  4CH6 A;  1R9T H;  5C4X H;  2Q7E A;  4H2Y A;  1YJN A;  3S15 H;  4XTY A;  1PH3 A;  2C35 B;  1M1K C;  5C53 B;  4LF9 L;  2EJ9 A;  4A3M H;  1B7Y A;  3OTO Q;  3UDX A;  1N36 Q;  3K81 C;  2ZR3 A;  4LVI A;  3HXZ A;  4DKA C;  3VQY A;  2J3M A;  1KC8 C;  3V7R A;  1OXX K;  1HTT A;  3AFP A;  3I4N H;  2K5V A;  1OXU A;  1SRU A;  1Q1E A;  4AIM A;  1GVP A;  1NBW A;  3T1Y L;  4HWS A;  2JA5 G;  1VQ9 A;  4KLK A;  4RMF A;  4C3H H;  4X5O A;  3G4S A;  2VQF Q;  2ID0 A;  2D0P A;  1K73 C;  4HT4 A;  4DV2 L;  3RZO H;  1GO3 E;  2ZT8 A;  3HOZ H;  2CGH A;  2CKZ B;  1VQJ A;  1Z47 A;  2DU7 A;  2EJG A;  4NPS A;  3U4V A;  4DV4 L;  3A5Z B;  1N32 L;  3KF6 A;  5DLQ E;  4LNQ A;  2CFM A;  1A8V A;  1N33 L;  4L87 A;  1OTC A;  2KBN A;  5M3M H;  4OO1 I;  4JYA Q;  1OXT A;  3U58 A;  5IP9 G;  3BU2 A;  3VQW A;  1JB7 A;  2JJQ A;  3EN2 A;  2DEQ A;  4P71 A;  1VQE A;  4PZ7 A;  4JI8 Q;  4DV7 L;  2R7F A;  2F3I A;  2ZXF A;  4B3R L;  3PO2 H;  1X3E A;  1XJV A;  5FLM G;  3HOV H;  1FVI A;  1HC7 A;  2DXU A;  3K7A H;  5BR8 Q;  3I4O A;  4TWA A;  2A8E A;  2RHS B;  1X56 A;  4P3O A;  4BA1 I;  3HTZ A;  4A3J H;  4XTV A;  3M85 A;  4JV5 L;  2CWA A;  4DAY B;  4DV2 Q;  2PNH A;  3HKZ G;  4YRQ A;  4YRJ A;  1KMM A;  4TVA B;  1NJ6 A;  1VQK A;  2GN5 A;  4GN4 B;  2DXT A;  2Y0S G;  1IBL L;  2VZA A;  4X6A H;  4TTV A;  4IOA A;  2JA5 H;  4CH5 A;  5LMU L;  1N32 Q;  4A3D G;  1IZ6 A;  4WJ4 A;  2DUD A;  4OXP A;  2IX0 A;  4HWT A;  4YCU A;  1TWG H;  1JMC A;  1K0R A;  3PCO B;  1VQ8 A;  3VQX A;  4PG3 A;  2ALY B;  3CC7 A;  1VQ6 A;  3ULJ A;  2F4V Q;  3RAC A;  5K1X A;  4BWA A;  1MJE A;  4DV7 Q;  4JI6 L;  4HA8 A;  2RF4 A;  3STB D;  4RG1 A;  1VQL A;  1HZ9 A;  4QY7 A;  1N34 L;  2WAQ G;  2VQE L;  1WOC A;  3L7Z C;  4A3F H;  1EQQ A;  1VS0 A;  2CQO A;  1BKB A;  3IKL A;  4JV5 Q;  3HFZ B;  3NEL A;  4LF6 Q;  3MF1 A;  1QUQ B;  2DU5 A;  1PH4 A;  2D0O A;  1MJC A;  1IBL Q;  2UUC L;  1GD7 A;  5FLM H;  4OON A;  4XU1 A;  2PME A;  4A3L G;  5ELO A;  5JJL A;  3PGZ A;  1VCI A;  5LMU Q;  1YJW A;  2JA6 G;  3RLN A;  3UE1 A;  1YZ6 A;  3HRI A;  1USY A;  1WQ7 A;  4P73 C;  2HHH Q;  1SR3 A;  2EL9 A;  1AH9 A;  5IYB G;  2VY3 A;  4PZ6 A;  3A7A A;  1VQC A;  2DZC A;  4G85 A;  4LFB L;  4HIK A;  4WI1 A;  5C4J H;  3PSI A;  4UY8 C;  4P72 C;  4LVK A;  2ZTE A;  4QJF A;  4YRL A;  4R4T A;  3PO3 G;  1LYL A;  4Q6G A;  1IXR A;  3S1M H;  4YDQ A;  1YFT A;  2XTI A;  2Z6K C;  3M4O H;  2VS1 A;  4JOI C;  4TQD A;  1Y1V H;  5M5W H;  1L1O C;  1PH8 A;  2NZH A;  2KEN A;  2VQE Q;  1E3P A;  3L2P A;  2B63 G;  2YU9 H;  4A76 A;  5C3E H;  1S3O A;  1VQH A;  5K1P A;  1Q7Y C;  4HJA A;  4AYB E;  3S16 H;  5C44 G;  4H2V A;  4BBS H;  3NEM A;  1PH1 A;  2UUA Q;  4GKJ L;  2LSS A;  5M5Y H;  2ZR2 A;  1NE3 A;  2UUC Q;  3F8T A;  4LNS A;  4XTX A;  4J15 A;  4IPD A;  1KRT A;  1G6P A;  1PH7 A;  4YY3 L;  1XPU A;  1BIA A;  2GVB A;  1XMQ Q;  1Q12 A;  3V7C A;  3G71 A;  4PZ8 A;  4LFB Q;  1Y1W G;  3TEG A;  2ZTD A;  1SMX A;  2UU9 L;  1BBU A;  2I5M X;  1HR0 W;  3J80 c;  2RHQ B;  1G5I A;  4AQY L;  5C0X J;  2B29 A;  3ULL A;  3S17 H;  2I4M A;  3ERR A;  3CCM A;  2D62 A;  3GTM H;  3PV0 A;  4L5S A;  3I4M G;  3GTG H;  2ZIN A;  4L5R C;  5M3F H;  4LF7 Q;  1EIY A;  3G1Z A;  3IKM B;  2EJF A;  4IFD I;  3D31 A;  2CJ9 A;  2HIV A;  3HOU H;  4QQB X;  3RKW A;  4POG A;  3PIO A;  1NY4 A;  2JQO A;  1XNR Q;  4DR7 Q;  2IHE A;  3P8T A;  1DGS A;  4JBM A;  4LF8 Q;  4DV6 Q;  1X2G A;  1A63 A;  2I4N A;  3OYY A;  4IO9 A;  1HZC A;  3FP9 A;  4YWL A;  4H2W A;  4A3M G;  3W1B A;  1EFW A;  4OLF A;  5C0X G;  3BJU A;  4P3N A;  1H4Q A;  3UGQ A;  3I4N G;  1W2B A;  1VQB A;  1KMN A;  2JK8 A;  2I5L X;  2KCM A;  2OQ0 A;  1EOV A;  2UU9 Q;  1L1O B;  2NVQ H;  3J7A 5;  1QVF A;  3BFM A;  4K86 A;  1UE7 A;  4POF A;  3OTO L;  1N36 L;  4FDB A;  4K0K Q;  2UXB Q;  2NN6 I;  3WWV A;  4DV1 Q;  1WLE A;  3L1A A;  3TEH B;  2N8N A;  1K8A C;  3A7R A;  3HOZ G;  3DSQ A;  1NMF A;  2PQA B;  3I55 A;  2NVX H;  2AWN A;  1Z7N A;  1Q81 C;  1WJJ A;  4NXN L;  2I4L A;  1V1Q A;  1T9H A;  1CKO A;  2ATW A;  3PUY A;  2DKG A;  4B3M Q;  1HNZ Q;  2QHS A;  3GTQ H;  3QO8 A;  3F2C A;  1KD1 C;  4JC0 A;  2R93 H;  1L2F A;  3HOW G;  5M3M G;  3TQY A;  2I0Q A;  4IPH A;  4NXM Q;  2BH8 A;  4LUO A;  1HR0 L;  3RN2 A;  5GAH C;  3A5Z A;  4IJH A;  2E2H H;  1Z9F A;  4DK6 C;  3VBB A;  2Q2H A;  3QTC A;  3UE0 A;  3CP0 A;  1KAW A;  4JYA L;  2DZ9 A;  3CC4 A;  4XTU A;  3HOV G;  1PH9 A;  3LGJ A;  1X9N A;  4YPF A;  1TWC H;  1IL2 A;  1I94 L;  1TWH H;  1NTG A;  3GTP H;  4AYB G;  4A3J G;  4R4O A;  4JI8 L;  2ZZG A;  4LF5 Q;  2DTO A;  3RN5 A;  1VQ5 A;  5IP7 H;  1CKN B;  4NB3 A;  4KR2 A;  1XPO A;  1UE1 A;  1IBK Q;  4X64 Q;  4NXN Q;  5BR8 L;  4R1J A;  1CSQ A;  2K4K A;  4P74 C;  1FL0 A;  4MZ9 A;  4H2S A;  2RHS A;  3K8A A;  5LMN W;  1JJC B;  2Q2T A;  4JI4 Q;  3RGL A;  1YHQ A;  4TVA A;  1YI2 A;  1J5W A;  2Q5I A;  2MO0 A;  1HR0 Q;  3KDF B;  1VQZ A;  2UUB Q;  3NBH B;  4LFA L;  1EVL A;  5FJ8 G;  2FYK A;  1VQG A;  1YNX A;  4JI1 Q;  2YV5 A;  4JI2 L;  3L4G B;  4Y52 H;  4LVJ A;  4APV A;  3J80 i;  3EFR A;  1KQS A;  3HY1 A;  3NEN A;  3HOW H;  3M9B A;  1VQF A;  3PCO A;  1PFS A;  1W3S A;  2ARS A;  4B3T L;  3T1H L;  4DV0 Q;  2ALY A;  1I94 Q;  3AYH B;  4YRG A;  2JA7 H;  4A3F G;  2N49 A;  2F4V L;  1LUZ A;  4MNO A;  4KQE A;  4CH3 A;  4DV3 Q;  2UXD Q;  3F2D A;  4YRT A;  1PVO A;  2LXJ A;  3HRK A;  2VUM H;  2BH2 A;  4TQF A;  5IE8 A;  1HZA A;  3S2H H;  4YWK A;  4C2M H;  1FGU A;  3CXC A;  3MEY A;  4RQE A;  5HGQ A;  3HFZ A;  4LF6 L;  3TS2 A;  4DR6 Q;  3LSS A;  3CCR A;  1QUQ A;  3S2D H;  1M90 C;  4QGU A;  1TXY A;  2DTH A;  1YFS A;  4IPC A;  4LFA Q;  5F5W A;  2HIX A;  4HWO A;  2HQL A;  2YTV A;  4JI2 Q;  2HHH L;  3GTO H;  4GOP A;  1Y1V G;  1C9O A;  2WB1 E;  5GAG C;  3HXU A;  1QVG A;  3GD7 A;  4H2X B;  1VQI A;  1V9P A;  1KHI A;  4DR3 L;  4YCV A;  1YIJ A;  4B3T Q;  2E2J H;  4HIO A;  3BZC A;  3T1H Q;  3RZD H;  1MKH A;  5C3E G;  2UXC L;  3RUX A;  3DLL A;  3K0X A;  3M4P A;  5LMN L;  3OD1 A;  1XTD A;  4YRP A;  2NVY H;  2E8G A;  2E5L L;  1PV4 A;  3W5O A;  1N8R C;  2AKW B;  5FJ8 H;  1X65 A;  4BA2 I;  1X3F A;  3MXN B;  4BBS G;  1USY C;  2YTY A;  4XU3 A;  4DUZ L;  2K50 A;  1K9M C;  3JC6 6;  1KRS A;  4HJ8 A;  1EIF A;  3RIR A;  1VQ4 A;  1WQW A;  2A19 A;  1C0A A;  4X62 Q;  3CCE A;  3A0J A;  1BBW A;  2MNA A;  3CCL A;  2ZT6 A;  4LF4 L;  2KHI A;  2UUA L;  5IY0 A;  4DPG A;  1NJI C;  4C3J H;  2RCN A;  4R4I A;  2Q5H A;  3PZC A;  2ZM6 L;  1QZH A;  4A4I A;  4OWX B;  3RR5 A;  5ELN A;  3I56 A;  2R7Z H;  2IX1 A;  3V8L A;  1UE5 A;  4KHZ A;  1SES A;  2QGQ A;  4YRS A;  2ZJQ A;  1XMQ L;  3A31 A;  4XTZ A;  4PMW A;  5M3F G;  3RKY A;  2R6G A;  3MQZ A;  4NCX A;  2E2I H;  1E1O A;  1Q82 C;  5GAD C;  4DR3 Q;  4R4C A;  3RLF A;  2I4O A;  5K36 G;  3HOU G;  2MO1 A;  2UXC Q;  2E1H A;  4H02 A;  4A3B H;  5LMN Q;  1AE3 A;  2RHQ A;  1H4T A;  3GTK H;  1J6Q A;  2DQ3 A;  3CPW A;  11AS A;  3RKX A;  2E5L Q;  3HOY H;  1X3G A;  3TRZ A;  1Q1B A;  3PUZ A;  2ZCE A;  2ZIO A;  4BY1 H;  3HXY A;  2J3L A;  3Q8D A;  1XPR A;  1BVS A;  4DUZ Q;  4LF7 L;  1PYS B;  4DR2 Q;  4R4Q A;  4JCV E;  1HNW L;  1FJG L;  4P75 A;  2JA8 G;  4GS3 A;  5GRO A;  1YBY A;  5AJ3 L;  1XNR L;  1VQO A;  4DR7 L;  1WU7 A;  4LF8 L;  3V8J A;  3L0O A;  2HNI A;  4DV6 L;  2BA1 A;  5C52 B;  4LF4 Q;  3A32 A;  3G6E A;  1JE5 A;  3H0G H;  3S1Q H;  4BY7 H;  1Q8K A;  4GN3 B;  2VNU D;  4LVL A;  2ZM6 Q;  2EXD A;  4P72 A;  3BZK A;  4KR3 A;  4A93 H;  4K88 A;  3H3V H;  1W66 A;  3D0F A;  2XGT A;  3HXV A;  4KI0 A;  1JJ2 A;  4JOI A;  4WJ3 M;  3HFV A;  3QO7 A;  2CIM A;  1ATI A;  2ZNJ A;  4UPA A;  3GO5 A;  1L1O A;  3S1R H;  1XMO L;  4KHP L;  3A5Y A;  4UP9 A;  2ODR C;  1WCM H;  2NS6 A;  4GKK Q;  2R93 G;  4K0K L;  3W3S A;  3ZJY C;  2UXB L;  1HJP A;  4DV1 L;  1L0W A;  3TEH A;  4YCW A;  2PQA A;  4X65 Q;  4OX9 L;  4PHC A;  4DR5 Q;  4GNX A;  4DR4 Q;  2KHJ A;  4YRM A;  1ADY A;  1KOG A;  2WB1 G;  4B3M L;  1HNZ L;  1HNW Q;  2QHU A;  2I5H A;  1FJG Q;  2ZNI A;  4LFC L;  4QIW E;  5AJ3 Q;  1VQN A;  3REX A;  1N9W A;  5JEA J;  3UDG A;  5IWA L;  4A3K H;  2YYZ A;  3TUP A;  2K5H A;  4A3I G;  4BBR H;  1YJ9 A;  4NXM L;  2ZGW A;  3REU A;  2LXK A;  1YVC A;  2R7D A;  3GTJ H;  1SN8 A;  2DTI A;  4X66 L;  2AMC B;  1QVC A;  1LTL A;  2JA8 H;  2IT1 A;  5IP7 G;  1NJ2 A;  4YRK A;  5C0X I;  3JAM i;  1GM5 A;  1HZB A;  2MFI A;  2C7I A;  5GQO A;  1YHB A;  1H95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...