3BJUA

Crystal structure of tetrameric form of human lysyl-trna synthetase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
507
structure length
503
Chain Sequence
SVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tetrameric form of human lysyl-tRNA synthetase: Implications for multisynthetase complex formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Lysyl-tRNA synthetase
total genus 160
structure length 503
sequence length 507
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2007-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3bjuA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3bjuA02
5JJKA 2OWOA 4X64Q 4YRSA 4JI8Q 3A0JA 2YYZA 1PH1A 3PGZA 2DUDA 1HNXL 3TEHA 3T1YQ 3CMAA 1EIYB 2F4VL 1Z9FA 3ZJYC 4BY7H 3GTLH 2KENA 3U58A 2VQFL 2UU9Q 1N9WA 1QZHA 2CCZA 2P0LA 4HA8A 1VQ6A 4DPGA 4K88A 1VQ5A 4Q15A 3P8VA 1EVKA 1DGSA 3HKZG 1B70A 1QZGA 4H02A 2DTOA 4DV7Q 4TVAA 4YROA 3S15H 1UE6A 4LF8L 3HFVA 4H2TA 3RN2A 3VQYA 3PUZA 4PZ8A 3PO2G 2PQAA 1KAWA 3H0GH 1AE3A 3NELA 3UDGA 4JI3L 5LMNL 2JEAI 3S17H 4HIDA 1L1OC 1QVGA 1HXDA 3U4VA 5GAGC 5JEAG 4NPSA 4JG2A 1YJ9A 1HZCA 5C44H 1X3FA 3TEGA 2A1AA 3NETA 1BKBA 1K3RA 5C53B 3PUYA 2N3SA 1X3GA 3RN5A 4JI3Q 2BH8A 1YHAA 2LXKA 1VQZA 1X2HA 4LFBQ 1WCMG 1Y1VH 2IHEA 5IYBH 5M3FH 4YRPA 1KQSA 3PIOA 1X6OA 3PF4A 1D8LA 1VQFA 1LTLA 3W1BA 4LF9Q 4GNXB 1CSPA 2MO1A 2Q5IA 1YFTA 1EOVA 3HKZE 5FLMH 1VQ7A 2UXDQ 4DV3L 4LFAL 3PCOB 3GD7A 1KHIA 1CKMA 4YWMA 4LFBL 4X65L 1H95A 5AJ3Q 3RZOH 2ZR2A 1SFOH 3S14H 1W3SA 3MF2A 4QY7A 1G5HA 1L2FA 4HJ9A 2BH2A 4LUOA 4KHZA 2FYKA 2IX1A 2ATWA 3KF6B 1E3PA 2RHSB 4RMFA 1R9TH 4A3CG 4OX9L 4P71C 3NEMA 1N8RC 3R07A 1MJCA 4YRLA 2JA8G 3ULLA 3RLFA 1RIPA 2QHSA 2K5HA 4YRIA 5GAHC 5KNNA 3NENA 3CF5A 2ZT5A 5BR8Q 3GTKH 4LF4L 4A3BH 4GLAC 2HQLA 3BFMA 4HJ5A 1SRUA 4A3BG 1EYGA 2CQOA 1HNZL 2NN6I 2N8NA 2K5NA 1PH5A 2WB1E 1G5IA 4L5TA 4DV4Q 1M90C 4BBSH 2R7ZG 3ICAA 1QUQB 4H2WA 4X66L 2JA5G 4NXML 2QA4A 1Q8KA 4O0AA 1B76A 2B63H 4AYBE 1O7IA 2NZHA 2WP8J 2JA7H 4H2XA 2AHOB 1SETA 3J81c 5DLQE 4RQFA 4RG1A 4ME3A 1Q81C 2DKGA 2E1HA 4TVAB 1B70B 1SRYA 1YJWA 5IP9H 12ASA 1EUJA 1NJ5A 4YRJA 1Q86C 1NYRA 4DNIA 1TWCH 2ZCEA 2RF4A 1SLJA 1XMOL 3HY0A 5ELNA 2I5MX 3WQZA 2ES2A 4IPDA 2Z6KC 1IBML 4DV0L 3KOJA 5M3MH 2I4OA 3REUA 1JJCB 1TWFH 2Z0SA 4DK3C 1IXRA 4LF7Q 3I7FA 1N32Q 3RIRA 4XTUA 1A8VA 1VQHA 2BA1A 4DR1Q 1EQQA 5C3EH 2VUMH 3TQYA 1Q12A 4LFAQ 2LSSA 4RQEA 1WQWA 3ERRA 1VQJA 1L1OB 3I4NH 1VQ9A 3A7RA 4LF6L 1G291 1ATIA 2KHJA 4OWWB 1CKNB 3MF1A 2ZM6Q 2RHSA 2K50A 1HNZQ 4YRFA 3OW2A 3TS2A 3T1HQ 3S2HH 2EL9A 2QHVA 1EFWA 4GOPC 4BWAA 2XTIA 3PZCA 4BBRG 2MNAA 1Z47A 4XEMA 4K0KQ 3FKIG 4PHCA 4DKAC 3MEFA 2Q2IA 4WJ4A 5C4XH 1G51A 2R93H 1SESA 2F3IA 1VQBA 2K52A 2RHQA 1YJNA 2ZIMA 5C52B 2QHUA 4JV5Q 3CAMA 2ZM6L 3CCSA 4HIOA 4TVWA 1JJ2A 2HHHQ 4X62Q 2QGQA 1WU7A 3FKIH 1N34L 4IOAA 1GKHA 2UUAQ 2JA6G 1UEBA 1NE3A 4IJHA 3IKLA 2JA5H 5EAYA 1H4TA 4IJLA 2DXTA 4AQYQ 4MZ9A 3KLWA 4CS2A 1L0WA 2ARSA 3HOXG 1SN8A 1VQPA 4YY3L 2UUAL 5IP9G 3HOWH 1NMGA 3I4MG 2CJ9A 3V8LA 1KC8C 4KHPL 3I4NG 3DLLA 3HOZG 4TQFA 3MXNB 4NXNQ 3A74A 1OXTA 2ZJRA 3K7UC 4A3MH 1VQDA 5GADC 2B29A 2E5AA 3T1YL 4KR2A 4A3DG 1XJVA 2ZJPA 5IP7H 4R1JA 1V1QA 4PG3A 1W66A 1P8LA 4JBJA 3NBHB 5C44G 3HRIA 1SE8A 2ZR3A 4DV7L 4DR6L 4A76A 3CPFA 4QQBX 4A93G 1B7YA 3J80i 2JK8A 3GTGH 1JB7A 2E8GA 3PCOA 3A32A 1C9OA 2D62A 4LFCQ 2C7IA 2ZZEA 3IKMB 4A4IA 4BA1I 4E51A 4CH6A 3PV0A 4QGUA 1YIJA 3CCQA 4QL5A 3M85A 4A3EH 2VQFQ 3FHWA 1HNWL 2C35B 1OTCA 1FL0A 4OO1G 2CGHA 4EO4A 1Y1WG 3PUWA 1KXLA 4YHHL 3BU2A 2VS1A 3S1RH 4KR3A 4DV3Q 2D0OA 3T1HL 3H3VI 2ZTEA 2EJ9A 3CQZH 4WI1A 1P16A 4GLVB 1I5FA 2YTVA 1MKHA 1IBKL 3UGQA 4LF9L 1ASYA 1J5EQ 4DR2L 3GTQH 5K36G 2EXDA 3JAMc 2JA8H 2PNHA 3HOVH 5IYDH 1XPUA 1U5KA 2PMZE 4P73A 4YWKA 1NMFA 3H15A 3QO5A 5JJIA 1I6HH 2DZCA 2NVXH 1VQGA 4LF5L 2WAQE 1PA6A 4LF8Q 1HZBA 2R7ZH 4DUYL 1IYJB 3TREA 4MTNA 4DV2L 4EQ5A 3EN2A 1QE0A 1WPYA 3UDXA 1XPRA 3CCLA 1VQIA 3UFGA 3P8TA 4AIMA 4YPFA 1HZAA 4TVYA 1XTDA 1E22A 1PH2A 2DJZA 4L5RC 1JJCA 3RLOA 1E1TA 3V7SA 4JI2Q 4IFDI 4DUYQ 4H2SA 4H2XB 3BZCA 3HXYA 4B3RQ 3V8JA 5C4JH 2CWAA 4YRTA 1UWVA 3CCMA 1TWGH 4A3LH 5IYCH 3JC66 1PVOA 1NYQA 4LW1A 3HOYG 1TWHH 1E24A 4APVA 2UXBL 3A5ZA 1K8GA 4EX5A 3E9IA 2ZXFA 2CWPA 4GOPB 2LXJA 4JYAL 3RNUA 3I55A 1WLEA 4DK6C 4P72A 4HIKA 3VQXA 3HY1A 4DV5Q 4BW9A 1IBKQ 4WJ3M 2KBNA 1IBMQ 1HR0W 3AYHB 2HT1A 4XTCS 2R92H 4IPGA 3VDYA 1WOCA 4G85A 4GKJL 2WAQG 3A5UA 3U4ZA 2Q5HA 3I4OA 4Y52H 3RUXA 3J81j 2F52A 4YDQA 5AJ3L 2JA6H 4OWTB 2ARTA 1MJEA 4GKJQ 2ASBA 3HTZA 4DV5L 3M3YH 3E9HA 4DR3L 4DV0Q 1WJJA 1QVFA 2ZZFA 3U50C 3A31A 1I3QH 4LF6Q 4RDXA 2ZTCA 3GTPH 2OCEA 1VQOA 3EBEA 4DR7L 3CC4A 1NBWA 1YGBA 2DEQA 2UUBQ 3VQVA 3DSQA 3PO3H 1OXUA 4R4QA 4CH4A 4R4TA 3AEVA 3HOUG 3G71A 2VQEL 4KQEA 2UUBL 4Y7NH 1XMQL 1X56A 4JI1L 2Q7EA 2BA0A 1IBLQ 5J3BA 3V7CA 3GO5A 3I2ZA 4X5OA 4POGA 4LNQA 4JI0Q 4OXPA 3A7AA 3RACA 2CJAA 4GKKL 4HVCA 3K8AA 2YV5A 1HH2P 5K1XA 3S1MH 2F4VQ 3LSSA 5M5XH 2VW9A 3IRBA 4JI4Q 3V8KA 2I5LX 2VZAA 2E5LL 2HIVA 2JEBI 5BR8L 1K0RA 2DXUA 3KDFA 1PYBA 2JJQA 2R6GA 4JI2L 4XU0A 3LGJA 4GN3B 4B3MQ 3H0GG 3L2ZA 4IPCA 4R4CA 4YCWA 1G6PA 1X01A 2E2HH 1SERA 4GOPA 3ULJA 3JAMi 1J6QA 2KCTA 2OTLA 1MIUA 3S16H 2MO0A 1IBLL 3A5YA 4B3TL 4ZTZB 4CH3A 2NVQH 4IO9A 3LSQA 3KJOA 1YFSA 4G84A 4H2YA 4HJAA 3CXCA 3F2DA 3KFUA 3CC2A 4WF2A 4OX9Q 2AWNA 1YBYA 4K86A 4XU2A 3M7NA 2V1CC 4IFDG 1N36L 3CMEA 3KJPA 3L1AA 5F5WA 4GN4B 4NXNL 3RKXA 4HJ8A 3QO7A 2I4MA 1PH7A 4H2UA 1CKOA 1VQ4A 2UXBQ 1NJ2A 1A0IA 2ZINA 3CCUA 5M5WH 1KRSA 4DV1L 3CCVA 3MEYA 3QO8A 1NJIC 2A19A 2FXQA 2KCMA 1PH4A 2I5HA 1XNRL 1EVLA 2XGTA 4QJFA 3PF5A 4UP9A 1VQAA 1PV4A 2K14A 2L15A 1EQRA 1LM0A 1J5WA 4A3DH 3HRKA 1QF6A 3G48A 4JBKA 1WCMH 5GQOA 1HR0L 2MQHA 3GTOH 2AKWA 4K0KL 1Q1EA 3RF1A 1TXYA 3H3VH 1HZ9A 1YFRA 3RZDH 3GTMH 5C0XI 3UDIA 3PO3G 1HR0Q 4LNSA 2Q7HA 2ZIOA 1X54A 1LYLA 4XTXA 1B8AA 1KD1C 3HOWG 5LMNW 5ELOA 4YREA 1CUKA 1OXSC 2ZNIA 5M3FG 5LMNQ 3RR5A 2DVEA 1SROA 1L1OA 3Q8DA 1PHJA 4YRKA 1KMNA 4KHPQ 4DR7Q 3L4GB 4HWOA 1D7QA 1AH9A 4C2MH 1FYFA 4A3EG 1I94Q 1EIYA 4YRMA 2DTHA 1KIXA 3PIPA 2DZ9A 2UU9L 1SR3A 1XMOQ 2DGYA 2AMCB 3I56A 4B3ML 3W5OA 4JI1Q 4DV4L 4A3KG 4K87A 4OWXB 1N36Q 1YHQA 2UUCQ 3K7AH 4UPAA 1EIFA 1N33L 4C3IH 4A75A 4JI6Q 2YTYA 3RLNA 4A93H 1GM5A 3HOXH 3CCEA 1A63A 2Y0SG 3HOUH 2CIMA 1TWAH 3CD6A 2EWNA 1X9NA 4P74C 3BJUA 1YITA 5IYBG 4H2VA 3DM3A 4YP0A 3OTOL 3IG2A 3HXUA 2CKZB 5C4XG 2EIFA 3S1QH 1OXVA 3HOYH 4DR4Q 2ALYA 4XTYA 1LUZA 4A3KH 4IFDJ 4A3GG 4PZ6A 1QUQA 1VCIA 1X3EA 4DR2Q 4A3FG 4DV2Q 2NVYH 2E3CA 1WFQA 4LF4Q 5IYDG 2PMFA 1VQEA 4JV5L 2OQ0A 3OTOQ 3HFZA 2ODRD 1WYDA 2GN5A 2OTJA 3KDFB 1UE5A 2R92G 4B3TQ 3RGLA 4UP8A 2E2JH 3HFZB 1X65A 4XIGS 2ZNJA 2IHFA 2NZOA 1KMMA 2EJFA 1JE5A 4CS3A 2DU7A 3A5ZB 4CH5A 4P3OA 1BBUA 1NY4A 4DV6Q 1NTGA 2C8MA 1YI2A 2MFIA 2DTIA 2QEXA 1XNQQ 4PZ7A 3HOVG 4X65Q 2DDZA 1USYC 3ICEA 4HWRA 1YEZA 5IYCG 2J3LA 2JA9A 2IT1A 5M5YH 3P8YA 2ZT7A 4FDBA 4XTZA 4YHHQ 4LF5Q 3STBC 4XTWA 1B7YB 1K9MC 2ALYB 1K83H 4C3HH 4DV6L 3UE0A 1UE1A 2B3GA 4NXMQ 4LFCL 3CCRA 4ALPA 2CFMA 4O2DA 4LUZA 5FJ8G 2P5IA 2Q2HA 4B3SL 3HKSA 3S2DH 1VS0A 2KHIA 3ER0A 4P71A 4JBWA 1JJGA 2I4LA 2JA7G 2DU5A 3KYHC 4BBRH 5C3EG 3L4GA 3D31A 1HTTA 3VQWA 3PUVA 2Z6KA 4XU1A 3TEHB 2Q7GA 1Y1WH 5JJLA 3D0FA 1E7ZA 2ZJQA 1YZ6A 2YTXA 1YHBA 1HC7A 4YCVA 4DV1Q 2EAYA 3J81i 2J3MA 1KRTA 5H1SE 4B3SQ 1WQ7A 1PH9A 4KLKA 1FJGQ 4BBSG 4JI5Q 2UXCQ 5C0XG 1UE7A 3K0XA 3FP9A 1BVSA 3GTJH 4DUZL 1PH8A 4JYAQ 5FJ8H 2E2IH 4JI5L 2UXCL 1HNWQ 1ASZA 2ZZGA 3VBBA 4OO1I 2HIXA 2ZT8A 4A3IG 5GAEC 3F8TA 1IZ6A 4DR1L 1Z7MA 1BBWA 2ID0A 1CKNA 4LUVA 4L5QA 4YCUA 1Y1VG 3WWVA 5C51B 4GLXA 3OYYA 4DUZQ 4JOIA 1VQKA 4OLFA 4DAYB 4A3JH 4JI6L 3CCJA 3F2CA 1H4QA 2K5VA 4DR5Q 4A3GH 3CW2C 4X66Q 1NNHA 4A3MG 3QTCA 4ZTUB 3GDEA 2I0QA 2IY5A 1N32L 1OXXK 3K80C 5E7NA 1A62A 4AH6A 4A3IH 3A7UA 4MNOA 5K1PA 1S40A 4P72C 1KL9A 4JI4L 1YB3A 1K73C 3CC7A 3HXXA 3G6EA 4AYBG 1WNLA 3HXWA 4DR6Q 1ADJA 1GO3E 4P3PA 3G1ZA 4X6AH 3BZKA 3F2BA 4XU3A 2ZT6A 2JQOA 4DAMA 1IL2A 4YWLA 4R4OA 1BIBA 1FJGL 1VQLA 1H4SA 4TTVA 3J7ZC 2Q2UA 4UP7A 3TS0A 4CS4A 1PH6A 4L5SA 2AWOA 1S3OA 4UY8C 3HOZH 2Q2TA 4YRQA 3EIVA 1RL2A 4GNXC 1X2GA 3I4MH 4PMWA 1SMXA 5E3IA 2H5XA 3W1GA 5LMUQ 2OQKA 4Q6GA 1WI5A 2UXDL 3UGTA 4LF7L 3LC0A 1USYA 4A3CH 2K4KA 2WB1G 4JI0L 5IT9c 2NN6G 4DR3Q 5IE8A 2ODRC 1V43A 1GVPA 5HY6A 2RCNA 1BIAA 2ZTGA 4JCVE 1S72A 3HXVA 5LMUL 4OONA 5IWAQ 1VQMA 2HNIA 4X62L 1PYSA 1Y14B 4YY3Q 1XNRQ 1YVCA 4DQ2A 4A3LG 4P75C 3SGIA 2VY3A 4NB3A 1ADYA 2VQEQ 5JEAJ 1T9HA 3W3SA 3V7RA 4YRRA 4AQYL 4GNXA 4BXXH 2I4NA 3S1NH 1JMCA 4BA2I 1PYSB 4XEOA 1NJ1A 4JI8L 5FLXc 1I94L 2Y0SE 3J80c 4HWPA 4POFA 2VUMG 3E0EA 2ZTDA 4KI0A 5IY0A 4XTVA 3AQQA 1PFSA 3RKYA 2AMCA 3EFSA 1FVIA 1Q1BA 4QIWE 4B3RL 2E41A 2DQ3A 3K81C 2AKWB 4BXXG 2CJBA 1J5EL 4JC0A 4HWTA 4HWSA 3CP0A 2D0PA 3ULPA 1I50H 1X55A 2R93G 3PSIA 4BY1G 4LWCA 2GVAA 4IPHA 4JBMA 3PO2H 1NJ6A 1KOGA 2B63G 2ZGWA 5HGQA 4R4IA 2N49A 3L0OA 4YRGA 1M1KC 1VQCA 4JI7Q 2JE6I 1E1OA 4NCXA 4TQDA 1GD7A 4P3NA 2PQAB 3B6YA 1U0LA 4YYEA 4HIMA 1Z7NA 2A8VA 3RKWA 3HXZA 3J7A5 1W2BA 4BY7G 2RHQB 3CMQA 3FJPA 4YRNA 4GS3A 4DR4L 3ERSX 4YRCA 4BY1H 2K75A 3M9BA 5M3MG 1FGUA 1AE2A 3KF6A 3L2PA 3STBD 4GKKQ 2E5LQ 4C3JH 4DR5L 2ARUA 1VQ8A 2HHHL 2PI2E 3RL6A 1N33Q 2YU9H 1GGMA 5C0XJ 1RIQA 1V9PA 1NJ8A 2N78A 2GVBA 3TRZA 4HJ7A 5IWAL 1XNQL 2E10A 3IALA 3EFRA 4A3JG 4IOCA 1QVCA 3AFPA 1C7YA 3UDFA 3S24A 2G4CA 5IP7G 1JT8A 2NVTH 4P73C 3UH0A 1HJPA 4JI7L 4GN5A 3M4PA 1PH3A 4JOIC 1K8AC 2VL6A 2PI2A 3M4OH 1C0AA 3QNEA 3L7ZC 4TQUS 3PUXA 2IX0A 2PMEA 1N34Q 2UUCL 4OP0A 3UE1A 2WFWA 2EJGA 3AFQA 5GROA 1XPOA 3CPWA 4TWAA 3TUPA 4P74A 1Q7YC 4L87A 3OD1A 2R7FA 1Q46A 2QHTA 5FLMG 1YNXA 3KF8B 1VQNA 1EWIA 2DQ0A 1HNXQ 2E65A 4J15A 4P75A 11ASA 4ZIBA 3M4QA 2R7DA 1CSQA 1H4VB 2VNUD 3REXA 4X64L 2E64A 3F1ZA 4A3FH 1XMQQ 1Q82C 2IY5B 3G4SA 2EQSA
chains in the Genus database with same CATH superfamily
3A54A 5JJKA 1RD9D 2OWOA 2JA6B 4X64Q 4YRSA 4JI8Q 1EYAA 3A0JA 3SVMA 4GZYC 2YYZA 1PRTB 2RKSA 3CU7A 3S17B 2HD3A 5ELDA 1PH1A 3PGZA 2DUDA 1HNXL 3TEHA 4KKTA 3E3XA 3T1YQ 3QOLA 2M00A 1PTOH 3CMAA 1EIYB 2F4VL 1Z9FA 3ZJYC 3J7AF 4BY7H 4ID6A 4KJNA 3GTLH 2OEOA 2KENA 3U58A 2VQFL 4XQJA 2UU9Q 4TKOB 3MXPA 1N9WA 1QZHA 5EKKA 2CCZA 1T5EA 2P0LA 4HA8A 1JWMD 3BYTB 1VQ6A 2NYZD 4N8FA 1ZKOA 4DPGA 4K88A 2X6GA 1VQ5A 4Q15A 1U4PA 3P8VA 1WTVA 1GUNA 1EVKA 1DGSA 3HKZG 1B70A 1QZGA 4H02A 2DTOA 4DV7Q 3PO3B 3RMHA 4TVAA 1CA6A 4ULLA 4YROA 3S15H 1UE6A 2JXMB 3G7LA 4RCNA 5G3LF 2ZXOA 4LF8L 1R4PB 3HFVA 4H2TA 3RN2A 2F3VA 4DNRB 4CDEC 2IW3A 3VQYA 3PUZA 4CGYB 1W6JA 2TMPA 1V1OA 4PZ8A 3PO2G 2PQAA 1KAWA 3DXJC 5M3FB 2R61A 4CDDC 2VXWA 3H0GH 1AE3A 3NELA 4J6HA 3UDGA 5C3XA 4JI3L 1YNJC 5LMNL 1EY0A 2I07B 4ILWA 2JEAI 3S17H 1U4RA 3C1FA 4HIDA 2IPKD 4C2MB 1L1OC 3IFTA 1QVGA 1HXDA 3U4VA 5GAGC 1B1ZA 4DGZA 5JEAG 4NPSA 4JG2A 1YJ9A 1HZCA 5C44H 4G7ZC 1X3FA 4X3SA 2RDGA 3TEGA 5D65A 2A1AA 3NETA 1BKBA 1K3RA 5C53B 1U9RA 3OPOA 3PUYA 3S2DB 2N3SA 2CW0C 1X3GA 1XYIA 3RN5A 4JI3Q 3NUCA 2BH8A 4I7ZC 4WRDA 1YHAA 2LXKA 1VQZA 1RKNA 2EJFC 4ZUJA 1X2HA 4LFBQ 2NTTA 1WCMG 1Y1VH 4ZKBB 2IHEA 3H6MA 5IYBH 5M3FH 4YRPA 1KQSA 2B2WC 3PIOA 4JPBW 1X6OA 3PF4A 4F8MA 1D8LA 1VQFA 2A6ED 1LTLA 4IUTA 3FMCA 3W1BA 1PZKD 1DYQA 4LF9Q 3TZDA 4GNXB 5FO7B 1CSPA 2D9UA 2MO1A 1E2ZA 2Q5IA 3GQBA 3I90A 2WIIB 5I2XA 3KBXA 3H09A 1YFTA 3HGBA 1EOVA 3HKZE 5EPKA 5FLMH 1SEBD 1VQ7A 4J8QA 2RVLA 4DV3L 2UXDQ 1X32A 3PCOB 3GD7A 4LFAL 1KHIA 1CKMA 4YWMA 2RBMA 4LFBL 4X65L 1CZWA 1H95A 4G57A 2EJMA 1PRTF 1KDAA 3NBIA 5AJ3Q 2B8FA 1H9JA 4B9WA 2IX3A 3RZOH 4HMIA 2ZR2A 3C2PA 2F0DA 1B9MA 3SK8A 1SFOH 3S14H 1W3SA 4YIJA 5I6WA 3MF2A 4QY7A 1G5HA 1NSNS 3TZUA 2FMMA 5EKIA 4HSPA 3GV3A 1L2FA 4HJ9A 4BBSB 4EQPA 3HOYB 4DN4M 2BH2A 2RCFA 4LUOA 2ICEC 4KHZA 3E5SA 2FYKA 2IX1A 2ATWA 3KF6B 1WTRA 1E3PA 2RHSB 4RMFA 1R9TH 4O1NA 4A3CG 4OX9L 1I4HA 3GTQB 4P71C 3NEMA 1N8RC 1EY8A 1MJCA 3R07A 2JA8G 4YRLA 3ULLA 2B8GA 5M3MB 3RLFA 1D1KA 5C4ZA 1AZQA 2JA8B 4HMJA 2PYKA 5A35A 1RIPA 2QHSA 2K5HA 3RD4A 2B2WA 4YRIA 2SOBA 5GAHC 1NAPA 1L0XB 5KNNA 1SE3A 3NENA 5KNBA 1I6HB 1SNOA 5EPJA 3CF5A 2PW7A 3HOVB 5BR8Q 3GTKH 2ZT5A 1ILQA 4EQOA 4LF4L 4A3BH 1SYFA 3DEPA 4GLAC 1IYUA 4KTAA 2Z4IA 2HQLA 2D5DA 1Y1VB 2DY7A 1BO0A 3BFMA 4HJ5A 1SRUA 4A3BG 2WKCA 1EYGA 2CQOA 1HNZL 1STAA 2NN6I 2N8NA 2K5NA 3MFGA 1PH5A 2LMCB 2WB1E 1G5IA 4I7AA 4L5TA 4DV4Q 1M90C 4BBSH 4C3HB 3K59A 1B2TA 2R7ZG 4A3MB 3ICAA 1QUQB 1JR0D 4QB4A 4H2WA 4X66L 2LFNA 4ZRZA 1RODA 1KNAA 2JA5G 3M7GA 4NXML 2QA4A 3PMFA 3Q22A 1Q8KA 4O0AA 2EY1A 2B63H 4AYBE 1B76A 1O7IA 2WACA 2NZHA 4RAUC 1FYCA 2ICIA 2WP8J 3EJIA 2JA7H 2CHBD 3NTKA 4H2XA 1TY2A 2Z6BA 4PMCA 4LVLA 2AHOB 1DOMA 5KIXA 1SETA 3J81c 5DLQE 5I2YA 4RQFA 4RG1A 2SEBD 4ME3A 1Q81C 3DWPA 2DKGA 1SNQA 2Q8IB 1TWGB 4AYBB 2E1HA 4BBRB 4TVAB 4ZUIA 1C4QA 4C3IB 1B70B 2L55A 1SRYA 1YJWA 1LLRD 4ZK9B 5IP9H 12ASA 4OL7A 1EUJA 3I91A 1NJ5A 4YRJA 4XXEA 1Q86C 4DNIA 1NYRA 1LTSD 1TWCH 3SK6A 2ZCEA 2RF4A 1SLJA 1XMOL 3HY0A 5ELNA 2I5MX 3WQZA 2ES2A 1K8OA 1SE4A 4IPDA 2Z6KC 1CA5A 2HDLA 1IBML 4DV0L 2I46A 3KOJA 1PLFA 4DK0A 5M3MH 2I4OA 3REUA 1JJCB 1TWFH 2Z0SA 3HRZC 1SYDA 2F0FA 1DJRD 1QOHA 2XNAC 4DK3C 1IXRA 4LF7Q 3OSOA 2MP1A 3I7FA 1XX8A 2L11A 1N32Q 1ET6A 3RIRA 4XTUA 2E2IB 2NTSA 1A8VA 1VQHA 2BA1A 4DR1Q 2NVYB 4IURA 1EQQA 2R3ZA 3DMUA 5C3EH 2VUMH 3TQYA 1Q12A 4LFAQ 2QKIC 2LSSA 1Q8IA 4RQEA 5EPLA 1WQWA 4DAYA 5C3WA 3ERRA 1VQJA 2NB0A 1L1OB 3I4NH 3GV6A 1VQ9A 3A7RA 1BF4A 4LF6L 3MAQA 1G291 4PMBA 1ATIA 1QNKA 2DNCA 2KHJA 4OWWB 2LY7A 1CKNB 4RGNA 1GHJA 1STHA 1TU2B 4KN7C 2ZM6Q 3MF1A 2AUJD 1DZ1A 4A3JB 2RHSA 3TDQA 3BDOA 4C3HG 3VR3A 2K50A 1HNZQ 3GTPB 4YRFA 2E2DC 2G9DA 3OW2A 4A3GB 1A2TA 4RKBA 3TS2A 1U4MA 1JE4A 3T1HQ 1B3QA 4LJZC 4LMQD 4MIUA 1LTAD 1LTGD 1X3QA 2K03A 1JWUD 3MTSA 1SMYD 3S2HH 2EL9A 1BXTA 5IT9E 1F9SA 3NWSA 4BWGB 4HTHA 2QHVA 3KLSX 1EFWA 1JB3A 1M8AA 2B2YC 2M9VA 4GOPC 4BWAA 3HOWB 1Q90A 2RDFA 2XTIA 3PZCA 2LS01 2HUGA 4BBRG 4FF4A 2MNAA 3VR4A 4JW0A 1MGSA 2O5JC 1V1PB 1Z47A 2EZVA 1EU3A 3NHHA 4OGQC 1RF2D 4XEMA 1KNEA 4NDXA 4CBVA 5HURA 4K0KQ 3FKIG 2TSSA 4PHCA 5KNCA 3VR6A 4DKAC 1EU4A 3MEFA 2VB2X 2Q2IA 1C48A 4LK1C 1K8MA 4WJ4A 5C4XH 1G51A 2D2CC 4RWSC 1KABA 4UDUC 2R93H 3DWQA 2F3IA 1SESA 3MA2B 1VQBA 2K52A 2KVMA 2RHQA 4ZYSA 2KOLA 4HAEA 1ML0D 1YJNA 1SXTA 2ZIMA 2QHUA 5C52B 2F0OA 4JV5Q 3CAMA 2PO4A 1EEID 5HGTA 2ZM6L 4OIJA 3EROA 1E2WA 4H44C 3CCSA 4HIOA 4TVWA 1JJ2A 2HHHQ 2PCFB 4CDFC 2J4XA 2QGQA 4X62Q 4ABNA 1WU7A 3FKIH 1N34L 4IOAA 1K83B 1GKHA 4RA8A 2UUAQ 3H94A 2JA6G 3BVZA 5DEHA 1UEBA 3G6JB 1NE3A 1WTQA 4IJHA 2F0SA 3IKLA 4X3TA 2RSNA 2E74C 5EAYA 2JA5H 1H4TA 4IJLA 4V0BA 5ISRA 1AFPA 1G6ZA 5L37A 2DXTA 1PTOB 4AQYQ 4IZ8A 1CZGA 2EXZA 2IJ0A 4MZ9A 3NQIA 4L8JA 1JOOA 2XVSA 3KLWA 4BY1B 3PIP3 4CS2A 3IKJA 1A6XA 1L0WA 1PFBA 2ARSA 2EYJA 3EQLC 3HOXG 1QILA 1SN8A 1VQPA 2A68D 4YY3L 3HZXA 2QCPX 4Q0FA 2UUAL 5IP9G 3HOXB 1HQRD 3HOWH 1LT5D 1NR2A 4WJWA 1NMGA 5CC4A 4FF3A 3I4MG 2CJ9A 3V8LA 1KC8C 4KY5A 4YDQA 4KHPL 3I4NG 3DLLA 3HOZG 4TQFA 4HEDA 2Z4HA 3MXNB 4NXNQ 3A7AB 3A74A 2PZTA 1OXTA 2ZJRA 3K7UC 3J7AV 1LABA 4A3MH 1VQDA 5GADC 2B29A 1JWSD 2E5AA 1CK1A 4A3EB 5D3IB 5CBAE 3T1YL 1TR5A 4KR2A 4A3DG 5IODA 1HFNA 3KLSA 2AQ1B 1XJVA 2ZJPA 5EBCA 2F0QA 5IP7H 4L63B 4U68A 2MUYA 4R1JA 1I4QA 1V1QA 4PG3A 1W66A 1ENAA 1P8LA 4N9PA 4JBJA 4NMZA 1I4PA 3LX0A 1CQVA 5KRUA 1H9RA 3K5LA 4A3IB 3NBHB 5C44G 3HRIA 1SE8A 2ZR3A 4DV7L 4A76A 3J81L 4DR6L 3CPFA 1PTOD 4QQBX 1TS5A 2Q8TA 4A93G 1F2LA 1M4VA 1B7YA 3J80i 2JK8A 3GTGH 1IKMA 1JB7A 2E8GA 2RQXA 4FVMA 3PCOA 1DD2A 3A32A 3KK7A 4L6TB 1C9OA 1QB5D 2D62A 1WCMB 1EIGA 3A8KE 4LFCQ 2F0GA 2C7IA 2R7ZB 2ZZEA 3MHBA 3IKMB 2RDHA 2VB3X 4XDXA 4A4IA 4BA1I 4E51A 4CH6A 3NBHA 3PV0A 4QGUA 1YIJA 3CCQA 4QL5A 5EGTA 3M85A 2QDBA 4A3EH 5M9OA 2VQFQ 3FHWA 1HNWL 3S9WA 2C35B 2EE1A 1FL0A 1OTCA 2NWGA 2JYOA 4OO1G 1TIID 5CV7A 3RZDB 1ZEQX 4DU9A 2CGHA 1E0BA 4EO4A 5BN5A 1HQMC 5K36H 1Y1WG 1QCBD 2KJXA 3PUWA 1KXLA 1XWEA 2B39A 3RZOB 4YHHL 3T16A 1ENFA 3QWNA 3BU2A 4ZQ3A 2VS1A 1KTKA 3PO2B 2MHVA 1J9OA 4KKSA 1SYEA 3S1RH 2XRQD 3NSWA 4KR3A 1GUSA 4DV3Q 1KLUD 2D0OA 3T1HL 3D4RA 3U9OA 4G4KA 3H3VI 2ZTEA 5ELBA 2EJ9A 3CQZH 3P1HA 4WI1A 3C3LA 4HR7B 3H3VC 1DM0B 1P16A 1UNSA 5C0XH 1HA6A 4GLVB 4DAPA 1I5FA 2YTVA 1MKHA 2QW7A 4KN4C 1HXYD 2O4XA 5E4WC 5FKAC 1IBKL 5I6YA 3UGQA 1BUVT 4OIKA 4NW2A 1B9NA 5I4DA 1I50B 4IQZA 4FF1A 3JAME 5FK9C 1EZ8A 2B2UA 4LF9L 4BY7B 1ASYA 3GTLB 1J5EQ 4DR2L 3GTQH 3FDTA 4CHTB 5K36G 2EXDA 1ILPA 3ERQA 3TBIB 3K7AB 3JAMc 1CT1D 1F77A 4IN3A 2OF1A 1WTHA 2JA8H 5IOCA 3I73A 3R93A 2PNHA 4DF7A 3HOVH 5IYDH 1XPUA 1U5KA 2PMZE 4P73A 4YWKA 4C56C 5LHY1 1NMFA 2F0VA 4KV6A 3H15A 5JJIA 3QO5A 2A5HA 1EEFD 1I6HH 2DZCA 2J0TD 4J1MA 5KYIA 2NVXH 2YU9B 4KY6A 1VQGA 4LF5L 2WAQE 1PA6A 4LF8Q 1HZBA 2R7ZH 1G8ZD 4DUYL 1IYJB 1NNXA 4KKUA 3TREA 4MTNA 4DV2L 1A3VA 5KYLA 3IL8A 1ESFA 1MSHA 3SDZA 4F7XA 4EQ5A 3M3YB 3EN2A 1QE0A 3MXUA 4IALA 1WPYA 3UDXA 1XPRA 3CCLA 1VQIA 3UFGA 1EY7A 2DN8A 3T53B 4AIMA 4G7OC 3P8TA 4YPFA 2L12A 4OHJA 4IUPA 5J39A 1NUCA 5A2QE 1EWHA 1HZAA 2K7VA 4HCEA 4N9TA 4TVYA 3MEHA 3S1NB 1XTDA 2H1EA 1E22A 2EYHA 1GOZA 1PH2A 2DJZA 3EA6A 2A6HD 1S4ZA 1SNMA 4XYOA 2NS6A 1O7ZA 4L5RC 1JJCA 3RLOA 1E1TA 3V7SA 3C1EA 4JI2Q 4IFDI 4K5XA 4DUYQ 1G2SA 2L4NA 4S3SA 4H2SA 3BZCA 1WD1A 3HXYA 4B3RQ 4H2XB 4EVOA 3V8JA 5C4JH 2CWAA 4YRTA 1UWVA 3ZYYX 3CCMA 1TWGH 4A3LH 5IYCH 3MWYW 3JC66 3J80E 1PVOA 2XN9C 4LW1A 1NYQA 2QEJC 3HOYG 1TWHH 1E24A 4APVA 2CH4A 2UXBL 3A5ZA 4F88A 1K8GA 3D4WA 1EYCA 4EX5A 1TVXA 4A3DB 3E9IA 2ZXFA 1I3QB 2CWPA 4GOPB 2LXJA 4JYAL 4IUNA 3RNUA 1Y69U 3I55A 1WLEA 1E2VA 4DK6C 4H0LC 4P72A 4HIKA 3VQXA 3HY1A 4DV5Q 4BW9A 1IBKQ 2XRSD 4WJ3M 1BR9A 5IIFA 2KBNA 1IBMQ 5JEAH 3BDCA 1HR0W 3AYHB 2KCNA 3QO2A 3SHLA 2HT1A 2SNSA 3K0YA 4XTCS 1JOKA 4ZLTF 2R92H 4IPGA 4KJOA 5CBEE 2AUKA 3VDYA 1WOCA 4G85A 4GKJL 2WAQG 3A5UA 4KMUC 3U4ZA 2Q5HA 3P75A 3I4OA 3OWEB 2EYFA 3MXNA 1AW7A 1QWYA 4DK1A 4Y52H 2Z9HA 2F52A 4K2LA 2OT2A 3J81j 2ZXRA 3GP7A 5AJ3L 2JA6H 3H91A 4OWTB 2ARTA 1MJEA 4GKJQ 2ASBA 3HTZA 4UHVA 4DV5L 3M3YH 3NPPA 1S5ED 3E0JA 1RHPA 1HTPA 3E9HA 5CGKA 1B50A 3HS0C 1KDCA 4DR3L 2JSOA 1WJJA 4DV0Q 1QVFA 3U50C 2ZZFA 3A31A 2K01A 1I3QH 4LF6Q 3TP7A 4RDXA 1ESRA 5JPNC 3CRLC 3K5MA 2ZTCA 3GTPH 4WFN3 4QCLA 2OCEA 1VQOA 1D2BA 1V8QA 2L5TA 2Z1CA 1EWCA 4HCSA 3EBEA 2A6EC 3CC4A 4DR7L 1NBWA 5EBDA 1YGBA 1SYCA 1BDOA 2DEQA 2UUBQ 3VQVA 3V05A 3DSQA 3PO3H 1JICA 3PQIA 4QUFA 2EY2A 4XQNA 3I4MB 1OXUA 4R4QA 4CH4A 3OHXC 1BCPD 3W2DA 2K32A 1EIHA 3U9SA 2DNEA 4R4TA 3AEVA 4LVJA 2EYMA 2X69A 3HG9A 3HOUG 1FGBD 3G71A 2SNMA 3NP8A 2VQEL 4KQEA 2UUBL 4Y7NH 1PYWD 1XMQL 1X56A 1IKLA 4JI1L 2Q7EA 1O7LA 2HCCA 3MXGA 2BA0A 1IBLQ 5J3BA 3V7CA 3GO5A 3BS1A 3I2ZA 2FJ2A 4X5OA 4POGA 2XWBB 2DJGC 3D6CA 4LVMA 1TS3A 2EY5A 4CJ1B 4NP5A 1SJED 4OXPA 4JI0Q 4LNQA 5IGCA 3T4AC 1T5XD 1RTOA 1B3AA 5LL6S 3A7AA 1S5DD 3RACA 2CJAA 4DAVA 2K5QA 4GKKL 4HVCA 3K8AA 2YV5A 1HH2P 5TSSA 5K1XA 2PNRC 3S1MH 2F4VQ 3LSSA 4I65A 2HDMA 5M5XH 3VR5A 2VW9A 1D5MC 1VF5C 2EDGA 3IRBA 5C44B 1H9MA 4JI4Q 3A56A 1LO5D 3V8KA 2I5LX 2VZAA 2NUCA 1NCVA 2E5LL 2HIVA 2JEBI 3A8IE 1C8CA 2K04A 5CV9A 5BR8L 1K0RA 2DXUA 3KF8A 3KDFA 1PYBA 2JJQA 2R6GA 4JI2L 1GUTA 1TT2A 4XU0A 1GUOA 3LGJA 4GN3B 2J7ZA 4PNYA 3R8BA 4CDCC 4B3MQ 1LTTD 3D3RA 3H0GG 2F0EA 3L2ZA 4IPCA 4R4CA 3QG1A 4YCWA 1G6PA 1JOQA 2E2HH 1X01A 1SERA 4GOPA 3ULJA 3JAMi 2NVTB 1J6QA 1I4XA 2KCTA 2EOTA 2JA5B 2OTLA 1TQOA 1MIUA 1G2TA 3S16H 2MO0A 5CV4A 2X6LA 3WOFA 2WB1B 1IBLL 1I4RA 1PXUA 3A5YA 2RSOA 3LWUA 1IYVA 4B3TL 1LT6D 1D5XC 5DAUA 4ZTZB 3JAML 2EVBA 4CH3A 2NVQH 2A73B 4IO9A 1HRJA 1LT3D 4FF2A 1FR3A 1HTLD 3LSQA 1HUNA 3KJOA 1MBYA 1BBXC 1YFSA 4M1UB 2IWHA 4G84A 4H2YA 5CV8A 1PRTD 4HJAA 3K6OA 3CXCA 3F2DA 3KFUA 3CC2A 4X3UA 4WF2A 2PZWA 4OX9Q 2AWNA 1YBYA 4K86A 5FLXL 4XU2A 3M7NA 3PIO3 1CHPD 2V1CC 4IFDG 3I3CA 1N36L 3GTOB 3CMEA 3KJPA 5NUCA 2K1BA 1PTOC 3L1AA 5F5WA 4GN4B 4NXNL 4XT3B 4Q5VA 2E2HB 3RKXA 3T13A 4HJ8A 3SK4A 3QO7A 3P20A 3X3MA 2I4MA 1PH7A 1MD2D 1CKOA 4H2UA 2C5CA 1X3PA 1VQ4A 2UXBQ 1NJ2A 1A0IA 2ZINA 3CCUA 5M5WH 3Q24A 1KRSA 4DV1L 3CCVA 2ENBA 3MEYA 4H13C 3QO8A 1CTMA 2F0UA 1NJIC 4N8X1 2A19A 2FXQA 2KCMA 1PH4A 2I5HA 1XNRL 1F2MA 2XGTA 5J22A 1EVLA 4QJFA 3PF5A 1D1IA 4UP9A 3VA5A 1TS2A 1VQAA 1PV4A 1H9SB 3TP5A 4A93B 2K14A 1TWHB 2L15A 2ZXPA 1EZ6A 1EQRA 1LT4D 4RH6A 1LM0A 1J5WA 4A3DH 3HRKA 1BCPF 1STBA 1QF6A 1SYBA 2N88A 1OO9B 3G48A 4JBKA 1WCMH 5GQOA 1S5CD 2DY8A 2CQAA 1HR0L 2MQHA 3GTOH 2AKWA 4K0KL 1Q1EA 3ND9A 3FEWX 3RF1A 1TXYA 3H3VH 1VMCA 1HZ9A 4R8IA 1YFRA 3RZDH 3GTMH 5C0XI 3UDIA 3FPPA 3PO3G 4CKEA 2A68C 4ZAIA 1HR0Q 1RCVD 3S15B 4LNSA 2Q7HA 2ZIOA 1X54A 4ODGA 5D3DA 1LYLA 2A69C 1ZYRD 4XTXA 1TKWB 1B8AA 2JA7B 1KD1C 3HOWG 5LMNW 3S1RB 5ELOA 4ZKCB 4YREA 1CUKA 1OXSC 2ZNIA 5M3FG 5LMNQ 1BCPB 3RR5A 2DVEA 1SROA 1L1OA 3Q8DA 1PZID 5ELEA 4C3IG 1PHJA 4KK7A 4YRKA 1KMNA 5BN4A 4KHPQ 4DR7Q 3L4GB 3FKIB 3ND8A 4HWOA 2K5WA 2RA4A 1D7QA 1AH9A 4C2MH 1FYFA 4A3EG 1I94Q 1EIYA 4YRMA 2DTHA 1BCPC 1KIXA 1STNA 5DM63 3PIPA 2DZ9A 2UU9L 1CM9A 5IT9L 1SR3A 1STEA 1XMOQ 2DGYA 2AMCB 3I56A 4B3ML 3W5OA 2F3WA 2A6HC 4JI1Q 4DV4L 4A3KG 4K87A 4OWXB 4FP5D 2B2TA 3MVVA 4WORA 2K33A 1N36Q 5IGBA 5ELFA 2V4DA 3KLRA 1YHQA 2UUCQ 2PQEA 3K7AH 4UPAA 3Q23A 4EQNA 1EIFA 1F9PA 1N33L 3O13A 2HCIA 4C3IH 4A75A 3P7JA 4JI6Q 4RKLA 2YTYA 5BN3A 3RLNA 4A93H 1GM5A 3HOXH 4Y7NB 3CCEA 1A63A 2Y0SG 3HOUH 2CIMA 1TWAH 3CD6A 2EWNA 1X9NA 4P74C 3BJUA 1RTNA 3KBGA 1YITA 3A8JE 5IYBG 4H2VA 3DM3A 3OTOL 4YP0A 1EY4A 3IG2A 3HXUA 2CKZB 3BG3A 5C4XG 2EIFA 1EQTA 3S1QH 1O7YA 1ONLA 1OXVA 2E76C 3HOYH 4DR4Q 4TRDA 2ALYA 5KGUA 2O5IC 4XTYA 1F9QA 1R9TB 2K05A 1HCZA 5CV5A 2FHTA 1LUZA 4A3KH 4IFDJ 2NZ1D 2KQ3A 4A3GG 2F0PA 4PZ6A 1QUQA 1VCIA 1X3EA 4DR2Q 1FNVA 4DV2Q 2NVYH 4A3FG 2E3CA 1WFQA 4LF4Q 2B2YA 4A3FB 3BDLA 5IYDG 2PMFA 2L1BA 4DXFA 1VQEA 4JV5L 4MTKA 5M5YB 2OQ0A 3OTOQ 1WVLA 3HFZA 4C1NI 2ODRD 1BOSA 1WYDA 3HP3A 2P5ZX 2GN5A 4XT1B 2OTJA 4DA2A 4FXDA 3KDFB 1UE5A 2R92G 4B3TQ 2E2JH 4UP8A 3RGLA 5C4JB 3HFZB 1H9KA 1X65A 5JAVA 1B44D 5IGGA 4XIGS 3QR8A 2ZNJA 2IHFA 2LKVA 2NZOA 1ENCA 1KMMA 2EJFA 1LV9A 3OMGA 1JE5A 1WTOA 4CS3A 2DU7A 3A5ZB 1K3BC 4CH5A 4P3OA 2F0TA 2MGSA 1BBUA 2FINB 1NY4A 3OIQA 4OEMB 4DV6Q 2CH4W 1NTGA 3I70A 2C8MA 1YI2A 2MFIA 3NQTA 2B2UC 2DTIA 3SXHA 3A7LA 2M2LA 1HUMA 1GUGA 2QEXA 1XNQQ 2BE5C 4PZ7A 3GTKB 3HOVG 4X65Q 2DDZA 1MHWC 2MJ8A 2JN4A 1USYC 3ICEA 1F2ZA 1ICFB 4HWRA 2WINB 1YEZA 5IYCG 2J3LA 1A2UA 2JA9A 4U673 1TWAB 1GXDC 2MPMA 3BVGA 3ONAB 2IT1A 3EVQA 5M5YH 1K0SA 3P8YA 2ZT7A 4FDBA 1BNZA 4XTZA 4YHHQ 4K6LA 4LF5Q 3W3AA 2EPBA 3STBC 1TS4A 1U4LA 3A55A 4XTWA 2F0JA 2F03A 1B7YB 1K9MC 2ALYB 1K83H 4RGTA 2KA7A 4C3HH 3CQZB 4DV6L 2AQ3B 3T51B 3UE0A 1UE1A 2B3GA 4NXMQ 4LFCL 3CCRA 1CQFA 5E1FA 4K6DA 4ALPA 2CFMA 1CI3M 4O2DA 4LUZA 1MI2A 1F2YA 5FJ8G 2P5IA 2Q2HA 4B3SL 1I4GA 4LVKA 1EY6A 3IFDA 4FO2A 3HKSA 3I4LA 5FO9B 5KNDA 4IUUA 5M5WB 3S2DH 3VR2A 1VS0A 2KHIA 1PRTC 3M4OB 3ER0A 4P71A 4JBWA 5AFWA 1JJGA 1WTXA 4IUQA 2I4LA 2JA7G 2DU5A 3KYHC 4BBRH 4RHSA 5C3EG 3L4GA 3D31A 4CJ2C 1HTTA 2E75C 3VQWA 2O2LD 3PUVA 2Z6KA 4XU1A 3TEHB 5C3EB 5DM73 1GUWA 2Q7GA 1Y1WH 5JJLA 5E4XA 1D5ZC 3D0FA 1E7ZA 5FOBB 2ZJQA 1YZ6A 2YTXA 1YHBA 1HC7A 3AMUA 4YCVA 4DV1Q 3R2TA 2EAYA 3J7YW 3J81i 2J3MA 1LTRD 1KRTA 5H1SE 4B3SQ 1L0YB 1WQ7A 2QDLA 1PH9A 4KLKA 1FJGQ 4BBSG 1QJOA 4JI5Q 2UXCQ 1ZXTA 2BDNA 5C0XG 1UE7A 3K0XA 3FP9A 1BVSA 3GTJH 4CKCA 1O78A 4DUZL 1PH8A 4JYAQ 1IL8A 1CHQD 5E3FA 5FJ8H 3BZDB 2E2IH 4JI5L 2UXCL 1HNWQ 3LNNA 2XSCA 1ASZA 2XWJB 3SR1A 5CMDA 1KDBA 3K58A 1LTID 1H9SA 2H4OA 2KECA 2B2VA 4OO1I 2ZZGA 2HIXA 3VBBA 2ZT8A 3S2HB 4CKBA 5IGFA 4A3IG 5GAEC 3F8TA 1IZ6A 3X3NA 2WV6D 3HEJA 3M4YA 4DR1L 5CYUA 4Z9CB 3QOJA 1BBWA 1Z7MA 3TMEA 1PDQA 2ID0A 1CKNA 4HN7A 1FNWA 4LUVA 3FPUB 4L5QA 4YCUA 2B2TC 5ELCA 1EQVA 1Y1VG 3WWVA 5C51B 4GLXA 3OYYA 2Q8RE 3GTGB 4LVIA 1QE6A 4HT4A 2L0CA 4DUZQ 2F4IA 1A3TA 2QILA 3QIAA 3T56B 3NXWA 4JOIA 1VQKA 1WTWA 4OLFA 4DAYB 2F0LA 4O42A 4A3JH 3DM1A 4JI6L 3VA7A 1ICWA 3CCJA 5JVG3 3F2CA 4K5WA 1H4QA 1UEAB 2K5VA 4DR5Q 4A3GH 3CW2C 4X66Q 1PMRA 1NNHA 4XQQA 3N6RA 3AB9A 4A3MG 3QTCA 4ZTUB 1SE2A 2NN6H 3GDEA 1EOTA 2I0QA 4F87A 2IY5A 2KCCA 1N32L 1OXXK 3K80C 3J80L 1XTCD 4P2CB 4ZCKA 5E7NA 3S16B 1A62A 3BVMA 1I6VC 3ITPA 3D8GA 4AH6A 4RCOA 4A3IH 2R93B 3A7UA 4RHRA 4MNOA 5LL6X 4KD3A 5K1PA 1UAPA 1S40A 4P72C 1KL9A 1B53A 2F0IA 4B9XA 1Y1WB 4JI4L 5DNFA 3HOUB 1LTBD 1AZPA 4PQXA 3CHBD 1YB3A 1K73C 2R92B 3CC7A 3HXXA 4HSVA 1KLGD 4AYBG 3G6EA 1WNLA 2PMZB 3HXWA 4DR6Q 2K28A 4DFAA 1ADJA 3Q6SA 4RFBA 3V96A 1GO3E 4P3PA 1GJXA 3D4DA 3G1ZA 2NBFA 1EY5A 1SNCA 1K28A 4X6AH 5F2DA 3BZKA 5FO8B 3F2BA 4XU3A 2SDFA 2BCOA 2ZT6A 2EYOA 4A3KB 1STYA 2JQOA 1TY0A 1CFMA 4DAMA 1IL2A 1HA5A 4YWLA 4R4OA 1BIBA 2F0NA 5T1GA 1B4OA 5JJZA 1FJGL 2XIWA 5IGDA 2EYPA 3SEBA 1VQLA 4OELB 1H4SA 2PW5A 4TTVA 3OWFA 1GHKA 3RUZA 3TSSA 2QF7A 3J7ZC 2PPBC 2Q2UA 1YNJD 4UP7A 2EJGC 1HFGA 4QIWB 3TS0A 2A8EA 1STGA 4CS4A 1PH6A 2HQEA 4L5SA 2AWOA 1S3OA 4UY8C 2WAQB 2F1MA 3HOZH 5I9PA 2Q2TA 2DJFC 2OXPA 3AU7A 3EIVA 4ME5A 1RL2A 4YRQA 2E2JB 4GNXC 1X2GA 1Z6HA 3I4MH 4PMWA 1SMXA 2K6AA 5IGEA 5E3IA 2H5XA 4M8AA 1AP0A 3W1GA 5LMUQ 4MHEA 2OQKA 1ZYRC 2A69D 4RGOS 1RJTA 4Q6GA 1WI5A 3J81E 2UXDL 3UGTA 4LF7L 3LC0A 2CVRA 1USYA 5I9OA 3IAYA 4A3CH 1VDZA 4QF4A 2K4KA 2WB1G 1SYGA 2ZT9C 3MC0B 4JI0L 3GTMB 5IT9c 2NN6G 1DOKA 5IE8A 4DR3Q 1EY9A 2ODRC 4IUVA 1NR4A 1V43A 1GVPA 3S1MB 5HY6A 2RCNA 1DXMA 1BIAA 1SDFA 3I8ZA 2ZTGA 3OOCA 4JCVE 1S72A 3SK5A 3HXVA 4R9WA 3K57A 5LMUL 3L9AX 4OONA 5IWAQ 1VQMA 2HNIA 3KUPA 1HHVA 1DONA 1SFOB 3S14B 4X62L 3I72A 4PV1C 3I4NB 3HOZB 1PYSA 3RUXA 1Y14B 4YY3Q 1XNRQ 1YVCA 1SMYC 4DQ2A 4A3LG 4P75C 3CRKC 3SGIA 4FXGC 5K5PA 2VY3A 4NB3A 5JPMC 1ADYA 2K5DA 2VQEQ 5JEAJ 1T9HA 3W3SA 3V7RA 4YRRA 1HPCA 5C5MA 1IW7C 1SNPA 4BS9A 2F0WA 4AQYL 5J1ZA 4E6IA 4GNXA 3OIPA 1O80A 4BXXH 2I4NA 3S1NH 3TP6A 3R2IA 5CR3A 2G5DA 1JMCA 4BA2I 1PYSB 4XEOA 1NJ1A 4JI8L 5FLXc 1WD0A 4KHVA 1I94L 2KHSA 2Y0SE 4X3KA 3SE0A 1PTOF 1A15A 3J80c 3DHQA 1MSGA 1IW7D 3NWTA 5KEEA 1EL0A 3WOEA 4UAIA 4HWPA 4POFA 4C3JB 4QUCA 1VMPA 2ZTDA 3E0EA 3QJYA 4KI0A 2VUMG 5IY0A 4C1NK 4XTVA 1DCZA 3AQQA 1PFSA 3RKYA 4A3BB 2AMCA 1S5FD 3EFSA 1FVIA 1Q1BA 4QIWE 4B3RL 3NTIA 2E41A 2DQ3A 3H0GB 3K81C 5C5LA 1Y8PB 2AKWB 4KD4A 3VYRA 4BXXG 1S5BD 1EYDA 4DXGA 2CJBA 1J5EL 4JC0A 4QMGA 1DOLA 5C4XB 3LWEA 4HWTA 4H7BA 4LAAA 4HWSA 3CP0A 3L3OC 2BE5D 2AQ2B 2D0PA 3ULPA 1I50H 1W6KA 3WDNA 1X55A 2R93G 5C4HA 3MQZA 1ET9A 4K8IA 4CJ0B 2EY6A 3PSIA 4BY1G 4LWCA 3CKIB 4R8NA 2GVAA 4IPHA 2B63B 4JBMA 1VF7A 3PO2H 5EJWA 1NJ6A 1KOGA 2B63G 5COYA 3DUZA 2ZGWA 5HGQA 4R4IA 4MN3A 3Q0AA 1R4QB 2N49A 3L0OA 4YRGA 2N55A 1M1KC 3DEOA 1PZJD 2EYLA 1LACA 3BYYB 2NVXB 1VQCA 4JI7Q 2JE6I 1E1OA 1F9RA 4NCXA 3UI2A 4TQDA 1GD7A 4P3NA 2PQAB 2IL8A 3B6YA 1U0LA 1TWCB 3FRPB 5T1IA 4YYEA 4HIMA 1Z7NA 2A8VA 3RKWA 3HXZA 3J7A5 5CORA 1W2BA 4BY7G 2RHQB 3CMQA 3FJPA 4YRNA 4GS3A 1RDPD 1FD7D 4V190 4DR4L 1SAPA 3D6WA 4RGMA 1FNUA 1SSOA 3ERSX 1JORA 4BY1H 5G3LD 4YRCA 3VYSA 5A2QL 2K75A 3M9BA 4G7HC 1TWFB 1FGUA 3FVQA 1AE2A 1UUPA 5M3MG 3KF6A 1KAAA 4EGVA 2Z8LA 3TN2A 3STBD 3L2PA 4GKKQ 1Y8OB 5M5XB 3E6ZX 1II3A 3VYUA 5C6AA 2E5LQ 4C3JH 1QG7A 3URYA 4DR5L 2ARUA 4K2KA 4FYDA 1VQ8A 2HHHL 2PI2E 3RL6A 1N33Q 4JK1C 2YU9H 2Y0SB 5FLXE 1GGMA 3OW7A 4JVZA 3NE5B 5C0XJ 4C3JG 2VUMB 3OMCA 4K14A 1QNUA 3F2UA 1RIQA 2KEEA 1V9PA 1NJ8A 2N78A 2GVBA 3TRZA 1JQYD 4HJ7A 4IFDH 1Y8NB 5IWAL 1XNQL 2F0MA 1PFNA 4K5VA 3C46A 4FXKC 2E10A 2BOSA 4XYQA 3DWAA 3IALA 3EFRA 3MFYA 1PFMA 1JCKB 2GA4B 3TP8A 4A3JG 2FMCA 4IOCA 1QVCA 4FNFA 1AEXA 3AFPA 4K8JA 1C7YA 3NTHA 3UDFA 3S24A 2G4CA 2PZUA 5IP7G 1JT8A 2NVTH 4P73C 3UH0A 1HJPA 1V1PA 4JI7L 4GN5A 3M4PA 3HKZB 1JC7A 1D6EC 1PH3A 4JOIC 3K5OA 1K8AC 1SBBB 2G9HD 2VL6A 2PI2A 3VYTA 5D14A 2L9HA 2F0KA 3M4OH 5JOBA 3V2TA 1C0AA 1J8IA 3QNEA 5EQ0A 1A3UA 3L7ZC 4TQUS 3PUXA 1BQQT 1YNNC 2IX0A 1N34Q 2UUCL 4OP0A 2PMEA 1XXGA 3R3OA 3UE1A 2BDOA 2WFWA 2EJGA 4KY7A 3AFQA 5GROA 1XPOA 3CPWA 2KUMA 2CW0D 4B08A 1Q3LA 4TWAA 1EFID 1SJHD 4DNTB 3QB3A 3TUPA 2F0HA 4P74A 5CV6A 1Q7YC 5JVH3 1G91A 1WTPA 4L87A 3OD1A 1Z7TA 2R7FA 1Q46A 2QHTA 5FLMG 3S1QB 2A74C 1YNXA 3KF8B 4OO1H 1VQNA 2FFKB 1AN8A 1EWIA 2WKDA 2DQ0A 3EFXD 1HNXQ 2E65A 4J15A 2B2VC 4TSSA 3GTJB 4P75A 1YNND 1IHZA 2NVQB 11ASA 3MZ5A 3NK9A 2JP1A 4ZIBA 3M4QA 2R7DA 2C9OA 1CSQA 1H4VB 2VNUD 3REXA 4X64L 2E64A 3F1ZA 3K5NA 4A3FH 4NKLA 1XMQQ 1Q82C 1SNDA 3N52A 2KEDA 2IY5B 5EKLA 3G4SA 2EQSA
chains in the Genus database with same CATH topology
5JJKA 2OWOA 4X64Q 4YRSA 4JI8Q 3A0JA 2YYZA 1PH1A 3PGZA 2DUDA 1HNXL 3TEHA 3T1YQ 3CMAA 1EIYB 2F4VL 1Z9FA 3ZJYC 4BY7H 3GTLH 2KENA 3U58A 2VQFL 2UU9Q 1N9WA 1QZHA 2CCZA 2P0LA 4HA8A 1VQ6A 4DPGA 4K88A 1VQ5A 4Q15A 3P8VA 1EVKA 1DGSA 3HKZG 1B70A 1QZGA 4H02A 2DTOA 4DV7Q 4TVAA 4YROA 3S15H 1UE6A 4LF8L 3HFVA 4H2TA 3RN2A 3VQYA 3PUZA 4PZ8A 3PO2G 2PQAA 1KAWA 3H0GH 1AE3A 3NELA 3UDGA 4JI3L 5LMNL 2JEAI 3S17H 4HIDA 1L1OC 1QVGA 1HXDA 3U4VA 5GAGC 5JEAG 4NPSA 4JG2A 1YJ9A 1HZCA 5C44H 1X3FA 3TEGA 2A1AA 3NETA 1BKBA 1K3RA 5C53B 3PUYA 2N3SA 1X3GA 3RN5A 4JI3Q 2BH8A 1YHAA 2LXKA 1VQZA 1X2HA 4LFBQ 1WCMG 1Y1VH 2IHEA 5IYBH 5M3FH 4YRPA 1KQSA 3PIOA 1X6OA 3PF4A 1D8LA 1VQFA 1LTLA 3W1BA 4LF9Q 4GNXB 1CSPA 2MO1A 2Q5IA 1YFTA 1EOVA 3HKZE 5FLMH 1VQ7A 2UXDQ 4DV3L 4LFAL 3PCOB 3GD7A 1KHIA 1CKMA 4YWMA 4LFBL 4X65L 1H95A 5AJ3Q 3RZOH 2ZR2A 1SFOH 3S14H 1W3SA 3MF2A 4QY7A 1G5HA 1L2FA 4HJ9A 2BH2A 4LUOA 4KHZA 2FYKA 2IX1A 2ATWA 3KF6B 1E3PA 2RHSB 4RMFA 1R9TH 4A3CG 4OX9L 4P71C 3NEMA 1N8RC 3R07A 1MJCA 4YRLA 2JA8G 3ULLA 3RLFA 1RIPA 2QHSA 2K5HA 4YRIA 5GAHC 5KNNA 3NENA 3CF5A 2ZT5A 5BR8Q 3GTKH 4LF4L 4A3BH 4GLAC 2HQLA 3BFMA 4HJ5A 1SRUA 4A3BG 1EYGA 2CQOA 1HNZL 2NN6I 2N8NA 2K5NA 1PH5A 2WB1E 1G5IA 4L5TA 4DV4Q 1M90C 4BBSH 2R7ZG 3ICAA 1QUQB 4H2WA 4X66L 2JA5G 4NXML 2QA4A 1Q8KA 4O0AA 1B76A 2B63H 4AYBE 1O7IA 2NZHA 2WP8J 2JA7H 4H2XA 4LVLA 2AHOB 1SETA 3J81c 5DLQE 4RQFA 4RG1A 4ME3A 1Q81C 2DKGA 2E1HA 4TVAB 1B70B 1SRYA 1YJWA 5IP9H 12ASA 1EUJA 1NJ5A 4YRJA 1Q86C 1NYRA 4DNIA 1TWCH 2ZCEA 2RF4A 1SLJA 1XMOL 3HY0A 5ELNA 2I5MX 3WQZA 2ES2A 4IPDA 2Z6KC 1IBML 4DV0L 3KOJA 5M3MH 2I4OA 3REUA 1JJCB 1TWFH 2Z0SA 4DK3C 1IXRA 4LF7Q 3I7FA 1N32Q 3RIRA 4XTUA 1A8VA 1VQHA 2BA1A 4DR1Q 1EQQA 5C3EH 2VUMH 3TQYA 1Q12A 4LFAQ 2LSSA 4RQEA 1WQWA 3ERRA 1VQJA 1L1OB 3I4NH 1VQ9A 3A7RA 4LF6L 1G291 1ATIA 2KHJA 4OWWB 1CKNB 3MF1A 2ZM6Q 2RHSA 2K50A 1HNZQ 4YRFA 3OW2A 3TS2A 3T1HQ 3S2HH 2EL9A 2QHVA 1EFWA 4GOPC 4BWAA 2XTIA 3PZCA 4BBRG 2MNAA 1Z47A 4XEMA 4K0KQ 3FKIG 4PHCA 4DKAC 3MEFA 2Q2IA 4WJ4A 5C4XH 1G51A 2R93H 1SESA 2F3IA 1VQBA 2K52A 2RHQA 1YJNA 2ZIMA 5C52B 2QHUA 4JV5Q 3CAMA 2ZM6L 3CCSA 4HIOA 4TVWA 1JJ2A 2HHHQ 4X62Q 2QGQA 1WU7A 3FKIH 1N34L 4IOAA 1GKHA 2UUAQ 2JA6G 1UEBA 1NE3A 4IJHA 3IKLA 2JA5H 5EAYA 1H4TA 4IJLA 2DXTA 4AQYQ 4MZ9A 3KLWA 4CS2A 1L0WA 2ARSA 3HOXG 1SN8A 1VQPA 4YY3L 2UUAL 5IP9G 3HOWH 1NMGA 3I4MG 2CJ9A 3V8LA 1KC8C 4KHPL 3I4NG 3DLLA 3HOZG 4TQFA 3MXNB 4NXNQ 3A74A 1OXTA 2ZJRA 3K7UC 4A3MH 1VQDA 5GADC 2B29A 2E5AA 3T1YL 4KR2A 4A3DG 1XJVA 2ZJPA 5IP7H 4R1JA 1V1QA 4PG3A 1W66A 1P8LA 4JBJA 3NBHB 5C44G 3HRIA 1SE8A 2ZR3A 4DV7L 4DR6L 4A76A 3CPFA 4QQBX 4A93G 1B7YA 3J80i 2JK8A 3GTGH 1JB7A 2E8GA 3PCOA 3A32A 1C9OA 2D62A 4LFCQ 2C7IA 2ZZEA 3IKMB 4A4IA 4BA1I 4E51A 4CH6A 3PV0A 4QGUA 1YIJA 3CCQA 4QL5A 3M85A 4A3EH 2VQFQ 3FHWA 1HNWL 2C35B 1OTCA 1FL0A 4OO1G 2CGHA 4EO4A 1Y1WG 3PUWA 1KXLA 4YHHL 3BU2A 2VS1A 3S1RH 4KR3A 4DV3Q 2D0OA 3T1HL 3H3VI 2ZTEA 2EJ9A 3CQZH 4WI1A 1P16A 4GLVB 1I5FA 2YTVA 1MKHA 1IBKL 3UGQA 4LF9L 1ASYA 1J5EQ 4DR2L 3GTQH 5K36G 2EXDA 3JAMc 2JA8H 2PNHA 3HOVH 5IYDH 1XPUA 1U5KA 2PMZE 4P73A 4YWKA 1NMFA 3H15A 3QO5A 5JJIA 1I6HH 2DZCA 2NVXH 1VQGA 4LF5L 2WAQE 1PA6A 4LF8Q 1HZBA 2R7ZH 4DUYL 1IYJB 3TREA 4MTNA 4DV2L 4EQ5A 3EN2A 1QE0A 1WPYA 3UDXA 1XPRA 3CCLA 1VQIA 3UFGA 3P8TA 4AIMA 4YPFA 1HZAA 4TVYA 1XTDA 1E22A 1PH2A 2DJZA 2NS6A 4L5RC 1JJCA 3RLOA 1E1TA 3V7SA 4JI2Q 4IFDI 4DUYQ 4H2SA 4H2XB 3BZCA 3HXYA 4B3RQ 3V8JA 5C4JH 2CWAA 4YRTA 1UWVA 3CCMA 1TWGH 4A3LH 5IYCH 3JC66 1PVOA 1NYQA 4LW1A 3HOYG 1TWHH 1E24A 4APVA 2UXBL 3A5ZA 1K8GA 4EX5A 3E9IA 2ZXFA 2CWPA 4GOPB 2LXJA 4JYAL 3RNUA 3I55A 1WLEA 4DK6C 4P72A 4HIKA 3VQXA 3HY1A 4DV5Q 4BW9A 1IBKQ 4WJ3M 2KBNA 1IBMQ 1HR0W 3AYHB 2HT1A 4XTCS 2R92H 4IPGA 3VDYA 1WOCA 4G85A 4GKJL 2WAQG 3A5UA 3U4ZA 2Q5HA 3I4OA 4Y52H 3RUXA 3J81j 2F52A 4YDQA 5AJ3L 2JA6H 4OWTB 2ARTA 1MJEA 4GKJQ 2ASBA 3HTZA 4DV5L 3M3YH 3E9HA 4DR3L 4DV0Q 1WJJA 1QVFA 2ZZFA 3U50C 3A31A 1I3QH 4LF6Q 4RDXA 2ZTCA 3GTPH 2OCEA 1VQOA 3EBEA 4DR7L 3CC4A 1NBWA 1YGBA 2DEQA 2UUBQ 3VQVA 3DSQA 3PO3H 1OXUA 4R4QA 4CH4A 4R4TA 3AEVA 4LVJA 3HOUG 3G71A 2VQEL 4KQEA 2UUBL 4Y7NH 1XMQL 1X56A 4JI1L 2Q7EA 2BA0A 1IBLQ 5J3BA 3V7CA 3GO5A 3I2ZA 4X5OA 4POGA 4LVMA 4LNQA 4JI0Q 4OXPA 3A7AA 3RACA 2CJAA 4GKKL 4HVCA 3K8AA 2YV5A 1HH2P 5K1XA 3S1MH 2F4VQ 3LSSA 5M5XH 2VW9A 3IRBA 4JI4Q 3V8KA 2I5LX 2VZAA 2E5LL 2HIVA 2JEBI 5BR8L 1K0RA 2DXUA 3KDFA 1PYBA 2JJQA 2R6GA 4JI2L 4XU0A 3LGJA 4GN3B 4B3MQ 3H0GG 3L2ZA 4IPCA 4R4CA 4YCWA 1G6PA 1X01A 2E2HH 1SERA 4GOPA 3ULJA 3JAMi 1J6QA 2KCTA 2OTLA 1MIUA 3S16H 2MO0A 1IBLL 3A5YA 4B3TL 4ZTZB 4CH3A 2NVQH 4IO9A 3LSQA 3KJOA 1YFSA 4G84A 4H2YA 4HJAA 3CXCA 3F2DA 3KFUA 3CC2A 4WF2A 4OX9Q 2AWNA 1YBYA 4K86A 4XU2A 3M7NA 2V1CC 4IFDG 1N36L 3CMEA 3KJPA 3L1AA 5F5WA 4GN4B 4NXNL 3RKXA 4HJ8A 3QO7A 2I4MA 1PH7A 4H2UA 1CKOA 1VQ4A 2UXBQ 1NJ2A 1A0IA 2ZINA 3CCUA 5M5WH 1KRSA 4DV1L 3CCVA 3MEYA 3QO8A 1NJIC 2A19A 2FXQA 2KCMA 1PH4A 2I5HA 1XNRL 1EVLA 2XGTA 4QJFA 3PF5A 4UP9A 1VQAA 1PV4A 2K14A 2L15A 1EQRA 1LM0A 1J5WA 4A3DH 3HRKA 1QF6A 3G48A 4JBKA 1WCMH 5GQOA 1HR0L 2MQHA 3GTOH 2AKWA 4K0KL 1Q1EA 3RF1A 1TXYA 3H3VH 1HZ9A 1YFRA 3RZDH 3GTMH 5C0XI 3UDIA 3PO3G 1HR0Q 4LNSA 2Q7HA 2ZIOA 1X54A 1LYLA 4XTXA 1B8AA 1KD1C 3HOWG 5LMNW 5ELOA 4YREA 1CUKA 1OXSC 2ZNIA 5M3FG 5LMNQ 3RR5A 2DVEA 1SROA 1L1OA 3Q8DA 1PHJA 4YRKA 1KMNA 4KHPQ 4DR7Q 3L4GB 4HWOA 1D7QA 1AH9A 4C2MH 1FYFA 4A3EG 1I94Q 1EIYA 4YRMA 2DTHA 1KIXA 3PIPA 2DZ9A 2UU9L 1SR3A 1XMOQ 2DGYA 2AMCB 3I56A 4B3ML 3W5OA 4JI1Q 4DV4L 4A3KG 4K87A 4OWXB 1N36Q 1YHQA 2UUCQ 3K7AH 4UPAA 1EIFA 1N33L 4C3IH 4A75A 4JI6Q 2YTYA 3RLNA 4A93H 1GM5A 3HOXH 3CCEA 1A63A 2Y0SG 3HOUH 2CIMA 1TWAH 3CD6A 2EWNA 1X9NA 4P74C 3BJUA 1YITA 5IYBG 4H2VA 3DM3A 4YP0A 3OTOL 3IG2A 3HXUA 2CKZB 5C4XG 2EIFA 3S1QH 1OXVA 3HOYH 4DR4Q 2ALYA 4XTYA 1LUZA 4A3KH 4IFDJ 4A3GG 4PZ6A 1QUQA 1VCIA 1X3EA 4DR2Q 4A3FG 4DV2Q 2NVYH 2E3CA 1WFQA 4LF4Q 5IYDG 2PMFA 1VQEA 4JV5L 2OQ0A 3OTOQ 3HFZA 2ODRD 1WYDA 2GN5A 2OTJA 3KDFB 1UE5A 2R92G 4B3TQ 3RGLA 4UP8A 2E2JH 3HFZB 1X65A 4XIGS 2ZNJA 2IHFA 2NZOA 1KMMA 2EJFA 1JE5A 4CS3A 2DU7A 3A5ZB 4CH5A 4P3OA 1BBUA 1NY4A 4DV6Q 1NTGA 2C8MA 1YI2A 2MFIA 2DTIA 2QEXA 1XNQQ 4PZ7A 3HOVG 4X65Q 2DDZA 1USYC 3ICEA 4HWRA 1YEZA 5IYCG 2J3LA 2JA9A 2IT1A 5M5YH 3P8YA 2ZT7A 4FDBA 4XTZA 4YHHQ 4LF5Q 3STBC 4XTWA 1B7YB 1K9MC 2ALYB 1K83H 4C3HH 4DV6L 3UE0A 1UE1A 2B3GA 4NXMQ 4LFCL 3CCRA 4ALPA 2CFMA 4O2DA 4LUZA 5FJ8G 2P5IA 2Q2HA 4B3SL 4LVKA 3HKSA 3S2DH 1VS0A 2KHIA 3ER0A 4P71A 4JBWA 1JJGA 2I4LA 2JA7G 2DU5A 3KYHC 4BBRH 5C3EG 3L4GA 3D31A 1HTTA 3VQWA 3PUVA 2Z6KA 4XU1A 3TEHB 2Q7GA 1Y1WH 5JJLA 3D0FA 1E7ZA 2ZJQA 1YZ6A 2YTXA 1YHBA 1HC7A 4YCVA 4DV1Q 2EAYA 3J81i 2J3MA 1KRTA 5H1SE 4B3SQ 1WQ7A 1PH9A 4KLKA 1FJGQ 4BBSG 4JI5Q 2UXCQ 5C0XG 1UE7A 3K0XA 3FP9A 1BVSA 3GTJH 4DUZL 1PH8A 4JYAQ 5FJ8H 2E2IH 4JI5L 2UXCL 1HNWQ 1ASZA 2ZZGA 3VBBA 4OO1I 2HIXA 2ZT8A 4A3IG 5GAEC 3F8TA 1IZ6A 4DR1L 1Z7MA 1BBWA 2ID0A 1CKNA 4LUVA 4L5QA 4YCUA 1Y1VG 3WWVA 5C51B 4GLXA 3OYYA 4LVIA 4HT4A 4DUZQ 4JOIA 1VQKA 4OLFA 4DAYB 4A3JH 4JI6L 3CCJA 3F2CA 1H4QA 2K5VA 4DR5Q 4A3GH 3CW2C 4X66Q 1NNHA 4A3MG 3QTCA 4ZTUB 3GDEA 2I0QA 2IY5A 1N32L 1OXXK 3K80C 5E7NA 1A62A 4AH6A 4A3IH 3A7UA 4MNOA 5K1PA 1S40A 4P72C 1KL9A 4JI4L 1YB3A 1K73C 3CC7A 3HXXA 3G6EA 4AYBG 1WNLA 3HXWA 4DR6Q 1ADJA 1GO3E 4P3PA 3G1ZA 4X6AH 3BZKA 3F2BA 4XU3A 2ZT6A 2JQOA 4DAMA 1IL2A 4YWLA 4R4OA 1BIBA 1FJGL 1VQLA 1H4SA 4TTVA 3J7ZC 2Q2UA 4UP7A 3TS0A 2A8EA 4CS4A 1PH6A 4L5SA 2AWOA 1S3OA 4UY8C 3HOZH 2Q2TA 4YRQA 3EIVA 1RL2A 4GNXC 1X2GA 3I4MH 4PMWA 1SMXA 5E3IA 2H5XA 3W1GA 5LMUQ 2OQKA 4Q6GA 1WI5A 2UXDL 3UGTA 4LF7L 3LC0A 1USYA 4A3CH 2K4KA 2WB1G 4JI0L 5IT9c 2NN6G 4DR3Q 5IE8A 2ODRC 1V43A 1GVPA 5HY6A 2RCNA 1BIAA 2ZTGA 4JCVE 1S72A 3HXVA 5LMUL 4OONA 5IWAQ 1VQMA 2HNIA 4X62L 1PYSA 1Y14B 4YY3Q 1XNRQ 1YVCA 4DQ2A 4A3LG 4P75C 3SGIA 2VY3A 4NB3A 1ADYA 2VQEQ 5JEAJ 1T9HA 3W3SA 3V7RA 4YRRA 4AQYL 4GNXA 4BXXH 2I4NA 3S1NH 1JMCA 4BA2I 1PYSB 4XEOA 1NJ1A 4JI8L 5FLXc 1I94L 2Y0SE 3J80c 4HWPA 4POFA 2VUMG 3E0EA 2ZTDA 4KI0A 5IY0A 4XTVA 3AQQA 1PFSA 3RKYA 2AMCA 3EFSA 1FVIA 1Q1BA 4QIWE 4B3RL 2E41A 2DQ3A 3K81C 2AKWB 4BXXG 2CJBA 1J5EL 4JC0A 4HWTA 4HWSA 3CP0A 2D0PA 3ULPA 1I50H 1X55A 2R93G 3MQZA 3PSIA 4BY1G 4LWCA 2GVAA 4IPHA 4JBMA 3PO2H 1NJ6A 1KOGA 2B63G 2ZGWA 5HGQA 4R4IA 2N49A 3L0OA 4YRGA 1M1KC 1VQCA 4JI7Q 2JE6I 1E1OA 4NCXA 4TQDA 1GD7A 4P3NA 2PQAB 3B6YA 1U0LA 4YYEA 4HIMA 1Z7NA 2A8VA 3RKWA 3HXZA 3J7A5 1W2BA 4BY7G 2RHQB 3CMQA 3FJPA 4YRNA 4GS3A 4DR4L 3ERSX 4YRCA 4BY1H 2K75A 3M9BA 5M3MG 1FGUA 1AE2A 3KF6A 3L2PA 3STBD 4GKKQ 2E5LQ 4C3JH 4DR5L 2ARUA 1VQ8A 2HHHL 2PI2E 3RL6A 1N33Q 2YU9H 1GGMA 5C0XJ 1RIQA 1V9PA 1NJ8A 2N78A 2GVBA 3TRZA 4HJ7A 5IWAL 1XNQL 2E10A 3IALA 3EFRA 4A3JG 4IOCA 1QVCA 3AFPA 1C7YA 3UDFA 3S24A 2G4CA 5IP7G 1JT8A 2NVTH 4P73C 3UH0A 1HJPA 4JI7L 4GN5A 3M4PA 1PH3A 4JOIC 1K8AC 2VL6A 2PI2A 3M4OH 1C0AA 3QNEA 3L7ZC 4TQUS 3PUXA 2IX0A 2PMEA 1N34Q 2UUCL 4OP0A 3UE1A 2WFWA 2EJGA 3AFQA 5GROA 1XPOA 3CPWA 4TWAA 3TUPA 4P74A 1Q7YC 4L87A 3OD1A 2R7FA 1Q46A 2QHTA 5FLMG 1YNXA 3KF8B 1VQNA 1EWIA 2DQ0A 1HNXQ 2E65A 4J15A 4P75A 11ASA 4ZIBA 3M4QA 2R7DA 1CSQA 1H4VB 2VNUD 3REXA 4X64L 2E64A 3F1ZA 4A3FH 1XMQQ 1Q82C 2IY5B 3G4SA 2EQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJK A;  2OWO A;  4X64 Q;  4YRS A;  4JI8 Q;  3A0J A;  2YYZ A;  1PH1 A;  3PGZ A;  2DUD A;  1HNX L;  3TEH A;  3T1Y Q;  3CMA A;  1EIY B;  2F4V L;  1Z9F A;  3ZJY C;  4BY7 H;  3GTL H;  2KEN A;  3U58 A;  2VQF L;  2UU9 Q;  1N9W A;  1QZH A;  2CCZ A;  2P0L A;  4HA8 A;  1VQ6 A;  4DPG A;  4K88 A;  1VQ5 A;  4Q15 A;  3P8V A;  1EVK A;  1DGS A;  3HKZ G;  1B70 A;  1QZG A;  4H02 A;  2DTO A;  4DV7 Q;  4TVA A;  4YRO A;  3S15 H;  1UE6 A;  4LF8 L;  3HFV A;  4H2T A;  3RN2 A;  3VQY A;  3PUZ A;  4PZ8 A;  3PO2 G;  2PQA A;  1KAW A;  3H0G H;  1AE3 A;  3NEL A;  3UDG A;  4JI3 L;  5LMN L;  2JEA I;  3S17 H;  4HID A;  1L1O C;  1QVG A;  1HXD A;  3U4V A;  5GAG C;  5JEA G;  4NPS A;  4JG2 A;  1YJ9 A;  1HZC A;  5C44 H;  1X3F A;  3TEG A;  2A1A A;  3NET A;  1BKB A;  1K3R A;  5C53 B;  3PUY A;  2N3S A;  1X3G A;  3RN5 A;  4JI3 Q;  2BH8 A;  1YHA A;  2LXK A;  1VQZ A;  1X2H A;  4LFB Q;  1WCM G;  1Y1V H;  2IHE A;  5IYB H;  5M3F H;  4YRP A;  1KQS A;  3PIO A;  1X6O A;  3PF4 A;  1D8L A;  1VQF A;  1LTL A;  3W1B A;  4LF9 Q;  4GNX B;  1CSP A;  2MO1 A;  2Q5I A;  1YFT A;  1EOV A;  3HKZ E;  5FLM H;  1VQ7 A;  2UXD Q;  4DV3 L;  4LFA L;  3PCO B;  3GD7 A;  1KHI A;  1CKM A;  4YWM A;  4LFB L;  4X65 L;  1H95 A;  5AJ3 Q;  3RZO H;  2ZR2 A;  1SFO H;  3S14 H;  1W3S A;  3MF2 A;  4QY7 A;  1G5H A;  1L2F A;  4HJ9 A;  2BH2 A;  4LUO A;  4KHZ A;  2FYK A;  2IX1 A;  2ATW A;  3KF6 B;  1E3P A;  2RHS B;  4RMF A;  1R9T H;  4A3C G;  4OX9 L;  4P71 C;  3NEM A;  1N8R C;  3R07 A;  1MJC A;  4YRL A;  2JA8 G;  3ULL A;  3RLF A;  1RIP A;  2QHS A;  2K5H A;  4YRI A;  5GAH C;  5KNN A;  3NEN A;  3CF5 A;  2ZT5 A;  5BR8 Q;  3GTK H;  4LF4 L;  4A3B H;  4GLA C;  2HQL A;  3BFM A;  4HJ5 A;  1SRU A;  4A3B G;  1EYG A;  2CQO A;  1HNZ L;  2NN6 I;  2N8N A;  2K5N A;  1PH5 A;  2WB1 E;  1G5I A;  4L5T A;  4DV4 Q;  1M90 C;  4BBS H;  2R7Z G;  3ICA A;  1QUQ B;  4H2W A;  4X66 L;  2JA5 G;  4NXM L;  2QA4 A;  1Q8K A;  4O0A A;  1B76 A;  2B63 H;  4AYB E;  1O7I A;  2NZH A;  2WP8 J;  2JA7 H;  4H2X A;  2AHO B;  1SET A;  3J81 c;  5DLQ E;  4RQF A;  4RG1 A;  4ME3 A;  1Q81 C;  2DKG A;  2E1H A;  4TVA B;  1B70 B;  1SRY A;  1YJW A;  5IP9 H;  12AS A;  1EUJ A;  1NJ5 A;  4YRJ A;  1Q86 C;  1NYR A;  4DNI A;  1TWC H;  2ZCE A;  2RF4 A;  1SLJ A;  1XMO L;  3HY0 A;  5ELN A;  2I5M X;  3WQZ A;  2ES2 A;  4IPD A;  2Z6K C;  1IBM L;  4DV0 L;  3KOJ A;  5M3M H;  2I4O A;  3REU A;  1JJC B;  1TWF H;  2Z0S A;  4DK3 C;  1IXR A;  4LF7 Q;  3I7F A;  1N32 Q;  3RIR A;  4XTU A;  1A8V A;  1VQH A;  2BA1 A;  4DR1 Q;  1EQQ A;  5C3E H;  2VUM H;  3TQY A;  1Q12 A;  4LFA Q;  2LSS A;  4RQE A;  1WQW A;  3ERR A;  1VQJ A;  1L1O B;  3I4N H;  1VQ9 A;  3A7R A;  4LF6 L;  1G29 1;  1ATI A;  2KHJ A;  4OWW B;  1CKN B;  3MF1 A;  2ZM6 Q;  2RHS A;  2K50 A;  1HNZ Q;  4YRF A;  3OW2 A;  3TS2 A;  3T1H Q;  3S2H H;  2EL9 A;  2QHV A;  1EFW A;  4GOP C;  4BWA A;  2XTI A;  3PZC A;  4BBR G;  2MNA A;  1Z47 A;  4XEM A;  4K0K Q;  3FKI G;  4PHC A;  4DKA C;  3MEF A;  2Q2I A;  4WJ4 A;  5C4X H;  1G51 A;  2R93 H;  1SES A;  2F3I A;  1VQB A;  2K52 A;  2RHQ A;  1YJN A;  2ZIM A;  5C52 B;  2QHU A;  4JV5 Q;  3CAM A;  2ZM6 L;  3CCS A;  4HIO A;  4TVW A;  1JJ2 A;  2HHH Q;  4X62 Q;  2QGQ A;  1WU7 A;  3FKI H;  1N34 L;  4IOA A;  1GKH A;  2UUA Q;  2JA6 G;  1UEB A;  1NE3 A;  4IJH A;  3IKL A;  2JA5 H;  5EAY A;  1H4T A;  4IJL A;  2DXT A;  4AQY Q;  4MZ9 A;  3KLW A;  4CS2 A;  1L0W A;  2ARS A;  3HOX G;  1SN8 A;  1VQP A;  4YY3 L;  2UUA L;  5IP9 G;  3HOW H;  1NMG A;  3I4M G;  2CJ9 A;  3V8L A;  1KC8 C;  4KHP L;  3I4N G;  3DLL A;  3HOZ G;  4TQF A;  3MXN B;  4NXN Q;  3A74 A;  1OXT A;  2ZJR A;  3K7U C;  4A3M H;  1VQD A;  5GAD C;  2B29 A;  2E5A A;  3T1Y L;  4KR2 A;  4A3D G;  1XJV A;  2ZJP A;  5IP7 H;  4R1J A;  1V1Q A;  4PG3 A;  1W66 A;  1P8L A;  4JBJ A;  3NBH B;  5C44 G;  3HRI A;  1SE8 A;  2ZR3 A;  4DV7 L;  4DR6 L;  4A76 A;  3CPF A;  4QQB X;  4A93 G;  1B7Y A;  3J80 i;  2JK8 A;  3GTG H;  1JB7 A;  2E8G A;  3PCO A;  3A32 A;  1C9O A;  2D62 A;  4LFC Q;  2C7I A;  2ZZE A;  3IKM B;  4A4I A;  4BA1 I;  4E51 A;  4CH6 A;  3PV0 A;  4QGU A;  1YIJ A;  3CCQ A;  4QL5 A;  3M85 A;  4A3E H;  2VQF Q;  3FHW A;  1HNW L;  2C35 B;  1OTC A;  1FL0 A;  4OO1 G;  2CGH A;  4EO4 A;  1Y1W G;  3PUW A;  1KXL A;  4YHH L;  3BU2 A;  2VS1 A;  3S1R H;  4KR3 A;  4DV3 Q;  2D0O A;  3T1H L;  3H3V I;  2ZTE A;  2EJ9 A;  3CQZ H;  4WI1 A;  1P16 A;  4GLV B;  1I5F A;  2YTV A;  1MKH A;  1IBK L;  3UGQ A;  4LF9 L;  1ASY A;  1J5E Q;  4DR2 L;  3GTQ H;  5K36 G;  2EXD A;  3JAM c;  2JA8 H;  2PNH A;  3HOV H;  5IYD H;  1XPU A;  1U5K A;  2PMZ E;  4P73 A;  4YWK A;  1NMF A;  3H15 A;  3QO5 A;  5JJI A;  1I6H H;  2DZC A;  2NVX H;  1VQG A;  4LF5 L;  2WAQ E;  1PA6 A;  4LF8 Q;  1HZB A;  2R7Z H;  4DUY L;  1IYJ B;  3TRE A;  4MTN A;  4DV2 L;  4EQ5 A;  3EN2 A;  1QE0 A;  1WPY A;  3UDX A;  1XPR A;  3CCL A;  1VQI A;  3UFG A;  3P8T A;  4AIM A;  4YPF A;  1HZA A;  4TVY A;  1XTD A;  1E22 A;  1PH2 A;  2DJZ A;  4L5R C;  1JJC A;  3RLO A;  1E1T A;  3V7S A;  4JI2 Q;  4IFD I;  4DUY Q;  4H2S A;  4H2X B;  3BZC A;  3HXY A;  4B3R Q;  3V8J A;  5C4J H;  2CWA A;  4YRT A;  1UWV A;  3CCM A;  1TWG H;  4A3L H;  5IYC H;  3JC6 6;  1PVO A;  1NYQ A;  4LW1 A;  3HOY G;  1TWH H;  1E24 A;  4APV A;  2UXB L;  3A5Z A;  1K8G A;  4EX5 A;  3E9I A;  2ZXF A;  2CWP A;  4GOP B;  2LXJ A;  4JYA L;  3RNU A;  3I55 A;  1WLE A;  4DK6 C;  4P72 A;  4HIK A;  3VQX A;  3HY1 A;  4DV5 Q;  4BW9 A;  1IBK Q;  4WJ3 M;  2KBN A;  1IBM Q;  1HR0 W;  3AYH B;  2HT1 A;  4XTC S;  2R92 H;  4IPG A;  3VDY A;  1WOC A;  4G85 A;  4GKJ L;  2WAQ G;  3A5U A;  3U4Z A;  2Q5H A;  3I4O A;  4Y52 H;  3RUX A;  3J81 j;  2F52 A;  4YDQ A;  5AJ3 L;  2JA6 H;  4OWT B;  2ART A;  1MJE A;  4GKJ Q;  2ASB A;  3HTZ A;  4DV5 L;  3M3Y H;  3E9H A;  4DR3 L;  4DV0 Q;  1WJJ A;  1QVF A;  2ZZF A;  3U50 C;  3A31 A;  1I3Q H;  4LF6 Q;  4RDX A;  2ZTC A;  3GTP H;  2OCE A;  1VQO A;  3EBE A;  4DR7 L;  3CC4 A;  1NBW A;  1YGB A;  2DEQ A;  2UUB Q;  3VQV A;  3DSQ A;  3PO3 H;  1OXU A;  4R4Q A;  4CH4 A;  4R4T A;  3AEV A;  3HOU G;  3G71 A;  2VQE L;  4KQE A;  2UUB L;  4Y7N H;  1XMQ L;  1X56 A;  4JI1 L;  2Q7E A;  2BA0 A;  1IBL Q;  5J3B A;  3V7C A;  3GO5 A;  3I2Z A;  4X5O A;  4POG A;  4LNQ A;  4JI0 Q;  4OXP A;  3A7A A;  3RAC A;  2CJA A;  4GKK L;  4HVC A;  3K8A A;  2YV5 A;  1HH2 P;  5K1X A;  3S1M H;  2F4V Q;  3LSS A;  5M5X H;  2VW9 A;  3IRB A;  4JI4 Q;  3V8K A;  2I5L X;  2VZA A;  2E5L L;  2HIV A;  2JEB I;  5BR8 L;  1K0R A;  2DXU A;  3KDF A;  1PYB A;  2JJQ A;  2R6G A;  4JI2 L;  4XU0 A;  3LGJ A;  4GN3 B;  4B3M Q;  3H0G G;  3L2Z A;  4IPC A;  4R4C A;  4YCW A;  1G6P A;  1X01 A;  2E2H H;  1SER A;  4GOP A;  3ULJ A;  3JAM i;  1J6Q A;  2KCT A;  2OTL A;  1MIU A;  3S16 H;  2MO0 A;  1IBL L;  3A5Y A;  4B3T L;  4ZTZ B;  4CH3 A;  2NVQ H;  4IO9 A;  3LSQ A;  3KJO A;  1YFS A;  4G84 A;  4H2Y A;  4HJA A;  3CXC A;  3F2D A;  3KFU A;  3CC2 A;  4WF2 A;  4OX9 Q;  2AWN A;  1YBY A;  4K86 A;  4XU2 A;  3M7N A;  2V1C C;  4IFD G;  1N36 L;  3CME A;  3KJP A;  3L1A A;  5F5W A;  4GN4 B;  4NXN L;  3RKX A;  4HJ8 A;  3QO7 A;  2I4M A;  1PH7 A;  4H2U A;  1CKO A;  1VQ4 A;  2UXB Q;  1NJ2 A;  1A0I A;  2ZIN A;  3CCU A;  5M5W H;  1KRS A;  4DV1 L;  3CCV A;  3MEY A;  3QO8 A;  1NJI C;  2A19 A;  2FXQ A;  2KCM A;  1PH4 A;  2I5H A;  1XNR L;  1EVL A;  2XGT A;  4QJF A;  3PF5 A;  4UP9 A;  1VQA A;  1PV4 A;  2K14 A;  2L15 A;  1EQR A;  1LM0 A;  1J5W A;  4A3D H;  3HRK A;  1QF6 A;  3G48 A;  4JBK A;  1WCM H;  5GQO A;  1HR0 L;  2MQH A;  3GTO H;  2AKW A;  4K0K L;  1Q1E A;  3RF1 A;  1TXY A;  3H3V H;  1HZ9 A;  1YFR A;  3RZD H;  3GTM H;  5C0X I;  3UDI A;  3PO3 G;  1HR0 Q;  4LNS A;  2Q7H A;  2ZIO A;  1X54 A;  1LYL A;  4XTX A;  1B8A A;  1KD1 C;  3HOW G;  5LMN W;  5ELO A;  4YRE A;  1CUK A;  1OXS C;  2ZNI A;  5M3F G;  5LMN Q;  3RR5 A;  2DVE A;  1SRO A;  1L1O A;  3Q8D A;  1PHJ A;  4YRK A;  1KMN A;  4KHP Q;  4DR7 Q;  3L4G B;  4HWO A;  1D7Q A;  1AH9 A;  4C2M H;  1FYF A;  4A3E G;  1I94 Q;  1EIY A;  4YRM A;  2DTH A;  1KIX A;  3PIP A;  2DZ9 A;  2UU9 L;  1SR3 A;  1XMO Q;  2DGY A;  2AMC B;  3I56 A;  4B3M L;  3W5O A;  4JI1 Q;  4DV4 L;  4A3K G;  4K87 A;  4OWX B;  1N36 Q;  1YHQ A;  2UUC Q;  3K7A H;  4UPA A;  1EIF A;  1N33 L;  4C3I H;  4A75 A;  4JI6 Q;  2YTY A;  3RLN A;  4A93 H;  1GM5 A;  3HOX H;  3CCE A;  1A63 A;  2Y0S G;  3HOU H;  2CIM A;  1TWA H;  3CD6 A;  2EWN A;  1X9N A;  4P74 C;  3BJU A;  1YIT A;  5IYB G;  4H2V A;  3DM3 A;  4YP0 A;  3OTO L;  3IG2 A;  3HXU A;  2CKZ B;  5C4X G;  2EIF A;  3S1Q H;  1OXV A;  3HOY H;  4DR4 Q;  2ALY A;  4XTY A;  1LUZ A;  4A3K H;  4IFD J;  4A3G G;  4PZ6 A;  1QUQ A;  1VCI A;  1X3E A;  4DR2 Q;  4A3F G;  4DV2 Q;  2NVY H;  2E3C A;  1WFQ A;  4LF4 Q;  5IYD G;  2PMF A;  1VQE A;  4JV5 L;  2OQ0 A;  3OTO Q;  3HFZ A;  2ODR D;  1WYD A;  2GN5 A;  2OTJ A;  3KDF B;  1UE5 A;  2R92 G;  4B3T Q;  3RGL A;  4UP8 A;  2E2J H;  3HFZ B;  1X65 A;  4XIG S;  2ZNJ A;  2IHF A;  2NZO A;  1KMM A;  2EJF A;  1JE5 A;  4CS3 A;  2DU7 A;  3A5Z B;  4CH5 A;  4P3O A;  1BBU A;  1NY4 A;  4DV6 Q;  1NTG A;  2C8M A;  1YI2 A;  2MFI A;  2DTI A;  2QEX A;  1XNQ Q;  4PZ7 A;  3HOV G;  4X65 Q;  2DDZ A;  1USY C;  3ICE A;  4HWR A;  1YEZ A;  5IYC G;  2J3L A;  2JA9 A;  2IT1 A;  5M5Y H;  3P8Y A;  2ZT7 A;  4FDB A;  4XTZ A;  4YHH Q;  4LF5 Q;  3STB C;  4XTW A;  1B7Y B;  1K9M C;  2ALY B;  1K83 H;  4C3H H;  4DV6 L;  3UE0 A;  1UE1 A;  2B3G A;  4NXM Q;  4LFC L;  3CCR A;  4ALP A;  2CFM A;  4O2D A;  4LUZ A;  5FJ8 G;  2P5I A;  2Q2H A;  4B3S L;  3HKS A;  3S2D H;  1VS0 A;  2KHI A;  3ER0 A;  4P71 A;  4JBW A;  1JJG A;  2I4L A;  2JA7 G;  2DU5 A;  3KYH C;  4BBR H;  5C3E G;  3L4G A;  3D31 A;  1HTT A;  3VQW A;  3PUV A;  2Z6K A;  4XU1 A;  3TEH B;  2Q7G A;  1Y1W H;  5JJL A;  3D0F A;  1E7Z A;  2ZJQ A;  1YZ6 A;  2YTX A;  1YHB A;  1HC7 A;  4YCV A;  4DV1 Q;  2EAY A;  3J81 i;  2J3M A;  1KRT A;  5H1S E;  4B3S Q;  1WQ7 A;  1PH9 A;  4KLK A;  1FJG Q;  4BBS G;  4JI5 Q;  2UXC Q;  5C0X G;  1UE7 A;  3K0X A;  3FP9 A;  1BVS A;  3GTJ H;  4DUZ L;  1PH8 A;  4JYA Q;  5FJ8 H;  2E2I H;  4JI5 L;  2UXC L;  1HNW Q;  1ASZ A;  2ZZG A;  3VBB A;  4OO1 I;  2HIX A;  2ZT8 A;  4A3I G;  5GAE C;  3F8T A;  1IZ6 A;  4DR1 L;  1Z7M A;  1BBW A;  2ID0 A;  1CKN A;  4LUV A;  4L5Q A;  4YCU A;  1Y1V G;  3WWV A;  5C51 B;  4GLX A;  3OYY A;  4DUZ Q;  4JOI A;  1VQK A;  4OLF A;  4DAY B;  4A3J H;  4JI6 L;  3CCJ A;  3F2C A;  1H4Q A;  2K5V A;  4DR5 Q;  4A3G H;  3CW2 C;  4X66 Q;  1NNH A;  4A3M G;  3QTC A;  4ZTU B;  3GDE A;  2I0Q A;  2IY5 A;  1N32 L;  1OXX K;  3K80 C;  5E7N A;  1A62 A;  4AH6 A;  4A3I H;  3A7U A;  4MNO A;  5K1P A;  1S40 A;  4P72 C;  1KL9 A;  4JI4 L;  1YB3 A;  1K73 C;  3CC7 A;  3HXX A;  3G6E A;  4AYB G;  1WNL A;  3HXW A;  4DR6 Q;  1ADJ A;  1GO3 E;  4P3P A;  3G1Z A;  4X6A H;  3BZK A;  3F2B A;  4XU3 A;  2ZT6 A;  2JQO A;  4DAM A;  1IL2 A;  4YWL A;  4R4O A;  1BIB A;  1FJG L;  1VQL A;  1H4S A;  4TTV A;  3J7Z C;  2Q2U A;  4UP7 A;  3TS0 A;  4CS4 A;  1PH6 A;  4L5S A;  2AWO A;  1S3O A;  4UY8 C;  3HOZ H;  2Q2T A;  4YRQ A;  3EIV A;  1RL2 A;  4GNX C;  1X2G A;  3I4M H;  4PMW A;  1SMX A;  5E3I A;  2H5X A;  3W1G A;  5LMU Q;  2OQK A;  4Q6G A;  1WI5 A;  2UXD L;  3UGT A;  4LF7 L;  3LC0 A;  1USY A;  4A3C H;  2K4K A;  2WB1 G;  4JI0 L;  5IT9 c;  2NN6 G;  4DR3 Q;  5IE8 A;  2ODR C;  1V43 A;  1GVP A;  5HY6 A;  2RCN A;  1BIA A;  2ZTG A;  4JCV E;  1S72 A;  3HXV A;  5LMU L;  4OON A;  5IWA Q;  1VQM A;  2HNI A;  4X62 L;  1PYS A;  1Y14 B;  4YY3 Q;  1XNR Q;  1YVC A;  4DQ2 A;  4A3L G;  4P75 C;  3SGI A;  2VY3 A;  4NB3 A;  1ADY A;  2VQE Q;  5JEA J;  1T9H A;  3W3S A;  3V7R A;  4YRR A;  4AQY L;  4GNX A;  4BXX H;  2I4N A;  3S1N H;  1JMC A;  4BA2 I;  1PYS B;  4XEO A;  1NJ1 A;  4JI8 L;  5FLX c;  1I94 L;  2Y0S E;  3J80 c;  4HWP A;  4POF A;  2VUM G;  3E0E A;  2ZTD A;  4KI0 A;  5IY0 A;  4XTV A;  3AQQ A;  1PFS A;  3RKY A;  2AMC A;  3EFS A;  1FVI A;  1Q1B A;  4QIW E;  4B3R L;  2E41 A;  2DQ3 A;  3K81 C;  2AKW B;  4BXX G;  2CJB A;  1J5E L;  4JC0 A;  4HWT A;  4HWS A;  3CP0 A;  2D0P A;  3ULP A;  1I50 H;  1X55 A;  2R93 G;  3PSI A;  4BY1 G;  4LWC A;  2GVA A;  4IPH A;  4JBM A;  3PO2 H;  1NJ6 A;  1KOG A;  2B63 G;  2ZGW A;  5HGQ A;  4R4I A;  2N49 A;  3L0O A;  4YRG A;  1M1K C;  1VQC A;  4JI7 Q;  2JE6 I;  1E1O A;  4NCX A;  4TQD A;  1GD7 A;  4P3N A;  2PQA B;  3B6Y A;  1U0L A;  4YYE A;  4HIM A;  1Z7N A;  2A8V A;  3RKW A;  3HXZ A;  3J7A 5;  1W2B A;  4BY7 G;  2RHQ B;  3CMQ A;  3FJP A;  4YRN A;  4GS3 A;  4DR4 L;  3ERS X;  4YRC A;  4BY1 H;  2K75 A;  3M9B A;  5M3M G;  1FGU A;  1AE2 A;  3KF6 A;  3L2P A;  3STB D;  4GKK Q;  2E5L Q;  4C3J H;  4DR5 L;  2ARU A;  1VQ8 A;  2HHH L;  2PI2 E;  3RL6 A;  1N33 Q;  2YU9 H;  1GGM A;  5C0X J;  1RIQ A;  1V9P A;  1NJ8 A;  2N78 A;  2GVB A;  3TRZ A;  4HJ7 A;  5IWA L;  1XNQ L;  2E10 A;  3IAL A;  3EFR A;  4A3J G;  4IOC A;  1QVC A;  3AFP A;  1C7Y A;  3UDF A;  3S24 A;  2G4C A;  5IP7 G;  1JT8 A;  2NVT H;  4P73 C;  3UH0 A;  1HJP A;  4JI7 L;  4GN5 A;  3M4P A;  1PH3 A;  4JOI C;  1K8A C;  2VL6 A;  2PI2 A;  3M4O H;  1C0A A;  3QNE A;  3L7Z C;  4TQU S;  3PUX A;  2IX0 A;  2PME A;  1N34 Q;  2UUC L;  4OP0 A;  3UE1 A;  2WFW A;  2EJG A;  3AFQ A;  5GRO A;  1XPO A;  3CPW A;  4TWA A;  3TUP A;  4P74 A;  1Q7Y C;  4L87 A;  3OD1 A;  2R7F A;  1Q46 A;  2QHT A;  5FLM G;  1YNX A;  3KF8 B;  1VQN A;  1EWI A;  2DQ0 A;  1HNX Q;  2E65 A;  4J15 A;  4P75 A;  11AS A;  4ZIB A;  3M4Q A;  2R7D A;  1CSQ A;  1H4V B;  2VNU D;  3REX A;  4X64 L;  2E64 A;  3F1Z A;  4A3F H;  1XMQ Q;  1Q82 C;  2IY5 B;  3G4S A;  2EQS A; 
#chains in the Genus database with same CATH topology
 3A54 A;  5JJK A;  1RD9 D;  2OWO A;  2JA6 B;  4X64 Q;  4YRS A;  4JI8 Q;  1EYA A;  3A0J A;  3SVM A;  4GZY C;  2YYZ A;  1PRT B;  2RKS A;  3CU7 A;  3S17 B;  2HD3 A;  5ELD A;  1PH1 A;  3PGZ A;  2DUD A;  1HNX L;  3TEH A;  4KKT A;  3E3X A;  3T1Y Q;  3QOL A;  2M00 A;  1PTO H;  3CMA A;  1EIY B;  2F4V L;  1Z9F A;  3ZJY C;  3J7A F;  4BY7 H;  4ID6 A;  4KJN A;  3GTL H;  2OEO A;  2KEN A;  3U58 A;  2VQF L;  4XQJ A;  2UU9 Q;  4TKO B;  3MXP A;  1N9W A;  1QZH A;  5EKK A;  2CCZ A;  1T5E A;  2P0L A;  4HA8 A;  1JWM D;  3BYT B;  1VQ6 A;  2NYZ D;  4N8F A;  1ZKO A;  4DPG A;  4K88 A;  2X6G A;  1VQ5 A;  4Q15 A;  1U4P A;  3P8V A;  1WTV A;  1GUN A;  1EVK A;  1DGS A;  3HKZ G;  1B70 A;  1QZG A;  4H02 A;  2DTO A;  4DV7 Q;  3PO3 B;  3RMH A;  4TVA A;  1CA6 A;  4ULL A;  4YRO A;  3S15 H;  1UE6 A;  2JXM B;  3G7L A;  4RCN A;  5G3L F;  2ZXO A;  4LF8 L;  1R4P B;  3HFV A;  4H2T A;  3RN2 A;  2F3V A;  4DNR B;  4CDE C;  2IW3 A;  3VQY A;  3PUZ A;  4CGY B;  1W6J A;  2TMP A;  1V1O A;  4PZ8 A;  3PO2 G;  2PQA A;  1KAW A;  3DXJ C;  5M3F B;  2R61 A;  4CDD C;  2VXW A;  3H0G H;  1AE3 A;  3NEL A;  4J6H A;  3UDG A;  5C3X A;  4JI3 L;  1YNJ C;  5LMN L;  1EY0 A;  2I07 B;  4ILW A;  2JEA I;  3S17 H;  1U4R A;  3C1F A;  4HID A;  2IPK D;  4C2M B;  1L1O C;  3IFT A;  1QVG A;  1HXD A;  3U4V A;  5GAG C;  1B1Z A;  4DGZ A;  5JEA G;  4NPS A;  4JG2 A;  1YJ9 A;  1HZC A;  5C44 H;  4G7Z C;  1X3F A;  4X3S A;  2RDG A;  3TEG A;  5D65 A;  2A1A A;  3NET A;  1BKB A;  1K3R A;  5C53 B;  1U9R A;  3OPO A;  3PUY A;  3S2D B;  2N3S A;  2CW0 C;  1X3G A;  1XYI A;  3RN5 A;  4JI3 Q;  3NUC A;  2BH8 A;  4I7Z C;  4WRD A;  1YHA A;  2LXK A;  1VQZ A;  1RKN A;  2EJF C;  4ZUJ A;  1X2H A;  4LFB Q;  2NTT A;  1WCM G;  1Y1V H;  4ZKB B;  2IHE A;  3H6M A;  5IYB H;  5M3F H;  4YRP A;  1KQS A;  2B2W C;  3PIO A;  4JPB W;  1X6O A;  3PF4 A;  4F8M A;  1D8L A;  1VQF A;  2A6E D;  1LTL A;  4IUT A;  3FMC A;  3W1B A;  1PZK D;  1DYQ A;  4LF9 Q;  3TZD A;  4GNX B;  5FO7 B;  1CSP A;  2D9U A;  2MO1 A;  1E2Z A;  2Q5I A;  3GQB A;  3I90 A;  2WII B;  5I2X A;  3KBX A;  3H09 A;  1YFT A;  3HGB A;  1EOV A;  3HKZ E;  5EPK A;  5FLM H;  1SEB D;  1VQ7 A;  4J8Q A;  2RVL A;  4DV3 L;  2UXD Q;  1X32 A;  3PCO B;  3GD7 A;  4LFA L;  1KHI A;  1CKM A;  4YWM A;  2RBM A;  4LFB L;  4X65 L;  1CZW A;  1H95 A;  4G57 A;  2EJM A;  1PRT F;  1KDA A;  3NBI A;  5AJ3 Q;  2B8F A;  1H9J A;  4B9W A;  2IX3 A;  3RZO H;  4HMI A;  2ZR2 A;  3C2P A;  2F0D A;  1B9M A;  3SK8 A;  1SFO H;  3S14 H;  1W3S A;  4YIJ A;  5I6W A;  3MF2 A;  4QY7 A;  1G5H A;  1NSN S;  3TZU A;  2FMM A;  5EKI A;  4HSP A;  3GV3 A;  1L2F A;  4HJ9 A;  4BBS B;  4EQP A;  3HOY B;  4DN4 M;  2BH2 A;  2RCF A;  4LUO A;  2ICE C;  4KHZ A;  3E5S A;  2FYK A;  2IX1 A;  2ATW A;  3KF6 B;  1WTR A;  1E3P A;  2RHS B;  4RMF A;  1R9T H;  4O1N A;  4A3C G;  4OX9 L;  1I4H A;  3GTQ B;  4P71 C;  3NEM A;  1N8R C;  1EY8 A;  1MJC A;  3R07 A;  2JA8 G;  4YRL A;  3ULL A;  2B8G A;  5M3M B;  3RLF A;  1D1K A;  5C4Z A;  1AZQ A;  2JA8 B;  4HMJ A;  2PYK A;  5A35 A;  1RIP A;  2QHS A;  2K5H A;  3RD4 A;  2B2W A;  4YRI A;  2SOB A;  5GAH C;  1NAP A;  1L0X B;  5KNN A;  1SE3 A;  3NEN A;  5KNB A;  1I6H B;  1SNO A;  5EPJ A;  3CF5 A;  2PW7 A;  3HOV B;  5BR8 Q;  3GTK H;  2ZT5 A;  1ILQ A;  4EQO A;  4LF4 L;  4A3B H;  1SYF A;  3DEP A;  4GLA C;  1IYU A;  4KTA A;  2Z4I A;  2HQL A;  2D5D A;  1Y1V B;  2DY7 A;  1BO0 A;  3BFM A;  4HJ5 A;  1SRU A;  4A3B G;  2WKC A;  1EYG A;  2CQO A;  1HNZ L;  1STA A;  2NN6 I;  2N8N A;  2K5N A;  3MFG A;  1PH5 A;  2LMC B;  2WB1 E;  1G5I A;  4I7A A;  4L5T A;  4DV4 Q;  1M90 C;  4BBS H;  4C3H B;  3K59 A;  1B2T A;  2R7Z G;  4A3M B;  3ICA A;  1QUQ B;  1JR0 D;  4QB4 A;  4H2W A;  4X66 L;  2LFN A;  4ZRZ A;  1ROD A;  1KNA A;  2JA5 G;  3M7G A;  4NXM L;  2QA4 A;  3PMF A;  3Q22 A;  1Q8K A;  4O0A A;  2EY1 A;  2B63 H;  4AYB E;  1B76 A;  1O7I A;  2WAC A;  2NZH A;  4RAU C;  1FYC A;  2ICI A;  2WP8 J;  3EJI A;  2JA7 H;  2CHB D;  3NTK A;  4H2X A;  1TY2 A;  2Z6B A;  4PMC A;  4LVL A;  2AHO B;  1DOM A;  5KIX A;  1SET A;  3J81 c;  5DLQ E;  5I2Y A;  4RQF A;  4RG1 A;  2SEB D;  4ME3 A;  1Q81 C;  3DWP A;  2DKG A;  1SNQ A;  2Q8I B;  1TWG B;  4AYB B;  2E1H A;  4BBR B;  4TVA B;  4ZUI A;  1C4Q A;  4C3I B;  1B70 B;  2L55 A;  1SRY A;  1YJW A;  1LLR D;  4ZK9 B;  5IP9 H;  12AS A;  4OL7 A;  1EUJ A;  3I91 A;  1NJ5 A;  4YRJ A;  4XXE A;  1Q86 C;  4DNI A;  1NYR A;  1LTS D;  1TWC H;  3SK6 A;  2ZCE A;  2RF4 A;  1SLJ A;  1XMO L;  3HY0 A;  5ELN A;  2I5M X;  3WQZ A;  2ES2 A;  1K8O A;  1SE4 A;  4IPD A;  2Z6K C;  1CA5 A;  2HDL A;  1IBM L;  4DV0 L;  2I46 A;  3KOJ A;  1PLF A;  4DK0 A;  5M3M H;  2I4O A;  3REU A;  1JJC B;  1TWF H;  2Z0S A;  3HRZ C;  1SYD A;  2F0F A;  1DJR D;  1QOH A;  2XNA C;  4DK3 C;  1IXR A;  4LF7 Q;  3OSO A;  2MP1 A;  3I7F A;  1XX8 A;  2L11 A;  1N32 Q;  1ET6 A;  3RIR A;  4XTU A;  2E2I B;  2NTS A;  1A8V A;  1VQH A;  2BA1 A;  4DR1 Q;  2NVY B;  4IUR A;  1EQQ A;  2R3Z A;  3DMU A;  5C3E H;  2VUM H;  3TQY A;  1Q12 A;  4LFA Q;  2QKI C;  2LSS A;  1Q8I A;  4RQE A;  5EPL A;  1WQW A;  4DAY A;  5C3W A;  3ERR A;  1VQJ A;  2NB0 A;  1L1O B;  3I4N H;  3GV6 A;  1VQ9 A;  3A7R A;  1BF4 A;  4LF6 L;  3MAQ A;  1G29 1;  4PMB A;  1ATI A;  1QNK A;  2DNC A;  2KHJ A;  4OWW B;  2LY7 A;  1CKN B;  4RGN A;  1GHJ A;  1STH A;  1TU2 B;  4KN7 C;  2ZM6 Q;  3MF1 A;  2AUJ D;  1DZ1 A;  4A3J B;  2RHS A;  3TDQ A;  3BDO A;  4C3H G;  3VR3 A;  2K50 A;  1HNZ Q;  3GTP B;  4YRF A;  2E2D C;  2G9D A;  3OW2 A;  4A3G B;  1A2T A;  4RKB A;  3TS2 A;  1U4M A;  1JE4 A;  3T1H Q;  1B3Q A;  4LJZ C;  4LMQ D;  4MIU A;  1LTA D;  1LTG D;  1X3Q A;  2K03 A;  1JWU D;  3MTS A;  1SMY D;  3S2H H;  2EL9 A;  1BXT A;  5IT9 E;  1F9S A;  3NWS A;  4BWG B;  4HTH A;  2QHV A;  3KLS X;  1EFW A;  1JB3 A;  1M8A A;  2B2Y C;  2M9V A;  4GOP C;  4BWA A;  3HOW B;  1Q90 A;  2RDF A;  2XTI A;  3PZC A;  2LS0 1;  2HUG A;  4BBR G;  4FF4 A;  2MNA A;  3VR4 A;  4JW0 A;  1MGS A;  2O5J C;  1V1P B;  1Z47 A;  2EZV A;  1EU3 A;  3NHH A;  4OGQ C;  1RF2 D;  4XEM A;  1KNE A;  4NDX A;  4CBV A;  5HUR A;  4K0K Q;  3FKI G;  2TSS A;  4PHC A;  5KNC A;  3VR6 A;  4DKA C;  1EU4 A;  3MEF A;  2VB2 X;  2Q2I A;  1C48 A;  4LK1 C;  1K8M A;  4WJ4 A;  5C4X H;  1G51 A;  2D2C C;  4RWS C;  1KAB A;  4UDU C;  2R93 H;  3DWQ A;  2F3I A;  1SES A;  3MA2 B;  1VQB A;  2K52 A;  2KVM A;  2RHQ A;  4ZYS A;  2KOL A;  4HAE A;  1ML0 D;  1YJN A;  1SXT A;  2ZIM A;  2QHU A;  5C52 B;  2F0O A;  4JV5 Q;  3CAM A;  2PO4 A;  1EEI D;  5HGT A;  2ZM6 L;  4OIJ A;  3ERO A;  1E2W A;  4H44 C;  3CCS A;  4HIO A;  4TVW A;  1JJ2 A;  2HHH Q;  2PCF B;  4CDF C;  2J4X A;  2QGQ A;  4X62 Q;  4ABN A;  1WU7 A;  3FKI H;  1N34 L;  4IOA A;  1K83 B;  1GKH A;  4RA8 A;  2UUA Q;  3H94 A;  2JA6 G;  3BVZ A;  5DEH A;  1UEB A;  3G6J B;  1NE3 A;  1WTQ A;  4IJH A;  2F0S A;  3IKL A;  4X3T A;  2RSN A;  2E74 C;  5EAY A;  2JA5 H;  1H4T A;  4IJL A;  4V0B A;  5ISR A;  1AFP A;  1G6Z A;  5L37 A;  2DXT A;  1PTO B;  4AQY Q;  4IZ8 A;  1CZG A;  2EXZ A;  2IJ0 A;  4MZ9 A;  3NQI A;  4L8J A;  1JOO A;  2XVS A;  3KLW A;  4BY1 B;  3PIP 3;  4CS2 A;  3IKJ A;  1A6X A;  1L0W A;  1PFB A;  2ARS A;  2EYJ A;  3EQL C;  3HOX G;  1QIL A;  1SN8 A;  1VQP A;  2A68 D;  4YY3 L;  3HZX A;  2QCP X;  4Q0F A;  2UUA L;  5IP9 G;  3HOX B;  1HQR D;  3HOW H;  1LT5 D;  1NR2 A;  4WJW A;  1NMG A;  5CC4 A;  4FF3 A;  3I4M G;  2CJ9 A;  3V8L A;  1KC8 C;  4KY5 A;  4YDQ A;  4KHP L;  3I4N G;  3DLL A;  3HOZ G;  4TQF A;  4HED A;  2Z4H A;  3MXN B;  4NXN Q;  3A7A B;  3A74 A;  2PZT A;  1OXT A;  2ZJR A;  3K7U C;  3J7A V;  1LAB A;  4A3M H;  1VQD A;  5GAD C;  2B29 A;  1JWS D;  2E5A A;  1CK1 A;  4A3E B;  5D3I B;  5CBA E;  3T1Y L;  1TR5 A;  4KR2 A;  4A3D G;  5IOD A;  1HFN A;  3KLS A;  2AQ1 B;  1XJV A;  2ZJP A;  5EBC A;  2F0Q A;  5IP7 H;  4L63 B;  4U68 A;  2MUY A;  4R1J A;  1I4Q A;  1V1Q A;  4PG3 A;  1W66 A;  1ENA A;  1P8L A;  4N9P A;  4JBJ A;  4NMZ A;  1I4P A;  3LX0 A;  1CQV A;  5KRU A;  1H9R A;  3K5L A;  4A3I B;  3NBH B;  5C44 G;  3HRI A;  1SE8 A;  2ZR3 A;  4DV7 L;  4A76 A;  3J81 L;  4DR6 L;  3CPF A;  1PTO D;  4QQB X;  1TS5 A;  2Q8T A;  4A93 G;  1F2L A;  1M4V A;  1B7Y A;  3J80 i;  2JK8 A;  3GTG H;  1IKM A;  1JB7 A;  2E8G A;  2RQX A;  4FVM A;  3PCO A;  1DD2 A;  3A32 A;  3KK7 A;  4L6T B;  1C9O A;  1QB5 D;  2D62 A;  1WCM B;  1EIG A;  3A8K E;  4LFC Q;  2F0G A;  2C7I A;  2R7Z B;  2ZZE A;  3MHB A;  3IKM B;  2RDH A;  2VB3 X;  4XDX A;  4A4I A;  4BA1 I;  4E51 A;  4CH6 A;  3NBH A;  3PV0 A;  4QGU A;  1YIJ A;  3CCQ A;  4QL5 A;  5EGT A;  3M85 A;  2QDB A;  4A3E H;  5M9O A;  2VQF Q;  3FHW A;  1HNW L;  3S9W A;  2C35 B;  2EE1 A;  1FL0 A;  1OTC A;  2NWG A;  2JYO A;  4OO1 G;  1TII D;  5CV7 A;  3RZD B;  1ZEQ X;  4DU9 A;  2CGH A;  1E0B A;  4EO4 A;  5BN5 A;  1HQM C;  5K36 H;  1Y1W G;  1QCB D;  2KJX A;  3PUW A;  1KXL A;  1XWE A;  2B39 A;  3RZO B;  4YHH L;  3T16 A;  1ENF A;  3QWN A;  3BU2 A;  4ZQ3 A;  2VS1 A;  1KTK A;  3PO2 B;  2MHV A;  1J9O A;  4KKS A;  1SYE A;  3S1R H;  2XRQ D;  3NSW A;  4KR3 A;  1GUS A;  4DV3 Q;  1KLU D;  2D0O A;  3T1H L;  3D4R A;  3U9O A;  4G4K A;  3H3V I;  2ZTE A;  5ELB A;  2EJ9 A;  3CQZ H;  3P1H A;  4WI1 A;  3C3L A;  4HR7 B;  3H3V C;  1DM0 B;  1P16 A;  1UNS A;  5C0X H;  1HA6 A;  4GLV B;  4DAP A;  1I5F A;  2YTV A;  1MKH A;  2QW7 A;  4KN4 C;  1HXY D;  2O4X A;  5E4W C;  5FKA C;  1IBK L;  5I6Y A;  3UGQ A;  1BUV T;  4OIK A;  4NW2 A;  1B9N A;  5I4D A;  1I50 B;  4IQZ A;  4FF1 A;  3JAM E;  5FK9 C;  1EZ8 A;  2B2U A;  4LF9 L;  4BY7 B;  1ASY A;  3GTL B;  1J5E Q;  4DR2 L;  3GTQ H;  3FDT A;  4CHT B;  5K36 G;  2EXD A;  1ILP A;  3ERQ A;  3TBI B;  3K7A B;  3JAM c;  1CT1 D;  1F77 A;  4IN3 A;  2OF1 A;  1WTH A;  2JA8 H;  5IOC A;  3I73 A;  3R93 A;  2PNH A;  4DF7 A;  3HOV H;  5IYD H;  1XPU A;  1U5K A;  2PMZ E;  4P73 A;  4YWK A;  4C56 C;  5LHY 1;  1NMF A;  2F0V A;  4KV6 A;  3H15 A;  5JJI A;  3QO5 A;  2A5H A;  1EEF D;  1I6H H;  2DZC A;  2J0T D;  4J1M A;  5KYI A;  2NVX H;  2YU9 B;  4KY6 A;  1VQG A;  4LF5 L;  2WAQ E;  1PA6 A;  4LF8 Q;  1HZB A;  2R7Z H;  1G8Z D;  4DUY L;  1IYJ B;  1NNX A;  4KKU A;  3TRE A;  4MTN A;  4DV2 L;  1A3V A;  5KYL A;  3IL8 A;  1ESF A;  1MSH A;  3SDZ A;  4F7X A;  4EQ5 A;  3M3Y B;  3EN2 A;  1QE0 A;  3MXU A;  4IAL A;  1WPY A;  3UDX A;  1XPR A;  3CCL A;  1VQI A;  3UFG A;  1EY7 A;  2DN8 A;  3T53 B;  4AIM A;  4G7O C;  3P8T A;  4YPF A;  2L12 A;  4OHJ A;  4IUP A;  5J39 A;  1NUC A;  5A2Q E;  1EWH A;  1HZA A;  2K7V A;  4HCE A;  4N9T A;  4TVY A;  3MEH A;  3S1N B;  1XTD A;  2H1E A;  1E22 A;  2EYH A;  1GOZ A;  1PH2 A;  2DJZ A;  3EA6 A;  2A6H D;  1S4Z A;  1SNM A;  4XYO A;  2NS6 A;  1O7Z A;  4L5R C;  1JJC A;  3RLO A;  1E1T A;  3V7S A;  3C1E A;  4JI2 Q;  4IFD I;  4K5X A;  4DUY Q;  1G2S A;  2L4N A;  4S3S A;  4H2S A;  3BZC A;  1WD1 A;  3HXY A;  4B3R Q;  4H2X B;  4EVO A;  3V8J A;  5C4J H;  2CWA A;  4YRT A;  1UWV A;  3ZYY X;  3CCM A;  1TWG H;  4A3L H;  5IYC H;  3MWY W;  3JC6 6;  3J80 E;  1PVO A;  2XN9 C;  4LW1 A;  1NYQ A;  2QEJ C;  3HOY G;  1TWH H;  1E24 A;  4APV A;  2CH4 A;  2UXB L;  3A5Z A;  4F88 A;  1K8G A;  3D4W A;  1EYC A;  4EX5 A;  1TVX A;  4A3D B;  3E9I A;  2ZXF A;  1I3Q B;  2CWP A;  4GOP B;  2LXJ A;  4JYA L;  4IUN A;  3RNU A;  1Y69 U;  3I55 A;  1WLE A;  1E2V A;  4DK6 C;  4H0L C;  4P72 A;  4HIK A;  3VQX A;  3HY1 A;  4DV5 Q;  4BW9 A;  1IBK Q;  2XRS D;  4WJ3 M;  1BR9 A;  5IIF A;  2KBN A;  1IBM Q;  5JEA H;  3BDC A;  1HR0 W;  3AYH B;  2KCN A;  3QO2 A;  3SHL A;  2HT1 A;  2SNS A;  3K0Y A;  4XTC S;  1JOK A;  4ZLT F;  2R92 H;  4IPG A;  4KJO A;  5CBE E;  2AUK A;  3VDY A;  1WOC A;  4G85 A;  4GKJ L;  2WAQ G;  3A5U A;  4KMU C;  3U4Z A;  2Q5H A;  3P75 A;  3I4O A;  3OWE B;  2EYF A;  3MXN A;  1AW7 A;  1QWY A;  4DK1 A;  4Y52 H;  2Z9H A;  2F52 A;  4K2L A;  2OT2 A;  3J81 j;  2ZXR A;  3GP7 A;  5AJ3 L;  2JA6 H;  3H91 A;  4OWT B;  2ART A;  1MJE A;  4GKJ Q;  2ASB A;  3HTZ A;  4UHV A;  4DV5 L;  3M3Y H;  3NPP A;  1S5E D;  3E0J A;  1RHP A;  1HTP A;  3E9H A;  5CGK A;  1B50 A;  3HS0 C;  1KDC A;  4DR3 L;  2JSO A;  1WJJ A;  4DV0 Q;  1QVF A;  3U50 C;  2ZZF A;  3A31 A;  2K01 A;  1I3Q H;  4LF6 Q;  3TP7 A;  4RDX A;  1ESR A;  5JPN C;  3CRL C;  3K5M A;  2ZTC A;  3GTP H;  4WFN 3;  4QCL A;  2OCE A;  1VQO A;  1D2B A;  1V8Q A;  2L5T A;  2Z1C A;  1EWC A;  4HCS A;  3EBE A;  2A6E C;  3CC4 A;  4DR7 L;  1NBW A;  5EBD A;  1YGB A;  1SYC A;  1BDO A;  2DEQ A;  2UUB Q;  3VQV A;  3V05 A;  3DSQ A;  3PO3 H;  1JIC A;  3PQI A;  4QUF A;  2EY2 A;  4XQN A;  3I4M B;  1OXU A;  4R4Q A;  4CH4 A;  3OHX C;  1BCP D;  3W2D A;  2K32 A;  1EIH A;  3U9S A;  2DNE A;  4R4T A;  3AEV A;  4LVJ A;  2EYM A;  2X69 A;  3HG9 A;  3HOU G;  1FGB D;  3G71 A;  2SNM A;  3NP8 A;  2VQE L;  4KQE A;  2UUB L;  4Y7N H;  1PYW D;  1XMQ L;  1X56 A;  1IKL A;  4JI1 L;  2Q7E A;  1O7L A;  2HCC A;  3MXG A;  2BA0 A;  1IBL Q;  5J3B A;  3V7C A;  3GO5 A;  3BS1 A;  3I2Z A;  2FJ2 A;  4X5O A;  4POG A;  2XWB B;  2DJG C;  3D6C A;  4LVM A;  1TS3 A;  2EY5 A;  4CJ1 B;  4NP5 A;  1SJE D;  4OXP A;  4JI0 Q;  4LNQ A;  5IGC A;  3T4A C;  1T5X D;  1RTO A;  1B3A A;  5LL6 S;  3A7A A;  1S5D D;  3RAC A;  2CJA A;  4DAV A;  2K5Q A;  4GKK L;  4HVC A;  3K8A A;  2YV5 A;  1HH2 P;  5TSS A;  5K1X A;  2PNR C;  3S1M H;  2F4V Q;  3LSS A;  4I65 A;  2HDM A;  5M5X H;  3VR5 A;  2VW9 A;  1D5M C;  1VF5 C;  2EDG A;  3IRB A;  5C44 B;  1H9M A;  4JI4 Q;  3A56 A;  1LO5 D;  3V8K A;  2I5L X;  2VZA A;  2NUC A;  1NCV A;  2E5L L;  2HIV A;  2JEB I;  3A8I E;  1C8C A;  2K04 A;  5CV9 A;  5BR8 L;  1K0R A;  2DXU A;  3KF8 A;  3KDF A;  1PYB A;  2JJQ A;  2R6G A;  4JI2 L;  1GUT A;  1TT2 A;  4XU0 A;  1GUO A;  3LGJ A;  4GN3 B;  2J7Z A;  4PNY A;  3R8B A;  4CDC C;  4B3M Q;  1LTT D;  3D3R A;  3H0G G;  2F0E A;  3L2Z A;  4IPC A;  4R4C A;  3QG1 A;  4YCW A;  1G6P A;  1JOQ A;  2E2H H;  1X01 A;  1SER A;  4GOP A;  3ULJ A;  3JAM i;  2NVT B;  1J6Q A;  1I4X A;  2KCT A;  2EOT A;  2JA5 B;  2OTL A;  1TQO A;  1MIU A;  1G2T A;  3S16 H;  2MO0 A;  5CV4 A;  2X6L A;  3WOF A;  2WB1 B;  1IBL L;  1I4R A;  1PXU A;  3A5Y A;  2RSO A;  3LWU A;  1IYV A;  4B3T L;  1LT6 D;  1D5X C;  5DAU A;  4ZTZ B;  3JAM L;  2EVB A;  4CH3 A;  2NVQ H;  2A73 B;  4IO9 A;  1HRJ A;  1LT3 D;  4FF2 A;  1FR3 A;  1HTL D;  3LSQ A;  1HUN A;  3KJO A;  1MBY A;  1BBX C;  1YFS A;  4M1U B;  2IWH A;  4G84 A;  4H2Y A;  5CV8 A;  1PRT D;  4HJA A;  3K6O A;  3CXC A;  3F2D A;  3KFU A;  3CC2 A;  4X3U A;  4WF2 A;  2PZW A;  4OX9 Q;  2AWN A;  1YBY A;  4K86 A;  5FLX L;  4XU2 A;  3M7N A;  3PIO 3;  1CHP D;  2V1C C;  4IFD G;  3I3C A;  1N36 L;  3GTO B;  3CME A;  3KJP A;  5NUC A;  2K1B A;  1PTO C;  3L1A A;  5F5W A;  4GN4 B;  4NXN L;  4XT3 B;  4Q5V A;  2E2H B;  3RKX A;  3T13 A;  4HJ8 A;  3SK4 A;  3QO7 A;  3P20 A;  3X3M A;  2I4M A;  1PH7 A;  1MD2 D;  1CKO A;  4H2U A;  2C5C A;  1X3P A;  1VQ4 A;  2UXB Q;  1NJ2 A;  1A0I A;  2ZIN A;  3CCU A;  5M5W H;  3Q24 A;  1KRS A;  4DV1 L;  3CCV A;  2ENB A;  3MEY A;  4H13 C;  3QO8 A;  1CTM A;  2F0U A;  1NJI C;  4N8X 1;  2A19 A;  2FXQ A;  2KCM A;  1PH4 A;  2I5H A;  1XNR L;  1F2M A;  2XGT A;  5J22 A;  1EVL A;  4QJF A;  3PF5 A;  1D1I A;  4UP9 A;  3VA5 A;  1TS2 A;  1VQA A;  1PV4 A;  1H9S B;  3TP5 A;  4A93 B;  2K14 A;  1TWH B;  2L15 A;  2ZXP A;  1EZ6 A;  1EQR A;  1LT4 D;  4RH6 A;  1LM0 A;  1J5W A;  4A3D H;  3HRK A;  1BCP F;  1STB A;  1QF6 A;  1SYB A;  2N88 A;  1OO9 B;  3G48 A;  4JBK A;  1WCM H;  5GQO A;  1S5C D;  2DY8 A;  2CQA A;  1HR0 L;  2MQH A;  3GTO H;  2AKW A;  4K0K L;  1Q1E A;  3ND9 A;  3FEW X;  3RF1 A;  1TXY A;  3H3V H;  1VMC A;  1HZ9 A;  4R8I A;  1YFR A;  3RZD H;  3GTM H;  5C0X I;  3UDI A;  3FPP A;  3PO3 G;  4CKE A;  2A68 C;  4ZAI A;  1HR0 Q;  1RCV D;  3S15 B;  4LNS A;  2Q7H A;  2ZIO A;  1X54 A;  4ODG A;  5D3D A;  1LYL A;  2A69 C;  1ZYR D;  4XTX A;  1TKW B;  1B8A A;  2JA7 B;  1KD1 C;  3HOW G;  5LMN W;  3S1R B;  5ELO A;  4ZKC B;  4YRE A;  1CUK A;  1OXS C;  2ZNI A;  5M3F G;  5LMN Q;  1BCP B;  3RR5 A;  2DVE A;  1SRO A;  1L1O A;  3Q8D A;  1PZI D;  5ELE A;  4C3I G;  1PHJ A;  4KK7 A;  4YRK A;  1KMN A;  5BN4 A;  4KHP Q;  4DR7 Q;  3L4G B;  3FKI B;  3ND8 A;  4HWO A;  2K5W A;  2RA4 A;  1D7Q A;  1AH9 A;  4C2M H;  1FYF A;  4A3E G;  1I94 Q;  1EIY A;  4YRM A;  2DTH A;  1BCP C;  1KIX A;  1STN A;  5DM6 3;  3PIP A;  2DZ9 A;  2UU9 L;  1CM9 A;  5IT9 L;  1SR3 A;  1STE A;  1XMO Q;  2DGY A;  2AMC B;  3I56 A;  4B3M L;  3W5O A;  2F3W A;  2A6H C;  4JI1 Q;  4DV4 L;  4A3K G;  4K87 A;  4OWX B;  4FP5 D;  2B2T A;  3MVV A;  4WOR A;  2K33 A;  1N36 Q;  5IGB A;  5ELF A;  2V4D A;  3KLR A;  1YHQ A;  2UUC Q;  2PQE A;  3K7A H;  4UPA A;  3Q23 A;  4EQN A;  1EIF A;  1F9P A;  1N33 L;  3O13 A;  2HCI A;  4C3I H;  4A75 A;  3P7J A;  4JI6 Q;  4RKL A;  2YTY A;  5BN3 A;  3RLN A;  4A93 H;  1GM5 A;  3HOX H;  4Y7N B;  3CCE A;  1A63 A;  2Y0S G;  3HOU H;  2CIM A;  1TWA H;  3CD6 A;  2EWN A;  1X9N A;  4P74 C;  3BJU A;  1RTN A;  3KBG A;  1YIT A;  3A8J E;  5IYB G;  4H2V A;  3DM3 A;  3OTO L;  4YP0 A;  1EY4 A;  3IG2 A;  3HXU A;  2CKZ B;  3BG3 A;  5C4X G;  2EIF A;  1EQT A;  3S1Q H;  1O7Y A;  1ONL A;  1OXV A;  2E76 C;  3HOY H;  4DR4 Q;  4TRD A;  2ALY A;  5KGU A;  2O5I C;  4XTY A;  1F9Q A;  1R9T B;  2K05 A;  1HCZ A;  5CV5 A;  2FHT A;  1LUZ A;  4A3K H;  4IFD J;  2NZ1 D;  2KQ3 A;  4A3G G;  2F0P A;  4PZ6 A;  1QUQ A;  1VCI A;  1X3E A;  4DR2 Q;  1FNV A;  4DV2 Q;  2NVY H;  4A3F G;  2E3C A;  1WFQ A;  4LF4 Q;  2B2Y A;  4A3F B;  3BDL A;  5IYD G;  2PMF A;  2L1B A;  4DXF A;  1VQE A;  4JV5 L;  4MTK A;  5M5Y B;  2OQ0 A;  3OTO Q;  1WVL A;  3HFZ A;  4C1N I;  2ODR D;  1BOS A;  1WYD A;  3HP3 A;  2P5Z X;  2GN5 A;  4XT1 B;  2OTJ A;  4DA2 A;  4FXD A;  3KDF B;  1UE5 A;  2R92 G;  4B3T Q;  2E2J H;  4UP8 A;  3RGL A;  5C4J B;  3HFZ B;  1H9K A;  1X65 A;  5JAV A;  1B44 D;  5IGG A;  4XIG S;  3QR8 A;  2ZNJ A;  2IHF A;  2LKV A;  2NZO A;  1ENC A;  1KMM A;  2EJF A;  1LV9 A;  3OMG A;  1JE5 A;  1WTO A;  4CS3 A;  2DU7 A;  3A5Z B;  1K3B C;  4CH5 A;  4P3O A;  2F0T A;  2MGS A;  1BBU A;  2FIN B;  1NY4 A;  3OIQ A;  4OEM B;  4DV6 Q;  2CH4 W;  1NTG A;  3I70 A;  2C8M A;  1YI2 A;  2MFI A;  3NQT A;  2B2U C;  2DTI A;  3SXH A;  3A7L A;  2M2L A;  1HUM A;  1GUG A;  2QEX A;  1XNQ Q;  2BE5 C;  4PZ7 A;  3GTK B;  3HOV G;  4X65 Q;  2DDZ A;  1MHW C;  2MJ8 A;  2JN4 A;  1USY C;  3ICE A;  1F2Z A;  1ICF B;  4HWR A;  2WIN B;  1YEZ A;  5IYC G;  2J3L A;  1A2U A;  2JA9 A;  4U67 3;  1TWA B;  1GXD C;  2MPM A;  3BVG A;  3ONA B;  2IT1 A;  3EVQ A;  5M5Y H;  1K0S A;  3P8Y A;  2ZT7 A;  4FDB A;  1BNZ A;  4XTZ A;  4YHH Q;  4K6L A;  4LF5 Q;  3W3A A;  2EPB A;  3STB C;  1TS4 A;  1U4L A;  3A55 A;  4XTW A;  2F0J A;  2F03 A;  1B7Y B;  1K9M C;  2ALY B;  1K83 H;  4RGT A;  2KA7 A;  4C3H H;  3CQZ B;  4DV6 L;  2AQ3 B;  3T51 B;  3UE0 A;  1UE1 A;  2B3G A;  4NXM Q;  4LFC L;  3CCR A;  1CQF A;  5E1F A;  4K6D A;  4ALP A;  2CFM A;  1CI3 M;  4O2D A;  4LUZ A;  1MI2 A;  1F2Y A;  5FJ8 G;  2P5I A;  2Q2H A;  4B3S L;  1I4G A;  4LVK A;  1EY6 A;  3IFD A;  4FO2 A;  3HKS A;  3I4L A;  5FO9 B;  5KND A;  4IUU A;  5M5W B;  3S2D H;  3VR2 A;  1VS0 A;  2KHI A;  1PRT C;  3M4O B;  3ER0 A;  4P71 A;  4JBW A;  5AFW A;  1JJG A;  1WTX A;  4IUQ A;  2I4L A;  2JA7 G;  2DU5 A;  3KYH C;  4BBR H;  4RHS A;  5C3E G;  3L4G A;  3D31 A;  4CJ2 C;  1HTT A;  2E75 C;  3VQW A;  2O2L D;  3PUV A;  2Z6K A;  4XU1 A;  3TEH B;  5C3E B;  5DM7 3;  1GUW A;  2Q7G A;  1Y1W H;  5JJL A;  5E4X A;  1D5Z C;  3D0F A;  1E7Z A;  5FOB B;  2ZJQ A;  1YZ6 A;  2YTX A;  1YHB A;  1HC7 A;  3AMU A;  4YCV A;  4DV1 Q;  3R2T A;  2EAY A;  3J7Y W;  3J81 i;  2J3M A;  1LTR D;  1KRT A;  5H1S E;  4B3S Q;  1L0Y B;  1WQ7 A;  2QDL A;  1PH9 A;  4KLK A;  1FJG Q;  4BBS G;  1QJO A;  4JI5 Q;  2UXC Q;  1ZXT A;  2BDN A;  5C0X G;  1UE7 A;  3K0X A;  3FP9 A;  1BVS A;  3GTJ H;  4CKC A;  1O78 A;  4DUZ L;  1PH8 A;  4JYA Q;  1IL8 A;  1CHQ D;  5E3F A;  5FJ8 H;  3BZD B;  2E2I H;  4JI5 L;  2UXC L;  1HNW Q;  3LNN A;  2XSC A;  1ASZ A;  2XWJ B;  3SR1 A;  5CMD A;  1KDB A;  3K58 A;  1LTI D;  1H9S A;  2H4O A;  2KEC A;  2B2V A;  4OO1 I;  2ZZG A;  2HIX A;  3VBB A;  2ZT8 A;  3S2H B;  4CKB A;  5IGF A;  4A3I G;  5GAE C;  3F8T A;  1IZ6 A;  3X3N A;  2WV6 D;  3HEJ A;  3M4Y A;  4DR1 L;  5CYU A;  4Z9C B;  3QOJ A;  1BBW A;  1Z7M A;  3TME A;  1PDQ A;  2ID0 A;  1CKN A;  4HN7 A;  1FNW A;  4LUV A;  3FPU B;  4L5Q A;  4YCU A;  2B2T C;  5ELC A;  1EQV A;  1Y1V G;  3WWV A;  5C51 B;  4GLX A;  3OYY A;  2Q8R E;  3GTG B;  4LVI A;  1QE6 A;  4HT4 A;  2L0C A;  4DUZ Q;  2F4I A;  1A3T A;  2QIL A;  3QIA A;  3T56 B;  3NXW A;  4JOI A;  1VQK A;  1WTW A;  4OLF A;  4DAY B;  2F0L A;  4O42 A;  4A3J H;  3DM1 A;  4JI6 L;  3VA7 A;  1ICW A;  3CCJ A;  5JVG 3;  3F2C A;  4K5W A;  1H4Q A;  1UEA B;  2K5V A;  4DR5 Q;  4A3G H;  3CW2 C;  4X66 Q;  1PMR A;  1NNH A;  4XQQ A;  3N6R A;  3AB9 A;  4A3M G;  3QTC A;  4ZTU B;  1SE2 A;  2NN6 H;  3GDE A;  1EOT A;  2I0Q A;  4F87 A;  2IY5 A;  2KCC A;  1N32 L;  1OXX K;  3K80 C;  3J80 L;  1XTC D;  4P2C B;  4ZCK A;  5E7N A;  3S16 B;  1A62 A;  3BVM A;  1I6V C;  3ITP A;  3D8G A;  4AH6 A;  4RCO A;  4A3I H;  2R93 B;  3A7U A;  4RHR A;  4MNO A;  5LL6 X;  4KD3 A;  5K1P A;  1UAP A;  1S40 A;  4P72 C;  1KL9 A;  1B53 A;  2F0I A;  4B9X A;  1Y1W B;  4JI4 L;  5DNF A;  3HOU B;  1LTB D;  1AZP A;  4PQX A;  3CHB D;  1YB3 A;  1K73 C;  2R92 B;  3CC7 A;  3HXX A;  4HSV A;  1KLG D;  4AYB G;  3G6E A;  1WNL A;  2PMZ B;  3HXW A;  4DR6 Q;  2K28 A;  4DFA A;  1ADJ A;  3Q6S A;  4RFB A;  3V96 A;  1GO3 E;  4P3P A;  1GJX A;  3D4D A;  3G1Z A;  2NBF A;  1EY5 A;  1SNC A;  1K28 A;  4X6A H;  5F2D A;  3BZK A;  5FO8 B;  3F2B A;  4XU3 A;  2SDF A;  2BCO A;  2ZT6 A;  2EYO A;  4A3K B;  1STY A;  2JQO A;  1TY0 A;  1CFM A;  4DAM A;  1IL2 A;  1HA5 A;  4YWL A;  4R4O A;  1BIB A;  2F0N A;  5T1G A;  1B4O A;  5JJZ A;  1FJG L;  2XIW A;  5IGD A;  2EYP A;  3SEB A;  1VQL A;  4OEL B;  1H4S A;  2PW5 A;  4TTV A;  3OWF A;  1GHK A;  3RUZ A;  3TSS A;  2QF7 A;  3J7Z C;  2PPB C;  2Q2U A;  1YNJ D;  4UP7 A;  2EJG C;  1HFG A;  4QIW B;  3TS0 A;  2A8E A;  1STG A;  4CS4 A;  1PH6 A;  2HQE A;  4L5S A;  2AWO A;  1S3O A;  4UY8 C;  2WAQ B;  2F1M A;  3HOZ H;  5I9P A;  2Q2T A;  2DJF C;  2OXP A;  3AU7 A;  3EIV A;  4ME5 A;  1RL2 A;  4YRQ A;  2E2J B;  4GNX C;  1X2G A;  1Z6H A;  3I4M H;  4PMW A;  1SMX A;  2K6A A;  5IGE A;  5E3I A;  2H5X A;  4M8A A;  1AP0 A;  3W1G A;  5LMU Q;  4MHE A;  2OQK A;  1ZYR C;  2A69 D;  4RGO S;  1RJT A;  4Q6G A;  1WI5 A;  3J81 E;  2UXD L;  3UGT A;  4LF7 L;  3LC0 A;  2CVR A;  1USY A;  5I9O A;  3IAY A;  4A3C H;  1VDZ A;  4QF4 A;  2K4K A;  2WB1 G;  1SYG A;  2ZT9 C;  3MC0 B;  4JI0 L;  3GTM B;  5IT9 c;  2NN6 G;  1DOK A;  5IE8 A;  4DR3 Q;  1EY9 A;  2ODR C;  4IUV A;  1NR4 A;  1V43 A;  1GVP A;  3S1M B;  5HY6 A;  2RCN A;  1DXM A;  1BIA A;  1SDF A;  3I8Z A;  2ZTG A;  3OOC A;  4JCV E;  1S72 A;  3SK5 A;  3HXV A;  4R9W A;  3K57 A;  5LMU L;  3L9A X;  4OON A;  5IWA Q;  1VQM A;  2HNI A;  3KUP A;  1HHV A;  1DON A;  1SFO B;  3S14 B;  4X62 L;  3I72 A;  4PV1 C;  3I4N B;  3HOZ B;  1PYS A;  3RUX A;  1Y14 B;  4YY3 Q;  1XNR Q;  1YVC A;  1SMY C;  4DQ2 A;  4A3L G;  4P75 C;  3CRK C;  3SGI A;  4FXG C;  5K5P A;  2VY3 A;  4NB3 A;  5JPM C;  1ADY A;  2K5D A;  2VQE Q;  5JEA J;  1T9H A;  3W3S A;  3V7R A;  4YRR A;  1HPC A;  5C5M A;  1IW7 C;  1SNP A;  4BS9 A;  2F0W A;  4AQY L;  5J1Z A;  4E6I A;  4GNX A;  3OIP A;  1O80 A;  4BXX H;  2I4N A;  3S1N H;  3TP6 A;  3R2I A;  5CR3 A;  2G5D A;  1JMC A;  4BA2 I;  1PYS B;  4XEO A;  1NJ1 A;  4JI8 L;  5FLX c;  1WD0 A;  4KHV A;  1I94 L;  2KHS A;  2Y0S E;  4X3K A;  3SE0 A;  1PTO F;  1A15 A;  3J80 c;  3DHQ A;  1MSG A;  1IW7 D;  3NWT A;  5KEE A;  1EL0 A;  3WOE A;  4UAI A;  4HWP A;  4POF A;  4C3J B;  4QUC A;  1VMP A;  2ZTD A;  3E0E A;  3QJY A;  4KI0 A;  2VUM G;  5IY0 A;  4C1N K;  4XTV A;  1DCZ A;  3AQQ A;  1PFS A;  3RKY A;  4A3B B;  2AMC A;  1S5F D;  3EFS A;  1FVI A;  1Q1B A;  4QIW E;  4B3R L;  3NTI A;  2E41 A;  2DQ3 A;  3H0G B;  3K81 C;  5C5L A;  1Y8P B;  2AKW B;  4KD4 A;  3VYR A;  4BXX G;  1S5B D;  1EYD A;  4DXG A;  2CJB A;  1J5E L;  4JC0 A;  4QMG A;  1DOL A;  5C4X B;  3LWE A;  4HWT A;  4H7B A;  4LAA A;  4HWS A;  3CP0 A;  3L3O C;  2BE5 D;  2AQ2 B;  2D0P A;  3ULP A;  1I50 H;  1W6K A;  3WDN A;  1X55 A;  2R93 G;  5C4H A;  3MQZ A;  1ET9 A;  4K8I A;  4CJ0 B;  2EY6 A;  3PSI A;  4BY1 G;  4LWC A;  3CKI B;  4R8N A;  2GVA A;  4IPH A;  2B63 B;  4JBM A;  1VF7 A;  3PO2 H;  5EJW A;  1NJ6 A;  1KOG A;  2B63 G;  5COY A;  3DUZ A;  2ZGW A;  5HGQ A;  4R4I A;  4MN3 A;  3Q0A A;  1R4Q B;  2N49 A;  3L0O A;  4YRG A;  2N55 A;  1M1K C;  3DEO A;  1PZJ D;  2EYL A;  1LAC A;  3BYY B;  2NVX B;  1VQC A;  4JI7 Q;  2JE6 I;  1E1O A;  1F9R A;  4NCX A;  3UI2 A;  4TQD A;  1GD7 A;  4P3N A;  2PQA B;  2IL8 A;  3B6Y A;  1U0L A;  1TWC B;  3FRP B;  5T1I A;  4YYE A;  4HIM A;  1Z7N A;  2A8V A;  3RKW A;  3HXZ A;  3J7A 5;  5COR A;  1W2B A;  4BY7 G;  2RHQ B;  3CMQ A;  3FJP A;  4YRN A;  4GS3 A;  1RDP D;  1FD7 D;  4V19 0;  4DR4 L;  1SAP A;  3D6W A;  4RGM A;  1FNU A;  1SSO A;  3ERS X;  1JOR A;  4BY1 H;  5G3L D;  4YRC A;  3VYS A;  5A2Q L;  2K75 A;  3M9B A;  4G7H C;  1TWF B;  1FGU A;  3FVQ A;  1AE2 A;  1UUP A;  5M3M G;  3KF6 A;  1KAA A;  4EGV A;  2Z8L A;  3TN2 A;  3STB D;  3L2P A;  4GKK Q;  1Y8O B;  5M5X B;  3E6Z X;  1II3 A;  3VYU A;  5C6A A;  2E5L Q;  4C3J H;  1QG7 A;  3URY A;  4DR5 L;  2ARU A;  4K2K A;  4FYD A;  1VQ8 A;  2HHH L;  2PI2 E;  3RL6 A;  1N33 Q;  4JK1 C;  2YU9 H;  2Y0S B;  5FLX E;  1GGM A;  3OW7 A;  4JVZ A;  3NE5 B;  5C0X J;  4C3J G;  2VUM B;  3OMC A;  4K14 A;  1QNU A;  3F2U A;  1RIQ A;  2KEE A;  1V9P A;  1NJ8 A;  2N78 A;  2GVB A;  3TRZ A;  1JQY D;  4HJ7 A;  4IFD H;  1Y8N B;  5IWA L;  1XNQ L;  2F0M A;  1PFN A;  4K5V A;  3C46 A;  4FXK C;  2E10 A;  2BOS A;  4XYQ A;  3DWA A;  3IAL A;  3EFR A;  3MFY A;  1PFM A;  1JCK B;  2GA4 B;  3TP8 A;  4A3J G;  2FMC A;  4IOC A;  1QVC A;  4FNF A;  1AEX A;  3AFP A;  4K8J A;  1C7Y A;  3NTH A;  3UDF A;  3S24 A;  2G4C A;  2PZU A;  5IP7 G;  1JT8 A;  2NVT H;  4P73 C;  3UH0 A;  1HJP A;  1V1P A;  4JI7 L;  4GN5 A;  3M4P A;  3HKZ B;  1JC7 A;  1D6E C;  1PH3 A;  4JOI C;  3K5O A;  1K8A C;  1SBB B;  2G9H D;  2VL6 A;  2PI2 A;  3VYT A;  5D14 A;  2L9H A;  2F0K A;  3M4O H;  5JOB A;  3V2T A;  1C0A A;  1J8I A;  3QNE A;  5EQ0 A;  1A3U A;  3L7Z C;  4TQU S;  3PUX A;  1BQQ T;  1YNN C;  2IX0 A;  1N34 Q;  2UUC L;  4OP0 A;  2PME A;  1XXG A;  3R3O A;  3UE1 A;  2BDO A;  2WFW A;  2EJG A;  4KY7 A;  3AFQ A;  5GRO A;  1XPO A;  3CPW A;  2KUM A;  2CW0 D;  4B08 A;  1Q3L A;  4TWA A;  1EFI D;  1SJH D;  4DNT B;  3QB3 A;  3TUP A;  2F0H A;  4P74 A;  5CV6 A;  1Q7Y C;  5JVH 3;  1G91 A;  1WTP A;  4L87 A;  3OD1 A;  1Z7T A;  2R7F A;  1Q46 A;  2QHT A;  5FLM G;  3S1Q B;  2A74 C;  1YNX A;  3KF8 B;  4OO1 H;  1VQN A;  2FFK B;  1AN8 A;  1EWI A;  2WKD A;  2DQ0 A;  3EFX D;  1HNX Q;  2E65 A;  4J15 A;  2B2V C;  4TSS A;  3GTJ B;  4P75 A;  1YNN D;  1IHZ A;  2NVQ B;  11AS A;  3MZ5 A;  3NK9 A;  2JP1 A;  4ZIB A;  3M4Q A;  2R7D A;  2C9O A;  1CSQ A;  1H4V B;  2VNU D;  3REX A;  4X64 L;  2E64 A;  3F1Z A;  3K5N A;  4A3F H;  4NKL A;  1XMQ Q;  1Q82 C;  1SND A;  3N52 A;  2KED A;  2IY5 B;  5EKL A;  3G4S A;  2EQS A; 
#chains in the Genus database with same CATH homology
 5JJK A;  2OWO A;  4X64 Q;  4YRS A;  4JI8 Q;  3A0J A;  2YYZ A;  1PH1 A;  3PGZ A;  2DUD A;  1HNX L;  3TEH A;  3T1Y Q;  3CMA A;  1EIY B;  2F4V L;  1Z9F A;  3ZJY C;  4BY7 H;  3GTL H;  2KEN A;  3U58 A;  2VQF L;  2UU9 Q;  1N9W A;  1QZH A;  2CCZ A;  2P0L A;  4HA8 A;  1VQ6 A;  4DPG A;  4K88 A;  1VQ5 A;  4Q15 A;  3P8V A;  1EVK A;  1DGS A;  3HKZ G;  1B70 A;  1QZG A;  4H02 A;  2DTO A;  4DV7 Q;  4TVA A;  4YRO A;  3S15 H;  1UE6 A;  4LF8 L;  3HFV A;  4H2T A;  3RN2 A;  3VQY A;  3PUZ A;  4PZ8 A;  3PO2 G;  2PQA A;  1KAW A;  3H0G H;  1AE3 A;  3NEL A;  3UDG A;  4JI3 L;  5LMN L;  2JEA I;  3S17 H;  4HID A;  1L1O C;  1QVG A;  1HXD A;  3U4V A;  5GAG C;  5JEA G;  4NPS A;  4JG2 A;  1YJ9 A;  1HZC A;  5C44 H;  1X3F A;  3TEG A;  2A1A A;  3NET A;  1BKB A;  1K3R A;  5C53 B;  3PUY A;  2N3S A;  1X3G A;  3RN5 A;  4JI3 Q;  2BH8 A;  1YHA A;  2LXK A;  1VQZ A;  1X2H A;  4LFB Q;  1WCM G;  1Y1V H;  2IHE A;  5IYB H;  5M3F H;  4YRP A;  1KQS A;  3PIO A;  1X6O A;  3PF4 A;  1D8L A;  1VQF A;  1LTL A;  3W1B A;  4LF9 Q;  4GNX B;  1CSP A;  2MO1 A;  2Q5I A;  1YFT A;  1EOV A;  3HKZ E;  5FLM H;  1VQ7 A;  2UXD Q;  4DV3 L;  4LFA L;  3PCO B;  3GD7 A;  1KHI A;  1CKM A;  4YWM A;  4LFB L;  4X65 L;  1H95 A;  5AJ3 Q;  3RZO H;  2ZR2 A;  1SFO H;  3S14 H;  1W3S A;  3MF2 A;  4QY7 A;  1G5H A;  1L2F A;  4HJ9 A;  2BH2 A;  4LUO A;  4KHZ A;  2FYK A;  2IX1 A;  2ATW A;  3KF6 B;  1E3P A;  2RHS B;  4RMF A;  1R9T H;  4A3C G;  4OX9 L;  4P71 C;  3NEM A;  1N8R C;  3R07 A;  1MJC A;  4YRL A;  2JA8 G;  3ULL A;  3RLF A;  1RIP A;  2QHS A;  2K5H A;  4YRI A;  5GAH C;  5KNN A;  3NEN A;  3CF5 A;  2ZT5 A;  5BR8 Q;  3GTK H;  4LF4 L;  4A3B H;  4GLA C;  2HQL A;  3BFM A;  4HJ5 A;  1SRU A;  4A3B G;  1EYG A;  2CQO A;  1HNZ L;  2NN6 I;  2N8N A;  2K5N A;  1PH5 A;  2WB1 E;  1G5I A;  4L5T A;  4DV4 Q;  1M90 C;  4BBS H;  2R7Z G;  3ICA A;  1QUQ B;  4H2W A;  4X66 L;  2JA5 G;  4NXM L;  2QA4 A;  1Q8K A;  4O0A A;  1B76 A;  2B63 H;  4AYB E;  1O7I A;  2NZH A;  2WP8 J;  2JA7 H;  4H2X A;  4LVL A;  2AHO B;  1SET A;  3J81 c;  5DLQ E;  4RQF A;  4RG1 A;  4ME3 A;  1Q81 C;  2DKG A;  2E1H A;  4TVA B;  1B70 B;  1SRY A;  1YJW A;  5IP9 H;  12AS A;  1EUJ A;  1NJ5 A;  4YRJ A;  1Q86 C;  1NYR A;  4DNI A;  1TWC H;  2ZCE A;  2RF4 A;  1SLJ A;  1XMO L;  3HY0 A;  5ELN A;  2I5M X;  3WQZ A;  2ES2 A;  4IPD A;  2Z6K C;  1IBM L;  4DV0 L;  3KOJ A;  5M3M H;  2I4O A;  3REU A;  1JJC B;  1TWF H;  2Z0S A;  4DK3 C;  1IXR A;  4LF7 Q;  3I7F A;  1N32 Q;  3RIR A;  4XTU A;  1A8V A;  1VQH A;  2BA1 A;  4DR1 Q;  1EQQ A;  5C3E H;  2VUM H;  3TQY A;  1Q12 A;  4LFA Q;  2LSS A;  4RQE A;  1WQW A;  3ERR A;  1VQJ A;  1L1O B;  3I4N H;  1VQ9 A;  3A7R A;  4LF6 L;  1G29 1;  1ATI A;  2KHJ A;  4OWW B;  1CKN B;  3MF1 A;  2ZM6 Q;  2RHS A;  2K50 A;  1HNZ Q;  4YRF A;  3OW2 A;  3TS2 A;  3T1H Q;  3S2H H;  2EL9 A;  2QHV A;  1EFW A;  4GOP C;  4BWA A;  2XTI A;  3PZC A;  4BBR G;  2MNA A;  1Z47 A;  4XEM A;  4K0K Q;  3FKI G;  4PHC A;  4DKA C;  3MEF A;  2Q2I A;  4WJ4 A;  5C4X H;  1G51 A;  2R93 H;  1SES A;  2F3I A;  1VQB A;  2K52 A;  2RHQ A;  1YJN A;  2ZIM A;  5C52 B;  2QHU A;  4JV5 Q;  3CAM A;  2ZM6 L;  3CCS A;  4HIO A;  4TVW A;  1JJ2 A;  2HHH Q;  4X62 Q;  2QGQ A;  1WU7 A;  3FKI H;  1N34 L;  4IOA A;  1GKH A;  2UUA Q;  2JA6 G;  1UEB A;  1NE3 A;  4IJH A;  3IKL A;  2JA5 H;  5EAY A;  1H4T A;  4IJL A;  2DXT A;  4AQY Q;  4MZ9 A;  3KLW A;  4CS2 A;  1L0W A;  2ARS A;  3HOX G;  1SN8 A;  1VQP A;  4YY3 L;  2UUA L;  5IP9 G;  3HOW H;  1NMG A;  3I4M G;  2CJ9 A;  3V8L A;  1KC8 C;  4KHP L;  3I4N G;  3DLL A;  3HOZ G;  4TQF A;  3MXN B;  4NXN Q;  3A74 A;  1OXT A;  2ZJR A;  3K7U C;  4A3M H;  1VQD A;  5GAD C;  2B29 A;  2E5A A;  3T1Y L;  4KR2 A;  4A3D G;  1XJV A;  2ZJP A;  5IP7 H;  4R1J A;  1V1Q A;  4PG3 A;  1W66 A;  1P8L A;  4JBJ A;  3NBH B;  5C44 G;  3HRI A;  1SE8 A;  2ZR3 A;  4DV7 L;  4DR6 L;  4A76 A;  3CPF A;  4QQB X;  4A93 G;  1B7Y A;  3J80 i;  2JK8 A;  3GTG H;  1JB7 A;  2E8G A;  3PCO A;  3A32 A;  1C9O A;  2D62 A;  4LFC Q;  2C7I A;  2ZZE A;  3IKM B;  4A4I A;  4BA1 I;  4E51 A;  4CH6 A;  3PV0 A;  4QGU A;  1YIJ A;  3CCQ A;  4QL5 A;  3M85 A;  4A3E H;  2VQF Q;  3FHW A;  1HNW L;  2C35 B;  1OTC A;  1FL0 A;  4OO1 G;  2CGH A;  4EO4 A;  1Y1W G;  3PUW A;  1KXL A;  4YHH L;  3BU2 A;  2VS1 A;  3S1R H;  4KR3 A;  4DV3 Q;  2D0O A;  3T1H L;  3H3V I;  2ZTE A;  2EJ9 A;  3CQZ H;  4WI1 A;  1P16 A;  4GLV B;  1I5F A;  2YTV A;  1MKH A;  1IBK L;  3UGQ A;  4LF9 L;  1ASY A;  1J5E Q;  4DR2 L;  3GTQ H;  5K36 G;  2EXD A;  3JAM c;  2JA8 H;  2PNH A;  3HOV H;  5IYD H;  1XPU A;  1U5K A;  2PMZ E;  4P73 A;  4YWK A;  1NMF A;  3H15 A;  3QO5 A;  5JJI A;  1I6H H;  2DZC A;  2NVX H;  1VQG A;  4LF5 L;  2WAQ E;  1PA6 A;  4LF8 Q;  1HZB A;  2R7Z H;  4DUY L;  1IYJ B;  3TRE A;  4MTN A;  4DV2 L;  4EQ5 A;  3EN2 A;  1QE0 A;  1WPY A;  3UDX A;  1XPR A;  3CCL A;  1VQI A;  3UFG A;  3P8T A;  4AIM A;  4YPF A;  1HZA A;  4TVY A;  1XTD A;  1E22 A;  1PH2 A;  2DJZ A;  2NS6 A;  4L5R C;  1JJC A;  3RLO A;  1E1T A;  3V7S A;  4JI2 Q;  4IFD I;  4DUY Q;  4H2S A;  4H2X B;  3BZC A;  3HXY A;  4B3R Q;  3V8J A;  5C4J H;  2CWA A;  4YRT A;  1UWV A;  3CCM A;  1TWG H;  4A3L H;  5IYC H;  3JC6 6;  1PVO A;  1NYQ A;  4LW1 A;  3HOY G;  1TWH H;  1E24 A;  4APV A;  2UXB L;  3A5Z A;  1K8G A;  4EX5 A;  3E9I A;  2ZXF A;  2CWP A;  4GOP B;  2LXJ A;  4JYA L;  3RNU A;  3I55 A;  1WLE A;  4DK6 C;  4P72 A;  4HIK A;  3VQX A;  3HY1 A;  4DV5 Q;  4BW9 A;  1IBK Q;  4WJ3 M;  2KBN A;  1IBM Q;  1HR0 W;  3AYH B;  2HT1 A;  4XTC S;  2R92 H;  4IPG A;  3VDY A;  1WOC A;  4G85 A;  4GKJ L;  2WAQ G;  3A5U A;  3U4Z A;  2Q5H A;  3I4O A;  4Y52 H;  3RUX A;  3J81 j;  2F52 A;  4YDQ A;  5AJ3 L;  2JA6 H;  4OWT B;  2ART A;  1MJE A;  4GKJ Q;  2ASB A;  3HTZ A;  4DV5 L;  3M3Y H;  3E9H A;  4DR3 L;  4DV0 Q;  1WJJ A;  1QVF A;  2ZZF A;  3U50 C;  3A31 A;  1I3Q H;  4LF6 Q;  4RDX A;  2ZTC A;  3GTP H;  2OCE A;  1VQO A;  3EBE A;  4DR7 L;  3CC4 A;  1NBW A;  1YGB A;  2DEQ A;  2UUB Q;  3VQV A;  3DSQ A;  3PO3 H;  1OXU A;  4R4Q A;  4CH4 A;  4R4T A;  3AEV A;  4LVJ A;  3HOU G;  3G71 A;  2VQE L;  4KQE A;  2UUB L;  4Y7N H;  1XMQ L;  1X56 A;  4JI1 L;  2Q7E A;  2BA0 A;  1IBL Q;  5J3B A;  3V7C A;  3GO5 A;  3I2Z A;  4X5O A;  4POG A;  4LVM A;  4LNQ A;  4JI0 Q;  4OXP A;  3A7A A;  3RAC A;  2CJA A;  4GKK L;  4HVC A;  3K8A A;  2YV5 A;  1HH2 P;  5K1X A;  3S1M H;  2F4V Q;  3LSS A;  5M5X H;  2VW9 A;  3IRB A;  4JI4 Q;  3V8K A;  2I5L X;  2VZA A;  2E5L L;  2HIV A;  2JEB I;  5BR8 L;  1K0R A;  2DXU A;  3KDF A;  1PYB A;  2JJQ A;  2R6G A;  4JI2 L;  4XU0 A;  3LGJ A;  4GN3 B;  4B3M Q;  3H0G G;  3L2Z A;  4IPC A;  4R4C A;  4YCW A;  1G6P A;  1X01 A;  2E2H H;  1SER A;  4GOP A;  3ULJ A;  3JAM i;  1J6Q A;  2KCT A;  2OTL A;  1MIU A;  3S16 H;  2MO0 A;  1IBL L;  3A5Y A;  4B3T L;  4ZTZ B;  4CH3 A;  2NVQ H;  4IO9 A;  3LSQ A;  3KJO A;  1YFS A;  4G84 A;  4H2Y A;  4HJA A;  3CXC A;  3F2D A;  3KFU A;  3CC2 A;  4WF2 A;  4OX9 Q;  2AWN A;  1YBY A;  4K86 A;  4XU2 A;  3M7N A;  2V1C C;  4IFD G;  1N36 L;  3CME A;  3KJP A;  3L1A A;  5F5W A;  4GN4 B;  4NXN L;  3RKX A;  4HJ8 A;  3QO7 A;  2I4M A;  1PH7 A;  4H2U A;  1CKO A;  1VQ4 A;  2UXB Q;  1NJ2 A;  1A0I A;  2ZIN A;  3CCU A;  5M5W H;  1KRS A;  4DV1 L;  3CCV A;  3MEY A;  3QO8 A;  1NJI C;  2A19 A;  2FXQ A;  2KCM A;  1PH4 A;  2I5H A;  1XNR L;  1EVL A;  2XGT A;  4QJF A;  3PF5 A;  4UP9 A;  1VQA A;  1PV4 A;  2K14 A;  2L15 A;  1EQR A;  1LM0 A;  1J5W A;  4A3D H;  3HRK A;  1QF6 A;  3G48 A;  4JBK A;  1WCM H;  5GQO A;  1HR0 L;  2MQH A;  3GTO H;  2AKW A;  4K0K L;  1Q1E A;  3RF1 A;  1TXY A;  3H3V H;  1HZ9 A;  1YFR A;  3RZD H;  3GTM H;  5C0X I;  3UDI A;  3PO3 G;  1HR0 Q;  4LNS A;  2Q7H A;  2ZIO A;  1X54 A;  1LYL A;  4XTX A;  1B8A A;  1KD1 C;  3HOW G;  5LMN W;  5ELO A;  4YRE A;  1CUK A;  1OXS C;  2ZNI A;  5M3F G;  5LMN Q;  3RR5 A;  2DVE A;  1SRO A;  1L1O A;  3Q8D A;  1PHJ A;  4YRK A;  1KMN A;  4KHP Q;  4DR7 Q;  3L4G B;  4HWO A;  1D7Q A;  1AH9 A;  4C2M H;  1FYF A;  4A3E G;  1I94 Q;  1EIY A;  4YRM A;  2DTH A;  1KIX A;  3PIP A;  2DZ9 A;  2UU9 L;  1SR3 A;  1XMO Q;  2DGY A;  2AMC B;  3I56 A;  4B3M L;  3W5O A;  4JI1 Q;  4DV4 L;  4A3K G;  4K87 A;  4OWX B;  1N36 Q;  1YHQ A;  2UUC Q;  3K7A H;  4UPA A;  1EIF A;  1N33 L;  4C3I H;  4A75 A;  4JI6 Q;  2YTY A;  3RLN A;  4A93 H;  1GM5 A;  3HOX H;  3CCE A;  1A63 A;  2Y0S G;  3HOU H;  2CIM A;  1TWA H;  3CD6 A;  2EWN A;  1X9N A;  4P74 C;  3BJU A;  1YIT A;  5IYB G;  4H2V A;  3DM3 A;  4YP0 A;  3OTO L;  3IG2 A;  3HXU A;  2CKZ B;  5C4X G;  2EIF A;  3S1Q H;  1OXV A;  3HOY H;  4DR4 Q;  2ALY A;  4XTY A;  1LUZ A;  4A3K H;  4IFD J;  4A3G G;  4PZ6 A;  1QUQ A;  1VCI A;  1X3E A;  4DR2 Q;  4A3F G;  4DV2 Q;  2NVY H;  2E3C A;  1WFQ A;  4LF4 Q;  5IYD G;  2PMF A;  1VQE A;  4JV5 L;  2OQ0 A;  3OTO Q;  3HFZ A;  2ODR D;  1WYD A;  2GN5 A;  2OTJ A;  3KDF B;  1UE5 A;  2R92 G;  4B3T Q;  3RGL A;  4UP8 A;  2E2J H;  3HFZ B;  1X65 A;  4XIG S;  2ZNJ A;  2IHF A;  2NZO A;  1KMM A;  2EJF A;  1JE5 A;  4CS3 A;  2DU7 A;  3A5Z B;  4CH5 A;  4P3O A;  1BBU A;  1NY4 A;  4DV6 Q;  1NTG A;  2C8M A;  1YI2 A;  2MFI A;  2DTI A;  2QEX A;  1XNQ Q;  4PZ7 A;  3HOV G;  4X65 Q;  2DDZ A;  1USY C;  3ICE A;  4HWR A;  1YEZ A;  5IYC G;  2J3L A;  2JA9 A;  2IT1 A;  5M5Y H;  3P8Y A;  2ZT7 A;  4FDB A;  4XTZ A;  4YHH Q;  4LF5 Q;  3STB C;  4XTW A;  1B7Y B;  1K9M C;  2ALY B;  1K83 H;  4C3H H;  4DV6 L;  3UE0 A;  1UE1 A;  2B3G A;  4NXM Q;  4LFC L;  3CCR A;  4ALP A;  2CFM A;  4O2D A;  4LUZ A;  5FJ8 G;  2P5I A;  2Q2H A;  4B3S L;  4LVK A;  3HKS A;  3S2D H;  1VS0 A;  2KHI A;  3ER0 A;  4P71 A;  4JBW A;  1JJG A;  2I4L A;  2JA7 G;  2DU5 A;  3KYH C;  4BBR H;  5C3E G;  3L4G A;  3D31 A;  1HTT A;  3VQW A;  3PUV A;  2Z6K A;  4XU1 A;  3TEH B;  2Q7G A;  1Y1W H;  5JJL A;  3D0F A;  1E7Z A;  2ZJQ A;  1YZ6 A;  2YTX A;  1YHB A;  1HC7 A;  4YCV A;  4DV1 Q;  2EAY A;  3J81 i;  2J3M A;  1KRT A;  5H1S E;  4B3S Q;  1WQ7 A;  1PH9 A;  4KLK A;  1FJG Q;  4BBS G;  4JI5 Q;  2UXC Q;  5C0X G;  1UE7 A;  3K0X A;  3FP9 A;  1BVS A;  3GTJ H;  4DUZ L;  1PH8 A;  4JYA Q;  5FJ8 H;  2E2I H;  4JI5 L;  2UXC L;  1HNW Q;  1ASZ A;  2ZZG A;  3VBB A;  4OO1 I;  2HIX A;  2ZT8 A;  4A3I G;  5GAE C;  3F8T A;  1IZ6 A;  4DR1 L;  1Z7M A;  1BBW A;  2ID0 A;  1CKN A;  4LUV A;  4L5Q A;  4YCU A;  1Y1V G;  3WWV A;  5C51 B;  4GLX A;  3OYY A;  4LVI A;  4HT4 A;  4DUZ Q;  4JOI A;  1VQK A;  4OLF A;  4DAY B;  4A3J H;  4JI6 L;  3CCJ A;  3F2C A;  1H4Q A;  2K5V A;  4DR5 Q;  4A3G H;  3CW2 C;  4X66 Q;  1NNH A;  4A3M G;  3QTC A;  4ZTU B;  3GDE A;  2I0Q A;  2IY5 A;  1N32 L;  1OXX K;  3K80 C;  5E7N A;  1A62 A;  4AH6 A;  4A3I H;  3A7U A;  4MNO A;  5K1P A;  1S40 A;  4P72 C;  1KL9 A;  4JI4 L;  1YB3 A;  1K73 C;  3CC7 A;  3HXX A;  3G6E A;  4AYB G;  1WNL A;  3HXW A;  4DR6 Q;  1ADJ A;  1GO3 E;  4P3P A;  3G1Z A;  4X6A H;  3BZK A;  3F2B A;  4XU3 A;  2ZT6 A;  2JQO A;  4DAM A;  1IL2 A;  4YWL A;  4R4O A;  1BIB A;  1FJG L;  1VQL A;  1H4S A;  4TTV A;  3J7Z C;  2Q2U A;  4UP7 A;  3TS0 A;  2A8E A;  4CS4 A;  1PH6 A;  4L5S A;  2AWO A;  1S3O A;  4UY8 C;  3HOZ H;  2Q2T A;  4YRQ A;  3EIV A;  1RL2 A;  4GNX C;  1X2G A;  3I4M H;  4PMW A;  1SMX A;  5E3I A;  2H5X A;  3W1G A;  5LMU Q;  2OQK A;  4Q6G A;  1WI5 A;  2UXD L;  3UGT A;  4LF7 L;  3LC0 A;  1USY A;  4A3C H;  2K4K A;  2WB1 G;  4JI0 L;  5IT9 c;  2NN6 G;  4DR3 Q;  5IE8 A;  2ODR C;  1V43 A;  1GVP A;  5HY6 A;  2RCN A;  1BIA A;  2ZTG A;  4JCV E;  1S72 A;  3HXV A;  5LMU L;  4OON A;  5IWA Q;  1VQM A;  2HNI A;  4X62 L;  1PYS A;  1Y14 B;  4YY3 Q;  1XNR Q;  1YVC A;  4DQ2 A;  4A3L G;  4P75 C;  3SGI A;  2VY3 A;  4NB3 A;  1ADY A;  2VQE Q;  5JEA J;  1T9H A;  3W3S A;  3V7R A;  4YRR A;  4AQY L;  4GNX A;  4BXX H;  2I4N A;  3S1N H;  1JMC A;  4BA2 I;  1PYS B;  4XEO A;  1NJ1 A;  4JI8 L;  5FLX c;  1I94 L;  2Y0S E;  3J80 c;  4HWP A;  4POF A;  2VUM G;  3E0E A;  2ZTD A;  4KI0 A;  5IY0 A;  4XTV A;  3AQQ A;  1PFS A;  3RKY A;  2AMC A;  3EFS A;  1FVI A;  1Q1B A;  4QIW E;  4B3R L;  2E41 A;  2DQ3 A;  3K81 C;  2AKW B;  4BXX G;  2CJB A;  1J5E L;  4JC0 A;  4HWT A;  4HWS A;  3CP0 A;  2D0P A;  3ULP A;  1I50 H;  1X55 A;  2R93 G;  3MQZ A;  3PSI A;  4BY1 G;  4LWC A;  2GVA A;  4IPH A;  4JBM A;  3PO2 H;  1NJ6 A;  1KOG A;  2B63 G;  2ZGW A;  5HGQ A;  4R4I A;  2N49 A;  3L0O A;  4YRG A;  1M1K C;  1VQC A;  4JI7 Q;  2JE6 I;  1E1O A;  4NCX A;  4TQD A;  1GD7 A;  4P3N A;  2PQA B;  3B6Y A;  1U0L A;  4YYE A;  4HIM A;  1Z7N A;  2A8V A;  3RKW A;  3HXZ A;  3J7A 5;  1W2B A;  4BY7 G;  2RHQ B;  3CMQ A;  3FJP A;  4YRN A;  4GS3 A;  4DR4 L;  3ERS X;  4YRC A;  4BY1 H;  2K75 A;  3M9B A;  5M3M G;  1FGU A;  1AE2 A;  3KF6 A;  3L2P A;  3STB D;  4GKK Q;  2E5L Q;  4C3J H;  4DR5 L;  2ARU A;  1VQ8 A;  2HHH L;  2PI2 E;  3RL6 A;  1N33 Q;  2YU9 H;  1GGM A;  5C0X J;  1RIQ A;  1V9P A;  1NJ8 A;  2N78 A;  2GVB A;  3TRZ A;  4HJ7 A;  5IWA L;  1XNQ L;  2E10 A;  3IAL A;  3EFR A;  4A3J G;  4IOC A;  1QVC A;  3AFP A;  1C7Y A;  3UDF A;  3S24 A;  2G4C A;  5IP7 G;  1JT8 A;  2NVT H;  4P73 C;  3UH0 A;  1HJP A;  4JI7 L;  4GN5 A;  3M4P A;  1PH3 A;  4JOI C;  1K8A C;  2VL6 A;  2PI2 A;  3M4O H;  1C0A A;  3QNE A;  3L7Z C;  4TQU S;  3PUX A;  2IX0 A;  2PME A;  1N34 Q;  2UUC L;  4OP0 A;  3UE1 A;  2WFW A;  2EJG A;  3AFQ A;  5GRO A;  1XPO A;  3CPW A;  4TWA A;  3TUP A;  4P74 A;  1Q7Y C;  4L87 A;  3OD1 A;  2R7F A;  1Q46 A;  2QHT A;  5FLM G;  1YNX A;  3KF8 B;  1VQN A;  1EWI A;  2DQ0 A;  1HNX Q;  2E65 A;  4J15 A;  4P75 A;  11AS A;  4ZIB A;  3M4Q A;  2R7D A;  1CSQ A;  1H4V B;  2VNU D;  3REX A;  4X64 L;  2E64 A;  3F1Z A;  4A3F H;  1XMQ Q;  1Q82 C;  2IY5 B;  3G4S A;  2EQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...