3BJUA

Crystal structure of tetrameric form of human lysyl-trna synthetase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
507
structure length
503
Chain Sequence
SVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tetrameric form of human lysyl-tRNA synthetase: Implications for multisynthetase complex formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Lysyl-tRNA synthetase
total genus 160
structure length 503
sequence length 507
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.6: Lysine--tRNA ligase.
pdb deposition date 2007-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N)
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3bjuA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3bjuA02
4GLXA 2ZTCA 4DV6Q 5KNNA 5C3EH 1VQJA 1I50H 1YHQA 4GS3A 4JI1L 4A76A 2EJGA 3I2ZA 1SN8A 2UUBL 3NEMA 1KMMA 3GTMH 3CCRA 5C44H 2Q2HA 2E8GA 1SE8A 5C0XJ 5FJ8H 4XU2A 3LGJA 2E5LL 1EVLA 3TEHB 4NCXA 3HXVA 3MEYA 1BBUA 3EFRA 4PZ6A 3HOWH 5JJIA 1VQBA 1AE3A 4HVCA 1X54A 2IY5A 4GOPC 3RLNA 4XIGS 1Q82C 1GM5A 1WI5A 4UP9A 1VQKA 3B6YA 4JI7L 2R7ZH 3VQXA 4YRQA 1N34Q 3KFUA 3HOWG 1E7ZA 2JK8A 2ARUA 3L4GA 4A3BH 3PIOA 1NJ1A 4A3IH 4X65Q 4HIOA 2C35B 2XGTA 1K3RA 2HIXA 2Q7GA 3V7SA 5IT9c 4YRFA 1VQEA 3PCOA 3ERRA 4BWAA 4P73C 3U4VA 4YY3L 2BA0A 5IYDG 1GKHA 1SESA 2NZHA 1NYQA 1XMQQ 3UDIA 4JI6L 4TVAB 1KQSA 1XPOA 1HNWL 1IYJB 2ZNJA 1BKBA 4HWTA 1GD7A 3STBC 4PZ8A 3A5ZB 1YHBA 1Q86C 4AIMA 4QJFA 3IRBA 1HZ9A 2DKGA 1JT8A 1I6HH 4JI4L 2KCTA 3EBEA 3I4NG 2B63G 3RLFA 4DR6Q 1C9OA 4A3BG 5C0XI 1YZ6A 5H1SE 1QF6A 2ZINA 3ICAA 5K36G 2Q7HA 4YRNA 3IKLA 1CSQA 3RKYA 1U5KA 4XTCS 1RIQA 1RIPA 4GN3B 1HNXL 2FXQA 5M5WH 2ZM6L 2HIVA 1N33L 2UXCL 4A3LG 2MO0A 2R93H 3HY1A 1AE2A 1HJPA 5IWAQ 4P71C 3MF2A 2YTXA 2EQSA 1N32Q 4NXMQ 2IHEA 4LF6L 3K80C 4XTXA 4DR1L 3T1HQ 1B76A 1X3FA 2ZNIA 2K52A 4A3FG 4IPHA 1SMXA 1M1KC 1WJJA 4DR3Q 3J7ZC 4BY1H 3R07A 1B7YB 1VQPA 1JJCA 3AYHB 1YFSA 2J3MA 4X66L 2J3LA 4IJLA 3PO2G 5E3IA 2ZCEA 4AQYL 2NVYH 1YJNA 4LNQA 2JEAI 2NZOA 1EOVA 3K7AH 3A5YA 5BR8L 1HNWQ 5E7NA 4TQDA 4NXNQ 3J81c 2AMCB 2NVQH 3CMQA 3RNUA 2PNHA 5IP7H 1CUKA 3DLLA 2CIMA 4L5SA 4A3DH 4DV1L 5LMNQ 1XNQL 4X65L 2JJQA 1NY4A 1JJGA 3CCJA 2WFWA 1YEZA 3IKMB 4LFCQ 1YI2A 1OXUA 2B29A 4YRKA 3S15H 1WOCA 4LFBQ 2CFMA 2VY3A 4DR2Q 1UWVA 4LF8L 4KR3A 4OWXB 4CS2A 2YTVA 1PH3A 4B3MQ 2DTOA 2UUBQ 4O0AA 1EUJA 3W3SA 4LFBL 2MO1A 5HY6A 2DTHA 1BBWA 11ASA 4BY7H 2RHSA 4A93H 4JV5Q 4RDXA 3CC2A 4BY7G 4YPFA 2E5AA 2DDZA 1H4QA 1J5WA 4KHPL 1ASZA 3JAMi 4JBMA 3HXXA 1NMFA 4LF7L 4YRCA 2Q7EA 2Q2UA 3QNEA 1G5IA 3GTJH 3GD7A 1PH6A 4DQ2A 4LF6Q 4TVAA 4P75C 1SFOH 4HJ5A 1LYLA 4JBJA 2HHHQ 3WQZA 2ZJQA 1Y14B 1TWAH 4LWCA 4GOPA 2QEXA 1WCMH 4H2XA 3G48A 1H4TA 2RF4A 2YV5A 4YRLA 3U50C 3RZDH 1ADJA 4DNIA 3HOUG 3PUVA 1X6OA 3J80i 4DUYQ 4KQEA 3H15A 2PMFA 3VDYA 4DV2Q 3PO3H 4BW9A 1A0IA 4HA8A 4G85A 3CPWA 5EAYA 4DPGA 2HQLA 2K75A 1LM0A 4DV7Q 1VQ6A 2ODRC 4NXML 2Z0SA 1B8AA 1LUZA 1XNRQ 4LF4L 4GLAC 1VQLA 4OP0A 1YIJA 3REUA 2JA6H 3H0GH 4JI1Q 5IWAL 1VQHA 1I3QH 3H0GG 4JYAQ 2ZR3A 4DK6C 1ASYA 4X64L 4H2TA 2CWAA 1Q46A 1I94L 5IYBG 3PGZA 4Q15A 3A7AA 1X55A 5FLMG 4B3SQ 4A3KG 1WCMG 3T1HL 4H2VA 3TEGA 2OWOA 4OWTB 4IJHA 4X6AH 2OTLA 1WNLA 1W66A 2ZZGA 1NNHA 3RGLA 1Z9FA 1NJIC 2AHOB 4X62Q 3IG2A 4JG2A 4DUZL 2ZM6Q 2N78A 1L0WA 4JI0Q 2OTJA 2I5LX 4JI0L 1G291 1PFSA 3GTKH 2HNIA 4OX9Q 2KHIA 4R4TA 1S40A 5LMUQ 4EX5A 2GVBA 3TREA 1YJWA 2VQFL 4LUOA 1FJGL 4GNXA 3HOZH 4DR4Q 4Y52H 3CW2C 1MJEA 1H95A 4HJ7A 2UXDL 4JOIC 1KRTA 1V9PA 3J81i 1M90C 3W1BA 2I5MX 2JEBI 4RQEA 2BA1A 4PZ7A 2VL6A 4XTZA 3KLWA 1BVSA 2PQAB 3F2DA 2MNAA 2JA9A 1VQ5A 3EIVA 3E0EA 4EO4A 2KHJA 2P0LA 4P72A 2DZ9A 2AKWA 1E1OA 2PMZE 3MF1A 4X64Q 3ERSX 2IX1A 4DV5L 3HKZE 3KYHC 1FVIA 1W3SA 2ZT6A 1GO3E 4YRSA 1IBLL 4L5TA 2PI2A 4B3ML 3I7FA 4TWAA 1XNRL 4DKAC 1WFQA 3D31A 3F2CA 3GDEA 1MJCA 1NYRA 1X2GA 2BH8A 3PO2H 3MEFA 2HHHL 1VQIA 1YGBA 3GTOH 2F3IA 1V43A 1W2BA 3REXA 4OONA 2WB1G 2DU5A 4UPAA 3QO7A 2WB1E 1EFWA 1VQAA 1Y1WG 4B3RL 2F52A 3I4MH 1L2FA 4OWWB 1VS0A 2NVTH 2C8MA 2UXBQ 4POFA 1Q81C 2R7FA 4OO1I 3TUPA 3K8AA 4R4CA 4CH4A 1O7IA 3JC66 2ASBA 1JE5A 3I4NH 1VQCA 2EWNA 4A3MG 1Z7NA 5C3EG 1SRUA 3HXYA 3RACA 1EYGA 1VQ4A 2EL9A 3RUXA 3IALA 1J5EL 3OD1A 2WAQG 2R92G 1PA6A 1SERA 3UH0A 2EXDA 1EIFA 12ASA 4AYBG 1WLEA 4DV3L 4CH6A 2I4OA 3H3VI 3DM3A 4OLFA 3ULPA 4DK3C 4GKJL 4A93G 4NPSA 4DV4L 4XU1A 4LUZA 3I4OA 4DV4Q 1Z47A 3F2BA 3M4PA 2E1HA 4YRPA 3V8KA 3RL6A 2ALYA 3VBBA 1YJ9A 5M5YH 5IP7G 2ZXFA 1JMCA 4PHCA 5JEAJ 1PH8A 1HR0Q 2ZT5A 1EIYB 5IY0A 2AWNA 2Q2IA 4B3TQ 4DR7L 2D0PA 3L2PA 3HRIA 4KR2A 1VQOA 5M5XH 4BY1G 3M9BA 3CCSA 2ZZEA 1J5EQ 1U0LA 2K14A 1PHJA 4GN5A 4LF5L 2E2JH 3ULJA 2ZIOA 2CGHA 2GN5A 5IYCG 3HRKA 3PUXA 2KBNA 4XU0A 1EQRA 1KD1C 5IE8A 1HNZL 1A8VA 1SR3A 1Y1WH 1YFTA 1UE6A 1BIAA 4B3RQ 4H2UA 4HWSA 1MIUA 3A7RA 4DR3L 4TQUS 2ZTEA 1UEBA 2VQFQ 1VQDA 1PYSB 5FLXc 1E1TA 4A3IG 3E9IA 2UUAL 3BZCA 2E41A 3ULLA 5IYCH 4MNOA 4H2XB 4OXPA 2UXCQ 3CC7A 5LMNW 1N34L 4YYEA 2RHSB 3PUZA 1HNXQ 4LNSA 4YWLA 4JI2Q 1JB7A 3Q8DA 1KMNA 3KOJA 1E3PA 4PG3A 2RHQA 3AFPA 2ZR2A 3UE1A 5JJKA 4B3SL 3A5ZA 4OX9L 1KAWA 4WI1A 3KDFB 3CXCA 2DQ0A 2NN6G 5F5WA 3V8JA 2K50A 4LF4Q 1XMQL 2IX0A 4JI3L 2UXDQ 4GLVB 1IBLQ 2B63H 3CMEA 4IOAA 3S1NH 1PH9A 2IY5B 2ALYB 4TQFA 1KL9A 1Q1BA 2Y0SG 3CCUA 3DSQA 2XTIA 5J3BA 2DU7A 1X9NA 1FYFA 4DR5L 4DR4L 3CD6A 2QHSA 4TVWA 2NVXH 4BBRH 3HKZG 3NENA 1R9TH 4G84A 5ELNA 3M3YH 4JBWA 4RG1A 1NJ5A 2CQOA 3OYYA 2VUMH 4YWKA 3EN2A 4JI7Q 3RKXA 4A3CH 4A3MH 1XPUA 3I4MG 1SROA 1PYBA 4P3NA 3PO3G 4DUYL 4A3JH 2AKWB 4HWOA 4L87A 3VQVA 3I56A 2VW9A 3FKIH 4YRJA 1KXLA 2CCZA 2DQ3A 5HGQA 2EIFA 2QGQA 4QQBX 1N36L 2I4NA 3HOZG 2VUMG 1VQMA 1E22A 4YROA 2FYKA 3CCEA 4QIWE 3H3VH 5M3FG 3HOYH 3NETA 2Q2TA 2KCMA 1RL2A 3U4ZA 4JYAL 1TWGH 1KC8C 3WWVA 4QGUA 1TXYA 1HC7A 3AFQA 3ICEA 3F1ZA 4P72C 2C7IA 3V8LA 1CKMA 3HKSA 1USYC 3PV0A 2A19A 3G1ZA 2ZJPA 4LF7Q 3HFZB 4XTUA 2UU9Q 1X65A 3P8VA 3L2ZA 3CF5A 4P3OA 3HOVG 2YU9H 2JA8G 4DV6L 3TEHA 3LSSA 2K5HA 4XEMA 1SLJA 4JV5L 1FL0A 4NB3A 3L0OA 1DGSA 4DV0Q 2A8VA 2IHFA 1XTDA 4LF9Q 4K86A 3HOYG 5C4JH 2F4VQ 4A3EG 1CKOA 2ZT7A 2JA5H 2ARSA 1WQWA 2ZTGA 4BA2I 2AMCA 4YHHQ 1KHIA 1E24A 4DR2L 1XMOQ 3CCMA 4H2WA 1NBWA 3PIPA 3S1RH 3HOXG 4KHZA 4JI8L 1YNXA 1HZBA 1OTCA 4IFDJ 5FLMH 1P8LA 4XU3A 2RCNA 4POGA 4IPDA 2DXTA 2EAYA 4CH5A 1Y1VH 1P16A 4LF9L 4LFAL 3L7ZC 4X66Q 3UFGA 1YBYA 4C3HH 3J80c 1NTGA 1V1QA 4O2DA 4MTNA 2PQAA 3P8YA 4K0KQ 2UUCL 3BFMA 1QVGA 1XNQQ 3MXNB 1NMGA 1GVPA 1Q1EA 1OXSC 4TTVA 1VQ8A 1QUQB 1Y1VG 2CJ9A 5K1PA 2BH2A 2E2HH 4Q6GA 3STBD 2LXKA 1HZAA 5DLQE 2CJAA 3E9HA 4YCVA 4JI5L 4MZ9A 2JA6G 4AQYQ 2QHVA 3HXWA 2K5NA 4ZTUB 1N33Q 1OXXK 2OQ0A 5M3MG 3K81C 2L15A 1PH2A 3KDFA 1XJVA 2K5VA 2F4VL 1UE7A 4JI5Q 3VQWA 4BXXH 4UP7A 4DV7L 2VNUD 1OXVA 2UUAQ 5K1XA 5IP9H 1WPYA 2MQHA 3RKWA 1Q7YC 5GAEC 4ME3A 2E64A 1PH5A 2DZCA 1N8RC 3HXUA 4L5RC 3HXZA 1EQQA 3HY0A 4RMFA 2YTYA 1EVKA 3L1AA 3S14H 3HTZA 4IPCA 3ER0A 3NBHB 4XEOA 1B70B 2ATWA 1PH1A 4XTYA 3M7NA 1PVOA 1D7QA 3CP0A 2UUCQ 4A3DG 4Y7NH 3TRZA 3BZKA 4L5QA 3GTLH 2Q5HA 4JI3Q 2QHUA 1SETA 4GKJQ 1CSPA 2JE6I 2QHTA 2JQOA 4HJ9A 4UY8C 1YB3A 4HIKA 1D8LA 4QL5A 3RN2A 2GVAA 3S2HH 4R1JA 1HNZQ 4JC0A 1N9WA 4A3GH 1WYDA 1A62A 1FJGQ 4K0KL 4X62L 1X3EA 2PMEA 3UDFA 4WF2A 4YREA 2LXJA 4BBSH 1VQFA 3A32A 4PMWA 4A3CG 4IFDI 3KJPA 3S17H 3T1YL 2JA7G 3A0JA 4BA1I 4K88A 1A63A 1MKHA 2ODRD 1K83H 1X01A 1EIYA 2JA7H 1HR0L 1S3OA 3UDGA 1ADYA 3QO5A 4CS3A 1PH4A 3AQQA 2R93G 4A3LH 4KLKA 5ELOA 2DUDA 4APVA 2D0OA 2N49A 1G51A 4H2SA 1IBKQ 3A5UA 4P75A 4A3GG 4H2YA 4YHHL 3FJPA 4YRGA 4ZIBA 1IZ6A 2CKZB 2DJZA 2E5LQ 1FGUA 4ALPA 2ZZFA 1QZHA 1HTTA 1IBKL 3J7A5 4HIMA 2DTIA 2ID0A 4IO9A 1I94Q 3UGQA 2A1AA 3RIRA 4AH6A 3GTQH 3KF6A 3FP9A 4DV2L 2PI2E 1QVCA 3HFZA 4GNXB 4YWMA 2ARTA 2E65A 3M4QA 3PF4A 2DGYA 2UU9L 2YYZA 3BJUA 1L1OC 4DR1Q 5C44G 2ZTDA 2ES2A 4FDBA 4C2MH 4BBSG 1LTLA 3SGIA 2UXBL 4WJ3M 1NJ6A 2D62A 2ZT8A 3D0FA 3UE0A 2R7ZG 1YFRA 4C3IH 2R92H 3P8TA 2AWOA 1TWCH 1H4VB 5M3MH 2I0QA 5C52B 1C0AA 3S1QH 4X5OA 4A4IA 4BXXG 2WAQE 4ZTZB 1YITA 3JAMc 2Q5IA 2Z6KA 1NJ8A 5GAHC 1JJCB 4YRTA 5C53B 4DV1Q 1VQGA 3PF5A 2R7DA 1K0RA 1K9MC 1AH9A 3A74A 5FJ8G 5IYDH 3PCOB 4DR5Q 4DUZQ 1QZGA 2CWPA 4DAYB 5JEAG 1IL2A 3LSQA 1K8AC 3AEVA 5IP9G 4P3PA 4DV5Q 1IXRA 3K0XA 2V1CC 3LC0A 3V7CA 1VQ9A 2ZIMA 5C0XG 3CMAA 4P74A 4DAMA 1T9HA 1Z7MA 1HH2P 1X3GA 5GAGC 3S2DH 3W5OA 4DR7Q 3VQYA 1EWIA 4B3TL 3QO8A 5GQOA 2MFIA 5GADC 1G6PA 3V7RA 2R6GA 1UE5A 1HR0W 3CPFA 1OXTA 4A75A 4E51A 3G4SA 2JA5G 1KOGA 2IT1A 3UDXA 4HJAA 2NN6I 2HT1A 2VQEL 3CC4A 2P5IA 1H4SA 1S72A 4XTWA 2N3SA 2N8NA 1PYSA 3OW2A 4GKKQ 4QY7A 1KRSA 4JI2L 3FHWA 3HOXH 2I4MA 2E3CA 2H5XA 2WP8J 5LMUL 1IBMQ 3NELA 1NJ2A 4HIDA 4YCWA 5GROA 4H02A 3T1YQ 1QVFA 4P71A 3BU2A 3CQZH 5BR8Q 3PSIA 1L1OB 1BIBA 3QTCA 4LW1A 3PUWA 4LFAQ 2EJ9A 1SRYA 1VQZA 1XPRA 1HXDA 5C51B 2OCEA 1UE1A 3K7UC 1X2HA 3PZCA 4R4QA 3G71A 5AJ3Q 3A7UA 3OTOQ 3GTGH 1YHAA 3OTOL 4XTVA 4IOCA 4KI0A 1USYA 4HWPA 1JJ2A 5AJ3L 3RR5A 3F8TA 2G4CA 1XMOL 4P73A 1IBML 1QE0A 5M3FH 1K73C 4YDQA 1VQ7A 3S1MH 4DR6L 4YRIA 3I55A 4GKKL 4OO1G 4YRMA 3EFSA 1GGMA 2B3GA 3GTPH 4A3KH 5C4XH 2JA8H 4R4IA 4R4OA 4A3EH 3FKIG 3PUYA 2I4LA 4YCUA 3A31A 2VQEQ 2Y0SE 1CKNB 4BBRG 4DV3Q 4HWRA 1J6QA 1VQNA 3TQYA 4RQFA 3HOUH 3CCVA 3HOVH 3RZOH 4EQ5A 1KIXA 3TS0A 1K8GA 4UP8A 1ATIA 4NXNL 4A3JG 4JI4Q 2CJBA 4HJ8A 3RLOA 3W1GA 1CKNA 3ZJYC 4A3FH 3TS2A 4TVYA 3CCLA 5JJLA 4YP0A 4LF5Q 2LSSA 1G5HA 4LF8Q 1I5FA 2RHQB 4YY3Q 1NE3A 3CAMA 1PV4A 4WJ4A 2Z6KC 2E2IH 3L4GB 4JI6Q 1C7YA 4JBKA 1B7YA 4C3JH 3KF8B 3RN5A 2VZAA 4LFCL 4JI8Q 2QA4A 4GNXC 4JCVE 4IPGA 1VCIA 5LMNL 2DXUA 1PH7A 1L1OA 4GOPB 4K87A 4AYBE 4JOIA 2VS1A 1HZCA 5C4XG 1B70A 4DV0L 4CS4A 4GN4B 1Q8KA 3S16H 1N32L 1QUQA 1YVCA 3KF6B 1WQ7A 3M85A 1TWFH 2E10A 3HFVA 4LUVA 2OQKA 2I5HA 4P74C 1X56A 3J81j 2ZJRA 1TWHH 4IFDG 1WU7A 3M4OH 4YRRA 3GO5A 2K4KA 4J15A 3U58A 2KENA 3KJOA 3UGTA 3G6EA 3CCQA 4CH3A 3RF1A 4KHPQ 3S24A 2EJFA 1N36Q 2DEQA 2DVEA 1Q12A 2ZGWA 5IYBH
chains in the Genus database with same CATH superfamily
1LTTD 1RKNA 4GLXA 1EY7A 2ZTCA 4DV6Q 2K1BA 4TKOB 5KNNA 5C3EH 4NP5A 1VQJA 2KOLA 1I50H 1YHQA 4GS3A 2QKIC 4HAEA 4JI1L 3I2ZA 4A76A 4A3KB 1SN8A 1U4MA 3MC0B 1WTXA 2EE1A 1D2BA 2UUBL 1D5MC 3NEMA 3NWTA 3J81L 1KMMA 1GUNA 2FINB 3GTMH 3CCRA 1SSOA 1U4RA 5C44H 2Q2HA 2E8GA 4ZUIA 1QNKA 1SE8A 3URYA 4XXEA 5C0XJ 1TS5A 5FJ8H 4XU2A 3LGJA 2E5LL 1EVLA 1RTNA 3TEHB 4K8JA 4NCXA 3HXVA 3MEYA 4G7ZC 1BBUA 3EFRA 4PZ6A 3HOWH 5JJIA 3S16B 1VQBA 4CKCA 1AE3A 4HVCA 1X54A 2IY5A 4ZLTF 1KLGD 1FR3A 4GOPC 4C3HB 2RBMA 4K5VA 3RLNA 4XIGS 4BY1B 3I3CA 3LWEA 1Q82C 1GM5A 1WI5A 3GQBA 4UP9A 1D1IA 1VQKA 3B6YA 4OGQC 4JI7L 1B50A 1LLRD 2R7ZH 3FDTA 3VQXA 4YRQA 1N34Q 3KFUA 2B2VA 4FXGC 2K04A 2RSNA 1K8MA 3HOWG 1HQRD 1E7ZA 1Y8OB 1CQVA 2JK8A 5LL6S 2ARUA 3L4GA 1XYIA 1SE4A 3D4RA 1MGSA 4A3BH 1TQOA 3ZYYX 3PIOA 2F03A 1NJ1A 2L11A 4A3IH 4X65Q 1F2ZA 5CV8A 4HIOA 4JPBW 1SDFA 2C35B 1AEXA 2XGTA 4KD4A 1HFNA 2D5DA 2SNMA 1E2VA 1K3RA 2HIXA 2Q7GA 3V7SA 5IT9c 3KBGA 4K2LA 4YRFA 1Y8PB 1VQEA 3DM1A 1JQYD 2AUJD 4A3GB 3PCOA 1BOSA 3ERRA 4BWAA 4P73C 3U4VA 1PZID 4YY3L 2BA0A 5IYDG 4CDCC 1RD9D 1GKHA 1SESA 2NZHA 1CFMA 1NYQA 1XMQQ 3K0YA 3UDIA 4JI6L 3CHBD 2WAQB 4TVAB 1KQSA 1XPOA 2OEOA 1HNWL 1IYJB 5M5XB 2ZNJA 1BKBA 4HWTA 1GD7A 3STBC 4H44C 3IFDA 4PZ8A 3A5ZB 3WOEA 1DXMA 1YHBA 5BN3A 1Q86C 4AIMA 1TWHB 4QJFA 3IRBA 1HZ9A 2DKGA 1JT8A 1O78A 4RGTA 1I6HH 4KD3A 1LT5D 4JI4L 1Y1WB 1KTKA 2EY1A 4ZQ3A 2KCTA 3EBEA 3I4NG 2B63G 1FNUA 1S5ED 3RLFA 4DR6Q 1C9OA 4A3BG 5C0XI 1YZ6A 3ND8A 5H1SE 3NBHA 2JSOA 1QF6A 2ZINA 4I65A 3NPPA 4XDXA 2P5ZX 3ICAA 5K36G 2Q7HA 4YRNA 4FF2A 1SYCA 3IKLA 1CSQA 5C4HA 3RKYA 5F2DA 3HOWB 3R93A 1U5KA 2EJGC 4XTCS 1BUVT 4FXKC 1B1ZA 1RIPA 1RIQA 2F4IA 4GN3B 4ID6A 3C1FA 1HNXL 1Z6HA 2FXQA 1O80A 5M5WH 2ZM6L 3WDNA 2HIVA 1N33L 2UXCL 4A3LG 2MO0A 1JWSD 2R93H 3HY1A 1AE2A 1HJPA 3A55A 3RD4A 5C44B 5IWAQ 4P71C 1WTPA 3MF2A 2YTXA 2B2TA 1A2TA 2JP1A 2EQSA 2CW0D 1KLUD 2X6LA 2JA8B 4FO2A 4LVLA 3HOVB 1DONA 1N32Q 4NXMQ 4B9WA 2IHEA 5C3WA 4MIUA 3K80C 4LF6L 1H9MA 3MAQA 2L5TA 1G8ZD 4XTXA 2MP1A 4I7ZC 4DR1L 3T1HQ 3TSSA 1HFGA 2SDFA 4DN4M 1B76A 1X3FA 2K5DA 3HRZC 2ZNIA 2K52A 1PZJD 4JW0A 4A3FG 4IPHA 1PTOD 2TSSA 2K5WA 1SMXA 4A93B 4RWSC 1WJJA 1M1KC 2DN8A 3J80L 4DR3Q 3J7ZC 3G7LA 4BY1H 1LTSD 1HQMC 4IUPA 3R07A 4I7AA 4X3TA 1B7YB 1YNJD 2OXPA 5KYIA 1STHA 1VQPA 1JJCA 4RA8A 1SMYC 4P2CB 1SYBA 3AYHB 2Q8IB 1MI2A 1YFSA 2J3MA 4X66L 1CHPD 3X3MA 2J3LA 4IJLA 5C0XH 3PO2G 5E3IA 1H9SA 4RHRA 4BBRB 2ZCEA 4AQYL 3SHLA 2NVYH 5FKAC 1YJNA 4LNQA 5FO7B 3A8KE 2JEAI 5CORA 2NZOA 1EOVA 3K7AH 3A5YA 4EQNA 5BR8L 5DAUA 3TP7A 1HNWQ 5ELCA 3LNNA 2BE5C 1PFMA 5CBAE 5E7NA 1BF4A 3GV3A 4TQDA 4NXNQ 1EOTA 3J81c 3NSWA 2LMCB 1PRTF 2FHTA 1ESRA 3A7AB 3MXUA 2DJFC 4J8QA 4PMBA 2AMCB 3FKIB 1HTPA 2NVQH 3CMQA 2CH4W 3RNUA 2PNHA 5IP7H 1SMYD 4C2MB 1CUKA 3DLLA 1V1OA 2CIMA 2JN4A 4L5SA 2A6HC 5T1GA 1F9SA 2WV6D 1X3PA 5BN4A 3VR2A 4A3MB 4A3DH 4HCSA 4DV1L 5LMNQ 1XNQL 4X65L 2JJQA 1NY4A 1JJGA 5IGEA 3CCJA 3SR1A 2E2HB 2FFKB 1MHWC 3OIPA 2WFWA 1YEZA 4LFCQ 1LABA 1YI2A 3IKMB 4FNFA 1BO0A 1OXUA 2B29A 4DAPA 4YRKA 3E0JA 1BNZA 3S15H 3V2TA 1WOCA 4LFBQ 3OHXC 2CFMA 4RCNA 4KY6A 2JA6B 4RFBA 4O1NA 2Z4IA 4R8NA 3W2DA 2VY3A 4DR2Q 5KYLA 3KLSX 5EPJA 5CR3A 1UWVA 4LF8L 3J7YW 4KR3A 1PRTD 4OWXB 4CS2A 2YTVA 3OMCA 1PH3A 4B3MQ 2MGSA 2DTOA 2UUBQ 4O0AA 4G7OC 5M9OA 3IAYA 1EUJA 3W3SA 4LFBL 2MO1A 5HY6A 2DTHA 4NMZA 1BBWA 11ASA 3C1EA 3KBXA 4BY7H 1SJHD 2RHSA 4A93H 2Z1CA 3L9AX 2B63B 2K5QA 4JV5Q 4RDXA 4N8X1 1B3QA 3CC2A 4BY7G 4YPFA 3H0GB 2E5AA 2B2YC 4NDXA 2DDZA 1H4QA 1J5WA 4KHPL 1ASZA 2F0QA 3JAMi 1SBBB 4JBMA 2FJ2A 2MJ8A 3QJYA 4ZK9B 1WD0A 1H9JA 3HXXA 1E2WA 1NMFA 1EL0A 3K59A 4LF7L 1Z7TA 4YRCA 1A3VA 4FF4A 2BDNA 3M4YA 1BBXC 2Q2UA 3QNEA 5D3DA 3PQIA 2Q7EA 1PTOB 1O7LA 5D3IB 1G5IA 5CYUA 3GTJH 4ZYSA 4OELB 3GD7A 1PH6A 3HS0C 4DQ2A 2A6HD 1VDZA 4LF6Q 4TVAA 1EEFD 2PCFB 4P75C 1SFOH 4HJ5A 3QR8A 1XWEA 1LYLA 4JBJA 4O42A 2HHHQ 3WQZA 2ZJQA 4UHVA 1Y14B 1TWAH 4LWCA 1EZ8A 2PYKA 4GOPA 4F8MA 2QEXA 1WCMH 3DWAA 4H2XA 1ZYRC 3G48A 4EQOA 4QB4A 1H4TA 5C6AA 2RF4A 2YV5A 4YRLA 3U50C 3Q24A 3RZDH 1ADJA 1VF7A 4DNIA 3HOUG 1SNPA 1QILA 5NUCA 3PUVA 1I4PA 2QDLA 1AW7A 2X69A 1X6OA 3J80i 4DUYQ 4KQEA 3H15A 2PMFA 3VDYA 4DV2Q 3PO3H 4BW9A 1A0IA 4HMJA 4HA8A 4G85A 3CPWA 1JOOA 2WKCA 5EAYA 4DPGA 2HQLA 1XXGA 2K75A 1LM0A 1AFPA 4DV7Q 2ZXPA 2RDGA 1VQ6A 2ODRC 1T5XD 4ZAIA 4NXML 1KDAA 2Z0SA 4OIJA 1B8AA 1V8QA 3EFXD 1LUZA 1XNRQ 2NWGA 4LF4L 1I50B 3KUPA 2EYPA 4GLAC 1VQLA 4OP0A 1YIJA 3REUA 2JA6H 3H0GH 4JI1Q 5IWAL 2IL8A 3IL8A 1VQHA 2C5CA 1I3QH 5JEAH 4C3HG 3H0GG 3ND9A 4JYAQ 1Y69U 2ZR3A 4DK6C 2KECA 3GTOB 1ASYA 4DXFA 4JK1C 3I90A 1G2SA 4X64L 2CWAA 3K57A 1AZPA 1Q46A 4H2TA 2SEBD 4WRDA 1YNJC 1I94L 5IYBG 3PGZA 4Q15A 3A7AA 3K6OA 1HTLD 2F0UA 4DNRB 1NR2A 1X55A 5FLMG 4B3SQ 5KRUA 4A3KG 1WCMG 1Y1VB 4F7XA 3T1HL 4H2VA 1RTOA 5L37A 3TEGA 2OWOA 4OWTB 4IJHA 4X6AH 2OTLA 3TZDA 3D3RA 1WNLA 1W66A 2R3ZA 2ZZGA 1DYQA 3TBIB 1NNHA 3RGLA 1Z9FA 1NJIC 2AHOB 4X62Q 3IG2A 3C2PA 2EY2A 4JG2A 4Q0FA 4DUZL 2ZM6Q 2N78A 1L0WA 4JI0Q 2OTJA 4U68A 3VA7A 2I5LX 3BDOA 4JI0L 1G291 3W3AA 3EVQA 1PFSA 4OIKA 3GTKH 2HNIA 5M3FB 4ODGA 4OX9Q 4FVMA 2KHIA 4R4TA 4IFDH 4RGOS 4N8FA 3I70A 1S40A 5LMUQ 4EX5A 2GVBA 4LVMA 3TREA 3D4WA 1YJWA 2NS6A 1O7YA 2VQFL 4LUOA 5EQ0A 1FJGL 4GNXA 3HOZH 1PZKD 4QMGA 4DR4Q 3D8GA 5HGTA 4Y52H 3CW2C 4TSSA 1MJEA 3H91A 1H95A 4HJ7A 2UXDL 4JOIC 1KRTA 1V9PA 3J81i 1M90C 2RQXA 5IGGA 3S1RB 2DY7A 5EJWA 4HN7A 2I5MX 3W1BA 2Q8TA 2Z8LA 2JEBI 4A3EB 1I4HA 2G9DA 4RQEA 3PMFA 2BA1A 4XQQA 5FLXL 1SFOB 4ZKCB 4L63B 4PZ7A 1H9KA 2F0NA 2VL6A 1H9SB 4L8JA 4XTZA 1NNXA 3KLWA 2NBFA 1BVSA 2PQAB 1D5XC 3F2DA 5IT9E 2MNAA 2Y0SB 2JA9A 3HKZB 4IUVA 1DZ1A 1VQ5A 4HR7B 3EIVA 2MPMA 4QF4A 5CV7A 1KNAA 4XQJA 3E0EA 3C46A 2L4NA 3TP6A 4EO4A 2KHJA 2P0LA 4P72A 2DZ9A 2AKWA 1SYFA 1E1OA 3VR3A 2QCPX 2PMZE 1J8IA 3MF1A 5CMDA 1F9RA 2WACA 3V96A 1WTWA 4X64Q 3ERSX 4DAVA 1SE3A 5I6YA 2IX1A 4CHTB 1Q3LA 4DV5L 2M9VA 3HKZE 3KYHC 2CVRA 3ERQA 1FVIA 1SNCA 1W3SA 1X3QA 2ZT6A 4IQZA 5CV6A 3X3NA 1GO3E 4YRSA 1TS2A 1IBLL 4L5TA 2PI2A 2HCCA 3I7FA 4YIJA 4B3ML 4TWAA 1GUSA 2OF1A 1XNRL 4LVJA 4DKAC 3D4DA 3J7AV 1WFQA 3D31A 5FLXE 3F2CA 3GDEA 1MJCA 1NYRA 1RJTA 3MVVA 1X2GA 1TU2B 2BH8A 1QB5D 4ME5A 3VA5A 3PO2H 3MEFA 2HHHL 4KN4C 2BOSA 1VQIA 4N9PA 4NW2A 1YGBA 5M5YB 3GTOH 2ICEC 4CBVA 2F3IA 1V43A 1EZ6A 1W2BA 3REXA 4OONA 3J80E 2WB1G 2KHSA 2DU5A 5K36H 1SAPA 1PYWD 4UPAA 5FOBB 3QO7A 2WB1E 1JWMD 3FEWX 1EFWA 3DHQA 1VQAA 2B8FA 2NTTA 1Y1WG 1LTAD 2I46A 3MXNA 2ZXOA 4B3RL 1AP0A 2F52A 3I91A 3I4MH 2IJ0A 3SK8A 1L2FA 4OWWB 1SYEA 1I3QB 1S4ZA 1VS0A 4A3BB 3BDCA 2NVTH 1TVXA 2C8MA 2NB0A 2UXBQ 3TP8A 3H3VC 4POFA 1Q81C 2R7FA 4OO1I 3TUPA 3K8AA 4R4CA 3TZUA 2E2JB 4CH4A 3EA6A 1O7IA 3LWUA 3JC66 2SOBA 2G9HD 1JE5A 2ASBA 1VQCA 3I4NH 2EWNA 4A3MG 2QW7A 5KNCA 4XT1B 5FK9C 2D9UA 2RDHA 1Z7NA 5C3EG 1SRUA 5D65A 2CH4A 3M4OB 2NVYB 3HXYA 2B2WC 1EU3A 1F2LA 3A54A 3RACA 4LMQD 1EYGA 4QIWB 2XRQD 1VQ4A 2QILA 1PFNA 1S5BD 2EL9A 3RUXA 3IALA 1STNA 2F0WA 1J5EL 1HA6A 2PW5A 3OD1A 2WAQG 4G4KA 3FPUB 1PTOH 4C3IG 2R92G 5I6WA 1PA6A 1SERA 2RVLA 2EXDA 1BQQT 2ICIA 3UH0A 1EIFA 1SE2A 5IIFA 12ASA 3GTGB 4IUUA 2KA7A 1ICFB 3OSOA 1HRJA 1JR0D 4RHSA 4AYBG 4CGYB 1WLEA 2AQ2B 4DV3L 1EWHA 4CH6A 4DU9A 2I4OA 3H3VI 3DM3A 4OLFA 3ULPA 4DK3C 3I8ZA 4GKJL 4A93G 4V0BA 4NPSA 1WTVA 2D2CC 4DV4L 4XU1A 4LUZA 1EY4A 3T16A 5EPLA 3I4OA 4DV4Q 2A5HA 3MTSA 1Z47A 3F2BA 2SNSA 3M4PA 2E1HA 4YRPA 3RUZA 3V8KA 1DD2A 2CHBD 3VR6A 3I72A 3BYYB 2PO4A 3RL6A 1LTID 2ALYA 3VBBA 2LFNA 1YJ9A 5M5YH 2K03A 5IP7G 3BYTB 5EPKA 1GUOA 2F0TA 1CZWA 4X3SA 2ZXFA 1JMCA 3AB9A 4DA2A 5JEAJ 1TWAB 5E4WC 1PH8A 4PHCA 1HR0Q 2ZT5A 1SEBD 1EIYB 5IY0A 2AWNA 2Q2IA 4B3TQ 2D0PA 3HEJA 4DR7L 1LTBD 2EY5A 3QO2A 3L2PA 3HRIA 4KR2A 1VQOA 5M5XH 4BY1G 4H7BA 3PIP3 5JOBA 3M9BA 3RZDB 1EY8A 1KDBA 2KQ3A 3R2IA 3CCSA 2ZZEA 3MXPA 2L9HA 4BWGB 1J5EQ 4KMUC 1U0LA 2K14A 5J39A 1PHJA 4GN5A 4KKTA 4LF5L 2E2JH 1Y8NB 3ULJA 1ZEQX 2ZIOA 2CGHA 4PMCA 4LAAA 2GN5A 1Q90A 1M8AA 2NVTB 1RCVD 1ESFA 3ONAB 2A69C 1SNOA 5IYCG 3DMUA 3Q23A 3HRKA 1MSGA 2EXZA 1SXTA 3PUXA 2KBNA 4DK0A 4XU0A 1C8CA 4MN3A 5ELFA 1EQRA 1KD1C 1EYCA 2A8EA 1EWCA 2KCNA 5IE8A 1V1PB 2F0HA 3NBIA 1HNZL 4KV6A 1EY6A 1A8VA 1LO5D 1B9NA 1SR3A 4G57A 3SE0A 1Y1WH 1UE6A 1YFTA 1BIAA 3WOFA 4B3RQ 4H2UA 4HWSA 1MIUA 3A7RA 4V190 4DR3L 4TQUS 5KNBA 1DJRD 2O2LD 1IL8A 2ZTEA 1UEBA 3N6RA 2VQFQ 5I9PA 1VQDA 1LTGD 1PRTB 1PYSB 1ZKOA 5IGBA 2DJGC 3OWFA 3K5LA 1FGBD 5FLXc 4ZCKA 5EGTA 2R93B 3OIQA 1E1TA 1QE6A 3I73A 3GTLB 4A3IG 1WTHA 3E9IA 5ELEA 2UUAL 1ONLA 3BZCA 2J0TD 3NE5B 2E41A 3ULLA 4ABNA 5IYCH 1KAAA 4MNOA 4H2XB 2CQAA 3MQZA 1SJED 4OXPA 1CHQD 4IN3A 4F87A 2NVQB 2UXCQ 3CC7A 2IPKD 5LMNW 1N34L 4YYEA 2RHSB 2PW7A 1IKLA 3KF8A 3S2HB 3PUZA 1HNXQ 4LNSA 2HDMA 3KK7A 4YWLA 2EJGA 4JI2Q 1JB7A 3Q8DA 1KMNA 3KOJA 5FO9B 1E3PA 3TP5A 4PG3A 2RHQA 5JVH3 3AFPA 2ZR2A 3UE1A 5JJKA 4B3SL 2KJXA 3AU7A 3NWSA 2HUGA 3K7AB 2EOTA 3D6WA 3A5ZA 4OX9L 1ILPA 4ZRZA 1KAWA 1B9MA 4WI1A 2QEJC 1I4XA 3KDFB 3CXCA 4KTAA 2DQ0A 2NN6G 5F5WA 3V8JA 2K50A 4LF4Q 1XMQL 5COYA 2IX0A 4JI3L 4BY7B 2UXDQ 4ULLA 4GLVB 4ZUJA 5K5PA 1VMCA 1IBLQ 4RKLA 2B63H 3CMEA 2F3VA 1U4LA 4IOAA 3S1NH 1PH9A 2IY5B 1PTOF 2E75C 2ALYB 4TQFA 4LVKA 1KL9A 1Q1BA 2Y0SG 3CCUA 3LX0A 3DSQA 2XTIA 5J3BA 1JB3A 2DU7A 1X9NA 2QF7A 4DR5L 1FYFA 5J22A 4DR4L 3CD6A 2QHSA 4TVWA 2NVXH 1EQTA 5JPMC 3M7GA 2E74C 3MA2B 4S3SA 4BBRH 1PRTC 3DEOA 3HKZG 3K5OA 3MEHA 3NENA 2V4DA 1R9TH 4RH6A 5I4DA 4G84A 5ELNA 3M3YH 4JBWA 4RG1A 1NJ5A 2CQOA 1QOHA 2F0EA 1ENAA 3OYYA 5E1FA 2VUMH 5IGCA 4YWKA 3EN2A 4JI7Q 1JWUD 2VB2X 1UNSA 3RKXA 1EFID 2PMZB 4A3CH 4KJNA 4A3MH 1XPUA 4CDFC 3GP7A 3I4MG 1V1PA 1SROA 4IALA 1PYBA 2WKDA 4P3NA 3PO3G 4DUYL 4DGZA 4A3JH 2AKWB 4HWOA 4L87A 3VQVA 3JAML 2F3WA 3I56A 5DM63 2VW9A 3FKIH 4YRJA 5JJZA 1E2ZA 1GUGA 2EYLA 1KXLA 2CCZA 1G91A 2DQ3A 5HGQA 2EIFA 2A69D 1HXYD 2QGQA 1STAA 3DXJC 4QQBX 1N36L 2I4NA 2KEEA 3NXWA 3HOZG 3KLRA 3QG1A 4RGMA 1VQMA 1MBYA 2VUMG 1E22A 2JA7B 1GXDC 4YROA 2FYKA 3CCEA 4QIWE 3H3VH 5M3FG 5C4XB 2RCFA 1I4QA 1WTQA 3HOYH 3NETA 4X3UA 4U673 1I6VC 4C3JG 2XRSD 2Q2TA 2KCMA 1RL2A 3U4ZA 4LVIA 4JYAL 2AQ3B 5LHY1 1TWGH 1KC8C 3WWVA 1DOKA 2B2YA 5JPNC 4QGUA 3P75A 1TXYA 1HC7A 3AFQA 2PZTA 3ICEA 4KY5A 1ENFA 3F1ZA 2M2LA 4QUCA 4QCLA 1G2TA 4P72C 2C7IA 3V8LA 4CJ1B 1CKMA 1JC7A 3HKSA 2K7VA 1USYC 3PV0A 1TIID 1R4PB 2RDFA 1UEAB 2A19A 2K01A 3G1ZA 3CU7A 1WCMB 2ZJPA 3DEPA 1S5CD 4LF7Q 5A2QE 3HFZB 4XTUA 1WTRA 1IYUA 2UU9Q 1X65A 3P8VA 3L2ZA 1F9QA 3CF5A 4P3OA 5C5LA 3HOVG 2YU9H 2E2IB 2JA8G 5CGKA 4DV6L 3TEHA 4OEMB 4CDDC 5I2YA 3LSSA 2K5HA 2PQEA 4XEMA 1SLJA 4JV5L 2JYOA 1FL0A 4NB3A 3L0OA 1DGSA 4DV0Q 3DWPA 3BZDB 1BCPB 2A8VA 2H1EA 2IHFA 1EY5A 1FNWA 1XTDA 4LF9Q 3VYTA 3HOUB 3BVZA 2J7ZA 4K86A 2IX3A 3HOYG 2A68C 4C3JB 5DM73 5C4JH 1XX8A 3GTKB 5LL6X 2F4VQ 2E2DC 4A3EG 1A3TA 1CKOA 2ZT7A 2JA5H 2ARSA 2EJMA 1WQWA 5JAVA 2ZTGA 4BA2I 1GHKA 2VUMB 3CRLC 4C1NI 2HDLA 1I6HB 2AMCA 2XVSA 3H6MA 3E3XA 4YHHQ 1KHIA 2PNRC 1U4PA 1E24A 4DR2L 1EY0A 1XMOQ 3T51B 2EPBA 5ISRA 3CCMA 1W6KA 1GUTA 4K6DA 4H2WA 1NBWA 3PIPA 1XTCD 3S1RH 3HOXG 2JXMB 3HOYB 4KHZA 1TWFB 2CW0C 1ML0D 4JI8L 1YNXA 1HZBA 3K5NA 3N52A 4ILWA 1OTCA 1D1KA 1M4VA 2RA4A 3K5MA 2RSOA 4IFDJ 5M3MB 3CRKC 1A3UA 3QOJA 3P20A 5FLMH 3F2UA 1P8LA 4XU3A 2RCNA 1WTOA 4POGA 1TS4A 4IPDA 2DXTA 2EAYA 4CH5A 1RDPD 1Y1VH 4DXGA 3VYUA 1P16A 2RKSA 4LF9L 4LFAL 3H09A 1STEA 3NHHA 1BCPD 3L7ZC 4X66Q 2WIIB 1TT2A 3UFGA 1OO9B 1YBYA 4C3HH 1EIGA 3J80c 1NTGA 1V1QA 1PDQA 4O2DA 4MTNA 2PQAA 3P8YA 4K0KQ 2UUCL 1K28A 3BFMA 2C9OA 1QVGA 1EYDA 1XNQQ 3MXNB 1NMGA 1Q8IA 2AQ1B 3L3OC 1EIHA 1GVPA 3BVGA 2Z4HA 1Q1EA 1OXSC 4TTVA 1VQ8A 5EKLA 1QUQB 1Y1VG 3OPOA 2CJ9A 5K1PA 2BH2A 1I4RA 2E2HH 1B2TA 4Q6GA 3STBD 2LXKA 1F2YA 1HZAA 5DLQE 1WVLA 3MFGA 2CJAA 3E9HA 3EROA 4YCVA 4JI5L 4MZ9A 2JA6G 3S9WA 2IWHA 4AQYQ 2F0GA 5EKIA 3BS1A 2QHVA 3HXWA 2K5NA 4ZTUB 4WFN3 1N33Q 3HOZB 1OXXK 1VMPA 2R7ZB 2OQ0A 5M3MG 5KGUA 3K81C 4UDUC 2L15A 1PH2A 3KDFA 4OHJA 1XJVA 2K5VA 2F4VL 1UE7A 3SK5A 1KABA 4MHEA 1ZYRD 4JI5Q 3HP3A 3VQWA 3GTMB 4BXXH 1STYA 5C3XA 4FP5D 4UP7A 4DV7L 2VNUD 1OXVA 2UUAQ 5K1XA 5IP9H 3S17B 1WPYA 3NP8A 2MQHA 3RKWA 2F0LA 1HUNA 1Q7YC 5GAEC 1YNNC 4ME3A 1DOMA 2E64A 4F88A 1PH5A 3J7AF 2DZCA 3BDLA 1N8RC 3HXUA 4L5RC 4HMIA 1BCPC 1K3BC 3VR5A 2VB3X 1CQFA 4DFAA 3HXZA 1MSHA 1EQQA 3HY0A 4RMFA 2YTYA 4AYBB 1ZXTA 4CDEC 1EVKA 3L1AA 2A6ED 5C5MA 3S14H 3HTZA 4IPCA 3ER0A 3NBHB 4XEOA 1B70B 2ATWA 4H13C 1FD7D 1PH1A 4XTYA 5I2XA 3A56A 3M7NA 1PVOA 1D7QA 3CP0A 2UUCQ 3HZXA 4A3DG 3PIO3 3T4AC 5EBCA 4Y7NH 3PO2B 3TRZA 3BZKA 5HURA 4L5QA 2TMPA 4RAUC 3GTLH 2Q5HA 4JI3Q 4GZYC 2QHUA 3SEBA 5CV5A 1SETA 4GKJQ 1CSPA 1YNND 2JE6I 2QHTA 2JQOA 2O5IC 4HJ9A 5BN5A 5IT9L 5IOCA 1H9RA 4KKUA 4UY8C 1YB3A 4HIKA 1D8LA 3UI2A 1X32A 4QL5A 3RN2A 3MFYA 5IGFA 2KUMA 2ZXRA 2GVAA 1GOZA 2XWJB 4EVOA 3S2HH 4R1JA 1HNZQ 1CM9A 1JOQA 4DNTB 2IW3A 4JC0A 1N9WA 4Z9CB 4A3GH 2DNEA 1WYDA 4TRDA 2B2WA 3KLSA 1RHPA 1A62A 4RGNA 2WB1B 1DCZA 1R9TB 1FJGQ 4K0KL 2M00A 4X62L 3E6ZX 1X3EA 2PMEA 4XQNA 3MXGA 4K2KA 3UDFA 4WF2A 4LJZC 4YREA 1I4GA 2LXJA 2NZ1D 4BBSH 1VQFA 1K0SA 2F0JA 3A32A 4PMWA 4A3CG 2NTSA 4IFDI 1TKWB 3KJPA 1IW7C 1IYVA 3S17H 1II3A 2Z6BA 5C4ZA 2KVMA 1A2UA 1F77A 4KHVA 1CA5A 3T1YL 1TWCB 2JA7G 1S5DD 2B8GA 3A0JA 4BA1I 4K88A 1A63A 1DOLA 1MKHA 3I4LA 3I4MB 3I4NB 3V05A 2ODRD 5E3FA 1K83H 1X01A 1EIYA 2JA7H 4FYDA 1HR0L 1D6EC 1S3OA 3UDGA 1ADYA 3QO5A 4CS3A 1PH4A 3AQQA 2H4OA 2R93G 4IURA 4A3LH 4KLKA 3S14B 3QB3A 5ELOA 3ITPA 1HUMA 2QDBA 2DUDA 4H0LC 4APVA 2D0OA 3PO3B 3SK4A 2N49A 1G51A 4H2SA 1TWGB 1IBKQ 1HA5A 3A5UA 5TSSA 4P75A 4A3GG 4H2YA 3SXHA 4YHHL 3FJPA 3NQTA 4LK1C 1HPCA 2BDOA 4YRGA 4ZIBA 1IZ6A 4DK1A 2CKZB 2DJZA 4ZKBB 1STGA 1FGUA 1PLFA 4K8IA 3QOLA 4ALPA 2E5LQ 4K5XA 1BCPF 2K33A 2ZZFA 1QZHA 2KCCA 1AN8A 2FMCA 1HTTA 3BVMA 1IBKL 3J7A5 1NR4A 4XYOA 4HIMA 2DTIA 1QJOA 2HQEA 2ID0A 4IO9A 1I94Q 2K28A 3SDZA 4C1NK 5EKKA 1PXUA 3UGQA 1F2MA 4HT4A 2A1AA 4RCOA 3FVQA 1B4OA 2PPBC 3RIRA 1B53A 4AH6A 4KK7A 1NSNS 3Q0AA 4A3FB 3U9OA 3GTQH 1HHVA 5C3EB 3SVMA 3KF6A 4G7HC 3FP9A 4DV2L 1LT3D 2PI2E 2F0PA 4CKBA 4HSPA 3OOCA 1MD2D 1QVCA 1UAPA 3HFZA 1PTOC 4GNXB 5IGDA 5FO8B 3J81E 4YWMA 1LTRD 2E76C 2A74C 2J4XA 1A6XA 2ARTA 4MTKA 2E65A 2XIWA 4R8IA 2K05A 3M4QA 3VYSA 3PF4A 2F0SA 2DGYA 2UU9L 2YYZA 3BJUA 1L1OC 1ILQA 4DR1Q 4FF3A 4C56C 5C44G 3D6CA 2ZTDA 3MZ5A 1S5FD 1QCBD 2EYJA 4PV1C 2ES2A 1NCVA 2F0DA 4FDBA 3FMCA 5C4JB 2F0IA 4C2MH 4BBSG 1LTLA 1DM0B 3SGIA 2L1BA 2UXBL 4WJ3M 1NJ6A 2A68D 2D62A 3OWEB 2ZT8A 2PZWA 3D0FA 3UE0A 2R7ZG 3VR4A 1YFRA 1D5ZC 4C3IH 2R92H 3P8TA 2AWOA 2A6EC 4PNYA 4IUQA 3R3OA 1TWCH 1H4VB 5M3MH 2I0QA 5C52B 1C0AA 3S1QH 4X5OA 4A4IA 2L12A 4BXXG 2WAQE 4ZTZB 1YITA 3JAMc 4DAYA 1TS3A 2Q5IA 3DUZA 4Y7NB 2Z6KA 1NJ8A 4JVZA 5GAHC 1JJCB 4YRTA 5C53B 4XYQA 4DV1Q 1VQGA 3PF5A 2F0MA 2R7DA 4EQPA 4FXDA 3O13A 1K0RA 1K9MC 1AH9A 3A74A 1JCKB 5FJ8G 2DNCA 1IHZA 1FNVA 5IYDH 3PCOB 4DR5Q 3TDQA 4DUZQ 4RKBA 1SNMA 2XN9C 2BE5D 1TR5A 5I9OA 1QZGA 2CWPA 3CQZB 4DAYB 5JEAG 4Q5VA 1IL2A 3A7LA 3LSQA 3GTJB 1K8AC 3AEVA 1SYDA 5IP9G 4P3PA 4DV5Q 1STBA 2F0FA 1IXRA 3K0XA 2V1CC 3LC0A 4OL7A 3K58A 3V7CA 2B2UA 1VQ9A 1K83B 2ZIMA 5T1IA 5C0XG 3A8IE 2AUKA 3CMAA 4P74A 1EEID 1IKMA 3DWQA 2X6GA 4DAMA 2LS01 1B3AA 1T9HA 1LT4D 1Z7MA 1HH2P 1X3GA 3CKIB 2Z9HA 5GAGC 3S2DH 3W5OA 3FRPB 1R4QB 4DR7Q 3VQYA 1EWIA 4B3TL 3QO8A 4M1UB 5GQOA 2MFIA 1C48A 5GADC 1G6PA 3V7RA 1BR9A 4KJOA 2R6GA 1UE5A 1HR0W 5CV9A 4OO1H 5A2QL 3CPFA 1OXTA 3OW7A 4A75A 4E51A 2L0CA 1JORA 3G4SA 2JA5G 1KOGA 2IT1A 3UDXA 1BDOA 4HJAA 4J6HA 2NN6I 2HT1A 2VQEL 1E0BA 1CK1A 3CC4A 4J1MA 2P5IA 1H4SA 2LY7A 1S72A 3NQIA 2NVXB 2N3SA 4XTWA 2R61A 2N8NA 1K8OA 3RMHA 3S1MB 1EY9A 2PZUA 3AMUA 3S1QB 3U9SA 1PYSA 1T5EA 3OW2A 2O4XA 2EYOA 2Q8RE 4GKKQ 2MUYA 4QY7A 2B2UC 1KRSA 4WJWA 3JAME 3FHWA 4JI2L 1GUWA 3HOXH 5DEHA 3EQLC 2I4MA 1JICA 2E3CA 2H5XA 2WP8J 2G5DA 5ELBA 3T13A 5LMUL 1IBMQ 3NELA 1NJ2A 4HIDA 4YCWA 3NTHA 3VYRA 2LKVA 5GROA 5JVG3 4H02A 3T1YQ 2EY6A 5G3LD 1LT6D 1QVFA 2FMMA 4P71A 1NUCA 5EBDA 3BU2A 2EJFC 3CQZH 2DY8A 5BR8Q 5CC4A 1RF2D 3T56B 3PSIA 1L1OB 2I07B 1A15A 1BIBA 4IUNA 3QTCA 4LW1A 3PUWA 1ENCA 1KNEA 3NTKA 4LFAQ 2EJ9A 4A3JB 2NYZD 1SRYA 1VQZA 1XPRA 4C3IB 2R92B 3EJIA 2EYMA 1HXDA 3SK6A 5C51B 2OCEA 1UE1A 1SYGA 3K7UC 5D14A 1X2HA 5CBEE 3PZCA 4UAIA 5G3LF 4R4QA 3G71A 2XSCA 5AJ3Q 2K32A 1SNDA 3C3LA 1GHJA 3A7UA 2WINB 2K6AA 1QNUA 3A8JE 3OTOQ 3GTGH 3E5SA 4BBSB 1YHAA 3OTOL 4R9WA 4XTVA 3S1NB 1RODA 1IW7D 4IOCA 4KI0A 1USYA 4HWPA 1JJ2A 2A73B 5AJ3L 3RR5A 2EYHA 3F8TA 4K5WA 2G4CA 1XMOL 4KKSA 4P73A 4K6LA 2L55A 3QWNA 5M3FH 1CA6A 1K73C 1IBML 1QE0A 4YDQA 1VQ7A 3S2DB 3S1MH 4DR6L 4YRIA 4HCEA 3I55A 4GKKL 4OO1G 4YRMA 3EFSA 1GGMA 2B3GA 5CV4A 3GTPH 4A3KH 5C4XH 2JA8H 3H94A 2NUCA 4R4IA 3Q6SA 4R4OA 1VF5C 4A3EH 2ENBA 3HOXB 3MWYW 3QIAA 4M8AA 3FKIG 3PUYA 2I4LA 2MHVA 4YCUA 3A31A 3M3YB 4QUFA 3NTIA 2BCOA 2VQEQ 3R2TA 1EQVA 3HG9A 2Y0SE 1CKNB 2N88A 4HTHA 2XNAC 4BBRG 4N9TA 4DV3Q 4HWRA 1ET9A 1J6QA 3TMEA 1VQNA 1UUPA 3TQYA 4RQFA 3HOUH 1BXTA 3NK9A 1CZGA 3T53B 5ELDA 1TY0A 2EYFA 3CCVA 1JOKA 3S15B 3HGBA 3IFTA 1EYAA 3HOVH 3RZOH 4EQ5A 4B9XA 1AZQA 1KIXA 3TS0A 1K8GA 4UP8A 1G6ZA 1ATIA 4NXNL 4CJ2C 4A3JG 4JI4Q 5KNDA 4HJ8A 2YU9B 2CJBA 3RLOA 1CI3M 5J1ZA 2F0OA 3G6JB 4KN7C 1CKNA 3TN2A 3W1GA 3ZJYC 1L0XB 4WORA 4A3FH 4L6TB 3TS2A 3BG3A 2OT2A 4TVYA 1ET6A 3CCLA 5JJLA 4DF7A 4YP0A 2F0KA 4LF5Q 2LSSA 4IZ8A 1G5HA 4LF8Q 2B2VC 1I5FA 1LACA 2RHQB 4YY3Q 1NE3A 3CAMA 4IUTA 1PV4A 4WJ4A 2Z6KC 4XT3B 2E2IH 4X3KA 3P7JA 3L4GB 4JI6Q 2XWBB 4HEDA 1C7YA 1SNQA 4JBKA 4C3JH 1B7YA 3KF8B 5E4XA 1W6JA 2VZAA 3RN5A 4LFCL 5DNFA 4JI8Q 2QA4A 4GNXC 2B39A 4JCVE 4IPGA 2JA5B 4E6IA 4HSVA 4A3DB 1CT1D 1VCIA 4NKLA 5LMNL 2DXUA 1PH7A 3FPPA 1GJXA 1L1OA 4GOPB 4K87A 4AYBE 3GTQB 4JOIA 4K14A 2VS1A 1HZCA 1HCZA 5C4XG 1B70A 4DV0L 2O5JC 4CJ0B 4CS4A 4GN4B 1WD1A 1Q8KA 2HCIA 3S16H 1JE4A 1PMRA 4PQXA 1N32L 1QUQA 5KIXA 2VXWA 1FYCA 3MHBA 1B44D 1YVCA 4KY7A 1QG7A 2EDGA 3KF6B 1WQ7A 3NUCA 4A3IB 3M85A 1ICWA 1O7ZA 4BS9A 1TWFH 2E10A 2ZT9C 3IKJA 1U9RA 3OMGA 2F1MA 3HFVA 1C4QA 4LUVA 2OQKA 5AFWA 2I5HA 2B2TC 4EGVA 4P74C 2KEDA 1X56A 3J81j 3GV6A 1TY2A 2ZJRA 3GTPB 1NAPA 1TWHH 2EVBA 4IFDG 1PFBA 1J9OA 1WU7A 3M4OH 1QWYA 4YRRA 5IODA 1LV9A 4B08A 2GA4B 3GO5A 5M5WB 2K4KA 4J15A 3U58A 1EU4A 3Q22A 2KENA 2EZVA 2N55A 3KJOA 3UGTA 3G6EA 1CTMA 2HD3A 3CCQA 2F0VA 4FF1A 4CKEA 3RF1A 4CH3A 1L0YB 5KEEA 2NN6H 4KHPQ 3S24A 2EJFA 3R8BA 1KDCA 5A35A 1N36Q 3P1HA 3RZOB 1Q12A 2DEQA 2DVEA 2ZGWA 5IYBH 1F9PA
chains in the Genus database with same CATH topology
4GLXA 2ZTCA 4DV6Q 5KNNA 5C3EH 1VQJA 1I50H 1YHQA 4GS3A 4JI1L 4A76A 2EJGA 3I2ZA 1SN8A 2UUBL 3NEMA 1KMMA 3GTMH 3CCRA 5C44H 2Q2HA 2E8GA 1SE8A 5C0XJ 5FJ8H 4XU2A 3LGJA 2E5LL 1EVLA 3TEHB 4NCXA 3HXVA 3MEYA 1BBUA 3EFRA 4PZ6A 3HOWH 5JJIA 1VQBA 1AE3A 4HVCA 1X54A 2IY5A 4GOPC 3RLNA 4XIGS 1Q82C 1GM5A 1WI5A 4UP9A 1VQKA 3B6YA 4JI7L 2R7ZH 3VQXA 4YRQA 1N34Q 3KFUA 3HOWG 1E7ZA 2JK8A 2ARUA 3L4GA 4A3BH 3PIOA 1NJ1A 4A3IH 4X65Q 4HIOA 2C35B 2XGTA 1K3RA 2HIXA 2Q7GA 3V7SA 5IT9c 4YRFA 1VQEA 3PCOA 3ERRA 4BWAA 4P73C 3U4VA 4YY3L 2BA0A 5IYDG 1GKHA 1SESA 2NZHA 1NYQA 1XMQQ 3UDIA 4JI6L 4TVAB 1KQSA 1XPOA 1HNWL 1IYJB 2ZNJA 1BKBA 4HWTA 1GD7A 3STBC 4PZ8A 3A5ZB 1YHBA 1Q86C 4AIMA 4QJFA 3IRBA 1HZ9A 2DKGA 1JT8A 1I6HH 4JI4L 2KCTA 3EBEA 3I4NG 2B63G 3RLFA 4DR6Q 1C9OA 4A3BG 5C0XI 1YZ6A 5H1SE 1QF6A 2ZINA 3ICAA 5K36G 2Q7HA 4YRNA 3IKLA 1CSQA 3RKYA 1U5KA 4XTCS 1RIQA 1RIPA 4GN3B 1HNXL 2FXQA 5M5WH 2ZM6L 2HIVA 1N33L 2UXCL 4A3LG 2MO0A 2R93H 3HY1A 1AE2A 1HJPA 5IWAQ 4P71C 3MF2A 2YTXA 2EQSA 4LVLA 1N32Q 4NXMQ 2IHEA 4LF6L 3K80C 4XTXA 4DR1L 3T1HQ 1B76A 1X3FA 2ZNIA 2K52A 4A3FG 4IPHA 1SMXA 1M1KC 1WJJA 4DR3Q 3J7ZC 4BY1H 3R07A 1B7YB 1VQPA 1JJCA 3AYHB 1YFSA 2J3MA 4X66L 2J3LA 4IJLA 3PO2G 5E3IA 2ZCEA 4AQYL 2NVYH 1YJNA 4LNQA 2JEAI 2NZOA 1EOVA 3K7AH 3A5YA 5BR8L 1HNWQ 5E7NA 4TQDA 4NXNQ 3J81c 2AMCB 2NVQH 3CMQA 3RNUA 2PNHA 5IP7H 1CUKA 3DLLA 2CIMA 4L5SA 4A3DH 4DV1L 5LMNQ 1XNQL 4X65L 2JJQA 1NY4A 1JJGA 3CCJA 2WFWA 1YEZA 3IKMB 4LFCQ 1YI2A 1OXUA 2B29A 4YRKA 3S15H 1WOCA 4LFBQ 2CFMA 2VY3A 4DR2Q 1UWVA 4LF8L 4KR3A 4OWXB 4CS2A 2YTVA 1PH3A 4B3MQ 2DTOA 2UUBQ 4O0AA 1EUJA 3W3SA 4LFBL 2MO1A 5HY6A 2DTHA 1BBWA 11ASA 4BY7H 2RHSA 4A93H 4JV5Q 4RDXA 3CC2A 4BY7G 4YPFA 2E5AA 2DDZA 1H4QA 1J5WA 4KHPL 1ASZA 3JAMi 4JBMA 3HXXA 1NMFA 4LF7L 4YRCA 2Q7EA 2Q2UA 3QNEA 1G5IA 3GTJH 3GD7A 1PH6A 4DQ2A 4LF6Q 4TVAA 4P75C 1SFOH 4HJ5A 1LYLA 4JBJA 2HHHQ 3WQZA 2ZJQA 1Y14B 1TWAH 4LWCA 4GOPA 2QEXA 1WCMH 4H2XA 3G48A 1H4TA 2RF4A 2YV5A 4YRLA 3U50C 3RZDH 1ADJA 4DNIA 3HOUG 3PUVA 1X6OA 3J80i 4DUYQ 4KQEA 3H15A 2PMFA 3VDYA 4DV2Q 3PO3H 4BW9A 1A0IA 4HA8A 4G85A 3CPWA 5EAYA 4DPGA 2HQLA 2K75A 1LM0A 4DV7Q 1VQ6A 2ODRC 4NXML 2Z0SA 1B8AA 1LUZA 1XNRQ 4LF4L 4GLAC 1VQLA 4OP0A 1YIJA 3REUA 2JA6H 3H0GH 4JI1Q 5IWAL 1VQHA 1I3QH 3H0GG 4JYAQ 2ZR3A 4DK6C 1ASYA 4X64L 4H2TA 2CWAA 1Q46A 1I94L 5IYBG 3PGZA 4Q15A 3A7AA 1X55A 5FLMG 4B3SQ 4A3KG 1WCMG 3T1HL 4H2VA 3TEGA 2OWOA 4OWTB 4IJHA 4X6AH 2OTLA 1WNLA 1W66A 2ZZGA 1NNHA 3RGLA 1Z9FA 1NJIC 2AHOB 4X62Q 3IG2A 4JG2A 4DUZL 2ZM6Q 2N78A 1L0WA 4JI0Q 2OTJA 2I5LX 4JI0L 1G291 1PFSA 3GTKH 2HNIA 4OX9Q 2KHIA 4R4TA 1S40A 5LMUQ 4EX5A 2GVBA 4LVMA 3TREA 1YJWA 2NS6A 2VQFL 4LUOA 1FJGL 4GNXA 3HOZH 4DR4Q 4Y52H 3CW2C 1MJEA 1H95A 4HJ7A 2UXDL 4JOIC 1KRTA 1V9PA 3J81i 1M90C 3W1BA 2I5MX 2JEBI 4RQEA 2BA1A 4PZ7A 2VL6A 4XTZA 3KLWA 1BVSA 2PQAB 3F2DA 2MNAA 2JA9A 1VQ5A 3EIVA 3E0EA 4EO4A 2KHJA 2P0LA 4P72A 2DZ9A 2AKWA 1E1OA 2PMZE 3MF1A 4X64Q 3ERSX 2IX1A 4DV5L 3HKZE 3KYHC 1FVIA 1W3SA 2ZT6A 1GO3E 4YRSA 1IBLL 4L5TA 2PI2A 4B3ML 3I7FA 4TWAA 1XNRL 4LVJA 4DKAC 1WFQA 3D31A 3F2CA 3GDEA 1MJCA 1NYRA 1X2GA 2BH8A 3PO2H 3MEFA 2HHHL 1VQIA 1YGBA 3GTOH 2F3IA 1V43A 1W2BA 3REXA 4OONA 2WB1G 2DU5A 4UPAA 3QO7A 2WB1E 1EFWA 1VQAA 1Y1WG 4B3RL 2F52A 3I4MH 1L2FA 4OWWB 1VS0A 2NVTH 2C8MA 2UXBQ 4POFA 1Q81C 2R7FA 4OO1I 3TUPA 3K8AA 4R4CA 4CH4A 1O7IA 3JC66 2ASBA 1JE5A 3I4NH 1VQCA 2EWNA 4A3MG 1Z7NA 5C3EG 1SRUA 3HXYA 3RACA 1EYGA 1VQ4A 2EL9A 3RUXA 3IALA 1J5EL 3OD1A 2WAQG 2R92G 1PA6A 1SERA 3UH0A 2EXDA 1EIFA 12ASA 4AYBG 1WLEA 4DV3L 4CH6A 2I4OA 3H3VI 3DM3A 4OLFA 3ULPA 4DK3C 4GKJL 4A93G 4NPSA 4DV4L 4XU1A 4LUZA 3I4OA 4DV4Q 1Z47A 3F2BA 3M4PA 2E1HA 4YRPA 3V8KA 3RL6A 2ALYA 3VBBA 1YJ9A 5M5YH 5IP7G 2ZXFA 1JMCA 4PHCA 5JEAJ 1PH8A 1HR0Q 2ZT5A 1EIYB 5IY0A 2AWNA 2Q2IA 4B3TQ 4DR7L 2D0PA 3L2PA 3HRIA 4KR2A 1VQOA 5M5XH 4BY1G 3M9BA 3CCSA 2ZZEA 1J5EQ 1U0LA 2K14A 1PHJA 4GN5A 4LF5L 2E2JH 3ULJA 2ZIOA 2CGHA 2GN5A 5IYCG 3HRKA 3PUXA 2KBNA 4XU0A 1EQRA 1KD1C 2A8EA 5IE8A 1HNZL 1A8VA 1SR3A 1Y1WH 1YFTA 1UE6A 1BIAA 4B3RQ 4H2UA 4HWSA 1MIUA 3A7RA 4DR3L 4TQUS 2ZTEA 1UEBA 2VQFQ 1VQDA 1PYSB 5FLXc 1E1TA 4A3IG 3E9IA 2UUAL 3BZCA 2E41A 3ULLA 5IYCH 4MNOA 4H2XB 3MQZA 4OXPA 2UXCQ 3CC7A 5LMNW 1N34L 4YYEA 2RHSB 3PUZA 1HNXQ 4LNSA 4YWLA 4JI2Q 1JB7A 3Q8DA 1KMNA 3KOJA 1E3PA 4PG3A 2RHQA 3AFPA 2ZR2A 3UE1A 5JJKA 4B3SL 3A5ZA 4OX9L 1KAWA 4WI1A 3KDFB 3CXCA 2DQ0A 2NN6G 5F5WA 3V8JA 2K50A 4LF4Q 1XMQL 2IX0A 4JI3L 2UXDQ 4GLVB 1IBLQ 2B63H 3CMEA 4IOAA 3S1NH 1PH9A 2IY5B 2ALYB 4TQFA 4LVKA 1KL9A 1Q1BA 2Y0SG 3CCUA 3DSQA 2XTIA 5J3BA 2DU7A 1X9NA 1FYFA 4DR5L 4DR4L 3CD6A 2QHSA 4TVWA 2NVXH 4BBRH 3HKZG 3NENA 1R9TH 4G84A 5ELNA 3M3YH 4JBWA 4RG1A 1NJ5A 2CQOA 3OYYA 2VUMH 4YWKA 3EN2A 4JI7Q 3RKXA 4A3CH 4A3MH 1XPUA 3I4MG 1SROA 1PYBA 4P3NA 3PO3G 4DUYL 4A3JH 2AKWB 4HWOA 4L87A 3VQVA 3I56A 2VW9A 3FKIH 4YRJA 1KXLA 2CCZA 2DQ3A 5HGQA 2EIFA 2QGQA 4QQBX 1N36L 2I4NA 3HOZG 2VUMG 1VQMA 1E22A 4YROA 2FYKA 3CCEA 4QIWE 3H3VH 5M3FG 3HOYH 3NETA 2Q2TA 2KCMA 1RL2A 3U4ZA 4LVIA 4JYAL 1TWGH 1KC8C 3WWVA 4QGUA 1TXYA 1HC7A 3AFQA 3ICEA 3F1ZA 4P72C 2C7IA 3V8LA 1CKMA 3HKSA 1USYC 3PV0A 2A19A 3G1ZA 2ZJPA 4LF7Q 3HFZB 4XTUA 2UU9Q 1X65A 3P8VA 3L2ZA 3CF5A 4P3OA 3HOVG 2YU9H 2JA8G 4DV6L 3TEHA 3LSSA 2K5HA 4XEMA 1SLJA 4JV5L 1FL0A 4NB3A 3L0OA 1DGSA 4DV0Q 2A8VA 2IHFA 1XTDA 4LF9Q 4K86A 3HOYG 5C4JH 2F4VQ 4A3EG 1CKOA 2ZT7A 2JA5H 2ARSA 1WQWA 2ZTGA 4BA2I 2AMCA 4YHHQ 1KHIA 1E24A 4DR2L 1XMOQ 3CCMA 4H2WA 1NBWA 3PIPA 3S1RH 3HOXG 4KHZA 4JI8L 1YNXA 1HZBA 1OTCA 4IFDJ 5FLMH 1P8LA 4XU3A 2RCNA 4POGA 4IPDA 2DXTA 2EAYA 4CH5A 1Y1VH 1P16A 4LF9L 4LFAL 3L7ZC 4X66Q 3UFGA 1YBYA 4C3HH 3J80c 1NTGA 1V1QA 4O2DA 4MTNA 2PQAA 3P8YA 4K0KQ 2UUCL 3BFMA 1QVGA 1XNQQ 3MXNB 1NMGA 1GVPA 1Q1EA 1OXSC 4TTVA 1VQ8A 1QUQB 1Y1VG 2CJ9A 5K1PA 2BH2A 2E2HH 4Q6GA 3STBD 2LXKA 1HZAA 5DLQE 2CJAA 3E9HA 4YCVA 4JI5L 4MZ9A 2JA6G 4AQYQ 2QHVA 3HXWA 2K5NA 4ZTUB 1N33Q 1OXXK 2OQ0A 5M3MG 3K81C 2L15A 1PH2A 3KDFA 1XJVA 2K5VA 2F4VL 1UE7A 4JI5Q 3VQWA 4BXXH 4UP7A 4DV7L 2VNUD 1OXVA 2UUAQ 5K1XA 5IP9H 1WPYA 2MQHA 3RKWA 1Q7YC 5GAEC 4ME3A 2E64A 1PH5A 2DZCA 1N8RC 3HXUA 4L5RC 3HXZA 1EQQA 3HY0A 4RMFA 2YTYA 1EVKA 3L1AA 3S14H 3HTZA 4IPCA 3ER0A 3NBHB 4XEOA 1B70B 2ATWA 1PH1A 4XTYA 3M7NA 1PVOA 1D7QA 3CP0A 2UUCQ 4A3DG 4Y7NH 3TRZA 3BZKA 4L5QA 3GTLH 2Q5HA 4JI3Q 2QHUA 1SETA 4GKJQ 1CSPA 2JE6I 2QHTA 2JQOA 4HJ9A 4UY8C 1YB3A 4HIKA 1D8LA 4QL5A 3RN2A 2GVAA 3S2HH 4R1JA 1HNZQ 4JC0A 1N9WA 4A3GH 1WYDA 1A62A 1FJGQ 4K0KL 4X62L 1X3EA 2PMEA 3UDFA 4WF2A 4YREA 2LXJA 4BBSH 1VQFA 3A32A 4PMWA 4A3CG 4IFDI 3KJPA 3S17H 3T1YL 2JA7G 3A0JA 4BA1I 4K88A 1A63A 1MKHA 2ODRD 1K83H 1X01A 1EIYA 2JA7H 1HR0L 1S3OA 3UDGA 1ADYA 3QO5A 4CS3A 1PH4A 3AQQA 2R93G 4A3LH 4KLKA 5ELOA 2DUDA 4APVA 2D0OA 2N49A 1G51A 4H2SA 1IBKQ 3A5UA 4P75A 4A3GG 4H2YA 4YHHL 3FJPA 4YRGA 4ZIBA 1IZ6A 2CKZB 2DJZA 2E5LQ 1FGUA 4ALPA 2ZZFA 1QZHA 1HTTA 1IBKL 3J7A5 4HIMA 2DTIA 2ID0A 4IO9A 1I94Q 3UGQA 4HT4A 2A1AA 3RIRA 4AH6A 3GTQH 3KF6A 3FP9A 4DV2L 2PI2E 1QVCA 3HFZA 4GNXB 4YWMA 2ARTA 2E65A 3M4QA 3PF4A 2DGYA 2UU9L 2YYZA 3BJUA 1L1OC 4DR1Q 5C44G 2ZTDA 2ES2A 4FDBA 4C2MH 4BBSG 1LTLA 3SGIA 2UXBL 4WJ3M 1NJ6A 2D62A 2ZT8A 3D0FA 3UE0A 2R7ZG 1YFRA 4C3IH 2R92H 3P8TA 2AWOA 1TWCH 1H4VB 5M3MH 2I0QA 5C52B 1C0AA 3S1QH 4X5OA 4A4IA 4BXXG 2WAQE 4ZTZB 1YITA 3JAMc 2Q5IA 2Z6KA 1NJ8A 5GAHC 1JJCB 4YRTA 5C53B 4DV1Q 1VQGA 3PF5A 2R7DA 1K0RA 1K9MC 1AH9A 3A74A 5FJ8G 5IYDH 3PCOB 4DR5Q 4DUZQ 1QZGA 2CWPA 4DAYB 5JEAG 1IL2A 3LSQA 1K8AC 3AEVA 5IP9G 4P3PA 4DV5Q 1IXRA 3K0XA 2V1CC 3LC0A 3V7CA 1VQ9A 2ZIMA 5C0XG 3CMAA 4P74A 4DAMA 1T9HA 1Z7MA 1HH2P 1X3GA 5GAGC 3S2DH 3W5OA 4DR7Q 3VQYA 1EWIA 4B3TL 3QO8A 5GQOA 2MFIA 5GADC 1G6PA 3V7RA 2R6GA 1UE5A 1HR0W 3CPFA 1OXTA 4A75A 4E51A 3G4SA 2JA5G 1KOGA 2IT1A 3UDXA 4HJAA 2NN6I 2HT1A 2VQEL 3CC4A 2P5IA 1H4SA 1S72A 4XTWA 2N3SA 2N8NA 1PYSA 3OW2A 4GKKQ 4QY7A 1KRSA 4JI2L 3FHWA 3HOXH 2I4MA 2E3CA 2H5XA 2WP8J 5LMUL 1IBMQ 3NELA 1NJ2A 4HIDA 4YCWA 5GROA 4H02A 3T1YQ 1QVFA 4P71A 3BU2A 3CQZH 5BR8Q 3PSIA 1L1OB 1BIBA 3QTCA 4LW1A 3PUWA 4LFAQ 2EJ9A 1SRYA 1VQZA 1XPRA 1HXDA 5C51B 2OCEA 1UE1A 3K7UC 1X2HA 3PZCA 4R4QA 3G71A 5AJ3Q 3A7UA 3OTOQ 3GTGH 1YHAA 3OTOL 4XTVA 4IOCA 4KI0A 1USYA 4HWPA 1JJ2A 5AJ3L 3RR5A 3F8TA 2G4CA 1XMOL 4P73A 1IBML 1QE0A 5M3FH 1K73C 4YDQA 1VQ7A 3S1MH 4DR6L 4YRIA 3I55A 4GKKL 4OO1G 4YRMA 3EFSA 1GGMA 2B3GA 3GTPH 4A3KH 5C4XH 2JA8H 4R4IA 4R4OA 4A3EH 3FKIG 3PUYA 2I4LA 4YCUA 3A31A 2VQEQ 2Y0SE 1CKNB 4BBRG 4DV3Q 4HWRA 1J6QA 1VQNA 3TQYA 4RQFA 3HOUH 3CCVA 3HOVH 3RZOH 4EQ5A 1KIXA 3TS0A 1K8GA 4UP8A 1ATIA 4NXNL 4A3JG 4JI4Q 2CJBA 4HJ8A 3RLOA 3W1GA 1CKNA 3ZJYC 4A3FH 3TS2A 4TVYA 3CCLA 5JJLA 4YP0A 4LF5Q 2LSSA 1G5HA 4LF8Q 1I5FA 2RHQB 4YY3Q 1NE3A 3CAMA 1PV4A 4WJ4A 2Z6KC 2E2IH 3L4GB 4JI6Q 1C7YA 4JBKA 1B7YA 4C3JH 3KF8B 3RN5A 2VZAA 4LFCL 4JI8Q 2QA4A 4GNXC 4JCVE 4IPGA 1VCIA 5LMNL 2DXUA 1PH7A 1L1OA 4GOPB 4K87A 4AYBE 4JOIA 2VS1A 1HZCA 5C4XG 1B70A 4DV0L 4CS4A 4GN4B 1Q8KA 3S16H 1N32L 1QUQA 1YVCA 3KF6B 1WQ7A 3M85A 1TWFH 2E10A 3HFVA 4LUVA 2OQKA 2I5HA 4P74C 1X56A 3J81j 2ZJRA 1TWHH 4IFDG 1WU7A 3M4OH 4YRRA 3GO5A 2K4KA 4J15A 3U58A 2KENA 3KJOA 3UGTA 3G6EA 3CCQA 4CH3A 3RF1A 4KHPQ 3S24A 2EJFA 1N36Q 2DEQA 2DVEA 1Q12A 2ZGWA 5IYBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLX A;  2ZTC A;  4DV6 Q;  5KNN A;  5C3E H;  1VQJ A;  1I50 H;  1YHQ A;  4GS3 A;  4JI1 L;  4A76 A;  2EJG A;  3I2Z A;  1SN8 A;  2UUB L;  3NEM A;  1KMM A;  3GTM H;  3CCR A;  5C44 H;  2Q2H A;  2E8G A;  1SE8 A;  5C0X J;  5FJ8 H;  4XU2 A;  3LGJ A;  2E5L L;  1EVL A;  3TEH B;  4NCX A;  3HXV A;  3MEY A;  1BBU A;  3EFR A;  4PZ6 A;  3HOW H;  5JJI A;  1VQB A;  1AE3 A;  4HVC A;  1X54 A;  2IY5 A;  4GOP C;  3RLN A;  4XIG S;  1Q82 C;  1GM5 A;  1WI5 A;  4UP9 A;  1VQK A;  3B6Y A;  4JI7 L;  2R7Z H;  3VQX A;  4YRQ A;  1N34 Q;  3KFU A;  3HOW G;  1E7Z A;  2JK8 A;  2ARU A;  3L4G A;  4A3B H;  3PIO A;  1NJ1 A;  4A3I H;  4X65 Q;  4HIO A;  2C35 B;  2XGT A;  1K3R A;  2HIX A;  2Q7G A;  3V7S A;  5IT9 c;  4YRF A;  1VQE A;  3PCO A;  3ERR A;  4BWA A;  4P73 C;  3U4V A;  4YY3 L;  2BA0 A;  5IYD G;  1GKH A;  1SES A;  2NZH A;  1NYQ A;  1XMQ Q;  3UDI A;  4JI6 L;  4TVA B;  1KQS A;  1XPO A;  1HNW L;  1IYJ B;  2ZNJ A;  1BKB A;  4HWT A;  1GD7 A;  3STB C;  4PZ8 A;  3A5Z B;  1YHB A;  1Q86 C;  4AIM A;  4QJF A;  3IRB A;  1HZ9 A;  2DKG A;  1JT8 A;  1I6H H;  4JI4 L;  2KCT A;  3EBE A;  3I4N G;  2B63 G;  3RLF A;  4DR6 Q;  1C9O A;  4A3B G;  5C0X I;  1YZ6 A;  5H1S E;  1QF6 A;  2ZIN A;  3ICA A;  5K36 G;  2Q7H A;  4YRN A;  3IKL A;  1CSQ A;  3RKY A;  1U5K A;  4XTC S;  1RIQ A;  1RIP A;  4GN3 B;  1HNX L;  2FXQ A;  5M5W H;  2ZM6 L;  2HIV A;  1N33 L;  2UXC L;  4A3L G;  2MO0 A;  2R93 H;  3HY1 A;  1AE2 A;  1HJP A;  5IWA Q;  4P71 C;  3MF2 A;  2YTX A;  2EQS A;  1N32 Q;  4NXM Q;  2IHE A;  4LF6 L;  3K80 C;  4XTX A;  4DR1 L;  3T1H Q;  1B76 A;  1X3F A;  2ZNI A;  2K52 A;  4A3F G;  4IPH A;  1SMX A;  1M1K C;  1WJJ A;  4DR3 Q;  3J7Z C;  4BY1 H;  3R07 A;  1B7Y B;  1VQP A;  1JJC A;  3AYH B;  1YFS A;  2J3M A;  4X66 L;  2J3L A;  4IJL A;  3PO2 G;  5E3I A;  2ZCE A;  4AQY L;  2NVY H;  1YJN A;  4LNQ A;  2JEA I;  2NZO A;  1EOV A;  3K7A H;  3A5Y A;  5BR8 L;  1HNW Q;  5E7N A;  4TQD A;  4NXN Q;  3J81 c;  2AMC B;  2NVQ H;  3CMQ A;  3RNU A;  2PNH A;  5IP7 H;  1CUK A;  3DLL A;  2CIM A;  4L5S A;  4A3D H;  4DV1 L;  5LMN Q;  1XNQ L;  4X65 L;  2JJQ A;  1NY4 A;  1JJG A;  3CCJ A;  2WFW A;  1YEZ A;  3IKM B;  4LFC Q;  1YI2 A;  1OXU A;  2B29 A;  4YRK A;  3S15 H;  1WOC A;  4LFB Q;  2CFM A;  2VY3 A;  4DR2 Q;  1UWV A;  4LF8 L;  4KR3 A;  4OWX B;  4CS2 A;  2YTV A;  1PH3 A;  4B3M Q;  2DTO A;  2UUB Q;  4O0A A;  1EUJ A;  3W3S A;  4LFB L;  2MO1 A;  5HY6 A;  2DTH A;  1BBW A;  11AS A;  4BY7 H;  2RHS A;  4A93 H;  4JV5 Q;  4RDX A;  3CC2 A;  4BY7 G;  4YPF A;  2E5A A;  2DDZ A;  1H4Q A;  1J5W A;  4KHP L;  1ASZ A;  3JAM i;  4JBM A;  3HXX A;  1NMF A;  4LF7 L;  4YRC A;  2Q7E A;  2Q2U A;  3QNE A;  1G5I A;  3GTJ H;  3GD7 A;  1PH6 A;  4DQ2 A;  4LF6 Q;  4TVA A;  4P75 C;  1SFO H;  4HJ5 A;  1LYL A;  4JBJ A;  2HHH Q;  3WQZ A;  2ZJQ A;  1Y14 B;  1TWA H;  4LWC A;  4GOP A;  2QEX A;  1WCM H;  4H2X A;  3G48 A;  1H4T A;  2RF4 A;  2YV5 A;  4YRL A;  3U50 C;  3RZD H;  1ADJ A;  4DNI A;  3HOU G;  3PUV A;  1X6O A;  3J80 i;  4DUY Q;  4KQE A;  3H15 A;  2PMF A;  3VDY A;  4DV2 Q;  3PO3 H;  4BW9 A;  1A0I A;  4HA8 A;  4G85 A;  3CPW A;  5EAY A;  4DPG A;  2HQL A;  2K75 A;  1LM0 A;  4DV7 Q;  1VQ6 A;  2ODR C;  4NXM L;  2Z0S A;  1B8A A;  1LUZ A;  1XNR Q;  4LF4 L;  4GLA C;  1VQL A;  4OP0 A;  1YIJ A;  3REU A;  2JA6 H;  3H0G H;  4JI1 Q;  5IWA L;  1VQH A;  1I3Q H;  3H0G G;  4JYA Q;  2ZR3 A;  4DK6 C;  1ASY A;  4X64 L;  4H2T A;  2CWA A;  1Q46 A;  1I94 L;  5IYB G;  3PGZ A;  4Q15 A;  3A7A A;  1X55 A;  5FLM G;  4B3S Q;  4A3K G;  1WCM G;  3T1H L;  4H2V A;  3TEG A;  2OWO A;  4OWT B;  4IJH A;  4X6A H;  2OTL A;  1WNL A;  1W66 A;  2ZZG A;  1NNH A;  3RGL A;  1Z9F A;  1NJI C;  2AHO B;  4X62 Q;  3IG2 A;  4JG2 A;  4DUZ L;  2ZM6 Q;  2N78 A;  1L0W A;  4JI0 Q;  2OTJ A;  2I5L X;  4JI0 L;  1G29 1;  1PFS A;  3GTK H;  2HNI A;  4OX9 Q;  2KHI A;  4R4T A;  1S40 A;  5LMU Q;  4EX5 A;  2GVB A;  3TRE A;  1YJW A;  2VQF L;  4LUO A;  1FJG L;  4GNX A;  3HOZ H;  4DR4 Q;  4Y52 H;  3CW2 C;  1MJE A;  1H95 A;  4HJ7 A;  2UXD L;  4JOI C;  1KRT A;  1V9P A;  3J81 i;  1M90 C;  3W1B A;  2I5M X;  2JEB I;  4RQE A;  2BA1 A;  4PZ7 A;  2VL6 A;  4XTZ A;  3KLW A;  1BVS A;  2PQA B;  3F2D A;  2MNA A;  2JA9 A;  1VQ5 A;  3EIV A;  3E0E A;  4EO4 A;  2KHJ A;  2P0L A;  4P72 A;  2DZ9 A;  2AKW A;  1E1O A;  2PMZ E;  3MF1 A;  4X64 Q;  3ERS X;  2IX1 A;  4DV5 L;  3HKZ E;  3KYH C;  1FVI A;  1W3S A;  2ZT6 A;  1GO3 E;  4YRS A;  1IBL L;  4L5T A;  2PI2 A;  4B3M L;  3I7F A;  4TWA A;  1XNR L;  4DKA C;  1WFQ A;  3D31 A;  3F2C A;  3GDE A;  1MJC A;  1NYR A;  1X2G A;  2BH8 A;  3PO2 H;  3MEF A;  2HHH L;  1VQI A;  1YGB A;  3GTO H;  2F3I A;  1V43 A;  1W2B A;  3REX A;  4OON A;  2WB1 G;  2DU5 A;  4UPA A;  3QO7 A;  2WB1 E;  1EFW A;  1VQA A;  1Y1W G;  4B3R L;  2F52 A;  3I4M H;  1L2F A;  4OWW B;  1VS0 A;  2NVT H;  2C8M A;  2UXB Q;  4POF A;  1Q81 C;  2R7F A;  4OO1 I;  3TUP A;  3K8A A;  4R4C A;  4CH4 A;  1O7I A;  3JC6 6;  2ASB A;  1JE5 A;  3I4N H;  1VQC A;  2EWN A;  4A3M G;  1Z7N A;  5C3E G;  1SRU A;  3HXY A;  3RAC A;  1EYG A;  1VQ4 A;  2EL9 A;  3RUX A;  3IAL A;  1J5E L;  3OD1 A;  2WAQ G;  2R92 G;  1PA6 A;  1SER A;  3UH0 A;  2EXD A;  1EIF A;  12AS A;  4AYB G;  1WLE A;  4DV3 L;  4CH6 A;  2I4O A;  3H3V I;  3DM3 A;  4OLF A;  3ULP A;  4DK3 C;  4GKJ L;  4A93 G;  4NPS A;  4DV4 L;  4XU1 A;  4LUZ A;  3I4O A;  4DV4 Q;  1Z47 A;  3F2B A;  3M4P A;  2E1H A;  4YRP A;  3V8K A;  3RL6 A;  2ALY A;  3VBB A;  1YJ9 A;  5M5Y H;  5IP7 G;  2ZXF A;  1JMC A;  4PHC A;  5JEA J;  1PH8 A;  1HR0 Q;  2ZT5 A;  1EIY B;  5IY0 A;  2AWN A;  2Q2I A;  4B3T Q;  4DR7 L;  2D0P A;  3L2P A;  3HRI A;  4KR2 A;  1VQO A;  5M5X H;  4BY1 G;  3M9B A;  3CCS A;  2ZZE A;  1J5E Q;  1U0L A;  2K14 A;  1PHJ A;  4GN5 A;  4LF5 L;  2E2J H;  3ULJ A;  2ZIO A;  2CGH A;  2GN5 A;  5IYC G;  3HRK A;  3PUX A;  2KBN A;  4XU0 A;  1EQR A;  1KD1 C;  5IE8 A;  1HNZ L;  1A8V A;  1SR3 A;  1Y1W H;  1YFT A;  1UE6 A;  1BIA A;  4B3R Q;  4H2U A;  4HWS A;  1MIU A;  3A7R A;  4DR3 L;  4TQU S;  2ZTE A;  1UEB A;  2VQF Q;  1VQD A;  1PYS B;  5FLX c;  1E1T A;  4A3I G;  3E9I A;  2UUA L;  3BZC A;  2E41 A;  3ULL A;  5IYC H;  4MNO A;  4H2X B;  4OXP A;  2UXC Q;  3CC7 A;  5LMN W;  1N34 L;  4YYE A;  2RHS B;  3PUZ A;  1HNX Q;  4LNS A;  4YWL A;  4JI2 Q;  1JB7 A;  3Q8D A;  1KMN A;  3KOJ A;  1E3P A;  4PG3 A;  2RHQ A;  3AFP A;  2ZR2 A;  3UE1 A;  5JJK A;  4B3S L;  3A5Z A;  4OX9 L;  1KAW A;  4WI1 A;  3KDF B;  3CXC A;  2DQ0 A;  2NN6 G;  5F5W A;  3V8J A;  2K50 A;  4LF4 Q;  1XMQ L;  2IX0 A;  4JI3 L;  2UXD Q;  4GLV B;  1IBL Q;  2B63 H;  3CME A;  4IOA A;  3S1N H;  1PH9 A;  2IY5 B;  2ALY B;  4TQF A;  1KL9 A;  1Q1B A;  2Y0S G;  3CCU A;  3DSQ A;  2XTI A;  5J3B A;  2DU7 A;  1X9N A;  1FYF A;  4DR5 L;  4DR4 L;  3CD6 A;  2QHS A;  4TVW A;  2NVX H;  4BBR H;  3HKZ G;  3NEN A;  1R9T H;  4G84 A;  5ELN A;  3M3Y H;  4JBW A;  4RG1 A;  1NJ5 A;  2CQO A;  3OYY A;  2VUM H;  4YWK A;  3EN2 A;  4JI7 Q;  3RKX A;  4A3C H;  4A3M H;  1XPU A;  3I4M G;  1SRO A;  1PYB A;  4P3N A;  3PO3 G;  4DUY L;  4A3J H;  2AKW B;  4HWO A;  4L87 A;  3VQV A;  3I56 A;  2VW9 A;  3FKI H;  4YRJ A;  1KXL A;  2CCZ A;  2DQ3 A;  5HGQ A;  2EIF A;  2QGQ A;  4QQB X;  1N36 L;  2I4N A;  3HOZ G;  2VUM G;  1VQM A;  1E22 A;  4YRO A;  2FYK A;  3CCE A;  4QIW E;  3H3V H;  5M3F G;  3HOY H;  3NET A;  2Q2T A;  2KCM A;  1RL2 A;  3U4Z A;  4JYA L;  1TWG H;  1KC8 C;  3WWV A;  4QGU A;  1TXY A;  1HC7 A;  3AFQ A;  3ICE A;  3F1Z A;  4P72 C;  2C7I A;  3V8L A;  1CKM A;  3HKS A;  1USY C;  3PV0 A;  2A19 A;  3G1Z A;  2ZJP A;  4LF7 Q;  3HFZ B;  4XTU A;  2UU9 Q;  1X65 A;  3P8V A;  3L2Z A;  3CF5 A;  4P3O A;  3HOV G;  2YU9 H;  2JA8 G;  4DV6 L;  3TEH A;  3LSS A;  2K5H A;  4XEM A;  1SLJ A;  4JV5 L;  1FL0 A;  4NB3 A;  3L0O A;  1DGS A;  4DV0 Q;  2A8V A;  2IHF A;  1XTD A;  4LF9 Q;  4K86 A;  3HOY G;  5C4J H;  2F4V Q;  4A3E G;  1CKO A;  2ZT7 A;  2JA5 H;  2ARS A;  1WQW A;  2ZTG A;  4BA2 I;  2AMC A;  4YHH Q;  1KHI A;  1E24 A;  4DR2 L;  1XMO Q;  3CCM A;  4H2W A;  1NBW A;  3PIP A;  3S1R H;  3HOX G;  4KHZ A;  4JI8 L;  1YNX A;  1HZB A;  1OTC A;  4IFD J;  5FLM H;  1P8L A;  4XU3 A;  2RCN A;  4POG A;  4IPD A;  2DXT A;  2EAY A;  4CH5 A;  1Y1V H;  1P16 A;  4LF9 L;  4LFA L;  3L7Z C;  4X66 Q;  3UFG A;  1YBY A;  4C3H H;  3J80 c;  1NTG A;  1V1Q A;  4O2D A;  4MTN A;  2PQA A;  3P8Y A;  4K0K Q;  2UUC L;  3BFM A;  1QVG A;  1XNQ Q;  3MXN B;  1NMG A;  1GVP A;  1Q1E A;  1OXS C;  4TTV A;  1VQ8 A;  1QUQ B;  1Y1V G;  2CJ9 A;  5K1P A;  2BH2 A;  2E2H H;  4Q6G A;  3STB D;  2LXK A;  1HZA A;  5DLQ E;  2CJA A;  3E9H A;  4YCV A;  4JI5 L;  4MZ9 A;  2JA6 G;  4AQY Q;  2QHV A;  3HXW A;  2K5N A;  4ZTU B;  1N33 Q;  1OXX K;  2OQ0 A;  5M3M G;  3K81 C;  2L15 A;  1PH2 A;  3KDF A;  1XJV A;  2K5V A;  2F4V L;  1UE7 A;  4JI5 Q;  3VQW A;  4BXX H;  4UP7 A;  4DV7 L;  2VNU D;  1OXV A;  2UUA Q;  5K1X A;  5IP9 H;  1WPY A;  2MQH A;  3RKW A;  1Q7Y C;  5GAE C;  4ME3 A;  2E64 A;  1PH5 A;  2DZC A;  1N8R C;  3HXU A;  4L5R C;  3HXZ A;  1EQQ A;  3HY0 A;  4RMF A;  2YTY A;  1EVK A;  3L1A A;  3S14 H;  3HTZ A;  4IPC A;  3ER0 A;  3NBH B;  4XEO A;  1B70 B;  2ATW A;  1PH1 A;  4XTY A;  3M7N A;  1PVO A;  1D7Q A;  3CP0 A;  2UUC Q;  4A3D G;  4Y7N H;  3TRZ A;  3BZK A;  4L5Q A;  3GTL H;  2Q5H A;  4JI3 Q;  2QHU A;  1SET A;  4GKJ Q;  1CSP A;  2JE6 I;  2QHT A;  2JQO A;  4HJ9 A;  4UY8 C;  1YB3 A;  4HIK A;  1D8L A;  4QL5 A;  3RN2 A;  2GVA A;  3S2H H;  4R1J A;  1HNZ Q;  4JC0 A;  1N9W A;  4A3G H;  1WYD A;  1A62 A;  1FJG Q;  4K0K L;  4X62 L;  1X3E A;  2PME A;  3UDF A;  4WF2 A;  4YRE A;  2LXJ A;  4BBS H;  1VQF A;  3A32 A;  4PMW A;  4A3C G;  4IFD I;  3KJP A;  3S17 H;  3T1Y L;  2JA7 G;  3A0J A;  4BA1 I;  4K88 A;  1A63 A;  1MKH A;  2ODR D;  1K83 H;  1X01 A;  1EIY A;  2JA7 H;  1HR0 L;  1S3O A;  3UDG A;  1ADY A;  3QO5 A;  4CS3 A;  1PH4 A;  3AQQ A;  2R93 G;  4A3L H;  4KLK A;  5ELO A;  2DUD A;  4APV A;  2D0O A;  2N49 A;  1G51 A;  4H2S A;  1IBK Q;  3A5U A;  4P75 A;  4A3G G;  4H2Y A;  4YHH L;  3FJP A;  4YRG A;  4ZIB A;  1IZ6 A;  2CKZ B;  2DJZ A;  2E5L Q;  1FGU A;  4ALP A;  2ZZF A;  1QZH A;  1HTT A;  1IBK L;  3J7A 5;  4HIM A;  2DTI A;  2ID0 A;  4IO9 A;  1I94 Q;  3UGQ A;  2A1A A;  3RIR A;  4AH6 A;  3GTQ H;  3KF6 A;  3FP9 A;  4DV2 L;  2PI2 E;  1QVC A;  3HFZ A;  4GNX B;  4YWM A;  2ART A;  2E65 A;  3M4Q A;  3PF4 A;  2DGY A;  2UU9 L;  2YYZ A;  3BJU A;  1L1O C;  4DR1 Q;  5C44 G;  2ZTD A;  2ES2 A;  4FDB A;  4C2M H;  4BBS G;  1LTL A;  3SGI A;  2UXB L;  4WJ3 M;  1NJ6 A;  2D62 A;  2ZT8 A;  3D0F A;  3UE0 A;  2R7Z G;  1YFR A;  4C3I H;  2R92 H;  3P8T A;  2AWO A;  1TWC H;  1H4V B;  5M3M H;  2I0Q A;  5C52 B;  1C0A A;  3S1Q H;  4X5O A;  4A4I A;  4BXX G;  2WAQ E;  4ZTZ B;  1YIT A;  3JAM c;  2Q5I A;  2Z6K A;  1NJ8 A;  5GAH C;  1JJC B;  4YRT A;  5C53 B;  4DV1 Q;  1VQG A;  3PF5 A;  2R7D A;  1K0R A;  1K9M C;  1AH9 A;  3A74 A;  5FJ8 G;  5IYD H;  3PCO B;  4DR5 Q;  4DUZ Q;  1QZG A;  2CWP A;  4DAY B;  5JEA G;  1IL2 A;  3LSQ A;  1K8A C;  3AEV A;  5IP9 G;  4P3P A;  4DV5 Q;  1IXR A;  3K0X A;  2V1C C;  3LC0 A;  3V7C A;  1VQ9 A;  2ZIM A;  5C0X G;  3CMA A;  4P74 A;  4DAM A;  1T9H A;  1Z7M A;  1HH2 P;  1X3G A;  5GAG C;  3S2D H;  3W5O A;  4DR7 Q;  3VQY A;  1EWI A;  4B3T L;  3QO8 A;  5GQO A;  2MFI A;  5GAD C;  1G6P A;  3V7R A;  2R6G A;  1UE5 A;  1HR0 W;  3CPF A;  1OXT A;  4A75 A;  4E51 A;  3G4S A;  2JA5 G;  1KOG A;  2IT1 A;  3UDX A;  4HJA A;  2NN6 I;  2HT1 A;  2VQE L;  3CC4 A;  2P5I A;  1H4S A;  1S72 A;  4XTW A;  2N3S A;  2N8N A;  1PYS A;  3OW2 A;  4GKK Q;  4QY7 A;  1KRS A;  4JI2 L;  3FHW A;  3HOX H;  2I4M A;  2E3C A;  2H5X A;  2WP8 J;  5LMU L;  1IBM Q;  3NEL A;  1NJ2 A;  4HID A;  4YCW A;  5GRO A;  4H02 A;  3T1Y Q;  1QVF A;  4P71 A;  3BU2 A;  3CQZ H;  5BR8 Q;  3PSI A;  1L1O B;  1BIB A;  3QTC A;  4LW1 A;  3PUW A;  4LFA Q;  2EJ9 A;  1SRY A;  1VQZ A;  1XPR A;  1HXD A;  5C51 B;  2OCE A;  1UE1 A;  3K7U C;  1X2H A;  3PZC A;  4R4Q A;  3G71 A;  5AJ3 Q;  3A7U A;  3OTO Q;  3GTG H;  1YHA A;  3OTO L;  4XTV A;  4IOC A;  4KI0 A;  1USY A;  4HWP A;  1JJ2 A;  5AJ3 L;  3RR5 A;  3F8T A;  2G4C A;  1XMO L;  4P73 A;  1IBM L;  1QE0 A;  5M3F H;  1K73 C;  4YDQ A;  1VQ7 A;  3S1M H;  4DR6 L;  4YRI A;  3I55 A;  4GKK L;  4OO1 G;  4YRM A;  3EFS A;  1GGM A;  2B3G A;  3GTP H;  4A3K H;  5C4X H;  2JA8 H;  4R4I A;  4R4O A;  4A3E H;  3FKI G;  3PUY A;  2I4L A;  4YCU A;  3A31 A;  2VQE Q;  2Y0S E;  1CKN B;  4BBR G;  4DV3 Q;  4HWR A;  1J6Q A;  1VQN A;  3TQY A;  4RQF A;  3HOU H;  3CCV A;  3HOV H;  3RZO H;  4EQ5 A;  1KIX A;  3TS0 A;  1K8G A;  4UP8 A;  1ATI A;  4NXN L;  4A3J G;  4JI4 Q;  2CJB A;  4HJ8 A;  3RLO A;  3W1G A;  1CKN A;  3ZJY C;  4A3F H;  3TS2 A;  4TVY A;  3CCL A;  5JJL A;  4YP0 A;  4LF5 Q;  2LSS A;  1G5H A;  4LF8 Q;  1I5F A;  2RHQ B;  4YY3 Q;  1NE3 A;  3CAM A;  1PV4 A;  4WJ4 A;  2Z6K C;  2E2I H;  3L4G B;  4JI6 Q;  1C7Y A;  4JBK A;  1B7Y A;  4C3J H;  3KF8 B;  3RN5 A;  2VZA A;  4LFC L;  4JI8 Q;  2QA4 A;  4GNX C;  4JCV E;  4IPG A;  1VCI A;  5LMN L;  2DXU A;  1PH7 A;  1L1O A;  4GOP B;  4K87 A;  4AYB E;  4JOI A;  2VS1 A;  1HZC A;  5C4X G;  1B70 A;  4DV0 L;  4CS4 A;  4GN4 B;  1Q8K A;  3S16 H;  1N32 L;  1QUQ A;  1YVC A;  3KF6 B;  1WQ7 A;  3M85 A;  1TWF H;  2E10 A;  3HFV A;  4LUV A;  2OQK A;  2I5H A;  4P74 C;  1X56 A;  3J81 j;  2ZJR A;  1TWH H;  4IFD G;  1WU7 A;  3M4O H;  4YRR A;  3GO5 A;  2K4K A;  4J15 A;  3U58 A;  2KEN A;  3KJO A;  3UGT A;  3G6E A;  3CCQ A;  4CH3 A;  3RF1 A;  4KHP Q;  3S24 A;  2EJF A;  1N36 Q;  2DEQ A;  2DVE A;  1Q12 A;  2ZGW A;  5IYB H; 
#chains in the Genus database with same CATH topology
 1LTT D;  1RKN A;  4GLX A;  1EY7 A;  2ZTC A;  4DV6 Q;  2K1B A;  4TKO B;  5KNN A;  5C3E H;  4NP5 A;  1VQJ A;  2KOL A;  1I50 H;  1YHQ A;  4GS3 A;  2QKI C;  4HAE A;  4JI1 L;  3I2Z A;  4A76 A;  4A3K B;  1SN8 A;  1U4M A;  3MC0 B;  1WTX A;  2EE1 A;  1D2B A;  2UUB L;  1D5M C;  3NEM A;  3NWT A;  3J81 L;  1KMM A;  1GUN A;  2FIN B;  3GTM H;  3CCR A;  1SSO A;  1U4R A;  5C44 H;  2Q2H A;  2E8G A;  4ZUI A;  1QNK A;  1SE8 A;  3URY A;  4XXE A;  5C0X J;  1TS5 A;  5FJ8 H;  4XU2 A;  3LGJ A;  2E5L L;  1EVL A;  1RTN A;  3TEH B;  4K8J A;  4NCX A;  3HXV A;  3MEY A;  4G7Z C;  1BBU A;  3EFR A;  4PZ6 A;  3HOW H;  5JJI A;  3S16 B;  1VQB A;  4CKC A;  1AE3 A;  4HVC A;  1X54 A;  2IY5 A;  4ZLT F;  1KLG D;  1FR3 A;  4GOP C;  4C3H B;  2RBM A;  4K5V A;  3RLN A;  4XIG S;  4BY1 B;  3I3C A;  3LWE A;  1Q82 C;  1GM5 A;  1WI5 A;  3GQB A;  4UP9 A;  1D1I A;  1VQK A;  3B6Y A;  4OGQ C;  4JI7 L;  1B50 A;  1LLR D;  2R7Z H;  3FDT A;  3VQX A;  4YRQ A;  1N34 Q;  3KFU A;  2B2V A;  4FXG C;  2K04 A;  2RSN A;  1K8M A;  3HOW G;  1HQR D;  1E7Z A;  1Y8O B;  1CQV A;  2JK8 A;  5LL6 S;  2ARU A;  3L4G A;  1XYI A;  1SE4 A;  3D4R A;  1MGS A;  4A3B H;  1TQO A;  3ZYY X;  3PIO A;  2F03 A;  1NJ1 A;  2L11 A;  4A3I H;  4X65 Q;  1F2Z A;  5CV8 A;  4HIO A;  4JPB W;  1SDF A;  2C35 B;  1AEX A;  2XGT A;  4KD4 A;  1HFN A;  2D5D A;  2SNM A;  1E2V A;  1K3R A;  2HIX A;  2Q7G A;  3V7S A;  5IT9 c;  3KBG A;  4K2L A;  4YRF A;  1Y8P B;  1VQE A;  3DM1 A;  1JQY D;  2AUJ D;  4A3G B;  3PCO A;  1BOS A;  3ERR A;  4BWA A;  4P73 C;  3U4V A;  1PZI D;  4YY3 L;  2BA0 A;  5IYD G;  4CDC C;  1RD9 D;  1GKH A;  1SES A;  2NZH A;  1CFM A;  1NYQ A;  1XMQ Q;  3K0Y A;  3UDI A;  4JI6 L;  3CHB D;  2WAQ B;  4TVA B;  1KQS A;  1XPO A;  2OEO A;  1HNW L;  1IYJ B;  5M5X B;  2ZNJ A;  1BKB A;  4HWT A;  1GD7 A;  3STB C;  4H44 C;  3IFD A;  4PZ8 A;  3A5Z B;  3WOE A;  1DXM A;  1YHB A;  5BN3 A;  1Q86 C;  4AIM A;  1TWH B;  4QJF A;  3IRB A;  1HZ9 A;  2DKG A;  1JT8 A;  1O78 A;  4RGT A;  1I6H H;  4KD3 A;  1LT5 D;  4JI4 L;  1Y1W B;  1KTK A;  2EY1 A;  4ZQ3 A;  2KCT A;  3EBE A;  3I4N G;  2B63 G;  1FNU A;  1S5E D;  3RLF A;  4DR6 Q;  1C9O A;  4A3B G;  5C0X I;  1YZ6 A;  3ND8 A;  5H1S E;  3NBH A;  2JSO A;  1QF6 A;  2ZIN A;  4I65 A;  3NPP A;  4XDX A;  2P5Z X;  3ICA A;  5K36 G;  2Q7H A;  4YRN A;  4FF2 A;  1SYC A;  3IKL A;  1CSQ A;  5C4H A;  3RKY A;  5F2D A;  3HOW B;  3R93 A;  1U5K A;  2EJG C;  4XTC S;  1BUV T;  4FXK C;  1B1Z A;  1RIP A;  1RIQ A;  2F4I A;  4GN3 B;  4ID6 A;  3C1F A;  1HNX L;  1Z6H A;  2FXQ A;  1O80 A;  5M5W H;  2ZM6 L;  3WDN A;  2HIV A;  1N33 L;  2UXC L;  4A3L G;  2MO0 A;  1JWS D;  2R93 H;  3HY1 A;  1AE2 A;  1HJP A;  3A55 A;  3RD4 A;  5C44 B;  5IWA Q;  4P71 C;  1WTP A;  3MF2 A;  2YTX A;  2B2T A;  1A2T A;  2JP1 A;  2EQS A;  2CW0 D;  1KLU D;  2X6L A;  2JA8 B;  4FO2 A;  4LVL A;  3HOV B;  1DON A;  1N32 Q;  4NXM Q;  4B9W A;  2IHE A;  5C3W A;  4MIU A;  3K80 C;  4LF6 L;  1H9M A;  3MAQ A;  2L5T A;  1G8Z D;  4XTX A;  2MP1 A;  4I7Z C;  4DR1 L;  3T1H Q;  3TSS A;  1HFG A;  2SDF A;  4DN4 M;  1B76 A;  1X3F A;  2K5D A;  3HRZ C;  2ZNI A;  2K52 A;  1PZJ D;  4JW0 A;  4A3F G;  4IPH A;  1PTO D;  2TSS A;  2K5W A;  1SMX A;  4A93 B;  4RWS C;  1WJJ A;  1M1K C;  2DN8 A;  3J80 L;  4DR3 Q;  3J7Z C;  3G7L A;  4BY1 H;  1LTS D;  1HQM C;  4IUP A;  3R07 A;  4I7A A;  4X3T A;  1B7Y B;  1YNJ D;  2OXP A;  5KYI A;  1STH A;  1VQP A;  1JJC A;  4RA8 A;  1SMY C;  4P2C B;  1SYB A;  3AYH B;  2Q8I B;  1MI2 A;  1YFS A;  2J3M A;  4X66 L;  1CHP D;  3X3M A;  2J3L A;  4IJL A;  5C0X H;  3PO2 G;  5E3I A;  1H9S A;  4RHR A;  4BBR B;  2ZCE A;  4AQY L;  3SHL A;  2NVY H;  5FKA C;  1YJN A;  4LNQ A;  5FO7 B;  3A8K E;  2JEA I;  5COR A;  2NZO A;  1EOV A;  3K7A H;  3A5Y A;  4EQN A;  5BR8 L;  5DAU A;  3TP7 A;  1HNW Q;  5ELC A;  3LNN A;  2BE5 C;  1PFM A;  5CBA E;  5E7N A;  1BF4 A;  3GV3 A;  4TQD A;  4NXN Q;  1EOT A;  3J81 c;  3NSW A;  2LMC B;  1PRT F;  2FHT A;  1ESR A;  3A7A B;  3MXU A;  2DJF C;  4J8Q A;  4PMB A;  2AMC B;  3FKI B;  1HTP A;  2NVQ H;  3CMQ A;  2CH4 W;  3RNU A;  2PNH A;  5IP7 H;  1SMY D;  4C2M B;  1CUK A;  3DLL A;  1V1O A;  2CIM A;  2JN4 A;  4L5S A;  2A6H C;  5T1G A;  1F9S A;  2WV6 D;  1X3P A;  5BN4 A;  3VR2 A;  4A3M B;  4A3D H;  4HCS A;  4DV1 L;  5LMN Q;  1XNQ L;  4X65 L;  2JJQ A;  1NY4 A;  1JJG A;  5IGE A;  3CCJ A;  3SR1 A;  2E2H B;  2FFK B;  1MHW C;  3OIP A;  2WFW A;  1YEZ A;  4LFC Q;  1LAB A;  1YI2 A;  3IKM B;  4FNF A;  1BO0 A;  1OXU A;  2B29 A;  4DAP A;  4YRK A;  3E0J A;  1BNZ A;  3S15 H;  3V2T A;  1WOC A;  4LFB Q;  3OHX C;  2CFM A;  4RCN A;  4KY6 A;  2JA6 B;  4RFB A;  4O1N A;  2Z4I A;  4R8N A;  3W2D A;  2VY3 A;  4DR2 Q;  5KYL A;  3KLS X;  5EPJ A;  5CR3 A;  1UWV A;  4LF8 L;  3J7Y W;  4KR3 A;  1PRT D;  4OWX B;  4CS2 A;  2YTV A;  3OMC A;  1PH3 A;  4B3M Q;  2MGS A;  2DTO A;  2UUB Q;  4O0A A;  4G7O C;  5M9O A;  3IAY A;  1EUJ A;  3W3S A;  4LFB L;  2MO1 A;  5HY6 A;  2DTH A;  4NMZ A;  1BBW A;  11AS A;  3C1E A;  3KBX A;  4BY7 H;  1SJH D;  2RHS A;  4A93 H;  2Z1C A;  3L9A X;  2B63 B;  2K5Q A;  4JV5 Q;  4RDX A;  4N8X 1;  1B3Q A;  3CC2 A;  4BY7 G;  4YPF A;  3H0G B;  2E5A A;  2B2Y C;  4NDX A;  2DDZ A;  1H4Q A;  1J5W A;  4KHP L;  1ASZ A;  2F0Q A;  3JAM i;  1SBB B;  4JBM A;  2FJ2 A;  2MJ8 A;  3QJY A;  4ZK9 B;  1WD0 A;  1H9J A;  3HXX A;  1E2W A;  1NMF A;  1EL0 A;  3K59 A;  4LF7 L;  1Z7T A;  4YRC A;  1A3V A;  4FF4 A;  2BDN A;  3M4Y A;  1BBX C;  2Q2U A;  3QNE A;  5D3D A;  3PQI A;  2Q7E A;  1PTO B;  1O7L A;  5D3I B;  1G5I A;  5CYU A;  3GTJ H;  4ZYS A;  4OEL B;  3GD7 A;  1PH6 A;  3HS0 C;  4DQ2 A;  2A6H D;  1VDZ A;  4LF6 Q;  4TVA A;  1EEF D;  2PCF B;  4P75 C;  1SFO H;  4HJ5 A;  3QR8 A;  1XWE A;  1LYL A;  4JBJ A;  4O42 A;  2HHH Q;  3WQZ A;  2ZJQ A;  4UHV A;  1Y14 B;  1TWA H;  4LWC A;  1EZ8 A;  2PYK A;  4GOP A;  4F8M A;  2QEX A;  1WCM H;  3DWA A;  4H2X A;  1ZYR C;  3G48 A;  4EQO A;  4QB4 A;  1H4T A;  5C6A A;  2RF4 A;  2YV5 A;  4YRL A;  3U50 C;  3Q24 A;  3RZD H;  1ADJ A;  1VF7 A;  4DNI A;  3HOU G;  1SNP A;  1QIL A;  5NUC A;  3PUV A;  1I4P A;  2QDL A;  1AW7 A;  2X69 A;  1X6O A;  3J80 i;  4DUY Q;  4KQE A;  3H15 A;  2PMF A;  3VDY A;  4DV2 Q;  3PO3 H;  4BW9 A;  1A0I A;  4HMJ A;  4HA8 A;  4G85 A;  3CPW A;  1JOO A;  2WKC A;  5EAY A;  4DPG A;  2HQL A;  1XXG A;  2K75 A;  1LM0 A;  1AFP A;  4DV7 Q;  2ZXP A;  2RDG A;  1VQ6 A;  2ODR C;  1T5X D;  4ZAI A;  4NXM L;  1KDA A;  2Z0S A;  4OIJ A;  1B8A A;  1V8Q A;  3EFX D;  1LUZ A;  1XNR Q;  2NWG A;  4LF4 L;  1I50 B;  3KUP A;  2EYP A;  4GLA C;  1VQL A;  4OP0 A;  1YIJ A;  3REU A;  2JA6 H;  3H0G H;  4JI1 Q;  5IWA L;  2IL8 A;  3IL8 A;  1VQH A;  2C5C A;  1I3Q H;  5JEA H;  4C3H G;  3H0G G;  3ND9 A;  4JYA Q;  1Y69 U;  2ZR3 A;  4DK6 C;  2KEC A;  3GTO B;  1ASY A;  4DXF A;  4JK1 C;  3I90 A;  1G2S A;  4X64 L;  2CWA A;  3K57 A;  1AZP A;  1Q46 A;  4H2T A;  2SEB D;  4WRD A;  1YNJ C;  1I94 L;  5IYB G;  3PGZ A;  4Q15 A;  3A7A A;  3K6O A;  1HTL D;  2F0U A;  4DNR B;  1NR2 A;  1X55 A;  5FLM G;  4B3S Q;  5KRU A;  4A3K G;  1WCM G;  1Y1V B;  4F7X A;  3T1H L;  4H2V A;  1RTO A;  5L37 A;  3TEG A;  2OWO A;  4OWT B;  4IJH A;  4X6A H;  2OTL A;  3TZD A;  3D3R A;  1WNL A;  1W66 A;  2R3Z A;  2ZZG A;  1DYQ A;  3TBI B;  1NNH A;  3RGL A;  1Z9F A;  1NJI C;  2AHO B;  4X62 Q;  3IG2 A;  3C2P A;  2EY2 A;  4JG2 A;  4Q0F A;  4DUZ L;  2ZM6 Q;  2N78 A;  1L0W A;  4JI0 Q;  2OTJ A;  4U68 A;  3VA7 A;  2I5L X;  3BDO A;  4JI0 L;  1G29 1;  3W3A A;  3EVQ A;  1PFS A;  4OIK A;  3GTK H;  2HNI A;  5M3F B;  4ODG A;  4OX9 Q;  4FVM A;  2KHI A;  4R4T A;  4IFD H;  4RGO S;  4N8F A;  3I70 A;  1S40 A;  5LMU Q;  4EX5 A;  2GVB A;  4LVM A;  3TRE A;  3D4W A;  1YJW A;  2NS6 A;  1O7Y A;  2VQF L;  4LUO A;  5EQ0 A;  1FJG L;  4GNX A;  3HOZ H;  1PZK D;  4QMG A;  4DR4 Q;  3D8G A;  5HGT A;  4Y52 H;  3CW2 C;  4TSS A;  1MJE A;  3H91 A;  1H95 A;  4HJ7 A;  2UXD L;  4JOI C;  1KRT A;  1V9P A;  3J81 i;  1M90 C;  2RQX A;  5IGG A;  3S1R B;  2DY7 A;  5EJW A;  4HN7 A;  2I5M X;  3W1B A;  2Q8T A;  2Z8L A;  2JEB I;  4A3E B;  1I4H A;  2G9D A;  4RQE A;  3PMF A;  2BA1 A;  4XQQ A;  5FLX L;  1SFO B;  4ZKC B;  4L63 B;  4PZ7 A;  1H9K A;  2F0N A;  2VL6 A;  1H9S B;  4L8J A;  4XTZ A;  1NNX A;  3KLW A;  2NBF A;  1BVS A;  2PQA B;  1D5X C;  3F2D A;  5IT9 E;  2MNA A;  2Y0S B;  2JA9 A;  3HKZ B;  4IUV A;  1DZ1 A;  1VQ5 A;  4HR7 B;  3EIV A;  2MPM A;  4QF4 A;  5CV7 A;  1KNA A;  4XQJ A;  3E0E A;  3C46 A;  2L4N A;  3TP6 A;  4EO4 A;  2KHJ A;  2P0L A;  4P72 A;  2DZ9 A;  2AKW A;  1SYF A;  1E1O A;  3VR3 A;  2QCP X;  2PMZ E;  1J8I A;  3MF1 A;  5CMD A;  1F9R A;  2WAC A;  3V96 A;  1WTW A;  4X64 Q;  3ERS X;  4DAV A;  1SE3 A;  5I6Y A;  2IX1 A;  4CHT B;  1Q3L A;  4DV5 L;  2M9V A;  3HKZ E;  3KYH C;  2CVR A;  3ERQ A;  1FVI A;  1SNC A;  1W3S A;  1X3Q A;  2ZT6 A;  4IQZ A;  5CV6 A;  3X3N A;  1GO3 E;  4YRS A;  1TS2 A;  1IBL L;  4L5T A;  2PI2 A;  2HCC A;  3I7F A;  4YIJ A;  4B3M L;  4TWA A;  1GUS A;  2OF1 A;  1XNR L;  4LVJ A;  4DKA C;  3D4D A;  3J7A V;  1WFQ A;  3D31 A;  5FLX E;  3F2C A;  3GDE A;  1MJC A;  1NYR A;  1RJT A;  3MVV A;  1X2G A;  1TU2 B;  2BH8 A;  1QB5 D;  4ME5 A;  3VA5 A;  3PO2 H;  3MEF A;  2HHH L;  4KN4 C;  2BOS A;  1VQI A;  4N9P A;  4NW2 A;  1YGB A;  5M5Y B;  3GTO H;  2ICE C;  4CBV A;  2F3I A;  1V43 A;  1EZ6 A;  1W2B A;  3REX A;  4OON A;  3J80 E;  2WB1 G;  2KHS A;  2DU5 A;  5K36 H;  1SAP A;  1PYW D;  4UPA A;  5FOB B;  3QO7 A;  2WB1 E;  1JWM D;  3FEW X;  1EFW A;  3DHQ A;  1VQA A;  2B8F A;  2NTT A;  1Y1W G;  1LTA D;  2I46 A;  3MXN A;  2ZXO A;  4B3R L;  1AP0 A;  2F52 A;  3I91 A;  3I4M H;  2IJ0 A;  3SK8 A;  1L2F A;  4OWW B;  1SYE A;  1I3Q B;  1S4Z A;  1VS0 A;  4A3B B;  3BDC A;  2NVT H;  1TVX A;  2C8M A;  2NB0 A;  2UXB Q;  3TP8 A;  3H3V C;  4POF A;  1Q81 C;  2R7F A;  4OO1 I;  3TUP A;  3K8A A;  4R4C A;  3TZU A;  2E2J B;  4CH4 A;  3EA6 A;  1O7I A;  3LWU A;  3JC6 6;  2SOB A;  2G9H D;  1JE5 A;  2ASB A;  1VQC A;  3I4N H;  2EWN A;  4A3M G;  2QW7 A;  5KNC A;  4XT1 B;  5FK9 C;  2D9U A;  2RDH A;  1Z7N A;  5C3E G;  1SRU A;  5D65 A;  2CH4 A;  3M4O B;  2NVY B;  3HXY A;  2B2W C;  1EU3 A;  1F2L A;  3A54 A;  3RAC A;  4LMQ D;  1EYG A;  4QIW B;  2XRQ D;  1VQ4 A;  2QIL A;  1PFN A;  1S5B D;  2EL9 A;  3RUX A;  3IAL A;  1STN A;  2F0W A;  1J5E L;  1HA6 A;  2PW5 A;  3OD1 A;  2WAQ G;  4G4K A;  3FPU B;  1PTO H;  4C3I G;  2R92 G;  5I6W A;  1PA6 A;  1SER A;  2RVL A;  2EXD A;  1BQQ T;  2ICI A;  3UH0 A;  1EIF A;  1SE2 A;  5IIF A;  12AS A;  3GTG B;  4IUU A;  2KA7 A;  1ICF B;  3OSO A;  1HRJ A;  1JR0 D;  4RHS A;  4AYB G;  4CGY B;  1WLE A;  2AQ2 B;  4DV3 L;  1EWH A;  4CH6 A;  4DU9 A;  2I4O A;  3H3V I;  3DM3 A;  4OLF A;  3ULP A;  4DK3 C;  3I8Z A;  4GKJ L;  4A93 G;  4V0B A;  4NPS A;  1WTV A;  2D2C C;  4DV4 L;  4XU1 A;  4LUZ A;  1EY4 A;  3T16 A;  5EPL A;  3I4O A;  4DV4 Q;  2A5H A;  3MTS A;  1Z47 A;  3F2B A;  2SNS A;  3M4P A;  2E1H A;  4YRP A;  3RUZ A;  3V8K A;  1DD2 A;  2CHB D;  3VR6 A;  3I72 A;  3BYY B;  2PO4 A;  3RL6 A;  1LTI D;  2ALY A;  3VBB A;  2LFN A;  1YJ9 A;  5M5Y H;  2K03 A;  5IP7 G;  3BYT B;  5EPK A;  1GUO A;  2F0T A;  1CZW A;  4X3S A;  2ZXF A;  1JMC A;  3AB9 A;  4DA2 A;  5JEA J;  1TWA B;  5E4W C;  1PH8 A;  4PHC A;  1HR0 Q;  2ZT5 A;  1SEB D;  1EIY B;  5IY0 A;  2AWN A;  2Q2I A;  4B3T Q;  2D0P A;  3HEJ A;  4DR7 L;  1LTB D;  2EY5 A;  3QO2 A;  3L2P A;  3HRI A;  4KR2 A;  1VQO A;  5M5X H;  4BY1 G;  4H7B A;  3PIP 3;  5JOB A;  3M9B A;  3RZD B;  1EY8 A;  1KDB A;  2KQ3 A;  3R2I A;  3CCS A;  2ZZE A;  3MXP A;  2L9H A;  4BWG B;  1J5E Q;  4KMU C;  1U0L A;  2K14 A;  5J39 A;  1PHJ A;  4GN5 A;  4KKT A;  4LF5 L;  2E2J H;  1Y8N B;  3ULJ A;  1ZEQ X;  2ZIO A;  2CGH A;  4PMC A;  4LAA A;  2GN5 A;  1Q90 A;  1M8A A;  2NVT B;  1RCV D;  1ESF A;  3ONA B;  2A69 C;  1SNO A;  5IYC G;  3DMU A;  3Q23 A;  3HRK A;  1MSG A;  2EXZ A;  1SXT A;  3PUX A;  2KBN A;  4DK0 A;  4XU0 A;  1C8C A;  4MN3 A;  5ELF A;  1EQR A;  1KD1 C;  1EYC A;  2A8E A;  1EWC A;  2KCN A;  5IE8 A;  1V1P B;  2F0H A;  3NBI A;  1HNZ L;  4KV6 A;  1EY6 A;  1A8V A;  1LO5 D;  1B9N A;  1SR3 A;  4G57 A;  3SE0 A;  1Y1W H;  1UE6 A;  1YFT A;  1BIA A;  3WOF A;  4B3R Q;  4H2U A;  4HWS A;  1MIU A;  3A7R A;  4V19 0;  4DR3 L;  4TQU S;  5KNB A;  1DJR D;  2O2L D;  1IL8 A;  2ZTE A;  1UEB A;  3N6R A;  2VQF Q;  5I9P A;  1VQD A;  1LTG D;  1PRT B;  1PYS B;  1ZKO A;  5IGB A;  2DJG C;  3OWF A;  3K5L A;  1FGB D;  5FLX c;  4ZCK A;  5EGT A;  2R93 B;  3OIQ A;  1E1T A;  1QE6 A;  3I73 A;  3GTL B;  4A3I G;  1WTH A;  3E9I A;  5ELE A;  2UUA L;  1ONL A;  3BZC A;  2J0T D;  3NE5 B;  2E41 A;  3ULL A;  4ABN A;  5IYC H;  1KAA A;  4MNO A;  4H2X B;  2CQA A;  3MQZ A;  1SJE D;  4OXP A;  1CHQ D;  4IN3 A;  4F87 A;  2NVQ B;  2UXC Q;  3CC7 A;  2IPK D;  5LMN W;  1N34 L;  4YYE A;  2RHS B;  2PW7 A;  1IKL A;  3KF8 A;  3S2H B;  3PUZ A;  1HNX Q;  4LNS A;  2HDM A;  3KK7 A;  4YWL A;  2EJG A;  4JI2 Q;  1JB7 A;  3Q8D A;  1KMN A;  3KOJ A;  5FO9 B;  1E3P A;  3TP5 A;  4PG3 A;  2RHQ A;  5JVH 3;  3AFP A;  2ZR2 A;  3UE1 A;  5JJK A;  4B3S L;  2KJX A;  3AU7 A;  3NWS A;  2HUG A;  3K7A B;  2EOT A;  3D6W A;  3A5Z A;  4OX9 L;  1ILP A;  4ZRZ A;  1KAW A;  1B9M A;  4WI1 A;  2QEJ C;  1I4X A;  3KDF B;  3CXC A;  4KTA A;  2DQ0 A;  2NN6 G;  5F5W A;  3V8J A;  2K50 A;  4LF4 Q;  1XMQ L;  5COY A;  2IX0 A;  4JI3 L;  4BY7 B;  2UXD Q;  4ULL A;  4GLV B;  4ZUJ A;  5K5P A;  1VMC A;  1IBL Q;  4RKL A;  2B63 H;  3CME A;  2F3V A;  1U4L A;  4IOA A;  3S1N H;  1PH9 A;  2IY5 B;  1PTO F;  2E75 C;  2ALY B;  4TQF A;  4LVK A;  1KL9 A;  1Q1B A;  2Y0S G;  3CCU A;  3LX0 A;  3DSQ A;  2XTI A;  5J3B A;  1JB3 A;  2DU7 A;  1X9N A;  2QF7 A;  4DR5 L;  1FYF A;  5J22 A;  4DR4 L;  3CD6 A;  2QHS A;  4TVW A;  2NVX H;  1EQT A;  5JPM C;  3M7G A;  2E74 C;  3MA2 B;  4S3S A;  4BBR H;  1PRT C;  3DEO A;  3HKZ G;  3K5O A;  3MEH A;  3NEN A;  2V4D A;  1R9T H;  4RH6 A;  5I4D A;  4G84 A;  5ELN A;  3M3Y H;  4JBW A;  4RG1 A;  1NJ5 A;  2CQO A;  1QOH A;  2F0E A;  1ENA A;  3OYY A;  5E1F A;  2VUM H;  5IGC A;  4YWK A;  3EN2 A;  4JI7 Q;  1JWU D;  2VB2 X;  1UNS A;  3RKX A;  1EFI D;  2PMZ B;  4A3C H;  4KJN A;  4A3M H;  1XPU A;  4CDF C;  3GP7 A;  3I4M G;  1V1P A;  1SRO A;  4IAL A;  1PYB A;  2WKD A;  4P3N A;  3PO3 G;  4DUY L;  4DGZ A;  4A3J H;  2AKW B;  4HWO A;  4L87 A;  3VQV A;  3JAM L;  2F3W A;  3I56 A;  5DM6 3;  2VW9 A;  3FKI H;  4YRJ A;  5JJZ A;  1E2Z A;  1GUG A;  2EYL A;  1KXL A;  2CCZ A;  1G91 A;  2DQ3 A;  5HGQ A;  2EIF A;  2A69 D;  1HXY D;  2QGQ A;  1STA A;  3DXJ C;  4QQB X;  1N36 L;  2I4N A;  2KEE A;  3NXW A;  3HOZ G;  3KLR A;  3QG1 A;  4RGM A;  1VQM A;  1MBY A;  2VUM G;  1E22 A;  2JA7 B;  1GXD C;  4YRO A;  2FYK A;  3CCE A;  4QIW E;  3H3V H;  5M3F G;  5C4X B;  2RCF A;  1I4Q A;  1WTQ A;  3HOY H;  3NET A;  4X3U A;  4U67 3;  1I6V C;  4C3J G;  2XRS D;  2Q2T A;  2KCM A;  1RL2 A;  3U4Z A;  4LVI A;  4JYA L;  2AQ3 B;  5LHY 1;  1TWG H;  1KC8 C;  3WWV A;  1DOK A;  2B2Y A;  5JPN C;  4QGU A;  3P75 A;  1TXY A;  1HC7 A;  3AFQ A;  2PZT A;  3ICE A;  4KY5 A;  1ENF A;  3F1Z A;  2M2L A;  4QUC A;  4QCL A;  1G2T A;  4P72 C;  2C7I A;  3V8L A;  4CJ1 B;  1CKM A;  1JC7 A;  3HKS A;  2K7V A;  1USY C;  3PV0 A;  1TII D;  1R4P B;  2RDF A;  1UEA B;  2A19 A;  2K01 A;  3G1Z A;  3CU7 A;  1WCM B;  2ZJP A;  3DEP A;  1S5C D;  4LF7 Q;  5A2Q E;  3HFZ B;  4XTU A;  1WTR A;  1IYU A;  2UU9 Q;  1X65 A;  3P8V A;  3L2Z A;  1F9Q A;  3CF5 A;  4P3O A;  5C5L A;  3HOV G;  2YU9 H;  2E2I B;  2JA8 G;  5CGK A;  4DV6 L;  3TEH A;  4OEM B;  4CDD C;  5I2Y A;  3LSS A;  2K5H A;  2PQE A;  4XEM A;  1SLJ A;  4JV5 L;  2JYO A;  1FL0 A;  4NB3 A;  3L0O A;  1DGS A;  4DV0 Q;  3DWP A;  3BZD B;  1BCP B;  2A8V A;  2H1E A;  2IHF A;  1EY5 A;  1FNW A;  1XTD A;  4LF9 Q;  3VYT A;  3HOU B;  3BVZ A;  2J7Z A;  4K86 A;  2IX3 A;  3HOY G;  2A68 C;  4C3J B;  5DM7 3;  5C4J H;  1XX8 A;  3GTK B;  5LL6 X;  2F4V Q;  2E2D C;  4A3E G;  1A3T A;  1CKO A;  2ZT7 A;  2JA5 H;  2ARS A;  2EJM A;  1WQW A;  5JAV A;  2ZTG A;  4BA2 I;  1GHK A;  2VUM B;  3CRL C;  4C1N I;  2HDL A;  1I6H B;  2AMC A;  2XVS A;  3H6M A;  3E3X A;  4YHH Q;  1KHI A;  2PNR C;  1U4P A;  1E24 A;  4DR2 L;  1EY0 A;  1XMO Q;  3T51 B;  2EPB A;  5ISR A;  3CCM A;  1W6K A;  1GUT A;  4K6D A;  4H2W A;  1NBW A;  3PIP A;  1XTC D;  3S1R H;  3HOX G;  2JXM B;  3HOY B;  4KHZ A;  1TWF B;  2CW0 C;  1ML0 D;  4JI8 L;  1YNX A;  1HZB A;  3K5N A;  3N52 A;  4ILW A;  1OTC A;  1D1K A;  1M4V A;  2RA4 A;  3K5M A;  2RSO A;  4IFD J;  5M3M B;  3CRK C;  1A3U A;  3QOJ A;  3P20 A;  5FLM H;  3F2U A;  1P8L A;  4XU3 A;  2RCN A;  1WTO A;  4POG A;  1TS4 A;  4IPD A;  2DXT A;  2EAY A;  4CH5 A;  1RDP D;  1Y1V H;  4DXG A;  3VYU A;  1P16 A;  2RKS A;  4LF9 L;  4LFA L;  3H09 A;  1STE A;  3NHH A;  1BCP D;  3L7Z C;  4X66 Q;  2WII B;  1TT2 A;  3UFG A;  1OO9 B;  1YBY A;  4C3H H;  1EIG A;  3J80 c;  1NTG A;  1V1Q A;  1PDQ A;  4O2D A;  4MTN A;  2PQA A;  3P8Y A;  4K0K Q;  2UUC L;  1K28 A;  3BFM A;  2C9O A;  1QVG A;  1EYD A;  1XNQ Q;  3MXN B;  1NMG A;  1Q8I A;  2AQ1 B;  3L3O C;  1EIH A;  1GVP A;  3BVG A;  2Z4H A;  1Q1E A;  1OXS C;  4TTV A;  1VQ8 A;  5EKL A;  1QUQ B;  1Y1V G;  3OPO A;  2CJ9 A;  5K1P A;  2BH2 A;  1I4R A;  2E2H H;  1B2T A;  4Q6G A;  3STB D;  2LXK A;  1F2Y A;  1HZA A;  5DLQ E;  1WVL A;  3MFG A;  2CJA A;  3E9H A;  3ERO A;  4YCV A;  4JI5 L;  4MZ9 A;  2JA6 G;  3S9W A;  2IWH A;  4AQY Q;  2F0G A;  5EKI A;  3BS1 A;  2QHV A;  3HXW A;  2K5N A;  4ZTU B;  4WFN 3;  1N33 Q;  3HOZ B;  1OXX K;  1VMP A;  2R7Z B;  2OQ0 A;  5M3M G;  5KGU A;  3K81 C;  4UDU C;  2L15 A;  1PH2 A;  3KDF A;  4OHJ A;  1XJV A;  2K5V A;  2F4V L;  1UE7 A;  3SK5 A;  1KAB A;  4MHE A;  1ZYR D;  4JI5 Q;  3HP3 A;  3VQW A;  3GTM B;  4BXX H;  1STY A;  5C3X A;  4FP5 D;  4UP7 A;  4DV7 L;  2VNU D;  1OXV A;  2UUA Q;  5K1X A;  5IP9 H;  3S17 B;  1WPY A;  3NP8 A;  2MQH A;  3RKW A;  2F0L A;  1HUN A;  1Q7Y C;  5GAE C;  1YNN C;  4ME3 A;  1DOM A;  2E64 A;  4F88 A;  1PH5 A;  3J7A F;  2DZC A;  3BDL A;  1N8R C;  3HXU A;  4L5R C;  4HMI A;  1BCP C;  1K3B C;  3VR5 A;  2VB3 X;  1CQF A;  4DFA A;  3HXZ A;  1MSH A;  1EQQ A;  3HY0 A;  4RMF A;  2YTY A;  4AYB B;  1ZXT A;  4CDE C;  1EVK A;  3L1A A;  2A6E D;  5C5M A;  3S14 H;  3HTZ A;  4IPC A;  3ER0 A;  3NBH B;  4XEO A;  1B70 B;  2ATW A;  4H13 C;  1FD7 D;  1PH1 A;  4XTY A;  5I2X A;  3A56 A;  3M7N A;  1PVO A;  1D7Q A;  3CP0 A;  2UUC Q;  3HZX A;  4A3D G;  3PIO 3;  3T4A C;  5EBC A;  4Y7N H;  3PO2 B;  3TRZ A;  3BZK A;  5HUR A;  4L5Q A;  2TMP A;  4RAU C;  3GTL H;  2Q5H A;  4JI3 Q;  4GZY C;  2QHU A;  3SEB A;  5CV5 A;  1SET A;  4GKJ Q;  1CSP A;  1YNN D;  2JE6 I;  2QHT A;  2JQO A;  2O5I C;  4HJ9 A;  5BN5 A;  5IT9 L;  5IOC A;  1H9R A;  4KKU A;  4UY8 C;  1YB3 A;  4HIK A;  1D8L A;  3UI2 A;  1X32 A;  4QL5 A;  3RN2 A;  3MFY A;  5IGF A;  2KUM A;  2ZXR A;  2GVA A;  1GOZ A;  2XWJ B;  4EVO A;  3S2H H;  4R1J A;  1HNZ Q;  1CM9 A;  1JOQ A;  4DNT B;  2IW3 A;  4JC0 A;  1N9W A;  4Z9C B;  4A3G H;  2DNE A;  1WYD A;  4TRD A;  2B2W A;  3KLS A;  1RHP A;  1A62 A;  4RGN A;  2WB1 B;  1DCZ A;  1R9T B;  1FJG Q;  4K0K L;  2M00 A;  4X62 L;  3E6Z X;  1X3E A;  2PME A;  4XQN A;  3MXG A;  4K2K A;  3UDF A;  4WF2 A;  4LJZ C;  4YRE A;  1I4G A;  2LXJ A;  2NZ1 D;  4BBS H;  1VQF A;  1K0S A;  2F0J A;  3A32 A;  4PMW A;  4A3C G;  2NTS A;  4IFD I;  1TKW B;  3KJP A;  1IW7 C;  1IYV A;  3S17 H;  1II3 A;  2Z6B A;  5C4Z A;  2KVM A;  1A2U A;  1F77 A;  4KHV A;  1CA5 A;  3T1Y L;  1TWC B;  2JA7 G;  1S5D D;  2B8G A;  3A0J A;  4BA1 I;  4K88 A;  1A63 A;  1DOL A;  1MKH A;  3I4L A;  3I4M B;  3I4N B;  3V05 A;  2ODR D;  5E3F A;  1K83 H;  1X01 A;  1EIY A;  2JA7 H;  4FYD A;  1HR0 L;  1D6E C;  1S3O A;  3UDG A;  1ADY A;  3QO5 A;  4CS3 A;  1PH4 A;  3AQQ A;  2H4O A;  2R93 G;  4IUR A;  4A3L H;  4KLK A;  3S14 B;  3QB3 A;  5ELO A;  3ITP A;  1HUM A;  2QDB A;  2DUD A;  4H0L C;  4APV A;  2D0O A;  3PO3 B;  3SK4 A;  2N49 A;  1G51 A;  4H2S A;  1TWG B;  1IBK Q;  1HA5 A;  3A5U A;  5TSS A;  4P75 A;  4A3G G;  4H2Y A;  3SXH A;  4YHH L;  3FJP A;  3NQT A;  4LK1 C;  1HPC A;  2BDO A;  4YRG A;  4ZIB A;  1IZ6 A;  4DK1 A;  2CKZ B;  2DJZ A;  4ZKB B;  1STG A;  1FGU A;  1PLF A;  4K8I A;  3QOL A;  4ALP A;  2E5L Q;  4K5X A;  1BCP F;  2K33 A;  2ZZF A;  1QZH A;  2KCC A;  1AN8 A;  2FMC A;  1HTT A;  3BVM A;  1IBK L;  3J7A 5;  1NR4 A;  4XYO A;  4HIM A;  2DTI A;  1QJO A;  2HQE A;  2ID0 A;  4IO9 A;  1I94 Q;  2K28 A;  3SDZ A;  4C1N K;  5EKK A;  1PXU A;  3UGQ A;  1F2M A;  4HT4 A;  2A1A A;  4RCO A;  3FVQ A;  1B4O A;  2PPB C;  3RIR A;  1B53 A;  4AH6 A;  4KK7 A;  1NSN S;  3Q0A A;  4A3F B;  3U9O A;  3GTQ H;  1HHV A;  5C3E B;  3SVM A;  3KF6 A;  4G7H C;  3FP9 A;  4DV2 L;  1LT3 D;  2PI2 E;  2F0P A;  4CKB A;  4HSP A;  3OOC A;  1MD2 D;  1QVC A;  1UAP A;  3HFZ A;  1PTO C;  4GNX B;  5IGD A;  5FO8 B;  3J81 E;  4YWM A;  1LTR D;  2E76 C;  2A74 C;  2J4X A;  1A6X A;  2ART A;  4MTK A;  2E65 A;  2XIW A;  4R8I A;  2K05 A;  3M4Q A;  3VYS A;  3PF4 A;  2F0S A;  2DGY A;  2UU9 L;  2YYZ A;  3BJU A;  1L1O C;  1ILQ A;  4DR1 Q;  4FF3 A;  4C56 C;  5C44 G;  3D6C A;  2ZTD A;  3MZ5 A;  1S5F D;  1QCB D;  2EYJ A;  4PV1 C;  2ES2 A;  1NCV A;  2F0D A;  4FDB A;  3FMC A;  5C4J B;  2F0I A;  4C2M H;  4BBS G;  1LTL A;  1DM0 B;  3SGI A;  2L1B A;  2UXB L;  4WJ3 M;  1NJ6 A;  2A68 D;  2D62 A;  3OWE B;  2ZT8 A;  2PZW A;  3D0F A;  3UE0 A;  2R7Z G;  3VR4 A;  1YFR A;  1D5Z C;  4C3I H;  2R92 H;  3P8T A;  2AWO A;  2A6E C;  4PNY A;  4IUQ A;  3R3O A;  1TWC H;  1H4V B;  5M3M H;  2I0Q A;  5C52 B;  1C0A A;  3S1Q H;  4X5O A;  4A4I A;  2L12 A;  4BXX G;  2WAQ E;  4ZTZ B;  1YIT A;  3JAM c;  4DAY A;  1TS3 A;  2Q5I A;  3DUZ A;  4Y7N B;  2Z6K A;  1NJ8 A;  4JVZ A;  5GAH C;  1JJC B;  4YRT A;  5C53 B;  4XYQ A;  4DV1 Q;  1VQG A;  3PF5 A;  2F0M A;  2R7D A;  4EQP A;  4FXD A;  3O13 A;  1K0R A;  1K9M C;  1AH9 A;  3A74 A;  1JCK B;  5FJ8 G;  2DNC A;  1IHZ A;  1FNV A;  5IYD H;  3PCO B;  4DR5 Q;  3TDQ A;  4DUZ Q;  4RKB A;  1SNM A;  2XN9 C;  2BE5 D;  1TR5 A;  5I9O A;  1QZG A;  2CWP A;  3CQZ B;  4DAY B;  5JEA G;  4Q5V A;  1IL2 A;  3A7L A;  3LSQ A;  3GTJ B;  1K8A C;  3AEV A;  1SYD A;  5IP9 G;  4P3P A;  4DV5 Q;  1STB A;  2F0F A;  1IXR A;  3K0X A;  2V1C C;  3LC0 A;  4OL7 A;  3K58 A;  3V7C A;  2B2U A;  1VQ9 A;  1K83 B;  2ZIM A;  5T1I A;  5C0X G;  3A8I E;  2AUK A;  3CMA A;  4P74 A;  1EEI D;  1IKM A;  3DWQ A;  2X6G A;  4DAM A;  2LS0 1;  1B3A A;  1T9H A;  1LT4 D;  1Z7M A;  1HH2 P;  1X3G A;  3CKI B;  2Z9H A;  5GAG C;  3S2D H;  3W5O A;  3FRP B;  1R4Q B;  4DR7 Q;  3VQY A;  1EWI A;  4B3T L;  3QO8 A;  4M1U B;  5GQO A;  2MFI A;  1C48 A;  5GAD C;  1G6P A;  3V7R A;  1BR9 A;  4KJO A;  2R6G A;  1UE5 A;  1HR0 W;  5CV9 A;  4OO1 H;  5A2Q L;  3CPF A;  1OXT A;  3OW7 A;  4A75 A;  4E51 A;  2L0C A;  1JOR A;  3G4S A;  2JA5 G;  1KOG A;  2IT1 A;  3UDX A;  1BDO A;  4HJA A;  4J6H A;  2NN6 I;  2HT1 A;  2VQE L;  1E0B A;  1CK1 A;  3CC4 A;  4J1M A;  2P5I A;  1H4S A;  2LY7 A;  1S72 A;  3NQI A;  2NVX B;  2N3S A;  4XTW A;  2R61 A;  2N8N A;  1K8O A;  3RMH A;  3S1M B;  1EY9 A;  2PZU A;  3AMU A;  3S1Q B;  3U9S A;  1PYS A;  1T5E A;  3OW2 A;  2O4X A;  2EYO A;  2Q8R E;  4GKK Q;  2MUY A;  4QY7 A;  2B2U C;  1KRS A;  4WJW A;  3JAM E;  3FHW A;  4JI2 L;  1GUW A;  3HOX H;  5DEH A;  3EQL C;  2I4M A;  1JIC A;  2E3C A;  2H5X A;  2WP8 J;  2G5D A;  5ELB A;  3T13 A;  5LMU L;  1IBM Q;  3NEL A;  1NJ2 A;  4HID A;  4YCW A;  3NTH A;  3VYR A;  2LKV A;  5GRO A;  5JVG 3;  4H02 A;  3T1Y Q;  2EY6 A;  5G3L D;  1LT6 D;  1QVF A;  2FMM A;  4P71 A;  1NUC A;  5EBD A;  3BU2 A;  2EJF C;  3CQZ H;  2DY8 A;  5BR8 Q;  5CC4 A;  1RF2 D;  3T56 B;  3PSI A;  1L1O B;  2I07 B;  1A15 A;  1BIB A;  4IUN A;  3QTC A;  4LW1 A;  3PUW A;  1ENC A;  1KNE A;  3NTK A;  4LFA Q;  2EJ9 A;  4A3J B;  2NYZ D;  1SRY A;  1VQZ A;  1XPR A;  4C3I B;  2R92 B;  3EJI A;  2EYM A;  1HXD A;  3SK6 A;  5C51 B;  2OCE A;  1UE1 A;  1SYG A;  3K7U C;  5D14 A;  1X2H A;  5CBE E;  3PZC A;  4UAI A;  5G3L F;  4R4Q A;  3G71 A;  2XSC A;  5AJ3 Q;  2K32 A;  1SND A;  3C3L A;  1GHJ A;  3A7U A;  2WIN B;  2K6A A;  1QNU A;  3A8J E;  3OTO Q;  3GTG H;  3E5S A;  4BBS B;  1YHA A;  3OTO L;  4R9W A;  4XTV A;  3S1N B;  1ROD A;  1IW7 D;  4IOC A;  4KI0 A;  1USY A;  4HWP A;  1JJ2 A;  2A73 B;  5AJ3 L;  3RR5 A;  2EYH A;  3F8T A;  4K5W A;  2G4C A;  1XMO L;  4KKS A;  4P73 A;  4K6L A;  2L55 A;  3QWN A;  5M3F H;  1CA6 A;  1K73 C;  1IBM L;  1QE0 A;  4YDQ A;  1VQ7 A;  3S2D B;  3S1M H;  4DR6 L;  4YRI A;  4HCE A;  3I55 A;  4GKK L;  4OO1 G;  4YRM A;  3EFS A;  1GGM A;  2B3G A;  5CV4 A;  3GTP H;  4A3K H;  5C4X H;  2JA8 H;  3H94 A;  2NUC A;  4R4I A;  3Q6S A;  4R4O A;  1VF5 C;  4A3E H;  2ENB A;  3HOX B;  3MWY W;  3QIA A;  4M8A A;  3FKI G;  3PUY A;  2I4L A;  2MHV A;  4YCU A;  3A31 A;  3M3Y B;  4QUF A;  3NTI A;  2BCO A;  2VQE Q;  3R2T A;  1EQV A;  3HG9 A;  2Y0S E;  1CKN B;  2N88 A;  4HTH A;  2XNA C;  4BBR G;  4N9T A;  4DV3 Q;  4HWR A;  1ET9 A;  1J6Q A;  3TME A;  1VQN A;  1UUP A;  3TQY A;  4RQF A;  3HOU H;  1BXT A;  3NK9 A;  1CZG A;  3T53 B;  5ELD A;  1TY0 A;  2EYF A;  3CCV A;  1JOK A;  3S15 B;  3HGB A;  3IFT A;  1EYA A;  3HOV H;  3RZO H;  4EQ5 A;  4B9X A;  1AZQ A;  1KIX A;  3TS0 A;  1K8G A;  4UP8 A;  1G6Z A;  1ATI A;  4NXN L;  4CJ2 C;  4A3J G;  4JI4 Q;  5KND A;  4HJ8 A;  2YU9 B;  2CJB A;  3RLO A;  1CI3 M;  5J1Z A;  2F0O A;  3G6J B;  4KN7 C;  1CKN A;  3TN2 A;  3W1G A;  3ZJY C;  1L0X B;  4WOR A;  4A3F H;  4L6T B;  3TS2 A;  3BG3 A;  2OT2 A;  4TVY A;  1ET6 A;  3CCL A;  5JJL A;  4DF7 A;  4YP0 A;  2F0K A;  4LF5 Q;  2LSS A;  4IZ8 A;  1G5H A;  4LF8 Q;  2B2V C;  1I5F A;  1LAC A;  2RHQ B;  4YY3 Q;  1NE3 A;  3CAM A;  4IUT A;  1PV4 A;  4WJ4 A;  2Z6K C;  4XT3 B;  2E2I H;  4X3K A;  3P7J A;  3L4G B;  4JI6 Q;  2XWB B;  4HED A;  1C7Y A;  1SNQ A;  4JBK A;  4C3J H;  1B7Y A;  3KF8 B;  5E4X A;  1W6J A;  2VZA A;  3RN5 A;  4LFC L;  5DNF A;  4JI8 Q;  2QA4 A;  4GNX C;  2B39 A;  4JCV E;  4IPG A;  2JA5 B;  4E6I A;  4HSV A;  4A3D B;  1CT1 D;  1VCI A;  4NKL A;  5LMN L;  2DXU A;  1PH7 A;  3FPP A;  1GJX A;  1L1O A;  4GOP B;  4K87 A;  4AYB E;  3GTQ B;  4JOI A;  4K14 A;  2VS1 A;  1HZC A;  1HCZ A;  5C4X G;  1B70 A;  4DV0 L;  2O5J C;  4CJ0 B;  4CS4 A;  4GN4 B;  1WD1 A;  1Q8K A;  2HCI A;  3S16 H;  1JE4 A;  1PMR A;  4PQX A;  1N32 L;  1QUQ A;  5KIX A;  2VXW A;  1FYC A;  3MHB A;  1B44 D;  1YVC A;  4KY7 A;  1QG7 A;  2EDG A;  3KF6 B;  1WQ7 A;  3NUC A;  4A3I B;  3M85 A;  1ICW A;  1O7Z A;  4BS9 A;  1TWF H;  2E10 A;  2ZT9 C;  3IKJ A;  1U9R A;  3OMG A;  2F1M A;  3HFV A;  1C4Q A;  4LUV A;  2OQK A;  5AFW A;  2I5H A;  2B2T C;  4EGV A;  4P74 C;  2KED A;  1X56 A;  3J81 j;  3GV6 A;  1TY2 A;  2ZJR A;  3GTP B;  1NAP A;  1TWH H;  2EVB A;  4IFD G;  1PFB A;  1J9O A;  1WU7 A;  3M4O H;  1QWY A;  4YRR A;  5IOD A;  1LV9 A;  4B08 A;  2GA4 B;  3GO5 A;  5M5W B;  2K4K A;  4J15 A;  3U58 A;  1EU4 A;  3Q22 A;  2KEN A;  2EZV A;  2N55 A;  3KJO A;  3UGT A;  3G6E A;  1CTM A;  2HD3 A;  3CCQ A;  2F0V A;  4FF1 A;  4CKE A;  3RF1 A;  4CH3 A;  1L0Y B;  5KEE A;  2NN6 H;  4KHP Q;  3S24 A;  2EJF A;  3R8B A;  1KDC A;  5A35 A;  1N36 Q;  3P1H A;  3RZO B;  1Q12 A;  2DEQ A;  2DVE A;  2ZGW A;  5IYB H;  1F9P A; 
#chains in the Genus database with same CATH homology
 4GLX A;  2ZTC A;  4DV6 Q;  5KNN A;  5C3E H;  1VQJ A;  1I50 H;  1YHQ A;  4GS3 A;  4JI1 L;  4A76 A;  2EJG A;  3I2Z A;  1SN8 A;  2UUB L;  3NEM A;  1KMM A;  3GTM H;  3CCR A;  5C44 H;  2Q2H A;  2E8G A;  1SE8 A;  5C0X J;  5FJ8 H;  4XU2 A;  3LGJ A;  2E5L L;  1EVL A;  3TEH B;  4NCX A;  3HXV A;  3MEY A;  1BBU A;  3EFR A;  4PZ6 A;  3HOW H;  5JJI A;  1VQB A;  1AE3 A;  4HVC A;  1X54 A;  2IY5 A;  4GOP C;  3RLN A;  4XIG S;  1Q82 C;  1GM5 A;  1WI5 A;  4UP9 A;  1VQK A;  3B6Y A;  4JI7 L;  2R7Z H;  3VQX A;  4YRQ A;  1N34 Q;  3KFU A;  3HOW G;  1E7Z A;  2JK8 A;  2ARU A;  3L4G A;  4A3B H;  3PIO A;  1NJ1 A;  4A3I H;  4X65 Q;  4HIO A;  2C35 B;  2XGT A;  1K3R A;  2HIX A;  2Q7G A;  3V7S A;  5IT9 c;  4YRF A;  1VQE A;  3PCO A;  3ERR A;  4BWA A;  4P73 C;  3U4V A;  4YY3 L;  2BA0 A;  5IYD G;  1GKH A;  1SES A;  2NZH A;  1NYQ A;  1XMQ Q;  3UDI A;  4JI6 L;  4TVA B;  1KQS A;  1XPO A;  1HNW L;  1IYJ B;  2ZNJ A;  1BKB A;  4HWT A;  1GD7 A;  3STB C;  4PZ8 A;  3A5Z B;  1YHB A;  1Q86 C;  4AIM A;  4QJF A;  3IRB A;  1HZ9 A;  2DKG A;  1JT8 A;  1I6H H;  4JI4 L;  2KCT A;  3EBE A;  3I4N G;  2B63 G;  3RLF A;  4DR6 Q;  1C9O A;  4A3B G;  5C0X I;  1YZ6 A;  5H1S E;  1QF6 A;  2ZIN A;  3ICA A;  5K36 G;  2Q7H A;  4YRN A;  3IKL A;  1CSQ A;  3RKY A;  1U5K A;  4XTC S;  1RIQ A;  1RIP A;  4GN3 B;  1HNX L;  2FXQ A;  5M5W H;  2ZM6 L;  2HIV A;  1N33 L;  2UXC L;  4A3L G;  2MO0 A;  2R93 H;  3HY1 A;  1AE2 A;  1HJP A;  5IWA Q;  4P71 C;  3MF2 A;  2YTX A;  2EQS A;  4LVL A;  1N32 Q;  4NXM Q;  2IHE A;  4LF6 L;  3K80 C;  4XTX A;  4DR1 L;  3T1H Q;  1B76 A;  1X3F A;  2ZNI A;  2K52 A;  4A3F G;  4IPH A;  1SMX A;  1M1K C;  1WJJ A;  4DR3 Q;  3J7Z C;  4BY1 H;  3R07 A;  1B7Y B;  1VQP A;  1JJC A;  3AYH B;  1YFS A;  2J3M A;  4X66 L;  2J3L A;  4IJL A;  3PO2 G;  5E3I A;  2ZCE A;  4AQY L;  2NVY H;  1YJN A;  4LNQ A;  2JEA I;  2NZO A;  1EOV A;  3K7A H;  3A5Y A;  5BR8 L;  1HNW Q;  5E7N A;  4TQD A;  4NXN Q;  3J81 c;  2AMC B;  2NVQ H;  3CMQ A;  3RNU A;  2PNH A;  5IP7 H;  1CUK A;  3DLL A;  2CIM A;  4L5S A;  4A3D H;  4DV1 L;  5LMN Q;  1XNQ L;  4X65 L;  2JJQ A;  1NY4 A;  1JJG A;  3CCJ A;  2WFW A;  1YEZ A;  3IKM B;  4LFC Q;  1YI2 A;  1OXU A;  2B29 A;  4YRK A;  3S15 H;  1WOC A;  4LFB Q;  2CFM A;  2VY3 A;  4DR2 Q;  1UWV A;  4LF8 L;  4KR3 A;  4OWX B;  4CS2 A;  2YTV A;  1PH3 A;  4B3M Q;  2DTO A;  2UUB Q;  4O0A A;  1EUJ A;  3W3S A;  4LFB L;  2MO1 A;  5HY6 A;  2DTH A;  1BBW A;  11AS A;  4BY7 H;  2RHS A;  4A93 H;  4JV5 Q;  4RDX A;  3CC2 A;  4BY7 G;  4YPF A;  2E5A A;  2DDZ A;  1H4Q A;  1J5W A;  4KHP L;  1ASZ A;  3JAM i;  4JBM A;  3HXX A;  1NMF A;  4LF7 L;  4YRC A;  2Q7E A;  2Q2U A;  3QNE A;  1G5I A;  3GTJ H;  3GD7 A;  1PH6 A;  4DQ2 A;  4LF6 Q;  4TVA A;  4P75 C;  1SFO H;  4HJ5 A;  1LYL A;  4JBJ A;  2HHH Q;  3WQZ A;  2ZJQ A;  1Y14 B;  1TWA H;  4LWC A;  4GOP A;  2QEX A;  1WCM H;  4H2X A;  3G48 A;  1H4T A;  2RF4 A;  2YV5 A;  4YRL A;  3U50 C;  3RZD H;  1ADJ A;  4DNI A;  3HOU G;  3PUV A;  1X6O A;  3J80 i;  4DUY Q;  4KQE A;  3H15 A;  2PMF A;  3VDY A;  4DV2 Q;  3PO3 H;  4BW9 A;  1A0I A;  4HA8 A;  4G85 A;  3CPW A;  5EAY A;  4DPG A;  2HQL A;  2K75 A;  1LM0 A;  4DV7 Q;  1VQ6 A;  2ODR C;  4NXM L;  2Z0S A;  1B8A A;  1LUZ A;  1XNR Q;  4LF4 L;  4GLA C;  1VQL A;  4OP0 A;  1YIJ A;  3REU A;  2JA6 H;  3H0G H;  4JI1 Q;  5IWA L;  1VQH A;  1I3Q H;  3H0G G;  4JYA Q;  2ZR3 A;  4DK6 C;  1ASY A;  4X64 L;  4H2T A;  2CWA A;  1Q46 A;  1I94 L;  5IYB G;  3PGZ A;  4Q15 A;  3A7A A;  1X55 A;  5FLM G;  4B3S Q;  4A3K G;  1WCM G;  3T1H L;  4H2V A;  3TEG A;  2OWO A;  4OWT B;  4IJH A;  4X6A H;  2OTL A;  1WNL A;  1W66 A;  2ZZG A;  1NNH A;  3RGL A;  1Z9F A;  1NJI C;  2AHO B;  4X62 Q;  3IG2 A;  4JG2 A;  4DUZ L;  2ZM6 Q;  2N78 A;  1L0W A;  4JI0 Q;  2OTJ A;  2I5L X;  4JI0 L;  1G29 1;  1PFS A;  3GTK H;  2HNI A;  4OX9 Q;  2KHI A;  4R4T A;  1S40 A;  5LMU Q;  4EX5 A;  2GVB A;  4LVM A;  3TRE A;  1YJW A;  2NS6 A;  2VQF L;  4LUO A;  1FJG L;  4GNX A;  3HOZ H;  4DR4 Q;  4Y52 H;  3CW2 C;  1MJE A;  1H95 A;  4HJ7 A;  2UXD L;  4JOI C;  1KRT A;  1V9P A;  3J81 i;  1M90 C;  3W1B A;  2I5M X;  2JEB I;  4RQE A;  2BA1 A;  4PZ7 A;  2VL6 A;  4XTZ A;  3KLW A;  1BVS A;  2PQA B;  3F2D A;  2MNA A;  2JA9 A;  1VQ5 A;  3EIV A;  3E0E A;  4EO4 A;  2KHJ A;  2P0L A;  4P72 A;  2DZ9 A;  2AKW A;  1E1O A;  2PMZ E;  3MF1 A;  4X64 Q;  3ERS X;  2IX1 A;  4DV5 L;  3HKZ E;  3KYH C;  1FVI A;  1W3S A;  2ZT6 A;  1GO3 E;  4YRS A;  1IBL L;  4L5T A;  2PI2 A;  4B3M L;  3I7F A;  4TWA A;  1XNR L;  4LVJ A;  4DKA C;  1WFQ A;  3D31 A;  3F2C A;  3GDE A;  1MJC A;  1NYR A;  1X2G A;  2BH8 A;  3PO2 H;  3MEF A;  2HHH L;  1VQI A;  1YGB A;  3GTO H;  2F3I A;  1V43 A;  1W2B A;  3REX A;  4OON A;  2WB1 G;  2DU5 A;  4UPA A;  3QO7 A;  2WB1 E;  1EFW A;  1VQA A;  1Y1W G;  4B3R L;  2F52 A;  3I4M H;  1L2F A;  4OWW B;  1VS0 A;  2NVT H;  2C8M A;  2UXB Q;  4POF A;  1Q81 C;  2R7F A;  4OO1 I;  3TUP A;  3K8A A;  4R4C A;  4CH4 A;  1O7I A;  3JC6 6;  2ASB A;  1JE5 A;  3I4N H;  1VQC A;  2EWN A;  4A3M G;  1Z7N A;  5C3E G;  1SRU A;  3HXY A;  3RAC A;  1EYG A;  1VQ4 A;  2EL9 A;  3RUX A;  3IAL A;  1J5E L;  3OD1 A;  2WAQ G;  2R92 G;  1PA6 A;  1SER A;  3UH0 A;  2EXD A;  1EIF A;  12AS A;  4AYB G;  1WLE A;  4DV3 L;  4CH6 A;  2I4O A;  3H3V I;  3DM3 A;  4OLF A;  3ULP A;  4DK3 C;  4GKJ L;  4A93 G;  4NPS A;  4DV4 L;  4XU1 A;  4LUZ A;  3I4O A;  4DV4 Q;  1Z47 A;  3F2B A;  3M4P A;  2E1H A;  4YRP A;  3V8K A;  3RL6 A;  2ALY A;  3VBB A;  1YJ9 A;  5M5Y H;  5IP7 G;  2ZXF A;  1JMC A;  4PHC A;  5JEA J;  1PH8 A;  1HR0 Q;  2ZT5 A;  1EIY B;  5IY0 A;  2AWN A;  2Q2I A;  4B3T Q;  4DR7 L;  2D0P A;  3L2P A;  3HRI A;  4KR2 A;  1VQO A;  5M5X H;  4BY1 G;  3M9B A;  3CCS A;  2ZZE A;  1J5E Q;  1U0L A;  2K14 A;  1PHJ A;  4GN5 A;  4LF5 L;  2E2J H;  3ULJ A;  2ZIO A;  2CGH A;  2GN5 A;  5IYC G;  3HRK A;  3PUX A;  2KBN A;  4XU0 A;  1EQR A;  1KD1 C;  2A8E A;  5IE8 A;  1HNZ L;  1A8V A;  1SR3 A;  1Y1W H;  1YFT A;  1UE6 A;  1BIA A;  4B3R Q;  4H2U A;  4HWS A;  1MIU A;  3A7R A;  4DR3 L;  4TQU S;  2ZTE A;  1UEB A;  2VQF Q;  1VQD A;  1PYS B;  5FLX c;  1E1T A;  4A3I G;  3E9I A;  2UUA L;  3BZC A;  2E41 A;  3ULL A;  5IYC H;  4MNO A;  4H2X B;  3MQZ A;  4OXP A;  2UXC Q;  3CC7 A;  5LMN W;  1N34 L;  4YYE A;  2RHS B;  3PUZ A;  1HNX Q;  4LNS A;  4YWL A;  4JI2 Q;  1JB7 A;  3Q8D A;  1KMN A;  3KOJ A;  1E3P A;  4PG3 A;  2RHQ A;  3AFP A;  2ZR2 A;  3UE1 A;  5JJK A;  4B3S L;  3A5Z A;  4OX9 L;  1KAW A;  4WI1 A;  3KDF B;  3CXC A;  2DQ0 A;  2NN6 G;  5F5W A;  3V8J A;  2K50 A;  4LF4 Q;  1XMQ L;  2IX0 A;  4JI3 L;  2UXD Q;  4GLV B;  1IBL Q;  2B63 H;  3CME A;  4IOA A;  3S1N H;  1PH9 A;  2IY5 B;  2ALY B;  4TQF A;  4LVK A;  1KL9 A;  1Q1B A;  2Y0S G;  3CCU A;  3DSQ A;  2XTI A;  5J3B A;  2DU7 A;  1X9N A;  1FYF A;  4DR5 L;  4DR4 L;  3CD6 A;  2QHS A;  4TVW A;  2NVX H;  4BBR H;  3HKZ G;  3NEN A;  1R9T H;  4G84 A;  5ELN A;  3M3Y H;  4JBW A;  4RG1 A;  1NJ5 A;  2CQO A;  3OYY A;  2VUM H;  4YWK A;  3EN2 A;  4JI7 Q;  3RKX A;  4A3C H;  4A3M H;  1XPU A;  3I4M G;  1SRO A;  1PYB A;  4P3N A;  3PO3 G;  4DUY L;  4A3J H;  2AKW B;  4HWO A;  4L87 A;  3VQV A;  3I56 A;  2VW9 A;  3FKI H;  4YRJ A;  1KXL A;  2CCZ A;  2DQ3 A;  5HGQ A;  2EIF A;  2QGQ A;  4QQB X;  1N36 L;  2I4N A;  3HOZ G;  2VUM G;  1VQM A;  1E22 A;  4YRO A;  2FYK A;  3CCE A;  4QIW E;  3H3V H;  5M3F G;  3HOY H;  3NET A;  2Q2T A;  2KCM A;  1RL2 A;  3U4Z A;  4LVI A;  4JYA L;  1TWG H;  1KC8 C;  3WWV A;  4QGU A;  1TXY A;  1HC7 A;  3AFQ A;  3ICE A;  3F1Z A;  4P72 C;  2C7I A;  3V8L A;  1CKM A;  3HKS A;  1USY C;  3PV0 A;  2A19 A;  3G1Z A;  2ZJP A;  4LF7 Q;  3HFZ B;  4XTU A;  2UU9 Q;  1X65 A;  3P8V A;  3L2Z A;  3CF5 A;  4P3O A;  3HOV G;  2YU9 H;  2JA8 G;  4DV6 L;  3TEH A;  3LSS A;  2K5H A;  4XEM A;  1SLJ A;  4JV5 L;  1FL0 A;  4NB3 A;  3L0O A;  1DGS A;  4DV0 Q;  2A8V A;  2IHF A;  1XTD A;  4LF9 Q;  4K86 A;  3HOY G;  5C4J H;  2F4V Q;  4A3E G;  1CKO A;  2ZT7 A;  2JA5 H;  2ARS A;  1WQW A;  2ZTG A;  4BA2 I;  2AMC A;  4YHH Q;  1KHI A;  1E24 A;  4DR2 L;  1XMO Q;  3CCM A;  4H2W A;  1NBW A;  3PIP A;  3S1R H;  3HOX G;  4KHZ A;  4JI8 L;  1YNX A;  1HZB A;  1OTC A;  4IFD J;  5FLM H;  1P8L A;  4XU3 A;  2RCN A;  4POG A;  4IPD A;  2DXT A;  2EAY A;  4CH5 A;  1Y1V H;  1P16 A;  4LF9 L;  4LFA L;  3L7Z C;  4X66 Q;  3UFG A;  1YBY A;  4C3H H;  3J80 c;  1NTG A;  1V1Q A;  4O2D A;  4MTN A;  2PQA A;  3P8Y A;  4K0K Q;  2UUC L;  3BFM A;  1QVG A;  1XNQ Q;  3MXN B;  1NMG A;  1GVP A;  1Q1E A;  1OXS C;  4TTV A;  1VQ8 A;  1QUQ B;  1Y1V G;  2CJ9 A;  5K1P A;  2BH2 A;  2E2H H;  4Q6G A;  3STB D;  2LXK A;  1HZA A;  5DLQ E;  2CJA A;  3E9H A;  4YCV A;  4JI5 L;  4MZ9 A;  2JA6 G;  4AQY Q;  2QHV A;  3HXW A;  2K5N A;  4ZTU B;  1N33 Q;  1OXX K;  2OQ0 A;  5M3M G;  3K81 C;  2L15 A;  1PH2 A;  3KDF A;  1XJV A;  2K5V A;  2F4V L;  1UE7 A;  4JI5 Q;  3VQW A;  4BXX H;  4UP7 A;  4DV7 L;  2VNU D;  1OXV A;  2UUA Q;  5K1X A;  5IP9 H;  1WPY A;  2MQH A;  3RKW A;  1Q7Y C;  5GAE C;  4ME3 A;  2E64 A;  1PH5 A;  2DZC A;  1N8R C;  3HXU A;  4L5R C;  3HXZ A;  1EQQ A;  3HY0 A;  4RMF A;  2YTY A;  1EVK A;  3L1A A;  3S14 H;  3HTZ A;  4IPC A;  3ER0 A;  3NBH B;  4XEO A;  1B70 B;  2ATW A;  1PH1 A;  4XTY A;  3M7N A;  1PVO A;  1D7Q A;  3CP0 A;  2UUC Q;  4A3D G;  4Y7N H;  3TRZ A;  3BZK A;  4L5Q A;  3GTL H;  2Q5H A;  4JI3 Q;  2QHU A;  1SET A;  4GKJ Q;  1CSP A;  2JE6 I;  2QHT A;  2JQO A;  4HJ9 A;  4UY8 C;  1YB3 A;  4HIK A;  1D8L A;  4QL5 A;  3RN2 A;  2GVA A;  3S2H H;  4R1J A;  1HNZ Q;  4JC0 A;  1N9W A;  4A3G H;  1WYD A;  1A62 A;  1FJG Q;  4K0K L;  4X62 L;  1X3E A;  2PME A;  3UDF A;  4WF2 A;  4YRE A;  2LXJ A;  4BBS H;  1VQF A;  3A32 A;  4PMW A;  4A3C G;  4IFD I;  3KJP A;  3S17 H;  3T1Y L;  2JA7 G;  3A0J A;  4BA1 I;  4K88 A;  1A63 A;  1MKH A;  2ODR D;  1K83 H;  1X01 A;  1EIY A;  2JA7 H;  1HR0 L;  1S3O A;  3UDG A;  1ADY A;  3QO5 A;  4CS3 A;  1PH4 A;  3AQQ A;  2R93 G;  4A3L H;  4KLK A;  5ELO A;  2DUD A;  4APV A;  2D0O A;  2N49 A;  1G51 A;  4H2S A;  1IBK Q;  3A5U A;  4P75 A;  4A3G G;  4H2Y A;  4YHH L;  3FJP A;  4YRG A;  4ZIB A;  1IZ6 A;  2CKZ B;  2DJZ A;  2E5L Q;  1FGU A;  4ALP A;  2ZZF A;  1QZH A;  1HTT A;  1IBK L;  3J7A 5;  4HIM A;  2DTI A;  2ID0 A;  4IO9 A;  1I94 Q;  3UGQ A;  4HT4 A;  2A1A A;  3RIR A;  4AH6 A;  3GTQ H;  3KF6 A;  3FP9 A;  4DV2 L;  2PI2 E;  1QVC A;  3HFZ A;  4GNX B;  4YWM A;  2ART A;  2E65 A;  3M4Q A;  3PF4 A;  2DGY A;  2UU9 L;  2YYZ A;  3BJU A;  1L1O C;  4DR1 Q;  5C44 G;  2ZTD A;  2ES2 A;  4FDB A;  4C2M H;  4BBS G;  1LTL A;  3SGI A;  2UXB L;  4WJ3 M;  1NJ6 A;  2D62 A;  2ZT8 A;  3D0F A;  3UE0 A;  2R7Z G;  1YFR A;  4C3I H;  2R92 H;  3P8T A;  2AWO A;  1TWC H;  1H4V B;  5M3M H;  2I0Q A;  5C52 B;  1C0A A;  3S1Q H;  4X5O A;  4A4I A;  4BXX G;  2WAQ E;  4ZTZ B;  1YIT A;  3JAM c;  2Q5I A;  2Z6K A;  1NJ8 A;  5GAH C;  1JJC B;  4YRT A;  5C53 B;  4DV1 Q;  1VQG A;  3PF5 A;  2R7D A;  1K0R A;  1K9M C;  1AH9 A;  3A74 A;  5FJ8 G;  5IYD H;  3PCO B;  4DR5 Q;  4DUZ Q;  1QZG A;  2CWP A;  4DAY B;  5JEA G;  1IL2 A;  3LSQ A;  1K8A C;  3AEV A;  5IP9 G;  4P3P A;  4DV5 Q;  1IXR A;  3K0X A;  2V1C C;  3LC0 A;  3V7C A;  1VQ9 A;  2ZIM A;  5C0X G;  3CMA A;  4P74 A;  4DAM A;  1T9H A;  1Z7M A;  1HH2 P;  1X3G A;  5GAG C;  3S2D H;  3W5O A;  4DR7 Q;  3VQY A;  1EWI A;  4B3T L;  3QO8 A;  5GQO A;  2MFI A;  5GAD C;  1G6P A;  3V7R A;  2R6G A;  1UE5 A;  1HR0 W;  3CPF A;  1OXT A;  4A75 A;  4E51 A;  3G4S A;  2JA5 G;  1KOG A;  2IT1 A;  3UDX A;  4HJA A;  2NN6 I;  2HT1 A;  2VQE L;  3CC4 A;  2P5I A;  1H4S A;  1S72 A;  4XTW A;  2N3S A;  2N8N A;  1PYS A;  3OW2 A;  4GKK Q;  4QY7 A;  1KRS A;  4JI2 L;  3FHW A;  3HOX H;  2I4M A;  2E3C A;  2H5X A;  2WP8 J;  5LMU L;  1IBM Q;  3NEL A;  1NJ2 A;  4HID A;  4YCW A;  5GRO A;  4H02 A;  3T1Y Q;  1QVF A;  4P71 A;  3BU2 A;  3CQZ H;  5BR8 Q;  3PSI A;  1L1O B;  1BIB A;  3QTC A;  4LW1 A;  3PUW A;  4LFA Q;  2EJ9 A;  1SRY A;  1VQZ A;  1XPR A;  1HXD A;  5C51 B;  2OCE A;  1UE1 A;  3K7U C;  1X2H A;  3PZC A;  4R4Q A;  3G71 A;  5AJ3 Q;  3A7U A;  3OTO Q;  3GTG H;  1YHA A;  3OTO L;  4XTV A;  4IOC A;  4KI0 A;  1USY A;  4HWP A;  1JJ2 A;  5AJ3 L;  3RR5 A;  3F8T A;  2G4C A;  1XMO L;  4P73 A;  1IBM L;  1QE0 A;  5M3F H;  1K73 C;  4YDQ A;  1VQ7 A;  3S1M H;  4DR6 L;  4YRI A;  3I55 A;  4GKK L;  4OO1 G;  4YRM A;  3EFS A;  1GGM A;  2B3G A;  3GTP H;  4A3K H;  5C4X H;  2JA8 H;  4R4I A;  4R4O A;  4A3E H;  3FKI G;  3PUY A;  2I4L A;  4YCU A;  3A31 A;  2VQE Q;  2Y0S E;  1CKN B;  4BBR G;  4DV3 Q;  4HWR A;  1J6Q A;  1VQN A;  3TQY A;  4RQF A;  3HOU H;  3CCV A;  3HOV H;  3RZO H;  4EQ5 A;  1KIX A;  3TS0 A;  1K8G A;  4UP8 A;  1ATI A;  4NXN L;  4A3J G;  4JI4 Q;  2CJB A;  4HJ8 A;  3RLO A;  3W1G A;  1CKN A;  3ZJY C;  4A3F H;  3TS2 A;  4TVY A;  3CCL A;  5JJL A;  4YP0 A;  4LF5 Q;  2LSS A;  1G5H A;  4LF8 Q;  1I5F A;  2RHQ B;  4YY3 Q;  1NE3 A;  3CAM A;  1PV4 A;  4WJ4 A;  2Z6K C;  2E2I H;  3L4G B;  4JI6 Q;  1C7Y A;  4JBK A;  1B7Y A;  4C3J H;  3KF8 B;  3RN5 A;  2VZA A;  4LFC L;  4JI8 Q;  2QA4 A;  4GNX C;  4JCV E;  4IPG A;  1VCI A;  5LMN L;  2DXU A;  1PH7 A;  1L1O A;  4GOP B;  4K87 A;  4AYB E;  4JOI A;  2VS1 A;  1HZC A;  5C4X G;  1B70 A;  4DV0 L;  4CS4 A;  4GN4 B;  1Q8K A;  3S16 H;  1N32 L;  1QUQ A;  1YVC A;  3KF6 B;  1WQ7 A;  3M85 A;  1TWF H;  2E10 A;  3HFV A;  4LUV A;  2OQK A;  2I5H A;  4P74 C;  1X56 A;  3J81 j;  2ZJR A;  1TWH H;  4IFD G;  1WU7 A;  3M4O H;  4YRR A;  3GO5 A;  2K4K A;  4J15 A;  3U58 A;  2KEN A;  3KJO A;  3UGT A;  3G6E A;  3CCQ A;  4CH3 A;  3RF1 A;  4KHP Q;  3S24 A;  2EJF A;  1N36 Q;  2DEQ A;  2DVE A;  1Q12 A;  2ZGW A;  5IYB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...