4HT4A

Molecular basis of vancomycin resistance transfer in staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
194
Chain Sequence
AMYHFQNKFVSKANGQSATAKSAFNSASRIKDFKENEFKDYSNKQCDYSEILLPNNADDKFKDREYLWNKVHDVENRKNSQVAREIIIGLPNEFDPNSNIELAKEFAESLSNEGMIVDLNIHKINEENPHAHLLCTLRGLDKNNEFEPKRKGNDYIRDWNTKEKHNEWRKRWENVQNKHLEKNGFSVRVSADSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Nicking enzyme
publication title Molecular basis of antibiotic multiresistance transfer in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 58
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4ht4A00
2NS6A 4LVJA 4LVKA 4LVMA 4LVIA 4HT4A 4LVLA
chains in the Genus database with same CATH superfamily
5KNNA 4P3PA 3HY0A 4TVAA 1SETA 4CS3A 2DU7A 4G85A 4XTUA 4CS4A 1YFTA 2C7IA 2QHTA 4YRKA 1WQWA 4XTYA 3A32A 3NENA 2NS6A 3V8KA 3HXVA 4YREA 3HXYA 4CS2A 2Q7GA 2P0LA 1EVKA 1EVLA 4H2TA 3R07A 3VQWA 4XU3A 3V8LA 4YRIA 3QO7A 3HXZA 4KR2A 1WLEA 4HWTA 3A7AA 4K88A 1WPYA 1USYC 4LVMA 1G5HA 4YRPA 3LC0A 1VQZA 2DTHA 4K86A 2EJ9A 3A31A 3VQYA 4LVIA 2CJ9A 4RDXA 4TVAB 3ICAA 1NYRA 4YPFA 3HY1A 1Z7NA 1X55A 1BBUA 2CJBA 1EIYB 4AH6A 3QTCA 2CIMA 4NCXA 3RKYA 1L0WA 4H2UA 4EX5A 1J5WA 4ZTUB 2I4MA 4YRFA 2AMCA 3REXA 2DQ3A 2E1HA 4UP7A 4P73C 4TWAA 4P73A 1WYDA 2EJFA 3UH0A 4DQ2A 3KFUA 5C53B 1ASYA 2DKGA 4YROA 5C51B 1WNLA 2ZZEA 1H4QA 1WQ7A 3G1ZA 1Z7MA 4ZTZB 4YRLA 1YGBA 4KQEA 2DZ9A 3RF1A 3NELA 3A5ZA 1G51A 2DEQA 4X5OA 2RHQA 3QO8A 4YRGA 3HFZB 1HXDA 2AKWB 4UP8A 1B7YB 2E3CA 1NYQA 5C52B 3PCOA 5ELNA 4YDQA 4TVWA 2ZZGA 2AMCB 1G5IA 2ZZFA 4XTWA 1HC7A 3W3SA 4XTVA 2QHUA 3MF2A 3RL6A 4WJ3M 2ZR3A 4LVLA 4WJ4A 1C0AA 11ASA 2G4CA 4P3OA 4XTZA 3TEGA 5E3IA 4HWSA 1KMMA 2E10A 4KR3A 1E1TA 4Q6GA 4YRRA 2DU5A 3CMQA 1N9WA 3IG2A 2ZT6A 1B8AA 4YRSA 1E22A 4YRNA 4ZIBA 1JJCA 2Q5IA 3ERRA 4YRMA 4K87A 3RKXA 1PYSA 3V7RA 2Q5HA 5K1PA 3NETA 5ELOA 1X56A 3P8YA 1KOGA 1NJ8A 4XTXA 1IL2A 3RACA 2EJGA 2ZCEA 3PCOB 2ZIMA 1EFWA 2ARUA 4RQFA 3HFVA 2ARSA 4YCUA 1X2GA 1YFRA 4HWPA 4TTVA 3QO5A 4L87A 1X2HA 3OD1A 3MEYA 3NEMA 1NJ5A 2E64A 3BJUA 2E5AA 1ADYA 3A5YA 5HGQA 1ADJA 1B70A 4PG3A 1H4VB 3VQVA 4CH6A 12ASA 1JJCB 1KMNA 2DJZA 2RHSA 2ZTGA 2DXUA 3PZCA 1PYSB 4H2YA 3A7RA 2I4NA 3RGLA 4TQDA 4H02A 1BIAA 2ALYA 4HVCA 2J3LA 3QNEA 1EOVA 4CH3A 4XU1A 1H4TA 3FJPA 3L4GA 4G84A 4H2WA 2ZT5A 4YCWA 2CGHA 2XGTA 2ODRD 2J3MA 2DTIA 2HNIA 3RIRA 4EO4A 3TEHA 3IKMB 4RMFA 2PMFA 3HXUA 4XU0A 4O2DA 3LSSA 1B70B 4WI1A 1BBWA 1X01A 4BWAA 1E24A 4YRTA 2ODRC 2CJAA 2RHSB 3RKWA 3VQXA 1YFSA 3UFGA 2P5IA 3EFSA 3WQZA 3L2ZA 4YRJA 4J15A 2ALYB 3UGQA 3MQZA 2ZT8A 4HWOA 4WF2A 4OP0A 1GGMA 1SERA 1NJ1A 2EL9A 5F5WA 3LSQA 2DDZA 3RUXA 2ZGWA 3L1AA 1BIBA 1SESA 4P3NA 3L4GB 2RHQB 1H4SA 4P74C 3VBBA 4P74A 1EIYA 3E9HA 4P71C 4YYEA 4P71A 1W66A 3V8JA 1NNHA 4P72C 3TEHB 4H2XA 4P72A 4BW9A 4H2SA 2DQ0A 1WU7A 4E51A 3UGTA 3A74A 4HA8A 1QF6A 2DTOA 3DSQA 2ARTA 2I4OA 2FYKA 2DXTA 2E65A 2ZNIA 3A7UA 1X54A 2DVEA 2ZR2A 2PMEA 1USYA 1B76A 2EWNA 2Q7HA 4HT4A 3HRIA 2ZNJA 4UPAA 3V7SA 4CH5A 3MF1A 2QHSA 3HFZA 2AKWA 2DZCA 2ZT7A 2EAYA 4TVYA 1B7YA 4XEMA 3E9IA 2I4LA 4H2XB 3M4QA 2ZINA 2IY5A 1LYLA 1FYFA 2ZXFA 3IKLA 3HXXA 1HTTA 1QE0A 3P8TA 3M4PA 2A8EA 4H2VA 3BFMA 3V7CA 3TUPA 4UP9A 1SRYA 1NJ2A 4LVJA 4CH4A 1NJ6A 3HRKA 4XEOA 4YP0A 1RIQA 2QHVA 3P8VA 4YCVA 4LVKA 4DPGA 4LNSA 3I7FA 4YRQA 4PHCA 1E1OA 2C8MA 2Q7EA 2E41A 1EQRA 1ATIA 3REUA 3HXWA 2XTIA 2ZIOA 4TQFA 4OLFA 3HTZA 3EFRA 4HWRA 1ASZA 4XU2A 4YRCA 4P75C 4P75A 4Q15A 4RQEA 2IY5B 1YB3A 3IALA 5K1XA
chains in the Genus database with same CATH topology
5KNNA 4P3PA 3HY0A 4TVAA 1SETA 4CS3A 2DU7A 4G85A 4XTUA 4CS4A 1YFTA 2C7IA 2QHTA 4YRKA 1WQWA 4XTYA 3A32A 3NENA 2NS6A 3V8KA 3HXVA 4YREA 3HXYA 4CS2A 2Q7GA 2P0LA 1EVKA 1EVLA 4H2TA 3R07A 3VQWA 4XU3A 3V8LA 4YRIA 3QO7A 3HXZA 4KR2A 1WLEA 4HWTA 3A7AA 4K88A 1WPYA 1USYC 4LVMA 1G5HA 4YRPA 3LC0A 1VQZA 2DTHA 4K86A 2EJ9A 3A31A 3VQYA 4LVIA 2CJ9A 4RDXA 4TVAB 3ICAA 1NYRA 4YPFA 3HY1A 1Z7NA 1X55A 1BBUA 2CJBA 1EIYB 4AH6A 3QTCA 2CIMA 4NCXA 3RKYA 1L0WA 4H2UA 4EX5A 1J5WA 4ZTUB 2I4MA 4YRFA 2AMCA 3REXA 2DQ3A 2E1HA 4UP7A 4P73C 4TWAA 4P73A 1WYDA 2EJFA 3UH0A 4DQ2A 3KFUA 5C53B 1ASYA 2DKGA 4YROA 5C51B 1WNLA 2ZZEA 1H4QA 1WQ7A 3G1ZA 1Z7MA 4ZTZB 4YRLA 1YGBA 4KQEA 2DZ9A 3RF1A 3NELA 3A5ZA 1G51A 2DEQA 4X5OA 2RHQA 3QO8A 4YRGA 3HFZB 1HXDA 2AKWB 4UP8A 1B7YB 2E3CA 1NYQA 5C52B 3PCOA 5ELNA 4YDQA 4TVWA 2ZZGA 2AMCB 1G5IA 2ZZFA 4XTWA 1HC7A 3W3SA 4XTVA 2QHUA 3MF2A 3RL6A 4WJ3M 2ZR3A 4LVLA 4WJ4A 1C0AA 11ASA 2G4CA 4P3OA 4XTZA 3TEGA 5E3IA 4HWSA 1KMMA 2E10A 4KR3A 1E1TA 4Q6GA 4YRRA 2DU5A 3CMQA 1N9WA 3IG2A 2ZT6A 1B8AA 4YRSA 1E22A 4YRNA 4ZIBA 1JJCA 2Q5IA 3ERRA 4YRMA 4K87A 3RKXA 1PYSA 3V7RA 2Q5HA 5K1PA 3NETA 5ELOA 1X56A 3P8YA 1KOGA 1NJ8A 4XTXA 1IL2A 3RACA 2EJGA 2ZCEA 3PCOB 2ZIMA 1EFWA 2ARUA 4RQFA 3HFVA 2ARSA 4YCUA 1X2GA 1YFRA 4HWPA 4TTVA 3QO5A 4L87A 1X2HA 3OD1A 3MEYA 3NEMA 1NJ5A 2E64A 3BJUA 2E5AA 1ADYA 3A5YA 5HGQA 1ADJA 1B70A 4PG3A 1H4VB 3VQVA 4CH6A 12ASA 1JJCB 1KMNA 2DJZA 2RHSA 2ZTGA 2DXUA 3PZCA 1PYSB 4H2YA 3A7RA 2I4NA 3RGLA 4TQDA 4H02A 1BIAA 2ALYA 4HVCA 2J3LA 3QNEA 1EOVA 4CH3A 4XU1A 1H4TA 3FJPA 3L4GA 4G84A 4H2WA 2ZT5A 4YCWA 2CGHA 2XGTA 2ODRD 2J3MA 2DTIA 2HNIA 3RIRA 4EO4A 3TEHA 3IKMB 4RMFA 2PMFA 3HXUA 4XU0A 4O2DA 3LSSA 1B70B 4WI1A 1BBWA 1X01A 4BWAA 1E24A 4YRTA 2ODRC 2CJAA 2RHSB 3RKWA 3VQXA 1YFSA 3UFGA 2P5IA 3EFSA 3WQZA 3L2ZA 4YRJA 4J15A 2ALYB 3UGQA 3MQZA 2ZT8A 4HWOA 4WF2A 4OP0A 1GGMA 1SERA 1NJ1A 2EL9A 5F5WA 3LSQA 2DDZA 3RUXA 2ZGWA 3L1AA 1BIBA 1SESA 4P3NA 3L4GB 2RHQB 1H4SA 4P74C 3VBBA 4P74A 1EIYA 3E9HA 4P71C 4YYEA 4P71A 1W66A 3V8JA 1NNHA 4P72C 3TEHB 4H2XA 4P72A 4BW9A 4H2SA 2DQ0A 1WU7A 4E51A 3UGTA 3A74A 4HA8A 1QF6A 2DTOA 3DSQA 2ARTA 2I4OA 2FYKA 2DXTA 2E65A 2ZNIA 3A7UA 1X54A 2DVEA 2ZR2A 2PMEA 1USYA 1B76A 2EWNA 2Q7HA 4HT4A 3HRIA 2ZNJA 4UPAA 3V7SA 4CH5A 3MF1A 2QHSA 3HFZA 2AKWA 2DZCA 2ZT7A 2EAYA 4TVYA 1B7YA 4XEMA 3E9IA 2I4LA 4H2XB 3M4QA 2ZINA 2IY5A 1LYLA 1FYFA 2ZXFA 3IKLA 3HXXA 1HTTA 1QE0A 3P8TA 3M4PA 2A8EA 4H2VA 3BFMA 3V7CA 3TUPA 4UP9A 1SRYA 1NJ2A 4LVJA 4CH4A 1NJ6A 3HRKA 4XEOA 4YP0A 1RIQA 2QHVA 3P8VA 4YCVA 4LVKA 4DPGA 4LNSA 3I7FA 4YRQA 4PHCA 1E1OA 2C8MA 2Q7EA 2E41A 1EQRA 1ATIA 3REUA 3HXWA 2XTIA 2ZIOA 4TQFA 4OLFA 3HTZA 3EFRA 4HWRA 1ASZA 4XU2A 4YRCA 4P75C 4P75A 4Q15A 4RQEA 2IY5B 1YB3A 3IALA 5K1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS6 A;  4LVJ A;  4LVK A;  4LVM A;  4LVI A;  4HT4 A;  4LVL A; 
#chains in the Genus database with same CATH topology
 5KNN A;  4P3P A;  3HY0 A;  4TVA A;  1SET A;  4CS3 A;  2DU7 A;  4G85 A;  4XTU A;  4CS4 A;  1YFT A;  2C7I A;  2QHT A;  4YRK A;  1WQW A;  4XTY A;  3A32 A;  3NEN A;  2NS6 A;  3V8K A;  3HXV A;  4YRE A;  3HXY A;  4CS2 A;  2Q7G A;  2P0L A;  1EVK A;  1EVL A;  4H2T A;  3R07 A;  3VQW A;  4XU3 A;  3V8L A;  4YRI A;  3QO7 A;  3HXZ A;  4KR2 A;  1WLE A;  4HWT A;  3A7A A;  4K88 A;  1WPY A;  1USY C;  4LVM A;  1G5H A;  4YRP A;  3LC0 A;  1VQZ A;  2DTH A;  4K86 A;  2EJ9 A;  3A31 A;  3VQY A;  4LVI A;  2CJ9 A;  4RDX A;  4TVA B;  3ICA A;  1NYR A;  4YPF A;  3HY1 A;  1Z7N A;  1X55 A;  1BBU A;  2CJB A;  1EIY B;  4AH6 A;  3QTC A;  2CIM A;  4NCX A;  3RKY A;  1L0W A;  4H2U A;  4EX5 A;  1J5W A;  4ZTU B;  2I4M A;  4YRF A;  2AMC A;  3REX A;  2DQ3 A;  2E1H A;  4UP7 A;  4P73 C;  4TWA A;  4P73 A;  1WYD A;  2EJF A;  3UH0 A;  4DQ2 A;  3KFU A;  5C53 B;  1ASY A;  2DKG A;  4YRO A;  5C51 B;  1WNL A;  2ZZE A;  1H4Q A;  1WQ7 A;  3G1Z A;  1Z7M A;  4ZTZ B;  4YRL A;  1YGB A;  4KQE A;  2DZ9 A;  3RF1 A;  3NEL A;  3A5Z A;  1G51 A;  2DEQ A;  4X5O A;  2RHQ A;  3QO8 A;  4YRG A;  3HFZ B;  1HXD A;  2AKW B;  4UP8 A;  1B7Y B;  2E3C A;  1NYQ A;  5C52 B;  3PCO A;  5ELN A;  4YDQ A;  4TVW A;  2ZZG A;  2AMC B;  1G5I A;  2ZZF A;  4XTW A;  1HC7 A;  3W3S A;  4XTV A;  2QHU A;  3MF2 A;  3RL6 A;  4WJ3 M;  2ZR3 A;  4LVL A;  4WJ4 A;  1C0A A;  11AS A;  2G4C A;  4P3O A;  4XTZ A;  3TEG A;  5E3I A;  4HWS A;  1KMM A;  2E10 A;  4KR3 A;  1E1T A;  4Q6G A;  4YRR A;  2DU5 A;  3CMQ A;  1N9W A;  3IG2 A;  2ZT6 A;  1B8A A;  4YRS A;  1E22 A;  4YRN A;  4ZIB A;  1JJC A;  2Q5I A;  3ERR A;  4YRM A;  4K87 A;  3RKX A;  1PYS A;  3V7R A;  2Q5H A;  5K1P A;  3NET A;  5ELO A;  1X56 A;  3P8Y A;  1KOG A;  1NJ8 A;  4XTX A;  1IL2 A;  3RAC A;  2EJG A;  2ZCE A;  3PCO B;  2ZIM A;  1EFW A;  2ARU A;  4RQF A;  3HFV A;  2ARS A;  4YCU A;  1X2G A;  1YFR A;  4HWP A;  4TTV A;  3QO5 A;  4L87 A;  1X2H A;  3OD1 A;  3MEY A;  3NEM A;  1NJ5 A;  2E64 A;  3BJU A;  2E5A A;  1ADY A;  3A5Y A;  5HGQ A;  1ADJ A;  1B70 A;  4PG3 A;  1H4V B;  3VQV A;  4CH6 A;  12AS A;  1JJC B;  1KMN A;  2DJZ A;  2RHS A;  2ZTG A;  2DXU A;  3PZC A;  1PYS B;  4H2Y A;  3A7R A;  2I4N A;  3RGL A;  4TQD A;  4H02 A;  1BIA A;  2ALY A;  4HVC A;  2J3L A;  3QNE A;  1EOV A;  4CH3 A;  4XU1 A;  1H4T A;  3FJP A;  3L4G A;  4G84 A;  4H2W A;  2ZT5 A;  4YCW A;  2CGH A;  2XGT A;  2ODR D;  2J3M A;  2DTI A;  2HNI A;  3RIR A;  4EO4 A;  3TEH A;  3IKM B;  4RMF A;  2PMF A;  3HXU A;  4XU0 A;  4O2D A;  3LSS A;  1B70 B;  4WI1 A;  1BBW A;  1X01 A;  4BWA A;  1E24 A;  4YRT A;  2ODR C;  2CJA A;  2RHS B;  3RKW A;  3VQX A;  1YFS A;  3UFG A;  2P5I A;  3EFS A;  3WQZ A;  3L2Z A;  4YRJ A;  4J15 A;  2ALY B;  3UGQ A;  3MQZ A;  2ZT8 A;  4HWO A;  4WF2 A;  4OP0 A;  1GGM A;  1SER A;  1NJ1 A;  2EL9 A;  5F5W A;  3LSQ A;  2DDZ A;  3RUX A;  2ZGW A;  3L1A A;  1BIB A;  1SES A;  4P3N A;  3L4G B;  2RHQ B;  1H4S A;  4P74 C;  3VBB A;  4P74 A;  1EIY A;  3E9H A;  4P71 C;  4YYE A;  4P71 A;  1W66 A;  3V8J A;  1NNH A;  4P72 C;  3TEH B;  4H2X A;  4P72 A;  4BW9 A;  4H2S A;  2DQ0 A;  1WU7 A;  4E51 A;  3UGT A;  3A74 A;  4HA8 A;  1QF6 A;  2DTO A;  3DSQ A;  2ART A;  2I4O A;  2FYK A;  2DXT A;  2E65 A;  2ZNI A;  3A7U A;  1X54 A;  2DVE A;  2ZR2 A;  2PME A;  1USY A;  1B76 A;  2EWN A;  2Q7H A;  4HT4 A;  3HRI A;  2ZNJ A;  4UPA A;  3V7S A;  4CH5 A;  3MF1 A;  2QHS A;  3HFZ A;  2AKW A;  2DZC A;  2ZT7 A;  2EAY A;  4TVY A;  1B7Y A;  4XEM A;  3E9I A;  2I4L A;  4H2X B;  3M4Q A;  2ZIN A;  2IY5 A;  1LYL A;  1FYF A;  2ZXF A;  3IKL A;  3HXX A;  1HTT A;  1QE0 A;  3P8T A;  3M4P A;  2A8E A;  4H2V A;  3BFM A;  3V7C A;  3TUP A;  4UP9 A;  1SRY A;  1NJ2 A;  4LVJ A;  4CH4 A;  1NJ6 A;  3HRK A;  4XEO A;  4YP0 A;  1RIQ A;  2QHV A;  3P8V A;  4YCV A;  4LVK A;  4DPG A;  4LNS A;  3I7F A;  4YRQ A;  4PHC A;  1E1O A;  2C8M A;  2Q7E A;  2E41 A;  1EQR A;  1ATI A;  3REU A;  3HXW A;  2XTI A;  2ZIO A;  4TQF A;  4OLF A;  3HTZ A;  3EFR A;  4HWR A;  1ASZ A;  4XU2 A;  4YRC A;  4P75 C;  4P75 A;  4Q15 A;  4RQE A;  2IY5 B;  1YB3 A;  3IAL A;  5K1X A; 
#chains in the Genus database with same CATH homology
 5KNN A;  4P3P A;  3HY0 A;  4TVA A;  1SET A;  4CS3 A;  2DU7 A;  4G85 A;  4XTU A;  4CS4 A;  1YFT A;  2C7I A;  2QHT A;  4YRK A;  1WQW A;  4XTY A;  3A32 A;  3NEN A;  2NS6 A;  3V8K A;  3HXV A;  4YRE A;  3HXY A;  4CS2 A;  2Q7G A;  2P0L A;  1EVK A;  1EVL A;  4H2T A;  3R07 A;  3VQW A;  4XU3 A;  3V8L A;  4YRI A;  3QO7 A;  3HXZ A;  4KR2 A;  1WLE A;  4HWT A;  3A7A A;  4K88 A;  1WPY A;  1USY C;  4LVM A;  1G5H A;  4YRP A;  3LC0 A;  1VQZ A;  2DTH A;  4K86 A;  2EJ9 A;  3A31 A;  3VQY A;  4LVI A;  2CJ9 A;  4RDX A;  4TVA B;  3ICA A;  1NYR A;  4YPF A;  3HY1 A;  1Z7N A;  1X55 A;  1BBU A;  2CJB A;  1EIY B;  4AH6 A;  3QTC A;  2CIM A;  4NCX A;  3RKY A;  1L0W A;  4H2U A;  4EX5 A;  1J5W A;  4ZTU B;  2I4M A;  4YRF A;  2AMC A;  3REX A;  2DQ3 A;  2E1H A;  4UP7 A;  4P73 C;  4TWA A;  4P73 A;  1WYD A;  2EJF A;  3UH0 A;  4DQ2 A;  3KFU A;  5C53 B;  1ASY A;  2DKG A;  4YRO A;  5C51 B;  1WNL A;  2ZZE A;  1H4Q A;  1WQ7 A;  3G1Z A;  1Z7M A;  4ZTZ B;  4YRL A;  1YGB A;  4KQE A;  2DZ9 A;  3RF1 A;  3NEL A;  3A5Z A;  1G51 A;  2DEQ A;  4X5O A;  2RHQ A;  3QO8 A;  4YRG A;  3HFZ B;  1HXD A;  2AKW B;  4UP8 A;  1B7Y B;  2E3C A;  1NYQ A;  5C52 B;  3PCO A;  5ELN A;  4YDQ A;  4TVW A;  2ZZG A;  2AMC B;  1G5I A;  2ZZF A;  4XTW A;  1HC7 A;  3W3S A;  4XTV A;  2QHU A;  3MF2 A;  3RL6 A;  4WJ3 M;  2ZR3 A;  4LVL A;  4WJ4 A;  1C0A A;  11AS A;  2G4C A;  4P3O A;  4XTZ A;  3TEG A;  5E3I A;  4HWS A;  1KMM A;  2E10 A;  4KR3 A;  1E1T A;  4Q6G A;  4YRR A;  2DU5 A;  3CMQ A;  1N9W A;  3IG2 A;  2ZT6 A;  1B8A A;  4YRS A;  1E22 A;  4YRN A;  4ZIB A;  1JJC A;  2Q5I A;  3ERR A;  4YRM A;  4K87 A;  3RKX A;  1PYS A;  3V7R A;  2Q5H A;  5K1P A;  3NET A;  5ELO A;  1X56 A;  3P8Y A;  1KOG A;  1NJ8 A;  4XTX A;  1IL2 A;  3RAC A;  2EJG A;  2ZCE A;  3PCO B;  2ZIM A;  1EFW A;  2ARU A;  4RQF A;  3HFV A;  2ARS A;  4YCU A;  1X2G A;  1YFR A;  4HWP A;  4TTV A;  3QO5 A;  4L87 A;  1X2H A;  3OD1 A;  3MEY A;  3NEM A;  1NJ5 A;  2E64 A;  3BJU A;  2E5A A;  1ADY A;  3A5Y A;  5HGQ A;  1ADJ A;  1B70 A;  4PG3 A;  1H4V B;  3VQV A;  4CH6 A;  12AS A;  1JJC B;  1KMN A;  2DJZ A;  2RHS A;  2ZTG A;  2DXU A;  3PZC A;  1PYS B;  4H2Y A;  3A7R A;  2I4N A;  3RGL A;  4TQD A;  4H02 A;  1BIA A;  2ALY A;  4HVC A;  2J3L A;  3QNE A;  1EOV A;  4CH3 A;  4XU1 A;  1H4T A;  3FJP A;  3L4G A;  4G84 A;  4H2W A;  2ZT5 A;  4YCW A;  2CGH A;  2XGT A;  2ODR D;  2J3M A;  2DTI A;  2HNI A;  3RIR A;  4EO4 A;  3TEH A;  3IKM B;  4RMF A;  2PMF A;  3HXU A;  4XU0 A;  4O2D A;  3LSS A;  1B70 B;  4WI1 A;  1BBW A;  1X01 A;  4BWA A;  1E24 A;  4YRT A;  2ODR C;  2CJA A;  2RHS B;  3RKW A;  3VQX A;  1YFS A;  3UFG A;  2P5I A;  3EFS A;  3WQZ A;  3L2Z A;  4YRJ A;  4J15 A;  2ALY B;  3UGQ A;  3MQZ A;  2ZT8 A;  4HWO A;  4WF2 A;  4OP0 A;  1GGM A;  1SER A;  1NJ1 A;  2EL9 A;  5F5W A;  3LSQ A;  2DDZ A;  3RUX A;  2ZGW A;  3L1A A;  1BIB A;  1SES A;  4P3N A;  3L4G B;  2RHQ B;  1H4S A;  4P74 C;  3VBB A;  4P74 A;  1EIY A;  3E9H A;  4P71 C;  4YYE A;  4P71 A;  1W66 A;  3V8J A;  1NNH A;  4P72 C;  3TEH B;  4H2X A;  4P72 A;  4BW9 A;  4H2S A;  2DQ0 A;  1WU7 A;  4E51 A;  3UGT A;  3A74 A;  4HA8 A;  1QF6 A;  2DTO A;  3DSQ A;  2ART A;  2I4O A;  2FYK A;  2DXT A;  2E65 A;  2ZNI A;  3A7U A;  1X54 A;  2DVE A;  2ZR2 A;  2PME A;  1USY A;  1B76 A;  2EWN A;  2Q7H A;  4HT4 A;  3HRI A;  2ZNJ A;  4UPA A;  3V7S A;  4CH5 A;  3MF1 A;  2QHS A;  3HFZ A;  2AKW A;  2DZC A;  2ZT7 A;  2EAY A;  4TVY A;  1B7Y A;  4XEM A;  3E9I A;  2I4L A;  4H2X B;  3M4Q A;  2ZIN A;  2IY5 A;  1LYL A;  1FYF A;  2ZXF A;  3IKL A;  3HXX A;  1HTT A;  1QE0 A;  3P8T A;  3M4P A;  2A8E A;  4H2V A;  3BFM A;  3V7C A;  3TUP A;  4UP9 A;  1SRY A;  1NJ2 A;  4LVJ A;  4CH4 A;  1NJ6 A;  3HRK A;  4XEO A;  4YP0 A;  1RIQ A;  2QHV A;  3P8V A;  4YCV A;  4LVK A;  4DPG A;  4LNS A;  3I7F A;  4YRQ A;  4PHC A;  1E1O A;  2C8M A;  2Q7E A;  2E41 A;  1EQR A;  1ATI A;  3REU A;  3HXW A;  2XTI A;  2ZIO A;  4TQF A;  4OLF A;  3HTZ A;  3EFR A;  4HWR A;  1ASZ A;  4XU2 A;  4YRC A;  4P75 C;  4P75 A;  4Q15 A;  4RQE A;  2IY5 B;  1YB3 A;  3IAL A;  5K1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...