4LVIA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt). mn-bound crystal structure at ph 4.6
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
190
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Plasmid recombination enzyme
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
total genus 60
structure length 190
sequence length 194
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lviA01
4LVIA 4LVJA 4HT4A 4LVKA 4LVMA 2NS6A 4LVLA
chains in the Genus database with same CATH superfamily
5E3IA 4CH4A 4P71A 1NJ8A 2E10A 3CMQA 4UP9A 3A5ZA 2DZ9A 1WLEA 2QHTA 4WJ4A 2ZR3A 3BFMA 2AMCA 4P72A 4HA8A 4XEOA 2E64A 1H4SA 2C8MA 1ASZA 1E1TA 3RKXA 1EFWA 4UP7A 2Q5HA 4Q15A 4XTUA 1JJCB 4TVWA 1PYSA 4YRLA 4XTYA 4LVIA 2C7IA 3V8JA 3PCOB 3NELA 2ALYA 1BIAA 3HXYA 1NYQA 2EAYA 2Q7HA 3IG2A 1LYLA 1EIYB 5ELOA 4LVMA 1HC7A 3L4GB 4XU2A 1X56A 1VQZA 2ZT6A 2DXTA 1E24A 2I4MA 5ELNA 3DSQA 4CH6A 1G5IA 3V7SA 4KR3A 3M4PA 5HGQA 2EJ9A 3MF1A 1NJ1A 3NETA 4P75C 1WU7A 2DKGA 4YCWA 2NS6A 2DXUA 2ARUA 1ADJA 4HWRA 11ASA 4K87A 1G5HA 4YRNA 1EQRA 4ZIBA 2Q7GA 4BW9A 2P0LA 4H2YA 1SETA 1WPYA 1BBWA 4P3NA 4YRIA 1ASYA 5C53B 2ZNIA 1YFRA 4PG3A 3NENA 4YRKA 4UP8A 2DZCA 3QNEA 2CJ9A 2Q5IA 2QHVA 4XU1A 3A32A 2ZNJA 4P75A 3IALA 1EVKA 4H2TA 1WQ7A 2ZZFA 1FYFA 1NNHA 1C0AA 2ZCEA 4LVKA 3MQZA 4CH3A 1H4TA 2IY5A 2AKWA 1NJ2A 2CJAA 2DEQA 3M4QA 2XGTA 4P74A 1W66A 3HFZA 2I4NA 3HFVA 4TQFA 2DTIA 2RHQA 3RKWA 2ZT5A 4L87A 3ERRA 2DJZA 4LVLA 3OD1A 3P8YA 4XTWA 2FYKA 1X54A 2EJGA 3RKYA 2RHSA 1YFTA 4YP0A 3HXUA 3QO5A 4YCUA 4DPGA 3RF1A 1HXDA 1USYC 5K1PA 3HTZA 3PCOA 1HTTA 2ZIOA 2ZT8A 3VBBA 4KR2A 4LVJA 1QE0A 2ALYB 4YRPA 3HXXA 4H2XA 3R07A 4RQFA 4TVAA 4CS2A 3KFUA 4H02A 4NCXA 5KNNA 3TUPA 2ARSA 3G1ZA 3BJUA 4ZTUB 4OLFA 4TWAA 2PMFA 3LC0A 1B7YA 1YB3A 3LSQA 4OP0A 3V8LA 2DU5A 2J3MA 3RGLA 4XTXA 4YROA 4LNSA 1H4QA 3PZCA 4DQ2A 4UPAA 4KQEA 1E22A 2ZT7A 4H2VA 4YRJA 3A7AA 2DDZA 3E9IA 4K88A 1EOVA 2E5AA 1NYRA 4XTZA 4PHCA 3HXWA 4YRTA 4P3OA 1Z7NA 4YDQA 1IL2A 4J15A 4XU0A 3TEHA 2I4LA 4HWSA 3W3SA 4HWTA 1X2GA 2EL9A 4XU3A 3VQVA 4YRCA 3HRKA 4HWPA 1N9WA 1BBUA 3HY0A 1WQWA 1B70A 3QO8A 4YRQA 3RACA 1RIQA 3A7RA 2DVEA 3L1AA 2CJBA 1SRYA 1E1OA 1Z7MA 4ZTZB 4P73C 3HXZA 2DTOA 3P8TA 3HY1A 4HVCA 3ICAA 4AH6A 4RDXA 4YCVA 2E41A 2I4OA 4WI1A 3V7RA 2ODRD 1NJ5A 3RL6A 3P8VA 3FJPA 2ODRC 3HXVA 3WQZA 1B8AA 2IY5B 4G85A 2AKWB 4EO4A 2AMCB 3MEYA 3HFZB 2CIMA 1G51A 4H2WA 3QTCA 4CS4A 2RHQB 3V8KA 3VQXA 1L0WA 1JJCA 4XEMA 2DQ0A 4K86A 2G4CA 3A74A 3UH0A 4X5OA 4CH5A 4YRSA 4WF2A 3IKMB 1X01A 2EWNA 1PYSB 4E51A 2E1HA 2QHUA 2RHSB 4P73A 3IKLA 2ZTGA 1ATIA 2PMEA 5C52B 1EIYA 4H2SA 4Q6GA 2QHSA 4RQEA 4RMFA 4HWOA 4TTVA 3EFSA 4YRGA 3L4GA 3I7FA 2P5IA 5C51B 4YRFA 1YFSA 4HT4A 1B76A 3HRIA 12ASA 4H2XB 2EJFA 2DTHA 4TVAB 3UGQA 4CS3A 4WJ3M 2ARTA 2ZINA 2Q7EA 3RIRA 4YREA 4YRMA 3E9HA 4TQDA 4H2UA 1B7YB 2ZIMA 1YGBA 2XTIA 1BIBA 3UGTA 1USYA 2ZZEA 5K1XA 3REUA 3VQYA 2ZR2A 3TEGA 1KMNA 1X55A 2DU7A 1WYDA 4G84A 2HNIA 2A8EA 4P3PA 3A31A 3NEMA 3A5YA 4P71C 4BWAA 2DQ3A 2ZZGA 3REXA 3UFGA 1X2HA 1H4VB 3TEHB 2ZXFA 3V7CA 4P74C 1NJ6A 4P72C 3VQWA 1J5WA 4O2DA 3L2ZA 4YRRA 1WNLA 3QO7A 4EX5A 4YPFA 5F5WA 1ADYA 1EVLA 4XTVA 1B70B 1QF6A 3A7UA 1GGMA 2E3CA 3RUXA 1SERA 2CGHA 1KOGA 3LSSA 2ZGWA 3EFRA 1SESA 1KMMA 2E65A 4YYEA 4TVYA 2J3LA 3MF2A
chains in the Genus database with same CATH topology
5E3IA 4CH4A 4P71A 1NJ8A 2E10A 3CMQA 4UP9A 3A5ZA 2DZ9A 1WLEA 2QHTA 4WJ4A 2ZR3A 3BFMA 2AMCA 4P72A 4HA8A 4XEOA 2E64A 1H4SA 2C8MA 1ASZA 1E1TA 3RKXA 1EFWA 4UP7A 2Q5HA 4Q15A 4XTUA 1JJCB 4TVWA 1PYSA 4YRLA 4XTYA 4LVIA 2C7IA 3V8JA 3PCOB 3NELA 2ALYA 1BIAA 3HXYA 1NYQA 2EAYA 2Q7HA 3IG2A 1LYLA 1EIYB 5ELOA 4LVMA 1HC7A 3L4GB 4XU2A 1X56A 1VQZA 2ZT6A 2DXTA 1E24A 2I4MA 5ELNA 3DSQA 4CH6A 1G5IA 3V7SA 4KR3A 3M4PA 5HGQA 2EJ9A 3MF1A 1NJ1A 3NETA 4P75C 1WU7A 2DKGA 4YCWA 2NS6A 2DXUA 2ARUA 1ADJA 4HWRA 11ASA 4K87A 1G5HA 4YRNA 1EQRA 4ZIBA 2Q7GA 4BW9A 2P0LA 4H2YA 1SETA 1WPYA 1BBWA 4P3NA 4YRIA 1ASYA 5C53B 2ZNIA 1YFRA 4PG3A 3NENA 4YRKA 4UP8A 2DZCA 3QNEA 2CJ9A 2Q5IA 2QHVA 4XU1A 3A32A 2ZNJA 4P75A 3IALA 1EVKA 4H2TA 1WQ7A 2ZZFA 1FYFA 1NNHA 1C0AA 2ZCEA 4LVKA 3MQZA 4CH3A 1H4TA 2IY5A 2AKWA 1NJ2A 2CJAA 2DEQA 3M4QA 2XGTA 4P74A 1W66A 3HFZA 2I4NA 3HFVA 4TQFA 2DTIA 2RHQA 3RKWA 2ZT5A 4L87A 3ERRA 2DJZA 4LVLA 3OD1A 3P8YA 4XTWA 2FYKA 1X54A 2EJGA 3RKYA 2RHSA 1YFTA 4YP0A 3HXUA 3QO5A 4YCUA 4DPGA 3RF1A 1HXDA 1USYC 5K1PA 3HTZA 3PCOA 1HTTA 2ZIOA 2ZT8A 3VBBA 4KR2A 4LVJA 1QE0A 2ALYB 4YRPA 3HXXA 4H2XA 3R07A 4RQFA 4TVAA 4CS2A 3KFUA 4H02A 4NCXA 5KNNA 3TUPA 2ARSA 3G1ZA 3BJUA 4ZTUB 4OLFA 4TWAA 2PMFA 3LC0A 1B7YA 1YB3A 3LSQA 4OP0A 3V8LA 2DU5A 2J3MA 3RGLA 4XTXA 4YROA 4LNSA 1H4QA 3PZCA 4DQ2A 4UPAA 4KQEA 1E22A 2ZT7A 4H2VA 4YRJA 3A7AA 2DDZA 3E9IA 4K88A 1EOVA 2E5AA 1NYRA 4XTZA 4PHCA 3HXWA 4YRTA 4P3OA 1Z7NA 4YDQA 1IL2A 4J15A 4XU0A 3TEHA 2I4LA 4HWSA 3W3SA 4HWTA 1X2GA 2EL9A 4XU3A 3VQVA 4YRCA 3HRKA 4HWPA 1N9WA 1BBUA 3HY0A 1WQWA 1B70A 3QO8A 4YRQA 3RACA 1RIQA 3A7RA 2DVEA 3L1AA 2CJBA 1SRYA 1E1OA 1Z7MA 4ZTZB 4P73C 3HXZA 2DTOA 3P8TA 3HY1A 4HVCA 3ICAA 4AH6A 4RDXA 4YCVA 2E41A 2I4OA 4WI1A 3V7RA 2ODRD 1NJ5A 3RL6A 3P8VA 3FJPA 2ODRC 3HXVA 3WQZA 1B8AA 2IY5B 4G85A 2AKWB 4EO4A 2AMCB 3MEYA 3HFZB 2CIMA 1G51A 4H2WA 3QTCA 4CS4A 2RHQB 3V8KA 3VQXA 1L0WA 1JJCA 4XEMA 2DQ0A 4K86A 2G4CA 3A74A 3UH0A 4X5OA 4CH5A 4YRSA 4WF2A 3IKMB 1X01A 2EWNA 1PYSB 4E51A 2E1HA 2QHUA 2RHSB 4P73A 3IKLA 2ZTGA 1ATIA 2PMEA 5C52B 1EIYA 4H2SA 4Q6GA 2QHSA 4RQEA 4RMFA 4HWOA 4TTVA 3EFSA 4YRGA 3L4GA 3I7FA 2P5IA 5C51B 4YRFA 1YFSA 4HT4A 1B76A 3HRIA 12ASA 4H2XB 2EJFA 2DTHA 4TVAB 3UGQA 4CS3A 4WJ3M 2ARTA 2ZINA 2Q7EA 3RIRA 4YREA 4YRMA 3E9HA 4TQDA 4H2UA 1B7YB 2ZIMA 1YGBA 2XTIA 1BIBA 3UGTA 1USYA 2ZZEA 5K1XA 3REUA 3VQYA 2ZR2A 3TEGA 1KMNA 1X55A 2DU7A 1WYDA 4G84A 2HNIA 2A8EA 4P3PA 3A31A 3NEMA 3A5YA 4P71C 4BWAA 2DQ3A 2ZZGA 3REXA 3UFGA 1X2HA 1H4VB 3TEHB 2ZXFA 3V7CA 4P74C 1NJ6A 4P72C 3VQWA 1J5WA 4O2DA 3L2ZA 4YRRA 1WNLA 3QO7A 4EX5A 4YPFA 5F5WA 1ADYA 1EVLA 4XTVA 1B70B 1QF6A 3A7UA 1GGMA 2E3CA 3RUXA 1SERA 2CGHA 1KOGA 3LSSA 2ZGWA 3EFRA 1SESA 1KMMA 2E65A 4YYEA 4TVYA 2J3LA 3MF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVI A;  4LVJ A;  4HT4 A;  4LVK A;  4LVM A;  2NS6 A;  4LVL A; 
#chains in the Genus database with same CATH topology
 5E3I A;  4CH4 A;  4P71 A;  1NJ8 A;  2E10 A;  3CMQ A;  4UP9 A;  3A5Z A;  2DZ9 A;  1WLE A;  2QHT A;  4WJ4 A;  2ZR3 A;  3BFM A;  2AMC A;  4P72 A;  4HA8 A;  4XEO A;  2E64 A;  1H4S A;  2C8M A;  1ASZ A;  1E1T A;  3RKX A;  1EFW A;  4UP7 A;  2Q5H A;  4Q15 A;  4XTU A;  1JJC B;  4TVW A;  1PYS A;  4YRL A;  4XTY A;  4LVI A;  2C7I A;  3V8J A;  3PCO B;  3NEL A;  2ALY A;  1BIA A;  3HXY A;  1NYQ A;  2EAY A;  2Q7H A;  3IG2 A;  1LYL A;  1EIY B;  5ELO A;  4LVM A;  1HC7 A;  3L4G B;  4XU2 A;  1X56 A;  1VQZ A;  2ZT6 A;  2DXT A;  1E24 A;  2I4M A;  5ELN A;  3DSQ A;  4CH6 A;  1G5I A;  3V7S A;  4KR3 A;  3M4P A;  5HGQ A;  2EJ9 A;  3MF1 A;  1NJ1 A;  3NET A;  4P75 C;  1WU7 A;  2DKG A;  4YCW A;  2NS6 A;  2DXU A;  2ARU A;  1ADJ A;  4HWR A;  11AS A;  4K87 A;  1G5H A;  4YRN A;  1EQR A;  4ZIB A;  2Q7G A;  4BW9 A;  2P0L A;  4H2Y A;  1SET A;  1WPY A;  1BBW A;  4P3N A;  4YRI A;  1ASY A;  5C53 B;  2ZNI A;  1YFR A;  4PG3 A;  3NEN A;  4YRK A;  4UP8 A;  2DZC A;  3QNE A;  2CJ9 A;  2Q5I A;  2QHV A;  4XU1 A;  3A32 A;  2ZNJ A;  4P75 A;  3IAL A;  1EVK A;  4H2T A;  1WQ7 A;  2ZZF A;  1FYF A;  1NNH A;  1C0A A;  2ZCE A;  4LVK A;  3MQZ A;  4CH3 A;  1H4T A;  2IY5 A;  2AKW A;  1NJ2 A;  2CJA A;  2DEQ A;  3M4Q A;  2XGT A;  4P74 A;  1W66 A;  3HFZ A;  2I4N A;  3HFV A;  4TQF A;  2DTI A;  2RHQ A;  3RKW A;  2ZT5 A;  4L87 A;  3ERR A;  2DJZ A;  4LVL A;  3OD1 A;  3P8Y A;  4XTW A;  2FYK A;  1X54 A;  2EJG A;  3RKY A;  2RHS A;  1YFT A;  4YP0 A;  3HXU A;  3QO5 A;  4YCU A;  4DPG A;  3RF1 A;  1HXD A;  1USY C;  5K1P A;  3HTZ A;  3PCO A;  1HTT A;  2ZIO A;  2ZT8 A;  3VBB A;  4KR2 A;  4LVJ A;  1QE0 A;  2ALY B;  4YRP A;  3HXX A;  4H2X A;  3R07 A;  4RQF A;  4TVA A;  4CS2 A;  3KFU A;  4H02 A;  4NCX A;  5KNN A;  3TUP A;  2ARS A;  3G1Z A;  3BJU A;  4ZTU B;  4OLF A;  4TWA A;  2PMF A;  3LC0 A;  1B7Y A;  1YB3 A;  3LSQ A;  4OP0 A;  3V8L A;  2DU5 A;  2J3M A;  3RGL A;  4XTX A;  4YRO A;  4LNS A;  1H4Q A;  3PZC A;  4DQ2 A;  4UPA A;  4KQE A;  1E22 A;  2ZT7 A;  4H2V A;  4YRJ A;  3A7A A;  2DDZ A;  3E9I A;  4K88 A;  1EOV A;  2E5A A;  1NYR A;  4XTZ A;  4PHC A;  3HXW A;  4YRT A;  4P3O A;  1Z7N A;  4YDQ A;  1IL2 A;  4J15 A;  4XU0 A;  3TEH A;  2I4L A;  4HWS A;  3W3S A;  4HWT A;  1X2G A;  2EL9 A;  4XU3 A;  3VQV A;  4YRC A;  3HRK A;  4HWP A;  1N9W A;  1BBU A;  3HY0 A;  1WQW A;  1B70 A;  3QO8 A;  4YRQ A;  3RAC A;  1RIQ A;  3A7R A;  2DVE A;  3L1A A;  2CJB A;  1SRY A;  1E1O A;  1Z7M A;  4ZTZ B;  4P73 C;  3HXZ A;  2DTO A;  3P8T A;  3HY1 A;  4HVC A;  3ICA A;  4AH6 A;  4RDX A;  4YCV A;  2E41 A;  2I4O A;  4WI1 A;  3V7R A;  2ODR D;  1NJ5 A;  3RL6 A;  3P8V A;  3FJP A;  2ODR C;  3HXV A;  3WQZ A;  1B8A A;  2IY5 B;  4G85 A;  2AKW B;  4EO4 A;  2AMC B;  3MEY A;  3HFZ B;  2CIM A;  1G51 A;  4H2W A;  3QTC A;  4CS4 A;  2RHQ B;  3V8K A;  3VQX A;  1L0W A;  1JJC A;  4XEM A;  2DQ0 A;  4K86 A;  2G4C A;  3A74 A;  3UH0 A;  4X5O A;  4CH5 A;  4YRS A;  4WF2 A;  3IKM B;  1X01 A;  2EWN A;  1PYS B;  4E51 A;  2E1H A;  2QHU A;  2RHS B;  4P73 A;  3IKL A;  2ZTG A;  1ATI A;  2PME A;  5C52 B;  1EIY A;  4H2S A;  4Q6G A;  2QHS A;  4RQE A;  4RMF A;  4HWO A;  4TTV A;  3EFS A;  4YRG A;  3L4G A;  3I7F A;  2P5I A;  5C51 B;  4YRF A;  1YFS A;  4HT4 A;  1B76 A;  3HRI A;  12AS A;  4H2X B;  2EJF A;  2DTH A;  4TVA B;  3UGQ A;  4CS3 A;  4WJ3 M;  2ART A;  2ZIN A;  2Q7E A;  3RIR A;  4YRE A;  4YRM A;  3E9H A;  4TQD A;  4H2U A;  1B7Y B;  2ZIM A;  1YGB A;  2XTI A;  1BIB A;  3UGT A;  1USY A;  2ZZE A;  5K1X A;  3REU A;  3VQY A;  2ZR2 A;  3TEG A;  1KMN A;  1X55 A;  2DU7 A;  1WYD A;  4G84 A;  2HNI A;  2A8E A;  4P3P A;  3A31 A;  3NEM A;  3A5Y A;  4P71 C;  4BWA A;  2DQ3 A;  2ZZG A;  3REX A;  3UFG A;  1X2H A;  1H4V B;  3TEH B;  2ZXF A;  3V7C A;  4P74 C;  1NJ6 A;  4P72 C;  3VQW A;  1J5W A;  4O2D A;  3L2Z A;  4YRR A;  1WNL A;  3QO7 A;  4EX5 A;  4YPF A;  5F5W A;  1ADY A;  1EVL A;  4XTV A;  1B70 B;  1QF6 A;  3A7U A;  1GGM A;  2E3C A;  3RUX A;  1SER A;  2CGH A;  1KOG A;  3LSS A;  2ZGW A;  3EFR A;  1SES A;  1KMM A;  2E65 A;  4YYE A;  4TVY A;  2J3L A;  3MF2 A; 
#chains in the Genus database with same CATH homology
 5E3I A;  4CH4 A;  4P71 A;  1NJ8 A;  2E10 A;  3CMQ A;  4UP9 A;  3A5Z A;  2DZ9 A;  1WLE A;  2QHT A;  4WJ4 A;  2ZR3 A;  3BFM A;  2AMC A;  4P72 A;  4HA8 A;  4XEO A;  2E64 A;  1H4S A;  2C8M A;  1ASZ A;  1E1T A;  3RKX A;  1EFW A;  4UP7 A;  2Q5H A;  4Q15 A;  4XTU A;  1JJC B;  4TVW A;  1PYS A;  4YRL A;  4XTY A;  4LVI A;  2C7I A;  3V8J A;  3PCO B;  3NEL A;  2ALY A;  1BIA A;  3HXY A;  1NYQ A;  2EAY A;  2Q7H A;  3IG2 A;  1LYL A;  1EIY B;  5ELO A;  4LVM A;  1HC7 A;  3L4G B;  4XU2 A;  1X56 A;  1VQZ A;  2ZT6 A;  2DXT A;  1E24 A;  2I4M A;  5ELN A;  3DSQ A;  4CH6 A;  1G5I A;  3V7S A;  4KR3 A;  3M4P A;  5HGQ A;  2EJ9 A;  3MF1 A;  1NJ1 A;  3NET A;  4P75 C;  1WU7 A;  2DKG A;  4YCW A;  2NS6 A;  2DXU A;  2ARU A;  1ADJ A;  4HWR A;  11AS A;  4K87 A;  1G5H A;  4YRN A;  1EQR A;  4ZIB A;  2Q7G A;  4BW9 A;  2P0L A;  4H2Y A;  1SET A;  1WPY A;  1BBW A;  4P3N A;  4YRI A;  1ASY A;  5C53 B;  2ZNI A;  1YFR A;  4PG3 A;  3NEN A;  4YRK A;  4UP8 A;  2DZC A;  3QNE A;  2CJ9 A;  2Q5I A;  2QHV A;  4XU1 A;  3A32 A;  2ZNJ A;  4P75 A;  3IAL A;  1EVK A;  4H2T A;  1WQ7 A;  2ZZF A;  1FYF A;  1NNH A;  1C0A A;  2ZCE A;  4LVK A;  3MQZ A;  4CH3 A;  1H4T A;  2IY5 A;  2AKW A;  1NJ2 A;  2CJA A;  2DEQ A;  3M4Q A;  2XGT A;  4P74 A;  1W66 A;  3HFZ A;  2I4N A;  3HFV A;  4TQF A;  2DTI A;  2RHQ A;  3RKW A;  2ZT5 A;  4L87 A;  3ERR A;  2DJZ A;  4LVL A;  3OD1 A;  3P8Y A;  4XTW A;  2FYK A;  1X54 A;  2EJG A;  3RKY A;  2RHS A;  1YFT A;  4YP0 A;  3HXU A;  3QO5 A;  4YCU A;  4DPG A;  3RF1 A;  1HXD A;  1USY C;  5K1P A;  3HTZ A;  3PCO A;  1HTT A;  2ZIO A;  2ZT8 A;  3VBB A;  4KR2 A;  4LVJ A;  1QE0 A;  2ALY B;  4YRP A;  3HXX A;  4H2X A;  3R07 A;  4RQF A;  4TVA A;  4CS2 A;  3KFU A;  4H02 A;  4NCX A;  5KNN A;  3TUP A;  2ARS A;  3G1Z A;  3BJU A;  4ZTU B;  4OLF A;  4TWA A;  2PMF A;  3LC0 A;  1B7Y A;  1YB3 A;  3LSQ A;  4OP0 A;  3V8L A;  2DU5 A;  2J3M A;  3RGL A;  4XTX A;  4YRO A;  4LNS A;  1H4Q A;  3PZC A;  4DQ2 A;  4UPA A;  4KQE A;  1E22 A;  2ZT7 A;  4H2V A;  4YRJ A;  3A7A A;  2DDZ A;  3E9I A;  4K88 A;  1EOV A;  2E5A A;  1NYR A;  4XTZ A;  4PHC A;  3HXW A;  4YRT A;  4P3O A;  1Z7N A;  4YDQ A;  1IL2 A;  4J15 A;  4XU0 A;  3TEH A;  2I4L A;  4HWS A;  3W3S A;  4HWT A;  1X2G A;  2EL9 A;  4XU3 A;  3VQV A;  4YRC A;  3HRK A;  4HWP A;  1N9W A;  1BBU A;  3HY0 A;  1WQW A;  1B70 A;  3QO8 A;  4YRQ A;  3RAC A;  1RIQ A;  3A7R A;  2DVE A;  3L1A A;  2CJB A;  1SRY A;  1E1O A;  1Z7M A;  4ZTZ B;  4P73 C;  3HXZ A;  2DTO A;  3P8T A;  3HY1 A;  4HVC A;  3ICA A;  4AH6 A;  4RDX A;  4YCV A;  2E41 A;  2I4O A;  4WI1 A;  3V7R A;  2ODR D;  1NJ5 A;  3RL6 A;  3P8V A;  3FJP A;  2ODR C;  3HXV A;  3WQZ A;  1B8A A;  2IY5 B;  4G85 A;  2AKW B;  4EO4 A;  2AMC B;  3MEY A;  3HFZ B;  2CIM A;  1G51 A;  4H2W A;  3QTC A;  4CS4 A;  2RHQ B;  3V8K A;  3VQX A;  1L0W A;  1JJC A;  4XEM A;  2DQ0 A;  4K86 A;  2G4C A;  3A74 A;  3UH0 A;  4X5O A;  4CH5 A;  4YRS A;  4WF2 A;  3IKM B;  1X01 A;  2EWN A;  1PYS B;  4E51 A;  2E1H A;  2QHU A;  2RHS B;  4P73 A;  3IKL A;  2ZTG A;  1ATI A;  2PME A;  5C52 B;  1EIY A;  4H2S A;  4Q6G A;  2QHS A;  4RQE A;  4RMF A;  4HWO A;  4TTV A;  3EFS A;  4YRG A;  3L4G A;  3I7F A;  2P5I A;  5C51 B;  4YRF A;  1YFS A;  4HT4 A;  1B76 A;  3HRI A;  12AS A;  4H2X B;  2EJF A;  2DTH A;  4TVA B;  3UGQ A;  4CS3 A;  4WJ3 M;  2ART A;  2ZIN A;  2Q7E A;  3RIR A;  4YRE A;  4YRM A;  3E9H A;  4TQD A;  4H2U A;  1B7Y B;  2ZIM A;  1YGB A;  2XTI A;  1BIB A;  3UGT A;  1USY A;  2ZZE A;  5K1X A;  3REU A;  3VQY A;  2ZR2 A;  3TEG A;  1KMN A;  1X55 A;  2DU7 A;  1WYD A;  4G84 A;  2HNI A;  2A8E A;  4P3P A;  3A31 A;  3NEM A;  3A5Y A;  4P71 C;  4BWA A;  2DQ3 A;  2ZZG A;  3REX A;  3UFG A;  1X2H A;  1H4V B;  3TEH B;  2ZXF A;  3V7C A;  4P74 C;  1NJ6 A;  4P72 C;  3VQW A;  1J5W A;  4O2D A;  3L2Z A;  4YRR A;  1WNL A;  3QO7 A;  4EX5 A;  4YPF A;  5F5W A;  1ADY A;  1EVL A;  4XTV A;  1B70 B;  1QF6 A;  3A7U A;  1GGM A;  2E3C A;  3RUX A;  1SER A;  2CGH A;  1KOG A;  3LSS A;  2ZGW A;  3EFR A;  1SES A;  1KMM A;  2E65 A;  4YYE A;  4TVY A;  2J3L A;  3MF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...