4LVJA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt). mn-bound crystal structure at ph 5.5
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
192
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVFSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Plasmid recombination enzyme
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
total genus 63
structure length 192
sequence length 195
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvjA01
4LVJA 4LVMA 2NS6A 4HT4A 4LVKA 4LVLA 4LVIA
chains in the Genus database with same CATH superfamily
4OP0A 2E10A 4CH6A 1USYC 3V8JA 4NCXA 1YFRA 4H2XB 4P75A 1Z7NA 3RL6A 3W3SA 4CH4A 2QHSA 4EO4A 1G51A 2I4OA 3P8TA 2ZINA 1E22A 3VQYA 4CH5A 4KR2A 2ZGWA 2ZT7A 4YP0A 4TVYA 1X56A 2E5AA 3MF2A 4XTWA 3IKMB 3P8YA 3V8LA 3A74A 1NJ2A 4YCUA 2DU5A 2ZIMA 1EVKA 4H2SA 11ASA 4CH3A 3A5ZA 4P74A 2RHSA 5E3IA 2DTOA 2ZT6A 3V8KA 5K1XA 3UH0A 4KQEA 4YRCA 3V7RA 1JJCB 1B76A 2FYKA 4WJ3M 3HY0A 3LC0A 4K88A 4XU0A 1QF6A 2XGTA 5ELNA 1SERA 2DQ0A 2E3CA 2E65A 2ZTGA 3MQZA 4H2XA 5C53B 3NELA 2DU7A 4YRJA 1NJ6A 4AH6A 4K87A 4E51A 1W66A 1FYFA 3HXVA 4YRSA 2G4CA 1ADJA 4BW9A 1H4TA 5ELOA 1B7YB 3HFZA 4LNSA 1C0AA 3HXUA 4HWOA 4XU2A 4H2YA 3HXYA 2ZT8A 4LVKA 3HRKA 1EIYA 3RUXA 3TEHA 4HWTA 4LVLA 2EWNA 3EFSA 3RACA 1EOVA 3QO8A 3QO7A 3R07A 4P71C 3A32A 5HGQA 3MEYA 3CMQA 4TTVA 4XTXA 3L4GB 1WU7A 1JJCA 1Z7MA 3UGQA 1VQZA 4G84A 2RHQB 1G5IA 2AMCB 2DZCA 4PG3A 3PCOB 3P8VA 4P73C 3VBBA 1HTTA 3V7CA 3KFUA 4YRPA 2EL9A 2Q5IA 1ATIA 1RIQA 4YDQA 2CIMA 4P3NA 4P72C 1QE0A 1KMNA 4HWPA 2Q7GA 3IKLA 3DSQA 1B7YA 2PMFA 1ADYA 2EJFA 4TQDA 1WLEA 3RKWA 1HXDA 2ZNIA 1LYLA 4P75C 4RMFA 4YRIA 1EVLA 4YRNA 3A5YA 2AKWA 4HWSA 2ARSA 2CJBA 1EFWA 1E1OA 3IALA 4YPFA 1NYQA 1L0WA 3HXXA 2DVEA 3NEMA 4TQFA 2CJAA 4ZIBA 3BFMA 4HWRA 4TVAB 2RHQA 2DTIA 5K1PA 3PCOA 2DEQA 3BJUA 1NJ1A 1B70A 1BBWA 4RDXA 4P74C 1EQRA 4CS3A 4YROA 2Q7HA 3IG2A 3ICAA 4XTYA 4YRFA 4XEOA 3REXA 1GGMA 3TEGA 4YCVA 4HT4A 4DQ2A 2Q5HA 2ZZFA 4CS2A 3UFGA 5F5WA 4DPGA 1WPYA 3LSQA 4L87A 1X01A 3E9IA 4YRKA 4PHCA 4XTZA 3RKXA 3M4QA 2A8EA 3A7AA 2QHTA 3LSSA 1YGBA 1KMMA 4XU3A 3OD1A 1H4QA 1NNHA 4UP7A 3NETA 4H2UA 4YREA 4EX5A 4HA8A 1X55A 4WF2A 4BWAA 1SESA 2ODRC 4ZTUB 3HXZA 2DZ9A 3VQVA 1X2GA 2DKGA 2DDZA 1WQWA 2ALYB 4H02A 1YFTA 1BIAA 4RQFA 2Q7EA 2P5IA 12ASA 3E9HA 2ZNJA 4RQEA 1SRYA 4YRRA 2PMEA 5KNNA 2HNIA 1NYRA 1X54A 3RIRA 4YRQA 1E24A 4UPAA 1ASZA 1NJ5A 4H2WA 4ZTZB 1HC7A 4HVCA 3FJPA 1H4VB 4YRGA 4XU1A 2C7IA 2EJ9A 2ODRD 1USYA 4P72A 4YYEA 4G85A 3HRIA 3WQZA 3V7SA 4LVJA 4J15A 3HTZA 4TVWA 1PYSB 5C51B 3HXWA 2XTIA 2ARUA 3MF1A 4UP8A 3L4GA 1BBUA 1E1TA 4XTVA 2ALYA 2ZIOA 3M4PA 1SETA 3HFZB 3HY1A 2DTHA 2DQ3A 2ZZGA 2EAYA 2J3MA 1IL2A 2AMCA 4YRMA 1WNLA 2I4NA 2QHUA 3TUPA 1NJ8A 3QO5A 3VQXA 3A31A 1J5WA 4WI1A 4LVIA 1BIBA 1EIYB 3TEHB 2NS6A 4KR3A 2ZR2A 1N9WA 4YRTA 2IY5B 4K86A 3UGTA 4P3OA 4P3PA 2P0LA 4H2VA 3A7RA 3QTCA 1YB3A 2DJZA 3I7FA 2CJ9A 3NENA 3HFVA 1PYSA 1WQ7A 2ZCEA 2DXTA 1X2HA 2CGHA 4TWAA 4CS4A 3VQWA 2J3LA 4Q6GA 3ERRA 4O2DA 2EJGA 4YCWA 5C52B 4WJ4A 4TVAA 3A7UA 2ZT5A 1B8AA 2ZZEA 3EFRA 3G1ZA 4P71A 4OLFA 3QNEA 4H2TA 2AKWB 2E64A 4YRLA 3REUA 2DXUA 1G5HA 4X5OA 3RKYA 1YFSA 3RGLA 2E41A 4LVMA 2E1HA 4XEMA 3L1AA 2IY5A 2I4LA 2QHVA 4P73A 2I4MA 1H4SA 3L2ZA 1ASYA 3PZCA 2ZR3A 2RHSB 4UP9A 2ARTA 2ZXFA 3RF1A 4XTUA 2C8MA 1B70B 1WYDA 4Q15A 1KOGA
chains in the Genus database with same CATH topology
4OP0A 2E10A 4CH6A 1USYC 3V8JA 4NCXA 1YFRA 4H2XB 4P75A 1Z7NA 3RL6A 3W3SA 4CH4A 2QHSA 4EO4A 1G51A 2I4OA 3P8TA 2ZINA 1E22A 3VQYA 4CH5A 4KR2A 2ZGWA 2ZT7A 4YP0A 4TVYA 1X56A 2E5AA 3MF2A 4XTWA 3IKMB 3P8YA 3V8LA 3A74A 1NJ2A 4YCUA 2DU5A 2ZIMA 1EVKA 4H2SA 11ASA 4CH3A 3A5ZA 4P74A 2RHSA 5E3IA 2DTOA 2ZT6A 3V8KA 5K1XA 3UH0A 4KQEA 4YRCA 3V7RA 1JJCB 1B76A 2FYKA 4WJ3M 3HY0A 3LC0A 4K88A 4XU0A 1QF6A 2XGTA 5ELNA 1SERA 2DQ0A 2E3CA 2E65A 2ZTGA 3MQZA 4H2XA 5C53B 3NELA 2DU7A 4YRJA 1NJ6A 4AH6A 4K87A 4E51A 1W66A 1FYFA 3HXVA 4YRSA 2G4CA 1ADJA 4BW9A 1H4TA 5ELOA 1B7YB 3HFZA 4LNSA 1C0AA 3HXUA 4HWOA 4XU2A 4H2YA 3HXYA 2ZT8A 4LVKA 3HRKA 1EIYA 3RUXA 3TEHA 4HWTA 4LVLA 2EWNA 3EFSA 3RACA 1EOVA 3QO8A 3QO7A 3R07A 4P71C 3A32A 5HGQA 3MEYA 3CMQA 4TTVA 4XTXA 3L4GB 1WU7A 1JJCA 1Z7MA 3UGQA 1VQZA 4G84A 2RHQB 1G5IA 2AMCB 2DZCA 4PG3A 3PCOB 3P8VA 4P73C 3VBBA 1HTTA 3V7CA 3KFUA 4YRPA 2EL9A 2Q5IA 1ATIA 1RIQA 4YDQA 2CIMA 4P3NA 4P72C 1QE0A 1KMNA 4HWPA 2Q7GA 3IKLA 3DSQA 1B7YA 2PMFA 1ADYA 2EJFA 4TQDA 1WLEA 3RKWA 1HXDA 2ZNIA 1LYLA 4P75C 4RMFA 4YRIA 1EVLA 4YRNA 3A5YA 2AKWA 4HWSA 2ARSA 2CJBA 1EFWA 1E1OA 3IALA 4YPFA 1NYQA 1L0WA 3HXXA 2DVEA 3NEMA 4TQFA 2CJAA 4ZIBA 3BFMA 4HWRA 4TVAB 2RHQA 2DTIA 5K1PA 3PCOA 2DEQA 3BJUA 1NJ1A 1B70A 1BBWA 4RDXA 4P74C 1EQRA 4CS3A 4YROA 2Q7HA 3IG2A 3ICAA 4XTYA 4YRFA 4XEOA 3REXA 1GGMA 3TEGA 4YCVA 4HT4A 4DQ2A 2Q5HA 2ZZFA 4CS2A 3UFGA 5F5WA 4DPGA 1WPYA 3LSQA 4L87A 1X01A 3E9IA 4YRKA 4PHCA 4XTZA 3RKXA 3M4QA 2A8EA 3A7AA 2QHTA 3LSSA 1YGBA 1KMMA 4XU3A 3OD1A 1H4QA 1NNHA 4UP7A 3NETA 4H2UA 4YREA 4EX5A 4HA8A 1X55A 4WF2A 4BWAA 1SESA 2ODRC 4ZTUB 3HXZA 2DZ9A 3VQVA 1X2GA 2DKGA 2DDZA 1WQWA 2ALYB 4H02A 1YFTA 1BIAA 4RQFA 2Q7EA 2P5IA 12ASA 3E9HA 2ZNJA 4RQEA 1SRYA 4YRRA 2PMEA 5KNNA 2HNIA 1NYRA 1X54A 3RIRA 4YRQA 1E24A 4UPAA 1ASZA 1NJ5A 4H2WA 4ZTZB 1HC7A 4HVCA 3FJPA 1H4VB 4YRGA 4XU1A 2C7IA 2EJ9A 2ODRD 1USYA 4P72A 4YYEA 4G85A 3HRIA 3WQZA 3V7SA 4LVJA 4J15A 3HTZA 4TVWA 1PYSB 5C51B 3HXWA 2XTIA 2ARUA 3MF1A 4UP8A 3L4GA 1BBUA 1E1TA 4XTVA 2ALYA 2ZIOA 3M4PA 1SETA 3HFZB 3HY1A 2DTHA 2DQ3A 2ZZGA 2EAYA 2J3MA 1IL2A 2AMCA 4YRMA 1WNLA 2I4NA 2QHUA 3TUPA 1NJ8A 3QO5A 3VQXA 3A31A 1J5WA 4WI1A 4LVIA 1BIBA 1EIYB 3TEHB 2NS6A 4KR3A 2ZR2A 1N9WA 4YRTA 2IY5B 4K86A 3UGTA 4P3OA 4P3PA 2P0LA 4H2VA 3A7RA 3QTCA 1YB3A 2DJZA 3I7FA 2CJ9A 3NENA 3HFVA 1PYSA 1WQ7A 2ZCEA 2DXTA 1X2HA 2CGHA 4TWAA 4CS4A 3VQWA 2J3LA 4Q6GA 3ERRA 4O2DA 2EJGA 4YCWA 5C52B 4WJ4A 4TVAA 3A7UA 2ZT5A 1B8AA 2ZZEA 3EFRA 3G1ZA 4P71A 4OLFA 3QNEA 4H2TA 2AKWB 2E64A 4YRLA 3REUA 2DXUA 1G5HA 4X5OA 3RKYA 1YFSA 3RGLA 2E41A 4LVMA 2E1HA 4XEMA 3L1AA 2IY5A 2I4LA 2QHVA 4P73A 2I4MA 1H4SA 3L2ZA 1ASYA 3PZCA 2ZR3A 2RHSB 4UP9A 2ARTA 2ZXFA 3RF1A 4XTUA 2C8MA 1B70B 1WYDA 4Q15A 1KOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVJ A;  4LVM A;  2NS6 A;  4HT4 A;  4LVK A;  4LVL A;  4LVI A; 
#chains in the Genus database with same CATH topology
 4OP0 A;  2E10 A;  4CH6 A;  1USY C;  3V8J A;  4NCX A;  1YFR A;  4H2X B;  4P75 A;  1Z7N A;  3RL6 A;  3W3S A;  4CH4 A;  2QHS A;  4EO4 A;  1G51 A;  2I4O A;  3P8T A;  2ZIN A;  1E22 A;  3VQY A;  4CH5 A;  4KR2 A;  2ZGW A;  2ZT7 A;  4YP0 A;  4TVY A;  1X56 A;  2E5A A;  3MF2 A;  4XTW A;  3IKM B;  3P8Y A;  3V8L A;  3A74 A;  1NJ2 A;  4YCU A;  2DU5 A;  2ZIM A;  1EVK A;  4H2S A;  11AS A;  4CH3 A;  3A5Z A;  4P74 A;  2RHS A;  5E3I A;  2DTO A;  2ZT6 A;  3V8K A;  5K1X A;  3UH0 A;  4KQE A;  4YRC A;  3V7R A;  1JJC B;  1B76 A;  2FYK A;  4WJ3 M;  3HY0 A;  3LC0 A;  4K88 A;  4XU0 A;  1QF6 A;  2XGT A;  5ELN A;  1SER A;  2DQ0 A;  2E3C A;  2E65 A;  2ZTG A;  3MQZ A;  4H2X A;  5C53 B;  3NEL A;  2DU7 A;  4YRJ A;  1NJ6 A;  4AH6 A;  4K87 A;  4E51 A;  1W66 A;  1FYF A;  3HXV A;  4YRS A;  2G4C A;  1ADJ A;  4BW9 A;  1H4T A;  5ELO A;  1B7Y B;  3HFZ A;  4LNS A;  1C0A A;  3HXU A;  4HWO A;  4XU2 A;  4H2Y A;  3HXY A;  2ZT8 A;  4LVK A;  3HRK A;  1EIY A;  3RUX A;  3TEH A;  4HWT A;  4LVL A;  2EWN A;  3EFS A;  3RAC A;  1EOV A;  3QO8 A;  3QO7 A;  3R07 A;  4P71 C;  3A32 A;  5HGQ A;  3MEY A;  3CMQ A;  4TTV A;  4XTX A;  3L4G B;  1WU7 A;  1JJC A;  1Z7M A;  3UGQ A;  1VQZ A;  4G84 A;  2RHQ B;  1G5I A;  2AMC B;  2DZC A;  4PG3 A;  3PCO B;  3P8V A;  4P73 C;  3VBB A;  1HTT A;  3V7C A;  3KFU A;  4YRP A;  2EL9 A;  2Q5I A;  1ATI A;  1RIQ A;  4YDQ A;  2CIM A;  4P3N A;  4P72 C;  1QE0 A;  1KMN A;  4HWP A;  2Q7G A;  3IKL A;  3DSQ A;  1B7Y A;  2PMF A;  1ADY A;  2EJF A;  4TQD A;  1WLE A;  3RKW A;  1HXD A;  2ZNI A;  1LYL A;  4P75 C;  4RMF A;  4YRI A;  1EVL A;  4YRN A;  3A5Y A;  2AKW A;  4HWS A;  2ARS A;  2CJB A;  1EFW A;  1E1O A;  3IAL A;  4YPF A;  1NYQ A;  1L0W A;  3HXX A;  2DVE A;  3NEM A;  4TQF A;  2CJA A;  4ZIB A;  3BFM A;  4HWR A;  4TVA B;  2RHQ A;  2DTI A;  5K1P A;  3PCO A;  2DEQ A;  3BJU A;  1NJ1 A;  1B70 A;  1BBW A;  4RDX A;  4P74 C;  1EQR A;  4CS3 A;  4YRO A;  2Q7H A;  3IG2 A;  3ICA A;  4XTY A;  4YRF A;  4XEO A;  3REX A;  1GGM A;  3TEG A;  4YCV A;  4HT4 A;  4DQ2 A;  2Q5H A;  2ZZF A;  4CS2 A;  3UFG A;  5F5W A;  4DPG A;  1WPY A;  3LSQ A;  4L87 A;  1X01 A;  3E9I A;  4YRK A;  4PHC A;  4XTZ A;  3RKX A;  3M4Q A;  2A8E A;  3A7A A;  2QHT A;  3LSS A;  1YGB A;  1KMM A;  4XU3 A;  3OD1 A;  1H4Q A;  1NNH A;  4UP7 A;  3NET A;  4H2U A;  4YRE A;  4EX5 A;  4HA8 A;  1X55 A;  4WF2 A;  4BWA A;  1SES A;  2ODR C;  4ZTU B;  3HXZ A;  2DZ9 A;  3VQV A;  1X2G A;  2DKG A;  2DDZ A;  1WQW A;  2ALY B;  4H02 A;  1YFT A;  1BIA A;  4RQF A;  2Q7E A;  2P5I A;  12AS A;  3E9H A;  2ZNJ A;  4RQE A;  1SRY A;  4YRR A;  2PME A;  5KNN A;  2HNI A;  1NYR A;  1X54 A;  3RIR A;  4YRQ A;  1E24 A;  4UPA A;  1ASZ A;  1NJ5 A;  4H2W A;  4ZTZ B;  1HC7 A;  4HVC A;  3FJP A;  1H4V B;  4YRG A;  4XU1 A;  2C7I A;  2EJ9 A;  2ODR D;  1USY A;  4P72 A;  4YYE A;  4G85 A;  3HRI A;  3WQZ A;  3V7S A;  4LVJ A;  4J15 A;  3HTZ A;  4TVW A;  1PYS B;  5C51 B;  3HXW A;  2XTI A;  2ARU A;  3MF1 A;  4UP8 A;  3L4G A;  1BBU A;  1E1T A;  4XTV A;  2ALY A;  2ZIO A;  3M4P A;  1SET A;  3HFZ B;  3HY1 A;  2DTH A;  2DQ3 A;  2ZZG A;  2EAY A;  2J3M A;  1IL2 A;  2AMC A;  4YRM A;  1WNL A;  2I4N A;  2QHU A;  3TUP A;  1NJ8 A;  3QO5 A;  3VQX A;  3A31 A;  1J5W A;  4WI1 A;  4LVI A;  1BIB A;  1EIY B;  3TEH B;  2NS6 A;  4KR3 A;  2ZR2 A;  1N9W A;  4YRT A;  2IY5 B;  4K86 A;  3UGT A;  4P3O A;  4P3P A;  2P0L A;  4H2V A;  3A7R A;  3QTC A;  1YB3 A;  2DJZ A;  3I7F A;  2CJ9 A;  3NEN A;  3HFV A;  1PYS A;  1WQ7 A;  2ZCE A;  2DXT A;  1X2H A;  2CGH A;  4TWA A;  4CS4 A;  3VQW A;  2J3L A;  4Q6G A;  3ERR A;  4O2D A;  2EJG A;  4YCW A;  5C52 B;  4WJ4 A;  4TVA A;  3A7U A;  2ZT5 A;  1B8A A;  2ZZE A;  3EFR A;  3G1Z A;  4P71 A;  4OLF A;  3QNE A;  4H2T A;  2AKW B;  2E64 A;  4YRL A;  3REU A;  2DXU A;  1G5H A;  4X5O A;  3RKY A;  1YFS A;  3RGL A;  2E41 A;  4LVM A;  2E1H A;  4XEM A;  3L1A A;  2IY5 A;  2I4L A;  2QHV A;  4P73 A;  2I4M A;  1H4S A;  3L2Z A;  1ASY A;  3PZC A;  2ZR3 A;  2RHS B;  4UP9 A;  2ART A;  2ZXF A;  3RF1 A;  4XTU A;  2C8M A;  1B70 B;  1WYD A;  4Q15 A;  1KOG A; 
#chains in the Genus database with same CATH homology
 4OP0 A;  2E10 A;  4CH6 A;  1USY C;  3V8J A;  4NCX A;  1YFR A;  4H2X B;  4P75 A;  1Z7N A;  3RL6 A;  3W3S A;  4CH4 A;  2QHS A;  4EO4 A;  1G51 A;  2I4O A;  3P8T A;  2ZIN A;  1E22 A;  3VQY A;  4CH5 A;  4KR2 A;  2ZGW A;  2ZT7 A;  4YP0 A;  4TVY A;  1X56 A;  2E5A A;  3MF2 A;  4XTW A;  3IKM B;  3P8Y A;  3V8L A;  3A74 A;  1NJ2 A;  4YCU A;  2DU5 A;  2ZIM A;  1EVK A;  4H2S A;  11AS A;  4CH3 A;  3A5Z A;  4P74 A;  2RHS A;  5E3I A;  2DTO A;  2ZT6 A;  3V8K A;  5K1X A;  3UH0 A;  4KQE A;  4YRC A;  3V7R A;  1JJC B;  1B76 A;  2FYK A;  4WJ3 M;  3HY0 A;  3LC0 A;  4K88 A;  4XU0 A;  1QF6 A;  2XGT A;  5ELN A;  1SER A;  2DQ0 A;  2E3C A;  2E65 A;  2ZTG A;  3MQZ A;  4H2X A;  5C53 B;  3NEL A;  2DU7 A;  4YRJ A;  1NJ6 A;  4AH6 A;  4K87 A;  4E51 A;  1W66 A;  1FYF A;  3HXV A;  4YRS A;  2G4C A;  1ADJ A;  4BW9 A;  1H4T A;  5ELO A;  1B7Y B;  3HFZ A;  4LNS A;  1C0A A;  3HXU A;  4HWO A;  4XU2 A;  4H2Y A;  3HXY A;  2ZT8 A;  4LVK A;  3HRK A;  1EIY A;  3RUX A;  3TEH A;  4HWT A;  4LVL A;  2EWN A;  3EFS A;  3RAC A;  1EOV A;  3QO8 A;  3QO7 A;  3R07 A;  4P71 C;  3A32 A;  5HGQ A;  3MEY A;  3CMQ A;  4TTV A;  4XTX A;  3L4G B;  1WU7 A;  1JJC A;  1Z7M A;  3UGQ A;  1VQZ A;  4G84 A;  2RHQ B;  1G5I A;  2AMC B;  2DZC A;  4PG3 A;  3PCO B;  3P8V A;  4P73 C;  3VBB A;  1HTT A;  3V7C A;  3KFU A;  4YRP A;  2EL9 A;  2Q5I A;  1ATI A;  1RIQ A;  4YDQ A;  2CIM A;  4P3N A;  4P72 C;  1QE0 A;  1KMN A;  4HWP A;  2Q7G A;  3IKL A;  3DSQ A;  1B7Y A;  2PMF A;  1ADY A;  2EJF A;  4TQD A;  1WLE A;  3RKW A;  1HXD A;  2ZNI A;  1LYL A;  4P75 C;  4RMF A;  4YRI A;  1EVL A;  4YRN A;  3A5Y A;  2AKW A;  4HWS A;  2ARS A;  2CJB A;  1EFW A;  1E1O A;  3IAL A;  4YPF A;  1NYQ A;  1L0W A;  3HXX A;  2DVE A;  3NEM A;  4TQF A;  2CJA A;  4ZIB A;  3BFM A;  4HWR A;  4TVA B;  2RHQ A;  2DTI A;  5K1P A;  3PCO A;  2DEQ A;  3BJU A;  1NJ1 A;  1B70 A;  1BBW A;  4RDX A;  4P74 C;  1EQR A;  4CS3 A;  4YRO A;  2Q7H A;  3IG2 A;  3ICA A;  4XTY A;  4YRF A;  4XEO A;  3REX A;  1GGM A;  3TEG A;  4YCV A;  4HT4 A;  4DQ2 A;  2Q5H A;  2ZZF A;  4CS2 A;  3UFG A;  5F5W A;  4DPG A;  1WPY A;  3LSQ A;  4L87 A;  1X01 A;  3E9I A;  4YRK A;  4PHC A;  4XTZ A;  3RKX A;  3M4Q A;  2A8E A;  3A7A A;  2QHT A;  3LSS A;  1YGB A;  1KMM A;  4XU3 A;  3OD1 A;  1H4Q A;  1NNH A;  4UP7 A;  3NET A;  4H2U A;  4YRE A;  4EX5 A;  4HA8 A;  1X55 A;  4WF2 A;  4BWA A;  1SES A;  2ODR C;  4ZTU B;  3HXZ A;  2DZ9 A;  3VQV A;  1X2G A;  2DKG A;  2DDZ A;  1WQW A;  2ALY B;  4H02 A;  1YFT A;  1BIA A;  4RQF A;  2Q7E A;  2P5I A;  12AS A;  3E9H A;  2ZNJ A;  4RQE A;  1SRY A;  4YRR A;  2PME A;  5KNN A;  2HNI A;  1NYR A;  1X54 A;  3RIR A;  4YRQ A;  1E24 A;  4UPA A;  1ASZ A;  1NJ5 A;  4H2W A;  4ZTZ B;  1HC7 A;  4HVC A;  3FJP A;  1H4V B;  4YRG A;  4XU1 A;  2C7I A;  2EJ9 A;  2ODR D;  1USY A;  4P72 A;  4YYE A;  4G85 A;  3HRI A;  3WQZ A;  3V7S A;  4LVJ A;  4J15 A;  3HTZ A;  4TVW A;  1PYS B;  5C51 B;  3HXW A;  2XTI A;  2ARU A;  3MF1 A;  4UP8 A;  3L4G A;  1BBU A;  1E1T A;  4XTV A;  2ALY A;  2ZIO A;  3M4P A;  1SET A;  3HFZ B;  3HY1 A;  2DTH A;  2DQ3 A;  2ZZG A;  2EAY A;  2J3M A;  1IL2 A;  2AMC A;  4YRM A;  1WNL A;  2I4N A;  2QHU A;  3TUP A;  1NJ8 A;  3QO5 A;  3VQX A;  3A31 A;  1J5W A;  4WI1 A;  4LVI A;  1BIB A;  1EIY B;  3TEH B;  2NS6 A;  4KR3 A;  2ZR2 A;  1N9W A;  4YRT A;  2IY5 B;  4K86 A;  3UGT A;  4P3O A;  4P3P A;  2P0L A;  4H2V A;  3A7R A;  3QTC A;  1YB3 A;  2DJZ A;  3I7F A;  2CJ9 A;  3NEN A;  3HFV A;  1PYS A;  1WQ7 A;  2ZCE A;  2DXT A;  1X2H A;  2CGH A;  4TWA A;  4CS4 A;  3VQW A;  2J3L A;  4Q6G A;  3ERR A;  4O2D A;  2EJG A;  4YCW A;  5C52 B;  4WJ4 A;  4TVA A;  3A7U A;  2ZT5 A;  1B8A A;  2ZZE A;  3EFR A;  3G1Z A;  4P71 A;  4OLF A;  3QNE A;  4H2T A;  2AKW B;  2E64 A;  4YRL A;  3REU A;  2DXU A;  1G5H A;  4X5O A;  3RKY A;  1YFS A;  3RGL A;  2E41 A;  4LVM A;  2E1H A;  4XEM A;  3L1A A;  2IY5 A;  2I4L A;  2QHV A;  4P73 A;  2I4M A;  1H4S A;  3L2Z A;  1ASY A;  3PZC A;  2ZR3 A;  2RHS B;  4UP9 A;  2ART A;  2ZXF A;  3RF1 A;  4XTU A;  2C8M A;  1B70 B;  1WYD A;  4Q15 A;  1KOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...