4LVLA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (22nt+3'thiophosphate). mn-bound crystal structure at ph 6.8
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
196
structure length
196
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVFETHSNKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Plasmid recombination enzyme
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
total genus 61
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvlA01
4LVIA 4HT4A 4LVJA 4LVKA 4LVLA 2NS6A 4LVMA
chains in the Genus database with same CATH superfamily
1EIYB 4YREA 3V8JA 4YRQA 11ASA 3IG2A 2Q7EA 4CH3A 1SERA 1Z7MA 2EL9A 5K1PA 3A7AA 4DQ2A 1H4SA 4ZIBA 4UPAA 1X56A 4P3OA 1YFSA 2ZNJA 4LVLA 5KNNA 3QNEA 3UGTA 4YRRA 4OP0A 2DQ3A 3BFMA 3M4PA 4H2XA 4J15A 4YRNA 2IY5B 2EJFA 4NCXA 2E3CA 1G5IA 2E1HA 1WNLA 2G4CA 4UP7A 2E5AA 4YRIA 2ZT8A 1ASZA 3I7FA 2AMCA 4LVIA 3MQZA 2DEQA 2I4NA 3RUXA 4P71A 1NYRA 2Q7GA 2AMCB 2CGHA 2DJZA 2HNIA 2RHSB 4TVAA 4P71C 4HT4A 1NYQA 2XTIA 4WF2A 4RMFA 1X55A 2I4LA 3V7SA 4H2YA 3W3SA 3RKWA 1PYSB 3P8VA 3A32A 2Q5HA 4P74A 4EO4A 1B70B 4P74C 4TQFA 4XTYA 4YP0A 2ZR2A 4YRPA 4WJ3M 3V7CA 2CJAA 3HY0A 2ZZEA 2DKGA 5ELOA 4YRSA 1N9WA 2AKWB 3L4GB 3RL6A 2ZR3A 4P3PA 1USYA 3HXXA 4YRCA 1E22A 3HFZA 1E1OA 2ODRD 4P75A 1USYC 3A5YA 4H02A 2RHQA 2C7IA 4P75C 1JJCB 2ZNIA 1H4TA 2J3LA 3MEYA 1L0WA 1X54A 4XTWA 1EFWA 1G5HA 1KMMA 4YYEA 1HTTA 2ZTGA 2QHUA 2ARUA 4KR3A 1B76A 2ODRC 2ZZFA 2NS6A 2ZXFA 3IKLA 4H2UA 4XTUA 3LSQA 4TTVA 4E51A 5C51B 1YFTA 3V8LA 3HTZA 4RQFA 1NJ2A 3HXUA 3A7RA 3TUPA 2EAYA 3HXWA 4KQEA 3HY1A 1QE0A 2DZCA 2DU7A 1FYFA 1HXDA 1SESA 4WJ4A 2ZT7A 12ASA 4WI1A 4XEMA 3L1AA 2DQ0A 4YRKA 1E1TA 3NETA 5K1XA 4H2XB 2ZIOA 4XU0A 3RKXA 4CH5A 3UH0A 1ADYA 4YRTA 3NENA 3REXA 4HWOA 2DVEA 2EJGA 4LVKA 4YPFA 1NJ6A 3NELA 4HWPA 3V8KA 1NJ1A 4YROA 3LC0A 3PZCA 1WU7A 2J3MA 3LSSA 1ATIA 4H2TA 2ZT6A 4TVAB 5C53B 4XTVA 4YRGA 4XU2A 2Q7HA 1EVLA 3CMQA 3QO8A 3FJPA 4K86A 1KOGA 5ELNA 2QHVA 3RACA 3E9HA 3A5ZA 3KFUA 4BWAA 4XEOA 3P8YA 4RDXA 4YRMA 4P72A 2QHTA 4H2WA 3ICAA 3VQWA 3EFSA 4P72C 3NEMA 3TEHA 3PCOA 2ALYA 4XTZA 4XU3A 1HC7A 4YRLA 1QF6A 1WLEA 3HFZB 4UP8A 4YDQA 4HWSA 4OLFA 2RHQB 1WQWA 3UFGA 1H4VB 1BIAA 1H4QA 3V7RA 2ARSA 3RF1A 3HXVA 3HXYA 1YFRA 3VQVA 2P0LA 3IALA 2E64A 3L2ZA 3DSQA 3VQXA 4TVYA 2XGTA 1RIQA 4BW9A 2DU5A 1J5WA 1SETA 2ZGWA 1BIBA 2CJBA 4L87A 2I4MA 3IKMB 4HWRA 1B8AA 3QO5A 2EWNA 4HWTA 4YCWA 3HRIA 3P8TA 3A31A 2ZIMA 3VQYA 4TVWA 4H2VA 1ASYA 4H2SA 2DTHA 2CIMA 1E24A 1SRYA 2PMFA 4PG3A 1G51A 4Q6GA 4UP9A 4RQEA 1Z7NA 4CS2A 3HFVA 3QTCA 5HGQA 4KR2A 4CS3A 3EFRA 1WPYA 1EVKA 2ZCEA 1WYDA 2CJ9A 2ARTA 2IY5A 4CH6A 3REUA 4XU1A 1NJ8A 4TWAA 4O2DA 2FYKA 4TQDA 5C52B 2DXUA 1YB3A 4CH4A 4G84A 1WQ7A 4PHCA 2DDZA 3TEGA 4K87A 2DTOA 2A8EA 1NNHA 2RHSA 3M4QA 3HXZA 3RGLA 3A7UA 3WQZA 1BBWA 4P3NA 3RIRA 3MF2A 2ZZGA 4HVCA 1PYSA 3E9IA 1B7YA 1EQRA 1C0AA 2E10A 3VBBA 1B70A 1NJ5A 4XTXA 3QO7A 1B7YB 1VQZA 4ZTUB 3RKYA 4YCVA 3OD1A 4K88A 3TEHB 3PCOB 2QHSA 5F5WA 4HA8A 4P73A 1LYLA 2ALYB 1X2GA 2PMEA 4P73C 1ADJA 3HRKA 4YCUA 2AKWA 3L4GA 4LVMA 4LNSA 1X2HA 2C8MA 2DTIA 2DZ9A 1KMNA 2E41A 3BJUA 2I4OA 1JJCA 1GGMA 3ERRA 4CS4A 2DXTA 4AH6A 2E65A 3A74A 3MF1A 1EOVA 4X5OA 4YRJA 4ZTZB 2EJ9A 1X01A 4G85A 4LVJA 4Q15A 1IL2A 1YGBA 4EX5A 5E3IA 1W66A 2ZINA 2P5IA 3UGQA 1BBUA 3G1ZA 1EIYA 4DPGA 4YRFA 3R07A 2ZT5A 2Q5IA
chains in the Genus database with same CATH topology
1EIYB 4YREA 3V8JA 4YRQA 11ASA 3IG2A 2Q7EA 4CH3A 1SERA 1Z7MA 2EL9A 5K1PA 3A7AA 4DQ2A 1H4SA 4ZIBA 4UPAA 1X56A 4P3OA 1YFSA 2ZNJA 4LVLA 5KNNA 3QNEA 3UGTA 4YRRA 4OP0A 2DQ3A 3BFMA 3M4PA 4H2XA 4J15A 4YRNA 2IY5B 2EJFA 4NCXA 2E3CA 1G5IA 2E1HA 1WNLA 2G4CA 4UP7A 2E5AA 4YRIA 2ZT8A 1ASZA 3I7FA 2AMCA 4LVIA 3MQZA 2DEQA 2I4NA 3RUXA 4P71A 1NYRA 2Q7GA 2AMCB 2CGHA 2DJZA 2HNIA 2RHSB 4TVAA 4P71C 4HT4A 1NYQA 2XTIA 4WF2A 4RMFA 1X55A 2I4LA 3V7SA 4H2YA 3W3SA 3RKWA 1PYSB 3P8VA 3A32A 2Q5HA 4P74A 4EO4A 1B70B 4P74C 4TQFA 4XTYA 4YP0A 2ZR2A 4YRPA 4WJ3M 3V7CA 2CJAA 3HY0A 2ZZEA 2DKGA 5ELOA 4YRSA 1N9WA 2AKWB 3L4GB 3RL6A 2ZR3A 4P3PA 1USYA 3HXXA 4YRCA 1E22A 3HFZA 1E1OA 2ODRD 4P75A 1USYC 3A5YA 4H02A 2RHQA 2C7IA 4P75C 1JJCB 2ZNIA 1H4TA 2J3LA 3MEYA 1L0WA 1X54A 4XTWA 1EFWA 1G5HA 1KMMA 4YYEA 1HTTA 2ZTGA 2QHUA 2ARUA 4KR3A 1B76A 2ODRC 2ZZFA 2NS6A 2ZXFA 3IKLA 4H2UA 4XTUA 3LSQA 4TTVA 4E51A 5C51B 1YFTA 3V8LA 3HTZA 4RQFA 1NJ2A 3HXUA 3A7RA 3TUPA 2EAYA 3HXWA 4KQEA 3HY1A 1QE0A 2DZCA 2DU7A 1FYFA 1HXDA 1SESA 4WJ4A 2ZT7A 12ASA 4WI1A 4XEMA 3L1AA 2DQ0A 4YRKA 1E1TA 3NETA 5K1XA 4H2XB 2ZIOA 4XU0A 3RKXA 4CH5A 3UH0A 1ADYA 4YRTA 3NENA 3REXA 4HWOA 2DVEA 2EJGA 4LVKA 4YPFA 1NJ6A 3NELA 4HWPA 3V8KA 1NJ1A 4YROA 3LC0A 3PZCA 1WU7A 2J3MA 3LSSA 1ATIA 4H2TA 2ZT6A 4TVAB 5C53B 4XTVA 4YRGA 4XU2A 2Q7HA 1EVLA 3CMQA 3QO8A 3FJPA 4K86A 1KOGA 5ELNA 2QHVA 3RACA 3E9HA 3A5ZA 3KFUA 4BWAA 4XEOA 3P8YA 4RDXA 4YRMA 4P72A 2QHTA 4H2WA 3ICAA 3VQWA 3EFSA 4P72C 3NEMA 3TEHA 3PCOA 2ALYA 4XTZA 4XU3A 1HC7A 4YRLA 1QF6A 1WLEA 3HFZB 4UP8A 4YDQA 4HWSA 4OLFA 2RHQB 1WQWA 3UFGA 1H4VB 1BIAA 1H4QA 3V7RA 2ARSA 3RF1A 3HXVA 3HXYA 1YFRA 3VQVA 2P0LA 3IALA 2E64A 3L2ZA 3DSQA 3VQXA 4TVYA 2XGTA 1RIQA 4BW9A 2DU5A 1J5WA 1SETA 2ZGWA 1BIBA 2CJBA 4L87A 2I4MA 3IKMB 4HWRA 1B8AA 3QO5A 2EWNA 4HWTA 4YCWA 3HRIA 3P8TA 3A31A 2ZIMA 3VQYA 4TVWA 4H2VA 1ASYA 4H2SA 2DTHA 2CIMA 1E24A 1SRYA 2PMFA 4PG3A 1G51A 4Q6GA 4UP9A 4RQEA 1Z7NA 4CS2A 3HFVA 3QTCA 5HGQA 4KR2A 4CS3A 3EFRA 1WPYA 1EVKA 2ZCEA 1WYDA 2CJ9A 2ARTA 2IY5A 4CH6A 3REUA 4XU1A 1NJ8A 4TWAA 4O2DA 2FYKA 4TQDA 5C52B 2DXUA 1YB3A 4CH4A 4G84A 1WQ7A 4PHCA 2DDZA 3TEGA 4K87A 2DTOA 2A8EA 1NNHA 2RHSA 3M4QA 3HXZA 3RGLA 3A7UA 3WQZA 1BBWA 4P3NA 3RIRA 3MF2A 2ZZGA 4HVCA 1PYSA 3E9IA 1B7YA 1EQRA 1C0AA 2E10A 3VBBA 1B70A 1NJ5A 4XTXA 3QO7A 1B7YB 1VQZA 4ZTUB 3RKYA 4YCVA 3OD1A 4K88A 3TEHB 3PCOB 2QHSA 5F5WA 4HA8A 4P73A 1LYLA 2ALYB 1X2GA 2PMEA 4P73C 1ADJA 3HRKA 4YCUA 2AKWA 3L4GA 4LVMA 4LNSA 1X2HA 2C8MA 2DTIA 2DZ9A 1KMNA 2E41A 3BJUA 2I4OA 1JJCA 1GGMA 3ERRA 4CS4A 2DXTA 4AH6A 2E65A 3A74A 3MF1A 1EOVA 4X5OA 4YRJA 4ZTZB 2EJ9A 1X01A 4G85A 4LVJA 4Q15A 1IL2A 1YGBA 4EX5A 5E3IA 1W66A 2ZINA 2P5IA 3UGQA 1BBUA 3G1ZA 1EIYA 4DPGA 4YRFA 3R07A 2ZT5A 2Q5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVI A;  4HT4 A;  4LVJ A;  4LVK A;  4LVL A;  2NS6 A;  4LVM A; 
#chains in the Genus database with same CATH topology
 1EIY B;  4YRE A;  3V8J A;  4YRQ A;  11AS A;  3IG2 A;  2Q7E A;  4CH3 A;  1SER A;  1Z7M A;  2EL9 A;  5K1P A;  3A7A A;  4DQ2 A;  1H4S A;  4ZIB A;  4UPA A;  1X56 A;  4P3O A;  1YFS A;  2ZNJ A;  4LVL A;  5KNN A;  3QNE A;  3UGT A;  4YRR A;  4OP0 A;  2DQ3 A;  3BFM A;  3M4P A;  4H2X A;  4J15 A;  4YRN A;  2IY5 B;  2EJF A;  4NCX A;  2E3C A;  1G5I A;  2E1H A;  1WNL A;  2G4C A;  4UP7 A;  2E5A A;  4YRI A;  2ZT8 A;  1ASZ A;  3I7F A;  2AMC A;  4LVI A;  3MQZ A;  2DEQ A;  2I4N A;  3RUX A;  4P71 A;  1NYR A;  2Q7G A;  2AMC B;  2CGH A;  2DJZ A;  2HNI A;  2RHS B;  4TVA A;  4P71 C;  4HT4 A;  1NYQ A;  2XTI A;  4WF2 A;  4RMF A;  1X55 A;  2I4L A;  3V7S A;  4H2Y A;  3W3S A;  3RKW A;  1PYS B;  3P8V A;  3A32 A;  2Q5H A;  4P74 A;  4EO4 A;  1B70 B;  4P74 C;  4TQF A;  4XTY A;  4YP0 A;  2ZR2 A;  4YRP A;  4WJ3 M;  3V7C A;  2CJA A;  3HY0 A;  2ZZE A;  2DKG A;  5ELO A;  4YRS A;  1N9W A;  2AKW B;  3L4G B;  3RL6 A;  2ZR3 A;  4P3P A;  1USY A;  3HXX A;  4YRC A;  1E22 A;  3HFZ A;  1E1O A;  2ODR D;  4P75 A;  1USY C;  3A5Y A;  4H02 A;  2RHQ A;  2C7I A;  4P75 C;  1JJC B;  2ZNI A;  1H4T A;  2J3L A;  3MEY A;  1L0W A;  1X54 A;  4XTW A;  1EFW A;  1G5H A;  1KMM A;  4YYE A;  1HTT A;  2ZTG A;  2QHU A;  2ARU A;  4KR3 A;  1B76 A;  2ODR C;  2ZZF A;  2NS6 A;  2ZXF A;  3IKL A;  4H2U A;  4XTU A;  3LSQ A;  4TTV A;  4E51 A;  5C51 B;  1YFT A;  3V8L A;  3HTZ A;  4RQF A;  1NJ2 A;  3HXU A;  3A7R A;  3TUP A;  2EAY A;  3HXW A;  4KQE A;  3HY1 A;  1QE0 A;  2DZC A;  2DU7 A;  1FYF A;  1HXD A;  1SES A;  4WJ4 A;  2ZT7 A;  12AS A;  4WI1 A;  4XEM A;  3L1A A;  2DQ0 A;  4YRK A;  1E1T A;  3NET A;  5K1X A;  4H2X B;  2ZIO A;  4XU0 A;  3RKX A;  4CH5 A;  3UH0 A;  1ADY A;  4YRT A;  3NEN A;  3REX A;  4HWO A;  2DVE A;  2EJG A;  4LVK A;  4YPF A;  1NJ6 A;  3NEL A;  4HWP A;  3V8K A;  1NJ1 A;  4YRO A;  3LC0 A;  3PZC A;  1WU7 A;  2J3M A;  3LSS A;  1ATI A;  4H2T A;  2ZT6 A;  4TVA B;  5C53 B;  4XTV A;  4YRG A;  4XU2 A;  2Q7H A;  1EVL A;  3CMQ A;  3QO8 A;  3FJP A;  4K86 A;  1KOG A;  5ELN A;  2QHV A;  3RAC A;  3E9H A;  3A5Z A;  3KFU A;  4BWA A;  4XEO A;  3P8Y A;  4RDX A;  4YRM A;  4P72 A;  2QHT A;  4H2W A;  3ICA A;  3VQW A;  3EFS A;  4P72 C;  3NEM A;  3TEH A;  3PCO A;  2ALY A;  4XTZ A;  4XU3 A;  1HC7 A;  4YRL A;  1QF6 A;  1WLE A;  3HFZ B;  4UP8 A;  4YDQ A;  4HWS A;  4OLF A;  2RHQ B;  1WQW A;  3UFG A;  1H4V B;  1BIA A;  1H4Q A;  3V7R A;  2ARS A;  3RF1 A;  3HXV A;  3HXY A;  1YFR A;  3VQV A;  2P0L A;  3IAL A;  2E64 A;  3L2Z A;  3DSQ A;  3VQX A;  4TVY A;  2XGT A;  1RIQ A;  4BW9 A;  2DU5 A;  1J5W A;  1SET A;  2ZGW A;  1BIB A;  2CJB A;  4L87 A;  2I4M A;  3IKM B;  4HWR A;  1B8A A;  3QO5 A;  2EWN A;  4HWT A;  4YCW A;  3HRI A;  3P8T A;  3A31 A;  2ZIM A;  3VQY A;  4TVW A;  4H2V A;  1ASY A;  4H2S A;  2DTH A;  2CIM A;  1E24 A;  1SRY A;  2PMF A;  4PG3 A;  1G51 A;  4Q6G A;  4UP9 A;  4RQE A;  1Z7N A;  4CS2 A;  3HFV A;  3QTC A;  5HGQ A;  4KR2 A;  4CS3 A;  3EFR A;  1WPY A;  1EVK A;  2ZCE A;  1WYD A;  2CJ9 A;  2ART A;  2IY5 A;  4CH6 A;  3REU A;  4XU1 A;  1NJ8 A;  4TWA A;  4O2D A;  2FYK A;  4TQD A;  5C52 B;  2DXU A;  1YB3 A;  4CH4 A;  4G84 A;  1WQ7 A;  4PHC A;  2DDZ A;  3TEG A;  4K87 A;  2DTO A;  2A8E A;  1NNH A;  2RHS A;  3M4Q A;  3HXZ A;  3RGL A;  3A7U A;  3WQZ A;  1BBW A;  4P3N A;  3RIR A;  3MF2 A;  2ZZG A;  4HVC A;  1PYS A;  3E9I A;  1B7Y A;  1EQR A;  1C0A A;  2E10 A;  3VBB A;  1B70 A;  1NJ5 A;  4XTX A;  3QO7 A;  1B7Y B;  1VQZ A;  4ZTU B;  3RKY A;  4YCV A;  3OD1 A;  4K88 A;  3TEH B;  3PCO B;  2QHS A;  5F5W A;  4HA8 A;  4P73 A;  1LYL A;  2ALY B;  1X2G A;  2PME A;  4P73 C;  1ADJ A;  3HRK A;  4YCU A;  2AKW A;  3L4G A;  4LVM A;  4LNS A;  1X2H A;  2C8M A;  2DTI A;  2DZ9 A;  1KMN A;  2E41 A;  3BJU A;  2I4O A;  1JJC A;  1GGM A;  3ERR A;  4CS4 A;  2DXT A;  4AH6 A;  2E65 A;  3A74 A;  3MF1 A;  1EOV A;  4X5O A;  4YRJ A;  4ZTZ B;  2EJ9 A;  1X01 A;  4G85 A;  4LVJ A;  4Q15 A;  1IL2 A;  1YGB A;  4EX5 A;  5E3I A;  1W66 A;  2ZIN A;  2P5I A;  3UGQ A;  1BBU A;  3G1Z A;  1EIY A;  4DPG A;  4YRF A;  3R07 A;  2ZT5 A;  2Q5I A; 
#chains in the Genus database with same CATH homology
 1EIY B;  4YRE A;  3V8J A;  4YRQ A;  11AS A;  3IG2 A;  2Q7E A;  4CH3 A;  1SER A;  1Z7M A;  2EL9 A;  5K1P A;  3A7A A;  4DQ2 A;  1H4S A;  4ZIB A;  4UPA A;  1X56 A;  4P3O A;  1YFS A;  2ZNJ A;  4LVL A;  5KNN A;  3QNE A;  3UGT A;  4YRR A;  4OP0 A;  2DQ3 A;  3BFM A;  3M4P A;  4H2X A;  4J15 A;  4YRN A;  2IY5 B;  2EJF A;  4NCX A;  2E3C A;  1G5I A;  2E1H A;  1WNL A;  2G4C A;  4UP7 A;  2E5A A;  4YRI A;  2ZT8 A;  1ASZ A;  3I7F A;  2AMC A;  4LVI A;  3MQZ A;  2DEQ A;  2I4N A;  3RUX A;  4P71 A;  1NYR A;  2Q7G A;  2AMC B;  2CGH A;  2DJZ A;  2HNI A;  2RHS B;  4TVA A;  4P71 C;  4HT4 A;  1NYQ A;  2XTI A;  4WF2 A;  4RMF A;  1X55 A;  2I4L A;  3V7S A;  4H2Y A;  3W3S A;  3RKW A;  1PYS B;  3P8V A;  3A32 A;  2Q5H A;  4P74 A;  4EO4 A;  1B70 B;  4P74 C;  4TQF A;  4XTY A;  4YP0 A;  2ZR2 A;  4YRP A;  4WJ3 M;  3V7C A;  2CJA A;  3HY0 A;  2ZZE A;  2DKG A;  5ELO A;  4YRS A;  1N9W A;  2AKW B;  3L4G B;  3RL6 A;  2ZR3 A;  4P3P A;  1USY A;  3HXX A;  4YRC A;  1E22 A;  3HFZ A;  1E1O A;  2ODR D;  4P75 A;  1USY C;  3A5Y A;  4H02 A;  2RHQ A;  2C7I A;  4P75 C;  1JJC B;  2ZNI A;  1H4T A;  2J3L A;  3MEY A;  1L0W A;  1X54 A;  4XTW A;  1EFW A;  1G5H A;  1KMM A;  4YYE A;  1HTT A;  2ZTG A;  2QHU A;  2ARU A;  4KR3 A;  1B76 A;  2ODR C;  2ZZF A;  2NS6 A;  2ZXF A;  3IKL A;  4H2U A;  4XTU A;  3LSQ A;  4TTV A;  4E51 A;  5C51 B;  1YFT A;  3V8L A;  3HTZ A;  4RQF A;  1NJ2 A;  3HXU A;  3A7R A;  3TUP A;  2EAY A;  3HXW A;  4KQE A;  3HY1 A;  1QE0 A;  2DZC A;  2DU7 A;  1FYF A;  1HXD A;  1SES A;  4WJ4 A;  2ZT7 A;  12AS A;  4WI1 A;  4XEM A;  3L1A A;  2DQ0 A;  4YRK A;  1E1T A;  3NET A;  5K1X A;  4H2X B;  2ZIO A;  4XU0 A;  3RKX A;  4CH5 A;  3UH0 A;  1ADY A;  4YRT A;  3NEN A;  3REX A;  4HWO A;  2DVE A;  2EJG A;  4LVK A;  4YPF A;  1NJ6 A;  3NEL A;  4HWP A;  3V8K A;  1NJ1 A;  4YRO A;  3LC0 A;  3PZC A;  1WU7 A;  2J3M A;  3LSS A;  1ATI A;  4H2T A;  2ZT6 A;  4TVA B;  5C53 B;  4XTV A;  4YRG A;  4XU2 A;  2Q7H A;  1EVL A;  3CMQ A;  3QO8 A;  3FJP A;  4K86 A;  1KOG A;  5ELN A;  2QHV A;  3RAC A;  3E9H A;  3A5Z A;  3KFU A;  4BWA A;  4XEO A;  3P8Y A;  4RDX A;  4YRM A;  4P72 A;  2QHT A;  4H2W A;  3ICA A;  3VQW A;  3EFS A;  4P72 C;  3NEM A;  3TEH A;  3PCO A;  2ALY A;  4XTZ A;  4XU3 A;  1HC7 A;  4YRL A;  1QF6 A;  1WLE A;  3HFZ B;  4UP8 A;  4YDQ A;  4HWS A;  4OLF A;  2RHQ B;  1WQW A;  3UFG A;  1H4V B;  1BIA A;  1H4Q A;  3V7R A;  2ARS A;  3RF1 A;  3HXV A;  3HXY A;  1YFR A;  3VQV A;  2P0L A;  3IAL A;  2E64 A;  3L2Z A;  3DSQ A;  3VQX A;  4TVY A;  2XGT A;  1RIQ A;  4BW9 A;  2DU5 A;  1J5W A;  1SET A;  2ZGW A;  1BIB A;  2CJB A;  4L87 A;  2I4M A;  3IKM B;  4HWR A;  1B8A A;  3QO5 A;  2EWN A;  4HWT A;  4YCW A;  3HRI A;  3P8T A;  3A31 A;  2ZIM A;  3VQY A;  4TVW A;  4H2V A;  1ASY A;  4H2S A;  2DTH A;  2CIM A;  1E24 A;  1SRY A;  2PMF A;  4PG3 A;  1G51 A;  4Q6G A;  4UP9 A;  4RQE A;  1Z7N A;  4CS2 A;  3HFV A;  3QTC A;  5HGQ A;  4KR2 A;  4CS3 A;  3EFR A;  1WPY A;  1EVK A;  2ZCE A;  1WYD A;  2CJ9 A;  2ART A;  2IY5 A;  4CH6 A;  3REU A;  4XU1 A;  1NJ8 A;  4TWA A;  4O2D A;  2FYK A;  4TQD A;  5C52 B;  2DXU A;  1YB3 A;  4CH4 A;  4G84 A;  1WQ7 A;  4PHC A;  2DDZ A;  3TEG A;  4K87 A;  2DTO A;  2A8E A;  1NNH A;  2RHS A;  3M4Q A;  3HXZ A;  3RGL A;  3A7U A;  3WQZ A;  1BBW A;  4P3N A;  3RIR A;  3MF2 A;  2ZZG A;  4HVC A;  1PYS A;  3E9I A;  1B7Y A;  1EQR A;  1C0A A;  2E10 A;  3VBB A;  1B70 A;  1NJ5 A;  4XTX A;  3QO7 A;  1B7Y B;  1VQZ A;  4ZTU B;  3RKY A;  4YCV A;  3OD1 A;  4K88 A;  3TEH B;  3PCO B;  2QHS A;  5F5W A;  4HA8 A;  4P73 A;  1LYL A;  2ALY B;  1X2G A;  2PME A;  4P73 C;  1ADJ A;  3HRK A;  4YCU A;  2AKW A;  3L4G A;  4LVM A;  4LNS A;  1X2H A;  2C8M A;  2DTI A;  2DZ9 A;  1KMN A;  2E41 A;  3BJU A;  2I4O A;  1JJC A;  1GGM A;  3ERR A;  4CS4 A;  2DXT A;  4AH6 A;  2E65 A;  3A74 A;  3MF1 A;  1EOV A;  4X5O A;  4YRJ A;  4ZTZ B;  2EJ9 A;  1X01 A;  4G85 A;  4LVJ A;  4Q15 A;  1IL2 A;  1YGB A;  4EX5 A;  5E3I A;  1W66 A;  2ZIN A;  2P5I A;  3UGQ A;  1BBU A;  3G1Z A;  1EIY A;  4DPG A;  4YRF A;  3R07 A;  2ZT5 A;  2Q5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...