1KG7A

Crystal structure of the e161a mutant of e.coli muty (core fragment)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
224
structure length
224
Chain Sequence
MQASQFSAQVLDWYDKYGRKTLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVANKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A/G-specific adenine glycosylase
publication title Analysis of the E.coli MutY DNA glycosylase structure and function by site-directed mutagenesis
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 80
structure length 224
sequence length 224
ec nomenclature ec 3.2.2.31: Adenine glycosylase.
pdb deposition date 2001-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF10576 EndIII_4Fe-2S Iron-sulfur binding domain of endonuclease III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1kg7A02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 1kg7A01
1MUDA 4EA4A 1YQLA 3OGDA 3KNTA 2H56A 1NKUA 4E9EA 1PU7A 1KG7A 2YG8A 1WEGA 1PVSA 2XHIA 3IH7A 3I0WA 1XQPA 1PU8A 1EBMA 3IHOA 1LWWA 3CW7A 1HU0A 1ORNA 1KEAA 4YPRA 4PIIA 4AI5A 5KN9A 4DK9A 2NOFA 3CVSA 1LMZA 2NOHA 2JG6A 4OFEA 3CWAA 4E9FA 1PU6A 1MUYA 2NOZA 4YOQA 1M3HA 3N5NX 1VRLA 4UOBA 3N0UA 3KTUA 4EJZA 1MPGA 1KG2A 1N39A 4AIAA 2NOEA 1LWVA 1KG3A 3F0ZA 4EVVA 3OH9A 3I0XA 2NOLA 2OFIA 2ABKA 1M3QA 1KG4A 2I5WA 1XG7A 4EW4A 4E9GA 4EW0A 2NOBA 5KN8A 1FN7A 2YG9A 4HSBA 3CWTA 4B24A 2JHNA 4B21A 1DIZA 3OH6A 1YQMA 3F10A 4B22A 3FSPA 1KQJA 5AN4A 1RRSA 1NGNA 3FHGA 1KG6A 1N3AA 3CWUA 1WEIA 4EJYA 3FHFA 5DPKA 3S6IA 1P7MA 4EA5A 1KO9A 4OFHA 1KG5A 4E9HA 4B23A 1YQRA 1RRQA 4AI4A 1N3CA 1ORPA 1P59A 2NOIA 4YPHA 1MUNA 1YQKA 1LWYA 3G0QA 1WEFA 2JHJA 4UNFA 2OFKA 5CHZA 4OFAA 3CVTA 3CWSA 1XQOA 3D4VA
chains in the Genus database with same CATH superfamily
1MUDA 3L2VA 4EA4A 1YQLA 3OGDA 4BACA 3KNTA 2H56A 1NKUA 4E9EA 4E7JA 1PU7A 1KG7A 2YG8A 4ZTJA 1WEGA 1PVSA 2XHIA 3IH7A 3I0WA 4BDZA 1XQPA 1PU8A 1EBMA 3OYNA 3IHOA 3S3NA 1LWWA 4BE1A 3CW7A 3D4VA 1HU0A 1ORNA 1KEAA 4YPRA 3OYGA 4PIIA 4AI5A 3S3OA 5KN9A 4DK9A 2NOFA 3CVSA 1LMZA 2NOHA 5FROA 2JG6A 5FRNA 4OFEA 3CWAA 3OYEA 4E9FA 1PU6A 1MUYA 2NOZA 4YOQA 3L2WA 4BDYA 1M3HA 2V75A 3N5NX 1VRLA 4UOBA 3N0UA 3KTUA 4BE0A 3OS2A 4EJZA 4NZGA 1MPGA 1KG2A 1N39A 4AIAA 2W03A 2NOEA 1LWVA 1KG3A 3OYMA 3F0ZA 3OYAA 4EVVA 3OH9A 3I0XA 3NNQA 2NOLA 2W04A 2ABKA 1M3QA 3OYLA 1KG4A 2OFIA 3OYDA 3LCNA 2I5WA 1XG7A 4EW4A 4E9GA 4EW0A 2NOBA 5KN8A 4BE2A 1FN7A 2YG9A 4HSBA 3CWTA 4B24A 2JHNA 3L2QA 3R2XC 4B21A 3OYJA 1DIZA 3OH6A 1YQMA 3F10A 4IKFA 4B22A 3OYHA 3OYBA 3FSPA 3L2RA 1KQJA 5AN4A 1RRSA 1NGNA 3FHGA 1KG6A 3OYIA 1N3AA 3CWUA 1WEIA 3S3MA 3OYFA 4EJYA 2JPSA 3FHFA 1U84A 5DPKA 3S6IA 5FRMA 1P7MA 4EA5A 4E7LA 1KO9A 4OFHA 1KG5A 4E9HA 4B23A 1YQRA 1RRQA 4AI4A 3OYKA 3L2UA 1N3CA 4E7IA 4E7HA 1ORPA 1P59A 2NOIA 4YPHA 3OY9A 3VW4A 1MUNA 4E7KA 1YQKA 1LWYA 3G0QA 1WEFA 3OYCA 2JHJA 4UNFA 2OFKA 3OS1A 5CHZA 4OFAA 3CVTA 4ZTFA 3CWSA 1XQOA 3OS0A
chains in the Genus database with same CATH topology
1MUDA 4EA4A 1YQLA 3OGDA 3KNTA 2H56A 1NKUA 4E9EA 1PU7A 1KG7A 2YG8A 1WEGA 1PVSA 2XHIA 3IH7A 3I0WA 1XQPA 1PU8A 1EBMA 3IHOA 1LWWA 3CW7A 1HU0A 1ORNA 1KEAA 4YPRA 4PIIA 4AI5A 5KN9A 4DK9A 2NOFA 3CVSA 1LMZA 2NOHA 2JG6A 4OFEA 3CWAA 4E9FA 1PU6A 1MUYA 2NOZA 4YOQA 1M3HA 3N5NX 1VRLA 4UOBA 3N0UA 3KTUA 4EJZA 1MPGA 1KG2A 1N39A 4AIAA 2NOEA 1LWVA 1KG3A 3F0ZA 4EVVA 3OH9A 3I0XA 2NOLA 2OFIA 2ABKA 1M3QA 1KG4A 2I5WA 1XG7A 4EW4A 4E9GA 4EW0A 2NOBA 5KN8A 1FN7A 2YG9A 4HSBA 3CWTA 4B24A 2JHNA 4B21A 1DIZA 3OH6A 1YQMA 3F10A 4B22A 3FSPA 1KQJA 5AN4A 1RRSA 1NGNA 3FHGA 1KG6A 1N3AA 3CWUA 1WEIA 4EJYA 3FHFA 5DPKA 3S6IA 1P7MA 4EA5A 1KO9A 4OFHA 1KG5A 4E9HA 4B23A 1YQRA 1RRQA 4AI4A 1N3CA 1ORPA 1P59A 2NOIA 4YPHA 1MUNA 1YQKA 1LWYA 3G0QA 1WEFA 2JHJA 4UNFA 2OFKA 5CHZA 4OFAA 3CVTA 3CWSA 1XQOA 3D4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MUD A;  4EA4 A;  1YQL A;  3OGD A;  3KNT A;  2H56 A;  1NKU A;  4E9E A;  1PU7 A;  1KG7 A;  2YG8 A;  1WEG A;  1PVS A;  2XHI A;  3IH7 A;  3I0W A;  1XQP A;  1PU8 A;  1EBM A;  3IHO A;  1LWW A;  3CW7 A;  1HU0 A;  1ORN A;  1KEA A;  4YPR A;  4PII A;  4AI5 A;  5KN9 A;  4DK9 A;  2NOF A;  3CVS A;  1LMZ A;  2NOH A;  2JG6 A;  4OFE A;  3CWA A;  4E9F A;  1PU6 A;  1MUY A;  2NOZ A;  4YOQ A;  1M3H A;  3N5N X;  1VRL A;  4UOB A;  3N0U A;  3KTU A;  4EJZ A;  1MPG A;  1KG2 A;  1N39 A;  4AIA A;  2NOE A;  1LWV A;  1KG3 A;  3F0Z A;  4EVV A;  3OH9 A;  3I0X A;  2NOL A;  2OFI A;  2ABK A;  1M3Q A;  1KG4 A;  2I5W A;  1XG7 A;  4EW4 A;  4E9G A;  4EW0 A;  2NOB A;  5KN8 A;  1FN7 A;  2YG9 A;  4HSB A;  3CWT A;  4B24 A;  2JHN A;  4B21 A;  1DIZ A;  3OH6 A;  1YQM A;  3F10 A;  4B22 A;  3FSP A;  1KQJ A;  5AN4 A;  1RRS A;  1NGN A;  3FHG A;  1KG6 A;  1N3A A;  3CWU A;  1WEI A;  4EJY A;  3FHF A;  5DPK A;  3S6I A;  1P7M A;  4EA5 A;  1KO9 A;  4OFH A;  1KG5 A;  4E9H A;  4B23 A;  1YQR A;  1RRQ A;  4AI4 A;  1N3C A;  1ORP A;  1P59 A;  2NOI A;  4YPH A;  1MUN A;  1YQK A;  1LWY A;  3G0Q A;  1WEF A;  2JHJ A;  4UNF A;  2OFK A;  5CHZ A;  4OFA A;  3CVT A;  3CWS A;  1XQO A;  3D4V A; 
#chains in the Genus database with same CATH topology
 1MUD A;  3L2V A;  4EA4 A;  1YQL A;  3OGD A;  4BAC A;  3KNT A;  2H56 A;  1NKU A;  4E9E A;  4E7J A;  1PU7 A;  1KG7 A;  2YG8 A;  4ZTJ A;  1WEG A;  1PVS A;  2XHI A;  3IH7 A;  3I0W A;  4BDZ A;  1XQP A;  1PU8 A;  1EBM A;  3OYN A;  3IHO A;  3S3N A;  1LWW A;  4BE1 A;  3CW7 A;  3D4V A;  1HU0 A;  1ORN A;  1KEA A;  4YPR A;  3OYG A;  4PII A;  4AI5 A;  3S3O A;  5KN9 A;  4DK9 A;  2NOF A;  3CVS A;  1LMZ A;  2NOH A;  5FRO A;  2JG6 A;  5FRN A;  4OFE A;  3CWA A;  3OYE A;  4E9F A;  1PU6 A;  1MUY A;  2NOZ A;  4YOQ A;  3L2W A;  4BDY A;  1M3H A;  2V75 A;  3N5N X;  1VRL A;  4UOB A;  3N0U A;  3KTU A;  4BE0 A;  3OS2 A;  4EJZ A;  4NZG A;  1MPG A;  1KG2 A;  1N39 A;  4AIA A;  2W03 A;  2NOE A;  1LWV A;  1KG3 A;  3OYM A;  3F0Z A;  3OYA A;  4EVV A;  3OH9 A;  3I0X A;  3NNQ A;  2NOL A;  2W04 A;  2ABK A;  1M3Q A;  3OYL A;  1KG4 A;  2OFI A;  3OYD A;  3LCN A;  2I5W A;  1XG7 A;  4EW4 A;  4E9G A;  4EW0 A;  2NOB A;  5KN8 A;  4BE2 A;  1FN7 A;  2YG9 A;  4HSB A;  3CWT A;  4B24 A;  2JHN A;  3L2Q A;  3R2X C;  4B21 A;  3OYJ A;  1DIZ A;  3OH6 A;  1YQM A;  3F10 A;  4IKF A;  4B22 A;  3OYH A;  3OYB A;  3FSP A;  3L2R A;  1KQJ A;  5AN4 A;  1RRS A;  1NGN A;  3FHG A;  1KG6 A;  3OYI A;  1N3A A;  3CWU A;  1WEI A;  3S3M A;  3OYF A;  4EJY A;  2JPS A;  3FHF A;  1U84 A;  5DPK A;  3S6I A;  5FRM A;  1P7M A;  4EA5 A;  4E7L A;  1KO9 A;  4OFH A;  1KG5 A;  4E9H A;  4B23 A;  1YQR A;  1RRQ A;  4AI4 A;  3OYK A;  3L2U A;  1N3C A;  4E7I A;  4E7H A;  1ORP A;  1P59 A;  2NOI A;  4YPH A;  3OY9 A;  3VW4 A;  1MUN A;  4E7K A;  1YQK A;  1LWY A;  3G0Q A;  1WEF A;  3OYC A;  2JHJ A;  4UNF A;  2OFK A;  3OS1 A;  5CHZ A;  4OFA A;  3CVT A;  4ZTF A;  3CWS A;  1XQO A;  3OS0 A; 
#chains in the Genus database with same CATH homology
 1MUD A;  4EA4 A;  1YQL A;  3OGD A;  3KNT A;  2H56 A;  1NKU A;  4E9E A;  1PU7 A;  1KG7 A;  2YG8 A;  1WEG A;  1PVS A;  2XHI A;  3IH7 A;  3I0W A;  1XQP A;  1PU8 A;  1EBM A;  3IHO A;  1LWW A;  3CW7 A;  1HU0 A;  1ORN A;  1KEA A;  4YPR A;  4PII A;  4AI5 A;  5KN9 A;  4DK9 A;  2NOF A;  3CVS A;  1LMZ A;  2NOH A;  2JG6 A;  4OFE A;  3CWA A;  4E9F A;  1PU6 A;  1MUY A;  2NOZ A;  4YOQ A;  1M3H A;  3N5N X;  1VRL A;  4UOB A;  3N0U A;  3KTU A;  4EJZ A;  1MPG A;  1KG2 A;  1N39 A;  4AIA A;  2NOE A;  1LWV A;  1KG3 A;  3F0Z A;  4EVV A;  3OH9 A;  3I0X A;  2NOL A;  2OFI A;  2ABK A;  1M3Q A;  1KG4 A;  2I5W A;  1XG7 A;  4EW4 A;  4E9G A;  4EW0 A;  2NOB A;  5KN8 A;  1FN7 A;  2YG9 A;  4HSB A;  3CWT A;  4B24 A;  2JHN A;  4B21 A;  1DIZ A;  3OH6 A;  1YQM A;  3F10 A;  4B22 A;  3FSP A;  1KQJ A;  5AN4 A;  1RRS A;  1NGN A;  3FHG A;  1KG6 A;  1N3A A;  3CWU A;  1WEI A;  4EJY A;  3FHF A;  5DPK A;  3S6I A;  1P7M A;  4EA5 A;  1KO9 A;  4OFH A;  1KG5 A;  4E9H A;  4B23 A;  1YQR A;  1RRQ A;  4AI4 A;  1N3C A;  1ORP A;  1P59 A;  2NOI A;  4YPH A;  1MUN A;  1YQK A;  1LWY A;  3G0Q A;  1WEF A;  2JHJ A;  4UNF A;  2OFK A;  5CHZ A;  4OFA A;  3CVT A;  3CWS A;  1XQO A;  3D4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...