1KG7A

Crystal structure of the e161a mutant of e.coli muty (core fragment)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
224
structure length
224
Chain Sequence
MQASQFSAQVLDWYDKYGRKTLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVANKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A/G-specific adenine glycosylase
publication title Analysis of the E.coli MutY DNA glycosylase structure and function by site-directed mutagenesis
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 80
structure length 224
sequence length 224
ec nomenclature ec 3.2.2.31: Adenine glycosylase.
pdb deposition date 2001-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF10576 EndIII_4Fe-2S Iron-sulfur binding domain of endonuclease III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1kg7A02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 1kg7A01
1NGNA 1EBMA 4UOBA 1RRSA 1WEIA 5KN9A 1LWVA 2I5WA 1MUYA 3CW7A 3CVTA 4EA4A 1YQKA 4YOQA 3CWTA 3F0ZA 2NOHA 1KG3A 4PIIA 1KG6A 1PVSA 1RRQA 3FHGA 4B22A 1YQMA 4YPHA 2JHNA 1NKUA 4HSBA 4OFAA 1KG2A 1WEGA 4EVVA 1KO9A 5AN4A 1VRLA 2H56A 2JG6A 3OGDA 1WEFA 3OH9A 1P59A 3CWSA 1M3HA 3CWUA 3FSPA 1MUNA 3OH6A 1HU0A 1KEAA 2OFIA 1DIZA 2OFKA 1N3CA 4YPRA 3KNTA 1YQLA 4B23A 1YQRA 4OFHA 3I0XA 2JHJA 2YG8A 5KN8A 4AI4A 4EW4A 4OFEA 1LWWA 1FN7A 1KG5A 3N5NX 3CVSA 1ORPA 5CHZA 1ORNA 3I0WA 3D4VA 3S6IA 3IH7A 1LWYA 3CWAA 1LMZA 2NOBA 3KTUA 1P7MA 1KG7A 1MUDA 3IHOA 1M3QA 4AI5A 4EW0A 1N3AA 4E9HA 4EJYA 2NOZA 2ABKA 1XQOA 3F10A 3N0UA 2NOFA 4UNFA 2NOLA 3G0QA 1MPGA 2NOIA 4DK9A 1XG7A 1KQJA 5DPKA 4B21A 1N39A 1XQPA 4E9FA 1PU7A 2NOEA 4AIAA 2YG9A 1PU6A 4E9EA 4EJZA 2XHIA 4E9GA 4EA5A 1KG4A 3FHFA 4B24A 1PU8A
chains in the Genus database with same CATH superfamily
1NGNA 1EBMA 4UOBA 1RRSA 1WEIA 5KN9A 1LWVA 2I5WA 1MUYA 3L2WA 3CW7A 5FRMA 4E7LA 3OYAA 3CVTA 4EA4A 4ZTJA 1YQKA 4YOQA 3CWTA 3F0ZA 4BE0A 2NOHA 4E7KA 3R2XC 1KG3A 3OYBA 4PIIA 1KG6A 1PVSA 1RRQA 5FROA 3FHGA 4B22A 1YQMA 4YPHA 2JHNA 1NKUA 4HSBA 3OYNA 4OFAA 3OYDA 4E7JA 1KG2A 1WEGA 3OS1A 3OYCA 4EVVA 1KO9A 5AN4A 3OYEA 2H56A 3S3OA 2JG6A 3OGDA 1VRLA 3OYHA 1WEFA 3OH9A 1P59A 3S3NA 3CWSA 4BDYA 1M3HA 4BACA 3CWUA 3FSPA 3VW4A 1MUNA 3OS2A 3OH6A 1HU0A 1KEAA 2OFIA 1DIZA 2OFKA 1N3CA 4YPRA 3OYGA 3KNTA 1YQLA 4B23A 1YQRA 4OFHA 3L2VA 3NNQA 3I0XA 2JHJA 2YG8A 3OS0A 5KN8A 3L2QA 5FRNA 4AI4A 4EW4A 3OYMA 4OFEA 3L2RA 1LWWA 1FN7A 1KG5A 4BE1A 3N5NX 4E7IA 4IKFA 4NZGA 2W04A 3CVSA 3S3MA 1ORPA 5CHZA 2W03A 1ORNA 3I0WA 3L2UA 3D4VA 3S6IA 3IH7A 3OYIA 1LWYA 3CWAA 1LMZA 2NOBA 3KTUA 2V75A 1P7MA 1KG7A 3LCNA 1MUDA 3IHOA 1M3QA 4AI5A 4EW0A 1N3AA 4E9HA 3OYFA 4EJYA 2NOZA 2ABKA 1XQOA 3F10A 3OYJA 3N0UA 2JPSA 2NOFA 4BE2A 3OY9A 1U84A 4UNFA 2NOLA 3G0QA 1MPGA 2NOIA 4DK9A 3OYKA 1XG7A 1KQJA 5DPKA 4B21A 1N39A 1XQPA 4E9FA 1PU7A 2NOEA 4ZTFA 3OYLA 4AIAA 2YG9A 4E7HA 1PU6A 4E9EA 4EJZA 2XHIA 4BDZA 4E9GA 4EA5A 1KG4A 3FHFA 4B24A 1PU8A
chains in the Genus database with same CATH topology
1NGNA 1EBMA 4UOBA 1RRSA 1WEIA 5KN9A 1LWVA 2I5WA 1MUYA 3CW7A 3CVTA 4EA4A 1YQKA 4YOQA 3CWTA 3F0ZA 2NOHA 1KG3A 4PIIA 1KG6A 1PVSA 1RRQA 3FHGA 4B22A 1YQMA 4YPHA 2JHNA 1NKUA 4HSBA 4OFAA 1KG2A 1WEGA 4EVVA 1KO9A 5AN4A 1VRLA 2H56A 2JG6A 3OGDA 1WEFA 3OH9A 1P59A 3CWSA 1M3HA 3CWUA 3FSPA 1MUNA 3OH6A 1HU0A 1KEAA 2OFIA 1DIZA 2OFKA 1N3CA 4YPRA 3KNTA 1YQLA 4B23A 1YQRA 4OFHA 3I0XA 2JHJA 2YG8A 5KN8A 4AI4A 4EW4A 4OFEA 1LWWA 1FN7A 1KG5A 3N5NX 3CVSA 1ORPA 5CHZA 1ORNA 3I0WA 3D4VA 3S6IA 3IH7A 1LWYA 3CWAA 1LMZA 2NOBA 3KTUA 1P7MA 1KG7A 1MUDA 3IHOA 1M3QA 4AI5A 4EW0A 1N3AA 4E9HA 4EJYA 2NOZA 2ABKA 1XQOA 3F10A 3N0UA 2NOFA 4UNFA 2NOLA 3G0QA 1MPGA 2NOIA 4DK9A 1XG7A 1KQJA 5DPKA 4B21A 1N39A 1XQPA 4E9FA 1PU7A 2NOEA 4AIAA 2YG9A 1PU6A 4E9EA 4EJZA 2XHIA 4E9GA 4EA5A 1KG4A 3FHFA 4B24A 1PU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGN A;  1EBM A;  4UOB A;  1RRS A;  1WEI A;  5KN9 A;  1LWV A;  2I5W A;  1MUY A;  3CW7 A;  3CVT A;  4EA4 A;  1YQK A;  4YOQ A;  3CWT A;  3F0Z A;  2NOH A;  1KG3 A;  4PII A;  1KG6 A;  1PVS A;  1RRQ A;  3FHG A;  4B22 A;  1YQM A;  4YPH A;  2JHN A;  1NKU A;  4HSB A;  4OFA A;  1KG2 A;  1WEG A;  4EVV A;  1KO9 A;  5AN4 A;  1VRL A;  2H56 A;  2JG6 A;  3OGD A;  1WEF A;  3OH9 A;  1P59 A;  3CWS A;  1M3H A;  3CWU A;  3FSP A;  1MUN A;  3OH6 A;  1HU0 A;  1KEA A;  2OFI A;  1DIZ A;  2OFK A;  1N3C A;  4YPR A;  3KNT A;  1YQL A;  4B23 A;  1YQR A;  4OFH A;  3I0X A;  2JHJ A;  2YG8 A;  5KN8 A;  4AI4 A;  4EW4 A;  4OFE A;  1LWW A;  1FN7 A;  1KG5 A;  3N5N X;  3CVS A;  1ORP A;  5CHZ A;  1ORN A;  3I0W A;  3D4V A;  3S6I A;  3IH7 A;  1LWY A;  3CWA A;  1LMZ A;  2NOB A;  3KTU A;  1P7M A;  1KG7 A;  1MUD A;  3IHO A;  1M3Q A;  4AI5 A;  4EW0 A;  1N3A A;  4E9H A;  4EJY A;  2NOZ A;  2ABK A;  1XQO A;  3F10 A;  3N0U A;  2NOF A;  4UNF A;  2NOL A;  3G0Q A;  1MPG A;  2NOI A;  4DK9 A;  1XG7 A;  1KQJ A;  5DPK A;  4B21 A;  1N39 A;  1XQP A;  4E9F A;  1PU7 A;  2NOE A;  4AIA A;  2YG9 A;  1PU6 A;  4E9E A;  4EJZ A;  2XHI A;  4E9G A;  4EA5 A;  1KG4 A;  3FHF A;  4B24 A;  1PU8 A; 
#chains in the Genus database with same CATH topology
 1NGN A;  1EBM A;  4UOB A;  1RRS A;  1WEI A;  5KN9 A;  1LWV A;  2I5W A;  1MUY A;  3L2W A;  3CW7 A;  5FRM A;  4E7L A;  3OYA A;  3CVT A;  4EA4 A;  4ZTJ A;  1YQK A;  4YOQ A;  3CWT A;  3F0Z A;  4BE0 A;  2NOH A;  4E7K A;  3R2X C;  1KG3 A;  3OYB A;  4PII A;  1KG6 A;  1PVS A;  1RRQ A;  5FRO A;  3FHG A;  4B22 A;  1YQM A;  4YPH A;  2JHN A;  1NKU A;  4HSB A;  3OYN A;  4OFA A;  3OYD A;  4E7J A;  1KG2 A;  1WEG A;  3OS1 A;  3OYC A;  4EVV A;  1KO9 A;  5AN4 A;  3OYE A;  2H56 A;  3S3O A;  2JG6 A;  3OGD A;  1VRL A;  3OYH A;  1WEF A;  3OH9 A;  1P59 A;  3S3N A;  3CWS A;  4BDY A;  1M3H A;  4BAC A;  3CWU A;  3FSP A;  3VW4 A;  1MUN A;  3OS2 A;  3OH6 A;  1HU0 A;  1KEA A;  2OFI A;  1DIZ A;  2OFK A;  1N3C A;  4YPR A;  3OYG A;  3KNT A;  1YQL A;  4B23 A;  1YQR A;  4OFH A;  3L2V A;  3NNQ A;  3I0X A;  2JHJ A;  2YG8 A;  3OS0 A;  5KN8 A;  3L2Q A;  5FRN A;  4AI4 A;  4EW4 A;  3OYM A;  4OFE A;  3L2R A;  1LWW A;  1FN7 A;  1KG5 A;  4BE1 A;  3N5N X;  4E7I A;  4IKF A;  4NZG A;  2W04 A;  3CVS A;  3S3M A;  1ORP A;  5CHZ A;  2W03 A;  1ORN A;  3I0W A;  3L2U A;  3D4V A;  3S6I A;  3IH7 A;  3OYI A;  1LWY A;  3CWA A;  1LMZ A;  2NOB A;  3KTU A;  2V75 A;  1P7M A;  1KG7 A;  3LCN A;  1MUD A;  3IHO A;  1M3Q A;  4AI5 A;  4EW0 A;  1N3A A;  4E9H A;  3OYF A;  4EJY A;  2NOZ A;  2ABK A;  1XQO A;  3F10 A;  3OYJ A;  3N0U A;  2JPS A;  2NOF A;  4BE2 A;  3OY9 A;  1U84 A;  4UNF A;  2NOL A;  3G0Q A;  1MPG A;  2NOI A;  4DK9 A;  3OYK A;  1XG7 A;  1KQJ A;  5DPK A;  4B21 A;  1N39 A;  1XQP A;  4E9F A;  1PU7 A;  2NOE A;  4ZTF A;  3OYL A;  4AIA A;  2YG9 A;  4E7H A;  1PU6 A;  4E9E A;  4EJZ A;  2XHI A;  4BDZ A;  4E9G A;  4EA5 A;  1KG4 A;  3FHF A;  4B24 A;  1PU8 A; 
#chains in the Genus database with same CATH homology
 1NGN A;  1EBM A;  4UOB A;  1RRS A;  1WEI A;  5KN9 A;  1LWV A;  2I5W A;  1MUY A;  3CW7 A;  3CVT A;  4EA4 A;  1YQK A;  4YOQ A;  3CWT A;  3F0Z A;  2NOH A;  1KG3 A;  4PII A;  1KG6 A;  1PVS A;  1RRQ A;  3FHG A;  4B22 A;  1YQM A;  4YPH A;  2JHN A;  1NKU A;  4HSB A;  4OFA A;  1KG2 A;  1WEG A;  4EVV A;  1KO9 A;  5AN4 A;  1VRL A;  2H56 A;  2JG6 A;  3OGD A;  1WEF A;  3OH9 A;  1P59 A;  3CWS A;  1M3H A;  3CWU A;  3FSP A;  1MUN A;  3OH6 A;  1HU0 A;  1KEA A;  2OFI A;  1DIZ A;  2OFK A;  1N3C A;  4YPR A;  3KNT A;  1YQL A;  4B23 A;  1YQR A;  4OFH A;  3I0X A;  2JHJ A;  2YG8 A;  5KN8 A;  4AI4 A;  4EW4 A;  4OFE A;  1LWW A;  1FN7 A;  1KG5 A;  3N5N X;  3CVS A;  1ORP A;  5CHZ A;  1ORN A;  3I0W A;  3D4V A;  3S6I A;  3IH7 A;  1LWY A;  3CWA A;  1LMZ A;  2NOB A;  3KTU A;  1P7M A;  1KG7 A;  1MUD A;  3IHO A;  1M3Q A;  4AI5 A;  4EW0 A;  1N3A A;  4E9H A;  4EJY A;  2NOZ A;  2ABK A;  1XQO A;  3F10 A;  3N0U A;  2NOF A;  4UNF A;  2NOL A;  3G0Q A;  1MPG A;  2NOI A;  4DK9 A;  1XG7 A;  1KQJ A;  5DPK A;  4B21 A;  1N39 A;  1XQP A;  4E9F A;  1PU7 A;  2NOE A;  4AIA A;  2YG9 A;  1PU6 A;  4E9E A;  4EJZ A;  2XHI A;  4E9G A;  4EA5 A;  1KG4 A;  3FHF A;  4B24 A;  1PU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...