2OFIA

Crystal structure of 3-methyladenine dna glycosylase i (tag) bound to dna/3ma
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
184
structure length
184
Chain Sequence
MQRCDWVSQDPLYIAYHDNEWGVPETDSRKLFEMICLEGQQAGLSWITVLKKRENYRACFHQFDPIRIAAMQEEDVERLLQNTGIIRHRGKIQAIISNARAWLAMEQNGESFADFVWSFVDGQPQITQAASLDKIPTSTPASDALAKALKKRGFKFVGTTICYSFMQACGLVNDHITGCFCHPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags 3-methyladenine dna glycosylase i/dna
molecule keywords 5'-D(*CP*GP*GP*AP*CP*TP*(3DR)P*AP*CP*GP*GP*G)-3'
publication title DNA damage recognition and repair by 3-methyladenine DNA glycosylase I (TAG).
pubmed doi rcsb
source organism Salmonella typhi
total genus 61
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2007-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03352 Adenine_glyco Methyladenine glycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 2ofiA00
1MUDA 3FHFA 3IH7A 4E9HA 2JHJA 4E9EA 4EA5A 4DK9A 4OFHA 4OFAA 5DPKA 4B22A 1LMZA 1N39A 1N3CA 3CWSA 1YQMA 3FSPA 1MUNA 4EW4A 2NOZA 4AI4A 1WEIA 1KG6A 1KG3A 1PVSA 4EVVA 3N0UA 1M3QA 4E9FA 4EJZA 3CWUA 3KNTA 1FN7A 3F0ZA 1PU8A 1MPGA 4UNFA 3I0WA 1YQLA 2OFIA 1P7MA 1NGNA 2I5WA 4YPHA 1XG7A 2JHNA 4OFEA 1M3HA 3CVSA 1KG5A 1MUYA 3OH6A 1LWYA 2NOHA 3OGDA 3F10A 5AN4A 3CVTA 1LWWA 1DIZA 1LWVA 4AIAA 1PU7A 3IHOA 4YPRA 3CWTA 1PU6A 4YOQA 1KG7A 5CHZA 1YQKA 2H56A 3N5NX 5KN8A 3G0QA 4EW0A 1RRQA 1ORNA 1WEGA 4B21A 3CWAA 2YG9A 1HU0A 2YG8A 4E9GA 1YQRA 1RRSA 1EBMA 5KN9A 4AI5A 4B24A 4UOBA 1VRLA 4PIIA 1KO9A 1NKUA 4B23A 4EA4A 2JG6A 1ORPA 1KEAA 3I0XA 1KG4A 2NOEA 2NOIA 2NOLA 3D4VA 1XQOA 2NOFA 3KTUA 4HSBA 1WEFA 1KQJA 3CW7A 3S6IA 3FHGA 2XHIA 1P59A 1KG2A 2ABKA 2NOBA 3OH9A 2OFKA 1XQPA 4EJYA 1N3AA
chains in the Genus database with same CATH superfamily
3L2WA 4BE1A 1MUDA 3FHFA 3IH7A 4BE0A 4E9HA 2JHJA 4E7IA 4E9EA 4EA5A 4DK9A 4OFHA 4OFAA 3OYCA 5DPKA 3NNQA 3OYNA 4B22A 3OYGA 1LMZA 1N39A 1N3CA 3CWSA 1YQMA 2V75A 1MUNA 3FSPA 4EW4A 4BDYA 3S3MA 2NOZA 4AI4A 1WEIA 1KG6A 1KG3A 1PVSA 3L2RA 4EVVA 3N0UA 1M3QA 4E9FA 5FRMA 4EJZA 4E7JA 3CWUA 3KNTA 4BDZA 1FN7A 3F0ZA 1PU8A 1MPGA 4ZTFA 4UNFA 3I0WA 1YQLA 2OFIA 1P7MA 1NGNA 2I5WA 4NZGA 4YPHA 1XG7A 2JHNA 3OS0A 4OFEA 3OS2A 1M3HA 3CVSA 1KG5A 1U84A 1MUYA 4E7LA 3OYHA 3OH6A 1LWYA 2NOHA 3OGDA 3F10A 5AN4A 2JPSA 3CVTA 3R2XC 1LWWA 4BACA 3OYIA 1DIZA 1LWVA 4AIAA 1PU7A 3IHOA 3S3OA 3VW4A 4YPRA 3CWTA 1PU6A 3OYMA 4YOQA 1KG7A 3OYKA 4BE2A 5FROA 3OYFA 3LCNA 5CHZA 1YQKA 2H56A 3N5NX 5KN8A 3G0QA 4EW0A 1RRQA 1ORNA 3L2UA 1WEGA 4B21A 3CWAA 3OY9A 2YG9A 3OYAA 1HU0A 2YG8A 4E9GA 1YQRA 1RRSA 2W04A 5KN9A 1EBMA 4AI5A 4B24A 4UOBA 3OYEA 2W03A 1VRLA 4PIIA 1KO9A 1NKUA 4B23A 4EA4A 2JG6A 3OYLA 3OYJA 1ORPA 1KEAA 3I0XA 1KG4A 3S3NA 3L2QA 2NOEA 2NOIA 3OS1A 2NOLA 3D4VA 4E7KA 1XQOA 2NOFA 3OYDA 4ZTJA 3KTUA 5FRNA 3L2VA 4HSBA 1WEFA 1KQJA 3CW7A 3S6IA 3FHGA 4E7HA 4IKFA 2XHIA 1P59A 1KG2A 2ABKA 2NOBA 3OH9A 2OFKA 1XQPA 3OYBA 4EJYA 1N3AA
chains in the Genus database with same CATH topology
1MUDA 3FHFA 3IH7A 4E9HA 2JHJA 4E9EA 4EA5A 4DK9A 4OFHA 4OFAA 5DPKA 4B22A 1LMZA 1N39A 1N3CA 3CWSA 1YQMA 3FSPA 1MUNA 4EW4A 2NOZA 4AI4A 1WEIA 1KG6A 1KG3A 1PVSA 4EVVA 3N0UA 1M3QA 4E9FA 4EJZA 3CWUA 3KNTA 1FN7A 3F0ZA 1PU8A 1MPGA 4UNFA 3I0WA 1YQLA 2OFIA 1P7MA 1NGNA 2I5WA 4YPHA 1XG7A 2JHNA 4OFEA 1M3HA 3CVSA 1KG5A 1MUYA 3OH6A 1LWYA 2NOHA 3OGDA 3F10A 5AN4A 3CVTA 1LWWA 1DIZA 1LWVA 4AIAA 1PU7A 3IHOA 4YPRA 3CWTA 1PU6A 4YOQA 1KG7A 5CHZA 1YQKA 2H56A 3N5NX 5KN8A 3G0QA 4EW0A 1RRQA 1ORNA 1WEGA 4B21A 3CWAA 2YG9A 1HU0A 2YG8A 4E9GA 1YQRA 1RRSA 1EBMA 5KN9A 4AI5A 4B24A 4UOBA 1VRLA 4PIIA 1KO9A 1NKUA 4B23A 4EA4A 2JG6A 1ORPA 1KEAA 3I0XA 1KG4A 2NOEA 2NOIA 2NOLA 3D4VA 1XQOA 2NOFA 3KTUA 4HSBA 1WEFA 1KQJA 3CW7A 3S6IA 3FHGA 2XHIA 1P59A 1KG2A 2ABKA 2NOBA 3OH9A 2OFKA 1XQPA 4EJYA 1N3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MUD A;  3FHF A;  3IH7 A;  4E9H A;  2JHJ A;  4E9E A;  4EA5 A;  4DK9 A;  4OFH A;  4OFA A;  5DPK A;  4B22 A;  1LMZ A;  1N39 A;  1N3C A;  3CWS A;  1YQM A;  3FSP A;  1MUN A;  4EW4 A;  2NOZ A;  4AI4 A;  1WEI A;  1KG6 A;  1KG3 A;  1PVS A;  4EVV A;  3N0U A;  1M3Q A;  4E9F A;  4EJZ A;  3CWU A;  3KNT A;  1FN7 A;  3F0Z A;  1PU8 A;  1MPG A;  4UNF A;  3I0W A;  1YQL A;  2OFI A;  1P7M A;  1NGN A;  2I5W A;  4YPH A;  1XG7 A;  2JHN A;  4OFE A;  1M3H A;  3CVS A;  1KG5 A;  1MUY A;  3OH6 A;  1LWY A;  2NOH A;  3OGD A;  3F10 A;  5AN4 A;  3CVT A;  1LWW A;  1DIZ A;  1LWV A;  4AIA A;  1PU7 A;  3IHO A;  4YPR A;  3CWT A;  1PU6 A;  4YOQ A;  1KG7 A;  5CHZ A;  1YQK A;  2H56 A;  3N5N X;  5KN8 A;  3G0Q A;  4EW0 A;  1RRQ A;  1ORN A;  1WEG A;  4B21 A;  3CWA A;  2YG9 A;  1HU0 A;  2YG8 A;  4E9G A;  1YQR A;  1RRS A;  1EBM A;  5KN9 A;  4AI5 A;  4B24 A;  4UOB A;  1VRL A;  4PII A;  1KO9 A;  1NKU A;  4B23 A;  4EA4 A;  2JG6 A;  1ORP A;  1KEA A;  3I0X A;  1KG4 A;  2NOE A;  2NOI A;  2NOL A;  3D4V A;  1XQO A;  2NOF A;  3KTU A;  4HSB A;  1WEF A;  1KQJ A;  3CW7 A;  3S6I A;  3FHG A;  2XHI A;  1P59 A;  1KG2 A;  2ABK A;  2NOB A;  3OH9 A;  2OFK A;  1XQP A;  4EJY A;  1N3A A; 
#chains in the Genus database with same CATH topology
 3L2W A;  4BE1 A;  1MUD A;  3FHF A;  3IH7 A;  4BE0 A;  4E9H A;  2JHJ A;  4E7I A;  4E9E A;  4EA5 A;  4DK9 A;  4OFH A;  4OFA A;  3OYC A;  5DPK A;  3NNQ A;  3OYN A;  4B22 A;  3OYG A;  1LMZ A;  1N39 A;  1N3C A;  3CWS A;  1YQM A;  2V75 A;  1MUN A;  3FSP A;  4EW4 A;  4BDY A;  3S3M A;  2NOZ A;  4AI4 A;  1WEI A;  1KG6 A;  1KG3 A;  1PVS A;  3L2R A;  4EVV A;  3N0U A;  1M3Q A;  4E9F A;  5FRM A;  4EJZ A;  4E7J A;  3CWU A;  3KNT A;  4BDZ A;  1FN7 A;  3F0Z A;  1PU8 A;  1MPG A;  4ZTF A;  4UNF A;  3I0W A;  1YQL A;  2OFI A;  1P7M A;  1NGN A;  2I5W A;  4NZG A;  4YPH A;  1XG7 A;  2JHN A;  3OS0 A;  4OFE A;  3OS2 A;  1M3H A;  3CVS A;  1KG5 A;  1U84 A;  1MUY A;  4E7L A;  3OYH A;  3OH6 A;  1LWY A;  2NOH A;  3OGD A;  3F10 A;  5AN4 A;  2JPS A;  3CVT A;  3R2X C;  1LWW A;  4BAC A;  3OYI A;  1DIZ A;  1LWV A;  4AIA A;  1PU7 A;  3IHO A;  3S3O A;  3VW4 A;  4YPR A;  3CWT A;  1PU6 A;  3OYM A;  4YOQ A;  1KG7 A;  3OYK A;  4BE2 A;  5FRO A;  3OYF A;  3LCN A;  5CHZ A;  1YQK A;  2H56 A;  3N5N X;  5KN8 A;  3G0Q A;  4EW0 A;  1RRQ A;  1ORN A;  3L2U A;  1WEG A;  4B21 A;  3CWA A;  3OY9 A;  2YG9 A;  3OYA A;  1HU0 A;  2YG8 A;  4E9G A;  1YQR A;  1RRS A;  2W04 A;  5KN9 A;  1EBM A;  4AI5 A;  4B24 A;  4UOB A;  3OYE A;  2W03 A;  1VRL A;  4PII A;  1KO9 A;  1NKU A;  4B23 A;  4EA4 A;  2JG6 A;  3OYL A;  3OYJ A;  1ORP A;  1KEA A;  3I0X A;  1KG4 A;  3S3N A;  3L2Q A;  2NOE A;  2NOI A;  3OS1 A;  2NOL A;  3D4V A;  4E7K A;  1XQO A;  2NOF A;  3OYD A;  4ZTJ A;  3KTU A;  5FRN A;  3L2V A;  4HSB A;  1WEF A;  1KQJ A;  3CW7 A;  3S6I A;  3FHG A;  4E7H A;  4IKF A;  2XHI A;  1P59 A;  1KG2 A;  2ABK A;  2NOB A;  3OH9 A;  2OFK A;  1XQP A;  3OYB A;  4EJY A;  1N3A A; 
#chains in the Genus database with same CATH homology
 1MUD A;  3FHF A;  3IH7 A;  4E9H A;  2JHJ A;  4E9E A;  4EA5 A;  4DK9 A;  4OFH A;  4OFA A;  5DPK A;  4B22 A;  1LMZ A;  1N39 A;  1N3C A;  3CWS A;  1YQM A;  3FSP A;  1MUN A;  4EW4 A;  2NOZ A;  4AI4 A;  1WEI A;  1KG6 A;  1KG3 A;  1PVS A;  4EVV A;  3N0U A;  1M3Q A;  4E9F A;  4EJZ A;  3CWU A;  3KNT A;  1FN7 A;  3F0Z A;  1PU8 A;  1MPG A;  4UNF A;  3I0W A;  1YQL A;  2OFI A;  1P7M A;  1NGN A;  2I5W A;  4YPH A;  1XG7 A;  2JHN A;  4OFE A;  1M3H A;  3CVS A;  1KG5 A;  1MUY A;  3OH6 A;  1LWY A;  2NOH A;  3OGD A;  3F10 A;  5AN4 A;  3CVT A;  1LWW A;  1DIZ A;  1LWV A;  4AIA A;  1PU7 A;  3IHO A;  4YPR A;  3CWT A;  1PU6 A;  4YOQ A;  1KG7 A;  5CHZ A;  1YQK A;  2H56 A;  3N5N X;  5KN8 A;  3G0Q A;  4EW0 A;  1RRQ A;  1ORN A;  1WEG A;  4B21 A;  3CWA A;  2YG9 A;  1HU0 A;  2YG8 A;  4E9G A;  1YQR A;  1RRS A;  1EBM A;  5KN9 A;  4AI5 A;  4B24 A;  4UOB A;  1VRL A;  4PII A;  1KO9 A;  1NKU A;  4B23 A;  4EA4 A;  2JG6 A;  1ORP A;  1KEA A;  3I0X A;  1KG4 A;  2NOE A;  2NOI A;  2NOL A;  3D4V A;  1XQO A;  2NOF A;  3KTU A;  4HSB A;  1WEF A;  1KQJ A;  3CW7 A;  3S6I A;  3FHG A;  2XHI A;  1P59 A;  1KG2 A;  2ABK A;  2NOB A;  3OH9 A;  2OFK A;  1XQP A;  4EJY A;  1N3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...