2OFIA

Crystal structure of 3-methyladenine dna glycosylase i (tag) bound to dna/3ma
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
184
structure length
184
Chain Sequence
MQRCDWVSQDPLYIAYHDNEWGVPETDSRKLFEMICLEGQQAGLSWITVLKKRENYRACFHQFDPIRIAAMQEEDVERLLQNTGIIRHRGKIQAIISNARAWLAMEQNGESFADFVWSFVDGQPQITQAASLDKIPTSTPASDALAKALKKRGFKFVGTTICYSFMQACGLVNDHITGCFCHPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*GP*AP*CP*TP*(3DR)P*AP*CP*GP*GP*G)-3'
publication title DNA damage recognition and repair by 3-methyladenine DNA glycosylase I (TAG).
pubmed doi rcsb
source organism Salmonella typhi
molecule tags 3-methyladenine dna glycosylase i/dna
total genus 61
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2007-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03352 Adenine_glyco Methyladenine glycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 2ofiA00
1KG3A 4AI5A 2NOBA 4AI4A 1MUDA 1KG6A 2H56A 1DIZA 2I5WA 4EW4A 1WEIA 2NOEA 1KG4A 2YG8A 3KTUA 4E9GA 2JHJA 1YQRA 1KQJA 4E9FA 1PVSA 5CHZA 4DK9A 1WEGA 1LWVA 3FHGA 4B21A 2NOIA 2OFIA 2JHNA 1RRSA 4E9EA 1PU6A 1XQPA 1MPGA 3N5NX 1WEFA 1ORPA 1YQMA 2OFKA 4PIIA 4EJYA 3I0WA 4YPHA 4HSBA 4E9HA 2YG9A 4YOQA 4AIAA 3S6IA 4YPRA 1M3QA 3FHFA 1YQLA 4UOBA 3G0QA 5AN4A 2NOFA 3CW7A 2ABKA 1N3CA 1YQKA 4EA5A 1VRLA 3F10A 1HU0A 2NOZA 4B22A 4EA4A 3FSPA 2XHIA 1MUNA 1PU8A 3CWAA 1ORNA 3OH6A 1KO9A 1NKUA 1NGNA 4EVVA 4EJZA 1FN7A 1LWYA 5KN9A 1N3AA 3CWUA 1RRQA 3IH7A 5KN8A 4OFAA 5DPKA 3I0XA 4EW0A 1XG7A 1EBMA 1PU7A 2JG6A 3F0ZA 1MUYA 4B24A 3IHOA 3D4VA 4OFHA 4UNFA 3N0UA 1LMZA 1KEAA 1M3HA 3CVSA 3KNTA 1XQOA 1N39A 3CVTA 3OGDA 1KG7A 3CWSA 1KG5A 2NOHA 1P59A 2NOLA 1KG2A 1P7MA 1LWWA 4B23A 3OH9A 3CWTA 4OFEA
chains in the Genus database with same CATH superfamily
1KG3A 4AI5A 2NOBA 4AI4A 1MUDA 1KG6A 2H56A 5FRMA 1DIZA 2I5WA 4EW4A 1WEIA 2NOEA 1KG4A 4NZGA 2YG8A 3KTUA 4E9GA 3OS1A 2JHJA 1YQRA 1KQJA 4E9FA 2W03A 1PVSA 3OYFA 3L2QA 5CHZA 1U84A 4DK9A 1WEGA 1LWVA 3OYDA 3FHGA 4B21A 2NOIA 3OYEA 2OFIA 2JHNA 4BE0A 1RRSA 3OYMA 4E9EA 1PU6A 1XQPA 3L2UA 1MPGA 3N5NX 3OYAA 4IKFA 1WEFA 4BE2A 1ORPA 1YQMA 2OFKA 4PIIA 4EJYA 3I0WA 4BDYA 4YPHA 3NNQA 4HSBA 4E9HA 2YG9A 4E7HA 4E7LA 4BACA 4YOQA 4AIAA 3S6IA 5FRNA 5FROA 4YPRA 1M3QA 3OY9A 3OYCA 3LCNA 2JPSA 3FHFA 2V75A 1YQLA 3OYLA 4UOBA 3G0QA 4E7JA 3S3NA 5AN4A 2NOFA 3CW7A 2ABKA 1N3CA 1YQKA 4EA5A 1VRLA 3F10A 3VW4A 3OS0A 3OS2A 1HU0A 3OYBA 2NOZA 4BE1A 4B22A 4EA4A 3FSPA 3OYIA 2XHIA 3OYNA 1MUNA 1PU8A 3CWAA 4ZTFA 3OH6A 4E7IA 1KO9A 3S3MA 1ORNA 1NKUA 1NGNA 4EVVA 4EJZA 1FN7A 1LWYA 5KN9A 1N3AA 3CWUA 2W04A 1RRQA 4E7KA 3IH7A 5KN8A 3L2RA 4OFAA 5DPKA 3L2WA 3I0XA 4EW0A 1XG7A 1EBMA 1PU7A 3OYKA 3L2VA 2JG6A 3F0ZA 1MUYA 4B24A 3IHOA 4BDZA 3D4VA 3R2XC 4UNFA 4OFHA 3N0UA 1LMZA 3S3OA 4ZTJA 1KEAA 1M3HA 3CVSA 3KNTA 1XQOA 1N39A 3CVTA 3OGDA 1KG7A 3CWSA 1KG5A 2NOHA 3OYGA 1P59A 2NOLA 1KG2A 1P7MA 1LWWA 3OYJA 4B23A 3OH9A 3CWTA 3OYHA 4OFEA
chains in the Genus database with same CATH topology
1KG3A 4AI5A 2NOBA 4AI4A 1MUDA 1KG6A 2H56A 1DIZA 2I5WA 4EW4A 1WEIA 2NOEA 1KG4A 2YG8A 3KTUA 4E9GA 2JHJA 1YQRA 1KQJA 4E9FA 1PVSA 5CHZA 4DK9A 1WEGA 1LWVA 3FHGA 4B21A 2NOIA 2OFIA 2JHNA 1RRSA 4E9EA 1PU6A 1XQPA 1MPGA 3N5NX 1WEFA 1ORPA 1YQMA 2OFKA 4PIIA 4EJYA 3I0WA 4YPHA 4HSBA 4E9HA 2YG9A 4YOQA 4AIAA 3S6IA 4YPRA 1M3QA 3FHFA 1YQLA 4UOBA 3G0QA 5AN4A 2NOFA 3CW7A 2ABKA 1N3CA 1YQKA 4EA5A 1VRLA 3F10A 1HU0A 2NOZA 4B22A 4EA4A 3FSPA 2XHIA 1MUNA 1PU8A 3CWAA 1ORNA 3OH6A 1KO9A 1NKUA 1NGNA 4EVVA 4EJZA 1FN7A 1LWYA 5KN9A 1N3AA 3CWUA 1RRQA 3IH7A 5KN8A 4OFAA 5DPKA 3I0XA 4EW0A 1XG7A 1EBMA 1PU7A 2JG6A 3F0ZA 1MUYA 4B24A 3IHOA 3D4VA 4OFHA 4UNFA 3N0UA 1LMZA 1KEAA 1M3HA 3CVSA 3KNTA 1XQOA 1N39A 3CVTA 3OGDA 1KG7A 3CWSA 1KG5A 2NOHA 1P59A 2NOLA 1KG2A 1P7MA 1LWWA 4B23A 3OH9A 3CWTA 4OFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KG3 A;  4AI5 A;  2NOB A;  4AI4 A;  1MUD A;  1KG6 A;  2H56 A;  1DIZ A;  2I5W A;  4EW4 A;  1WEI A;  2NOE A;  1KG4 A;  2YG8 A;  3KTU A;  4E9G A;  2JHJ A;  1YQR A;  1KQJ A;  4E9F A;  1PVS A;  5CHZ A;  4DK9 A;  1WEG A;  1LWV A;  3FHG A;  4B21 A;  2NOI A;  2OFI A;  2JHN A;  1RRS A;  4E9E A;  1PU6 A;  1XQP A;  1MPG A;  3N5N X;  1WEF A;  1ORP A;  1YQM A;  2OFK A;  4PII A;  4EJY A;  3I0W A;  4YPH A;  4HSB A;  4E9H A;  2YG9 A;  4YOQ A;  4AIA A;  3S6I A;  4YPR A;  1M3Q A;  3FHF A;  1YQL A;  4UOB A;  3G0Q A;  5AN4 A;  2NOF A;  3CW7 A;  2ABK A;  1N3C A;  1YQK A;  4EA5 A;  1VRL A;  3F10 A;  1HU0 A;  2NOZ A;  4B22 A;  4EA4 A;  3FSP A;  2XHI A;  1MUN A;  1PU8 A;  3CWA A;  1ORN A;  3OH6 A;  1KO9 A;  1NKU A;  1NGN A;  4EVV A;  4EJZ A;  1FN7 A;  1LWY A;  5KN9 A;  1N3A A;  3CWU A;  1RRQ A;  3IH7 A;  5KN8 A;  4OFA A;  5DPK A;  3I0X A;  4EW0 A;  1XG7 A;  1EBM A;  1PU7 A;  2JG6 A;  3F0Z A;  1MUY A;  4B24 A;  3IHO A;  3D4V A;  4OFH A;  4UNF A;  3N0U A;  1LMZ A;  1KEA A;  1M3H A;  3CVS A;  3KNT A;  1XQO A;  1N39 A;  3CVT A;  3OGD A;  1KG7 A;  3CWS A;  1KG5 A;  2NOH A;  1P59 A;  2NOL A;  1KG2 A;  1P7M A;  1LWW A;  4B23 A;  3OH9 A;  3CWT A;  4OFE A; 
#chains in the Genus database with same CATH topology
 1KG3 A;  4AI5 A;  2NOB A;  4AI4 A;  1MUD A;  1KG6 A;  2H56 A;  5FRM A;  1DIZ A;  2I5W A;  4EW4 A;  1WEI A;  2NOE A;  1KG4 A;  4NZG A;  2YG8 A;  3KTU A;  4E9G A;  3OS1 A;  2JHJ A;  1YQR A;  1KQJ A;  4E9F A;  2W03 A;  1PVS A;  3OYF A;  3L2Q A;  5CHZ A;  1U84 A;  4DK9 A;  1WEG A;  1LWV A;  3OYD A;  3FHG A;  4B21 A;  2NOI A;  3OYE A;  2OFI A;  2JHN A;  4BE0 A;  1RRS A;  3OYM A;  4E9E A;  1PU6 A;  1XQP A;  3L2U A;  1MPG A;  3N5N X;  3OYA A;  4IKF A;  1WEF A;  4BE2 A;  1ORP A;  1YQM A;  2OFK A;  4PII A;  4EJY A;  3I0W A;  4BDY A;  4YPH A;  3NNQ A;  4HSB A;  4E9H A;  2YG9 A;  4E7H A;  4E7L A;  4BAC A;  4YOQ A;  4AIA A;  3S6I A;  5FRN A;  5FRO A;  4YPR A;  1M3Q A;  3OY9 A;  3OYC A;  3LCN A;  2JPS A;  3FHF A;  2V75 A;  1YQL A;  3OYL A;  4UOB A;  3G0Q A;  4E7J A;  3S3N A;  5AN4 A;  2NOF A;  3CW7 A;  2ABK A;  1N3C A;  1YQK A;  4EA5 A;  1VRL A;  3F10 A;  3VW4 A;  3OS0 A;  3OS2 A;  1HU0 A;  3OYB A;  2NOZ A;  4BE1 A;  4B22 A;  4EA4 A;  3FSP A;  3OYI A;  2XHI A;  3OYN A;  1MUN A;  1PU8 A;  3CWA A;  4ZTF A;  3OH6 A;  4E7I A;  1KO9 A;  3S3M A;  1ORN A;  1NKU A;  1NGN A;  4EVV A;  4EJZ A;  1FN7 A;  1LWY A;  5KN9 A;  1N3A A;  3CWU A;  2W04 A;  1RRQ A;  4E7K A;  3IH7 A;  5KN8 A;  3L2R A;  4OFA A;  5DPK A;  3L2W A;  3I0X A;  4EW0 A;  1XG7 A;  1EBM A;  1PU7 A;  3OYK A;  3L2V A;  2JG6 A;  3F0Z A;  1MUY A;  4B24 A;  3IHO A;  4BDZ A;  3D4V A;  3R2X C;  4UNF A;  4OFH A;  3N0U A;  1LMZ A;  3S3O A;  4ZTJ A;  1KEA A;  1M3H A;  3CVS A;  3KNT A;  1XQO A;  1N39 A;  3CVT A;  3OGD A;  1KG7 A;  3CWS A;  1KG5 A;  2NOH A;  3OYG A;  1P59 A;  2NOL A;  1KG2 A;  1P7M A;  1LWW A;  3OYJ A;  4B23 A;  3OH9 A;  3CWT A;  3OYH A;  4OFE A; 
#chains in the Genus database with same CATH homology
 1KG3 A;  4AI5 A;  2NOB A;  4AI4 A;  1MUD A;  1KG6 A;  2H56 A;  1DIZ A;  2I5W A;  4EW4 A;  1WEI A;  2NOE A;  1KG4 A;  2YG8 A;  3KTU A;  4E9G A;  2JHJ A;  1YQR A;  1KQJ A;  4E9F A;  1PVS A;  5CHZ A;  4DK9 A;  1WEG A;  1LWV A;  3FHG A;  4B21 A;  2NOI A;  2OFI A;  2JHN A;  1RRS A;  4E9E A;  1PU6 A;  1XQP A;  1MPG A;  3N5N X;  1WEF A;  1ORP A;  1YQM A;  2OFK A;  4PII A;  4EJY A;  3I0W A;  4YPH A;  4HSB A;  4E9H A;  2YG9 A;  4YOQ A;  4AIA A;  3S6I A;  4YPR A;  1M3Q A;  3FHF A;  1YQL A;  4UOB A;  3G0Q A;  5AN4 A;  2NOF A;  3CW7 A;  2ABK A;  1N3C A;  1YQK A;  4EA5 A;  1VRL A;  3F10 A;  1HU0 A;  2NOZ A;  4B22 A;  4EA4 A;  3FSP A;  2XHI A;  1MUN A;  1PU8 A;  3CWA A;  1ORN A;  3OH6 A;  1KO9 A;  1NKU A;  1NGN A;  4EVV A;  4EJZ A;  1FN7 A;  1LWY A;  5KN9 A;  1N3A A;  3CWU A;  1RRQ A;  3IH7 A;  5KN8 A;  4OFA A;  5DPK A;  3I0X A;  4EW0 A;  1XG7 A;  1EBM A;  1PU7 A;  2JG6 A;  3F0Z A;  1MUY A;  4B24 A;  3IHO A;  3D4V A;  4OFH A;  4UNF A;  3N0U A;  1LMZ A;  1KEA A;  1M3H A;  3CVS A;  3KNT A;  1XQO A;  1N39 A;  3CVT A;  3OGD A;  1KG7 A;  3CWS A;  1KG5 A;  2NOH A;  1P59 A;  2NOL A;  1KG2 A;  1P7M A;  1LWW A;  4B23 A;  3OH9 A;  3CWT A;  4OFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...