3I0WA

Crystal structure of clostridium acetobutylicum 8-oxoguanine glycosylase/lyase in complex with dsdna containing cytosine opposite to 8-oxog
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
290
structure length
290
Chain Sequence
MDFDMIEEKKDSVIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEKVVEVQKIGEDVVIYNINEEEFKNVWSEYFDLYRDYGEIKKELSRDPLLKKSVDFGEGIRILRQDPFEILLSFIISANNRIPMIKKCINNISEKAGKKLEYKGKIYYAFPTVDKLHEFTEKDFEECTAGFRAKYLKDTVDRIYNGELNLEYIKSLNDNECHEELKKFMGVGPQVADCIMLFSMQKYSAFPVDTWVKKAMMSLYVAPDVSLKKIRDFGREKFGSLSGFAQQYLFYYARENNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase,lyase/dna
molecule keywords 8-oxoguanine-DNA-glycosylase
publication title Structural basis for the lack of opposite base specificity of Clostridium acetobutylicum 8-oxoguanine DNA glycosylase.
pubmed doi rcsb
source organism Clostridium acetobutylicum
total genus 107
structure length 290
sequence length 290
ec nomenclature ec 3.2.2.-:
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3i0wA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 3i0wA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3i0wA01
4EA4A 1MUDA 5KN9A 1RRQA 1N3AA 3CW7A 4B21A 4EW0A 4EW4A 1KEAA 1LWWA 1XQPA 2JHNA 1EBMA 4HSBA 1KG4A 4PIIA 4E9EA 2NOZA 1P59A 3CWAA 5CHZA 3KNTA 1MPGA 2NOHA 2I5WA 1YQRA 4AI5A 1VRLA 1PU8A 1N3CA 4OFEA 1YQMA 2YG8A 3OH6A 3S6IA 1WEIA 4EA5A 1NKUA 1WEFA 1M3HA 4AIAA 4E9FA 4E9GA 4B23A 4E9HA 1HU0A 5AN4A 4DK9A 3I0XA 2YG9A 3CWTA 3I0WA 1LWYA 1WEGA 1XQOA 3FHGA 1N39A 1P7MA 1FN7A 1KG5A 2H56A 2JG6A 4EVVA 4UNFA 3N5NX 3IHOA 3OH9A 3D4VA 1ORNA 3KTUA 2XHIA 1DIZA 4B22A 1LWVA 3CWSA 4EJZA 1KQJA 3FSPA 1MUYA 2OFIA 1PU6A 3CVSA 5DPKA 4B24A 1PVSA 4YOQA 2ABKA 1M3QA 2JHJA 1YQLA 3FHFA 1MUNA 3F0ZA 2OFKA 3IH7A 2NOEA 1KG6A 2NOIA 2NOBA 2NOFA 1KG3A 1PU7A 3OGDA 1XG7A 4UOBA 1KG7A 3F10A 1ORPA 1LMZA 4OFHA 3G0QA 3N0UA 4EJYA 4YPHA 4OFAA 1RRSA 2NOLA 1KG2A 3CWUA 1NGNA 1KO9A 4AI4A 3CVTA 4YPRA 5KN8A 1YQKA
chains in the Genus database with same CATH superfamily
4EA4A 2DKAA 2IV8A 3CW7A 4EW4A 1KEAA 2V9JA 2QRDA 2NOZA 1C4GA 1MPGA 3DPTA 2Z0FA 4MRQA 1B9KA 2I5WA 4AI5A 1QN7A 1LXTA 2YG8A 3OYGA 4BE1A 1WEIA 3D7QA 1UL7A 1NKUA 1QNBA 2H5AX 3EIKA 2W03A 1UT7A 3DPUA 4IL8A 4DK9A 3OCIA 3HS8A 1CDWA 4EAKA 5HSHA 3OSTA 2OOYA 1FN7A 1PCJX 4UNFA 5IYBP 1KFIA 3KTUA 3T4NA 3KRMA 1LWVA 4EJZA 2HZMA 3L2UA 1KQJA 5FRMA 3FSPA 2H4LX 2OFIA 4IKFA 4B24A 3OYLA 3S3MA 2QREA 2DKCA 1C47A 5EPCA 4EALA 3C04A 3LCNA 1QN4A 3OYIA 1KG3A 1PU7A 1TBAB 1KYFA 2O3OA 3VN5A 2EHBD 3OYNA 4EJYA 1RRSA 1E42A 4D7RA 1VOLB 3OS2A 2G30A 2FKFA 1P5DX 2QR1A 4EAJA 1KG2A 4AI4A 1TBPA 3CVTA 1VTOA 1U84A 4RODB 5KN9A 1NGMA 3ULXA 2JHNA 1EBMA 4HSBA 1KG4A 4PIIA 3L2VA 4BDZA 2QLVA 3KNTA 1VKLA 2NOHA 1YQRA 4OFEA 1YQMA 2YH5A 3S6IA 4QG5A 4EA5A 1M3HA 4AIAA 3OYAA 1QTPA 4ZTJA 3PDKA 1UT4A 2F7LA 4BACA 4TPSA 3CWTA 1LWYA 1EUVA 3L2QA 1QN9A 3OYDA 2IV9A 3FHGA 2MJ7A 3H1ZA 1P7MA 2H56A 3IHOA 3D4VA 1DIZA 1JFIC 4WX8A 4ROCB 5FRNA 1TUOA 4EAIA 3CVSA 1QN8A 1V5SA 3NNQA 5KL0A 3FHFA 1D3UA 4E7KA 1AISA 4DULA 2NOFA 2V8QA 5BMPA 4UOBA 3F10A 4OFHA 3ENOC 3N0UA 3SNSA 4B0AA 3CWUA 2QRCA 5JMVD 4EAGA 2JOIA 3ENCA 1YQKA 4CFFA 3OY9A 4WXAA 3OYHA 2V75A 5IYDP 5F9CA 3OS0A 1RRQA 1N3AA 2R5XA 3BKQX 4B21A 4ROEB 1LWWA 2D0CA 1P59A 3EAYA 2YA3A 4C7PA 2DKDA 3UW2A 2JPIA 2FUVA 1PU8A 3I3WA 3RSMA 3OH6A 3N89A 2Y8QA 2MZ8A 3OYCA 1WEFA 1JDYA 4E9GA 4B23A 4E9HA 4ZTFA 1HU0A 5AN4A 2FKMX 3OYKA 4E7IA 1WEGA 1VOKA 1P5GX 1KG5A 2JG6A 2Y8LA 2XHIA 1QNAA 4B22A 4BJUA 1KFQA 1XSZA 1PU6A 2ZFDB 3NA5A 5DPKA 1PVSA 4YOQA 2ABKA 2NVMA 1KYDA 1RM1A 1M3QA 2JHJA 1YQLA 1T6AA 1MUNA 3OYEA 3F0ZA 2OFKA 1KG6A 2NOBA 3L2RA 1QN3A 1YTFA 4D7QA 4BDYA 1C9BB 1LMZA 3OLPA 3OYFA 2HL8A 4YPHA 4OFAA 5BMNA 4PY5A 2NOLA 3OS1A 1PCZA 2D0AA 4I8OA 3R2XC 3L2WA 1R4XA 1KO9A 2HL9A 2OOXA 4E7HA 1MUDA 3VW4A 3PMGA 1QN5A 4EW0A 1XQPA 1NH2A 4E9EA 4HJHA 3CWAA 5CHZA 1WQAA 3RPJA 1VRLA 1VTLE 1J3MA 1N3CA 1QN6A 3HS9A 1K2YX 1KY6A 1MP9A 1QTSA 4E9FA 1M5Q1 3OSMA 2NWVA 1YTBA 3S3NA 4NZGA 3I0XA 2YG9A 1PZDA 1QNCA 3I0WA 2PWWA 3OSEA 1XQOA 1W80A 1N39A 4BE2A 2LAEA 5FROA 3OYBA 4EVVA 2HKPA 3N5NX 3OH9A 1ORNA 1K35A 3CWSA 2FGTA 4E7JA 1MUYA 3TDHA 5IYCP 2JPSA 2Z8UA 2W04A 1KYUA 2VJ0A 1Q9UA 3TE5A 3IH7A 2NOEA 1WJWA 3OYMA 4WZSD 3OC3C 1NVPA 1QNEA 2HZSA 1TGHA 4E7LA 2NOIA 1KY7A 3OGDA 1XG7A 1KG7A 1ORPA 5JN5A 2V92A 3G0QA 2NLVA 4BE0A 3S3OA 4Q11A 3ASMA 1PCMX 1NGNA 2D0BA 4YPRA 5KN8A 3OYJA
chains in the Genus database with same CATH topology
4EA4A 1MUDA 4RODB 5IYDP 5KN9A 2IV8A 1RRQA 1NGMA 1N3AA 3CW7A 3ULXA 1QN5A 4B21A 4EW0A 4EW4A 1KEAA 1LWWA 1XQPA 4ROEB 2JHNA 1EBMA 4HSBA 2D0CA 1NH2A 1KG4A 4PIIA 4E9EA 2NOZA 1P59A 3CWAA 5CHZA 3KNTA 3RPJA 1MPGA 3DPTA 2NOHA 1B9KA 2I5WA 1YQRA 4AI5A 1VRLA 1QN7A 1VTLE 1PU8A 1N3CA 4OFEA 3HS9A 1QN6A 1YQMA 2YH5A 2YG8A 3OH6A 3N89A 3S6IA 1WEIA 2MZ8A 4EA5A 1NKUA 1KY6A 1MP9A 1WEFA 1M3HA 1QNBA 3EIKA 4AIAA 1QTSA 4E9FA 4E9GA 4B23A 3OSMA 1UT7A 3DPUA 1QTPA 1YTBA 4E9HA 1UT4A 1HU0A 5AN4A 4DK9A 3I0XA 2YG9A 4TPSA 1PZDA 3CWTA 3I0WA 1LWYA 1QNCA 3OCIA 3HS8A 1CDWA 1WEGA 1QN9A 1XQOA 2IV9A 3FHGA 1VOKA 1W80A 1N39A 3OSTA 2MJ7A 3H1ZA 1P7MA 1FN7A 1KG5A 2H56A 2JG6A 4EVVA 2LAEA 4UNFA 5IYBP 3N5NX 3IHOA 3OH9A 3D4VA 1ORNA 3KTUA 2XHIA 1QNAA 1DIZA 3KRMA 4B22A 4ROCB 1LWVA 1JFIC 3CWSA 4EJZA 2HZMA 2FGTA 1KQJA 3FSPA 1MUYA 2OFIA 1PU6A 3CVSA 5IYCP 5DPKA 4B24A 1QN8A 2Z8UA 1PVSA 4YOQA 2ABKA 1KYUA 2VJ0A 1KYDA 1RM1A 1M3QA 2JHJA 1YQLA 3FHFA 1D3UA 1MUNA 3F0ZA 2OFKA 3IH7A 2NOEA 4WZSD 3OC3C 1NVPA 1AISA 1KG6A 2HZSA 4DULA 1QNEA 1QN4A 1TGHA 2NOIA 1KY7A 2NOBA 2NOFA 1KG3A 1QN3A 1PU7A 1TBAB 1KYFA 1YTFA 3OGDA 1XG7A 2O3OA 4UOBA 1KG7A 1C9BB 3F10A 3VN5A 1ORPA 1LMZA 4OFHA 3G0QA 3N0UA 4EJYA 4YPHA 4OFAA 1RRSA 1E42A 1VOLB 4PY5A 3SNSA 2NOLA 2G30A 1PCZA 2D0AA 4B0AA 4Q11A 1KG2A 3ASMA 3CWUA 4I8OA 1R4XA 1NGNA 1KO9A 4AI4A 2D0BA 1TBPA 3CVTA 1VTOA 2JOIA 4YPRA 5KN8A 1YQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EA4 A;  1MUD A;  5KN9 A;  1RRQ A;  1N3A A;  3CW7 A;  4B21 A;  4EW0 A;  4EW4 A;  1KEA A;  1LWW A;  1XQP A;  2JHN A;  1EBM A;  4HSB A;  1KG4 A;  4PII A;  4E9E A;  2NOZ A;  1P59 A;  3CWA A;  5CHZ A;  3KNT A;  1MPG A;  2NOH A;  2I5W A;  1YQR A;  4AI5 A;  1VRL A;  1PU8 A;  1N3C A;  4OFE A;  1YQM A;  2YG8 A;  3OH6 A;  3S6I A;  1WEI A;  4EA5 A;  1NKU A;  1WEF A;  1M3H A;  4AIA A;  4E9F A;  4E9G A;  4B23 A;  4E9H A;  1HU0 A;  5AN4 A;  4DK9 A;  3I0X A;  2YG9 A;  3CWT A;  3I0W A;  1LWY A;  1WEG A;  1XQO A;  3FHG A;  1N39 A;  1P7M A;  1FN7 A;  1KG5 A;  2H56 A;  2JG6 A;  4EVV A;  4UNF A;  3N5N X;  3IHO A;  3OH9 A;  3D4V A;  1ORN A;  3KTU A;  2XHI A;  1DIZ A;  4B22 A;  1LWV A;  3CWS A;  4EJZ A;  1KQJ A;  3FSP A;  1MUY A;  2OFI A;  1PU6 A;  3CVS A;  5DPK A;  4B24 A;  1PVS A;  4YOQ A;  2ABK A;  1M3Q A;  2JHJ A;  1YQL A;  3FHF A;  1MUN A;  3F0Z A;  2OFK A;  3IH7 A;  2NOE A;  1KG6 A;  2NOI A;  2NOB A;  2NOF A;  1KG3 A;  1PU7 A;  3OGD A;  1XG7 A;  4UOB A;  1KG7 A;  3F10 A;  1ORP A;  1LMZ A;  4OFH A;  3G0Q A;  3N0U A;  4EJY A;  4YPH A;  4OFA A;  1RRS A;  2NOL A;  1KG2 A;  3CWU A;  1NGN A;  1KO9 A;  4AI4 A;  3CVT A;  4YPR A;  5KN8 A;  1YQK A; 
#chains in the Genus database with same CATH topology
 4EA4 A;  2DKA A;  2IV8 A;  3CW7 A;  4EW4 A;  1KEA A;  2V9J A;  2QRD A;  2NOZ A;  1C4G A;  1MPG A;  3DPT A;  2Z0F A;  4MRQ A;  1B9K A;  2I5W A;  4AI5 A;  1QN7 A;  1LXT A;  2YG8 A;  3OYG A;  4BE1 A;  1WEI A;  3D7Q A;  1UL7 A;  1NKU A;  1QNB A;  2H5A X;  3EIK A;  2W03 A;  1UT7 A;  3DPU A;  4IL8 A;  4DK9 A;  3OCI A;  3HS8 A;  1CDW A;  4EAK A;  5HSH A;  3OST A;  2OOY A;  1FN7 A;  1PCJ X;  4UNF A;  5IYB P;  1KFI A;  3KTU A;  3T4N A;  3KRM A;  1LWV A;  4EJZ A;  2HZM A;  3L2U A;  1KQJ A;  5FRM A;  3FSP A;  2H4L X;  2OFI A;  4IKF A;  4B24 A;  3OYL A;  3S3M A;  2QRE A;  2DKC A;  1C47 A;  5EPC A;  4EAL A;  3C04 A;  3LCN A;  1QN4 A;  3OYI A;  1KG3 A;  1PU7 A;  1TBA B;  1KYF A;  2O3O A;  3VN5 A;  2EHB D;  3OYN A;  4EJY A;  1RRS A;  1E42 A;  4D7R A;  1VOL B;  3OS2 A;  2G30 A;  2FKF A;  1P5D X;  2QR1 A;  4EAJ A;  1KG2 A;  4AI4 A;  1TBP A;  3CVT A;  1VTO A;  1U84 A;  4ROD B;  5KN9 A;  1NGM A;  3ULX A;  2JHN A;  1EBM A;  4HSB A;  1KG4 A;  4PII A;  3L2V A;  4BDZ A;  2QLV A;  3KNT A;  1VKL A;  2NOH A;  1YQR A;  4OFE A;  1YQM A;  2YH5 A;  3S6I A;  4QG5 A;  4EA5 A;  1M3H A;  4AIA A;  3OYA A;  1QTP A;  4ZTJ A;  3PDK A;  1UT4 A;  2F7L A;  4BAC A;  4TPS A;  3CWT A;  1LWY A;  1EUV A;  3L2Q A;  1QN9 A;  3OYD A;  2IV9 A;  3FHG A;  2MJ7 A;  3H1Z A;  1P7M A;  2H56 A;  3IHO A;  3D4V A;  1DIZ A;  1JFI C;  4WX8 A;  4ROC B;  5FRN A;  1TUO A;  4EAI A;  3CVS A;  1QN8 A;  1V5S A;  3NNQ A;  5KL0 A;  3FHF A;  1D3U A;  4E7K A;  1AIS A;  4DUL A;  2NOF A;  2V8Q A;  5BMP A;  4UOB A;  3F10 A;  4OFH A;  3ENO C;  3N0U A;  3SNS A;  4B0A A;  3CWU A;  2QRC A;  5JMV D;  4EAG A;  2JOI A;  3ENC A;  1YQK A;  4CFF A;  3OY9 A;  4WXA A;  3OYH A;  2V75 A;  5IYD P;  5F9C A;  3OS0 A;  1RRQ A;  1N3A A;  2R5X A;  3BKQ X;  4B21 A;  4ROE B;  1LWW A;  2D0C A;  1P59 A;  3EAY A;  2YA3 A;  4C7P A;  2DKD A;  3UW2 A;  2JPI A;  2FUV A;  1PU8 A;  3I3W A;  3RSM A;  3OH6 A;  3N89 A;  2Y8Q A;  2MZ8 A;  3OYC A;  1WEF A;  1JDY A;  4E9G A;  4B23 A;  4E9H A;  4ZTF A;  1HU0 A;  5AN4 A;  2FKM X;  3OYK A;  4E7I A;  1WEG A;  1VOK A;  1P5G X;  1KG5 A;  2JG6 A;  2Y8L A;  2XHI A;  1QNA A;  4B22 A;  4BJU A;  1KFQ A;  1XSZ A;  1PU6 A;  2ZFD B;  3NA5 A;  5DPK A;  1PVS A;  4YOQ A;  2ABK A;  2NVM A;  1KYD A;  1RM1 A;  1M3Q A;  2JHJ A;  1YQL A;  1T6A A;  1MUN A;  3OYE A;  3F0Z A;  2OFK A;  1KG6 A;  2NOB A;  3L2R A;  1QN3 A;  1YTF A;  4D7Q A;  4BDY A;  1C9B B;  1LMZ A;  3OLP A;  3OYF A;  2HL8 A;  4YPH A;  4OFA A;  5BMN A;  4PY5 A;  2NOL A;  3OS1 A;  1PCZ A;  2D0A A;  4I8O A;  3R2X C;  3L2W A;  1R4X A;  1KO9 A;  2HL9 A;  2OOX A;  4E7H A;  1MUD A;  3VW4 A;  3PMG A;  1QN5 A;  4EW0 A;  1XQP A;  1NH2 A;  4E9E A;  4HJH A;  3CWA A;  5CHZ A;  1WQA A;  3RPJ A;  1VRL A;  1VTL E;  1J3M A;  1N3C A;  1QN6 A;  3HS9 A;  1K2Y X;  1KY6 A;  1MP9 A;  1QTS A;  4E9F A;  1M5Q 1;  3OSM A;  2NWV A;  1YTB A;  3S3N A;  4NZG A;  3I0X A;  2YG9 A;  1PZD A;  1QNC A;  3I0W A;  2PWW A;  3OSE A;  1XQO A;  1W80 A;  1N39 A;  4BE2 A;  2LAE A;  5FRO A;  3OYB A;  4EVV A;  2HKP A;  3N5N X;  3OH9 A;  1ORN A;  1K35 A;  3CWS A;  2FGT A;  4E7J A;  1MUY A;  3TDH A;  5IYC P;  2JPS A;  2Z8U A;  2W04 A;  1KYU A;  2VJ0 A;  1Q9U A;  3TE5 A;  3IH7 A;  2NOE A;  1WJW A;  3OYM A;  4WZS D;  3OC3 C;  1NVP A;  1QNE A;  2HZS A;  1TGH A;  4E7L A;  2NOI A;  1KY7 A;  3OGD A;  1XG7 A;  1KG7 A;  1ORP A;  5JN5 A;  2V92 A;  3G0Q A;  2NLV A;  4BE0 A;  3S3O A;  4Q11 A;  3ASM A;  1PCM X;  1NGN A;  2D0B A;  4YPR A;  5KN8 A;  3OYJ A; 
#chains in the Genus database with same CATH homology
 4EA4 A;  1MUD A;  4ROD B;  5IYD P;  5KN9 A;  2IV8 A;  1RRQ A;  1NGM A;  1N3A A;  3CW7 A;  3ULX A;  1QN5 A;  4B21 A;  4EW0 A;  4EW4 A;  1KEA A;  1LWW A;  1XQP A;  4ROE B;  2JHN A;  1EBM A;  4HSB A;  2D0C A;  1NH2 A;  1KG4 A;  4PII A;  4E9E A;  2NOZ A;  1P59 A;  3CWA A;  5CHZ A;  3KNT A;  3RPJ A;  1MPG A;  3DPT A;  2NOH A;  1B9K A;  2I5W A;  1YQR A;  4AI5 A;  1VRL A;  1QN7 A;  1VTL E;  1PU8 A;  1N3C A;  4OFE A;  3HS9 A;  1QN6 A;  1YQM A;  2YH5 A;  2YG8 A;  3OH6 A;  3N89 A;  3S6I A;  1WEI A;  2MZ8 A;  4EA5 A;  1NKU A;  1KY6 A;  1MP9 A;  1WEF A;  1M3H A;  1QNB A;  3EIK A;  4AIA A;  1QTS A;  4E9F A;  4E9G A;  4B23 A;  3OSM A;  1UT7 A;  3DPU A;  1QTP A;  1YTB A;  4E9H A;  1UT4 A;  1HU0 A;  5AN4 A;  4DK9 A;  3I0X A;  2YG9 A;  4TPS A;  1PZD A;  3CWT A;  3I0W A;  1LWY A;  1QNC A;  3OCI A;  3HS8 A;  1CDW A;  1WEG A;  1QN9 A;  1XQO A;  2IV9 A;  3FHG A;  1VOK A;  1W80 A;  1N39 A;  3OST A;  2MJ7 A;  3H1Z A;  1P7M A;  1FN7 A;  1KG5 A;  2H56 A;  2JG6 A;  4EVV A;  2LAE A;  4UNF A;  5IYB P;  3N5N X;  3IHO A;  3OH9 A;  3D4V A;  1ORN A;  3KTU A;  2XHI A;  1QNA A;  1DIZ A;  3KRM A;  4B22 A;  4ROC B;  1LWV A;  1JFI C;  3CWS A;  4EJZ A;  2HZM A;  2FGT A;  1KQJ A;  3FSP A;  1MUY A;  2OFI A;  1PU6 A;  3CVS A;  5IYC P;  5DPK A;  4B24 A;  1QN8 A;  2Z8U A;  1PVS A;  4YOQ A;  2ABK A;  1KYU A;  2VJ0 A;  1KYD A;  1RM1 A;  1M3Q A;  2JHJ A;  1YQL A;  3FHF A;  1D3U A;  1MUN A;  3F0Z A;  2OFK A;  3IH7 A;  2NOE A;  4WZS D;  3OC3 C;  1NVP A;  1AIS A;  1KG6 A;  2HZS A;  4DUL A;  1QNE A;  1QN4 A;  1TGH A;  2NOI A;  1KY7 A;  2NOB A;  2NOF A;  1KG3 A;  1QN3 A;  1PU7 A;  1TBA B;  1KYF A;  1YTF A;  3OGD A;  1XG7 A;  2O3O A;  4UOB A;  1KG7 A;  1C9B B;  3F10 A;  3VN5 A;  1ORP A;  1LMZ A;  4OFH A;  3G0Q A;  3N0U A;  4EJY A;  4YPH A;  4OFA A;  1RRS A;  1E42 A;  1VOL B;  4PY5 A;  3SNS A;  2NOL A;  2G30 A;  1PCZ A;  2D0A A;  4B0A A;  4Q11 A;  1KG2 A;  3ASM A;  3CWU A;  4I8O A;  1R4X A;  1NGN A;  1KO9 A;  4AI4 A;  2D0B A;  1TBP A;  3CVT A;  1VTO A;  2JOI A;  4YPR A;  5KN8 A;  1YQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...