3I0WA

Crystal structure of clostridium acetobutylicum 8-oxoguanine glycosylase/lyase in complex with dsdna containing cytosine opposite to 8-oxog
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
290
structure length
290
Chain Sequence
MDFDMIEEKKDSVIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEKVVEVQKIGEDVVIYNINEEEFKNVWSEYFDLYRDYGEIKKELSRDPLLKKSVDFGEGIRILRQDPFEILLSFIISANNRIPMIKKCINNISEKAGKKLEYKGKIYYAFPTVDKLHEFTEKDFEECTAGFRAKYLKDTVDRIYNGELNLEYIKSLNDNECHEELKKFMGVGPQVADCIMLFSMQKYSAFPVDTWVKKAMMSLYVAPDVSLKKIRDFGREKFGSLSGFAQQYLFYYARENNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8-oxoguanine-DNA-glycosylase
publication title Structural basis for the lack of opposite base specificity of Clostridium acetobutylicum 8-oxoguanine DNA glycosylase.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase,lyase/dna
total genus 107
structure length 290
sequence length 290
ec nomenclature ec 3.2.2.-:
pdb deposition date 2009-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3i0wA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 3i0wA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3i0wA01
4AIAA 1KQJA 4OFHA 3KTUA 2NOIA 2YG9A 4YPRA 3CVTA 1ORNA 3N5NX 4OFEA 3S6IA 3OGDA 4EW0A 4B24A 1KG4A 3D4VA 4B23A 4B21A 3CVSA 4E9EA 1XG7A 1N3AA 4OFAA 1P7MA 1RRQA 1YQKA 1N3CA 3OH6A 1PU8A 4AI5A 4EJZA 2H56A 3IHOA 2I5WA 2XHIA 4EJYA 3F0ZA 1NGNA 1YQLA 3N0UA 3CWAA 2JHNA 3I0XA 4HSBA 1KEAA 3CW7A 3G0QA 2NOBA 1KG2A 1N39A 4EA5A 1MUDA 4EVVA 1LWYA 2ABKA 1WEGA 1KG3A 3F10A 1FN7A 3OH9A 4UNFA 4EA4A 5DPKA 1WEIA 1VRLA 1LWWA 4E9GA 1KG6A 5KN8A 4PIIA 2NOLA 2JG6A 1PU7A 1KG7A 4EW4A 5KN9A 3CWTA 3CWSA 2NOEA 4E9HA 2YG8A 1MUNA 1MPGA 3FHGA 4E9FA 1EBMA 1RRSA 1KG5A 4AI4A 1KO9A 3I0WA 4YOQA 1NKUA 2OFKA 1PU6A 2NOFA 1YQMA 2OFIA 2NOZA 1XQOA 2NOHA 3FHFA 1M3HA 3CWUA 1PVSA 1DIZA 1WEFA 5AN4A 1YQRA 4B22A 1MUYA 1M3QA 1ORPA 3KNTA 3IH7A 1P59A 1HU0A 2JHJA 1LWVA 1XQPA 5CHZA 4YPHA 4DK9A 3FSPA 1LMZA 4UOBA
chains in the Genus database with same CATH superfamily
1KQJA 2Y8QA 4EAIA 4YPRA 1QN7A 4MRQA 4OFEA 3RSMA 4E7LA 1KYDA 1KG4A 3EAYA 3PMGA 3OC3C 2ZFDB 4E9EA 4OFAA 5EPCA 3OYEA 5BMPA 3HS9A 1N3CA 3OYDA 3L2VA 3OCIA 3L2WA 1T6AA 2NLVA 1KG2A 3TDHA 1N39A 1Q9UA 3C04A 2QLVA 4EVVA 4NZGA 2HZSA 3VN5A 5DPKA 4ROEB 2OOXA 2V92A 2NOLA 3OYNA 4QG5A 4IKFA 3CWSA 3OY9A 3ENCA 1QTPA 1QNEA 1VOLB 2YH5A 1NKUA 1PU6A 2FGTA 5HSHA 3FHFA 2R5XA 3CWUA 3UW2A 4ROCB 2D0BA 3OYGA 1YQRA 4B22A 3OYLA 1KYUA 3EIKA 4D7QA 1HU0A 1WJWA 2YA3A 5CHZA 4IL8A 4TPSA 1LMZA 2D0CA 2HL9A 4AIAA 3KTUA 2YG9A 3CVTA 1C47A 1ORNA 3PDKA 3OGDA 3OYFA 4B24A 3ENOC 4B21A 4E7KA 1N3AA 1XG7A 1RRQA 1YQKA 3NA5A 1D3UA 4EJZA 2I5WA 2XHIA 1YTFA 3OYBA 1QNCA 1PCZA 3N0UA 1KY7A 2V8QA 4HSBA 1YTBA 1TBAB 4RODB 3S3OA 1NVPA 1NGMA 1MUDA 2IV8A 1KG3A 3F10A 1FN7A 1W80A 1LWWA 1P5GX 1R4XA 2OOYA 1JDYA 5KL0A 2H4LX 2JG6A 1KG7A 2YG8A 1MPGA 1K35A 3L2RA 1KYFA 3DPUA 4CFFA 1PCMX 2NOFA 4I8OA 1P5DX 1PVSA 1WEFA 2V9JA 1MUYA 4ZTJA 3OSTA 1KFIA 2Z8UA 3KNTA 4BDZA 1C9BB 4DULA 4C7PA 2PWWA 5IYDP 3OYKA 3D7QA 4EALA 2EHBD 3I3WA 2HL8A 1VKLA 3D4VA 4B23A 3HS8A 3CVSA 1P7MA 3DPTA 3OH6A 4AI5A 1XSZA 2H56A 3IHOA 2O3OA 4BE1A 3F0ZA 1YQLA 1QN4A 1RM1A 4BE2A 3I0XA 4BE0A 2DKCA 3RPJA 3BKQX 4EA5A 4BACA 1LWYA 2ABKA 1C4GA 3OH9A 4UNFA 3VW4A 1WEIA 2H5AX 3OYJA 3L2UA 3TE5A 1KG6A 1TGHA 1QN9A 1QTSA 2VJ0A 1B9KA 2FUVA 1JFIC 1PU7A 3OYAA 5KN9A 2NOEA 1QN3A 1UL7A 3FHGA 2QRDA 1QN5A 4E9FA 1K2YX 2Y8LA 4EAGA 1RRSA 1KO9A 3OS2A 1TUOA 2FKFA 1KFQA 3OS1A 1YQMA 3T4NA 2NOZA 1KY6A 3OYIA 4HJHA 1UT4A 2QREA 3S3NA 1M3QA 2QR1A 4E7JA 1UT7A 1XQPA 2DKDA 1AISA 4YPHA 2QRCA 4WZSD 3FSPA 3S3MA 2MZ8A 4OFHA 2HKPA 2NWVA 2NOIA 1TBPA 3LCNA 3R2XC 4Q11A 3N5NX 3S6IA 3ULXA 4EW0A 1U84A 1QN8A 3OSMA 2W03A 3SNSA 1VTOA 4BJUA 4E7HA 1CDWA 5F9CA 1PU8A 5JN5A 1MP9A 5FRNA 2IV9A 3OYHA 1PCJX 1V5SA 1EUVA 2G30A 5JMVD 4EJYA 1NGNA 3L2QA 3CWAA 1VTLE 2JHNA 2JPSA 1KEAA 3CW7A 3G0QA 2NOBA 2F7LA 2JOIA 1M5Q1 4WX8A 5IYCP 5FROA 1QNBA 1VOKA 1WEGA 2LAEA 3H1ZA 4EA4A 3OSEA 3OYCA 2D0AA 1VRLA 4E7IA 4E9GA 1WQAA 4WXAA 4EAJA 5KN8A 1J3MA 4PIIA 5IYBP 3OYMA 4EW4A 3CWTA 4E9HA 1MUNA 4PY5A 4B0AA 4ZTFA 3NNQA 5FRMA 3KRMA 2DKAA 2V75A 1EBMA 2W04A 1KG5A 3OLPA 4AI4A 3I0WA 1QNAA 4YOQA 2OFKA 3ASMA 3N89A 1QN6A 4BDYA 1E42A 2OFIA 1XQOA 2NOHA 1M3HA 1NH2A 5BMNA 2NVMA 1DIZA 1PZDA 2Z0FA 3OS0A 5AN4A 1ORPA 3IH7A 1P59A 2HZMA 2JHJA 1LWVA 4EAKA 2FKMX 1LXTA 4D7RA 2MJ7A 4DK9A 2JPIA 4UOBA
chains in the Genus database with same CATH topology
2MZ8A 4AIAA 1KQJA 4OFHA 3KTUA 2NOIA 2YG9A 1TBPA 4YPRA 3CVTA 4Q11A 1QN7A 1ORNA 3N5NX 4OFEA 3S6IA 3OGDA 3ULXA 4EW0A 4B24A 1KYDA 1KG4A 3D4VA 4B23A 4B21A 1QN8A 3HS8A 3OSMA 3OC3C 3CVSA 4E9EA 1XG7A 1N3AA 3SNSA 4OFAA 1P7MA 3DPTA 1VTOA 1RRQA 1YQKA 3HS9A 1CDWA 1N3CA 3OH6A 1D3UA 1PU8A 4AI5A 4EJZA 2H56A 1MP9A 3IHOA 2IV9A 2O3OA 2I5WA 2XHIA 2G30A 1YTFA 4EJYA 1QNCA 3F0ZA 1NGNA 1YQLA 1PCZA 3N0UA 3CWAA 2JHNA 1KY7A 3OCIA 1VTLE 1RM1A 1QN4A 3I0XA 4HSBA 1KEAA 3CW7A 1TBAB 1YTBA 3G0QA 4RODB 2NOBA 3RPJA 1KG2A 2JOIA 1NVPA 1N39A 5IYCP 1NGMA 4EA5A 1QNBA 1VOKA 1MUDA 4EVVA 1LWYA 2ABKA 2IV8A 1WEGA 1KG3A 3F10A 2HZSA 2LAEA 1FN7A 1W80A 3H1ZA 3OH9A 4UNFA 4EA4A 3VN5A 5DPKA 1WEIA 2D0AA 1VRLA 4ROEB 1LWWA 4E9GA 1KG6A 1TGHA 1R4XA 1QN9A 5KN8A 1QTSA 2VJ0A 1B9KA 4PIIA 2NOLA 5IYBP 2JG6A 1JFIC 1PU7A 1KG7A 4EW4A 5KN9A 3CWTA 2D0CA 3CWSA 2NOEA 4E9HA 1QN3A 2YG8A 1MUNA 4PY5A 1MPGA 4B0AA 1KYFA 3FHGA 1QN5A 3KRMA 3DPUA 1QTPA 4E9FA 1EBMA 1QNEA 1VOLB 1RRSA 1KG5A 2YH5A 4AI4A 1KO9A 3I0WA 1QNAA 4YOQA 1NKUA 2OFKA 3ASMA 3N89A 1QN6A 1PU6A 2NOFA 4I8OA 1YQMA 2FGTA 1E42A 2OFIA 2NOZA 1XQOA 1KY6A 2NOHA 3FHFA 1M3HA 1NH2A 3CWUA 1PVSA 1UT4A 1DIZA 1WEFA 1PZDA 4ROCB 2D0BA 5AN4A 1YQRA 4B22A 1MUYA 1M3QA 1KYUA 1ORPA 3OSTA 2Z8UA 3KNTA 1UT7A 3IH7A 3EIKA 1P59A 1HU0A 2HZMA 2JHJA 1C9BB 1LWVA 1XQPA 4DULA 1AISA 5CHZA 4YPHA 4TPSA 2MJ7A 4WZSD 4DK9A 3FSPA 1LMZA 4UOBA 5IYDP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AIA A;  1KQJ A;  4OFH A;  3KTU A;  2NOI A;  2YG9 A;  4YPR A;  3CVT A;  1ORN A;  3N5N X;  4OFE A;  3S6I A;  3OGD A;  4EW0 A;  4B24 A;  1KG4 A;  3D4V A;  4B23 A;  4B21 A;  3CVS A;  4E9E A;  1XG7 A;  1N3A A;  4OFA A;  1P7M A;  1RRQ A;  1YQK A;  1N3C A;  3OH6 A;  1PU8 A;  4AI5 A;  4EJZ A;  2H56 A;  3IHO A;  2I5W A;  2XHI A;  4EJY A;  3F0Z A;  1NGN A;  1YQL A;  3N0U A;  3CWA A;  2JHN A;  3I0X A;  4HSB A;  1KEA A;  3CW7 A;  3G0Q A;  2NOB A;  1KG2 A;  1N39 A;  4EA5 A;  1MUD A;  4EVV A;  1LWY A;  2ABK A;  1WEG A;  1KG3 A;  3F10 A;  1FN7 A;  3OH9 A;  4UNF A;  4EA4 A;  5DPK A;  1WEI A;  1VRL A;  1LWW A;  4E9G A;  1KG6 A;  5KN8 A;  4PII A;  2NOL A;  2JG6 A;  1PU7 A;  1KG7 A;  4EW4 A;  5KN9 A;  3CWT A;  3CWS A;  2NOE A;  4E9H A;  2YG8 A;  1MUN A;  1MPG A;  3FHG A;  4E9F A;  1EBM A;  1RRS A;  1KG5 A;  4AI4 A;  1KO9 A;  3I0W A;  4YOQ A;  1NKU A;  2OFK A;  1PU6 A;  2NOF A;  1YQM A;  2OFI A;  2NOZ A;  1XQO A;  2NOH A;  3FHF A;  1M3H A;  3CWU A;  1PVS A;  1DIZ A;  1WEF A;  5AN4 A;  1YQR A;  4B22 A;  1MUY A;  1M3Q A;  1ORP A;  3KNT A;  3IH7 A;  1P59 A;  1HU0 A;  2JHJ A;  1LWV A;  1XQP A;  5CHZ A;  4YPH A;  4DK9 A;  3FSP A;  1LMZ A;  4UOB A; 
#chains in the Genus database with same CATH topology
 1KQJ A;  2Y8Q A;  4EAI A;  4YPR A;  1QN7 A;  4MRQ A;  4OFE A;  3RSM A;  4E7L A;  1KYD A;  1KG4 A;  3EAY A;  3PMG A;  3OC3 C;  2ZFD B;  4E9E A;  4OFA A;  5EPC A;  3OYE A;  5BMP A;  3HS9 A;  1N3C A;  3OYD A;  3L2V A;  3OCI A;  3L2W A;  1T6A A;  2NLV A;  1KG2 A;  3TDH A;  1N39 A;  1Q9U A;  3C04 A;  2QLV A;  4EVV A;  4NZG A;  2HZS A;  3VN5 A;  5DPK A;  4ROE B;  2OOX A;  2V92 A;  2NOL A;  3OYN A;  4QG5 A;  4IKF A;  3CWS A;  3OY9 A;  3ENC A;  1QTP A;  1QNE A;  1VOL B;  2YH5 A;  1NKU A;  1PU6 A;  2FGT A;  5HSH A;  3FHF A;  2R5X A;  3CWU A;  3UW2 A;  4ROC B;  2D0B A;  3OYG A;  1YQR A;  4B22 A;  3OYL A;  1KYU A;  3EIK A;  4D7Q A;  1HU0 A;  1WJW A;  2YA3 A;  5CHZ A;  4IL8 A;  4TPS A;  1LMZ A;  2D0C A;  2HL9 A;  4AIA A;  3KTU A;  2YG9 A;  3CVT A;  1C47 A;  1ORN A;  3PDK A;  3OGD A;  3OYF A;  4B24 A;  3ENO C;  4B21 A;  4E7K A;  1N3A A;  1XG7 A;  1RRQ A;  1YQK A;  3NA5 A;  1D3U A;  4EJZ A;  2I5W A;  2XHI A;  1YTF A;  3OYB A;  1QNC A;  1PCZ A;  3N0U A;  1KY7 A;  2V8Q A;  4HSB A;  1YTB A;  1TBA B;  4ROD B;  3S3O A;  1NVP A;  1NGM A;  1MUD A;  2IV8 A;  1KG3 A;  3F10 A;  1FN7 A;  1W80 A;  1LWW A;  1P5G X;  1R4X A;  2OOY A;  1JDY A;  5KL0 A;  2H4L X;  2JG6 A;  1KG7 A;  2YG8 A;  1MPG A;  1K35 A;  3L2R A;  1KYF A;  3DPU A;  4CFF A;  1PCM X;  2NOF A;  4I8O A;  1P5D X;  1PVS A;  1WEF A;  2V9J A;  1MUY A;  4ZTJ A;  3OST A;  1KFI A;  2Z8U A;  3KNT A;  4BDZ A;  1C9B B;  4DUL A;  4C7P A;  2PWW A;  5IYD P;  3OYK A;  3D7Q A;  4EAL A;  2EHB D;  3I3W A;  2HL8 A;  1VKL A;  3D4V A;  4B23 A;  3HS8 A;  3CVS A;  1P7M A;  3DPT A;  3OH6 A;  4AI5 A;  1XSZ A;  2H56 A;  3IHO A;  2O3O A;  4BE1 A;  3F0Z A;  1YQL A;  1QN4 A;  1RM1 A;  4BE2 A;  3I0X A;  4BE0 A;  2DKC A;  3RPJ A;  3BKQ X;  4EA5 A;  4BAC A;  1LWY A;  2ABK A;  1C4G A;  3OH9 A;  4UNF A;  3VW4 A;  1WEI A;  2H5A X;  3OYJ A;  3L2U A;  3TE5 A;  1KG6 A;  1TGH A;  1QN9 A;  1QTS A;  2VJ0 A;  1B9K A;  2FUV A;  1JFI C;  1PU7 A;  3OYA A;  5KN9 A;  2NOE A;  1QN3 A;  1UL7 A;  3FHG A;  2QRD A;  1QN5 A;  4E9F A;  1K2Y X;  2Y8L A;  4EAG A;  1RRS A;  1KO9 A;  3OS2 A;  1TUO A;  2FKF A;  1KFQ A;  3OS1 A;  1YQM A;  3T4N A;  2NOZ A;  1KY6 A;  3OYI A;  4HJH A;  1UT4 A;  2QRE A;  3S3N A;  1M3Q A;  2QR1 A;  4E7J A;  1UT7 A;  1XQP A;  2DKD A;  1AIS A;  4YPH A;  2QRC A;  4WZS D;  3FSP A;  3S3M A;  2MZ8 A;  4OFH A;  2HKP A;  2NWV A;  2NOI A;  1TBP A;  3LCN A;  3R2X C;  4Q11 A;  3N5N X;  3S6I A;  3ULX A;  4EW0 A;  1U84 A;  1QN8 A;  3OSM A;  2W03 A;  3SNS A;  1VTO A;  4BJU A;  4E7H A;  1CDW A;  5F9C A;  1PU8 A;  5JN5 A;  1MP9 A;  5FRN A;  2IV9 A;  3OYH A;  1PCJ X;  1V5S A;  1EUV A;  2G30 A;  5JMV D;  4EJY A;  1NGN A;  3L2Q A;  3CWA A;  1VTL E;  2JHN A;  2JPS A;  1KEA A;  3CW7 A;  3G0Q A;  2NOB A;  2F7L A;  2JOI A;  1M5Q 1;  4WX8 A;  5IYC P;  5FRO A;  1QNB A;  1VOK A;  1WEG A;  2LAE A;  3H1Z A;  4EA4 A;  3OSE A;  3OYC A;  2D0A A;  1VRL A;  4E7I A;  4E9G A;  1WQA A;  4WXA A;  4EAJ A;  5KN8 A;  1J3M A;  4PII A;  5IYB P;  3OYM A;  4EW4 A;  3CWT A;  4E9H A;  1MUN A;  4PY5 A;  4B0A A;  4ZTF A;  3NNQ A;  5FRM A;  3KRM A;  2DKA A;  2V75 A;  1EBM A;  2W04 A;  1KG5 A;  3OLP A;  4AI4 A;  3I0W A;  1QNA A;  4YOQ A;  2OFK A;  3ASM A;  3N89 A;  1QN6 A;  4BDY A;  1E42 A;  2OFI A;  1XQO A;  2NOH A;  1M3H A;  1NH2 A;  5BMN A;  2NVM A;  1DIZ A;  1PZD A;  2Z0F A;  3OS0 A;  5AN4 A;  1ORP A;  3IH7 A;  1P59 A;  2HZM A;  2JHJ A;  1LWV A;  4EAK A;  2FKM X;  1LXT A;  4D7R A;  2MJ7 A;  4DK9 A;  2JPI A;  4UOB A; 
#chains in the Genus database with same CATH homology
 2MZ8 A;  4AIA A;  1KQJ A;  4OFH A;  3KTU A;  2NOI A;  2YG9 A;  1TBP A;  4YPR A;  3CVT A;  4Q11 A;  1QN7 A;  1ORN A;  3N5N X;  4OFE A;  3S6I A;  3OGD A;  3ULX A;  4EW0 A;  4B24 A;  1KYD A;  1KG4 A;  3D4V A;  4B23 A;  4B21 A;  1QN8 A;  3HS8 A;  3OSM A;  3OC3 C;  3CVS A;  4E9E A;  1XG7 A;  1N3A A;  3SNS A;  4OFA A;  1P7M A;  3DPT A;  1VTO A;  1RRQ A;  1YQK A;  3HS9 A;  1CDW A;  1N3C A;  3OH6 A;  1D3U A;  1PU8 A;  4AI5 A;  4EJZ A;  2H56 A;  1MP9 A;  3IHO A;  2IV9 A;  2O3O A;  2I5W A;  2XHI A;  2G30 A;  1YTF A;  4EJY A;  1QNC A;  3F0Z A;  1NGN A;  1YQL A;  1PCZ A;  3N0U A;  3CWA A;  2JHN A;  1KY7 A;  3OCI A;  1VTL E;  1RM1 A;  1QN4 A;  3I0X A;  4HSB A;  1KEA A;  3CW7 A;  1TBA B;  1YTB A;  3G0Q A;  4ROD B;  2NOB A;  3RPJ A;  1KG2 A;  2JOI A;  1NVP A;  1N39 A;  5IYC P;  1NGM A;  4EA5 A;  1QNB A;  1VOK A;  1MUD A;  4EVV A;  1LWY A;  2ABK A;  2IV8 A;  1WEG A;  1KG3 A;  3F10 A;  2HZS A;  2LAE A;  1FN7 A;  1W80 A;  3H1Z A;  3OH9 A;  4UNF A;  4EA4 A;  3VN5 A;  5DPK A;  1WEI A;  2D0A A;  1VRL A;  4ROE B;  1LWW A;  4E9G A;  1KG6 A;  1TGH A;  1R4X A;  1QN9 A;  5KN8 A;  1QTS A;  2VJ0 A;  1B9K A;  4PII A;  2NOL A;  5IYB P;  2JG6 A;  1JFI C;  1PU7 A;  1KG7 A;  4EW4 A;  5KN9 A;  3CWT A;  2D0C A;  3CWS A;  2NOE A;  4E9H A;  1QN3 A;  2YG8 A;  1MUN A;  4PY5 A;  1MPG A;  4B0A A;  1KYF A;  3FHG A;  1QN5 A;  3KRM A;  3DPU A;  1QTP A;  4E9F A;  1EBM A;  1QNE A;  1VOL B;  1RRS A;  1KG5 A;  2YH5 A;  4AI4 A;  1KO9 A;  3I0W A;  1QNA A;  4YOQ A;  1NKU A;  2OFK A;  3ASM A;  3N89 A;  1QN6 A;  1PU6 A;  2NOF A;  4I8O A;  1YQM A;  2FGT A;  1E42 A;  2OFI A;  2NOZ A;  1XQO A;  1KY6 A;  2NOH A;  3FHF A;  1M3H A;  1NH2 A;  3CWU A;  1PVS A;  1UT4 A;  1DIZ A;  1WEF A;  1PZD A;  4ROC B;  2D0B A;  5AN4 A;  1YQR A;  4B22 A;  1MUY A;  1M3Q A;  1KYU A;  1ORP A;  3OST A;  2Z8U A;  3KNT A;  1UT7 A;  3IH7 A;  3EIK A;  1P59 A;  1HU0 A;  2HZM A;  2JHJ A;  1C9B B;  1LWV A;  1XQP A;  4DUL A;  1AIS A;  5CHZ A;  4YPH A;  4TPS A;  2MJ7 A;  4WZS D;  4DK9 A;  3FSP A;  1LMZ A;  4UOB A;  5IYD P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...