5FRNA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz419 (compound 4c)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
367
structure length
367
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PFV INTEGRASE
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 102
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5frnA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5frnA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5frnA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5frnA03
4QQ6A 3OS1A 1ASVA 4UQGA 2O4GA 5C25A 3DLHA 2IG0A 4CHOA 1WAFA 1BIZA 3FLGA 3HSTB 3RR8A 4FZZA 4FW2A 3CYMA 2OZMA 4M3XA 4CF9A 2JLEA 4E7LA 4N56A 1NJXA 3LAMA 3TARA 2X6SA 1TK0A 1CZBA 1Q9YA 3MO8A 3V9XA 3K58A 4KHSA 2AJQA 1RDBA 2ATQA 2OZSA 1RBRA 4W5QA 3AVHA 3E9GA 5HBMA 4AHRA 3K5LA 4QOZB 1NK6A 4E19A 4CGDA 2JGUA 3AVAA 2ITGA 2G8VA 5KE3A 2D0AA 4N47A 3LLRA 3AO1A 3AA5X 1Z25A 3DRRA 4Z4FA 4KTWA 3H08A 2PZSA 4E1NA 4AILC 4ELTA 1ITGA 4IBNA 4JRQA 2WOMA 2YKNA 2XY7A 3S3NA 1EETA 5D6YA 4EP4A 1NK9A 2VG6A 3LH0A 3VQQA 4AH9A 2YHBA 2JTFA 3RR7A 3ZT0A 2BKDN 1VSJA 1HNIA 2P1JA 2G8KA 1U49A 1S1VA 2KQ2A 4PA1A 4F2SA 3LWLA 3MXMA 3C4SA 1VSDA 3LP0A 4CECA 4H4OA 4Z4EA 3L2UA 2QQRA 3KD5E 3ZSWA 1KCFA 3LZIA 5HRPA 4NS5A 2D0CA 4KB0A 4II1A 3QINA 1OZ2A 4FJ9A 2LVMA 5IN1A 1KTQA 4PY5A 1BI4B 4QQGA 5C24A 4CEQA 2RHUA 1RT1A 4AHTA 3PX6A 4IUPA 1KRPA 3B6OA 1XHXA 2OPQA 1BL3A 2X4XA 3TWHA 4CGJA 4I9LA 1T03A 3RMBA 3NTHA 4AHVA 4DF8A 1NKBA 2GV9A 1D9FA 3F70A 3OY9A 1RBVA 1LV5A 3QEWA 3UIQA 1VSFA 3MEDA 3LGFA 4CF1A 2G8FA 3OS2A 3V6DA 4F8RA 4B9TA 4FJHA 1TGOA 3NF6A 2E5QA 4FJLA 4IG0A 3DLEA 4E1MA 1JLBA 3C95A 1RNHA 1J9AA 3NH2A 4GY5A 2IDOA 1L3UA 4CEZA 3M8SA 1S1WA 4J2BA 4QVZA 1EP4A 3NTKA 4M41A 1S6PA 2LDMA 2Z1IA 3C94A 4BE1A 5E41A 4YFUA 3EZ5A 3OYBA 3DLKA 1WSGA 4CJQA 4B9SA 4Y1CA 3LANA 1GOAA 4KHWA 4PLIA 1RBUA 1DLOA 4C8MA 4CJVA 4IFYA 2L8DA 3WNHA 1SUQA 4PUOA 1Q9XA 4IUTA 4DQSA 2PQWA 4FJXA 3V9ZA 3THVA 3DYAA 3L3VA 3KLEA 4ZTFA 1BGXT 4DLGA 1QSYA 2GBZA 1KVAA 3JSMA 3HPOA 4ELUA 4EZ9A 1UA1A 3ZT2A 2EQMA 5KH6A 3MEVA 5HRRA 1QSSA 3DLRA 1H3ZA 4F2RA 2M1HA 4N4GA 3KLFA 3NTIA 3MP6A 4PLLA 1HYZA 4L59A 3SUQA 3OVNA 2DTUA 2MWPA 1RI0A 5J39A 1EX4A 3PX0A 3IS9A 3PO4A 1YVUA 2X78A 2JZ2A 3F73A 3H8ZA 4CHQA 3AV9A 4BE2A 4FXDA 1NK5A 4C5HA 4CIFA 4B9NA 2O4IA 4I9QA 4M3TA 5D6WA 3G0ZA 4FK4A 4KO0A 4CJKA 3AO5A 1KLMA 3KLHA 3OMCA 3VQ9A 3OYGA 4CCHA 4LD0A 1N5YA 3B6PA 4O44A 3LP2A 1EXQA 1ZYQA 4AHCA 3OYIA 4FM1A 4AHUA 3WNFA 1RT4A 3NAEA 3NHGA 3OYAA 1UA0A 3ISNC 3MECA 3O3FA 4DTNA 2YNGA 4N5SA 3MEEA 2OPPA 4JS5A 4AHSA 4Z4HA 4DTMA 2GFUA 1BQNA 2RJFA 3PV8A 1WNSA 1D9DA 3CFOA 2R57A 4CRIA 1VSKA 4CK2A 4DU4A 3SCXA 4DFKA 2IGIA 4CEOA 1NOYA 3T1AA 3ZT4A 4KI6A 1NJYA 4QQDA 2YNFA 3AVNA 3MEUA 1IH7A 3KTQA 4B8CA 3V1QA 1FXXA 1S5JA 3FEOA 1Y97A 1NJZA 1I39A 3RWUA 4DU1A 1TAUA 4CJ5A 3OYLA 4E3SA 4H8KA 3TAQA 1BCOA 3NH1A 4KTZA 3AVBA 3OYJA 1SKSA 3BGRA 4BDYA 1G5VA 1NK4A 2LTOA 3ZSZA 1Q8IA 1TVRA 3IAYA 4HUFA 4I2PA 2OPSA 3OYDA 1S1UA 2XHBA 3HJFA 3EAEA 2BIVA 1JLEA 1KHCA 1CZ9A 1J5OA 2EQUA 3DI6A 2RJCA 2FC0A 4FJGA 3F9KA 4A4GA 2XY6A 3T3FA 2OPRA 4W5OA 2HHQA 3U3GA 3QIPA 3O4QA 3H6ZA 2RN2A 1ZBLA 5J26A 1U04A 4C8LA 1LAWA 4CJFA 4CERA 2G8IA 3VQEA 3MXJA 1LWEA 1RTDA 3VQ4A 3AVFA 1Z26A 4IFVA 4NCAA 4HUGA 4B9UA 3M8RA 2X35A 4PL6A 1J54A 4RW4A 2RHIA 3O4NA 1VSLA 2EX3A 1NK7A 4CJRA 5J2MA 3CM5A 3KKSA 1BISA 3P8HA 3D0PA 4C5EA 4JLHA 4FJKA 2DY4A 1D8YA 3VQDA 1UOCA 3I8DA 3KK1A 1RBTA 4FCYA 3IRXA 4BWJA 3RMCA 2K3XA 4OPJA 1C0MA 3SV3A 4MFBA 4LY7A 3L2RA 1KVBA 4CHNA 4DQPA 4FLVA 1DTTA 3S6WA 5FRMA 2YHAA 1MU2A 4I2QA 3VQ6A 4DQQA 4FM2A 3SNNA 5HRSA 4GW6A 1HYSA 1L5UA 1G15A 3O3HA 3CFPA 1NKEA 4FZXC 3K59A 4CJTA 4J2AA 1FKPA 4FJMA 3PFSA 1LWFA 3SQ2A 2HVIA 1IO2A 5KI6A 1XWLA 3CG7A 3P5JA 1JL1A 4FLUA 2FHDA 1LW2A 3DM2A 3SQ1A 4OPKA 4ELVA 4KB1A 2QXFA 5J1EA 4DF4A 1ZBFA 1R0AA 1WSEA 4BE0A 4Y1DA 1RILA 3IG1A 1ZBUA 2ZD1A 4CIGA 4A4EA 2HHSA 2HVHA 3VQCA 2HNDA 2X74A 3K57A 3QIOA 3VQ5A 2L89A 2D9TA 4OKEA 3LGLA 1HMVA 4DU3A 2RHXA 1WLJA 2MWOA 4IUUA 1TK5A 3OMGA 2XK0A 3TR8A 4JRPA 1L3SA 3MEWA 3TANA 2F96A 3OQ5A 2XY8A 5FDLA 3DLMA 4CFDA 3E9FA 1YTAA 4DSKA 4CEFA 2LSNA 1RDDA 4IKFA 1KLNA 3ITHA 4BDZA 2BANA 3VQ7A 3QERA 5FROA 3NDKA 5KCHA 1QS4A 3Q1JA 5I42A 4QAGA 2RJDA 4CEEA 4Z0UA 4CK1A 1JLFA 3L2QA 4UC4A 2RKIA 4CJPA 3GOXA 1JLCA 4CFCA 4DMNA 4Z02A 3KLGA 2NLUA 4FVMA 3OYKA 3SI6A 4DTSA 1IKWA 2L3RA 3AVLA 3OS0A 1RT6A 4DWIA 4EZ6A 4KREA 3MP8A 5CZ1A 5DK5A 3V4IA 1WSFA 1QSLA 4E7KA 1WJQA 2XRIA 3U3YA 3ME9A 3OJSA 1N6QA 2R5MA 3V81A 2YNIA 4Z4CA 2HMIA 4OVLA 4FLZA 3E01A 3SJJA 3NF9A 1XI1A 1A5VA 2YNHA 2FBXA 2BGGA 4NCGA 2HB5A 4FL6A 2RHYA 4I7FA 4CJWA 4F3OA 1BI4A 3O3GA 4C8NA 4CEBA 2EKOA 3VQBA 3LDSA 2VYTA 4DFJA 3AVCA 4OKKA 1K6YA 4CHPA 4J2DA 3CEYA 3QEXA 4CJLA 5C42A 4Q5WA 4CGIA 1ASUA 3HVTA 1C1BA 3SD4A 1X9WA 1W9HA 4A4FA 2PY5A 3SQ4A 4FZYA 3TAMA 1HQUA 3AVIA 1HYVA 1HRHA 3K5OA 3CQ8A 2Z1HA 2KZMA 2HHXA 2VWKA 3LWMA 1XHZA 2X4WA 1RT3A 1B9DA 1WJRA 1KFSA 4CFAA 1MHNA 2Y1IA 4CJUA 3SZ2A 3SUPA 4H4MA 3NNQA 3VA0A 3OYCA 3QESA 5D3GA 2FBYA 3ZSXA 2LRQA 3LP3A 1VSEA 4MQ3A 4CF8A 3V1OA 3KLIA 1TKZA 4C8OA 4FU6A 3AVKA 5KRTA 1UAXA 2DFFA 1QQCA 4FJJA 4WE1A 3PUFA 4Q5VA 2KTQA 1L3VA 3LX7A 2FBTA 1IG9A 2KFNA 1SL1A 1U47A 1XNIA 3NBPA 4BDPA 4RG2A 3ZCMA 3RMDA 3SUNA 4B9XA 3DLGA 2G8HA 3VQAA 3LPUA 1HNVA 3NGYA 1OYXA 4RG8A 2D0BA 3QKJA 1TV6A 2YRVA 5C6SA 4ID1A 3VA3A 1YTUA 4CEAA 1NK0A 4FJ5A 5C0MA 3HYFA 2QKBA 2D5RA 4O0IA 4RW6A 3CFRA 2E6LA 4F3TA 3HK2A 4FLWA 4HCCA 4FLXA 3JYTA 1X9SA 5KCOA 2W42A 3AA4A 2WACA 2DFEA 2KFZA 1GOBA 3LP1A 1X1PA 3NGZA 4DQIA 3HM9A 2X4YA 3AO4A 3KK3A 4KFBA 3SPYA 3PO5A 1UWBA 2LCCA 2A1RA 5KTQA 3A2FA 4DFPA 2RI5A 3DLBA 1KFDA 4LSNA 3OB9A 1X9MA 3K5MA 4DTUA 4OVAA 3PY8A 4F4KA 1NK8A 3UWNA 5CYQA 4B3OA 5HP1A 3META 1CXUA 4JS4A 3OYHA 2RI2A 1YT3A 4IURA 4FYDA 2E6NA 3M8QA 2RO0A 2EQJA 2WONA 3DRSA 1EKEA 4HCBA 4CESA 4CGFA 4NCBA 3M9QA 1TKTA 1CXQA 4OKJA 2ZE2A 3OYEA 4E7JA 2NUBA 2EFIA 1TK8A 3ZT1A 4E7HA 4M45A 1RTJA 3S3MA 1BCMA 1WSIA 4CJ3A 4KHNA 4ZHRA 4FK0A 3V1RA 4FLTA 4CFBA 2P5GA 3TAEA 1LW0A 4RW9A 1JLAA 5T7BA 3DRPA 4N4IA 4DS5A 1TKXA 1TL1A 3FFIA 1A5XA 3PMTA 2E6MA 1JKHA 2OYQA 3KKRA 1VSIA 1SKWA 1NKCA 3MEAA 3NH0A 2Q3SA 5JS2A 3I0SA 2HNYA 2M16A 3AVGA 1B9FA 3ZSRA 4CE9A 4W5RA 2YKMA 4C8KA 4R5PA 2BUDA 2DFHA 4CIEA 4J2EA 2EHGA 4CF2A 4ICLA 3HPGA 3SV4A 3LAKA 3PNWC 3HO1A 3NFAA 2IOCA 4CJEA 2Z1JA 2IS3A 3L2WA 1A5WA 2CKKA 1RTHA 1VRTA 2HQEA 4B9LA 4M42A 1C6VA 5HLFA 1T7PA 2B5JA 3SQ0A 3OYMA 2XDPA 4OJRA 2IAJA 4DSJA 4K8XA 4M3ZA 1WGSA 5CZ2A 5M9OA 2ETJA 1C1CA 4NYFA 4M3YA 3AVMA 3DOLA 3O8VA 4QW2A 3OA6A 3NGIA 4DSEA 3ZEHA 4KV8A 1REVA 1RCHA 1DTQA 4OGEA 1HPZA 4O55A 2RJEA 1TL3A 2IC3A 3LALA 2DIGA 5J2QA 3EY1A 1S6QA 1F21A 1U45A 2RPIA 3HT3A 2RF2A 4K8ZA 3NF8A 2VG5A 4CHZA 3PX4A 3KJVA 5DMRA 4O4GA 3OYFA 3TAPA 3VQ8A 1FK9A 4PQUA 3HL8A 1U48A 3WNGA 2G8WA 3LPTA 2A1SA 2GF7A 4HVJA 3MXIA 4LD6A 4E7IA 2VG7A 1L3TA 1WJSA 4CF0A 4BACA 4C5IA 5HROA 2BE2A 5IAYA 3ZSQA 3U6FA 3RRHA 2F8TA 3TI0A 2FBVA 4KAZA 1WSJA 3NCIA 2GUIA 3QO9A 4EP5A 3DB4A 1I3AA 3PMIA 1U4BA 5D6XA 1GOCA 1RBSA 1WN7A 5KRSA 1JXBA 5KGXA 1SKRA 3LZJA 2F5KA 3CM6A 2Y1JA 3RMAA 3KUFA 3MP1A 4DTPA 2HQXA 1KVCA 3HVRA 3AVJA 4NZGA 2QQSA 3L2VA 4DTJA 1FKOA 4E89A 4HCZA 2K3YA 3ZSVA 1S9EA 4GMJB 2B4JA 1NOZA 2HNZA 3QETA 2YV0X 5SZTA 2OA8A 1SV5A 3OJUA 3P8DA 1J53A 3QJ6A 4BWMA 5EU7A 1RT7A 4HHTA 3TAGA 4Q0BA 1ZBIA 4W5NA 4OLBA 3BDLA 2XY5A 5HRNA 1RT2A 3SYZA 4DSFA 4FJIA 4CJ4A 4DSLA 3V9WA 2QKKA 4G1QA 1RDCA 1NJWA 4KRFA 4DLEA 4OGCA 3DMJA 3ZSYA 4DSIA 4KHUA 2E4LA 2EQKA 1LAVA 4LSLA 3HPHA 4W5TA 4C5GA 3VN5A 1IKVA 4KI4A 4DS4A 4M3WA 2O4XB 5JS1A 3AA3A 4HUEA 4B9MA 1BQMA 2XO7A 4M3RA 4FJ7A 4Z4GA 3K5NA 2M0OA 4LH4A 4ZTJA 3D45A 3MAQA 5KE2A 3ZSOA 3L42A 5CYMA 3MEGA 1JLGA 3SUOA 3RTVA 3KIOA 3TAFA 1HJRA 3NF7A 2GFAA 4IUVA 2R7YA 4YNQA 2PYLA 3QEIA 3S9HA 1SSFA 4FW1A 4IDKA 1S9GA 4FLYA 1BIUA 2DAQA 1QTMA 4GVMA 3ASKA 3QNNA 4X34A 4RW7A 1JLQA 3OYNA 4DFMA 3HXMA 4Z4IA 4FJNA 5K14A 4CGHA 1TAQA 1C0TA 3P1GA 3V9UA 4CEDA 1OI1A 1D5AA 3WNEA 3BDPA 1N27A 1JXEA 2X6NA 3G10A 4A4HA 3T19A 2ZQBA 4N76A 1WSHA 3QIIA 5FRNA 3TABA 3V9SA 4DQRA 2HHWA 1S1TA 2F8SA 2Z1GA 4FK2A 4BD3A 1BHLA 3QNOA 4RW8A 4KHYA 2RHZA 3ZT3A 1SL2A 1RDAA 2O4XA 2BDPA 3L3UA 4PWDA 1B92A 1RT5A 4KTQA 3FC3A 3VQPA 2QK9A 4KPYA 3C6UA 4B08A 3L8BA 4CHYA 2HW3A 5KGWA 4B9WA 4DTOA 1JL2A 2B8AA 5I3UA 1VSMA 1ASWA 4TSXA 5J2PA 3DOKA 1WAJA 4NYNA 2B6AA 1W0HA 2P0KA 1RTIA 3P83D 2G3RA 4O5BA 4DTRA 1CLQA 4CGGA 1TKDA 3EYZA 1OZ3A 1LWCA 4M3UA 5J2NA 1C1AA 4QCLA 4XIUA 4B8AB 4FM0A 1S1XA 3ASMA 1QHTA 1SL0A 3LYIA 1VK0A 2KZZA 2VWJA 3QBYA 1IKXA 3NE6A 2P5OA 4OLAA 3AA2A 4B9VA 1T05A 3AO2A 4KKOA 2KW4A 3KD1E 5CIUA 2HHUA 1KSPA 3K2PA 3QEPA 4IUQA 4O0JA 3RRGA 3FDRA 2HHTA 4E0DA 2R5AA 1IKYA 2HHVA 2DIQA 1VRUA 4N4HA 4ID5A 3QEVA 3I0RA 3SPZA 3HP9A 1HQEA 1ZBHA 4DTXA 4N41A 4HTUA 1QE1A 4IG3A 3HP6A 4CK3A 3KK2A 1O1WA 3C6TA 2P51A 4FJ8A 4EDUA 4KHQA 3ALYA 3AO3A 2R58A 1T8EA 1VSHA 2PYJA 3S3OA 1XC9A 4CJSA 5CY4A 3M8PA 2G8UA 3QLHA 4DG1A 5SWMA 1C0UA 4LH5A 2I5JA 3UT1A 4L8RB 2RI3A 3DB3A 3ULDA
chains in the Genus database with same CATH superfamily
4QQ6A 4WXDA 3R61A 4S04A 3OS1A 2LX7A 1ASVA 5GAGP 5C25A 4G7ZF 3ABKH 3CJ1A 3HSTB 4GDFA 3SJHA 2LMJA 4IRIA 2IGKA 3RR8A 1LCUA 3E6DA 1OCZH 4CF9A 1VQMT 2V9PA 2DMUA 3JCMW 4CH7A 1USSA 3NWTA 2X6SA 5DY9A 3KZIC 4KHSA 2GIVA 2P7CB 2A42A 3I55T 2OA4A 1VQNT 4PGGA 5H6QA 1E0EA 2R7TA 3WTZA 3E9GA 2JZYA 1SD7A 1X6OA 4YFKF 4BC3A 1QZ5A 1G4DA 3PFYA 2HD0A 2OU2A 4U0VA 4WWCA 3FJPA 4XU2A 1HCRA 1NM7A 3L2ZA 1VQ8Q 2G8VA 1RDUA 2IJLA 1KC8O 4KTWA 4KGXB 2LCSA 2PZSA 4X66K 4ORZA 4DR6K 1M27C 1ITGA 3A03A 4IBNA 3M0QA 4MDAA 4JI7K 2P9IB 3WTUC 2MGQA 4CI0C 2YKNA 2GIZA 2O2OA 5D6YA 1NGIA 2A37A 2VG6A 4IL6C 3LH0A 1MMGA 4M78B 5I2SA 3CXCM 5KYYA 2L0KA 3M59A 1T0FA 3RR7A 2LMDA 1HNIA 3GOIA 4YOTA 3N0UA 2G8KA 1ZC6A 1RDWX 2YJEA 1J59A 2AZSA 4A6DA 2DA7A 4EJWA 4PA1A 3WVDB 3C4SA 1MUNA 1VSDA 4Z4EA 2QQRA 3E9LA 3L00A 3ZSWA 4S0HB 2PVOB 4GNIA 1TQMA 4NS5A 2D0CA 3U9ZA 4B3RK 3CCJI 4II1A 3QINA 1QVTA 2ID6A 4NUBA 1I81A 4V2SA 3ASOH 1KTQA 3FLCO 5LMUK 4PY5A 2M8GX 2O8BB 1MV3A 2NOZA 4KBMB 2V6EA 3KLNA 1HKTA 1BI4B 3CMEA 4ON0A 2CFOA 1IV0A 3JB9G 2A07F 1RT1A 4AHTA 3JCMe 4A63B 4OIRF 4PGHA 3OW2M 2E5LK 3A02A 2ZJRF 4O6JA 2CYYA 1DKGD 4LMYA 2BUPA 4RTUA 4B9QA 1LVKA 5GANf 1KD1R 4I9LA 2JRTA 4YIRX 2FA5A 4RMOA 2DN0A 4FPAA 3NTHA 4AHVA 4NC6A 4M63C 2FEZA 1BG3A 3ENBA 4ZYGA 1RBVA 3C6AA 2UZKA 1RADB 4YOYA 3MN7A 1VSFA 3SFZA 4C92A 2G8FA 3OS2A 1FJGK 4F8RA 2QQAA 4KUMA 2FRWA 4FJHA 2Q2EA 2K79A 1U1SA 2W57A 5D4RA 2DA2A 1QQOA 3DLEA 4KT6A 5GP9A 5H6RA 1JEGA 4NDLA 2GXGA 3TTDA 4ILHA 1RNHA 2ZF5O 2FUG2 3V8KA 2HSEB 3W6JB 4GY5A 4M77B 2IDOA 1L3UA 2W10A 4AFSC 3M8SA 1S1WA 1HA8A 3NEUA 2WSCE 2ZFUA 2HBWA 3EO3A 4A2BA 1YLFA 5DS9A 5E41A 4Y13A 3PSFA 4PSXA 4JKGB 3DLKA 4AYBA 1A36A 3KHYA 3VPZA 3I4PA 1FBQA 4HVWA 4B9SA 1ZAOA 2L5QA 3WG7H 3QWLA 2E1MC 5J1RA 4DYQA 4IFYA 4AF1A 2M02A 4HRIA 1J75A 1OCRH 1W7AA 4J9DA 4OB1B 1PM3A 2PMZN 2HF4A 4IHSA 5JVTA 2EZIA 3CCEA 3M0RA 4IUTA 4XLAA 1WQ2A 1F5TA 3CCMA 3LW5E 3DYAA 3H5NA 1YOVB 1BGXT 5GIPA 1RFQA 2A05A 4BY1J 1BI0A 4ELUA 2R5YA 1ZG1A 2UUCK 3ZT2A 2KZVA 1TH7A 3OWTA 4UUVA 4RTZA 3MEVA 1ITYA 5HRRA 4JI3K 4AIHA 2H8HA 1BM9A 3HSBA 2M1HA 5LD2C 3JTGA 5F04A 1P6RA 4OINF 4L59A 2IVMA 1ETWA 3JRFA 3CPEA 4M6YA 1OPLA 5J39A 5LJ3d 4BI3A 1QVGM 4CC7A 3CJBA 2P81A 3BTCA 3VS2A 2X1CA 4A5BA 2D1HA 4CHQA 1LUJB 3EYIA 4ITVA 3FMSA 5DTDA 2R7WA 3TQNA 1NK5A 3CXCS 3VSLA 4DV0K 4CIFA 2EBPA 2O4IA 1S7AA 1WI9A 3RNJA 3G0ZA 2HKXA 1V1CA 1WKMA 3O9SA 1OH6A 4LIUA 1KLMA 1JCEA 1V4RA 3SEZA 1IZ6A 4JJNK 4DYCA 2YDLA 3MN6A 4KH4A 2RPNA 3DKWA 1ACIA 3ZMTA 3VEYA 4C1NI 1N5YA 5CPRB 5IOYA 1EXQA 1ZYQA 3C1DA 4FWRA 5KYUA 4JOMA 4AHUA 4KH6A 2LQ8A 2COWA 3GMEA 4H0OA 4B43A 1GRIA 1PD0A 2KBTA 1UA0A 1JJ8C 5BMZA 2CUEA 3E3VA 2P84A 4KBOA 1VQ7T 2DF6A 3C7NA 4JS5A 4AHSA 1YHQA 1P4WA 5B3SH 2YCHA 2DA1A 3OW2S 1KQ2A 3U1KA 2VT2A 2GEMA 2VJJA 2CZ1B 2RJFA 4NL2A 3UKUA 1IN7A 4RAYA 1U5TB 2E7XA 5M1KA 1MJ9A 5AQTA 4CRIA 5CQGA 3PIOL 3FKJA 4DU4A 2EFNA 3SCXA 4DFKA 4IPAA 2QWOA 1SZ2A 3DPTA 4B1RA 4E9HA 1X43A 1NGNA 3ZT4A 1NJYA 2FBIA 1VQ9N 3MEUA 1Y56A 2O5RA 2R7DA 2W1OA 2V1UA 2RA2A 3G3ZA 3K1MA 4JQFA 1JHFA 5FO5A 4OIOF 4FTHA 2D45A 2DL4A 5FPNA 1NJZA 3EPZA 4DU1A 1K9MR 1R0BG 1W2BM 2CGKA 1H92A 3TAQA 3NVKA 4QKUA 3AVBA 4UB8C 4CUGA 1SKSA 2K3BA 1AD5A 2NOJB 1G5VA 4EMGA 3DKYA 4OMPA 3CJ7A 1BJAA 1Q8IA 1XNRK 2ZO4A 4C23A 1S1UA 5AZIA 1Z7UA 4F17A 2BIVA 2E60A 2KI7A 1KHCA 3LSTA 1MMDA 1BA1A 4DBFA 3CC4Q 2EQUA 2RJCA 4YEJA 1DUXC 3BUZB 3OYYA 1S72Q 2RC4A 2V79A 2RQUA 1WSUA 4J9CA 3M57A 2D1VA 3S1NJ 3TOBA 4A4GA 4BQQA 2XY6A 3F5TA 4ZDPA 1X3NA 4ELZC 1O4XA 4A69C 5J40A 1X1CA 4W5OA 1N25A 5B1AH 2R92J 1ZA2B 1U04A 4C8LA 3H5AA 4CJFA 2ZGWA 1RTDA 5FPMA 2O8FB 2P9UB 1U6ZA 5J1YA 1JJ6C 2VQGA 4HUGA 1VZ0A 1M1KO 3I9V2 4PL6A 3ABMH 4F14A 3L0QA 2PMUA 2IS1A 3WUHA 3TMOA 4I2OA 5EXWA 2NRWA 4CJRA 2QA4T 1K8AR 1BISA 4OPAA 1VQNA 1DQUA 3D0PA 1TG0A 1GCQC 2DY4A 1FWZA 1QCOA 3CQYA 4RTYA 2HDCA 2DRKA 4LUEA 5C3EJ 1RBTA 5LJ5h 4RTTA 2ASPA 4F7UG 4BXFA 4PJLA 3G1JA 4OPJA 1WB9A 1QVGS 1GVDA 1D5YA 4Q5SF 5KNLA 3SV3A 1SC7A 1BR4A 2CQQA 4LY7A 4FWOA 4CHNA 3BC8A 3NHNA 1VQ9I 4DQPA 3MFKA 1NGEA 5C15A 5FRMA 1IRXA 2YHAA 3OSFA 2DL8A 3VQ6A 4J01A 5IP6A 2WBNA 2E7WA 4PUSA 4FWSA 1B1BA 2FOWA 2XKOC 3EYYA 1G15A 1ON1A 1BIBA 5J3BA 5JLWA 1NKEA 2YHTA 2UXCK 3K59A 3AHUA 5CQYA 5DM7L 1GCPA 2XI9A 5GAHJ 1UECA 1O13A 3P31A 1R23A 3E6BA 4J2AA 2C6YA 4D5FA 3CBPA 4RB2C 2E1HA 4XLHA 3OL3A 2F4IA 2KDZA 1TSFA 1YJWT 2GX9A 1QPIA 4HSBA 1HKGA 4JI4K 4BC5A 1WJAA 3RESA 1IO2A 1WI7A 4J6YA 3F8MA 2F7TA 4CZZA 3P5JA 4U7BA 1Z9CA 2EPDA 2ICWG 3DM2A 1YQRA 1ZGJA 1G83A 3P8BB 3SQ1A 1N5ZA 3T8RA 2FVUA 5ICEA 3WT0A 4DF4A 1V5GA 1ZBFA 3MZHA 1X3ZB 3A5NC 1QNTA 2JPCA 4BE0A 1DGWY 4Y1DA 4PJOG 3IG1A 1YO5C 1ZBUA 2ZD1A 2HEOA 2VQHA 2O6GE 4R56A 3JB9H 1HUXA 1YX5A 4QTRA 3RVCA 2V51B 2D9TA 3ZMSA 1U78A 1WLJA 1VA7A 2GBYA 1TK5A 2GTOA 1ZKGA 3MCPA 5AQQA 4J9GA 2OCEA 3DPLC 4XONA 2D0PA 3TR8A 4E6KG 2LKSA 2P9LA 4N9HA 1X2KA 1O75A 3RDIA 2E64A 3VEOA 5FDLA 5E1XA 4F7UE 2BZXA 3DLMA 3HOSA 3E9FA 4X65K 2HOAA 1LQ1A 4GCVA 1WXUA 2NUZA 4IKFA 2NVXJ 4KICA 4YDUA 4RTWA 1SFEA 3CC7N 3RR6A 2W41A 4UHTA 1KIKA 3QERA 1Q1VA 4D6WA 4MHGA 4HLXA 4JKHA 4ISFA 4F91B 1ZBSA 3K4BA 1P2FA 1WZ2A 1OVYA 2Z99A 4JEPA 5I42A 3J7AY 3HBTA 2P9IA 4CK1A 4FX0A 1ORNA 4EW0A 4YTLA 2RKIA 3ZETB 4Y28E 3CLOA 2NRZA 1UGVA 4M78A 5JLFA 2AHQA 3EFOB 2LD5A 4Z02A 3F6OA 2NLUA 2XV4S 4EJOA 3SI6A 3JS6A 1R0CB 4DTSA 1IKWA 2N8GA 2QGFB 5BOXA 3AG3H 1RT6A 2DYSH 1FP1D 3CD6N 3E6MA 2E41A 4KREA 1WOQA 4PK4A 1TWAJ 5CZ1A 2RQTA 2KKZA 2P7VB 2MC3A 3KP5A 1WJQA 3F8CA 2XRIA 2L2PA 5KYXA 3VWBA 5CR2A 4GXOA 1ZXOA 2R5MA 1WEGA 4U0WA 1UUEA 3V81A 4Z4CA 1Y96A 4OMMA 4OVLA 4FLZA 4P9UA 2F2VA 3SJJA 4RB1A 4ESRA 3NF9A 3RKQA 3J7AF 4U87A 1OQYA 2EJ9A 1KQJA 3FRNA 1NKUA 2O8BA 3EE8A 4IEEA 4CJWA 1B72A 2DQLA 2V26A 1BI4A 4BI4A 3TQ7P 4HZFA 1AVZC 4C8NA 2W40A 3H0GJ 3ECHA 4CZFA 2L3SA 1V4SA 3CWAA 1I6XA 3OW2A 3LDSA 2VYTA 4MDWA 4B24A 4RLFA 2JNGA 4J2DA 3GTKJ 1X58A 2NLXA 5BRFA 3QEXA 3PQKA 3G25A 1SFXA 2ZPEB 2GA2A 5LHHA 3HVTA 4JK7A 3CQXA 1C1BA 3Q7BA 1WPKA 1P4AA 2RDPA 4A4FA 3A5OC 2XAGA 1V4TA 1HRHA 2CREA 1Z3XA 3Q7CA 1PRLC 2PFBA 4MIMA 5HVQC 2MPXC 2JWTA 2X4WA 4ZGEB 1ZLKA 1ZQ1A 1B9DA 2DMQA 4B22A 1KFSA 4CFAA 4CJUA 3J80O 4H4MA 5D8KB 4PDKA 1RAAB 3VA0A 1P7MA 1M2OA 1EA3A 2MMPA 2FBYA 2V52B 4L18B 1TP4A 1K78B 5JVGL 4HT9A 2HS5A 4BQZA 5GAN6 4M77A 1R59O 3K4NA 1VSEA 2C0TA 4EQQA 1YG2A 3KLIA 4IOXA 3JCMJ 4PL8A 1VQ7A 5KRTA 1UAXA 5LRRA 2OCCH 3DEUA 2ME6A 4BU2A 4JKGA 1KQSS 1VQ5T 3K1NA 3PIPA 5FPDA 3VOEA 2O03A 4EMSA 4ILGB 3QXEB 3F8NA 1R1UA 4QS8A 3BG7A 4FWLA 3NBPA 4KH0B 2DVEA 1KU9A 5J47A 4RG2A 3TO7A 2O8EA 4DR3K 4ME7A 2VE9A 3RMDA 5DLOA 2QASA 3CD6I 2LF7A 1X4PA 5JLHA 1O3SA 2L9RA 2G8HA 4MZTA 3RQ4A 1V55H 3VS4A 2D2WA 4OMYA 4IQ4A 3AG4H 2PMHA 3IC7A 1ODDA 3QKJA 1U1TA 3TL4X 3DCFA 3VODA 1R8OB 3VA3A 2D0OA 2K9QA 3CJNA 4BHPA 1F43A 1EZZB 4JX4A 3E6CC 5AQXA 2V1QA 2FO0A 1QHAA 2H3GX 4OOIA 4RAGA 2H56A 3K9TA 2W42A 5FKMA 2K02A 4NHJA 2WACA 5TKYA 5KPZA 2KFZA 2VKVA 2CO5A 3NGZA 2IGNA 3UR3C 3AO4A 3VJPA 5D5XB 4KFBA 3SPYA 4OP0A 1NJIO 2A1RA 4X62K 4A3DJ 2KXDA 4JKCA 5DM7F 1Z1DA 3DLBA 1EWRA 2F69A 3OB9A 1YCYA 2H1KA 2XIGA 2YWWA 3PLAA 2E5NA 1GXPA 4JUVA 4F4KA 2E36A 3ID6A 5HP1A 3KZZA 1IV6A 3CCQT 2RMOA 2QGGA 4PFZA 4WQ4C 1AU7A 3H9JA 3JAMK 2E2JJ 1KQ0A 3LFKA 2GTDA 1N8RU 2QA4A 1FZPB 1WJFA 2RO0A 2HKQB 4CBXA 4M3EA 2ME0A 2EJGA 3F21A 1ZLMA 2CH4W 4CESA 2DTOA 1HPMA 4NCBA 4ZZDA 4ZDLA 4EEFG 3QPLA 3M9QA 4OKJA 1T33A 2DU9A 5AQYA 4E7JA 3MQ0A 3DAWA 2QEXT 1TK8A 4B1ZA 3VFZA 3A8HB 1K73R 4E7HA 1LMZA 3GWZA 1D3YA 2NNYA 4YFNF 3CCJT 3BPXA 1YIJT 4CJ3A 3VGKA 4KHNA 4ZHRA 1M3QA 4DUYK 3MCZA 3KEQA 4ZN3A 2YLBA 1FT9A 4XR6A 1YI2A 3DBLB 2M4GA 4KYWA 3O9TA 1TKXA 4LDWA 3PMTA 2E6MA 3VYHB 1SVLA 3L4QA 2DO3A 2ZPBB 2ZSHB 1W2BA 4E7SA 1W6XA 3I53A 2KIMA 2GNCA 4JLGA 2VKEA 2XIDA 3P4IA 1TWGJ 2HSTA 1QP2A 2XDBA 1YITN 2Q2RA 2Y0SN 1VQ6T 4I0BA 2YKMA 1TWCJ 4LDUA 4R5PA 3BP8A 2BUDA 2WC2A 1VIFA 5CKTA 5GMKj 1YWOA 3RPQA 1NG2A 3R9PA 3GX4X 3V7CA 3QYBA 2QSFX 3BJOA 2K27A 8ATCB 2G7HA 4A3IJ 1JKRC 4M7DD 2NRRA 1XG1A 5C0YA 1SKUB 3CCVT 4C92E 1UB4A 1QQMA 2PBDA 2X4HA 2ADUA 2HQEA 2NS7A 1NLOC 2FBKA 5KPRA 1X2MA 1W0TA 4LB5A 4C0DC 1CQTA 3SQ0A 1JXSA 4M7DC 2XDPA 4AFZC 3DQVC 4OJRA 4HPQA 2O8FA 3DLAA 4K8XA 3LA3A 5FU6C 4CZGA 5F1RA 3JREA 2EB7A 3AVMA 3FM5A 4JK9A 3NMUA 4DSEA 4OB2B 5IP9J 1IRZA 3CCUA 3OOUA 4KV8A 2CGHA 3DXMA 3I54A 1CGPA 1LFPA 1REVA 2CU7A 3ERED 5DPKA 4BYYA 4O55A 2RJEA 2WSFE 4A2UA 3X2QH 1U45A 1XC3A 1BU1A 3HT3A 2RF2A 3NF8A 2ED0A 1M1GA 1T6CA 1S7EA 4MEXF 4O8UA 1JGGA 3OYFA 4BRHA 4PQUA 2A1SA 3MXIA 3FXUA 1YS6A 2CMPA 2HPIA 1FOWA 4C5IA 5HROA 1IXCA 1EJ9A 3U6FA 4LF5K 1UDLA 3RRHA 3FXRA 1FYMA 4PIIA 4LXCA 2FBVA 4ATOA 4KAZA 4FYXB 4BGAA 1UFMA 4CD3A 4P9FA 3SWNA 3H45C 2DETA 3DB4A 3PMIA 4M9XA 1EH8A 3SEQA 4HDUA 1VYUA 2BY2A 1YITI 1Q7YO 3A0HC 1ZELA 3G1MA 1YI2Q 4RDUA 1WN7A 3SBGA 5LMNK 5JVGF 3I56N 5IT3A 2P9NA 3EQLF 3R8EA 1H9GA 3CM6A 1FOKA 1PP8F 4Y3OA 3VU3C 2QTXA 3X24B 2KY9A 2UXBK 4EVIA 2ZSIB 2K2VA 3L2VA 5CE3A 5LJ5d 4IVNA 3ZSVA 3P7NA 4IHYA 2MA3A 4V19K 2F9WA 4GMJB 3HG9A 1ZBJA 1IUFA 3R60A 2YV0X 2OA8A 3MX5A 3WGIA 4Z8AA 1SV5A 4GGGA 3OJUA 5IY5H 1UG2A 3HRMA 3ZMDA 2DPNA 2Q1NA 2DQRA 2HZDA 3OSVA 2QWLA 3M1FA 3OMYA 3TDZC 3CCRN 1JI8A 1ZA1B 1Q81R 1IGQA 4IRHA 2QKKA 4B4CA 5KVRA 3ZQHA 4OB0B 2DMTA 2CP3A 1RDCA 2ZGZA 1J3TA 4KRFA 4DV2K 3DMJA 3HFNA 4CYDA 4DSIA 5A2QZ 4BRMA 1T0FC 1IN6A 4IRGA 4C2MJ 2AA4A 2F9TA 1PJRA 1YYVA 2L7MP 1HK9A 1Y0MA 4LSLA 3QU6A 2P0WA 2CW8A 4M3DA 4JHDA 4FE7A 2VJ5A 2ESHA 5AQFA 4A62A 1IKVA 4A0YA 4M3WA 3M8FA 4K43A 1OQKA 2XO7A 3WXMB 2DTZA 3CDHA 1ZSZB 4Z4GA 4N9IA 3SDZA 1LNWA 2LBFB 4L9JA 1P92A 3RERA 1TNTA 2HQ5A 3ZSOA 1C6VX 2W0ZA 2UUBK 5LJ3e 2VJIA 3CJTB 3S15J 3KIOA 2ZFWA 1UE9A 2QXLA 4WFAL 2LC2A 2GFAA 4IUVA 4YNQA 1R00A 3AGRA 4MQ9F 3S9HA 3ZEUB 3MVPA 1Z9QA 3O80A 2X51A 4LFUA 2DNUA 1BIUA 3I56I 2YSRA 3ABLH 1UJYA 4C92D 2NOLA 4X34A 2MH9A 4DV3K 2IA1A 2HKOA 3HXMA 3QFUA 1RACB 3TREA 4C92C 3HOZJ 2V75A 3CCLT 3FXOA 1XDUA 2HBMA 4A4HA 4CCJA 3A5LC 2LSOA 3CD6Q 4RWTA 3JRZA 3J7AO 2F8SA 2Z1GA 2WFBA 2K9NA 5IH2A 2EZLA 4RW8A 5GANg 3CPWP 2O4XA 3LCNA 3CCRI 1VYTA 2FF6A 4KTQA 3SHFA 5GAOl 2RVCA 4M6XA 2UWMA 1FTZA 2O31A 4K42A 1K9MU 1MNEA 4Q47A 2V4JC 2VGNA 4QPOA 2L3QA 3BG6A 4D0PA 2ROTA 3VGLA 5KGWA 4B9WA 4EHTA 2DODA 4RTVA 1VQ9T 3CCQA 1ZRCA 5I3UA 4QVCA 4RCHA 1PRMC 2K4YA 1ASWA 4GVEA 2O8CA 5J2PA 3DOKA 5E26A 1NZ9A 1WAJA 1UGQB 2A28A 1K78A 4O5BA 3IH2A 3TOAA 4LNPA 2YX7A 1TKDA 2W00A 5F64A 3EDPA 5J2NA 2DK8A 2WV1A 4B8AB 2CSQA 3ZMUA 3EGUA 1P4XA 4UOBA 4RGUA 4PKGA 4W1UA 2OAZA 3MWPA 5K1YA 2KZZA 1LJ9A 1HLUA 4OFAA 2QEXA 4EM1A 5GAMf 3QBYA 5D5UB 2CGJA 1IKXA 2LT4A 4M78G 3I58A 2J5OA 4OLAA 3J7YJ 2HXIA 1KAXA 4BXUA 1WBBA 4JK8A 1YIJA 3E9OA 3RMQA 4DR5K 1KQ1A 3B6CA 1R6RA 4X0GA 3FJ5A 2R7XA 4B9VA 3TEEA 3AO2A 2K3FA 4XQ3A 1U06A 4AG1C 4CDGA 5CIUA 3VENA 1K8AU 4IUQA 3K4KA 2FSWA 4BBRJ 3FDRA 2HHTA 4A53A 4E0DA 3G71T 4RB3C 2HHVA 2VGMA 2P5VA 1NGFA 2VQFK 4ID5A 3SPZA 4V2GA 1HQEA 2E5KA 3EKSA 2EW3A 1SFUA 4OU0A 1MBEA 3FGUA 1VQ6A 2E5ZA 5C44J 4EM2A 4B44A 2HYJA 2MBFA 3AO3A 5BN9A 3I4NJ 2PJRB 1ACMB 2KRSA 2PYJA 2HHHK 5EYRA 4Y33A 4F04B 3S3OA 1WVRA 2EAYA 1HJDA 1MDMB 5CY4A 2L4AA 2CWEA 2DK5A 5AQVA 1C0UA 3QHSA 3HOWJ 4NC7A 2ZKZA 2I7NA 3DB3A 3CCVA 4DNCA 1Y39A 1YQAA 2PI0A 1VQLN 4XLCA 4LK0F 3GVAA 5M5WJ 2M7BA 1G3TA 3HSEA 4KGVB 4KN4X 3QOEA 1XQHA 2IG0A 2X9DA 3GL1A 1WAFA 1BIZA 4M3FA 1X19A 1JTXA 4C1NK 4UVCA 2EGEA 1W1WE 4E7LA 3LSJA 5GIOA 5FKNA 3TARA 2EFPA 3ELKA 2EH3A 4L9VA 4XLNF 1U8RA 5AQUA 2J6FA 3K58A 1D0ZA 2AJQA 4M77G 3CPWA 3EG1A 1VYVA 3RI4A 1RDBA 3TSZA 3REAB 4A5MA 1M90C 2ASOA 2LY9A 1I4K1 3AVHA 2MFZA 3PT9A 4AHRA 4AIKA 4M78E 2PNIA 4EW4A 2DYRH 2RGVA 3IL2A 1W7PA 1HDDC 2HL3A 1J09A 5CQXA 2E3IA 1OCCH 1XSDA 2VOOA 3K9KA 2DMOA 2ITGA 4BGDA 1ABOA 2OTLN 3LLRA 4M7AB 2LTPA 4Z4FA 4MMLA 3H08A 1RL2A 3FISA 2BTTA 4ISEA 4KMUX 2M3AA 3BZCA 2F2WA 4XMYA 5AONA 2ESWA 2HSPA 5HK0A 4UY8O 3K4JA 2WOMA 2EIJH 2XAFA 2XY7A 1M3HA 1EETA 2XROA 3TW6A 2LQNA 3CUOA 3VQQA 2KE9A 2EILH 3DPUA 4DYRA 2OTJN 2Y75A 1OYYA 1AA7A 1R5HA 3F23A 4LF9K 1IBKK 1BL0A 3TTCA 1HW2A 2Z2SB 3JB9I 1X6GA 1T6SA 3LWLA 1K0SA 2KDOA 1U3EM 3ULEB 3LP0A 1VIEA 4H4OA 2DERA 3EH1A 2E1OA 3ABUA 2HL5C 3FKIJ 1O3QA 1RESA 1ETQA 5HRPA 1YITQ 3CC2N 2XHCA 2BE7D 1ESVA 3CIPA 1OZ2A 4CCNA 1VQLI 3CC7T 2SRCA 3R6NA 4CEQA 4QQGA 3TW7A 3V8JA 3T9NA 4E7ZA 2JT4A 4PKIA 4BVOA 1QHGA 1QVFM 3UKGA 2KYBA 1KU7A 5FLXZ 2HWVA 4M77E 4S05A 3QYGB 1T03A 3QDRB 4EJVA 3IH7A 4YIIA 2A5XA 1U84A 1NKBA 1D9FA 3IFRA 3R0JA 1N39A 3QUIA 2JTVA 1M30A 1LV5A 2HNHA 3I8BA 3ZX2A 4RGRA 3W6KB 1RGIA 1QZEA 1N75A 1WH7A 3MEDA 3QYHB 1AKHB 4CF1A 3F3XA 3NRVA 2EYZA 4AFQC 5K5QA 4ELYC 4KHPK 1S1NA 1G3SA 2OTLI 2K57A 3H92A 4E1MA 1JLBA 1ZUYA 3H1CA 2O9SA 2ZJQF 2OX7A 1GLAG 2VODA 3GTOJ 3A8OB 3E7LA 4GYIA 4FWKA 3TP0A 4QVZA 2HBPA 3WHCA 3M7GA 3ESWB 4B21A 4M7DF 4B09A 2PU9B 2FEIA 2Z1IA 3EZ5A 2DEQA 3OYBA 1ARKA 5M1PA 1M1KC 1SFKA 1QWFA 2E71A 5FKKA 2OTJI 1VQON 4ENKA 5GAN5 4RA2A 4H5VA 3TDUC 2GTJA 4PLIA 1RBUA 1TUYA 3WNHA 1SUQA 2BYVE 3HKSA 4M75D 5GMKh 3H36A 1ERDA 3D2FB 2W84A 1T56A 1CZAN 2IVWA 2R7OA 3V9ZA 1JUMA 1NMNA 3M3YJ 3ATVA 2PX9A 3VEVA 1GL5A 3CC2I 2BVLA 3CCLA 2EK5A 2DBBA 2GBZA 4M75C 4Z94A 3I56Q 5ED4A 5C12A 3HPOA 1UA1A 4LG3A 2P9KB 2J06A 5GAEJ 2VOPA 2DVJA 1ENHA 5KH6A 1JXOA 1EH6A 5JI6A 5J4YA 1QSSA 3DLRA 4EJYA 3COAC 1OCTC 4N4GA 3KLFA 2JA8J 3G1LA 2ABLA 2MK5A 2YUOA 1Q95G 1HYZA 3SUQA 3OR1C 4GV6A 2MWPA 2OJED 3HGGA 2IA0A 2X48A 1EX4A 1K9AA 2C0IA 4HAMA 3PO4A 2F5DA 1BI3A 4YHHK 1W5TA 3N97A 3J81Z 1J7KA 2QCOA 1U8BA 2MLKA 4JNEA 3EEQA 2QUFA 2IIMA 2BE9B 2L01A 2F5TX 5D6WA 3E2UA 1BB9A 1UFFA 2V7ZA 3GFMA 3GF5A 1WFWA 2ZJ2A 1TTHB 2EA2A 3AO5A 3DEWA 1RABB 3AG1H 5GAN2 1O7LA 2QAZA 2EIFA 4K41A 4H5TA 2KRHA 4E9GA 1KU3A 1MH3A 4CCHA 4LF4K 3B6PA 2EVRA 1DDNA 1BR2A 4O44A 2RQPA 4FM1A 3QSUA 2WV0A 3R4KA 2LBFA 1WJCA 1TUUA 1RT4A 2GOXB 5GTIC 5CKEA 4JBAA 3NAEA 3NHGA 3B8AX 3CJRB 1KFZA 1YE9A 3O3FA 3KEYA 1LWVA 4DTNA 3K6GA 2YNGA 3RQIA 3MEEA 4Z4HA 4U0YA 1L0OC 3AG2H 5F0FA 2RHKA 1VQOI 2CS3A 1ZGWA 5E17F 4XSZF 3CMAN 3EGXA 1WNSA 4II3A 1QVFS 3CFOA 2R57A 1VSKA 3V42A 3SQNA 4ZYDA 2ABKA 2IGIA 3QODA 4BRCA 4K2EA 4GFBA 1BOTO 4QQDA 2YNFA 5DM6F 3AVNA 5AQSA 3S1QJ 3KTQA 3A0BC 1S5JA 3FIWA 3U8XA 1Q1HA 3G71A 5CKBA 4Z2YA 1EH7A 2A0FB 2RM4A 4AQYK 3LA7A 1TAUA 3OYLA 1M4ZA 2CUJA 2L3DA 2OBPA 1T3SA 5ICCA 1AWXA 3ZQIA 2R7SA 1NK4A 2OJ2A 1K73U 3A98A 4AVZA 2WAQN 3HOTA 2LTOA 3KYLA 2O7OA 3ZSZA 1YJ9T 4HVVA 5IPAA 3QG1A 2W6LA 1G3WA 2CUBA 2JK3A 5EGOB 1M3CA 1CZ9A 3MKYB 1J5OA 3DI6A 2ROLA 1RLPC 4AG2C 5GAN3 1YJNN 2FC0A 2HVSA 2QVOA 1PKTA 3F9KA 2O8DB 4DR4K 4CHUA 3MN5A 2PUOB 1YW9A 2QYZA 5J6XA 1N9RA 3T69A 4PJMA 5HS7A 3U3GA 3HB9A 2KQRA 2RN2A 1ZBLA 5J26A 3WXKA 1NJIR 3QFPA 4NQWB 4C92F 4CERA 3VQEA 1LWEA 1LFBA 3KXTA 1Z26A 4IFVA 1UMQA 3QYFA 4B9UA 3M8RA 2ZC2A 5AQGA 3O4NA 1ZH5A 4C0GA 1NK7A 3HRUA 1E3HA 3WTYC 1M1EB 4M73A 4M9ZA 1KQSP 4Z88A 4BY9C 4UXNA 1D8YA 3VQDA 2QG9B 3A5ZB 3IKTA 4KFCA 1Q86U 3CQTA 5J8CA 3CMAI 4XK8E 3VS1A 2RK2A 5CK9A 1SVMA 5IWAK 2AXLA 3FB9A 5DUIA 1Q82R 2E1MB 1LPQA 2A3ZA 3RMCA 1QW1A 3IAS2 2LNBA 5EG2A 2CFXA 5DD4A 2EV6A 3H5RA 3ATUA 3JXUA 4BRIA 3J8AA 2XRNA 1PNJA 5GANe 5A2QK 4UB6C 3L2RA 1RAIB 1DTTA 3J7ZI 1FBSA 2MOXA 2MYSA 1E7OA 1MU2A 4MO7A 1U9OA 3SZTA 4DQQA 1SAXA 4GW6A 1HYSA 2FL7A 1IUYA 4M3BA 2YSQA 2NUTB 1KXPA 2L0AA 1BOAA 3O3HA 4I98B 1WJ5A 2X4JA 3ULQB 4EHUA 2KJCA 1EF4A 4YOVA 3ZR8X 5MLCQ 1SMTA 4WX9A 2WB1A 2HDDA 1B9MA 2K6DA 4FYVB 1UTIA 2HF3A 5IYDJ 2CZ0B 2HVIA 5GMKi 1N77A 1K6OA 5KI6A 2PJRA 4XTUA 4KGZB 4NLBA 3N4PA 3UA7A 2VPRA 1NGBA 2QKLB 4FLUA 2FHDA 3BZKA 2JTMA 1MDMA 3D5LA 2OI3A 1M2VB 1RI7A 4PL7A 1YJNI 4OPKA 2DT6A 4BRQA 1SFOJ 2Y4XA 3EUHC 4KB1A 2KPMA 4Q48A 4K25A 3CC7A 4CYCA 4H4KC 2ZZDA 2MSYA 3CMMA 1HSJA 4LB6B 3M6GA 3VQCA 1YQLA 2H3EB 2JUGA 3SEMA 3VQ5A 1XG7A 4LF7K 3PJRA 2MWOA 1AWCA 1VQPT 2DRMA 1H1VA 1VQLQ 4IUUA 5GAN7 4ZYEA 2V9VA 2NUPB 3GLLA 4R0KA 4HNVA 1LWYA 2XK0A 3LDLA 4OX9K 1KSWA 2CUZA 3W0LA 4BC4A 2W04A 2A68F 1AHJB 3MEWA 4RM2A 2M34A 2VQEK 3OV8A 1J2XA 2F96A 3VSKA 2LFBA 2XY8A 3QBWA 3OSGA 4D9JA 1GLEG 5LJ5e 5GADP 3RBBB 4LG0A 1U2VB 4YORA 1N3AA 1P9QC 1QVPA 4D7MA 1OYWA 1RC9A 1YTAA 4DSKA 3DKMA 3DLLA 4CEFA 4HBLA 1RDDA 2WUSA 4JP0A 5FWCA 3EETA 5JMVA 4M7AA 2NVYJ 5DLQE 4BDZA 2IEKA 1WXBA 2QK0A 2E12A 2IGMA 3I3LA 4BR9A 1Q81U 4ZYAA 5FROA 5GANj 3DXKA 4WQ5C 5HK3A 1QS4A 4X6AJ 2DBKA 4KT0E 4H0XB 1SD6A 3UDCA 2KRMA 2J4RA 3V7SA 3KNTA 1K4TA 1WX6A 4UC4A 1G8XA 1S6LA 1F9NA 3C65A 4CJPA 5AQPA 3TSQA 1W36D 4CFCA 4BB7A 5LHGA 4KH1B 3CCRT 1OCPA 3OYKA 2CH5A 2STTA 2Q0OA 2ENMA 3W2VA 4OFHA 1LOTB 2NRVA 3AVLA 2BTFA 3M54A 4EZ6A 3CMEN 3T1YK 2CUFA 2L4MA 1KG5A 1W36C 1DIZA 3ULEA 2OTJQ 3QPTA 5CKDA 4U88A 2XSJC 3MP8A 5AQIA 5DK5A 3LL3A 1Q7YR 4YELA 4E7KA 1Q86C 1FPQA 1I1SA 3ME9A 3TGNA 2I8DA 2FQ4A 2XGXA 3J7ZO 2ESNA 4XM3A 4IX7A 2QWNA 5TISC 3CVTA 3UB5A 4X1VA 1UGRB 1WFXA 1Z9ZA 3K2AA 1UEBA 4NCGA 4LFAK 4FL6A 4I7FA 3CC2Q 4CEBA 3J7AP 3H0FA 3NARA 4DFJA 1NK3P 3M4GA 3AVCA 1U5SA 5GAHP 4MEYF 4CHPA 1OKRA 4WCGA 1MNMC 1GLCG 3CEYA 1RKTA 5DCMA 2RH2A 2JVHA 1MMSA 2YG9A 1SHGA 2FZCB 2O9VA 2VWBA 3HTUA 3Q0UA 1HBXG 3C2BA 2F6CA 3OHRA 1RRJA 1I1JA 5ICGA 2PY5A 1NH3A 3SWNC 1YQKA 3AVIA 1HYVA 2XDVA 1IBMK 3LAJA 1AKHA 3CQ8A 4JJCA 2KZMA 2XKPA 4HNUA 3VYGA 2HFHA 1XHZA 1RT3A 3O3KA 2R7RA 3G7ZA 3VS6A 3EN9A 2CQ7A 1OISA 3U1DA 1SPKA 1HDPA 3C0BA 4AYBN 1X3MA 4ISGA 1E3MA 3JR9A 5EEGA 2F4OB 4AWXB 3MKWB 1XB4A 1ORPA 2RF0A 2FOKA 1TTYA 3OYCA 3OS5A 3MHXA 2O0YA 1EBMA 4BR4A 3I59A 5FD5A 1T39A 1GT0C 2YHYA 4CF8A 1UJ8A 1OOTA 4DOWA 2ZJRL 1D3BA 4FWQA 3M0PA 2GAUA 3S1RJ 1WBDA 4QIWN 2DFFA 1QQCA 3CCEN 4WE1A 2L9SA 4Q5VA 4LLLA 2GOMA 3CCMN 3HOVJ 3LX7A 2PQ8A 3CLQA 3WODF 2FBTA 4ZZLA 1RRQA 1E2XA 1OR7C 4CICA 1DPUA 2NOIA 1S5LC 3M5RA 2KFNA 1SL1A 2R7QA 2IVOA 4TVRA 1HX1A 2DXTA 3WU0A 3CMEI 4LFCK 3MX2A 1EQYA 4XIDA 2VT3A 3DLGA 4NLCA 1VQOQ 3D2FA 3LPUA 2HXOA 3FMQA 4OIQF 1RR7A 2DEUA 1YRNB 3BR1A 1TV6A 5FW9A 2KGTA 5C6SA 4ID1A 2QQ8A 4CEAA 3SFIA 4MQVA 2P9KA 5M3MJ 4P96A 2K3PA 3HYFA 4PJOA 4RW6A 1TYQB 4KITB 4JPBW 1YJ9A 3DWLA 9ATCB 2OV7A 4FLWA 3OR2C 5C4JJ 3R6MA 3JYTA 3BR0A 4AFUC 4F52A 5KCOA 1HYOA 4Y7NJ 3AT1B 4JKAA 3KBGA 1W4MA 3G6EA 2DFEA 1WJDA 3Q5FA 1WH5A 2DLLA 4FT2A 2NVUB 3QPSA 3GFIA 3GBQA 2G9WA 1TWHJ 2IPOB 1UWBA 4G94A 1V5EA 5KTQA 3IP4B 4DFPA 2OZ6A 1BOBA 3CJ9A 1KFDA 3JCMX 4LSNA 4DTUA 2DMNA 5FKOA 2K7LA 1ZTRA 5A0LA 1YHQN 3UWNA 2ZNYA 5CYQA 1LPLA 2NRHA 4M75F 1TWBA 3LWIA 3KP3A 1VQKT 1FMKA 3QZ9B 4EMKC 2H3JA 3CTAA 3OYHA 1JKQC 1YT3A 4IURA 2FMYA 4CXFA 2NYXA 2E6NA 3PIOA 1GLFO 1BI1A 3HZJA 2EQJA 2PG4A 4XU0A 5FLXE 2JS2A 3CWSA 3CCEI 2FSNA 3I5UA 4FL9A 1XTAA 3CCMI 4YRVA 3GZ6A 3FSPA 4UVAA 1IJWC 3K10A 1CF7B 2DD5A 2ZE2A 1A5JA 3OYEA 4ZGJB 4GLKA 4EMHA 2NUBA 4X9DA 2A6AA 3DJCA 2EFIA 1LWWA 4QLCU 4A93J 1R22A 2I5WA 2E8AA 1O3RA 2KVQG 5A0DA 4XRMA 5FFZA 4EA5A 1B7TA 3S3MA 1WSIA 5LEKA 4JK1X 4FK0A 3V1RA 1OYIA 4IO8A 4NBQA 3BWGA 2GCXA 1LW0A 5HDKA 1PHTA 4RW9A 4UUSB 1OKJA 5T7BA 3M4YA 1MNDA 3KWIA 3DRPA 3CZ6A 1WDXA 4N4IA 2FBHA 4L9NA 3FFIA 4OMLA 3JRBA 1JKHA 5CR4A 6PAXA 1I6HJ 5HL7L 3M0UA 3D2EA 1SMYF 3JCMP 1V5FA 3MEAA 3NH0A 3IV5A 5E8GA 2JA7J 2E2IJ 4XLFA 5AFUA 4B1WB 2HNYA 3LSPA 5D7UA 5IXBA 3ZSRA 2CQKA 2AQEA 2ZM6K 1CKBA 1RPWA 2DFHA 5E79C 4BRDA 3ZQCA 4CF2A 4ICLA 4LDXA 3PNWC 3HO1A 2G6FX 3NFAA 5IHNA 1KONA 4HG2A 1QKWA 4FT8A 2IS3A 2GZWA 4CZJA 4E70A 1JUPA 2OTLT 1ATNA 4FHTA 2IVNA 1IDYA 3HSRA 1RTHA 4DV1K 2HMAA 1VQNN 4IEIA 4LFBK 1OCOH 2KRNA 4EGZA 2JG6A 1H3HA 1YHQI 1WUAA 2KHOA 1YJNQ 2CP0A 4D8DA 3BQZA 4MLOA 3OYMA 1JT6A 2X1EA 2H1LA 1VQPA 2KSSA 4DSJA 5CZ2A 1PVSA 1TOVA 5HLIA 5M9OA 3KWGA 1IV8A 3CUQA 2ETJA 1C1CA 5DM7R 4ZGDB 1W1FA 1RUOA 1PU8A 1ULYA 3J81E 4XOTA 3R0AA 4M77F 4IDHA 3F10A 5GAMg 1YBYA 2HZTA 3K69A 3ZN1A 2QTVA 3GTMJ 4OB3B 5KN9A 5KPTA 2PEXA 1UGPB 5J2QA 3EY1A 3CF2A 3J81K 1S6QA 4WFBL 2HMPA 3QPHA 4CHZA 3PX4A 5DMRA 1R5ID 1H88C 1Q18A 3VEPA 4C8QD 3HL8A 3WXJA 2G8WA 4LD6A 2KROA 4E7IA 5TRDA 1L3TA 5DDGA 4UVBA 1WJSA 4CF0A 3EG2A 1RZ4A 5LL6S 4ENNA 3WQTA 2NUTA 3W2WA 4C8QC 5GAOr 3HGYA 3QO9A 3RSEB 1PKSA 4EP5A 4E9EA 2A5YB 3G4SA 1QWEA 3CCST 2M0CA 2I0NA 2LNHB 4A12A 1X2QA 2PFUA 5IHIA 3M56A 3O6WA 1JBMA 1JXBA 1UHMA 3LZJA 2JUFA 2EIMH 2YG8A 1W7PD 2M8EA 5HY6A 4A5NA 1E17A 4H5RA 2K85A 4AM6A 1XCVA 4J8FA 3HVRA 1W4SA 3MWTA 1K76A 2QQSA 1M2VA 1K4US 2LKXA 4DTJA 2B9SA 2YRDA 1UHFA 3AY9A 4E89A 1WHMA 2K3YA 2GXBA 5BNGA 1S9EA 3BLYA 3UA6A 3M0TA 1GUUA 1VQNI 2B4JA 3QETA 2YHWA 2GQVA 1JCFA 1APLC 1J53A 2TDXA 2BGCA 3S93A 3C3WA 4AU7A 2NS0A 3T1BA 4HHTA 1YNZA 4OLBA 3ZOBA 4L5JA 2LJ3A 5GPAA 4XBFA 1M9SA 2R7FA 1KU2A 2NUPA 4KULA 3HYIA 1T8IA 1AOJA 1AHDP 2XY5A 4YFXF 1RT2A 1HSQA 4H0PA 5HOOA 1T08B 2ELKA 3RCOA 3CBOA 1D09B 4DLEA 2AP1A 2XU8A 4XQFA 2Z9OA 2EQKA 2P0QA 1JQQA 1X1BA 4AM7A 4EPCA 1I27A 1NTCA 3PVQA 3LA2A 1SG5A 4DS4A 4F92B 1BQMA 2LQKA 4M3RA 2NRXA 1XGOA 4FJ7A 1X75C 3K5NA 3JRGA 2M0OA 4LH4A 4QS9A 3D45A 2E4HA 1E3PA 1HLVA 2XRLA 5KE2A 5FPEA 1VF9A 2MLGA 2NNNA 2CG4A 1LE8B 4C2TA 2J5PA 1OLTA 3MEGA 2LJ1A 5GAN8 1BBZA 2ATCB 3THWB 4XAXB 2V8KA 3SUOA 5LRSA 4DEXA 5J3LA 2R7YA 1NBEB 1OPKA 4IHXA 3LDOA 3QEIA 1SSFA 4QWQA 3PM1A 3GPLA 4BKXA 4GKKK 4PNOA 4NNJA 4M6VA 1U2WA 5EJCA 2KYMA 1JLQA 1VHXA 1M90O 3D5SC 3SJMA 3AL0C 3L6QA 2JVGA 2RQRA 1R36A 2VQLA 5GAOp 3GFJA 1ETYA 4HXJA 4JI2K 1D5AA 1N27A 3H1VX 2GQIA 2YUNA 1JXEA 3G4SQ 3G10A 3MDQA 5IYBJ 2NOFA 3CMEQ 2KIQA 7AT1B 3FBNB 2DT7B 4RGSA 3TEDA 2E10A 2ZQBA 1MJBA 3HHGA 2BV6A 2K9SA 3VV0A 5FRNA 2AXTC 4C0DB 2Q0UA 4DQRA 4FYYB 3FZKA 2HHWA 3SHWA 4G12A 1XUPO 4M7DB 2E1YA 4FK2A 1K9MO 2R7UA 2BXZA 3BTLA 3VRYA 3OA9A 3WQUA 5FU6B 1RDAA 3R2XC 2BDPA 5B8HA 3O8GA 1VQ4T 3VTIA 3CMAT 2K5FA 2ZPIB 3VQPA 2X6OA 2YR2A 3JRDA 3C6UA 1GCQA 2NYSA 3IWZA 1R5GA 4BEHA 2V1RA 3FXQA 1RAEB 3I33A 1R1VA 2FG0A 1MUDA 3N4QA 4JI0K 2EV0A 3L8BA 1DP3A 1VQ7N 3EE9A 3RKWA 3X20B 1K7AA 1TLHB 5CVRA 2HW3A 4N0AC 3BTIA 1NEGA 1TT0A 3JCMc 4U67L 2FYKA 4IHVA 1VQKA 1VSMA 3FHGA 4TSXA 2E70A 2COYA 4KISA 3LH5A 4M7AG 2STWA 3P83D 4CZIA 5C10A 1NEBA 5GANh 2QM1A 3EYZA 5LJ3f 1RAHB 1YW7A 1C1AA 1U0JA 2DA3A 2CGPA 1WCMJ 3ASMA 2XD0A 3LYIA 1VK0A 1U9NA 2WY7Q 3WU2C 3HEFA 2M4KA 2XAQA 3QOPA 2W48A 3M55A 1NJIU 4DCHA 3L7WA 2PUKB 2P5OA 4HX4A 1LDDA 5GAOn 2DOAA 3CCEQ 2NRTA 3GZ5A 2CJJA 3CCMQ 3O5BA 4YY3K 3A5MC 3GUDA 1T05A 1STZA 2K86A 1VQ8T 2KW4A 3KD1E 1XS9A 1FLIA 3VW4A 1MBHA 4XKCA 1YRNA 4KN7X 2Q1ZB 1IKYA 4JKDA 2ZWHA 2W7NA 1TC3C 5E18F 4A3KJ 3QEVA 1N9SA 3H0IA 3I0RA 3HP9A 1KG1A 3JCMg 2GA1A 5ILVA 5AZJB 1Q82U 4N41A 2OAUA 2HEQA 4HTUA 2DLPA 1TYQA 2JHJA 4IG3A 3OGDA 3X25B 1O1WA 1MJAA 4FWNA 4FOIA 4EDUA 5HODA 1LB2A 3ALYA 2LH9A 2K40A 4IIOA 1GLNA 2UUAK 1VQMA 2D6FA 2F5CA 1XC9A 4CJSA 1LEBA 1Z91A 2DKGA 4B1XB 4D8KA 2KP6A 5SWMA 4ESJA 5LEJA 3NVMA 1BW5A 1A04A 1D8JA 2M9UA 3I55A 4L8RB 3FXLA 4BXXJ 2QA4N 1Y7XA 1NPPA 1VQ7I 2BH1A 3THYB 4UQGA 5DUKA 3CWUA 1NWKA 3HIFA 2G7UA 3FLGA 1WIEA 2JW4A 2E3HA 4FZZA 4FW2A 1RUWA 3CYMA 2OZMA 4M7AE 1MWKA 2JLEA 4N56A 1NJXA 3LAMA 2MD0A 2EFQA 3SBTA 3KCCA 1A35A 1ATRA 2A40A 3JB9D 1Q9YA 3MO8A 2VYPA 2DPDA 1YHQQ 2DDAA 2EWSA 2BVMA 1HQCA 2VQCA 3HM5A 1TT5B 1NG7A 1RBRA 1YI2N 1LKXA 3K5LA 1NK6A 2JHNA 4CGDA 3VETA 1GHCA 1OX8A 4B1YB 2JGUA 3MN9A 4OPHA 1MDUB 3IHUA 2EJRA 2D0AA 3AO1A 1Z25A 3HKZA 5GJVB 1PUEE 1S29A 3VUZA 2H09A 4R8HA 2K9MA 1I50J 4E1NA 3ECOA 4ELTA 4M9SA 1GLBG 3O1WA 3REOA 3RYRA 4CC3A 1RETA 1SEMA 5EDNA 4C92B 2HOTA 3S3NA 4EP4A 1IXDA 2Q2EB 3OIOA 6AT1B 5LL6Z 1FP2A 3TKYA 3G1OA 4AIDA 2YHBA 4AH9A 2ZJPL 3CF5F 4Y52J 3CCSA 3VS3A 1P90A 4JYAK 4BS9A 2BKDN 4HEA2 5LFAA 2WC9A 1BR1A 1WI3A 5FFXA 3PTAA 3BY6A 2NRAC 1HNWK 3MXMA 1BC7C 2AHJB 3UNGC 3KD5E 3KPHA 2HU9A 2L9NA 3ZMVA 4IF4A 3F8FA 3LZIA 1PSFA 1QU3A 1JUSA 2AZVA 4LC9B 5BR8K 4KB0A 1W2BS 5L3GA 4DHYA 4B1UB 4FJ9A 2LVMA 2QA4I 1ZUUA 1ETKA 3CQZJ 5KCMA 3TTFA 5IN1A 3IHOA 4JDSA 4HNTA 3KETA 3P39A 2HOEA 5C24A 2CT3A 1XSXA 2ZPGB 3CCUN 4IUPA 4ENMA 3FHFA 1KRPA 3ZBDA 3OH6A 2EYWA 3MPUB 1ABQA 2ECZA 5CVIA 3B6OA 2HDWA 4R1HA 1BL3A 2X4XA 4AIAA 3TWHA 3I55Q 1VRLA 1VQNQ 2D8HA 3U9DA 1NNEA 1W5SA 3A8GB 4DF8A 2R5YB 3URGA 4ANJA 3F70A 3MAJA 4HW0A 4MZPA 3M9AA 5JR3A 4G7OF 1YI2I 2EA4A 5E3LA 1XN7A 3V6DA 4CZKA 1FSEA 3K4LA 3CMET 1MPGA 2W4SA 1TGOA 1L3LA 4JZ3A 4Y91A 1TUGB 2E5QA 1LDJA 2GQQA 2UXNA 4FJLA 4GRIA 5E20A 2JM8A 1GV2A 5FU7C 4KH5A 1B6AA 1IRFA 5AQRA 3S2HJ 1Z3YA 2FF3B 2RNAA 4BRKA 2LLKA 4J2BA 4P5OA 2E1CA 1EP4A 3TSUA 2HGCA 1H89C 5D5VB 2VKDA 1S6PA 3S32A 3C94A 3GLXA 2Y90A 3QP6A 3CBMA 5GINA 3BDDA 3VGMA 4FQGA 2KLAA 4HTLA 2JS0A 4PJOE 4JLIA 5BRDA 4BHBA 1VTNC 3RUXA 3LANA 4XH4A 5BRHA 3DWLE 4KHWA 1Y0NA 1RRSA 2VBXA 4CJVA 5KYUB 2VUMJ 2L8DA 3VMFB 5F1JA 4QVDA 5EG0B 3NPFA 2PVDB 3F6VA 3D7EO 4PUOA 4AUXA 1Q9XA 3RSNA 4B1VA 4DQSA 3PO3J 4EVVA 1N34K 5AN4A 4FJXA 4G7HF 4J00A 3C7NB 3L3VA 2M9HA 1EO1A 4DLGA 1QSYA 2DXCA 1ON2A 4MNUA 2YLCA 1KG2A 1DU6A 1MBGA 1KQ8A 3BG9A 2I10A 3UKRB 2B7EA 2XF7A 4JKBA 5GMKm 2D0NA 1GLDG 2Q31A 3CCUI 3R1XA 1H3ZA 4F2RA 4M7AC 3WG9A 2IPQX 1Y71A 3HTVA 3BR3A 4PLLA 2KRFA 2HZYA 1FIPA 1X4OA 3GTPJ 4C8QF 5ILSA 2DTUA 4TV7A 1VQ4A 1PG5B 3IS9A 4KRTA 3O5ZA 3BFMA 3M8JA 4KIFA 4AVPA 2NOEA 2JZ2A 2X78A 1X27A 2FRYA 2EKHA 4BE2A 2IS6A 5KYNA 4C5HA 1Z67A 3IMXA 4B9NA 2LP5A 3CC4T 4FK4A 1S72T 3H41A 3KLHA 5IXFA 3VUBA 1J9IA 4IZ9A 3VQ9A 3OYGA 3C18A 2YI1A 2DM1A 4LD0A 1F1ZA 4B3MK 1FYNA 4JJBA 1ETOA 5D8LB 2E2HJ 1YWPA 2AKKA 2KRCA 3F0CA 2JA6J 4EV0A 4IO9F 4RUGA 2BXYA 5AR0A 2BY3A 3U21A 4I99C 2XG8D 3SAHA 3VOVA 2UYTA 2OPPA 1NYFA 1WZOA 1IREB 1MBKA 4DTMA 2GFUA 2DL3A 1AT1B 1WRJA 1Y07A 3THKA 4LF8K 1MZBA 2KISA 1QBJA 3H1QA 3CESA 2Z16A 3S6IA 2L3PA 1ZUKA 5GMKe 1VQ8A 1NOYA 1GLLO 1A6QA 3T1AA 4G6TB 3LL7A 1RAGB 3AKZA 3BCBA 4RTXA 2FQ3A 1K73O 4B8CA 2CP5A 1FXXA 1ZHFA 3FEOA 2DJIA 2MIOA 1JT0A 1T38A 1H9TA 1I39A 3RWUA 3ZRGA 1P7JA 4CJ5A 1HKCA 4KIBA 4F16A 3RPUA 1XQPA 4ZJZA 2MG4A 1BCOA 3NH1A 3ZP5A 3OH9A 1XMOK 4BDYA 5GAMj 4QSHA 3HXLA 3F2KA 3GDQA 2WADA 4XKWA 2VXZA 5IP7J 1KZHA 1XMAA 4M7DA 2P0PA 1TVRA 4KA4A 4I2PA 2OPSA 4BRFA 3SZGA 4BRAA 2W82A 1JLEA 1IAWA 4Y0WA 3K4CA 4CC4B 1Y8RB 3PGGA 4NO7A 3ABTA 2BZ8A 4L6V5 4F55A 1BA0A 3CPWM 3A01B 4CCMA 3K4MA 2VB6A 2ZJPF 4XN0A 2YPRA 2COZA 3ISPA 5I22A 1HOMA 3P38A 3T3FA 3ZMZA 3JRIA 2OPRA 4M74A 3UE5A 5F1XA 2J6KA 1B3QA 2Y2ZA 3ID8A 3QIPA 4CA0A 2ZPFB 3IH4A 1XGMA 1LAWA 1WHLA 5GAEP 4N0BA 2NS8A 2G8IA 1U5TA 3VQ4A 1Q86O 2VXDA 4N4NB 2LF8A 3LSRA 1IHWA 2OQGA 4PJOD 2E20A 2FD5A 2D5VA 2X35A 4F7ZA 1VQ7Q 3KK7A 4A0XA 1VSLA 3EKUA 2EX3A 1JJ2P 5J2MA 3CM5A 4BH9A 3KKSA 1YIJN 3TVTA 3P8HA 1G99A 5JICA 4RCBA 1PCXA 3NAUA 5F6FA 4FJKA 3HPWA 2GLOA 1UOCA 3BDUA 4PJOC 5CQEA 3X26B 4UNFA 5JVHL 5E84A 5EEHA 4I76A 2EYXA 2ZPHB 2YRCA 3JRCA 4O3MA 2DW4A 3IRXA 4BWJA 1SAZA 2RNJA 2OPTA 3QB0A 2W03A 1QVUA 1KAYA 2KT0A 3JB9J 1YJWA 1WWXA 2P9LB 3G0QA 1VQ6N 1UHSA 5M5YJ 8AT1B 3FM3A 4FLVA 5EOYA 4I2QA 1Z7LA 1FOXA 5A2QO 2CV0A 3ZQFA 1IHVA 4FM2A 5HRSA 3SNNA 4M75B 5DCFA 3EG3A 1G2BA 3BR6A 4HF1A 3HM8A 4BVPA 2VKHA 3CFPA 1IDZA 3FIFA 1I5OB 5AZJA 4CJTA 2NVQJ 1XOVA 3CCVN 1BC8C 1REPC 4X9CA 4FJMA 1QCFA 3PFSA 1QLYA 4DOVA 4BR5A 4XU3A 4RM3A 5GANd 4OAYA 2HCKA 1XWLA 3CCQI 2AS5F 2P9UA 4DBRA 1JL1A 3H46O 1G6NA 4PJ0C 3UATA 4O5VA 5BN8A 3DLLL 2X85A 1WQWA 3BY5A 3D6RA 4HX7A 2VC8A 2LOOA 1WSEA 1ZRDA 2RNGA 9ANTA 3VEXA 4CIGA 1F4KA 4A4EA 2QKMB 3THYA 5DYMA 3D7SB 3DXJF 3WEEB 1EWQA 4D5CA 4WF9L 2X74A 2KIFA 3FXKA 1TNSA 4OKEA 2QEXI 4DU3A 2RHXA 1HKSA 2QA4Q 1BN5A 1PWTA 2A61A 5IT9Z 2DMPA 1X1AA 3OMGA 3L1PA 5KYXB 1CKAA 1KD1U 5EX5A 1Y96B 1WHJA 1YIJI 4A3GJ 2CH4A 3JAMZ 3CO7C 1ZK8A 3ENHA 3I9QA 2FNPA 3SMSA 4PCQA 3OQ5A 5L3FA 1ETXA 1K83J 4ZDOA 1B72B 4DV5K 3VYSB 3HSFA 1Q81O 1KC8R 1OPCA 2LVSA 3W3CA 3EL2A 3DU5A 3IDHA 5AQKA 2LSNA 2ZMEB 1KJWA 5HCKA 4YPHA 3GTLJ 3CPWS 4YOQA 5KK1A 1N8RC 3VQ7A 1VQ6I 1LDKB 3HBLA 1R4MB 2K5IA 2H8WA 5KCHA 2PVGB 3Q1JA 2P4TA 3A1YA 3LQRA 3QP5A 4QAGA 3GBGA 2RJDA 4CEEA 4Z0UA 4B6MA 4MO4A 1SAUA 1JJ2A 3R3LA 4RLQA 4BNCA 1JLFA 4H03B 3GOXA 1JLCA 2OANA 5AQHA 2F4VK 3B6AA 1YJWQ 4B3XA 3CCVI 4XRFA 4XLPF 2EV5A 3SB2A 3GP8A 5AFUH 3S2WA 3EG0A 4C0FA 2K4BA 2L3RA 3I5SA 1JO8A 4JI6K 4BRNA 3CUQC 3FFKB 1OV3A 2ZB9A 3JB9F 1Y1WJ 4FT4A 2XICA 1U6GA 1GXQA 4XH5A 1QSLA 3U3YA 3KTUA 3EGDB 3M07A 1N6QA 5CAIA 1SVOA 2YNIA 2F5FA 3REBB 2P5LC 1PD1A 3KE2A 1T44A 1XI1A 3FZVA 1A5VA 2FBXA 2F48A 5BR9A 4HF2A 2ITMA 2O8EB 1HNXK 2MD5A 1J5EK 3O3GA 1ILYA 2QWQA 1Z0XA 3LSHA 4F3QA 3A1PA 2EQIA 3PNVA 3H35A 3VQBA 5CHZA 3L1AA 3ER0A 3R6OA 2IIRA 3VDXA 3EUKL 1QQIA 4IXCA 1MBFA 1SS6A 4Q5WA 4CGIA 4W97A 1SD5A 3MN2A 1ASUA 3CCUQ 3SK3A 2QWWA 3CC4A 2HBLA 2W25A 5KHDA 3G73A 4FZYA 3TAMA 1XQOA 1S72A 1MGQA 4EJZA 1VQ5A 5LJ5f 1JTYA 3VF6A 3K5OA 3LWFA 1JRIA 3I0TA 3H3NO 4B3TK 1OU8A 1JHHA 3ZETA 2RE2A 2YU3A 4BQAA 1WJRA 4BC2A 5K7HA 2KT8A 3BZ6A 3EFOA 2Y1IA 2ISYA 3SZ2A 3SUPA 3NNQA 2TCTA 2QTDA 2JPBA 2DT5A 2FE3A 3ZSXA 2LRQA 4A3MJ 1PSEA 3ROUA 2LRDA 2X6XA 1NG9A 2JOYA 3C2GA 1X6BA 1FEXA 4J7FA 2H8RA 3HDDA 1KG6A 1TKZA 4C8OA 2DCEA 2MW8A 4EFHA 1QZ6A 4FJJA 1LEAA 3PUFA 4OMOA 2KTQA 2NOHA 1L3VA 1K1ZA 3MZ8A 2M2EA 1IG9A 5B66C 2Y9YA 3CCLN 1XNIA 1NGGA 4BQLA 4E6RA 4BDPA 1O3TA 1PDNC 1HXDA 3ZCMA 2GWJA 1KD1C 2M7AA 5EG0A 1MIJA 4PJJA 1KEAA 4OMNA 3FDYA 5CVVA 1WNLA 1HNVA 3T8TA 1OYXA 4G9YA 1HC8A 4HSRA 3NWSA 3CO6C 2ZJQL 2JM9A 2PBIA 3FHZA 2UXXA 4LOCA 1WYXA 1YTUA 1NK0A 3PSIA 1V29B 3O8MA 2D4WA 1M90R 4BY6C 2XVCA 4BHCA 5C0MA 1E3OC 4YOUA 4KJZA 3UKRA 4HF0A 3DTIA 5AQJA 2NXNB 3ZX0A 3U4LA 3LDQA 3CFRA 3HL2A 2E6LA 3H6EA 1WA7A 4F3TA 2A6EF 1ZLJA 4A6EA 3RJPA 2BHZA 2E2PA 5HS9A 4IJAA 2V8IA 2DI3A 1WXTA 1R1TA 5GPCA 3W2AA 4YOXA 3ONQA 4YIFA 1DP7P 3AA4A 2Z1DA 2RK1A 1X3WB 1QZYA 1M3AA 3O9UA 3LP1A 4M3GA 1TS9A 2IW5A 3HM9A 5E1ZB 2O61A 4KIGA 2QYOA 3WU1B 2LT1A 1TBXA 5D4SA 2QENA 1SRLA 3FXJA 1B4AA 3HRGA 2RI5A 2HOSA 4F9OA 3LDNA 2CH0A 3K5MA 3SYTA 3CVSA 4IEJA 3ZGKA 1MD0A 3GNGA 2GM4A 4JI8K 4DW6A 1TU0B 2EINH 2JTEA 1CXUA 3HOYJ 5B1BH 2WY8Q 3GXOA 5L3EA 4G6QA 3QRFF 1J6ZA 3Q3SA 3CCJA 3VB2A 2DTIA 2O01E 3TP3A 1IN4A 1Y8QB 2F5EA 3DLLF 4MMKA 2KDSA 5GADJ 3M8QA 1VQ5Q 4M7AF 5I2MA 1S9HA 1BW6A 3V7RA 2WONA 1EKEA 4HCBA 2KZGA 5FWBA 4A3EJ 1QO0D 5C2DA 4QT7A 1TKTA 4M7YA 3S14J 3CCLI 3G71N 1NGJA 4C30A 1TUDA 3VYRB 1MMAA 3WE2A 2ZXJA 4BG8A 3E5XA 1N6AA 1RTJA 2HVQA 5FLXO 1XPXA 2VXEA 1YIOA 1BIAA 1FBUA 2HQRA 4FLTA 3S1MJ 4DBHA 1F36A 1UB9A 3H9GA 2PLYA 4CFBA 2P5GA 3TAEA 3WXLA 3TO9A 2OC6A 4NXMK 2V1NA 3CXCP 2XHIA 2DK3A 3DXMB 4DS5A 4C3JJ 3KP6A 3OIQA 1C0WA 2OYQA 5LBQA 3KKRA 1XSVA 2KNBB 2A08A 1SKWA 1NKCA 4J5YA 2QW9A 2VBWA 2M0YA 2JN0A 1KQ9A 3U23A 2EYYA 3AVGA 1B9FA 2O3FA 4W5RA 2EBIA 2QSGX 1D4XA 5TGTA 4E47A 4JKEA 1DJ7B 3K7AJ 2QM3A 4CIEA 1YI2T 1BWFO 1ZG3A 4BJ6C 2VVKA 4EATA 3SV4A 2BE5F 2FZGB 2ELHA 1HR0K 3INZA 4CJEA 2LR8A 1X69A 3ZX3A 2IRFG 3A01A 1G2HA 3FMRA 2IT0A 2XHKA 2IXSA 4A2AA 3SWNB 4MGRA 4GKJK 2H94A 4A57A 1O9SA 4DKWA 2UXDK 2CS7A 3OW2P 2DDBA 5DM6L 2JSPA 1MV0B 2NZTA 1ZR2A 3CCQQ 1M1KR 4IHTA 4CD1A 1C6VA 4GV9A 3EFSA 2KKOA 3D1NI 5HLFA 1T7PA 2P9NB 2B5JA 3GTQJ 2GUPA 2D8JA 2LYCA 4M3ZA 2XGCA 1W70A 3GFLA 2QQ9A 4F7UF 3I71A 1BJZA 4CW7B 5LJ3g 2LREA 4M3YA 1QQNA 1JB0E 4DEYA 4J9BA 2P9SB 3GTJJ 1K9MC 2A3SA 3P9KA 3DOLA 1V3FA 3OA6A 3NGIA 3A0IX 3ZEHA 4CZEA 2QEXQ 3WHBA 2OF7A 3THXB 1AZGB 1HPZA 3G71I 2KXCA 1KQSM 1TL3A 2CDTA 4D1QA 2IC3A 3LALA 2DIGA 3CCJQ 1YIJQ 4FE4A 3OOPA 2ZXIA 2RPIA 2VG5A 4PZJA 3KJVA 3KP4A 1TL8A 1UHWA 3VQ8A 3J81O 3KEOA 1GLJO 5AQMA 2VWFA 2RQQA 3LWHA 3WNGA 3LPTA 4BQOA 4BJTA 4XKVA 2EQRA 1QA6A 4NB5A 2WB1N 3D5RC 2PJPA 3L2CA 3IQLA 2ECCA 1F1BB 2JT1A 2BE2A 3ZFJA 2LK2A 3CCUT 3ZSQA 3M4OJ 4M75A 4UUTA 5LY3A 1RI9A 2V7FA 5AYFA 2L7KA 2MABA 1WSJA 4JHDB 1VQ6Q 5ILUA 3NCIA 5GAOq 2GUIA 3GO5A 4CZLA 1I3AA 3H3UA 2QWPA 3K1PA 4AI5A 5GAMh 5D6XA 1RBSA 4XTYA 1SEUA 4A3FJ 2J6OA 5KRSA 1H641 3E1YA 4XH1A 2Y30A 4PJOF 4PKCC 5KGXA 2DL7A 4M7DG 3KFVA 2F5KA 3KYCB 4LUDA 2HYGD 1K8AC 3BEXA 3RMAA 3AAPA 2HQXA 3E97A 2XMFA 1U3OA 1N78A 1MMNA 1GV5A 4CBWA 1Y0UA 3AVJA 3CCVQ 2QBYB 4DV7K 2FXUA 1KA8A 4DQ2A 4NZGA 5IHKA 2OFIA 5F27A 5M3FJ 2FSJA 1FKOA 3BJ6A 4HCZA 3TBIA 2YHXA 5CKFA 3QU3A 3CXCA 1TW2A 3AFHA 1NOZA 1VUBA 4VUBA 1WLPB 1XTDA 1NGHA 2PMZA 2XF6A 3CHWA 3CD6T 1QVGP 3WEEA 4EMKB 4BWMA 2DYIA 5EU7A 2RKHA 1RT7A 5K7FA 4E1JA 4Q0BA 3V4GA 1QKXA 4W5NA 3BPVA 1N3CA 3B02A 4A5AA 4CBUA 5FD6A 3SYZA 2CYZB 3L4IA 3V9WA 3IRQA 2V8JA 3KLOA 4M4ZA 2LDUA 2X6WA 3HRSA 4OGCA 3ZSYA 2AKLA 3PIOF 3FF5A 1I3QJ 1K61A 4KHUA 2DE0X 1LAVA 2FXAA 4W5TA 1IZ1A 3EHQA 2M5WA 1GF