5FRNA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz419 (compound 4c)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
367
structure length
367
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase
total genus 102
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5frnA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5frnA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5frnA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5frnA03
2ZD1A 3M8QA 4KTWA 1Z26A 5FRNA 1X9SA 2B8AA 3SZ2A 3DRSA 3TARA 4CFBA 1T7PA 3AVJA 1S1XA 4F8RA 2P5OA 4HCZA 3V1OA 1N6QA 4CGGA 4CK1A 1YTAA 3SJJA 2XY7A 2BUDA 4CJLA 4K8XA 4GVMA 1YT3A 2Z1GA 5C6SA 4J2AA 2OA8A 3P5JA 4IKFA 1NKEA 2YNHA 5HBMA 3NF6A 1RILA 5KI6A 3AVHA 3AO2A 2XY5A 1RDCA 4RG2A 1FKOA 1U47A 4DTOA 3RMCA 3O3GA 3ULDA 2VG6A 3SQ0A 2HB5A 3LWLA 2KQ2A 3L3UA 2GV9A 4A4HA 4B9NA 3LX7A 3QINA 3K5MA 3DLBA 4FW1A 4Z4EA 4FW2A 2HVIA 3AA4A 4ELTA 2IAJA 4DSKA 2XDPA 2P1JA 3VN5A 4QCLA 3OYGA 1EKEA 4BDZA 4M3TA 4DSJA 5KH6A 5HRPA 4PY5A 1U4BA 2HHVA 3T3FA 3HL8A 4CHNA 2FHDA 3Q1JA 2HHSA 4HUEA 4F2RA 3MEUA 3QEXA 1B9DA 4ICLA 2IDOA 3VQAA 3OYLA 2CKKA 1D5AA 4FJMA 3OYEA 2O4XB 1VSHA 3C6TA 3H08A 4DFJA 5JS1A 4N4HA 1T8EA 2RHIA 3FLGA 2EX3A 5KCOA 1NK8A 1Q9YA 1KSPA 4YNQA 1Q9XA 2JLEA 3FC3A 4FU6A 2GF7A 4DTJA 3PFSA 4DTRA 2P51A 4BWMA 4CJQA 3FDRA 2G8HA 3HYFA 1NK0A 4DTMA 4CJEA 3B6OA 4CEBA 3EY1A 3CM5A 3GOXA 1HNIA 1Y97A 4B8CA 2HQXA 3S6WA 4CGHA 3KLHA 4C8OA 4RW9A 3V9ZA 1WAFA 3LP1A 3OYDA 4Z4FA 2R57A 4CK2A 2G3RA 2LTOA 4N5SA 1RBUA 3QIOA 1SSFA 1BCOA 4FZYA 1IG9A 4CGIA 4CJPA 3MP1A 2G8FA 2X35A 1TKTA 4C8NA 3SUPA 3RR7A 1RTHA 1GOCA 4NZGA 4JLHA 3QEIA 3K59A 4H8KA 5CYMA 3SCXA 3KD5E 5E41A 3DLKA 3MEVA 3VQ6A 3V9SA 3WNFA 3LYIA 4AHTA 2VYTA 3VQPA 1CXQA 5HROA 3SPZA 4Z4HA 3AVKA 4MFBA 1KFDA 4IG0A 3OYHA 3HP6A 1L3UA 4E89A 4OGCA 3AVBA 1FK9A 2R58A 4JRQA 1RT3A 4DFPA 1TKXA 1WSIA 4BDPA 4DQSA 3KKSA 4R5PA 1TAUA 2D9TA 4DQIA 4N56A 4BE1A 4DG1A 3OJUA 2LVMA 2YNIA 2MWPA 1SL0A 3AO3A 3SNNA 2XHBA 4H4MA 2PYJA 1RDBA 2M1HA 4RG8A 1G15A 4FM1A 3KD1E 3E9GA 4CF9A 4KHNA 4NCBA 4CEZA 3AVMA 4HTUA 4QQDA 5D6WA 4KTZA 1RT2A 3TWHA 4FJIA 3C4SA 2Z1HA 1MHNA 3NGIA 2DIGA 1TK8A 1WJQA 4DSFA 3F70A 4YFUA 2HHWA 4FJGA 4FLYA 4FJ5A 4CJKA 3CQ8A 2A1RA 3V1RA 4J2BA 1HNVA 4QVZA 1ZBHA 1KVAA 4DSIA 1JXEA 1ASVA 2RJEA 4C8KA 1LAVA 5SWMA 1JLCA 2EQJA 1HQUA 4DWIA 2OPSA 3VQ4A 4BDYA 3HVTA 3L2RA 3ISNC 3MEWA 3NF8A 1WSHA 3AA5X 2XK0A 4M3RA 3ZCMA 4B3OA 2DAQA 1JLFA 1BL3A 3P1GA 4W5QA 3AVGA 3E01A 4OVLA 4DTXA 2EFIA 1DTQA 4J2EA 1YTUA 1A5XA 3KK2A 2M0OA 2XO7A 3QNNA 5D6YA 4CK3A 2JZ2A 1IKWA 1RNHA 3P83D 1S9GA 2MWOA 4KHYA 1RT4A 4GY5A 2IC3A 3NTIA 4PL6A 2LRQA 3NFAA 4OJRA 2O4XA 2HHQA 3RR8A 3IAYA 4IFVA 3LP0A 2RHXA 4E1MA 1G5VA 1MU2A 3A2FA 3WNEA 4E7KA 2RO0A 1RI0A 4RW6A 3OY9A 2E6MA 4NCGA 4DU3A 3CM6A 3LDSA 3VA3A 3C94A 1NK9A 1LV5A 1C1AA 3MEEA 5KRSA 5C42A 3RMAA 3DRRA 3BDLA 2RF2A 1R0AA 1NKBA 4CF1A 1TAQA 4DU4A 4B9TA 1D8YA 4OKEA 4I9LA 1T05A 4FJJA 4KI6A 2FBVA 5C0MA 4CERA 3VQCA 4QW2A 3PNWC 1CZBA 3L2QA 3QEPA 3CFRA 3NNQA 2R7YA 1KTQA 2B5JA 4B9VA 4PQUA 3PUFA 4DSLA 3NH1A 3O4QA 4I2PA 3ITHA 1HRHA 3UWNA 1C6VA 4E7JA 3OQ5A 3THVA 2L89A 3ZSRA 3NGZA 1LWEA 1WSFA 4AH9A 2OPPA 3KTQA 3H8ZA 3KUFA 1T03A 2KZZA 3HSTB 1ZBIA 4LH5A 4Z4GA 2VWKA 3ZSYA 2VG5A 4DS4A 1ASWA 2RKIA 1ZBUA 3MAQA 4B9MA 3LH0A 4QAGA 1TKDA 1C0MA 3RRHA 4FJ8A 4DQPA 1XWLA 4F3OA 2X74A 2X4WA 1X9WA 4E7IA 1I39A 3LALA 4FJKA 3ZT4A 4CECA 4OKKA 3AVLA 2X6SA 4FXDA 3AVNA 3MXJA 4EP5A 4ZTFA 2YRVA 3QKJA 4L59A 4OGEA 1WJRA 3G0ZA 2QKKA 4CJ5A 4Y1CA 3VQQA 3ZSZA 1C1CA 4IUPA 1KFSA 4KO0A 5CZ2A 2RJFA 2K3YA 3SD4A 1WAJA 1U04A 3MECA 1VSMA 4M3UA 4FLUA 3PX0A 4M45A 3HP9A 3NH0A 3TAFA 4C5GA 5CY4A 3NF7A 4Y1DA 3AO5A 1LWFA 3O3HA 1RDAA 4DTNA 3V81A 2FBXA 5KGWA 4OPJA 2HNYA 3K2PA 1F21A 3ZT1A 3AVCA 3NHGA 1SKRA 2ATQA 4E19A 2YV0X 3V9WA 3QIIA 1UAXA 4CFDA 4NYFA 1LW0A 1JXBA 2E4LA 2IG0A 4ZHRA 2EQMA 3MEAA 4F3TA 4LD6A 3RMDA 3OYNA 1S5JA 3F9KA 3TI0A 1VK0A 3L8BA 2M16A 1SUQA 3L3VA 3VA0A 3QEVA 4DLGA 3VQ7A 3TR8A 1UA0A 3K5NA 5I3UA 4FK2A 3NCIA 3O3FA 4DU1A 1VSEA 1NJYA 3DOKA 2G8IA 4CGJA 4FK4A 5KGXA 4II1A 1A5VA 4A4FA 4CJUA 2JGUA 2DFEA 4B9XA 3P8DA 4E7LA 2HHXA 4KRFA 1BQNA 4FJHA 2WACA 3MEDA 4N4GA 3L2UA 4CJVA 4IUTA 4O0JA 3QETA 1TKZA 1HJRA 1IO2A 1TV6A 5KE2A 1FKPA 4O44A 4Q0BA 4DLEA 2RPIA 3O8VA 3OMGA 3I0RA 3B6PA 2ZQBA 3PO5A 4CCHA 1IH7A 3OYKA 3UIQA 3ZEHA 4CJTA 1B92A 3CYMA 2BIVA 3IG1A 4KI4A 2HNZA 2E5QA 3KLEA 4KFBA 1NK4A 3P8HA 4FLXA 2RHZA 3D0PA 1WGSA 2YKMA 3VQBA 1VSIA 3S3MA 1HYVA 3OA6A 1ASUA 5KCHA 4IG3A 3DRPA 1S6PA 1RT5A 4Q5VA 1SV5A 3AV9A 1WN7A 5EU7A 1WSGA 1VSDA 3AA3A 1RT7A 3AO1A 4DQRA 2ZE2A 1QS4A 2RHUA 4HHTA 3QEWA 4UQGA 2P5GA 3DOLA 4O55A 3M8SA 4W5TA 3OMCA 4HUFA 2DFFA 1XI1A 1KLMA 4IBNA 1NKCA 4NS5A 1BISA 3LGLA 1WSEA 2XRIA 3OS2A 3KLFA 1JLQA 3LANA 2RJDA 3EAEA 3RRGA 2KZMA 5KRTA 2R5MA 5J26A 2G8VA 2O4GA 1D9DA 3PO4A 4JS5A 5IAYA 4CEDA 2BDPA 2BANA 4FJNA 4JRPA 3OS1A 1L3SA 5J1EA 3ZT3A 3SQ2A 4KHSA 1X1PA 2P0KA 1C0UA 4ZTJA 1GOAA 4ID1A 3HJFA 4FJXA 4FLTA 4EP4A 2RN2A 1QHTA 2O4IA 3QLHA 4W5OA 2EKOA 4E7HA 3LZIA 4FL6A 1NJZA 2Q3SA 3ZSXA 4FVMA 2B4JA 1RTJA 1HMVA 3F73A 3JYTA 1KHCA 3V4IA 2F8SA 5DK5A 3L42A 3OYCA 2GFUA 3O4NA 4ELVA 3DLHA 4IUQA 2G8KA 2K3XA 3KLGA 3DB4A 4O4GA 3VQEA 1NK5A 4JS4A 2DFHA 3PX6A 1KLNA 4X34A 3K58A 3KKRA 2D5RA 4KTQA 2EQKA 4IFYA 4A4GA 3OYAA 5K14A 1UWBA 4KV8A 3V6DA 4FZZA 3HXMA 3S9HA 4PLIA 2OZSA 4EZ6A 1IKVA 4W5RA 5D3GA 5KTQA 2HNDA 4CFAA 2X4YA 1EXQA 2E6LA 4CJRA 1XHXA 3AVFA 3AO4A 4CEOA 3CG7A 3D45A 4A4EA 4I7FA 3SYZA 1SKSA 3LP2A 4BWJA 3T19A 4CHOA 1QE1A 4L8RB 4DFMA 1ZBFA 4CE9A 2LDMA 1WLJA 3RWUA 1IKYA 1S1WA 3MO8A 4B9SA 3AVIA 1RBRA 3I8DA 1BCMA 2HQEA 3SUQA 2RI3A 2Z1IA 4OPKA 4CRIA 3WNHA 3META 4B9UA 3DM2A 2HMIA 1RBSA 4BD3A 2EQUA 3U3GA 1TGOA 1DTTA 1J5OA 2OPQA 4IDKA 4BE2A 3VQDA 1LWCA 3OB9A 1EX4A 3MP6A 2HHTA 4RW7A 3SQ1A 4M3ZA 3UT1A 3TABA 4IUUA 3OJSA 1REVA 1TL3A 1ZYQA 4OLAA 3EYZA 3OYIA 1KVBA 2G8WA 4HCBA 4DQQA 4CIFA 3DMJA 3QIPA 2WOMA 4C8LA 3PMIA 2F96A 3SPYA 3KK1A 3K57A 3AA2A 3SV3A 1TK0A 1QSYA 2E6NA 1TK5A 4DF4A 1WNSA 1HYSA 1BQMA 1KCFA 2PQWA 4DS5A 4FJ7A 2NUBA 4CIGA 1LW2A 2EHGA 2NLUA 3LWMA 1JL1A 3HT3A 3DI6A 4I9QA 2L3RA 2LCCA 4KREA 3FFIA 1K6YA 4CEFA 4AHVA 4GMJB 4C5IA 4N41A 4CJ4A 4N76A 4E1NA 3OVNA 2X78A 4OVAA 5DMRA 1HYZA 4FM2A 5CZ1A 3BDPA 3HVRA 1RT6A 3DLGA 3LAMA 4FK0A 2FBYA 5JS2A 3MXIA 2Y1IA 1XC9A 3SQ4A 4IURA 5J2MA 1S1UA 4DF8A 3KIOA 1EP4A 1NOZA 5SZTA 1N5YA 1JLBA 1KVCA 4OKJA 2QKBA 4NYNA 4ID5A 2DIQA 5HRSA 1W9HA 2JTFA 4EZ9A 2VWJA 1VSJA 3T1AA 4Z4IA 4KKOA 4PUOA 2QK9A 1JKHA 2HW3A 3QJ6A 2IOCA 3SI6A 1O1WA 1CZ9A 4M42A 4EDUA 4CEQA 3OYJA 1BI4B 3TAMA 3DYAA 3LAKA 1S9EA 3VQ8A 3V9UA 4FLZA 3IS9A 2VG7A 1C1BA 4FJ9A 2D0CA 2RJCA 3DLEA 3PX4A 1NJXA 2X6NA 4CGDA 4B8AB 4B9WA 2DY4A 2OZMA 1DLOA 1LAWA 4LD0A 3NGYA 3ZT0A 2XY8A 4FLWA 3G10A 4CESA 3C6UA 3TANA 1IKXA 3M8RA 2D0BA 4MQ3A 2RI2A 1L3TA 5J2QA 4DFKA 5J2NA 3PMTA 4J2DA 5KE3A 1D9FA 3OS0A 3OYFA 3HK2A 1UA1A 1UOCA 3CFPA 3KK3A 3DLRA 3CEYA 3M8PA 3FEOA 1VRTA 4G1QA 4CGFA 4CHPA 1RT1A 3ZSVA 3MEGA 4QQGA 5HLFA 2YKNA 3DB3A 1C0TA 2L8DA 4M3XA 5C25A 2R5AA 5HP1A 4CF8A 5IN1A 4BE0A 3JSMA 4CIEA 4KPYA 1TL1A 2KFNA 1WSJA 2B6AA 4AILC 1H3ZA 1I3AA 4RW4A 3SV4A 4CEAA 5D6XA 4TSXA 4DTPA 2D0AA 3PV8A 1J9AA 1S1VA 1JLEA 1S6QA 4UC4A 1J53A 3ZSWA 1U49A 1A5WA 3U6FA 4CFCA 1RTDA 4CJSA 2QQSA 3M9QA 2GUIA 3U3YA 1QSSA 1XNIA 4AHSA 1OI1A 3LP3A 2I5JA 2QXFA 4CHZA 3I0SA 3TAEA 4W5NA 1NOYA 4AHCA 3PY8A 1L3VA 2BKDN 4QOZB 4CJWA 1JLAA 5J2PA 3CFOA 4PA1A 4RW8A 4O5BA 2IGIA 2OPRA 2YHAA 5HRRA 4LY7A 3ME9A 4DTSA 1JL2A 3DLMA 3NF9A 4DTUA 3NTKA 4LSNA 1OYXA 4ELUA 1RDDA 1SL1A 4HUGA 4C5EA 5T7BA 2WONA 1RCHA 1Q8IA 1X9MA 1WJSA 1HPZA 1VSKA 3HPOA 4QQ6A 1L5UA 2RHYA 4M3WA 5HRNA 3MXMA 4I2QA 3RTVA 1CXUA 3WNGA 2BE2A 4E0DA 2PZSA 1BHLA 2YNGA 4XIUA 5FRMA 1BGXT 2YNFA 4KHWA 3MP8A 4H4OA 3S3OA 1VSFA 3EZ5A 3SUOA 1NJWA 5CIUA 1VSLA 2W42A 2YHBA 4OLBA 3QO9A 5M9OA 1SKWA 4Q5WA 4E3SA 4AHRA 3RMBA 3ZT2A 4F4KA 1NK6A 3ASMA 5C24A 3L2VA 4FM0A 4Z0UA 1BI4A 1HQEA 4Z4CA 2HVHA 4B9LA 3QNOA 4LSLA 3KJVA 2G8UA 2DTUA 2RI5A 2F5KA 4IUVA 1QQCA 3E9FA 3V9XA 1JLGA 3LPUA 4O0IA 2GFAA 3IRXA 4CJFA 3HPGA 4DSEA 2F8TA 4AHUA 2GBZA 1GOBA 4FZXC 2PY5A 2FC0A 4C8MA 2OYQA 3BGRA 1Z25A 4CF2A 2KFZA 3OYMA 4CJ3A 3V1QA 4K8ZA 3NAEA 3LGFA 3ALYA 3C95A 2A1SA 1N27A 2ETJA 1XHZA 3LLRA 1U48A 3SUNA 1EETA 3L2WA 1FXXA 4Z02A 1RTIA 4FCYA 3VQ9A 3NDKA 4N4IA 4LH4A 4KHQA 4PLLA 4B08A 1RBTA 1QTMA 4CF0A 1U45A 3AVAA 3H6ZA 2AJQA 1RBVA 3ZSQA 3K5OA 4C5HA 2X4XA 5J39A 3HM9A 2ITGA 2LSNA 3TAGA 4DMNA 4FYDA 3KLIA 3NTHA 3QERA 3S3NA 2QQRA 3QBYA 4M41A 1KRPA 3OYBA 1SL2A 3VQ5A 1J54A 4CEEA 2HHUA 1TVRA 3NE6A 1YVUA 4PWDA 2PYLA 1OZ2A 1NK7A 4N47A 4HCCA 4KAZA 2BGGA 2KTQA 2KW4A 2XY6A 4WE1A 4BACA 3NBPA 1ITGA 1OZ3A 4M3YA 3HO1A 4GW6A 3HPHA 1BIUA 4CHYA 4CHQA 5FROA 1BIZA 1S1TA 2IS3A 3LPTA 3NH2A 4F2SA 3ASKA 5CYQA 3TAQA 5FDLA 4KHUA 1W0HA 3ZSOA 3TAPA 2Y1JA 4FJLA 1B9FA 1CLQA 4KB0A 4NCAA 4FLVA 1VRUA 5I42A 2FBTA 1ZBLA 4HVJA 4KB1A 2Z1JA 3K5LA 3QESA 3LZJA 1QSLA
chains in the Genus database with same CATH superfamily
1H8AC 5A2QE 2ZB9A 1VQ7N 1QKWA 2UXNA 5FRNA 5HCKA 1H89C 2O8EA 1KG3A 4KUIA 3BF3A 1GLAG 2QM1A 5AQWA 2WBNA 2D8HA 3EH1A 1PC0A 1A04A 1IXCA 3IAS2 4YIFA 2W25A 1Y71A 4AVPA 2C0OA 3V1OA 1WJAA 5L23A 3NAUA 3VJPA 2J4RA 4PKIA 1FMVA 1D3YA 3CMAI 2HKOA 2YI1A 4BR2A 1UZCA 4HNVA 2X3XD 3CCRA 1YT3A 5C6SA 3JB9D 1EIFA 2BXYA 3HUGA 1QZ5A 3PIPA 2KJBA 3C0BA 5I9EB 4C8QE 4C92D 3DEEA 2XRLA 5EZHA 3NF6A 3MN9A 3ULRB 1RILA 4DV3K 1OKRA 2M8EA 1TWFJ 2XKPA 3QFPA 1VI0A 2I5WA 4HAMA 1RDCA 3O08A 3E7LA 5M5WJ 3DXMB 3AARA 2VKHA 2ZGZA 3WEEA 1JKQC 3LNQA 4DTOA 4OF1A 2AXTC 4NC6A 1EQYA 2VG6A 1HKQA 4JKHA 2ISYA 3DKYA 4XKCA 1EBMA 1XMQK 2GV9A 1WHJA 4FW1A 4Z4EA 1HYOA 2LC2A 2HVIA 1SFKA 4ELTA 2QCOA 1JXSA 4DSKA 4IF4A 5IP6A 4F16A 3K1NA 2XDPA 3IH3A 1PVSA 3QODA 4HSBA 1PKSA 1YN8A 3VN5A 1HR0K 2R93J 2O5RA 3OYGA 1DPUA 4CXFA 4M3TA 1KD1R 3MN2A 3F2KA 1Q81R 1EO1A 3TTDA 3T5XA 4MQVA 5M1OA 4Y13A 1M9SA 1BA5A 3CQYA 1YAGA 2UXCK 5FB2A 3Q5FA 3G71I 1YJNT 1D3BA 3HL8A 2FHDA 3E97A 1NBEB 4IJNA 1IN7A 1VQNN 3GL1A 4RTVA 2VQGA 1B9DA 1X1CA 1WEIA 3EG0A 2FF3B 1D5AA 1QVGM 4IOCF 2H6BA 2O8BA 2HF3A 5JS1A 2P84A 3H5RA 3PFIA 1BBYA 1GT0C 1XOVA 1X3ZB 2KK4A 3I33A 5KCOA 4QSHA 4CI6A 4XKWA 3VTHA 2DD5A 3FC3A 3H0HA 2GF7A 2DLPA 3PFSA 1N36K 1YITQ 3KP5A 3QDRB 2L5QA 4WCIA 4DTMA 4CJEA 1C0GA 2LCSA 2HQXA 4BR9A 3X28B 1HKCA 4M77D 3V9ZA 2TCTA 5CR2A 1WAFA 4PJOF 3CTAA 1KQ0A 1Y8RB 4RTYA 2Q31A 1PNJA 3CCEN 3QIOA 4BRLA 3UKGA 2Y0MA 2A3LA 1IG9A 2VJ5A 1RUOA 1J9IA 1DEJA 1UMQA 3CPWM 2X35A 2BY0A 3RR7A 1HC8A 4JLHA 4CICA 5DV5A 3QEIA 5GMKe 2K86A 2DA1A 3KD5E 2EFWA 3S1QJ 3CCMN 4J7IA 2VV5A 4B1UB 5IHIA 4AHTA 3GMEA 3G2BA 4WX9A 1K0SA 2R5ZB 1T0HA 1J09A 1ZUUA 2M3AA 2JPSA 4YOQA 2ZC2A 1GCQA 5CQEA 4C8QD 3GFJA 4ELZC 1BW6A 1YQKA 2YG8A 2ZMEA 4RM2A 2LRDA 5GAGP 1NM1A 3CC4N 2LNBA 1J5EK 5KN9A 1CF7A 1OPLA 4M73A 4DFPA 4CC4B 1B4AA 5HLTA 1YBYA 4BDPA 2ECCA 1UDLA 1VA7A 2L4MA 1Z1DA 2LQWA 4JNEA 4DG1A 4UUVA 2LVMA 3VTIA 3GPLA 2CSQA 1ETOA 2QXLA 3EL2A 5K5RA 2MWPA 3CCSI 3AO3A 4J9BA 2HBKA 3CJCA 2XHBA 2C06A 2PYJA 1JKPC 1G15A 1I07A 3LW5E 2XKOC 3DU5A 4PJOE 1G2HA 1S72A 4LGWA 4HTUA 3THYA 2ELJA 2LJ0A 4KTZA 5J1YA 3TWHA 4G9YA 4AFZC 2W0ZA 4RKUE 3NGIA 5BS6A 2WV1A 2DIGA 4WXHA 1ORNA 4ELYC 4YFUA 3E9OA 1FIAA 2FSWA 4CZKA 4DR4K 4P55A 1VQ6A 4CJKA 2WAQN 1G4DA 2CQXA 3E6MA 3DXMA 4DSIA 2X48A 4BI3A 3JRAA 1VQPT 1ZAOA 4EHUA 4JI1K 3CWAA 2JK3A 1UUEA 1NJIR 2XHIA 4DWIA 2P0WA 4IDHA 2VOPA 3WXLA 3BQYA 4EJTA 2Y4XA 1NGJA 3L2RA 3B6CA 2HVSA 2BHZA 1SD7A 1KD1C 3HXLA 3QU3A 1Q81C 1SD4A 1JJ2P 1NEBA 1X6BA 5FFXA 2FMLA 3GXOA 2DTHA 2QGFB 1V5FA 4HQMA 1UHWA 1ZSZC 5LJ3g 2FNPA 3CUQB 3QNNA 4V19K 5HLHA 2V4JC 3CCRQ 1XG1A 4FWMA 1S9GA 2MABA 2EV0A 4GY5A 1EJ9A 2DDAA 5EJCA 5AONA 3JCMV 2ZSIB 2LRQA 3E5QA 3FM5A 3RR8A 3LP0A 1G5VA 4IQ4A 3WNEA 4RTZA 4E7KA 2PVOB 1X6OA 2LY1A 4HZFA 1RI0A 3I54A 3DPLC 3R6NA 2F5EA 2F2EA 3TMOA 3JRCA 5FKMA 4M4ZA 2DTRA 2X3WD 3VENA 1LV5A 1VQ8Q 2N8GA 1AWCA 4JAXA 3A01B 1ON1A 3RMAA 1HSJA 2CW7A 4PUSA 2MYSA 4DV6K 1Z9ZA 1T38A 4CC3A 2FLOA 1T05A 5D7UA 1R5HA 4B1ZA 5F27A 1FP1D 4FJJA 2FBVA 2DXIA 2FJ1A 5K5QA 5C0MA 1N78A 4JHDB 4CI0C 1YHQN 2VC8A 2PEXA 1VQ9Q 1WEFA 2XPVA 3URGA 1CZBA 2LTPA 3EHRA 3QEPA 2GXAA 4F04B 3N4PA 2R7WA 1K1ZA 4PQUA 3L4QA 3PUFA 4XLFA 2LH9A 4PKGA 4PJOD 3NH1A 3O4QA 3TU5A 2A36A 3EO3A 3X25B 1Q82R 5AZJB 3LDNA 2HI3A 3ZSRA 4AFQC 4AH9A 3BTIA 3ZQFA 5IP9J 2R5ZA 3H8ZA 5E1ZB 3HSTB 5GAN4 4LH5A 3M54A 2VWKA 5GTHC 4LF4K 2ZM6K 4B43A 2RKIA 3H5NA 3LH0A 3JB9H 3R0JA 1OR7A 3VS6A 3SJMA 1VQKI 2YXYA 3EE8A 5FU6C 3RRHA 2H94A 1R23A 3CCQT 1Z0XA 4DQPA 3O8MA 3EFSA 5J3BA 2P0QA 1V54H 3JCUC 2X4WA 5K7ZA 2A5YB 1Y96B 4FJKA 5DD4A 2VBWA 4FSVA 2E4HA 3ZT4A 4DV4K 3PUBA 1T6DA 2FQ3A 1Q7YR 3I0XA 2PLYA 4CCOA 2Y90A 3MXJA 1VQ4T 2OTLT 2YRVA 3QKJA 4XTVA 2F2XA 2IIMA 3RKYA 3H9NA 1WJRA 1IRFA 2KGTA 5LEJA 2YHYA 4M7AC 3ZSZA 4KO0A 5B8HA 2XAGA 2KT0A 4GCVA 3R9PA 3SD4A 3KP3A 5GAOn 1UJYA 2P6SA 4KIBA 1VSMA 2BZTA 2LDUA 1K6OA 1OFCX 1KYWA 1KQ8A 5M5XJ 3LWFA 3HP9A 3HRSA 3TAFA 4UHTA 4C5GA 5CY4A 1LWFA 3O3HA 1RDAA 4RB2C 5BPNA 2Q0UA 4DTNA 3AG2H 3ZT1A 2V8JA 1A0NB 3AVCA 2COBA 2DPPB 4G6TB 4A6DA 4MEXF 2VBXA 1SFUA 3H35A 3MWPA 3SBTA 1H0MA 2YRDA 1LW0A 4BRDA 4I0BA 4MZTA 3OV8A 4EW4A 4PFPA 1U6GA 5FJ8J 1Q86O 3BR1A 4HG2A 4A5NA 2KT8A 4R55A 2PMUA 4LD6A 4GGGA 3CCVT 4AM7A 2FA5A 1NGNA 1I4K1 1FW6A 3L09A 2OI3A 1RRQA 1YX5A 1WHHA 3IAM2 5ILSA 2W00A 1UGQB 1SFEA 1OYYA 2ZO4A 2HFHA 4GYIA 2ICWG 1SUQA 1M1KO 1N8RU 1FSEA 1WX6A 1UA0A 2JMWA 3CUQA 1WRJA 5I3UA 3CJTB 4KFCA 2MI6A 3NCIA 2XAJA 4DU1A 1VSEA 1U6ZA 2HPIA 2Y69H 4FWRA 2XU8A 4AF1A 5AYFA 3JW4A 1QQOA 3AAQA 4FK4A 1MV3A 1A5VA 2NRZA 4HWIA 3ZX3A 4GFBA 3J7AP 3OL3A 1VQ6Q 4JX6A 3FZHA 2AKLA 4B9XA 2D8JA 2ZXJA 2KI7A 1BQNA 1OQKA 3K70D 5E8GA 2JS2A 2RQUA 4X62K 4M78E 2JVHA 1IO2A 3NWSA 1PM3A 4M71A 3QRFF 1NGHA 3A01A 1LWWA 3VS7A 1RAAB 3S2WA 2RQTA 2DJZA 2Z1DA 4II2A 3M4GA 3G25A 4A2UA 1TUCA 3OYKA 4JN4A 1KAXA 2HSEB 3ZEHA 3C12A 3G4SQ 2CUZA 4FYWB 3EUKL 3VEPA 1NK4A 1Y39A 3HRMA 1DUXC 2EYYA 4IZZA 4JHDA 3D0PA 4I98B 3H9JA 3EH2A 4BG9A 3C1DA 1EH7A 4F93B 3S3MA 1LDDA 2XPWA 3JS6A 4EIAA 1ASUA 5DLOA 4IG3A 3DRPA 1I6HJ 1S6PA 2KR3A 4Q5VA 4HW0A 1WBDA 4BRGA 1Y7XA 2K5CA 2O3FA 1VSDA 5MLCQ 4JLIA 1MIJA 2QEXA 1Q82C 1XSXA 2OTJI 5AZJA 4UQGA 2ESWA 4FSSA 4WQ5A 1VQMQ 1I5LA 2XGEA 4H5VA 3QBWA 2H3GX 4M78B 1XI1A 2DVEA 2VGMA 5FW9A 1KLMA 2KQRA 3LGLA 3VODA 3THXB 4R8HA 1ETQA 1IN4A 3L7WA 2DK8A 2E88A 2H56A 3HOYJ 4CC7A 1W7PB 3VWBA 1Y96A 4IRGA 4C3IJ 3GUDA 3VEZA 4HNUA 4AM6A 2O4GA 4BGAA 3J7AY 1Q7YC 3HRGA 3C7JA 2HPMA 2Z0WA 1JE8A 5EYRA 1YOVB 3CCLI 1GLNA 4MFDA 2HBJA 3OS1A 4BREA 3GW2A 3HZ6A 2I7PA 3SQ2A 2SEMA 4D6WA 5L3DA 1Z3XA 4L9VA 3I55A 2CS7A 3CMAQ 3S14J 1TG0A 4FJXA 2DA5A 1W1FA 3F0ZA 1QHTA 3VS5A 2ZGYA 5F04A 2WAEA 1BOAA 2JHNA 2FX0A 3GP8A 2QUFA 3PIOA 2B4JA 1RTJA 2KY9A 1TWAJ 1Q1VA 5GAMj 1ENHA 1XGSA 3HTUA 1KHCA 2WA0A 5HDNA 3T0YA 2F8SA 3QJYA 5DK5A 1JXMA 4U0WA 1NYGA 1XC5A 3U8XA 5CLSA 1MNMC 3PSFA 1OX8A 3QWXX 2VL8A 1D5VA 2RQWA 3CCRN 5FWCA 3VQEA 3FZLA 2RB6A 3GNGA 4JS4A 2DFHA 2IS4A 2X6WA 4MNUA 4X34A 2E2QA 2AKKA 3VF2A 4HF1A 1WXUA 1NM7A 1BC7C 3ZLJA 4BR0A 2BYVE 1YFNA 2EQKA 4B24A 2JXBA 3TQNA 4A4GA 5K14A 1UWBA 3IWZA 1WXBA 3V7RA 3V6DA 1BIBA 4FZZA 4CDGA 2UUBK 2CQNA 1K73O 4CGZA 3HOSA 1VQ8N 4I7HA 3CJAA 1FBQA 1RRJA 4YG2F 3CJRB 3F8BA 3VDXA 1MBJA 3M8JA 3C18A 2X4YA 1YQAA 4BHPA 3FXQA 1NG6A 4CJRA 1XHXA 3T69A 4JKBA 1VQOI 4ZGEB 1EA3A 2B63J 1IV8A 3HM5A 3K4MA 4BWJA 2YRCA 1OCTC 3DJCA 1B6AA 1QE1A 2YHTA 3OTOK 4L8RB 2VASA 2LQ8A 1Z9CA 3K4JA 4L9JA 2EIFA 5GINA 3CCUA 2VJJA 2H8HA 4G7ZF 3L4IA 3SUQA 4DGWB 3TVTA 1VQ9N 1OCPA 2YLBA 1Z91A 2K3FA 1BK2A 3M1CA 2HMIA 3J81E 2M34A 3VETA 2RM4A 3FJ5A 4IDKA 3VQDA 4TVRA 4GVEA 3CQTA 1M90O 3DLLL 4ESJA 2Y2ZA 3SQ1A 3UT1A 2EZHA 3EHQA 4CZZA 2CP0A 3SMPA 4IUUA 5C4JJ 2CP5A 1V5EA 4G8XA 3JB9J 2AHQA 5C44J 2LFBA 5FFZA 3IDHA 5HL7L 4AYBN 1W2BA 3QIPA 4DUZK 4B8XA 4JJNK 5AJ3K 3N4QA 2DL7A 2EW3A 3MMVA 3UKUB 2CGJA 3RYRA 3IKVA 2E1HA 5ICFA 3RZDJ 1W1WE 4C92C 3K57A 5LHHA 4PFZA 2JTMA 4EM1A 5J40A 1KHIA 4M78A 2EBIA 5BR8K 1JTXA 2M1BA 1ACIA 1BQMA 2FUG2 3X26B 1KCFA 1FIPA 3THXA 2CS3A 1JCGA 1YQRA 3GFMA 1ODDA 2C6YA 5K5OA 3CC7T 2LNHB 4DS5A 3WODF 2DA7A 4ZC3A 1W7PA 4KICA 4CIGA 3E1SA 2R7ZJ 1LW2A 4UY8O 3ONQA 2AZVA 2NLUA 4BGBA 5M3FJ 1VF9A 1OX9A 4LDUA 3LWMA 5AQYA 5BRHA 3HT3A 1WH7A 3RR6A 2H8RA 4I9QA 1O13A 1I81A 4MQ9F 4J00A 4KREA 5ILVA 4AHVA 1U8RA 2GQIA 5EG2A 1IREB 5TJJA 2KKOA 1TUDA 4CJ4A 3CXCP 2JUGA 4LXCA 1OCOH 4Y15A 4FM2A 1A31A 3VERA 3DLGA 4CCNA 4FK0A 4XR6A 3THKA 3MXIA 4A5BA 2CT4A 1XC9A 2RREA 1HKGA 4ESRA 2KHOA 1KU9A 4DF8A 2DDBA 5LGNA 4JI4K 1NOZA 5SZTA 1MDUB 4NDLA 4OPHA 2MLGA 3NEUA 4XLCA 3WTVC 4E9FA 1KG1A 1BC8C 4D0PA 2D1KA 2DK5A 1B8IB 3MHXA 4ID5A 1YIJA 4DQ2A 3FISA 3C2HA 3O6BB 1OCCH 4AMCA 2HQ5A 2WADA 5ICEA 3RMSA 3GZ5A 2HW3A 3E6DA 1G3TA 2WSCE 5FU7C 1QPIA 1MPGA 3MWMA 3VPRA 2DMNA 1BI4B 2BXZA 1C0WA 1VQ6N 2D1HA 4EVVA 3CF5F 2CQ7A 1S9EA 1R8OB 1TNSA 3EFOB 3I55Q 3ULEA 2H6CA 4BRPA 3JXUA 3IS9A 4CCJA 1M30A 2VG7A 5FLXK 1C1BA 5CKFA 3U21A 4M3FA 2IA0A 1SS6A 2VQLA 1WJ5A 4PGGA 2MCNA 2FG0A 1VQ5T 1GRIA 2X6NA 3E6CC 4CGDA 5AQZA 4DR7K 3KE2A 3CCYA 1TUGB 2OZMA 1OULA 4XRSG 1LAWA 4JQFA 2O31A 4IWVA 4BAYA 3NGYA 3G3ZA 3IKTA 5IXBA 1M2VB 2XY8A 4OX9K 2ME6A 4FLWA 3C6UA 1XPXA 3TANA 4DEXA 2A69F 3SEMA 2Q97A 3EKUA 3G4SN 2RF0A 4J19A 3G6EQ 2D0BA 5H6RA 4MLEA 1LNWA 4HF2A 4DFKA 1AZGB 2L9RA 3HKZN 2CFXA 2GWRA 3WG7H 2W41A 3H6EA 3JSPA 2V7FA 1UAAA 4XLEA 3S1RJ 3F72A 3OYFA 2LY9A 2NYSA 3V8LA 3HK2A 1UA1A 1UOCA 4IOCL 3KK3A 2V6EA 3FJPA 1S7AA 2GQQA 3DLRA 1E3OC 1M3CA 2F5FA 3M8EA 2M8GX 2ROTA 4KN4X 3CMMA 1X69A 2MLKA 3H0GJ 4FWLA 1VQMN 5C25A 1BWFO 2FF4A 3BT9A 5HP1A 4J83A 1OU8A 4NHJA 5GAMf 5IN1A 4XQ3A 4DCHA 4CIEA 2WSFE 3B73A 4K0KK 4AILC 1H3ZA 1I3AA 3CCJI 2KDZA 4CEAA 3HSFA 5D6XA 1BM9A 4TSXA 3L6QA 3K2ZA 3PV8A 5LJWA 2KIQA 3HSCA 3UKUA 4M78G 3BG7A 4HBLA 3QMLA 4BI4A 4CD1A 1DGWY 3R60A 1JLEA 2CYYA 1MBGA 1ZUYA 1QVGP 3C65A 1RTDA 4KA4A 3KFWX 1ETXA 1VQLA 3M9QA 1N25A 3FXKA 4LLNA 1LE8B 1B59A 2LKXA 2QXFA 3J80E 3E3VA 3TAEA 3AAFA 2CH4A 3CMAN 4CCLA 1IF1A 4EJZA 4U67L 2FQ4A 2J06A 4X64K 4H5WA 4C3HJ 1L3VA 2QYOA 2BKDN 4CJWA 2W24A 2GZWA 4XH4A 2ENMA 2YUOA 2IGIA 2OPRA 1K9MR 4DYCA 5HRRA 3JRBA 3H3VK 3ME9A 2K7LA 4JZ3A 5BOXA 4IHVA 3D5SC 1Z21A 2HDAA 2GEMA 4H5RA 3E6BA 1SQKA 4LSNA 4WK8F 3F8MA 5GAMh 3UKRB 4IX7A 2A3SA 3CIPA 4AIAA 5BN9A 4BVPA 3O5ZA 2OX7A 5GAOm 1RCHA 2XI9A 1X9MA 1YI2A 2EA2A 4AFUC 3CD6T 3CPWP 3QG1A 2A6HF 4QQ6A 2XHKA 1PKTA 3X24B 2RHYA 3JCMe 3FB9A 1MNDA 1HQCA 3S17J 3X20B 3UA7A 2E35A 2Y9YA 1BHLA 2YNGA 2E5KA 1DU0A 3UNGC 1BGXT 3WQUA 2DO7A 2HTJA 4A3CJ 1ZBXA 1KQJA 3NPFA 3MD2A 1J5YA 3ZQIA 2L0KA 4G7OF 2AHJB 1LUJB 1NJIU 2DA4A 1B8IA 2A6AA 1FT9A 1N33K 3K9TA 1LEBA 3J7YP 4J9GA 2JVVA 1X01A 2KAFA 1GLFO 4NXNK 2J05A 4LD5A 2R7QA 3RSEB 1D1BA 2ME0A 1SKWA 3K2AA 4E7SA 1PUEE 2KIUA 4AHRA 3RMBA 2IPOB 4WXDA 4F4KA 1SEUA 4NL2A 1NYFA 3L2VA 4X9CA 4F7ZA 4Z0UA 1BI4A 4FM0A 2IVPA 3EG1A 1R6RA 4M75C 1QVGA 3MX2A 2E5ZA 3EFOA 2DTUA 2ZXWH 1VQ7I 4LG3A 3A5ZB 5GAHP 2GELA 3IUOA 4DUYK 2CUEA 5E3NA 3KYLA 3NQOA 3OHRA 4CJFA 2YX7A 1XC3A 4JI0K 4MIMA 3C3WA 4HT9A 2KBTA 2GBZA 2EFNA 1WHMA 3ER0A 3BGRA 1JCFA 1FYMA 1M2VA 4DYRA 1PRLC 4CJ3A 3V1QA 3A5MC 3I5RA 4K8ZA 5FPEA 4Y0WA 3C95A 2CREA 5HK0A 2M87A 5LEKA 2ETJA 4IEIA 3CERA 2L7KA 1QLYA 1U48A 2Y0SN 1YIJQ 5LRRA 3SUNA 2YUSA 1EETA 4FWSA 1OVYA 4LH4A 3E9LA 4KHQA 1M1EB 3T1BA 1OH6A 1SC7A 1HDPA 4B08A 3ZX0A 1QTMA 1U45A 3OH6A 3AVAA 3TSUA 1RBVA 1Q86U 3CC2A 1YCYA 1IBLK 3K5OA 3M58A 4C5HA 2X4XA 2JVGA 3S6IA 2E1YA 1D8KA 4M7YA 2CP6A 2V1QA 1YJWT 1ETYA 4DK9A 5D8KB 1R71A 3BWGA 4L9NA 3J7AO 4FYDA 3KLIA 1YJ9T 3S1MJ 2NRWA 1ZG5A 2RNGA 3DTIA 1SAXA 3M55A 1TVRA 2DJQA 2DBBA 2DERA 5HS9A 4PWDA 1HJOA 1QPMA 1XMAA 1VQNI 3LDPA 2M7AA 2IRFG 4KAZA 3DBRB 1M1KR 1WJFA 3DTKA 3TL4X 3ZQQA 5F1XA 2Y30A 4Y33A 1QQIA 4CYCB 2EZKA 4B9QA 1ZK8A 3CZ6A 2JMCA 3NBPA 1ITGA 1OZ3A 4P5OA 1Y0UA 2HZYA 2NVYJ 2JTVA 2HEQA 4M3YA 2NRHA 2V7ZA 1W5SA 1BIUA 1LE8A 4MEYF 4JI7K 4UXNA 4CHYA 1TW3A 1AWJA 2RGVA 2LZ6B 4CHQA 2NRVA 3JCMJ 3TOAA 4EMKB 3B8AX 3GCMA 3TEEA 4F2SA 3ASKA 3KLNA 1QCNA 4KHUA 3SDGA 1GV5A 1XX5A 3P7NA 4IHTA 1W0HA 3HOZJ 2OUMA 3QPSA 3TAPA 2DXUA 5D5UB 2BE7D 2JMAA 2JM8A 2Y1JA 1E3PA 2VQCA 1U9OA 2BOLA 2CG4A 1UFMA 2CUFA 4Q48A 3WG9A 3VOVA 1AEYA 2JRMA 4DJAA 3UKRA 1ZBLA 4HVJA 4B22A 1VQPA 3G71A 4BRMA 3CCEI 1AD5A 1D1AA 1FN7A 2O8XA 2B8AA 2RHKA 1KG2A 4CH7A 3DRSA 3MQ0A 2D0QB 3AY9A 1T7PA 2FBKA 5IYDJ 4F8RA 1G2BA 4RAZA 2QK0A 1SSHA 2E41A 2QA4T 4CK1A 5GANe 1K83J 3QWYA 4C1NK 4A12A 1MMAA 2HZTA 4HX4A 4DA4A 2P5KA 3NMUA 2GM4A 1XUPO 3ASOH 5HBMA 3EFRA 1L3LA 2GTOA 2NVQJ 1LFUP 4RS8A 5E84A 4F91B 2XY5A 1TP4A 3AG4H 2EGCA 3PLAA 4HKEA 4MHGA 1FKOA 3RSEA 2HR3A 1TTHB 2K5FA 3RMCA 2A3ZA 2HB5A 4DBQA 5B3SH 4A53A 1RETA 3GDQA 2QWPA 2L9VA 1RAEB 2NOZA 1IRZA 4M9SA 1GLDG 4OB2B 3G6EN 3AA4A 2Q36A 2HNHA 2LK2A 5D6EA 1D0YA 1M8VA 2FZGB 1HCRA 1S72T 3T8RA 2V7YA 4QCLA 1MSFC 5CK9A 4BDZA 4QLCU 2L9SA 2WB1A 1ERDA 5KH6A 3A0HC 3QDFA 3WE3A 4OMMA 1R22A 1TWGJ 5HS8A 2VUBA 3ZMDA 4JK8A 2QKLB 4I0AA 4JDSA 1X4PA 3ENOA 2Y31A 5EY4A 4OOIA 4HUEA 2KRFA 3MEUA 4A3MJ 3QEXA 4ICLA 4RLFA 1E4FT 1GLJO 3HSEA 2BVLA 4XOTA 3OYEA 3N97A 2NYXA 1YJNQ 2VONA 4L3QA 5AQQA 3H36A 1IZ6A 4N4HA 1T8EA 1Y64A 2NNYA 4J9DA 2RHIA 4N4NB 4PSWA 5AIPA 2EX3A 2Z3YA 4LF5K 1KSPA 1OH8A 4YNQA 1CKAA 5M1QA 2STWA 2JLEA 3JCMg 2DYIA 3CCSA 1ETWA 1Q86C 1DIZA 2F4MB 4BWMA 4CJQA 2DOFA 2MGQA 4XQFA 5KAIC 1K4TA 3FDRA 3HYFA 1NK0A 4BB7A 1BJAA 1K8AU 4DOWA 2HL3A 3CM5A 4HLXA 3GOXA 1HNIA 1Y97A 3S6WA 4ILJA 3KLHA 1TT0A 1SHGA 2W82A 2DMUA 2XRNA 1A36A 2HQAA 1WPKA 2OANA 2CQQA 5J3LA 4CZJA 2BY3A 2R57A 4BHBA 3BPXA 1M1KC 4NC8A 4N5SA 1RBUA 2EB7A 2R7VA 1K73U 4ETSA 1TU0B 1BCOA 4CYCA 1XCVA 2MG4A 4CJPA 4OWRB 2G8FA 4Z6YA 1TKTA 4C8NA 4FPAA 3FXMA 4ENMA 1GOCA 3I4MJ 2OTLA 1IRGA 1XTDA 2NOEA 3WQTA 3EG3A 3K59A 3KXTA 3P9CA 3SCXA 3SHWA 3HFNA 1Z7UA 3DLKA 5E41A 2V79A 3MEVA 3VQ6A 2GIZA 2JNGA 3LYIA 4FWNA 1S22A 1UJ8A 9ATCB 2ZJRL 2P8TA 3D6RA 4EMKA 2V9VA 4A3FJ 1ZYRF 3AVKA 2VE8A 1KFDA 1POGA 4ZDPA 4JV5K 3HP6A 1FY7A 3CCMT 1PP7U 1L3UA 4E89A 4C0DC 4OGCA 1NKUA 5GPAA 2LKPA 4S05A 3HRUA 1MJ9A 4JRQA 2H27A 2DO3A 1TKXA 2MH2A 5JICA 4Q4ZF 2KEAA 2PQ8A 4M7DB 4R5PA 5LJ5h 5KQDA 3BJAA 2RKHA 4B23A 4HX8A 3A8OB 2YNIA 4U0YA 1SL0A 3CC4T 5AQOA 3ATVA 3O9RA 3REAB 2DBMA 1QMCA 1QVFA 2PN6A 2XIDA 2KLOA 2M1HA 5AQPA 2Y9ZA 3E9GA 4CF9A 3LFKA 4I76A 2P0PA 2QSHX 4CEZA 5GAN5 5D6WA 2CSOA 3KZIC 2Z1HA 1U06A 1SRMA 1AA7A 3CDIA 2AP1A 3GFLA 4WYBA 1TK8A 1Y07A 4IXCA 5E17F 2HHWA 4XNFA 3F3XA 1M3QA 4FJ5A 2KZVA 2ZWHA 1WIEA 3GBGA 3PQKA 2A1RA 4HYEA 2COMA 3N0UA 1M27C 2DT7B 2L2PA 4BYYA 1KVAA 4PDKA 1JXEA 2LREA 1ASVA 2F7TA 2BZ8A 2O03A 2JW4A 2VXZA 4FOIA 5SWMA 1JLCA 3T8TA 2LC4A 2EQJA 4YOUA 1E4GT 4XIDA 2DFUA 2OPSA 1P7MA 2DMQA 3MKZA 1Z05A 1FOYA 3WU0A 4BDYA 1W7PD 3I71A 1X6GA 2LX7A 1KQ9A 3U1DA 1VQPQ 3AA5X 1MW7A 2DAQA 1JLFA 2WC9A 2KDSA 1WH5A 4KT0E 3JSOA 4NLBA 2CYZB 4KGVB 1F1ZA 2VUMJ 2LP0A 1P90A 2ITMA 3NMZC 4M7AF 3E01A 2NRAC 1MUYA 3Q7BA 4BJ6C 3ERMA 3F0CA 4KRTA 1DTQA 4J2EA 1YTUA 3I56I 2K4YA 3O1WA 1A5XA 1LJ9A 1MBEA 1IDZA 2XO7A 2H8WA 2V1XA 1HF0A 4ABZA 5D6YA 3CUOA 3FLCO 2JZ2A 1IKWA 2DNUA 4PKHA 1C6VX 4BC2A 4EJWA 3P83D 4F7UE 4PL6A 5IP7J 1VQKA 4GV3A 2NOGA 3NFAA 4OJRA 4B3XA 3CMET 2HHQA 1G83A 3OW2S 4NXMK 4IFVA 2YS9A 5DUKA 1OH7A 2KDOA 1HW2A 2OFKA 1NEGA 4DU3A 3ZFJA 3CM6A 1KG5A 3LDSA 3C94A 3IRRA 2CV0A 1NK9A 3ATUA 4X6AJ 2DOEA 1PWTA 1JT0A 5GANg 2V9KA 5M3MJ 1K9AA 3CP8A 3LSTA 2JT4A 1NKBA 2NS7A 3QYBA 1LDJA 3EE9A 1TAQA 2QQ8A 1D8YA 3P4IA 3RPUD 1OCRH 3HSRA 3EG2A 5KYUB 2YHXA 3TO9A 1YITI 2YX6A 1MH3A 4QW2A 5JR3A 3L2QA 4GKJK 2FPEA 1ZQ1A 3NNQA 3CFRA 2HVQA 4A2BA 5TKWA 1U0JA 4C2TA 3DXJF 4F7UB 1BDGA 1NMDA 3QWLA 3ITHA 1HRHA 3WXJA 1YHQT 4E7JA 2A40A 2BE5F 3OQ5A 5CVIA 2QENA 3NHNA 4IFEA 3THVA 4L0YB 1W2BS 2OPPA 3ZMTA 2K40A 2FOKA 2EBPA 1MGTA 3F22A 3LA2A 2HGCA 1GCQC 1IJWC 4DS4A 2LNVA 3GOIA 4B9MA 5ILUA 1JKOC 2ZMEC 1S9HA 1C0MA 3F21A 4G7HF 1WHKA 4KN7X 1V5GA 1YRNB 1QP3A 3PO2J 4M7DA 4E7IA 1I39A 2M30A 3LALA 1M90C 4M3BA 3FBNB 1T0FA 1MUNA 1N3AA 4K11A 3EYYA 3CCQQ 4OKKA 3AVLA 1QQJA 2X6SA 3PL8A 4EGYA 2GA1A 2X1EA 1Z7LA 4ZTFA 2O6GE 3MKYB 2RVCA 9ANTA 4IXAA 1T3LA 3G0ZA 1YO5C 5ICGA 1C1CA 3GO5A 2DL4A 2DW4A 2RJFA 3BR5A 1VQ4Q 4HLYA 2E8AA 3I59B 2MD5A 4KGXB 4CZMA 1UHSA 1U04A 4LFBK 3BF1A 1EZZB 1VOMA 2RQPA 3PX0A 2E70A 4Y1DA 3AO5A 2M4KA 2FBXA 4OPJA 1F21A 4BR5A 3WGIA 3NHGA 2YV0X 5L3BA 3QIIA 1FBSA 1H9GA 1IW7F 5TGTA 1NHAA 3ZL7C 2E1NA 5D4SA 5F64A 2EV5A 2X51A 2DN0A 2DJIA 1XTAA 5LJ3f 2E5LK 3PGGA 4MZPA 4D8KA 4ZHRA 1V4TA 3H3OB 3I58A 3MEAA 2GUPA 1KJWA 1F5TA 4D8DA 4LN2A 1R9TJ 3RMDA 2IGOA 1IDYA 2F1LA 3CBPA 3V7SA 1YJNN 4M7XA 3TI0A 2F5TX 3JSCA 3VESA 2ASOA 1QNTA 3AGRA 1IGQA 2PAVA 3CCVQ 4AU7A 2Q2EB 1HOMA 2OTJA 2DX1A 2M16A 3CF5L 3VA0A 3G1JA 1OISA 1AZEA 1R49A 4UOBA 2X4HA 3DQVC 2I5UA 3QP6A 2VXFA 1E7OA 3IFRA 5JLWA 4CGJA 2YR2A 4LF6K 4OU0A 5KGXA 4M7AD 4M74A 4II1A 1A6QA 2OQGA 4U7DA 1WQ7A 4RMOA 1M1FA 1FEXA 1O9SA 3P8DA 4E7LA 1LCKA 5KYNA 2WACA 3MEDA 4RUGA 4IUTA 2JWLA 2CP2A 2W84A 3MKWB 4J9HA 5LJ3h 3LSKA 3CCRI 1TKZA 4JJDA 1HJRA 2K3PA 3GTJJ 3TO6A 4XTXA 2J6OA 3CCLA 4IO8A 4XH5A 2Z33A 1OH5A 3HGGA 1QO0D 2KMTA 4U87A 4A5MA 3OMGA 3CP2A 2DAOA 2DYRH 5DY9A 5BPIA 3OW2M 4JKEA 4MDAA 5H2FC 1SANA 3SZTA 2BIVA 4QVDA 3SQNA 2E5QA 3KLEA 5KYUA 4LF9K 5GAN3 3CC7A 5E20A 1WQ2A 4Y4RA 3A02A 1VQ8I 3A8YA 2XIGA 2RHZA 3VS0A 3CF2A 2XDVA 1AU7A 2YKMA 1VSIA 3JCMb 5KCHA 4F52A 2Q1ZB 3ASNH 1ZUKA 5L3CA 4BXXJ 3AV9A 1WN7A 3H5AA 2NAZA 4Y17A 3HOWJ 4BC5A 2CV2A 4GYGA 4F7UA 5LY3A 1WSGA 5HS7A 3U9DA 1NGCA 3AA3A 1ZARA 2ZE2A 4HHTA 4L5IA 1ZLKA 5A0DA 2Q2RA 4HTLA 3DOLA 4O5VA 4O55A 2RH2A 3M8SA 5AQKA 3MAJA 3QPTA 1QBJA 4W5TA 3MMYB 1EF4A 1B34B 4HSTA 4O8KA 2EFQA 4A59A 3QQAA 4M7DG 4IBNA 1NKCA 2EJRA 4LF7K 4B3AA 3OS2A 4AUXA 2RJDA 1YRNA 3HSBA 4K25A 1G3YA 2KZMA 5KRTA 1UJ0A 2H3EB 2X4JA 3H3ZA 5J26A 3FZMA 1LQ1A 4EA4A 1W2BM 3INZA 1X27A 2O8FB 3CVTA 4MMKA 1X58A 4JS5A 3NVKA 2JWKA 4GXOA 1QHGA 3W2VA 3HFOA 1QKXA 3MCAB 4AQYK 1TC3C 5IT9E 1VQOA 5HVQC 5KCMA 3HKSA 2F2VA 4IOAF 1X1PA 2GOXB 1IG8A 3M4YA 1DPRA 4FT2A 1RAFB 1N8RO 4FLTA 4EP4A 3I59A 1XQSC 2RK1A 2O4IA 3GF2A 4LDVA 4CYDA 3DCFA 3PNYA 3QLHA 1W36D 2YU9J 2EKOA 1DT9A 3LZIA 4YFKF 4XH1A 1WFXA 3HTSB 2E2HJ 3F73A 2KIMA 4LLGF 3JYTA 1KU3A 3V4IA 2OA4A 5AQGA 3LA3A 1WJBA 1YIOA 3VF4A 1CGPA 4A62A 3IHOA 4ELVA 1EV7A 4A0YA 3K9KA 2K02A 3WVDB 3AL0B 2G8KA 2L3SA 1RPWA 4P9FA 5FLXE 1R1VA 2JA6J 3AG1H 4Y91A 4O4GA 1LWVA 1QVUA 4JZ4A 2DA9A 1O7LA 2WC2A 2E1MB 2CZ6B 3OA9A 3REOA 4XU1A 2NLXA 4AC0A 2PVDB 2GXBA 2D5RA 3FE1A 2JT1A 4KTQA 2Q2EA 4YIRX 4IFYA 5AQXA 5GAMd 2DBKA 2VQHA 4ISEA 2XG8D 1BI2A 3CUQC 4PLIA 3O4WA 4EZ6A 4OMOA 3RVCA 4RM3A 2ZPEB 5KTQA 4GNIA 4EIKA 3KNTA 2E6LA 5DM7R 1FWZA 5GMKh 3AVFA 3AO4A 2HSPA 4JK1X 3CG7A 3D45A 2AIRB 2HU9A 5CAIA 4I7FA 3CCJN 3K4BA 2DVJA 3SYZA 2BV6A 5EGOB 2LKSA 2F69A 4C92E 1VTNC 3WGGA 2V1NA 1VFCA 4M3EA 3P9IA 2P4TA 4CE9A 3F8FA 2YUPA 1KGSA 2A6EF 3RWUA 1IKYA 3MO8A 1JU5C 3AVIA 4CA0A 1YNZA 3TW6A 1LJOA 4ME7A 5HY6A 1O57A 3A8MB 4F14A 3RESA 3WNHA 4Y52J 2E5NA 4B3TK 1YS6A 2IGKA 1X9JA 2QQBA 1QZYA 2QWRA 1RAHB 1VQ6I 3QDKA 1TGOA 2OPQA 4X1VA 2HBLA 4ZYAA 1LWCA 4OP0A 2OU2A 2NOIA 2HHTA 1VQ9T 4RW7A 1HLUA 4M3ZA 1NU0A 3O8HA 4OIOF 5ADXH 4KH1B 2CGPA 1T56A 2M4GA 1REVA 1TL3A 1ZYQA 4F7UG 4I6ZA 3MJXA 4DZJA 1BJZA 1H9TA 1TXQA 5BRFA 3FIFA 8ATCB 3K7AJ 2LCLA 3TP0A 5DM7L 2D2WA 2O8KA 4EPCA 5M1NA 2WOMA 2MFZA 2QTDA 4YRVA 4J5YA 1CSKA 5IYBJ 2L3PA 1OMIA 3SPYA 4X66K 2KYMA 4OMLA 3CCQN 4WQ5C 5GPCA 5EG0B 3OR1C 3AFHA 2KQWA 1S3JA 4XN0A 3SV3A 2KT1A 1NNEA 2CW0F 1TK0A 1KONA 3A5OC 1TK5A 3CD6A 1B34A 5LJ5g 1J75A 2CV1A 1HYSA 2K4JA 1N9SA 2NS8A 1FOKA 1YF5L 2HQRA 1P7JA 4GV6A 2G9WA 1VQ4N 1IV0A 1O3QA 4BY6B 5AQRA 3SAHA 4M3DA 4A54A 4FL9A 1VQMI 4Z89A 2EHGA 4FISA 2O8FA 3EUAA 1IJJA 3K4KA 3C6AA 4BS9A 2CZ0B 3CC7Q 4YDUA 5LL6S 4M77E 2BEOA 2M45A 5LGTA 1HBXG 2P7CB 2Z99A 3AT1B 3DI6A 2E34A 2L0AA 1UELB 4NNJA 5GJVB 4CEFA 3TDUC 4RAYA 3V42A 1C0FA 2GWKA 2Z9OA 4IEEA 4B3MK 2O8DB 1VQLT 3K10A 1UCRA 5CZ1A 3HVRA 3LAMA 2EYZA 5DYMA 2HXIA 1RRSA 1ZN2A 5JLXA 1P4WA 3THYB 1FNNA 3SQ4A 4IURA 1QZZA 1EH8A 4H0OA 1AWXA 1S1UA 2KRSA 3H92A 3WVEB 3T1YK 3M0RA 4CD3A 1W5TA 2CQKA 2UUZA 2V9PA 3CCVN 4OMNA 1N5YA 1O3RA 1D09B 4OKJA 2QKBA 4MLHA 1SEMA 1BO5O 5L8RE 2DIQA 5HRSA 1ZQ3P 5L3FA 1W9HA 2UV1A 2JTFA 4EZ9A 4XLAA 3TU4K 4Z4IA 2QK9A 4FO0A 1SFXA 3HZJA 3IRQA 2DKGA 2IOCA 4QWQA 5E26A 2MMPA 4IQJA 3SI6A 2WAFA 2ISZA 1O1WA 4M77B 4B1VA 4EDUA 2CZ1B 3W3DA 3B6AA 2ZPFB 4XBFA 5KAFC 1YI2T 2IIRA 3I56Q 3VQ8A 5GAMe 1NWKA 4DHYA 1YP5A 1ZREA 1G99A 1J2XA 2D0CA 2RJCA 1KQSS 1V4SA 3PX4A 4FYXB 2FNAA 2F9TA 4B8AB 1YJWA 4JX4A 3C0CA 1OYWA 2LR8A 1DLOA 4EQQA 1FX7A 3WE2A 1YJ9A 2RE2A 2YLCA 4B1RA 2O01E 4IO9L 4RAGA 1PD0A 1VQ5Q 4CESA 2XDDA 5EGOA 2CZ7B 1ZHIA 4M63C 1ORKA 3IHUA 4MQ3A 1GXPA 3H9GA 3JRIA 1YWPA 1L3TA 4BEHA 1V55H 4C8QB 2XDBA 1GFCA 5J2NA 3QB0A 2LOOA 2I10A 3R1XA 2K2VA 4AVZA 4I2OA 1D9FA 2YDLA 5ICCA 4IIMA 1NK2P 1MMNA 2RAEA 3CFPA 2J6FA 3KX2A 3G4ST 4JX5A 4AD9A 5GAOq 2E2IJ 2HOAA 3FEOA 1W7AA 4G1QA 4CGFA 4OMFB 4CHPA 1H1VA 1APLC 4FWPA 3ZSVA 4M75F 4QQGA 3SDZA 4OFAA 2PUOB 3D5RC 1C0TA 4M3XA 1IXRC 4WCGA 3LSIA 5AIQA 3P9KA 4N0AA 1MA9B 1GV2A 1JBMA 2LQNA 3VS4A 1TL1A 1BI3A 2L02A 4DOVA 4RW4A 3SV4A 4RB0A 2D0AA 2NRXA 4QS8A 1WCMJ 3Q9SA 1F36A 4A0ZA 4RA2A 1J53A 1U49A 3ZSWA 3OL4A 3QAHA 1UGPB 3C7NB 5EG0A 3I5SA 5E8IA 4EM2A 2EJGA 3U3YA 3HBTA 1UHCA 2BVMA 4M78C 1G3SA 2LVSA 3CC2T 3ZMUA 5GAOl 3I0SA 2EIMH 3CJ9A 1BUPA 4WQ4A 4L18B 5HKCA 1VQ7A 3LWIA 2QA4A 3VS1A 1KEAA 3RZOJ 5CVUA 1JLAA 5J2PA 3BFMA 3BY5A 1OLTA 4RW8A 4O5BA 2DXCA 2YHAA 3I53A 4PK4A 4DTSA 2JN0A 2DODA 3DLMA 4XSZF 3OSFA 3CMAT 1MKMA 3NF9A 3D7SB 1K4US 4XLPF 4EJOA 1I0CA 5DPKA 3LSPA 3RKWA 2OQRA 3GX4X 4M75E 2EV6A 4ZGJB 5AQSA 2K5LA 3WTZA 4C5EA 3CJ7A 3FBIB 1U1TA 3EKSA 4GV9A 2WONA 4B1YB 4F3QA 1Q8IA 1UEBA 3HOVJ 3VRYA 3U2RA 3VOEA 4ASNA 2O8DA 3R6MA 2ZFUA 3O9QA 1ULYA 2LD5A 4DR5K 1VSKA 1UG2A 3VEXA 2DD4A 2IA2A 3PFYA 2KLAA 1V29B 4M3WA 1O7FA 5HRNA 2R7UA 2TRTA 1Y56A 5BR9A 5DEQA 3MXMA 4A3BJ 1TLHB 3MN6A 2K9SA 1CZAN 3WTUC 2BE2A 3FKJA 1QVFS 1NLPC 3CD6Q 4XIUA 3PSIA 2YNFA 1NZ9A 4YIIA 4LFCK 5CQYA 1F9NA 3GE1A 2AQFA 4OPAA 2QEXI 1UHMA 2FZCB 3SUOA 1X2MA 1HW5A 1T33A 1NJWA 2W48A 3ZXSA 4UNFA 3IC7A 4BVOA 2YHWA 4QT7A 4K2EA 1UGRB 1RL2A 2H3JA 2HHHK 4Q5WA 3V8KA 3G71T 3FMSA 1NK6A 5C24A 4M77A 5J8FA 2ZCWA 3FX3A 1PYVA 1AWOA 3QNOA 1VQNA 5FLVA 3JAME 5IWAK 2RI5A 4XORA 3G1MA 4BH9A 3E9FA 1KC8U 2MIOA 4RGUA 1RADB 1ZSGA 4O0IA 1JGSA 2FD5A 4JEPA 1HXDA 5E1XA 4ORZA 3KP6A 3IRXA 2VCPA 2MPXC 4B44A 1HSQA 3CI5A 4MTEA 1KU7A 4FZXC 4JK7A 2FC0A 5J47A 4PJOB 4F55A 2OYQA 4XRFA 2EIJH 2M51A 4ANJA 4BR7A 1YLFA 1HLVA 2R7FA 4DV2K 3I55I 2HEOA 2FXUA 3ALYA 1D5YA 3GTGJ 3I4PA 4B09A 3PQJA 1XQPA 5LBQA 3KEOA 2JPBA 3FHGA 2EPFA 3LLRA 5ECAA 4C8QA 3D1NI 2R0QC 4OB1B 3L2WA 1FXXA 3BTJA 1R5ID 4Z02A 2MH9A 5DCFA 4N4IA 4LNPA 1RBTA 2CGKA 3N05A 4MDWA 1DJ7B 2AJQA 3CCEA 1RDUA 1ABOA 4EFHA 3G6EI 2M9HA 3ZSQA 1HPMA 3OBWA 5E3OA 5J39A 4ZDLA 4LD9K 2ITGA 1HKSA 3HG9A 3SK3A 1XN7A 5HNFA 2R4GA 3QBYA 4LFUA 3ZQHA 4JI6K 4B21A 3JB9G 3CCMA 1J54A 5EZGA 3S2DJ 4AIDA 4M75D 2YG9A 4L0ZB 4C92G 3NE6A 2YX4A 1YVUA 4V19S 4BBSJ 4Q47A 1NK7A 1MH4A 4J9FA 4N47A 2DL5A 2BGGA 3WGHA 4HDUA 4ATOA 3CDLA 3QFUA 3JREA 2NOFA 3C7NA 3CC7N 2ZKZA 3GWZA 1I6XA 3CC4A 2VC0A 4Y7NJ 1RI9A 5EC7A 4LUEA 3HO1A 3JRZA 4GW6A 4RBOA 1WUAA 3CCST 4BY9C 3FGUA 4C0FA 1V4RA 1K78B 3I0TA 1S1TA 2IT0A 3LPTA 1NJIO 1DP3A 2E6ZA 4LDXA 1ESVA 2ZBKA 1BU6O 4A2AA 3TREA 4X0GA 5BREA 3KP7A 2KZGA 3ZSOA 3TKYA 3NRVA 1JKRC 3DFGA 4HXJA 2NS0A 3EG9B 1B9FA 4OMZA 4HPQA 2G6FX 1MV0B 4KB0A 4YELA 1LFPA 4NCAA 2V52B 2MC4A 5I42A 4JOMA 4UUTA 3ISPA 3HI0A 3LA7A 5AQNA 3VUZA 2V8IA 2PFBA 3BTCA 4BRIA 2D1XA 2D6FA 3QESA 1ZH5A 4YFXF 2HKXA 2Y4YA 3M8QA 4KTWA 3BZCA 5AR0A 1LFBA 2WAQA 4CFBA 5EOYA 3AVJA 3RSNA 2B86A 1S1XA 2CO5A 3E2UA 4HRIA 2Z2SB 2R7DA 2A7YA 1ORPA 4C9YA 3SJJA 5FWBA 1W4SA 2BUDA 4CJLA 4XM3A 2XY7A 4K8XA 3I56N 3C6HA 3DKXA 4H0PA 4FX4A 5HNHA 3FF5A 4GVMA 3P5JA 5BPLA 2YNHA 3A2KA 3DKWA 4I09A 1MGQA 3TQ7P 3EYIA 4M77G 2QA4Q 3ZN0A 3SAFA 3HB9A 3AVHA 4FETA 4DBFA 3AO2A 2GTJA 1PUFB 2G7UA 1IN6A 4FYVB 2KMUA 1EWRA 5HODA 1U47A 3BZ6A 2XASA 1QWEA 3DEWA 1QVFM 3CO7C 3LWLA 2KQ2A 3CMEA 2DE0X 2WBMA 5JVTA 4A4HA 4B9NA 3LX7A 3QINA 1VQ5N 2G0EA 1WA7A 3DLBA 4ILHA 3UB5A 2VXDA 4C2UA 4LOCA 1GVDA 5CKTA 3FHZA 1S29A 4IPAA 2IAJA 4JYAK 2KFDA 1RAGB 5A2QZ 3VKIA 4A0XA 1FOXA 5J4VA 2J7IA 1EKEA 1HJDA 2STTA 1PU7A 4DSJA 1ETVA 2DZCA 5CQXA 4B1XB 4PY5A 4PJOA 2HHVA 1S72Q 2UUCK 4C8QG 3JCMP 4KGZB 4DV0K 3BDUA 2ROLA 4XK4A 1N8RR 4CHNA 1YITN 2FO0A 4QS9A 4F2RA 1GLBG 3PIPF 2BH1A 2IDOA 4QKUA 2QG9B 3VQAA 3OYLA 4JRKA 1ABQA 1Z67A 4J9EA 4FJMA 2DRMA 2F6CA 4KMFA 2P5VA 2KE9A 2O4XB 1P6RA 2J5PA 1Q95G 2E64A 3KEQA 2JJ7A 2HOEA 3GEZA 1SF9A 2MAMA 3GIBA 3VYSB 1IUYA 4Y92A 2VODA 1NLVA 1NK8A 4HSRA 2BY1A 1Q9YA 2XAUA 1Q9XA 1YHQA 3QBXA 2WY7Q 1FOWA 4YOWA 2BUPA 3LOCA 4DTJA 4UUSB 3RDIA 4ENJA 4KH4A 2G8HA 4TV7A 1GLEG 1WI7A 5LGUA 1YIJI 1OQYA 3B6OA 3M5AA 4UB8C 4M9XA 5AQTA 4CEBA 3EY1A 3ENBA 4CGHA 2A05A 2JZYA 4RW9A 3G1LA 2H1KA 3PVLA 3M59A 2K3BA 2R92J 2RNJA 1R4NB 3SDBA 5GTIC 3OYDA 4Z4FA 1MBFA 2LTOA 3CWSA 2NOLA 4R0KA 1VQKT 4A93J 1WDXA 1W36C 4JKAA 1SSFA 2DCEA 4FZYA 4CGIA 3MN5A 3MP1A 1YW8A 3N5BB 3SUPA 1S7EA 5IYCJ 1RTHA 2RN8A 4NZGA 1Z3YA 1R4MB 2VGNA 2ZNZA 1BW5A 5CYMA 5E3MA 1AVZC 2ZJRF 3M0UA 3V9SA 3WNFA 1K78A 1PSEA 2P9UB 1CXQA 4BQNA 1OYIA 1RLQC 1R59O 4Z4HA 2FMYA 4J6XA 2UXXA 3VV0A 2E65A 4IG0A 5AQVA 2DZ9A 3OYHA 3CJQB 5GAN7 2W6KA 2HBMA 2XD0A 5LJ3d 3CWTA 1H3HA 3OW2P 3EG9A 5JI6A 3JTHA 1E6HA 2R58A 1OJLA 4JRIA 2MA3A 4RB1A 4EM0B 1RT3A 2L54A 5CKBA 4A6EA 4ZJZA 5IT9O 1QVPA 1YG2A 4DQIA 4BE1A 2KPMA 1QHHD 3OJUA 1MUZA 4ISFA 1MUDA 4EV0A 3OSGA 1IO6A 2X9DA 2Q1NA 3KZYA 1OPCA 1R00A 3CBMA 2IPQX 3M3YJ 2PNIA 2QQAA 3SNNA 4H4MA 5JHFA 3SZPA 3RPQA 4RG8A 2K6DA 4FM1A 3UDCA 2MC3A 3KD1E 3QYHB 4BNCA 5KHDA 1NMNA 4B48A 4IOAL 2P7VB 1IUFA 4QQDA 2IEKA 2LJ3A 5JVGF 4LC9B 5GIOA 2JA2A 4FJIA 3C4SA 2RA2A 3S15J 4AG1C 1QRYA 1SRLA 3U4LA 3F70A 3RMQA 3QO3A 4FJGA 4CZCA 1DDNA 3W6VA 3EN9A 1PUFA 4GBQA 4J2BA 4I99C 4CUGA 4QVZA 1ZBHA 2RJEA 2F2WA 2H09A 2KKZA 4BXFA 1LAVA 1BU1A 1VNDA 1W2BP 1TZLA 4OIQF 3FSPA 4Z8AA 3VQ4A 3SFZA 1N6AA 1QWFA 4UVBA 1WSHA 2P9KB 1K8AO 4M3RA 3ZCMA 4PJOG 4R79A 1I1SA 1BL3A 2ED1A 3LQRA 1QQNA 2KXCA 4W5QA 3R6SA 4IHYA 3AVGA 3HIFA 2E12A 3ULEB 4OVLA 2COWA 3CLOA 4DTXA 3HL2A 4OMQA 2DXBA 2QDLA 4B3SK 1N8RC 4ZYDA 2XVCA 3VYRB 4FHTA 3JCMf 4EATA 3DF8A 3OW2A 3D2EB 3JRFA 5E3LA 2XGXA 2G7HA 2MWOA 4KHYA 1XNQK 2IC3A 4DYQA 4XK8E 1IXDA 1KG7A 2O4XA 1XB4A 1EWQA 3HHGA 3E5XA 2RHXA 2PFUA 4AI5A 1MU2A 3FHNA 2M0CA 3A2FA 4XRSA 2RO0A 4R56A 2P9LB 3H3UA 4RW6A 4B4CA 1FP2A 2E6MA 4NCGA 3CMEQ 2JUFA 1VZ0A 3FXJA 5I22A 3TGNA 4UUSA 3MEEA 5KRSA 5C42A 3JAMZ 5GADJ 3FK7A 1T8IA 3E9PA 3BDLA 1YJNI 1R0AA 2OTJT 4CF1A 4E70A 3K4CA 4CZFA 3FMQA 4DU4A 4B9TA 3ZRGA 2P6TA 4C23A 4I9LA 3VGLA 5KPRA 3I8BA 4PJJA 1ZHFA 3VS3A 1NG2A 4KI6A 3P38A 5M1FA 1WB9A 5GAN2 2RNAA 3QU6A 3PNWC 3JCMh 4KH6A 1KTQA 4YY3K 2OJED 2B5JA 2M7BA 4RLQA 3SWNB 3QOEA 2BW3B 3OSSC 4DSLA 4IRIA 4HDVA 1OEBA 3GFIA 4I2PA 3THWB 2HYGD 1WJEA 3CCLT 2L89A 5F2RA 2D0NA 5E1WA 3NGZA 1WSFA 4RTXA 2P9UA 3RDVA 1RESA 3KTQA 3VUBA 4EMKC 1IG7A 1LOTB 1HDDC 4WF9L 4Z4GA 3O9SA 4HVWA 3M0TA 2VG5A 3ID8A 3MAQA 4YPRA 1BBZA 4QAGA 2JSPA 4JKGB 1N5ZA 4GKKK 4F3OA 3BCBA 3LSMA 4NUBA 4OAYA 4GO1A 1X9WA 2W85A 5D6FA 5C3EJ 2AQEA 4HCKA 4M6XA 1JXOA 3ABTA 5EEGA 4OIRF 1R77A 1MMGA 3LWHA 2ZJQF 2IP2A 4L5EA 4Y28E 5D8LB 3QPHA 3ZETB 4CECA 2DPUA 1TTYA 3M57A 1QQMA 4FXDA 4H0XB 4JUVA 2GGRA 2QGGA 4EP5A 5A2QO 5EXWA 2QA4N 2LLKA 1X3WB 1KSWA 1SVOA 4BQAA 4XRMA 2QSFX 2XMFA 2XAFA 2QKKA 4MO5A 1RKTA 1WZOA 2YWWA 4IUPA 1KFSA 1XDUA 2RN7A 3OBYA 1WI3A 3QICA 2QEXQ 2OCEA 4CW7B 4X1EA 1ZR2A 1GHCA 2P4RA 4FLUA 3BLYA 3L1AA 3NF7A 1XG7A 1R0BG 2DA2A 1VIFA 3WXKA 3O3KA 3CBOA 1QP2A 4KISA 5KGWA 4A57A 1J7KA 4K43A 2R7TA 2ATQA 4E19A 3V9WA 2EKHA 1LPQA 2GNCA 3HOTA 5IT3A 2ZPBB 3M56A 3T1HK 2PI0A 1SZ2A 3ZBDA 4NYFA 4ZZDA 3JCMQ 1S72N 2KIFA 5AN4A 2E4LA 2IG0A 2NNWA 5K7HA 2KROA 4NOYA 2VBZA 2HSTA 1VQ8A 3AHUA 2GLOA 5LD2C 2AK5A 1VQOT 4A3JJ 3MKDA 3ZGKA 5ED4A 4BRCA 2P9KA 3F9KA 2EA4A 2QASA 1KD1U 2FBHA 1Q81U 2J6KA 5J1RA 2FXAA 4L5GA 2B0LA 2R5YB 1O75A 4KT5C 1PP8F 3BR3A 3M4OJ 2CH0A 1A5JA 4DLGA 1XQOA 3VQ7A 4DR2K 3TR8A 2AS5F 5F08A 1E6GA 3K9JA 3F8CA 1VQPI 1DU6A 3M07A 1VQ9A 5GMKm 4JKCA 4CSWA 4FK2A 3IMXA 3D2EA 1XSDA 1NJYA 1YQLA 2PMZA 1P9QC 1K61A 3HGYA 3DOKA 5CO7A 2DTOA 5GANf 4XAXB 4QPQA 4CJUA 2L7MP 1X19A 3ZP5A 4MTDA 2JGUA 3PTAA 3CETA 1X2NA 4KRFA 2P9LA 1PG5B 4BRQA 1UB9A 4A63B 3JCMX 4RTUA 3VEOA 3S16J 2WFBA 1MBHA 2YPRA 1J59A 4MZMA 2P9NB 4O44A 3ZYYX 4DLEA 2EFPA 4AYBA 2K4BA 2RPIA 3O8VA 2HMAA 3I0RA 4PZJA 3BCAA 3B6PA 1YE9A 1RDWX 2VBYA 4LIUA 2F48A 1IH7A 2ELKA 3SYTA 4JK9A 3UIQA 5M1PA 4CJTA 2ZXHA 1B92A 4H03B 2AA4A 2HNZA 4XU0A 3BR0A 2HZDA 1WYXA 3HTVA 2DTZA 5GAOp 4BI8B 2ASPA 3W0LA 1JQQA 1WPYA 2NVUB 3P8HA 4FLXA 5FD5A 4H5TA 3HDDA 1ZLMA 1U5TB 2PG4A 6AT1B 2ATCB 2CMPA 3U9GA 4E4HA 5K7FA 5GANh 2OZUA 3SWNA 2BW3A 4PIIA 4JD2B 2CJJA 4BQZA 3THWA 1X3MA 1RT7A 1QS4A 3JRGA 4Y3OA 2PUKB 3QEWA 3SXYA 4U0VA 4G94A 2L3QA 2CGLA 2XHCA 4AT1B 1XQHA 5B66C 4EHTA 5BMZA 3CCUQ 2DFFA 4N9HA 1K4SA 4A3IJ 1S3XA 3ECHA 2HWVA 4EGZA 2V1DA 4NS5A 1E17A 3L2ZA 5M1KA 4JKGA 3KLFA 2NNNA 1RZ4A 2LF8A 3EAEA 5C2DA 1OOTA 4XU2A 2RPNA 3RRGA 5H6QA 2R5MA 2G8VA 4D1QA 5GAN6 4M7DC 1U5SA 1GXQA 2LG4A 1FYLA 4JP0A 5I2SA 1T0FC 1D9DA 3BJ6A 3ZETA 3PO4A 4V2FA 2A42A 4IHSA 2OD5A 3GLLA 2BDPA 2BANA 4DB3A 3RBBB 4FJNA 3KWIA 4E1JA 4JRPA 5J1EA 3ZT3A 4X9DA 1W0TA 1BN5A 4ZTJA 1V76A 1GOAA 3SEQA 5J6XA 3HC7A 2ECZA 1LWYA 3M0SA 3KVGA 1T6SA 3ZR8X 2RN2A 3CCQI 4W5OA 2DK3A 1MSEC 1NJZA 2IW5A 1FJLA 3WTYC 4DNCA 1T44A 1HMVA 5F1JA 5LJ5j 2KYBA 3VS2A 1VQ4I 3KETA 3K6GA 2OTLI 1WLPB 4VUBA 2UXDK 1UHFA 3L42A 2QWQA 3R0AA 3UA6A 2A07F 2JA5J 3OYCA 4WXCA 2GFUA 1YVNA 3BC8A 1OPKA 1TT5B 5J1UA 4IUQA 4BR4A 2K3XA 2F5VA 3KLGA 3JAMO 1NK5A 3J7AF 3PX6A 1KLNA 3K58A 5IY5H 5KK1A 2HXOA 3KKRA 2A61A 2LT4A 3G4SA 2E60A 4FYYB 3A03A 1JJ6C 4CZGA 3IL2A 2R5YA 4OMPA 3M1FA 1RFQA 2HQNA 4EW0A 1IBMK 3DEUA 1BI0A 4A69C 4D7MA 4KV8A 3HKZA 2JQ7A 4NBQA 3GVAA 3VFZA 2MK5A 3CMEN 1HNZK 2K9LA 3S9HA 3PVQA 1Y0MA 4W5RA 3R3LA 3W2AA 2HNDA 3P8BB 1UG0A 1EXQA 2E1OA 1N9RA 4LJZF 1JT6A 3CW7A 3TCJA 1M3HA 3KBGA 3CO6C 3PIOF 2O9LA 2ZJPF 3CCVI 1XGMA 2XAQA 3H1CA 5GMKi 3ZMZA 4CHOA 4PKCC 2A41A 1VQMA 4DFMA 1M3AA 4A61A 1IXSB 1MJAA 1ZA2B 1ZBFA 4OAZA 2CH6A 1S1WA 3VF6A 2Z16A 5E18F 3I8DA 1K9MO 4ESBA 3CCJT 4FWKA 1WEGA 4PJMA 2P9NA 4OPKA 2IAIA 2YT6A 5CVRA 4CRIA 3J7ZI 8AT1B 3LM2A 1ZRFA 3H0IA 3QPLA 2MSYA 1RBSA 4WCEL 3HBLA 4KBMB 2EWSA 3V8JA 3U3GA 4ISGA 2HF4A 3EUHC 1J5OA 4BE2A 3OB9A 2FPDA 3U9ZA 2ZZDA 1Q86R 3SHFA 5BN8A 1N3CA 4GLKA 2WTEA 4C0ZA 1NGBA 2XICA 1NGEA 3EYZA 1M3BA 5TKYA 1X1BA 4GRIA 4I01A 1IHVA 2QI2A 5DM7F 1U5TA 4HCBA 2BTTA 4DQQA 1SVLA 2CP3A 3CMAA 4CIFA 2K9GA 4KULA 2F5CA 4JLGA 3CJNA 4JD2A 1Q82U 1MMDA 4S04A 1HKTA 3FXUA 2M5WA 4C8LA 1TNTA 1Y6IA 4PJ0C 1WHLA 2PZ1A 4CVNE 1KQSP 4U7BA 2JG6A 2EQIA 1P4AA 3AA2A 2ID3A 4JKDA 1QSYA 3KK7A 1V1CA 1ATSA 1JTYA 1JJ2A 1WNSA 4JI3K 1JB0E 4J6YA 2BZYA 1QA6A 1T2KA 4OINF 1WZ2A 2FSJA 2NOBA 3J81Z 1KQ1A 3JRDA 5HOOA 4BRNA 4RTFD 2QEXN 2EZIA 1UGVA 2X6OA 1Q7YU 1M2OA 2R7XA 2GTDA 1ZTRA 2LP5A 2XB5A 2LYCA 1ZGWA 3VEVA 3S1NJ 4GLMA 1Y8QB 1JL1A 1W70A 2DQLA 3FZFA 3IP4B 1XNRK 1NPRA 2L3RA 2LCCA 3FFIA 3K1PA 2A68F 1KG4A 4GMJB 1GLLO 4DZPA 1SD6A 4N41A 2VKVA 1UGSB 2QVOA 4E1NA 3GZNB 1ZRDA 2CDTA 2X78A 2P4WA 5KYYB 5DMRA 1IAWA 2QTVA 5JFRA 1RT6A 2FBYA 4JI8K 1DP7P 3O1BA 4KMUX 2A08A 5B1BH 4CZEA 1VQLQ 3L1PA 4M78F 1XDSA 1VQ7T 5J2MA 2CU7A 3GTKJ 2WUSA 5KVRA 2HAXA 1PU6A 3TDZC 2IGMA 3I55N 1JLBA 1YX3A 4PHTX 5AZIB 2DFIA 2HDWA 1NJIC 2JUCA 1ZLJA 3T9NA 2V1UA 2VWJA 3FHFA 4LB5A 4ZYGA 3T1AA 4KKOA 2HBPA 3I5UA 5DUIA 1RUNA 4PUOA 4D9JA 4FM4B 1JKHA 4BRKA 5CE3A 4XL9A 4BRAA 1B72B 1VRLA 1LKXA 3EETA 2QAZA 1CZ9A 4E9GA 4M42A 3QUIA 4CEQA 3OYJA 3E19A 3TAMA 1KQSA 1XSVA 2VQEK 4DW6A 3WTWC 3V9UA 1SHFA 1JGGA 4BC4A 1FPQA 3DP7A 2UU9K 2K9QA 2Y0SA 2R7SA 2DA3A 4FJ9A 2CUDA 3MEXA 2WSEE 1YI2Q 3DLEA 1NJXA 3R61A 4B9WA 4H0EA 4A3DJ 2JPCA 1WJDA 4LD0A 3I9V2 4IO9F 3P39A 2EJ9A 3FR0A 4JKFA 5GAEJ 2ZPGB 1ARKA 3G10A 2W04A 3QXEB 2DI3A 4PCQA 4ZZLA 3M8RA 5D5XB 3MZHA 4BUPA 2RI2A 2NRRA 5J2QA 2VJIA 3PMTA 2W57A 3RUXA 3PIPL 1GXIE 4R1HA 5KE3A 1AHDP 2XPUA 3FZVA 3BUZB 1QVFP 5FPNA 2XF7A 1WHGA 3LDOA 1VQNT 1H88C 1TSFA 4BG8A 3CEYA 2JSCA 1TL8A 1P2FA 2LQKA 3L2CA 2NUPB 2SRCA 4CC2A 3W6KB 2IXSA 2A0FB 3OS5A 3DB3A 4KUDK 2L8DA 2P9PB 1IHWA 3W3CA 4XICA 4XKVA 1K8AR 3QSUA 3CCUN 4CF8A 2E20A 3PJRA 5LJ5f 4KPYA 2B6AA 3QZ5B 3I3LA 2FEIA 2YUNA 5LJ3j 5EEAA 3HEFA 2E1CA 4V2SA 1NGGA 3IH4A 1J9AA 4IIOA 4KH0B 3HYIA 3EGXB 5FKNA 4UC4A 1UG1A 1K73R 1A5WA 4C1NI 1ZBJA 1FYKA 5CHZA 4CFCA 2P5LC 3PNTA 4HOBA 2EYWA 4CJSA 1SVMA 2A5XA 4AIJA 4P5NA 2GUIA 5IXFA 1QSSA 1XNIA 2PJRB 3CCET 4AG2C 3LP3A 4ENNA 2I5JA 4CHZA 1AT1B 3ZOBA 2DL8A 4HF0A 4W5NA 5CCAA 1RIOH 1NOYA 5LL6Z 1HNWK 3M5RA 2DEQA 4AHCA 3PY8A 4KIFA 3CC2Q 2RQQA 1I5OB 2W40A 4PA1A 2OV7A 4LY7A 3LMMA 5JMVA 1JL2A 4YDUC 4DR6K 2E71A 2NXNB 4DTUA 4EEFG 3A5LC 2GQVA 1OYXA 4HQEA 1RDDA 1SL1A 4HEA2 2FRWA 4HUGA 3BTLA 1U2WA 1M90R 4D5FA 3HJEA 4KDPA 1KFZA 5I2MA 5AQJA 5FKKA 2OAWA 2ECBA 5CKEA<