5FRNA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz419 (compound 4c)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
367
structure length
367
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase
total genus 102
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5frnA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5frnA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5frnA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5frnA03
4KHUA 5SWMA 3V9UA 2FBYA 1S9EA 4Z0UA 1KVCA 2KFNA 3OYHA 4AHUA 3K58A 4CEDA 1VSIA 4CEQA 3OYBA 3PNWC 2AJQA 1JL2A 3AA5X 3WNEA 4CGDA 4O5BA 3L8BA 4QQGA 3NGZA 5HRPA 1BHLA 3EYZA 1K6YA 3CFRA 3LX7A 3OYEA 3NE6A 1LWEA 5C6SA 1X1PA 5D6XA 4DFPA 4FLXA 4YFUA 3TI0A 4E1NA 2R58A 4BWJA 3IS9A 2X4WA 4CIGA 2ZQBA 2BKDN 2YHBA 1IKWA 4CFCA 3ALYA 4KTWA 2L89A 1HMVA 4FL6A 3KLIA 5JS1A 4DSKA 5KH6A 3D0PA 3PFSA 4Z4EA 4Z4GA 4FW2A 3I0SA 3A2FA 3HO1A 4M3WA 2Z1IA 4HHTA 3THVA 4FK4A 5EU7A 4CEFA 5CYMA 4FLWA 3AO5A 3CG7A 2Q3SA 4CJWA 4DFKA 2DAQA 2YKNA 3ITHA 3PMTA 3OS0A 4M41A 4FLVA 2O4XA 3AVFA 3ISNC 4DSIA 2XY5A 1IG9A 3MEWA 2IOCA 4CJRA 4FZYA 4A4EA 3TANA 1TAQA 1JLFA 4CECA 1S6QA 1CLQA 4QQDA 1TAUA 2BANA 5M9OA 4I9LA 3B6OA 3KKSA 3VQQA 4CF2A 1FK9A 3EZ5A 4EZ9A 3DLKA 2LDMA 3DM2A 3S3OA 3MEAA 1NJYA 2P5OA 4ID5A 1OZ2A 3VQ5A 3OS1A 2BE2A 3SZ2A 4FM0A 1XI1A 2IDOA 2P0KA 4QQ6A 3BDPA 1ASVA 2IS3A 2RJCA 1Q9XA 5HRSA 4M3UA 2EQUA 5SZTA 4RW6A 2XY6A 4FW1A 5J1EA 3UT1A 4KB0A 3V1QA 1HPZA 4E19A 3SV3A 4DU4A 1L5UA 3E9GA 2O4GA 4CF9A 2G8FA 3L2RA 1JL1A 3NH2A 4FJGA 4DQQA 2DTUA 4DG1A 4CK3A 1RT5A 2M0OA 5CIUA 1UAXA 3WNFA 1RTDA 4B9LA 3SPZA 5KCOA 3DLHA 2D0BA 3OYKA 2G8KA 1GOBA 5HROA 4Z4CA 4IG0A 4TSXA 4N41A 3ZSXA 5KTQA 1WN7A 2E5QA 1S1UA 3PX6A 4A4FA 1YVUA 3C6TA 1JLQA 4DTRA 4FJJA 3LP1A 1U49A 1HNIA 3EY1A 5J2NA 4HUEA 4DLGA 1W9HA 1LWFA 2X74A 3TAGA 4FVMA 2YKMA 4OKJA 4PLLA 4LSNA 3K5OA 3NGIA 2VYTA 2EQKA 2YNGA 1I39A 4DQIA 3HYFA 5J2PA 1EETA 3LZIA 4KHWA 4DU1A 2F5KA 1VK0A 3IG1A 4BWMA 4B08A 4FM1A 3EAEA 1RBSA 3DLRA 4M42A 2P1JA 4GMJB 1UOCA 3PY8A 3I0RA 4N56A 1SL1A 3L2UA 3AVNA 1RT3A 4QAGA 4CIEA 3LYIA 1RT7A 3S3MA 2HNDA 1KFSA 1JKHA 3QETA 2HB5A 4FZZA 4KI6A 2M1HA 1RT4A 4KHYA 4DS4A 1LV5A 4RG8A 2YV0X 1MHNA 4DMNA 1TL1A 3ZT4A 4CHNA 4EP5A 4BD3A 1RTJA 4HUGA 4CJUA 3MO8A 4J2BA 3TARA 3AA2A 4L8RB 1J9AA 5DK5A 4Z4HA 4EZ6A 3NH0A 1MU2A 5HBMA 1VSEA 3VQBA 1NK9A 3META 3OYMA 4Z02A 1C6VA 3ZSRA 4KB1A 3RMDA 4II1A 1T8EA 3SJJA 3I8DA 5CYQA 4FJ9A 1TKTA 1WNSA 2WOMA 3VQ8A 4F3OA 1NJZA 3ME9A 4CCHA 3LANA 2D5RA 3OYCA 4CEBA 1ASWA 4E7LA 2O4XB 1NK8A 4B9NA 3NF9A 2KTQA 2D0AA 3VQEA 4OPJA 3D45A 1BIUA 2X4YA 3KK3A 1BISA 5D3GA 3V6DA 4DTSA 4BDZA 3HVTA 4CJEA 2D0CA 3L42A 2X78A 3OYNA 2GFAA 3E01A 2HHUA 3JYTA 3H8ZA 2NUBA 1GOCA 4CEEA 4CK2A 3NHGA 3QERA 3OJSA 3CM6A 1HQUA 3HP9A 4E1MA 3V1OA 2G3RA 3LP3A 1IO2A 1FKPA 4C8OA 1WJSA 3BDLA 3KUFA 3S6WA 4CGFA 4OPKA 1YTUA 1RDDA 2LVMA 2X4XA 1BL3A 1X9SA 1W0HA 4FJ7A 1TKZA 1CZ9A 3QEVA 4FCYA 4F2RA 3LPTA 1FXXA 4GVMA 3OYFA 2R5MA 4JS5A 2D9TA 2B8AA 2F96A 3NF7A 1B92A 3SUQA 5T7BA 3F9KA 4IDKA 2XY8A 3IAYA 3KIOA 3MECA 3KLGA 4C5HA 3KLFA 4KREA 2RI5A 3PMIA 2EKOA 3V9SA 2DFHA 3HT3A 1VSLA 1U4BA 4PA1A 1X9WA 4IFYA 4OVAA 3DLBA 2VWJA 4CIFA 5E41A 3ZCMA 1WJRA 3OJUA 1RBTA 4O44A 4OJRA 4J2AA 2DFEA 3KLHA 3WNGA 4AHCA 5KRTA 1TVRA 3QESA 1A5WA 3H6ZA 2RHIA 3DLEA 3L2VA 2IAJA 3TAPA 4N4HA 4FJXA 2MWPA 3AVGA 3SUOA 2RI2A 3QIOA 1QSYA 4K8XA 3F70A 2ATQA 3LALA 4FLTA 3NNQA 4CJFA 3S9HA 1XC9A 1A5VA 3SD4A 2Y1IA 1TGOA 4M3TA 3MAQA 1KRPA 1NK4A 1ZBFA 1U48A 3KD1E 3AVLA 2R5AA 1RDCA 1WSIA 3AVHA 3TAFA 2QK9A 1G15A 2IC3A 1EKEA 1N6QA 3PX0A 2K3XA 2VG5A 4Y1CA 2Z1GA 1ZBIA 1Q8IA 3HPHA 1F21A 1SSFA 2M16A 4DTPA 4CFAA 3CYMA 2RJFA 1FKOA 3WNHA 1C0UA 5IN1A 4DTXA 2VWKA 3AVJA 1REVA 4E7JA 3HPOA 2XHBA 4JRPA 4CJKA 4CERA 4A4GA 5C42A 1QTMA 1C1CA 4UC4A 2RI3A 1XHZA 1I3AA 4BE2A 1WJQA 3QKJA 3DYAA 1SUQA 1RILA 1IH7A 3H08A 4FJMA 3SQ2A 3RR8A 4JRQA 2XO7A 4AHSA 4MFBA 1IKXA 2JLEA 2O4IA 3QEXA 4ID1A 4E7IA 1LW0A 1RCHA 3OQ5A 3FDRA 4Y1DA 1NK5A 5KI6A 4KTQA 1RT6A 3RMCA 3PUFA 3LAMA 4OGEA 4BE0A 5HRNA 2XK0A 1JLAA 3MXMA 2EQJA 3DLGA 4DTOA 1NJXA 3LP0A 3F73A 4W5RA 1GOAA 4NZGA 5CY4A 4C8MA 3RRGA 3KTQA 3ZT1A 3FFIA 2XDPA 2WONA 4DTNA 2W42A 3MP1A 2YNIA 3E9FA 2OPSA 2PYLA 4F4KA 2YHAA 3O3HA 5J2QA 2RHXA 2P5GA 1TKDA 2RJDA 3DOLA 4Q5WA 3SV4A 5KCHA 1Y97A 5IAYA 1C0TA 1S1TA 4KRFA 1QQCA 2GUIA 3FLGA 3HM9A 3QIIA 4B9MA 3DB4A 4ZHRA 1BI4A 3M8SA 3NFAA 1R0AA 4B9WA 4QCLA 3QO9A 3QNNA 4E7KA 4I9QA 2VG7A 2LTOA 1TL3A 1IKYA 2YRVA 4YNQA 4IURA 3NGYA 4F3TA 4Z4FA 4DQPA 2P51A 3HVRA 2A1SA 1TV6A 4FXDA 4C8KA 4H4OA 4E3SA 4HTUA 3PX4A 4B9XA 4KHSA 2XY7A 3NBPA 2E6NA 3KD5E 4DSEA 4BDYA 5I3UA 3L3VA 1L3VA 1T05A 2KZMA 1G5VA 4J2DA 3B6PA 3RRHA 1C0MA 1YTAA 3SPYA 3PO5A 2I5JA 5I42A 1KSPA 2X6NA 4CJLA 4FJ8A 1CXUA 3OY9A 4H4MA 1BIZA 3KK2A 5KGWA 3SNNA 1VSKA 4AHRA 4IKFA 3TAMA 1WSJA 3SQ1A 2G8IA 1B9FA 2L3RA 4AILC 3SUNA 3OS2A 3HL8A 3CFPA 4FJLA 1J5OA 3VN5A 4KFBA 3NH1A 3S3NA 3ASKA 4CFBA 4CJ4A 4FLUA 3AVMA 1KLNA 3O4QA 3LLRA 2FBXA 3NTHA 3RR7A 4LSLA 4CJPA 3M8RA 4NCAA 2BUDA 2HHVA 1QSLA 1D9FA 2DIGA 2FBVA 3ULDA 1RBRA 2HMIA 3HJFA 5FRMA 2X6SA 3UIQA 1KCFA 3ZSQA 1HYVA 1VRTA 1T03A 1WAJA 4IUTA 4KO0A 4CF8A 3MXJA 3K2PA 2B5JA 3G10A 4DTUA 4KAZA 4OKKA 5HRRA 3O3FA 1BQMA 3LWMA 4C5GA 3NCIA 1VSMA 5CZ1A 1H3ZA 3RWUA 1S5JA 4R5PA 1LWCA 4PQUA 3DMJA 2PY5A 3NDKA 3VQPA 3VA0A 3DRSA 3QBYA 1XHXA 3LP2A 3MXIA 3C94A 3QLHA 1B9DA 3P8DA 3NTKA 3KK1A 3DRPA 3OYLA 3DLMA 4N5SA 3HP6A 5D6WA 3K5MA 3P5JA 4XIUA 3RTVA 4IUUA 1JXBA 3OYDA 4E89A 1RDBA 4CGIA 2F8SA 3O4NA 4PWDA 3VQ9A 2RO0A 3LPUA 1EXQA 3U3YA 2QXFA 1C1AA 1YT3A 1ASUA 3M8PA 2HHXA 4HCZA 4JS4A 2DY4A 3ZSVA 2LSNA 1TK8A 4NCBA 1TK0A 4CHYA 4CGJA 4B9UA 3DRRA 2Z1JA 1HYZA 3ZSZA 4CF1A 4E7HA 1VSDA 3QINA 4B8CA 4EP4A 4F8RA 1NOZA 1D5AA 1S1VA 3LAKA 3K57A 2A1RA 3VQ4A 3OYJA 4E0DA 2EQMA 1NOYA 4IUPA 4FLYA 4X34A 1BI4B 3LDSA 4CHPA 3TWHA 3V1RA 2KW4A 4FJ5A 4FK2A 4B8AB 2JTFA 4W5QA 4C8LA 4CGHA 1HQEA 1KVBA 2OYQA 1WGSA 1QS4A 1EX4A 3SYZA 1D9DA 3SQ4A 2HNZA 1S6PA 5HP1A 3AO4A 4M45A 3V9XA 3V4IA 3L3UA 3AO3A 2OZSA 2DIQA 2G8VA 2MWOA 4RG2A 4DQSA 2CKKA 1VSFA 2NLUA 4FLZA 1NKBA 4FM2A 4M3XA 4O0IA 1HJRA 2HVHA 1U04A 1ZBHA 4DTMA 3GOXA 3ZEHA 4DS5A 2PQWA 3K59A 4AH9A 4DSJA 1S1WA 3QJ6A 4BDPA 4CF0A 5JS2A 1CXQA 4IG3A 2HHQA 1ZBLA 4O55A 3DOKA 4RW8A 4M3ZA 1BGXT 4ELVA 4HVJA 2Z1HA 1JXEA 2RF2A 4CEZA 4RW4A 2HQEA 3OYAA 1RI0A 1VRUA 4FU6A 3DB3A 4FJNA 4HCBA 2GV9A 3C95A 4KI4A 3TAEA 1WSGA 1Z25A 3ZSOA 3OMGA 3JSMA 1DTQA 1WSEA 2OA8A 1OI1A 4HUFA 2X35A 3ZSYA 3LH0A 1D8YA 2RN2A 3CFOA 2HHTA 3MEDA 4BACA 1L3SA 4QVZA 4IBNA 2VG6A 4L59A 1O1WA 4ICLA 4B9SA 3C6UA 4LD0A 1NKCA 2BGGA 3AVAA 5CZ2A 1WLJA 3LZJA 4W5TA 2OPRA 3NF8A 4KV8A 2DFFA 4GY5A 5DMRA 4GW6A 1NJWA 2KZZA 4ZTFA 3OA6A 4IFVA 3AV9A 2ITGA 4B3OA 5KE2A 4N4GA 3VQCA 1DTTA 2ETJA 4O0JA 2G8WA 3U6FA 3T1AA 1VSJA 1RNHA 4FZXC 4PLIA 4CRIA 3AO1A 2HNYA 2JZ2A 2OPPA 4KKOA 4CE9A 1LAVA 3MEUA 4CK1A 1BQNA 3MEVA 4KTZA 2R7YA 3PV8A 4N76A 4G1QA 4DSFA 4NS5A 1J54A 1SL2A 1SKWA 2E6MA 5FROA 4J2EA 1C1BA 4FYDA 1RTIA 2B4JA 2EHGA 3NAEA 2F8TA 4KPYA 4N47A 3AVCA 1HNVA 3VQ6A 3KLEA 3QIPA 3MP6A 3KJVA 4NYFA 1UA0A 2HHSA 1SKRA 4Z4IA 1L3UA 4QOZB 1KVAA 1TKXA 3OYIA 2ZD1A 1KTQA 2KQ2A 1L3TA 1QSSA 3L2QA 2G8HA 4K8ZA 2EX3A 4DTJA 1VSHA 4ELTA 3OYGA 2OPQA 3TAQA 3VQDA 5FRNA 1OYXA 1NKEA 2YNFA 3U3GA 3PO4A 3ZT3A 4OLAA 4DQRA 4NYNA 1RBUA 2HQXA 3AVKA 2HW3A 4KHNA 4CGGA 3HK2A 5KRSA 1OZ3A 4W5NA 3P83D 4DLEA 1SL0A 3G0ZA 4Q0BA 1QHTA 2RHYA 5D6YA 4CHQA 3SQ0A 5C24A 2RHZA 3HSTB 3QNOA 3IRXA 4W5OA 4CFDA 4CESA 3Q1JA 4B9VA 2ZE2A 1N5YA 4LH4A 4KHQA 4DWIA 4I2PA 1X9MA 2GFUA 1SKSA 2OZMA 3V9ZA 1Q9YA 3UWNA 3O3GA 2HVIA 1NK6A 4CHOA 1T7PA 5J2MA 3K5NA 2FBTA 3K5LA 3QEPA 1ITGA 4PY5A 2PZSA 1HYSA 2FHDA 2B6AA 4N4IA 3AA4A 4EDUA 3LGLA 1QE1A 2FC0A 2QKKA 3MEEA 1UWBA 1WAFA 1RBVA 3FEOA 2RKIA 3QEWA 4F2SA 3VQAA 3MEGA 3LGFA 1NK0A 4AHVA 1WSFA 3FC3A 4I7FA 4ZTJA 3CQ8A 5KE3A 5J26A 2JGUA 3LWLA 2IG0A 2EFIA 3ZT0A 2QQSA 3QEIA 4C8NA 3P1GA 3L2WA 3P8HA 3OVNA 4ELUA 4O4GA 5K14A 3VA3A 1Z26A 1HRHA 3ZT2A 1J53A 2BIVA 1CZBA 3T19A 1JLEA 4CJQA 3RMAA 4PUOA 1IKVA 1EP4A 4DF4A 2YNHA 5C0MA 4LY7A 3CM5A 5J39A 3SCXA 1NK7A 4B9TA 4HCCA 5C25A 1KFDA 2BDPA 4Q5VA 1BCMA 3AVBA 2RJEA 4OVLA 3RMBA 1U45A 3SUPA 2LRQA 1UA1A 1A5XA 1JLCA 4RW7A 4JLHA 1KLMA 4H8KA 1XNIA 3C4SA 2L8DA 4DSLA 2KFZA 3BGRA 4CJVA 2RHUA 4DF8A 3AVIA 3HPGA 2WACA 1XWLA 1LW2A 1RT2A 4OLBA 2QQRA 2XRIA 3AO2A 4DU3A 1U47A 4M3YA 1S1XA 1RTHA 2Y1JA 3SI6A 4A4HA 3KKRA 2LCCA 4CJSA 4NCGA 1SV5A 4QW2A 4UQGA 2R57A 3ZSWA 4BE1A 4OGCA 1ZBUA 1N27A 4C5EA 4I2QA 4RW9A 2HHWA 2K3YA 3ASMA 1RDAA 2IGIA 1KHCA 4CJ5A 3OB9A 3T3FA 1JLBA 2E6LA 1RT1A 1DLOA 3AA3A 4IUVA 5FDLA 5KGXA 4M3RA 1JLGA 2G8UA 2E4LA 2PYJA 4WE1A 3V9WA 4PL6A 4DFMA 1LAWA 3NF6A 3TR8A 2RPIA 4FJIA 1WSHA 3HXMA 4CJ3A 2GBZA 3V81A 3OMCA 4FK0A 1S9GA 4CJTA 3M9QA 3MP8A 4CEAA 4LD6A 3DI6A 4DFJA 5HLFA 4CHZA 3TABA 4FJKA 1BCOA 4AHTA 1TK5A 3O8VA 4FJHA 3M8QA 4MQ3A 4IUQA 3CEYA 3NTIA 4LH5A 1ZYQA 2QKBA 4CEOA 4OKEA 4C5IA 2GF7A 3VQ7A
chains in the Genus database with same CATH superfamily
5JLXA 2ESHA 3D5SC 5SWMA 3GF2A 3A1PA 4C8QF 2E6ZA 2J6KA 1S9EA 3I0XA 4Z0UA 2R5YB 3OYHA 2CG4A 1VQKI 1YP5A 2E20A 1R22A 5CHZA 3NMUA 3SEQA 1JL2A 4FWRA 2HBWA 1LOJA 4ZGEB 2D0QB 3BDDA 1E7OA 3ESWB 2M02A 4QS8A 4R1HA 2YG9A 5HRPA 1W36D 1VQLN 1HW5A 3VYSB 3EYZA 1REPC 5IXBA 1VQ4T 4DKWA 4M77F 3LX7A 4MO5A 5B66C 3ML6A 2OV7A 4GV9A 3FXMA 3ELKA 1YX5A 1OULA 1XS9A 3MFKA 4IOAL 4FLXA 1W1FA 3FE1A 4E1NA 2DTRA 2R58A 3CO6C 2VBZA 5ADXA 5B1AH 1VQ8T 3WT0A 2D4WA 1T0HA 5J8FA 1DP7P 5HOOA 2QQ8A 1O3SA 1M3BA 1IKWA 4BVOA 4ZN1A 1VQPN 1YTYA 2P4RA 2L89A 4AI4A 2NNNA 1HXDA 2OTJT 1RGIA 2DJIA 3K10A 1T38A 2HQRA 3ZCOA 2NNWA 4FE7A 4BY1J 2W85A 3CO7C 3NMZC 4Z4GA 1LPLA 3IKMA 5GPCA 3VSLA 3VTHA 1ILYA 4OAZA 1ETQA 2WV0A 1W5SA 2MF2A 4MZTA 3HG9A 4FLWA 2IEKA 5CR2A 4PSXA 2NRZA 4HDVA 3VF2A 4RB2C 5LHIA 2F4IA 1H88C 3CCRN 4M41A 3AGRA 3ISNC 5AYFA 4XSZF 1VQPA 1Q82U 4MEYF 4PFOA 4BGBA 1NGEA 3CCYA 1IG9A 1KSWA 5F1JA 1ZG1A 1AOJA 4JEPA 1XGNA 4P96A 1FP1D 4C3JJ 3I9V2 1Y7XA 2E35A 2MH9A 3AG2H 1RC9A 1FWZA 3JSOA 4RTYA 2KE9A 1I8FA 2LH9A 3VFZA 1FEXA 1ENHA 4CDGA 2E2QA 1D1BA 2BY3A 3CCJN 3QB0A 3DWLA 3GL1A 5IP7J 3JRCA 1VUBA 3DXKA 2I7NA 3REOA 3KKSA 4IPAA 4CF2A 4NB5A 4LIUA 1MWMA 3DLKA 4AIHA 1S6LA 3FKJA 1YQAA 2P5OA 4ID5A 2AK5A 1OZ2A 3DLLL 5MLCQ 1VQ6T 4FM0A 3VOVA 2RHKA 3WQUA 3LSGA 3RQIA 3OW2S 2RVCA 3CUQA 1NEGA 1SEMA 3CVSA 3BDPA 3LA3A 1SZ2A 4B47A 1PKTA 4NXNK 4OMZA 3JCMJ 2L4MA 2NRTA 1TBXA 4RW6A 3EO3A 2E60A 3SDBA 1UJYA 3WXLA 4FW1A 3SK3A 4OIQF 2YUPA 3UT1A 4BYYA 2BY2A 2Z9OA 1UCRA 1HPZA 1PYVA 2NS8A 4HX7A 2O4GA 2G8FA 2VONA 3V7RA 2D6FA 3VETA 3GFJA 4CA0A 1SEUA 1UAXA 1VYTA 2Y4YA 2M45A 1JCGA 3SPZA 3EUAA 4M3EA 4A3GJ 5GAGJ 5A0LA 4WXDA 3G6EI 3ZSXA 5KTQA 3FXOA 2OTLT 1Z3YA 3M1EA 3K2ZA 1RFQA 4YPRA 2DTZA 3PX6A 2P9IA 1I07A 3C6TA 3A0IX 4RMOA 2QTVA 3U2RA 4IQ4A 1YN8A 1UE9A 3CQZJ 3V8JA 2XROA 3NWSA 3EY1A 2HOTA 1JJ8C 3FM5A 1OU8A 4HUEA 3CC2Q 4V19S 1MJAA 1IGUA 1N25A 4FSXA 2X3XD 4EJYA 1LWFA 1GLCG 3TO9A 3FHGA 4IHVA 2GA1A 2NOBA 3EG0A 3WU0A 5DEQA 1UB4A 1IO6A 1FY7A 4F04B 3K5OA 3F23A 1N39A 3NGIA 2VYTA 4ISFA 5DD8A 2EQKA 5I21A 2YNGA 3SXYA 3HYFA 5J2PA 4BU2A 3LZIA 2XRNA 2A28A 4KHWA 2K7LA 4BWMA 4FM1A 3RERA 1Z6TA 4X9DA 2DU9A 1FTTA 1MNMC 2H3EB 1OVQA 1Q81C 2FO0A 4M7AC 4RTXA 4GMJB 3J81K 5CKFA 1P4XA 2AXTC 3AVNA 3DXMA 3BZ6A 5IT9Z 3HSCA 3SBTA 1G3WA 3BROA 2JVVA 4G94A 1KFSA 1Q1HA 1NGHA 4KI6A 1JRIA 4LLGF 3D2EA 1GLEG 4KH5A 5FU7B 1MHNA 4DMNA 1TL1A 4BS9A 3JRHA 4CHNA 4BD3A 4ENKA 1XQOA 1DDNA 4CJUA 3TARA 3CCLT 4PZJA 2F2XA 4L8RB 3WXKA 1J9AA 1C0GA 4OMQA 1I5LA 4HXJA 3VYGA 1VSEA 3BY6A 5GIOA 2DAOA 2WAQN 1OCOH 4DJAA 2K02A 3E9PA 4MO7A 4FJ9A 1TKTA 1XNRK 3QSUA 4JX5A 2WOMA 4F3OA 3R60A 1K8KA 4I6MA 2B7EA 2DF6A 2GQQA 4CD3A 3BT9A 3LANA 3OYCA 3TSPA 1X6OA 2DMOA 4IIMA 3RSNA 1MBFA 1Y1WJ 2FEIA 3S1MJ 1TUDA 1F4KA 1VQMQ 2YCHA 1BIUA 3VEWA 1KQSP 3KK3A 1DJ7B 1BISA 3WTXC 3A01A 2DT6A 5FU6B 4YOVA 3GWZA 5FD5A 1GCQC 3DXKB 5KAIC 4M7AE 2X78A 2HHUA 2WAQA 3ENHA 3HZJA 1CGPA 1BK2A 3HUGA 2Q2EA 2O0YA 2X1EA 3QERA 3Q9SA 1GVDA 1FBUA 1HKSA 3CM6A 1VQ7T 2IXSA 2XIGA 3F72A 4HTLA 1M1KO 2QA4T 3LP3A 2NRWA 1IO2A 3MDQA 2EZIA 2PJPA 1W2BA 5DTDA 2R5ZB 3CUQB 1W2BM 2I5WA 1K9MO 4IEJA 4FJ7A 2XIDA 1B9NA 2H56A 3QEVA 2Z0WA 2YLCA 3WTWC 2DI3A 1FXXA 2DQLA 1YCSB 5AQMA 4EMSA 4JLGA 3HC7A 2R5MA 2B8AA 1I1SA 1PSFA 2M87A 4DR2K 2A61A 1LCKA 4X9CA 3CETA 3DLAA 2XY8A 3GBQA 4M7XA 5K5QA 3CXCA 1Y64A 1P9QC 2NOIA 3KLFA 3CXCM 5DLOA 3WE3A 3DEWA 4C3HJ 2NUPA 3ZQHA 2J6OA 2PZ1A 1VSLA 2E2IJ 1PKSA 5FPEA 1X9WA 3EN9A 4IFYA 4IWVA 5ICCA 4UB8C 2A6EF 2P9IB 1MBHA 5AQRA 2CYZB 1HC8A 4AG2C 4M6XA 3ZCMA 3SFMA 2KRMA 5M1OA 4O44A 4OJRA 3GNGA 2Y4XA 1OKJA 2QWPA 2WV1A 2ZSHB 4IZZA 2QQBA 3D5LA 3LDPA 4MMKA 3CF5L 3C2HA 3GW2A 2IAJA 2QKLB 5CQXA 3WTVC 1ZARA 4N4HA 2AT1B 5CVJA 1FOYA 1ZG3A 4I76A 2OAZA 2RI2A 1STZA 3HHGA 5IP9J 3QIOA 1I6XA 4NC7A 4AU7A 3E5XA 4JK7A 3O08A 3F70A 3DQVC 2JTEA 1B07A 3WXIA 1B3QA 1Q7YU 1K6OA 2XKOA 5F0FA 4CJFA 3S9HA 4NHJA 2EPDA 1QO0D 2XUBA 1LMZA 1A5VA 4WFAL 1G59A 5AQXA 3IKVA 5M1FA 5DY9A 3W2VA 1KRPA 3CJ1A 1E6GA 2E2JJ 1YJNT 1T3LA 2O9VA 1U48A 2R3SA 3AVLA 2P5KA 2QM1A 1WSIA 1N75A 3JCMc 1XD7A 1N33K 2W0ZA 2EQIA 3CCMT 2IC3A 2QSHX 4F16A 1PG5B 5D8LB 1I1GA 1Y57A 2NS0A 1PVEA 2IT0A 1Q8IA 4JKEA 3CC4N 2CW8A 2DYBA 1K76A 3EUHC 1F21A 2VKHA 2HTSA 2GELA 3G4SN 2LFBA 4EJUA 2VPLA 2Y69H 2EYZA 2V1XA 1MH4A 1NEBA 4CFAA 1VQ4Q 1UELB 5FO5A 1S8NA 3I55T 3JCMX 2FOKA 4EMHA 2P9SA 1ZXOA 4DYCA 1C0UA 2A0FB 5IHKA 1WKMA 1WJBA 2RAEA 4CJKA 3D6RA 3RKWA 1AT1B 2M51A 3QP6A 3U21A 4UC4A 2VQLA 2VIXA 2V1NA 2WY8Q 4XH5A 3VGMA 1WJQA 2RPNA 3CIPA 1K8KB 3K4CA 3GTMJ 2DBKA 5A0DA 1EQYA 1K78A 3RMSA 2VJ4A 3QYBA 3SQ2A 3A5ZB 3CC4A 2O4IA 3H9QA 1C0WA 3C7JA 1ZBJA 1LDKB 4E7IA 2HYJA 1LW0A 4M72A 3L7WA 3KE2A 3A01B 3DEEA 2EGEA 4CC3A 1BWFO 3J7YP 2CQXA 3ID6A 3CF2A 4J01A 1BA1A 1IUYA 3Q0WA 3ZMVA 4OGEA 2R7SA 1ETYA 3I0WA 4M3FA 3DLGA 5IOYA 2HYFA 2PBDA 4OOIA 2Q2EB 3F73A 1BKBA 3A1YA 3CMEA 4C8MA 3KTQA 2UZKA 1VIEA 3ZT1A 4L0ZB 1LKXA 4UB6C 3JCMg 1M8VA 3I8BA 1T56A 4DTNA 4XLCA 2RNGA 2CUBA 3E9FA 2UXDK 1O75A 3O3HA 2A3ZA 3I59A 2BXZA 5C3EJ 3CF5F 2YX4A 1S1NA 5BS6A 2K40A 1X9JA 3LL7A 1ZUYA 1IV8A 3I56I 2DVJA 2CSOA 5BPMA 1S1TA 2CUFA 1FOWA 1PUEE 2JA2A 2KROA 4C8QB 1FW6A 3SWNC 5GTIC 3QIIA 1R23A 1X19A 3DB4A 4CJ7A 2VQFK 1MH3A 3M8SA 4UHTA 1ORKA 4AIAA 3S14J 3PFYA 2KISA 4B3AA 4PHTX 4QCLA 2IGNA 3QO9A 5GADJ 4OPHA 1QVFS 2DA9A 1TL3A 2NUPB 3NGYA 4F3TA 4JAXA 2Y0SN 1BUPA 4JP0A 3HVRA 2OANA 3CC7N 1K0SA 4M77B 3S17J 2VQGA 1S5LC 4EM0B 4EJOA 3I5UA 1DP3A 4C8KA 4XU3A 2YHYA 5BR9A 4B4CA 4XONA 1Q82R 2MK5A 2ZJPL 2CMPA 3I58A 3I5SA 4XLEA 2ZPHB 2XAFA 5I3UA 4KMUX 1L3VA 2KZMA 4J2DA 3B6PA 1WLPB 4LF4K 1MSFC 4Y7NJ 3CJ9A 3H3OB 2GIVA 4PJJA 3R6OA 1ZRDA 4JKHA 1PWTA 1D3YA 5FLXK 1HNZK 1VQ9I 1KSPA 3ABMH 1Z1DA 2KRCA 3JAMK 5ED4A 2X6NA 2L3DA 5AQYA 1BIZA 4BRLA 1BA0A 3KK2A 4UY8O 2KXDA 2Y0SA 3J7AP 4BBRJ 2Q0OA 4O5FA 4OU0A 2OX7A 5A2QK 1TL8A 5ECAA 5AN4A 4Y52J 3UKUA 5D4RA 1D5YA 4FJLA 3SAFA 1J5OA 4DZJA 4PSWA 3NH1A 1RR7A 5HS7A 3CD6A 2K6DA 1XNQK 3KFVA 3ZLJA 2LNBA 2FD5A 4DV5K 2PNIA 4CJ4A 4A3FJ 3HOZJ 1K1ZA 3F8NA 4EEFG 3NTHA 3L4QA 3GLXA 2JTVA 3FHZA 2JWKA 1NPPA 2JRTA 1VQ5I 4B3SK 4A57A 3A98A 2BUDA 4H0EA 2IPQX 4F7ZA 1BOAA 4PK4A 3QPLA 2CSIA 2DZCA 4JN4A 1JJ2A 1EH6A 2L9SA 2FBVA 3ULDA 1JXOA 1JJ2M 2ABLA 3F6VA 3X25B 2P9SB 5FRMA 1MJBA 1KCFA 2WADA 3FMQA 2DXBA 3BFMA 2I7PA 1WAJA 3VGKA 3MZYA 4KO0A 4CF8A 3MXJA 3CCSI 4OKKA 4ITVA 3HOYJ 1X3UA 1YITI 1R1VA 1UECA 2DOFA 1U06A 2IIMA 1R5ID 3NCIA 1VSMA 3QWXX 2HZYA 1K78B 1LWCA 2VE9A 2K9NA 3VQPA 2F5TX 2YLBA 4C8QG 1UEBA 1V5GA 4MFDA 4NBQA 3JB9D 4BRDA 2ZM6K 2E1HA 4BUPA 1K8AU 3SHWA 5AQWA 4FT2A 3P8DA 3CJNA 4V2SA 5L3EA 4M7AF 5LL6Z 3E1SA 5M1NA 2KY9A 4LF5K 3DBHB 4I09A 4QPOA 1ZR2A 3HHTB 1R0CB 2KIUA 3F8FA 4BR5A 4IUUA 3OYDA 2R7UA 3FXKA 1ODDA 1GHCA 5D4SA 1BJAA 1HX1A 1KO9A 4M77G 2F8SA 3O4NA 4RTVA 2RO0A 3G25A 2VGNA 3U3YA 4J8OA 3WHBA 3O9RA 1M2VB 3FXRA 2IVOA 1YT3A 2Y9YA 1VQMN 4JS4A 1PU8A 2NYXA 3A0BC 4HEA2 2DD4A 3MKWB 4CC4B 4KIFA 2HSTA 5LY3A 3KP4A 4LN2A 4EA5A 2V9VA 1TK8A 5GAHJ 1WEIA 3TEDA 3IH7A 1QVGS 1TK0A 1NMNA 3RPUA 1DQUA 3ABLH 1VQ8I 3I59B 4FYYB 4HAMA 2QEXI 2E2PA 4XRSG 4IOCL 4EW0A 4B8CA 4F8RA 4KH0B 2CDTA 1NOZA 3PQJA 2OTJI 1ACMB 1VQ7Q 2A1RA 4OFEA 5HDKA 3FLCO 2H94A 2QA4Q 1T0FC 1IRGA 4HNVA 1YW8A 5FKNA 1P7MA 2ROLA 2V51B 1Y56A 1WXBA 5GJWB 2AZSA 1IGNA 1R71A 4DUYK 4CHPA 2DW4A 3TWHA 3K6GA 1MDMA 2KT1A 4BI8B 3EHRA 4BRNA 2JPBA 3UR3C 3V42A 1YFHA 3T1YK 3CCVI 2RQWA 3NAUA 1YRNB 2JTFA 4B8AB 4H0OA 3PIOA 1XMXA 4W5QA 1S9HA 1RAEB 4LFUA 1WXUA 2O8FB 1G6NA 1EX4A 2PVOB 3X26B 1SAUA 1D9DA 1UHWA 4JRKA 2HNZA 1JUMA 5ILUA 3AO4A 1PP8F 2GUPA 1U5TB 3AO3A 4AM7A 5AIQA 4HCKA 2Z1DA 2G8VA 3PVQA 2COYA 3JR9A 2E88A 4XKVA 4M3XA 1HJRA 1Q7YC 2HVHA 3TQ7P 1ZBHA 1GV2A 4AH9A 1TQIA 4DSJA 5ERIA 5E3MA 4WFBL 1S1WA 4MDXA 2D0NA 2LQNA 4CF0A 4C92C 2LC2A 4IG3A 2HHQA 5AT1B 1IZ1A 1ZH5A 2HWVA 1R5GA 3UDCA 4O55A 3DOKA 4Y4RA 3WXMB 3JXUA 4QIWN 5C15A 3CPEA 3GZ5A 1GCPA 1WHLA 2Z1HA 3ULEA 4CEZA 1VQ6I 4M7DE 2HQEA 3QPHA 5M5YJ 3UKUB 5DLQE 1VQON 3L1PA 2YPRA 4NL2A 3DB3A 4FT8A 2VQHA 1SFUA 3QDKA 2JG6A 5AZIA 3CCUT 2EZHA 4BY9C 4RTUA 1HDPA 1DGKN 4AT1B 1QHHD 1R36A 4DR7K 1X3ZB 2RD1A 1WSGA 4CGZA 4YDUA 2MFZA 2L3SA 3ZSOA 1NHAA 2ATCB 1NJIC 1YE9A 2DCEA 1DTQA 2F5CA 1ZAOA 2FMYA 2JVGA 2ZNZA 1Z9QA 2FXUA 3LH0A 4BC2A 1K73C 2JA5J 3H46O 5TJJA 1FIAA 3MEDA 1K83J 2KJBA 4G9ZA 3MK6A 4CYCA 1A36A 4H4KC 1O1WA 3JRZA 3C6UA 3CESA 4EGYA 2BGGA 3AVAA 1VQOA 1WLJA 3ZEUA 1VAZA 3VS3A 3P9IA 2DD5A 1X1DA 3CCMQ 2FMLA 3THYA 2P6SA 2OTLI 3AG1H 2LRDA 1VQNA 4MTDA 4F3QA 3NF8A 4JI1K 2ZPIB 3JB9G 1WI7A 3S1RJ 3KLNA 2DFFA 3E6BA 2RV8A 2HF4A 3O6BB 1OJLA 4GW6A 1NJWA 3I55Q 2DYSH 2DJNA 4IFVA 5DM7R 3FGUA 4EHUA 5C0YA 3OSVA 3CP8A 5KE2A 4CBUA 4IXAA 5GAGP 4BRCA 2IGMA 3VQCA 4EIKA 3U6FA 5C4XJ 2M3AA 1RNHA 4C92E 2Y30A 4CZLA 2K9LA 4KMFA 4F7UE 2HS5A 3E19A 5D5WB 4G8XA 1OH5A 2B0LA 5EY4A 4X62K 2V26A 3MN9A 4KN4X 1JBMA 2HVQA 1LAVA 2F9TA 2O3FA 4CK1A 1J2XA 4U7DA 1Q7YR 2ETHA 2RDPA 2PUOB 1IV6A 2BZ8A 5CKBA 4PGGA 3V8KA 1AWOA 3QZ5B 3K9KA 3RSEA 2P0WA 2D1HA 1O57A 2DVEA 5FROA 4H5RA 3MN2A 1RTIA 3KYDB 1SC7A 1ETOA 3E9OA 2EHGA 2JUGA 3OOUA 2F8TA 4N47A 3S8PA 3FR0A 4J19A 3P7NA 1HNVA 1AKHA 3IP4B 1V4SA 2OD5A 2FQ3A 2CGJA 3JCMd 4E7ZA 2FSNA 1R1UA 4NYFA 1UA0A 4LDYA 4Z4IA 1WI3A 4A0ZA 3T0YA 1I27A 2WWYA 3MX5A 3BE3A 1JEGA 2F2VA 1KVAA 1J5YA 3CCLI 3CCQQ 1YOVB 3N05A 3PVLA 4JJCA 1W1WE 4OB0B 3EE9A 3VDXA 3AAFA 4K8ZA 1VQKN 4JDSA 1NJIR 5K5RA 1VSHA 4B1WB 1MDMB 1NGAA 3GTLJ 1UAAA 2R7RA 4RAFA 4YIRX 3EETA 2KKZA 2GNCA 5KVRA 3TAQA 4RB3C 3U8XA 3T9NA 1H92A 3CBMA 4II2A 3VS7A 4YOXA 3PO4A 3ZT3A 1YJWI 4OLAA 2XHCA 2RF0A 3QDFA 4AIJA 2RH2A 4KHNA 1YHQA 3HK2A 4KH6A 1SVOA 4MLEA 3N5NX 5M3MJ 1HQCA 3EEQA 3W6JB 2YSRA 4Y0WA 5H20A 5CVUA 5DM6F 4PIIA 3H0DA 5D6YA 4OMLA 2NVYJ 1X3MA 3HSTB 2RNAA 4AFUC 2AQFA 3VS2A 5M1KA 2PFBA 1C0FA 3Q1JA 4CCJA 2ZE2A 1PC0A 3MHXA 4EJZA 2R4GA 1FNNA 1VQKA 1BBYA 3UWNA 2XAHA 1OCZH 1Q95G 2FBTA 3ULRB 4BJ6C 3KFWX 5GANf 1LWVA 1HYSA 2FHDA 1JT6A 3ZN1A 4ANJA 3CJBA 2B6AA 1LFBA 3KEQA 3AA4A 1WRJA 1UFMA 4O8UA 3M58A 1S29A 3EFOA 3ULEB 2DDAA 3U1KA 3LGLA 3GFLA 2RK1A 2MOXA 2BZTA 3CUOA 1Y0NA 3MEEA 1X3NA 1UWBA 3NFCA 4F2SA 3VQAA 5JHUA 1RUOA 5IPAA 2JJ7A 5AQHA 3E5QA 1XG1A 3G3ZA 3CQ8A 2IGOA 3K4KA 4DBFA 4A93J 3L09A 4F17A 1N36K 1U3EM 3GTQJ 2AHJB 2PAVA 3CJ7A 3VW4A 2DTHA 2QQSA 2KKOA 5KN9A 3L2WA 1A6IA 3PO3J 5K14A 2XI9A 2CGPA 1FJGK 1HRHA 4WK8F 1A6QA 4HQEA 4CYCB 3KYLA 1G83A 2HSEB 1U6ZA 3SB2A 2PU9B 3FZHA 3ZEUB 4XR6A 4FWSA 3THYB 2YNHA 4CZCA 1YG2A 4KDPA 2WAEA 1UB9A 2DMNA 1M27C 4LY7A 1YCYA 3MCZA 4KJZA 3HSRA 1K8AC 3CPWP 2AP1A 1QQJA 4HCCA 2YHWA 1WQ2A 1WHMA 3E97A 2OI3A 4RDUA 2AKLA 5JLWA 2CGLA 5J3BA 2E12A 1VTNC 3RMBA 2H3GX 1U45A 4M78D 1UA1A 1A5XA 3DKYA 3OW2A 4JLHA 3CJCA 4FASD 3OW2M 1XNIA 1MKMA 2W24A 2J5PA 4BC4A 2KFZA 1WB9A 1T33A 3AHUA 1IHVA 2H1LA 4MDAA 2XICA 4DF8A 1YJ9T 2DMPA 3P39A 2F48A 3T5XA 2WACA 3EPZA 2LJ1A 3QXEB 2D2WA 3TOBA 5GAEP 2M8GX 3W0LA 1J09A 4E6KG 5LGNA 3WTTC 1N8RC 4LNPA 4IX7A 4BHBA 4M3YA 3RSEB 2LP5A 3G6EN 1WHUA 2Y2ZA 4BE1A 1YJNI 3J7AY 2M7BA 2BE9B 1NNEA 1ZBUA 5BMZA 1AKHB 4I2QA 3GYHX 4HV5A 3H1QA 1IN5A 5FD6A 1RDAA 2IGIA 3SHFA 1KQSS 2DX1A 4HF2A 2E6LA 2VOOA 4IUVA 4IHWA 1TWGJ 4M3RA 3ZQCA 1OR7C 3KPHA 4GGGA 4BR2A 2RA2A 3K1NA 2G8UA 1KFZA 2EIJH 1M9SA 4BG9A 4KT5C 3QMLA 2OAUA 2JWTA 3ECOA 2MCNA 3TBIA 1GLLO 2NVQJ 3AY9A 3HXMA 4FWQA 1BOTO 1S9GA 2ZCFB 1VQLT 1J7KA 2X51A 3M56A 3ECHA 1DT9A 2WB1A 2A6HF 3HKZN 3LW5E 4VUBA 4MZPA 5HLFA 2CJJA 3TABA 4BRKA 3ZQFA 3QICA 3GO5A 1YLFA 3O2PE 1TSFA 3DFGA 4DR5K 1I50J 2K5CA 2BH1A 1JHFA 3CCEA 1JO8A 4EVVA 2FNPA 3TTDA 2XSJC 4IUQA 3WXJA 4BY6C 4LH5A 2QKBA 5CO7A 2RGVA 4BUGA 2GF7A 1KK7A 1IF1A 2GQIA 2KQRA 2EW3A 1K8AR 3OYYA 2FPEA 1HR0K 5HL7L 1O3TA 4WFNL 2PLYA 2MSYA 3KWIA 3QOEA 3GTOJ 2O2OA 1KVCA 2KFNA 1JKPC 3P9KA 2QSGX 4AVPA 2DM1A 5AQPA 2K3FA 3L2CA 3DCFA 1GFDA 4CEQA 3OYBA 4PJOD 3PNWC 3I54A 4G7OF 5AQTA 1EO1A 1B8IA 2HPIA 2JSCA 4BJTA 4XAXB 5FU7C 3I64A 4M7DF 2F5EA 3HKZA 1LB2A 3WNEA 5KQDA 3HKSA 4O5BA 1IXRC 2CS3A 1NGGA 2AIRB 3WU2C 4IIOA 1K6YA 4CCNA 1WFWA 3GNFB 1NG7A 1OPLA 3CCRT 4CXFA 2D0PA 2CP5A 1EJ9A 2EZLA 1X1PA 3MMYB 4BQAA 1N8RR 3U9DA 2WY7Q 4BWJA 1YBYA 3NGPA 5FKLA 2VUBA 4CIGA 4LG0A 2GWKA 2ZQBA 2LQWA 2BKDN 2YHBA 3TL4X 1XG7A 2BY0A 2CH4A 1HUXA 1PVSA 1TU0B 4DV1K 1F43A 2Y90A 4EQQA 4BRQA 3CCJT 4DSKA 2KVQG 4A0YA 4M7AB 2HKQB 5KH6A 5DM7F 3FXUA 2RQUA 4BGAA 3D0PA 4HV6A 4BAYA 2MH2A 4C0GA 2QF7A 1BI3A 5GANe 4BR7A 3PFSA 3EGUA 1KG2A 1WX6A 3FF5A 2PQ8A 4A6DA 3I0SA 1Q1VA 3CCUQ 5K7ZA 3A2FA 2ZKZA 4PL8A 3HO1A 2EIMH 4Z94A 4ZYGA 3QWLA 2Z1IA 4AWXB 2WBMA 1QQNA 4BBSJ 3MWPA 2EYQA 2HDDA 5FU6C 4KUMA 5CYMA 3MCAB 1S7OA 3U4LA 2L7FP 2GX9A 1HPMA 4FYWB 3I3LA 3CI5A 4ELYC 2DA6A 4A5NA 5HLHA 1LVKA 3GBGA 3PMTA 3OS0A 3RBBB 1X4PA 3ZMZA 1NBEB 2O4XA 4UOBA 2KJCA 4A3BJ 1IDZA 4C92F 5GADP 3MEWA 4W97A 5AJ3K 3M8JA 3DKMA 4CJRA 4MO4A 4FZYA 2EFNA 4JOMA 1TAQA 1DKGD 4BR0A 4F7UF 1BR1A 1JLFA 2FNAA 1S6QA 2NOZA 1MMSA 4DEYA 5FPDA 4QQDA 5J1UA 1O13A 1PUFA 1QU3A 3JRAA 1AWJA 4C2MJ 2QW9A 3VESA 3UKGA 2ELJA 4AQYK 1GLNA 4WF9L 1NU0A 2ESNA 1JCEA 4B43A 3B6OA 2Q0UA 3OS5A 3J80E 1ZLMA 1FK9A 3DM2A 3H92A 2DRMA 2BEOA 2IA2A 3OS1A 1BU6O 5BREA 1YQMA 4GYGA 3EG1A 4AI5A 1IUFA 1KU9A 2K3PA 4FTHA 2CV2A 2DL4A 1S72Q 2P0KA 4QQ6A 2O9SA 1I81A 2IS3A 3M59A 5LJVA 2F9WA 8AT1B 2E1ZA 3O5ZA 2WA0A 3TGNA 3I4NJ 1MZBA 1CKAA 1U9OA 2XY6A 1SF9A 2QWMA 2M7AA 3QU6A 2E1OA 3WU1B 1WDXA 1ZN2A 2QWRA 3E9GA 4MQ9F 1U3OA 4E47A 4DQQA 4C0FA 4XLNF 2JT1A 3JCMb 3CVTA 1K7AA 2M5WA 3O8HA 2A69F 1Z9CA 4QVCA 1HBXG 4LB5A 2JS0A 3HI0A 2XDDA 5HROA 4IG0A 2ASMA 2W84A 4N41A 2E5QA 1S1UA 1ZBSA 5FKKA 1MUDA 4ZGDB 4C1NK 1FPQA 2HQNA 2DL3A 5E8IA 1YVUA 3J81Z 4DTRA 1U49A 5J2NA 2D5VA 3SWNA 1BC8C 2FJ1A 1NTCA 3N5BB 4M75E 4M7AG 1NKUA 5LJ3h 1R77A 4CZJA 5AQOA 3N4MA 5AONA 2CQNA 3S16J 4FVMA 3VEPA 1WEGA 2VCPA 2V4JC 4MTEA 3D7SB 4WTOB 4DBQA 1I39A 2VOPA 2IVPA 1EETA 2F5KA 1VK0A 1B8IB 1ZSZA 3LA7A 3B6CA 4ESBA 2LNHB 3DLRA 2LZ6B 3TDUC 2F5FA 4M42A 2K2VA 2P1JA 5LBQA 3K9JA 3JRGA 3L2UA 3FZKA 1TWFJ 4U88A 2EWSA 4QAGA 1S3JA 3S3MA 1K4TA 1JKHA 2HB5A 4FZZA 3SAGA 3AT1B 2FPDA 1RT4A 2HOEA 3GTJJ 1P90A 4LG0B 2CV0A 2X6YA 2GA2A 4W1UA 2GBYA 3U9GA 3ASNH 2LY2A 2NRXA 4XRMA 1KC8U 4JX4A 2KHOA 1Q7YO 3K7AJ 3TP0A 5KAFC 4IEEA 3M0UA 1T44A 1X6GA 3CC2A 2ACJA 1BL0A 2X85A 4GDFA 1MU2A 2KBTA 5HBMA 1M1FA 2YRCA 3LL3A 3BG6A 3FIFA 3VQBA 1NK9A 3OYMA 3OA9A 1C6VA 4HLYA 1XPXA 3IDHA 3OR2C 3GIBA 3RMDA 5HNHA 3SJJA 3THXA 3O9QA 5DUIA 3EHQA 1Q86C 3I8DA 1ZRCA 2VT3A 4IXCA 4CZHA 1WNSA 3KZYA 2NVTJ 4YG2F 2X4JA 4LFCK 1KXPA 2YHTA 1NJZA 2UXXA 2HEOA 5KPZA 4X64K 1X1CA 3ME9A 4CCHA 2D5RA 4R55A 1GBRA 2TCTA 2Q1NA 1ASWA 4JKDA 4E7LA 3QQAA 2O4XB 3CMAT 3WUHA 1VIFA 5LJ3j 2K9QA 3Q7BA 4OIOF 3NF9A 3WGGA 3VQEA 1YI2I 4GCVA 3JCMh 1X69A 1NJIO 3I56N 5D3GA 1PUFB 5IT3A 4Z8AA 4BDZA 5FLVA 5GMKh 2R7DA 5AIPA 4K11A 3UKRA 2D0CA 3OYNA 3JYTA 1B1BA 3K9TA 4BEHA 4CK2A 1PU7A 4RLFA 1XGMA 1ZHFA 1YF5L 1QZYA 5KK1A 4DQ2A 4EMKC 2O5RA 3BTIA 3HBTA 2HHHK 4E4HA 1ON1A 1V55H 2UXNA 3FWEA 1FSHA 2CT4A 2CS7A 4J6WA 3BDLA 3O8GA 1CF7A 1RAIB 3KUFA 4ASNA 2I2LA 3CMEI 4CGFA 1QKXA 1YTUA 1BL3A 1X9SA 3LA2A 3G71T 5J1YA 4EATA 4YEJA 1TKZA 1CZ9A 3GTKJ 4YOQA 4S04A 3I56A 3VUZA 1RIOH 1KQ8A 2M4GA 4A4KA 4KGVB 4Y15A 3OYFA 4KHPK 3G1OA 4WXCA 2J7IA 5TKYA 4JS5A 5BPLA 1H3HA 3QRFF 5J4VA 2VXFA 2F96A 3X24B 1B92A 1MMAA 1VQ9N 2Q97A 3CPFA 4CH7A 5L3DA 4EJWA 3KIOA 4ATOA 4XL9A 2GOMA 4M7DA 4NL3A 4KREA 3P8BB 4B6MA 3PMIA 2EKOA 1ERDA 3L9FA 3GX4X 1M3AA 3OV8A 2QI2A 2ZCWA 5FWCA 2G7HA 1UG1A 5LLQA 4LD9K 5E41A 1WJRA 4Y91A 3SWNB 2WSEE 1Q86R 3KLHA 3C6HA 2QZ8A 5KRTA 4J9BA 1TVRA 5I11A 3VEYA 2CW0F 1OH7A 5F64A 1W0UA 1X01A 1VQLQ 1PNJA 3G4ST 3ZP5A 3DLEA 1NMDA 3L2VA 1VQ5N 2C06A 4BQZA 2V75A 5GMKj 2YU9J 4FJXA 2VI6A 3MPUB 3BR0A 3SUOA 1NGIA 3E2UA 2VE8A 3H41A 1RUNA 2HZTA 1QSYA 3GFMA 2ATQA 1ZSZB 3DU6A 3NNQA 4N4NB 3LSIA 1JTYA 5GAMg 2DK8A 4R56A 1VQPQ 2R7XA 1XC9A 5M5XJ 3BR3A 3Q9VA 1QQOA 3COAC 3ZETA 1Y07A 2Z33A 2E1CA 3SD4A 1A31A 1LCUA 3BF3A 4M3TA 2R92J 2WC9A 3CCSN 4IO9L 4B3MK 1VYUA 1TW2A 3BR5A 4FOIA 3PE0A 3ZX3A 5EC7A 1I0CA 3QPSA 9ATCB 3TAFA 2HPMA 4D9JA 1JJ2P 3A8GB 5GAOn 4BQLA 4C92A 1XCVA 1N6QA 1VQ5A 2DL7A 4KH1B 4UVBA 2Z1GA 2CZ1B 4GNIA 1ZBIA 2LREA 1B9MA 2HVSA 3QUIA 3VWBA 2ZPGB 4A63B 2NRAC 2KYMA 1ZGJA 4DTPA 3G1JA 1RAAB 2IVMA 3Q5FA 1FKOA 3CCRQ 3UNGC 4E7JA 1REVA 2FUG2 4JI4K 3CJRB 1KYZA 4CERA 1LWWA 5F0XA 4CCOA 3CCSA 2P9PA 4IO8A 3MMVA 3ID8A 1YITA 1S7AA 3ATVA 2DXCA 1IGQA 4BE2A 4ETSA 3NWTA 4DOVA 2X1DA 5LJ5h 4EHTA 3QKJA 3M4OJ 1K9MC 1RILA 3E9LA 1IH7A 3FZVA 4A3KJ 3RESA 1MNEA 2XO7A 2HBMA 2PI0A 1VQ8N 1IKXA 5IP6A 1YXQA 1WFXA 3M8EA 2IW5A 4FWMA 2DXIA 2OQRA 2YI1A 2QEXN 3EFSA 1RCHA 3OQ5A 5CKHA 2NOJB 4BRHA 3EQLF 1QVGA 1NK5A 4BRPA 2HYGD 4K42A 1LWYA 2OTJN 2HBKA 1RT6A 3RMCA 1QVGM 5AQZA 1WQ7A 2ZMEA 2NOHA 2VQCA 2LY9A 3UKRB 2J6FA 4BE0A 5HRNA 2VXEA 1SAZA 4BEHB 2EQJA 1IREB 1NJXA 1B7TA 3PIPL 1VQ4A 4NZGA 3CCVN 2VJJA 3CC7T 5DYMA 3RRGA 2O8BA 3FXQA 1LUJB 1V4TA 2XDPA 3VS6A 3E6DA 3O80A 1CF7B 1FJLA 2OPSA 5GAN3 1K8AO 5EEHA 5JVGF 1VQ8A 2YHAA 2ZO4A 4OWRB 2ELKA 5J2QA 5C2FA 2QEXA 5AQGA 2RJDA 2OTJA 4HSBA 1Y97A 5ELZA 4HLXA 1C0TA 3LFKA 4KRFA 2H1KA 2GUIA 1WI9A 1R0BG 3T8TA 1HDDC 4ZHRA 1JI8A 1BI4A 2X6WA 5BRFA 4AYBN 4B9WA 3LSMA 1S72N 5FLXZ 2IVNA 3PNTA 1VOMA 1H1VA 4JKAA 4M7DB 4L0YB 2E4HA 3THWB 2YUSA 1M4ZA 1YWPA 2MD5A 5LRSA 2NRVA 2VG7A 1R7JA 4B48A 1N9SA 4GY2B 1N8RO 4IO9F 5KYWB 4A3CJ 1QZEA 3GXOA 1XQSC 4V2FA 2JA7J 4MLOA 4H0PA 4HVVA 2KFDA 2DK5A 4OMFB 5LJ5j 4LF8K 1TV6A 3CJQB 4EW4A 3HSEA 4E3SA 4M75F 3PX4A 1NZ9A 1VHXA 4H0XB 5ICEA 1ZSGA 2XY7A 3JAME 2E6NA 3KD5E 3L3VA 2JMWA 2XV4S 1GLDG 2R0QC 3TMOA 5K5OA 1MBGA 3RRHA 4CYDA 5A2QE 1R6RA 3SPYA 3E66A 1YJ9I 3PO5A 4AYBA 2I5JA 4CJLA 3SMPA 3F0CA 1CXUA 1SFXA 3OY9A 3K4NA 2FSKA 1ULYA 3VS5A 3SNNA 3LSHA 5FLMJ 4IKFA 2DXUA 4WQ4A 3ER0A 1VQ6A 1WSJA 2L7MP 1O4XA 2QG9B 3TKYA 4H0TB 1NGCA 2RE2A 1WJDA 2DPDA 2OTLN 2CV1A 4LF6K 1ITYA 1NG9A 3VN5A 2VVKA 4ZN3A 1POGA 2Z16A 1KC8C 3P4IA 4BI3A 3S3NA 4CFBA 4XLPF 2A07F 3M3ZA 3JSPA 2LD5A 4FLUA 3ASOH 1JGSA 2ZXIA 3PSFA 4C92B 1HK9A 1DIZA 2CZ0B 3LLRA 1XC3A 3K4MA 3RR7A 3R6SA 3CBOA 3TP3A 2A7YA 4F7UB 5DS9A 4LSLA 3JRFA 3M8RA 1T6DA 2KI7A 4JYAK 1QSLA 1RESA 2F2WA 3FXLA 1K9AA 2DIGA 4B3RK 1RBRA 5LEKA 3RPQA 4M7YA 3CLOA 2P0PA 2DT5A 2HXOA 3HJFA 4XKBA 2V1UA 4NC6A 4PNOA 2X6SA 4CO8A 1SG5A 3PIPF 3O1BA 5CQEA 1HYVA 1U1TA 2EV5A 1VRTA 2OTLA 1DU0A 1MPGA 1T03A 1BIAA 1VQMT 2P9PB 1RACB 4LDXA 3IRRA 2EKHA 3J80O 4KAZA 4XQFA 3LWMA 1ACIA 4A3MJ 5CZ1A 3VEXA 3F8BA 1S5JA 2M1BA 3H5NA 3DMJA 2YX6A 1P7IA 4H0VB 2PY5A 1GFCA 3NDKA 2FZKB 4D6WA 4RB1A 1QVUA 3DRSA 5C4JJ 2ID6A 3QBYA 3L6QA 1XHXA 4Q47A 3QLHA 1KD1U 4A59A 3RVCA 3NTKA 2EBPA 3K1MA 3OYLA 3DLMA 2EJGA 2ZMEB 2OJED 4GYIA 2RQRA 2M0CA 3IRQA 5D6WA 3P5JA 3C18A 1P4WA 1WPYA 1FT9A 1IZ6A 4EFHA 1HKTA 2OBPA 4JK1X 2KDSA 2HKNA 3FRNA 3VQ9A 5CVRA 1HKGA 2FF4A 1D3BA 3FM3A 1QMCA 1OCRH 1C1AA 4XH1A 2O8BB 2LR8A 1RADB 3Q3SA 2B86A 3CPWS 1ASUA 3M8PA 1YJWN 3MX2A 4HCZA 2XVCA 5J3LA 2ZB9A 1HSTA 1AWWA 2XF6A 4QTRA 2VJ5A 2E5NA 4A3LJ 1NBWA 2DY4A 2LSNA 5JI6A 3U23A 3LQRA 4AIDA 4F91B 2Y0MA 3QBWA 2A42A 1MMNA 4YHHK 4M71A 2HBLA 3HDDA 4A5MA 4Z88A 4LUDA 3DRRA 4HNTA 3CCLA 3ZSZA 4CF1A 1VSDA 3QINA 1KC8R 1ATRA 4S05A 3CCJI 1D5AA 1X2NA 4BXUA 1S1VA 4FWOA 1UTIA 3OWTA 2OA4A 4MQVA 3IC7A 3OYJA 1BO5O 4E0DA 3BY7A 2VKEA 2ME6A 2LP0A 1BI4B 3BQZA 5DCMA 3LDSA 1LEBA 2E2NA 4FK2A 5KN8A 4D5CA 1YJWA 2I5UA 4LC9B 1IHWA 1WHJA 4C8LA 4TVRA 5A0GA 2ZJRL 3ZX0A 4U7BA 2OYQA 1WGSA 1QS4A 3GTPJ 2YRDA 4C92G 1H641 3N4QA 1QQIA 4BI4A 1S6PA 5HP1A 2XMFA 2P5VA 4F7UG 3UA6A 3V9XA 2KAFA 1ZK8A 3F6OA 3R9PA 4UUVA 4ZH4F 4PKIA 2BZYA 4DQSA 1YAGA 4FLZA 2PVDB 1NKBA 4XQ3A 2O8KA 2RMOA 3QYGB 1KAXA 1VYVA 4O0IA 1U04A 2F2EA 5LGTA 3N4PA 2NLXA 2JMCA 3ZEHA 1ETKA 2X48A 4JKBA 3QJ6A 1JT0A 2I8DA 4PJNA 2GTJA 4XM3A 4XN0A 4J6XA 1TTYA 4ILJA 2KDZA 1DGRM 1LVAA 2DPNA 2OCCH 1VQ7A 4YDUC 3R6MA 2QA4A 4YIIA 1L0OC 4JKCA 1JXEA 2QUFA 3T8RA 2UWMA 4RW4A 3CC4Q 2EYXA 1BW6A 1WJ5A 4CZFA 1E2XA 4EV0A 2ENMA 3G4SQ 5BPDA 2AKKA 4QS7A 1UJ0A 5GAMd 5HDGA 3UF4A 3VRYA 4FJNA 2GV9A 2DERA 1V4RA 4KISA 3FMSA 3ZXSA 4FM4B 2XAQA 4R79A 1DUXC 3C7NA 3C95A 1X1BA 2IVWA 4KI4A 1Z05A 5E1XA 3H9JA 1U0JA 1WSEA 4A54A 3VPZA 1TG0A 2FA5A 5LMUK 2HMAA 3ZSYA 2E5KA 4PKHA 1SFKA 2QWQA 4F93B 2J5OA 3THKA 3VF4A 4JKFA 3BTLA 4C30A 2LC4A 3H6EA 3JTGA 1PD1A 1L3SA 1XUPO 1NKCA 2P84A 1IBMK 1XSXA 1SD4A 3X20B 4RA2A 1IN6A 1HJDA 4W5TA 2OPRA 2WTEA 1FX7A 2VWFA 3UPUA 2LF7A 4Q5SF 1BBZA 4L3QA 4HYEA 3M4YA 1ZHIA 4GY5A 1D1AA 4KH4A 1M1KU 4ZTFA 4GV6A 2L7ZA 1JB0E 2DXTA 2CGHA 2ITGA 4KIGA 1OKRA 5JVHL 4G12A 3RKXA 2V6EA 4E9GA 4E9FA 1CKBA 2G8WA 3D0SA 3T1AA 1VSJA 2QBYA 4PL7A 2YJFA 4FZXC 4CRIA 5HCKA 1ZC6A 3JRBA 2HNYA 3C65A 1VQKT 3MKYB 1KQSA 4RWTA 2RN7A 1UHMA 2DA1A 4S0HB 1E6HA 1MW7A 1BQNA 3MEVA 2ZJRF 2M9HA 2L3PA 4FWPA 2Y48A 1RETA 2H8WA 5FW9A 4JYKA 1D3BB 1SKWA 1Z67A 2E6MA 2QXLA 3QYEA 4LB6B 2FVUA 1YJNA 1YIJI 1C1BA 4HDUA 1Q86O 3SEMA 4IJAA 3CCMA 3VQ6A 1EA3A 4M75A 2E1NA 3K1PA 3QIPA 4NO7A 2IGKA 1PU6A 1BJZA 4A69C 2FE3A 1K61A 2EV6A 3HXLA 2HFHA 3QYHB 1U2VA 4BY7J 3I55A 2JOYA 4RTWA 3CC7Q 3OYIA 3MKZA 2ZD1A 5K7HA 2L9VA 2L0AA 1L3TA 5HLGA 2JTMA 3L2QA 1ZUUA 1M90C 1VZ0A 3M53A 4FVUA 4A0XA 3CD6Q 5DCMB 1W2BS 2Q0RA 4ELTA 2NOGA 3KP3A 5F0CA 3GF5A 2ZAEA 3MN6A 1YO5C 5AZJA 4KBMB 1TS9A 1NKEA 1LNWA 4M4ZA 1XB4A 4NYNA 2C0TA 4UV9A 2HQXA 1GLFO 2HW3A 5EYRA 3A02A 1J5EK 5KRSA 4Z89A 1BI1A 1SSHA 1SL0A 1NGFA 3CMAI 3G0ZA 4Q0BA 2LJ0A 4GVEA 1QHTA 1P4AA 3UATA 3CCEI 5C24A 3H3NO 3IRXA 4CFDA 3ZMDA 1WJAA 4DWIA 4XOPA 2RQVA 1H0MA 2GFUA 1SKSA 3V9ZA 2XPUA 5FFXA 1OFCX 3IWZA 4LLLA 3CDIA 4CHOA 1M8MA 2XHKA 5J2MA 3PIPA 1ITGA 2HD0A 1ZX6A 3HYIA 2VODA 3IHOA 2OFIA 2L7KA 2BYVE 3DTKA 4CI6A 2H6BA 3F22A 2QWLA 4EDUA 4BY6B 1WZOA 4J9IA 4RCCA 5BN9A 1QE1A 2FC0A 3F0ZA 3QEWA 1TT5B 5KYXA 3FC3A 4ZTJA 1M3CA 4HT8A 3G71I 4HF0A 3BLYA 3C7NB 1OU9A 2JXBA 1KQ9A 2XGEA 2XC7A 3JCUC 4CBWA 3EZWA 3RR6A 3H3UA 3P1GA 2O7OA 4DOZA 3QHSA 2GAUA 4H5NA 4ESFA 3D2FA 2O9LA 3MZ8A 5IT9E 1Z26A 3WODF 2XAGA 1R5HA 1KGSA 5BPNA 1JLEA 4DUZK 1WOQA 2UU9K 4XICA 4CJQA 3MD2A 4C9YA 3VJPA 4OINF 4D0PA 4PUOA 4TV7A 1WJFA 4N9HA 1IKVA 3G6ET 1QQMA 2WUSA 4K0KK 4DF4A 1KG5A 5C0MA 2CQ7A 4JUVA 1M90R 4H03B 4PJ0C 3CM5A 1NK7A 4B9TA 3VOEA 1ZQ1A 2ZJQL 1KD1C 4WX9A 2NOEA 1KFDA 5AQIA 3PIOL 3B6AA 2XF5A 3URGA 1GLBG 1W7PA 4OFAA 2BDPA 2A05A 4FHTA 1BCMA 1ZKGA 1OH6A 4OVLA 3VTIA 1FC3A 2DBBA 2VV5A 2MABA 4RW7A 2NWMA 2H27A 1N9RA 3HTSB 5EJCA 2CT3A 2QBYB 4J9EA 3C4SA 3OIOA 3V4GA 1H89C 4DV3K 1Y6IA 4CJVA 3S41A 2QGUA 5L3FA 2EPFA 4DR6K 2KR3A 1IJJA 5JLFA 2P7VB 3AVIA 3BCAA 3HPGA 4KUDK 3RJPA 3KZZA 1JUPA 1IAWA 2DRKA 1QLYA 2P9NA 1RT2A 2QQRA 2XRIA 3AO2A 4DU3A 3IUCA 4FPBA 1D0YA 3A2KA 2Y1JA 3SI6A 3AG4H 3KKRA 4NCGA 4UQGA 1O9SA 2UUBK 4DR1K 3F10A 3J8AA 5FPMA 4M75B 4RW9A 2HHWA 1MBEA 4HSTA 3JB9I 1X3WB 4BR9A 2ZBKA 2XGDA 4XTWA 4X1VA 1K4SA 3OB9A 3T3FA 1JLBA 1XOVA 1ON2A 3ERMA 1U2VB 1DLOA 4GBQA 1AOYA 1TUCA 1K79A 3GDQA 2GXGA 4JJBA 3JB9H 2JNGA 4EMKA 3KHYA 2D0OA 4WE1A 3BJ6A 4OIPF 4HX8A 2L2OA 2MW8A 3TR8A 1EFNA 2RPIA 1ZTRA 4I7HA 4C0DB 3V81A 4CSWA 2HBJA 3EGDA 4XU1A 2IS1A 5JVTA 5AZJB 3M9QA 5KYUA 3SFIA 4LD6A 3DI6A 4CHZA 2P9KA 4IL6C 2FL7A 3IHUA 2E3IA 2E1MB 4L5EA 1BCOA 4G6QA 1I1JA 4B22A 4WWCA 4D7NA 1TK5A 1U6GA 4XIDA 1KEAA 3M8QA 3DKWA 5GAOq 4MQ3A 2K9MA 3NHNA 1J0RA 4CEOA 2O03A 2AQEA 4OKEA 4M9ZA 4JJDA 2K27A 4C5IA 5GAEJ 2STTA 3LWFA 5E1ZB 1KD1R 1G8XA 1VQOQ 1JQQA 4DIQA 4FYXB 5J47A 2X6OA 3V9UA 2HF3A 4A2UA 1VQNQ 4AG1C 3OBYA 1QHAA 1VSIA 4DV0K 2YWWA 3J7ZO 1S7EA 3FBNB 4WCGA 4N0BA 3N97A 4E9EA 3GOIA 1T08B 4IDHA 4RGUA 1MSEC 2E3HA 4J5YA 3AA5X 1KQ2A 2IBDA 1BDGA 3TCJA 2G7UA 3L8BA 4Y28E 2GLOA 2ZJQF 1OCTC 5HY6A 2LYCA 1GXQA 3PIOF 4B1RA 4KGXB 4MMLA 3SYTA 2STWA 5KYXB 3DXMB 4YFKF 1BA5A 4DFPA 1N78A 2E8AA 3K70D 3TI0A 4NNJA 2HEQA 1UHCA 3INZA 3IS9A 2QTDA 1RL2A 2XD0A 2E5LK 3K2AA 3D2EB 2W10A 1TTHB 3LFUA 3V7SA 3ALYA 2LT1A 1SD7A 3JS6A 1YI2N 1WEFA 4KTWA 1HMVA 4FL6A 3O6WA 2PJRA 5JS1A 3L4IA 3BP8A 5F1RA 3D2FB 4DBHA 1J75A 3PM1A 4Z4EA 3P31A 1KJWA 4IHTA 4FW2A 3CC2I 1W4SA 2GGRA 2O8EA 4WXHA 3LWIA 4FPAA 4M3WA 4LITA 3EH2A 3THVA 4FK4A 3IH2A 5H6QA 2DO3A 3KYCB 1Q82C 2VT2A 5EU7A 4CEFA 1PSEA 2IPOB 3AO5A 3CG7A 3HHHA 4DFKA 2KDOA 3HOTA 4OF1A 3VYHB 1W7PB 3CMEN 1Z6RA 1JJ2S 2A41A 4V2GA 1KC8O 4I6MB 1T3VA 4FLVA 3AVFA 2ROTA 4DSIA 2DL5A 1YI2A 4A2AA 2W82A 4LK0F 3VYTB 4ENJA 4A4EA 1JE8A 1TP4A 3TANA 3CQYA 3ZFJA 3O1WA 1VI0A 2VASA 1W7AA 1Q18A 2Y31A 3HRMA 4AC0A 3JCMV 1CLQA 2PG4A 5AQFA 1XC5A 2BANA 4XLAA 1IRZA 5M9OA 3ZGKA 5LGUA 3HM8A 2MBFA 1YHQQ 2ZGYA 4OMNA 3VQQA 1NM1A 8ATCB 4QWQA 2CRGA 1OV3A 2P9NB 3EZ5A 4EZ9A 4WCIA 5FGMA 4C8QD 2BOLA 1NJYA 1E3HA 3GBTA 1W5CC 3BTCA 3HUGB 1MGQA 1UUEA 2BE2A 4IVNA 3WG7H 2EYYA 2MYSA 1B59A 3REAB 3G2BA 2EFOA 3EG9A 3CCQT 4PCQA 4DEXA 3VERA 2BUPA 3CCUA 2BTTA 2DTIA 1VQKQ 2V7ZA 3GCMA 2M4KA 3HOXJ 3QG1A 5HRSA 4M77D 2LTPA 2EQUA 1YS7A 1FBQA 2A40A 5J1EA 1I94K 2COWA 4KB0A 2R7WA 2H3JA 4ESRA 4E19A 4JI6K 4DU4A 5C2DA 5D5VB 2GXAA 1JL1A 3NH2A 2DTUA 2F5DA 2FBIA 3P9CA 4DG1A 2OAWA 4EMKB 3DF8A 3F3XA 4ZNXA 5CIUA 1EBMA 4O8KA 4OIRF 3DEUA 5IYBJ 1LFUP 2BVLA 4KT6A 3TU4K 1GOBA 1VQMI 3EGDB 4Z4CA 5GMKm 5KYUB 2W1OA 4TSXA 2ABKA 1AEYA 1WN7A 1O7FA 2ID3A 2P9KB 5GP9A 3H35A 2DTOA 4RTTA 4D5FA 1TUYA 3OH9A 3FB9A 1M1KR 1JLQA 4FJJA 5GMKi 4I0BA 3X28B 2R7VA 1NGBA 1HNIA 2DOEA 3I35A 1ZSZC 4YIFA 4F14A 1R49A 5GAMh 1OLTA 4FETA 4UY8I 2ZC2A 4BL0B 2VKNA 2CP7A 3CD6N 4DLGA 1IW7F 2KZVA 3TDZC 1W9HA 5EZHA 4M3GA 1CQTA 2X74A 3TAGA 2YKMA 2KP6A 2RQPA 1KU2A 3FXJA 1A04A 2L01A 4LSNA 4JI7K 3SJMA 1QVPA 3TOAA 5E18F 4A5AA 4KBOA 1WWXA 4FQGA 1OYYA 2WFBA 1FMVA 3M0SA 3HSBA 1LNXA 4B23A 5DCFA 1NGJA 2PN6A 3CWAA 5M3FJ 2WBNA 2O88A 1UOCA 2P9UA 3PY8A 2K7AA 1NLOC 1SL1A 1RRJA 4DQ8A 4DZPA 3M0QA 2NRHA 3TO6A 1QP2A 3UA7A 5HS9A 1TH7A 4WYBA 3LYIA 2HNDA 2NS7A 2M8EA 3QETA 2KRHA 3VB2A 1Q81U 4B1XB 2M1HA 2QASA 3EG2A 3RDIA 4R8HA 2R7OA 1AZEA 1SMTA 3ZT4A 1RTJA 3RIRA 2PVGB 4HUGA 3MO8A 3MKLA 4J2BA 5GAOm 3HSFA 2A68F 3ZQ7A 5DK5A 4Z4HA 2KZGA 3CQTA 2OZUA 3NH0A 3L00A 4JI0K 2IRFG 4FX4A 5FPNA 4M74A 4OFHA 3TPQA 5LRRA 3HRSA 2O8EB 2UYTA 1NLVA 4II1A 1T8EA 4BC5A 1UMQA 4BHPA 3VQ8A 2VKVA 5IHNA 5KCMA 4L9TA 5GAMj 3O3KA 2EILH 1X27A 1NK8A 4B9NA 3FIWA 2D0AA 3DP7A 4LK1F 4OPJA 3D45A 5KPTA 2PMUA 2X4YA 2HR3A 2JA8J 3B8AX 3FK6A 3QO3A 1G3YA 3G6EQ 1OCPA 2JPSA 4XSXF 3FHFA 1VQ9T 3KXTA 4IOXA 4A62A 2M9UA 2GZWA 4N0AA 1QPMA 4CJEA 1ZYRF 4BQNA 3F8CA 2GFAA 3E01A 1W0TA 3PUBA 4CEEA 4ILGB 2EAYA 4FT4A 4FX0A 3OJSA 2KGTA 1UG2A 4FWLA 1IXDA 3WHCA 4PJLA 1WA7A 2DJZA 3V1OA 2E1YA 3A0HC 2G3RA 3EG9B 2YSQA 2K9GA 4DK9A 1VQ4I 1WJSA 2VC1A 3S15J 2CP6A 1IRXA 4GKJK 3TEEA 3QODA 2COZA 1BG3A 1R00A 3W3DA 3DJCA 2LVMA 2X4XA 4M7DC 1B6AA 1W0HA 1HF0A 2YUNA 3W6VA 3LH5A 5BNGA 3IV5A 4FCYA 4F2RA 3EDPA 4GVMA 1R58A 4DV2K 2I0NA 5F6FA 2NVXJ 3HZ6A 3C0BA 2FSJA 3NF7A 4MFEA 4YPHA 3SUQA 3F9KA 2NAZA 4CC7A 2XU8A 2K2MA 5AQNA 3IAYA 5FKOA 2YS9A 3MECA 1QHGA 3AKZA 2NOLA 2RI5A 1XX5A 1Z3XA 1GLAG 4UNOA 3CCST 1SS6A 4XOTA 3DAWA 1EV7A 1RI7A 4OVAA 3DLBA 4U0YA 2JN6A 3FHNA 3LSTA 2NZTA 3OJUA 3O9UA 1HNWK 1JXSA 4GV3A 2OFKA 3H0IA 4FL9A 1J59A 2DFEA 2CGKA 4R0KA 1WBBA 2EFWA 3T1BA 2G0EA 2JHJA 2LT4A 2HL5C 2O31A 3C6AA 2ZFWA 2CH4W 1YJ9A 4AFSC 2EBIA 4I99C 2W00A 3JB9J 2Z2SB 2YXYA 2MWPA 5FJ8J 4MIMA 2R7QA 4CCMA 5H6RA 1GRIA 1LDJA 3LALA 1M90O 2P8TA 4FLTA 1ETVA 5JLHA 2OCEA 2VWBA 1WPKA 3I4MJ 5IT9O 3R8EA 4FISA 2UV1A 2P9UB 2FSWA 2XASA 3T1HK 2Y1IA 2IS6A 3FZLA 1TGOA 3MAQA 1NK4A 3QJYA 1TWAJ 2LG4A 1ZBFA 3KD1E 1QNTA 1RDCA 1NGNA 1VQNN 1U1SA 3RKQA 2QK9A 1G15A 2QEXT 3PX0A 4Y1CA 5I9EB 2LQKA 2QLZA 2M0YA 3FJPA 5DM6L 1GLJO 4G7ZF 2RJFA 2R7ZJ 2EV0A 5IN1A 1VQLA 1WH7A 4BREA 2DA7A 1XGOA 4H0YB 3HPOA 2XHBA 3E0JB 2YDLA 4JRPA 4DGWB 2ZNYA 3CCVT 3K4JA 2W7NA 2CREA 1LJOA 2X1CA 4A4GA 5C42A 4I01A 4HVUA 5E26A 2RI3A 4BQOA 2UXCK 2VN2A 2J06A 3S2WA 4ABZA 1WQWA 1EH8A 1I3AA 4OB2B 2ZMEC 4MDWA 3HOWJ 3EGXA 2E2OA 4YOYA 3IH4A 4ISGA 3DYAA 5L3BA 2R7TA 5B5EC 2A37A 4JRIA 2DMQA 3ZN0A 3CHWA 3CPWA 3AAQA 4IJNA 4AHSA 3C2BA 3CPWM 1SMYF 2KK4A 1PHTA 3QEXA 3A5MC 3EFRA 1SAXA 4M78C 1ZELA 2EFPA 4ZC3A 3FDRA 1ZA1B 5KI6A 2MIOA 4EMGA 3RPUD 1FP2A 4KTQA 2TRTA 1OCCH 3PUFA 5HLIA 5LEJA 1S72T 3HFNA 3LAMA 4M3DA 2BY1A 3TO7A 2XK0A 4O6JA 1JLAA 1FSEA 4C23A 3MXMA 3H5AA 2DLPA 3CZ6A 4W5RA 5CY4A 5JHFA 2FRHA 4DB3A 3CCRA 3S6IA 1TT0A 3EYYA 1G2BA 4A3DJ 3J80K 2XGXA 3FFIA 2R5ZA 4XKCA 3SDZA 1KQ1A 4C2UA 3RCOA 3CBPA 3TW7A 2W42A 3MP1A 2YNIA 2CO5A 2PYLA 4F4KA 2A6TA 1KD1O 1JKQC 2RHXA 2P5GA 1FYLA 5DV5A 1TKDA 2LKPA 1IXSB 1YHQN 2ZXWH 4XKWA 1KG4A 4OAYA 3CCJA 3SV4A 2ZXHA 5EG2A 3E6MA 1D1CA 3E7LA 1OISA 3ONQA 3MN5A 1TC3C 2LBFA 2A5WA 4DYRA 4NQWA 3FLGA 3A8HB 2L9NA 2M0MA 2MLKA 3HM9A 1H9TA 1ZREA 3NFAA 2QWWA 1R0AA 2EJFA 3G7ZA 2PMZN 2JWLA 1N34K 2JZYA 4EA4A 2LTOA 1VNDA 2UXBK 1IKYA 2YRVA 4IURA 5AQVA 4XRFA 2ZXJA 4IOAF 4J00A 4Z4FA 5GIPA 4DQPA 2X9HA 1TOVA 3O9SA 2A1SA 1TWHJ 3VS1A 3BZCA 5DD4A 4FXDA 4H5WA 1K0XA 3ZX2A 2W41A 2M34A 3JB9F 2P7CB 4KUIA 1ORNA 4CW7B 1B34A 4M78E 4B9XA 4KHSA 2L3QA 4U0VA 1AVZC 4WQ4C 1SVMA 1ZBXA 3X2QH 1N5ZA 4DSEA 2YU3A 3ATUA 1T05A 2H09A 1D09B 1NWKA 5E3OA 2HQHA 1XMAA 1AWXA 3LSPA 1C0MA 1YTAA 2C0IA 2ZF5O 2MMPA 3FX3A 1RRQA 3ZOBA 5IHIA 1LE8A 5LJ3f 2PMZA 3VENA 1TWBA 1J3TA 4H4MA 1M3QA 4LD5A 4BG8A 4EPCA 4AHRA 3TAMA 4PJOC 4PDKA 4Q48A 2VQEK 5F1XA 1B9FA 2DA5A 3H3VK 1VQ7I 1RKTA 3OS2A 4LDWA 3C0CA 2QA4I 4GXOA 3WVEB 2VC8A 2ZJ2A 2H8HA 1GXPA 3AVMA 2MG4A 3UE5A 1IN4A 5AZIB 1KLNA 3TSUA 3O4QA 4RTZA 3MCPA 2B9SA 4U0WA 2E70A 1SD5A 1SHGA 2K86A 2HHVA 4G6TB 1CZAN 2AHQA 5CKTA 5EG0A 1D9FA 2EGAA 2SEMA 4JPBW 2E10A 1V5FA 4AM3A 2HMIA 3DLLF 2LX9A 3TW6A 1A5JA 4Y92A 3DPLC 2VBXA 3L1AA 1ETWA 3BTJA 4IUTA 2E65A 1YJWT 2E19A 2WC2A 5DDGA 3K2PA 2E36A 2B5JA 3G10A 3I56Q 1YIJN 2EJ9A 4DTUA 2DLLA 3TTCA 3DBLB 4ZYAA 2KT0A 3EGXB 4JI5K 4BVPA 4C5GA 4DCHA 3RWUA 1H3ZA 3CWTA 2L4AA 1TYQA 4R5PA 1H9GA 2WTUA 4BGDA 1SRLA 3TU5A 2ADUA 3VA0A 2ZPFB 3BG7A 4AUXA 4RGXA 3KVGA 3G1MA 4KFCA 3LP2A 4DV6K 3MXIA 1RKWA 2GBQA 2NVUB 2JMAA 1B9DA 1KG7A 3KK1A 3DRPA 5F04A 1RZ4A 4HOBA 2EINH 2COMA 4PJOE 4M3BA 2VXDA 4HZFA 3K5MA 1YWOA 3JCMf 4YTLA 4KYWA 4E89A 4P55A 1RDBA 5CVVA 5DM7L 4CGIA 4PWDA 3MEXA 1YIJA 4UUSA 4A12A 1EXQA 2HOSA 1XQPA 2QXFA 3KZIC 1W97L 2HHXA 3OIQA 5GAN8 4NOYA 1Q82O 3MAJA 1VQ9Q 1Q81R 2WB1N 3ABTA 2YR2A 4ZZLA 4NCBA 3CMAN 1ESVA 1FOKA 5GJVB 4CGJA 1OMIA 1HOMA 2QK0A 3H9GA 3CCMI 3CCEN 1HLVA 2DQRA 3PNVA 1APLC 4PJMA 2GWRA 2QCOA 4C8QA 1HU0A 3K57A 2O8DA 3CDHA 5AQQA 2ITMA 4AMCA 2HU9A 2LBFB 5DUKA 2E7XA 4NQWB 4UVAA 1NOYA 5TRDA 5I2SA 3I55I 4IUPA 4FLYA 4X34A 3SZPA 3V1RA 2KW4A 3WTYC 2DEUA 4X66K 4UXNA 4GKKK 2BXYA 5H1SQ 4RAGA 3GG4A 4RTFD 3ZMSA 4CGHA 4M77A 1YIOA 4YELA 1KVBA 4IRHA 1VQ5Q 1BN5A 2JSPA 3G73A 4XNFA 3R2XC 1QBJA 3SYZA 3CMAA 4Y33A 3H3ZA 1WJEA 4M45A 1B34B 3G71N 4A3EJ 2LOOA 1MD0A 3WTZA 3LQQA 1OX9A 2OZSA 2XG8D 3HIFA 4UV8A 2RM4A 2DIQA 3PL8A 4F92B 4N4OB 4FM2A 1VQPT 2QYZA 2RK2A 3GEZA 2A5XA 4XRSA 3KP2A 1BC7C 2EGCA 1OPKA 3ZMUA 3CCSQ 4Z2YA 1FYMA 2PQWA 3K59A 3ULQB 1YITQ 1LE8B 4HF1A 1WBDA 5JS2A 2ECCA 1KYWA 1ZBLA 3QU3A 2KPMA 4OMPA 1D0XA 4RW8A 2CYYA 2QQAA 4M7AD 4M3ZA 2QENA 5LJ3g 4ELVA 3RDVA 1TQMA 2RF2A 3CCQI 4RS8A 3LDNA 3I0TA 2KMTA 3EFOB 4CCLA 4FU6A 5GANg 3G71A 3D4VA 3WG9A 5EVZA 2O8CA 2EWNA 2FPFA 4HCBA 2KRSA 2GTDA 1HSJA 2FB7A 3SEZA 3TAEA 1JCFA 1QCFA 2ICWG 3OMGA 1LQ1A 4OB1B 3TQNA 4EJTA 2OA8A 3BG3A 4J9FA 2ZGWA 2X35A 3REBB 5AQKA 3M9AA 3K69A 1D8YA 2RN2A 3LSRA 5EG0B 2B63J 5LJ3e 3BPXA 1AD5A 3CFOA 1HYOA 3QWYA 4BACA 2L54A 3S2HJ 2HKOA 1FYKA 1X58A 4QVZA 5TGTA 1NJIU 4L59A 4BR4A 5GAOr 4GFBA 4LD0A 2X3WD 1VQ8Q 5CZ2A 4PKCC 1K73U 2FF6A 3D5RC 2FG0A 2QEXQ 1UHFA 4BRFA 3LDOA 1NLPC 3HOVJ 2OTJQ 3M6GA 1XCBA 5EXWA 2LVSA 4KV8A 2W25A 2Q31A 1LDDA 1I4K1 2ZPEB 2HMPA 5DMRA 1TNSA 5B8HA 1O7LA 1QRYA 1TYQB 5HK0A 1F36A 5J40A 5KHDA 4L6V5 4QVDA 3AV9A 3EH1A 2V52B 3G4SA 1WXTA 1O3QA 4EGZA 3BWGA 2ETJA 5LJ5f 3CCVQ 3ABUA 3AO1A 2XAUA 1SKUB 5LL6S 3H5RA 2JZ2A 3HL2A 4L5JA 2X4HA 2DDBA 5C44J 1FOXA 5L3CA 3ERED 4M75C 1MIJA 4CCKA 3FISA 3WGIA 4J6YA 5JR3A 4KTZA 5IWAK 2R7YA 3PV8A 1QKWA 3VU3C 1EWQA 2LY1A 4G1QA 1GVJA 3HBLA 3FSPA 1M2VA 5HKCA 4NS5A 1J54A 4UUSB 3BW1A 1W2BP 3SQNA 1T8IA 1XSDA 4F9OA 4AFZC 3M0RA 1QZ5A 4HG2A 1UFFA 1J6ZA 2V9KA 2QGFB 2B4JA 1KU7A 3NAEA 3AAPA 4KPYA 3DBRB 2MI6A<