5FRNA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz419 (compound 4c)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
367
structure length
367
Chain Sequence
b'DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase
total genus 102
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5frnA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5frnA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5frnA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5frnA03
4N4HA 4F4KA 4CEZA 3QEWA 4E7IA 2ATQA 1DTTA 2PQWA 1WSHA 4LSLA 4H4OA 5IN1A 2Z1GA 5HP1A 3OY9A 4G1QA 2CKKA 3AVJA 3Q1JA 4L8RB 1XHZA 1WLJA 4CGFA 1TAQA 1WNSA 1RTDA 3PV8A 2M16A 3MEEA 3MEVA 2RO0A 3SQ1A 4FW1A 3RMBA 3FC3A 4B3OA 1HMVA 1WJQA 5C6SA 4IUPA 2G8UA 4AH9A 4FLZA 3O4QA 4NYFA 3QNOA 4OJRA 2HNYA 1VSDA 1JLEA 2QKKA 4CJ3A 2IS3A 4HUEA 4DQIA 4PWDA 2LRQA 3AA5X 3SJJA 3O3GA 4O5BA 3ZT3A 4ZTFA 4FK0A 3K57A 3FDRA 3LLRA 4DTJA 4DU4A 4NYNA 1W0HA 3OYIA 1ASVA 4Z0UA 3ME9A 3SYZA 4CF8A 3KK2A 5J2PA 4Z4FA 1X9MA 3HVTA 1T7PA 1IKYA 4A4EA 2YKNA 4Q0BA 4E19A 3CFOA 5KTQA 3K5NA 4ZTJA 1TK5A 3MXMA 3OMCA 2HQXA 3MEGA 4X34A 1U47A 2F8TA 3OYEA 2DIGA 4ID5A 3A2FA 1NK6A 3RMAA 3ZT0A 3ZT1A 4BE0A 3TAFA 1C0MA 3PNWC 4CK1A 4C5IA 4CHYA 4FK4A 1RTIA 3QETA 3SUOA 3ZSOA 3PY8A 1Y97A 3O3FA 3LH0A 2YHBA 1RI0A 4JRPA 2XDPA 1NKBA 3HL8A 1RBSA 5J39A 2PYLA 3DMJA 1RT2A 2RJDA 3M8QA 5JS2A 4CFBA 3ULDA 1Q8IA 3E01A 4HHTA 2OYQA 1IO2A 4FJKA 4FJ9A 3JSMA 5C42A 5I42A 1TKDA 3MO8A 3P5JA 4W5NA 4C5EA 2X35A 2OPRA 3QO9A 4LD0A 4IG3A 2YKMA 3CEYA 3KLHA 3V1OA 2Z1IA 4CEBA 3HO1A 4FZXC 4CGJA 3DRSA 1C0TA 3HXMA 3AA4A 3TAQA 3L42A 3MP8A 4CF1A 4CJSA 2WONA 2GUIA 4DTUA 3OYBA 1Z25A 3B6PA 4CJVA 5KRTA 3SV4A 4HVJA 4FW2A 1TK8A 2G8WA 4MQ3A 5C0MA 1B9FA 1A5XA 2KZMA 1BQMA 5D3GA 1W9HA 4M41A 1ZYQA 2FC0A 3SCXA 4CJPA 4DSJA 3RTVA 3MEAA 1TL1A 3V9UA 4QW2A 3CQ8A 1D5AA 4NS5A 1SL1A 4MFBA 2XY5A 4DS4A 4PLLA 2D0CA 1U45A 1LWFA 3OS1A 1RCHA 2JTFA 4XIUA 3LALA 1EKEA 2RHYA 4PQUA 3ZSWA 1VK0A 1I39A 1IKWA 3ZSZA 4AHRA 1U04A 1N6QA 3L2RA 2RPIA 3TAEA 4M42A 3K5OA 1HYSA 4LD6A 4HCCA 3H6ZA 2EQUA 2A1RA 5CIUA 3OB9A 4HUGA 4FYDA 2NUBA 4DU1A 3ZSXA 3DOKA 1TKTA 4PLIA 4QQ6A 3KTQA 3QJ6A 3CG7A 1HYZA 3MEDA 1TL3A 4C5HA 4FJ5A 2LSNA 3NBPA 2OPSA 2X4WA 5FRMA 1L3VA 3LWMA 3KD5E 4KPYA 1LWCA 3L3VA 3OYCA 2O4XA 1NK7A 1N27A 3NF9A 5CZ1A 2JLEA 4O4GA 5M9OA 1B92A 1HPZA 3DB3A 1LV5A 1OYXA 3AA2A 1H3ZA 4FVMA 2RHIA 2K3YA 3KD1E 1XI1A 3SPZA 3VQBA 1T05A 3HJFA 4Y1DA 4KHUA 3P83D 3AO5A 4I2PA 3NF6A 5HRRA 4EZ6A 3WNFA 3U3GA 3NH1A 2HHWA 4PUOA 5DMRA 3M8SA 4CHZA 4DF8A 4KB1A 2QQRA 1J53A 1NJYA 5KRSA 4NCBA 1IH7A 4UQGA 3DLEA 2HB5A 4CEEA 5DK5A 3QESA 1L5UA 3HPOA 4OVAA 4R5PA 3DLKA 4CFCA 1KTQA 4BDYA 3QIOA 2HNDA 4BE1A 2LTOA 4DSLA 4BD3A 3VA3A 1RDCA 3OS0A 2VWJA 4II1A 1J54A 3H8ZA 3K5LA 1KFSA 3ASMA 1ZBUA 4FLYA 4IURA 3MEWA 1R0AA 3V4IA 2ZD1A 1C0UA 4E89A 1SUQA 3RR8A 4E7JA 3VQ5A 3THVA 3V6DA 2YNFA 3D45A 4OPKA 1C1BA 3TWHA 3DLGA 4WE1A 1XHXA 3PFSA 5HBMA 2RN2A 3P8DA 4M3XA 4J2BA 4KRFA 4CEFA 3HPHA 4KV8A 2DFFA 2VG5A 4IDKA 5I3UA 3QEPA 1I3AA 3NGYA 1DTQA 4KAZA 2FBVA 2RKIA 1OZ3A 2MWOA 4B9LA 4Y1CA 2QK9A 4FJNA 1S9GA 3IS9A 4RW4A 3ZSVA 3L2QA 3VQ8A 4IUQA 2R7YA 4ELVA 4FJHA 3VQQA 1HNIA 1NKCA 2RF2A 3OJUA 4KB0A 4IG0A 4A4GA 2PYJA 3SZ2A 5KI6A 3GOXA 2YHAA 3AV9A 4H8KA 2EX3A 3LPTA 1S5JA 4KHNA 3VA0A 1HNVA 4AHCA 4FLWA 2W42A 1UWBA 4FK2A 5J26A 1Q9XA 4DFPA 1GOCA 1VSJA 3MP1A 1TKXA 3PX6A 3LP2A 1TAUA 4KHSA 4RG8A 3VQ9A 3QIIA 3MECA 4OLAA 2RJCA 3I0RA 3SV3A 4DF4A 3NNQA 1JLCA 2DFEA 1JLAA 4Q5VA 1S1UA 2DAQA 4DTPA 3K5MA 3AO3A 2XO7A 2P5OA 4Z4EA 2P5GA 2OA8A 4IUVA 4RW9A 4W5TA 2XK0A 5K14A 4KREA 1IKVA 1G15A 3AVAA 3V1QA 2IC3A 1SKRA 2AJQA 2WACA 2BUDA 4L59A 4AHVA 1MHNA 2X6NA 1C1CA 3DLMA 3AO2A 3PX4A 3VQ7A 3SUNA 1VRTA 2B6AA 4H4MA 3SI6A 4UC4A 3QEVA 4FM1A 3SQ2A 4NCAA 4BWJA 1KVAA 1NKEA 3L2VA 4QVZA 2QXFA 4JRQA 3AA3A 3F73A 4FLVA 5HRNA 1KFDA 3CM6A 4DSKA 4F8RA 4EZ9A 1BCMA 3FFIA 3O3HA 3MXJA 3C6TA 4I7FA 1X9WA 4FM2A 2BDPA 2HQEA 1NK8A 3DRRA 1RBVA 4DQSA 4AHSA 3S9HA 2YV0X 2HHTA 3G10A 4KHYA 2L8DA 1VSKA 3DOLA 1D8YA 1RNHA 4CEDA 3NH0A 2GV9A 2DFHA 4M3TA 4OGEA 3SUPA 1UOCA 4DG1A 2BE2A 1N5YA 4CEOA 3NE6A 4QCLA 3LANA 3P8HA 3O4NA 1WSGA 3SNNA 2X4YA 2EHGA 3V81A 3OYDA 4IKFA 1RDBA 4QOZB 2YNHA 3PX0A 3NHGA 2NLUA 2O4IA 1GOBA 4E1MA 4DTSA 3MXIA 3DM2A 1L3UA 3VQCA 5E41A 4AHUA 1SL2A 1UA0A 3V9XA 1TGOA 1SL0A 2EFIA 5KE2A 5IAYA 4CGIA 2LDMA 4HCBA 1EX4A 4FL6A 4EDUA 4CF9A 4CEAA 3NFAA 1IKXA 3KIOA 2GBZA 4CF0A 3H08A 3PMTA 1XNIA 2Z1JA 1RT7A 2FBTA 4E7LA 2XY7A 2D9TA 2RJFA 1RTJA 3LGFA 3D0PA 3RRHA 2ITGA 3OMGA 1NK5A 4IUTA 1S1XA 1JLGA 1VSHA 4NCGA 4PA1A 1FKOA 2HHXA 1OZ2A 2F96A 2IG0A 3NGZA 5HRSA 3HM9A 4O44A 4BE2A 5SWMA 2ZQBA 4Z4HA 2WOMA 1NJXA 3META 3ITHA 1LW2A 3NF8A 3K58A 1RTHA 3ISNC 3U3YA 3QKJA 4IBNA 3VQ4A 2Q3SA 5J1EA 4CFDA 4CJLA 4BDZA 3E9FA 1A5VA 4O0IA 4Z4GA 4HCZA 3ZT4A 1ITGA 4N4IA 3CM5A 3EYZA 5KGWA 4FZZA 3LGLA 2XY8A 3NCIA 3TAPA 4J2EA 4B9VA 4BDPA 1EP4A 4HTUA 3LP1A 2EQJA 1CLQA 4I2QA 4DFKA 4YNQA 4IFVA 2D0AA 1T03A 2BANA 2Y1IA 2R58A 1QS4A 4FJ7A 4PY5A 1FK9A 3RRGA 2KFNA 1JL2A 4O0JA 1CXQA 4OPJA 4KI6A 3LYIA 1CXUA 4FJJA 4E7KA 4OGCA 3S3MA 4NZGA 2YRVA 1YT3A 3QERA 2E6NA 2JZ2A 3K2PA 3AVNA 3L8BA 1ZBFA 3ZSRA 2K3XA 2RI2A 4KKOA 1BISA 4FCYA 3V1RA 1ASWA 2I5JA 2MWPA 4CJQA 2GFAA 3F70A 2FBYA 1NOYA 3QINA 3TANA 1K6YA 4FU6A 3TABA 1D9FA 4J2AA 3JYTA 1KVBA 3OYNA 4LH4A 2YNGA 3IAYA 4CHQA 5T7BA 4DSIA 1TKZA 1NK9A 1D9DA 1SSFA 3BDLA 4DLEA 1JLBA 3WNEA 2XHBA 3OYKA 2X4XA 3QEIA 3PO5A 4O55A 4C8NA 1YTAA 2PZSA 5KH6A 1VSLA 4ELTA 3BDPA 2L3RA 2HMIA 5C25A 4CJ5A 3KUFA 3T1AA 3G0ZA 1RBRA 4M3UA 3KLEA 1NK0A 3S3NA 3LZJA 1HJRA 4CK2A 3EZ5A 3NTKA 1BHLA 3CFPA 3U6FA 1QSLA 1LAVA 4FJXA 3MEUA 3OJSA 4K8ZA 3SQ4A 2DTUA 3LAKA 4KTWA 1RILA 1LW0A 1ZBLA 1WGSA 3OYHA 1BIUA 2RHUA 4B9TA 4IFYA 1S6PA 1KLMA 4I9QA 4W5QA 1VSIA 1EETA 1LAWA 1L3SA 3M9QA 2B5JA 1KVCA 4DFMA 1TVRA 3UIQA 2LVMA 3KJVA 1SKWA 2HHQA 5HRPA 2EQKA 2YNIA 1HRHA 2G8FA 1QHTA 4CESA 4FJIA 3MP6A 2O4XB 3SD4A 1RT6A 3FEOA 3NDKA 4DWIA 4M3RA 4CHOA 3OYLA 3OYAA 1QSYA 2IDOA 2HHSA 3VQ6A 2KZZA 4FXDA 3OA6A 3QNNA 2O4GA 4CERA 4DQQA 5D6XA 3IRXA 4LY7A 2VWKA 2B4JA 3DRPA 3AVGA 4RG2A 2QKBA 2X6SA 3OYFA 4C8LA 3LDSA 1UA1A 2HVIA 2DY4A 5CZ2A 3OYGA 1RT3A 4DQRA 2E5QA 4C8OA 4A4FA 4CGGA 3QLHA 5HLFA 4CIGA 1NOZA 1BQNA 4N56A 4FJLA 1QSSA 4DTMA 3DYAA 3KLGA 4ELUA 3C4SA 1C6VA 1F21A 4DS5A 2ZE2A 1RDAA 1WSFA 4B8AB 2BGGA 1OI1A 4B9NA 3CYMA 1WSEA 1QTMA 2PY5A 2ETJA 1KCFA 4RW6A 3V9WA 3PUFA 4GMJB 4EP5A 3AO1A 1RT1A 3AVCA 4QQDA 2G3RA 4DTRA 5CY4A 1KHCA 2IAJA 4N41A 3ASKA 2X78A 2OPPA 2RHZA 4M3YA 1BL3A 1HQUA 1YVUA 3HP9A 1LWEA 4C8KA 3NAEA 2JGUA 1S9EA 4KFBA 3L2UA 3AVIA 3S6WA 4YFUA 3O8VA 4DTOA 1S6QA 1WJRA 3DLRA 3M8RA 3LAMA 3QIPA 2RI5A 3ZCMA 3AVMA 4CEQA 3C94A 1NJZA 3PO4A 1KRPA 4CJTA 3QEXA 1YTUA 2X74A 3TAGA 5D6YA 4DTXA 3TARA 5D6WA 4M45A 2GF7A 2EQMA 3OYJA 5J2MA 1BI4A 4IUUA 2QQSA 2RHXA 4CRIA 1DLOA 4LSNA 5FDLA 4LH5A 1L3TA 5C24A 4BWMA 1JLFA 3VQPA 4Z02A 1S1TA 3I8DA 2KTQA 4F2RA 4KTQA 2EKOA 1UAXA 1X9SA 3AVKA 1HQEA 1TV6A 4F3OA 4J2DA 3ZSQA 4Z4IA 3LP0A 3KLIA 1ZBHA 4B9XA 2GFUA 2R5MA 1Q9YA 4CIFA 1JL1A 4KTZA 1RT4A 2G8HA 3VN5A 1EXQA 3T3FA 3HK2A 3SPYA 4B9UA 3LX7A 2FHDA 1S1VA 3L2WA 1VSFA 1Z26A 1JKHA 4ID1A 2P1JA 4FM0A 5JS1A 1WAJA 4GY5A 1MU2A 2P51A 4FJGA 4Z4CA 3NF7A 4FLUA 2RI3A 1JLQA 4CIEA 2M1HA 5KGXA 5KE3A 5EU7A 3NTHA 4N47A 1ZBIA 4FJ8A 2P0KA 4CGDA 2OZSA 3DI6A 2OPQA 4DQPA 4N5SA 2F5KA 1BCOA 1KLNA 4CJWA 2E6MA 4KI4A 1RT5A 1J9AA 1NJWA 2D5RA 4OKJA 3TAMA 2FBXA 1CZBA 4OKEA 4QAGA 4DMNA 1J5OA 3DLHA 3UWNA 3CFRA 3M8PA 3OYMA 3C95A 1IG9A 1HYVA 3QBYA 1BI4B 3AVHA 5FRNA 3PMIA 3RWUA 4DLGA 3AO4A 4M3ZA 4DSEA 3SUQA 4A4HA 4OKKA 3B6OA 2L89A 1X1PA 3OVNA 1FKPA 3EY1A 3L3UA 2HNZA 4PL6A 3KLFA 4B9SA 4CJKA 3HSTB 2D0BA 1WSJA 4CJUA 4JLHA 4FJMA 3LPUA 4RW8A 4K8XA 3VQAA 4Q5WA 3WNHA 4CE9A 3NGIA 4HUFA 2R5AA 1SV5A 4CHNA 1WAFA 3HVRA 3VQEA 3RMDA 4KHQA 4FZYA 3HT3A 5CYQA 1A5WA 1RDDA 4GW6A 1TK0A 2HHUA 1U4BA 2BKDN 3RR7A 4OVLA 4B8CA 2HHVA 4DFJA 3KKSA 5SZTA 1S1WA 4W5RA 2G8VA 1VRUA 4DU3A 4FLXA 4B9WA 2B8AA 3VQDA 3DB4A 4E3SA 3SQ0A 1FXXA 3LZIA 4E7HA 1RBUA 1REVA 3NTIA 1U49A 1RBTA 1B9DA 3AVBA 4GVMA 4FLTA 3P1GA 4C5GA 5HROA 2KQ2A 4AHTA 2A1SA 1U48A 4CF2A 3V9SA 4CECA 4CFAA 1XC9A 1JXEA 4BACA 2LCCA 4CJRA 4E0DA 2IGIA 4CK3A 3EAEA 1WSIA 1BIZA 4AILC 2G8IA 1T8EA 4B9MA 4CGHA 4OLBA 2DIQA 4EP4A 3KK3A 2G8KA 3KKRA 4DTNA 1SKSA 4ICLA 1VSEA 3IG1A 2E6LA 4KO0A 3HP6A 4M3WA 2M0OA 3C6UA 3T19A 2HVHA 4TSXA 5KCHA 4B08A 3NH2A 3S3OA 2OZMA 3MAQA 4W5OA 3BGRA 3ZEHA 1ASUA 3HYFA 4JS5A 4DSFA 2VG7A 2XY6A 5FROA 4F3TA 2IOCA 2E4LA 4KHWA 4CCHA 1WJSA 3AVFA 3KK1A 1QQCA 1NK4A 4RW7A 3FLGA 3LWLA 5KCOA 2R57A 3I0SA 1O1WA 2Y1JA 3OQ5A 3ZSYA 1KSPA 1GOAA 4CJFA 4CJ4A 3F9KA 3LP3A 2BIVA 1JXBA 2XRIA 2VYTA 1WN7A 3V9ZA 5CYMA 1G5VA 4CHPA 5J2NA 3ZT2A 1QE1A 2KW4A 4N4GA 4CJEA 4JS4A 3OS2A 2Z1HA 1C1AA 4C8MA 2F8SA 3TR8A 4E1NA 3DLBA 1VSMA 5J2QA 2VG6A 2KFZA 3RMCA 3WNGA 3ALYA 3TI0A 4N76A 3K59A 3AVLA 4ZHRA 4QQGA 1BGXT 3E9GA 4I9LA 3UT1A 2HW3A 3HPGA 1CZ9A 2RJEA 1XWLA 4F2SA
chains in the Genus database with same CATH superfamily
2R92J 4QVCA 3NMUA 4CEZA 3MWMA 1ETVA 3KWGA 3HOTA 5HK3A 3DTKA 1DTTA 1YHQN 3ZFJA 4JLIA 4H4OA 5AQOA 5D4SA 2Z1GA 3F8FA 4BQOA 4G1QA 5JI6A 3REAB 3CCJN 3V8KA 3JS6A 1N5ZA 1XHZA 2RK1A 3VW4A 2SEMA 1WJAA 3PV8A 1P59A 2HSEB 3JAMK 3BW1A 3HXLA 1VQ6A 2HDAA 2CP5A 1YJWN 3F22A 1YQRA 4J7FA 4M7XA 3U8XA 1G3YA 3S6IA 3DBRB 1M27C 1POGA 5ECAA 4BRLA 4JN4A 5GAMd 4LG3A 3ENHA 3D1NI 3QMLA 2IS2A 3KCCA 1JLEA 1ENHA 2RQRA 1H89C 2AA4A 3MEXA 5BPNA 4A2UA 3TO9A 2NOIA 4BY9C 1HNXK 1OQKA 4IOCL 3ZLJA 4XLEA 4M75G 2COZA 1VQNT 4L9VA 3CCMI 4M63C 2VBZA 3G3ZA 4C92D 2XICA 3CC7A 4CCNA 4YDUA 3ABMH 4P1WA 5GP9A 2FF3B 3U23A 1M90O 2L02A 3GZ5A 3REBB 2DEUA 5BNGA 3OYIA 3IH4A 4YORA 3VS1A 4Z0UA 5BN9A 2V4JC 1U1SA 4G8XA 4CF8A 1SFOJ 2PFBA 1KAZA 3I33A 3KK2A 4DA4A 1X9MA 3PUBA 2HL3A 1T7PA 1IKYA 2XPWA 2YKNA 1JJ2A 4Q0BA 3WVDB 1EA3A 3CFOA 1KC8O 4JJDA 3DXMB 2CFOA 3KYDB 4UY8I 4BNCA 5GMKj 4LN2A 4C2TA 2R7FA 1VTNC 2MOXA 3MXMA 1RC9A 1R7JA 4JDSA 1IN7A 5GAMg 3NWSA 2QF7A 4ID5A 1VQLN 3NFCA 2D1VA 3EE9A 5IYDJ 2LSOA 5EYRA 1QVFP 2MC3A 1R77A 1C0GA 1VQOT 3FHNA 2COMA 1MBJA 2E5LK 1BIBA 2HS5A 3AG1H 3ZSOA 1YRNB 4PK4A 5EX5A 3O3FA 4IRHA 4ON0A 1NG2A 3S41A 2NRAC 1RI0A 3CMET 2V8JA 1SD7A 1A5JA 1Y8QB 1J6ZA 4IO9L 1VFCA 1K9AA 2PYLA 2X9HA 5IHNA 2JRMA 1RT2A 2RJDA 4JX5A 4CFBA 1W36D 3WQUA 5H2FC 4WQ4A 3BY6A 4GXOA 3F21A 2XGEA 4HHTA 3G6ET 5AZIA 4PJOE 5CHZA 4J9EA 2BE5F 5KYWB 3F8NA 3ZQGA 1SD4A 4YPRA 5E3NA 1TKDA 3ZQFA 1XJWB 3MO8A 2XIGA 2LG4A 5FKLA 3K2ZA 4WCEL 2OTLQ 5HS8A 4W5NA 2QZ8A 3LSKA 1HU0A 3KP7A 4I0BA 4IG3A 2QWPA 1UG2A 3NGPA 1RR8C 4J9CA 1N33K 1IREB 1MUDA 2HU9A 2EJFA 2VJIA 1YBYA 3L42A 3KZZA 5LBQA 3CCLQ 4MLEA 3KE2A 4CJSA 3RJPA 2JTMA 4X65K 4HTLA 4BJ6C 1G4DA 1VQ5I 4CJVA 4C1NK 3HM5A 4AU7A 1J75A 3FKIJ 1VQLQ 1TK8A 2CYZB 2DA1A 5IHKA 1F4KA 3QFUA 4NO7A 1A5XA 1HJOA 5D3GA 3JRFA 1W9HA 4Y3OA 5FLXZ 1LPLA 5M1QA 3SCXA 1J59A 5J3LA 4LK1F 3RIRA 3E0JB 2O8DB 4LXCA 3KFVA 1QVGA 1XG1A 2AIRB 2NOZA 2WFBA 1Z3XA 2LREA 1D09B 3JB9J 1D5AA 3A8GB 2O8BB 1SL1A 3ERED 5E20A 2LCLA 4DS4A 3EHRA 4XLNF 3PT9A 2ZSHB 2GAUA 1Q81R 3K4BA 1MJAA 1MWMA 1RRSA 1NLOC 2DZCA 1MBEA 1X3MA 2QEXN 3LALA 2RHYA 2F9TA 2VOPA 3KP4A 2KLOA 1ZX6A 3WU2C 1NGBA 2OF7A 1FOXA 3I59B 2O8CB 3M3ZA 1ZHIA 3C0CA 2VIXA 4HCCA 2ROLA 1FYMA 1OKJA 3I9QA 5LY3A 2KT0A 2CH4A 3RKWA 3PIOF 1I5OB 4CBWA 2ZGYA 2CP7A 3RMQA 3VEVA 3OB9A 4HUGA 2NUBA 4RUGA 1CF7B 1P92A 2A07F 2E3HA 5I2MA 3VERA 3CD6N 1KHIA 3QWLA 5BRHA 2HR3A 4RTFD 2GXGA 4DR2K 3VWBA 5LRSA 3SWNB 1YHQA 5E1XA 5KAIC 2M45A 2ZPEB 3Q3SA 4QQ6A 1GXIE 3QJ6A 1HYZA 3MEDA 5KVRA 1RAEB 1UECA 2I7NA 1M2VB 1AEYA 5GAOr 2DRKA 3CCJA 4AM6A 2X4WA 1L3VA 2K85A 4KPYA 1YJNT 3LDLA 4FT2A 2O4XA 4BHBA 3MMYB 3HJEA 4B6MA 1N27A 1QP2A 2E1YA 1YJWA 1X2KA 1FTZA 3DPLC 4LD5A 2Q31A 4D6WA 5M9OA 1KO9A 2P5LC 3O08A 4RGRA 2M34A 1B92A 1HPZA 2HF3A 4XONA 2E88A 2HBLA 1OYXA 3AA2A 1R49A 4P5OA 1J5YA 4BRKA 4LUDA 1TT5B 1T05A 1I5LA 5DDGA 4M78B 2XROA 3P83D 2JNGA 3NF6A 2ID3A 3FX3A 3EGDA 3U3GA 3NH1A 2HHWA 3QYGB 4PUOA 5E18F 3KETA 5D4RA 2E1NA 3J80Z 1ZLKA 4DYCA 3QZ5B 3G1MA 2PI0A 1WJDA 3I4NJ 2QQRA 3AAPA 4L18B 1JT0A 3VETA 5GADJ 2HQAA 2VC0A 3HOVJ 4NCBA 4UQGA 4M78C 4DR1K 4DV2K 2COYA 2HB5A 4OMZA 4CEEA 3R1XA 1L5UA 4JEPA 4OVAA 4ILHA 2KDZA 2DL7A 4R5PA 1K73U 5IOZA 3W6KB 1J0RA 3WTTC 3MHXA 4N0BA 1TUGB 4Z2YA 2DETA 4M7AA 3VA3A 3DKXA 1RDCA 1FPQA 1GV5A 2YX4A 5B5EC 1KFSA 3ASMA 4IURA 1R0AA 2K86A 1N8RC 3RR8A 4E7JA 3VQ5A 1BC7C 3THVA 1K76A 2HI3A 1ORPA 4E7SA 1FMWA 3E9LA 3WTYC 1AHDP 3D45A 3WU0A 4OIPF 3K10A 4Y0WA 1D1BA 3DLGA 3GFMA 4JKAA 3A5ZB 3QUIA 2DFFA 1VQLA 5I3UA 3U2RA 2HHHK 3G6EQ 1GRIA 4I01A 5GAEJ 1E3HA 4JK1X 1TTHB 2LMJA 4B9LA 3CXCA 2QK9A 3CMAT 1I0CA 3HRUA 4L9JA 2P9UA 1NGGA 3PIOA 3DLAA 3VQ8A 4JI3K 2QCOA 1VQ9N 2DILA 1HNIA 2RF2A 1NKCA 2EIMH 4KB0A 2BV6A 2RNGA 5KI6A 1P7MA 1UDLA 1BI0A 3HKZN 3GOXA 3T1YK 1GBQA 3M53A 1JGSA 5CVUA 5AQMA 4XRMA 1TWGJ 3C12A 5LMNK 3VA0A 1T44A 2BXYA 4G94A 3FXOA 1B72B 1R6RA 1VI0A 4Q4ZF 4FK2A 2UZKA 1M1KU 2XGXA 1Z91A 1VSJA 8ATCB 3MP1A 1E3OC 4IVNA 1MH3A 3VOVA 4LLGF 5H1SQ 2PBDA 4XU3A 5CVRA 5IY5H 1U1TA 1VQ8N 5LJ5d 1ERDA 3QIIA 4ZNXA 2RJCA 4K42A 4KHPK 3I0RA 1YIJN 2NVYJ 5HCKA 4KDPA 4BQNA 4XBFA 3X26B 5AZJB 4JQFA 3NNQA 3SEMA 4FX4A 3CCRI 4BR9A 5AQWA 2P9SA 3MN2A 2DAQA 4A0XA 2EZHA 4DTPA 5JLWA 2KLAA 5C0YA 2P9NA 1KAXA 3AO3A 5CHIA 3CO6C 2XO7A 3ZETB 1I4K1 4YOXA 2VBXA 4E9EA 5F0XA 3A5MC 1EBMA 2OA8A 2VXFA 2HDWA 4KREA 1ZLMA 3QQAA 1FJLA 2ISYA 3K6GA 3ZYYX 5DV5A 5DS9A 2F5FA 2BUDA 2W6LA 5EOYA 1MHNA 2X6NA 3JRGA 1PC0A 5HKCA 3PX4A 1NYFA 1R5GA 2K9SA 3HSRA 4RCHA 2ZWHA 4H4MA 3SI6A 3SQ2A 4NCAA 1N3CA 1NGDA 1MGTA 1VIEA 2DVJA 2DERA 1UHSA 2HBMA 4PL8A 1RRQA 5HDGA 3NARA 4HSBA 4FLVA 5HRNA 5FLXO 5LJ5g 1HW5A 4MMKA 2QEXA 2RV8A 3FFIA 4RB2C 1S7AA 1QVGM 1X9WA 3AG3H 2E5NA 5DCMA 1NK8A 2HHTA 4ENNA 3VF4A 2KIFA 3IUOA 4CA0A 1YJNQ 5GAN3 4CEDA 3NH0A 2GV9A 2DFHA 3ASNH 1RACB 3RVCA 3EG9A 4OIQF 3VEZA 3CD6A 5CLSA 4RTYA 5E8IA 1WSGA 3SEZA 2GQIA 5ICFA 3ISPA 3OYDA 4B3AA 1G59A 3GTJJ 1IXDA 1XG7A 1XSDA 2OA4A 5F1JA 3NAUA 3NHGA 1QW1A 5F1RA 1OV3A 1PUFB 2O0YA 4RTVA 5EGOB 7AT1B 3MXIA 2VT3A 5CPRB 4KT0E 3C6AA 2CU7A 3K4KA 5E41A 1K8AC 4CZMA 2VASA 4BYYA 2X9DA 2PTKA 4ANJA 3JB9H 1WPKA 5E17F 1NJIR 1FIPA 2QYZA 1A36A 1SL0A 4OAYA 1K9MC 2EFIA 3VFZA 3ULEA 4C8QF 2QQBA 5EG0B 1FOKA 4CGIA 4DV1K 4FL6A 1QVTA 1XD7A 4EDUA 4XTZA 1MKMA 2A69F 3OR2C 2IRFG 2WV0A 4D1QA 3G7ZA 1IV0A 4EM1A 3PMTA 4CZHA 4ZYAA 2KZGA 2KRNA 4A61A 4BI3A 1NK5A 3WTZA 2JXBA 2JPBA 2K5CA 2X85A 1AOYA 3LM2A 2PZ1A 2ESWA 1LCUA 3CW7A 3CBPA 1SRMA 3A5NC 2OJ2A 4AFUC 4M78D 3EE8A 3J81Z 2R7WA 2A0FB 3C7NB 3EDPA 1OZ2A 2F96A 4IFEA 2ED1A 3NGZA 2AKLA 2QGGA 1NMDA 3TQ7P 1O3SA 3H5RA 4CCLA 1IGQA 4GRIA 1ETQA 4CI0C 3EPZA 5SWMA 1K79A 1RL2A 2HKNA 1W5TA 3O5BA 1H8AC 2M8GX 3TOBA 3CP8A 2V79A 3BR0A 3CMAQ 2Q3SA 3E5XA 5J1EA 2EZKA 4CD3A 2H27A 3I0WA 2E2HJ 4O0IA 3M3YJ 4QT7A 4CC7A 3X20B 3VEYA 4EJZA 3EYZA 2HBKA 2E1OA 1ZLJA 4KBOA 2BH1A 4AIHA 3NCIA 3T8RA 1EP4A 2DJZA 4HTUA 4JJBA 2O3FA 4I2QA 4BXUA 3GFIA 3G1JA 1H92A 4XK4A 3CUOA 1T03A 5FKMA 2QKMB 3LWFA 3KZYA 5LGTA 4ORZA 4PY5A 1FK9A 2CUBA 4IIOA 4B4CA 4OPJA 4IZ9A 3JAMZ 4HF2A 4JKHA 2JT1A 3PQKA 2CH5A 4OGCA 2COBA 1YJ9N 3QERA 5IT3A 2OTJA 1VQ9A 2HTJA 3IKVA 1WI7A 4WF2A 2JZ2A 4CICA 1ILYA 3H1CA 2BE9B 1BUPA 2K3XA 2YX6A 4KKOA 1BISA 3HKZA 3FBIB 3V1RA 4OIOF 2KQWA 3OBYA 2FOKA 1BI1A 3S14J 4L9TA 2ECBA 5C4JJ 1R0CB 3TANA 1K6YA 5DM6L 1G3TA 4JNEA 2IXSA 2XF6A 1ESVA 1WQWA 3TABA 3I55I 1D9FA 2DT5A 3JYTA 3UKGA 4Y17A 4J8FA 4YEJA 2QM1A 4YFKF 1MMNA 4CVNE 1Y64A 1TNTA 1VQ8A 5T7BA 3VF2A 2V7YA 1YIJA 2MD0A 4ZYHA 2Y0MA 5KYUA 1KG6A 1FEXA 4YPHA 1FLIA 4ZGEB 4A5BA 3WNEA 1BWFO 5B8HA 4Z89A 1EH7A 1KQ1A 4HKEA 1HCRA 6AT1B 1WFXA 1YTAA 1WBDA 1P4XA 3M4YA 4RB1A 1OU9A 1A31A 5DPKA 3D4VA 4CJ5A 3KUFA 4F7UF 2OI3A 2I7PA 4BGBA 2NOLA 3OWTA 3KFWX 5EY4A 3EZ5A 1YXQA 1OPCA 4G12A 3JREA 3BJAA 1LAVA 5M1OA 2DMUA 4C92F 1KIKA 1G2HA 1S29A 5CQYA 2IW5A 4P5NA 1ZELA 2ZJQF 1ZBLA 3Q9VA 2XRLA 4HCKA 1BIUA 2X6XA 4P55A 2WY8Q 5JFRA 4IFYA 1KLMA 3D0SA 2KGTA 4FE7A 4LF6K 1Z21A 1GVJA 5FLXE 1EETA 1LAWA 3CVTA 1JI8A 4UUSB 4J7IA 1JO8A 1WJEA 3R0JA 2W41A 5A0DA 3QFPA 2EPDA 3PNVA 3KJVA 2ELHA 2HHQA 5HRPA 3PIPA 1HRHA 4Y15A 2V7ZA 2N8GA 1S72N 5IWAK 2YHTA 1MMAA 1QHTA 4FJIA 4AMCA 4XTYA 3SD4A 3FEOA 4DWIA 4M3RA 4FTHA 1X58A 3TSQA 3LSMA 2XG8D 4I6MA 2F7TA 2CT4A 2A42A 2E8AA 1ON1A 4DZJA 4WK8F 5KHDA 2B4JA 3DRPA 2X1EA 4F14A 3CJ7A 5ICGA 4OOIA 2X6SA 3CCEN 1NBEB 2QXLA 1MGQA 3O8GA 4DBQA 2V9VA 2LNHB 4PJLA 1RT3A 4A4FA 3RSEB 4CIGA 3NVKA 1NOZA 3M0UA 4FJLA 4DTMA 1MUNA 2E65A 3FM5A 3C4SA 1HX1A 4NHJA 1OMIA 2ZE2A 3CCST 4IEIA 2C06A 3J8AA 3ZX3A 3DWLE 5GIPA 2ZCFB 1A6IA 3CVSA 3X2QH 1YCSB 2F69A 1WSEA 2RDPA 1RI9A 4KH5A 3I55T 3CJ9A 2GX9A 3V9WA 2A7YA 2GM4A 2Y4YA 4EP5A 5KN8A 4M75B 3AO1A 2ZJRL 1SMYF 3AVCA 2IJLA 2RM4A 3QPLA 2X6YA 3OL3A 2ELKA 3I9V2 2NRHA 3ZN0A 2BOLA 4N41A 2QTXA 3ASKA 4DV6K 3HSCA 2RHZA 4M3YA 1WIEA 4EEFG 4HV5A 2DEQA 3ZEUB 3KP6A 1C0WA 2P4TA 1R23A 1YVUA 4M75C 1MNEA 1OQYA 2DA6A 4EMKC 1U06A 1F9NA 5F27A 1OCRH 2UWMA 1ZSZA 4KUMA 4WCIA 3VYRB 5B1AH 2D1HA 4DV3K 2CGKA 3BP8A 3COAC 4C92A 2E60A 3DLRA 1Y1VJ 3M8RA 1X1CA 4ASNA 2R5YB 3QIPA 2VODA 3ZCMA 1UGPB 4KJZA 2H94A 1NJZA 1AOJA 4ZDLA 2W0ZA 3KLNA 1FP2A 4ZZLA 1MBHA 2X74A 4I02A 5GADP 3GFJA 3CQXA 2K2MA 2EIKH 3T1HK 3FJPA 2IS1A 4LDYA 2LD5A 1BYMA 3DQVC 2EQMA 1N8RU 3MDQA 4IUUA 3QDFA 1DLOA 1TUUA 1ZR2A 1Z0XA 3TP0A 4LSNA 1G83A 3OS5A 5M1FA 1U0JA 5EEHA 5CR4A 4M9SA 2QQAA 2HQRA 1JLFA 1IG8A 4Z6YA 2FF4A 4XEIA 3Q7BA 2DPPB 1Z7LA 1UAXA 3S2WA 1OISA 3HTVA 4F3OA 5D5XB 3K9KA 3GNFB 1Q82O 5IYCJ 3G25A 3A03A 3IH7A 3LP0A 5LFAA 3JSCA 3A2KA 3KLIA 4JX4A 4D7NA 3M7GA 3CBOA 1U5TA 1YJ9A 1PM3A 4A2BA 1HC8A 3OW2A 1Q9YA 1FN7A 3I54A 1JL1A 2I10A 4UNFA 1YCYA 2W84A 1ZXOA 1K73R 2PAVA 4WQ5C 5CKTA 1S5LC 3SPYA 3SEQA 2EFQA 5EG2A 4AG1C 1KG4A 1S1VA 1KG7A 3WXKA 2RKHA 3L2WA 1VQKN 1QA6A 3JAMO 1JKHA 3RCOA 3FR0A 4A54A 2P1JA 3Q0UA 4HX4A 2V6CA 1WAJA 2VGNA 3I0TA 3L2ZA 5TKWA 1HKTA 4Z4CA 4ELYC 3H9QA 2R0QC 2DYRH 1JLQA 3LNQA 2FB7A 1HUXA 1Q86C 2CP0A 3DFGA 1SC7A 3RERA 1NEBA 1N3AA 1BO5O 3CCSN 2P0KA 2QK0A 3CF2A 3EETA 1FX7A 4XSZF 4CJWA 2E6MA 4QS9A 1J9AA 1NG7A 4OFHA 1V5GA 1UG0A 1GLFO 2HD0A 1ETWA 4YOQA 4LC9B 1LVKA 5CJ9A 3DLHA 1ATSA 3H45C 1E3MA 4RAZA 3C95A 3DBHB 1R9TJ 4YOWA 4UVAA 3GVAA 1I07A 1MUZA 3MKWB 1FP1D 3VGLA 3AO4A 2LRDA 2K4YA 1P9QC 2EKHA 3FKJA 3HRSA 2YT6A 2AXLA 3H1QA 3BLYA 3P38A 1HPMA 1NBWA 3CC2A 2Q2EA 1X1PA 4KUIA 1FKPA 3CPWM 2KP6A 2QA4I 2MA3A 2GUPA 3BC8A 2JOYA 3EH1A 3SFZA 4OAZA 1MNMC 3HSTB 2D0BA 3P9KA 1TXQA 1WSJA 4OX9K 1JJ2P 3ZN1A 2MPXC 3RSNA 3SAFA 1M1KR 2FA5A 5E79C 1ARKA 1JHFA 3A0HC 3JRHA 1ACMB 1MBGA 1IO6A 3VQAA 1ZG1A 4Q5WA 4DEXA 5KPTA 5K7FA 3NGIA 4HUFA 2NS8A 1VQKQ 1ITYA 3JCMc 4CHNA 3BZKA 4A3DJ 3HVRA 1S72A 1YW8A 4FWMA 4KHQA 4J6WA 3OHRA 5GAOm 4FZYA 1RPWA 1PHTA 4II2A 4PIIA 5CYQA 1A5WA 1RDDA 2UUBK 3T5XA 1QLYA 1TK0A 5JVGF 4BHCA 2K9GA 4PFOA 3J7AO 3G4ST 3EG1A 2PJRB 1G99A 4B8CA 2M9UA 4B43A 4BBSJ 3VPRA 2KQRA 4MHGA 1USSA 2YUQA 4XU2A 3CCSQ 2VUMJ 2RN8A 2HPIA 5LHHA 4B9WA 3GF2A 4HT8A 4P9FA 2BEOA 1JUMA 1YE9A 3M56A 3FXUA 1WX6A 1VQ7N 1N32K 3CCEA 1K4TA 2A37A 4JYAK 1Q81C 3M5RA 1M90U 3ZCOA 5LJ3e 3NTIA 1U49A 4UVCA 3FHZA 4I99C 3I56T 3T0YA 1YI2T 4EJTA 4GVMA 5HLTA 5HROA 1ZN2A 2KAFA 1U48A 2WY7Q 4E7ZA 4CF2A 4E6RA 3V9SA 2WV1A 2XD0A 2V26A 1KC8U 4BY6B 4IZZA 4A3LJ 4BACA 3SAHA 4CJRA 3TDUC 1K8AU 2X3XD 1IRZA 2RA2A 3EAEA 3JCMP 2EGAA 1D3BA 1X3NA 3A0BC 3BY7A 1T8EA 4B9MA 2D0NA 2YRDA 3CETA 1LOTB 4DYQA 4GLMA 2E12A 2BZ8A 4DBFA 3KKRA 1YFHA 4M7DE 3OGDA 2NUTA 4HT9A 1SKSA 1QCNA 3KYLA 5LJVA 2OPTA 5B66C 2E1ZA 1VA7A 1OH5A 2E41A 3INZA 3SZGA 3WE3A 1LDDA 3FBNB 2QYOA 4HQEA 3KLOA 2CV2A 2XKOC 4ZN1A 4M75D 1BKBA 2CP6A 3MAQA 4N9IA 1EWQA 4W5OA 4AF1A 2GA2A 3JCMh 5E3LA 4RWTA 1ASUA 3V7SA 1XCVA 4JS5A 2AO9A 5F64A 2YUOA 2DMNA 2RNJA 1BR1A 1BL0A 4L9NA 1KQSM 2W57A 5FROA 3WU1B 1D3YA 2NWMA 2RQUA 1QZEA 5A0LA 4KHWA 2OCCH 1QQOA 1WJSA 1QVGP 3AVFA 3D2FA 1O3RA 4JKBA 3CCQI 4A0ZA 2Y0SN 3A01B 5D6FA 1KQ2A 3ZSYA 3QPSA 2YR2A 3O5ZA 1OX9A 2K5FA 4O6JA 4BRPA 1ZH5A 2DXTA 1WHLA 4PJNA 1NM1A 4UUVA 4FVUA 2JHNA 4B3TK 3CPWS 3UATA 4F55A 2C6YA 4RKUE 4EJUA 1G5VA 2IA2A 4PJJA 4JI5K 1QE1A 1JJ6C 4N4GA 4CJEA 1QWEA 3CC4I 3LDOA 5LRRA 2GOXB 1B3QA 4FPAA 3S15J 4C8MA 2F8SA 2ZMEC 2AZVA 2XAUA 4ISEA 4E1NA 4MQ9F 2X0LA 1VSMA 4JI4K 5J2QA 2KFZA 2YWWA 2X1DA 3AVLA 1WHUA 4MZPA 3FWEA 2P9LA 1BGXT 4I9LA 3UT1A 3V8JA 3AGRA 3WTSC 1XWLA 4F2SA 3DXMA 2ZO4A 4N4HA 3EFRA 4AVPA 4XTWA 3M1FA 5GAMe 2ATQA 1NYGA 1WSHA 4LSLA 4A6EA 5IN1A 4LLLA 1FYNA 5HP1A 1HF0A 4QKUA 2CG4A 4CCKA 2VVKA 3JAME 5DUKA 2DE0X 3Q1JA 4TV7A 1WLJA 4KMUX 2QENA 1IF1A 4PL7A 2M16A 1JUPA 3MEEA 1VQKA 1I50J 2RE2A 2KKOA 1AT1B 3SQ1A 2DRMA 3FF5A 3DCFA 1NH3A 1QCFA 1U84A 4B1UB 5ILSA 3I4PA 4BRCA 1W4MA 2J6OA 1W2BA 1HKBA 4IUPA 1GFCA 3OW2M 1MNDA 4FLZA 1ZG5A 5BREA 1T0HA 1TUYA 3VPZA 3QNOA 3K4JA 3PQJA 3X28B 2HNYA 1VSDA 5GANj 5AQIA 2P9PB 4UOBA 4DCHA 2QKKA 4M7AG 4DB3A 3H0GJ 4HWIA 1ACIA 2L0KA 2I5WA 4PJ0C 1GLBG 5C15A 2K3PA 1KU3A 2J6KA 4PJMA 2ZJPF 4PWDA 3AA5X 3N05A 4LDVA 3WTWC 3MFKA 5GAGJ 3SJHA 4ZTFA 4M77E 4XN3A 1B8IA 3GTKJ 3K57A 4FSVA 3FDRA 3LLRA 1QZ5A 3FXLA 4DYRA 1VQ5N 1HLVA 4DTJA 1IGNA 4RAGA 2KRFA 1TP4A 2D1XA 4KISA 4YOTA 4NYNA 1KG2A 4M78F 5CE3A 1WGXA 1ASVA 3K4CA 1XMXA 3CCUT 3HFOA 1NE8A 2H56A 5FO5A 1BOAA 2CW0F 5J2PA 3JV3A 3JCMd 3HOZJ 1X6GA 3HVTA 1FSHA 1FSEA 3G4SQ 3ZL7C 2JVVA 1KQSS 4E9FA 1Y39A 3CCQT 5IT9K 2WSEE 4BVPA 2W48A 1QVPA 1TK5A 1PUEE 4A12A 1IC8A 2HQXA 3MEGA 2HGCA 2LNBA 1U47A 5HVQC 2DBMA 3FZKA 3CQYA 1CSKA 3A2FA 2XIDA 2EA2A 3ZT0A 1JEGA 4JHDB 1ZGJA 3ROUA 3QP6A 4DIQA 4FWQA 5CKHA 3I56Q 4CHYA 2BW3B 1YI2Q 1VQMI 2F2VA 2JA2A 3HSBA 2O8BA 1FYLA 1VQOA 5H6RA 4GGGA 1TBXA 3LH0A 3RTRA 2YHBA 3O1WA 2LFBA 3SZPA 3S1NJ 3RYRA 1IJWC 3H36A 2JWKA 5M1PA 3IDHA 2XDPA 1MMGA 1OCPA 3CMEA 3FGUA 1R36A 1HKSA 1T6DA 3QO3A 5J39A 5FLMJ 3A0IX 1WA7A 3VGKA 4Q48A 4JD2B 3E6BA 1Q8IA 3MCPA 4DV4K 2EFPA 3E01A 1M9SA 1VQ7A 1NK3P 4J9FA 2OYQA 1IO2A 4FJKA 5ELZA 2NRRA 2O8CA 2E5KA 3BEXA 2CZ7B 3H41A 3B02A 2CP2A 2ZGWA 2HMAA 4RB3C 1T3LA 3WVEB 2HBJA 4F04B 4EHTA 4EIKA 3JCMb 2UUZA 4LD0A 3WHBA 1UEBA 4WWCA 4HSRA 1GV2A 3EZWA 2QTDA 3V1OA 4JKEA 2GTDA 1UHCA 2DL8A 2LJ0A 3VUZA 4NOYA 4IO8A 4JX6A 1XNRK 3TAQA 3PSIA 3MP8A 2XSJC 4CF1A 2WONA 1W0UA 1HXDA 5FGMA 2HPMA 1CGPA 3H0FA 1Z25A 3LCNA 2NYSA 5AJ3K 5KRTA 3SV4A 1DPRA 2LJ1A 1K1ZA 4TVRA 3MJXA 2E3IA 4FW2A 1RESA 2G8WA 4A3BJ 3HGGA 4XKCA 1QU3A 2K5IA 1R1UA 1XS9A 3W6JB 5K5OA 3LSJA 4D9JA 4HNVA 2C0IA 4S05A 4YFNF 3K1NA 4KNYA 5BPDA 4DJAA 1WH5A 4DSJA 3M0QA 3MEAA 3CCMA 1NJIC 3J7YJ 4V19K 1QWFA 1TL1A 1BJAA 1DIZA 2DA2A 2FX0A 4BRFA 3HFNA 4NS5A 2W82A 4MFBA 4OMPA 3U21A 2Y0SA 4PLLA 4ZDPA 5GAN5 2FXUA 3O6BB 3CCUN 2V75A 5A2QK 2EINH 4BJTA 3OA9A 2BY0A 2EV5A 3LDPA 1X3WB 4KH0B 1IN8A 2KEAA 2JTFA 4XIUA 2Z99A 3VS5A 4IRGA 3MD2A 3ZSWA 1VK0A 1PSEA 3EYIA 3ZSZA 4AHRA 2HZYA 3SDBA 3L2RA 3RESA 3UF4A 1FT9A 1HYSA 4K0KK 2MMPA 3H6ZA 4MTEA 1UCRA 1TG0A 2EQUA 3ATUA 2HAXA 5CIUA 3FIWA 2ZZDA 4DU1A 4HA8A 3ZSXA 1AA7A 1JB0E 1GBRA 3SHWA 2LC2A 1TS9A 2FF6A 1N77A 2KRCA 2ZJ2A 3BG9A 3EQLF 3G71N 1TKTA 2V1DA 2VKEA 3SJMA 2Z33A 5JHUA 4JOMA 3CG7A 2O8EB 5M5YJ 4C5HA 2F9WA 1M3QA 2O8FA 4FJ5A 4B3XA 2LSNA 4FIBA 2YU3A 3X24B 5FRMA 3KD5E 1BIAA 1U6GA 2AQFA 1VQ4I 1NK7A 5E1WA 4M6VA 2VGMA 1X6BA 3NF9A 3CWSA 5LJ3f 4IF4A 1D5YA 2JLEA 4NB4A 2Y31A 3S16J 3SMPA 4U67L 2M4KA 2ABLA 4CD1A 1UAAA 3HSFA 1B9NA 4FT8A 4UUTA 3W6VA 4UV8A 4QSHA 2RGVA 3HZJA 2LZ6B 1OYWA 2K3YA 3GCMA 1LEAA 4XQ3A 3REOA 4KT5C 4F16A 4AIKA 1N8RR 5DY9A 4Y1DA 3CCUQ 4KHUA 3BT9A 1LCKA 1A04A 2DMTA 4XQFA 3AO5A 1SZ2A 4I2PA 2FD5A 1IJJA 4UXNA 1T0FA 3TU4K 1TWBA 2COWA 4NNJA 2QWLA 1Q86U 3K1MA 2WADA 2H1LA 4KB1A 4RGSA 2Q0OA 3BG6A 1XC3A 1BOTO 3PFYA 3CCRN 4CCMA 1NJYA 5ADXA 2ASMA 3NHNA 1E6GA 3A1YA 1IH7A 3GO5A 2CUZA 2BYVE 1PKSA 3F5TA 3QESA 1O3QA 2O61A 4FYXB 1WLPB 3IMXA 1VQ5A 3D6RA 3O1BA 1ZQ3P 4PJOG 3QIOA 2HNDA 1TOVA 1K78A 2YJFA 4DSLA 4J5YA 2FPDA 1YP5A 2Z0WA 5AZJA 1T3VA 2K3FA 3BPXA 5HL7L 4EMHA 2B0LA 4XMYA 5J1YA 3O9UA 4BUGA 3H5NA 2PMHA 3O9SA 3FXMA 3PIPL 5EJCA 4E89A 1BBYA 4LOCA 1KQ8A 3M58A 4M6XA 4G7HF 4M71A 2YNFA 2NYXA 1QPIA 4OPKA 4A3CJ 4BI4A 1P7JA 4IOAF 4OO1J 2XUBA 4WE1A 5HBMA 2RN2A 4J2BA 2QAZA 4CEFA 2XAGA 3HPHA 4KV8A 4IDKA 1ZBSA 3V7CA 3NGYA 1IBMK 2FNPA 4AVZA 1DTQA 5DM7F 3CCVT 4KAZA 2KRMA 5LLQA 1WSUA 2PN6A 1OZ3A 1XTDA 4OB3B 2QSHX 1AWJA 1TQMA 1PYVA 3ECHA 2OANA 5IXFA 3EGUA 1GCQA 1S9GA 1WQ7A 3FE1A 4L0ZB 4MDWA 3VYUB 3ZSVA 2PU9B 2WB1N 1Z9ZA 5LJ5e 4ELVA 1OH6A 2D8JA 3VS6A 1Q7YO 1N39A 2PYJA 2J4RA 5ILVA 3MMVA 5I22A 4RBOA 3D5SC 2K2VA 4BBRJ 3C18A 5GAMf 2Q1NA 4J8OA 1VQ6T 3CUQA 1S5JA 3VS3A 4EA4A 1SAUA 4KN4X 1UWBA 4KICA 1EF4A 5J26A 4C8QC 2L9VA 4IXAA 4AM3A 1GOCA 1QVFS 3FXJA 1CQTA 2LQ8A 5CKFA 1P90A 2IS6A 3ABTA 1T6CA 3LP2A 4HXJA 1TAUA 1WUAA 4MDBA 2GWKA 2HBPA 4RTTA 3VQ9A 1IHWA 1ETOA 3IUCA 2G7UA 3QWYA 9ANTA 5IXBA 3EKUA 3E9OA 1P4AA 2E19A 4QWQA 2EILH 1X2NA 3OIQA 1JLCA 1ZRDA 4N4OB 5HOOA 1JLAA 2D0OA 1RAHB 1S1UA 3A8MB 3K1PA 2VUBA 3DU5A 4M9XA 1LEBA 3HBLA 3CC7T 1WCMJ 4XTVA 3EHQA 2IGKA 3CPWP 2KT8A 2P5OA 2I2LA 5TISC 4J6YA 1X3UA 3LQRA 1PP7U 4IUVA 5J6XA 1JKQC 2JTVA 4AFQC 2ZJQL 3ECOA 5EG0A 3RQIA 1N36K 2MAMA 2WAQN 2FSJA 1KA8A 1V4RA 4OB2B 1GVDA 2AJQA 3OSVA 2WACA 4RMNA 1AKHA 4FX0A 2ETHA 1ZSGA 1C1CA 3DEEA 1R4NB 3BJ6A 1AWXA 4FHTA 3AO2A 1VRTA 2MD5A 3BROA 3RDVA 1M90R 1UGSB 4UC4A 4B8XA 3GLXA 2FU4A 1S22A 4S04A 1NKEA 2DAOA 2D0QB 2CMPA 2ZXHA 3MVPA 2FPEA 2CZ1B 2CO5A 1KU9A 2FZCB 2FSNA 3AA3A 3F73A 3N5BB 3CM6A 3HRGA 4DSKA 1KC8R 1WNLA 4GCVA 1NGFA 4EZ9A 3O3HA 3ZQIA 4A5AA 4GV9A 1K8AR 3C6TA 2QUFA 1ZRCA 4FM2A 1SSHA 4ENJA 4LDXA 4A59A 3DRRA 2CGPA 2ZPHB 2A6HF 2HFHA 3MKLA 2QGFB 4AHSA 1FY7A 4B44A 2RQPA 2XAJA 4KHYA 5F08A 4DK9A 2JS2A 1RNHA 3EGXA 1ZBXA 5BPLA 4J9HA 2EYWA 1ZGAA 1F1BB 4J01A 2HKOA 4CZKA 3BOQA 1UOCA 5E84A 4DG1A 2BE2A 4MGRA 4CEOA 1IAWA 3QB0A 3P8HA 1V5EA 1TUCA 3G71A 4HVWA 2JPCA 2EHGA 1YJWI 1XMKA 1NU0A 3O3KA 2E71A 3PX0A 3MN5A 3JTGA 2NLUA 4U0WA 4DTSA 3ABUA 3T9NA 2VWBA 3E19A 2MFZA 4M77A 4AHUA 3V9XA 3OH6A 4DOWA 3R9PA 3VS0A 2KXDA 3IH2A 1HOMA 3Q7CA 3UPUA 2E1CA 4HCBA 2P9KB 4CEAA 2RREA 4IJNA 4PKHA 3RI4A 1LJOA 3KIOA 4JPBW 4ILJA 5LJ3h 2M2EA 2HKXA 5TKYA 1I1GA 1RT7A 3GBGA 3VEXA 2O7OA 2H8RA 2LX9A 2KHOA 4J9BA 2OTLI 3HSEA 5DM7R 4IUTA 1S1XA 1WJCA 3MKZA 3ZPLA 3C1DA 1K73C 3CCRA 5J8CA 1VSHA 4JJCA 4PA1A 2DN0A 5KYYA 2VWFA 1FKOA 4PFZA 4ESFA 4G9YA 2O9LA 3CCLI 2ATCB 4X1EA 3HM9A 3MZHA 4K43A 4O44A 4BE2A 3QICA 4M75F 1N25A 4Z4HA 2CW7A 2WOMA 1NJXA 3CCVQ 2D4WA 3ITHA 1JBMA 3F10A 3SDGA 1RTHA 1VQLI 3U3YA 2PVDB 4IBNA 4GO1A 4RM2A 4CFDA 4CJLA 4KH4A 2ZPBB 3E9FA 5BQTA 4HW0A 1A5VA 3ULRB 4HCZA 1FOYA 4OMQA 3CM5A 4HF1A 3BTJA 4FZZA 1I94K 2F4OB 1B1BA 4B9VA 2EQJA 3N97A 2LCSA 2DLLA 3G0QA 4DFKA 4YNQA 1QQIA 2LOOA 1SG5A 2AQEA 3HBTA 2BANA 1UTIA 1VQ6Q 3KNTA 1HNWK 4FJ7A 2Q0UA 1SAXA 3U9DA 5AQFA 4BG9A 1G3SA 1I1SA 2KFNA 1NGNA 1X1BA 2MBFA 2E2NA 2FZGB 3LYIA 1KONA 3PFIA 2QWQA 2XPVA 2PVGB 4E7KA 1YHQT 3JRDA 4UUSA 3S3MA 2WB1A 3EKSA 1YT3A 2BY3A 2NOHA 1XGOA 4EGZA 2E6NA 1SRLA 2E36A 3CCJT 2BY1A 1FMKA 2X51A 3OW2P 1FMVA 3F6VA 1MV0B 3L8BA 4BRQA 4QVDA 1W36C 1LDJA 2DA9A 2ZKZA 2NUPB 4LDUA 2MWPA 1P6RA 1M1KC 4A3MJ 5CR2A 1OPKA 1YJWT 3E5UA 1QRYA 2FBYA 4DW6A 3CC7Q 4BQQA 5FLVA 1NNEA 1TZLA 5GAHJ 4CZZA 2KROA 5GAMh 4DUYK 1K0SA 2ID6A 2DK3A 1NGCA 2CH6A 3IAYA 2KXCA 2FNAA 4JKDA 1Y96A 4XTXA 1D9DA 2UUCK 3ZGKA 2LC4A 4NBQA 1M3AA 4V2GA 3OYKA 2X4XA 3QEIA 3G1LA 2P4RA 4ESRA 4O55A 2BHYA 1OKRA 4OMMA 3IWZA 4F93B 1VSLA 3BDPA 1RLQC 2HMIA 2DT7B 5C25A 4YOUA 4LF4K 1ZUYA 2A3LA 4M3UA 3KX2A 4IOCF 4EFHA 3LZJA 5IT9Z 4H0TB 1BHLA 1XMAA 3U6FA 4RCBA 2WAQA 4RCCA 2OFKA 3L4IA 3QPTA 3MEUA 3OJSA 3CP2A 2GXAA 4FYVB 3BQYA 4ATOA 2FOWA 1LW0A 1RILA 4EMKA 1KD1O 1ZKGA 3S1RJ 2RHUA 3KEOA 3GP8A 2R5ZA 2OAZA 4I9QA 4H5VA 3K70C 3WEEA 2PMUA 1K61A 4DEYA 4LF5K 2DOFA 2HKQB 1VQPN 1PD0A 2BZTA 1R4MB 1VQLT 4NC7A 2Y90A 4CXFA 4N0AC 1V55H 1KYWA 1QVFA 4LB5A 4YFXF 1MJ9A 2M7BA 4Y92A 1SKWA 2YNIA 4EGYA 3PGGA 2QWOA 1YITN 3A8LB 1YVNA 2ZF5O 3QU6A 4H5NA 4JP0A 1NWKA 2EBIA 2O4XB 3KZBA 2R5YA 5EC7A 2YUPA 1LNWA 3CERA 3FMSA 2HYGD 3E9PA 4J9GA 3JCMQ 2E1HA 2HHSA 1IUFA 4KGVB 4AQYK 3P4IA 4I09A 5I9EB 5FKKA 4FXDA 3OA6A 5LHIA 3KZIC 3TTFA 2D1KA 2BZYA 3IRXA 2ZXWH 4JI1K 3FISA 5GJWB 4LY7A 5FPEA 2H6CA 1QO0D 3G6EI 1UHWA 4E6KG 3WUHA 3KP5A 4RG2A 2QKBA 4IO9F 2RB6A 2P4WA 3EGDB 2W04A 3LA3A 4EQQA 5LJ5f 3LDSA 1T2KA 2DY4A 3ESWB 2GLOA 3BJOA 2CGJA 3QLHA 4CGGA 3EN9A 1QHGA 2LQWA 2A3SA 1BQNA 2V52B 4CI6A 4CZCA 4KULA 3KLGA 1ZREA 1C6VA 4L5JA 3RMSA 4PSWA 2L7ZA 4F91B 2BGGA 4JI8K 1MSFC 1ABQA 2IVMA 3CYMA 3IV5A 1J5EK 5LEJA 4M7AB 5HLGA 3BF1A 2DT6A 1E4GT 4FWPA 2DYBA 4GMJB 2JMCA 1BA1A 2EJRA 3I55A 5LD2C 3TW7A 1RT1A 2A61A 5CQGA 1S7EA 3J7ZO 1LQ1A 3GZ6A 4LUEA 4LIVA 5F2RA 4LFBK 2DFIA 2NOJB 4M7AC 3CJCA 1BL3A 1ZHFA 1ATRA 2VL8A 1HQUA 3HP9A 3SMSA 2JGUA 4KN7X 3UDCA 1BA0A 4KFBA 3L2UA 2QSFX 3K4LA 3AVIA 3DTEA 4YFUA 1U2VA 5GAN8 1NLPC 1S6QA 2VB6A 1ULYA 3DAWA 1TWAJ 1GXPA 1YN8A 2RI5A 2JWLA 3KVGA 2P9UB 4JJNK 4BC4A 4CJTA 3QEXA 4B3MK 3SHFA 3E7LA 1YTUA 4M3EA 5HLIA 4M72A 2XDDA 1RAGB 1QZZA 2QEXT 4OMLA 1XQPA 1YHQQ 4J83A 5FPMA 1N9SA 4A57A 1Z1DA 2QA4N 2L2PA 2HDCA 1QKWA 2GF7A 3B6AA 1XGMA 3CCJQ 1R22A 3LSRA 2IPQX 2EZIA 2RHXA 4BR5A 2JUCA 3CDLA 3KBGA 5FDLA 3ID6A 3VSKA 5LMUK 2B86A 4RTZA 2W4SA 5GTHC 1TQPA 1RNLA 1YJWQ 4C0GA 4DBHA 3I8DA 3GW2A 4F2RA 4KTQA 4B1RA 3AVKA 1KG3A 3CD6T 2L4MA 3LA7A 1T0JA 4J2DA 1Q86R 3ZSQA 2DOAA 3E6DA 1XGSA 5C44J 2CH0A 2DD4A 3BDDA 1MV3A 3L6QA 2P9SB 2QWNA 2P6SA 1K4US 1EXQA 3T3FA 3HK2A 3GZNB 4B9UA 2NS0A 1PCXA 4BY1J 2O88A 3K9JA 1YJNI 5J4YA 3SK3A 2WBMA 4XLCA 1Z26A 2G6FX 5JS1A 2E64A 5FKNA 4HX8A 3TSZA 2VPLA 4GY5A 2P51A 2HCKA 4OPAA 4HLXA 3M6GA 2HXOA 1WQ2A 2CH4W 1O75A 5KGXA 3R8EA 5KE3A 3NTHA 2LBFA 1NG6A 2K4BA 3HTRA 4A5MA 4FJ8A 3SBTA 2ZJPL 4XL9A 3DI6A 2OPQA 5E8GA 1FBUA 1W5SA 2R4GA 3OIPA 5F0CA 1K8KA 2YG8A 1WWXA 3URGA 3CLQA 1VYTA 3FMRA 3ZOBA 1YX3A 4OKJA 3TAMA 4MLHA 3KWIA 4I0AA 4II3A 3M9AA 5HK0A 3CFRA 3M8PA 2M87A 3OYMA 4LF9K 2EVRA 3J7AY 2MC4A 1BI4B 2VE8A 5TGTA 4B1WB 2KMUA 4I2OA 5DCMB 1MDMB 4M3ZA 3OSFA 3VYGA 2WUSA 2DCEA 2XKOA 1ETKA 2Q1ZB 3P9IA 3TP3A 4C8QE 3GBQA 4XLAA 3VEPA 4PKCC 1X27A 2K7LA 2OJED 3EY1A 3L3UA 3EG9B 2HNZA 3KLFA 3K70D 2AHQA 3F8MA 3M8EA 4LFUA 2VYPA 5IT9O 5F0HA 1VQPA 4C0DB 2JA6J 3FDYA 5AQKA 3FIFA 4RTWA 3JCMX 4LFCK 3WNHA 4CE9A 3H92A 1GT0C 5ADXH 5FWCA 2HOTA 4H0VB 1X19A 5AQQA 2CQNA 2EBPA 2I5UA 3VQEA 4MZMA 3R6SA 1YITA 5F0FA 3RMDA 2X6OA 3HOXJ 2IVOA 5C2FA 3BUZB 3CMAI 3HT3A 2DQLA 2JUFA 2NNNA 2HEQA 2W6KA 4GW6A 2HHUA 4Y13A 1U4BA 2BKDN 4R1HA 3CC4N 2HYJA 2P5KA 2OTJT 2VT2A 1VQ9T 3RR7A 4OVLA 4A3GJ 1BW5A 2ZMEA 3R4KA 2RVCA 1SFUA 1BDGA 3IL2A 4JRIA 4W5RA 1X6OA 1VRUA 2CGHA 2B8AA 4RGXA 2FLOA 1DEJA 3IAM2 2ENMA 3VQDA 3DB4A 4BGAA 1Z67A 2RMOA 4HAMA 3V42A 3ERMA 5ERIA 3K4MA 2JN0A 1RBTA 1B9DA 2WC2A 1IG7A 4FETA 3AVBA 4OIRF 4FLTA 5LL6Z 4EATA 2MGQA 2A6TA 4K25A 1JT6A 3PVLA 3QDKA 2GNCA 4ZYDA 2EQRA 4XH1A 2FRWA 4CECA 5LJ5h 1VQ8T 3SWNC 4MTDA 3DXJF 1YIJT 2R7RA 5KNLA 3HHTB 2IGIA 4CK3A 1YQKA 1LFUP 1RAAB 2ESHA 1ATNA 2FXAA 2PEXA 2ZNZA 4OLBA 3WXIA 2G8KA 1EH8A 2QW9A 4KFCA 4ICLA 1VSEA 3IG1A 3WTXC 2M0YA 1BBZA 1RAIB 5JVTA 3PNYA 4M7AD 4M3WA 1R1TA 3HOYJ 2QEXQ 4PJOB 2MSYA 4BKXA 3NH2A 3S3OA 1RUNA 2OZMA 3DLLF 1T38A 6PAXA 1LNXA 1ODDA 4Q5SF 2HVSA 4AIJA 3WG7H 2VG7A 4F3TA 2DTZA 3OOPA 2VV5A 4CCHA 1D1CA 2TRTA 3KK1A 3R0AA 3RZDJ 3H9NA 4PJOC 1NK4A 3FLGA 1Z9CA 2Y9YA 3I0SA 3LSGA 1EIFA 1O1WA 5K5RA 4F17A 2Y1JA 2CQQA 5KYXA 1KG1A 3CD6Q 5A2QO 4CJFA 4CJ4A 1W7AA 2GXBA 4C3HJ 2ZXIA 4JZ4A 1YTYA 2XHIA 1KEAA 2YHWA 1MH4A 5EEGA 1JCFA 1WN7A 2UXBK 3ONQA 3MCAB 5CYMA 1JCGA 2QA4A 5FB2A 1Y7XA 4KH6A 3WTUC 1ZYRF 1K0XA 1YO5C 2Z1HA 1C1AA 1W1WE 2VQGA 2W24A 4F7UE 3F72A 2FBKA 4ZJZA 1YYVA 3VTHA 3FMQA 2VQLA 3TI0A 4N76A 4QQGA 1M3BA 3TDZC 1HW2A 2DXUA 4LF8K 5F1XA 4NLBA 3HPWA 3HPGA 4XR6A 2FPFA 4HVUA 2RJEA 1JKOC 4C92E 4K41A 2HW3A 1STZA 2OZUA 4PKGA 3M4OJ 1JJ2M 1DDNA 4BR2A 3GMEA 3E6MA 4GYIA 2LY1A 4BXFA 4F4KA 3FXQA 3EL2A 4E7IA 5B3SH 3VDXA 1QKXA 3JSPA 5KYUB 2OTJN 3CJAA 1KD1C 1XMQK 2H1KA 3W2AA 2FE3A 1WEGA 1YUWA 1EQYA 1XMOK 2NOGA 3FZVA 3ZP5A 3WHCA 1AZEA 4L8RB 2HOEA 4CGFA 1TAQA 1RTDA 1WFWA 3W0LA 2LF8A 3F8BA 1OCOH 4FW1A 2JRTA 4FQGA 4LG0B 3RMBA 1I6HJ 3FC3A 2YG9A 1LE8B 4ITVA 1WJQA 1IB8A 2XHKA 3QYFA 4AH9A 3VUBA 2YRCA 4JD2A 2QGUA 2HVQA 2VXDA 1E17A 3JRBA 4KGXB 3JCMe 2D6FA 4CJ3A 1D8KA 2VCPA 2R7TA 2IS3A 1T98A 1FNNA 4MEYF 2V9PA 4XIDA 4FM4B 4XLPF 2WAFA 1H3HA 4DQIA 3C65A 2CZ0B 3HOSA 3NMZC 1D4XA 4EIAA 5GANd 5A0GA 3O3GA 1BM9A 3QHSA 4MDXA 4FK0A 1IDYA 2ZAEA 2DJQA 4Y52J 3DLLA 2F4MB 2EIFA 5GMKe 3A98A 2KI7A 1ZG3A 3L9FA 2R7QA 2DM1A 3EH2A 1X2QA 1W0HA 2YPRA 4LIUA 2KJCA 5GINA 2CS3A 3GPLA 3J80K 2DZ9A 3LM9A 1VYVA 4LD9K 4Z4FA 1F36A 5IT9E 2NVUB 4RS8A 1PVEA 2LY9A 2FMLA 2OTJQ 3HEFA 1VQ9Q 5C10A 4NL2A 2IVNA 2JVGA 2VC1A 4C23A 2NUZA 4HSTA 3OMCA 4H0XB 3CCQA 4X34A 1TL8A 2K9NA 3OYEA 2LF7A 2DIGA 3BR2A 3M0RA 3RMAA 3WTVC 2D45A 4M7DG 2FSWA 2UXXA 2Y30A 3P9CA 5H6QA 3TAFA 3DXKA 1C0MA 3PNWC 1JGGA 2NRTA 4B1ZA 4DV5K 4BRGA 1HYOA 3D7EO 2MG4A 3CWTA 3MZYA 1RTIA 3CCEI 3GXOA 1CZAN 3PY8A 2H09A 4P9UA 5CQXA 1YJ9T 2LMDA 3CC4A 5GANg 1WEIA 4GDFA 1VQ8Q 1HDPA 3O4WA 2XASA 1YIJQ 4JRPA 1WDXA 3HL8A 4R56A 1M90C 3D5LA 5KPZA 3PJRA 1BK2A 5BS6A 3FZFA 3AARA 1Q82R 4IHXA 5JS2A 1X1DA 1YFNA 1YWOA 2WSFE 1WI9A 3W2VA 3GF5A 1RABB 1JJ2S 3F3XA 1J9IA 3RKYA 3WQTA 3BWGA 5GAOp 3BG7A 2DJNA 3JSMA 3M1CA 5C42A 5FFZA 3GLLA 1KC8C 3QBWA 2ISZA 2P8TA 3MWTA 2AKKA 4BH9A 5KCMA 1SMTA 1Y0MA 5IHIA 4C5EA 3EG0A 2V6EA 2X35A 1A6QA 3QO9A 4MNUA 3GX4X 2J06A 5DM6F 3EUHC 5L3GA 2W10A 3CEYA 1VQ4N 2Y9ZA 4CEBA 2ZFUA 3E1SA 3E5QA 3HXMA 1V76A 3AA4A 2E2JJ 2P7VB 1IRFA 2O8EA 3H35A 2HQHA 4A53A 4GLKA 3UKUA 2OQRA 4MFEA 2A3ZA 3ZMUA 3OYBA 3K0LA 1DU0A 1LFPA 2HF4A 1H9GA 4G9ZA 3AG2H 2PUKB 4HVJA 3FZLA 5EZGA 1APLC 4PGHA 3OBWA 5AQTA 4MQ3A 5CKBA 1QZYA 2OV7A 4IRIA 2EFOA 4LE9A 2A05A 3D2EA 2KZMA 2FG0A 2WBNA 2LH9A 3BZ6A 1XPXA 3VS7A 2WC9A 4DUZK 3A4CA 1ZYQA 5H20A 5DD8A 2FC0A 1Q7YU 3CC2T 3UKRB 3RKQA 3V9UA 2JS0A 3CQ8A 1OR7C 2JVHA 3FJ5A 4PJOD 4BVOA 5A2QE 4R55A 2VKDA 2XY5A 2HZDA 4GV3A 3MWPA 1TH7A 3O8MA 1E3PA 1Y0NA 1LFBA 2J6FA 3I35A 2FQ4A 3LW5E 3JRCA 1RCHA 1S72T 2JQ7A 3MX5A 5GMKl 1RFQA 1V5FA 4L0YB 2AP1A 4O8KA 3EG2A 1EKEA 2HOAA 4OFEA 4GVEA 4FT4A 3B6CA 4ZH4F 2ZB9A 1N6QA 3FK6A 2RPIA 4NQWA 3L09A 3TAEA 3CMMA 5GMKm 4LD6A 4K11A 1KSWA 1HSJA 4CO8A 1KFZA 5KK1A 3I5RA 4M77G 2KDOA 4ZGDB 4RM3A 5JICA 4AC0A 4ZDOA 1QVGS 1HK9A 4PHTX 1VQKI 3CCET 4QTRA 5JLHA 1VQMA 1VZ0A 3EFOA 4UNOA 3LSTA 1OFCX 4V2FA 5L3DA 3T69A 1R5HA 2KJBA 4M3DA 4EMGA 3RUXA 2MK5A 1LWCA 2KNBB 4DR4K 4IXCA 2X48A 1HKCA 3CCSI 2F1LA 3CXCM 1SS6A 2ZFWA 3VYSB 1N8RO 2HNHA 3WXLA 1M3HA 4QPOA 3ZMSA 3O9TA 2FBHA 3CBMA 4UY8O 2M0MA 4S0HB 1H3ZA 4IL6C 4FVMA 2RHIA 4BQZA 1JKRC 3QWXX 1SKUB 3KD1E 4C8QA 1XI1A 3TBIA 3SPZA 3VQBA 3HJFA 2Y4XA 2Q2EB 1B34B 2J5PA 1DGKN 1Q1HA 1LMZA 2LY2A 4CW7B 1QHAA 3JXUA 2JW4A 2NXNB 2ZJRF 5DMRA 2DLPA 2EWSA 5HS9A 2JZYA 1SFKA 5GTIC 1J53A 2O9VA 4RLFA 1RDWX 4HLYA 1IW7F 1OCCH 4AG2C 4BE1A 3J7AP 1MUYA 3GG4A 4XN0A 4BD3A 1SEUA 1R1VA 2VWJA 4II1A 3VYTB 2A6EF 2E1MB 1ZBUA 4FLYA 4JBAA 3TPQA 3MEWA 3V4IA 4DKWA 3CC2N 2E20A 3JB9G 2VBWA 1ZTRA 3J81K 2E2OA 1YJ9Q 1MBKA 2C0OA 1LUJB 3QBXA 4CBXA 4YOVA 2EIJH 4OINF 2CW8A 5CKEA 1ZGWA 1PNJA 1BR4A 1U5SA 1C1BA 4MO4A 1QHHD 1FIAA 2E1MC 3TWHA 5J47A 1XHXA 3PFSA 1O13A 4Z94A 4M3XA 2PUOB 2QDLA 1W7PA 3WXMB 4E9HA 3QEPA 1SVLA 1QQJA 3LDNA 1I3AA 3A02A 4JK9A 2XB5A 5LJ3g 2QLZA 1T3SA 2KIUA 2FBVA 2MW8A 3C2HA 3BR1A 2MWOA 4KMFA 4FJNA 4DV7K 3IWFA 3LWIA 3H0IA 3K0SA 1OH7A 2NVTJ 2CQXA 4CYCA 4U88A 3CWUA 4RW4A 2XV4S 2XAQA 3L2QA 1FC3A 1GHCA 4IUQA 3HB9A 2R7YA 5JHFA 4F52A 4FJHA 4U7DA 1D3BB 1SPKA 1Z7UA 3QAHA 2BHZA 4RTUA 4IG0A 2IGOA 2HTSA 4A4GA 3SZ2A 2NUTB 1X4OA 3LSHA 2YHAA 4H8KA 4OP0A 1VQKT 3HTUA 3TVTA 1KQ0A 1XB4A 2Z2SB 2I8DA 2XAFA 5BRDA 5M5XJ 1VNDA 1AD5A 3ZQQA 4FLWA 2W42A 1PU8A 2LJ3A 4BR7A 5FU6B 1XSVA 1Q9XA 3VV0A 3NEUA 2X3WD 2RD1A 2XVCA 4JZ3A 5AFUA 1O4XA 2H6BA 1TKXA 3PX6A 1N9RA 2FEIA 2QM3A 2R7XA 4W97A 3MECA 2KYBA 1G8XA 3CDIA 4M3GA 1VQ4A 3CC2Q 3CXCS 1MIJA 3D2FB 2UYTA 5FU6C 2HDDA 1D8JA 4EW0A 2DFEA 5BPIA 4IX7A 4X66K 2RQVA 4Q5VA 1OCTC 5HS7A 3M55A 2CV1A 5M1NA 2V9KA 2ASPA 3K5MA 3Q0VA 4WXCA 3A8YA 2A6AA 3HG9A 2P5GA 3JCMf 4C3IJ 1WHKA 4RW9A 4W5TA 2XK0A 5K14A 2CS7A 1S72Q 1RKWA 1IKVA 2OTLN 3BFMA 3V1QA 2VQCA 4F7UA 4EA5A 2IC3A 3LOCA 2P9KA 4OMYA 1SKRA 3H3VK 2IIRA 4AHVA 2YS9A 5GPCA 1M3CA 3UNGC 3DLMA 2DTHA 2RC4A 3CF5F 3SUNA 2IT0A 2P9LB 1EV7A 3O2PE 4BR0A 4IWVA 4XU0A 3CCLN 2L5QA 3K2AA 1KVAA 1UFFA 1YW7A 2F4IA 1K8AO 4J00A 3MX2A 2Q0RA 5KQDA 2NOFA 3DP7A 4JRQA 3I5SA 5FJ8J 3DV8A 3CCEQ 4B21A 1ZK8A 1K9MO 3U9GA 2XAHA 3KEYA 3A8OB 1BCMA 3WODF 3MXJA 2VOOA 5LHGA 4I7FA 4H0PA 2ELJA 2RNAA 3M07A 4U0VA 4XICA 3I4MJ 3OL4A 2KK4A 1LWYA 4M73A 4ZYGA 1RBVA 4DQSA 3S9HA 3G4SI 2QBYB 1UGRB 3G10A 2DA3A 4MDAA 3ML6A 1VSKA 1D8YA 2A5XA 1W6XA 1WRJA 4M78E 2X4JA 2O31A 2MF2A 3GFLA 4OGEA 2ME6A 3SBGA 4AYBA 1I81A 1BU1A 1GLJO 1VQ7T 1N5YA 3NE6A 4QCLA 3UE5A 1M4ZA 1Y07A 1IV6A 1B4AA 2M8EA 4FYWB 4IKFA 1RDBA 3JR9A 3I56I 3LSIA 2BTFA 2YNHA 1YI2I 4PSXA 2B9SA 1RETA 2HMPA 3TGNA 2ED0A 4XH5A 3E3VA 3DM2A 4BROA 5GAEP 4XKVA 1L3UA 3VQCA 4XLFA 2L7KA 1KD1U 3ENOA 1X1AA 2EJ9A 1UA0A 4QS7A 5AONA 2CQ7A 1B8IB 1VYUA 4I7HA 1TGOA 5IP9J 5KE2A 5IAYA 4KA4A 3TSUA 3LFKA 1K6OA 1U2WA 1EX4A 2EGCA 1QBJA 4HDVA 3M0SA 3FK7A 1RKTA 3NFAA 3QRFF 3IAS2 1YS6A 3B73A 5AQPA 2GBZA 1DQUA 1XUPO 3TQNA 1LPQA 1G6NA 3H08A 3S32A 3MKYB 1A35A 1XNIA 2FBTA 2NUPA 1YQLA 2RJFA 4OPHA 3LGFA 3D0PA 3RRHA 1LOJA 1KK7A 2W85A 3OMGA 1XN7A 1HBXG 3M54A 3I0XA 4BB7A 4B1VA 4NCGA 3H0DA 3GTMJ 1VQNN 2KHMA 3CCMT 5M5WJ 5CVJA 4M7AF 3RKXA 2IG0A 3I5UA 3MN9A 1G3WA 5HY6A 1FBQA 4FWKA 1NEGA 2ZQBA 3BPVA 5GJVB 1JHHA 3META 1LW2A 2DK5A 3IKTA 2Y2ZA 2R7SA 3VRYA 3ISNC 4CGZA 2KRSA 2KR3A 4WXHA 1PD1A 2K27A 1GL5A 1ZUUA 4BDZA 4AUXA 1M1FA 1AWOA 4D8DA 3THXB 4FOIA 1ITGA 4N4IA 1SD5A 4KITB 4Y28E 3QSUA 3LGLA 2XB0X 1X75C 4BU2A 2PFUA 4O5FA 5GAOl 3IFRA 2DDBA 1E6HA 4IFVA 1XQSC 2HSPA 2P7CB 1GDTA 3WG9A 1S8NA 2J05A 4N0AA 2DPNA 2QTVA 1NZ9A 1UGVA 3RRGA 1JL2A 4O0JA 4MMLA 5FPNA 4KI6A 1VQON 3ZQHA 4WXDA 3EYYA 3ZX0A 3QXEB 4FJJA 1NGEA 4BJ5C 4XKBA 4AT1B 4NZGA 2YRVA 4FOEA 2DI3A 1SQKA 3VS4A 4BS9A 3WGHA 3CMEN 3C0BA 1WHMA 1JU5C 1NGJA 3AVNA 2G9WA 2MH9A 4FWLA 3ZSRA 2CRGA 2RI2A 5FWBA 1KXPA 4MLOA 3L0QA 4FCYA 1ASWA 4X64K 2I5JA 4D0PA 4CDGA 3G6EN 4KUDK 3F70A 1VQNQ 1NOYA 4CYDA 2M1BA 5KQ8A 1IRXA 2A5WA 5CAIA 2KVQG 4EM2A 3F6OA 1BU6O 2CUFA 5L3FA 4EAHD 1ZQ1A 4R79A 4LH4A 3CDHA 4CHQA 1I1JA 4NXMK 4IHTA 1NK9A 3H46O 3RNJA 1SSFA 2F5DA 5E1ZB 1S9HA 1JLBA 1ZR4A 2XHBA 2FEZA 4LMYA 3TOAA 3T1BA 1U8BA 3QOEA 3N4QA 3NRVA 4DR7K 3PO5A 4C8NA 1SEMA 4BY6C 4P96A 3M8JA 5DLQE 3THYB 1KG5A 3OSSC 4EW4A 5IH2A 1VQ5T 3T1AA 4B1YB 3L1AA 2DXBA 3KLEA 3S3NA 3HRMA 1PP8F 2BBYA 4X9DA 4MEXF 4CK2A 4FWOA 4LGWA 1KYZA 5IPAA 3CFPA 2JA7J 3ZQ7A 2OTLA 5C3EJ 2QASA 3ZMTA 4AI4A 1QSLA 3CCUI 5HODA 4PZJA 5D6EA 2OFIA 4FJXA 4K8ZA 4YRVA 1VQOQ 1XDSA 3LAKA 3CCMN 4M9ZA 3HTSB 1WGSA 1TYQB 1OEBA 2JN6A 5J40A 2LQNA 2DO3A 4B9TA 1S6PA 2F4VK 3G1OA 3CMEQ 3CCLA 2GELA 1VSIA 1NPRA 1NMNA 4M3BA 3AHUA 1KVCA 4XRFA 3QP5A 5C4XJ 1EJ9A 3UIQA 1VQ7Q 2JWTA 3F23A 3I58A 3OR1C 5GMKh 1UE9A 1XTAA 4IDHA 2EQKA 2FYKA 4YIRX 2O8FB 2G8FA 4BGDA 4CESA 2L3SA 3MP6A 2IGMA 1ZUKA 3VEWA 3PIOL 2P81A 3G71I 3NDKA 4CHOA 2JSPA 4IHYA 1BB9A 4A93J 4GBQA 3WXJA 4CBUA 3VQ6A 2KZZA 3EUKL 2KMTA 2ZPGB 1V3FA 1MA9B 2NVXJ 2V1XA 2EV6A 2K3BA 3S17J 3AVGA 3A5OC 4JKCA 1Q7YR 5CZ2A 1XSXA 3ZQLA 4DQRA 2P84A 3GOIA 1JQQA 5HLFA 2BUPA 4FWRA 5AQXA 1QSSA 1N75A 2IA1A 2CFXA 4L5EA 1F21A 1YNZA 2WTEA 3M0TA 1S7OA 1WZOA 1YRNA 3UA6A 1T0FC 1YJNN 1WSFA 4MQVA 3CCMQ 1WXBA 1K78B 4CH7A 3QU3A 2DXIA 2F5VA 1QTMA 2YXYA 2CUJA 1KCFA 3PUFA 1AWCA 3VKIA 5FW9A 4ESJA 1YF5L 4JKFA 5FKOA 2DMQA 4DOVA 4PGGA 3LFUA 2TDXA 1ETYA 5JLFA 2VQEK 4DTRA 2EYYA 2DPDA 2IAJA 5CY4A 3DLLL 4FPBA 2IPOB 2X78A 1WHGA 2OPPA 4AIDA 1LWVA 5KYWA 3PNTA 3BY5A 3ENBA 4A6DA 1EZZB 2DVEA 4WFNL 2OX7A 3SAGA 5IOYA 1KAYA 3OMYA 4KIGA 5LGNA 1VQNA 2FSKA 3NAEA 2JJ7A 2O5RA 2BVMA 3S6WA 3LQQA 5AQHA 4ZGJB 1PVSA 4PKIA 5D8LB 3LAMA 5JLXA 4D5CA 3CO7C 3TTCA 1HNZK 5IP7J 3TEEA 2K40A 1XCBA 4G7OF 2M4GA 3MZ8A 3ZQCA 3AVMA 3C94A 4OWRB 2HNIA 3PO4A 2Z16A 4PCQA 4EV0A 1M5Q1 4WFAL 3SZTA 4PJOF 3TAGA 1UB9A 1FW6A 1GLEG 1RR7A 3JB9I 5D6YA 3R61A 4DTXA 1B6AA 5LEKA 4M7DB 1YAGA 5GAOq 5E26A 1ZC6A 1FTTA 1I6XA 1MMDA 4BRDA 2P0PA 1GCQC 3OYJA 5J2MA 2Q8KA 2YSRA 1BI4A 5KN9A 2O8KA 2V8KA 3CUQB 1Z77A 1MDMA 1L0OC 1Q86O 1QMCA 4H03B 1WBBA 3IRRA 1L3TA 1OULA 4C1NI 4XLHA 5AQJA 2W7NA 3OOUA 2O8DA 3VQPA 4Z02A 4M7DC 5AQNA 1S1TA 1TUDA 2VQHA 1HQEA 1UB4A 3F2KA 4FSXA 1ZRFA 1EO1A 3CUQC 3G71T 3CXCP 4MO5A 3X25B 3CMAN 4Z4IA 3H6EA 4ESBA 5AQLA 3JCMJ 2DDAA 4M4ZA 2L9SA 5CVVA 2R5MA 2D5VA 4EVIA 4KGZB 2G7HA 5EEAA 3FHFA 1RT4A 1CKAA 2G8HA 3VN5A 1JE8A 1YQAA 3LX7A 1SVOA 3GNGA 2YCHA 3A1PA 1VSFA 3G6EA 4ID1A 4R0KA 4MFDA 2CZ6B 4FM0A 3I59A 1JUSA 1VQ5Q 1MU2A 3NVMA 1F5TA 4FJGA 3AFHA 1XOVA 4ZC3A 3RYPA 3LL7A 3JRIA 2O8XA 1V29B 2IP2A 1WH7A 1AKHB 4JYKA 1CF7A 1U6ZA 1JJ8C 3ABLH 2PLYA 3N5NX 3HKSA 2L3QA 4D5FA 3HIFA 1ZBIA 2LK2A 2R7VA 3GE1A 1QGPA 1YIOA 2DF6A 3SWNA 4HG2A 3JCUC 4DQPA 4WX9A 2F5KA 4RLQA 3ZMZA 3CCRT 1KLNA 4KRTA 1M2VA 3THWB 4KI4A 1RT5A 3S8PA 1Q82