5FRNA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz419 (compound 4c)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
367
structure length
367
Chain Sequence
DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase
molecule keywords PFV INTEGRASE
total genus 102
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5frnA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5frnA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5frnA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5frnA03
4DU3A 5D6XA 3AVAA 3LP2A 1L5UA 3DLBA 3OY9A 3MP6A 1LW2A 4HHTA 3TI0A 2VWKA 4CHPA 1HQEA 3BDPA 1XC9A 2E6LA 2A1SA 3KKRA 3IG1A 3TAGA 4DFKA 4BD3A 1SUQA 1RBTA 4CJUA 3RTVA 3L3VA 1VSKA 2GF7A 2VG6A 3SV4A 3AO2A 2HHSA 1EKEA 1RTHA 1N27A 4OKEA 3KK3A 4DTJA 3L42A 3SUPA 4L8RB 2L3RA 4FZZA 1I3AA 4BDYA 2YNGA 3VQ9A 3LDSA 2K3YA 3NF9A 2DAQA 3QBYA 4ZTFA 1VSHA 3WNHA 3SZ2A 2I5JA 3AVMA 1VSDA 5HRNA 4H8KA 1NKCA 4IBNA 2HW3A 4QQDA 3WNGA 3EAEA 5SZTA 3ZSWA 1RT3A 5T7BA 3OJUA 4AHVA 3TWHA 1NJWA 2RKIA 2XO7A 3EYZA 2G3RA 1BHLA 1JXBA 5JS2A 3NCIA 1BCMA 4M3TA 1JLEA 3SD4A 4J2BA 4HCZA 3H6ZA 3PNWC 4QQGA 1A5VA 2Q3SA 1NK0A 1HMVA 1GOAA 1KLMA 3OYHA 4E7HA 5SWMA 1NOYA 1RBSA 1RT7A 1RDAA 4BWJA 4AHCA 4M41A 1I39A 3V9WA 3F73A 3PX0A 1L3UA 4KAZA 2QK9A 1X1PA 4CK3A 5C24A 2XY6A 4DTNA 3LZJA 2X6NA 4DWIA 4CJKA 3S9HA 1GOBA 1LAVA 1ZBIA 3AV9A 1Z26A 4JS4A 2E4LA 4OGCA 4BACA 1S1TA 4HUEA 1WAFA 3O4NA 4OPKA 4DFPA 4E19A 1T05A 2DIQA 4OGEA 3P8HA 2Z1GA 3ZT2A 3HT3A 1X9WA 4CRIA 3RR8A 4FJLA 4PQUA 1TKDA 3L2RA 1WJRA 3MEDA 3KD1E 4N76A 2KZMA 3OYGA 4L59A 4PLLA 1S9GA 3OVNA 5FROA 4IG0A 4BE1A 4W5OA 5D6WA 4DQRA 4DS5A 3SPYA 1G5VA 1VRUA 3ALYA 4LSNA 2O4XA 4E0DA 3NGZA 2MWPA 2B4JA 3AVGA 1U4BA 2X4XA 5KE2A 2IDOA 1NJYA 3FFIA 1SL1A 1TK0A 1ZBUA 3OYDA 3HPOA 4RW6A 3ZSYA 2IGIA 3FEOA 3NDKA 4ELTA 1IKWA 1YTAA 1HNIA 2P0KA 2FBXA 2R5MA 3V9ZA 4DTXA 3DYAA 4B9LA 4I9LA 4M3RA 3KK2A 2XDPA 4LH4A 4FLWA 3JYTA 1LW0A 2QKBA 2KW4A 1KVBA 4NYFA 4CF0A 2VYTA 3AA3A 3DLHA 5KCOA 4CHOA 1QSLA 1CZBA 3OYKA 4IUTA 3BDLA 4AHSA 4CHYA 4C8KA 1VK0A 5DMRA 3EZ5A 4BE0A 3LP0A 1C1BA 1BIUA 3PO4A 4ZTJA 3OYLA 1HPZA 4G1QA 2K3XA 3OJSA 4HTUA 2DFHA 3TAPA 4FJHA 3M9QA 3AO4A 3QIOA 2Y1IA 2YRVA 3CEYA 3PMIA 1NJZA 1QSYA 1KSPA 4DQQA 1ZYQA 4DLEA 2NUBA 4N47A 3PV8A 1F21A 1TL3A 3LALA 3SI6A 5J2PA 2OA8A 1RT6A 1HNVA 4CGHA 2G8KA 4II1A 1NK4A 3ISNC 4CFCA 1HYZA 2D9TA 2JGUA 3LAMA 3O3FA 2LVMA 1QSSA 4FJJA 3OB9A 3CFPA 2XY8A 1QS4A 4DQPA 4W5NA 4CK2A 4PLIA 4CJVA 4FM1A 1SL2A 1NK8A 2D0CA 3SQ0A 4KV8A 4B9WA 1LAWA 4X34A 3CM6A 3NF7A 4BWMA 1U47A 4HCCA 4FJMA 4M3WA 5JS1A 3MEWA 4QVZA 3SUOA 4FK4A 5KE3A 2YNFA 3PX4A 1SKRA 3AO1A 3KLHA 4Z0UA 2D0BA 2RJDA 3K59A 5FRMA 2M1HA 3FC3A 4Z02A 4M42A 4C8NA 4CK1A 1Q9YA 2MWOA 4XIUA 4CF9A 4FLXA 3HO1A 3QEIA 4DU1A 3TAEA 3ZSRA 4IDKA 3T3FA 3UT1A 4Z4CA 4M3XA 4Z4EA 4DSJA 3QIIA 2G8IA 3HXMA 5CZ1A 4LD0A 1X9SA 1EP4A 2XY5A 1JLFA 3AVHA 4CJWA 3HM9A 5KH6A 2ZD1A 3K5NA 1ZBLA 4M3YA 1WSEA 4DTPA 1L3SA 4K8XA 2RF2A 4GVMA 4H4MA 5CYMA 3SUNA 4RG8A 4F8RA 3U6FA 1BQMA 3KJVA 4M3UA 3L2QA 3NAEA 2HHVA 4BE2A 1HQUA 5KCHA 1VSJA 1BL3A 3IS9A 3LANA 2IG0A 3E9FA 4M3ZA 4KRFA 4CEEA 2JTFA 4FJIA 3I0RA 4FU6A 2HB5A 2FBYA 3LZIA 3WNFA 1BIZA 2RI3A 2VG5A 3SQ4A 1SKSA 1NK7A 3OYAA 1ZBFA 3HSTB 1D9FA 2OYQA 1SV5A 3OA6A 3V1RA 4CEOA 3QERA 2LDMA 3ZSXA 2KFZA 3KUFA 4CGIA 2B8AA 4CFAA 5KTQA 1JL1A 3TAFA 3V9SA 1R0AA 4CCHA 5KGWA 3HPHA 3ZT0A 1J53A 1U48A 1WNSA 3RMAA 1WJQA 4OLAA 3TANA 4Q5WA 4O44A 4CEZA 4GY5A 4CEAA 2G8WA 1QQCA 3GOXA 1XWLA 2ITGA 3MP8A 5J2NA 2F5KA 3VQDA 1NKEA 1Q9XA 4LH5A 5J39A 4C8LA 1RT4A 1S1VA 3HP6A 4N4GA 4PA1A 4HUFA 1XNIA 4DS4A 1X9MA 1XI1A 2PQWA 3O4QA 1IKVA 1IKXA 3TAQA 3EY1A 4EP5A 2BE2A 1REVA 3V6DA 2BKDN 2HQXA 3QEXA 1ASUA 2RI5A 4NZGA 4B8CA 4N56A 3LPUA 3V9XA 1WJSA 4RG2A 1JLBA 5CZ2A 3AVKA 3ZSOA 3RRHA 4W5QA 3D0PA 2XHBA 1T03A 2E6MA 2X78A 4EP4A 4FVMA 1KCFA 4ICLA 1RCHA 3OQ5A 1RTJA 2EHGA 3LP3A 3NF6A 4QAGA 4I9QA 4OLBA 3S6WA 1WN7A 4C5HA 3AA4A 4CESA 3DM2A 3OYJA 2RHUA 3NTKA 4J2DA 2VG7A 3M8QA 4FJXA 4KI6A 1NK6A 3O3GA 1OYXA 3OYBA 4Z4FA 3QO9A 3QLHA 4CJTA 1LWEA 3NFAA 1RTIA 4CEBA 1TKXA 1KVCA 3RRGA 3L2UA 2KTQA 1LWCA 3MP1A 3LGFA 1WSIA 4O55A 3VQCA 1MHNA 4YNQA 1RBUA 2PYJA 4DSKA 3KLIA 3OYEA 4ELVA 3UIQA 4DSFA 3OMCA 4JRPA 2BIVA 4LD6A 1VSFA 4CFDA 2PZSA 3HVTA 4FYDA 3ZT4A 3BGRA 1WSGA 4EDUA 4B9MA 3KKSA 2L89A 4GMJB 4I2QA 3OS2A 1C1CA 1YT3A 2YV0X 4C5EA 3LH0A 5EU7A 2QXFA 3ASMA 3ZCMA 4R5PA 4B9VA 4EZ6A 4FJNA 3MEUA 1BGXT 1VSIA 3DI6A 4FLVA 1T7PA 1Q8IA 3KD5E 2KZZA 4N4HA 1BI4A 1RNHA 1UA0A 2P51A 1J5OA 3S3MA 3DLKA 3G0ZA 2G8UA 2QQSA 3FLGA 1UWBA 4C8OA 4FZXC 4YFUA 4DSEA 2YNHA 4DQSA 1WSJA 3TR8A 4IFVA 2RJFA 3B6OA 3SNNA 1IO2A 3DMJA 2ZQBA 4LY7A 3PFSA 2CKKA 1SSFA 4CF8A 2HNDA 4NCBA 2XRIA 3L2VA 3QKJA 2EKOA 2E6NA 5IAYA 1OZ3A 4M45A 3TAMA 4CHQA 3K5LA 5J26A 2RI2A 4CHNA 3G10A 1UOCA 4AHUA 3RMDA 3ULDA 4E7LA 1C0MA 2O4XB 3AVCA 3T1AA 4MQ3A 3OYNA 1S9EA 4FM0A 4DTOA 4FJGA 1BISA 1J9AA 4FLTA 2IC3A 2X74A 4OPJA 3V1OA 1NK5A 1B9FA 4DTSA 1TAQA 1CXUA 2WACA 3IRXA 4B9SA 2GV9A 2BUDA 3ZT1A 4W5RA 3PX6A 4BDZA 1RDDA 1TAUA 1C0TA 4KHYA 4E89A 3C95A 3CQ8A 4CJQA 3LWMA 4CGJA 3SV3A 2QQRA 3DLEA 2PY5A 2HHXA 1NJXA 3Q1JA 1TV6A 3MXMA 4Q0BA 1S6QA 4KHSA 1BQNA 3K5OA 4NCAA 2EQMA 2XY7A 2M0OA 2RJEA 2ETJA 4O4GA 5HRRA 4IURA 4CEFA 3SJJA 4CJRA 3TABA 2KFNA 3OS0A 5HBMA 1KTQA 3QNOA 3V4IA 5D6YA 1T8EA 2PYLA 4FLYA 3ASKA 2DFEA 2BDPA 3NF8A 3VA3A 4FZYA 3VQ8A 3KK1A 3E9GA 4QQ6A 3L2WA 4FXDA 1HJRA 3QNNA 2YNIA 5D3GA 3H08A 1S1XA 5C25A 4EZ9A 1KRPA 3H8ZA 1DTQA 2WOMA 2GBZA 3CFOA 3VQBA 4AH9A 4Q5VA 4E1NA 1RT2A 3RMCA 1N6QA 3AVJA 3OYFA 3DRSA 4DTRA 4DFMA 3NH2A 4KTQA 4E3SA 3PMTA 3OYMA 2HHWA 4I2PA 2HVIA 1ASVA 2F8TA 1WLJA 4FJ9A 4A4HA 1H3ZA 1LWFA 3U3GA 3SQ1A 2R58A 2R7YA 2RN2A 4B3OA 3KTQA 2EQJA 2RHYA 1IKYA 3NE6A 4A4FA 3VQ6A 3QETA 2GFUA 3C94A 3HK2A 4CF2A 1U45A 3MXJA 2NLUA 1JKHA 2YKMA 3KIOA 1VSLA 4O0IA 4FM2A 3AO3A 1C0UA 3K5MA 3S3OA 4OKJA 1IG9A 4HUGA 2DY4A 2EQKA 1YTUA 3P5JA 2FBVA 3C6TA 1C6VA 1LV5A 5C6SA 2Y1JA 2F8SA 3QJ6A 4JLHA 4IKFA 3UWNA 3K58A 3JSMA 4DQIA 1L3VA 2ZE2A 3CM5A 4UC4A 1TKZA 3OYIA 4RW7A 1J54A 1DTTA 3F9KA 3NH1A 4OVLA 4FLZA 4FLUA 3F70A 5C0MA 1HRHA 4KTWA 4CGGA 4CIFA 3LGLA 4IUUA 1A5WA 1RILA 3M8SA 4BDPA 1U49A 4IUVA 4ID1A 3VQQA 3U3YA 3MXIA 4DSIA 4AILC 3QEVA 3SUQA 4F4KA 4KHQA 4FK0A 1FK9A 3DLMA 4H4OA 3LLRA 3MO8A 4E7JA 1VSEA 3C6UA 5DK5A 2GUIA 3LWLA 2HHQA 1Y97A 2HHTA 2LCCA 3CG7A 2L8DA 1UAXA 2YKNA 2RHIA 4HVJA 5KI6A 4PWDA 2EFIA 1KFSA 4KTZA 1SL0A 3AVNA 3KLEA 4Z4HA 1U04A 2XK0A 3D45A 4KB0A 3NGIA 4F3OA 4ZHRA 2BANA 3DB4A 5HROA 4Y1CA 2B5JA 3HYFA 4N41A 3DOLA 4O0JA 3SPZA 1CXQA 2JZ2A 2E5QA 1JL2A 1RDBA 4CFBA 3LPTA 3O8VA 1JXEA 2W42A 4FCYA 2ATQA 4NCGA 5KGXA 2LSNA 4KFBA 5IN1A 2IS3A 4KHNA 4UQGA 4DU4A 2G8VA 3HP9A 3QESA 3CFRA 1KLNA 3HJFA 1A5XA 3SYZA 4KHUA 3AO5A 4N5SA 3ZSQA 4GW6A 3NHGA 1Z25A 3V81A 2LTOA 4KREA 2VWJA 4CJFA 4IUPA 1QHTA 1S5JA 1QTMA 1EETA 3L3UA 5J2QA 5HLFA 4OKKA 1TK5A 4PUOA 3LAKA 1NK9A 3ZT3A 4F2SA 2R5AA 3MAQA 3S3NA 3VQAA 2X35A 3KLFA 2HMIA 3L8BA 3OYCA 4JRQA 3KLGA 1C1AA 4IUQA 1KVAA 3ZEHA 4DFJA 2KQ2A 3RMBA 4AHRA 2AJQA 1XHXA 3META 1ASWA 5I42A 3MEVA 2DIGA 3NNQA 4NS5A 1D9DA 1WGSA 1WSHA 1TKTA 2B6AA 2OPRA 3B6PA 2P5OA 3PY8A 2O4IA 2HQEA 2RPIA 3DRRA 3VQ5A 5E41A 1N5YA 4K8ZA 3NTHA 3P83D 4ELUA 1CLQA 4HCBA 4E7KA 4CJLA 5HP1A 2D5RA 4CJ5A 1CZ9A 4DMNA 1D8YA 4KI4A 2HHUA 2FC0A 3PUFA 4OJRA 4CJ4A 3K57A 3C4SA 3NTIA 3P8DA 4QW2A 3K2PA 2YHBA 2Z1JA 4NYNA 3VQEA 2X4YA 1K6YA 5I3UA 1OZ2A 1NKBA 3M8RA 2Z1IA 4CECA 4B9UA 1RTDA 2OPSA 1B92A 4CGDA 2F96A 1RBVA 4F3TA 3QINA 4DLGA 1WSFA 3LYIA 4I7FA 2OZSA 3AA5X 3FDRA 5K14A 3HPGA 3VQ7A 5KRTA 1KHCA 3V9UA 2G8FA 1IH7A 4DF8A 1TGOA 2OPQA 2RHXA 1JLCA 4CJSA 3TARA 3SCXA 1S1UA 4CHZA 1JLAA 4MFBA 5M9OA 1BI4B 3ZSVA 3THVA 4LSLA 5J1EA 4CGFA 3E01A 3DLRA 3PO5A 4FJ8A 3QEPA 2X4WA 1B9DA 4KHWA 4DG1A 1ITGA 3VQ4A 3IAYA 4FW2A 2FBTA 4FJ7A 1S1WA 2WONA 3AVBA 1RT5A 1SKWA 4E7IA 1MU2A 1NOZA 1S6PA 4DSLA 4KKOA 2HNYA 5FRNA 4KO0A 4FJKA 3NH0A 4OVAA 5CIUA 4IG3A 2X6SA 4WE1A 2RO0A 1JLGA 2HNZA 3MEAA 3MEEA 5KRSA 4FW1A 4DTUA 1XHZA 4B9NA 4B9XA 5FDLA 4KB1A 1FKOA 4C5IA 1JLQA 4PY5A 2EX3A 2YHAA 1VSMA 2JLEA 2P5GA 5CYQA 2BGGA 4PL6A 4RW8A 1GOCA 3AVIA 3DOKA 4B08A 1OI1A 1TL1A 4CERA 2GFAA 4AHTA 4CEQA 3ZSZA 3QEWA 1RBRA 3AVFA 4CIGA 3VQPA 4B9TA 2DTUA 3VN5A 3OS1A 3M8PA 1UA1A 4FK2A 4Z4GA 1TVRA 2IOCA 3DRPA 3A2FA 4CIEA 3P1GA 3RR7A 2Z1HA 4CEDA 1W0HA 3NGYA 4RW4A 4J2AA 5J2MA 3LP1A 1RDCA 4W5TA 2DFFA 4B8AB 4CJ3A 4QOZB 1TK8A 3HVRA 2R57A 1KFDA 5HRSA 2LRQA 5HRPA 3O3HA 4ID5A 2HVHA 4DF4A 1G15A 2D0AA 2OPPA 1HYVA 1HYSA 4A4GA 3OMGA 3AA2A 1W9HA 3HL8A 2EQUA 2RJCA 3I0SA 1O1WA 3LX7A 1DLOA 2QKKA 3DLGA 1BCOA 4RW9A 1FXXA 3QIPA 3WNEA 3MEGA 1EXQA 1QE1A 2P1JA 3RWUA 4J2EA 5CY4A 2IAJA 3MECA 3T19A 1FKPA 4CJEA 3VA0A 2G8HA 1ZBHA 4QCLA 2O4GA 4FJ5A 4KPYA 4Z4IA 4C8MA 3ITHA 1VRTA 3AVLA 4Y1DA 4CF1A 4JS5A 1WAJA 4TSXA 4FL6A 4CJPA 1RT1A 4N4IA 5C42A 3SQ2A 3DB3A 2OZMA 3V1QA 2FHDA 3NBPA 1L3TA 2RHZA 4C5GA 1YVUA 3CYMA 1D5AA 1RI0A 2M16A 3ME9A 4E1MA 4DTMA 3I8DA 4O5BA 4CE9A 4IFYA 4F2RA 1EX4A 2A1RA 4A4EA
chains in the Genus database with same CATH superfamily
1VZ0A 3JCMh 3CCRA 5E1ZB 4J6XA 3L00A 2A1SA 4H0PA 2HDCA 4OKEA 3SUPA 1SEUA 3O5BA 2YNGA 4V19S 2DAQA 2DA9A 3ZYYX 4IBNA 2HW3A 4BY1J 2FOKA 1NBWA 3K9KA 3WNGA 2Y0SA 1HJDA 2IIMA 4XSZF 4LJZF 4DEXA 1HMVA 2NZTA 5SWMA 3IUCA 5LJ3g 1X1PA 4I6MB 2JMAA 4ME7A 1YVNA 1IUYA 4NC8A 1K78B 1WAFA 4QWQA 4C3JJ 2WA0A 3LDNA 1T05A 3CCRI 3IAM2 4YORA 1HLUA 5F64A 1WJRA 1JO8A 5AQMA 3LH5A 1MIJA 3DXMA 1UGVA 3EG2A 4AMCA 2D1KA 3CDLA 3AVGA 1T0JA 3QICA 4I99C 3FEOA 5FPNA 1WHUA 4KA4A 3CCQT 1IKWA 4U67L 2P0KA 5L3DA 2H94A 4ON0A 5FD6A 3LSIA 3IH7A 4HSTA 2C06A 3JYTA 3CCJN 3IWFA 4CF0A 2VYTA 2L3PA 3A1YA 4M78B 4IUTA 4NO7A 2ZKZA 3GLXA 1OVYA 3EE9A 4M77A 1K73O 3DU5A 4ILJA 3CEYA 2ED1A 1QSYA 2M9HA 4O5VA 3A8OB 1P7MA 2JT1A 1AWXA 5EX5A 5BPMA 1KQ1A 5ILVA 2P9PB 1V55H 2MOXA 3SXYA 3M54A 2O3FA 1JBMA 4OB2B 1ABQA 3P8BB 3SQ0A 2PMUA 2XF6A 4FK4A 3TW7A 3O2PE 1UJ8A 4RTYA 1MBGA 1WXBA 2H8RA 5HDKA 5JVHL 4OIQF 2RREA 2G8IA 4PKCC 5CZ1A 2EVRA 3HRSA 2M51A 4MDBA 4MGRA 4K8XA 5GMKm 3BLYA 4J9HA 4A3FJ 4E70A 4RAYA 4RS8A 3ZQIA 3J7AO 2QTDA 3J7YP 1I5ZA 5K7FA 3PE0A 1YJWT 1R0AA 4H5TA 3RMAA 4CEAA 2KL4A 1HC8A 3FMSA 4DCHA 4M73A 4RDUA 2W00A 4IJNA 1XNIA 3C3WA 3J7YJ 4LF6K 3A5LC 2FQ3A 2RI5A 4PWDA 1JLBA 4XEIA 3LSTA 4JZ3A 2F6CA 1ZSZC 4KMFA 3NEUA 4G8XA 5C12A 1LJ9A 5D7UA 5EXWA 2GM4A 1M1KR 1K4US 3M8QA 5I2SA 4ILHA 4RAGA 5L8RE 5CAIA 1BIBA 2EV6A 1FYNA 4CFDA 4KICA 1VQMN 1F4KA 3LH0A 2O7OA 3RYPA 1JCGA 1Q95G 3CWTA 2VE9A 2KI7A 2R7DA 4WFAL 4EW0A 1GVDA 2VQHA 5F1RA 2NNWA 2A7YA 1N78A 3INZA 3A5MC 4CUGA 4CZCA 1ATRA 2MPXC 3H3UA 3RDVA 1QRYA 1OR7A 5FWCA 1YN8A 2RB6A 2V1DA 1QQJA 1VQ6A 3LWMA 1ETWA 3BR3A 3O5ZA 4D0PA 1S6QA 4IURA 2DJNA 1VQ8I 2ZFUA 3L0QA 1KTQA 1HU0A 3PFIA 2VKVA 4P55A 4XLEA 1GV5A 1BUPA 4M75F 1S1XA 1DTQA 2GBZA 4KT0E 3CFOA 1N6QA 4HX7A 2L2OA 4M77D 3OYFA 1OX9A 3PMTA 2K86A 3SQ1A 5HKCA 2HBMA 2PVGB 1BC7C 4M74A 3CUQB 5IT9K 1KGSA 1JKHA 2YKMA 5CKTA 2MW8A 3UATA 2DA2A 3QU3A 4A93J 3QJ6A 3THXA 5KAFC 1VYUA 4JLHA 3U1DA 1NKUA 5H6QA 4XRSG 2ZE2A 3HRGA 3HOVJ 1YO5C 3I4NJ 5L3BA 1OCPA 2V8IA 2NUTB 4EJZA 3I5SA 2JK3A 3JAMK 1ZHIA 2ZJQF 5HROA 4FPBA 2OTLA 4E9FA 3UDCA 3REAB 1BR4A 5FKNA 1PNJA 1TWCJ 5HOOA 3K4MA 3ISPA 2IIRA 3QESA 3CFRA 4OAYA 2FBKA 5FLVA 1TH7A 3MMVA 1EETA 1YI2I 5KYWA 4OKKA 4KBMB 2YSRA 1W97L 3I8BA 3L8BA 3Q3SA 4O6JA 4DFJA 4H5VA 1JCFA 2CH0A 4XR6A 1ACMB 3PT9A 2MYSA 3THXB 1V76A 1SFUA 1PD0A 2K3FA 4B44A 1VQNI 1WZ2A 3C4SA 2O2OA 4JI7K 1FTZA 1LWYA 2OPSA 1PG5B 2VIXA 1WSFA 2FB7A 5KRTA 2K2MA 3ECOA 2G6FX 3SCXA 3OL3A 1E6GA 1U5TA 3A03A 1V5FA 1IV8A 2QSGX 1AD5A 1NHAA 5H1SQ 1S1NA 5AQNA 1UHCA 2KYBA 2KT0A 2ECCA 4AI4A 2GFAA 4LOCA 1SHGA 1RBRA 1FX7A 3CCQA 4CBXA 4OIRF 1G15A 4B3XA 2YUQA 2EQUA 3VFZA 2COYA 4QCLA 4ZYAA 5J3LA 2O8XA 2DM1A 3DBHB 5E1XA 3CD6A 2JTVA 2L4AA 2CH4A 3GBQA 2M4GA 3V42A 3WGGA 1D5AA 4ZYDA 5AQSA 1SD7A 2A1RA 5CKHA 4HW0A 2XAJA 3CPWS 3GXOA 2B63J 1AZGB 1Z1DA 3JSOA 2KRNA 2FEIA 4YEJA 3TDUC 3MD2A 1YJ9I 1X1DA 3QWXX 2G3RA 1JXBA 4DOWA 3V7CA 2DKGA 1VYTA 1Z26A 4J6WA 4QKUA 3Q9SA 2OU2A 1YHQN 2KZMA 5HODA 3OYGA 3QFPA 2P9SB 3G2BA 4DS5A 4BE1A 2QCOA 3EPZA 2O4XA 5AONA 1QVUA 3HBLA 2P9LB 3SBTA 2E1CA 2AXLA 5JS1A 3V8KA 1ON1A 1M4ZA 4XORA 2H56A 1YJ9A 1IAWA 5ERIA 1LW0A 4Y13A 1GUUA 1ZA2B 3EZ5A 5CKEA 1Y8QB 3OYLA 1YIJA 5CVIA 4HTUA 3PNTA 2ENMA 3QIOA 1MNEA 2NUBA 5C0YA 2DVJA 4PJ0C 4R79A 3BEXA 3JCMX 3FX3A 2NYXA 5M5YJ 3OB9A 4CK2A 1W7PA 5CVUA 2QEXA 3MEWA 2V9KA 2CYYA 1S29A 2BV6A 2NRTA 3BG3A 2EV5A 3IMXA 1QCNA 3KLNA 1KAZA 2DXBA 3CCRT 4JP0A 5KQDA 3DTKA 4P9FA 5E17F 5HLHA 5HDNA 3O8MA 1TC3C 3VYRB 1FNNA 5D6FA 5DYMA 1YI2Q 4F8RA 2V52B 3U6FA 3KJVA 1FT9A 3DP7A 3DKXA 4F7UE 3M0UA 2YSQA 2FBYA 3M3YJ 3HFOA 3OYAA 3VGMA 1S3JA 4I7HA 3TAFA 1NNEA 3ZT0A 1TUGB 5J2NA 3HRTA 2ITGA 3MP8A 2E2HJ 4IHVA 1D4XA 4B1XB 4N4GA 4PA1A 3E66A 3JS6A 1REVA 3D2FA 5IHKA 2FRHA 5A0GA 3V9XA 3RRHA 1FOYA 4M77G 2XC7A 4NHJA 3H3ZA 3G71Q 3CCMA 3CDIA 4C5HA 5HS9A 2MBFA 2K9SA 5J1YA 4K41A 1LWEA 5FLXZ 1N9SA 1TKXA 5DM6L 4PJMA 3MP1A 2DFIA 3CF5L 5FJ8J 4OPAA 3DV8A 2ZMEC 4LD6A 1FP1D 1WSGA 4LFAK 2EYWA 5HP1A 1MBKA 2M02A 4BXFA 4J9FA 1ZN2A 2G8UA 2VKEA 1E0EA 2LY2A 2QQSA 1UWBA 2K9QA 4QT7A 1KU7A 4FYVB 1WPKA 4C92B 4M77F 5LL6Z 4LY7A 3CC2A 3I0TA 2DX1A 4M7DB 4UUTA 3QKJA 1BI0A 1G83A 2IVOA 1OZ3A 3LCNA 4CI6A 3EH2A 3EHRA 2VONA 3OYNA 4FLTA 1LWWA 1YW9A 5AZIA 3FSPA 3WG7H 3UNGC 4PJOB 4EVIA 4AF1A 3JRBA 4V2GA 3ZBDA 1DGKN 1L3LA 1QWFA 1VQ9A 2HCKA 2GTDA 1T8EA 4B1VA 4AUXA 4N9IA 3VA3A 3CC2T 3E9GA 1KC8R 5HS8A 3H45C 5IOYA 2V6EA 3CW7A 5DUIA 4V2FA 1U1SA 2HBLA 3N4QA 3NH2A 3R3LA 2EBPA 1U5SA 3CPWM 3K4KA 3VQ6A 1A35A 1IRZA 1SVLA 3WTVC 1UDLA 4LGWA 1WI9A 3G3ZA 3VV0A 4HUGA 3CCMN 2F8SA 1P7JA 3JSMA 1JTYA 2KMTA 3CM5A 1I07A 2P0WA 4UC4A 1DTTA 3F70A 5I21A 1KU3A 2GQVA 4C0DB 3I5UA 4Y17A 3MMYB 2K3BA 4AM6A 4M78D 3CLQA 3HSEA 3JR9A 2H6BA 2V1UA 2ZJ2A 1J5YA 3M55A 1DDNA 4MMLA 4XMYA 2XK0A 3NGIA 3E0JB 3HYFA 5FU7B 2JZ2A 4CFBA 2DJQA 4FCYA 5IN1A 2G8VA 2RN8A 2LMDA 3A5NC 3O8GA 5CCAA 3NHGA 4XH1A 1TK5A 3DTEA 2VPRA 2O01E 3W6JB 3MAQA 4O8KA 2E60A 1C1AA 1KVAA 1H92A 3PIPA 1D9DA 5M5WJ 2P5OA 4EMSA 4K8ZA 4F14A 3VPRA 3I55I 2CP2A 2E34A 2KT8A 4KI4A 4GFBA 1K9MO 3EGUA 1X4OA 2X4YA 3CCVI 3AT1B 4DQ8A 1NKBA 1VYVA 1NYFA 5EJCA 3G1LA 3M3ZA 2OA4A 2I2LA 2OCEA 1RAFB 1MDMA 3ABUA 2A5WA 3GL1A 2XD0A 3K6GA 2CH4W 1IDZA 4B9XA 5HCKA 3ZL7C 2R5YB 3TCJA 3TOAA 2O8KA 3T8TA 3SK3A 2DA6A 3DWLA 1H9TA 1QZ6A 4OB3B 1VQ7N 3M8PA 2PJRA 1GV2A 4HVVA 1Y96A 2ZJRF 4QOZB 1G3WA 3SDBA 2L3QA 4KDPA 2RK2A 4C2MJ 4PL7A 2DPPB 3UB5A 5EEAA 4JZ4A 5CQGA 1BCOA 2ED0A 1FXXA 3CMEI 2P1JA 2LK2A 2Q2RA 4Y92A 1QVFS 4CF1A 2DO3A 2WV0A 4FL6A 5C42A 1RGIA 5E8IA 3I8DA 1KQSS 1KA8A 1L5UA 4LB5A 5BQTA 2QA4I 2DPUA 1QQNA 3JCMe 2VBZA 1SUQA 5CQYA 2YPRA 1BB9A 1YLFA 3J80Z 5B1AH 4BI8B 2JWTA 1YIJN 1Q82C 4RGRA 2PNIA 1K8AC 1M90U 2W40A 2DERA 3U4LA 2HSEB 4AHVA 2XO7A 3B6CA 4L3QA 1J0RA 3BP8A 2LG4A 3L1PA 2FPEA 1Y6IA 1Y96B 2CWEA 4M41A 3V9WA 4DV2K 2ZNZA 2JJ9A 3S17J 3LA2A 3FIWA 4AC0A 3U9GA 2C0IA 4E19A 4FSSA 1X1BA 2DVEA 4CRIA 4FIBA 1BU6O 1ESVA 5D6WA 3K2ZA 2LX7A 4JHDB 1A31A 1D5YA 3BG9A 2X4XA 1KO9A 5DPKA 3KVGA 1U4BA 5HL7L 1HOMA 4KH5A 4RW6A 2DJZA 1IJJA 1Q1HA 3DYAA 4M3RA 2CQ7A 2DODA 4NYFA 5AQZA 4LF9K 3U9ZA 4C0GA 3C7NA 1UFFA 4PKGA 2F5FA 5MLCQ 2FSWA 3BZ6A 4B09A 1BIAA 2RN7A 3PV8A 1VI0A 3LAMA 4F16A 4GCVA 1KZHA 4CD1A 5KQ8A 1J5EK 3BDUA 4QS8A 3WT0A 2LBFB 1KJWA 2CSQA 3KLHA 1BYMA 2KRMA 5HY6A 2YDLA 1W2BA 4XIUA 2G7UA 1WB9A 2VXDA 3QEIA 4JI3K 4Z4EA 4DSJA 2KQWA 3F8FA 2IEKA 1T44A 1QPIA 3EFSA 4A5BA 2JTMA 3GE1A 1V1CA 3I4MJ 2VG5A 1DIZA 1I6XA 3HTVA 1F1ZA 4ZDLA 2O8CB 2P7CB 3F8CA 3QERA 1HR0K 4CCHA 1U48A 4YIRX 1XNRK 1I1GA 2G8WA 3ZMTA 4CEZA 2VE8A 3AAFA 1QLYA 1RT4A 2JTEA 1I4K1 1S8NA 1N3AA 3RZOJ 3V6DA 4BYYA 4L5IA 3M9AA 3IFRA 3LPUA 3PO2J 4AWXB 3CXCA 4FVMA 3OH9A 1K78A 5KYNA 3ESWB 3WU1B 4HX8A 3JW4A 4MDAA 3A1PA 4DBQA 1A6QA 2DK3A 4BC3A 3JV3A 2HYGD 2EJ9A 2JSCA 2NXNB 2BIVA 5LJ3f 3RSEB 3W3DA 3BTIA 1SEMA 3VRYA 3ASMA 1LFBA 3HC7A 4FJNA 3C2BA 2JRMA 2OTJI 1J3TA 2DL7A 1BWFO 2H3GX 3KP6A 1RNHA 1SS6A 2A6EF 1ZUKA 3JTGA 2M0MA 2RPNA 4DR2K 5I22A 1Z3XA 2M7BA 2RJFA 1H3HA 3PFSA 2E5LK 3HRUA 2WAQA 2DOEA 4G6DA 2CSOA 2CP5A 3E1YA 3M0PA 4A5AA 1M1KU 3ULDA 3AVCA 3SJMA 5EDNA 3VUZA 1OH5A 2LP0A 4K11A 2DOAA 1RDDA 1C0TA 3A01A 5IOZA 3EG3A 4ZYEA 1YAGA 1NJXA 3SFIA 1WI3A 4O4GA 3KETA 5KYUB 2KFNA 3OS0A 4KNYA 2P8TA 3V4IA 4M7DC 2KHMA 3JRIA 5E3LA 2V51B 1RIOH 1TTHB 3MKZA 3C7NB 4A3GJ 3H8ZA 2WOMA 2E1YA 4FJGA 5AYFA 4RCHA 3AVJA 4LDUA 4A69C 3CO7C 5GAHJ 4BRCA 4OMPA 2J6KA 3O8HA 1I8FA 3HK2A 2H6CA 4LLGF 5GMKh 1C0UA 5F0FA 4OKJA 5C6SA 3EQLF 1YBYA 1D8KA 2K5IA 4HT9A 1K79A 1TKZA 2DA5A 2EGCA 3X28B 1J54A 1EH8A 4UB6C 3LGLA 2EFOA 4JJNK 4DSIA 4R5PA 1SC7A 1X1AA 2W10A 5DK5A 3TU4K 2H8WA 1WHHA 4NLBA 5GIOA 1IG8A 1YRNB 3H1CA 4IEIA 3DXKB 3T1YK 3ELKA 1EBMA 4BAYA 4Y33A 2DT5A 2L4MA 2DBMA 3LPTA 2W42A 3VJPA 5KGXA 2FF3B 3FXKA 1PRMC 4XLNF 2ME6A 1XCVA 3BOQA 3HI0A 1S7OA 2EKHA 2LTOA 3NGPA 1X6OA 1Z7LA 1KG3A 5CKFA 3VTHA 2HF3A 3KLFA 3OYCA 4BRLA 2F5TX 3UKRA 2FD5A 2FXUA 2AJQA 5CQXA 3ZQ7A 1M9SA 3HRMA 3G6EI 1W1FA 2B6AA 2DDAA 3B6PA 4FWOA 4ELUA 1WHJA 4IHXA 2AO9A 5E18F 2Q1ZB 4YELA 3K57A 2E2NA 1YQRA 2K02A 2K85A 3M8RA 2X0LA 4EHUA 1HKCA 5CHIA 4YOQA 3E9OA 2ETHA 2EV0A 2QQBA 1ETVA 2HI3A 2G8FA 3DLLA 1DEJA 5AR0A 3SMPA 1HDPA 4M7AE 5J1UA 1BI4B 1T3SA 2RH2A 4XTXA 2VC1A 4C3HJ 2CZ1B 5GTIC 5KRSA 3ZQLA 2ABLA 2FG0A 4B9NA 1DP7P 3EG1A 5FDLA 3GWZA 3M7GA 3BR2A 1QPMA 1PSEA 3ZSZA 3AVFA 4CEQA 2IGOA 1JKPC 3E5QA 2IOCA 4J2AA 1ZQ3P 1RDCA 3VYUB 4B8AB 2O61A 1YITA 5KPZA 5BPNA 3HXLA 2E19A 1VQ4T 4JNEA 3JCMV 1X01A 3I0SA 2XMFA 4RW9A 3QIPA 3DF8A 1UELB 1XTDA 3VA0A 3NAUA 2DMPA 4BUGA 4BRKA 4C23A 3AAQA 1YVUA 2NUZA 4F2RA 3CQZJ 3J7ZO 1VQOT 1AHJB 4CC7A 2VWKA 4ZC3A 5LHHA 3CCEN 3S8PA 3T8RA 4B8XA 4AI5A 4CJUA 3GTPJ 1VSKA 2GF7A 1RKTA 3K10A 3RKYA 3OR2C 2KZVA 1M3HA 1YITT 1YW7A 4L8RB 1IGNA 2CGKA 2K3YA 2UXXA 1KONA 4H8KA 1XCBA 2RC4A 4LFUA 3EAEA 1RT3A 1YTYA 3E19A 1LVAA 4FM4B 4OMOA 3Q0VA 3HEFA 1RBSA 4BY7J 2OTLN 2A5YB 5GADP 4JQFA 4LF8K 2F9WA 2QK0A 4W5OA 1G5VA 1PU8A 1PC0A 4ENJA 2EWSA 1VQ6I 1VQ7A 4IOAL 4G7ZF 1ACIA 1QU3A 3KK2A 4M75B 4JKAA 4H5WA 4N0AC 4C92A 1NM7A 4AG2C 1BIUA 5EEGA 2Q0UA 2WTUA 1UMQA 4ISGA 3AO4A 2YRVA 4C30A 4DQQA 1ZYQA 3KYCB 3ISNC 1XTAA 3OSFA 3DXJF 4CJVA 5GAN5 4CI0C 2GELA 4BQOA 3DLLL 1B4AA 5KE3A 2JRTA 2D0BA 2STWA 1YUWA 3W2WA 2PI0A 4CK1A 4QIWN 1YHQA 1TS9A 4KH4A 1Z3YA 3C7JA 2JHJA 3A8GB 3CC7Q 3QIIA 4B9QA 4DHYA 3ER0A 2MLGA 3K5NA 3C1DA 2IS1A 4OFHA 1E4FT 2WY8Q 2PJPA 1VUBA 3H5RA 3F72A 2RMOA 3FB9A 4CCKA 3I5RA 2HD0A 5M1FA 5E26A 4M3XA 2JS0A 4CEOA 5GJVB 2K9MA 5HLIA 2F5KA 2AKLA 4RUGA 2R7ZJ 2EZKA 3LSHA 3QXEB 4H0OA 4IHTA 2LCSA 2P9PA 2OAWA 2TCTA 3M1FA 2PQWA 2HQAA 3CCLA 1WJEA 4N56A 3TO7A 1KSWA 4CESA 3C0CA 3SQNA 1YP5A 2KRCA 1ZELA 2EW3A 2P9SA 2EA2A 3CC2I 3DTIA 2RNGA 5ICGA 3ENOA 3ZT4A 1I1JA 3KKSA 2R7RA 1NGIA 2V79A 1Q8IA 2HYJA 3DLKA 4FZXC 1S9HA 5EOYA 4F17A 1FIAA 4A5MA 3H0GJ 4CC2A 2EKOA 1QVFP 2KXCA 3G73A 4EGYA 1ZRDA 2MC3A 3GFMA 5KN8A 2IC3A 3ZN1A 1F9NA 3P9IA 3H5AA 3CC7T 2GWRA 4GV3A 2CP0A 2E1ZA 4Y28E 1SAUA 2OZUA 2KVQG 4CEFA 4CC4B 4EJVA 2BDPA 1X6BA 1SANA 4HVWA 4KT6A 2FRYA 1TZLA 3LQQA 4XRFA 3VYSB 4IIOA 3M0SA 5C4JJ 5EZHA 2F2EA 4PCQA 3VEVA 2YX4A 2CS3A 4EJYA 1N25A 1XSVA 1Q86C 3Q5FA 5EVZA 1G99A 1RLQC 1KG1A 5GMKe 5AQUA 2MIOA 4JI0K 4IUUA 1MNDA 1ZR2A 4WFNL 3SUQA 2V7YA 1N32K 1VSEA 2P5VA 1KQ0A 1B72A 2YKNA 4IEJA 2X85A 3AGRA 4KTZA 1U04A 2FQ4A 2GQQA 1YF5L 5H2FC 4IHSA 2XG8D 3DB4A 1JJ8C 1RRJA 4X65K 1YIJQ 4NCGA 5BPIA 4UQGA 2DRMA 4CZJA 4JEPA 3JRDA 3M53A 5GAMj 1GHCA 1K76A 1MV0B 3QFUA 4IUPA 2V26A 3L3UA 2XAHA 3S3NA 5JLHA 1NGCA 3ZEHA 1ZGAA 2JPCA 1WFWA 3NTHA 4DV4K 1KQ9A 2JSPA 1DGWY 3NTIA 3P8DA 4QW2A 3VQEA 2YHBA 3WTUC 1MUDA 2E64A 3QB0A 3I54A 3CD6T 2QTVA 5FU6C 4HT8A 2F96A 4NDLA 5AZJB 1KHCA 2DO7A 3PVLA 2NAZA 2FOWA 3CC4I 5J1EA 4CGFA 5FLMJ 3FJ5A 1T39A 2DTHA 3ULQB 4UUVA 4BQAA 2HVSA 3ZQQA 1NGEA 4IG3A 3QG1A 1QGPA 3HTSB 1Q81C 3MEEA 2L02A 1XHZA 1K4TA 4B3TK 1KQSP 5CYQA 2GGRA 1AHDP 1BG3A 3DOKA 1OI1A 1B6AA 5IXFA 3VQPA 4PJNA 3CDHA 3RDIA 4A61A 2Z1HA 5A0LA 4IHYA 1KEAA 1FTTA 3LP1A 1TK8A 4NOYA 5FKLA 2R57A 3TP3A 2Q8KA 2GOMA 3RTRA 3AA2A 1MMDA 4LFCK 1DLOA 2DZCA 4P1WA 1MBFA 3LSPA 4CJEA 1ZBHA 2BOLA 4QS9A 3F8NA 2XF7A 2MA3A 2L7ZA 3I56N 5EZGA 4FWPA 1AOJA 3HPWA 3MKDA 3CPFA 4KT5C 4A4EA 3GP8A 1KC8C 1FY7A 2OI3A 1IXRC 2BHYA 4JI4K 4FT2A 2E2OA 4DR7K 3BDPA 4EMGA 3M8JA 1AA7A 5M5XJ 1GLLO 4DTJA 3BF1A 1I3AA 2KIQA 3RR6A 5HRNA 4FX4A 3OJUA 2CFXA 1OPLA 5GMKi 3PVQA 3JAMZ 2HQNA 4QQGA 2X9DA 4YPHA 3I56Q 3LZJA 1D0ZA 3FXQA 2E12A 2A3LA 3S9HA 1LAVA 4RB1A 1DUXC 1S1TA 2KPMA 4H0XB 2KSSA 2GWJA 2D1HA 5DS9A 1VQ8N 4ZGJB 5GAEJ 2DIQA 3P8HA 4PQUA 3FM3A 3QBWA 4OB0B 3L2RA 1BJAA 1UFMA 1OU9A 1T08B 2HQRA 4M6YA 1VRUA 4KMUX 3ALYA 3NGZA 3DEUA 4DV1K 4BI3A 3MK6A 2Z1DA 1GBQA 4M7AA 3CUQA 4IOXA 4NUBA 5E8GA 4C2UA 2A42A 4CHOA 1QSLA 1MW7A 5LJVA 1UB4A 2IXSA 4ZTJA 2V1RA 3EGXA 1S5LC 4KBOA 3VYTB 4QTRA 1LMZA 4DV0K 1NK4A 5CVVA 1G4DA 2R3SA 1Y1WJ 3O1WA 5FU6B 5AFUA 5GAN2 4XTWA 2CW0F 4BWMA 2UUZA 4X34A 2GXGA 2KDOA 1YFNA 3GFIA 4C9YA 3PX4A 1MBJA 1P92A 3SZTA 4Z0UA 4LIVA 5AQTA 3WXLA 4JD2B 1RESA 3E7LA 4CF9A 4IWVA 4DV3K 5HS7A 4IDKA 2ZSHB 2PMHA 2K40A 4KN4X 4GLMA 3ZQGA 2GA2A 2RF2A 3MKYB 5HLTA 3D1NI 2UUCK 2YHTA 4OMFB 4IXAA 3P9CA 2E5ZA 1Q82U 2D1XA 5LMNK 1MBEA 2Y0MA 1S72I 2JTFA 4R55A 4FJIA 1AZEA 2IBDA 2CQKA 3O3KA 3RMQA 1U3EM 2MH2A 2OYQA 4PJOE 2O03A 3J8AA 3HPHA 1O3QA 2YRCA 2HL5C 1O7LA 1IN8A 5CO7A 4O44A 2HBJA 2AZVA 4YRVA 3LL7A 3VQDA 1NKEA 4HQEA 4M9SA 1Q7YU 1UCRA 4C3IJ 1ETYA 4MDWA 2NRWA 4M7DE 2WV1A 4RG2A 3D0PA 2X78A 1KFZA 4EP4A 3OQ5A 3LP3A 4LN2A 1WN7A 3AA4A 1Q82O 1XS9A 3GX4X 2CMPA 3NTKA 1UGSB 2VOPA 3J7AP 4YNQA 1XMQK 4EIAA 3CQTA 2CGHA 1GLCG 4XLCA 3KLIA 1RAAB 4WQ4A 4DSFA 4ABZA 3OS2A 3X20B 2EWNA 2QXFA 4X66K 4NNJA 1BGXT 4I6MA 1K8AR 2RNJA 1X3ZB 1J5OA 1RAEB 4M75G 2YX6A 5BN8A 3CESA 1TG0A 2XRIA 2YUOA 2PLYA 4NL2A 1YCYA 1S72Q 1TWBA 4YDUA 4K2EA 1S9EA 2D0QB 2P9KA 1NK5A 2GA1A 1V3FA 1FZPB 4HRIA 2JJ7A 4L5JA 4RCBA 1YITN 1MH4A 2RJEA 1ZBXA 1N36K 2W48A 1Y8RB 4DK9A 4J9BA 3LOCA 4QQ6A 3LFUA 1RNLA 2LX9A 4RTUA 1S22A 3AAPA 4E1NA 4O5FA 4FOEA 3CUQC 2HHWA 4BEHB 1H3ZA 1JJ2S 4FVUA 3EE8A 4CF2A 1NG2A 4PFPA 4ZYHA 2NLUA 3T69A 3UKRB 2SRCA 2VYPA 2OJ2A 1TU0B 2QEXN 3P31A 3K58A 1LPLA 4FYWB 1X3NA 4IVNA 2XKOC 1CSKA 2R93J 3U3YA 2CV1A 4L0ZB 2J4RA 2HEQA 1U0JA 1OCTC 2H8HA 4MLOA 4I01A 2A28A 5F0XA 2XVCA 3A01B 4HVJA 3FISA 2M34A 3M07A 1NJIC 3CF5F 2DYRH 1XC3A 4C1NI 4M78A 3CJQB 3IWZA 5JMVA 5ECAA 4BB7A 3O8VA 3FBIB 2ATQA 1W4MA 2EZLA 4XRMA 3R0AA 5EF6A 3QWYA 4UUSB 3OR1C 4A57A 1V4RA 2RAEA 2O8BA 2QI2A 3H3OB 2QQAA 4UHTA 4DZJA 1MJBA 4OINF 5BPDA 1E4GT 4A3IJ 3LSRA 2HF4A 2NS0A 2P7VB 4Y15A 5IPAA 3RZDJ 1ZLJA 2GIVA 4ZH4F 4NYNA 5I3UA 4B9UA 2P9KB 4FWQA 4J8FA 3JAMO 4I7FA 1TQIA 3JCMQ 3QYFA 1WXTA 5KPRA 2GQIA 3F6OA 2VWBA 2DCEA 3IAYA 3AVBA 4DSLA 2O6GE 4HDVA 3C12A 3ABLH 2EYZA 3NH0A 2RO0A 1JT0A 3HOXJ 1WCMJ 2D8JA 3E9LA 2HAXA 2NOZA 3QEWA 3I59A 3CC4A 1VQ7T 4C8QD 3RR7A 3TKYA 4RW4A 2K4JA 2QEXQ 3FZKA 3EG0A 1XN7A 2W03A 2D0AA 3ZMSA 2OPPA 1NLPC 4C8QG 2X6OA 1RUNA 2XGCA 3HL8A 3OOUA 3VEZA 2YUSA 2XPUA 3WNEA 4BRQA 4GBQA 4KH6A 4C8MA 4BRDA 1D0XA 4CSWA 1HW1A 4N4IA 5LLQA 3CC4T 3CYMA 1RI0A 3ME9A 4DR5K 3ZRGA 1EX4A 4KIGA 5CLSA 1YJNT 2BE5F 2DD5A 4DFKA 3OTOK 3RTVA 1EKEA 2L3RA 2CUFA 1YX5A 3J80K 3BW1A 1TW3A 5CVJA 5AIPA 2BZXA 3CJCA 2K4BA 4HNTA 3TWHA 2RKIA 3BROA 1WLPB 3NCIA 1ULYA 2H27A 3G7ZA 5JS2A 2IT0A 2LF7A 2UXCK 4PIIA 1A5VA 5FU7C 4Q47A 1U3OA 3OYHA 3M56A 2XAQA 3FKIJ 3AG1H 1OVQA 3O4WA 1OQKA 3T5XA 2WWYA 1JJ6C 4YOTA 5GAMe 5B8HA 1WGXA 2ID6A 3QDKA 2O8FB 1XDUA 1ZUYA 4P96A 4HEA2 1K9MU 2Q0OA 5K5RA 2HDAA 4L59A 2L7MP 4FYYB 1DPRA 3QOEA 1GDTA 1GLJO 3LDOA 4C92E 2QWPA 3X25B 4UV9A 1NJYA 1QBJA 2P6TA 2CYZB 3HM8A 1JHHA 5AQXA 5C4XJ 1GFDA 3B73A 2LTPA 1N9RA 3SMSA 2LH9A 1KQ2A 2CO5A 1J9IA 5JI6A 1I6HJ 3W6KB 2A3ZA 2UUBK 1HXDA 3PO4A 2BHZA 2DFHA 4DOVA 2GTJA 1TUDA 2ZJPL 1X19A 2F69A 2PEXA 5J2PA 4NQWA 3ID8A 1QMCA 1WH5A 1B72B 1WJAA 3HDDA 1MWMA 2XAGA 2CUBA 4FM1A 3FZVA 2EK5A 3D0SA 2RHKA 4AIKA 3VETA 5GANj 3L1AA 2OC6A 4BQZA 3N5BB 2WAFA 2CU7A 4AM3A 1ERDA 2NVXJ 2HHSA 1EFNA 3UT1A 3NWTA 2PMZA 3FK6A 1LPQA 1ZSGA 3P39A 3CJRB 3R2XC 3HM9A 4PGGA 4LDWA 1N77A 4FWRA 1LVKA 3N4PA 4M7AB 4CYCB 1N75A 3FMRA 4ZGDB 4WTOB 3J81E 3W2VA 1TW2A 1LJOA 3SQ4A 1BIZA 1QHHD 1NK7A 3BCAA 4GKJK 4A3MJ 1ZX6A 2ASMA 1VQ8A 3CXCS 4GRIA 3V9SA 1OYWA 3KP5A 4B21A 1WJQA 2JZYA 2NS8A 4A6EA 4Z88A 3EFRA 4CZKA 3K1MA 1IN6A 4U0YA 1KD1C 1IKXA 4EP5A 3T1BA 3MZYA 3QEXA 3CVTA 3ZR8X 2XHBA 3HJEA 3VS3A 4YY3K 3JTHA 2YU9J 1ILYA 5KYYB 4FJXA 2K9LA 1TT0A 2DJIA 4EPCA 2NRAC 4QVCA 1MDUB 1I94K 3P38A 3CWAA 4I2QA 4GMJB 4H0VB 6AT1B 5EU7A 4C5EA 2JM9A 2A6AA 2KK4A 3H0FA 1ZG3A 1M90C 3HFNA 4H4KC 2J05A 2YNHA 1WSJA 4RAZA 3TR8A 2FRWA 3DMJA 4CF8A 2LY1A 1T0FC 1MH3A 1M1EB 1FJLA 2WADA 4DW6A 3J81O 1XGNA 4CHNA 3T1AA 4MQ3A 4A3DJ 2QWNA 4NQWB 3E9PA 1MMGA 3ZT1A 1U8RA 1RAGB 3I33A 4LK0F 2HHXA 3QQAA 2M0OA 2ETJA 4XQFA 2VKHA 4C92F 2M9UA 1LKXA 3VQ8A 5BR9A 8AT1B 1HJRA 1YQAA 2CRGA 2CREA 1GBRA 4JKGB 8ATCB 1IF1A 4E3SA 2KP6A 3VF4A 1Z9ZA 3G4SN 4AIJA 2GNCA 4HF2A 3EHQA 2PG4A 1M27C 2H3JA 3A0IX 2QDLA 1R71A 2HOAA 2CQXA 2Y1JA 5AQWA 4ELYC 2M0YA 4LG3A 1XMKA 3NH1A 3L4QA 2R0QC 1YWOA 1AKHA 2XGDA 4KHQA 2V9VA 3BDDA 3TW6A 3GTJJ 2GBQA 1W36C 2GUIA 4AU7A 2P81A 5LJ5h 1ZC6A 4OF1A 3KLEA 2ME0A 3TREA 1HLVA 4Y1CA 4AYBN 2K7AA 4O0JA 4M6XA 2HKNA 2E5QA 4PJOG 1P2FA 1ETXA 3E5UA 2QLZA 4KGXB 4X1EA 1EA3A 1MSEC 4JRKA 1KLNA 4RB3C 2I7PA 4KH1B 1JGSA 4M71A 3R6MA 4XM3A 2A68F 3ZT3A 4RTTA 1OCRH 1KQ8A 3GF2A 3MN5A 2W84A 1R4MB 1USSA 4BC2A 4K0KK 3A8LB 1ASWA 3CCRN 4GV6A 3CCEA 2QWRA 1A36A 3TSWA 4LG0A 5FFXA 3P83D 2L0KA 1N34K 2HKOA 4M7AD 1IN5A 4MLEA 3CCUN 5GANe 3M8FA 4DYRA 2K6DA 3TTDA 2VBXA 1J59A 4CCJA 3VQ7A 5AQKA 4HX4A 1F1BB 1S1UA 2QKLB 3PO5A 3E01A 3PIOA 2FJ1A 2MK5A 1RRSA 3O9TA 2I0NA 4BRPA 2HNZA 3WXMB 2EX3A 2YHAA 1ETOA 3SFZA 3QEVA 2QGUA 5EGOA 4B9TA 4AHTA 2ABKA 3DRPA 3OWTA 4CIEA 5F0HA 2CUEA 4PDKA 2A6TA 2XHKA 2DFFA 1IDYA 1KFDA 2LRQA 2AQEA 4M9XA 4DF4A 4ZJZA 2VPLA 4M77C 2ZPEB 3WXIA 1O1WA 2NYSA 4MEXF 3DAWA 5BPLA 2W82A 4PL8A 2A40A 3T19A 3HHGA 4XK8E 3ERMA 1W1WE 5IYBJ 2DPDA 2EA4A 3VF6A 3IUOA 4GYGA 1HD3A 1RPWA 5E3OA 2PU9B 2KAFA 4NXNK 2XICA 1HQEA 2OTJN 1ZRCA 3CI5A 3FZMA 2F4MB 1K8AO 2CZ7B 3C2GA 2HKXA 2MGQA 4B4CA 4XTZA 3HM5A 2R7UA 4QQDA 1RUOA 5K5QA 4NB4A 5AIQA 5JHUA 1WQ2A 2XRLA 1YJ9T 3CPEA 4M3TA 4RTFD 1KYZA 4P5OA 5DDGA 4DZPA 4DTNA 3BR1A 3KK7A 1GOBA 2HZDA 3AV9A 4OGCA 4BACA 3OSVA 4J7IA 3QPLA 3CCLQ 4JK9A 2ZXIA 2RD1A 4LG0B 5LBQA 1UGPB 3GPLA 1M8VA 2F4VK 1FPQA 2B4JA 2FU4A 3CMET 1KG6A 2IDOA 1SL1A 4WX9A 4XLFA 1KG5A 4ELTA 1B9MA 2B9SA 2CV0A 1IGUA 2VJ4A 3BR0A 3ID6A 1FMVA 3WXKA 3BR5A 2OUMA 1TUYA 2A61A 2J5OA 1SPKA 5HDGA 1C6VX 1U2VB 4EA5A 1C1BA 2QA4T 1AEYA 4C8KA 3FHZA 5IWAK 4BRNA 2R5ZB 1F21A 4L5GA 4BHPA 3I9V2 5LRRA 2KFDA 3SI6A 1OLTA 2KT1A 2D9TA 1MJAA 4HPQA 1KHIA 4GO1A 3JRGA 3WTXC 1VRLA 3HBTA 4FQGA 3T1HK 2Z5UA 2F9TA 2ESNA 1R9TJ 1UG2A 2F7TA 1GFCA 2R7TA 3AO1A 3K59A 1HQCA 4U88A 4M42A 1Q9YA 1E3HA 4HYEA 1GXPA 2LNHB 3O9UA 3EO3A 5IP6A 2EIJH 1VQKN 4M7AC 4ETSA 1EP4A 3C6HA 3CBMA 2ZD1A 2DMTA 4PJOD 4L0YB 4WQ4C 2CT4A 2CGLA 4U7BA 4ZNXA 4CEEA 4LITA 3I0RA 1SKSA 3WNFA 3NRVA 3CMYA 1NGJA 4CA0A 1ZBFA 3CCUQ 1SV5A 1SF9A 3V1RA 2YJFA 4OIOF 4BBRJ 1U5TC 3I53A 3TANA 3JB9D 1E2XA 3DWLE 3MN2A 2X6YA 1R23A 1XOVA 1S72N 2KHOA 2XKPA 3DKYA 2J5PA 2L9RA 3VENA 4OB1B 3VODA 2RVCA 2PVOB 3AVKA 3Q0WA 4B47A 1KCFA 2KXDA 5D4SA 1OYXA 1W36D 1J2XA 3BJOA 2P5KA 3ZMZA 1ARKA 2YT6A 5M3MJ 2F2XA 1VQ5T 1NE8A 1RBUA 1IV0A 4JRPA 3OMCA 3ERED 1VSFA 3EDPA 3HVTA 3CCST 4EDUA 2LZ6B 1YT3A 2LLKA 4JK7A 4FLVA 1VIFA 2X6WA 1VAZA 1JI8A 1K73U 5K7HA 4YFUA 3WQUA 4RGUA 3KZZA 1ETKA 3R4KA 4J9IA 4XSXF 4CHQA 3LDPA 1TXQA 4R8HA 4FASD 4MIMA 5L3CA 4BHBA 3H9NA 5LJ5f 3ATUA 1ODDA 3IV5A 4E1JA 1QVGM 4IOCF 3ABMH 4JYKA 1TAUA 2ZCFB 5IH2A 5J3BA 1GLFO 5LFAA 2BW3A 3ZXSA 2EGAA 3Q1JA 4A0XA 4B1UB 4LNPA 3FHGA 2BVMA 4FZYA 2J7IA 3CCEI 5J4YA 5GAN4 4OAZA 1VQMQ 1T3VA 1JXOA 5CHZA 3ENBA 3WE3A 2RN2A 4B3OA 4P5NA 2M2EA 4FM2A 1WJDA 1B8IB 4HAMA 3S41A 4JAXA 4EAHD 4KISA 1KU2A 1L3VA 4A59A 4F9OA 4CXFA 2OTLI 2OTLQ 3BWGA 1RILA 4AVZA 2DLPA 3CCQQ 3EUHC 1R8OB 3DLMA 4JI1K 3MO8A 5GMKj 1S7EA 1ZQ1A 5GIPA 1LOTB 1VQ6N 2VGMA 3PJRA 3AVNA 3CCEQ 1J09A 3CWSA 3J81Z 2NNNA 2QQ9A 2BXZA 3DOLA 3RESA 2XI9A 3REOA 2NRRA 2C0TA 3CJBA 3HSRA 4F55A 3GZNB 2HOEA 2YU3A 2OPTA 3CC7A 1QHTA 4RMOA 3QSUA 3VSKA 4EHTA 1S6LA 3KE2A 3KP4A 3KWGA 4B22A 5AQIA 1RR7A 2KQ2A 3M0QA 2JNGA 3HKSA 4NS5A 1H1VA 3KHYA 4OO1J 1WSHA 3H5NA 4C92D 5D5UB 4FTHA 1STZA 4KUIA 5DV5A 2CH6A 4UNOA 4CZFA 4CJ5A 5FPDA 1N8RR 1R7JA 3IH4A 1K1ZA 4CO8A 3SWNC 1FBQA 3CD6N 1YYVA 3UKUA 1D3BB 3PO3J 2GBYA 2OZSA 1H89C 2E10A 2HXIA 3V9UA 4J00A 1TQMA 2K9GA 3BG7A 1FBUA 2ADUA 1DU6A 4KHWA 1L0OC 4HV6A 2DT6A 1RT5A 3DBRB 3EGXB 4JD2A 5DD4A 3RQIA 5GANg 5C15A 4A6DA 2P5GA 4RTWA 1SL0A 3FXMA 1Q86R 1VQPN 2ID3A 2NWMA 3ZX0A 4Z4GA 1KQSA 3OHRA 3P1GA 4CEDA 3HHHA 1OFCX 3ZX2A 1Z7UA 4JV5K 4UY8I 2B86A 1YHQQ 4WXCA 3LX7A 1BOTO 4C8QA 4DIQA 3RI4A 5AQQA 1PD1A 1B7TA 4XONA 3CCJT 2IS6A 4FJ5A 4D8KA 4PSWA 1VRTA 1VQ9T 1MV3A 5E20A 4J9CA 2FHDA 2KROA 3HKZN 2O9LA 2RHZA 5E3MA 1WQWA 2QWOA 1LDDA 2QQ8A 3FFKB 2DEQA 3DLBA 3TTCA 1BC8C 4EM1A 4LK1F 4CHPA 3GEZA 3T9NA 1X4PA 4GLKA 1I0CA 4EFHA 1X75C 5E3NA 1RKWA 5A2QK 2HDDA 1O4XA 3L42A 1R4NB 2H09A 3MWMA 1LWVA 4BDYA 3VQ9A 1I81A 3CPWA 1PYVA 1VSHA 2ZGYA 1ZG1A 4FO0A 3MAJA 2O5RA 2VV5A 4ESRA 3TU5A 4J2BA 2Q3SA 2FBIA 4V19K 4RTZA 1MKMA 3URGA 3F73A 2KLOA 2CDTA 1R49A 4BNCA 3GMEA 3O4NA 4IFEA 1ZH5A 5C3EJ 2CUJA 2ZM6K 3HT3A 3LW5E 1WEFA 1YHQT 3SWNB 2P0QA 4X62K 2QDYB 3JCMJ 4E0DA 2MWPA 3H6EA 4M7YA 3CJTB 2DA4A 3NDKA 5JLXA 3TL4X 1WJBA 5AZIB 1Q81R 2DXUA 1ZREA 2KISA 3U2RA 3DLHA 5M3FJ 1VQLA 4HA8A 1HPZA 2VQGA 1P90A 4Z89A 2DMQA 1P59A 1V5EA 5GAMf 3FHFA 1KXPA 1TL3A 3LALA 1HNVA 4CGHA 2YHXA 1HYZA 1QSSA 3O9SA 4N9HA 4FE4A 1U8BA 3PSIA 4B3MK 1QKXA 2YNFA 3THWA 1SKRA 1R5ID 3JB9J 1JKOC 5FRMA 1HSJA 4C92C 3OV8A 1YIOA 2JN0A 4DU1A 4LUEA 5AQPA 4BXXJ 1FJGK 1D0YA 4ENMA 2KZGA 1NG6A 2D5VA 4DUZK 3N97A 2FYKA 5D6EA 1TT5B 4DBRA 1ZSZA 3GIBA 4AYBA 4XKWA 3TBIA 1C0GA 1PU6A 2QG9B 4IO9L 1NG9A 1D9FA 1GXQA 1VQLI 1YIJT 2WY7Q 1WNSA 2DU9A 2YX7A 4JRIA 4FSXA 2D0OA 2KJCA 1UHSA 1BR2A 1ORKA 5J39A 3M0TA 4DS4A 1IKVA 4DV5K 2Z99A 4B3SK 2HQXA 3KP3A 1BDGA 3FMQA 1T03A 5AT1B 1QZ5A 1YXQA 1M2VB 3S6WA 2ZJRL 2QUFA 5ILUA 1QCOA 2VG7A 1EH7A 5F2RA 2RQUA 1P6RA 1Z0XA 4I02A 4CEBA 1TQPA 1LWCA 4N0BA 3OS5A 5F08A 1CQTA 4IZ9A 2ZJQL 3ABKH 1WBDA 3I55T 2KLAA 3ZCMA 4XK4A 4XN3A 3CCVQ 3L6QA 3B6OA 1IO2A 5BR8K 5IAYA 3T7ZA 5GJWB 3R9PA 2KGTA 4B1RA 4JHDA 3S1QJ 3JCMP 4FM0A 1WA7A 2OTJT 2IVPA 3FE1A 2X74A 4EA4A 4ZZDA 3IRXA 5IYDJ 4BDZA 1LB2A 4BC4A 3CQ8A 3DLEA 1Y1VJ 1IRFA 3K5OA 4K25A 5DCMA 5GAOr 2GAUA 3CCSQ 2DF6A 2CS7A 2L9NA 5FD5A 3L2WA 3G4SQ 4EZ9A 3G71I 4L9VA 1D1BA 4ESJA 4KH0B 1XMXA 5DUKA 5C2FA 3S2HJ 4DOZA 4JI2K 3U3GA 4KGVB 2IW5A 4ZDPA 1H8AC 3CCSA 2WTEA 3QETA 4Q5SF 1U45A 3UF4A 2GEMA 3VSLA 3MWTA 1VQMI 2FA5A 2VC0A 3F0CA 4F7UA 3MHXA 4RW7A 3F9KA 1AWOA 4CZLA 4BUPA 5F27A 3M8SA 1U49A 4IUVA 2ASPA 3KCCA 4F4KA 3NVKA 2HNIA 3V7RA 3ASOH 2K27A 4BJ6C 4L18B 4W97A 4CCOA 4RAFA 1UAAA 1VQ4I 3GF5A 3K9JA 3TOBA 1N6AA 1WYXA 3OSSC 3SPZA 3ZCOA 1IXSB 4HNUA 4BQQA 2W04A 1PUEE 2QYZA 2FZCB 3HJFA 2KDSA 3Q0UA 1IHWA 1WEGA 1OYYA 2XROA 4CJFA 1S5JA 2OX7A 2EINH 2YJEA 2R5AA 1HKGA 2CT3A 1J6ZA 1NGBA 2F48A 1PKTA 1FW6A 4Z6YA 2PFUA 1S3XA 1CLQA 5GANh 3MKWB 4ESFA 2FSKA 2Z1JA 1V5GA 3SEQA 1R5GA 4CGDA 2IGNA 4PSXA 3HPGA 2FMYA 4IRIA 4BY9C 3ZMUA 4C1NK 3H3NO 2RHXA 3CC7I 2E2PA 4WQ5C 3I55A 1GCPA 1B9DA 3VQ4A 4XU3A 3J80O 1YS6A 3CCUI 2MI6A 4F7UF 4KKOA 5FRNA 3FZLA 4A54A 4OVAA 2O9SA 2GXBA 4DTUA 3ECHA 4UVAA 2DTIA 4EM2A 1VSMA 2HS5A 3MCPA 3AVIA 3CMEA 5L3EA 5J40A 5GAMg 1JRIA 2EGEA 1NMNA 1E3MA 4OFAA 2QXLA 3R61A 3JCMb 1QHAA 5GAMd 4DBFA 3DLGA 1EXQA 5CY4A 4UY8O 1Z05A 3EUKL 2HNHA 4LFBK 2E2JJ 3V1QA 1L3TA 2E35A 3LAPA 1IXDA 4GGGA 4E1MA 3MZ8A 4MTDA 1JTXA 1A04A 1ZYRF 3BY6A 3REBB 2CQNA 5J47A 3FXOA 3EZWA 1YJNN 4RKUE 4K43A 2KKOA 3SV4A 4M3FA 2O31A 1SD5A 2ZGZA 4ZTFA 2EIFA 3HGYA 1NKCA 2QASA 2DK8A 3KZYA 5T7BA 1TTYA 3VGKA 1BCMA 1JLEA 3CBOA 5JFRA 3GTKJ 1GVJA 3PNWC 2MMPA 3PNYA 2UXDK 4CZEA 2VQCA 3CO6C 4JS4A 1R1VA 4HUEA 2HXOA 5KYYA 3OMYA 5JVTA 1VQ9I 1TKDA 1QQOA 2VI6A 1LCUA 3JRCA 3CCMQ 1NJIU 3AL0B 4IO8A 4A2AA 3GFJA 4YFNF 3MJXA 2VODA 3FFIA 3OYDA 4GVEA 1JCEA 2R5MA 3VEYA 4C0ZA 2XGEA 4BR2A 4ZYGA 3K4CA 5KCOA 2YLBA 1CZBA 3OYKA 3F9MA 4RWTA 5DMRA 2HR3A 4M7DA 3T0YA 1PU7A 1BI2A 3OJSA 3TAPA 2D6FA 2JHNA 1NJZA 3IC7A 4N47A 2O8EA 1HDDC 4JKEA 5BN9A 1ZGJA 4GV9A 2H1KA 2NOHA 5DM7F 4FJJA 4FL9A 1FYKA 4DQPA 1NK8A 1RI9A 4KYWA 4M3WA 5K5OA 4KJZA 1P4WA 3NMUA 1GT0C 2MH9A 4KHPK 3B02A 1XSXA 3HOUJ 1U2WA 1KK7A 4E9EA 4IOAF 3T3FA 2EJGA 2QSFX 4LD0A 3JRHA 4A2UA 3KZBA 5KH6A 4M3YA 5B3SH 1K0SA 4BY6C 3PIPL 2ZAEA 4PFZA 4A4KA 1HQUA 2XF5A 2MCNA 3LANA 2IG0A 3LMMA 1IO6A 4A3LJ 4F7UB 3QYBA 1QVGA 4FHTA 2V8KA 3SJHA 3OA6A 3K4NA 2LT4A 3ZSXA 4DR3K 4BS9A 1ABOA 2K5LA 1K9MR 3DPLC 5GAOm 1XWLA 1DT9A 5DLQE 2CUDA 1TOVA 4R56A 2Y9YA 1YJWQ 3M59A 3R60A 4AFQC 5KPTA 4W5QA 3HZJA 2P0PA 2X4HA 3RQ4A 4PKHA 3QO9A 1TL8A 4OOIA 2LF8A 4IQJA 2DI3A 2D8HA 1VQ8Q 2FF6A 1P4XA 4KUMA 3NWSA 2DRKA 2FL7A 3RERA 4DR4K 1VQ5I 3GZ6A 3VU3C 1EV7A 1NLVA 1LFPA 2ZSIB 5IHIA 1VSIA 1G3SA 3D5RC 1ZAOA 2L3DA 3CERA 2VT2A 1WEIA 4JPBW 4XQ3A 4IFVA 1BA5A 1HJOA 3L2VA 3TAMA 2A69F 2E6NA 2Q31A 2RI2A 2X1EA 2BYVE 4E7LA 1C0MA 2O4XB 2EAYA 3CCYA 3R0JA 1NGGA 2ZPIB 4OPJA 3PL8A 2BUDA 4BH9A 1QNTA 1WHMA 4E89A 3EUHA 2C6YA 2CUZA 1XDSA 1G8XA 1Z6TA 4R0KA 4U0WA 3TP0A 3QDFA 1ON2A 3BZKA 3NF8A 4J9EA 2FZKB 2Q97A 5C25A 2VUMJ 1KRPA 1CKBA 1Y57A 4C0DC 4A0YA 2E1HA 4NXMK 3S15J 4DFMA 5JVGL 2IGKA 4PFOA 4A4HA 1SD6A 3G4ST 4YOWA 3NE6A 1OU8A 3E6MA 1W7PB 1T95A 3AO3A 4JKFA 3ZGKA 4UOBA 2BE9B 3BJ6A 3OYIA 3SEZA 2AK5A 2XHIA 2LFBA 3WE2A 3WTWC 2M8GX 2R5ZA 2P9UA 4LF7K 3KPHA 1TNSA 2HMAA 1FK9A 2YI1A 3JCMc 3HGGA 1H88C 1ZUUA 4QVDA 1W2BP 1KFSA 1BBYA 4ISFA 3FDYA 1U5TB 1GLBG 1SQKA 2AQFA 3N4MA 2DAOA 1NJIR 3VEWA 4JJBA 3D7SB 2LKXA 5FPMA 5EYRA 1Y07A 1HCRA 2VWFA 3HP9A 3AO5A 4N5SA 3K0SA 1QVFM 1IC8A 3V81A 1VFCA 2M4KA 4PUOA 2CZ6B 1PVEA 3TGNA 5FLXK 5HLFA 4YIIA 1VQMT 1IHVA 3VQAA 5LGTA 2A36A 1VTNC 4IUQA 4J19A 1M3QA 4AHRA 4A2BA 4EGZA 3ZEUA 2D1VA 3PY8A 1LEBA 2LCLA 4TV7A 1KD1U 3IH2A 3CCLT 2HHVA 4DMNA 3PFYA 1N8RO 1SD4A 3PUFA 1USTA 3SWNA 5LL6S 1K6YA 2O8EB 2NRHA 5GINA 4DLGA 2AXTC 1KG4A 3CMAN 4M78G 2WSFE 1VQ5A 4OWRB 4C8QF 1RRQA 3R8EA 4A3BJ 3THVA 2HL3A 3A5OC 4FW2A 3QRFF 2WONA 3HUGB 4E7IA 1X1CA 1MJ9A 4U87A 3CD6I 5GMKl 3RPUD 3M58A 3ASNH 4XH4A 1JLQA 2LQ8A 2K4YA 3H35A 2VQLA 1TUCA 4L9NA 3SDGA 5FKKA 1N8RU 3QDRB 1XGMA 4JUVA 2QAZA 2CSIA 3GG4A 1HA8A 3MDQA 1T98A 2MSYA 1WUAA 2HDWA 2HVHA 4KN7X 4M78F 4CH7A 1NLOC 3F8BA 1T33A 5GAHP 3K70C 1QZEA 3J7AF 3KEQA 2HBWA 1RADB 4PJJA 2EQRA 2HFHA 3EH1A 2TRTA 2X1DA 3L2CA 4Y1DA 3F8MA 1X6GA 2XKOA 3CCJI 3TO9A 2NUTA 2QWWA 5KN9A 4O5BA 4CE9A 4IFYA 2CP3A 5D6XA 4J9GA 3LP2A 3MP6A 4YHHK 1B8IA 3HOZJ 1Q81O 1HNZK 4DYQA 4BD3A 3CCET 2O8CA 2FF4A 4J7FA 3LWFA 2DTZA 1OULA 4M78C 1KG2A 3SZ2A 2OJED 3VS7A 4CZGA 2WB1N 3AG2H 5SZTA 4O8UA 1VQPA 1HUXA 1BN5A 2FMLA 3SD4A 1O3TA 4HCZA 3ZQCA 1LDJA 2IGMA 1RDAA 1VQ7I 4DWIA 1RABB 4EIKA 1K9AA 4MO5A 4OPKA 4DFPA 3A0HC 4EMHA 4FJLA 2F1LA 4M63C 4N76A 2W24A 2DK5A 3COAC 4LSNA 1SAXA 5KE2A 3CMEN 1ENHA 2QEXT 3UKUB 2IGIA 5M1NA 1YTAA 4BR4A 2A08A 1LCKA 3GNFB 5F1JA 4M78E 2QKBA 4CICA 3M57A 2LYCA 3BG5A 1NG7A 3TSPA 3LP0A 5CE3A 5GAMh 4UNFA 2QA4N 1Q86O 2VQEK 2Y1IA 5KVRA 2BEOA 1VQLT 4V2SA 4F7ZA 4IO9F 3ML6A 4IXCA 2JMWA 2LSOA 4IRHA 3L2ZA 2D4WA 1LDKB 1HKQA 4HSBA 5M1KA 1H9GA 2LRDA 2NOIA 2BZTA 3ZSRA 1HW2A 3L4IA 1X9SA 1X27A 1NZ9A 2K79A 2QSHX 2LY9A 2ELKA 4H4MA 3L2QA 1B07A 3CVSA 1BL3A 2ZJPF 4KRFA 3VEOA 3FHNA 3E3VA 1VOMA 4LUDA 1Y0NA 4JX6A 3VYHB 3A4CA 5TGTA 4CCLA 2AA4A 4XKCA 3QODA 1RACB 2BH1A 5FFZA 1PJRA 9ATCB 4K42A 1Q9XA 1JU5C 4BRGA 3OIQA 2JWKA 4C2TA 4N4NB 2LDUA 4M7AF 3UA7A 2P4WA 3QU6A 4KGZB 2WC2A 3HOYJ 3MZHA 4ICLA 2EHGA 2A5XA 3HUGA 4KI6A 3O3GA 3H9QA 2L7KA 1RTIA 3RRGA 2DBBA 3L2UA 5J8CA 4LLNA 1WSIA 3VQCA 2KRHA 4DSKA 5LJWA 3I59B 3WTYC 3S16J 4RCCA 1HPMA 2HQ5A 3DI6A 2GLOA 4OMZA 4GXOA 2J06A 1WOQA 1RL2A 1FMKA 1X2MA 3JCUC 2PUKB 2HNDA 5CYVA 4JX5A 2ATCB 5J26A 2WSCE 3N0UA 4MTEA 3RMDA 1J9AA 4W5RA 3G71A 5FGMA 2JPBA 3R1XA 3MXMA 4Q0BA 3F23A 2XY7A 4CJRA 3Q7CA 1OH8A 3HTUA 2RE2A 5BMZA 4ESBA 1QP2A 2Z2SB 3OIPA 4N4OB 1R0CB 3I4PA 1KYWA 3DBLB 3O9QA 3VQBA 4Q5VA 4L6V5 1T3LA 1VNDA 3UA6A 4JI8K 4WYBA 1OX8A 4KTQA 2LQNA 4M7XA 3S6IA 1ASVA 1SFOJ 5M1QA 4F93B 2DA1A 2RQVA 2Y69H 2RQRA 1BI1A 2DXIA 3DCFA 3A98A 2EYXA 2DA3A 2NVUB 2ITMA 3CCUT 3U9DA 4M75C 2FBVA 3QPTA 1VQNN 3M6GA 4CVNE 1WSUA 3D5SC 1BL0A 4J83A 4OVLA 4FLZA 5C0MA 2DXCA 4PHTX 3DXMB 4CIFA 3TEDA 1A5WA 3JXUA 4R1HA 4BDPA 4WCIA 2XB0X 1OKRA 3LLRA 4E7JA 2OANA 3LWLA 1JGGA 5IXBA 1U78A 4X64K 2D0NA 2L54A 2EFIA 2LVSA 3V7SA 3K70D 4G7OF 1QHGA 3D45A 5DM7R 4LMYA 4F3OA 4ZHRA 1YQLA 4D9JA 3ONQA 3F21A 3CF2A 1RAIB 3ENHA 2ELHA 3I3LA 3GCMA 2WFBA 2YUPA 4U0VA 4KFBA 2IS3A 1KC8U 3EYIA 3RMSA 2EFNA 4KREA 1VQ4N 2YG8A 3X2QH 1O3RA 1MNMC 3F22A 2MD5A 3CCVT 1DQUA 5BRFA 3KLGA 2ZGWA 3H9JA 5LJ5e 1WH7A 4LIUA 3META 1XHXA 3THWB 4H03B 3CZ6A 3K4JA 1AT1B 1U2VA 3VYGA 1YJNA 2DYSH 4W1UA 2DW4A 4G7HF 4EMKA 3I55Q 4OMYA 3V8LA 4HCBA 1TWFJ 3QAHA 2BZYA 3Q7BA 2Y48A 4B1YB 2JM8A 4H0EA 1VQKI 1NJIO 5K14A 3PNVA 5BRDA 3QWLA 3HL2A 4MZTA 3EG9A 3FZFA 5J1RA 4XKVA 4HWIA 1UHWA 3QEPA 4FJ7A 4XL9A 1S1WA 2V8JA 1KQSM 4E4HA 1RLPC 2X6SA 1OH7A 4H5RA 4LDVA 3PIPF 5GAOp 5D5WB 2XRNA 4ATOA 1HKBA 2QBYA 2RQWA 3GFLA 3QO3A 3S1RJ 2MD0A 1N33K 1EH6A 5J2MA 1YOVB 3JAME 1FYMA 4ZZLA 3L9FA 3TMOA 3ZFJA 3PIOF 3CCLI 2R7OA 3VEPA 2QTXA 3CXCP 5ICFA 1T6DA 3J7AY 1GCQA 3RWUA 1LE8B 1QE1A 4J2EA 2OD5A 1XG1A 2FPDA 2DBKA 3CHWA 4BGBA 5J8FA 1ZTRA 3AVLA 3G1MA 1R00A 1I27A 2A41A 2M16A 2O8DA 3W3CA 1M3BA 2E3HA 1K6OA 1K61A 3OY9A 1LW2A 4X6AJ 1MGTA 3BUZB 3FR0A 1KU9A 1MMNA 3X26B 2E8AA 3H9GA 3KK3A 5ELZA 1X3WB 1WX6A 3EYZA 1BHLA 3GVAA 2X48A 3FLCO 1QW1A 3MWPA 1NOYA 2QKMB 4FETA 4I09A 3RSNA 2BY0A 4KAZA 5C24A 3CJAA 4Y3OA 2VC8A 4Z2YA 3CWUA 2HZTA 2ZWHA 3PGGA 3RR8A 3EEQA 3LSMA 1EQYA 2CH5A 3GBGA 4MNUA 2O0YA 4C8QC 3E6DA 3CCQN 4O3MA 3K2AA 4B9LA 2K5FA 3NPFA 2UYTA 3WG9A 4RGSA 4BR5A 3IH3A 1VK0A 4EJUA 3EFOA 3TTFA 2XPWA 2K3XA 3TSQA 4BU2A 2NOLA 2RQQA 1KSPA 2QWLA 3JB9H 2EBIA 4J8OA 3I56A 2NOEA 3WVEB 2A3SA 1J7KA 3E6BA 1A6IA 3O3FA 2XY8A 4YTLA 4B9WA 3GO5A 2E70A 1OPCA 3F6VA 3FC3A 2XIDA 4M7DF 2MWOA 2F2VA 3DPTA 4BVOA 1VQ9Q 4D5CA 3ROUA 2L5QA 2DT7B 2XY5A 1OCOH 4RG8A 1EWQA 1MUZA 1I5OB 1IN4A 3THYA 1VSJA 4M3ZA 3E9FA 3AY9A 4ORZA 2KIMA 2QM1A 3EYYA 3QHSA 5FO5A 1RETA 2W6LA 2KFZA 2EZIA 5KTQA 2AS5F 4ELZC 5LJ5j 4OMLA 5I2MA 5EGOB 4LH5A 2JA5J 1PSFA 3RIRA 1IG7A 1T6SA 1FP2A 3O4QA 3HKZA 2DD4A 4ITVA 3IDHA 2X3XD 4AD9A 2EPDA 4H0TB 2ZPHB 4B43A 1X2NA 2GUPA 3OYJA 1JE8A 3QLHA 1DU0A 1OEBA 3M1EA 2KTQA 2RA2A 5LY3A 5ADXH 4DQ2A 3BGRA 1QZZA 4EEFG 1VQPI 1XB4A 4EZ6A 1H641 3TSUA 3G0ZA 3DEEA 3FLGA 3G6EQ 4YOYA 3ZEUB 4RTVA 4HG2A 4X0GA 4DQSA 2BBYA 1O57A 4NCBA 1VQ6T 2JN6A 4AHUA 5H6RA 4DTOA 3V1OA 3GNGA 1XX5A 3HSBA 1TAQA 2QBYB 3PX6A 1VQKQ 2LJ1A 2KE9A 4A63B 1DJ7B 4NCAA 3OBWA 3QNOA 3QBXA 4LF4K 4XBFA 4HLXA 1ZG5A 4QS7A 1ORNA 1Z91A 4YFKF 4NBQA 2HVRA 2QGFB 4LD9K 2JWLA 4WF9L 3RMCA 1GL5A 2VOOA 3DRSA 1VQ6Q 2F8TA 1C0WA 5LEKA 2DFUA 2XIGA 2M1BA 3MXJA 2Z0WA 1Y0UA 3MN9A 2P6SA 4Y4RA 3S3OA 2E6ZA 2LNBA 1YTUA 3P5JA 2HZYA 2IJLA 2NOGA 4DQIA 1QCFA 2RQTA 3SHFA 1ZBIA 1Q7YO 4JLGA 4KTWA 1OJLA 2FO0A 3IRRA 1NPRA 4HF1A 3C6UA 3D2EB 4G94A 1VQ4Q 1G6NA 3G1JA 3EG9B 3IP4B 1F43A 4KB0A 2PBDA 2E1NA 2E7XA 2BANA 4N41A 4HF0A 5TJJA 1Y7XA 2E5NA 1JL2A 5CKDA 1QP3A 2PN6A 4KUDK 4YOVA 1Y39A 1Z25A 1O75A 4XTYA 3KP7A 4LXCA 1AWCA 1KQJA 2X35A 3CC2Q 2FBHA 3MEXA 2ZZDA 3FGUA 1TKTA 3F5TA 2NNYA 4DBHA 3TO6A 4RLQA 1LE8A 2D5RA 4IOCL 2VXEA 4CJ4A 2OF7A 4AIDA 1W6XA 2AKKA 4JK8A 2Z3YA 1JUMA 1QA6A 2EYQA 4CECA 1MD0A 1PCXA 2CW7A 1K9MC 4BI4A 2DYIA 4F91B 3VMFB 1JLCA 3D2FB 4M4ZA 1AOYA 4FJ8A 2XSJC 1ITGA 5F1XA 4ENKA 1NOZA 1S6PA 3KNTA 2FPFA 4WE1A 1JLGA 1OPKA 4FPAA 1VA7A 3VOVA 1TL1A 2JVGA 5ILSA 1M2OA 1UA1A 1K0XA 2A05A 1YE9A 3RKXA 4G9ZA 1NH3A 2BVLA 2ZXHA 4CJ3A 3SZPA 5IT9E 4M6VA 5DD8A 4HDUA 2EYYA 1LOJA 1VQOI 2RJCA 3O9RA 3JRFA 3VS1A 1W4SA 3FZHA 3F0ZA 2P9IB 3WEEB 1O7FA 3RJPA 2BZ8A 2DPNA 2L9SA 1M3CA 3JB9I 3CJ7A 2STTA 1ZSZB 1YRNA 3BQZA 2FXAA 2B7EA 1MMAA 2E6LA 4HCKA 3JCMf 3IG1A 2VKNA 1YJWN 1U6GA 3GTQJ 3AO2A 5TRDA 4FZZA 2JS2A 2LP5A 1M90R 3FK7A 1VQLQ 4G9YA 2MF2A 4ENNA 4JN4A 3CJ1A 2HVIA 4ILGB 1EO1A 1UB9A 1FN7A 2QK9A 4CK3A 4DUYK 2LC4A 4E7SA 1OH6A 1SVOA 1M2VA 3P9KA 2I5WA 2Z33A 1TLHB 2EIKH 5I9EB 3U23A 4F52A 5IYCJ 2PFBA 4PLLA 3MPUB 5FROA 2CZ0B 4DQRA 3CLOA 4YDUC 4OMMA 1SAZA 2JA2A 4XTVA 5I11A 4E9GA 1ORPA 1G2BA 1TK0A 1IXCA 1OQYA 4I9LA 2XDPA 2HHHK 2Y30A 2KW4A 1KVBA 2YS9A 2IS4A 5TKWA 3ULEA 4BE0A 4BG8A 3RYRA 4G1QA 4E7ZA 4FJHA 3PMIA 1LEAA 4OIPF 4AFUC 2DQLA 3U8XA 5KNLA 1NU0A 4PLIA 3VGLA 2D0CA 1LAWA 1U47A 3NF7A 4HCCA 4J5YA 5LJ5d 3HIFA 2RNAA 5AN4A 2VQFK 1AWJA 2M3AA 1VF9A 5L23A 2IS2A 1WRJA 1Z77A 4AQYK 1X58A 1JLFA 3AVHA 2O8BB 2FEZA 2OAZA 1WSEA 2BY3A 2H1LA 4GVMA 2V6CA 5KYXB 1CGPA 1OKJA 3H0DA 3IS9A 2HOSA 1JJ2P 3LSGA 1C0FA 4A62A 1MDMB 1CZAN 2RGVA 2VXZA 4GNIA 1RZ4A