4B22A

Unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
205
Chain Sequence
DSDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQKLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIHIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGRLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLWQIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAG2, DNA-3-METHYLADENINE GLYCOSYLASE 2
publication title Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
total genus 70
structure length 205
sequence length 205
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4b22A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4b22A01
2NOFA 4AI4A 3CW7A 1KG4A 3N0UA 4UOBA 1WEFA 1LMZA 1RRQA 1EBMA 3F0ZA 3I0WA 5KN8A 2JHNA 4E9HA 3CWTA 2JHJA 3G0QA 4B24A 1KG3A 1WEGA 1MUNA 4HSBA 4YPHA 4OFAA 4AIAA 4YPRA 4EA4A 1KG6A 2NOZA 3OGDA 2NOBA 1KEAA 3F10A 1P7MA 2NOEA 1VRLA 1YQLA 1MUDA 1YQMA 1LWVA 3I0XA 4DK9A 2H56A 4E9GA 5AN4A 1WEIA 3D4VA 4PIIA 3IHOA 1XQOA 3CVSA 2NOIA 1LWWA 3OH9A 1KG7A 1XQPA 1MUYA 4E9EA 2YG9A 2YG8A 1YQRA 3S6IA 4EW0A 4UNFA 5DPKA 4B23A 1P59A 3IH7A 4EJZA 3KTUA 5CHZA 2OFKA 1FN7A 1ORPA 2ABKA 4B22A 1M3HA 4EVVA 2JG6A 4OFEA 5KN9A 1HU0A 3OH6A 1M3QA 4B21A 3KNTA 1YQKA 4OFHA 1N3AA 3FSPA 1KG2A 1RRSA 1KG5A 1KQJA 4E9FA 1LWYA 1PU7A 3CWSA 4EW4A 1DIZA 3CVTA 4EJYA 1PVSA 3CWUA 3N5NX 4EA5A 3FHFA 1NGNA 1XG7A 2NOHA 1NKUA 4YOQA 2I5WA 3FHGA 1ORNA 1N3CA 2OFIA 2NOLA 1PU8A 4AI5A 1N39A 3CWAA 1MPGA 1KO9A 1PU6A 2XHIA
chains in the Genus database with same CATH superfamily
3OYAA 2NOFA 4AI4A 3S3NA 3CW7A 1KG4A 3N0UA 4UOBA 1WEFA 4BE0A 3VW4A 1LMZA 1RRQA 1EBMA 3OS1A 3OYBA 3F0ZA 3OS2A 3I0WA 5KN8A 2JHNA 4E9HA 3CWTA 2JHJA 3G0QA 4B24A 1KG3A 1WEGA 1MUNA 3OY9A 3OYCA 3L2RA 4YPHA 4HSBA 3L2WA 4E7LA 4OFAA 4AIAA 3OYDA 4YPRA 4EA4A 1KG6A 2NOZA 3OGDA 3OYFA 2NOBA 1KEAA 3F10A 1P7MA 3OYLA 2NOEA 1VRLA 5FRMA 1YQLA 1MUDA 3L2UA 1YQMA 1LWVA 3I0XA 4E7JA 4DK9A 3LCNA 4E7KA 2H56A 4BDZA 4E9GA 5AN4A 1WEIA 3D4VA 4PIIA 3IHOA 1XQOA 3OYMA 3CVSA 4BE1A 4BACA 2NOIA 1LWWA 3OH9A 1KG7A 1XQPA 1MUYA 4BDYA 3OYJA 2V75A 4E9EA 2YG9A 2W04A 2YG8A 1U84A 3OYHA 1YQRA 3S6IA 4EW0A 4UNFA 5DPKA 4B23A 4IKFA 1P59A 3IH7A 4EJZA 3KTUA 5CHZA 2OFKA 1FN7A 1ORPA 2ABKA 4B22A 1M3HA 4EVVA 2JG6A 4NZGA 4OFEA 3OYNA 3S3OA 4ZTFA 5FRNA 5KN9A 3S3MA 5FROA 3OS0A 1HU0A 3L2VA 3OH6A 3OYKA 1M3QA 4B21A 3OYEA 3KNTA 1YQKA 4OFHA 1N3AA 3FSPA 1KG2A 1RRSA 1KG5A 1KQJA 4ZTJA 4E9FA 3OYGA 1PU7A 4E7HA 1LWYA 4EW4A 3CWSA 1DIZA 3CVTA 4EJYA 1PVSA 3CWUA 3N5NX 4BE2A 4EA5A 2W03A 3FHFA 1NGNA 1XG7A 2NOHA 1NKUA 3R2XC 4E7IA 4YOQA 2I5WA 3FHGA 2JPSA 3OYIA 1ORNA 1N3CA 2OFIA 2NOLA 1PU8A 3NNQA 4AI5A 1N39A 3CWAA 1MPGA 3L2QA 1KO9A 1PU6A 2XHIA
chains in the Genus database with same CATH topology
2NOFA 4AI4A 3CW7A 1KG4A 3N0UA 4UOBA 1WEFA 1LMZA 1RRQA 1EBMA 3F0ZA 3I0WA 5KN8A 2JHNA 4E9HA 3CWTA 2JHJA 3G0QA 4B24A 1KG3A 1WEGA 1MUNA 4HSBA 4YPHA 4OFAA 4AIAA 4YPRA 4EA4A 1KG6A 2NOZA 3OGDA 2NOBA 1KEAA 3F10A 1P7MA 2NOEA 1VRLA 1YQLA 1MUDA 1YQMA 1LWVA 3I0XA 4DK9A 2H56A 4E9GA 5AN4A 1WEIA 3D4VA 4PIIA 3IHOA 1XQOA 3CVSA 2NOIA 1LWWA 3OH9A 1KG7A 1XQPA 1MUYA 4E9EA 2YG9A 2YG8A 1YQRA 3S6IA 4EW0A 4UNFA 5DPKA 4B23A 1P59A 3IH7A 4EJZA 3KTUA 5CHZA 2OFKA 1FN7A 1ORPA 2ABKA 4B22A 1M3HA 4EVVA 2JG6A 4OFEA 5KN9A 1HU0A 3OH6A 1M3QA 4B21A 3KNTA 1YQKA 4OFHA 1N3AA 3FSPA 1KG2A 1RRSA 1KG5A 1KQJA 4E9FA 1LWYA 1PU7A 3CWSA 4EW4A 1DIZA 3CVTA 4EJYA 1PVSA 3CWUA 3N5NX 4EA5A 3FHFA 1NGNA 1XG7A 2NOHA 1NKUA 4YOQA 2I5WA 3FHGA 1ORNA 1N3CA 2OFIA 2NOLA 1PU8A 4AI5A 1N39A 3CWAA 1MPGA 1KO9A 1PU6A 2XHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NOF A;  4AI4 A;  3CW7 A;  1KG4 A;  3N0U A;  4UOB A;  1WEF A;  1LMZ A;  1RRQ A;  1EBM A;  3F0Z A;  3I0W A;  5KN8 A;  2JHN A;  4E9H A;  3CWT A;  2JHJ A;  3G0Q A;  4B24 A;  1KG3 A;  1WEG A;  1MUN A;  4HSB A;  4YPH A;  4OFA A;  4AIA A;  4YPR A;  4EA4 A;  1KG6 A;  2NOZ A;  3OGD A;  2NOB A;  1KEA A;  3F10 A;  1P7M A;  2NOE A;  1VRL A;  1YQL A;  1MUD A;  1YQM A;  1LWV A;  3I0X A;  4DK9 A;  2H56 A;  4E9G A;  5AN4 A;  1WEI A;  3D4V A;  4PII A;  3IHO A;  1XQO A;  3CVS A;  2NOI A;  1LWW A;  3OH9 A;  1KG7 A;  1XQP A;  1MUY A;  4E9E A;  2YG9 A;  2YG8 A;  1YQR A;  3S6I A;  4EW0 A;  4UNF A;  5DPK A;  4B23 A;  1P59 A;  3IH7 A;  4EJZ A;  3KTU A;  5CHZ A;  2OFK A;  1FN7 A;  1ORP A;  2ABK A;  4B22 A;  1M3H A;  4EVV A;  2JG6 A;  4OFE A;  5KN9 A;  1HU0 A;  3OH6 A;  1M3Q A;  4B21 A;  3KNT A;  1YQK A;  4OFH A;  1N3A A;  3FSP A;  1KG2 A;  1RRS A;  1KG5 A;  1KQJ A;  4E9F A;  1LWY A;  1PU7 A;  3CWS A;  4EW4 A;  1DIZ A;  3CVT A;  4EJY A;  1PVS A;  3CWU A;  3N5N X;  4EA5 A;  3FHF A;  1NGN A;  1XG7 A;  2NOH A;  1NKU A;  4YOQ A;  2I5W A;  3FHG A;  1ORN A;  1N3C A;  2OFI A;  2NOL A;  1PU8 A;  4AI5 A;  1N39 A;  3CWA A;  1MPG A;  1KO9 A;  1PU6 A;  2XHI A; 
#chains in the Genus database with same CATH topology
 3OYA A;  2NOF A;  4AI4 A;  3S3N A;  3CW7 A;  1KG4 A;  3N0U A;  4UOB A;  1WEF A;  4BE0 A;  3VW4 A;  1LMZ A;  1RRQ A;  1EBM A;  3OS1 A;  3OYB A;  3F0Z A;  3OS2 A;  3I0W A;  5KN8 A;  2JHN A;  4E9H A;  3CWT A;  2JHJ A;  3G0Q A;  4B24 A;  1KG3 A;  1WEG A;  1MUN A;  3OY9 A;  3OYC A;  3L2R A;  4YPH A;  4HSB A;  3L2W A;  4E7L A;  4OFA A;  4AIA A;  3OYD A;  4YPR A;  4EA4 A;  1KG6 A;  2NOZ A;  3OGD A;  3OYF A;  2NOB A;  1KEA A;  3F10 A;  1P7M A;  3OYL A;  2NOE A;  1VRL A;  5FRM A;  1YQL A;  1MUD A;  3L2U A;  1YQM A;  1LWV A;  3I0X A;  4E7J A;  4DK9 A;  3LCN A;  4E7K A;  2H56 A;  4BDZ A;  4E9G A;  5AN4 A;  1WEI A;  3D4V A;  4PII A;  3IHO A;  1XQO A;  3OYM A;  3CVS A;  4BE1 A;  4BAC A;  2NOI A;  1LWW A;  3OH9 A;  1KG7 A;  1XQP A;  1MUY A;  4BDY A;  3OYJ A;  2V75 A;  4E9E A;  2YG9 A;  2W04 A;  2YG8 A;  1U84 A;  3OYH A;  1YQR A;  3S6I A;  4EW0 A;  4UNF A;  5DPK A;  4B23 A;  4IKF A;  1P59 A;  3IH7 A;  4EJZ A;  3KTU A;  5CHZ A;  2OFK A;  1FN7 A;  1ORP A;  2ABK A;  4B22 A;  1M3H A;  4EVV A;  2JG6 A;  4NZG A;  4OFE A;  3OYN A;  3S3O A;  4ZTF A;  5FRN A;  5KN9 A;  3S3M A;  5FRO A;  3OS0 A;  1HU0 A;  3L2V A;  3OH6 A;  3OYK A;  1M3Q A;  4B21 A;  3OYE A;  3KNT A;  1YQK A;  4OFH A;  1N3A A;  3FSP A;  1KG2 A;  1RRS A;  1KG5 A;  1KQJ A;  4ZTJ A;  4E9F A;  3OYG A;  1PU7 A;  4E7H A;  1LWY A;  4EW4 A;  3CWS A;  1DIZ A;  3CVT A;  4EJY A;  1PVS A;  3CWU A;  3N5N X;  4BE2 A;  4EA5 A;  2W03 A;  3FHF A;  1NGN A;  1XG7 A;  2NOH A;  1NKU A;  3R2X C;  4E7I A;  4YOQ A;  2I5W A;  3FHG A;  2JPS A;  3OYI A;  1ORN A;  1N3C A;  2OFI A;  2NOL A;  1PU8 A;  3NNQ A;  4AI5 A;  1N39 A;  3CWA A;  1MPG A;  3L2Q A;  1KO9 A;  1PU6 A;  2XHI A; 
#chains in the Genus database with same CATH homology
 2NOF A;  4AI4 A;  3CW7 A;  1KG4 A;  3N0U A;  4UOB A;  1WEF A;  1LMZ A;  1RRQ A;  1EBM A;  3F0Z A;  3I0W A;  5KN8 A;  2JHN A;  4E9H A;  3CWT A;  2JHJ A;  3G0Q A;  4B24 A;  1KG3 A;  1WEG A;  1MUN A;  4HSB A;  4YPH A;  4OFA A;  4AIA A;  4YPR A;  4EA4 A;  1KG6 A;  2NOZ A;  3OGD A;  2NOB A;  1KEA A;  3F10 A;  1P7M A;  2NOE A;  1VRL A;  1YQL A;  1MUD A;  1YQM A;  1LWV A;  3I0X A;  4DK9 A;  2H56 A;  4E9G A;  5AN4 A;  1WEI A;  3D4V A;  4PII A;  3IHO A;  1XQO A;  3CVS A;  2NOI A;  1LWW A;  3OH9 A;  1KG7 A;  1XQP A;  1MUY A;  4E9E A;  2YG9 A;  2YG8 A;  1YQR A;  3S6I A;  4EW0 A;  4UNF A;  5DPK A;  4B23 A;  1P59 A;  3IH7 A;  4EJZ A;  3KTU A;  5CHZ A;  2OFK A;  1FN7 A;  1ORP A;  2ABK A;  4B22 A;  1M3H A;  4EVV A;  2JG6 A;  4OFE A;  5KN9 A;  1HU0 A;  3OH6 A;  1M3Q A;  4B21 A;  3KNT A;  1YQK A;  4OFH A;  1N3A A;  3FSP A;  1KG2 A;  1RRS A;  1KG5 A;  1KQJ A;  4E9F A;  1LWY A;  1PU7 A;  3CWS A;  4EW4 A;  1DIZ A;  3CVT A;  4EJY A;  1PVS A;  3CWU A;  3N5N X;  4EA5 A;  3FHF A;  1NGN A;  1XG7 A;  2NOH A;  1NKU A;  4YOQ A;  2I5W A;  3FHG A;  1ORN A;  1N3C A;  2OFI A;  2NOL A;  1PU8 A;  4AI5 A;  1N39 A;  3CWA A;  1MPG A;  1KO9 A;  1PU6 A;  2XHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...