4E7IA

Pfv intasome freeze-trapped prior to 3'-processing, mn-bound form (ui-mn)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 110
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7iA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7iA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7iA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7iA03
1WJRA 3ME9A 4CFDA 4L8RB 5C42A 3KD1E 1A5VA 3VQPA 1KVBA 2HMIA 2B6AA 1SL1A 1QSSA 2GFUA 1QSLA 1U49A 3IG1A 1NK4A 4RG2A 2D9TA 3BDPA 3LP3A 5FRNA 4AHUA 5DMRA 2D0AA 4LSLA 1U4BA 4Z4CA 4FK0A 3K58A 3WNEA 4CHPA 1RBUA 3C6UA 1RTIA 2HNZA 4KPYA 4BE0A 3C4SA 3TR8A 2YHAA 1X9SA 4O4GA 3LWLA 4RG8A 5EU7A 4CF1A 3EAEA 1OZ3A 3LAMA 1W9HA 1G5VA 3IRXA 3L2QA 4H8KA 2BDPA 3KKRA 2E4LA 1WNSA 3MP1A 4Z02A 1D9FA 3F73A 4OKKA 4PL6A 5C0MA 4FJJA 4DF4A 3O4NA 3QIOA 4BD3A 4NYNA 2XHBA 4O55A 4FLWA 3MEGA 4IUTA 3SUOA 2PY5A 2X4YA 4OPKA 3I8DA 4IKFA 5CYMA 1KFDA 3VQ8A 2QKKA 4KHWA 1HPZA 3DLRA 3NCIA 3ZT0A 5I42A 4CJUA 4N56A 3MO8A 1UAXA 2DTUA 3L3VA 4AH9A 3DB3A 2IOCA 2EFIA 1MU2A 4B9MA 2B4JA 2ZQBA 4FM0A 3IS9A 4KB0A 1RTJA 3F70A 1XHXA 3LGFA 3P83D 3OJUA 3WNGA 3KLGA 2X6NA 3OY9A 1YT3A 3V1OA 4II1A 1LW2A 4CECA 3K5NA 4Q5VA 4RW6A 4DFPA 4ELUA 1GOCA 1EETA 5HBMA 5J2QA 3AA3A 1LAWA 1HMVA 2M0OA 1RTHA 4B08A 1VSMA 3O8VA 3QEIA 4JS4A 3ZT4A 1JXEA 2Z1IA 4CJ4A 1S6PA 1EXQA 4LD0A 2M1HA 2RI5A 1BQMA 2BE2A 3IAYA 1A5XA 4KV8A 1C6VA 4DSEA 1Z25A 2G8FA 1IO2A 3HPOA 1S6QA 4M3RA 2OA8A 4E7JA 4YFUA 4F3OA 4CJTA 3OQ5A 2DIGA 5KH6A 1KCFA 3DRPA 1TGOA 4FJXA 4FLVA 4IUQA 3NF8A 4CIEA 1L3SA 1RI0A 4ELTA 4W5QA 4C5IA 3VQ4A 1VSJA 4C5HA 3DOLA 2OYQA 4W5TA 3TI0A 2ZD1A 5CY4A 4UQGA 3UWNA 4DTRA 3TABA 3M8SA 2O4GA 4FXDA 1VSHA 4FJGA 1UA1A 1ZYQA 1T03A 3LH0A 2LRQA 3TAFA 4E7HA 4JLHA 1QE1A 5D3GA 4DU3A 1HQEA 2F5KA 2EQMA 3QJ6A 1TK0A 4CHQA 1BI4A 4IBNA 4DWIA 1NKBA 3VQQA 4DTUA 1LV5A 3AA2A 4FZYA 3A2FA 1LWCA 3NGZA 4CFAA 5C25A 4CJPA 3AA4A 3NTHA 2P51A 4CGIA 3V6DA 4F2SA 1TVRA 1SKWA 4CK2A 4LY7A 4FW1A 4CCHA 3ZCMA 4J2BA 1K6YA 3TANA 3KLFA 3P8HA 4CEQA 3ULDA 2BANA 5KI6A 3LP0A 3G10A 1BCOA 3M9QA 1L3UA 3QNOA 4E7LA 3I0SA 1T7PA 4YNQA 2P0KA 2HVHA 5J1EA 3SV3A 3VQ6A 3VQEA 3S6WA 1HNVA 2FBYA 5C24A 2G8HA 2QKBA 4CHZA 3LAKA 4PQUA 3HP9A 2RKIA 3QO9A 4EZ6A 3MP6A 5JS2A 1N5YA 4EZ9A 1Y97A 2I5JA 1R0AA 3PV8A 2KTQA 3HM9A 2YRVA 1HYVA 4KB1A 4CJSA 4HUGA 2VG5A 5D6XA 3MEAA 3NHGA 4N4GA 1SKRA 1KLNA 1WJQA 3PNWC 3P5JA 4FLYA 1ZBIA 3EZ5A 1GOBA 1I3AA 1JXBA 4IG0A 3OYFA 3ZSWA 2QQRA 3TARA 2F8SA 2BGGA 2JGUA 3META 5HP1A 3NAEA 3ZSQA 4CJQA 2A1SA 4OVLA 1QS4A 2VYTA 2R7YA 4L59A 4CK3A 3ALYA 4K8ZA 3E01A 1RDBA 1RDAA 3P8DA 3MXJA 1BIZA 3U3GA 3SUPA 1NK6A 4I9QA 4B9UA 1U47A 2HHWA 3DLBA 3AVGA 3SPZA 1ZBHA 3K57A 4RW8A 1JLQA 3AVBA 3NNQA 1X1PA 4HHTA 3L2RA 4FK4A 2RHIA 1RT5A 3TAPA 3AVNA 2LTOA 2D5RA 2HHXA 3G0ZA 3SUQA 4CGDA 1VSDA 3QINA 2HHSA 4CIGA 2YNHA 4DTJA 1C0MA 3O3HA 1XNIA 1B9DA 4HCBA 4KHNA 4B9WA 1BIUA 3QBYA 3AO2A 3VA0A 1NOYA 4HUEA 4CF9A 3PUFA 3PO5A 3L3UA 3OYNA 4AHCA 3DI6A 1VSIA 1NK9A 2BUDA 4M3WA 1BGXT 4QVZA 3L2VA 3OS0A 3OVNA 3CFPA 1TL3A 2DFHA 4Z4HA 3L2WA 3NF7A 3ASKA 4QQGA 4Z4GA 2K3XA 1IKYA 2GF7A 4DMNA 2GV9A 4F4KA 4E7IA 4IUUA 1RBVA 3JYTA 3OYCA 4M3ZA 3HPGA 3V9WA 3SCXA 4Q5WA 1TK8A 3MAQA 3RMCA 3O3GA 2YV0X 4DU4A 2HHUA 4CHYA 4CJFA 4CEFA 4CEAA 1IKWA 1B92A 1DLOA 4CE9A 3CM6A 3QKJA 5HRRA 1RBTA 3O4QA 3MEDA 4DTOA 1VSLA 3KTQA 3LGLA 4CIFA 2E6MA 2L8DA 4QAGA 1JLEA 3VQDA 1RT4A 1QQCA 5KRTA 4NCBA 2L89A 1N27A 1TKXA 1FXXA 2RI3A 2R5AA 1UWBA 4QCLA 1LAVA 5I3UA 3K5MA 2F8TA 2RHYA 4G1QA 4KI4A 2QQSA 2PYJA 2RJEA 3KK1A 4FZXC 3U6FA 4I2QA 4CJ3A 5FROA 1C1CA 1DTTA 2ETJA 1HNIA 4FL6A 2JLEA 1T8EA 1S1XA 2G8KA 2HQXA 4OLBA 2IG0A 4F3TA 3EYZA 2KZZA 4M41A 2LSNA 3UT1A 2OPSA 2XDPA 3AO5A 1SL0A 3MEEA 3SD4A 4O44A 3AVCA 3S9HA 4CRIA 3SUNA 1JLBA 4FU6A 1CZ9A 4FJ9A 4DQPA 2AJQA 4C5GA 1SL2A 4C8MA 2B8AA 4AHRA 1EKEA 4BE2A 4OGCA 2Q3SA 4KO0A 1SSFA 2YHBA 3OB9A 4PLLA 4M3YA 4C8LA 3ZSRA 3UIQA 3HO1A 4NCAA 1KFSA 2YNGA 4DF8A 3K2PA 4BWMA 3M8QA 4E0DA 4WE1A 5D6YA 3HP6A 1RILA 3ZSVA 3VQ9A 4FLUA 2YKMA 2XY7A 4DTNA 1WJSA 5HRNA 4AHTA 3OYAA 1JLCA 2XO7A 4I9LA 4FVMA 2VG6A 3DB4A 3NTIA 1WN7A 4B9SA 5J2PA 4KAZA 3MEUA 3KD5E 4H4OA 2YKNA 4K8XA 2FBVA 2X6SA 4BDPA 4DFKA 2IDOA 4Z0UA 2K3YA 1X9MA 3NTKA 5SZTA 1C0UA 4IFYA 3LANA 3DYAA 5KCHA 2IAJA 4NS5A 2VWJA 1VSEA 4B3OA 5D6WA 1NKEA 2HHQA 3RTVA 1JKHA 3B6OA 5E41A 3OS2A 3OMGA 5C6SA 3D0PA 1ZBFA 1ASWA 5KGXA 2X78A 5CZ1A 1ZBLA 3PFSA 3NH0A 3V9ZA 4BE1A 4F2RA 1VSFA 4N4HA 1O1WA 3HXMA 1BL3A 1NOZA 3F9KA 2YNIA 2HNDA 4GY5A 1J9AA 3PMIA 4DG1A 3T1AA 4KHYA 1QTMA 3ASMA 3Q1JA 3HVTA 3QLHA 4O5BA 3MP8A 3FDRA 3ZT2A 4C8KA 4RW7A 1XHZA 3LYIA 1KVAA 3NF9A 3FFIA 3OYGA 2OZMA 4AHSA 2EKOA 3U3YA 4FLTA 3ZSZA 2MWPA 4DQRA 1LW0A 4DTSA 5DK5A 5HRSA 4BDZA 3NFAA 3VQBA 1RTDA 1CXUA 2OPQA 2Z1JA 2F96A 4CHNA 2RPIA 3WNHA 2RN2A 3H6ZA 4HCZA 1WSJA 3QNNA 3T3FA 3C6TA 2E5QA 2JTFA 3EY1A 4JRQA 4FJIA 4W5OA 2LVMA 4EP5A 3MEWA 3NF6A 2DY4A 1NK0A 3KUFA 3HSTB 3RRHA 3SZ2A 3MEVA 4TSXA 4W5NA 3ZT3A 4E3SA 4B8AB 4KI6A 1ASUA 2WONA 4CFBA 4N5SA 4B9NA 4EP4A 3VQ7A 3LZJA 3H8ZA 3KK3A 4CJLA 4FJNA 3OYEA 5KE2A 1RT7A 4ZTFA 3TWHA 3AVJA 1BCMA 2HB5A 3AO4A 1J5OA 4JRPA 3HPHA 2HVIA 4A4FA 4OKJA 4FYDA 2EQUA 2M16A 1LWEA 4FJLA 5J2MA 2MWOA 3OJSA 3BGRA 3E9GA 1TK5A 4MFBA 1W0HA 1QHTA 3SI6A 4I2PA 2RHUA 4CF2A 3AV9A 2W42A 4FCYA 1Q8IA 2WOMA 3PX6A 1HYZA 1WSGA 3RMDA 1KHCA 1A5WA 1HYSA 3DLEA 5J39A 3HL8A 3RMAA 5FRMA 3M8RA 4E7KA 4Z4IA 4H4MA 1L3VA 4DQQA 1WLJA 1S1VA 3V9XA 1VRTA 4QQDA 1CXQA 4B9VA 4DS4A 3HT3A 1I39A 3DLHA 1OYXA 4CGHA 4A4HA 3OA6A 2O4IA 3LPUA 2KQ2A 4IUVA 3V1RA 1FKPA 4CGJA 2G8WA 3NBPA 4LSNA 3P1GA 2R5MA 1Q9YA 3QERA 2RJFA 4CJRA 5T7BA 1B9FA 2X35A 2KFZA 4OPJA 1UA0A 3LDSA 3TAQA 2R57A 4FW2A 1WSFA 4KTWA 3OYJA 1TKZA 5K14A 4CJ5A 3THVA 1KVCA 3QEXA 4LH5A 3CQ8A 2E6NA 2NUBA 1BQNA 4QW2A 2HHTA 1RT3A 4J2AA 1VRUA 2OPRA 3RR7A 4E19A 4B9LA 3RWUA 4DFJA 2PZSA 1YTUA 4HCCA 2XRIA 2VG7A 2QK9A 3S3MA 4E1MA 5J2NA 3OYLA 2VWKA 3T19A 3DMJA 1X9WA 1ASVA 4FM1A 4C8NA 1WGSA 3SQ2A 1RBRA 3C95A 3E9FA 2G8VA 1ZBUA 3DRSA 4KRFA 4LD6A 4RW4A 4IG3A 3I0RA 1BHLA 4CHOA 1H3ZA 3HK2A 1WSIA 4IDKA 4PWDA 2EQJA 1SKSA 2HW3A 4CEEA 3AVMA 2DFEA 4PLIA 3AVFA 3VQAA 3SQ4A 4CEZA 3PX4A 4FM2A 3AVHA 1F21A 3CM5A 4CJEA 3NE6A 2WACA 1DTQA 2G3RA 1TL1A 4M42A 3RMBA 3NGIA 4FLZA 2Z1GA 4DS5A 3LWMA 1SUQA 3VQCA 4CFCA 2L3RA 4W5RA 1S9GA 1MHNA 2LDMA 1C1BA 1RNHA 2GUIA 4FZZA 4KHQA 4UC4A 1RCHA 1TKTA 1D8YA 3HVRA 1XWLA 2XK0A 1NK7A 3FLGA 3LLRA 3S3OA 5SWMA 4GW6A 4N4IA 4ZTJA 2DIQA 4DSLA 4OKEA 2YNFA 4N41A 5HLFA 3ITHA 5KTQA 2EHGA 1JL1A 3DLMA 1OZ2A 2RHZA 4ID5A 2P1JA 1RDDA 1IKXA 3PY8A 3SPYA 3AVLA 3MXIA 1FK9A 4HUFA 1JLFA 3QIPA 3ZSYA 1XC9A 1LWFA 4QQ6A 2D0CA 2Y1IA 4CK1A 4NYFA 4XIUA 2E6LA 4CF8A 3L42A 1JLAA 4EDUA 1JL2A 4IUPA 4ELVA 4BWJA 4AHVA 1WAFA 4IFVA 1J53A 2XY6A 4O0JA 3DOKA 3QEPA 2HHVA 4E89A 2IGIA 4DSIA 3L2UA 4ZHRA 4FJMA 1NK8A 3QEVA 1QSYA 1OI1A 4IURA 2FBXA 1NKCA 2PQWA 5HROA 2HQEA 4ICLA 5FDLA 4FLXA 4GMJB 3QIIA 3MXMA 2GFAA 1YTAA 2P5OA 1SV5A 2CKKA 1S1WA 3BDLA 1G15A 4DSFA 4FJ7A 2ITGA 3FEOA 1TV6A 5M9OA 4NZGA 1NJZA 1IKVA 3OMCA 2G8UA 1IH7A 4F8RA 1BISA 3NDKA 4DU1A 5CYQA 1HQUA 4CJWA 4A4GA 3ZT1A 1NK5A 3AO1A 4M3TA 3H08A 1KLMA 3LZIA 4OGEA 3SQ0A 1J54A 2IS3A 4DSJA 1KSPA 2RO0A 3AA5X 3SV4A 2BIVA 3FC3A 4B8CA 4AILC 4FJ8A 3WNFA 2G8IA 5IN1A 3TAMA 4GVMA 2O4XA 1U45A 4QOZB 2OPPA 2FC0A 4Z4FA 3KLEA 3VQ5A 4X34A 3OS1A 4Y1CA 3DLKA 2X4XA 2X74A 4KTQA 4BACA 1IG9A 3DM2A 2KZMA 4Z4EA 4LH4A 4A4EA 4HVJA 3K5OA 4DTPA 4ID1A 4KHUA 4HTUA 4OLAA 4PA1A 4CESA 2B5JA 1YVUA 1TAUA 4C5EA 2P5GA 4FK2A 4OJRA 5JS1A 1S1TA 1JLGA 1U48A 3VN5A 1RDCA 3RR8A 4KFBA 5IAYA 3KK2A 1C0TA 1RBSA 4B9TA 3NH1A 3DRRA 4FJHA 1KRPA 3RRGA 4KHSA 3ISNC 1FKOA 4R5PA 4MQ3A 3V81A 3V9SA 3KJVA 5CZ2A 4O0IA 3OYBA 2R58A 2Y1JA 3QESA 3VA3A 1WSHA 3JSMA 5J26A 3AVIA 2IC3A 4DQIA 2D0BA 4KKOA 3LX7A 3MECA 4CGFA 2EX3A 2Z1HA 3LALA 2EQKA 2FHDA 3QETA 4PY5A 4CEDA 3ZSOA 1D9DA 3PO4A 2KW4A 3NH2A 3SJJA 1CLQA 3AO3A 5HRPA 3L8BA 3GOXA 1L3TA 5KE3A 1WSEA 4KTZA 4DSKA 3LP1A 3CFOA 4DLEA 3V9UA 3V1QA 2KFNA 1HJRA 3CEYA 3OYIA 2DFFA 4DTMA 3C94A 4OVAA 3CYMA 3KLIA 1NJWA 2FBTA 4DQSA 4M3XA 4E1NA 4B9XA 3OYDA 4FJ5A 2XY8A 3KIOA 5CIUA 4DFMA 5KCOA 1T05A 1NJXA 4CERA 4Q0BA 3LPTA 3AVAA 1ITGA 3M8PA 4CF0A 3K5LA 2RJDA 1EP4A 4I7FA 2GBZA 4Y1DA 3ZSXA 3QEWA 2O4XB 3KLHA 3HYFA 3CFRA 1XI1A 1VK0A 1D5AA 3OYMA 1S5JA 5KRSA 1U04A 3K59A 1L5UA 1Z26A 3LP2A 3KKSA 1CZBA 5KGWA 1UOCA 4CEBA 1RT6A 3OYHA 1KTQA 4M45A 4NCGA 3B6PA 3D45A 1EX4A 2X4WA 4CJVA 2BKDN 2DAQA 1TAQA 3NGYA 4CGGA 2OZSA 1NJYA 2ZE2A 1GOAA 1HRHA 3DLGA 4N76A 2HNYA 1REVA 1BI4B 2PYLA 4J2DA 4CEOA 3PX0A 3SNNA 4DTXA 3TAGA 3PMTA 4JS5A 3TAEA 1S1UA 2RF2A 2RI2A 3AVKA 2QXFA 3S3NA 3HJFA 3V4IA 1N6QA 1Q9XA 4N47A 1RT1A 2ATQA 4M3UA 4C8OA 3SQ1A 1TKDA 3OYKA 2LCCA 4FJKA 4PUOA 3ZEHA 2A1RA 4RW9A 2RJCA 3CG7A 4KREA 1WAJA 2XY5A 1S9EA 4CJKA 4BDYA 2JZ2A 2NLUA 4DLGA 1VSKA 3O3FA 4J2EA 1RT2A 2RHXA 3SYZA 1C1AA
chains in the Genus database with same CATH superfamily
1DUXC 4F04B 4EMKC 4CFDA 3NQOA 3VQPA 2NVUB 2L01A 2JWLA 1IV0A 1Z3XA 1LDKB 3BDPA 3B73A 4DV1K 3LP3A 2R3SA 5DMRA 1WKMA 2JS2A 4IO9L 2BUPA 2UXDK 1Y96A 4RTUA 2IGNA 2LFBA 5B5EC 5HDKA 4FPAA 1RBUA 1K9MU 1VQNA 4RLFA 1LCKA 2FPDA 2QEXQ 4FWQA 2M9UA 3MFKA 5LEJA 1DGWY 4BE0A 1OOTA 2G7UA 5LHHA 1V5GA 3IAS2 1PUEE 5KPZA 3ENOA 3CCYA 2QDLA 2V9KA 3AGRA 1U0JA 4UHTA 2CH4W 4H8KA 5LEKA 1YIJI 5F0XA 2B86A 3F73A 5DV5A 2DA9A 4U0YA 2Y48A 5EYRA 4FJJA 2A40A 1K8AO 4NNJA 1LFUP 1UCRA 4O55A 2V8JA 3MVPA 1FOWA 1FBQA 1MIJA 4IUTA 3SUOA 2PY5A 2EPFA 4IKFA 3HJEA 2Y2ZA 1KFDA 5KPTA 2EINH 1HPZA 3DLRA 4F93B 1A04A 4FO0A 4DHYA 3GIBA 3MO8A 2DTUA 2HI3A 4AH9A 2WAFA 2X6YA 4F7UB 3LA7A 3DB3A 1J75A 4HQMA 1MU2A 4HF2A 2KRSA 2WSCE 1X4OA 4LXCA 1P8ZA 2BTFA 5CKEA 4ISGA 2V1RA 2ZQBA 4FM0A 3IS9A 5ILVA 3EUAA 1JBMA 1WJBA 1T33A 2DLPA 1W97L 2O8KA 5CVIA 2CP6A 3KK7A 3CBPA 1X43A 5BMZA 1SG5A 2DL7A 1YJ9T 3LWIA 2IS6A 3OY9A 2FEIA 1BYMA 5E17F 4MLHA 4BQOA 2ZCFB 2PZ1A 4KHPK 3C0CA 4BRKA 2L02A 3K5NA 3KWIA 4RW6A 2WSEE 4ELUA 5HBMA 5J2QA 1J59A 1LAWA 1VQ8N 1HMVA 1RTHA 3ENHA 4DW6A 5GADP 2FG0A 4EMKB 3FF5A 3TOAA 4CZKA 2G7HA 1TWGJ 2CP3A 3IKVA 2X4HA 5GAEJ 1ACIA 1BU1A 1QVGM 2FMYA 3VF6A 1M90R 3CCLN 1N32K 3G6EI 2FL7A 1XMXA 2DFIA 1BI3A 2DPUA 1QVGS 4CJ4A 3BJOA 2DA7A 3HYIA 1GHCA 2YLBA 4J6YA 2JTEA 5D4RA 1BKBA 1EF4A 1P92A 1PU8A 1WA7A 4XU1A 2LP5A 1IO2A 3EG2A 3MD2A 5HLHA 5GAOn 1QVFA 4K41A 4F3OA 4GV3A 1HW2A 1FPQA 1PUFB 4FIBA 4B3XA 4AWXB 1WHJA 1S6LA 3DRPA 1M3HA 1K8AU 2KNBB 1VQLN 2W48A 1L3SA 2DJIA 2XB5A 1N75A 5E3LA 3BR2A 4BUPA 1RI0A 4PJJA 2X51A 1Q95G 3ZR8X 2L4MA 3S1QJ 1HXDA 4IQ4A 3O1WA 3DOLA 4A3LJ 1ENHA 2PJRB 1QCNA 1K8KB 3D5LA 3CVTA 2V1QA 2RQRA 2V6EA 5GAN5 3UWNA 2MI6A 4FSVA 4RAYA 2QA4N 2KZVA 4FXDA 2O4GA 2ID3A 1VSHA 4I99C 1WFXA 3LH0A 1T03A 1UG0A 4E7HA 1JEGA 4JLHA 2E1MC 4LD9K 1FBSA 2QCOA 3A5NC 4HNVA 1KG1A 1W1FA 3MX2A 3E6DA 3S1MJ 1UZCA 2E19A 3QJ6A 3IWFA 1TK0A 3J81K 3CUQA 3SK3A 4FSSA 1XNQK 3CCSN 1UFFA 2R5YA 1A5JA 2CW7A 5GAMe 4CC2A 4BR0A 2JPSA 3MWPA 4C23A 1N25A 1BJZA 2A68F 1VQ5T 4JKDA 1V29B 2IVNA 1FT9A 3V6DA 3H0IA 3OSGA 2AKLA 4F2SA 4WWCA 4M9XA 4BAYA 3N4PA 1AZGB 4LY7A 4PJLA 2A6AA 1KG2A 1VQ9I 2P9IA 1LWWA 4BBSJ 3TANA 3KLFA 1KD1O 2V9VA 4CEQA 5KI6A 2HVRA 3C65A 3QNOA 1NJIO 3VV0A 1M4ZA 1YBYA 3D2EA 4XTWA 5LJ5f 2HVHA 2P6SA 2JUFA 4C3HJ 3SV3A 1IDZA 3VQ6A 3RI4A 2L9RA 4DQ2A 5E3NA 1NGIA 2QVOA 5EG0A 4LG0A 3KZBA 1KQ8A 2QKBA 2E6ZA 2FYKA 2MLKA 5TRDA 4PQUA 3HP9A 2PMZA 3QO9A 3MP6A 2IVWA 1QZ5A 1YI2I 1ZA1B 2HYGD 1R0AA 2JSCA 1ILYA 4NC8A 3HM9A 2DAOA 4LLNA 3I9V2 3CMEQ 3A5MC 4DBRA 2VKNA 3ULRB 3H0DA 1FW6A 3A1YA 3CWUA 1VQ6Q 1E3OC 3CC2Q 4LIUA 3EGUA 3MEAA 3G71Q 3NHGA 3K0SA 3EUHA 4N4GA 1G59A 5FD5A 1YRNB 1UHWA 1IBLK 3P5JA 3P7NA 2FX0A 1ZBIA 5TGTA 4AI4A 1XG1A 4N0AA 4WK8F 2KGTA 5GINA 2V1XA 1Z21A 2GIVA 4XRSG 3ZSWA 2XF6A 3C2HA 2YS9A 2QQRA 4GRIA 1AD5A 1S5LC 3CCVN 3OR1C 2HL5C 2JHNA 3BUZB 2A1SA 5LJ3j 2LCSA 4OVLA 2UU9K 3TPQA 3JRCA 2ZJ2A 4CK3A 3Q9SA 4HNUA 3D0SA 4M6YA 4JLIA 1RDBA 1WUAA 3DKYA 3FK6A 2D0QB 1BIZA 1OU8A 3H35A 3LMMA 1S1NA 4UUSB 3SUPA 2HHHK 4B9UA 2E2OA 2OTJN 5KVRA 5CKDA 2VQGA 2HHWA 3CD6A 3DLBA 2P0QA 3GNFB 2M0YA 3VF4A 3K57A 2HVQA 3WU1B 4RW8A 3GTKJ 1JLQA 2FU4A 4NC7A 1X1PA 3NGPA 5GANh 1DP3A 3FFKB 1KD1U 1VQ5A 1RT5A 3TAPA 3AVNA 1YXQA 3CMAT 2Z99A 2HHXA 4PJOC 2LRDA 5GADJ 3E5QA 3DLAA 3SUQA 2A0FB 1MPGA 1YJNQ 4DB3A 5IT9E 1NJIU 3F5TA 5AQFA 2O88A 2ZGYA 3O3HA 1WI3A 1XNIA 4B9WA 1BIUA 2JUGA 4IX7A 3QBYA 2MBFA 3AO2A 2NS0A 2CUDA 1BR1A 1U5SA 3SXYA 3VA0A 3EYIA 3TTDA 3FZHA 1BOTO 3KZIC 1H88C 4HUEA 3A8MB 1U9NA 1HUXA 3L3UA 3GP8A 5AQWA 5EJCA 2XI9A 3IUCA 4BNCA 2DMOA 2F2XA 5FU6C 4ESRA 2D1HA 2K4BA 3BTJA 5BOXA 3A0BC 4Z4HA 4MQVA 3L2CA 2MOXA 4JI1K 3L2WA 2STWA 2DNUA 5BRHA 3MMYB 2K3XA 4C0FA 2R4GA 1BM9A 4XLHA 2K9GA 2VBZA 5EDNA 2WY7Q 4A2UA 4BL0B 2D0NA 3HPGA 1RDWX 1T2KA 2D0OA 1FX7A 1MMGA 3CCMQ 5GANe 2QSGX 2HOTA 4DU4A 3QYFA 4CHYA 4CJFA 4G6DA 3BDUA 3KP6A 4B1UB 3JRDA 3E3VA 3CC7Q 2FVUA 1RESA 1RBTA 3PSIA 3TSWA 1MBGA 2LQKA 1F5TA 1JJ8C 4R79A 3KTQA 3DXMA 3LGLA 4J7FA 1VQKA 3HIFA 2PMHA 3A5LC 2M34A 2LF8A 2EYYA 4QAGA 3SAFA 1JLEA 4JQFA 3PIOA 1RT4A 3JB9I 1OCRH 2HD0A 4NCBA 4RAZA 2L89A 1TKXA 2E70A 1D5YA 2MH9A 2RI3A 4P5NA 2KDSA 4J9DA 3K7AJ 2X0LA 1M2VB 4DUZK 2O8FB 5I3UA 1ATSA 2F8TA 2VASA 2QQSA 2FSKA 4CC3A 4YOWA 3EFOB 5JLWA 5KK1A 3U6FA 3CXCP 4PKHA 2ECBA 2FQ4A 3F2KA 1R1TA 2ETJA 2VJJA 3CMEI 4DQ8A 2W82A 2RQUA 1T8EA 4MFDA 4C2MJ 1YG2A 2HQXA 4OMFB 4OLBA 4F3TA 4A0XA 1VQ6I 2KZZA 1T3VA 2K7LA 3O9QA 1E6GA 4M41A 2LSNA 2OA4A 4DV5K 1OQYA 3CMAA 2K5CA 3AO5A 4PJOB 3LL3A 1LJ9A 2QEXT 3SD4A 4CRIA 3KXTA 2P8TA 4KGVB 2W7NA 1YOVB 4DBFA 5LBQA 3LL7A 4AG1C 1Z1DA 2V1NA 5LGUA 3F8CA 1JLBA 4FU6A 5HS9A 5GIPA 1W4MA 4FJ9A 1TBXA 4Y13A 2F4OB 4XRMA 3T9NA 4C8MA 1EKEA 3EPZA 4OGCA 1GDTA 3A5OC 3U4LA 2YHBA 2XSJC 1VOMA 5C12A 4PCQA 1KZHA 3RKQA 1BOBA 3W2VA 3HO1A 5K7HA 3JCMP 5FU6B 1RKWA 1SZ2A 5GIOA 2DK8A 2X48A 5BNGA 1UGSB 3K2PA 2RD1A 1FZPB 4WE1A 4BRHA 4MEYF 2M9HA 2UUZA 3HP6A 2NVTJ 3SFIA 4HSTA 4AIKA 3U9DA 1HF0A 1SEUA 5EXWA 5K7FA 3PO3J 5D7UA 4X9CA 2YKMA 1P2FA 2OU2A 4IXCA 1YITN 1FC3A 5IY5H 2ZJQL 2JMCA 2QYZA 2X1DA 1ETQA 3CCJI 1RAHB 3EGDA 5AQNA 2WWYA 2LP0A 1N39A 4KH0B 2Y4XA 1JLCA 4FVMA 2KIFA 3M0QA 2M30A 3HRMA 3DB4A 1UECA 8ATCB 1WN7A 4KAZA 3CJ1A 2VXEA 3IQLA 2NNYA 1K73O 3VYUB 5F0FA 2K3YA 4ZZLA 1O3RA 4EMGA 3KFVA 3LM2A 4RB0A 2QAZA 3LANA 5ICCA 1UE9A 2WAQN 2NUTB 5KCHA 5LRSA 3DPLC 4F55A 3CJCA 1WQ2A 3DKWA 2BTTA 4O8KA 5E41A 3OS2A 2YRDA 2E7XA 2R7DA 3L9FA 1VYTA 5DTDA 3WXKA 1ZBLA 1TNTA 4OFEA 1I07A 4IF4A 5AZJA 3GF2A 1SS6A 4P1WA 4K42A 4BE1A 3CCEN 1VSFA 5CQEA 2DD5A 1HNXK 1NOZA 4ILHA 3LCNA 2BZXA 4GY5A 1W6XA 2VUBA 4BS9A 4Y3OA 1RUNA 4U87A 2DJQA 2P9LB 1NYFA 1R0CB 3OW2M 1NYGA 5CCAA 3T1AA 3VWBA 4KHYA 4N4NB 1VQ8A 1XSXA 3OW2S 2NUZA 3HVTA 1TWCJ 1HOMA 4O5BA 4A3IJ 3O9TA 3D2FB 3M54A 3LYIA 3CC7I 2E2QA 1TWHJ 1RFQA 2OZMA 2EKOA 1V4TA 3U3YA 2JVHA 4NHJA 2EJ9A 4HG2A 4LOCA 3BG9A 1CXUA 1U5TC 4EW4A 1HLVA 1Y0NA 2F96A 1T56A 2RPIA 3FSPA 2RHKA 5DEQA 1TSFA 1WSJA 3CWTA 1E3MA 3M56A 2HEOA 2JTFA 3VRZA 2EFNA 2F2EA 4DK9A 3GFLA 4WFAL 2HDCA 2UYTA 2LVMA 2RQTA 3MEWA 2DY4A 1VQLA 1T98A 3FZMA 3HSTB 1U9OA 1T39A 1ZR2A 4DR7K 2QTDA 3JCMe 3MN6A 3CCVT 4BRAA 3KFWX 3IP4B 2QA4A 2VT3A 1K73U 3JRIA 1RKTA 3VQ7A 3V7SA 3H8ZA 4E9EA 3OBYA 4CZGA 1P59A 1Q82O 4UNFA 5LGTA 1RT7A 2LCLA 1MBJA 3FMSA 1BCMA 1IN7A 4BGAA 4JRPA 5B66C 2E1NA 1SANA 4RTFD 2EQUA 3CCSA 1LWEA 4FJLA 2P9PB 1WEIA 1VQ7N 2JOYA 4MFBA 2AZVA 1W0HA 1YF5L 1VQ4N 4FASD 4YPRA 2CG4A 1LJOA 4AVPA 4M7AG 3SI6A 4I2PA 4CF2A 3AV9A 1Q8IA 2WOMA 3FHNA 2F48A 4IJNA 1UELB 1KHCA 5J39A 1CF7B 4JK1X 2Q36A 3RMAA 5C4JJ 3M8RA 3JRZA 3G2BA 4Z4IA 3T1HK 2W1OA 1O13A 1WLJA 1ZRDA 2JPBA 4K11A 1GFDA 4XLFA 3VS4A 1BO5O 1AU7A 4R8HA 4IIOA 1I39A 3DLHA 4BKXA 5LJ3h 4R0KA 2PFUA 3OA6A 2O4IA 4QSHA 3V1RA 2KKZA 1KAXA 4Z8AA 2XF7A 4EMHA 4HF0A 1ZXOA 4NDLA 5KYUB 2ASOA 3P1GA 3CC2T 1DU0A 3ULEB 3G71T 1QLYA 5IT9O 5CVUA 2NOZA 3QERA 2RJFA 4MMLA 4ESJA 4EJYA 2DO3A 2GQIA 1YQKA 3WT0A 2KFZA 3DTEA 1ZKGA 4JD2A 3LDSA 3G1JA 4M63C 2L0AA 2YLCA 3VS0A 5CKFA 4FW2A 1U5TB 2ROTA 1WSFA 3JRFA 3F10A 4KTWA 3OYJA 1R22A 2GLOA 4CJ5A 2MD0A 3BC8A 1KVCA 4NQWB 1K4SA 4WXCA 2L2OA 3QEXA 5J1UA 4C92E 3CQ8A 4KIFA 4JI5K 2DERA 3Q0VA 1WJFA 4XU3A 2H1LA 3RIRA 1BIAA 2OPRA 5FKNA 4EVIA 1ZQ3P 3F6VA 3RWUA 1IB8A 1YTUA 3C12A 1YIJN 3KETA 5E79C 3VRYA 4F7ZA 2VG7A 1Q82U 1L0OC 2YHYA 2ZGZA 4E7SA 2FBHA 1WJDA 2QK9A 1FJGK 3CCVA 3BROA 2K85A 5D6FA 1WPYA 5KCMA 3OYLA 2VWKA 1X9WA 1V4RA 1FEXA 1T44A 1TS9A 1YS7A 3K4BA 1ATRA 5IWAK 2P4RA 3E9FA 2A37A 3S1RJ 2G8VA 2HF4A 3DRSA 4RW4A 3R0AA 1RC9A 1ON1A 4RA2A 4M7AD 2PVOB 1QZEA 3SMSA 1X6GA 2LSOA 1JJ2P 3M3YJ 3SDGA 4F17A 3M57A 3BY5A 4PK4A 4IDKA 4YOYA 3PVLA 3TOBA 3LFUA 4CYDA 4CC4B 2KP6A 2MG4A 2CS3A 4CEEA 3AVMA 2DFEA 1I5OB 3THYB 1YX5A 3AVFA 2E5ZA 2MA3A 5KHDA 5F08A 3VETA 3AVHA 1F21A 1UG2A 3JCUC 2K02A 1LOTB 2RM4A 2HMAA 4A5NA 4OMQA 3CCQI 3HC7A 2O5RA 1W4SA 1KYZA 3KHYA 1UUEA 2CSIA 1KA8A 4EHUA 4M3BA 3DEEA 2DYIA 4PGHA 2K4YA 2MCNA 3THWB 2RQWA 4XONA 5GP9A 2XGEA 2IS4A 4AF1A 1SUQA 1ETVA 1BL0A 4M7AA 4UY8I 1BA0A 3HTSB 3SWNA 4HOBA 2IP2A 5KAFC 4Y91A 3CCMT 4M71A 2LTPA 1NKUA 2E2JJ 4LJZF 1RCHA 1TKTA 1WH5A 2H3GX 3G6EN 2ZCWA 1RNLA 2DQLA 1NK7A 4ZN1A 2ZPEB 1KQ0A 3LLRA 1S72Q 4BB7A 2IA0A 1Z67A 3K9TA 3CW7A 2HDAA 4ZTJA 4DSLA 3U23A 2EIFA 2EFWA 3N4MA 2YNFA 4C92G 2EHGA 1JL1A 4XLPF 2YWWA 1OZ2A 2FO0A 4ID5A 3GL1A 3VEOA 1U2VA 2AQEA 1BA1A 3ONQA 2KI7A 1QA6A 1FK9A 4HUFA 1JLFA 5B1BH 4CCKA 3ZSYA 2OPTA 1LWFA 1MMNA 3RJPA 2D0CA 5L3CA 2Y1IA 2QF7A 4BRLA 4NYFA 1OV3A 3TTCA 3EFRA 2DT6A 3EUKL 2E2HJ 2JTMA 2DL3A 2KYBA 3EE8A 1QCFA 2E6LA 2HBPA 3L42A 3DTKA 1OCZH 3F6OA 1JL2A 4RUGA 4XSXF 5LJWA 3M9AA 3KYLA 4NB4A 2IAIA 5FFZA 3EKSA 4W1UA 1D8KA 3CCET 2RQPA 3TGNA 2I0NA 4DOWA 3I33A 1YQRA 4MO4A 1X6BA 4RGSA 4IURA 2CYZB 3X26B 2FBXA 3K2AA 4H0YB 1NKCA 4AVZA 3MZYA 2HQEA 4NC6A 1EWQA 1TUYA 5E1XA 3QIIA 2GFAA 3K4LA 1Y39A 2RDPA 2CKKA 1V1CA 1YQLA 1R77A 1SFUA 3CETA 4FYYB 4FJ7A 3EO3A 3EHRA 3HSCA 3MKDA 1VQOI 5MLCQ 4AIHA 1Q81O 1VQ9N 3EGXB 2XVCA 2P9NB 2E5NA 2HTJA 1VYVA 2M5WA 3LSMA 1AWCA 2AXLA 1BISA 2DW4A 2BV6A 1NGDA 4A4GA 2KHMA 3ZT1A 5FJ8J 2W04A 1P7JA 4DV3K 4G7OF 3H08A 1JTXA 2VJ4A 3QPLA 4XICA 3M53A 4AIDA 3HEFA 1IGQA 3HM5A 1N36K 1W2BP 1U78A 5GJWB 2BIVA 4E9GA 2ZJRL 2QM1A 4B8CA 4AILC 1TXQA 2D45A 3ZQCA 3AL0B 2OD5A 1KU7A 1YUWA 2JVGA 3I64A 4PSWA 4HT9A 3M1CA 2V52B 3C2BA 3VOEA 4M75F 2OPPA 4Z4FA 1YI2N 5GAOr 2GOMA 3OSFA 1Q7YC 1IXCA 4C92D 2X4XA 3V7RA 4A3JJ 1JCEA 3VS5A 2X74A 1VUBA 4CJ7A 4BACA 3HG9A 2RK1A 3DM2A 3HOZJ 4HVJA 2FPFA 4C30A 2DJZA 4OLAA 1KU9A 2EZLA 1IJWC 4PA1A 3HKSA 4CYCA 1N3AA 2E1CA 2VUMJ 2O2OA 3RBBB 4C5EA 3WEEA 3GNGA 1HDPA 2GNCA 4OJRA 2WAQA 5JS1A 1S1TA 1U48A 1IBMK 3H5AA 3U21A 1OMIA 4GY2B 4LUEA 5FLXE 1KFZA 2F4IA 1NEGA 2BW3A 4C92A 3QDFA 3DRRA 3G7ZA 4O5FA 1FKOA 4R5PA 3CCEA 4J01A 3V81A 3CPFA 3O6BB 3DLLA 1S72I 4QWQA 3ZMSA 3O1BA 2YXYA 5CZ2A 4DBQA 2NXNB 3RSEB 2R58A 2LMJA 2DO7A 4CZEA 4HDUA 1BR4A 3VA3A 5HLGA 2QDYB 4CXFA 2XUBA 2QBYA 5J26A 3AVIA 4KKOA 3LX7A 1E3HA 3FIFA 1N8RC 1R1UA 2EX3A 5AFUH 3LQRA 3RUXA 4DV6K 5F2RA 3QETA 4A57A 2XSDC 3DCFA 4E47A 3OSSC 4XLEA 2DTHA 5FPEA 2VE8A 3SJJA 4IPAA 1GUUA 2LQNA 2W40A 3JXUA 5BQTA 3GBTA 3OIQA 1AHJB 3FM5A 1DQUA 4DLEA 1IN5A 3V9UA 5M5YJ 1HJRA 4I09A 4LN2A 2DFFA 4DV7K 4DTMA 2FBIA 4XM3A 3RESA 3PUBA 4YRVA 3F9MA 4JI6K 3IKMA 3TTFA 3KIOA 2DILA 2YHXA 3A01A 1J2XA 5AR0A 4PSXA 4J9BA 3AKZA 5E1WA 9ATCB 2RPNA 1NJXA 1XSVA 3GF5A 5AZIB 1R49A 4JKGB 1LPLA 3LPTA 3K5LA 3C18A 1X3WB 2L3DA 3FISA 3CCUI 1ZGWA 2I2LA 4PZJA 1WHHA 2GBZA 3LH5A 3MMVA 4KH6A 3UKUB 2YG9A 3H0GJ 2IEKA 3ZSXA 4MFEA 4WF2A 3CFRA 1S9HA 2HNHA 1Y0UA 5KRSA 2FB7A 1VA7A 5TKWA 1UEBA 2KBTA 3JW4A 4U0WA 1K83J 2ZXWH 4FT8A 3BG6A 3HDDA 1MMDA 1ESVA 1VQ7A 5EGOB 1AEYA 5GTHC 5KQ8A 3T8RA 3M3ZA 3WXMB 1NJYA 4CZMA 5F0CA 3HGYA 4BR4A 2E12A 2HNYA 1KYWA 1BI4B 1REVA 4Q4ZF 4I98B 3SAGA 3PX0A 3O5ZA 2RKHA 5F1RA 2V79A 4AUXA 4DTXA 1B34B 3K2ZA 2WB1N 2CZ6B 3TAEA 2E71A 3H3VK 1Q86C 3AVKA 2K7AA 5LL6Z 3EZWA 4FT2A 2W85A 3CMEN 2ATQA 2ZO4A 3QWXX 5IPAA 2VQLA 4C0ZA 1R71A 3H36A 4K43A 2LCCA 1JKRC 1T6CA 1ZQ1A 1PVEA 2PMUA 1YWPA 5C3EJ 3U8XA 1HA8A 2PJPA 2A1RA 2W4SA 2XDDA 3CG7A 1K8AC 1BJAA 3G6ET 3HSEA 2XY5A 1U3EM 3I5RA 2J6FA 4JYAK 3W6JB 3ZMVA 3HGGA 1WXUA 1J6ZA 1YW8A 3MKZA 2EZHA 3GWZA 1ZC6A 2N8GA 4DLGA 2OUMA 1PJRA 3O3FA 1WH7A 1IGNA 3D5RC 4ENKA 4M77D 3KD1E 1A5VA 1TQIA 2HMIA 1E2XA 2B6AA 2GFUA 1QSLA 4FX4A 3BOQA 3IG1A 4RG2A 2D9TA 3RYRA 5FRNA 3VS2A 4A63B 4DJAA 1K61A 1IC8A 1D0ZA 1U4BA 1YIJA 4Z4CA 1PDNC 3K58A 1NM1A 2DXBA 4MO7A 4FTHA 3H3UA 4ZDOA 4KT0E 1OEBA 3OMYA 1V76A 2HNZA 3CCJN 1XTDA 3C4SA 2DJNA 3TR8A 1OPLA 5I9EB 3L00A 4O4GA 4JBAA 4YFNF 4AIJA 3C7JA 3EAEA 1IN8A 3LAMA 1XNRK 3H3OB 3IRXA 2BDPA 2MW8A 3FDYA 3F23A 1WNSA 2DZCA 2O8CA 4EATA 4U7DA 2CP7A 4Z02A 1QKWA 1D9FA 3D7EO 1K6OA 3VTIA 4B9QA 4PL6A 3F0CA 4BQAA 5C0MA 4J9IA 3H9GA 2VKDA 3O4NA 4M78D 3ABUA 3MEGA 4A3BJ 4JKEA 6PAXA 4BREA 1PVSA 1UHMA 2LKSA 1Y71A 4WYBA 5CYMA 2K2MA 2BVMA 2QKKA 1IZ6A 4KHWA 1U06A 1M1FA 3CQTA 4CJUA 3GMEA 3GX4X 1RRJA 2MF2A 3WXIA 2PVDB 3M1FA 2KDOA 2IOCA 3ZEUA 2C0OA 2B4JA 5A0LA 4OIPF 3BY6A 2P81A 2JT1A 1RTJA 3F70A 1XHXA 4A2AA 2GX9A 3H5RA 3RERA 5F64A 4IQJA 3G6EA 3W3DA 2QTVA 5GMKj 2X6NA 2CP0A 4M7DD 3S16J 4PFPA 3I55Q 1GLJO 4ZN3A 2J05A 3H1VX 4KGXB 2H8WA 1YJWT 2M0OA 2NNNA 5CQYA 2MFZA 2ELJA 4BG9A 1MJ9A 1Z3YA 1RETA 4AU7A 1TWFJ 1JXEA 2UWMA 4HF1A 1XOVA 4CVNE 1MKMA 2LBFA 4CZJA 3X20B 5HS7A 2NRAC 1AOJA 2X1CA 3CJRB 1EXQA 1QRYA 2BZYA 2UXNA 1X2MA 3B6CA 2CV2A 1BBYA 1JI8A 2M1HA 3CXCM 1ONVA 3CCRN 4G9YA 3CZ6A 5BR9A 3QJYA 3CUOA 3IAYA 3CXCS 1A5XA 4N9IA 2WBMA 2VPLA 3A0HC 1C6VA 2G8FA 1ZARA 5GAHJ 1NJIC 5HS8A 4M75C 1Y96B 4M3RA 1BW6A 2OA8A 4ATOA 5KH6A 2V7YA 3QG1A 1YHQQ 4JI7K 4DOZA 1SQKA 4CIEA 2CGHA 4C1NI 3PIPL 5CVVA 3QOEA 4BC4A 1YW9A 3JB9H 4CO8A 1TG0A 3IHUA 3DKXA 4CI6A 1T0JA 1QVPA 4DTRA 2R5ZA 3WTSC 3J7AP 4LF7K 4ITVA 4F7UG 1UA1A 4JI0K 2AQFA 2VOPA 3I71A 2LQWA 3HSRA 5K5QA 4XSZF 2Y30A 1QE1A 4PJNA 3KWGA 1AT1B 5FLXO 4DU3A 1X1DA 1HQEA 3WTWC 3BPVA 2EQMA 1VQ9A 3H45C 2H27A 4XTXA 3LSPA 3VUZA 4IBNA 5DDGA 3EN9A 3VQQA 4YFKF 4O5VA 3CPWP 2H6BA 4FZYA 3GO5A 4P5OA 1XMAA 5DM6L 2KK4A 2I7PA 2K3BA 4CJPA 1DGRM 3VPZA 4DZPA 3JCMQ 4KISA 3NTHA 2P51A 3JAMK 1M8MA 1TVRA 5FKOA 2MAMA 4QS8A 4CK2A 1HYOA 1JKQC 1J3TA 3RDVA 4CCHA 2VB6A 1I94K 2XIDA 4J2BA 2V8KA 2VGNA 1K6YA 1C6VX 4UB6C 3CC4Q 2C0IA 3I5SA 3T1YK 1WZOA 2V7FA 3NRVA 3SEZA 3LW5E 2ASMA 2DL4A 5LJVA 4BHCA 3ZX3A 4F52A 1ETYA 3QMLA 1YI2A 1MSEC 3WVEB 1A6IA 2DODA 4MDXA 4E7LA 2FNAA 3A8HB 4YNQA 4D9JA 4BC5A 1YJWA 4V19K 4YOUA 3R6OA 2M4GA 3TU5A 2VKEA 4OMPA 2BHYA 2X6OA 1JJ6C 3ELKA 3COAC 4C8QE 5AQRA 3EEQA 4EM1A 1RGIA 3HZJA 3ZFJA 3TKYA 2ZPFB 2CGJA 2G8HA 4CBUA 3JTGA 3VEYA 1QNTA 2CSQA 1WI7A 5GANf 3CESA 5JS2A 1Y97A 4DGWB 2D4WA 5CVJA 1VQNQ 4Z89A 2CP2A 2KHOA 2O6GE 4CJSA 2HBLA 4HUGA 3G1LA 1VFCA 2O8XA 5LJ3d 4V2GA 4M75B 1SKRA 1WJQA 1S7AA 3PNWC 5CHZA 2VPRA 2UUCK 1S8NA 1VQMI 1J5EK 3CERA 2XAFA 4PKCC 2W0ZA 4A0YA 5FLVA 1M5Q1 3EUHC 1YQMA 3QICA 3X2QH 2BZ8A 2F8SA 2DOEA 4F14A 2BGGA 1HKTA 2JGUA 1F9NA 5IHIA 5HP1A 3NAEA 3ZSQA 4CJQA 3J7ZO 2OTLI 1JU5C 4N0AC 1QS4A 2HMPA 5EY4A 2VYTA 1NM7A 3ALYA 4K8ZA 1WBBA 1Y7XA 2F5DA 1G4DA 3MXJA 3J81E 1OYWA 5BPDA 2YUNA 3S2DJ 2YCHA 3GOIA 3MN5A 3GUDA 4I9QA 3MN7A 1IRFA 3VSLA 2GCXA 1WJCA 2FPEA 3SPZA 5KAIC 2B63J 3LDLA 3CCQN 1NPRA 3BTLA 1FSHA 4FPBA 4HHTA 2AIRB 3SJMA 2Q0RA 2FZCB 2LTOA 1K78A 4ILJA 2R5YB 1YHQI 5IHNA 1BDGA 3CJAA 3QINA 2HDWA 2WV0A 2HHSA 2CZ7B 4M7YA 3P31A 2YNHA 2E7WA 4FM4B 5FU7C 1C0MA 2R92J 3ZX2A 3ABLH 1B9DA 4F3QA 3ZXSA 1R1VA 4LLLA 4II2A 3I3LA 2DDBA 3JB9D 2P9IB 5AQKA 2EPDA 2EQIA 3QPHA 4HVUA 3PUFA 3OYNA 2YPRA 5H6RA 3J80K 1NK9A 3G25A 2Z9OA 1LDJA 2BUDA 3FZKA 2KRCA 1NGJA 3WG9A 3IAM2 4QVZA 4BH9A 2DFHA 4EMKA 1X2KA 2JMAA 1ZG5A 2Q97A 3K4JA 3BG7A 1WJ5A 4DMNA 2GV9A 3BG5A 4IUUA 1RBVA 4YEJA 1QVFM 1KC8C 4LDUA 3N05A 1I1GA 1QVFS 4LG0B 4Q5WA 2WC9A 3MAQA 3RMCA 1IJJA 4B43A 4OP0A 4AM3A 1P7IA 2LD5A 4G8XA 3CC4I 1IF1A 3WGIA 4MDWA 2HCKA 3CM6A 1LWVA 3QKJA 2YR2A 2WB1A 3I35A 5IOYA 3BR6A 3JRGA 4DTOA 1PUFA 1QHAA 2VKVA 5CPRB 4LFCK 3CMEA 2LT1A 1GVDA 1MNDA 4MNUA 3M8EA 2DL8A 1IUYA 4WCIA 3KLOA 3VQDA 5D4SA 2GXBA 2DZ9A 4FVUA 4ZNXA 4EAHD 5KRTA 2DXIA 1D1CA 1N27A 4H5RA 1K8KA 2R5AA 1WSUA 4Z88A 4S0HB 1NG9A 2PYJA 4PJOE 5LJ3g 1VQON 1LB2A 3DQVC 3IH4A 2PBDA 1HKQA 1DTTA 4OOIA 3K1MA 5DD8A 3QPSA 1WQ7A 2JLEA 3CDHA 2E35A 2DA2A 1K73C 2Z1DA 1XQSC 3KTUA 4AFQC 4KYWA 2DEUA 2FF6A 3TO6A 2EJRA 3BCBA 4RWTA 4D8KA 4M77C 3AVCA 3SEMA 5M1KA 1JQQA 3SUNA 2KT8A 5EF6A 2UZKA 1OX8A 4KT6A 5KNLA 2CV0A 2HVSA 3TVTA 1CZ9A 4FT4A 2F5EA 2AJQA 5GAN7 2DXTA 5AQXA 4ZDLA 4PL8A 4JKFA 4WCGA 3RYPA 1SL2A 1QHGA 2B8AA 3CCRT 2ELHA 4BE2A 3OIOA 4IOCL 2Q3SA 1TUCA 3KZZA 4L9JA 1SSFA 1SVMA 3DKMA 4PLLA 3K1PA 4C8LA 4M3YA 4KRTA 4Y4RA 1FOKA 4PJMA 1VIEA 3CCJA 3UIQA 5J4VA 5AJ3K 1MDMA 3AHUA 1YE9A 3M4OJ 2YNGA 3URGA 2DVJA 5GAN6 1QZ6A 2QI2A 5ADXH 1ZLMA 4K25A 2A42A 2XU8A 3ZSVA 4GV9A 3E5UA 2EBPA 1ZUUA 3EE9A 5FWBA 2LY1A 2XY7A 5C2FA 4DTNA 2UXXA 1WJSA 1AA7A 2DX1A 3TQNA 4F91B 2IS2A 2VODA 4AHTA 3KPHA 2VG6A 2RN7A 4KUIA 3TSQA 1HC8A 3VERA 3I5UA 4CZIA 4B9SA 3V42A 3KD5E 4H4OA 2YKNA 4K8XA 2X6SA 1QZZA 3BR1A 5JVGF 2RVCA 3NTKA 3GZ5A 3H46O 3NVMA 2SRCA 1S72N 5AT1B 3RR6A 1FTTA 2O8BA 2GIZA 4YOQA 3N4QA 1W0TA 1GXIE 3I55T 1HCRA 1NKEA 1MBEA 4DV2K 1XN7A 5EVZA 4PDKA 4G12A 4E9HA 1RR7A 3HL2A 1STZA 2K3FA 3VS6A 4CI0C 1AWXA 4PJOG 1OH8A 4UXNA 1FWZA 3PFSA 1SMYF 1Y07A 5F27A 3CD6Q 1YYVA 3HXMA 1O7LA 5GMKe 4CGZA 1R5ID 4JDSA 1Q82C 2V1DA 3OA9A 2HGCA 2YNIA 2DFUA 4E2FB 2IGKA 1Y6IA 1VQ5Q 3IMXA 1JGGA 2PAVA 2QLZA 2XAQA 4O8UA 1ZG3A 3FHFA 3GFIA 2G9WA 3QLHA 4B09A 1I1SA 4DKWA 2DK3A 1E4FT 1KVAA 1YW7A 3GXOA 4P55A 1HKSA 5DM7L 4DV0K 2DTZA 2KQRA 3SHWA 3CHWA 4AHSA 3Q3SA 5L3GA 4FLTA 3QB0A 3DBHB 3O3KA 3AAFA 4ORZA 3HHHA 4OWRB 5H1SQ 3TL4X 5DK5A 2VBWA 2JJ9A 3FM3A 1V5EA 4XAXB 1GBQA 3QODA 4NLCA 3CCRA 4CHNA 2A36A 5AQVA 3RPUD 1GVJA 4JZ3A 4OMLA 4QPOA 4BRIA 3CCUN 3PNTA 5IYCJ 3LSRA 2WADA 3SFZA 2BBYA 2COWA 4CDGA 2A61A 3O80A 4EP5A 1WXBA 5LJ3f 1ZLJA 4OB0B 3CVSA 4HQEA 1NK2P 3HRGA 5M1OA 4EPCA 2K6DA 4TSXA 4W5NA 2JS0A 4EMSA 3KP4A 3ZT3A 5M1FA 3CIPA 2V9PA 3FR0A 1OYYA 4E3SA 5DCMB 4KI6A 1ABQA 4AYBN 4N5SA 4B9NA 3ZCOA 4RBOA 3V4GA 2FJ1A 3QUIA 4CJLA 2K3PA 3ENBA 3M59A 2YX6A 3RPUA 2EYZA 1E7OA 1MUYA 1UJYA 4ZTFA 2HFHA 4H0OA 1YJ9I 2RN8A 2HB5A 3M55A 4AIAA 1JKPC 5B8HA 2LY9A 1MSFC 4FE7A 1MJAA 3V7CA 2KRHA 4JJBA 1AWOA 2X6XA 4MTEA 2ZSHB 1VQKQ 2XGCA 3FMRA 4IIMA 3OJSA 1QQIA 1TK5A 1N9RA 5KYWA 1AKHA 4LDYA 5BN9A 1X3ZB 4GNIA 2E3HA 3O4WA 1HYSA 4PJOD 3CQZJ 3JSCA 3HOUJ 4ZJZA 2M4KA 3HL8A 3ATVA 2EWSA 4FISA 4E7KA 2K9QA 1L3VA 4DQQA 2IGOA 3J81O 1S1VA 1M2VA 2O8FA 4B9VA 3FBNB 3ER0A 1OKJA 1TUUA 3HT3A 2MSYA 4XK4A 1D09B 5LJ5d 2NRHA 2DYSH 2EFOA 4X6AJ 4B21A 4IUVA 2F1LA 3RNJA 3CMAQ 1M3CA 4CGJA 1VQNT 1M1EB 4PKIA 3DPUA 3KX2A 2G8WA 3QO3A 3KNTA 4BRQA 4B23A 3NBPA 2Q31A 5M5XJ 4RM3A 2HXOA 2OCEA 1GLEG 2FSNA 2KMTA 2OCCH 3EG1A 2FEZA 4PJOA 4B1VA 4LF8K 3I54A 3QYEA 1T8IA 1B9FA 2QTXA 4OPJA 4AFUC 3GFJA 2JNGA 5LHGA 4I76A 1MW7A 3FK7A 1IN4A 1PP8F 2OANA 1TKZA 1IV8A 5K14A 4UV9A 1D3BA 3FXQA 1HBXG 2LREA 4ZYGA 1WFWA 1RAGB 5HDGA 2NRXA 4M4ZA 2E6NA 2DA4A 4DYRA 1MZBA 2ECCA 3CJTB 1PU7A 1VRUA 1HW1A 1P4AA 4E19A 1KQ9A 3LDNA 4DFJA 3FZFA 4CUGA 3GBGA 1MBFA 4JEPA 2ISYA 1VQ5I 2FOWA 2XHIA 1WB9A 4A69C 4L9VA 3BF1A 4E1MA 2FBKA 5J2NA 3LSIA 3A4CA 4IHVA 2LDUA 3K1NA 2KQWA 3NPFA 1A0NB 1ASVA 3QWLA 3BG3A 5CE3A 2IS1A 1E0EA 5GPAA 1CGPA 2Y0SN 4XOTA 2R7VA 3ISPA 3CF5L 1N6AA 1QZYA 2O0YA 1R9TJ 3ZLJA 3GLLA 4KRFA 4LD6A 3ZGKA 2ME0A 1H9TA 4H5TA 2DOAA 2VOOA 1HNZK 3CCQA 1Z7LA 4PFOA 4PWDA 2EVRA 4LB5A 1IBKK 4DYCA 3QBXA 2HW3A 3ZQIA 1ABOA 4QIWN 2ZBKA 2XV4S 3VQAA 1B1BA 3R3LA 2OQRA 3PX4A 4FM2A 4IOAL 2HKXA 3VESA 1YS6A 2J7IA 4CJEA 2MC3A 3NE6A 4Y15A 1I1JA 1CKBA 2GWJA 1NG2A 2WACA 1DTQA 1ORKA 2HKOA 3VENA 2P7CB 2HQNA 2HDDA 3VPRA 3SJHA 2G3RA 2VKHA 3H1QA 1O7FA 3P4IA 4M42A 1ZGJA 1VTNC 5FGMA 1VQ8Q 3RMBA 3GPLA 4EJVA 3RCOA 1UB9A 1OISA 1ZYRF 1IXDA 3LDPA 4W5RA 1S9GA 2EV0A 4BRCA 2EFQA 1X6OA 1RNHA 5HKCA 1J9IA 2E8AA 3H0FA 2IA1A 2F5FA 1HQCA 2F4VK 3DLLL 1UJ8A 5E8IA 1D8YA 3ZOBA 1XWLA 4X65K 4EJZA 1Q81C 3S32A 3KP7A 3DEUA 5SWMA 5EG2A 1LDDA 3MK6A 5LJ5g 5HLFA 3ITHA 5KTQA 2E36A 2RHZA 2P1JA 1RDDA 1V55H 4FETA 1IKXA 5HCKA 4EGZA 2JSPA 1QPIA 2LX9A 4AMCA 1VQLQ 1F1BB 3TP3A 1T3LA 5J1YA 1H92A 2DTIA 2PNIA 1AWWA 2H6CA 4XIUA 2W6KA 4ON0A 5LFAA 2DT7B 3CMAI 2QA4Q 2LZ6B 2PUKB 1JLAA 2E41A 1C0WA 2GBQA 3FJ5A 3FE1A 5HY6A 2A05A 4BWJA 2D8HA 4H0PA 3OHRA 3SDZA 3DFGA 3QEPA 4RDUA 3VS3A 3FX3A 3PLAA 3L2UA 5LRRA 1JTYA 1VQOA 2CSOA 2UV1A 1KHIA 2QWOA 3CCSQ 1QSYA 3A2KA 3A5ZB 3PTAA 2PQWA 5HROA 4ICLA 5FDLA 1Q18A 3K4NA 3UKGA 3GFMA 4JHDB 1OR7C 2KVQG 1YTAA 4IOXA 2P5OA 2GTOA 1SV5A 2GBYA 1GLAG 2WSFE 3H5NA 2P9PA 5I2MA 2L3QA 1SFXA 3LSTA 2JG6A 1PKTA 1TV6A 2CO5A 3VMFB 5L3DA 4UOBA 1CF7A 1P4XA 3ID8A 2QWWA 3I56T 1IKVA 3LSJA 2G8UA 1IH7A 2A5XA 4XORA 4F8RA 5GAMh 3ZQGA 1RUOA 2ZSIB 1J5YA 2OFIA 3NDKA 1HQUA 1S3JA 1EA3A 4U88A 5LY3A 4FWRA 1NK5A 3AO1A 1QQOA 4M3TA 2XRLA 3WG7H 3F21A 4NB5A 4HRIA 1YIOA 3KP3A 3ZP5A 2PFBA 2CZ0B 3B8AX 3SQ0A 2RH2A 3AA5X 2ZF5O 2D1KA 1IXRC 3TEDA 1XB4A 4FJ8A 3A1PA 5KYUA 5IN1A 3TAMA 1JUPA 4MDBA 3SWNB 4M72A 3OH6A 1RACB 2NNWA 4QOZB 3WUHA 3RKXA 2JJ7A 4DV4K 1G83A 3C7NB 2DE0X 5E26A 1MUNA 2MMPA 4X34A 5D5VB 4Y1CA 3DLKA 4GVEA 1K0XA 3CJBA 1TNSA 1CZAN 2DMUA 3H3ZA 1RLQC 5A2QZ 1IG9A 4Z4EA 1U5TA 2XGXA 3A0IX 3WE2A 2XKOC 3K5OA 5A2QK 1AHDP 5LL6S 5GAGP 4NQWA 5DD4A 3J81Z 1EH8A 1PM3A 3SYTA 2QZ8A 1TAUA 2OZ6A 1VQMN 4A53A 3CD6T 3E9PA 1X27A 2P7VB 1B8IA 2ACJA 1U2VB 2L9SA 3CCVQ 3TMOA 3CP2A 2ZKZA 1JLGA 4N9HA 1VI0A 3VN5A 4P96A 2QEXI 1IREB 1RDCA 1HLUA 2OTLN 4A5AA 1T3SA 4CD3A 5K1YA 2QG9B 3KK2A 4OMYA 1FMKA 1C0TA 3LWHA 4B9TA 5JR3A 3H6EA 2XPVA 1KGSA 2KDZA 2CU7A 3RRGA 3ISNC 1Q7YR 2GWRA 2ISZA 4WXDA 4MDAA 3V9SA 2AHJB 1FYKA 2YUOA 2D6FA 2C0TA 2HTSA 2FZKB 4HX8A 4WCEL 2V4JC 4IHYA 5FPMA 3CJNA 1WSHA 4KIBA 2IC3A 2D0BA 2IBDA 3MECA 1OH5A 3QSUA 1TW3A 2ZJPL 1B4AA 3LALA 2EQKA 2FHDA 2RK2A 4HV5A 1RIOH 2NOHA 1YHQN 2J5OA 3ZSOA 3W3CA 2QWMA 3I58A 2EV5A 2K27A 5H6QA 3I59B 3MEXA 3NH2A 4YIRX 3W6KB 2QQBA 5CQXA 2FSJA 3HOVJ 3MJXA 3BT9A 3ZMZA 2X9DA 1TW2A 3GOXA 2MLGA 1VQPT 1L3TA 5KE3A 3I56A 3GW2A 4DNCA 3L1PA 4JI3K 4GKKK 4DSKA 3LA3A 3Q0UA 2NRRA 3LP1A 3ERMA 1JJ2A 1ZREA 2PBIA 4FWMA 1M1KC 2KRFA 5JLFA 3CCUA 5KN9A 1KG5A 4BRGA 4OVAA 3CYMA 3KLIA 1NJWA 2JUCA 3QU6A 4E1JA 2EBIA 2F4MB 4B9XA 4FHTA 2PTKA 5CKHA 1DPUA 5J3BA 2EKHA 1NGGA 1LEAA 1N8RR 4J7IA 3ZQQA 1FTZA 3BE3A 2P84A 2ZWHA 1X2NA 3AVAA 1ITGA 1IO6A 4RCHA 3CQXA 1VQKT 1YN8A 2ASPA 4DOVA 4AYBA 3C0BA 1Z6TA 4M74A 1EP4A 4EGYA 4EA5A 2Q0UA 4Y1DA 3D4VA 3QEWA 1SHGA 4YDUC 5EZHA 1ORNA 2F9TA 1D5AA 2M45A 4KGZB 3AY9A 4WFNL 2LKPA 3S15J 1Y56A 2QWRA 2HKNA 2WUSA 3KKSA 5GAOp 4ABZA 2CH6A 4OMMA 4MZTA 4LK0F 3LWFA 5D5WB 3BQYA 4L9NA 1RT6A 4M45A 1XGMA 1UGPB 2IIMA 1KG4A 3R6SA 2DYRH 1O3SA 4BRDA 2X4WA 2BKDN 2DAQA 5CHIA 4CYCB 3HRTA 2OZSA 2ZE2A 1J0RA 3DBRB 2ZJQF 1H89C 2DA5A 4X64K 4J2DA 1FNNA 3JB9J 1VIFA 3DWLE 4L5EA 3M07A 5C2DA 2O8EA 2E3IA 5DLOA 2L54A 3CWAA 3MWMA 2XGDA 5FPDA 1S1UA 1RRSA 4RTYA 1IV6A 2BW3B 3BCAA 2QXFA 2WBNA 3PIPA 4RB3C 2NAZA 3K6GA 3SQ1A 3NWTA 3RZDJ 3OYKA 4FJKA 4B24A 1QVUA 3R2XC 3EG9B 4QPQA 3ZEHA 2CUEA 1B59A 3NFCA 2VQHA 4ZH4F 2YJFA 2ABLA 4ASNA 1HPMA 1WAJA 2EYWA 4DA4A 4IVNA 2DA6A 2QBYB 1S9EA 1TC3C 5M1PA 1PU6A 2EIKH 4CJKA 3CCVI 3JCMV 4RTVA 3NMZC 1MNMC 1RZ4A 1VQPA 4ME7A 3KBGA 2P4WA 2YX4A 2NLUA 3CMYA 2CRGA 3VEZA 2CGKA 2YUSA 4ZDPA 2HOEA 1VSKA 4XIDA 2RHXA 4B3SK 3FMQA 3ME9A 1Z05A 1I0CA 5C42A 4XQ3A 4JI8K 5GAGJ 1QHHD 1Q86R 1SL1A 1QSSA 1U49A 4G9ZA 2P0WA 1NK4A 2BXYA 4RAGA 4C3IJ 1W1WE 4AHUA 1T6DA 2COMA 2IW5A 3O5BA 2D0AA 1R23A 4LSLA 3H92A 2QGUA 4D5FA 1MMAA 4EHTA 4XRFA 4JNEA 3MDQA 2VV5A 3WNEA 4CHPA 3A01B 3M0SA 1G2BA 1MMSA 1RTIA 4XH5A 1X75C 1WYXA 4PKGA 3E7LA 1ZSZC 1HJOA 1X9SA 2R7RA 2NVYJ 2QENA 3IWZA 3LWLA 4RG8A 4CF1A 1W2BA 1OZ3A 1G5VA 2JW4A 3J7YP 3L2QA 1KQSA 2JVVA 2X3XD 2ENMA 3LSGA 5DM7R 1IG7A 2EFPA 1Z7UA 4OKKA 3WU2C 2DBKA 2EQRA 4DF4A 4XRSA 4BD3A 1N5ZA 2V1UA 1TH7A 3VEPA 3CC2I 1VQ8T 3G71I 2X4YA 1F1ZA 4OPKA 2VN2A 2UUAK 2IXSA 4HZFA 3CCEQ 4HAMA 3CCLT 3UR3C 3VQ8A 3I9QA 4LD5A 1W36C 2O8DB 2HBJA 3R0JA 3ZT0A 4U67L 5I42A 1NLVA 2GELA 2DN0A 5EX5A 4N56A 1BK2A 3WTXC 1UAXA 3EG0A 4IL6C 4XQFA 2LC4A 5EC7A 3MN9A 2EFIA 1RPWA 4B9MA 1QKXA 2A07F 4W97A 1OPKA 3GEZA 4L5IA 5F6FA 4KB0A 1ARKA 3TSZA 2GXGA 2PUOB 1IN6A 3TP0A 1PG5B 4OIOF 1GLBG 2ABKA 5I11A 3THKA 1H8KA 2P9SA 2GEMA 5AQUA 2RA2A 3VDXA 1VQLT 3KLGA 4BG8A 4L0ZB 1F4KA 2K86A 1YNZA 3VU3C 1WDXA 2PQ8A 4WF9L 3V1OA 4A6EA 4II1A 4CECA 2F69A 5AQPA 5I2SA 2Q0OA 4JI4K 3FXOA 1GOCA 2FUG2 2QGGA 2QA4T 2IVMA 3K9KA 1VSMA 1NNEA 1JO8A 2WY8Q 3KEOA 1YJNI 2A5WA 4CD1A 3TSUA 4U7BA 5IXFA 3INZA 4EIKA 1MD0A 3WXJA 4BC3A 4EQQA 3ZT4A 2Z1IA 2EIMH 4KFCA 5DLQE 1DEJA 1S29A 3QYGB 3WGHA 3GE1A 4I6MA 4LD0A 3UA7A 3CCST 2NOFA 3UKRA 2RI5A 4KH5A 3QXEB 3E6CC 1JCFA 1BQMA 1B7TA 1JKOC 2BE2A 3DBLB 3O08A 1FBUA 2E5LK 5AZIA 1BWFO 5HNFA 4JKGA 4A3MJ 4KV8A 2R7ZJ 4DSEA 1Z25A 3HPOA 4O3MA 1S6QA 4M7AE 1ZSZB 4E7JA 3GCMA 2HAXA 2NOGA 2CS7A 1SHFA 3O8GA 1X3MA 4A0ZA 4S05A 4C8QF 1EO1A 3UKUA 5ECAA 1KCFA 1TGOA 4FJXA 1M90O 4IUQA 3NF8A 1D0YA 3CLQA 2DRKA 1YJ9N 4ELTA 3E1SA 1L3LA 3BP8A 1I50J 1VSJA 1VQ7Q 5AQSA 4H4KC 4ENNA 4JUVA 3JCMh 5AIPA 4W5TA 3TI0A 3FIWA 4NL3A 2KE9A 3TABA 3M8SA 2QKMB 1ZG1A 4JK9A 3MCZA 1ZYQA 3L2ZA 3OYYA 3WTUC 2LRQA 3CCMI 4NOYA 3PFYA 4A4KA 3P9CA 4A3KJ 1WJEA 1I4K1 1QVTA 3M7GA 1WGXA 5LD2C 5LMUK 2PMZN 4CHQA 1V5FA 1BI4A 2AP1A 3CCLA 1O75A 1OYIA 5CJ9A 4ISEA 3I8BA 4E70A 3A2FA 4WQ4A 1LWCA 2XKPA 1PRLC 1NJIR 2M0CA 1KONA 2KISA 4CFAA 4CH7A 3AG2H 5C25A 4MQ9F 3VYTB 3VUBA 2EJGA 2EILH 3PVQA 4CGIA 1SKWA 4HLYA 1KSWA 3EQLF 1FMVA 3ZRGA 3BLYA 2DU9A 3ZCMA 3G4SN 4IRIA 1USSA 2YU9J 3DWLA 5C44J 1M27C 3ZEUB 4BY7J 1P6RA 3ULDA 3A8YA 2PI0A 3OOUA 2BANA 2VXDA 3THXB 3R1XA 3T8TA 4YOXA 3LP0A 3G10A 3PNVA 3HBTA 2KL4A 3M9QA 1L3UA 4J9FA 1KU2A 4KH4A 1T7PA 3M4YA 4IHWA 3KZYA 2H09A 2JPCA 1XGNA 1GFCA 4I6ZA 3S14J 3OH9A 3CCEI 1LCUA 2ZXIA 3S6WA 1HNVA 1SKUB 2DETA 1Q7YO 1W7PB 4LF4K 3J7YJ 4M75E 4B6MA 4XL9A 1YIJQ 2OTJT 3EKUA 2RKIA 1VQMA 4JZ4A 4DZJA 1B9MA 1N5YA 4Q47A 3TREA 1AZEA 1D8JA 1ZRFA 2KTQA 5J3LA 2YRVA 2LBFB 1M90U 1WHKA 3VW4A 1HYVA 4KB1A 2J6OA 2LY2A 3KP2A 2OTLA 1MUZA 5AQQA 3SEQA 4LFBK 3BR3A 3MPUB 3M4GA 2EGEA 1KLNA 2OX7A 3C6AA 2Q2EA 3ZQHA 3SLCA 3TQ7P 3UNGC 3CLOA 3E5XA 2LJ1A 3TCJA 1FYLA 1MJBA 1GOBA 1JXBA 4LF6K 2RQVA 4A3CJ 3TARA 3QU3A 3OOPA 1U6ZA 3META 3E9OA 4K2EA 5KYXA 4L59A 4L5JA 1SMTA 1ZX6A 3W6VA 2Z2SB 4UVAA 1NK6A 2O03A 3WE3A 3HOTA 1X2QA 1N8RO 2A6EF 3AVGA 2K57A 2CFOA 1H0MA 5BN8A 2OQGA 1EQYA 5DCFA 4M7XA 4ENJA 2KPMA 3AVBA 3NNQA 2P9UA 3FZVA 1SPKA 4FK4A 1SAUA 2L7KA 4CCNA 2L3PA 2D5RA 4J19A 5H2FC 5JFRA 3VODA 2ELKA 1RDUA 5D5UB 1A35A 1XUPO 1VSDA 1YX3A 1Y8QB 2JRTA 4CIGA 2IJLA 4QVDA 3CO6C 1PSFA 4DTJA 3G6EQ 3O9SA 4KHNA 1WOQA 1R4MB 4EJTA 3VYSB 4JJDA 2HPMA 2DBMA 1Q7YU 1JT6A 4CF9A 2VVKA 1RAIB 2CH0A 5IP6A 1FJLA 4AHCA 4E6RA 1NK3P 1UG1A 1AVZC 1VSIA 1UGRB 2LKXA 1IRXA 4M3WA 5EEAA 1BGXT 5C15A 2XAUA 2LVSA 3L2VA 1OLTA 3OS0A 3OVNA 2Z0WA 4M75G 3LSKA 3H9JA 3M0PA 3ASKA 4Z4GA 1TUGB 4AI5A 1ZELA 1IKYA 2GF7A 2OTJA 1YQAA 4F4KA 4E7IA 2V7ZA 2ZJRF 4DEYA 3JYTA 3AAQA 2E2NA 3OYCA 1XG7A 1BOAA 1LNWA 3L1AA 3TEEA 2KEAA 3VEXA 4JN4A 3V9WA 1RI9A 3SCXA 3CMAN 3B6AA 4JRKA 3O3GA 1U6GA 2IGMA 1X1BA 2YV0X 3VGMA 3HUGA 1JUSA 4HNTA 1Z9CA 3K9JA 2HHUA 3T1BA 2QSFX 4IHXA 3FB9A 1E6HA 3JS6A 1A31A 1ETKA 4MLOA 2JM8A 3FBIB 3O4QA 4YORA 3MEDA 2Z3YA 3WQTA 2AS5F 4CIFA 3D5SC 4D8DA 2HNIA 2BXZA 2NUPA 4BI8B 4NLBA 4YIFA 1FSEA 2E1YA 1N8RU 1PSEA 4PHTX 1DGKN 1G99A 1Q86O 3JCMX 2DMQA 1LAVA 1R7JA 1VQ9Q 5A0DA 1KC8R 4G1QA 1D3YA 1H1VA 2RJEA 2FLOA 2RAEA 4HV6A 1T08B 1YFHA 4MEXF 5FROA 4NO7A 1C1CA 2ECZA 4CBWA 2DYBA 5J1RA 5A0GA 4J9EA 4M6XA 1ZH5A 3AL0C 1NGHA 3VFZA 5IP9J 1I6HJ 4HVWA 2IG0A 1YITT 2CH4A 4MMKA 3WHCA 2E20A 1QQMA 3GZNB 2QSHX 2A41A 2OPSA 2XDPA 4Y17A 3FWEA 2ZPGB 2E60A 4LNPA 3MEEA 2LMDA 2OJED 3HBLA 4BBRJ 3EYYA 3M1EA 5KYYA 1GXPA 2RREA 1BA5A 2FRWA 2KROA 2VWBA 2W03A 1K78B 3B02A 3UDCA 2H56A 2KRMA 2NRVA 4DQPA 3CPWA 1YI2Q 2EW3A 2RMOA 1FY7A 3HI0A 4J6WA 3J80E 4KO0A 2JA6J 3MWTA 3K69A 3M5RA 1YJWQ 2KY9A 2ETHA 4NCAA 3LA2A 4M75D 1N77A 2ZB9A 1VYUA 4BWMA 2PN6A 1K73R 4BXXJ 1Z77A 2E34A 4IJAA 3OS5A 3EH1A 5K7ZA 1RILA 1SSHA 2I8DA 1EJ9A 5GMKi 1ERDA 5HNHA 3VQ9A 4FLUA 1OH6A 4J8FA 4P9UA 4D6WA 2M3AA 4IDHA 4B3RK 2PG4A 1HNWK 4FE4A 1GCQC 3P9IA 4C3JJ 2WC2A 2QEXN 2VI6A 1T0FC 1O57A 5GAMd 4I9LA 3R6MA 2JZYA 5BRFA 4OFHA 3O8MA 5KQDA 2YSRA 1LOJA 4HT8A 2M1BA 3BJ6A 4M75A 4Z0UA 1X9MA 1OFCX 1Q86U 4CZHA 5SZTA 1C0UA 4C8QC 4IFYA 2OAUA 5AQTA 3CF2A 2CQKA 1BC7C 1NLOC 3DYAA 2Y9YA 2YG8A 2IAJA 4BXUA 4C1NK 2VWJA 1VSEA 4B3OA 2QKLB 1RLPC 2HHQA 3RTVA 1UGQB 1JKHA 1H8AC 3OMGA 1SC7A 3J7AO 5C4XJ 2VL8A 3G4ST 3D0PA 1ZBFA 2GOXB 2X78A 4N0BA 3H1CA 2DDAA 3FXLA 1FOXA 2ADUA 3NH0A 3RMSA 2IA2A 1C0FA 5AQLA 4M77E 1MDUB 4N4HA 4RTZA 4OF1A 1ON2A 5K5RA 1POGA 3VKIA 1KQSP 2HNDA 1BI2A 5AQGA 1Y1WJ 3EDPA 4DG1A 1VF9A 5GPCA 1S7EA 2HQ5A 1YITA 5IXBA 1JHFA 1Z9QA 3N5BB 2A6HF 3AAPA 3OL3A 3MP8A 4EM2A 3FDRA 1U8RA 2W10A 3KP5A 1KU3A 2XF5A 4RW7A 2M87A 1XHZA 3FFIA 3K70C 4Y28E 3OYGA 2DK5A 2K9SA 4PIIA 2DBBA 4XU2A 1XPXA 2YX7A 4JJNK 3ZSZA 2MWPA 4DQRA 4G94A 4DTSA 1XD7A 3CJ9A 4BDZA 3NFAA 4HVVA 1RTDA 2GTJA 2OPQA 2Z1JA 4M9SA 3BZKA 2XB0X 2BHZA 3DPTA 1VQ7T 5DUKA 3WNHA 4LK1F 1VQ4T 5BR8K 5HLTA 5E8GA 4B3TK 3VYHB 2VJIA 3QNNA 3T3FA 1Q82R 3EY1A 3LSHA 5AQMA 4K0KK 5CO7A 4L5GA 4FWLA 4UVBA 4XN3A 4W5OA 1I6XA 1NWKA 2RV8A 3NF6A 3HOSA 2XAHA 3K4KA 4M78E 3J7ZI 2LG4A 1NK0A 1YJ9A 4BRNA 2D0PA 3SZ2A 1ACMB 3MEVA 1K4US 2H8RA 3QRFF 1MDMB 3SZGA 3NVKA 5HDNA 1I27A 3DF8A 4GKJK 5C10A 4B8AB 4LFAK 3HTVA 1ZA2B 1ASUA 2WONA 1K9MC 3AG3H 3L4QA 2P9KA 4EP4A 4ZGEB 5AQHA 2QQ9A 2R7FA 4CCMA 3FHGA 1OCTC 3SHFA 2NRWA 4J6XA 3AVJA 3ABTA 3AO4A 1P90A 2XDBA 1D1BA 3OGDA 2HVIA 4A4FA 3O6WA 4OKJA 4FYDA 2M16A 2ICWG 5HLIA 1K4TA 4RLQA 4JX5A 4OMZA 5JLXA 3E9GA 4CSWA 4C8QB 1YJWI 4C2TA 2CZ1B 2HYFA 3ZQFA 3LQQA 4BQZA 2QYOA 1Y1VJ 4R55A 2FF4A 5K5OA 5M5WJ 1JXMA 1BB9A 2W42A 4FCYA 2YJEA 2LNVA 3PX6A 4XKBA 2YI1A 4M7DE 5BRDA 2FXAA 5GJVB 2Q1ZB 3RMDA 5DY9A 1A5WA 2CREA 3G4SA 2X9HA 1TOVA 1XQOA 2FZGB 2O8BB 3DXJF 2K5LA 3F3XA 5J40A 5GAMg 4X62K 2KR3A 3Q0WA 4M77G 1I5LA 1N34K 2VBYA 1VRTA 1CXQA 4FWOA 3LDQA 3UE5A 1U1SA 1YIJT 1MBKA 1OYXA 2JA8J 4KH1B 2M7AA 3CTAA 1VNDA 2RNJA 3LPUA 5E3MA 4Z2YA 1XCBA 1FKPA 2LT4A 3JAMO 2E1MB 2NRZA 4X1VA 5GAOl 4OX9K 4LGWA 4YG2F 4AC0A 2HS5A 3V8LA 1ZBSA 1J09A 4JX6A 2XROA 4CCOA 1X01A 4A5MA 2KYMA 4LIVA 2K5IA 4ISFA 5GANd 4CJRA 4BR5A 2R57A 1LE8A 2BY2A 3G73A 4OPAA 5HL7L 3IC7A 3E97A 4J8OA 4OB2B 3D6RA 3C2GA 4NXNK 2OZUA 4BI4A 3HRSA 3CCJQ 1VQ4A 1B9NA 2XRNA 2JM9A 1IGUA 3ESWB 1GLDG 4CZFA 3LAJA 3MN2A 4DR6K 2L9NA 1ETOA 3R8EA 4XN0A 1M8VA 2HHTA 5GAHP 1RT3A 2JMWA 4J2AA 3ROUA 4BEHB 3RR7A 4M78G 1BR2A 3M0UA 3ULQB 1NEBA 2ZMEC 1PP7U 3WVDB 4HCCA 2XRIA 1S3XA 1AWJA 3V8JA 2VC0A 1K7AA 3K0LA 3S3MA 3JSPA 1GRIA 4A3GJ 2COZA 2KKOA 3RMQA 3T19A 1GLLO 3QP5A 3TSPA 1I3QJ 5GAN8 1TL8A 3ZBDA 3CO7C 1VQ6N 1SRMA 3SZPA 4FM1A 3CC2N 3SDBA 1TYQA 3G71N 5CR4A 1WGSA 3SQ2A 2OV7A 4YY3K 4LC9B 3DV8A 3C95A 3SAHA 4H0XB 2VBXA 1K79A 5FO5A 2O9LA 3P39A 2A5YB 4UVCA 1RAAB 1HD3A 3X25B 4X9DA 4HPQA 4IG3A 3I0RA 2K40A 3RKWA 4CHOA 3PIPF 3PE0A 3HK2A 4CCLA 3WODF 4BYYA 2EQJA 4M7DG 2NWMA 4GV6A 1SVOA 2XICA 3PO2J 4E9FA 3QDRB 2L9VA 3SQ4A 4CEZA 1RUWA 2Y31A 5KYWB 1AKHB 4OO1J 1MA9B 3K10A 4B1YB 2VLAA 4CZCA 2BYVE 4FQGA 1MV3A 1ORPA 2OI3A 1KQ1A 2ID6A 2HSPA 4N4OB 1S7OA 3S2HJ 2ZNZA 4C0DC 2D8JA 3NGIA 2G0EA 1I81A 5DM6F 5GAOm 2Z1GA 2KIUA 3VQCA 2JQ7A 4CFCA 2L3RA 3MCPA 2YT6A 4MIMA 1MHNA 2LDMA 4D5CA 1WX6A 3W2AA 3HPWA 4AM7A 4FZZA 1YJNN 2NOBA 4CHUA 4G7HF 4M77A 4BJ6C 1B72A 4H03B 3DTIA 1M30A 2XK0A 1UJ0A 3CCRQ 1Z6RA 4AT1B 2RB6A 2F7TA 5IYBJ 4OIQF 2CMPA 3HKZN 3UATA 3P9KA 1XQHA 2XASA 1B07A 4N4IA 2KIQA 1GXQA 1FIAA 4N41A 3MAJA 1SD4A 2FOKA 3J80O 1M9SA 3DLMA 3PIOF 1XSDA 2ESWA 3DXKB 4F92B 1QP2A 5GAOq 1KC8O 4KMFA 4F7UE 3SPYA 1ZN2A 4UV8A 2ZGWA 3AVLA 5GAMf 1D3BB 1VQ9T 2L4AA 1ZLKA 4EEFG 4WFBL 1XMQK 3QFUA 1M3QA 2ZMEB 4EJWA 5GANg 2MGQA 5AFUA 4CF8A 3UPUA 5D8KB 4EDUA 4ZYAA 2R7QA 5LGNA 3FGUA 1TTHB 4OB1B 4IUPA 3UA6A 3X28B 4JP0A 2NOIA 1WBDA 4KJZA 1ZBXA 3VS7A 4DR2K 4AHVA 5DCMA 4S04A 3CCMN 3I0TA 1WAFA 1ODDA 2XY6A 1U3OA 1Q81R 4O0JA 3DOKA 4GGGA 2HHVA 1X19A 1KG6A 4DSIA 3FRNA 2B7EA 4XOPA 4ZHRA 3FXKA 1LNXA 3ECOA 4B22A 2DT5A 3CC7N 2RF0A 4ELZC 3QEVA 4M78A 2E2PA 2EH3A 1WI9A 3A8OB 3ZMDA 4OPHA 2XD0A 3ZETB 3MXMA 4XTVA 2XAGA 2TDXA 1YI2T 2CQQA 3ZX0A 3IH3A 2H3JA 1LMZA 2E2IJ 1X58A 3PFIA 1S1WA 4FOIA 1G15A 4DSFA 2RC4A 2QQAA 4LG3A 3A02A 5M9OA 3BEXA 2ZNYA 1NJZA 3QYHB 4M3FA 5JHUA 5FB2A 3OMCA 4UNOA 2STTA 4NXMK 4B1RA 5CYQA 4CJWA 2DQRA 4C0DB 2GTDA 1KD1C 4KITB 4G6TB 3G3ZA 1W5TA 4EW0A 3IV5A 3JCMd 1RAEB 4M7DA 4KULA 1K76A 4LDWA 2GA1A 2NRTA 1J54A 4EM0B 3F8NA 2HF3A 1KSPA 4L9TA 3SV4A 2KT0A 5M1QA 1LPQA 4RGUA 5E20A 3QPTA 1OU9A 3WNFA 2G8IA 4IEJA 4KICA 2O4XA 1KC8U 3S17J 2FC0A 3FKIJ 3OS1A 1E3PA 1YLFA 4KTQA 2QEXA 1TUDA 1NMNA 4HTUA 1P9QC 4NBQA 4QS9A 5L23A 1ZTRA 4CESA 4KBOA 2ME6A 4BY1J 2B5JA 3ASOH 1R5GA 3OL4A 2P5GA 2ZPHB 3PJRA 2TRTA 3G1OA