4E7IA

Pfv intasome freeze-trapped prior to 3'-processing, mn-bound form (ui-mn)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
total genus 110
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7iA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7iA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7iA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7iA03
1HYSA 2RO0A 1VRTA 3H8ZA 3L2QA 3LX7A 2DFEA 4CGGA 4B9SA 1RTJA 4C5EA 1RDDA 1QE1A 3NCIA 1RILA 5EU7A 3VQ4A 1ZBIA 2VG5A 2YKMA 3V81A 1IKWA 4DFMA 3C6TA 1SKSA 3TAQA 3RMBA 3QEXA 3MEVA 4K8XA 2LDMA 3K5OA 2FHDA 3QBYA 1FKPA 1VSHA 2QXFA 4M3RA 3ZT2A 1HQEA 2ZQBA 3LWMA 1JLBA 4KV8A 4CEBA 1CXQA 1KFSA 2PYLA 4TSXA 4FLZA 3V6DA 2OZMA 2D0AA 1LV5A 4FJ9A 1X9WA 5J26A 3NF8A 1JXEA 4N4IA 4Z4HA 1C0MA 5C42A 2PY5A 3KKRA 3KD1E 2EQUA 4B8AB 4CEZA 1JLGA 4QW2A 2OPSA 3V9UA 2Y1JA 2X78A 3OMGA 3MO8A 1XI1A 1J54A 4C8NA 4IKFA 4NYFA 1KLMA 4FJMA 1RT4A 3ZCMA 1J9AA 5JS1A 2EX3A 4NCBA 2EFIA 2BUDA 4GY5A 1A5VA 4ZTJA 4CJWA 4CHYA 4FLUA 4DU4A 3T3FA 2G3RA 4BE2A 3M8RA 3RMCA 1T05A 3AV9A 1JLAA 4II1A 4M3XA 4Z4IA 4LY7A 4FJ7A 4LH4A 3HP9A 4LH5A 2KTQA 1HRHA 1C0UA 1KRPA 5FRMA 3ZSWA 1WLJA 2E6MA 1KVBA 3KLGA 1IKXA 2IC3A 3K57A 3QERA 2XDPA 3OA6A 2KZMA 5KH6A 4E7JA 1TGOA 3NTKA 1SSFA 2RJEA 1WSIA 3T19A 3QEWA 4I9QA 4B9TA 1FXXA 3BDPA 1EETA 1HQUA 3K2PA 4IFVA 2F5KA 5DK5A 1NKBA 4FJGA 4J2DA 2OYQA 3E9FA 5KE3A 4NCAA 3CM5A 3MEUA 3DMJA 4MQ3A 3NGZA 4DTOA 1G5VA 2EQKA 4GVMA 4E19A 3ZSOA 3FFIA 4EP4A 2L89A 4KTZA 4C8LA 1S1WA 4CJFA 2Q3SA 2P5GA 1S1TA 3P8DA 4ZTFA 2IOCA 1C1AA 3CFOA 3HVTA 1C0TA 5T7BA 1RT6A 5J2MA 4CHZA 4AHCA 4FJNA 4AHTA 3OYHA 5C0MA 3AVLA 3AVJA 3OYGA 2IG0A 3EYZA 2IDOA 1YTUA 3AVNA 3HPOA 1OZ3A 2KW4A 1NJZA 3NTIA 1TV6A 3HO1A 3PUFA 4HCBA 4X34A 4DF8A 2EQJA 1HYVA 4CIGA 3DRPA 3VQPA 2WACA 3PFSA 3SQ1A 5HLFA 2HHUA 3OY9A 1W9HA 2FBXA 1JLCA 5HBMA 3DLBA 5IN1A 3ZSVA 1JLQA 1SUQA 4FXDA 1UWBA 4CHOA 1RTHA 4O0IA 3NHGA 4C5IA 4DQQA 4F2SA 1JLFA 3OS0A 4OPKA 4QQ6A 2F96A 3MECA 2KZZA 1VSEA 2BANA 4KI4A 1A5WA 1Z25A 3HT3A 1Q9XA 4IFYA 3GOXA 5D6WA 3HXMA 3VQDA 1JXBA 1S6QA 2E4LA 2DIGA 5HRSA 3NGIA 4M3ZA 1U49A 1BISA 1WN7A 3NF6A 3PMTA 1WAJA 4H8KA 4CK3A 1X9SA 3KD5E 4PA1A 1ZBUA 2YHAA 3DOKA 4KAZA 4DU3A 1BIZA 1SL1A 3V9WA 4HCZA 2XY6A 2X6SA 1ZBFA 4MFBA 1HMVA 4OKJA 4ID5A 2R57A 3OYIA 3V1OA 1EXQA 2VG7A 4CJTA 4DTSA 4E3SA 2B8AA 3AVCA 3PO5A 4DFKA 3PX6A 1ASUA 3AO4A 2YNIA 1BHLA 3QNOA 4KHNA 4DSIA 1IO2A 4DS4A 3DB3A 1RCHA 2DTUA 4IUVA 3Q1JA 3SD4A 4CECA 4FM1A 4DWIA 2A1RA 4RG2A 4FJJA 1VK0A 1TK0A 3RR8A 4I7FA 4CF2A 4FZYA 4FJ5A 3WNEA 4E7LA 3A2FA 4CIEA 1YTAA 3THVA 4M41A 3V1QA 2DFFA 4E89A 2LTOA 3LP3A 3VQCA 3MAQA 3VA0A 1HNVA 3KLHA 3NDKA 3IG1A 4L8RB 4CRIA 1O1WA 1TVRA 4FK2A 1TAUA 3S3MA 3VQAA 3OYEA 3TARA 4KTQA 3MP6A 3ZSZA 2G8IA 4DTPA 4OGEA 3QEPA 3MXMA 2HVHA 3SYZA 1J5OA 3NFAA 2DIQA 4FW2A 4QVZA 1EKEA 3LP2A 4PLIA 1WNSA 1JLEA 3VQ9A 2R5MA 4KB0A 2D9TA 4F4KA 2YHBA 3AA2A 5HRPA 1BGXT 1LAVA 1S5JA 3HPHA 3ZSRA 2BE2A 3MXJA 1BCMA 4FLVA 4GW6A 4CERA 4CJ4A 2X4YA 3QJ6A 4IG0A 2RJFA 3OYMA 1CXUA 4ID1A 3TAMA 4YFUA 1RT2A 3ZSXA 3SZ2A 2VWJA 3TABA 2HNDA 1UA1A 5HRRA 4RW9A 1L3SA 4CJQA 3QEIA 4F8RA 4FJLA 2YNHA 3H08A 4L59A 3MEGA 2AJQA 3ASMA 3SNNA 3AVMA 3TAGA 5J1EA 4FJIA 1XWLA 2GBZA 1Q9YA 3OYJA 3L2UA 3QKJA 1IH7A 1KFDA 3LP1A 4FVMA 3V1RA 3ZSQA 4W5OA 1L3TA 2JLEA 2Y1IA 4Z4GA 4RG8A 3LH0A 5D6YA 5J2PA 3RMDA 3L42A 2Z1JA 3CYMA 3RMAA 4KPYA 5CZ2A 3DI6A 4NZGA 2ZE2A 2X4WA 2OPPA 3F73A 2ATQA 1NK0A 4Z0UA 3TI0A 1U48A 2XO7A 4DF4A 1S6PA 4M3YA 3OYLA 3MP1A 1OYXA 3OYBA 2MWOA 2O4GA 4FJXA 5E41A 1ASWA 3RRHA 3FC3A 4HHTA 3EAEA 1OI1A 3LGLA 3DLKA 3IS9A 3P8HA 4HUFA 1NK4A 3NNQA 2OZSA 1I3AA 3NTHA 2YV0X 3TWHA 3L2VA 4PLLA 5J2NA 3SI6A 2E6LA 5DMRA 4C5GA 2D5RA 3K5LA 1T7PA 4W5NA 3HVRA 1SL2A 2GFAA 2HB5A 2IS3A 4BWJA 4G1QA 1QHTA 3LYIA 3QLHA 1QSSA 4OLBA 5KE2A 3F70A 4CGJA 4PQUA 1NK5A 1LAWA 2M16A 3NBPA 3PX0A 3SPZA 4F2RA 4LSNA 4CHPA 4RW6A 3TR8A 3VQ8A 4B08A 3JSMA 4FM0A 4QCLA 2JGUA 4DLGA 4FYDA 3V9SA 4Z02A 1CZ9A 3OYKA 4CEQA 2WOMA 1S1VA 3KLIA 1RT7A 4CGFA 4UQGA 1NJXA 3K59A 4OVAA 4CEDA 2G8KA 3VA3A 2Z1IA 3SPYA 5CY4A 2RI3A 1LW0A 4KFBA 1WSHA 2VWKA 1SL0A 5I3UA 3PX4A 3S3NA 1LWCA 1XC9A 3VQQA 4B9NA 1LWFA 2CKKA 4N4GA 3CEYA 2B5JA 4BACA 3LALA 4Q5VA 3NH0A 3LZJA 2WONA 1N6QA 4BD3A 2QK9A 3DLMA 4H4OA 2G8FA 3LAMA 3QIPA 1BCOA 1QQCA 4ICLA 4RW4A 4CESA 4W5RA 2HQEA 1TL3A 2L8DA 3RR7A 3WNFA 2EHGA 4Y1CA 4OLAA 2RKIA 2K3YA 3KUFA 3OYNA 3M9QA 3TANA 2HHTA 3C94A 3ISNC 3O4NA 4NYNA 3DRSA 4N41A 4M3TA 4CJUA 1F21A 1B9FA 1W0HA 2B4JA 1JL1A 3E01A 3AA4A 3OMCA 3C6UA 3F9KA 2GV9A 3AVAA 2X35A 4GMJB 1G15A 4CJRA 1HJRA 4E1MA 3HJFA 1OZ2A 1JKHA 4J2EA 4CEFA 2NUBA 2ETJA 2RN2A 4NS5A 3U6FA 1DTTA 1B92A 4AILC 2RJDA 3IAYA 4EZ9A 3SJJA 4IUUA 1S1UA 4CF8A 1RT3A 4YNQA 3HK2A 1BQMA 1I39A 2GUIA 3VQ6A 1X9MA 4K8ZA 3HSTB 2ZD1A 1TKXA 2LCCA 3NE6A 2Z1GA 2O4XB 4M3UA 1BIUA 1CLQA 3NH2A 1D5AA 3NH1A 1VSDA 4QQDA 4EDUA 5CYQA 5KRTA 4DQRA 4DSLA 4PWDA 4Y1DA 1VSJA 2XY5A 3TAPA 2HW3A 3OQ5A 4B9WA 5CIUA 4N5SA 2HVIA 4CGHA 4DSJA 1U4BA 3SQ2A 3O3HA 1WSJA 1DLOA 2DY4A 4QQGA 4LD0A 3ULDA 4OPJA 4F3TA 3FDRA 3M8QA 2RHXA 4CEOA 3LZIA 4FL6A 3EY1A 4OJRA 5HRNA 4W5TA 3LDSA 3I0SA 2JTFA 1L3VA 4KREA 4FW1A 4CHNA 1ZYQA 4JS4A 4Z4EA 5FDLA 3OS1A 5KCHA 4M45A 4CF9A 2GFUA 3AA3A 1SKRA 3AO3A 2M1HA 5C6SA 1N27A 1N5YA 5KRSA 3CM6A 4ELUA 1HNIA 3OS2A 2OPRA 2XRIA 3EZ5A 1GOBA 3BDLA 1SKWA 4N4HA 1VSMA 2LRQA 3O3FA 1Q8IA 2RHUA 3HPGA 3SUQA 2RPIA 1XHZA 3SV3A 3KJVA 2K3XA 4J2BA 2QQRA 1RNHA 1BI4B 4IUQA 4FK0A 1NK7A 2E6NA 2BIVA 2X74A 1NOZA 2D0CA 3TAFA 1U47A 1D8YA 2HHSA 2BKDN 5D6XA 4LSLA 4IDKA 3U3YA 1U45A 3AVIA 3L8BA 2R7YA 4IUTA 4DS5A 4CFDA 4B9XA 4OKKA 1QTMA 5JS2A 5HROA 4CK1A 2L3RA 1ITGA 4CHQA 4R5PA 1A5XA 1TKZA 4B9UA 1EX4A 2VYTA 1WSEA 3META 1C1BA 1VSLA 4FM2A 3V9XA 2KFNA 1GOAA 3S6WA 2KFZA 4BE0A 3OYAA 1HYZA 5KI6A 3HL8A 3OYFA 4Z4FA 1XNIA 1UOCA 2M0OA 1VSKA 5D3GA 3MP8A 3NGYA 2Z1HA 1EP4A 1MU2A 4A4FA 3SV4A 4CCHA 4FLTA 5C25A 3LPTA 3FEOA 3HP6A 1TK8A 4FZXC 3KK1A 4CJEA 4C8OA 2QKBA 4WE1A 2D0BA 4AH9A 4FCYA 2RHZA 3OB9A 1Z26A 3L2RA 3DLRA 4O44A 4FLYA 3S9HA 1KLNA 1VSFA 3SUPA 4ELVA 1SV5A 2IAJA 4DSEA 4DG1A 3LLRA 1NJYA 3HYFA 1NKCA 4FJ8A 4CF1A 4KB1A 4A4GA 2P5OA 3NF7A 4KTWA 3AVFA 3LANA 3K5MA 1QSYA 3LP0A 4FU6A 3I8DA 1WJRA 1NK9A 3P83D 2XY8A 3CG7A 1NOYA 1TKTA 4DQSA 4KKOA 4PY5A 3UT1A 5J2QA 2QKKA 4KHUA 4IUPA 1D9DA 4O55A 4DU1A 4BE1A 3K58A 4DLEA 3ALYA 3C4SA 4CJ5A 2DAQA 2DFHA 4HCCA 1S9EA 3L3VA 3T1AA 4DQPA 2KQ2A 1WAFA 1K6YA 2HNZA 1TAQA 4B8CA 2G8VA 3SQ4A 1RDAA 3CFPA 4E7IA 1S1XA 3ZT4A 4CFBA 3JYTA 4C8KA 5SWMA 1ASVA 4DFJA 3ZT3A 3CFRA 1U04A 4CF0A 1YVUA 3BGRA 3M8PA 2OA8A 1UA0A 4FLXA 4B3OA 3OYDA 1X1PA 5CYMA 3DOLA 2G8UA 4KHQA 5C24A 1QSLA 2HMIA 5CZ1A 1J53A 2E5QA 3KKSA 1KSPA 3QO9A 4O0JA 1IG9A 1CZBA 2R58A 3B6PA 4I2QA 3ZT1A 4DTRA 2HHWA 1JL2A 3DLGA 3ZSYA 2G8HA 2P1JA 3AA5X 3QETA 4FLWA 2HHQA 3VQ7A 2RJCA 2I5JA 1RBUA 1BQNA 4OVLA 4AHSA 3MXIA 2OPQA 4BWMA 3UWNA 5J39A 3I0RA 4CEEA 3DB4A 4RW8A 3SUNA 3DLHA 2G8WA 4KHSA 2RHYA 2RI2A 3NF9A 1Y97A 4XIUA 3WNGA 3AVBA 3OJUA 4JRQA 3VQBA 3ASKA 1WSFA 4CGIA 5KCOA 4E1NA 3PY8A 4O5BA 4DSFA 4DQIA 2YKNA 4A4EA 4CJVA 3S3OA 5M9OA 1RDCA 3WNHA 1IKYA 4DTXA 3ITHA 2PZSA 3DM2A 3OVNA 5KTQA 4O4GA 4DFPA 1C1CA 2LSNA 2MWPA 4C8MA 4DSKA 2R5AA 4KRFA 1L5UA 1NKEA 2O4XA 3O8VA 3LGFA 1REVA 3QEVA 4DMNA 4EP5A 4HTUA 3QIIA 4KHWA 4DTUA 1RDBA 3KK3A 4A4HA 3MEAA 3RRGA 1TL1A 1ZBLA 1RI0A 4IURA 1FK9A 3KIOA 3HM9A 4CJLA 4OKEA 2X4XA 4CJPA 4CJKA 4B9VA 3CQ8A 4B9LA 3DLEA 1KCFA 3QESA 1C6VA 3G10A 1MHNA 1RT5A 1S9GA 1XHXA 3QINA 4E7KA 1WJQA 2LVMA 4Z4CA 4JRPA 4JS5A 1ZBHA 4CK2A 1IKVA 3MEEA 2GF7A 3G0ZA 1NK6A 3LPUA 4UC4A 2F8TA 4E7HA 1KVAA 3UIQA 2BGGA 2EQMA 4W5QA 1BL3A 4IBNA 1NK8A 4QOZB 4C5HA 4CFAA 1T8EA 4FZZA 3PNWC 4I2PA 4B9MA 2XHBA 4Q5WA 2HNYA 1GOCA 3KLEA 1RBSA 2RHIA 2RF2A 2X6NA 3C95A 3O4QA 4DTJA 2P51A 2F8SA 3AO1A 4N56A 4ELTA 1KTQA 3ME9A 3PMIA 3ZEHA 2XY7A 3DYAA 4PL6A 4IG3A 3ZT0A 2YRVA 2JZ2A 3P5JA 1WGSA 4LD6A 4ZHRA 5HP1A 4PUOA 2IGIA 1D9FA 4BDZA 3RWUA 1YT3A 4KO0A 4CEAA 1T03A 4BDPA 3AVGA 1HPZA 3IRXA 5I42A 5IAYA 3L2WA 3B6OA 4BDYA 1L3UA 3PO4A 3SUOA 1TKDA 2XK0A 2FBYA 4N76A 2PQWA 4AHRA 4CJSA 1H3ZA 4Q0BA 1TK5A 1QS4A 3DRRA 1RBVA 1WSGA 3MEWA 4RW7A 3KK2A 3P1GA 1RBRA 5K14A 1LW2A 3E9GA 3VQEA 4CE9A 1R0AA 3OYCA 2NLUA 1NJWA 4CIFA 2BDPA 4F3OA 2QQSA 3AVKA 3AVHA 3VQ5A 4H4MA 2HHVA 2ITGA 4FK4A 1LWEA 3FLGA 2RI5A 3MEDA 3QIOA 2PYJA 3V9ZA 2P0KA 2YNGA 5FRNA 4N47A 3OJSA 2HQXA 1RTDA 4HUGA 4EZ6A 2A1SA 2W42A 4DTMA 4HUEA 1RTIA 3SCXA 2VG6A 5KGWA 4KI6A 3QNNA 3L3UA 3K5NA 3V4IA 3NAEA 3SQ0A 1WJSA 2FBTA 3KLFA 1KVCA 1RT1A 2FBVA 2YNFA 4J2AA 4CGDA 3U3GA 3D0PA 4AHVA 4I9LA 2EKOA 1KHCA 4CJ3A 3KTQA 1VRUA 4NCGA 3VN5A 3AO5A 3LWLA 2HHXA 4JLHA 3LAKA 3RTVA 4DTNA 4M3WA 4FJHA 3H6ZA 2FC0A 4OGCA 1RBTA 1FKOA 4CFCA 5KGXA 4QAGA 1UAXA 3TAEA 5FROA 3D45A 4KHYA 5SZTA 2O4IA 3O3GA 3M8SA 3PV8A 4FJKA 2B6AA 4HVJA 1BI4A 4AHUA 4E0DA 1VSIA 4M42A 1DTQA 3AO2A 1B9DA
chains in the Genus database with same CATH superfamily
3OW2M 2A6TA 1RTJA 3MEVA 2HNHA 1WOQA 2GZWA 1OISA 2PYLA 2STWA 2XAUA 4HG2A 3THWB 2GM4A 1YRNA 1J54A 4C8NA 5E20A 3AHUA 2L0KA 4M3XA 4Z4IA 4BB7A 2HBWA 3SFZA 1C0UA 5FRMA 4B48A 5FW9A 2E1NA 1T0FA 1TGOA 1PP7U 2EA4A 1FXXA 3K2PA 2K9SA 2DFIA 2KI7A 1M8MA 3RMSA 4HDVA 1G5VA 2VJ5A 4F3QA 1HKBA 4AM7A 4L9TA 2JA2A 5D5VB 2W41A 1T6CA 4FIBA 2QENA 1HU0A 2FQ3A 3H0HA 4KUIA 3CDLA 4X34A 3CO7C 1VQON 4C3HJ 2HHUA 3TGNA 1YCSB 3SMSA 4JEPA 5HDKA 1A31A 3WU2C 1LFBA 3H9GA 5HBMA 1VQKN 1UWBA 3O80A 2K5LA 5IPAA 1IV8A 2LF7A 2X9HA 3NF6A 1X6GA 2PFUA 4GFBA 3BR3A 4CA0A 1YW7A 2RQRA 4IFEA 3GF2A 1ZR2A 3HHTB 1KHIA 3RR8A 2OANA 3GBQA 3V1QA 2LTOA 3INZA 3EDPA 2BE7D 1WJFA 4E7ZA 2RD1A 5AN4A 4QIWN 1HJDA 2X1EA 3RPUD 4JYAK 4OGEA 3JCMc 3JXUA 4E9HA 2P5LC 4LUEA 3AL0B 3F8NA 2DDAA 2GXGA 3CMAN 1JXMA 4HA8A 3I71A 1YJWT 1VQNT 1G4DA 2X4YA 4ZN3A 1ZYRF 1G2BA 1AEYA 2DDBA 1U8RA 4RW9A 2Y2ZA 2A6AA 5M3FJ 4A0ZA 4DSKA 2VBWA 3M5RA 1VQPA 1QPMA 3L42A 3RMAA 1SVLA 3HOXJ 3TI0A 2H6BA 1JHHA 3M1CA 3ZMVA 3X25B 3RRHA 1ZR4A 1ZRCA 1KO9A 4UNFA 1OI1A 4F7UE 1NK4A 2QA4N 1T8IA 2XRLA 1HCRA 1VQNQ 4HBLA 3CCRN 1VQ8T 2HB5A 1KQSS 3CCSN 3CC7A 5M3MJ 4EA4A 3SPZA 3ONQA 3RSEB 2IRFG 5CLSA 3OYKA 4CEQA 5LHIA 4CEDA 2D0NA 2ACJA 4KFBA 1SFOJ 5D6EA 2AK5A 1U3OA 3VQQA 5LEKA 2B5JA 4ZGJB 1N77A 4M7AB 4PJOA 2WFBA 4V2FA 4BEHA 3CMAQ 4E47A 2F7TA 3C94A 1Z9ZA 4B3TK 4WCEL 1A36A 1IXDA 4MQVA 4CJRA 2JA6J 4LJZF 4H0EA 3KVGA 2E4HA 3HK2A 2E2NA 4KIFA 2MIOA 4M3UA 4RTYA 2QVOA 3NH2A 1VSDA 4QQDA 3CWSA 5KRTA 4DSLA 1PUFB 4HSBA 2EJRA 2AHQA 1ARKA 1M90O 4IHYA 5DS9A 5HLIA 2Q1NA 4OJRA 3CCRQ 4Z4EA 2EFQA 3AA3A 4CVNE 2M1HA 1Y8QB 2LC4A 1VSMA 2LYCA 4M78A 3T7ZA 3SUQA 3VS7A 4FK0A 2L9VA 1MUDA 1NOZA 3ZYYX 4M63C 2OJ2A 2O9SA 5IYCJ 2L7ZA 2LSOA 3V9XA 3TMOA 2P6SA 1WI3A 3HL8A 1GBRA 4EATA 3OYFA 5D6FA 2V8JA 3RMQA 1Q7YR 2FSJA 4BR7A 4WE1A 4FCYA 4BJ5C 2K02A 1NG6A 4LB5A 2DBBA 3CJNA 2M51A 1VQ6A 2DLPA 2HZDA 3E7LA 1PRLC 3MZYA 1VQMQ 4KTWA 3AVFA 3ATUA 5KAIC 2N8GA 1ZGWA 2V26A 4FU6A 3LSMA 3P83D 2VOOA 3IH2A 3ULEA 1GCPA 3ALYA 3MJXA 3T1AA 2D1VA 3X20B 4PJOE 1KD1C 3UE5A 2Y4YA 1WFWA 3CFRA 2FE3A 4CICA 2LVSA 5M1NA 2FBIA 3BROA 4MFDA 2GTJA 1EV7A 2L02A 5CQXA 4I2QA 4F92B 3QRFF 4OMZA 4BHBA 4G9YA 5JICA 1KC8C 1E3OC 4AHSA 1P9QC 2E3HA 3CCUQ 2E20A 3UWNA 5J39A 3KZBA 5M5WJ 5AQIA 3AVBA 3ASKA 5GAN3 1WSFA 5KYUB 1ATNA 5M9OA 2A6EF 2DBKA 3N5BB 2OTLQ 4C8MA 3O8VA 2NZTA 1FWZA 3QBXA 2AA4A 1STZA 4XONA 4DR6K 1ZBLA 9ANTA 1BC8C 4M7AF 1K78A 4CJLA 4YY3K 1ATSA 3G10A 5EX5A 4JD2A 4JKFA 3A5LC 3MKLA 1IV0A 5EGOB 2RMOA 2VCPA 4IBNA 3TSPA 2XAQA 3HG9A 4A53A 3MKDA 1K8KB 3Q7BA 4V2GA 4ZHRA 5K5QA 2IT0A 1Q82U 4KO0A 4BDPA 5AQMA 4FQGA 4CJSA 4PJOG 2XGXA 4XOPA 2P4WA 4HVWA 1VQ6T 4H4MA 2D45A 1FJLA 1XC5A 2HQXA 1RI7A 2CZ0B 2VG6A 1Y1WJ 1OOTA 2XDVA 1WJSA 3DF8A 4Y28E 3KTQA 3G71A 3TEEA 4JLHA 1SANA 3S2WA 2M02A 1KQSM 4D8DA 2OJED 2LQKA 5FROA 3SEMA 3CC2A 1MDMA 1Q86R 4C8QA 2O8KA 1L3SA 3AG4H 3LX7A 2D0QB 1YUWA 1M2VA 4B9SA 2M30A 3LW5E 5GANh 3U9DA 3K70C 1T33A 3E0JB 4KDPA 2E5ZA 3QBYA 4M3RA 1HNXK 2FD5A 1VQKA 2RQVA 4A61A 1HC8A 1W4SA 4EQQA 3VYSB 1VQ9N 3GXOA 4CEZA 1S7AA 3MO8A 1RAGB 3VEOA 4M73A 4NYFA 4LMYA 1R8OB 2EFIA 1GL5A 1UGSB 5GANg 4HXJA 1JLAA 4A2UA 3FXKA 1BOAA 1F1BB 2VV5A 2LREA 2JN6A 5J3LA 1LMZA 1K8KA 2BZTA 4C2TA 4BROA 1UG0A 1VQLI 4D9JA 4IRHA 3VDXA 1SC7A 3IUOA 4LG0A 5FPMA 4NCAA 2DJNA 5J2MA 1UG1A 1VYUA 2RN8A 2O3FA 1YJNN 1Z7LA 2IA2A 3SK3A 3HPOA 4XR6A 2CU7A 2B9SA 4CIGA 1KG4A 2RQQA 4Y7NJ 3DLBA 2HYFA 1UJYA 2BANA 4U0VA 4H0YB 2B0LA 3HPWA 1XSVA 1P4AA 3L2CA 4BHPA 5GMKi 4OKJA 2CQQA 5FU7B 4RUGA 2OX7A 3JRAA 3M58A 3AO4A 1IO2A 2E5NA 3M7GA 3DB3A 1TTYA 1T39A 2HF3A 1NGGA 4M41A 2YRDA 4BXXJ 2HCKA 1QA6A 2VVKA 2DTZA 2XSDC 3S3MA 1UJ0A 1K8AR 4A63B 3QEPA 2LJ3A 4YFXF 1EKEA 3VQ9A 1V4SA 1D8JA 2JK3A 1WBDA 2K27A 3BF3A 5IT3A 1BCMA 4CERA 1YJNQ 1BW5A 1XDSA 2AXLA 4M7AC 1YJ9T 4CJQA 3R2XC 2YNHA 3GZ6A 5EC7A 5E3OA 2GBZA 3H1QA 3EHQA 2Y1IA 3LH0A 1JGGA 3ML6A 3CCMA 5AQVA 2KIQA 1TUDA 5HL7L 4L5EA 2ZPBB 1K73R 1TW2A 4CZGA 5CQEA 1XG1A 4IXAA 4PLLA 4L9NA 4R8HA 3RESA 3CCVQ 4UY8I 3BW1A 4M77C 3GTKJ 4BWJA 5KE2A 1QVTA 2Q0RA 4MIMA 4CC2A 1LAWA 2K3PA 4F2RA 5AQFA 4RW6A 1Y0NA 3LL7A 4G9ZA 4CGZA 4CC3A 4F7UF 5CE3A 5CVIA 5FLXE 2FZCB 4M3BA 2FVUA 3SPYA 2Z33A 3S32A 1N6QA 2WONA 3A02A 2P9SA 1BCOA 4PHTX 2VGMA 1VQOQ 1VI0A 2KIMA 3FIFA 3C12A 4PL8A 3T1YK 3A01A 5AQWA 2ZSIB 1Z21A 3CD6Q 2V9VA 3R6OA 4RWTA 2ETJA 4E70A 5LL6Z 3HOUJ 2CW7A 1RT3A 5AYFA 1N33K 4H0OA 2BTTA 4XRSA 3J7YJ 2KRSA 3EUKL 1N5ZA 3G4ST 5GTIC 2KE9A 1CLQA 3O3KA 4EDUA 4L0ZB 1ABOA 1IG8A 2M0MA 3I0XA 4JI6K 4AIHA 4MDAA 3FDRA 4FL6A 1SAUA 1ON2A 2ZPHB 5FDLA 1S72T 2OPRA 1J2XA 1X19A 3GLXA 2RPIA 2EFWA 1NLPC 1U1TA 3CP2A 3KP5A 3H1CA 2FU4A 1I8FA 5D6XA 1QCNA 2AP1A 1YF5L 2GWRA 3CO6C 4E6RA 2QCOA 1QTMA 2CUZA 1LNXA 2H3EB 4M75E 4MDXA 4BI4A 2IS6A 3META 5ILUA 3I3LA 2MMPA 3S6IA 2O8FA 3FZVA 2Z99A 1BBZA 4HTLA 4OPAA 4I6MA 1FZPB 5EF6A 1K9AA 4Z4GA 3S9HA 3OSGA 3H0GJ 2NRRA 1M3CA 3CC2I 4JDSA 3BCAA 4RDUA 1AD5A 3H9QA 3ULRB 5C12A 5BR8K 1XD7A 1NOYA 4XEIA 3SMPA 4PY5A 4QSHA 2Q8KA 5EG0A 3FISA 2WC9A 2DFHA 3H3VK 4GV3A 4B8CA 2HDDA 2JJ9A 3CCST 3FKIJ 2CDTA 2VXFA 3VYUB 1U04A 4DCHA 4WCIA 3TSUA 3PJRA 2JW4A 4O0JA 1EBMA 3IAS2 3ZT1A 1JL2A 4A3JJ 3VQ7A 3IWZA 2RJCA 2I5JA 2OPQA 4IEJA 4KHSA 3NF9A 3CJAA 2LT1A 3S3OA 1UE9A 4DKWA 1K9MU 3DM2A 5KTQA 4OAYA 1S72Q 2LSNA 2KRCA 4DMNA 1JJ2P 3RRGA 2X3XD 3Q5FA 5TRDA 3HM9A 1JXOA 4N9HA 3QESA 1SQKA 1ZUYA 1JJ2A 1OCTC 1MWKA 5BRHA 5GJWB 1X2NA 2M4KA 4PJLA 4MGRA 4J6YA 1RBSA 2RHIA 4DTJA 3AO1A 1RLPC 2ZPFB 2J5OA 4H0VB 3DLLF 3PIOF 1Q82R 5GADP 2W48A 2JZ2A 5F08A 2P8TA 5HP1A 1EFNA 3DBRB 1E4GT 1WFXA 1TK5A 1QS4A 4QPOA 1RBRA 1VQ4T 2PUOB 3VQEA 3T69A 3KXTA 3AVHA 2VT2A 4EGYA 1UHSA 5TKYA 4C8QB 2NNWA 1RTIA 4I0AA 2ZSHB 2O0YA 1KVCA 3LSHA 3ZP5A 2JVHA 4DOZA 2W7NA 3CJTB 5AQZA 4NCGA 4PDKA 1VQKT 4FJHA 1OCPA 2WADA 2Y69H 3VEZA 3FSPA 5SZTA 5CKEA 4E0DA 3ZQHA 2L4AA 2QQAA 3M0UA 3CHWA 2LCSA 3M4OJ 1YI2N 3RMBA 4K8XA 4RS8A 2VUBA 2UUAK 2FSNA 4FJ9A 2YU3A 4AWXB 5C42A 1O7FA 1OFCX 1R23A 1VQMT 3O6BB 2KT0A 3Q9SA 2MC4A 1KU9A 1KLMA 2O8DA 1YI2I 1Y57A 1N39A 1Y0UA 4UUVA 4G7ZF 1I5ZA 2V6EA 1KRPA 1C0WA 1TLHB 5AZJA 1W1FA 1ZX6A 1HQUA 2DOEA 5CJ9A 4EJTA 1NKBA 4FJGA 4NC8A 2CH4A 3QPLA 3RZDJ 4Z8AA 3KHYA 4EP4A 4OOIA 4CJFA 1MIJA 4FETA 3ZEUA 3HVTA 1C1AA 3TSZA 3A5ZB 2QEXQ 3OYHA 4R0KA 5KPZA 1XJWB 2QLZA 2IG0A 3WODF 3VS0A 2KW4A 4HCBA 2PUKB 2FEZA 4H0XB 1GCQC 2NRAC 5KYUA 2JS0A 1WX6A 3WEEA 5IYDJ 3I56Q 1RTHA 2DBMA 4OMMA 4A3MJ 2DTIA 2A08A 2E4LA 4AM6A 3JAMO 1K76A 1LE8B 3LFKA 4MFBA 3V1OA 5LGUA 2R57A 2BXZA 3HBTA 3QNOA 3PO3J 2DTRA 3BC8A 4L5JA 2W24A 3TL4X 5HLGA 2YHYA 2O8BB 3DXMA 2CFOA 2E64A 3VA0A 2FXUA 4BR5A 1CF7A 1BJAA 2M3AA 3NFAA 3E2UA 3SLCA 2P9UB 1WHUA 3EUHA 4MEYF 2KK4A 2EAYA 3EKUA 3Q9VA 1O9SA 3BR1A 2HNDA 2A68F 1K9MO 3DP7A 3H08A 1RUOA 4L59A 3ASMA 1VQOT 2O88A 3LDLA 2VBZA 3QKJA 2JN0A 2Y0SN 3H3UA 4YOTA 3CESA 1Z6TA 5C0YA 3CYMA 1ZUKA 4FYYB 4HSRA 4DYRA 3GNGA 2DOAA 1X3ZB 1S6PA 5LMNK 1ZBJA 4XMYA 3QYFA 3OHRA 3EFSA 5DY9A 5FU7C 3RIRA 1SAZA 2D5RA 3VTHA 2HDCA 2LKSA 3FZKA 4JD2B 2DA5A 3RPQA 4OLBA 1AVZC 1AWJA 2MW8A 3J8AA 1S5LC 2MCNA 5DUKA 3M4YA 1ZSZA 4B9NA 3BEXA 2CYYA 4XN3A 3AG2H 2HD0A 1IRGA 1B34A 2E2PA 4W5RA 5ICEA 3QQAA 2L8DA 3RR7A 2P84A 4Y1CA 4ZYGA 3KETA 4NYNA 3ZMUA 2J7IA 2B86A 4EW4A 2A05A 5CPRB 4CO8A 2RJDA 1QVFS 5JI6A 1G3WA 5ADXA 2HVRA 3HSTB 5GAEJ 3NE6A 4EM2A 1H9TA 3I59B 3KPHA 2FJ1A 1ORNA 1QPIA 1KGSA 2RKHA 3OW2S 3IWFA 5CYQA 3ZR8X 1JGSA 2WC2A 2XY5A 4XTVA 3CD6A 1VRLA 1POGA 4NQWB 4M75B 3ULDA 2QEXN 5GAEP 3HHGA 2EKHA 3KEYA 5KCHA 3UA6A 3MWTA 4HAMA 2BY0A 2KAFA 2LQ8A 2V9PA 3HPGA 1ZLJA 4IUQA 1AKHA 5KYXB 2H8WA 3HI0A 4CSWA 4B09A 1J5YA 4GRIA 1DGWY 2ZJ2A 2VYTA 1B4AA 2X0LA 3D0SA 3GPLA 4CXFA 3J81O 3UR3C 1GHCA 1HUXA 1R36A 4XRFA 3O2PE 2FPDA 4J9FA 2XPWA 3F9MA 2ISYA 1P7MA 4OPHA 4AU7A 1BA0A 2Y0MA 2FF4A 1QQIA 1SSHA 2RH2A 4NQWA 3D6RA 1ETKA 5J8FA 4D7NA 4AYBN 4C1NK 2FOKA 3QU6A 3CG7A 2Y9ZA 2P9NA 2NOGA 2CGKA 2O7OA 1XNQK 3CJRB 4M3FA 2O31A 1ESVA 3H92A 1D5VA 4M9SA 5KYXA 3CFPA 3GFJA 4X1VA 1VQOA 3IH7A 2NRXA 1MW7A 4EW0A 3BGRA 4FLXA 4DZJA 3TDUC 1J53A 2CT4A 2JPSA 4I7HA 2F5DA 2W4SA 4BXFA 4FPBA 3J80O 2HYJA 4C30A 2GA2A 3OJUA 3PY8A 1T6SA 5KCOA 4A4EA 4CJVA 4OAZA 4DZPA 3EG9A 3M1FA 4MFEA 2MAMA 1GDTA 2GLOA 2LZ6B 3CD6N 4GXOA 4NC6A 3CCMI 1QZEA 5I9EB 2LVMA 4A2BA 3CCVT 4H5TA 1IKVA 4B1VA 1Q1HA 4B8XA 1NEGA 3AAFA 3M0QA 3HZ6A 2XHBA 2CO5A 1GOCA 1TTHB 4N56A 2A5WA 1OH8A 2KHMA 1U2VA 4U7DA 2YRVA 3ZETA 1XUPO 3FE1A 2QA4I 1OVQA 1NH3A 1L3UA 4M7DA 2PQWA 1PVEA 2KSSA 3H3OB 2XF6A 1NJIR 2UXCK 1QKXA 4JKBA 1LW2A 2E1MC 2IA0A 1O4XA 1TU0B 2EYQA 2DK3A 1KQ9A 3KLNA 1ZHIA 3OJSA 2MG4A 2K7AA 4X64K 4O8UA 3LDOA 2FBVA 4J2AA 2M0YA 3D0PA 4FWLA 4EV0A 4MTDA 3EL2A 2E1HA 4FTHA 3ASOH 2YT6A 2DLLA 2YDLA 4KBOA 2BW3A 2ABLA 1C6VX 3M8SA 3P39A 1DTQA 1EH8A 3VERA 5AQJA 3FF5A 4LG0B 1HF0A 3NCIA 3SZPA 1BI0A 3C6TA 1M27C 1NGDA 1RACB 3DLLL 4K41A 1KFSA 1I5OB 3LSTA 1HX1A 3QYGB 2HI3A 4XTUA 5CHZA 4IO9L 3FZHA 3ZCMA 2K5CA 4PJNA 1E2XA 2QDLA 2KLAA 2E7XA 3T3FA 1HDDC 2V1QA 1GVJA 3QDFA 2YLBA 2DK8A 5C2FA 3CCLQ 2PFBA 2CQXA 2G0EA 2XDPA 4E7JA 3SZTA 3JREA 1XQOA 4DUZK 3JCUC 5L3FA 1M2VB 2W85A 3LDQA 2E1ZA 3HRUA 4A69C 4PL7A 3ENOA 4FWKA 4GVMA 2ZJQF 3DJCA 2P5GA 1YTYA 3MKYB 5C3EJ 1I3QJ 2VQFK 3EYZA 1YTUA 1VFCA 1VQ4A 3HO1A 1HYVA 4UVAA 5FWCA 4EM1A 1XMQK 4X9CA 1IRXA 1WYXA 1GV2A 4A3DJ 2RAEA 2XF7A 1MSEC 2QM1A 2LNVA 3HM8A 3MECA 3JSCA 1QHHD 5C10A 3HXMA 2QXLA 4L5IA 3R60A 3W3DA 1D3YA 1U49A 1WN7A 2OFKA 2CUDA 3DTKA 4ILJA 2D6FA 3AAPA 1MNEA 2OTJT 3OV8A 4CZHA 4B1UB 4JKCA 3B6CA 3ZQQA 3O8HA 3JAMZ 2R5ZB 4RG2A 1VK0A 4FJ5A 4EIAA 3J80Z 2FOWA 3ZQLA 3H6EA 4FWRA 1WQ7A 4QVZA 4PLIA 1J7KA 1XMXA 4F4KA 1FC3A 1HW2A 3HPHA 3KFWX 4AUXA 4KRTA 4WQ5A 1CXUA 1QVGM 5F6FA 3T9NA 3AVMA 3TAGA 4HYEA 3VRZA 3V1RA 1IUYA 2R5YA 4RG8A 2Z1JA 1FEXA 2VONA 1M90C 2ZE2A 2H1LA 2XKOA 3CBMA 3TTCA 4FX4A 4ZYHA 2L5QA 4IEEA 2P7VB 3VPZA 1XQHA 2P9IA 3ECHA 4Q5SF 5DMRA 3J81E 2EBPA 2KIFA 4J19A 3VODA 1LE8A 2X3WD 2J05A 4CGFA 5KK1A 2R4GA 3MWPA 1GFDA 3QPTA 3BZKA 5I3UA 3PNYA 3WGIA 4Q5VA 3DTEA 4GCVA 1YIJA 3IDHA 1YJWI 3LAMA 1T7PA 1WQWA 2HQEA 3P4IA 2DCEA 4RB0A 3M9QA 3GLLA 4L9JA 2WV1A 3O4NA 3MFKA 4N41A 3K1NA 2B4JA 5EU7A 4GMJB 1G15A 4M7XA 3ZEUB 1JT6A 1BA5A 4XKBA 3VPRA 3HOYJ 1MMNA 4L5GA 2ID3A 1BWFO 1Y6IA 2LMJA 3E9OA 3P38A 1N78A 1V4RA 2DTUA 3BJ6A 3L7WA 1QQJA 2HVIA 5KYNA 1WSJA 3A8YA 3DFGA 1BM9A 3EN9A 3U9GA 3IP4B 2OV7A 4BI8B 3HTUA 2XRIA 1IHWA 4OB0B 2RHUA 4HLXA 2DF6A 1ZQ1A 1WKMA 3G1OA 1U47A 4DR4K 1BIBA 2HHSA 3ECOA 1JKRC 4G6TB 3WUHA 2BXYA 2EILH 1VF9A 1FYNA 3TOBA 4B9UA 3BG6A 3TO6A 4FM2A 1QVGS 1NU0A 5TISC 1XNIA 1VSKA 4FLTA 4ATOA 4XAXB 2ZKZA 3HKZA 3L2RA 2COBA 1SV5A 1YJWN 2X6XA 4KULA 1YXQA 1G8XA 3G3ZA 2YHXA 3G4SA 1MNMC 3M0RA 2X6WA 1YYVA 2DXIA 1V5GA 4JKAA 2G9WA 4U0WA 1R59O 2ZJQL 2DD4A 2OTLT 1W7PB 1DPRA 1ZTRA 2ECBA 2P0PA 2P4TA 4WQ4A 2GXBA 5AFUA 4CC7A 3M8PA 1UA0A 5AQQA 2DQLA 1OVYA 2BZYA 4ESJA 2DJQA 3MZHA 4DTRA 4KBMB 3AG1H 4R79A 5CYVA 1MWMA 1ITYA 2VT3A 2RHYA 2XI9A 2YUOA 2I8DA 4F91B 1ZRFA 3JRHA 3URGA 2XGCA 1SRMA 3CLOA 4LIUA 4M78F 4NBQA 2P5KA 3OR1C 1ILYA 3LGFA 5IH2A 4UXNA 3KK3A 4AMCA 4I76A 2HGCA 2HXOA 2L9NA 4MQ9F 3JV3A 4Z4CA 4JS5A 4AC0A 3JCMd 2KISA 4O5VA 3UIQA 2BGGA 2VUMJ 1YW8A 4RAYA 3M0SA 1Q81U 3G6EI 2LLKA 2RE2A 2RNJA 4ZDLA 3P5JA 1WDXA 1D9FA 9ATCB 1IN4A 3LA3A 1FTZA 4BDYA 2XK0A 4RLQA 2K9GA 4LF8K 3WXIA 3KK2A 3CETA 4HZFA 2DMOA 3E9GA 2RK2A 2QW9A 1TC3C 4UB6C 1V29B 2LFBA 3A8LB 3J7YP 4ESFA 4DTMA 3BFMA 1VQNA 2KBTA 2HPMA 4K42A 1YBYA 1RNLA 4CGDA 4M7AG 3RKYA 3OOPA 2P4RA 1M30A 2H56A 1WB9A 2J4RA 3I33A 4B1RA 3D45A 4KGXB 2B6AA 4M42A 1VQ8I 2A0FB 1YP5A 2R7DA 2GGRA 5F1XA 4XN0A 4LN2A 2LDMA 1Z67A 1H8AC 3LQQA 2VI6A 2KKOA 3HHHA 4J8FA 1Q18A 1NLOC 3V9UA 2ABKA 5B1AH 2ZJPF 3CC2T 5D5WB 1PNJA 1J9AA 2EX3A 3AV9A 2Y4XA 1QQMA 1JUMA 1KVBA 4XSZF 4OMQA 1K8AU 3E9FA 2EINH 4BRMA 1U6GA 1Q81C 3CCSI 3EG2A 3FFIA 2L89A 4RA2A 4LK1F 3AVJA 1H88C 5FPEA 2VPLA 3SFMA 2XB0X 3PFSA 4RCCA 1N8RO 4XK8E 2EIFA 4HPQA 1RIOH 3CIPA 3GOXA 2DAOA 4IHTA 2E6ZA 5FLMJ 4CK3A 4XH5A 2O8CA 2G6FX 1Q95G 3RYPA 2KHOA 2KZGA 3HYIA 4HCZA 1T3LA 4XLCA 2HVSA 4H5WA 5L3EA 3Q1JA 4FM1A 3S2HJ 4CF2A 5E1ZB 4E7LA 4Z6YA 1I1GA 2ZGZA 4ELZC 1L3LA 3FXMA 3GF5A 4CRIA 2QTXA 2W6LA 1H9GA 2G8IA 3IFRA 3SBTA 1V5EA 3VS5A 1FW6A 1QQOA 4Y13A 1P8ZA 2DIQA 5EEGA 3FRNA 4DEXA 3R0AA 3WTTC 1U8BA 1NBEB 4A54A 1M2OA 1I07A 3K10A 3R9PA 2VC0A 5GIOA 3ZSQA 1YIJN 3CWUA 1GXPA 1KD1U 3KZIC 3CCEQ 3MKWB 2XO7A 2IGKA 4PCQA 3OYLA 1TWFJ 1RAHB 1R0BG 3Q7CA 4M9ZA 2MWOA 3FC3A 4DB3A 2K2MA 2OTLN 3E66A 4BKXA 4YELA 2P7CB 2QASA 3N0UA 5FGMA 1PHTA 1AWOA 3BDDA 4FHTA 1Z7UA 4PQUA 1DU6A 3NWSA 4Y92A 3UATA 1USSA 3P8BB 1D1CA 3CC4T 1S1NA 2OTJQ 1M3QA 5CY4A 2OQGA 1XC3A 4OU0A 5GAMj 3E9LA 3DLMA 1S7EA 4OWRB 2X85A 5A2QZ 2AS5F 3DU5A 1Y8RB 2LQWA 1B9FA 1W0HA 1SFXA 3HJFA 4C0FA 5AIQA 3CCLA 4UY8O 2HFHA 4Z94A 3IAYA 2R0QC 2O8EA 3D5LA 4YOVA 4J9DA 5L8RE 4K8ZA 2R5ZA 2NRWA 3P9CA 4M78B 2J06A 3C65A 1SHFA 2E1MB 4B9WA 3TW7A 4AG2C 4NL2A 1N9RA 4QQGA 4F3TA 3QWYA 2VXEA 3QAHA 3FLCO 1BW6A 4JS4A 2R7SA 2KP6A 1M1KR 4JUVA 4LLLA 3BE3A 5GAMh 3SV3A 1QZYA 2BKDN 3K6GA 2L2PA 4CFDA 1NG9A 1KC8R 3SWNA 3CCLI 1EO1A 2R5YB 1EX4A 3O5ZA 1VSLA 4KNYA 2FX0A 4BE0A 1JJ6C 3I56A 1EP4A 3SV4A 3IKMA 3SDGA 1W2BA 2CUFA 1UJ8A 4C8OA 2DQRA 1D0YA 4RTUA 4J7IA 4CF1A 2L9RA 2LF8A 3M8FA 4KT0E 3CCJI 3LP0A 2AZSA 5KQDA 3OBYA 1GLLO 2YXYA 5FKKA 1MNDA 3UT1A 2QKKA 3KFVA 3QWXX 5FFZA 5GPCA 2XD0A 2JPCA 3VOVA 1RDAA 1YG2A 2JHNA 4D5FA 1X2KA 1YIOA 3C2BA 2LDUA 2OTJA 4BEHB 2HMIA 2E8AA 3OL3A 2XU8A 3CCMN 4BY1J 3OYYA 2NOIA 4FLWA 3GBGA 4GO1A 1LCUA 2XDBA 5EYRA 3SUNA 5IHKA 3WE3A 2RDPA 2HOSA 1X6BA 4N0AC 4I99C 4F7UB 2EFNA 4A62A 3SEZA 2GTOA 4QS9A 3K4LA 1DPUA 2O4XA 4F16A 4JKEA 2ZWHA 4AI4A 3MEAA 1WA7A 2FL7A 4CJKA 4CJPA 4MLOA 1A6QA 5L3DA 1TYQA 3G6EA 1YHQA 1P6RA 4E7KA 1BR4A 3WTXC 1NK6A 3LPUA 3CJBA 2FSKA 4DQ8A 1T0JA 4W5QA 3EE9A 2NUZA 1UFFA 4QOZB 4C5HA 5DEQA 2F8SA 4A6DA 4M72A 1DUXC 1LDKB 3ZEHA 3ZBDA 4LD6A 3VEPA 1PRMC 3R61A 1A0NB 4PGGA 1VQKQ 3P9IA 3CJCA 4OIQF 3S1MJ 4N4NB 5LJVA 5LEJA 2X48A 1N75A 1OMIA 4M7DC 1YX5A 1GLJO 2M9UA 4M77E 1LWEA 1G6NA 3E5UA 2ZMEC 2YNGA 5JVHL 3PVQA 4DV7K 2DA3A 3P9KA 4HUGA 2XC7A 4GKKK 2QWLA 2GIVA 3N4QA 4BRGA 2O61A 4XL9A 5D4SA 5HDNA 3GTPJ 3K4NA 3M5AA 2FC0A 4M4ZA 1P59A 4HWIA 5ADXH 1UDLA 2O4IA 3MPUB 1SFUA 1YJWQ 3ERED 1YITA 3H41A 1HYSA 2QAZA 5FD5A 3J7AP 1ON1A 2XMFA 3FHNA 4A2AA 4KMUX 1IZ1A 1KG3A 1D09B 4K43A 3CUOA 1T44A 4FLZA 1YITN 3KKRA 4ZDPA 2EQUA 1JTXA 1JLGA 2LX7A 4FLUA 2KT8A 1KEAA 1PD1A 4KA4A 1ACMB 4LH5A 3LDPA 1VTNC 1WLJA 3O5BA 1WSIA 2KLOA 2P81A 1B34B 4ESRA 1D3BB 3BQYA 2JA7J 3EFOA 2PQ8A 4D5CA 4C8QE 1ZG1A 3ZSOA 2YHWA 4L9VA 1S1WA 3BJAA 3D7SB 4BVPA 3CC4Q 3THYA 2IDOA 2GXAA 5FFXA 5LJ3g 3KP7A 1EH6A 2HDWA 2PMZA 1YQRA 1WQ2A 2BGCA 2VE8A 2DI3A 2K3FA 1XSXA 2PAVA 4F2SA 4LF5K 1VQMN 2HMAA 5A0DA 5D6WA 4YIRX 2ESWA 4HVUA 4M3ZA 3OH9A 1AZEA 3VENA 5EXWA 2DVJA 1OQYA 5GJVB 1HMVA 1VQMI 4M7DF 3S17J 4BY6B 3CCVI 1KYZA 5AQSA 3ISPA 3OH6A 3LM2A 4DHYA 2X51A 1HNVA 4P9FA 2J6OA 4PFOA 3R3LA 4G12A 4FK2A 1TNSA 4CCOA 4A5BA 4IF4A 3OIQA 1SHGA 1HSTA 5HS8A 2JHJA 1UHMA 1VQ9I 2D9TA 1BOBA 3OMYA 3EEQA 2CGHA 2MYSA 1W2BS 1CKBA 4BRNA 1N8RC 1QQNA 3EH1A 4I0BA 1RKTA 2XRNA 2JUFA 2P9SB 4C9YA 2V52B 4KB0A 4FVMA 1GLBG 1M1KO 4CBWA 3RMDA 4OFEA 4LB6B 1KFZA 1L0OC 4JHDA 2DYSH 1KG5A 4PJOD 3QZ9B 3CLQA 5J8CA 1QKWA 3SI6A 1NWKA 2JTEA 1RADB 3K5LA 4W5NA 2A41A 4XH1A 4WCGA 4X66K 2HVQA 4V19S 4BVOA 2W10A 4IJAA 3F70A 2DA4A 3NMZC 3FXLA 1MDUB 3TQNA 2YWWA 1UG2A 1ZLKA 2HNIA 1NJXA 1CKAA 4O3MA 1WSHA 4CZEA 3PNVA 1LWFA 3L6QA 4C8QG 3THWA 1FIPA 5BNGA 3IL2A 1QQCA 1ZBXA 3BR6A 2WV0A 1RETA 3T0YA 1IAWA 5FKNA 1Q86C 3ISNC 5DCMA 5FPNA 1TWAJ 2EFOA 1IB8A 3H5AA 2COYA 4GKJK 3RVCA 5B66C 4CEFA 3U6FA 1DTTA 2DXTA 1BU6O 4YNQA 1X58A 1W2BM 4NC7A 2PU9B 3NH1A 1D5AA 5HS9A 4DQRA 3CWAA 3ER0A 1QVGA 3SQ2A 3O3HA 4G94A 3KBGA 4CEOA 4ENNA 2QKLB 1MMGA 2L4MA 1NM1A 2DYIA 2WSFE 2NRVA 3TTFA 4IQJA 3O3FA 4EFHA 3CCQI 4EVVA 2QQRA 3ZMSA 1J59A 1ZXOA 1D8YA 2EB7A 2ZJRL 5C4XJ 3NRVA 4IVNA 1Z3YA 3EHRA 4DS5A 4UV9A 4U0YA 2NUTA 3W2AA 1BOTO 4CK1A 4R5PA 4YDUC 3VEVA 3RSNA 4BU2A 4B6MA 2GTDA 1UOCA 3TO7A 5D3GA 3QP6A 1MU2A 1FPQA 1TK8A 3ESWB 5IOZA 1LEAA 3M54A 2IBDA 2EBIA 4AH9A 1F43A 1KLNA 2DPUA 2W82A 1LB2A 2XICA 4RTVA 5AZJB 3K5MA 3JR9A 1TKTA 4KKOA 4EGZA 4BE1A 3G71Q 1N9SA 1GRIA 1W7PD 4AD9A 5EGOA 5GAHP 4ZC3A 3HBLA 1GLAG 3SQ4A 1Z1DA 4GLKA 4JX6A 1BI3A 3EGDB 2GWKA 4CF0A 5J4YA 3F23A 2P9IB 1MSFC 1KQ1A 3B6PA 4WQ4C 4YOWA 3VTIA 1YHQT 4PKGA 1RBUA 2MH2A 1O3TA 4ELYC 2OAWA 3KE2A 2DL5A 2ROTA 2O8EB 2ZXIA 1A04A 2MSYA 1SD4A 4LC9B 4DV5K 2E2OA 2DT7B 2QGUA 4IIMA 2IA1A 3KWIA 5E3NA 1RI0A 2DA6A 2H09A 1RI9A 3QINA 1MHNA 1NMNA 4CYDA 1GLNA 3CCJT 1QGPA 2R7RA 2EQMA 1JU5C 2M4GA 1XCBA 1X1BA 4B9MA 3KLEA 2ZBKA 4M77A 3KK7A 3TPQA 5LJ5j 2K4BA 3PMIA 3S1NJ 2HQ5A 1HW5A 4A0XA 1MBGA 3RWUA 3M57A 3JRZA 5IAYA 2HKOA 3G4SI 5HLHA 1VQNI 3HSCA 1NJIU 2NLUA 4EJZA 5K5RA 4YRVA 2VBXA 2L7FP 3E6MA 3GWZA 4DIQA 2FBKA 4C92A 2VLAA 2P0KA 2Q0OA 3V9ZA 5KQ8A 4YPHA 4DBHA 3MN5A 3L3UA 1UHWA 2D2WA 3F8FA 1S9HA 4BRLA 1U5SA 5BQTA 2NVTJ 4FE7A 3O6WA 4XK4A 2P9KA 2X1DA 1WZOA 2O8DB 1TP4A 1V5FA 4M77B 3AARA 4BBRJ 1R1UA 5GMKe 4CGGA 5M1OA 3VESA 1ZHFA 3VU3C 1VHXA 3VQ4A 2FMYA 2CW0F 3NWTA 4EP5A 1VSHA 1QW1A 1Q82C 1OKJA 1MUYA 4FX0A 3JCMf 4KV8A 3HOZJ 4M75G 2X78A 3CJQB 4IKFA 3K7AJ 1T0FC 4CHYA 3RMCA 1XGOA 2CQNA 1BG3A 4L6V5 1IKXA 2DEUA 2V51B 4DR5K 2ZMEB 4MNUA 4C2MJ 4J2DA 3M1EA 3DMJA 2R93J 3MK6A 1PKSA 2YCHA 3K1MA 3OBWA 2Q3SA 3OSFA 2QSGX 2XG8D 1IXRC 1JJ8C 1WJAA 1NJZA 1GVDA 1TV6A 3PUFA 3S16J 3EYIA 4DUYK 1YJ9I 1SUQA 2JTVA 1D0ZA 4OPKA 2KZZA 2I7NA 4F04B 4CH7A 5HRSA 1FNNA 1K9MR 2LCLA 4H8KA 3KD5E 2B7EA 2MLGA 2L3DA 1SL1A 5F1RA 5HDGA 3SQNA 3V8JA 5E1XA 4B3OA 3HFOA 1QHAA 3PUBA 1WHMA 1MGTA 3WQTA 3THVA 2M5WA 3CF5F 1VQ7N 2FG0A 3GMEA 4KGZB 3IG1A 1V1CA 2JM8A 2P9LA 4CZIA 3TARA 3LSGA 2FZGB 2D4WA 3H3ZA 3PVLA 2XKPA 2YG9A 5F0CA 3BZCA 2O8CB 4W97A 2GWJA 5HODA 3REBB 1YI2A 4UNOA 3ZLJA 1Y64A 3ZX0A 1WHJA 3SDZA 3FMRA 3CMAT 1R4MB 4BUPA 2DPDA 2IPOB 2D1KA 1KQJA 3CMAA 2VKDA 1T3VA 2NAZA 1ETQA 3GP8A 3THYB 3CDIA 2A40A 4Z0UA 1KD1O 1KC8O 4M7DG 1K0XA 3MP1A 3I4NJ 4RLFA 2OBPA 5DLQE 1QHGA 2EGCA 4HUFA 2V9KA 2YX6A 4DR2K 2XAFA 2FSWA 1V55H 4B1XB 3ID6A 4DQ2A 3M8EA 3HGGA 1IN6A 4MDWA 3JSMA 1KQ2A 4H03B 2L3SA 2JGUA 4QCLA 3VUBA 1CZ9A 5GMKl 2G8KA 1HKCA 1MJAA 4BY9C 4NDLA 2RI3A 2K9NA 4XKVA 3SJHA 4YIFA 2JXBA 3HUGA 2ITMA 4Y15A 1EJ9A 3KP3A 4JPBW 2K9QA 3V8LA 3F5TA 2NOBA 2V7FA 1ATRA 3F9KA 2K9LA 3DQVC 5ICCA 3TTDA 2HOTA 4U88A 2QGFB 3NVKA 1J0RA 2L0AA 4J2EA 1B92A 4IUUA 2LRDA 2GUIA 1X27A 2A3ZA 1D5YA 3EG9B 1FOKA 5FKLA 1VQ5Q 1LWWA 3CPFA 4Y1DA 2MC3A 4DYQA 2DMTA 1VQ6I 1YNZA 1AA7A 2F5FA 1XS9A 3X2QH 5HVQC 2QA4A 4JI3K 3CD6T 2KXDA 3A5NC 2Q2EA 2LRQA 2NS0A 2BIVA 2X74A 1MMAA 2HBKA 4IDKA 2XSJC 4CI6A 1E0EA 1TW3A 3DPUA 4PJMA 2W04A 5KVRA 4CHQA 2A61A 4G7OF 1TKZA 1WSEA 2EQRA 5ICGA 2M0OA 3G7ZA 2VQCA 5KN9A 3OWTA 5CKHA 1ZH5A 4XTWA 2TCTA 5I2SA 5C25A 1VQ5A 3OB9A 4CCMA 1VQ7A 2IAJA 1IDZA 2A28A 1NJYA 2CP6A 4KB1A 3VF4A 3ZX3A 3CTAA 2EPDA 2IPQX 3LANA 3RDVA 2ZJRF 1VQ5N 1KG1A 4RB2C 2LK2A 1VQLT 5AQGA 3K58A 5HKCA 4E9FA 1ETWA 2HNZA 4P9UA 3VS3A 2RB6A 1VQ7I 1S1XA 3AG3H 4KGVB 4XU2A 2QA4Q 1OLTA 1S7OA 2M34A 3FK6A 1HA8A 3F0CA 3BPVA 2JWTA 5C24A 4IJNA 4DEYA 1T6DA 3LSJA 4LE9A 4PKCC 2HL3A 3QO9A 3IHUA 2O8XA 3FIWA 2RQPA 2IEKA 4YFKF 2A5YB 3UKUB 4NOYA 4JN4A 4OO1J 3S15J 2HKXA 4E2FB 4WXDA 3VQBA 2YJEA 4DQIA 4E1NA 3LWIA 4RCBA 4DBFA 1RLQC 3FBNB 3FJPA 3TQ7P 3OVNA 3CC7I 4IOXA 2XIGA 4DR7K 2R5AA 1KAZA 2DYBA 1L5UA 2VN2A 4PNOA 1FOXA 3QEVA 4U87A 1B72B 2W6KA 4B9LA 1R71A 4F7ZA 4M3DA 1NYFA 5FWBA 3IH4A 1XHXA 1YITI 5GANf 3MEEA 1IJWC 3MVPA 2LT4A 3OW2P 4XOTA 1WHLA 2KDSA 2Y9YA 3QHSA 4FZZA 3IV5A 3LAPA 2DTHA 2FXAA 3BCBA 4IG3A 3G0QA 3CUQA 4FL9A 2KT1A 3JB9H 3IRXA 3FKJA 4L3QA 3I56N 5EVZA 1OYYA 4MO4A 1TUCA 2JT4A 1ZBSA 3OYCA 3ERMA 3IH3A 1CZAN 4GV9A 3TSWA 2IS4A 5KYYA 2PYJA 4HOBA 5AQHA 5GAMe 4F52A 4EPCA 4DV3K 2KXCA 3VGKA 3V4IA 1NBWA 5IHIA 4LF7K 2ZMEA 1JKQC 3FZFA 5CVRA 3SB2A 3GFIA 1KAXA 3IKVA 1LPQA 4KHYA 2KRNA 2EV6A 1VSIA 5I21A 1TUGB 3DXKA 4GGGA 4M7DE 2CUJA 3JCMg 4R1HA 1Z91A 2WAFA 3TAQA 5IT9E 4KIGA 4LF9K 1JLBA 2H8HA 1CXQA 2O2OA 2EIJH 3PIPA 4FOIA 3I55I 4RCHA 3VMFB 1PCXA 4A12A 2XVCA 4IX7A 2LX9A 3S8PA 3ULEB 2G3RA 3CJ7A 3DPTA 3M8RA 4KH5A 4PGHA 1B9NA 3OIOA 4LH4A 2E5LK 3HTSB 3F0ZA 3PQKA 4LDXA 2PBIA 3OIPA 1S3XA 1YQLA 2UYTA 2DA2A 2CFXA 2K2VA 1UB4A 4KTZA 4UV8A 1C0TA 1EWRA 1VIFA 2GA1A 1IF1A 1JE8A 3T8TA 3DRPA 3U1DA 4BJTA 3HOWJ 3VJPA 2GQQA 4QKUA 4AFZC 3G71N 1G99A 1UHFA 3QDKA 5LY3A 1VQPT 3O9QA 4KI4A 3HT3A 1FTTA 1KD1R 3UKUA 4B21A 1QVPA 1IN8A 5LJ3e 3PQJA 1A6IA 2HL5C 2E5KA 3FR0A 2V75A 1K8AO 4ID5A 3PO5A 1PU6A 4BGDA 1ASUA 1K83J 4DW6A 1MBFA 2C0OA 4IUVA 3SD4A 4IHWA 3A2FA 3RQ4A 5AQTA 4X6AJ 3THXB 2LR8A 4IEIA 3WTSC 5BRFA 5K7FA 4EJYA 2ID6A 2VASA 2K4YA 4AYBA 3O9RA 3A8OB 5CKTA 2VJJA 1J5OA 2DMNA 4IQ4A 3DKYA 3CC7N 3K0LA 4B44A 3KP2A 3D2EB 2M7AA 3F72A 1VQ5T 5GADJ 3EFRA 1ZSGA 2DL7A 3QJ6A 4F14A 4FOEA 3OYMA 3SZ2A 3TAMA 1UA1A 2VWJA 3EG1A 5EOYA 3W2WA 3QEIA 3MDQA 4ZYAA 4EMKA 3MEGA 5ICFA 2WBNA 3LP1A 3GIBA 3JTGA 2JLEA 3W6KB 3IQLA 1PDNC 1OPKA 4CZLA 1VQLA 5AZIB 1OYXA 3CCMQ 1TL8A 2QBYA 3KEOA 1JTYA 1ZGAA 2E71A 1OH5A 1I3AA 4HF1A 3J7AY 4LUDA 1FX7A 3V7SA 1WEGA 3DV8A 4CBUA 1SD6A 2QQ8A 1QSSA 4CGJA 1NK5A 4HV5A 4FM0A 4XKCA 2IIMA 3E6DA 3KTUA 2YI1A 3VWBA 1ERDA 4ASNA 1WHKA 1FSHA 4HT8A 4HQEA 3KP4A 1HKTA 2E1YA 3PX4A 5DD4A 5CCAA 2G7UA 2D8JA 1VNDA 2CH0A 2QDYB 1D1BA 4ICLA 1PU8A 4A93J 4HX4A 4A0YA 2VGNA 4M75D 5ILVA 5ELZA 4CJUA 3QBWA 2R7ZJ 1SKUB 2X35A 1JI8A 1TH7A 1S3JA 2F4OB 1S1UA 5E8IA 5B1BH 4MZPA 2Z1GA 4KH6A 3CMEI 3X28B 4H0PA 1W5TA 5CIUA 4CGHA 4A3IJ 1NPRA 1ZK8A 2ZXJA 3EFOB 2ZM6K 3M8QA 5M1KA 3LDSA 4W5TA 5DM6F 1SKRA 3O4WA 1N27A 2SRCA 3R0JA 4ELUA 2LY1A 3BTCA 3C18A 4BQZA 2JG6A 1OCZH 1RNHA 3NAUA 4FWNA 1UHCA 2IVOA 4IUTA 3FJ5A 2VPRA 3CMEN 3VYTB 4B9XA 4A5NA 1M3BA 2CP7A 2L3RA 1JCFA 2VOPA 4AIJA 5FKOA 4ABZA 3PL8A 2KFNA 2LOOA 3GTLJ 3S6WA 2K40A 5LRSA 4JK7A 3CXCA 2RA2A 1SF9A 4A4FA 4KN7X 1DEJA 2J6KA 3FEOA 3I58A 5FU6B 1D3BA 4FLYA 1U5TC 1UB9A 2JTMA 3DLRA 1QWEA 1ODDA 3SUPA 1WSUA 4EHUA 2CT3A 3QUIA 1KQSA 5M1FA 1NGCA 3I8DA 1WJRA 2XY8A 1D9DA 1T08B 4CYCA 4ILGB 1VQPQ 1WAFA 2GOMA 3G4SN 4CFBA 2QA4T 3G2BA 1YVUA 4C92E 4HDUA 4LNPA 3K9KA 1X1PA 5CYMA 3S41A 1F4KA 4EMKC 3KKSA 3A5OC 4JV5K 2HHWA 3UA7A 3NVMA 4BQAA 2CP0A 2QBYB 2PMHA 1IBMK 4BWMA 4CEEA 2GOXB 3DB4A 1TQIA 4Y0WA 1P7JA 4CGIA 1BBYA 3QU3A 5FU6C 4JI7K 4IOAL 2A3LA 3PO2J 3DBLB 4M75F 1TL1A 1KQSP 1Q7YO 2FNAA 1W5CC 5TKWA 2X4XA 4J9HA 2LY9A 4DK9A 1NGJA 3CMMA 4G8XA 5JHFA 3LOCA 4AFSC 2DPNA 1FYKA 3PNWC 4I2PA 2QWQA 3C95A 5ECAA 5BN9A 4ELTA 4M77F 2XY7A 3DYAA 2PMZN 2KEAA 2IGIA 1KAYA 3J7ZO 4H0TB 5HK3A 2ZO4A 2ITGA 2CQKA 2WA0A 1HQCA 2HOEA 5IYBJ 1NKUA 3JCMJ 5FJ8J 4S05A 4MDBA 5LHHA 2XHCA 4C92C 2YNFA 3FX3A 1NHAA 4UB8C 3VN5A 4M3WA 2EW3A 4L18B 2DL3A 4QS7A 2Q0UA 5DV5A 5CZ1A 4FM4B 2CV1A 5CVJA 4OIPF 5K7HA 1R6RA 3CBOA 4M77G 2PMUA 1R1VA 2FHDA 4M78G 1M3AA 1LV5A 3KD1E 1PG5B 4K2EA 1VQ4Q 2BUDA 2ELHA 4F9OA 3I4PA 4DU4A 4II1A 3I59A 3KLGA 2IC3A 5KH6A 3NTKA 4X9DA 4IFVA 1XB4A 2P0WA 3FHZA 3CM5A 2K5FA 1EWQA 4C8LA 3K2ZA 4IZ9A 4ZTFA 2W03A 3FXRA 3GOIA 4AQYK 3SYTA 4QVDA 3CCQN 4OMYA 3VQPA 3CCUA 1YHQI 1J3TA 1XQSC 5IN1A 4B1YB 4QQ6A 2BZXA 2GQVA 4IFYA 3VQDA 3VRYA 3THXA 5KPTA 2KMTA 4QVCA 3EH2A 3ATVA 2AHJB 2E1OA 2XV4S 2OA4A 3OSSC 3JTHA 2X6SA 4KRFA 1ZG3A 1SS6A 4OMLA 4A3CJ 3DEEA 3H9NA 4FZYA 3F8CA 3TSQA 2FBHA 4JI0K 2YR2A 4U67L 3IC7A 5BPIA 1D0XA 4NXMK 3E5QA 1XNRK 3LP2A 4BR9A 2EYYA 3I8BA 5IWAK 3OTOK 3MN9A 1O7LA 1LAVA 1HNZK 2ZNZA 3ZXSA 2BE2A 2O01E 5EG0B 1MH3A 4FLVA 3BR0A 1LEBA 4BRIA 2QM3A 3TABA 3SEQA 2D0PA 1QVFM 3GG4A 2ECZA 2OU2A 1ZLMA 2VWFA 2O9VA 1L3TA 3TU5A 2LH9A 3G71T 3CCET 5D6YA 4YOUA 1IW7F 4KPYA 4IO8A 3QZ5B 4DF4A 1OX8A 4FSVA 4M74A 2I5UA 3GFLA 1D4XA 4FVUA 4C92D 4K25A 1T56A 4XNFA 4X1EA 3NTHA 1RRJA 1YWOA 5E26A 2GFAA 5L3CA 4HVVA 3LYIA 3DAWA 1NGHA 3NBPA 5IT9K 1ZKGA 2E3IA 3DXKB 1WRJA 3N05A 4LIVA 3A98A 3ABLH 2F4IA 1KJWA 2NOZA 3HOSA 3WU0A 1SL0A 4B3RK 4K0KK 3QO3A 2CKKA 3NH0A 3WHBA 2X9DA 4F93B 4QTRA 2CRGA 2V1DA 3ID8A 2RKIA 3OYNA 5GAN5 4M3TA 4JI5K 4FXDA 3BQZA 4RBOA 4E1MA 1JKHA 2NUBA 2RN2A 4YHHK 1K6OA 3VQ6A 5GMKj 2A37A 3QYHB 2HS5A 1K0SA 1OQKA 2LKXA 5E79C 2W1OA 4AIAA 2HW3A 4ZYEA 1FMWA 5J40A 1KQ0A 1R9TJ 4N5SA 1PD0A 3H46O 4CJ7A 1EF4A 2C6YA 5HRNA 2OFIA 3DKXA 1L3VA 3BY5A 2GIZA 4QPQA 2CP5A 3ELKA 5BPDA 5KYYB 1JBMA 3E1SA 1WXBA 5A2QE 1SRLA 1LJOA 4IOCL 1BI4B 3TAFA 2NS8A 3IRRA 1U45A 3AVIA 3L8BA 3OR2C 3ENHA 3QMLA 4P5OA 1MH4A 3EE8A 5AFUH 1HKSA 2KFZA 2RQWA 3EG3A 4A3BJ 2IVNA 3GCMA 4LXCA 1RPWA 2IW5A 2E2IJ 2DW4A 1MJ9A 1P7IA 2DXUA 2RHZA 2KVQG 4LLNA 2PVDB 1NK3P 1W2BP 5GAOn 4BY6C 5GAHJ 3FHFA 1U0JA 2RQTA 1ZC6A 1OR7A 1FMKA 1YJWA 5JVGF 1ETVA 1TAQA 3LL3A 4C8KA 2DL8A 4EMSA 2BVMA 1TUUA 4JRIA 2E5QA 1IG9A 2CG4A 1ETOA 2GQIA 3BT9A 2BHZA 5IY5H 2HF4A 2CGLA 4O5BA 1U6ZA 1IKYA 4DTXA 3E97A 4BY7J 3N5NX 2CSOA 5IT9O 2LNHB 1B6AA 1REVA 1MMDA 4KHWA 3RSEA 3RKXA 5JMVA 5ILSA 1F5TA 5GAN6 3HC7A 1KCFA 1ZBHA 1JO8A 3S1QJ 4RTXA 1UECA 2NNYA 3BTLA 3UNGC 3DPLC 3K4JA 1W70A 4KITB 3EZWA 1BU1A 3VEYA 4LITA 5CKDA 3B6OA 3NHNA 4H4KC 4G6QA 3CUQC 4LK0F 5CR2A 3LSPA 3CCVA 1HK9A 5H1SQ 3ZQ7A 3P31A 1XPXA 2HHVA 1VQ6N 2VQGA 3ZN0A 1M1FA 2WTEA 3CVSA 3VS1A 2HBMA 2X4HA 4RAGA 3CD6I 1WI7A 4FWPA 3ZPLA 3U3GA 1TT0A 3I5UA 3CW7A 3LSRA 3AO5A 2PG4A 3JCMe 3LAKA 1M9SA 5DTDA 4EAHD 5GAMg 1LOJA 3PV8A 2HKNA 2YJFA 5GAN4 2L9SA 3AO2A 2XHKA 3K70D 1VRTA 3L2QA 3QFUA 2OI3A 3CPWA 1XMOK 1RDDA 1QE1A 2R3SA 1I0CA 3K5OA 4M71A 4OIRF 3VGMA 1HQEA 3B02A 3AAQA 3RI4A 2D0AA 2P9KB 3VYRB 5E18F 3NF8A 5BREA 3ASNH 3IKTA 3RYRA 1PUEE 3CMEQ 2EYWA 1SFKA 5F2RA 5F0HA 1ZREA 3HP9A 2KTQA 3HFNA 5EZHA 3CCRI 2F2XA 5I22A 6AT1B 3OA6A 3QEWA 5KN8A 4ISEA 4KN4X 1IGQA 5DK5A 1NG2A 3K9TA 4RKUE 4CCNA 1NPPA 3I4MJ 1P4XA 5D4RA 1S1TA 1TYQB 2KRFA 2JRTA 4JJNK 2V7YA 3MN6A 3OA9A 5JLFA 1HD3A 5AQRA 4BAYA 1GV5A 2HBJA 1VSEA 1QZ6A 1HLVA 3RPUA 3MZ8A 2NOLA 3A1YA 3X26B 4R56A 1I5LA 4HRIA 3PMTA 2JM9A 2F5EA 4Y91A 4PSXA 2PVOB 2A36A 3OYIA 4HV6A 1R22A 2F5TX 5J3BA 4DS4A 4GY2B 1JKPC 1MV0B 3WG9A 4A6EA 2PNIA 1M1EB 2DA7A 4RB1A 2DL4A 2DFFA 3VQCA 1M5Q1 2AO9A 5GAOl 1SMTA 3G6EN 4KTQA 4N0AA 3QP5A 5GTHC 2OTLA 4WQ5C 2E12A 3SJMA 1OEBA 3HTVA 1OPLA 3ZSRA 4P1WA 2K79A 3CCUI 4J5YA 2A07F 4M6YA 3A4CA 5GANj 2DT6A 4Y17A 4W5OA 4OB3B 2F2WA 3W0LA 1SVOA 4KUDK 2OTLI 1H641 2DXCA 2E36A 3ZQGA 2M0CA 1T2KA 3A8GB 2OPPA 3PNTA 3N4MA 2K7LA 2K86A 4OX9K 4FJXA 2IAIA 4C23A 2GEMA 1O57A 3QDRB 1YOVB 1EQYA 2ESNA 3BDUA 4OP0A 5F64A 4JJDA 1ZA1B 4EA5A 4JZ4A 3L09A 2BE5F 1TWHJ 2OD5A 5FD6A 2H3JA 2Z1IA 3BTIA 4DOWA 2I2LA 4J00A 3O9SA 4HSTA 3SHFA 1JUSA 3BF1A 3CCLT 3QIPA 1N3AA 1KC8U 1MGQA 5KYWB 1IV6A 1IN5A 5BPMA 3IMXA 2ED0A 2COMA 3UPUA 2HTJA 2GV9A 3AVAA 3DBHB 4M78D 3BUZB 3CCEI 2BVLA 1BQMA 5J6XA 2D5VA 3V7RA 1X9MA 4OMPA 4XBFA 2YHTA 1OCCH 3EYYA 4PWDA 3SZGA 1P2FA 3TAPA 2QG9B 2DXBA 4PJ0C 2CV0A 5D7UA 4AM3A 4LG3A 4DV1K 2XIDA 1VYVA 1RFQA 1HR0K 1O13A 4DOVA 2R7VA 1FBQA 4M7AD 2NS7A 4WX9A 1R4NB 3LA2A 4HEA2 1Q8IA 5FLXK 2VYPA 2VWBA 1TZLA 3ZGKA 3MAJA 2I7PA 1HJOA 1U2WA 4M78E 3M8JA 1LCKA 3CXCS 2H8RA 1HSQA 2DPPB 2OQRA 1ITGA 1R0CB 3ABUA 4LD5A 3J81Z 1WJ5A 4C8QD 3RUXA 4PIIA 4FYWB 1OCOH 4JX5A 4HX7A 3O08A 1HYZA 5KI6A 3CBPA 2M1BA 3MP8A 3FK7A 1X6OA 2LBFA 5LD2C 2FUG2 3NQOA 3PSIA 3ULQB 2D0BA 3C7NB 4XQFA 5GAOq 4ELVA 4DG1A 1NKCA 4MZTA 3WTVC 2SEMA 4CZKA 3FM5A 1YQMA 1OX9A 2EJGA 4IOAF 2MPXC 3C4SA 3SWNB 4X0GA 1K6YA 1OYWA 1ORPA 2V8IA 1PP8F 3PM1A 3BR2A 1FBSA 1S29A 3HSRA 4M7AA 4RTFD 1M1KC 2UUBK 3OYDA 4JBAA 2HPIA 2BY2A 3FM3A 4E6KG 1N6AA 3QOEA 3TOAA 1CZBA 3VKIA 1X69A 3DLGA 3ZSYA 1K78B 1MBHA 1I94K 4RW8A 3DLHA 2G8WA 1NYGA 4JRQA 2MFZA 2AIRB 4F17A 2XPUA 2AKKA 1NZ9A 2RF0A 4DFPA 5DDGA 2RN7A 3OW2A 2WSEE 3J7AF 5GAMd 5JVGL 3KYLA 1ZGJA 1U78A 1WXTA 3O8GA 3P7NA 2AKLA 1YJNI 1K4TA 1S9GA 3FXJA 1B8IA 3G0ZA 2Z1DA 3U8XA 4E7HA 4Z88A 2VBYA 1XQPA 4FSXA 2WAQN 1XOVA 3R8EA 1Y7XA 2A42A 3DCFA 2P6TA 4Q5WA 3VFZA 1YQKA 2O9LA 2WB1A 1ONVA 3QYBA 3JB9I 2W57A 1MPGA 4BDZA 2BV6A 3WGHA 1OU8A 4XLAA 3G1JA 3HKSA 1O3QA 2MD5A 1H3ZA 1RBVA 4CDGA 3BY7A 3MEWA 3CF2A 3H3NO 4F3OA 3D2FA 4A5AA 1KQ8A 4YG2F 3QIOA 3M3YJ 2DNUA 4N47A 1R58A 4C92F 1SPKA 3SQ0A 2M7BA 4KH0B 5KNLA 2EPFA 3LNQA 2C06A 1YVNA 1VRUA 2D0OA 1BR1A 1B1BA 5GAN8 1NGEA 2VQEK 1WZ2A 4RMOA 4JP0A 2W0ZA 1YW9A 1ABQA 4CCKA 2MH9A 5GAN2 2RO0A 2XDDA 1Y1VJ 1PJRA 4KH4A 1BL0A 2QXFA 1YX3A 1M90U 4RGXA 1BUPA 3IUCA 4B1ZA 3DKWA 3HUGB 3V6DA 5H20A 1X9WA 2P9LB 4N4IA 2VC1A 3TVTA 1ETXA 4QW2A 2Z5UA 4B24A 2HOAA 4PJJA 2KYBA 1T05A 3EUAA 4LY7A 4KHPK 1HRHA 2ZGYA 1X2MA 2KZMA 2RJEA 2W84A 1XMKA 1X01A 4XH4A 3L0QA 5DM7R 4JK8A 2CH4W 2GX9A 3ROUA 4B22A 3ABMH 3MN2A 3JRDA 4CHZA 2JVGA 1UCRA 2DA1A 3FWEA 2EQJA 2WACA 3I5RA 4XORA 3GO5A 4G6DA 2FPEA 4Q48A 5IT9Z 4CZZA 3R6SA 1A5WA 5D8KB 2X4JA 1S6QA 4IPAA 4ORZA 3C6AA 4Y33A 2VE9A 1FT9A 5M5YJ 3HSBA 4V19K 4X65K 4FT2A 1EXQA 1B9MA 2B8AA 5HK0A 2VC8A 1MJBA 3GDQA 4CIEA 3ZQFA 4E89A 2F5VA 3PSFA 3MAQA 2GUPA 2JSPA 2CW8A 3NDKA 5JHUA 1TAUA 4RMNA 3PIPF 3VQAA 4HQMA 4LDYA 5H6RA 3JRFA 1QO0D 1YJ9A 3VSLA 2VL8A 4Y3OA 2KQRA 3MXJA 3GBTA 4Y4RA 2F2VA 4IG0A 3E6BA 4YFUA 3ZSXA 1QWFA 2DZ9A 5J1RA 1RAAB 3M0TA 2E7WA 3CQYA 3BP8A 4PK4A 2BE9B 2OUMA 3JRCA 4C1NI 2X4WA 3F73A 1HDPA 3C6HA 2HTSA 2ASOA 1H0MA 2JWLA 1RKWA 4ENJA 5FB2A 3P8HA 3VOEA 1ACIA 1AKHB 3TREA 1DGKN 5E3MA 4GDFA 1IGUA 2K5IA 1WVRA 4G1QA 3NEUA 1QHTA 5M5XJ 2R7WA 4BR0A 3W6JB 1TS9A 3O9UA 2EIKH 2HYGD 3CC2N 3VQ8A 2HQNA 3CCUN 5KAFC 1S1VA 4ENKA 3JCMQ 2OAZA 2ME6A 2LG4A 1WH5A 4JJCA 2RPNA 1BI1A 4X62K 2UUCK 3F22A 3A1PA 1KXPA 2NOJB 4EMKB 1YITT 2HMPA 4E1JA 2QK9A 4H4OA 5J4VA 2G8FA 4CESA 1TL3A 4OLAA 3OSVA 4EM0B 2DJIA 3WVDB 1F21A 1BYMA 2RNAA 3OMCA 5GMKm 4UOBA 3ZQCA 1M90R 2F48A 3GUDA 4NS5A 4CF8A 2COZA 5AQXA 2ATCB 4NUBA 3DTIA 5EZGA 2HBPA 3SAHA 2Q1ZB 3ZL7C 4DSJA 3VS6A 4BR4A 4OPJA 3BPXA 3UF4A 1RDUA 2FPFA 4UHTA 4J7FA 1X3MA 4RAFA 2EH3A 1MA9B 3EGXA 3M0PA 1IG7A 1N5YA 2PN6A 2HBLA 5KRSA 3OS2A 4AF1A 3BDLA 2QTDA 1XHZA 5E84A 1GCQA 4J2BA 4PFZA 4XSXF 2Q36A 1W0TA 3U3YA 4RTZA 2R7YA 2E1CA 4OKKA 1YLFA 4M75C 3PFYA 3CWTA 2LP5A 3WXKA 3LSIA 2NVUB 2LQNA 5AQPA 4M7AE 1RAFB 4Z4FA 3LM9A 2LY2A 3WE2A 3NGYA 5LJ3h 2A69F 4LDUA 5LL6S 3VF6A 2XGEA 3KK1A 1SVMA 1R5ID 3KZYA 3I55T 4EVIA 2IGMA 1WWXA 3CUQB 3HYFA 1CF7B 2P5OA 1IC8A 1QSYA 1UAAA 2DRKA 2CV2A 4ZH4F 2IIRA 4DQSA 1IJJA 4CZMA 3HRTA 1ZRDA 4J9CA 4R55A 2FB7A 3G6ET 4CJ5A 3G6EQ 3V42A 1WJBA 2DD5A 4G7HF 1KU2A 2L7MP 4P5NA 1T3SA 4IRIA 3EO3A 1OPCA 2JA8J 3CCQQ 2V4JC 1QSLA 3U2RA 1KSPA 4MZMA 1WJCA 3J80E 3VGLA 3L4QA 2HHQA 2QQBA 5LJ5d 4FASD 2H94A 2KDZA 4XU0A 2D1XA 2YX7A 4B9QA 3CCJN 3EKSA 2CH5A 5BMZA 4V2SA 2V79A 5BOXA 1LDDA 2JWKA 4BRFA 3EG0A 4HF0A 2PJRB 2Y75A 4ZGDB 1IGNA 2WBMA 4OKEA 3CC2Q 4B9VA 4LFAK 4KIBA 1C6VA 2UUZA 4JRPA 4I6ZA 4M7DB 3WGGA 1KZHA 2K57A 1R77A 3I0TA 2EWNA 1NGFA 2Q2RA 4JX4A 2KJBA 4E9GA 1NG7A 1RESA 1NEBA 2ADUA 3HZJA 1X3UA 2RF2A 2WUSA 2RHKA 3O4QA 2PJRA 1IRFA 1YFNA 5GIPA 4H5VA 2FNPA 3BG7A 3FBIB 1B7TA 2QEXA 4B3XA 3L2WA 2M8GX 4B4CA 2EZLA 4AHRA 1WSGA 1F36A 1R49A 1PSEA 1TXQA 2BDPA 1IXSB 2DILA 1HW1A 1D8KA 4BQNA 2ZAEA 2HZTA 2A1SA 3EGDA 4FWSA 1T0HA 2YU9J 4KI6A 3QNNA 2YS9A 5C15A 1WJEA 1B72A 4FYVB 5AONA 2ZJPL 4XU1A 1Y07A 2ENMA 3GTJJ 4EJUA 1H3HA 4WWCA 3CQZJ 1JJ2M 2EJFA 4OGCA 5IOYA 1WIEA 4LLGF 3MX2A 4HCKA 2DU9A 2MBFA 4MMLA 1WH7A 3V7CA 2DEQA 3VYHB 4B1WB 3H8ZA 2ICWG 3JCMV 3BTJA 1REPC 1NE8A 2IXSA 2L3QA 3GZ5A 4C8QC 2QWPA 3CP8A 1TOVA 4CZFA 2P0QA 4KJZA 4ISFA 4HNVA 1R5HA 3RNJA 2OF7A 4GY5A 4ZTJA 1G83A 3COAC 2NUPB 4KHQA 3FMQA 4KISA 1SSFA 2HQRA 3BDPA 1X43A 2F5KA 1DGRM 4OF1A 3QICA 4ME7A 3NGZA 2DMQA 4DTOA 1FSEA 5DCMB 5GANe 3F6VA 4MHGA 2VODA 3VETA 2CUEA 2LJ0A 4AHTA 1TNTA 4YOQA 5IXFA 2BY1A 1FOWA 1MV3A 5D5XB 1M8VA 3WTYC 2QUFA 1VOMA 1E17A 4BR2A 1JLCA 1FBUA 2PLYA 1JLQA 3GFMA 3JCMh 4O0IA 4S0HB 1WHGA 4HW0A 2WWYA 3WXLA 1XN7A 1Q9XA 4YOYA 3M56A 4IZZA 2KFDA 2DIGA 3TBIA 1NM7A 3CC7T 2HKQB 1YE9A 2ZFWA 5FLXZ 1BISA 3QPSA 1X9SA 4C2UA 1JKOC 2Y30A 3JSOA 1E6HA 2KKZA 2YHAA 3DOKA 1PKTA 4DU3A 3UB5A 4A59A 2RNGA 1ZBFA 3L9FA 2VG7A 3AVCA 3PX6A 3MWMA 1IXCA 2EV0A 4KHNA 3ZRGA 2ZGWA 4CECA 3TW6A 1TK0A 4I7FA 1GLFO 3T5XA 4LD9K 3A5MC 4I09A 1NGNA 1TVRA 5C44J 3OYEA 5AR0A