4E7IA

Pfv intasome freeze-trapped prior to 3'-processing, mn-bound form (ui-mn)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 110
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7iA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7iA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7iA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7iA03
5JS1A 3NGYA 3LWLA 2E4LA 3LGFA 4B9MA 5I42A 3VQPA 4Q5VA 5FRNA 3MO8A 1VK0A 3NDKA 4PUOA 1KHCA 4FJHA 2G3RA 3VA0A 4K8ZA 4FLZA 3A2FA 2BDPA 1LW2A 3KLHA 1XNIA 3TI0A 2PYLA 4CGIA 4AHVA 3SQ2A 4CJRA 4N76A 3T1AA 1HQEA 3ZT0A 5CZ1A 4TSXA 4F2RA 2PYJA 1BCMA 1CZBA 2O4XA 3KLFA 3HXMA 2ZE2A 4I2QA 2ATQA 1IH7A 1LAWA 2M1HA 1IKWA 2G8WA 2QXFA 3M8RA 4DQPA 4DSLA 2GV9A 3C4SA 1KTQA 3VQ6A 1TGOA 2RHXA 4GMJB 1HPZA 4HCCA 2X6NA 3OYLA 1RTHA 4BDPA 4B9LA 1Z25A 2X74A 5HBMA 4DFJA 1NKCA 3FFIA 4M3YA 4G1QA 3OVNA 3AO4A 5M9OA 1FXXA 1KVCA 4FL6A 3VQ7A 3O3GA 4FJJA 1NOYA 4DS5A 3QETA 3KUFA 3SPZA 2I5JA 1RT5A 2FBXA 2DIGA 4Q5WA 2EFIA 1DLOA 1ASVA 1X1PA 3NBPA 1EKEA 1TAQA 4CGGA 2D0CA 3MEGA 4FVMA 2NUBA 4DU3A 3I8DA 2VWKA 4FJMA 3ZSRA 4CK1A 1RI0A 1DTTA 2E6NA 5FROA 1UOCA 3V1RA 4QQGA 3ZEHA 2WACA 3DB3A 3SI6A 3CM6A 3OS1A 3OJUA 4B9TA 4KKOA 3VQ5A 3P8HA 5DMRA 3MXJA 1RBVA 1YT3A 3TABA 4CFAA 3ZSVA 2WOMA 3AO1A 4BE0A 4FJKA 1TL1A 3MEVA 1EXQA 3DLEA 3SYZA 4OVLA 2HMIA 5SZTA 4KHUA 3NTHA 5CIUA 4CK3A 2KTQA 1SUQA 2O4GA 5CY4A 5I3UA 2BUDA 3F73A 1S1WA 3PX4A 5T7BA 1ZBHA 3ME9A 4KTQA 3HPGA 1XWLA 4OPJA 2WONA 4Z02A 2XK0A 2D0BA 3ISNC 3AVAA 4KPYA 4KHWA 5HLFA 4HUFA 5KGWA 4DLGA 4ID5A 3NFAA 2P5OA 4BDZA 5CZ2A 3WNFA 2X78A 5J2NA 2GFUA 1LV5A 3HK2A 1VSMA 4H4MA 4CEDA 2G8VA 1WSEA 4CHQA 1RTIA 1VRUA 3QKJA 2YKNA 3MEEA 4PL6A 1Y97A 3OYFA 4M3ZA 4Z4HA 4ELTA 1TKDA 1H3ZA 1BCOA 1SL0A 4W5NA 1N5YA 3NNQA 4Q0BA 1HMVA 3AA3A 4Z4FA 4C8NA 3LDSA 1Z26A 1NKBA 2O4IA 3RR8A 3S9HA 1L3SA 1BI4B 4I7FA 4H4OA 2B6AA 1G15A 3MEAA 2O4XB 4HTUA 4L59A 3IRXA 4B9UA 3RRGA 1QE1A 3DYAA 1KVAA 4Y1DA 4CK2A 3H6ZA 4M45A 1JL1A 4FCYA 3SQ0A 2FBYA 5J2MA 1IG9A 3I0RA 2EKOA 1ZBUA 1OZ2A 4FK2A 4M3RA 2JGUA 1JKHA 3OA6A 3AVBA 1S1TA 3ZSXA 2PY5A 3G0ZA 3TAPA 1GOCA 3KD5E 3C95A 4ELUA 3V6DA 3QERA 4DS4A 3AVCA 2OPSA 4FLXA 2FBVA 1LWEA 3LANA 2GUIA 4FJGA 3KLEA 4DFPA 4C5HA 3ZSZA 4FJXA 4KTZA 3K59A 1CZ9A 4IBNA 4B8CA 4EDUA 4FK0A 4CEQA 2B5JA 2LSNA 1S1XA 1RT2A 2JTFA 3AV9A 2GBZA 4XIUA 3DOLA 3T3FA 1A5XA 3MEDA 1HYZA 1XHZA 3NE6A 3S3MA 3ALYA 4OKEA 4BWMA 2M0OA 1JLBA 1C1BA 2YV0X 1X9WA 3L2WA 4Z4IA 1W9HA 2IDOA 3QIPA 4A4HA 2ZQBA 2D9TA 2PZSA 1WAFA 2XRIA 1WJQA 2FC0A 2JLEA 3NH1A 3RRHA 2PQWA 4FK4A 3HM9A 2ITGA 3NCIA 4NCGA 1RBUA 3KKRA 3MECA 4DQQA 3KK1A 4DTPA 2HHXA 4C5GA 5KE2A 1S1VA 1JXEA 1UWBA 1CXUA 4CJVA 4E7HA 2W42A 3MXMA 3C94A 4B9WA 4KB1A 1T03A 3NF8A 4UQGA 1S9EA 5C42A 1JLGA 2OZMA 2X6SA 5SWMA 3LGLA 3ZT4A 3L3VA 1SKRA 2RI2A 4ZTFA 3O4QA 4I9LA 2X4XA 3TARA 1OYXA 3OYNA 4N41A 3SUQA 1BQNA 1U47A 3ZT2A 1J5OA 4I2PA 3S3NA 4CF0A 4E3SA 1HYSA 1D8YA 3PMIA 1J54A 2EHGA 1KSPA 1HQUA 1LAVA 4GVMA 3AO2A 4JRQA 3V9ZA 4CFBA 2L3RA 2RI3A 2DAQA 5D6WA 3NF6A 4IUVA 3DLMA 3L2VA 4I9QA 3T19A 4II1A 4QQDA 4M3TA 4CJLA 5KRSA 2YHBA 3V9WA 1UAXA 2QQRA 3QINA 4CIEA 1BL3A 4F3OA 3NGIA 3FC3A 3DMJA 4RW7A 1XI1A 4J2EA 4PLLA 3E9FA 4CHOA 1ZBLA 4FYDA 3UWNA 3L2RA 3TWHA 4C8LA 4IUUA 1J9AA 2DTUA 2QKKA 3K5NA 5J2QA 4IUPA 2E6LA 4OPKA 3O4NA 1S5JA 3S6WA 1ZBIA 2IAJA 2YNIA 4FJ8A 2Z1JA 3L8BA 4CJ4A 2P51A 1C6VA 4KREA 4ZTJA 4AHTA 5HP1A 1RDDA 3DLGA 3WNGA 5IAYA 3P5JA 3KK3A 3SV4A 1VSHA 3SUNA 4ICLA 3PX6A 1G5VA 4CIFA 4LH5A 3CM5A 2RJEA 4CEEA 3NAEA 1FKOA 3LAMA 5E41A 3V9SA 4UC4A 3CG7A 4CESA 3IG1A 2G8FA 4DSFA 1BGXT 1RT6A 4OGEA 3BGRA 4CJFA 2YNGA 4CHZA 3CFOA 1KCFA 3VQ9A 4H8KA 2RPIA 2HHQA 4IUTA 1SKSA 3THVA 1BIZA 3TANA 3HT3A 3PMTA 3TAFA 2ETJA 1NOZA 4IG3A 1WSJA 1W0HA 3NGZA 3M8SA 4CEBA 1EP4A 1YTAA 1X9SA 4CF1A 4PQUA 2IC3A 2DFEA 3NTIA 1REVA 4J2BA 3HVRA 1EX4A 3PUFA 2OYQA 1RDAA 1C0MA 1WSFA 2VG7A 4CGJA 3OYHA 4NCBA 1ASWA 4DU1A 4O55A 4CIGA 3NH0A 4CGFA 4RW6A 3OJSA 4FLWA 1U04A 3ZT3A 3MP1A 4CJWA 1RBRA 1C0UA 3U3GA 1ASUA 5KI6A 4YNQA 4FZYA 4CEZA 3CFRA 1IKXA 5EU7A 1D9DA 3DM2A 2DY4A 1RT4A 1QTMA 2XDPA 5C25A 5DK5A 3OYIA 3DLKA 2BANA 4DFMA 1QSSA 2F8SA 5HROA 4DSEA 4JS4A 3AVJA 4O0JA 3SPYA 3DB4A 3ITHA 4N4IA 1IO2A 3OMGA 3JYTA 4DWIA 3QIOA 3AVFA 4CJQA 4WE1A 1B92A 1QQCA 4BD3A 3QO9A 1L3TA 2LCCA 3UT1A 5C6SA 4M3WA 4NZGA 2KQ2A 1WJRA 2ZD1A 3WNEA 4CFCA 4E89A 3GOXA 4IKFA 4CERA 3AVGA 4KV8A 3LLRA 4FJ9A 4DTXA 3LYIA 5K14A 4FZXC 3KTQA 2LTOA 3HYFA 3VQAA 1WN7A 1KVBA 3LH0A 5J39A 2RKIA 4RW8A 3E9GA 4M41A 1NJWA 1S6QA 2HVIA 1R0AA 2Q3SA 3AVMA 3HVTA 1RTJA 1I3AA 3DI6A 3K5MA 1HYVA 2K3XA 4HVJA 1NJYA 4HCZA 4DQRA 3QJ6A 3C6TA 2R58A 3HPHA 4EP4A 3P83D 1YTUA 4R5PA 3DLHA 4K8XA 1RILA 2KW4A 4KFBA 2G8UA 4QVZA 1WSGA 3LP0A 4Z0UA 3RMDA 3LAKA 4OLAA 3UIQA 5KCHA 3O8VA 1TV6A 4FLVA 4AH9A 1TKXA 2E6MA 4FJNA 3QNOA 3AO5A 3M9QA 2HQEA 1BQMA 4MQ3A 4FJIA 3HPOA 3LP1A 1FK9A 2OPPA 2HHVA 2B8AA 3ZSWA 1FKPA 3AVIA 1S6PA 3BDLA 1HNIA 3KJVA 4OKKA 1SL2A 2VG5A 4FW2A 3QBYA 4ID1A 1SSFA 4KTWA 1L3VA 4DTJA 3VQDA 4FZZA 4OGCA 1Q9YA 2EQUA 1JLCA 3TAEA 3PX0A 3V1OA 3QEXA 2LVMA 3LP3A 5HRSA 4BWJA 3VQEA 1RBSA 4LSLA 4DSIA 3MP8A 2VG6A 3RR7A 1MHNA 5KE3A 2K3YA 3FDRA 2HHSA 3OY9A 3LPTA 5CYMA 3LZJA 3LPUA 3HSTB 2R57A 4W5TA 4CJUA 1KFSA 3KLIA 2Z1IA 1K6YA 2X4WA 3IS9A 5D3GA 3NH2A 3SNNA 1NJXA 4GW6A 2Y1JA 4CJSA 2BGGA 3JSMA 1B9FA 2LRQA 4CEOA 2RJFA 1N27A 4IURA 4GY5A 3OMCA 4E7IA 3S3OA 4RW4A 1WSIA 2IOCA 4DU4A 1U48A 3U3YA 3LP2A 3E01A 4DMNA 1I39A 2KZZA 4LD6A 4FU6A 2YNHA 4B3OA 2LDMA 5KH6A 4M42A 3VQ4A 4QAGA 3VQQA 1ITGA 2RN2A 3RTVA 4E7JA 3MP6A 5CYQA 1NK6A 3OYAA 2DFFA 4RW9A 1GOAA 3V4IA 3TR8A 2XY5A 4HUGA 5KTQA 3FEOA 1VSEA 2YKMA 1DTQA 4DF8A 4W5QA 3P8DA 1C0TA 4DF4A 4BE1A 5D6XA 1JLFA 4KHNA 1NK9A 3P1GA 3H08A 2DFHA 3MAQA 1VSLA 4PA1A 1RBTA 2QK9A 4KHQA 3NF7A 4DTUA 3ASKA 3SQ4A 4FM0A 1VSFA 4B9VA 3OYGA 1SKWA 2NLUA 2GF7A 1VRTA 4FM2A 2HNYA 4DTMA 2G8KA 2L8DA 1O1WA 2HQXA 2RHZA 3EY1A 5J2PA 4JLHA 2D0AA 3NTKA 2VYTA 4OKJA 3L2QA 3OQ5A 3QLHA 4CJPA 4A4EA 2RHYA 1NK7A 4IFVA 2P0KA 4RG8A 4N56A 4OVAA 1IKYA 4CE9A 3QEPA 1S1UA 3QIIA 4B9XA 1TL3A 1TK5A 1QHTA 5HRPA 1VSJA 2BE2A 4CJ3A 2MWPA 3LX7A 3KLGA 1KLNA 4KI4A 4CF2A 1NJZA 4F2SA 1TK8A 4E1NA 4DFKA 4A4FA 4BDYA 1WJSA 1GOBA 1U45A 1TAUA 1L5UA 3HL8A 1IKVA 3SD4A 2Z1HA 3I0SA 1BI4A 4KO0A 3RMCA 2XY6A 4KHYA 1WNSA 5J1EA 3QEIA 2RJDA 3AO3A 2F8TA 4BE2A 1JLQA 1VSKA 4O0IA 1WAJA 4HUEA 4DTOA 1RTDA 4FW1A 4Z4CA 4FJLA 2FBTA 4J2DA 4NYFA 3FLGA 4C8KA 4ELVA 2IS3A 1B9DA 1JXBA 1CLQA 4L8RB 4F4KA 2RHUA 4AHUA 3ZCMA 3AA5X 3L3UA 4PWDA 4FM1A 2A1RA 2M16A 3WNHA 1RT1A 3QEWA 1KFDA 2HHUA 3OYMA 2R5AA 3KIOA 3DLBA 2OA8A 4N5SA 4CRIA 1XHXA 4E19A 1HJRA 2EX3A 1SV5A 3D45A 4EZ6A 4EP5A 4B9NA 4C8OA 4CJTA 2F96A 4ZHRA 2G8HA 4BACA 2HW3A 4LSNA 3EYZA 3D0PA 3AVNA 2X4YA 4F8RA 2P1JA 1HNVA 4NYNA 3M8QA 3ULDA 3ZT1A 3H8ZA 3DOKA 1RNHA 4W5OA 2EQKA 3VQCA 4C5EA 1YVUA 2XY8A 2IGIA 2HB5A 3NF9A 4HHTA 4DSKA 3OB9A 4CGHA 4IG0A 1UA0A 1RCHA 2Y1IA 2MWOA 4KHSA 3NHGA 2F5KA 3KK2A 1F21A 2YNFA 1TKZA 1JLEA 4CHNA 1QS4A 4FLTA 3PO4A 4C5IA 3AA4A 2L89A 2OZSA 1J53A 4DTRA 2HVHA 3Q1JA 3BDPA 1JL2A 5D6YA 2AJQA 1TK0A 3VQ8A 2QQSA 3OYEA 2RJCA 3ZSYA 4AHCA 1LWFA 4LD0A 3O3FA 3PY8A 3SJJA 4X34A 4O5BA 3K57A 3OS0A 4CEFA 4QOZB 3QESA 1TKTA 4CFDA 2EQMA 3AVHA 4O4GA 3KKSA 3RWUA 4LY7A 3V9UA 1CXQA 4B08A 4CGDA 2HHWA 1T05A 2G8IA 2R5MA 4N4GA 1C1AA 2JZ2A 4CEAA 3QNNA 3V81A 1OI1A 1OZ3A 1NKEA 4KAZA 3VN5A 2P5GA 4O44A 4QCLA 3PFSA 2YRVA 4FLYA 1S9GA 2IG0A 3C6UA 3TAGA 1Q9XA 1MU2A 3CEYA 3AVLA 4CCHA 4MFBA 3V9XA 1VSDA 4CJ5A 3K5OA 5IN1A 2QKBA 5KRTA 4AHSA 4RG2A 4JS5A 1N6QA 1RDCA 3HO1A 4YFUA 3M8PA 2B4JA 4IUQA 3OYDA 3RMAA 4DG1A 4AILC 3MEWA 1RT7A 1BISA 4E0DA 3L2UA 3SZ2A 3OYJA 2E5QA 4QW2A 1U4BA 2RHIA 4DQIA 2BIVA 3IAYA 4PY5A 4DSJA 4E7KA 1T7PA 3ZSOA 4CHPA 4LH4A 3SUOA 1ZBFA 3G10A 3QEVA 1LW0A 5FDLA 5HRNA 3ASMA 3SUPA 1HRHA 1QSLA 3B6PA 4CJKA 3CFPA 1D9FA 1XC9A 1NK0A 1NK5A 4DLEA 4CHYA 2HNDA 2HHTA 3F70A 2VWJA 2A1SA 1EETA 3OYKA 3VQBA 4Z4EA 3SQ1A 1U49A 5FRMA 2FHDA 4IFYA 4OLBA 4DTNA 4DTSA 4DQSA 1SL1A 2R7YA 2RO0A 4EZ9A 1QSYA 2EQJA 1A5WA 2BKDN 3K5LA 3L42A 4CECA 1C1CA 3O3HA 3PNWC 3PO5A 4CJEA 1A5VA 2OPQA 1BHLA 4OJRA 3VA3A 1WGSA 4PLIA 2OPRA 4FJ7A 3EAEA 4W5RA 3DLRA 1X9MA 4N47A 4E1MA 4KB0A 4NCAA 3F9KA 2KFZA 4J2AA 2GFAA 4NS5A 3DRPA 3SV3A 3TAQA 4FXDA 3AA2A 2KFNA 2DIQA 1KRPA 1WLJA 3SCXA 4HCBA 1ZYQA 3OYBA 2Z1GA 1JLAA 4KI6A 5HRRA 2RI5A 4N4HA 3CYMA 4CF8A 2CKKA 2YHAA 1TVRA 4M3UA 4A4GA 1Q8IA 4Z4GA 3META 1VSIA 2RF2A 4M3XA 3OYCA 4QQ6A 3K2PA 1BIUA 2KZMA 4E7LA 5KCOA 4JRPA 4AHRA 3K58A 3ZSQA 5C0MA 1NK4A 2XO7A 1T8EA 5J26A 1KLMA 2D5RA 4B8AB 3HP6A 4B9SA 2HNZA 5C24A 3LWMA 4Y1CA 3CQ8A 4F3TA 3HJFA 1LWCA 3OS2A 5JS2A 1NK8A 4FJ5A 2XY7A 1WSHA 1UA1A 3LALA 3TAMA 3MEUA 1RT3A 3U6FA 3HP9A 3V1QA 3KD1E 3MXIA 3LZIA 4FLUA 3DRSA 2XHBA 4IDKA 4C8MA 5KGXA 3DRRA 3B6OA 3RMBA 3EZ5A 3AVKA 3PV8A 4KRFA 1D5AA 4CF9A 1L3UA 2X35A 1RDBA
chains in the Genus database with same CATH superfamily
3K4CA 5DDGA 3LWLA 1N34K 2E4LA 2KHMA 3LGFA 4B9MA 3QMLA 3VQPA 5HLTA 5DPKA 3T9NA 3EGDB 5LJ5e 1WXUA 5LD2C 2MD0A 2MD5A 4PUOA 1KHCA 4FJHA 4HT9A 1PWTA 3U9ZA 2W84A 1UFFA 5H20A 2BDPA 1N75A 4F9OA 1OYIA 1FBQA 2MFZA 3LQRA 2DEUA 3TI0A 3V8JA 3T1AA 4H0VB 5GAMf 1R77A 2VV5A 2PMUA 1HQEA 2XICA 3ZT0A 5EGOA 1R0CB 4M7DG 1YJ9N 3LH5A 4EMKC 4F2RA 2M8EA 1CZBA 1QVFM 1WDXA 1T0FC 1PNJA 1YCYA 4I2QA 2ATQA 1IH7A 2P9KA 4C3JJ 2K4JA 3ZP5A 4DEYA 4D5FA 1FJLA 1P92A 3UKUA 3C4SA 4I0AA 2RHXA 3ZETA 1TQIA 4KN7X 5A2QE 2P4RA 4JHDB 1SAXA 4JKBA 3MFKA 2L7MP 1RTHA 4B9LA 3M54A 4DQ8A 2M0YA 2B7EA 4GRIA 4J9GA 4XQ3A 3CXCS 4QS7A 1NKCA 4M3YA 4FYVB 3FZKA 2LOOA 1YCSB 4LF9K 3OVNA 3A02A 5LHGA 3M4OJ 1ILYA 2BY3A 4L5EA 4ZGEB 3S1RJ 4FL6A 2VJ4A 1R1VA 3O3GA 2E3IA 4KBMB 3BG6A 1W70A 5EX5A 2FBXA 2L9SA 2IA1A 3O5BA 3LDQA 2DIGA 1TBXA 1HKSA 2H3JA 4NQWA 3DPUA 2XF5A 1PU7A 2FUG2 2QGFB 4CGGA 2DCEA 1MUDA 3HBTA 1IUYA 4DU3A 3M53A 5AQZA 4J9FA 1T0FA 3KBGA 4RB3C 2CP0A 3W2VA 3V1RA 4BRQA 2XGCA 2WACA 4PJ0C 5F0HA 3SI6A 1IN8A 3CHWA 1WJBA 2HOSA 5I21A 4OIQF 3CCQQ 4D9JA 2YUPA 3SFMA 3MXJA 4S04A 2KQRA 4I2OA 4PKGA 4M74A 3ZSVA 3AO1A 3CCLQ 4ZC3A 1EXQA 2ID3A 1R8OB 3DLEA 3LDPA 1K8AO 4FPAA 2HMIA 4GY2B 5SZTA 2DOFA 4KHUA 2CH6A 4I09A 3NTHA 4E9GA 2VKVA 4HCKA 1HX1A 2K02A 4G9YA 4HVVA 1VQOI 1RETA 3BLYA 4LK1F 4IHTA 1SUQA 2JUCA 1BYMA 2QKLB 1YJWQ 3WXJA 3G1JA 3S2WA 3BFMA 1NEGA 4BL0B 1M3AA 5AQJA 2CG4A 3CMEQ 4JZ3A 4PHTX 2JQ7A 3HPGA 4FO0A 4H5RA 4UUSB 2LD5A 2O9LA 1W6XA 1P2FA 1VFCA 4Z02A 2WAQA 2YSRA 1MNMC 3H92A 2D0BA 3ISNC 4KHWA 4KPYA 2O03A 5HLFA 1YQKA 2ZXWH 2CWEA 1VQ4A 2XKOC 1YW7A 4HUFA 2JWLA 2HQAA 3SJHA 2EYWA 1BI1A 2CP3A 4O8KA 3O9TA 3B6CA 2XAGA 4MZPA 1HLVA 1WJFA 2P5OA 4V2GA 1PHTA 1WVRA 5CZ2A 4JRIA 3NHNA 2X78A 5J8CA 4HF0A 1M1EB 1H8AC 1B9MA 5CCAA 2G8VA 2HZTA 4N0AA 1MBGA 1WSEA 4M78C 3QKJA 2L4AA 4PL6A 3E6DA 3EGXB 4QIWN 3OYFA 3CD6N 1VQON 2KROA 4LNPA 4OIRF 1VA7A 4Q5SF 4Z4HA 2DD4A 1TKDA 4ELTA 2HD0A 3ZBDA 1X1DA 1U3EM 4UOBA 1KC8O 1WI7A 1N5YA 3ZQIA 3OL3A 4Q0BA 1HMVA 4OO1J 4XRSA 1FYKA 1R5ID 1XB4A 2O4IA 2XUBA 3QB0A 3SDBA 2M30A 4OF1A 4PKCC 1L3SA 2Z0WA 1BI4B 4IO9L 4M63C 1IUFA 3E1YA 3DCFA 4A5NA 4BBRJ 1O4XA 4I7FA 2QSFX 4PKHA 2NNNA 4HTUA 2H09A 3SHWA 4JJDA 3R60A 3DYAA 3DEUA 2QA4I 1Z91A 3B73A 2XKOA 1Y96B 2VYPA 4Y1DA 5GANd 2R5ZA 2C06A 1J5EK 2VQGA 4M45A 1UG2A 4HX7A 3M7GA 1HSQA 1TWAJ 2LDUA 2N8GA 3CCST 2KDSA 2FL7A 3BR5A 2EKOA 1ZBUA 4M78A 2DK8A 4L9JA 3OSGA 1YN8A 1JKHA 3OA6A 4RGRA 4UHTA 1LFUP 1AHDP 3C95A 5LHHA 3QERA 3NWTA 4ILHA 1QW1A 4HZFA 5GAMe 4KISA 5LL6S 4XH5A 1ZG5A 3EFRA 3AVCA 1PP8F 4LDUA 4C3IJ 4ETSA 5HNFA 4LIVA 3LANA 3CC2I 5FLXK 2V9KA 4G8XA 5E18F 4ILGB 4J9BA 3QAHA 4IFEA 2NOJB 2DA3A 1T3SA 1IJWC 3KWIA 2QA4N 3S32A 1RT2A 1NKUA 2F4OB 2JTFA 1ATNA 2F9WA 3BC8A 1QLYA 2J05A 2GBZA 4XIUA 2JXBA 4GXOA 2F2XA 3HOZJ 2COWA 4X66K 3HKSA 4M7DC 2P5VA 5FLMJ 3FZFA 1XHZA 1S6LA 4HNUA 2E71A 2W24A 4NL2A 4HT8A 1WQWA 2DPUA 5GAN8 4XONA 2M0OA 2YV0X 1D0YA 4KICA 3SXYA 3RZOJ 4XU2A 4I6MA 4EVVA 4A4HA 1GLDG 4HQMA 1WGXA 2LTPA 3G71T 2VKDA 1B8IA 3CJAA 1VQLA 1WAFA 1HDDC 1WJQA 4YRVA 5GMKh 2ITGA 1ETQA 3CCQN 2CQNA 4AWXB 1I07A 2FSKA 4U0YA 3EQLF 2X1DA 4A61A 3HZJA 3MECA 3KK1A 4DTPA 2L0AA 2HHXA 1I81A 4C5GA 1UCRA 5KE2A 1S1VA 4RS8A 1JXEA 1R7JA 2W40A 2WAFA 3CJQB 4AMCA 3PLAA 2ZGWA 3E5XA 5EXWA 1YS7A 1E3PA 4PIIA 4B9WA 4XTZA 3OSVA 4XSXF 1D1CA 3AAQA 1T03A 3N5BB 4CZHA 1JLGA 2KLOA 3LGLA 2HBKA 3LL3A 3C7NA 4M7DA 1KQ2A 1U1SA 4ZTFA 4I9LA 3L1PA 3CMEN 5LY3A 3A5MC 1BQNA 3MDQA 5GAGJ 3BDDA 3LA2A 1QCNA 2DTOA 1R59O 4LOCA 1LEBA 4RTUA 5GTIC 2EYYA 2HL3A 5JLWA 2NOIA 5AZJB 3S3NA 2PMZN 3P9KA 3ZYYX 5FKNA 3L1AA 2LQWA 3LW5E 1FTTA 2DRKA 1HQUA 4C23A 4GVMA 1NLPC 4LMYA 3D2EA 1XGSA 5D5WB 2VQLA 4IJAA 1VQNA 2KP6A 3W2WA 1I0CA 1X2QA 3CCMI 5CK9A 1W0TA 3EDPA 2DAQA 2FB7A 1QA6A 2GUPA 1KU7A 3A0IX 1HK9A 2P9PB 2DMUA 3T19A 4EEFG 4XOTA 3EFSA 5ICGA 3I33A 3EYYA 4IOAF 1M90C 2KMTA 2YHBA 2X6YA 4WCIA 2QSGX 3RESA 1KQSP 3H36A 1MMDA 2LF8A 4F3OA 1ZSZB 2DL8A 2CQQA 2O88A 1XI1A 2FEZA 2F1LA 4PLLA 3BUZB 2DL7A 3E9FA 2OBPA 3JTHA 3JCMb 3VS2A 5ICFA 4GKKK 5DD8A 3CC2A 1NGJA 1ETWA 3K4MA 1U6ZA 5GADJ 2I5UA 2QQ9A 1S5JA 1SEUA 3VSLA 3S6WA 2IAJA 1HW5A 2P9LA 3C1DA 5FJ8J 4JI1K 2Z1JA 3RDIA 1U5TC 4A3LJ 3FB9A 3GBTA 3CCMN 2JN0A 3GOIA 2QWWA 2LY2A 2QK0A 1HKGA 1PD1A 1K73U 1MV0B 3M8FA 3WNGA 1X2MA 4L6V5 3P5JA 3QICA 4ZH4F 3G71Q 1TT5B 1ZGJA 5GMKi 3GLLA 4IOCF 3CPEA 3SV4A 4Z94A 2LKPA 3SUNA 1J09A 4DR2K 1N8RU 5AIQA 1RDWX 2E2PA 3PX6A 1KHIA 1V4SA 3I59A 4CIFA 4LH5A 4CEEA 1G3WA 2WSEE 5E41A 3IWZA 4UC4A 3CZ6A 4YDUC 3LDNA 4KITB 3Q7BA 3JSPA 3IG1A 2PFBA 2F6CA 1A6IA 2E2HJ 3DU6A 2CGLA 1BGXT 1GLCG 3P7NA 4YOTA 1YOVB 5LL6Z 4CJFA 1HSJA 1RLQC 4CHZA 1KCFA 1X1AA 2RPIA 1UEBA 4V2SA 2EPFA 1SKSA 4RDUA 1N25A 1GV5A 1RRSA 4PNOA 1KYWA 3U9GA 3PMTA 4LGWA 3LSTA 1U5TA 4IG3A 2HPIA 3A2KA 4I6ZA 1BU6O 3NGZA 3M8SA 1MWMA 2FU4A 4BAYA 4LB5A 1M1GA 3N4QA 3WU0A 1FEXA 2ZKZA 4J9CA 2V8KA 3J80K 4KULA 4AM6A 1Z67A 3FXJA 1O57A 2JVHA 4XLHA 5AQKA 2ZMEA 5AFUH 4J2BA 2FSWA 3I4PA 3O1WA 3ZMSA 3KVGA 1MDMB 2NRAC 3HVRA 3JRIA 2OYQA 4CZFA 1C0MA 1WSFA 3EG9B 4CGJA 3OYHA 1VQ4T 1GLBG 4DU1A 1Q7YU 4KNYA 4XL9A 2WB1A 1OCRH 3PO2J 4YDUA 4CHUA 5IYCJ 4CD1A 2VXZA 2CUDA 4FLWA 2R0QC 4CJWA 2M87A 3M3YJ 1A0NB 4AFSC 1RBRA 4EA5A 4BI3A 3LFKA 5KI6A 2FLOA 2CW0F 2DX1A 4FZYA 4CEZA 5HNHA 1JHHA 3VEYA 1IKXA 1D9DA 3J7YP 3G6EN 2BTTA 4I0BA 1QTMA 3GDQA 4Q4ZF 1GLJO 3NMUA 1HCRA 3A03A 2NVXJ 4EJUA 2BANA 1QSSA 2BBYA 4AD9A 5E3OA 4Y28E 4A2AA 3CXCA 2KMUA 1W5TA 3SPYA 2DU9A 3ABMH 4DYCA 1IO2A 5F2RA 3VRZA 2KDOA 1RPWA 4LE9A 2D4WA 2AQFA 2ZPGB 2LBFA 1J3TA 4RA2A 1ZELA 2ZCFB 4NZGA 3U21A 1YG2A 3K1PA 3GTPJ 1B07A 2QYOA 2EA4A 4CERA 1IJJA 1W4MA 1L3LA 4DTXA 4JI5K 3M6GA 2V79A 1SD6A 1K73R 2IS2A 3ZMZA 4AYBA 3F5TA 1NBEB 4P9UA 1JKOC 1WN7A 3KE2A 4O6JA 3E9GA 1UTIA 1NJWA 1N8RR 2HVIA 2A36A 2Q3SA 3AVMA 2QUFA 1SD5A 1LWYA 2F48A 1BA5A 1QVGP 1RTJA 3C6AA 5TKWA 3DI6A 2O9VA 1IG8A 5EGOB 2M9HA 2A07F 2CV0A 3WTWC 3QJ6A 1X3UA 4EP4A 3RMQA 4OB0B 1X75C 1BA0A 2GOMA 2NNWA 4MO7A 3BWGA 1YTUA 1XCBA 4F7UF 4R5PA 4EJWA 4K8XA 2EFPA 4F52A 2P9KB 2EGAA 2G8UA 2DA1A 3QU6A 1YLFA 3UKUB 3RMDA 1MBKA 4OLAA 4U67L 4BVOA 1G2BA 2E5LK 2Y9YA 3ZETB 3O8VA 2HTJA 4FLVA 4A3EJ 1VQOT 5FU7B 4G7HF 2KXCA 1XTDA 2NYXA 3H0IA 3PGGA 2JTMA 5F6FA 2DZCA 1WQ2A 2WC9A 2AHJB 2HHVA 2B8AA 5BPDA 3OW2A 1S6PA 4XKCA 1XMAA 1VQ4Q 2OPTA 3KJVA 1R5HA 2UXCK 3IKVA 2RMOA 4ID1A 2X6XA 5TJJA 1Q7YR 2PI0A 4NQWB 4KTWA 1L3VA 1I5OB 2HNHA 2P4WA 5HY6A 3E7LA 2HCKA 4DTJA 3I5SA 3JCMV 3VQDA 1PRMC 1VQ6A 4Y3OA 4OGCA 3FHFA 4BREA 2K2VA 1ORKA 2FRWA 3TAEA 1EO1A 1NPPA 1HU0A 2L3SA 3QEXA 3RPUA 4Z89A 2NVQJ 1ZN2A 2LY1A 4CBXA 2K9MA 3VEZA 2HL5C 5KAFC 4DV3K 5IT9E 2LMJA 4BR5A 3RR7A 3UF4A 2K3YA 5KNLA 3VS5A 4CZMA 1ZA1B 1RACB 3VYGA 3JTGA 4FASD 2KK4A 4A3KJ 1YITI 2K7LA 3E0JB 1UG0A 5AR0A 1LOJA 3HPWA 4W5TA 3G3ZA 3H5AA 4JQFA 4BI4A 4J9IA 1KFSA 4MEXF 2Z1IA 4ITVA 3IMXA 3V4GA 3L09A 3JW4A 4WTOB 5D3GA 2Y1JA 4S0HB 3JSMA 4AM3A 3GE1A 2ZGZA 4M7AD 2RM4A 3M1CA 4II2A 1VQ5A 2AA4A 2DZ9A 3TEEA 4C8QE 4E7IA 3RR6A 4QS9A 3HOYJ 2QA4T 4RW4A 1NJIO 1VQNT 5AQQA 4KA4A 4DU4A 1IDZA 1U48A 1OULA 3SWNC 1I39A 2Y30A 4A62A 3MWPA 2LQNA 2YNHA 2GXGA 4B3OA 4M42A 2HVSA 3VQ4A 4HXJA 4QAGA 3VQQA 4HF1A 1Y0UA 3MP6A 3X25B 5CYQA 2IAIA 1FC3A 4J83A 2OANA 1K76A 2EILH 1RI7A 1GOAA 3V4IA 2E2QA 1QRYA 2D1HA 4J6WA 2EB7A 3IUOA 4PDKA 1AZEA 4E1JA 3IH7A 2GWKA 2Y90A 3FEOA 2KRNA 5M5WJ 4YHHK 3P8DA 1HKTA 5BREA 1QZEA 1K0XA 4DF4A 4RM2A 1I50J 4K42A 2FA5A 2VB6A 4XRMA 5E17F 3KWGA 4JK7A 3IKTA 1VQPA 2UUCK 1Q81U 4JNEA 3CC2T 3Q0UA 5AQYA 4L3QA 5A2QO 1J2XA 2XSDC 4DUZK 3VENA 4A93J 2BE5F 1RBTA 1LUJB 1UAAA 3HRGA 4XMYA 3E2UA 2Q1ZB 2CUBA 4DTUA 3ASKA 4FM0A 4YFXF 4YOVA 5M1OA 5HLGA 3OYGA 1XOVA 3CCEI 2RA2A 3RYRA 2PG4A 2UUZA 1C0WA 3EUHC 3BJOA 4DBRA 4Y0WA 2HNYA 1QVPA 5BN9A 3O08A 1D1AA 3R8EA 2XRNA 1NYGA 1KD1U 1QQIA 4B8XA 4C2TA 3IP4B 2XG8D 4LDXA 3CJNA 3GYHX 3H3UA 2D0AA 3NTKA 4OKJA 3OQ5A 4OFHA 1VQLQ 1DGWY 3K1NA 4CGZA 5GAN4 1N33K 3HTUA 2A6HF 2ASMA 2DA5A 2R5ZB 1NK7A 4WX9A 5BMZA 3QQAA 4IFVA 4UXNA 3BDUA 4OVAA 2OFKA 2HKNA 3VW4A 2H6CA 1MKMA 3HOWJ 3BG9A 2LT1A 3CC7I 2XVCA 1DU6A 5LJ3j 1TK5A 1QHTA 2K5FA 1GXIE 5HRPA 1VSJA 2BE2A 1C0FA 2P6SA 4M78B 4KH4A 2BXYA 1UE9A 5FD5A 4KI4A 3MX2A 3H0FA 4CF2A 2BGCA 4E1NA 2YS9A 1I5ZA 4BDYA 1NGAA 2ITMA 2NOGA 1RAEB 5D4SA 1MNEA 3SD4A 4FSXA 1M9SA 4HX8A 4KO0A 4BHPA 1UG1A 2D45A 1WNSA 2YX7A 5CQXA 1XC3A 1ZBSA 4FWNA 4LN2A 4KBOA 1WAJA 2COZA 4A53A 5GANf 1YITA 1BI2A 2E65A 3ZQQA 3JREA 5DD4A 3S15J 2FBTA 2MLGA 4J2DA 4NYFA 1KD1C 2A6AA 2IGMA 1AHJB 2HDAA 3HFNA 4DV7K 2JRMA 4C8KA 2EIFA 1VQNQ 1HA8A 3CC7N 4NXNK 3JR9A 3EO3A 2I7NA 3BOQA 1IXSB 3VV0A 4ZN1A 4E7ZA 1JKRC 1KAXA 3CCMT 4BH9A 2A1RA 1RT1A 3QEWA 1UHFA 1EIFA 1KFDA 1R4NB 2BZTA 3F8MA 4IIOA 3W3CA 5FD6A 2DXCA 2R5AA 5HDGA 1TW2A 5JFRA 1LVKA 2YUQA 2LC2A 1B8IB 3KIOA 1RAIB 4WFNL 4RBOA 4PGHA 4PJLA 3EH2A 1OH6A 1OPKA 2EX3A 2V9PA 3LSMA 3QPTA 4J19A 1RRJA 4AG1C 2GNCA 4P96A 2W03A 2IGNA 2HFHA 5K7FA 1HF0A 5DM6F 5DTDA 4Y15A 3CC2Q 4KDPA 3KYLA 2DKGA 2G0EA 4L5JA 4KH5A 1U3OA 2GX9A 2VGNA 4Y33A 1Q81R 2L3PA 1W2BP 4F8RA 3KNTA 3AGKA 3C0BA 2ID6A 5BS6A 2JWTA 5GAOm 1HNVA 3KP2A 1DU0A 3WGGA 1ZUUA 3K0LA 4M7DB 4WYBA 4HNVA 4IEEA 3VQCA 4DZJA 4J5YA 2ACJA 1JGSA 2G6FX 3QWLA 2PEXA 4C5EA 4AF1A 2D8HA 5M5XJ 3NF9A 2NUTA 5H1SQ 5IHKA 1UA0A 4BR7A 3L00A 2CT4A 4EQQA 4KHSA 5C2DA 4BQOA 2F5KA 3WG7H 2G9WA 1KD1R 1P9QC 1TKZA 1X19A 2DQLA 1WBDA 5CQEA 1X2NA 3TVTA 3WXIA 4FLTA 3INZA 2MYSA 3O8HA 4PKIA 4C0GA 4OMPA 3PO4A 1KQ8A 4C5IA 2FNPA 1J53A 3VB2A 1DIZA 4DTRA 2HVHA 3JSCA 4WK8F 1E17A 3C0CA 1IXCA 1UHMA 1M5Q1 3M0TA 2DNUA 1GXQA 3BTCA 3ECHA 1X01A 4PJJA 1WFXA 3ZSYA 3QZ5B 1NG9A 4IX7A 1AVZC 4YORA 4LUEA 4DR7K 3JB9G 1KQJA 2W04A 3O3FA 3G1MA 1YRNA 4X34A 4DR5K 2P6TA 2VOPA 2CV1A 2XAJA 5H6RA 4QOZB 4DYQA 3CP8A 2ECZA 3JV3A 4M78D 4M7YA 1Z77A 4BVPA 5AQRA 2EQMA 1S22A 3Q3SA 2QEXI 1YHQN 3TO9A 3JCMf 3RWUA 3ULEA 3V9UA 4B08A 2K5IA 1B9NA 3EETA 1SHFA 2NAZA 3TSUA 5E3LA 5L3FA 4RLFA 3MCAB 4N4GA 3L6QA 1KJWA 2P9LB 3V81A 2ESHA 3IRQA 1OZ3A 1B1BA 4OMOA 1VQLN 4Y4RA 3KXTA 3TL4X 4O44A 4CBUA 1YYVA 4FSVA 2VGMA 1S9GA 1X4OA 3IV5A 3CC4N 3TAGA 1MU2A 1NGFA 1OQKA 2ISZA 2M51A 3AVLA 2DL5A 3KYDB 3CWUA 1KQSS 4M78F 2NS0A 5FU6C 1TWGJ 3I56I 3BTJA 2OC6A 1FT9A 5LRSA 2E1YA 3M0RA 1LPLA 4WXCA 4GV3A 4A3MJ 4JS5A 1MH4A 3I55I 4YFUA 3J7AY 1TTHB 2DMPA 3TBIA 3OYDA 3RMAA 4DEXA 5DLOA 3SZ2A 2QEXN 2PQ8A 1U4BA 2RHIA 4DQIA 1SF9A 2K3PA 2BIVA 3M56A 4PY5A 4E7KA 1YQLA 1XSVA 5D6EA 1ORNA 3O9SA 1K4US 4CDGA 4CZIA 4UNOA 3O5ZA 5E1XA 2GAUA 4QPOA 2OF7A 3G4SA 4IWVA 4DV2K 1YQMA 1XJWB 3DXJF 3SUPA 2R7VA 4MFDA 2DF6A 1HRHA 1QSLA 3CUOA 4IDHA 2G7HA 1FJGK 1Z9QA 2EJRA 3MZ8A 2LJ3A 2HR3A 2HVRA 4DLEA 2W4SA 5GAHJ 2PFUA 4BR9A 4K43A 1H9GA 3I56N 1N3AA 3D7SB 1YJNI 1R6RA 2HNDA 5GANe 3LSKA 3FXQA 2JW4A 2ZMEB 4IO9F 3AL0B 4BROA 4KMFA 2M8GX 2ATCB 4Z4EA 2NUPA 1U49A 2JRTA 2FHDA 4IFYA 3KLNA 4DQSA 3GTLJ 3I53A 5GMKm 2L4MA 4EZ9A 1QSYA 2NXNB 3RERA 1I94K 3KK7A 1A5WA 2CP2A 4MFEA 2PUOB 3K5LA 4CECA 2FX0A 4OB3B 1C1CA 1X3NA 3CMAI 4CJEA 1W1FA 1BHLA 2OPQA 4UB6C 3EAEA 3UA7A 4W5RA 2M0MA 1X3MA 3DTEA 2DFIA 4DBQA 4RB2C 2ZPEB 4N47A 5EEAA 4PFPA 1OQYA 1OPCA 2KFZA 5GPCA 4IIMA 2UV1A 3ZCOA 1ARKA 5M1FA 4J2AA 2GFAA 4M7DF 3JRCA 2ZF5O 4LIUA 4NS5A 3TAQA 3IQLA 2DO7A 2F5FA 1ZX6A 2FYKA 4FX4A 4XTWA 5DUIA 5LJ3f 3S2HJ 4HOBA 1Z0XA 3OYBA 2IRFG 5D4RA 2OQRA 4N4HA 3CYMA 2CO5A 2A3LA 2YHAA 3KP7A 3A8GB 4A4GA 5JI6A 2E2OA 2D0QB 2KIFA 3RSEA 5AQXA 2LBFB 1BIUA 4FOIA 2E36A 2HGCA 2RQTA 1RRQA 4JRPA 3ENOA 4AHRA 3MKZA 3GFIA 1WZ2A 1Y7XA 3J81E 4M6YA 1WHKA 1DP3A 2CFXA 3BY7A 5EEHA 1ETOA 1IHWA 5J26A 3EGUA 4OPAA 3HTSB 3NVKA 1VQ6Q 1MBEA 3DXKA 1TTYA 2YI1A 4IQ4A 4F3QA 3J80Z 4U0WA 4PJNA 5B3SH 3HJFA 1MH3A 2OX7A 4FJ5A 2NOLA 3EN9A 2GQIA 3WVEB 3MEUA 3ERMA 2QQ8A 2KZVA 5LJWA 1T2KA 2OTLI 1ZLJA 3OYYA 1B7TA 3HEFA 1P4WA 2XHBA 3E3VA 4IDKA 4C8MA 5KGXA 4E70A 2XGXA 5IY5H 3S14J 5BRHA 1YITT 3EZ5A 2D6FA 3PV8A 3W2AA 4KRFA 1D5AA 2VLAA 3VGKA 4RGSA 4OMYA 1P6RA 3DBLB 1VQ5Q 4RM3A 4ZJZA 1D0XA 1BR4A 2WTEA 1VK0A 4BB7A 3VPRA 3W6JB 2WB1N 1WRJA 4FOEA 2A7YA 3CBPA 2O8FA 3FHNA 2PYLA 2W0ZA 1YJNA 4N76A 2ZFWA 4D7MA 4JI7K 1KG2A 5KK1A 1F5TA 2QZ8A 4UV9A 4BRNA 2LCLA 5I2SA 2R5YA 3TO7A 1Y8RB 2M7BA 5CZ1A 1MZBA 4NC6A 4TSXA 3A5LC 3IL2A 3S1MJ 2O4XA 4WF2A 2HOTA 1SVMA 3HXMA 3MK6A 2LH9A 2OTLN 4DK9A 2P7VB 1PM3A 4PJOG 4M9XA 2QXFA 5D5XB 3E66A 1SRMA 3M3ZA 2BE7D 4JI4K 1VQPQ 3VQ6A 1TGOA 2ZJRF 1SMTA 1UELB 1Q82C 1C6VX 1K0SA 1EV7A 4A57A 2WBNA 4RAZA 2M3AA 2UXDK 2RGVA 4YFKF 1XQOA 4G1QA 1FY7A 2COYA 2WBMA 1KVCA 2ZPFB 4HEA2 4FJJA 5KYUA 3CCET 4QVCA 3MD2A 4RAYA 3GVAA 3NFCA 1VYVA 9ANTA 2JHNA 1DLOA 1AWXA 1ASVA 2LQ8A 3JCMc 2O8KA 3NBPA 4RWTA 4FTHA 1HD3A 2D0CA 4RTVA 3RSNA 3DLAA 4FVMA 3CPWM 2DAOA 3I8DA 2C0TA 2YHTA 1GL5A 2E6NA 5FROA 3DU5A 4Y52J 3VWBA 3ZEHA 1M2VA 1SZ2A 4J9EA 1Q86U 2QWQA 1X43A 2HF4A 1BOBA 3EE9A 1RESA 4M77B 3R6NA 1NGCA 1D09B 5GTHC 3K9TA 3WT0A 3JAMK 4FHTA 5LMNK 5F0FA 1ACIA 3CC7T 2GZWA 1I8FA 4DV6K 3K70D 3FXUA 1YIJI 4E9FA 1YO5C 5FWCA 1YT3A 1HJDA 3QWYA 4CFAA 2J4RA 1QMCA 2ZAEA 4CBWA 3R6SA 2DMOA 3SYZA 2RKHA 5DEQA 4DIQA 3IRRA 4OVLA 4DV0K 1ITYA 5GAN2 4K25A 1IN7A 4HLYA 2QENA 4DNCA 1QHGA 2IIRA 5FGMA 5CIUA 3HDDA 4ABZA 4CK3A 2WY8Q 3CCJI 2DJIA 2FNAA 1P59A 1YITQ 2DFUA 2O4GA 3F73A 4NXMK 3FXMA 3PX4A 1ZQ3P 5F04A 2H8WA 1IW7F 4EHTA 5GAN6 4BGAA 3WG9A 4IXAA 1XWLA 1QVFP 2RQUA 1F1ZA 3HOTA 5GP9A 4AUXA 1WI9A 3QYEA 1MPGA 3FZHA 1JQQA 1WBBA 3QG1A 1NM1A 2QDLA 4PSXA 5EZGA 4OB2B 1VQ6N 2DVJA 2HQ5A 2MC4A 2AIRB 1JUPA 1U84A 1X1BA 2J06A 2P9NA 4CH7A 2DXTA 2FPFA 1SSHA 1WEIA 1JXOA 4M7XA 3BCBA 2GFUA 4HVWA 1LV5A 4M3GA 1YQRA 3HK2A 4CCJA 4D8DA 1OISA 5GIOA 3MEEA 1R23A 1NHAA 1A35A 5IYDJ 2JM9A 2QTVA 2VODA 1K8AC 1BCOA 1GXPA 1SL0A 3FMSA 1H89C 4W5NA 5IT9O 1TUDA 1W5SA 3CF2A 3AA3A 4ENJA 4FPBA 1NKBA 1VQ5N 1FSHA 3RR8A 5BPMA 2VPRA 3G4ST 2EWSA 5CLSA 3CCUA 2HYFA 2RE2A 2QWOA 1J7KA 1S3XA 1QWFA 4X9CA 2IJLA 4X1VA 1O9SA 3VSKA 3MVPA 1IRFA 3RYPA 2D1XA 1KVAA 2QGGA 1IV8A 2M5WA 3KPHA 4BC3A 4CK2A 1X1CA 3LL7A 1WCMJ 1X3WB 2RVCA 4J7FA 2AP1A 3L2ZA 2FMYA 1VQ8A 4A3FJ 1K9MU 5K1YA 1IG9A 2ZCWA 4TVRA 1OZ2A 4FK2A 2JGUA 3HGYA 1BDGA 3ZSXA 1Q86R 3G0ZA 4BRCA 1B4AA 2XKPA 5CVRA 4A2BA 4FWOA 3A5NC 3JB9J 3QODA 1LJ9A 2LLKA 2OPSA 3J81K 1RUOA 2FMLA 5A0GA 3RPQA 1J9IA 4ILJA 5AT1B 4EFHA 3JRHA 3AGRA 1K61A 2ME6A 2H6BA 2HOEA 3RUXA 4FJXA 2JUFA 2XAFA 1YIJA 4KTZA 3KLOA 4FSSA 2DJQA 3CCRA 4B8CA 3CUQB 5LJ5j 3GNFB 5CVIA 3THYA 3RJPA 4C8QD 1GLNA 3CCJA 1A5XA 2KLAA 1HYOA 3MEDA 1QWEA 2IW5A 1Z1DA 1OH5A 1NLVA 4M77E 2CGHA 4EMGA 1NGNA 5D7UA 2CU7A 2OAWA 1JLBA 4LDWA 1K9MC 4PJOC 4X9DA 1X9WA 1MJAA 4CO8A 1XQSC 2FZCB 2GWRA 4R1HA 3I9QA 3JCMh 3BF3A 3QIPA 3JS6A 2OAUA 2PJRB 2NUTB 3FJ5A 1USSA 5AQSA 2NRRA 1VHXA 2X85A 2XRIA 5E1ZB 1WXBA 1JTXA 3RRHA 2O8DA 4I99C 2EGEA 4FK4A 2NRWA 1VOMA 3VS6A 1NNEA 4JKHA 3I56T 3NCIA 1RBUA 3KKRA 2VE9A 2BXZA 3E5UA 2R7QA 1UGQB 3I55T 2OTJI 2VXFA 4B47A 4CJVA 2W42A 4O5FA 2VC1A 3C94A 4KB1A 5JVTA 1BK2A 2CP7A 4C0FA 3DTKA 3NF8A 3DV8A 3D5LA 5LGUA 3IKMA 2OZMA 2ZB9A 3QJYA 3ZT4A 1YRNB 3ELKA 3HTVA 3G4SQ 2IPQX 2YHYA 2X4XA 3SBTA 3TARA 3OYNA 5GAEP 1NGHA 2XHKA 3JRFA 3HIFA 3ZT2A 1J5OA 2MH9A 4PJOA 2DXIA 1HUXA 3WU2C 3G1LA 3CJCA 3ULEB 4CF0A 2NOHA 4GGGA 1ZLKA 2KPMA 3PT9A 3GUDA 2QG9B 1J54A 2EHGA 1KSPA 1RC9A 2YLCA 1ZUKA 3OSSC 3AO2A 1KG3A 4OMZA 4JRQA 1I27A 1YJNT 2PU9B 3HM8A 1A5JA 2RI3A 1GV2A 5D6WA 4H0XB 2K9SA 1MMNA 3WQTA 2JUGA 1PUFA 4AIHA 2EJFA 1T56A 3L2VA 1LQ1A 3DLMA 1K9MR 2OTJN 3VF2A 4KUDK 2YCHA 3HGGA 4M3TA 2V4JC 4JDSA 2EZLA 1O3SA 2RAEA 1UAXA 4FWSA 2DRMA 3TP3A 4C92C 4CIEA 2WUSA 1DJ7B 1BL3A 3FC3A 4KIFA 5JVHL 5BPLA 3CMAT 1SAUA 1D8KA 1H8KA 3BF1A 1H3HA 3VS7A 4YPHA 2HSTA 1VQKI 4CHOA 1ZBLA 1R71A 3LAPA 3OWTA 5KYXA 1F1BB 5EC7A 3TWHA 3VPZA 4C8LA 2DTUA 2DE0X 3O1BA 4FE4A 2E6LA 1IB8A 3O4NA 2A5XA 1W4SA 5M5YJ 2LNBA 1IXRC 1ZBIA 5C12A 2HKQB 3WXMB 3ZQFA 3A8LB 3U1KA 2H27A 3TW7A 3UDCA 3H5RA 2DA9A 1BJAA 3UNGC 2KDZA 3H1VX 4RCCA 3WXKA 3A1YA 2E1NA 4BRHA 1B34A 3PVQA 3FFKB 4AIDA 4Z88A 1GLAG 5MLCQ 1BC8C 1RDDA 5LJ3h 3A0BC 5IAYA 5FLVA 1WPKA 4ICLA 3B8AX 5L3EA 1G5VA 3VUBA 2K79A 1N9RA 2W6LA 3GBQA 1JUSA 3CM5A 2RJEA 2NUPB 3NAEA 1FKOA 3LAMA 1ZRDA 4JEPA 1FNNA 3LA7A 5AQTA 4CESA 4ENKA 2BVMA 5IP6A 5IT9Z 4M7AG 2YUSA 5EDNA 3E6CC 2ZC2A 1RADB 1RT6A 4ZYHA 2R7XA 2X6OA 5C10A 3KZZA 1Y71A 2B86A 4RGUA 3DEEA 5M3MJ 3THVA 2HOAA 4RTYA 5C2FA 4R79A 8AT1B 3DTIA 4AI4A 2WTUA 2OTLT 4B3TK 1MNDA 3NQOA 2UU9K 3MEXA 2E7XA 5AJ3K 2IVMA 4CEBA 1MW7A 2J6FA 1YTAA 1X9SA 2IC3A 2DFEA 2FSNA 4DOWA 2W6KA 3I71A 3OIOA 2LY9A 3J7AO 4B1ZA 2IA2A 1D5YA 4BC2A 1DQUA 2P9SA 2F5DA 4PGGA 3RCOA 3M8EA 3LA3A 1EX4A 2O9SA 3ATUA 1OJLA 1RDAA 4JKGA 3CPWA 1YJNQ 1QVGA 2FBKA 5GAMj 2FO0A 3WTZA 3RSEB 3PSFA 4XLCA 5J8FA 3OJSA 1KZHA 3TO6A 3SAGA 3CI5A 4HDVA 3JRZA 3FGUA 3SEMA 3H9NA 3HC7A 1OFCX 4NLBA 2JM8A 3X20B 2ISYA 5BOXA 1IBMK 2CQKA 4YNQA 1GVDA 4CJ7A 4F93B 1VQ9I 3CQZJ 3DXKB 4JX5A 4G7OF 1U2VA 5H6QA 2VKNA 4CZZA 3DM2A 4EV0A 5C25A 4H4KC 4DFMA 2F8SA 2HZYA 3QYGB 1VNDA 4O0JA 4RMNA 3ITHA 2V1XA 2VE8A 1VQKA 3D5RC 3OGDA 4ISFA 3K4BA 3CCUT 4DWIA 3QIOA 4J01A 2YU9J 1KQ9A 3G25A 3SBGA 5LEJA 1H641 3O2PE 5A0DA 4BD3A 1L3TA 5J40A 2KVQG 5IT3A 1IGUA 3ATVA 5CR2A 4M3WA 1G59A 3GFJA 1LE8B 2KQ2A 4DGWB 1FIAA 2F5CA 4PJMA 3WNEA 4CFCA 2ADUA 4E89A 2KXDA 3GOXA 3MHXA 4CC4B 2K27A 2V75A 3AVGA 3FBNB 1MA9B 2LX7A 1S9HA 3F22A 3C12A 4FJ9A 4JD2B 2Q0OA 4FZXC 3S1NJ 1BI0A 2LTOA 4P5OA 3K7AJ 5I2MA 3R61A 1SG5A 1KVBA 2K3BA 3N5NX 5J39A 4RW8A 1WEGA 5AQPA 4M41A 2FF4A 4QLCU 2HXIA 5L23A 1YVNA 1R0AA 4KUMA 4NNJA 3EPZA 4VUBA 5FFZA 2F9TA 2X9DA 4JV5K 2JK3A 1NG6A 3CWSA 1I3AA 1HYVA 4HVJA 1QVTA 2R5YB 4DQRA 2WAEA 5IYBJ 5J4VA 3P83D 4XM3A 5LLQA 3I5RA 3W6KB 2JPSA 1FOYA 1TXQA 2SEMA 3DLHA 1YIJT 2KW4A 3KP3A 2HKXA 3CCRT 1R5GA 3U4LA 1XMOK 3J7YJ 4CVNE 4Z0UA 2H8HA 3LAKA 5IHIA 3X2QH 1HDPA 4GYGA 5KCHA 4BY1J 1ZXOA 4PZJA 3L2CA 2CUJA 1TV6A 3O4WA 3D5SC 2E88A 4FT8A 4P55A 4FM4B 2DI3A 2E6MA 4RAFA 3CCJT 1R0BG 1SS6A 4G94A 1R00A 2OZ6A 4F7ZA 2FRHA 4M75C 4JP0A 5BRFA 1C0GA 1FMVA 3O6BB 4IHSA 1FK9A 1NGIA 1DDNA 4DQ2A 3S17J 2BHYA 3ZSWA 3BDLA 1XMXA 3AAFA 4X62K 4NHJA 4OKKA 5KYNA 3MJXA 3K4LA 5J1YA 2RN7A 3J81O 3HHHA 4XKVA 1HNWK 2W00A 4HX4A 1V4RA 1PVEA 5L3CA 1WUAA 1YUWA 3ZQCA 1V5GA 3HSEA 2YJEA 4E6RA 1K9AA 2VUBA 4CD3A 5LHIA 4EVIA 1GLLO 1CF7A 1M8VA 1HPMA 2CW7A 5HRSA 4BWJA 1RBSA 4OINF 4DSIA 3MP8A 4RCBA 1CGPA 2O5RA 1WHGA 2HHSA 3CCVA 3CCSA 3LPTA 2LZ6B 5CYMA 3LPUA 4L5IA 4G6TB 2BY2A 3HSTB 2LP5A 1A36A 1CZAN 4CJUA 5CVVA 1S72I 3CCUQ 3Q0VA 4MO5A 2EV5A 2X4WA 1SHGA 1UGVA 4FYXB 4JUVA 4GW6A 1TH7A 1B9FA 4DW6A 1XNRK 4A3IJ 5AQLA 3Q9SA 3KZBA 2RJFA 4IURA 2BEOA 4GY5A 2CFOA 2F5TX 1EA3A 4CYCA 3PO3J 4M7AC 4GDFA 3WQUA 5M1KA 3S8PA 4YG2F 3U3YA 3DKXA 4GLMA 2OCEA 1VQ8Q 4DMNA 5KQ8A 4IRIA 1P7MA 2J7IA 3ERED 2HEQA 1X69A 4U7DA 2RNJA 1FX7A 3ABKH 4E7JA 1VTNC 3TTCA 4UUTA 4ZYDA 3OYAA 4RTWA 4C2UA 1PU6A 4HBLA 1QZ5A 2E1OA 3S2DJ 3CVTA 2QAZA 1PU8A 3TR8A 4HQEA 2XY5A 3AARA 2P9NB 4HUGA 3CWAA 1VQ7N 3GFLA 2CV2A 4K0KK 5LJ5g 4DF8A 4W5QA 1S72N 1MUZA 2DA7A 5D8KB 4A0XA 1YIJQ 2VPLA 5LJ5d 3VU3C 3NAUA 5D6XA 3CCRQ 4JX6A 4NLCA 1NK9A 3QP6A 3H08A 1UHCA 2HS5A 4AG2C 3I5UA 5FLXE 4OFEA 3I0WA 1YI2I 3MAQA 4FT4A 2XHIA 4FIBA 4KHQA 2LP0A 2ZNYA 1R1UA 3T1BA 4P5NA 3O9UA 1E3MA 2D8JA 2YUOA 2V6EA 4J7IA 3CCJQ 1QVFS 2AQEA 2DPDA 2ELKA 3ROUA 3RQIA 4HKEA 2HZDA 1RR8C 3S16J 4M7AA 1YJ9I 4FM2A 3HHGA 4DTMA 4YFNF 2R93J 3E1SA 1JUMA 4CC3A 1NJIC 2L8DA 4IEJA 3AG1H 2RHZA 3EY1A 4JLHA 3HUGA 4B23A 2KNBB 1I1JA 4BQAA 4J9DA 1R4MB 1IZ1A 1TWHJ 4JKEA 4A0YA 1ZRFA 4IO8A 3MN7A 2MGQA 1ZYRF 5FPEA 1LVAA 2UXNA 1XGOA 4LLGF 3C7JA 4ELYC 2K40A 2JOYA 2EPDA 3ZMUA 1BW5A 2E1MB 4OMLA 3KLGA 3JB9D 1KLNA 1W2BA 1NMDA 1YI2N 3BG3A 1REPC 4BEHA 3SJMA 1DEJA 3P4IA 3WXLA 2A42A 4A4FA 3CIPA 2HNIA 4RTXA 2OTJT 1K73O 2BY1A 3ZQ7A 1N32K 2DETA 3OBWA 1IKVA 2Z1HA 1GDTA 5J4YA 3BR3A 2LJ0A 3FXRA 5DM6L 5J1EA 1IGQA 3AO3A 2HMAA 1AWJA 1N8RO 1JLQA 1SVOA 2E19A 3TSZA 1BJZA 5FWBA 2WV1A 1U9NA 3R0AA 3FHGA 3JB9F 1XC5A 4OOIA 1YBYA 3PNVA 4JI3K 2F2VA 3FLGA 5DYMA 5FB2A 3HOUJ 1FP1D 1B9DA 1JXBA 2HBPA 5LGTA 4CC7A 2V51B 2VI6A 4L8RB 2DT5A 3GO5A 4RAGA 2K3FA 2IIMA 3AG4H 4AHUA 4M3BA 3AA5X 4PWDA 4LXCA 4FM1A 5CVUA 3HKZA 4WQ5C 1KEAA 3GTMJ 2LYCA 3OYMA 1JJ2M 3F6VA 1HNXK 3DLBA 5HS7A 2OA8A 2M0CA 4UNFA 2HYJA 1SV5A 1Z21A 2O8DB 2CZ0B 1GVJA 4EP5A 5CKBA 2A41A 4EMKA 5LJVA 2G8HA 2A3ZA 3GTQJ 3WVDB 4DCHA 2VBXA 4XH1A 5F64A 4LSNA 3EYZA 2QW9A 3AVNA 2X4YA 1Q7YO 3G0QA 1VQKT 1VYUA 3BY5A 1BU1A 5DUKA 1RNLA 2BHZA 3QYBA 2JPCA 2O8CA 4MQ9F 5JHUA 3M8QA 2KJBA 1WXTA 1MJBA 3ZT1A 1O7FA 3H8ZA 2VONA 2RV8A 3K1MA 1W97L 1EH7A 4CZJA 1PP7U 2E1ZA 3EKSA 1EJ9A 3J81Z 2Q31A 5E84A 3CETA 3LSPA 3ZQLA 4BXXJ 1YVUA 2XY8A 1WHUA 2IGIA 3FIWA 2HB5A 4JKDA 3BQZA 4DSKA 1YJ9A 1ZA2B 4PJOB 1H1VA 3F72A 1IN5A 4WQ5A 2LQKA 3Q7CA 1YW9A 3CD6I 3WTSC 4DV1K 2FOWA 1ABQA 4CHNA 1QS4A 1JKQC 4D7NA 4B4CA 3AA4A 1OH7A 5FKMA 2VVKA 3FK7A 3BDPA 2YDLA 1VQMN 3KFVA 3VQ8A 5GAOq 1AD5A 5C4XJ 4M6VA 5EVZA 1YNZA 4U7BA 4N0BA 3CBOA 4LD0A 1UGPB 3OW2S 4RUGA 4XLPF 3SJJA 1ZREA 3K57A 5DM7L 3VEXA 3OS0A 3SDGA 5HDKA 1HC8A 4CEFA 2DXBA 5FPMA 2EAYA 3ZLJA 1M27C 1RAAB 3VYRB 2PVDB 1TKTA 1T6CA 1OCOH 3PIOL 1DGKN 1QP2A 2NOZA 4O4GA 3EG1A 4LY7A 2KGTA 3QBXA 5KYXB 3N4MA 2PUKB 1TC3C 3IWFA 4HTLA 3GXOA 1HKCA 2GTOA 2LR8A 1OCTC 2RNAA 3AY9A 5BR9A 2R5MA 2D1VA 4ESJA 5DV5A 4BR2A 3J80E 1PCXA 5GAMg 1JE8A 5HVQC 1WEFA 1D3BA 4NOYA 5JVGL 2GLOA 1NKEA 4KAZA 1V5EA 1ATRA 3WODF 2EINH 2QBYA 3I64A 2YRVA 5AQGA 4KH6A 4NL3A 2IG0A 5F1JA 1FOWA 1Q9XA 4GNIA 3CEYA 4CCHA 3V9XA 1VSDA 2LT4A 4M72A 3DWLE 4JYAK 3VEWA 4CJ5A 2VASA 4BKXA 3FHZA 3K2ZA 2EQIA 4ZYGA 1OLTA 4XLFA 3ZQHA 4BU2A 1R36A 3M8PA 1SAZA 1LCUA 4DZPA 2AO9A 4IUQA 5F1XA 4FWKA 3HSBA 1BISA 1VQ9T 2HTSA 1J75A 3WHCA 3ZX3A 1N5ZA 3EEQA 4B48A 1MBJA 3CCVT 3IAYA 3LSGA 2YLBA 1HXDA 3CQTA 4CW7B 3CWTA 2RD1A 5KVRA 1DGRM 1AWWA 1VQKQ 1K78A 4LH4A 2FZKB 2M2EA 5ADXH 3I3LA 1M1FA 1YQAA 3L4IA 3CJ7A 3ASMA 3FX3A 2RPNA 1RABB 3RVCA 2Q2EA 1U2WA 3FMRA 1FTZA 1ETVA 1D9FA 2IBDA 4WXDA 2VJIA 3CCQI 1PKSA 2X4JA 2W41A 4L5GA 3S41A 2A28A 1NH3A 2KYMA 3PIOA 3AKZA 3K2AA 3QXEB 1PC0A 4KGXB 2HHTA 4ON0A 3EUAA 3F70A 3CCLI 1KSWA 4BRFA 1EETA 2EFWA 2P9SB 1QQJA 1OOTA 3PE0A 4MTEA 1NK2P 5DM7R 2LMDA 3M8JA 5FRMA 1HKBA 4JKGB 4DTNA 2F4IA 2VXEA 2Y48A 4DTSA 4EM2A 1VQOA 1SL1A 1YJWI 3ABUA 2EYXA 4PJOD 3CW7A 2WC2A 5GAOn 5HS9A 3RKWA 4Y92A 2BKDN 3VYHB 3CMEI 3FSPA 1WJAA 5LJ5h 4OJRA 1WGSA 2O8EA 3CO6C 1IV6A 3DLRA 4MLEA 4HV6A 3QUIA 2ZSHB 3JCMX 1BW6A 1ENHA 1HOMA 3DRPA 3SV3A 1FW6A 1TQMA 1WJDA 4FXDA 3VS3A 3MN2A 4HCBA 1ZYQA 3T1YK 1WLPB 4XRFA 3CCLN 2Z1GA 1JLAA 1M90U 4PJOF 1M3HA 2FF3B 2ED0A 4B24A 5E3MA 2E4HA 1TVRA 4PL8A 2KI7A 1QPIA 2NS8A 1Q8IA 3U8XA 4Z4GA 2K9GA 3G73A 2KZMA 1T3VA 1YJWN 2GA1A 1E0EA 4BG8A 1U1TA 3BE3A 3WUHA 1XSXA 3K58A 4Y13A 1XSDA 2YRDA 1JCGA 5C0MA 2XO7A 1Q81O 2HI3A 4EJZA 1T8EA 1KLMA 1LCKA 3J7ZI 2IVWA 4QTRA 1KK7A 2R7SA 4F3TA 2X48A 4L0ZB 2JMAA 4XTYA 3VKIA 2EFQA 1PSEA 3GF2A 3OS2A 2FQ4A 3ABLH 4LUDA 3VGMA 4N4OB 2RN8A 2QA4A 4ZZDA 3A4CA 1UA1A 3TAMA 4LF6K 3LSRA 2FZGB 3BZKA 3CCVQ 3CCSQ 2DLPA 2K5LA 4A4KA 3V1QA 5BNGA 4C92D 3DRSA 3RI4A 3M5RA 4CC2A 2ZJRL 2OZUA 4B1YB 2CT3A 3RMBA 3AVKA 1I1GA 1T44A 1S72T 3LSHA 3BY6A 2CH5A 1RDBA 5GAOr 2M7AA 1CKAA 4JJNK 5JS1A 3NGYA 2ME0A 5I42A 4Q5VA 2L7FP 3I0XA 5KQDA 4A6DA 5FRNA 3MO8A 2O8BB 1MBHA 3NDKA 3NEUA 1LEAA 2G3RA 4K8ZA 2UUAK 5L3GA 3KLHA 2BH1A 3LWFA 2CDTA 2CUFA 1XNIA 1DPRA 1X2KA 2EIKH 4OIPF 4AFUC 5KPTA 4CGIA 1LNXA 4F7UB 4AHVA 4C30A 2VT3A 3GF5A 2X3XD 1G8XA 5C4JJ 1YXQA 1WHLA 5KYYA 4XLAA 3REBB 4C8QG 2EK5A 1L0OC 2ASPA 1BCMA 3KLFA 3K0SA 3QHSA 5AQHA 2HBLA 2KT0A 1Y96A 1LAWA 2M1HA 3E9PA 2G8WA 1TQPA 3E97A 4OU0A 1IXDA 3F9MA 4GMJB 2KIMA 1QQNA 1HPZA 4H0YB 4XICA 1CF7B 7AT1B 2MG4A 3OYLA 3ZMVA 3WEEA 2GBYA 3PUBA 1K7AA 4BDPA 5JLHA 2DA4A 3X28B 1QVFA 1QGPA 1Z25A 2X74A 2PMZA 5HBMA 1YI2T 4B3RK 4N4NB 3MX5A 1ZTRA 2H3GX 4RB1A 1M3BA 2X1EA 1YWOA 1FXXA 5HDNA 2BW3B 4HVUA 1M90R 3QPHA 4DS5A 1R1TA 2I5JA 1RT5A 3CLQA 2M4KA 2DOEA 1YJ9T 2EFIA 5J6XA 1ZKGA 4MNUA 5FW9A 2MPXC 1X1PA 2ICWG 2OI3A 2BZXA 1EKEA 2JZYA 3S93A 1AA7A 2ZSIB 3IH4A 2QI2A 4IL6C 3G6EI 3MEGA 2L9RA 4CYCB 2NUBA 3CTAA 1LJOA 2K57A 3IDHA 1RLPC 3HSFA 3ZSRA 2M4GA 2L2PA 4FJMA 3SHFA 5AQUA 4JAXA 2XPUA 1JJ2A 2Z5UA 2I2LA 1VAZA 4JPBW 5F0CA 2OUMA 4X6AJ 1GCPA 4GCVA 4IRHA 3OJUA 4B9TA 4GVEA 1J6ZA 3VQ5A 4IXCA 3P8HA 1XDSA 3THXA 3HRTA 3LSJA 3TABA 3I35A 2GQVA 4BE0A 4IOXA 5IOYA 4JI2K 4BR0A 1TL1A 3MEVA 3K70C 2HBJA 2OA4A 1PRLC 1MV3A 1FN7A 5LGNA 3CCMA 5ERIA 2KTQA 4U88A 5GANj 3QOPA 5CY4A 5I3UA 5DCMB 2BUDA 1S1WA 1FMKA 5FKLA 4FWLA 2K7AA 2EJGA 5T7BA 2LF7A 4HA8A 4RTZA 5GAMh 4KTQA 2E5ZA 4EIKA 2Y0SN 3R0JA 2WONA 4Q47A 1NZ9A 2F4MB 1TZLA 4QWQA 4M7AB 2NLXA 4A5BA 2DBMA 4LFBK 3ZOBA 4FT2A 3OOUA 3A01A 3RTRA 4JN4A 1XGMA 4DLGA 2DTIA 4ID5A 3NFAA 3GBGA 3HOXJ 4BYYA 3HUGB 2YG9A 3BPVA 2HQRA 4HYEA 1FYLA 4BDZA 3A8YA 3KP4A 3DXMA 2R7WA 4MZMA 1VSMA 3SFIA 4CHQA 1RTIA 1VRUA 4RGXA 2R7DA 3CDLA 3FXKA 3W3DA 4M3ZA 2GGRA 1Y8QB 2STWA 1H3ZA 4E7SA 3W6VA 2UYTA 1V4TA 1Z7LA 4BEHB 3NNQA 1S7AA 2XROA 4Z4FA 1VIEA 3LDSA 1ON2A 2L5QA 1Z26A 4F7UE 4CZEA 3CPWP 4BGDA 5D6FA 4XTVA 3QPLA 2RH2A 3CBMA 1AZGB 3FZMA 5TRDA 2B6AA 4R55A 1T0JA 3MEAA 1KXPA 3IRXA 1E6HA 3RRGA 1Z05A 2GM4A 1YJ9Q 5LBQA 2RDPA 2X4HA 4XN3A 2GTJA 3ZN1A 1CQTA 4E6KG 1V29B 2JPBA 2WWYA 2QWMA 1JL1A 4FCYA 2FBYA 4ZDPA 1OR7C 5J2MA 4J6XA 4H5NA 4M75D 4ANJA 3FKIJ 2DMQA 3CD6T 3HZ6A 2O3FA 3G6EA 1PJRA 2V9VA 3AVBA 1S1TA 3TAPA 1GOCA 3A5ZB 3KD5E 4ELUA 3TOBA 2XB5A 3H6EA 2CYZB 3G71N 4DS4A 3A98A 4LG0A 1QKWA 2I0NA 2FBVA 1OU8A 4GYIA 2GUIA 3CDIA 1T6DA 3KLEA 4LB6B 1JJ6C 2KRSA 4DFPA 3QBWA 5TISC 3ZSZA 2OV7A 2HAXA 3K59A 2Y69H 1CZ9A 4IBNA 3TREA 2WY7Q 4FK0A 4XLNF 2RQRA 4CEQA 5FLXO 4EMKB 2LSNA 4MGRA 1S1XA 1W7PD 3MN9A 1TW3A 4XEIA 2AXTC 4E4HA 4A5MA 2KBTA 3DOLA 3LM2A 2Q36A 1HYZA 2A6EF 4W1UA 3F8FA 4UVAA 1K8KA 4IHWA 3M4GA 4C8QC 4JKFA 1O7LA 3S3MA 2O8CB 1ACMB 4OKEA 4LFAK 2W57A 4BWMA 3P39A 2EYZA 1OR7A 2MF2A 2NOBA 4R56A 1C1BA 1LNWA 1P8ZA 3L2WA 1USTA 1QBJA 2KKZA 1W9HA 1X3ZB 3VJPA 1O13A 2ZQBA 4AFQC 4UVBA 5JHFA 1BWFO 1JCEA 2D9TA 3FR0A 2VQCA 5EJCA 5B1AH 2VOOA 4A3DJ 4CCKA 2A08A 1ONVA 2FC0A 2JLEA 1QO0D 3NH1A 4M9ZA 3DKYA 3HM9A 1WPYA 4FYWB 3MPUB 3RMSA 2LCSA 2K9QA 1FOKA 4NCGA 1MDMA 2IVOA 3TQ7P 1UWBA 5KAIC 2NRZA 2K2MA 2ZFUA 4B3AA 2CUEA 2DVEA 4E7HA 1IAWA 3FLCO 3MXMA 4CCOA 3CJBA 1KG6A 9ATCB 3KFWX 2E60A 5C42A 2ZJQL 2FPDA 1OX9A 4JJCA 1KAZA 3H9QA 1SKRA 2RI2A 1SFXA 2JMCA 3BQYA 3R4KA 4BRIA 4NUBA 3O4QA 4C8QA 4I01A 1OYXA 3SUQA 4M7AF 2MOXA 3ONQA 5GAOl 4ZN3A 4I2PA 4X64K 3RKQA 1VYTA 4E3SA 1HYSA 1M3QA 4K41A 5IHNA 1D8YA 3OL4A 1RAFB 1BR2A 4U87A 2QWLA 3CCQT 2Q2RA 1LAVA 3VDXA 4XKBA 3LM9A 3V9ZA 1IHVA 1T33A 3K4NA 3DBRB 4MLOA 1Y0NA 4LG3A 3CCLT 4D6WA 3NF6A 3CD6Q 1VQOQ 4F55A 1U0JA 4II1A 3OV8A 4XK8E 4EATA 3N4PA 3JCMP 4HAMA 1UB9A 1WYXA 1JKPC 1OX8A 3SWNA 3QDKA 5FU7C 2QQRA 3QINA 2MSYA 4QT7A 3NGIA 2ECBA 2RQWA 4G6QA 1QZ6A 4RW7A 4J6YA 1HBXG 5HK3A 3CMET 1J5YA 5DLQE 4J2EA 1VQ4I 2ELHA 2ZJPL 4X1EA 1FWZA 3L2RA 4DR3K 1T6SA 2A37A 1X6OA 5GAN7 4IUPA 2CP6A 4OPKA 5K7ZA 1RL2A 1B72A 5GMKe 2R4GA 1Y57A 2G7UA 1QCOA 2YNIA 1K78B 2D0OA 2D2WA 1RAHB 2ZO4A 5GAEJ 4MMKA 2Q2EB 1C6VA 2MLKA 4KREA 2YHXA 3H45C 4AHTA 3TGNA 1J59A 1GHCA 2GIZA 4ZGDB 3DLGA 3VS0A 5E8IA 2F69A 3ZL7C 3KK3A 4XTXA 4H0OA 3QFPA 3OH6A 3EUHA 2MIOA 4BNCA 1LWWA 5EG2A 4BJTA 3VRYA 3V7RA 3HOSA 3UR3C 3NPFA 3H46O 5AQOA 3T0YA 2FG0A 2WAQN 2GXBA 3V9SA 2OAZA 3R2XC 3CG7A 1Y0MA 1ABOA 1VQ4N 3N97A 1F9NA 3FBIB 4M73A 1VUBA 2IEKA 2QA4Q 2V8IA 3E5QA 4OGEA 2KHOA 4C0DC 1ESVA 3CFOA 1KAYA 1D0ZA 3TW6A 1TLHB 4IUTA 1BIZA 3HT3A 2PN6A 2O8EB 4I6MB 3TAFA 1NOZA 3QDRB 3QFUA 1WSJA 3LDLA 1W0HA 1WJEA 1RUNA 1EP4A 5J47A 1Q86O 4CZGA 3NTIA 3V7SA 2DLLA 2DA2A 2ZBKA 1BC7C 1S5LC 3HB9A 4ZNXA 3LMMA 3OTOK 3K6GA 3J80O 5AIPA 1GUUA 3VODA 2YSQA 4AM7A 4I76A 2VG7A 3DFGA 2YRCA 1XX5A 2AZVA 4N0AC 3NH0A 4Z8AA 4CIGA 5CKFA 5HCKA 4CGFA 3ZEUA 2AKLA 3BTLA 5GPAA 4BI8B 2FBHA 1VZ0A 2AXLA 3MP1A 5GAN3 3AG2H 3C7NB 3OIPA 3CXCM 3FM5A 1N6AA 3U3GA 3PL8A 2R7OA 4G12A 3CCEA 4G6DA 5GMKl 1YHQI 2VBZA 3ZFJA 5FLXZ 2DL3A 3TMOA 1QQOA 4HPQA 5EU7A 4CUGA 1RT4A 4BJ6C 5AFUA 4OIOF 2Q0RA 4EGYA 1IBLK 3M0QA 5EYRA 1SFKA 4CZLA 1LFBA 3D2EB 3RIRA 4JS4A 3AVJA 4JI0K 5DCFA 4BBSJ 2DK3A 1VQLI 4F04B 4AIJA 1GLEG 3NGPA 2ESWA 2EYQA 5KPZA 1SANA 3MKLA 2QXLA 3CC4I 3C3WA 4ISEA 4WE1A 1TU0B 3DP7A 3EG3A 2OJ2A 3CC7A 3BR2A 3KYCB 1QQCA 3QO9A 2EWNA 2Y4YA 5C6SA 2NRXA 4Z2YA 1WJRA 2ZD1A 2XF6A 2WADA 5AONA 1EWRA 4BRGA 2E41A 1YE9A 2KT1A 5B66C 3EZWA 3LLRA 4BHCA 2KR3A 3LYIA 2A61A 3ZGKA 2VL8A 4PK4A 2KJCA 1KU9A 1WJ5A 4GV9A 4OFAA 4Y17A 3RNJA 4EM0B 4BQLA 1NWKA 2O2OA 2PAVA 1TT0A 2M02A 3G6ET 3QSUA 3QP5A 4LLNA 1M8MA 4H0EA 2DYRH 2UXXA 5KYYB 2K3XA 2W85A 2TRTA 1NJYA 5E20A 4M78E 4BC4A 3F3XA 3JAME 1FMWA 3VOVA 2LC4A 3HPHA 1P7JA 2E35A 3BW1A 1EZZB 1YS6A 4AT1B 1FP2A 2L7KA 2CJJA 2CS3A 3OOPA 3LAJA 1OPLA 5GANg 4A63B 1TNSA 5KCMA 1RILA 4KFBA 4H0TB 1VQNI 3HL2A 3CCMQ 2UZKA 1WSGA 1V55H 4D5CA 3LP0A 4AI5A 3OW2M 1TWBA 4BRLA 2HBMA 1D4XA 3UIQA 1K9MO 2ZPIB 1XTAA 5H2FC 1ATSA 1TKXA 4AH9A 4FJNA 4M3FA 3WEEB 4LFUA 5DM7F 3I59B 3QNOA 3U9DA 3OHRA 4AVZA 2W25A 1SVLA 4AFZC 3AO5A 3CQYA 3M9QA 2K9LA 1BQMA 2A05A 4FJIA 4YEJA 2Z9OA 3HM5A 1X6GA 3PIOF 4ASNA 4EMHA 1G3TA 2OPPA 2RQVA 2OJED 2MW8A 2IS6A 3MKDA 1IRGA 1HNIA 2DPPB 1SL2A 4OB1B 4FW2A 3BR1A 3QBYA 2ZZDA 4JJBA 1O3QA 5JVGF 4MMLA 4Z6YA 4A69C 1Z6TA 1OYYA 1U5TB 4DV5K 2DL4A 2X6WA 2DYBA 3VF6A 1HR0K 1VQNN 5ILSA 2EQUA 4IPAA 2LKSA 5GIPA 2P84A 2E1HA 5CQGA 2LVMA 3LP3A 1ZG3A 3BR0A 3VQEA 3CJRB 1YHQA 2PVOB 2MK5A 4OAYA 2VG6A 1MHNA 3VF4A 3THXB 5C0YA 3OY9A 2Y9ZA 4XAXB 1K79A 2VT2A 2NVTJ 1MIJA 3P38A 3R3LA 4J8FA 3QO3A 3KLIA 1IRZA 2KRMA 1T95A 4YOXA 2V1DA 4CJSA 2BGGA 1IN6A 4C1NI 3AG3H 4A6EA 1JXMA 2LRQA 4MQVA 1TYQA 3CC4A 4M7DE 3CC2N 3ENHA 4PCQA 3I8BA 4JK8A 4BRKA 2MCNA 1XD7A 3S3OA 2JTVA 2WSCE 3PIPL 2IOCA 1JCFA 3IFRA 1RAGB 3PFYA 3Q9VA 3PSIA 1A6QA 1KG5A 1Z9CA 2V8JA 5KH6A 3BG7A 2HSPA 3G6EQ 3M0SA 5CKHA 1ITGA 4FVUA 5FPDA 5AQFA 1MJ9A 1OKJA 3A01B 1IN4A 2QEXA 4WCEL 2HDDA 2PX9A 3GL1A 1NK6A 3M1FA 5L8RE 3QDFA 4RW9A 1OVYA 3VEPA 1YAGA 1JJ8C 1ZHIA 3CF5F 3DXMB 1RKWA 4J9HA 1DTQA 1LFPA 3HSRA 1C0TA 1RIOH 1Q95G 3CJ1A 4WCGA 5A2QK 3JCMg 4BE1A 1JLFA 4KHNA 4BY6C 3JCMd 2A68F 3P1GA 5BPNA 2QYZA 4L9TA 4BRMA 1Z3XA 4PA1A 2BUPA 2QK9A 2I8DA 2XPWA 4R8HA 1TUUA 4X65K 2VQEK 1NEBA 3I56A 3NF7A 2I10A 4ZYAA 4B9VA 1SKWA 2NLUA 5GJWB 3TOAA 4GKJK 3I55A 1WX6A 4F17A 2Y75A 4NB5A 4FWPA 1YFHA 2VJJA 2OQGA 5CPRB 3GLXA 3PM1A 4XLEA 1MD0A 3J7ZO 4AIAA 2E34A 1O1WA 2HQXA 3CDHA 5J2PA 2O8XA 3BT9A 4XOPA 1Q82U 3CLOA 4FL9A 1MMSA 2KKOA 3DPLC 2VYTA 3L2QA 2XHCA 2TDXA 4L0YB 4C9YA 1F4KA 4A4EA 3MKWB 4I7HA 4RG8A 5AQNA 4N56A 1IKYA 4CE9A 3QEPA 5C15A 4M77G 4XNFA 4B9XA 4HF2A 3HFOA 2WFBA 5CHZA 3PIPA 3LX7A 3I54A 3O9RA 1NJZA 2W82A 4DFKA 3GP8A 2O0YA 4IHVA 4BY7J 3LOCA 3CPWS 1QVGS 3CJ9A 2Y2ZA 1L5UA 4PL7A 1UGRB 4LG0B 3MAJA 2ZMEC 3AL0C 2Y31A 2DERA 1AWCA 2CP5A 3QEIA 2RJDA 3AFHA 1UGSB 4DR1K 1JXSA 1U8RA 4E2FB 4BE2A 1VSKA 4O0IA 3DPTA 3KEQA 2DTZA 3RZDJ 4HUEA 2L01A 2JNGA 4DTOA 4E47A 2X3WD 1Q18A 3THKA 1RTDA 4ATOA 2ZXHA 1G6NA 4XBFA 4Z4CA 4FJLA 1GFDA 2YX6A 3E6BA 1E4FT 2P81A 1PG5B 1XUPO 3HBLA 3CMAA 2IVPA 3WTXC 2HHHK 6PAXA 2XB0X 4ELVA 2IS3A 1K8KB 1CLQA 2KIQA 2VCPA 2XGDA 4HDUA 4F14A 3M58A 3ZCMA 1E4GT 2M16A 3WNHA 2DJZA 4XORA 4I98B 2VUMJ 2HHUA 3D0SA 4JOMA 4E9HA 2GTDA 1JBMA 4F91B 4QKUA 1Q1HA 4AYBN 2K4BA 1XHXA 4E19A 2JVGA 3IUCA 3VTIA 1T08B 1JRIA 3D45A 4EZ6A 1U9OA 2QF7A 1WQ7A 3FK6A 4C8OA 4HG2A 4B1WB 4CJTA 3VEVA 2C6YA 1K73C 3L9FA 3X24B 5J1RA 4KUIA 5LJ3g 4JI8K 1XMKA 2V26A 1M1KO 5LJ3d 1IF1A 1V3FA 3K9JA 2B63J 1UJ8A 2LJ1A 1TS9A 1N8RC 3KEOA 2PVGB 1ZR2A 2P1JA 3O8GA 1BOTO 1VQ6I 1GFCA 1KQ0A 1TWCJ 4LJZF 2DYIA 3ULDA 3DOKA 1NYFA 3GZ5A 1WWXA 5JMVA 2EQKA 4CSWA 4W5OA 4M71A 4C8QB 3E19A 5LMUK 3QWXX 2VQFK 1MUYA 2GWJA 4DR6K 3F6OA 1FPQA 3OB9A 2VKEA 3GIBA 4IG0A 4CGHA 4RCHA 1RCHA 1K8AU 3BTIA 1YWPA 1RKTA 4DYRA 5EY4A 1RR7A 1O3TA 4EJVA 1LDDA 2BOLA 2XIDA 2YNFA 2M9UA 3PTAA 1Q82R 2OTLA 1Y6IA 2EGCA 4WFBL 4LLLA 4C92G 3VS1A 4IZ9A 3NMZC 2E5NA 4UY8O 5E3NA 1BBZA 3Q1JA 1EWQA 4K2EA 4RTTA 5D6YA 3SEZA 1V54H 2MABA 1BN5A 3FF5A 2J6KA 2AJQA 2KT8A 2GIVA 3RBBB 2UUBK 1VQ5I 2QQSA 2E2IJ 3KHYA 2RJCA 5EOYA 5GAOp 3LWIA 1ZC6A 5GANh 4IVNA 3SWNB 3D2FA 1Q7YC 1N39A