4E7IA

Pfv intasome freeze-trapped prior to 3'-processing, mn-bound form (ui-mn)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 110
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7iA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7iA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7iA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7iA03
3PX4A 4KTZA 1JLGA 4KHUA 2DAQA 2G3RA 3L2WA 3CEYA 2G8UA 4UC4A 1D9DA 4M42A 4CIGA 2OPRA 3LALA 4C8LA 2X6NA 3CFPA 2HVIA 2YNHA 3RR8A 3MEAA 3I0RA 4DTRA 1JL1A 3V9WA 1HQEA 2M0OA 1VRTA 2Z1HA 3L2UA 4Y1DA 1ASWA 1Q9YA 5SZTA 4QW2A 5FRMA 5KCOA 1D9FA 4AHUA 1SUQA 4PA1A 3OYCA 4OPKA 3TABA 3ZSYA 1TK0A 3AO5A 1RDDA 3VQ4A 3DB3A 4F8RA 5C0MA 4W5TA 4GW6A 3ZSZA 3QIOA 2F8TA 2HW3A 3CFRA 3LAKA 4DSEA 2QQSA 4OKJA 1X9SA 4E7JA 3FDRA 1RBTA 3ZEHA 4C8NA 1WSHA 3LP0A 3NCIA 3QEVA 3P83D 2IC3A 4DMNA 3HPHA 1J54A 4Z4CA 3MEVA 3O4NA 4UQGA 1XC9A 4PY5A 2IDOA 2XY6A 1NK7A 2O4XB 2HHQA 4FZYA 5C6SA 1K6YA 1LW2A 1FK9A 4NYFA 4KB0A 3OYJA 3MXMA 3OYNA 2LDMA 3L2VA 3E9GA 4CGJA 1L3UA 5C42A 4IG0A 1S6QA 3L2RA 4CF1A 1WJSA 3DOKA 3O3FA 1EX4A 4QQGA 4RW4A 3V9XA 2ITGA 2P0KA 3CM6A 1HNIA 4DFPA 4HCBA 3QNNA 4FM0A 4C5EA 3M8RA 4N4IA 4PUOA 2KFZA 4MQ3A 1NJYA 1KSPA 1SKWA 1VSMA 4RW7A 2FBXA 1BGXT 5CIUA 3AA3A 4FK4A 4DTPA 3TARA 4CK3A 1JLEA 2FHDA 4FW1A 3VQDA 4IBNA 2ZE2A 3HPGA 2X74A 4CEOA 4NZGA 4IUQA 2BUDA 3T19A 1ZBIA 2X4XA 2W42A 3AVFA 3S3MA 4DQQA 4DQRA 1NJZA 4E19A 5J2QA 1A5VA 1ZBLA 1VSFA 3RMDA 4ELTA 4FM2A 4CGHA 4AHSA 1S1TA 4E7HA 2GFAA 4BWJA 3V4IA 3LWLA 3PNWC 1H3ZA 3VQPA 4DSJA 3NDKA 3G10A 2YRVA 4FJIA 3V1QA 4KKOA 3NH0A 4KB1A 3MEDA 4HTUA 4BDZA 3VQQA 3KLHA 3A2FA 3S9HA 3SQ4A 2VG6A 2XO7A 1TK5A 1WJQA 2KTQA 4NS5A 4Z4FA 1QS4A 1BHLA 3TR8A 1W0HA 1C1AA 1KCFA 1R0AA 1RDCA 4LH4A 3I0SA 5KE3A 1T05A 5M9OA 2RHZA 4IUPA 4B9UA 3DLGA 1KFSA 3WNHA 3MEEA 4PQUA 3KK3A 3AA4A 2QKKA 3VQ6A 3NTIA 4KPYA 4FJ9A 1LWEA 4DTSA 2O4IA 1NK5A 1NKEA 3T3FA 4KAZA 4BE0A 3DRRA 2O4GA 3PMTA 4IFVA 3BDPA 4FLYA 1NK9A 4Z4EA 5D6WA 3LPUA 5I3UA 2R57A 4B9XA 2CKKA 3PMIA 3KLIA 1VSKA 4CFCA 3QBYA 3ZT1A 4Z0UA 4FJ8A 4PL6A 4AHRA 4DTJA 1QTMA 1BQNA 2VG7A 1ZBHA 3S3NA 4FJJA 4ZTFA 1SL2A 2KW4A 2XRIA 3RMBA 1OZ3A 1EETA 4Z02A 2WOMA 4O44A 3KTQA 2KQ2A 5IN1A 1B9FA 3MEUA 3AO2A 3NHGA 2PYLA 3FLGA 1NOZA 5FROA 3LP2A 1HRHA 4M3XA 5CZ1A 1C0MA 3DRPA 3P5JA 3LLRA 1VRUA 3IRXA 4CJEA 3F70A 2NUBA 3SZ2A 2BANA 1C0UA 3AVBA 4JS4A 3QNOA 4CJ5A 5K14A 3OY9A 4CJSA 1KVBA 1ZBFA 2HMIA 4RW9A 3OYGA 1IKYA 3PX0A 4ELUA 2JGUA 2HHUA 2WACA 2VWKA 3KD1E 3SYZA 1GOBA 3SUNA 3E9FA 4OGEA 3NF8A 1C0TA 2YKMA 1RBSA 4CF0A 3SV3A 1Q9XA 4CIFA 1SKRA 4FYDA 1KLMA 1CZBA 4C8MA 2G8FA 1RT3A 4AHVA 3DYAA 1N6QA 4QOZB 3QIPA 3AVIA 1LW0A 4FVMA 4BWMA 2X78A 1TGOA 4E1MA 3FC3A 4FW2A 3OYAA 2E6MA 2G8VA 3EAEA 4A4HA 1FXXA 2X6SA 4CEZA 4W5RA 2HHXA 3DLBA 1J53A 3H6ZA 3I8DA 1GOAA 3SUQA 4ID5A 4DTMA 1WJRA 1KTQA 1NK0A 2E6LA 2OZSA 1TV6A 4Z4IA 3MEWA 4QQDA 3D45A 3V9ZA 3NH1A 3PV8A 3V1OA 1S1VA 1EKEA 3V9SA 4CGGA 4RW8A 4ICLA 3ZCMA 3IAYA 4N4GA 4FZXC 4FM1A 1XWLA 3O3HA 1RDAA 1RT5A 1WAFA 2BDPA 3OS0A 2IS3A 3SQ2A 2EQJA 2P1JA 5HRSA 3MAQA 1C1BA 2OA8A 3C6TA 2K3XA 1NK6A 3EZ5A 4CEFA 1S9GA 2RKIA 3LDSA 3D0PA 1BIUA 3DLRA 2HHTA 3QKJA 1JLCA 2RI3A 2XY7A 4FJ5A 3AV9A 2RHXA 3OMCA 1YTAA 3U3YA 5J1EA 1TL3A 1T8EA 4L59A 1I3AA 4F3OA 4I2QA 4ZHRA 3DI6A 4CEQA 2G8KA 4NCAA 4W5NA 4OLAA 3MP1A 4HUEA 2GF7A 4CEEA 2L8DA 3HYFA 1X9MA 1YTUA 4CF2A 1DTTA 3AO3A 4LY7A 4E0DA 4QQ6A 4KHNA 3L42A 2ZQBA 2B5JA 4KHWA 3K58A 3DLMA 4W5OA 1JKHA 2EQKA 2BIVA 3RMCA 3CQ8A 3ITHA 3TAEA 1VSJA 4DS5A 4I7FA 3QLHA 3JSMA 2IOCA 4DTUA 1L5UA 1RT7A 3OB9A 1BISA 2Z1GA 3SD4A 5D6XA 3AO1A 4RG2A 1CXQA 4QVZA 1IKXA 2EHGA 3ZT2A 4DF4A 3MEGA 2O4XA 4KRFA 2NLUA 3OJSA 3S6WA 2X4WA 1JLBA 3ALYA 4CJFA 1WGSA 4O4GA 4M3WA 2KZMA 3WNEA 1I39A 1OZ2A 2KFNA 2RHIA 1REVA 1YVUA 1D5AA 5CYQA 4J2AA 4AH9A 4G1QA 1WSJA 3ZSQA 3NF6A 2D0CA 1S9EA 1QHTA 3CM5A 3DRSA 3ZSXA 4DSKA 4O55A 3TAPA 1LV5A 4M3ZA 4DSFA 4N41A 1JLQA 1U48A 2LSNA 4CESA 1BI4B 1HNVA 4OJRA 2FBTA 4Y1CA 4DTXA 1ITGA 1Z25A 2YV0X 3AVKA 3OYIA 4F3TA 4K8XA 3KKRA 1CZ9A 4ZTJA 3K5OA 5KGXA 4A4FA 4QCLA 3T1AA 4BDYA 4CJQA 1S1WA 4EP4A 3LGLA 3KKSA 4FK2A 3DMJA 2DFFA 4M3RA 5KRTA 2A1SA 5E41A 1RBUA 4CCHA 4C5GA 4DU4A 3VA3A 3ZT4A 2F5KA 5EU7A 3PO5A 4DLEA 4FLZA 4CERA 4BE2A 3KK2A 2YKNA 3NTHA 1SKSA 3B6PA 1ZBUA 3OYBA 3NBPA 3P8DA 1G5VA 4DFMA 1WSEA 4AHCA 4CJ4A 3OYFA 5HRNA 1KRPA 1C1CA 2BKDN 1UWBA 3QEWA 5C24A 4JRQA 3NE6A 5KRSA 1F21A 3ZSOA 3MECA 5FDLA 4NCGA 4J2EA 3THVA 1S5JA 1LAVA 2RN2A 2FBVA 2FC0A 1T7PA 4CK1A 4OLBA 3VA0A 4CJRA 4CRIA 3KLFA 1QE1A 4BD3A 4DG1A 3HJFA 4CEBA 2EX3A 4I9QA 1YT3A 1OYXA 4FLXA 3AVNA 1WNSA 3RRHA 4FK0A 1SV5A 4CE9A 2JLEA 4A4EA 3AA2A 3RWUA 2OZMA 5J2NA 3TAMA 4M3UA 4N5SA 3LZJA 2B6AA 4LD0A 3K5NA 4DTOA 1HYVA 4M45A 1UA0A 3HVRA 4NCBA 3MP6A 1IO2A 1NJWA 5IAYA 1VSHA 1WSGA 2YNGA 4C5HA 4F4KA 2HHVA 2EFIA 1L3SA 2VYTA 4FJMA 3RR7A 1TAUA 1TKZA 3SUPA 4N76A 4E89A 4DSLA 4LSLA 2IGIA 1WSIA 3CYMA 4DQPA 4K8ZA 4CFAA 4KFBA 4FCYA 2RPIA 1U4BA 3B6OA 4YFUA 4DTNA 3OS2A 3FEOA 4M41A 2OPPA 1O1WA 3RRGA 4KHQA 1RTJA 2RJDA 4IUVA 1JLAA 2XK0A 4JLHA 3DLHA 3SCXA 1BCOA 3V1RA 1ZYQA 1U45A 4O5BA 3VQ7A 3OYHA 3PUFA 2XY8A 4AHTA 3U6FA 1TK8A 3OVNA 2RI5A 3ME9A 4FJNA 2HQXA 5D6YA 4FZZA 3TAGA 3OYLA 4OKEA 1T03A 2YNFA 3QESA 1SL1A 4PLIA 1XI1A 3QEXA 4B3OA 4B9NA 1UAXA 3U3GA 2QK9A 3VQ9A 3IS9A 1JXBA 1JLFA 3LH0A 2M16A 4CHOA 2VWJA 1RI0A 3KLGA 4CF8A 1DLOA 1IG9A 4CJVA 3V9UA 1KVCA 3NGYA 1QSSA 3WNFA 1KHCA 1XHXA 3C95A 4CJPA 1GOCA 3K2PA 4KHYA 3L8BA 4ELVA 2L3RA 2YNIA 1C6VA 2ATQA 4CJWA 3SPZA 1G15A 3AVCA 3OA6A 4DQIA 4JRPA 1VSLA 3JYTA 2Y1IA 4BDPA 1HMVA 2HNYA 4B8AB 3HP6A 3NTKA 5FRNA 1BCMA 3F9KA 2HNZA 3M8SA 5J2MA 2D5RA 3H8ZA 1KLNA 4Q5WA 3LX7A 3F73A 3TAFA 2OPSA 4M3YA 4HCCA 4B9WA 1TL1A 2P51A 3HO1A 1A5XA 3V81A 3RMAA 4EDUA 3C6UA 3HT3A 2HHWA 4MFBA 3AA5X 3TI0A 3NF9A 1WN7A 3K57A 3NH2A 4KI6A 3AVGA 5J2PA 3HVTA 4OKKA 2E4LA 2QKBA 1BL3A 3VQCA 3DLEA 1IH7A 4LD6A 4H4OA 2PYJA 4KI4A 3OYMA 4IKFA 4NYNA 4KV8A 2DTUA 5CY4A 3V6DA 3DOLA 3VQEA 1RILA 3K59A 2PZSA 4AILC 1RT2A 2MWPA 4B9LA 2K3YA 1NOYA 3SJJA 3PY8A 3ULDA 1KVAA 4DFKA 3L3VA 3OYDA 3ZT0A 2Z1JA 1RT1A 2G8IA 4CJLA 2HB5A 4DU1A 1RTIA 2QXFA 3SQ0A 4X34A 3GOXA 3KK1A 1RTHA 3OMGA 4CHNA 5KTQA 1EP4A 4M3TA 3P8HA 2YHBA 4KREA 2HQEA 2XY5A 4YNQA 2DY4A 3QIIA 3E01A 2GBZA 4KTWA 4W5QA 3PO4A 3OJUA 1OI1A 4FLUA 3LAMA 3QINA 5HP1A 4FJ7A 3QETA 4B9SA 2B4JA 2RJFA 4DS4A 3HP9A 2Q3SA 1IKVA 1BIZA 1B9DA 3O3GA 3TANA 3UT1A 3O4QA 3SQ1A 3S3OA 4O0JA 2R5MA 4E7KA 2GUIA 4IG3A 5J39A 2RHUA 4GY5A 1L3TA 4H4MA 4N47A 1MHNA 2R58A 2ETJA 3TWHA 2R5AA 4PWDA 4IUTA 1RCHA 2PY5A 4DQSA 1VSDA 4FJXA 2RF2A 2DIGA 5HBMA 3QJ6A 3C4SA 1VSEA 1ASVA 3NFAA 1U04A 2DIQA 1DTQA 3SI6A 3QO9A 5I42A 4KO0A 1BI4A 3LWMA 4KTQA 2RJEA 5KCHA 5DMRA 4ID1A 1NKBA 2PQWA 3VQAA 5CYMA 1SL0A 2D0AA 4CFDA 2ZD1A 3QERA 2LCCA 3SPYA 3KUFA 1RDBA 3ISNC 4E7LA 3META 1TKDA 1SSFA 1HPZA 4CGFA 1CLQA 4CEAA 3AO4A 5KGWA 3KJVA 3LP1A 4FJLA 4Z4HA 3KD5E 2M1HA 1NKCA 4HCZA 1XHZA 1VSIA 3NAEA 4GVMA 3L3UA 5C25A 3NF7A 4E3SA 2RHYA 1U49A 3HXMA 4B8CA 1RNHA 4EZ6A 2RJCA 4HVJA 2E5QA 4B08A 1QSYA 1HYSA 1HQUA 3DLKA 2R7YA 3MO8A 1EXQA 5HRPA 4N56A 3NNQA 5CZ2A 5T7BA 2IG0A 2VG5A 3UIQA 3ASMA 3L2QA 4DU3A 3OYKA 5HROA 3G0ZA 3PFSA 4KHSA 4JS5A 4EP5A 1N27A 4H8KA 4FU6A 4PLLA 1RBRA 5HRRA 4CGIA 3VQ8A 1RTDA 2MWOA 1L3VA 4WE1A 1BQMA 3LANA 4FJGA 3DB4A 2BGGA 2QQRA 3VQBA 3LYIA 3KIOA 1S6PA 1HYZA 4CJUA 4N4HA 2XDPA 2XHBA 3ZT3A 2JZ2A 4LSNA 1FKPA 4DLGA 3ZSVA 1TKTA 4HUFA 2GV9A 3HK2A 3M8QA 1CXUA 3NGIA 3H08A 2HVHA 5KH6A 1X9WA 1N5YA 1J9AA 3ZSRA 2AJQA 4IFYA 4CGDA 4E1NA 4B9VA 4O0IA 3QEIA 1X1PA 2JTFA 3LP3A 4J2BA 2EKOA 3LZIA 1WLJA 5J26A 4IUUA 5KI6A 3OS1A 3ZSWA 2OPQA 4B9TA 4DSIA 4BE1A 4L8RB 3TAQA 2G8WA 3LGFA 1LAWA 3UWNA 1JXEA 4J2DA 1Z26A 2BE2A 1QSLA 1LWFA 2EQUA 2DFHA 3VQ5A 1NJXA 3C94A 3M9QA 1J5OA 1WSFA 4F2RA 2LRQA 3BGRA 3WNGA 3NGZA 1HJRA 2YHAA 2IAJA 2DFEA 4CK2A 1JL2A 4E7IA 2FBYA 4A4GA 1D8YA 3AVHA 3RTVA 1NK8A 1B92A 4FJKA 4GMJB 3MXIA 2OYQA 3P1GA 1RBVA 3AVMA 1IKWA 3OQ5A 1S1XA 2F96A 4OPJA 4FL6A 2Z1IA 4R5PA 4C8OA 3SUOA 3AVJA 4OVAA 1S1UA 1WAJA 3K5LA 3MXJA 1XNIA 4FLWA 4BACA 2D9TA 3M8PA 1RT4A 4DWIA 2LTOA 3AVLA 4RW6A 4Q5VA 3DM2A 1UOCA 1TKXA 1A5WA 1FKOA 3IG1A 3QEPA 1TVRA 4CHYA 4CEDA 3MP8A 4OGCA 4TSXA 2RI2A 4QAGA 4C5IA 1W9HA 1ASUA 3LPTA 2L89A 2WONA 4CJ3A 4Z4GA 2P5GA 4CJKA 3EYZA 1MU2A 3ASKA 4B9MA 5DK5A 3HL8A 5D3GA 1U47A 1Y97A 3AVAA 3HM9A 1QQCA 4CJTA 2F8SA 2E6NA 5HLFA 5SWMA 1VK0A 4I9LA 4CECA 4HHTA 4CHZA 4FJHA 2HNDA 2GFUA 4I2PA 3K5MA 4DFJA 2P5OA 4Q0BA 4IURA 3CFOA 5JS2A 3OYEA 1TAQA 4C8KA 1UA1A 3Q1JA 2G8HA 4CHQA 3KLEA 1LWCA 4CFBA 4CHPA 4F2SA 2EQMA 2KZZA 1RT6A 1NK4A 2LVMA 3HPOA 2X35A 2D0BA 2I5JA 4IDKA 4FLVA 4CF9A 4RG8A 4CIEA 2A1RA 4EZ9A 5JS1A 3VN5A 3PX6A 2X4YA 4OVLA 2B8AA 3HSTB 3BDLA 4FXDA 4HUGA 2Y1JA 2RO0A 4XIUA 4DF8A 3SNNA 3SV4A 4LH5A 1Q8IA 2HHSA 3CG7A 5KE2A 3EY1A 3O8VA 3FFIA 4II1A 1KFDA 4FLTA
chains in the Genus database with same CATH superfamily
1NGBA 1CQTA 3CQYA 3HL2A 4KHUA 2DAQA 5BPDA 1DIZA 5L3CA 1UHWA 3CMEA 1YHQN 1KYWA 4CIGA 5HLGA 3CFPA 4X66K 3QDRB 4JKCA 4LNPA 1H3HA 4BHBA 2DRKA 4JRIA 2BHZA 3DKMA 4KJZA 3KP5A 3D0SA 1AWXA 4KGZB 5C4JJ 3V9WA 4ESBA 1HQEA 1PU7A 3NMZC 4XU2A 1VRTA 3CMAA 1RESA 2VOPA 1Z7LA 1WQWA 1O13A 1Q9YA 3E7LA 3E9OA 3WG7H 3DF8A 1D9FA 2AXLA 3WTSC 3CCQI 1LVAA 4M7XA 3TABA 4V2SA 2W1OA 2YS9A 3CJAA 2BOLA 4GW6A 3ZSZA 1UAAA 3QIOA 4C9YA 2HW3A 4A6DA 1N77A 1LNWA 4I6ZA 4DSEA 2UXCK 4OKJA 1NG9A 1QU3A 4YOUA 1FW6A 4C8NA 2Z3YA 3IC7A 5E79C 1UELB 3QEVA 4RBOA 1Q95G 1ZG1A 5IHKA 1BUPA 3LSRA 5LRSA 2RQRA 3D2FB 2COBA 3E3VA 3HPHA 4Z4CA 2DYSH 3MEVA 2IBDA 2IDOA 1W2BM 4DEXA 1NK7A 1Y57A 8ATCB 1U2VA 1U1SA 5AQZA 3CC2Q 2NRZA 4J8FA 1JEGA 4FO0A 4NYFA 4DOWA 1VQ8T 1AEYA 2EA2A 1K9AA 1HXDA 1HLVA 5LJ3h 3L2VA 2BZ8A 1L3UA 1NEBA 5C42A 3I71A 4JJNK 4IG0A 3EUKL 4YOXA 3U9GA 5DM7R 2ITGA 4HCBA 1JCFA 4BR0A 2ETHA 1VHXA 3E5XA 5K5OA 1XD7A 3M8RA 4V19S 3L09A 4C92E 3AG1H 3HUGA 4FWOA 1NMNA 1NJYA 2O0YA 1W97L 4EGYA 1SVOA 4RW7A 2OAZA 2FBXA 4LDUA 1VQPQ 3G6EQ 1Y96A 2Q0UA 2QWWA 4FK4A 4OMPA 2Q97A 4DTPA 4M3DA 2CQ7A 5J6XA 1YW8A 3TMOA 2GQVA 5HK3A 2W40A 1KD1C 4IBNA 2D8HA 4DYRA 2HTJA 2D45A 2XAJA 1ESVA 4NZGA 3PUBA 1QP2A 4C3IJ 2EFPA 2X4XA 4UVBA 2UXNA 3WG9A 3AVFA 1WA7A 3S3MA 5HDNA 4DQRA 4PKIA 5GAN7 2E1HA 3CDHA 5GAMe 4E19A 2DOEA 4EHTA 1B8IB 4GV6A 5B1AH 4XQ3A 4M78G 2LLKA 1YF5L 3KZIC 4GRIA 3RMDA 4ELTA 4F7UB 5KYUA 4JAXA 4YPHA 4CGHA 3Q0WA 4CUGA 5L8RE 1QRYA 1VQ8I 3R3LA 1WBBA 5JR3A 1S1TA 1YNZA 2PZ1A 1HKCA 5DTDA 2ABKA 2DO3A 4JKAA 1HKSA 1WKMA 4P9FA 3VYRB 3PNWC 2M0CA 1H3ZA 1M4ZA 5LL6Z 2N8GA 4IRIA 3GTKJ 2MSYA 4B47A 4A3BJ 1VQOQ 1R58A 5KYXB 1ILYA 2VJ4A 1NGEA 4KB1A 3M0RA 2QWMA 4XLNF 1ZUYA 2KMTA 3EG2A 2O7OA 5KVRA 5J47A 1HNXK 1TK5A 5A2QO 1M90U 3QU6A 3E2UA 3OS5A 4OFHA 1WJQA 3W6KB 2PJRA 3I5SA 4Z4FA 1QS4A 4U67L 2OANA 1BHLA 1UGVA 3ATVA 1YJ9N 3E66A 1IN4A 1OX9A 3L1AA 4LH4A 3IV5A 1T05A 2DA4A 1KQ2A 2RHZA 3THWA 3ZPLA 3DLGA 2HTSA 3LSTA 1JE8A 3WNHA 5GAN8 1V3FA 4PQUA 3F8MA 3KK3A 2PAVA 3JV3A 1JGSA 3NTIA 3PL8A 4DJAA 4MO5A 4CCKA 1LWEA 3NARA 1PD0A 2HI3A 1HW1A 4DBFA 3KZBA 1NK5A 5CKHA 4PGHA 3M4YA 1XN7A 3T3FA 1GLDG 1LWWA 4EJYA 2DL4A 1GXPA 1UZCA 3K4MA 1JXSA 1NYFA 2O4GA 3MPUB 4IXCA 1NM7A 1XMOK 1YITN 4EW4A 3KHYA 4FLYA 2HDCA 3CMAN 2VXEA 1ZGAA 3DLLL 2HKQB 2CKKA 3VEPA 4DV2K 3KETA 1NLPC 2LQNA 1KXPA 2HF4A 5ELZA 2RD1A 4FJ8A 4P1WA 4BY7J 3I56A 1XQPA 5E3LA 2A6EF 1BQNA 1WHJA 2R93J 1ZBHA 1VQKA 4XSZF 3S3NA 1ZREA 1R49A 4J7FA 3FISA 3FSPA 2WOMA 4Z02A 3W0LA 1LEAA 4EIKA 3CCUQ 3CDIA 2ZMEC 4BBSJ 2V79A 4LOCA 4UNOA 4GKKK 2R7UA 2KIFA 2DJNA 5IN1A 4BY6B 3MEUA 3VB2A 1IV6A 2HBKA 3I35A 1WQ2A 2TRTA 2BE5F 7AT1B 3DWLE 2JXBA 1K9MU 4XRSA 5FROA 1K73R 4BG9A 3S2WA 4M3XA 1W2BS 1Z77A 1C0MA 3DRPA 1YJNQ 1ZARA 3NPFA 3A5MC 2WBNA 1LDJA 2C06A 3A0IX 5H2FC 2GA2A 2XPVA 4I6MA 3SZ2A 1VQMN 2BANA 4MDWA 1C0UA 3IP4B 4EEFG 4JS4A 3QNOA 2RQTA 2WTUA 3OL3A 2R7SA 3ZMZA 2Z2SB 3HGGA 1OKJA 3OY9A 2CJJA 4OIPF 3QZ9B 1LCUA 3OYGA 1IKYA 1R8OB 2VBYA 3WGHA 2PUKB 4M7AA 4ELUA 3PIPA 2WACA 2KPMA 2VWKA 3TP0A 2FU4A 3SUNA 5CCAA 2YKMA 1IG7A 4BY6C 3TL4X 3FR0A 4CF0A 3CCSQ 2OTLQ 3VV0A 4HV5A 2MBFA 2Y0SN 2AK5A 3I4NJ 3QPHA 3U9ZA 2YG8A 4H0EA 4QOZB 3QIPA 1BI1A 2QWNA 2DPPB 2FRYA 1FOYA 3ZMUA 3MKZA 3FC3A 3M0QA 4FW2A 2A08A 3QZ5B 3G4SQ 2UU9K 2E6MA 1IW7F 1FTTA 5AZIB 1LJOA 3AL0B 2ASMA 2GTJA 2QDYB 4A3GJ 2NRVA 3WHBA 1F1BB 1B3QA 1DP7P 4IJNA 3EAEA 3MKLA 5DDGA 4W5RA 3IKTA 3DBLB 2JW4A 3I8DA 4EPCA 3VODA 4M3BA 4HPQA 1W5CC 1MDMB 3CJRB 1N8RR 4N9IA 1JJ8C 1WJRA 2OQRA 4WXDA 3G71Q 2DMOA 2E6LA 3P8BB 3U4LA 5EEAA 4DBHA 1I5LA 3K0LA 1NGJA 3T0YA 2L3PA 3U21A 1ZSZB 3OBYA 4Y13A 2CZ1B 1P8ZA 3PV8A 3F72A 3BC8A 1TWBA 3CERA 4CGGA 5AQGA 3ZOBA 4RW8A 2HYGD 5HDGA 3VERA 3ZCMA 1XWLA 2LMJA 3O3HA 1KQ9A 2KKOA 3I8BA 5GAN4 2RAEA 2HOAA 4A12A 1YIJA 1D8JA 4MGRA 2MD0A 1WAFA 1HJOA 3I4MJ 4YIFA 3HDDA 2EQJA 1IRFA 5FWBA 5E1WA 5HRSA 3MAQA 1C1BA 3C6TA 4YFKF 4BC5A 2BYVE 4L9VA 3AL0C 2XDBA 5GAGJ 4BRCA 2OPTA 2K40A 1BIUA 1GV2A 4EM1A 3DLRA 2EINH 1IXDA 3BY6A 5LFAA 2XAFA 2AKLA 2HL5C 3RPQA 2QQ8A 2K5LA 3GZ5A 5D8KB 4OB2B 3T7ZA 1YTAA 2ASPA 4A2UA 1B34B 2WC2A 4E6KG 2V7FA 1D1CA 1TL3A 3CO7C 3EG9B 4L59A 3UNGC 1BO5O 4F3OA 1ZSZC 4ZHRA 1G3WA 1YQRA 4CEQA 2IEKA 4AIKA 2A5WA 1BJAA 4NCAA 3MP1A 2DTRA 2K2VA 4DEYA 4HUEA 1PKTA 4OB3B 2D0PA 4BRGA 4CCMA 1KU3A 2NRWA 2XV4S 2MGQA 1DTTA 3AO3A 3PSFA 4KHNA 4B1WB 3LWIA 3WXKA 2ZQBA 2NVTJ 1SRLA 2AHQA 3F5TA 3LDNA 3GLXA 2JS2A 3J81O 1KEAA 2EGAA 2WTEA 2XKOC 5BN9A 2RQPA 1ZG5A 1ZXOA 5M1PA 2JJ9A 1TWCJ 2ZJRL 3CJQB 2WC9A 2PVOB 2JT4A 3JSMA 1KU7A 1HC8A 1QVTA 3J7AF 4LLLA 4JHDB 1YCSB 3BR2A 1RT7A 2NRTA 2LSOA 1BISA 2Z1GA 3J80Z 1W7AA 1ULYA 4OWRB 2O8FA 3SMPA 2O61A 1M8MA 1F36A 3JB9F 2RE2A 4RG2A 4RTXA 1N5ZA 2BY3A 2EHGA 4HWIA 3H41A 1S7AA 1V4TA 5E1XA 3FE1A 3SYTA 4JI5K 4IDHA 2CZ0B 2YRCA 2F5EA 4XK4A 1D3BA 1VQNT 1FY7A 2JPSA 5M5YJ 5GMKl 2FYKA 5AQYA 4PJ0C 1J6ZA 2XRLA 2YHTA 2KZMA 1KU2A 5CKBA 3RDIA 1I39A 1AVZC 1RAGB 1REVA 3RMSA 3BROA 2CGKA 4AH9A 1TXQA 4WTOB 3S1QJ 2OBPA 3NF6A 2BVLA 4CZKA 1PCXA 2MYSA 2P8TA 4FT8A 1HNZK 4U87A 1R7JA 1QHTA 3ZX0A 3HM5A 3VUBA 1XB4A 1Z21A 2IIMA 3W2VA 1FC3A 2K3FA 1U48A 3CJ9A 3JR9A 1FOKA 4ZDLA 5LBQA 1EH7A 5E3MA 4XLAA 4R8HA 3KKRA 1CZ9A 1GRIA 5GAOp 1SKUB 4IOAL 4C0ZA 3N0UA 1D5VA 1MMNA 2ZAEA 4M7AF 3PIPF 2NRXA 4W1UA 2E5NA 1K0SA 2DFFA 4HRIA 5CQXA 4B3MK 2ZXWH 3CCQQ 2A1SA 1RBUA 1OKRA 2JHJA 1V4SA 2R7ZJ 1IC8A 3MMVA 1ODDA 2A7YA 1WJDA 1EQYA 4DV6K 3VA3A 4CZIA 3HOSA 1VQNI 1SAZA 1XGMA 4U7DA 2XGXA 2ZJPF 4QTRA 1MMAA 2F5KA 2KXCA 2XC7A 2QBYA 2DZ9A 3MWTA 3PO5A 4CBUA 1NBWA 3FXLA 5JVGL 3KK2A 2YKNA 2JM8A 5AJ3K 4AFSC 1N33K 3DP7A 2VGNA 3JCMV 1SKSA 1X4OA 2F4MB 1PDNC 2DTIA 4HCKA 1MSEC 2DW4A 2P0QA 1MMSA 5HCKA 1M30A 1GLFO 1YIJN 1MBFA 1Z0XA 3P4IA 1T39A 2LF8A 1WSEA 4CJ4A 3OYFA 1OLTA 3FZKA 1EZZB 1U1TA 2RNAA 2NUTB 1U2WA 4KA4A 5CVUA 1USSA 4AU7A 4J2EA 2IXSA 3IHOA 3THVA 4YOWA 2GIVA 1T6SA 1M1EB 3H0IA 2NUPA 1T7PA 2PVGB 2L9NA 3K10A 5D4SA 3IUCA 3KLFA 3VENA 1YI2A 2ZGZA 4I9QA 4S05A 4K0KK 4HOBA 5GTIC 1Z9QA 3SK3A 4FLXA 2LY9A 1TYQB 1WNSA 3KZYA 2Z16A 2GOXB 3GDQA 2IT0A 2EZLA 1LDKB 1W70A 4X64K 1Z7UA 2KI7A 4A4EA 3AA2A 3CQZJ 1RRSA 3JAMZ 1QVPA 4D5FA 2XRNA 3W3CA 5J3LA 1STZA 3LZJA 3JRAA 4V2GA 2UYTA 2CU7A 1VUBA 1Y0MA 1D3YA 4LD0A 2W6KA 4UY8I 3QWYA 1HYVA 1IREB 1QZEA 2R92J 4KT0E 3PIOL 1NBEB 1LPQA 4NCBA 2P9KA 1KG1A 3FZMA 5AQTA 3CCYA 3D2EB 1ZTRA 2BY0A 2F5CA 5CQGA 2HHVA 2W10A 4EM0B 4FJMA 2WAEA 4A59A 5FJ8J 5IYDJ 5FFZA 1VQ7N 5AQOA 2UXBK 3SUPA 3ATUA 2YX7A 1VQ8Q 2EZIA 1ZELA 1OCPA 3ZMVA 4K8ZA 3TKYA 3EO3A 5GAGP 1U4BA 4YFUA 5EYRA 1IN6A 2LDUA 1AWOA 3OS2A 5GAN2 4FWSA 5AQHA 3EPZA 2P7CB 1FEXA 3RRGA 2KEAA 1NHAA 2RJDA 5AONA 2NOIA 1WB9A 3GPLA 4IUVA 3GLLA 2RNGA 2VC1A 1K8KB 5ICEA 1IDZA 1X6BA 1KG5A 4O5BA 3MN9A 3VQ7A 2ZNYA 3HKSA 5D6YA 2X3WD 1DP3A 4FZZA 1ON2A 4KBMB 3QESA 5JICA 3KNTA 1W7PD 3QEXA 3AAPA 1FJLA 2EYXA 2AQEA 1UAXA 2M30A 3ZETB 1SC7A 3HC7A 4FHTA 1R6RA 1PD1A 1K4SA 2NOEA 4CHOA 2FXUA 2P9IA 2CDTA 1RI0A 3PTAA 4LFCK 2OI3A 4CYDA 1FYLA 5AQPA 1QSSA 5BN8A 3WNFA 5BRDA 2A05A 2O8EA 4CZEA 4JKEA 3GG4A 3VGLA 4BR7A 4IOCL 3IHUA 4ELVA 1BI0A 1MMDA 2L3RA 1ON1A 4L5GA 1W2BP 4KH6A 3MX5A 1RUWA 4HF0A 3FX3A 5H1SQ 2AQFA 1NPPA 1BIBA 3BTJA 3C18A 4CJWA 2DA9A 3M0SA 2QTXA 4BQOA 3ABKH 3AVCA 4XL9A 3OSSC 4JRPA 3QICA 3TU5A 5M5XJ 1KK7A 4QS8A 4DA4A 1T6DA 4BDPA 2P4WA 2FPFA 4M74A 2BTTA 4RCBA 1IG8A 1T3VA 2QEXA 3WXMB 1BCMA 1KAXA 3F9KA 1HQCA 3S15J 4FTHA 1W2BA 3INZA 4HSTA 4B1VA 4PNOA 1YIOA 2GGRA 3F73A 4JX4A 3JCMP 1KG4A 2OPSA 4M3YA 1K61A 4DBRA 1R36A 1IHWA 2RHKA 3G1JA 1LQ1A 2EA4A 3C6UA 4MFBA 3K57A 3EGXB 4EJUA 2C0OA 5GMKi 2ISZA 2JRTA 2E2JJ 4AIAA 4D8DA 4FX4A 1PWTA 3HTSB 2COMA 4BGBA 3CXCM 2AZVA 1IRGA 5FPNA 5DLQE 2QXLA 1GFDA 1Q1HA 1XC3A 2ZSIB 2LBFA 3WTTC 2WSFE 2JN0A 1JUPA 5F0CA 2DMPA 2VQGA 5GAHJ 3V6DA 3DOLA 3MN7A 4KN7X 1RILA 2EBIA 5B3SH 1WOQA 1CF7A 4M7AE 4AILC 4S0HB 4B9LA 3RKWA 2K3YA 2ZPIB 5CVJA 2OF7A 4N9HA 3JRBA 3L3VA 2VQFK 3BPXA 4JKHA 3FZLA 3CC2N 3L2CA 2H6CA 3N5BB 2BE7D 1KD1U 4F16A 3IAS2 1NGHA 1PRLC 1X58A 3NGPA 1QZYA 3WU2C 3P9KA 5KPZA 4LIUA 3FGUA 2DF6A 1ZLMA 3I0WA 5KTQA 2Z1DA 1V29B 1EP4A 5M1QA 3P8HA 1D4XA 1N78A 4C0DB 2H8RA 1GLJO 4RKUE 4YNQA 4U7BA 3TBIA 1ERDA 2GBZA 4A57A 2YHWA 4HX8A 1OOTA 4KTWA 1GLEG 3QYEA 4W5QA 3HSFA 5AQLA 1BR4A 3FXKA 1K9MR 1D1BA 1U2VB 1OI1A 4FLUA 2DA7A 3CMET 4OIRF 5HP1A 1S7OA 1PP7U 3A8YA 4FJ7A 1VQPN 3G6EN 1S22A 1EBMA 1SMTA 1A36A 4B9SA 1W7PB 3VEZA 2A3ZA 1OYYA 2P9PA 2Q3SA 3WU0A 2FMYA 1KJWA 3CMAT 2L9RA 2XVCA 1EA3A 2HGCA 3DLAA 3M53A 3UT1A 4EJWA 1AA7A 1NE8A 5E1ZB 1YG2A 3F6VA 4E7KA 4CC3A 3U2RA 5IXFA 1S6LA 1GLNA 1R5GA 3H92A 3HUGB 3MKDA 2GUIA 2Z9OA 2ELHA 2EK5A 4C0DC 3W3DA 4IG3A 3M0PA 4AUXA 1F9NA 1Y96B 1L3TA 5GPCA 3C1DA 1RR7A 4Y33A 4M63C 3T1BA 1SF9A 2R58A 2R5AA 3O8GA 3K4JA 4DQSA 2RF2A 4E7SA 2P9LA 2H1KA 1ZX6A 1VQON 4A6EA 1YTYA 2V1RA 4OU0A 3NFAA 1NLOC 1OVYA 4NXNK 4H0XB 2DQRA 1QCNA 3SI6A 2DMNA 4AI5A 3HOXJ 3OWTA 1BI4A 4CD1A 4JYKA 4P96A 1Y8RB 2JWKA 3E1SA 3F21A 4ID1A 1NKBA 3DTKA 5LJ5e 3VQAA 4WXCA 3CMEI 5KYUB 2PX9A 1SL0A 1TU0B 1SG5A 3SWNA 3LSHA 3M1CA 2AIRB 3SLCA 1TT0A 1NWKA 2P0WA 3HTUA 4E7LA 3GTLJ 3IH7A 1JI8A 2OTJA 1O4XA 2V1UA 3CMAI 1T2KA 1HPZA 3LCNA 2RGVA 5KGWA 1XPXA 4PSXA 2M1HA 4K41A 1XHZA 4B3TK 3EUHA 4JDSA 5C25A 5AQNA 4E3SA 1JXOA 1T38A 1ORNA 4B8CA 1K73O 3C3WA 3ZFJA 4O3MA 1IRXA 2PJRB 4EVVA 1QSYA 2FLOA 2PQ8A 4YG2F 4YEJA 1HQUA 2Y90A 3EHRA 4B44A 1ACIA 3MO8A 4JKDA 4OFAA 5HRPA 3RUXA 1Q81R 3ZX2A 4KH4A 2IG0A 3ASMA 2NVQJ 4J9DA 3THWB 3D4VA 4C30A 5ERIA 2XF5A 5ICGA 2ID3A 2FA5A 1KU9A 5FLXK 4WF9L 4KHSA 3OSGA 5GAOq 4CGIA 3VQ8A 2L4MA 2K5CA 4MZTA 4M3EA 1L3VA 4KITB 2EJGA 1HCRA 4Y0WA 1MGQA 2O9LA 3CXCS 2QKLB 3VRYA 2SRCA 2LY2A 1X1DA 3VQBA 1IBKK 3CCUN 1AWCA 1RAAB 3X20B 4N4HA 2BUPA 5F64A 4BUGA 2JZ2A 5J3BA 1T95A 3PJRA 4RB3C 3J7YJ 1TKTA 4DR5K 3ZQIA 2GV9A 3M8QA 1B4AA 3NGIA 3H08A 1R71A 5JFRA 3QJYA 5KYNA 2BTFA 3F9MA 2HSTA 4DNCA 4IFYA 2FPEA 1W4SA 3FXJA 4E1NA 3BQZA 2JVGA 2HBJA 4KIBA 3OOPA 4C92G 2EJRA 3LZIA 5J26A 4IUUA 2GTDA 5BRHA 3OS1A 1G2HA 5B66C 3QODA 2DE0X 5D7UA 5ICFA 4B9TA 2JZYA 1NG2A 1ZRCA 2KNBB 1NPRA 4C0GA 1E3OC 1J59A 3M8JA 9ATCB 1X1AA 1NJXA 2FNPA 4ZNXA 3LAPA 3M9QA 4RDUA 1MMGA 2OFKA 5FKLA 3BGRA 4FIBA 4KHPK 2YHAA 3I4PA 1PU6A 2FSJA 3CJBA 2CG4A 1JJ2A 4RCCA 5FW9A 3CCEA 3AVHA 1NK8A 2HZTA 3A8OB 4XRFA 1VQNQ 3J7AO 5HKCA 2RREA 3CCSN 2NOBA 4I6MB 2OTLN 2HAXA 2F7TA 3TREA 4KH5A 1FYNA 4JRKA 4V2FA 1UHFA 1ETVA 2CUBA 4OPJA 1RAIB 2CQNA 3ZXSA 3CIPA 3ZQ7A 3GCMA 2R7WA 2F9TA 3BDDA 5CHIA 1E4FT 2M1BA 4ZGDB 3SUOA 2MLKA 4KGXB 4PK4A 2FZKB 3G4SN 1UFMA 1FMVA 3FB9A 4X65K 3MXJA 3I56T 4FLWA 1VI0A 2LNHB 4DWIA 4A3MJ 5LMNK 4XKVA 2Q31A 4BRIA 1VQKT 4IEIA 1V5GA 4HSBA 3WQTA 3QEPA 3DQVC 2OCCH 1KA8A 2COYA 5DUKA 3OIOA 3EE8A 2X6YA 3RMQA 1PG5B 2JUFA 2RI2A 5LJ3g 1BIAA 1YWPA 3QU3A 4HA8A 1VOMA 2K4YA 4O6JA 4WXHA 3LPTA 1CSKA 1SFOJ 2P5GA 4CJKA 3EYZA 1MD0A 2ME6A 3ASKA 2DJIA 3GTMJ 2QA4A 2K9MA 2QQAA 4FT4A 2P9SB 3FKIJ 2V7YA 4A0YA 5EGOA 1XTAA 2KSSA 4JK8A 5EVZA 4CJTA 4EM2A 1W5SA 5GAOl 3J80E 2F8SA 3OW2M 1T6CA 5HLFA 4D8KA 1TWGJ 1VK0A 4CECA 2FBKA 4V19K 3H5RA 2CW8A 5ECAA 1N36K 2NYXA 4I2PA 2P5OA 4Q0BA 5IT9Z 5GJWB 4JX5A 5IOYA 3CWTA 5JS2A 4IO8A 1RKTA 4C8KA 2G8HA 1ZLJA 4CFBA 2FX0A 1BBZA 3VU3C 4CHPA 1Y8QB 2RQVA 1RPWA 3I56I 4XTXA 2V75A 3TSZA 4HNUA 3JB9I 1YW9A 4XN0A 4CF9A 1VQKI 2YLCA 4EGZA 5GADJ 3P38A 3SFZA 4CIEA 3QFPA 4KT6A 3RKXA 2A1RA 4BRMA 5JS1A 2X4YA 3CLOA 1IXCA 4YIRX 1MW7A 1YQKA 4RS8A 3TOBA 5AT1B 1WFXA 3REAB 2LD5A 4C23A 1RI7A 3SV4A 2HHSA 3D1NI 5HODA 5CYVA 1KFDA 2I10A 2WA0A 2GCXA 1YO5C 1U0JA 5H20A 3SB2A 5LRRA 1G8XA 1KC8R 1QHAA 1YN8A 2XKPA 5DM6F 5J1UA 2OPRA 3LALA 4C8LA 2H3EB 2X6NA 1KQ8A 2YNHA 4A0XA 2L3DA 1FSHA 2GUPA 3I0RA 4YDUC 1JL1A 1I81A 2L2OA 3EFOA 4G6QA 2Z1HA 3THYA 1I50J 2YDLA 4DHYA 1NNEA 4QW2A 5FRMA 5KCOA 3W6JB 2V1DA 1C0GA 1SUQA 4PA1A 4B3RK 1E0EA 1ZR2A 3ZSYA 1TK0A 1BR2A 3DB3A 4F8RA 2JUGA 1NK2P 3EL2A 3WXIA 3K70D 2EFQA 1WFWA 2F8TA 2HDAA 5DM7L 2JQ7A 1NGDA 2EZKA 1ARKA 2J5OA 5H6QA 3M3ZA 4DQ2A 2A42A 2DL5A 3PFYA 2YG9A 2HBMA 3CCMA 3CC4A 4PHTX 3E97A 3CF2A 2R7DA 2XAQA 4CC2A 3MD2A 4WX9A 5A0DA 3A8LB 1TUGB 2V7ZA 4YELA 2YU9J 2W6LA 3PNTA 3O4NA 5AQKA 2O8FB 4BUPA 2F1LA 2NRRA 1WXBA 4A3JJ 4PY5A 5GAN6 3QYGB 3D2FA 2DAOA 4QLCU 2R7RA 1D3BB 3DJCA 3H1QA 2CSIA 5IP7J 1UG2A 2V1XA 5E18F 1IO6A 3E9GA 3FXMA 4CGJA 2XDVA 5FKOA 4XR6A 3L2RA 2D4WA 1T33A 4CF1A 3DOKA 4EAHD 2P81A 4CZZA 2VLAA 2C0TA 4LLNA 3JAME 1GBRA 1HSJA 3QNNA 3CCQN 4FM0A 2YLBA 4MDAA 3J7YP 1B07A 4C5EA 2FZCB 2LKPA 4IIMA 4IVNA 5AQVA 4HXJA 3T8TA 1SKWA 2XDDA 1K8AC 4JUVA 3LH5A 2CV1A 1BGXT 3R60A 2PEXA 2JUCA 3TARA 1YVNA 4CK3A 3QHSA 1R5ID 1YFNA 2FHDA 2FSNA 4UUTA 3VETA 2LH9A 1VFCA 3KEYA 4RM3A 1X27A 4XMYA 2BUDA 4XLFA 2A5XA 4DQQA 3MVPA 4Z88A 2C0IA 3ZEUA 3BOQA 1Z67A 1SQKA 2HNHA 5JLHA 1U06A 3OW2S 1PSEA 2X85A 5EJCA 2QBYB 4AHSA 2EV0A 3QXEB 4ISFA 5DCFA 3WTUC 2GFAA 5CKFA 1ZRFA 3JCMh 5GANf 4DR2K 1F4KA 3D5SC 2E12A 3VQPA 4CZGA 3NDKA 4DSJA 3K6GA 3LFKA 2YRVA 4A3EJ 3CO6C 1Z3XA 2UZKA 5GMKj 3LWFA 3UR3C 3NH0A 3MEDA 2KLAA 2UXXA 4MTEA 2QW9A 3VQQA 1PRMC 3S9HA 3IMXA 4HQEA 3CPWM 3DEWA 1K6OA 4GO1A 2HBWA 2KTQA 3TR8A 3TGNA 3S6IA 4J9IA 2Q2RA 2GIZA 2LNVA 3LM2A 5CVVA 1R0AA 4UV9A 4IIOA 2F2EA 4AYBA 2NUPB 2ZJQF 5M9OA 3PM1A 2ZCFB 1JTXA 1KFSA 4KN4X 3RJPA 2CT3A 3MEEA 1IBLK 1MBHA 2BXZA 3AA4A 3VQ6A 4A3FJ 4FWLA 4ZYEA 4FJ9A 3LDLA 2VB6A 2DD5A 2NRHA 1QVGM 4A3CJ 4DTSA 3NMUA 2O4IA 3CWAA 4CI0C 3ECHA 4E9HA 3CCLA 1X2MA 1YP5A 3DRRA 3VESA 4M7DD 2QCOA 1I0CA 2ZMEA 3PMTA 1OR7A 2XICA 2X3XD 2BGCA 2GBYA 4AIJA 3LPUA 4B9XA 1VQ8N 2HZDA 2JG6A 2BXYA 3HHTB 4HVUA 5BR9A 3ESWB 1KD1R 3QBYA 1CZAN 4Z0UA 3WVDB 3JCMe 2W57A 4PL6A 3QSUA 4AHRA 2P9KB 4DTJA 4BY9C 4CCJA 1QTMA 2JVHA 2ZNZA 4BHCA 1W4MA 4LE9A 3ECOA 4QWQA 1WRJA 2MW8A 2P84A 1SL2A 5KAFC 2WWYA 1EETA 4NLCA 3TCJA 3CMEQ 1R59O 3WEEA 2RF0A 4M7DG 3K70C 1WI9A 3FZHA 3J81Z 3T9NA 4L5EA 3NHGA 3J80O 5BRFA 2DBMA 4CZHA 3CESA 2PFUA 1TG0A 1JU5C 2DNUA 3T1YK 1NOZA 2LREA 1YI2T 3CMAQ 1IV0A 3LP2A 4QSHA 3D7EO 1HRHA 1I27A 1RRQA 1CKBA 3AAFA 3FHZA 1M2VA 3P5JA 4RB2C 3SEMA 1JT0A 5DS9A 3CXCP 2FUG2 1HW2A 4DW6A 1VRUA 3OHRA 1WHLA 2EQIA 4M78A 3F70A 3BG5A 2ZF5O 3E19A 3H9QA 1W0TA 3K0SA 1QZ5A 4CD3A 4LITA 3PSIA 1YLFA 2G7UA 2PU9B 3G1LA 3EZWA 4CJ5A 5B8HA 2A69F 3F8FA 4LDVA 2YUSA 4PJOD 1IGUA 4H03B 4J19A 1GVDA 1IHVA 2JGUA 3BLYA 1NK3P 1XX5A 2AP1A 3T5XA 3CXCA 1FBSA 1OMIA 2ELJA 4ENKA 3A5NC 3DKYA 3JTHA 5HNHA 3NF8A 3MQ0A 1MJBA 1RBSA 1SS6A 5CKEA 2P9IB 2M7BA 4IQ4A 2ZWHA 2JTEA 1Q9XA 4CIFA 2R7FA 1KLMA 4II3A 1CZBA 1Z05A 4U0VA 2QVOA 1RT3A 2YUNA 4C8QE 3DYAA 1N6QA 3AVIA 3E6CC 1LW0A 2YUPA 2X78A 4HT8A 4CCNA 3ISPA 3W6VA 4GYIA 3OYAA 1YI2I 2G8VA 4PJOG 3KEOA 2FZGB 2EIMH 4KGVB 2Z33A 3S93A 1HPMA 3BG9A 4B09A 4DR4K 1X2KA 2L7MP 3DLBA 3SBTA 4G7OF 4CA0A 4A0ZA 1GOAA 3SUQA 4PKGA 3JS6A 3ABUA 4BVPA 5DYMA 2WAQN 4HQMA 4Z2YA 1GLCG 3O9RA 1SD6A 4LD5A 2OZSA 2P9NB 2FQ4A 1TV6A 4IF4A 1Y56A 1ZA1B 1KQSM 1S1VA 5F6FA 4E7ZA 2Y4YA 3TTDA 1IB8A 3A02A 3CWSA 1XQOA 4LF8K 1Y1VJ 2IVMA 5I2MA 4N4GA 3LL3A 4FZXC 4FM1A 3U1DA 2IPOB 1ZSZA 2D1VA 1RT5A 2FNAA 3CPWS 2F6CA 3OS0A 4M7DB 4I02A 2IS3A 3I3LA 3E5QA 4E4HA 1QA6A 3PIPL 3FM5A 3RPUA 3E9PA 3H9NA 4FWQA 1BW5A 4AYBN 2G0EA 5AQRA 1S72A 5EZGA 2F5VA 2DFUA 2H1LA 3QB0A 2LBFB 4BRLA 2JT1A 2XY7A 1FN7A 5C15A 2BY2A 1CF7B 4UB6C 1LFBA 2ZPGB 2GAUA 1JHHA 4J9GA 2RK1A 2E6ZA 5J1EA 4YFNF 1KG7A 4ZC3A 4U0YA 4C2UA 1X6OA 3DI6A 1M1FA 3O6BB 1LB2A 1V4RA 2O6GE 3H1CA 3EKUA 3JAMO 1NJIO 1NJIC 4C2MJ 1Q18A 5C12A 5BNGA 4F7ZA 5KYYA 2DK5A 3DEEA 2QEXT 5C10A 2VJJA 1KO9A 2QF7A 3HYFA 2BEOA 5KQ8A 1X9MA 1KG3A 1YTUA 4M7DC 4A5BA 4AG2C 1SHFA 4LY7A 4E0DA 3FFKB 5BS6A 2B5JA 3CTAA 2IGMA 4KHWA 3BCBA 4HDVA 2KRSA 1JKHA 3P9CA 4MZMA 4DZJA 2EILH 2EYWA 1TZLA 2PBDA 3ER0A 1J5EK 2PMZA 3JRFA 2CV0A 3TAEA 4NC7A 3CD6A 1YJWA 1IRZA 4LXCA 1A6IA 1XJWB 2IOCA 4EMHA 2I0NA 4HTLA 4PJOB 4GKJK 3OB9A 4Y3OA 2P9PB 1HKGA 1QGPA 1T0HA 3AO1A 2A40A 4FOIA 3NQOA 5D5WB 2J6FA 3KYLA 1IKXA 5J1YA 3M7GA 1Q81O 1ITYA 3E6MA 2E1YA 4DF4A 3MEXA 4CZLA 4JHDA 4JKGA 3M4GA 4FT2A 1CKAA 1K73U 2WV0A 3I56Q 3N4PA 2ROTA 1PM3A 3GUDA 1JLBA 3ALYA 3OIQA 3MX2A 1GVJA 2CW7A 1VQKQ 4M3WA 2RNJA 1WBDA 1IGQA 3HHHA 3WTZA 3GFLA 1TWFJ 2KFNA 2RHIA 1D5AA 5CYQA 2QEXI 4H0TB 4II2A 3HGYA 5GAMf 4ZGEB 2L2PA 3ZSQA 3LSMA 1OISA 3UPUA 2D0CA 2HMPA 2P9LB 3QYFA 4HW0A 3SAHA 1S9EA 1R9TJ 3CM5A 3URGA 3CVTA 2BZYA 4O55A 3I33A 4M3ZA 5C44J 1JLQA 4PJOC 4CESA 1BI4B 5DLOA 3ZMTA 3EG1A 2FBTA 2PI0A 4F3TA 4ZTJA 3ZX3A 2MMPA 1GLLO 1MWKA 2FO0A 4A4FA 3T1AA 5CE3A 3SWNB 2VXZA 5JLXA 2CGHA 2O01E 2FB7A 3KKSA 3VFZA 5FLVA 2IP2A 3OH9A 1MDUB 3VS0A 2E36A 5E41A 1N6AA 2DBKA 3OR1C 4DU4A 1PVEA 3F23A 3HTVA 1YX5A 1Y0UA 2ADUA 2WADA 3I0XA 2Y2ZA 2O8KA 4JJDA 3CBPA 3A4CA 3F6OA 1X6GA 3RVCA 3LA7A 2DJZA 4DLEA 4FLZA 4CERA 2ECZA 4IO9F 5GAN3 1XCBA 3NTHA 1KQSS 3GE1A 4M73A 3BP8A 3COAC 4Q5SF 4L9JA 2YUQA 5ILUA 2OAWA 5FU7C 2CGLA 2JA8J 3P8DA 1RABB 1D09B 1SD7A 4Q48A 1O75A 2IVNA 4AHCA 3CF5F 3SWNC 1A0NB 5HRNA 2P7VB 3BG6A 1C1CA 1UWBA 3R6SA 4M72A 3PFIA 4JRQA 2IRFG 2HOSA 3VYGA 1BI2A 4RMOA 1S72N 1LAVA 3H5AA 1X43A 1WEGA 2FC0A 3I54A 4PFZA 3KYCB 4CK1A 3G7ZA 1Q86O 3H3ZA 1Q86C 3EUHC 2LP5A 3G1MA 4CJRA 4CRIA 5FFXA 2NUTA 4KMFA 1QE1A 2WB1A 3G1OA 4BD3A 1AWWA 3B6CA 5BMZA 4CEBA 1I4K1 2RA2A 1QVUA 2OTJT 1F1ZA 4AQYK 3RRHA 4YFXF 3OW2P 2YRDA 5IT9E 2VOOA 3L1PA 1H8KA 1VQ5A 4M6VA 1VQ4A 1JT6A 2L3SA 3ML6A 2LK2A 2GELA 1YIJQ 1JBMA 2OZMA 1VQNN 5J2NA 3BZCA 3TAMA 3M59A 4NL3A 2EGCA 2ISYA 3RSNA 3LA3A 1E6GA 4YOQA 1S1NA 1BYMA 2RQQA 5E26A 1J9IA 2XSDC 1T44A 2BW3A 2O8CA 1Y0NA 1N8RC 4M45A 1UA0A 2QM3A 3EFSA 1ZQ3P 4BBRJ 1Z6RA 1IO2A 1NJWA 4J83A 5IAYA 4H5VA 2BH1A 1XCVA 3JSCA 2CYZB 1ABQA 4OP0A 4NUBA 2EFIA 1L3SA 1X3UA 4HF2A 4CBXA 1SVMA 3P7NA 4BI4A 1TKZA 4JZ3A 3DV8A 1HBXG 1VYUA 3TEEA 3M55A 4E89A 4DSLA 1YBYA 2LC2A 2O88A 1WSIA 1HKTA 4KFBA 4CFAA 5F1XA 2RPIA 4H5NA 1A5JA 4OMQA 1U5TA 2OCEA 3LSIA 4F7UE 1UJ8A 4KHQA 2OTJI 2IGNA 1RTJA 1UECA 4G9ZA 3GF5A 4A5MA 2M8GX 1RAFB 1P59A 2D2WA 2V9VA 5CKDA 5L23A 5AQUA 3V1RA 1APLC 1TUUA 1ZYQA 3HM8A 2NS7A 3BG7A 3M4OJ 2KKZA 3KBGA 3ME9A 4FJNA 2HQXA 4Y92A 3GXOA 1KC8O 4H0OA 3U23A 4OAYA 3JRDA 3X25B 3FXOA 3O3KA 2DPNA 2HKXA 4Y91A 4B3OA 4B9NA 1O3SA 1J2XA 1NG6A 1OULA 2LQWA 3ULEA 1VNDA 3VQ9A 2VQHA 4NB5A 1T3LA 4GLKA 5M1FA 2VE9A 4KUDK 1YUWA 1UE9A 5GMKe 3SAFA 3KLGA 2DT7B 1OX8A 3DXKA 3HKZA 4CF8A 2M0MA 1DLOA 5EGOB 2PJPA 5BPMA 3NHNA 3ZETA 3CCET 1D5YA 3E5UA 3TQNA 2KFDA 1DGRM 3VRZA 2K6DA 2QASA 5KNLA 1GOCA 2XGCA 4R1HA 2Q0OA 3EH1A 1UMQA 1MUDA 4JZ4A 3ZQLA 1VQ6A 2ATQA 4XSXF 2FOWA 3S1RJ 1QVFP 3Q9VA 2F4VK 2QI2A 2VJ5A 3CC7A 1PSFA 3JYTA 1HYOA 1OFCX 3ZQFA 4DUYK 1TQIA 2YXYA 1XG1A 4JLIA 4ABZA 3JXUA 3H0DA 4XAXB 4MZPA 4BREA 4IOXA 2MD5A 2PMUA 3HP6A 3NTKA 4PKCC 2HQAA 3C6AA 5M3FJ 2HNZA 5D6FA 3LQQA 5EOYA 5J2MA 3QOPA 2D5RA 3GBGA 3H8ZA 5JHFA 1FX7A 2P5LC 1HNWK 4Q5WA 3NRVA 2ITMA 2PMHA 1E4GT 3ZN1A 1QVFA 3AT1B 1TL1A 2P51A 4LB6B 3HO1A 1MH3A 2CUJA 4A3LJ 4BR5A 3VSLA 2A28A 3RI4A 2QA4T 3IL2A 2EIJH 3CCEI 2DK8A 1NH3A 2XI9A 3EG0A 4BRDA 3DLEA 2B7EA 4ENNA 2CUEA 3EGXA 1MWMA 2Y31A 1GT0C 3RTRA 3HZ6A 3EFOB 5AFUH 1S5LC 2W48A 4KV8A 1VYTA 3THYB 2DTUA 1I5OB 5F1JA 4EIAA 2KE9A 1UHMA 2EFNA 3CPEA 2PZSA 1X3ZB 1RT2A 2MWPA 1ZQ1A 1OYWA 5GANj 1NOYA 1M5Q1 1K8AU 4RTVA 4I01A 1KVAA 2Y75A 2XAHA 1VAZA 1QQOA 1GBQA 3VS2A 4JKFA 2EIKH 1J75A 1MSFC 2XHIA 2QXFA 4FPBA 2M51A 2L7ZA 3M8FA 2ZBKA 4CHNA 1JGGA 3O8HA 2YHBA 4KREA 3A8HB 2HQEA 3CCRT 1GL5A 2DY4A 2GX9A 3EYYA 3E01A 1SZ2A 4LF9K 3FIFA 2VC8A 1U8RA 3GTPJ 3CPWP 2ENMA 4JD2B 1YI2Q 5KN9A 4IHXA 3ABLH 2EFOA 1TUCA 1NEGA 5L3GA 4YOTA 2QA4I 2JS0A 3TVTA 2A3SA 4PFPA 3QINA 3MFKA 1U84A 3EFRA 1RIOH 4I2OA 4GCVA 1N9RA 1IDYA 2IA1A 2RB6A 4DS4A 4GV9A 4MQ9F 3HP9A 4MO7A 1MNMC 4DQ8A 3BT9A 3N4QA 5LHIA 1B9DA 3O3GA 3M3YJ 3GZ6A 3KXTA 4LUEA 3O4QA 2V26A 4O0JA 4FSXA 3UKUA 2O8DB 4HBLA 1KAYA 1WIEA 1W7PA 2K02A 2JM9A 3IAM2 4A3DJ 3S16J 4AFQC 1TL8A 5E8GA 1U8BA 4L9NA 1MBJA 2X1CA 3H5NA 2KIUA 1OCTC 2IGKA 4EA4A 2DL7A 3DCFA 3I5UA 1SEMA 2O9SA 2VUBA 4M78D 3FHGA 2O8BA 4N47A 1MHNA 2ETJA 3M56A 5M5WJ 3CCMT 3A0HC 2DKGA 3CC4T 4IXAA 4RTTA 3I55A 1VSDA 4FJXA 4ZDOA 1A35A 3CCRI 1UUEA 3DFGA 3QJ6A 3EETA 3C4SA 2CP7A 4UHTA 1A04A 3ROUA 1PJRA 2DEUA 4EW0A 2F2XA 3FKJA 1I8FA 1DTQA 3QO9A 4XIDA 1KD1O 5IPAA 3ZEUB 2ESNA 3J81E 2JWTA 4KTQA 5DMRA 1Y1WJ 2OJ2A 2UXDK 5E84A 4A69C 4JYAK 3M9AA 4ITVA 4CFDA 5H6RA 4FYWB 3QERA 2ESHA 5K5QA 2K27A 1MGTA 5IT9O 4A5AA 2DA2A 1WI7A 2K9NA 3KUFA 1RDBA 3FZFA 3P9IA 3ISNC 2RN7A 2K86A 4IJAA 4LIVA 1TQMA 4CGFA 1V54H 1CLQA 4VUBA 2E1CA 4FJLA 4FWRA 3HHGA 3CUQA 4HCZA 3NAEA 3L3UA 3HB9A 2RHYA 3DEUA 3EGDB 3REOA 5LJ3e 1WH5A 2ZCWA 4HVJA 2E5QA 3A2KA 2NOFA 2W00A 5TKYA 3GBQA 1BR1A 1EWQA 1UGPB 2CS7A 3CCMI 2TCTA 5T7BA 3CC4I 3E9LA 3L2QA 2YX6A 3KWGA 4DU3A 2DYRH 5HROA 3G0ZA 2DK3A 2ZGYA 2VONA 9ANTA 1Z6TA 4LJZF 1YAGA 1GXIE 4XLPF 1AU7A 4PLLA 2LJ3A 2FBIA 2GXGA 4AFZC 4E9FA 3CDLA 4CHUA 1IN5A 3CCVA 2OZUA 2IS4A 2LZ6B 1X2QA 1H88C 3LANA 2DT5A 3DTIA 2ZMEB 4M6YA 2QQRA 3LYIA 1SPKA 3HEFA 4CJUA 3RPUD 5EEHA 3ZMDA 4BJ6C 1MA9B 2XASA 4D0PA 3CMEN 1MNDA 4KYWA 1X19A 5DPKA 2JHNA 2QEXQ 1QQIA 4FWNA 3M0UA 6PAXA 2OFIA 3S1NJ 3DU5A 1YQMA 2RN8A 4I98B 4JI4K 3VEWA 2HVHA 5KH6A 1XS9A 1X9WA 2K3BA 3QG1A 3TTFA 4DV5K 1AOJA 1RLQC 2I8DA 5GAOn 3OR2C 2DA1A 2P6TA 3QEIA 2JTFA 3LP3A 2K9LA 1U78A 4J2BA 1R0CB 4BQAA 2KIMA 2KR3A 3UKRA 1TT5B 3RCOA 5KI6A 3ZSWA 1GDTA 3WEEB 4MMKA 1TW2A 1WQ7A 1ATRA 1G59A 2QWLA 4BE1A 4Z6YA 3TAQA 5IHIA 2G8WA 3LGFA 4RWTA 3UWNA 1JXEA 2BE2A 4PL7A 3HSEA 3A5ZB 1NM1A 2DFHA 3VQ5A 3JCMQ 2A6TA 1M90C 1WSFA 4OPHA 2ZPFB 5DM6L 5HNFA 2V1QA 1OR7C 1BOAA 4CK2A 2KROA 1XGNA 1WVRA 4PSWA 1X3MA 1M2VB 2MC3A 2FBYA 2ZKZA 4A4GA 5CK9A 3SFIA 2YWWA 4LK0F 3RTVA 2D1KA 5DCMA 2XIGA 4D9JA 3CCLT 4M78B 4B8XA 3FXQA 3H0FA 2V6CA 3OL4A 1EV7A 1ORPA 3MXIA 2OYQA 3P1GA 1HJDA 3AVMA 5FKKA 3OQ5A 1S1XA 2AZSA 4BXXJ 3BJAA 1X4PA 3PNVA 3ZN0A 2QGFB 2DI3A 3R0JA 2Z1IA 3WQUA 4R5PA 4C8OA 3GTQJ 3TPQA 1JHFA 5EG2A 3AVJA 3FWEA 1FOXA 3S14J 2E1MB 2L4AA 1BOBA 1XNIA 4BACA 2D9TA 2MFZA 2D5VA 3M8PA 2LG4A 3EEQA 1EWRA 5FLXZ 2EKHA 1JUMA 3K1PA 3A8MB 1A5WA 1FKOA 4LF7K 1O7LA 1ETXA 4XNFA 4AWXB 2VGMA 4CEDA 4AM7A 5D8LB 3CJ7A 1SFEA 1UEBA 2VC0A 2HKNA 4TSXA 4BXFA 4C1NK 4QAGA 2M2EA 5CPRB 2XUBA 1NG7A 4N0BA 1OU9A 2EH3A 5E3NA 2RVCA 5AQFA 2WONA 1UGRB 1JCGA 3DKXA 4M78C 5LGUA 4X1VA 2XSJC 1FTZA 1TUYA 2L0AA 3FIWA 1Y97A 1QKXA 4PGGA 1NJIU 2LRDA 4M75D 2CO5A 5GANd 5AZJA 2RH2A 1M3HA 3CCLI 4RM2A 2LT1A 3HRUA 4FJHA 3LM9A 2HL3A 2JOYA 2P9SA 2HNDA 2E1MC 1OCRH 5DD8A 1MBEA 2IGOA 4K43A 4A3IJ 4ATOA 1TAQA 1D1AA 1UA1A 3Q1JA 3ZLJA 2R0QC 4AT1B 3KLEA 3OYYA 4X9CA 2GZWA 4Y15A 4LG3A 1WWXA 3O1BA 2NAZA 3WTWC 4KH0B 3JCMX 2DT6A 5F2RA 3KLOA 1XSVA 2LVMA 2ACJA 3HPOA 4BYYA 2X35A 5I9EB 5GAMj 3HRGA 4IDKA 2V51B 4B43A 2X6XA 1UB9A 1BL0A 2E19A 1LEBA 3J7AY 4YDUA 4B1XB 1NGNA 2D0NA 2X6OA 4DYQA 4C92A 4M75G 3BDLA 1X2NA 3VPZA 4HUGA 5GAOm 3TO9A 5ADXH 1W6XA 3JCMg 4DF8A 3SNNA 1Q81U 3O8VA 3FFIA 4II1A 1UG0A 4FLTA 2E64A 1D8KA 1XUPO 4KTZA 1JLGA 2OTJQ 2I5WA 2G3RA 3CEYA 4NNJA 4L5JA 4CYCA 1KG6A 3AGKA 3ASNH 2G8UA 4M42A 1VIEA 3F10A 2GWKA 2RV8A 1DKGD 3MZ8A 3MEAA 2ZXJA 2QKMB 4CSWA 4ESJA 2DCEA 2ZGWA 4FVUA 4DTRA 1ZSGA 5JMVA 2M0OA 2EPFA 1AHDP 5KYYB 1BA1A 3F0CA 1YQAA 4D1QA 4IHWA 2ZFUA 4BGDA 3L2UA 2EYQA 4Y1DA 3GTGJ 5LY3A 4AHUA 3C12A 4OPKA 2HEQA 4H5WA 2NOLA 2J6KA 1YW7A 4EFHA 1RDDA 3S8PA 5C0MA 4W5TA 4MMLA 1QCOA 4OOIA 1BJZA 3LAKA 3KP4A 2QQSA 1X9SA 4E7JA 4E70A 2CGPA 3I56N 3ZQQA 1E17A 2ZJQL 3IRRA 1YQLA 4LDYA 3LWHA 2LX7A 1WSHA 3HOTA 2PG4A 1VQKN 3NCIA 3HG9A 3PVLA 3MKWB 4EJZA 4I76A 3P83D 2KK4A 2CMPA 2Y48A 4DMNA 1S72T 1J54A 4C8QG 3B02A 3IQLA 5M1KA 1BKBA 1XC9A 1VQLA 2K4JA 1AZGB 2GXAA 1HKBA 3WXJA 2M0YA 4JKGB 3R6MA 3HFOA 3N97A 2HHQA 3I0TA 5C6SA 2XD0A 4A63B 3HJEA 1WHUA 4QPQA 4DV0K 2X1DA 2J5PA 3M54A 3OYJA 3HPWA 3CMMA 3J7ZI 2Q36A 1YJNT 2W82A 1EO1A 3WVEB 4KIFA 1S6QA 3SEZA 1WJSA 4DIQA 4UVCA 1ZUKA 3G2BA 3QFUA 3FK7A 3V9XA 3WUHA 2P0KA 1RDUA 3CM6A 1HNIA 4D7MA 5LJ5f 1XQHA 4ZZLA 2HDDA 5GAEJ 5GANh 4BRHA 2KFZA 2DETA 3DPTA 2E65A 4MQ3A 2E71A 1UDLA 2KDOA 1DDNA 1I1GA 4BJ5C 2R5YA 2XAUA 5CIUA 3VEYA 1C0WA 3AA3A 1ENHA 3CCEQ 2IVOA 4WCGA 1Q86U 3OGDA 3CD6T 1JLEA 1YJWT 2PNIA 4LG0A 2ZE2A 3JREA 1G3TA 4A62A 3WGIA 2LFBA 2X74A 2FEZA 1S72I 2L9VA 4CEOA 5D4RA 4IUQA 3T19A 2J06A 3CCJA 4LMYA 4OMOA 2W42A 2KHOA 1KFZA 3VS1A 1NJZA 4DUZK 2F4OB 5I11A 5J2QA 5CKTA 2DTZA 1QKWA 3DWLA 1VSFA 1E2XA 3FXRA 3K4CA 3UKGA 1QMCA 1YFHA 2QWRA 1LE8A 2KDZA 2VKNA 1Q82O 2R7QA 1Q82C 4IHVA 3F0ZA 1JO8A 4M77D 3RNJA 4E7HA 5CVRA 5CR2A 4HYEA 4BWJA 4N4NB 1YJNI 3V4IA 5ILVA 3LWLA 4UY8O 1PYVA 1V76A 3G25A 4A53A 3G10A 3T8RA 1XMKA 3V1QA 4G6DA 4FJIA 2JK3A 4AG1C 4BRPA 4M75C 2HOEA 1DT9A 1YRNA 3JCMc 3G71T 3VYHB 1FJGK 1E7OA 3QO3A 2QGUA 4BDZA 4JI0K 3A2FA 4W97A 2KRMA 2XO7A 4BL0B 4HG2A 2HEOA 4CGZA 1J09A 1G2BA 2MLGA 3O9QA 2W24A 4ISGA 1LOTB 2QA4Q 3EKSA 4NLBA 4ESRA 2XG8D 2LKXA 1W0HA 2O03A 1KCFA 1RR8C 5FPEA 3FBIB 4BQQA 1RDCA 3CP8A 4ZGJB 3CD6I 3LSPA 1YJWI 2D6FA 4M77G 2OJED 4F3QA 3T1HK 3BY7A 3KFVA 3X24B 4BI8B 1MBKA 1YHQA 3AY9A 1MV3A 4A93J 2GLOA 4BGAA 4NXMK 3F22A 3AAQA 2ATCB 4XLHA 5LL6S 3CJTB 1WHGA 4DOVA 6AT1B 1KYZA 5FWCA 3PNYA 1NKEA 4KAZA 4BE0A 1P7IA 3FF5A 4HX4A 2EAYA 1PVSA 2O31A 1KC8U 3DAWA 5ILSA 3EHQA 4F93B 1K8AR 5CAIA 4CO8A 5I3UA 2R57A 4H0VB 1U3OA 3BTLA 2RK2A 1U6ZA 2P4TA 3KLIA 3EGUA 1VSKA 2R3SA 1C0FA 2A3LA 3VYTB 4NDLA 2BW3B 2O8CB 4EVIA 3I9V2 3G71I 4RLQA 4ZYDA 2P4RA 3VWBA 3KLNA 3CI5A 2PUOB 1Q7YO 2IA0A 3TSPA 3IH2A 3TDUC 3CZ6A 1PC0A 1Q7YC 1IAWA 1ZBXA 4FJJA 3CWUA 3RMBA 1IZ1A 4HVVA 1OZ3A 5K1YA 4IEEA 4IHSA 3LDQA 4ANJA 4O44A 4WQ5C 1BW6A 1S9HA 5IYCJ 1B9FA 3ENBA 3HYIA 2F5TX 3AO2A 3VW4A 4JK7A 2KRNA 2DFIA 3JSOA 1UHSA 1U5TB 2CT4A 5A2QK 3QUIA 1WJBA 3W2AA 3KCCA 3IDHA 2CGJA 1ABOA 4WFAL 3KP2A 2A07F 1MKMA 2NOZA 1G6NA 1HSTA 5CZ1A 4N4OB 1A6QA 2XB5A 4Q4ZF 3TDZC 5AQJA 3QWLA 4JLGA 3CQXA 3VS3A 3H1VX 3IRXA 1NYGA 2JA7J 5BPLA 5FO5A 2CP2A 4BEHA 3H3UA 2DA3A 2NUBA 4A61A 1VQ5T 5GAMd 1VQ4T 4GVEA 4HSRA 1K78B 4XKWA 4XM3A 5LMUK 4XH4A 5K14A 4CJSA 2KMUA 2HMIA 2W85A 3QYHB 3CCMQ 3CC4Q 4B22A 3PX0A 3AHUA 2HHUA 5IH2A 1P7JA 2V6EA 3ULEB 1C6VX 2DXUA 3SYZA 4NBQA 3GF2A 2M4GA 5M1OA 1O3QA 3RKYA 2VE8A 1M1KC 2X0LA 4OGEA 2GXBA 4XONA 2IVPA 3SV3A 3DXKB 1Y07A 2ME0A 4M77B 4FYDA 3K9JA 1U5TC 2M45A 1F5TA 3JB9J 1SD5A 4AHVA 1DJ7B 5GTHC 3EUAA 2FSWA 4ILJA 4FVMA 4BWMA 1NGGA 1S29A 4E1MA 3CCJN 2KZVA 1FOWA 3HOUJ 1YCYA 1JXMA 2JTVA 2E70A 3VF2A 1W5TA 4UUVA 2WY8Q 3BJ6A 1FXXA 2X6SA 4CEZA 2HHXA 3H6ZA 2OA4A 2JJ7A 1QQNA 1RADB 4DTMA 1VQ5I 1KTQA 1NK0A 1VQ4I 3LAJA 1NGAA 4H5RA 3MEWA 3OSFA 1OPCA 1TP4A 2K85A 4Y17A 3NH1A 3V1OA 2FXAA 1FIAA 3NAUA 1OQKA 1EKEA 3V9SA 4E9EA 2W41A 1RZ4A 4ISEA 4M77C 4ICLA 2DXTA 2P9NA 3IAYA 3Q7CA 1YJ9A 1G3YA 4DCHA 1RDAA 1QZZA 2ZPBB 1WJAA 1ZYRF 3SQ2A 2AA4A 4JNEA 2GEMA 3ABMH 1NK6A 1H8AC 4CEFA 3S32A 3LDSA 4I7HA 4DK9A 3RERA 4M7DA 1RRJA 5B5EC 4FSSA 3SBGA 3MWMA 3MWPA 3HSBA 3HOZJ 1W1FA 2R7OA 3QKJA 1JLCA 3CBMA 4LF6K 3VS5A 4XKBA 2RHXA 3MZYA 2W4SA 4BQLA 1XC5A 1UG1A 1YITA 3WTYC 2FQ3A 1VQ6T 4F7UG 1YI2N 2NS0A 1T8EA 1OH8A 4IO9L 3P39A 2E1NA 1BC7C 3CHWA 4IEJA 4K2EA 1B72B 4OB1B 3Q3SA 3CC7T 2IS1A 4OLAA 5AQQA 2CWEA 3IWZA 5AFUA 2E41A 2L8DA 4X1EA 2L7FP 5CQEA 2STTA 2X9DA 2HPMA 3FMSA 2D0OA 2ZPHB 3CF5L 4K25A 3H3VK 4QQ6A 3L42A 4IHYA 1OH7A 4LD9K 3K58A 3GP8A 2EQKA 1G3SA 5GAMh 2BIVA 4NC6A 3V7SA 2AS5F 3CQ8A 2EPDA 3GFJA 2KHMA 3ZL7C 4UOBA 4DS5A 4I7FA 3SHFA 3CCLQ 3QLHA 2WFBA 2IS6A 2RPNA 4ZJZA 4DTUA 2MH2A 1L5UA 2HR3A 2MF2A 5J40A 5BR8K 2QQ9A 3SD4A 5D6XA 1WI3A 2VQEK 2OC6A 3VS4A 1CXQA 1ETOA 2O3FA 1WXTA 2DXIA 3ZT2A 3UKUB 2NVYJ 3MEGA 5K7FA 2O4XA 1VQMA 1J3TA 1VQ6I 4PJOA 4F55A 2Q1NA 3M57A 3M5AA 3OJSA 1PUFA 5J8CA 2X4WA 4KMUX 2O2OA 3CC7I 4O4GA 1X01A 2OAUA 2HS5A 1MIJA 2VVKA 2DMTA 3ZR8X 1OZ2A 4IQJA 2O8BB 4NO7A 3JRCA 2ELKA 1LFPA 5IY5H 5A0GA 1WSJA 4G1QA 2VASA 4BY1J 1WJ5A 4BRKA 2DPDA 4JP0A 2JWLA 4CJ7A 3VF4A 1JB0E 3DRSA 2CQKA 3ZSXA 4XTZA 3TAPA 2Y0SA 4DSFA 1NMDA 2LCSA 1E6HA 2E1OA 1HNVA 3AVKA 3G3ZA 3OYIA 2KRHA 5KGXA 4K8XA 3K5OA 3NEUA 1NKUA 3BR0A 2HYJA 4QCLA 1NJIR 4BDYA 2ROLA 4OMLA 2JVVA 1S1WA 4EP4A 2CP3A 3LGLA 3O6WA 4HX7A 3I58A 2V9KA 2DJQA 2RMOA 1M3AA 4B3AA 3J81K 2H09A 2WAFA 4J6XA 4R56A 4B1UB 1AT1B 5IXBA 2D8JA 2QWQA 4M9ZA 4ESFA 2P0PA 3CUQB 5C2DA 5C3EJ 4MO4A 1NGIA 3ZT4A 2I5UA 1FYKA 3C2BA 4G9YA 4Y7NJ 2MPXC 5F27A 1YYVA 5EEGA 2R4GA 3D6RA 2L7KA 2DTHA 3LDOA 2QEXN 2Z0WA 2HD0A 3OYBA 5FLXE 1JKQC 3NBPA 4FE7A 3I55T 4ELYC 5DM7F 4BR9A 1G5VA 4L6V5 1X3NA 3U8XA 2EV6A 4RB1A 1GV5A 3UDCA 2DBBA 3TEDA 2P5VA 1SFKA 1KRPA 2X1EA 2BKDN 5AQSA 5KRSA 3RKQA 2M3AA 3ZSOA 3MECA 4NCGA 5HS9A 4BQNA 3JCMf 4QVDA 1KAZA 1S5JA 1SHGA 3J7AP 1V55H 3JTGA 2LJ1A 2W0ZA 5F08A 2YU3A 2PLYA 1O7FA 1P4XA 3CUQC 4C92D 3O9UA 2VYPA 1YS7A 3RSEA 2EX3A 3OIPA 3ENHA 4B1RA 1WGXA 1E3PA 2YUOA 2MAMA 2Y0MA 1OYXA 1TNSA 4G7ZF 3BG3A 5IP9J 1K7AA 4MDXA 1S3XA 1LJ9A 4FK0A 1HX1A 2D1XA 1SV5A 1BWFO 4BJTA 2KQRA 3SFMA 2UUCK 1JKRC 1H92A 1U9OA 1O3RA 2UUAK 4M7DF 5EX5A 3B73A 4M3UA 4XOTA 4EMKA 4XTYA 3UKRB 3L7WA 4N5SA 1HDDC 1I6XA 1B9NA 2B6AA 3K5NA 3WHCA 4WCEL 1YXQA 4A5NA 1E3MA 4P5NA 2GWJA 2F2VA 1ZHFA 1QCFA 3F3XA 2W25A 1S72Q 2TDXA 3IUOA 2VIXA 5CO7A 3I55I 3MP6A 2Y69H 3GX4X 4ZZDA 3TU4K 1FPQA 3H3NO 1VSHA 3I59A 1WSGA 3A0BC 1QQMA 2GBQA 4C5HA 3QDKA 4F4KA 2DZCA 2V4JC 2VYTA 3O2PE 1MJAA 1DEJA 1L0OC 3R4KA 5DCMB 2L01A 4QS7A 4JN4A 4N76A 3CCVT 2MC4A 1SD4A 4CZCA 2A5YB 4LSLA 2LQKA 1T0FC 2FSKA 3CYMA 4B1ZA 2B0LA 1BG3A 1IXSB 5TKWA 1I3QJ 1ETWA 4OF1A 3FEOA 4M41A 2OPPA 1O1WA 4CZJA 4PKHA 2I7NA 1QPIA 1Z9ZA 3ZYYX 4MEXF 1JLAA 4JLHA 3DLHA 3TW7A 1D0XA 2FVUA 1T3SA 4KBOA 4QPOA 1U45A 4D5CA 4RAGA 2E1ZA 3KZZA 1OH6A 2DYBA 3MZHA 3PUFA 2XY8A 3CETA 4AHTA 1TK8A 2VBZA 2XU8A 2E2HJ 3ZGKA 3TAGA 5GAHP 4OKEA 3WU1B 5IOZA 2ESWA 2E2QA 1M3QA 2YNFA 1XI1A 3CD6Q 5IHNA 3MHXA 1YJWQ 2DILA 3K1MA 4A2BA 1Q86R 1T56A 1WZ2A 3U3GA 1IUFA 2QK9A 5IYBJ 4PJOF 4BH9A 4XEIA 3IS9A 3V8JA 3K9TA 4OMZA 1ZGJA 3KYDB 2KY9A 4DV3K 1WJCA 2VWJA 4FWKA 2K9QA 3SZTA 5FPMA 1IG9A 4OIQF 1T0JA 3ZQCA 2FE3A 1Y6IA 4QVCA 1KVCA 3SEQA 3NGYA 5AZJB 3HSRA 3GFIA 3CCVI 1KHCA 2ZZDA 1BC8C 4CC4B 3T69A 3C95A 3ABTA 2DTOA 3MDQA 3FK6A 1ZUUA 3K4KA 2KIQA 4M71A 3F8BA 2O8XA 1X9JA 4DV4K 2YNIA 4RAFA 1C6VA 2E20A 1XQSC 3SPZA 2HF3A 2H8HA 2H27A 4AVPA 2VKDA 1VQ9A 3I64A 1SANA 1JJ2M 4HVWA 4M4ZA 2XAGA 2XPWA 3M6GA 3OA6A 3O8MA 2OTJN 4IFEA 1I5ZA 2HSPA 5LJVA 4OIOF 2Y1IA 3SMSA 3AG2H 1HMVA 2VKVA 2QSGX 2HNYA 4B8AB 4N0AC 2HFHA 1T08B 5BQTA 5LJ5j 1M8VA 4C92B 3M8SA 1KLNA 2W04A 3LX7A 1BB9A 5JLWA 2QWOA 2DVJA 3MMYB 3RQ4A 4Y52J 3QOEA 2CH4W 2HXIA 3RMAA 4EDUA 3HT3A 2HHWA 3TI0A 3NF9A 1HSQA 1TWAJ 3CCRA 2NVUB 1U9NA 1H0MA 5TISC 2H56A 2JNGA 3K2AA 1ZH5A 4I0AA 3HI0A 4CYCB 4GFBA 4KI6A 3AVGA 2MCNA 3HVTA 1VIFA 2QKBA 1BL3A 3VYSB 1IH7A 1UGQB 4H4OA 2V8KA 5ADXA 4MQVA 5HK0A 1K79A 2KBTA 5B1BH 2CS3A 5E20A 3GMEA 3S1MJ 3EH2A 3EE9A 4EJOA 3K59A 1PP8F 1X1CA 2F69A 1S8NA 3VMFB 4C92C 3SJJA 4KUIA 4LC9B 2KAFA 3DU6A 3IKVA 3ULDA 2HQ5A 4DFKA 3FHNA 2VQLA 3OYDA 4XU3A 1RT1A 4B48A 2LKSA 2HB5A 2XPUA 4DU1A 1RTIA 3SQ0A 3GOXA 3M5RA 5KCMA 3AARA 1L3LA 2VCPA 2PN6A 1GXQA 4B6MA 4IPAA 2XY5A 1WEFA 1OCOH 1JTYA 4LB5A 1VQ7A 3O1WA 2QLZA 1NZ9A 4XK8E 2DPUA 3I5RA 4RMNA 1I07A 3O9SA 1AOYA 1RI9A 2P9UA 4RUGA 1Q82U 3LSGA 3LAMA 1LMZA 2A41A 3CJ1A 4LFBK 2FJ1A 4XQFA 2E2NA 4JD2A 3GIBA 5CVIA 3CMYA 4GY2B 4P55A 1VQ5Q 2RJFA 4J01A 1VQ4Q 3CCEN 4RTWA 2A6AA 1WEIA 4O8UA 1IKVA 1BIZA 1HOMA 2FF3B 3HRMA 4KULA 3WGGA 3WODF 3A01B 3CW7A 2VV5A 3VTIA 3VS7A 3VUZA 4MNUA 4XU0A 1WZOA 3SQ1A 4QS9A 2R5MA 1JCEA 2DA6A 4A2AA 2DMQA 4CI6A 1PUEE 3JCMJ 1G4DA 1MPGA 3VPRA 2HNIA 3CJNA 5HS7A 3N4MA 2KISA 3BEXA 2M8EA 5FLXO 2COWA 5KYWA 1XDSA 4BQZA 2R5YB 2O8DA 2RHUA 3M1FA 2VN2A 2LQ8A 4H4MA 4MIMA 2EJ9A 3AG4H 2NOJB 4CXFA 3TWHA 4IUTA 2Q2EA 4LG0B 2DIGA 4NOYA 2IJLA 4M7DE 1K8AO 4BRAA 3KP3A 1VSEA 3QMLA 2LJ0A 2K9GA 1U04A 2DIQA 1ETKA 1SEUA 1LWVA 1VQLT 5I42A 1V1CA 4RTFD 4KO0A 3V8LA 5GP9A 2ED1A 4JEPA 1KQ1A 4YY3K 4AC0A 4ZYGA 2ABLA 2ED0A 1QBJA 4C0FA 4L0ZB 1TBXA 4DR1K 3KTUA 5CYMA 5KHDA 1LE8B 2RDPA 2QA4N 4C3HJ 2GWRA 2A61A 3OMYA 3THXB 1WDXA 1J0RA 2JA6J 2OX7A 4KNYA 3AO4A 1YRNB 1SSHA 3KJVA 1VQ9N 1Q7YU 2VPLA 5GIPA 5LD2C 1JJ2S 1VSIA 4G8XA 4GVMA 1RGIA 1O57A 4JI8K 2FG0A 3QYBA 1U49A 5LJWA 4EMSA 3OTOK 3HXMA 1O3TA 4ELZC 4BROA 5K7ZA 4YIIA 4EZ6A 2ZXIA 2A0FB 5TGTA