4E7IA

Pfv intasome freeze-trapped prior to 3'-processing, mn-bound form (ui-mn)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 110
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7iA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7iA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7iA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7iA03
3TAFA 2P5OA 3ISNC 1ITGA 3VQAA 5J2NA 1HRHA 5C6SA 2XY5A 1C1BA 4CJSA 4CRIA 1QSYA 4HTUA 4CEOA 1EKEA 4CJVA 1L3SA 4KPYA 4B9WA 3WNHA 3V9SA 4F3OA 4F2SA 1UWBA 5FDLA 3BGRA 1B9DA 4CJRA 1SL0A 1NK8A 3NF7A 1RT4A 5DMRA 4E1MA 2HHQA 1CZ9A 4HUEA 4E89A 3DLBA 4ZHRA 2OA8A 4OJRA 3V9XA 2LCCA 2Z1HA 1Q8IA 3OA6A 2X6SA 4O0IA 4H8KA 3V1OA 4IUTA 1J54A 3QIOA 3HSTB 3NH1A 2MWOA 5EU7A 1IG9A 4AILC 4KV8A 4KB0A 1T8EA 1SL1A 3UWNA 2XDPA 2O4XB 4FL6A 3ZSZA 4A4FA 5CY4A 4RW9A 2GFUA 1LAVA 4MQ3A 4IUQA 4CECA 3A2FA 1BI4A 5HRPA 4KREA 4CJKA 1L5UA 4HCBA 4FK2A 2YNIA 3DLHA 3OYNA 3NTKA 1HJRA 3ALYA 1GOAA 4K8ZA 3PO4A 4Z4EA 1RBRA 3ZT1A 3PX0A 3VA3A 3PUFA 3O3FA 1RBUA 3I8DA 1RDDA 4FM0A 1ZBLA 1VSJA 1BQNA 3VQPA 3P83D 3V1RA 2B4JA 4CFAA 4DFJA 2JTFA 4FJMA 2ZQBA 1JLFA 1N6QA 1RBTA 5KCHA 3LLRA 5J2PA 3P5JA 3VA0A 3O4NA 4CERA 1KLMA 3OYJA 5DK5A 4M3TA 3QINA 4O0JA 1VK0A 3CFOA 4N41A 2BDPA 4N47A 4DTMA 2XHBA 4BWMA 2PZSA 1U47A 3LGLA 4CFCA 1VSMA 3VQDA 3DLEA 4J2BA 3O8VA 4M45A 2EHGA 5CYQA 3DOKA 4PQUA 3NGIA 4E7KA 3OMCA 4DF4A 3LWLA 3PX4A 2IS3A 4B9TA 2HNZA 5J26A 3AO5A 4CFBA 4Z4HA 1NK4A 5KE2A 3PMTA 1RDBA 3KLFA 2EX3A 3G10A 2DFEA 4CJWA 3AO3A 2E6LA 3MEAA 1RT3A 3LPTA 3VQBA 1BL3A 2BUDA 3L42A 1KVAA 2BANA 4FJ7A 2HQEA 3ZSQA 4FW1A 1NK7A 3P8HA 2PYJA 1QSSA 5SZTA 1ASWA 2HMIA 4PWDA 3TAPA 1Z26A 5C42A 5CZ2A 3LAMA 3HP6A 3QNOA 1KLNA 1I3AA 3NTIA 2X6NA 3I0RA 1EXQA 1OI1A 4CHZA 1NK0A 1S1WA 3KK2A 4QCLA 4KHSA 2G8VA 2XY7A 5CYMA 1RCHA 1WJSA 4DTXA 3SJJA 1HYVA 3EZ5A 4KKOA 2EKOA 3K2PA 1G15A 3OMGA 5M9OA 3AO2A 4C5HA 1X9MA 4DSLA 3EYZA 3ZEHA 4EP5A 1C0TA 1L3TA 4KRFA 4OGCA 3SPYA 4Y1CA 4NCGA 2LDMA 4W5TA 2YV0X 3L2UA 5HBMA 1XI1A 4B9SA 3IG1A 1XHZA 3LGFA 4BDPA 3SV4A 3L2RA 1NK9A 1UOCA 1S6QA 1A5VA 4CJ4A 4FLYA 1RBSA 4IUVA 1JLEA 3NTHA 1WSIA 3AO1A 1UA1A 3E9GA 4CGIA 3NGZA 2D0BA 4FLWA 1ZBFA 4N5SA 3DYAA 4CGDA 2DIQA 2BGGA 1ASUA 4LD6A 4DS4A 3AA3A 1D8YA 3B6PA 3BDLA 2GFAA 5IAYA 3AVMA 3C6UA 4B9VA 3OYKA 2P0KA 2YNFA 1NJYA 3DM2A 3ASKA 2HHUA 3SUQA 1OYXA 2B5JA 1XHXA 4L8RB 3OYAA 2JZ2A 2A1RA 3S3MA 4DQRA 4DS5A 2RI2A 4UQGA 1ZYQA 1X1PA 4BACA 4DTUA 3KJVA 2BIVA 3DLMA 4CJPA 5KGWA 3V81A 1S9EA 3S9HA 5D6WA 3HM9A 2L89A 5KE3A 3NF6A 2QKKA 2KFNA 4LH4A 4E7JA 3U3YA 1QTMA 1VSDA 1X9SA 2X4WA 1W0HA 3ITHA 4TSXA 2HW3A 2Q3SA 1EX4A 5HRSA 3RWUA 2OZMA 2KW4A 2X4YA 3LP0A 4PLLA 1UA0A 3V9ZA 4IG0A 4DLEA 4NCBA 5KCOA 3FFIA 5HRNA 3V9UA 3EAEA 1SV5A 4A4HA 2PYLA 1RBVA 5HRRA 4DG1A 1LV5A 1N5YA 4KFBA 1D9DA 2G8FA 3MECA 2G8KA 4C5EA 4NYFA 2F5KA 4DTNA 4ZTJA 3OS0A 3TWHA 3OYCA 3M8PA 1NJZA 3MP8A 3BDPA 1FXXA 1TK0A 1J9AA 4CIEA 3SPZA 2WACA 3VQ8A 1Z25A 3VQQA 2IAJA 1X9WA 5KRSA 2X78A 3META 5HLFA 3ZT2A 1C0MA 4HUGA 1GOBA 3RRHA 4M3WA 3SQ0A 2P1JA 2OZSA 3S3OA 1RNHA 4FLTA 3K5OA 3B6OA 1BI4B 1ZBIA 1OZ3A 4CHQA 3GOXA 1OZ2A 4KTWA 4FJJA 2LSNA 3LP3A 4FM1A 3NH2A 1IH7A 3SV3A 4B08A 3QEXA 4FZXC 3F73A 3AVIA 4HCCA 2YHBA 2GF7A 4DTJA 4CGFA 2WONA 3PNWC 1A5WA 1MHNA 3O3GA 1JXEA 2FBYA 1HPZA 3NF8A 2AJQA 3LDSA 1J5OA 1CZBA 4PL6A 1K6YA 3M8RA 1L3VA 2QQSA 4J2AA 3PV8A 4FJ5A 3Q1JA 1U45A 2XRIA 2RN2A 3ZSVA 4C8MA 3T19A 4FCYA 2HNDA 1TK8A 3P8DA 4AH9A 5D6YA 3VQ4A 3LX7A 4CK1A 4W5OA 2RJFA 2RHXA 2KTQA 4Z4FA 1TL1A 3HXMA 1S5JA 4IURA 2VWJA 2IC3A 4M41A 2YRVA 3QKJA 2MWPA 2D0AA 4GVMA 4EP4A 4C8KA 1IKWA 3ZSXA 4E7LA 3LP1A 3HVRA 4CK3A 3VQ6A 1ZBUA 4NZGA 2A1SA 5HROA 5HP1A 2ITGA 3DLRA 3RR7A 4KHUA 4J2DA 4Q5VA 3OYHA 2O4IA 4FJHA 2RJDA 1NK5A 1S1XA 2VYTA 1O1WA 1RTIA 1IO2A 4OLAA 2XK0A 2RI5A 3ZSOA 1RI0A 2HB5A 1S1VA 3QEPA 3DRRA 2XY8A 1IKVA 3VQ7A 1ASVA 4JLHA 3TI0A 2EQJA 2K3YA 3VQ9A 4AHCA 1XWLA 1RDCA 3D0PA 4CJTA 2I5JA 4CJUA 4Z4GA 1LWEA 1LWFA 2F96A 4L59A 4IBNA 1NKCA 4PLIA 1JLAA 3V4IA 2LRQA 2DFFA 2CKKA 3QO9A 4FLUA 4DSIA 4FLZA 4DQPA 1WJRA 4CIFA 4AHVA 4CJ3A 4CEFA 2KQ2A 4KHNA 5C24A 4CF1A 2OPQA 3SI6A 4Z0UA 4E3SA 3LYIA 1U4BA 3OS2A 3WNEA 1NOYA 4DFPA 1HYSA 3FC3A 1GOCA 3ZSYA 2Y1IA 4RG8A 3QLHA 3AO4A 3OJUA 1EP4A 4FK0A 4MFBA 4KI4A 1KCFA 3QIPA 4DMNA 4BD3A 2Y1JA 2VWKA 4M3ZA 3ASMA 2Z1IA 1Q9XA 3O4QA 3T1AA 2XY6A 3E01A 3AVHA 4F4KA 2IDOA 3AVLA 2DIGA 4DU4A 4R5PA 1S9GA 1DTQA 3NE6A 1MU2A 1BIUA 2DTUA 4CJEA 1QS4A 3L2WA 3QIIA 5KI6A 3UIQA 4FJNA 1N27A 2X74A 3C95A 4FJXA 2D0CA 1DLOA 4EDUA 4JS4A 3KLIA 4QOZB 2ZD1A 1NK6A 1SKRA 3C4SA 4JRPA 5I42A 1BCMA 4W5NA 4I9LA 2P5GA 1KFDA 4OKJA 3OJSA 3H6ZA 1HQEA 1RT2A 1NJXA 3P1GA 3OYBA 3MEVA 1YTUA 4GW6A 3CYMA 1HMVA 1LW2A 2L3RA 3AA2A 4FJ8A 1U49A 2OYQA 1TKTA 4OKEA 4DFKA 4CEZA 1NKBA 3K5MA 2RJCA 1YT3A 4G1QA 3O3HA 4A4EA 1WN7A 4N56A 3EY1A 5K14A 3QEIA 1TV6A 4CJLA 3E9FA 1VRTA 2ETJA 4PY5A 4M42A 2M1HA 4AHTA 2B8AA 3SNNA 3OYIA 1D5AA 3OYDA 4OVAA 4Z02A 1HNVA 2G8IA 4AHUA 5D6XA 4W5RA 3RMDA 1WSGA 4FJIA 4B8AB 1RT5A 1RT6A 2RI3A 2K3XA 3TAMA 2NLUA 3PX6A 4BE1A 3F9KA 5FROA 4E19A 3HP9A 3NBPA 3OYGA 4JS5A 3SUOA 4N4IA 4YNQA 4O55A 3KKRA 3L2QA 1REVA 2LTOA 3U3GA 2VG7A 3ZSRA 5J1EA 1TAQA 1VSKA 1JLGA 3DRPA 1W9HA 4KB1A 5J39A 1TKXA 2HVHA 1J53A 3JYTA 4KO0A 3M8SA 1FKPA 3OYFA 4Y1DA 3OB9A 3LANA 3AV9A 4FJKA 4RW4A 4DSEA 4FYDA 2HHSA 3VQCA 3NHGA 3V9WA 3QESA 2R57A 4II1A 1U48A 2HHXA 1JL2A 1XNIA 3RMCA 1IKXA 4Q0BA 3ZT4A 1WAJA 2D5RA 3L8BA 2FBTA 1LAWA 2FBVA 2Z1GA 2IG0A 2OPSA 3FEOA 3DMJA 5E41A 3H8ZA 1BHLA 4O4GA 2QXFA 4IUUA 2G8UA 1HYZA 3ZCMA 3NCIA 1RILA 3DB4A 2VG5A 5D3GA 3H08A 1S6PA 3OYMA 4DTOA 3QJ6A 1JL1A 2R5MA 3S3NA 3FDRA 3V1QA 3AVGA 1C6VA 2RF2A 2M0OA 1BISA 3DOLA 3QBYA 4BE0A 2FBXA 4I7FA 3VN5A 1SUQA 4DSFA 1RTJA 4DQQA 1G5VA 2E4LA 4ICLA 1IKYA 3MEWA 4O5BA 1VSLA 3MXIA 4B9NA 4N76A 1QQCA 4FLVA 1BIZA 1TL3A 4DU1A 4KTQA 2QQRA 4FXDA 3LP2A 4BWJA 5C25A 4JRQA 3QEVA 4NYNA 4CE9A 4QW2A 1Q9YA 1T7PA 3OYEA 4F2RA 3WNFA 3PO5A 3RRGA 3C6TA 1QSLA 3NNQA 3CG7A 3WNGA 4OKKA 4F8RA 2E6MA 2GUIA 1C1CA 3LZJA 3DB3A 3IS9A 3CM6A 4I2PA 3HYFA 2OPPA 1B92A 3KK1A 3VQ5A 4EZ9A 4CESA 3CFPA 4B9XA 2GBZA 4M3XA 4F3TA 4DSJA 4E7HA 4BE2A 1WJQA 1YVUA 4LSNA 4FZYA 4FVMA 4GMJB 3HPGA 3G0ZA 2D9TA 1DTTA 2RHIA 2KFZA 4C8OA 3OQ5A 4HVJA 1CLQA 2EQMA 2RJEA 1VSEA 4DFMA 4B8CA 4B9MA 3HO1A 2WOMA 3SQ4A 3I0SA 4HHTA 2JLEA 2YKNA 4HCZA 3M8QA 3MXJA 3T3FA 4AHSA 3MP6A 4KI6A 3NF9A 1FK9A 4CF0A 4LY7A 2XO7A 4KTZA 3KTQA 4ID5A 4QVZA 4M3RA 3QEWA 4C8LA 3KLHA 4FW2A 4C8NA 1UAXA 2BKDN 3L3UA 4DTSA 3SCXA 3M9QA 5J2QA 2KZMA 2M16A 3PMIA 5FRMA 3AVJA 4IDKA 4CHYA 1FKOA 3F70A 5IN1A 4FZZA 4OLBA 3TARA 5JS2A 3TAEA 2G8WA 4CEAA 2G3RA 3TAGA 3KK3A 4HUFA 2YKMA 3SUNA 3KD1E 2RHUA 2QK9A 2BE2A 2VG6A 1JLQA 3MO8A 2JGUA 3SD4A 5FRNA 1R0AA 5JS1A 1KTQA 1L3UA 5CZ1A 1U04A 2O4GA 4CEQA 1WNSA 4CHOA 1TGOA 4H4OA 2QKBA 4FJGA 3L3VA 2E6NA 3PY8A 3CEYA 1QHTA 3HPHA 3K5NA 2DFHA 4O44A 4C5IA 3DLGA 4CGJA 2LVMA 1NJWA 2L8DA 1I39A 1H3ZA 3TANA 3RTVA 4X34A 4H4MA 4FK4A 3NFAA 4CGGA 3SUPA 1BGXT 1TVRA 3SQ2A 2F8SA 3OYLA 3RMBA 4DTPA 2KZZA 3OVNA 3HK2A 3FLGA 4IG3A 1WSFA 3SZ2A 4FJ9A 1CXQA 2RO0A 4FJLA 4PUOA 3HVTA 3NH0A 3MP1A 2X4XA 1T05A 3AA4A 4IKFA 2IGIA 4KHWA 1S1TA 1XC9A 4EZ6A 4GY5A 4FM2A 1KHCA 4E7IA 3KKSA 4I2QA 2P51A 4ELUA 1JXBA 2PY5A 3LALA 3LAKA 2O4XA 4KHQA 2HHVA 1TAUA 3UT1A 4E1NA 1JLBA 2G8HA 1TKZA 5J2MA 1NKEA 4IFYA 3HJFA 3AVBA 4BDYA 4OGEA 4WE1A 3JSMA 2RHZA 4B9LA 1VSIA 4IUPA 3OS1A 2Z1JA 4CEEA 4N4HA 2R58A 2R5AA 4QQDA 4LD0A 3IRXA 1CXUA 4KHYA 3THVA 4CFDA 3PFSA 4ZTFA 1ZBHA 3IAYA 4CHPA 1SKWA 3HT3A 1RT1A 1KVCA 1BCOA 4CIGA 3ULDA 3TR8A 1Y97A 3K58A 1WSJA 1RT7A 1WLJA 3QERA 4QQGA 1JKHA 4CJ5A 3CM5A 2OPRA 4CHNA 1SSFA 4FU6A 1EETA 4RW6A 4ELTA 4RG2A 2IOCA 2HQXA 4AHRA 2HNYA 3MEDA 1VSFA 3QNNA 4CJQA 3HPOA 2RKIA 1B9FA 4N4GA 5KRTA 1QE1A 3LPUA 4W5QA 3DLKA 5SWMA 1KFSA 4XIUA 3NGYA 4CF2A 3HL8A 4PA1A 4RW7A 3KD5E 2ZE2A 3MEEA 3KLGA 3V6DA 4C5GA 2W42A 4B3OA 1HNIA 2FHDA 3NAEA 3AVFA 3U6FA 3K5LA 3TABA 4DSKA 5T7BA 4OVLA 2F8TA 1LW0A 3LWMA 2DAQA 5CIUA 1VSHA 2YHAA 1KSPA 3S6WA 1RTHA 4BDZA 1KVBA 4CCHA 3DI6A 4YFUA 4QQ6A 3QETA 1D9FA 2RHYA 1NOZA 3SYZA 3ZT3A 4QAGA 4Q5WA 3ZT0A 4DLGA 3LZIA 4CGHA 2ATQA 2GV9A 1VRUA 1WAFA 1YTAA 4DTRA 3RMAA 4Z4CA 1WSHA 4DU3A 2R7YA 2EFIA 3AVNA 3OY9A 4I9QA 1JLCA 1S1UA 5KTQA 2EQUA 1SKSA 1BQMA 4DQIA 2EQKA 4M3UA 1TKDA 3K59A 3CFRA 4UC4A 2YNHA 3MEUA 3KIOA 5I3UA 3MEGA 4A4GA 4ID1A 4CF8A 1KRPA 3C94A 1RTDA 4NCAA 4DWIA 3KUFA 4CJFA 1C0UA 1T03A 3NDKA 4M3YA 4K8XA 1A5XA 4ELVA 3L2VA 3MXMA 4OPJA 3AA5X 2PQWA 5C0MA 3D45A 1HQUA 2E5QA 4B9UA 3KLEA 1LWCA 2FC0A 5KGXA 3CQ8A 4Z4IA 4KAZA 3ME9A 4DQSA 4IFVA 3SQ1A 2B6AA 3VQEA 3TAQA 1SL2A 1TK5A 4CEBA 3ZSWA 4CF9A 2HVIA 3MAQA 4E0DA 1C1AA 2DY4A 3LH0A 3AVKA 1RDAA 4CEDA 2HHTA 3AVAA 1F21A 3AVCA 5KH6A 4LH5A 4LSLA 3K57A 3RR8A 1WSEA 4NS5A 2YNGA 2NUBA 4RW8A 3DRSA 4FLXA 4J2EA 4DF8A 4OPKA 4CK2A 2X35A 2RPIA 2HHWA 1WGSA
chains in the Genus database with same CATH superfamily
5IY5H 3CWAA 3A5NC 4IRGA 5ELZA 4B1YB 3TAFA 3VQAA 4HKEA 4PKIA 3FKJA 1FP1D 3DKMA 2ZSIB 1G3SA 2ROLA 2VBZA 1MMNA 3BROA 3FMRA 4HTUA 5IYDJ 1L3SA 3R6MA 5J40A 3T69A 1Q81O 3R2XC 4F3OA 1GL5A 3H36A 2KRCA 5GPCA 5FDLA 3HOZJ 1Z05A 2YX6A 1BI3A 1HU0A 3MZHA 2HZYA 4QS7A 3QODA 4JX6A 1B9DA 4JD2B 3K0LA 1SL0A 3HUGA 1RT4A 4AI4A 3EDPA 4Y33A 1YHQI 2IVMA 2RDPA 5DCMB 1IRFA 1KYWA 3TBIA 1QHAA 4XLCA 4DBRA 1M8MA 2MF2A 5EXWA 1U78A 4BRHA 1Q8IA 5ILSA 3FXMA 2O8CB 1OV3A 2GAUA 3OA6A 1X3WB 3CCJI 5HLIA 3TCJA 1CSKA 4RB0A 4AG2C 2O8XA 1FJLA 1ZBSA 1D0XA 5E1XA 4ASNA 2VGNA 4LDYA 2QKLB 1G99A 4NQWB 1N9SA 1X4PA 3PIPF 3AGRA 4FX4A 1T8EA 2L9RA 5B5EC 2NOFA 3GZ6A 3SJMA 1ZXOA 3WTUC 2GTOA 4FL6A 1KC8U 3LL7A 3SWNC 1VQ9A 2RAEA 4CZIA 1YQKA 3U1KA 2GFUA 4LF4K 4A5NA 3I5RA 1TT0A 1ZELA 5HNFA 2R7XA 1BI4A 1FEXA 1TT5B 4IEIA 4BHBA 2JSPA 1M3HA 5HRPA 4F14A 5EGOA 1EJ9A 3E9PA 4HCBA 4C8QB 3DLHA 1WWXA 4HTLA 1QLYA 5TJJA 5HY6A 3B8AX 2QA4T 3ALYA 4WCEL 4PGHA 1W7AA 4U0VA 1R22A 1RACB 3FX3A 2HYFA 1BKBA 4P1WA 5KYNA 1LDDA 4PFPA 1RDDA 1N8RR 2A61A 1ZBLA 1LEAA 3VQPA 3N4QA 2FVUA 5AQWA 3CCST 1HPMA 3P83D 3V1RA 4CFAA 2ZQBA 4FISA 2IS4A 3NEUA 1U5TA 3VEWA 3ZOBA 3CCRT 3GLXA 4MEXF 3WTWC 3CMEN 5J2PA 3C65A 2DU9A 3MAJA 4LK1F 2XD0A 2CSIA 2KL4A 2AKKA 3ISPA 4M3TA 1YJ9A 3H35A 3DU5A 3QINA 3CFOA 3RDVA 4DTMA 1WBBA 3VGKA 3LGLA 1OPCA 1T33A 5GAOn 2E3HA 5GMKh 3JR9A 4RMOA 4AFQC 4J2BA 2ZPBB 3O8VA 1RRSA 1XQPA 3DOKA 1KONA 1APLC 4A3CJ 4K42A 2K5LA 5AQIA 2G0EA 4OWRB 3GW2A 4DR6K 2NXNB 1YTYA 1UUEA 4LF6K 3WHCA 2OZUA 3FGUA 3H6EA 4DR5K 2KMUA 3LDLA 3D7EO 4OIPF 3C2BA 2EGEA 1U06A 1OCRH 2EX3A 2DFEA 2V1QA 4CJWA 2PZ1A 4J7IA 3TO9A 3VQBA 3VSLA 1V3FA 4FJ7A 3WTXC 4BGBA 2QA4Q 2HQEA 3MKZA 4FW1A 1NK7A 4JI5K 4D5FA 2G7UA 1QSSA 2O03A 1ASWA 1LFUP 2DA5A 3LWHA 2FA5A 3VV0A 3HP6A 1ZRCA 4IXCA 1EF4A 3CCSQ 2QGGA 5D8KB 1KLNA 2DPDA 1D3YA 1I3AA 4NB5A 3VJPA 3NTIA 3UE5A 2F9WA 4EATA 1R1UA 1OI1A 4IL6C 1WXTA 2O0YA 2FRWA 5L3GA 2P9SA 2G8VA 2DF6A 5BQTA 2V1UA 3EZ5A 4KKOA 1SAXA 4M77A 2OV7A 3LSIA 2ZPEB 4LB6B 3OMGA 4JK8A 3LQQA 3QP5A 4DSLA 3EYZA 3F2KA 4CZJA 4KRFA 2DXUA 4OGCA 3FE1A 3SPYA 1HSTA 4NCGA 4LFAK 1HW5A 4PHTX 4W5TA 1SZ2A 2VJJA 3L2UA 5HBMA 3AG4H 5B66C 1EV7A 3BQZA 1XHZA 2KLAA 3A0BC 2XB5A 2V7YA 3MVPA 1S6QA 2CGJA 4JKCA 4CJ4A 1XD7A 2HZDA 2RD1A 4FLYA 1RBSA 1ENHA 1V4SA 5KK1A 4BJ6C 4JLGA 2J6FA 5I2SA 3KLNA 3NTHA 3M0SA 1OH6A 1T98A 1N9RA 2VQGA 1AKHB 1UA1A 2CT4A 1WJFA 2QSGX 2K4YA 3E9GA 2CGPA 3G6ET 2O61A 3F23A 4MTEA 2PBDA 2H3JA 1ZBFA 1TS9A 4LD6A 1TUCA 3ENHA 2HKQB 1YIJI 2DPUA 3B6PA 2XDVA 2GFAA 2EPFA 4B9VA 5FFZA 2YU3A 3QFPA 4PZJA 1ARKA 3OYKA 4WCGA 3OW2M 4AQYK 3F8CA 2AA4A 5JVHL 3DM2A 1W7PB 3ASKA 2BHYA 1LE8A 2DMQA 1QPIA 3IKTA 3EH1A 2A08A 3CUQB 4DW6A 1YYVA 1EFNA 3CCQT 2IAIA 3SZTA 3QZ5B 1Y0MA 1P90A 2V9VA 1A6IA 1FMVA 2CS3A 2RHKA 4OP0A 5J1UA 4UQGA 3D5SC 2XG8D 2KPMA 3C2GA 1RI7A 2MYSA 5IT9E 2K9LA 1Z1DA 4EM1A 1Z9CA 3QWXX 1N39A 2JA7J 3FHZA 1H8AC 1K9MC 1B8IB 2KFNA 4DOVA 4LH4A 4E7JA 2EFOA 1OPKA 4M78D 1W0HA 1XOVA 3WTZA 4TSXA 3MK6A 2Q3SA 4KUMA 3HL2A 4E9GA 3KNTA 2X4YA 3ZR8X 1YUWA 4IG0A 4DLEA 3Q0WA 1KQ0A 3EAEA 4MO7A 1SV5A 1Z6TA 5L3EA 2EBPA 3FMSA 4XSZF 3PIPL 4M7AG 4DG1A 1LV5A 1NPPA 5KYUA 4C92G 4KNYA 3G6EQ 4KFBA 2EH3A 1NJIC 5EOYA 3WVDB 1YCYA 2E64A 5AQKA 2G8KA 2NYXA 1BW6A 1NGFA 3KZIC 2FOWA 4C2UA 3M0UA 3CLQA 3MCAB 5M1QA 1X58A 5JLHA 1W2BS 1FWZA 5BR8K 3OYCA 3K4NA 3O8HA 2QA4A 2COBA 2DLLA 1TK0A 3LSTA 2WACA 1ZN2A 1IXCA 2ITMA 5A2QO 5B1AH 2KXCA 4HUGA 1D5VA 3SQ0A 3CCQQ 2EZHA 2OZSA 2CG4A 3CCSA 4BL0B 3B6OA 3QMLA 4WFAL 1PVEA 4HV6A 4A6DA 2DBKA 2ZJ2A 3CZ6A 2BE5F 4J6WA 5FPMA 3A5MC 4DEYA 5E3OA 4BXXJ 3QBWA 1VQ4T 4FJJA 1IF1A 3LP3A 2EJGA 4IXAA 2L01A 4J6YA 1LDKB 4M3EA 1IH7A 1C6VX 3F6OA 5BMZA 4ME7A 3AGKA 3GCMA 3QEXA 4FZXC 1K76A 2CQKA 4PJOA 3VWBA 3DKYA 2YHBA 2GF7A 1A6QA 3V42A 1C0GA 1VQON 3G7ZA 5D4SA 2ZPHB 2IA1A 2HNHA 2KQWA 5ERIA 3A0IX 5I11A 4L9VA 1K6YA 3A03A 5GAMh 2QQSA 4Z89A 2IS6A 4JKAA 3WTTC 1J0RA 1TOVA 1KQSP 3F5TA 2RN2A 1U3OA 3UA6A 3GL1A 4C8MA 4YOYA 1ETXA 3ECHA 4FCYA 3ASNH 4AH9A 5D6YA 1YRNB 5K7HA 4YORA 1E2XA 2CUZA 1L0OC 4KH5A 3HJEA 1JCEA 1OCCH 4CO8A 4Z4FA 3Q3SA 1FLIA 1OCPA 2LK2A 2VQLA 1S5JA 2VWJA 2IC3A 1YI2I 2X85A 3QKJA 5HOOA 4EJWA 4RB2C 1EWRA 4GVMA 2KBTA 3CESA 1Z9QA 5KQDA 3FMQA 4BS9A 3JRIA 1W0UA 4DOWA 4A3MJ 3PNYA 4NC6A 4GLKA 1BR4A 3I5SA 3HVRA 4PFOA 1YITI 2I0NA 4D1QA 3TEDA 4KMFA 2R0QC 2A1SA 1TU0B 5HS9A 4A0YA 1YQMA 2ITGA 3P31A 1VQNI 1NGBA 3HZJA 3RR7A 2YHXA 4KHUA 2E7XA 4C9YA 4J2DA 3OYHA 3A8YA 2JQ7A 3LSJA 2HBJA 3HZ6A 2O4IA 4FJHA 3LM2A 2QXLA 2NOLA 4CCNA 2FRYA 2RJDA 5D4RA 2Y48A 5DUKA 2MGQA 4RTXA 2IVNA 3D2FA 1O1WA 3GZ5A 5M1KA 2M1BA 2YHYA 3V7CA 4IVNA 4PJOC 4NDLA 2FZGB 5GTIC 2HBMA 1HD3A 2H94A 1S1VA 1M3QA 2IGKA 1M1EB 2OJ2A 5KAFC 1I4K1 3PVLA 3VQ7A 4XOTA 3QPLA 1Y1WJ 1I3QJ 1FPQA 1WCMJ 4BQOA 1JEGA 2CMPA 2J5PA 4H0YB 1QVUA 3G4SI 4LG0B 1HR0K 3FHNA 1SF9A 4DYCA 4D7NA 3PUBA 2VOOA 1B34B 4AHCA 1GXIE 2QCOA 3FZLA 4M75E 2P4RA 2LFBA 5FD6A 1P7JA 1ZYRF 2I5JA 1JE8A 2UUCK 2OAWA 2DMNA 5E3LA 2A3SA 4RS8A 2K7LA 2IT0A 3G6EA 3A8OB 1K73R 4B3MK 2LRQA 1QQNA 3QO9A 4BREA 4GFBA 1K8AC 3O4WA 2QSFX 2B86A 1X3ZB 2KQ2A 3D1NI 4CF1A 1TSFA 3DXMB 3OS2A 1A36A 3O1WA 4F16A 1LDJA 1QVFM 2NRWA 4XLEA 1C0WA 2ZF5O 4RTTA 3FC3A 1J09A 3ZSYA 4QT7A 3JRDA 1WLPB 1VQMT 4HA8A 2HMAA 1JBMA 4R0KA 3CCQA 2XF5A 2RMOA 2BGCA 4FK0A 1T3SA 3FXRA 4MEYF 3KBGA 4KI4A 4M6VA 1K4SA 4FPAA 2NRZA 1P8ZA 4AD9A 1PRMC 1KG1A 3EHQA 5GJWB 4BD3A 2Y1JA 2EJRA 3RMQA 3ID6A 4DV7K 3PO3J 3BOQA 3TSPA 2Z1IA 3LAJA 2LY1A 3P38A 3GLLA 3A98A 1BR1A 1DGWY 4MTDA 3T1AA 3H1VX 1O13A 4J9FA 1RI9A 4F4KA 1D8KA 2VUBA 1XG7A 4YG2F 2J05A 2FLOA 1KD1U 3KZYA 2DL3A 2DA2A 3GTMJ 2IW5A 1Q82O 4BKXA 3L2WA 3EYIA 2CUDA 5F0XA 1WZOA 2MH2A 4OMPA 3F8BA 2ABLA 1N27A 2X74A 2YJFA 2OF7A 2DAOA 2I8DA 2DFIA 5HCKA 4OOIA 3HB9A 1BBZA 1FOKA 4MZMA 4H03B 3K9KA 4HNVA 1NK6A 3E3VA 2Z16A 4EIKA 2BZ8A 2PAVA 4HF2A 3T1HK 3BTIA 3FIFA 2LF8A 2MLGA 1KFDA 3H6ZA 2EIMH 2HXOA 4I09A 1HQEA 4XICA 1SFUA 3NVKA 1LKXA 3CXCA 3OYYA 5DM7L 3P1GA 1JTYA 4M75B 3CCJT 3CYMA 1YJNQ 4GV6A 2L3RA 2IS2A 2ABKA 1NJIR 4YOVA 1U8BA 1QWFA 2WWYA 2OTJQ 1MUYA 2RC4A 3TL4X 3C7NA 4DFKA 4CEZA 1OH7A 4HF0A 3CCMI 4B1XB 1YT3A 1M2OA 3IQLA 4KT5C 3O3HA 2V9KA 1VQLN 4BG8A 4M72A 4RCCA 1K8KA 5GAN4 2W6LA 4CJLA 4LLLA 4WWCA 2H09A 1UECA 1VQ4A 2ETJA 2P9NB 2M2EA 5KYWA 4CCMA 2QI2A 2E70A 5F2RA 4F7ZA 3C7JA 3U9DA 4DBHA 2JMCA 4M78F 1G3TA 3CETA 4Z02A 4M77G 1HNVA 3WXIA 3CJBA 2BV6A 3WTVC 5AQHA 4KMUX 3CCLT 5BN9A 4B8AB 2QM3A 1RT5A 2F5FA 2NLUA 1YJWN 1M9SA 3PFYA 5FROA 2VKEA 1S1NA 1LCUA 4XAXB 4E19A 2HWVA 2HPMA 4JS5A 1M90R 3SUOA 2F5EA 4YNQA 4O55A 1BU6O 2XROA 1REVA 3GNGA 2LTOA 1NLVA 2Y4XA 4EMKB 5J1EA 2YX4A 3IHOA 4WXHA 5IT3A 4HQMA 5EX5A 4KB1A 1NBWA 5J39A 3JYTA 2IEKA 1WXBA 3M8SA 1P4XA 2M87A 3GTOJ 2ZMEC 3CCJQ 4ZN1A 3DKXA 1FKPA 3OA9A 4Y1DA 4H5RA 1LWVA 3GPLA 3AV9A 4FJKA 4FYDA 4RCHA 1AWXA 4FT4A 3VQCA 3NHGA 3V9WA 2KVQG 4L18B 4CZLA 3OSSC 2CZ7B 2A42A 2FF6A 3I59A 2FPFA 1HKGA 5HLHA 1XQOA 2LYCA 1RGIA 3RMCA 2PUOB 3FHGA 1WHGA 1IKXA 2QGFB 3S41A 2PVDB 2Q0RA 2RREA 1GLBG 2ZM6K 5E26A 1PYVA 2FBVA 2Z1GA 3FXJA 2LX7A 1Q81C 1MKMA 1YQAA 4MDBA 3MCPA 2MAMA 2O9LA 3HUGB 3EPZA 4HZFA 3NCIA 1RILA 2VG5A 5D3GA 1GHCA 3H08A 2NAZA 4PDKA 2IPQX 1W2BM 3I64A 2GA1A 3CCLQ 2DNUA 3V8KA 3W6JB 3CP2A 2YT6A 1QP3A 3QBYA 2FBXA 1QQOA 5GAN8 2W24A 3CC4T 2E4HA 3PM1A 2X4JA 4RTVA 3U9ZA 3VF2A 1Z6RA 4JAXA 3D6RA 1Y64A 1T8IA 1QQCA 2DD4A 1H9TA 1YX5A 3JREA 4KTQA 3SEQA 2F5DA 2L3QA 2J6KA 1VUBA 3W2VA 1BK2A 5LY3A 1Y39A 1MJAA 2YLCA 2HKNA 2CSQA 4A5AA 1Z77A 4LDWA 4CE9A 4EJVA 5M1FA 4F2RA 2RB6A 2YUSA 5EGOB 5GAOp 3CG7A 1UCRA 5FKMA 3ZPLA 2RNJA 2NRAC 3BCAA 2LNBA 4E70A 3GX4X 3IS9A 2CH5A 2DKGA 4IWVA 3KK1A 2NOZA 4BR2A 4IPAA 2L9NA 1BR2A 3KYDB 2A3LA 3BG3A 3X24B 2OTLN 1QMCA 3E6CC 3R8EA 4B4CA 3PNTA 4E7HA 1WJQA 2Y9ZA 4XRMA 1LVKA 4BJ5C 4B23A 3QDFA 1R1VA 3HBTA 4FZYA 2YI1A 4Y4RA 2OTJA 4M77E 4BRDA 5B3SH 4LXCA 1F43A 2XPWA 5DCFA 4QVDA 4WFBL 1U2WA 2IXSA 2RHIA 1U5TB 4E9EA 4XH4A 2DOEA 2FF4A 2YRDA 1FMWA 3Q0VA 2P5LC 1ODDA 4B8CA 3HRTA 1U2VA 2WOMA 3SQ4A 1XMXA 2P0WA 3BZKA 2JLEA 5KAIC 3MXJA 3T3FA 3S93A 4PJOG 3GF2A 3MP6A 4C2MJ 3BTJA 2R7DA 4C0FA 3VMFB 3PL8A 2QSHX 2ID6A 3I4PA 4YY3K 2VE9A 4KN7X 4X65K 1JKOC 3KEYA 2P9IA 4ID5A 4OAZA 2BEOA 5LGTA 3ER0A 5GMKm 4JI4K 2KI7A 3IH2A 2YXYA 1NGIA 5C44J 2MABA 3QDKA 3M8EA 3L3UA 4IX7A 1JO8A 1GVJA 1FMKA 3SCXA 5J2QA 3O3KA 2M16A 4EJOA 2DVEA 3PMIA 5LJ3f 3MKWB 4CZFA 1HJDA 1ZX6A 2LKXA 1YWPA 2L9VA 2CGHA 2HAXA 3TAEA 4LNPA 2G8WA 4DV3K 1SEUA 4F52A 3RCOA 4ZZLA 4D7MA 2UXNA 2WB1A 3KD1E 2M4GA 4RA2A 1YWOA 2RHUA 1FT9A 2FRHA 3CCJA 4M6XA 1X6BA 1QA6A 2FZKB 5E20A 3JRZA 4AWXB 1GLFO 1E0EA 5AQOA 5JS1A 4Y3OA 3KHYA 1IN5A 4RBOA 2EGAA 4D9JA 4NBQA 4HYEA 4CHOA 1TGOA 3OW2A 4NLCA 3A01A 4LGWA 1BI1A 1R4MB 1QHTA 2D8JA 4EJTA 4AVPA 2EWSA 1HYOA 4C5IA 3ZEUB 1TXQA 3DLGA 2P9SB 1VQKN 5FU7C 2MCNA 4G12A 1WHHA 3WU1B 1I39A 4ZN3A 2UUBK 4B9QA 1H3ZA 2KFDA 1WJ5A 1HW2A 3VYHB 3JAMK 1EH8A 1YIJQ 4M77B 5IHKA 3GVAA 3M3YJ 3S1NJ 4O8KA 1VQ7T 4LD5A 3CCLA 3NFAA 1BB9A 4GCVA 2Y0SA 3IUCA 1BGXT 2GLOA 3SQ2A 2F8SA 1LEBA 3KWIA 1M1KU 3DP7A 3OYLA 2LQ8A 1MZBA 4BY6B 1BA5A 2E5KA 5IPAA 2VL8A 4EAHD 1Y6IA 4IG3A 3FFKB 1WSFA 3H9NA 3FBIB 2NUPA 3HVTA 4A0ZA 1HXDA 3NWTA 1U1TA 3NH0A 3VS0A 1T05A 2P9UB 4MZPA 3AA4A 2RV8A 4IKFA 3JB9I 3EGXA 3KYLA 3M0QA 4HEA2 1B9NA 4XKVA 3E2UA 4RTZA 3HC7A 2L4AA 3UR3C 2P7CB 1JTXA 4KHWA 4BRKA 4VUBA 2E10A 3CMEI 1ILYA 3KZZA 2QAZA 3OSGA 1NNEA 3VTIA 4BRQA 1RLPC 4ELUA 3RZDJ 3H9JA 2K3FA 4W97A 2NWMA 1BOTO 5M3MJ 3LAKA 1I81A 1TAUA 3UT1A 3J81Z 3EGUA 4AFZC 4KUDK 2ZO4A 4BXUA 2LKPA 3CO7C 1LE8B 1K4US 3G71T 3AVBA 4DUZK 1X3MA 5K7FA 2NVQJ 3UNGC 4WE1A 1R5GA 1IG8A 3PJRA 4JX4A 3GG4A 2XAUA 3R1XA 4QVCA 2VIXA 1I5ZA 2A05A 1TTYA 4GO1A 1T3VA 2P9LB 3OS1A 2HOEA 4MNUA 2F1LA 2VQCA 1MNEA 4CEEA 1HSJA 3K7AJ 2R58A 3UKUA 2R5AA 4FIBA 1GLLO 4QQDA 3IRXA 3EEQA 4CFDA 2DL4A 1VQ7Q 3OSVA 4JRIA 2KISA 1JHFA 1VQPN 3AHUA 4CHPA 1SKWA 1AU7A 3HT3A 2EIJH 2A5YB 3HFNA 1KVCA 2BZTA 3ULDA 3TR8A 1GCQA 2FUG2 1OULA 2JWKA 3E6MA 2GGRA 2KRHA 5E8IA 5AQQA 4PJ0C 4MLOA 4IZZA 1K78A 1OVQA 1JKHA 2H3GX 2QQ8A 3Q9VA 5HVQC 4CJ5A 5ADXH 3VRZA 4IOCF 3EG1A 2VONA 1WBDA 5BPLA 1MMDA 2TDXA 4HX8A 5GAN6 1ZAOA 1HKTA 2QBYA 1XCVA 2RPNA 3T7ZA 3R4KA 2LC4A 1VQNT 3EG9A 3PTAA 1P7MA 1WYXA 3T9NA 3O6BB 2IOCA 4AHRA 4NOYA 2FQ4A 3QSUA 4DV6K 3QJYA 1XGOA 3CMMA 3VU3C 4CI0C 3L00A 5M5YJ 2GEMA 2I5UA 3DLKA 5M5XJ 3H5NA 2CDTA 1KFSA 3TPQA 2ZNZA 3K9JA 4H0PA 3F10A 4FWRA 3KLGA 4OB2B 2V8KA 3K4KA 1GT0C 1S3XA 1T56A 2CREA 4RAZA 2ECCA 2ZPIB 4II2A 2LT4A 3UKRA 2R7VA 4WCIA 1RR8C 3A4CA 4XU2A 3A5OC 3A8HB 2WAQA 1RAIB 4DSKA 4BQAA 2KZVA 1ZKGA 1ETYA 1OQKA 1VSHA 4OIQF 2O01E 2YHAA 2Q2RA 4YELA 1KSPA 3PSFA 4BDZA 4LFUA 4B3XA 1YI2Q 1KG5A 1SVLA 4YFUA 3ERMA 1YIJA 2Y69H 2RHYA 4CBUA 5KQ8A 1Z7UA 3CMAN 1I1SA 2BUPA 4B24A 1GCQC 3K4MA 4BRGA 4QAGA 3ZT0A 1YTAA 1WAFA 4DTRA 1OMIA 4Z4CA 1YITQ 3LDPA 2HGCA 3DWLA 3HI0A 1LCKA 2QASA 3EN9A 3JW4A 1IXRC 2NRVA 3OY9A 4EV0A 2UXDK 1VQNQ 3F22A 2EQUA 3VEYA 4KGXB 1SKSA 1E3MA 1BQMA 3ULEB 3CFRA 2LD5A 1O7FA 2F2EA 3MEUA 4IQJA 2E2QA 4CC2A 1PKSA 4X9DA 4C3JJ 1RTDA 5JICA 4OB0B 2BY2A 2VXFA 1XJWB 2DPNA 1PCXA 2GTDA 3CXCP 1W6XA 3A5LC 4M3YA 5FLXO 4NC7A 3RSNA 1N6AA 1R36A 2EVRA 4BRPA 4B3AA 3L2VA 2GZWA 3M8JA 1Y8RB 5ILUA 2A6AA 2E5NA 2OUMA 3MXMA 2QK0A 4MQ9F 1I1JA 1VNDA 3AA5X 3G4SQ 3D45A 2A37A 2ZJPL 5CHZA 2CP0A 5DM6F 3SBTA 1LWCA 2LCLA 5KGXA 1QVFA 2L7ZA 3QOEA 3LFKA 4M73A 4ZH4F 2KIUA 1WEIA 4LB5A 2B6AA 3IL2A 2K2VA 1SL2A 3L1AA 5B1BH 3BR0A 3IRRA 4MGRA 1KO9A 3SQNA 1N78A 3D2FB 5FJ8J 3OH6A 2KJBA 3HTVA 3LH0A 1VQ7A 1IGUA 2ZXJA 2JT1A 4MZTA 1RDAA 2P4WA 1KQ8A 5CCAA 1IDYA 5HDKA 4IZ9A 2RA2A 4M71A 3KP5A 4EMSA 2X9DA 2W10A 1F21A 4LSLA 4A62A 1WSEA 3LSGA 2GQIA 2DQLA 4NS5A 1I07A 5M1OA 3FBNB 4J9IA 2NUBA 3EYYA 1G8XA 4FLXA 2JSCA 2QF7A 3CCMT 4M7DC 2FSNA 1WHJA 1IZ1A 4XIDA 3I0XA 4DF8A 3DTKA 4CK2A 2X35A 2RPIA 1SC7A 1IJJA 1WGSA 3TO6A 3MDQA 2P5OA 2KKOA 3U4LA 1PSFA 4F91B 1HRHA 4H0XB 2JPCA 1TZLA 3G1OA 2JOYA 2DXBA 1C1BA 4CJSA 3D5LA 2ZXHA 1XGNA 1QSYA 1UHFA 4XU1A 1YHQN 4CEOA 4WF9L 1VQ9N 4KPYA 2LREA 3BY6A 3WNHA 5BPNA 3MZYA 2M51A 4U88A 2CV0A 4NUBA 1JJ2S 3VESA 1VQOI 4UUSB 1UTIA 3T5XA 2JPBA 5DMRA 4E1MA 3KP6A 1GCPA 3G71A 1CZ9A 1KC8R 4BXFA 3CCYA 2DA3A 1WJBA 4E89A 4X6AJ 4ZHRA 4ATOA 3CD6T 2KEAA 2LCCA 1BYMA 2KRSA 2E2PA 2DMPA 2NOHA 2YHTA 3CCVT 1UFFA 3TDZC 3QPTA 2EYWA 4IUTA 2EYZA 4LFBK 2E1ZA 5M1PA 3NH1A 2V1XA 1TUGB 4XRFA 4OMLA 1O4XA 4HDVA 2GQVA 4CC4B 2CS7A 2WUSA 4XK4A 4KV8A 4A2UA 2BXYA 3UWNA 4EGZA 4Y7NJ 1YI2A 2O4XB 1FN7A 2HSTA 2P9KA 3U9GA 4KBOA 1WJEA 3I56T 3WHBA 3RR6A 1RL2A 4MQ3A 4RTYA 2BY0A 2FPEA 4IUQA 2KROA 4CECA 3CCMQ 2AP1A 1PC0A 2V8IA 3VFZA 3KX2A 1A0NB 1IJWC 4BRFA 2AT1B 3WXLA 4BY7J 1YITA 4CA0A 2YCHA 1WPKA 4PSWA 1HLUA 4CYCA 1Q82C 1D09B 5FPEA 4ESJA 1VQNA 1R8OB 3B02A 5CKDA 4UHTA 1HJRA 2NOJB 4M7AD 3HKZN 2XU8A 4C92D 2JA5J 5A2QK 4FL9A 3PO4A 4IOCL 1RABB 1I50J 1QVGM 2FSKA 1UG1A 3VA3A 5ICFA 2F4IA 5DS9A 3PSIA 2XGEA 3I4MJ 1RBUA 3CBPA 1YLFA 1VQ5T 2VLAA 2HXIA 2NOIA 2M9UA 1DKGD 4JYKA 4FWPA 1HKSA 4PKGA 3TREA 5EZGA 5KCHA 3C7NB 2COZA 1KU2A 3LLRA 3CD6Q 3P5JA 3RYPA 1ETWA 2ISYA 4H5TA 5C10A 3JCMW 1KLMA 3CCVQ 2IIRA 1ZGWA 4O3MA 4A3GJ 4MDXA 1SEMA 2BDPA 1WVRA 2DERA 3IC7A 3QZ9B 5KYWB 2C0OA 4BWMA 1M2VA 2E34A 1VSMA 5GMKl 2XAJA 3DLEA 3VQDA 5J3LA 4OMOA 5FW9A 2QEXT 4M45A 1I5LA 5GAOr 4BHCA 2R5ZA 1W2BA 4AI5A 3HKSA 2E1CA 3NGIA 3CCET 4E7KA 1SD5A 5E84A 3CC2N 4DF4A 3LWLA 2W00A 2QWMA 2D0QB 1MBFA 2K9GA 3PQJA 4CFBA 3AO5A 3MX5A 2PEXA 3J80O 3J81O 1T6CA 5I2MA 3PMTA 4JEPA 1JJ8C 3KLFA 1SAUA 1AZEA 2GIZA 2F4VK 1B4AA 2H56A 3G10A 2DMUA 3I54A 1ON2A 3MEAA 1RT3A 2CP2A 2BUDA 1KVAA 3J8AA 1NWKA 2PYJA 1OKRA 3HTRA 4LMYA 2ED0A 2ZPFB 2BY3A 1BL0A 2KSSA 1R71A 2H8HA 4LIUA 4FTHA 5CZ2A 1GVDA 2VXEA 1VQ5Q 1RPWA 2MH9A 3QNOA 4EJZA 1NGDA 4DYQA 2D6FA 1UB9A 4N0AA 3SEZA 1SSHA 2Q1NA 3I0RA 1ZUYA 1XS9A 2RF0A 5GAHJ 4BY1J 4CHZA 3ID8A 3I59B 5JHUA 1X69A 5LHGA 3P8BB 3KLOA 1S1WA 3KK2A 4QCLA 3OW2P 4KHSA 2VJ5A 4IO8A 4CD1A 2X6YA 5IYBJ 3H0IA 1RCHA 1W0TA 2HBWA 3SMPA 3VW4A 2ELKA 3NQOA 3AO2A 1X9MA 1K9MU 4EFHA 3FJPA 5GAHP 1XMQK 4ILGB 4Y1CA 3L6QA 2WBNA 2QEXQ 1VI0A 3S16J 2YV0X 5ECAA 4XH5A 1RR7A 1XI1A 2W03A 2V51B 1MBJA 3EUHA 4JYAK 1ZRDA 3SV4A 4CBWA 2DPPB 4IHWA 4GGGA 3VRYA 1WGXA 2GX9A 4FT2A 1DEJA 2O8DA 4IUVA 2IVPA 3WGHA 2JTEA 2PFUA 2EIKH 1SFKA 4Z2YA 5F08A 2AO9A 2C0IA 3AO1A 3MQ0A 4AFSC 3CCMA 4WX9A 1WHMA 2HL5C 4CGIA 1NJIU 3NGZA 5LMUK 1RKTA 4O8UA 3DYAA 1OYYA 5LJ5j 2BGGA 1ASUA 3JRHA 2ASPA 2D1HA 3BDLA 3I0TA 2WADA 1VF9A 4II3A 4Y15A 2P0KA 2YNFA 4KN4X 4BUPA 4RWTA 2VBWA 1OYXA 4DHYA 2B5JA 1XHXA 4XU0A 2CUBA 2RQPA 3OYAA 2DTRA 4N0AC 1ZH5A 5I9EB 2A1RA 1YOVB 2XAGA 3AL0B 1XDSA 5E1WA 2LC2A 4DS5A 1WNLA 1YJWI 1WA7A 1X1PA 1ZYQA 4GDFA 3VEPA 1X3NA 1TW2A 1ATNA 4IHXA 1VQ8T 3VUBA 3ZETA 2BIVA 4UOBA 1KJWA 2KJCA 3CD6A 4RTWA 3ZMUA 3KFVA 1KAZA 3H3NO 3CCVA 4P5NA 4HSBA 3K70C 1VSDA 2WAFA 1RETA 3AFHA 2ZPGB 5IH2A 4M78E 5CQXA 9ANTA 1T0FA 1TBXA 3JRCA 1AWCA 1NGCA 4CZCA 2KYBA 3BW1A 3LP0A 3QB0A 4M9ZA 4GV3A 3CCRN 2IA2A 4NCBA 3FK7A 5KCOA 3V9UA 3MMYB 1UHSA 4FWMA 5JVTA 4OF1A 3BPXA 4BR9A 1QKWA 3FXQA 3C18A 4A4HA 2PYLA 3WQUA 1RBVA 5GAMd 1B7TA 3OBWA 4XN3A 5H20A 2XPUA 1VQ6T 4DOZA 2V4JC 1V54H 4C5EA 3LQRA 4NYFA 3R9PA 4IDHA 3WE3A 5AN4A 3TWHA 1HQCA 4I02A 3REOA 1NJZA 1R6RA 2QWNA 3LDOA 3U8XA 4HW0A 3BDPA 3AARA 2Y0MA 1J9AA 2GIVA 2WBMA 3CC7I 2W4SA 3SPZA 2Q0OA 1QP2A 5B8HA 4OB1B 2X78A 5HLFA 3ZT2A 4IIOA 1C0MA 5BRDA 2PG4A 1GOBA 3RRHA 1Q82R 1VQ5A 4M3WA 1O75A 2JJ9A 2C0TA 4J9HA 3AAFA 4BEHA 1IG7A 1AHJB 2ACJA 4UB8C 1ZBIA 5GAN5 4DUYK 1OZ3A 4CHQA 5IWAK 4A3KJ 3NMUA 3A1PA 4KTWA 1WH7A 1EIFA 4FM1A 2Y9YA 3G73A 4XLPF 4DBQA 1IN4A 5IYCJ 4X1VA 3M4GA 4BRAA 4B08A 1YS7A 3R61A 4PKCC 4ABZA 1LOTB 4HCCA 4DTJA 2A3ZA 3PNWC 1A5WA 3HOWJ 2E2OA 3HOSA 1P59A 4BI8B 3EHRA 1MMAA 3W2WA 1T0FC 5EZHA 1X01A 2QEXA 2FBKA 1S72T 1B72B 4W1UA 3LDSA 4YDUC 1GV2A 4KULA 3M0PA 4PL6A 1S22A 1U6ZA 4FJ5A 3Q1JA 3T8TA 4A5MA 1ZBXA 5J4VA 3CDHA 5LHIA 3CJ7A 5DLQE 4M78B 1FIAA 2OTLI 3DLLF 1NHAA 1HW1A 2HNDA 4LOCA 3P8DA 1NLOC 3VQ4A 3MCZA 2BW3B 2WSFE 2HEQA 4W5OA 2NUPB 4RLQA 5HK0A 3CPWM 2H3EB 3F6VA 4M7AF 2KTQA 3TP0A 3FF5A 3K4CA 4C92F 1TL1A 3G1JA 3REBB 4MMLA 2X1CA 3P9IA 2D4WA 4CH7A 2LTPA 1K8AU 4EGYA 3F72A 1XN7A 4M41A 4M74A 5L8RE 5AZJA 2YRVA 1DT9A 1MUZA 4CGZA 2D0AA 1WB9A 4N4OB 1IKWA 2R7FA 2HYJA 4A53A 3ZSXA 1JCGA 5AFUA 4CK3A 1WI9A 4JJDA 3G6EN 2EV0A 1Q7YO 2M5WA 1GLCG 5HROA 5CE3A 5HP1A 4LJZF 2JUFA 4MDWA 5IXFA 3J7ZI 1LVAA 1HNWK 1QVFP 1HX1A 3T8RA 1V4TA 2BVMA 2ZXIA 3O6WA 1NLPC 1DPRA 1S1XA 1WUAA 2VYTA 1MJBA 2JN0A 1RTIA 2AQFA 3HRMA 2XK0A 2RI5A 1RI0A 1ZSZB 2HB5A 3FRNA 5GANg 3UKUB 3QEPA 1JXOA 3LDQA 3CCQN 4F7UG 1KQSS 1IKVA 4PKHA 1ASVA 2OCEA 2JUCA 3UPUA 2EQJA 6AT1B 2KDOA 1ACIA 5LJ5f 4G6TB 3C0BA 3VQ9A 2JM8A 1NG6A 2HDWA 1OISA 2ECBA 3IRQA 1XWLA 1GXQA 2E35A 4CJTA 4A54A 1OYWA 4Z4GA 1LWEA 1K78B 4HX4A 3HSBA 4A3FJ 4IBNA 1NKCA 5AIQA 2CKKA 4DSIA 2VASA 1E7OA 4FLZA 4G8XA 3WXKA 4CIFA 4AHVA 3EG9B 2PU9B 4M3DA 4CEFA 5KYYB 1MJ9A 3JCMg 2XVCA 2XGCA 4ESFA 1VQKI 2OPQA 3SI6A 4Z0UA 4NXMK 3BLYA 3LYIA 4E3SA 1U4BA 1HYSA 4HAMA 2OAUA 3I4NJ 2LJ3A 3P39A 3CERA 3OGDA 4MO4A 3FZVA 4JI3K 4RG8A 2KAFA 2O8BA 2Q0UA 3M55A 1V5EA 3OJUA 3FIWA 1K7AA 4MFBA 1USSA 3HEFA 1BG3A 5LJ5e 3RSEA 2LQWA 2VWKA 1T2KA 2HR3A 3L7WA 2QWWA 4EVVA 3UKRB 4CZGA 1Q9XA 1T6DA 2CW8A 3N05A 1U3EM 2XY6A 3ZL7C 3LA7A 2NRHA 1UHWA 2IDOA 3AVLA 4XKBA 2MD5A 3JRAA 3H5RA 2W04A 4E9HA 3LSMA 3RI4A 2M7BA 2N8GA 3VPRA 4F9OA 5F0FA 3EZWA 1KHIA 1SHFA 5L3BA 1R0BG 5KI6A 1I8FA 1VQ4N 4OB3B 4FJNA 4PJOD 2O9VA 2E6ZA 3H41A 1R7JA 1T39A 4JKDA 1AOYA 4G7HF 3SB2A 2K27A 4A2BA 4JS4A 2X9HA 4IHTA 1KA8A 4QOZB 1SFOJ 3INZA 4FWLA 3LWFA 4JRPA 1AWOA 4C30A 5I42A 1UJYA 4HBLA 2VE8A 1SFXA 3OR1C 2K9MA 4AM7A 3OJSA 2A07F 2O8FA 4EM0B 1CF7B 1PRLC 4DV4K 1GUUA 1J75A 1RT2A 2Q1ZB 4MLEA 2HBLA 5AJ3K 1NJXA 2WA0A 3MEVA 1ZR4A 4CZKA 1HMVA 1XSVA 5EEGA 2XDDA 2WY7Q 4J6XA 2FO0A 1NMNA 3THXA 5CR2A 4XN0A 2Y4YA 3DEUA 2ZB9A 5DTDA 4GNIA 1VQPI 5LD2C 1HLVA 2CZ6B 3CQTA 3K5MA 4OMQA 2UWMA 2KRFA 5LRSA 2HU9A 2DDAA 1WJAA 2A69F 5JHFA 4N56A 3HSRA 2DJIA 1Q81U 1J3TA 2LQNA 4YEJA 3A0HC 2Y2ZA 4H0OA 1HKCA 1D8JA 1T3LA 4B09A 1IZ6A 1KQJA 2M1HA 2IVOA 2DA1A 3TW7A 2PJPA 3OYIA 1FOYA 3J7AO 4JI0K 4BQNA 3CCUT 3DCFA 3I53A 1D5AA 4RM3A 3QUIA 5D6XA 5GMKj 5AQXA 2JXBA 2K79A 1FTTA 3THWB 2ZFUA 4MHGA 1ZHIA 2EFWA 2K3XA 3QAHA 3KP2A 4BE1A 3F9KA 1X2NA 1W2BP 4XK8E 3GBQA 1WHLA 3HYIA 3HP9A 1HKBA 3J7ZO 1VQOQ 4F17A 2KE9A 4N4IA 1BA0A 1JRIA 2FEIA 1T0HA 3ZMZA 3M0TA 3L2QA 1S8NA 2FL7A 1RKWA 2X1EA 1SAZA 2LBFA 3DRPA 5IT9O 1W9HA 3OR2C 2RH2A 2K40A 4IIMA 1HA8A 2HVHA 2EBIA 3RVCA 3H5AA 3RQ4A 5JFRA 3DLLA 4L3QA 1QGPA 4AM3A 1X1CA 1O3QA 3CJRB 1P7IA 5LHHA 1DPUA 4RW4A 3QESA 3HRUA 4M7AA 4II1A 4C92A 2WC9A 1XDUA 7AT1B 1JL2A 4LE9A 1XNIA 3HOYJ 2NNWA 3I71A 1N8RO 3E5QA 4N9HA 2GOMA 4BU2A 3ZT4A 4Q0BA 1QVGA 2D5RA 2P6TA 3BJAA 2JA2A 2K3PA 1NMDA 2FBTA 1LAWA 2IG0A 3CW7A 2VV5A 3FEOA 3DMJA 2EZIA 3QDRB 3O9TA 5E41A 1J9IA 3CMAI 2B63J 2J06A 1FYNA 3BJ6A 3R60A 1HYZA 4CJ7A 4IFEA 3N4PA 5LGNA 4IHSA 3CCUQ 4DTOA 1JL1A 2EQIA 4KH0B 3AVGA 4A6EA 1I6XA 2RF2A 1IN8A 1MA9B 2M0OA 3DOLA 3VENA 1GBRA 1S29A 1QCNA 1KGSA 2PBIA 3GDQA 1SUQA 1VQMN 1M1FA 4CZHA 1OYIA 2E4LA 5BPMA 1YO5C 5BRHA 2AKLA 5CQGA 2VKDA 1MUDA 2RM4A 4N76A 2X6XA 5KN9A 2DBBA 4BR4A 1ONVA 2P9KB 4BQQA 3LP2A 2L02A 2G9WA 3C6HA 4G7ZF 4BWJA 1N3AA 3URGA 1MBGA 5JVGF 4I0AA 4PIIA 3OYEA 4FWOA 1ZGJA 5A2QZ 3JB9H 3MN9A 1PUEE 3EG3A 4XTWA 1QSLA 2DZ9A 4Y91A 3K2AA 3S6IA 3CLOA 4DQ2A 3DPUA 2ENMA 4CYCB 1C1CA 3DB3A 3K1PA 4I2PA 5FWBA 3H1QA 2OPPA 2DK3A 1N36K 4CESA 2VUMJ 4BROA 4M3XA 3OTOK 4YTLA 2CP3A 4B1UB 5AQTA 2DTOA 1IBMK 4EA5A 3VS6A 1H88C 2J6OA 1RLQC 2XC7A 1PUFA 2F6CA 2MA3A 4XORA 2XKOA 4GMJB 2JVHA 4OIRF 1HCRA 3HPGA 1E3OC 4NXNK 2E1MB 3N5NX 3QWYA 1LUJB 2LKSA 3GTKJ 1BO5O 2ZWHA 2D9TA 2WB1N 2WFBA 4N0BA 3VOEA 3M56A 1FY7A 3X25B 4C8OA 1ACMB 1IV6A 5CHIA 2QDLA 2EQMA 2RJEA 3QXEB 4DFMA 3EGDA 1K9AA 3K9TA 1K0SA 3L9FA 2V7ZA 1CZAN 3PT9A 3HO1A 1VQLT 2C06A 1TUUA 1R0CB 1UFMA 3VS1A 1OKJA 2UYTA 3PO2J 3CF5L 1TC3C 2FG0A 1Q1VA 1ETKA 2HSEB 4KI6A 4A59A 1FK9A 2E2NA 4CF0A 1M2VB 4HG2A 4KTZA 1ZC6A 4FM4B 1VQ9I 1MPGA 2W1OA 5DLOA 3AG3H 3QEWA 3TSUA 2NRRA 2R4GA 3EE9A 4DV2K 4AFUC 1VQOA 3O9UA 1LPLA 2BKDN 2E1OA 2X6WA 1VYUA 2FXAA 3AVJA 3NAUA 2VOPA 4OLBA 5CLSA 3V8LA 4JKFA 2Y0SN 1ZBJA 5CYVA 2G3RA 1W36C 3HRSA 1T0JA 3KK3A 2AS5F 1Y96A 3SUNA 3THYB 3CTAA 2QK9A 4RB3C 2BE2A 1IBLK 1JLQA 5CVIA 2FXUA 2JWLA 3KETA 5GAN7 3FXUA 1BN5A 4XM3A 1TWBA 3CO6C 5TKWA 2JA8J 4NL2A 1KTQA 2H6BA 1L3UA 3NRVA 1TWFJ 2K5IA 3ENOA 3QICA 2M0MA 5CZ1A 1PG5B 4CEQA 4H4OA 2QKBA 3VDXA 4JHDA 4FJGA 2E6NA 1M1KR 3PY8A 2XKOC 4JKEA 4ZYEA 3DXKA 4CCKA 3K5NA 1K1ZA 2CP5A 4RUGA 3BE3A 2Z3YA 1YJ9I 4HF1A 3SEMA 4HV5A 4CGJA 2IP2A 4XLAA 5TRDA 2L8DA 1VQLQ 3ROUA 3TANA 3RTVA 1P4AA 3CCUA 3SFIA 4H4MA 3KP4A 3NHNA 4FK4A 3IAS2 4KHPK 2H1KA 5IOYA 3WTSC 2EJ9A 2K3BA 4KT0E 3JCMb 4WYBA 4RAYA 1RUOA 2BZYA 4AMCA 3BY5A 4PJOF 2XHKA 4DTPA 2KZZA 3JCMV 4F93B 4LC9B 4FWSA 1SD6A 2RO0A 4FJLA 2K57A 3ABLH 5GIOA 3RYRA 3MP1A 1YJWQ 3VTHA 2O8DB 5EG0B 5BRFA 2Z33A 2JRMA 2XGXA 3U21A 2O8CA 1TNTA 3SFMA 3BC8A 4R79A 2JUGA 3CC4N 1UG2A 1TWGJ 1RUNA 3WUHA 5E8GA 4AIAA 4AYBN 1ZG5A 3ZBDA 4E7IA 4S04A 1JXBA 1MBKA 1IV0A 2PY5A 3G25A 4KHQA 3DJCA 2HHVA 4DGWB 1YQLA 2G8HA 3NMZC 1VHXA 5HL7L 5DDGA 3GUDA 1FSHA 3HOUJ 3NFCA 4IFYA 4UB6C 3HJFA 1G2HA 2E1YA 4MO5A 2EK5A 3CJNA 3RZOJ 4OGEA 3JSMA 3CC2I 1SG5A 3DTIA 3BR5A 3DFGA 5F1XA 2AXTC 3BG6A 4EQQA 3EFRA 1E3PA 4P9UA 2Z1JA 1KQ1A 1POGA 4XNFA 3ZETB 1O3RA 3JCMc 3GNFB 5K1YA 3PFSA 4DA4A 5M3FJ 1Z67A 3CDLA 4XTYA 1JGGA 3JB9G 1XC5A 4ZGEB 2YR2A 4ENMA 3MWMA 3K58A 1WSJA 3SYTA 3FB9A 4YOTA 2H27A 1WPYA 4QQGA 2F4MB 3GTPJ 4ZDOA 1M4ZA 3SZPA 4HT9A 2CH4W 2DT6A 1N5ZA 4FU6A 3JRBA 1EETA 1SMYF 2HPIA 1TQPA 4DKWA 4RG2A 2G7HA 3ZQHA 2HNYA 3MEDA 4OO1J 4WFNL 4A93J 2VKNA 4JP0A 3GMEA 2DBMA 4LDXA 1FSEA 2UU9K 2EV6A 5L3FA 2RKIA 3CPWA 2ZZDA 3FKIJ 2BH1A 3LPUA 4W5QA 4M4ZA 1XMKA 1Z7LA 3BUZB 5FU6B 2ZC2A 4A57A 4XIUA 3ZQCA 3HL8A 1ETOA 4RCBA 1PU8A 2XPVA 4L5GA 2K9NA 1QKXA 5EEHA 3MEEA 1W1WE 1KZHA 4WF2A 5J6XA 2VI6A 4C5GA 4B3OA 1HNIA 3O9RA 3H3UA 4P96A 4IRIA 2FHDA 1W70A 2FMLA 2OTLQ 4BEHB 4XTZA 5E1ZB 3AVFA 2FSJA 3K5LA 4C8QC 3TABA 2JWTA 4KGVB 8ATCB 5T7BA 1WSUA 4QTRA 4IO9L 5CIUA 1RAFB 2F5TX 1RUWA 1Y56A 1JXSA 5AQJA 1LOJA 1VQLA 1KVBA 1GV5A 2P9PB 2VKHA 1IDZA 3F0CA 2DMOA 3N97A 3J80K 3J81K 5KVRA 2K86A 3VODA 1A35A 1NPRA 5I22A 4H0VB 5D7UA 2QVOA 3KPHA 2NUTB 4L9TA 4XH1A 3E66A 2B9SA 4BC3A 1MBEA 4I2OA 3R0JA 4DQIA 4JX5A 3K59A 1YJWA 4UC4A 2YNHA 2HS5A 3MFKA 3KIOA 5I3UA 2DT5A 3RKQA 2QA4I 2R7UA 4LD9K 1K73O 4NCAA 4XOPA 3WU0A 4CJFA 1BOBA 4HNUA 1WJCA 2LF7A 1IXSB 4K8XA 1A5XA 4ELVA 2LMJA 3SFZA 1J7KA 3TMOA 4C3IJ 2H6CA 2VQHA 3CCSI 1NK2P 1MWKA 1YW8A 4H4KC 2PQWA 3WGGA 1HQUA 2E5QA 2YUNA 1DQUA 4B9UA 3FK6A 2F9TA 4KBMB 2FC0A 4RGRA 2GWJA 4UVAA 3CCRI 1W97L 2E5LK 3JTGA 3VGMA 2CGLA 3HRGA 2A28A 4DQSA 3GFMA 2DLPA 3S15J 1HDPA 2FU4A 3O5ZA 3TAQA 2JTMA 1Q7YC 4FWNA 3OHRA 4CEBA 5J8CA 1V1CA 2HVIA 3NARA 3S1MJ 2Y30A 1XNRK 1HJOA 2HVRA 1W7PA 3HOTA 4BGAA 1PDNC 2XAQA 1VQKQ 3G71N 4JDSA 2MK5A 1LMZA 2HHTA 1W5CC 2ZNYA 2KHMA 2CH0A 1HNZK 1UB4A 3AVCA 4LH5A 3RR8A 2LJ0A 3EKUA 2L4MA 4KT6A 1EH6A 1O9SA 2M3AA 5EC7A 4OPKA 3VEZA 3ISNC 1ITGA 1Y7XA 5J2NA 1Q82U 1H0MA 5C4JJ 1B8IA 3RPUA 2XY5A 3BY7A 1CQTA 2X0LA 4H0EA 5F0CA 1EKEA 4J9CA 3TOBA 2YUQA 4ORZA 4YOQA 1D3BA 3SJHA 1UWBA 2JTVA 3V8JA 3LW5E 3BGRA 3SAHA 1OPLA 3WT0A 4XQ3A 3FHFA 4CJRA 3HG9A 3SHWA 1MDUB 2HHQA 1QZEA 1QVGP 5BS6A 4XKWA 5K7ZA 4BRIA 2ZGWA 2D2WA 2HQ5A 5C2FA 2OA8A 4JKGA 3V9XA 3PIOA 3ZRGA 4ISEA 2L3PA 2CJJA 1REPC 4V19S 2VQFK 2OTLA 1QZ6A 3G1MA 1VYTA 2X6SA 4RTFD 2HQNA 4U67L 3RSEB 1J54A 3QIOA 3HSTB 2B0LA 3PE0A 2MWOA 5EU7A 3F0ZA 4UV9A 5LBQA 1SL1A 1EZZB 2JM9A 1ZARA 1OEBA 3ZSZA 3CUQC 3S32A 1LAVA 3JCMX 2HKXA 1VQPQ 1I27A 3MN7A 3A2FA 2YDLA 4WQ4C 2KDSA 1BJAA 1M90O 3PGGA 5A0LA 4KREA 3O8GA 1X1DA 4CJKA 4FK2A 3G6EI 5LEKA 1R1TA 2FNPA 2QWLA 2K2MA 2KR3A 4M7AE 4ELZC 4K8ZA 4C92E 1YE9A 5CR4A 2I7NA 2QQAA 1BC7C 4Z4EA 3M1EA 4J9GA 1JKRC 4A3BJ 4JN4A 4M7DD 3X28B 4CZZA 3PX0A 1ZG3A 1D1CA 3ABKH 1NK3P 3PUFA 4CXFA 4FM0A 4MLHA 3FR0A 3H0DA 4MDAA 4E6KG 5AR0A 1X2QA 4Y13A 2CQNA 2JTFA 4FJMA 3THXB 3CCQI 2P0PA 1ITYA 4UNFA 2CH4A 1QZ5A 2L7MP 5F6FA 1YRNA 3VA0A 3O4NA 2DA6A 1NYGA 2XRLA 2AHJB 2R3SA 3OYJA 2GBQA 4B21A 3JSPA 3RQIA 1SANA 3CQXA 1VK0A 1JT0A 3EE8A 4EHTA 1YJNT 2PZSA 1U47A 4CFCA 4BR0A 2FBIA 5LJ5h 3HDDA 4C0DB 5CYQA 3CJTB 2I7PA 3PQKA 2EW3A 4B6MA 3U23A 2OTJT 4PQUA 5HDNA 3OMCA 1RIOH 2XAFA 3PX4A 1KFZA 4JZ3A 1VQKA 2IS3A 4B48A 5AQZA 4B9TA 2HNZA 4Z4HA 3HSEA 4J5YA 5DD8A 2KIFA 4PK4A 1XQHA 2QM1A 3K0SA 3QO3A 3M53A 4E4HA 3CMAQ 3AO3A 2LCSA 4IQ4A 5CJ9A 2UXXA 3S1QJ 4OMYA 3LPTA 1BL3A 2VYPA 1IN6A 2TCTA 2LP5A 1PU7A 1UHCA 2NOBA 2LBFB 1AZGB 5SZTA 2HQHA 4BQLA 5FKOA 1K6OA 1SRLA 3W6VA 4Y92A 2HMIA 4BC2A 4PWDA 3PLAA 3TAPA 2KIQA 4ETSA 1Z26A 5C42A 5DY9A 1RZ4A 4PJJA 4I01A 4RTUA 4YIFA 1JJ6C 3ZQGA 4E47A 1K9MR 4EJYA 2VC8A 4OMFB 1X1BA 1B59A 2Q2EB 2V6EA 1GLJO 3ENBA 1X2MA 5GANd 4M7AB 1B34A 1EXQA 1R5HA 3CVSA 4C92B 1YHQT 3AAQA 2DYIA 3TSWA 5FLVA 1FYKA 4ILJA 1WI3A 1DGRM 2ZMEA 4X64K 1VQ4I 5CYMA 1WJSA 3ZMDA 1DP3A 1QU3A 3MJXA 2EKOA 2J4RA 1G15A 3K2PA 5M9OA 1N8RC 2VJIA 2MW8A 3ZEHA 5BNGA 3VB2A 1O57A 3LSRA 2XUBA 1C0TA 4KH6A 4J19A 1GRIA 5IP6A 2GCXA 5E18F 2HQRA 5GAMg 1ZR2A 1LFBA 1F1BB 3QU6A 1TNSA 2DFUA 5CKBA 1OU8A 1UEBA 1XGMA 4ZDPA 4BH9A 3LGFA 1LB2A 3UF4A 1I6HJ 3L2RA 1NK9A 5L23A 1UOCA 1IV8A 1OR7C 4OINF 1BU1A 1A5VA 3TU5A 3VS3A 2YSRA 2RK2A 4UUVA 1OU9A 4GYIA 3JCMd 1K79A 5AQRA 5CAIA 1JLEA 1KU7A 3LSPA 1VQPA 1OOTA 5GAOm 2M45A 3L0QA 3DF8A 4BHPA 5GAN3 2D0BA 4FLWA 2LZ6B 2EB7A 4N5SA 3HM8A 1OH5A 2L5QA 2ECZA 2VXZA 2RGVA 1QW1A 2QQ9A 4DS4A 4JLIA 3ZP5A 1USTA 3PVQA 5IAYA 3ATUA 3FZKA 3AVMA 1HC8A 3I56N 3WQTA 4OFHA 4Y28E 1HKQA 4BRNA 1C0FA 3S14J 2HHUA 1LWYA 4L0ZB 3E19A 3SWNB 3ABMH 3OW2S 2X48A 3FM5A 4MFEA 3M4YA 1YHQQ 2R7RA 2HDDA 4FETA 1MBHA 4M63C 2L54A 4E1JA 5FKLA 1I5OB 4M6YA 3S1RJ 1OCZH 3K4BA 4I6MB 3GOIA 4X0GA 4BACA 4DTUA 4B3RK 1PNJA 1PUFB 5CKFA 4JNEA 3KJVA 2IRFG 4WTOB 3DLMA 4BRMA 3O9SA 1NU0A 1S9EA 3S9HA 3IKMA 2O8EA 2DA4A 5EDNA 1TUDA 2IPOB 3NF6A 1KU9A 2QKKA 2DZCA 1BBYA 3R6NA 2EJFA 4WQ5C 1SFEA 4M75A 1WRJA 4RAGA 4U7BA 3FWEA 4RKUE 1FBUA 3V4GA 3EGDB 1H1VA 4FYYB 1TWAJ 2KW4A 4FE4A 4J83A 1SRMA 4DQ8A 1UA0A 4TVRA 3HPWA 1X27A 1BI0A 3RDIA 1N34K 2PMHA 3QQAA 5E17F 1OVYA 1QRYA 3KK7A 3CC7N 5KHDA 1N5YA 1D1AA 2DDBA 2G8FA 3MECA 5FLXZ 3L4IA 4UUTA 1VAZA 3QPSA 3CMAA 4DTNA 2QEXN 3LM9A 4CI6A 4ZTJA 3OS0A 2XRNA 2HVSA 1ZRFA 5JLWA 3M8PA 4PGGA 2JMAA 5GAN2 2OFIA 2L7KA 2HEOA 3CCEN 1XMOK 5KCMA 2VB6A 2XASA 1Y96B 3TEEA 2OBPA 1YAGA 3CPWP 1VYVA 1X9WA 3KTUA 1EBMA 1I0CA 2DW4A 4YFNF 2BTTA 1OX8A 2P1JA 4CBXA 1RESA 5H2FC 3E5UA 3N4MA 1RNHA 3CJCA 4FLTA 5KNLA 1VQMI 3K5OA 2W57A 1BI4B 1JKQC 4H5NA 3JTHA 4A61A 2R7WA 4JHDB 4CW7B 4XR6A 4FPBA 3P7NA 1TYQA 1D4XA 4GXOA 1MH3A 3TVTA 4K43A 1LJOA 3F73A 1AD5A 3H92A 1W1FA 3AVIA 4L5JA 2VC1A 2WONA 4Z88A 1YJNA 2K9QA 1BDGA 1NKUA 5TISC 4M75C 1SQKA 1MHNA 2DCEA 3T1YK 2FBYA 3FXOA 4XSXF 4J00A 1S6LA 5HS8A 2AJQA 1KU3A 2RKHA 1J5OA 1K8AR 1CZBA 4HLYA 3M8RA 1L3VA 1YW7A 4J2AA 3K70D 1U45A 2XRIA 1FBSA 2PMZN 2VXDA 3WXJA 2M0YA 3VS4A 3ZSVA 5IT9K 4E7SA 4FOEA 3IH7A 1G3WA 5ADXA 1TK8A 2R7SA 2L2OA 3CC2Q 3LX7A 5LJ3d 5KYXA 2RE2A 2KZGA 3CQZJ 2RJFA 2RHXA 1N33K 3ZX3A 3EQLF 5E3MA 2A40A 4XLNF 5IP9J 1YIJT 4C0ZA 2LVSA 2DVJA 4IURA 4M7DF 2PQ8A 2DE0X 3KEOA 1PSEA 5AQMA 4EPCA 3CPEA 1MNDA 2E3IA 3K1NA 4G7OF 3U1DA 5DEQA 3M07A 4C8KA 5JMVA 4YPHA 1Q86O 2P81A 3EH2A 2FB7A 4E7LA 3LP1A 1J5YA 3TTDA 4P55A 2ELHA 4EA4A 4ESBA 3A5ZB 3K4LA 1ZBUA 4NZGA 2DT7B 1YHQA 3C0CA 1WOQA 4BY9C 3DTEA 3WEEA 3DLRA 2KMTA 1WDXA 5D5WB 2D45A 2K7AA 4XBFA 1BM9A 4EMKC 3S2DJ 1UGPB 1NK5A 4AIHA 1BIAA 3E1YA 1ZQ3P 1IO2A 2OQRA 4FYVB 3ZSOA 4FE7A 4F3QA 2K5FA 4QPQA 3OS5A 3F8MA 3CCLI 5CKTA 2XY8A 2LQKA 2ADUA 3OBYA 4JLHA 3X26B 4C0GA 3O8MA 2QENA 2ETHA 4ZYAA 1VQ8N 2HSPA 2YX7A 2UV1A 3MEXA 5DPKA 2KP6A 1SVOA 3A8GB 1ZHFA 4QWQA 4NC8A 4DBFA 1RDCA 4K2EA 4MQVA 5BOXA 4CJUA 5FGMA 4HVUA 1XPXA 4L59A 2M34A 1JLAA 3V4IA 2F2VA 3BCBA 3K1MA 1IUYA 4FLUA 4GY2B 1YN8A 3CP8A 2P5VA 2HOTA 2W48A 1ETVA 2MMPA 1ABOA 3M3ZA 4IJAA 3ZN1A 1V4RA 4V2SA 1GOCA 3ZXSA 2CP6A 2Y1IA 2XIDA 4N9IA 3OIOA 4J7FA 1VQ6N 2HOAA 4LK0F 3QLHA 1QVFS 1MW7A 3HKZA 3AO4A 2DL5A 3VYSB 4AM6A 4QKUA 3DPTA 4DMNA 1MNMC 1Y07A 3SHFA 2CQXA 1XUPO 2V52B 3ASMA 2E88A 3O80A 2JHJA 5BN8A 4PFZA 3O4QA 1MGQA 1AA7A 1Y0UA 1BWFO 3GYHX 3FLCO 3E01A 2D8HA 3J80Z 2L3SA 2CSOA 3SBGA 2DI3A 3CJQB 3HSCA 1S9GA 4HSRA 1DTQA 3CC4I 2DK8A 2EPDA 2DTUA 4CJEA 2VODA 1QS4A 4C2TA 2A68F 3QIIA 4CZEA 3UIQA 3J7AP 5KPZA 3GFJA 4F7UF 4PJOE 3C95A 1Z91A 1DLOA 4OFEA 1UZCA 5HKCA 2L3DA 5GINA 1N3CA 3EKSA 4JJNK 2OX7A 5JI6A 3CCRQ 3ZEUA 2L0AA 1BCMA 3E6BA 2NS7A 4ZZDA 3I9V2 4J01A 2WSCE 3P9CA 4W5NA 1U5TC 3K69A 2P5GA 3CC2A 4BGDA 3L4QA 2KRMA 5HODA 4E2FB 1H3HA 1Q81R 1RRQA 2Q8KA 1YI2T 1S72N 2X6OA 3I58A 4YPRA 3EFOA 4DK9A 3OYBA 3LWIA 4LUDA 4GW6A 2HFHA 3ZQQA 5FFXA 1LW2A 4QSHA 3C6AA 3AA2A 2ZJQF 2YRCA 5JR3A 1E6GA 3P4IA 1R23A 2OYQA 1OX9A 2RNGA 1JUMA 1R9TJ 1ULYA 4OKEA 4I99C 1YITT 3ZQIA 4N4NB 3VERA 2RJCA 1QNTA 1K73C 2D0PA 4A4EA 1WN7A 4XLHA 1JU5C 2CRGA 2WV0A 3MN2A 1PD1A 5KYUB 2CU7A 2P9UA 5GADJ 1NGNA 2BYVE 1ORNA 5CKEA 1KC8O 4M42A 4AHTA 2ME0A 4ENKA 2B8AA 2K9SA 3OYDA 2LY9A 1TQIA 2SEMA 4AHUA 4W5RA 2QG9B 2O6GE 2NYSA 4FJIA 2A0FB 2HMPA 1O3SA 2PX9A 2RI3A 4DJAA 3HIFA 2COWA 1LJ9A 4AIKA 4ZGDB 3TAMA 3PX6A 5GADP 5GAGJ 2MG4A 4GV9A 3G4ST 4RGXA 3QG1A 3JCUC 2AK5A 3OYGA 4YRVA 3HHGA 4A3JJ 3H46O 3ZFJA 4R56A 1ZQ1A 4E6RA 1M3CA 5CPRB 4IHVA 3KKRA 1R5ID 2VG7A 3ZSRA 2LOOA 4RMNA 3UATA 3NPFA 4YIIA 2P9LA 2IGMA 1TKXA 1D1BA 3HGGA 5GAGP 1IRGA 5FPNA 3MWTA 4PJOB 1FOXA 2DYRH 3OYFA 1YVNA 2Z2SB 3I55N 2IJLA 4CUGA 3LANA 4Q48A 5DV5A 4M77C 2F48A 2WC2A 2HHSA 4DSEA 2R57A 3AY9A 4LLNA 1GFDA 1D3BB 3GFLA 4BY6C 1B6AA 3N5BB 4M7DA 4UV8A 3E0JB 2KYMA 4ITVA 2ESWA 2VWBA 3CWUA 3IV5A 2WSEE 2OPSA 4OPAA 4TV7A 4GYGA 3H8ZA 1BHLA 4O4GA 1LPQA 4UVCA 3ML6A 4IUUA 5MLCQ 2DJNA 3ZCMA 2DO7A 3ZQLA 3DB4A 3PIPA 1YS6A 5DM7F 3X2QH 3RUXA 1S6PA 3OYMA 1DUXC 2XAHA 2R5MA 3MWPA 3CDIA 1ETQA 4R8HA 3V1QA 4JKGB 2P6SA 2ISZA 1I94K 5H6QA 2Q31A 3GBGA 2QTXA 1BISA 3QYHB 5DUIA 1PU6A 4DR7K 1VQ7I 1E4GT 4DQQA 1DJ7B 4M75G 4ICLA 1IKYA 1LQ1A 3MEWA 2OAZA 3NGPA 2VBXA 5GAOl 4O5BA 2HKOA 1SD7A 1VSLA 3MXIA 1LNWA 3HBLA 4J9DA 4B9NA 1MIJA 1S5LC 4QS8A 4FLVA 3REAB 4OMMA 2PLYA 4DU1A 5GAEJ 4EW4A 3JB9D 2F5VA 2QQRA 4FXDA 1V55H 3B73A 3WGIA 2W84A 5AQUA 5D6EA 1NYFA 5C25A 1NGJA 4QW2A 2W7NA 1Q18A 5DD4A 5KPTA 3RRGA 2JN6A 3NNQA 4D8DA 3CCRA 3SAFA 4OKKA 2E6MA 2GUIA 4M7YA 1F9NA 3RPQA 3KZBA 5FKNA 1BOAA 5GAEP 3HYFA 5D5UB 1M90C 4Q5SF 3C3WA 2JJ7A 4HCKA 5GANj 1B92A 1TW3A 2E19A 1JXMA 3JAME 4B9XA 4F3TA 1OFCX 4L5IA 2X4HA 3WU2C 4XRSA 2MLKA 3H0GJ 3L09A 2OI3A 2LRDA 4BNCA 2BOLA 1P92A 2E41A 1F1ZA 4LSNA 3DEWA 4FVMA 3G71I 2RQVA 2AXLA 3G0ZA 2DYSH 1VIEA 2EIFA 1DTTA 1U6GA 3ULEA 3OQ5A 4HVJA 2UUAK 2B7EA 2PUKB 1NM1A 2RQTA 4A5BA 1NH3A 3TKYA 4OMZA 2V75A 3I0SA 4HHTA 4BG9A 3EUKL 5D8LB 1NGAA 2YKNA 4AHSA 5J8FA 3RKXA 2DL8A 4XL9A 2COYA 5TGTA 3NF9A 1X6GA 5LL6Z 4LY7A 2IIMA 4DR2K 1W4SA 3KTQA 4QVZA 4C8LA 1YG2A 4YHHK 3ZGKA 5LL6S 2E60A 3WODF 3ZQFA 4ZJZA 1UAXA 5IHNA 4DTSA 2V6CA 3M9QA 3CCUN 2KZMA 2DN0A 2NVTJ 4O6JA 2PFBA 2VN2A 1FKOA 1VQ4Q 2PN6A 5J1RA 4KGZB 4F7UA 3LL3A 3TARA 2DILA 5JS2A 3F8FA 3TAGA 4XKCA 2QZ8A 4HUFA 3R3LA 3Q5FA 4ELYC 3QU3A 2YKMA 2LLKA 3DXJF 4DB3A 4Y17A 3GTLJ 3FM3A 2VG6A 4JI1K 1JHHA 3MO8A 1YJ9N 2JGUA 3SD4A 5FRNA 1R0AA 3DEEA 2HQAA 3ATVA 1GLAG 1WNSA 1XQSC 2EA2A 4LF7K 2Z0WA 3E7LA 3VGLA 2ZJQL 5LMNK 3HPHA 2KT1A 2D1VA 1WEGA 1S9HA 5AQSA 2XHCA 1NJWA 2LVMA 5ILVA 4CC3A 1H641 4PUSA 2ZMEB 4OMNA 3A2KA 3VYRB 2KHOA 1KAXA 1Z3XA 3MD2A 1QWEA 2KIMA 3BT9A 4KITB 2CYZB 4BC5A 1D5YA 3SUPA 2GWRA 3GTGJ 2XI9A 4QLCU 2KT8A 4BJTA 5KN8A 4OIOF 3WXMB 3Q0UA 4UUSA 3G4SA 2EZLA 2MSYA 3ASOH 3OVNA 3G3ZA 3HK2A 3FLGA 5GTHC 5CVRA 3SZ2A 4G6QA 1XG1A 3D5RC 1CXQA 4PUOA 4AU7A 5GJVB 4JK1X 1K8KB 1S3JA 4IEEA 4OAYA 3RERA 4ISFA 2X4XA 1WIEA 1JKPC 2DEQA 4B1VA 2DTZA 1IREB 4A3IJ 2D1XA 3H1CA 4B1ZA 2IGIA 3BF3A 5FWCA 3LDNA 3B6CA 5FB2A 1WHKA 1S1TA 3W6KB 4A3EJ 3DAWA 1XC9A 4AC0A 4EZ6A 4GY5A 4JUVA 3M8FA 1BW5A