4ZTJA

Crystal structure of the prototype foamy virus intasome with a 2-pyridinone aminal inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title Discovery of 2-Pyridinone Aminals: A Prodrug Strategy to Advance a Second Generation of HIV-1 Integrase Strand Transfer Inhibitors.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna/inhibitor
total genus 103
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ztjA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ztjA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ztjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ztjA03
1D8YA 4RG8A 3MXJA 3VQ8A 3PO4A 4I9LA 3OMCA 3T3FA 4E1NA 4C8LA 3QEIA 4Q5WA 4RW8A 1GOAA 1CXQA 3S3MA 3KLHA 2YRVA 5M9OA 2D9TA 5HRPA 1T03A 4O0JA 4E7LA 3HJFA 4C8MA 4AHVA 1RDBA 4K8ZA 5KI6A 4KB0A 1WAFA 1U47A 4NCGA 3K2PA 5J2NA 1RBSA 3VA0A 4ELUA 4MFBA 4FL6A 3CYMA 2KFNA 3RRHA 1NOYA 5HRSA 1KRPA 3QEWA 2RHXA 4ID5A 1VSJA 4FW2A 1ASWA 1KVBA 3ZSZA 3TWHA 3KUFA 1JLBA 1S1VA 3AVJA 4FJ5A 2JZ2A 1RT1A 4PL6A 4Y1DA 2G8KA 2LRQA 3SD4A 1OZ2A 4IURA 4Z4HA 4KHUA 1KCFA 1WLJA 3VQAA 2BGGA 4X34A 4B08A 4FJGA 4W5NA 4KRFA 4CEFA 4L8RB 3P8HA 3O8VA 1HYSA 1LAWA 4LSLA 3NDKA 4CEDA 3RRGA 2RO0A 1W0HA 1HYVA 3K5MA 4C5EA 3KK3A 1Z25A 4IUTA 2KW4A 4CE9A 4OPJA 4E7KA 4FLZA 4EP4A 4BACA 1S9EA 3SPZA 3PNWC 1G5VA 1I3AA 1B92A 4CEEA 1SL0A 4CGFA 1VSHA 1KLMA 3CQ8A 5FRMA 4CEAA 4DTPA 1KHCA 4K8XA 2HQXA 3KK2A 3L2QA 5C0MA 1Q8IA 2B5JA 4N56A 3C6TA 2R7YA 3OYKA 3AVFA 3SUOA 2F8SA 1NK8A 1H3ZA 1LW0A 1WJSA 1KVCA 3QLHA 3VQ4A 2YKMA 3RWUA 1NK9A 2VWJA 3KK1A 1GOCA 4KFBA 1ASVA 4IBNA 4BDPA 3S3NA 3K59A 3PMTA 2LCCA 3TARA 1OZ3A 1G15A 2IG0A 2DTUA 5IAYA 3T1AA 3V9WA 4IUQA 4DQSA 1NJWA 1VK0A 2IS3A 4CIEA 3L3UA 4B8AB 4OKJA 4AHUA 4EZ9A 4CJLA 4Y1CA 2IC3A 4B9XA 4FJHA 1SV5A 1N6QA 2HHXA 3LAMA 2E6LA 4NZGA 2NLUA 4BDYA 3U3YA 4O44A 4FZXC 5J26A 4RW6A 1YVUA 4BE2A 3NH1A 1JXBA 4DU3A 2GBZA 2R57A 1ZBUA 4N47A 3LZJA 4C8NA 3QEXA 4E0DA 4F3TA 1XNIA 2RJEA 3LPTA 3MEAA 1RDCA 3OYNA 5KE3A 2M1HA 4DG1A 2M0OA 2Y1JA 5HP1A 4Z4FA 1JL1A 2YHAA 3OA6A 1SKRA 4IG0A 4DSEA 2X4XA 1TL1A 3MEEA 3AO5A 4XIUA 1SL2A 2YNIA 3KLIA 1TK5A 2AJQA 4C5HA 1NOZA 5CYQA 1JLEA 1L5UA 3MP8A 1JL2A 4PY5A 2Z1JA 3JYTA 2HHVA 1RT2A 2WONA 3OYEA 4N4GA 4G1QA 4AHTA 1S1UA 3UT1A 4CFAA 3KIOA 3NHGA 5K14A 3LWLA 3LZIA 3VQ7A 4Z4GA 2EQMA 4N41A 1JLGA 3TR8A 5C42A 1TV6A 4AHRA 4FJIA 5SWMA 1QQCA 5J2QA 2DAQA 3QJ6A 3PFSA 1IKVA 1S1WA 4Z4IA 3QKJA 2HQEA 4DSFA 1HQEA 2VG7A 3AO3A 3EZ5A 1WSHA 3MO8A 4OVAA 3MP1A 4DQPA 4O4GA 3HK2A 3CFOA 3V81A 3S3OA 4CJ4A 3DB3A 5CZ1A 3ZSXA 4LY7A 4CGJA 3NF9A 4A4EA 3NH0A 2D0BA 4CF9A 4W5QA 1A5XA 2XY6A 3QETA 2OPQA 3QO9A 2XDPA 4ZTJA 1Y97A 4TSXA 4M45A 3DI6A 4CJSA 1EP4A 3L2VA 1D9FA 5HROA 1NK0A 3IS9A 5HRRA 1WSEA 1WAJA 4M41A 1X1PA 3SUQA 3KJVA 5C6SA 3LP1A 3E9FA 1CZBA 3ZSOA 1CLQA 5DMRA 1JLQA 4LSNA 4BWJA 3TAPA 2X35A 4N5SA 5KH6A 1J9AA 1HPZA 4B9WA 1N27A 4M3ZA 3DB4A 3OYFA 2GUIA 1T7PA 5KRTA 2OPRA 4PLLA 2EHGA 2QKBA 3AVGA 4CJRA 4H4MA 4DSIA 2G8HA 3V1RA 2YV0X 2JLEA 4DSLA 4KHNA 4DF8A 1OI1A 1C6VA 3ALYA 2HHWA 4F2RA 3ULDA 2KQ2A 1EX4A 2F96A 3VQCA 2EKOA 4KI4A 3IRXA 4CK1A 3C95A 4OGCA 4FU6A 4AILC 3OYAA 4N4HA 1UOCA 3OS2A 4FLWA 3SQ4A 3NFAA 1U49A 1WGSA 3LGLA 1WJQA 2HHSA 1FKPA 3M8SA 1C0UA 1QSLA 3TANA 5KE2A 2Y1IA 4E89A 5T7BA 3VQEA 3A2FA 3M8PA 1MHNA 2RJDA 3H8ZA 3L2WA 3LH0A 3SZ2A 4FZYA 2DY4A 3TAEA 2EFIA 1KTQA 1VRTA 2B4JA 4C5GA 1VSLA 3SUNA 4WE1A 5IN1A 2YNGA 2D0AA 2YHBA 2RN2A 4FM1A 1K6YA 2L8DA 2GV9A 2XK0A 2YNHA 3LYIA 4QVZA 4CFDA 3OS0A 3QBYA 4UQGA 4JRQA 2VWKA 3ITHA 4I2QA 1LAVA 1ZBHA 3AVMA 3SQ2A 3BDPA 3BGRA 4PA1A 4J2DA 3QEPA 4CJEA 5FDLA 4CCHA 5D6YA 2X4WA 4DLGA 2G3RA 4B9MA 3QERA 3AO1A 4KHWA 3OB9A 1HYZA 3SQ1A 2HHTA 4FLYA 2R5MA 4CEQA 3FC3A 4HUFA 3QIOA 3SV3A 3HM9A 3F73A 3WNGA 2GFUA 3KD5E 2RJFA 3CM5A 4FK4A 1NK7A 2IGIA 4KB1A 4DF4A 4QOZB 3VQ9A 4CIGA 2I5JA 3PV8A 1WJRA 4CF8A 4BD3A 2HB5A 1RTDA 4CESA 2G8FA 4DSJA 3DLGA 3PX6A 3MXMA 1RTJA 3AVLA 5FRNA 2QQRA 3RMAA 4A4GA 2BIVA 4CJUA 1JLAA 3RMDA 3ZT4A 1W9HA 3F9KA 3OJUA 4FLUA 4DQRA 1WSIA 3NF6A 4EP5A 2ZD1A 1EXQA 3E01A 4CGDA 4DU4A 4CGHA 1RCHA 4M3WA 1T05A 3BDLA 3OVNA 3OYHA 3P5JA 4M3XA 3LP2A 4KPYA 4I9QA 1BI4A 3RMBA 2RI3A 5HLFA 2K3YA 4CHYA 1C0MA 2LSNA 4FM0A 2BKDN 4B9SA 5DK5A 4GY5A 4DTNA 2DFHA 3QIPA 1S6PA 1IKYA 2K3XA 3NH2A 4O5BA 4DTXA 1U4BA 4OJRA 1XI1A 3KLGA 4HCBA 4GW6A 3LWMA 2EQUA 5HRNA 3V1QA 3NTKA 1WN7A 2PY5A 3O3HA 2RF2A 3E9GA 5I42A 3OYGA 4LH5A 3SJJA 2FBTA 1NJXA 2E6NA 3LANA 5KGXA 4BE0A 3ZT2A 2OYQA 3IAYA 3RR7A 1FXXA 2HVIA 4DS5A 1RT6A 4M3YA 3DLRA 3ASKA 3MEWA 2IOCA 1TAQA 4NCBA 5CY4A 1IKXA 1I39A 1YTAA 3QNOA 3NTHA 4FJKA 4QCLA 2XY5A 4FCYA 2ZE2A 1OYXA 2YNFA 2DFEA 2D5RA 4FW1A 1NKEA 4H4OA 4HUEA 3I8DA 2HHQA 3QINA 5D6WA 2WOMA 3K5OA 1F21A 3HP9A 4PWDA 3OYBA 4GMJB 4FVMA 3MEUA 4QQDA 3NNQA 1S6QA 2MWOA 1RDAA 3HPGA 3HL8A 3HYFA 3ZCMA 2EQJA 1Q9YA 1BIZA 2E4LA 1NKBA 4DTUA 2KTQA 4FK0A 3DRRA 3META 3ZSWA 4R5PA 3OQ5A 2P5GA 1RT7A 4E7IA 4LD6A 4KO0A 1LWCA 3WNEA 1IH7A 4PQUA 3OYIA 2L89A 3TAGA 1U45A 1TVRA 1TKXA 2WACA 3U3GA 1NJZA 1KVAA 4CEBA 3PY8A 1XC9A 2ZQBA 3WNHA 2HNDA 1TKZA 2O4XB 4YFUA 3DYAA 4A4FA 1NK5A 1NKCA 3HP6A 3HVRA 1KFSA 4IG3A 4FLTA 4OKKA 2P0KA 4PLIA 1LW2A 3B6PA 1VSKA 1YTUA 3OYMA 4IFYA 4OLBA 4CF1A 4FYDA 4I7FA 1X9MA 4KAZA 3MEGA 4FK2A 1VSEA 3FEOA 1NK4A 3G0ZA 1O1WA 1XHZA 4NYNA 2PQWA 4B8CA 4DS4A 3VQ6A 4RW4A 1S1XA 1NJYA 3NGZA 2X4YA 2RJCA 1B9DA 4OKEA 3DMJA 3L2RA 1LWFA 3ZT0A 4FXDA 1HJRA 2FBVA 3ZSQA 4ZTFA 3OYCA 1WSJA 2FHDA 2GF7A 1J5OA 1QSYA 3DM2A 2OZSA 3QNNA 2HW3A 4M3RA 3IG1A 4J2AA 3S6WA 3HXMA 2PYJA 4BWMA 2IDOA 3JSMA 2FBYA 3HSTB 1RTIA 2OPSA 1RT5A 1L3SA 3OYLA 4DFJA 2RHYA 4KREA 2EQKA 4EZ6A 4CJ3A 4FLXA 3LALA 4AHSA 2HHUA 3KKSA 4CJ5A 1EKEA 3DRSA 1SSFA 3AA4A 1WNSA 4CFCA 2EX3A 3KD1E 3AVHA 4KTQA 2F5KA 4HUGA 1D5AA 3C4SA 1S1TA 4O55A 3K58A 2X78A 4CJFA 4KHQA 5C25A 4IUPA 4FJXA 4HCCA 4FJ7A 1S5JA 3K5NA 2GFAA 1C1CA 2JTFA 3KLFA 3H08A 3ZEHA 3EAEA 3LP0A 1BIUA 3P1GA 1QS4A 5SZTA 3HT3A 3AA3A 3HPOA 2OA8A 1UA0A 5CYMA 1VSFA 1RDDA 1TKDA 3RTVA 3NAEA 2M16A 1XWLA 4MQ3A 4LD0A 1FK9A 3F70A 3AVNA 4FJ8A 1TK0A 1BL3A 3L42A 3Q1JA 1A5VA 4F3OA 4BE1A 1TL3A 1BI4B 3DLEA 5EU7A 4OPKA 4KI6A 3AV9A 4M3TA 4HCZA 1UWBA 1VSMA 3D0PA 4II1A 4CGIA 5E41A 1IO2A 1T8EA 2FBXA 4NS5A 1GOBA 2JGUA 3TAQA 3ISNC 1L3VA 4DTMA 4ELTA 4CJTA 1L3UA 3PMIA 3P8DA 4KTWA 1RILA 3AVBA 2B8AA 3ZSRA 1X9SA 1BCMA 4Z4CA 4DQQA 4KV8A 4CF0A 4IDKA 4QW2A 3DRPA 3FDRA 4DQIA 1N5YA 1VSDA 3K5LA 3V9ZA 4FZZA 3VQQA 3OY9A 2P1JA 4DFMA 2BUDA 2A1RA 4CECA 3L8BA 2QQSA 4C8OA 4KTZA 3OMGA 2R5AA 2R58A 2NUBA 3RR8A 4B9NA 1S9GA 1SL1A 1ZBIA 4UC4A 3V9SA 4Q0BA 3VQPA 4HTUA 4CRIA 4BDZA 3ASMA 1Q9XA 2O4IA 3VQBA 3O4QA 2LTOA 3M8RA 4J2EA 1HNIA 2G8IA 3EYZA 1IKWA 3L2UA 3THVA 4JRPA 4B3OA 3TAMA 4CHQA 3LX7A 5KCOA 3O3FA 5C24A 3LGFA 1RT4A 3LP3A 2HNZA 3HVTA 1BGXT 3VA3A 1IG9A 3CEYA 3T19A 1TAUA 4CJQA 3TABA 1MU2A 4CHNA 4JS4A 2HNYA 1R0AA 1J54A 2X6NA 4CK2A 5CIUA 3NBPA 2ITGA 2BDPA 3SNNA 4KKOA 1HQUA 2VG6A 5J1EA 2DFFA 1QE1A 2RI2A 4QQ6A 3LDSA 1U48A 1HNVA 4C8KA 2FC0A 1RNHA 4B9LA 3PUFA 5HBMA 1DTTA 1WSGA 2DIQA 5J39A 2RI5A 2P5OA 1D9DA 1U04A 5KTQA 3O3GA 3GOXA 3NTIA 2YKNA 1BQMA 4W5TA 3DLBA 1C1BA 3M9QA 4DTJA 1UAXA 1REVA 4CIFA 3ZT1A 4YNQA 1QTMA 3RMCA 2VG5A 1QSSA 4E1MA 4DTOA 2XO7A 2PZSA 3PX0A 1KLNA 2KZMA 3KLEA 1KSPA 3EY1A 3KKRA 4DFPA 4DFKA 1XHXA 4CF2A 3UIQA 3QEVA 3DOLA 4NYFA 4CGGA 4M3UA 5J2MA 4B9VA 4DTSA 2MWPA 2BANA 1RBTA 3OYJA 2DIGA 3SI6A 3NGIA 5FROA 2XY8A 4B9UA 3SPYA 3ZSVA 4DLEA 1YT3A 3CG7A 2CKKA 4FJMA 1KFDA 3DLHA 3FLGA 4CEOA 4F8RA 4KHYA 5D3GA 3B6OA 3HPHA 2HVHA 1C0TA 2A1SA 4CEZA 4QAGA 1ITGA 3C94A 3TI0A 4Q5VA 4E7HA 3SYZA 3OS1A 1LWEA 2QK9A 3LPUA 4HHTA 1CXUA 2LVMA 5KGWA 4FJJA 4FJ9A 3AA5X 4LH4A 5J2PA 3H6ZA 3DLMA 3V1OA 1RBVA 4AH9A 5D6XA 2LDMA 4CERA 3DOKA 4B9TA 3MECA 4J2BA 1UA1A 1BISA 1ASUA 1RI0A 4RW9A 4JS5A 1TGOA 1RBRA 4DSKA 2KFZA 2X74A 3V9XA 4OLAA 3OJSA 3AO4A 1HMVA 4ICLA 2L3RA 2RHUA 4ZHRA 3S9HA 1BHLA 4JLHA 4IKFA 4RW7A 4AHCA 1RT3A 3LLRA 1JLFA 4IUVA 2B6AA 1EETA 1WSFA 1SUQA 3UWNA 2RPIA 1ZYQA 2Z1IA 4E7JA 3VN5A 5JS2A 4DU1A 3NCIA 3D45A 4ID1A 4DMNA 3L3VA 2KZZA 3NF7A 4N76A 4DWIA 4Z4EA 3DLKA 1L3TA 2RHZA 3C6UA 4CFBA 4RG2A 2QKKA 4CK3A 1VRUA 3NGYA 1TK8A 2BE2A 1CZ9A 1A5WA 4A4HA 4CHZA 5I3UA 1DTQA 3MEVA 4HVJA 3OYDA 4KHSA 4E19A 3M8QA 3AA2A 4FJNA 3AVAA 1ZBLA 2D0CA 3AVKA 4F4KA 1Z26A 3AO2A 3MEDA 3TAFA 3VQDA 2O4GA 2ATQA 3ME9A 2XY7A 3V9UA 2G8UA 2QXFA 1DLOA 3U6FA 3MAQA 1J53A 1ZBFA 4EDUA 3HO1A 3FFIA 1VSIA 4QQGA 2Q3SA 3CM6A 4F2SA 2G8WA 4N4IA 2RHIA 3SQ0A 1SKWA 2OPPA 4FLVA 5KCHA 3I0RA 3WNFA 4W5RA 2PYLA 4OVLA 4PUOA 4L59A 1X9WA 1NK6A 4OGEA 5JS1A 4E3SA 3LAKA 3PX4A 4Z02A 3MXIA 4CHPA 1B9FA 3NF8A 3QIIA 3PO5A 4CJWA 3K57A 1C1AA 3SV4A 4IFVA 4DTRA 2E6MA 2IAJA 2G8VA 2RKIA 3KTQA 2X6SA 3SUPA 4GVMA 2E5QA 1BCOA 1FKOA 3VQ5A 1BQNA 3I0SA 2XHBA 1TKTA 4Z0UA 3QESA 3AVCA 3O4NA 3ZSYA 4CHOA 4I2PA 1JXEA 1RTHA 4NCAA 4FJLA 1SKSA 2Z1GA 2HMIA 5KRSA 4O0IA 3P83D 4M42A 4CJVA 3ZT3A 4ELVA 3V4IA 1JKHA 2Z1HA 3V6DA 1QHTA 4FM2A 3MP6A 4CJKA 2XRIA 4CJPA 4IUUA 2P51A 2ETJA 3CFPA 3NE6A 4C5IA 1JLCA 3CFRA 2O4XA 3SCXA 2VYTA 2OZMA 2F8TA 1RBUA 4H8KA 4W5OA 3AVIA 5CZ2A 2W42A 1LV5A 1HRHA 3G10A
chains in the Genus database with same CATH superfamily
1XSDA 1GCPA 3HSEA 3L09A 3JRHA 2NNWA 4IZ9A 4HRIA 2PBDA 4B3TK 1D1AA 4DIQA 3PGGA 1H3HA 5CLSA 1OH6A 2VASA 3DLLA 2EA2A 3ER0A 1OFCX 4XKVA 3HOTA 1SD7A 4HT8A 3KLHA 5M9OA 2GTJA 2JJ7A 3SJHA 1NPPA 3RBBB 5K7HA 4O0JA 1WGXA 4E7LA 1RFQA 1YJWA 4AHVA 1T0HA 1QZ6A 3KLNA 4MFDA 5KI6A 4P96A 1U47A 2V9PA 3K2PA 4B1VA 1RBSA 2W1OA 2A61A 5L3FA 3THWA 4A12A 4XLNF 2LQWA 3RRHA 1VQ7I 1T8IA 4L5IA 1TG0A 4FW2A 1S72A 4FE7A 1ASWA 3Q0VA 3VOVA 3CWTA 4RAFA 4Y92A 1YQKA 4WCIA 9ATCB 2DO3A 1VQ4I 3CXCM 4FJ5A 3CDHA 3N4PA 3QU3A 3DBRB 1JCGA 3BTLA 3E7LA 2XKOA 2G8KA 2VYPA 1CZAN 1ZA1B 5M1QA 3RSEB 1KCFA 2XKOC 5IXFA 3CCQN 5J1YA 3S1MJ 1SPKA 2F5TX 1NGJA 3NAUA 4FJGA 4W5NA 5GAEJ 4BRGA 5BPDA 5IHIA 3R9PA 2VJIA 5KYYB 2UXBK 4MGRA 3JCMP 2DMOA 3P8HA 1AWCA 3O8VA 3O1WA 2OTLA 1I81A 2DA2A 3O2PE 4M7AE 3L6QA 1XSXA 3PQJA 4H5VA 4JX4A 4ENMA 1O3TA 4IJAA 3S2HJ 3BTCA 4B1WB 4RMOA 1P7IA 4CE9A 4OPJA 1D0XA 3JTGA 3SPZA 5DDGA 3HBTA 3H0HA 1G5VA 1B92A 2E20A 2XAJA 3E6MA 1SL0A 3CCLN 3D5LA 1IC8A 4KT6A 4L18B 2W48A 1TC3C 3CQ8A 3CPFA 5LJ5g 1UB4A 3CCSA 4DTPA 1KAXA 4KFCA 4ZGEB 4PJ0C 1PKTA 1XMQK 3JCMV 3KK2A 2MSYA 2BOLA 1Q8IA 1QQMA 2D1KA 3WGGA 2BZTA 1VI0A 5HDKA 2EA4A 3C6TA 2L0AA 4C92B 4ZZLA 2JUFA 4N9HA 5CCAA 3AVFA 2M8GX 1VQOT 4JRIA 1VQLN 1LW0A 3F21A 3EYIA 3CCUQ 3QLHA 2XAHA 4CZEA 2NNYA 1GOCA 4IBNA 4ON0A 3HM8A 4C1NK 5TKYA 1U8RA 2X48A 3TARA 1OZ3A 3UB5A 2DTUA 1SANA 4M78G 3J7AP 2CP3A 3V9WA 5JLHA 4Y15A 2VQFK 4XOPA 2E1NA 3MD2A 2DYSH 2DJQA 3GTJJ 4B8AB 4DHYA 4C0DC 4EIAA 4Y1CA 2KT1A 2IC3A 1RDUA 5M5WJ 4G9ZA 3HFNA 2R7WA 1SV5A 2Z2SB 4DBQA 3LAMA 1TWHJ 2E6LA 5H6QA 2PLYA 2EK5A 3SEQA 3C7NB 1RABB 1UB9A 4C92G 4MHGA 1EFNA 5J26A 5AQVA 3MCZA 5LHHA 3UDCA 1JXBA 4DU3A 1OCPA 5IOYA 2BV6A 4KHPK 4F3TA 4BRLA 4YRVA 2ENMA 2VI6A 4BBSJ 1RDCA 2JPBA 3KFWX 2M0OA 4LFCK 1NGAA 4LF4K 4YPHA 2GEMA 3RKYA 4W97A 1YAGA 1YQLA 4Z4FA 4D7MA 5BMZA 1SKRA 3DKXA 3M56A 3FIWA 1MD0A 4U0YA 2O61A 2X4XA 1JJ2A 2ASPA 2PFBA 1TL1A 4IRIA 5GAMe 3TU5A 1SL2A 2YNIA 3NRVA 2R5YA 1YJ9A 1NOZA 2HR3A 1T33A 1VQ7Q 4KH6A 2KHOA 2Z1JA 4OB2B 4AIKA 1MUYA 3LAJA 1RT2A 2WONA 4AHTA 2EJ9A 1VQ4Q 2L2PA 3WXMB 4HV6A 1OJLA 5B66C 1G83A 2A08A 1LFPA 5K14A 2OI3A 1YHQN 1I6HJ 1FC3A 1K7AA 3DXKA 1JLGA 1OKRA 5C42A 1TV6A 4FJIA 5SWMA 1Y96A 4B1RA 3M8EA 5FU7C 3DKYA 1AOJA 4C2MJ 5FLMJ 2VKHA 4YIIA 3A0HC 4G6QA 4NQWA 2DAQA 1R77A 3J7AY 2ICWG 3QJ6A 2IW5A 1Q81C 1IKVA 5M3FJ 1HQEA 3IH3A 4RGRA 3MO8A 2DO7A 2V26A 5M1PA 4IHXA 3OYYA 5GMKj 3MVPA 1GXPA 4I01A 3DEWA 4EMKB 3CFOA 3V81A 3S3OA 3IV5A 4CJ4A 5J3LA 2Q97A 4N0BA 5CZ1A 4LY7A 4PSWA 4UUTA 2ZPIB 1P9QC 2IS6A 2D0BA 3LQQA 3CCEN 5GAHP 2GXBA 1XQOA 5CE3A 4NC6A 3KYDB 4BI8B 4UB8C 4ZTJA 1NGCA 4XKCA 1SF9A 4D0PA 1QVGS 3LOCA 1M3HA 3CF5L 4M75B 3VEWA 2BY2A 2LH9A 3DI6A 1VQ6A 1TYQB 2W04A 3BR3A 3K9JA 5IP9J 3HSBA 4EHUA 1NK0A 1IREB 4CC2A 1JE8A 4AF1A 1MMNA 2CP7A 4M41A 2A3ZA 2L7FP 5DPKA 3QWYA 4O8UA 2NUPA 2JRMA 3SHFA 3LP1A 1JKPC 1DT9A 3E9FA 1LCUA 2CUDA 4FSVA 1IDYA 1B6AA 4B3AA 3R3LA 2WUSA 4ELYC 3SFMA 3EEQA 3OSGA 2P9IB 3EG1A 2LF7A 4B9WA 4UVAA 1UECA 2KDOA 1IV0A 1M5Q1 1T7PA 1M3AA 2K5IA 3O5ZA 2OPRA 2MFZA 2M9HA 1C0GA 3RVCA 1N39A 2CQXA 2DPPB 1FSHA 1FZPB 4D5FA 3CMAN 1QZEA 4M75G 2F1LA 1WEIA 2DEUA 1K73U 1EBMA 3JAME 4F92B 2AP1A 2DODA 1A6QA 4LFUA 2J5PA 4KHNA 2XG8D 4BBRJ 1K0XA 2HHWA 5E8IA 4F2RA 2ZNZA 1DP3A 4KDPA 4M7DE 2IPQX 3I0TA 1FOWA 2V8JA 3ZP5A 1UFMA 3VQCA 5F08A 2RKHA 2DL3A 5BPMA 2DI3A 3CTAA 3CCRT 3I3LA 3C95A 4OGCA 4AILC 3LSKA 2Y9ZA 2YWWA 1TW3A 1IXSB 2L9RA 1NYGA 4HKEA 4N4HA 4DBHA 4LXCA 1MDMA 3LH5A 4OAZA 3QBXA 2KHMA 1U49A 5D5WB 2HU9A 2ZF5O 4M9XA 2MCNA 1FKPA 1APLC 4KMUX 1UAAA 1OYIA 4DR6K 2M30A 4NBQA 4XRSG 1GDTA 2DQLA 5GAOm 2Y1IA 4E89A 5T7BA 2WAQA 1BM9A 1LCKA 5A0GA 4XH1A 3M8PA 1LB2A 1G3SA 5TISC 1KQSS 2UUCK 1TQPA 4ZGDB 3VS0A 3TAEA 2EFIA 1TOVA 1Z9ZA 2K9NA 2V75A 5FJ8J 1VRTA 3CCYA 3CESA 1OCZH 2P7CB 2M0MA 1K9MC 4MO7A 4U67L 3F5TA 1ORPA 4PJOF 1QVFP 3IAM2 2W4SA 3UKUB 2GV9A 2H6BA 1I1SA 3LYIA 2EBIA 4CFDA 4UQGA 4JRQA 3GTKJ 5DCMA 4II3A 3N4QA 3LW5E 4I2QA 4AU7A 2IRFG 3CZ6A 3VEPA 3AVMA 1GRIA 4PA1A 4CJEA 2LD5A 4FETA 2JT4A 3CCUA 4WFAL 2E12A 4YDUA 5D6YA 4DLGA 2VUMJ 2G3RA 3I4MJ 3KP7A 2HOTA 5K7FA 4CD1A 4YDUC 1R59O 4JKFA 2J4RA 1FBSA 2R5MA 2CSOA 3C0BA 3VF6A 3GBTA 3P38A 3F73A 3OW2A 1BO5O 3VS4A 3CM5A 5L3CA 2CP0A 2LJ3A 4ATOA 4KB1A 2YX4A 3A0IX 3VQ9A 3BR6A 2B9SA 5ECAA 3RI4A 4RUGA 3ZEUB 5IPAA 2P9KB 1WI3A 2OAUA 2HB5A 2DBMA 2E2NA 2KL4A 4M9ZA 1QVGP 1ZX6A 1OR7A 2GQIA 3DLGA 3PX6A 5GAOn 3U1KA 1AU7A 1D09B 2COZA 4YOQA 1OR7C 4F7UE 4E7SA 3WG9A 5GINA 2FZKB 2R3SA 2DJNA 3VEXA 1BIAA 2EV5A 4QS9A 3HRGA 2L7KA 4IHTA 3ZT4A 4B1XB 4LUDA 1EJ9A 3M58A 2DERA 3OJUA 3QP6A 3NF6A 1RKWA 5JVGL 3AHUA 3SDZA 1UHFA 1ZUUA 4L5EA 3JAMZ 3VYRB 3CVTA 1EXQA 4MDXA 4KMFA 1RCHA 1T05A 3CD6I 3CMMA 5JLFA 1S72T 4H5NA 5KQ8A 4I9QA 2KBTA 4HV5A 3M0PA 2CFOA 2NYXA 2XPUA 1S7AA 2DT5A 2DXCA 3BR0A 4FM0A 3CF5F 2BKDN 5HKCA 2Y48A 1KQ0A 4DTNA 3THYB 3VTHA 2LC4A 2E2QA 4B1ZA 1YIJI 4U88A 3NH2A 5KYXB 3HBLA 4BRHA 3U9ZA 3GLLA 4XLCA 3TGNA 3JCUC 2KROA 4HCBA 2WAEA 2ELKA 1SD5A 3DFGA 3FXUA 2LZ6B 3VEZA 3CUOA 3A2KA 3O3HA 2V7YA 2FVUA 3OYGA 2RQWA 4IFEA 4E70A 2E6NA 4IZZA 4JJCA 4CZMA 5KGXA 4BE0A 3DAWA 5IH2A 3ZT2A 3IAYA 3RR7A 3NVKA 4L9JA 1OCRH 3J81Z 3S41A 4DS5A 1UUEA 2X3WD 1RT6A 2GZWA 2EIJH 1D8JA 3C7JA 3DLRA 5GP9A 4UVBA 3MEWA 3BROA 1KD1R 3FIFA 4XKBA 1KYWA 3GPLA 5AIPA 1I39A 2Y9YA 2DQRA 3NTHA 1SFUA 4FJKA 4CXFA 2ME0A 3U2RA 3FKJA 2DBBA 4HA8A 2DFEA 2YNFA 4BB7A 4FW1A 1NKEA 5GMKl 3I8DA 2QYOA 3J7AO 3O9UA 3JCMh 3EFOA 2GGRA 1VQMT 1F21A 4LG0A 3A5ZB 1FLIA 2AIRB 3F8CA 2BYVE 5GAGP 3OYBA 2XKPA 4FVMA 3VEYA 3NNQA 3ZQ7A 1PVEA 1PUEE 4YOVA 2KMUA 4HZFA 2A07F 4JHDB 2EQJA 1Q9YA 1BIZA 4F16A 2V9VA 3EETA 4OIPF 3HC7A 4IXAA 3TOAA 2P9UB 1PSEA 2R7RA 1ZKGA 3W3DA 3DRRA 3AL0B 1W7PB 5TRDA 2BGCA 1LOJA 9ANTA 1RT7A 4CD3A 3M3ZA 4XOTA 4BXUA 4E7IA 2IT0A 5LJ3e 2LX9A 4WWCA 2ZBKA 3OYIA 2ZGYA 1ETYA 3EFRA 4AT1B 2YX6A 1TKXA 5I22A 3U3GA 1IRXA 3PY8A 2HOEA 3WNHA 2PI0A 1ETOA 5JI6A 3RSEA 4D6WA 4FWLA 4IOCL 2V6EA 1NK5A 2CUEA 1AWJA 3HVRA 1KFSA 4IG3A 1LPQA 5KYYA 3CC4A 4BRAA 1TWFJ 4EFHA 4FYXB 1V54H 4FYDA 5LGNA 3ZQGA 1X9MA 3F3XA 2KI7A 4OU0A 3A0BC 1P6RA 2ZMEA 1P59A 2FNPA 3MX2A 2FSWA 3G0ZA 1O1WA 4HVWA 3L2ZA 2LY1A 2PQWA 2K5LA 4DS4A 3VQ6A 2ZMEC 2IEKA 3SMPA 4NNJA 5F0CA 1NJYA 4AFSC 3TDUC 5KQDA 4A3BJ 4M3FA 2H1LA 5AN4A 2HQNA 3OH9A 3CCVI 3QWXX 4FWMA 2KKOA 4OKEA 3CCEI 1FP2A 4M78A 1JTXA 2YG8A 4JRKA 1Q7YR 2WY8Q 1PP8F 1YJ9T 2ELJA 1WSJA 4JQFA 4M78C 3HHTB 3GFIA 2CJJA 2XC7A 3CD6Q 3KVGA 2OZSA 3QNNA 2HW3A 3IG1A 1D0YA 1GV5A 5LHIA 5ADXA 3A8LB 2CG4A 3HXMA 4CUGA 2JMWA 1YS6A 2PYJA 3D7EO 4BWMA 1YBYA 3QOEA 2QTVA 3T7ZA 2W25A 1Z67A 2MD5A 4DFJA 1YITA 4XRMA 2EQKA 4CJ3A 4FLXA 1D5VA 4C92A 1YIJQ 5BNGA 2HI3A 2HHUA 3I0WA 3KKSA 4CJ5A 3GX4X 1EKEA 3DRSA 1MMDA 4MMKA 4C92C 1ZR4A 1R1UA 1WNSA 4HBLA 1J75A 2BBYA 4EM1A 1TSFA 3KD1E 1M1KR 2KLOA 2L3PA 1S1TA 3TSZA 2LFBA 1HBXG 4E4HA 3K58A 3T1BA 5KYNA 4KT0E 2QKLB 2O5RA 4HCCA 1VQKA 4PKHA 4FJ7A 1Z0XA 5JVGF 2JTFA 5GIOA 3MCAB 2CGPA 4RGSA 3H08A 4F17A 3ZEHA 2E2HJ 3EAEA 1YOVB 1BIUA 1HSJA 1B1BA 3G71I 2D2WA 1QS4A 2DJZA 3HT3A 1ZG1A 4CZKA 4AIDA 1UGPB 1GHCA 2ASMA 1I5LA 1RDDA 1OYWA 4A59A 5LEJA 4PZJA 2JQ7A 3ZQIA 5D4SA 4LD0A 3AVNA 2KJBA 2P0QA 2Q2EB 4MQ9F 2NS0A 3L42A 5JLWA 4F3OA 2STTA 4BE1A 1I0CA 3PSFA 1R6RA 3DLEA 4A61A 1TLHB 2JMAA 5J6XA 4JDSA 2GBYA 2WBNA 2K3FA 1UWBA 2HTSA 1O3QA 3F8BA 3I0XA 1IO2A 3CHWA 4LG3A 2GX9A 2LT4A 2R93J 3FZVA 5FKNA 1I5OB 1TWAJ 5DM6L 3G6EI 1LEAA 5JFRA 3B8AX 2ZPFB 4P55A 4XTZA 1U8BA 1WHLA 3PMIA 2NVXJ 2E70A 5CVVA 2IP2A 3ISPA 3MKWB 3TOBA 1KC8O 1X9SA 4CA0A 2F4OB 4Z4CA 4BG9A 2XGEA 1JUSA 5IP6A 4M77D 2ZGZA 4G7OF 1NBWA 2ZXHA 2XI9A 2ZPHB 4KV8A 4RLQA 2MA3A 1C6VX 2X9HA 5GANg 5EG2A 4BNCA 2NOZA 2ROLA 1U9OA 4I76A 1LOTB 4DR1K 1N5YA 3CDLA 6PAXA 2EZKA 3CC7I 3TP0A 3HXLA 3HYIA 1XGNA 1EZZB 1OPKA 4FZZA 2DT6A 2QM3A 5C4JJ 2PFUA 4DR5K 4PL7A 2BUDA 4CECA 2DFIA 3L8BA 2QQSA 5D6EA 4C3HJ 4BRMA 3OMGA 5IT9K 2DK5A 3JB9H 4DBRA 1K4US 4A0XA 3GW2A 1P7MA 4UC4A 3H5RA 3DQVC 2P4RA 5J1RA 4WCEL 1X3MA 3V9SA 4Q0BA 1R5ID 2JT1A 4HTUA 1BKBA 3ASMA 3NWTA 4EMKA 1HR0K 2ZXJA 4U0WA 2QSGX 1ABQA 4OOIA 3V4GA 4EMKC 1VQON 2DTHA 3CCVQ 3CCEQ 1A04A 5AQMA 3EYZA 2VGMA 5BQTA 3CO6C 3VYSB 3CETA 3TAMA 4CHQA 1ZLKA 1N77A 5FFXA 2KYMA 2BY1A 1YQRA 3BPXA 3SBTA 1WEFA 1ZTRA 3O3FA 3LGFA 2QENA 1PG5B 4ORZA 2HNZA 2DA4A 3ECHA 3HVTA 1MJ9A 1KQSM 3BT9A 2FG0A 3MKLA 2G0EA 4CHNA 1ACMB 2V1XA 5FU6C 2X6NA 1FJGK 2ITGA 2BDPA 3D2EA 2VT2A 3CDIA 3HKZN 3EGDB 2UUBK 2BE5F 4AM6A 3K4CA 1K78B 3U21A 4CZFA 1U48A 3AT1B 4FX0A 4LB5A 1UFFA 4E9GA 2PMZA 2RQTA 4C8KA 2HNHA 2J7IA 3SEZA 3CCUT 1V76A 4J9DA 1RNHA 4B9LA 1KXPA 3O5BA 2ECZA 1WHGA 2H56A 2RI5A 3LFKA 2P5OA 3ROUA 1SC7A 3H0GJ 1YWOA 2LY9A 3G71Q 3GOXA 1UG1A 3SJMA 2YKNA 3S1QJ 4BRPA 4W5TA 2HEQA 5CQXA 5BPIA 1ZUYA 4XRFA 3M9QA 4DTJA 3REAB 1IRGA 4R8HA 3K4LA 2R7TA 4A54A 1MWKA 3P39A 1QSSA 4J7FA 4G6TB 2I0NA 4CZJA 3PVLA 4DTOA 2H8HA 3WGHA 1XDSA 2PZSA 1N25A 1BA0A 2CT3A 2XASA 3BC8A 2KZMA 3SZGA 3B02A 3CP2A 2XIDA 2J06A 4DFKA 1XHXA 1NZ9A 3I5UA 1YI2I 2D6FA 5DD4A 2GQQA 1WJAA 5BR8K 5MLCQ 3CBOA 3EH1A 1HNWK 2R7ZJ 1XOVA 3WU0A 4UY8O 5J1UA 3H6EA 4OFHA 3QQAA 3JRIA 4M3UA 1NJIR 2CV1A 4DV6K 2DLLA 1NYFA 4DTSA 1RI9A 2YUPA 2L4MA 3G6EQ 1QPMA 5F1RA 1TNTA 2BANA 3BEXA 1RBTA 5EC7A 2LCLA 3SPYA 3ABTA 4AYBN 2DA9A 3ZSVA 2UU9K 1WLPB 1O13A 4JNEA 1SZ2A 1X19A 2DE0X 5E3NA 4PJOA 2P9PB 1VQ7T 3CD6A 4BC5A 3VGLA 5GAN5 3RJPA 1ZH5A 4PJOC 3N4MA 3CC7Q 3AKZA 1A31A 4ZGJB 4KGXB 1VQ4T 4UY8I 2DD4A 4CEZA 2VC1A 1WH7A 2Y0MA 5AQHA 4EJUA 5GMKi 2VBYA 2P6TA 1YIJA 4CC4B 1R49A 3TL4X 5IP7J 3OS1A 4E7HA 5I21A 1LWEA 1XSVA 2QK9A 1VUBA 2H27A 1HNZK 1CXUA 4NHJA 5DM6F 3DXJF 1W2BM 4FJJA 4I0AA 3ZL7C 3GL1A 4OMQA 1HK9A 4LH4A 2PJPA 2YLBA 2VB6A 3QPLA 3EG9B 4CCKA 1VQ8A 3J7ZO 2EVRA 2P0PA 1KD1U 1O4XA 2CREA 4F91B 4F52A 1N6AA 2GXAA 5AQIA 4J2BA 2FJ1A 1RI0A 5LL6S 3F9MA 2V1RA 4JI3K 1RBRA 5C2DA 5GPAA 2X74A 3V9XA 4OLAA 1RKTA 4PFPA 3E9PA 5K5QA 2L3RA 2LY2A 4BC2A 4LNPA 3EG2A 3IC7A 3IKMA 2E60A 4BUGA 4PIIA 1W36D 3VW4A 4RWTA 2F7TA 1JLFA 1FYMA 1WSFA 2DK8A 1SUQA 2QA4Q 3G4SI 3BF1A 4CSWA 2BTFA 3GG4A 3VN5A 4DU1A 5GAMg 3D45A 2QGFB 2CQQA 3HRTA 4PKIA 4DMNA 5CKFA 3Q0WA 3L3VA 3CCRN 2WA0A 2KZZA 5HDGA 3OMYA 2IIMA 3HHGA 1TH7A 2RHZA 2FUG2 5HODA 2QWNA 1VRUA 2Y2ZA 3JCMX 4OB3B 3M07A 1QKWA 3J80K 2LP0A 4BVPA 1CZ9A 4A4HA 2DW4A 2FA5A 3SWNA 2KIFA 3MZHA 2F9TA 4UNOA 3THYA 2V7FA 3VYUB 2IPOB 2XHKA 3SWNC 5KYXA 2RQUA 1YUWA 3AVKA 4F4KA 1BBZA 3OL4A 4Z88A 1MNMC 2D0NA 2G8UA 2K79A 3R6MA 1LDDA 4GV9A 1XGOA 2PMUA 2BZ8A 3EGXB 3MDQA 4BS9A 2F4VK 4A3FJ 1YW8A 1OLTA 2KR3A 1YI2Q 2HF4A 4BC4A 2LR8A 2L9NA 3OTOK 4LMYA 2QWOA 1J53A 1ZBFA 3HO1A 3HZ6A 1VSIA 4B3XA 2RQVA 2UXNA 1MUDA 2CUBA 2GAUA 2HKXA 4XLPF 3CPEA 3DXMB 1UJYA 5M1NA 4P9FA 2RHKA 3LL3A 3SAHA 1JGGA 4M73A 5AQQA 4PUOA 4L59A 4CHUA 1X9WA 4EW0A 1NK6A 1JXSA 4GV3A 1S22A 3X20B 1JJ6C 5JS1A 4M78E 2YHYA 2MH2A 3FM5A 3LAKA 4Z02A 2V1UA 5LD2C 5EEGA 2QF7A 2X4HA 3H9JA 3CWSA 5E79C 5F0FA 3SV4A 4IFVA 4MDBA 3WU1B 2E6MA 4DV3K 2FLOA 2E3HA 2K2MA 3KTQA 2X6SA 2OZUA 5C12A 1BCOA 4U0VA 2E2PA 3VPRA 2VBXA 4B1UB 3GTLJ 4EVIA 4FWNA 2XHBA 4Z0UA 1BU6O 3AVCA 3O4NA 2FBHA 4C92E 2HD0A 1RTHA 1W5CC 2L9SA 5ADXH 3M4OJ 1WI7A 5LMNK 3GF5A 2DXTA 2P9UA 4KGVB 1KG3A 3M4GA 1OKJA 2IBDA 1D3YA 2HMIA 4FIBA 4DYCA 1T95A 4RTYA 4O0IA 2JPCA 2LKXA 3P83D 3ULEB 3LSIA 3PT9A 4JD2B 2J6FA 1JKHA 2Z1HA 3CW7A 1XCVA 1J3TA 4YOWA 1QHTA 3MN7A 2VXEA 3IAS2 4CJKA 4KBOA 4F3QA 4IUUA 2P51A 1R23A 3CFPA 2OA4A 3NE6A 1E0EA 1JLCA 3ZX0A 1JEGA 2QK0A 3CFRA 1Q86R 4G94A 3NMZC 2FD5A 1E4FT 1BK2A 5CHZA 1R9TJ 3AGKA 1IO6A 2F8TA 3GBGA 3I4PA 1E6GA 5BPLA 1S72N 1UHWA 5LLQA 5IT9E 2W42A 2ZJ2A 4EMGA 1XMXA 2XAQA 1X1CA 4EQQA 3VQ8A 1RZ4A 2I7PA 4KITB 2F2XA 4I9LA 3OMCA 1CF7A 4S04A 4C8LA 1H641 1G59A 4GCVA 4Q5WA 2DL5A 1Z05A 1GOAA 2JVGA 2ZJRF 3G4SQ 4BJ5C 3IH4A 2NS8A 3S3MA 3WE2A 3JRGA 3G2BA 1JI8A 2DMUA 3JV3A 1JCFA 5HRPA 1T03A 3URGA 5FGMA 1AKHA 1SD6A 4NC8A 4KH4A 3BQYA 3OV8A 5C3EJ 5BRFA 2E1MC 5GJWB 2F2WA 2A40A 2Q36A 2JA6J 4KB0A 1WAFA 3MAJA 4NCGA 5J2NA 3VA0A 1JU5C 3G6EA 1JKQC 1S6LA 2YUOA 3TVTA 1ZSGA 3QPHA 4BY6C 3CJ9A 4J00A 1VSJA 4M7AD 3QYGB 3T9NA 1KVBA 3ZSZA 5CK9A 3TWHA 2PUKB 2FSJA 3W3CA 1N8RU 1U06A 3TU4K 2ZFUA 2VODA 3AVJA 2JZ2A 1RT1A 1ZGAA 3QPSA 2EB7A 4ILHA 1SMTA 2LRQA 1Z7UA 4Z4HA 4KHUA 1WSUA 2O8CA 2GWJA 3MN6A 2BHZA 4X34A 3H3ZA 5E1ZB 5ICFA 4KRFA 5CKDA 1KG1A 3BG9A 2BXZA 4UHTA 1XQHA 1RRJA 5L3DA 1ZG3A 4PFZA 1VQMN 4XM3A 3M53A 5AQNA 4ZYGA 3NDKA 3PO2J 4KIBA 2K4JA 1GLAG 5B1AH 1NNEA 1W0HA 1YP5A 3WTWC 4BRQA 3MEXA 4TVRA 5KN9A 1QCOA 5GAN4 4IUTA 3X26B 1OX9A 1KC8C 4E7KA 3A5LC 3KPHA 1BB9A 2HYGD 2BEOA 1R58A 1ZREA 4Y52J 2Q2EA 2HVSA 1W5SA 3LA2A 2LNBA 5CR2A 1PVSA 3C2GA 1KO9A 1STZA 4CGFA 5GAMd 2HDDA 4M75E 3N97A 2CO5A 3M1EA 1WHKA 1FX7A 1B4AA 3HIFA 3ZPLA 1KHCA 1ODDA 2HQXA 3F0CA 2KNBB 5FPDA 3CF2A 3L2QA 2EFNA 1X01A 2YRDA 2P7VB 2DAOA 2KK4A 2QZ8A 2B5JA 1FSEA 2EZIA 4M7YA 3OYKA 1U9NA 4HCKA 3SUOA 1T2KA 2F8SA 2DN0A 2XPWA 2QA4A 4IO9L 1KVCA 4CO8A 4II2A 2NUTA 3RWUA 5E84A 1NK9A 3PO3J 2BTTA 3KK1A 3LM2A 3LSHA 3CCJI 5AFUA 3TTDA 1QVFA 3D6RA 2LCCA 4J8OA 4MTDA 1WFXA 2IG0A 2XSDC 3KZZA 2GOMA 1NJWA 1VK0A 2IS3A 2PQ8A 3GVAA 3L3UA 1HW2A 4OKJA 5IT9Z 4AHUA 4CJLA 3I33A 3TSUA 3N0UA 4BUPA 1XD7A 5AQUA 1YJ9N 4DKWA 4A2AA 4FISA 3GCMA 2L2OA 3NQOA 4CCNA 3RZDJ 3PM1A 2MABA 1R8OB 5CYVA 3KP4A 3SAFA 2HHXA 3EGUA 2XICA 1A6IA 4BDYA 4H5TA 3U3YA 1UGRB 4WCGA 3I35A 2ID6A 2WSFE 1YVUA 3NVMA 3R6OA 4BE2A 2QTDA 2N8GA 3JXUA 1AWWA 5D5UB 2DJIA 2ZPEB 3LZJA 4C8NA 3QEXA 1P92A 4C8QB 4JJDA 2EKHA 1XNIA 5LJWA 3LPTA 1M4ZA 1SFXA 4IO8A 5KE3A 1BR1A 2ISYA 4JKAA 3DF8A 1MH3A 3EG3A 4M77F 5HP1A 1SRLA 4YPRA 1JL1A 2K7AA 2YHAA 3OA6A 1SFKA 3VTIA 1NMDA 2A0FB 4FSSA 1N75A 4DSEA 1QVGA 1REPC 1PRMC 1P4XA 1VQ9I 2D4WA 5KCMA 1KU7A 1TK5A 2HBMA 1ZRDA 1HUXA 2ZGWA 1N9RA 4EJOA 2K3PA 1V1CA 1YWPA 1MBJA 3WEEB 3CJ1A 5CYQA 1JLEA 3VF4A 1T3VA 4WK8F 3CD6T 1TT5B 1JL2A 1B8IB 4PY5A 1FIPA 1ZK8A 2O6GE 2ZJPF 2KT8A 4N4GA 1Q1HA 4G1QA 1PP7U 2LMJA 3O6BB 2V8KA 1R1TA 1SFOJ 1YO5C 2K9SA 1PUFB 3AARA 2DPDA 3LWLA 1OV3A 3LZIA 1C0WA 3FJ5A 3ATVA 3VQ7A 3CUQB 3D2FB 3TR8A 4JK9A 1YIJT 3ENBA 5HOOA 5AR0A 2CQ7A 3GF2A 3R2XC 2HL3A 4J8FA 4PSXA 1FY7A 2KISA 2E1CA 2BXYA 3FZHA 4BI4A 3GLXA 2LQNA 2MD0A 1ZYRF 1S1WA 2PZ1A 5LJ3g 3QKJA 4DSFA 3QSUA 2VG7A 4H0XB 3J80E 4BR9A 2QASA 2XAGA 4XLEA 4NL2A 1O75A 2KRSA 4MZMA 4O4GA 3HK2A 1MV3A 2HMPA 2Y4XA 3G0QA 3TSWA 1Q7YO 1YS7A 4XN0A 3BDDA 3DB3A 4A4EA 3B6AA 1Z6TA 3NH0A 4IEEA 3FDYA 3VERA 1QCNA 1Q95G 4W5QA 3I9QA 5HDNA 1Z7LA 5KHDA 5D5VB 3THWB 1ONVA 1NM7A 2DOEA 3PIOL 1GXIE 3CC2I 1B9NA 4CJSA 1F4KA 1HW5A 3GIBA 1D9FA 3I71A 3IS9A 4XTUA 2QAZA 1WSEA 4MNUA 3SUQA 3KJVA 3M7GA 4B24A 2FXUA 5C6SA 2HGCA 1ETKA 5KPZA 2M02A 1M1KO 1H92A 1CZBA 1CLQA 4MO4A 3VGKA 3BPVA 1WVRA 3BF3A 3VUBA 3G4SA 1LE8B 3P31A 3LA7A 2DL4A 4RTFD 2KGTA 4M7DD 4HF2A 3PIPL 1KQSA 2X6WA 4BC3A 1A35A 1HPZA 1OU9A 3VS5A 2A42A 3LSGA 2K3BA 3CCJQ 2NOGA 4M3ZA 2HZTA 1IB8A 3BJOA 2AKLA 3I8BA 5AJ3K 4PLLA 2NRAC 3BQZA 4V19K 3CBPA 5LJ5j 4CJRA 4BQZA 1BR2A 1FWZA 1FYLA 1S7OA 4P1WA 3V1RA 3RNJA 2FMLA 1JQQA 3ALYA 4A3DJ 2B0LA 2LVSA 3ULDA 2ZFWA 4H4KC 1JJ2M 2MYSA 3O4WA 1EX4A 2KRMA 2X6YA 2KKZA 4N0AA 2EINH 3F8NA 2VJJA 1IRFA 4AIJA 3WVDB 4KI4A 2E4HA 2ZZDA 4OMPA 4N0AC 4CK1A 2VGNA 2HHHK 3THKA 1AVZC 2RM4A 4FLWA 1YJWI 2Y0SN 3W2AA 3G1LA 1ZN2A 4E9FA 2JVHA 3J7YP 4C8QD 4A63B 1WJQA 4UOBA 3JTHA 2IGNA 4LOCA 2CRGA 1VQ9Q 4RB1A 3CCVT 3CCUN 3TANA 4A2BA 3CCET 3VS2A 3JRAA 2L02A 2W03A 1YTYA 2Q2RA 4L0YB 2F5VA 3SYTA 1IRZA 4J01A 2X1DA 3L2WA 3AGRA 3MHXA 4C0DB 3ERMA 1R0CB 3O8GA 3AAFA 1ESVA 2DY4A 4MO5A 4BG8A 1JKRC 2I5UA 2B4JA 1VSLA 3SUNA 4XSZF 4WE1A 3VDXA 1X1AA 2YNGA 2A69F 2DBKA 1KFZA 2D0AA 3DJCA 3HG9A 3FHFA 3J80Z 4QVZA 1U6ZA 5KYUB 3OR1C 3QBYA 1W7AA 2OTLI 1SAXA 1KAYA 1FYNA 2FU4A 5GAN7 2G9WA 3SQ2A 4DK9A 4J2DA 1UTIA 3QEPA 4CBUA 1XTDA 2XF5A 2C06A 1HW1A 1YJNA 1JT6A 1YQAA 1BC7C 4AFQC 2X4WA 1UHCA 4PGGA 1BN5A 1RR7A 2QGUA 4DV0K 1QQOA 1Q86U 4CYCA 1Z9CA 1HYZA 3G71T 4AIHA 2HHTA 4FLYA 3FC3A 3CJCA 4HUFA 1VQPA 3HM9A 1Y0NA 1QLYA 2IIRA 3WNGA 2ZPGB 2W7NA 2GFUA 2KDSA 2XRLA 4Y33A 4FK4A 2AT1B 4XMYA 2A28A 3CCSI 3PTAA 4ESFA 4QOZB 2R5YB 4E2FB 4CIGA 3CC2Q 4IL6C 3PV8A 1VQ7N 1WJRA 4BD3A 3GEZA 5C4XJ 5GAOq 3KEOA 1RTDA 5HS9A 1UE9A 4XTWA 1XQSC 4CESA 5AQXA 4YHHK 3VMFB 4OMZA 3KWIA 1VQ4N 2LREA 1O7FA 2ZPBB 1S1NA 2E5NA 2QQRA 3RMAA 1SKUB 2LC2A 1JLAA 3RMDA 3DXKB 2FB7A 1Y96B 1WSIA 2KZGA 2D0PA 2VLAA 3VPZA 1WZ2A 2O88A 1XGMA 3G6ET 1XUPO 3ID8A 3E01A 4Z89A 2VCPA 2Q1ZB 1XC3A 2JUGA 4Q48A 1KHIA 2D45A 5GJVB 3OVNA 2M34A 2O2OA 4FE4A 3CPWS 1S9HA 1XGSA 2HDWA 2QDYB 3P5JA 4M3XA 2DILA 3LP2A 4X0GA 3RMBA 2RI3A 3E3VA 2EV6A 4EMSA 1C0MA 5LJ3d 1I27A 2CZ0B 4CC7A 5JR3A 5DK5A 4JLGA 3QIPA 1OVQA 1NLOC 3AG3H 3CC7T 1IKYA 4X1EA 2VQLA 3H5NA 1YG2A 5B5EC 1RACB 3REBB 3QOPA 3VYGA 4OJRA 1XI1A 2MC3A 4BQAA 5JHUA 3KLGA 4GW6A 3ULEA 1Q81R 3UA7A 4DOVA 3FHNA 2W40A 4JD2A 1XMKA 3F6OA 4AM3A 2CGKA 3TMOA 3FXQA 3KXTA 1NJIO 4XQ3A 3IH2A 1YJWQ 2PUOB 3PIPF 3BLYA 3SJJA 2FBTA 2M2EA 2ITMA 3VEOA 3PFIA 2M1BA 3LANA 2NUPB 3BOQA 3I54A 1SS6A 1JKOC 5J3BA 2RREA 4A3KJ 1TUDA 1AT1B 2LCSA 4BHCA 4CZCA 1SVMA 2V79A 2PNIA 2IOCA 5B3SH 5FLXO 2KIQA 4FHTA 3E2UA 4NCBA 2YUNA 1OULA 5CY4A 3M5AA 1YTAA 1NGFA 5EVZA 5J8FA 2H1KA 2FOWA 3VJPA 3MKZA 4FCYA 2E36A 3E5XA 2ZE2A 1IV6A 2K7LA 4UUVA 2KQRA 2Y75A 1B72A 4H4OA 4HUEA 3BE3A 3NMUA 4CZIA 3KEYA 4I2OA 1BDGA 3K10A 3BP8A 5D6WA 3QINA 1Y1VJ 1GCQA 2HPMA 2QKMB 2P9SA 4PWDA 2Z16A 4HWIA 5FWCA 3IFRA 3MEUA 1GCQC 4QQDA 4C23A 2MWOA 2GWKA 5F27A 2GA1A 4BR7A 2OTLQ 4KUDK 3OW2M 3HPGA 3CJBA 3ZCMA 4JX5A 4HDUA 4DTUA 2KTQA 4B21A 1B7TA 3LSRA 4H0PA 3SHWA 1LWVA 3MN5A 4RA2A 1RGIA 3V8LA 2P5GA 4WF2A 4LD6A 4KO0A 2UXCK 3WNEA 2GCXA 2D1VA 2SEMA 3KZYA 1OVYA 3RQIA 3REOA 2BW3A 3TAGA 4GYGA 2WACA 3BG7A 4CEBA 2OZ6A 1ZARA 1UMQA 4XTXA 2O8FB 5F64A 2V52B 4UB6C 4Y13A 4E9HA 3JB9G 3CCSQ 4ESJA 5AFUH 1VQ6I 3F22A 1NWKA 2MLGA 3M57A 1NKCA 4Y91A 2DD5A 2BY0A 3R0AA 4PLIA 3I58A 3B6PA 1VSKA 2QGGA 3AY9A 3A8HB 2RQQA 1YTUA 2Z5UA 2RV8A 4IFYA 2F5EA 1KQ1A 3TW7A 3MEGA 1YI2T 1VSEA 1NK4A 1MNEA 3GUDA 4B8CA 3HOYJ 4RW4A 3LNQA 1FMWA 1S1XA 3P9CA 2XGCA 3SMSA 2RJCA 4M7AF 1RLQC 3OSFA 2CGJA 1QWEA 1GLBG 3DMJA 1LWFA 4DR3K 1HJRA 4A3LJ 5L3GA 2GF7A 1J5OA 4Q4ZF 4L9TA 3JB9I 4EMHA 4M3RA 4JBAA 5CR4A 4GXOA 4J2AA 2IVPA 2NRTA 2ED1A 2IDOA 1WIEA 1YHQA 4ZZDA 2UWMA 5K5OA 2O31A 4QS7A 3CPWP 4YG2F 3ERED 2NXNB 1KQ9A 3VOEA 1XTAA 3PNVA 3FE1A 2M7AA 4EZ6A 3LSTA 2A05A 3X25B 3CQXA 3LALA 2F4MB 3ABUA 4AHSA 3HZJA 1BI1A 4NL3A 3F2KA 1CQTA 4EVVA 2EV0A 3F8FA 3G7ZA 2XDBA 3AA4A 4CFCA 1RAGB 3W0LA 2EX3A 2P5VA 4DEXA 1RADB 3S1NJ 1V3FA 1D5AA 1JO8A 4O55A 1WQ7A 2X6OA 4M4ZA 2IS2A 2IA1A 4M71A 2EWNA 4KHQA 1LKXA 1X58A 4HNVA 2QBYB 3CJQB 2K4BA 1S5JA 3BTJA 4ESBA 3CJTB 1EQYA 5B8HA 3K5NA 2GFAA 1C1CA 1SMYF 3KLFA 2BVMA 1N3CA 3V8JA 4E7ZA 3P1GA 3X24B 3TBIA 3RESA 2R4GA 1YRNA 1VSFA 2FBIA 5J4YA 3WU2C 1NGEA 3MN2A 4XU0A 2ED0A 1R36A 1OISA 2NRHA 1XWLA 2LX7A 4J5YA 2JM8A 1WHHA 1X3NA 4EJVA 3HTUA 3Q1JA 4JK7A 2OU2A 1MGTA 3HPWA 3LDNA 2MW8A 4M77A 2WAFA 2QWWA 3ZXSA 1TL3A 2JJ9A 3KHYA 2GTOA 5EU7A 2QQBA 4OPKA 4KI6A 4C0FA 3I56I 4M3TA 3CC2A 4M77C 3GTQJ 1T98A 2JN6A 2C0TA 4BROA 1YX5A 3ESWB 5AQRA 1WHUA 3D0PA 4A69C 1X3WB 1NGHA 1V5GA 5EY4A 3FXJA 1Q82O 2KE9A 3G4ST 4IHYA 3IRRA 1G2BA 2A37A 2KRFA 2QW9A 4CJTA 3EDPA 2OBPA 1VF9A 3U23A 1H88C 4KTWA 1AD5A 3P8DA 3CMAA 3WEEA 3M0RA 2CSQA 1ATNA 2EIFA 2FSNA 4LLNA 1Q7YC 1B8IA 4IQJA 5A2QZ 4ILGB 4M6VA 3GTPJ 4IOAL 3QBWA 3FFKB 2P8TA 1FTZA 1VSDA 3RUXA 3K5LA 4BQLA 2FF6A 3TSPA 3BJ6A 5EOYA 5GPCA 1WHMA 1VQ6Q 1DQUA 3HEFA 2CQKA 3H35A 2A1RA 1K8AO 2OAWA 4MMLA 5HLGA 1T39A 2F4IA 1LUJB 2R5AA 4G7ZF 1OPLA 3U9GA 2DMPA 2RGVA 1XPXA 5JLXA 1M1KC 1PHTA 2M9UA 5E26A 2XB0X 3VQPA 4CRIA 2FMYA 2E34A 1Q9XA 3EFOB 1WJFA 1U78A 4LG0B 3R8EA 2DPNA 3PSIA 2DOFA 1WX6A 2O01E 3DLLL 3O4QA 1D1BA 3H3VK 2PMZN 1IN4A 3M8RA 2VC8A 1OYYA 4RB0A 2G8IA 4ISEA 3GNGA 4RM3A 3FF5A 3QRFF 3WHBA 1Z77A 4IIMA 1M2VB 4EA4A 4JRPA 4NXNK 4I02A 2NWMA 2YJFA 3LX7A 5KCOA 2HS5A 4XK4A 3OWTA 2YJEA 3KYCB 2V8IA 2FPEA 3E9LA 3VA3A 1IG9A 3CEYA 1TAUA 2J6OA 2MLKA 1HSQA 5F0XA 1NH3A 4A3MJ 1N36K 3D5RC 2YRCA 4BGBA 4CK2A 3ZQFA 1M90U 2KIMA 1HSTA 4J6WA 1K1ZA 3MN9A 4KKOA 1HQUA 5F0HA 1LE8A 5F1JA 5J1EA 2DFFA 1YCSB 4L9NA 3I59B 2FO0A 4XH5A 2FX0A 1LFBA 4MEXF 3E5UA 4IEIA 3JSOA 2DX1A 4JI4K 4H0VB 3C0CA 1MWMA 3CLOA 2DFUA 1T38A 2QEXI 1QCFA 5J39A 2ZMEB 3T69A 2F9WA 2NRRA 3FK7A 3O3GA 4A4KA 3K4BA 1C1BA 5JHFA 3AG2H 3LAPA 4CBXA 3WQUA 4CIFA 3ZT1A 4BQOA 5GAN6 4M78B 3BZ6A 1WUAA 3RMCA 2YUQA 1PKSA 4A5AA 1RAIB 1K4SA 1W1WE 1M1GA 1F1BB 3CD6N 2XMFA 3CMEI 3M54A 3S16J 1KLNA 3S17J 2MAMA 1TP4A 2DCEA 4ISGA 2K85A 2YG9A 1W70A 3I56Q 4M7DF 2L01A 3UIQA 5GAEP 5BOXA 2NOFA 2QWPA 3FZLA 4FYYB 4NYFA 1YIJN 4B9VA 1M90C 3JB9J 3GZ5A 1OH7A 3TCJA 4WXHA 3GXOA 2MWPA 1P4AA 4B09A 3EFSA 1WJBA 1FP1D 1G8XA 4B9UA 1XN7A 2PJRA 3A1PA 2JM9A 1GBRA 2VKVA 3CG7A 2CKKA 3JAMO 2K9QA 1PJRA 1KFDA 4OAYA 1AZGB 3DLHA 3FISA 3VV0A 4DB3A 4P9UA 1WNLA 3BG6A 1NG2A 2ABKA 1KZHA 3SB2A 3FXMA 2VE9A 5EG0A 4KHYA 4HAMA 3B6OA 2AK5A 2DTZA 1E17A 3M9AA 4GV6A 2COBA 5BR9A 4ENJA 3F6VA 2M0YA 5KYUA 3CC4I 2A1SA 2D8JA 2JHJA 1IAWA 2ESWA 1OPCA 3V7SA 5M5XJ 1Q81U 2DMTA 2C6YA 4Q5VA 1WXTA 1G3WA 3C2HA 4BJTA 4BR0A 4Q47A 4JZ4A 1RAEB 2COYA 2CZ7B 3N05A 3HOWJ 5GAN8 2VKEA 2LVMA 1J6ZA 1FTTA 5KGWA 1CSKA 1SFEA 2EAYA 2EYXA 3HTRA 4FJ9A 2ADUA 3AA5X 4MZPA 4A3EJ 3VS1A 3PNTA 3P9KA 1WOQA 3IMXA 2D5VA 3H6ZA 1XMOK 4FT4A 1OCTC 5GANj 4D5CA 5EDNA 1TUYA 3EL2A 4UUSA 5D6XA 2JZYA 2LDMA 4QVCA 1YW9A 4CERA 3DOKA 3ZMUA 3J81O 1BISA 4RW9A 3FGUA 4JS5A 1TGOA 4DSKA 2JNGA 2YDLA 4MTEA 2MG4A 1AA7A 4ICLA 3O3KA 1YITI 1ENHA 4ZHRA 4G9YA 3S9HA 1QVFS 2EYWA 1X1BA 2XUBA 1IUYA 2XHCA 4AHCA 1XX5A 4RLFA 3DKWA 5LBQA 4IUVA 3CP8A 2YX7A 1KG5A 3UWNA 1JXMA 1HXDA 1ZYQA 1MZBA 4E7JA 5JS2A 1O7LA 4PDKA 2HBKA 3NCIA 1VQKI 3EUHA 4ID1A 5IHNA 4F7UF 3NF7A 5IY5H 4A2UA 3K70C 3EUHC 2QEXQ 2Q0RA 2VONA 1L3TA 3C6UA 1TU0B 4L5JA 1Q1VA 3DKMA 3IKVA 2HSEB 3CCJT 1UGQB 4OB1B 3C6HA 3SFZA 5DM7R 3K4JA 4RM2A 2OF7A 4YIRX 1IF1A 1X69A 3CCVN 4HVJA 5M3MJ 4LGWA 2VN2A 2HXIA 4L3QA 1KQ8A 2D0CA 2VIXA 1Z26A 3AO2A 1UELB 5KVRA 1VAZA 4FOIA 3CMEQ 4GFBA 4F7UG 4M78D 4XLFA 1DGWY 1U3EM 4QKUA 1Y39A 5H20A 2H3JA 5FKOA 3RPUA 5FU6B 4KISA 4EDUA 3GDQA 5KPTA 5AQPA 4A0YA 1B3QA 4IQ4A 3DP7A 1D8KA 2G8WA 2FQ4A 2LYCA 1OOTA 2PAVA 2RHIA 3OR2C 1SKWA 2FQ3A 5EZGA 2M45A 4FVUA 4NDLA 1EIFA 5LMUK 1ZXOA 1J7KA 4KICA 5KCHA 1SAZA 1IJJA 3QYHB 3D2EB 5AQOA 1U6GA 3I0RA 4K42A 1YYVA 2F48A 2CS3A 2W85A 4PNOA 4OMLA 2EBPA 2RN8A 4FT8A 1MBGA 1H0MA 4C92D 1R0BG 5AYFA 4E3SA 1VQ9T 3VS3A 3DV8A 3PX4A 1MGQA 3ML6A 4CHPA 2FPDA 1VNDA 5GAN3 4ESRA 3PO5A 4CJWA 2CW0F 3ENHA 3ABLH 3G71N 2G8VA 1K9MU 4XSXF 4EGZA 5LFAA 4DYQA 1W0UA 5FLXK 4QLCU 4GVMA 2E2IJ 3VQ5A 2YUSA 2EGEA 2CH4A 3U4LA 3I0SA 3TREA 4XBFA 3CC4Q 3GWZA 4B22A 3M55A 1TKTA 4KA4A 2OANA 3QESA 3F23A 3P4IA 2HOSA 4CHOA 1HKGA 1ATSA 1FT9A 4RTXA 3S2DJ 1SKSA 3QAHA 3HGGA 1QBJA 2O7OA 2WTEA 3FZFA 5KRSA 1Y1WJ 4J19A 4DGWB 3H0IA 4CJVA 3ZT3A 1XS9A 1V55H 4B3SK 5L8RE 4V2FA 1XB4A 3OBYA 3R6SA 1MV0B 2MH9A 5I11A 5LJ5d 1GLLO 1LEBA 4BQQA 4FM2A 1PDNC 2XRIA 1WQWA 2E7WA 2O8FA 4HX4A 3OSVA 3JCMc 3CO7C 4C5IA 5ED4A 2XDVA 4AG1C 5KNLA 4J6XA 2X4JA 3WTYC 3G6EN 3FKIJ 4H0YB 2ATCB 3CXCS 2OZMA 2UUZA 3MWTA 3K1NA 1K8KA 3ELKA 7AT1B 3O6WA 2RB6A 4W5OA 5FD6A 3QXEB 3FMQA 1YITQ 2I5WA 1I07A 3T8TA 4UV8A 4HSBA 3G10A 1Q82U 3CC2T 4RG8A 4PJOB 3MXJA 4C8QE 4E6RA 3HGYA 3T3FA 4NLCA 3CC7N 4K2EA 1WQ2A 4D9JA 4RW8A 2K4YA 3I56A 2JUCA 1RIOH 4IOXA 1ATRA 1X43A 3QICA 2UXXA 1VQKQ 4B3MK 2IGKA 5GMKh 4C8MA 1IZ6A 4AQYK 1RDBA 4JEPA 1ERDA 2B86A 3S1RJ 4MFBA 4FL6A 1HLUA 4CH7A 1AZEA 4KUMA 1D1CA 3RIRA 3V42A 1NOYA 5HRSA 2A5YB 2LMDA 1RDWX 1WEGA 2RHXA 5AIQA 4KH5A 1MIJA 2COWA 2DA3A 2P0WA 3QDFA 1E2XA 3ZMZA 3LDPA 2Q0UA 3VGMA 4PJOG 1XC5A 2QSFX 4ILJA 4NO7A 4DV2K 4GYIA 4PL6A 2IS4A 4M74A 2EGAA 3SD4A 2OJED 4IURA 1OEBA 5AZJA 2JRTA 2GBQA 1WLJA 3H36A 4OPAA 4NOYA 2STWA 3GNFB 2BGGA 5GAMj 2AO9A 4B08A 4AFZC 2TCTA 4FT2A 2QBYA 4L8RB 4M75D 1Q82C 1HYSA 2NVYJ 3DEUA 2DYBA 5E3MA 1K61A 1UGSB 4KUIA 1J5EK 1PU6A 2RO0A 4RTZA 2FF4A 5HY6A 2XROA 1HYVA 1YJWT 3WVEB 4I6MA 2QA4N 1VHXA 3JRZA 1SHGA 4FLZA 2G7UA 3Q5FA 3G25A 1QGPA 4JOMA 3VRZA 3DPLC 4ME7A 4GKKK 1I3AA 3PNWC 3TW6A 2KT0A 4CEEA 3TDZC 4Y0WA 3VESA 1VSHA 2MMPA 4A5BA 2XHIA 4Y28E 2CWEA 1Q18A 3HKZA 2E64A 1ZLJA 4K8XA 1X6BA 5HS8A 3SWNB 2KY9A 4AIAA 3CQZJ 5DTDA 1K8AC 3EHQA 2K2VA 4RB2C 4D1QA 1M3QA 1JHFA 1KAZA 4IX7A 3BY7A 1S29A 1SVOA 4MIMA 1FNNA 4FM4B 1NK8A 2A6HF 1E7OA 3GTGJ 1H3ZA 4ZDPA 1WJSA 2OTLT 4A3CJ 3VQ4A 3RDIA 3HI0A 1IG8A 4AI5A 1YI2N 4ZN3A 2VWJA 1LVAA 4BDPA 2HF3A 3IUOA 1M30A 1HJDA 2CQNA 4WFBL 2VKNA 1VQ8I 5IAYA 2R7FA 1WWXA 5HVQC 2ZKZA 2QEXA 3T1AA 4IUQA 5DYMA 3C12A 1HKBA 3D7SB 1GBQA 3QYFA 2EZLA 2YU3A 2WTUA 4B9XA 2WB1A 4J9IA 5E1XA 3M1FA 1X3UA 3ASNH 1NTCA 2HQRA 4HSRA 5LJ5f 3CCST 4NZGA 4C2UA 1QVPA 2NLUA 3CXCP 2K40A 5GAOp 4FZXC 1UG0A 4RW6A 3V7CA 3HOSA 3NH1A 3I64A 3CMEA 4FL9A 5HNFA 1WJDA 1QWFA 2RJEA 2DTIA 2D0OA 5JMVA 4DG1A 2ABLA 3HDDA 1QA6A 3RERA 1MBFA 4G12A 2D1XA 4Z8AA 4CCMA 4AYBA 1V4TA 1MSEC 3FM3A 4LLGF 4IG0A 1M2VA 2FYKA 4B3RK 2P4WA 4L0ZB 5FKLA 4Y17A 3MEEA 1G4DA 3FMRA 1YCYA 2AJQA 3IWFA 4C5HA 4LDVA 1KEAA 5FPNA 3Q7BA 2VUBA 2ZXWH 2JS2A 2NYSA 4EHTA 1M9SA 4S05A 1DP7P 4ZN1A 3SBGA 4CZGA 3MP8A 4BYYA 4IHVA 3L00A 4KBMB 5CVRA 4DBFA 3ENOA 3T0YA 3PL8A 2HHVA 4JPBW 3FR0A 4CW7B 5EYRA 1MMAA 3KIOA 5LJVA 2JA8J 3ONQA 2F69A 3GP8A 5GAMh 1F5TA 2ZB9A 3E97A 2YR2A 2HVQA 1BUPA 3QG1A 4Z4GA 3QP5A 2EQMA 2XD0A 3I59A 2SRCA 4LK1F 4AHRA 1NHAA 2DKGA 4JKDA 1C0FA 1ARKA 1FBQA 3BR2A 3PFSA 4BHPA 4JV5K 4Z4IA 2KDZA 5HLHA 2QWQA 3VS7A 1CF7B 4DQPA 5LGTA 2QWMA 1EO1A 1MBEA 3HM5A 3G4SN 1BJAA 1HKQA 3QZ9B 5AQJA 4H03B 3HOUJ 2E1MB 3ZSXA 3TO9A 2F2VA 4MZTA 1AKHB 1NGIA 1OCOH 1B07A 4PJJA 4CF9A 3PUBA 4JN4A 3RMQA 1A5XA 2OCCH 2OPQA 1I3QJ 2DRKA 4LN2A 1U1SA 1TW2A 1ZRCA 2CMPA 3GOIA 4BY6B 1O9SA 5D5XB 1EH6A 1V5FA 1Y97A 4M45A 2E19A 3JRCA 1K73O 1EP4A 3L2VA 3M3YJ 1QVFM 2KRHA 2KIUA 4GLMA 2LP5A 5J47A 2A3LA 5HRRA 2BVLA 3FSPA 3ZRGA 3FXLA 1IGUA 1SRMA 1SAUA 1WAJA 3CCRA 2OFKA 1MH4A 2O8DA 2K02A 3FMSA 1DUXC 1DKGD 1S5LC 3NARA 2DEQA 1MW7A 4B23A 4MQVA 3OIPA 5DMRA 2O8CB 5FO5A 3MJXA 2EZHA 1QQJA 4ISFA 5EGOB 4LSNA 1QVUA 3FWEA 1J9AA 1ZELA 3ZLJA 1SG5A 1T0JA 3BJAA 4ZNXA 1BW6A 3HTVA 3MWMA 4LIVA 3SK3A 3UA6A 1VQ8Q 3KETA 4C3IJ 2GUIA 3JCMQ 4MDAA 1DGKN 2EHGA 2P9LA 5FLXE 2A6AA 1W4MA 3JREA 5EJCA 2K86A 1GVDA 4DSIA 2G8HA 3V7RA 2YV0X 2FZGB 2JLEA 2OC6A 1C6VA 1ETXA 4LITA 2M7BA 5LHGA 5M1FA 3M59A 3BWGA 1QVGM 5E8GA 1IBLK 1EF4A 2VQHA 1VQ6T 2RF0A 4EATA 4RAZA 3O1BA 1N78A 4X6AJ 4BVOA 4B6MA 3IRXA 3VSLA 2VQCA 3IQLA 4GVEA 2EYQA 1ORKA 1KQJA 4FU6A 3OYAA 1NGBA 5LL6Z 3D0SA 3L4IA 4M3BA 2FL7A 1N3AA 1N9SA 3SQ4A 1WGSA 3LGLA 4IHSA 1KC8R 1ULYA 4JKGA 3NEUA 1YF5L 3M8SA 1QSLA 5KE2A 5E3LA 2MOXA 1BL0A 3FX3A 1X2MA 2NUTB 4XEIA 2CV0A 3FXKA 2YS9A 3VQEA 3A2FA 3QWLA 4WQ4A 2EJRA 2RJDA 3H8ZA 4DOWA 1Z1DA 3BFMA 4OP0A 2WV0A 5GMKe 4WQ4C 1W7PD 3J81K 1KTQA 4R55A 4O8KA 2XPVA 5DM7L 2BZXA 4BRIA 2OTJI 4C5GA 2KSSA 1N8RR 4F7UA 3BCBA 3EH2A 2DF6A 4F9OA 2RN2A 4FM1A 1K6YA 2H6CA 2XK0A 5C10A 2LKPA 2H09A 3TQ7P 3HOVJ 1OX8A 5FB2A 5C44J 3OS0A 2AHQA 3JCMJ 3CPWA 2OUMA 1LAVA 1ORNA 1ZBHA 1ZG5A 4PL8A 4IDHA 3BDPA 3H5AA 3HUGA 5FDLA 2CU7A 5EF6A 1TQMA 2EFPA 4AI4A 4DEYA 2KMTA 3QERA 1TUGB 3A8MB 2NVTJ 2CW7A 2CH4W 2MIOA 4CEQA 5HCKA 3TO7A 3SV3A 2IGMA 3M8JA 1ETWA 3MMYB 4FX4A 4OO1J 2HVRA 2EJGA 3BTIA 4XLAA 5IYBJ 1I8FA 1R4MB 4BXFA 5M1KA 1T0FA 1R5HA 3MWPA 4IOCF 3EO3A 1B34A 5F2RA 2ECCA 1HF0A 1BG3A 2JPSA 2QTXA 1T0FC 3K2AA 3SFIA 2F6CA 2G8FA 5AQLA 4DSJA 1VQNI 3I4NJ 4BI3A 5LJ3j 3AVLA 3I56T 4EAHD 1VYVA 2P81A 5CKHA 3M5RA 2YLCA 4LE9A 3Q0UA 4RBOA 4GLKA 2QA4I 1ABOA 4PJLA 1K83J 3T5XA 4WFNL 4A4GA 1AHJB 2BHYA 1W9HA 2A6EF 3ZETB 3F9KA 4CCLA 2KAFA 2K9GA 1WYXA 1NBEB 1NGNA 5FLXZ 2A68F 1F9NA 3OOUA 3OL3A 1CKBA 4DU4A 1NMNA 4M3WA 2VE8A 4UXNA 4KT5C 1RAHB 2F5CA 3UKRA 4EJWA 4HTLA 3UR3C 3H9NA 4CZLA 1FOXA 2NS7A 2CT4A 1BI4A 4M78F 3H3UA 4MDWA 5HLFA 4ANJA 3ZQHA 3HL2A 4B9SA 3KP5A 2RD1A 1U1TA 5D7UA 2DFHA 2ZSHB 1S6PA 4YTLA 2EQIA 3I55I 4QWQA 5FD5A 2K3XA 4LF9K 4O5BA 1VQMA 4K43A 4JI7K 2IA2A 1ZRFA 2Y31A 3OBWA 5TKWA 2ISZA 1U4BA 1VYUA 2PEXA 1T08B 3A02A 4OWRB 3WODF 1QKXA 3LWMA 2EQUA 1NGGA 1QO0D 4J9BA 4C92F 1SVLA 4JJNK 1WN7A 3QZ5B 2DETA 3O8MA 2RF2A 3FZKA 3E9GA 2EILH 5I42A 2L7ZA 3N5BB 2X9DA 2YPRA 4A3IJ 3GTMJ 1I94K 1KONA 1WFWA 4FWRA 5IHKA 4Y4RA 2PVGB 2HVIA 3K1MA 1TS9A 2KLAA 3JCMe 2VXDA 1ITYA 1E3MA 4K25A 3MQ0A 1TAQA 1WPYA 1A5JA 3QNOA 2E1ZA 3CCMI 3CCJN 3RYPA 1WA7A 5C0YA 3KK7A 2ZXIA 1OYXA 1ZLMA 1Z3XA 2D5RA 2FF3B 2HHQA 2OTJQ 4RCBA 2WOMA 3K5OA 2R7XA 3WXJA 3HP9A 4WXCA 1KQ2A 4JP0A 1R1VA 3VWBA 3DU6A 4GMJB 3X28B 2O3FA 5BRDA 2JA5J 4JYKA 3C1DA 1RDAA 3HL8A 3HYFA 2E4LA 4V2GA 2ACJA 4ZDOA 1Z91A 1XG1A 2HKNA 4OMFB 4J6YA 2K5FA 2DVJA 3QO3A 1OU8A 4PJNA 5ELZA 3KP6A 2QEXT 3OQ5A 4BRDA 3INZA 1LWCA 1IH7A 5I9EB 3QFUA 1ETQA 3HRMA 1TVRA 4EGYA 1NJZA 5GAHJ 1X1DA 2GOXB 3LMMA 3W2VA 2LLKA 1XC9A 3JS6A 3KTUA 4DV7K 2MK5A 4PFOA 2JVVA 2QM1A 2HNDA 5IT9O 3GYHX 1VQ9N 2KXDA 4U7BA 5DM7F 1VQ5I 3FK6A 3DBLB 3DYAA 5AQTA 4RB3C 3LDLA 3QDRB 1FBUA 4NUBA 1N5ZA 3UKGA 3U9DA 5LJ3h 2X3XD 3OYMA 3CMET 4OLBA 4CF1A 2CZ6B 2VV5A 1BJZA 1F36A 2E2OA 4BL0B 4KAZA 3WXIA 1VQNQ 1X27A 3FEOA 2DZCA 3OS5A 5F1XA 1T6SA 1XHZA 4RTUA 4NYNA 3WGIA 5AQWA 3ZMVA 1SHFA 4HLXA 5GANd 1JXOA 3J7ZI 1B9DA 2COMA 2XB5A 3S93A 5H1SQ 1V5EA 2ESHA 3ZT0A 4FXDA 2FBVA 3ZSQA 4ABZA 3OYCA 1MUZA 4OX9K 3U8XA 3DM2A 1YFNA 3VKIA 3O8HA 2WWYA 2FE3A 3QFPA 4C0ZA 3VS6A 1U0JA 3S6WA 1FMKA 4C9YA 3Q9SA 4LD5A 3TKYA 2FBYA 2HQAA 3HSTB 2P6SA 1RT5A 1L3SA 2Y90A 2XSJC 4CYCB 4NC7A 1BI2A 3SDBA 3OHRA 4M75F 4P5NA 4KREA 2IVMA 1Y57A 1RUNA 3I55Q 4E47A 4BGDA 1H8KA 1X6GA 3CC4T 3K2ZA 1SSFA 4H0OA 4R1HA 3CIPA 1KJWA 1N32K 3CC2N 4KTQA 5IYDJ 1WXUA 2F5KA 4HUGA 4ETSA 1Y56A 4OMMA 4CCOA 1QQIA 3RZOJ 1JTYA 5C25A 1W1FA 3E5QA 2O8BA 1M2OA 1X2NA 1BA5A 3EZWA 3T1YK 1XQPA 4XK8E 3M8FA 5KYWA 3AG4H 1IUFA 2LSOA 1RRSA 2PMHA 3A01A 3L1PA 5CQYA 3AA3A 3LL7A 4PHTX 1UA0A 2RVCA 4V19S 5AZIB 3NAEA 3EPZA 4I98B 2JN0A 3P7NA 4GDFA 2M16A 4MQ3A 2VKDA 1FK9A 3F70A 3CCMQ 3AAQA 3TQNA 1QP3A 1CKAA 3DPTA 1LQ1A 1QPIA 1NEBA 1A5VA 2UUAK 5DCFA 4HVVA 3IKTA 1GFCA 1YITT 2HQHA 4KJZA 2YSRA 5GTHC 1DDNA 3AV9A 3FXRA 1GLFO 5FPEA 4EV0A 1TZLA 1VSMA 4II1A 4JI2K 4XQFA 3UPUA 1T8EA 4NS5A 2XGXA 4CVNE 4A57A 1W6XA 2WV1A 3TAQA 3H46O 3ISNC 1L3VA 1XDUA 2DL7A 1YJNI 3AAPA 4HEA2 1D3BB 3LDOA 5BN8A 3H9GA 1VQKT 3RYRA 5FFZA 1RILA 1ZA2B 3AVBA 1USSA 1T6DA 2B8AA 1XJWB 1Z9QA 1BCMA 3A8OB 4J9CA 1YJWN 4DQQA 4HG2A 1XNRK 1VQPI 2EIKH 4EIKA 3J81E 5D4RA 1R22A 3EG0A 1X2QA 4IDKA 1V4SA 3DRPA 3MKDA 1L0OC 1GLNA 2ASOA 1MJAA 4YOXA 3VQQA 4EW4A 4XIDA 3DWLA 1K73C 1VQ5Q 2M3AA 4DFMA 5DY9A 4FWKA 4RTTA 2ID3A 1O3SA 4KTZA 2L5QA 1JJ8C 4OIOF 2CUFA 2Y0SA 2NUBA 2V6CA 4B9NA 2A41A 2VJ4A 4XU1A 1HYOA 1S9GA 1B72B 1SL1A 4Y7NJ 2KPMA 3HB9A 3L2CA 3P9IA 2FOKA 2O4IA 5AQFA 4J9GA 3H92A 3ZCOA 1KC8U 3VQBA 2P9SB 2CP6A 4JI8K 1IN7A 2XAFA 4NXMK 2HPIA 2WADA 5CKTA 3EE8A 1DPRA 2VBZA 3ABKH 3HKSA 2OTLN 4J2EA 2O9LA 1W0TA 2E2JJ 3L2UA 2UXDK 3THVA 2VWFA 2Z33A 3ZX3A 1SEMA 3ZMDA 1X6OA 1LDKB 3RCOA 4K11A 1TQIA 5LY3A 2LOOA 4EJTA 3CCQI 3W6JB 5GANf 1RT4A 2DVEA 4A53A 3LP3A 1NG6A 4KYWA 1PSFA 4OFAA 3T19A 1XCBA 4CJQA 2NOJB 2BW3B 1FOKA 4RS8A 1R7JA 1F1ZA 4JS4A 4HT9A 2HNYA 3OA9A 2NVQJ 1R0AA 2EYYA 4BHBA 3NBPA 2IVOA 3SNNA 2H8WA 2OTJA 3CCSN 2E71A 2VG6A 2RDPA 5EGOA 1RUWA 3S32A 4G7HF 3E1SA 4PKGA 2V1QA 4F93B 3GFLA 1NK3P 2CFXA 4DOZA 2HXOA 2PTKA 3J80O 2DYIA 1QZ5A 1QHAA 2R92J 4RCCA 4A5MA 2FC0A 3PQKA 3PUFA 5HBMA 1WSGA 2DIQA 4JI5K 2HL5C 3CCLI 3QDKA 4B4CA 4H5RA 2MI6A 1U04A 4FOEA 3NTIA 3LA3A 2OPTA 4Z94A 2A5XA 1BQMA 1MBHA 2E3IA 3DLBA 3K4NA 1KU2A 1UAXA 1REVA 2FRYA 1VQ7A 3MZ8A 1QTMA 8AT1B 2VG5A 5CHIA 3ABMH 1VQ4A 1POGA 1UG2A 4BY1J 4BRCA 1VQLI 2JW4A 2DDAA 3KLEA 1KSPA 3EY1A 3KKRA 4DFPA 5GADP 2HWVA 5TJJA 5GAGJ 4O5VA 3R60A 3J7AF 4PJMA 1R4NB 2AZSA 3HSRA 1KU3A 2RA2A 4BR2A 1X9JA 1MNDA 1W2BS 3ID6A 4LF5K 4CGGA 3ZN1A 1VQNA 1KSWA 3DU5A 4OMNA 2K9MA 1WJCA 4JKHA 1JBMA 1ZBSA 1IZ1A 1YJNQ 3I5SA 2FZCB 5E3OA 4OB0B 2DIGA 3NGIA 5FROA 1LMZA 4KH1B 2GA2A 2W6LA 1KU9A 2RAEA 1YT3A 2NLXA 2RQPA 4R0KA 1VQPQ 4EJYA 5EEHA 4N4OB 1GXQA 4QIWN 2CW8A 3BR5A