4ZTJA

Crystal structure of the prototype foamy virus intasome with a 2-pyridinone aminal inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 2-Pyridinone Aminals: A Prodrug Strategy to Advance a Second Generation of HIV-1 Integrase Strand Transfer Inhibitors.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna/inhibitor
molecule keywords PFV INTEGRASE
total genus 103
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ztjA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ztjA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ztjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ztjA03
3BDLA 1G15A 3U3GA 5IAYA 3NDKA 4G1QA 5FRMA 3ZEHA 3NAEA 1HQEA 1KHCA 3F9KA 2ATQA 5C0MA 4OVLA 4H8KA 4FK2A 2X74A 2GF7A 4IDKA 1S1XA 2X4WA 4OPJA 2P5GA 3ZSZA 4Z4IA 2FBYA 3IAYA 4C8MA 4IG0A 3ULDA 3MECA 4NCGA 4CFDA 3NF6A 1SKRA 1C1BA 4AILC 3QEWA 4FJXA 4Q5VA 1RT4A 2HHQA 4R5PA 3BGRA 3PFSA 5KGWA 5KH6A 2GFAA 4CJ5A 3LWLA 3V9SA 4HTUA 4ELVA 4J2AA 2DFFA 4BD3A 3KK3A 4IURA 3KLIA 3NHGA 4NYFA 4II1A 2JGUA 3NGIA 3VA0A 3CM5A 2O4GA 1SL0A 4BWMA 3OYAA 2BUDA 3H08A 4DTXA 1U48A 4CEBA 3AV9A 2A1SA 3LH0A 3V1RA 1KFSA 1LAVA 4C8LA 1HNVA 5FDLA 2K3XA 4A4FA 3VQAA 4IUPA 1LAWA 1S1WA 2IS3A 5IN1A 3SJJA 4KO0A 3I0RA 4LSLA 2IDOA 2ZE2A 5C6SA 3AO5A 1C0TA 1WGSA 2WOMA 5HRSA 2M16A 2KW4A 1LW2A 3VQDA 3QKJA 4CEFA 3KLHA 3P8HA 3EZ5A 4CF8A 3QEPA 4FZXC 2ZD1A 4W5RA 1ASVA 5HRRA 2LRQA 4FJHA 3ASKA 1WSJA 2F8SA 1VSKA 1RT6A 2G8IA 3DRRA 1NKBA 2WACA 1REVA 3CG7A 4DSJA 4E19A 1T03A 1WN7A 3OA6A 4M42A 2VG5A 3K59A 1D9DA 2JLEA 3HM9A 4HUEA 4O4GA 3NF7A 2OZMA 3CFPA 4BDZA 2Z1IA 4DTPA 3TAEA 2D5RA 3NH1A 1X9SA 1J54A 1X9MA 2M1HA 4X34A 1KLMA 1S9GA 3SQ1A 2JZ2A 3LPTA 3NH0A 2HVHA 3G10A 4FLUA 4IUTA 1S1TA 3D45A 3L3UA 4DMNA 2VYTA 1RDAA 3SUNA 3SQ2A 3D0PA 3ZSOA 2D0CA 4UC4A 4KHWA 2EHGA 3ZT0A 1NOZA 2DFHA 4FJ8A 2F8TA 3LDSA 4KHNA 4PWDA 2ITGA 3UIQA 2G8KA 1NK6A 2XO7A 4BWJA 1J9AA 1WJRA 3V81A 2G8WA 2RKIA 4N76A 5CYMA 2BANA 4KTWA 1KFDA 3LALA 2E6MA 3WNFA 3L2VA 4CFAA 1C0MA 2IC3A 4AHSA 3DLBA 3AVJA 3V1OA 2G8UA 4EZ6A 1YVUA 4M3RA 3ZSVA 3S9HA 2E6NA 2X6SA 3KLGA 1ASWA 1HPZA 4CIFA 4C5GA 1DLOA 1XI1A 1J53A 5J39A 1CXUA 5J2MA 2X4XA 2OPQA 3QIOA 2RHXA 4QQDA 1QTMA 4M41A 3LWMA 3IS9A 4RW7A 4OLBA 1C6VA 1RBTA 1L3SA 3FLGA 3C6TA 1UAXA 3KUFA 3FC3A 3AVHA 2PYJA 5KCOA 3AA5X 3DOKA 1CXQA 3SUQA 4F3OA 4Z02A 4KB0A 2HVIA 1IKWA 1WSHA 1I3AA 3ZT4A 4CJTA 3BDPA 4FJ7A 1C1AA 4W5NA 4EP5A 4BE0A 3QNOA 3QEVA 1NKEA 4FM0A 3L8BA 4M3ZA 3KLEA 1HQUA 4PY5A 1BI4B 2DFEA 1IH7A 4FM2A 3KD1E 5CZ1A 2KZMA 4PQUA 3LAMA 5HROA 4OLAA 4A4EA 1RT1A 2DY4A 4E7LA 1YTAA 1TVRA 4KB1A 1CLQA 4N56A 4JLHA 2EQUA 1S6QA 3CEYA 5HRNA 3DLMA 1TK8A 4M3WA 5EU7A 4FK4A 3AVGA 3HSTB 2R58A 3OS0A 2FHDA 4C8OA 2QKBA 3T3FA 3P8DA 4B9NA 4RG8A 1S5JA 2YNHA 3TR8A 4B08A 4CEAA 4DG1A 4Y1DA 3VQBA 1RI0A 4A4HA 4FJ9A 1S1UA 2RI3A 3NF9A 4CEZA 1JLGA 1Y97A 3PV8A 1GOCA 3QIIA 3DB4A 3UT1A 1WAFA 4CHOA 4XIUA 1SKWA 4DQIA 2KFNA 2NUBA 3C94A 3DOLA 4OVAA 4FW1A 4CHZA 2G8FA 2L89A 2XK0A 2OYQA 3TABA 3CFOA 4I9LA 4CK3A 1T7PA 4DU4A 2KQ2A 3PX6A 1RT3A 4FXDA 3NGYA 4FLZA 4CJKA 3O3GA 4DU1A 4Z4FA 2QQSA 4B9VA 4MQ3A 4I2PA 3PX0A 4CHQA 3SQ0A 1XC9A 1JXEA 3AVCA 4BDPA 4FJKA 1SL2A 1NJWA 4NCAA 1FXXA 3MP8A 3RR7A 2DAQA 2D0AA 1ZBLA 5CY4A 3KLFA 3AO1A 3H8ZA 4JS5A 1WSIA 2IG0A 2M0OA 2P0KA 2IGIA 3VA3A 3MP6A 1EKEA 2F96A 1QSSA 2ZQBA 4RW6A 5HRPA 1FKPA 1U04A 5D3GA 3QETA 3LP2A 2KZZA 2YKMA 4B9SA 2LCCA 4JS4A 3NF8A 4IG3A 2O4XB 3ZT2A 3NTIA 5DMRA 4KAZA 2HMIA 3QJ6A 3DYAA 1SKSA 2YV0X 3F73A 1OI1A 4QAGA 4O44A 4Z4EA 2HHUA 1RT2A 2LDMA 4F2RA 2R7YA 3V4IA 3C4SA 3LAKA 4L59A 4B8AB 1TKZA 2L3RA 4ID1A 4N47A 3RMBA 4I2QA 3B6PA 3B6OA 3M8PA 4GW6A 3OYGA 1KTQA 4CJ4A 2XDPA 4B3OA 4FJGA 3NH2A 2RJEA 2RHYA 2BDPA 2KTQA 2HQEA 2G8HA 1B9DA 2XRIA 4B9TA 5K14A 3QINA 3SD4A 4PLLA 1VSMA 3NNQA 4O55A 3ZT3A 4CJ3A 3O3FA 3E9FA 4FM1A 2Z1GA 3V9UA 4GMJB 4DFPA 4KPYA 2HHWA 3L3VA 1U47A 4IUQA 4IBNA 3SUOA 3AO4A 4IKFA 1BISA 1L3UA 5CYQA 4CECA 3EYZA 3V1QA 4O5BA 4DLGA 2PZSA 3KK2A 1BI4A 4PUOA 3NTHA 1XWLA 3OYEA 1EETA 1XHZA 4DLEA 3RMDA 3LZIA 1J5OA 3HK2A 5DK5A 3TARA 4FU6A 4OKEA 1NK0A 1D5AA 3SZ2A 1BGXT 3ITHA 4CESA 4DF4A 3VN5A 4HUFA 3AVBA 1TKXA 3G0ZA 1VSJA 4DFJA 4WE1A 3KTQA 3MEVA 5J2PA 2EQMA 4DTSA 1KCFA 3S3NA 1TAQA 1LWEA 3UWNA 3WNEA 3VQ9A 4AHVA 4C5IA 4DQRA 4ELUA 4QVZA 1C0UA 1HYVA 1RBRA 3DLHA 4CJQA 3SV3A 2YKNA 5I42A 3TI0A 3PUFA 1KSPA 5T7BA 3HXMA 3AA2A 4AHRA 4CK1A 3LP3A 5KE3A 4LH5A 1O1WA 1N6QA 4FJJA 3I0SA 1TAUA 1A5XA 3VQ8A 3ZSRA 2A1RA 4ELTA 5JS2A 1NK9A 4CJSA 3PY8A 1VSLA 4HVJA 4J2BA 2IAJA 3MAQA 4AHCA 3OYFA 1LWFA 3HL8A 4TSXA 3FEOA 4Q5WA 3ZSYA 3AVLA 4EP4A 3SI6A 3QESA 1L3TA 1QQCA 2DIQA 4CF9A 1LV5A 2Z1HA 3VQPA 2OPPA 1HYZA 3MXJA 2B4JA 4C8KA 2HNZA 1TGOA 1B92A 4EZ9A 4M45A 1IKXA 2RPIA 3QO9A 4H4MA 2IOCA 2LSNA 4DTMA 4FLTA 4CF2A 3JSMA 3OS2A 2D0BA 3NE6A 1DTQA 4N4IA 4Z4CA 1KVAA 3SQ4A 2E5QA 1WSEA 3QERA 3M8SA 1A5VA 3PNWC 1LWCA 3DRPA 5KTQA 4B9UA 3OYHA 4KRFA 3SPYA 4W5QA 3WNGA 3TAQA 3L2QA 2RHUA 3O3HA 2I5JA 3EY1A 3RTVA 3SUPA 3HPHA 1NK7A 1WSFA 4J2EA 4KREA 4Z4HA 4KHUA 2PQWA 2RJCA 3AVAA 3OQ5A 4PA1A 3ZCMA 4CGJA 2P5OA 1ZBHA 3HP9A 3CYMA 1JL1A 3RWUA 1HNIA 2B5JA 4FLYA 1WSGA 4J2DA 1VRUA 3RMCA 3PMTA 4W5OA 4CHNA 4KHQA 1SL1A 4CGGA 3VQ7A 4RG2A 1A5WA 5JS1A 1RDCA 3IG1A 5J2NA 3M9QA 3K2PA 4CJUA 1TL3A 3CQ8A 1RT5A 1JLAA 1HRHA 4BE1A 1SV5A 1Z26A 1Z25A 3L42A 3MEDA 1SUQA 4NCBA 3NFAA 4BE2A 4M3TA 3O4NA 1U4BA 3HVRA 2QQRA 1UOCA 1RDDA 3HPGA 4KTZA 4UQGA 2X4YA 1OYXA 1HMVA 2EFIA 1QS4A 5CZ2A 1W0HA 4LD0A 4M3XA 3ZSXA 3C95A 4FZYA 2RN2A 3OVNA 4C8NA 2Y1JA 2YNFA 2BKDN 3SNNA 1RBUA 1VSFA 3A2FA 4JRPA 3V9XA 3T19A 2XY7A 1WAJA 3DLEA 3HO1A 4EDUA 3VQ6A 1VRTA 1JLQA 4E1MA 2LTOA 3LYIA 3KKRA 4CFBA 3TAFA 5E41A 2EKOA 1LW0A 1UWBA 1BQNA 3ALYA 3ASMA 4CF1A 3HT3A 4FW2A 2VWJA 3QEIA 3K5LA 5HBMA 1JLCA 4DSFA 2XHBA 3AVKA 1U45A 2WONA 1RDBA 4CHPA 3LLRA 4OGEA 1VK0A 3TANA 1BIZA 4CEEA 3PX4A 1D9FA 4F4KA 4NS5A 3CM6A 4C5EA 2FC0A 3WNHA 2OPSA 4CJEA 3SV4A 2RO0A 3OS1A 4KV8A 4RW4A 4IFYA 4DQSA 2Y1IA 1Q9XA 1WLJA 4HHTA 4DWIA 2VWKA 2CKKA 1VSIA 3GOXA 3QIPA 1EXQA 2HB5A 5J1EA 3NGZA 1RTHA 3AVFA 2YNGA 1KVCA 4O0JA 3ZSWA 5C25A 3U6FA 2E6LA 1RT7A 4CIGA 4HCBA 2GBZA 5KRTA 1T8EA 4B9MA 3MEWA 1S9EA 1ZBIA 4B9LA 2HW3A 2VG6A 3MEGA 1UA1A 3MXMA 3OYCA 2R5MA 2PY5A 4CEDA 4CGFA 4O0IA 1QSLA 3AVNA 3NBPA 4KKOA 4K8ZA 1GOAA 3PO5A 4YFUA 4NYNA 1RBVA 4DTNA 4CRIA 3AVMA 4Y1CA 4CK2A 4Z4GA 3ISNC 4DSIA 1JLFA 3HYFA 4B9WA 4E7KA 3OYLA 5KRSA 4FL6A 3THVA 2D9TA 4OJRA 4DTUA 1MHNA 3OYBA 3KJVA 5HLFA 1I39A 4FJMA 4FJLA 1JL2A 2HNDA 3DM2A 4OPKA 1YT3A 3MO8A 4DSEA 4CJLA 4A4GA 2F5KA 3M8RA 5FROA 4H4OA 1QE1A 2QKKA 4ZTJA 4DS4A 2W42A 1S1VA 1DTTA 1VSEA 4FJ5A 5KI6A 2G8VA 1F21A 1FKOA 1RNHA 1B9FA 4DTOA 2XY5A 4OGCA 1ZBUA 2Z1JA 5C42A 3SPZA 4FZZA 5FRNA 3O8VA 3V9ZA 5SZTA 4PLIA 4N4GA 4QQGA 1L3VA 1BIUA 5HP1A 5D6XA 2BIVA 4N4HA 3OYIA 4CGIA 3TAGA 4AHTA 3RR8A 3LGFA 4DFKA 1TKDA 1OZ3A 4E7JA 1K6YA 4DQQA 3RRHA 3SCXA 3AO3A 1T05A 3OMCA 2LVMA 4N41A 4KI4A 2GUIA 4BDYA 4RW8A 3O4QA 2HHSA 4M3UA 4KTQA 2RI2A 2BE2A 4RW9A 4E7HA 4KFBA 2FBXA 1XNIA 3S6WA 1KVBA 3VQ4A 1H3ZA 4JRQA 2X35A 3OYDA 3V6DA 1TKTA 1NKCA 2O4IA 1RTDA 1QHTA 2RJDA 4QQ6A 5KGXA 2B6AA 2KFZA 4I7FA 1NK5A 2L8DA 1X9WA 1JKHA 4E3SA 1YTUA 2YHAA 4DF8A 1C1CA 4NZGA 4CJPA 4MFBA 3MEAA 4CHYA 3P83D 3VQ5A 1CZBA 1BCMA 3M8QA 1ASUA 3L2RA 5D6WA 3MEUA 3DLGA 4CERA 2GFUA 2K3YA 2DIGA 1IKVA 1RBSA 3LPUA 4OKKA 4Z0UA 1JXBA 1UA0A 4C5HA 3K58A 1TV6A 1WJSA 3ZT1A 4DTRA 4F3TA 2HHVA 4HCCA 3JYTA 1GOBA 3AVIA 1BHLA 3HPOA 3HJFA 3AA4A 3DLRA 3FFIA 2VG7A 3P1GA 4HCZA 1R0AA 2OZSA 5J26A 4CJRA 4F8RA 2X6NA 4GVMA 4CGHA 2P1JA 3Q1JA 4FYDA 1WJQA 2MWOA 3OB9A 4FLVA 3OY9A 2B8AA 3NTKA 1IO2A 2X78A 3NCIA 5CIUA 1U49A 4E89A 4LSNA 4HUGA 4ICLA 3TWHA 3QNNA 1KLNA 4K8XA 1NK4A 2NLUA 4FVMA 3DRSA 3KK1A 3KKSA 1TK0A 3EAEA 1Q8IA 3K5MA 4DSLA 2RF2A 3C6UA 1RILA 4FLWA 3L2WA 4DS5A 2QK9A 1CZ9A 2XY8A 2DTUA 4E1NA 1S6PA 3V9WA 4LD6A 4GY5A 1X1PA 3P5JA 2MWPA 3DMJA 5D6YA 1BL3A 3OYJA 4OKJA 1OZ2A 2YRVA 5SWMA 4ZTFA 2HHXA 1W9HA 5KCHA 2FBTA 4W5TA 1VSHA 2Q3SA 2YNIA 1WNSA 3VQEA 3E01A 2HQXA 3OMGA 3S3OA 1TL1A 3K5OA 3I8DA 3OYKA 3SYZA 3AA3A 3T1AA 5J2QA 1D8YA 1TK5A 4CF0A 1MU2A 3LX7A 1EX4A 3LZJA 2ETJA 2R5AA 3IRXA 4CIEA 2EX3A 3MP1A 2HHTA 1G5VA 2RHZA 2E4LA 5C24A 2RHIA 4IUUA 2QXFA 3KD5E 3OJSA 1NJYA 1JLBA 3HVTA 3LP0A 1N5YA 2O4XA 3OJUA 1ZYQA 4KHSA 3QBYA 3L2UA 3OYMA 4M3YA 2FBVA 1EP4A 3FDRA 1NK8A 2R57A 4CJWA 1NOYA 3LANA 3HP6A 3QLHA 4CJFA 4FJNA 4E7IA 1JLEA 2OPRA 4IFVA 2XY6A 3MEEA 2HNYA 1XHXA 3PO4A 4FK0A 3META 3U3YA 3MXIA 1QSYA 4AHUA 3ME9A 5I3UA 2RJFA 4DTJA 5KE2A 1ITGA 4ID5A 2JTFA 3QEXA 3DB3A 2GV9A 4DQPA 4E0DA 2OA8A 4KHYA 4F2SA 2BGGA 1RCHA 2EQJA 1RTJA 3DLKA 3TAMA 3VQQA 4LH4A 4CGDA 1NJXA 3DI6A 1Q9YA 2AJQA 4CJVA 1N27A 4I9QA 4QW2A 4B8CA 1ZBFA 4CCHA 1FK9A 3KIOA 3LP1A 4FJIA 4L8RB 4KI6A 1HYSA 4BACA 4DU3A 1IG9A 3ZSQA 4QOZB 4LY7A 1BCOA 4CFCA 1VSDA 3RMAA 2YHBA 2EQKA 2P51A 3LGLA 3K5NA 2PYLA 3E9GA 1BQMA 2RI5A 1HJRA 4ZHRA 4DSKA 5M9OA 3VQCA 4QCLA 1SSFA 4YNQA 4IUVA 4AH9A 3OYNA 4CE9A 3AO2A 2G3RA 4FCYA 4B9XA 4N5SA 1IKYA 4DFMA 3H6ZA 4CEOA 4CEQA 3CFRA 1RTIA 3PMIA 1L5UA 1KRPA 3S3MA 3RRGA 4FLXA 3K57A 3TAPA 1NJZA 3F70A 4Q0BA 4PL6A
chains in the Genus database with same CATH superfamily
2J5OA 2SRCA 3EYYA 1W0TA 2JJ9A 1MDMA 2FE3A 1YJWA 2DAOA 3RSEA 2HDAA 3VJPA 2X4WA 4OPJA 3PIOF 1WQ7A 3A8GB 1JKRC 1DT9A 2MGQA 2VWFA 3GBGA 4QPQA 3CMEI 1QCNA 3QEWA 1Q86O 3NHGA 2VBXA 4HDUA 1BI0A 2JT1A 2I10A 3JXUA 4P55A 5HOOA 4ESJA 3SJJA 2ZE2A 3CQXA 4J9EA 2ROLA 3MZ8A 4CBWA 4A3IJ 1FC3A 5AIPA 4RTWA 4OFHA 4RUGA 4A63B 1RT6A 3GP8A 3ZMUA 4CD3A 3CC2N 5LL6S 1D3BB 2VG5A 2Q1NA 5FFZA 3BWGA 1HX1A 1S1NA 5K5OA 3NH1A 3IH4A 5AQMA 4LGWA 4FLUA 3HFNA 1MH4A 1S1TA 2FQ4A 2D0CA 1NGIA 1TL8A 4M9XA 1R1VA 2W04A 1EZZB 4IOCF 4BI3A 4N76A 1G3YA 1KFDA 3L2VA 1MBJA 1D5YA 4X6AJ 3DKWA 3GBQA 1NYFA 4C5GA 3LQRA 2MIOA 2OPQA 1HUXA 3CCJA 5DM6F 2RN8A 2CW7A 2ZJ2A 1L3SA 2H8HA 1TYQA 1OCOH 3T9NA 1SZ2A 1Y8QB 3EG9B 3O8MA 3HOSA 3G7ZA 1WJEA 3BCAA 3ERED 1OPKA 3QPLA 3MZYA 3EZWA 3D0SA 2EQUA 1M2VA 4RTZA 5BREA 2E2IJ 4CD1A 4B08A 3I3LA 4EM2A 3DB4A 4OB3B 3C94A 2A36A 3DQVC 3QP6A 4K11A 4BY9C 2LJ3A 4C8QE 4UB6C 3IAM2 4GFBA 2WV0A 4CHQA 4BG9A 2HYJA 2NNWA 5CY4A 2DMQA 3H8ZA 3CPFA 2DRKA 2VBWA 1EKEA 4MO5A 2E1YA 3I8BA 4CZLA 4DK9A 3DXMB 5DTDA 1R59O 4DUYK 1OI1A 1S72Q 5BNGA 2QGUA 4PJ0C 2KP6A 4L59A 4N47A 3HGGA 3V7RA 3M8PA 4J8FA 2XDPA 4FJGA 2BDPA 5JHUA 4PLLA 3V9UA 4BQAA 4JKGB 4FYVB 2V75A 3KZBA 3SUOA 1F9NA 1WHMA 3VDXA 3HTVA 4GV6A 2DD4A 1YJ9N 1X43A 1VQ8I 3RDIA 4MLOA 2ZXIA 4G8XA 4FU6A 1NK0A 1TKXA 5GAGP 3MEVA 4LDXA 2PUKB 1OFCX 2HQ5A 1T56A 3BR1A 1VQMI 3MAQA 3AVLA 1JKPC 2HXOA 1YWPA 2NRVA 1HSJA 1VQLT 2XUBA 4C9YA 3QAHA 1P90A 4XH5A 2N8GA 4ITVA 3KP4A 3ABKH 5GINA 1VYUA 1DTQA 4B3SK 2ZPIB 1XMKA 3SQ4A 2JQ7A 2EBIA 2O8FB 5LEJA 5KTQA 4BR2A 1Q81R 3RTVA 2EV0A 4IDHA 1QZ5A 2P5OA 5K5RA 1XS9A 3BTLA 1TWHJ 2YHWA 3JRCA 4RG2A 4FPAA 3IG1A 2A40A 2MLGA 3DPTA 4A53A 4NCBA 3LSGA 3G71Q 2V52B 2R7SA 1QS4A 1HMVA 3LA2A 3E9OA 1ZUUA 3MMYB 1IN6A 1ZLMA 1H3HA 1AA7A 3EHRA 2DVEA 4AIAA 2M7BA 1TUUA 3CBPA 1V5FA 4ILHA 4ZGDB 1UJ0A 4KV8A 1X6GA 3R6MA 4LF6K 2UV1A 2GGRA 1RTHA 4WTOB 2K6DA 2DPNA 2DPDA 5LGTA 3ULRB 1DKGD 2P9LB 4Z89A 2KT0A 4E9HA 1T3SA 2L9SA 1X58A 3F2KA 1JKQC 1FMVA 3EG3A 3GZ5A 1O13A 4DTNA 1YITA 2F48A 1OVQA 3GCMA 1SG5A 2QQ9A 2HNDA 2LP0A 2CGKA 1V29B 2QKKA 4L9TA 2W42A 2DNUA 4XKCA 1ZBUA 2Z1JA 1DEJA 4FZZA 3CO7C 1G99A 3CD6Q 1M3AA 2CQXA 3CF5F 1MIJA 1I1GA 1P7IA 3K1NA 1GLNA 1K6YA 2VL8A 3RRHA 2K9QA 4BDYA 4ZYHA 3ZX3A 3OIPA 5EX5A 1KVBA 5GANg 3CJ1A 1QHTA 3L9FA 5DM7R 5L3DA 4Y13A 3WTWC 4NZGA 4D7MA 3M8QA 5AZJB 4RAYA 2DIGA 1RBSA 2CP2A 3LDNA 3U21A 3VF4A 4FYYB 2H94A 2DT5A 1NGJA 1GOBA 4JAXA 4J01A 4BQLA 4CC4B 1N33K 2M7AA 3GTOJ 2YCHA 3OB9A 4FE4A 1RABB 2DU9A 2HI3A 3N4MA 2HR3A 2LR8A 4C92C 2D8JA 2FYKA 2CP0A 1ON2A 2O0YA 4OPHA 2QSFX 2YNIA 1L3UA 4BL0B 1Q18A 2QA4T 5AIQA 2FF3B 5GAHJ 5LRSA 3JB9I 3LZJA 2XF7A 2DM1A 4E70A 1JLBA 1VQOT 2GA1A 2OTJN 4F7UE 3RKQA 2JA8J 2QBYA 3L4IA 1M1EB 3U3YA 1B59A 3QEXA 4M77F 1N8RR 2BGGA 4CICA 5D4SA 1K8AR 1YTUA 3MPUB 3WODF 2F1LA 3VS2A 2RQUA 2ETHA 4C92D 2DQLA 4GNIA 4N4OB 3S17J 1QCOA 3H6ZA 1J2XA 4JK8A 3RPUA 3WHBA 3RRGA 3GWZA 2FF6A 3FE1A 1VQKQ 2FZCB 3TVTA 3F9KA 1TT5B 1S1XA 1X2MA 4M75C 2EPDA 5J8FA 3MECA 4DBQA 1C1BA 4FJXA 2FNAA 3BGRA 4JP0A 3PFSA 2DFFA 3CM5A 2OU2A 3Q7BA 1W1FA 1Z0XA 1M90U 1NNEA 4AM6A 2QGGA 5AJ3K 3FKJA 4YOYA 4BRIA 1TWFJ 3MXIA 4M77B 5D8KB 4ZDLA 2WOMA 3VQDA 4YOQA 3CBMA 3CC2I 1IRZA 1E4GT 1GVJA 2DDBA 1VSKA 4BR4A 3O9QA 3E5QA 2EFNA 3THYB 1XMOK 2OA4A 1VQ9A 3BROA 2EPFA 1JHHA 1KG7A 3JRZA 1M8MA 2HVHA 2QWOA 2CH0A 2CP3A 1ZXOA 4X64K 4IEJA 3D0PA 1KYWA 5GAOm 3LMMA 3R60A 3J7AP 2G8KA 1Y0NA 4BWJA 1J9AA 3UF4A 2M2EA 1RADB 2PVGB 2X3XD 3LSMA 3FGUA 1HLUA 1UUEA 2KGTA 5FO5A 1VQ5A 3BPXA 4PIIA 4YFKF 4DV2K 5LJWA 2EYXA 1K9AA 1UAXA 3QMLA 2JPSA 2DLPA 1IKWA 3BDPA 2A68F 4UY8I 4RGRA 1YCYA 3L8BA 3JCMf 4XLEA 5IT9K 5LGUA 3KD1E 4ASNA 1DPRA 3H9QA 4BEHB 1YJ9A 3AAQA 2DXBA 2KJCA 2E7XA 3TR8A 2E34A 1KZHA 2DMPA 2V7YA 1HCRA 1P7JA 2X6XA 2KQ2A 5A2QO 1Q81C 1P59A 4B9VA 3JCMd 4I2PA 2IGKA 4FJKA 4LF5K 4NCAA 3CJNA 2V1NA 1K83J 4JS5A 2GZWA 3BG5A 1NWKA 3S1NJ 1EQYA 1FKPA 3H1VX 1IBKK 2YKMA 1K73U 3Q7CA 4NUBA 1XG1A 3SBGA 4ID1A 4W97A 4M75A 3OYGA 3N0UA 4E6RA 2LRDA 2LDUA 4FYXB 5L8RE 4C3JJ 3ZT3A 3O3FA 4XH4A 2WAQA 3AO4A 1PSEA 1W0UA 4BJ6C 3CXCA 1MBKA 2PMUA 3VFZA 2WTUA 3CC4A 4FT8A 5I11A 3ZETA 2P9PB 3SZ2A 5DLQE 2OCEA 3VN5A 2UXDK 1DU0A 1E0EA 1PKSA 4F7UG 3M9AA 3VQ9A 1OQKA 4ELUA 2QWWA 3LSKA 3CCQI 2E41A 1KSPA 2LKSA 3HFOA 3FFKB 1IW7F 5ICEA 4CF9A 2IVPA 2FB7A 1TGOA 4J6WA 4KH6A 4QTRA 2RPIA 4DTMA 3JTGA 1M9SA 2JTEA 2P81A 1N25A 1JQQA 2FEZA 3M1FA 3L2QA 3JR9A 4RAZA 3OWTA 4CC2A 4JI7K 3FJ5A 3B8AX 3CCSQ 3KWIA 4L9JA 5A0DA 5E1ZB 4YHHK 3O9RA 2W1OA 3QDRB 4M3TA 3CJ9A 3V4GA 4UQGA 2X4YA 1U9NA 3I53A 3M07A 1NYGA 5ADXH 4M77G 5IOZA 4JX4A 1BQNA 3ASMA 4MEYF 5FKLA 5LHHA 5B66C 2FOWA 5C44J 2E2JJ 2RO0A 3KP2A 4BYYA 3VYHB 2COWA 2XC7A 2X48A 1VSIA 3GOXA 3OOUA 3C65A 3NFCA 1O4XA 3CC2T 3ONQA 2HW3A 3J80O 5TISC 4KKOA 1OCZH 1UGRB 3T5XA 2YDLA 2O8KA 2E12A 4YFUA 2ZMEA 2DJQA 5IHKA 3AVMA 2ZPFB 3G6EA 4A3DJ 1J7KA 4M3DA 3E5UA 3OYBA 1PWTA 1IRGA 1OR7C 5ICCA 3ZRGA 4H4OA 4C2TA 4DS4A 3WE3A 1WCMJ 5E1XA 2ZXHA 4PLIA 4N4GA 4HVUA 1LEAA 1O7LA 3M57A 5D6XA 5FW9A 3O1BA 2RK1A 3EH2A 2RK2A 4BR0A 3LFUA 3I9QA 1OZ3A 5IP6A 4N41A 1GLFO 3O3KA 2DI3A 1R36A 1BI1A 1XCBA 2RQPA 2O4IA 1H3ZA 2X35A 2RD1A 3IH3A 5FFXA 4I7FA 4Z6YA 2L8DA 4ZYEA 3H5RA 4DF8A 4XTXA 2RH2A 5ICGA 4EJYA 2QKMB 5AFUH 4UB8C 4LOCA 4A0ZA 2DEQA 2ICWG 2C06A 4DTRA 1QCFA 1MDUB 4PJOF 2VJIA 4CJRA 2X6NA 1K8AU 1M4ZA 2PUOB 1NGEA 1YHQQ 1U49A 1KLNA 4ICLA 4A3EJ 3CPEA 3SEZA 1Z91A 3TTCA 3VTIA 3K4CA 3HKZA 4OKJA 2ZMEC 2XKOC 3CMAT 2JUFA 1MDMB 1NM1A 3J7YJ 3IRXA 2LBFA 2TCTA 4IPAA 5I21A 5C24A 2RHIA 1VQPQ 2AZVA 3U1DA 4KHSA 5BPNA 5GAMg 4E9FA 5EC7A 3CCVT 3QBYA 3CERA 4BY1J 1NOYA 1VQ6Q 2R3SA 2GQQA 4F92B 2QK0A 4WWCA 3HOYJ 3U9DA 4O6JA 4M7AG 4PJOD 1SMYF 3R61A 3SWNC 3JSCA 2EQJA 4HTLA 1UTIA 1EWRA 3L7WA 4CFCA 3MKDA 3F8MA 1X27A 1QVFP 2P5LC 1OEBA 2IXSA 2OAWA 1XOVA 3M53A 2OI3A 1ON1A 2DXIA 3CMEQ 4AIJA 4Q0BA 1G15A 3G71I 2QKLB 1MJAA 5KYNA 3FZFA 4K43A 2P5GA 3S93A 3K0SA 2FBYA 2NRAC 2PMHA 3HTUA 1RRJA 3CJ7A 1AWJA 3K69A 2DKGA 4R5PA 5M5WJ 4NB4A 5AQFA 1EF4A 4KUDK 1VAZA 4JD2A 5LJ5g 4H5WA 1KQSM 3HHHA 4M3GA 4JI1K 2W6KA 2R7ZJ 2E8AA 1NGDA 4C92B 3VEZA 3ASKA 2F8SA 2KJBA 1VQMT 4V2FA 4DNCA 1U6GA 5J1RA 4HBLA 3HM9A 5JVGF 2Q1ZB 1N32K 2J4RA 1IRXA 3H1QA 3SQ1A 5FKNA 4LD9K 3GZNB 2M02A 3L3UA 1Q7YC 1VQ8Q 4XN3A 3EE9A 1P6RA 1R00A 5IPAA 5GAOr 3PL8A 3HM8A 2BEOA 5AQSA 2E6MA 1C0MA 2ZKZA 2WBMA 1BW6A 4GKKK 1WI9A 5LJ3f 3CJAA 2X4XA 2RHXA 2A5WA 1KU3A 1RBTA 1VUBA 1YLFA 1MPGA 2PYJA 3QPSA 1CXQA 5AQRA 2OAUA 5GMKm 4L18B 4C92F 4EP5A 5FKKA 4JKEA 5JICA 2CGPA 2KRHA 2VQGA 4XORA 1S8NA 1T39A 1E4FT 3O08A 3OS0A 3RKYA 4C8OA 4LITA 5K7FA 5AFUA 1S1UA 4FJJA 1MV0B 3U8XA 4EEFG 2G8FA 2PEXA 2IJLA 2IEKA 4DR1K 3F10A 2QQSA 4BR9A 4MQ3A 3PX0A 3CCUI 2GTOA 3F8NA 2D0AA 2IG0A 4WCEL 1DGRM 2ZQBA 2KZZA 4BC3A 3NTIA 3PO2J 3K9TA 5CR2A 3DLAA 3BR6A 5GAOn 4Z4EA 3ULEB 5ILSA 2YG8A 3CWSA 2ELKA 3LWFA 3TGNA 4KGXB 2YX4A 2L3RA 3LWIA 4IHXA 2RJEA 1B9DA 1FJGK 1MUNA 2VWBA 3RNJA 2NNYA 3L3VA 3INZA 2Y75A 1E7OA 4IBNA 2F5EA 5CVUA 4RTVA 2E1CA 2NXNB 5EG0B 3KK2A 1GLJO 1XWLA 3OYEA 2K40A 5GMKj 5A0GA 1PD1A 4XONA 4L9NA 3GNFB 3CCMI 2M3AA 2RF0A 1KCFA 1LWEA 2V7ZA 2VT2A 2VVKA 4Q48A 2YKNA 1N6QA 4WFBL 3VQ8A 4J2BA 2IAJA 2HKXA 3EUHA 1FX7A 2E5NA 1ZC6A 1QHHD 3CPWS 2MG4A 2OFIA 5DUIA 2JHJA 2AKKA 1Z67A 2KZGA 3QOEA 2NRHA 4XU0A 1RL2A 2CT4A 2CRGA 4NHJA 3WNGA 1NK7A 3HPHA 5DM7F 1S7EA 1HPMA 4PA1A 4JX5A 5BMZA 4RTUA 4NXMK 2R5ZA 1PJRA 3CPWP 3PMTA 2BE5F 1K79A 3VQ7A 3MZHA 3MX5A 1XD7A 3HRGA 2P6TA 1WI3A 4FO0A 2OANA 2L7KA 1XPXA 2WSEE 4MDWA 3MN6A 4OU0A 1KQ9A 3UKRA 1OYXA 4AFQC 4MFDA 2F69A 4EM0B 4C8NA 2OF7A 4LB6B 4KBMB 2O8EB 5KQ8A 2PAVA 2YUQA 4XRFA 2LTOA 2VXEA 4QSHA 1ZRCA 2HVQA 4FW2A 3QEIA 2ZNYA 2UUBK 2JRTA 1MJ9A 4AVPA 3KEOA 4Z4GA 3BR3A 3JRFA 3IKTA 2IA0A 1W2BS 4FL9A 2FC0A 5HS9A 1VQPA 1ESVA 2G7UA 3B6AA 1UDLA 2C6YA 2ESWA 2VOPA 3ID6A 1SFOJ 2JA5J 1RBVA 3ELKA 1SMTA 1Y96B 4EJVA 5GAMj 2K3PA 4MLHA 4OMYA 3AAPA 2V1XA 3LSHA 1Q1HA 1JL2A 4AD9A 1TUYA 2LK2A 1EH8A 5FROA 4OO1J 1F21A 1RNHA 5ECAA 3SPZA 1L3VA 4M3EA 1P9QC 1D0YA 5GAN4 3LGFA 1QO0D 3CJRB 5IYBJ 5M1OA 2A6HF 3TKYA 4RKUE 2UWMA 1FNNA 1YNZA 1W36D 4JI0K 1QVUA 4EJOA 5BN9A 3TSZA 3CCRQ 1VQNI 3M55A 4D6WA 4ENJA 2DYIA 3CMAI 4BY7J 1XSDA 1P7MA 3KETA 2HEOA 5HDNA 2HEQA 1D0ZA 4O3MA 3S15J 3HM5A 4G6DA 2JG6A 3KHYA 2QQ8A 3VEXA 1NLOC 1PU7A 2XDBA 1IO2A 2E3IA 3REBB 2KKOA 4PJOG 4M7AD 1NBWA 1QQNA 2VJ5A 2E60A 4A5MA 4ISGA 4M74A 2RA2A 1TW3A 1Y96A 2Q2EA 4U7BA 1MNDA 2E64A 5KNLA 3A5NC 4J00A 3OYJA 5DPKA 1TP4A 2YRVA 1YIJN 3RZDJ 4W5TA 2FBTA 3KXTA 3K5OA 1C0FA 2R5AA 5F2RA 3CCLN 4H0EA 2Y48A 3CBOA 3HVTA 1ZYQA 4JBAA 2OQGA 2WADA 3T8RA 3GDQA 1ONVA 3BOQA 2LBFB 1POGA 4JK9A 4GXOA 2CFOA 1O3QA 4FJNA 5BPIA 2HNYA 4BVPA 2AZSA 4DQPA 3GNGA 5L23A 3TAMA 2DJIA 4G6QA 3X28B 1Q86C 3GLLA 4CCHA 1HYSA 4WXDA 1QVTA 3RMQA 1GXIE 5GMKi 3KFWX 1TUDA 5J4VA 2QWRA 5CK9A 5E3MA 1VQPI 3M0PA 5BR9A 1MBHA 4B9XA 2IIRA 1NGBA 3H1CA 1BA0A 3ZPLA 3F70A 3KLNA 1YX3A 4GYGA 3W3CA 3VF2A 2ESNA 3ZBDA 1JJ2M 3G6EI 1SFXA 4Z4IA 3CC4N 1MMDA 4G9ZA 2LSOA 1IN7A 1SKRA 5GAN8 1UG0A 4XNFA 1RT4A 4IHYA 3AKZA 4BD3A 3C3WA 2KSSA 2CREA 2JGUA 4JKDA 1MSEC 3AV9A 5TGTA 4GCVA 3FJPA 5JVTA 1Q7YR 2HKNA 1LW2A 2FBHA 3ML6A 3GYHX 4R56A 1YI2T 2M51A 3C7NB 1WHUA 1NKBA 4HA8A 1YFNA 1PHTA 1T03A 1WN7A 1AZGB 2DOFA 4AUXA 4Q5SF 2I7PA 2TDXA 3RR6A 3G4SN 2STWA 3H9GA 2YR2A 4HPQA 5M3MJ 4UC4A 4FJ8A 2FF4A 4KHNA 3T1YK 4HX4A 2HVRA 1QNTA 3QICA 3HZJA 2DZ9A 1KG4A 1GLDG 3LALA 1F1BB 3E9LA 4HF1A 4YOWA 4DB3A 1LQ1A 5LMNK 4M77A 1A5JA 3HHTB 2NOLA 1JRIA 4J9CA 5A2QE 3C6TA 1VQ4A 4FOEA 4Z02A 2LC2A 1AHDP 1SFEA 3LCNA 3QEVA 5GADP 1XSVA 5CZ1A 1NE8A 1A31A 2PVDB 4JLHA 4HQEA 3PNVA 3R1XA 3T3FA 3ZX0A 3I4PA 2YNHA 2JWLA 2JMCA 5F1RA 4LG0B 3G1OA 2LH9A 4ENKA 5J3LA 2UUCK 2XPWA 1B07A 1YOVB 1RRQA 3MKLA 4J9DA 3DWLA 3G6EN 5F04A 5C0YA 4CXFA 3FMQA 1QVPA 4KHWA 3A5OC 1RNLA 3VA3A 1GXQA 1HJDA 2HMIA 3MCAB 1Z9QA 1IJJA 3FWEA 3C12A 2CSIA 1ODDA 3NH2A 2YSRA 3WU0A 1HC8A 2D0PA 3SHFA 2OX7A 3S8PA 4GMJB 1QPMA 3TSUA 2AA4A 2ACJA 4DLGA 2PJRB 3M8JA 3JRDA 3EGDB 1YYVA 1R58A 2KZVA 3CCUT 1NJIO 1PUEE 4CK1A 2XGEA 1Q82R 3I0SA 2JA6J 3W6KB 3QFPA 1K73O 1LNWA 3KX2A 1LV5A 5DD8A 4JLGA 5D5VB 3GTQJ 2ZF5O 3JW4A 2V26A 2JPBA 3SK3A 2CP5A 2L02A 3GW2A 2LREA 3CCJN 1HDPA 2CW0F 2QQBA 3O3HA 1QHGA 3IHOA 1IGNA 1ZSZC 2E20A 1FYLA 1KQ8A 1WZOA 4J2DA 2M0CA 3K2PA 3CCRA 1TL3A 2EZLA 3M0TA 1Z25A 2XPUA 2NRZA 1KXPA 4FZYA 2DODA 1R0BG 1N5ZA 4BRKA 3V9XA 3DLEA 1QLYA 3NWSA 1VRTA 4CF1A 3DTIA 3QBWA 4B44A 4ISFA 4XIDA 3C6AA 2L9VA 3SWNB 4DQSA 3ZQCA 5HDKA 5CVRA 3SB2A 4HV5A 2H3GX 5C3EJ 4HSRA 2UZKA 2L9RA 3MXMA 1MMNA 3NBPA 4K8ZA 4G6TB 2O01E 4PHTX 3EUAA 3TL4X 1M5Q1 4A93J 4EA4A 1U1SA 1VQOQ 5KYYA 2IP2A 1DDNA 4L5JA 1FKOA 1V5GA 2LZ6B 3CESA 5J47A 3O8VA 1X3ZB 4E1JA 4BHPA 5HP1A 2FBIA 3A0IX 3FXKA 2OZ6A 2EWNA 2O88A 2O31A 4ILJA 1D8JA 4H03B 1WWXA 4EMKB 3ENHA 2DEUA 3K10A 3FHFA 4E7HA 2WV1A 2B7EA 1U2VB 1F43A 2RJDA 5D7UA 2X1DA 2CUEA 4XBFA 3P83D 1N77A 1E3MA 4M9SA 1YHQI 1OPCA 5AQLA 1DP7P 2FRHA 1UA0A 1WFWA 3EGUA 3M0UA 2Y9ZA 4J7FA 3CC7A 1O57A 4KMFA 1VQ7Q 2EFOA 5J26A 4F8RA 4GVMA 1KQ1A 2QEXN 3EDPA 4E89A 4BNCA 5AQTA 2ADUA 3C2BA 4BXFA 4I6MA 3DV8A 4ABZA 2W84A 4B48A 5GAOq 5KN9A 2HQXA 3OMGA 1Y39A 3AA3A 2Q2EB 5J2QA 2R7RA 1BU6O 1YJWQ 3RVCA 1ZHIA 3MCPA 5D5UB 4MTEA 4GRIA 2E2QA 2OTJA 4CJWA 4M78A 2X6OA 5C15A 1G2HA 2R5YA 3LSJA 3H0FA 5I3UA 2WY8Q 4ID5A 1ZHFA 3DLKA 4CGDA 4RCBA 1ZBFA 3M58A 4FJIA 4AIKA 2Z5UA 1JHFA 3G73A 2P51A 4DSKA 1HJRA 4L0YB 1A0NB 1HF0A 4FCYA 1IG8A 5A2QK 4XLHA 1P92A 4FWOA 5BRDA 3ZEUA 5AQJA 2IS6A 5JLWA 1RAGB 1S72T 3CTAA 1YI2I 4B24A 2GXGA 2EILH 3WXIA 1BKBA 4HTUA 3CVTA 2YHTA 4N0BA 3F8BA 1XTDA 4F93B 3H08A 4B1XB 3Q0UA 1QVGS 4A0XA 3P9CA 1B8IB 2H09A 2I2LA 3D2EB 3EFSA 4HYEA 3QEPA 5H20A 2JA7J 3CCMA 2ZD1A 4H5RA 1ZLKA 4W5RA 3PIOL 2RQQA 5HRRA 3I59A 3WXMB 2CU7A 2NUTB 2BVMA 4UXNA 3JRGA 1D9DA 2GA2A 2CDTA 4PUSA 1D4XA 2HQRA 1QWFA 3LM9A 4DTPA 4H0VB 4B9QA 4FWNA 3PFYA 4BRAA 4OIRF 3EFOB 4AG2C 2DA3A 1XQHA 2DA5A 1KFZA 1NK6A 5J6XA 2G8WA 5CYMA 2P4TA 2P0QA 3DLBA 3K6GA 3H3VK 3KLGA 2JSPA 1CXUA 3VPZA 5J2MA 3L6QA 1ABQA 4H0PA 4BRLA 5EDNA 1HKCA 3AVHA 3G3ZA 3KPHA 4L5IA 3IV5A 4LNPA 4HNTA 3HC7A 2YHXA 2XI9A 4PKIA 3O6WA 4XOPA 4LDYA 2LOOA 2HOSA 1GL5A 3HSEA 3TQ7P 4NLCA 5DM7L 4M3WA 2E1MC 4EW4A 1TK8A 4FK4A 1NM7A 4V19S 3NHNA 1FPQA 2A6TA 1K9MO 4B9NA 4L6V5 2GWJA 3W6VA 4FJ9A 3P9KA 4CEZA 3THWA 3TEDA 1B6AA 3N4QA 1JJ8C 3SMPA 4DYCA 1F5TA 4CHZA 1R5ID 3G1MA 4WK8F 3CXCM 2FRYA 1U2WA 1WXUA 2MI6A 2ZCWA 1K8AO 1ENHA 1RDWX 1RACB 2E7WA 1U04A 3LP2A 2M0MA 4JS4A 1SHGA 3VUBA 1S7OA 1B7TA 2MPXC 2XRLA 1YJNI 4QAGA 2HAXA 1N34K 2ED0A 1RT2A 5EEAA 3C0CA 2H6CA 1K0SA 2ZO4A 3RMBA 2VOOA 1MUYA 1NGHA 3FDYA 5IOYA 2XRIA 3TW7A 4IWVA 3RPQA 1PDNC 3TMOA 3CD6T 1ZX6A 4XAXB 2PZSA 2DDAA 4QIWN 1XHZA 5FPMA 2LKXA 4PJOA 2VQFK 4OOIA 4AFSC 4HUFA 3G0ZA 1UFFA 4DTSA 4ETSA 3S3NA 4DQRA 1X2QA 4YOVA 1XQSC 4AHRA 1TAUA 3URGA 1NK9A 1E2XA 2E2PA 3MD2A 1J5YA 4EMSA 5T7BA 2IA1A 3CMAA 3JCMV 1BR1A 3D2FA 2HDDA 2M9UA 1FIAA 1MGTA 1XJWB 2E1ZA 4HOBA 2DRMA 2A69F 3HOUJ 4A61A 3AAFA 3M8SA 4XQ3A 4C8QA 2E5ZA 2X9HA 1BA1A 2L2OA 5AQPA 1WSGA 5GP9A 3LSTA 1SL1A 2K5IA 3CCJI 2ASOA 4HT9A 1ZGWA 1YX5A 4M3XA 1VQLA 4RS8A 1YUWA 3MFKA 1L0OC 5JR3A 1VIFA 3JCUC 3BTCA 5HLGA 2XASA 3JAMK 3LYIA 3HT3A 3QG1A 5HBMA 4PK4A 3JRHA 2PNIA 1M30A 4OGEA 3WTTC 2Z9OA 2ZXWH 4AYBN 2B9SA 4EVVA 2M34A 2HB5A 2EWSA 5GIPA 3AVFA 3ZSWA 3U6FA 2A7YA 1KD1U 5KRTA 3THXA 4B9MA 4B1YB 3EGXA 3EG9A 1T98A 2P9NB 2KRSA 4CK2A 4E7KA 2K5CA 4FE7A 3ZMZA 4E4HA 1MHNA 1W7PD 2XSDC 2HOTA 2CUZA 1IAWA 1RC9A 4K2EA 4FJ5A 1X3UA 4II2A 2E3HA 4DTOA 3BT9A 2HOEA 1BIUA 4PKHA 4DQQA 1JGGA 1ZK8A 3V8JA 3HBLA 4A2UA 3SLCA 2DA1A 3CETA 2PN6A 1TKTA 5HK3A 5J1YA 4B1WB 3E6BA 4P5OA 1K4US 1BCMA 3BUZB 3ZMTA 3ZR8X 4Z0UA 1HYOA 2A07F 1TV6A 1WJSA 1MH3A 3RI4A 3GO5A 4MTDA 4CDGA 1X3WB 3T1BA 2RAEA 1R0AA 5GMKl 1ZRFA 1SEUA 4JNEA 5JMVA 5IP7J 2KYBA 3C18A 4YFNF 3NQOA 3NTKA 3VGLA 2LCLA 2PLYA 1RLPC 1NK4A 4KJZA 5GAEP 2QLZA 4M7DC 2QDYB 3O9UA 1YI2N 1RILA 1QU3A 4QKUA 5CKTA 5LJ3h 1RUOA 2WAFA 3TPQA 3OYKA 2EFWA 1QVGP 2NVTJ 1MWMA 1N5YA 2MABA 2QM1A 2QZ8A 3FDRA 3HP6A 2XY6A 3MEEA 3FZHA 4B43A 2GQVA 4YIIA 3CP8A 4KH5A 1KK7A 2GBQA 1D3YA 3DB3A 5MLCQ 3P39A 2HQAA 4DYQA 2V1UA 5BPMA 5GAHP 4CJVA 3R0AA 4R8HA 3M1EA 1SAUA 3HSRA 3LP1A 3OSFA 4OX9K 2HZTA 1UMQA 4M7DF 4RM2A 3LGLA 2RI5A 4DR3K 2FXUA 2TRTA 1IKYA 1JJ2S 1XGNA 4CEOA 1P8ZA 1KRPA 1ZA2B 4I6MB 4CHUA 1MBEA 3DBHB 1PUFB 2VCPA 3EE8A 3ZEHA 4QPOA 1G2BA 2L7ZA 4OVLA 1B1BA 4A2BA 1ZSGA 2X3WD 3PJRA 5LLQA 4CZZA 4IG0A 5CQGA 3DBRB 3HTRA 2PJPA 1VQON 3V9SA 1T33A 1O3SA 2CZ1B 4BQNA 4BWMA 4UUSB 5F0HA 2NYSA 4NL2A 1KFSA 1WGXA 1HNVA 2RPNA 4LXCA 4M78B 3KLHA 3X24B 4TV7A 3ER0A 4A5BA 4BHCA 4HRIA 3CXCP 4BI8B 2QA4I 1LE8B 4OB0B 3DFGA 3LA3A 4DSJA 1SPKA 5CKBA 1Q7YU 2KRNA 5HVQC 2JVVA 3CCQQ 4C8QD 1QKXA 3VWBA 1D8KA 4AIHA 3DLLA 5CKFA 1LWWA 2DFHA 5L3CA 3P38A 2DW4A 2BZXA 1TU0B 4EMHA 4VUBA 3THKA 2KLOA 2BANA 2KVQG 4B09A 4CFAA 1Y57A 3U9GA 5EY4A 3PIPL 2K4BA 1YQRA 2Z0WA 4M7DE 3WG7H 2NS7A 3LOCA 4FWLA 4EIAA 2L7MP 5FLMJ 2HSTA 4A3LJ 1I3AA 4FJ7A 3KLEA 4HAMA 3JRBA 2JS2A 5GANf 2KK4A 1PRLC 2GTDA 4E7LA 4N56A 5FJ8J 1HKQA 4DR5K 2W10A 2DCEA 3HOWJ 2MOXA 4DQIA 3OL3A 2KFNA 1GUUA 2VUMJ 2E71A 2NZTA 4FSVA 3CFOA 3PX6A 1YIJI 2EJFA 4FLZA 1JXEA 3AVCA 1Y64A 3AO1A 3EEQA 2F2XA 1AVZC 3MP6A 4RW6A 2GWKA 2V9VA 1A35A 3AARA 2CZ7B 1ZRDA 3CF2A 2EIJH 3M0SA 3Q5FA 2HHUA 2AHJB 2R7YA 3C4SA 5H6QA 3WXLA 3B6PA 1I0CA 3WTXC 1SEMA 2HL3A 5KPRA 5L3EA 5KYXB 1WZ2A 1BI2A 4YIFA 2VC8A 4IUQA 3PLAA 2YWWA 1MMSA 1SKUB 4J8OA 3VS3A 5IT9O 4G12A 1V3FA 4EHUA 2J6FA 4WFAL 5I22A 4GLKA 3GUDA 4FT4A 1VQKA 2OBPA 3K4JA 1RBRA 4DR6K 4BAYA 3FHNA 2VJJA 2J05A 1VQNA 4B3RK 2HPMA 1RPWA 3PQKA 3HL8A 5TRDA 3FEOA 1J6ZA 3IH7A 1L3TA 4JDSA 1LPQA 1YJWN 3VQPA 2DK8A 1BW5A 3OW2S 1IKXA 1ZR4A 2IOCA 3CC7Q 4N4IA 2EA2A 2CGJA 4KUIA 1WSEA 2LY2A 3FMRA 3SPYA 5KPTA 3NRVA 2BTTA 2RJCA 3M4YA 4CGJA 1VRUA 3IWFA 2UXNA 5FKMA 3SDZA 1UZCA 4CJUA 1JJ6C 2WC9A 1SUQA 4UOBA 3O4NA 2RNJA 4DV4K 3BW1A 3ZXSA 1JBMA 3D7EO 3SNNA 3G1LA 1VYTA 2HQNA 4B4CA 3CCQT 1X19A 4BRGA 3DU5A 3H92A 4IHTA 3M8EA 2R7QA 2BXYA 3QPHA 1ATSA 1RDBA 1SQKA 1BIZA 3TANA 4F4KA 3WNHA 2OPSA 2F5DA 2ZGZA 1QQOA 4MO4A 3VEPA 1KG5A 3MEWA 2BY3A 2HFHA 4CGFA 1K6OA 2NOZA 4F7UB 4JI2K 4Y1CA 1KQSS 4YPRA 3EGXB 2PU9B 1F4KA 3HYFA 1SD7A 2VQHA 2D9TA 1VQ9I 1YI2A 1LMZA 2DLLA 2PMZN 4OPKA 3FXLA 1BDGA 1WHGA 2JHNA 2Q2RA 1W97L 3H35A 1S1VA 3A8HB 3QWYA 3JCMc 2HCKA 1YQAA 4EJTA 2BUPA 1P4WA 2FXAA 4O5FA 3VS4A 3MDQA 2O5RA 4CGIA 4CZEA 4AHTA 4BRQA 5IT9Z 3X26B 3SCXA 4YDUA 3CC2A 1AOJA 4E6KG 4BRNA 1OCPA 2RI2A 4RW9A 2F4IA 2F4OB 2EH3A 1VQKI 4JI3K 2AXLA 4CJPA 1W6XA 3J8AA 4L3QA 3U9ZA 1HK9A 1VQ8T 3LPUA 1TZLA 1VRLA 1T0FA 3ZT1A 4CZHA 1I50J 4IHVA 2QTVA 1NGNA 1CZAN 2BTFA 3FFIA 5M5XJ 4HCZA 1YJ9I 4A3JJ 1WJQA 2B8AA 2KIUA 3BDDA 1SKSA 1USTA 4I6ZA 4LSNA 3CD6I 2EAYA 1OVYA 2F4VK 4I02A 3OW2M 4Z2YA 3K5MA 1FOXA 4FLWA 3NMZC 1IDYA 1S6PA 1GLEG 3CPWM 1VQ7N 2M4KA 1VOMA 1SSHA 1X9JA 2CV1A 2HD0A 3L0QA 1VSHA 2LP5A 4A12A 2FBKA 4CF0A 4FWKA 4RB1A 2ETJA 5HODA 2HF4A 4CIEA 4HVVA 2V8KA 2E4LA 1IRFA 3OJSA 3LP0A 5KAFC 2O4XA 4BC4A 1VQ7T 2DL4A 2K86A 1D0XA 3LANA 3O80A 1JT0A 1WIEA 1FWZA 2R7FA 4DOZA 4Y28E 5KE2A 1YF5L 1ZREA 2JTFA 5HNHA 1LVKA 4O5VA 1Q82C 5LJ3j 1FYKA 2AJQA 5KYWA 1B72A 2VI6A 2DA9A 1JUSA 2DA2A 3B73A 5CJ9A 4XSZF 4U7DA 4XQFA 1HKGA 2HXIA 3IHUA 2D1VA 2JW4A 1TYQB 4AH9A 3AO2A 2CUBA 1H9TA 4M71A 1MSFC 2LF7A 1D1CA 4N0AA 3U3GA 5FLXE 5FRMA 1KHCA 4FWMA 1ATRA 4F04B 5GAMe 1BN5A 2CGHA 2DBBA 3SDGA 4CFDA 2GXAA 2FPFA 3UR3C 3CCVN 1DP3A 1SL0A 3DXKA 5CAIA 3HI0A 5M1PA 4S05A 4FHTA 2P9PA 3V1RA 4PJOC 1ETXA 3VQAA 3HRMA 3CMAN 2NS0A 1C0TA 3S1RJ 4OMLA 2WFBA 3VS5A 4ENMA 1L3LA 1UGSB 2F2WA 2NNNA 4BC2A 2P5VA 4HUEA 4PJLA 1BWFO 3NF7A 2JWKA 4B1VA 2Z1IA 2RQWA 1S9GA 4JUVA 1IXDA 2ENMA 4GV3A 1VQ4Q 2ECBA 2VYTA 3BZCA 1NGFA 3LDSA 2KYMA 4HNUA 1OLTA 3QOPA 3MAJA 3CD6A 4KIFA 4XRSA 3AVJA 1UAAA 2CP6A 5GAMf 1LWVA 2E6NA 5J3BA 4CIFA 1XI1A 3QIOA 2GWRA 2P9KA 1Z6RA 4RDUA 1X01A 1KAXA 2QA4Q 1VQ4N 2BY0A 5EZGA 1IXCA 3S41A 1C1AA 2KBTA 2L3PA 4M3ZA 2VGMA 4LUDA 4EGYA 2DERA 4PQUA 3MCZA 1WFXA 2V1RA 1PRMC 4NL3A 1T95A 1NBEB 2ZBKA 2W82A 1N3CA 5HNFA 4DG1A 1RI0A 3ZQIA 3PTAA 1SKWA 3GXOA 4NOYA 2NUBA 1M1KO 3A5MC 4A3BJ 3TABA 2VKHA 1FTTA 2EINH 3LDQA 2XB0X 4CJKA 4JN4A 4BDPA 3EH1A 4BRHA 3MP8A 2DAQA 3FKIJ 2KIMA 2P0KA 1M90O 1GFCA 1YITI 4CYDA 2PI0A 2XV4S 4M7DB 2CZ0B 3E6MA 3B6OA 4EGZA 4B3OA 5M1NA 2DK5A 2G8HA 4GO1A 4BY6C 1IBMK 4C8QB 5LL6Z 3RBBB 2WSCE 1KHIA 5CYQA 3R4KA 4DLEA 5JI6A 1YIJQ 1FBUA 5BN8A 2L0AA 1S3JA 3NVKA 1BGXT 3KTQA 4KIGA 1WYXA 3QP5A 1MKMA 3RDVA 1VQMN 3I5SA 2EYWA 1KC8O 4ORZA 4ZNXA 2YX6A 5JS2A 3KP6A 4Q5WA 1QQIA 3IL2A 1YQKA 3MXJA 2IVWA 1B92A 1Z3XA 2F2VA 4HEA2 2DYRH 2XDDA 2VN2A 3M56A 4Y4RA 1N6AA 3BG7A 3J81Z 2YLBA 1VQ4T 4PFPA 2AS5F 4RM3A 1KAZA 3A8MB 4DOVA 2DETA 2I5JA 2IBDA 3TDUC 4QS8A 2PQWA 2HKQB 1MGQA 4M75B 2RMOA 3UPUA 4F16A 1S5LC 1TWAJ 2KXDA 3L42A 3VEYA 3E2UA 5FB2A 3N4PA 2DFIA 2VPRA 2FG0A 1NJIR 4WQ4C 3CWUA 3HXLA 2IRFG 4OFEA 3BR5A 2RE2A 3SDBA 2NUTA 2X0LA 1JLQA 1X3NA 1P4AA 4M73A 1UWBA 3MWMA 3I0XA 2JVGA 2HMAA 2OJED 4MDXA 5I2SA 1WPYA 5GPAA 1ZBJA 4O0JA 3SJMA 2GIZA 1LOJA 3CDIA 3MEGA 3M3ZA 1F36A 2JMAA 3PO5A 1VQ6A 4HLXA 1KD1R 3GF5A 3O4WA 2D8HA 1U06A 3OW2A 3OSGA 4BXXJ 3HHGA 3DXMA 4GGGA 3MWPA 3DPLC 2O03A 1ILYA 4A6DA 2Y9YA 4CC3A 5TKWA 1E3OC 3DEUA 2PJRA 2H8RA 1FJLA 4BR7A 2R7DA 2K2MA 1N9RA 1M3CA 4KTQA 2BE2A 2HOAA 1LDJA 2L4MA 2M30A 2FBXA 3JAMZ 4KFBA 2DE0X 2JJ7A 3CUQA 3VQ4A 3OYDA 1G3WA 3HKSA 3V6DA 2L01A 2EZHA 4MDAA 1HNXK 2IS2A 1JKHA 1ORNA 1YJNN 3SAFA 1ASUA 4D5CA 3CC4Q 4C23A 2EYYA 1TS9A 4MDBA 3K58A 4W1UA 2O7OA 5FU6B 2DL5A 1M27C 1Z77A 3P1GA 1PNJA 1QVFA 4LDVA 5E8GA 2XAFA 3HRSA 4YEJA 3ZMSA 4ELZC 2QEXA 5GAOl 3K4BA 1YE9A 1WEFA 5EGOB 1TC3C 3KK1A 3KKSA 3EAEA 4ENNA 2RF2A 4D5FA 3HB9A 3L2WA 3F21A 2DFUA 3CLOA 1BL3A 1PG5B 1U3OA 1H8KA 2NUZA 3H0HA 2Q8KA 3AFHA 3S3OA 4C1NK 4GLMA 2V51B 3T1AA 1FOKA 3TQNA 2RHZA 3J7AO 3DEWA 4M3BA 1HU0A 4M3YA 3DF8A 3KE2A 1X1BA 5AR0A 3CDHA 2SEMA 4CBUA 1WHLA 4E0DA 1VQ5N 1RTJA 4U67L 1NJXA 2BHYA 5JVHL 3V8KA 3I9V2 1ZKGA 2YHBA 2EQKA 2HTJA 2YXYA 4RMNA 3OYNA 4M75D 2CYYA 1V4RA 1LDKB 3SEQA 3TP3A 4FWRA 5BRFA 2DO3A 1BJZA 4I0BA 3GIBA 4LDWA 3E1SA 4DUZK 1I1SA 1BR2A 3SEMA 4E47A 3CCVI 1OJLA 4ANJA 3NAUA 1CKAA 2UXXA 3I33A 5CVIA 4AILC 2DTRA 4DW6A 2HHQA 1VQKN 4M7AE 3MKWB 4CCNA 2BUDA 1H641 1VQNN 3CO6C 1WHHA 4NO7A 1WVRA 1S1WA 1V54H 3GOIA 2Q36A 1PVSA 2XVCA 1EH7A 3EUKL 1N75A 4J7IA 5JVGL 1X4PA 2CS3A 1AT1B 2QAZA 1Z9CA 1DU6A 3CCJT 3OA6A 3DTKA 2M1HA 2MF2A 5FU7B 5KYYB 3O6BB 1SD6A 4Y92A 4ZYDA 2M0YA 3A03A 4BR5A 3J81K 3J80E 3E1YA 2EA4A 4Y3OA 1HDDC 2Z99A 2M8EA 4WF9L 3DTEA 5JHFA 1XTAA 1X2NA 3RQ4A 2IC3A 2XB5A 4EZ6A 2BH1A 3KP7A 3AL0C 3BJAA 2H3JA 2JOYA 1HPZA 4LFCK 5LRRA 4QQDA 1HNZK 4JKAA 3FLGA 3M1CA 4FETA 4LJZF 1GV5A 1FMKA 4PL8A 4KN7X 3OYYA 2KIQA 1HQUA 4JOMA 1VI0A 2KZMA 4BU2A 4ZZLA 2UXBK 5EU7A 1GLAG 3HSTB 5FPNA 5FPDA 1S5JA 1XMXA 4Y1DA 3VQBA 4CZFA 2O8DB 1VHXA 3NF9A 2A41A 2ISYA 2XG8D 5C2FA 4KH4A 4F52A 5DV5A 1NK3P 4DU4A 5GADJ 1RT3A 4F3QA 2ME0A 1FN7A 4HT8A 3O3GA 3ABLH 2A37A 3ZLJA 4LF4K 2IGNA 2LMDA 1NHAA 3QUIA 2KT8A 3S2DJ 4IG3A 4JJNK 1WSUA 4KAZA 2CFXA 4V2SA 1A6IA 1HKTA 4EJZA 4HV6A 4OIQF 3I55T 4F2RA 4B8AB 2R0QC 3BQZA 1S72I 2OTLI 1HA8A 4C30A 2J6OA 1RRSA 2CZ6B 1JJ2P 4M7XA 2KTQA 3HSFA 4JPBW 4CYCA 4KPYA 2F8TA 5HY6A 4O5BA 1H88C 4KMUX 1J5OA 3HK2A 4MGRA 3JRAA 5DK5A 3TO9A 4WE1A 3QZ5B 4UV9A 2MA3A 3F72A 3AA2A 3WVEB 3R0JA 3ZSRA 4DV1K 4OMOA 4RGXA 2XAUA 3KEYA 4ZN3A 4PNOA 1VSLA 1LWFA 1YS6A 4WXHA 5AQXA 2P9UB 2OQRA 4RLFA 1U78A 4YY3K 1HYZA 2B4JA 3EYIA 4FLTA 4IO9F 3JSMA 3QYFA 8AT1B 2QDLA 5J4YA 2YUSA 4BUPA 5HKCA 4XU3A 4RBOA 5ERIA 1ERDA 3JCMX 3GTMJ 2CQKA 4JX6A 4NQWB 2LLKA 3ZCMA 3S14J 5KVRA 4XK4A 5JS1A 1WB9A 2OV7A 3VEVA 1T0FC 5AQGA 3MEDA 5D4RA 1AU7A 3FK6A 1WJ5A 1M3BA 3EETA 5BPLA 3BE3A 5EJCA 1W7PB 3RSNA 2XY7A 1OU8A 1WAJA 3HO1A 2RQRA 4H5VA 4E1MA 4QVDA 3TAFA 2EKOA 4Z8AA 4ESRA 3K5LA 4X9CA 4AFZC 4BRPA 3HKZN 1KD1C 3PM1A 4F17A 4CHPA 4LE9A 3BY6A 3A8OB 5GAN3 1K8KA 4J83A 4DGWB 1WLJA 4MMKA 2CKKA 1N39A 3UA6A 1HOMA 2YNGA 4JI6K 2E10A 1UGPB 4IX7A 2H27A 1QRYA 3JCMJ 1ULYA 4HZFA 1PYVA 3AVNA 2XAGA 2DTHA 1W70A 4MLEA 1WI7A 1P2FA 3BEXA 5F08A 5GAEJ 1UG2A 1UHSA 5LJ5f 3MO8A 5LJ3e 1ZAOA 3O5BA 4C3HJ 3CI5A 1DJ7B 1JGSA 3CCUQ 1UHWA 1UGQB 4OGCA 3H45C 3UB5A 5LJ3g 1WEGA 2AQEA 3ZFJA 3A01B 1OPLA 4BEHA 4E7JA 1RLQC 2GUIA 3A4CA 3HOXJ 2ZJQF 3O4QA 3ISPA 3OIQA 3QHSA 1XNIA 3EPZA 4JRQA 2FJ1A 1USSA 3F22A 2Y0SA 1IUFA 1FBSA 1WJDA 3MEAA 3MHXA 4EIKA 1IHWA 3K1MA 3OHRA 1LFUP 5EF6A 3M6GA 4G94A 4JKCA 1WLPB 1K8KB 3AVIA 1JB0E 3AA4A 1TNTA 2V79A 3D1NI 4OF1A 2VQCA 2OTJT 2OZSA 3HSBA 1YBYA 3RKWA 2EJ9A 1NJYA 2O8CB 4K8XA 2LFBA 1LE8A 4MZMA 5LJ5d 5AONA 4I2OA 4CO8A 2Z33A 4E1NA 1A04A 4XM3A 2W48A 1U6ZA 2A5YB 1JUMA 2HHXA 2HBKA 4X1EA 1ZQ1A 1WNSA 2IT0A 4C0DC 3CCEA 1TL1A 3SYZA 3HOZJ 1VQ4I 1YW9A 2VONA 4A5AA 1YTYA 3CCYA 5GTIC 2HYGD 2HKOA 1G5VA 2KDZA 3V8LA 3RYRA 2ECZA 5LBQA 1NLVA 2OC6A 1TQIA 2V8IA 2KRCA 4KN4X 2P9IA 2ZWHA 1ORKA 1QSYA 2KIFA 3CUQB 1XQPA 3WU1B 2XF6A 2O8XA 2K85A 3A1PA 4BI4A 2OA8A 2L9NA 4F2SA 5GIOA 1N27A 3WTZA 4B6MA 3I56T 4BACA 5BS6A 4RB2C 1W7AA 2BYVE 3BCBA 3LW5E 2IPQX 4M77D 4I09A 3CC4I 4CEQA 1GLLO 2QVOA 2M45A 4XLNF 1HSTA 5LY3A 4PL6A 2UU9K 3G0QA 4YORA 1BJAA 5F27A 1B34B 3HRUA 5FGMA 1KONA 3M5RA 4XTZA 3CCQA 1VQMQ 2OUMA 1X2KA 4GYIA 1OH5A 5CQEA 5D6FA 1VQOI 3ESWB 2ZPBB 5IHNA 4CJ5A 1YW8A 3DU6A 2P84A 4KREA 2LJ0A 4BROA 2ZAEA 1LAVA 1SVOA 2ECCA 1MBFA 4OINF 3BZKA 2P9KB 4LSLA 3I54A 2VB6A 3QKJA 4YPHA 1SAZA 2MH9A 3WHCA 2A42A 3MX2A 4IOAF 2PG4A 5GAOp 3GG4A 4DQ8A 4E19A 2ZCFB 4NC7A 4UUVA 2JLEA 3ZOBA 2MK5A 4O4GA 4OWRB 3CWAA 1QPIA 1F1ZA 2K79A 2QWNA 3NH0A 3HTSB 3NGPA 3SQ2A 4Z94A 2EHGA 3ZT0A 1W2BM 2ITMA 2ITGA 2EGAA 1FOWA 3RCOA 3A5LC 4C92E 1KJWA 2CGLA 1LUJB 2Y30A 4D7NA 4M3UA 2WA0A 5LJ5e 4EPCA 5BPDA 1GXPA 3HUGB 3LWMA 1PM3A 1C6VA 2VXZA 1PU6A 4G9YA 1OYWA 1N9SA 4KB0A 4LFUA 1NGCA 2G9WA 4RA2A 3I4MJ 1O7FA 2ESHA 1R5HA 2DTIA 2QI2A 3AG3H 3VYTB 2CV2A 4OMQA 1YTAA 1G83A 2DO7A 4AM7A 4KB1A 1CLQA 2VJ4A 1C6VX 4CZKA 3AG1H 2O8CA 3OBYA 4A4HA 1C0WA 1Y97A 1Y71A 4XIUA 1HLVA 3JAMO 2ZJRF 4XRMA 3QYGB 3WQUA 3TOAA 3CCEQ 5KN8A 1I4K1 4BQOA 4Y15A 3RR7A 3I56Q 1DGKN 1T3VA 5M5YJ 1WSIA 3Q3SA 3DWLE 4BQZA 4I76A 1IREB 2E65A 2JXBA 4NB5A 1ZELA 1BR4A 1BG3A 4G7OF 2VC1A 1KAYA 5K14A 4CJ3A 1VQPN 3NNQA 1XDSA 4XSXF 2A05A 4DEXA 1BISA 4CYCB 2E2HJ 3FZLA 3N05A 3T69A 4OKEA 3SWNA 1D5AA 4CESA 4AM3A 3ENBA 3BF1A 3CJBA 3UWNA 1ETKA 3G71A 3NEUA 2DX1A 3G4ST 4ILGB 1NH3A 1WHJA 4TSXA 2CQ7A 4KDPA 1RR7A 4EV0A 3G6ET 4I0AA 4C8KA 2HNZA 2NRXA 4RB3C 5IYCJ 4EHTA 1TTHB 3ID8A 1K9MR 4XKVA 1A5VA 2DYBA 3OYHA 3EY1A 4OMMA 2ZPGB 8ATCB 3CCSA 4CI0C 2O8BB 2XAHA 3UKUA 4FLYA 3FBIB 2HMPA 4KHQA 2NVUB 1QKWA 4OAYA 4UY8O 3S1QJ 3HVRA 3HPGA 3A1YA 2R7XA 2WTEA 3W0LA 3WUHA 5LJ3d 4EATA 2WB1A 4Y33A 1Y8RB 3H5AA 3A98A 1RI9A 3DKMA 4FVUA 4HVWA 3ASNH 4NS5A 3VRYA 2QSGX 1U8RA 3QSUA 2Y1IA 4KH1B 3F6VA 2F5TX 6PAXA 1VNDA 1WX6A 1NJZA 4LD5A 1Y6IA 1KQ0A 3F23A 5ELZA 2NOBA 1G4DA 5CO7A 3K9JA 3M59A 2CT3A 1JCFA 4EFHA 3CCVQ 4DTUA 1KG1A 5HLFA 1HBXG 2PMZA 4D9JA 1BBYA 4FWQA 1QE1A 1TWGJ 1J09A 4PGGA 5K7HA 4M78E 2JMWA 3KLOA 2PZ1A 3K1PA 3OR2C 1VQKT 1AZEA 4QQGA 4BXUA 3M0QA 4DZPA 4AC0A 3I71A 3PUBA 5GANj 4N4NB 2C0IA 1K76A 1W36C 4X65K 4RW8A 5HDGA 4XR6A 2K5LA 1RTDA 1YITN 3VB2A 1C1CA 1I6HJ 2ZGWA 2GFUA 4OKKA 2J06A 1ZG1A 2HHVA 5L3GA 5DD4A 3BDUA 2DQRA 2YHYA 2Y90A 4L9VA 4CGHA 1IHVA 5B5EC 4JZ4A 3EUHC 3NCIA 4KI6A 3QNNA 2F5VA 1WJCA 3ULEA 4FVMA 4DSLA 5GAMh 3WXKA 2XY8A 2XMFA 1LVAA 3P5JA 3IH2A 4R1HA 4CBXA 2QTXA 2CJJA 3CUQC 3SXYA 3E01A 2EYQA 4FWSA 1RESA 1MU2A 2D4WA 4HX7A 4QVCA 1LWYA 2BE7D 3OJUA 3CCLI 4CJFA 2OPRA 3A02A 2M8GX 2YS9A 3H9NA 4FK0A 3CIPA 1KC8C 5LD2C 4CCOA 2HGCA 3VS0A 3CC2Q 2GV9A 1GFDA 2KFDA 4E9EA 4QS7A 1SC7A 3DI6A 1ZBHA 2DXCA 4B8CA 1FK9A 1KSWA 2DMTA 3MJXA 1VQLQ 1V4SA 3HL2A 2O8BA 5EGOA 2LMJA 5D6EA 3VUZA 3K5NA 5DYMA 5M9OA 2R5YB 5B8HA 4YNQA 3GVAA 1QVFS 3LDOA 4DFMA 3S3MA 3IKVA 1HW2A 2EYZA 3CUOA 4M3FA 2JN0A 2HHHK 3NDKA 2ATQA 4C2MJ 4RTFD 4LF7K 2JTMA 4UUTA 2LQNA 4M6VA 5AQYA 1T8IA 4C8MA 2ZFWA 1TWCJ 3GFIA 1PCXA 1N36K 3SZTA 1M90C 4IOCL 2DVJA 1E6GA 1YN8A 3KK3A 1ZBXA 3VA0A 3FR0A 1XGSA 3KCCA 4DR4K 5FWBA 2X6YA 1BL0A 2CH4A 1VQ8A 1LPLA 2IDOA 4IEIA 5HRSA 1YIJT 4XLAA 3J81O 2EQIA 2LQKA 3ATVA 5EVZA 4I98B 3UDCA 2G8IA 3DAWA 4X66K 2RC4A 4F7UA 3E3VA 4E7ZA 1WQ2A 1J54A 3UKGA 3LPTA 4J9IA 1U84A 5LFAA 5K1YA 3FBNB 1MD0A 3BJ6A 2L5QA 3VRZA 1RR8C 2VBYA 5AQHA 1WJRA 1TUGB 1TSFA 3CD6N 4LF8K 5HL7L 3VYUB 2X6SA 1J53A 4RW7A 2PX9A 2WUSA 4A3KJ 3CC7T 3P8BB 4LK1F 4CJTA 4JYAK 2DFEA 3S2WA 4UUSA 5LEKA 1OCTC 1MBGA 4EJUA 3VYSB 3H3UA 1HW1A 1K78A 1S6QA 5HRNA 3DLMA 2GM4A 4WCGA 1O3RA 1DUXC 5LJ5h 1NZ9A 1IN4A 1U5SA 1R23A 3UT1A 3VGMA 1QVGA 4OVAA 4YOTA 2L89A 2K5FA 4XTVA 1WQWA 2ZSIB 4ZYGA 2DTZA 3E19A 2L54A 3WQTA 3QQAA 3KLFA 1OMIA 2F96A 3QETA 2LCCA 3NF8A 2X6WA 1A36A 4O44A 1VFCA 1K73C 2K3FA 2K9LA 1TBXA 1W4MA 3VEOA 1KC8R 5CPRB 1GCQC 1YHQN 3SD4A 4FM1A 4DFPA 1Q81U 4IL6C 3JRIA 2FL7A 1LJ9A 4YFXF 3PNTA 1EETA 4LFBK 1W5CC 1CQTA 2MLKA 4KA4A 1U0JA 4MNUA 2Q31A 5J2PA 1TAQA 2ZJQL 2I8DA 1JKOC 1YQMA 4CJQA 3THXB 3GBTA 1A5XA 4JLIA 4AHCA 3ZSYA 3K4KA 1ORPA 2OZUA 1FW6A 1H0MA 3CCMT 1NTCA 4H0YB 2GOXB 2R7UA 2OTLQ 1N78A 2JS0A 1BYMA 4ATOA 3SUPA 2FMLA 3K2ZA 2BE9B 4KHUA 2DBKA 1Z7UA 4XL9A 4LN2A 1JL1A 3PSFA 5ILUA 4YG2F 4IVNA 4BE1A 2W41A 3K9KA 3NFAA 1U4BA 1UOCA 2YPRA 4KRTA 5IHIA 3TSPA 4LD0A 2EZIA 3ZSXA 2RN2A 5AQUA 4PJOB 1OCCH 1NEGA 1OQYA 2DPUA 3A5ZB 3C7NA 5IH2A 3CMEA 5E41A 2VWJA 4DSFA 2XHBA 1X1DA 1BB9A 1VQ9Q 4CEEA 4C5EA 2JWTA 2R7WA 4HHTA 2E36A 3C6HA 1NPPA 2CW8A 3CCUA 3H3OB 3G71T 1ZBIA 1GVDA 3QU6A 2ID6A 4B8XA 2LQWA 3HG9A 4O0IA 1XSXA 4HCKA 4NYNA 3OIOA 1VQ6N 4OMZA 4B9WA 3TO6A 4JKHA 3THVA 5H6RA 3MEXA 4MHGA 1B9NA 4BC5A 3CC4T 2HDCA 1KQJA 5BQTA 1R22A 2NS8A 3PSIA 3LDLA 3FZKA 1Z7LA 1P4XA 3I56A 1TKDA 1RETA 3EKSA 3AO3A 4KI4A 1ETQA 2GXBA 3RMSA 3NMUA 2K7AA 3I55A 3S6WA 2IIMA 4IJNA 2XKOA 3OS5A 1YITT 5KGXA 1EWQA 1NK5A 1U9OA 3UKRB 4B1UB 3AGKA 1U5TB 2M87A 1ZGAA 3L2RA 1IDZA 3MEUA 4CERA 4X62K 1HNWK 1JXBA 3SJHA 1S6LA 3VF6A 2DL8A 1X1AA 2D1XA 3JYTA 3PIPA 1EV7A 3QRFF 1N8RU 3U1KA 4GBQA 3LSIA 1B8IA 3OY9A 2YJEA 1T08B 4KBOA 3EN9A 4KH0B 1TK0A 3HOVJ 2EFQA 2GELA 2W85A 3DBLB 4X9DA 4GY5A 2R5ZB 4M6YA 1AWOA 2P9SB 5SWMA 4ZTFA 4A2AA 5BOXA 1SANA 1D8YA 3EG0A 4B1RA 1NMDA 2EFPA 3M54A 3VENA 1ACMB 2DMOA 3KD5E 1KG2A 3Q0VA 3KYDB 1I8FA 2FBVA 1EP4A 3NPFA 3QLHA 3JTHA 2QA4N 2DT6A 4DV5K 4PCQA 1WBBA 3DEEA 2RJFA 4DTJA 4BRCA 4KHYA 3HSCA 4RTYA 3GX4X 1S7AA 1ZG3A 2RREA 1Q9YA 4L8RB 1QZEA 4MQ9F 5H2FC 4DU3A 1Q86R 1U5TA 1QVFM 2DXUA 1BQMA 4QCLA 4B3AA 4LIUA 2IW5A 4CE9A 5E79C 2G3RA 3WEEA 3TBIA 2KL4A 4B1ZA 4XU1A 5F0FA 2DMNA 1NG6A 1MA9B 3PO3J 3T8TA 2V4JC 4X0GA 1WJAA 3FXOA 4FK2A 2X74A 2F6CA 2FO0A 2CS7A 2PVOB 4FOIA 4NC6A 5F1XA 2YSQA 4BVOA 5FD5A 4YOUA 3NF6A 2HNHA 3GF2A 2GFAA 5FU6C 3LWLA 4IURA 3KLIA 1X1CA 1OH6A 2O4GA 4CEBA 5ADXA 2A1SA 2LTPA 3ZCOA 2K3XA 4BY6B 3CMMA 2IS3A 3ZMDA 3D6RA 3I0RA 5AZIA 1EBMA 3ATUA 1PC0A 3D5SC 2O9SA 2V6CA 1A6QA 1HXDA 2HSEB 4N9HA 4D0PA 1MW7A 2LCSA 1FSEA 4YDUC 1NPRA 3LAPA 1D5VA 2RN7A 4FT2A 5A0LA 4DHYA 1LB2A 2KROA 3Q0WA 1YITQ 1X9SA 1U2VA 1KLMA 4HW0A 2GX9A 2F5FA 1XQOA 1I81A 2LNHB 4M75E 3E6CC 3V81A 5JLXA 1ZUKA 2A3ZA 3LSRA 4PJJA 4KTWA 2NUPB 3GTGJ 4JQFA 2CH5A 2K3BA 3CCSI 5FWCA 2G8UA 2A3LA 2EB7A 4A3FJ 4NXNK 3SFZA 1ZYRF 1YHQA 3AA5X 1BU1A 3ZT4A 1WBDA 1SF9A 4A5NA 4EMKC 3BY7A 4IHSA 2MW8A 3ZQFA 1RT1A 4MZPA 1TVRA 3N5NX 2P0PA 2KKZA 4F7UF 4R79A 3P8DA 3ZL7C 3KTUA 4RG8A 4ZGJB 1FY7A 4EQQA 1KEAA 5FLXK 3S32A 1OR7A 1BI3A 1DGWY 2W4SA 1I1JA 2AP1A 4WF2A 2BVLA 2EQRA 1SVMA 1S22A 4CK3A 1LEBA 1U3EM 1SL2A 1NJWA 6AT1B 1VQLN 3W2AA 1KU7A 1UE9A 4AI4A 3JCMb 2IGIA 2O9LA 5HRPA 1V1CA 5DCMB 1Y56A 2O4XB 2O9VA 2KHMA 2Q0RA 3MN7A 3QYHB 3GTKJ 1U1TA 3QO3A 1NLPC 3AT1B 4FX0A 2RHYA 3H3NO 1S9HA 4QS9A 1VSMA 4E7SA 2ZSHB 4FISA 2QEXI 5J1UA 1XGMA 4RWTA 3BLYA 4IXCA 3ERMA 2P5KA 1M1KR 1Z9ZA 4AHVA 1IG7A 4LUEA 1HYVA 2J5PA 2NVYJ 3CMEN 2JRMA 3TI0A 3HXMA 4F91B 4M72A 3O9SA 3QESA 5DLOA 1UEBA 2MAMA 2CSOA 3GE1A 2ROTA 3CJQB 2DZCA 3ZQHA 4HSTA 4CF2A 4DIQA 4G7ZF 2EZKA 4HKEA 5M1FA 3CW7A 4DCHA 3AVAA 3OQ5A 1TWBA 1AD5A 1KU9A 1HNIA 2EVRA 4CGGA 1NJIU 1XG7A 1R6RA 1RT5A 2K9NA 5E3OA 2M9HA 3R6NA 2DMUA 2K4YA 3AY9A 2VQEK 2M4GA 2H1LA 3I56N 3MMVA 2KQWA 3TU4K 4CZCA 1G59A 2ZGYA 1ETYA 1YJNT 1JLCA 2Z3YA 2CH6A 3AVKA 3K70D 2X1EA 5IXBA 1VK0A 1NKUA 4EA5A 3CM6A 4LG0A 4M7YA 4J9BA 4BJ5C 1RAAB 3SV4A 4O8KA 3QWLA 1WHKA 4BGDA 3HZ6A 1FTZA 1BM9A 1T0JA 1U8BA 2COMA 1S9EA 3D5LA 2E88A 3M7GA 3UKUB 4KGVB 2R5MA 2EKHA 1FEXA 1IGQA 4IZZA 1JJ2A 2IVMA 4ESFA 1VQOA 1EH6A 5CKHA 3COAC 1YT3A 3WGIA 1YO5C 2NAZA 3PIOA 4U0WA 5CQYA 3C7JA 2HF3A 1B9FA 1IZ6A 5LGNA 5SZTA 1MNMC 3EG1A 3DCFA 2V7FA 1OISA 3OYIA 4LLNA 4N4HA 1O75A 1JE8A 3F6OA 4CSWA 3FK7A 3HGYA 3G25A 2F9WA 1NMNA 3I64A 1I5LA 2YHAA 3VS6A 1XC3A 4MFBA 4PL7A 1GBQA 3VSLA 4M7DA 4HSBA 5D6WA 4IRIA 5KK1A 2JK3A 4RB0A 1HKSA 1RZ4A 2P4RA 1HW5A 4C92G 2K57A 3BPVA 1BHLA 3E0JB 2RNGA 2VLAA 1H92A 2QUFA 4DQ2A 2P7VB 1VQNQ 3C2GA 1C0GA 3TWHA 3IP4B 4CCKA 2OAZA 3WGHA 3PGGA 4YOXA 5H1SQ 5CVVA 4B47A 3JS6A 1X1PA 2H1KA 3DMJA 2CP7A 5D5WB 1XUPO 1JEGA 4FM4B 5F1JA 1EX4A 1HJOA 4BGBA 5KYUA 3EFOA 5AQZA 2MYSA 2LKPA 2A5XA 1YS7A 1S72A 2OTLA 5JLFA 3VOEA 5I2MA 1ITGA 1GBRA 1LFPA 1RCHA 4DV3K 3UATA 2W40A 1AKHB 4I9QA 2UUAK 1JCEA 1MUDA 2XROA 3DKYA 1TG0A 3CDLA 1HD3A 4GKJK 4ELYC 1TW2A 3F8FA 1LKXA 3K0LA 2K9MA 5DCFA 4B3XA 3WE2A 3BDLA 2CUJA 1T2KA 4P9FA 3N97A 4IQJA 3CCQN 4H8KA 5KYXA 3KZZA 2CG4A 2GF7A 3EHQA 3PVLA 4KNYA 3PQJA 3ZSZA 2DTOA 3NARA 1OU9A 3G4SA 5KH6A 4J2AA 3D7SB 5CQXA 1K8AC 3OYAA 2IAIA 3AGRA 3ZN0A 3FIWA 4AVZA 5AQNA 1KO9A 4IUPA 4Y91A 1LAWA 3LQQA 1NG7A 3SMSA 1N8RO 2M16A 4CEFA 2Q0UA 1G3TA 3OW2P 5AQKA 3WXJA 3OR1C 1FOYA 1REVA 3FXRA 3LDPA 4P5NA 4RMOA 2KY9A 4A4KA 4AIDA 2V8JA 4J9GA 3A0HC 2KMTA 3H41A 1GLCG 2HU9A 2VYPA 3TAEA 1BOBA 4A6EA 5DS9A 2HVSA 1X9MA 2GNCA 4DMNA 4BG8A 2FPDA 5FLXZ 2XHIA 5FPEA 1JXMA 2HQHA 2FX0A 2RKIA 1IB8A 4XN0A 5DDGA 3UA7A 4IXAA 3V1OA 2KMUA 3EG2A 4KULA 3O9TA 3VPRA 2RB6A 1BOAA 3RESA 4DEYA 2QEXQ 4AI5A 1HSQA 2AIRB 2HVIA 1WSHA 4PFZA 2QWLA 3UNGC 4FM0A 1UCRA 3JB9J