4ZTJA

Crystal structure of the prototype foamy virus intasome with a 2-pyridinone aminal inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/inhibitor
molecule keywords PFV INTEGRASE
publication title Discovery of 2-Pyridinone Aminals: A Prodrug Strategy to Advance a Second Generation of HIV-1 Integrase Strand Transfer Inhibitors.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 103
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ztjA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ztjA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ztjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ztjA03
3IAYA 2NLUA 3NF8A 2RJFA 3M8SA 3Q1JA 4IDKA 1RT5A 3DOKA 1IH7A 2RI3A 3L2QA 1DLOA 2KZMA 4BACA 2GBZA 2O4GA 4FK2A 3U3GA 4DTJA 3DLHA 1IKXA 3FFIA 4O55A 1OZ3A 4PY5A 4PLIA 1C1BA 4CF1A 1NKBA 1GOCA 4EP4A 3O3FA 4A4HA 4RW9A 3PMIA 3MECA 1FXXA 1RT1A 3M9QA 1TAUA 4I7FA 3KLFA 5FDLA 4Z0UA 4ELTA 5FRNA 1RBUA 3QESA 1RDAA 3AO2A 5C24A 1KVCA 4B9NA 4PQUA 2G8FA 4FW2A 3SQ0A 3NTIA 3SPYA 5T7BA 3UWNA 3AA5X 3ZSXA 4Z4EA 4W5QA 2G8IA 4DTMA 1BHLA 3QJ6A 1IKVA 2Q3SA 2VG7A 4B08A 3LP2A 3PUFA 3KKRA 1EETA 2KZZA 2RHZA 1VSFA 5EU7A 1RTIA 3KIOA 3AVBA 4KHWA 4PLLA 3SQ4A 1TGOA 2QKBA 3MEAA 3NH0A 4KI4A 3P5JA 3MEUA 1NK4A 3NTHA 2XO7A 4Z02A 2G3RA 1RBTA 1NJWA 3LWMA 1N5YA 4CHOA 3AVNA 1X9MA 5KGXA 4PA1A 4J2AA 3NGIA 1JL2A 3ZSOA 1T8EA 2LTOA 3FDRA 2Z1GA 1D5AA 4N47A 3E9GA 2YKMA 2HNZA 4HTUA 4FK4A 5IAYA 1JLBA 4M3XA 1BISA 1FKPA 1T7PA 2YNFA 1LV5A 1RCHA 4C5EA 1S9GA 4M3UA 4E7LA 2A1SA 3SJJA 2Y1JA 4B3OA 2R7YA 4CGIA 4OLAA 2M16A 4B9MA 3SNNA 1H3ZA 4IFYA 4CGDA 1EKEA 4KRFA 1L3VA 3QEIA 3SUOA 1L5UA 3QIOA 1VSDA 2FBVA 2FHDA 1QSSA 4N4HA 3RRHA 1HYVA 4N4IA 3SZ2A 1BCMA 1NKCA 4DFKA 2RJDA 1RNHA 5E41A 1QQCA 1YTUA 3TAMA 5J2QA 1YVUA 5DMRA 4CHZA 3L8BA 4DQRA 4DSIA 4Z4CA 4RW6A 4CEOA 3DB4A 3NCIA 3B6PA 4CF9A 3O8VA 3E01A 3LAKA 4NCGA 1A5XA 3HPGA 2P0KA 3AO1A 1IKWA 3KKSA 4CEFA 3C6UA 1BCOA 3QEXA 2IGIA 2X4XA 1JKHA 4NZGA 2ZQBA 4KB0A 3AO3A 4LD6A 3CFOA 3THVA 3NH1A 2XY7A 3PO5A 4F4KA 1TL1A 4Z4FA 4OGCA 4DG1A 3VQ4A 4OVAA 4K8ZA 3HPOA 4N56A 4CFCA 4B9WA 4FVMA 3ZT3A 3HVRA 3P8HA 1CZBA 4N76A 3LGFA 4DTUA 4FJJA 2XRIA 3E9FA 1KRPA 2BKDN 5KH6A 1LW2A 5CZ1A 2D0AA 2X78A 4EZ6A 2E4LA 2X74A 3QNNA 2HHXA 3JSMA 2OPQA 3AA4A 3QEVA 2QK9A 1ZBHA 3G10A 3AVLA 1G15A 4CJFA 4RW7A 4UQGA 2G8UA 1RT7A 3NGZA 3IRXA 2LVMA 1BGXT 1MU2A 1LAWA 3RMCA 4J2EA 3V6DA 3MEWA 1T05A 3EZ5A 4FLXA 2OZSA 2RN2A 3PY8A 4QQGA 1NJZA 3V1RA 3CEYA 3ASKA 3OYCA 3WNGA 2HHWA 4E0DA 1UA0A 5KRTA 4M3TA 4IUUA 3LGLA 2WACA 2YNIA 1KLNA 4BDZA 2PZSA 2ETJA 2IG0A 1WJSA 1JLEA 2DY4A 3S3MA 3LLRA 4CGJA 3MP6A 1WSFA 4FK0A 3SI6A 1RTJA 5C6SA 1VSLA 1X1PA 4FJ5A 3OJSA 5CIUA 3KLGA 3QETA 1U04A 4CF0A 5KE2A 1RT2A 3OYIA 4DWIA 5SWMA 4OVLA 4CHQA 3MXJA 1QTMA 3DLBA 2X6SA 1JLGA 1F21A 1L3TA 4CGFA 4CJ5A 2L8DA 1WSJA 1Q9XA 2Y1IA 4KTWA 4K8XA 4DQQA 4QAGA 3ZSVA 5KE3A 2G8HA 2YNGA 4CFBA 1A5VA 3I0SA 3K5NA 3C4SA 2F8TA 1TVRA 2B5JA 2E5QA 1CXUA 1N6QA 3VQ7A 5JS2A 2G8WA 2X6NA 4ICLA 4M3YA 3MO8A 1S9EA 4OLBA 1RDDA 1REVA 2G8VA 3HM9A 4F2SA 4CK2A 1TK8A 4CEAA 3HXMA 3D0PA 1U45A 3DLGA 3VQQA 3VQDA 3LX7A 4YNQA 2OPPA 4CK3A 4CFDA 3NTKA 3S3OA 1WNSA 1XI1A 4B9VA 4CEEA 3KUFA 2IAJA 1XNIA 4NYNA 3VQ8A 4J2BA 2R5MA 4PL6A 4ELUA 3FC3A 1ZBIA 4L8RB 3QLHA 2ATQA 2HHQA 4LY7A 3KLHA 1LWFA 4A4GA 4DTXA 4N41A 1DTTA 3QEWA 2D9TA 1TL3A 3KD5E 4E3SA 4CJPA 1TAQA 4FCYA 1R0AA 1ASWA 3ZT0A 1W0HA 3F9KA 4C8KA 4ZTJA 4KB1A 1NK5A 4KFBA 4JRPA 4IUTA 3AO5A 2PYLA 2D0CA 1QSLA 2GUIA 4I2QA 5JS1A 4CJSA 4OGEA 5D6WA 2VWKA 4CJVA 3OYFA 2EQJA 1EX4A 2EQUA 4FW1A 3PX4A 5J39A 1UWBA 5M9OA 1WN7A 2M1HA 2DFFA 4LH4A 1VSEA 4XIUA 4N4GA 4CJRA 2XY8A 3LAMA 3AV9A 2YV0X 1TKXA 5KRSA 2CKKA 3NAEA 3BDPA 2B6AA 3FLGA 3OMGA 4CJQA 1ZYQA 4BE0A 1UA1A 3ZT1A 3UIQA 2IS3A 3QNOA 4IUPA 4M3ZA 4C8MA 4TSXA 3V4IA 4DTPA 5HRNA 3SPZA 3OS2A 4KKOA 2G8KA 1CXQA 4NS5A 1TK5A 4CESA 3NBPA 4BWJA 3EAEA 4B8CA 1SSFA 1LWEA 4AHVA 1VRUA 5CZ2A 4ZHRA 4FZYA 4FLWA 4FJXA 3FEOA 3NFAA 4DU1A 2JTFA 1WJRA 3TI0A 3S3NA 4R5PA 1IG9A 2Z1HA 5CYMA 1B9DA 2E6LA 3AVFA 3KK2A 4FJLA 4A4EA 4BD3A 3PX0A 2QKKA 2VYTA 4GW6A 1U48A 4CEBA 3OY9A 2B8AA 4CEZA 3P83D 4B9UA 3S6WA 3RMAA 3OYJA 4RW4A 3U6FA 4Z4IA 1IKYA 4JS4A 2DIQA 1ZBFA 2YNHA 4AILC 1S1UA 3SUPA 1B92A 4E1MA 3ZSZA 2A1RA 2I5JA 2EFIA 4FJ9A 3K2PA 2OYQA 1VSMA 1NK8A 4Z4HA 1WSHA 4FZXC 3ASMA 1J53A 4BDPA 4RG8A 4IBNA 1NKEA 3OS0A 5C0MA 3RWUA 5C25A 4KV8A 4DTSA 1NK0A 1SUQA 3PNWC 4LSNA 1S6PA 3NGYA 4BDYA 3D45A 3T1AA 3RMDA 1C1AA 2L3RA 3SQ1A 4A4FA 2O4XA 3ZSRA 3HPHA 3DRPA 2RHIA 4CF8A 1SL1A 2RI2A 1KVBA 3OB9A 4IFVA 4BE1A 3TAEA 1SL2A 3NNQA 1HYZA 3ULDA 4OJRA 1S6QA 4FM2A 4L59A 3HYFA 2DIGA 1VSKA 3OA6A 1VSIA 3VQ9A 3OMCA 1HQUA 1C6VA 3H8ZA 1N27A 2EHGA 4F2RA 3DB3A 3F70A 3HK2A 3LP3A 3LP0A 3B6OA 4JRQA 3KLIA 4M41A 4N5SA 2F5KA 3RMBA 4C8OA 4I9LA 2QXFA 4B9LA 5J2MA 1WSGA 3L2VA 4HUGA 2XY5A 1JXEA 2FBTA 2PY5A 3DM2A 3ISNC 1HYSA 3V9ZA 3V1OA 1WAJA 1Q8IA 1D9FA 3V81A 5J2NA 1Z25A 3CQ8A 4OKJA 1Z26A 3ITHA 3HP6A 5C42A 1WLJA 1ASUA 3H6ZA 3AA3A 1C0MA 3ZT4A 2ZE2A 4IURA 4DQPA 4DFJA 3BDLA 3V1QA 2LRQA 1JL1A 3C94A 1BIZA 4W5OA 4DSEA 1DTQA 2JLEA 3AVMA 1RI0A 4QQDA 4HUEA 1JLCA 4MQ3A 2HQEA 2YKNA 3LZIA 1RDBA 4LD0A 3ZSYA 1UOCA 1ASVA 3CG7A 2RKIA 1VSJA 4FJKA 4ELVA 4IG3A 3ZT2A 1FKOA 2MWOA 3LDSA 1NOZA 3VA3A 3OQ5A 4CF2A 2HVIA 1T03A 1LWCA 1B9FA 2IDOA 1HNIA 4O5BA 3O4NA 2RHUA 1WSIA 4DTRA 4YFUA 2GF7A 3OJUA 3V9SA 3KJVA 1WAFA 4B9SA 2O4IA 1XHXA 2X4YA 3K57A 4FM1A 2MWPA 3TAPA 4Q5VA 4CRIA 1NK6A 3MEEA 3V9WA 3U3YA 2XK0A 3DLMA 1C1CA 4OKKA 4OPKA 4FJ7A 3CFPA 3SYZA 4CJ4A 1RILA 4I9QA 4IKFA 4O44A 4I2PA 3CFRA 4BE2A 4CHPA 3AO4A 3HVTA 4FJIA 2RHYA 3OYDA 1SKSA 3LWLA 3LZJA 1X9SA 2YRVA 2P5GA 3LPUA 3MXIA 2DTUA 5D6XA 2JGUA 2JZ2A 1S1VA 4MFBA 4IG0A 4FJGA 2WONA 1U49A 5HBMA 2BDPA 4HCBA 1BIUA 3G0ZA 4GMJB 3I0RA 4JS5A 3TARA 4Q5WA 2OA8A 3OYKA 5J1EA 3TAFA 4EDUA 1SKRA 2HNYA 4C8LA 3HSTB 1GOAA 2LSNA 3DOLA 3NF9A 3RR8A 3CYMA 1LW0A 3ZCMA 2BANA 4DS5A 4FJNA 3QO9A 1JLQA 1RT3A 4CEQA 4CERA 3AA2A 2QQSA 4CJ3A 4DF4A 1KCFA 2LCCA 1OYXA 3O3HA 1W9HA 1KTQA 5CYQA 1BI4B 2BIVA 4CJEA 3PV8A 3QINA 2HHTA 3HT3A 4E7HA 1OZ2A 1RBSA 3VN5A 4C8NA 4DLGA 4ID1A 3BGRA 1YT3A 5HLFA 2Z1IA 4H8KA 3LANA 3L3UA 2KFNA 4QOZB 4KO0A 2X35A 2X4WA 2R58A 3SV4A 4Y1CA 2M0OA 4GVMA 4KI6A 4C5GA 3MP1A 1TK0A 3MEVA 3PX6A 1K6YA 1XHZA 4F8RA 4ID5A 4KTQA 4G1QA 1TKTA 4CK1A 4FLVA 5KGWA 2LDMA 2KQ2A 4E1NA 2HMIA 2BGGA 4ZTFA 4CCHA 3A2FA 5KTQA 4HUFA 3M8PA 4DU3A 1TKZA 1G5VA 2RJEA 4W5RA 1HQEA 1KLMA 4NYFA 3QKJA 1WGSA 4E89A 4QQ6A 3SV3A 3WNEA 4AH9A 4CE9A 2RPIA 5FROA 1J54A 4DFPA 3VQCA 3HJFA 4DMNA 1A5WA 4C5IA 1VK0A 3VQ6A 3RR7A 3CM6A 4KHYA 4M3WA 3DLRA 2HHVA 4AHCA 4FL6A 3VQPA 5K14A 3P1GA 3K5MA 4UC4A 4DQIA 4CJUA 1ITGA 2VG5A 3SQ2A 3C6TA 1D8YA 3M8QA 5J26A 3QIPA 1JLAA 3VQAA 4DSFA 1NJXA 4CIFA 1BQNA 1SV5A 1S1TA 2WOMA 3AVAA 4CJLA 4DTOA 4E7IA 2HHSA 1U47A 3VQBA 3DYAA 5CY4A 2XY6A 5I42A 2K3XA 4DQSA 1NK7A 3OYHA 3T19A 1HMVA 4B9XA 2RJCA 4CJTA 2EQKA 2YHAA 2R57A 2K3YA 2XDPA 4CFAA 2HNDA 3EYZA 4B9TA 4CJKA 1CZ9A 3VQ5A 3L2WA 3IG1A 3AVJA 3DMJA 3QIIA 3MAQA 3K59A 2OPSA 4CGHA 4Y1DA 3DLEA 4DSJA 2L89A 2RI5A 1WSEA 3F73A 3L42A 1RBVA 4KHQA 2EX3A 2GV9A 4FU6A 3V9XA 4DTNA 2VWJA 3GOXA 2IC3A 2R5AA 2NUBA 3NDKA 2DFHA 4AHUA 4Z4GA 2E6MA 3S9HA 3H08A 3K5LA 3K5OA 1C0TA 2XHBA 2FBYA 2HQXA 1S5JA 2RO0A 2PQWA 1JLFA 4M45A 3DLKA 1IO2A 1KHCA 4H4MA 1RDCA 3OYBA 4E7KA 3DRSA 1Q9YA 1HPZA 3AVKA 3LP1A 4M3RA 4AHSA 4NCAA 3HP9A 1SKWA 3KTQA 2E6NA 1J9AA 2P1JA 4FLUA 4EP5A 4FZZA 1VRTA 3MXMA 3AVGA 3ME9A 5DK5A 1J5OA 1BQMA 3UT1A 3O4QA 4KTZA 2QQRA 1CLQA 3OYEA 1RT6A 5HRSA 3I8DA 1S1WA 1D9DA 1L3SA 5KI6A 3KK1A 1JXBA 2P51A 2OZMA 2GFUA 4F3TA 1FK9A 4RW8A 3ZSWA 3JYTA 3ZSQA 4FLYA 1MHNA 3PMTA 2AJQA 1KFSA 3NHGA 1VSHA 2FC0A 3VQEA 3LALA 2RHXA 2OPRA 1EP4A 4M42A 1QE1A 1BI4A 3IS9A 2FBXA 3MEDA 4FXDA 1QS4A 1XWLA 1O1WA 1OI1A 1I3AA 5HRRA 1SL0A 4X34A 4DU4A 1Y97A 5KCHA 3AVCA 1RTDA 4QCLA 3KD1E 3AVHA 1ZBUA 4DSKA 2B4JA 4W5TA 3T3FA 2P5OA 4W5NA 3META 2GFAA 4CIGA 3LYIA 3TAQA 2HW3A 3P8DA 4II1A 1S1XA 1KVAA 2Z1JA 5HROA 1QHTA 4CIEA 4HCZA 4KPYA 2DFEA 5IN1A 4LSLA 2KFZA 4CHYA 4PWDA 4CEDA 4NCBA 2KTQA 1XC9A 3MP8A 3DI6A 3SCXA 1ZBLA 4IUVA 2HB5A 3EY1A 4HVJA 3OVNA 4FLTA 3MEGA 1KFDA 4DLEA 1HRHA 1TV6A 4FJHA 1X9WA 1L3UA 2EQMA 1YTAA 3SUNA 3WNFA 1EXQA 4KREA 1WJQA 3AVIA 2F8SA 4KAZA 3OYGA 3KLEA 3NF7A 1NK9A 1KSPA 4QVZA 3L3VA 1TKDA 4FJ8A 2HHUA 3HL8A 2PYJA 4EZ9A 1U4BA 2KW4A 2HVHA 2O4XB 3VA0A 4C5HA 2ITGA 3QEPA 3V9UA 4KHNA 4IUQA 3DRRA 4E7JA 1NJYA 1UAXA 1NOYA 5J2PA 4FYDA 3CM5A 3TANA 4WE1A 2D0BA 4QW2A 4E19A 4RG2A 5D6YA 1I39A 3L2UA 3OYLA 4CHNA 4DFMA 1RBRA 4Q0BA 4KHUA 3PFSA 2ZD1A 5D3GA 1LAVA 4H4OA 3RTVA 4PUOA 3M8RA 4DF8A 3ZEHA 4O4GA 3HO1A 3QERA 3TWHA 3NH2A 3OYNA 4LH5A 4J2DA 4FM0A 5SZTA 3QBYA 4B8AB 2DAQA 2W42A 3K58A 4FJMA 1C0UA 3KK3A 5FRMA 3NE6A 4FLZA 2RF2A 1BL3A 4CJWA 5HRPA 1HJRA 5I3UA 4DS4A 3OS1A 3OYAA 3SUQA 3LPTA 3LH0A 2BUDA 2EKOA 3NF6A 4OKEA 4CECA 5HP1A 2IOCA 2BE2A 3ALYA 1QSYA 3L2RA 1GOBA 4AHRA 3WNHA 4OPJA 1RT4A 4DSLA 2VG6A 4HCCA 1HNVA 5KCOA 2YHBA 3TR8A 3TAGA 1RTHA 4AHTA 3RRGA 3TABA 4O0IA 3C95A 4O0JA 2D5RA 4JLHA 3O3GA 4CGGA 4BWMA 3PO4A 3OYMA 4F3OA 4KHSA 4HHTA 2F96A 3SD4A 4GY5A
chains in the Genus database with same CATH superfamily
4FX0A 3IAYA 3BY6A 3Q5FA 2NLUA 2LY1A 2CH4W 2HD0A 4IDKA 3L4QA 1K1ZA 5AQJA 1IBKK 1NG6A 3DOKA 4EMKA 4D6WA 1QVFA 1DLOA 4I0AA 1U2VB 3ZETA 4BACA 2DN0A 3KTUA 1UB9A 3TSZA 3U3GA 1LFPA 1IKXA 2DEQA 2FL7A 3JCMQ 1OJLA 2DOEA 2LJ0A 1FZPB 4O55A 2XGEA 2Y9ZA 1C0GA 3CPWS 2P9PA 3GTMJ 4WCGA 1IRFA 1ZBXA 1NKBA 4QVCA 3O3FA 2RDPA 4A61A 4PFZA 2OD5A 5HDNA 3MECA 3REBB 4C0FA 4BQAA 3M9QA 2AK5A 1TAUA 4ZDOA 3KLFA 4GV3A 1YOVB 4IEIA 4C2UA 3VS2A 3G6ET 1RDAA 3AO2A 5C24A 1KVCA 4FASD 3GTGJ 2VUMJ 4B9NA 2BZYA 2G8FA 4FW2A 4Q4ZF 1T3VA 3MKDA 1D3BB 2IA2A 3D7SB 2EWSA 5BQTA 2CGHA 4JKHA 3JCMh 4Z4EA 1ETQA 4XLFA 3EETA 2CSQA 3ZQIA 1IKVA 2KYMA 1XMQK 3ATUA 4BVOA 1VQ6N 3IWZA 1BR4A 1MBJA 5CVUA 3N4PA 2O0YA 3IH4A 5FU7B 5A2QZ 3PUFA 1S1NA 4HVWA 1IXRC 4BHCA 2KZZA 1N8RU 3O4WA 3D2EA 5J3LA 5EU7A 2GWJA 3VS3A 1IXDA 3R6SA 4HNVA 1YJNQ 2QKBA 3PNVA 4DUZK 4LF8K 4KI4A 1X19A 4IEJA 3P5JA 3NTHA 1U6GA 2XO7A 3ZN0A 3A2KA 3VF6A 1ZQ1A 3CQZJ 1KQJA 5KGXA 1QKXA 4PA1A 2MA3A 1RFQA 4V2FA 3I56A 2DTIA 1NZ9A 3QDRB 1OU9A 1XB4A 2RK1A 5M5WJ 1MBKA 3E9GA 2BY0A 2DD5A 4BC5A 4HTUA 5J1RA 2E41A 1SMTA 1X3ZB 5IAYA 1OVYA 1BISA 2HEOA 2YNFA 5GP9A 2O01E 2ZCWA 3NRVA 1LE8B 2WBNA 1RCHA 5AQRA 5FO5A 2A68F 4E47A 4JK8A 3M4GA 4NL3A 4EJOA 4L5GA 1QVFM 1VQON 3SJJA 5CR2A 5GAOm 2E5LK 2NUZA 3PQKA 1AWXA 1FW6A 1HKQA 1BB9A 5FPEA 4OLAA 1LFBA 4D9JA 2M16A 1JO8A 4C8QC 3QEIA 2A36A 3SUOA 2WTEA 2OTJN 3FR0A 1G3WA 3CMAA 3QIOA 3SHFA 2JMWA 1VSDA 2FSNA 5ICFA 4ORZA 1QSSA 1WPKA 4N4HA 1UG2A 4TV7A 2DRMA 1HYVA 4C0ZA 1IRGA 5GAOl 4JX5A 2W6KA 1GHCA 1WEGA 4R0KA 1Z9ZA 3BR0A 2LCLA 3RPQA 3JB9H 1RNHA 5FLXO 4BJ6C 2IXSA 1QQCA 4EGZA 3NVKA 5DM7F 4M78G 2JVVA 2FZKB 3HSEA 1YVUA 5GAN7 3REAB 1BA5A 3OA9A 2R7UA 4CHZA 3JRZA 3JSPA 1BUPA 5AQIA 4DQRA 3DKXA 2XGCA 4ZN3A 2MC3A 3NCIA 2NNWA 2E36A 1K9MU 1LNWA 1XX5A 2KT0A 2HDCA 4CF9A 4P9FA 2DXUA 4DYQA 3E01A 3EFOA 4Z89A 4B1UB 3J7ZI 3VYHB 5ED4A 2ESWA 1A5XA 3HPGA 3M1EA 4IOCL 5B5EC 2P0KA 4A63B 2EZIA 1IKWA 5A0LA 4GKJK 3KKSA 4CEFA 1BCOA 2GUPA 2DTZA 3QEXA 2IGIA 2FPDA 1IW7F 2B63J 5DY9A 3RPUA 2JPBA 3S14J 2NRRA 4OGCA 3L2CA 1NM1A 1T98A 2Y30A 2D1VA 4XTXA 2KNBB 1I8FA 1JCFA 3FJ5A 5DD4A 3FFKB 2EFOA 2RQVA 5EG2A 4EHUA 4B9QA 1BJZA 4B9WA 3CPWA 2EKHA 1IF1A 3ZT3A 4AFZC 2OTLA 3O08A 3M53A 3VF4A 3E1SA 3KX2A 1TWCJ 2XKOA 3MKZA 4DIQA 2XRIA 1FBSA 2K5CA 3GIBA 1ZKGA 2OJED 4NXMK 1XDUA 1Y96A 4OB1B 4D0PA 4ZH4F 4U7BA 5CZ1A 4RMNA 2D0AA 3WQTA 1W36D 3J81E 3TOBA 2FSJA 4HQEA 1IV6A 3AKZA 3CCEN 1KG4A 3JSMA 2QDYB 5LJ5h 2YS9A 3DV8A 3DXKA 1W4MA 2HOAA 2QK9A 2X85A 4IHSA 4BR2A 4PJMA 4CJFA 4DV7K 4H0YB 4DZJA 1R8OB 4PKHA 5KN9A 1X3MA 3IRXA 3PJRA 2GELA 5CVVA 1R5HA 3RMCA 1R6RA 2M0YA 4YOUA 1OV3A 3CXCS 4D7MA 2EYZA 3MEWA 5EGOB 2OU2A 1K4US 5KCMA 1KQ8A 2E1HA 4XKBA 1SMYF 3ROUA 1QPIA 1XC3A 2OQGA 1SF9A 4IPAA 3BZ6A 4RB2C 1HKSA 3OYCA 4XTUA 3WNGA 5E3NA 5TGTA 1YJNT 3CC2Q 2KZVA 4JBAA 1UHMA 3DPLC 4M78B 2HYGD 2DE0X 2LY9A 3V42A 4D7NA 4A6DA 1KG6A 1HSTA 1XQOA 4O6JA 2IG0A 3X20B 1PDNC 1TWHJ 3A0HC 4AQYK 3HKSA 3MP6A 4CGJA 1E3PA 2EIMH 4FK0A 2XPVA 2QWWA 1X1BA 1Z6TA 1HYOA 1RR8C 3BW1A 4MO7A 1RRQA 2NOHA 1YQAA 4XTVA 2LNHB 4GLMA 4NLBA 1RT2A 3N5NX 3OYIA 2CQQA 4M7AG 3JCUC 1IV0A 1BW5A 2K4BA 4BL0B 5L3CA 1U84A 1UUEA 3Q7BA 1E2XA 4CZEA 3EYYA 1Q9XA 5KPZA 2Y1IA 1T3SA 3GWZA 1SFEA 2PVDB 3CPWM 3ZSVA 1K61A 3CI5A 2H6BA 4CFBA 1B1BA 3UKRB 4PJNA 4CJ7A 2DMNA 2NOIA 1TVRA 1SFUA 2E5QA 4XLCA 4CICA 2YG8A 5JS2A 3RTRA 2G8WA 3ZQGA 2X6NA 2TCTA 3ZYYX 3L7WA 1AZGB 1IC8A 3KP5A 4LFBK 4OMOA 4NB4A 3VS5A 1H9GA 1N9RA 3O9RA 3DP7A 4QPQA 2BY2A 2Y75A 5C2FA 4ENMA 4M7DC 2P8TA 5JLXA 2X1EA 2DA5A 1YHQI 3VENA 4M77F 2X1DA 1PUFA 2DODA 2P6SA 4XR6A 2JMAA 4DUYK 4CEEA 3KUFA 2D1KA 1K8AC 2NVXJ 2XD0A 3VQ8A 2DA4A 4BRQA 1R77A 4PL6A 3FC3A 4P5NA 2P9LA 1YQKA 3ENOA 4L8RB 2PVOB 2BBYA 3C2HA 3K6GA 4LY7A 1LOTB 2HVRA 4JKAA 3A5NC 3S1MJ 3KD5E 1TAQA 2DYSH 1R0AA 2VBYA 4CCLA 1WJAA 3P8BB 3ZT0A 2O31A 2P0PA 3SBTA 3HYIA 1G2BA 3AO5A 4A3LJ 2ELJA 4AUXA 5FWCA 2GQVA 3RESA 4OIQF 4CJSA 5IWAK 3FMQA 2VC1A 3ABUA 2VWKA 1YITN 2EQUA 4KJZA 2QM3A 4WXCA 4Z8AA 1WN7A 4C92A 4YOVA 2P9SA 1VSEA 1B9MA 5JVTA 2PBDA 3LAMA 2VIXA 4HSTA 2PQ8A 4EMHA 3AV9A 4RTFD 4JYAK 4BY7J 3EL2A 1MNEA 2YSRA 1YQMA 1SRMA 3GLXA 4M7AB 1BOAA 3UIQA 3ECHA 4F91B 3S2DJ 2ZMEA 1N39A 5HDKA 4IO8A 2A41A 2V51B 5DM6F 2IS3A 2ZJQF 2EJFA 4M78D 4BAYA 1T8IA 4LN2A 2K02A 4TSXA 1I0CA 1KQ9A 2YX6A 5TKWA 2ADUA 2D0PA 4JX6A 3G0QA 3SPZA 3OS2A 4E70A 2KSSA 2XUBA 4GXOA 3K69A 3EAEA 2DMTA 1I07A 4YOXA 2QENA 4VUBA 1FLIA 1LWEA 4MZMA 2XAFA 4AHVA 1K4TA 2LH9A 1MMGA 3N5BB 4FZYA 4FLWA 2EIFA 1SC7A 4JYKA 1TS9A 4FJXA 3FEOA 4DU1A 1WJRA 2Z16A 4R5PA 1IG9A 5EEGA 1XQHA 2XHIA 1UMQA 2E8AA 4GKKK 2XV4S 2E6LA 3V7SA 3TMOA 3CC7N 3KK2A 4BRNA 1YJ9N 4A4EA 1VQ5T 4L6V5 4BY1J 1GCQC 1HW2A 4UNFA 4G7OF 2VYTA 4OFHA 1U48A 3OY9A 1IZ1A 3IKMA 3VPZA 1M90R 3OYJA 1ATSA 1KC8C 3J7AY 3LSGA 2YNHA 1Q86R 2O8FA 5FPDA 3CCUI 3E2UA 1B92A 4J9CA 1UJYA 3ZSZA 3DU6A 5AFUH 3EE9A 1LDKB 1RRJA 3HM5A 1X1CA 3K2PA 4PJOF 3ZFJA 1ZG5A 2IS1A 3SAFA 4UVCA 2VONA 1KJWA 1WSHA 3KLNA 1BR2A 3ASMA 2FPFA 3TO6A 1TP4A 1QGPA 3H3UA 1WB9A 3BG9A 4C1NI 4M72A 1VQ4I 2XPUA 4DJAA 4M3GA 2HGCA 3G71Q 2OV7A 2CUFA 3ZP5A 3SEQA 3HOWJ 4LSNA 4JKCA 3D45A 2VC8A 1YS7A 3H0DA 1DUXC 2A3ZA 4QT7A 2H3JA 1WI3A 2FLOA 3E6MA 1NGDA 2CGJA 3BY5A 2WADA 2XHKA 2QYOA 2VT2A 3ZSRA 3DRPA 4CF8A 5F0XA 1PKSA 3CJNA 1YIJQ 5J6XA 1YQRA 2RI2A 3KBGA 3OB9A 3JCMJ 3IAS2 1B3QA 1CF7B 3OW2P 1HYZA 4RTVA 2OCEA 1JTXA 2KIUA 1JB0E 3HYFA 5ICCA 1WHHA 2DYIA 3VQ9A 2XGXA 1XD7A 5DCMB 2H8RA 3PLAA 4JJNK 3G1MA 3JRDA 3H0GJ 5JVHL 2XGDA 3G6EI 3JTGA 5D5XB 2EFWA 5IOYA 2LR8A 4KIBA 2PUKB 2RMOA 3B6OA 2WY8Q 3KLIA 4M41A 1WYXA 4CO8A 4M7AD 3U2RA 2HAXA 2QM1A 1ZK8A 1AHJB 5KQ8A 5HLIA 5IYCJ 4AIHA 1X2KA 3JCMW 2P7CB 2CUDA 3G1LA 2QXFA 1WSGA 3HOUJ 4HSBA 1GRIA 4FSXA 3PFIA 3V1OA 1X2NA 4EMSA 2VODA 3AGKA 3M6GA 3ULEB 1YN8A 1JKRC 1D9FA 3V81A 1BDGA 1Z25A 2FRYA 1NWKA 1Z26A 4FWMA 1ATNA 3H6ZA 5D5UB 5CCAA 1ZHFA 1C0MA 5LHGA 4UNOA 5FLXZ 2DTHA 2O03A 4IURA 3JV3A 3I33A 4FHTA 3LAJA 3QYBA 1JL1A 2MOXA 1XCBA 1DTQA 1P8ZA 4ZYHA 1RI0A 1UTIA 2O8DB 2HQEA 2YKNA 3LZIA 2JTVA 4ILGB 2F7TA 1UOCA 4A0YA 1FWZA 5GMKe 4IOCF 4UY8O 2K57A 1Z0XA 2VXDA 4E9FA 1RABB 3CG7A 3GBTA 4QS8A 3HFNA 4R1HA 4J8OA 1XNQK 2DT7B 1N8RC 3E9OA 4AM6A 4ELVA 2O8EA 4IG3A 1FKOA 3K7AJ 1U2VA 5FU6B 2ZPFB 2MWOA 3ZQCA 3LDSA 1VUBA 1NOZA 1ZBSA 2BW3B 4CF2A 1T38A 2HVIA 1LWCA 2HDWA 2A5YB 3GBQA 3HTUA 3DTEA 2GX9A 5AQQA 4A5MA 1WSIA 4DTRA 3JAME 1R1VA 3S6IA 2B7EA 3J7YP 1XNRK 1YITA 2I5WA 4B9SA 3WEEB 2LQKA 3MJXA 1Q82R 4BEHB 1YHQA 2MWPA 2K5FA 2GOXB 4Q5VA 3I55I 4CRIA 3R9PA 3V9WA 3U3YA 3OH6A 4LK1F 5GAMd 3DLMA 3SFIA 2LQNA 2ME6A 2NRVA 3LM9A 4U0WA 2EPDA 2EGAA 3PL8A 2AQFA 2ED1A 2NYXA 1TT5B 1XMXA 1RILA 1TC3C 5CVRA 4I9QA 4IKFA 4N4OB 4QS7A 4I2PA 3G2BA 2ROLA 2CGPA 3VS6A 3AO4A 3HVTA 2K9QA 2EV5A 4XRSA 3OYDA 1KONA 1SKSA 3ASOH 4LITA 1N5ZA 2K7LA 2DL3A 1MMDA 4KGXB 1RI7A 2FOKA 1MDMA 3LPUA 4OMFB 3QAHA 4AMCA 1GLBG 5AQXA 4MO4A 1S1VA 3NWSA 4KMUX 2DCEA 3JAMO 1LWWA 3HI0A 4X62K 2E6ZA 2LBFB 3IRQA 5HODA 4GMJB 5HS7A 2EYWA 2RHKA 3DTIA 4YG2F 1OULA 3OL3A 4MNUA 4TVRA 1GOAA 3G71T 2W7NA 2YG9A 2OAWA 5CVIA 2VE8A 2D0OA 2V52B 3RR8A 2EFNA 2KP6A 4K0KK 3KYCB 1LW0A 3ZCMA 2BANA 4NOYA 4Z2YA 4EA5A 2GTDA 1Z3XA 5F0CA 1P4XA 1RT3A 5M1PA 4CEQA 3LFKA 1YIJT 3TVTA 3AA2A 4CJ3A 2L3QA 1KCFA 3AHUA 1AWOA 1OYXA 1OCTC 4H0EA 3DLLL 2BIVA 2FZGB 3VOVA 4AIAA 3PV8A 2DQRA 3F2KA 3A5MC 4K25A 1VQ7Q 2MSYA 3EGDB 2ZF5O 2HHTA 1H0MA 3I5RA 4E7HA 4J7FA 2LD5A 1P92A 2Z1IA 4H8KA 1ZAOA 4A5NA 3QPSA 4HVUA 4JDSA 4L5EA 2KFNA 1MGQA 4M77C 4GYGA 5KK1A 5AQZA 4BY6C 3MCZA 2LOOA 2QQAA 2M0OA 4N0AC 2Q36A 4NO7A 3A03A 4E7SA 4UY8I 3MEVA 1Z6RA 2V75A 4RAFA 1VQLT 2HZDA 4CK1A 1PD1A 2NUPB 2LDMA 1ETXA 4E1NA 2HMIA 1SD7A 1SRLA 1QZ5A 2PJPA 4HUFA 1VQMT 2HU9A 3S2HJ 1QCOA 3CJ7A 3O80A 4W5RA 1HQEA 5I9EB 4P55A 1B8IA 1YJNI 3E6CC 1NGBA 2WA0A 4AH9A 2QWRA 1X43A 4DR6K 1S5LC 2RPIA 1S8NA 3H46O 3K4LA 3TW6A 4OMQA 5BN8A 3HJFA 5HS9A 2IS4A 4JPBW 5ICGA 2KIFA 1VK0A 1R1TA 2Q97A 3HPWA 4KHYA 5E1XA 2JUCA 1X9JA 2UXCK 4I09A 1DQUA 2M51A 4Q48A 2HHHK 1WJCA 2JA7J 1P9QC 2CSIA 1OCZH 1P4WA 4M75E 3VQPA 3FZKA 3K5MA 1GLLO 5FPMA 2R7OA 2P5LC 3M5RA 1KG1A 2VG5A 1R00A 1BYMA 3SQ2A 3I4NJ 1HUXA 1YJNN 5J26A 4RM3A 1FOYA 2VWBA 1GV5A 4LFAK 3DBRB 1IUYA 3RDIA 3VDXA 3JCMb 1NJXA 1MBEA 3IH2A 4U7DA 1R1UA 1SV5A 4FX4A 4F7UE 1NGNA 3FHFA 1S1TA 2WOMA 3EZWA 3CETA 3H9NA 1HPMA 2D0NA 5EEHA 1LEAA 2HQRA 2JPSA 2MF2A 4XK4A 2CS7A 5I42A 4IQJA 1WFWA 3WE3A 3B6CA 4DQ2A 3T19A 4DBFA 3HOZJ 2QYZA 2EIJH 1BBZA 4K43A 2ROTA 3M4OJ 3FLCO 1WJDA 1XN7A 1MUDA 4KN4X 4JK1X 3MZ8A 3CLOA 4CJTA 2LT4A 2Z3YA 3MKYB 3G6EA 1N25A 2XDPA 3ENBA 3BDDA 2CSOA 1WJ5A 4AVPA 2CP5A 3ZL7C 3VQ5A 5EGOA 3AVJA 2DVEA 2DA6A 4DB3A 4KISA 2YHWA 4Y1DA 4C3JJ 3F73A 3L42A 1RBVA 1TUUA 4OX9K 2GA2A 2CG4A 2A37A 3PVQA 2E34A 2GV9A 4DTNA 3F5TA 2VWJA 1TWGJ 2NUBA 3HHTB 3S1QJ 2UXXA 4C3HJ 1ZG1A 2CZ7B 1YCYA 4LIUA 3I9QA 3S9HA 3K5LA 3K5OA 1LMZA 3KCCA 2XHBA 2BOLA 4ASNA 4JUVA 4PJOC 4RGSA 4BRDA 4A12A 3I35A 3FZHA 4A3BJ 1HNZK 2LTPA 5FD5A 3C6AA 1S5JA 3M0SA 3W3CA 2RO0A 2PQWA 3CCRN 2PMZA 1OPLA 4MDWA 2DK8A 4Y92A 1NGAA 1RDCA 3TCJA 4EA4A 2E3HA 4Q5SF 3LP1A 4AHSA 4CSWA 3VEVA 2VQHA 3KTQA 4M78F 1K78B 2YHXA 3CBPA 2DA9A 4EP5A 1VQ7T 2E4HA 2GQQA 3MXMA 3AVGA 2M7BA 4KIGA 1FN7A 3VEOA 3FM3A 1U78A 1U3OA 4BBRJ 1UJ0A 1Z1DA 1OLTA 4DV4K 1BQMA 1M2VB 4UHTA 1RT6A 1EBMA 3BR1A 4RTTA 3FXJA 5KI6A 2OPTA 5F2RA 2P51A 2E1MB 4F3TA 1VQPI 2VGNA 3IP4B 2CREA 3JYTA 1M1KR 4F9OA 2GXAA 1YO5C 2QWQA 3P39A 4HKEA 1ZR4A 2K9SA 1VSHA 3VF2A 4FYVB 4YFXF 3VQEA 2QKMB 4YHHK 5CO7A 1EP4A 4M3DA 4M42A 9ATCB 1KD1O 1B72A 1DGRM 3HSBA 1TYQB 1M3AA 1QVGS 1TTHB 1XWLA 3CC2I 2XDVA 1OI1A 2P9IA 1BC8C 3CERA 3QG1A 2ISYA 4OIRF 5A0DA 3BT9A 4EJWA 5I21A 2FB7A 4II3A 1ZBUA 4B3RK 4ZZDA 2F2VA 4IHVA 3CP2A 4BRFA 1H8KA 4AFUC 2P5OA 5M1OA 2ME0A 2PBIA 5IT9K 1IN4A 3GPLA 2DJZA 3VS7A 3P8DA 5AT1B 1HK9A 1IGQA 3TO7A 1AWWA 3I8BA 4KGVB 1O3RA 4CIEA 3A0BC 4J6YA 4RB1A 4C8QB 4JV5K 1X27A 4LSLA 1O13A 2C0OA 2LSOA 1WOQA 4X66K 4YOWA 1MMNA 1H3HA 4L9TA 5IYDJ 2XG8D 3BFMA 3H45C 5C12A 1XC9A 3HGYA 3DI6A 5LY3A 4U67L 3SCXA 1VQ5N 1VI0A 2DU9A 1ZBLA 3R6NA 4BQZA 2UV1A 3KP3A 2NS0A 4IX7A 3S1NJ 3CUOA 4KBOA 2ID6A 4EMGA 3MEGA 1KFDA 2X51A 3F3XA 2VJIA 3OIPA 1HRHA 1KQ1A 3QU6A 1Q7YO 3TP0A 1TV6A 5EEAA 2E19A 4FJHA 2MBFA 4MLOA 3SUNA 4XORA 2WC2A 1YW7A 1WJQA 3AVIA 2K86A 2KDSA 2RREA 3FMSA 1Z7LA 1Q81R 1XTAA 3M0RA 3OYGA 3BEXA 1L3LA 2K5IA 1PKTA 3NF7A 1ZGAA 1T0HA 2O3FA 4Y52J 1J9IA 4I6ZA 4KUDK 3HL8A 2ACJA 3SWNA 4M7AF 5C44J 5I11A 4MQ9F 4M7XA 5LRRA 3IL2A 4ZGEB 2Z1DA 1RUNA 2DILA 2HNHA 1ZLKA 4A3IJ 4UXNA 4FWLA 3V9UA 1V5GA 3JR9A 1TUGB 1NJYA 2BUPA 5GAMf 5D6EA 3N97A 1NOYA 2QAZA 3FHGA 4FYDA 4FT8A 4WE1A 2OI3A 5LJ3d 1YJNA 4E19A 1ETOA 2QWLA 3SB2A 1LCKA 4M3EA 1KHIA 4CHNA 1SAXA 4HDUA 4OMZA 4A53A 3PFSA 1K6OA 3C2BA 3RTVA 2HSTA 4PUOA 5E3OA 2L9SA 4DZPA 2JA2A 2KLAA 4WFAL 3QERA 2FSKA 1TQPA 3EG9B 1B4AA 4II2A 2O9VA 2PFUA 1UECA 3CBOA 1D09B 3HC7A 1O57A 2VQEK 1OU8A 1IGUA 3SHWA 3BTCA 4RB3C 3QBYA 2W42A 5KYXB 3PO3J 5FU7C 1YS6A 4HW0A 1TU0B 3QXEB 1C0UA 4FJMA 3H1CA 3NE6A 2RF0A 1KAYA 4M6VA 3HL2A 5HRPA 3BJ6A 3CIPA 4C8QE 5LBQA 3EUHC 1XGSA 1Y56A 1XDSA 2KIQA 2EKOA 5E8GA 4AT1B 4KH1B 3PSIA 4OKEA 3V7CA 1YW8A 2HTSA 2DNUA 4MDBA 1J09A 2RB6A 3FBNB 2QSHX 1UGSB 4OPJA 2DTOA 3ABLH 3SMSA 1G3YA 2V6EA 1I94K 1HNVA 5KCOA 5E1WA 4O0IA 3TABA 3M0PA 2D5RA 3LSKA 3X24B 2KKOA 2BH1A 4Y28E 3S16J 4C8QD 3PO4A 4F3OA 3HB9A 5FFZA 3SD4A 2DXTA 3DLLF 4A62A 3NF8A 3C1DA 1WQ2A 5DCMA 2L9NA 4DV0K 1O7FA 2DDAA 4DV6K 1IH7A 2LY2A 2IVWA 1V5FA 2KZMA 4BVPA 2GBZA 1BU1A 5AQTA 4X9CA 5HL7L 2VXEA 3VJPA 1O9SA 4I98B 3DLHA 5KYNA 5AZJA 1USTA 3AAPA 4I6MB 2WFBA 3FFIA 4IF4A 1NH3A 2PNIA 3N4QA 2YDLA 2CT3A 1NMDA 4PY5A 5D5VB 4PLIA 2ECBA 1PC0A 1W7PB 3BG7A 4CF1A 1JJ2P 2ZB9A 3IH3A 3CO7C 4EP4A 2HTJA 5K7HA 4BBSJ 1FXXA 2CUEA 1W5SA 1PVSA 3A0IX 5FDLA 2F4VK 2YU9J 4EJYA 4UVBA 5F64A 3W2AA 3K9JA 1D8JA 5T7BA 3UWNA 1MWMA 4F14A 2P0WA 1Z05A 2A6TA 3BQZA 1M5Q1 2KZGA 1BHLA 4ATOA 1QW1A 4G6TB 1FIAA 4LG0B 2LKSA 2Y90A 4B08A 4AYBN 3R8EA 3MKWB 3MVPA 3ZX3A 2PFBA 3HUGA 3LP2A 1JKOC 3LWFA 2QA4Q 2Y9YA 3KKRA 1GXQA 2LC2A 1EETA 2RHZA 1VSFA 2EV6A 4H4KC 3KIOA 3CO6C 3AVBA 1JCGA 4KFCA 1A6QA 3SQ4A 1YIJI 5EG0B 2HDDA 2PJRB 3IDHA 2VBZA 3NH0A 5FKLA 1GLNA 1WGXA 2WTUA 1BK2A 3PIOL 2W41A 2X9HA 3VEWA 1RBTA 4BR7A 5LRSA 1NJWA 1NJIR 4FPAA 3LWMA 3RERA 4CHOA 5DM7R 1CGPA 2QXLA 2NYSA 4GBQA 1U8RA 1DGWY 3PNYA 3T1YK 3THWA 3D2FB 1N34K 2K2MA 2L0AA 3BPVA 2GNCA 4MEYF 4D5CA 2YKMA 3FHNA 2HNZA 3DPTA 3VV0A 4XMYA 5HLGA 1JLBA 1QZZA 4WQ4A 4M3XA 3G71N 2A6AA 4BEHA 3HRTA 4O8KA 3K4MA 3CC2A 3PM1A 4X65K 4XU1A 3HFOA 4E6RA 1ZH5A 1YIJN 4CGIA 1PHTA 2D0QB 1S72Q 2JVHA 3SNNA 3BR5A 1VIEA 4KRFA 1L3VA 1L5UA 2JJ9A 2H94A 3IMXA 2FBVA 5KYYB 2FNPA 3CCQI 2VKVA 4G12A 5JHFA 3CZ6A 1KD1U 2W25A 2XF7A 3ZOBA 1NKCA 4M75A 3M8EA 2VOPA 3LWIA 4KRTA 5AJ3K 3ZQ7A 1ONVA 2RJDA 1D0ZA 4ITVA 2LBFA 5GTIC 3HKZN 1YI2I 3GTPJ 5EVZA 3WTTC 3TAMA 3D1NI 1IV8A 1RPWA 1FOXA 2QGGA 3TSQA 1GXIE 1RAEB 1VQLN 4LLNA 2R7WA 4OMYA 4CC2A 3L8BA 4F7UA 1ZXOA 3BG5A 4M78C 1WZ2A 1VQMN 4Z4CA 2RV8A 3DAWA 3LQRA 1HLVA 4PIIA 1OH6A 4ESRA 4AF1A 4IRGA 1LFUP 4WCEL 3F21A 3N4MA 5JVGL 4NCGA 1W7PD 1YJWQ 1KYZA 3I9V2 2DPNA 3INZA 4M7DE 5IH2A 2V8KA 2XB5A 5AYFA 4IEEA 2A40A 2ELKA 3J8AA 2QUFA 1JKHA 4NZGA 1W2BP 5EX5A 1KGSA 3AO3A 2HZTA 5GAN3 1H9TA 5GMKh 2XY7A 3PO5A 3RKQA 1O7LA 2NOZA 1ETWA 2P9UB 1TL1A 5M3FJ 4PDKA 4DG1A 1SEMA 3VQ4A 4OVAA 4BQLA 3E7LA 4LF4K 5DD8A 3GBGA 4RCBA 3BOQA 2VPLA 3HPOA 4CFCA 3CCJI 1ZREA 2O5RA 3UR3C 4CUGA 3ZX0A 4ISFA 3HVRA 3P8HA 1UB4A 1CZBA 3I4MJ 3LGFA 5GMKi 2ATCB 3OTOK 4OIOF 2K4YA 1FYNA 5FFXA 4UV8A 1QZ6A 2R92J 2NUPA 4HQMA 3UF4A 3O1BA 3VKIA 5KH6A 2GXGA 1T56A 4BRIA 2X78A 2AS5F 2JA5J 2X74A 1IREB 2FBIA 3M3YJ 3LH5A 1JT0A 3VW4A 3K1MA 2CS3A 1ZBHA 3G10A 4B3MK 4NBQA 2LYCA 2G8UA 1RT7A 3NGZA 2HQAA 4EAHD 4AVZA 5J1YA 3VUBA 3VYTB 4GFBA 5H20A 1IO6A 2BY1A 3GDQA 1X01A 4FPBA 3EZ5A 4FLXA 4RTYA 2RN2A 3A8OB 2QA4T 1CZAN 3UA7A 4QQGA 1I27A 2NVUB 3PIPA 2NXNB 5AZIB 1TUCA 2BHZA 3F10A 3V1RA 2FZCB 2HHWA 3J80E 2JQ7A 3JRFA 3Q3SA 4WTOB 3QP6A 3QUIA 4LF7K 3VGMA 3LGLA 2WACA 4BDZA 1VQ7I 2ETJA 2DY4A 3S3MA 3LLRA 3RMSA 3HRUA 1VSLA 1X1PA 2KI7A 3WT0A 3O6BB 1H88C 1KYWA 1LDDA 5K5OA 2X48A 4RAYA 3REOA 5CIUA 3RJPA 2AXTC 4ISGA 2A08A 4FETA 2I7NA 3QETA 1YG2A 5AQPA 1U04A 5KE2A 1R0CB 2CQKA 4DWIA 5SWMA 2JSCA 1JLGA 2I0NA 3RDVA 5IT9O 3OSFA 4XKCA 2BE7D 3GTQJ 1TH7A 3BF3A 2DOAA 4K8XA 4M7AC 1S72T 3VFZA 3QDFA 3J80O 4EQQA 2W24A 5AQKA 3MX2A 2O8CB 2E1ZA 4L3QA 2YNGA 4GV9A 4XLHA 3BC8A 3I0SA 4YOQA 3O2PE 3CW7A 3C4SA 1VQ7N 3U23A 2Y4XA 3COAC 1WNLA 2B5JA 1CXUA 3QB0A 2IVOA 3O9TA 2DL4A 1KQSS 1OH8A 2FVUA 1V3FA 1JXMA 1V54H 4DNCA 4ICLA 1M1FA 3MO8A 1S9EA 3TW7A 4N9IA 1XSDA 4OLBA 5F1RA 1T0FA 1SFKA 5GAEJ 2QWNA 3Q7CA 4F2SA 2DDBA 4HSRA 1U5TB 5GAMj 2FSWA 3VQDA 3LX7A 2DPPB 5LJ3f 4YNQA 3R2XC 2EGCA 4CK3A 3S3OA 2YXYA 3TGNA 4B9VA 4YPHA 1IN7A 2IAJA 4NYNA 2K3PA 3MN5A 5C0YA 3I5SA 1TWAJ 4LOCA 3JSCA 3JB9G 4J2BA 5A2QE 3C7NB 1Q1HA 4A4KA 2CUZA 4XK8E 2ATQA 3K9KA 5J40A 2QW9A 2WB1N 5K1YA 2JM8A 4UB6C 2EILH 2L7FP 3G71A 4N41A 2OFIA 2QDLA 1TL3A 4E3SA 4FCYA 4PHTX 1YJWT 4J6WA 1HSJA 3JREA 4JK9A 1A31A 2D0CA 1YIJA 3NWTA 4I2QA 2LG4A 3O8HA 1A5JA 3DXMA 3ZLJA 1NG2A 5TRDA 2E35A 4EM1A 3Q0UA 4QVDA 3ABMH 2M1HA 1UHFA 2DFFA 5KAFC 2OFKA 5HCKA 4RDUA 4CJRA 3WXLA 4XIDA 1OFCX 5L8RE 5KRSA 3SLCA 3NAEA 3Q0VA 4LF9K 3CCVI 2KFDA 4RM2A 2P6TA 1ZYQA 1E3OC 3M59A 3JCMg 1UA1A 5CJ9A 3ZT1A 3HKZA 4BJTA 3M0UA 2VWFA 2VQLA 3I58A 1ZSZC 1RGIA 1TW2A 4WXDA 1TYQA 3GOIA 3DKYA 5KYWB 4U0YA 3EO3A 3UB5A 1I3QJ 2VI6A 1VQ9Q 1K0XA 1O3SA 5ILSA 4FWOA 3LMMA 1VQ8Q 2L9RA 3QPTA 4YDUC 4RKUE 2LLKA 2EBIA 1KSWA 1JU5C 1ORKA 3T1HK 4CESA 1M90O 1NYFA 4BWJA 1M8VA 1I50J 3W0LA 2DBKA 1SSFA 4OAZA 1Q86O 1IG8A 4ELZC 4NC7A 3NFAA 2DL7A 3W6VA 1AZEA 3TI0A 2ZWHA 2NRXA 3S3NA 4LDXA 3SDBA 3IQLA 2Z1HA 4ESFA 2HL5C 4KT0E 4C8QA 4FJLA 2XMFA 5EDNA 3PX0A 2MAMA 4BHPA 3KP7A 4GW6A 4CEZA 3PIOA 3S8PA 5TJJA 3WXKA 1NYGA 3DF8A 3KPHA 3GXOA 3UKUA 4Z4IA 1IKYA 1KAZA 4JS4A 5EOYA 3SQNA 4CBUA 1QZEA 1HKGA 1S1UA 4YIFA 5LJVA 5CQYA 4E1MA 2WAEA 1KEAA 4WYBA 5C3EJ 2FO0A 3P9KA 1IHVA 2Y0MA 1Y7XA 1M9SA 2OYQA 2ICWG 1VSMA 1NK8A 2HXOA 4A2UA 3BR6A 2NWMA 1I1SA 1GLAG 2HKQB 4FZXC 2UZKA 2PAVA 2KRSA 1BOTO 4RG8A 4DOVA 1NKEA 2QWMA 2ZGYA 2MIOA 2P0QA 3OS0A 3CCMQ 2KAFA 1EIFA 4I01A 1XQPA 4LD9K 1AOJA 3OS5A 3AL0B 1AKHA 3RWUA 5D4SA 1XG1A 4H0OA 1NK0A 2IAIA 1SUQA 3VRZA 3M9AA 3PNWC 4OIPF 3SXYA 4BDYA 1HQCA 3A8LB 5FU6C 1E4FT 3SQ1A 3UDCA 4H0VB 4DV5K 1YVNA 4XOPA 4B24A 3QJYA 3EFSA 3CHWA 1D1AA 1SL1A 2AP1A 4XLEA 1YFHA 1HA8A 3CPEA 2NOGA 1P7IA 1KVBA 3HTRA 3M8JA 5C15A 3ERMA 2BZ8A 2STWA 4AM7A 1RZ4A 4OJRA 4FM2A 3S15J 2V9PA 3CVTA 4IZ9A 2NOBA 1VSIA 4JI4K 1HQUA 2EZLA 4CCNA 3H35A 3PT9A 1R22A 4D8KA 3ZGKA 4I0BA 1VQNQ 1N27A 2EHGA 2YHYA 3RUXA 3DB3A 3HK2A 4AU7A 2DJQA 4OMLA 3BF1A 4FSVA 3CCUQ 1AWJA 2BXZA 2N8GA 1WA7A 4N5SA 2F5KA 2IP2A 2PG4A 2YPRA 4C8OA 5IHNA 5J47A 2FPEA 5D7UA 5J2MA 3L2VA 5KYXA 2NVQJ 3VGLA 4HUGA 2RQUA 4YTLA 1JXEA 3FB9A 2PY5A 2JT4A 4CZKA 1IGNA 3V9ZA 1HLUA 1Q8IA 4OB3B 3BZCA 1VQ7A 3CUQB 2H56A 2G7UA 3ITHA 4ZJZA 3HP6A 1VQ4Q 2M30A 1GDTA 3AA3A 3TSPA 3BY7A 4M77E 5GAOn 1JUPA 2DQLA 3V1QA 2LRQA 2ZBKA 2NOJB 3HBTA 1DJ7B 1WHGA 1BIZA 4W5OA 4DSEA 4BU2A 2JLEA 1YUWA 4XH5A 4MQ3A 4IJNA 5EY4A 2M45A 1QVUA 3ZSYA 2GBYA 1YHQT 4HRIA 1K9MO 1VQ9T 3OW2A 3W2VA 1Z7UA 2M0MA 3JB9D 2E5ZA 4A3GJ 2HCKA 2K3FA 2RKIA 3T69A 2NLXA 1SZ2A 3KLOA 2MG4A 3CCLQ 1VSJA 3OH9A 3CF5F 1ZUUA 3FGUA 2Q31A 3VA3A 3QOPA 4EJZA 3R60A 4ZYAA 2DLPA 2R5YA 1BG3A 3RBBB 5IHIA 4I6MA 2P9KB 4G6DA 3FXLA 1HNIA 4O5BA 3O4NA 4P96A 3P31A 1YAGA 3BROA 2L3DA 4FQGA 1SSHA 1Q1VA 3OJUA 4EM0B 5TISC 2RQWA 2O4IA 2HOEA 2DEUA 4JD2A 4FM1A 1ON1A 3TAPA 2CV2A 1NK6A 3MEEA 2FMLA 2HMAA 1E17A 1TWFJ 1DEJA 1P7JA 4HTLA 1C1CA 4OPKA 2EK5A 3CFPA 2Q2EB 1DPRA 2F5CA 5B3SH 4RTZA 3S17J 2K9GA 3NEUA 3CFRA 4CHPA 1SHGA 1VQKI 1T39A 3EG0A 3LWLA 1YIOA 1M3CA 2SEMA 4Y4RA 2P5GA 3E5UA 3LSHA 4M7DA 1W0UA 4BRPA 3MXIA 4J5YA 4MLHA 2HR3A 4JI0K 4MFBA 2K3BA 2WONA 1U49A 2PJRA 3HBLA 5B66C 2BDPA 2EBPA 3LA7A 4KUMA 4H5TA 1GXPA 1KD1C 1FIPA 1B34A 1H1VA 1OCPA 3LM2A 1BIUA 3G0ZA 3TARA 4BR5A 2V1NA 3CCMT 3TAFA 4J00A 4F55A 4M9SA 2HNYA 4BC4A 3JCMd 1G6NA 1QQNA 5EYRA 2DKGA 4OP0A 3C2GA 3BQYA 3DBHB 2LC4A 3CYMA 3IUCA 1HDDC 1NNEA 4DS5A 3WQUA 2ETHA 4FJNA 3FWEA 3QO9A 2XAQA 1STZA 4IXCA 4KITB 3OW2M 1YQLA 4CERA 2RPNA 1E3HA 4HT9A 3CJRB 4PFPA 3CCSI 2OTLN 3O3HA 3I55Q 1BI4B 2NAZA 1YYVA 1HW5A 4XLPF 3CXCP 1MUNA 1R36A 2MK5A 3HT3A 3OGDA 1RBSA 2A6HF 1RNLA 3VN5A 2GWKA 4PJOE 5M1NA 3BGRA 4ANJA 5FGMA 4HAMA 3ZQFA 1IBLK 2W4SA 3L3UA 4N9HA 3T1BA 5E8IA 2XF5A 3CCUT 2DMPA 1UDLA 2BXYA 1MZBA 1T08B 4Y1CA 3ER0A 2IVMA 4GVMA 4C5GA 1NGEA 2DTRA 4DGWB 4ID5A 2E10A 4KTQA 4JRIA 2ZJQL 5FKNA 5KGWA 2LMJA 2LNVA 3CMYA 4ZTFA 2C0TA 3A2FA 2QA4I 3M8PA 2ASMA 3O5ZA 1M90U 4ILHA 4KIFA 4FIBA 1P4AA 1ETKA 1KLMA 1NGFA 1VQ4T 1WGSA 3SV3A 2GTOA 4BUPA 1Q86U 1KG2A 1KG7A 1NKUA 2EYXA 1RADB 3K4NA 2YUNA 1FTZA 3WU1B 1QCFA 1RKWA 2KXCA 4ZYGA 3T0YA 3TEEA 4V19S 2KHMA 2QBYB 4DMNA 1R58A 2CP6A 2JRTA 4EW0A 3T9NA 5DS9A 3VEPA 4L18B 3BE3A 3QHSA 2A5WA 3CM6A 3GE1A 1GCQA 5IXFA 2DZ9A 3OMYA 3EKUA 3KYDB 1ACMB 4M3WA 3JW4A 3URGA 4RMOA 1AVZC 4AHCA 4FL6A 2MFZA 3P1GA 2P9UA 2UUAK 4UC4A 3GF2A 2OA4A 2JN0A 3VMFB 5F0FA 1NLPC 3VS0A 1DT9A 2NOEA 2XASA 4V19K 5AIPA 3U4LA 2YCHA 3C6TA 1QHGA 3RYRA 3M8QA 1S72I 1RLQC 3QIPA 1JLAA 3VQAA 1ORPA 2ZJRF 3CCYA 5LFAA 2KYBA 1WHLA 2JHJA 4DSFA 3NFCA 2J5PA 2V7YA 1YE9A 4FTHA 1FNNA 1OOTA 3AVAA 4L0ZB 2H8HA 3A5LC 4DTOA 2FE3A 1JE8A 4E7IA 1OH7A 1V1CA 1ITYA 1MPGA 4CZMA 2E1MC 2UUBK 3VQBA 2MGQA 3DYAA 3FMRA 1K8KB 2A3LA 4AFSC 2P4TA 2XY6A 4JJBA 1NMNA 4DQSA 4ZZLA 2Y31A 3V8JA 2CP3A 1BI0A 5AQLA 3JCMe 3KEOA 2YHAA 4D8DA 1IDZA 2FJ1A 2FRWA 3EYZA 3BG6A 1R71A 1ZTRA 3DMJA 3QIIA 3WXMB 1DDNA 5L3GA 4Y17A 1E6GA 2OPSA 4CGHA 4DSJA 5AZIA 2IGKA 1PWTA 3TSUA 2P5VA 1WI7A 5F08A 4KHQA 4JRKA 2WSCE 1DKGD 2XIGA 1F43A 4KMFA 5FLXE 1ZUKA 3V9XA 1W5TA 2ZXIA 4M6XA 4M7YA 1YJWI 5LJ5d 5C4JJ 3QWLA 2IC3A 4B1VA 3RZOJ 3KZZA 1R49A 1SAZA 2XF6A 4AHUA 4Z4GA 2FU4A 5ILUA 4XOTA 2W48A 3BJOA 2F6CA 3BZKA 1C0TA 4JJCA 1X3WB 2QCOA 5C4XJ 1NG9A 2FBYA 4YOYA 2FEZA 2VLAA 1FP1D 5FKMA 5GANh 2HQXA 1D1CA 3K1PA 5F27A 2V1DA 1R0BG 2PZ1A 3BLYA 1FYKA 2HF3A 1VQOQ 4QLCU 1SD4A 4PL8A 4H4MA 2LK2A 1IHWA 5E1ZB 2E1CA 1JJ8C 3A98A 3I55T 4NCAA 3HP9A 4RTXA 3X25B 4DA4A 2OTJQ 4FLUA 3LWHA 4CBXA 3F8FA 1VRTA 5L3FA 4AC0A 1YJWN 2PX9A 1J5OA 1Z67A 3DJCA 4BYYA 2X3WD 3UT1A 5GIOA 4EMKB 3I8DA 3BUZB 1JXBA 2GFUA 4JAXA 2ZXHA 1Q82U 1ODDA 1WDXA 2FUG2 2JN6A 1MHNA 4GVEA 4BH9A 3BDUA 3PMTA 2AJQA 2HOSA 4MZPA 2J6FA 5ICEA 2NRZA 5AIQA 1RAIB 1WVRA 1R5ID 3CQYA 3FZVA 2V79A 3O9UA 3BTJA 2JA8J 2ASPA 1D3YA 3GCMA 3R0AA 3IS9A 2RE2A 3L4IA 3VYGA 4ELYC 3MEDA 4FXDA 4C3IJ 2P4RA 1O1WA 2KDOA 4BRHA 2RKHA 3LNQA 1T2KA 2A3SA 1BI3A 2F4OB 3ZR8X 5KYUB 5DDGA 1Y97A 1GVDA 5KCHA 2CP0A 1S7OA 4JKEA 2EWNA 1MH3A 3AVHA 4DSKA 2DAOA 1SPKA 5GADP 4W5TA 3META 4LC9B 4DV3K 1A0NB 4NLCA 2VC0A 4CIGA 1Y39A 3QFUA 3S41A 3LYIA 1G83A 2L7MP 1N32K 5FKOA 3RVCA 5AQUA 2HW3A 4II1A 4L0YB 4AG1C 3D2EB 3F0ZA 2ZFWA 1NTCA 2I2LA 1B9NA 1BJAA 4BG9A 2HYFA 4HV5A 3LDLA 3CWAA 3ATVA 3BCAA 4LB5A 4KPYA 4F3QA 3I0WA 2DFEA 5IN1A 1HC8A 1B59A 2RQQA 3VSLA 3CF2A 4PJLA 3OSVA 4NCBA 2F9WA 5CE3A 2KTQA 4K42A 1VQPQ 1RC9A 3VPRA 3F0CA 4J83A 5DV5A 5D6FA 3FE1A 3GUDA 4XKVA 3CCEQ 1TLHB 4RLQA 4IUVA 4KT5C 2HB5A 2HQNA 1HNWK 4ENJA 4XSXF 4B21A 2QTXA 4HVJA 1YCSB 1WJBA 4XTZA 3CJCA 4HYEA 5JLFA 5CQXA 4J9FA 5KPTA 4FT2A 4KGZB 1BBYA 4MLEA 2F5DA 3WNFA 1EXQA 4KREA 4YPRA 2AZVA 4KAZA 2KQWA 1FSHA 5BPIA 2R7SA 3L3VA 1TKDA 2R7TA 3AT1B 7AT1B 4LB6B 3CVSA 4DV2K 3AARA 1U4BA 2Q0RA 4BQNA 2EA4A 3BR2A 5EZGA 2QA4A 3VA0A 4PFOA 5J1UA 1SHFA 2PU9B 1W5CC 3EUKL 5AR0A 1B07A 1SVLA 4NL2A 5H6RA 2V7FA 4B3AA 3AGRA 5LL6S 3HHHA 4M77A 2AZSA 2CZ1B 2Q0UA 2EAYA 4DFMA 4N0AA 2O7OA 1RBRA 4A3KJ 3HTSB 2RA2A 3TDUC 2ZD1A 1N77A 2COMA 5KVRA 3R61A 2V1QA 1VQOT 1Y57A 1S3XA 3HOYJ 4KICA 4BC2A 4DF8A 1EH8A 4P5OA 2DT5A 3WTWC 1K73O 2JSPA 1Y64A 4FVUA 4F92B 4G8XA 1WEFA 4J2DA 1MMSA 1LOJA 2OTJT 1BA0A 3N0UA 3SDGA 2DETA 5SZTA 2V7ZA 4B8AB 4WWCA 2NUTA 2BZXA 5J4YA 4LD5A 3JB9F 4YFNF 3KK3A 3B8AX 3FXOA 1MKMA 3JCMf 4G7HF 4CJWA 1VQ9I 4IIOA 4DS4A 1S72A 1D5VA 2P5KA 5HS8A 1BA1A 1VQ8I 4XLNF 2EYQA 2IOCA 2ZZDA 1DU6A 3ALYA 1W6XA 3G4SQ 2MI6A 4AIKA 2F2WA 5GAMg 5H6QA 3QWXX 4U88A 2Z5UA 1USSA 5HOOA 2YHBA 2KHOA 3L2ZA 5ADXA 4JI5K 2F5EA 1ZG3A 3C95A 5BRHA 2IGMA 4LIVA 1B6AA 1LVAA 2TDXA 4A5BA 3GF5A 4BNCA 3FKJA 1ZRFA 4CGGA 3H3ZA 1WWXA 1FEXA 3EGUA 4BWMA 2E2QA 2BV6A 2MABA 5DTDA 3DXKB 1OKRA 2F96A 1QKWA 2D6FA 4JI1K 1HBXG 4ZC3A 4CHUA 4XN3A 1N78A 4M78E 1YHQN 1SD5A 3J7AF 3NARA 3VWBA 3L2QA 1VQ9N 2L7KA 1V5EA 4WF2A 2XI9A 2GZWA 1Y71A 2XROA 2NOFA 4B22A 1S3JA 2CQNA 1WH7A 4JP0A 3CWUA 4I02A 1OZ3A 5ELZA 2CQXA 4G6QA 3HJEA 3ZEUB 1C1BA 3RI4A 1YJWA 4OU0A 1GOCA 3PNTA 1YNZA 2E5NA 5JFRA 4A4HA 4RW9A 3RNJA 2VE9A 3BTLA 3L6QA 3S93A 3P7NA 3EHRA 4FSSA 5L3BA 2RNGA 3AG1H 5FRNA 3QESA 4JZ4A 5BS6A 4BQOA 2F69A 2L2PA 4C92G 4PQUA 1EF4A 3WXIA 3MHXA 3NTIA 3SPYA 3DPUA 3QU3A 5FLMJ 1VQPT 2W04A 2HBJA 3AA5X 2A0FB 3ZSXA 2IIMA 1YXQA 4M3FA 3CCMI 3F8BA 4W5QA 2R7FA 2HKXA 3CCET 1WRJA 2F4IA 3BP8A 4Y0WA 3EEQA 2Z33A 1RACB 4HA8A 3JCMc 2Q3SA 2VG7A 4PGGA 4HNUA 2VKNA 3VB2A 1MV3A 4RGXA 1BL0A 3T7ZA 4KHWA 4U0VA 4PLLA 3C3WA 1ZN2A 4PJOA 3CC2T 1TGOA 4IO9F 5BPDA 3DBLB 3MEAA 1P90A 4CCMA 2KY9A 1JXOA 4LE9A 2Y69H 5JMVA 4KHPK 1NK4A 2LVSA 3NPFA 2IVNA 4Z02A 2G3RA 1ZX6A 1W2BS 1M1KU 2X3XD 1TWBA 3AVNA 1X9MA 1TUYA 1HD3A 3NGIA 1JL2A 3ZSOA 4H5WA 2LTOA 3I5UA 4C30A 3VYUB 4BS9A 2Z1GA 1M3QA 3DEWA 1D5AA 3CDLA 3EG3A 3CQTA 1YJ9Q 1VQNI 1GUUA 3HDDA 2DOFA 4A3JJ 4MFEA 3X26B 1WHKA 4M6YA 3ABKH 1QPMA 3GLLA 1JJ2A 1LV5A 3AAQA 4C5EA 1SS6A 1S9GA 2GAUA 4M3UA 5M1KA 2IRFG 2ZM6K 1NGCA 2HPMA 1PUFB 2ABLA 3CPFA 3RPUD 3FZFA 3CMMA 1X3UA 3U1KA 4B3OA 4MDXA 1O4XA 1QWFA 4AD9A 4IFEA 4JN4A 4B9MA 1WQ7A 4IFYA 4UUSA 4CGDA 2R7ZJ 2P9LB 1EKEA 5B8HA 4F17A 4EHTA 3HOVJ 2HBLA 3M56A 3ZMUA 3LA3A 2UXDK 2FHDA 2XU8A 3QOEA 3RRHA 4EM2A 4XLAA 1NLVA 3SZ2A 4LG3A 2JZYA 1ZSZB 2H8WA 5BR8K 3MZYA 3H41A 5BN9A 5GMKm 1X6GA 2R5ZA 4LFCK 5LJ5f 1KU9A 4B3XA 3L09A 3CCUN 3K70D 4M7AE 3QZ5B 4CVNE 2PVGB 5D5WB 3GTLJ 1FYMA 4C92B 1F36A 1S6LA 2P9SB 3VODA 3ZCOA 2PUOB 3I56I 1MH4A 4WXHA 3CCLI 2RNJA 1M90C 4RW6A 4CEOA 4J9HA 3G4ST 4C0GA 1R7JA 2WV0A 1VQ4N 2C06A 1Q86C 1O3TA 3OL4A 2M5WA 2AT1B 3AO1A 2JM9A 3J81K 3NMUA 3ZMZA 3C6UA 1T3LA 5LGTA 3TSWA 1Q81U 2ZQBA 1IG7A 2IA1A 5GAHJ 2K6DA 2M0CA 4L5JA 3CFOA 3THVA 1RUWA 3NH1A 3C18A 3O6WA 2QKLB 4F4KA 4IXAA 4Z4FA 2A5XA 2K2VA 2DO7A 1FPQA 2A69F 5E18F 3NAUA 2EYYA 3CMAI 1ZBJA 4N56A 4LNPA 4XU2A 2AKKA 2VKDA 2I8DA 3B73A 1RAHB 3CCQQ 1JJ2M 4FVMA 4BGDA 2CYZB 2HFHA 4BY9C 4N76A 2B9SA 3DTKA 4B3TK 4DTUA 4FJJA 3G6EN 1TNTA 2QF7A 4EVVA 5J8CA 1YFNA 1KRPA 4C9YA 4HF0A 1KD1R 2BKDN 4K2EA 4IIMA 1NE8A 1PP8F 5HDGA 2J6OA 1YI2Q 3QNNA 3DKWA 1WHJA 2BGCA 2HHXA 1SQKA 3H5NA 3AA4A 1U5TC 3CTAA 1G15A 5AQWA 1H92A 2DXCA 3MFKA 2LVMA 1BGXT 1MU2A 1LAWA 1V55H 3X28B 1IJJA 2QBYA 1BIBA 2O2OA 4J2EA 3V6DA 1GBQA 2GIVA 2O8FB 4HLXA 5GPAA 2LX9A 4CH7A 1T05A 1D8KA 2VB6A 2VVKA 2OZSA 1UELB 5JI6A 3PY8A 2HBKA 3R6OA 1FT9A 2DYBA 4BRLA 3FXKA 3CBMA 3QPHA 2LX7A 4IHXA 3CEYA 2VT3A 1G8XA 4E0DA 2PMZN 1W2BA 4CCJA 3VESA 2XSJC 5KRTA 4M3TA 1R59O 4RCCA 4IUUA 1VQ9A 2FBKA 4JZ3A 4F04B 2H6CA 2YNIA 3JS6A 2IEKA 1M27C 1WJSA 1JLEA 1VQ8A 4C1NK 1K73U 2ASOA 3Q9VA 1G59A 3SI6A 1D3BA 3CCJQ 1M1EB 3I4PA 5GINA 4FJ5A 1OR7C 3ELKA 3KZIC 1YJ9T 1SD6A 1Z9CA 2LJ1A 1F4KA 4PUSA 3K2ZA 3HRGA 3LDQA 1C6VX 1QVGP 1TNSA 4ILJA 1PD0A 4YFKF 1Q7YR 4OVLA 5GAN5 1RESA 1QTMA 2X6SA 1JGGA 1L3TA 1FSEA 4CGFA 4CJ5A 1WSJA 5FJ8J 2CWEA 3EUHA 3AG2H 3E19A 2KRMA 3OWTA 4DQQA 1X6OA 4WQ5C 4QAGA 2L5QA 3LAPA 4WFBL 4H0TB 1E7OA 4RS8A 2G0EA 2G8HA 4I2OA 3HHGA 3I55N 6PAXA 2D8JA 5HNHA 3KK7A 2F8TA 1J75A 1N6QA 4IOXA 2O8BB 1HJOA 3VQ7A 1UZCA 1MD0A 4HT8A 5KPRA 1P2FA 4XRSG 2WWYA 2E64A 4F7ZA 4FO0A 2PMHA 3IWFA 2KE9A 4M3YA 1EO1A 1QU3A 1K0SA 1JI8A 1REVA 1O3QA 3HM9A 2BEOA 4B1ZA 1TK8A 1OQYA 1LE8A 3THXB 3DLGA 4XEIA 2RM4A 1K9MC 1W4SA 3LFUA 2OPPA 2FG0A 1XQSC 4R79A 4XL9A 1RDWX 3ISPA 1XI1A 2HF4A 1XNIA 2YR2A 3UA6A 3HOSA 1OVQA 2E2PA 4BB7A 2FRHA 2Y48A 3S32A 2VASA 4RB0A 4XBFA 5IP6A 3CCMA 2COWA 4BI4A 2V9VA 4A4GA 4JI8K 1DTTA 1GFCA 3AG4H 2BVLA 1X6BA 1W2BM 1GLDG 2E2NA 4C8KA 4ZTJA 1UFMA 2E1NA 4KFBA 4JRPA 4NQWB 4UUTA 3VSKA 1APLC 2PYLA 2GUIA 1NJIU 1M4ZA 3M58A 5JS1A 3LOCA 5D6WA 2OJ2A 4ZGDB 3OYFA 1EX4A 4AG2C 2DFUA 3HSFA 3RKYA 2O8EB 4MQVA 5BPMA 3ERED 2NZTA 2LQWA 4N4GA 1VQ6I 5D8LB 2XY8A 2FX0A 4DOWA 4FISA 1TKXA 3CCQT 2FBHA 1V4TA 4LUDA 1VQNA 1NGHA 2JUGA 3BDPA 1LEBA 2B6AA 3F6VA 3FLGA 4H0PA 4PL7A 3CCUA 3AL0C 3OMGA 4CJQA 5LJ3g 2HQ5A 3OHRA 2COZA 4BE0A 1FYLA 1KZHA 4CI6A 2D5VA 3FJPA 3J7ZO 1ERDA 1YI2T 4YIIA 4OB0B 3QNOA 1ETYA 4IUPA 3GNFB 4M3ZA 4I76A 3V4IA 5GAMe 3KNTA 5ILVA 3ZQLA 5HRNA 2ID3A 1MUZA 4IOAF 5KYUA 3ID8A 1TUDA 4KKOA 1QP3A 2G8KA 4NS5A 1VQ4A 2CUBA 2KBTA 1BOBA 4RUGA 4L9JA 1S7EA 1TZLA 3NBPA 1WXUA 3ECOA 4IL6C 2X4JA 1TSFA 3B6AA 4LDWA 1MDMB 2L02A 2VKHA 3VS1A 1ZR2A 1X75C 4XQ3A 4DR7K 2JTFA 4W1UA 1VQOI 2F9TA 5GANj 3GTKJ 5CYMA 2J4RA 2ED0A 2IVPA 3AVFA 2DL5A 2LP0A 4NXNK 2OTJI 2M4GA 2KK4A 4PKGA 4CEBA 4B44A 3P83D 3CCLA 1ZGWA 3CCJT 1XSXA 4B9UA 4B1WB 3RMAA 4RW4A 4HF2A 3CCVQ 3CUQC 2DIQA 1ZBFA 4AILC 2XAUA 2OAZA 3N05A 2UUZA 3EGXB 2A1RA 5DEQA 2EFIA 1IRZA 3FK6A 2G6FX 1R23A 3JCMV 4PSWA 1U9NA 2EFPA 2CFOA 1E6HA 4M78A 4Y13A 3CJQB 1J53A 1TG0A 1PM3A 2YX4A 4B43A 5E84A 2GBQA 5B1BH 3A5ZB 2BTTA 1BO5O 2K7AA 1W1WE 3SFZA 5GAN4 3P38A 1XOVA 4KV8A 4EIAA 2VKEA 1G4DA 4DTSA 3UPUA 1AD5A 1SFOJ 1LPQA 2I10A 3NGYA 3T1AA 3RMDA 1C1AA 2BY3A 2F4MB 1ZSGA 2EIKH 1MGTA 4JQFA 2ZKZA 2GTJA 3TU4K 3PE0A 1U1SA 4CYDA 3U8XA 2OQRA 1VNDA 1Y6IA 2O88A 1OISA 4IFVA 2NNNA 5F0HA 4GO1A 3K4CA 3TAEA 2VJ4A 3U21A 4KH5A 2VBXA 3CCRQ 3QYEA 1B8IB 1S6QA 4L59A 4FWNA 2DIGA 1VSKA 3OA6A 3VTIA 4DKWA 1UCRA 3NQOA 3U9GA 2Z99A 4N0BA 2L2OA 3UKRA 5AQMA 1NEBA 1OEBA 2MD5A 3F70A 3LP3A 1OX8A 1QLYA 3LP0A 2DLLA 1X58A 1UGVA 2YLBA 5HLHA 4JRQA 1V76A 4JEPA 3RMBA 1BW6A 4E6KG 5K7FA 2K9NA 5LJ5j 3CCEI 5GADJ 4E9EA 5LGUA 4I9LA 4B9LA 5JLWA 1ABOA 1WFXA 1BWFO 1VF9A 5M5XJ 2FBTA 4BHBA 3DM2A 4WK8F 2PTKA 4Y3OA 3ISNC 3I55A 2H1LA 3W3DA 1S29A 4N4NB 4EVIA 2ZJPF 1Y0MA 4K41A 4OKJA 1RUOA 2IPQX 4DYCA 2JXBA 5C42A 4FT4A 1ASUA 1FOKA 1HXDA 1AT1B 1I5OB 2R7XA 3ZT4A 3OSSC 4LK0F 2HBMA 3MPUB 2ZE2A 1PJRA 4DQPA 2DJIA 4CBWA 2F5FA 5ADXH 3RQIA 2YX7A 3WTVC 1RDUA 4LDVA 1GLEG 2HSEB 2D2WA 3RSEB 4YELA 3C94A 1GL5A 3JAMK 5IOZA 2ZSIB 2D45A 4QQDA 1JLCA 1VQPN 3CWSA 3DXJF 2J7IA 1KQ0A 1RDBA 4B1XB 5CK9A 4B09A 4HV6A 3A1YA 2OUMA 4BKXA 1MJ9A 3GTJJ 2W10A 1WJFA 4ENKA 2OC6A 1ASVA 3KEQA 2VUBA 3ZT2A 2HWVA 3A01B 3UE5A 1FMWA 2EJGA 1WQWA 3OQ5A 1QVTA 1RRSA 3CC2N 2CV1A 4XTWA 1X4OA 2Y0SN 4C2TA 4RBOA 3M07A 3UATA 3CC4Q 3AAFA 1M1KC 1MBFA 4KULA 1SAUA 3TEDA 2RHUA 3ZEUA 3SBGA 4FWKA 4YFUA 4A3DJ 4M7AA 4RCHA 1WAFA 4YRVA 3QFPA 1VIFA 3TP3A 3J81O 1VQ5Q 3WU0A 1K8AR 2CT4A 2ZFUA 4OKKA 4CZZA 2JNGA 4FJ7A 4CJ4A 1A6IA 3A1PA 2YJEA 2J5OA 4O44A 3ZXSA 1U6ZA 1BU6O 3CCVT 3GZ6A 4BE2A 3J7AP 2AA4A 4FJIA 4B6MA 2QSGX 2RHYA 3LZJA 3SEMA 3KVGA 4BC3A 5MLCQ 3G4SI 1UG0A 5DLQE 5D6XA 2JGUA 2AO9A 5DCFA 1XGNA 3PQJA 4IG0A 4FJGA 4AI5A 4E2FB 4PGHA 2WY7Q 4RGUA 2JWTA 3K2AA 4JS5A 3F72A 4QKUA 4C0DB 4H0XB 3OYKA 1VQ6A 5J1EA 2BHYA 2E2IJ 4EDUA 2D1HA 4C8LA 1N6AA 2LSNA 2QVOA 4GCVA 1U2WA 1JGSA 3NF9A 3Q9SA 3WXJA 1UGQB 2QEXQ 2BYVE 2YLCA 2HBWA 2E60A 4GNIA 4JK7A 1JLQA 1IXCA 2QQSA 2M9UA 4A2AA 1YITI 1I1GA 2R7VA 3G4SN 4NC6A 1ZYRF 3GW2A 4F52A 3MMYB 1W9HA 1KTQA 1Y8QB 1DP3A 1B72B 3WU2C 4A69C 4J9GA 3VU3C 3CCRT 5ECAA 3VEZA 2YJFA 3HSCA 3QINA 4X1VA 1OZ2A 3K0SA 2P9IB 4R8HA 2KVQG 4ID1A 3DLLA 1YT3A 1Q81C 3LANA 4FYWB 2C0IA 1A36A 3ZMDA 5IHKA 4QOZB 3IKTA 1VQKQ 3KE2A 2X4WA 2R58A 2DJNA 3SV4A 3CP8A 1ZSZA 2E71A 2L0KA 4KI6A 4BI8B 1VQOA 1TK0A 1F1ZA 3PX6A 1K6YA 2DRKA 1XHZA 4F8RA 3S2WA 2L3SA 1XJWB 4X6AJ 4G1QA 2DFIA 2CJJA 2M1BA 2V1RA 2H09A 4YDUA 5KTQA 2HYJA 3ASNH 1G5VA 2OTJA 1XUPO 3C6HA 1Y07A 1CF7A 5HK0A 2EA2A 3C7JA 4CCOA 2HL3A 4E89A 2DXIA 4QQ6A 3WNEA 2QI2A 3LL7A 1WBDA 3K4BA 4GGGA 4CE9A 4LF6K 3F23A 5FROA 1Z91A 3WGHA 1KC8R 1J54A 4DFPA 4G7ZF 1T0JA 5K7ZA 2QK0A 1J2XA 4A57A 1A5WA 3ZMVA 2H3GX 2FOWA 2X1CA 3CC7I 3RR7A 1YJ9I 3ZQHA 3QQAA 1I4K1 5LHHA 4KDPA 2LCSA 3CCSQ 2EZKA 2CMPA 2WV1A 4XN0A 2L4AA 3DLRA 1VFCA 1P7MA 5HK3A 3CXCA 5LMNK 5K14A 5GJWB 4C92F 1KQSP 3ULEA 4CJUA 1ITGA 2QLZA 5AQSA 2RAEA 4CZFA 1D8YA 4QWQA 2SRCA 1FMKA 1QRYA 2E7WA 4BXXJ 1AA7A 3WE2A 1U8BA 4JLGA 3CC4T 4GRIA 5GAGP 3NHNA 4CJLA 5GAOq 3SWNB 4EMKC 1K73C 4HX8A 2HHSA 1OYYA 3R6MA 1HDPA 5A0GA 2O8DA 2XAHA 1KU7A 1GLFO 4B4CA 1VYUA 4FWSA 3CMEQ 4E4HA 1NK7A 5M3MJ 3CJTB 2CH4A 2QQ9A 1OCRH 5CHIA 5LJ3e 2KLOA 4B9XA 5L3DA 1K79A 2NRTA 3C0CA 4ZYEA 2RJCA 2A28A 3P9CA 1K83J 3PGGA 1ZRCA 2R57A 4ESJA 1X2QA 2CQ7A 4CFAA 5LL6Z 2HNDA 4CJKA 2BW3A 4KNYA 4HWIA 1I5ZA 4HDVA 2EPFA 2AQEA 2OBPA 1VQPA 2M34A 3CCEA 3MEXA 3IC7A 3IUOA 5GAOp 3DLEA 1WSEA 2RI5A 4JI3K 3MMVA 4FU6A 3WEEA 2W40A 4RA2A 2ENMA 2R5AA 3HSRA 3NDKA 1QWEA 4A3FJ 3H6EA 1MNDA 2B86A 4KBMB 2E6MA 1Z21A 2J05A 3MWPA 2Y0SA 5CAIA 2Q1ZB 1PU8A 2OCCH 2RN8A 1J5EK 3PSFA 2WSFE 4JKGB 2QEXT 4KH4A 3MN9A 1QQIA 3LSPA 3A8MB 3EUAA 3GEZA 2R7DA 1HKCA 2MD0A 3HGGA 4Q47A 4PKIA 3DLKA 2YSQA 2YU3A 5IY5H 2P9NB 3H9QA 1LWYA 3CXCM 4IRIA 3VOEA 1F5TA 2E12A 2Y2ZA 4JKBA 1FJLA 3H0IA 4HF1A 1FTTA 2VBWA 4I7HA 2JTMA 1Z9QA 3ME9A 5DK5A 1N8RR 4GYIA 4CZJA 5BPLA 2C6YA 1U5SA 4GY2B 1J5YA 3GFLA 4OFEA 1NJIC 3O4QA 2YUPA 4BXUA 2QQRA 4FWRA 3PFYA 1S1WA 2KL4A 2LP5A 1D9DA 2O8BA 1I1JA 1VQKT 3I64A 4G9ZA 2G9WA 2OZMA 1FK9A 4DR4K 3ZSWA 1P6RA 3VYRB 2KGTA 1XCVA 2CUJA 2MCNA 5AZJB 4RAZA 3ZSQA 2LREA 3QP5A 1DU0A 1CKBA 1KFSA 3I59B 1VQLQ 1N36K 3H92A 2NRWA 3THXA 2R4GA 4ZYDA 4M75G 3CCQN 5IYBJ 4OO1J 4XONA 1VQMQ 2RHXA 1MMAA 2PLYA 2OPRA 1QE1A 3R3LA 1X3NA 2FBXA 2BZTA 1T6SA 3V8KA 1QS4A 3ABTA 3EGDA 3HOXJ 2ZXWH 4YY3K 5LHIA 3CF5L 2DL8A 4MFDA 5DUIA 1I3AA 4CCKA 3G25A 4X34A 4OINF 1YI2N 4F7UG 3AVCA 1LUJB 1D0YA 3VGKA 2DERA 2V9KA 3H0FA 2CRGA 2B4JA 3T3FA 5BNGA 4PKCC 3G4SA 4HPQA 3DKMA 3HUGB 1Q95G 1IRXA 5IPAA 3A4CA 4NQWA 2DX1A 2UU9K 3V7RA 3CCST 4ESBA 2HNIA 2MPXC 4PJJA 5F1JA 1K76A 2JRMA 1HX1A 2FD5A 2BE9B 3WHBA