4ZTJA

Crystal structure of the prototype foamy virus intasome with a 2-pyridinone aminal inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title Discovery of 2-Pyridinone Aminals: A Prodrug Strategy to Advance a Second Generation of HIV-1 Integrase Strand Transfer Inhibitors.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna/inhibitor
total genus 103
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4ztjA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4ztjA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ztjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ztjA03
4I7FA 2IGIA 4Z4CA 4M3YA 1Q8IA 3Q1JA 4N4GA 4CHZA 2GF7A 5C42A 3EAEA 1TKTA 1RT6A 3I8DA 2QQRA 3OYBA 4IG0A 1SV5A 4FLVA 3OS2A 2B6AA 2DY4A 2DIQA 3SUOA 3RMDA 4CJWA 4CHOA 3MXIA 2E6MA 3V9XA 2HHTA 1RBTA 2G3RA 1S1WA 1WN7A 3K5LA 2G8KA 2YHAA 4A4FA 3SZ2A 4DFKA 2GBZA 4F2SA 4N4IA 1REVA 4FW2A 3VQBA 3F70A 1LW0A 4CIEA 4ZTFA 1RT3A 1UA0A 1X9SA 3L42A 3TR8A 2Y1JA 3KUFA 3HPGA 2KZMA 1XHZA 2RF2A 4F8RA 1LW2A 3VQAA 4EDUA 1VSKA 5JS2A 4E7JA 2RJDA 4Z4IA 1S9EA 3SQ2A 1KRPA 4E1NA 3B6PA 3ASKA 4FXDA 3OYLA 3A2FA 3O4NA 1HQEA 3M8RA 1U45A 3DLHA 3DLGA 1RBUA 3SYZA 4PA1A 3IRXA 1Q9XA 5DMRA 1LWFA 4I9QA 3DLEA 3MP8A 3KK1A 3LH0A 1DTTA 4IUTA 3ZSWA 4E3SA 2FBXA 2HVIA 2O4XB 3NGYA 2L8DA 4B8AB 1HYSA 3T1AA 3OY9A 3ZSXA 4CGJA 4CF9A 3D45A 4IKFA 5T7BA 3ZT2A 2DFEA 4DS5A 2HMIA 3QNOA 3OJSA 2RI5A 3AVIA 2RN2A 4CJSA 3LGLA 3PO5A 1CZBA 3RTVA 5I42A 3V9ZA 1GOAA 1Q9YA 2QKBA 1EXQA 1A5XA 2RHZA 2P0KA 2GUIA 4O44A 1WNSA 2Z1JA 4OLAA 3VQQA 3QLHA 4KPYA 1WSIA 3QEVA 3RRGA 3EY1A 3ZSYA 3CM6A 3EYZA 3QKJA 3HXMA 2X4WA 3UWNA 4DU1A 1S1UA 3AVJA 4PL6A 2Y1IA 4EP4A 1T7PA 3V1QA 2X74A 1NK8A 3O4QA 4CFCA 5HLFA 4KREA 3DRSA 3QIPA 3VQEA 4KFBA 3SCXA 4N47A 3S3OA 2FHDA 2RJEA 3H6ZA 2D9TA 4IURA 3O3GA 1J5OA 4G1QA 4W5RA 2R58A 1WJQA 1TK5A 2RHIA 3DB3A 3OYGA 4CECA 4JRPA 3QO9A 4FZZA 2R57A 4DSEA 4B9XA 2RKIA 4CEAA 4KHUA 2RHUA 4NYNA 1RCHA 3AO4A 5KCOA 3MEUA 2M1HA 3LWLA 1RTIA 3K58A 3DLKA 2G8WA 1IG9A 1QE1A 4HHTA 3F9KA 2F96A 3MP6A 1TGOA 3LP2A 2OPQA 1ZBHA 3P1GA 1HJRA 1R0AA 1RT5A 4AHSA 1O1WA 2PYLA 3OJUA 1NJZA 3SPZA 1U49A 2EFIA 4B9MA 2X35A 4CJ3A 4QCLA 3AO3A 3KJVA 5C25A 1TVRA 2FC0A 1NKEA 3U6FA 1KFDA 4M3RA 3WNGA 2O4GA 1VSFA 1TKXA 1W0HA 4AHRA 1L3SA 4F4KA 5D6WA 5EU7A 5J39A 1KHCA 3LPUA 3SQ1A 2MWOA 4DQSA 4CEFA 2VG5A 4ID1A 5J2NA 4KB0A 1XNIA 3AVKA 2Z1IA 4ZTJA 4JLHA 1NK9A 2XRIA 4I9LA 2X4YA 1TAQA 2O4IA 4CEZA 5KGXA 4CFAA 5J2QA 4QVZA 1TAUA 2QK9A 1J53A 3P8DA 2Q3SA 3SUQA 3HP9A 1X9WA 2G8IA 4Z4HA 4PLIA 4CEQA 3ZT3A 5KGWA 3OVNA 4Q5VA 4E7LA 4IDKA 4LD6A 3KK3A 1LV5A 1BCMA 4FZXC 5KI6A 5J2MA 1ZYQA 1SUQA 2IDOA 1ASVA 2RHXA 1YT3A 3C6UA 3L2QA 2QXFA 3K5MA 3O8VA 4BWMA 2EQMA 3GOXA 4DU4A 3ALYA 4JS5A 5J1EA 3LYIA 1LAVA 3M8QA 1C1CA 5KE2A 4FVMA 4KRFA 1IKWA 4HCBA 3S9HA 4DU3A 4FK4A 1S1TA 4KAZA 1WAJA 4QAGA 2RI2A 1JLCA 3M8PA 5HRNA 4KHWA 3AA2A 4OPKA 3SV4A 4DTPA 4I2PA 1HRHA 5CY4A 3SV3A 3K59A 2PY5A 5C24A 2KQ2A 3QBYA 5KH6A 2ZD1A 4FJJA 4FK0A 3RWUA 1IKVA 3L2VA 4KHNA 3L2RA 4GY5A 5CZ2A 3OYEA 2M16A 2D0BA 3VQDA 1CXUA 3NGZA 1RNHA 4N4HA 1B9DA 2NLUA 4KTQA 3MXMA 3TWHA 3FC3A 1HMVA 1MHNA 3OB9A 4DQQA 4KI4A 1C6VA 2YV0X 3P8HA 1NKCA 3KIOA 4IFVA 1D5AA 2VWJA 3LGFA 1W9HA 2WOMA 1KLNA 5D6XA 4HUGA 1FKPA 5FROA 2HQEA 1WJSA 1BCOA 1LAWA 2P51A 3C6TA 4NS5A 3TAQA 4KO0A 1B9FA 4DSKA 3OYCA 4WE1A 1GOCA 3CM5A 3NH0A 3OA6A 1C0MA 4IUQA 4L59A 2Z1GA 3AVBA 4E0DA 4F3TA 4FL6A 1MU2A 4DWIA 1HQUA 1RDBA 3TANA 1FK9A 4FJ8A 3NTKA 3PO4A 3HPOA 4UQGA 4MFBA 3DYAA 3ZSRA 4BDPA 2EQUA 4B9VA 1HYZA 4CESA 2RJCA 2IOCA 4KHQA 4KKOA 3NF8A 3LP1A 1S6QA 1SKRA 3ZEHA 2XK0A 4OKEA 3NH2A 1OI1A 3NNQA 4ICLA 3VQ7A 3DLBA 3FDRA 4CF1A 3CQ8A 4CF8A 1JXBA 1S6PA 4DMNA 3AA4A 4FCYA 4KHSA 1JXEA 2VWKA 3C4SA 4FJLA 1ZBLA 3OYKA 4CK1A 1S5JA 3RMAA 5K14A 2QKKA 3JYTA 3L3UA 2L89A 1K6YA 1J9AA 1X9MA 5E41A 4II1A 3ZT0A 3TAEA 4Y1DA 4PQUA 2RPIA 3QETA 3MEGA 3CFPA 5FDLA 1GOBA 4CJKA 2D5RA 1WAFA 2A1RA 3SQ0A 4C5GA 4CGFA 1ZBIA 2OA8A 3MXJA 1VSJA 4DG1A 3LWMA 2OPPA 1JLQA 3S3NA 4FLWA 3QERA 4AH9A 4B3OA 1WSFA 5SZTA 2HNYA 4HVJA 4BWJA 3K5NA 1QS4A 3CFOA 3AVNA 3L2UA 1NK7A 1RBVA 2X6NA 2BANA 4FJNA 3G0ZA 3VQPA 1L3TA 4EP5A 2LDMA 1UA1A 3ZSQA 3PMIA 3AA5X 3QEPA 3L8BA 3CEYA 4CK3A 3MEWA 4DTJA 4C8MA 5KE3A 1QSLA 2BUDA 5HRRA 1VSLA 3IS9A 3K57A 1X1PA 4DF4A 4CFDA 4PWDA 2R7YA 1CZ9A 3PX0A 4B08A 4M3XA 1RTDA 3SJJA 2KFZA 3KTQA 1BQNA 5J2PA 4M3UA 3QNNA 1CLQA 3NGIA 3OYNA 2HVHA 4DTNA 2LTOA 4KI6A 3V1RA 2O4XA 1RBSA 4LY7A 4AILC 4FM1A 4I2QA 1D9FA 1TK0A 3ZT1A 2F8TA 2F5KA 4CRIA 3H08A 1KSPA 4E19A 3CYMA 3LAKA 4KV8A 3RRHA 1DLOA 3VQ6A 2LCCA 2NUBA 4CIGA 4YNQA 3ZT4A 4DTUA 1WLJA 2YKMA 2XY6A 3C95A 1N5YA 4DTXA 2HHXA 2R5MA 4HCZA 1JL1A 2B5JA 4FJ9A 4ELUA 3QEWA 2HW3A 3IG1A 3V9UA 2GFAA 5FRMA 5CIUA 2HB5A 4N41A 2AJQA 2YNHA 4E1MA 2XHBA 4DQPA 4CJQA 3O3HA 1SL0A 3HVTA 4TSXA 2YNFA 1BI4B 4W5NA 3QEXA 4Z4EA 4Y1CA 5J26A 2G8HA 4CJ4A 1RILA 3DOKA 3LP0A 4E7IA 4GW6A 4QW2A 1T03A 2ZQBA 1RDAA 4OVLA 2RI3A 4J2AA 3LAMA 4DFMA 4M3ZA 4E89A 3LPTA 1YVUA 2HHUA 2VG7A 2XY7A 1RT1A 4OLBA 3OMGA 3SUPA 2VYTA 3QIOA 3OYHA 1NJYA 4FZYA 4DLEA 1WSJA 1UOCA 1WSEA 1UWBA 3HSTB 3OQ5A 1WGSA 4KHYA 3DRRA 4ELTA 4DS4A 1KFSA 4H4OA 3KD1E 3QESA 3OYIA 4DTOA 5CZ1A 4C5IA 3AO5A 3HK2A 3TARA 4OKKA 5KRSA 3RR8A 4N5SA 2RHYA 1RT2A 3AO1A 3AO2A 4CEDA 1LWEA 2PQWA 2CKKA 4CERA 4DTSA 1T05A 3NCIA 2DFHA 1L5UA 1SL1A 4CHNA 3AVCA 2P1JA 2HNZA 2OYQA 4O0IA 3P5JA 3QJ6A 4M42A 1YTUA 3TABA 2KW4A 4CIFA 1ZBFA 4CCHA 2JZ2A 2K3YA 3WNEA 3AVMA 1VSEA 2XO7A 1KVBA 1H3ZA 3ZSVA 3L3VA 2MWPA 4OKJA 1NKBA 3V9SA 4AHUA 5HROA 3KK2A 3LDSA 1HNIA 2LVMA 3T3FA 2OZSA 3WNFA 1RBRA 3HT3A 1NJWA 5IN1A 4RW4A 4CJVA 2BKDN 3PNWC 1IH7A 1DTQA 3U3GA 2EQJA 1N27A 2WONA 4B9SA 4BDZA 1VSDA 3UIQA 3OYFA 5CYQA 2VG6A 1EX4A 4OJRA 3DB4A 2OZMA 3HJFA 3E9GA 4RW9A 5D3GA 3LZJA 4O5BA 3PV8A 4GVMA 3DM2A 3SUNA 2EKOA 5SWMA 1SKSA 2BE2A 4FYDA 1JLEA 3TI0A 2IG0A 2HHSA 4J2BA 3PMTA 1ASWA 1VSIA 1RTHA 4QOZB 4RW8A 1TL1A 4ELVA 3AVLA 2B4JA 5CYMA 4IUUA 4FLTA 4C8OA 3FEOA 4HCCA 4J2EA 3ZSOA 3HM9A 3KLHA 3PX4A 4FJHA 2M0OA 1U47A 1G15A 3ULDA 3DRPA 5HBMA 1A5WA 3MECA 3B6OA 3D0PA 3I0RA 5KTQA 4OVAA 4K8XA 4CHYA 4CJ5A 2FBTA 4PLLA 4B9LA 4RW6A 3UT1A 1WJRA 3CG7A 4GMJB 4CJEA 1XC9A 1C0TA 4IG3A 1SKWA 2HHQA 2HNDA 1VK0A 2WACA 4EZ6A 4HTUA 2LRQA 3VQ8A 4KB1A 4MQ3A 2ITGA 1NOZA 3RMBA 1Z25A 3RMCA 1KVCA 4IFYA 3OYAA 3THVA 1C0UA 4CEBA 4X34A 1IKYA 1KTQA 2D0AA 1TKDA 3OMCA 1NK4A 2KTQA 1QQCA 3MEVA 3KLEA 4CJRA 3U3YA 1D8YA 1ZBUA 2X78A 3KKSA 2YKNA 2K3XA 4NCBA 2XY5A 1S1VA 3ITHA 1BIZA 1U04A 3AV9A 4L8RB 3PY8A 4FJKA 3ZSZA 1SL2A 3SQ4A 1WSGA 2ETJA 3S6WA 3HPHA 4CHPA 2JLEA 2BIVA 1I3AA 3NBPA 5KCHA 1TK8A 4OGEA 2LSNA 2YNGA 4FLUA 4CJFA 1VRUA 3NTIA 4CEOA 4F3OA 2OPSA 2RO0A 1OYXA 4RG2A 5KRTA 4Z4FA 4A4HA 1XWLA 2BGGA 1QTMA 3HVRA 1FXXA 1JLGA 3TAFA 4C5HA 3NDKA 1NK6A 3HL8A 1WSHA 4CGDA 4RW7A 4B9NA 1BHLA 3E01A 3K5OA 3IAYA 4E7HA 1JLFA 3DI6A 3AVGA 2ATQA 2P5OA 4Z0UA 1RDCA 4CF2A 4C5EA 4QQ6A 4LH4A 1EP4A 3L2WA 3HO1A 4O55A 3HYFA 1OZ2A 1KLMA 2IC3A 4FM2A 2OPRA 3NFAA 3KLFA 3VN5A 4QQDA 3O3FA 3LLRA 3NE6A 2X6SA 1JKHA 2YNIA 4FLZA 4FLXA 3SPYA 3G10A 3SD4A 5HRSA 2PZSA 2P5GA 4CJTA 3NAEA 1L3UA 2DTUA 2DFFA 4CFBA 3PFSA 4DTMA 4B9WA 4FJMA 3F73A 2FBYA 1QSSA 4CF0A 1NK5A 4CGIA 3K2PA 4IBNA 1C1BA 3BGRA 1UAXA 1YTAA 1NK0A 3NH1A 3VA0A 4FW1A 4A4EA 2GV9A 2B8AA 1ITGA 1S1XA 3MEDA 4UC4A 4IUVA 1JL2A 3QEIA 4N76A 4BE1A 1IKXA 2EX3A 3KKRA 3TAGA 5M9OA 4E7KA 3SNNA 2EHGA 4BD3A 3E9FA 4FJ5A 3VQCA 5IAYA 1B92A 4PY5A 2I5JA 4O4GA 3M9QA 4AHVA 5C6SA 4F2RA 3AVHA 2E4LA 4B8CA 2Z1HA 3P83D 1RI0A 2YHBA 2XDPA 3EZ5A 1U48A 3VA3A 5D6YA 1QHTA 2D0CA 3V6DA 1RTJA 3NTHA 4Z02A 1CXQA 4ID5A 3OYMA 4FK2A 2IS3A 3AA3A 4AHTA 3VQ9A 4QQGA 3FFIA 3BDPA 4KTZA 2W42A 4CJLA 1BQMA 3SI6A 5C0MA 1OZ3A 1HPZA 1N6QA 4YFUA 2IAJA 3MAQA 2DIGA 4CJPA 3CFRA 3NHGA 4Q5WA 3V4IA 1BI4A 1T8EA 4NCGA 4C8LA 4R5PA 4FJ7A 3AVAA 1L3VA 3QINA 4NZGA 1EKEA 1C1AA 1VRTA 3LP3A 4H8KA 1RT4A 2JGUA 2E6LA 3OYDA 3ME9A 4Z4GA 3WNHA 3FLGA 2ZE2A 3V1OA 4H4MA 1ASUA 4BE0A 5FRNA 4FJIA 1BIUA 4M3TA 3DLMA 2GFUA 4K8ZA 4LSNA 1HNVA 3V9WA 3KLIA 4BACA 4Q0BA 4PUOA 1IO2A 1BISA 1BL3A 1Y97A 1FKOA 4CJUA 1RDDA 4CGHA 2KZZA 3KLGA 2YRVA 4XIUA 2F8SA 4DSIA 3LZIA 4CEEA 1J54A 4NCAA 5I3UA 3DLRA 3MP1A 4N56A 1JLAA 4DFPA 2L3RA 4DSJA 4DQRA 4W5QA 2QQSA 1Z26A 2HHVA 4FJXA 4A4GA 3OS1A 1XHXA 4CE9A 4HUFA 1I39A 2E6NA 3S3MA 2PYJA 3ASMA 4CHQA 3PUFA 2HQXA 4DFJA 1XI1A 1RT7A 3RR7A 3I0SA 3JSMA 4BDYA 3QIIA 3META 4DTRA 3VQ5A 2G8VA 4B9TA 4IUPA 4EZ9A 3MEAA 2A1SA 3LALA 4DSFA 1QSYA 1KCFA 4C8KA 1VSHA 4OPJA 4LSLA 5JS1A 4ZHRA 5DK5A 1U4BA 3MO8A 4JS4A 1TL3A 2X4XA 1EETA 4AHCA 2DAQA 3VQ4A 3NF6A 3T19A 4HUEA 2G8UA 4B9UA 4M41A 3OYJA 3MEEA 4FJGA 3NF7A 4M45A 1HYVA 4M3WA 4JRQA 2XY8A 3DMJA 2HHWA 4C8NA 3KD5E 2G8FA 3V81A 3AVFA 3TAPA 1TV6A 3PX6A 2BDPA 4OGCA 4CK2A 4KTWA 3BDLA 4O0JA 4J2DA 4LH5A 1LWCA 1JLBA 1G5VA 3DOLA 1VSMA 2JTFA 1F21A 1NJXA 4DSLA 1TKZA 1D9DA 3LANA 3HP6A 4FM0A 3H8ZA 1S9GA 4LD0A 4W5OA 5HP1A 4FU6A 2E5QA 4NYFA 4RG8A 1SSFA 1BGXT 2KFNA 3TAMA 4CGGA 4FLYA 3M8SA 4DF8A 3C94A 3ISNC 2R5AA 2RJFA 4DLGA 3OS0A 1A5VA 3LX7A 2EQKA 1NOYA 5HRPA 2FBVA 4BE2A 3NF9A 1KVAA 4DQIA 3ZCMA 4W5TA
chains in the Genus database with same CATH superfamily
4HCKA 1GBRA 1P9QC 2IGIA 1K76A 4CHZA 4JDSA 2J6KA 4X9DA 2OI3A 3OR2C 2NRHA 3CCJN 4C92G 3EAEA 2DW4A 1TKTA 2BW3A 1RT6A 2EINH 4FLVA 3OS2A 2R5ZB 5DUKA 4IEJA 1T39A 2B6AA 1VQ8A 2DIQA 1MGQA 3CI5A 2CGPA 4C3JJ 4Q4ZF 4JZ4A 3DEEA 5DD8A 4CJWA 3LSIA 5C3EJ 4CHOA 4RAZA 4M77B 4H0YB 2HXIA 1BM9A 1RBTA 2G3RA 4I98B 4C8QC 2AHQA 3KEQA 3WVEB 1VQ5T 3K5LA 1K79A 1K8AO 4A4FA 1FYKA 4E9GA 4GXOA 4CC4B 5DS9A 3CCVN 2K4BA 1IW7F 3VQBA 2M34A 1KC8R 3NMUA 1VQKI 1GXQA 5J1YA 1PU7A 4NO7A 2LREA 1RT3A 1UA0A 3HTRA 2KISA 4CZLA 3L42A 3AG2H 3TR8A 4ANJA 3CQYA 3H9GA 3R6OA 1XHZA 1XN7A 2LY1A 4BUGA 2ZWHA 1RRJA 2COYA 4RGRA 3KE2A 1VSKA 1HSTA 5FWBA 4E7JA 4PNOA 2WSFE 5K7FA 3SFIA 4Z4IA 1KRPA 2O8DA 4BY6B 1TW2A 1K9MU 3CCLN 4I09A 3M1CA 1ON1A 3OYLA 3DTIA 3T0YA 1N25A 2YU3A 2ZMEC 3BROA 1YI2I 4DOVA 2LNVA 3G73A 1UTIA 4DEXA 3M8RA 3IAM2 3GUDA 2JM8A 3IRXA 2HBWA 4F7UA 4JKBA 5B3SH 1LWFA 3KK1A 1OFCX 3LH0A 2JJ9A 4HBLA 4Q5SF 2BOLA 3SWNA 4M7DC 2O4XB 3R0JA 1O7LA 2QTDA 2NAZA 4Y17A 5I9EB 1QMCA 5GAMg 1D8JA 2IVMA 3ZSXA 3SFMA 4XU0A 4M4ZA 4CF9A 3D45A 4IKFA 5FLVA 2HD0A 2H6BA 4M77E 1AHJB 2DFEA 1VQPN 4FETA 1Q86O 3F6VA 2ECBA 1YCSB 3TDUC 4XTZA 2HMIA 1IXSB 2ESNA 3RSEA 1RRSA 1FY7A 1TUDA 2KRSA 4F9OA 1PD1A 1ZSGA 2RI5A 2RN2A 2R7WA 2H8HA 4XORA 3LGLA 1VOMA 3SMPA 3RTVA 3RKXA 3QPTA 1X6BA 1FBUA 3V9ZA 1GOAA 1XC5A 3QP5A 3S1NJ 2RAEA 1EXQA 2EBIA 3SQNA 3VQQA 2GM4A 2R5YB 4KPYA 3UDCA 3EY1A 3ZSYA 2JPCA 2CH6A 3EYZA 4KGXB 5I11A 4IO9F 3OOUA 2X4WA 3PIOA 1A5JA 4V2FA 2K7AA 3Q0WA 5LRRA 3G4SQ 1YI2T 3AVJA 2E1YA 1NK8A 4JAXA 4CFCA 1EA3A 2DQRA 5HLFA 4CD1A 3QIPA 1YBYA 2QWWA 1VZ0A 3IH3A 4WF2A 3VEOA 2AKKA 1Y96A 2FU4A 3V7CA 3P39A 1G6NA 5M1PA 1IHVA 2ME6A 4BREA 2O8EA 2FHDA 1YITN 4IURA 5D7UA 1ZUYA 2XRLA 2KKOA 1WBBA 1TK5A 2NRRA 2RHIA 5F64A 8AT1B 2ZBKA 4CECA 4PJOD 4FZZA 3F9MA 2J5PA 4JK7A 3H46O 4OO1J 5E1XA 1CZAN 4CEAA 3FHGA 2RHUA 1JU5C 4AIHA 2LZ6B 1RCHA 2COBA 3KFVA 5C44J 4HOBA 4XAXB 4ENJA 2X4JA 4KH0B 4IRHA 2YT6A 4J6WA 1N3CA 1FBQA 2DXTA 2X4HA 2HMPA 4QS9A 2QSHX 1QE1A 3F9KA 3G1MA 4GRIA 3ATUA 2EYYA 5AQRA 3CJ9A 2CP2A 1Q82U 1TGOA 2NRVA 3CCVQ 4M3DA 2P9PB 4EMKA 5J8FA 2ZPIB 4MFEA 1FT9A 3MKYB 3NWTA 4OB0B 3OJUA 1NJZA 3CCMA 5GMKl 3VEXA 1FNNA 2EFIA 1N9RA 1T3LA 4XL9A 5BQTA 4QCLA 2M0CA 5DD4A 5C25A 4A3JJ 4EPCA 2NOLA 4YDUA 1AA7A 1KG4A 4NB5A 2O4GA 1T2KA 3CCLQ 1HK9A 3ESWB 2I2LA 1TWGJ 3G4SI 4F4KA 3E5QA 4A54A 3F0CA 5D6WA 5EU7A 1KHCA 2O3FA 4HA8A 3SQ1A 2MWOA 2QVOA 5TGTA 1SEMA 5LJVA 3RZDJ 2LT4A 3CPWA 3BZ6A 4L9NA 4Y92A 3QODA 4DA4A 1S9HA 4LMYA 2M4KA 2E5KA 4NC7A 4KJZA 3S2HJ 4I9LA 2X4YA 3M5AA 2ZNZA 3VS6A 4EGZA 4LDUA 1SD6A 5GAHJ 5J2QA 2ISYA 1APLC 4QT7A 1E2XA 3CBMA 1E3HA 2LP0A 1X9WA 4PLIA 3ZT3A 4M78E 3BJOA 3W6JB 3SZTA 3KPHA 4M75F 5KGWA 3TQ7P 4E7LA 4IDKA 1VQPQ 3KK3A 3WE2A 5A2QK 4FZXC 4CZFA 2UUAK 4HX4A 3BPXA 4IHVA 4F3QA 1GLNA 5J2MA 1IGUA 1SUQA 3LSTA 3E1YA 2ED0A 1ASVA 2VYPA 1HKQA 3SK3A 1K4SA 3O8VA 3A98A 4L3QA 3ATVA 2LSOA 5EJCA 3O8MA 3CCVI 1FWZA 4A3GJ 2H3EB 5BPDA 1MJ9A 3GVAA 3VEWA 2H8WA 1BIAA 1IKWA 4LF9K 1K9MC 4DU3A 2Z99A 1E17A 5BNGA 4IXCA 2P84A 5GAMd 4LOCA 1WUAA 2EJFA 4QAGA 5GIPA 2JRMA 3C3WA 2FEIA 1AWXA 3AA2A 2EZLA 1ZSZB 2F6CA 3JCMV 3VEYA 3SV4A 1PUEE 1G83A 3I5UA 2FL7A 4I2PA 1EH8A 5CY4A 3K59A 5L3GA 4HNTA 1JJ2P 3WU1B 1FBSA 4I6MB 1WKMA 4C8QG 3CCLI 2HQRA 1H641 2UUCK 2F4MB 3CJBA 2J7IA 1IKVA 2CUFA 2XROA 4KHNA 1HJOA 4PHTX 2K2VA 1YITQ 3JCMe 2DRKA 2QA4N 5ICFA 5E26A 5AIQA 4LD9K 2O88A 4GY5A 4A59A 2M16A 1CXUA 5BPNA 2D1XA 1OCCH 1TYQB 5LJ5e 1QQMA 1EH7A 3MXMA 4YIRX 1VQMN 3THWA 4XR6A 4DQQA 4C8QF 4KI4A 3VYTB 1XSXA 1NKCA 2W40A 1IAWA 4IFVA 3R6MA 1X27A 3FBIB 2B0LA 1U84A 1W9HA 1OPKA 2I7NA 1VQPI 2WOMA 5D6XA 3CC2A 4BQNA 4HUGA 1YFNA 2WFBA 5FROA 1ZXOA 1A04A 1BCOA 1V5GA 4ESRA 1HLVA 2P51A 3C6TA 2LQKA 4KGZB 3H5NA 2E65A 1B9FA 1OU8A 4WTOB 5DTDA 3NH0A 2ESHA 5F0FA 4L59A 4JI8K 4M7DG 2IXSA 4C1NK 2HAXA 1YX5A 1MBJA 3TSZA 3DEUA 2NOEA 3CCMN 2VT2A 1ETVA 3PO4A 1JUSA 4MO5A 4UQGA 2A5WA 3DYAA 4BRPA 4I0AA 4BDPA 1M1GA 4B9VA 2YR2A 1HYZA 2FZGB 5AQJA 1QVGP 1EBMA 4JLGA 3NF8A 4RUGA 2AKLA 1HCRA 2K27A 2EW3A 1CGPA 3ZEHA 2KNBB 3K7AJ 1S3XA 1OI1A 2CUJA 3NNQA 1PJRA 2GBQA 3VQ7A 4CF1A 1JXBA 4M7DF 3J7AY 2K5LA 4NOYA 3TEDA 3T8TA 3ISPA 2NVQJ 4C92E 2CRGA 5HY6A 1FSEA 3G6EN 3U9DA 4DR1K 3RMAA 1Q82C 4AFUC 3JRAA 3I56T 3L3UA 2DPPB 1UZCA 1K9AA 4RTWA 2XKOA 6PAXA 2CYYA 1B07A 3PM1A 1BU1A 1BI3A 4KBOA 4AM7A 2H6CA 4OMOA 5HKCA 2DYBA 4Y1DA 3OHRA 3A8MB 3HOVJ 3UF4A 4JPBW 4RM2A 1FC3A 1D0XA 2F5VA 1VQ8I 2JT1A 4LG0A 2KFDA 1ZRDA 3KETA 3MMVA 3CLOA 4JI5K 1A6IA 3CTAA 3M0SA 2CGJA 2B63J 4CGFA 4BI8B 4Z6YA 5GAEP 2UZKA 1PU8A 2PZ1A 3O1WA 1V4SA 3F3XA 3SJMA 1HSQA 2FQ3A 1HW1A 4DG1A 2OPPA 1JLQA 1UGQB 3HSCA 2DJIA 3DU5A 1ZYRF 4MDBA 5SZTA 3JCMf 2HNYA 1CSKA 1E7OA 3K5NA 1YOVB 1QS4A 3CFOA 1QZYA 1RBVA 2BTFA 2QBYA 4YOVA 3FJ5A 2IVOA 3G0ZA 4M7AA 4KMFA 4UVCA 2DTZA 5LJ5f 3ZN1A 2QG9B 1R0CB 1KONA 4M74A 2QA4Q 3PMIA 4Y33A 3CEYA 4CCOA 4EJVA 2FE3A 4D6WA 3GNGA 2M7AA 1BIBA 5IYDJ 5FPMA 5JMVA 1VIFA 2KT0A 1F36A 2BUDA 3M54A 1XGMA 2VKEA 3HL2A 1ZUUA 2R7YA 3I59A 3VV0A 3M5RA 1K8AU 2Z3YA 2VJ5A 5KN8A 1R22A 3CCQA 1VQ8T 2E2PA 3SJJA 5FO5A 2ZNYA 2P5KA 3EGXB 3KTQA 2RE2A 3FXLA 3H92A 1BQNA 5J2PA 1VQON 1OX9A 2HDAA 1CLQA 2BZTA 5KHDA 3AAFA 3OYNA 4DTNA 1KQSA 4P9FA 5AQTA 3GNFB 1EO1A 4UNFA 2RPNA 3K2AA 1ZA1B 1Z6TA 2HI3A 1IB8A 4CVNE 4LY7A 3GFMA 3U21A 4BRKA 2EJGA 5ICGA 1O75A 4D7MA 3GFLA 2RN8A 1TK0A 1OVYA 2LJ1A 2F8TA 2OU2A 1KSPA 2RQRA 3CCMQ 1MA9B 4KV8A 2M02A 4GV3A 2JW4A 2I0NA 3DLLF 3C0CA 4XQ3A 3QXEB 5IP9J 1TQMA 5F6FA 3R3LA 3ONQA 1U9OA 3ERED 5CHZA 3C6AA 5D4SA 1F43A 4XQFA 1B72B 3OL3A 1RADB 2HHXA 3K4LA 1N75A 4HCZA 3D2FB 2X1DA 1N39A 5AJ3K 1OR7C 2HW3A 3J7AO 4IPAA 5JHUA 3H6EA 1S7OA 2DYIA 5CIUA 3ULEA 4N4OB 1HQCA 3EL2A 4A6EA 3ENHA 3O8HA 3ZGKA 3M1FA 1SL0A 3HVTA 3VUBA 2VODA 1Q86U 4TSXA 3BPVA 2YNFA 2HKQB 2K3FA 2RDPA 3PT9A 4FM4B 5A0LA 4Y1CA 1BJAA 4XRMA 2J4RA 4CJ4A 4C3IJ 1GFDA 4IX7A 3A5LC 4E7IA 3A0BC 2A0FB 1T03A 2ZQBA 4ZZDA 5LD2C 3CCSN 1RDAA 4OVLA 3IKVA 1WEGA 3ABLH 2GLOA 3EFRA 4C0DB 1YVUA 5DUIA 1E4GT 3D2FA 2XY7A 4J9FA 2DBMA 4PFOA 2UV1A 4E9HA 1RAAB 3OYHA 4PCQA 2D0OA 2WV1A 3PNTA 4JJBA 4FZYA 1WYXA 1DU0A 5AN4A 1GCQA 5GMKi 1M1KO 2Y0SA 2E12A 4HRIA 4M7YA 3DWLE 3KD1E 3LSHA 5GTIC 4A62A 3O6BB 1WHMA 3CCMI 3E66A 4DKWA 3HK2A 2FNPA 4OKKA 4WQ4C 1ZLMA 4PJJA 3RR8A 2K5CA 4N5SA 3VMFB 3AO1A 1IUYA 5DPKA 2ADUA 4BJ5C 3JCMW 2CKKA 3P38A 3UATA 4CERA 4B44A 4KH5A 1MNMC 5BRHA 2P1JA 3FSPA 2QLZA 3RIRA 1W36D 3TP0A 4MTEA 4IHXA 2P7VB 4M42A 4XLHA 5IT9K 2P6SA 1ZBFA 4LIUA 2K3YA 3WNEA 1RI7A 3AVMA 3UPUA 1LVAA 2R7DA 2A6HF 4HSRA 3CLQA 3SFZA 4QIWN 1RR7A 4CC2A 3M8EA 1Y8RB 2MWPA 3AFHA 1IRGA 3QFPA 2L9NA 5M3MJ 3JB9G 1VQOQ 4YFNF 3LDSA 2DAOA 3CCQN 1NJIC 3MWTA 1S1NA 2HZTA 2GTDA 4CZZA 2E64A 4JYAK 4Z2YA 1PD0A 1WXBA 2YI1A 1NJWA 4FWKA 1W6XA 2E36A 2BKDN 3ZETA 3RKYA 5CKFA 3WG9A 5IT9E 3PFYA 2OZ6A 3WHBA 2O31A 2YHTA 4BDZA 4BR9A 2VKNA 2VG6A 3Q9SA 1WVRA 5HVQC 3ZMVA 1C0WA 2H3GX 2NOHA 1RFQA 3HJFA 5HL7L 4RW9A 2QZ8A 4QVDA 3E9PA 2ZC2A 1AOJA 2A6AA 1ZKGA 4FYWB 1E0EA 1WFWA 2EKOA 5SWMA 2DMPA 4ISEA 4BQOA 2BE2A 1JLEA 1LKXA 3M0TA 3VSLA 3IMXA 2ZJQF 5GAGP 4P9UA 5KK1A 3GCMA 1VSIA 3JAME 2E2NA 1S29A 1Q95G 4AFSC 1G3YA 3A03A 3QDFA 2JS0A 2EH3A 2SEMA 2KQRA 1NGFA 2LOOA 2B4JA 5CYMA 1RKWA 2DJQA 2PNIA 4HCCA 1IG8A 4K43A 1TUYA 3S93A 3ZSOA 2RQPA 3KLHA 2M0OA 1G15A 2P9KB 5AZJA 3ULDA 3TTFA 3CCEN 1SKUB 5FPEA 1NPRA 2NWMA 3HGYA 2KPMA 3CCSQ 4G6TB 1YTYA 3FXUA 2KDOA 4NB4A 1U5TC 1LDKB 2AK5A 1K73R 1IZ6A 2RC4A 4HW0A 3B6OA 4XN0A 2EYXA 2CQ7A 2WTEA 2VV5A 1VQOI 2K4YA 5KTQA 4EW0A 3ZXSA 1ACIA 3BY5A 5JICA 1MMGA 3ASNH 2NOBA 2O8FA 4CJ5A 5F1XA 5DLQE 4PLLA 2GWJA 3UT1A 3CC2I 2Q2EB 4RGSA 2V26A 2WC9A 1XC9A 3JRDA 4IG3A 3C7NA 4BKXA 4GLMA 5FU6B 2MA3A 2WA0A 2P9NA 2WACA 5EXWA 5GIOA 5AQUA 2LRQA 3B73A 4KB1A 2UXDK 2ZJRL 1FOWA 2E1ZA 1MDUB 1AWOA 1Z6RA 4OIRF 3RMBA 4M3GA 5GADJ 5GINA 1W2BP 3S6IA 1EH6A 2FB7A 3L00A 1KVCA 4XK4A 3KVGA 1QZEA 4RTFD 2A05A 3THVA 4I01A 4CEBA 2F48A 2XGDA 1Q86C 4BH9A 3GTJJ 1TKDA 3RTRA 1IXCA 2JPBA 4FTHA 5ED4A 3HSRA 1YWOA 5BREA 1MJBA 5CKDA 3X2QH 4KBMB 2K9QA 1LOTB 1X1DA 4HF2A 3GPLA 1SD4A 1UG0A 3DKXA 4A5MA 5KYYA 1SVOA 1S1VA 4O5FA 3GBQA 5GAN4 4ESJA 2EIFA 1ODDA 1R5HA 3DXKA 4JUVA 1SL2A 1LFBA 1TWHJ 5CQEA 4H0XB 3EG9B 2ZPBB 4BG8A 2ETJA 3HPHA 3S6WA 1QU3A 4FWMA 4CHPA 2RK1A 2AHJB 2W48A 2M9UA 3HBLA 3CC2T 3ZX3A 3CCQQ 1VQ7A 2Q31A 2XAGA 4FLUA 1ZBJA 4XU1A 2F5FA 3NTIA 1KU2A 4XICA 4CEOA 4F3OA 3BJ6A 4PKGA 3TVTA 1HLUA 1NGDA 2RO0A 2IS6A 3F6OA 1ATRA 2CYZB 1X1CA 3D6RA 5KYUB 1NK6A 3D7EO 1R9TJ 3FX3A 1WSHA 4CGDA 2HOAA 3ZMTA 3L9FA 2JOYA 1RR8C 5DV5A 4ABZA 2DETA 4DUYK 4EQQA 3M1EA 3J80Z 3DI6A 2ATQA 1RDCA 4QQ6A 4LH4A 5DCMB 5CR2A 3AARA 4U87A 4IIOA 2XDDA 1Q81R 3HO1A 3HYFA 4RTXA 5E1ZB 1KLMA 2IC3A 2VWBA 5GANg 2OPRA 2KIFA 3EDPA 2ASMA 3CD6A 2KSSA 4XKBA 4BQQA 1RRQA 3EN9A 1A35A 1HU0A 2V8IA 1JT6A 3NE6A 2DEUA 4FLZA 4GO1A 1TLHB 1ATNA 2F9WA 1R77A 3KYDB 1I5LA 2AQEA 4RDUA 5CR4A 2CW0F 2PZSA 1FJLA 2WB1N 3HYIA 2VGNA 1ZLJA 3QUIA 3NAEA 2M8EA 4XTXA 3CCEQ 3IH4A 1NGHA 1T0FC 3H9JA 4L5JA 2DFFA 3R61A 3VODA 5GAOn 3F73A 2HOSA 1YJWA 4YG2F 4GVEA 5DCMA 1XMXA 3RMSA 1NK5A 3GDQA 1DGWY 5D5UB 1WA7A 4W1UA 3CCQI 1C1BA 2ECCA 3VYRB 3LCNA 2VXDA 4ILJA 2LKXA 1T0JA 2Y0MA 4DB3A 1N8RO 4CYDA 4DV1K 1N33K 3NH1A 3VA0A 4JKAA 4GCVA 1QQNA 1RGIA 3DV8A 5LJ5g 2GV9A 4A57A 4ZN1A 1S1XA 3CCYA 2JT4A 5LHIA 4KULA 3QG1A 2DE0X 4F92B 3QWYA 4JD2A 5JI6A 3CVTA 5M9OA 2KY9A 3GTOJ 4GV6A 3NRVA 1ABOA 5EGOA 1K4US 2E6ZA 3CDHA 1B92A 3CMAN 4NUBA 5ILUA 3ERMA 2V52B 4F2RA 4J5YA 4G7OF 1YP5A 2FRYA 1GDTA 3AVHA 3HTVA 4BRFA 3F21A 2Z1HA 3RYPA 3ZCOA 1RI0A 3GEZA 4KHPK 3EZ5A 5FLXK 3OW2M 4B1WB 1FSHA 1XMKA 4NLBA 2VC8A 3NTHA 4Z02A 1CXQA 2VL8A 3CWSA 3CCQT 2YHXA 1KEAA 4QQGA 2HU9A 2D2WA 2XU8A 1XC3A 3WTYC 3J81E 2DPNA 2BZ8A 5I2MA 1SQKA 2KYMA 2IAJA 3BG6A 3CUOA 3LWIA 2YSRA 2L0AA 2DIGA 3T7ZA 2MMPA 4EGYA 5HK0A 4Q5WA 2YJFA 3TTDA 3PQJA 2CFOA 5F08A 4M78A 3V4IA 1M90R 3VDXA 2DCEA 1NM7A 2M7BA 2X1CA 1BI4A 4C8LA 4J00A 4JKFA 3AVAA 3FRNA 3PIOF 1L3VA 3QINA 2HL3A 2ASOA 1VRTA 4B21A 1KG5A 3H5RA 3TKYA 5E79C 5D5VB 2JGUA 3EUHC 1M1FA 5C15A 4Z4GA 3CMET 1XD7A 4GBQA 4D5CA 1K78B 9ATCB 5AQHA 1UG2A 4H4MA 4IHWA 4BE0A 5FRNA 1IDYA 2PI0A 3VENA 1OCTC 3F5TA 4FJIA 4M3TA 1T98A 2GFUA 2XF7A 3UKGA 3I54A 3WTVC 2FRHA 2OTLA 4HPQA 4BRGA 4BACA 3FHFA 3P9CA 4EM1A 3CDLA 1J5YA 2QEXN 1WPKA 2LG4A 4LIVA 4L18B 1UGRB 4MQVA 3DAWA 1AKHA 3OBWA 3V8LA 2RMOA 4JJCA 4FASD 3FZMA 2VC1A 4CJUA 3OW2S 2KZZA 3WTTC 2O9VA 3VRYA 4X6AJ 2F8SA 3G1LA 1K0XA 4CEEA 4A3EJ 1G8XA 5ILSA 2R3SA 3CD6N 1K83J 3MP1A 4N56A 2Y9YA 2DA2A 5H6RA 1JLAA 1TP4A 4DZJA 2EV0A 2L02A 3N5NX 1N78A 2NNNA 4L5GA 3HPWA 3OL4A 1ZAOA 4CZEA 1MBEA 4YOXA 2JM9A 5AQIA 3HDDA 1IRFA 3G0QA 2HHVA 2DYRH 3ENOA 1W0UA 2VXZA 1MW7A 4DR2K 1WEFA 2DTIA 2BXYA 5GANd 4FWQA 1M1KU 1MWKA 4FT8A 1QQJA 2F9TA 1X6OA 2A61A 4RMNA 1GCPA 2ABLA 4ON0A 1NNEA 1YJWN 4QTRA 4DFJA 1M3BA 3LSKA 4Y52J 4CZHA 2L7MP 3BFMA 1RT7A 1XX5A 3HRUA 2GTJA 1PSFA 2G8VA 4QPOA 3LM2A 2C6YA 2K9MA 4DSFA 1ACMB 1FX7A 1QVFM 5EDNA 3VFZA 2Q1ZB 4JOMA 4C8KA 2JQ7A 1VSHA 4LSLA 2VBYA 1U4BA 3FKJA 4UVAA 1VQLN 2UXBK 2X4XA 3AY9A 3HZ6A 2EIKH 2LTPA 1PCXA 3VQ4A 3T19A 2CZ6B 4KNYA 4ORZA 2RREA 2OTJA 2PMZA 1M2VB 5L3CA 4OOIA 2QTXA 3NF7A 1S5LC 3CF5F 1BI0A 2KKZA 2QGGA 2UUZA 4JRQA 2DXUA 1SZ2A 2FSNA 1R4NB 4KFCA 5GAN5 1JE8A 3V81A 4Y4RA 2VKHA 3FXRA 3PX6A 3THXA 2QWLA 4IJAA 3BUZB 2VQHA 4OB3B 5HLIA 2V9PA 1YQRA 1WQ2A 4PJLA 2FSJA 3JCMP 1W1FA 4LH5A 4D5FA 3A5NC 1G5VA 4Y0WA 4BQZA 2JTFA 4Q48A 2CQXA 2LBFB 5DM7L 3DXMA 1RUNA 1QNTA 3C6HA 3HP6A 1Z05A 1KU7A 4FM0A 3H8ZA 1S9GA 2BE5F 4J9HA 1QVFS 3M0PA 4W5OA 1VQ7Q 3CXCM 4I0BA 2E5QA 1FW6A 4S05A 4BRLA 5LEJA 3TAMA 3TQNA 9ANTA 2D1HA 2XVCA 3LDOA 3P8BB 1J9IA 2KHOA 1S7EA 4XOTA 4KIFA 1SC7A 4FISA 5DCFA 2MGQA 3ZCMA 4KN4X 4QWQA 1Q8IA 1WQ7A 1V5EA 4R79A 4LK0F 5C42A 1VA7A 5HLTA 2LBFA 2QEXQ 4IG0A 4JLIA 5K5RA 4BRCA 2OTLN 2D0NA 3QMLA 4CBXA 1Z3XA 3KBGA 3SUOA 3A5ZB 3RMDA 1ZC6A 1KG7A 4N0AC 2AIRB 3FFKB 4BXFA 3CD6Q 1XCBA 3V9XA 1D3BA 4A0ZA 3M59A 1S1WA 3ABUA 1WN7A 3J80O 2OAZA 2YHAA 3THKA 4DFKA 4LFAK 2MIOA 1B8IB 2IS1A 4ZYAA 3QOPA 4FW2A 4RTTA 3S8PA 3R0AA 1J09A 3CXCS 2KT1A 4IVNA 4J9CA 1U5SA 3AL0C 1WI7A 3A8LB 2G9WA 5M1KA 3RJPA 1X9SA 1NH3A 1XTAA 3HPGA 3PNYA 2O9LA 4HF1A 1YJWQ 2KZMA 4H4KC 4ME7A 3THYB 2RF2A 1LW2A 5K1YA 5FD6A 4CC7A 4EDUA 3J81Z 3TSQA 4R8HA 5HLGA 1F5TA 1YRNB 1P6RA 2VPLA 3SQ2A 3K70D 1VQ7I 2L7KA 4FXDA 3TP3A 3A2FA 4UB6C 1LCUA 2KI7A 1JGGA 3H36A 3PL8A 2EFPA 1B8IA 3A8OB 4JRIA 1JKRC 1QW1A 4PA1A 5C4XJ 2CP0A 2O8BB 3M07A 2VKDA 3S17J 2YDLA 1GXIE 2FBXA 2HVIA 1B6AA 3X26B 2CS3A 1JUPA 3URGA 4B8AB 1HYSA 3DKMA 2QEXI 2FD5A 2DN0A 3EYYA 5E18F 4DCHA 4ZC3A 4CGJA 3KZIC 3KEYA 3M7GA 1XOVA 4HDUA 3OSSC 2PMZN 5GTHC 2BY0A 2LF7A 2K3BA 5DM6F 2CP5A 1Z21A 3KP2A 3CBPA 3QNOA 3CD6I 2HR3A 3OJSA 4CJSA 1HDPA 3PO5A 2Y31A 4XIDA 1X01A 3D2EB 5I42A 4FL9A 1Q9YA 1WJCA 2QKBA 1I07A 3FK6A 1A5XA 1TNTA 4DV2K 5BPMA 3ZYYX 2P0KA 1KAXA 1WNSA 3EUAA 3HIFA 4CZIA 3QLHA 1GBQA 2E2HJ 4I02A 3FMSA 1YVNA 3RRGA 2DVJA 1VQ7T 1GHCA 3HKSA 5AQYA 3PNVA 3HXMA 1YJWI 4BY9C 3O8GA 3LWFA 4LDYA 1KIKA 1T7PA 3GWZA 2UUBK 3I58A 1VQ6A 4M75B 4KREA 5A2QZ 1LEBA 2DL5A 4JI3K 3VQEA 1YF5L 2RQUA 4KFBA 3I9V2 1VFCA 2OUMA 2XAUA 3G71N 4N47A 2ETHA 3MAJA 3S3OA 4BC5A 2QSGX 4NL3A 2CJJA 3EFOB 2DK5A 1PP8F 4RTYA 3HFOA 4YRVA 3KCCA 3BR6A 4KITB 2R58A 2W4SA 4HDVA 4XH4A 1WJQA 1FPQA 3TSWA 3DB3A 3OYGA 1ZK8A 2H94A 3QO9A 3DWLA 5EF6A 4RB1A 5EX5A 4KHUA 3CD6T 2OTLQ 1TWAJ 1K9MR 2IVWA 5KCOA 3MEUA 1YHQN 2E19A 3UKRB 2VASA 5L3FA 1RTIA 4FIBA 4HHTA 2P5VA 2F96A 5LJ3h 1X2NA 4M3BA 3IQLA 4B3RK 1ATSA 2HCKA 2GZWA 5FFXA 1TW3A 4L0ZB 2HKNA 4F91B 4AHSA 2PYLA 1ZLKA 1YJWT 4FPAA 2FXUA 5L23A 4JKCA 1N8RU 1SG5A 4BI4A 3L7WA 4CJ3A 2Z33A 3AO3A 3QICA 3FKIJ 3KZYA 4XKWA 1ABQA 4M77C 2YG9A 3CJCA 1MSEC 4LD5A 2EZHA 1BI1A 1KFDA 4MIMA 1STZA 1TKXA 2X9DA 2ZSIB 4AHRA 5JVTA 4X66K 1L3SA 2NUTB 4DBRA 4OF1A 4XSZF 2M8GX 2JMAA 4OMQA 4XKVA 1T8IA 1XUPO 1NGJA 4K0KK 3SBTA 1ZA2B 5GAN7 2R7XA 2EV5A 1PP7U 4DR5K 2VG5A 4DGWB 1XNIA 3AVKA 4ZTJA 2XB0X 3WTUC 2EBPA 4Y13A 3ZQGA 2P9IA 5LL6Z 3EHRA 4JK1X 1IC8A 4IEEA 1NBEB 4CFAA 2TDXA 1RDUA 1AZGB 2QK9A 1TAUA 1YQLA 3HP9A 3VGLA 4BY6C 3SAFA 3CJTB 1KD1U 1MJAA 1JJ2A 2OTLI 2KMTA 4CI0C 1NG7A 3JV3A 3E5XA 1H8AC 2NUTA 1MZBA 4C8QA 5KI6A 3BP8A 4JKHA 2Z0WA 3W2AA 2OQGA 3OH6A 3SMSA 3V4GA 4KT5C 2RHXA 2QXFA 3TO7A 2L2PA 2NOJB 2RK2A 2EQMA 3H35A 2CP3A 3ALYA 1XCVA 3G1JA 4JS5A 3I4NJ 1ULYA 2HBMA 1NKUA 1LAVA 3PIPL 3M8QA 3CCUT 5EY4A 4FVMA 2CWEA 4FK4A 2E41A 3F23A 1S1TA 1GVDA 2H09A 2RI2A 2I5WA 5A0DA 4DTPA 4AYBN 5ADXA 2DTOA 4HQMA 2D6FA 1DIZA 3TSUA 1HRHA 3BE3A 3R4KA 3O5BA 1Q82R 3JREA 1T6CA 5C24A 4DR6K 5KH6A 2ZD1A 2CW7A 3CESA 1X4PA 3BOQA 2H56A 1IBMK 3C2HA 1XMQK 2DF6A 3SXYA 2P9SA 3ABMH 2ZMEA 3QP6A 4AC0A 4G9ZA 3RWUA 4YPHA 3L2VA 3G71Q 3Q5FA 1SVMA 2VLAA 1UGVA 1S72N 1VQ6N 1D0YA 1V29B 3L2RA 2EYWA 4EM2A 2K7LA 3H3NO 3OYEA 4DBHA 4BVOA 2D0BA 3VQDA 4XLCA 4C0ZA 2HPIA 2DMNA 4M7DA 3O9QA 2E1CA 1RNHA 4XNFA 2IJLA 2H3JA 1QA6A 1Y6IA 5AQZA 1T3VA 1YHQQ 4V2SA 3OB9A 2VXEA 4OPHA 3L09A 3KIOA 5M1NA 1RAGB 1S22A 1QVGA 3J7AP 3T8RA 3WEEB 3HOZJ 2XC7A 4B3SK 2OTJI 1BOTO 1V54H 1B7TA 5AQVA 1WJSA 4R56A 3WE3A 1LAWA 1OYIA 2DO3A 2PVGB 3AGKA 1BBYA 2XAHA 3EETA 1W36C 2IP2A 2KRCA 4KO0A 3UR3C 3E9LA 5LY3A 1VIEA 3BTLA 4IEIA 2P9LB 1C0MA 4IUQA 4XBFA 1PVEA 5TISC 1BK2A 4LF5K 3EG1A 4AIJA 4FL6A 1M3HA 4BL0B 3J7AF 4HF0A 2ZKZA 3Q9VA 4DWIA 3TANA 4FJ8A 2E5ZA 1IGNA 4C1NI 4HNUA 2KXDA 4MFBA 4BRAA 3S32A 1HD3A 2EQUA 3CC4T 5C0YA 2IOCA 2JNGA 4KKOA 1XGOA 2VIXA 4MNUA 1SVLA 3VEVA 4DQ2A 1BG3A 5M1QA 5GAMh 2XK0A 4OKEA 3RCOA 3NH2A 1JXMA 2A5YB 4ICLA 2BY1A 4I6ZA 4WX9A 3CQ8A 4CF8A 1S6PA 3AA4A 4FCYA 1AWWA 3KWGA 3MD2A 4KHSA 3E6MA 1KZHA 1UMQA 3VYHB 5KYWA 3LDPA 4IOAF 3FZKA 3QU6A 5HCKA 3C4SA 2CG4A 1ZBLA 5IPAA 1R59O 1W0TA 2GXBA 1OU9A 4CK1A 4AG1C 2OTJT 3FHNA 3E2UA 2ZXJA 1RL2A 2A42A 4NC8A 2F2WA 3JYTA 4E9EA 4LXCA 3K69A 1J9AA 4B1UB 2K79A 1X9MA 3KP4A 4NQWB 5E41A 1YHQI 3NVMA 3F0ZA 2E1MB 3ZT0A 3CQZJ 5JLXA 2GIVA 4PQUA 1N8RC 1QVUA 2RPIA 3KEOA 4Z8AA 3MEGA 1JTXA 5GAEJ 2JUCA 2SRCA 5FDLA 3LOCA 2E20A 1WHUA 1GOBA 4RTVA 3SQ0A 4C5GA 2OCCH 1KXPA 3MK6A 3M6GA 1YIJA 2GTOA 3UA7A 2OA8A 2C0OA 3Q7CA 4CYCA 5IP7J 5F0XA 5ILVA 4OIPF 5M3FJ 2QK0A 2HF3A 3S3NA 3ECHA 1EIFA 3QERA 4AH9A 1W4MA 2WBNA 1WSFA 2ZO4A 2JSCA 3RPUA 4X1EA 1OCRH 2D8HA 4IIMA 1NK7A 3VF6A 2BANA 3DLLA 2W00A 2JXBA 4FJNA 3EG2A 3IV5A 4EP5A 2NNYA 2V1XA 2X51A 3ZSQA 1VQ6Q 1D09B 3QEPA 3INZA 3HEFA 4F17A 4CK3A 3MEWA 1ETWA 5D6FA 2YUSA 2R4GA 4PJOB 1KD1C 4C8MA 1NGCA 5HRRA 3HKZN 1ZSZC 3K57A 1G3SA 3CWUA 1VHXA 4DF4A 4L9VA 4CFDA 3TTCA 4M77G 3PX0A 2K5FA 1K7AA 2IIMA 3VOEA 4OMFB 2F2XA 1PRLC 4JK8A 2DT7B 5IYCJ 4JI4K 1M3CA 5A2QO 4OFAA 2R0QC 4UUTA 3SHFA 3I5RA 2E7WA 4M3UA 4A12A 2DYSH 3WQTA 2F5DA 4F7UG 3LFUA 1IN6A 5IP6A 4BJ6C 2DMQA 3EG0A 3VW4A 1LE8A 2LTOA 3V1RA 4LDXA 2LC2A 1NGIA 1TNSA 3L2CA 1RBSA 4I2QA 1MDMB 4M77F 3ZT1A 2OC6A 3F8MA 1U2VB 3J8AA 1WXTA 4CRIA 1TL8A 2QASA 1KG1A 3ZX2A 4YNQA 1J5EK 3HSBA 2DO7A 1W5TA 3ZQFA 2RH2A 3N4QA 2L3DA 5AZIB 2O8CB 4DTXA 2R5MA 1JL1A 2FNAA 4FJ9A 4OU0A 1W97L 1WZOA 3R2XC 2Y9ZA 1YLFA 3V9UA 5JLWA 2K85A 1BR2A 4AWXB 1W5CC 1K73O 1B34A 4PJOE 1VQ6I 4RLQA 1NJIR 3KXTA 3CUQB 3TL4X 2VVKA 3M3ZA 2KRNA 4D9JA 2VBXA 3SBGA 2XHBA 2HVQA 3HTSB 1YYVA 1WLPB 3EGDB 4U67L 1JTYA 3I4PA 2QAZA 1BU6O 4W5NA 2DFIA 4Z4EA 3HOXJ 5AQLA 1P59A 3MKZA 3DFGA 2WAEA 2G8HA 4A6DA 3D1NI 1RILA 2Q0RA 1ETXA 4QW2A 4B3XA 2LNHB 3CP2A 2GNCA 1RAIB 4IQ4A 1QP3A 4ETSA 5GAMj 4J2AA 4DFMA 1X3WB 4LGWA 3U23A 4M3ZA 2O8CA 1NYFA 4JHDB 2HHUA 4HX8A 5JLFA 1YFHA 1RT1A 2DDAA 2PMUA 3I55N 4JKGA 1I81A 3SUPA 4C2TA 2VYTA 2NVYJ 1YJNT 1TH7A 5J3BA 4BAYA 1U0JA 3MZ8A 3G4SA 3X25B 4IOCL 2QXLA 1T33A 3HSTB 1SANA 4KMUX 5CVIA 4CCJA 4ELYC 2X6XA 4KHYA 5KN9A 4MQ9F 3DRRA 5GPCA 1ON2A 4DS4A 3F8CA 4H4OA 3GE1A 2IGMA 3CC7N 1IF1A 1ETYA 1YIJN 1LJOA 2O01E 1TQIA 4XM3A 1JCFA 3KLNA 3TARA 2YLCA 2HOEA 5LGNA 5KRSA 1CKBA 3W3CA 4AI5A 4M75D 1SD7A 4KT0E 3KP5A 3CCJA 3AO2A 1LWEA 3H45C 2EAYA 3RUXA 1T05A 4M6VA 4BY1J 2I10A 5I2SA 4OINF 4I7HA 1QZ6A 2BE7D 4CHNA 1SL1A 2LJ0A 5EC7A 2VGMA 2C0IA 3MKLA 3N5BB 3HRTA 2ZJQL 2R7VA 1M5Q1 2OYQA 2XGCA 2CZ1B 2MD0A 4AM6A 3KWIA 5LMUK 1CKAA 1N77A 1ORNA 4F52A 1VSEA 2VI6A 1Y56A 2XO7A 5D4RA 3L3VA 5F2RA 1OPCA 3FZHA 4AHUA 1VQ9N 5HROA 1J7KA 2NS0A 3GZ6A 3HBTA 4BVPA 2LVMA 2L3QA 3RERA 3BTJA 3M57A 4BR7A 2DXCA 3CWTA 3IAS2 1Q81O 2E60A 4RW4A 3BY6A 3H0DA 3PNWC 1DTQA 3U3GA 4DEYA 2A3ZA 1N27A 2WONA 2WADA 4B9SA 2CV0A 3MJXA 1EX4A 3TU5A 1V4RA 2L5QA 4RGXA 1W7PB 4E70A 2OZMA 2CQNA 2KIQA 2QTVA 3A5OC 2D45A 1H9TA 3PV8A 3JCMX 4GVMA 4C8QD 5HK3A 5GAGJ 4DJAA 2ELKA 3QQAA 2HBJA 4J9BA 2BGCA 4K41A 3GBGA 2YUNA 5GMKm 2IG0A 5EYRA 4J2BA 2KIMA 3PMTA 1WSUA 1M30A 1BA5A 1WHJA 2JUGA 2IGOA 2A41A 2FUG2 4ELVA 4QS8A 2P9UB 3P31A 1T3SA 2ROTA 2PN6A 1C0GA 2VOPA 5JFRA 2DM1A 2ZGYA 2XUBA 1OCZH 2Q1NA 1W2BA 4BROA 1FP1D 1JKOC 1K4TA 2UU9K 2COMA 1R36A 2HMAA 2GCXA 1IO6A 5D5WB 4RB3C 2B9SA 3E97A 1WJFA 1V4TA 3DU6A 1HUXA 3I55Q 3D5RC 4IRGA 3I0RA 1LDJA 1KYZA 1I50J 1NEGA 4CZKA 4XOPA 1DQUA 1N3AA 1WJRA 1TT0A 4GMJB 2DERA 1YJ9N 3NAUA 3N97A 2XMFA 4CJEA 1WH5A 4CDGA 4M7DD 3S1QJ 1C0TA 1TUGB 4L9TA 2HNDA 3OSGA 1VK0A 3CC7Q 4X64K 1ETOA 4HTUA 1YIJQ 4ZGDB 3QU3A 5AQQA 4C0DC 1YITA 1UE9A 1SFKA 3FWEA 2MLKA 5CVUA 2ZJ2A 4RGUA 3KP3A 1WHKA 1OR7A 4BR4A 1IKYA 1CQTA 3BQYA 1YG2A 1NK4A 2D1KA 2M87A 1QQCA 3I0WA 3MEVA 4WCIA 3CMYA 5GAOq 1ZBUA 2X78A 4HT8A 1LPQA 2XY5A 1M90O 1VRLA 2XB5A 2O8DB 1EWRA 4IWVA 2QWPA 1PNJA 3W0LA 3SQ4A 2FZCB 4D8KA 3RBBB 2IS2A 1VQ9Q 2AZVA 4D0PA 4HYEA 1I6XA 3NBPA 2ZXWH 1YUWA 2NS7A 2QWOA 1VQ4A 2YNGA 1M3AA 4C92F 4F7UB 3SYTA 3RESA 3JRFA 3I55I 1SRMA 2OPSA 2WY8Q 3SWNB 1Z7UA 3DF8A 5KRTA 1XWLA 2B86A 4J83A 1FXXA 3RI4A 1JJ8C 2R93J 3LWHA 4ZNXA 1HOMA 4B9NA 2ED1A 1BHLA 3E01A 3B6CA 1J2XA 3WGHA 2TCTA 5FLXZ 3CC7I 5LJ3e 2ACJA 1H1VA 2CDTA 2FMYA 1YIJI 3RSEB 4WQ4A 4CUGA 2HSPA 1TUUA 3AVGA 2P5OA 2QQAA 4Z0UA 1LMZA 2A69F 3SAHA 4ESBA 3E0JB 2DBKA 4A3DJ 2VBWA 2RGVA 2FEZA 3AAPA 5HNHA 3VN5A 2JN0A 4C23A 4A3MJ 3J7ZO 3H0FA 1B9NA 4RWTA 1GL5A 3LLRA 2DRMA 2FMLA 5EG0B 1KYWA 2YNIA 1KFZA 1NLPC 2GGRA 5BRFA 5HRSA 1E3OC 3MN9A 3BCBA 2DJNA 1VYTA 2XIDA 2MPXC 4FVUA 4MZTA 3VS7A 4CJTA 2HTSA 4ZDPA 4JKDA 1L3UA 2KLOA 1XTDA 2DTUA 3RPUD 1MH3A 1T0HA 2BYVE 4B9WA 2P4TA 1VQKT 1A36A 2FBYA 4O8UA 2EGAA 2DDBA 1QSSA 2PUKB 1Y96B 3CBOA 2O8EB 1NG9A 5E3OA 2ZPFB 1JO8A 1X3UA 2RNJA 4F7UE 3H0IA 2EWSA 5AQPA 2DOFA 3G3ZA 3NWSA 3Q0UA 1U8BA 4DW6A 1TXQA 5EG0A 1NM1A 1YIJT 4ZDLA 3E3VA 2ATCB 4A4EA 3BDUA 4FE4A 4BBRJ 2BY2A 2B8AA 3QWXX 4QS7A 4XU3A 1WNLA 2X9HA 1X4OA 2QA4A 3PIOL 4WCGA 1NHAA 2EX3A 1OOTA 3AG4H 3HUGA 5LFAA 3OW2P 4BR0A 4BBSJ 4E7KA 4YOWA 3WXKA 3NFCA 2EIJH 1XMOK 2AXTC 3CCRN 2D4WA 3MKDA 4FJ5A 4EMKB 2XI9A 3ZLJA 3TOBA 3M9QA 4LB6B 1FMVA 1UJ8A 2E1OA 1K8KA 3K70C 3CCJQ 2GIZA 3ENBA 1VQMA 3MCAB 1QZZA 5FU6C 2VJIA 5AQGA 2NZTA 4JKEA 4B8CA 1U3EM 4I99C 4HLYA 3R6SA 2YHBA 2XDPA 3H9QA 3VEPA 5D6YA 1QHTA 1IN7A 3JRHA 3FDYA 2D0CA 5FW9A 4ID5A 3OYMA 4FK2A 2DOEA 4GYIA 1JT0A 2ZGWA 4EVVA 5KVRA 5JVHL 4CI6A 1H8KA 1U5TA 2CGLA 4N4NB 3BR2A 1Q7YC 2LP5A 1OZ3A 1MUNA 3BR0A 4MO7A 1BW6A 2BTTA 1BUPA 1N6QA 2L01A 2H8RA 2DILA 1SFEA 5JVGL 4CJPA 4M72A 3UNGC 4J6XA 2DA3A 3CFRA 3NHGA 4UV8A 1U2WA 3AT1B 1X1AA 4YPRA 3O6WA 2HOTA 5LJ3f 4A3CJ 2L4AA 3A8YA 4NCGA 1T8EA 2K3PA 4R5PA 1VQ4N 4FJ7A 2HDWA 1EKEA 1HKTA 5TKYA 1KSWA 4JI1K 3LP3A 4H8KA 2FX0A 2KGTA 3PSIA 3OYDA 2E8AA 1SFOJ 1WZ2A 3V1OA 3HGGA 2MAMA 1B59A 2CU7A 4YOQA 2B7EA 4DV7K 1ASUA 4PGGA 5J4YA 4RCHA 4ZYGA 4K8ZA 1A31A 5J40A 1HNVA 3ULRB 1JGSA 2DK8A 3G25A 3KLIA 1ENHA 4Q0BA 2DBBA 3G6EA 2XRNA 3ZMSA 4BRQA 1BISA 2V8JA 1RESA 1RDDA 4CGHA 3JB9I 4GFBA 4FHTA 5BMZA 2YRVA 4FYXB 3RQIA 5LJWA 3FLCO 4DSIA 2HSTA 2FVUA 5HS9A 3CCJI 3LL7A 3MN2A 1X3ZB 5AONA 4NL2A 2V7FA 4IHYA 2PMHA 2ASPA 3DLRA 4CBWA 1YW8A 1PVSA 3QZ5B 1HW2A 3AGRA 1AZEA 1KG6A 1JKPC 4ENKA 4G7HF 2HPMA 4PFZA 3FIFA 2NOIA 2GWKA 4UHTA 1QVFP 5GAMe 1WPYA 1PHTA 2HHHK 2V9VA 2DZ9A 3BWGA 4FJXA 2UXNA 3AAQA 3RDIA 3OS1A 3IHOA 1J6ZA 1U1SA 5AQOA 2KJCA 4JX5A 1DJ7B 4HUFA 1I39A 2E6NA 3EZWA 3M4GA 5ELZA 1RAHB 4OMMA 3RR7A 2DFUA 4YY3K 3G4ST 5M5XJ 4EV0A 2WAQN 3CZ6A 3VQ5A 4B9TA 4NDLA 4LDVA 1GVJA 4IUPA 2WSCE 2LQ8A 5J47A 4S0HB 4EZ9A 3ZBDA 1E6GA 3THWB 2COWA 2EA2A 2EVRA 2HQ5A 1M8VA 2CH4W 1IBKK 2PX9A 4H0PA 3I53A 4OPJA 3NVKA 3ID8A 1X6GA 2P81A 3MO8A 1M8MA 4B23A 1KHIA 3NGPA 5EG2A 2QWNA 3C65A 3I8BA 1DP3A 4O8KA 4AHCA 4A3KJ 5FKKA 3DTKA 4J19A 3CCJT 2NUZA 3NF6A 1OULA 1NMNA 3QO3A 3GO5A 1GLCG 1P7MA 3T1BA 1DGRM 4IF4A 4UUSA 3MEEA 3L6QA 4FJGA 3WHCA 4HXJA 1XGSA 4M45A 4A5NA 4FYYB 2XY8A 3DMJA 4C2UA 3KD5E 1I5ZA 4KH6A 3OIQA 3VF2A 3CXCP 2KK4A 1C6VX 1VQOA 3K6GA 3JCMJ 3TAPA 2HYFA 4MMKA 1TV6A 2QCOA 4A4KA 2BDPA 3JSCA 1T0FA 3K4NA 1O7FA 2M5WA 4OP0A 3CCVT 1TG0A 1K61A 3O9TA 2DNUA 4O0JA 5BR9A 4J2DA 1Q81U 3SZPA 3VS3A 1JLBA 2Y4YA 2O9SA 3FXMA 1MNEA 1FTTA 3ZOBA 2GUPA 1I27A 3A5MC 3R9PA 2ZJPF 4H5TA 1UEBA 3GBTA 4G7ZF 4M3FA 1U6GA 1ORPA 1X43A 1I1SA 5HP1A 1VQ4Q 2GWRA 3GP8A 4FU6A 4FSVA 5GPAA 4RG8A 1L0OC 1BN5A 1SSFA 1BGXT 5HLHA 3F2KA 4MLOA 4C30A 1QWFA 4IHSA 3CCLT 4CGGA 4WFBL 4FLYA 3M8SA 2EIMH 4DF8A 2DU9A 4WWCA 3C94A 5GANh 5AFUH 4WXCA 2JVGA 2MOXA 2RJFA 2F2EA 1HJDA 2V8KA 3LX7A 4DHYA 1QQOA 5CO7A 1IJJA 3CHWA 3BEXA 1R8OB 1W7PD 4BE2A 4P5NA 1FTZA 5GAN6 4BHPA 4JX4A 4RTUA 4I7FA 3IL2A 4M3YA 1PWTA 1VNDA 2LF8A 1QQIA 3Q1JA 1VQNN 1QHAA 3MEXA 1HXDA 3HOYJ 4LG0B 2NRAC 3I8DA 4XTVA 4GNIA 5CLSA 1YITI 1SV5A 1ARKA 1DP7P 4O6JA 2M51A 3BLYA 2O8XA 2X3XD 2IBDA 2RQVA 5LGUA 2EQIA 5GAMf 3JCMb 5GAOm 3CCSA 4YTLA 1VQPT 2MABA 1ZG1A 2HHTA 2X0LA 1NBWA 3JRGA 2K2MA 5K5OA 2LR8A 2UXXA 4BXUA 5FLXO 4GKKK 2GX9A 1EV7A 3BR5A 5KYNA 2YPRA 5IXBA 2GBZA 1QPMA 2QBYB 4QVCA 3D4VA 4U7BA 4M7AB 2FOWA 3VERA 3ZQCA 1LW0A 3RMQA 4FOEA 4YELA 4E47A 4DV5K 3QRFF 5DM6L 3CJNA 1HR0K 1Z9QA 4U0VA 1BKBA 2OX7A 4F8RA 3LA7A 1CF7A 4H0EA 5JS2A 1Z1DA 2M0YA 2AO9A 2NOFA 4BHBA 2YUQA 2RJDA 1I1JA 1VQ4I 3I59B 2QDYB 3JB9H 1NLVA 3B6PA 1ZR2A 3ASKA 3BG7A 2F5CA 2DMUA 2ZM6K 3EUHA 3O4NA 4YFKF 4PGHA 2EZIA 1G2BA 1NLOC 3R60A 1HQEA 1YITT 2HYJA 4K25A 3DLHA 3DLGA 3SYZA 1Q9XA 4I9QA 3MP8A 3ZSWA 2A36A 4E3SA 3TEEA 2R7ZJ 4HG2A 2CP7A 3IFRA 4H5VA 1MWMA 3PQKA 2L8DA 5BPIA 2NS8A 3SEQA 2LMJA 2FZKB 5CKBA 3ZT2A 2LX9A 3KK7A 1ZGWA 4DS5A 2F4OB 2FBKA 1VQMQ 2DVEA 1UUEA 1VQ5N 3AVIA 1VTNC 3FIWA 1Q82O 4LLGF 1H88C 2E1NA 3WG7H 4PSWA 4OPAA 3UKUA 4O44A 1O57A 1RC9A 3FF5A 2IIRA 2EZKA 3HC7A 4PUSA 1WSIA 3QEVA 4JBAA 4JQFA 4HLXA 3ULEB 3CM6A 4E1JA 3E6DA 3QKJA 4FT4A 3WTXC 1R5ID 4DU1A 1S1UA 4NNJA 3SLCA 3HJEA 1S8NA 2RNAA 4EP4A 2E1HA 4EVIA 2KHMA 4BEHA 2R7FA 2MSYA 3FGUA 3FE1A 3W3DA 3ECOA 1MGTA 1T6DA 3EHQA 4L6V5 1D0ZA 1MMSA 3JRCA 2D9TA 3ZMDA 3O3GA 1UHCA 1J5OA 3H41A 2HS5A 1VQNQ 4FPBA 4W5RA 3LAJA 1J3TA 1OJLA 3H5AA 4DQ8A 3RZOJ 5ERIA 4KISA 2R57A 2QA4I 4MLEA 4DSEA 4B9XA 2V1NA 2BXZA 4IFEA 4IL6C 2RKIA 3D0SA 4YEJA 4LN2A 5E8GA 1MUDA 3AO4A 3CCEA 5AQNA 3GIBA 2M1HA 3T9NA 3G6EQ 3E5UA 3LWLA 5GANj 3JR9A 1MD0A 3K58A 1I0CA 3DLKA 2G8WA 3FXOA 4A2AA 4BRHA 4EJTA 4CCMA 4BGDA 3HB9A 2O61A 2ISZA 2EA4A 2HBKA 1MKMA 4BG9A 2KRHA 3MP6A 3R1XA 1VQMI 2E2IJ 2XIGA 2OPQA 3P1GA 1R0AA 1RT5A 2COZA 1L3LA 3M58A 3OGDA 1O1WA 4YOUA 1PKTA 2IVPA 3HZJA 1R58A 5LLQA 1EZZB 3SPZA 1U49A 1WIEA 2X35A 2DMTA 1QVPA 2V1DA 1QKWA 5C2DA 1F1BB 1Y8QB 1TVRA 4LITA 3MZHA 2LMDA 1O3SA 3ZEUA 3J80E 4JX6A 3U6FA 2CT4A 2HQHA 1WJDA 2DPUA 2GBYA 1YI2N 3A0HC 3WNGA 1BL0A 1VSFA 2VUMJ 4Z88A 2E34A 5J39A 1UJ0A 3LPUA 1W7AA 4E4HA 1XQHA 1MH4A 3GX4X 3ULQB 5J2NA 1R1TA 4LF4K 2CGKA 2QA4T 2Z1IA 2PBIA 3TBIA 4AD9A 2ZAEA 4B1YB 5D5XB 2CQKA 3QYHB 3FXQA 1B1BA 3JCMQ 1QGPA 1TAQA 1VQNI 4CEZA 5KGXA 3O3KA 4QVZA 2MC4A 1ZHIA 4HKEA 3P8DA 2Q3SA 1VAZA 2YRCA 3ZETB 4OFEA 1Y64A 1WJ5A 2KL4A 2KIUA 1VQMT 1YAGA 4N0AA 2CV1A 5KPTA 4Y91A 4LD6A 2VT3A 3GFIA 2K02A 2YU9J 1BCMA 3G6EI 2AZSA 5AR0A 2EK5A 1VQ5Q 4IO8A 1ZYQA 2XASA 3IP4B 3WU2C 5FU7B 2PBDA 4HQEA 1E4FT 3L2QA 1ZBSA 3ZR8X 5LJ3g 4BWMA 3GOXA 2MK5A 3GLXA 2E2OA 1OVQA 5J1EA 4R55A 1C1CA 3VS0A 1RZ4A 4HCBA 3S9HA 3O9SA 4CSWA 3WXLA 1HBXG 2F4VK 4KAZA 4KT6A 3P9KA 1LFPA 2PJRA 1JLCA 4OMZA 3M8PA 5HRNA 3DP7A 5AT1B 3CCMT 3JAMK 4CA0A 1FYNA 1QCNA 4DR7K 3PGGA 4M3EA 2PU9B 4QSHA 2ESWA 3NHNA 3LSRA 3U2RA 3RNJA 3L4IA 4HVWA 4M63C 3QBYA 1BR4A 4PKCC 1FOXA 5AZJB 3CPWM 4FJJA 3JB9F 2XDVA 3CERA 1NGEA 4JK9A 1G4DA 4A0YA 2BVMA 2DEQA 1OCOH 2FF6A 3M0UA 1V55H 4FE7A 2NXNB 4BC3A 2O8FB 1XPXA 3VRZA 3GTGJ 3MN7A 4N4HA 2WB1A 1K8AC 5A0GA 3O5ZA 1Y1WJ 3G6ET 1B9DA 2FRWA 1J0RA 4FWPA 1EQYA 4H0VB 2NLUA 3VU3C 2M9HA 5M5YJ 4M75C 3QZ9B 3C7NB 2XGXA 1HMVA 2G6FX 1EF4A 1C6VA 2YV0X 2P9NB 3CO7C 1REPC 4OX9K 1DU6A 1MSFC 3V8JA 1XQPA 1NGNA 1VQ5I 1VI0A 2ECZA 3M3YJ 4NS5A 1XNQK 4WXDA 2P7CB 5FKOA 4ATOA 2ZF5O 4XRFA 2VE9A 1LQ1A 3K0SA 1GOCA 3P7NA 4DSKA 4KICA 5EZGA 4V19S 3OA6A 1SRLA 3LNQA 1M3QA 3AVBA 4OIQF 1OQYA 4DYRA 1P90A 4F3TA 1KD1R 3GFJA 3ZP5A 1WI9A 2XAQA 1NJIO 1IV6A 1TSFA 3CPWS 2VQGA 1YI2Q 1HQUA 3CW7A 1KA8A 3NTKA 1TTHB 5KYYB 1PG5B 2JTVA 1QCFA 1A0NB 2XICA 1R0BG 5LBQA 1SMYF 3L1PA 4LJZF 3RKQA 2RJCA 2JS2A 3TREA 4B4CA 3DXKB 3CJQB 3HG9A 2UXCK 3CMAA 3LP1A 4CZGA 1S6QA 3BY7A 4D1QA 1SKRA 4Z89A 2EILH 3OOPA 3WXJA 1JHHA 2VONA 3FDRA 2KQWA 5L3EA 1JCEA 5C2FA 5AYFA 4F14A 1JXEA 4GDFA 5FKNA 3PVQA 1EJ9A 4FJLA 1IV0A 2Q8KA 4G8XA 3OYKA 3NQOA 3QYFA 3QOEA 1S5JA 2IA0A 2X6WA 2AA4A 3GW2A 5B1BH 2P4RA 2QKKA 5GAN2 1BOAA 4CJ7A 1K6YA 4DIQA 1Y0UA 1JRIA 3DKYA 5DM7F 3VGKA 2O2OA 3DKWA 1R00A 4XLEA 4IZ9A 3DBLB 4EJUA 1KQ9A 1VQOT 2XHKA 3E9OA 3I3LA 3LSJA 1HF0A 2FPFA 1QHHD 4OB1B 3IC7A 3CFPA 4F16A 3ASOH 1O4XA 3CCSI 4CJKA 2ZXIA 1B3QA 1WAFA 4AT1B 3QPLA 3QYEA 2WUSA 2R5ZA 1ZBIA 3MXJA 5F1RA 3GTMJ 4RM3A 3MN6A 4M77A 2E3IA 4B3OA 3VYUB 3VB2A 1V76A 4HVJA 4BWJA 3KP6A 4LNPA 1HX1A 1DGKN 2JA6J 4JI2K 3KFWX 3CJ7A 3F72A 2Y30A 4GGGA 3L2UA 4MHGA 2DA1A 4LFCK 1R5GA 1X1BA 3VQPA 1L3TA 1P92A 2LDMA 4DBFA 1UA1A 3K1NA 2XPUA 2QEXA 5LJ3d 1ONVA 2F7TA 4EMHA 4YIFA 4M9ZA 2A37A 4JJNK 4DTJA 5KE3A 1VSLA 3F8FA 3CIPA 3IS9A 3GTKJ 2YUPA 3REOA 5GJWB 2DMOA 4CW7B 2N8GA 3H1QA 2YLBA 1CZ9A 1KG3A 3I56N 5GP9A 4B08A 1V5FA 4M3XA 4CCKA 2JJ7A 2PVDB 3H0GJ 2KFZA 4MFDA 3CCST 2HKXA 2QYZA 1VUBA 2ID3A 2MI6A 4M9XA 3VGMA 4JD2B 2DZCA 1D8KA 3PVLA 5LGTA 3E6BA 1X19A 1VYVA 3H0HA 5ADXH 4M7AD 5EGOB 4KI6A 5IYBJ 3U1DA 1QPIA 2O4XA 3VEZA 1AWJA 3JW4A 4JZ3A 3H3OB 4EIAA 1D9FA 5LHHA 4NXMK 3JCMg 4C0GA 3BZCA 2F5KA 5J8CA 5DYMA 3GLLA 4F55A 3LAKA 1JB0E 3RRHA 2VXFA 3VQ6A 1HSJA 2O5RA 2NUBA 1QHGA 1LPLA 4DTUA 3GTQJ 1WLJA 4FYVB 2YKMA 1VQLA 3S1MJ 2QQ8A 3HHHA 4IOXA 4G6DA 1NGGA 1LDDA 2B5JA 4ELUA 2CSQA 2DD5A 4YORA 4DUZK 2LLKA 3IG1A 5B5EC 5KQDA 1X2MA 2R5YA 2GFAA 5FRMA 1FP2A 4MGRA 3M8JA 4N41A 5H1SQ 4RAFA 2AJQA 3J81K 2YNHA 2QM3A 2DJZA 4CJQA 1FIAA 3LSGA 4M78B 3N4PA 2XPVA 1BI4B 4RCBA 1GLAG 5TRDA 1ZG3A 5J26A 3GZNB 2P4WA 3K2ZA 1FEXA 3N4MA 3BR3A 2JA5J 1XSDA 2E3HA 4QLCU 2A5XA 4OMYA 2JA8J 1VQ8N 4B6MA 4NHJA 4G12A 3LMMA 1NK3P 2W85A 2RI3A 1R4MB 3LAMA 1XDSA 1USSA 5KPRA 3LPTA 4A3IJ 5GAOp 1KQSM 4OLBA 3OMGA 3CCEI 2F5EA 2WY7Q 4QKUA 3GF5A 2OBPA 4C2MJ 2EFQA 1O3QA 3HRMA 4BHCA 1NJYA 1A6QA 4HAMA 2V9KA 4NC6A 4Q47A 1WSEA 4DV3K 1YXQA 2JPSA 1YS6A 1AKHB 3OQ5A 3WODF 1D5VA 1WGSA 2GXAA 4JRKA 1KFSA 5L8RE 3OV8A 2YHYA 2JVHA 5CZ1A 2E1MC 4M75G 5ECAA 2QWQA 1XQOA 2DA6A 4C5IA 1Y07A 2VCPA 3K10A 4AG2C 5FKLA 1WHGA 1R23A 2JUFA 3G2BA 4WCEL 1E3MA 2P9PA 2FXAA 1RT2A 3FZFA 1KQJA 3CWAA 3MVPA 1Y0MA 2L3SA 2P6TA 4ZGJB 3CF2A 3S15J 2KDSA 3NCIA 1UJYA 3HRSA 2VN2A 2DFHA 1L5UA 2YCHA 3AVCA 3BF3A 2NOGA 3C2BA 2HNZA 1KC8O 2L3PA 2KAFA 1AD5A 1NPPA 3BG9A 1DDNA 4O0IA 3P5JA 4LG3A 1YTUA 1GT0C 3SEMA 2HQNA 1J75A 2ZGZA 2KW4A 3I56Q 4CIFA 1M4ZA 5IWAK 1KQSS 2OD5A 2V7ZA 1X69A 2OCEA 3CCET 2A3LA 5GANe 1D1BA 4XTUA 1H3ZA 4G9YA 1QKXA 4OKJA 2RA2A 3RVCA 3AKZA 1SS6A 2DA7A 2HVSA 1LVKA 1T08B 1VF9A 4PJOC 4DYCA 4B3AA 4LF6K 1MMNA 4JYKA 1OPLA 4J9GA 3WNFA 1RBRA 1NWKA 1N36K 5IN1A 2IVNA 1IH7A 3HOUJ 1OV3A 2ZCWA 1NGBA 3IHUA 1AEYA 4K2EA 4MEXF 1BC7C 3LH5A 5A2QE 5D8KB 3UIQA 4ISGA 1KG2A 2MH2A 3OYFA 3W2VA 4OJRA 2Z5UA 3T69A 1LJ9A 1LB2A 4BS9A 5IXFA 2RQWA 2WTUA 1ZUKA 3F8BA 4EW4A 4XTYA 4AVZA 5D3GA 1PYVA 1QCOA 3LZJA 4AFQC 1MUZA 2JRTA 4O5BA 4WK8F 3THXB 4N9HA 3OA9A 4MZPA 3SUNA 3DLAA 1JQQA 1JJ6C 4PJ0C 2JHJA 1SKSA 4OMPA 4CH7A 1FN7A 4Y28E 2KRMA 3IRRA 3Q3SA 4KUDK 5J1RA 1U9NA 4R0KA 4C92B 2KZGA 2E7XA 1ASWA 3CMAQ 5IH2A 1K1ZA 2Z16A 1RPWA 1RTHA 4II3A 2A6EF 3DXMB 4GKJK 4QOZB 3B02A 1ORKA 4RW8A 1TL1A 1ZSZA 3JCMd 5LHGA 1XG1A 3AVLA 4IUUA 4FLTA 1X2QA 3FEOA 3VYGA 4WXHA 1RLQC 4J2EA 2LNBA 4BRNA 3HM9A 3PX4A 5FD5A 1SFUA 1HYOA 3LFKA 4I6MA 1RACB 5LJ5d 1VQ8Q 1ILYA 3PIPF 3DRPA 1BDGA 1E3PA 3I56I 2ZXHA 3K4BA 5TJJA 5EEHA 4P96A 2R7TA 1A5WA 3ER0A 3E1SA 3ID6A 2CZ0B 1R7JA 3MECA 2HEQA 3VS4A 1GLFO 1NTCA 3CUQC 2EPFA 3FR0A 2R7UA 4CHYA 1TYQA 3S14J 4ELZC 3QAHA 2CMPA 4C92A 4B9LA 2A3SA 2L4MA 2BE9B 5EZHA 3COAC 3O9RA 4WFNL 5CKTA 4BGAA 1SKWA 3VS2A 3HOWJ 7AT1B 2VUBA 2Y90A 4ESFA 4EZ6A 1S3JA 4CO8A 1RI9A 1AOYA 3VQ8A 1T38A 3QBXA 3G71A 3PLAA 3ZQLA 2NVUB 1D3BB 4MQ3A 1NOZA 2DA9A 4HV6A 4XMYA 5CKEA 3RSNA 4ZDOA 1P8ZA 1X3NA 1M1EB 4IXAA 4H5RA 4IFYA 1GV2A 3OYAA 3CDIA 5GAOr 2CP6A 4B09A 4BC4A 1DEJA 1KTQA 2D0AA 3JXUA 4DZPA 3WTZA 3FM3A 2VB6A 4LE9A 4CBUA 4KGVB 2KTQA 3LQRA 3ZQHA 3QPSA 5GANf 1KQ2A 3KLEA 3U3YA 3IRQA 1YHQA 4A5AA 3CMAI 3A0IX 3MWPA 4AIDA 2BEOA 3IH2A 1JXSA 1N32K 4NCBA 2CREA 1I94K 1U04A 3TGNA 3O1BA 5HS7A 3PY8A 5CVRA 4FX0A 1Y1VJ 3KTUA 4KH1B 1HNZK 1PM3A 1WWXA 5IY5H 1WSGA 2Q97A 1IZ1A 4FWOA 2JLEA 2BIVA 1I3AA 5B8HA 1TK8A 1GLEG 4OGEA 2LSNA 1H92A 4B43A 3EH1A 3PJRA 3WGIA 2LJ3A 1VRUA 1SF9A 2KEAA 1RIOH 1IN4A 1NJIU 2ZZDA 1OYXA 4I2OA 1U78A 4BB7A 4MO4A 1QTMA 3V7SA 3L1AA 3HVRA 3DXJF 5AQKA 3TAFA 4C5HA 4S04A 3LSMA 2FJ1A 1BB9A 3HL8A 5CK9A 3ELKA 4RW7A 3IAYA 4ENNA 2W1OA 2P8TA 4E7HA 1JLFA 3ZQ7A 3X28B 1RUOA 4IO9L 3ABKH 4A3LJ 4WF9L 4DV6K 1KU9A 3JRBA 3TSPA 4CF2A 4C5EA 4LF8K 1NMDA 1EP4A 2V6CA 2OF7A 1P4XA 3L2WA 3I35A 2EWNA 5M5WJ 1ZRCA 2GXGA 4O55A 5KYXB 3CMAT 4FM2A 1WDXA 1ITYA 2K9NA 1VQLQ 3T1YK 5L3DA 1Q7YR 3KLFA 1Z3YA 3O3FA 3BTIA 1ZTRA 2L9SA 3OWTA 3O08A 2LD5A 1WB9A 4FLXA 3SPYA 3G10A 2BV6A 2YSQA 3CJ1A 2DOAA 2P5GA 5DY9A 4B8XA 5CKHA 2KP6A 3DJCA 3H3VK 4M77D 1ZH5A 1KO9A 3ZQIA 2QGUA 3C18A 2W03A 3OW2A 4CFBA 5HDNA 3PFSA 3FM5A 4DTMA 2ENMA 4DOZA 2LC4A 1T95A 4FJMA 3ZMZA 3S2WA 2W84A 1M1KC 3VF4A 3V42A 4CF0