3F10A

Crystal structure of clostridium acetobutylicum 8-oxoguanine dna glycosylase in complex with 8-oxoguanosine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
b'MDFDMIEEKKDSVIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEKVVEVQKIGEDVVIYNINEEEFKNVWSEYFDLYRDYGEIKKELSRDPLLKKSVDFGEGIRILRQDPFEILLSFIISANNRIPMIKKCINNISEKAGKKLEYKGKIYYAFPTVDKLHEFTEKDFEECTAGFRAKYLKDTVDRIYNGELNLEYIKSLNDNECHEELKKFMGVGPQVADCIMLFSMQKYSAFPVDTWVKKAMMSLYVAPDVSLKKIRDFGREKFGSLSGFAQQYLFYYARENNIQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8-oxoguanine-DNA-glycosylase
molecule tags Hydrolase, lyase
source organism Clostridium acetobutylicum
publication title Structural characterization of Clostridium acetobutylicum 8-oxoguanine DNA glycosylase in its apo form and in complex with 8-oxodeoxyguanosine.
pubmed doi rcsb
total genus 107
structure length 292
sequence length 292
ec nomenclature ec 3.2.2.-:
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3f10A02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 3f10A03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3f10A01
1KO9A 1RRQA 3CVSA 3CWAA 3OH6A 4EJYA 4AIAA 3G0QA 1NKUA 4B21A 4B24A 1P7MA 1N39A 4EVVA 2OFIA 3D4VA 1N3AA 1ORNA 1WEGA 2NOHA 2NOZA 1YQLA 4B23A 3N0UA 4OFEA 1KG5A 1KG4A 2NOLA 1VRLA 1HU0A 1NGNA 4E9FA 2YG8A 1XG7A 4E9GA 1MPGA 4EA4A 1WEFA 3I0XA 2JHNA 1M3QA 4UNFA 3F10A 3F0ZA 4AI5A 3CW7A 1PU7A 4EA5A 4EW0A 1KG2A 3IH7A 3FHFA 5DPKA 1EBMA 1KQJA 1YQKA 1FN7A 1PU6A 2NOEA 1LWWA 4YPHA 4AI4A 1MUYA 2OFKA 4OFAA 3IHOA 1KG7A 2YG9A 5KN8A 2NOBA 3FSPA 1PU8A 3OH9A 4EW4A 1ORPA 3CWUA 1MUNA 1LMZA 1DIZA 2NOFA 3KNTA 4DK9A 4E9HA 4EJZA 1LWYA 3CWTA 4PIIA 1XQOA 2I5WA 2ABKA 4E9EA 1P59A 1PVSA 3CWSA 1LWVA 5CHZA 3OGDA 1YQMA 1M3HA 4OFHA 1WEIA 4UOBA 1YQRA 3CVTA 5AN4A 3S6IA 4HSBA 3FHGA 3N5NX 1KEAA 2JG6A 1KG6A 4YOQA 1N3CA 1XQPA 5KN9A 3KTUA 4B22A 3I0WA 2NOIA 2XHIA 2H56A 1MUDA 1RRSA 1KG3A 4YPRA 2JHJA
chains in the Genus database with same CATH superfamily
5FROA 3CWAA 4EJYA 1QN9A 4E7KA 4ROCB 1P7MA 4EVVA 2OFIA 1N3AA 2NOHA 2D0BA 1KYDA 4ZTJA 1YQLA 4HJHA 4B23A 4WZSD 4WXAA 1B9KA 2NOLA 1MP9A 1TBAB 4E9FA 1XSZA 1MPGA 4EA4A 1PCZA 2NLVA 2JHNA 4UNFA 4AI5A 3OS2A 1C47A 3IH7A 2R5XA 2JPIA 1FN7A 4E7LA 5BMNA 2EHBD 3ULXA 3OS1A 1UL7A 2Z0FA 2OFKA 2YG9A 5KN8A 1PU8A 2F7LA 4EW4A 1ORPA 3CWUA 3BKQX 4EAIA 3OYAA 5BMPA 4QG5A 4EJZA 2IV8A 2FKFA 2NVMA 1EUVA 4PIIA 1UT7A 1K2YX 1LWVA 2G30A 3ENOC 1T6AA 1UT4A 1P5DX 3OYGA 1LXTA 1KY7A 3TDHA 3OYKA 4IKFA 3DPTA 2JG6A 1KG6A 4YOQA 3L2QA 3OYDA 3KTUA 4B22A 3S3OA 2H56A 1KG3A 2OOYA 4BDYA 4YPRA 4EAGA 2V75A 3C04A 1NKUA 2FUVA 4E7HA 1WEGA 3KRMA 1K35A 5KL0A 1KG5A 1KG4A 1HU0A 1KYFA 1NGNA 3OYFA 1WQAA 4E9GA 2O3OA 1WEFA 3PDKA 4BJUA 2VJ0A 3L2VA 1VOKA 1M5Q1 4B0AA 4C7PA 3F0ZA 2W04A 2DKAA 1C4GA 3CW7A 3OSTA 3S3MA 3OYLA 4EA5A 3EIKA 1CDWA 3RSMA 1YQKA 5JMVD 1PU6A 2NOEA 1NVPA 1NH2A 1TUOA 3R2XC 1KFIA 5EPCA 3FSPA 1MUNA 1LMZA 1QN8A 4E9HA 1TBPA 4E7JA 3N89A 3OSMA 2ABKA 4E9EA 1PVSA 3CWSA 3HS9A 1YTFA 4UOBA 5AN4A 3S6IA 2QLVA 4EAJA 3N5NX 2H4LX 1KEAA 1C9BB 2NOIA 1R4XA 4BACA 1KY6A 1KO9A 1RRQA 1QN7A 3PMGA 2FKMX 3EAYA 1N39A 3D4VA 4BE2A 3S3NA 2NOZA 2QR1A 3OCIA 1QTPA 4Q11A 3VW4A 2YH5A 1PCJX 1QN5A 1VRLA 1E42A 2YG8A 1QTSA 1AISA 4EALA 1JFIC 2YA3A 1M3QA 3F10A 1PU7A 1VTLE 4D7QA 5IYDP 4EW0A 3RPJA 5JN5A 1Q9UA 1EBMA 1KQJA 3HS8A 3L2WA 2MZ8A 1V5SA 4TPSA 1QNBA 4YPHA 3DPUA 4DULA 1D3UA 3OYBA 3OYMA 1MUYA 2HKPA 2DKCA 1J3MA 2QRDA 3I3WA 3OH9A 2HL8A 2QREA 2Z8UA 3OYIA 2NOFA 3KNTA 4DK9A 1PCMX 3OYCA 3H1ZA 5IYBP 3OY9A 3VN5A 4CFFA 3L2UA 4ROEB 3OC3C 4BE0A 5FRNA 3CWTA 3SNSA 2I5WA 4BDZA 1P5GX 3OLPA 1YQMA 1VTOA 1WEIA 2Y8LA 3ASMA 1YQRA 2W03A 4HSBA 3NA5A 3UW2A 4BE1A 1VKLA 1N3CA 5KN9A 1WJWA 3ENCA 2ZFDB 1MUDA 5F9CA 1RRSA 2V92A 3CVSA 2JPSA 3OH6A 1KYUA 4EAKA 4AIAA 3G0QA 3OS0A 4B21A 3OYNA 4WX8A 2Y8QA 2NWVA 4B24A 1NGMA 1RM1A 1ORNA 2HL9A 3N0UA 4OFEA 1QN3A 4I8OA 1XG7A 1VOLB 2FGTA 3I0XA 1KFQA 3NNQA 1QNCA 2H5AX 1QNAA 4IL8A 1KG2A 3FHFA 5DPKA 2LAEA 1W80A 1LWWA 3D7QA 5FRMA 1QN6A 4AI4A 1TGHA 2MJ7A 2D0AA 2HZSA 4OFAA 3IHOA 1KG7A 1JDYA 2NOBA 1QNEA 2PWWA 1YTBA 3TE5A 1DIZA 2HZMA 2V9JA 2OOXA 2QRCA 3T4NA 5HSHA 1QN4A 1LWYA 4MRQA 2IV9A 3OSEA 3L2RA 2DKDA 1XQOA 1PZDA 1P59A 4PY5A 3OYJA 5CHZA 3OGDA 4ZTFA 1M3HA 4OFHA 4D7RA 3CVTA 2JOIA 3LCNA 3FHGA 5IYCP 2V8QA 4NZGA 3OYEA 1U84A 4E7IA 1XQPA 2D0CA 3I0WA 4RODB 2XHIA 3OYHA 2JHJA
chains in the Genus database with same CATH topology
1KO9A 1RRQA 3CVSA 3CWAA 1QN7A 3OH6A 1KYUA 4EJYA 4AIAA 3G0QA 1NKUA 4B21A 1QN9A 4ROCB 4B24A 1P7MA 1N39A 1NGMA 4EVVA 2OFIA 3D4VA 1N3AA 1ORNA 1RM1A 1WEGA 2NOHA 2NOZA 2D0BA 1KYDA 3KRMA 3OCIA 1YQLA 4B23A 1KY6A 1QTPA 4Q11A 4WZSD 3N0UA 4OFEA 1QN3A 2YH5A 1KG5A 1KG4A 1B9KA 2NOLA 1QN5A 1VRLA 1MP9A 1HU0A 1KYFA 1NGNA 4E9FA 1E42A 1TBAB 4I8OA 2YG8A 1XG7A 1QTSA 4E9GA 1MPGA 4EA4A 2O3OA 1WEFA 1PCZA 1VOLB 1AISA 2VJ0A 2FGTA 1JFIC 3I0XA 2JHNA 1M3QA 1VOKA 4B0AA 4UNFA 3F10A 3F0ZA 4AI5A 3CW7A 1PU7A 1VTLE 3OSTA 1QNCA 5IYDP 4EA5A 4EW0A 1QNAA 1KG2A 3IH7A 3EIKA 3RPJA 3FHFA 5DPKA 1CDWA 1EBMA 1KQJA 3HS8A 1YQKA 2LAEA 1FN7A 2MZ8A 1PU6A 2NOEA 1W80A 1LWWA 4TPSA 1NVPA 1QNBA 4YPHA 1QN6A 1NH2A 3DPUA 4AI4A 4DULA 1D3UA 1TGHA 3ULXA 2MJ7A 2D0AA 2HZSA 1MUYA 2OFKA 4OFAA 3IHOA 1KG7A 2YG9A 5KN8A 2NOBA 3FSPA 1PU8A 3OH9A 4EW4A 1ORPA 1QNEA 3CWUA 1MUNA 1YTBA 1LMZA 1DIZA 2Z8UA 2HZMA 2NOFA 3KNTA 4DK9A 5IYBP 1QN8A 4E9HA 3H1ZA 1QN4A 1TBPA 3VN5A 4EJZA 1LWYA 2IV8A 4ROEB 3N89A 3OC3C 2IV9A 3CWTA 3OSMA 3SNSA 1UT7A 4PIIA 1XQOA 2I5WA 2ABKA 1PZDA 4E9EA 1P59A 4PY5A 1PVSA 3CWSA 1LWVA 2G30A 5CHZA 3OGDA 1UT4A 1YQMA 1M3HA 3HS9A 4OFHA 1VTOA 1YTFA 1WEIA 1KY7A 3ASMA 4UOBA 1YQRA 3CVTA 5AN4A 3S6IA 2JOIA 4HSBA 3FHGA 5IYCP 3N5NX 1KEAA 2JG6A 3DPTA 1KG6A 4YOQA 1N3CA 1XQPA 5KN9A 3KTUA 4B22A 3I0WA 2NOIA 2D0CA 1C9BB 4RODB 1R4XA 2XHIA 2H56A 1MUDA 1RRSA 1KG3A 4YPRA 2JHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KO9 A;  1RRQ A;  3CVS A;  3CWA A;  3OH6 A;  4EJY A;  4AIA A;  3G0Q A;  1NKU A;  4B21 A;  4B24 A;  1P7M A;  1N39 A;  4EVV A;  2OFI A;  3D4V A;  1N3A A;  1ORN A;  1WEG A;  2NOH A;  2NOZ A;  1YQL A;  4B23 A;  3N0U A;  4OFE A;  1KG5 A;  1KG4 A;  2NOL A;  1VRL A;  1HU0 A;  1NGN A;  4E9F A;  2YG8 A;  1XG7 A;  4E9G A;  1MPG A;  4EA4 A;  1WEF A;  3I0X A;  2JHN A;  1M3Q A;  4UNF A;  3F10 A;  3F0Z A;  4AI5 A;  3CW7 A;  1PU7 A;  4EA5 A;  4EW0 A;  1KG2 A;  3IH7 A;  3FHF A;  5DPK A;  1EBM A;  1KQJ A;  1YQK A;  1FN7 A;  1PU6 A;  2NOE A;  1LWW A;  4YPH A;  4AI4 A;  1MUY A;  2OFK A;  4OFA A;  3IHO A;  1KG7 A;  2YG9 A;  5KN8 A;  2NOB A;  3FSP A;  1PU8 A;  3OH9 A;  4EW4 A;  1ORP A;  3CWU A;  1MUN A;  1LMZ A;  1DIZ A;  2NOF A;  3KNT A;  4DK9 A;  4E9H A;  4EJZ A;  1LWY A;  3CWT A;  4PII A;  1XQO A;  2I5W A;  2ABK A;  4E9E A;  1P59 A;  1PVS A;  3CWS A;  1LWV A;  5CHZ A;  3OGD A;  1YQM A;  1M3H A;  4OFH A;  1WEI A;  4UOB A;  1YQR A;  3CVT A;  5AN4 A;  3S6I A;  4HSB A;  3FHG A;  3N5N X;  1KEA A;  2JG6 A;  1KG6 A;  4YOQ A;  1N3C A;  1XQP A;  5KN9 A;  3KTU A;  4B22 A;  3I0W A;  2NOI A;  2XHI A;  2H56 A;  1MUD A;  1RRS A;  1KG3 A;  4YPR A;  2JHJ A; 
#chains in the Genus database with same CATH topology
 5FRO A;  3CWA A;  4EJY A;  1QN9 A;  4E7K A;  4ROC B;  1P7M A;  4EVV A;  2OFI A;  1N3A A;  2NOH A;  2D0B A;  1KYD A;  4ZTJ A;  1YQL A;  4HJH A;  4B23 A;  4WZS D;  4WXA A;  1B9K A;  2NOL A;  1MP9 A;  1TBA B;  4E9F A;  1XSZ A;  1MPG A;  4EA4 A;  1PCZ A;  2NLV A;  2JHN A;  4UNF A;  4AI5 A;  3OS2 A;  1C47 A;  3IH7 A;  2R5X A;  2JPI A;  1FN7 A;  4E7L A;  5BMN A;  2EHB D;  3ULX A;  3OS1 A;  1UL7 A;  2Z0F A;  2OFK A;  2YG9 A;  5KN8 A;  1PU8 A;  2F7L A;  4EW4 A;  1ORP A;  3CWU A;  3BKQ X;  4EAI A;  3OYA A;  5BMP A;  4QG5 A;  4EJZ A;  2IV8 A;  2FKF A;  2NVM A;  1EUV A;  4PII A;  1UT7 A;  1K2Y X;  1LWV A;  2G30 A;  3ENO C;  1T6A A;  1UT4 A;  1P5D X;  3OYG A;  1LXT A;  1KY7 A;  3TDH A;  3OYK A;  4IKF A;  3DPT A;  2JG6 A;  1KG6 A;  4YOQ A;  3L2Q A;  3OYD A;  3KTU A;  4B22 A;  3S3O A;  2H56 A;  1KG3 A;  2OOY A;  4BDY A;  4YPR A;  4EAG A;  2V75 A;  3C04 A;  1NKU A;  2FUV A;  4E7H A;  1WEG A;  3KRM A;  1K35 A;  5KL0 A;  1KG5 A;  1KG4 A;  1HU0 A;  1KYF A;  1NGN A;  3OYF A;  1WQA A;  4E9G A;  2O3O A;  1WEF A;  3PDK A;  4BJU A;  2VJ0 A;  3L2V A;  1VOK A;  1M5Q 1;  4B0A A;  4C7P A;  3F0Z A;  2W04 A;  2DKA A;  1C4G A;  3CW7 A;  3OST A;  3S3M A;  3OYL A;  4EA5 A;  3EIK A;  1CDW A;  3RSM A;  1YQK A;  5JMV D;  1PU6 A;  2NOE A;  1NVP A;  1NH2 A;  1TUO A;  3R2X C;  1KFI A;  5EPC A;  3FSP A;  1MUN A;  1LMZ A;  1QN8 A;  4E9H A;  1TBP A;  4E7J A;  3N89 A;  3OSM A;  2ABK A;  4E9E A;  1PVS A;  3CWS A;  3HS9 A;  1YTF A;  4UOB A;  5AN4 A;  3S6I A;  2QLV A;  4EAJ A;  3N5N X;  2H4L X;  1KEA A;  1C9B B;  2NOI A;  1R4X A;  4BAC A;  1KY6 A;  1KO9 A;  1RRQ A;  1QN7 A;  3PMG A;  2FKM X;  3EAY A;  1N39 A;  3D4V A;  4BE2 A;  3S3N A;  2NOZ A;  2QR1 A;  3OCI A;  1QTP A;  4Q11 A;  3VW4 A;  2YH5 A;  1PCJ X;  1QN5 A;  1VRL A;  1E42 A;  2YG8 A;  1QTS A;  1AIS A;  4EAL A;  1JFI C;  2YA3 A;  1M3Q A;  3F10 A;  1PU7 A;  1VTL E;  4D7Q A;  5IYD P;  4EW0 A;  3RPJ A;  5JN5 A;  1Q9U A;  1EBM A;  1KQJ A;  3HS8 A;  3L2W A;  2MZ8 A;  1V5S A;  4TPS A;  1QNB A;  4YPH A;  3DPU A;  4DUL A;  1D3U A;  3OYB A;  3OYM A;  1MUY A;  2HKP A;  2DKC A;  1J3M A;  2QRD A;  3I3W A;  3OH9 A;  2HL8 A;  2QRE A;  2Z8U A;  3OYI A;  2NOF A;  3KNT A;  4DK9 A;  1PCM X;  3OYC A;  3H1Z A;  5IYB P;  3OY9 A;  3VN5 A;  4CFF A;  3L2U A;  4ROE B;  3OC3 C;  4BE0 A;  5FRN A;  3CWT A;  3SNS A;  2I5W A;  4BDZ A;  1P5G X;  3OLP A;  1YQM A;  1VTO A;  1WEI A;  2Y8L A;  3ASM A;  1YQR A;  2W03 A;  4HSB A;  3NA5 A;  3UW2 A;  4BE1 A;  1VKL A;  1N3C A;  5KN9 A;  1WJW A;  3ENC A;  2ZFD B;  1MUD A;  5F9C A;  1RRS A;  2V92 A;  3CVS A;  2JPS A;  3OH6 A;  1KYU A;  4EAK A;  4AIA A;  3G0Q A;  3OS0 A;  4B21 A;  3OYN A;  4WX8 A;  2Y8Q A;  2NWV A;  4B24 A;  1NGM A;  1RM1 A;  1ORN A;  2HL9 A;  3N0U A;  4OFE A;  1QN3 A;  4I8O A;  1XG7 A;  1VOL B;  2FGT A;  3I0X A;  1KFQ A;  3NNQ A;  1QNC A;  2H5A X;  1QNA A;  4IL8 A;  1KG2 A;  3FHF A;  5DPK A;  2LAE A;  1W80 A;  1LWW A;  3D7Q A;  5FRM A;  1QN6 A;  4AI4 A;  1TGH A;  2MJ7 A;  2D0A A;  2HZS A;  4OFA A;  3IHO A;  1KG7 A;  1JDY A;  2NOB A;  1QNE A;  2PWW A;  1YTB A;  3TE5 A;  1DIZ A;  2HZM A;  2V9J A;  2OOX A;  2QRC A;  3T4N A;  5HSH A;  1QN4 A;  1LWY A;  4MRQ A;  2IV9 A;  3OSE A;  3L2R A;  2DKD A;  1XQO A;  1PZD A;  1P59 A;  4PY5 A;  3OYJ A;  5CHZ A;  3OGD A;  4ZTF A;  1M3H A;  4OFH A;  4D7R A;  3CVT A;  2JOI A;  3LCN A;  3FHG A;  5IYC P;  2V8Q A;  4NZG A;  3OYE A;  1U84 A;  4E7I A;  1XQP A;  2D0C A;  3I0W A;  4ROD B;  2XHI A;  3OYH A;  2JHJ A; 
#chains in the Genus database with same CATH homology
 1KO9 A;  1RRQ A;  3CVS A;  3CWA A;  1QN7 A;  3OH6 A;  1KYU A;  4EJY A;  4AIA A;  3G0Q A;  1NKU A;  4B21 A;  1QN9 A;  4ROC B;  4B24 A;  1P7M A;  1N39 A;  1NGM A;  4EVV A;  2OFI A;  3D4V A;  1N3A A;  1ORN A;  1RM1 A;  1WEG A;  2NOH A;  2NOZ A;  2D0B A;  1KYD A;  3KRM A;  3OCI A;  1YQL A;  4B23 A;  1KY6 A;  1QTP A;  4Q11 A;  4WZS D;  3N0U A;  4OFE A;  1QN3 A;  2YH5 A;  1KG5 A;  1KG4 A;  1B9K A;  2NOL A;  1QN5 A;  1VRL A;  1MP9 A;  1HU0 A;  1KYF A;  1NGN A;  4E9F A;  1E42 A;  1TBA B;  4I8O A;  2YG8 A;  1XG7 A;  1QTS A;  4E9G A;  1MPG A;  4EA4 A;  2O3O A;  1WEF A;  1PCZ A;  1VOL B;  1AIS A;  2VJ0 A;  2FGT A;  1JFI C;  3I0X A;  2JHN A;  1M3Q A;  1VOK A;  4B0A A;  4UNF A;  3F10 A;  3F0Z A;  4AI5 A;  3CW7 A;  1PU7 A;  1VTL E;  3OST A;  1QNC A;  5IYD P;  4EA5 A;  4EW0 A;  1QNA A;  1KG2 A;  3IH7 A;  3EIK A;  3RPJ A;  3FHF A;  5DPK A;  1CDW A;  1EBM A;  1KQJ A;  3HS8 A;  1YQK A;  2LAE A;  1FN7 A;  2MZ8 A;  1PU6 A;  2NOE A;  1W80 A;  1LWW A;  4TPS A;  1NVP A;  1QNB A;  4YPH A;  1QN6 A;  1NH2 A;  3DPU A;  4AI4 A;  4DUL A;  1D3U A;  1TGH A;  3ULX A;  2MJ7 A;  2D0A A;  2HZS A;  1MUY A;  2OFK A;  4OFA A;  3IHO A;  1KG7 A;  2YG9 A;  5KN8 A;  2NOB A;  3FSP A;  1PU8 A;  3OH9 A;  4EW4 A;  1ORP A;  1QNE A;  3CWU A;  1MUN A;  1YTB A;  1LMZ A;  1DIZ A;  2Z8U A;  2HZM A;  2NOF A;  3KNT A;  4DK9 A;  5IYB P;  1QN8 A;  4E9H A;  3H1Z A;  1QN4 A;  1TBP A;  3VN5 A;  4EJZ A;  1LWY A;  2IV8 A;  4ROE B;  3N89 A;  3OC3 C;  2IV9 A;  3CWT A;  3OSM A;  3SNS A;  1UT7 A;  4PII A;  1XQO A;  2I5W A;  2ABK A;  1PZD A;  4E9E A;  1P59 A;  4PY5 A;  1PVS A;  3CWS A;  1LWV A;  2G30 A;  5CHZ A;  3OGD A;  1UT4 A;  1YQM A;  1M3H A;  3HS9 A;  4OFH A;  1VTO A;  1YTF A;  1WEI A;  1KY7 A;  3ASM A;  4UOB A;  1YQR A;  3CVT A;  5AN4 A;  3S6I A;  2JOI A;  4HSB A;  3FHG A;  5IYC P;  3N5N X;  1KEA A;  2JG6 A;  3DPT A;  1KG6 A;  4YOQ A;  1N3C A;  1XQP A;  5KN9 A;  3KTU A;  4B22 A;  3I0W A;  2NOI A;  2D0C A;  1C9B B;  4ROD B;  1R4X A;  2XHI A;  2H56 A;  1MUD A;  1RRS A;  1KG3 A;  4YPR A;  2JHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...