3F10A

Crystal structure of clostridium acetobutylicum 8-oxoguanine dna glycosylase in complex with 8-oxoguanosine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
MDFDMIEEKKDSVIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEKVVEVQKIGEDVVIYNINEEEFKNVWSEYFDLYRDYGEIKKELSRDPLLKKSVDFGEGIRILRQDPFEILLSFIISANNRIPMIKKCINNISEKAGKKLEYKGKIYYAFPTVDKLHEFTEKDFEECTAGFRAKYLKDTVDRIYNGELNLEYIKSLNDNECHEELKKFMGVGPQVADCIMLFSMQKYSAFPVDTWVKKAMMSLYVAPDVSLKKIRDFGREKFGSLSGFAQQYLFYYARENNIQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8-oxoguanine-DNA-glycosylase
publication title Structural characterization of Clostridium acetobutylicum 8-oxoguanine DNA glycosylase in its apo form and in complex with 8-oxodeoxyguanosine.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase, lyase
total genus 107
structure length 292
sequence length 292
ec nomenclature ec 3.2.2.-:
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3f10A02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 3f10A03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3f10A01
3CVSA 2I5WA 1LWVA 4EW4A 4AI5A 1YQKA 1KQJA 3IH7A 4DK9A 1YQMA 5CHZA 3F0ZA 1LWWA 1KEAA 1RRSA 1P7MA 3CWAA 3G0QA 1KG4A 1M3QA 1FN7A 3CWTA 1EBMA 2NOLA 4E9GA 1N39A 1WEFA 1MUDA 4EA5A 1XQPA 1NKUA 3FHGA 1WEGA 2NOIA 2ABKA 1XG7A 3FHFA 1YQLA 2OFIA 3OGDA 2JHNA 4AI4A 3N5NX 4EVVA 3CWUA 3IHOA 4AIAA 3F10A 2H56A 4YPRA 1N3CA 3I0WA 4B21A 1RRQA 1KG3A 1DIZA 1KG2A 4YPHA 1XQOA 1NGNA 2YG9A 4PIIA 1PU7A 2OFKA 2NOFA 2NOEA 1KG5A 4B23A 4UNFA 1KO9A 4EW0A 3CW7A 4OFEA 1LMZA 4E9HA 5KN8A 4B24A 1P59A 3D4VA 1KG6A 1M3HA 1ORPA 1VRLA 1PU6A 3OH6A 1ORNA 3CVTA 2NOBA 1MUYA 2JG6A 5KN9A 4OFAA 1MPGA 2NOZA 3FSPA 1YQRA 2JHJA 1PU8A 4YOQA 4OFHA 4EJYA 4HSBA 1WEIA 3OH9A 4EJZA 3CWSA 4E9FA 1MUNA 2YG8A 4E9EA 5AN4A 5DPKA 1KG7A 1HU0A 1N3AA 1PVSA 3N0UA 4UOBA 3KNTA 4B22A 4EA4A 1LWYA 2NOHA 3S6IA 3KTUA 2XHIA 3I0XA
chains in the Genus database with same CATH superfamily
3HS9A 3D7QA 4EW4A 1YQKA 2D0BA 3F0ZA 3RSMA 2ZFDB 1RRSA 4Q11A 1KG4A 1FN7A 2NLVA 3ENOC 1NH2A 1NVPA 3C04A 1N39A 1WEFA 2DKCA 2OOXA 4EA5A 3OSMA 1P5DX 1PCMX 1QN9A 4BDZA 2OFIA 4NZGA 2IV8A 3DPUA 4AI4A 3N5NX 2FKFA 4BACA 2H56A 4YPRA 3ASMA 3OSTA 1WJWA 5KL0A 1KG3A 3OLPA 3OYLA 4YPHA 3VN5A 1XQOA 2YG9A 4PIIA 1RM1A 4EAIA 2QLVA 1QNEA 1B9KA 2F7LA 2DKAA 4BE1A 2NOEA 1KG5A 1K2YX 2HZMA 5IYDP 1YTFA 3DPTA 5JN5A 3CW7A 2QRCA 1KG6A 1KY6A 4B0AA 3OS2A 4E7KA 5FRNA 2G30A 3RPJA 4E9FA 2Y8QA 1WQAA 4ROEB 1N3AA 3KNTA 4EA4A 2NOHA 4E7LA 3OY9A 4BJUA 3CVSA 3EAYA 1KYUA 1KQJA 4BE0A 4DK9A 1YQMA 5IYBP 3CWAA 3OYAA 3CWTA 3OCIA 3BKQX 3OYHA 2LAEA 1MUDA 2R5XA 3NNQA 2ABKA 1TGHA 3OYJA 3OGDA 1EUVA 1V5SA 2HKPA 1AISA 1XSZA 5IYCP 3F10A 2Y8LA 1QTPA 4EAJA 3H1ZA 1VTOA 3I0WA 4E7IA 2HZSA 4QG5A 4D7QA 2QREA 1QN8A 4WX8A 3OYEA 2OFKA 3OYKA 5F9CA 3HS8A 4C7PA 4UNFA 5BMNA 2JOIA 4OFEA 1LMZA 1MP9A 2D0CA 3L2WA 3D4VA 3OYIA 1R4XA 1TBAB 3OYFA 1ORPA 3I3WA 1VRLA 3CVTA 3OS0A 2PWWA 2H5AX 4WXAA 1MPGA 2NOZA 4EJYA 3OH9A 2FKMX 1CDWA 2YG8A 1W80A 4ZTFA 1LWYA 3OSEA 1KY7A 3EIKA 2V75A 3I0XA 2I5WA 4AI5A 1JFIC 1D3UA 2V92A 1P7MA 1VKLA 2V9JA 2NOLA 4E9GA 1XQPA 1NKUA 3FHGA 2NOIA 3S3NA 1KYDA 3OYNA 2O3OA 1YQLA 4WZSD 2V8QA 4I8OA 3OS1A 4EVVA 2MZ8A 1QN7A 4PY5A 4AIAA 5FRMA 4DULA 1P5GX 1N3CA 1KYFA 3L2UA 3VW4A 1KG2A 4IL8A 2FGTA 3S3OA 1KFIA 2JPIA 1NGNA 5JMVD 1PU7A 2NOFA 4B23A 3NA5A 1K35A 4EAKA 4CFFA 1E42A 1QN6A 2Z0FA 2H4LX 1LXTA 2Z8UA 5FROA 3L2VA 1TBPA 4E7HA 4E9HA 2D0AA 2DKDA 4B24A 1TUOA 2FUVA 3OYCA 1M3HA 2NWVA 3ENCA 4EALA 1PU6A 3OH6A 1ORNA 2NOBA 2JPSA 1T6AA 2IV9A 1VOKA 2W03A 1C4GA 3ULXA 4IKFA 1PZDA 4OFAA 3FSPA 1YQRA 2JHJA 4OFHA 3OYDA 4HSBA 4EJZA 3CWSA 5HSHA 1MUNA 2EHBD 4EAGA 4E9EA 5AN4A 5DPKA 1HU0A 2QR1A 2VJ0A 3T4NA 1PVSA 5EPCA 4UOBA 4B22A 1QNAA 3S6IA 3KTUA 3TE5A 2YH5A 1QNCA 4YOQA 1LWVA 3LCNA 2OOYA 3IH7A 1NGMA 1U84A 2W04A 5CHZA 3OC3C 4E7JA 1LWWA 3N89A 1KEAA 3G0QA 1M3QA 4ROCB 3PDKA 1C47A 1EBMA 3KRMA 1UT7A 3OYBA 1WEGA 3OYGA 2YA3A 4TPSA 1XG7A 4ZTJA 3FHFA 2JHNA 4BDYA 1UT4A 1QN5A 1Q9UA 4D7RA 3CWUA 3OYMA 3IHOA 3PMGA 2MJ7A 3SNSA 1VOLB 4B21A 1RRQA 4HJHA 3TDHA 1DIZA 1J3MA 1JDYA 3UW2A 1M5Q1 1PCJX 1YTBA 2HL9A 4BE2A 2QRDA 3R2XC 1QTSA 3S3MA 5BMPA 1QN4A 3L2RA 1KO9A 4EW0A 5KN8A 1P59A 1QNBA 2HL8A 1PCZA 1MUYA 3L2QA 2JG6A 5KN9A 1QN3A 1KFQA 1PU8A 1WEIA 1VTLE 2NVMA 4RODB 4MRQA 1KG7A 3N0UA 1C9BB 2XHIA 1UL7A
chains in the Genus database with same CATH topology
3CVSA 2I5WA 3HS9A 1LWVA 4EW4A 4AI5A 1JFIC 1KYUA 1YQKA 1KQJA 3IH7A 4DK9A 1NGMA 1D3UA 1YQMA 3OC3C 5CHZA 2D0BA 3F0ZA 1LWWA 3N89A 5IYBP 1KEAA 1RRSA 1P7MA 3CWAA 4Q11A 3G0QA 1KG4A 1M3QA 4ROCB 1FN7A 3CWTA 3OCIA 1EBMA 2NOLA 1NH2A 1NVPA 4E9GA 3KRMA 1UT7A 1N39A 1WEFA 2LAEA 1MUDA 4EA5A 3OSMA 1XQPA 1NKUA 3FHGA 1WEGA 2NOIA 1KYDA 2ABKA 4TPSA 1QN9A 2O3OA 1XG7A 1TGHA 3FHFA 1YQLA 2OFIA 3OGDA 2JHNA 1UT4A 4WZSD 1QN5A 2IV8A 1AISA 3DPUA 4AI4A 4I8OA 3N5NX 4EVVA 2MZ8A 3CWUA 1QN7A 3IHOA 5IYCP 4PY5A 2MJ7A 4AIAA 3F10A 2H56A 4YPRA 3SNSA 4DULA 1N3CA 1QTPA 3H1ZA 1VTOA 3I0WA 4B21A 1VOLB 3ASMA 1KYFA 1RRQA 3OSTA 1KG3A 1DIZA 2HZSA 1KG2A 4YPHA 2FGTA 3VN5A 1YTBA 1XQOA 1QN8A 1NGNA 2YG9A 4PIIA 1RM1A 1PU7A 2OFKA 1QNEA 1B9KA 2NOFA 2NOEA 1KG5A 4B23A 2HZMA 3HS8A 5IYDP 1YTFA 1QTSA 4UNFA 1E42A 1QN6A 1QN4A 3DPTA 2Z8UA 2JOIA 1KO9A 1TBPA 4EW0A 3CW7A 4OFEA 1LMZA 4E9HA 1MP9A 2D0CA 5KN8A 2D0AA 4B24A 1P59A 3D4VA 1KG6A 1M3HA 1KY6A 1R4XA 1TBAB 4B0AA 1QNBA 1ORPA 1VRLA 1PU6A 3OH6A 1ORNA 3CVTA 1PCZA 2NOBA 1MUYA 1VOKA 2IV9A 3ULXA 2JG6A 5KN9A 1PZDA 1QN3A 4OFAA 1MPGA 2NOZA 3FSPA 1YQRA 2G30A 2JHJA 1PU8A 4YOQA 4OFHA 4EJYA 4HSBA 1WEIA 3OH9A 4EJZA 3CWSA 3RPJA 1VTLE 1CDWA 4E9FA 1MUNA 4RODB 2YG8A 4E9EA 5AN4A 5DPKA 1W80A 1KG7A 1HU0A 2VJ0A 4ROEB 1N3AA 1PVSA 3N0UA 4UOBA 3KNTA 4B22A 4EA4A 1LWYA 2NOHA 1C9BB 1QNAA 3S6IA 3KTUA 1KY7A 2YH5A 2XHIA 1QNCA 3EIKA 3I0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVS A;  2I5W A;  1LWV A;  4EW4 A;  4AI5 A;  1YQK A;  1KQJ A;  3IH7 A;  4DK9 A;  1YQM A;  5CHZ A;  3F0Z A;  1LWW A;  1KEA A;  1RRS A;  1P7M A;  3CWA A;  3G0Q A;  1KG4 A;  1M3Q A;  1FN7 A;  3CWT A;  1EBM A;  2NOL A;  4E9G A;  1N39 A;  1WEF A;  1MUD A;  4EA5 A;  1XQP A;  1NKU A;  3FHG A;  1WEG A;  2NOI A;  2ABK A;  1XG7 A;  3FHF A;  1YQL A;  2OFI A;  3OGD A;  2JHN A;  4AI4 A;  3N5N X;  4EVV A;  3CWU A;  3IHO A;  4AIA A;  3F10 A;  2H56 A;  4YPR A;  1N3C A;  3I0W A;  4B21 A;  1RRQ A;  1KG3 A;  1DIZ A;  1KG2 A;  4YPH A;  1XQO A;  1NGN A;  2YG9 A;  4PII A;  1PU7 A;  2OFK A;  2NOF A;  2NOE A;  1KG5 A;  4B23 A;  4UNF A;  1KO9 A;  4EW0 A;  3CW7 A;  4OFE A;  1LMZ A;  4E9H A;  5KN8 A;  4B24 A;  1P59 A;  3D4V A;  1KG6 A;  1M3H A;  1ORP A;  1VRL A;  1PU6 A;  3OH6 A;  1ORN A;  3CVT A;  2NOB A;  1MUY A;  2JG6 A;  5KN9 A;  4OFA A;  1MPG A;  2NOZ A;  3FSP A;  1YQR A;  2JHJ A;  1PU8 A;  4YOQ A;  4OFH A;  4EJY A;  4HSB A;  1WEI A;  3OH9 A;  4EJZ A;  3CWS A;  4E9F A;  1MUN A;  2YG8 A;  4E9E A;  5AN4 A;  5DPK A;  1KG7 A;  1HU0 A;  1N3A A;  1PVS A;  3N0U A;  4UOB A;  3KNT A;  4B22 A;  4EA4 A;  1LWY A;  2NOH A;  3S6I A;  3KTU A;  2XHI A;  3I0X A; 
#chains in the Genus database with same CATH topology
 3HS9 A;  3D7Q A;  4EW4 A;  1YQK A;  2D0B A;  3F0Z A;  3RSM A;  2ZFD B;  1RRS A;  4Q11 A;  1KG4 A;  1FN7 A;  2NLV A;  3ENO C;  1NH2 A;  1NVP A;  3C04 A;  1N39 A;  1WEF A;  2DKC A;  2OOX A;  4EA5 A;  3OSM A;  1P5D X;  1PCM X;  1QN9 A;  4BDZ A;  2OFI A;  4NZG A;  2IV8 A;  3DPU A;  4AI4 A;  3N5N X;  2FKF A;  4BAC A;  2H56 A;  4YPR A;  3ASM A;  3OST A;  1WJW A;  5KL0 A;  1KG3 A;  3OLP A;  3OYL A;  4YPH A;  3VN5 A;  1XQO A;  2YG9 A;  4PII A;  1RM1 A;  4EAI A;  2QLV A;  1QNE A;  1B9K A;  2F7L A;  2DKA A;  4BE1 A;  2NOE A;  1KG5 A;  1K2Y X;  2HZM A;  5IYD P;  1YTF A;  3DPT A;  5JN5 A;  3CW7 A;  2QRC A;  1KG6 A;  1KY6 A;  4B0A A;  3OS2 A;  4E7K A;  5FRN A;  2G30 A;  3RPJ A;  4E9F A;  2Y8Q A;  1WQA A;  4ROE B;  1N3A A;  3KNT A;  4EA4 A;  2NOH A;  4E7L A;  3OY9 A;  4BJU A;  3CVS A;  3EAY A;  1KYU A;  1KQJ A;  4BE0 A;  4DK9 A;  1YQM A;  5IYB P;  3CWA A;  3OYA A;  3CWT A;  3OCI A;  3BKQ X;  3OYH A;  2LAE A;  1MUD A;  2R5X A;  3NNQ A;  2ABK A;  1TGH A;  3OYJ A;  3OGD A;  1EUV A;  1V5S A;  2HKP A;  1AIS A;  1XSZ A;  5IYC P;  3F10 A;  2Y8L A;  1QTP A;  4EAJ A;  3H1Z A;  1VTO A;  3I0W A;  4E7I A;  2HZS A;  4QG5 A;  4D7Q A;  2QRE A;  1QN8 A;  4WX8 A;  3OYE A;  2OFK A;  3OYK A;  5F9C A;  3HS8 A;  4C7P A;  4UNF A;  5BMN A;  2JOI A;  4OFE A;  1LMZ A;  1MP9 A;  2D0C A;  3L2W A;  3D4V A;  3OYI A;  1R4X A;  1TBA B;  3OYF A;  1ORP A;  3I3W A;  1VRL A;  3CVT A;  3OS0 A;  2PWW A;  2H5A X;  4WXA A;  1MPG A;  2NOZ A;  4EJY A;  3OH9 A;  2FKM X;  1CDW A;  2YG8 A;  1W80 A;  4ZTF A;  1LWY A;  3OSE A;  1KY7 A;  3EIK A;  2V75 A;  3I0X A;  2I5W A;  4AI5 A;  1JFI C;  1D3U A;  2V92 A;  1P7M A;  1VKL A;  2V9J A;  2NOL A;  4E9G A;  1XQP A;  1NKU A;  3FHG A;  2NOI A;  3S3N A;  1KYD A;  3OYN A;  2O3O A;  1YQL A;  4WZS D;  2V8Q A;  4I8O A;  3OS1 A;  4EVV A;  2MZ8 A;  1QN7 A;  4PY5 A;  4AIA A;  5FRM A;  4DUL A;  1P5G X;  1N3C A;  1KYF A;  3L2U A;  3VW4 A;  1KG2 A;  4IL8 A;  2FGT A;  3S3O A;  1KFI A;  2JPI A;  1NGN A;  5JMV D;  1PU7 A;  2NOF A;  4B23 A;  3NA5 A;  1K35 A;  4EAK A;  4CFF A;  1E42 A;  1QN6 A;  2Z0F A;  2H4L X;  1LXT A;  2Z8U A;  5FRO A;  3L2V A;  1TBP A;  4E7H A;  4E9H A;  2D0A A;  2DKD A;  4B24 A;  1TUO A;  2FUV A;  3OYC A;  1M3H A;  2NWV A;  3ENC A;  4EAL A;  1PU6 A;  3OH6 A;  1ORN A;  2NOB A;  2JPS A;  1T6A A;  2IV9 A;  1VOK A;  2W03 A;  1C4G A;  3ULX A;  4IKF A;  1PZD A;  4OFA A;  3FSP A;  1YQR A;  2JHJ A;  4OFH A;  3OYD A;  4HSB A;  4EJZ A;  3CWS A;  5HSH A;  1MUN A;  2EHB D;  4EAG A;  4E9E A;  5AN4 A;  5DPK A;  1HU0 A;  2QR1 A;  2VJ0 A;  3T4N A;  1PVS A;  5EPC A;  4UOB A;  4B22 A;  1QNA A;  3S6I A;  3KTU A;  3TE5 A;  2YH5 A;  1QNC A;  4YOQ A;  1LWV A;  3LCN A;  2OOY A;  3IH7 A;  1NGM A;  1U84 A;  2W04 A;  5CHZ A;  3OC3 C;  4E7J A;  1LWW A;  3N89 A;  1KEA A;  3G0Q A;  1M3Q A;  4ROC B;  3PDK A;  1C47 A;  1EBM A;  3KRM A;  1UT7 A;  3OYB A;  1WEG A;  3OYG A;  2YA3 A;  4TPS A;  1XG7 A;  4ZTJ A;  3FHF A;  2JHN A;  4BDY A;  1UT4 A;  1QN5 A;  1Q9U A;  4D7R A;  3CWU A;  3OYM A;  3IHO A;  3PMG A;  2MJ7 A;  3SNS A;  1VOL B;  4B21 A;  1RRQ A;  4HJH A;  3TDH A;  1DIZ A;  1J3M A;  1JDY A;  3UW2 A;  1M5Q 1;  1PCJ X;  1YTB A;  2HL9 A;  4BE2 A;  2QRD A;  3R2X C;  1QTS A;  3S3M A;  5BMP A;  1QN4 A;  3L2R A;  1KO9 A;  4EW0 A;  5KN8 A;  1P59 A;  1QNB A;  2HL8 A;  1PCZ A;  1MUY A;  3L2Q A;  2JG6 A;  5KN9 A;  1QN3 A;  1KFQ A;  1PU8 A;  1WEI A;  1VTL E;  2NVM A;  4ROD B;  4MRQ A;  1KG7 A;  3N0U A;  1C9B B;  2XHI A;  1UL7 A; 
#chains in the Genus database with same CATH homology
 3CVS A;  2I5W A;  3HS9 A;  1LWV A;  4EW4 A;  4AI5 A;  1JFI C;  1KYU A;  1YQK A;  1KQJ A;  3IH7 A;  4DK9 A;  1NGM A;  1D3U A;  1YQM A;  3OC3 C;  5CHZ A;  2D0B A;  3F0Z A;  1LWW A;  3N89 A;  5IYB P;  1KEA A;  1RRS A;  1P7M A;  3CWA A;  4Q11 A;  3G0Q A;  1KG4 A;  1M3Q A;  4ROC B;  1FN7 A;  3CWT A;  3OCI A;  1EBM A;  2NOL A;  1NH2 A;  1NVP A;  4E9G A;  3KRM A;  1UT7 A;  1N39 A;  1WEF A;  2LAE A;  1MUD A;  4EA5 A;  3OSM A;  1XQP A;  1NKU A;  3FHG A;  1WEG A;  2NOI A;  1KYD A;  2ABK A;  4TPS A;  1QN9 A;  2O3O A;  1XG7 A;  1TGH A;  3FHF A;  1YQL A;  2OFI A;  3OGD A;  2JHN A;  1UT4 A;  4WZS D;  1QN5 A;  2IV8 A;  1AIS A;  3DPU A;  4AI4 A;  4I8O A;  3N5N X;  4EVV A;  2MZ8 A;  3CWU A;  1QN7 A;  3IHO A;  5IYC P;  4PY5 A;  2MJ7 A;  4AIA A;  3F10 A;  2H56 A;  4YPR A;  3SNS A;  4DUL A;  1N3C A;  1QTP A;  3H1Z A;  1VTO A;  3I0W A;  4B21 A;  1VOL B;  3ASM A;  1KYF A;  1RRQ A;  3OST A;  1KG3 A;  1DIZ A;  2HZS A;  1KG2 A;  4YPH A;  2FGT A;  3VN5 A;  1YTB A;  1XQO A;  1QN8 A;  1NGN A;  2YG9 A;  4PII A;  1RM1 A;  1PU7 A;  2OFK A;  1QNE A;  1B9K A;  2NOF A;  2NOE A;  1KG5 A;  4B23 A;  2HZM A;  3HS8 A;  5IYD P;  1YTF A;  1QTS A;  4UNF A;  1E42 A;  1QN6 A;  1QN4 A;  3DPT A;  2Z8U A;  2JOI A;  1KO9 A;  1TBP A;  4EW0 A;  3CW7 A;  4OFE A;  1LMZ A;  4E9H A;  1MP9 A;  2D0C A;  5KN8 A;  2D0A A;  4B24 A;  1P59 A;  3D4V A;  1KG6 A;  1M3H A;  1KY6 A;  1R4X A;  1TBA B;  4B0A A;  1QNB A;  1ORP A;  1VRL A;  1PU6 A;  3OH6 A;  1ORN A;  3CVT A;  1PCZ A;  2NOB A;  1MUY A;  1VOK A;  2IV9 A;  3ULX A;  2JG6 A;  5KN9 A;  1PZD A;  1QN3 A;  4OFA A;  1MPG A;  2NOZ A;  3FSP A;  1YQR A;  2G30 A;  2JHJ A;  1PU8 A;  4YOQ A;  4OFH A;  4EJY A;  4HSB A;  1WEI A;  3OH9 A;  4EJZ A;  3CWS A;  3RPJ A;  1VTL E;  1CDW A;  4E9F A;  1MUN A;  4ROD B;  2YG8 A;  4E9E A;  5AN4 A;  5DPK A;  1W80 A;  1KG7 A;  1HU0 A;  2VJ0 A;  4ROE B;  1N3A A;  1PVS A;  3N0U A;  4UOB A;  3KNT A;  4B22 A;  4EA4 A;  1LWY A;  2NOH A;  1C9B B;  1QNA A;  3S6I A;  3KTU A;  1KY7 A;  2YH5 A;  2XHI A;  1QNC A;  3EIK A;  3I0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...