3F10A

Crystal structure of clostridium acetobutylicum 8-oxoguanine dna glycosylase in complex with 8-oxoguanosine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
MDFDMIEEKKDSVIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEKVVEVQKIGEDVVIYNINEEEFKNVWSEYFDLYRDYGEIKKELSRDPLLKKSVDFGEGIRILRQDPFEILLSFIISANNRIPMIKKCINNISEKAGKKLEYKGKIYYAFPTVDKLHEFTEKDFEECTAGFRAKYLKDTVDRIYNGELNLEYIKSLNDNECHEELKKFMGVGPQVADCIMLFSMQKYSAFPVDTWVKKAMMSLYVAPDVSLKKIRDFGREKFGSLSGFAQQYLFYYARENNIQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, lyase
molecule keywords 8-oxoguanine-DNA-glycosylase
publication title Structural characterization of Clostridium acetobutylicum 8-oxoguanine DNA glycosylase in its apo form and in complex with 8-oxodeoxyguanosine.
pubmed doi rcsb
source organism Clostridium acetobutylicum
total genus 107
structure length 292
sequence length 292
ec nomenclature ec 3.2.2.-:
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3f10A02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 3f10A03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3f10A01
3S6IA 4B22A 1P7MA 1N3AA 4DK9A 3OH6A 1DIZA 3I0WA 4EW0A 2NOFA 2YG8A 3CWAA 4EJZA 1KG6A 1ORNA 2NOBA 3F0ZA 3G0QA 2I5WA 1WEGA 4EW4A 4E9GA 1KG4A 1VRLA 1KG3A 4EJYA 1XQPA 2XHIA 1EBMA 1P59A 3CWUA 5AN4A 1MUYA 1MUNA 4E9EA 1LWVA 1LMZA 1PU6A 3I0XA 1YQRA 5CHZA 4OFHA 3CWSA 3D4VA 2JHNA 4E9FA 1NKUA 3FSPA 1WEIA 1KEAA 1KG2A 1N39A 3F10A 4AI4A 4EVVA 4OFEA 3FHGA 4HSBA 3KTUA 1KO9A 1MPGA 3OGDA 1PU8A 1MUDA 3CWTA 4AIAA 1KG5A 3CVSA 2NOHA 1KQJA 2YG9A 5KN9A 1NGNA 3IHOA 2NOIA 2NOEA 1PU7A 4PIIA 1YQLA 4YPRA 5KN8A 3N5NX 3CW7A 1N3CA 2OFKA 3OH9A 4EA4A 1RRSA 4B21A 1RRQA 3CVTA 2JHJA 1YQMA 1XG7A 4AI5A 3KNTA 1YQKA 1WEFA 4OFAA 3IH7A 4E9HA 2H56A 1M3QA 2OFIA 2NOLA 4UOBA 1XQOA 1HU0A 3N0UA 4UNFA 4EA5A 4YOQA 1KG7A 1PVSA 4B23A 1ORPA 4B24A 1LWYA 1LWWA 1M3HA 2ABKA 2NOZA 3FHFA 1FN7A 4YPHA 2JG6A 5DPKA
chains in the Genus database with same CATH superfamily
4B22A 1N3AA 3RSMA 4EAJA 2HZMA 1DIZA 3UW2A 4EW0A 2YG8A 4WZSD 3OYEA 1ORNA 3I3WA 3G0QA 1WEGA 2NLVA 1K35A 4E9GA 4BE2A 4EJYA 1P59A 3CWUA 1MUYA 1UL7A 1QNBA 1LWVA 1KYUA 1PU6A 3I0XA 1YQRA 1KY6A 2FGTA 4E7KA 1T6AA 2JPIA 1R4XA 4E9FA 3FSPA 1KYFA 1U84A 3HS8A 3OYMA 3F10A 4AI4A 1QN5A 4EVVA 4OFEA 4BDZA 2VJ0A 3KTUA 2QRCA 1MUDA 2IV8A 3NA5A 2NOHA 1NGMA 3D7QA 2YG9A 2LAEA 2HL9A 3ASMA 2FUVA 3OSEA 2D0CA 4PIIA 4YPRA 1UT7A 3N89A 3TE5A 3ULXA 1RRQA 2YH5A 1XG7A 4OFAA 2Y8LA 4EAKA 1M3QA 1V5SA 3BKQX 5IYCP 4YOQA 2FKFA 3H1ZA 5HSHA 1LWYA 1TBAB 1FN7A 4HJHA 3OLPA 2JG6A 5JMVD 3S6IA 1B9KA 1C4GA 3VW4A 3OYFA 3DPUA 3L2WA 3T4NA 1W80A 2W03A 4EW4A 1KG3A 3S3NA 1JDYA 2XHIA 2EHBD 5CHZA 3OYCA 3D4VA 1LXTA 2IV9A 2PWWA 1NKUA 4E7LA 4EAIA 3OYLA 3LCNA 2MZ8A 1J3MA 1KYDA 2H4LX 4HSBA 1QN8A 4WXAA 3OGDA 3CWTA 4AIAA 1KG5A 2H5AX 3PDKA 1VTLE 1QNAA 1C9BB 1QN4A 2D0BA 2JPSA 1NH2A 3IHOA 5BMNA 2V8QA 1PU7A 3OYNA 5KN8A 3N5NX 1YTBA 3CW7A 1N3CA 3OYAA 3OH9A 4EA4A 2Y8QA 4ZTFA 2YA3A 2Z0FA 2JHJA 1MP9A 3R2XC 4IKFA 5FRNA 3OCIA 1QN7A 1WEFA 3OYDA 1TUOA 4BE1A 4E9HA 2NOLA 1XQOA 1TGHA 1HU0A 4NZGA 3N0UA 4B23A 2MJ7A 3SNSA 3NNQA 4RODB 1P5GX 4D7RA 1P7MA 2HL8A 3L2VA 4DK9A 3S3OA 3OYJA 3EAYA 2DKCA 3OS1A 3CWAA 4EJZA 1PCZA 1KG6A 1NVPA 2I5WA 1VTOA 1XQPA 1EBMA 1P5DX 5AN4A 3DPTA 1LMZA 3OS2A 1K2YX 2NWVA 5FRMA 1PCMX 1TBPA 3OYGA 2JHNA 2OOYA 3OYHA 3OS0A 3KRMA 1WEIA 1M5Q1 3OYBA 4EAGA 4DULA 2QR1A 3OSTA 2ZFDB 3L2RA 1PCJX 3FHGA 2OOXA 1KO9A 3RPJA 1QN6A 1UT4A 3CVSA 1KY7A 5KN9A 1NGNA 2NOIA 2JOIA 2NOEA 1YQLA 3EIKA 1QNCA 3OY9A 3HS9A 2OFKA 1RRSA 3CVTA 1WQAA 4AI5A 5EPCA 3KNTA 2V75A 3PMGA 1QTSA 4Q11A 3IH7A 4D7QA 2H56A 2OFIA 2QREA 4C7PA 4E7IA 4UNFA 1KFQA 1PVSA 1ORPA 1LWWA 4TPSA 2V9JA 3ENCA 1RM1A 5FROA 4CFFA 3ENOC 1EUVA 1VKLA 3VN5A 3OSMA 4I8OA 5DPKA 4ROEB 3OH6A 1VOLB 2DKDA 3I0WA 2NOFA 1XSZA 5IYDP 2NOBA 3F0ZA 2G30A 1KG4A 3OC3C 1VRLA 4E7JA 2W04A 3OYIA 1AISA 1C47A 2D0AA 5IYBP 1QNEA 1MUNA 4E9EA 4E7HA 4OFHA 2NVMA 2QLVA 3CWSA 4B0AA 1VOKA 2FKMX 4BJUA 2F7LA 1QTPA 1KEAA 4IL8A 2Z8UA 1KG2A 1N39A 1QN3A 1CDWA 1QN9A 1MPGA 1PU8A 2DKAA 3OYKA 2V92A 1KQJA 4BE0A 2HZSA 5KL0A 4ZTJA 3L2UA 5JN5A 1E42A 1PZDA 4ROCB 4BACA 3C04A 1Q9UA 1JFIC 4B21A 1YTFA 4EALA 1YQMA 4BDYA 3S3MA 1YQKA 4WX8A 2R5XA 4QG5A 2HKPA 3L2QA 1KFIA 4MRQA 5BMPA 4UOBA 2O3OA 4EA5A 1KG7A 5F9CA 4B24A 1M3HA 1WJWA 2ABKA 2NOZA 3FHFA 2QRDA 1D3UA 4YPHA 3TDHA 4PY5A
chains in the Genus database with same CATH topology
3S6IA 4ROEB 4B22A 1P7MA 1N3AA 4DK9A 1B9KA 3OH6A 2HZMA 1VOLB 1DIZA 3I0WA 4EW0A 2NOFA 2YG8A 3CWAA 3DPUA 4WZSD 4EJZA 1PCZA 1W80A 5IYDP 1KG6A 1ORNA 1NVPA 2NOBA 3F0ZA 3G0QA 2I5WA 1WEGA 4EW4A 2G30A 4E9GA 1KG4A 3OC3C 1VTOA 1VRLA 1KG3A 4EJYA 1XQPA 2XHIA 1EBMA 1P59A 3CWUA 1AISA 5AN4A 2D0AA 5IYBP 3DPTA 1QNEA 1MUYA 1MUNA 4E9EA 1LWVA 1QNBA 1LMZA 1KYUA 1PU6A 3I0XA 1YQRA 1KY6A 5CHZA 4OFHA 2FGTA 3CWSA 4B0AA 1VOKA 3D4VA 1TBPA 2JHNA 1R4XA 2IV9A 3KRMA 4E9FA 1NKUA 3FSPA 1QTPA 1WEIA 1KEAA 1KYFA 2Z8UA 1KG2A 1N39A 3HS8A 4DULA 1QN3A 3OSTA 1CDWA 3F10A 4AI4A 1QN5A 2MZ8A 4EVVA 4OFEA 1QN9A 3FHGA 1KYDA 2VJ0A 4HSBA 3KTUA 1QN8A 1KO9A 1MPGA 3OGDA 1PU8A 3RPJA 1MUDA 3CWTA 1QN6A 4AIAA 1KG5A 2IV8A 1UT4A 3CVSA 2NOHA 1KY7A 1KQJA 1NGMA 1VTLE 1QNAA 1C9BB 1QN4A 2YG9A 5KN9A 2HZSA 2LAEA 1NGNA 3ASMA 2D0BA 1NH2A 2D0CA 3IHOA 2NOIA 2JOIA 2NOEA 1PU7A 4PIIA 1YQLA 1E42A 1PZDA 3EIKA 4ROCB 4YPRA 1QNCA 5KN8A 1UT7A 3N89A 3N5NX 1YTBA 3CW7A 3ULXA 1N3CA 1JFIC 3HS9A 2OFKA 3OH9A 4EA4A 1RRSA 4B21A 1YTFA 1RRQA 3CVTA 2JHJA 1YQMA 1MP9A 2YH5A 1XG7A 4AI5A 3KNTA 1YQKA 3OCIA 1QN7A 1WEFA 1QTSA 4Q11A 4OFAA 3IH7A 4E9HA 2H56A 1M3QA 2OFIA 2NOLA 4UOBA 1XQOA 2O3OA 1TGHA 1HU0A 3N0UA 4UNFA 4EA5A 5IYCP 4YOQA 1KG7A 3H1ZA 1PVSA 4B23A 2MJ7A 1ORPA 4B24A 1LWYA 1LWWA 1M3HA 2ABKA 4TPSA 3SNSA 1RM1A 1TBAB 2NOZA 3FHFA 1FN7A 1D3UA 4YPHA 4RODB 2JG6A 4PY5A 3VN5A 3OSMA 4I8OA 5DPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6I A;  4B22 A;  1P7M A;  1N3A A;  4DK9 A;  3OH6 A;  1DIZ A;  3I0W A;  4EW0 A;  2NOF A;  2YG8 A;  3CWA A;  4EJZ A;  1KG6 A;  1ORN A;  2NOB A;  3F0Z A;  3G0Q A;  2I5W A;  1WEG A;  4EW4 A;  4E9G A;  1KG4 A;  1VRL A;  1KG3 A;  4EJY A;  1XQP A;  2XHI A;  1EBM A;  1P59 A;  3CWU A;  5AN4 A;  1MUY A;  1MUN A;  4E9E A;  1LWV A;  1LMZ A;  1PU6 A;  3I0X A;  1YQR A;  5CHZ A;  4OFH A;  3CWS A;  3D4V A;  2JHN A;  4E9F A;  1NKU A;  3FSP A;  1WEI A;  1KEA A;  1KG2 A;  1N39 A;  3F10 A;  4AI4 A;  4EVV A;  4OFE A;  3FHG A;  4HSB A;  3KTU A;  1KO9 A;  1MPG A;  3OGD A;  1PU8 A;  1MUD A;  3CWT A;  4AIA A;  1KG5 A;  3CVS A;  2NOH A;  1KQJ A;  2YG9 A;  5KN9 A;  1NGN A;  3IHO A;  2NOI A;  2NOE A;  1PU7 A;  4PII A;  1YQL A;  4YPR A;  5KN8 A;  3N5N X;  3CW7 A;  1N3C A;  2OFK A;  3OH9 A;  4EA4 A;  1RRS A;  4B21 A;  1RRQ A;  3CVT A;  2JHJ A;  1YQM A;  1XG7 A;  4AI5 A;  3KNT A;  1YQK A;  1WEF A;  4OFA A;  3IH7 A;  4E9H A;  2H56 A;  1M3Q A;  2OFI A;  2NOL A;  4UOB A;  1XQO A;  1HU0 A;  3N0U A;  4UNF A;  4EA5 A;  4YOQ A;  1KG7 A;  1PVS A;  4B23 A;  1ORP A;  4B24 A;  1LWY A;  1LWW A;  1M3H A;  2ABK A;  2NOZ A;  3FHF A;  1FN7 A;  4YPH A;  2JG6 A;  5DPK A; 
#chains in the Genus database with same CATH topology
 4B22 A;  1N3A A;  3RSM A;  4EAJ A;  2HZM A;  1DIZ A;  3UW2 A;  4EW0 A;  2YG8 A;  4WZS D;  3OYE A;  1ORN A;  3I3W A;  3G0Q A;  1WEG A;  2NLV A;  1K35 A;  4E9G A;  4BE2 A;  4EJY A;  1P59 A;  3CWU A;  1MUY A;  1UL7 A;  1QNB A;  1LWV A;  1KYU A;  1PU6 A;  3I0X A;  1YQR A;  1KY6 A;  2FGT A;  4E7K A;  1T6A A;  2JPI A;  1R4X A;  4E9F A;  3FSP A;  1KYF A;  1U84 A;  3HS8 A;  3OYM A;  3F10 A;  4AI4 A;  1QN5 A;  4EVV A;  4OFE A;  4BDZ A;  2VJ0 A;  3KTU A;  2QRC A;  1MUD A;  2IV8 A;  3NA5 A;  2NOH A;  1NGM A;  3D7Q A;  2YG9 A;  2LAE A;  2HL9 A;  3ASM A;  2FUV A;  3OSE A;  2D0C A;  4PII A;  4YPR A;  1UT7 A;  3N89 A;  3TE5 A;  3ULX A;  1RRQ A;  2YH5 A;  1XG7 A;  4OFA A;  2Y8L A;  4EAK A;  1M3Q A;  1V5S A;  3BKQ X;  5IYC P;  4YOQ A;  2FKF A;  3H1Z A;  5HSH A;  1LWY A;  1TBA B;  1FN7 A;  4HJH A;  3OLP A;  2JG6 A;  5JMV D;  3S6I A;  1B9K A;  1C4G A;  3VW4 A;  3OYF A;  3DPU A;  3L2W A;  3T4N A;  1W80 A;  2W03 A;  4EW4 A;  1KG3 A;  3S3N A;  1JDY A;  2XHI A;  2EHB D;  5CHZ A;  3OYC A;  3D4V A;  1LXT A;  2IV9 A;  2PWW A;  1NKU A;  4E7L A;  4EAI A;  3OYL A;  3LCN A;  2MZ8 A;  1J3M A;  1KYD A;  2H4L X;  4HSB A;  1QN8 A;  4WXA A;  3OGD A;  3CWT A;  4AIA A;  1KG5 A;  2H5A X;  3PDK A;  1VTL E;  1QNA A;  1C9B B;  1QN4 A;  2D0B A;  2JPS A;  1NH2 A;  3IHO A;  5BMN A;  2V8Q A;  1PU7 A;  3OYN A;  5KN8 A;  3N5N X;  1YTB A;  3CW7 A;  1N3C A;  3OYA A;  3OH9 A;  4EA4 A;  2Y8Q A;  4ZTF A;  2YA3 A;  2Z0F A;  2JHJ A;  1MP9 A;  3R2X C;  4IKF A;  5FRN A;  3OCI A;  1QN7 A;  1WEF A;  3OYD A;  1TUO A;  4BE1 A;  4E9H A;  2NOL A;  1XQO A;  1TGH A;  1HU0 A;  4NZG A;  3N0U A;  4B23 A;  2MJ7 A;  3SNS A;  3NNQ A;  4ROD B;  1P5G X;  4D7R A;  1P7M A;  2HL8 A;  3L2V A;  4DK9 A;  3S3O A;  3OYJ A;  3EAY A;  2DKC A;  3OS1 A;  3CWA A;  4EJZ A;  1PCZ A;  1KG6 A;  1NVP A;  2I5W A;  1VTO A;  1XQP A;  1EBM A;  1P5D X;  5AN4 A;  3DPT A;  1LMZ A;  3OS2 A;  1K2Y X;  2NWV A;  5FRM A;  1PCM X;  1TBP A;  3OYG A;  2JHN A;  2OOY A;  3OYH A;  3OS0 A;  3KRM A;  1WEI A;  1M5Q 1;  3OYB A;  4EAG A;  4DUL A;  2QR1 A;  3OST A;  2ZFD B;  3L2R A;  1PCJ X;  3FHG A;  2OOX A;  1KO9 A;  3RPJ A;  1QN6 A;  1UT4 A;  3CVS A;  1KY7 A;  5KN9 A;  1NGN A;  2NOI A;  2JOI A;  2NOE A;  1YQL A;  3EIK A;  1QNC A;  3OY9 A;  3HS9 A;  2OFK A;  1RRS A;  3CVT A;  1WQA A;  4AI5 A;  5EPC A;  3KNT A;  2V75 A;  3PMG A;  1QTS A;  4Q11 A;  3IH7 A;  4D7Q A;  2H56 A;  2OFI A;  2QRE A;  4C7P A;  4E7I A;  4UNF A;  1KFQ A;  1PVS A;  1ORP A;  1LWW A;  4TPS A;  2V9J A;  3ENC A;  1RM1 A;  5FRO A;  4CFF A;  3ENO C;  1EUV A;  1VKL A;  3VN5 A;  3OSM A;  4I8O A;  5DPK A;  4ROE B;  3OH6 A;  1VOL B;  2DKD A;  3I0W A;  2NOF A;  1XSZ A;  5IYD P;  2NOB A;  3F0Z A;  2G30 A;  1KG4 A;  3OC3 C;  1VRL A;  4E7J A;  2W04 A;  3OYI A;  1AIS A;  1C47 A;  2D0A A;  5IYB P;  1QNE A;  1MUN A;  4E9E A;  4E7H A;  4OFH A;  2NVM A;  2QLV A;  3CWS A;  4B0A A;  1VOK A;  2FKM X;  4BJU A;  2F7L A;  1QTP A;  1KEA A;  4IL8 A;  2Z8U A;  1KG2 A;  1N39 A;  1QN3 A;  1CDW A;  1QN9 A;  1MPG A;  1PU8 A;  2DKA A;  3OYK A;  2V92 A;  1KQJ A;  4BE0 A;  2HZS A;  5KL0 A;  4ZTJ A;  3L2U A;  5JN5 A;  1E42 A;  1PZD A;  4ROC B;  4BAC A;  3C04 A;  1Q9U A;  1JFI C;  4B21 A;  1YTF A;  4EAL A;  1YQM A;  4BDY A;  3S3M A;  1YQK A;  4WX8 A;  2R5X A;  4QG5 A;  2HKP A;  3L2Q A;  1KFI A;  4MRQ A;  5BMP A;  4UOB A;  2O3O A;  4EA5 A;  1KG7 A;  5F9C A;  4B24 A;  1M3H A;  1WJW A;  2ABK A;  2NOZ A;  3FHF A;  2QRD A;  1D3U A;  4YPH A;  3TDH A;  4PY5 A; 
#chains in the Genus database with same CATH homology
 3S6I A;  4ROE B;  4B22 A;  1P7M A;  1N3A A;  4DK9 A;  1B9K A;  3OH6 A;  2HZM A;  1VOL B;  1DIZ A;  3I0W A;  4EW0 A;  2NOF A;  2YG8 A;  3CWA A;  3DPU A;  4WZS D;  4EJZ A;  1PCZ A;  1W80 A;  5IYD P;  1KG6 A;  1ORN A;  1NVP A;  2NOB A;  3F0Z A;  3G0Q A;  2I5W A;  1WEG A;  4EW4 A;  2G30 A;  4E9G A;  1KG4 A;  3OC3 C;  1VTO A;  1VRL A;  1KG3 A;  4EJY A;  1XQP A;  2XHI A;  1EBM A;  1P59 A;  3CWU A;  1AIS A;  5AN4 A;  2D0A A;  5IYB P;  3DPT A;  1QNE A;  1MUY A;  1MUN A;  4E9E A;  1LWV A;  1QNB A;  1LMZ A;  1KYU A;  1PU6 A;  3I0X A;  1YQR A;  1KY6 A;  5CHZ A;  4OFH A;  2FGT A;  3CWS A;  4B0A A;  1VOK A;  3D4V A;  1TBP A;  2JHN A;  1R4X A;  2IV9 A;  3KRM A;  4E9F A;  1NKU A;  3FSP A;  1QTP A;  1WEI A;  1KEA A;  1KYF A;  2Z8U A;  1KG2 A;  1N39 A;  3HS8 A;  4DUL A;  1QN3 A;  3OST A;  1CDW A;  3F10 A;  4AI4 A;  1QN5 A;  2MZ8 A;  4EVV A;  4OFE A;  1QN9 A;  3FHG A;  1KYD A;  2VJ0 A;  4HSB A;  3KTU A;  1QN8 A;  1KO9 A;  1MPG A;  3OGD A;  1PU8 A;  3RPJ A;  1MUD A;  3CWT A;  1QN6 A;  4AIA A;  1KG5 A;  2IV8 A;  1UT4 A;  3CVS A;  2NOH A;  1KY7 A;  1KQJ A;  1NGM A;  1VTL E;  1QNA A;  1C9B B;  1QN4 A;  2YG9 A;  5KN9 A;  2HZS A;  2LAE A;  1NGN A;  3ASM A;  2D0B A;  1NH2 A;  2D0C A;  3IHO A;  2NOI A;  2JOI A;  2NOE A;  1PU7 A;  4PII A;  1YQL A;  1E42 A;  1PZD A;  3EIK A;  4ROC B;  4YPR A;  1QNC A;  5KN8 A;  1UT7 A;  3N89 A;  3N5N X;  1YTB A;  3CW7 A;  3ULX A;  1N3C A;  1JFI C;  3HS9 A;  2OFK A;  3OH9 A;  4EA4 A;  1RRS A;  4B21 A;  1YTF A;  1RRQ A;  3CVT A;  2JHJ A;  1YQM A;  1MP9 A;  2YH5 A;  1XG7 A;  4AI5 A;  3KNT A;  1YQK A;  3OCI A;  1QN7 A;  1WEF A;  1QTS A;  4Q11 A;  4OFA A;  3IH7 A;  4E9H A;  2H56 A;  1M3Q A;  2OFI A;  2NOL A;  4UOB A;  1XQO A;  2O3O A;  1TGH A;  1HU0 A;  3N0U A;  4UNF A;  4EA5 A;  5IYC P;  4YOQ A;  1KG7 A;  3H1Z A;  1PVS A;  4B23 A;  2MJ7 A;  1ORP A;  4B24 A;  1LWY A;  1LWW A;  1M3H A;  2ABK A;  4TPS A;  3SNS A;  1RM1 A;  1TBA B;  2NOZ A;  3FHF A;  1FN7 A;  1D3U A;  4YPH A;  4ROD B;  2JG6 A;  4PY5 A;  3VN5 A;  3OSM A;  4I8O A;  5DPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...