3F10A

Crystal structure of clostridium acetobutylicum 8-oxoguanine dna glycosylase in complex with 8-oxoguanosine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
MDFDMIEEKKDSVIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEKVVEVQKIGEDVVIYNINEEEFKNVWSEYFDLYRDYGEIKKELSRDPLLKKSVDFGEGIRILRQDPFEILLSFIISANNRIPMIKKCINNISEKAGKKLEYKGKIYYAFPTVDKLHEFTEKDFEECTAGFRAKYLKDTVDRIYNGELNLEYIKSLNDNECHEELKKFMGVGPQVADCIMLFSMQKYSAFPVDTWVKKAMMSLYVAPDVSLKKIRDFGREKFGSLSGFAQQYLFYYARENNIQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8-oxoguanine-DNA-glycosylase
publication title Structural characterization of Clostridium acetobutylicum 8-oxoguanine DNA glycosylase in its apo form and in complex with 8-oxodeoxyguanosine.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase, lyase
total genus 107
structure length 292
sequence length 292
ec nomenclature ec 3.2.2.-:
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3f10A02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 3f10A03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3f10A01
2NOZA 3CWTA 1LMZA 1YQLA 4UOBA 1KG4A 2JHNA 1PU6A 3CWUA 1PU7A 4EA4A 1M3QA 1NKUA 2JHJA 2NOFA 1KG6A 1XG7A 1WEIA 1PVSA 2YG9A 4E9GA 4DK9A 3FSPA 1P7MA 2I5WA 2NOHA 3KTUA 2XHIA 4B24A 4EVVA 4E9HA 1N3AA 3OH9A 1MUYA 1KG5A 1ORPA 1RRSA 4AI4A 3F0ZA 3FHGA 1PU8A 3CVTA 1LWVA 1XQOA 4B22A 1EBMA 4OFAA 4B23A 4B21A 1MUNA 4AIAA 4YPHA 1VRLA 4AI5A 1LWWA 4EW4A 3F10A 3G0QA 1YQKA 1P59A 4E9EA 3FHFA 3I0XA 1MPGA 4EJYA 3D4VA 1NGNA 1MUDA 3CWAA 4EJZA 3N5NX 1KQJA 1N39A 1RRQA 5KN9A 1HU0A 3CWSA 1KG2A 4E9FA 2NOLA 3IH7A 4OFHA 1YQMA 1ORNA 2YG8A 2OFKA 1WEGA 3CVSA 1KG3A 1WEFA 2NOIA 1KEAA 2NOBA 3OGDA 4YPRA 3N0UA 4HSBA 1YQRA 5DPKA 3OH6A 5AN4A 3I0WA 1LWYA 1M3HA 3IHOA 4EA5A 5KN8A 1KG7A 3KNTA 4UNFA 4OFEA 2NOEA 2ABKA 1FN7A 1KO9A 2OFIA 1DIZA 1N3CA 5CHZA 1XQPA 4PIIA 3S6IA 3CW7A 2JG6A 2H56A 4YOQA 4EW0A
chains in the Genus database with same CATH superfamily
3ENCA 4NZGA 2FUVA 1M3QA 2IV8A 3UW2A 1VTOA 3EAYA 3KRMA 3L2VA 3OSTA 2DKDA 3OLPA 3NA5A 3KTUA 1P5DX 1TBPA 2D0BA 2QR1A 2DKCA 1QNCA 4AI4A 4BE1A 1W80A 1EBMA 4B23A 1J3MA 1MUNA 2F7LA 1JFIC 3OYDA 3L2RA 1VTLE 1TBAB 1QNEA 1P59A 2JPIA 1D3UA 3I0XA 3S3OA 4WZSD 4E7LA 1NGNA 1MUDA 2LAEA 4C7PA 4EJZA 2PWWA 2HL9A 2Y8QA 3PMGA 3PDKA 2NWVA 2HL8A 1UT4A 3BKQX 4OFHA 4BE0A 3H1ZA 4BACA 1U84A 3L2UA 1CDWA 2G30A 3OYHA 3OYIA 3SNSA 3OYNA 4HSBA 1KYFA 1QN6A 3I3WA 3I0WA 1MP9A 1KG7A 4BJUA 4UNFA 5FRMA 4WXAA 5JN5A 3RPJA 1NVPA 3TDHA 1YTBA 2JPSA 2JG6A 4BE2A 4YOQA 2V8QA 1LMZA 1KG4A 2JHNA 1PU7A 2V92A 2W03A 4D7QA 2NOFA 4ZTFA 1WEIA 1QN8A 1PCZA 1WQAA 1VOLB 4B24A 1KYUA 4TPSA 3OSEA 3OH9A 1T6AA 3FHGA 3CVTA 4HJHA 2H4LX 2NLVA 4B21A 2OOXA 1K35A 2V75A 1B9KA 4BDZA 3FHFA 4EJYA 1KY6A 3CWAA 1QNAA 3N5NX 1V5SA 3NNQA 1JDYA 1Q9UA 1C9BB 1P5GX 2Z0FA 5KN9A 3CWSA 1QN5A 2O3OA 3IH7A 2FGTA 4E7HA 3OYKA 3D7QA 2YG8A 1WEGA 1KG3A 1WEFA 3RSMA 3ASMA 1PZDA 1EUVA 3OYFA 3N0UA 1YTFA 4EA5A 1E42A 4OFEA 3T4NA 2DKAA 2V9JA 4E7IA 2QRCA 3HS8A 3CW7A 1QTSA 1WJWA 1KY7A 4CFFA 3OS2A 4EAGA 4EW0A 3CWTA 4PY5A 3S3NA 1NKUA 4B0AA 4DULA 1KG6A 4WX8A 1XG7A 1NH2A 2Y8LA 1M5Q1 3OC3C 4DK9A 5F9CA 2I5WA 1KYDA 1K2YX 5IYBP 4E9HA 1KG5A 5IYDP 4D7RA 3F0ZA 4ZTJA 1UT7A 1XQOA 4B22A 3L2QA 2YH5A 1QTPA 4AIAA 4I8OA 4YPHA 4AI5A 1LWWA 5FRNA 1UL7A 3ULXA 3G0QA 4E9EA 1MPGA 4Q11A 3TE5A 3LCNA 3OYBA 3D4VA 3DPUA 2D0AA 2QREA 4EAKA 1KQJA 2JOIA 2EHBD 1KFIA 3OYCA 1KFQA 3OYEA 2IV9A 2HZSA 1VOKA 4E9FA 3OYMA 2NOLA 1C4GA 5BMPA 4EALA 2QLVA 1LXTA 1PCJX 1C47A 3N89A 3OYGA 5IYCP 2NOBA 3OGDA 2W04A 1LWYA 3IHOA 2D0CA 5KN8A 3KNTA 4E7KA 2FKFA 2ABKA 1VKLA 3S3MA 1DIZA 1QN3A 1N3CA 1TUOA 5JMVD 4RODB 3VN5A 4PIIA 3OCIA 2OOYA 1AISA 3DPTA 2H56A 2NOZA 3OS1A 1YQLA 4UOBA 2ZFDB 3CWUA 1PU6A 5HSHA 3ENOC 1QN7A 4EA4A 2JHJA 1TGHA 2R5XA 1PCMX 4ROEB 2VJ0A 1PVSA 2YG9A 4E9GA 3FSPA 1P7MA 3OS0A 2NOHA 2YA3A 2XHIA 4EVVA 1N3AA 1MUYA 1ORPA 1RRSA 3OYJA 1PU8A 1LWVA 4IKFA 4OFAA 4ROCB 2Z8UA 1VRLA 4IL8A 2QRDA 4EW4A 5KL0A 1QN4A 3F10A 1YQKA 3EIKA 3C04A 3OYAA 1R4XA 4MRQA 4E7JA 2FKMX 5BMNA 4EAJA 1N39A 1RRQA 1QNBA 1HU0A 1KG2A 5EPCA 2NVMA 3HS9A 1YQMA 1ORNA 2OFKA 3CVSA 3OY9A 2NOIA 2MZ8A 1KEAA 4YPRA 4BDYA 1YQRA 5DPKA 3OH6A 5AN4A 1NGMA 1M3HA 3L2WA 5FROA 1QN9A 3OYLA 2NOEA 1FN7A 1KO9A 2OFIA 2HZMA 5CHZA 1XSZA 3VW4A 3R2XC 1XQPA 1RM1A 4EAIA 2MJ7A 3S6IA 4QG5A 2HKPA 2H5AX 3OSMA
chains in the Genus database with same CATH topology
2NOZA 3CWTA 1LMZA 1YQLA 4UOBA 1KG4A 2JHNA 1PU6A 3CWUA 1PU7A 1QN7A 4PY5A 4EA4A 1M3QA 2IV8A 1VTOA 1NKUA 2JHJA 4B0AA 1TGHA 4DULA 2NOFA 3KRMA 1KG6A 1XG7A 1WEIA 1NH2A 1QN8A 3OSTA 4ROEB 2VJ0A 1PVSA 2YG9A 4E9GA 3OC3C 4DK9A 3FSPA 1P7MA 1PCZA 2I5WA 2NOHA 3KTUA 1VOLB 2XHIA 4B24A 1KYDA 1KYUA 1TBPA 2D0BA 4TPSA 4EVVA 5IYBP 4E9HA 1N3AA 3OH9A 1MUYA 1KG5A 1ORPA 1QNCA 1RRSA 5IYDP 4AI4A 3F0ZA 3FHGA 1PU8A 1W80A 3CVTA 1UT7A 1LWVA 1XQOA 4B22A 1EBMA 4OFAA 4B23A 4B21A 2YH5A 1MUNA 1QTPA 4AIAA 4I8OA 4ROCB 2Z8UA 4YPHA 1VRLA 4AI5A 1LWWA 1JFIC 4EW4A 1VTLE 1QN4A 3F10A 3ULXA 3G0QA 1YQKA 1B9KA 1TBAB 1QNEA 3EIKA 1P59A 4E9EA 3FHFA 1D3UA 3I0XA 1MPGA 1R4XA 4EJYA 1KY6A 4Q11A 4WZSD 3D4VA 1NGNA 1MUDA 3DPUA 3CWAA 2LAEA 1QNAA 4EJZA 2D0AA 3N5NX 1KQJA 2JOIA 1N39A 1C9BB 1RRQA 2IV9A 5KN9A 2HZSA 1HU0A 3CWSA 1KG2A 1VOKA 1QNBA 1QN5A 4E9FA 2O3OA 2NOLA 3IH7A 1UT4A 2FGTA 4OFHA 3H1ZA 3HS9A 1YQMA 1ORNA 1CDWA 2YG8A 2OFKA 1WEGA 3N89A 3CVSA 1KG3A 1WEFA 2NOIA 2MZ8A 2G30A 1KEAA 2NOBA 3ASMA 1PZDA 5IYCP 3OGDA 3SNSA 4YPRA 3N0UA 4HSBA 1YQRA 1KYFA 5DPKA 1QN6A 3OH6A 5AN4A 1YTFA 3I0WA 1MP9A 1NGMA 1LWYA 1M3HA 3IHOA 4EA5A 5KN8A 1E42A 1KG7A 3KNTA 2D0CA 4UNFA 4OFEA 1QN9A 2NOEA 2ABKA 1FN7A 1KO9A 2OFIA 1DIZA 2HZMA 1QN3A 1N3CA 5CHZA 3RPJA 1NVPA 4RODB 1XQPA 3HS8A 1RM1A 2MJ7A 3VN5A 4PIIA 3S6IA 3OCIA 1YTBA 1AISA 3DPTA 3CW7A 1QTSA 1KY7A 2JG6A 2H56A 3OSMA 4YOQA 4EW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NOZ A;  3CWT A;  1LMZ A;  1YQL A;  4UOB A;  1KG4 A;  2JHN A;  1PU6 A;  3CWU A;  1PU7 A;  4EA4 A;  1M3Q A;  1NKU A;  2JHJ A;  2NOF A;  1KG6 A;  1XG7 A;  1WEI A;  1PVS A;  2YG9 A;  4E9G A;  4DK9 A;  3FSP A;  1P7M A;  2I5W A;  2NOH A;  3KTU A;  2XHI A;  4B24 A;  4EVV A;  4E9H A;  1N3A A;  3OH9 A;  1MUY A;  1KG5 A;  1ORP A;  1RRS A;  4AI4 A;  3F0Z A;  3FHG A;  1PU8 A;  3CVT A;  1LWV A;  1XQO A;  4B22 A;  1EBM A;  4OFA A;  4B23 A;  4B21 A;  1MUN A;  4AIA A;  4YPH A;  1VRL A;  4AI5 A;  1LWW A;  4EW4 A;  3F10 A;  3G0Q A;  1YQK A;  1P59 A;  4E9E A;  3FHF A;  3I0X A;  1MPG A;  4EJY A;  3D4V A;  1NGN A;  1MUD A;  3CWA A;  4EJZ A;  3N5N X;  1KQJ A;  1N39 A;  1RRQ A;  5KN9 A;  1HU0 A;  3CWS A;  1KG2 A;  4E9F A;  2NOL A;  3IH7 A;  4OFH A;  1YQM A;  1ORN A;  2YG8 A;  2OFK A;  1WEG A;  3CVS A;  1KG3 A;  1WEF A;  2NOI A;  1KEA A;  2NOB A;  3OGD A;  4YPR A;  3N0U A;  4HSB A;  1YQR A;  5DPK A;  3OH6 A;  5AN4 A;  3I0W A;  1LWY A;  1M3H A;  3IHO A;  4EA5 A;  5KN8 A;  1KG7 A;  3KNT A;  4UNF A;  4OFE A;  2NOE A;  2ABK A;  1FN7 A;  1KO9 A;  2OFI A;  1DIZ A;  1N3C A;  5CHZ A;  1XQP A;  4PII A;  3S6I A;  3CW7 A;  2JG6 A;  2H56 A;  4YOQ A;  4EW0 A; 
#chains in the Genus database with same CATH topology
 3ENC A;  4NZG A;  2FUV A;  1M3Q A;  2IV8 A;  3UW2 A;  1VTO A;  3EAY A;  3KRM A;  3L2V A;  3OST A;  2DKD A;  3OLP A;  3NA5 A;  3KTU A;  1P5D X;  1TBP A;  2D0B A;  2QR1 A;  2DKC A;  1QNC A;  4AI4 A;  4BE1 A;  1W80 A;  1EBM A;  4B23 A;  1J3M A;  1MUN A;  2F7L A;  1JFI C;  3OYD A;  3L2R A;  1VTL E;  1TBA B;  1QNE A;  1P59 A;  2JPI A;  1D3U A;  3I0X A;  3S3O A;  4WZS D;  4E7L A;  1NGN A;  1MUD A;  2LAE A;  4C7P A;  4EJZ A;  2PWW A;  2HL9 A;  2Y8Q A;  3PMG A;  3PDK A;  2NWV A;  2HL8 A;  1UT4 A;  3BKQ X;  4OFH A;  4BE0 A;  3H1Z A;  4BAC A;  1U84 A;  3L2U A;  1CDW A;  2G30 A;  3OYH A;  3OYI A;  3SNS A;  3OYN A;  4HSB A;  1KYF A;  1QN6 A;  3I3W A;  3I0W A;  1MP9 A;  1KG7 A;  4BJU A;  4UNF A;  5FRM A;  4WXA A;  5JN5 A;  3RPJ A;  1NVP A;  3TDH A;  1YTB A;  2JPS A;  2JG6 A;  4BE2 A;  4YOQ A;  2V8Q A;  1LMZ A;  1KG4 A;  2JHN A;  1PU7 A;  2V92 A;  2W03 A;  4D7Q A;  2NOF A;  4ZTF A;  1WEI A;  1QN8 A;  1PCZ A;  1WQA A;  1VOL B;  4B24 A;  1KYU A;  4TPS A;  3OSE A;  3OH9 A;  1T6A A;  3FHG A;  3CVT A;  4HJH A;  2H4L X;  2NLV A;  4B21 A;  2OOX A;  1K35 A;  2V75 A;  1B9K A;  4BDZ A;  3FHF A;  4EJY A;  1KY6 A;  3CWA A;  1QNA A;  3N5N X;  1V5S A;  3NNQ A;  1JDY A;  1Q9U A;  1C9B B;  1P5G X;  2Z0F A;  5KN9 A;  3CWS A;  1QN5 A;  2O3O A;  3IH7 A;  2FGT A;  4E7H A;  3OYK A;  3D7Q A;  2YG8 A;  1WEG A;  1KG3 A;  1WEF A;  3RSM A;  3ASM A;  1PZD A;  1EUV A;  3OYF A;  3N0U A;  1YTF A;  4EA5 A;  1E42 A;  4OFE A;  3T4N A;  2DKA A;  2V9J A;  4E7I A;  2QRC A;  3HS8 A;  3CW7 A;  1QTS A;  1WJW A;  1KY7 A;  4CFF A;  3OS2 A;  4EAG A;  4EW0 A;  3CWT A;  4PY5 A;  3S3N A;  1NKU A;  4B0A A;  4DUL A;  1KG6 A;  4WX8 A;  1XG7 A;  1NH2 A;  2Y8L A;  1M5Q 1;  3OC3 C;  4DK9 A;  5F9C A;  2I5W A;  1KYD A;  1K2Y X;  5IYB P;  4E9H A;  1KG5 A;  5IYD P;  4D7R A;  3F0Z A;  4ZTJ A;  1UT7 A;  1XQO A;  4B22 A;  3L2Q A;  2YH5 A;  1QTP A;  4AIA A;  4I8O A;  4YPH A;  4AI5 A;  1LWW A;  5FRN A;  1UL7 A;  3ULX A;  3G0Q A;  4E9E A;  1MPG A;  4Q11 A;  3TE5 A;  3LCN A;  3OYB A;  3D4V A;  3DPU A;  2D0A A;  2QRE A;  4EAK A;  1KQJ A;  2JOI A;  2EHB D;  1KFI A;  3OYC A;  1KFQ A;  3OYE A;  2IV9 A;  2HZS A;  1VOK A;  4E9F A;  3OYM A;  2NOL A;  1C4G A;  5BMP A;  4EAL A;  2QLV A;  1LXT A;  1PCJ X;  1C47 A;  3N89 A;  3OYG A;  5IYC P;  2NOB A;  3OGD A;  2W04 A;  1LWY A;  3IHO A;  2D0C A;  5KN8 A;  3KNT A;  4E7K A;  2FKF A;  2ABK A;  1VKL A;  3S3M A;  1DIZ A;  1QN3 A;  1N3C A;  1TUO A;  5JMV D;  4ROD B;  3VN5 A;  4PII A;  3OCI A;  2OOY A;  1AIS A;  3DPT A;  2H56 A;  2NOZ A;  3OS1 A;  1YQL A;  4UOB A;  2ZFD B;  3CWU A;  1PU6 A;  5HSH A;  3ENO C;  1QN7 A;  4EA4 A;  2JHJ A;  1TGH A;  2R5X A;  1PCM X;  4ROE B;  2VJ0 A;  1PVS A;  2YG9 A;  4E9G A;  3FSP A;  1P7M A;  3OS0 A;  2NOH A;  2YA3 A;  2XHI A;  4EVV A;  1N3A A;  1MUY A;  1ORP A;  1RRS A;  3OYJ A;  1PU8 A;  1LWV A;  4IKF A;  4OFA A;  4ROC B;  2Z8U A;  1VRL A;  4IL8 A;  2QRD A;  4EW4 A;  5KL0 A;  1QN4 A;  3F10 A;  1YQK A;  3EIK A;  3C04 A;  3OYA A;  1R4X A;  4MRQ A;  4E7J A;  2FKM X;  5BMN A;  4EAJ A;  1N39 A;  1RRQ A;  1QNB A;  1HU0 A;  1KG2 A;  5EPC A;  2NVM A;  3HS9 A;  1YQM A;  1ORN A;  2OFK A;  3CVS A;  3OY9 A;  2NOI A;  2MZ8 A;  1KEA A;  4YPR A;  4BDY A;  1YQR A;  5DPK A;  3OH6 A;  5AN4 A;  1NGM A;  1M3H A;  3L2W A;  5FRO A;  1QN9 A;  3OYL A;  2NOE A;  1FN7 A;  1KO9 A;  2OFI A;  2HZM A;  5CHZ A;  1XSZ A;  3VW4 A;  3R2X C;  1XQP A;  1RM1 A;  4EAI A;  2MJ7 A;  3S6I A;  4QG5 A;  2HKP A;  2H5A X;  3OSM A; 
#chains in the Genus database with same CATH homology
 2NOZ A;  3CWT A;  1LMZ A;  1YQL A;  4UOB A;  1KG4 A;  2JHN A;  1PU6 A;  3CWU A;  1PU7 A;  1QN7 A;  4PY5 A;  4EA4 A;  1M3Q A;  2IV8 A;  1VTO A;  1NKU A;  2JHJ A;  4B0A A;  1TGH A;  4DUL A;  2NOF A;  3KRM A;  1KG6 A;  1XG7 A;  1WEI A;  1NH2 A;  1QN8 A;  3OST A;  4ROE B;  2VJ0 A;  1PVS A;  2YG9 A;  4E9G A;  3OC3 C;  4DK9 A;  3FSP A;  1P7M A;  1PCZ A;  2I5W A;  2NOH A;  3KTU A;  1VOL B;  2XHI A;  4B24 A;  1KYD A;  1KYU A;  1TBP A;  2D0B A;  4TPS A;  4EVV A;  5IYB P;  4E9H A;  1N3A A;  3OH9 A;  1MUY A;  1KG5 A;  1ORP A;  1QNC A;  1RRS A;  5IYD P;  4AI4 A;  3F0Z A;  3FHG A;  1PU8 A;  1W80 A;  3CVT A;  1UT7 A;  1LWV A;  1XQO A;  4B22 A;  1EBM A;  4OFA A;  4B23 A;  4B21 A;  2YH5 A;  1MUN A;  1QTP A;  4AIA A;  4I8O A;  4ROC B;  2Z8U A;  4YPH A;  1VRL A;  4AI5 A;  1LWW A;  1JFI C;  4EW4 A;  1VTL E;  1QN4 A;  3F10 A;  3ULX A;  3G0Q A;  1YQK A;  1B9K A;  1TBA B;  1QNE A;  3EIK A;  1P59 A;  4E9E A;  3FHF A;  1D3U A;  3I0X A;  1MPG A;  1R4X A;  4EJY A;  1KY6 A;  4Q11 A;  4WZS D;  3D4V A;  1NGN A;  1MUD A;  3DPU A;  3CWA A;  2LAE A;  1QNA A;  4EJZ A;  2D0A A;  3N5N X;  1KQJ A;  2JOI A;  1N39 A;  1C9B B;  1RRQ A;  2IV9 A;  5KN9 A;  2HZS A;  1HU0 A;  3CWS A;  1KG2 A;  1VOK A;  1QNB A;  1QN5 A;  4E9F A;  2O3O A;  2NOL A;  3IH7 A;  1UT4 A;  2FGT A;  4OFH A;  3H1Z A;  3HS9 A;  1YQM A;  1ORN A;  1CDW A;  2YG8 A;  2OFK A;  1WEG A;  3N89 A;  3CVS A;  1KG3 A;  1WEF A;  2NOI A;  2MZ8 A;  2G30 A;  1KEA A;  2NOB A;  3ASM A;  1PZD A;  5IYC P;  3OGD A;  3SNS A;  4YPR A;  3N0U A;  4HSB A;  1YQR A;  1KYF A;  5DPK A;  1QN6 A;  3OH6 A;  5AN4 A;  1YTF A;  3I0W A;  1MP9 A;  1NGM A;  1LWY A;  1M3H A;  3IHO A;  4EA5 A;  5KN8 A;  1E42 A;  1KG7 A;  3KNT A;  2D0C A;  4UNF A;  4OFE A;  1QN9 A;  2NOE A;  2ABK A;  1FN7 A;  1KO9 A;  2OFI A;  1DIZ A;  2HZM A;  1QN3 A;  1N3C A;  5CHZ A;  3RPJ A;  1NVP A;  4ROD B;  1XQP A;  3HS8 A;  1RM1 A;  2MJ7 A;  3VN5 A;  4PII A;  3S6I A;  3OCI A;  1YTB A;  1AIS A;  3DPT A;  3CW7 A;  1QTS A;  1KY7 A;  2JG6 A;  2H56 A;  3OSM A;  4YOQ A;  4EW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...