3F10A

Crystal structure of clostridium acetobutylicum 8-oxoguanine dna glycosylase in complex with 8-oxoguanosine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
MDFDMIEEKKDSVIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEKVVEVQKIGEDVVIYNINEEEFKNVWSEYFDLYRDYGEIKKELSRDPLLKKSVDFGEGIRILRQDPFEILLSFIISANNRIPMIKKCINNISEKAGKKLEYKGKIYYAFPTVDKLHEFTEKDFEECTAGFRAKYLKDTVDRIYNGELNLEYIKSLNDNECHEELKKFMGVGPQVADCIMLFSMQKYSAFPVDTWVKKAMMSLYVAPDVSLKKIRDFGREKFGSLSGFAQQYLFYYARENNIQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of Clostridium acetobutylicum 8-oxoguanine DNA glycosylase in its apo form and in complex with 8-oxodeoxyguanosine.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Hydrolase, lyase
molecule keywords 8-oxoguanine-DNA-glycosylase
total genus 107
structure length 292
sequence length 292
ec nomenclature ec 3.2.2.-:
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3f10A02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 3f10A03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3f10A01
2NOHA 1NKUA 1MUNA 5KN9A 1RRQA 4OFHA 1KO9A 2NOFA 3N0UA 2OFKA 3N5NX 2NOBA 2H56A 4B21A 3OH6A 2I5WA 1XG7A 1KG4A 2JHJA 3FHFA 1YQLA 1KEAA 4OFEA 2XHIA 3CWSA 2YG9A 2NOEA 3I0WA 1KQJA 1DIZA 4PIIA 3IH7A 4AIAA 1WEGA 2NOLA 2JHNA 3F0ZA 3CWUA 3FHGA 4EA5A 4DK9A 1LWYA 3OGDA 5CHZA 1YQMA 4AI4A 5DPKA 1VRLA 1MUYA 3CVSA 2YG8A 3CWAA 1LWWA 1KG3A 1WEFA 3CWTA 2JG6A 4E9GA 3CW7A 4EJZA 2NOZA 5AN4A 4B22A 4E9FA 4UOBA 1KG7A 1ORNA 3KTUA 4YPRA 4EVVA 4AI5A 1M3QA 4B24A 1P59A 1WEIA 1YQKA 3S6IA 1PU6A 1XQOA 3IHOA 4E9HA 3OH9A 1N3AA 1YQRA 1KG5A 4EJYA 1N39A 1RRSA 4EW0A 1PU7A 4B23A 1KG6A 4OFAA 1LWVA 1MUDA 3I0XA 2OFIA 3D4VA 3G0QA 2NOIA 1PVSA 3F10A 3CVTA 1XQPA 1NGNA 3KNTA 4YOQA 4EA4A 4HSBA 1MPGA 1ORPA 1LMZA 4UNFA 1N3CA 1FN7A 1KG2A 2ABKA 1P7MA 4YPHA 4EW4A 1EBMA 4E9EA 5KN8A 1M3HA 3FSPA 1HU0A 1PU8A
chains in the Genus database with same CATH superfamily
2NOHA 2FKMX 1VTLE 1NH2A 5IYBP 4OFHA 5F9CA 3N0UA 2D0BA 2H56A 2Z0FA 2I5WA 4WX8A 1XG7A 2OOYA 2JHJA 3FHFA 1YQLA 1Q9UA 2IV8A 2MJ7A 3OSEA 4WZSD 1R4XA 4PIIA 3L2UA 2PWWA 3ASMA 3OYEA 3OGDA 3OYBA 2ZFDB 1KYDA 2QR1A 4E7IA 3CWAA 1LWWA 3OCIA 2V75A 2JG6A 3CW7A 4EJZA 2NOZA 1P5DX 3S3OA 3RSMA 5JMVD 3L2QA 4B22A 3ULXA 1ORNA 1KG7A 4YPRA 4AI5A 1KFQA 4B24A 3KRMA 2FKFA 3S6IA 1B9KA 2VJ0A 1N3AA 1YQRA 1KYFA 2Z8UA 4EW0A 3OYGA 2YA3A 1RM1A 1KG6A 3L2VA 1MUDA 4MRQA 2OFIA 3F10A 3CVTA 1XQPA 3C04A 1NGNA 1QN6A 4YOQA 1QTSA 1QN7A 3HS8A 4UNFA 1T6AA 1QNCA 3OS1A 5BMPA 1KYUA 5FRNA 4BDYA 1QNBA 1PCJX 3VW4A 2HL9A 2HZMA 4DULA 1TBPA 2DKDA 2V9JA 5IYDP 4IL8A 1RRQA 4TPSA 1VTOA 2V8QA 5BMNA 2HZSA 1PCZA 2JPSA 5IYCP 2JOIA 3OYIA 4OFEA 2XHIA 4CFFA 2YG9A 2LAEA 4BACA 1VOKA 1WEGA 2NOLA 4DK9A 3OY9A 2EHBD 5CHZA 1VOLB 1QN5A 3TE5A 4AI4A 4NZGA 1PZDA 4PY5A 3DPTA 1KG3A 1WEFA 2FUVA 1QTPA 3NNQA 1WQAA 3N89A 5AN4A 4UOBA 3ENCA 2JPIA 1WEIA 1YQKA 3VN5A 4BJUA 4EJYA 4C7PA 1RRSA 2HKPA 1TBAB 2W03A 3OS2A 2IV9A 4HJHA 4ZTJA 3OYJA 3L2RA 3D4VA 1PVSA 4E7JA 3S3MA 4E7HA 1NVPA 1CDWA 3L2WA 2H5AX 4BE1A 1LMZA 1KY7A 1KG2A 2D0AA 3OSTA 2ABKA 1P7MA 3EAYA 4EW4A 1PCMX 2H4LX 1M3HA 1E42A 2F7LA 1PU8A 3ENOC 1MUNA 1YTFA 1NGMA 2D0CA 1KO9A 3OYHA 2OFKA 1UL7A 1QN8A 1KY6A 1W80A 5HSHA 1V5SA 3IH7A 3BKQX 4B0AA 4AIAA 3F0ZA 3FHGA 1LWYA 1QN4A 1YQMA 1QNAA 2QREA 2YG8A 1J3MA 1TGHA 3CWTA 4RODB 2Y8QA 3OYKA 1K35A 4I8OA 4D7QA 4E9FA 1QN3A 3OYDA 3OYAA 2MZ8A 3KTUA 3EIKA 4WXAA 1QNEA 1LXTA 1JDYA 2QRDA 4E7KA 1KG5A 4BE0A 1WJWA 4B23A 5FROA 4OFAA 2NLVA 3I0XA 5KL0A 1UT4A 4E7LA 4BE2A 3PMGA 5FRMA 2O3OA 4EA4A 3S3NA 4HSBA 1P5GX 4D7RA 1K2YX 1AISA 2NVMA 3UW2A 3OYMA 1N3CA 4ROCB 1EBMA 3OYLA 3FSPA 4EAKA 3RPJA 1EUVA 1NKUA 3I3WA 4EALA 4IKFA 5KN9A 1UT7A 2R5XA 2Y8LA 2NOFA 4Q11A 2QRCA 3N5NX 2NOBA 4B21A 3OH6A 1KG4A 2FGTA 3OYNA 2YH5A 1KEAA 5EPCA 2NWVA 1U84A 2W04A 3CWSA 2NOEA 3I0WA 1KQJA 1DIZA 3R2XC 1KFIA 2JHNA 3CWUA 4EA5A 3T4NA 1YTBA 5DPKA 1VRLA 1MUYA 3CVSA 1C47A 2HL8A 4E9GA 2DKCA 3D7QA 3OS0A 3OC3C 1M5Q1 4EVVA 4QG5A 1M3QA 3DPUA 1P59A 1JFIC 1C9BB 1PU6A 1XQOA 3IHOA 4E9HA 3OH9A 2DKAA 4ZTFA 1VKLA 3PDKA 2V92A 1N39A 4EAJA 3LCNA 1PU7A 3NA5A 4EAGA 1LWVA 2G30A 2OOXA 1XSZA 1MP9A 3OYFA 3G0QA 2NOIA 1D3UA 4BDZA 3KNTA 3OSMA 1TUOA 3OYCA 2QLVA 3TDHA 1MPGA 3SNSA 4EAIA 1ORPA 5JN5A 1C4GA 1FN7A 4ROEB 4YPHA 3OLPA 3H1ZA 4E9EA 5KN8A 3HS9A 1QN9A 1HU0A
chains in the Genus database with same CATH topology
2NOHA 4DULA 1TBPA 1NKUA 1MUNA 1YTFA 1VTLE 1NGMA 5IYDP 5KN9A 1UT7A 5IYBP 1RRQA 1NH2A 4OFHA 2D0CA 4TPSA 1KO9A 1VTOA 2NOFA 3N0UA 2D0BA 4Q11A 2OFKA 3N5NX 2HZSA 2NOBA 2H56A 4B21A 1PCZA 3OH6A 2I5WA 1XG7A 1KG4A 1QN8A 5IYCP 2FGTA 2JOIA 2JHJA 3FHFA 2YH5A 1YQLA 1KEAA 4OFEA 2IV8A 2XHIA 3CWSA 1KY6A 1W80A 2MJ7A 2YG9A 2NOEA 2LAEA 3I0WA 4WZSD 1KQJA 1R4XA 1DIZA 4PIIA 3IH7A 4B0AA 4AIAA 1VOKA 3ASMA 1WEGA 2NOLA 2JHNA 3F0ZA 3CWUA 3FHGA 4EA5A 4DK9A 1LWYA 3OGDA 1QN4A 5CHZA 1YQMA 1VOLB 1QN5A 4AI4A 1KYDA 1YTBA 1PZDA 5DPKA 1VRLA 1QNAA 1MUYA 3CVSA 4PY5A 2YG8A 3DPTA 3CWAA 1TGHA 1LWWA 1KG3A 1WEFA 3CWTA 3OCIA 4RODB 1QTPA 2JG6A 4E9GA 3CW7A 4EJZA 3N89A 2NOZA 3OC3C 4I8OA 5AN4A 4B22A 4E9FA 3ULXA 1QN3A 4UOBA 1KG7A 1ORNA 2MZ8A 3KTUA 4YPRA 4EVVA 3EIKA 4AI5A 1M3QA 3DPUA 1QNEA 4B24A 1P59A 1JFIC 3KRMA 1WEIA 1YQKA 3S6IA 1C9BB 1PU6A 1XQOA 3VN5A 3IHOA 4E9HA 1B9KA 3OH9A 2VJ0A 1N3AA 1YQRA 1KG5A 4EJYA 1N39A 1KYFA 1RRSA 2Z8UA 4EW0A 1PU7A 1TBAB 4B23A 1RM1A 1KG6A 2IV9A 4OFAA 1LWVA 1MUDA 3I0XA 2G30A 2OFIA 1MP9A 1UT4A 3D4VA 3G0QA 2NOIA 1PVSA 1D3UA 3F10A 3CVTA 1XQPA 1NGNA 3KNTA 3OSMA 1QN6A 4YOQA 2O3OA 1QTSA 4EA4A 4HSBA 1NVPA 1CDWA 1QN7A 1MPGA 1ORPA 1LMZA 4UNFA 3HS8A 3SNSA 1KY7A 1AISA 1QNCA 1KYUA 1N3CA 1FN7A 1KG2A 2D0AA 3OSTA 4ROEB 2ABKA 1P7MA 4YPHA 4EW4A 4ROCB 1EBMA 1QNBA 3H1ZA 4E9EA 5KN8A 1M3HA 3FSPA 1E42A 3HS9A 2HZMA 3RPJA 1QN9A 1HU0A 1PU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NOH A;  1NKU A;  1MUN A;  5KN9 A;  1RRQ A;  4OFH A;  1KO9 A;  2NOF A;  3N0U A;  2OFK A;  3N5N X;  2NOB A;  2H56 A;  4B21 A;  3OH6 A;  2I5W A;  1XG7 A;  1KG4 A;  2JHJ A;  3FHF A;  1YQL A;  1KEA A;  4OFE A;  2XHI A;  3CWS A;  2YG9 A;  2NOE A;  3I0W A;  1KQJ A;  1DIZ A;  4PII A;  3IH7 A;  4AIA A;  1WEG A;  2NOL A;  2JHN A;  3F0Z A;  3CWU A;  3FHG A;  4EA5 A;  4DK9 A;  1LWY A;  3OGD A;  5CHZ A;  1YQM A;  4AI4 A;  5DPK A;  1VRL A;  1MUY A;  3CVS A;  2YG8 A;  3CWA A;  1LWW A;  1KG3 A;  1WEF A;  3CWT A;  2JG6 A;  4E9G A;  3CW7 A;  4EJZ A;  2NOZ A;  5AN4 A;  4B22 A;  4E9F A;  4UOB A;  1KG7 A;  1ORN A;  3KTU A;  4YPR A;  4EVV A;  4AI5 A;  1M3Q A;  4B24 A;  1P59 A;  1WEI A;  1YQK A;  3S6I A;  1PU6 A;  1XQO A;  3IHO A;  4E9H A;  3OH9 A;  1N3A A;  1YQR A;  1KG5 A;  4EJY A;  1N39 A;  1RRS A;  4EW0 A;  1PU7 A;  4B23 A;  1KG6 A;  4OFA A;  1LWV A;  1MUD A;  3I0X A;  2OFI A;  3D4V A;  3G0Q A;  2NOI A;  1PVS A;  3F10 A;  3CVT A;  1XQP A;  1NGN A;  3KNT A;  4YOQ A;  4EA4 A;  4HSB A;  1MPG A;  1ORP A;  1LMZ A;  4UNF A;  1N3C A;  1FN7 A;  1KG2 A;  2ABK A;  1P7M A;  4YPH A;  4EW4 A;  1EBM A;  4E9E A;  5KN8 A;  1M3H A;  3FSP A;  1HU0 A;  1PU8 A; 
#chains in the Genus database with same CATH topology
 2NOH A;  2FKM X;  1VTL E;  1NH2 A;  5IYB P;  4OFH A;  5F9C A;  3N0U A;  2D0B A;  2H56 A;  2Z0F A;  2I5W A;  4WX8 A;  1XG7 A;  2OOY A;  2JHJ A;  3FHF A;  1YQL A;  1Q9U A;  2IV8 A;  2MJ7 A;  3OSE A;  4WZS D;  1R4X A;  4PII A;  3L2U A;  2PWW A;  3ASM A;  3OYE A;  3OGD A;  3OYB A;  2ZFD B;  1KYD A;  2QR1 A;  4E7I A;  3CWA A;  1LWW A;  3OCI A;  2V75 A;  2JG6 A;  3CW7 A;  4EJZ A;  2NOZ A;  1P5D X;  3S3O A;  3RSM A;  5JMV D;  3L2Q A;  4B22 A;  3ULX A;  1ORN A;  1KG7 A;  4YPR A;  4AI5 A;  1KFQ A;  4B24 A;  3KRM A;  2FKF A;  3S6I A;  1B9K A;  2VJ0 A;  1N3A A;  1YQR A;  1KYF A;  2Z8U A;  4EW0 A;  3OYG A;  2YA3 A;  1RM1 A;  1KG6 A;  3L2V A;  1MUD A;  4MRQ A;  2OFI A;  3F10 A;  3CVT A;  1XQP A;  3C04 A;  1NGN A;  1QN6 A;  4YOQ A;  1QTS A;  1QN7 A;  3HS8 A;  4UNF A;  1T6A A;  1QNC A;  3OS1 A;  5BMP A;  1KYU A;  5FRN A;  4BDY A;  1QNB A;  1PCJ X;  3VW4 A;  2HL9 A;  2HZM A;  4DUL A;  1TBP A;  2DKD A;  2V9J A;  5IYD P;  4IL8 A;  1RRQ A;  4TPS A;  1VTO A;  2V8Q A;  5BMN A;  2HZS A;  1PCZ A;  2JPS A;  5IYC P;  2JOI A;  3OYI A;  4OFE A;  2XHI A;  4CFF A;  2YG9 A;  2LAE A;  4BAC A;  1VOK A;  1WEG A;  2NOL A;  4DK9 A;  3OY9 A;  2EHB D;  5CHZ A;  1VOL B;  1QN5 A;  3TE5 A;  4AI4 A;  4NZG A;  1PZD A;  4PY5 A;  3DPT A;  1KG3 A;  1WEF A;  2FUV A;  1QTP A;  3NNQ A;  1WQA A;  3N89 A;  5AN4 A;  4UOB A;  3ENC A;  2JPI A;  1WEI A;  1YQK A;  3VN5 A;  4BJU A;  4EJY A;  4C7P A;  1RRS A;  2HKP A;  1TBA B;  2W03 A;  3OS2 A;  2IV9 A;  4HJH A;  4ZTJ A;  3OYJ A;  3L2R A;  3D4V A;  1PVS A;  4E7J A;  3S3M A;  4E7H A;  1NVP A;  1CDW A;  3L2W A;  2H5A X;  4BE1 A;  1LMZ A;  1KY7 A;  1KG2 A;  2D0A A;  3OST A;  2ABK A;  1P7M A;  3EAY A;  4EW4 A;  1PCM X;  2H4L X;  1M3H A;  1E42 A;  2F7L A;  1PU8 A;  3ENO C;  1MUN A;  1YTF A;  1NGM A;  2D0C A;  1KO9 A;  3OYH A;  2OFK A;  1UL7 A;  1QN8 A;  1KY6 A;  1W80 A;  5HSH A;  1V5S A;  3IH7 A;  3BKQ X;  4B0A A;  4AIA A;  3F0Z A;  3FHG A;  1LWY A;  1QN4 A;  1YQM A;  1QNA A;  2QRE A;  2YG8 A;  1J3M A;  1TGH A;  3CWT A;  4ROD B;  2Y8Q A;  3OYK A;  1K35 A;  4I8O A;  4D7Q A;  4E9F A;  1QN3 A;  3OYD A;  3OYA A;  2MZ8 A;  3KTU A;  3EIK A;  4WXA A;  1QNE A;  1LXT A;  1JDY A;  2QRD A;  4E7K A;  1KG5 A;  4BE0 A;  1WJW A;  4B23 A;  5FRO A;  4OFA A;  2NLV A;  3I0X A;  5KL0 A;  1UT4 A;  4E7L A;  4BE2 A;  3PMG A;  5FRM A;  2O3O A;  4EA4 A;  3S3N A;  4HSB A;  1P5G X;  4D7R A;  1K2Y X;  1AIS A;  2NVM A;  3UW2 A;  3OYM A;  1N3C A;  4ROC B;  1EBM A;  3OYL A;  3FSP A;  4EAK A;  3RPJ A;  1EUV A;  1NKU A;  3I3W A;  4EAL A;  4IKF A;  5KN9 A;  1UT7 A;  2R5X A;  2Y8L A;  2NOF A;  4Q11 A;  2QRC A;  3N5N X;  2NOB A;  4B21 A;  3OH6 A;  1KG4 A;  2FGT A;  3OYN A;  2YH5 A;  1KEA A;  5EPC A;  2NWV A;  1U84 A;  2W04 A;  3CWS A;  2NOE A;  3I0W A;  1KQJ A;  1DIZ A;  3R2X C;  1KFI A;  2JHN A;  3CWU A;  4EA5 A;  3T4N A;  1YTB A;  5DPK A;  1VRL A;  1MUY A;  3CVS A;  1C47 A;  2HL8 A;  4E9G A;  2DKC A;  3D7Q A;  3OS0 A;  3OC3 C;  1M5Q 1;  4EVV A;  4QG5 A;  1M3Q A;  3DPU A;  1P59 A;  1JFI C;  1C9B B;  1PU6 A;  1XQO A;  3IHO A;  4E9H A;  3OH9 A;  2DKA A;  4ZTF A;  1VKL A;  3PDK A;  2V92 A;  1N39 A;  4EAJ A;  3LCN A;  1PU7 A;  3NA5 A;  4EAG A;  1LWV A;  2G30 A;  2OOX A;  1XSZ A;  1MP9 A;  3OYF A;  3G0Q A;  2NOI A;  1D3U A;  4BDZ A;  3KNT A;  3OSM A;  1TUO A;  3OYC A;  2QLV A;  3TDH A;  1MPG A;  3SNS A;  4EAI A;  1ORP A;  5JN5 A;  1C4G A;  1FN7 A;  4ROE B;  4YPH A;  3OLP A;  3H1Z A;  4E9E A;  5KN8 A;  3HS9 A;  1QN9 A;  1HU0 A; 
#chains in the Genus database with same CATH homology
 2NOH A;  4DUL A;  1TBP A;  1NKU A;  1MUN A;  1YTF A;  1VTL E;  1NGM A;  5IYD P;  5KN9 A;  1UT7 A;  5IYB P;  1RRQ A;  1NH2 A;  4OFH A;  2D0C A;  4TPS A;  1KO9 A;  1VTO A;  2NOF A;  3N0U A;  2D0B A;  4Q11 A;  2OFK A;  3N5N X;  2HZS A;  2NOB A;  2H56 A;  4B21 A;  1PCZ A;  3OH6 A;  2I5W A;  1XG7 A;  1KG4 A;  1QN8 A;  5IYC P;  2FGT A;  2JOI A;  2JHJ A;  3FHF A;  2YH5 A;  1YQL A;  1KEA A;  4OFE A;  2IV8 A;  2XHI A;  3CWS A;  1KY6 A;  1W80 A;  2MJ7 A;  2YG9 A;  2NOE A;  2LAE A;  3I0W A;  4WZS D;  1KQJ A;  1R4X A;  1DIZ A;  4PII A;  3IH7 A;  4B0A A;  4AIA A;  1VOK A;  3ASM A;  1WEG A;  2NOL A;  2JHN A;  3F0Z A;  3CWU A;  3FHG A;  4EA5 A;  4DK9 A;  1LWY A;  3OGD A;  1QN4 A;  5CHZ A;  1YQM A;  1VOL B;  1QN5 A;  4AI4 A;  1KYD A;  1YTB A;  1PZD A;  5DPK A;  1VRL A;  1QNA A;  1MUY A;  3CVS A;  4PY5 A;  2YG8 A;  3DPT A;  3CWA A;  1TGH A;  1LWW A;  1KG3 A;  1WEF A;  3CWT A;  3OCI A;  4ROD B;  1QTP A;  2JG6 A;  4E9G A;  3CW7 A;  4EJZ A;  3N89 A;  2NOZ A;  3OC3 C;  4I8O A;  5AN4 A;  4B22 A;  4E9F A;  3ULX A;  1QN3 A;  4UOB A;  1KG7 A;  1ORN A;  2MZ8 A;  3KTU A;  4YPR A;  4EVV A;  3EIK A;  4AI5 A;  1M3Q A;  3DPU A;  1QNE A;  4B24 A;  1P59 A;  1JFI C;  3KRM A;  1WEI A;  1YQK A;  3S6I A;  1C9B B;  1PU6 A;  1XQO A;  3VN5 A;  3IHO A;  4E9H A;  1B9K A;  3OH9 A;  2VJ0 A;  1N3A A;  1YQR A;  1KG5 A;  4EJY A;  1N39 A;  1KYF A;  1RRS A;  2Z8U A;  4EW0 A;  1PU7 A;  1TBA B;  4B23 A;  1RM1 A;  1KG6 A;  2IV9 A;  4OFA A;  1LWV A;  1MUD A;  3I0X A;  2G30 A;  2OFI A;  1MP9 A;  1UT4 A;  3D4V A;  3G0Q A;  2NOI A;  1PVS A;  1D3U A;  3F10 A;  3CVT A;  1XQP A;  1NGN A;  3KNT A;  3OSM A;  1QN6 A;  4YOQ A;  2O3O A;  1QTS A;  4EA4 A;  4HSB A;  1NVP A;  1CDW A;  1QN7 A;  1MPG A;  1ORP A;  1LMZ A;  4UNF A;  3HS8 A;  3SNS A;  1KY7 A;  1AIS A;  1QNC A;  1KYU A;  1N3C A;  1FN7 A;  1KG2 A;  2D0A A;  3OST A;  4ROE B;  2ABK A;  1P7M A;  4YPH A;  4EW4 A;  4ROC B;  1EBM A;  1QNB A;  3H1Z A;  4E9E A;  5KN8 A;  1M3H A;  3FSP A;  1E42 A;  3HS9 A;  2HZM A;  3RPJ A;  1QN9 A;  1HU0 A;  1PU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...