4EJZA

Structure of mbogg1 in complex with low affinity dna ligand
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
289
Chain Sequence
MKYNVEEKGTKVIVRGIADFNLKETFESGQCFRWNEEEDGSYTGVAYDRVVNVKLEGDTLIIDNTNLTDFYDIWFDYFDLGRDYGQIKESLSKDPVLKEAIKFGQGIRILRQDTWETLVSFIVSQNNRIPQIKKVIENLATSFGNPIEYKGKIYYTFPKPEELVMYDVETIAKTRCGFRAKYIFDAASKVFSGEINLLKLHEYSTSEIRDILMTINGVGPKVADCVILYSIGRYDTFPTDVWIKRIVEHLYLKREGTPVEIQLFAIDKFGDLSGFAQQYLFYYGREMGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords 3-Methyladenine DNA glycosylase
publication title Crystal structures of MBOgg1 in complex with two abasic DNA ligands
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
total genus 96
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4ejzA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4ejzA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4ejzA01
1PU6A 4UOBA 2NOHA 2XHIA 5AN4A 1RRSA 1MUYA 3CWAA 3N5NX 3CVSA 4EW4A 4PIIA 1VRLA 1YQRA 1LMZA 4EJYA 1NGNA 3F0ZA 1DIZA 1N39A 1P59A 3CWUA 1LWVA 4B23A 5DPKA 1P7MA 2NOLA 3F10A 4HSBA 5KN9A 2NOZA 2YG8A 4EJZA 2JHNA 1HU0A 3N0UA 1KO9A 1KG2A 1KG5A 1XG7A 5KN8A 4OFEA 1RRQA 3S6IA 2NOIA 1MUDA 3I0WA 3I0XA 2I5WA 3CVTA 2JG6A 4EA5A 2ABKA 1WEIA 1N3AA 1KQJA 3KNTA 1KG6A 3OH9A 4E9FA 1XQPA 4B22A 4B24A 1ORPA 5CHZA 1FN7A 4OFAA 4YOQA 1M3HA 1MPGA 1MUNA 1KG3A 3FHGA 4E9EA 1YQLA 1N3CA 1KG7A 4AIAA 1WEFA 4YPHA 4AI5A 3KTUA 1M3QA 1YQMA 4EA4A 3OGDA 4UNFA 2OFIA 4EW0A 4EVVA 1XQOA 1WEGA 2H56A 1ORNA 3CW7A 1PVSA 1YQKA 3IH7A 4AI4A 1KEAA 3CWTA 1EBMA 1PU7A 3D4VA 4B21A 1LWYA 4OFHA 2NOBA 1LWWA 4YPRA 4E9GA 2NOFA 4E9HA 4DK9A 2YG9A 1PU8A 2OFKA 3FHFA 3CWSA 2JHJA 1KG4A 1NKUA 3IHOA 3G0QA 2NOEA 3OH6A 3FSPA
chains in the Genus database with same CATH superfamily
1MUYA 2Y8QA 3F0ZA 1DIZA 1VOKA 1N39A 1P59A 2G30A 3ENCA 5HSHA 5DPKA 2YA3A 1Q9UA 1QN3A 3L2QA 3RSMA 2QRCA 4HSBA 4E7JA 4EAKA 3D7QA 4EJZA 2JHNA 4HJHA 3T4NA 2D0BA 2V8QA 3N0UA 1KO9A 2V92A 2NOIA 1P5DX 3TDHA 2JOIA 1YTFA 3OSMA 1TBPA 3PMGA 2YH5A 2HZSA 1KY6A 2HKPA 1PCJX 4EAIA 3NA5A 4WX8A 1KG6A 4E9FA 3S3MA 3KRMA 1VTOA 5CHZA 1FN7A 2IV8A 4YOQA 1MPGA 1NH2A 2W03A 5FRNA 1YQLA 1C47A 4AIAA 4I8OA 4YPHA 3KTUA 1M3QA 3OYIA 1TBAB 2JPSA 1PVSA 3OYCA 4E7IA 3CWTA 2FKMX 3D4VA 4B21A 2HL8A 1QN4A 1LWWA 2DKDA 4E9HA 1QNCA 3OYKA 1PU8A 3FHFA 3OSEA 3CWSA 2JHJA 3OYNA 3G0QA 3OH6A 1QNAA 2NOHA 2DKCA 2JPIA 1WJWA 1D3UA 3N5NX 4EW4A 3ASMA 1KYFA 1TGHA 4B23A 1QNBA 2O3OA 2NOLA 3L2WA 1E42A 4WXAA 2W04A 3F10A 4Q11A 2NOZA 2MJ7A 3OYHA 1U84A 4EAJA 2ZFDB 1QNEA 1KG2A 3SNSA 1MUDA 1K2YX 4D7QA 2I5WA 1P5GX 4D7RA 3RPJA 2JG6A 1KYUA 2Z0FA 2H5AX 2ABKA 1WEIA 4E7LA 1N3AA 3KNTA 4E7KA 3OH9A 4PY5A 3OS0A 4B22A 4ZTFA 3OYAA 1ORPA 1EUVA 2NWVA 1QN6A 4ZTJA 3FHGA 4DULA 2LAEA 3OYMA 1YQMA 5IYDP 2D0AA 1T6AA 2FGTA 2OFIA 4EW0A 1VOLB 2MZ8A 4EVVA 1WEGA 3ULXA 1ORNA 3CW7A 3S3OA 3IH7A 4AI4A 1KEAA 5BMPA 2QRDA 1PU7A 1KY7A 1TUOA 3OYEA 3OY9A 2H4LX 2NOFA 1QTSA 2QR1A 2QLVA 4E7HA 1KG4A 4TPSA 2QREA 1AISA 3OS2A 1LXTA 1NVPA 3OYDA 1QN8A 3CVSA 1VRLA 3PDKA 1VKLA 4EJYA 3DPTA 4BDYA 4BE1A 2DKAA 3OSTA 5IYCP 3OS1A 5KN9A 5FROA 2OOYA 2V9JA 2NLVA 2V75A 2YG8A 1HU0A 1J3MA 3OLPA 3UW2A 1UL7A 1KG5A 1JDYA 3OCIA 3TE5A 5KN8A 3EAYA 1R4XA 1QN7A 1RRQA 1QTPA 3I0WA 3I0XA 4EA5A 3H1ZA 2EHBD 1QN5A 4ROCB 3DPUA 1KQJA 3EIKA 1B9KA 5EPCA 1XQPA 1PCMX 1MP9A 1JFIC 4OFAA 1M3HA 4RODB 4CFFA 3N89A 1RM1A 1KG7A 4QG5A 4AI5A 3OGDA 1CDWA 4IKFA 4UNFA 2R5XA 3L2VA 4BE0A 3L2RA 3OYLA 1XQOA 2PWWA 1YQKA 3R2XC 2D0CA 3VN5A 1EBMA 1LWYA 2HZMA 3I3WA 2NVMA 3OC3C 3HS9A 4BDZA 1C4GA 2YG9A 2FUVA 2OFKA 3L2UA 3NNQA 1NKUA 3IHOA 3BKQX 3OYFA 3S3NA 3OYJA 3FSPA 5IYBP 1PU6A 4UOBA 1WQAA 2XHIA 1K35A 5AN4A 1RRSA 4IL8A 4PIIA 1YQRA 1LMZA 4B0AA 1NGNA 5KL0A 1LWVA 3CWUA 1PZDA 1UT7A 1P7MA 3HS8A 5F9CA 4MRQA 4BJUA 4ROEB 5FRMA 2HL9A 1KYDA 1VTLE 2Y8LA 2FKFA 2OOXA 1KFQA 1XG7A 4OFEA 3OYBA 3S6IA 3C04A 5JN5A 2VJ0A 1NGMA 3CVTA 1M5Q1 3VW4A 3LCNA 2IV9A 4BE2A 1W80A 4B24A 1YTBA 3ENOC 5JMVD 1MUNA 1KG3A 4E9EA 1C9BB 2F7LA 1QN9A 2Z8UA 1N3CA 4C7PA 1WEFA 5BMNA 1UT4A 4EA4A 1KFIA 2H56A 1XSZA 1V5SA 4EALA 4EAGA 4WZSD 4OFHA 4BACA 2NOBA 4YPRA 4NZGA 4E9GA 4DK9A 1PCZA 2NOEA 3CWAA 3OYGA
chains in the Genus database with same CATH topology
1PU6A 4UOBA 1QNAA 2NOHA 2XHIA 5AN4A 1RRSA 1MUYA 1D3UA 3CWAA 3N5NX 3CVSA 4EW4A 1QN8A 4PIIA 1VRLA 3ASMA 1YQRA 1LMZA 4EJYA 1NGNA 3F0ZA 1DIZA 1KYFA 1N39A 1P59A 3CWUA 1LWVA 1VOKA 3DPTA 2G30A 1TGHA 4B23A 1PZDA 5DPKA 1QNBA 1UT7A 3OSTA 2O3OA 5IYCP 1P7MA 2NOLA 1QN3A 3HS8A 1E42A 3F10A 4HSBA 4ROEB 5KN9A 4Q11A 2NOZA 1KYDA 1VTLE 2YG8A 4EJZA 2JHNA 1HU0A 2MJ7A 2D0BA 3N0UA 1KO9A 1QNEA 1KG2A 1KG5A 1XG7A 3OCIA 5KN8A 3SNSA 4OFEA 1R4XA 1QN7A 1RRQA 3S6IA 2NOIA 1QTPA 1MUDA 3I0WA 2JOIA 2VJ0A 3I0XA 1NGMA 1YTFA 2I5WA 3OSMA 3CVTA 1TBPA 3RPJA 2JG6A 2YH5A 4EA5A 2HZSA 1KY6A 3H1ZA 1QN5A 4ROCB 1KYUA 2ABKA 1WEIA 1N3AA 1KQJA 3DPUA 3KNTA 1B9KA 1KG6A 3OH9A 3EIKA 4B0AA 4E9FA 1XQPA 4PY5A 2IV9A 4B22A 1W80A 4B24A 1ORPA 5CHZA 1FN7A 1MP9A 3KRMA 1VTOA 1YTBA 1JFIC 2IV8A 4OFAA 4YOQA 1M3HA 1QN6A 1MPGA 1MUNA 1KG3A 3FHGA 4E9EA 4RODB 3N89A 1NH2A 1C9BB 1YQLA 4DULA 1QN9A 2LAEA 1RM1A 2Z8UA 1N3CA 1KG7A 4AIAA 1WEFA 4I8OA 4YPHA 4AI5A 3KTUA 1M3QA 1UT4A 1YQMA 5IYDP 4EA4A 3OGDA 1CDWA 2D0AA 1TBAB 4UNFA 2FGTA 2OFIA 4EW0A 1VOLB 2MZ8A 4EVVA 1XQOA 1WEGA 2H56A 3ULXA 1ORNA 3CW7A 1PVSA 1YQKA 3IH7A 4AI4A 2D0CA 4WZSD 1KEAA 3CWTA 1EBMA 3VN5A 1PU7A 3D4VA 4B21A 1LWYA 4OFHA 2HZMA 1QN4A 2NOBA 1KY7A 1LWWA 4YPRA 3OC3C 4E9GA 2NOFA 4E9HA 3HS9A 4DK9A 1QNCA 1QTSA 2YG9A 1PU8A 2OFKA 3FHFA 3CWSA 2JHJA 1KG4A 1NKUA 3IHOA 3G0QA 4TPSA 1PCZA 1AISA 2NOEA 3OH6A 3FSPA 5IYBP 1NVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PU6 A;  4UOB A;  2NOH A;  2XHI A;  5AN4 A;  1RRS A;  1MUY A;  3CWA A;  3N5N X;  3CVS A;  4EW4 A;  4PII A;  1VRL A;  1YQR A;  1LMZ A;  4EJY A;  1NGN A;  3F0Z A;  1DIZ A;  1N39 A;  1P59 A;  3CWU A;  1LWV A;  4B23 A;  5DPK A;  1P7M A;  2NOL A;  3F10 A;  4HSB A;  5KN9 A;  2NOZ A;  2YG8 A;  4EJZ A;  2JHN A;  1HU0 A;  3N0U A;  1KO9 A;  1KG2 A;  1KG5 A;  1XG7 A;  5KN8 A;  4OFE A;  1RRQ A;  3S6I A;  2NOI A;  1MUD A;  3I0W A;  3I0X A;  2I5W A;  3CVT A;  2JG6 A;  4EA5 A;  2ABK A;  1WEI A;  1N3A A;  1KQJ A;  3KNT A;  1KG6 A;  3OH9 A;  4E9F A;  1XQP A;  4B22 A;  4B24 A;  1ORP A;  5CHZ A;  1FN7 A;  4OFA A;  4YOQ A;  1M3H A;  1MPG A;  1MUN A;  1KG3 A;  3FHG A;  4E9E A;  1YQL A;  1N3C A;  1KG7 A;  4AIA A;  1WEF A;  4YPH A;  4AI5 A;  3KTU A;  1M3Q A;  1YQM A;  4EA4 A;  3OGD A;  4UNF A;  2OFI A;  4EW0 A;  4EVV A;  1XQO A;  1WEG A;  2H56 A;  1ORN A;  3CW7 A;  1PVS A;  1YQK A;  3IH7 A;  4AI4 A;  1KEA A;  3CWT A;  1EBM A;  1PU7 A;  3D4V A;  4B21 A;  1LWY A;  4OFH A;  2NOB A;  1LWW A;  4YPR A;  4E9G A;  2NOF A;  4E9H A;  4DK9 A;  2YG9 A;  1PU8 A;  2OFK A;  3FHF A;  3CWS A;  2JHJ A;  1KG4 A;  1NKU A;  3IHO A;  3G0Q A;  2NOE A;  3OH6 A;  3FSP A; 
#chains in the Genus database with same CATH topology
 1MUY A;  2Y8Q A;  3F0Z A;  1DIZ A;  1VOK A;  1N39 A;  1P59 A;  2G30 A;  3ENC A;  5HSH A;  5DPK A;  2YA3 A;  1Q9U A;  1QN3 A;  3L2Q A;  3RSM A;  2QRC A;  4HSB A;  4E7J A;  4EAK A;  3D7Q A;  4EJZ A;  2JHN A;  4HJH A;  3T4N A;  2D0B A;  2V8Q A;  3N0U A;  1KO9 A;  2V92 A;  2NOI A;  1P5D X;  3TDH A;  2JOI A;  1YTF A;  3OSM A;  1TBP A;  3PMG A;  2YH5 A;  2HZS A;  1KY6 A;  2HKP A;  1PCJ X;  4EAI A;  3NA5 A;  4WX8 A;  1KG6 A;  4E9F A;  3S3M A;  3KRM A;  1VTO A;  5CHZ A;  1FN7 A;  2IV8 A;  4YOQ A;  1MPG A;  1NH2 A;  2W03 A;  5FRN A;  1YQL A;  1C47 A;  4AIA A;  4I8O A;  4YPH A;  3KTU A;  1M3Q A;  3OYI A;  1TBA B;  2JPS A;  1PVS A;  3OYC A;  4E7I A;  3CWT A;  2FKM X;  3D4V A;  4B21 A;  2HL8 A;  1QN4 A;  1LWW A;  2DKD A;  4E9H A;  1QNC A;  3OYK A;  1PU8 A;  3FHF A;  3OSE A;  3CWS A;  2JHJ A;  3OYN A;  3G0Q A;  3OH6 A;  1QNA A;  2NOH A;  2DKC A;  2JPI A;  1WJW A;  1D3U A;  3N5N X;  4EW4 A;  3ASM A;  1KYF A;  1TGH A;  4B23 A;  1QNB A;  2O3O A;  2NOL A;  3L2W A;  1E42 A;  4WXA A;  2W04 A;  3F10 A;  4Q11 A;  2NOZ A;  2MJ7 A;  3OYH A;  1U84 A;  4EAJ A;  2ZFD B;  1QNE A;  1KG2 A;  3SNS A;  1MUD A;  1K2Y X;  4D7Q A;  2I5W A;  1P5G X;  4D7R A;  3RPJ A;  2JG6 A;  1KYU A;  2Z0F A;  2H5A X;  2ABK A;  1WEI A;  4E7L A;  1N3A A;  3KNT A;  4E7K A;  3OH9 A;  4PY5 A;  3OS0 A;  4B22 A;  4ZTF A;  3OYA A;  1ORP A;  1EUV A;  2NWV A;  1QN6 A;  4ZTJ A;  3FHG A;  4DUL A;  2LAE A;  3OYM A;  1YQM A;  5IYD P;  2D0A A;  1T6A A;  2FGT A;  2OFI A;  4EW0 A;  1VOL B;  2MZ8 A;  4EVV A;  1WEG A;  3ULX A;  1ORN A;  3CW7 A;  3S3O A;  3IH7 A;  4AI4 A;  1KEA A;  5BMP A;  2QRD A;  1PU7 A;  1KY7 A;  1TUO A;  3OYE A;  3OY9 A;  2H4L X;  2NOF A;  1QTS A;  2QR1 A;  2QLV A;  4E7H A;  1KG4 A;  4TPS A;  2QRE A;  1AIS A;  3OS2 A;  1LXT A;  1NVP A;  3OYD A;  1QN8 A;  3CVS A;  1VRL A;  3PDK A;  1VKL A;  4EJY A;  3DPT A;  4BDY A;  4BE1 A;  2DKA A;  3OST A;  5IYC P;  3OS1 A;  5KN9 A;  5FRO A;  2OOY A;  2V9J A;  2NLV A;  2V75 A;  2YG8 A;  1HU0 A;  1J3M A;  3OLP A;  3UW2 A;  1UL7 A;  1KG5 A;  1JDY A;  3OCI A;  3TE5 A;  5KN8 A;  3EAY A;  1R4X A;  1QN7 A;  1RRQ A;  1QTP A;  3I0W A;  3I0X A;  4EA5 A;  3H1Z A;  2EHB D;  1QN5 A;  4ROC B;  3DPU A;  1KQJ A;  3EIK A;  1B9K A;  5EPC A;  1XQP A;  1PCM X;  1MP9 A;  1JFI C;  4OFA A;  1M3H A;  4ROD B;  4CFF A;  3N89 A;  1RM1 A;  1KG7 A;  4QG5 A;  4AI5 A;  3OGD A;  1CDW A;  4IKF A;  4UNF A;  2R5X A;  3L2V A;  4BE0 A;  3L2R A;  3OYL A;  1XQO A;  2PWW A;  1YQK A;  3R2X C;  2D0C A;  3VN5 A;  1EBM A;  1LWY A;  2HZM A;  3I3W A;  2NVM A;  3OC3 C;  3HS9 A;  4BDZ A;  1C4G A;  2YG9 A;  2FUV A;  2OFK A;  3L2U A;  3NNQ A;  1NKU A;  3IHO A;  3BKQ X;  3OYF A;  3S3N A;  3OYJ A;  3FSP A;  5IYB P;  1PU6 A;  4UOB A;  1WQA A;  2XHI A;  1K35 A;  5AN4 A;  1RRS A;  4IL8 A;  4PII A;  1YQR A;  1LMZ A;  4B0A A;  1NGN A;  5KL0 A;  1LWV A;  3CWU A;  1PZD A;  1UT7 A;  1P7M A;  3HS8 A;  5F9C A;  4MRQ A;  4BJU A;  4ROE B;  5FRM A;  2HL9 A;  1KYD A;  1VTL E;  2Y8L A;  2FKF A;  2OOX A;  1KFQ A;  1XG7 A;  4OFE A;  3OYB A;  3S6I A;  3C04 A;  5JN5 A;  2VJ0 A;  1NGM A;  3CVT A;  1M5Q 1;  3VW4 A;  3LCN A;  2IV9 A;  4BE2 A;  1W80 A;  4B24 A;  1YTB A;  3ENO C;  5JMV D;  1MUN A;  1KG3 A;  4E9E A;  1C9B B;  2F7L A;  1QN9 A;  2Z8U A;  1N3C A;  4C7P A;  1WEF A;  5BMN A;  1UT4 A;  4EA4 A;  1KFI A;  2H56 A;  1XSZ A;  1V5S A;  4EAL A;  4EAG A;  4WZS D;  4OFH A;  4BAC A;  2NOB A;  4YPR A;  4NZG A;  4E9G A;  4DK9 A;  1PCZ A;  2NOE A;  3CWA A;  3OYG A; 
#chains in the Genus database with same CATH homology
 1PU6 A;  4UOB A;  1QNA A;  2NOH A;  2XHI A;  5AN4 A;  1RRS A;  1MUY A;  1D3U A;  3CWA A;  3N5N X;  3CVS A;  4EW4 A;  1QN8 A;  4PII A;  1VRL A;  3ASM A;  1YQR A;  1LMZ A;  4EJY A;  1NGN A;  3F0Z A;  1DIZ A;  1KYF A;  1N39 A;  1P59 A;  3CWU A;  1LWV A;  1VOK A;  3DPT A;  2G30 A;  1TGH A;  4B23 A;  1PZD A;  5DPK A;  1QNB A;  1UT7 A;  3OST A;  2O3O A;  5IYC P;  1P7M A;  2NOL A;  1QN3 A;  3HS8 A;  1E42 A;  3F10 A;  4HSB A;  4ROE B;  5KN9 A;  4Q11 A;  2NOZ A;  1KYD A;  1VTL E;  2YG8 A;  4EJZ A;  2JHN A;  1HU0 A;  2MJ7 A;  2D0B A;  3N0U A;  1KO9 A;  1QNE A;  1KG2 A;  1KG5 A;  1XG7 A;  3OCI A;  5KN8 A;  3SNS A;  4OFE A;  1R4X A;  1QN7 A;  1RRQ A;  3S6I A;  2NOI A;  1QTP A;  1MUD A;  3I0W A;  2JOI A;  2VJ0 A;  3I0X A;  1NGM A;  1YTF A;  2I5W A;  3OSM A;  3CVT A;  1TBP A;  3RPJ A;  2JG6 A;  2YH5 A;  4EA5 A;  2HZS A;  1KY6 A;  3H1Z A;  1QN5 A;  4ROC B;  1KYU A;  2ABK A;  1WEI A;  1N3A A;  1KQJ A;  3DPU A;  3KNT A;  1B9K A;  1KG6 A;  3OH9 A;  3EIK A;  4B0A A;  4E9F A;  1XQP A;  4PY5 A;  2IV9 A;  4B22 A;  1W80 A;  4B24 A;  1ORP A;  5CHZ A;  1FN7 A;  1MP9 A;  3KRM A;  1VTO A;  1YTB A;  1JFI C;  2IV8 A;  4OFA A;  4YOQ A;  1M3H A;  1QN6 A;  1MPG A;  1MUN A;  1KG3 A;  3FHG A;  4E9E A;  4ROD B;  3N89 A;  1NH2 A;  1C9B B;  1YQL A;  4DUL A;  1QN9 A;  2LAE A;  1RM1 A;  2Z8U A;  1N3C A;  1KG7 A;  4AIA A;  1WEF A;  4I8O A;  4YPH A;  4AI5 A;  3KTU A;  1M3Q A;  1UT4 A;  1YQM A;  5IYD P;  4EA4 A;  3OGD A;  1CDW A;  2D0A A;  1TBA B;  4UNF A;  2FGT A;  2OFI A;  4EW0 A;  1VOL B;  2MZ8 A;  4EVV A;  1XQO A;  1WEG A;  2H56 A;  3ULX A;  1ORN A;  3CW7 A;  1PVS A;  1YQK A;  3IH7 A;  4AI4 A;  2D0C A;  4WZS D;  1KEA A;  3CWT A;  1EBM A;  3VN5 A;  1PU7 A;  3D4V A;  4B21 A;  1LWY A;  4OFH A;  2HZM A;  1QN4 A;  2NOB A;  1KY7 A;  1LWW A;  4YPR A;  3OC3 C;  4E9G A;  2NOF A;  4E9H A;  3HS9 A;  4DK9 A;  1QNC A;  1QTS A;  2YG9 A;  1PU8 A;  2OFK A;  3FHF A;  3CWS A;  2JHJ A;  1KG4 A;  1NKU A;  3IHO A;  3G0Q A;  4TPS A;  1PCZ A;  1AIS A;  2NOE A;  3OH6 A;  3FSP A;  5IYB P;  1NVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...