4EJZA

Structure of mbogg1 in complex with low affinity dna ligand
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
289
Chain Sequence
MKYNVEEKGTKVIVRGIADFNLKETFESGQCFRWNEEEDGSYTGVAYDRVVNVKLEGDTLIIDNTNLTDFYDIWFDYFDLGRDYGQIKESLSKDPVLKEAIKFGQGIRILRQDTWETLVSFIVSQNNRIPQIKKVIENLATSFGNPIEYKGKIYYTFPKPEELVMYDVETIAKTRCGFRAKYIFDAASKVFSGEINLLKLHEYSTSEIRDILMTINGVGPKVADCVILYSIGRYDTFPTDVWIKRIVEHLYLKREGTPVEIQLFAIDKFGDLSGFAQQYLFYYGREMGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-Methyladenine DNA glycosylase
publication title Crystal structures of MBOgg1 in complex with two abasic DNA ligands
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Hydrolase/dna
total genus 96
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4ejzA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4ejzA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4ejzA01
3OH6A 3KNTA 4E9HA 3I0WA 3KTUA 1YQMA 1LWWA 1RRSA 3CWUA 3G0QA 1KG4A 4EA5A 1WEIA 1KG6A 1LMZA 1PU6A 2ABKA 4EA4A 1LWVA 3F10A 4OFAA 3CVTA 3FHFA 1VRLA 1WEGA 1P59A 5DPKA 2OFIA 1DIZA 3FSPA 5AN4A 5CHZA 1FN7A 4E9FA 1N3AA 1NKUA 1P7MA 1XQOA 4AI5A 1XQPA 1KG5A 1MUDA 1PU8A 4OFEA 1M3HA 1N39A 3D4VA 4EJYA 4YOQA 1RRQA 3CVSA 1N3CA 1KQJA 3CWTA 3FHGA 4EW0A 4B24A 1KG3A 1MPGA 1EBMA 2JG6A 4EJZA 1PU7A 1YQLA 2NOFA 1M3QA 1KO9A 3OGDA 2NOLA 1KG7A 4EVVA 2XHIA 2JHJA 3IH7A 4YPRA 2NOZA 3N0UA 4EW4A 3CWSA 4DK9A 4B22A 4AIAA 4E9GA 4PIIA 4YPHA 2NOBA 2JHNA 1KG2A 1LWYA 4UOBA 1MUNA 1KEAA 3S6IA 1PVSA 3IHOA 2NOEA 2NOHA 2OFKA 4HSBA 3OH9A 4AI4A 3CW7A 5KN9A 1MUYA 1YQKA 1HU0A 5KN8A 4B21A 4UNFA 2I5WA 3CWAA 4B23A 3N5NX 1YQRA 1WEFA 1XG7A 3I0XA 2YG9A 2NOIA 2YG8A 1NGNA 2H56A 1ORPA 4OFHA 4E9EA 1ORNA 3F0ZA
chains in the Genus database with same CATH superfamily
3S3OA 3DPUA 2IV8A 1R4XA 1XSZA 4EAGA 3RSMA 3CWUA 3UW2A 4EA5A 2V75A 2ABKA 1VTOA 3OYDA 4OFAA 1WEGA 2NVMA 3BKQX 1QN5A 2OFIA 3OYFA 5HSHA 2H4LX 1FN7A 3ASMA 2ZFDB 2HZSA 1PU8A 4NZGA 1YTBA 3OYEA 1RRQA 1N3CA 1EUVA 1KQJA 1MPGA 2JG6A 1W80A 1QN4A 1YQLA 2NOFA 1RM1A 4EVVA 1NGMA 1TBAB 4BE2A 2VJ0A 1WJWA 1C9BB 4ZTFA 4B22A 1CDWA 2W04A 4BE0A 4ROCB 1KEAA 3S6IA 2QREA 3OSMA 4HJHA 2EHBD 3OS2A 3ULXA 3DPTA 5KN9A 3R2XC 5KN8A 3CWAA 4D7RA 3L2RA 3OYBA 1YQRA 1WEFA 1QNBA 3EAYA 1XG7A 1UL7A 3OY9A 1NGNA 1ORPA 2O3OA 3OYLA 4DULA 4QG5A 1M5Q1 1QN8A 3I0WA 1YQMA 1VOLB 3PDKA 3G0QA 1U84A 5KL0A 1KG4A 1WEIA 1KG6A 1QNAA 1VTLE 2Z8UA 3TE5A 1DIZA 3FSPA 4E9FA 2HKPA 1XQPA 2FKFA 1KG5A 1KY7A 4I8OA 2QLVA 1M3HA 4Q11A 4BJUA 3D7QA 3CVSA 2JPIA 4EW0A 1KO9A 3OGDA 4RODB 1QNEA 1NVPA 2QRCA 1JDYA 3N0UA 1T6AA 3OYGA 4EAIA 4DK9A 2HL9A 2V92A 4AIAA 4EAJA 4E9GA 4PIIA 3OS1A 2NOBA 4E7IA 4E7JA 1QN6A 3EIKA 2NWVA 3IHOA 2H5AX 1P5DX 4HSBA 4WZSD 4MRQA 4E7KA 4AI4A 5FRNA 2FUVA 1Q9UA 1YQKA 1HU0A 4B21A 4UNFA 3OYCA 2DKCA 2HZMA 3L2VA 1PCZA 4OFHA 1K35A 3N89A 4CFFA 3L2UA 3ENCA 5IYDP 3KNTA 4E9HA 4B0AA 3KTUA 1LWWA 2D0CA 1RRSA 1KY6A 3KRMA 3VW4A 3F10A 3FHFA 1VRLA 1P59A 4D7QA 5DPKA 2PWWA 2YH5A 5CHZA 1N3AA 3HS9A 5IYCP 1KYUA 4WX8A 1PCJX 3HS8A 4ROEB 1XQOA 4AI5A 1VOKA 1MUDA 4OFEA 1K2YX 4BDZA 1N39A 5IYBP 3D4VA 2MJ7A 4BACA 4EJYA 4YOQA 2V9JA 3L2QA 2R5XA 1P5GX 4TPSA 3CWTA 5JMVD 3FHGA 1KG3A 1MP9A 1EBMA 2Z0FA 1M3QA 3C04A 3S3NA 1C4GA 2NOLA 2FKMX 1KG7A 1QTSA 3OYJA 1VKLA 2DKDA 1B9KA 3IH7A 3I3WA 4YPRA 2NOZA 3PMGA 2W03A 4EW4A 1UT7A 2JOIA 2YA3A 3S3MA 2Y8LA 5FROA 3VN5A 1D3UA 1LWYA 1KFIA 5BMPA 2MZ8A 1PVSA 1TGHA 2NOEA 2V8QA 1E42A 4E7LA 2OFKA 2HL8A 1QTPA 3OH9A 2DKAA 4BDYA 5FRMA 2D0BA 1NH2A 1MUYA 4B23A 3H1ZA 3T4NA 1J3MA 3OYMA 3OYIA 1PCMX 1AISA 2NOIA 3OLPA 4WXAA 5BMNA 1ORNA 3OH6A 3OYAA 4EALA 3TDHA 3RPJA 1QN7A 3SNSA 2NLVA 4IKFA 1PZDA 1PU6A 1LMZA 1LWVA 4IL8A 4EA4A 1TUOA 3OSEA 3OCIA 3CVTA 4EAKA 2OOXA 1JFIC 5AN4A 3OYKA 1NKUA 1C47A 1YTFA 1P7MA 5JN5A 4C7PA 2FGTA 1QN9A 2LAEA 5F9CA 1LXTA 3OYNA 2G30A 2QRDA 4B24A 4EJZA 1PU7A 1V5SA 2IV9A 2Y8QA 5EPCA 4PY5A 1UT4A 2XHIA 2JHJA 1TBPA 2F7LA 3OS0A 3LCNA 1QNCA 2JPSA 3CWSA 4ZTJA 3OC3C 4YPHA 2JHNA 3NA5A 1KG2A 3OSTA 4UOBA 1KYDA 1MUNA 2NOHA 1WQAA 1KFQA 1QN3A 4E7HA 3NNQA 4BE1A 3CW7A 3OYHA 2D0AA 3ENOC 2OOYA 2I5WA 1KYFA 3L2WA 3N5NX 3I0XA 2YG9A 2YG8A 2H56A 2QR1A 4E9EA 3F0ZA
chains in the Genus database with same CATH topology
3N89A 4DULA 3OH6A 5IYDP 3DPUA 3KNTA 4E9HA 2IV8A 4B0AA 1QN8A 3I0WA 1R4XA 3KTUA 1YQMA 1LWWA 2D0CA 3RPJA 1VOLB 1RRSA 3CWUA 1QN7A 3SNSA 1KY6A 3G0QA 1KG4A 4EA5A 1WEIA 1PZDA 1KG6A 1LMZA 1PU6A 2ABKA 4EA4A 1LWVA 3KRMA 1QNAA 3OCIA 3F10A 2Z8UA 1VTOA 1VTLE 4OFAA 3CVTA 3FHFA 1VRLA 1WEGA 1P59A 1QN5A 5DPKA 2OFIA 1JFIC 2YH5A 1DIZA 3FSPA 5AN4A 5CHZA 1FN7A 4E9FA 1N3AA 1NKUA 3HS9A 5IYCP 1KYUA 1P7MA 3ASMA 1YTFA 3HS8A 2HZSA 4ROEB 1XQOA 4AI5A 1XQPA 1KG5A 1KY7A 1MUDA 1PU8A 4OFEA 1VOKA 4I8OA 2FGTA 1QN9A 1M3HA 1N39A 5IYBP 3D4VA 4Q11A 2MJ7A 4EJYA 2LAEA 4YOQA 1YTBA 1RRQA 3CVSA 1N3CA 2G30A 1KQJA 4TPSA 3CWTA 3FHGA 4EW0A 4B24A 1KG3A 1MPGA 1EBMA 2JG6A 4EJZA 1MP9A 1W80A 1PU7A 1YQLA 1QN4A 2NOFA 1M3QA 1KO9A 3OGDA 2IV9A 2NOLA 4RODB 1KG7A 1RM1A 1QTSA 4EVVA 1QNEA 4PY5A 1B9KA 1NVPA 1TBAB 1NGMA 1UT4A 2XHIA 2JHJA 3IH7A 1TBPA 4YPRA 2NOZA 2VJ0A 3N0UA 4EW4A 1UT7A 2JOIA 1QNCA 3CWSA 1C9BB 4DK9A 4B22A 4AIAA 3OC3C 4E9GA 4PIIA 4YPHA 1CDWA 3VN5A 2NOBA 2JHNA 1D3UA 1KG2A 1LWYA 3OSTA 4ROCB 4UOBA 1KYDA 1MUNA 1QN6A 1KEAA 3S6IA 3EIKA 2MZ8A 1PVSA 3OSMA 1TGHA 3IHOA 2NOEA 2NOHA 1E42A 2OFKA 1QN3A 4HSBA 4WZSD 3ULXA 1QTPA 3OH9A 4AI4A 3DPTA 2D0BA 3CW7A 5KN9A 1NH2A 2D0AA 1MUYA 1YQKA 1HU0A 5KN8A 4B21A 4UNFA 2I5WA 3CWAA 4B23A 1KYFA 3H1ZA 3N5NX 1YQRA 1WEFA 1QNBA 2HZMA 1XG7A 3I0XA 1AISA 2YG9A 2NOIA 1PCZA 2YG8A 1NGNA 2H56A 1ORPA 4OFHA 2O3OA 4E9EA 1ORNA 3F0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OH6 A;  3KNT A;  4E9H A;  3I0W A;  3KTU A;  1YQM A;  1LWW A;  1RRS A;  3CWU A;  3G0Q A;  1KG4 A;  4EA5 A;  1WEI A;  1KG6 A;  1LMZ A;  1PU6 A;  2ABK A;  4EA4 A;  1LWV A;  3F10 A;  4OFA A;  3CVT A;  3FHF A;  1VRL A;  1WEG A;  1P59 A;  5DPK A;  2OFI A;  1DIZ A;  3FSP A;  5AN4 A;  5CHZ A;  1FN7 A;  4E9F A;  1N3A A;  1NKU A;  1P7M A;  1XQO A;  4AI5 A;  1XQP A;  1KG5 A;  1MUD A;  1PU8 A;  4OFE A;  1M3H A;  1N39 A;  3D4V A;  4EJY A;  4YOQ A;  1RRQ A;  3CVS A;  1N3C A;  1KQJ A;  3CWT A;  3FHG A;  4EW0 A;  4B24 A;  1KG3 A;  1MPG A;  1EBM A;  2JG6 A;  4EJZ A;  1PU7 A;  1YQL A;  2NOF A;  1M3Q A;  1KO9 A;  3OGD A;  2NOL A;  1KG7 A;  4EVV A;  2XHI A;  2JHJ A;  3IH7 A;  4YPR A;  2NOZ A;  3N0U A;  4EW4 A;  3CWS A;  4DK9 A;  4B22 A;  4AIA A;  4E9G A;  4PII A;  4YPH A;  2NOB A;  2JHN A;  1KG2 A;  1LWY A;  4UOB A;  1MUN A;  1KEA A;  3S6I A;  1PVS A;  3IHO A;  2NOE A;  2NOH A;  2OFK A;  4HSB A;  3OH9 A;  4AI4 A;  3CW7 A;  5KN9 A;  1MUY A;  1YQK A;  1HU0 A;  5KN8 A;  4B21 A;  4UNF A;  2I5W A;  3CWA A;  4B23 A;  3N5N X;  1YQR A;  1WEF A;  1XG7 A;  3I0X A;  2YG9 A;  2NOI A;  2YG8 A;  1NGN A;  2H56 A;  1ORP A;  4OFH A;  4E9E A;  1ORN A;  3F0Z A; 
#chains in the Genus database with same CATH topology
 3S3O A;  3DPU A;  2IV8 A;  1R4X A;  1XSZ A;  4EAG A;  3RSM A;  3CWU A;  3UW2 A;  4EA5 A;  2V75 A;  2ABK A;  1VTO A;  3OYD A;  4OFA A;  1WEG A;  2NVM A;  3BKQ X;  1QN5 A;  2OFI A;  3OYF A;  5HSH A;  2H4L X;  1FN7 A;  3ASM A;  2ZFD B;  2HZS A;  1PU8 A;  4NZG A;  1YTB A;  3OYE A;  1RRQ A;  1N3C A;  1EUV A;  1KQJ A;  1MPG A;  2JG6 A;  1W80 A;  1QN4 A;  1YQL A;  2NOF A;  1RM1 A;  4EVV A;  1NGM A;  1TBA B;  4BE2 A;  2VJ0 A;  1WJW A;  1C9B B;  4ZTF A;  4B22 A;  1CDW A;  2W04 A;  4BE0 A;  4ROC B;  1KEA A;  3S6I A;  2QRE A;  3OSM A;  4HJH A;  2EHB D;  3OS2 A;  3ULX A;  3DPT A;  5KN9 A;  3R2X C;  5KN8 A;  3CWA A;  4D7R A;  3L2R A;  3OYB A;  1YQR A;  1WEF A;  1QNB A;  3EAY A;  1XG7 A;  1UL7 A;  3OY9 A;  1NGN A;  1ORP A;  2O3O A;  3OYL A;  4DUL A;  4QG5 A;  1M5Q 1;  1QN8 A;  3I0W A;  1YQM A;  1VOL B;  3PDK A;  3G0Q A;  1U84 A;  5KL0 A;  1KG4 A;  1WEI A;  1KG6 A;  1QNA A;  1VTL E;  2Z8U A;  3TE5 A;  1DIZ A;  3FSP A;  4E9F A;  2HKP A;  1XQP A;  2FKF A;  1KG5 A;  1KY7 A;  4I8O A;  2QLV A;  1M3H A;  4Q11 A;  4BJU A;  3D7Q A;  3CVS A;  2JPI A;  4EW0 A;  1KO9 A;  3OGD A;  4ROD B;  1QNE A;  1NVP A;  2QRC A;  1JDY A;  3N0U A;  1T6A A;  3OYG A;  4EAI A;  4DK9 A;  2HL9 A;  2V92 A;  4AIA A;  4EAJ A;  4E9G A;  4PII A;  3OS1 A;  2NOB A;  4E7I A;  4E7J A;  1QN6 A;  3EIK A;  2NWV A;  3IHO A;  2H5A X;  1P5D X;  4HSB A;  4WZS D;  4MRQ A;  4E7K A;  4AI4 A;  5FRN A;  2FUV A;  1Q9U A;  1YQK A;  1HU0 A;  4B21 A;  4UNF A;  3OYC A;  2DKC A;  2HZM A;  3L2V A;  1PCZ A;  4OFH A;  1K35 A;  3N89 A;  4CFF A;  3L2U A;  3ENC A;  5IYD P;  3KNT A;  4E9H A;  4B0A A;  3KTU A;  1LWW A;  2D0C A;  1RRS A;  1KY6 A;  3KRM A;  3VW4 A;  3F10 A;  3FHF A;  1VRL A;  1P59 A;  4D7Q A;  5DPK A;  2PWW A;  2YH5 A;  5CHZ A;  1N3A A;  3HS9 A;  5IYC P;  1KYU A;  4WX8 A;  1PCJ X;  3HS8 A;  4ROE B;  1XQO A;  4AI5 A;  1VOK A;  1MUD A;  4OFE A;  1K2Y X;  4BDZ A;  1N39 A;  5IYB P;  3D4V A;  2MJ7 A;  4BAC A;  4EJY A;  4YOQ A;  2V9J A;  3L2Q A;  2R5X A;  1P5G X;  4TPS A;  3CWT A;  5JMV D;  3FHG A;  1KG3 A;  1MP9 A;  1EBM A;  2Z0F A;  1M3Q A;  3C04 A;  3S3N A;  1C4G A;  2NOL A;  2FKM X;  1KG7 A;  1QTS A;  3OYJ A;  1VKL A;  2DKD A;  1B9K A;  3IH7 A;  3I3W A;  4YPR A;  2NOZ A;  3PMG A;  2W03 A;  4EW4 A;  1UT7 A;  2JOI A;  2YA3 A;  3S3M A;  2Y8L A;  5FRO A;  3VN5 A;  1D3U A;  1LWY A;  1KFI A;  5BMP A;  2MZ8 A;  1PVS A;  1TGH A;  2NOE A;  2V8Q A;  1E42 A;  4E7L A;  2OFK A;  2HL8 A;  1QTP A;  3OH9 A;  2DKA A;  4BDY A;  5FRM A;  2D0B A;  1NH2 A;  1MUY A;  4B23 A;  3H1Z A;  3T4N A;  1J3M A;  3OYM A;  3OYI A;  1PCM X;  1AIS A;  2NOI A;  3OLP A;  4WXA A;  5BMN A;  1ORN A;  3OH6 A;  3OYA A;  4EAL A;  3TDH A;  3RPJ A;  1QN7 A;  3SNS A;  2NLV A;  4IKF A;  1PZD A;  1PU6 A;  1LMZ A;  1LWV A;  4IL8 A;  4EA4 A;  1TUO A;  3OSE A;  3OCI A;  3CVT A;  4EAK A;  2OOX A;  1JFI C;  5AN4 A;  3OYK A;  1NKU A;  1C47 A;  1YTF A;  1P7M A;  5JN5 A;  4C7P A;  2FGT A;  1QN9 A;  2LAE A;  5F9C A;  1LXT A;  3OYN A;  2G30 A;  2QRD A;  4B24 A;  4EJZ A;  1PU7 A;  1V5S A;  2IV9 A;  2Y8Q A;  5EPC A;  4PY5 A;  1UT4 A;  2XHI A;  2JHJ A;  1TBP A;  2F7L A;  3OS0 A;  3LCN A;  1QNC A;  2JPS A;  3CWS A;  4ZTJ A;  3OC3 C;  4YPH A;  2JHN A;  3NA5 A;  1KG2 A;  3OST A;  4UOB A;  1KYD A;  1MUN A;  2NOH A;  1WQA A;  1KFQ A;  1QN3 A;  4E7H A;  3NNQ A;  4BE1 A;  3CW7 A;  3OYH A;  2D0A A;  3ENO C;  2OOY A;  2I5W A;  1KYF A;  3L2W A;  3N5N X;  3I0X A;  2YG9 A;  2YG8 A;  2H56 A;  2QR1 A;  4E9E A;  3F0Z A; 
#chains in the Genus database with same CATH homology
 3N89 A;  4DUL A;  3OH6 A;  5IYD P;  3DPU A;  3KNT A;  4E9H A;  2IV8 A;  4B0A A;  1QN8 A;  3I0W A;  1R4X A;  3KTU A;  1YQM A;  1LWW A;  2D0C A;  3RPJ A;  1VOL B;  1RRS A;  3CWU A;  1QN7 A;  3SNS A;  1KY6 A;  3G0Q A;  1KG4 A;  4EA5 A;  1WEI A;  1PZD A;  1KG6 A;  1LMZ A;  1PU6 A;  2ABK A;  4EA4 A;  1LWV A;  3KRM A;  1QNA A;  3OCI A;  3F10 A;  2Z8U A;  1VTO A;  1VTL E;  4OFA A;  3CVT A;  3FHF A;  1VRL A;  1WEG A;  1P59 A;  1QN5 A;  5DPK A;  2OFI A;  1JFI C;  2YH5 A;  1DIZ A;  3FSP A;  5AN4 A;  5CHZ A;  1FN7 A;  4E9F A;  1N3A A;  1NKU A;  3HS9 A;  5IYC P;  1KYU A;  1P7M A;  3ASM A;  1YTF A;  3HS8 A;  2HZS A;  4ROE B;  1XQO A;  4AI5 A;  1XQP A;  1KG5 A;  1KY7 A;  1MUD A;  1PU8 A;  4OFE A;  1VOK A;  4I8O A;  2FGT A;  1QN9 A;  1M3H A;  1N39 A;  5IYB P;  3D4V A;  4Q11 A;  2MJ7 A;  4EJY A;  2LAE A;  4YOQ A;  1YTB A;  1RRQ A;  3CVS A;  1N3C A;  2G30 A;  1KQJ A;  4TPS A;  3CWT A;  3FHG A;  4EW0 A;  4B24 A;  1KG3 A;  1MPG A;  1EBM A;  2JG6 A;  4EJZ A;  1MP9 A;  1W80 A;  1PU7 A;  1YQL A;  1QN4 A;  2NOF A;  1M3Q A;  1KO9 A;  3OGD A;  2IV9 A;  2NOL A;  4ROD B;  1KG7 A;  1RM1 A;  1QTS A;  4EVV A;  1QNE A;  4PY5 A;  1B9K A;  1NVP A;  1TBA B;  1NGM A;  1UT4 A;  2XHI A;  2JHJ A;  3IH7 A;  1TBP A;  4YPR A;  2NOZ A;  2VJ0 A;  3N0U A;  4EW4 A;  1UT7 A;  2JOI A;  1QNC A;  3CWS A;  1C9B B;  4DK9 A;  4B22 A;  4AIA A;  3OC3 C;  4E9G A;  4PII A;  4YPH A;  1CDW A;  3VN5 A;  2NOB A;  2JHN A;  1D3U A;  1KG2 A;  1LWY A;  3OST A;  4ROC B;  4UOB A;  1KYD A;  1MUN A;  1QN6 A;  1KEA A;  3S6I A;  3EIK A;  2MZ8 A;  1PVS A;  3OSM A;  1TGH A;  3IHO A;  2NOE A;  2NOH A;  1E42 A;  2OFK A;  1QN3 A;  4HSB A;  4WZS D;  3ULX A;  1QTP A;  3OH9 A;  4AI4 A;  3DPT A;  2D0B A;  3CW7 A;  5KN9 A;  1NH2 A;  2D0A A;  1MUY A;  1YQK A;  1HU0 A;  5KN8 A;  4B21 A;  4UNF A;  2I5W A;  3CWA A;  4B23 A;  1KYF A;  3H1Z A;  3N5N X;  1YQR A;  1WEF A;  1QNB A;  2HZM A;  1XG7 A;  3I0X A;  1AIS A;  2YG9 A;  2NOI A;  1PCZ A;  2YG8 A;  1NGN A;  2H56 A;  1ORP A;  4OFH A;  2O3O A;  4E9E A;  1ORN A;  3F0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...