4EJZA

Structure of mbogg1 in complex with low affinity dna ligand
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
289
Chain Sequence
MKYNVEEKGTKVIVRGIADFNLKETFESGQCFRWNEEEDGSYTGVAYDRVVNVKLEGDTLIIDNTNLTDFYDIWFDYFDLGRDYGQIKESLSKDPVLKEAIKFGQGIRILRQDTWETLVSFIVSQNNRIPQIKKVIENLATSFGNPIEYKGKIYYTFPKPEELVMYDVETIAKTRCGFRAKYIFDAASKVFSGEINLLKLHEYSTSEIRDILMTINGVGPKVADCVILYSIGRYDTFPTDVWIKRIVEHLYLKREGTPVEIQLFAIDKFGDLSGFAQQYLFYYGREMGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of MBOgg1 in complex with two abasic DNA ligands
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Hydrolase/dna
molecule keywords 3-Methyladenine DNA glycosylase
total genus 96
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4ejzA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4ejzA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4ejzA01
1ORPA 3CW7A 3N5NX 1LMZA 4B21A 1YQRA 4YOQA 1M3HA 1KG3A 3D4VA 3CWTA 4AIAA 1KG5A 2NOEA 1MUYA 1DIZA 1N3CA 1RRSA 3IH7A 3F10A 4UNFA 3KTUA 3CWSA 2NOBA 4AI5A 1P7MA 3I0WA 2YG8A 4UOBA 3OGDA 1HU0A 3CVTA 5AN4A 4OFAA 1MPGA 2NOHA 4B23A 5CHZA 2JG6A 1ORNA 2JHJA 3CWUA 1KO9A 2H56A 1YQLA 4EJZA 1XQPA 1WEFA 4EA4A 3I0XA 3CWAA 1RRQA 3S6IA 1VRLA 1KQJA 1KG4A 1PU8A 2JHNA 1NKUA 3CVSA 4OFEA 4YPHA 5KN9A 3FHGA 2ABKA 5KN8A 1PVSA 1M3QA 1EBMA 1PU7A 3F0ZA 3KNTA 1LWYA 1KG6A 1P59A 1WEGA 1KEAA 2OFKA 4PIIA 3FSPA 1N3AA 2NOLA 1XG7A 2OFIA 4EA5A 1MUNA 3G0QA 4B24A 1KG7A 5DPKA 1LWWA 1MUDA 4EW0A 4EJYA 4B22A 4E9FA 1FN7A 4OFHA 3OH9A 3IHOA 4YPRA 3FHFA 1N39A 2YG9A 2XHIA 1YQKA 1NGNA 4DK9A 1KG2A 4HSBA 2NOZA 1XQOA 4EVVA 1YQMA 2I5WA 1LWVA 1PU6A 2NOFA 4AI4A 4E9EA 2NOIA 3N0UA 4EW4A 4E9GA 3OH6A 1WEIA 4E9HA
chains in the Genus database with same CATH superfamily
3D7QA 3CW7A 2JOIA 2MJ7A 4B21A 1KG3A 2Z8UA 3CWTA 3HS8A 1QTSA 3RSMA 1W80A 1DIZA 1C4GA 1N3CA 1QNCA 1VKLA 1TUOA 4UNFA 3KTUA 3OC3C 1UT4A 2NOBA 3I3WA 1P7MA 1XSZA 2YG8A 3L2WA 5JMVD 3ASMA 2QREA 3VN5A 1TBAB 3R2XC 2NOHA 3PMGA 2OOYA 3CWUA 1KO9A 3UW2A 2OOXA 1P5GX 1XQPA 3S3NA 1RRQA 1KQJA 2JHNA 1QN5A 5FROA 3CVSA 1B9KA 5KN9A 4PY5A 3KRMA 4B0AA 1KEAA 2OFKA 1QN3A 4BE2A 2FGTA 1XG7A 2FKFA 4HJHA 1MUNA 1KG7A 1Q9UA 2QRCA 2Y8LA 2V92A 1MUDA 3OH9A 3FHFA 4D7RA 5BMPA 1YQKA 4DK9A 2NOZA 1PCJX 1VOLB 3OLPA 1PU6A 2NOFA 3OYFA 4AI4A 4CFFA 4E9HA 1CDWA 3N5NX 3DPTA 3VW4A 1PZDA 4YOQA 3ENCA 2LAEA 4E7HA 2H4LX 2HL9A 4QG5A 2HKPA 1KFQA 3OYEA 1R4XA 3IH7A 3F10A 5IYCP 3OYNA 3OYCA 1HU0A 4BJUA 3S3MA 5CHZA 2JG6A 2H56A 4EJZA 1PCMX 2QLVA 1M5Q1 4TPSA 3CWAA 4WZSD 3OYGA 2V8QA 3L2VA 5FRNA 1KYFA 4YPHA 1J3MA 1C9BB 1EBMA 3F0ZA 3KNTA 1KG6A 3TDHA 3OS2A 1P59A 2O3OA 3FSPA 1N3AA 2MZ8A 3ENOC 4BDZA 4EA5A 2D0CA 1JFIC 1QNBA 1NGMA 2H5AX 2NWVA 1QTPA 4EAJA 4EJYA 2DKAA 3T4NA 1VTLE 1FN7A 4OFHA 1QN4A 4BDYA 4YPRA 4Q11A 1UL7A 1YTFA 3OSTA 1NGNA 4WX8A 3S3OA 4EVVA 4BE1A 1WJWA 3ULXA 4E7LA 1UT7A 3HS9A 3N0UA 3OYAA 1K2YX 2DKCA 1LMZA 4E7IA 3OSMA 1YQRA 4IKFA 3N89A 3D4VA 4AIAA 4D7QA 4BACA 1RRSA 4EAKA 2V75A 3L2QA 4MRQA 3CWSA 4NZGA 3NA5A 4UOBA 3OGDA 1E42A 1VTOA 4OFAA 3BKQX 2QR1A 3OYBA 2Z0FA 2JHJA 1YQLA 4E7JA 1WEFA 3DPUA 4EA4A 3C04A 2Y8QA 1EUVA 3OY9A 1KYUA 1V5SA 1NKUA 4OFEA 1PVSA 1LWYA 1LXTA 1TGHA 4IL8A 2EHBD 4WXAA 1U84A 4PIIA 2NOLA 1KY7A 2HL8A 3EAYA 3G0QA 2QRDA 1LWWA 1K35A 1QN9A 5IYDP 3OS1A 1QNEA 4EW0A 1KFIA 4B22A 2V9JA 2IV8A 1QN6A 1D3UA 3OYKA 1T6AA 4HSBA 4ROCB 5F9CA 3NNQA 1JDYA 1YQMA 2I5WA 3EIKA 1RM1A 2HZSA 2YA3A 2NOIA 3L2UA 2F7LA 4E9GA 1ORPA 3SNSA 2FUVA 3L2RA 1M3HA 4C7PA 2G30A 1P5DX 4RODB 1KYDA 1KG5A 2NOEA 1MUYA 5HSHA 3OYDA 2D0BA 5FRMA 3OYIA 1PCZA 4AI5A 3I0WA 2VJ0A 4EALA 3CVTA 5AN4A 3RPJA 5IYBP 1MPGA 4B23A 3OYHA 1ORNA 1WQAA 3OSEA 3OYJA 3OYMA 3OYLA 3I0XA 4EAIA 3S6IA 2DKDA 1VRLA 1KG4A 5JN5A 1PU8A 1NVPA 3FHGA 2ABKA 5KN8A 2JPIA 1M3QA 2NLVA 1PU7A 3TE5A 1QN8A 2PWWA 1WEGA 1MP9A 3OCIA 3OS0A 2FKMX 2OFIA 5KL0A 2W03A 2ZFDB 4BE0A 1AISA 1QNAA 4B24A 5DPKA 4ZTFA 2IV9A 3H1ZA 4EAGA 5BMNA 1VOKA 1NH2A 5EPCA 3LCNA 3IHOA 4ROEB 4ZTJA 1N39A 2YG9A 1KY6A 2XHIA 2YH5A 2NVMA 1KG2A 1TBPA 4DULA 1C47A 2D0AA 1XQOA 2JPSA 2W04A 4I8OA 1QN7A 1LWVA 2HZMA 2R5XA 4E9EA 3PDKA 4E7KA 1YTBA 4EW4A 3OH6A 1WEIA 4E9FA
chains in the Genus database with same CATH topology
1ORPA 1CDWA 3CW7A 3N5NX 3SNSA 3DPTA 2JOIA 1LMZA 1PZDA 2MJ7A 4B21A 3OSMA 1YQRA 4YOQA 1M3HA 1KG3A 2G30A 2LAEA 2Z8UA 3D4VA 3N89A 4RODB 3CWTA 4AIAA 1KYDA 1KG5A 3HS8A 1QTSA 2NOEA 1MUYA 1W80A 1DIZA 1N3CA 1R4XA 1RRSA 1QNCA 3IH7A 3F10A 2D0BA 4UNFA 3KTUA 5IYCP 3OC3C 1UT4A 3CWSA 2NOBA 4AI5A 1PCZA 1P7MA 3I0WA 2YG8A 2VJ0A 3ASMA 4UOBA 3OGDA 1E42A 1VTOA 1HU0A 3CVTA 5AN4A 3RPJA 3VN5A 5IYBP 1TBAB 4OFAA 1MPGA 2NOHA 4B23A 5CHZA 2JG6A 1ORNA 2JHJA 3CWUA 1KO9A 2H56A 1YQLA 4EJZA 1XQPA 1WEFA 4TPSA 3DPUA 4EA4A 3I0XA 3CWAA 1RRQA 3S6IA 4WZSD 1VRLA 1KQJA 1KG4A 1KYUA 1PU8A 2JHNA 1QN5A 1NKUA 3CVSA 1B9KA 1KYFA 4OFEA 4YPHA 5KN9A 1NVPA 3FHGA 2ABKA 4PY5A 5KN8A 1PVSA 3KRMA 1M3QA 1C9BB 1EBMA 1PU7A 3F0ZA 3KNTA 1LWYA 1QN8A 1TGHA 4B0AA 1KG6A 1P59A 1WEGA 1MP9A 1KEAA 2O3OA 2OFKA 4PIIA 3FSPA 1N3AA 2NOLA 3OCIA 2FGTA 1QN3A 1XG7A 2MZ8A 2OFIA 1KY7A 4EA5A 1MUNA 2D0CA 3G0QA 1AISA 1QNAA 4B24A 1KG7A 5DPKA 1JFIC 1QNBA 1LWWA 1NGMA 2IV9A 1QN9A 3H1ZA 5IYDP 1QTPA 1QNEA 1MUDA 4EW0A 4EJYA 1VOKA 1NH2A 4B22A 2IV8A 1QN6A 4E9FA 1VTLE 1FN7A 4OFHA 3OH9A 1D3UA 1QN4A 3IHOA 4ROEB 4YPRA 3FHFA 4Q11A 1N39A 1YTFA 2YG9A 1KY6A 2XHIA 1YQKA 3OSTA 1NGNA 2YH5A 4DK9A 1KG2A 4HSBA 4ROCB 2NOZA 1TBPA 4DULA 2D0AA 1VOLB 1XQOA 4EVVA 4I8OA 1QN7A 1YQMA 2I5WA 3EIKA 1LWVA 1PU6A 2NOFA 2HZMA 3ULXA 1RM1A 2HZSA 4AI4A 4E9EA 2NOIA 1YTBA 1UT7A 3HS9A 3N0UA 4EW4A 4E9GA 3OH6A 1WEIA 4E9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORP A;  3CW7 A;  3N5N X;  1LMZ A;  4B21 A;  1YQR A;  4YOQ A;  1M3H A;  1KG3 A;  3D4V A;  3CWT A;  4AIA A;  1KG5 A;  2NOE A;  1MUY A;  1DIZ A;  1N3C A;  1RRS A;  3IH7 A;  3F10 A;  4UNF A;  3KTU A;  3CWS A;  2NOB A;  4AI5 A;  1P7M A;  3I0W A;  2YG8 A;  4UOB A;  3OGD A;  1HU0 A;  3CVT A;  5AN4 A;  4OFA A;  1MPG A;  2NOH A;  4B23 A;  5CHZ A;  2JG6 A;  1ORN A;  2JHJ A;  3CWU A;  1KO9 A;  2H56 A;  1YQL A;  4EJZ A;  1XQP A;  1WEF A;  4EA4 A;  3I0X A;  3CWA A;  1RRQ A;  3S6I A;  1VRL A;  1KQJ A;  1KG4 A;  1PU8 A;  2JHN A;  1NKU A;  3CVS A;  4OFE A;  4YPH A;  5KN9 A;  3FHG A;  2ABK A;  5KN8 A;  1PVS A;  1M3Q A;  1EBM A;  1PU7 A;  3F0Z A;  3KNT A;  1LWY A;  1KG6 A;  1P59 A;  1WEG A;  1KEA A;  2OFK A;  4PII A;  3FSP A;  1N3A A;  2NOL A;  1XG7 A;  2OFI A;  4EA5 A;  1MUN A;  3G0Q A;  4B24 A;  1KG7 A;  5DPK A;  1LWW A;  1MUD A;  4EW0 A;  4EJY A;  4B22 A;  4E9F A;  1FN7 A;  4OFH A;  3OH9 A;  3IHO A;  4YPR A;  3FHF A;  1N39 A;  2YG9 A;  2XHI A;  1YQK A;  1NGN A;  4DK9 A;  1KG2 A;  4HSB A;  2NOZ A;  1XQO A;  4EVV A;  1YQM A;  2I5W A;  1LWV A;  1PU6 A;  2NOF A;  4AI4 A;  4E9E A;  2NOI A;  3N0U A;  4EW4 A;  4E9G A;  3OH6 A;  1WEI A;  4E9H A; 
#chains in the Genus database with same CATH topology
 3D7Q A;  3CW7 A;  2JOI A;  2MJ7 A;  4B21 A;  1KG3 A;  2Z8U A;  3CWT A;  3HS8 A;  1QTS A;  3RSM A;  1W80 A;  1DIZ A;  1C4G A;  1N3C A;  1QNC A;  1VKL A;  1TUO A;  4UNF A;  3KTU A;  3OC3 C;  1UT4 A;  2NOB A;  3I3W A;  1P7M A;  1XSZ A;  2YG8 A;  3L2W A;  5JMV D;  3ASM A;  2QRE A;  3VN5 A;  1TBA B;  3R2X C;  2NOH A;  3PMG A;  2OOY A;  3CWU A;  1KO9 A;  3UW2 A;  2OOX A;  1P5G X;  1XQP A;  3S3N A;  1RRQ A;  1KQJ A;  2JHN A;  1QN5 A;  5FRO A;  3CVS A;  1B9K A;  5KN9 A;  4PY5 A;  3KRM A;  4B0A A;  1KEA A;  2OFK A;  1QN3 A;  4BE2 A;  2FGT A;  1XG7 A;  2FKF A;  4HJH A;  1MUN A;  1KG7 A;  1Q9U A;  2QRC A;  2Y8L A;  2V92 A;  1MUD A;  3OH9 A;  3FHF A;  4D7R A;  5BMP A;  1YQK A;  4DK9 A;  2NOZ A;  1PCJ X;  1VOL B;  3OLP A;  1PU6 A;  2NOF A;  3OYF A;  4AI4 A;  4CFF A;  4E9H A;  1CDW A;  3N5N X;  3DPT A;  3VW4 A;  1PZD A;  4YOQ A;  3ENC A;  2LAE A;  4E7H A;  2H4L X;  2HL9 A;  4QG5 A;  2HKP A;  1KFQ A;  3OYE A;  1R4X A;  3IH7 A;  3F10 A;  5IYC P;  3OYN A;  3OYC A;  1HU0 A;  4BJU A;  3S3M A;  5CHZ A;  2JG6 A;  2H56 A;  4EJZ A;  1PCM X;  2QLV A;  1M5Q 1;  4TPS A;  3CWA A;  4WZS D;  3OYG A;  2V8Q A;  3L2V A;  5FRN A;  1KYF A;  4YPH A;  1J3M A;  1C9B B;  1EBM A;  3F0Z A;  3KNT A;  1KG6 A;  3TDH A;  3OS2 A;  1P59 A;  2O3O A;  3FSP A;  1N3A A;  2MZ8 A;  3ENO C;  4BDZ A;  4EA5 A;  2D0C A;  1JFI C;  1QNB A;  1NGM A;  2H5A X;  2NWV A;  1QTP A;  4EAJ A;  4EJY A;  2DKA A;  3T4N A;  1VTL E;  1FN7 A;  4OFH A;  1QN4 A;  4BDY A;  4YPR A;  4Q11 A;  1UL7 A;  1YTF A;  3OST A;  1NGN A;  4WX8 A;  3S3O A;  4EVV A;  4BE1 A;  1WJW A;  3ULX A;  4E7L A;  1UT7 A;  3HS9 A;  3N0U A;  3OYA A;  1K2Y X;  2DKC A;  1LMZ A;  4E7I A;  3OSM A;  1YQR A;  4IKF A;  3N89 A;  3D4V A;  4AIA A;  4D7Q A;  4BAC A;  1RRS A;  4EAK A;  2V75 A;  3L2Q A;  4MRQ A;  3CWS A;  4NZG A;  3NA5 A;  4UOB A;  3OGD A;  1E42 A;  1VTO A;  4OFA A;  3BKQ X;  2QR1 A;  3OYB A;  2Z0F A;  2JHJ A;  1YQL A;  4E7J A;  1WEF A;  3DPU A;  4EA4 A;  3C04 A;  2Y8Q A;  1EUV A;  3OY9 A;  1KYU A;  1V5S A;  1NKU A;  4OFE A;  1PVS A;  1LWY A;  1LXT A;  1TGH A;  4IL8 A;  2EHB D;  4WXA A;  1U84 A;  4PII A;  2NOL A;  1KY7 A;  2HL8 A;  3EAY A;  3G0Q A;  2QRD A;  1LWW A;  1K35 A;  1QN9 A;  5IYD P;  3OS1 A;  1QNE A;  4EW0 A;  1KFI A;  4B22 A;  2V9J A;  2IV8 A;  1QN6 A;  1D3U A;  3OYK A;  1T6A A;  4HSB A;  4ROC B;  5F9C A;  3NNQ A;  1JDY A;  1YQM A;  2I5W A;  3EIK A;  1RM1 A;  2HZS A;  2YA3 A;  2NOI A;  3L2U A;  2F7L A;  4E9G A;  1ORP A;  3SNS A;  2FUV A;  3L2R A;  1M3H A;  4C7P A;  2G30 A;  1P5D X;  4ROD B;  1KYD A;  1KG5 A;  2NOE A;  1MUY A;  5HSH A;  3OYD A;  2D0B A;  5FRM A;  3OYI A;  1PCZ A;  4AI5 A;  3I0W A;  2VJ0 A;  4EAL A;  3CVT A;  5AN4 A;  3RPJ A;  5IYB P;  1MPG A;  4B23 A;  3OYH A;  1ORN A;  1WQA A;  3OSE A;  3OYJ A;  3OYM A;  3OYL A;  3I0X A;  4EAI A;  3S6I A;  2DKD A;  1VRL A;  1KG4 A;  5JN5 A;  1PU8 A;  1NVP A;  3FHG A;  2ABK A;  5KN8 A;  2JPI A;  1M3Q A;  2NLV A;  1PU7 A;  3TE5 A;  1QN8 A;  2PWW A;  1WEG A;  1MP9 A;  3OCI A;  3OS0 A;  2FKM X;  2OFI A;  5KL0 A;  2W03 A;  2ZFD B;  4BE0 A;  1AIS A;  1QNA A;  4B24 A;  5DPK A;  4ZTF A;  2IV9 A;  3H1Z A;  4EAG A;  5BMN A;  1VOK A;  1NH2 A;  5EPC A;  3LCN A;  3IHO A;  4ROE B;  4ZTJ A;  1N39 A;  2YG9 A;  1KY6 A;  2XHI A;  2YH5 A;  2NVM A;  1KG2 A;  1TBP A;  4DUL A;  1C47 A;  2D0A A;  1XQO A;  2JPS A;  2W04 A;  4I8O A;  1QN7 A;  1LWV A;  2HZM A;  2R5X A;  4E9E A;  3PDK A;  4E7K A;  1YTB A;  4EW4 A;  3OH6 A;  1WEI A;  4E9F A; 
#chains in the Genus database with same CATH homology
 1ORP A;  1CDW A;  3CW7 A;  3N5N X;  3SNS A;  3DPT A;  2JOI A;  1LMZ A;  1PZD A;  2MJ7 A;  4B21 A;  3OSM A;  1YQR A;  4YOQ A;  1M3H A;  1KG3 A;  2G30 A;  2LAE A;  2Z8U A;  3D4V A;  3N89 A;  4ROD B;  3CWT A;  4AIA A;  1KYD A;  1KG5 A;  3HS8 A;  1QTS A;  2NOE A;  1MUY A;  1W80 A;  1DIZ A;  1N3C A;  1R4X A;  1RRS A;  1QNC A;  3IH7 A;  3F10 A;  2D0B A;  4UNF A;  3KTU A;  5IYC P;  3OC3 C;  1UT4 A;  3CWS A;  2NOB A;  4AI5 A;  1PCZ A;  1P7M A;  3I0W A;  2YG8 A;  2VJ0 A;  3ASM A;  4UOB A;  3OGD A;  1E42 A;  1VTO A;  1HU0 A;  3CVT A;  5AN4 A;  3RPJ A;  3VN5 A;  5IYB P;  1TBA B;  4OFA A;  1MPG A;  2NOH A;  4B23 A;  5CHZ A;  2JG6 A;  1ORN A;  2JHJ A;  3CWU A;  1KO9 A;  2H56 A;  1YQL A;  4EJZ A;  1XQP A;  1WEF A;  4TPS A;  3DPU A;  4EA4 A;  3I0X A;  3CWA A;  1RRQ A;  3S6I A;  4WZS D;  1VRL A;  1KQJ A;  1KG4 A;  1KYU A;  1PU8 A;  2JHN A;  1QN5 A;  1NKU A;  3CVS A;  1B9K A;  1KYF A;  4OFE A;  4YPH A;  5KN9 A;  1NVP A;  3FHG A;  2ABK A;  4PY5 A;  5KN8 A;  1PVS A;  3KRM A;  1M3Q A;  1C9B B;  1EBM A;  1PU7 A;  3F0Z A;  3KNT A;  1LWY A;  1QN8 A;  1TGH A;  4B0A A;  1KG6 A;  1P59 A;  1WEG A;  1MP9 A;  1KEA A;  2O3O A;  2OFK A;  4PII A;  3FSP A;  1N3A A;  2NOL A;  3OCI A;  2FGT A;  1QN3 A;  1XG7 A;  2MZ8 A;  2OFI A;  1KY7 A;  4EA5 A;  1MUN A;  2D0C A;  3G0Q A;  1AIS A;  1QNA A;  4B24 A;  1KG7 A;  5DPK A;  1JFI C;  1QNB A;  1LWW A;  1NGM A;  2IV9 A;  1QN9 A;  3H1Z A;  5IYD P;  1QTP A;  1QNE A;  1MUD A;  4EW0 A;  4EJY A;  1VOK A;  1NH2 A;  4B22 A;  2IV8 A;  1QN6 A;  4E9F A;  1VTL E;  1FN7 A;  4OFH A;  3OH9 A;  1D3U A;  1QN4 A;  3IHO A;  4ROE B;  4YPR A;  3FHF A;  4Q11 A;  1N39 A;  1YTF A;  2YG9 A;  1KY6 A;  2XHI A;  1YQK A;  3OST A;  1NGN A;  2YH5 A;  4DK9 A;  1KG2 A;  4HSB A;  4ROC B;  2NOZ A;  1TBP A;  4DUL A;  2D0A A;  1VOL B;  1XQO A;  4EVV A;  4I8O A;  1QN7 A;  1YQM A;  2I5W A;  3EIK A;  1LWV A;  1PU6 A;  2NOF A;  2HZM A;  3ULX A;  1RM1 A;  2HZS A;  4AI4 A;  4E9E A;  2NOI A;  1YTB A;  1UT7 A;  3HS9 A;  3N0U A;  4EW4 A;  4E9G A;  3OH6 A;  1WEI A;  4E9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...