4EJZA

Structure of mbogg1 in complex with low affinity dna ligand
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
289
Chain Sequence
b'MKYNVEEKGTKVIVRGIADFNLKETFESGQCFRWNEEEDGSYTGVAYDRVVNVKLEGDTLIIDNTNLTDFYDIWFDYFDLGRDYGQIKESLSKDPVLKEAIKFGQGIRILRQDTWETLVSFIVSQNNRIPQIKKVIENLATSFGNPIEYKGKIYYTFPKPEELVMYDVETIAKTRCGFRAKYIFDAASKVFSGEINLLKLHEYSTSEIRDILMTINGVGPKVADCVILYSIGRYDTFPTDVWIKRIVEHLYLKREGTPVEIQLFAIDKFGDLSGFAQQYLFYYGREMGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-Methyladenine DNA glycosylase
publication title Crystal structures of MBOgg1 in complex with two abasic DNA ligands
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Hydrolase/dna
total genus 96
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4ejzA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4ejzA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4ejzA01
3OH6A 4OFAA 3CWTA 3IHOA 1P59A 3CWAA 4OFHA 3OGDA 4E9GA 1M3QA 1PU7A 2JHNA 3N0UA 4EW0A 1KG6A 2H56A 4HSBA 4EVVA 1ORNA 4EA4A 4YPHA 2NOHA 1YQRA 2YG8A 1N39A 1KG4A 1KG3A 1PVSA 2JHJA 5DPKA 3F10A 5KN9A 3FHGA 2OFKA 2JG6A 1MUDA 1LMZA 4AIAA 1ORPA 4AI5A 3G0QA 2NOBA 1WEIA 1MUNA 1WEFA 4OFEA 3CVTA 2OFIA 4AI4A 1KEAA 4B21A 1HU0A 1NKUA 4E9EA 3KNTA 1KG5A 1XQPA 4E9HA 3FSPA 5KN8A 1XG7A 4EW4A 2NOFA 1YQKA 1VRLA 1DIZA 1LWVA 2YG9A 1KG2A 3KTUA 3F0ZA 2NOIA 1WEGA 4UOBA 1N3CA 1MUYA 1EBMA 3N5NX 1XQOA 3CWUA 1PU6A 1M3HA 3S6IA 5CHZA 4DK9A 3D4VA 1MPGA 4YPRA 3FHFA 3CW7A 1P7MA 1LWYA 2NOLA 5AN4A 4E9FA 1RRSA 1FN7A 2NOEA 1LWWA 2I5WA 3CWSA 1KG7A 3OH9A 4EJZA 1KQJA 4YOQA 2NOZA 3I0XA 1NGNA 1KO9A 3CVSA 2XHIA 1RRQA 4EA5A 4PIIA 1YQMA 4B24A 3IH7A 4EJYA 1N3AA 2ABKA 4B23A 1YQLA 4UNFA 4B22A 1PU8A 3I0WA
chains in the Genus database with same CATH superfamily
3I3WA 4E9GA 3OC3C 3OLPA 1PCZA 4BE0A 4EW0A 2HZMA 4HJHA 4I8OA 3RPJA 2H56A 3OYFA 3HS9A 1QNBA 1NVPA 4EAKA 1PVSA 4RODB 2JHJA 2H5AX 2DKCA 4WXAA 3T4NA 3N89A 1MUDA 4AIAA 4AI5A 3G0QA 3OCIA 1MUNA 1WEFA 2OOXA 3CVTA 3DPUA 1QTSA 1WJWA 3L2WA 2IV8A 2FKMX 4E9EA 1KG5A 2ZFDB 2MZ8A 1YQKA 2MJ7A 1AISA 5EPCA 1VOKA 2V92A 1MUYA 2FGTA 3OYAA 4ZTFA 5BMNA 5KL0A 2OOYA 3ENCA 1E42A 1P5DX 4B0AA 5CHZA 3OY9A 4DK9A 1C9BB 2HZSA 1V5SA 1LWYA 1YTBA 1FN7A 1XSZA 3EAYA 2I5WA 1KYDA 1KYFA 3OH9A 4EJZA 5FRNA 3I0XA 2XHIA 4PIIA 1YQMA 4B24A 2NLVA 1N3AA 1PU8A 3VW4A 1U84A 1UL7A 2IV9A 1P59A 2QLVA 3CWAA 2JHNA 3R2XC 1PCJX 4BJUA 1VTOA 1KG6A 1D3UA 1QN9A 2G30A 2PWWA 3UW2A 4HSBA 1ORNA 1K35A 3H1ZA 3BKQX 5JN5A 3OSTA 4EAIA 1NH2A 4YPHA 2QR1A 2YA3A 4E7KA 2YG8A 4Q11A 3KRMA 1KG4A 3OYDA 4IKFA 3F10A 3FHGA 1JFIC 2JG6A 4WZSD 1PZDA 3NA5A 3NNQA 2FUVA 1QN8A 1WEIA 3LCNA 4CFFA 1TBPA 2OFIA 1KEAA 4B21A 2QRCA 1LXTA 1NKUA 2HL8A 3OYMA 5IYCP 3OYKA 1TUOA 1XQPA 3OYLA 2DKDA 1KY7A 4E7JA 2D0BA 1B9KA 4C7PA 3PDKA 1XG7A 3OYGA 1M5Q1 4BDYA 3SNSA 1Q9UA 1QNEA 2YG9A 2HKPA 3KTUA 1J3MA 1N3CA 5BMPA 1EBMA 2W03A 1MPGA 4YPRA 3OS1A 3FHFA 4PY5A 2LAEA 3CW7A 4TPSA 2NOLA 4BDZA 1WQAA 5AN4A 3OYJA 1RRSA 1MP9A 1NGMA 1KG7A 1KQJA 4ROEB 1UT4A 1KFQA 3L2VA 1KO9A 1RRQA 2QREA 2VJ0A 3I0WA 1CDWA 1JDYA 3D7QA 4OFHA 4EALA 2V9JA 2NWVA 5FRMA 2W04A 4EVVA 5IYDP 2NOHA 5DPKA 5FROA 3S3MA 5KN9A 3HS8A 2OFKA 4IL8A 3TE5A 4ROCB 3TDHA 4E7LA 1ORPA 4BE1A 2NOBA 1QN5A 1P5GX 1VTLE 1KFIA 3RSMA 1PCMX 1HU0A 3OYBA 2FKFA 1K2YX 4ZTJA 4E9HA 3FSPA 5KN8A 5HSHA 3L2UA 4EW4A 1QN7A 1KY6A 2EHBD 1KYUA 1RM1A 5IYBP 1KG2A 3L2RA 3OSMA 2V8QA 5F9CA 3DPTA 2NVMA 2JPIA 3ULXA 3CWUA 1TGHA 2D0CA 3S6IA 4EAGA 4D7RA 3VN5A 3PMGA 4YOQA 4E7HA 3CVSA 1C4GA 2F7LA 3IH7A 3S3OA 1YTFA 4B23A 4MRQA 1C47A 1QNAA 3OYEA 3OH6A 4OFAA 3CWTA 3IHOA 4D7QA 3OGDA 1M3QA 3OS2A 4EAJA 1PU7A 1T6AA 3N0UA 1QTPA 2O3OA 2R5XA 1W80A 3ENOC 4EA4A 1YQRA 1N39A 1KG3A 2D0AA 3ASMA 4DULA 1LMZA 4WX8A 3OSEA 1VOLB 4OFEA 4NZGA 3OYHA 2Y8LA 4AI4A 3OYIA 2JOIA 2Y8QA 3KNTA 1QNCA 3S3NA 2H4LX 3OYCA 2NOFA 3C04A 1VRLA 1DIZA 2DKAA 1LWVA 1VKLA 3OS0A 3F0ZA 2NOIA 1WEGA 4UOBA 5JMVD 3N5NX 1XQOA 4E7IA 1PU6A 1M3HA 2YH5A 2HL9A 1UT7A 3D4VA 4BE2A 3L2QA 1P7MA 2Z8UA 4E9FA 2Z0FA 4BACA 2NOEA 1EUVA 2QRDA 1LWWA 3CWSA 1QN4A 2V75A 3OYNA 3EIKA 1QN6A 2NOZA 2JPSA 1NGNA 4EA5A 1TBAB 4QG5A 4EJYA 2ABKA 1QN3A 1YQLA 4UNFA 4B22A 1R4XA
chains in the Genus database with same CATH topology
1CDWA 3OH6A 4OFAA 3CWTA 3IHOA 2IV9A 1P59A 3CWAA 4OFHA 3OGDA 4E9GA 1M3QA 3OC3C 1PCZA 1PU7A 2JHNA 3N0UA 1QTPA 1VTOA 4EW0A 2HZMA 1KG6A 2O3OA 1D3UA 4I8OA 1QN9A 2G30A 3RPJA 2H56A 4HSBA 4EVVA 1ORNA 1W80A 3HS9A 3H1ZA 5IYDP 1QNBA 3OSTA 1NH2A 4EA4A 4YPHA 2NOHA 1NVPA 1YQRA 2YG8A 4Q11A 1N39A 3KRMA 1KG4A 1KG3A 1PVSA 4RODB 2JHJA 5DPKA 3F10A 2D0AA 3HS8A 5KN9A 3FHGA 2OFKA 2JG6A 3N89A 4ROCB 4WZSD 3ASMA 1PZDA 1JFIC 4DULA 1MUDA 1LMZA 4AIAA 1ORPA 4AI5A 3G0QA 1QN8A 3OCIA 2NOBA 1WEIA 1QN5A 1MUNA 1WEFA 1VOLB 1TBPA 4OFEA 3CVTA 2OFIA 1VTLE 4AI4A 1KEAA 4B21A 1HU0A 1NKUA 3DPUA 1QTSA 5IYCP 2JOIA 2IV8A 4E9EA 3KNTA 1KG5A 1QNCA 1XQPA 4E9HA 2MZ8A 1KY7A 3FSPA 5KN8A 1B9KA 2D0BA 1XG7A 4EW4A 1QN7A 2NOFA 1YQKA 1KY6A 1KYUA 2MJ7A 1RM1A 1AISA 1VRLA 1DIZA 3SNSA 1LWVA 1QNEA 5IYBP 2YG9A 1R4XA 1KG2A 3KTUA 1VOKA 2VJ0A 3F0ZA 2NOIA 3OSMA 1WEGA 4UOBA 3DPTA 1N3CA 1MUYA 2FGTA 1EBMA 3ULXA 3N5NX 1XQOA 3CWUA 1TGHA 1PU6A 1M3HA 1E42A 2D0CA 3S6IA 2YH5A 4B0AA 1UT7A 5CHZA 4DK9A 3D4VA 1C9BB 1MPGA 4YPRA 2HZSA 3FHFA 4PY5A 2LAEA 3CW7A 1P7MA 1LWYA 2NOLA 2Z8UA 4TPSA 3VN5A 5AN4A 4E9FA 1RRSA 1FN7A 1YTBA 2NOEA 1MP9A 1LWWA 1NGMA 2I5WA 1KYDA 3CWSA 1KYFA 1KG7A 3OH9A 1QN4A 4EJZA 1KQJA 3EIKA 4ROEB 4YOQA 1UT4A 1QN6A 2NOZA 3I0XA 1NGNA 1KO9A 3CVSA 2XHIA 1RRQA 4EA5A 4PIIA 1TBAB 1YQMA 4B24A 3IH7A 1YTFA 4EJYA 1N3AA 2ABKA 4B23A 1YQLA 1QN3A 4UNFA 4B22A 1PU8A 1QNAA 3I0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OH6 A;  4OFA A;  3CWT A;  3IHO A;  1P59 A;  3CWA A;  4OFH A;  3OGD A;  4E9G A;  1M3Q A;  1PU7 A;  2JHN A;  3N0U A;  4EW0 A;  1KG6 A;  2H56 A;  4HSB A;  4EVV A;  1ORN A;  4EA4 A;  4YPH A;  2NOH A;  1YQR A;  2YG8 A;  1N39 A;  1KG4 A;  1KG3 A;  1PVS A;  2JHJ A;  5DPK A;  3F10 A;  5KN9 A;  3FHG A;  2OFK A;  2JG6 A;  1MUD A;  1LMZ A;  4AIA A;  1ORP A;  4AI5 A;  3G0Q A;  2NOB A;  1WEI A;  1MUN A;  1WEF A;  4OFE A;  3CVT A;  2OFI A;  4AI4 A;  1KEA A;  4B21 A;  1HU0 A;  1NKU A;  4E9E A;  3KNT A;  1KG5 A;  1XQP A;  4E9H A;  3FSP A;  5KN8 A;  1XG7 A;  4EW4 A;  2NOF A;  1YQK A;  1VRL A;  1DIZ A;  1LWV A;  2YG9 A;  1KG2 A;  3KTU A;  3F0Z A;  2NOI A;  1WEG A;  4UOB A;  1N3C A;  1MUY A;  1EBM A;  3N5N X;  1XQO A;  3CWU A;  1PU6 A;  1M3H A;  3S6I A;  5CHZ A;  4DK9 A;  3D4V A;  1MPG A;  4YPR A;  3FHF A;  3CW7 A;  1P7M A;  1LWY A;  2NOL A;  5AN4 A;  4E9F A;  1RRS A;  1FN7 A;  2NOE A;  1LWW A;  2I5W A;  3CWS A;  1KG7 A;  3OH9 A;  4EJZ A;  1KQJ A;  4YOQ A;  2NOZ A;  3I0X A;  1NGN A;  1KO9 A;  3CVS A;  2XHI A;  1RRQ A;  4EA5 A;  4PII A;  1YQM A;  4B24 A;  3IH7 A;  4EJY A;  1N3A A;  2ABK A;  4B23 A;  1YQL A;  4UNF A;  4B22 A;  1PU8 A;  3I0W A; 
#chains in the Genus database with same CATH topology
 3I3W A;  4E9G A;  3OC3 C;  3OLP A;  1PCZ A;  4BE0 A;  4EW0 A;  2HZM A;  4HJH A;  4I8O A;  3RPJ A;  2H56 A;  3OYF A;  3HS9 A;  1QNB A;  1NVP A;  4EAK A;  1PVS A;  4ROD B;  2JHJ A;  2H5A X;  2DKC A;  4WXA A;  3T4N A;  3N89 A;  1MUD A;  4AIA A;  4AI5 A;  3G0Q A;  3OCI A;  1MUN A;  1WEF A;  2OOX A;  3CVT A;  3DPU A;  1QTS A;  1WJW A;  3L2W A;  2IV8 A;  2FKM X;  4E9E A;  1KG5 A;  2ZFD B;  2MZ8 A;  1YQK A;  2MJ7 A;  1AIS A;  5EPC A;  1VOK A;  2V92 A;  1MUY A;  2FGT A;  3OYA A;  4ZTF A;  5BMN A;  5KL0 A;  2OOY A;  3ENC A;  1E42 A;  1P5D X;  4B0A A;  5CHZ A;  3OY9 A;  4DK9 A;  1C9B B;  2HZS A;  1V5S A;  1LWY A;  1YTB A;  1FN7 A;  1XSZ A;  3EAY A;  2I5W A;  1KYD A;  1KYF A;  3OH9 A;  4EJZ A;  5FRN A;  3I0X A;  2XHI A;  4PII A;  1YQM A;  4B24 A;  2NLV A;  1N3A A;  1PU8 A;  3VW4 A;  1U84 A;  1UL7 A;  2IV9 A;  1P59 A;  2QLV A;  3CWA A;  2JHN A;  3R2X C;  1PCJ X;  4BJU A;  1VTO A;  1KG6 A;  1D3U A;  1QN9 A;  2G30 A;  2PWW A;  3UW2 A;  4HSB A;  1ORN A;  1K35 A;  3H1Z A;  3BKQ X;  5JN5 A;  3OST A;  4EAI A;  1NH2 A;  4YPH A;  2QR1 A;  2YA3 A;  4E7K A;  2YG8 A;  4Q11 A;  3KRM A;  1KG4 A;  3OYD A;  4IKF A;  3F10 A;  3FHG A;  1JFI C;  2JG6 A;  4WZS D;  1PZD A;  3NA5 A;  3NNQ A;  2FUV A;  1QN8 A;  1WEI A;  3LCN A;  4CFF A;  1TBP A;  2OFI A;  1KEA A;  4B21 A;  2QRC A;  1LXT A;  1NKU A;  2HL8 A;  3OYM A;  5IYC P;  3OYK A;  1TUO A;  1XQP A;  3OYL A;  2DKD A;  1KY7 A;  4E7J A;  2D0B A;  1B9K A;  4C7P A;  3PDK A;  1XG7 A;  3OYG A;  1M5Q 1;  4BDY A;  3SNS A;  1Q9U A;  1QNE A;  2YG9 A;  2HKP A;  3KTU A;  1J3M A;  1N3C A;  5BMP A;  1EBM A;  2W03 A;  1MPG A;  4YPR A;  3OS1 A;  3FHF A;  4PY5 A;  2LAE A;  3CW7 A;  4TPS A;  2NOL A;  4BDZ A;  1WQA A;  5AN4 A;  3OYJ A;  1RRS A;  1MP9 A;  1NGM A;  1KG7 A;  1KQJ A;  4ROE B;  1UT4 A;  1KFQ A;  3L2V A;  1KO9 A;  1RRQ A;  2QRE A;  2VJ0 A;  3I0W A;  1CDW A;  1JDY A;  3D7Q A;  4OFH A;  4EAL A;  2V9J A;  2NWV A;  5FRM A;  2W04 A;  4EVV A;  5IYD P;  2NOH A;  5DPK A;  5FRO A;  3S3M A;  5KN9 A;  3HS8 A;  2OFK A;  4IL8 A;  3TE5 A;  4ROC B;  3TDH A;  4E7L A;  1ORP A;  4BE1 A;  2NOB A;  1QN5 A;  1P5G X;  1VTL E;  1KFI A;  3RSM A;  1PCM X;  1HU0 A;  3OYB A;  2FKF A;  1K2Y X;  4ZTJ A;  4E9H A;  3FSP A;  5KN8 A;  5HSH A;  3L2U A;  4EW4 A;  1QN7 A;  1KY6 A;  2EHB D;  1KYU A;  1RM1 A;  5IYB P;  1KG2 A;  3L2R A;  3OSM A;  2V8Q A;  5F9C A;  3DPT A;  2NVM A;  2JPI A;  3ULX A;  3CWU A;  1TGH A;  2D0C A;  3S6I A;  4EAG A;  4D7R A;  3VN5 A;  3PMG A;  4YOQ A;  4E7H A;  3CVS A;  1C4G A;  2F7L A;  3IH7 A;  3S3O A;  1YTF A;  4B23 A;  4MRQ A;  1C47 A;  1QNA A;  3OYE A;  3OH6 A;  4OFA A;  3CWT A;  3IHO A;  4D7Q A;  3OGD A;  1M3Q A;  3OS2 A;  4EAJ A;  1PU7 A;  1T6A A;  3N0U A;  1QTP A;  2O3O A;  2R5X A;  1W80 A;  3ENO C;  4EA4 A;  1YQR A;  1N39 A;  1KG3 A;  2D0A A;  3ASM A;  4DUL A;  1LMZ A;  4WX8 A;  3OSE A;  1VOL B;  4OFE A;  4NZG A;  3OYH A;  2Y8L A;  4AI4 A;  3OYI A;  2JOI A;  2Y8Q A;  3KNT A;  1QNC A;  3S3N A;  2H4L X;  3OYC A;  2NOF A;  3C04 A;  1VRL A;  1DIZ A;  2DKA A;  1LWV A;  1VKL A;  3OS0 A;  3F0Z A;  2NOI A;  1WEG A;  4UOB A;  5JMV D;  3N5N X;  1XQO A;  4E7I A;  1PU6 A;  1M3H A;  2YH5 A;  2HL9 A;  1UT7 A;  3D4V A;  4BE2 A;  3L2Q A;  1P7M A;  2Z8U A;  4E9F A;  2Z0F A;  4BAC A;  2NOE A;  1EUV A;  2QRD A;  1LWW A;  3CWS A;  1QN4 A;  2V75 A;  3OYN A;  3EIK A;  1QN6 A;  2NOZ A;  2JPS A;  1NGN A;  4EA5 A;  1TBA B;  4QG5 A;  4EJY A;  2ABK A;  1QN3 A;  1YQL A;  4UNF A;  4B22 A;  1R4X A; 
#chains in the Genus database with same CATH homology
 1CDW A;  3OH6 A;  4OFA A;  3CWT A;  3IHO A;  2IV9 A;  1P59 A;  3CWA A;  4OFH A;  3OGD A;  4E9G A;  1M3Q A;  3OC3 C;  1PCZ A;  1PU7 A;  2JHN A;  3N0U A;  1QTP A;  1VTO A;  4EW0 A;  2HZM A;  1KG6 A;  2O3O A;  1D3U A;  4I8O A;  1QN9 A;  2G30 A;  3RPJ A;  2H56 A;  4HSB A;  4EVV A;  1ORN A;  1W80 A;  3HS9 A;  3H1Z A;  5IYD P;  1QNB A;  3OST A;  1NH2 A;  4EA4 A;  4YPH A;  2NOH A;  1NVP A;  1YQR A;  2YG8 A;  4Q11 A;  1N39 A;  3KRM A;  1KG4 A;  1KG3 A;  1PVS A;  4ROD B;  2JHJ A;  5DPK A;  3F10 A;  2D0A A;  3HS8 A;  5KN9 A;  3FHG A;  2OFK A;  2JG6 A;  3N89 A;  4ROC B;  4WZS D;  3ASM A;  1PZD A;  1JFI C;  4DUL A;  1MUD A;  1LMZ A;  4AIA A;  1ORP A;  4AI5 A;  3G0Q A;  1QN8 A;  3OCI A;  2NOB A;  1WEI A;  1QN5 A;  1MUN A;  1WEF A;  1VOL B;  1TBP A;  4OFE A;  3CVT A;  2OFI A;  1VTL E;  4AI4 A;  1KEA A;  4B21 A;  1HU0 A;  1NKU A;  3DPU A;  1QTS A;  5IYC P;  2JOI A;  2IV8 A;  4E9E A;  3KNT A;  1KG5 A;  1QNC A;  1XQP A;  4E9H A;  2MZ8 A;  1KY7 A;  3FSP A;  5KN8 A;  1B9K A;  2D0B A;  1XG7 A;  4EW4 A;  1QN7 A;  2NOF A;  1YQK A;  1KY6 A;  1KYU A;  2MJ7 A;  1RM1 A;  1AIS A;  1VRL A;  1DIZ A;  3SNS A;  1LWV A;  1QNE A;  5IYB P;  2YG9 A;  1R4X A;  1KG2 A;  3KTU A;  1VOK A;  2VJ0 A;  3F0Z A;  2NOI A;  3OSM A;  1WEG A;  4UOB A;  3DPT A;  1N3C A;  1MUY A;  2FGT A;  1EBM A;  3ULX A;  3N5N X;  1XQO A;  3CWU A;  1TGH A;  1PU6 A;  1M3H A;  1E42 A;  2D0C A;  3S6I A;  2YH5 A;  4B0A A;  1UT7 A;  5CHZ A;  4DK9 A;  3D4V A;  1C9B B;  1MPG A;  4YPR A;  2HZS A;  3FHF A;  4PY5 A;  2LAE A;  3CW7 A;  1P7M A;  1LWY A;  2NOL A;  2Z8U A;  4TPS A;  3VN5 A;  5AN4 A;  4E9F A;  1RRS A;  1FN7 A;  1YTB A;  2NOE A;  1MP9 A;  1LWW A;  1NGM A;  2I5W A;  1KYD A;  3CWS A;  1KYF A;  1KG7 A;  3OH9 A;  1QN4 A;  4EJZ A;  1KQJ A;  3EIK A;  4ROE B;  4YOQ A;  1UT4 A;  1QN6 A;  2NOZ A;  3I0X A;  1NGN A;  1KO9 A;  3CVS A;  2XHI A;  1RRQ A;  4EA5 A;  4PII A;  1TBA B;  1YQM A;  4B24 A;  3IH7 A;  1YTF A;  4EJY A;  1N3A A;  2ABK A;  4B23 A;  1YQL A;  1QN3 A;  4UNF A;  4B22 A;  1PU8 A;  1QNA A;  3I0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...