4EJZA

Structure of mbogg1 in complex with low affinity dna ligand
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
289
Chain Sequence
b'MKYNVEEKGTKVIVRGIADFNLKETFESGQCFRWNEEEDGSYTGVAYDRVVNVKLEGDTLIIDNTNLTDFYDIWFDYFDLGRDYGQIKESLSKDPVLKEAIKFGQGIRILRQDTWETLVSFIVSQNNRIPQIKKVIENLATSFGNPIEYKGKIYYTFPKPEELVMYDVETIAKTRCGFRAKYIFDAASKVFSGEINLLKLHEYSTSEIRDILMTINGVGPKVADCVILYSIGRYDTFPTDVWIKRIVEHLYLKREGTPVEIQLFAIDKFGDLSGFAQQYLFYYGREMGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-Methyladenine DNA glycosylase
publication title Crystal structures of MBOgg1 in complex with two abasic DNA ligands
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Hydrolase/dna
total genus 96
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4ejzA02
1.10.1670.50 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4ejzA03
3.30.310.260 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4ejzA01
3I0WA 4B24A 1KG7A 3D4VA 1LWVA 2XHIA 2NOFA 3CVTA 4AIAA 1NGNA 1YQRA 1KQJA 1P59A 2OFIA 5AN4A 4OFAA 1WEGA 1MPGA 3F10A 4EJZA 2JHNA 1PVSA 3FHFA 3N5NX 1PU7A 1M3QA 3IH7A 1LMZA 2NOIA 2JHJA 4E9GA 1N3CA 1DIZA 1P7MA 1XQPA 1ORPA 1YQLA 4B23A 4E9HA 1YQMA 4EA4A 1KG4A 2NOBA 4AI5A 3G0QA 3CW7A 1XQOA 4YPHA 1MUDA 1WEFA 1NKUA 5KN9A 1KEAA 1PU6A 2I5WA 4B21A 4AI4A 2YG8A 4UNFA 5DPKA 2OFKA 3CWSA 4EVVA 1MUYA 1LWYA 1MUNA 3CWTA 4YPRA 1KG2A 1FN7A 4UOBA 4EA5A 2NOZA 4PIIA 2ABKA 1N3AA 4EW4A 1KG6A 2NOLA 1M3HA 3FSPA 4E9FA 1N39A 1HU0A 1VRLA 3CWUA 1EBMA 2NOEA 1PU8A 1LWWA 3I0XA 4OFHA 3KNTA 1KG3A 5CHZA 4HSBA 2H56A 1WEIA 4OFEA 4B22A 4EW0A 2JG6A 3OGDA 3IHOA 3CVSA 3F0ZA 4DK9A 3FHGA 3N0UA 2YG9A 4YOQA 1KG5A 1RRSA 1RRQA 3OH9A 3S6IA 3KTUA 4E9EA 5KN8A 1XG7A 1KO9A 3CWAA 3OH6A 1ORNA 4EJYA 2NOHA 1YQKA
chains in the Genus database with same CATH superfamily
1M5Q1 1TGHA 3LCNA 4I8OA 2NOFA 1R4XA 3CVTA 4AIAA 1NGNA 1WQAA 5BMNA 4OFAA 3OYCA 1UT4A 1WEGA 2JHNA 3D7QA 4C7PA 1PVSA 1WJWA 3HS8A 1PU7A 3PMGA 3C04A 4E9GA 2O3OA 4IKFA 4WZSD 2JPIA 2NOBA 2V92A 3OYGA 2HL9A 3G0QA 3CW7A 3PDKA 4EAIA 3L2QA 1NKUA 5KN9A 3L2RA 2I5WA 4B21A 5IYCP 1MUYA 2D0BA 1LWYA 3UW2A 4UOBA 3R2XC 2ABKA 4BDZA 3OYFA 2W04A 1VOLB 1HU0A 1VTOA 1PU8A 3H1ZA 5CHZA 4HSBA 2H56A 3OCIA 3S3OA 1WEIA 2JG6A 3IHOA 1KFQA 1QNAA 3OYJA 4DK9A 3OYAA 3SNSA 4BE0A 1RRSA 4EAJA 3OH9A 3ENOC 1UT7A 1XG7A 2QLVA 3CWAA 3OSTA 4EJYA 3I0WA 1NGMA 3D4VA 1VOKA 3TDHA 2EHBD 2OFIA 1P59A 1KY6A 2QRDA 3ASMA 4CFFA 1QTSA 2HZSA 5F9CA 2Z8UA 1QNCA 4ROEB 3IH7A 2YA3A 1QN6A 2JHJA 2Y8LA 3OYDA 4B23A 1YQMA 4EA4A 1C47A 4AI5A 2DKCA 4ROCB 1QN8A 1XQOA 1T6AA 1MUDA 3L2WA 4QG5A 1KEAA 1PU6A 4BE1A 3TE5A 4AI4A 2OFKA 5JN5A 2JOIA 4BJUA 1W80A 1K2YX 1TBPA 3CWTA 2V9JA 1KG2A 1QN7A 1E42A 2PWWA 3I3WA 4HJHA 1KG6A 1M3HA 3N89A 4EAGA 1VRLA 3CWUA 1LWWA 3KNTA 3OYIA 4D7RA 1KYUA 2DKDA 3NA5A 4OFEA 4EAKA 1JDYA 2QR1A 1QN4A 4B0AA 1TBAB 3F0ZA 1YTFA 3ULXA 3OLPA 1D3UA 1KG5A 1K35A 1RRQA 2VJ0A 4E9EA 1KO9A 4RODB 3OY9A 2YH5A 2FKMX 2ZFDB 4B24A 1UL7A 2Z0FA 1QN9A 2QREA 2XHIA 5FROA 2LAEA 1YQRA 1KQJA 5AN4A 2D0CA 1MPGA 4EJZA 1TUOA 1MP9A 3N5NX 3EIKA 4MRQA 1M3QA 1LMZA 1N3CA 4E7LA 1P5DX 1ORPA 1YQLA 1QNEA 1CDWA 5BMPA 4E7IA 4EALA 1KYFA 1KG4A 3OYKA 2H4LX 3OS2A 3OYMA 1XSZA 3OYEA 2IV8A 3ENCA 3S3NA 1NH2A 3DPUA 2HZMA 4EVVA 3VN5A 5JMVD 1NVPA 4YPRA 3RSMA 1FN7A 4WXAA 1V5SA 4PIIA 1N3AA 2FGTA 4EW4A 1RM1A 3FSPA 2MJ7A 2NOEA 3HS9A 1PCMX 1PZDA 3OS1A 4BE2A 4B22A 1U84A 3OGDA 3CVSA 1QNBA 3DPTA 2G30A 3VW4A 3FHGA 2DKAA 3S3MA 3OYNA 4YOQA 1Q9UA 3KTUA 4Q11A 3T4NA 3OH6A 2OOXA 1ORNA 1LXTA 5FRNA 2MZ8A 1J3MA 2FUVA 1C4GA 1EUVA 2HKPA 1KFIA 1VKLA 4WX8A 1P5GX 3L2VA 1B9KA 1KG7A 1LWVA 5EPCA 2V75A 4PY5A 4E7HA 5HSHA 4E7JA 3F10A 2IV9A 2V8QA 4ZTFA 4D7QA 1KYDA 3FHFA 3L2UA 4ZTJA 4DULA 2NLVA 2NOIA 1DIZA 3OS0A 1P7MA 1XQPA 4E9HA 4IL8A 3OYLA 5FRMA 1QN5A 1QN3A 2H5AX 2FKFA 3BKQX 3OYHA 4YPHA 1WEFA 2OOYA 1C9BB 3NNQA 2R5XA 1VTLE 2YG8A 4UNFA 5DPKA 2D0AA 3OSEA 4BACA 3KRMA 3CWSA 1KY7A 1MUNA 1PCJX 2HL8A 4EA5A 2NOZA 4NZGA 4BDYA 2NOLA 1N39A 4E9FA 1EBMA 3I0XA 1QTPA 4OFHA 2NWVA 5KL0A 3OSMA 1KG3A 3OYBA 3OC3C 2JPSA 4EW0A 2Y8QA 5IYBP 3N0UA 3RPJA 2YG9A 2NVMA 1JFIC 2W03A 1AISA 3S6IA 5KN8A 4TPSA 1YTBA 1PCZA 2F7LA 2QRCA 3EAYA 4E7KA 5IYDP 2NOHA 1YQKA
chains in the Genus database with same CATH topology
3I0WA 1NGMA 4B24A 1TGHA 1QN9A 4I8OA 1B9KA 1KG7A 3D4VA 1LWVA 2XHIA 2NOFA 1R4XA 3CVTA 2LAEA 4AIAA 1NGNA 1YQRA 1VOKA 1KQJA 1P59A 2OFIA 5AN4A 1KY6A 3ASMA 4PY5A 2D0CA 4OFAA 1UT4A 1WEGA 1QTSA 1MPGA 3F10A 4EJZA 2JHNA 2IV9A 2HZSA 2Z8UA 1MP9A 1PVSA 1KYDA 3FHFA 1QNCA 3N5NX 3EIKA 3HS8A 1PU7A 4ROEB 1M3QA 3IH7A 1LMZA 4DULA 2NOIA 1QN6A 2JHJA 4E9GA 2O3OA 1N3CA 1DIZA 1P7MA 1XQPA 1ORPA 1YQLA 1QNEA 4B23A 4E9HA 1YQMA 1CDWA 1KYFA 3OSTA 4WZSD 1QN5A 4EA4A 1KG4A 2NOBA 1QN3A 4AI5A 3G0QA 4ROCB 3CW7A 1QN8A 1XQOA 4YPHA 1MUDA 1WEFA 1NKUA 5KN9A 2IV8A 1C9BB 1KEAA 1PU6A 2I5WA 4B21A 1VTLE 3DPUA 4AI4A 2YG8A 4UNFA 5DPKA 2D0AA 2OFKA 2HZMA 5IYCP 3KRMA 3CWSA 4EVVA 3VN5A 1MUYA 1KY7A 2D0BA 2JOIA 1LWYA 1W80A 1MUNA 1NVPA 1TBPA 3CWTA 4YPRA 1KG2A 1QN7A 1FN7A 4UOBA 4EA5A 2NOZA 1E42A 4PIIA 2ABKA 1N3AA 4EW4A 2FGTA 1KG6A 1RM1A 2NOLA 1M3HA 3N89A 3FSPA 4E9FA 1N39A 1VOLB 2MJ7A 1HU0A 1VRLA 1VTOA 3CWUA 1EBMA 2NOEA 3HS9A 1PU8A 1LWWA 3I0XA 1QTPA 4OFHA 3KNTA 3OSMA 3H1ZA 1KG3A 1NH2A 5CHZA 4HSBA 2H56A 1PZDA 1KYUA 3OCIA 3OC3C 1WEIA 4OFEA 4B22A 4EW0A 2JG6A 1QN4A 3OGDA 3IHOA 4B0AA 3CVSA 3F0ZA 1TBAB 1QNBA 1QNAA 3DPTA 2G30A 1YTFA 3ULXA 4DK9A 3FHGA 5IYBP 3N0UA 3RPJA 3SNSA 2YG9A 1D3UA 1JFIC 4YOQA 1KG5A 1RRSA 1RRQA 1AISA 3OH9A 3S6IA 2VJ0A 3KTUA 4E9EA 5KN8A 1UT7A 1XG7A 1KO9A 4TPSA 4Q11A 1PCZA 4RODB 1YTBA 3CWAA 3OH6A 2YH5A 5IYDP 1ORNA 4EJYA 2NOHA 1YQKA 2MZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0W A;  4B24 A;  1KG7 A;  3D4V A;  1LWV A;  2XHI A;  2NOF A;  3CVT A;  4AIA A;  1NGN A;  1YQR A;  1KQJ A;  1P59 A;  2OFI A;  5AN4 A;  4OFA A;  1WEG A;  1MPG A;  3F10 A;  4EJZ A;  2JHN A;  1PVS A;  3FHF A;  3N5N X;  1PU7 A;  1M3Q A;  3IH7 A;  1LMZ A;  2NOI A;  2JHJ A;  4E9G A;  1N3C A;  1DIZ A;  1P7M A;  1XQP A;  1ORP A;  1YQL A;  4B23 A;  4E9H A;  1YQM A;  4EA4 A;  1KG4 A;  2NOB A;  4AI5 A;  3G0Q A;  3CW7 A;  1XQO A;  4YPH A;  1MUD A;  1WEF A;  1NKU A;  5KN9 A;  1KEA A;  1PU6 A;  2I5W A;  4B21 A;  4AI4 A;  2YG8 A;  4UNF A;  5DPK A;  2OFK A;  3CWS A;  4EVV A;  1MUY A;  1LWY A;  1MUN A;  3CWT A;  4YPR A;  1KG2 A;  1FN7 A;  4UOB A;  4EA5 A;  2NOZ A;  4PII A;  2ABK A;  1N3A A;  4EW4 A;  1KG6 A;  2NOL A;  1M3H A;  3FSP A;  4E9F A;  1N39 A;  1HU0 A;  1VRL A;  3CWU A;  1EBM A;  2NOE A;  1PU8 A;  1LWW A;  3I0X A;  4OFH A;  3KNT A;  1KG3 A;  5CHZ A;  4HSB A;  2H56 A;  1WEI A;  4OFE A;  4B22 A;  4EW0 A;  2JG6 A;  3OGD A;  3IHO A;  3CVS A;  3F0Z A;  4DK9 A;  3FHG A;  3N0U A;  2YG9 A;  4YOQ A;  1KG5 A;  1RRS A;  1RRQ A;  3OH9 A;  3S6I A;  3KTU A;  4E9E A;  5KN8 A;  1XG7 A;  1KO9 A;  3CWA A;  3OH6 A;  1ORN A;  4EJY A;  2NOH A;  1YQK A; 
#chains in the Genus database with same CATH topology
 1M5Q 1;  1TGH A;  3LCN A;  4I8O A;  2NOF A;  1R4X A;  3CVT A;  4AIA A;  1NGN A;  1WQA A;  5BMN A;  4OFA A;  3OYC A;  1UT4 A;  1WEG A;  2JHN A;  3D7Q A;  4C7P A;  1PVS A;  1WJW A;  3HS8 A;  1PU7 A;  3PMG A;  3C04 A;  4E9G A;  2O3O A;  4IKF A;  4WZS D;  2JPI A;  2NOB A;  2V92 A;  3OYG A;  2HL9 A;  3G0Q A;  3CW7 A;  3PDK A;  4EAI A;  3L2Q A;  1NKU A;  5KN9 A;  3L2R A;  2I5W A;  4B21 A;  5IYC P;  1MUY A;  2D0B A;  1LWY A;  3UW2 A;  4UOB A;  3R2X C;  2ABK A;  4BDZ A;  3OYF A;  2W04 A;  1VOL B;  1HU0 A;  1VTO A;  1PU8 A;  3H1Z A;  5CHZ A;  4HSB A;  2H56 A;  3OCI A;  3S3O A;  1WEI A;  2JG6 A;  3IHO A;  1KFQ A;  1QNA A;  3OYJ A;  4DK9 A;  3OYA A;  3SNS A;  4BE0 A;  1RRS A;  4EAJ A;  3OH9 A;  3ENO C;  1UT7 A;  1XG7 A;  2QLV A;  3CWA A;  3OST A;  4EJY A;  3I0W A;  1NGM A;  3D4V A;  1VOK A;  3TDH A;  2EHB D;  2OFI A;  1P59 A;  1KY6 A;  2QRD A;  3ASM A;  4CFF A;  1QTS A;  2HZS A;  5F9C A;  2Z8U A;  1QNC A;  4ROE B;  3IH7 A;  2YA3 A;  1QN6 A;  2JHJ A;  2Y8L A;  3OYD A;  4B23 A;  1YQM A;  4EA4 A;  1C47 A;  4AI5 A;  2DKC A;  4ROC B;  1QN8 A;  1XQO A;  1T6A A;  1MUD A;  3L2W A;  4QG5 A;  1KEA A;  1PU6 A;  4BE1 A;  3TE5 A;  4AI4 A;  2OFK A;  5JN5 A;  2JOI A;  4BJU A;  1W80 A;  1K2Y X;  1TBP A;  3CWT A;  2V9J A;  1KG2 A;  1QN7 A;  1E42 A;  2PWW A;  3I3W A;  4HJH A;  1KG6 A;  1M3H A;  3N89 A;  4EAG A;  1VRL A;  3CWU A;  1LWW A;  3KNT A;  3OYI A;  4D7R A;  1KYU A;  2DKD A;  3NA5 A;  4OFE A;  4EAK A;  1JDY A;  2QR1 A;  1QN4 A;  4B0A A;  1TBA B;  3F0Z A;  1YTF A;  3ULX A;  3OLP A;  1D3U A;  1KG5 A;  1K35 A;  1RRQ A;  2VJ0 A;  4E9E A;  1KO9 A;  4ROD B;  3OY9 A;  2YH5 A;  2FKM X;  2ZFD B;  4B24 A;  1UL7 A;  2Z0F A;  1QN9 A;  2QRE A;  2XHI A;  5FRO A;  2LAE A;  1YQR A;  1KQJ A;  5AN4 A;  2D0C A;  1MPG A;  4EJZ A;  1TUO A;  1MP9 A;  3N5N X;  3EIK A;  4MRQ A;  1M3Q A;  1LMZ A;  1N3C A;  4E7L A;  1P5D X;  1ORP A;  1YQL A;  1QNE A;  1CDW A;  5BMP A;  4E7I A;  4EAL A;  1KYF A;  1KG4 A;  3OYK A;  2H4L X;  3OS2 A;  3OYM A;  1XSZ A;  3OYE A;  2IV8 A;  3ENC A;  3S3N A;  1NH2 A;  3DPU A;  2HZM A;  4EVV A;  3VN5 A;  5JMV D;  1NVP A;  4YPR A;  3RSM A;  1FN7 A;  4WXA A;  1V5S A;  4PII A;  1N3A A;  2FGT A;  4EW4 A;  1RM1 A;  3FSP A;  2MJ7 A;  2NOE A;  3HS9 A;  1PCM X;  1PZD A;  3OS1 A;  4BE2 A;  4B22 A;  1U84 A;  3OGD A;  3CVS A;  1QNB A;  3DPT A;  2G30 A;  3VW4 A;  3FHG A;  2DKA A;  3S3M A;  3OYN A;  4YOQ A;  1Q9U A;  3KTU A;  4Q11 A;  3T4N A;  3OH6 A;  2OOX A;  1ORN A;  1LXT A;  5FRN A;  2MZ8 A;  1J3M A;  2FUV A;  1C4G A;  1EUV A;  2HKP A;  1KFI A;  1VKL A;  4WX8 A;  1P5G X;  3L2V A;  1B9K A;  1KG7 A;  1LWV A;  5EPC A;  2V75 A;  4PY5 A;  4E7H A;  5HSH A;  4E7J A;  3F10 A;  2IV9 A;  2V8Q A;  4ZTF A;  4D7Q A;  1KYD A;  3FHF A;  3L2U A;  4ZTJ A;  4DUL A;  2NLV A;  2NOI A;  1DIZ A;  3OS0 A;  1P7M A;  1XQP A;  4E9H A;  4IL8 A;  3OYL A;  5FRM A;  1QN5 A;  1QN3 A;  2H5A X;  2FKF A;  3BKQ X;  3OYH A;  4YPH A;  1WEF A;  2OOY A;  1C9B B;  3NNQ A;  2R5X A;  1VTL E;  2YG8 A;  4UNF A;  5DPK A;  2D0A A;  3OSE A;  4BAC A;  3KRM A;  3CWS A;  1KY7 A;  1MUN A;  1PCJ X;  2HL8 A;  4EA5 A;  2NOZ A;  4NZG A;  4BDY A;  2NOL A;  1N39 A;  4E9F A;  1EBM A;  3I0X A;  1QTP A;  4OFH A;  2NWV A;  5KL0 A;  3OSM A;  1KG3 A;  3OYB A;  3OC3 C;  2JPS A;  4EW0 A;  2Y8Q A;  5IYB P;  3N0U A;  3RPJ A;  2YG9 A;  2NVM A;  1JFI C;  2W03 A;  1AIS A;  3S6I A;  5KN8 A;  4TPS A;  1YTB A;  1PCZ A;  2F7L A;  2QRC A;  3EAY A;  4E7K A;  5IYD P;  2NOH A;  1YQK A; 
#chains in the Genus database with same CATH homology
 3I0W A;  1NGM A;  4B24 A;  1TGH A;  1QN9 A;  4I8O A;  1B9K A;  1KG7 A;  3D4V A;  1LWV A;  2XHI A;  2NOF A;  1R4X A;  3CVT A;  2LAE A;  4AIA A;  1NGN A;  1YQR A;  1VOK A;  1KQJ A;  1P59 A;  2OFI A;  5AN4 A;  1KY6 A;  3ASM A;  4PY5 A;  2D0C A;  4OFA A;  1UT4 A;  1WEG A;  1QTS A;  1MPG A;  3F10 A;  4EJZ A;  2JHN A;  2IV9 A;  2HZS A;  2Z8U A;  1MP9 A;  1PVS A;  1KYD A;  3FHF A;  1QNC A;  3N5N X;  3EIK A;  3HS8 A;  1PU7 A;  4ROE B;  1M3Q A;  3IH7 A;  1LMZ A;  4DUL A;  2NOI A;  1QN6 A;  2JHJ A;  4E9G A;  2O3O A;  1N3C A;  1DIZ A;  1P7M A;  1XQP A;  1ORP A;  1YQL A;  1QNE A;  4B23 A;  4E9H A;  1YQM A;  1CDW A;  1KYF A;  3OST A;  4WZS D;  1QN5 A;  4EA4 A;  1KG4 A;  2NOB A;  1QN3 A;  4AI5 A;  3G0Q A;  4ROC B;  3CW7 A;  1QN8 A;  1XQO A;  4YPH A;  1MUD A;  1WEF A;  1NKU A;  5KN9 A;  2IV8 A;  1C9B B;  1KEA A;  1PU6 A;  2I5W A;  4B21 A;  1VTL E;  3DPU A;  4AI4 A;  2YG8 A;  4UNF A;  5DPK A;  2D0A A;  2OFK A;  2HZM A;  5IYC P;  3KRM A;  3CWS A;  4EVV A;  3VN5 A;  1MUY A;  1KY7 A;  2D0B A;  2JOI A;  1LWY A;  1W80 A;  1MUN A;  1NVP A;  1TBP A;  3CWT A;  4YPR A;  1KG2 A;  1QN7 A;  1FN7 A;  4UOB A;  4EA5 A;  2NOZ A;  1E42 A;  4PII A;  2ABK A;  1N3A A;  4EW4 A;  2FGT A;  1KG6 A;  1RM1 A;  2NOL A;  1M3H A;  3N89 A;  3FSP A;  4E9F A;  1N39 A;  1VOL B;  2MJ7 A;  1HU0 A;  1VRL A;  1VTO A;  3CWU A;  1EBM A;  2NOE A;  3HS9 A;  1PU8 A;  1LWW A;  3I0X A;  1QTP A;  4OFH A;  3KNT A;  3OSM A;  3H1Z A;  1KG3 A;  1NH2 A;  5CHZ A;  4HSB A;  2H56 A;  1PZD A;  1KYU A;  3OCI A;  3OC3 C;  1WEI A;  4OFE A;  4B22 A;  4EW0 A;  2JG6 A;  1QN4 A;  3OGD A;  3IHO A;  4B0A A;  3CVS A;  3F0Z A;  1TBA B;  1QNB A;  1QNA A;  3DPT A;  2G30 A;  1YTF A;  3ULX A;  4DK9 A;  3FHG A;  5IYB P;  3N0U A;  3RPJ A;  3SNS A;  2YG9 A;  1D3U A;  1JFI C;  4YOQ A;  1KG5 A;  1RRS A;  1RRQ A;  1AIS A;  3OH9 A;  3S6I A;  2VJ0 A;  3KTU A;  4E9E A;  5KN8 A;  1UT7 A;  1XG7 A;  1KO9 A;  4TPS A;  4Q11 A;  1PCZ A;  4ROD B;  1YTB A;  3CWA A;  3OH6 A;  2YH5 A;  5IYD P;  1ORN A;  4EJY A;  2NOH A;  1YQK A;  2MZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...