3OH9A

Alka undamaged dna complex: interrogation of a t:a base pair
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
288
structure length
288
Chain Sequence
MADIGSEFYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDCLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of Escherichia coli AlkA in Complex with Undamaged DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 84
structure length 288
sequence length 288
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2010-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3oh9A02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3oh9A03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3oh9A01
3IH7A 1DIZA 3CWAA 1KG4A 1MUYA 1LMZA 3FHGA 1PU8A 4OFEA 2H56A 2JG6A 2JHNA 4AI5A 3FHFA 2ABKA 1EBMA 4EW4A 5KN9A 1KQJA 1NGNA 1PU7A 4UNFA 4AIAA 3I0XA 2YG9A 3IHOA 4EJYA 3CVTA 2NOHA 1YQKA 3G0QA 3OGDA 3I0WA 1M3HA 4YPRA 3FSPA 4E9GA 3CWUA 4E9EA 1M3QA 1RRQA 1MUNA 1KG2A 1KG5A 1YQRA 3CVSA 4B24A 1HU0A 1LWVA 3N5NX 5KN8A 1XQOA 4E9FA 1WEGA 3OH9A 3KTUA 1XQPA 1FN7A 1PU6A 1P7MA 1WEIA 1NKUA 2JHJA 4EA5A 1KO9A 4HSBA 4B22A 1KG7A 2I5WA 1KEAA 4B21A 4YOQA 3F0ZA 5AN4A 1N39A 4E9HA 4YPHA 4EVVA 2NOBA 2OFIA 1ORNA 2NOFA 5CHZA 3CWSA 1N3CA 4OFAA 4EA4A 1N3AA 4PIIA 1YQLA 2OFKA 1ORPA 3D4VA 3N0UA 1MPGA 4OFHA 1LWYA 2NOZA 1KG3A 1MUDA 2XHIA 1XG7A 1YQMA 3CWTA 4EW0A 4AI4A 5DPKA 3CW7A 1P59A 2NOEA 2YG8A 3OH6A 1KG6A 2NOLA 1WEFA 1RRSA 3S6IA 3F10A 4B23A 2NOIA 4UOBA 1VRLA 4DK9A 4EJZA 1LWWA 3KNTA 1PVSA
chains in the Genus database with same CATH superfamily
3PDKA 3OS2A 3IH7A 5FRMA 1EUVA 3NA5A 1T6AA 1DIZA 1QTSA 4I8OA 1QN3A 3FHGA 4ZTJA 1VTLE 1PCJX 3OLPA 2QLVA 1W80A 2MZ8A 1KYDA 3IHOA 4B0AA 1QNBA 3KRMA 3UW2A 3OYHA 3EAYA 2Y8QA 1MUNA 3NNQA 1KG2A 1XSZA 3EIKA 2DKCA 4B24A 5JN5A 3N5NX 1CDWA 4C7PA 2V9JA 4ROCB 1P7MA 2ZFDB 2PWWA 1KO9A 5JMVD 2QREA 5AN4A 2V8QA 4YPHA 1M5Q1 2QR1A 2NOBA 4WXAA 1QN5A 1KY6A 4OFAA 4PIIA 1YQLA 1ORPA 1MPGA 4OFHA 1LWYA 1MUDA 3OYEA 1KYUA 2EHBD 1YQMA 3CWTA 1P5GX 1RM1A 3DPTA 2V92A 2YH5A 3OH6A 5F9CA 2NOLA 3F10A 5FRNA 1V5SA 2R5XA 4MRQA 4EAGA 3OYBA 3KNTA 3OY9A 4BE2A 3OS1A 2MJ7A 3CWAA 1KG4A 3H1ZA 2HZSA 1TBPA 3C04A 4BDZA 2NLVA 4EAKA 1PU8A 2FGTA 4OFEA 2ABKA 3OYJA 4EW4A 4UNFA 4BACA 3VN5A 2V75A 1TUOA 1YTFA 3PMGA 3OGDA 4YPRA 4E9EA 3R2XC 3S3MA 1YQRA 4EAJA 2HZMA 2Z8UA 1LWVA 2IV9A 2JOIA 5KN8A 1XQOA 4E9FA 1C47A 1WJWA 2JPSA 1PU6A 4EA5A 4B22A 3OYGA 1KEAA 4E7HA 3ULXA 3OYKA 4Q11A 4E9HA 4E7LA 1QNEA 5HSHA 1PZDA 3D7QA 1K35A 3CWSA 2H4LX 3T4NA 3D4VA 2D0CA 3OSEA 2FUVA 1KG3A 3OS0A 1C9BB 4EW0A 1KY7A 2QRDA 4AI4A 3OYDA 2H5AX 3OSMA 1JDYA 4PY5A 1P59A 1R4XA 4EAIA 3DPUA 3S3OA 2NOEA 4EALA 2FKFA 1KG6A 3OC3C 3OYNA 4HJHA 2NOIA 4UOBA 1VRLA 4DK9A 5BMPA 4EJZA 2YA3A 3RSMA 1LWWA 1UT4A 1PVSA 5FROA 3OYFA 4E7KA 3TDHA 4CFFA 2D0BA 4WX8A 1NGMA 5EPCA 3HS8A 1KFIA 3L2VA 2H56A 2JG6A 4AI5A 4BJUA 4IKFA 1U84A 3FHFA 2NWVA 2DKAA 3L2RA 5BMNA 3L2QA 1P5DX 4IL8A 3OSTA 4BE0A 1MP9A 3L2WA 4EJYA 2DKDA 4RODB 3OYAA 2NOHA 1M3HA 3I0WA 1LXTA 1TGHA 3CWUA 1TBAB 1RRQA 3HS9A 1KG5A 1K2YX 3CVSA 1HU0A 4WZSD 1WQAA 3OYMA 3OH9A 3KTUA 1XQPA 2Z0FA 4TPSA 1NKUA 2VJ0A 2JHJA 1UT7A 2NVMA 4B21A 1QN6A 3F0ZA 1NH2A 1AISA 1KFQA 4BE1A 2F7LA 2OFIA 1QNCA 1PCZA 4D7RA 1ORNA 2NOFA 5CHZA 4E7IA 2G30A 4EA4A 3ENOC 2OFKA 2QRCA 1QN7A 2NOZA 3ASMA 4BDYA 1XG7A 4ZTFA 2W03A 4D7QA 4E7JA 1QN9A 5IYDP 2YG8A 2W04A 1QN8A 1RRSA 4B23A 2JPIA 2D0AA 2OOXA 3S3NA 5IYBP 1D3UA 1KYFA 3OCIA 1E42A 1MUYA 1LMZA 2JHNA 3OYIA 4QG5A 4ROEB 1Q9UA 1EBMA 5KN9A 5KL0A 1KQJA 4AIAA 1NGNA 1PU7A 3I0XA 2HKPA 2YG9A 1QNAA 2LAEA 1JFIC 1PCMX 3CVTA 3N89A 1YQKA 3G0QA 3FSPA 4E9GA 1VTOA 1M3QA 2HL8A 1VOLB 1B9KA 1NVPA 3BKQX 3SNSA 2Y8LA 3RPJA 1WEGA 3OYCA 1YTBA 1FN7A 2IV8A 1WEIA 3L2UA 4HSBA 1KG7A 2I5WA 2OOYA 4YOQA 5IYCP 1N39A 4EVVA 1VKLA 4NZGA 3VW4A 4DULA 2FKMX 1N3CA 1N3AA 3N0UA 2XHIA 2O3OA 3I3WA 2HL9A 1J3MA 3TE5A 5DPKA 3CW7A 1VOKA 1UL7A 3ENCA 1QN4A 1C4GA 1WEFA 1QTPA 3S6IA 3OYLA 3LCNA
chains in the Genus database with same CATH topology
3IH7A 1DIZA 3CWAA 1KG4A 1MUYA 1LMZA 3FHGA 1PU8A 4OFEA 2H56A 2JG6A 2JHNA 4AI5A 3FHFA 2ABKA 1EBMA 4EW4A 5KN9A 1KQJA 1NGNA 1PU7A 4UNFA 4AIAA 3I0XA 2YG9A 3IHOA 4EJYA 3CVTA 2NOHA 1YQKA 3G0QA 3OGDA 3I0WA 1M3HA 4YPRA 3FSPA 4E9GA 3CWUA 4E9EA 1M3QA 1RRQA 1MUNA 1KG2A 1KG5A 1YQRA 3CVSA 4B24A 1HU0A 1LWVA 3N5NX 5KN8A 1XQOA 4E9FA 1WEGA 3OH9A 3KTUA 1XQPA 1FN7A 1PU6A 1P7MA 1WEIA 1NKUA 2JHJA 4EA5A 1KO9A 4HSBA 4B22A 1KG7A 2I5WA 1KEAA 4B21A 4YOQA 3F0ZA 5AN4A 1N39A 4E9HA 4YPHA 4EVVA 2NOBA 2OFIA 1ORNA 2NOFA 5CHZA 3CWSA 1N3CA 4OFAA 4EA4A 1N3AA 4PIIA 1YQLA 2OFKA 1ORPA 3D4VA 3N0UA 1MPGA 4OFHA 1LWYA 2NOZA 1KG3A 1MUDA 2XHIA 1XG7A 1YQMA 3CWTA 4EW0A 4AI4A 5DPKA 3CW7A 1P59A 2NOEA 2YG8A 3OH6A 1KG6A 2NOLA 1WEFA 1RRSA 3S6IA 3F10A 4B23A 2NOIA 4UOBA 1VRLA 4DK9A 4EJZA 1LWWA 3KNTA 1PVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH7 A;  1DIZ A;  3CWA A;  1KG4 A;  1MUY A;  1LMZ A;  3FHG A;  1PU8 A;  4OFE A;  2H56 A;  2JG6 A;  2JHN A;  4AI5 A;  3FHF A;  2ABK A;  1EBM A;  4EW4 A;  5KN9 A;  1KQJ A;  1NGN A;  1PU7 A;  4UNF A;  4AIA A;  3I0X A;  2YG9 A;  3IHO A;  4EJY A;  3CVT A;  2NOH A;  1YQK A;  3G0Q A;  3OGD A;  3I0W A;  1M3H A;  4YPR A;  3FSP A;  4E9G A;  3CWU A;  4E9E A;  1M3Q A;  1RRQ A;  1MUN A;  1KG2 A;  1KG5 A;  1YQR A;  3CVS A;  4B24 A;  1HU0 A;  1LWV A;  3N5N X;  5KN8 A;  1XQO A;  4E9F A;  1WEG A;  3OH9 A;  3KTU A;  1XQP A;  1FN7 A;  1PU6 A;  1P7M A;  1WEI A;  1NKU A;  2JHJ A;  4EA5 A;  1KO9 A;  4HSB A;  4B22 A;  1KG7 A;  2I5W A;  1KEA A;  4B21 A;  4YOQ A;  3F0Z A;  5AN4 A;  1N39 A;  4E9H A;  4YPH A;  4EVV A;  2NOB A;  2OFI A;  1ORN A;  2NOF A;  5CHZ A;  3CWS A;  1N3C A;  4OFA A;  4EA4 A;  1N3A A;  4PII A;  1YQL A;  2OFK A;  1ORP A;  3D4V A;  3N0U A;  1MPG A;  4OFH A;  1LWY A;  2NOZ A;  1KG3 A;  1MUD A;  2XHI A;  1XG7 A;  1YQM A;  3CWT A;  4EW0 A;  4AI4 A;  5DPK A;  3CW7 A;  1P59 A;  2NOE A;  2YG8 A;  3OH6 A;  1KG6 A;  2NOL A;  1WEF A;  1RRS A;  3S6I A;  3F10 A;  4B23 A;  2NOI A;  4UOB A;  1VRL A;  4DK9 A;  4EJZ A;  1LWW A;  3KNT A;  1PVS A; 
#chains in the Genus database with same CATH topology
 3PDK A;  3OS2 A;  3IH7 A;  5FRM A;  1EUV A;  3NA5 A;  1T6A A;  1DIZ A;  1QTS A;  4I8O A;  1QN3 A;  3FHG A;  4ZTJ A;  1VTL E;  1PCJ X;  3OLP A;  2QLV A;  1W80 A;  2MZ8 A;  1KYD A;  3IHO A;  4B0A A;  1QNB A;  3KRM A;  3UW2 A;  3OYH A;  3EAY A;  2Y8Q A;  1MUN A;  3NNQ A;  1KG2 A;  1XSZ A;  3EIK A;  2DKC A;  4B24 A;  5JN5 A;  3N5N X;  1CDW A;  4C7P A;  2V9J A;  4ROC B;  1P7M A;  2ZFD B;  2PWW A;  1KO9 A;  5JMV D;  2QRE A;  5AN4 A;  2V8Q A;  4YPH A;  1M5Q 1;  2QR1 A;  2NOB A;  4WXA A;  1QN5 A;  1KY6 A;  4OFA A;  4PII A;  1YQL A;  1ORP A;  1MPG A;  4OFH A;  1LWY A;  1MUD A;  3OYE A;  1KYU A;  2EHB D;  1YQM A;  3CWT A;  1P5G X;  1RM1 A;  3DPT A;  2V92 A;  2YH5 A;  3OH6 A;  5F9C A;  2NOL A;  3F10 A;  5FRN A;  1V5S A;  2R5X A;  4MRQ A;  4EAG A;  3OYB A;  3KNT A;  3OY9 A;  4BE2 A;  3OS1 A;  2MJ7 A;  3CWA A;  1KG4 A;  3H1Z A;  2HZS A;  1TBP A;  3C04 A;  4BDZ A;  2NLV A;  4EAK A;  1PU8 A;  2FGT A;  4OFE A;  2ABK A;  3OYJ A;  4EW4 A;  4UNF A;  4BAC A;  3VN5 A;  2V75 A;  1TUO A;  1YTF A;  3PMG A;  3OGD A;  4YPR A;  4E9E A;  3R2X C;  3S3M A;  1YQR A;  4EAJ A;  2HZM A;  2Z8U A;  1LWV A;  2IV9 A;  2JOI A;  5KN8 A;  1XQO A;  4E9F A;  1C47 A;  1WJW A;  2JPS A;  1PU6 A;  4EA5 A;  4B22 A;  3OYG A;  1KEA A;  4E7H A;  3ULX A;  3OYK A;  4Q11 A;  4E9H A;  4E7L A;  1QNE A;  5HSH A;  1PZD A;  3D7Q A;  1K35 A;  3CWS A;  2H4L X;  3T4N A;  3D4V A;  2D0C A;  3OSE A;  2FUV A;  1KG3 A;  3OS0 A;  1C9B B;  4EW0 A;  1KY7 A;  2QRD A;  4AI4 A;  3OYD A;  2H5A X;  3OSM A;  1JDY A;  4PY5 A;  1P59 A;  1R4X A;  4EAI A;  3DPU A;  3S3O A;  2NOE A;  4EAL A;  2FKF A;  1KG6 A;  3OC3 C;  3OYN A;  4HJH A;  2NOI A;  4UOB A;  1VRL A;  4DK9 A;  5BMP A;  4EJZ A;  2YA3 A;  3RSM A;  1LWW A;  1UT4 A;  1PVS A;  5FRO A;  3OYF A;  4E7K A;  3TDH A;  4CFF A;  2D0B A;  4WX8 A;  1NGM A;  5EPC A;  3HS8 A;  1KFI A;  3L2V A;  2H56 A;  2JG6 A;  4AI5 A;  4BJU A;  4IKF A;  1U84 A;  3FHF A;  2NWV A;  2DKA A;  3L2R A;  5BMN A;  3L2Q A;  1P5D X;  4IL8 A;  3OST A;  4BE0 A;  1MP9 A;  3L2W A;  4EJY A;  2DKD A;  4ROD B;  3OYA A;  2NOH A;  1M3H A;  3I0W A;  1LXT A;  1TGH A;  3CWU A;  1TBA B;  1RRQ A;  3HS9 A;  1KG5 A;  1K2Y X;  3CVS A;  1HU0 A;  4WZS D;  1WQA A;  3OYM A;  3OH9 A;  3KTU A;  1XQP A;  2Z0F A;  4TPS A;  1NKU A;  2VJ0 A;  2JHJ A;  1UT7 A;  2NVM A;  4B21 A;  1QN6 A;  3F0Z A;  1NH2 A;  1AIS A;  1KFQ A;  4BE1 A;  2F7L A;  2OFI A;  1QNC A;  1PCZ A;  4D7R A;  1ORN A;  2NOF A;  5CHZ A;  4E7I A;  2G30 A;  4EA4 A;  3ENO C;  2OFK A;  2QRC A;  1QN7 A;  2NOZ A;  3ASM A;  4BDY A;  1XG7 A;  4ZTF A;  2W03 A;  4D7Q A;  4E7J A;  1QN9 A;  5IYD P;  2YG8 A;  2W04 A;  1QN8 A;  1RRS A;  4B23 A;  2JPI A;  2D0A A;  2OOX A;  3S3N A;  5IYB P;  1D3U A;  1KYF A;  3OCI A;  1E42 A;  1MUY A;  1LMZ A;  2JHN A;  3OYI A;  4QG5 A;  4ROE B;  1Q9U A;  1EBM A;  5KN9 A;  5KL0 A;  1KQJ A;  4AIA A;  1NGN A;  1PU7 A;  3I0X A;  2HKP A;  2YG9 A;  1QNA A;  2LAE A;  1JFI C;  1PCM X;  3CVT A;  3N89 A;  1YQK A;  3G0Q A;  3FSP A;  4E9G A;  1VTO A;  1M3Q A;  2HL8 A;  1VOL B;  1B9K A;  1NVP A;  3BKQ X;  3SNS A;  2Y8L A;  3RPJ A;  1WEG A;  3OYC A;  1YTB A;  1FN7 A;  2IV8 A;  1WEI A;  3L2U A;  4HSB A;  1KG7 A;  2I5W A;  2OOY A;  4YOQ A;  5IYC P;  1N39 A;  4EVV A;  1VKL A;  4NZG A;  3VW4 A;  4DUL A;  2FKM X;  1N3C A;  1N3A A;  3N0U A;  2XHI A;  2O3O A;  3I3W A;  2HL9 A;  1J3M A;  3TE5 A;  5DPK A;  3CW7 A;  1VOK A;  1UL7 A;  3ENC A;  1QN4 A;  1C4G A;  1WEF A;  1QTP A;  3S6I A;  3OYL A;  3LCN A; 
#chains in the Genus database with same CATH homology
 3IH7 A;  1DIZ A;  3CWA A;  1KG4 A;  1MUY A;  1LMZ A;  3FHG A;  1PU8 A;  4OFE A;  2H56 A;  2JG6 A;  2JHN A;  4AI5 A;  3FHF A;  2ABK A;  1EBM A;  4EW4 A;  5KN9 A;  1KQJ A;  1NGN A;  1PU7 A;  4UNF A;  4AIA A;  3I0X A;  2YG9 A;  3IHO A;  4EJY A;  3CVT A;  2NOH A;  1YQK A;  3G0Q A;  3OGD A;  3I0W A;  1M3H A;  4YPR A;  3FSP A;  4E9G A;  3CWU A;  4E9E A;  1M3Q A;  1RRQ A;  1MUN A;  1KG2 A;  1KG5 A;  1YQR A;  3CVS A;  4B24 A;  1HU0 A;  1LWV A;  3N5N X;  5KN8 A;  1XQO A;  4E9F A;  1WEG A;  3OH9 A;  3KTU A;  1XQP A;  1FN7 A;  1PU6 A;  1P7M A;  1WEI A;  1NKU A;  2JHJ A;  4EA5 A;  1KO9 A;  4HSB A;  4B22 A;  1KG7 A;  2I5W A;  1KEA A;  4B21 A;  4YOQ A;  3F0Z A;  5AN4 A;  1N39 A;  4E9H A;  4YPH A;  4EVV A;  2NOB A;  2OFI A;  1ORN A;  2NOF A;  5CHZ A;  3CWS A;  1N3C A;  4OFA A;  4EA4 A;  1N3A A;  4PII A;  1YQL A;  2OFK A;  1ORP A;  3D4V A;  3N0U A;  1MPG A;  4OFH A;  1LWY A;  2NOZ A;  1KG3 A;  1MUD A;  2XHI A;  1XG7 A;  1YQM A;  3CWT A;  4EW0 A;  4AI4 A;  5DPK A;  3CW7 A;  1P59 A;  2NOE A;  2YG8 A;  3OH6 A;  1KG6 A;  2NOL A;  1WEF A;  1RRS A;  3S6I A;  3F10 A;  4B23 A;  2NOI A;  4UOB A;  1VRL A;  4DK9 A;  4EJZ A;  1LWW A;  3KNT A;  1PVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...