3OH9A

Alka undamaged dna complex: interrogation of a t:a base pair
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
288
structure length
288
Chain Sequence
MADIGSEFYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDCLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords DNA-3-methyladenine glycosylase 2
publication title Structure of Escherichia coli AlkA in Complex with Undamaged DNA.
pubmed doi rcsb
source organism Escherichia coli
total genus 84
structure length 288
sequence length 288
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2010-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3oh9A02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3oh9A03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3oh9A01
4E9GA 4B23A 4B21A 4EA4A 1LWVA 4EW0A 1YQKA 4YOQA 1LMZA 4EW4A 1M3HA 4EJYA 1ORPA 3FSPA 1XQOA 1KO9A 1N3CA 4OFAA 2XHIA 3S6IA 3I0XA 2YG8A 1KG4A 4EA5A 1P59A 1LWWA 4AI5A 4PIIA 1MUDA 1N3AA 3IH7A 5CHZA 2JHJA 3D4VA 4OFHA 1WEFA 4UOBA 3N5NX 1KG5A 2JHNA 3CVSA 4YPRA 1XG7A 1KG7A 3KTUA 1N39A 2YG9A 1XQPA 2JG6A 1WEGA 3OH9A 2I5WA 1YQLA 1PU6A 3N0UA 1YQMA 3CVTA 1MUYA 2ABKA 1NGNA 3FHGA 1P7MA 2NOLA 1RRSA 3F0ZA 4EJZA 4EVVA 5AN4A 3FHFA 1PU7A 2OFIA 4B22A 2NOZA 4UNFA 5KN8A 5KN9A 1HU0A 1YQRA 1PVSA 4AI4A 3CWUA 4E9EA 1FN7A 2NOBA 4YPHA 1RRQA 2NOHA 1KG6A 1KG3A 4HSBA 3G0QA 1VRLA 1M3QA 1EBMA 3OGDA 3KNTA 2NOIA 1NKUA 2OFKA 1ORNA 4B24A 3CWTA 4E9HA 3IHOA 1KEAA 2NOFA 1KG2A 3CWAA 4OFEA 3CWSA 3I0WA 5DPKA 1DIZA 2H56A 4E9FA 3CW7A 3F10A 3OH6A 1KQJA 2NOEA 4DK9A 1MUNA 4AIAA 1WEIA 1LWYA 1MPGA 1PU8A
chains in the Genus database with same CATH superfamily
4E7KA 1NVPA 3OCIA 4ROEB 1K35A 1P5DX 4EAJA 4EAKA 1XQOA 1NGMA 1LWWA 1KG4A 4EA5A 4AI5A 2YH5A 1MUDA 3OYCA 3OSTA 4IKFA 1WEFA 3LCNA 3OYAA 3OYKA 3TE5A 1KG7A 2D0CA 2OOXA 1XQPA 4EAIA 1WEGA 2I5WA 1YQLA 2Z8UA 3OYIA 2ABKA 3OLPA 3HS9A 1RRSA 2D0AA 4EJZA 4EVVA 5BMPA 1KFIA 4UNFA 1YTFA 1QTPA 1AISA 1QTSA 4WZSD 1D3UA 4YPHA 2W04A 4WXAA 2NOHA 1KG6A 4HSBA 4BDZA 5IYCP 1QN4A 3OY9A 1QN6A 5EPCA 1JDYA 1B9KA 3OYMA 1NKUA 2QR1A 2G30A 1ORNA 2NLVA 2F7LA 4D7RA 1WJWA 3HS8A 1TBPA 3OYLA 1M5Q1 2QRCA 4C7PA 2QREA 5HSHA 1W80A 2FGTA 1PZDA 3OS2A 3I3WA 1QN8A 4MRQA 3F10A 3OH6A 3TDHA 4AIAA 1KY7A 4B23A 1XSZA 3ULXA 1YQKA 1LMZA 1KYFA 1ORPA 1PCZA 4OFAA 3I0XA 2YG8A 1P59A 3OYBA 3OYHA 1K2YX 3VW4A 4OFHA 1VOLB 4UOBA 1KG5A 2JHNA 3OS0A 1P5GX 1XG7A 5JN5A 1N39A 1KFQA 2YG9A 2NWVA 1QNCA 3OH9A 2DKDA 1PU6A 3CVTA 3FHGA 1J3MA 5AN4A 3FHFA 2HZMA 4B22A 3OYJA 1PVSA 5KL0A 4E7LA 4AI4A 2HKPA 3OYNA 1FN7A 3C04A 4E7HA 2V92A 3S3MA 1VRLA 2Y8LA 1M3QA 3S3NA 3L2UA 2PWWA 4BACA 3SNSA 4B24A 4CFFA 3CWTA 3NA5A 3IHOA 1KEAA 1KYUA 3DPUA 4EAGA 3UW2A 1MP9A 4OFEA 1UL7A 4EALA 4BDYA 3DPTA 2D0BA 3KRMA 2JPIA 1C47A 5FRNA 3ENCA 1QN9A 1R4XA 1TBAB 3L2RA 1MPGA 4Q11A 4E9GA 3H1ZA 1VTOA 2NVMA 3ASMA 1M3HA 4BE2A 4EJYA 2JOIA 4TPSA 1KO9A 2XHIA 1RM1A 1VTLE 4PIIA 3EIKA 1YTBA 5CHZA 5JMVD 3N5NX 3CVSA 3L2QA 1KY6A 1UT7A 2QRDA 3VN5A 4YPRA 5IYBP 3KTUA 1T6AA 2JG6A 4BE1A 1Q9UA 1VKLA 1JFIC 4ZTFA 4DULA 2NOLA 3EAYA 3F0ZA 2V75A 1VOKA 2FKFA 5FRMA 4QG5A 2QLVA 3RSMA 2IV8A 3CWUA 4E9EA 1UT4A 1TUOA 1RRQA 3L2VA 3S3OA 1WQAA 3L2WA 3BKQX 2HZSA 4E7JA 3R2XC 3OGDA 2V8QA 4ZTJA 1E42A 1QNAA 1PCJX 2YA3A 3PMGA 4HJHA 1V5SA 2H4LX 2NOFA 3OYFA 3CWAA 4PY5A 2EHBD 5F9CA 1LXTA 2HL9A 1DIZA 2V9JA 4E9FA 3CW7A 1KQJA 2NOEA 1QN7A 4DK9A 1MUNA 1WEIA 1LWYA 2R5XA 1PU8A 4RODB 1U84A 4B21A 4EA4A 1LWVA 2VJ0A 3OS1A 4EW0A 4YOQA 4EW4A 4I8OA 3FSPA 1N3CA 3S6IA 2IV9A 4BE0A 1N3AA 3IH7A 2JHJA 3D4VA 1QN3A 4D7QA 2FUVA 4BJUA 4ROCB 3OSEA 2HL8A 3D7QA 1QN5A 1KYDA 3N89A 3N0UA 1YQMA 3OC3C 1MUYA 1C9BB 2MZ8A 1NGNA 2O3OA 3ENOC 1P7MA 1C4GA 2LAEA 2W03A 4WX8A 1PU7A 2OFIA 2MJ7A 4NZGA 2Z0FA 2NOZA 5KN8A 3NNQA 2H5AX 5KN9A 1NH2A 1HU0A 3OYEA 1YQRA 2NOBA 2JPSA 1TGHA 1KG3A 4E7IA 3OSMA 2Y8QA 3G0QA 1EBMA 1QNBA 3KNTA 5IYDP 2NOIA 3OYDA 2OFKA 2DKCA 4E9HA 2DKAA 1EUVA 3RPJA 1KG2A 4IL8A 5BMNA 5FROA 1QNEA 3CWSA 3I0WA 4B0AA 5DPKA 1PCMX 3PDKA 3T4NA 2H56A 2ZFDB 1CDWA 2OOYA 3OYGA 2FKMX
chains in the Genus database with same CATH topology
4E9GA 4B23A 4B21A 4EA4A 1LWVA 4EW0A 1YQKA 4YOQA 1LMZA 4EW4A 1M3HA 4EJYA 1ORPA 3FSPA 1XQOA 1KO9A 1N3CA 4OFAA 2XHIA 3S6IA 3I0XA 2YG8A 1KG4A 4EA5A 1P59A 1LWWA 4AI5A 4PIIA 1MUDA 1N3AA 3IH7A 5CHZA 2JHJA 3D4VA 4OFHA 1WEFA 4UOBA 3N5NX 1KG5A 2JHNA 3CVSA 4YPRA 1XG7A 1KG7A 3KTUA 1N39A 2YG9A 1XQPA 2JG6A 1WEGA 3OH9A 2I5WA 1YQLA 1PU6A 3N0UA 1YQMA 3CVTA 1MUYA 2ABKA 1NGNA 3FHGA 1P7MA 2NOLA 1RRSA 3F0ZA 4EJZA 4EVVA 5AN4A 3FHFA 1PU7A 2OFIA 4B22A 2NOZA 4UNFA 5KN8A 5KN9A 1HU0A 1YQRA 1PVSA 4AI4A 3CWUA 4E9EA 1FN7A 2NOBA 4YPHA 1RRQA 2NOHA 1KG6A 1KG3A 4HSBA 3G0QA 1VRLA 1M3QA 1EBMA 3OGDA 3KNTA 2NOIA 1NKUA 2OFKA 1ORNA 4B24A 3CWTA 4E9HA 3IHOA 1KEAA 2NOFA 1KG2A 3CWAA 4OFEA 3CWSA 3I0WA 5DPKA 1DIZA 2H56A 4E9FA 3CW7A 3F10A 3OH6A 1KQJA 2NOEA 4DK9A 1MUNA 4AIAA 1WEIA 1LWYA 1MPGA 1PU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E9G A;  4B23 A;  4B21 A;  4EA4 A;  1LWV A;  4EW0 A;  1YQK A;  4YOQ A;  1LMZ A;  4EW4 A;  1M3H A;  4EJY A;  1ORP A;  3FSP A;  1XQO A;  1KO9 A;  1N3C A;  4OFA A;  2XHI A;  3S6I A;  3I0X A;  2YG8 A;  1KG4 A;  4EA5 A;  1P59 A;  1LWW A;  4AI5 A;  4PII A;  1MUD A;  1N3A A;  3IH7 A;  5CHZ A;  2JHJ A;  3D4V A;  4OFH A;  1WEF A;  4UOB A;  3N5N X;  1KG5 A;  2JHN A;  3CVS A;  4YPR A;  1XG7 A;  1KG7 A;  3KTU A;  1N39 A;  2YG9 A;  1XQP A;  2JG6 A;  1WEG A;  3OH9 A;  2I5W A;  1YQL A;  1PU6 A;  3N0U A;  1YQM A;  3CVT A;  1MUY A;  2ABK A;  1NGN A;  3FHG A;  1P7M A;  2NOL A;  1RRS A;  3F0Z A;  4EJZ A;  4EVV A;  5AN4 A;  3FHF A;  1PU7 A;  2OFI A;  4B22 A;  2NOZ A;  4UNF A;  5KN8 A;  5KN9 A;  1HU0 A;  1YQR A;  1PVS A;  4AI4 A;  3CWU A;  4E9E A;  1FN7 A;  2NOB A;  4YPH A;  1RRQ A;  2NOH A;  1KG6 A;  1KG3 A;  4HSB A;  3G0Q A;  1VRL A;  1M3Q A;  1EBM A;  3OGD A;  3KNT A;  2NOI A;  1NKU A;  2OFK A;  1ORN A;  4B24 A;  3CWT A;  4E9H A;  3IHO A;  1KEA A;  2NOF A;  1KG2 A;  3CWA A;  4OFE A;  3CWS A;  3I0W A;  5DPK A;  1DIZ A;  2H56 A;  4E9F A;  3CW7 A;  3F10 A;  3OH6 A;  1KQJ A;  2NOE A;  4DK9 A;  1MUN A;  4AIA A;  1WEI A;  1LWY A;  1MPG A;  1PU8 A; 
#chains in the Genus database with same CATH topology
 4E7K A;  1NVP A;  3OCI A;  4ROE B;  1K35 A;  1P5D X;  4EAJ A;  4EAK A;  1XQO A;  1NGM A;  1LWW A;  1KG4 A;  4EA5 A;  4AI5 A;  2YH5 A;  1MUD A;  3OYC A;  3OST A;  4IKF A;  1WEF A;  3LCN A;  3OYA A;  3OYK A;  3TE5 A;  1KG7 A;  2D0C A;  2OOX A;  1XQP A;  4EAI A;  1WEG A;  2I5W A;  1YQL A;  2Z8U A;  3OYI A;  2ABK A;  3OLP A;  3HS9 A;  1RRS A;  2D0A A;  4EJZ A;  4EVV A;  5BMP A;  1KFI A;  4UNF A;  1YTF A;  1QTP A;  1AIS A;  1QTS A;  4WZS D;  1D3U A;  4YPH A;  2W04 A;  4WXA A;  2NOH A;  1KG6 A;  4HSB A;  4BDZ A;  5IYC P;  1QN4 A;  3OY9 A;  1QN6 A;  5EPC A;  1JDY A;  1B9K A;  3OYM A;  1NKU A;  2QR1 A;  2G30 A;  1ORN A;  2NLV A;  2F7L A;  4D7R A;  1WJW A;  3HS8 A;  1TBP A;  3OYL A;  1M5Q 1;  2QRC A;  4C7P A;  2QRE A;  5HSH A;  1W80 A;  2FGT A;  1PZD A;  3OS2 A;  3I3W A;  1QN8 A;  4MRQ A;  3F10 A;  3OH6 A;  3TDH A;  4AIA A;  1KY7 A;  4B23 A;  1XSZ A;  3ULX A;  1YQK A;  1LMZ A;  1KYF A;  1ORP A;  1PCZ A;  4OFA A;  3I0X A;  2YG8 A;  1P59 A;  3OYB A;  3OYH A;  1K2Y X;  3VW4 A;  4OFH A;  1VOL B;  4UOB A;  1KG5 A;  2JHN A;  3OS0 A;  1P5G X;  1XG7 A;  5JN5 A;  1N39 A;  1KFQ A;  2YG9 A;  2NWV A;  1QNC A;  3OH9 A;  2DKD A;  1PU6 A;  3CVT A;  3FHG A;  1J3M A;  5AN4 A;  3FHF A;  2HZM A;  4B22 A;  3OYJ A;  1PVS A;  5KL0 A;  4E7L A;  4AI4 A;  2HKP A;  3OYN A;  1FN7 A;  3C04 A;  4E7H A;  2V92 A;  3S3M A;  1VRL A;  2Y8L A;  1M3Q A;  3S3N A;  3L2U A;  2PWW A;  4BAC A;  3SNS A;  4B24 A;  4CFF A;  3CWT A;  3NA5 A;  3IHO A;  1KEA A;  1KYU A;  3DPU A;  4EAG A;  3UW2 A;  1MP9 A;  4OFE A;  1UL7 A;  4EAL A;  4BDY A;  3DPT A;  2D0B A;  3KRM A;  2JPI A;  1C47 A;  5FRN A;  3ENC A;  1QN9 A;  1R4X A;  1TBA B;  3L2R A;  1MPG A;  4Q11 A;  4E9G A;  3H1Z A;  1VTO A;  2NVM A;  3ASM A;  1M3H A;  4BE2 A;  4EJY A;  2JOI A;  4TPS A;  1KO9 A;  2XHI A;  1RM1 A;  1VTL E;  4PII A;  3EIK A;  1YTB A;  5CHZ A;  5JMV D;  3N5N X;  3CVS A;  3L2Q A;  1KY6 A;  1UT7 A;  2QRD A;  3VN5 A;  4YPR A;  5IYB P;  3KTU A;  1T6A A;  2JG6 A;  4BE1 A;  1Q9U A;  1VKL A;  1JFI C;  4ZTF A;  4DUL A;  2NOL A;  3EAY A;  3F0Z A;  2V75 A;  1VOK A;  2FKF A;  5FRM A;  4QG5 A;  2QLV A;  3RSM A;  2IV8 A;  3CWU A;  4E9E A;  1UT4 A;  1TUO A;  1RRQ A;  3L2V A;  3S3O A;  1WQA A;  3L2W A;  3BKQ X;  2HZS A;  4E7J A;  3R2X C;  3OGD A;  2V8Q A;  4ZTJ A;  1E42 A;  1QNA A;  1PCJ X;  2YA3 A;  3PMG A;  4HJH A;  1V5S A;  2H4L X;  2NOF A;  3OYF A;  3CWA A;  4PY5 A;  2EHB D;  5F9C A;  1LXT A;  2HL9 A;  1DIZ A;  2V9J A;  4E9F A;  3CW7 A;  1KQJ A;  2NOE A;  1QN7 A;  4DK9 A;  1MUN A;  1WEI A;  1LWY A;  2R5X A;  1PU8 A;  4ROD B;  1U84 A;  4B21 A;  4EA4 A;  1LWV A;  2VJ0 A;  3OS1 A;  4EW0 A;  4YOQ A;  4EW4 A;  4I8O A;  3FSP A;  1N3C A;  3S6I A;  2IV9 A;  4BE0 A;  1N3A A;  3IH7 A;  2JHJ A;  3D4V A;  1QN3 A;  4D7Q A;  2FUV A;  4BJU A;  4ROC B;  3OSE A;  2HL8 A;  3D7Q A;  1QN5 A;  1KYD A;  3N89 A;  3N0U A;  1YQM A;  3OC3 C;  1MUY A;  1C9B B;  2MZ8 A;  1NGN A;  2O3O A;  3ENO C;  1P7M A;  1C4G A;  2LAE A;  2W03 A;  4WX8 A;  1PU7 A;  2OFI A;  2MJ7 A;  4NZG A;  2Z0F A;  2NOZ A;  5KN8 A;  3NNQ A;  2H5A X;  5KN9 A;  1NH2 A;  1HU0 A;  3OYE A;  1YQR A;  2NOB A;  2JPS A;  1TGH A;  1KG3 A;  4E7I A;  3OSM A;  2Y8Q A;  3G0Q A;  1EBM A;  1QNB A;  3KNT A;  5IYD P;  2NOI A;  3OYD A;  2OFK A;  2DKC A;  4E9H A;  2DKA A;  1EUV A;  3RPJ A;  1KG2 A;  4IL8 A;  5BMN A;  5FRO A;  1QNE A;  3CWS A;  3I0W A;  4B0A A;  5DPK A;  1PCM X;  3PDK A;  3T4N A;  2H56 A;  2ZFD B;  1CDW A;  2OOY A;  3OYG A;  2FKM X; 
#chains in the Genus database with same CATH homology
 4E9G A;  4B23 A;  4B21 A;  4EA4 A;  1LWV A;  4EW0 A;  1YQK A;  4YOQ A;  1LMZ A;  4EW4 A;  1M3H A;  4EJY A;  1ORP A;  3FSP A;  1XQO A;  1KO9 A;  1N3C A;  4OFA A;  2XHI A;  3S6I A;  3I0X A;  2YG8 A;  1KG4 A;  4EA5 A;  1P59 A;  1LWW A;  4AI5 A;  4PII A;  1MUD A;  1N3A A;  3IH7 A;  5CHZ A;  2JHJ A;  3D4V A;  4OFH A;  1WEF A;  4UOB A;  3N5N X;  1KG5 A;  2JHN A;  3CVS A;  4YPR A;  1XG7 A;  1KG7 A;  3KTU A;  1N39 A;  2YG9 A;  1XQP A;  2JG6 A;  1WEG A;  3OH9 A;  2I5W A;  1YQL A;  1PU6 A;  3N0U A;  1YQM A;  3CVT A;  1MUY A;  2ABK A;  1NGN A;  3FHG A;  1P7M A;  2NOL A;  1RRS A;  3F0Z A;  4EJZ A;  4EVV A;  5AN4 A;  3FHF A;  1PU7 A;  2OFI A;  4B22 A;  2NOZ A;  4UNF A;  5KN8 A;  5KN9 A;  1HU0 A;  1YQR A;  1PVS A;  4AI4 A;  3CWU A;  4E9E A;  1FN7 A;  2NOB A;  4YPH A;  1RRQ A;  2NOH A;  1KG6 A;  1KG3 A;  4HSB A;  3G0Q A;  1VRL A;  1M3Q A;  1EBM A;  3OGD A;  3KNT A;  2NOI A;  1NKU A;  2OFK A;  1ORN A;  4B24 A;  3CWT A;  4E9H A;  3IHO A;  1KEA A;  2NOF A;  1KG2 A;  3CWA A;  4OFE A;  3CWS A;  3I0W A;  5DPK A;  1DIZ A;  2H56 A;  4E9F A;  3CW7 A;  3F10 A;  3OH6 A;  1KQJ A;  2NOE A;  4DK9 A;  1MUN A;  4AIA A;  1WEI A;  1LWY A;  1MPG A;  1PU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...