1LMZA

Solution structure of 3-methyladenine dna glycosylase i (tag)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
187
structure length
187
Chain Sequence
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACFHQFDPVKVAAMQEEDVERLVQDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFADFVWSFVNHQPQMTQATTLSEIPTSTPASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCCCYPGNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-methyladenine DNA glycosylase I (TAG)
publication title 3-Methyladenine DNA glycosylase I is an unexpected helix-hairpin-helix superfamily member.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 47
structure length 187
sequence length 187
ec nomenclature ec 3.2.2.20: DNA-3-methyladenine glycosylase I.
pdb deposition date 2002-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03352 Adenine_glyco Methyladenine glycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1lmzA00
3FSPA 3KNTA 4B22A 1PVSA 4HSBA 4E9GA 4YPHA 2YG9A 1PU7A 1P7MA 1NGNA 1YQMA 4OFHA 2NOEA 3I0WA 3OH6A 1RRSA 4EW0A 1ORNA 4YPRA 1YQKA 1KO9A 3I0XA 4E9HA 3FHGA 2H56A 2NOBA 2OFIA 3CVSA 2I5WA 3CVTA 4EJZA 1KG6A 5KN9A 4EA5A 1LWVA 1YQLA 1KG2A 3N0UA 1MUYA 1KG7A 3F0ZA 1FN7A 1LWWA 4AI5A 1KG5A 2NOIA 3IH7A 2NOZA 4AIAA 4OFEA 2JG6A 4EJYA 4EW4A 4DK9A 1HU0A 2OFKA 1WEFA 3OGDA 4B23A 1WEIA 3OH9A 1N39A 1EBMA 3G0QA 4EVVA 1YQRA 1ORPA 1NKUA 1XG7A 3FHFA 4E9EA 4PIIA 1XQOA 3CWSA 1MUDA 1MUNA 1LMZA 1MPGA 4B24A 2NOHA 1M3QA 3F10A 5KN8A 2JHJA 4UNFA 4UOBA 1PU8A 4YOQA 2XHIA 1XQPA 2ABKA 1PU6A 4E9FA 5DPKA 4EA4A 1KG4A 4B21A 1KEAA 5AN4A 2NOLA 4AI4A 1KQJA 3IHOA 1WEGA 1DIZA 1P59A 3KTUA 1KG3A 4OFAA 1VRLA 1RRQA 3D4VA 3S6IA 3CW7A 3CWUA 5CHZA 1N3AA 1M3HA 1LWYA 3CWAA 3CWTA 2JHNA 2NOFA 2YG8A 3N5NX 1N3CA
chains in the Genus database with same CATH superfamily
3FSPA 3KNTA 4B22A 1PVSA 4HSBA 4E9GA 4YPHA 5FRNA 4E7LA 2YG9A 2W03A 3OYMA 1PU7A 1P7MA 1NGNA 1YQMA 4OFHA 3OYNA 4BDYA 4BDZA 3OYKA 2NOEA 3I0WA 3OH6A 1RRSA 4EW0A 4BE0A 1ORNA 4YPRA 1YQKA 1KO9A 3L2VA 3I0XA 3FHGA 4E9HA 2H56A 2NOBA 3OS2A 3OYCA 2OFIA 3L2RA 3CVSA 2I5WA 3CVTA 4EJZA 1KG6A 5KN9A 4EA5A 1LWVA 1YQLA 1KG2A 4IKFA 3N0UA 1MUYA 1KG7A 3F0ZA 1FN7A 3L2UA 1LWWA 4ZTJA 4AI5A 1N3CA 1KG5A 3S3OA 3IH7A 2NOIA 2NOZA 4E7JA 4AIAA 4OFEA 2JG6A 4EJYA 4EW4A 4DK9A 1HU0A 2OFKA 1WEFA 3OGDA 4B23A 1WEIA 3OH9A 4E7KA 1N39A 1EBMA 3G0QA 4EVVA 1YQRA 1ORPA 1NKUA 3LCNA 1XG7A 3OS1A 3FHFA 4E9EA 3S3NA 4PIIA 1XQOA 3CWSA 3OYFA 1MUDA 1MUNA 1LMZA 1MPGA 4B24A 3S3MA 1M3QA 3OYBA 2NOHA 3F10A 5KN8A 2JHJA 4UNFA 4UOBA 4E7HA 1PU8A 3OYEA 3L2WA 4YOQA 2XHIA 1XQPA 2ABKA 4BE1A 1PU6A 4E9FA 3OYHA 4BACA 5DPKA 4EA4A 3OYDA 1KG4A 3OS0A 4B21A 1KEAA 5FROA 5AN4A 2NOLA 2V75A 4AI4A 2JPSA 3OYJA 2W04A 3OY9A 3OYGA 1KQJA 3IHOA 1WEGA 1DIZA 1P59A 3KTUA 3VW4A 1KG3A 4OFAA 1VRLA 1RRQA 3OYIA 3D4VA 4ZTFA 3S6IA 3CW7A 4NZGA 3CWUA 1U84A 4BE2A 5FRMA 5CHZA 3OYLA 1N3AA 1M3HA 1LWYA 3CWAA 4E7IA 3CWTA 3R2XC 2JHNA 2NOFA 2YG8A 3N5NX 3L2QA 3OYAA 3NNQA
chains in the Genus database with same CATH topology
3FSPA 3KNTA 4B22A 1PVSA 4HSBA 4E9GA 4YPHA 2YG9A 1PU7A 1P7MA 1NGNA 1YQMA 4OFHA 2NOEA 3I0WA 3OH6A 1RRSA 4EW0A 1ORNA 4YPRA 1YQKA 1KO9A 3I0XA 4E9HA 3FHGA 2H56A 2NOBA 2OFIA 3CVSA 2I5WA 3CVTA 4EJZA 1KG6A 5KN9A 4EA5A 1LWVA 1YQLA 1KG2A 3N0UA 1MUYA 1KG7A 3F0ZA 1FN7A 1LWWA 4AI5A 1KG5A 2NOIA 3IH7A 2NOZA 4AIAA 4OFEA 2JG6A 4EJYA 4EW4A 4DK9A 1HU0A 2OFKA 1WEFA 3OGDA 4B23A 1WEIA 3OH9A 1N39A 1EBMA 3G0QA 4EVVA 1YQRA 1ORPA 1NKUA 1XG7A 3FHFA 4E9EA 4PIIA 1XQOA 3CWSA 1MUDA 1MUNA 1LMZA 1MPGA 4B24A 2NOHA 1M3QA 3F10A 5KN8A 2JHJA 4UNFA 4UOBA 1PU8A 4YOQA 2XHIA 1XQPA 2ABKA 1PU6A 4E9FA 5DPKA 4EA4A 1KG4A 4B21A 1KEAA 5AN4A 2NOLA 4AI4A 1KQJA 3IHOA 1WEGA 1DIZA 1P59A 3KTUA 1KG3A 4OFAA 1VRLA 1RRQA 3D4VA 3S6IA 3CW7A 3CWUA 5CHZA 1N3AA 1M3HA 1LWYA 3CWAA 3CWTA 2JHNA 2NOFA 2YG8A 3N5NX 1N3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FSP A;  3KNT A;  4B22 A;  1PVS A;  4HSB A;  4E9G A;  4YPH A;  2YG9 A;  1PU7 A;  1P7M A;  1NGN A;  1YQM A;  4OFH A;  2NOE A;  3I0W A;  3OH6 A;  1RRS A;  4EW0 A;  1ORN A;  4YPR A;  1YQK A;  1KO9 A;  3I0X A;  4E9H A;  3FHG A;  2H56 A;  2NOB A;  2OFI A;  3CVS A;  2I5W A;  3CVT A;  4EJZ A;  1KG6 A;  5KN9 A;  4EA5 A;  1LWV A;  1YQL A;  1KG2 A;  3N0U A;  1MUY A;  1KG7 A;  3F0Z A;  1FN7 A;  1LWW A;  4AI5 A;  1KG5 A;  2NOI A;  3IH7 A;  2NOZ A;  4AIA A;  4OFE A;  2JG6 A;  4EJY A;  4EW4 A;  4DK9 A;  1HU0 A;  2OFK A;  1WEF A;  3OGD A;  4B23 A;  1WEI A;  3OH9 A;  1N39 A;  1EBM A;  3G0Q A;  4EVV A;  1YQR A;  1ORP A;  1NKU A;  1XG7 A;  3FHF A;  4E9E A;  4PII A;  1XQO A;  3CWS A;  1MUD A;  1MUN A;  1LMZ A;  1MPG A;  4B24 A;  2NOH A;  1M3Q A;  3F10 A;  5KN8 A;  2JHJ A;  4UNF A;  4UOB A;  1PU8 A;  4YOQ A;  2XHI A;  1XQP A;  2ABK A;  1PU6 A;  4E9F A;  5DPK A;  4EA4 A;  1KG4 A;  4B21 A;  1KEA A;  5AN4 A;  2NOL A;  4AI4 A;  1KQJ A;  3IHO A;  1WEG A;  1DIZ A;  1P59 A;  3KTU A;  1KG3 A;  4OFA A;  1VRL A;  1RRQ A;  3D4V A;  3S6I A;  3CW7 A;  3CWU A;  5CHZ A;  1N3A A;  1M3H A;  1LWY A;  3CWA A;  3CWT A;  2JHN A;  2NOF A;  2YG8 A;  3N5N X;  1N3C A; 
#chains in the Genus database with same CATH topology
 3FSP A;  3KNT A;  4B22 A;  1PVS A;  4HSB A;  4E9G A;  4YPH A;  5FRN A;  4E7L A;  2YG9 A;  2W03 A;  3OYM A;  1PU7 A;  1P7M A;  1NGN A;  1YQM A;  4OFH A;  3OYN A;  4BDY A;  4BDZ A;  3OYK A;  2NOE A;  3I0W A;  3OH6 A;  1RRS A;  4EW0 A;  4BE0 A;  1ORN A;  4YPR A;  1YQK A;  1KO9 A;  3L2V A;  3I0X A;  3FHG A;  4E9H A;  2H56 A;  2NOB A;  3OS2 A;  3OYC A;  2OFI A;  3L2R A;  3CVS A;  2I5W A;  3CVT A;  4EJZ A;  1KG6 A;  5KN9 A;  4EA5 A;  1LWV A;  1YQL A;  1KG2 A;  4IKF A;  3N0U A;  1MUY A;  1KG7 A;  3F0Z A;  1FN7 A;  3L2U A;  1LWW A;  4ZTJ A;  4AI5 A;  1N3C A;  1KG5 A;  3S3O A;  3IH7 A;  2NOI A;  2NOZ A;  4E7J A;  4AIA A;  4OFE A;  2JG6 A;  4EJY A;  4EW4 A;  4DK9 A;  1HU0 A;  2OFK A;  1WEF A;  3OGD A;  4B23 A;  1WEI A;  3OH9 A;  4E7K A;  1N39 A;  1EBM A;  3G0Q A;  4EVV A;  1YQR A;  1ORP A;  1NKU A;  3LCN A;  1XG7 A;  3OS1 A;  3FHF A;  4E9E A;  3S3N A;  4PII A;  1XQO A;  3CWS A;  3OYF A;  1MUD A;  1MUN A;  1LMZ A;  1MPG A;  4B24 A;  3S3M A;  1M3Q A;  3OYB A;  2NOH A;  3F10 A;  5KN8 A;  2JHJ A;  4UNF A;  4UOB A;  4E7H A;  1PU8 A;  3OYE A;  3L2W A;  4YOQ A;  2XHI A;  1XQP A;  2ABK A;  4BE1 A;  1PU6 A;  4E9F A;  3OYH A;  4BAC A;  5DPK A;  4EA4 A;  3OYD A;  1KG4 A;  3OS0 A;  4B21 A;  1KEA A;  5FRO A;  5AN4 A;  2NOL A;  2V75 A;  4AI4 A;  2JPS A;  3OYJ A;  2W04 A;  3OY9 A;  3OYG A;  1KQJ A;  3IHO A;  1WEG A;  1DIZ A;  1P59 A;  3KTU A;  3VW4 A;  1KG3 A;  4OFA A;  1VRL A;  1RRQ A;  3OYI A;  3D4V A;  4ZTF A;  3S6I A;  3CW7 A;  4NZG A;  3CWU A;  1U84 A;  4BE2 A;  5FRM A;  5CHZ A;  3OYL A;  1N3A A;  1M3H A;  1LWY A;  3CWA A;  4E7I A;  3CWT A;  3R2X C;  2JHN A;  2NOF A;  2YG8 A;  3N5N X;  3L2Q A;  3OYA A;  3NNQ A; 
#chains in the Genus database with same CATH homology
 3FSP A;  3KNT A;  4B22 A;  1PVS A;  4HSB A;  4E9G A;  4YPH A;  2YG9 A;  1PU7 A;  1P7M A;  1NGN A;  1YQM A;  4OFH A;  2NOE A;  3I0W A;  3OH6 A;  1RRS A;  4EW0 A;  1ORN A;  4YPR A;  1YQK A;  1KO9 A;  3I0X A;  4E9H A;  3FHG A;  2H56 A;  2NOB A;  2OFI A;  3CVS A;  2I5W A;  3CVT A;  4EJZ A;  1KG6 A;  5KN9 A;  4EA5 A;  1LWV A;  1YQL A;  1KG2 A;  3N0U A;  1MUY A;  1KG7 A;  3F0Z A;  1FN7 A;  1LWW A;  4AI5 A;  1KG5 A;  2NOI A;  3IH7 A;  2NOZ A;  4AIA A;  4OFE A;  2JG6 A;  4EJY A;  4EW4 A;  4DK9 A;  1HU0 A;  2OFK A;  1WEF A;  3OGD A;  4B23 A;  1WEI A;  3OH9 A;  1N39 A;  1EBM A;  3G0Q A;  4EVV A;  1YQR A;  1ORP A;  1NKU A;  1XG7 A;  3FHF A;  4E9E A;  4PII A;  1XQO A;  3CWS A;  1MUD A;  1MUN A;  1LMZ A;  1MPG A;  4B24 A;  2NOH A;  1M3Q A;  3F10 A;  5KN8 A;  2JHJ A;  4UNF A;  4UOB A;  1PU8 A;  4YOQ A;  2XHI A;  1XQP A;  2ABK A;  1PU6 A;  4E9F A;  5DPK A;  4EA4 A;  1KG4 A;  4B21 A;  1KEA A;  5AN4 A;  2NOL A;  4AI4 A;  1KQJ A;  3IHO A;  1WEG A;  1DIZ A;  1P59 A;  3KTU A;  1KG3 A;  4OFA A;  1VRL A;  1RRQ A;  3D4V A;  3S6I A;  3CW7 A;  3CWU A;  5CHZ A;  1N3A A;  1M3H A;  1LWY A;  3CWA A;  3CWT A;  2JHN A;  2NOF A;  2YG8 A;  3N5N X;  1N3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...